4HA2A

Crystal structure ofa phenyl alanine 91 mutant of wci
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
174
Chain Sequence
b'DDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWFTVVDSPQGPAVKLSQQKLPEKDALVFKFEKVSHSNIHVYKLLYCQHDEVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title A conserved tryptophan (W91) at the barrel-lid junction modulates the packing and stability of Kunitz (STI) family of inhibitors.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 29
structure length 174
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4ha2A00
3FJIA 3AZWA 3I2AA 2D43A 4I4SA 1SR4A 1IRPA 2VUAA 4QKSA 1JTCA 2LIEA 1HWNB 2VXRA 6I1BA 4G1RA 2Y9GA 4F83A 2P23A 2QN4A 3TC2A 3I2XA 3FGMA 4LO2A 3BA7A 2VXTI 4CJMA 4L4HA 2MC2A 3T8SA 1JY0A 4ZGRB 1JT7A 3AJ6A 4I4UA 2Q9XA 4QBCA 3N0KA 2HWMA 1BARA 5B2HA 7I1BA 4XFSA 3QYDA 3FJKA 3S8JA 2J3PA 3UJ0A 4Z8SB 2NYYA 4YOLA 3O4AA 3CRHA 1BFGA 4I8MA 4Q9PA 5BP5A 1T9FA 3OGGA 2UUSA 3K1XA 4IZEA 2Z48A 3N7LA 1VCLA 4Z9WB 3FJAA 1YF8B 3AH2A 2DREA 4G6MA 4EFPA 1BLDA 3POKA 1AFCA 5EC5A 1WBAA 4JP0A 1YYNA 3HSMA 4I1BA 4IONA 3LTQA 1S0EA 4GOVA 3N7JA 2GZBA 4I4QA 3OBTA 2GO2A 2XOAA 1DZDA 2BEBA 1W3FA 2NZ9A 2D20A 3O4OA 4LO1A 3WMUA 1T4QA 3OBRA 3P6IA 2LIQA 1NZKA 3P53A 1HCEA 1EV2A 2Y9FA 3AH4A 4OWJA 3WO4A 1N4KA 5FNXA 3BRDA 3CAHA 3KMVA 3H6RB 3FJCA 4I0YA 3PMEA 2Z49A 3Q7YA 1FMMS 2AQZA 3C9ZA 4DEPA 4IQPA 1Z4SA 4LO3A 1G9AA 3VT1A 5BXPA 3V0AB 1YXWA 1G9DA 1TTUA 2HZ9A 3BRGC 5F8SA 2AAIB 4EEEB 3HOMA 4L4IA 1ABRB 2MIBA 1ISXA 1GGPB 4H04A 4P0KA 4PC4A 1W3GA 3ILAA 4IY8A 1DQGA 1EYLA 4J2YA 4R6UB 2DS0A 1IHKA 3VEQA 3BA5A 4EFRA 3A23A 3BAVA 3UD7A 3OJVA 3H6QA 5FZYA 1HWOB 31BIA 3FJHA 1K5VA 3A07A 4GAFA 3I29B 3BRFA 3RSJA 3CRIA 1Q04A 1YTOA 5EHAA 1PUMB 4I4PA 1BFBA 4H9WA 3N7MA 4OWLA 4OWKA 4Q9GA 1ISVA 4EB2B 1PC8B 3UD9A 2ZR1B 3HBWA 5DSSB 3ZXGA 1CE7B 1RG8A 2QYIB 3D7WB 4JKXB 2D23A 4I7IA 1M16A 2F2FC 1R8OA 3FJBA 3FJJA 1Z0HA 4JRAA 1V6WA 3NBCA 3WA1A 4QKRA 1G9CA 1F31A 5D61A 3A21A 2YUGA 4AN7B 4IY9A 4LO0C 1DFCA 2NTDA 2KKIA 3NJ5A 4I37A 2K8RA 1JQZA 3O4DA 1E0OA 3PHZA 2NP0A 1AXMA 3AZVA 1KNMA 3NBNA 1BFFA 2FGFA 4J2KA 1FGAA 4KC3A 1WBCA 5FNWA 4GP3A 3RTIB 1JT5A 1IRAX 1QXMA 3WINA 1TWMA 3AJ5A 1IILA 4ZA3B 4A7ZA 1G82A 2KI4A 4ENDA 5I1BA 5E24E 4IZXA 3O49A 4I4XA 1PWAA 3CRGA 1DIWA 5F90A 4A7YA 5BQUC 3BTAA 3FJ9A 2E4MC 3JUTA 41BIA 4D0TA 1ONKB 3RMYA 5FZUA 3B9UA 2MLLB 1L2HA 2F2FA 2RSTA 3CU1B 2K4AB 1SZ6B 1FQ9A 3FJDA 2DRZA 5F8YA 1MC9A 4QO3A 2Y9WC 2ET2A 4OW4A 4HA2A 4AN6A 1G9BA 5G00A 1RY7A 1YBIA 1ISZA 1V6XA 3ZX7A 4LO0A 3H6RA 3CA5A 2R9KB 3IM7A 2KH2A 1BLAA 3AKFA 3NBDA 2X2SA 1ILR1 4LO8B 3UDAA 2D24A 3V0AA 3F62B 1I1BA 3ZC9A 1DZCA 1NUNA 3CA6A 3WMVA 5BXRA 1M2TB 3Q7WA 5BOWA 1ITBA 2ERMA 2D1ZA 1EPWA 3AKHA 1DLLA 1S0LA 1AF9A 5D63A 1S0GA 3NBEA 3ZXDA 3R4UA 1HWPB 4D8HA 4Q91A 1I1EA 3IIRA 4ZLBB 5DUYA 3R4SA 2IWTB 1HWMB 3VWCA 4OEFA 4KEJA 4XFTA 1UPSA 2KI6B 4FVVA 1DQOA 1IJTA 2M49A 5GAQA 4ISRA 3CA3A 5F8WA 1WD4A 4USPA 1SR4C 4D0ZA 1Q03A 2K43A 2L5XA 4KEKA 2BEAA 1FWUA 4OEGA 3WO3A 4X37A 5BXSA 3FJ8A 4J2SA 3F1RA 1BASA 4I3NA 1TP0A 2FFVA 4LO2C 3OJMA 2D7IA 3EF2A 2NVHA 4IHZA 1IOBA 1BFCA 4I2SA 5JMCA 4P0JA 3CA0A 3MPPG 2Q3NB 2DRYA 4DCKC 4USOA 4KBBA 3VT0A 1S0BA 4ZFUB 9ILBA 2FFUA 4GP0A 1JT3A 2AFGA 2VU9A 4ZFWB 2KLLA 3HN1A 3CA1A 3CQAA 5BP5C 4J2XA 1K5UA 4QD2C 1Z2VA 3O44A 1TFMB 3PUBA 3RTJB 4JQ0A 2HW9A 2IHOA 4X38A 1HIBA 2ZQOA 4F34A 2D7RA 4FGFA 3ZC8A 4LO7C 4XKIA 2I1BA 3WO2A 3AKIA 3BB2A 2RQ9A 3V0BB 1FWVA 1FV2A 1AVAC 1AVXB 1Q1UA 1AVUA 3N7KA 1V6UA 3W9TA 5DVHA 5DZUA 1RZOB 1FN0A 3LLPA 4ZKTB 4LO1C 3MALA 4P0LA 4GOYA 5BVPI 4QC4A 4ZFYB 2BFHA 3PG0A 4I6IA 1S0FA 1XHBA 1II4A 3FJFA 3OJ2A 4DENA 1IT0A 4I4RA 4X39A 4IYBA 4G9MA 3IAGC 3O4CA 3BAOA 2FDBM 3Q7XA 1XG6A 2D44A 3QR5A 2HWAA 3FUOA 4LO3C 3FFZA 1RMLA 4TLPA 1JT4A 4HJJA 3VUOA 1FMZA 4KEIA 4QBVA 4JAWA 4ZOTA 1EVTA 2F8XC 4EFQA 3OGFA 1ISYA 1XYFA 3AH1A 1HKNA 4WBCA 1J0SA 1DJSB 