5FZZA

Crystal structure of potato sti-kunitz bi-functional inhibitor of serine and aspartic proteases in space group p22121 and ph 7.0
Total Genus 38
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
38
sequence length
185
structure length
185
Chain Sequence
PLPKPVLDTNGKELNPNSSYRIISIGRGALGGDVYLGKSPNSDAPCPDGVFRYNSDVGPSGTPVRFIPLSTNIFEDQLLNIQFNIPTVKLCVSYTIWKVGNLNAYFRTMLLETGGTIGQADNSYFKIVKSSKIGYNLLSCPFTSIICLRCPEDQFCAKVGVVIQNGKRRLALVNENPLDVLFQEV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords KTI-A PROTEIN
publication title Structures of a bi-functional Kunitz-type STI family inhibitor of serine and aspartic proteases: Could the aspartic protease inhibition have evolved from a canonical serine protease-binding loop?
pubmed doi rcsb
source organism Solanum tuberosum
molecule tags Hydrolase
total genus 38
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2016-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5fzzA00
3UD8A 3BRDA 3OGFA 3FJDA 2ZQOA 2QN4A 1OQLB 2D1ZA 3VEQA 1DZDA 4Q91A 2X2SA 3CRGA 3FJ9A 3IIRA 1TWMA 2NM1A 5FZUA 3VWCA 3ILAA 3FGMA 2ET2A 3PHZA 4L4IA 5FZYA 5BOWA 4R6UB 2BFHA 2R9KB 4GOYA 2D44A 2K4AB 5D63A 3OBTA 5BP5A 4OEFA 1JLYA 1BASA 1ABRB 5BXTA 1ISWA 5FNXA 3VT0A 3LTQA 4KC3A 3Q7XA 1NUNA 2P23A 2P39A 4OW4A 1G9CA 1Q1UA 3BRFA 2Z48A 3EF2A 4Z8SB 3SNVA 4AN7B 1JTCA 3AH2A 4GP3A 4I1BA 5BXPA 1Z4SA 3BB2A 3O4OA 1EYLA 4I7IA 3I29B 1FWUA 2Q3NB 1EV2A 4G9MA 3LLPA 3HMYA 4Q9GA 4EFQA 2E4MC 3O4BA 4EB2B 1BFCA 2AXMA 3IAGC 1I1EA 3V0AB 2Y9GA 3PG0A 4AN6A 4H9WA 4QALA 2AAIB 5D62A 1S0GA 2D7RA 3AKIA 3CA1A 4LO3C 3FJJA 1JQZA 5F90A 4I4YA 1AVAC 1HWNB 2VXTI 4QC4A 2ERMA 3RTJB 3V79C 3BAGA 4X37A 4ISQA 2X2TA 1HCDA 3F62B 3N7JA 4ZOTA 3FJHA 4J2SA 1XYFA 2K8RA 3VT2A 4A7KA 1DZCA 1CE7B 2AQZA 1JT5A 3FJEA 4FGFA 1HKNA 4KEIA 2UUSA 3N7MA 4HR6C 4G1RA 3BA4A 2K43A 3ZXGA 3CA0A 3O3QA 2Y9WC 1S0LA 3WO3A 3A21A 5FNWA 4DEPA 2FO1A 3R4SA 2HWMA 4I8MA 5BQUC 1JLXA 1BFGA 4ZKTB 4LO0C 3FJ8A 3IM5A 4LO7B 2F2FC 4J2XA 3P6IA 2VU9A 1R8NA 2VLCA 2VUAA 1J0SA 3WO4A 5G00A 1IJTA 3AZWA 4EKXB 3BAQA 2LIQA 4TLPA 3Q7WA 3I2AA 4ZBVB 31BIA 3PUBA 2WRYA 3WINC 3N7LA 4J2YA 2NVHA 4PC4A 2VSEA 1S0FA 2LIEA 3ZX7A 1IT0A 3OBRA 3UDAA 1IRPA 3RTIB 1PC8B 4ZFUB 2DREA 1DIWA 3A07A 1Z0HA 3AJ6A 2FDBM 4LO7C 2I1BA 3BA7A 1FQ9A 1YBIA 1FWVA 4I4RA 2D24A 21BIA 3CAHA 3F1RA 4GOVA 1M16A 2HZ9A 4JQ0A 4L4HA 1ISZA 1IHKA 4F83A 1HIBA 3O5WB 2YUGA 2RSTA 3JUTA 1XHBA 5DSSB 1SR4C 4I4SA 3VUOA 3C9ZA 3OGGA 2BEAA 3KMVA 4HJJA 4XFSA 3BAUA 4IY9A 4CJMA 2MC2A 3E8LC 4ZLBB 3CRHA 1IILA 1PZZA 3FJKA 1TTUA 5BVPI 3R4UA 1M2TB 1JT3A 1AVUA 1TOOA 3D7WB 2M49A 4D0ZA 4JRAA 1DQGA 4LO8B 1WD4A 3QR5A 3NBEA 1Q04A 1JT7A 1IOBA 3BAOA 4OUJA 4Q9PA 1D0HA 4USOA 4JPZA 3CA3A 5JMCA 3FUOA 1DJSB 3PMEA 41BIA 1BLAA 2Y9XE 5DUYA 3NBCA 4HA2A 4X3AA 1FMMS 1AVWB 4ENDA 4EFPA 3W9TA 2Z49A 5D61A 1Q03A 4KEKA 2MLLB 3I2XA 2Q9XA 3P6JA 3RSJA 2IHOA 4LO2C 1VCLA 3FJBA 3QYDA 4OEGA 4WBCA 4Z9WB 2NP0A 3MALA 3WA1A 1YXWA 1V6UA 4ZFWB 1R8OA 2AFGA 3HBWA 1FV3A 3P53A 1JT4A 4P0JA 1II4A 4KEJA 2FFVA 3N0KA 1TIEA 4X39A 1YYNA 2KLLA 3V0BA 5EHAA 1BFFA 1S0EA 2DRZA 4GP0A 2DRYA 2NYYA 3VSFA 5JLVA 3NBDA 1QQLA 2IWTB 4P0LA 1W3GA 5F8SA 1V6VA 1L2HA 5GAQA 1DQOA 4YOLA 3A22A 3JRRA 2KI6B 4G6JA 3BAHA 4DCKC 2ZR1B 3OJVA 4I4UA 4IQPA 2RG9B 3AKFA 3HALA 5DZUA 3IM6A 2DS0A 3UD7A 5F8WA 1HWPB 4ZA3B 3CA6A 5I1BA 1XG6A 4P0KA 1DLLA 3WO2A 2WBCA 3B9UA 3CRIA 3AH1A 5HPZA 4ISRA 3CA5A 3RMXA 1AXMA 4I2SA 4QKRA 3OJMA 5FZZA 1RY7A 4I0YA 1IRAX 3O49A 3BA5A 2D20A 3TC2A 2F2FA 4LO1A 1W3FA 1DFCA 4IHZA 3O44A 1T9FA 3HN1A 2KI4A 1E0OA 1YF8B 2J3PA 1UPSA 4I4OA 4GAIA 4QBVA 2D7IA 5BP5C 4QBCA 1S0BA 3NBNA 1RZOB 3MPPG 2KKIA 1RG8A 2D43A 3ZC8A 3O4CA 1T4QA 4EFRA 1N4KA 1PUMB 1Z2VA 3FFZA 3VT1A 4JKXB 4JAWA 5DVHA 1WBCA 3CA4A 3WINA 3HSMA 1PUUB 4I3NA 1QQKA 1AF9A 2L5XA 3A23A 3O4AA 9ILBA 3RMYA 3H6RA 1W3AA 3H6QA 4G9NA 5F8YA 1ILR1 4J23B 3UJ0A 3BADA 3S8KA 2F8XC 3IM7A 4P6AA 3V0BB 1NZKA 3N7KA 1G9AA 3ZC9A 