1IJTA

Crystal structure of fibroblast growth factor 4 (fgf4)
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'GIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALGKNGKTKKGNRVSPTMKVTHFLPRL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords fibroblast growth factor 4
publication title Identification of receptor and heparin binding sites in fibroblast growth factor 4 by structure-based mutagenesis.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone/growth factor
total genus 31
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2001-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1ijtA00
4I4XA 1YTOA 2FFVA 3BTAA 5BQUC 2IWTB 3N0KA 3VT0A 1JLXA 3JUTA 1MD6A 2E4MA 3HSMA 1WBAA 1BFFA 2HWAA 4EFRA 2VU9A 1I1BA 4R6UB 3WINA 1YBIA 1N4KA 2HW9A 4A7YA 1IRAX 1BFCA 2LIQA 1NZKA 1Q03A 3V79C 1S0BA 3OGFA 5D62A 3VT2A 1CE7B 1TOOA 3AZWA 3D7WB 3BAGA 4LO0C 5BXRA 2VXTI 1II4A 41BIA 3A07A 4JP0A 4OWLA 4F34A 1DZCA 1M2TB 1IHKA 1JT5A 2NZ9A 3RMXA 1DZDA 4G6JA 1M16A 4QBCA 1PWAA 1JT7A 1XHBA 2I1BA 3F62B 3P6IA 4QD2C 1G9BA 3BA5A 4EFPA 3FJIA 2GO2A 1K5UA 1IT0A 2AQZA 2VXRA 4II0A 1TFMB 3CU1B 3AJ6A 4FGFA 1FWVA 4D0ZA 1Z4SA 2QYIB 4L4IA 3WO3A 2NP0A 2NTDA 2DRZA 3FJBA 3OGGA 4D0TA 1SR4A 5BXPA 1EVTA 1WD4A 2Y9GA 1RZOB 1W3FA 3FJAA 1UPSA 4J2XA 5DVHA 1V6XA 4I96A 3CA1A 3BAQA 3ZXGA 2AXMA 3AKGA 3O5WB 1AFCA 2VLCA 5FZYA 4LO3C 1CVSA 1ONKB 1R8NA 5F90A 2D44A 1I1EA 4GP0A 4PC4A 4X3AA 3ZC8A 1QQKA 4I1BA 3FJHA 4I4QA 3AKFA 4LO7C 2BFHA 3P53A 2M49A 2DRYA 4ZBVB 2D20A 1TWEA 1DJSB 2X2SA 1PZZA 2KLLA 3N7KA 1DQOA 1AVUA 1XYFA 3IAGC 4LO1C 3S8KA 1DFQA 2K4AB 5BXTA 2D7IA 4KC3A 1SR4C 4IY8A 4P6AA 5F8SA 1D0HA 3ZX7A 4ZFWB 1NUNA 3MALA 1HIBA 3OJ2A 3Q7WA 3IM7A 3V0AA 5DSSB 3HMYA 5GAQA 4I4SA 1AVWB 4A7KA 3QR5A 3HN1A 3RTJB 1S0GA 4DENA 3A22A 4JKQA 5JMCA 4ZFUB 4H9WA 2BEBA 4I8MA 1FN0A 1TP0A 3H6QA 1TIEA 3NBEA 3UD7A 1R8OA 4LO0A 4EEEB 2DREA 3FJDA 2VUAA 4DEPA 2K8RA 4IQPA 3WMUA 4IZXA 3RTIB 4HR6C 1JLYA 1WBCA 2AAIB 1DFCA 1S0FA 4QKSA 3RSJA 1JT3A 3Q7XA 5DZUA 4DCKC 1Q04A 3BX1C 1FWUA 1G9AA 2GZBA 3CQAA 5I1BA 3FJKA 3NJ5A 5BVPI 1F31A 1PC8B 2P39A 4OW4A 2XOAA 2F2FA 1W3AA 3VWCA 1IILA 1EYLA 3VEQA 4GP3A 1AXMA 4ZOTA 1VCLA 4EFQA 4QKRA 3ZC9A 4XFTA 3OJMA 2NM1A 4L4HA 1BLAA 2YUGA 3A21A 5F8YA 4G1RA 3HALA 1JT4A 2X2TA 3O44A 1T4QA 4J2SA 5BP5A 4LO3A 3WO2A 4Q91A 3B9UA 4AN6A 1AF9A 1DQGA 3C9ZA 3V0BB 5B2HA 3BA4A 2ESUA 1J0SA 2BEAA 3UD8A 2KKIA 3ZXDA 3CA4A 3Q7YA 3CA6A 3RMYA 4J2YA 4KEJA 3IIRA 3AKIA 4I4YA 4JRAA 1ISYA 1BARA 3NBNA 4LO1A 3SNVA 3IM6A 2F2FC 1A8DA 4XKIA 2D43A 3POKA 1W3GA 3EF2A 3VT1A 4P0JA 4GOYA 4IYBA 4LO2C 4IZEA 2K43A 5EG6C 1IJTA 5G00A 1WD3A 1V6VA 5BP5C 4EB2B 3UD9A 2AFGA 4ISRA 4P0LA 3O4OA 3CRIA 1K5VA 2Z49A 2ERMA 4F83A 1Q1UA 4USPA 2D7RA 2D22A 4G6MA 4ZKTB 4QO3A 2Q9XA 2Y9FA 1FMZA 3FUQA 3LLPA 3R4SA 3A23A 5F8WA 1DIWA 1V6WA 4J23B 1HWNB 3H6RB 1AVXB 1BFBA 1V6UA 1RMLA 3R4UA 4KEIA 3WA1A 2Y9XE 4I0YA 1HWMB 4AN7B 3E8LC 3I29B 4I3NA 2P23A 4I37A 3AKHA 3O4BA 2HZ9A 1QQLA 5BOWA 2QN4A 3FUOA 5HPZA 1BASA 3CAHA 4ZLBB 1S0LA 2MC2A 1XG6A 2NYYA 3BRGC 5E24E 1OQLB 3NBDA 3FJ8A 2MIBA 3CA5A 7I1BA 1FGAA 2HWMA 2WRYA 4QBVA 1HKNA 3VSZA 2Z48A 3WMVA 4Q9PA 1FV2A 3CA3A 2FFUA 4X39A 4TLPA 4XFUA 3N7JA 2Y9WC 2MLLB 1ITBA 5BXSA 1P63A 3UDAA 3I2AA 3OBRA 1G9CA 2VSAA 31BIA 4FVVA 1FMMS 2KI4A 2NVHA 4OEGA 3TC2A 5JLVA 3V0BA 3CA0A 3V0AB 1S0EA 3IM5A 3T8SA 1YF8B 2Q3NB 1GGPB 4I6IA 1JQZA 3QYDA 4LO2A 1S0DA 1RG8A 4I1EA 3P6JA 4I2SA 4GAIA 3N7MA 4I7IA 1ISXA 8I1BA 3BAHA 3HBWA 4P0KA 3HOMA 4HA2A 1ILR1 3PHZA 3S8JA 2J3PA 1BA7A 1DLLA 3PG0A 4CJMA 1Z2VA 3K1XA 4KBBA 4GAFA 4XFSA 3AH1A 1BFGA 3I2XA 4OEEA 1XZZA 3ILAA 4G9NA 3O4CA 1TTUA 4QD2B 4GOVA 3PUBA 3AH4A 1ABRB 3AJ5A 1FV3A 1YXWA 3FFZA 4EKXB 4I4VA 4JPZA 3BA7A 2UUSA 2ZQNA 4I4PA 3BADA 3BB2A 3NBCA 6I1BA 3CRGA 4OEFA 4Z9WB 3H6RA 2D1ZA 3VUOA 1S0CA 1HCEA 1JTCA 5EHAA 2RSTA 3N7LA 2E4MC 1ISZA 4QALA 1L2HA 4ZGRB 1ISWA 1G82A 21BIA 4OWJA 4X37A 