2WRYA 1BA7A 3V79C 2NM1A 4QD2B 4J23B 2Y9XE 1HCDA 1WD3A 4QALA 3FJEA 3P6JA 4G9NA 4OUJA 1R8NA 1FV3A 5BQUA 3BA4A 4I4YA 2ZQNA 4LO7B 4I96A 4II0A 2E4MA 4ISQA 3BAHA 5HPZA 1OQLB 1QQLA 4XFUA 2WBCA 1V6VA 1TWEA 3AKGA 4P6AA 3BX1C 2FO1A 4X3AA 2RG9B 4A7KA 4I1EA 1CVSA 5BXTA 3IM6A 3E8LC 1AVWB 4GAIA 2ESUA 3VSFA 1DFQA 3VSZA 3HMYA 1TIEA 1XZZA 3O3QA 4I4VA 3VT2A 1JLXA 3RMXA 2X2TA 2P39A 3O5WB 4OEEA 1A8DA 3FUQA 3S8KA 3BAUA 1PZZA 3SNVA 4JKQA 4ZBVB 1ISWA 1QQKA 3WINC 5EG6C 2AXMA 1W3AA 2VSEA 3JRRA 2VSAA 4I4OA 3CA4A 8I1BA 3BAQA 2VLCA 3UD8A 1P63A 21BIA 2D22A 5D62A 1JLYA 4JPZA 1TOOA 3V0BA 3HALA 5JLVA 3H6SE 4HR6C 3O4BA 1S0DA 4G6JA 3UJ4A 4EKXB 1S0CA 3BADA 3A22A 5FZZA 1D0HA 3BAGA 1MD6A 3IM5A 1PUUB
chains in the Genus database with same CATH superfamily
3FJIA 3AZWA 3I2AA 2D43A 4I4SA 1SR4A 1IRPA 2VUAA 4QKSA 1JTCA 2LIEA 1HWNB 2VXRA 6I1BA 4G1RA 2Y9GA 4F83A 2P23A 2QN4A 3TC2A 3I2XA 3FGMA 4LO2A 3BA7A 2VXTI 4CJMA 4L4HA 2MC2A 3T8SA 1JY0A 4ZGRB 1JT7A 3AJ6A 4I4UA 2Q9XA 4QBCA 3N0KA 2HWMA 1BARA 5B2HA 7I1BA 4XFSA 3QYDA 3FJKA 3S8JA 2J3PA 3UJ0A 4Z8SB 2NYYA 4YOLA 3O4AA 3CRHA 1BFGA 4I8MA 4Q9PA 5BP5A 1T9FA 3OGGA 2UUSA 3K1XA 4IZEA 2Z48A 3N7LA 1VCLA 4Z9WB 3FJAA 1YF8B 3AH2A 2DREA 4G6MA 4EFPA 1BLDA 3POKA 1AFCA 5EC5A 1WBAA 4JP0A 1YYNA 3HSMA 4I1BA 4IONA 3LTQA 1S0EA 4GOVA 3N7JA 2GZBA 4I4QA 3OBTA 2GO2A 2XOAA 1DZDA 2BEBA 1W3FA 2NZ9A 2D20A 3O4OA 4LO1A 3WMUA 1T4QA 3OBRA 3P6IA 2LIQA 1NZKA 3P53A 1HCEA 1EV2A 2Y9FA 3AH4A 4OWJA 3WO4A 1N4KA 5FNXA 3BRDA 3CAHA 3KMVA 3H6RB 3FJCA 4I0YA 3PMEA 2Z49A 3Q7YA 1FMMS 2AQZA 3C9ZA 4DEPA 4IQPA 1Z4SA 4LO3A 1G9AA 3VT1A 5BXPA 3V0AB 1YXWA 1G9DA 1TTUA 2HZ9A 3BRGC 5F8SA 2AAIB 4EEEB 3HOMA 4L4IA 1ABRB 2MIBA 1ISXA 1GGPB 4H04A 4MZFB 4P0KA 4PC4A 1W3GA 3ILAA 4IY8A 1DQGA 1EYLA 4J2YA 4R6UB 2DS0A 1IHKA 3VEQA 3BA5A 4EFRA 3A23A 3BAVA 3UD7A 3OJVA 3H6QA 5FZYA 1HWOB 31BIA 3FJHA 1K5VA 3A07A 4GAFA 3I29B 3BRFA 3RSJA 3CRIA 1Q04A 1YTOA 5EHAA 1PUMB 4I4PA 1BFBA 4H9WA 3N7MA 4OWLA 4OWKA 4Q9GA 1ISVA 4EB2B 1PC8B 3UD9A 2ZR1B 3HBWA 5DSSB 3ZXGA 1CE7B 1RG8A 2QYIB 3D7WB 4JKXB 2D23A 4I7IA 1M16A 2F2FC 1R8OA 3FJBA 3FJJA 1Z0HA 4JRAA 1V6WA 3NBCA 3WA1A 4QKRA 1G9CA 1F31A 5D61A 3A21A 2YUGA 4AN7B 4IY9A 4LO0C 1DFCA 2NTDA 2KKIA 3NJ5A 4I37A 2K8RA 1JQZA 3O4DA 1E0OA 3PHZA 2NP0A 1AXMA 3AZVA 1KNMA 3NBNA 1BFFA 2FGFA 4J2KA 1FGAA 4KC3A 1WBCA 5FNWA 4GP3A 3RTIB 1JT5A 1IRAX 1QXMA 3WINA 1TWMA 3AJ5A 1IILA 4ZA3B 4A7ZA 1G82A 2KI4A 4ENDA 5I1BA 5E24E 4IZXA 3O49A 4I4XA 1PWAA 3CRGA 1DIWA 5F90A 4A7YA 5BQUC 3BTAA 3FJ9A 2E4MC 3JUTA 41BIA 4D0TA 1ONKB 3RMYA 5FZUA 3B9UA 2MLLB 1L2HA 2F2FA 2RSTA 3CU1B 2K4AB 1SZ6B 1FQ9A 3FJDA 2DRZA 5F8YA 1MC9A 4QO3A 2Y9WC 2ET2A 4OW4A 4HA2A 4AN6A 1G9BA 5G00A 1RY7A 1YBIA 1ISZA 1V6XA 3ZX7A 4LO0A 3H6RA 3CA5A 2R9KB 3IM7A 2KH2A 1BLAA 3AKFA 3NBDA 2X2SA 1ILR1 4LO8B 3UDAA 2D24A 3V0AA 3F62B 1I1BA 3ZC9A 1DZCA 1NUNA 3CA6A 3WMVA 5BXRA 1M2TB 3Q7WA 5BOWA 1ITBA 2ERMA 2D1ZA 1EPWA 3AKHA 1DLLA 1S0LA 1AF9A 5D63A 1S0GA 3NBEA 3ZXDA 3R4UA 1HWPB 4D8HA 4Q91A 1I1EA 3IIRA 4ZLBB 5DUYA 3R4SA 2IWTB 1HWMB 3VWCA 4H75A 4OEFA 4KEJA 4XFTA 1UPSA 2KI6B 4FVVA 1DQOA 1IJTA 2M49A 5GAQA 4ISRA 3CA3A 5F8WA 1WD4A 4USPA 1SR4C 4D0ZA 1Q03A 2K43A 2L5XA 4KEKA 2BEAA 1FWUA 4OEGA 3WO3A 4X37A 5BXSA 3FJ8A 4J2SA 3F1RA 1BASA 4I3NA 1TP0A 2FFVA 4LO2C 3OJMA 2D7IA 3EF2A 2NVHA 4IHZA 1IOBA 1BFCA 4I2SA 5JMCA 4P0JA 3CA0A 3MPPG 2Q3NB 2DRYA 4DCKC 4USOA 4KBBA 3VT0A 1S0BA 4ZFUB 9ILBA 2FFUA 4GP0A 1JT3A 2AFGA 2VU9A 4ZFWB 2KLLA 3HN1A 3CA1A 3CQAA 5BP5C 4J2XA 1K5UA 4QD2C 1Z2VA 3O44A 1TFMB 3PUBA 3RTJB 4JQ0A 2HW9A 2IHOA 4X38A 1HIBA 2ZQOA 4F34A 2D7RA 4FGFA 3ZC8A 4LO7C 4XKIA 2I1BA 3WO2A 3AKIA 3BB2A 2RQ9A 3V0BB 1FWVA 1FV2A 1AVAC 1AVXB 1Q1UA 1AVUA 3N7KA 1V6UA 2NS2A 3W9TA 5DVHA 5DZUA 1RZOB 1FN0A 3LLPA 4ZKTB 4LO1C 3MALA 4P0LA 4GOYA 5BVPI 4QC4A 4ZFYB 2BFHA 3PG0A 4I6IA 1S0FA 1XHBA 1II4A 3FJFA 3OJ2A 4DENA 1IT0A 4I4RA 4X39A 4IYBA 4G9MA 3IAGC 3O4CA 3BAOA 2FDBM 