1KNMA

Streptomyces lividans xylan binding domain cbm13 in complex with lactose
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
129
structure length
129
Chain Sequence
b'PPADGGQIKGVGSGRCLDVPDASTSDGTQLQLWDCHSGTNQQWAATDAGELRVYGDKCLDAAGTSNGSKVQIYSCWGGDNQKWRLNSDGSVVGVQSGLCLDAVGNGTANGTLIQLYTCSNGSNQRWTRT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENDO-1,4-BETA-XYLANASE A
publication title High-resolution crystal structures of the lectin-like xylan binding domain from Streptomyces lividans xylanase 10A with bound substrates reveal a novel mode of xylan binding.
pubmed doi rcsb
source organism Streptomyces lividans
molecule tags Hydrolase
total genus 41
structure length 129
sequence length 129
ec nomenclature ec 3.2.1.8: Endo-1,4-beta-xylanase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1knmA00
4Q91A 1OQLB 1NUNA 1PUUB 1PC8B 3T8SA 1Q04A 1ILR1 1XHBA 3FFZA 3FUOA 1W3GA 1W3AA 4ZLBB 2NTDA 1S0LA 1TFMB 2D20A 3HALA 1JT7A 5D62A 2YUGA 2KH2A 2Q9XA 3UJ0A 5F8YA 1AF9A 1EYLA 3FGMA 4JQ0A 1II4A 1QXMA 3PG0A 3RMXA 5B2HA 2VSAA 31BIA 3P6JA 1AFCA 4GAFA 3OJMA 3BAUA 1YYNA 1YF8B 5EHAA 5FZYA 3BRDA 5G00A 1G9CA 1ITBA 2RQ9A 3LLPA 3FJCA 8I1BA 1BFGA 4OWJA 1JQZA 1G9AA 2UUSA 3R4SA 2FGFA 2NM1A 1IRAX 2Y9FA 3N0KA 1JT4A 3PMEA 4ENDA 5E24E 2D23A 2QN4A 1IRPA 1FN0A 1XZZA 1HWPB 1D0HA 2FFVA 2NVHA 4I37A 1RG8A 2IWTB 4LO3C 1BFCA 1S0BA 2L5XA 1HWOB 3VEQA 4I4SA 2F2FC 4I7IA 1I1BA 4Q9GA 1HCEA 2VXTI 3AKIA 3FJBA 4HJJA 3AH2A 4A7ZA 1Z2VA 3CA6A 3VT1A 3N7MA 3A23A 2E4MC 2D7IA 2D22A 4GP3A 2NYYA 3NBNA 3HSMA 4I4QA 3AZWA 3KMVA 4GOYA 2Z48A 5HPZA 3UD8A 2HWAA 3VSZA 3BAGA 2VU9A 3K1XA 4YOLA 3CRIA 2ET2A 4X37A 4L4HA 2K4AB 2AXMA 2GO2A 2Z49A 2D44A 2Y9GA 1CE7B 3EF2A 3BAHA 4D0TA 4USOA 4QKRA 4F34A 4KEKA 4A7YA 2ESUA 3UDAA 1YTOA 4LO7B 1BARA 1VCLA 2D24A 3BAQA 3O49A 3V79C 4IY9A 1HKNA 4H04A 1TIEA 1TTUA 3N7LA 1DFQA 1AXMA 3N7KA 1IJTA 2R9KB 4ZFUB 1EPWA 5BQUC 4QC4A 1AVAC 3LTQA 3POKA 3I2XA 2BEAA 2VUAA 1BFFA 3FJJA 3O4DA 3OGGA 1ISWA 2HWMA 3WO4A 1BFBA 2NZ9A 3IM6A 1M16A 1T4QA 2AQZA 3BADA 1BLAA 3AH1A 3RTIB 1DFCA 4IYBA 3CRGA 1HWMB 5BXSA 4OEEA 5BVPI 3CA4A 4PC4A 4LO1C 4J2XA 3ZX7A 1I1EA 1ONKB 4JKQA 1N4KA 2ZQNA 2KI6B 1JTCA 3IAGC 4QD2B 3I29B 5BOWA 3A22A 1JT5A 2MLLB 3HMYA 3WMVA 1S0DA 1DZDA 4JKXB 1J0SA 4ZBVB 2MIBA 4A7KA 2VSEA 4J23B 4QBCA 1IT0A 3QYDA 3ZC8A 1WD4A 3WINC 1PUMB 3VUOA 4LO3A 1K5VA 2WBCA 4X39A 3AZVA 3UD7A 5EC5A 5FZUA 4QO3A 2P39A 4R6UB 3CA3A 4EKXB 1AVUA 4IQPA 1ISVA 3ZXDA 2NP0A 5D61A 3AJ5A 3B9UA 1SZ6B 1W3FA 3WO3A 2FDBM 5FNWA 2K43A 4KBBA 4I6IA 1RY7A 4I4VA 1IILA 3AH4A 3S8JA 1V6XA 3BRFA 1HCDA 4JAWA 5I1BA 3FJ8A 3BA5A 3RSJA 4Z9WB 4IZXA 3O5WB 1JT3A 4L4IA 3OGFA 3IM7A 2RSTA 4Z8SB 3BA4A 3VSFA 2DREA 4OWLA 5BXTA 4XKIA 1BASA 3VWCA 4GP0A 4LO2A 4Q9PA 4X38A 2ZR1B 1QQKA 4CJMA 1TWEA 4G6MA 4QBVA 3A21A 3C9ZA 1JLXA 3OJ2A 4GAIA 5BP5C 2ZQOA 2ERMA 3O3QA 1FMZA 3O4BA 2M49A 4I4XA 9ILBA 4J2YA 3FJKA 1Q1UA 2DS0A 4I1BA 1R8OA 1G82A 1Z4SA 5BXRA 2VLCA 4OWKA 1EVTA 3FUQA 41BIA 5DVHA 1MC9A 4I4RA 1UPSA 4TLPA 3O4AA 1JLYA 3JRRA 4I2SA 4XFSA 3CA1A 3FJHA 3FJAA 3ILAA 3Q7WA 3I2AA 3HOMA 1XG6A 4FGFA 1SR4A 4OUJA 3IM5A 4J2SA 2BEBA 5DZUA 1DQOA 2DRYA 2AAIB 3AKHA 4ISQA 3AKFA 2F8XC 4LO1A 4P0JA 4II0A 1TWMA 1WBAA 3NBCA 1DJSB 3N7JA 3P6IA 3ZC9A 2VXRA 5JMCA 1FWUA 1S0EA 3OBRA 4I4OA 4ZKTB 4KC3A 3PUBA 4ZGRB 3JUTA 1M2TB 3FJEA 4KEJA 1R8NA 4I3NA 4P0LA 3RMYA 1FWVA 1PZZA 5EG6C 4I1EA 2I1BA 3CRHA 3UD9A 3WINA 3PHZA 21BIA 2RG9B 4JP0A 4DENA 4P6AA 3S8KA 3A07A 3FJ9A 2LIEA 1FV3A 1EV2A 1V6UA 2AFGA 1CVSA 1ISXA 3WMUA 1FQ9A 4XFUA 5D63A 4I4UA 4LO0C 1FMMS 1S0CA 5F90A 3H6QA 4JPZA 4F83A 1PWAA 1MD6A 1DLLA 2Y9WC 3OJVA 2HW9A 4LO7C 4EFPA 3NBDA 4I0YA 3AKGA 3CQAA 1DQGA 1WD3A 1DIWA 3IIRA 4D0ZA 2F2FA 4G6JA 4FVVA 4ZFYB 3V0AB 2MC2A 4J2KA 3V0AA 1HIBA 2D7RA 3WO2A 1BA7A 1YBIA 3BTAA 3Q7XA 3FJIA 1TOOA 4ZOTA 5DUYA 3FJFA 2E4MA 3HN1A 3NBEA 3P53A 5BP5A 4WBCA 5JLVA 3MPPG 2K8RA 3MALA 2FO1A 4QKSA 3VT0A 