2AXMA

Heparin-linked biologically-active dimer of fibroblast growth factor
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
130
structure length
130
Chain Sequence
b'KKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ACIDIC FIBROBLAST GROWTH FACTOR
publication title Structure of a heparin-linked biologically active dimer of fibroblast growth factor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 30
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 1997-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2axmA00
2FFVA 4OUJA 3SNVA 2P39A 2K8RA 2RQ9A 4ZFWB 1DFCA 1Z2VA 4OWKA 4G1RA 1JT5A 4JPZA 1BASA 3S8JA 3P6JA 1IT0A 3O4OA 1QQLA 4PC4A 1TTUA 3BAQA 4LO3C 4QKRA 3BAOA 3PMEA 3JUTA 5FNWA 5FZUA 3OBRA 5G00A 3V0BA 2Y9WC 1V6UA 1AFCA 1MD6A 3FJ9A 3HSMA 1HWNB 2FDBM 1G9DA 3IAGC 21BIA 1WD4A 1G9BA 2AFGA 4ZLBB 3AH4A 3N0KA 3AZWA 2LIQA 2E4MC 2E4MA 1PC8B 2P23A 2BEBA 3BRGC 3O5WB 3FJEA 3POKA 1S0FA 4LO1C 1YTOA 1RZOB 4G9MA 4DENA 1FV3A 3BRFA 2J3PA 3IIRA 5BVPI 1DLLA 1JY0A 1F31A 4JKXB 4XFUA 2KI4A 2D44A 1IRAX 3CU1B 1ILR1 1AXMA 3VSZA 5B2HA 1ISVA 1K5VA 3O49A 1HWMB 2ZQNA 1V6VA 2HWMA 3O4BA 1SR4C 4IONA 3R4UA 4JQ0A 3BADA 4I1BA 3HMYA 1NZKA 2UUSA 3CA5A 2ESUA 4EFQA 1I1BA 1W3FA 4I4XA 5D61A 1HCDA 9ILBA 3N7LA 2Q9XA 3H6RA 3A23A 1DZCA 4J2YA 1VCLA 2MC2A 4H9WA 3BAGA 3OGGA 3CA6A 3BRDA 3W9TA 1EPWA 4IYBA 4ZFYB 4CJMA 2ZQOA 1XHBA 1BFFA 1G9AA 4JP0A 5BXTA 1QXMA 4ZKTB 1DQGA 3F62B 3AKFA 1CVSA 3RTIB 1PZZA 2D1ZA 4ZFUB 1IRPA 1W3AA 2QN4A 4GP3A 3EF2A 4XFTA 1RG8A 1HWOB 1ISZA 3NBEA 1A8DA 3UD8A 1SZ6B 2GO2A 1QQKA 4IZXA 4KEKA 3ZX7A 4I0YA 4DCKC 4H04A 3UJ0A 1BFGA 3FFZA 4I96A 2IHOA 3AKIA 3CRGA 3FGMA 4X3AA 3NBNA 1IJTA 3WO2A 2WRYA 3I29B 2VSAA 2HZ9A 3AKGA 1YBIA 1IHKA 3PUBA 5BQUC 5JMCA 3WMVA 3HALA 1XZZA 1HWPB 3NBDA 3Q7YA 2F8XC 1S0DA 3A07A 3FJAA 1XG6A 5EC5A 2MIBA 3CRHA 4EEEB 3IM7A 5BOWA 1XYFA 2DRZA 5DSSB 4IZEA 4I7IA 1PUMB 4I4YA 3AJ5A 2LIEA 3WA1A 1AVAC 3AH2A 3HBWA 2KKIA 1ISYA 3OBTA 3C9ZA 3CA3A 1RY7A 3TC2A 1WBCA 1YF8B 3O4DA 4I3NA 4A7YA 4EKXB 5I1BA 1YYNA 1BA7A 1S0CA 1FMMS 4KEIA 1G82A 4ZBVB 4J2XA 1PUUB 4JRAA 4OEFA 1JLXA 2FFUA 3N7KA 4Q9PA 3OJMA 4KEJA 3FJHA 3FUQA 4P0KA 3NBCA 3P53A 3ZC9A 3FJDA 3BA4A 3A22A 2L5XA 4FGFA 4L4HA 4Q9GA 4R6UB 4L4IA 3BB2A 4IQPA 2YUGA 3VT0A 5JLVA 2Z48A 1AVXB 1Z4SA 4HJJA 4ISRA 3UD9A 3K1XA 3OJVA 3OGFA 3LTQA 3O44A 4QD2B 1BFCA 1ISWA 1ITBA 2X2SA 1ABRB 4LO0A 2DREA 2VU9A 1WD3A 4I4PA 4OEGA 3BTAA 4P0JA 4TLPA 2VXTI 4Z9WB 4FVVA 2VSEA 3BAUA 2D7RA 3BA7A 1DQOA 2D43A 2DS0A 4IY9A 3FUOA 1EYLA 1Q03A 2ERMA 3I2AA 4GOYA 2IWTB 1ONKB 1EV2A 5DUYA 3FJFA 1JLYA 4D8HA 2MLLB 2RG9B 5FZZA 1JT7A 3WINC 2M49A 4XKIA 3WINA 4Z8SB 3V0AB 3R4SA 5E24E 4LO7B 4XFSA 4IHZA 1Q1UA 1DJSB 2Q3NB 3E8LC 2RSTA 1HIBA 3AZVA 3JRRA 3QYDA 2X2TA 1TFMB 4LO2A 3VEQA 1V6XA 3VUOA 1DIWA 3O4CA 1AVWB 1HCEA 1TOOA 1UPSA 5FZYA 1T4QA 2FGFA 4I37A 4J23B 4DEPA 3O4AA 1S0GA 1IOBA 3RTJB 4Q91A 1EVTA 1TWMA 1DZDA 4GAFA 1FGAA 1BFBA 2I1BA 1BLDA 5FNXA 1M2TB 3V0BB 4G6JA 1AVUA 4I2SA 1TIEA 3N7MA 3OJ2A 3CQAA 4QALA 3UDAA 1N4KA 1R8NA 3KMVA 4GAIA 2BEAA 4J2KA 3BA5A 8I1BA 5GAQA 3MPPG 3AKHA 1TP0A 3VSFA 1I1EA 5BXSA 2FO1A 4I4RA 1RMLA 3V0AA 2K43A 3CAHA 4GP0A 2D7IA 5BP5C 1YXWA 3H6QA 5BP5A 1JT4A 3S8KA 2KLLA 4USPA 3CA0A 4J2SA 5D62A 3WO3A 3LLPA 1T9FA 1L2HA 2QYIB 2VLCA 4ENDA 3FJ8A 4OEEA 3RMYA 3IM6A 4G9NA 5F8WA 1JTCA 4G6MA 3ZXGA 3VWCA 4LO3A 2Y9XE 4KC3A 3ZC8A 1ISXA 1D0HA 3H6RB 2NZ9A 1K5UA 5EG6C 3CA1A 2K4AB 4I1EA 4QC4A 3FJBA 4IY8A 4F34A 4ZOTA 3AH1A 4EB2B 2NVHA 5F8SA 3P6IA 2AXMA 1S0EA 5DVHA 4I4SA 1CE7B 3AJ6A 1HKNA 4P6AA 3IM5A 3V79C 3ZXDA 1S0LA 4P0LA 3FJCA 4I4VA 1OQLB 1II4A 4I8MA 4X38A 5HPZA 4JAWA 3NJ5A 4I6IA 4HA2A 4LO0C 4EFRA 2Y9FA 4KBBA 1WBAA 1JQZA 1W3GA 2NM1A 4AN6A 4LO1A 1BARA 4QO3A 3WMUA 1FN0A 4I4QA 2HW9A 2KH2A 3PHZA 3O3QA 3Q7WA 3ILAA 1TWEA 41BIA 4I4UA 3VT1A 2KI6B 4I4OA 4X37A 3UD7A 1NUNA 2NP0A 3UJ4A 2GZBA 1E0OA 4GOVA 2D20A 4QKSA 4QBVA 