3O4BA

Crystal structure of symfoil-4t: de novo designed beta-trefoil architecture with symmetric primary structure
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
123
structure length
123
Chain Sequence
PVLLKSTETGQYLRINPDGTVDGTRDRSDTHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDTHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDTHIQFQISPE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords de novo designed beta-trefoil architecture with symmetric pr
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 37
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o4bA00
1T4QA 4GOYA 1WBAA 1YXWA 7I1BA 3ZC8A 4OEGA 5D63A 3AKHA 4I96A 3WO4A 1JTCA 2LIEA 4EKXB 4LO1C 3N0KA 2MC2A 3BA4A 3AZVA 1QQLA 3UJ0A 4L4HA 1RZOB 4KBBA 3FJBA 3OBTA 1S0BA 5FNWA 4D0ZA 2D43A 2IWTB 2KH2A 3P6JA 3Q7YA 4G6JA 4OUJA 2RG9B 1Q04A 1TTUA 4ISQA 2D44A 2Y9GA 1QQKA 1R8OA 4F34A 1JT3A 4LO7B 3OJMA 2Y9WC 2BEAA 1DZDA 4I1BA 3N7KA 3NJ5A 2KI4A 3FFZA 2MIBA 3V0BB 3BAGA 3RSJA 2D22A 4USOA 4I4OA 1TWMA 1S0FA 3OJVA 3V0BA 2M49A 1AVAC 3RMXA 3VWCA 1BFFA 5BP5C 3LTQA 2FFUA 4I4XA 1G9BA 2NM1A 4G9MA 3CA3A 4P6AA 1VCLA 4QALA 4I4VA 1FMZA 3R4SA 5G00A 5BXRA 1FGAA 3O3QA 4F83A 1V6XA 3VT1A 2VSAA 2QYIB 3WMUA 3AKIA 1M2TB 3UDAA 3WO2A 4I4YA 3WO3A 3ZC9A 4J2XA 2K43A 2DRYA 3BA7A 4IZXA 1DFQA 1FWUA 2HZ9A 5HPZA 4JP0A 3JRRA 1TOOA 4ZOTA 4I0YA 4I4PA 3BRDA 3N7MA 1JT4A 1HCEA 1HIBA 5EHAA 1TP0A 1I1BA 3BADA 3POKA 4USPA 1AF9A 3BX1C 5F90A 1DLLA 1JLXA 5F8SA 1IILA 3WINA 4A7KA 4LO3C 3I29B 3B9UA 3CA0A 1WBCA 3CQAA 4LO0C 4J23B 4X39A 3F1RA 3P53A 3VT2A 2BFHA 4ZFYB 5E24E 2ZR1B 3V0AA 1FV3A 3BAOA 2E4MA 5BQUC 1K5UA 3VEQA 5I1BA 4J2SA 1AVUA 5BVPI 3O44A 4A7ZA 1MD6A 4IHZA 2AAIB 1BA7A 2D20A 5BXSA 3IIRA 3FUOA 3A07A 4QBVA 4OEFA 4CJMA 5F8YA 4P0LA 4FGFA 1NUNA 1PC8B 2ZQOA 4J2YA 3AJ6A 2XOAA 1S0DA 3CA6A 1ISYA 2VUAA 4KEJA 5D62A 1W3FA 1HWPB 3HMYA 1FMMS 4G6MA 31BIA 2X2TA 4OWJA 5FZYA 3FUQA 1NZKA 1P63A 1Z0HA 4KEIA 3CA1A 21BIA 4ZA3B 2Q3NB 1QXMA 3FJAA 1BFGA 3FJKA 1JLYA 4Q9PA 3BAQA 1TWEA 3AH4A 1GGPB 4ZGRB 4IZEA 1II4A 1BARA 1AVXB 1JT5A 4QD2C 1TFMB 2NYYA 4LO3A 1Q1UA 3BAUA 3BAHA 2F2FC 1SZ6B 1ABRB 3O49A 4FVVA 1Q03A 6I1BA 2GZBA 4Q9GA 3AZWA 1YYNA 2NZ9A 3I2XA 4X3AA 4GAFA 1FN0A 2K4AB 3CRGA 3BTAA 2FDBM 2IHOA 3AH1A 4JQ0A 2HWMA 3BAVA 2NTDA 3O4OA 1JQZA 1L2HA 3F62B 2D7IA 1IT0A 1BASA 3KMVA 4ZKTB 4EFRA 5EG6C 4GP3A 2FGFA 2Q9XA 1YTOA 5EC5A 1G9AA 3WA1A 3NBCA 4I4QA 3UD8A 2BEBA 2Z49A 2LIQA 1ISZA 4QKRA 4AN7B 2R9KB 3OBRA 3A21A 1EYLA 1ITBA 4DENA 2K8RA 3AJ5A 4ZBVB 1YBIA 4TLPA 3FJDA 5DZUA 2NP0A 2WBCA 4LO1A 4HA2A 4A7YA 2D7RA 2DREA 2DRZA 1CVSA 4I3NA 1FQ9A 2Z48A 4P0KA 5JMCA 4QD2B 1Z2VA 1MC9A 2AFGA 3TC2A 4HR6C 1DQGA 4HJJA 3Q7XA 3FJ9A 1ONKB 1XYFA 2GO2A 2L5XA 2VXTI 1ILR1 1HWOB 2F8XC 3H6QA 5BOWA 3N7JA 4IQPA 1WD3A 1W3GA 4JKXB 4LO8B 1YF8B 1PUUB 3A22A 3LLPA 4D0TA 3OGFA 3CAHA 4H9WA 1DQOA 4I4UA 4I37A 4Z8SB 1M16A 3AKFA 4QBCA 3BRFA 2VSEA 3FJ8A 1JY0A 1T9FA 3MALA 5D61A 1PUMB 5JLVA 1Z4SA 4Z9WB 1R8NA 5BP5A 4I4SA 1AXMA 3S8JA 2ET2A 5GAQA 3UD7A 5BXPA 4XFUA 2NVHA 2I1BA 1E0OA 3R4UA 1RMLA 2Y9XE 3O4DA 1A8DA 1ISWA 4XFSA 3BB2A 4QO3A 3ZXGA 4XKIA 1N4KA 3CA4A 4I6IA 3CRHA 1V6WA 2KI6B 4GOVA 4I2SA 3UJ4A 3FJHA 2Y9FA 2AXMA 9ILBA 1SR4C 3HBWA 1EVTA 4J2KA 2P39A 3HOMA 1S0LA 3NBDA 4LO2C 4GAIA 3W9TA 3AKGA 3Q7WA 4X38A 4JPZA 2J3PA 1IJTA 4R6UB 3C9ZA 3IM5A 2DS0A 4GP0A 3IAGC 1DIWA 2D1ZA 1V6UA 4OW4A 4ENDA 1BLAA 2QN4A 3IM6A 3OJ2A 5B2HA 1V6VA 3MPPG 4IY8A 1BLDA 1AVWB 1G82A 4EEEB 4LO0A 1W3AA 4OEEA 2P23A 3N7LA 3VT0A 1S0GA 3WMVA 5BQUA 2AQZA 4I8MA 1FV2A 1AFCA 4I1EA 4II0A 3NBNA 2MLLB 2YUGA 3FJEA 2FO1A 1FWVA 3O4BA 1ISVA 3CU1B 3WINC 1F31A 4G9NA 4JRAA 4OWLA 4IYBA 3V79C 3ILAA 4OWKA 5F8WA 1SR4A 3FJCA 3PUBA 3SNVA 3E8LC 1EPWA 1S0EA 3AH2A 3PHZA 4EFQA 2VU9A 1CE7B 4LO2A 3ZXDA 3FJFA 1XG6A 1XHBA 2ERMA 3PMEA 2E4MC 1BFBA 4QC4A 4Q91A 4XFTA 1HWMB 41BIA 2WRYA 3I2AA 1IOBA 5DUYA 1HCDA 2VXRA 2KKIA 4I7IA 