3WINC 3OJVA 4G9MA 3FJ9A 3BRDA 3BRFA 1HWOB 1MC9A 4I4RA 2VSEA 2D24A 3PMEA 3W9TA 3O49A 4JQ0A 4H04A 1QXMA 4USOA 4J2KA 1T9FA 2R9KB 1E0OA 2KI6B 3BAUA 3OBTA 4LO7B 2F8XC 3LTQA 4IY9A 3FJEA 5FNXA 3FJFA 4IHZA 2D23A 4LO8B 1YYNA 3H6SE 4Q9GA 4D8HA 2KH2A 4ZA3B 1Z0HA 1IOBA 3O4AA 2FGFA 4JKXB 5D61A 1PUUB 1JY0A 3MPPG 3VSFA 2RQ9A 1EPWA 3FGMA 2ET2A 4I4UA 1ISVA 4QC4A 4Z8SB 1KNMA 5D63A 4OUJA 5FNWA 5FZZA 5FZUA 3UJ0A 1HWPB 3FJJA 1PUMB 3O4DA 4JAWA 3AH2A 3O3QA 3BAVA 1IRPA 5BQUA 4I4OA 4WBCA 3UJ4A 2WBCA 4ENDA 3JRRA 4X38A 4A7ZA 1HCDA 3FJCA 2ZQOA 1TWMA 2L5XA 5DUYA 3KMVA 3CRHA 4OWKA 4HJJA 2FO1A 4IONA 2ZR1B 4YOLA 3AZVA 1EV2A 1SZ6B 1RY7A 3BAOA 3WO4A 4ISQA 4ZFYB 2LIEA 4KEKA 5EC5A 2FDBM 1BLDA 1AVAC 3F1RA 2RG9B 2DS0A 1FQ9A 9ILBA 1G9DA 2IHOA
chains in the Genus database with same CATH superfamily
4I4XA 1YTOA 2FFVA 3BTAA 5BQUC 2IWTB 3N0KA 3VT0A 1JLXA 3JUTA 1MD6A 2E4MA 3HSMA 1WBAA 1BFFA 2HWAA 4EFRA 2VU9A 1I1BA 4R6UB 3WINA 1YBIA 1N4KA 2HW9A 4A7YA 1IRAX 1BFCA 2LIQA 1NZKA 1Q03A 3V79C 1S0BA 3OGFA 5D62A 3VT2A 1CE7B 1TOOA 3AZWA 3D7WB 3BAGA 4LO0C 5BXRA 2VXTI 1II4A 41BIA 3A07A 4JP0A 4OWLA 4F34A 1DZCA 1M2TB 1IHKA 1JT5A 2NZ9A 3RMXA 1DZDA 4G6JA 1M16A 4QBCA 1PWAA 1JT7A 1XHBA 2I1BA 3F62B 3P6IA 4QD2C 1G9BA 3BA5A 4EFPA 3FJIA 2GO2A 1K5UA 1IT0A 2AQZA 2VXRA 4II0A 1TFMB 3CU1B 3AJ6A 4FGFA 1FWVA 4D0ZA 1Z4SA 2QYIB 4L4IA 3WO3A 2NP0A 2NTDA 2DRZA 3FJBA 3OGGA 4MZGB 4D0TA 1SR4A 5BXPA 1EVTA 1WD4A 2Y9GA 1RZOB 1W3FA 3FJAA 1UPSA 4J2XA 5DVHA 1V6XA 4I96A 3CA1A 3BAQA 3ZXGA 4H75A 2AXMA 3AKGA 3O5WB 1AFCA 2VLCA 5FZYA 4LO3C 1CVSA 1ONKB 1R8NA 5F90A 2D44A 1I1EA 4GP0A 4PC4A 4X3AA 3ZC8A 1QQKA 4I1BA 3FJHA 4I4QA 3AKFA 4LO7C 2BFHA 3P53A 2M49A 2DRYA 4ZBVB 2D20A 1TWEA 1DJSB 2X2SA 1PZZA 2KLLA 3N7KA 1DQOA 1AVUA 1XYFA 3IAGC 4LO1C 3S8KA 1DFQA 2K4AB 5BXTA 2D7IA 4KC3A 1SR4C 4IY8A 4P6AA 5F8SA 1D0HA 3ZX7A 4ZFWB 1NUNA 3MALA 1HIBA 3OJ2A 3Q7WA 3IM7A 3V0AA 5DSSB 3HMYA 5GAQA 4I4SA 1AVWB 4A7KA 3QR5A 3HN1A 3RTJB 1S0GA 2NS2A 4DENA 3A22A 4JKQA 5JMCA 4ZFUB 4H9WA 2BEBA 4I8MA 1FN0A 1TP0A 3H6QA 1TIEA 3NBEA 3UD7A 1R8OA 4LO0A 4EEEB 2DREA 3FJDA 2VUAA 4DEPA 2K8RA 4IQPA 3WMUA 4IZXA 3RTIB 4HR6C 1JLYA 1WBCA 2AAIB 1DFCA 1S0FA 4QKSA 3RSJA 1JT3A 3Q7XA 5DZUA 4DCKC 1Q04A 3BX1C 1FWUA 1G9AA 2GZBA 3CQAA 5I1BA 3FJKA 3NJ5A 5BVPI 1F31A 1PC8B 2P39A 4OW4A 2XOAA 2F2FA 1W3AA 3VWCA 1IILA 1EYLA 3VEQA 4GP3A 1AXMA 4ZOTA 1VCLA 4EFQA 4QKRA 3ZC9A 4XFTA 3OJMA 2NM1A 4L4HA 1BLAA 2YUGA 3A21A 5F8YA 4G1RA 3HALA 1JT4A 2X2TA 3O44A 1T4QA 4J2SA 5BP5A 4LO3A 3WO2A 4Q91A 3B9UA 4AN6A 1AF9A 1DQGA 3C9ZA 3V0BB 5B2HA 3BA4A 2ESUA 1J0SA 2BEAA 3UD8A 2KKIA 3ZXDA 3CA4A 3Q7YA 3CA6A 3RMYA 4J2YA 4KEJA 3IIRA 3AKIA 4I4YA 4JRAA 1ISYA 1BARA 3NBNA 4LO1A 3SNVA 3IM6A 2F2FC 1A8DA 4XKIA 2D43A 3POKA 1W3GA 3EF2A 3VT1A 4P0JA 4GOYA 4IYBA 4LO2C 4IZEA 2K43A 5EG6C 1IJTA 5G00A 1WD3A 1V6VA 5BP5C 4EB2B 3UD9A 2AFGA 4ISRA 4P0LA 3O4OA 3CRIA 1K5VA 2Z49A 2ERMA 4F83A 1Q1UA 4USPA 2D7RA 2D22A 4G6MA 4ZKTB 4QO3A 2Q9XA 2Y9FA 1FMZA 3FUQA 3LLPA 3R4SA 3A23A 5F8WA 1DIWA 1V6WA 4J23B 1HWNB 3H6RB 1AVXB 1BFBA 1V6UA 1RMLA 3R4UA 4KEIA 3WA1A 2Y9XE 4I0YA 1HWMB 4AN7B 3E8LC 3I29B 4I3NA 2P23A 4I37A 3AKHA 3O4BA 2HZ9A 1QQLA 5BOWA 2QN4A 3FUOA 5HPZA 1BASA 3CAHA 4ZLBB 1S0LA 2MC2A 1XG6A 2NYYA 3BRGC 5E24E 1OQLB 3NBDA 3FJ8A 2MIBA 3CA5A 7I1BA 1FGAA 2HWMA 2WRYA 4QBVA 1HKNA 3VSZA 2Z48A 3WMVA 4Q9PA 1FV2A 3CA3A 2FFUA 4X39A 4TLPA 4MZHA 4XFUA 3N7JA 2Y9WC 2MLLB 1ITBA 5BXSA 1P63A 3UDAA 3I2AA 3OBRA 1G9CA 2VSAA 31BIA 4FVVA 1FMMS 2KI4A 2NVHA 4OEGA 3TC2A 5JLVA 3V0BA 3CA0A 3V0AB 1S0EA 3IM5A 3T8SA 1YF8B 2Q3NB 1GGPB 4I6IA 1JQZA 3QYDA 4LO2A 1S0DA 1RG8A 4I1EA 3P6JA 4I2SA 4GAIA 3N7MA 4I7IA 1ISXA 8I1BA 3BAHA 3HBWA 4P0KA 3HOMA 4HA2A 1ILR1 3PHZA 3S8JA 2J3PA 1BA7A 1DLLA 3PG0A 4CJMA 1Z2VA 3K1XA 4KBBA 4GAFA 4XFSA 3AH1A 1BFGA 3I2XA 4OEEA 1XZZA 3ILAA 4G9NA 3O4CA 1TTUA 4QD2B 4GOVA 3PUBA 3AH4A 1ABRB 3AJ5A 1FV3A 1YXWA 3FFZA 4EKXB 4I4VA 4JPZA 