4LO1A

Ha17-ha33-gal
Total Genus 73
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
73
sequence length
286
structure length
286
Chain Sequence
b'NSLNDKIVTISCKADTNLFFYQVAGNVSLFQQTRNYLERWRLIYDSNKAAYKIKSMDIHNTNLVLTWNAPTHNISTQQDSNADNQYWLLLKDIGNNSFIIASYKNPNLVLYADTVARNLKLSTLNNSNYIKFIIEDYIISDLNNFTCKISPILDLNKVVQQVDVTNLNVNLYTWDYGRNQKWTIRYNEEKAAYQFFNTILSNGVLTWIFSNGNTVRVSSSNDQNNDAQYWLINPVSDTDETYTITNLRDTTKALDLYGGQTANGTAIQVFNYHGDDNQKWNIRNPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HA-33
publication title Structure of a Bimodular Botulinum Neurotoxin Complex Provides Insights into Its Oral Toxicity.
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Protein transport
total genus 73
structure length 286
sequence length 286
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo1A01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4lo1A02
1ONKB 1JT5A 3H6RB 2VSEA 3UD8A 3CA4A 4A7YA 2QN4A 1ISXA 1IOBA 3AJ5A 2NP0A 4LO3C 3W9TA 2DRYA 1DFQA 3N7KA 1RG8A 3A23A 1K5VA 1WBAA 3WINC 4LO8B 1R8NA 3HSMA 2J3PA 4ZFWB 1AVAC 3N7LA 1JT7A 3AKIA 3OBRA 4Z8SB 3WA1A 1FWVA 3VSFA 4HJJA 2X2TA 4DCKC 4R6UB 4I6IA 1UPSA 1MD6A 1IRAX 1I1BA 3CAHA 2X2SA 2FDBM 3BA4A 3E8LC 3I2AA 3N7MA 3H6QA 2NVHA 2D7RA 5D61A 3PUBA 1T4QA 1BFGA 4HA2A 1JY0A 3PHZA 1D0HA 4Q91A 3NBNA 21BIA 1FWUA 4X39A 3AKHA 5JMCA 3CA6A 3V0AB 5DSSB 4IHZA 4IZEA 4I4UA 2RQ9A 1ITBA 3FJIA 1S0DA 1Q1UA 1WD4A 4GOVA 1SR4A 5D62A 3JUTA 4OUJA 4D0ZA 5D63A 4EFPA 2D20A 1TP0A 3WO4A 3FJCA 4LO7C 3RTJB 1EYLA 5HPZA 3A22A 4JP0A 2HW9A 1W3GA 5FNWA 3P6IA 4I4YA 3RTIB 1G9CA 4I8MA 3EF2A 3V0BB 3N0KA 1AVWB 1HWOB 1IHKA 1Z0HA 2D24A 3BA5A 3BA7A 4DENA 3NBCA 4I4SA 3BB2A 5EC5A 1WD3A 1S0LA 1XG6A 3IM7A 3O49A 2KI4A 4YOLA 5BP5A 3CA1A 1PC8B 1Q03A 2P23A 1R8OA 3OGFA 2YUGA 2KI6B 2MC2A 1TIEA 2ZQOA 1AVXB 3WO3A 2L5XA 1A8DA 3FJFA 1M16A 1GGPB 3MPPG 3K1XA 3AH1A 2IWTB 2K8RA 1SZ6B 4KC3A 3AH2A 4G1RA 2Z49A 31BIA 4QALA 3UJ0A 2D7IA 3CU1B 4I4VA 1FMZA 4KEKA 5BQUA 2MLLB 3NBDA 5F8SA 2KLLA 3Q7XA 1ABRB 4XKIA 2Y9FA 1FQ9A 4QD2C 3FUQA 4AN6A 1DLLA 5I1BA 1IILA 2KH2A 3PG0A 1CE7B 4I0YA 2VXTI 4A7KA 4ZKTB 3Q7YA 3BAVA 4X38A 9ILBA 1FV3A 3HALA 3TC2A 2AQZA 4J23B 4LO1C 3S8KA 3JRRA 4I4RA 3OJMA 4XFSA 2Y9GA 3BRFA 3ZXGA 3O5WB 4ZOTA 1FV2A 2ESUA 4J2SA 2NYYA 1G9DA 3AZVA 4EFRA 1YYNA 3S8JA 4IY9A 2LIQA 2QYIB 4OEEA 5F8YA 4KBBA 4LO7B 4I1EA 5FZYA 3OGGA 1SR4C 4QKRA 1S0EA 2D44A 4I96A 3HBWA 3IM6A 4IY8A 5BXPA 41BIA 1F31A 4OWKA 4ENDA 2BEBA 3UD7A 3CRIA 3UDAA 1IRPA 4I4XA 2NZ9A 1BARA 3HN1A 4QKSA 3VWCA 2F8XC 3D7WB 4II0A 4PC4A 3AZWA 3ZC9A 1HWPB 1ISVA 4F83A 4LO0A 4L4IA 3LTQA 3BADA 4L4HA 3RSJA 1BLDA 1RY7A 3BAGA 1PUMB 1S0FA 1AFCA 3P6JA 4XFTA 3FJ8A 5BP5C 2AXMA 4LO1A 3B9UA 1Q04A 2AAIB 4HR6C 4GOYA 4I7IA 3AH4A 1YTOA 1HWNB 2ZR1B 4KEIA 3O4CA 4OWJA 4WBCA 3BTAA 3I2XA 5DUYA 3UD9A 3O44A 4QD2B 5FNXA 3IM5A 5DZUA 5BQUC 1Z4SA 1DZCA 2RG9B 5BOWA 4I2SA 3ZX7A 3AKGA 2GO2A 1WBCA 3ILAA 1VCLA 7I1BA 1FMMS 1MC9A 3FFZA 2AFGA 2ET2A 1S0BA 2MIBA 2VUAA 4ZA3B 3FJJA 1W3FA 3MALA 3HMYA 