3H6RB 3UD9A 2HWAA 1I1EA 3PG0A 1XZZA 4QKSA 1ISXA 8I1BA 1S0CA 4ZLBB 2UUSA 4KC3A 3K1XA 3OGGA 4DEPA 3H6RA 4D8HA 1OQLB 1IHKA 2KLLA 3HALA 3O4AA 2F2FA 3QR5A 4KEKA 3VUOA 2RQ9A 3RTIB 3CRIA 3QYDA 4JKQA 1KNMA 5FNXA 2D23A 4WBCA 1UPSA 4YOLA 3S8KA 4I4RA 3P6IA 1BFCA 1EV2A 1PWAA 4PC4A 2X2SA 1IRPA 1HWNB 4H04A 3RMYA 1DZCA 3HSMA 3A23A 3JUTA 3FJIA 1D0HA 1DJSB 3RTJB 4IONA 4IY9A 2D24A 1RY7A 4ZFUB 3HN1A 5DSSB 3V0AB 4ZFWB 3O4CA 4P0JA 3D7WB 3VSFA 5FZUA 4ISRA 3O5WB 3BRGC 1G9CA 4EFPA 1G9DA 1DFCA 3BA5A 1K5VA 1WD4A 4LO7C 1IRAX 4DCKC 2ESUA 2ZQNA 1TIEA 3CA5A 2FFVA 1PZZA 3VSZA 3EF2A 4AN6A 2VLCA 1J0SA 5FZZA 4EB2B 1HKNA 4G1RA 1RG8A 3NBEA 3FGMA 1JT7A 3H6SE 2HW9A 3FJJA 3ZX7A 5DVHA 5BXTA 4JAWA 4X37A 3T8SA 2RSTA 3IM7A 4L4IA
chains in the Genus database with same CATH superfamily
1T4QA 4GOYA 1WBAA 1YXWA 7I1BA 3ZC8A 4OEGA 5D63A 2NS2A 3AKHA 4I96A 3WO4A 1JTCA 2LIEA 4EKXB 4LO1C 3N0KA 2MC2A 3BA4A 3AZVA 1QQLA 3UJ0A 4L4HA 1RZOB 4KBBA 3FJBA 3OBTA 1S0BA 5FNWA 4D0ZA 2D43A 2IWTB 2KH2A 3P6JA 3Q7YA 4G6JA 4OUJA 2RG9B 1Q04A 1TTUA 4ISQA 2D44A 2Y9GA 1QQKA 1R8OA 4F34A 4MZHA 1JT3A 4LO7B 3OJMA 2Y9WC 2BEAA 1DZDA 4I1BA 3N7KA 3NJ5A 2KI4A 3FFZA 2MIBA 3V0BB 3BAGA 3RSJA 2D22A 4USOA 4I4OA 1TWMA 1S0FA 3OJVA 3V0BA 2M49A 1AVAC 3RMXA 3VWCA 1BFFA 5BP5C 3LTQA 2FFUA 4I4XA 1G9BA 2NM1A 4G9MA 3CA3A 4P6AA 1VCLA 4QALA 4I4VA 1FMZA 3R4SA 5G00A 5BXRA 1FGAA 3O3QA 4F83A 1V6XA 3VT1A 2VSAA 2QYIB 3WMUA 3AKIA 1M2TB 3UDAA 3WO2A 4I4YA 3WO3A 3ZC9A 4MZGB 4J2XA 2K43A 2DRYA 3BA7A 4IZXA 1DFQA 1FWUA 2HZ9A 5HPZA 4JP0A 3JRRA 1TOOA 4ZOTA 4I0YA 4I4PA 3BRDA 3N7MA 1JT4A 1HCEA 1HIBA 5EHAA 1TP0A 1I1BA 3BADA 3POKA 4USPA 1AF9A 3BX1C 5F90A 1DLLA 1JLXA 5F8SA 1IILA 3WINA 4A7KA 4LO3C 3I29B 3B9UA 3CA0A 1WBCA 3CQAA 4H75A 4J23B 4LO0C 4X39A 3F1RA 3P53A 3VT2A 2BFHA 4ZFYB 5E24E 2ZR1B 3V0AA 1FV3A 3BAOA 2E4MA 5BQUC 1K5UA 3VEQA 5I1BA 4J2SA 1AVUA 5BVPI 3O44A 4A7ZA 1MD6A 4IHZA 2AAIB 1BA7A 2D20A 5BXSA 3IIRA 3FUOA 3A07A 4QBVA 4OEFA 4CJMA 5F8YA 4P0LA 4FGFA 1NUNA 1PC8B 2ZQOA 4J2YA 3AJ6A 2XOAA 1S0DA 3CA6A 1ISYA 2VUAA 4KEJA 5D62A 1W3FA 1HWPB 3HMYA 1FMMS 4G6MA 31BIA 2X2TA 4OWJA 5FZYA 3FUQA 1NZKA 1P63A 1Z0HA 4KEIA 3CA1A 21BIA 4ZA3B 2Q3NB 1QXMA 3FJAA 1BFGA 3FJKA 1JLYA 4Q9PA 3BAQA 1TWEA 3AH4A 1GGPB 4ZGRB 4IZEA 1II4A 1BARA 1AVXB 1JT5A 4QD2C 1TFMB 2NYYA 4LO3A 1Q1UA 3BAUA 3BAHA 2F2FC 1SZ6B 1ABRB 3O49A 4FVVA 1Q03A 6I1BA 2GZBA 4Q9GA 3AZWA 1YYNA 2NZ9A 3I2XA 4X3AA 4GAFA 1FN0A 2K4AB 3CRGA 3BTAA 2FDBM 2IHOA 3AH1A 4JQ0A 2HWMA 3BAVA 2NTDA 3O4OA 1JQZA 1L2HA 3F62B 2D7IA 1IT0A 4UY4A 1BASA 3KMVA 4ZKTB 4EFRA 5EG6C 4GP3A 2FGFA 2Q9XA 1YTOA 5EC5A 1G9AA 3WA1A 3NBCA 4I4QA 3UD8A 2BEBA 2Z49A 2LIQA 1ISZA 4QKRA 4AN7B 2R9KB 3OBRA 3A21A 1EYLA 1ITBA 4DENA 2K8RA 3AJ5A 4ZBVB 1YBIA 4TLPA 3FJDA 5DZUA 2NP0A 2WBCA 4LO1A 4HA2A 4A7YA 2D7RA 2DREA 2DRZA 1CVSA 4I3NA 1FQ9A 2Z48A 4P0KA 5JMCA 4QD2B 1Z2VA 1MC9A 2AFGA 3TC2A 4HR6C 1DQGA 4HJJA 3Q7XA 3FJ9A 1ONKB 1XYFA 2GO2A 2L5XA 2VXTI 1ILR1 1HWOB 2F8XC 3H6QA 5BOWA 3N7JA 4IQPA 1WD3A 1W3GA 4JKXB 4LO8B 1YF8B 1PUUB 3A22A 3LLPA 4D0TA 3OGFA 3CAHA 4H9WA 1DQOA 4I4UA 4I37A 4Z8SB 1M16A 3AKFA 4QBCA 3BRFA 2VSEA 3FJ8A 1JY0A 1T9FA 3MALA 5D61A 1PUMB 5JLVA 1Z4SA 4Z9WB 4MZFB 1R8NA 5BP5A 4I4SA 1AXMA 3S8JA 2ET2A 5GAQA 3UD7A 5BXPA 4XFUA 2NVHA 2I1BA 1E0OA 3R4UA 1RMLA 2Y9XE 3O4DA 1A8DA 1ISWA 4XFSA 3BB2A 4QO3A 3ZXGA 4XKIA 1N4KA 3CA4A 4I6IA 3CRHA 1V6WA 2KI6B 4GOVA 4I2SA 3UJ4A 3FJHA 2Y9FA 2AXMA 9ILBA 1SR4C 3HBWA 1EVTA 4J2KA 2P39A 3HOMA 1S0LA 3NBDA 4LO2C 4GAIA 3W9TA 3AKGA 3Q7WA 4X38A 4JPZA 2J3PA 1IJTA 4R6UB 3C9ZA 3IM5A 2DS0A 4GP0A 3IAGC 1DIWA 2D1ZA 1V6UA 4OW4A 4ENDA 1BLAA 2QN4A 3IM6A 3OJ2A 5B2HA 1V6VA 3MPPG 4IY8A 1BLDA 1AVWB 1G82A 4EEEB 4LO0A 1W3AA 4OEEA 2P23A 3N7LA 3VT0A 1S0GA 3WMVA 5BQUA 2AQZA 4I8MA 1FV2A 1AFCA 4I1EA 4II0A 3NBNA 2MLLB 2YUGA 3FJEA 2FO1A 1FWVA 3O4BA 1ISVA 3CU1B 3WINC 1F31A 4G9NA 4JRAA 4OWLA 4IYBA 3V79C 3ILAA 4OWKA 5F8WA 1SR4A 3FJCA 