2FGFA 3FJCA 4X38A 4XFTA 1ISVA 4I4PA 1BLDA 3AZVA 1TP0A 2GZBA 1EVTA 1EPWA 3BTAA 4DENA 4IZEA 4JKQA 1G82A 4OWLA 1AFCA 1S0CA 1ISXA 1SR4A 3ZXDA 5E24E 1ONKB 3AH4A 3FJAA 3NJ5A 1AVXB 1ITBA 1S0DA 4ZGRB 2ESUA 3O4DA 3VSZA 3WMVA 1XZZA 3FJIA 3K1XA 4I4QA 2E4MA 2NTDA 3OJ2A 4EEEB 3UJ4A 4I1EA 4ZFYB 4QD2B 1I1BA 1SZ6B 3T8SA 1RMLA 4D8HA 4OEEA 1WBAA 3AKHA 1QXMA 3Q7YA 1MD6A 3BX1C 1TWEA 1HWMB 4LO3A 2FFUA 3CU1B 2ZQNA 4USPA 4F34A 4KBBA 4OWJA 3POKA 2GO2A 2D22A 4QO3A 3FJFA 1TFMB 4JP0A 1BARA 3WMUA 1F31A 1CVSA 1G9BA 1ISYA 3BRGC 1BA7A 1P63A 1KNMA 3FUQA 1K5VA 2Y9FA 3HOMA 4I96A 4I4VA 4LO2A 4H04A 2VSAA 4I37A 1WD3A 4A7YA 3H6RB 4A7ZA 1MC9A 2BEBA 4QKSA 3UD9A 1BFBA 4FVVA 1FN0A 1A8DA 4J2KA 4QD2C 1GGPB 3V0AA 2NZ9A 5BXRA 4LO1C 5BQUA 4XKIA 1V6XA 4IZXA 4LO0A 5B2HA 1V6WA 1G9DA 3AKGA 3AJ5A 4I6IA 3CQAA 5EG6C 2MIBA 3S8JA 4G6MA 2D23A 4IYBA 1YTOA 1K5UA 7I1BA 2QYIB 5EC5A 2XOAA 1HWOB 2HWAA 1DFQA 4OWKA 1FGAA 2VXRA 5BXSA 1FMZA 6I1BA 4II0A 2HW9A 3BAVA 4IY8A 4I4XA 1HCEA 4IONA 2KH2A 2RQ9A 8I1BA 4D0TA 3H6SE 4XFUA 1PWAA 1JY0A 1FV2A 4GAFA
chains in the Genus database with same CATH superfamily
3UD8A 3BRDA 3OGFA 3FJDA 2ZQOA 2QN4A 1OQLB 2D1ZA 3VEQA 1DZDA 4Q91A 2X2SA 3CRGA 3FJ9A 3IIRA 1TWMA 2NM1A 5FZUA 3VWCA 3ILAA 3FGMA 2ET2A 3PHZA 4L4IA 5FZYA 5BOWA 4R6UB 2BFHA 2R9KB 4GOYA 2D44A 2K4AB 5D63A 3OBTA 5BP5A 4OEFA 1JLYA 1BASA 1ABRB 5BXTA 1ISWA 5FNXA 3VT0A 3LTQA 4KC3A 3Q7XA 1NUNA 2P23A 2P39A 4OW4A 1G9CA 1Q1UA 3BRFA 2Z48A 3EF2A 4Z8SB 3SNVA 4AN7B 1JTCA 3AH2A 4GP3A 4I1BA 5BXPA 1Z4SA 3BB2A 3O4OA 1EYLA 4I7IA 3I29B 1FWUA 2Q3NB 1EV2A 4G9MA 3LLPA 3HMYA 4Q9GA 4EFQA 2E4MC 3O4BA 4EB2B 1BFCA 2AXMA 3IAGC 1I1EA 3V0AB 2Y9GA 3PG0A 4AN6A 4H9WA 4QALA 2AAIB 5D62A 1S0GA 2D7RA 3AKIA 3CA1A 4LO3C 3FJJA 1JQZA 5F90A 4I4YA 1AVAC 1HWNB 2VXTI 4QC4A 2ERMA 3RTJB 3V79C 3BAGA 4X37A 4ISQA 2X2TA 1HCDA 3F62B 3N7JA 4ZOTA 3FJHA 4J2SA 1XYFA 2K8RA 3VT2A 4A7KA 1DZCA 1CE7B 2AQZA 1JT5A 3FJEA 4FGFA 1HKNA 4KEIA 2UUSA 3N7MA 4HR6C 4G1RA 3BA4A 2K43A 3ZXGA 3CA0A 3O3QA 2Y9WC 1S0LA 3WO3A 3A21A 5FNWA 4DEPA 2FO1A 3R4SA 2HWMA 4I8MA 5BQUC 1JLXA 1BFGA 4ZKTB 4LO0C 3FJ8A 3IM5A 4LO7B 2F2FC 4J2XA 3P6IA 2VU9A 4MZGB 1R8NA 2VLCA 2VUAA 1J0SA 3WO4A 5G00A 1IJTA 3AZWA 4EKXB 3BAQA 2LIQA 4TLPA 3Q7WA 3I2AA 4ZBVB 31BIA 3PUBA 4MZHA 2WRYA 3WINC 3N7LA 4J2YA 2NVHA 4PC4A 2VSEA 1S0FA 2LIEA 3ZX7A 1IT0A 3OBRA 3UDAA 1IRPA 3RTIB 1PC8B 4ZFUB 2DREA 1DIWA 3A07A 1Z0HA 3AJ6A 2FDBM 4LO7C 2I1BA 3BA7A 1FQ9A 1YBIA 1FWVA 4I4RA 2D24A 21BIA 3CAHA 3F1RA 4GOVA 1M16A 2HZ9A 4JQ0A 4L4HA 1ISZA 1IHKA 4F83A 1HIBA 3O5WB 2YUGA 2RSTA 3JUTA 1XHBA 5DSSB 1SR4C 4I4SA 3VUOA 3C9ZA 3OGGA 2BEAA 3KMVA 4HJJA 4XFSA 3BAUA 4IY9A 4CJMA 2MC2A 3E8LC 4ZLBB 3CRHA 1IILA 1PZZA 3FJKA 1TTUA 5BVPI 3R4UA 1M2TB 1JT3A 1AVUA 1TOOA 3D7WB 2M49A 4D0ZA 4JRAA 1DQGA 4LO8B 1WD4A 3QR5A 3NBEA 1Q04A 1JT7A 1IOBA 3BAOA 4OUJA 4Q9PA 1D0HA 4USOA 4JPZA 3CA3A 5JMCA 3FUOA 1DJSB 3PMEA 41BIA 1BLAA 2Y9XE 5DUYA 3NBCA 4HA2A 4X3AA 1FMMS 1AVWB 4ENDA 4EFPA 3W9TA 2Z49A 5D61A 1Q03A 4KEKA 2MLLB 3I2XA 2Q9XA 3P6JA 3RSJA 2IHOA 4LO2C 1VCLA 3FJBA 3QYDA 4OEGA 4WBCA 4Z9WB 2NP0A 3MALA 3WA1A 1YXWA 1V6UA 4ZFWB 1R8OA 2AFGA 3HBWA 1FV3A 3P53A 1JT4A 4P0JA 1II4A 4KEJA 2FFVA 3N0KA 1TIEA 4X39A 1YYNA 2KLLA 3V0BA 5EHAA 1BFFA 1S0EA 2DRZA 4GP0A 2DRYA 2NYYA 2NS2A 3VSFA 5JLVA 3NBDA 1QQLA 2IWTB 4P0LA 1W3GA 5F8SA 1V6VA 1L2HA 5GAQA 1DQOA 4YOLA 3A22A 3JRRA 2KI6B 4G6JA 3BAHA 4DCKC 2ZR1B 3OJVA 4I4UA 4IQPA 2RG9B 3AKFA 3HALA 5DZUA 3IM6A 2DS0A 3UD7A 5F8WA 1HWPB 4ZA3B 3CA6A 5I1BA 1XG6A 4P0KA 1DLLA 3WO2A 2WBCA 3B9UA 3CRIA 3AH1A 5HPZA 4ISRA 3CA5A 3RMXA 1AXMA 4I2SA 4QKRA 3OJMA 5FZZA 1RY7A 4I0YA 1IRAX 3O49A 3BA5A 2D20A 3TC2A 2F2FA 4LO1A 1W3FA 1DFCA 4IHZA 3O44A 1T9FA 3HN1A 2KI4A 1E0OA 1YF8B 2J3PA 1UPSA 4I4OA 4GAIA 4QBVA 2D7IA 5BP5C 4QBCA 1S0BA 3NBNA 1RZOB 3MPPG 2KKIA 1RG8A 2D43A 3ZC8A 3O4CA 1T4QA 4EFRA 1N4KA 1PUMB 1Z2VA 3FFZA 3VT1A 4JKXB 4JAWA 5DVHA 1WBCA 3CA4A 3WINA 3HSMA 1PUUB 4I3NA 1QQKA 1AF9A 2L5XA 