1DQGA

Crystal structure of the cysteine rich domain of mannose receptor
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
134
structure length
134
Chain Sequence
DARQFLIYNEDHKRCVDALSAISVQTATCNPEAESQKFRWVSDSQIMSVAFKLCLGVPSKTDWASVTLYACDSKSEYQKWECKNDTLFGIKGTELYFNYGNRQEKNIKLYKGSGLWSRWKVYGTTDDLCSRGYE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords MANNOSE RECEPTOR
publication title Crystal structure of the cysteine-rich domain of mannose receptor complexed with a sulfated carbohydrate ligand.
pubmed doi rcsb
source organism Mus musculus
total genus 34
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2000-01-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1dqgA00
2RSTA 2VU9A 1W3AA 4I4PA 1ISYA 1JTCA 4QC4A 3AH2A 1GGPB 3CA3A 4D0TA 3NJ5A 2X2SA 2K4AB 5DUYA 2HW9A 3FJJA 1TWMA 4AN7B 4ENDA 4LO2A 2HZ9A 2X2TA 3H6SE 3VSFA 2D24A 4EFQA 3Q7WA 4GOVA 1TP0A 2ZR1B 3RMYA 1E0OA 3BAGA 3FUQA 3RSJA 3N7MA 3AZVA 3FGMA 3PG0A 4KEJA 3OBTA 1JLYA 1DFCA 3JUTA 1QXMA 3S8KA 2Y9FA 3CRIA 4LO8B 1BLDA 5GAQA 5FNXA 5BXRA 2Z49A 2MC2A 1V6UA 5DZUA 2GZBA 3CA6A 1IOBA 1G9AA 4I4XA 4XFSA 1XHBA 2D20A 1EV2A 2IHOA 3H6RB 1WBAA 5FNWA 4LO7B 2NYYA 3FJCA 3V0BA 3OGGA 3CAHA 3VT0A 1JT4A 1Q1UA 4QD2C 4I37A 4OW4A 5E24E 3V0AA 4J2KA 4GAFA 1WD4A 2K43A 1K5VA 2UUSA 3I2XA 1FWVA 1XZZA 3IIRA 3BX1C 4JAWA 2P39A 2Z48A 4II0A 1EYLA 1XG6A 1S0BA 1G9DA 1G9BA 1DFQA 5BXSA 1MC9A 4I4RA 5BXTA 1T9FA 3A21A 3O4BA 2NVHA 3CA5A 3CRGA 2MIBA 2VLCA 4KC3A 2AQZA 1ISVA 1KNMA 3BADA 4R6UB 4Q91A 1BASA 2NM1A 2VUAA 4OUJA 4X38A 5D63A 1ONKB 1S0LA 4EB2B 4G6JA 5BP5A 4AN6A 3FJDA 1S0EA 2RQ9A 8I1BA 1G9CA 1PZZA 3S8JA 3UDAA 3BAOA 4OEGA 3T8SA 1BFGA 1ISWA 4JKXB 3P53A 2M49A 3VSZA 3CA4A 2QN4A 2D7RA 4WBCA 4I4VA 5I1BA 4D0ZA 3AKFA 2F8XC 4GP3A 1DIWA 1SZ6B 2BEBA 3R4SA 3FJIA 4JQ0A 5D61A 2ZQOA 3OBRA 4QO3A 3KMVA 3LTQA 1RG8A 2DS0A 5BP5C 4OWJA 4LO0A 3O4DA 6I1BA 3QR5A 1WD3A 4IZEA 1FQ9A 1VCLA 3E8LC 4GOYA 1D0HA 2D44A 2LIEA 3BB2A 2KI6B 4XKIA 3MALA 2FFVA 2Y9WC 3BAVA 1RMLA 5JMCA 3CU1B 1HWPB 4D8HA 3AKHA 2VSAA 2F2FA 4LO3C 3UD7A 4JP0A 2NZ9A 4ISRA 1NZKA 4ZFWB 3OGFA 3BTAA 3H6QA 1DLLA 1K5UA 1I1BA 3JRRA 4LO0C 4CJMA 3BA5A 3VEQA 3PUBA 2I1BA 2DRYA 4JPZA 4LO1A 3N7KA 4IZXA 1QQLA 5EC5A 1FWUA 4I7IA 1V6VA 1TOOA 3HN1A 2FFUA 3P6IA 3N7JA 4QD2B 1IHKA 3O44A 1JT5A 3R4UA 3AH1A 3VT1A 1CE7B 3H6RA 3O4AA 1FMMS 1AVUA 3P6JA 4J2SA 3FJBA 3O3QA 4IYBA 4X3AA 2F2FC 4I4QA 1PUMB 5HPZA 1M16A 4HA2A 1YF8B 4JRAA 1R8OA 2ERMA 1W3FA 4QBVA 2AFGA 2KLLA 1Z0HA 2Y9XE 2DREA 4ZLBB 1AFCA 4P6AA 3BAQA 4I8MA 4X37A 4Q9PA 4LO1C 3Q7YA 3IAGC 3A07A 4ZFUB 2DRZA 3N7LA 2ET2A 2BFHA 4YOLA 3V0BB 4Z9WB 2Q3NB 2XOAA 3ZC9A 1IT0A 3EF2A 3WINA 3CA0A 1FMZA 3V0AB 4LO7C 2RG9B 4L4HA 1AVAC 3BRFA 5EHAA 3UJ0A 1QQKA 4I4UA 4HR6C 5F8SA 3NBNA 31BIA 1ILR1 1CVSA 5FZYA 4QKRA 1J0SA 4DEPA 4F83A 1BARA 3UJ4A 4I1EA 1BFBA 4P0JA 3SNVA 3Q7XA 2LIQA 3V79C 1FV3A 2KI4A 2D7IA 4G9MA 3K1XA 1ITBA 4G6MA 2AAIB 3WMVA 4F34A 3O4CA 2KH2A 4ZFYB 4ZBVB 3OJ2A 1UPSA 1S0DA 1Z4SA 1DZDA 1P63A 3ZXGA 4GAIA 1HWMB 3WINC 4EEEB 1JT3A 2AXMA 2YUGA 4I0YA 1AVXB 2D1ZA 4QBCA 1PWAA 4LO3A 4FVVA 4EFRA 4KEIA 4L4IA 5FZZA 3CQAA 3BAUA 4I96A 2ZQNA 2HWMA 2ESUA 1W3GA 2D23A 5BQUA 1V6XA 1BA7A 2J3PA 3MPPG 4A7ZA 3NBDA 2Y9GA 3WO3A 4KBBA 2MLLB 3WO2A 1JY0A 3POKA 5B2HA 3ZX7A 1N4KA 3FJEA 5DSSB 3N0KA 3VUOA 1RZOB 1Q04A 3WA1A 3CA1A 1DJSB 2HWAA 3HALA 7I1BA 1YYNA 2QYIB 3BA7A 3HSMA 3O4OA 1DQOA 2D22A 1XYFA 3FUOA 5G00A 2Q9XA 1Z2VA 5BQUC 1FN0A 3O5WB 1HKNA 3B9UA 4H9WA 4EKXB 3WO4A 4KEKA 1DQGA 4IQPA 3AH4A 5EG6C 4XFUA 2E4MA 9ILBA 3FJHA 2WBCA 1T4QA 1OQLB 1R8NA 1TFMB 1SR4A 1S0CA 3F1RA 3ZC8A 4I4SA 4USPA 3FJAA 1RY7A 3W9TA 3A22A 4QALA 3FFZA 1BLAA 3OJVA 4USOA 5FZUA 4ZGRB 3C9ZA 4PC4A 4OEFA 4J2XA 2P23A 5D62A 1EPWA 1JQZA 3I2AA 2GO2A 1HCEA 4HJJA 3TC2A 2R9KB 3RMXA 1L2HA 3HMYA 2KKIA 1F31A 1M2TB 2E4MC 3FJKA 3BRGC 4IY9A 1IRAX 1JT7A 4LO2C 3OJMA 4X39A 1SR4C 3HBWA 3CRHA 5BVPI 3QYDA 4FGFA 4ISQA 2L5XA 