3Q7XA 1XG6A 2D44A 3QR5A 2HWAA 3FUOA 4LO3C 3FFZA 1RMLA 4TLPA 1JT4A 4HJJA 3VUOA 1FMZA 4KEIA 4QBVA 4JAWA 4ZOTA 1EVTA 2F8XC 4EFQA 3OGFA 1ISYA 1XYFA 3AH1A 1HKNA 4WBCA 1J0SA 1DJSB 2WRYA 1BA7A 3V79C 2NM1A 4QD2B 4J23B 2Y9XE 1HCDA 1WD3A 4QALA 3FJEA 3P6JA 4G9NA 4OUJA 1R8NA 1FV3A 5BQUA 3BA4A 4I4YA 2ZQNA 4LO7B 4I96A 4II0A 2E4MA 4ISQA 3BAHA 5HPZA 1OQLB 1QQLA 4XFUA 2WBCA 1V6VA 1TWEA 3AKGA 4P6AA 3BX1C 2FO1A 4X3AA 2RG9B 4A7KA 4I1EA 1CVSA 5BXTA 3IM6A 3E8LC 1AVWB 4GAIA 2ESUA 3VSFA 1DFQA 3VSZA 3HMYA 1TIEA 1XZZA 3O3QA 4I4VA 3VT2A 4UY4A 1JLXA 3RMXA 2X2TA 2P39A 3O5WB 4OEEA 1A8DA 3FUQA 3S8KA 3BAUA 1PZZA 3SNVA 4JKQA 4ZBVB 1ISWA 1QQKA 3WINC 5EG6C 2AXMA 1W3AA 2VSEA 3JRRA 2VSAA 4I4OA 3CA4A 8I1BA 3BAQA 2VLCA 4MZGB 3UD8A 1P63A 21BIA 2D22A 5D62A 1JLYA 4JPZA 1TOOA 3V0BA 3HALA 5JLVA 3H6SE 4HR6C 3O4BA 1S0DA 4G6JA 3UJ4A 4EKXB 1S0CA 3BADA 3A22A 5FZZA 1D0HA 4MZHA 3BAGA 1MD6A 3IM5A 1PUUB
chains in the Genus database with same CATH topology
3FJIA 3AZWA 3I2AA 2D43A 4I4SA 1SR4A 1IRPA 2VUAA 4QKSA 1JTCA 2LIEA 1HWNB 2VXRA 6I1BA 4G1RA 2Y9GA 4F83A 2P23A 2QN4A 3TC2A 3I2XA 3FGMA 4LO2A 3BA7A 2VXTI 4CJMA 4L4HA 2MC2A 3T8SA 1JY0A 4ZGRB 1JT7A 3AJ6A 4I4UA 2Q9XA 4QBCA 3N0KA 2HWMA 1BARA 5B2HA 7I1BA 4XFSA 3QYDA 3FJKA 3S8JA 2J3PA 3UJ0A 4Z8SB 2NYYA 4YOLA 3O4AA 3CRHA 1BFGA 4I8MA 4Q9PA 5BP5A 1T9FA 3OGGA 2UUSA 3K1XA 4IZEA 2Z48A 3N7LA 1VCLA 4Z9WB 3FJAA 1YF8B 3AH2A 2DREA 4G6MA 4EFPA 1BLDA 3POKA 1AFCA 5EC5A 1WBAA 4JP0A 1YYNA 3HSMA 4I1BA 4IONA 3LTQA 1S0EA 4GOVA 3N7JA 2GZBA 4I4QA 3OBTA 2GO2A 2XOAA 1DZDA 2BEBA 1W3FA 2NZ9A 2D20A 3O4OA 4LO1A 3WMUA 1T4QA 3OBRA 3P6IA 2LIQA 1NZKA 3P53A 1HCEA 1EV2A 2Y9FA 3AH4A 4OWJA 3WO4A 1N4KA 5FNXA 3BRDA 3CAHA 3KMVA 3H6RB 3FJCA 4I0YA 3PMEA 2Z49A 3Q7YA 1FMMS 2AQZA 3C9ZA 4DEPA 4IQPA 1Z4SA 4LO3A 1G9AA 3VT1A 5BXPA 3V0AB 1YXWA 1G9DA 1TTUA 2HZ9A 3BRGC 5F8SA 2AAIB 4EEEB 3HOMA 4L4IA 1ABRB 2MIBA 1ISXA 1GGPB 4H04A 4MZFB 4P0KA 4PC4A 1W3GA 3ILAA 4IY8A 1DQGA 1EYLA 4J2YA 4R6UB 2DS0A 1IHKA 3VEQA 3BA5A 4EFRA 3A23A 3BAVA 3UD7A 3OJVA 3H6QA 5FZYA 1HWOB 31BIA 3FJHA 1K5VA 3A07A 4GAFA 3I29B 3BRFA 3RSJA 3CRIA 1Q04A 1YTOA 5EHAA 1PUMB 4I4PA 1BFBA 4H9WA 3N7MA 4OWLA 4OWKA 4Q9GA 1ISVA 4EB2B 1PC8B 3UD9A 2ZR1B 3HBWA 5DSSB 3ZXGA 1CE7B 1RG8A 2QYIB 3D7WB 4JKXB 2D23A 4I7IA 1M16A 2F2FC 1R8OA 3FJBA 3FJJA 1Z0HA 4JRAA 1V6WA 3NBCA 3WA1A 4QKRA 1G9CA 1F31A 5D61A 3A21A 2YUGA 4AN7B 4IY9A 4LO0C 1DFCA 2NTDA 2KKIA 3NJ5A 4I37A 2K8RA 1JQZA 3O4DA 1E0OA 3PHZA 2NP0A 1AXMA 3AZVA 1KNMA 3NBNA 1BFFA 2FGFA 4J2KA 1FGAA 4KC3A 1WBCA 5FNWA 4GP3A 3RTIB 1JT5A 1IRAX 1QXMA 3WINA 1TWMA 3AJ5A 1IILA 4ZA3B 4A7ZA 1G82A 2KI4A 4ENDA 5I1BA 5E24E 4IZXA 3O49A 4I4XA 1PWAA 3CRGA 1DIWA 5F90A 4A7YA 5BQUC 3BTAA 3FJ9A 2E4MC 3JUTA 41BIA 4D0TA 1ONKB 3RMYA 5FZUA 3B9UA 2MLLB 1L2HA 2F2FA 2RSTA 3CU1B 2K4AB 1SZ6B 1FQ9A 3FJDA 2DRZA 5F8YA 1MC9A 4QO3A 2Y9WC 2ET2A 4OW4A 4HA2A 4AN6A 1G9BA 5G00A 1RY7A 1YBIA 1ISZA 1V6XA 3ZX7A 4LO0A 3H6RA 3CA5A 2R9KB 3IM7A 2KH2A 1BLAA 3AKFA 3NBDA 2X2SA 1ILR1 4LO8B 3UDAA 2D24A 3V0AA 3F62B 1I1BA 3ZC9A 1DZCA 1NUNA 3CA6A 3WMVA 5BXRA 1M2TB 3Q7WA 5BOWA 1ITBA 2ERMA 2D1ZA 1EPWA 3AKHA 1DLLA 1S0LA 1AF9A 5D63A 1S0GA 3NBEA 3ZXDA 3R4UA 1HWPB 4D8HA 4Q91A 1I1EA 3IIRA 4ZLBB 5DUYA 3R4SA 2IWTB 1HWMB 3VWCA 4H75A 4OEFA 4KEJA 4XFTA 1UPSA 2KI6B 4FVVA 1DQOA 1IJTA 2M49A 5GAQA 4ISRA 3CA3A 5F8WA 1WD4A 4USPA 1SR4C 4D0ZA 1Q03A 2K43A 2L5XA 4KEKA 2BEAA 1FWUA 4OEGA 3WO3A 4X37A 5BXSA 3FJ8A 4J2SA 3F1RA 1BASA 4I3NA 1TP0A 2FFVA 4LO2C 3OJMA 2D7IA 3EF2A 2NVHA 4IHZA 1IOBA 1BFCA 4I2SA 5JMCA 4P0JA 3CA0A 3MPPG 2Q3NB 2DRYA 4DCKC 4USOA 4KBBA 3VT0A 1S0BA 4ZFUB 9ILBA 2FFUA 4GP0A 1JT3A 2AFGA 2VU9A 4ZFWB 2KLLA 3HN1A 3CA1A 3CQAA 5BP5C 4J2XA 1K5UA 4QD2C 1Z2VA 3O44A 1TFMB 3PUBA 3RTJB 4JQ0A 2HW9A 2IHOA 4X38A 1HIBA 2ZQOA 4F34A 2D7RA 4FGFA 3ZC8A 4LO7C 4XKIA 2I1BA 3WO2A 3AKIA 3BB2A 2RQ9A 3V0BB 1FWVA 1FV2A 1AVAC 1AVXB 1Q1UA 1AVUA 3N7KA 1V6UA 2NS2A 