3A23A 3O4AA 9ILBA 3RMYA 3H6RA 1W3AA 3H6QA 4G9NA 5F8YA 1ILR1 4J23B 3UJ0A 3BADA 3S8KA 2F8XC 3IM7A 4P6AA 3V0BB 1NZKA 3N7KA 1G9AA 3ZC9A 2FGFA 3FJCA 4X38A 4XFTA 1ISVA 4I4PA 1BLDA 3AZVA 1TP0A 2GZBA 1EVTA 1EPWA 3BTAA 4DENA 4IZEA 4JKQA 1G82A 4OWLA 1AFCA 1S0CA 1ISXA 4MZFB 1SR4A 3ZXDA 5E24E 1ONKB 3AH4A 3FJAA 3NJ5A 1AVXB 1ITBA 1S0DA 4ZGRB 2ESUA 3O4DA 3VSZA 3WMVA 1XZZA 3FJIA 3K1XA 4I4QA 2E4MA 2NTDA 3OJ2A 4EEEB 3UJ4A 4I1EA 4ZFYB 4QD2B 1I1BA 1SZ6B 3T8SA 1RMLA 4D8HA 4OEEA 1WBAA 3AKHA 1QXMA 3Q7YA 1MD6A 3BX1C 1TWEA 1HWMB 4LO3A 2FFUA 3CU1B 2ZQNA 4USPA 4F34A 4KBBA 4OWJA 3POKA 2GO2A 2D22A 4QO3A 3FJFA 1TFMB 4JP0A 1BARA 3WMUA 1F31A 1CVSA 1G9BA 1ISYA 3BRGC 1BA7A 1P63A 1KNMA 3FUQA 1K5VA 2Y9FA 3HOMA 4I96A 4I4VA 4LO2A 4H04A 2VSAA 4I37A 1WD3A 4A7YA 3H6RB 4A7ZA 1MC9A 2BEBA 4QKSA 3UD9A 1BFBA 4UY4A 4FVVA 1FN0A 1A8DA 4H75A 4J2KA 4QD2C 1GGPB 3V0AA 2NZ9A 5BXRA 4LO1C 5BQUA 4XKIA 1V6XA 4IZXA 4LO0A 5B2HA 1V6WA 1G9DA 3AKGA 3AJ5A 4I6IA 3CQAA 5EG6C 2MIBA 3S8JA 4G6MA 2D23A 4IYBA 1YTOA 1K5UA 7I1BA 2QYIB 5EC5A 2XOAA 1HWOB 2HWAA 1DFQA 4OWKA 1FGAA 2VXRA 5BXSA 1FMZA 6I1BA 4II0A 2HW9A 3BAVA 4IY8A 4I4XA 1HCEA 4IONA 2KH2A 2RQ9A 8I1BA 4D0TA 3H6SE 4XFUA 1PWAA 1JY0A 1FV2A 4GAFA
chains in the Genus database with same CATH topology
3UD8A 3BRDA 3OGFA 3FJDA 2ZQOA 2QN4A 1OQLB 2D1ZA 3VEQA 1DZDA 4Q91A 2X2SA 3CRGA 3FJ9A 3IIRA 1TWMA 2NM1A 5FZUA 3VWCA 3ILAA 3FGMA 2ET2A 3PHZA 4L4IA 5FZYA 5BOWA 4R6UB 2BFHA 2R9KB 4GOYA 2D44A 2K4AB 5D63A 3OBTA 5BP5A 4OEFA 1JLYA 1BASA 1ABRB 5BXTA 1ISWA 5FNXA 3VT0A 3LTQA 4KC3A 3Q7XA 1NUNA 2P23A 2P39A 4OW4A 1G9CA 1Q1UA 3BRFA 2Z48A 3EF2A 4Z8SB 3SNVA 4AN7B 1JTCA 3AH2A 4GP3A 4I1BA 5BXPA 1Z4SA 3BB2A 3O4OA 1EYLA 4I7IA 3I29B 1FWUA 2Q3NB 1EV2A 4G9MA 3LLPA 3HMYA 4Q9GA 4EFQA 2E4MC 3O4BA 4EB2B 1BFCA 2AXMA 3IAGC 1I1EA 3V0AB 2Y9GA 3PG0A 4AN6A 4H9WA 4QALA 2AAIB 5D62A 1S0GA 2D7RA 3AKIA 3CA1A 4LO3C 3FJJA 1JQZA 5F90A 4I4YA 1AVAC 1HWNB 2VXTI 4QC4A 2ERMA 3RTJB 3V79C 3BAGA 4X37A 4ISQA 2X2TA 1HCDA 3F62B 3N7JA 4ZOTA 3FJHA 4J2SA 1XYFA 2K8RA 3VT2A 4A7KA 1DZCA 1CE7B 2AQZA 1JT5A 3FJEA 4FGFA 1HKNA 4KEIA 2UUSA 3N7MA 4HR6C 4G1RA 3BA4A 2K43A 3ZXGA 3CA0A 3O3QA 2Y9WC 1S0LA 3WO3A 3A21A 5FNWA 4DEPA 2FO1A 3R4SA 2HWMA 4I8MA 5BQUC 1JLXA 1BFGA 4ZKTB 4LO0C 3FJ8A 3IM5A 4LO7B 2F2FC 4J2XA 3P6IA 2VU9A 4MZGB 1R8NA 2VLCA 2VUAA 1J0SA 3WO4A 5G00A 1IJTA 3AZWA 4EKXB 3BAQA 2LIQA 4TLPA 3Q7WA 3I2AA 4ZBVB 31BIA 3PUBA 4MZHA 2WRYA 3WINC 3N7LA 4J2YA 2NVHA 4PC4A 2VSEA 1S0FA 2LIEA 3ZX7A 1IT0A 3OBRA 3UDAA 1IRPA 3RTIB 1PC8B 4ZFUB 2DREA 1DIWA 3A07A 1Z0HA 3AJ6A 2FDBM 4LO7C 2I1BA 3BA7A 1FQ9A 1YBIA 1FWVA 4I4RA 2D24A 21BIA 3CAHA 3F1RA 4GOVA 1M16A 2HZ9A 4JQ0A 4L4HA 1ISZA 1IHKA 4F83A 1HIBA 3O5WB 2YUGA 2RSTA 3JUTA 1XHBA 5DSSB 1SR4C 4I4SA 3VUOA 3C9ZA 3OGGA 2BEAA 3KMVA 4HJJA 4XFSA 3BAUA 4IY9A 4CJMA 2MC2A 3E8LC 4ZLBB 3CRHA 1IILA 1PZZA 3FJKA 1TTUA 5BVPI 3R4UA 1M2TB 1JT3A 1AVUA 1TOOA 3D7WB 2M49A 4D0ZA 4JRAA 1DQGA 4LO8B 1WD4A 3QR5A 3NBEA 1Q04A 1JT7A 1IOBA 3BAOA 4OUJA 4Q9PA 1D0HA 4USOA 4JPZA 3CA3A 5JMCA 3FUOA 1DJSB 3PMEA 41BIA 1BLAA 2Y9XE 5DUYA 3NBCA 4HA2A 4X3AA 1FMMS 1AVWB 4ENDA 4EFPA 3W9TA 2Z49A 5D61A 1Q03A 4KEKA 2MLLB 3I2XA 2Q9XA 3P6JA 3RSJA 2IHOA 4LO2C 1VCLA 3FJBA 3QYDA 4OEGA 4WBCA 4Z9WB 2NP0A 3MALA 3WA1A 1YXWA 1V6UA 4ZFWB 1R8OA 2AFGA 3HBWA 1FV3A 3P53A 1JT4A 4P0JA 1II4A 4KEJA 2FFVA 3N0KA 1TIEA 4X39A 1YYNA 2KLLA 3V0BA 5EHAA 1BFFA 1S0EA 2DRZA 4GP0A 2DRYA 2NYYA 2NS2A 3VSFA 5JLVA 3NBDA 1QQLA 2IWTB 4P0LA 1W3GA 5F8SA 1V6VA 1L2HA 5GAQA 1DQOA 4YOLA 3A22A 3JRRA 2KI6B 4G6JA 3BAHA 4DCKC 2ZR1B 3OJVA 4I4UA 4IQPA 2RG9B 3AKFA 3HALA 5DZUA 3IM6A 2DS0A 3UD7A 5F8WA 1HWPB 4ZA3B 3CA6A 5I1BA 1XG6A 4P0KA 1DLLA 3WO2A 2WBCA 3B9UA 3CRIA 3AH1A 5HPZA 4ISRA 3CA5A 3RMXA 1AXMA 4I2SA 4QKRA 3OJMA 5FZZA 1RY7A 4I0YA 1IRAX 3O49A 3BA5A 2D20A 3TC2A 2F2FA 4LO1A 1W3FA 1DFCA 4IHZA 3O44A 1T9FA 3HN1A 2KI4A 1E0OA 1YF8B 2J3PA 1UPSA 4I4OA 4GAIA 4QBVA 2D7IA 5BP5C 4QBCA 1S0BA 3NBNA 1RZOB 3MPPG 