3AKIA 3IM5A 4ZA3B 4J2YA 5F90A 3NBEA 3UD8A 4A7KA 1TTUA 1JLXA 1IJTA 4I6IA 1FGAA 1BFFA 5JLVA 4TLPA 4OWKA 4I4YA 3AJ5A 1ISZA 2NTDA 1MD6A 3A23A 5BXPA 1V6WA 3D7WB 4IY8A 2VSEA 2FDBM 4J23B 3FJ8A 1ISXA 4XFTA 4QKSA 4DCKC 4A7YA 2WRYA 1IILA 3PHZA 1HCDA 2VXTI 3WMUA 3FJFA 2BEAA 2FO1A 1G82A 1PUUB 1AF9A 1YXWA 1S0FA 4JKQA 3ZXDA 4IONA 3O49A 3VWCA 4GP0A 1WBCA 5BOWA 3F62B 1DZCA 4P0KA 3BRDA 1IRPA 1Q03A 1YBIA 4G1RA 3RTJB 1EVTA 4EFPA 1HWOB 3PMEA 3RTIB 21BIA 5DVHA 4ZKTB 1HWNB 4H04A 2IWTB 1AVWB 3IM6A 4Q9GA 1NUNA 1AXMA 5F8YA 3HOMA 1FV2A 4OEEA 4IHZA 3AZWA 4G9NA 1A8DA 1HIBA 1BFCA 3FJ9A 3UD9A 4ZOTA 1II4A 4I2SA 2K8RA 1YTOA 4OWLA 4Z8SB 1I1EA 4P0LA 3BA4A 3AKGA 3VT2A 41BIA 1S0GA 5F8WA 3IM7A 4I3NA 1TIEA 2D43A 3LLPA 2NP0A 2VXRA 4I4OA 4I1BA 1TWEA 3NBCA 3BAHA 1ABRB 3I29B 3AJ6A 1PC8B 4DENA 3ILAA 2FGFA
chains in the Genus database with same CATH superfamily
2RSTA 2VU9A 1W3AA 4I4PA 1ISYA 1JTCA 4QC4A 3AH2A 1GGPB 3CA3A 4D0TA 3NJ5A 2X2SA 2K4AB 5DUYA 2HW9A 3FJJA 1TWMA 4AN7B 4ENDA 4LO2A 2HZ9A 2X2TA 3H6SE 3VSFA 2D24A 4EFQA 3Q7WA 4GOVA 1TP0A 2ZR1B 3RMYA 1E0OA 3BAGA 3FUQA 3RSJA 3N7MA 3AZVA 3FGMA 3PG0A 4KEJA 3OBTA 1JLYA 1DFCA 3JUTA 1QXMA 3S8KA 2Y9FA 3CRIA 4LO8B 1BLDA 5GAQA 5FNXA 5BXRA 2Z49A 2MC2A 1V6UA 5DZUA 2GZBA 3CA6A 1IOBA 1G9AA 4I4XA 4XFSA 1XHBA 2D20A 1EV2A 2IHOA 3H6RB 1WBAA 5FNWA 4LO7B 2NYYA 3FJCA 3V0BA 3OGGA 3CAHA 3VT0A 1JT4A 1Q1UA 4QD2C 4I37A 4OW4A 5E24E 3V0AA 4J2KA 4GAFA 1WD4A 2K43A 1K5VA 2UUSA 3I2XA 1FWVA 1XZZA 3IIRA 3BX1C 4JAWA 2P39A 2Z48A 4II0A 1EYLA 1XG6A 1S0BA 1G9DA 1G9BA 1DFQA 5BXSA 1MC9A 4I4RA 5BXTA 1T9FA 3A21A 3O4BA 2NVHA 3CA5A 3CRGA 2MIBA 2VLCA 4KC3A 2AQZA 1ISVA 1KNMA 3BADA 4R6UB 4Q91A 1BASA 2NM1A 2VUAA 4OUJA 4X38A 5D63A 1ONKB 1S0LA 4EB2B 4G6JA 5BP5A 4MZFB 4AN6A 3FJDA 1S0EA 2RQ9A 8I1BA 1G9CA 1PZZA 3S8JA 3UDAA 3BAOA 4OEGA 3T8SA 1BFGA 1ISWA 4JKXB 3P53A 2M49A 3VSZA 3CA4A 2QN4A 2D7RA 4WBCA 4I4VA 5I1BA 4D0ZA 3AKFA 2F8XC 4GP3A 1DIWA 1SZ6B 2BEBA 3R4SA 3FJIA 4JQ0A 5D61A 2ZQOA 3OBRA 4QO3A 3KMVA 3LTQA 1RG8A 2DS0A 5BP5C 4OWJA 4LO0A 3O4DA 6I1BA 3QR5A 1WD3A 4IZEA 1FQ9A 1VCLA 3E8LC 4GOYA 1D0HA 2D44A 2LIEA 3BB2A 2KI6B 4XKIA 3MALA 2FFVA 2Y9WC 3BAVA 1RMLA 5JMCA 3CU1B 1HWPB 4D8HA 3AKHA 2VSAA 2F2FA 4LO3C 3UD7A 4UY4A 4JP0A 2NZ9A 4ISRA 1NZKA 4ZFWB 3OGFA 3BTAA 3H6QA 1DLLA 1K5UA 1I1BA 3JRRA 4LO0C 4CJMA 3BA5A 3VEQA 3PUBA 2I1BA 2DRYA 4JPZA 4LO1A 3N7KA 4IZXA 1QQLA 5EC5A 1FWUA 4I7IA 1V6VA 1TOOA 3HN1A 2FFUA 3P6IA 3N7JA 4QD2B 1IHKA 3O44A 1JT5A 3R4UA 3AH1A 3VT1A 1CE7B 3H6RA 3O4AA 1FMMS 1AVUA 3P6JA 4H75A 4J2SA 3FJBA 3O3QA 4IYBA 4X3AA 2F2FC 4I4QA 1PUMB 5HPZA 1M16A 4HA2A 1YF8B 4JRAA 1R8OA 2ERMA 1W3FA 4QBVA 2AFGA 2KLLA 1Z0HA 2Y9XE 2DREA 4ZLBB 1AFCA 4P6AA 3BAQA 4I8MA 4X37A 4Q9PA 4LO1C 3Q7YA 3IAGC 3A07A 4ZFUB 2DRZA 3N7LA 2ET2A 2BFHA 4YOLA 3V0BB 4Z9WB 2Q3NB 2XOAA 3ZC9A 1IT0A 3EF2A 3WINA 3CA0A 1FMZA 3V0AB 4LO7C 2RG9B 4L4HA 1AVAC 3BRFA 5EHAA 3UJ0A 1QQKA 4I4UA 4HR6C 5F8SA 3NBNA 31BIA 1ILR1 1CVSA 5FZYA 4QKRA 1J0SA 4DEPA 4F83A 1BARA 3UJ4A 4I1EA 1BFBA 4P0JA 3SNVA 3Q7XA 2LIQA 3V79C 1FV3A 2KI4A 2D7IA 4G9MA 3K1XA 1ITBA 4G6MA 2AAIB 3WMVA 4F34A 3O4CA 2KH2A 4ZFYB 4ZBVB 3OJ2A 1UPSA 1S0DA 1Z4SA 1DZDA 1P63A 3ZXGA 4GAIA 2NS2A 1HWMB 3WINC 4EEEB 1JT3A 2AXMA 2YUGA 4I0YA 1AVXB 2D1ZA 4QBCA 1PWAA 4LO3A 4FVVA 4EFRA 4KEIA 4L4IA 5FZZA 3CQAA 3BAUA 4I96A 2ZQNA 2HWMA 2ESUA 1W3GA 2D23A 5BQUA 1V6XA 1BA7A 2J3PA 3MPPG 4A7ZA 3NBDA 2Y9GA 3WO3A 4KBBA 2MLLB 3WO2A 1JY0A 3POKA 5B2HA 3ZX7A 1N4KA 3FJEA 5DSSB 3N0KA 3VUOA 1RZOB 1Q04A 3WA1A 3CA1A 1DJSB 2HWAA 4MZGB 3HALA 7I1BA 1YYNA 2QYIB 3BA7A 3HSMA 3O4OA 1DQOA 2D22A 1XYFA 3FUOA 5G00A 2Q9XA 1Z2VA 5BQUC 1FN0A 3O5WB 1HKNA 3B9UA 4H9WA 4EKXB 3WO4A 4KEKA 1DQGA 4IQPA 3AH4A 5EG6C 4XFUA 2E4MA 9ILBA 3FJHA 2WBCA 1T4QA 1OQLB 1R8NA 1TFMB 1SR4A 1S0CA 3F1RA 3ZC8A 4I4SA 4USPA 3FJAA 1RY7A 3W9TA 3A22A 4QALA 3FFZA 1BLAA 3OJVA 4USOA 5FZUA 4ZGRB 3C9ZA 4PC4A 4OEFA 4J2XA 2P23A 5D62A 1EPWA 1JQZA 