1L2HA 1YXWA 2FFVA 3FJBA 2HZ9A 3N7JA 1P63A 4EB2B 1EVTA 5EG6C 3O3QA 3O4DA 2VLCA 4P6AA 5DVHA 1FN0A 2I1BA 2K43A 1PWAA 5EHAA 2ERMA 2K4AB 1KNMA 4F34A 1YBIA 4FVVA 4P0KA 4QBVA 4AN7B 3F1RA 3BAOA 1S0CA 1G82A 2Y9XE 2DS0A 4USOA 3OJVA 1ISYA 5JLVA 3FJKA 4ZBVB 3FJDA 1DQOA 3A07A 5B2HA 2VXRA 2XOAA 5BXTA 3H6RA 1BFFA 1W3AA 1JTCA 4DEPA 4LO0C 1JLXA 3C9ZA 3QYDA 1PZZA 1EPWA 3VT0A 4I1BA 2KKIA 3LLPA 2WRYA 2E4MA 5F90A 1J0SA 1HCDA 4G6JA 4ISRA 2D22A 2D43A 4GAFA 1ILR1 1DZDA 3A21A 3OJ2A 4J2XA 3NJ5A 4ZFUB 4D8HA 1CVSA 3CQAA 4H9WA 1BA7A 1S0GA 4X37A 4OEFA 1JT3A 3WMVA 1RMLA 3AKFA 1YF8B 3FUOA 5BXSA 3FJEA 3IIRA 4IYBA 2ZQNA 3ZC8A 3SNVA 4QC4A 3VUOA 2VU9A 4JQ0A 4EEEB 3T8SA 4ZGRB 1DJSB 3CRGA 3BAUA 3R4SA 1TWEA 3O4AA 4IZXA 4IQPA 3BX1C 3OBTA 3NBEA 3ZXDA 4P0JA 4IONA 2F2FA 3V0AA 3POKA 1FGAA 2NTDA 1TOOA 1E0OA 1V6XA 4JKXB 4JPZA 6I1BA 3R4UA 3BRGC 2D1ZA 4QBCA 4ZLBB 1RZOB 1HCEA 2Q9XA 1Z2VA 3H6SE 4LO2A 4XFUA 3VT1A 1ISZA 4EFQA 3WO2A 1V6VA 3KMVA 3WMUA 1II4A 1K5UA 3BAHA 4OW4A 2VSAA 1JLYA 3P53A 4QO3A 2Z48A 1IT0A 2RSTA 2HWMA 4I4OA 1BFCA 1NUNA 3RMYA 3V0BA 1M2TB 3FJAA 3F62B 2D23A 4JRAA 4I4QA 4GP3A 2UUSA 4LO3A 1OQLB 1QQKA 2P39A 3VSZA 8I1BA 4ZFYB 4J2YA 3FJ9A 1N4KA 1HIBA 3HOMA 3VT2A 4I37A 3O4BA 2BFHA 3WINA 4GAIA 1NZKA 2Q3NB 4JKQA 4I3NA 5G00A 2E4MC 5F8WA 1I1EA 1G9AA 1JT4A 4OEGA 2WBCA 1XYFA 3AJ6A 1IJTA 1ISWA 1V6WA 2LIEA 4CJMA 5E24E 1BFBA 1QQLA 1TWMA 2IHOA 4X3AA 3CA0A 1TFMB 3O4OA 4A7ZA 3I29B 2R9KB 2DRZA 4D0TA 1BLAA 3VEQA 1DQGA 1BASA 2M49A 1EV2A 3UJ4A 1AXMA 3FGMA 4J2KA 4Z9WB 4H04A 1HKNA 1XHBA 2NM1A 3CA3A 5FZZA 5BVPI 3IAGC 1PUUB 2BEAA 4FGFA 1XZZA 2Y9WC 3V79C 4ISQA 4OWLA 1QXMA 2GZBA 4TLPA 4KEJA 2F2FC 3BRDA 4USPA 5FZUA 4G6MA 3RMXA 4I4PA 4G9NA 2FGFA 3Q7WA 1HWMB 4G9MA 5GAQA 1AF9A 3FJHA 2FFUA 1AVUA 3PMEA 3QR5A 1G9BA 1DFCA 4P0LA 2DREA 4LO2C 2HWAA 1T9FA 4Q9PA 3CA5A 1JQZA 3BAQA 4GP0A 5BXRA 4EKXB 4Q9GA 4JAWA 1V6UA 1TTUA 1DIWA 3CRHA 2FO1A
chains in the Genus database with same CATH superfamily
1ONKB 1JT5A 3H6RB 2VSEA 3UD8A 3CA4A 4A7YA 2QN4A 1ISXA 1IOBA 3AJ5A 2NP0A 4LO3C 3W9TA 2DRYA 1DFQA 4MZFB 3N7KA 1RG8A 3A23A 1K5VA 1WBAA 3WINC 4LO8B 1R8NA 3HSMA 2J3PA 4ZFWB 1AVAC 3N7LA 1JT7A 3AKIA 3OBRA 4Z8SB 3WA1A 1FWVA 3VSFA 4HJJA 2X2TA 4DCKC 4R6UB 4I6IA 1UPSA 1MD6A 1IRAX 1I1BA 3CAHA 2X2SA 2FDBM 3BA4A 3E8LC 3I2AA 3N7MA 3H6QA 2NVHA 2D7RA 5D61A 3PUBA 1T4QA 1BFGA 4HA2A 1JY0A 3PHZA 1D0HA 4Q91A 3NBNA 21BIA 1FWUA 4X39A 3AKHA 5JMCA 3CA6A 3V0AB 5DSSB 4IHZA 4H75A 4IZEA 4I4UA 2RQ9A 1ITBA 3FJIA 1S0DA 1Q1UA 1WD4A 4GOVA 1SR4A 5D62A 3JUTA 4OUJA 4D0ZA 5D63A 4EFPA 2D20A 1TP0A 3WO4A 3FJCA 4LO7C 3RTJB 1EYLA 5HPZA 3A22A 4JP0A 2HW9A 1W3GA 5FNWA 3P6IA 4I4YA 3RTIB 1G9CA 4I8MA 3EF2A 3V0BB 3N0KA 1AVWB 1HWOB 1IHKA 1Z0HA 2D24A 3BA5A 3BA7A 4DENA 3NBCA 4I4SA 3BB2A 5EC5A 1WD3A 1S0LA 1XG6A 3IM7A 3O49A 2KI4A 4YOLA 5BP5A 3CA1A 1PC8B 1Q03A 2P23A 1R8OA 3OGFA 2YUGA 2KI6B 2MC2A 1TIEA 2ZQOA 1AVXB 3WO3A 2L5XA 1A8DA 3FJFA 1M16A 1GGPB 3MPPG 3K1XA 3AH1A 2IWTB 2K8RA 1SZ6B 4KC3A 3AH2A 4G1RA 2Z49A 31BIA 4QALA 3UJ0A 2D7IA 3CU1B 4I4VA 1FMZA 4KEKA 5BQUA 2MLLB 3NBDA 5F8SA 2KLLA 3Q7XA 1ABRB 4XKIA 2Y9FA 1FQ9A 4QD2C 3FUQA 4AN6A 1DLLA 5I1BA 1IILA 2KH2A 3PG0A 1CE7B 4I0YA 2VXTI 4A7KA 4ZKTB 3Q7YA 3BAVA 4X38A 9ILBA 1FV3A 3HALA 3TC2A 2AQZA 4J23B 4LO1C 3S8KA 3JRRA 4I4RA 3OJMA 4XFSA 2Y9GA 3BRFA 3ZXGA 3O5WB 4ZOTA 1FV2A 2ESUA 4J2SA 2NYYA 1G9DA 3AZVA 4EFRA 1YYNA 3S8JA 4IY9A 2LIQA 2QYIB 4OEEA 5F8YA 4KBBA 4LO7B 4I1EA 5FZYA 3OGGA 1SR4C 4QKRA 1S0EA 2D44A 4I96A 3HBWA 3IM6A 4IY8A 5BXPA 41BIA 1F31A 4MZHA 4OWKA 4ENDA 2BEBA 3UD7A 3CRIA 3UDAA 1IRPA 4I4XA 2NZ9A 1BARA 3HN1A 4QKSA 3VWCA 2F8XC 3D7WB 4II0A 4PC4A 3AZWA 3ZC9A 1HWPB 1ISVA 4F83A 4LO0A 4L4IA 3LTQA 3BADA 4L4HA 3RSJA 1BLDA 1RY7A 3BAGA 1PUMB 1S0FA 1AFCA 3P6JA 4XFTA 3FJ8A 5BP5C 2AXMA 4LO1A 3B9UA 1Q04A 2AAIB 4HR6C 4GOYA 4I7IA 3AH4A 1YTOA 1HWNB 2ZR1B 4KEIA 3O4CA 4OWJA 4WBCA 3BTAA 3I2XA 5DUYA 3UD9A 3O44A 4QD2B 5FNXA 3IM5A 5DZUA 5BQUC 1Z4SA 1DZCA 2RG9B 5BOWA 4I2SA 3ZX7A 3AKGA 2GO2A 1WBCA 3ILAA 1VCLA 7I1BA 1FMMS 1MC9A 3FFZA 2AFGA 2ET2A 1S0BA 2MIBA 2VUAA 4ZA3B 3FJJA 1W3FA 3MALA 3HMYA 1L2HA 1YXWA 2FFVA 3FJBA 2HZ9A 3N7JA 4UY4A 1P63A 4EB2B 1EVTA 5EG6C 3O3QA 3O4DA 2VLCA 4P6AA 5DVHA 1FN0A 2I1BA 2K43A 1PWAA 5EHAA 2ERMA 2K4AB 1KNMA 4F34A 1YBIA 4FVVA 4P0KA 4QBVA 4AN7B 3F1RA 3BAOA 1S0CA 1G82A 2Y9XE 2DS0A 4USOA 3OJVA 1ISYA 5JLVA 3FJKA 4ZBVB 3FJDA 1DQOA 3A07A 5B2HA 2VXRA 2XOAA 5BXTA 3H6RA 1BFFA 1W3AA 1JTCA 4DEPA 4LO0C 1JLXA 3C9ZA 3QYDA 1PZZA 1EPWA 3VT0A 4I1BA 2KKIA 3LLPA 2WRYA 2E4MA 5F90A 1J0SA 1HCDA 4G6JA 4ISRA 2D22A 2D43A 4GAFA 1ILR1 1DZDA 3A21A 3OJ2A 4J2XA 3NJ5A 4ZFUB 4D8HA 1CVSA 3CQAA 4H9WA 1BA7A 1S0GA 4X37A 4OEFA 1JT3A 3WMVA 1RMLA 3AKFA 1YF8B 3FUOA 5BXSA 3FJEA 3IIRA 4IYBA 2ZQNA 3ZC8A 3SNVA 4QC4A 3VUOA 2VU9A 4JQ0A 4EEEB 3T8SA 4ZGRB 1DJSB 3CRGA 3BAUA 3R4SA 1TWEA 3O4AA 4IZXA 4IQPA 3BX1C 3OBTA 3NBEA 3ZXDA 4P0JA 4IONA 2F2FA 3V0AA 3POKA 1FGAA 2NTDA 1TOOA 1E0OA 1V6XA 4JKXB 4JPZA 6I1BA 3R4UA 3BRGC 2D1ZA 4QBCA 4ZLBB 1RZOB 1HCEA 2Q9XA 1Z2VA 3H6SE 4LO2A 4XFUA 3VT1A 1ISZA 4EFQA 3WO2A 1V6VA 3KMVA 3WMUA 1II4A 1K5UA 3BAHA 4OW4A 2VSAA 1JLYA 3P53A 4QO3A 2Z48A 1IT0A 2RSTA 2HWMA 4I4OA 1BFCA 1NUNA 3RMYA 3V0BA 1M2TB 3FJAA 3F62B 2D23A 2NS2A 4JRAA 4I4QA 4GP3A 2UUSA 4LO3A 1OQLB 1QQKA 2P39A 3VSZA 8I1BA 4ZFYB 4J2YA 3FJ9A 1N4KA 1HIBA 3HOMA 3VT2A 4I37A 3O4BA 2BFHA 3WINA 4GAIA 1NZKA 2Q3NB 4JKQA 4I3NA 5G00A 2E4MC 5F8WA 1I1EA 1G9AA 1JT4A 4OEGA 2WBCA 1XYFA 3AJ6A 1IJTA 1ISWA 1V6WA 2LIEA 4CJMA 5E24E 1BFBA 1QQLA 1TWMA 2IHOA 4X3AA 3CA0A 1TFMB 3O4OA 4A7ZA 3I29B 2R9KB 2DRZA 4D0TA 1BLAA 3VEQA 1DQGA 1BASA 4MZGB 2M49A 1EV2A 3UJ4A 1AXMA 3FGMA 4J2KA 4Z9WB 4H04A 1HKNA 1XHBA 2NM1A 3CA3A 5FZZA 5BVPI 3IAGC 1PUUB 2BEAA 4FGFA 1XZZA 2Y9WC 3V79C 4ISQA 4OWLA 1QXMA 2GZBA 4TLPA 4KEJA 2F2FC 3BRDA 4USPA 5FZUA 4G6MA 3RMXA 4I4PA 4G9NA 2FGFA 3Q7WA 1HWMB 4G9MA 5GAQA 1AF9A 3FJHA 2FFUA 1AVUA 3PMEA 3QR5A 1G9BA 1DFCA 4P0LA 2DREA 4LO2C 2HWAA 1T9FA 4Q9PA 3CA5A 1JQZA 3BAQA 4GP0A 5BXRA 4EKXB 4Q9GA 4JAWA 1V6UA 1TTUA 1DIWA 3CRHA 2FO1A