4X39A 4LO8B 2ET2A 1BLAA 1FWVA 1P63A 3BAHA 4II0A 3T8SA 1SR4A 2VUAA 3CA4A 5D63A 3H6SE 2VXRA 4OW4A 2AQZA 3RMXA 2D22A 3CRIA 3HOMA 1Q04A 4ZGRB 1G9CA 4LO2C 4ZA3B 1JT3A 1FV2A 4D0TA 2Z49A 3A21A 1KNMA 1M16A 3WO4A 1S0BA 2ZR1B 3D7WB 1FQ9A 5F90A 5BXRA 2F2FC 4A7KA 2F2FA 4WBCA 4OWJA 3RSJA 2NYYA 5DZUA 5BXPA 1MC9A 4QD2C 4A7ZA 3MALA 4HR6C 3BAVA 1GGPB 3PG0A 1R8OA 2Y9GA 4QBCA 4F83A 2D24A 4YOLA 1DFQA 3QR5A 4EFPA 3I2XA 6I1BA 4USOA 2NTDA 3B9UA 4ISQA 4AN7B 3VT2A 2XOAA 1Z0HA 2R9KB 3N7JA 1AF9A 1J0SA 3Q7XA 1FMZA 2HWAA 4D0ZA 1IILA 3FJJA 3F1RA 3FJIA 4OWLA 2BFHA 2WBCA 3FJKA 5BQUA 5F8YA 4LO7C 2AAIB 1PWAA 5EHAA 3HN1A 31BIA 1V6WA 7I1BA 3BX1C 1FWUA 4JKQA 2D23A 2DRYA
chains in the Genus database with same CATH superfamily
2FFVA 4OUJA 3SNVA 2P39A 2K8RA 2RQ9A 4ZFWB 1DFCA 1Z2VA 4OWKA 4G1RA 1JT5A 4JPZA 1BASA 3S8JA 3P6JA 1IT0A 3O4OA 1QQLA 4PC4A 1TTUA 3BAQA 4LO3C 4QKRA 3BAOA 3PMEA 3JUTA 5FNWA 5FZUA 3OBRA 5G00A 3V0BA 2Y9WC 1V6UA 1AFCA 1MD6A 3FJ9A 3HSMA 1HWNB 2FDBM 1G9DA 3IAGC 21BIA 1WD4A 1G9BA 2AFGA 4ZLBB 3AH4A 3N0KA 3AZWA 2LIQA 2E4MC 2E4MA 1PC8B 2P23A 2BEBA 3BRGC 3O5WB 3FJEA 3POKA 1S0FA 4LO1C 1YTOA 1RZOB 4G9MA 4DENA 1FV3A 3BRFA 4UY4A 2J3PA 3IIRA 5BVPI 1DLLA 1JY0A 1F31A 4JKXB 4XFUA 2KI4A 2D44A 1IRAX 3CU1B 1ILR1 1AXMA 3VSZA 5B2HA 1ISVA 1K5VA 3O49A 1HWMB 2ZQNA 1V6VA 2HWMA 3O4BA 1SR4C 4IONA 3R4UA 4JQ0A 3BADA 4I1BA 3HMYA 1NZKA 2UUSA 3CA5A 2ESUA 4EFQA 1I1BA 1W3FA 4I4XA 5D61A 1HCDA 9ILBA 3N7LA 2Q9XA 3H6RA 3A23A 1DZCA 4J2YA 1VCLA 2MC2A 4H9WA 3BAGA 3OGGA 3CA6A 3BRDA 3W9TA 1EPWA 4IYBA 4ZFYB 4CJMA 2ZQOA 1XHBA 1BFFA 1G9AA 4JP0A 5BXTA 1QXMA 4ZKTB 1DQGA 3F62B 3AKFA 1CVSA 3RTIB 1PZZA 2D1ZA 4ZFUB 1IRPA 1W3AA 2QN4A 4GP3A 3EF2A 4XFTA 1RG8A 1HWOB 1ISZA 3NBEA 1A8DA 3UD8A 1SZ6B 2GO2A 4MZHA 1QQKA 4IZXA 4KEKA 3ZX7A 4I0YA 4DCKC 4H04A 3UJ0A 1BFGA 3FFZA 4I96A 2IHOA 3AKIA 3CRGA 3FGMA 4X3AA 3NBNA 1IJTA 3WO2A 2WRYA 3I29B 2VSAA 2HZ9A 3AKGA 1YBIA 1IHKA 3PUBA 5BQUC 5JMCA 3WMVA 3HALA 1XZZA 1HWPB 3NBDA 3Q7YA 2F8XC 1S0DA 3A07A 3FJAA 1XG6A 5EC5A 2MIBA 3CRHA 4EEEB 3IM7A 5BOWA 1XYFA 2DRZA 5DSSB 4IZEA 4I7IA 1PUMB 4I4YA 3AJ5A 2LIEA 3WA1A 1AVAC 3AH2A 3HBWA 2KKIA 1ISYA 3OBTA 3C9ZA 3CA3A 1RY7A 3TC2A 1WBCA 1YF8B 3O4DA 4I3NA 4A7YA 4EKXB 4MZFB 5I1BA 1YYNA 1BA7A 1S0CA 1FMMS 4KEIA 1G82A 4ZBVB 4J2XA 1PUUB 4JRAA 4OEFA 1JLXA 2FFUA 3N7KA 4Q9PA 3OJMA 4KEJA 3FJHA 3FUQA 4P0KA 3NBCA 3P53A 3ZC9A 3FJDA 3BA4A 3A22A 2L5XA 4FGFA 4L4HA 4Q9GA 4R6UB 4L4IA 3BB2A 4IQPA 2YUGA 3VT0A 5JLVA 2Z48A 1AVXB 1Z4SA 4HJJA 4ISRA 3UD9A 3K1XA 3OJVA 3OGFA 3LTQA 3O44A 4QD2B 1BFCA 1ISWA 1ITBA 2X2SA 1ABRB 4LO0A 2DREA 2VU9A 1WD3A 4I4PA 4MZGB 4OEGA 3BTAA 4P0JA 4TLPA 2VXTI 4Z9WB 4FVVA 2VSEA 3BAUA 2D7RA 3BA7A 1DQOA 2D43A 2DS0A 4IY9A 3FUOA 1EYLA 1Q03A 2ERMA 3I2AA 4GOYA 2IWTB 1ONKB 1EV2A 5DUYA 3FJFA 1JLYA 4D8HA 2MLLB 2RG9B 5FZZA 1JT7A 3WINC 2M49A 4XKIA 3WINA 4Z8SB 3V0AB 3R4SA 5E24E 4LO7B 4XFSA 4IHZA 1Q1UA 1DJSB 2Q3NB 3E8LC 2RSTA 1HIBA 3AZVA 3JRRA 3QYDA 2X2TA 1TFMB 4LO2A 3VEQA 1V6XA 3VUOA 1DIWA 3O4CA 1AVWB 1HCEA 1TOOA 1UPSA 5FZYA 1T4QA 2FGFA 4I37A 4J23B 4DEPA 3O4AA 1S0GA 1IOBA 3RTJB 4Q91A 1EVTA 1TWMA 1DZDA 4GAFA 1FGAA 1BFBA 2I1BA 1BLDA 5FNXA 1M2TB 3V0BB 4G6JA 1AVUA 4I2SA 1TIEA 3N7MA 3OJ2A 3CQAA 4QALA 3UDAA 1N4KA 1R8NA 3KMVA 4GAIA 2BEAA 4J2KA 3BA5A 8I1BA 5GAQA 3MPPG 3AKHA 1TP0A 3VSFA 1I1EA 5BXSA 2FO1A 4I4RA 1RMLA 3V0AA 2K43A 3CAHA 4GP0A 2D7IA 5BP5C 1YXWA 3H6QA 5BP5A 1JT4A 3S8KA 2KLLA 4USPA 3CA0A 4J2SA 5D62A 3WO3A 3LLPA 1T9FA 1L2HA 2QYIB 2VLCA 4ENDA 3FJ8A 4OEEA 3RMYA 3IM6A 4G9NA 5F8WA 1JTCA 4G6MA 3ZXGA 3VWCA 4LO3A 2Y9XE 4KC3A 3ZC8A 1ISXA 1D0HA 3H6RB 2NZ9A 1K5UA 5EG6C 3CA1A 2K4AB 4I1EA 4QC4A 3FJBA 4IY8A 4F34A 4ZOTA 3AH1A 4EB2B 2NVHA 5F8SA 3P6IA 2AXMA 1S0EA 5DVHA 4I4SA 1CE7B 3AJ6A 1HKNA 4P6AA 3IM5A 3V79C 3ZXDA 1S0LA 4P0LA 3FJCA 4I4VA 1OQLB 1II4A 4I8MA 4X38A 5HPZA 4JAWA 3NJ5A 4I6IA 4HA2A 4LO0C 4EFRA 2Y9FA 4KBBA 1WBAA 1JQZA 1W3GA 