3W9TA 5DVHA 5DZUA 1RZOB 1FN0A 3LLPA 4ZKTB 4LO1C 3MALA 4P0LA 4GOYA 5BVPI 4QC4A 4ZFYB 2BFHA 3PG0A 4I6IA 1S0FA 1XHBA 1II4A 3FJFA 3OJ2A 4DENA 1IT0A 4I4RA 4X39A 4IYBA 4G9MA 3IAGC 3O4CA 3BAOA 2FDBM 3Q7XA 1XG6A 2D44A 3QR5A 2HWAA 3FUOA 4LO3C 3FFZA 1RMLA 4TLPA 1JT4A 4HJJA 3VUOA 1FMZA 4KEIA 4QBVA 4JAWA 4ZOTA 1EVTA 2F8XC 4EFQA 3OGFA 1ISYA 1XYFA 3AH1A 1HKNA 4WBCA 1J0SA 1DJSB 2WRYA 1BA7A 3V79C 2NM1A 4QD2B 4J23B 2Y9XE 1HCDA 1WD3A 4QALA 3FJEA 3P6JA 4G9NA 4OUJA 1R8NA 1FV3A 5BQUA 3BA4A 4I4YA 2ZQNA 4LO7B 4I96A 4II0A 2E4MA 4ISQA 3BAHA 5HPZA 1OQLB 1QQLA 4XFUA 2WBCA 1V6VA 1TWEA 3AKGA 4P6AA 3BX1C 2FO1A 4X3AA 2RG9B 4A7KA 4I1EA 1CVSA 5BXTA 3IM6A 3E8LC 1AVWB 4GAIA 2ESUA 3VSFA 1DFQA 3VSZA 3HMYA 1TIEA 1XZZA 3O3QA 4I4VA 3VT2A 4UY4A 1JLXA 3RMXA 2X2TA 2P39A 3O5WB 4OEEA 1A8DA 3FUQA 3S8KA 3BAUA 1PZZA 3SNVA 4JKQA 4ZBVB 1ISWA 1QQKA 3WINC 5EG6C 2AXMA 1W3AA 2VSEA 3JRRA 2VSAA 4I4OA 3CA4A 8I1BA 3BAQA 2VLCA 4MZGB 3UD8A 1P63A 21BIA 2D22A 5D62A 1JLYA 4JPZA 1TOOA 3V0BA 3HALA 5JLVA 3H6SE 4HR6C 3O4BA 1S0DA 4G6JA 3UJ4A 4EKXB 1S0CA 3BADA 3A22A 5FZZA 1D0HA 4MZHA 3BAGA 1MD6A 3IM5A 1PUUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FJI A;  3AZW A;  3I2A A;  2D43 A;  4I4S A;  1SR4 A;  1IRP A;  2VUA A;  4QKS A;  1JTC A;  2LIE A;  1HWN B;  2VXR A;  6I1B A;  4G1R A;  2Y9G A;  4F83 A;  2P23 A;  2QN4 A;  3TC2 A;  3I2X A;  3FGM A;  4LO2 A;  3BA7 A;  2VXT I;  4CJM A;  4L4H A;  2MC2 A;  3T8S A;  1JY0 A;  4ZGR B;  1JT7 A;  3AJ6 A;  4I4U A;  2Q9X A;  4QBC A;  3N0K A;  2HWM A;  1BAR A;  5B2H A;  7I1B A;  4XFS A;  3QYD A;  3FJK A;  3S8J A;  2J3P A;  3UJ0 A;  4Z8S B;  2NYY A;  4YOL A;  3O4A A;  3CRH A;  1BFG A;  4I8M A;  4Q9P A;  5BP5 A;  1T9F A;  3OGG A;  2UUS A;  3K1X A;  4IZE A;  2Z48 A;  3N7L A;  1VCL A;  4Z9W B;  3FJA A;  1YF8 B;  3AH2 A;  2DRE A;  4G6M A;  4EFP A;  1BLD A;  3POK A;  1AFC A;  5EC5 A;  1WBA A;  4JP0 A;  1YYN A;  3HSM A;  4I1B A;  4ION A;  3LTQ A;  1S0E A;  4GOV A;  3N7J A;  2GZB A;  4I4Q A;  3OBT A;  2GO2 A;  2XOA A;  1DZD A;  2BEB A;  1W3F A;  2NZ9 A;  2D20 A;  3O4O A;  4LO1 A;  3WMU A;  1T4Q A;  3OBR A;  3P6I A;  2LIQ A;  1NZK A;  3P53 A;  1HCE A;  1EV2 A;  2Y9F A;  3AH4 A;  4OWJ A;  3WO4 A;  1N4K A;  5FNX A;  3BRD A;  3CAH A;  3KMV A;  3H6R B;  3FJC A;  4I0Y A;  3PME A;  2Z49 A;  3Q7Y A;  1FMM S;  2AQZ A;  3C9Z A;  4DEP A;  4IQP A;  1Z4S A;  4LO3 A;  1G9A A;  3VT1 A;  5BXP A;  3V0A B;  1YXW A;  1G9D A;  1TTU A;  2HZ9 A;  3BRG C;  5F8S A;  2AAI B;  4EEE B;  3HOM A;  4L4I A;  1ABR B;  2MIB A;  1ISX A;  1GGP B;  4H04 A;  4P0K A;  4PC4 A;  1W3G A;  3ILA A;  4IY8 A;  1DQG A;  1EYL A;  4J2Y A;  4R6U B;  2DS0 A;  1IHK A;  3VEQ A;  3BA5 A;  4EFR A;  3A23 A;  3BAV A;  3UD7 A;  3OJV A;  3H6Q A;  5FZY A;  1HWO B;  31BI A;  3FJH A;  1K5V A;  3A07 A;  4GAF A;  3I29 B;  3BRF A;  3RSJ A;  3CRI A;  1Q04 A;  1YTO A;  5EHA A;  1PUM B;  4I4P A;  1BFB A;  4H9W A;  3N7M A;  4OWL A;  4OWK A;  4Q9G A;  1ISV A;  4EB2 B;  1PC8 B;  3UD9 A;  2ZR1 B;  3HBW A;  5DSS B;  3ZXG A;  1CE7 B;  1RG8 A;  2QYI B;  3D7W B;  4JKX B;  2D23 A;  4I7I A;  1M16 A;  2F2F C;  1R8O A;  3FJB A;  3FJJ A;  1Z0H A;  4JRA A;  1V6W A;  3NBC A;  3WA1 A;  4QKR A;  1G9C A;  1F31 A;  5D61 A;  3A21 A;  2YUG A;  4AN7 B;  4IY9 A;  4LO0 C;  1DFC A;  2NTD A;  2KKI A;  3NJ5 A;  4I37 A;  2K8R A;  1JQZ A;  3O4D A;  1E0O A;  3PHZ A;  2NP0 A;  1AXM A;  3AZV A;  1KNM A;  3NBN A;  1BFF A;  2FGF A;  4J2K A;  1FGA A;  4KC3 A;  1WBC A;  5FNW A;  4GP3 A;  3RTI B;  1JT5 A;  1IRA X;  1QXM A;  3WIN A;  1TWM A;  3AJ5 A;  1IIL A;  4ZA3 B;  4A7Z A;  1G82 A;  2KI4 A;  4END A;  5I1B A;  5E24 E;  4IZX A;  3O49 A;  4I4X A;  1PWA A;  3CRG A;  1DIW A;  5F90 A;  4A7Y A;  5BQU C;  3BTA A;  3FJ9 A;  2E4M C;  3JUT A;  41BI A;  4D0T A;  1ONK B;  3RMY A;  5FZU A;  3B9U A;  2MLL B;  1L2H A;  2F2F A;  2RST A;  3CU1 B;  2K4A