3I2AA 2GO2A 1HCEA 4HJJA 3TC2A 2R9KB 3RMXA 1L2HA 3HMYA 2KKIA 1F31A 1M2TB 2E4MC 3FJKA 3BRGC 4IY9A 1IRAX 1JT7A 4LO2C 3OJMA 4X39A 1SR4C 3HBWA 3CRHA 5BVPI 3QYDA 4FGFA 4ISQA 2L5XA 3AKIA 3IM5A 4ZA3B 4J2YA 5F90A 3NBEA 3UD8A 4A7KA 1TTUA 1JLXA 1IJTA 4I6IA 1FGAA 1BFFA 5JLVA 4TLPA 4OWKA 4I4YA 3AJ5A 1ISZA 2NTDA 1MD6A 3A23A 5BXPA 1V6WA 3D7WB 4IY8A 2VSEA 2FDBM 4J23B 3FJ8A 1ISXA 4XFTA 4QKSA 4DCKC 4A7YA 2WRYA 1IILA 3PHZA 1HCDA 2VXTI 3WMUA 3FJFA 2BEAA 2FO1A 1G82A 1PUUB 1AF9A 1YXWA 1S0FA 4JKQA 3ZXDA 4IONA 3O49A 3VWCA 4GP0A 1WBCA 5BOWA 3F62B 1DZCA 4P0KA 3BRDA 1IRPA 1Q03A 1YBIA 4G1RA 3RTJB 1EVTA 4EFPA 1HWOB 3PMEA 3RTIB 21BIA 5DVHA 4ZKTB 1HWNB 4H04A 2IWTB 1AVWB 3IM6A 4Q9GA 1NUNA 1AXMA 5F8YA 3HOMA 1FV2A 4OEEA 4IHZA 3AZWA 4G9NA 1A8DA 1HIBA 1BFCA 3FJ9A 3UD9A 4ZOTA 1II4A 4I2SA 2K8RA 1YTOA 4OWLA 4Z8SB 1I1EA 4P0LA 3BA4A 3AKGA 3VT2A 41BIA 1S0GA 5F8WA 3IM7A 4I3NA 1TIEA 2D43A 3LLPA 2NP0A 2VXRA 4I4OA 4MZHA 4I1BA 1TWEA 3NBCA 3BAHA 1ABRB 3I29B 3AJ6A 1PC8B 4DENA 3ILAA 2FGFA
chains in the Genus database with same CATH topology
2RSTA 2VU9A 1W3AA 4I4PA 1ISYA 1JTCA 4QC4A 3AH2A 1GGPB 3CA3A 4D0TA 3NJ5A 2X2SA 2K4AB 5DUYA 2HW9A 3FJJA 1TWMA 4AN7B 4ENDA 4LO2A 2HZ9A 2X2TA 3H6SE 3VSFA 2D24A 4EFQA 3Q7WA 4GOVA 1TP0A 2ZR1B 3RMYA 1E0OA 3BAGA 3FUQA 3RSJA 3N7MA 3AZVA 3FGMA 3PG0A 4KEJA 3OBTA 1JLYA 1DFCA 3JUTA 1QXMA 3S8KA 2Y9FA 3CRIA 4LO8B 1BLDA 5GAQA 5FNXA 5BXRA 2Z49A 2MC2A 1V6UA 5DZUA 2GZBA 3CA6A 1IOBA 1G9AA 4I4XA 4XFSA 1XHBA 2D20A 1EV2A 2IHOA 3H6RB 1WBAA 5FNWA 4LO7B 2NYYA 3FJCA 3V0BA 3OGGA 3CAHA 3VT0A 1JT4A 1Q1UA 4QD2C 4I37A 4OW4A 5E24E 3V0AA 4J2KA 4GAFA 1WD4A 2K43A 1K5VA 2UUSA 3I2XA 1FWVA 1XZZA 3IIRA 3BX1C 4JAWA 2P39A 2Z48A 4II0A 1EYLA 1XG6A 1S0BA 1G9DA 1G9BA 1DFQA 5BXSA 1MC9A 4I4RA 5BXTA 1T9FA 3A21A 3O4BA 2NVHA 3CA5A 3CRGA 2MIBA 2VLCA 4KC3A 2AQZA 1ISVA 1KNMA 3BADA 4R6UB 4Q91A 1BASA 2NM1A 2VUAA 4OUJA 4X38A 5D63A 1ONKB 1S0LA 4EB2B 4G6JA 5BP5A 4MZFB 4AN6A 3FJDA 1S0EA 2RQ9A 8I1BA 1G9CA 1PZZA 3S8JA 3UDAA 3BAOA 4OEGA 3T8SA 1BFGA 1ISWA 4JKXB 3P53A 2M49A 3VSZA 3CA4A 2QN4A 2D7RA 4WBCA 4I4VA 5I1BA 4D0ZA 3AKFA 2F8XC 4GP3A 1DIWA 1SZ6B 2BEBA 3R4SA 3FJIA 4JQ0A 5D61A 2ZQOA 3OBRA 4QO3A 3KMVA 3LTQA 1RG8A 2DS0A 5BP5C 4OWJA 4LO0A 3O4DA 6I1BA 3QR5A 1WD3A 4IZEA 1FQ9A 1VCLA 3E8LC 4GOYA 1D0HA 2D44A 2LIEA 3BB2A 2KI6B 4XKIA 3MALA 2FFVA 2Y9WC 3BAVA 1RMLA 5JMCA 3CU1B 1HWPB 4D8HA 3AKHA 2VSAA 2F2FA 4LO3C 3UD7A 4UY4A 4JP0A 2NZ9A 4ISRA 1NZKA 4ZFWB 3OGFA 3BTAA 3H6QA 1DLLA 1K5UA 1I1BA 3JRRA 4LO0C 4CJMA 3BA5A 3VEQA 3PUBA 2I1BA 2DRYA 4JPZA 4LO1A 3N7KA 4IZXA 1QQLA 5EC5A 1FWUA 4I7IA 1V6VA 1TOOA 3HN1A 2FFUA 3P6IA 3N7JA 4QD2B 1IHKA 3O44A 1JT5A 3R4UA 3AH1A 3VT1A 1CE7B 3H6RA 3O4AA 1FMMS 1AVUA 3P6JA 4H75A 4J2SA 3FJBA 3O3QA 4IYBA 4X3AA 2F2FC 4I4QA 1PUMB 5HPZA 1M16A 4HA2A 1YF8B 4JRAA 1R8OA 2ERMA 1W3FA 4QBVA 2AFGA 2KLLA 1Z0HA 2Y9XE 2DREA 4ZLBB 1AFCA 4P6AA 3BAQA 4I8MA 4X37A 4Q9PA 4LO1C 3Q7YA 3IAGC 3A07A 4ZFUB 2DRZA 3N7LA 2ET2A 2BFHA 4YOLA 3V0BB 4Z9WB 2Q3NB 2XOAA 3ZC9A 1IT0A 3EF2A 3WINA 3CA0A 1FMZA 3V0AB 4LO7C 2RG9B 4L4HA 1AVAC 3BRFA 5EHAA 3UJ0A 1QQKA 4I4UA 4HR6C 5F8SA 3NBNA 31BIA 1ILR1 1CVSA 5FZYA 4QKRA 1J0SA 4DEPA 4F83A 1BARA 3UJ4A 4I1EA 1BFBA 4P0JA 3SNVA 3Q7XA 2LIQA 3V79C 1FV3A 2KI4A 2D7IA 4G9MA 3K1XA 1ITBA 4G6MA 2AAIB 3WMVA 4F34A 3O4CA 2KH2A 4ZFYB 4ZBVB 3OJ2A 1UPSA 1S0DA 1Z4SA 1DZDA 1P63A 3ZXGA 4GAIA 2NS2A 1HWMB 3WINC 4EEEB 1JT3A 2AXMA 2YUGA 4I0YA 1AVXB 2D1ZA 4QBCA 1PWAA 4LO3A 4FVVA 4EFRA 4KEIA 4L4IA 5FZZA 3CQAA 3BAUA 4I96A 2ZQNA 2HWMA 2ESUA 1W3GA 2D23A 5BQUA 1V6XA 1BA7A 2J3PA 3MPPG 4A7ZA 3NBDA 2Y9GA 3WO3A 4KBBA 2MLLB 3WO2A 1JY0A 3POKA 5B2HA 3ZX7A 1N4KA 3FJEA 5DSSB 3N0KA 3VUOA 1RZOB 1Q04A 3WA1A 3CA1A 1DJSB 2HWAA 4MZGB 3HALA 7I1BA 1YYNA 2QYIB 3BA7A 3HSMA 3O4OA 1DQOA 2D22A 1XYFA 3FUOA 5G00A 2Q9XA 1Z2VA 5BQUC 1FN0A 3O5WB 1HKNA 3B9UA 4H9WA 4EKXB 3WO4A 4KEKA 1DQGA 4IQPA 3AH4A 5EG6C 4XFUA 2E4MA 9ILBA 3FJHA 