2NM1A 4AN6A 4LO1A 1BARA 4QO3A 3WMUA 1FN0A 4I4QA 2HW9A 2KH2A 3PHZA 3O3QA 3Q7WA 3ILAA 1TWEA 41BIA 4I4UA 3VT1A 2KI6B 4I4OA 4X37A 3UD7A 1NUNA 2NP0A 3UJ4A 2GZBA 1E0OA 4GOVA 2D20A 4QKSA 4QBVA 4X39A 4LO8B 2ET2A 1BLAA 1FWVA 1P63A 3BAHA 4II0A 3T8SA 1SR4A 2VUAA 3CA4A 5D63A 3H6SE 2VXRA 4OW4A 2AQZA 3RMXA 2D22A 3CRIA 3HOMA 1Q04A 4ZGRB 1G9CA 4LO2C 4ZA3B 1JT3A 1FV2A 4D0TA 2Z49A 3A21A 1KNMA 1M16A 3WO4A 1S0BA 2ZR1B 3D7WB 2NS2A 1FQ9A 5F90A 5BXRA 2F2FC 4A7KA 2F2FA 4WBCA 4OWJA 3RSJA 2NYYA 5DZUA 5BXPA 1MC9A 4QD2C 4A7ZA 3MALA 4HR6C 3BAVA 1GGPB 3PG0A 1R8OA 2Y9GA 4H75A 4QBCA 4F83A 2D24A 4YOLA 1DFQA 3QR5A 4EFPA 3I2XA 6I1BA 4USOA 2NTDA 3B9UA 4ISQA 4AN7B 3VT2A 2XOAA 1Z0HA 2R9KB 3N7JA 1AF9A 1J0SA 3Q7XA 1FMZA 2HWAA 4D0ZA 1IILA 3FJJA 3F1RA 3FJIA 4OWLA 2BFHA 2WBCA 3FJKA 5BQUA 5F8YA 4LO7C 2AAIB 1PWAA 5EHAA 3HN1A 31BIA 1V6WA 7I1BA 3BX1C 1FWUA 4JKQA 2D23A 2DRYA
chains in the Genus database with same CATH topology
2FFVA 4OUJA 3SNVA 2P39A 2K8RA 2RQ9A 4ZFWB 1DFCA 1Z2VA 4OWKA 4G1RA 1JT5A 4JPZA 1BASA 3S8JA 3P6JA 1IT0A 3O4OA 1QQLA 4PC4A 1TTUA 3BAQA 4LO3C 4QKRA 3BAOA 3PMEA 3JUTA 5FNWA 5FZUA 3OBRA 5G00A 3V0BA 2Y9WC 1V6UA 1AFCA 1MD6A 3FJ9A 3HSMA 1HWNB 2FDBM 1G9DA 3IAGC 21BIA 1WD4A 1G9BA 2AFGA 4ZLBB 3AH4A 3N0KA 3AZWA 2LIQA 2E4MC 2E4MA 1PC8B 2P23A 2BEBA 3BRGC 3O5WB 3FJEA 3POKA 1S0FA 4LO1C 1YTOA 1RZOB 4G9MA 4DENA 1FV3A 3BRFA 4UY4A 2J3PA 3IIRA 5BVPI 1DLLA 1JY0A 1F31A 4JKXB 4XFUA 2KI4A 2D44A 1IRAX 3CU1B 1ILR1 1AXMA 3VSZA 5B2HA 1ISVA 1K5VA 3O49A 1HWMB 2ZQNA 1V6VA 2HWMA 3O4BA 1SR4C 4IONA 3R4UA 4JQ0A 3BADA 4I1BA 3HMYA 1NZKA 2UUSA 3CA5A 2ESUA 4EFQA 1I1BA 1W3FA 4I4XA 5D61A 1HCDA 9ILBA 3N7LA 2Q9XA 3H6RA 3A23A 1DZCA 4J2YA 1VCLA 2MC2A 4H9WA 3BAGA 3OGGA 3CA6A 3BRDA 3W9TA 1EPWA 4IYBA 4ZFYB 4CJMA 2ZQOA 1XHBA 1BFFA 1G9AA 4JP0A 5BXTA 1QXMA 4ZKTB 1DQGA 3F62B 3AKFA 1CVSA 3RTIB 1PZZA 2D1ZA 4ZFUB 1IRPA 1W3AA 2QN4A 4GP3A 3EF2A 4XFTA 1RG8A 1HWOB 1ISZA 3NBEA 1A8DA 3UD8A 1SZ6B 2GO2A 4MZHA 1QQKA 4IZXA 4KEKA 3ZX7A 4I0YA 4DCKC 4H04A 3UJ0A 1BFGA 3FFZA 4I96A 2IHOA 3AKIA 3CRGA 3FGMA 4X3AA 3NBNA 1IJTA 3WO2A 2WRYA 3I29B 2VSAA 2HZ9A 3AKGA 1YBIA 1IHKA 3PUBA 5BQUC 5JMCA 3WMVA 3HALA 1XZZA 1HWPB 3NBDA 3Q7YA 2F8XC 1S0DA 3A07A 3FJAA 1XG6A 5EC5A 2MIBA 3CRHA 4EEEB 3IM7A 5BOWA 1XYFA 2DRZA 5DSSB 4IZEA 4I7IA 1PUMB 4I4YA 3AJ5A 2LIEA 3WA1A 1AVAC 3AH2A 3HBWA 2KKIA 1ISYA 3OBTA 3C9ZA 3CA3A 1RY7A 3TC2A 1WBCA 1YF8B 3O4DA 4I3NA 4A7YA 4EKXB 4MZFB 5I1BA 1YYNA 1BA7A 1S0CA 1FMMS 4KEIA 1G82A 4ZBVB 4J2XA 1PUUB 4JRAA 4OEFA 1JLXA 2FFUA 3N7KA 4Q9PA 3OJMA 4KEJA 3FJHA 3FUQA 4P0KA 3NBCA 3P53A 3ZC9A 3FJDA 3BA4A 3A22A 2L5XA 4FGFA 4L4HA 4Q9GA 4R6UB 4L4IA 3BB2A 4IQPA 2YUGA 3VT0A 5JLVA 2Z48A 1AVXB 1Z4SA 4HJJA 4ISRA 3UD9A 3K1XA 3OJVA 3OGFA 3LTQA 3O44A 4QD2B 1BFCA 1ISWA 1ITBA 2X2SA 1ABRB 4LO0A 2DREA 2VU9A 1WD3A 4I4PA 4MZGB 4OEGA 3BTAA 4P0JA 4TLPA 2VXTI 4Z9WB 4FVVA 2VSEA 3BAUA 2D7RA 3BA7A 1DQOA 2D43A 2DS0A 4IY9A 3FUOA 1EYLA 1Q03A 2ERMA 3I2AA 4GOYA 2IWTB 1ONKB 1EV2A 5DUYA 3FJFA 1JLYA 4D8HA 2MLLB 2RG9B 5FZZA 1JT7A 3WINC 2M49A 4XKIA 3WINA 4Z8SB 3V0AB 3R4SA 5E24E 4LO7B 4XFSA 4IHZA 1Q1UA 1DJSB 2Q3NB 3E8LC 2RSTA 1HIBA 3AZVA 3JRRA 3QYDA 2X2TA 1TFMB 4LO2A 3VEQA 1V6XA 3VUOA 1DIWA 3O4CA 1AVWB 1HCEA 1TOOA 1UPSA 5FZYA 1T4QA 2FGFA 4I37A 4J23B 4DEPA 3O4AA 1S0GA 1IOBA 3RTJB 4Q91A 1EVTA 1TWMA 1DZDA 4GAFA 1FGAA 1BFBA 2I1BA 1BLDA 5FNXA 1M2TB 3V0BB 4G6JA 1AVUA 4I2SA 1TIEA 3N7MA 3OJ2A 3CQAA 4QALA 3UDAA 1N4KA 1R8NA 3KMVA 4GAIA 2BEAA 4J2KA 3BA5A 8I1BA 5GAQA 3MPPG 3AKHA 1TP0A 3VSFA 1I1EA 5BXSA 2FO1A 4I4RA 1RMLA 3V0AA 2K43A 3CAHA 4GP0A 2D7IA 5BP5C 1YXWA 3H6QA 5BP5A 1JT4A 3S8KA 2KLLA 4USPA 3CA0A 4J2SA 5D62A 3WO3A 3LLPA 1T9FA 1L2HA 2QYIB 2VLCA 4ENDA 3FJ8A 4OEEA 3RMYA 3IM6A 4G9NA 5F8WA 1JTCA 4G6MA 3ZXGA 3VWCA 4LO3A 2Y9XE 4KC3A 3ZC8A 1ISXA 1D0HA 3H6RB 2NZ9A 1K5UA 5EG6C 3CA1A 2K4AB 4I1EA 4QC4A 3FJBA 4IY8A 4F34A 4ZOTA 3AH1A 4EB2B 2NVHA 