3BA7A 2UUSA 2ZQNA 4I4PA 3BADA 3BB2A 3NBCA 6I1BA 3CRGA 4OEFA 4Z9WB 3H6RA 2D1ZA 3VUOA 1S0CA 1HCEA 1JTCA 4MZFB 5EHAA 2RSTA 3N7LA 2E4MC 1ISZA 4QALA 1L2HA 4ZGRB 1ISWA 1G82A 21BIA 4OWJA 4X37A 3WINC 3OJVA 4G9MA 3FJ9A 3BRDA 3BRFA 1HWOB 1MC9A 4I4RA 2VSEA 2D24A 3PMEA 3W9TA 3O49A 4JQ0A 4H04A 1QXMA 4USOA 4J2KA 1T9FA 2R9KB 1E0OA 2KI6B 3BAUA 3OBTA 4LO7B 2F8XC 3LTQA 4IY9A 3FJEA 5FNXA 3FJFA 4IHZA 2D23A 4LO8B 1YYNA 3H6SE 4Q9GA 4D8HA 2KH2A 4ZA3B 1Z0HA 1IOBA 3O4AA 2FGFA 4JKXB 5D61A 1PUUB 1JY0A 3MPPG 3VSFA 2RQ9A 1EPWA 3FGMA 2ET2A 4I4UA 1ISVA 4QC4A 4Z8SB 1KNMA 5D63A 4OUJA 5FNWA 5FZZA 5FZUA 3UJ0A 1HWPB 3FJJA 1PUMB 3O4DA 4JAWA 3AH2A 3O3QA 3BAVA 1IRPA 5BQUA 4I4OA 4WBCA 3UJ4A 2WBCA 4ENDA 3JRRA 4X38A 4A7ZA 1HCDA 3FJCA 2ZQOA 1TWMA 2L5XA 5DUYA 3KMVA 4UY4A 3CRHA 4OWKA 4HJJA 2FO1A 4IONA 2ZR1B 4YOLA 3AZVA 1EV2A 1SZ6B 1RY7A 3BAOA 3WO4A 4ISQA 4ZFYB 2LIEA 4KEKA 5EC5A 2FDBM 1BLDA 1AVAC 3F1RA 2RG9B 2DS0A 1FQ9A 9ILBA 1G9DA 2IHOA
chains in the Genus database with same CATH topology
4I4XA 1YTOA 2FFVA 3BTAA 5BQUC 2IWTB 3N0KA 3VT0A 1JLXA 3JUTA 1MD6A 2E4MA 3HSMA 1WBAA 1BFFA 2HWAA 4EFRA 2VU9A 1I1BA 4R6UB 3WINA 1YBIA 1N4KA 2HW9A 4A7YA 1IRAX 1BFCA 2LIQA 1NZKA 1Q03A 3V79C 1S0BA 3OGFA 5D62A 3VT2A 1CE7B 1TOOA 3AZWA 3D7WB 3BAGA 4LO0C 5BXRA 2VXTI 1II4A 41BIA 3A07A 4JP0A 4OWLA 4F34A 1DZCA 1M2TB 1IHKA 1JT5A 2NZ9A 3RMXA 1DZDA 4G6JA 1M16A 4QBCA 1PWAA 1JT7A 1XHBA 2I1BA 3F62B 3P6IA 4QD2C 1G9BA 3BA5A 4EFPA 3FJIA 2GO2A 1K5UA 1IT0A 2AQZA 2VXRA 4II0A 1TFMB 3CU1B 3AJ6A 4FGFA 1FWVA 4D0ZA 1Z4SA 2QYIB 4L4IA 3WO3A 2NP0A 2NTDA 2DRZA 3FJBA 3OGGA 4MZGB 4D0TA 1SR4A 5BXPA 1EVTA 1WD4A 2Y9GA 1RZOB 1W3FA 3FJAA 1UPSA 4J2XA 5DVHA 1V6XA 4I96A 3CA1A 3BAQA 3ZXGA 4H75A 2AXMA 3AKGA 3O5WB 1AFCA 2VLCA 5FZYA 4LO3C 1CVSA 1ONKB 1R8NA 5F90A 2D44A 1I1EA 4GP0A 4PC4A 4X3AA 3ZC8A 1QQKA 4I1BA 3FJHA 4I4QA 3AKFA 4LO7C 2BFHA 3P53A 2M49A 2DRYA 4ZBVB 2D20A 1TWEA 1DJSB 2X2SA 1PZZA 2KLLA 3N7KA 1DQOA 1AVUA 1XYFA 3IAGC 4LO1C 3S8KA 1DFQA 2K4AB 5BXTA 2D7IA 4KC3A 1SR4C 4IY8A 4P6AA 5F8SA 1D0HA 3ZX7A 4ZFWB 1NUNA 3MALA 1HIBA 3OJ2A 3Q7WA 3IM7A 3V0AA 5DSSB 3HMYA 5GAQA 4I4SA 1AVWB 4A7KA 3QR5A 3HN1A 3RTJB 1S0GA 2NS2A 4DENA 3A22A 4JKQA 5JMCA 4ZFUB 4H9WA 2BEBA 4I8MA 1FN0A 1TP0A 3H6QA 1TIEA 3NBEA 3UD7A 1R8OA 4LO0A 4EEEB 2DREA 3FJDA 2VUAA 4DEPA 2K8RA 4IQPA 3WMUA 4IZXA 3RTIB 4HR6C 1JLYA 1WBCA 2AAIB 1DFCA 1S0FA 4QKSA 3RSJA 1JT3A 3Q7XA 5DZUA 4DCKC 1Q04A 3BX1C 1FWUA 1G9AA 2GZBA 3CQAA 5I1BA 3FJKA 3NJ5A 5BVPI 1F31A 1PC8B 2P39A 4OW4A 2XOAA 2F2FA 1W3AA 3VWCA 1IILA 1EYLA 3VEQA 4GP3A 1AXMA 4ZOTA 1VCLA 4EFQA 4QKRA 3ZC9A 4XFTA 3OJMA 2NM1A 4L4HA 1BLAA 2YUGA 3A21A 5F8YA 4G1RA 3HALA 1JT4A 2X2TA 3O44A 1T4QA 4J2SA 5BP5A 4LO3A 3WO2A 4Q91A 3B9UA 4AN6A 1AF9A 1DQGA 3C9ZA 3V0BB 5B2HA 3BA4A 2ESUA 1J0SA 2BEAA 3UD8A 2KKIA 3ZXDA 3CA4A 3Q7YA 3CA6A 3RMYA 4J2YA 4KEJA 3IIRA 3AKIA 4I4YA 4JRAA 1ISYA 1BARA 3NBNA 4LO1A 3SNVA 3IM6A 2F2FC 1A8DA 4XKIA 2D43A 3POKA 1W3GA 3EF2A 3VT1A 4P0JA 4GOYA 4IYBA 4LO2C 4IZEA 2K43A 5EG6C 1IJTA 5G00A 1WD3A 1V6VA 5BP5C 4EB2B 3UD9A 2AFGA 4ISRA 4P0LA 3O4OA 3CRIA 1K5VA 2Z49A 2ERMA 4F83A 1Q1UA 4USPA 2D7RA 2D22A 4G6MA 4ZKTB 4QO3A 2Q9XA 2Y9FA 1FMZA 3FUQA 3LLPA 3R4SA 3A23A 5F8WA 1DIWA 1V6WA 4J23B 1HWNB 3H6RB 1AVXB 1BFBA 1V6UA 1RMLA 3R4UA 4KEIA 3WA1A 2Y9XE 4I0YA 1HWMB 4AN7B 3E8LC 3I29B 4I3NA 2P23A 4I37A 3AKHA 3O4BA 2HZ9A 1QQLA 5BOWA 2QN4A 3FUOA 5HPZA 1BASA 3CAHA 4ZLBB 1S0LA 2MC2A 1XG6A 2NYYA 3BRGC 5E24E 1OQLB 3NBDA 3FJ8A 2MIBA 3CA5A 7I1BA 1FGAA 2HWMA 2WRYA 4QBVA 1HKNA 3VSZA 2Z48A 3WMVA 4Q9PA 1FV2A 3CA3A 2FFUA 4X39A 4TLPA 4MZHA 4XFUA 3N7JA 2Y9WC 2MLLB 1ITBA 5BXSA 1P63A 3UDAA 3I2AA 3OBRA 1G9CA 2VSAA 31BIA 4FVVA 1FMMS 2KI4A 2NVHA 4OEGA 3TC2A 5JLVA 3V0BA 3CA0A 3V0AB 1S0EA 3IM5A 3T8SA 1YF8B 2Q3NB 1GGPB 4I6IA 1JQZA 3QYDA 4LO2A 1S0DA 1RG8A 4I1EA 3P6JA 4I2SA 4GAIA 3N7MA 4I7IA 1ISXA 8I1BA 3BAHA 3HBWA 4P0KA 3HOMA 4HA2A 1ILR1 3PHZA 3S8JA 2J3PA 