2KKIA 1RG8A 2D43A 3ZC8A 3O4CA 1T4QA 4EFRA 1N4KA 1PUMB 1Z2VA 3FFZA 3VT1A 4JKXB 4JAWA 5DVHA 1WBCA 3CA4A 3WINA 3HSMA 1PUUB 4I3NA 1QQKA 1AF9A 2L5XA 3A23A 3O4AA 9ILBA 3RMYA 3H6RA 1W3AA 3H6QA 4G9NA 5F8YA 1ILR1 4J23B 3UJ0A 3BADA 3S8KA 2F8XC 3IM7A 4P6AA 3V0BB 1NZKA 3N7KA 1G9AA 3ZC9A 2FGFA 3FJCA 4X38A 4XFTA 1ISVA 4I4PA 1BLDA 3AZVA 1TP0A 2GZBA 1EVTA 1EPWA 3BTAA 4DENA 4IZEA 4JKQA 1G82A 4OWLA 1AFCA 1S0CA 1ISXA 4MZFB 1SR4A 3ZXDA 5E24E 1ONKB 3AH4A 3FJAA 3NJ5A 1AVXB 1ITBA 1S0DA 4ZGRB 2ESUA 3O4DA 3VSZA 3WMVA 1XZZA 3FJIA 3K1XA 4I4QA 2E4MA 2NTDA 3OJ2A 4EEEB 3UJ4A 4I1EA 4ZFYB 4QD2B 1I1BA 1SZ6B 3T8SA 1RMLA 4D8HA 4OEEA 1WBAA 3AKHA 1QXMA 3Q7YA 1MD6A 3BX1C 1TWEA 1HWMB 4LO3A 2FFUA 3CU1B 2ZQNA 4USPA 4F34A 4KBBA 4OWJA 3POKA 2GO2A 2D22A 4QO3A 3FJFA 1TFMB 4JP0A 1BARA 3WMUA 1F31A 1CVSA 1G9BA 1ISYA 3BRGC 1BA7A 1P63A 1KNMA 3FUQA 1K5VA 2Y9FA 3HOMA 4I96A 4I4VA 4LO2A 4H04A 2VSAA 4I37A 1WD3A 4A7YA 3H6RB 4A7ZA 1MC9A 2BEBA 4QKSA 3UD9A 1BFBA 4UY4A 4FVVA 1FN0A 1A8DA 4H75A 4J2KA 4QD2C 1GGPB 3V0AA 2NZ9A 5BXRA 4LO1C 5BQUA 4XKIA 1V6XA 4IZXA 4LO0A 5B2HA 1V6WA 1G9DA 3AKGA 3AJ5A 4I6IA 3CQAA 5EG6C 2MIBA 3S8JA 4G6MA 2D23A 4IYBA 1YTOA 1K5UA 7I1BA 2QYIB 5EC5A 2XOAA 1HWOB 2HWAA 1DFQA 4OWKA 1FGAA 2VXRA 5BXSA 1FMZA 6I1BA 4II0A 2HW9A 3BAVA 4IY8A 4I4XA 1HCEA 4IONA 2KH2A 2RQ9A 8I1BA 4D0TA 3H6SE 4XFUA 1PWAA 1JY0A 1FV2A 4GAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UD8 A;  3BRD A;  3OGF A;  3FJD A;  2ZQO A;  2QN4 A;  1OQL B;  2D1Z A;  3VEQ A;  1DZD A;  4Q91 A;  2X2S A;  3CRG A;  3FJ9 A;  3IIR A;  1TWM A;  2NM1 A;  5FZU A;  3VWC A;  3ILA A;  3FGM A;  2ET2 A;  3PHZ A;  4L4I A;  5FZY A;  5BOW A;  4R6U B;  2BFH A;  2R9K B;  4GOY A;  2D44 A;  2K4A B;  5D63 A;  3OBT A;  5BP5 A;  4OEF A;  1JLY A;  1BAS A;  1ABR B;  5BXT A;  1ISW A;  5FNX A;  3VT0 A;  3LTQ A;  4KC3 A;  3Q7X A;  1NUN A;  2P23 A;  2P39 A;  4OW4 A;  1G9C A;  1Q1U A;  3BRF A;  2Z48 A;  3EF2 A;  4Z8S B;  3SNV A;  4AN7 B;  1JTC A;  3AH2 A;  4GP3 A;  4I1B A;  5BXP A;  1Z4S A;  3BB2 A;  3O4O A;  1EYL A;  4I7I A;  3I29 B;  1FWU A;  2Q3N B;  1EV2 A;  4G9M A;  3LLP A;  3HMY A;  4Q9G A;  4EFQ A;  2E4M C;  3O4B A;  4EB2 B;  1BFC A;  2AXM A;  3IAG C;  1I1E A;  3V0A B;  2Y9G A;  3PG0 A;  4AN6 A;  4H9W A;  4QAL A;  2AAI B;  5D62 A;  1S0G A;  2D7R A;  3AKI A;  3CA1 A;  4LO3 C;  3FJJ A;  1JQZ A;  5F90 A;  4I4Y A;  1AVA C;  1HWN B;  2VXT I;  4QC4 A;  2ERM A;  3RTJ B;  3V79 C;  3BAG A;  4X37 A;  4ISQ A;  2X2T A;  1HCD A;  3F62 B;  3N7J A;  4ZOT A;  3FJH A;  4J2S A;  1XYF A;  2K8R A;  3VT2 A;  4A7K A;  1DZC A;  1CE7 B;  2AQZ A;  1JT5 A;  3FJE A;  4FGF A;  1HKN A;  4KEI A;  2UUS A;  3N7M A;  4HR6 C;  4G1R A;  3BA4 A;  2K43 A;  3ZXG A;  3CA0 A;  3O3Q A;  2Y9W C;  1S0L A;  3WO3 A;  3A21 A;  5FNW A;  4DEP A;  2FO1 A;  3R4S A;  2HWM A;  4I8M A;  5BQU C;  1JLX A;  1BFG A;  4ZKT B;  4LO0 C;  3FJ8 A;  3IM5 A;  4LO7 B;  2F2F C;  4J2X A;  3P6I A;  2VU9 A;  1R8N A;  2VLC A;  2VUA A;  1J0S A;  3WO4 A;  5G00 A;  1IJT A;  3AZW A;  4EKX B;  3BAQ A;  2LIQ A;  4TLP A;  3Q7W A;  3I2A A;  4ZBV B;  31BI A;  3PUB A;  2WRY A;  3WIN C;  3N7L A;  4J2Y A;  2NVH A;  4PC4 A;  2VSE A;  1S0F A;  2LIE A;  3ZX7 A;  1IT0 A;  3OBR A;  3UDA A;  1IRP A;  3RTI B;  1PC8 B;  4ZFU B;  2DRE A;  1DIW A;  3A07 A;  1Z0H A;  3AJ6 A;  2FDB M;  4LO7 C;  2I1B A;  3BA7 A;  1FQ9 A;  1YBI A;  1FWV A;  4I4R A;  2D24 A;  21BI A;  3CAH A;  3F1R A;  4GOV A;  1M16 A;  2HZ9 A;  4JQ0 A;  4L4H A;  1ISZ A;  1IHK A;  4F83 A;  1HIB A;  3O5W B;  2YUG A;  2RST A;  3JUT A;  1XHB A;  5DSS B;  1SR4 C;  4I4S A;  3VUO A;  3C9Z A;  3OGG A;  2BEA A;  3KMV A;  4HJJ A;  4XFS A;  3BAU A;  4IY9 A;  4CJM A;  2MC2 A;  3E8L C;  4ZLB B;  3CRH A;  1IIL A;  1PZZ A;  3FJK A;  1TTU A;  5BVP I;  3R4U A;  1M2T B;  1JT3 A;  1AVU A;  1TOO A;  3D7W B;  2M49 A;  4D0Z A;  4JRA A;  1DQG A;  4LO8 B;  1WD4 A;  3QR5 A;  3NBE A;  1Q04 A;  1JT7 