1RMLA 2FFUA 2Q3NB 3ZXGA 3BA7A 3CU1B 4DCKC 2KKIA 4XFTA 3RTJB 2BFHA 1NZKA 1DZCA 1QQLA 7I1BA 3F62B 4QD2C 1Q03A 1AVWB 1L2HA 3FJDA 1KNMA 1ABRB 3CA5A 4LO8B 1IHKA 4I8MA 4JRAA 1ISYA 1GGPB 1G9DA 4AN6A 3D7WB 4EB2B 1S0GA 1IOBA 2GZBA 4IY8A 5BQUA 2DRZA 2QYIB 5GAQA 1A8DA 1RZOB 4IHZA 4I96A 4IZEA 4G9NA 3NJ5A 4I4PA 4DEPA 1V6WA 1WBCA 1BLDA 5FNXA 3O4OA 5FZZA 3BAVA 1YXWA 4H9WA 1P63A 3CAHA 4GOVA 3SNVA 3BRGC 3H6RB 5F8SA 1E0OA 3O44A 3O4CA 3R4UA 4HR6C 4EEEB 3H6RA 4EFRA 4USPA 4ZA3B 3BAOA 3F1RA 3QR5A 1S0FA 4ISRA 3UJ4A 2D1ZA 4OEGA 4P0KA 2X2SA 5BXPA 1ISZA 4G1RA 2IHOA 4LO0A 6I1BA 3H6SE 3AJ6A 4OW4A 4LO2C 2KI4A 1XYFA 5F8WA 1G9BA 3BB2A 4D8HA 4G9MA 4KEIA 1V6VA 3BX1C 3V0BB 4I4YA 5DSSB 3V0BA 1F31A 3E8LC 1FGAA 3OBTA 1K5UA 3Q7YA 2HZ9A 4AN7B 3VT2A 1AVXB 3HBWA 1T9FA 3TC2A 1TP0A 3WA1A 1JY0A 4HA2A 2WRYA 2D43A 1Z0HA 2P23A 2KLLA 4EFQA 4OEFA 4QALA 3W9TA 1HWNB 2Y9XE 1FV2A 2XOAA 4ZFWB 2X2TA 4IONA 4X3AA 1SR4C 3CA0A 2J3PA 2LIQA
chains in the Genus database with same CATH superfamily
4Q91A 1OQLB 1NUNA 1PUUB 1PC8B 3T8SA 1Q04A 1ILR1 1XHBA 3FFZA 3FUOA 1W3GA 1W3AA 4ZLBB 2NTDA 1S0LA 1TFMB 2D20A 3HALA 1JT7A 5D62A 2YUGA 2KH2A 2Q9XA 3UJ0A 5F8YA 1AF9A 1EYLA 3FGMA 4JQ0A 1II4A 1QXMA 3PG0A 3RMXA 5B2HA 2VSAA 31BIA 3P6JA 1AFCA 4GAFA 3OJMA 3BAUA 1YYNA 1YF8B 5EHAA 5FZYA 3BRDA 5G00A 1G9CA 1ITBA 2RQ9A 3LLPA 3FJCA 8I1BA 1BFGA 4OWJA 1JQZA 1G9AA 2UUSA 3R4SA 2FGFA 2NM1A 1IRAX 2Y9FA 3N0KA 1JT4A 3PMEA 4ENDA 5E24E 2D23A 2QN4A 1IRPA 1FN0A 1XZZA 1HWPB 1D0HA 2FFVA 2NVHA 4I37A 1RG8A 2IWTB 4LO3C 1BFCA 1S0BA 2L5XA 1HWOB 3VEQA 4I4SA 2F2FC 4I7IA 1I1BA 4UY4A 4Q9GA 1HCEA 2VXTI 3AKIA 3FJBA 4HJJA 3AH2A 4A7ZA 1Z2VA 3CA6A 3VT1A 3N7MA 3A23A 2E4MC 2D7IA 2D22A 4GP3A 2NYYA 3NBNA 3HSMA 4I4QA 3AZWA 3KMVA 4GOYA 2Z48A 5HPZA 3UD8A 2HWAA 3VSZA 3BAGA 2VU9A 3K1XA 4YOLA 3CRIA 2ET2A 4X37A 4L4HA 2K4AB 2AXMA 2GO2A 2Z49A 2D44A 2Y9GA 1CE7B 3EF2A 3BAHA 4D0TA 4USOA 4QKRA 4F34A 4KEKA 4A7YA 2ESUA 3UDAA 1YTOA 4LO7B 1BARA 1VCLA 2D24A 3BAQA 3O49A 3V79C 4IY9A 1HKNA 4H04A 1TIEA 1TTUA 3N7LA 1DFQA 1AXMA 3N7KA 1IJTA 2R9KB 4ZFUB 1EPWA 5BQUC 4QC4A 1AVAC 3LTQA 3POKA 3I2XA 2BEAA 2VUAA 1BFFA 3FJJA 3O4DA 3OGGA 1ISWA 2HWMA 3WO4A 1BFBA 2NZ9A 3IM6A 1M16A 1T4QA 4MZHA 2AQZA 3BADA 1BLAA 3AH1A 3RTIB 1DFCA 4IYBA 3CRGA 1HWMB 5BXSA 4OEEA 5BVPI 3CA4A 4PC4A 4LO1C 4J2XA 3ZX7A 1I1EA 1ONKB 4JKQA 1N4KA 2ZQNA 2KI6B 1JTCA 3IAGC 4QD2B 3I29B 5BOWA 3A22A 1JT5A 2MLLB 3HMYA 3WMVA 1S0DA 1DZDA 4JKXB 1J0SA 4ZBVB 2MIBA 4A7KA 2VSEA 4J23B 4QBCA 1IT0A 3QYDA 3ZC8A 1WD4A 3WINC 1PUMB 3VUOA 4LO3A 1K5VA 2WBCA 4X39A 3AZVA 3UD7A 5EC5A 5FZUA 4QO3A 2P39A 4R6UB 3CA3A 4EKXB 1AVUA 4IQPA 1ISVA 3ZXDA 2NP0A 5D61A 3AJ5A 3B9UA 1SZ6B 1W3FA 3WO3A 2FDBM 5FNWA 2K43A 4KBBA 4I6IA 1RY7A 4I4VA 1IILA 3AH4A 3S8JA 1V6XA 3BRFA 1HCDA 4JAWA 5I1BA 3FJ8A 3BA5A 3RSJA 4Z9WB 4IZXA 3O5WB 1JT3A 4L4IA 3OGFA 3IM7A 2RSTA 4Z8SB 3BA4A 3VSFA 2DREA 4OWLA 5BXTA 4XKIA 1BASA 3VWCA 4GP0A 4LO2A 4Q9PA 4X38A 2ZR1B 1QQKA 4CJMA 1TWEA 4G6MA 4QBVA 3A21A 3C9ZA 1JLXA 3OJ2A 4GAIA 5BP5C 2ZQOA 2ERMA 3O3QA 1FMZA 3O4BA 2M49A 4I4XA 9ILBA 4J2YA 3FJKA 2NS2A 1Q1UA 2DS0A 4I1BA 4MZFB 1R8OA 1G82A 1Z4SA 5BXRA 2VLCA 4OWKA 1EVTA 3FUQA 41BIA 5DVHA 1MC9A 4I4RA 1UPSA 4TLPA 3O4AA 1JLYA 3JRRA 4I2SA 4XFSA 3CA1A 3FJHA 3FJAA 3ILAA 3Q7WA 3I2AA 3HOMA 1XG6A 4FGFA 1SR4A 4OUJA 3IM5A 4J2SA 2BEBA 5DZUA 1DQOA 2DRYA 2AAIB 3AKHA 4ISQA 3AKFA 2F8XC 4LO1A 4P0JA 4II0A 1TWMA 1WBAA 3NBCA 1DJSB 3N7JA 3P6IA 3ZC9A 2VXRA 5JMCA 1FWUA 1S0EA 3OBRA 4I4OA 4ZKTB 4KC3A 3PUBA 4ZGRB 3JUTA 1M2TB 3FJEA 4KEJA 1R8NA 4I3NA 4P0LA 3RMYA 1FWVA 1PZZA 5EG6C 4I1EA 2I1BA 3CRHA 3UD9A 3WINA 3PHZA 21BIA 2RG9B 4JP0A 4DENA 4P6AA 3S8KA 3A07A 3FJ9A 2LIEA 1FV3A 1EV2A 1V6UA 2AFGA 1CVSA 1ISXA 3WMUA 1FQ9A 4XFUA 5D63A 4I4UA 4LO0C 1FMMS 1S0CA 5F90A 3H6QA 4JPZA 4F83A 1PWAA 1MD6A 1DLLA 2Y9WC 3OJVA 2HW9A 4LO7C 4EFPA 3NBDA 4I0YA 3AKGA 3CQAA 1DQGA 1WD3A 1DIWA 3IIRA 4D0ZA 2F2FA 4G6JA 4FVVA 4ZFYB 3V0AB 2MC2A 4J2KA 3V0AA 