4HA2A

Crystal structure ofa phenyl alanine 91 mutant of wci
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
176
structure length
174
Chain Sequence
DDLVDAEGNLVENGGTYYLLPHIWAHGGGIETAKTGNEPCPLTVVRSPNEVSKGEPIRISSQFLSLFIPRGSLVALGFANPPSCAASPWFTVVDSPQGPAVKLSQQKLPEKDALVFKFEKVSHSNIHVYKLLYCQHDEVKCDQYIGIHRDRNGNRRLVVTEENPLELVLLKAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Chymotrypsin inhibitor 3
publication title A conserved tryptophan (W91) at the barrel-lid junction modulates the packing and stability of Kunitz (STI) family of inhibitors.
pubmed doi rcsb
source organism Psophocarpus tetragonolobus
molecule tags Hydrolase inhibitor
total genus 29
structure length 174
sequence length 176
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4ha2A00
1YBIA 2I1BA 4P6AA 4I4XA 3HOMA 1IILA 4LO7C 1DZDA 3RTJB 1JLYA 3WINC 1IRAX 1FV3A 1AFCA 3FJ8A 5G00A 3FJHA 2Y9WC 2AAIB 3AKGA 3H6RB 1I1EA 1XHBA 4OWKA 4IYBA 3JRRA 5BXTA 3R4SA 3W9TA 4ZA3B 2D43A 3CA5A 4QBCA 1F31A 3KMVA 1HCDA 4GAFA 3CA3A 5BP5A 3WO3A 1AF9A 2RQ9A 3FJCA 3V0BB 4HR6C 4GP0A 4WBCA 3AKHA 1KNMA 4QC4A 2NVHA 4I4QA 3AH1A 1YYNA 4LO3A 3VSFA 4LO7B 3N0KA 1DQOA 4ISRA 4LO0A 3EF2A 4LO1C 2DRYA 3V0AA 4LO2C 1BASA 1QQKA 3RMYA 1ONKB 3VEQA 5BXPA 1AVUA 4L4IA 2NTDA 3PHZA 3CRIA 4ZFWB 1JT7A 1DLLA 4I6IA 3E8LC 1S0GA 1TWMA 1PUMB 1G9AA 2RG9B 2MIBA 3FUOA 5F8YA 3CRHA 3CA0A 2D23A 1W3AA 3UD8A 2BFHA 1EPWA 3FJBA 1JTCA 4QKSA 4I4PA 5HPZA 2Q3NB 4I4OA 3FJDA 3MALA 1BLAA 3IM7A 3BTAA 2VSEA 2D44A 3LLPA 3RTIB 3C9ZA 3Q7YA 5BXSA 3OJVA 2AXMA 3BAGA 3VT2A 2VXRA 3RSJA 3CQAA 2DS0A 4XFSA 5BQUA 3FJAA 3OBRA 1V6XA 1V6WA 2VXTI 1ITBA 2NZ9A 4ISQA 3OJ2A 1IJTA 4IQPA 4P0LA 1K5VA 4G9NA 2HW9A 1IRPA 3BA7A 4GOVA 1S0EA 2KKIA 1MC9A 1S0DA 3BRDA 2VU9A 2FO1A 3AJ6A 4KBBA 1DJSB 2WBCA 1EVTA 1S0FA 1XZZA 3HSMA 1IOBA 3NJ5A 1ISZA 1PWAA 4JP0A 2K43A 3FFZA 3UJ4A 3WO4A 5I1BA 2P39A 9ILBA 5JLVA 1R8NA 4Z9WB 2E4MC 2RSTA 1HWPB 1BA7A 3A23A 2X2TA 1A8DA 1JT5A 3F62B 4IHZA 1SR4A 3I29B 1S0CA 3A22A 4FVVA 4FGFA 3BRGC 1E0OA 2IHOA 1MD6A 3ZXDA 3O44A 3FJJA 1DQGA 4I96A 2K8RA 1DFCA 4IZEA 6I1BA 2D7RA 3S8JA 3ZX7A 1W3GA 2J3PA 4I1EA 3O4DA 3CA6A 3O4CA 3B9UA 3BB2A 3FJ9A 3FJIA 4JPZA 3IIRA 4OWLA 3ZC8A 4H04A 2KI4A 1JLXA 5F90A 3BRFA 1IHKA 4KEJA 2Z49A 1JT4A 2D20A 5B2HA 4ZFUB 1ILR1 4ENDA 1IT0A 4D8HA 1TFMB 1YF8B 3SNVA 2NYYA 4I3NA 4Q9GA 4EKXB 2F8XC 1DZCA 2DREA 4ZLBB 2FGFA 2FFUA 5BP5C 2F2FC 3N7KA 4OUJA 1T4QA 1Z4SA 3UJ0A 3WMVA 3TC2A 1M2TB 4J2KA 4IY8A 4KEIA 3CA4A 4DEPA 3AH2A 3I2XA 3CRGA 5EHAA 2FFVA 1OQLB 1XG6A 4LO0C 5D63A 3FGMA 1WD3A 4QD2B 5BXRA 2GZBA 4ZGRB 3FJFA 1FGAA 4XFUA 1BFCA 2VUAA 5JMCA 4OW4A 3P53A 3PUBA 4G6MA 3VSZA 4F83A 1JT3A 1FN0A 1DIWA 4J2YA 2QN4A 4QKRA 1M16A 3BA5A 2Y9XE 5FZZA 1Q1UA 4LO2A 4JAWA 1RY7A 3AJ5A 5D62A 1WD4A 3BA4A 1J0SA 4II0A 2M49A 2Y9FA 3WA1A 1TIEA 5E24E 4IONA 5BQUC 5DSSB 1WBCA 5FZUA 4QO3A 4Z8SB 1HIBA 1FV2A 3T8SA 3V0AB 4F34A 2NM1A 4XKIA 2Y9GA 4ZBVB 5FNXA 1TP0A 1FWUA 3F1RA 2LIQA 2ESUA 2ZR1B 4QBVA 3AZWA 1S0LA 5FNWA 1JQZA 2Z48A 1TTUA 3Q7XA 2BEAA 5F8WA 4ZOTA 2DRZA 3IM5A 2Q9XA 1QQLA 4EFQA 5EC5A 3CA1A 2P23A 4HJJA 4A7KA 1PC8B 4J2SA 3Q7WA 3OBTA 3PMEA 3VT0A 4JRAA 3HN1A 1XYFA 4DCKC 3BADA 4HA2A 2D1ZA 3UDAA 1TOOA 1VCLA 4P0JA 3H6QA 3BAVA 3QYDA 1L2HA 1G82A 1ABRB 3P6IA 3V79C 3WMUA 4JQ0A 1V6VA 1NZKA 1HCEA 4G1RA 4ZFYB 1EV2A 4AN6A 3H6RA 1FMMS 4I8MA 4I4UA 5D61A 4ZKTB 3AKFA 2KLLA 2D22A 1FMZA 2E4MA 3NBCA 1G9BA 3HBWA 4L4HA 2VLCA 4QD2C 3O4OA 3HMYA 3D7WB 3VT1A 2ZQNA 1G9CA 4LO8B 3V0BA 3O4BA 2R9KB 4Q9PA 4EEEB 4D0TA 3O3QA 1RG8A 1PZZA 4G9MA 2MC2A 3ZC9A 1TWEA 2WRYA 1FWVA 3ZXGA 1ISYA 1GGPB 1BFGA 8I1BA 3WINA 4DENA 3O5WB 3FUQA 1BFBA 3CAHA 1NUNA 3VWCA 1RMLA 4GP3A 1UPSA 1HWMB 4GAIA 4Q91A 4QALA 4LO3C 2K4AB 4I4YA 3PG0A 5DUYA 1BARA 2AQZA 3OGGA 4I7IA 1CE7B 3OGFA 3POKA 1N4KA 4A7YA 2IWTB 4IZXA 2F2FA 4CJMA 3A21A 2BEBA 2HZ9A 3BX1C 1AVAC 2MLLB 1R8OA 2FDBM 4OEEA 3N7JA 1II4A 3NBNA 4USPA 3NBEA 41BIA 4AN7B 4A7ZA 