A;  1IOB A;  3BAO A;  4OUJ A;  4Q9P A;  1D0H A;  4USO A;  4JPZ A;  3CA3 A;  5JMC A;  3FUO A;  1DJS B;  3PME A;  41BI A;  1BLA A;  2Y9X E;  5DUY A;  3NBC A;  4HA2 A;  4X3A A;  1FMM S;  1AVW B;  4END A;  4EFP A;  3W9T A;  2Z49 A;  5D61 A;  1Q03 A;  4KEK A;  2MLL B;  3I2X A;  2Q9X A;  3P6J A;  3RSJ A;  2IHO A;  4LO2 C;  1VCL A;  3FJB A;  3QYD A;  4OEG A;  4WBC A;  4Z9W B;  2NP0 A;  3MAL A;  3WA1 A;  1YXW A;  1V6U A;  4ZFW B;  1R8O A;  2AFG A;  3HBW A;  1FV3 A;  3P53 A;  1JT4 A;  4P0J A;  1II4 A;  4KEJ A;  2FFV A;  3N0K A;  1TIE A;  4X39 A;  1YYN A;  2KLL A;  3V0B A;  5EHA A;  1BFF A;  1S0E A;  2DRZ A;  4GP0 A;  2DRY A;  2NYY A;  3VSF A;  5JLV A;  3NBD A;  1QQL A;  2IWT B;  4P0L A;  1W3G A;  5F8S A;  1V6V A;  1L2H A;  5GAQ A;  1DQO A;  4YOL A;  3A22 A;  3JRR A;  2KI6 B;  4G6J A;  3BAH A;  4DCK C;  2ZR1 B;  3OJV A;  4I4U A;  4IQP A;  2RG9 B;  3AKF A;  3HAL A;  5DZU A;  3IM6 A;  2DS0 A;  3UD7 A;  5F8W A;  1HWP B;  4ZA3 B;  3CA6 A;  5I1B A;  1XG6 A;  4P0K A;  1DLL A;  3WO2 A;  2WBC A;  3B9U A;  3CRI A;  3AH1 A;  5HPZ A;  4ISR A;  3CA5 A;  3RMX A;  1AXM A;  4I2S A;  4QKR A;  3OJM A;  5FZZ A;  1RY7 A;  4I0Y A;  1IRA X;  3O49 A;  3BA5 A;  2D20 A;  3TC2 A;  2F2F A;  4LO1 A;  1W3F A;  1DFC A;  4IHZ A;  3O44 A;  1T9F A;  3HN1 A;  2KI4 A;  1E0O A;  1YF8 B;  2J3P A;  1UPS A;  4I4O A;  4GAI A;  4QBV A;  2D7I A;  5BP5 C;  4QBC A;  1S0B A;  3NBN A;  1RZO B;  3MPP G;  2KKI A;  1RG8 A;  2D43 A;  3ZC8 A;  3O4C A;  1T4Q A;  4EFR A;  1N4K A;  1PUM B;  1Z2V A;  3FFZ A;  3VT1 A;  4JKX B;  4JAW A;  5DVH A;  1WBC A;  3CA4 A;  3WIN A;  3HSM A;  1PUU B;  4I3N A;  1QQK A;  1AF9 A;  2L5X A;  3A23 A;  3O4A A;  9ILB A;  3RMY A;  3H6R A;  1W3A A;  3H6Q A;  4G9N A;  5F8Y A;  1ILR 1;  4J23 B;  3UJ0 A;  3BAD A;  3S8K A;  2F8X C;  3IM7 A;  4P6A A;  3V0B B;  1NZK A;  3N7K A;  1G9A A;  3ZC9 A;  2FGF A;  3FJC A;  4X38 A;  4XFT A;  1ISV A;  4I4P A;  1BLD A;  3AZV A;  1TP0 A;  2GZB A;  1EVT A;  1EPW A;  3BTA A;  4DEN A;  4IZE A;  4JKQ A;  1G82 A;  4OWL A;  1AFC A;  1S0C A;  1ISX A;  1SR4 A;  3ZXD A;  5E24 E;  1ONK B;  3AH4 A;  3FJA A;  3NJ5 A;  1AVX B;  1ITB A;  1S0D A;  4ZGR B;  2ESU A;  3O4D A;  3VSZ A;  3WMV A;  1XZZ A;  3FJI A;  3K1X A;  4I4Q A;  2E4M A;  2NTD A;  3OJ2 A;  4EEE B;  3UJ4 A;  4I1E A;  4ZFY B;  4QD2 B;  1I1B A;  1SZ6 B;  3T8S A;  1RML A;  4D8H A;  4OEE A;  1WBA A;  3AKH A;  1QXM A;  3Q7Y A;  1MD6 A;  3BX1 C;  1TWE A;  1HWM B;  4LO3 A;  2FFU A;  3CU1 B;  2ZQN A;  4USP A;  4F34 A;  4KBB A;  4OWJ A;  3POK A;  2GO2 A;  2D22 A;  4QO3 A;  3FJF A;  1TFM B;  4JP0 A;  1BAR A;  3WMU A;  1F31 A;  1CVS A;  1G9B A;  1ISY A;  3BRG C;  1BA7 A;  1P63 A;  1KNM A;  3FUQ A;  1K5V A;  2Y9F A;  3HOM A;  4I96 A;  4I4V A;  4LO2 A;  4H04 A;  2VSA A;  4I37 A;  1WD3 A;  4A7Y A;  3H6R B;  4A7Z A;  1MC9 A;  2BEB A;  4QKS A;  3UD9 A;  1BFB A;  4FVV A;  1FN0 A;  1A8D A;  4J2K A;  4QD2 C;  1GGP B;  3V0A A;  2NZ9 A;  5BXR A;  4LO1 C;  5BQU A;  4XKI A;  1V6X A;  4IZX A;  4LO0 A;  5B2H A;  1V6W A;  1G9D A;  3AKG A;  3AJ5 A;  4I6I A;  3CQA A;  5EG6 C;  2MIB A;  3S8J A;  4G6M A;  2D23 A;  4IYB A;  1YTO A;  1K5U A;  7I1B A;  2QYI B;  5EC5 A;  2XOA A;  1HWO B;  2HWA A;  1DFQ A;  4OWK A;  1FGA A;  2VXR A;  5BXS A;  1FMZ A;  6I1B A;  4II0 A;  2HW9 A;  3BAV A;  4IY8 A;  4I4X A;  1HCE A;  4ION A;  2KH2 A;  2RQ9 A;  8I1B A;  4D0T A;  3H6S E;  4XFU A;  1PWA A;  1JY0 A;  1FV2 A;  4GAF A; 
#chains in the Genus database with same CATH topology
