4OWLA

Crystal structure of the vibrio vulnificus hemolysin/cytolysin beta-trefoil lectin with n-acetyl-d-lactosamine bound
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
132
structure length
132
Chain Sequence
b'MAHVTLQSLSNNDLCLDVYGENGDKTVAGGSVNGWSCHGSWNQVWGLDKEERYRSRVASDRCLTVNADKTLTVEQCGANLAQKWYWEGDKLISRYVDGNNTRYLLNIVGGRNVQVTPENEANQARWKPTLQQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Cytolysin
publication title Glycan Specificity of the Vibrio vulnificus Hemolysin Lectin Outlines Evolutionary History of Membrane Targeting by a Toxin Family.
pubmed doi rcsb
source organism Vibrio vulnificus
molecule tags Toxin
total genus 30
structure length 132
sequence length 132
chains with identical sequence B, C, D, E, F, G
ec nomenclature
pdb deposition date 2014-02-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4owlA00
2E4MC 4R6UB 4I4PA 1TWMA 2P39A 3IM5A 5EC5A 2WRYA 4I4UA 1ISVA 4KEIA 4FGFA 2FFUA 2UUSA 4LO0A 3I29B 2Q9XA 2KKIA 1EPWA 1XHBA 3BTAA 3VT2A 2ET2A 3A22A 1RMLA 4I0YA 3JUTA 4P0KA 3FJAA 3WA1A 1QQKA 4XFSA 3BAOA 3N7KA 1SR4C 1RY7A 5BXSA 5B2HA 1DZCA 4YOLA 4XKIA 2D7IA 3AKHA 1G9AA 1AVXB 1IOBA 3VT1A 5BXTA 3AH4A 3BA5A 2KLLA 4QKSA 4EFRA 2AQZA 2Y9WC 3RSJA 1FGAA 3BRDA 4JQ0A 4I7IA 1BFCA 2Z48A 4LO3C 4J2XA 2HZ9A 3AZVA 3PG0A 3WO3A 1DQGA 1S0FA 3VT0A 1JT4A 1ILR1 1TWEA 3WO4A 2FO1A 1K5VA 1PC8B 1WD3A 2P23A 3CRIA 4HJJA 5D62A 4ZBVB 4A7YA 2AFGA 2K43A 1YF8B 4I4SA 1HWNB 1S0DA 3HSMA 2F2FA 2KI4A 3O49A 1XZZA 4I4YA 1RG8A 3RMXA 3UDAA 2D7RA 4ZGRB 4G6JA 4I37A 3QYDA 2NVHA 4EEEB 1EYLA 4L4IA 2NM1A 1N4KA 1Q04A 3BAGA 3H6SE 3NBNA 3P6JA 3WMVA 3ZC8A 2FDBM 3CU1B 1R8NA 31BIA 3P53A 4D0TA 4Q91A 5FZUA 3BX1C 1D0HA 2GZBA 4G6MA 3Q7YA 1BARA 1Z2VA 4Z9WB 1NUNA 1VCLA 3BA7A 3A23A 3FJEA 4QD2B 3V0AB 3OBRA 2RSTA 3FGMA 1WBAA 4I4XA 3OJMA 1S0LA 3HN1A 2KH2A 1AVAC 5FZYA 1DFCA 1T4QA 4TLPA 2DRYA 5BVPI 3LLPA 1S0BA 4Q9PA 3ZXDA 5F90A 1P63A 4F83A 4ZFUB 5BOWA 3O44A 4OEEA 1JLYA 4IQPA 4JKXB 3CAHA 3CRGA 3FJ9A 1EVTA 4QD2C 3CA3A 5BQUA 3N7MA 2K4AB 1MC9A 4ENDA 3Q7WA 2BFHA 1KNMA 2NP0A 2E4MA 4HR6C 3UD8A 4XFTA 1G9CA 3BADA 2D43A 3CQAA 1AF9A 2VU9A 1JY0A 1G9DA 3CA1A 5BP5C 4ZFYB 1L2HA 5I1BA 1SZ6B 1PWAA 3OJ2A 2D24A 2NYYA 1IT0A 3AJ6A 2IWTB 1SR4A 2MC2A 3HALA 4GAFA 2D23A 3ZC9A 3KMVA 2MIBA 3BAQA 3NBEA 1PZZA 2KI6B 1Z0HA 3OGGA 5GAQA 2L5XA 4J2YA 3A07A 2HWMA 3FUOA 3BRGC 3AJ5A 4OW4A 4D0ZA 4OUJA 3OBTA 3UJ4A 4XFUA 3VEQA 1Z4SA 5DVHA 4KEKA 4LO3A 4LO2C 3VWCA 3SNVA 2QN4A 4GP0A 3JRRA 4LO0C 4X37A 4IONA 2HW9A 4JRAA 3F1RA 4JP0A 3IIRA 2D44A 1CE7B 3OGFA 2ZR1B 1AVUA 4IY8A 4Z8SB 3P6IA 1BFGA 1YYNA 3O5WB 3O4DA 1TTUA 1HWPB 3S8JA 2X2TA 3FFZA 7I1BA 1OQLB 3VSFA 2Q3NB 4LO7B 3AH1A 1CVSA 2HWAA 4LO1C 4IY9A 4FVVA 4JPZA 3NBCA 1GGPB 2VXRA 3V0BA 1W3AA 3EF2A 3AKIA 3HMYA 1M16A 2QYIB 5EHAA 3VUOA 3FJBA 4I4VA 1YXWA 4I1BA 4QBVA 3CRHA 4EKXB 3BAUA 1FMMS 3WO2A 3NBDA 3CA5A 1FQ9A 3B9UA 4QC4A 5FZZA 3K1XA 3UD9A 1WBCA 4G9NA 3A21A 4I4QA 2BEAA 3FJFA 4IHZA 2DS0A 3CA0A 2VSEA 3ZXGA 4OEGA 1ISZA 1ITBA 2BEBA 1BASA 2FGFA 2NTDA 3CA4A 3O4AA 3N7LA 3VSZA 4I4RA 3H6RA 1ISWA 1DIWA 4I4OA 4II0A 4KC3A 4USOA 3WINC 6I1BA 1I1EA 2RG9B 5JLVA 4P0LA 8I1BA 3PHZA 3V0AA 2VXTI 1DJSB 3AKFA 1XG6A 3W9TA 1TOOA 1V6VA 4EFQA 4LO8B 4H9WA 2YUGA 1AFCA 4X3AA 1ONKB 3C9ZA 2VSAA 1JQZA 5BP5A 1BLDA 3V79C 4DEPA 3O3QA 3Q7XA 2R9KB 1JT7A 3HBWA 4CJMA 4GP3A 4J2KA 2D22A 1YBIA 3PMEA 3N0KA 4WBCA 4OEFA 2ZQOA 2GO2A 4QALA 3HOMA 3UJ0A 4G9MA 5BXPA 3D7WB 4I96A 1I1BA 1S0CA 1DZDA 4ISRA 4KBBA 1E0OA 3H6QA 3AZWA 3AH2A 4P6AA 5E24E 1BA7A 1JT3A 3S8KA 1HKNA 4D8HA 3R4UA 4OWLA 3FJJA 2FFVA 3FJ8A 1TFMB 2NZ9A 4J2SA 2AXMA 4GOVA 4PC4A 3O4CA 1DLLA 1G82A 1AXMA 3ILAA 4ZLBB 4LO2A 3R4SA 4I1EA 2VUAA 3F62B 5F8WA 1HCEA 5D63A 4H04A 3BAHA 1G9BA 4QBCA 1V6WA 2ZQNA 4GAIA 2XOAA 3TC2A 4DENA 4IZEA 1W3GA 2X2SA 4KEJA 5D61A 4OWKA 4OWJA 4HA2A 2MLLB 4ISQA 1IHKA 1JT5A 5EG6C 2Y9FA 3FJDA 1K5UA 3BB2A 1QXMA 3OJVA 4IYBA 5FNWA 1QQLA 4I6IA 3IM7A 4USPA 