chains in the Genus database with same CATH topology
1ONKB 1JT5A 3H6RB 2VSEA 3UD8A 3CA4A 4A7YA 2QN4A 1ISXA 1IOBA 3AJ5A 2NP0A 4LO3C 3W9TA 2DRYA 1DFQA 4MZFB 3N7KA 1RG8A 3A23A 1K5VA 1WBAA 3WINC 4LO8B 1R8NA 3HSMA 2J3PA 4ZFWB 1AVAC 3N7LA 1JT7A 3AKIA 3OBRA 4Z8SB 3WA1A 1FWVA 3VSFA 4HJJA 2X2TA 4DCKC 4R6UB 4I6IA 1UPSA 1MD6A 1IRAX 1I1BA 3CAHA 2X2SA 2FDBM 3BA4A 3E8LC 3I2AA 3N7MA 3H6QA 2NVHA 2D7RA 5D61A 3PUBA 1T4QA 1BFGA 4HA2A 1JY0A 3PHZA 1D0HA 4Q91A 3NBNA 21BIA 1FWUA 4X39A 3AKHA 5JMCA 3CA6A 3V0AB 5DSSB 4IHZA 4H75A 4IZEA 4I4UA 2RQ9A 1ITBA 3FJIA 1S0DA 1Q1UA 1WD4A 4GOVA 1SR4A 5D62A 3JUTA 4OUJA 4D0ZA 5D63A 4EFPA 2D20A 1TP0A 3WO4A 3FJCA 4LO7C 3RTJB 1EYLA 5HPZA 3A22A 4JP0A 2HW9A 1W3GA 5FNWA 3P6IA 4I4YA 3RTIB 1G9CA 4I8MA 3EF2A 3V0BB 3N0KA 1AVWB 1HWOB 1IHKA 1Z0HA 2D24A 3BA5A 3BA7A 4DENA 3NBCA 4I4SA 3BB2A 5EC5A 1WD3A 1S0LA 1XG6A 3IM7A 3O49A 2KI4A 4YOLA 5BP5A 3CA1A 1PC8B 1Q03A 2P23A 1R8OA 3OGFA 2YUGA 2KI6B 2MC2A 1TIEA 2ZQOA 1AVXB 3WO3A 2L5XA 1A8DA 3FJFA 1M16A 1GGPB 3MPPG 3K1XA 3AH1A 2IWTB 2K8RA 1SZ6B 4KC3A 3AH2A 4G1RA 2Z49A 31BIA 4QALA 3UJ0A 2D7IA 3CU1B 4I4VA 1FMZA 4KEKA 5BQUA 2MLLB 3NBDA 5F8SA 2KLLA 3Q7XA 1ABRB 4XKIA 2Y9FA 1FQ9A 4QD2C 3FUQA 4AN6A 1DLLA 5I1BA 1IILA 2KH2A 3PG0A 1CE7B 4I0YA 2VXTI 4A7KA 4ZKTB 3Q7YA 3BAVA 4X38A 9ILBA 1FV3A 3HALA 3TC2A 2AQZA 4J23B 4LO1C 3S8KA 3JRRA 4I4RA 3OJMA 4XFSA 2Y9GA 3BRFA 3ZXGA 3O5WB 4ZOTA 1FV2A 2ESUA 4J2SA 2NYYA 1G9DA 3AZVA 4EFRA 1YYNA 3S8JA 4IY9A 2LIQA 2QYIB 4OEEA 5F8YA 4KBBA 4LO7B 4I1EA 5FZYA 3OGGA 1SR4C 4QKRA 1S0EA 2D44A 4I96A 3HBWA 3IM6A 4IY8A 5BXPA 41BIA 1F31A 4MZHA 4OWKA 4ENDA 2BEBA 3UD7A 3CRIA 3UDAA 1IRPA 4I4XA 2NZ9A 1BARA 3HN1A 4QKSA 3VWCA 2F8XC 3D7WB 4II0A 4PC4A 3AZWA 3ZC9A 1HWPB 1ISVA 4F83A 4LO0A 4L4IA 3LTQA 3BADA 4L4HA 3RSJA 1BLDA 1RY7A 3BAGA 1PUMB 1S0FA 1AFCA 3P6JA 4XFTA 3FJ8A 5BP5C 2AXMA 4LO1A 3B9UA 1Q04A 2AAIB 4HR6C 4GOYA 4I7IA 3AH4A 1YTOA 1HWNB 2ZR1B 4KEIA 3O4CA 4OWJA 4WBCA 3BTAA 3I2XA 5DUYA 3UD9A 3O44A 4QD2B 5FNXA 3IM5A 5DZUA 5BQUC 1Z4SA 1DZCA 2RG9B 5BOWA 4I2SA 3ZX7A 3AKGA 2GO2A 1WBCA 3ILAA 1VCLA 7I1BA 1FMMS 1MC9A 3FFZA 2AFGA 2ET2A 1S0BA 2MIBA 2VUAA 4ZA3B 3FJJA 1W3FA 3MALA 3HMYA 1L2HA 1YXWA 2FFVA 3FJBA 2HZ9A 3N7JA 4UY4A 1P63A 4EB2B 1EVTA 5EG6C 3O3QA 3O4DA 2VLCA 4P6AA 5DVHA 1FN0A 2I1BA 2K43A 1PWAA 5EHAA 2ERMA 2K4AB 1KNMA 4F34A 1YBIA 4FVVA 4P0KA 4QBVA 4AN7B 3F1RA 3BAOA 1S0CA 1G82A 2Y9XE 2DS0A 4USOA 3OJVA 1ISYA 5JLVA 3FJKA 4ZBVB 3FJDA 1DQOA 3A07A 5B2HA 2VXRA 2XOAA 5BXTA 3H6RA 1BFFA 1W3AA 1JTCA 4DEPA 4LO0C 1JLXA 3C9ZA 3QYDA 1PZZA 1EPWA 3VT0A 4I1BA 2KKIA 3LLPA 2WRYA 2E4MA 5F90A 1J0SA 1HCDA 4G6JA 4ISRA 2D22A 2D43A 4GAFA 1ILR1 1DZDA 3A21A 3OJ2A 4J2XA 3NJ5A 4ZFUB 4D8HA 1CVSA 3CQAA 4H9WA 1BA7A 1S0GA 4X37A 4OEFA 1JT3A 3WMVA 1RMLA 3AKFA 1YF8B 3FUOA 5BXSA 3FJEA 3IIRA 4IYBA 2ZQNA 3ZC8A 3SNVA 4QC4A 3VUOA 2VU9A 4JQ0A 4EEEB 3T8SA 4ZGRB 1DJSB 3CRGA 3BAUA 3R4SA 1TWEA 3O4AA 4IZXA 4IQPA 3BX1C 3OBTA 3NBEA 3ZXDA 4P0JA 4IONA 2F2FA 3V0AA 3POKA 1FGAA 2NTDA 1TOOA 1E0OA 1V6XA 