3PUBA 3SNVA 3E8LC 1EPWA 1S0EA 3AH2A 3PHZA 4EFQA 2VU9A 1CE7B 4LO2A 3ZXDA 3FJFA 1XG6A 1XHBA 2ERMA 3PMEA 2E4MC 1BFBA 4QC4A 4Q91A 4XFTA 1HWMB 41BIA 2WRYA 3I2AA 1IOBA 5DUYA 1HCDA 2VXRA 2KKIA 4I7IA 3H6RB 3UD9A 2HWAA 1I1EA 3PG0A 1XZZA 4QKSA 1ISXA 8I1BA 1S0CA 4ZLBB 2UUSA 4KC3A 3K1XA 3OGGA 4DEPA 3H6RA 4D8HA 1OQLB 1IHKA 2KLLA 3HALA 3O4AA 2F2FA 3QR5A 4KEKA 3VUOA 2RQ9A 3RTIB 3CRIA 3QYDA 4JKQA 1KNMA 5FNXA 2D23A 4WBCA 1UPSA 4YOLA 3S8KA 4I4RA 3P6IA 1BFCA 1EV2A 1PWAA 4PC4A 2X2SA 1IRPA 1HWNB 4H04A 3RMYA 1DZCA 3HSMA 3A23A 3JUTA 3FJIA 1D0HA 1DJSB 3RTJB 4IONA 4IY9A 2D24A 1RY7A 4ZFUB 3HN1A 5DSSB 3V0AB 4ZFWB 3O4CA 4P0JA 3D7WB 3VSFA 5FZUA 4ISRA 3O5WB 3BRGC 1G9CA 4EFPA 1G9DA 1DFCA 3BA5A 1K5VA 1WD4A 4LO7C 1IRAX 4DCKC 2ESUA 2ZQNA 1TIEA 3CA5A 2FFVA 1PZZA 3VSZA 3EF2A 4AN6A 2VLCA 1J0SA 5FZZA 4EB2B 1HKNA 4G1RA 1RG8A 3NBEA 3FGMA 1JT7A 3H6SE 2HW9A 3FJJA 3ZX7A 5DVHA 5BXTA 4JAWA 4X37A 3T8SA 2RSTA 3IM7A 4L4IA
chains in the Genus database with same CATH topology
1T4QA 4GOYA 1WBAA 1YXWA 7I1BA 3ZC8A 4OEGA 5D63A 2NS2A 3AKHA 4I96A 3WO4A 1JTCA 2LIEA 4EKXB 4LO1C 3N0KA 2MC2A 3BA4A 3AZVA 1QQLA 3UJ0A 4L4HA 1RZOB 4KBBA 3FJBA 3OBTA 1S0BA 5FNWA 4D0ZA 2D43A 2IWTB 2KH2A 3P6JA 3Q7YA 4G6JA 4OUJA 2RG9B 1Q04A 1TTUA 4ISQA 2D44A 2Y9GA 1QQKA 1R8OA 4F34A 4MZHA 1JT3A 4LO7B 3OJMA 2Y9WC 2BEAA 1DZDA 4I1BA 3N7KA 3NJ5A 2KI4A 3FFZA 2MIBA 3V0BB 3BAGA 3RSJA 2D22A 4USOA 4I4OA 1TWMA 1S0FA 3OJVA 3V0BA 2M49A 1AVAC 3RMXA 3VWCA 1BFFA 5BP5C 3LTQA 2FFUA 4I4XA 1G9BA 2NM1A 4G9MA 3CA3A 4P6AA 1VCLA 4QALA 4I4VA 1FMZA 3R4SA 5G00A 5BXRA 1FGAA 3O3QA 4F83A 1V6XA 3VT1A 2VSAA 2QYIB 3WMUA 3AKIA 1M2TB 3UDAA 3WO2A 4I4YA 3WO3A 3ZC9A 4MZGB 4J2XA 2K43A 2DRYA 3BA7A 4IZXA 1DFQA 1FWUA 2HZ9A 5HPZA 4JP0A 3JRRA 1TOOA 4ZOTA 4I0YA 4I4PA 3BRDA 3N7MA 1JT4A 1HCEA 1HIBA 5EHAA 1TP0A 1I1BA 3BADA 3POKA 4USPA 1AF9A 3BX1C 5F90A 1DLLA 1JLXA 5F8SA 1IILA 3WINA 4A7KA 4LO3C 3I29B 3B9UA 3CA0A 1WBCA 3CQAA 4H75A 4J23B 4LO0C 4X39A 3F1RA 3P53A 3VT2A 2BFHA 4ZFYB 5E24E 2ZR1B 3V0AA 1FV3A 3BAOA 2E4MA 5BQUC 1K5UA 3VEQA 5I1BA 4J2SA 1AVUA 5BVPI 3O44A 4A7ZA 1MD6A 4IHZA 2AAIB 1BA7A 2D20A 5BXSA 3IIRA 3FUOA 3A07A 4QBVA 4OEFA 4CJMA 5F8YA 4P0LA 4FGFA 1NUNA 1PC8B 2ZQOA 4J2YA 3AJ6A 2XOAA 1S0DA 3CA6A 1ISYA 2VUAA 4KEJA 5D62A 1W3FA 1HWPB 3HMYA 1FMMS 4G6MA 31BIA 2X2TA 4OWJA 5FZYA 3FUQA 1NZKA 1P63A 1Z0HA 4KEIA 3CA1A 21BIA 4ZA3B 2Q3NB 1QXMA 3FJAA 1BFGA 3FJKA 1JLYA 4Q9PA 3BAQA 1TWEA 3AH4A 1GGPB 4ZGRB 4IZEA 1II4A 1BARA 1AVXB 1JT5A 4QD2C 1TFMB 2NYYA 4LO3A 1Q1UA 3BAUA 3BAHA 2F2FC 1SZ6B 1ABRB 3O49A 4FVVA 1Q03A 6I1BA 2GZBA 4Q9GA 3AZWA 1YYNA 2NZ9A 3I2XA 4X3AA 4GAFA 1FN0A 2K4AB 3CRGA 3BTAA 2FDBM 2IHOA 3AH1A 4JQ0A 2HWMA 3BAVA 2NTDA 3O4OA 1JQZA 1L2HA 3F62B 2D7IA 1IT0A 4UY4A 1BASA 3KMVA 4ZKTB 4EFRA 5EG6C 4GP3A 2FGFA 2Q9XA 1YTOA 5EC5A 1G9AA 3WA1A 3NBCA 4I4QA 3UD8A 2BEBA 2Z49A 2LIQA 1ISZA 4QKRA 4AN7B 2R9KB 3OBRA 3A21A 1EYLA 1ITBA 4DENA 2K8RA 3AJ5A 4ZBVB 1YBIA 4TLPA 3FJDA 5DZUA 2NP0A 2WBCA 4LO1A 4HA2A 4A7YA 2D7RA 2DREA 2DRZA 1CVSA 4I3NA 1FQ9A 2Z48A 4P0KA 5JMCA 4QD2B 1Z2VA 1MC9A 2AFGA 3TC2A 4HR6C 1DQGA 4HJJA 3Q7XA 3FJ9A 1ONKB 1XYFA 2GO2A 2L5XA 2VXTI 1ILR1 1HWOB 2F8XC 3H6QA 5BOWA 3N7JA 4IQPA 1WD3A 1W3GA 4JKXB 4LO8B 1YF8B 1PUUB 3A22A 3LLPA 4D0TA 3OGFA 3CAHA 4H9WA 1DQOA 4I4UA 4I37A 4Z8SB 1M16A 3AKFA 4QBCA 3BRFA 2VSEA 3FJ8A 1JY0A 1T9FA 3MALA 5D61A 1PUMB 5JLVA 1Z4SA 4Z9WB 4MZFB 1R8NA 5BP5A 4I4SA 1AXMA 3S8JA 2ET2A 5GAQA 3UD7A 5BXPA 4XFUA 2NVHA 2I1BA 1E0OA 3R4UA 1RMLA 2Y9XE 3O4DA 1A8DA 1ISWA 4XFSA 3BB2A 4QO3A 3ZXGA 4XKIA 1N4KA 3CA4A 4I6IA 3CRHA 1V6WA 2KI6B 4GOVA 4I2SA 3UJ4A 3FJHA 2Y9FA 2AXMA 9ILBA 1SR4C 3HBWA 1EVTA 4J2KA 2P39A 3HOMA 1S0LA 3NBDA 4LO2C 4GAIA 3W9TA 3AKGA 3Q7WA 4X38A 4JPZA 2J3PA 1IJTA 4R6UB 3C9ZA 3IM5A 2DS0A 4GP0A 3IAGC 1DIWA 2D1ZA 1V6UA 4OW4A 4ENDA 1BLAA 2QN4A 3IM6A 3OJ2A 5B2HA 1V6VA 3MPPG 4IY8A 1BLDA 1AVWB 1G82A 4EEEB 4LO0A 1W3AA 4OEEA 2P23A 3N7LA 