B;  1SZ6 B;  1FQ9 A;  3FJD A;  2DRZ A;  5F8Y A;  1MC9 A;  4QO3 A;  2Y9W C;  2ET2 A;  4OW4 A;  4HA2 A;  4AN6 A;  1G9B A;  5G00 A;  1RY7 A;  1YBI A;  1ISZ A;  1V6X A;  3ZX7 A;  4LO0 A;  3H6R A;  3CA5 A;  2R9K B;  3IM7 A;  2KH2 A;  1BLA A;  3AKF A;  3NBD A;  2X2S A;  1ILR 1;  4LO8 B;  3UDA A;  2D24 A;  3V0A A;  3F62 B;  1I1B A;  3ZC9 A;  1DZC A;  1NUN A;  3CA6 A;  3WMV A;  5BXR A;  1M2T B;  3Q7W A;  5BOW A;  1ITB A;  2ERM A;  2D1Z A;  1EPW A;  3AKH A;  1DLL A;  1S0L A;  1AF9 A;  5D63 A;  1S0G A;  3NBE A;  3ZXD A;  3R4U A;  1HWP B;  4D8H A;  4Q91 A;  1I1E A;  3IIR A;  4ZLB B;  5DUY A;  3R4S A;  2IWT B;  1HWM B;  3VWC A;  4OEF A;  4KEJ A;  4XFT A;  1UPS A;  2KI6 B;  4FVV A;  1DQO A;  1IJT A;  2M49 A;  5GAQ A;  4ISR A;  3CA3 A;  5F8W A;  1WD4 A;  4USP A;  1SR4 C;  4D0Z A;  1Q03 A;  2K43 A;  2L5X A;  4KEK A;  2BEA A;  1FWU A;  4OEG A;  3WO3 A;  4X37 A;  5BXS A;  3FJ8 A;  4J2S A;  3F1R A;  1BAS A;  4I3N A;  1TP0 A;  2FFV A;  4LO2 C;  3OJM A;  2D7I A;  3EF2 A;  2NVH A;  4IHZ A;  1IOB A;  1BFC A;  4I2S A;  5JMC A;  4P0J A;  3CA0 A;  3MPP G;  2Q3N B;  2DRY A;  4DCK C;  4USO A;  4KBB A;  3VT0 A;  1S0B A;  4ZFU B;  9ILB A;  2FFU A;  4GP0 A;  1JT3 A;  2AFG A;  2VU9 A;  4ZFW B;  2KLL A;  3HN1 A;  3CA1 A;  3CQA A;  5BP5 C;  4J2X A;  1K5U A;  4QD2 C;  1Z2V A;  3O44 A;  1TFM B;  3PUB A;  3RTJ B;  4JQ0 A;  2HW9 A;  2IHO A;  4X38 A;  1HIB A;  2ZQO A;  4F34 A;  2D7R A;  4FGF A;  3ZC8 A;  4LO7 C;  4XKI A;  2I1B A;  3WO2 A;  3AKI A;  3BB2 A;  2RQ9 A;  3V0B B;  1FWV A;  1FV2 A;  1AVA C;  1AVX B;  1Q1U A;  1AVU A;  3N7K A;  1V6U A;  3W9T A;  5DVH A;  5DZU A;  1RZO B;  1FN0 A;  3LLP A;  4ZKT B;  4LO1 C;  3MAL A;  4P0L A;  4GOY A;  5BVP I;  4QC4 A;  4ZFY B;  2BFH A;  3PG0 A;  4I6I A;  1S0F A;  1XHB A;  1II4 A;  3FJF A;  3OJ2 A;  4DEN A;  1IT0 A;  4I4R A;  4X39 A;  4IYB A;  4G9M A;  3IAG C;  3O4C A;  3BAO A;  2FDB M;  3Q7X A;  1XG6 A;  2D44 A;  3QR5 A;  2HWA A;  3FUO A;  4LO3 C;  3FFZ A;  1RML A;  4TLP A;  1JT4 A;  4HJJ A;  3VUO A;  1FMZ A;  4KEI A;  4QBV A;  4JAW A;  4ZOT A;  1EVT A;  2F8X C;  4EFQ A;  3OGF A;  1ISY A;  1XYF A;  3AH1 A;  1HKN A;  4WBC A;  1J0S A;  1DJS B;  2WRY A;  1BA7 A;  3V79 C;  2NM1 A;  4QD2 B;  4J23 B;  2Y9X E;  1HCD A;  1WD3 A;  4QAL A;  3FJE A;  3P6J A;  4G9N A;  4OUJ A;  1R8N A;  1FV3 A;  5BQU A;  3BA4 A;  4I4Y A;  2ZQN A;  4LO7 B;  4I96 A;  4II0 A;  2E4M A;  4ISQ A;  3BAH A;  5HPZ A;  1OQL B;  1QQL A;  4XFU A;  2WBC A;  1V6V A;  1TWE A;  3AKG A;  4P6A A;  3BX1 C;  2FO1 A;  4X3A A;  2RG9 B;  4A7K A;  4I1E A;  1CVS A;  5BXT A;  3IM6 A;  3E8L C;  1AVW B;  4GAI A;  2ESU A;  3VSF A;  1DFQ A;  3VSZ A;  3HMY A;  1TIE A;  1XZZ A;  3O3Q A;  4I4V A;  3VT2 A;  1JLX A;  3RMX A;  2X2T A;  2P39 A;  3O5W B;  4OEE A;  1A8D A;  3FUQ A;  3S8K A;  3BAU A;  1PZZ A;  3SNV A;  4JKQ A;  4ZBV B;  1ISW A;  1QQK A;  3WIN C;  5EG6 C;  2AXM A;  1W3A A;  2VSE A;  3JRR A;  2VSA A;  4I4O A;  3CA4 A;  8I1B A;  3BAQ A;  2VLC A;  3UD8 A;  1P63 A;  21BI A;  2D22 A;  5D62 A;  1JLY A;  4JPZ A;  1TOO A;  3V0B A;  3HAL A;  5JLV A;  3H6S E;  4HR6 C;  3O4B A;  1S0D A;  4G6J A;  3UJ4 A;  4EKX B;  1S0C A;  3BAD A;  3A22 A;  5FZZ A;  1D0H A;  3BAG A;  1MD6 A;  3IM5 A;  1PUU B; 
#chains in the Genus database with same CATH topology