1HIBA 2D7RA 3WO2A 1BA7A 1YBIA 3BTAA 3Q7XA 3FJIA 1TOOA 4ZOTA 5DUYA 3FJFA 2E4MA 3HN1A 3NBEA 3P53A 5BP5A 4WBCA 5JLVA 3MPPG 2K8RA 3MALA 2FO1A 4QKSA 3VT0A 1RMLA 2FFUA 2Q3NB 3ZXGA 3BA7A 3CU1B 4DCKC 2KKIA 4XFTA 3RTJB 2BFHA 1NZKA 1DZCA 1QQLA 4H75A 7I1BA 3F62B 4QD2C 1Q03A 1AVWB 1L2HA 3FJDA 1KNMA 1ABRB 3CA5A 4LO8B 1IHKA 4I8MA 4JRAA 1ISYA 1GGPB 1G9DA 4AN6A 3D7WB 4EB2B 1S0GA 1IOBA 2GZBA 4IY8A 5BQUA 2DRZA 2QYIB 5GAQA 1A8DA 1RZOB 4IHZA 4I96A 4IZEA 4G9NA 3NJ5A 4I4PA 4DEPA 1V6WA 1WBCA 1BLDA 5FNXA 3O4OA 5FZZA 3BAVA 1YXWA 4H9WA 1P63A 3CAHA 4GOVA 3SNVA 3BRGC 3H6RB 4MZGB 5F8SA 1E0OA 3O44A 3O4CA 3R4UA 4HR6C 4EEEB 3H6RA 4EFRA 4USPA 4ZA3B 3BAOA 3F1RA 3QR5A 1S0FA 4ISRA 3UJ4A 2D1ZA 4OEGA 4P0KA 2X2SA 5BXPA 1ISZA 4G1RA 2IHOA 4LO0A 6I1BA 3H6SE 3AJ6A 4OW4A 4LO2C 2KI4A 1XYFA 5F8WA 1G9BA 3BB2A 4D8HA 4G9MA 4KEIA 1V6VA 3BX1C 3V0BB 4I4YA 5DSSB 3V0BA 1F31A 3E8LC 1FGAA 3OBTA 1K5UA 3Q7YA 2HZ9A 4AN7B 3VT2A 1AVXB 3HBWA 1T9FA 3TC2A 1TP0A 3WA1A 1JY0A 4HA2A 2WRYA 2D43A 1Z0HA 2P23A 2KLLA 4EFQA 4OEFA 4QALA 3W9TA 1HWNB 2Y9XE 1FV2A 2XOAA 4ZFWB 2X2TA 4IONA 4X3AA 1SR4C 3CA0A 2J3PA 2LIQA
chains in the Genus database with same CATH topology
4Q91A 1OQLB 1NUNA 1PUUB 1PC8B 3T8SA 1Q04A 1ILR1 1XHBA 3FFZA 3FUOA 1W3GA 1W3AA 4ZLBB 2NTDA 1S0LA 1TFMB 2D20A 3HALA 1JT7A 5D62A 2YUGA 2KH2A 2Q9XA 3UJ0A 5F8YA 1AF9A 1EYLA 3FGMA 4JQ0A 1II4A 1QXMA 3PG0A 3RMXA 5B2HA 2VSAA 31BIA 3P6JA 1AFCA 4GAFA 3OJMA 3BAUA 1YYNA 1YF8B 5EHAA 5FZYA 3BRDA 5G00A 1G9CA 1ITBA 2RQ9A 3LLPA 3FJCA 8I1BA 1BFGA 4OWJA 1JQZA 1G9AA 2UUSA 3R4SA 2FGFA 2NM1A 1IRAX 2Y9FA 3N0KA 1JT4A 3PMEA 4ENDA 5E24E 2D23A 2QN4A 1IRPA 1FN0A 1XZZA 1HWPB 1D0HA 2FFVA 2NVHA 4I37A 1RG8A 2IWTB 4LO3C 1BFCA 1S0BA 2L5XA 1HWOB 3VEQA 4I4SA 2F2FC 4I7IA 1I1BA 4UY4A 4Q9GA 1HCEA 2VXTI 3AKIA 3FJBA 4HJJA 3AH2A 4A7ZA 1Z2VA 3CA6A 3VT1A 3N7MA 3A23A 2E4MC 2D7IA 2D22A 4GP3A 2NYYA 3NBNA 3HSMA 4I4QA 3AZWA 3KMVA 4GOYA 2Z48A 5HPZA 3UD8A 2HWAA 3VSZA 3BAGA 2VU9A 3K1XA 4YOLA 3CRIA 2ET2A 4X37A 4L4HA 2K4AB 2AXMA 2GO2A 2Z49A 2D44A 2Y9GA 1CE7B 3EF2A 3BAHA 4D0TA 4USOA 4QKRA 4F34A 4KEKA 4A7YA 2ESUA 3UDAA 1YTOA 4LO7B 1BARA 1VCLA 2D24A 3BAQA 3O49A 3V79C 4IY9A 1HKNA 4H04A 1TIEA 1TTUA 3N7LA 1DFQA 1AXMA 3N7KA 1IJTA 2R9KB 4ZFUB 1EPWA 5BQUC 4QC4A 1AVAC 3LTQA 3POKA 3I2XA 2BEAA 2VUAA 1BFFA 3FJJA 3O4DA 3OGGA 1ISWA 2HWMA 3WO4A 1BFBA 2NZ9A 3IM6A 1M16A 1T4QA 4MZHA 2AQZA 3BADA 1BLAA 3AH1A 3RTIB 1DFCA 4IYBA 3CRGA 1HWMB 5BXSA 4OEEA 5BVPI 3CA4A 4PC4A 4LO1C 4J2XA 3ZX7A 1I1EA 1ONKB 4JKQA 1N4KA 2ZQNA 2KI6B 1JTCA 3IAGC 4QD2B 3I29B 5BOWA 3A22A 1JT5A 2MLLB 3HMYA 3WMVA 1S0DA 1DZDA 4JKXB 1J0SA 4ZBVB 2MIBA 4A7KA 2VSEA 4J23B 4QBCA 1IT0A 3QYDA 3ZC8A 1WD4A 3WINC 1PUMB 3VUOA 4LO3A 1K5VA 2WBCA 4X39A 3AZVA 3UD7A 5EC5A 5FZUA 4QO3A 2P39A 4R6UB 3CA3A 4EKXB 1AVUA 4IQPA 1ISVA 3ZXDA 2NP0A 5D61A 3AJ5A 3B9UA 1SZ6B 1W3FA 3WO3A 2FDBM 5FNWA 2K43A 4KBBA 4I6IA 1RY7A 4I4VA 1IILA 3AH4A 3S8JA 1V6XA 3BRFA 1HCDA 4JAWA 5I1BA 3FJ8A 3BA5A 3RSJA 4Z9WB 4IZXA 3O5WB 1JT3A 4L4IA 3OGFA 3IM7A 2RSTA 4Z8SB 3BA4A 3VSFA 2DREA 4OWLA 5BXTA 4XKIA 1BASA 3VWCA 4GP0A 4LO2A 4Q9PA 4X38A 2ZR1B 1QQKA 4CJMA 1TWEA 4G6MA 4QBVA 3A21A 3C9ZA 1JLXA 3OJ2A 4GAIA 5BP5C 2ZQOA 2ERMA 3O3QA 1FMZA 3O4BA 2M49A 4I4XA 9ILBA 4J2YA 3FJKA 2NS2A 1Q1UA 2DS0A 4I1BA 4MZFB 1R8OA 1G82A 1Z4SA 5BXRA 2VLCA 4OWKA 1EVTA 3FUQA 41BIA 5DVHA 1MC9A 4I4RA 1UPSA 4TLPA 3O4AA 1JLYA 3JRRA 4I2SA 4XFSA 3CA1A 3FJHA 3FJAA 3ILAA 3Q7WA 3I2AA 3HOMA 1XG6A 4FGFA 1SR4A 4OUJA 3IM5A 4J2SA 2BEBA 5DZUA 1DQOA 2DRYA 2AAIB 3AKHA 4ISQA 3AKFA 2F8XC 4LO1A 4P0JA 4II0A 1TWMA 1WBAA 3NBCA 1DJSB 3N7JA 3P6IA 3ZC9A 2VXRA 5JMCA 1FWUA 1S0EA 3OBRA 4I4OA 4ZKTB 4KC3A 3PUBA 4ZGRB 3JUTA 1M2TB 3FJEA 4KEJA 1R8NA 4I3NA 4P0LA 3RMYA 1FWVA 1PZZA 5EG6C 4I1EA 2I1BA 3CRHA 3UD9A 3WINA 3PHZA 21BIA 2RG9B 4JP0A 4DENA 4P6AA 3S8KA 3A07A 3FJ9A 2LIEA 1FV3A 1EV2A 1V6UA 2AFGA 1CVSA 1ISXA 3WMUA 1FQ9A 4XFUA 5D63A 4I4UA 4LO0C 1FMMS 1S0CA 5F90A 3H6QA 4JPZA 