3VT0A 1S0GA 3WMVA 5BQUA 2AQZA 4I8MA 1FV2A 1AFCA 4I1EA 4II0A 3NBNA 2MLLB 2YUGA 3FJEA 2FO1A 1FWVA 3O4BA 1ISVA 3CU1B 3WINC 1F31A 4G9NA 4JRAA 4OWLA 4IYBA 3V79C 3ILAA 4OWKA 5F8WA 1SR4A 3FJCA 3PUBA 3SNVA 3E8LC 1EPWA 1S0EA 3AH2A 3PHZA 4EFQA 2VU9A 1CE7B 4LO2A 3ZXDA 3FJFA 1XG6A 1XHBA 2ERMA 3PMEA 2E4MC 1BFBA 4QC4A 4Q91A 4XFTA 1HWMB 41BIA 2WRYA 3I2AA 1IOBA 5DUYA 1HCDA 2VXRA 2KKIA 4I7IA 3H6RB 3UD9A 2HWAA 1I1EA 3PG0A 1XZZA 4QKSA 1ISXA 8I1BA 1S0CA 4ZLBB 2UUSA 4KC3A 3K1XA 3OGGA 4DEPA 3H6RA 4D8HA 1OQLB 1IHKA 2KLLA 3HALA 3O4AA 2F2FA 3QR5A 4KEKA 3VUOA 2RQ9A 3RTIB 3CRIA 3QYDA 4JKQA 1KNMA 5FNXA 2D23A 4WBCA 1UPSA 4YOLA 3S8KA 4I4RA 3P6IA 1BFCA 1EV2A 1PWAA 4PC4A 2X2SA 1IRPA 1HWNB 4H04A 3RMYA 1DZCA 3HSMA 3A23A 3JUTA 3FJIA 1D0HA 1DJSB 3RTJB 4IONA 4IY9A 2D24A 1RY7A 4ZFUB 3HN1A 5DSSB 3V0AB 4ZFWB 3O4CA 4P0JA 3D7WB 3VSFA 5FZUA 4ISRA 3O5WB 3BRGC 1G9CA 4EFPA 1G9DA 1DFCA 3BA5A 1K5VA 1WD4A 4LO7C 1IRAX 4DCKC 2ESUA 2ZQNA 1TIEA 3CA5A 2FFVA 1PZZA 3VSZA 3EF2A 4AN6A 2VLCA 1J0SA 5FZZA 4EB2B 1HKNA 4G1RA 1RG8A 3NBEA 3FGMA 1JT7A 3H6SE 2HW9A 3FJJA 3ZX7A 5DVHA 5BXTA 4JAWA 4X37A 3T8SA 2RSTA 3IM7A 4L4IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Q A;  4GOY A;  1WBA A;  1YXW A;  7I1B A;  3ZC8 A;  4OEG A;  5D63 A;  3AKH A;  4I96 A;  3WO4 A;  1JTC A;  2LIE A;  4EKX B;  4LO1 C;  3N0K A;  2MC2 A;  3BA4 A;  3AZV A;  1QQL A;  3UJ0 A;  4L4H A;  1RZO B;  4KBB A;  3FJB A;  3OBT A;  1S0B A;  5FNW A;  4D0Z A;  2D43 A;  2IWT B;  2KH2 A;  3P6J A;  3Q7Y A;  4G6J A;  4OUJ A;  2RG9 B;  1Q04 A;  1TTU A;  4ISQ A;  2D44 A;  2Y9G A;  1QQK A;  1R8O A;  4F34 A;  1JT3 A;  4LO7 B;  3OJM A;  2Y9W C;  2BEA A;  1DZD A;  4I1B A;  3N7K A;  3NJ5 A;  2KI4 A;  3FFZ A;  2MIB A;  3V0B B;  3BAG A;  3RSJ A;  2D22 A;  4USO A;  4I4O A;  1TWM A;  1S0F A;  3OJV A;  3V0B A;  2M49 A;  1AVA C;  3RMX A;  3VWC A;  1BFF A;  5BP5 C;  3LTQ A;  2FFU A;  4I4X A;  1G9B A;  2NM1 A;  4G9M A;  3CA3 A;  4P6A A;  1VCL A;  4QAL A;  4I4V A;  1FMZ A;  3R4S A;  5G00 A;  5BXR A;  1FGA A;  3O3Q A;  4F83 A;  1V6X A;  3VT1 A;  2VSA A;  2QYI B;  3WMU A;  3AKI A;  1M2T B;  3UDA A;  3WO2 A;  4I4Y A;  3WO3 A;  3ZC9 A;  4J2X A;  2K43 A;  2DRY A;  3BA7 A;  4IZX A;  1DFQ A;  1FWU A;  2HZ9 A;  5HPZ A;  4JP0 A;  3JRR A;  1TOO A;  4ZOT A;  4I0Y A;  4I4P A;  3BRD A;  3N7M A;  1JT4 A;  1HCE A;  1HIB A;  5EHA A;  1TP0 A;  1I1B A;  3BAD A;  3POK A;  4USP A;  1AF9 A;  3BX1 C;  5F90 A;  1DLL A;  1JLX A;  5F8S A;  1IIL A;  3WIN A;  4A7K A;  4LO3 C;  3I29 B;  3B9U A;  3CA0 A;  1WBC A;  3CQA A;  4LO0 C;  4J23 B;  4X39 A;  3F1R A;  3P53 A;  3VT2 A;  2BFH A;  4ZFY B;  5E24 E;  2ZR1 B;  3V0A A;  1FV3 A;  3BAO A;  2E4M A;  5BQU C;  1K5U A;  3VEQ A;  5I1B A;  4J2S A;  1AVU A;  5BVP I;  3O44 A;  4A7Z A;  1MD6 A;  4IHZ A;  2AAI B;  1BA7 A;  2D20 A;  5BXS A;  3IIR A;  3FUO A;  3A07 A;  4QBV A;  4OEF A;  4CJM A;  5F8Y A;  4P0L A;  4FGF A;  1NUN A;  1PC8 B;  2ZQO A;  4J2Y A;  3AJ6 A;  2XOA A;  1S0D A;  3CA6 A;  1ISY A;  2VUA A;  4KEJ A;  5D62 A;  1W3F A;  1HWP B;  3HMY A;  1FMM S;  4G6M A;  31BI A;  2X2T A;  4OWJ A;  5FZY A;  3FUQ A;  1NZK A;  1P63 A;  1Z0H A;  4KEI A;  3CA1 A;  21BI A;  4ZA3 B;  2Q3N B;  1QXM A;  3FJA A;  1BFG A;  3FJK A;  1JLY A;  4Q9P A;  3BAQ A;  1TWE A;  3AH4 A;  1GGP B;  4ZGR B;  4IZE A;  1II4 A;  1BAR A;  1AVX B;  1JT5 A;  4QD2 C;  1TFM B;  2NYY A;  4LO3 A;  1Q1U A;  3BAU A;  3BAH A;  2F2F C;  1SZ6 B;  1ABR B;  3O49 A;  4FVV A;  1Q03 A;  6I1B A;  2GZB A;  4Q9G A;  3AZW A;  1YYN A;  2NZ9 A;  3I2X A;  4X3A A;  4GAF A;  1FN0 A;  2K4A B;  3CRG A;  3BTA A;  2FDB M;  2IHO A;  3AH1 A;  4JQ0 A;  2HWM A;  3BAV A;  2NTD A;  3O4O A;  1JQZ A;  1L2H A;  3F62 B;  2D7I A;  1IT0 A;  1BAS A;  3KMV A;  4ZKT B;  4EFR A;  5EG6 C;  4GP3 A;  2FGF A;  2Q9X A;  1YTO A;  5EC5 A;  1G9A A;  3WA1 A;  3NBC A;  4I4Q A;  3UD8 A;  2BEB A;  