 3FJI A;  3AZW A;  3I2A A;  2D43 A;  4I4S A;  1SR4 A;  1IRP A;  2VUA A;  4QKS A;  1JTC A;  2LIE A;  1HWN B;  2VXR A;  6I1B A;  4G1R A;  2Y9G A;  4F83 A;  2P23 A;  2QN4 A;  3TC2 A;  3I2X A;  3FGM A;  4LO2 A;  3BA7 A;  2VXT I;  4CJM A;  4L4H A;  2MC2 A;  3T8S A;  1JY0 A;  4ZGR B;  1JT7 A;  3AJ6 A;  4I4U A;  2Q9X A;  4QBC A;  3N0K A;  2HWM A;  1BAR A;  5B2H A;  7I1B A;  4XFS A;  3QYD A;  3FJK A;  3S8J A;  2J3P A;  3UJ0 A;  4Z8S B;  2NYY A;  4YOL A;  3O4A A;  3CRH A;  1BFG A;  4I8M A;  4Q9P A;  5BP5 A;  1T9F A;  3OGG A;  2UUS A;  3K1X A;  4IZE A;  2Z48 A;  3N7L A;  1VCL A;  4Z9W B;  3FJA A;  1YF8 B;  3AH2 A;  2DRE A;  4G6M A;  4EFP A;  1BLD A;  3POK A;  1AFC A;  5EC5 A;  1WBA A;  4JP0 A;  1YYN A;  3HSM A;  4I1B A;  4ION A;  3LTQ A;  1S0E A;  4GOV A;  3N7J A;  2GZB A;  4I4Q A;  3OBT A;  2GO2 A;  2XOA A;  1DZD A;  2BEB A;  1W3F A;  2NZ9 A;  2D20 A;  3O4O A;  4LO1 A;  3WMU A;  1T4Q A;  3OBR A;  3P6I A;  2LIQ A;  1NZK A;  3P53 A;  1HCE A;  1EV2 A;  2Y9F A;  3AH4 A;  4OWJ A;  3WO4 A;  1N4K A;  5FNX A;  3BRD A;  3CAH A;  3KMV A;  3H6R B;  3FJC A;  4I0Y A;  3PME A;  2Z49 A;  3Q7Y A;  1FMM S;  2AQZ A;  3C9Z A;  4DEP A;  4IQP A;  1Z4S A;  4LO3 A;  1G9A A;  3VT1 A;  5BXP A;  3V0A B;  1YXW A;  1G9D A;  1TTU A;  2HZ9 A;  3BRG C;  5F8S A;  2AAI B;  4EEE B;  3HOM A;  4L4I A;  1ABR B;  2MIB A;  1ISX A;  1GGP B;  4H04 A;  4MZF B;  4P0K A;  4PC4 A;  1W3G A;  3ILA A;  4IY8 A;  1DQG A;  1EYL A;  4J2Y A;  4R6U B;  2DS0 A;  1IHK A;  3VEQ A;  3BA5 A;  4EFR A;  3A23 A;  3BAV A;  3UD7 A;  3OJV A;  3H6Q A;  5FZY A;  1HWO B;  31BI A;  3FJH A;  1K5V A;  3A07 A;  4GAF A;  3I29 B;  3BRF A;  3RSJ A;  3CRI A;  1Q04 A;  1YTO A;  5EHA A;  1PUM B;  4I4P A;  1BFB A;  4H9W A;  3N7M A;  4OWL A;  4OWK A;  4Q9G A;  1ISV A;  4EB2 B;  1PC8 B;  3UD9 A;  2ZR1 B;  3HBW A;  5DSS B;  3ZXG A;  1CE7 B;  1RG8 A;  2QYI B;  3D7W B;  4JKX B;  2D23 A;  4I7I A;  1M16 A;  2F2F C;  1R8O A;  3FJB A;  3FJJ A;  1Z0H A;  4JRA A;  1V6W A;  3NBC A;  3WA1 A;  4QKR A;  1G9C A;  1F31 A;  5D61 A;  3A21 A;  2YUG A;  4AN7 B;  4IY9 A;  4LO0 C;  1DFC A;  2NTD A;  2KKI A;  3NJ5 A;  4I37 A;  2K8R A;  1JQZ A;  3O4D A;  1E0O A;  3PHZ A;  2NP0 A;  1AXM A;  3AZV A;  1KNM A;  3NBN A;  1BFF A;  2FGF A;  4J2K A;  1FGA A;  4KC3 A;  1WBC A;  5FNW A;  4GP3 A;  3RTI B;  1JT5 A;  1IRA X;  1QXM A;  3WIN A;  1TWM A;  3AJ5 A;  1IIL A;  4ZA3 B;  4A7Z A;  1G82 A;  2KI4 A;  4END A;  5I1B A;  5E24 E;  4IZX A;  3O49 A;  4I4X A;  1PWA A;  3CRG A;  1DIW A;  5F90 A;  4A7Y A;  5BQU C;  3BTA A;  3FJ9 A;  2E4M C;  3JUT A;  41BI A;  4D0T A;  1ONK B;  3RMY A;  5FZU A;  3B9U A;  2MLL B;  1L2H A;  2F2F A;  2RST A;  3CU1 B;  2K4A B;  1SZ6 B;  1FQ9 A;  3FJD A;  2DRZ A;  5F8Y A;  1MC9 A;  4QO3 A;  2Y9W C;  2ET2 A;  4OW4 A;  4HA2 A;  4AN6 A;  1G9B A;  5G00 A;  1RY7 A;  1YBI A;  1ISZ A;  1V6X A;  3ZX7 A;  4LO0 A;  3H6R A;  3CA5 A;  2R9K B;  3IM7 A;  2KH2 A;  1BLA A;  3AKF A;  3NBD A;  2X2S A;  1ILR 1;  4LO8 B;  3UDA A;  2D24 A;  3V0A A;  3F62 B;  1I1B A;  3ZC9 A;  1DZC A;  1NUN A;  3CA6 A;  3WMV A;  5BXR A;  1M2T B;  3Q7W A;  5BOW A;  1ITB A;  2ERM A;  2D1Z A;  1EPW A;  3AKH A;  1DLL A;  1S0L A;  1AF9 A;  5D63 A;  1S0G A;  3NBE A;  3ZXD A;  3R4U A;  1HWP B;  4D8H A;  4Q91 A;  1I1E A;  3IIR A;  4ZLB B;  5DUY A;  3R4S A;  2IWT B;  1HWM B;  3VWC A;  4H75 A;  4OEF A;  4KEJ A;  4XFT A;  1UPS A;  2KI6 B;  4FVV A;  1DQO A;  1IJT A;  2M49 A;  5GAQ A;  4ISR A;  3CA3 A;  5F8W A;  1WD4 A;  4USP A;  1SR4 C;  4D0Z A;  1Q03 A;  2K43 A;  2L5X A;  4KEK A;  2BEA A;  1FWU A;  4OEG A;  3WO3 A;  4X37 A;  5BXS A;  3FJ8 A;  4J2S A;  3F1R A;  1BAS A;  4I3N A;  1TP0 A;  2FFV A;  4LO2 C;  3OJM A;  2D7I A;  3EF2 A;  2NVH A;  4IHZ A;  1IOB A;  1BFC A;  4I2S A;  5JMC A;  4P0J A;  3CA0 A;  3MPP G;  2Q3N B;  2DRY A;  4DCK C;  4USO A;  4KBB A;  3VT0 A;  1S0B A;  4ZFU B;  9ILB A;  2FFU A;  4GP0 A;  1JT3 A;  2AFG A;  2VU9 A;  4ZFW B;  2KLL A;  3HN1 A;  3CA1 A;  3CQA A;  5BP5 C;  4J2X A;  1K5U A;  4QD2 C;  1Z2V A;  3O44 A;  1TFM B;  3PUB A;  3RTJ B;  4JQ0 A;  2HW9 A;  2IHO A;  4X38 A;  1HIB A;  2ZQO A;  4F34 A;  2D7R A;  4FGF A;  3ZC8 A;  4LO7 C;  4XKI A;  2I1B A;  3WO2 A;  3AKI A;  3BB2 A;  2RQ9 A;  3V0B B;  1FWV A;  1FV2 A;  1AVA C;  1AVX B;  1Q1U A;  1AVU A;  3N7K A;  1V6U A;  2NS2 A;  3W9T A;  5DVH A;  5DZU A;  1RZO B;  1FN0 A;  3LLP A;  4ZKT B;  