5F8SA 3P6IA 2AXMA 1S0EA 5DVHA 4I4SA 1CE7B 3AJ6A 1HKNA 4P6AA 3IM5A 3V79C 3ZXDA 1S0LA 4P0LA 3FJCA 4I4VA 1OQLB 1II4A 4I8MA 4X38A 5HPZA 4JAWA 3NJ5A 4I6IA 4HA2A 4LO0C 4EFRA 2Y9FA 4KBBA 1WBAA 1JQZA 1W3GA 2NM1A 4AN6A 4LO1A 1BARA 4QO3A 3WMUA 1FN0A 4I4QA 2HW9A 2KH2A 3PHZA 3O3QA 3Q7WA 3ILAA 1TWEA 41BIA 4I4UA 3VT1A 2KI6B 4I4OA 4X37A 3UD7A 1NUNA 2NP0A 3UJ4A 2GZBA 1E0OA 4GOVA 2D20A 4QKSA 4QBVA 4X39A 4LO8B 2ET2A 1BLAA 1FWVA 1P63A 3BAHA 4II0A 3T8SA 1SR4A 2VUAA 3CA4A 5D63A 3H6SE 2VXRA 4OW4A 2AQZA 3RMXA 2D22A 3CRIA 3HOMA 1Q04A 4ZGRB 1G9CA 4LO2C 4ZA3B 1JT3A 1FV2A 4D0TA 2Z49A 3A21A 1KNMA 1M16A 3WO4A 1S0BA 2ZR1B 3D7WB 2NS2A 1FQ9A 5F90A 5BXRA 2F2FC 4A7KA 2F2FA 4WBCA 4OWJA 3RSJA 2NYYA 5DZUA 5BXPA 1MC9A 4QD2C 4A7ZA 3MALA 4HR6C 3BAVA 1GGPB 3PG0A 1R8OA 2Y9GA 4H75A 4QBCA 4F83A 2D24A 4YOLA 1DFQA 3QR5A 4EFPA 3I2XA 6I1BA 4USOA 2NTDA 3B9UA 4ISQA 4AN7B 3VT2A 2XOAA 1Z0HA 2R9KB 3N7JA 1AF9A 1J0SA 3Q7XA 1FMZA 2HWAA 4D0ZA 1IILA 3FJJA 3F1RA 3FJIA 4OWLA 2BFHA 2WBCA 3FJKA 5BQUA 5F8YA 4LO7C 2AAIB 1PWAA 5EHAA 3HN1A 31BIA 1V6WA 7I1BA 3BX1C 1FWUA 4JKQA 2D23A 2DRYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FFV A;  4OUJ A;  3SNV A;  2P39 A;  2K8R A;  2RQ9 A;  4ZFW B;  1DFC A;  1Z2V A;  4OWK A;  4G1R A;  1JT5 A;  4JPZ A;  1BAS A;  3S8J A;  3P6J A;  1IT0 A;  3O4O A;  1QQL A;  4PC4 A;  1TTU A;  3BAQ A;  4LO3 C;  4QKR A;  3BAO A;  3PME A;  3JUT A;  5FNW A;  5FZU A;  3OBR A;  5G00 A;  3V0B A;  2Y9W C;  1V6U A;  1AFC A;  1MD6 A;  3FJ9 A;  3HSM A;  1HWN B;  2FDB M;  1G9D A;  3IAG C;  21BI A;  1WD4 A;  1G9B A;  2AFG A;  4ZLB B;  3AH4 A;  3N0K A;  3AZW A;  2LIQ A;  2E4M C;  2E4M A;  1PC8 B;  2P23 A;  2BEB A;  3BRG C;  3O5W B;  3FJE A;  3POK A;  1S0F A;  4LO1 C;  1YTO A;  1RZO B;  4G9M A;  4DEN A;  1FV3 A;  3BRF A;  2J3P A;  3IIR A;  5BVP I;  1DLL A;  1JY0 A;  1F31 A;  4JKX B;  4XFU A;  2KI4 A;  2D44 A;  1IRA X;  3CU1 B;  1ILR 1;  1AXM A;  3VSZ A;  5B2H A;  1ISV A;  1K5V A;  3O49 A;  1HWM B;  2ZQN A;  1V6V A;  2HWM A;  3O4B A;  1SR4 C;  4ION A;  3R4U A;  4JQ0 A;  3BAD A;  4I1B A;  3HMY A;  1NZK A;  2UUS A;  3CA5 A;  2ESU A;  4EFQ A;  1I1B A;  1W3F A;  4I4X A;  5D61 A;  1HCD A;  9ILB A;  3N7L A;  2Q9X A;  3H6R A;  3A23 A;  1DZC A;  4J2Y A;  1VCL A;  2MC2 A;  4H9W A;  3BAG A;  3OGG A;  3CA6 A;  3BRD A;  3W9T A;  1EPW A;  4IYB A;  4ZFY B;  4CJM A;  2ZQO A;  1XHB A;  1BFF A;  1G9A A;  4JP0 A;  5BXT A;  1QXM A;  4ZKT B;  1DQG A;  3F62 B;  3AKF A;  1CVS A;  3RTI B;  1PZZ A;  2D1Z A;  4ZFU B;  1IRP A;  1W3A A;  2QN4 A;  4GP3 A;  3EF2 A;  4XFT A;  1RG8 A;  1HWO B;  1ISZ A;  3NBE A;  1A8D A;  3UD8 A;  1SZ6 B;  2GO2 A;  1QQK A;  4IZX A;  4KEK A;  3ZX7 A;  4I0Y A;  4DCK C;  4H04 A;  3UJ0 A;  1BFG A;  3FFZ A;  4I96 A;  2IHO A;  3AKI A;  3CRG A;  3FGM A;  4X3A A;  3NBN A;  1IJT A;  3WO2 A;  2WRY A;  3I29 B;  2VSA A;  2HZ9 A;  3AKG A;  1YBI A;  1IHK A;  3PUB A;  5BQU C;  5JMC A;  3WMV A;  3HAL A;  1XZZ A;  1HWP B;  3NBD A;  3Q7Y A;  2F8X C;  1S0D A;  3A07 A;  3FJA A;  1XG6 A;  5EC5 A;  2MIB A;  3CRH A;  4EEE B;  3IM7 A;  5BOW A;  1XYF A;  2DRZ A;  5DSS B;  4IZE A;  4I7I A;  1PUM B;  4I4Y A;  3AJ5 A;  2LIE A;  3WA1 A;  1AVA C;  3AH2 A;  3HBW A;  2KKI A;  1ISY A;  3OBT A;  3C9Z A;  3CA3 A;  1RY7 A;  3TC2 A;  1WBC A;  1YF8 B;  3O4D A;  4I3N A;  4A7Y A;  4EKX B;  5I1B A;  1YYN A;  1BA7 A;  1S0C A;  1FMM S;  4KEI A;  1G82 A;  4ZBV B;  4J2X A;  1PUU B;  4JRA A;  4OEF A;  1JLX A;  2FFU A;  3N7K A;  4Q9P A;  3OJM A;  4KEJ A;  3FJH A;  3FUQ A;  4P0K A;  3NBC A;  3P53 A;  3ZC9 A;  3FJD A;  3BA4 A;  3A22 A;  2L5X A;  4FGF A;  4L4H A;  4Q9G A;  4R6U B;  4L4I A;  3BB2 A;  4IQP A;  2YUG A;  3VT0 A;  5JLV A;  2Z48 A;  1AVX B;  1Z4S A;  4HJJ A;  4ISR A;  3UD9 A;  3K1X A;  3OJV A;  3OGF A;  3LTQ A;  3O44 A;  4QD2 B;  1BFC A;  1ISW A;  1ITB A;  2X2S A;  1ABR B;  4LO0 A;  