1SZ6B 4PC4A 3UD9A 4LO1A 2QYIB 3JUTA 4I1BA 3VUOA 3BAOA 4EB2B 1EYLA 3S8KA 2LIEA 1K5UA 5DZUA 4EFPA 2HWMA 2AFGA 4OEFA 1S0BA 1QXMA 4I37A 4J2XA 2HWAA 4TLPA 3H6SE 2KI6B 3ILAA 4R6UB 2ZQOA 3LTQA 1Q03A 3CU1B 3WO2A 3R4UA 1HKNA 5DVHA 5BOWA 1BLDA 3FJKA 4EFRA 2NP0A 1DFQA 1HWOB 7I1BA 3HALA 3O4AA 2ET2A 1FQ9A 3P6JA 3BAHA 4J23B 1Z2VA 3N7LA 1Z0HA 1HWNB 3IAGC 2GO2A 2KH2A 3I2AA 3BAQA 4P0KA 4X39A 3AH4A 4USOA 4I2SA 1D0HA 4KEKA 3A07A 5GAQA 3IM6A 2XOAA 2ERMA 1W3FA 1SR4C 1I1BA 1RZOB 1JY0A 4G6JA 4GOYA 3UD7A 3FJEA 2VSAA 1YXWA 1G9DA 3K1XA 4OEGA 5BVPI 3OJMA 3BAUA 3RMXA 21BIA 1V6UA 4I4VA 2UUSA 4JKQA 1ISWA 4I0YA 4IY9A 1P63A 4YOLA 4JKXB 5EG6C 4I4SA 1PUUB 4H9WA 4I4RA 5F8SA 1AXMA 2D7IA 4X3AA 1YTOA 2D24A 3NBDA 1BFFA 1Q04A 3O49A 31BIA 2YUGA 3QR5A 4X38A 3AZVA 1CVSA 4D0ZA 4KC3A 3N7MA 1ISXA 1T9FA 4X37A 3MPPG 1AVWB 1WBAA 2X2SA 4XFTA 1ISVA 2L5XA 3AKIA 4OWJA 5FZYA 1AVXB
chains in the Genus database with same CATH superfamily
1YBIA 2I1BA 4P6AA 4I4XA 3HOMA 1IILA 4LO7C 1DZDA 3RTJB 1JLYA 3WINC 1IRAX 1FV3A 1AFCA 3FJ8A 5G00A 3FJHA 2Y9WC 2AAIB 3AKGA 3H6RB 1I1EA 1XHBA 4OWKA 4IYBA 3JRRA 5BXTA 3R4SA 3W9TA 4ZA3B 2D43A 3CA5A 4QBCA 1F31A 3KMVA 1HCDA 4GAFA 3CA3A 5BP5A 3WO3A 1AF9A 2RQ9A 3FJCA 3V0BB 4HR6C 4GP0A 4WBCA 3AKHA 1KNMA 4QC4A 2NVHA 4I4QA 3AH1A 1YYNA 4LO3A 3VSFA 4LO7B 3N0KA 1DQOA 4ISRA 4LO0A 3EF2A 4LO1C 2DRYA 3V0AA 4LO2C 1BASA 1QQKA 3RMYA 1ONKB 3VEQA 5BXPA 1AVUA 4L4IA 2NTDA 3PHZA 3CRIA 4ZFWB 1JT7A 1DLLA 4I6IA 3E8LC 1S0GA 1TWMA 1PUMB 1G9AA 2RG9B 2MIBA 3FUOA 5F8YA 3CRHA 3CA0A 2D23A 1W3AA 3UD8A 2BFHA 1EPWA 3FJBA 1JTCA 4QKSA 4I4PA 5HPZA 2Q3NB 4I4OA 3FJDA 3MALA 1BLAA 3IM7A 3BTAA 2VSEA 2D44A 3LLPA 3RTIB 3C9ZA 3Q7YA 5BXSA 3OJVA 2AXMA 3BAGA 3VT2A 2VXRA 3RSJA 3CQAA 2DS0A 4XFSA 5BQUA 3FJAA 3OBRA 1V6XA 1V6WA 2VXTI 1ITBA 2NZ9A 4ISQA 3OJ2A 1IJTA 4IQPA 4P0LA 1K5VA 4G9NA 2HW9A 1IRPA 3BA7A 4GOVA 1S0EA 2KKIA 1MC9A 1S0DA 3BRDA 2VU9A 2FO1A 3AJ6A 4KBBA 1DJSB 2WBCA 1EVTA 1S0FA 1XZZA 3HSMA 1IOBA 3NJ5A 1ISZA 1PWAA 4JP0A 2K43A 3FFZA 3UJ4A 3WO4A 5I1BA 2P39A 9ILBA 5JLVA 1R8NA 4Z9WB 2E4MC 2RSTA 1HWPB 1BA7A 3A23A 2X2TA 1A8DA 1JT5A 3F62B 4IHZA 1SR4A 3I29B 1S0CA 3A22A 4FVVA 4FGFA 3BRGC 1E0OA 2IHOA 1MD6A 3ZXDA 3O44A 3FJJA 1DQGA 4I96A 2K8RA 1DFCA 4IZEA 6I1BA 2D7RA 3S8JA 3ZX7A 1W3GA 2J3PA 4I1EA 3O4DA 3CA6A 3O4CA 3B9UA 3BB2A 3FJ9A 3FJIA 4JPZA 3IIRA 4OWLA 3ZC8A 4H04A 2KI4A 1JLXA 5F90A 3BRFA 1IHKA 4KEJA 2Z49A 1JT4A 2D20A 5B2HA 4ZFUB 1ILR1 4ENDA 1IT0A 4D8HA 1TFMB 1YF8B 4MZHA 3SNVA 2NYYA 4I3NA 4Q9GA 4EKXB 2F8XC 1DZCA 2DREA 4ZLBB 2FGFA 2FFUA 5BP5C 2F2FC 3N7KA 4OUJA 1T4QA 1Z4SA 3UJ0A 3WMVA 3TC2A 1M2TB 4J2KA 4IY8A 4KEIA 3CA4A 4DEPA 3AH2A 3I2XA 3CRGA 5EHAA 2FFVA 1OQLB 1XG6A 4LO0C 5D63A 3FGMA 1WD3A 4QD2B 5BXRA 2GZBA 4ZGRB 3FJFA 1FGAA 4XFUA 1BFCA 2VUAA 5JMCA 4OW4A 3P53A 3PUBA 4G6MA 3VSZA 4F83A 1JT3A 1FN0A 1DIWA 4J2YA 2QN4A 4QKRA 1M16A 3BA5A 2Y9XE 4UY4A 5FZZA 1Q1UA 4LO2A 4JAWA 1RY7A 3AJ5A 5D62A 1WD4A 3BA4A 1J0SA 4II0A 2M49A 2Y9FA 3WA1A 1TIEA 5E24E 4IONA 5BQUC 5DSSB 1WBCA 5FZUA 4QO3A 4Z8SB 1HIBA 1FV2A 3T8SA 3V0AB 4F34A 2NM1A 4XKIA 2Y9GA 4ZBVB 5FNXA 1TP0A 1FWUA 3F1RA 2LIQA 2ESUA 2ZR1B 4QBVA 3AZWA 1S0LA 5FNWA 1JQZA 2Z48A 1TTUA 3Q7XA 2BEAA 5F8WA 4ZOTA 2DRZA 3IM5A 2Q9XA 4H75A 1QQLA 4EFQA 5EC5A 3CA1A 2P23A 4HJJA 4A7KA 1PC8B 4J2SA 3Q7WA 3OBTA 3PMEA 3VT0A 4JRAA 3HN1A 1XYFA 4DCKC 3BADA 4HA2A 2D1ZA 2NS2A 3UDAA 1TOOA 1VCLA 4P0JA 3H6QA 3BAVA 3QYDA 1L2HA 1G82A 1ABRB 3P6IA 3V79C 3WMUA 4JQ0A 1V6VA 1NZKA 1HCEA 4G1RA 4ZFYB 1EV2A 4AN6A 3H6RA 1FMMS 4I8MA 4I4UA 5D61A 4ZKTB 3AKFA 2KLLA 2D22A 1FMZA 2E4MA 3NBCA 1G9BA 3HBWA 4L4HA 2VLCA 4QD2C 3O4OA 3HMYA 3D7WB 3VT1A 2ZQNA 1G9CA 4LO8B 3V0BA 3O4BA 2R9KB 4Q9PA 4EEEB 4D0TA 3O3QA 1RG8A 1PZZA 4G9MA 2MC2A 3ZC9A 1TWEA 2WRYA 1FWVA 3ZXGA 1ISYA 1GGPB 1BFGA 8I1BA 3WINA 4DENA 3O5WB 3FUQA 1BFBA 3CAHA 1NUNA 3VWCA 1RMLA 4GP3A 1UPSA 1HWMB 4GAIA 4Q91A 4QALA 4LO3C 2K4AB 4I4YA 3PG0A 5DUYA 1BARA 2AQZA 3OGGA 