2Z49 A;  2LIQ A;  1ISZ A;  4QKR A;  4AN7 B;  2R9K B;  3OBR A;  3A21 A;  1EYL A;  1ITB A;  4DEN A;  2K8R A;  3AJ5 A;  4ZBV B;  1YBI A;  4TLP A;  3FJD A;  5DZU A;  2NP0 A;  2WBC A;  4LO1 A;  4HA2 A;  4A7Y A;  2D7R A;  2DRE A;  2DRZ A;  1CVS A;  4I3N A;  1FQ9 A;  2Z48 A;  4P0K A;  5JMC A;  4QD2 B;  1Z2V A;  1MC9 A;  2AFG A;  3TC2 A;  4HR6 C;  1DQG A;  4HJJ A;  3Q7X A;  3FJ9 A;  1ONK B;  1XYF A;  2GO2 A;  2L5X A;  2VXT I;  1ILR 1;  1HWO B;  2F8X C;  3H6Q A;  5BOW A;  3N7J A;  4IQP A;  1WD3 A;  1W3G A;  4JKX B;  4LO8 B;  1YF8 B;  1PUU B;  3A22 A;  3LLP A;  4D0T A;  3OGF A;  3CAH A;  4H9W A;  1DQO A;  4I4U A;  4I37 A;  4Z8S B;  1M16 A;  3AKF A;  4QBC A;  3BRF A;  2VSE A;  3FJ8 A;  1JY0 A;  1T9F A;  3MAL A;  5D61 A;  1PUM B;  5JLV A;  1Z4S A;  4Z9W B;  1R8N A;  5BP5 A;  4I4S A;  1AXM A;  3S8J A;  2ET2 A;  5GAQ A;  3UD7 A;  5BXP A;  4XFU A;  2NVH A;  2I1B A;  1E0O A;  3R4U A;  1RML A;  2Y9X E;  3O4D A;  1A8D A;  1ISW A;  4XFS A;  3BB2 A;  4QO3 A;  3ZXG A;  4XKI A;  1N4K A;  3CA4 A;  4I6I A;  3CRH A;  1V6W A;  2KI6 B;  4GOV A;  4I2S A;  3UJ4 A;  3FJH A;  2Y9F A;  2AXM A;  9ILB A;  1SR4 C;  3HBW A;  1EVT A;  4J2K A;  2P39 A;  3HOM A;  1S0L A;  3NBD A;  4LO2 C;  4GAI A;  3W9T A;  3AKG A;  3Q7W A;  4X38 A;  4JPZ A;  2J3P A;  1IJT A;  4R6U B;  3C9Z A;  3IM5 A;  2DS0 A;  4GP0 A;  3IAG C;  1DIW A;  2D1Z A;  1V6U A;  4OW4 A;  4END A;  1BLA A;  2QN4 A;  3IM6 A;  3OJ2 A;  5B2H A;  1V6V A;  3MPP G;  4IY8 A;  1BLD A;  1AVW B;  1G82 A;  4EEE B;  4LO0 A;  1W3A A;  4OEE A;  2P23 A;  3N7L A;  3VT0 A;  1S0G A;  3WMV A;  5BQU A;  2AQZ A;  4I8M A;  1FV2 A;  1AFC A;  4I1E A;  4II0 A;  3NBN A;  2MLL B;  2YUG A;  3FJE A;  2FO1 A;  1FWV A;  3O4B A;  1ISV A;  3CU1 B;  3WIN C;  1F31 A;  4G9N A;  4JRA A;  4OWL A;  4IYB A;  3V79 C;  3ILA A;  4OWK A;  5F8W A;  1SR4 A;  3FJC A;  3PUB A;  3SNV A;  3E8L C;  1EPW A;  1S0E A;  3AH2 A;  3PHZ A;  4EFQ A;  2VU9 A;  1CE7 B;  4LO2 A;  3ZXD A;  3FJF A;  1XG6 A;  1XHB A;  2ERM A;  3PME A;  2E4M C;  1BFB A;  4QC4 A;  4Q91 A;  4XFT A;  1HWM B;  41BI A;  2WRY A;  3I2A A;  1IOB A;  5DUY A;  1HCD A;  2VXR A;  2KKI A;  4I7I A;  3H6R B;  3UD9 A;  2HWA A;  1I1E A;  3PG0 A;  1XZZ A;  4QKS A;  1ISX A;  8I1B A;  1S0C A;  4ZLB B;  2UUS A;  4KC3 A;  3K1X A;  3OGG A;  4DEP A;  3H6R A;  4D8H A;  1OQL B;  1IHK A;  2KLL A;  3HAL A;  3O4A A;  2F2F A;  3QR5 A;  4KEK A;  3VUO A;  2RQ9 A;  3RTI B;  3CRI A;  3QYD A;  4JKQ A;  1KNM A;  5FNX A;  2D23 A;  4WBC A;  1UPS A;  4YOL A;  3S8K A;  4I4R A;  3P6I A;  1BFC A;  1EV2 A;  1PWA A;  4PC4 A;  2X2S A;  1IRP A;  1HWN B;  4H04 A;  3RMY A;  1DZC A;  3HSM A;  3A23 A;  3JUT A;  3FJI A;  1D0H A;  1DJS B;  3RTJ B;  4ION A;  4IY9 A;  2D24 A;  1RY7 A;  4ZFU B;  3HN1 A;  5DSS B;  3V0A B;  4ZFW B;  3O4C A;  4P0J A;  3D7W B;  3VSF A;  5FZU A;  4ISR A;  3O5W B;  3BRG C;  1G9C A;  4EFP A;  1G9D A;  1DFC A;  3BA5 A;  1K5V A;  1WD4 A;  4LO7 C;  1IRA X;  4DCK C;  2ESU A;  2ZQN A;  1TIE A;  3CA5 A;  2FFV A;  1PZZ A;  3VSZ A;  3EF2 A;  4AN6 A;  2VLC A;  1J0S A;  5FZZ A;  4EB2 B;  1HKN A;  4G1R A;  1RG8 A;  3NBE A;  3FGM A;  1JT7 A;  3H6S E;  2HW9 A;  3FJJ A;  3ZX7 A;  5DVH A;  5BXT A;  4JAW A;  4X37 A;  3T8S A;  2RST A;  3IM7 A;  4L4I A; 
#chains in the Genus database with same CATH topology