1BA7A 1DLLA 3PG0A 4CJMA 1Z2VA 3K1XA 4KBBA 4GAFA 4XFSA 3AH1A 1BFGA 3I2XA 4OEEA 1XZZA 3ILAA 4G9NA 3O4CA 1TTUA 4QD2B 4GOVA 3PUBA 3AH4A 1ABRB 3AJ5A 1FV3A 1YXWA 3FFZA 4EKXB 4I4VA 4JPZA 3BA7A 2UUSA 2ZQNA 4I4PA 3BADA 3BB2A 3NBCA 6I1BA 3CRGA 4OEFA 4Z9WB 3H6RA 2D1ZA 3VUOA 1S0CA 1HCEA 1JTCA 4MZFB 5EHAA 2RSTA 3N7LA 2E4MC 1ISZA 4QALA 1L2HA 4ZGRB 1ISWA 1G82A 21BIA 4OWJA 4X37A 3WINC 3OJVA 4G9MA 3FJ9A 3BRDA 3BRFA 1HWOB 1MC9A 4I4RA 2VSEA 2D24A 3PMEA 3W9TA 3O49A 4JQ0A 4H04A 1QXMA 4USOA 4J2KA 1T9FA 2R9KB 1E0OA 2KI6B 3BAUA 3OBTA 4LO7B 2F8XC 3LTQA 4IY9A 3FJEA 5FNXA 3FJFA 4IHZA 2D23A 4LO8B 1YYNA 3H6SE 4Q9GA 4D8HA 2KH2A 4ZA3B 1Z0HA 1IOBA 3O4AA 2FGFA 4JKXB 5D61A 1PUUB 1JY0A 3MPPG 3VSFA 2RQ9A 1EPWA 3FGMA 2ET2A 4I4UA 1ISVA 4QC4A 4Z8SB 1KNMA 5D63A 4OUJA 5FNWA 5FZZA 5FZUA 3UJ0A 1HWPB 3FJJA 1PUMB 3O4DA 4JAWA 3AH2A 3O3QA 3BAVA 1IRPA 5BQUA 4I4OA 4WBCA 3UJ4A 2WBCA 4ENDA 3JRRA 4X38A 4A7ZA 1HCDA 3FJCA 2ZQOA 1TWMA 2L5XA 5DUYA 3KMVA 4UY4A 3CRHA 4OWKA 4HJJA 2FO1A 4IONA 2ZR1B 4YOLA 3AZVA 1EV2A 1SZ6B 1RY7A 3BAOA 3WO4A 4ISQA 4ZFYB 2LIEA 4KEKA 5EC5A 2FDBM 1BLDA 1AVAC 3F1RA 2RG9B 2DS0A 1FQ9A 9ILBA 1G9DA 2IHOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I4X A;  1YTO A;  2FFV A;  3BTA A;  5BQU C;  2IWT B;  3N0K A;  3VT0 A;  1JLX A;  3JUT A;  1MD6 A;  2E4M A;  3HSM A;  1WBA A;  1BFF A;  2HWA A;  4EFR A;  2VU9 A;  1I1B A;  4R6U B;  3WIN A;  1YBI A;  1N4K A;  2HW9 A;  4A7Y A;  1IRA X;  1BFC A;  2LIQ A;  1NZK A;  1Q03 A;  3V79 C;  1S0B A;  3OGF A;  5D62 A;  3VT2 A;  1CE7 B;  1TOO A;  3AZW A;  3D7W B;  3BAG A;  4LO0 C;  5BXR A;  2VXT I;  1II4 A;  41BI A;  3A07 A;  4JP0 A;  4OWL A;  4F34 A;  1DZC A;  1M2T B;  1IHK A;  1JT5 A;  2NZ9 A;  3RMX A;  1DZD A;  4G6J A;  1M16 A;  4QBC A;  1PWA A;  1JT7 A;  1XHB A;  2I1B A;  3F62 B;  3P6I A;  4QD2 C;  1G9B A;  3BA5 A;  4EFP A;  3FJI A;  2GO2 A;  1K5U A;  1IT0 A;  2AQZ A;  2VXR A;  4II0 A;  1TFM B;  3CU1 B;  3AJ6 A;  4FGF A;  1FWV A;  4D0Z A;  1Z4S A;  2QYI B;  4L4I A;  3WO3 A;  2NP0 A;  2NTD A;  2DRZ A;  3FJB A;  3OGG A;  4D0T A;  1SR4 A;  5BXP A;  1EVT A;  1WD4 A;  2Y9G A;  1RZO B;  1W3F A;  3FJA A;  1UPS A;  4J2X A;  5DVH A;  1V6X A;  4I96 A;  3CA1 A;  3BAQ A;  3ZXG A;  2AXM A;  3AKG A;  3O5W B;  1AFC A;  2VLC A;  5FZY A;  4LO3 C;  1CVS A;  1ONK B;  1R8N A;  5F90 A;  2D44 A;  1I1E A;  4GP0 A;  4PC4 A;  4X3A A;  3ZC8 A;  1QQK A;  4I1B A;  3FJH A;  4I4Q A;  3AKF A;  4LO7 C;  2BFH A;  3P53 A;  2M49 A;  2DRY A;  4ZBV B;  2D20 A;  1TWE A;  1DJS B;  2X2S A;  1PZZ A;  2KLL A;  3N7K A;  1DQO A;  1AVU A;  1XYF A;  3IAG C;  4LO1 C;  3S8K A;  1DFQ A;  2K4A B;  5BXT A;  2D7I A;  4KC3 A;  1SR4 C;  4IY8 A;  4P6A A;  5F8S A;  1D0H A;  3ZX7 A;  4ZFW B;  1NUN A;  3MAL A;  1HIB A;  3OJ2 A;  3Q7W A;  3IM7 A;  3V0A A;  5DSS B;  3HMY A;  5GAQ A;  4I4S A;  1AVW B;  4A7K A;  3QR5 A;  3HN1 A;  3RTJ B;  1S0G A;  4DEN A;  3A22 A;  4JKQ A;  5JMC A;  4ZFU B;  4H9W A;  2BEB A;  4I8M A;  1FN0 A;  1TP0 A;  3H6Q A;  1TIE A;  3NBE A;  3UD7 A;  1R8O A;  4LO0 A;  4EEE B;  2DRE A;  3FJD A;  2VUA A;  4DEP A;  2K8R A;  4IQP A;  3WMU A;  4IZX A;  3RTI B;  4HR6 C;  1JLY A;  1WBC A;  2AAI B;  1DFC A;  1S0F A;  4QKS A;  3RSJ A;  1JT3 A;  3Q7X A;  5DZU A;  4DCK C;  1Q04 A;  3BX1 C;  1FWU A;  1G9A A;  2GZB A;  3CQA A;  5I1B A;  3FJK A;  3NJ5 A;  5BVP I;  1F31 A;  1PC8 B;  2P39 A;  4OW4 A;  2XOA A;  2F2F A;  1W3A A;  3VWC A;  1IIL A;  1EYL A;  3VEQ A;  4GP3 A;  1AXM A;  4ZOT A;  1VCL A;  4EFQ A;  4QKR A;  3ZC9 A;  4XFT A;  3OJM A;  2NM1 A;  4L4H A;  1BLA A;  2YUG A;  3A21 A;  5F8Y A;  4G1R A;  3HAL A;  1JT4 A;  2X2T A;  3O44 A;  1T4Q A;  4J2S A;  5BP5 A;  4LO3 A;  3WO2 A;  4Q91 A;  3B9U A;  4AN6 A;  1AF9 A;  1DQG A;  3C9Z A;  3V0B B;  5B2H A;  3BA4 A;  2ESU A;  1J0S A;  2BEA A;  3UD8 A;  2KKI A;  3ZXD A;  3CA4 A;  3Q7Y A;  3CA6 A;  3RMY A;  4J2Y