 3UD8 A;  3BRD A;  3OGF A;  3FJD A;  2ZQO A;  2QN4 A;  1OQL B;  2D1Z A;  3VEQ A;  1DZD A;  4Q91 A;  2X2S A;  3CRG A;  3FJ9 A;  3IIR A;  1TWM A;  2NM1 A;  5FZU A;  3VWC A;  3ILA A;  3FGM A;  2ET2 A;  3PHZ A;  4L4I A;  5FZY A;  5BOW A;  4R6U B;  2BFH A;  2R9K B;  4GOY A;  2D44 A;  2K4A B;  5D63 A;  3OBT A;  5BP5 A;  4OEF A;  1JLY A;  1BAS A;  1ABR B;  5BXT A;  1ISW A;  5FNX A;  3VT0 A;  3LTQ A;  4KC3 A;  3Q7X A;  1NUN A;  2P23 A;  2P39 A;  4OW4 A;  1G9C A;  1Q1U A;  3BRF A;  2Z48 A;  3EF2 A;  4Z8S B;  3SNV A;  4AN7 B;  1JTC A;  3AH2 A;  4GP3 A;  4I1B A;  5BXP A;  1Z4S A;  3BB2 A;  3O4O A;  1EYL A;  4I7I A;  3I29 B;  1FWU A;  2Q3N B;  1EV2 A;  4G9M A;  3LLP A;  3HMY A;  4Q9G A;  4EFQ A;  2E4M C;  3O4B A;  4EB2 B;  1BFC A;  2AXM A;  3IAG C;  1I1E A;  3V0A B;  2Y9G A;  3PG0 A;  4AN6 A;  4H9W A;  4QAL A;  2AAI B;  5D62 A;  1S0G A;  2D7R A;  3AKI A;  3CA1 A;  4LO3 C;  3FJJ A;  1JQZ A;  5F90 A;  4I4Y A;  1AVA C;  1HWN B;  2VXT I;  4QC4 A;  2ERM A;  3RTJ B;  3V79 C;  3BAG A;  4X37 A;  4ISQ A;  2X2T A;  1HCD A;  3F62 B;  3N7J A;  4ZOT A;  3FJH A;  4J2S A;  1XYF A;  2K8R A;  3VT2 A;  4A7K A;  1DZC A;  1CE7 B;  2AQZ A;  1JT5 A;  3FJE A;  4FGF A;  1HKN A;  4KEI A;  2UUS A;  3N7M A;  4HR6 C;  4G1R A;  3BA4 A;  2K43 A;  3ZXG A;  3CA0 A;  3O3Q A;  2Y9W C;  1S0L A;  3WO3 A;  3A21 A;  5FNW A;  4DEP A;  2FO1 A;  3R4S A;  2HWM A;  4I8M A;  5BQU C;  1JLX A;  1BFG A;  4ZKT B;  4LO0 C;  3FJ8 A;  3IM5 A;  4LO7 B;  2F2F C;  4J2X A;  3P6I A;  2VU9 A;  4MZG B;  1R8N A;  2VLC A;  2VUA A;  1J0S A;  3WO4 A;  5G00 A;  1IJT A;  3AZW A;  4EKX B;  3BAQ A;  2LIQ A;  4TLP A;  3Q7W A;  3I2A A;  4ZBV B;  31BI A;  3PUB A;  4MZH A;  2WRY A;  3WIN C;  3N7L A;  4J2Y A;  2NVH A;  4PC4 A;  2VSE A;  1S0F A;  2LIE A;  3ZX7 A;  1IT0 A;  3OBR A;  3UDA A;  1IRP A;  3RTI B;  1PC8 B;  4ZFU B;  2DRE A;  1DIW A;  3A07 A;  1Z0H A;  3AJ6 A;  2FDB M;  4LO7 C;  2I1B A;  3BA7 A;  1FQ9 A;  1YBI A;  1FWV A;  4I4R A;  2D24 A;  21BI A;  3CAH A;  3F1R A;  4GOV A;  1M16 A;  2HZ9 A;  4JQ0 A;  4L4H A;  1ISZ A;  1IHK A;  4F83 A;  1HIB A;  3O5W B;  2YUG A;  2RST A;  3JUT A;  1XHB A;  5DSS B;  1SR4 C;  4I4S A;  3VUO A;  3C9Z A;  3OGG A;  2BEA A;  3KMV A;  4HJJ A;  4XFS A;  3BAU A;  4IY9 A;  4CJM A;  2MC2 A;  3E8L C;  4ZLB B;  3CRH A;  1IIL A;  1PZZ A;  3FJK A;  1TTU A;  5BVP I;  3R4U A;  1M2T B;  1JT3 A;  1AVU A;  1TOO A;  3D7W B;  2M49 A;  4D0Z A;  4JRA A;  1DQG A;  4LO8 B;  1WD4 A;  3QR5 A;  3NBE A;  1Q04 A;  1JT7 A;  1IOB A;  3BAO A;  4OUJ A;  4Q9P A;  1D0H A;  4USO A;  4JPZ A;  3CA3 A;  5JMC A;  3FUO A;  1DJS B;  3PME A;  41BI A;  1BLA A;  2Y9X E;  5DUY A;  3NBC A;  4HA2 A;  4X3A A;  1FMM S;  1AVW B;  4END A;  4EFP A;  3W9T A;  2Z49 A;  5D61 A;  1Q03 A;  4KEK A;  2MLL B;  3I2X A;  2Q9X A;  3P6J A;  3RSJ A;  2IHO A;  4LO2 C;  1VCL A;  3FJB A;  3QYD A;  4OEG A;  4WBC A;  4Z9W B;  2NP0 A;  3MAL A;  3WA1 A;  1YXW A;  1V6U A;  4ZFW B;  1R8O A;  2AFG A;  3HBW A;  1FV3 A;  3P53 A;  1JT4 A;  4P0J A;  1II4 A;  4KEJ A;  2FFV A;  3N0K A;  1TIE A;  4X39 A;  1YYN A;  2KLL A;  3V0B A;  5EHA A;  1BFF A;  1S0E A;  2DRZ A;  4GP0 A;  2DRY A;  2NYY A;  2NS2 A;  3VSF A;  5JLV A;  3NBD A;  1QQL A;  2IWT B;  4P0L A;  1W3G A;  5F8S A;  1V6V A;  1L2H A;  5GAQ A;  1DQO A;  4YOL A;  3A22 A;  3JRR A;  2KI6 B;  4G6J A;  3BAH A;  4DCK C;  2ZR1 B;  3OJV A;  4I4U A;  4IQP A;  2RG9 B;  3AKF A;  3HAL A;  5DZU A;  3IM6 A;  2DS0 A;  3UD7 A;  5F8W A;  1HWP B;  4ZA3 B;  3CA6 A;  5I1B A;  1XG6 A;  4P0K A;  1DLL A;  3WO2 A;  2WBC A;  3B9U A;  3CRI A;  3AH1 A;  5HPZ A;  4ISR A;  3CA5 A;  3RMX A;  1AXM A;  4I2S A;  4QKR A;  3OJM A;  5FZZ A;  1RY7 A;  4I0Y A;  1IRA X;  3O49 A;  3BA5 A;  2D20 A;  3TC2 A;  2F2F A;  4LO1 A;  1W3F A;  1DFC A;  4IHZ A;  3O44 A;  1T9F A;  3HN1 A;  2KI4 A;  1E0O A;  1YF8 B;  2J3P A;  1UPS A;  4I4O A;  4GAI A;  4QBV A;  2D7I A;  5BP5 C;  4QBC A;  1S0B A;  3NBN A;  1RZO B;  3MPP G;  2KKI A;  1RG8 A;  2D43 A;  3ZC8 A;  3O4C A;  1T4Q A;  4EFR A;  1N4K A;  1PUM B;  1Z2V A;  3FFZ A;  3VT1 A;  4JKX B;  4JAW A;  5DVH A;  1WBC A;  3CA4 A;  3WIN A;  3HSM A;  1PUU B;  4I3N A;  1QQK A;  1AF9 A;  2L5X A;  3A23 A;  3O4A A;  9ILB A;  3RMY A;  3H6R A;  1W3A A;  3H6Q A;  4G9N A;  5F8Y A;  1ILR 1;  4J23 B;  3UJ0 