4JKXB 4JPZA 6I1BA 3R4UA 3BRGC 2D1ZA 4QBCA 4ZLBB 1RZOB 1HCEA 2Q9XA 1Z2VA 3H6SE 4LO2A 4XFUA 3VT1A 1ISZA 4EFQA 3WO2A 1V6VA 3KMVA 3WMUA 1II4A 1K5UA 3BAHA 4OW4A 2VSAA 1JLYA 3P53A 4QO3A 2Z48A 1IT0A 2RSTA 2HWMA 4I4OA 1BFCA 1NUNA 3RMYA 3V0BA 1M2TB 3FJAA 3F62B 2D23A 2NS2A 4JRAA 4I4QA 4GP3A 2UUSA 4LO3A 1OQLB 1QQKA 2P39A 3VSZA 8I1BA 4ZFYB 4J2YA 3FJ9A 1N4KA 1HIBA 3HOMA 3VT2A 4I37A 3O4BA 2BFHA 3WINA 4GAIA 1NZKA 2Q3NB 4JKQA 4I3NA 5G00A 2E4MC 5F8WA 1I1EA 1G9AA 1JT4A 4OEGA 2WBCA 1XYFA 3AJ6A 1IJTA 1ISWA 1V6WA 2LIEA 4CJMA 5E24E 1BFBA 1QQLA 1TWMA 2IHOA 4X3AA 3CA0A 1TFMB 3O4OA 4A7ZA 3I29B 2R9KB 2DRZA 4D0TA 1BLAA 3VEQA 1DQGA 1BASA 4MZGB 2M49A 1EV2A 3UJ4A 1AXMA 3FGMA 4J2KA 4Z9WB 4H04A 1HKNA 1XHBA 2NM1A 3CA3A 5FZZA 5BVPI 3IAGC 1PUUB 2BEAA 4FGFA 1XZZA 2Y9WC 3V79C 4ISQA 4OWLA 1QXMA 2GZBA 4TLPA 4KEJA 2F2FC 3BRDA 4USPA 5FZUA 4G6MA 3RMXA 4I4PA 4G9NA 2FGFA 3Q7WA 1HWMB 4G9MA 5GAQA 1AF9A 3FJHA 2FFUA 1AVUA 3PMEA 3QR5A 1G9BA 1DFCA 4P0LA 2DREA 4LO2C 2HWAA 1T9FA 4Q9PA 3CA5A 1JQZA 3BAQA 4GP0A 5BXRA 4EKXB 4Q9GA 4JAWA 1V6UA 1TTUA 1DIWA 3CRHA 2FO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ONK B;  1JT5 A;  3H6R B;  2VSE A;  3UD8 A;  3CA4 A;  4A7Y A;  2QN4 A;  1ISX A;  1IOB A;  3AJ5 A;  2NP0 A;  4LO3 C;  3W9T A;  2DRY A;  1DFQ A;  3N7K A;  1RG8 A;  3A23 A;  1K5V A;  1WBA A;  3WIN C;  4LO8 B;  1R8N A;  3HSM A;  2J3P A;  4ZFW B;  1AVA C;  3N7L A;  1JT7 A;  3AKI A;  3OBR A;  4Z8S B;  3WA1 A;  1FWV A;  3VSF A;  4HJJ A;  2X2T A;  4DCK C;  4R6U B;  4I6I A;  1UPS A;  1MD6 A;  1IRA X;  1I1B A;  3CAH A;  2X2S A;  2FDB M;  3BA4 A;  3E8L C;  3I2A A;  3N7M A;  3H6Q A;  2NVH A;  2D7R A;  5D61 A;  3PUB A;  1T4Q A;  1BFG A;  4HA2 A;  1JY0 A;  3PHZ A;  1D0H A;  4Q91 A;  3NBN A;  21BI A;  1FWU A;  4X39 A;  3AKH A;  5JMC A;  3CA6 A;  3V0A B;  5DSS B;  4IHZ A;  4IZE A;  4I4U A;  2RQ9 A;  1ITB A;  3FJI A;  1S0D A;  1Q1U A;  1WD4 A;  4GOV A;  1SR4 A;  5D62 A;  3JUT A;  4OUJ A;  4D0Z A;  5D63 A;  4EFP A;  2D20 A;  1TP0 A;  3WO4 A;  3FJC A;  4LO7 C;  3RTJ B;  1EYL A;  5HPZ A;  3A22 A;  4JP0 A;  2HW9 A;  1W3G A;  5FNW A;  3P6I A;  4I4Y A;  3RTI B;  1G9C A;  4I8M A;  3EF2 A;  3V0B B;  3N0K A;  1AVW B;  1HWO B;  1IHK A;  1Z0H A;  2D24 A;  3BA5 A;  3BA7 A;  4DEN A;  3NBC A;  4I4S A;  3BB2 A;  5EC5 A;  1WD3 A;  1S0L A;  1XG6 A;  3IM7 A;  3O49 A;  2KI4 A;  4YOL A;  5BP5 A;  3CA1 A;  1PC8 B;  1Q03 A;  2P23 A;  1R8O A;  3OGF A;  2YUG A;  2KI6 B;  2MC2 A;  1TIE A;  2ZQO A;  1AVX B;  3WO3 A;  2L5X A;  1A8D A;  3FJF A;  1M16 A;  1GGP B;  3MPP G;  3K1X A;  3AH1 A;  2IWT B;  2K8R A;  1SZ6 B;  4KC3 A;  3AH2 A;  4G1R A;  2Z49 A;  31BI A;  4QAL A;  3UJ0 A;  2D7I A;  3CU1 B;  4I4V A;  1FMZ A;  4KEK A;  5BQU A;  2MLL B;  3NBD A;  5F8S A;  2KLL A;  3Q7X A;  1ABR B;  4XKI A;  2Y9F A;  1FQ9 A;  4QD2 C;  3FUQ A;  4AN6 A;  1DLL A;  5I1B A;  1IIL A;  2KH2 A;  3PG0 A;  1CE7 B;  4I0Y A;  2VXT I;  4A7K A;  4ZKT B;  3Q7Y A;  3BAV A;  4X38 A;  9ILB A;  1FV3 