5DZUA 4AN6A 1S0GA 1Q03A 3QR5A 4LO1A 4EB2B 1BFFA 3BA4A 4DCKC 4P0JA 4JAWA 1BLAA 1ABRB 5BXRA 2M49A 3I2AA 4ZKTB 3CA6A 4AN7B 1W3FA 1ISXA 3N7JA 1FV3A 3I2XA 1JTCA 3V0BB 4ZFWB 4G1RA 3O4OA 4GOYA 4QKRA 1PUUB 4I8MA 1FMZA 2J3PA 2LIQA 3POKA 5DSSB 1BFBA 3IAGC 1MD6A 3FJIA 4LO7C 2F8XC 5JMCA 3MPPG 1UPSA 4QO3A 3PUBA 4I2SA 1TIEA 5F8YA 3WINA 2Y9XE 3LTQA 2D1ZA 4JKQA 2K8RA 2WBCA 2F2FC 5G00A 1Q1UA 1FN0A 1DFQA 3FJHA 4J23B 1IJTA 4EFPA 2RQ9A 2Y9GA 2IHOA 1TP0A 1R8OA 3IM6A 1YTOA 4L4HA 1IILA 1EV2A 1PUMB 4A7KA 3ZX7A 1F31A 3H6RB 4ZOTA 1V6UA 3UD7A 2DRZA 1NZKA 2Z49A 1AVWB 2DREA 3FJKA 1XYFA 41BIA 4ZA3B 2AAIB 5FNXA 3FJCA 1FWUA 3O4BA 4I3NA 1RZOB 1JLXA 4X39A 1J0SA 2ERMA 2ESUA 3FUQA 1DQOA 2I1BA 1HIBA 9ILBA 3NJ5A 3RMYA 1FWVA 3RTJB 1A8DA 1FV2A 4Q9GA 4F34A 3AKGA 1ISYA 1IRAX 1S0EA 4IZXA 3RTIB 1HWMB 3E8LC 5HPZA 1M2TB 3T8SA 4X38A 5F8SA 5DUYA 3MALA 4A7ZA 1HCDA 21BIA 1T9FA 1HWOB 3BAVA 5BQUC 1WD4A 1IRPA 2D20A 2LIEA 2VLCA 3BRFA 3WMUA 1V6XA 1II4A
chains in the Genus database with same CATH superfamily
2E4MC 4R6UB 2NS2A 4I4PA 1TWMA 2P39A 3IM5A 5EC5A 2WRYA 4I4UA 1ISVA 4KEIA 4FGFA 2FFUA 2UUSA 4LO0A 3I29B 2Q9XA 2KKIA 1EPWA 1XHBA 3BTAA 3VT2A 2ET2A 3A22A 1RMLA 4I0YA 3JUTA 4P0KA 3FJAA 3WA1A 1QQKA 4XFSA 3BAOA 3N7KA 1SR4C 1RY7A 5BXSA 5B2HA 1DZCA 4YOLA 4XKIA 2D7IA 3AKHA 1G9AA 1AVXB 1IOBA 3VT1A 5BXTA 3AH4A 3BA5A 2KLLA 4QKSA 4EFRA 2AQZA 2Y9WC 3RSJA 1FGAA 3BRDA 4JQ0A 4I7IA 1BFCA 2Z48A 4LO3C 4J2XA 2HZ9A 3AZVA 3PG0A 3WO3A 1DQGA 1S0FA 3VT0A 1JT4A 1ILR1 1TWEA 3WO4A 2FO1A 1K5VA 1PC8B 1WD3A 2P23A 3CRIA 4HJJA 5D62A 4ZBVB 4A7YA 2AFGA 2K43A 1YF8B 4I4SA 1HWNB 1S0DA 3HSMA 2F2FA 2KI4A 3O49A 1XZZA 4I4YA 1RG8A 3RMXA 3UDAA 2D7RA 4ZGRB 4G6JA 4I37A 3QYDA 4MZFB 2NVHA 4EEEB 1EYLA 4L4IA 2NM1A 1N4KA 1Q04A 3BAGA 3H6SE 3NBNA 3P6JA 3WMVA 3ZC8A 2FDBM 3CU1B 1R8NA 31BIA 3P53A 4D0TA 4Q91A 5FZUA 3BX1C 1D0HA 2GZBA 4G6MA 3Q7YA 1BARA 1Z2VA 4Z9WB 1NUNA 1VCLA 3BA7A 3A23A 3FJEA 4QD2B 3V0AB 3OBRA 2RSTA 3FGMA 1WBAA 4I4XA 3OJMA 1S0LA 3HN1A 2KH2A 1AVAC 5FZYA 1DFCA 1T4QA 4TLPA 2DRYA 5BVPI 3LLPA 1S0BA 4Q9PA 3ZXDA 5F90A 1P63A 4F83A 4ZFUB 5BOWA 3O44A 4OEEA 1JLYA 4IQPA 4JKXB 3CAHA 3CRGA 3FJ9A 1EVTA 4QD2C 3CA3A 5BQUA 3N7MA 2K4AB 1MC9A 4ENDA 3Q7WA 2BFHA 1KNMA 2NP0A 2E4MA 4HR6C 3UD8A 4XFTA 1G9CA 3BADA 2D43A 3CQAA 1AF9A 2VU9A 1JY0A 1G9DA 3CA1A 5BP5C 4ZFYB 1L2HA 5I1BA 1SZ6B 1PWAA 3OJ2A 2D24A 2NYYA 1IT0A 3AJ6A 2IWTB 1SR4A 2MC2A 3HALA 4GAFA 2D23A 3ZC9A 3KMVA 2MIBA 3BAQA 3NBEA 1PZZA 2KI6B 1Z0HA 3OGGA 5GAQA 2L5XA 4J2YA 3A07A 2HWMA 3FUOA 3BRGC 3AJ5A 4OW4A 4D0ZA 4OUJA 3OBTA 3UJ4A 4XFUA 3VEQA 1Z4SA 5DVHA 4KEKA 4LO3A 4LO2C 3VWCA 3SNVA 2QN4A 4GP0A 3JRRA 4LO0C 4X37A 4IONA 2HW9A 4JRAA 3F1RA 4JP0A 3IIRA 2D44A 1CE7B 3OGFA 2ZR1B 1AVUA 4IY8A 4Z8SB 3P6IA 1BFGA 1YYNA 3O5WB 3O4DA 1TTUA 1HWPB 3S8JA 2X2TA 3FFZA 7I1BA 1OQLB 3VSFA 2Q3NB 4LO7B 3AH1A 1CVSA 2HWAA 4LO1C 4IY9A 4FVVA 4JPZA 3NBCA 1GGPB 2VXRA 3V0BA 1W3AA 3EF2A 3AKIA 3HMYA 1M16A 2QYIB 5EHAA 3VUOA 3FJBA 4I4VA 1YXWA 4I1BA 4QBVA 3CRHA 4EKXB 3BAUA 1FMMS 3WO2A 3NBDA 3CA5A 1FQ9A 3B9UA 4QC4A 5FZZA 3K1XA 3UD9A 1WBCA 4G9NA 3A21A 4I4QA 2BEAA 3FJFA 4IHZA 2DS0A 3CA0A 2VSEA 3ZXGA 4OEGA 1ISZA 1ITBA 2BEBA 1BASA 2FGFA 2NTDA 3CA4A 3O4AA 3N7LA 3VSZA 4I4RA 3H6RA 1ISWA 1DIWA 4I4OA 4II0A 4KC3A 4USOA 3WINC 6I1BA 1I1EA 2RG9B 5JLVA 4P0LA 8I1BA 3PHZA 3V0AA 2VXTI 1DJSB 3AKFA 1XG6A 3W9TA 1TOOA 1V6VA 4EFQA 4LO8B 4H9WA 2YUGA 1AFCA 4X3AA 1ONKB 3C9ZA 2VSAA 1JQZA 5BP5A 1BLDA 3V79C 4DEPA 3O3QA 3Q7XA 2R9KB 1JT7A 3HBWA 4CJMA 4GP3A 4J2KA 2D22A 1YBIA 3PMEA 3N0KA 4UY4A 4WBCA 4OEFA 2ZQOA 2GO2A 4QALA 3HOMA 3UJ0A 4G9MA 5BXPA 3D7WB 4I96A 1I1BA 1S0CA 1DZDA 4ISRA 4KBBA 1E0OA 3H6QA 3AZWA 3AH2A 4P6AA 5E24E 1BA7A 1JT3A 3S8KA 1HKNA 4D8HA 3R4UA 4OWLA 3FJJA 2FFVA 3FJ8A 1TFMB 2NZ9A 4J2SA 2AXMA 4GOVA 4PC4A 3O4CA 1DLLA 1G82A 1AXMA 3ILAA 4ZLBB 4LO2A 3R4SA 4I1EA 2VUAA 3F62B 4MZGB 1HCEA 5F8WA 5D63A 4H04A 3BAHA 1G9BA 4QBCA 1V6WA 2ZQNA 4GAIA 2XOAA 3TC2A 4DENA 