4I7IA 1CE7B 3OGFA 3POKA 1N4KA 4A7YA 2IWTB 4IZXA 2F2FA 4CJMA 3A21A 2BEBA 2HZ9A 3BX1C 1AVAC 2MLLB 1R8OA 2FDBM 4OEEA 3N7JA 1II4A 3NBNA 4USPA 3NBEA 41BIA 4AN7B 4A7ZA 1SZ6B 4PC4A 3UD9A 4LO1A 2QYIB 3JUTA 4I1BA 3VUOA 3BAOA 4EB2B 1EYLA 3S8KA 2LIEA 1K5UA 4MZGB 5DZUA 4EFPA 2HWMA 2AFGA 4OEFA 1S0BA 1QXMA 4I37A 4J2XA 2HWAA 4TLPA 3H6SE 2KI6B 3ILAA 4R6UB 2ZQOA 3LTQA 1Q03A 3CU1B 3WO2A 3R4UA 1HKNA 5DVHA 5BOWA 1BLDA 3FJKA 4EFRA 2NP0A 1DFQA 1HWOB 7I1BA 3HALA 3O4AA 2ET2A 1FQ9A 3P6JA 3BAHA 4J23B 1Z2VA 3N7LA 1Z0HA 1HWNB 3IAGC 2GO2A 2KH2A 3I2AA 3BAQA 4P0KA 4X39A 3AH4A 4USOA 4I2SA 1D0HA 4KEKA 3A07A 5GAQA 3IM6A 2XOAA 2ERMA 1W3FA 1SR4C 1I1BA 1RZOB 1JY0A 4G6JA 4GOYA 3UD7A 3FJEA 2VSAA 1YXWA 1G9DA 3K1XA 4OEGA 5BVPI 3OJMA 3BAUA 3RMXA 21BIA 1V6UA 4I4VA 2UUSA 4JKQA 1ISWA 4I0YA 4IY9A 1P63A 4YOLA 4JKXB 5EG6C 4I4SA 1PUUB 4H9WA 4I4RA 5F8SA 1AXMA 2D7IA 4X3AA 1YTOA 2D24A 3NBDA 1BFFA 1Q04A 3O49A 31BIA 2YUGA 3QR5A 4X38A 3AZVA 1CVSA 4D0ZA 4KC3A 3N7MA 1ISXA 1T9FA 4X37A 3MPPG 1AVWB 1WBAA 2X2SA 4XFTA 4MZFB 1ISVA 2L5XA 3AKIA 4OWJA 5FZYA 1AVXB
chains in the Genus database with same CATH topology
1YBIA 2I1BA 4P6AA 4I4XA 3HOMA 1IILA 4LO7C 1DZDA 3RTJB 1JLYA 3WINC 1IRAX 1FV3A 1AFCA 3FJ8A 5G00A 3FJHA 2Y9WC 2AAIB 3AKGA 3H6RB 1I1EA 1XHBA 4OWKA 4IYBA 3JRRA 5BXTA 3R4SA 3W9TA 4ZA3B 2D43A 3CA5A 4QBCA 1F31A 3KMVA 1HCDA 4GAFA 3CA3A 5BP5A 3WO3A 1AF9A 2RQ9A 3FJCA 3V0BB 4HR6C 4GP0A 4WBCA 3AKHA 1KNMA 4QC4A 2NVHA 4I4QA 3AH1A 1YYNA 4LO3A 3VSFA 4LO7B 3N0KA 1DQOA 4ISRA 4LO0A 3EF2A 4LO1C 2DRYA 3V0AA 4LO2C 1BASA 1QQKA 3RMYA 1ONKB 3VEQA 5BXPA 1AVUA 4L4IA 2NTDA 3PHZA 3CRIA 4ZFWB 1JT7A 1DLLA 4I6IA 3E8LC 1S0GA 1TWMA 1PUMB 1G9AA 2RG9B 2MIBA 3FUOA 5F8YA 3CRHA 3CA0A 2D23A 1W3AA 3UD8A 2BFHA 1EPWA 3FJBA 1JTCA 4QKSA 4I4PA 5HPZA 2Q3NB 4I4OA 3FJDA 3MALA 1BLAA 3IM7A 3BTAA 2VSEA 2D44A 3LLPA 3RTIB 3C9ZA 3Q7YA 5BXSA 3OJVA 2AXMA 3BAGA 3VT2A 2VXRA 3RSJA 3CQAA 2DS0A 4XFSA 5BQUA 3FJAA 3OBRA 1V6XA 1V6WA 2VXTI 1ITBA 2NZ9A 4ISQA 3OJ2A 1IJTA 4IQPA 4P0LA 1K5VA 4G9NA 2HW9A 1IRPA 3BA7A 4GOVA 1S0EA 2KKIA 1MC9A 1S0DA 3BRDA 2VU9A 2FO1A 3AJ6A 4KBBA 1DJSB 2WBCA 1EVTA 1S0FA 1XZZA 3HSMA 1IOBA 3NJ5A 1ISZA 1PWAA 4JP0A 2K43A 3FFZA 3UJ4A 3WO4A 5I1BA 2P39A 9ILBA 5JLVA 1R8NA 4Z9WB 2E4MC 2RSTA 1HWPB 1BA7A 3A23A 2X2TA 1A8DA 1JT5A 3F62B 4IHZA 1SR4A 3I29B 1S0CA 3A22A 4FVVA 4FGFA 3BRGC 1E0OA 2IHOA 1MD6A 3ZXDA 3O44A 3FJJA 1DQGA 4I96A 2K8RA 1DFCA 4IZEA 6I1BA 2D7RA 3S8JA 3ZX7A 1W3GA 2J3PA 4I1EA 3O4DA 3CA6A 3O4CA 3B9UA 3BB2A 3FJ9A 3FJIA 4JPZA 3IIRA 4OWLA 3ZC8A 4H04A 2KI4A 1JLXA 5F90A 3BRFA 1IHKA 4KEJA 2Z49A 1JT4A 2D20A 5B2HA 4ZFUB 1ILR1 4ENDA 1IT0A 4D8HA 1TFMB 1YF8B 4MZHA 3SNVA 2NYYA 4I3NA 4Q9GA 4EKXB 2F8XC 1DZCA 2DREA 4ZLBB 2FGFA 2FFUA 5BP5C 2F2FC 3N7KA 4OUJA 1T4QA 1Z4SA 3UJ0A 3WMVA 3TC2A 1M2TB 4J2KA 4IY8A 4KEIA 3CA4A 4DEPA 3AH2A 3I2XA 3CRGA 5EHAA 2FFVA 1OQLB 1XG6A 4LO0C 5D63A 3FGMA 1WD3A 4QD2B 5BXRA 2GZBA 4ZGRB 3FJFA 1FGAA 4XFUA 1BFCA 2VUAA 5JMCA 4OW4A 3P53A 3PUBA 4G6MA 3VSZA 4F83A 1JT3A 1FN0A 1DIWA 4J2YA 2QN4A 4QKRA 1M16A 3BA5A 2Y9XE 4UY4A 5FZZA 1Q1UA 4LO2A 4JAWA 1RY7A 3AJ5A 5D62A 1WD4A 3BA4A 1J0SA 4II0A 2M49A 2Y9FA 3WA1A 1TIEA 5E24E 4IONA 5BQUC 5DSSB 1WBCA 5FZUA 4QO3A 4Z8SB 1HIBA 1FV2A 3T8SA 3V0AB 4F34A 2NM1A 4XKIA 2Y9GA 4ZBVB 5FNXA 1TP0A 1FWUA 3F1RA 2LIQA 2ESUA 2ZR1B 4QBVA 3AZWA 1S0LA 5FNWA 1JQZA 2Z48A 1TTUA 3Q7XA 2BEAA 5F8WA 4ZOTA 2DRZA 3IM5A 2Q9XA 4H75A 1QQLA 4EFQA 5EC5A 3CA1A 2P23A 4HJJA 4A7KA 1PC8B 4J2SA 3Q7WA 3OBTA 3PMEA 3VT0A 4JRAA 3HN1A 1XYFA 4DCKC 3BADA 4HA2A 2D1ZA 2NS2A 3UDAA 1TOOA 1VCLA 4P0JA 3H6QA 3BAVA 3QYDA 1L2HA 1G82A 1ABRB 3P6IA 3V79C 3WMUA 4JQ0A 1V6VA 1NZKA 1HCEA 4G1RA 4ZFYB 1EV2A 4AN6A 3H6RA 1FMMS 4I8MA 4I4UA 5D61A 4ZKTB 3AKFA 2KLLA 2D22A 1FMZA 2E4MA 3NBCA 1G9BA 3HBWA 4L4HA 2VLCA 4QD2C 3O4OA 3HMYA 3D7WB 3VT1A 2ZQNA 1G9CA 4LO8B 3V0BA 3O4BA 2R9KB 4Q9PA 4EEEB 4D0TA 3O3QA 1RG8A 1PZZA 4G9MA 2MC2A 3ZC9A 1TWEA 2WRYA 1FWVA 3ZXGA 