A;  3HAL A;  3TC2 A;  2AQZ A;  4J23 B;  4LO1 C;  3S8K A;  3JRR A;  4I4R A;  3OJM A;  4XFS A;  2Y9G A;  3BRF A;  3ZXG A;  3O5W B;  4ZOT A;  1FV2 A;  2ESU A;  4J2S A;  2NYY A;  1G9D A;  3AZV A;  4EFR A;  1YYN A;  3S8J A;  4IY9 A;  2LIQ A;  2QYI B;  4OEE A;  5F8Y A;  4KBB A;  4LO7 B;  4I1E A;  5FZY A;  3OGG A;  1SR4 C;  4QKR A;  1S0E A;  2D44 A;  4I96 A;  3HBW A;  3IM6 A;  4IY8 A;  5BXP A;  41BI A;  1F31 A;  4OWK A;  4END A;  2BEB A;  3UD7 A;  3CRI A;  3UDA A;  1IRP A;  4I4X A;  2NZ9 A;  1BAR A;  3HN1 A;  4QKS A;  3VWC A;  2F8X C;  3D7W B;  4II0 A;  4PC4 A;  3AZW A;  3ZC9 A;  1HWP B;  1ISV A;  4F83 A;  4LO0 A;  4L4I A;  3LTQ A;  3BAD A;  4L4H A;  3RSJ A;  1BLD A;  1RY7 A;  3BAG A;  1PUM B;  1S0F A;  1AFC A;  3P6J A;  4XFT A;  3FJ8 A;  5BP5 C;  2AXM A;  4LO1 A;  3B9U A;  1Q04 A;  2AAI B;  4HR6 C;  4GOY A;  4I7I A;  3AH4 A;  1YTO A;  1HWN B;  2ZR1 B;  4KEI A;  3O4C A;  4OWJ A;  4WBC A;  3BTA A;  3I2X A;  5DUY A;  3UD9 A;  3O44 A;  4QD2 B;  5FNX A;  3IM5 A;  5DZU A;  5BQU C;  1Z4S A;  1DZC A;  2RG9 B;  5BOW A;  4I2S A;  3ZX7 A;  3AKG A;  2GO2 A;  1WBC A;  3ILA A;  1VCL A;  7I1B A;  1FMM S;  1MC9 A;  3FFZ A;  2AFG A;  2ET2 A;  1S0B A;  2MIB A;  2VUA A;  4ZA3 B;  3FJJ A;  1W3F A;  3MAL A;  3HMY A;  1L2H A;  1YXW A;  2FFV A;  3FJB A;  2HZ9 A;  3N7J A;  1P63 A;  4EB2 B;  1EVT A;  5EG6 C;  3O3Q A;  3O4D A;  2VLC A;  4P6A A;  5DVH A;  1FN0 A;  2I1B A;  2K43 A;  1PWA A;  5EHA A;  2ERM A;  2K4A B;  1KNM A;  4F34 A;  1YBI A;  4FVV A;  4P0K A;  4QBV A;  4AN7 B;  3F1R A;  3BAO A;  1S0C A;  1G82 A;  2Y9X E;  2DS0 A;  4USO A;  3OJV A;  1ISY A;  5JLV A;  3FJK A;  4ZBV B;  3FJD A;  1DQO A;  3A07 A;  5B2H A;  2VXR A;  2XOA A;  5BXT A;  3H6R A;  1BFF A;  1W3A A;  1JTC A;  4DEP A;  4LO0 C;  1JLX A;  3C9Z A;  3QYD A;  1PZZ A;  1EPW A;  3VT0 A;  4I1B A;  2KKI A;  3LLP A;  2WRY A;  2E4M A;  5F90 A;  1J0S A;  1HCD A;  4G6J A;  4ISR A;  2D22 A;  2D43 A;  4GAF A;  1ILR 1;  1DZD A;  3A21 A;  3OJ2 A;  4J2X A;  3NJ5 A;  4ZFU B;  4D8H A;  1CVS A;  3CQA A;  4H9W A;  1BA7 A;  1S0G A;  4X37 A;  4OEF A;  1JT3 A;  3WMV A;  1RML A;  3AKF A;  1YF8 B;  3FUO A;  5BXS A;  3FJE A;  3IIR A;  4IYB A;  2ZQN A;  3ZC8 A;  3SNV A;  4QC4 A;  3VUO A;  2VU9 A;  4JQ0 A;  4EEE B;  3T8S A;  4ZGR B;  1DJS B;  3CRG A;  3BAU A;  3R4S A;  1TWE A;  3O4A A;  4IZX A;  4IQP A;  3BX1 C;  3OBT A;  3NBE A;  3ZXD A;  4P0J A;  4ION A;  2F2F A;  3V0A A;  3POK A;  1FGA A;  2NTD A;  1TOO A;  1E0O A;  1V6X A;  4JKX B;  4JPZ A;  6I1B A;  3R4U A;  3BRG C;  2D1Z A;  4QBC A;  4ZLB B;  1RZO B;  1HCE A;  2Q9X A;  1Z2V A;  3H6S E;  4LO2 A;  4XFU A;  3VT1 A;  1ISZ A;  4EFQ A;  3WO2 A;  1V6V A;  3KMV A;  3WMU A;  1II4 A;  1K5U A;  3BAH A;  4OW4 A;  2VSA A;  1JLY A;  3P53 A;  4QO3 A;  2Z48 A;  1IT0 A;  2RST A;  2HWM A;  4I4O A;  1BFC A;  1NUN A;  3RMY A;  3V0B A;  1M2T B;  3FJA A;  3F62 B;  2D23 A;  4JRA A;  4I4Q A;  4GP3 A;  2UUS A;  4LO3 A;  1OQL B;  1QQK A;  