2WBCA 1T4QA 1OQLB 1R8NA 1TFMB 1SR4A 1S0CA 3F1RA 3ZC8A 4I4SA 4USPA 3FJAA 1RY7A 3W9TA 3A22A 4QALA 3FFZA 1BLAA 3OJVA 4USOA 5FZUA 4ZGRB 3C9ZA 4PC4A 4OEFA 4J2XA 2P23A 5D62A 1EPWA 1JQZA 3I2AA 2GO2A 1HCEA 4HJJA 3TC2A 2R9KB 3RMXA 1L2HA 3HMYA 2KKIA 1F31A 1M2TB 2E4MC 3FJKA 3BRGC 4IY9A 1IRAX 1JT7A 4LO2C 3OJMA 4X39A 1SR4C 3HBWA 3CRHA 5BVPI 3QYDA 4FGFA 4ISQA 2L5XA 3AKIA 3IM5A 4ZA3B 4J2YA 5F90A 3NBEA 3UD8A 4A7KA 1TTUA 1JLXA 1IJTA 4I6IA 1FGAA 1BFFA 5JLVA 4TLPA 4OWKA 4I4YA 3AJ5A 1ISZA 2NTDA 1MD6A 3A23A 5BXPA 1V6WA 3D7WB 4IY8A 2VSEA 2FDBM 4J23B 3FJ8A 1ISXA 4XFTA 4QKSA 4DCKC 4A7YA 2WRYA 1IILA 3PHZA 1HCDA 2VXTI 3WMUA 3FJFA 2BEAA 2FO1A 1G82A 1PUUB 1AF9A 1YXWA 1S0FA 4JKQA 3ZXDA 4IONA 3O49A 3VWCA 4GP0A 1WBCA 5BOWA 3F62B 1DZCA 4P0KA 3BRDA 1IRPA 1Q03A 1YBIA 4G1RA 3RTJB 1EVTA 4EFPA 1HWOB 3PMEA 3RTIB 21BIA 5DVHA 4ZKTB 1HWNB 4H04A 2IWTB 1AVWB 3IM6A 4Q9GA 1NUNA 1AXMA 5F8YA 3HOMA 1FV2A 4OEEA 4IHZA 3AZWA 4G9NA 1A8DA 1HIBA 1BFCA 3FJ9A 3UD9A 4ZOTA 1II4A 4I2SA 2K8RA 1YTOA 4OWLA 4Z8SB 1I1EA 4P0LA 3BA4A 3AKGA 3VT2A 41BIA 1S0GA 5F8WA 3IM7A 4I3NA 1TIEA 2D43A 3LLPA 2NP0A 2VXRA 4I4OA 4MZHA 4I1BA 1TWEA 3NBCA 3BAHA 1ABRB 3I29B 3AJ6A 1PC8B 4DENA 3ILAA 2FGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RST A;  2VU9 A;  1W3A A;  4I4P A;  1ISY A;  1JTC A;  4QC4 A;  3AH2 A;  1GGP B;  3CA3 A;  4D0T A;  3NJ5 A;  2X2S A;  2K4A B;  5DUY A;  2HW9 A;  3FJJ A;  1TWM A;  4AN7 B;  4END A;  4LO2 A;  2HZ9 A;  2X2T A;  3H6S E;  3VSF A;  2D24 A;  4EFQ A;  3Q7W A;  4GOV A;  1TP0 A;  2ZR1 B;  3RMY A;  1E0O A;  3BAG A;  3FUQ A;  3RSJ A;  3N7M A;  3AZV A;  3FGM A;  3PG0 A;  4KEJ A;  3OBT A;  1JLY A;  1DFC A;  3JUT A;  1QXM A;  3S8K A;  2Y9F A;  3CRI A;  4LO8 B;  1BLD A;  5GAQ A;  5FNX A;  5BXR A;  2Z49 A;  2MC2 A;  1V6U A;  5DZU A;  2GZB A;  3CA6 A;  1IOB A;  1G9A A;  4I4X A;  4XFS A;  1XHB A;  2D20 A;  1EV2 A;  2IHO A;  3H6R B;  1WBA A;  5FNW A;  4LO7 B;  2NYY A;  3FJC A;  3V0B A;  3OGG A;  3CAH A;  3VT0 A;  1JT4 A;  1Q1U A;  4QD2 C;  4I37 A;  4OW4 A;  5E24 E;  3V0A A;  4J2K A;  4GAF A;  1WD4 A;  2K43 A;  1K5V A;  2UUS A;  3I2X A;  1FWV A;  1XZZ A;  3IIR A;  3BX1 C;  4JAW A;  2P39 A;  2Z48 A;  4II0 A;  1EYL A;  1XG6 A;  1S0B A;  1G9D A;  1G9B A;  1DFQ A;  5BXS A;  1MC9 A;  4I4R A;  5BXT A;  1T9F A;  3A21 A;  3O4B A;  2NVH A;  3CA5 A;  3CRG A;  2MIB A;  2VLC A;  4KC3 A;  2AQZ A;  1ISV A;  1KNM A;  3BAD A;  4R6U B;  4Q91 A;  1BAS A;  2NM1 A;  2VUA A;  4OUJ A;  4X38 A;  5D63 A;  1ONK B;  1S0L A;  4EB2 B;  4G6J A;  5BP5 A;  4AN6 A;  3FJD A;  1S0E A;  2RQ9 A;  8I1B A;  1G9C A;  1PZZ A;  3S8J A;  3UDA A;  3BAO A;  4OEG A;  3T8S A;  1BFG A;  1ISW A;  4JKX B;  3P53 A;  2M49 A;  3VSZ A;  3CA4 A;  2QN4 A;  2D7R A;  4WBC A;  4I4V A;  5I1B A;  4D0Z A;  3AKF A;  2F8X C;  4GP3 A;  1DIW A;  1SZ6 B;  2BEB A;  3R4S A;  3FJI A;  4JQ0 A;  5D61 A;  2ZQO A;  3OBR A;  4QO3 A;  3KMV A;  3LTQ A;  1RG8 A;  2DS0 A;  5BP5 C;  4OWJ A;  4LO0 A;  3O4D A;  6I1B A;  3QR5 A;  1WD3 A;  4IZE A;  1FQ9 A;  1VCL A;  3E8L C;  4GOY A;  1D0H A;  2D44 A;  2LIE A;  3BB2 A;  2KI6 B;  4XKI A;  3MAL A;  2FFV A;  2Y9W C;  3BAV A;  1RML A;  5JMC A;  3CU1 B;  1HWP B;  4D8H A;  3AKH A;  2VSA A;  2F2F A;  4LO3 C;  3UD7 A;  4JP0 A;  2NZ9 A;  4ISR A;  1NZK A;  4ZFW B;  3OGF A;  3BTA A;  3H6Q A;  1DLL A;  1K5U A;  1I1B A;  3JRR A;  4LO0 C;  4CJM A;  3BA5 A;  3VEQ A;  3PUB A;  2I1B A;  2DRY A;  4JPZ A;  4LO1 A;  3N7K A;  4IZX A;  1QQL A;  5EC5 A;  1FWU A;  4I7I A;  1V6V A;  1TOO A;  3HN1 A;  2FFU A;  3P6I A;  3N7J A;  4QD2 B;  1IHK A;  3O44 A;  1JT5 A;  3R4U A;  3AH1 A;  3VT1 A;  1CE7 B;  3H6R A;  3O4A A;  1FMM S;  1AVU A;  3P6J A;  4J2S A;  3FJB A;  3O3Q A;  4IYB A;  4X3A A;  2F2F C;  4I4Q A;  1PUM B;  5HPZ A;  1M16 A;  4HA2 A;  1YF8 B;  4JRA A;  1R8O A;  2ERM A;  1W3F A;  4QBV A;  2AFG A;  2KLL A;  1Z0H A;  2Y9X E;  2DRE A;  