4IZEA 1W3GA 2X2SA 4KEJA 5D61A 4OWKA 4OWJA 4HA2A 2MLLB 4ISQA 1IHKA 1JT5A 5EG6C 2Y9FA 3FJDA 1K5UA 3BB2A 1QXMA 3OJVA 4IYBA 5FNWA 1QQLA 4I6IA 3IM7A 4USPA 5DZUA 4AN6A 1S0GA 1Q03A 3QR5A 4LO1A 4EB2B 1BFFA 3BA4A 4DCKC 4P0JA 4JAWA 1BLAA 1ABRB 5BXRA 2M49A 3I2AA 4ZKTB 3CA6A 4AN7B 1W3FA 1ISXA 3N7JA 1FV3A 3I2XA 1JTCA 3V0BB 4ZFWB 4G1RA 3O4OA 4GOYA 4QKRA 1PUUB 4I8MA 1FMZA 2J3PA 2LIQA 3POKA 5DSSB 1BFBA 3IAGC 1MD6A 3FJIA 4LO7C 2F8XC 5JMCA 3MPPG 1UPSA 4QO3A 3PUBA 4I2SA 1TIEA 4H75A 5F8YA 3WINA 2Y9XE 3LTQA 2D1ZA 4JKQA 2K8RA 2WBCA 2F2FC 5G00A 1Q1UA 1FN0A 1DFQA 3FJHA 4J23B 1IJTA 4EFPA 2RQ9A 2Y9GA 2IHOA 1TP0A 1R8OA 3IM6A 1YTOA 4L4HA 1IILA 1EV2A 1PUMB 4A7KA 3ZX7A 1F31A 3H6RB 4ZOTA 1V6UA 3UD7A 2DRZA 1NZKA 2Z49A 1AVWB 2DREA 3FJKA 1XYFA 41BIA 4ZA3B 2AAIB 5FNXA 3FJCA 1FWUA 3O4BA 4I3NA 1RZOB 1JLXA 4X39A 1J0SA 2ERMA 2ESUA 3FUQA 1DQOA 2I1BA 1HIBA 9ILBA 3NJ5A 3RMYA 1FWVA 3RTJB 1A8DA 1FV2A 4Q9GA 4F34A 3AKGA 1ISYA 1IRAX 1S0EA 4IZXA 3RTIB 4MZHA 1HWMB 3E8LC 5HPZA 1M2TB 3T8SA 4X38A 5F8SA 5DUYA 3MALA 4A7ZA 1HCDA 21BIA 1T9FA 1HWOB 3BAVA 5BQUC 1WD4A 1IRPA 2D20A 2LIEA 2VLCA 3BRFA 3WMUA 1V6XA 1II4A
chains in the Genus database with same CATH topology
2E4MC 4R6UB 2NS2A 4I4PA 1TWMA 2P39A 3IM5A 5EC5A 2WRYA 4I4UA 1ISVA 4KEIA 4FGFA 2FFUA 2UUSA 4LO0A 3I29B 2Q9XA 2KKIA 1EPWA 1XHBA 3BTAA 3VT2A 2ET2A 3A22A 1RMLA 4I0YA 3JUTA 4P0KA 3FJAA 3WA1A 1QQKA 4XFSA 3BAOA 3N7KA 1SR4C 1RY7A 5BXSA 5B2HA 1DZCA 4YOLA 4XKIA 2D7IA 3AKHA 1G9AA 1AVXB 1IOBA 3VT1A 5BXTA 3AH4A 3BA5A 2KLLA 4QKSA 4EFRA 2AQZA 2Y9WC 3RSJA 1FGAA 3BRDA 4JQ0A 4I7IA 1BFCA 2Z48A 4LO3C 4J2XA 2HZ9A 3AZVA 3PG0A 3WO3A 1DQGA 1S0FA 3VT0A 1JT4A 1ILR1 1TWEA 3WO4A 2FO1A 1K5VA 1PC8B 1WD3A 2P23A 3CRIA 4HJJA 5D62A 4ZBVB 4A7YA 2AFGA 2K43A 1YF8B 4I4SA 1HWNB 1S0DA 3HSMA 2F2FA 2KI4A 3O49A 1XZZA 4I4YA 1RG8A 3RMXA 3UDAA 2D7RA 4ZGRB 4G6JA 4I37A 3QYDA 4MZFB 2NVHA 4EEEB 1EYLA 4L4IA 2NM1A 1N4KA 1Q04A 3BAGA 3H6SE 3NBNA 3P6JA 3WMVA 3ZC8A 2FDBM 3CU1B 1R8NA 31BIA 3P53A 4D0TA 4Q91A 5FZUA 3BX1C 1D0HA 2GZBA 4G6MA 3Q7YA 1BARA 1Z2VA 4Z9WB 1NUNA 1VCLA 3BA7A 3A23A 3FJEA 4QD2B 3V0AB 3OBRA 2RSTA 3FGMA 1WBAA 4I4XA 3OJMA 1S0LA 3HN1A 2KH2A 1AVAC 5FZYA 1DFCA 1T4QA 4TLPA 2DRYA 5BVPI 3LLPA 1S0BA 4Q9PA 3ZXDA 5F90A 1P63A 4F83A 4ZFUB 5BOWA 3O44A 4OEEA 1JLYA 4IQPA 4JKXB 3CAHA 3CRGA 3FJ9A 1EVTA 4QD2C 3CA3A 5BQUA 3N7MA 2K4AB 1MC9A 4ENDA 3Q7WA 2BFHA 1KNMA 2NP0A 2E4MA 4HR6C 3UD8A 4XFTA 1G9CA 3BADA 2D43A 3CQAA 1AF9A 2VU9A 1JY0A 1G9DA 3CA1A 5BP5C 4ZFYB 1L2HA 5I1BA 1SZ6B 1PWAA 3OJ2A 2D24A 2NYYA 1IT0A 3AJ6A 2IWTB 1SR4A 2MC2A 3HALA 4GAFA 2D23A 3ZC9A 3KMVA 2MIBA 3BAQA 3NBEA 1PZZA 2KI6B 1Z0HA 3OGGA 5GAQA 2L5XA 4J2YA 3A07A 2HWMA 3FUOA 3BRGC 3AJ5A 4OW4A 4D0ZA 4OUJA 3OBTA 3UJ4A 4XFUA 3VEQA 1Z4SA 5DVHA 4KEKA 4LO3A 4LO2C 3VWCA 3SNVA 2QN4A 4GP0A 3JRRA 4LO0C 4X37A 4IONA 2HW9A 4JRAA 3F1RA 4JP0A 3IIRA 2D44A 1CE7B 3OGFA 2ZR1B 1AVUA 4IY8A 4Z8SB 3P6IA 1BFGA 1YYNA 3O5WB 3O4DA 1TTUA 1HWPB 3S8JA 2X2TA 3FFZA 7I1BA 1OQLB 3VSFA 2Q3NB 4LO7B 3AH1A 1CVSA 2HWAA 4LO1C 4IY9A 4FVVA 4JPZA 3NBCA 1GGPB 2VXRA 3V0BA 1W3AA 3EF2A 3AKIA 3HMYA 1M16A 2QYIB 5EHAA 3VUOA 3FJBA 4I4VA 1YXWA 4I1BA 4QBVA 3CRHA 4EKXB 3BAUA 1FMMS 3WO2A 3NBDA 3CA5A 1FQ9A 3B9UA 4QC4A 5FZZA 3K1XA 3UD9A 1WBCA 4G9NA 3A21A 4I4QA 2BEAA 3FJFA 4IHZA 2DS0A 3CA0A 2VSEA 3ZXGA 4OEGA 1ISZA 1ITBA 2BEBA 1BASA 2FGFA 2NTDA 3CA4A 3O4AA 3N7LA 3VSZA 4I4RA 3H6RA 1ISWA 1DIWA 4I4OA 4II0A 4KC3A 4USOA 3WINC 6I1BA 1I1EA 2RG9B 5JLVA 4P0LA 8I1BA 3PHZA 3V0AA 2VXTI 1DJSB 3AKFA 1XG6A 3W9TA 1TOOA 1V6VA 4EFQA 4LO8B 4H9WA 2YUGA 1AFCA 4X3AA 1ONKB 3C9ZA 2VSAA 1JQZA 5BP5A 1BLDA 3V79C 4DEPA 3O3QA 3Q7XA 2R9KB 1JT7A 3HBWA 4CJMA 4GP3A 4J2KA 2D22A 1YBIA 3PMEA 3N0KA 4UY4A 4WBCA 4OEFA 2ZQOA 2GO2A 4QALA 3HOMA 3UJ0A 4G9MA 5BXPA 3D7WB 4I96A 1I1BA 1S0CA 1DZDA 4ISRA 4KBBA 1E0OA 3H6QA 3AZWA 3AH2A 4P6AA 5E24E 1BA7A 1JT3A 3S8KA 1HKNA 4D8HA 3R4UA 4OWLA 3FJJA 2FFVA 3FJ8A 1TFMB 2NZ9A 4J2SA 2AXMA 4GOVA 