1ISYA 1GGPB 1BFGA 8I1BA 3WINA 4DENA 3O5WB 3FUQA 1BFBA 3CAHA 1NUNA 3VWCA 1RMLA 4GP3A 1UPSA 1HWMB 4GAIA 4Q91A 4QALA 4LO3C 2K4AB 4I4YA 3PG0A 5DUYA 1BARA 2AQZA 3OGGA 4I7IA 1CE7B 3OGFA 3POKA 1N4KA 4A7YA 2IWTB 4IZXA 2F2FA 4CJMA 3A21A 2BEBA 2HZ9A 3BX1C 1AVAC 2MLLB 1R8OA 2FDBM 4OEEA 3N7JA 1II4A 3NBNA 4USPA 3NBEA 41BIA 4AN7B 4A7ZA 1SZ6B 4PC4A 3UD9A 4LO1A 2QYIB 3JUTA 4I1BA 3VUOA 3BAOA 4EB2B 1EYLA 3S8KA 2LIEA 1K5UA 4MZGB 5DZUA 4EFPA 2HWMA 2AFGA 4OEFA 1S0BA 1QXMA 4I37A 4J2XA 2HWAA 4TLPA 3H6SE 2KI6B 3ILAA 4R6UB 2ZQOA 3LTQA 1Q03A 3CU1B 3WO2A 3R4UA 1HKNA 5DVHA 5BOWA 1BLDA 3FJKA 4EFRA 2NP0A 1DFQA 1HWOB 7I1BA 3HALA 3O4AA 2ET2A 1FQ9A 3P6JA 3BAHA 4J23B 1Z2VA 3N7LA 1Z0HA 1HWNB 3IAGC 2GO2A 2KH2A 3I2AA 3BAQA 4P0KA 4X39A 3AH4A 4USOA 4I2SA 1D0HA 4KEKA 3A07A 5GAQA 3IM6A 2XOAA 2ERMA 1W3FA 1SR4C 1I1BA 1RZOB 1JY0A 4G6JA 4GOYA 3UD7A 3FJEA 2VSAA 1YXWA 1G9DA 3K1XA 4OEGA 5BVPI 3OJMA 3BAUA 3RMXA 21BIA 1V6UA 4I4VA 2UUSA 4JKQA 1ISWA 4I0YA 4IY9A 1P63A 4YOLA 4JKXB 5EG6C 4I4SA 1PUUB 4H9WA 4I4RA 5F8SA 1AXMA 2D7IA 4X3AA 1YTOA 2D24A 3NBDA 1BFFA 1Q04A 3O49A 31BIA 2YUGA 3QR5A 4X38A 3AZVA 1CVSA 4D0ZA 4KC3A 3N7MA 1ISXA 1T9FA 4X37A 3MPPG 1AVWB 1WBAA 2X2SA 4XFTA 4MZFB 1ISVA 2L5XA 3AKIA 4OWJA 5FZYA 1AVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YBI A;  2I1B A;  4P6A A;  4I4X A;  3HOM A;  1IIL A;  4LO7 C;  1DZD A;  3RTJ B;  1JLY A;  3WIN C;  1IRA X;  1FV3 A;  1AFC A;  3FJ8 A;  5G00 A;  3FJH A;  2Y9W C;  2AAI B;  3AKG A;  3H6R B;  1I1E A;  1XHB A;  4OWK A;  4IYB A;  3JRR A;  5BXT A;  3R4S A;  3W9T A;  4ZA3 B;  2D43 A;  3CA5 A;  4QBC A;  1F31 A;  3KMV A;  1HCD A;  4GAF A;  3CA3 A;  5BP5 A;  3WO3 A;  1AF9 A;  2RQ9 A;  3FJC A;  3V0B B;  4HR6 C;  4GP0 A;  4WBC A;  3AKH A;  1KNM A;  4QC4 A;  2NVH A;  4I4Q A;  3AH1 A;  1YYN A;  4LO3 A;  3VSF A;  4LO7 B;  3N0K A;  1DQO A;  4ISR A;  4LO0 A;  3EF2 A;  4LO1 C;  2DRY A;  3V0A A;  4LO2 C;  1BAS A;  1QQK A;  3RMY A;  1ONK B;  3VEQ A;  5BXP A;  1AVU A;  4L4I A;  2NTD A;  3PHZ A;  3CRI A;  4ZFW B;  1JT7 A;  1DLL A;  4I6I A;  3E8L C;  1S0G A;  1TWM A;  1PUM B;  1G9A A;  2RG9 B;  2MIB A;  3FUO A;  5F8Y A;  3CRH A;  3CA0 A;  2D23 A;  1W3A A;  3UD8 A;  2BFH A;  1EPW A;  3FJB A;  1JTC A;  4QKS A;  4I4P A;  5HPZ A;  2Q3N B;  4I4O A;  3FJD A;  3MAL A;  1BLA A;  3IM7 A;  3BTA A;  2VSE A;  2D44 A;  3LLP A;  3RTI B;  3C9Z A;  3Q7Y A;  5BXS A;  3OJV A;  2AXM A;  3BAG A;  3VT2 A;  2VXR A;  3RSJ A;  3CQA A;  2DS0 A;  4XFS A;  5BQU A;  3FJA A;  3OBR A;  1V6X A;  1V6W A;  2VXT I;  1ITB A;  2NZ9 A;  4ISQ A;  3OJ2 A;  1IJT A;  4IQP A;  4P0L A;  1K5V A;  4G9N A;  2HW9 A;  1IRP A;  3BA7 A;  4GOV A;  1S0E A;  2KKI A;  1MC9 A;  1S0D A;  3BRD A;  2VU9 A;  2FO1 A;  3AJ6 A;  4KBB A;  1DJS B;  2WBC A;  1EVT A;  1S0F A;  1XZZ A;  3HSM A;  1IOB A;  3NJ5 A;  1ISZ A;  1PWA A;  4JP0 A;  2K43 A;  3FFZ A;  3UJ4 A;  3WO4 A;  5I1B A;  2P39 A;  9ILB A;  5JLV A;  1R8N A;  4Z9W B;  2E4M C;  2RST A;  1HWP B;  1BA7 A;  3A23 A;  2X2T A;  1A8D A;  1JT5 A;  3F62 B;  4IHZ A;  1SR4 A;  3I29 B;  1S0C A;  3A22 A;  4FVV A;  4FGF A;  3BRG C;  1E0O A;  2IHO A;  1MD6 A;  3ZXD A;  3O44 A;  3FJJ A;  1DQG A;  4I96 A;  2K8R A;  1DFC A;  4IZE A;  6I1B A;  2D7R A;  3S8J A;  3ZX7 A;  1W3G A;  2J3P A;  4I1E A;  3O4D A;  3CA6 A;  3O4C A;  3B9U A;  3BB2 A;  3FJ9 A;  3FJI A;  4JPZ A;  3IIR A;  4OWL A;  3ZC8 A;  4H04 A;  2KI4 A;  1JLX A;  5F90 A;  3BRF A;  1IHK A;  4KEJ A;  2Z49 A;  1JT4 A;  2D20 A;  5B2H A;  4ZFU B;  1ILR 1;  4END A;  1IT0 A;  4D8H A;  1TFM B;  1YF8 B;  3SNV A;  2NYY A;  4I3N A;  4Q9G A;  4EKX B;  2F8X C;  1DZC A;  2DRE A;  4ZLB B;  2FGF A;  2FFU A;  5BP5 C;  2F2F C;  3N7K A;  4OUJ A;  1T4Q A;  1Z4S A;  3UJ0 A;  3WMV A;  3TC2 A;  1M2T B;  4J2K A;  4IY8 A;  4KEI A;  3CA4 A;  4DEP A;  3AH2 A;  3I2X A;  3CRG A;  5EHA A;  2FFV A;  1OQL B;  1XG6 A;  4LO0 C;  5D63 A;  3FGM