4ZLB B;  1AFC A;  4P6A A;  3BAQ A;  4I8M A;  4X37 A;  4Q9P A;  4LO1 C;  3Q7Y A;  3IAG C;  3A07 A;  4ZFU B;  2DRZ A;  3N7L A;  2ET2 A;  2BFH A;  4YOL A;  3V0B B;  4Z9W B;  2Q3N B;  2XOA A;  3ZC9 A;  1IT0 A;  3EF2 A;  3WIN A;  3CA0 A;  1FMZ A;  3V0A B;  4LO7 C;  2RG9 B;  4L4H A;  1AVA C;  3BRF A;  5EHA A;  3UJ0 A;  1QQK A;  4I4U A;  4HR6 C;  5F8S A;  3NBN A;  31BI A;  1ILR 1;  1CVS A;  5FZY A;  4QKR A;  1J0S A;  4DEP A;  4F83 A;  1BAR A;  3UJ4 A;  4I1E A;  1BFB A;  4P0J A;  3SNV A;  3Q7X A;  2LIQ A;  3V79 C;  1FV3 A;  2KI4 A;  2D7I A;  4G9M A;  3K1X A;  1ITB A;  4G6M A;  2AAI B;  3WMV A;  4F34 A;  3O4C A;  2KH2 A;  4ZFY B;  4ZBV B;  3OJ2 A;  1UPS A;  1S0D A;  1Z4S A;  1DZD A;  1P63 A;  3ZXG A;  4GAI A;  1HWM B;  3WIN C;  4EEE B;  1JT3 A;  2AXM A;  2YUG A;  4I0Y A;  1AVX B;  2D1Z A;  4QBC A;  1PWA A;  4LO3 A;  4FVV A;  4EFR A;  4KEI A;  4L4I A;  5FZZ A;  3CQA A;  3BAU A;  4I96 A;  2ZQN A;  2HWM A;  2ESU A;  1W3G A;  2D23 A;  5BQU A;  1V6X A;  1BA7 A;  2J3P A;  3MPP G;  4A7Z A;  3NBD A;  2Y9G A;  3WO3 A;  4KBB A;  2MLL B;  3WO2 A;  1JY0 A;  3POK A;  5B2H A;  3ZX7 A;  1N4K A;  3FJE A;  5DSS B;  3N0K A;  3VUO A;  1RZO B;  1Q04 A;  3WA1 A;  3CA1 A;  1DJS B;  2HWA A;  3HAL A;  7I1B A;  1YYN A;  2QYI B;  3BA7 A;  3HSM A;  3O4O A;  1DQO A;  2D22 A;  1XYF A;  3FUO A;  5G00 A;  2Q9X A;  1Z2V A;  5BQU C;  1FN0 A;  3O5W B;  1HKN A;  3B9U A;  4H9W A;  4EKX B;  3WO4 A;  4KEK A;  1DQG A;  4IQP A;  3AH4 A;  5EG6 C;  4XFU A;  2E4M A;  9ILB A;  3FJH A;  2WBC A;  1T4Q A;  1OQL B;  1R8N A;  1TFM B;  1SR4 A;  1S0C A;  3F1R A;  3ZC8 A;  4I4S A;  4USP A;  3FJA A;  1RY7 A;  3W9T A;  3A22 A;  4QAL A;  3FFZ A;  1BLA A;  3OJV A;  4USO A;  5FZU A;  4ZGR B;  3C9Z A;  4PC4 A;  4OEF A;  4J2X A;  2P23 A;  5D62 A;  1EPW A;  1JQZ A;  3I2A A;  2GO2 A;  1HCE A;  4HJJ A;  3TC2 A;  2R9K B;  3RMX A;  1L2H A;  3HMY A;  2KKI A;  1F31 A;  1M2T B;  2E4M C;  3FJK A;  3BRG C;  4IY9 A;  1IRA X;  1JT7 A;  4LO2 C;  3OJM A;  4X39 A;  1SR4 C;  3HBW A;  3CRH A;  5BVP I;  3QYD A;  4FGF A;  4ISQ A;  2L5X A;  3AKI A;  3IM5 A;  4ZA3 B;  4J2Y A;  5F90 A;  3NBE A;  3UD8 A;  4A7K A;  1TTU A;  1JLX A;  1IJT A;  4I6I A;  1FGA A;  1BFF A;  5JLV A;  4TLP A;  4OWK A;  4I4Y A;  3AJ5 A;  1ISZ A;  2NTD A;  1MD6 A;  3A23 A;  5BXP A;  1V6W A;  3D7W B;  4IY8 A;  2VSE A;  2FDB M;  4J23 B;  3FJ8 A;  1ISX A;  4XFT A;  4QKS A;  4DCK C;  4A7Y A;  2WRY A;  1IIL A;  3PHZ A;  1HCD A;  2VXT I;  3WMU A;  3FJF A;  2BEA A;  2FO1 A;  1G82 A;  1PUU B;  1AF9 A;  1YXW A;  1S0F A;  4JKQ A;  3ZXD A;  4ION A;  3O49 A;  3VWC A;  4GP0 A;  1WBC A;  5BOW A;  3F62 B;  1DZC A;  4P0K A;  3BRD A;  1IRP A;  1Q03 A;  1YBI A;  4G1R A;  3RTJ B;  1EVT A;  4EFP A;  1HWO B;  3PME A;  3RTI B;  21BI A;  5DVH A;  4ZKT B;  1HWN B;  4H04 A;  2IWT B;  1AVW B;  3IM6 A;  4Q9G A;  1NUN A;  1AXM A;  5F8Y A;  3HOM A;  1FV2 A;  4OEE A;  4IHZ A;  3AZW A;  4G9N A;  1A8D A;  1HIB A;  1BFC A;  3FJ9 A;  3UD9 A;  4ZOT A;  1II4 A;  4I2S A;  2K8R A;  1YTO A;  4OWL A;  4Z8S B;  1I1E A;  4P0L A;  3BA4 A;  3AKG A;  3VT2 A;  41BI A;  1S0G A;  5F8W A;  3IM7 A;  4I3N A;  1TIE A;  2D43 A;  3LLP A;  2NP0 A;  2VXR A;  4I4O A;  4I1B A;  1TWE A;  3NBC A;  3BAH A;  1ABR B;  3I29 B;  3AJ6 A;  1PC8 B;  4DEN A;  3ILA A;  2FGF A; 
#chains in the Genus database with same CATH topology