4F83A 1PWAA 1MD6A 1DLLA 2Y9WC 3OJVA 2HW9A 4LO7C 4EFPA 3NBDA 4I0YA 3AKGA 3CQAA 1DQGA 1WD3A 1DIWA 3IIRA 4D0ZA 2F2FA 4G6JA 4FVVA 4ZFYB 3V0AB 2MC2A 4J2KA 3V0AA 1HIBA 2D7RA 3WO2A 1BA7A 1YBIA 3BTAA 3Q7XA 3FJIA 1TOOA 4ZOTA 5DUYA 3FJFA 2E4MA 3HN1A 3NBEA 3P53A 5BP5A 4WBCA 5JLVA 3MPPG 2K8RA 3MALA 2FO1A 4QKSA 3VT0A 1RMLA 2FFUA 2Q3NB 3ZXGA 3BA7A 3CU1B 4DCKC 2KKIA 4XFTA 3RTJB 2BFHA 1NZKA 1DZCA 1QQLA 4H75A 7I1BA 3F62B 4QD2C 1Q03A 1AVWB 1L2HA 3FJDA 1KNMA 1ABRB 3CA5A 4LO8B 1IHKA 4I8MA 4JRAA 1ISYA 1GGPB 1G9DA 4AN6A 3D7WB 4EB2B 1S0GA 1IOBA 2GZBA 4IY8A 5BQUA 2DRZA 2QYIB 5GAQA 1A8DA 1RZOB 4IHZA 4I96A 4IZEA 4G9NA 3NJ5A 4I4PA 4DEPA 1V6WA 1WBCA 1BLDA 5FNXA 3O4OA 5FZZA 3BAVA 1YXWA 4H9WA 1P63A 3CAHA 4GOVA 3SNVA 3BRGC 3H6RB 4MZGB 5F8SA 1E0OA 3O44A 3O4CA 3R4UA 4HR6C 4EEEB 3H6RA 4EFRA 4USPA 4ZA3B 3BAOA 3F1RA 3QR5A 1S0FA 4ISRA 3UJ4A 2D1ZA 4OEGA 4P0KA 2X2SA 5BXPA 1ISZA 4G1RA 2IHOA 4LO0A 6I1BA 3H6SE 3AJ6A 4OW4A 4LO2C 2KI4A 1XYFA 5F8WA 1G9BA 3BB2A 4D8HA 4G9MA 4KEIA 1V6VA 3BX1C 3V0BB 4I4YA 5DSSB 3V0BA 1F31A 3E8LC 1FGAA 3OBTA 1K5UA 3Q7YA 2HZ9A 4AN7B 3VT2A 1AVXB 3HBWA 1T9FA 3TC2A 1TP0A 3WA1A 1JY0A 4HA2A 2WRYA 2D43A 1Z0HA 2P23A 2KLLA 4EFQA 4OEFA 4QALA 3W9TA 1HWNB 2Y9XE 1FV2A 2XOAA 4ZFWB 2X2TA 4IONA 4X3AA 1SR4C 3CA0A 2J3PA 2LIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Q91 A;  1OQL B;  1NUN A;  1PUU B;  1PC8 B;  3T8S A;  1Q04 A;  1ILR 1;  1XHB A;  3FFZ A;  3FUO A;  1W3G A;  1W3A A;  4ZLB B;  2NTD A;  1S0L A;  1TFM B;  2D20 A;  3HAL A;  1JT7 A;  5D62 A;  2YUG A;  2KH2 A;  2Q9X A;  3UJ0 A;  5F8Y A;  1AF9 A;  1EYL A;  3FGM A;  4JQ0 A;  1II4 A;  1QXM A;  3PG0 A;  3RMX A;  5B2H A;  2VSA A;  31BI A;  3P6J A;  1AFC A;  4GAF A;  3OJM A;  3BAU A;  1YYN A;  1YF8 B;  5EHA A;  5FZY A;  3BRD A;  5G00 A;  1G9C A;  1ITB A;  2RQ9 A;  3LLP A;  3FJC A;  8I1B A;  1BFG A;  4OWJ A;  1JQZ A;  1G9A A;  2UUS A;  3R4S A;  2FGF A;  2NM1 A;  1IRA X;  2Y9F A;  3N0K A;  1JT4 A;  3PME A;  4END A;  5E24 E;  2D23 A;  2QN4 A;  1IRP A;  1FN0 A;  1XZZ A;  1HWP B;  1D0H A;  2FFV A;  2NVH A;  4I37 A;  1RG8 A;  2IWT B;  4LO3 C;  1BFC A;  1S0B A;  2L5X A;  1HWO B;  3VEQ A;  4I4S A;  2F2F C;  4I7I A;  1I1B A;  4Q9G A;  1HCE A;  2VXT I;  3AKI A;  3FJB A;  4HJJ A;  3AH2 A;  4A7Z A;  1Z2V A;  3CA6 A;  3VT1 A;  3N7M A;  3A23 A;  2E4M C;  2D7I A;  2D22 A;  4GP3 A;  2NYY A;  3NBN A;  3HSM A;  4I4Q A;  3AZW A;  3KMV A;  4GOY A;  2Z48 A;  5HPZ A;  3UD8 A;  2HWA A;  3VSZ A;  3BAG A;  2VU9 A;  3K1X A;  4YOL A;  3CRI A;  2ET2 A;  4X37 A;  4L4H A;  2K4A B;  2AXM A;  2GO2 A;  2Z49 A;  2D44 A;  2Y9G A;  1CE7 B;  3EF2 A;  3BAH A;  4D0T A;  4USO A;  4QKR A;  4F34 A;  4KEK A;  4A7Y A;  2ESU A;  3UDA A;  1YTO A;  4LO7 B;  1BAR A;  1VCL A;  2D24 A;  3BAQ A;  3O49 A;  3V79 C;  4IY9 A;  1HKN A;  4H04 A;  1TIE A;  1TTU A;  3N7L A;  1DFQ A;  1AXM A;  3N7K A;  1IJT A;  2R9K B;  4ZFU B;  1EPW A;  5BQU C;  4QC4 A;  1AVA C;  3LTQ A;  3POK A;  3I2X A;  2BEA A;  2VUA A;  1BFF A;  3FJJ A;  3O4D A;  3OGG A;  1ISW A;  2HWM A;  3WO4 A;  1BFB A;  2NZ9 A;  3IM6 A;  1M16 A;  1T4Q A;  2AQZ A;  3BAD A;  1BLA A;  3AH1 A;  3RTI B;  1DFC A;  4IYB A;  3CRG A;  1HWM B;  5BXS A;  4OEE A;  5BVP I;  3CA4 A;  4PC4 A;  4LO1 C;  4J2X A;  3ZX7 A;  1I1E A;  1ONK B;  4JKQ A;  1N4K A;  2ZQN A;  2KI6 B;  1JTC A;  3IAG C;  4QD2 B;  3I29 B;  5BOW A;  3A22 A;  1JT5 A;  2MLL B;  3HMY A;  3WMV A;  1S0D A;  1DZD A;  4JKX B;  1J0S A;  4ZBV B;  2MIB A;  4A7K A;  2VSE A;  4J23 B;  4QBC A;  1IT0 A;  3QYD A;  3ZC8 A;  1WD4 A;  3WIN C;  1PUM B;  3VUO A;  4LO3 A;  1K5V A;  2WBC A;  4X39 A;  3AZV A;  3UD7 A;  5EC5 A;  5FZU A;  4QO3 A;  2P39 A;  4R6U B;  3CA3 A;  4EKX B;  1AVU A;  4IQP A;  1ISV A;  3ZXD A;  2NP0 A;  5D61 A;  3AJ5 A;  3B9U A;  1SZ6 B;  1W3F A;  3WO3 A;  2FDB M;  5FNW A;  2K43 A;  4KBB A;  4I6I A;  1RY7 A;  4I4V A;  1IIL A;  3AH4 A;  3S8J A;  1V6X