A;  3BAD A;  3S8K A;  2F8X C;  3IM7 A;  4P6A A;  3V0B B;  1NZK A;  3N7K A;  1G9A A;  3ZC9 A;  2FGF A;  3FJC A;  4X38 A;  4XFT A;  1ISV A;  4I4P A;  1BLD A;  3AZV A;  1TP0 A;  2GZB A;  1EVT A;  1EPW A;  3BTA A;  4DEN A;  4IZE A;  4JKQ A;  1G82 A;  4OWL A;  1AFC A;  1S0C A;  1ISX A;  4MZF B;  1SR4 A;  3ZXD A;  5E24 E;  1ONK B;  3AH4 A;  3FJA A;  3NJ5 A;  1AVX B;  1ITB A;  1S0D A;  4ZGR B;  2ESU A;  3O4D A;  3VSZ A;  3WMV A;  1XZZ A;  3FJI A;  3K1X A;  4I4Q A;  2E4M A;  2NTD A;  3OJ2 A;  4EEE B;  3UJ4 A;  4I1E A;  4ZFY B;  4QD2 B;  1I1B A;  1SZ6 B;  3T8S A;  1RML A;  4D8H A;  4OEE A;  1WBA A;  3AKH A;  1QXM A;  3Q7Y A;  1MD6 A;  3BX1 C;  1TWE A;  1HWM B;  4LO3 A;  2FFU A;  3CU1 B;  2ZQN A;  4USP A;  4F34 A;  4KBB A;  4OWJ A;  3POK A;  2GO2 A;  2D22 A;  4QO3 A;  3FJF A;  1TFM B;  4JP0 A;  1BAR A;  3WMU A;  1F31 A;  1CVS A;  1G9B A;  1ISY A;  3BRG C;  1BA7 A;  1P63 A;  1KNM A;  3FUQ A;  1K5V A;  2Y9F A;  3HOM A;  4I96 A;  4I4V A;  4LO2 A;  4H04 A;  2VSA A;  4I37 A;  1WD3 A;  4A7Y A;  3H6R B;  4A7Z A;  1MC9 A;  2BEB A;  4QKS A;  3UD9 A;  1BFB A;  4UY4 A;  4FVV A;  1FN0 A;  1A8D A;  4H75 A;  4J2K A;  4QD2 C;  1GGP B;  3V0A A;  2NZ9 A;  5BXR A;  4LO1 C;  5BQU A;  4XKI A;  1V6X A;  4IZX A;  4LO0 A;  5B2H A;  1V6W A;  1G9D A;  3AKG A;  3AJ5 A;  4I6I A;  3CQA A;  5EG6 C;  2MIB A;  3S8J A;  4G6M A;  2D23 A;  4IYB A;  1YTO A;  1K5U A;  7I1B A;  2QYI B;  5EC5 A;  2XOA A;  1HWO B;  2HWA A;  1DFQ A;  4OWK A;  1FGA A;  2VXR A;  5BXS A;  1FMZ A;  6I1B A;  4II0 A;  2HW9 A;  3BAV A;  4IY8 A;  4I4X A;  1HCE A;  4ION A;  2KH2 A;  2RQ9 A;  8I1B A;  4D0T A;  3H6S E;  4XFU A;  1PWA A;  1JY0 A;  1FV2 A;  4GAF A; 
#chains in the Genus database with same CATH homology
 3UD8 A;  3BRD A;  3OGF A;  3FJD A;  2ZQO A;  2QN4 A;  1OQL B;  2D1Z A;  3VEQ A;  1DZD A;  4Q91 A;  2X2S A;  3CRG A;  3FJ9 A;  3IIR A;  1TWM A;  2NM1 A;  5FZU A;  3VWC A;  3ILA A;  3FGM A;  2ET2 A;  3PHZ A;  4L4I A;  5FZY A;  5BOW A;  4R6U B;  2BFH A;  2R9K B;  4GOY A;  2D44 A;  2K4A B;  5D63 A;  3OBT A;  5BP5 A;  4OEF A;  1JLY A;  1BAS A;  1ABR B;  5BXT A;  1ISW A;  5FNX A;  3VT0 A;  3LTQ A;  4KC3 A;  3Q7X A;  1NUN A;  2P23 A;  2P39 A;  4OW4 A;  1G9C A;  1Q1U A;  3BRF A;  2Z48 A;  3EF2 A;  4Z8S B;  3SNV A;  4AN7 B;  1JTC A;  3AH2 A;  4GP3 A;  4I1B A;  5BXP A;  1Z4S A;  3BB2 A;  3O4O A;  1EYL A;  4I7I A;  3I29 B;  1FWU A;  2Q3N B;  1EV2 A;  4G9M A;  3LLP A;  3HMY A;  4Q9G A;  4EFQ A;  2E4M C;  3O4B A;  4EB2 B;  1BFC A;  2AXM A;  3IAG C;  1I1E A;  3V0A B;  2Y9G A;  3PG0 A;  4AN6 A;  4H9W A;  4QAL A;  2AAI B;  5D62 A;  1S0G A;  2D7R A;  3AKI A;  3CA1 A;  4LO3 C;  3FJJ A;  1JQZ A;  5F90 A;  4I4Y A;  1AVA C;  1HWN B;  2VXT I;  4QC4 A;  2ERM A;  3RTJ B;  3V79 C;  3BAG A;  4X37 A;  4ISQ A;  2X2T A;  1HCD A;  3F62 B;  3N7J A;  4ZOT A;  3FJH A;  4J2S A;  1XYF A;  2K8R A;  3VT2 A;  4A7K A;  1DZC A;  1CE7 B;  2AQZ A;  1JT5 A;  3FJE A;  4FGF A;  1HKN A;  4KEI A;  2UUS A;  3N7M A;  4HR6 C;  4G1R A;  3BA4 A;  2K43 A;  3ZXG A;  3CA0 A;  3O3Q A;  2Y9W C;  1S0L A;  3WO3 A;  3A21 A;  5FNW A;  4DEP A;  2FO1 A;  3R4S A;  2HWM A;  4I8M A;  5BQU C;  1JLX A;  1BFG A;  4ZKT B;  4LO0 C;  3FJ8 A;  3IM5 A;  4LO7 B;  2F2F C;  4J2X A;  3P6I A;  2VU9 A;  4MZG B;  1R8N A;  2VLC A;  2VUA A;  1J0S A;  3WO4 A;  5G00 A;  1IJT A;  3AZW A;  4EKX B;  3BAQ A;  2LIQ A;  4TLP A;  3Q7W A;  3I2A A;  4ZBV B;  31BI A;  3PUB A;  4MZH A;  2WRY A;  3WIN C;  3N7L A;  4J2Y A;  2NVH A;  4PC4 A;  2VSE A;  1S0F A;  2LIE A;  3ZX7 A;  1IT0 A;  3OBR A;  3UDA A;  1IRP A;  3RTI B;  1PC8 B;  4ZFU B;  2DRE A;  1DIW A;  3A07 A;  1Z0H A;  3AJ6 A;  2FDB M;  4LO7 C;  2I1B A;  3BA7 A;  1FQ9 A;  1YBI A;  1FWV A;  4I4R A;  2D24 A;  21BI A;  3CAH A;  3F1R A;  4GOV A;  1M16 A;  2HZ9 A;  4JQ0 A;  4L4H A;  1ISZ A;  1IHK A;  4F83 A;  1HIB A;  3O5W B;  2YUG A;  2RST A;  3JUT A;  