 2RST A;  2VU9 A;  1W3A A;  4I4P A;  1ISY A;  1JTC A;  4QC4 A;  3AH2 A;  1GGP B;  3CA3 A;  4D0T A;  3NJ5 A;  2X2S A;  2K4A B;  5DUY A;  2HW9 A;  3FJJ A;  1TWM A;  4AN7 B;  4END A;  4LO2 A;  2HZ9 A;  2X2T A;  3H6S E;  3VSF A;  2D24 A;  4EFQ A;  3Q7W A;  4GOV A;  1TP0 A;  2ZR1 B;  3RMY A;  1E0O A;  3BAG A;  3FUQ A;  3RSJ A;  3N7M A;  3AZV A;  3FGM A;  3PG0 A;  4KEJ A;  3OBT A;  1JLY A;  1DFC A;  3JUT A;  1QXM A;  3S8K A;  2Y9F A;  3CRI A;  4LO8 B;  1BLD A;  5GAQ A;  5FNX A;  5BXR A;  2Z49 A;  2MC2 A;  1V6U A;  5DZU A;  2GZB A;  3CA6 A;  1IOB A;  1G9A A;  4I4X A;  4XFS A;  1XHB A;  2D20 A;  1EV2 A;  2IHO A;  3H6R B;  1WBA A;  5FNW A;  4LO7 B;  2NYY A;  3FJC A;  3V0B A;  3OGG A;  3CAH A;  3VT0 A;  1JT4 A;  1Q1U A;  4QD2 C;  4I37 A;  4OW4 A;  5E24 E;  3V0A A;  4J2K A;  4GAF A;  1WD4 A;  2K43 A;  1K5V A;  2UUS A;  3I2X A;  1FWV A;  1XZZ A;  3IIR A;  3BX1 C;  4JAW A;  2P39 A;  2Z48 A;  4II0 A;  1EYL A;  1XG6 A;  1S0B A;  1G9D A;  1G9B A;  1DFQ A;  5BXS A;  1MC9 A;  4I4R A;  5BXT A;  1T9F A;  3A21 A;  3O4B A;  2NVH A;  3CA5 A;  3CRG A;  2MIB A;  2VLC A;  4KC3 A;  2AQZ A;  1ISV A;  1KNM A;  3BAD A;  4R6U B;  4Q91 A;  1BAS A;  2NM1 A;  2VUA A;  4OUJ A;  4X38 A;  5D63 A;  1ONK B;  1S0L A;  4EB2 B;  4G6J A;  5BP5 A;  4MZF B;  4AN6 A;  3FJD A;  1S0E A;  2RQ9 A;  8I1B A;  1G9C A;  1PZZ A;  3S8J A;  3UDA A;  3BAO A;  4OEG A;  3T8S A;  1BFG A;  1ISW A;  4JKX B;  3P53 A;  2M49 A;  3VSZ A;  3CA4 A;  2QN4 A;  2D7R A;  4WBC A;  4I4V A;  5I1B A;  4D0Z A;  3AKF A;  2F8X C;  4GP3 A;  1DIW A;  1SZ6 B;  2BEB A;  3R4S A;  3FJI A;  4JQ0 A;  5D61 A;  2ZQO A;  3OBR A;  4QO3 A;  3KMV A;  3LTQ A;  1RG8 A;  2DS0 A;  5BP5 C;  4OWJ A;  4LO0 A;  3O4D A;  6I1B A;  3QR5 A;  1WD3 A;  4IZE A;  1FQ9 A;  1VCL A;  3E8L C;  4GOY A;  1D0H A;  2D44 A;  2LIE A;  3BB2 A;  2KI6 B;  4XKI A;  3MAL A;  2FFV A;  2Y9W C;  3BAV A;  1RML A;  5JMC A;  3CU1 B;  1HWP B;  4D8H A;  3AKH A;  2VSA A;  2F2F A;  4LO3 C;  3UD7 A;  4UY4 A;  4JP0 A;  2NZ9 A;  4ISR A;  1NZK A;  4ZFW B;  3OGF A;  3BTA A;  3H6Q A;  1DLL A;  1K5U A;  1I1B A;  3JRR A;  4LO0 C;  4CJM A;  3BA5 A;  3VEQ A;  3PUB A;  2I1B A;  2DRY A;  4JPZ A;  4LO1 A;  3N7K A;  4IZX A;  1QQL A;  5EC5 A;  1FWU A;  4I7I A;  1V6V A;  1TOO A;  3HN1 A;  2FFU A;  3P6I A;  3N7J A;  4QD2 B;  1IHK A;  3O44 A;  1JT5 A;  3R4U A;  3AH1 A;  3VT1 A;  1CE7 B;  3H6R A;  3O4A A;  1FMM S;  1AVU A;  3P6J A;  4H75 A;  4J2S A;  3FJB A;  3O3Q A;  4IYB A;  4X3A A;  2F2F C;  4I4Q A;  1PUM B;  5HPZ A;  1M16 A;  4HA2 A;  1YF8 B;  4JRA A;  1R8O A;  2ERM A;  1W3F A;  4QBV A;  2AFG A;  2KLL A;  1Z0H A;  2Y9X E;  2DRE A;  4ZLB B;  1AFC A;  4P6A A;  3BAQ A;  4I8M A;  4X37 A;  4Q9P A;  4LO1 C;  3Q7Y A;  3IAG C;  3A07 A;  4ZFU B;  2DRZ A;  3N7L A;  2ET2 A;  2BFH A;  4YOL A;  3V0B B;  4Z9W B;  2Q3N B;  2XOA A;  3ZC9 A;  1IT0 A;  3EF2 A;  3WIN A;  3CA0 A;  1FMZ A;  3V0A B;  4LO7 C;  2RG9 B;  4L4H A;  1AVA C;  3BRF A;  5EHA A;  3UJ0 A;  1QQK A;  4I4U A;  4HR6 C;  5F8S A;  3NBN A;  31BI A;  1ILR 1;  1CVS A;  5FZY A;  4QKR A;  1J0S A;  4DEP A;  4F83 A;  1BAR A;  3UJ4 A;  4I1E A;  1BFB A;  4P0J A;  3SNV A;  3Q7X A;  2LIQ A;  3V79 C;  1FV3 A;  2KI4 A;  2D7I A;  4G9M A;  3K1X A;  1ITB A;  4G6M A;  2AAI B;  3WMV A;  4F34 A;  3O4C A;  2KH2 A;  4ZFY B;  4ZBV B;  3OJ2 A;  1UPS A;  1S0D A;  1Z4S A;  1DZD A;  1P63 A;  3ZXG A;  4GAI A;  2NS2 A;  1HWM B;  3WIN C;  4EEE B;  1JT3 A;  2AXM A;  2YUG A;  4I0Y A;  1AVX B;  2D1Z A;  4QBC A;  1PWA A;  4LO3 A;  4FVV A;  4EFR A;  4KEI A;  4L4I A;  5FZZ A;  3CQA A;  3BAU A;  4I96 A;  2ZQN A;  2HWM A;  2ESU A;  1W3G A;  2D23 A;  5BQU A;  1V6X A;  1BA7 A;  2J3P A;  3MPP G;  4A7Z A;  3NBD A;  2Y9G A;  3WO3 A;  4KBB A;  2MLL B;  3WO2 A;  1JY0 A;  3POK A;  5B2H A;  3ZX7 A;  1N4K A;  3FJE A;  5DSS B;  3N0K A;  3VUO A;  1RZO B;  1Q04 A;  3WA1 A;  3CA1 A;  1DJS B;  2HWA A;  4MZG B;  3HAL A;  7I1B A;  1YYN A;  2QYI B;  3BA7 A;  3HSM A;  3O4O A;  1DQO A;  2D22 A;  1XYF A;  3FUO A;  5G00 A;  2Q9X A;  1Z2V A;  5BQU C;  1FN0 A;  3O5W B;  1HKN A;  3B9U A;  4H9W A;  4EKX B;  3WO4 A;  4KEK A;  1DQG A;  4IQP A;  3AH4 A;  5EG6 C;  4XFU A;  2E4M A;  9ILB A;  3FJH A;  2WBC A;  1T4Q A;  1OQL B;  1R8N A;  1TFM B;  1SR4 A;  1S0C A;  3F1R A;  3ZC8 A;  4I4S A;  4USP A;  3FJA A;  1RY7 A;  3W9T A;  3A22 A;  4QAL A;  3FFZ A;  1BLA A;  3OJV A;  4USO A;  5FZU A;  4ZGR B;  3C9Z A;  4PC4 A;  4OEF A;  4J2X A;  2P23 A;  5D62 A;  1EPW A;  1JQZ A;  3I2A A;  2GO2 A;  1HCE A;  4HJJ A;  3TC2 A;  2R9K B;  3RMX A;  1L2H A;  3HMY A;  2KKI A;  1F31 A;  1M2T B;  2E4M C;  3FJK A;  3BRG C;  4IY9 A;  1IRA X;  1JT7 A;  4LO2 C;  3OJM A;  4X39 A;  1SR4 C;  3HBW A;  3CRH A;  5BVP I;  3QYD A;  4FGF A;  4ISQ A;  2L5X A;  3AKI A;  3IM5 A;  4ZA3 B;  4J2Y A;  5F90 A;  3NBE A;  3UD8 A;  4A7K A;  1TTU A;  1JLX A;  1IJT A;  4I6I A;  1FGA A;  1BFF A;  5JLV A;  4TLP A;  4OWK A;  4I4Y A;  3AJ5 A;  1ISZ A;  2NTD A;  1MD6 A;  3A23 A;  5BXP A;  1V6W A;  3D7W B;  4IY8 A;  2VSE A;  2FDB M;  4J23 B;  3FJ8 A;  1ISX A;  4XFT A;  4QKS A;  4DCK C;  4A7Y A;  2WRY A;  1IIL A;  3PHZ A;  1HCD A;  2VXT I;  3WMU A;  3FJF A;  2BEA A;  2FO1 A;  1G82 A;  1PUU B;  1AF9 A;  1YXW A;  1S0F A;  4JKQ A;  3ZXD A;  4ION A;  3O49 A;  3VWC A;  4GP0 A;  1WBC A;  5BOW A;  3F62 B;  1DZC A;  4P0K A;  3BRD A;  1IRP A;  1Q03 A;  1YBI A;  4G1R A;  3RTJ B;  1EVT A;  4EFP A;  1HWO B;  3PME A;  3RTI B;  21BI A;  5DVH A;  4ZKT B;  1HWN B;  4H04 A;  2IWT B;  1AVW B;  3IM6 A;  4Q9G A;  1NUN A;  1AXM A;  5F8Y A;  3HOM A;  1FV2 A;  4OEE A;  4IHZ A;  3AZW A;  4G9N A;  1A8D A;  1HIB A;  1BFC A;  3FJ9 A;  3UD9 A;  4ZOT A;  1II4 A;  4I2S A;  2K8R A;  1YTO A;  4OWL A;  4Z8S B;  1I1E A;  4P0L A;  3BA4 A;  3AKG A;  3VT2 A;  41BI A;  1S0G A;  5F8W A;  3IM7 A;  4I3N A;  1TIE A;  2D43 A;  3LLP A;  2NP0 A;  2VXR A;  4I4O A;  4MZH A;  4I1B A;  1TWE A;  3NBC A;  3BAH A;  1ABR B;  3I29 B;  3AJ6 A;  1PC8 B;  4DEN A;  3ILA A;  2FGF A; 
#chains in the Genus database with same CATH homology
 2RST A;  2VU9 A;  1W3A A;  4I4P A;  1ISY A;  1JTC A;  4QC4 A;  3AH2 A;  1GGP B;  3CA3 A;  4D0T A;  3NJ5 A;  2X2S A;  2K4A B;  5DUY A;  2HW9 A;  3FJJ A;  1TWM A;  4AN7 B;  4END A;  4LO2 A;  2HZ9 A;  2X2T A;  3H6S E;  3VSF A;  2D24 A;  4EFQ A;  3Q7W A;  4GOV A;  1TP0 A;  2ZR1 B;  3RMY A;  1E0O A;  3BAG A;  3FUQ A;  3RSJ A;  3N7M A;  3AZV A;  3FGM A;  3PG0 A;  4KEJ A;  3OBT A;  1JLY A;  1DFC A;  3JUT A;  1QXM A;  3S8K A;  2Y9F A;  3CRI A;  4LO8 B;  1BLD A;  5GAQ A;  5FNX A;  5BXR A;  2Z49 A;  2MC2 A;  1V6U A;  5DZU A;  2GZB A;  3CA6 A;  1IOB A;  1G9A A;  4I4X A;  4XFS A;  1XHB A;  2D20 A;  1EV2 A;  2IHO A;  3H6R B;  1WBA A;  5FNW A;  4LO7 B;  2NYY A;  3FJC A;  3V0B A;  3OGG A;  3CAH A;  3VT0 A;  1JT4 A;  1Q1U A;  4QD2 C;  4I37 A;  4OW4 A;  5E24 E;  3V0A A;  4J2K A;  4GAF A;  1WD4 A;  2K43 A;  1K5V A;  2UUS A;  3I2X A;  1FWV A;  1XZZ A;  3IIR A;  3BX1 C;  4JAW A;  2P39 A;  2Z48 A;  4II0 A;  1EYL A;  1XG6 A;  1S0B A;  1G9D A;  1G9B A;  1DFQ A;  5BXS A;  1MC9 A;  4I4R A;  5BXT A;  1T9F A;  3A21 A;  3O4B A;  2NVH A;  3CA5 A;  3CRG A;  2MIB A;  2VLC A;  4KC3 A;  2AQZ A;  1ISV A;  1KNM A;  3BAD A;  4R6U B;  4Q91 A;  1BAS A;  2NM1 A;  2VUA A;  4OUJ A;  4X38 A;  5D63 A;  1ONK B;  1S0L A;  4EB2 B;  4G6J A;  5BP5 A;  4MZF B;  4AN6 A;  3FJD A;  1S0E A;  2RQ9 A;  8I1B A;  1G9C A;  1PZZ A;  3S8J A;  3UDA A;  3BAO A;  4OEG A;  3T8S A;  1BFG A;  1ISW A;  4JKX B;  3P53 A;  2M49 A;  3VSZ A;  3CA4 A;  2QN4 A;  2D7R A;  4WBC A;  4I4V A;  5I1B A;  4D0Z A;  3AKF A;  2F8X C;  4GP3 A;  1DIW A;  1SZ6 B;  2BEB A;  3R4S A;  3FJI A;  4JQ0 A;  5D61 A;  2ZQO A;  3OBR A;  4QO3 A;  3KMV A;  3LTQ A;  1RG8 A;  2DS0 A;  5BP5 C;  4OWJ A;  4LO0 A;  3O4D A;  6I1B A;  3QR5 A;  1WD3 A;  4IZE A;  1FQ9 A;  1VCL A;  3E8L C;  4GOY A;  1D0H A;  2D44 A;  2LIE A;  3BB2 A;  2KI6 B;  4XKI A;  3MAL A;  2FFV A;  2Y9W C;  3BAV A;  1RML A;  5JMC A;  3CU1 B;  1HWP B;  4D8H A;  3AKH A;  2VSA A;  2F2F A;  4LO3 C;  3UD7 A;  4UY4 A;  4JP0 A;  2NZ9 A;  4ISR A;  1NZK A;  4ZFW B;  3OGF A;  3BTA A;  3H6Q A;  1DLL A;  1K5U A;  1I1B A;  3JRR A;  4LO0 C;  4CJM A;  3BA5 A;  3VEQ A;  3PUB A;  2I1B A;  2DRY