A;  1WD3 A;  4QD2 B;  5BXR A;  2GZB A;  4ZGR B;  3FJF A;  1FGA A;  4XFU A;  1BFC A;  2VUA A;  5JMC A;  4OW4 A;  3P53 A;  3PUB A;  4G6M A;  3VSZ A;  4F83 A;  1JT3 A;  1FN0 A;  1DIW A;  4J2Y A;  2QN4 A;  4QKR A;  1M16 A;  3BA5 A;  2Y9X E;  5FZZ A;  1Q1U A;  4LO2 A;  4JAW A;  1RY7 A;  3AJ5 A;  5D62 A;  1WD4 A;  3BA4 A;  1J0S A;  4II0 A;  2M49 A;  2Y9F A;  3WA1 A;  1TIE A;  5E24 E;  4ION A;  5BQU C;  5DSS B;  1WBC A;  5FZU A;  4QO3 A;  4Z8S B;  1HIB A;  1FV2 A;  3T8S A;  3V0A B;  4F34 A;  2NM1 A;  4XKI A;  2Y9G A;  4ZBV B;  5FNX A;  1TP0 A;  1FWU A;  3F1R A;  2LIQ A;  2ESU A;  2ZR1 B;  4QBV A;  3AZW A;  1S0L A;  5FNW A;  1JQZ A;  2Z48 A;  1TTU A;  3Q7X A;  2BEA A;  5F8W A;  4ZOT A;  2DRZ A;  3IM5 A;  2Q9X A;  1QQL A;  4EFQ A;  5EC5 A;  3CA1 A;  2P23 A;  4HJJ A;  4A7K A;  1PC8 B;  4J2S A;  3Q7W A;  3OBT A;  3PME A;  3VT0 A;  4JRA A;  3HN1 A;  1XYF A;  4DCK C;  3BAD A;  4HA2 A;  2D1Z A;  3UDA A;  1TOO A;  1VCL A;  4P0J A;  3H6Q A;  3BAV A;  3QYD A;  1L2H A;  1G82 A;  1ABR B;  3P6I A;  3V79 C;  3WMU A;  4JQ0 A;  1V6V A;  1NZK A;  1HCE A;  4G1R A;  4ZFY B;  1EV2 A;  4AN6 A;  3H6R A;  1FMM S;  4I8M A;  4I4U A;  5D61 A;  4ZKT B;  3AKF A;  2KLL A;  2D22 A;  1FMZ A;  2E4M A;  3NBC A;  1G9B A;  3HBW A;  4L4H A;  2VLC A;  4QD2 C;  3O4O A;  3HMY A;  3D7W B;  3VT1 A;  2ZQN A;  1G9C A;  4LO8 B;  3V0B A;  3O4B A;  2R9K B;  4Q9P A;  4EEE B;  4D0T A;  3O3Q A;  1RG8 A;  1PZZ A;  4G9M A;  2MC2 A;  3ZC9 A;  1TWE A;  2WRY A;  1FWV A;  3ZXG A;  1ISY A;  1GGP B;  1BFG A;  8I1B A;  3WIN A;  4DEN A;  3O5W B;  3FUQ A;  1BFB A;  3CAH A;  1NUN A;  3VWC A;  1RML A;  4GP3 A;  1UPS A;  1HWM B;  4GAI A;  4Q91 A;  4QAL A;  4LO3 C;  2K4A B;  4I4Y A;  3PG0 A;  5DUY A;  1BAR A;  2AQZ A;  3OGG A;  4I7I A;  1CE7 B;  3OGF A;  3POK A;  1N4K A;  4A7Y A;  2IWT B;  4IZX A;  2F2F A;  4CJM A;  3A21 A;  2BEB A;  2HZ9 A;  3BX1 C;  1AVA C;  2MLL B;  1R8O A;  2FDB M;  4OEE A;  3N7J A;  1II4 A;  3NBN A;  4USP A;  3NBE A;  41BI A;  4AN7 B;  4A7Z A;  1SZ6 B;  4PC4 A;  3UD9 A;  4LO1 A;  2QYI B;  3JUT A;  4I1B A;  3VUO A;  3BAO A;  4EB2 B;  1EYL A;  3S8K A;  2LIE A;  1K5U A;  5DZU A;  4EFP A;  2HWM A;  2AFG A;  4OEF A;  1S0B A;  1QXM A;  4I37 A;  4J2X A;  2HWA A;  4TLP A;  3H6S E;  2KI6 B;  3ILA A;  4R6U B;  2ZQO A;  3LTQ A;  1Q03 A;  3CU1 B;  3WO2 A;  3R4U A;  1HKN A;  5DVH A;  5BOW A;  1BLD A;  3FJK A;  4EFR A;  2NP0 A;  1DFQ A;  1HWO B;  7I1B A;  3HAL A;  3O4A A;  2ET2 A;  1FQ9 A;  3P6J A;  3BAH A;  4J23 B;  1Z2V A;  3N7L A;  1Z0H A;  1HWN B;  3IAG C;  2GO2 A;  2KH2 A;  3I2A A;  3BAQ A;  4P0K A;  4X39 A;  3AH4 A;  4USO A;  4I2S A;  1D0H A;  4KEK A;  3A07 A;  5GAQ A;  3IM6 A;  2XOA A;  2ERM A;  1W3F A;  1SR4 C;  1I1B A;  1RZO B;  1JY0 A;  4G6J A;  4GOY A;  3UD7 A;  3FJE A;  2VSA A;  1YXW A;  1G9D A;  3K1X A;  4OEG A;  5BVP I;  3OJM A;  3BAU A;  3RMX A;  21BI A;  1V6U A;  4I4V A;  2UUS A;  4JKQ A;  1ISW A;  4I0Y A;  4IY9 A;  1P63 A;  4YOL A;  4JKX B;  5EG6 C;  4I4S A;  1PUU B;  4H9W A;  4I4R A;  5F8S A;  1AXM A;  2D7I A;  4X3A A;  1YTO A;  2D24 A;  3NBD A;  1BFF A;  1Q04 A;  3O49 A;  31BI A;  2YUG A;  3QR5 A;  4X38 A;  3AZV A;  1CVS A;  4D0Z A;  4KC3 A;  3N7M A;  1ISX A;  1T9F A;  4X37 A;  3MPP G;  1AVW B;  1WBA A;  2X2S A;  4XFT A;  1ISV A;  2L5X A;  3AKI A;  4OWJ A;  5FZY A;  1AVX B; 
#chains in the Genus database with same CATH topology