4PC4A 3O4CA 1DLLA 1G82A 1AXMA 3ILAA 4ZLBB 4LO2A 3R4SA 4I1EA 2VUAA 3F62B 4MZGB 1HCEA 5F8WA 5D63A 4H04A 3BAHA 1G9BA 4QBCA 1V6WA 2ZQNA 4GAIA 2XOAA 3TC2A 4DENA 4IZEA 1W3GA 2X2SA 4KEJA 5D61A 4OWKA 4OWJA 4HA2A 2MLLB 4ISQA 1IHKA 1JT5A 5EG6C 2Y9FA 3FJDA 1K5UA 3BB2A 1QXMA 3OJVA 4IYBA 5FNWA 1QQLA 4I6IA 3IM7A 4USPA 5DZUA 4AN6A 1S0GA 1Q03A 3QR5A 4LO1A 4EB2B 1BFFA 3BA4A 4DCKC 4P0JA 4JAWA 1BLAA 1ABRB 5BXRA 2M49A 3I2AA 4ZKTB 3CA6A 4AN7B 1W3FA 1ISXA 3N7JA 1FV3A 3I2XA 1JTCA 3V0BB 4ZFWB 4G1RA 3O4OA 4GOYA 4QKRA 1PUUB 4I8MA 1FMZA 2J3PA 2LIQA 3POKA 5DSSB 1BFBA 3IAGC 1MD6A 3FJIA 4LO7C 2F8XC 5JMCA 3MPPG 1UPSA 4QO3A 3PUBA 4I2SA 1TIEA 4H75A 5F8YA 3WINA 2Y9XE 3LTQA 2D1ZA 4JKQA 2K8RA 2WBCA 2F2FC 5G00A 1Q1UA 1FN0A 1DFQA 3FJHA 4J23B 1IJTA 4EFPA 2RQ9A 2Y9GA 2IHOA 1TP0A 1R8OA 3IM6A 1YTOA 4L4HA 1IILA 1EV2A 1PUMB 4A7KA 3ZX7A 1F31A 3H6RB 4ZOTA 1V6UA 3UD7A 2DRZA 1NZKA 2Z49A 1AVWB 2DREA 3FJKA 1XYFA 41BIA 4ZA3B 2AAIB 5FNXA 3FJCA 1FWUA 3O4BA 4I3NA 1RZOB 1JLXA 4X39A 1J0SA 2ERMA 2ESUA 3FUQA 1DQOA 2I1BA 1HIBA 9ILBA 3NJ5A 3RMYA 1FWVA 3RTJB 1A8DA 1FV2A 4Q9GA 4F34A 3AKGA 1ISYA 1IRAX 1S0EA 4IZXA 3RTIB 4MZHA 1HWMB 3E8LC 5HPZA 1M2TB 3T8SA 4X38A 5F8SA 5DUYA 3MALA 4A7ZA 1HCDA 21BIA 1T9FA 1HWOB 3BAVA 5BQUC 1WD4A 1IRPA 2D20A 2LIEA 2VLCA 3BRFA 3WMUA 1V6XA 1II4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E4M C;  4R6U B;  4I4P A;  1TWM A;  2P39 A;  3IM5 A;  5EC5 A;  2WRY A;  4I4U A;  1ISV A;  4KEI A;  4FGF A;  2FFU A;  2UUS A;  4LO0 A;  3I29 B;  2Q9X A;  2KKI A;  1EPW A;  1XHB A;  3BTA A;  3VT2 A;  2ET2 A;  3A22 A;  1RML A;  4I0Y A;  3JUT A;  4P0K A;  3FJA A;  3WA1 A;  1QQK A;  4XFS A;  3BAO A;  3N7K A;  1SR4 C;  1RY7 A;  5BXS A;  5B2H A;  1DZC A;  4YOL A;  4XKI A;  2D7I A;  3AKH A;  1G9A A;  1AVX B;  1IOB A;  3VT1 A;  5BXT A;  3AH4 A;  3BA5 A;  2KLL A;  4QKS A;  4EFR A;  2AQZ A;  2Y9W C;  3RSJ A;  1FGA A;  3BRD A;  4JQ0 A;  4I7I A;  1BFC A;  2Z48 A;  4LO3 C;  4J2X A;  2HZ9 A;  3AZV A;  3PG0 A;  3WO3 A;  1DQG A;  1S0F A;  3VT0 A;  1JT4 A;  1ILR 1;  1TWE A;  3WO4 A;  2FO1 A;  1K5V A;  1PC8 B;  1WD3 A;  2P23 A;  3CRI A;  4HJJ A;  5D62 A;  4ZBV B;  4A7Y A;  2AFG A;  2K43 A;  1YF8 B;  4I4S A;  1HWN B;  1S0D A;  3HSM A;  2F2F A;  2KI4 A;  3O49 A;  1XZZ A;  4I4Y A;  1RG8 A;  3RMX A;  3UDA A;  2D7R A;  4ZGR B;  4G6J A;  4I37 A;  3QYD A;  2NVH A;  4EEE B;  1EYL A;  4L4I A;  2NM1 A;  1N4K A;  1Q04 A;  3BAG A;  3H6S E;  3NBN A;  3P6J A;  3WMV A;  3ZC8 A;  2FDB M;  3CU1 B;  1R8N A;  31BI A;  3P53 A;  4D0T A;  4Q91 A;  5FZU A;  3BX1 C;  1D0H A;  2GZB A;  4G6M A;  3Q7Y A;  1BAR A;  1Z2V A;  4Z9W B;  1NUN A;  1VCL A;  3BA7 A;  3A23 A;  3FJE A;  4QD2 B;  3V0A B;  3OBR A;  2RST A;  3FGM A;  1WBA A;  4I4X A;  3OJM A;  1S0L A;  3HN1 A;  2KH2 A;  1AVA C;  5FZY A;  1DFC A;  1T4Q A;  4TLP A;  2DRY A;  5BVP I;  3LLP A;  1S0B A;  4Q9P A;  3ZXD A;  5F90 A;  1P63 A;  4F83 A;  4ZFU B;  5BOW A;  3O44 A;  4OEE A;  1JLY A;  4IQP A;  4JKX B;  3CAH A;  3CRG A;  3FJ9 A;  1EVT A;  4QD2 C;  3CA3 A;  5BQU A;  3N7M A;  2K4A B;  1MC9 A;  4END A;  3Q7W A;  2BFH A;  1KNM A;  2NP0 A;  2E4M A;  4HR6 C;  3UD8 A;  4XFT A;  1G9C A;  3BAD A;  2D43 A;  3CQA A;  1AF9 A;  2VU9 A;  1JY0 A;  1G9D A;  3CA1 A;  5BP5 C;  4ZFY B;  1L2H A;  5I1B A;  1SZ6 B;  1PWA A;  3OJ2 A;  2D24 A;  2NYY A;  1IT0 A;  3AJ6 A;  2IWT B;  1SR4 A;  2MC2 A;  3HAL A;  4GAF A;  2D23 A;  3ZC9 A;  3KMV A;  2MIB A;  3BAQ A;  3NBE A;  1PZZ A;  2KI6 B;  1Z0H A;  3OGG A;  5GAQ A;  2L5X A;  4J2Y A;  3A07 A;  2HWM A;  3FUO A;  3BRG C;  3AJ5 A;  4OW4 A;  4D0Z A;  4OUJ A;  3OBT A;  3UJ4 A;  4XFU A;  3VEQ A;  1Z4S A;  5DVH A;  4KEK A;  4LO3 A;  4LO2 C;  3VWC A;  3SNV A;  2QN4 A;  4GP0 A;  3JRR A;  4LO0 C;  4X37 A;  4ION A;  2HW9 A;  4JRA A;  3F1R A;  4JP0 A;  3IIR A;  2D44 A;  1CE7 B;  3OGF A;  2ZR1 B;  1AVU A;  4IY8 A;  4Z8S B;  3P6I A;  1BFG A;  1YYN A;  3O5W B;  3O4D A;  1TTU A;  1HWP B;  3S8J A;  2X2T A;  3FFZ A;  7I1B A;  1OQL B;  3VSF A;  2Q3N B;  4LO7 B;  3AH1 A;  1CVS A;  2HWA A;  4LO1 C;  4IY9 A;  4FVV A;  4JPZ A;  3NBC A;  1GGP B;  2VXR A;  3V0B A;  1W3A A;  3EF2 A;  3AKI A;  3HMY A;  1M16 A;  2QYI B;  5EHA A;  3VUO A;  3FJB A;  4I4V A;  1YXW A;  4I1B A;  4QBV A;  3CRH A;  4EKX B;  3BAU A;  1FMM S;  3WO2 A;  3NBD A;  3CA5 A;  1FQ9 A;  3B9U A;  4QC4 A;  5FZZ A;  3K1X A;  3UD9 A;  1WBC A;  4G9N A;  3A21 A;  4I4Q A;  2BEA A;  3FJF A;  4IHZ A;  2DS0 A;  3CA0 A;  2VSE A;  3ZXG A;  4OEG A;  1ISZ A;  1ITB A;  2BEB A;  1BAS A;  2FGF A;  2NTD A;  3CA4 A;  3O4A A;  3N7L A;  3VSZ A;  4I4R A;  3H6R A;  1ISW A;  1DIW A;  4I4O A;  4II0 A;  4KC3 A;  4USO A;  3WIN C;  6I1B A;  1I1E A;  2RG9 B;  5JLV A;  4P0L A;  8I1B A;  3PHZ A;  3V0A A;  2VXT I;  1DJS B;  3AKF A;  1XG6 A;  3W9T A;  1TOO A;  1V6V A;  4EFQ A;  4LO8 B;  4H9W A;  2YUG A;  1AFC A;  4X3A A;  1ONK B;  3C9Z A;  2VSA A;  1JQZ A;  5BP5 A;  1BLD A;  3V79 C;  4DEP A;  3O3Q A;  3Q7X A;  2R9K B;  1JT7 A;  3HBW A;  4CJM A;  4GP3 A;  4J2K A;  2D22 A;  1YBI A;  3PME A;  3N0K A;  4WBC A;  4OEF A;  2ZQO A;  2GO2 A;  4QAL A;  3HOM A;  3UJ0 A;  4G9M A;  5BXP A;  3D7W B;  4I96 A;  1I1B A;  1S0C A;  1DZD A;  4ISR A;  4KBB A;  1E0O A;  3H6Q A;  3AZW A;  3AH2 A;  4P6A A;  5E24 E;  1BA7 A;  1JT3 A;  3S8K A;  1HKN A;  4D8H A;  3R4U A;  4OWL A;  3FJJ A;  2FFV A;  3FJ8 A;  1TFM B;  2NZ9 A;  4J2S A;  2AXM A;  4GOV A;  4PC4 A;  3O4C A;  1DLL A;  1G82 A;  1AXM A;  3ILA A;  4ZLB B;  4LO2 A;  3R4S A;  4I1E A;  2VUA A;  3F62 B;  5F8W A;  1HCE A;  5D63 A;  4H04 A;  3BAH A;  1G9B A;  4QBC A;  1V6W A;  2ZQN A;  4GAI A;  2XOA A;  3TC2 A;  4DEN A;  4IZE A;  1W3G A;  2X2S A;  4KEJ A;  5D61 A;  4OWK A;  4OWJ A;  4HA2 A;  2MLL B;  4ISQ A;  1IHK A;  1JT5 A;  5EG6 C;  2Y9F A;  3FJD A;  1K5U A;  3BB2 A;  1QXM A;  3OJV A;  4IYB A;  5FNW A;  1QQL A;  4I6I A;  3IM7 A;  4USP A;  5DZU A;  4AN6 A;  1S0G A;  1Q03 A;  3QR5 A;  4LO1 A;  4EB2 B;  1BFF A;  3BA4 A;  4DCK C;  4P0J A;  4JAW A;  1BLA A;  1ABR B;  5BXR A;  2M49 A;  3I2A A;  4ZKT B;  3CA6 A;  4AN7 B;  1W3F A;  1ISX A;  3N7J A;  1FV3 A;  3I2X A;  1JTC A;  3V0B B;  4ZFW B;  4G1R A;  3O4O A;  4GOY A;  4QKR A;  1PUU B;  4I8M A;  1FMZ A;  2J3P A;  2LIQ A;  3POK A;  5DSS B;  1BFB A;  3IAG C;  1MD6 A;  3FJI A;  4LO7 C;  2F8X C;  5JMC A;  3MPP G;  1UPS A;  4QO3 A;  3PUB A;  4I2S A;  1TIE A;  5F8Y A;  3WIN A;  2Y9X E;  3LTQ A;  2D1Z A;  4JKQ A;  2K8R A;  2WBC A;  2F2F C;  5G00 A;  1Q1U A;  1FN0 A;  1DFQ A;  3FJH A;  4J23 B;  1IJT A;  4EFP A;  2RQ9 A;  2Y9G A;  2IHO A;  1TP0 A;  1R8O A;  3IM6 A;  1YTO A;  4L4H A;  1IIL A;  1EV2 A;  1PUM B;  4A7K A;  3ZX7 A;  1F31 A;  3H6R B;  4ZOT A;  1V6U A;  3UD7 A;  2DRZ A;  1NZK A;  2Z49 A;  1AVW B;  2DRE A;  3FJK A;  1XYF A;  41BI A;  4ZA3 B;  2AAI B;  5FNX A;  3FJC A;  1FWU A;  3O4B A;  4I3N A;  1RZO B;  1JLX A;  4X39 A;  1J0S A;  2ERM A;  2ESU A;  3FUQ A;  1DQO A;  2I1B A;  1HIB A;  9ILB A;  3NJ5 A;  3RMY A;  1FWV A;  3RTJ B;  1A8D A;  1FV2 A;  4Q9G A;  4F34 A;  3AKG A;  1ISY A;  1IRA X;  1S0E A;  4IZX A;  3RTI B;  1HWM B;  3E8L C;  5HPZ A;  1M2T B;  3T8S A;  4X38 A;  5F8S A;  5DUY A;  3MAL A;  4A7Z A;  1HCD A;  21BI A;  1T9F A;  1HWO B;  3BAV A;  5BQU C;  1WD4 A;  1IRP A;  2D20 A;  2LIE A;  2VLC A;  3BRF A;  3WMU A;  1V6X A;  1II4 A; 
#chains in the Genus database with same CATH topology