1XHB A;  5DSS B;  1SR4 C;  4I4S A;  3VUO A;  3C9Z A;  3OGG A;  2BEA A;  3KMV A;  4HJJ A;  4XFS A;  3BAU A;  4IY9 A;  4CJM A;  2MC2 A;  3E8L C;  4ZLB B;  3CRH A;  1IIL A;  1PZZ A;  3FJK A;  1TTU A;  5BVP I;  3R4U A;  1M2T B;  1JT3 A;  1AVU A;  1TOO A;  3D7W B;  2M49 A;  4D0Z A;  4JRA A;  1DQG A;  4LO8 B;  1WD4 A;  3QR5 A;  3NBE A;  1Q04 A;  1JT7 A;  1IOB A;  3BAO A;  4OUJ A;  4Q9P A;  1D0H A;  4USO A;  4JPZ A;  3CA3 A;  5JMC A;  3FUO A;  1DJS B;  3PME A;  41BI A;  1BLA A;  2Y9X E;  5DUY A;  3NBC A;  4HA2 A;  4X3A A;  1FMM S;  1AVW B;  4END A;  4EFP A;  3W9T A;  2Z49 A;  5D61 A;  1Q03 A;  4KEK A;  2MLL B;  3I2X A;  2Q9X A;  3P6J A;  3RSJ A;  2IHO A;  4LO2 C;  1VCL A;  3FJB A;  3QYD A;  4OEG A;  4WBC A;  4Z9W B;  2NP0 A;  3MAL A;  3WA1 A;  1YXW A;  1V6U A;  4ZFW B;  1R8O A;  2AFG A;  3HBW A;  1FV3 A;  3P53 A;  1JT4 A;  4P0J A;  1II4 A;  4KEJ A;  2FFV A;  3N0K A;  1TIE A;  4X39 A;  1YYN A;  2KLL A;  3V0B A;  5EHA A;  1BFF A;  1S0E A;  2DRZ A;  4GP0 A;  2DRY A;  2NYY A;  2NS2 A;  3VSF A;  5JLV A;  3NBD A;  1QQL A;  2IWT B;  4P0L A;  1W3G A;  5F8S A;  1V6V A;  1L2H A;  5GAQ A;  1DQO A;  4YOL A;  3A22 A;  3JRR A;  2KI6 B;  4G6J A;  3BAH A;  4DCK C;  2ZR1 B;  3OJV A;  4I4U A;  4IQP A;  2RG9 B;  3AKF A;  3HAL A;  5DZU A;  3IM6 A;  2DS0 A;  3UD7 A;  5F8W A;  1HWP B;  4ZA3 B;  3CA6 A;  5I1B A;  1XG6 A;  4P0K A;  1DLL A;  3WO2 A;  2WBC A;  3B9U A;  3CRI A;  3AH1 A;  5HPZ A;  4ISR A;  3CA5 A;  3RMX A;  1AXM A;  4I2S A;  4QKR A;  3OJM A;  5FZZ A;  1RY7 A;  4I0Y A;  1IRA X;  3O49 A;  3BA5 A;  2D20 A;  3TC2 A;  2F2F A;  4LO1 A;  1W3F A;  1DFC A;  4IHZ A;  3O44 A;  1T9F A;  3HN1 A;  2KI4 A;  1E0O A;  1YF8 B;  2J3P A;  1UPS A;  4I4O A;  4GAI A;  4QBV A;  2D7I A;  5BP5 C;  4QBC A;  1S0B A;  3NBN A;  1RZO B;  3MPP G;  2KKI A;  1RG8 A;  2D43 A;  3ZC8 A;  3O4C A;  1T4Q A;  4EFR A;  1N4K A;  1PUM B;  1Z2V A;  3FFZ A;  3VT1 A;  4JKX B;  4JAW A;  5DVH A;  1WBC A;  3CA4 A;  3WIN A;  3HSM A;  1PUU B;  4I3N A;  1QQK A;  1AF9 A;  2L5X A;  3A23 A;  3O4A A;  9ILB A;  3RMY A;  3H6R A;  1W3A A;  3H6Q A;  4G9N A;  5F8Y A;  1ILR 1;  4J23 B;  3UJ0 A;  3BAD A;  3S8K A;  2F8X C;  3IM7 A;  4P6A A;  3V0B B;  1NZK A;  3N7K A;  1G9A A;  3ZC9 A;  2FGF A;  3FJC A;  4X38 A;  4XFT A;  1ISV A;  4I4P A;  1BLD A;  3AZV A;  1TP0 A;  2GZB A;  1EVT A;  1EPW A;  3BTA A;  4DEN A;  4IZE A;  4JKQ A;  1G82 A;  4OWL A;  1AFC A;  1S0C A;  1ISX A;  4MZF B;  1SR4 A;  3ZXD A;  5E24 E;  1ONK B;  3AH4 A;  3FJA A;  3NJ5 A;  1AVX B;  1ITB A;  1S0D A;  4ZGR B;  2ESU A;  3O4D A;  3VSZ A;  3WMV A;  1XZZ A;  3FJI A;  3K1X A;  4I4Q A;  2E4M A;  2NTD A;  3OJ2 A;  4EEE B;  3UJ4 A;  4I1E A;  4ZFY B;  4QD2 B;  1I1B A;  1SZ6 B;  3T8S A;  1RML A;  4D8H A;  4OEE A;  1WBA A;  3AKH A;  1QXM A;  3Q7Y A;  1MD6 A;  3BX1 C;  1TWE A;  1HWM B;  4LO3 A;  2FFU A;  3CU1 B;  2ZQN A;  4USP A;  4F34 A;  4KBB A;  4OWJ A;  3POK A;  2GO2 A;  2D22 A;  4QO3 A;  3FJF A;  1TFM B;  4JP0 A;  1BAR A;  3WMU A;  1F31 A;  1CVS A;  1G9B A;  1ISY A;  3BRG C;  1BA7 A;  1P63 A;  1KNM A;  3FUQ A;  1K5V A;  2Y9F A;  3HOM A;  4I96 A;  4I4V A;  4LO2 A;  4H04 A;  2VSA A;  4I37 A;  1WD3 A;  4A7Y A;  3H6R B;  4A7Z A;  1MC9 A;  2BEB A;  4QKS A;  3UD9 A;  1BFB A;  4UY4 A;  4FVV A;  1FN0 A;  1A8D A;  4H75 A;  4J2K A;  4QD2 C;  1GGP B;  3V0A A;  2NZ9 A;  5BXR A;  4LO1 C;  5BQU A;  4XKI A;  1V6X A;  4IZX A;  4LO0 A;  5B2H A;  1V6W A;  1G9D A;  3AKG A;  3AJ5 A;  4I6I A;  3CQA A;  5EG6 C;  2MIB A;  3S8J A;  4G6M A;  2D23 A;  4IYB A;  1YTO A;  1K5U A;  7I1B A;  2QYI B;  5EC5 A;  2XOA A;  1HWO B;  2HWA A;  1DFQ A;  4OWK A;  1FGA A;  2VXR A;  5BXS A;  1FMZ A;  6I1B A;  4II0 A;  2HW9 A;  3BAV A;  4IY8 A;  4I4X A;  1HCE A;  4ION A;  2KH2 A;  2RQ9 A;  8I1B A;  4D0T A;  3H6S E;  4XFU A;  1PWA A;  1JY0 A;  1FV2 A;  4GAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...