2P39 A;  3VSZ A;  8I1B A;  4ZFY B;  4J2Y A;  3FJ9 A;  1N4K A;  1HIB A;  3HOM A;  3VT2 A;  4I37 A;  3O4B A;  2BFH A;  3WIN A;  4GAI A;  1NZK A;  2Q3N B;  4JKQ A;  4I3N A;  5G00 A;  2E4M C;  5F8W A;  1I1E A;  1G9A A;  1JT4 A;  4OEG A;  2WBC A;  1XYF A;  3AJ6 A;  1IJT A;  1ISW A;  1V6W A;  2LIE A;  4CJM A;  5E24 E;  1BFB A;  1QQL A;  1TWM A;  2IHO A;  4X3A A;  3CA0 A;  1TFM B;  3O4O A;  4A7Z A;  3I29 B;  2R9K B;  2DRZ A;  4D0T A;  1BLA A;  3VEQ A;  1DQG A;  1BAS A;  2M49 A;  1EV2 A;  3UJ4 A;  1AXM A;  3FGM A;  4J2K A;  4Z9W B;  4H04 A;  1HKN A;  1XHB A;  2NM1 A;  3CA3 A;  5FZZ A;  5BVP I;  3IAG C;  1PUU B;  2BEA A;  4FGF A;  1XZZ A;  2Y9W C;  3V79 C;  4ISQ A;  4OWL A;  1QXM A;  2GZB A;  4TLP A;  4KEJ A;  2F2F C;  3BRD A;  4USP A;  5FZU A;  4G6M A;  3RMX A;  4I4P A;  4G9N A;  2FGF A;  3Q7W A;  1HWM B;  4G9M A;  5GAQ A;  1AF9 A;  3FJH A;  2FFU A;  1AVU A;  3PME A;  3QR5 A;  1G9B A;  1DFC A;  4P0L A;  2DRE A;  4LO2 C;  2HWA A;  1T9F A;  4Q9P A;  3CA5 A;  1JQZ A;  3BAQ A;  4GP0 A;  5BXR A;  4EKX B;  4Q9G A;  4JAW A;  1V6U A;  1TTU A;  1DIW A;  3CRH A;  2FO1 A; 
#chains in the Genus database with same CATH topology
 1ONK B;  1JT5 A;  3H6R B;  2VSE A;  3UD8 A;  3CA4 A;  4A7Y A;  2QN4 A;  1ISX A;  1IOB A;  3AJ5 A;  2NP0 A;  4LO3 C;  3W9T A;  2DRY A;  1DFQ A;  4MZF B;  3N7K A;  1RG8 A;  3A23 A;  1K5V A;  1WBA A;  3WIN C;  4LO8 B;  1R8N A;  3HSM A;  2J3P A;  4ZFW B;  1AVA C;  3N7L A;  1JT7 A;  3AKI A;  3OBR A;  4Z8S B;  3WA1 A;  1FWV A;  3VSF A;  4HJJ A;  2X2T A;  4DCK C;  4R6U B;  4I6I A;  1UPS A;  1MD6 A;  1IRA X;  1I1B A;  3CAH A;  2X2S A;  2FDB M;  3BA4 A;  3E8L C;  3I2A A;  3N7M A;  3H6Q A;  2NVH A;  2D7R A;  5D61 A;  3PUB A;  1T4Q A;  1BFG A;  4HA2 A;  1JY0 A;  3PHZ A;  1D0H A;  4Q91 A;  3NBN A;  21BI A;  1FWU A;  4X39 A;  3AKH A;  5JMC A;  3CA6 A;  3V0A B;  5DSS B;  4IHZ A;  4H75 A;  4IZE A;  4I4U A;  2RQ9 A;  1ITB A;  3FJI A;  1S0D A;  1Q1U A;  1WD4 A;  4GOV A;  1SR4 A;  5D62 A;  3JUT A;  4OUJ A;  4D0Z A;  5D63 A;  4EFP A;  2D20 A;  1TP0 A;  3WO4 A;  3FJC A;  4LO7 C;  3RTJ B;  1EYL A;  5HPZ A;  3A22 A;  4JP0 A;  2HW9 A;  1W3G A;  5FNW A;  3P6I A;  4I4Y A;  3RTI B;  1G9C A;  4I8M A;  3EF2 A;  3V0B B;  3N0K A;  1AVW B;  1HWO B;  1IHK A;  1Z0H A;  2D24 A;  3BA5 A;  3BA7 A;  4DEN A;  3NBC A;  4I4S A;  3BB2 A;  5EC5 A;  1WD3 A;  1S0L A;  1XG6 A;  3IM7 A;  3O49 A;  2KI4 A;  4YOL A;  5BP5 A;  3CA1 A;  1PC8 B;  1Q03 A;  2P23 A;  1R8O A;  3OGF A;  2YUG A;  2KI6 B;  2MC2 A;  1TIE A;  2ZQO A;  1AVX B;  3WO3 A;  2L5X A;  1A8D A;  3FJF A;  1M16 A;  1GGP B;  3MPP G;  3K1X A;  3AH1 A;  2IWT B;  2K8R A;  1SZ6 B;  4KC3 A;  3AH2 A;  4G1R A;  2Z49 A;  31BI A;  4QAL A;  3UJ0 A;  2D7I A;  3CU1 B;  4I4V A;  1FMZ A;  4KEK A;  5BQU A;  2MLL B;  3NBD A;  5F8S A;  2KLL A;  3Q7X A;  1ABR B;  4XKI A;  2Y9F A;  1FQ9 A;  4QD2 C;  3FUQ A;  4AN6 A;  1DLL A;  5I1B A;  1IIL A;  2KH2 A;  3PG0 A;  1CE7 B;  4I0Y A;  