 2E4M C;  4R6U B;  2NS2 A;  4I4P A;  1TWM A;  2P39 A;  3IM5 A;  5EC5 A;  2WRY A;  4I4U A;  1ISV A;  4KEI A;  4FGF A;  2FFU A;  2UUS A;  4LO0 A;  3I29 B;  2Q9X A;  2KKI A;  1EPW A;  1XHB A;  3BTA A;  3VT2 A;  2ET2 A;  3A22 A;  1RML A;  4I0Y A;  3JUT A;  4P0K A;  3FJA A;  3WA1 A;  1QQK A;  4XFS A;  3BAO A;  3N7K A;  1SR4 C;  1RY7 A;  5BXS A;  5B2H A;  1DZC A;  4YOL A;  4XKI A;  2D7I A;  3AKH A;  1G9A A;  1AVX B;  1IOB A;  3VT1 A;  5BXT A;  3AH4 A;  3BA5 A;  2KLL A;  4QKS A;  4EFR A;  2AQZ A;  2Y9W C;  3RSJ A;  1FGA A;  3BRD A;  4JQ0 A;  4I7I A;  1BFC A;  2Z48 A;  4LO3 C;  4J2X A;  2HZ9 A;  3AZV A;  3PG0 A;  3WO3 A;  1DQG A;  1S0F A;  3VT0 A;  1JT4 A;  1ILR 1;  1TWE A;  3WO4 A;  2FO1 A;  1K5V A;  1PC8 B;  1WD3 A;  2P23 A;  3CRI A;  4HJJ A;  5D62 A;  4ZBV B;  4A7Y A;  2AFG A;  2K43 A;  1YF8 B;  4I4S A;  1HWN B;  1S0D A;  3HSM A;  2F2F A;  2KI4 A;  3O49 A;  1XZZ A;  4I4Y A;  1RG8 A;  3RMX A;  3UDA A;  2D7R A;  4ZGR B;  4G6J A;  4I37 A;  3QYD A;  4MZF B;  2NVH A;  4EEE B;  1EYL A;  4L4I A;  2NM1 A;  1N4K A;  1Q04 A;  3BAG A;  3H6S E;  3NBN A;  3P6J A;  3WMV A;  3ZC8 A;  2FDB M;  3CU1 B;  1R8N A;  31BI A;  3P53 A;  4D0T A;  4Q91 A;  5FZU A;  3BX1 C;  1D0H A;  2GZB A;  4G6M A;  3Q7Y A;  1BAR A;  1Z2V A;  4Z9W B;  1NUN A;  1VCL A;  3BA7 A;  3A23 A;  3FJE A;  4QD2 B;  3V0A B;  3OBR A;  2RST A;  3FGM A;  1WBA A;  4I4X A;  3OJM A;  1S0L A;  3HN1 A;  2KH2 A;  1AVA C;  5FZY A;  1DFC A;  1T4Q A;  4TLP A;  2DRY A;  5BVP I;  3LLP A;  1S0B A;  4Q9P A;  3ZXD A;  5F90 A;  1P63 A;  4F83 A;  4ZFU B;  5BOW A;  3O44 A;  4OEE A;  1JLY A;  4IQP A;  4JKX B;  3CAH A;  3CRG A;  3FJ9 A;  1EVT A;  4QD2 C;  3CA3 A;  5BQU A;  3N7M A;  2K4A B;  1MC9 A;  4END A;  3Q7W A;  2BFH A;  1KNM A;  2NP0 A;  2E4M A;  4HR6 C;  3UD8 A;  4XFT A;  1G9C A;  3BAD A;  2D43 A;  3CQA A;  1AF9 A;  2VU9 A;  1JY0 A;  1G9D A;  3CA1 A;  5BP5 C;  4ZFY B;  1L2H A;  5I1B A;  1SZ6 B;  1PWA A;  3OJ2 A;  2D24 A;  2NYY A;  1IT0 A;  3AJ6 A;  2IWT B;  1SR4 A;  2MC2 A;  3HAL A;  4GAF A;  2D23 A;  3ZC9 A;  3KMV A;  2MIB A;  3BAQ A;  3NBE A;  1PZZ A;  2KI6 B;  1Z0H A;  3OGG A;  5GAQ A;  2L5X A;  4J2Y A;  3A07 A;  2HWM A;  3FUO A;  3BRG C;  3AJ5 A;  4OW4 A;  4D0Z A;  4OUJ A;  3OBT A;  3UJ4 A;  4XFU A;  3VEQ A;  1Z4S A;  5DVH A;  4KEK A;  4LO3 A;  4LO2 C;  3VWC A;  3SNV A;  2QN4 A;  4GP0 A;  3JRR A;  4LO0 C;  4X37 A;  4ION A;  2HW9 A;  4JRA A;  3F1R A;  4JP0 A;  3IIR A;  2D44 A;  1CE7 B;  3OGF A;  2ZR1 B;  1AVU A;  4IY8 A;  4Z8S B;  3P6I A;  1BFG A;  1YYN A;  3O5W B;  3O4D A;  1TTU A;  1HWP B;  3S8J A;  2X2T A;  3FFZ A;  7I1B A;  1OQL B;  3VSF A;  2Q3N B;  4LO7 B;  3AH1 A;  1CVS A;  2HWA A;  4LO1 C;  4IY9 A;  4FVV A;  4JPZ A;  3NBC A;  1GGP B;  2VXR A;  3V0B A;  1W3A A;  3EF2 A;  3AKI A;  3HMY A;  1M16 A;  2QYI B;  5EHA A;  3VUO A;  3FJB A;  4I4V A;  1YXW A;  4I1B A;  4QBV A;  3CRH A;  4EKX B;  3BAU A;  1FMM S;  3WO2 A;  3NBD A;  3CA5 A;  1FQ9 A;  3B9U A;  4QC4 A;  5FZZ A;  3K1X A;  3UD9 A;  1WBC A;  4G9N A;  3A21 A;  4I4Q A;  2BEA A;  3FJF A;  4IHZ A;  2DS0 A;  3CA0 A;  2VSE A;  3ZXG A;  4OEG A;  1ISZ A;  1ITB A;  2BEB A;  1BAS A;  2FGF A;  2NTD A;  3CA4 A;  3O4A A;  3N7L A;  3VSZ A;  4I4R A;  3H6R A;  1ISW A;  1DIW A;  4I4O A;  4II0 A;  4KC3 A;  4USO A;  3WIN C;  6I1B A;  1I1E A;  2RG9 B;  5JLV A;  4P0L A;  8I1B A;  3PHZ A;  3V0A A;  2VXT I;  1DJS B;  3AKF A;  1XG6 A;  3W9T A;  1TOO A;  1V6V A;  4EFQ A;  4LO8 B;  4H9W A;  2YUG A;  1AFC A;  4X3A A;  1ONK B;  3C9Z A;  2VSA A;  1JQZ A;  5BP5 A;  1BLD A;  3V79 C;  4DEP A;  3O3Q A;  3Q7X A;  2R9K B;  1JT7 A;  3HBW A;  4CJM A;  4GP3 A;  4J2K A;  2D22 A;  1YBI A;  3PME A;  3N0K A;  4UY4 A;  4WBC A;  4OEF A;  2ZQO A;  2GO2 A;  4QAL A;  3HOM A;  3UJ0 A;  4G9M A;  5BXP A;  3D7W B;  4I96 A;  1I1B A;  1S0C A;  1DZD A;  4ISR A;  4KBB A;  1E0O A;  3H6Q A;  3AZW A;  3AH2 A;  4P6A A;  5E24 E;  1BA7 A;  1JT3 A;  3S8K A;  1HKN A;  4D8H A;  3R4U A;  4OWL A;  3FJJ A;  2FFV A;  3FJ8 A;  1TFM B;  2NZ9 A;  4J2S A;  2AXM A;  4GOV A;  4PC4 A;  3O4C A;  1DLL A;  1G82 A;  1AXM A;  3ILA A;  4ZLB B;  4LO2 A;  3R4S A;  4I1E A;  2VUA A;  3F62 B;  4MZG B;  1HCE A;  5F8W A;  5D63 A;  4H04 A;  3BAH A;  1G9B A;  4QBC A;  1V6W A;  2ZQN A;  4GAI A;  2XOA A;  3TC2 A;  4DEN A;  4IZE A;  1W3G A;  2X2S