2DRE A;  2VU9 A;  1WD3 A;  4I4P A;  4OEG A;  3BTA A;  4P0J A;  4TLP A;  2VXT I;  4Z9W B;  4FVV A;  2VSE A;  3BAU A;  2D7R A;  3BA7 A;  1DQO A;  2D43 A;  2DS0 A;  4IY9 A;  3FUO A;  1EYL A;  1Q03 A;  2ERM A;  3I2A A;  4GOY A;  2IWT B;  1ONK B;  1EV2 A;  5DUY A;  3FJF A;  1JLY A;  4D8H A;  2MLL B;  2RG9 B;  5FZZ A;  1JT7 A;  3WIN C;  2M49 A;  4XKI A;  3WIN A;  4Z8S B;  3V0A B;  3R4S A;  5E24 E;  4LO7 B;  4XFS A;  4IHZ A;  1Q1U A;  1DJS B;  2Q3N B;  3E8L C;  2RST A;  1HIB A;  3AZV A;  3JRR A;  3QYD A;  2X2T A;  1TFM B;  4LO2 A;  3VEQ A;  1V6X A;  3VUO A;  1DIW A;  3O4C A;  1AVW B;  1HCE A;  1TOO A;  1UPS A;  5FZY A;  1T4Q A;  2FGF A;  4I37 A;  4J23 B;  4DEP A;  3O4A A;  1S0G A;  1IOB A;  3RTJ B;  4Q91 A;  1EVT A;  1TWM A;  1DZD A;  4GAF A;  1FGA A;  1BFB A;  2I1B A;  1BLD A;  5FNX A;  1M2T B;  3V0B B;  4G6J A;  1AVU A;  4I2S A;  1TIE A;  3N7M A;  3OJ2 A;  3CQA A;  4QAL A;  3UDA A;  1N4K A;  1R8N A;  3KMV A;  4GAI A;  2BEA A;  4J2K A;  3BA5 A;  8I1B A;  5GAQ A;  3MPP G;  3AKH A;  1TP0 A;  3VSF A;  1I1E A;  5BXS A;  2FO1 A;  4I4R A;  1RML A;  3V0A A;  2K43 A;  3CAH A;  4GP0 A;  2D7I A;  5BP5 C;  1YXW A;  3H6Q A;  5BP5 A;  1JT4 A;  3S8K A;  2KLL A;  4USP A;  3CA0 A;  4J2S A;  5D62 A;  3WO3 A;  3LLP A;  1T9F A;  1L2H A;  2QYI B;  2VLC A;  4END A;  3FJ8 A;  4OEE A;  3RMY A;  3IM6 A;  4G9N A;  5F8W A;  1JTC A;  4G6M A;  3ZXG A;  3VWC A;  4LO3 A;  2Y9X E;  4KC3 A;  3ZC8 A;  1ISX A;  1D0H A;  3H6R B;  2NZ9 A;  1K5U A;  5EG6 C;  3CA1 A;  2K4A B;  4I1E A;  4QC4 A;  3FJB A;  4IY8 A;  4F34 A;  4ZOT A;  3AH1 A;  4EB2 B;  2NVH A;  5F8S A;  3P6I A;  2AXM A;  1S0E A;  5DVH A;  4I4S A;  1CE7 B;  3AJ6 A;  1HKN A;  4P6A A;  3IM5 A;  3V79 C;  3ZXD A;  1S0L A;  4P0L A;  3FJC A;  4I4V A;  1OQL B;  1II4 A;  4I8M A;  4X38 A;  5HPZ A;  4JAW A;  3NJ5 A;  4I6I A;  4HA2 A;  4LO0 C;  4EFR A;  2Y9F A;  4KBB A;  1WBA A;  1JQZ A;  1W3G A;  2NM1 A;  4AN6 A;  4LO1 A;  1BAR A;  4QO3 A;  3WMU A;  1FN0 A;  4I4Q A;  2HW9 A;  2KH2 A;  3PHZ A;  3O3Q A;  3Q7W A;  3ILA A;  1TWE A;  41BI A;  4I4U A;  3VT1 A;  2KI6 B;  4I4O A;  4X37 A;  3UD7 A;  1NUN A;  2NP0 A;  3UJ4 A;  2GZB A;  1E0O A;  4GOV A;  2D20 A;  4QKS A;  4QBV A;  4X39 A;  4LO8 B;  2ET2 A;  1BLA A;  1FWV A;  1P63 A;  3BAH A;  4II0 A;  3T8S A;  1SR4 A;  2VUA A;  3CA4 A;  5D63 A;  3H6S E;  2VXR A;  4OW4 A;  2AQZ A;  3RMX A;  2D22 A;  3CRI A;  3HOM A;  1Q04 A;  4ZGR B;  1G9C A;  4LO2 C;  4ZA3 B;  1JT3 A;  1FV2 A;  4D0T A;  2Z49 A;  3A21 A;  1KNM A;  1M16 A;  3WO4 A;  1S0B A;  2ZR1 B;  3D7W B;  1FQ9 A;  5F90 A;  5BXR A;  2F2F C;  4A7K A;  2F2F A;  4WBC A;  4OWJ A;  3RSJ A;  2NYY A;  5DZU A;  5BXP A;  1MC9 A;  4QD2 C;  4A7Z A;  3MAL A;  4HR6 C;  3BAV A;  1GGP B;  3PG0 A;  1R8O A;  2Y9G A;  4QBC A;  4F83 A;  2D24 A;  4YOL A;  1DFQ A;  3QR5 A;  4EFP A;  3I2X A;  6I1B A;  4USO A;  2NTD A;  3B9U A;  4ISQ A;  4AN7 B;  3VT2 A;  2XOA A;  1Z0H A;  2R9K B;  3N7J A;  1AF9 A;  1J0S A;  3Q7X A;  1FMZ A;  2HWA A;  4D0Z A;  1IIL A;  3FJJ A;  3F1R A;  3FJI A;  4OWL A;  2BFH A;  2WBC A;  3FJK A;  5BQU A;  5F8Y A;  4LO7 C;  2AAI B;  1PWA A;  5EHA A;  3HN1 A;  31BI A;  1V6W A;  7I1B A;  3BX1 C;  1FWU A;  4JKQ A;  2D23 A;  2DRY A; 
#chains in the Genus database with same CATH topology