 1YBI A;  2I1B A;  4P6A A;  4I4X A;  3HOM A;  1IIL A;  4LO7 C;  1DZD A;  3RTJ B;  1JLY A;  3WIN C;  1IRA X;  1FV3 A;  1AFC A;  3FJ8 A;  5G00 A;  3FJH A;  2Y9W C;  2AAI B;  3AKG A;  3H6R B;  1I1E A;  1XHB A;  4OWK A;  4IYB A;  3JRR A;  5BXT A;  3R4S A;  3W9T A;  4ZA3 B;  2D43 A;  3CA5 A;  4QBC A;  1F31 A;  3KMV A;  1HCD A;  4GAF A;  3CA3 A;  5BP5 A;  3WO3 A;  1AF9 A;  2RQ9 A;  3FJC A;  3V0B B;  4HR6 C;  4GP0 A;  4WBC A;  3AKH A;  1KNM A;  4QC4 A;  2NVH A;  4I4Q A;  3AH1 A;  1YYN A;  4LO3 A;  3VSF A;  4LO7 B;  3N0K A;  1DQO A;  4ISR A;  4LO0 A;  3EF2 A;  4LO1 C;  2DRY A;  3V0A A;  4LO2 C;  1BAS A;  1QQK A;  3RMY A;  1ONK B;  3VEQ A;  5BXP A;  1AVU A;  4L4I A;  2NTD A;  3PHZ A;  3CRI A;  4ZFW B;  1JT7 A;  1DLL A;  4I6I A;  3E8L C;  1S0G A;  1TWM A;  1PUM B;  1G9A A;  2RG9 B;  2MIB A;  3FUO A;  5F8Y A;  3CRH A;  3CA0 A;  2D23 A;  1W3A A;  3UD8 A;  2BFH A;  1EPW A;  3FJB A;  1JTC A;  4QKS A;  4I4P A;  5HPZ A;  2Q3N B;  4I4O A;  3FJD A;  3MAL A;  1BLA A;  3IM7 A;  3BTA A;  2VSE A;  2D44 A;  3LLP A;  3RTI B;  3C9Z A;  3Q7Y A;  5BXS A;  3OJV A;  2AXM A;  3BAG A;  3VT2 A;  2VXR A;  3RSJ A;  3CQA A;  2DS0 A;  4XFS A;  5BQU A;  3FJA A;  3OBR A;  1V6X A;  1V6W A;  2VXT I;  1ITB A;  2NZ9 A;  4ISQ A;  3OJ2 A;  1IJT A;  4IQP A;  4P0L A;  1K5V A;  4G9N A;  2HW9 A;  1IRP A;  3BA7 A;  4GOV A;  1S0E A;  2KKI A;  1MC9 A;  1S0D A;  3BRD A;  2VU9 A;  2FO1 A;  3AJ6 A;  4KBB A;  1DJS B;  2WBC A;  1EVT A;  1S0F A;  1XZZ A;  3HSM A;  1IOB A;  3NJ5 A;  1ISZ A;  1PWA A;  4JP0 A;  2K43 A;  3FFZ A;  3UJ4 A;  3WO4 A;  5I1B A;  2P39 A;  9ILB A;  5JLV A;  1R8N A;  4Z9W B;  2E4M C;  2RST A;  1HWP B;  1BA7 A;  3A23 A;  2X2T A;  1A8D A;  1JT5 A;  3F62 B;  4IHZ A;  1SR4 A;  3I29 B;  1S0C A;  3A22 A;  4FVV A;  4FGF A;  3BRG C;  1E0O A;  2IHO A;  1MD6 A;  3ZXD A;  3O44 A;  3FJJ A;  1DQG A;  4I96 A;  2K8R A;  1DFC A;  4IZE A;  6I1B A;  2D7R A;  3S8J A;  3ZX7 A;  1W3G A;  2J3P A;  4I1E A;  3O4D A;  3CA6 A;  3O4C A;  3B9U A;  3BB2 A;  3FJ9 A;  3FJI A;  4JPZ A;  3IIR A;  4OWL A;  3ZC8 A;  4H04 A;  2KI4 A;  1JLX A;  5F90 A;  3BRF A;  1IHK A;  4KEJ A;  2Z49 A;  1JT4 A;  2D20 A;  5B2H A;  4ZFU B;  1ILR 1;  4END A;  1IT0 A;  4D8H A;  1TFM B;  1YF8 B;  4MZH A;  3SNV A;  2NYY A;  4I3N A;  4Q9G A;  4EKX B;  2F8X C;  1DZC A;  2DRE A;  4ZLB B;  2FGF A;  2FFU A;  5BP5 C;  2F2F C;  3N7K A;  4OUJ A;  1T4Q A;  1Z4S A;  3UJ0 A;  3WMV A;  3TC2 A;  1M2T B;  4J2K A;  4IY8 A;  4KEI A;  3CA4 A;  4DEP A;  3AH2 A;  3I2X A;  3CRG A;  5EHA A;  2FFV A;  1OQL B;  1XG6 A;  4LO0 C;  5D63 A;  3FGM A;  1WD3 A;  4QD2 B;  5BXR A;  2GZB A;  4ZGR B;  3FJF A;  1FGA A;  4XFU A;  1BFC A;  2VUA A;  5JMC A;  4OW4 A;  3P53 A;  3PUB A;  4G6M A;  3VSZ A;  4F83 A;  1JT3 A;  1FN0 A;  1DIW A;  4J2Y A;  2QN4 A;  4QKR A;  1M16 A;  3BA5 A;  2Y9X E;  4UY4 A;  5FZZ A;  1Q1U A;  4LO2 A;  4JAW A;  1RY7 A;  3AJ5 A;  5D62 A;  1WD4 A;  3BA4 A;  1J0S A;  4II0 A;  2M49 A;  2Y9F A;  3WA1 A;  1TIE A;  5E24 E;  4ION A;  5BQU C;  5DSS B;  1WBC A;  5FZU A;  4QO3 A;  4Z8S B;  1HIB A;  1FV2 A;  3T8S A;  3V0A B;  4F34 A;  2NM1 A;  4XKI A;  2Y9G A;  4ZBV B;  5FNX A;  1TP0 A;  1FWU A;  3F1R A;  2LIQ A;  2ESU A;  2ZR1 B;  4QBV A;  3AZW A;  1S0L A;  5FNW A;  1JQZ A;  2Z48 A;  1TTU A;  3Q7X A;  2BEA A;  5F8W A;  4ZOT A;  2DRZ A;  3IM5 A;  2Q9X A;  4H75 A;  1QQL A;  4EFQ A;  5EC5 A;  3CA1 A;  2P23 A;  4HJJ A;  4A7K A;  1PC8 B;  4J2S A;  3Q7W A;  3OBT A;  3PME A;  3VT0 A;  4JRA A;  3HN1 A;  1XYF A;  4DCK C;  3BAD A;  4HA2 A;  2D1Z A;  2NS2 A;  3UDA A;  1TOO A;  1VCL A;  4P0J A;  3H6Q A;  3BAV A;  3QYD A;  1L2H A;  1G82 A;  1ABR B;  3P6I A;  3V79 C;  3WMU A;  4JQ0 A;  1V6V A;  1NZK A;  1HCE A;  4G1R A;  4ZFY B;  1EV2 A;  4AN6 A;  3H6R A;  1FMM S;  4I8M A;  4I4U A;  5D61 A;  4ZKT B;  3AKF A;  2KLL A;  2D22 A;  1FMZ A;  2E4M A;  3NBC A;  1G9B A;  3HBW A;  4L4H A;  2VLC A;  4QD2 C;  3O4O A;  3HMY A;  3D7W B;  3VT1 A;  2ZQN A;  1G9C A;  4LO8 B;  3V0B A;  3O4B A;  2R9K B;  4Q9P A;  4EEE B;  4D0T A;  3O3Q A;  1RG8 A;  1PZZ A;  4G9M A;  2MC2 A;  3ZC9 A;  1TWE A;  2WRY A;  1FWV A;  3ZXG A;  1ISY A;  1GGP B;  1BFG A;  8I1B A;  3WIN A;  4DEN A;  3O5W B;  3FUQ A;  1BFB A;  3CAH A;  1NUN A;  3VWC A;  1RML A;  4GP3 A;  1UPS A;  1HWM B;  4GAI A;  4Q91 A;  4QAL A;  4LO3 C;  2K4A B;  4I4Y