A;  4KEJ A;  5D61 A;  4OWK A;  4OWJ A;  4HA2 A;  2MLL B;  4ISQ A;  1IHK A;  1JT5 A;  5EG6 C;  2Y9F A;  3FJD A;  1K5U A;  3BB2 A;  1QXM A;  3OJV A;  4IYB A;  5FNW A;  1QQL A;  4I6I A;  3IM7 A;  4USP A;  5DZU A;  4AN6 A;  1S0G A;  1Q03 A;  3QR5 A;  4LO1 A;  4EB2 B;  1BFF A;  3BA4 A;  4DCK C;  4P0J A;  4JAW A;  1BLA A;  1ABR B;  5BXR A;  2M49 A;  3I2A A;  4ZKT B;  3CA6 A;  4AN7 B;  1W3F A;  1ISX A;  3N7J A;  1FV3 A;  3I2X A;  1JTC A;  3V0B B;  4ZFW B;  4G1R A;  3O4O A;  4GOY A;  4QKR A;  1PUU B;  4I8M A;  1FMZ A;  2J3P A;  2LIQ A;  3POK A;  5DSS B;  1BFB A;  3IAG C;  1MD6 A;  3FJI A;  4LO7 C;  2F8X C;  5JMC A;  3MPP G;  1UPS A;  4QO3 A;  3PUB A;  4I2S A;  1TIE A;  4H75 A;  5F8Y A;  3WIN A;  2Y9X E;  3LTQ A;  2D1Z A;  4JKQ A;  2K8R A;  2WBC A;  2F2F C;  5G00 A;  1Q1U A;  1FN0 A;  1DFQ A;  3FJH A;  4J23 B;  1IJT A;  4EFP A;  2RQ9 A;  2Y9G A;  2IHO A;  1TP0 A;  1R8O A;  3IM6 A;  1YTO A;  4L4H A;  1IIL A;  1EV2 A;  1PUM B;  4A7K A;  3ZX7 A;  1F31 A;  3H6R B;  4ZOT A;  1V6U A;  3UD7 A;  2DRZ A;  1NZK A;  2Z49 A;  1AVW B;  2DRE A;  3FJK A;  1XYF A;  41BI A;  4ZA3 B;  2AAI B;  5FNX A;  3FJC A;  1FWU A;  3O4B A;  4I3N A;  1RZO B;  1JLX A;  4X39 A;  1J0S A;  2ERM A;  2ESU A;  3FUQ A;  1DQO A;  2I1B A;  1HIB A;  9ILB A;  3NJ5 A;  3RMY A;  1FWV A;  3RTJ B;  1A8D A;  1FV2 A;  4Q9G A;  4F34 A;  3AKG A;  1ISY A;  1IRA X;  1S0E A;  4IZX A;  3RTI B;  4MZH A;  1HWM B;  3E8L C;  5HPZ A;  1M2T B;  3T8S A;  4X38 A;  5F8S A;  5DUY A;  3MAL A;  4A7Z A;  1HCD A;  21BI A;  1T9F A;  1HWO B;  3BAV A;  5BQU C;  1WD4 A;  1IRP A;  2D20 A;  2LIE A;  2VLC A;  3BRF A;  3WMU A;  1V6X A;  1II4 A; 
#chains in the Genus database with same CATH homology
 2E4M C;  4R6U B;  2NS2 A;  4I4P A;  1TWM A;  2P39 A;  3IM5 A;  5EC5 A;  2WRY A;  4I4U A;  1ISV A;  4KEI A;  4FGF A;  2FFU A;  2UUS A;  4LO0 A;  3I29 B;  2Q9X A;  2KKI A;  1EPW A;  1XHB A;  3BTA A;  3VT2 A;  2ET2 A;  3A22 A;  1RML A;  4I0Y A;  3JUT A;  4P0K A;  3FJA A;  3WA1 A;  1QQK A;  4XFS A;  3BAO A;  3N7K A;  1SR4 C;  1RY7 A;  5BXS A;  5B2H A;  1DZC A;  4YOL A;  4XKI A;  2D7I A;  3AKH A;  1G9A A;  1AVX B;  1IOB A;  3VT1 A;  5BXT A;  3AH4 A;  3BA5 A;  2KLL A;  4QKS A;  4EFR A;  2AQZ A;  2Y9W C;  3RSJ A;  1FGA A;  3BRD A;  4JQ0 A;  4I7I A;  1BFC A;  2Z48 A;  4LO3 C;  4J2X A;  2HZ9 A;  3AZV A;  3PG0 A;  3WO3 A;  1DQG A;  1S0F A;  3VT0 A;  1JT4 A;  1ILR 1;  1TWE A;  3WO4 A;  2FO1 A;  1K5V A;  1PC8 B;  1WD3 A;  2P23 A;  3CRI A;  4HJJ A;  5D62 A;  4ZBV B;  4A7Y A;  2AFG A;  2K43 A;  1YF8 B;  4I4S A;  1HWN B;  1S0D A;  3HSM A;  2F2F A;  2KI4 A;  3O49 A;  1XZZ A;  4I4Y A;  1RG8 A;  3RMX A;  3UDA A;  2D7R A;  4ZGR B;  4G6J A;  4I37 A;  3QYD A;  4MZF B;  2NVH A;  4EEE B;  1EYL A;  4L4I A;  2NM1 A;  1N4K A;  1Q04 A;  3BAG A;  3H6S E;  3NBN A;  3P6J A;  3WMV A;  3ZC8 A;  2FDB M;  3CU1 B;  1R8N A;  31BI A;  3P53 A;  4D0T A;  4Q91 A;  5FZU A;  3BX1 C;  1D0H A;  2GZB A;  4G6M A;  3Q7Y A;  1BAR A;  1Z2V A;  4Z9W B;  1NUN A;  1VCL A;  3BA7 A;  3A23 A;  3FJE A;  4QD2 B;  3V0A B;  3OBR A;  2RST A;  3FGM A;  1WBA A;  4I4X A;  3OJM A;  1S0L A;  3HN1 A;  2KH2 A;  1AVA C;  5FZY A;  1DFC A;  1T4Q A;  4TLP A;  2DRY A;  5BVP I;  3LLP A;  1S0B A;  4Q9P A;  3ZXD A;  5F90 A;  1P63 A;  4F83 A;  4ZFU B;  5BOW A;  3O44 A;  4OEE A;  1JLY A;  4IQP A;  4JKX B;  3CAH A;  3CRG A;  3FJ9 A;  1EVT A;  4QD2 C;  3CA3 A;  5BQU A;  3N7M A;  2K4A B;  1MC9 A;  4END A;  3Q7W A;  2BFH A;  1KNM A;  2NP0 A;  2E4M A;  4HR6 C;  3UD8 A;  4XFT A;  1G9C A;  3BAD A;  2D43 A;  3CQA A;  1AF9 A;  2VU9 A;  1JY0 A;  1G9D A;  3CA1 A;  5BP5 C;  4ZFY B;  1L2H A;  5I1B A;  1SZ6 B;  1PWA A;  3OJ2 A;  2D24 A;  2NYY A;  1IT0 A;  3AJ6 A;  2IWT B;  1SR4 A;  2MC2 A;  3HAL A;  4GAF A;  2D23 A;  3ZC9 A;  3KMV A;  2MIB A;  3BAQ A;  3NBE A;  1PZZ A;  2KI6 B;  1Z0H A;  3OGG A;  5GAQ A;  2L5X