A;  3BRF A;  1HCD A;  4JAW A;  5I1B A;  3FJ8 A;  3BA5 A;  3RSJ A;  4Z9W B;  4IZX A;  3O5W B;  1JT3 A;  4L4I A;  3OGF A;  3IM7 A;  2RST A;  4Z8S B;  3BA4 A;  3VSF A;  2DRE A;  4OWL A;  5BXT A;  4XKI A;  1BAS A;  3VWC A;  4GP0 A;  4LO2 A;  4Q9P A;  4X38 A;  2ZR1 B;  1QQK A;  4CJM A;  1TWE A;  4G6M A;  4QBV A;  3A21 A;  3C9Z A;  1JLX A;  3OJ2 A;  4GAI A;  5BP5 C;  2ZQO A;  2ERM A;  3O3Q A;  1FMZ A;  3O4B A;  2M49 A;  4I4X A;  9ILB A;  4J2Y A;  3FJK A;  1Q1U A;  2DS0 A;  4I1B A;  1R8O A;  1G82 A;  1Z4S A;  5BXR A;  2VLC A;  4OWK A;  1EVT A;  3FUQ A;  41BI A;  5DVH A;  1MC9 A;  4I4R A;  1UPS A;  4TLP A;  3O4A A;  1JLY A;  3JRR A;  4I2S A;  4XFS A;  3CA1 A;  3FJH A;  3FJA A;  3ILA A;  3Q7W A;  3I2A A;  3HOM A;  1XG6 A;  4FGF A;  1SR4 A;  4OUJ A;  3IM5 A;  4J2S A;  2BEB A;  5DZU A;  1DQO A;  2DRY A;  2AAI B;  3AKH A;  4ISQ A;  3AKF A;  2F8X C;  4LO1 A;  4P0J A;  4II0 A;  1TWM A;  1WBA A;  3NBC A;  1DJS B;  3N7J A;  3P6I A;  3ZC9 A;  2VXR A;  5JMC A;  1FWU A;  1S0E A;  3OBR A;  4I4O A;  4ZKT B;  4KC3 A;  3PUB A;  4ZGR B;  3JUT A;  1M2T B;  3FJE A;  4KEJ A;  1R8N A;  4I3N A;  4P0L A;  3RMY A;  1FWV A;  1PZZ A;  5EG6 C;  4I1E A;  2I1B A;  3CRH A;  3UD9 A;  3WIN A;  3PHZ A;  21BI A;  2RG9 B;  4JP0 A;  4DEN A;  4P6A A;  3S8K A;  3A07 A;  3FJ9 A;  2LIE A;  1FV3 A;  1EV2 A;  1V6U A;  2AFG A;  1CVS A;  1ISX A;  3WMU A;  1FQ9 A;  4XFU A;  5D63 A;  4I4U A;  4LO0 C;  1FMM S;  1S0C A;  5F90 A;  3H6Q A;  4JPZ A;  4F83 A;  1PWA A;  1MD6 A;  1DLL A;  2Y9W C;  3OJV A;  2HW9 A;  4LO7 C;  4EFP A;  3NBD A;  4I0Y A;  3AKG A;  3CQA A;  1DQG A;  1WD3 A;  1DIW A;  3IIR A;  4D0Z A;  2F2F A;  4G6J A;  4FVV A;  4ZFY B;  3V0A B;  2MC2 A;  4J2K A;  3V0A A;  1HIB A;  2D7R A;  3WO2 A;  1BA7 A;  1YBI A;  3BTA A;  3Q7X A;  3FJI A;  1TOO A;  4ZOT A;  5DUY A;  3FJF A;  2E4M A;  3HN1 A;  3NBE A;  3P53 A;  5BP5 A;  4WBC A;  5JLV A;  3MPP G;  2K8R A;  3MAL A;  2FO1 A;  4QKS A;  3VT0 A;  1RML A;  2FFU A;  2Q3N B;  3ZXG A;  3BA7 A;  3CU1 B;  4DCK C;  2KKI A;  4XFT A;  3RTJ B;  2BFH A;  1NZK A;  1DZC A;  1QQL A;  7I1B A;  3F62 B;  4QD2 C;  1Q03 A;  1AVW B;  1L2H A;  3FJD A;  1KNM A;  1ABR B;  3CA5 A;  4LO8 B;  1IHK A;  4I8M A;  4JRA A;  1ISY A;  1GGP B;  1G9D A;  4AN6 A;  3D7W B;  4EB2 B;  1S0G A;  1IOB A;  2GZB A;  4IY8 A;  5BQU A;  2DRZ A;  2QYI B;  5GAQ A;  1A8D A;  1RZO B;  4IHZ A;  4I96 A;  4IZE A;  4G9N A;  3NJ5 A;  4I4P A;  4DEP A;  1V6W A;  1WBC A;  1BLD A;  5FNX A;  3O4O A;  5FZZ A;  3BAV A;  1YXW A;  4H9W A;  1P63 A;  3CAH A;  4GOV A;  3SNV A;  3BRG C;  3H6R B;  5F8S A;  1E0O A;  3O44 A;  3O4C A;  3R4U A;  4HR6 C;  4EEE B;  3H6R A;  4EFR A;  4USP A;  4ZA3 B;  3BAO A;  3F1R A;  3QR5 A;  1S0F A;  4ISR A;  3UJ4 A;  2D1Z A;  4OEG A;  4P0K A;  2X2S A;  5BXP A;  1ISZ A;  4G1R A;  2IHO A;  4LO0 A;  6I1B A;  3H6S E;  3AJ6 A;  4OW4 A;  4LO2 C;  2KI4 A;  1XYF A;  5F8W A;  1G9B A;  3BB2 A;  4D8H A;  4G9M A;  4KEI A;  1V6V A;  3BX1 C;  3V0B B;  4I4Y A;  5DSS B;  3V0B A;  1F31 A;  3E8L C;  1FGA A;  3OBT A;  1K5U A;  3Q7Y A;  2HZ9 A;  4AN7 B;  3VT2 A;  1AVX B;  3HBW A;  1T9F A;  3TC2 A;  1TP0 A;  3WA1 A;  1JY0 A;  4HA2 A;  2WRY A;  2D43 A;  1Z0H A;  2P23 A;  2KLL A;  4EFQ A;  4OEF A;  4QAL A;  3W9T A;  1HWN B;  2Y9X E;  1FV2 A;  2XOA A;  4ZFW B;  2X2T A;  4ION A;  4X3A A;  1SR4 C;  3CA0 A;  2J3P A;  2LIQ A; 
#chains in the Genus database with same CATH topology