 2FFV A;  4OUJ A;  3SNV A;  2P39 A;  2K8R A;  2RQ9 A;  4ZFW B;  1DFC A;  1Z2V A;  4OWK A;  4G1R A;  1JT5 A;  4JPZ A;  1BAS A;  3S8J A;  3P6J A;  1IT0 A;  3O4O A;  1QQL A;  4PC4 A;  1TTU A;  3BAQ A;  4LO3 C;  4QKR A;  3BAO A;  3PME A;  3JUT A;  5FNW A;  5FZU A;  3OBR A;  5G00 A;  3V0B A;  2Y9W C;  1V6U A;  1AFC A;  1MD6 A;  3FJ9 A;  3HSM A;  1HWN B;  2FDB M;  1G9D A;  3IAG C;  21BI A;  1WD4 A;  1G9B A;  2AFG A;  4ZLB B;  3AH4 A;  3N0K A;  3AZW A;  2LIQ A;  2E4M C;  2E4M A;  1PC8 B;  2P23 A;  2BEB A;  3BRG C;  3O5W B;  3FJE A;  3POK A;  1S0F A;  4LO1 C;  1YTO A;  1RZO B;  4G9M A;  4DEN A;  1FV3 A;  3BRF A;  4UY4 A;  2J3P A;  3IIR A;  5BVP I;  1DLL A;  1JY0 A;  1F31 A;  4JKX B;  4XFU A;  2KI4 A;  2D44 A;  1IRA X;  3CU1 B;  1ILR 1;  1AXM A;  3VSZ A;  5B2H A;  1ISV A;  1K5V A;  3O49 A;  1HWM B;  2ZQN A;  1V6V A;  2HWM A;  3O4B A;  1SR4 C;  4ION A;  3R4U A;  4JQ0 A;  3BAD A;  4I1B A;  3HMY A;  1NZK A;  2UUS A;  3CA5 A;  2ESU A;  4EFQ A;  1I1B A;  1W3F A;  4I4X A;  5D61 A;  1HCD A;  9ILB A;  3N7L A;  2Q9X A;  3H6R A;  3A23 A;  1DZC A;  4J2Y A;  1VCL A;  2MC2 A;  4H9W A;  3BAG A;  3OGG A;  3CA6 A;  3BRD A;  3W9T A;  1EPW A;  4IYB A;  4ZFY B;  4CJM A;  2ZQO A;  1XHB A;  1BFF A;  1G9A A;  4JP0 A;  5BXT A;  1QXM A;  4ZKT B;  1DQG A;  3F62 B;  3AKF A;  1CVS A;  3RTI B;  1PZZ A;  2D1Z A;  4ZFU B;  1IRP A;  1W3A A;  2QN4 A;  4GP3 A;  3EF2 A;  4XFT A;  1RG8 A;  1HWO B;  1ISZ A;  3NBE A;  1A8D A;  3UD8 A;  1SZ6 B;  2GO2 A;  4MZH A;  1QQK A;  4IZX A;  4KEK A;  3ZX7 A;  4I0Y A;  4DCK C;  4H04 A;  3UJ0 A;  1BFG A;  3FFZ A;  4I96 A;  2IHO A;  3AKI A;  3CRG A;  3FGM A;  4X3A A;  3NBN A;  1IJT A;  3WO2 A;  2WRY A;  3I29 B;  2VSA A;  2HZ9 A;  3AKG A;  1YBI A;  1IHK A;  3PUB A;  5BQU C;  5JMC A;  3WMV A;  3HAL A;  1XZZ A;  1HWP B;  3NBD A;  3Q7Y A;  2F8X C;  1S0D A;  3A07 A;  3FJA A;  1XG6 A;  5EC5 A;  2MIB A;  3CRH A;  4EEE B;  3IM7 A;  5BOW A;  1XYF A;  2DRZ A;  5DSS B;  4IZE A;  4I7I A;  1PUM B;  4I4Y A;  3AJ5 A;  2LIE A;  3WA1 A;  1AVA C;  3AH2 A;  3HBW A;  2KKI A;  1ISY A;  3OBT A;  3C9Z A;  3CA3 A;  1RY7 A;  3TC2 A;  1WBC A;  1YF8 B;  3O4D A;  4I3N A;  4A7Y A;  4EKX B;  4MZF B;  5I1B A;  1YYN A;  1BA7 A;  1S0C A;  1FMM S;  4KEI A;  1G82 A;  4ZBV B;  4J2X A;  1PUU B;  4JRA A;  4OEF A;  1JLX A;  2FFU A;  3N7K A;  4Q9P A;  3OJM A;  4KEJ A;  3FJH A;  3FUQ A;  4P0K A;  3NBC A;  3P53 A;  3ZC9 A;  3FJD A;  3BA4 A;  3A22 A;  2L5X A;  4FGF A;  4L4H A;  4Q9G A;  4R6U B;  4L4I A;  3BB2 A;  4IQP A;  2YUG A;  3VT0 A;  5JLV A;  2Z48 A;  1AVX B;  1Z4S A;  4HJJ A;  4ISR A;  3UD9 A;  3K1X A;  3OJV A;  3OGF A;  3LTQ A;  3O44 A;  4QD2 B;  1BFC A;  1ISW A;  1ITB A;  2X2S A;  1ABR B;  4LO0 A;  2DRE A;  2VU9 A;  1WD3 A;  4I4P A;  4MZG B;  4OEG A;  3BTA A;  4P0J A;  4TLP A;  2VXT I;  4Z9W B;  4FVV A;  2VSE A;  3BAU A;  2D7R A;  3BA7 A;  1DQO A;  2D43 A;  2DS0 A;  4IY9 A;  3FUO A;  1EYL A;  1Q03 A;  2ERM A;  3I2A A;  4GOY A;  2IWT B;  1ONK B;  1EV2 A;  5DUY A;  3FJF A;  1JLY A;  4D8H A;  2MLL B;  2RG9 B;  5FZZ A;  1JT7 A;  3WIN C;  2M49 A;  4XKI A;  3WIN A;  4Z8S B;  3V0A B;  3R4S A;  5E24 E;  4LO7 B;  4XFS A;  4IHZ A;  1Q1U A;  1DJS B;  2Q3N B;  3E8L C;  2RST A;  1HIB A;  3AZV A;  3JRR A;  3QYD A;  2X2T A;  1TFM B;  4LO2 A;  3VEQ A;  1V6X A;  3VUO A;  1DIW A;  3O4C A;  1AVW B;  1HCE A;  1TOO A;  1UPS A;  5FZY A;  1T4Q A;  2FGF A;  4I37 A;  4J23 B;  4DEP A;  3O4A A;  1S0G A;  1IOB A;  3RTJ B;  4Q91 A;  1EVT A;  1TWM A;  1DZD A;  4GAF A;  1FGA A;  1BFB A;  2I1B A;  1BLD A;  5FNX A;  1M2T B;  3V0B B;  4G6J A;  1AVU A;  4I2S A;  1TIE A;  3N7M A;  3OJ2 A;  3CQA A;  4QAL A;  3UDA A;  1N4K A;  1R8N A;  3KMV A;  4GAI A;  2BEA A;  4J2K A;  3BA5 A;  8I1B A;  5GAQ A;  3MPP G;  3AKH A;  1TP0 A;  3VSF A;  1I1E A;  5BXS A;  2FO1 A;  4I4R A;  1RML A;  3V0A A;  2K43 A;  3CAH A;  4GP0 A;  2D7I A;  5BP5 C;  1YXW A;  3H6Q A;  5BP5 A;  1JT4 A;  3S8K A;  2KLL A;  4USP A;  3CA0 A;  4J2S A;  5D62 A;  3WO3 A;  3LLP A;  1T9F A;  1L2H A;  2QYI B;  2VLC A;  4END A;  3FJ8 A;  4OEE A;  3RMY A;  3IM6 A;  4G9N A;  5F8W A;  1JTC A;  4G6M A;  3ZXG A;  3VWC A;  4LO3 A;  2Y9X E;  4KC3 A;  3ZC8 A;  1ISX A;  1D0H A;  3H6R B;  2NZ9 A;  1K5U A;  5EG6 C;  3CA1 A;  2K4A B;  4I1E A;  4QC4 A;  3FJB A;  4IY8 A;  4F34 A;  4ZOT A;  3AH1 A;  4EB2 B;  2NVH A;  5F8S A;  3P6I A;  2AXM A;  1S0E A;  5DVH A;  