A;  4JPZ A;  4LO1 A;  3N7K A;  4IZX A;  1QQL A;  5EC5 A;  1FWU A;  4I7I A;  1V6V A;  1TOO A;  3HN1 A;  2FFU A;  3P6I A;  3N7J A;  4QD2 B;  1IHK A;  3O44 A;  1JT5 A;  3R4U A;  3AH1 A;  3VT1 A;  1CE7 B;  3H6R A;  3O4A A;  1FMM S;  1AVU A;  3P6J A;  4H75 A;  4J2S A;  3FJB A;  3O3Q A;  4IYB A;  4X3A A;  2F2F C;  4I4Q A;  1PUM B;  5HPZ A;  1M16 A;  4HA2 A;  1YF8 B;  4JRA A;  1R8O A;  2ERM A;  1W3F A;  4QBV A;  2AFG A;  2KLL A;  1Z0H A;  2Y9X E;  2DRE A;  4ZLB B;  1AFC A;  4P6A A;  3BAQ A;  4I8M A;  4X37 A;  4Q9P A;  4LO1 C;  3Q7Y A;  3IAG C;  3A07 A;  4ZFU B;  2DRZ A;  3N7L A;  2ET2 A;  2BFH A;  4YOL A;  3V0B B;  4Z9W B;  2Q3N B;  2XOA A;  3ZC9 A;  1IT0 A;  3EF2 A;  3WIN A;  3CA0 A;  1FMZ A;  3V0A B;  4LO7 C;  2RG9 B;  4L4H A;  1AVA C;  3BRF A;  5EHA A;  3UJ0 A;  1QQK A;  4I4U A;  4HR6 C;  5F8S A;  3NBN A;  31BI A;  1ILR 1;  1CVS A;  5FZY A;  4QKR A;  1J0S A;  4DEP A;  4F83 A;  1BAR A;  3UJ4 A;  4I1E A;  1BFB A;  4P0J A;  3SNV A;  3Q7X A;  2LIQ A;  3V79 C;  1FV3 A;  2KI4 A;  2D7I A;  4G9M A;  3K1X A;  1ITB A;  4G6M A;  2AAI B;  3WMV A;  4F34 A;  3O4C A;  2KH2 A;  4ZFY B;  4ZBV B;  3OJ2 A;  1UPS A;  1S0D A;  1Z4S A;  1DZD A;  1P63 A;  3ZXG A;  4GAI A;  2NS2 A;  1HWM B;  3WIN C;  4EEE B;  1JT3 A;  2AXM A;  2YUG A;  4I0Y A;  1AVX B;  2D1Z A;  4QBC A;  1PWA A;  4LO3 A;  4FVV A;  4EFR A;  4KEI A;  4L4I A;  5FZZ A;  3CQA A;  3BAU A;  4I96 A;  2ZQN A;  2HWM A;  2ESU A;  1W3G A;  2D23 A;  5BQU A;  1V6X A;  1BA7 A;  2J3P A;  3MPP G;  4A7Z A;  3NBD A;  2Y9G A;  3WO3 A;  4KBB A;  2MLL B;  3WO2 A;  1JY0 A;  3POK A;  5B2H A;  3ZX7 A;  1N4K A;  3FJE A;  5DSS B;  3N0K A;  3VUO A;  1RZO B;  1Q04 A;  3WA1 A;  3CA1 A;  1DJS B;  2HWA A;  4MZG B;  3HAL A;  7I1B A;  1YYN A;  2QYI B;  3BA7 A;  3HSM A;  3O4O A;  1DQO A;  2D22 A;  1XYF A;  3FUO A;  5G00 A;  2Q9X A;  1Z2V A;  5BQU C;  1FN0 A;  3O5W B;  1HKN A;  3B9U A;  4H9W A;  4EKX B;  3WO4 A;  4KEK A;  1DQG A;  4IQP A;  3AH4 A;  5EG6 C;  4XFU A;  2E4M A;  9ILB A;  3FJH A;  2WBC A;  1T4Q A;  1OQL B;  1R8N A;  1TFM B;  1SR4 A;  1S0C A;  3F1R A;  3ZC8 A;  4I4S A;  4USP A;  3FJA A;  1RY7 A;  3W9T A;  3A22 A;  4QAL A;  3FFZ A;  1BLA A;  3OJV A;  4USO A;  5FZU A;  4ZGR B;  3C9Z A;  4PC4 A;  4OEF A;  4J2X A;  2P23 A;  5D62 A;  1EPW A;  1JQZ A;  3I2A A;  2GO2 A;  1HCE A;  4HJJ A;  3TC2 A;  2R9K B;  3RMX A;  1L2H A;  3HMY A;  2KKI A;  1F31 A;  1M2T B;  2E4M C;  3FJK A;  3BRG C;  4IY9 A;  1IRA X;  1JT7 A;  4LO2 C;  3OJM A;  4X39 A;  1SR4 C;  3HBW A;  3CRH A;  5BVP I;  3QYD A;  4FGF A;  4ISQ A;  2L5X A;  3AKI A;  3IM5 A;  4ZA3 B;  4J2Y A;  5F90 A;  3NBE A;  3UD8 A;  4A7K A;  1TTU A;  1JLX A;  1IJT A;  4I6I A;  1FGA A;  1BFF A;  5JLV A;  4TLP A;  4OWK A;  4I4Y A;  3AJ5 A;  1ISZ A;  2NTD A;  1MD6 A;  3A23 A;  5BXP A;  1V6W A;  3D7W B;  4IY8 A;  2VSE A;  2FDB M;  4J23 B;  3FJ8 A;  1ISX A;  4XFT A;  4QKS A;  4DCK C;  4A7Y A;  2WRY A;  1IIL A;  3PHZ A;  1HCD A;  2VXT I;  3WMU A;  3FJF A;  2BEA A;  2FO1 A;  1G82 A;  1PUU B;  1AF9 A;  1YXW A;  1S0F A;  4JKQ A;  3ZXD A;  4ION A;  3O49 A;  3VWC A;  4GP0 A;  1WBC A;  5BOW A;  3F62 B;  1DZC A;  4P0K A;  3BRD A;  1IRP A;  1Q03 A;  1YBI A;  4G1R A;  3RTJ B;  1EVT A;  4EFP A;  1HWO B;  3PME A;  3RTI B;  21BI A;  5DVH A;  4ZKT B;  1HWN B;  4H04 A;  2IWT B;  1AVW B;  3IM6 A;  4Q9G A;  1NUN A;  1AXM A;  5F8Y A;  3HOM A;  1FV2 A;  4OEE A;  4IHZ A;  3AZW A;  4G9N A;  1A8D A;  1HIB A;  1BFC A;  3FJ9 A;  3UD9 A;  4ZOT A;  1II4 A;  4I2S A;  2K8R A;  1YTO A;  4OWL A;  4Z8S B;  1I1E A;  4P0L A;  3BA4 A;  3AKG A;  3VT2 A;  41BI A;  1S0G A;  5F8W A;  3IM7 A;  4I3N A;  1TIE A;  2D43 A;  3LLP A;  2NP0 A;  2VXR A;  4I4O A;  4MZH A;  4I1B A;  1TWE A;  3NBC A;  3BAH A;  1ABR B;  3I29 B;  3AJ6 A;  1PC8 B;  4DEN A;  3ILA A;  2FGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...