 4Q91 A;  1OQL B;  1NUN A;  1PUU B;  1PC8 B;  3T8S A;  1Q04 A;  1ILR 1;  1XHB A;  3FFZ A;  3FUO A;  1W3G A;  1W3A A;  4ZLB B;  2NTD A;  1S0L A;  1TFM B;  2D20 A;  3HAL A;  1JT7 A;  5D62 A;  2YUG A;  2KH2 A;  2Q9X A;  3UJ0 A;  5F8Y A;  1AF9 A;  1EYL A;  3FGM A;  4JQ0 A;  1II4 A;  1QXM A;  3PG0 A;  3RMX A;  5B2H A;  2VSA A;  31BI A;  3P6J A;  1AFC A;  4GAF A;  3OJM A;  3BAU A;  1YYN A;  1YF8 B;  5EHA A;  5FZY A;  3BRD A;  5G00 A;  1G9C A;  1ITB A;  2RQ9 A;  3LLP A;  3FJC A;  8I1B A;  1BFG A;  4OWJ A;  1JQZ A;  1G9A A;  2UUS A;  3R4S A;  2FGF A;  2NM1 A;  1IRA X;  2Y9F A;  3N0K A;  1JT4 A;  3PME A;  4END A;  5E24 E;  2D23 A;  2QN4 A;  1IRP A;  1FN0 A;  1XZZ A;  1HWP B;  1D0H A;  2FFV A;  2NVH A;  4I37 A;  1RG8 A;  2IWT B;  4LO3 C;  1BFC A;  1S0B A;  2L5X A;  1HWO B;  3VEQ A;  4I4S A;  2F2F C;  4I7I A;  1I1B A;  4UY4 A;  4Q9G A;  1HCE A;  2VXT I;  3AKI A;  3FJB A;  4HJJ A;  3AH2 A;  4A7Z A;  1Z2V A;  3CA6 A;  3VT1 A;  3N7M A;  3A23 A;  2E4M C;  2D7I A;  2D22 A;  4GP3 A;  2NYY A;  3NBN A;  3HSM A;  4I4Q A;  3AZW A;  3KMV A;  4GOY A;  2Z48 A;  5HPZ A;  3UD8 A;  2HWA A;  3VSZ A;  3BAG A;  2VU9 A;  3K1X A;  4YOL A;  3CRI A;  2ET2 A;  4X37 A;  4L4H A;  2K4A B;  2AXM A;  2GO2 A;  2Z49 A;  2D44 A;  2Y9G A;  1CE7 B;  3EF2 A;  3BAH A;  4D0T A;  4USO A;  4QKR A;  4F34 A;  4KEK A;  4A7Y A;  2ESU A;  3UDA A;  1YTO A;  4LO7 B;  1BAR A;  1VCL A;  2D24 A;  3BAQ A;  3O49 A;  3V79 C;  4IY9 A;  1HKN A;  4H04 A;  1TIE A;  1TTU A;  3N7L A;  1DFQ A;  1AXM A;  3N7K A;  1IJT A;  2R9K B;  4ZFU B;  1EPW A;  5BQU C;  4QC4 A;  1AVA C;  3LTQ A;  3POK A;  3I2X A;  2BEA A;  2VUA A;  1BFF A;  3FJJ A;  3O4D A;  3OGG A;  1ISW A;  2HWM A;  3WO4 A;  1BFB A;  2NZ9 A;  3IM6 A;  1M16 A;  1T4Q A;  4MZH A;  2AQZ A;  3BAD A;  1BLA A;  3AH1 A;  3RTI B;  1DFC A;  4IYB A;  3CRG A;  1HWM B;  5BXS A;  4OEE A;  5BVP I;  3CA4 A;  4PC4 A;  4LO1 C;  4J2X A;  3ZX7 A;  1I1E A;  1ONK B;  4JKQ A;  1N4K A;  2ZQN A;  2KI6 B;  1JTC A;  3IAG C;  4QD2 B;  3I29 B;  5BOW A;  3A22 A;  1JT5 A;  2MLL B;  3HMY A;  3WMV A;  1S0D A;  1DZD A;  4JKX B;  1J0S A;  4ZBV B;  2MIB A;  4A7K A;  2VSE A;  4J23 B;  4QBC A;  1IT0 A;  3QYD A;  3ZC8 A;  1WD4 A;  3WIN C;  1PUM B;  3VUO A;  4LO3 A;  1K5V A;  2WBC A;  4X39 A;  3AZV A;  3UD7 A;  5EC5 A;  5FZU A;  4QO3 A;  2P39 A;  4R6U B;  3CA3 A;  4EKX B;  1AVU A;  4IQP A;  1ISV A;  3ZXD A;  2NP0 A;  5D61 A;  3AJ5 A;  3B9U A;  1SZ6 B;  1W3F A;  3WO3 A;  2FDB M;  5FNW A;  2K43 A;  4KBB A;  4I6I A;  1RY7 A;  4I4V A;  1IIL A;  3AH4 A;  3S8J A;  1V6X A;  3BRF A;  1HCD A;  4JAW A;  5I1B A;  3FJ8 A;  3BA5 A;  3RSJ A;  4Z9W B;  4IZX A;  3O5W B;  1JT3 A;  4L4I A;  3OGF A;  3IM7 A;  2RST A;  4Z8S B;  3BA4 A;  3VSF A;  2DRE A;  4OWL A;  5BXT A;  4XKI A;  1BAS A;  3VWC A;  4GP0 A;  4LO2 A;  4Q9P A;  4X38 A;  2ZR1 B;  1QQK A;  4CJM A;  1TWE A;  4G6M A;  4QBV A;  3A21 A;  3C9Z A;  1JLX A;  3OJ2 A;  4GAI A;  5BP5 C;  2ZQO A;  2ERM A;  3O3Q A;  1FMZ A;  3O4B A;  2M49 A;  4I4X A;  9ILB A;  4J2Y A;  3FJK A;  2NS2 A;  1Q1U A;  2DS0 A;  4I1B A;  4MZF B;  1R8O A;  1G82 A;  1Z4S A;  5BXR A;  2VLC A;  4OWK A;  1EVT A;  3FUQ A;  41BI A;  5DVH A;  1MC9 A;  4I4R A;  1UPS A;  4TLP A;  3O4A A;  1JLY A;  3JRR A;  4I2S A;  4XFS A;  3CA1 A;  3FJH A;  3FJA A;  3ILA A;  3Q7W A;  3I2A A;  3HOM A;  1XG6 A;  4FGF A;  1SR4 A;  4OUJ A;  3IM5 A;  4J2S A;  2BEB A;  5DZU A;  1DQO A;  2DRY A;  2AAI B;  3AKH A;  4ISQ A;  3AKF A;  2F8X C;  4LO1 A;  4P0J A;  4II0 A;  1TWM A;  1WBA A;  3NBC A;  1DJS B;  3N7J A;  3P6I A;  3ZC9 A;  2VXR A;  5JMC A;  1FWU A;  1S0E A;  3OBR A;  4I4O A;  4ZKT B;  4KC3 A;  3PUB A;  4ZGR B;  3JUT A;  1M2T B;  3FJE A;  4KEJ A;  1R8N A;  4I3N A;  4P0L A;  3RMY A;  1FWV A;  1PZZ A;  5EG6 C;  4I1E A;  2I1B A;  3CRH A;  3UD9 A;  3WIN A;  3PHZ A;  21BI A;  2RG9 B;  4JP0 A;  4DEN A;  4P6A A;  3S8K A;  3A07 A;  3FJ9 A;  2LIE A;  1FV3 A;  1EV2 A;  1V6U A;  2AFG A;  1CVS A;  1ISX A;  3WMU A;  1FQ9 A;  4XFU A;  5D63 A;  4I4U A;  4LO0 C;  1FMM S;  1S0C A;  5F90 A;  3H6Q A;  4JPZ A;  4F83 A;  1PWA A;  1MD6 A;  1DLL A;  2Y9W C;  3OJV A;  2HW9 A;  4LO7 C;  4EFP A;  3NBD A;  4I0Y A;  3AKG A;  3CQA A;  1DQG A;  1WD3 A;  1DIW A;  3IIR A;  4D0Z A;  2F2F A;  4G6J A;  4FVV A;  4ZFY B;  3V0A B;  2MC2 A;  4J2K A;  3V0A A;  