A;  4KEJ A;  3IIR A;  3AKI A;  4I4Y A;  4JRA A;  1ISY A;  1BAR A;  3NBN A;  4LO1 A;  3SNV A;  3IM6 A;  2F2F C;  1A8D A;  4XKI A;  2D43 A;  3POK A;  1W3G A;  3EF2 A;  3VT1 A;  4P0J A;  4GOY A;  4IYB A;  4LO2 C;  4IZE A;  2K43 A;  5EG6 C;  1IJT A;  5G00 A;  1WD3 A;  1V6V A;  5BP5 C;  4EB2 B;  3UD9 A;  2AFG A;  4ISR A;  4P0L A;  3O4O A;  3CRI A;  1K5V A;  2Z49 A;  2ERM A;  4F83 A;  1Q1U A;  4USP A;  2D7R A;  2D22 A;  4G6M A;  4ZKT B;  4QO3 A;  2Q9X A;  2Y9F A;  1FMZ A;  3FUQ A;  3LLP A;  3R4S A;  3A23 A;  5F8W A;  1DIW A;  1V6W A;  4J23 B;  1HWN B;  3H6R B;  1AVX B;  1BFB A;  1V6U A;  1RML A;  3R4U A;  4KEI A;  3WA1 A;  2Y9X E;  4I0Y A;  1HWM B;  4AN7 B;  3E8L C;  3I29 B;  4I3N A;  2P23 A;  4I37 A;  3AKH A;  3O4B A;  2HZ9 A;  1QQL A;  5BOW A;  2QN4 A;  3FUO A;  5HPZ A;  1BAS A;  3CAH A;  4ZLB B;  1S0L A;  2MC2 A;  1XG6 A;  2NYY A;  3BRG C;  5E24 E;  1OQL B;  3NBD A;  3FJ8 A;  2MIB A;  3CA5 A;  7I1B A;  1FGA A;  2HWM A;  2WRY A;  4QBV A;  1HKN A;  3VSZ A;  2Z48 A;  3WMV A;  4Q9P A;  1FV2 A;  3CA3 A;  2FFU A;  4X39 A;  4TLP A;  4XFU A;  3N7J A;  2Y9W C;  2MLL B;  1ITB A;  5BXS A;  1P63 A;  3UDA A;  3I2A A;  3OBR A;  1G9C A;  2VSA A;  31BI A;  4FVV A;  1FMM S;  2KI4 A;  2NVH A;  4OEG A;  3TC2 A;  5JLV A;  3V0B A;  3CA0 A;  3V0A B;  1S0E A;  3IM5 A;  3T8S A;  1YF8 B;  2Q3N B;  1GGP B;  4I6I A;  1JQZ A;  3QYD A;  4LO2 A;  1S0D A;  1RG8 A;  4I1E A;  3P6J A;  4I2S A;  4GAI A;  3N7M A;  4I7I A;  1ISX A;  8I1B A;  3BAH A;  3HBW A;  4P0K A;  3HOM A;  4HA2 A;  1ILR 1;  3PHZ A;  3S8J A;  2J3P A;  1BA7 A;  1DLL A;  3PG0 A;  4CJM A;  1Z2V A;  3K1X A;  4KBB A;  4GAF A;  4XFS A;  3AH1 A;  1BFG A;  3I2X A;  4OEE A;  1XZZ A;  3ILA A;  4G9N A;  3O4C A;  1TTU A;  4QD2 B;  4GOV A;  3PUB A;  3AH4 A;  1ABR B;  3AJ5 A;  1FV3 A;  1YXW A;  3FFZ A;  4EKX B;  4I4V A;  4JPZ A;  3BA7 A;  2UUS A;  2ZQN A;  4I4P A;  3BAD A;  3BB2 A;  3NBC A;  6I1B A;  3CRG A;  4OEF A;  4Z9W B;  3H6R A;  2D1Z A;  3VUO A;  1S0C A;  1HCE A;  1JTC A;  5EHA A;  2RST A;  3N7L A;  2E4M C;  1ISZ A;  4QAL A;  1L2H A;  4ZGR B;  1ISW A;  1G82 A;  21BI A;  4OWJ A;  4X37 A;  3WIN C;  3OJV A;  4G9M A;  3FJ9 A;  3BRD A;  3BRF A;  1HWO B;  1MC9 A;  4I4R A;  2VSE A;  2D24 A;  3PME A;  3W9T A;  3O49 A;  4JQ0 A;  4H04 A;  1QXM A;  4USO A;  4J2K A;  1T9F A;  2R9K B;  1E0O A;  2KI6 B;  3BAU A;  3OBT A;  4LO7 B;  2F8X C;  3LTQ A;  4IY9 A;  3FJE A;  5FNX A;  3FJF A;  4IHZ A;  2D23 A;  4LO8 B;  1YYN A;  3H6S E;  4Q9G A;  4D8H A;  2KH2 A;  4ZA3 B;  1Z0H A;  1IOB A;  3O4A A;  2FGF A;  4JKX B;  5D61 A;  1PUU B;  1JY0 A;  3MPP G;  3VSF A;  2RQ9 A;  1EPW A;  3FGM A;  2ET2 A;  4I4U A;  1ISV A;  4QC4 A;  4Z8S B;  1KNM A;  5D63 A;  4OUJ A;  5FNW A;  5FZZ A;  5FZU A;  3UJ0 A;  1HWP B;  3FJJ A;  1PUM B;  3O4D A;  4JAW A;  3AH2 A;  3O3Q A;  3BAV A;  1IRP A;  5BQU A;  4I4O A;  4WBC A;  3UJ4 A;  2WBC A;  4END A;  3JRR A;  4X38 A;  4A7Z A;  1HCD A;  3FJC A;  2ZQO A;  1TWM A;  2L5X A;  5DUY A;  3KMV A;  3CRH A;  4OWK A;  4HJJ A;  2FO1 A;  4ION A;  2ZR1 B;  4YOL A;  3AZV A;  1EV2 A;  1SZ6 B;  1RY7 A;  3BAO A;  3WO4 A;  4ISQ A;  4ZFY B;  2LIE A;  4KEK A;  5EC5 A;  2FDB M;  1BLD A;  1AVA C;  3F1R A;  2RG9 B;  2DS0 A;  1FQ9 A;  9ILB A;  1G9D A;  2IHO A; 
#chains in the Genus database with same CATH topology