A;  3PG0 A;  5DUY A;  1BAR A;  2AQZ A;  3OGG A;  4I7I A;  1CE7 B;  3OGF A;  3POK A;  1N4K A;  4A7Y A;  2IWT B;  4IZX A;  2F2F A;  4CJM A;  3A21 A;  2BEB A;  2HZ9 A;  3BX1 C;  1AVA C;  2MLL B;  1R8O A;  2FDB M;  4OEE A;  3N7J A;  1II4 A;  3NBN A;  4USP A;  3NBE A;  41BI A;  4AN7 B;  4A7Z A;  1SZ6 B;  4PC4 A;  3UD9 A;  4LO1 A;  2QYI B;  3JUT A;  4I1B A;  3VUO A;  3BAO A;  4EB2 B;  1EYL A;  3S8K A;  2LIE A;  1K5U A;  4MZG B;  5DZU A;  4EFP A;  2HWM A;  2AFG A;  4OEF A;  1S0B A;  1QXM A;  4I37 A;  4J2X A;  2HWA A;  4TLP A;  3H6S E;  2KI6 B;  3ILA A;  4R6U B;  2ZQO A;  3LTQ A;  1Q03 A;  3CU1 B;  3WO2 A;  3R4U A;  1HKN A;  5DVH A;  5BOW A;  1BLD A;  3FJK A;  4EFR A;  2NP0 A;  1DFQ A;  1HWO B;  7I1B A;  3HAL A;  3O4A A;  2ET2 A;  1FQ9 A;  3P6J A;  3BAH A;  4J23 B;  1Z2V A;  3N7L A;  1Z0H A;  1HWN B;  3IAG C;  2GO2 A;  2KH2 A;  3I2A A;  3BAQ A;  4P0K A;  4X39 A;  3AH4 A;  4USO A;  4I2S A;  1D0H A;  4KEK A;  3A07 A;  5GAQ A;  3IM6 A;  2XOA A;  2ERM A;  1W3F A;  1SR4 C;  1I1B A;  1RZO B;  1JY0 A;  4G6J A;  4GOY A;  3UD7 A;  3FJE A;  2VSA A;  1YXW A;  1G9D A;  3K1X A;  4OEG A;  5BVP I;  3OJM A;  3BAU A;  3RMX A;  21BI A;  1V6U A;  4I4V A;  2UUS A;  4JKQ A;  1ISW A;  4I0Y A;  4IY9 A;  1P63 A;  4YOL A;  4JKX B;  5EG6 C;  4I4S A;  1PUU B;  4H9W A;  4I4R A;  5F8S A;  1AXM A;  2D7I A;  4X3A A;  1YTO A;  2D24 A;  3NBD A;  1BFF A;  1Q04 A;  3O49 A;  31BI A;  2YUG A;  3QR5 A;  4X38 A;  3AZV A;  1CVS A;  4D0Z A;  4KC3 A;  3N7M A;  1ISX A;  1T9F A;  4X37 A;  3MPP G;  1AVW B;  1WBA A;  2X2S A;  4XFT A;  4MZF B;  1ISV A;  2L5X A;  3AKI A;  4OWJ A;  5FZY A;  1AVX B; 
#chains in the Genus database with same CATH homology
 1YBI A;  2I1B A;  4P6A A;  4I4X A;  3HOM A;  1IIL A;  4LO7 C;  1DZD A;  3RTJ B;  1JLY A;  3WIN C;  1IRA X;  1FV3 A;  1AFC A;  3FJ8 A;  5G00 A;  3FJH A;  2Y9W C;  2AAI B;  3AKG A;  3H6R B;  1I1E A;  1XHB A;  4OWK A;  4IYB A;  3JRR A;  5BXT A;  3R4S A;  3W9T A;  4ZA3 B;  2D43 A;  3CA5 A;  4QBC A;  1F31 A;  3KMV A;  1HCD A;  4GAF A;  3CA3 A;  5BP5 A;  3WO3 A;  1AF9 A;  2RQ9 A;  3FJC A;  3V0B B;  4HR6 C;  4GP0 A;  4WBC A;  3AKH A;  1KNM A;  4QC4 A;  2NVH A;  4I4Q A;  3AH1 A;  1YYN A;  4LO3 A;  3VSF A;  4LO7 B;  3N0K A;  1DQO A;  4ISR A;  4LO0 A;  3EF2 A;  4LO1 C;  2DRY A;  3V0A A;  4LO2 C;  1BAS A;  1QQK A;  3RMY A;  1ONK B;  3VEQ A;  5BXP A;  1AVU A;  4L4I A;  2NTD A;  3PHZ A;  3CRI A;  4ZFW B;  1JT7 A;  1DLL A;  4I6I A;  3E8L C;  1S0G A;  1TWM A;  1PUM B;  1G9A A;  2RG9 B;  2MIB A;  3FUO A;  5F8Y A;  3CRH A;  3CA0 A;  2D23 A;  1W3A A;  3UD8 A;  2BFH A;  1EPW A;  3FJB A;  1JTC A;  4QKS A;  4I4P A;  5HPZ A;  2Q3N B;  4I4O A;  3FJD A;  3MAL A;  1BLA A;  3IM7 A;  3BTA A;  2VSE A;  2D44 A;  3LLP A;  3RTI B;  3C9Z A;  3Q7Y A;  5BXS A;  3OJV A;  2AXM A;  3BAG A;  3VT2 A;  2VXR A;  3RSJ A;  3CQA A;  2DS0 A;  4XFS A;  5BQU A;  3FJA A;  3OBR A;  1V6X A;  1V6W A;  2VXT I;  1ITB A;  2NZ9 A;  4ISQ A;  3OJ2 A;  1IJT A;  4IQP A;  4P0L A;  1K5V A;  4G9N A;  2HW9 A;  1IRP A;  3BA7 A;  4GOV A;  1S0E A;  2KKI A;  1MC9 A;  1S0D A;  3BRD A;  2VU9 A;  2FO1 A;  3AJ6 A;  4KBB A;  1DJS B;  2WBC A;  1EVT A;  1S0F A;  1XZZ A;  3HSM A;  1IOB A;  3NJ5 A;  1ISZ A;  1PWA A;  4JP0 A;  2K43 A;  3FFZ A;  3UJ4 A;  3WO4 A;  5I1B A;  2P39 A;  9ILB A;  5JLV A;  1R8N A;  4Z9W B;  2E4M C;  2RST A;  1HWP B;  1BA7 A;  3A23 A;  2X2T A;  1A8D A;  1JT5 A;  3F62 B;  4IHZ A;  1SR4 A;  3I29 B;  1S0C A;  3A22 A;  4FVV A;  4FGF A;  3BRG C;  1E0O A;  2IHO A;  1MD6 A;  3ZXD A;  3O44 A;  3FJJ A;  1DQG A;  4I96 A;  2K8R A;  1DFC A;  4IZE A;  6I1B A;  2D7R A;  3S8J A;  3ZX7 A;  1W3G A;  2J3P A;  4I1E A;  3O4D A;  3CA6 A;  3O4C A;  3B9U A;  3BB2 A;  3FJ9 A;  3FJI A;  4JPZ A;  3IIR A;  4OWL A;  3ZC8 A;  4H04 A;  2KI4 A;  1JLX A;  5F90 A;  3BRF A;  1IHK A;  4KEJ A;  2Z49 A;  1JT4 A;  2D20 