4I4S A;  1CE7 B;  3AJ6 A;  1HKN A;  4P6A A;  3IM5 A;  3V79 C;  3ZXD A;  1S0L A;  4P0L A;  3FJC A;  4I4V A;  1OQL B;  1II4 A;  4I8M A;  4X38 A;  5HPZ A;  4JAW A;  3NJ5 A;  4I6I A;  4HA2 A;  4LO0 C;  4EFR A;  2Y9F A;  4KBB A;  1WBA A;  1JQZ A;  1W3G A;  2NM1 A;  4AN6 A;  4LO1 A;  1BAR A;  4QO3 A;  3WMU A;  1FN0 A;  4I4Q A;  2HW9 A;  2KH2 A;  3PHZ A;  3O3Q A;  3Q7W A;  3ILA A;  1TWE A;  41BI A;  4I4U A;  3VT1 A;  2KI6 B;  4I4O A;  4X37 A;  3UD7 A;  1NUN A;  2NP0 A;  3UJ4 A;  2GZB A;  1E0O A;  4GOV A;  2D20 A;  4QKS A;  4QBV A;  4X39 A;  4LO8 B;  2ET2 A;  1BLA A;  1FWV A;  1P63 A;  3BAH A;  4II0 A;  3T8S A;  1SR4 A;  2VUA A;  3CA4 A;  5D63 A;  3H6S E;  2VXR A;  4OW4 A;  2AQZ A;  3RMX A;  2D22 A;  3CRI A;  3HOM A;  1Q04 A;  4ZGR B;  1G9C A;  4LO2 C;  4ZA3 B;  1JT3 A;  1FV2 A;  4D0T A;  2Z49 A;  3A21 A;  1KNM A;  1M16 A;  3WO4 A;  1S0B A;  2ZR1 B;  3D7W B;  2NS2 A;  1FQ9 A;  5F90 A;  5BXR A;  2F2F C;  4A7K A;  2F2F A;  4WBC A;  4OWJ A;  3RSJ A;  2NYY A;  5DZU A;  5BXP A;  1MC9 A;  4QD2 C;  4A7Z A;  3MAL A;  4HR6 C;  3BAV A;  1GGP B;  3PG0 A;  1R8O A;  2Y9G A;  4H75 A;  4QBC A;  4F83 A;  2D24 A;  4YOL A;  1DFQ A;  3QR5 A;  4EFP A;  3I2X A;  6I1B A;  4USO A;  2NTD A;  3B9U A;  4ISQ A;  4AN7 B;  3VT2 A;  2XOA A;  1Z0H A;  2R9K B;  3N7J A;  1AF9 A;  1J0S A;  3Q7X A;  1FMZ A;  2HWA A;  4D0Z A;  1IIL A;  3FJJ A;  3F1R A;  3FJI A;  4OWL A;  2BFH A;  2WBC A;  3FJK A;  5BQU A;  5F8Y A;  4LO7 C;  2AAI B;  1PWA A;  5EHA A;  3HN1 A;  31BI A;  1V6W A;  7I1B A;  3BX1 C;  1FWU A;  4JKQ A;  2D23 A;  2DRY A; 
#chains in the Genus database with same CATH homology
 2FFV A;  4OUJ A;  3SNV A;  2P39 A;  2K8R A;  2RQ9 A;  4ZFW B;  1DFC A;  1Z2V A;  4OWK A;  4G1R A;  1JT5 A;  4JPZ A;  1BAS A;  3S8J A;  3P6J A;  1IT0 A;  3O4O A;  1QQL A;  4PC4 A;  1TTU A;  3BAQ A;  4LO3 C;  4QKR A;  3BAO A;  3PME A;  3JUT A;  5FNW A;  5FZU A;  3OBR A;  5G00 A;  3V0B A;  2Y9W C;  1V6U A;  1AFC A;  1MD6 A;  3FJ9 A;  3HSM A;  1HWN B;  2FDB M;  1G9D A;  3IAG C;  21BI A;  1WD4 A;  1G9B A;  2AFG A;  4ZLB B;  3AH4 A;  3N0K A;  3AZW A;  2LIQ A;  2E4M C;  2E4M A;  1PC8 B;  2P23 A;  2BEB A;  3BRG C;  3O5W B;  3FJE A;  3POK A;  1S0F A;  4LO1 C;  1YTO A;  1RZO B;  4G9M A;  4DEN A;  1FV3 A;  3BRF A;  4UY4 A;  2J3P A;  3IIR A;  5BVP I;  1DLL A;  1JY0 A;  1F31 A;  4JKX B;  4XFU A;  2KI4 A;  2D44 A;  1IRA X;  3CU1 B;  1ILR 1;  1AXM A;  3VSZ A;  5B2H A;  1ISV A;  1K5V A;  3O49 A;  1HWM B;  2ZQN A;  1V6V A;  2HWM A;  3O4B A;  1SR4 C;  4ION A;  3R4U A;  4JQ0 A;  3BAD A;  4I1B A;  3HMY A;  1NZK A;  2UUS A;  3CA5 A;  2ESU A;  4EFQ A;  1I1B A;  1W3F A;  4I4X A;  5D61 A;  1HCD A;  9ILB A;  3N7L A;  2Q9X A;  3H6R A;  3A23 A;  1DZC A;  4J2Y A;  1VCL A;  2MC2 A;  4H9W A;  3BAG A;  3OGG A;  3CA6 A;  3BRD A;  3W9T A;  1EPW A;  4IYB A;  4ZFY B;  4CJM A;  2ZQO A;  1XHB A;  1BFF A;  1G9A A;  4JP0 A;  5BXT A;  1QXM A;  4ZKT B;  1DQG A;  3F62 B;  3AKF A;  1CVS A;  3RTI B;  1PZZ A;  2D1Z A;  4ZFU B;  1IRP A;  1W3A A;  2QN4 A;  4GP3 A;  3EF2 A;  4XFT A;  1RG8 A;  1HWO B;  1ISZ A;  3NBE A;  1A8D A;  3UD8 A;  1SZ6 B;  2GO2 A;  4MZH A;  1QQK A;  4IZX A;  4KEK A;  3ZX7 A;  4I0Y A;  4DCK C;  4H04 A;  3UJ0 A;  1BFG A;  3FFZ A;  4I96 A;  2IHO A;  3AKI A;  3CRG A;  3FGM A;  4X3A A;  3NBN A;  1IJT A;  3WO2 A;  2WRY A;  3I29 B;  2VSA A;  2HZ9 A;  3AKG A;  1YBI A;  1IHK A;  3PUB A;  5BQU C;  5JMC A;  3WMV A;  3HAL A;  1XZZ A;  1HWP B;  3NBD A;  3Q7Y A;  2F8X C;  1S0D A;  3A07 A;  3FJA A;  1XG6 A;  5EC5 A;  2MIB A;  3CRH A;  4EEE B;  3IM7 A;  5BOW A;  1XYF A;  2DRZ A;  5DSS B;  4IZE A;  4I7I A;  1PUM B;  4I4Y A;  3AJ5 A;  2LIE A;  3WA1 A;  1AVA C;  3AH2 A;  3HBW A;  2KKI A;  1ISY A;  3OBT A;  3C9Z A;  3CA3 A;  1RY7 A;  3TC2 A;  1WBC A;  1YF8 B;  3O4D A;  4I3N A;  4A7Y A;  4EKX B;  4MZF