 4I4X A;  1YTO A;  2FFV A;  3BTA A;  5BQU C;  2IWT B;  3N0K A;  3VT0 A;  1JLX A;  3JUT A;  1MD6 A;  2E4M A;  3HSM A;  1WBA A;  1BFF A;  2HWA A;  4EFR A;  2VU9 A;  1I1B A;  4R6U B;  3WIN A;  1YBI A;  1N4K A;  2HW9 A;  4A7Y A;  1IRA X;  1BFC A;  2LIQ A;  1NZK A;  1Q03 A;  3V79 C;  1S0B A;  3OGF A;  5D62 A;  3VT2 A;  1CE7 B;  1TOO A;  3AZW A;  3D7W B;  3BAG A;  4LO0 C;  5BXR A;  2VXT I;  1II4 A;  41BI A;  3A07 A;  4JP0 A;  4OWL A;  4F34 A;  1DZC A;  1M2T B;  1IHK A;  1JT5 A;  2NZ9 A;  3RMX A;  1DZD A;  4G6J A;  1M16 A;  4QBC A;  1PWA A;  1JT7 A;  1XHB A;  2I1B A;  3F62 B;  3P6I A;  4QD2 C;  1G9B A;  3BA5 A;  4EFP A;  3FJI A;  2GO2 A;  1K5U A;  1IT0 A;  2AQZ A;  2VXR A;  4II0 A;  1TFM B;  3CU1 B;  3AJ6 A;  4FGF A;  1FWV A;  4D0Z A;  1Z4S A;  2QYI B;  4L4I A;  3WO3 A;  2NP0 A;  2NTD A;  2DRZ A;  3FJB A;  3OGG A;  4MZG B;  4D0T A;  1SR4 A;  5BXP A;  1EVT A;  1WD4 A;  2Y9G A;  1RZO B;  1W3F A;  3FJA A;  1UPS A;  4J2X A;  5DVH A;  1V6X A;  4I96 A;  3CA1 A;  3BAQ A;  3ZXG A;  4H75 A;  2AXM A;  3AKG A;  3O5W B;  1AFC A;  2VLC A;  5FZY A;  4LO3 C;  1CVS A;  1ONK B;  1R8N A;  5F90 A;  2D44 A;  1I1E A;  4GP0 A;  4PC4 A;  4X3A A;  3ZC8 A;  1QQK A;  4I1B A;  3FJH A;  4I4Q A;  3AKF A;  4LO7 C;  2BFH A;  3P53 A;  2M49 A;  2DRY A;  4ZBV B;  2D20 A;  1TWE A;  1DJS B;  2X2S A;  1PZZ A;  2KLL A;  3N7K A;  1DQO A;  1AVU A;  1XYF A;  3IAG C;  4LO1 C;  3S8K A;  1DFQ A;  2K4A B;  5BXT A;  2D7I A;  4KC3 A;  1SR4 C;  4IY8 A;  4P6A A;  5F8S A;  1D0H A;  3ZX7 A;  4ZFW B;  1NUN A;  3MAL A;  1HIB A;  3OJ2 A;  3Q7W A;  3IM7 A;  3V0A A;  5DSS B;  3HMY A;  5GAQ A;  4I4S A;  1AVW B;  4A7K A;  3QR5 A;  3HN1 A;  3RTJ B;  1S0G A;  2NS2 A;  4DEN A;  3A22 A;  4JKQ A;  5JMC A;  4ZFU B;  4H9W A;  2BEB A;  4I8M A;  1FN0 A;  1TP0 A;  3H6Q A;  1TIE A;  3NBE A;  3UD7 A;  1R8O A;  4LO0 A;  4EEE B;  2DRE A;  3FJD A;  2VUA A;  4DEP A;  2K8R A;  4IQP A;  3WMU A;  4IZX A;  3RTI B;  4HR6 C;  1JLY A;  1WBC A;  2AAI B;  1DFC A;  1S0F A;  4QKS A;  3RSJ A;  1JT3 A;  3Q7X A;  5DZU A;  4DCK C;  1Q04 A;  3BX1 C;  1FWU A;  1G9A A;  2GZB A;  3CQA A;  5I1B A;  3FJK A;  3NJ5 A;  5BVP I;  1F31 A;  1PC8 B;  2P39 A;  4OW4 A;  2XOA A;  2F2F A;  1W3A A;  3VWC A;  1IIL A;  1EYL A;  3VEQ A;  4GP3 A;  1AXM A;  4ZOT A;  1VCL A;  4EFQ A;  4QKR A;  3ZC9 A;  4XFT A;  3OJM A;  2NM1 A;  4L4H A;  1BLA A;  2YUG A;  3A21 A;  5F8Y A;  4G1R A;  3HAL A;  1JT4 A;  2X2T A;  3O44 A;  1T4Q A;  4J2S A;  5BP5 A;  4LO3 A;  3WO2 A;  4Q91 A;  3B9U A;  4AN6 A;  1AF9 A;  1DQG A;  3C9Z A;  3V0B B;  5B2H A;  3BA4 A;  2ESU A;  1J0S A;  2BEA A;  3UD8 A;  2KKI A;  3ZXD A;  3CA4 A;  3Q7Y A;  3CA6 A;  3RMY A;  4J2Y A;  4KEJ A;  3IIR A;  3AKI A;  4I4Y A;  4JRA A;  1ISY A;  1BAR A;  3NBN A;  4LO1 A;  3SNV A;  3IM6 A;  2F2F C;  1A8D A;  4XKI A;  2D43 A;  3POK A;  1W3G A;  3EF2 A;  3VT1 A;  4P0J A;  4GOY A;  4IYB A;  4LO2 C;  4IZE A;  2K43 A;  5EG6 C;  1IJT A;  5G00 A;  1WD3 A;  1V6V A;  5BP5 C;  4EB2 B;  3UD9 A;  2AFG A;  4ISR A;  4P0L A;  3O4O A;  3CRI A;  1K5V A;  2Z49 A;  2ERM A;  4F83 A;  1Q1U A;  4USP A;  2D7R A;  2D22 A;  4G6M A;  4ZKT B;  4QO3 A;  2Q9X A;  2Y9F A;  1FMZ A;  3FUQ A;  3LLP A;  3R4S A;  3A23 A;  5F8W A;  1DIW A;  1V6W A;  4J23 B;  1HWN B;  3H6R B;  1AVX B;  1BFB A;  1V6U A;  1RML A;  3R4U A;  4KEI A;  3WA1 A;  2Y9X E;  4I0Y A;  1HWM B;  4AN7 B;  3E8L C;  3I29 B;  4I3N A;  2P23 A;  4I37 A;  3AKH A;  3O4B A;  2HZ9 A;  1QQL A;  5BOW A;  2QN4 A;  3FUO A;  5HPZ A;  1BAS A;  3CAH A;  4ZLB B;  1S0L A;  2MC2 A;  1XG6 A;  2NYY A;  3BRG C;  5E24 E;  1OQL B;  3NBD A;  3FJ8 A;  2MIB A;  3CA5 A;  7I1B A;  1FGA A;  2HWM A;  2WRY A;  4QBV A;  1HKN A;  3VSZ A;  2Z48 A;  3WMV A;  4Q9P A;  1FV2 A;  3CA3 A;  2FFU A;  4X39 A;  4TLP A;  4MZH A;  4XFU A;  3N7J A;  2Y9W C;  2MLL B;  1ITB A;  5BXS A;  1P63 A;  3UDA A;  3I2A A;  3OBR A;  1G9C A;  2VSA A;  31BI A;  4FVV A;  1FMM S;  2KI4 A;  2NVH A;  4OEG A;  3TC2 A;  5JLV A;  3V0B A;  3CA0 A;  3V0A B;  1S0E A;  3IM5 A;  3T8S A;  1YF8 B;  2Q3N B;  1GGP B;  4I6I A;  1JQZ A;  3QYD A;  4LO2 A;  1S0D A;  1RG8 A;  4I1E A;  3P6J A;  4I2S A;  4GAI A;  3N7M A;  4I7I A;  1ISX A;  8I1B A;  3BAH A;  3HBW A;  4P0K A;  3HOM A;  4HA2 A;  1ILR 1;  3PHZ A;  3S8J A;  2J3P A;  1BA7 A;  1DLL A;  3PG0 A;  4CJM A;  1Z2V A;  3K1X A;  4KBB A;  4GAF A;  4XFS A;  3AH1 A;  1BFG