A;  5B2H A;  4ZFU B;  1ILR 1;  4END A;  1IT0 A;  4D8H A;  1TFM B;  1YF8 B;  4MZH A;  3SNV A;  2NYY A;  4I3N A;  4Q9G A;  4EKX B;  2F8X C;  1DZC A;  2DRE A;  4ZLB B;  2FGF A;  2FFU A;  5BP5 C;  2F2F C;  3N7K A;  4OUJ A;  1T4Q A;  1Z4S A;  3UJ0 A;  3WMV A;  3TC2 A;  1M2T B;  4J2K A;  4IY8 A;  4KEI A;  3CA4 A;  4DEP A;  3AH2 A;  3I2X A;  3CRG A;  5EHA A;  2FFV A;  1OQL B;  1XG6 A;  4LO0 C;  5D63 A;  3FGM A;  1WD3 A;  4QD2 B;  5BXR A;  2GZB A;  4ZGR B;  3FJF A;  1FGA A;  4XFU A;  1BFC A;  2VUA A;  5JMC A;  4OW4 A;  3P53 A;  3PUB A;  4G6M A;  3VSZ A;  4F83 A;  1JT3 A;  1FN0 A;  1DIW A;  4J2Y A;  2QN4 A;  4QKR A;  1M16 A;  3BA5 A;  2Y9X E;  4UY4 A;  5FZZ A;  1Q1U A;  4LO2 A;  4JAW A;  1RY7 A;  3AJ5 A;  5D62 A;  1WD4 A;  3BA4 A;  1J0S A;  4II0 A;  2M49 A;  2Y9F A;  3WA1 A;  1TIE A;  5E24 E;  4ION A;  5BQU C;  5DSS B;  1WBC A;  5FZU A;  4QO3 A;  4Z8S B;  1HIB A;  1FV2 A;  3T8S A;  3V0A B;  4F34 A;  2NM1 A;  4XKI A;  2Y9G A;  4ZBV B;  5FNX A;  1TP0 A;  1FWU A;  3F1R A;  2LIQ A;  2ESU A;  2ZR1 B;  4QBV A;  3AZW A;  1S0L A;  5FNW A;  1JQZ A;  2Z48 A;  1TTU A;  3Q7X A;  2BEA A;  5F8W A;  4ZOT A;  2DRZ A;  3IM5 A;  2Q9X A;  4H75 A;  1QQL A;  4EFQ A;  5EC5 A;  3CA1 A;  2P23 A;  4HJJ A;  4A7K A;  1PC8 B;  4J2S A;  3Q7W A;  3OBT A;  3PME A;  3VT0 A;  4JRA A;  3HN1 A;  1XYF A;  4DCK C;  3BAD A;  4HA2 A;  2D1Z A;  2NS2 A;  3UDA A;  1TOO A;  1VCL A;  4P0J A;  3H6Q A;  3BAV A;  3QYD A;  1L2H A;  1G82 A;  1ABR B;  3P6I A;  3V79 C;  3WMU A;  4JQ0 A;  1V6V A;  1NZK A;  1HCE A;  4G1R A;  4ZFY B;  1EV2 A;  4AN6 A;  3H6R A;  1FMM S;  4I8M A;  4I4U A;  5D61 A;  4ZKT B;  3AKF A;  2KLL A;  2D22 A;  1FMZ A;  2E4M A;  3NBC A;  1G9B A;  3HBW A;  4L4H A;  2VLC A;  4QD2 C;  3O4O A;  3HMY A;  3D7W B;  3VT1 A;  2ZQN A;  1G9C A;  4LO8 B;  3V0B A;  3O4B A;  2R9K B;  4Q9P A;  4EEE B;  4D0T A;  3O3Q A;  1RG8 A;  1PZZ A;  4G9M A;  2MC2 A;  3ZC9 A;  1TWE A;  2WRY A;  1FWV A;  3ZXG A;  1ISY A;  1GGP B;  1BFG A;  8I1B A;  3WIN A;  4DEN A;  3O5W B;  3FUQ A;  1BFB A;  3CAH A;  1NUN A;  3VWC A;  1RML A;  4GP3 A;  1UPS A;  1HWM B;  4GAI A;  4Q91 A;  4QAL A;  4LO3 C;  2K4A B;  4I4Y A;  3PG0 A;  5DUY A;  1BAR A;  2AQZ A;  3OGG A;  4I7I A;  1CE7 B;  3OGF A;  3POK A;  1N4K A;  4A7Y A;  2IWT B;  4IZX A;  2F2F A;  4CJM A;  3A21 A;  2BEB A;  2HZ9 A;  3BX1 C;  1AVA C;  2MLL B;  1R8O A;  2FDB M;  4OEE A;  3N7J A;  1II4 A;  3NBN A;  4USP A;  3NBE A;  41BI A;  4AN7 B;  4A7Z A;  1SZ6 B;  4PC4 A;  3UD9 A;  4LO1 A;  2QYI B;  3JUT A;  4I1B A;  3VUO A;  3BAO A;  4EB2 B;  1EYL A;  3S8K A;  2LIE A;  1K5U A;  4MZG B;  5DZU A;  4EFP A;  2HWM A;  2AFG A;  4OEF A;  1S0B A;  1QXM A;  4I37 A;  4J2X A;  2HWA A;  4TLP A;  3H6S E;  2KI6 B;  3ILA A;  4R6U B;  2ZQO A;  3LTQ A;  1Q03 A;  3CU1 B;  3WO2 A;  3R4U A;  1HKN A;  5DVH A;  5BOW A;  1BLD A;  3FJK A;  4EFR A;  2NP0 A;  1DFQ A;  1HWO B;  7I1B A;  3HAL A;  3O4A A;  2ET2 A;  1FQ9 A;  3P6J A;  3BAH A;  4J23 B;  1Z2V A;  3N7L A;  1Z0H A;  1HWN B;  3IAG C;  2GO2 A;  2KH2 A;  3I2A A;  3BAQ A;  4P0K A;  4X39 A;  3AH4 A;  4USO A;  4I2S A;  1D0H A;  4KEK A;  3A07 A;  5GAQ A;  3IM6 A;  2XOA A;  2ERM A;  1W3F A;  1SR4 C;  1I1B A;  1RZO B;  1JY0 A;  4G6J A;  4GOY A;  3UD7 A;  3FJE A;  2VSA A;  1YXW A;  1G9D A;  3K1X A;  4OEG A;  5BVP I;  3OJM A;  3BAU A;  3RMX A;  21BI A;  1V6U A;  4I4V A;  2UUS A;  4JKQ A;  1ISW A;  4I0Y A;  4IY9 A;  1P63 A;  4YOL A;  4JKX B;  5EG6 C;  4I4S A;  1PUU B;  4H9W A;  4I4R A;  5F8S A;  1AXM A;  2D7I A;  4X3A A;  1YTO A;  2D24 A;  3NBD A;  1BFF A;  1Q04 A;  3O49 A;  31BI A;  2YUG A;  3QR5 A;  4X38 A;  3AZV A;  1CVS A;  4D0Z A;  4KC3 A;  3N7M A;  1ISX A;  1T9F A;  4X37 A;  3MPP G;  1AVW B;  1WBA A;  2X2S A;  4XFT A;  4MZF B;  1ISV A;  2L5X A;  3AKI A;  4OWJ A;  5FZY A;  1AVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...