1HIB A;  2D7R A;  3WO2 A;  1BA7 A;  1YBI A;  3BTA A;  3Q7X A;  3FJI A;  1TOO A;  4ZOT A;  5DUY A;  3FJF A;  2E4M A;  3HN1 A;  3NBE A;  3P53 A;  5BP5 A;  4WBC A;  5JLV A;  3MPP G;  2K8R A;  3MAL A;  2FO1 A;  4QKS A;  3VT0 A;  1RML A;  2FFU A;  2Q3N B;  3ZXG A;  3BA7 A;  3CU1 B;  4DCK C;  2KKI A;  4XFT A;  3RTJ B;  2BFH A;  1NZK A;  1DZC A;  1QQL A;  4H75 A;  7I1B A;  3F62 B;  4QD2 C;  1Q03 A;  1AVW B;  1L2H A;  3FJD A;  1KNM A;  1ABR B;  3CA5 A;  4LO8 B;  1IHK A;  4I8M A;  4JRA A;  1ISY A;  1GGP B;  1G9D A;  4AN6 A;  3D7W B;  4EB2 B;  1S0G A;  1IOB A;  2GZB A;  4IY8 A;  5BQU A;  2DRZ A;  2QYI B;  5GAQ A;  1A8D A;  1RZO B;  4IHZ A;  4I96 A;  4IZE A;  4G9N A;  3NJ5 A;  4I4P A;  4DEP A;  1V6W A;  1WBC A;  1BLD A;  5FNX A;  3O4O A;  5FZZ A;  3BAV A;  1YXW A;  4H9W A;  1P63 A;  3CAH A;  4GOV A;  3SNV A;  3BRG C;  3H6R B;  4MZG B;  5F8S A;  1E0O A;  3O44 A;  3O4C A;  3R4U A;  4HR6 C;  4EEE B;  3H6R A;  4EFR A;  4USP A;  4ZA3 B;  3BAO A;  3F1R A;  3QR5 A;  1S0F A;  4ISR A;  3UJ4 A;  2D1Z A;  4OEG A;  4P0K A;  2X2S A;  5BXP A;  1ISZ A;  4G1R A;  2IHO A;  4LO0 A;  6I1B A;  3H6S E;  3AJ6 A;  4OW4 A;  4LO2 C;  2KI4 A;  1XYF A;  5F8W A;  1G9B A;  3BB2 A;  4D8H A;  4G9M A;  4KEI A;  1V6V A;  3BX1 C;  3V0B B;  4I4Y A;  5DSS B;  3V0B A;  1F31 A;  3E8L C;  1FGA A;  3OBT A;  1K5U A;  3Q7Y A;  2HZ9 A;  4AN7 B;  3VT2 A;  1AVX B;  3HBW A;  1T9F A;  3TC2 A;  1TP0 A;  3WA1 A;  1JY0 A;  4HA2 A;  2WRY A;  2D43 A;  1Z0H A;  2P23 A;  2KLL A;  4EFQ A;  4OEF A;  4QAL A;  3W9T A;  1HWN B;  2Y9X E;  1FV2 A;  2XOA A;  4ZFW B;  2X2T A;  4ION A;  4X3A A;  1SR4 C;  3CA0 A;  2J3P A;  2LIQ A; 
#chains in the Genus database with same CATH homology
 4Q91 A;  1OQL B;  1NUN A;  1PUU B;  1PC8 B;  3T8S A;  1Q04 A;  1ILR 1;  1XHB A;  3FFZ A;  3FUO A;  1W3G A;  1W3A A;  4ZLB B;  2NTD A;  1S0L A;  1TFM B;  2D20 A;  3HAL A;  1JT7 A;  5D62 A;  2YUG A;  2KH2 A;  2Q9X A;  3UJ0 A;  5F8Y A;  1AF9 A;  1EYL A;  3FGM A;  4JQ0 A;  1II4 A;  1QXM A;  3PG0 A;  3RMX A;  5B2H A;  2VSA A;  31BI A;  3P6J A;  1AFC A;  4GAF A;  3OJM A;  3BAU A;  1YYN A;  1YF8 B;  5EHA A;  5FZY A;  3BRD A;  5G00 A;  1G9C A;  1ITB A;  2RQ9 A;  3LLP A;  3FJC A;  8I1B A;  1BFG A;  4OWJ A;  1JQZ A;  1G9A A;  2UUS A;  3R4S A;  2FGF A;  2NM1 A;  1IRA X;  2Y9F A;  3N0K A;  1JT4 A;  3PME A;  4END A;  5E24 E;  2D23 A;  2QN4 A;  1IRP A;  1FN0 A;  1XZZ A;  1HWP B;  1D0H A;  2FFV A;  2NVH A;  4I37 A;  1RG8 A;  2IWT B;  4LO3 C;  1BFC A;  1S0B A;  2L5X A;  1HWO B;  3VEQ A;  4I4S A;  2F2F C;  4I7I A;  1I1B A;  4UY4 A;  4Q9G A;  1HCE A;  2VXT I;  3AKI A;  3FJB A;  4HJJ A;  3AH2 A;  4A7Z A;  1Z2V A;  3CA6 A;  3VT1 A;  3N7M A;  3A23 A;  2E4M C;  2D7I A;  2D22 A;  4GP3 A;  2NYY A;  3NBN A;  3HSM A;  4I4Q A;  3AZW A;  3KMV A;  4GOY A;  2Z48 A;  5HPZ A;  3UD8 A;  2HWA A;  3VSZ A;  3BAG A;  2VU9 A;  3K1X A;  4YOL A;  3CRI A;  2ET2 A;  4X37 A;  4L4H A;  2K4A B;  2AXM A;  2GO2 A;  2Z49 A;  2D44 A;  2Y9G A;  1CE7 B;  3EF2 A;  3BAH A;  4D0T A;  4USO A;  4QKR A;  4F34 A;  4KEK A;  4A7Y A;  2ESU A;  3UDA A;  1YTO A;  4LO7 B;  1BAR A;  1VCL A;  2D24 A;  3BAQ A;  3O49 A;  3V79 C;  4IY9 A;  1HKN A;  4H04 A;  1TIE A;  1TTU A;  3N7L A;  1DFQ A;  1AXM A;  3N7K A;  1IJT A;  2R9K B;  4ZFU B;  1EPW A;  5BQU C;  4QC4 A;  1AVA C;  3LTQ A;  3POK A;  3I2X A;  2BEA A;  2VUA A;  1BFF A;  3FJJ A;  3O4D A;  3OGG A;  1ISW A;  2HWM A;  3WO4 A;  1BFB A;  2NZ9 A;  3IM6 A;  1M16 A;  1T4Q A;  4MZH A;  2AQZ A;  3BAD A;  1BLA A;  3AH1 A;  3RTI B;  1DFC A;  4IYB A;  3CRG A;  1HWM B;  5BXS A;  4OEE A;  5BVP I;  3CA4 A;  4PC4 A;  4LO1 C;  4J2X A;  3ZX7 A;  1I1E A;  1ONK B;  4JKQ A;  1N4K A;  2ZQN A;  2KI6 B;  1JTC A;  3IAG C;  4QD2 B;  3I29 B;  5BOW A;  3A22 A;  1JT5 A;  2MLL B;  3HMY A;  3WMV A;  1S0D A;  1DZD A;  4JKX B;  1J0S A;  4ZBV B;  2MIB A;  4A7K A;  2VSE