 1T4Q A;  4GOY A;  1WBA A;  1YXW A;  7I1B A;  3ZC8 A;  4OEG A;  5D63 A;  2NS2 A;  3AKH A;  4I96 A;  3WO4 A;  1JTC A;  2LIE A;  4EKX B;  4LO1 C;  3N0K A;  2MC2 A;  3BA4 A;  3AZV A;  1QQL A;  3UJ0 A;  4L4H A;  1RZO B;  4KBB A;  3FJB A;  3OBT A;  1S0B A;  5FNW A;  4D0Z A;  2D43 A;  2IWT B;  2KH2 A;  3P6J A;  3Q7Y A;  4G6J A;  4OUJ A;  2RG9 B;  1Q04 A;  1TTU A;  4ISQ A;  2D44 A;  2Y9G A;  1QQK A;  1R8O A;  4F34 A;  4MZH A;  1JT3 A;  4LO7 B;  3OJM A;  2Y9W C;  2BEA A;  1DZD A;  4I1B A;  3N7K A;  3NJ5 A;  2KI4 A;  3FFZ A;  2MIB A;  3V0B B;  3BAG A;  3RSJ A;  2D22 A;  4USO A;  4I4O A;  1TWM A;  1S0F A;  3OJV A;  3V0B A;  2M49 A;  1AVA C;  3RMX A;  3VWC A;  1BFF A;  5BP5 C;  3LTQ A;  2FFU A;  4I4X A;  1G9B A;  2NM1 A;  4G9M A;  3CA3 A;  4P6A A;  1VCL A;  4QAL A;  4I4V A;  1FMZ A;  3R4S A;  5G00 A;  5BXR A;  1FGA A;  3O3Q A;  4F83 A;  1V6X A;  3VT1 A;  2VSA A;  2QYI B;  3WMU A;  3AKI A;  1M2T B;  3UDA A;  3WO2 A;  4I4Y A;  3WO3 A;  3ZC9 A;  4MZG B;  4J2X A;  2K43 A;  2DRY A;  3BA7 A;  4IZX A;  1DFQ A;  1FWU A;  2HZ9 A;  5HPZ A;  4JP0 A;  3JRR A;  1TOO A;  4ZOT A;  4I0Y A;  4I4P A;  3BRD A;  3N7M A;  1JT4 A;  1HCE A;  1HIB A;  5EHA A;  1TP0 A;  1I1B A;  3BAD A;  3POK A;  4USP A;  1AF9 A;  3BX1 C;  5F90 A;  1DLL A;  1JLX A;  5F8S A;  1IIL A;  3WIN A;  4A7K A;  4LO3 C;  3I29 B;  3B9U A;  3CA0 A;  1WBC A;  3CQA A;  4H75 A;  4J23 B;  4LO0 C;  4X39 A;  3F1R A;  3P53 A;  3VT2 A;  2BFH A;  4ZFY B;  5E24 E;  2ZR1 B;  3V0A A;  1FV3 A;  3BAO A;  2E4M A;  5BQU C;  1K5U A;  3VEQ A;  5I1B A;  4J2S A;  1AVU A;  5BVP I;  3O44 A;  4A7Z A;  1MD6 A;  4IHZ A;  2AAI B;  1BA7 A;  2D20 A;  5BXS A;  3IIR A;  3FUO A;  3A07 A;  4QBV A;  4OEF A;  4CJM A;  5F8Y A;  4P0L A;  4FGF A;  1NUN A;  1PC8 B;  2ZQO A;  4J2Y A;  3AJ6 A;  2XOA A;  1S0D A;  3CA6 A;  1ISY A;  2VUA A;  4KEJ A;  5D62 A;  1W3F A;  1HWP B;  3HMY A;  1FMM S;  4G6M A;  31BI A;  2X2T A;  4OWJ A;  5FZY A;  3FUQ A;  1NZK A;  1P63 A;  1Z0H A;  4KEI A;  3CA1 A;  21BI A;  4ZA3 B;  2Q3N B;  1QXM A;  3FJA A;  1BFG A;  3FJK A;  1JLY A;  4Q9P A;  3BAQ A;  1TWE A;  3AH4 A;  1GGP B;  4ZGR B;  4IZE A;  1II4 A;  1BAR A;  1AVX B;  1JT5 A;  4QD2 C;  1TFM B;  2NYY A;  4LO3 A;  1Q1U A;  3BAU A;  3BAH A;  2F2F C;  1SZ6 B;  1ABR B;  3O49 A;  4FVV A;  1Q03 A;  6I1B A;  2GZB A;  4Q9G A;  3AZW A;  1YYN A;  2NZ9 A;  3I2X A;  4X3A A;  4GAF A;  1FN0 A;  2K4A B;  3CRG A;  3BTA A;  2FDB M;  2IHO A;  3AH1 A;  4JQ0 A;  2HWM A;  3BAV A;  2NTD A;  3O4O A;  1JQZ A;  1L2H A;  3F62 B;  2D7I A;  1IT0 A;  4UY4 A;  1BAS A;  3KMV A;  4ZKT B;  4EFR A;  5EG6 C;  4GP3 A;  2FGF A;  2Q9X A;  1YTO A;  5EC5 A;  1G9A A;  3WA1 A;  3NBC A;  4I4Q A;  3UD8 A;  2BEB A;  2Z49 A;  2LIQ A;  1ISZ A;  4QKR A;  4AN7 B;  2R9K B;  3OBR A;  3A21 A;  1EYL A;  1ITB A;  4DEN A;  2K8R A;  3AJ5 A;  4ZBV B;  1YBI A;  4TLP A;  3FJD A;  5DZU A;  2NP0 A;  2WBC A;  4LO1 A;  4HA2 A;  4A7Y A;  2D7R A;  2DRE A;  2DRZ A;  1CVS A;  4I3N A;  1FQ9 A;  2Z48 A;  4P0K A;  5JMC A;  4QD2 B;  1Z2V A;  1MC9 A;  2AFG A;  3TC2 A;  4HR6 C;  1DQG A;  4HJJ A;  3Q7X A;  3FJ9 A;  1ONK B;  1XYF A;  2GO2 A;  2L5X A;  2VXT I;  1ILR 1;  1HWO B;  2F8X C;  3H6Q A;  5BOW A;  3N7J A;  4IQP A;  1WD3 A;  1W3G A;  4JKX B;  4LO8 B;  1YF8 B;  1PUU B;  3A22 A;  3LLP A;  4D0T A;  3OGF A;  3CAH A;  4H9W A;  1DQO A;  4I4U A;  4I37 A;  4Z8S B;  1M16 A;  3AKF A;  4QBC A;  3BRF A;  2VSE A;  3FJ8 A;  1JY0 A;  1T9F A;  3MAL A;  5D61 A;  1PUM B;  5JLV A;  1Z4S A;  4Z9W B;  4MZF B;  1R8N A;  5BP5 A;  4I4S A;  1AXM A;  3S8J A;  2ET2 A;  5GAQ A;  3UD7 A;  5BXP A;  4XFU A;  2NVH A;  2I1B A;  1E0O A;  3R4U A;  1RML A;  2Y9X E;  3O4D A;  1A8D A;  1ISW A;  4XFS A;  3BB2 A;  4QO3 A;  3ZXG A;  4XKI A;  1N4K A;  3CA4 A;  4I6I A;  3CRH A;  1V6W A;  2KI6 B;  4GOV A;  4I2S A;  3UJ4 A;  3FJH A;  2Y9F A;  2AXM A;  9ILB A;  1SR4 C;  3HBW A;  1EVT A;  4J2K A;  2P39 A;  3HOM A;  1S0L A;  3NBD A;  4LO2 C;  4GAI A;  3W9T A;  3AKG A;  3Q7W A;  4X38 A;  4JPZ A;  2J3P A;  1IJT A;  4R6U B;  3C9Z A;  3IM5 A;  2DS0 A;  4GP0 A;  3IAG C;  1DIW A;  2D1Z A;  1V6U A;  4OW4 A;  4END A;  1BLA A;  2QN4 A;  3IM6 A;  3OJ2 A;  5B2H A;  1V6V A;  3MPP G;  4IY8 A;  1BLD A;  1AVW B;  1G82 A;  4EEE B;  4LO0 A;  1W3A A;  4OEE A;  2P23 A;  3N7L A;  3VT0 A;  1S0G A;  3WMV A;  5BQU A;  2AQZ A;  4I8M A;  1FV2 A;  1AFC A;  4I1E A;  4II0 