A;  3I2X A;  4OEE A;  1XZZ A;  3ILA A;  4G9N A;  3O4C A;  1TTU A;  4QD2 B;  4GOV A;  3PUB A;  3AH4 A;  1ABR B;  3AJ5 A;  1FV3 A;  1YXW A;  3FFZ A;  4EKX B;  4I4V A;  4JPZ A;  3BA7 A;  2UUS A;  2ZQN A;  4I4P A;  3BAD A;  3BB2 A;  3NBC A;  6I1B A;  3CRG A;  4OEF A;  4Z9W B;  3H6R A;  2D1Z A;  3VUO A;  1S0C A;  1HCE A;  1JTC A;  4MZF B;  5EHA A;  2RST A;  3N7L A;  2E4M C;  1ISZ A;  4QAL A;  1L2H A;  4ZGR B;  1ISW A;  1G82 A;  21BI A;  4OWJ A;  4X37 A;  3WIN C;  3OJV A;  4G9M A;  3FJ9 A;  3BRD A;  3BRF A;  1HWO B;  1MC9 A;  4I4R A;  2VSE A;  2D24 A;  3PME A;  3W9T A;  3O49 A;  4JQ0 A;  4H04 A;  1QXM A;  4USO A;  4J2K A;  1T9F A;  2R9K B;  1E0O A;  2KI6 B;  3BAU A;  3OBT A;  4LO7 B;  2F8X C;  3LTQ A;  4IY9 A;  3FJE A;  5FNX A;  3FJF A;  4IHZ A;  2D23 A;  4LO8 B;  1YYN A;  3H6S E;  4Q9G A;  4D8H A;  2KH2 A;  4ZA3 B;  1Z0H A;  1IOB A;  3O4A A;  2FGF A;  4JKX B;  5D61 A;  1PUU B;  1JY0 A;  3MPP G;  3VSF A;  2RQ9 A;  1EPW A;  3FGM A;  2ET2 A;  4I4U A;  1ISV A;  4QC4 A;  4Z8S B;  1KNM A;  5D63 A;  4OUJ A;  5FNW A;  5FZZ A;  5FZU A;  3UJ0 A;  1HWP B;  3FJJ A;  1PUM B;  3O4D A;  4JAW A;  3AH2 A;  3O3Q A;  3BAV A;  1IRP A;  5BQU A;  4I4O A;  4WBC A;  3UJ4 A;  2WBC A;  4END A;  3JRR A;  4X38 A;  4A7Z A;  1HCD A;  3FJC A;  2ZQO A;  1TWM A;  2L5X A;  5DUY A;  3KMV A;  4UY4 A;  3CRH A;  4OWK A;  4HJJ A;  2FO1 A;  4ION A;  2ZR1 B;  4YOL A;  3AZV A;  1EV2 A;  1SZ6 B;  1RY7 A;  3BAO A;  3WO4 A;  4ISQ A;  4ZFY B;  2LIE A;  4KEK A;  5EC5 A;  2FDB M;  1BLD A;  1AVA C;  3F1R A;  2RG9 B;  2DS0 A;  1FQ9 A;  9ILB A;  1G9D A;  2IHO A; 
#chains in the Genus database with same CATH homology
 4I4X A;  1YTO A;  2FFV A;  3BTA A;  5BQU C;  2IWT B;  3N0K A;  3VT0 A;  1JLX A;  3JUT A;  1MD6 A;  2E4M A;  3HSM A;  1WBA A;  1BFF A;  2HWA A;  4EFR A;  2VU9 A;  1I1B A;  4R6U B;  3WIN A;  1YBI A;  1N4K A;  2HW9 A;  4A7Y A;  1IRA X;  1BFC A;  2LIQ A;  1NZK A;  1Q03 A;  3V79 C;  1S0B A;  3OGF A;  5D62 A;  3VT2 A;  1CE7 B;  1TOO A;  3AZW A;  3D7W B;  3BAG A;  4LO0 C;  5BXR A;  2VXT I;  1II4 A;  41BI A;  3A07 A;  4JP0 A;  4OWL A;  4F34 A;  1DZC A;  1M2T B;  1IHK A;  1JT5 A;  2NZ9 A;  3RMX A;  1DZD A;  4G6J A;  1M16 A;  4QBC A;  1PWA A;  1JT7 A;  1XHB A;  2I1B A;  3F62 B;  3P6I A;  4QD2 C;  1G9B A;  3BA5 A;  4EFP A;  3FJI A;  2GO2 A;  1K5U A;  1IT0 A;  2AQZ A;  2VXR A;  4II0 A;  1TFM B;  3CU1 B;  3AJ6 A;  4FGF A;  1FWV A;  4D0Z A;  1Z4S A;  2QYI B;  4L4I A;  3WO3 A;  2NP0 A;  2NTD A;  2DRZ A;  3FJB A;  3OGG A;  4MZG B;  4D0T A;  1SR4 A;  5BXP A;  1EVT A;  1WD4 A;  2Y9G A;  1RZO B;  1W3F A;  3FJA A;  1UPS A;  4J2X A;  5DVH A;  1V6X A;  4I96 A;  3CA1 A;  3BAQ A;  3ZXG A;  4H75 A;  2AXM A;  3AKG A;  3O5W B;  1AFC A;  2VLC A;  5FZY A;  4LO3 C;  1CVS A;  1ONK B;  1R8N A;  5F90 A;  2D44 A;  1I1E A;  4GP0 A;  4PC4 A;  4X3A A;  3ZC8 A;  1QQK A;  4I1B A;  3FJH A;  4I4Q A;  3AKF A;  4LO7 C;  2BFH A;  3P53 A;  2M49 A;  2DRY A;  4ZBV B;  2D20 A;  1TWE A;  1DJS B;  2X2S A;  1PZZ A;  2KLL A;  3N7K A;  1DQO A;  1AVU A;  1XYF A;  3IAG C;  4LO1 C;  3S8K A;  1DFQ A;  2K4A B;  5BXT A;  2D7I A;  4KC3 A;  1SR4 C;  4IY8 A;  4P6A A;  5F8S A;  1D0H A;  3ZX7 A;  4ZFW B;  1NUN A;  3MAL A;  1HIB A;  3OJ2 A;  3Q7W A;  3IM7 A;  3V0A A;  5DSS B;  3HMY A;  5GAQ A;  4I4S A;  1AVW B;  4A7K A;  3QR5 A;  3HN1 A;  3RTJ B;  1S0G A;  2NS2 A;  4DEN A;  3A22 A;  4JKQ A;  5JMC A;  4ZFU B;  4H9W A;  2BEB A;  4I8M A;  1FN0 A;  1TP0 A;  3H6Q A;  1TIE A;  3NBE A;  3UD7 A;  1R8O A;  4LO0 A;  4EEE B;  2DRE A;  3FJD A;  2VUA A;  4DEP A;  2K8R A;  4IQP A;  3WMU A;  4IZX A;  3RTI B;  4HR6 C;  1JLY A;  1WBC A;  2AAI B;  1DFC A;  1S0F A;  4QKS A;  3RSJ A;  1JT3 A;  3Q7X A;  5DZU A;  4DCK C;  1Q04 A;  3BX1 C;  1FWU A;  1G9A A;  2GZB A;  3CQA A;  5I1B A;  3FJK A;  3NJ5 A;  5BVP I;  1F31 A;  1PC8 B;  2P39 