A;  4J2Y A;  3A07 A;  2HWM A;  3FUO A;  3BRG C;  3AJ5 A;  4OW4 A;  4D0Z A;  4OUJ A;  3OBT A;  3UJ4 A;  4XFU A;  3VEQ A;  1Z4S A;  5DVH A;  4KEK A;  4LO3 A;  4LO2 C;  3VWC A;  3SNV A;  2QN4 A;  4GP0 A;  3JRR A;  4LO0 C;  4X37 A;  4ION A;  2HW9 A;  4JRA A;  3F1R A;  4JP0 A;  3IIR A;  2D44 A;  1CE7 B;  3OGF A;  2ZR1 B;  1AVU A;  4IY8 A;  4Z8S B;  3P6I A;  1BFG A;  1YYN A;  3O5W B;  3O4D A;  1TTU A;  1HWP B;  3S8J A;  2X2T A;  3FFZ A;  7I1B A;  1OQL B;  3VSF A;  2Q3N B;  4LO7 B;  3AH1 A;  1CVS A;  2HWA A;  4LO1 C;  4IY9 A;  4FVV A;  4JPZ A;  3NBC A;  1GGP B;  2VXR A;  3V0B A;  1W3A A;  3EF2 A;  3AKI A;  3HMY A;  1M16 A;  2QYI B;  5EHA A;  3VUO A;  3FJB A;  4I4V A;  1YXW A;  4I1B A;  4QBV A;  3CRH A;  4EKX B;  3BAU A;  1FMM S;  3WO2 A;  3NBD A;  3CA5 A;  1FQ9 A;  3B9U A;  4QC4 A;  5FZZ A;  3K1X A;  3UD9 A;  1WBC A;  4G9N A;  3A21 A;  4I4Q A;  2BEA A;  3FJF A;  4IHZ A;  2DS0 A;  3CA0 A;  2VSE A;  3ZXG A;  4OEG A;  1ISZ A;  1ITB A;  2BEB A;  1BAS A;  2FGF A;  2NTD A;  3CA4 A;  3O4A A;  3N7L A;  3VSZ A;  4I4R A;  3H6R A;  1ISW A;  1DIW A;  4I4O A;  4II0 A;  4KC3 A;  4USO A;  3WIN C;  6I1B A;  1I1E A;  2RG9 B;  5JLV A;  4P0L A;  8I1B A;  3PHZ A;  3V0A A;  2VXT I;  1DJS B;  3AKF A;  1XG6 A;  3W9T A;  1TOO A;  1V6V A;  4EFQ A;  4LO8 B;  4H9W A;  2YUG A;  1AFC A;  4X3A A;  1ONK B;  3C9Z A;  2VSA A;  1JQZ A;  5BP5 A;  1BLD A;  3V79 C;  4DEP A;  3O3Q A;  3Q7X A;  2R9K B;  1JT7 A;  3HBW A;  4CJM A;  4GP3 A;  4J2K A;  2D22 A;  1YBI A;  3PME A;  3N0K A;  4UY4 A;  4WBC A;  4OEF A;  2ZQO A;  2GO2 A;  4QAL A;  3HOM A;  3UJ0 A;  4G9M A;  5BXP A;  3D7W B;  4I96 A;  1I1B A;  1S0C A;  1DZD A;  4ISR A;  4KBB A;  1E0O A;  3H6Q A;  3AZW A;  3AH2 A;  4P6A A;  5E24 E;  1BA7 A;  1JT3 A;  3S8K A;  1HKN A;  4D8H A;  3R4U A;  4OWL A;  3FJJ A;  2FFV A;  3FJ8 A;  1TFM B;  2NZ9 A;  4J2S A;  2AXM A;  4GOV A;  4PC4 A;  3O4C A;  1DLL A;  1G82 A;  1AXM A;  3ILA A;  4ZLB B;  4LO2 A;  3R4S A;  4I1E A;  2VUA A;  3F62 B;  4MZG B;  1HCE A;  5F8W A;  5D63 A;  4H04 A;  3BAH A;  1G9B A;  4QBC A;  1V6W A;  2ZQN A;  4GAI A;  2XOA A;  3TC2 A;  4DEN A;  4IZE A;  1W3G A;  2X2S A;  4KEJ A;  5D61 A;  4OWK A;  4OWJ A;  4HA2 A;  2MLL B;  4ISQ A;  1IHK A;  1JT5 A;  5EG6 C;  2Y9F A;  3FJD A;  1K5U A;  3BB2 A;  1QXM A;  3OJV A;  4IYB A;  5FNW A;  1QQL A;  4I6I A;  3IM7 A;  4USP A;  5DZU A;  4AN6 A;  1S0G A;  1Q03 A;  3QR5 A;  4LO1 A;  4EB2 B;  1BFF A;  3BA4 A;  4DCK C;  4P0J A;  4JAW A;  1BLA A;  1ABR B;  5BXR A;  2M49 A;  3I2A A;  4ZKT B;  3CA6 A;  4AN7 B;  1W3F A;  1ISX A;  3N7J A;  1FV3 A;  3I2X A;  1JTC A;  3V0B B;  4ZFW B;  4G1R A;  3O4O A;  4GOY A;  4QKR A;  1PUU B;  4I8M A;  1FMZ A;  2J3P A;  2LIQ A;  3POK A;  5DSS B;  1BFB A;  3IAG C;  1MD6 A;  3FJI A;  4LO7 C;  2F8X C;  5JMC A;  3MPP G;  1UPS A;  4QO3 A;  3PUB A;  4I2S A;  1TIE A;  4H75 A;  5F8Y A;  3WIN A;  2Y9X E;  3LTQ A;  2D1Z A;  4JKQ A;  2K8R A;  2WBC A;  2F2F C;  5G00 A;  1Q1U A;  1FN0 A;  1DFQ A;  3FJH A;  4J23 B;  1IJT A;  4EFP A;  2RQ9 A;  2Y9G A;  2IHO A;  1TP0 A;  1R8O A;  3IM6 A;  1YTO A;  4L4H A;  1IIL A;  1EV2 A;  1PUM B;  4A7K A;  3ZX7 A;  1F31 A;  3H6R B;  4ZOT A;  1V6U A;  3UD7 A;  2DRZ A;  1NZK A;  2Z49 A;  1AVW B;  2DRE A;  3FJK A;  1XYF A;  41BI A;  4ZA3 B;  2AAI B;  5FNX A;  3FJC A;  1FWU A;  3O4B A;  4I3N A;  1RZO B;  1JLX A;  4X39 A;  1J0S A;  2ERM A;  2ESU A;  3FUQ A;  1DQO A;  2I1B A;  1HIB A;  9ILB A;  3NJ5 A;  3RMY A;  1FWV A;  3RTJ B;  1A8D A;  1FV2 A;  4Q9G A;  4F34 A;  3AKG A;  1ISY A;  1IRA X;  1S0E A;  4IZX A;  3RTI B;  4MZH A;  1HWM B;  3E8L C;  5HPZ A;  1M2T B;  3T8S A;  4X38 A;  5F8S A;  5DUY A;  3MAL A;  4A7Z A;  1HCD A;  21BI A;  1T9F A;  1HWO B;  3BAV A;  5BQU C;  1WD4 A;  1IRP A;  2D20 A;  2LIE A;  2VLC A;  3BRF A;  3WMU A;  1V6X A;  1II4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...