4LO1 C;  3MAL A;  4P0L A;  4GOY A;  5BVP I;  4QC4 A;  4ZFY B;  2BFH A;  3PG0 A;  4I6I A;  1S0F A;  1XHB A;  1II4 A;  3FJF A;  3OJ2 A;  4DEN A;  1IT0 A;  4I4R A;  4X39 A;  4IYB A;  4G9M A;  3IAG C;  3O4C A;  3BAO A;  2FDB M;  3Q7X A;  1XG6 A;  2D44 A;  3QR5 A;  2HWA A;  3FUO A;  4LO3 C;  3FFZ A;  1RML A;  4TLP A;  1JT4 A;  4HJJ A;  3VUO A;  1FMZ A;  4KEI A;  4QBV A;  4JAW A;  4ZOT A;  1EVT A;  2F8X C;  4EFQ A;  3OGF A;  1ISY A;  1XYF A;  3AH1 A;  1HKN A;  4WBC A;  1J0S A;  1DJS B;  2WRY A;  1BA7 A;  3V79 C;  2NM1 A;  4QD2 B;  4J23 B;  2Y9X E;  1HCD A;  1WD3 A;  4QAL A;  3FJE A;  3P6J A;  4G9N A;  4OUJ A;  1R8N A;  1FV3 A;  5BQU A;  3BA4 A;  4I4Y A;  2ZQN A;  4LO7 B;  4I96 A;  4II0 A;  2E4M A;  4ISQ A;  3BAH A;  5HPZ A;  1OQL B;  1QQL A;  4XFU A;  2WBC A;  1V6V A;  1TWE A;  3AKG A;  4P6A A;  3BX1 C;  2FO1 A;  4X3A A;  2RG9 B;  4A7K A;  4I1E A;  1CVS A;  5BXT A;  3IM6 A;  3E8L C;  1AVW B;  4GAI A;  2ESU A;  3VSF A;  1DFQ A;  3VSZ A;  3HMY A;  1TIE A;  1XZZ A;  3O3Q A;  4I4V A;  3VT2 A;  4UY4 A;  1JLX A;  3RMX A;  2X2T A;  2P39 A;  3O5W B;  4OEE A;  1A8D A;  3FUQ A;  3S8K A;  3BAU A;  1PZZ A;  3SNV A;  4JKQ A;  4ZBV B;  1ISW A;  1QQK A;  3WIN C;  5EG6 C;  2AXM A;  1W3A A;  2VSE A;  3JRR A;  2VSA A;  4I4O A;  3CA4 A;  8I1B A;  3BAQ A;  2VLC A;  4MZG B;  3UD8 A;  1P63 A;  21BI A;  2D22 A;  5D62 A;  1JLY A;  4JPZ A;  1TOO A;  3V0B A;  3HAL A;  5JLV A;  3H6S E;  4HR6 C;  3O4B A;  1S0D A;  4G6J A;  3UJ4 A;  4EKX B;  1S0C A;  3BAD A;  3A22 A;  5FZZ A;  1D0H A;  4MZH A;  3BAG A;  1MD6 A;  3IM5 A;  1PUU B; 
#chains in the Genus database with same CATH homology
 3FJI A;  3AZW A;  3I2A A;  2D43 A;  4I4S A;  1SR4 A;  1IRP A;  2VUA A;  4QKS A;  1JTC A;  2LIE A;  1HWN B;  2VXR A;  6I1B A;  4G1R A;  2Y9G A;  4F83 A;  2P23 A;  2QN4 A;  3TC2 A;  3I2X A;  3FGM A;  4LO2 A;  3BA7 A;  2VXT I;  4CJM A;  4L4H A;  2MC2 A;  3T8S A;  1JY0 A;  4ZGR B;  1JT7 A;  3AJ6 A;  4I4U A;  2Q9X A;  4QBC A;  3N0K A;  2HWM A;  1BAR A;  5B2H A;  7I1B A;  4XFS A;  3QYD A;  3FJK A;  3S8J A;  2J3P A;  3UJ0 A;  4Z8S B;  2NYY A;  4YOL A;  3O4A A;  3CRH A;  1BFG A;  4I8M A;  4Q9P A;  5BP5 A;  1T9F A;  3OGG A;  2UUS A;  3K1X A;  4IZE A;  2Z48 A;  3N7L A;  1VCL A;  4Z9W B;  3FJA A;  1YF8 B;  3AH2 A;  2DRE A;  4G6M A;  4EFP A;  1BLD A;  3POK A;  1AFC A;  5EC5 A;  1WBA A;  4JP0 A;  1YYN A;  3HSM A;  4I1B A;  4ION A;  3LTQ A;  1S0E A;  4GOV A;  3N7J A;  2GZB A;  4I4Q A;  3OBT A;  2GO2 A;  2XOA A;  1DZD A;  2BEB A;  1W3F A;  2NZ9 A;  2D20 A;  3O4O A;  4LO1 A;  3WMU A;  1T4Q A;  3OBR A;  3P6I A;  2LIQ A;  1NZK A;  3P53 A;  1HCE A;  1EV2 A;  2Y9F A;  3AH4 A;  4OWJ A;  3WO4 A;  1N4K A;  5FNX A;  3BRD A;  3CAH A;  3KMV A;  3H6R B;  3FJC A;  4I0Y A;  3PME A;  2Z49 A;  3Q7Y A;  1FMM S;  2AQZ A;  3C9Z A;  4DEP A;  4IQP A;  1Z4S A;  4LO3 A;  1G9A A;  3VT1 A;  5BXP A;  3V0A B;  1YXW A;  1G9D A;  1TTU A;  2HZ9 A;  3BRG C;  5F8S A;  2AAI B;  4EEE B;  3HOM A;  4L4I A;  1ABR B;  2MIB A;  1ISX A;  1GGP B;  4H04 A;  4MZF B;  4P0K A;  4PC4 A;  1W3G A;  3ILA A;  4IY8 A;  1DQG A;  1EYL A;  4J2Y A;  4R6U B;  2DS0 A;  1IHK A;  3VEQ A;  3BA5 A;  4EFR A;  3A23 A;  3BAV A;  3UD7 A;  3OJV A;  3H6Q A;  5FZY A;  1HWO B;  31BI A;  3FJH A;  1K5V A;  3A07 A;  4GAF A;  3I29 B;  3BRF A;  3RSJ A;  3CRI A;  1Q04 A;  1YTO A;  5EHA A;  1PUM B;  4I4P A;  1BFB A;  4H9W A;  3N7M A;  4OWL A;  4OWK A;  4Q9G A;  1ISV A;  4EB2 B;  1PC8 B;  3UD9 A;  2ZR1 B;  3HBW A;  5DSS B;  3ZXG A;  1CE7 B;  1RG8 A;  2QYI B;  3D7W B;  4JKX B;  2D23 A;  4I7I A;  1M16 A;  2F2F C;  1R8O A;  3FJB A;  3FJJ A;  1Z0H A;  4JRA A;  1V6W A;  3NBC A;  3WA1 A;  4QKR A;  1G9C A;  1F31 A;  5D61 A;  3A21 A;  2YUG A;  4AN7 B;  4IY9 A;  4LO0 C;  1DFC A;  2NTD A;  2KKI A;  3NJ5 A;  4I37 A;  2K8R A;  1JQZ A;  3O4D A;  1E0O A;  3PHZ A;  2NP0 A;  1AXM A;  3AZV A;  1KNM A;  3NBN A;  1BFF A;  2FGF A;  4J2K A;  1FGA A;  4KC3 A;  1WBC A;  5FNW A;  4GP3 A;  3RTI B;  1JT5 A;  1IRA X;  1QXM A;  3WIN A;  1TWM A;  3AJ5 A;  1IIL A;  4ZA3 B;  4A7Z A;  1G82 A;  2KI4 A;  4END A;  5I1B A;  5E24 E;  4IZX A;  3O49 A;  4I4X A;  1PWA A;  3CRG A;  1DIW A;  5F90 A;  4A7Y A;  5BQU C;  3BTA A;  3FJ9 A;  2E4M C;  3JUT A;  41BI A;  4D0T A;  1ONK B;  3RMY A;  5FZU A;  3B9U A;  2MLL B;  1L2H A;  2F2F A;  2RST A;  3CU1 B;  2K4A B;  1SZ6 B;  1FQ9 A;  3FJD A;  2DRZ A;  5F8Y A;  1MC9 A;  4QO3 A;  2Y9W C;  2ET2 A;  4OW4 A;  4HA2 A;  4AN6 A;  1G9B A;  5G00 A;  1RY7 A;  1YBI A;  1ISZ A;  1V6X A;  3ZX7 A;  4LO0 A;  3H6R A;  3CA5 A;  2R9K B;  3IM7 A;  2KH2 A;  1BLA A;  3AKF A;  3NBD A;  2X2S A;  1ILR 1;  4LO8 B;  3UDA A;  2D24 A;  3V0A A;  3F62 B;  1I1B A;  3ZC9 A;  1DZC A;  1NUN A;  3CA6 A;  3WMV A;  5BXR A;  1M2T B;  3Q7W A;  5BOW A;  1ITB A;  2ERM A;  2D1Z A;  1EPW A;  3AKH A;  1DLL A;  1S0L A;  1AF9 A;  5D63 A;  1S0G A;  3NBE A;  3ZXD A;  3R4U A;  1HWP B;  4D8H A;  4Q91 A;  1I1E A;  3IIR A;  4ZLB B;  5DUY A;  3R4S A;  2IWT B;  1HWM B;  3VWC A;  4H75 A;  4OEF A;  4KEJ A;  4XFT A;  1UPS A;  2KI6 B;  4FVV A;  1DQO A;  1IJT A;  2M49 A;  5GAQ A;  4ISR A;  3CA3 A;  5F8W A;  1WD4 A;  4USP A;  1SR4 C;  4D0Z A;  1Q03 A;  2K43 A;  2L5X A;  4KEK A;  2BEA A;  1FWU A;  4OEG A;  3WO3 A;  4X37 A;  5BXS A;  3FJ8 A;  4J2S A;  3F1R A;  1BAS A;  4I3N A;  1TP0 A;  2FFV A;  4LO2 C;  3OJM A;  2D7I A;  3EF2 A;  2NVH A;  4IHZ A;  1IOB A;  1BFC A;  4I2S A;  5JMC A;  4P0J A;  3CA0 A;  3MPP G;  2Q3N B;  2DRY A;  4DCK C;  4USO A;  4KBB A;  3VT0 A;  1S0B A;  4ZFU B;  9ILB A;  2FFU A;  4GP0 A;  1JT3 A;  2AFG A;  2VU9 A;  4ZFW B;  2KLL A;  3HN1 A;  3CA1 A;  3CQA A;  5BP5 C;  4J2X A;  1K5U A;  4QD2 C;  1Z2V A;  3O44 A;  1TFM B;  3PUB A;  3RTJ B;  4JQ0 A;  2HW9 A;  2IHO A;  4X38 A;  1HIB A;  2ZQO A;  4F34 A;  2D7R A;  4FGF A;  3ZC8 A;  4LO7 C;  4XKI A;  2I1B A;  3WO2 A;  3AKI A;  3BB2 A;  2RQ9 A;  3V0B B;  1FWV A;  1FV2 A;  1AVA C;  1AVX B;  1Q1U A;  1AVU A;  3N7K A;  1V6U A;  2NS2 A;  3W9T A;  5DVH A;  5DZU A;  1RZO B;  1FN0 A;  3LLP A;  4ZKT B;  4LO1 C;  3MAL A;  4P0L A;  4GOY A;  5BVP I;  4QC4 A;  4ZFY B;  2BFH A;  3PG0 A;  4I6I A;  1S0F A;  1XHB A;  1II4 A;  3FJF A;  3OJ2 A;  4DEN A;  1IT0 A;  4I4R A;  4X39 A;  4IYB A;  4G9M A;  3IAG C;  3O4C A;  3BAO A;  2FDB M;  3Q7X A;  1XG6 A;  2D44 A;  3QR5 A;  2HWA A;  3FUO A;  4LO3 C;  3FFZ A;  1RML A;  4TLP A;  1JT4 A;  4HJJ A;  3VUO A;  1FMZ A;  4KEI A;  4QBV A;  4JAW A;  4ZOT A;  1EVT A;  2F8X C;  4EFQ A;  3OGF A;  1ISY A;  1XYF A;  3AH1 A;  1HKN A;  4WBC A;  1J0S A;  1DJS B;  2WRY A;  1BA7 A;  3V79 C;  2NM1 A;  4QD2 B;  4J23 B;  2Y9X E;  1HCD A;  1WD3 A;  4QAL A;  3FJE A;  3P6J A;  4G9N A;  4OUJ A;  1R8N A;  1FV3 A;  5BQU A;  3BA4 A;  4I4Y A;  2ZQN A;  4LO7 B;  4I96 A;  4II0 A;  2E4M A;  4ISQ A;  3BAH A;  5HPZ A;  1OQL B;  1QQL A;  4XFU A;  2WBC A;  1V6V A;  1TWE A;  3AKG A;  4P6A A;  3BX1 C;  2FO1 A;  4X3A A;  2RG9 B;  4A7K A;  4I1E A;  1CVS A;  5BXT A;  3IM6 A;  3E8L C;  1AVW B;  4GAI A;  2ESU A;  3VSF A;  1DFQ A;  3VSZ A;  3HMY A;  1TIE A;  1XZZ A;  3O3Q A;  4I4V A;  3VT2 A;  4UY4 A;  1JLX A;  3RMX A;  2X2T A;  2P39 A;  3O5W B;  4OEE A;  1A8D A;  3FUQ A;  3S8K A;  3BAU A;  1PZZ A;  3SNV A;  4JKQ A;  4ZBV B;  1ISW A;  1QQK A;  3WIN C;  5EG6 C;  2AXM A;  1W3A A;  2VSE A;  3JRR A;  2VSA A;  4I4O A;  3CA4 A;  8I1B A;  3BAQ A;  2VLC A;  4MZG B;  3UD8 A;  1P63 A;  21BI A;  2D22 A;  5D62 A;  1JLY A;  4JPZ A;  1TOO A;  3V0B A;  3HAL A;  5JLV A;  3H6S E;  4HR6 C;  3O4B A;  1S0D A;  4G6J A;  3UJ4 A;  4EKX B;  1S0C A;  3BAD A;  3A22 A;  5FZZ A;  1D0H A;  4MZH A;  3BAG A;  1MD6 A;  3IM5 A;  1PUU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...