A;  4OW4 A;  2XOA A;  2F2F A;  1W3A A;  3VWC A;  1IIL A;  1EYL A;  3VEQ A;  4GP3 A;  1AXM A;  4ZOT A;  1VCL A;  4EFQ A;  4QKR A;  3ZC9 A;  4XFT A;  3OJM A;  2NM1 A;  4L4H A;  1BLA A;  2YUG A;  3A21 A;  5F8Y A;  4G1R A;  3HAL A;  1JT4 A;  2X2T A;  3O44 A;  1T4Q A;  4J2S A;  5BP5 A;  4LO3 A;  3WO2 A;  4Q91 A;  3B9U A;  4AN6 A;  1AF9 A;  1DQG A;  3C9Z A;  3V0B B;  5B2H A;  3BA4 A;  2ESU A;  1J0S A;  2BEA A;  3UD8 A;  2KKI A;  3ZXD A;  3CA4 A;  3Q7Y A;  3CA6 A;  3RMY A;  4J2Y A;  4KEJ A;  3IIR A;  3AKI A;  4I4Y A;  4JRA A;  1ISY A;  1BAR A;  3NBN A;  4LO1 A;  3SNV A;  3IM6 A;  2F2F C;  1A8D A;  4XKI A;  2D43 A;  3POK A;  1W3G A;  3EF2 A;  3VT1 A;  4P0J A;  4GOY A;  4IYB A;  4LO2 C;  4IZE A;  2K43 A;  5EG6 C;  1IJT A;  5G00 A;  1WD3 A;  1V6V A;  5BP5 C;  4EB2 B;  3UD9 A;  2AFG A;  4ISR A;  4P0L A;  3O4O A;  3CRI A;  1K5V A;  2Z49 A;  2ERM A;  4F83 A;  1Q1U A;  4USP A;  2D7R A;  2D22 A;  4G6M A;  4ZKT B;  4QO3 A;  2Q9X A;  2Y9F A;  1FMZ A;  3FUQ A;  3LLP A;  3R4S A;  3A23 A;  5F8W A;  1DIW A;  1V6W A;  4J23 B;  1HWN B;  3H6R B;  1AVX B;  1BFB A;  1V6U A;  1RML A;  3R4U A;  4KEI A;  3WA1 A;  2Y9X E;  4I0Y A;  1HWM B;  4AN7 B;  3E8L C;  3I29 B;  4I3N A;  2P23 A;  4I37 A;  3AKH A;  3O4B A;  2HZ9 A;  1QQL A;  5BOW A;  2QN4 A;  3FUO A;  5HPZ A;  1BAS A;  3CAH A;  4ZLB B;  1S0L A;  2MC2 A;  1XG6 A;  2NYY A;  3BRG C;  5E24 E;  1OQL B;  3NBD A;  3FJ8 A;  2MIB A;  3CA5 A;  7I1B A;  1FGA A;  2HWM A;  2WRY A;  4QBV A;  1HKN A;  3VSZ A;  2Z48 A;  3WMV A;  4Q9P A;  1FV2 A;  3CA3 A;  2FFU A;  4X39 A;  4TLP A;  4MZH A;  4XFU A;  3N7J A;  2Y9W C;  2MLL B;  1ITB A;  5BXS A;  1P63 A;  3UDA A;  3I2A A;  3OBR A;  1G9C A;  2VSA A;  31BI A;  4FVV A;  1FMM S;  2KI4 A;  2NVH A;  4OEG A;  3TC2 A;  5JLV A;  3V0B A;  3CA0 A;  3V0A B;  1S0E A;  3IM5 A;  3T8S A;  1YF8 B;  2Q3N B;  1GGP B;  4I6I A;  1JQZ A;  3QYD A;  4LO2 A;  1S0D A;  1RG8 A;  4I1E A;  3P6J A;  4I2S A;  4GAI A;  3N7M A;  4I7I A;  1ISX A;  8I1B A;  3BAH A;  3HBW A;  4P0K A;  3HOM A;  4HA2 A;  1ILR 1;  3PHZ A;  3S8J A;  2J3P A;  1BA7 A;  1DLL A;  3PG0 A;  4CJM A;  1Z2V A;  3K1X A;  4KBB A;  4GAF A;  4XFS A;  3AH1 A;  1BFG A;  3I2X A;  4OEE A;  1XZZ A;  3ILA A;  4G9N A;  3O4C A;  1TTU A;  4QD2 B;  4GOV A;  3PUB A;  3AH4 A;  1ABR B;  3AJ5 A;  1FV3 A;  1YXW A;  3FFZ A;  4EKX B;  4I4V A;  4JPZ A;  3BA7 A;  2UUS A;  2ZQN A;  4I4P A;  3BAD A;  3BB2 A;  3NBC A;  6I1B A;  3CRG A;  4OEF A;  4Z9W B;  3H6R A;  2D1Z A;  3VUO A;  1S0C A;  1HCE A;  1JTC A;  4MZF B;  5EHA A;  2RST A;  3N7L A;  2E4M C;  1ISZ A;  4QAL A;  1L2H A;  4ZGR B;  1ISW A;  1G82 A;  21BI A;  4OWJ A;  4X37 A;  3WIN C;  3OJV A;  4G9M A;  3FJ9 A;  3BRD A;  3BRF A;  1HWO B;  1MC9 A;  4I4R A;  2VSE A;  2D24 A;  3PME A;  3W9T A;  3O49 A;  4JQ0 A;  4H04 A;  1QXM A;  4USO A;  4J2K A;  1T9F A;  2R9K B;  1E0O A;  2KI6 B;  3BAU A;  3OBT A;  4LO7 B;  2F8X C;  3LTQ A;  4IY9 A;  3FJE A;  5FNX A;  3FJF A;  4IHZ A;  2D23 A;  4LO8 B;  1YYN A;  3H6S E;  4Q9G A;  4D8H A;  2KH2 A;  4ZA3 B;  1Z0H A;  1IOB A;  3O4A A;  2FGF A;  4JKX B;  5D61 A;  1PUU B;  1JY0 A;  3MPP G;  3VSF A;  2RQ9 A;  1EPW A;  3FGM A;  2ET2 A;  4I4U A;  1ISV A;  4QC4 A;  4Z8S B;  1KNM A;  5D63 A;  4OUJ A;  5FNW A;  5FZZ A;  5FZU A;  3UJ0 A;  1HWP B;  3FJJ A;  1PUM B;  3O4D A;  4JAW A;  3AH2 A;  3O3Q A;  3BAV A;  1IRP A;  5BQU A;  4I4O A;  4WBC A;  3UJ4 A;  2WBC A;  4END A;  3JRR A;  4X38 A;  4A7Z A;  1HCD A;  3FJC A;  2ZQO A;  1TWM A;  2L5X A;  5DUY A;  3KMV A;  4UY4 A;  3CRH A;  4OWK A;  4HJJ A;  2FO1 A;  4ION A;  2ZR1 B;  4YOL A;  3AZV A;  1EV2 A;  1SZ6 B;  1RY7 A;  3BAO A;  3WO4 A;  4ISQ A;  4ZFY B;  2LIE A;  4KEK A;  5EC5 A;  2FDB M;  1BLD A;  1AVA C;  3F1R A;  2RG9 B;  2DS0 A;  1FQ9 A;  9ILB A;  1G9D A;  2IHO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...