A;  3NBN A;  2MLL B;  2YUG A;  3FJE A;  2FO1 A;  1FWV A;  3O4B A;  1ISV A;  3CU1 B;  3WIN C;  1F31 A;  4G9N A;  4JRA A;  4OWL A;  4IYB A;  3V79 C;  3ILA A;  4OWK A;  5F8W A;  1SR4 A;  3FJC A;  3PUB A;  3SNV A;  3E8L C;  1EPW A;  1S0E A;  3AH2 A;  3PHZ A;  4EFQ A;  2VU9 A;  1CE7 B;  4LO2 A;  3ZXD A;  3FJF A;  1XG6 A;  1XHB A;  2ERM A;  3PME A;  2E4M C;  1BFB A;  4QC4 A;  4Q91 A;  4XFT A;  1HWM B;  41BI A;  2WRY A;  3I2A A;  1IOB A;  5DUY A;  1HCD A;  2VXR A;  2KKI A;  4I7I A;  3H6R B;  3UD9 A;  2HWA A;  1I1E A;  3PG0 A;  1XZZ A;  4QKS A;  1ISX A;  8I1B A;  1S0C A;  4ZLB B;  2UUS A;  4KC3 A;  3K1X A;  3OGG A;  4DEP A;  3H6R A;  4D8H A;  1OQL B;  1IHK A;  2KLL A;  3HAL A;  3O4A A;  2F2F A;  3QR5 A;  4KEK A;  3VUO A;  2RQ9 A;  3RTI B;  3CRI A;  3QYD A;  4JKQ A;  1KNM A;  5FNX A;  2D23 A;  4WBC A;  1UPS A;  4YOL A;  3S8K A;  4I4R A;  3P6I A;  1BFC A;  1EV2 A;  1PWA A;  4PC4 A;  2X2S A;  1IRP A;  1HWN B;  4H04 A;  3RMY A;  1DZC A;  3HSM A;  3A23 A;  3JUT A;  3FJI A;  1D0H A;  1DJS B;  3RTJ B;  4ION A;  4IY9 A;  2D24 A;  1RY7 A;  4ZFU B;  3HN1 A;  5DSS B;  3V0A B;  4ZFW B;  3O4C A;  4P0J A;  3D7W B;  3VSF A;  5FZU A;  4ISR A;  3O5W B;  3BRG C;  1G9C A;  4EFP A;  1G9D A;  1DFC A;  3BA5 A;  1K5V A;  1WD4 A;  4LO7 C;  1IRA X;  4DCK C;  2ESU A;  2ZQN A;  1TIE A;  3CA5 A;  2FFV A;  1PZZ A;  3VSZ A;  3EF2 A;  4AN6 A;  2VLC A;  1J0S A;  5FZZ A;  4EB2 B;  1HKN A;  4G1R A;  1RG8 A;  3NBE A;  3FGM A;  1JT7 A;  3H6S E;  2HW9 A;  3FJJ A;  3ZX7 A;  5DVH A;  5BXT A;  4JAW A;  4X37 A;  3T8S A;  2RST A;  3IM7 A;  4L4I A; 
#chains in the Genus database with same CATH homology
 1T4Q A;  4GOY A;  1WBA A;  1YXW A;  7I1B A;  3ZC8 A;  4OEG A;  5D63 A;  2NS2 A;  3AKH A;  4I96 A;  3WO4 A;  1JTC A;  2LIE A;  4EKX B;  4LO1 C;  3N0K A;  2MC2 A;  3BA4 A;  3AZV A;  1QQL A;  3UJ0 A;  4L4H A;  1RZO B;  4KBB A;  3FJB A;  3OBT A;  1S0B A;  5FNW A;  4D0Z A;  2D43 A;  2IWT B;  2KH2 A;  3P6J A;  3Q7Y A;  4G6J A;  4OUJ A;  2RG9 B;  1Q04 A;  1TTU A;  4ISQ A;  2D44 A;  2Y9G A;  1QQK A;  1R8O A;  4F34 A;  4MZH A;  1JT3 A;  4LO7 B;  3OJM A;  2Y9W C;  2BEA A;  1DZD A;  4I1B A;  3N7K A;  3NJ5 A;  2KI4 A;  3FFZ A;  2MIB A;  3V0B B;  3BAG A;  3RSJ A;  2D22 A;  4USO A;  4I4O A;  1TWM A;  1S0F A;  3OJV A;  3V0B A;  2M49 A;  1AVA C;  3RMX A;  3VWC A;  1BFF A;  5BP5 C;  3LTQ A;  2FFU A;  4I4X A;  1G9B A;  2NM1 A;  4G9M A;  3CA3 A;  4P6A A;  1VCL A;  4QAL A;  4I4V A;  1FMZ A;  3R4S A;  5G00 A;  5BXR A;  1FGA A;  3O3Q A;  4F83 A;  1V6X A;  3VT1 A;  2VSA A;  2QYI B;  3WMU A;  3AKI A;  1M2T B;  3UDA A;  3WO2 A;  4I4Y A;  3WO3 A;  3ZC9 A;  4MZG B;  4J2X A;  2K43 A;  2DRY A;  3BA7 A;  4IZX A;  1DFQ A;  1FWU A;  2HZ9 A;  5HPZ A;  4JP0 A;  3JRR A;  1TOO A;  4ZOT A;  4I0Y A;  4I4P A;  3BRD A;  3N7M A;  1JT4 A;  1HCE A;  1HIB A;  5EHA A;  1TP0 A;  1I1B A;  3BAD A;  3POK A;  4USP A;  1AF9 A;  3BX1 C;  5F90 A;  1DLL A;  1JLX A;  5F8S A;  1IIL A;  3WIN A;  4A7K A;  4LO3 C;  3I29 B;  3B9U A;  3CA0 A;  1WBC A;  3CQA A;  4H75 A;  4J23 B;  4LO0 C;  4X39 A;  3F1R A;  3P53 A;  3VT2 A;  2BFH A;  4ZFY B;  5E24 E;  2ZR1 B;  3V0A A;  1FV3 A;  3BAO A;  2E4M A;  5BQU C;  1K5U A;  3VEQ A;  5I1B A;  4J2S A;  1AVU A;  5BVP I;  3O44 A;  4A7Z A;  1MD6 A;  4IHZ A;  2AAI B;  1BA7 A;  2D20 A;  5BXS A;  3IIR A;  3FUO A;  3A07 A;  4QBV A;  4OEF A;  4CJM A;  5F8Y A;  4P0L A;  4FGF A;  1NUN A;  1PC8 B;  2ZQO A;  4J2Y A;  3AJ6 A;  2XOA A;  1S0D A;  3CA6 A;  1ISY A;  2VUA A;  4KEJ A;  5D62 A;  1W3F A;  1HWP B;  3HMY A;  1FMM S;  4G6M A;  31BI A;  2X2T A;  4OWJ A;  5FZY A;  3FUQ A;  1NZK A;  1P63 A;  1Z0H A;  4KEI A;  3CA1 A;  21BI A;  4ZA3 B;  2Q3N B;  1QXM A;  3FJA A;  1BFG A;  3FJK A;  1JLY A;  4Q9P A;  3BAQ A;  1TWE A;  3AH4 A;  1GGP B;  4ZGR B;  4IZE A;  1II4 A;  1BAR A;  1AVX B;  1JT5 A;  