B;  5I1B A;  1YYN A;  1BA7 A;  1S0C A;  1FMM S;  4KEI A;  1G82 A;  4ZBV B;  4J2X A;  1PUU B;  4JRA A;  4OEF A;  1JLX A;  2FFU A;  3N7K A;  4Q9P A;  3OJM A;  4KEJ A;  3FJH A;  3FUQ A;  4P0K A;  3NBC A;  3P53 A;  3ZC9 A;  3FJD A;  3BA4 A;  3A22 A;  2L5X A;  4FGF A;  4L4H A;  4Q9G A;  4R6U B;  4L4I A;  3BB2 A;  4IQP A;  2YUG A;  3VT0 A;  5JLV A;  2Z48 A;  1AVX B;  1Z4S A;  4HJJ A;  4ISR A;  3UD9 A;  3K1X A;  3OJV A;  3OGF A;  3LTQ A;  3O44 A;  4QD2 B;  1BFC A;  1ISW A;  1ITB A;  2X2S A;  1ABR B;  4LO0 A;  2DRE A;  2VU9 A;  1WD3 A;  4I4P A;  4MZG B;  4OEG A;  3BTA A;  4P0J A;  4TLP A;  2VXT I;  4Z9W B;  4FVV A;  2VSE A;  3BAU A;  2D7R A;  3BA7 A;  1DQO A;  2D43 A;  2DS0 A;  4IY9 A;  3FUO A;  1EYL A;  1Q03 A;  2ERM A;  3I2A A;  4GOY A;  2IWT B;  1ONK B;  1EV2 A;  5DUY A;  3FJF A;  1JLY A;  4D8H A;  2MLL B;  2RG9 B;  5FZZ A;  1JT7 A;  3WIN C;  2M49 A;  4XKI A;  3WIN A;  4Z8S B;  3V0A B;  3R4S A;  5E24 E;  4LO7 B;  4XFS A;  4IHZ A;  1Q1U A;  1DJS B;  2Q3N B;  3E8L C;  2RST A;  1HIB A;  3AZV A;  3JRR A;  3QYD A;  2X2T A;  1TFM B;  4LO2 A;  3VEQ A;  1V6X A;  3VUO A;  1DIW A;  3O4C A;  1AVW B;  1HCE A;  1TOO A;  1UPS A;  5FZY A;  1T4Q A;  2FGF A;  4I37 A;  4J23 B;  4DEP A;  3O4A A;  1S0G A;  1IOB A;  3RTJ B;  4Q91 A;  1EVT A;  1TWM A;  1DZD A;  4GAF A;  1FGA A;  1BFB A;  2I1B A;  1BLD A;  5FNX A;  1M2T B;  3V0B B;  4G6J A;  1AVU A;  4I2S A;  1TIE A;  3N7M A;  3OJ2 A;  3CQA A;  4QAL A;  3UDA A;  1N4K A;  1R8N A;  3KMV A;  4GAI A;  2BEA A;  4J2K A;  3BA5 A;  8I1B A;  5GAQ A;  3MPP G;  3AKH A;  1TP0 A;  3VSF A;  1I1E A;  5BXS A;  2FO1 A;  4I4R A;  1RML A;  3V0A A;  2K43 A;  3CAH A;  4GP0 A;  2D7I A;  5BP5 C;  1YXW A;  3H6Q A;  5BP5 A;  1JT4 A;  3S8K A;  2KLL A;  4USP A;  3CA0 A;  4J2S A;  5D62 A;  3WO3 A;  3LLP A;  1T9F A;  1L2H A;  2QYI B;  2VLC A;  4END A;  3FJ8 A;  4OEE A;  3RMY A;  3IM6 A;  4G9N A;  5F8W A;  1JTC A;  4G6M A;  3ZXG A;  3VWC A;  4LO3 A;  2Y9X E;  4KC3 A;  3ZC8 A;  1ISX A;  1D0H A;  3H6R B;  2NZ9 A;  1K5U A;  5EG6 C;  3CA1 A;  2K4A B;  4I1E A;  4QC4 A;  3FJB A;  4IY8 A;  4F34 A;  4ZOT A;  3AH1 A;  4EB2 B;  2NVH A;  5F8S A;  3P6I A;  2AXM A;  1S0E A;  5DVH A;  4I4S A;  1CE7 B;  3AJ6 A;  1HKN A;  4P6A A;  3IM5 A;  3V79 C;  3ZXD A;  1S0L A;  4P0L A;  3FJC A;  4I4V A;  1OQL B;  1II4 A;  4I8M A;  4X38 A;  5HPZ A;  4JAW A;  3NJ5 A;  4I6I A;  4HA2 A;  4LO0 C;  4EFR A;  2Y9F A;  4KBB A;  1WBA A;  1JQZ A;  1W3G A;  2NM1 A;  4AN6 A;  4LO1 A;  1BAR A;  4QO3 A;  3WMU A;  1FN0 A;  4I4Q A;  2HW9 A;  2KH2 A;  3PHZ A;  3O3Q A;  3Q7W A;  3ILA A;  1TWE A;  41BI A;  4I4U A;  3VT1 A;  2KI6 B;  4I4O A;  4X37 A;  3UD7 A;  1NUN A;  2NP0 A;  3UJ4 A;  2GZB A;  1E0O A;  4GOV A;  2D20 A;  4QKS A;  4QBV A;  4X39 A;  4LO8 B;  2ET2 A;  1BLA A;  1FWV A;  1P63 A;  3BAH A;  4II0 A;  3T8S A;  1SR4 A;  2VUA A;  3CA4 A;  5D63 A;  3H6S E;  2VXR A;  4OW4 A;  2AQZ A;  3RMX A;  2D22 A;  3CRI A;  3HOM A;  1Q04 A;  4ZGR B;  1G9C A;  4LO2 C;  4ZA3 B;  1JT3 A;  1FV2 A;  4D0T A;  2Z49 A;  3A21 A;  1KNM A;  1M16 A;  3WO4 A;  1S0B A;  2ZR1 B;  3D7W B;  2NS2 A;  1FQ9 A;  5F90 A;  5BXR A;  2F2F C;  4A7K A;  2F2F A;  4WBC A;  4OWJ A;  3RSJ A;  2NYY A;  5DZU A;  5BXP A;  1MC9 A;  4QD2 C;  4A7Z A;  3MAL A;  4HR6 C;  3BAV A;  1GGP B;  3PG0 A;  1R8O A;  2Y9G A;  4H75 A;  4QBC A;  4F83 A;  2D24 A;  4YOL A;  1DFQ A;  3QR5 A;  4EFP A;  3I2X A;  6I1B A;  4USO A;  2NTD A;  3B9U A;  4ISQ A;  4AN7 B;  3VT2 A;  2XOA A;  1Z0H A;  2R9K B;  3N7J A;  1AF9 A;  1J0S A;  3Q7X A;  1FMZ A;  2HWA A;  4D0Z A;  1IIL A;  3FJJ A;  3F1R A;  3FJI A;  4OWL A;  2BFH A;  2WBC A;  3FJK A;  5BQU A;  5F8Y A;  4LO7 C;  2AAI B;  1PWA A;  5EHA A;  3HN1 A;  31BI A;  1V6W A;  7I1B A;  3BX1 C;  1FWU A;  4JKQ A;  2D23 A;  2DRY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...