A;  4J23 B;  4QBC A;  1IT0 A;  3QYD A;  3ZC8 A;  1WD4 A;  3WIN C;  1PUM B;  3VUO A;  4LO3 A;  1K5V A;  2WBC A;  4X39 A;  3AZV A;  3UD7 A;  5EC5 A;  5FZU A;  4QO3 A;  2P39 A;  4R6U B;  3CA3 A;  4EKX B;  1AVU A;  4IQP A;  1ISV A;  3ZXD A;  2NP0 A;  5D61 A;  3AJ5 A;  3B9U A;  1SZ6 B;  1W3F A;  3WO3 A;  2FDB M;  5FNW A;  2K43 A;  4KBB A;  4I6I A;  1RY7 A;  4I4V A;  1IIL A;  3AH4 A;  3S8J A;  1V6X A;  3BRF A;  1HCD A;  4JAW A;  5I1B A;  3FJ8 A;  3BA5 A;  3RSJ A;  4Z9W B;  4IZX A;  3O5W B;  1JT3 A;  4L4I A;  3OGF A;  3IM7 A;  2RST A;  4Z8S B;  3BA4 A;  3VSF A;  2DRE A;  4OWL A;  5BXT A;  4XKI A;  1BAS A;  3VWC A;  4GP0 A;  4LO2 A;  4Q9P A;  4X38 A;  2ZR1 B;  1QQK A;  4CJM A;  1TWE A;  4G6M A;  4QBV A;  3A21 A;  3C9Z A;  1JLX A;  3OJ2 A;  4GAI A;  5BP5 C;  2ZQO A;  2ERM A;  3O3Q A;  1FMZ A;  3O4B A;  2M49 A;  4I4X A;  9ILB A;  4J2Y A;  3FJK A;  2NS2 A;  1Q1U A;  2DS0 A;  4I1B A;  4MZF B;  1R8O A;  1G82 A;  1Z4S A;  5BXR A;  2VLC A;  4OWK A;  1EVT A;  3FUQ A;  41BI A;  5DVH A;  1MC9 A;  4I4R A;  1UPS A;  4TLP A;  3O4A A;  1JLY A;  3JRR A;  4I2S A;  4XFS A;  3CA1 A;  3FJH A;  3FJA A;  3ILA A;  3Q7W A;  3I2A A;  3HOM A;  1XG6 A;  4FGF A;  1SR4 A;  4OUJ A;  3IM5 A;  4J2S A;  2BEB A;  5DZU A;  1DQO A;  2DRY A;  2AAI B;  3AKH A;  4ISQ A;  3AKF A;  2F8X C;  4LO1 A;  4P0J A;  4II0 A;  1TWM A;  1WBA A;  3NBC A;  1DJS B;  3N7J A;  3P6I A;  3ZC9 A;  2VXR A;  5JMC A;  1FWU A;  1S0E A;  3OBR A;  4I4O A;  4ZKT B;  4KC3 A;  3PUB A;  4ZGR B;  3JUT A;  1M2T B;  3FJE A;  4KEJ A;  1R8N A;  4I3N A;  4P0L A;  3RMY A;  1FWV A;  1PZZ A;  5EG6 C;  4I1E A;  2I1B A;  3CRH A;  3UD9 A;  3WIN A;  3PHZ A;  21BI A;  2RG9 B;  4JP0 A;  4DEN A;  4P6A A;  3S8K A;  3A07 A;  3FJ9 A;  2LIE A;  1FV3 A;  1EV2 A;  1V6U A;  2AFG A;  1CVS A;  1ISX A;  3WMU A;  1FQ9 A;  4XFU A;  5D63 A;  4I4U A;  4LO0 C;  1FMM S;  1S0C A;  5F90 A;  3H6Q A;  4JPZ A;  4F83 A;  1PWA A;  1MD6 A;  1DLL A;  2Y9W C;  3OJV A;  2HW9 A;  4LO7 C;  4EFP A;  3NBD A;  4I0Y A;  3AKG A;  3CQA A;  1DQG A;  1WD3 A;  1DIW A;  3IIR A;  4D0Z A;  2F2F A;  4G6J A;  4FVV A;  4ZFY B;  3V0A B;  2MC2 A;  4J2K A;  3V0A A;  1HIB A;  2D7R A;  3WO2 A;  1BA7 A;  1YBI A;  3BTA A;  3Q7X A;  3FJI A;  1TOO A;  4ZOT A;  5DUY A;  3FJF A;  2E4M A;  3HN1 A;  3NBE A;  3P53 A;  5BP5 A;  4WBC A;  5JLV A;  3MPP G;  2K8R A;  3MAL A;  2FO1 A;  4QKS A;  3VT0 A;  1RML A;  2FFU A;  2Q3N B;  3ZXG A;  3BA7 A;  3CU1 B;  4DCK C;  2KKI A;  4XFT A;  3RTJ B;  2BFH A;  1NZK A;  1DZC A;  1QQL A;  4H75 A;  7I1B A;  3F62 B;  4QD2 C;  1Q03 A;  1AVW B;  1L2H A;  3FJD A;  1KNM A;  1ABR B;  3CA5 A;  4LO8 B;  1IHK A;  4I8M A;  4JRA A;  1ISY A;  1GGP B;  1G9D A;  4AN6 A;  3D7W B;  4EB2 B;  1S0G A;  1IOB A;  2GZB A;  4IY8 A;  5BQU A;  2DRZ A;  2QYI B;  5GAQ A;  1A8D A;  1RZO B;  4IHZ A;  4I96 A;  4IZE A;  4G9N A;  3NJ5 A;  4I4P A;  4DEP A;  1V6W A;  1WBC A;  1BLD A;  5FNX A;  3O4O A;  5FZZ A;  3BAV A;  1YXW A;  4H9W A;  1P63 A;  3CAH A;  4GOV A;  3SNV A;  3BRG C;  3H6R B;  4MZG B;  5F8S A;  1E0O A;  3O44 A;  3O4C A;  3R4U A;  4HR6 C;  4EEE B;  3H6R A;  4EFR A;  4USP A;  4ZA3 B;  3BAO A;  3F1R A;  3QR5 A;  1S0F A;  4ISR A;  3UJ4 A;  2D1Z A;  4OEG A;  4P0K A;  2X2S A;  5BXP A;  1ISZ A;  4G1R A;  2IHO A;  4LO0 A;  6I1B A;  3H6S E;  3AJ6 A;  4OW4 A;  4LO2 C;  2KI4 A;  1XYF A;  5F8W A;  1G9B A;  3BB2 A;  4D8H A;  4G9M A;  4KEI A;  1V6V A;  3BX1 C;  3V0B B;  4I4Y A;  5DSS B;  3V0B A;  1F31 A;  3E8L C;  1FGA A;  3OBT A;  1K5U A;  3Q7Y A;  2HZ9 A;  4AN7 B;  3VT2 A;  1AVX B;  3HBW A;  1T9F A;  3TC2 A;  1TP0 A;  3WA1 A;  1JY0 A;  4HA2 A;  2WRY A;  2D43 A;  1Z0H A;  2P23 A;  2KLL A;  4EFQ A;  4OEF A;  4QAL A;  3W9T A;  1HWN B;  2Y9X E;  1FV2 A;  2XOA A;  4ZFW B;  2X2T A;  4ION A;  4X3A A;  1SR4 C;  3CA0 A;  2J3P A;  2LIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...