4QD2 C;  1TFM B;  2NYY A;  4LO3 A;  1Q1U A;  3BAU A;  3BAH A;  2F2F C;  1SZ6 B;  1ABR B;  3O49 A;  4FVV A;  1Q03 A;  6I1B A;  2GZB A;  4Q9G A;  3AZW A;  1YYN A;  2NZ9 A;  3I2X A;  4X3A A;  4GAF A;  1FN0 A;  2K4A B;  3CRG A;  3BTA A;  2FDB M;  2IHO A;  3AH1 A;  4JQ0 A;  2HWM A;  3BAV A;  2NTD A;  3O4O A;  1JQZ A;  1L2H A;  3F62 B;  2D7I A;  1IT0 A;  4UY4 A;  1BAS A;  3KMV A;  4ZKT B;  4EFR A;  5EG6 C;  4GP3 A;  2FGF A;  2Q9X A;  1YTO A;  5EC5 A;  1G9A A;  3WA1 A;  3NBC A;  4I4Q A;  3UD8 A;  2BEB A;  2Z49 A;  2LIQ A;  1ISZ A;  4QKR A;  4AN7 B;  2R9K B;  3OBR A;  3A21 A;  1EYL A;  1ITB A;  4DEN A;  2K8R A;  3AJ5 A;  4ZBV B;  1YBI A;  4TLP A;  3FJD A;  5DZU A;  2NP0 A;  2WBC A;  4LO1 A;  4HA2 A;  4A7Y A;  2D7R A;  2DRE A;  2DRZ A;  1CVS A;  4I3N A;  1FQ9 A;  2Z48 A;  4P0K A;  5JMC A;  4QD2 B;  1Z2V A;  1MC9 A;  2AFG A;  3TC2 A;  4HR6 C;  1DQG A;  4HJJ A;  3Q7X A;  3FJ9 A;  1ONK B;  1XYF A;  2GO2 A;  2L5X A;  2VXT I;  1ILR 1;  1HWO B;  2F8X C;  3H6Q A;  5BOW A;  3N7J A;  4IQP A;  1WD3 A;  1W3G A;  4JKX B;  4LO8 B;  1YF8 B;  1PUU B;  3A22 A;  3LLP A;  4D0T A;  3OGF A;  3CAH A;  4H9W A;  1DQO A;  4I4U A;  4I37 A;  4Z8S B;  1M16 A;  3AKF A;  4QBC A;  3BRF A;  2VSE A;  3FJ8 A;  1JY0 A;  1T9F A;  3MAL A;  5D61 A;  1PUM B;  5JLV A;  1Z4S A;  4Z9W B;  4MZF B;  1R8N A;  5BP5 A;  4I4S A;  1AXM A;  3S8J A;  2ET2 A;  5GAQ A;  3UD7 A;  5BXP A;  4XFU A;  2NVH A;  2I1B A;  1E0O A;  3R4U A;  1RML A;  2Y9X E;  3O4D A;  1A8D A;  1ISW A;  4XFS A;  3BB2 A;  4QO3 A;  3ZXG A;  4XKI A;  1N4K A;  3CA4 A;  4I6I A;  3CRH A;  1V6W A;  2KI6 B;  4GOV A;  4I2S A;  3UJ4 A;  3FJH A;  2Y9F A;  2AXM A;  9ILB A;  1SR4 C;  3HBW A;  1EVT A;  4J2K A;  2P39 A;  3HOM A;  1S0L A;  3NBD A;  4LO2 C;  4GAI A;  3W9T A;  3AKG A;  3Q7W A;  4X38 A;  4JPZ A;  2J3P A;  1IJT A;  4R6U B;  3C9Z A;  3IM5 A;  2DS0 A;  4GP0 A;  3IAG C;  1DIW A;  2D1Z A;  1V6U A;  4OW4 A;  4END A;  1BLA A;  2QN4 A;  3IM6 A;  3OJ2 A;  5B2H A;  1V6V A;  3MPP G;  4IY8 A;  1BLD A;  1AVW B;  1G82 A;  4EEE B;  4LO0 A;  1W3A A;  4OEE A;  2P23 A;  3N7L A;  3VT0 A;  1S0G A;  3WMV A;  5BQU A;  2AQZ A;  4I8M A;  1FV2 A;  1AFC A;  4I1E A;  4II0 A;  3NBN A;  2MLL B;  2YUG A;  3FJE A;  2FO1 A;  1FWV A;  3O4B A;  1ISV A;  3CU1 B;  3WIN C;  1F31 A;  4G9N A;  4JRA A;  4OWL A;  4IYB A;  3V79 C;  3ILA A;  4OWK A;  5F8W A;  1SR4 A;  3FJC A;  3PUB A;  3SNV A;  3E8L C;  1EPW A;  1S0E A;  3AH2 A;  3PHZ A;  4EFQ A;  2VU9 A;  1CE7 B;  4LO2 A;  3ZXD A;  3FJF A;  1XG6 A;  1XHB A;  2ERM A;  3PME A;  2E4M C;  1BFB A;  4QC4 A;  4Q91 A;  4XFT A;  1HWM B;  41BI A;  2WRY A;  3I2A A;  1IOB A;  5DUY A;  1HCD A;  2VXR A;  2KKI A;  4I7I A;  3H6R B;  3UD9 A;  2HWA A;  1I1E A;  3PG0 A;  1XZZ A;  4QKS A;  1ISX A;  8I1B A;  1S0C A;  4ZLB B;  2UUS A;  4KC3 A;  3K1X A;  3OGG A;  4DEP A;  3H6R A;  4D8H A;  1OQL B;  1IHK A;  2KLL A;  3HAL A;  3O4A A;  2F2F A;  3QR5 A;  4KEK A;  3VUO A;  2RQ9 A;  3RTI B;  3CRI A;  3QYD A;  4JKQ A;  1KNM A;  5FNX A;  2D23 A;  4WBC A;  1UPS A;  4YOL A;  3S8K A;  4I4R A;  3P6I A;  1BFC A;  1EV2 A;  1PWA A;  4PC4 A;  2X2S A;  1IRP A;  1HWN B;  4H04 A;  3RMY A;  1DZC A;  3HSM A;  3A23 A;  3JUT A;  3FJI A;  1D0H A;  1DJS B;  3RTJ B;  4ION A;  4IY9 A;  2D24 A;  1RY7 A;  4ZFU B;  3HN1 A;  5DSS B;  3V0A B;  4ZFW B;  3O4C A;  4P0J A;  3D7W B;  3VSF A;  5FZU A;  4ISR A;  3O5W B;  3BRG C;  1G9C A;  4EFP A;  1G9D A;  1DFC A;  3BA5 A;  1K5V A;  1WD4 A;  4LO7 C;  1IRA X;  4DCK C;  2ESU A;  2ZQN A;  1TIE A;  3CA5 A;  2FFV A;  1PZZ A;  3VSZ A;  3EF2 A;  4AN6 A;  2VLC A;  1J0S A;  5FZZ A;  4EB2 B;  1HKN A;  4G1R A;  1RG8 A;  3NBE A;  3FGM A;  1JT7 A;  3H6S E;  2HW9 A;  3FJJ A;  3ZX7 A;  5DVH A;  5BXT A;  4JAW A;  4X37 A;  3T8S A;  2RST A;  3IM7 A;  4L4I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...