2VXT I;  4A7K A;  4ZKT B;  3Q7Y A;  3BAV A;  4X38 A;  9ILB A;  1FV3 A;  3HAL A;  3TC2 A;  2AQZ A;  4J23 B;  4LO1 C;  3S8K A;  3JRR A;  4I4R A;  3OJM A;  4XFS A;  2Y9G A;  3BRF A;  3ZXG A;  3O5W B;  4ZOT A;  1FV2 A;  2ESU A;  4J2S A;  2NYY A;  1G9D A;  3AZV A;  4EFR A;  1YYN A;  3S8J A;  4IY9 A;  2LIQ A;  2QYI B;  4OEE A;  5F8Y A;  4KBB A;  4LO7 B;  4I1E A;  5FZY A;  3OGG A;  1SR4 C;  4QKR A;  1S0E A;  2D44 A;  4I96 A;  3HBW A;  3IM6 A;  4IY8 A;  5BXP A;  41BI A;  1F31 A;  4MZH A;  4OWK A;  4END A;  2BEB A;  3UD7 A;  3CRI A;  3UDA A;  1IRP A;  4I4X A;  2NZ9 A;  1BAR A;  3HN1 A;  4QKS A;  3VWC A;  2F8X C;  3D7W B;  4II0 A;  4PC4 A;  3AZW A;  3ZC9 A;  1HWP B;  1ISV A;  4F83 A;  4LO0 A;  4L4I A;  3LTQ A;  3BAD A;  4L4H A;  3RSJ A;  1BLD A;  1RY7 A;  3BAG A;  1PUM B;  1S0F A;  1AFC A;  3P6J A;  4XFT A;  3FJ8 A;  5BP5 C;  2AXM A;  4LO1 A;  3B9U A;  1Q04 A;  2AAI B;  4HR6 C;  4GOY A;  4I7I A;  3AH4 A;  1YTO A;  1HWN B;  2ZR1 B;  4KEI A;  3O4C A;  4OWJ A;  4WBC A;  3BTA A;  3I2X A;  5DUY A;  3UD9 A;  3O44 A;  4QD2 B;  5FNX A;  3IM5 A;  5DZU A;  5BQU C;  1Z4S A;  1DZC A;  2RG9 B;  5BOW A;  4I2S A;  3ZX7 A;  3AKG A;  2GO2 A;  1WBC A;  3ILA A;  1VCL A;  7I1B A;  1FMM S;  1MC9 A;  3FFZ A;  2AFG A;  2ET2 A;  1S0B A;  2MIB A;  2VUA A;  4ZA3 B;  3FJJ A;  1W3F A;  3MAL A;  3HMY A;  1L2H A;  1YXW A;  2FFV A;  3FJB A;  2HZ9 A;  3N7J A;  4UY4 A;  1P63 A;  4EB2 B;  1EVT A;  5EG6 C;  3O3Q A;  3O4D A;  2VLC A;  4P6A A;  5DVH A;  1FN0 A;  2I1B A;  2K43 A;  1PWA A;  5EHA A;  2ERM A;  2K4A B;  1KNM A;  4F34 A;  1YBI A;  4FVV A;  4P0K A;  4QBV A;  4AN7 B;  3F1R A;  3BAO A;  1S0C A;  1G82 A;  2Y9X E;  2DS0 A;  4USO A;  3OJV A;  1ISY A;  5JLV A;  3FJK A;  4ZBV B;  3FJD A;  1DQO A;  3A07 A;  5B2H A;  2VXR A;  2XOA A;  5BXT A;  3H6R A;  1BFF A;  1W3A A;  1JTC A;  4DEP A;  4LO0 C;  1JLX A;  3C9Z A;  3QYD A;  1PZZ A;  1EPW A;  3VT0 A;  4I1B A;  2KKI A;  3LLP A;  2WRY A;  2E4M A;  5F90 A;  1J0S A;  1HCD A;  4G6J A;  4ISR A;  2D22 A;  2D43 A;  4GAF A;  1ILR 1;  1DZD A;  3A21 A;  3OJ2 A;  4J2X A;  3NJ5 A;  4ZFU B;  4D8H A;  1CVS A;  3CQA A;  4H9W A;  1BA7 A;  1S0G A;  4X37 A;  4OEF A;  1JT3 A;  3WMV A;  1RML A;  3AKF A;  1YF8 B;  3FUO A;  5BXS A;  3FJE A;  3IIR A;  4IYB A;  2ZQN A;  3ZC8 A;  3SNV A;  4QC4 A;  3VUO A;  2VU9 A;  4JQ0 A;  4EEE B;  3T8S A;  4ZGR B;  1DJS B;  3CRG A;  3BAU A;  3R4S A;  1TWE A;  3O4A A;  4IZX A;  4IQP A;  3BX1 C;  3OBT A;  3NBE A;  3ZXD A;  4P0J A;  4ION A;  2F2F A;  3V0A A;  3POK A;  1FGA A;  2NTD A;  1TOO A;  1E0O A;  1V6X A;  4JKX B;  4JPZ A;  6I1B A;  3R4U A;  3BRG C;  2D1Z A;  4QBC A;  4ZLB B;  1RZO B;  1HCE A;  2Q9X A;  1Z2V A;  3H6S E;  4LO2 A;  4XFU A;  3VT1 A;  1ISZ A;  4EFQ A;  3WO2 A;  1V6V A;  3KMV A;  3WMU A;  1II4 A;  1K5U A;  3BAH A;  4OW4 A;  2VSA A;  1JLY A;  3P53 A;  4QO3 A;  2Z48 A;  1IT0 A;  2RST A;  2HWM A;  4I4O A;  1BFC A;  1NUN A;  3RMY A;  3V0B A;  1M2T B;  3FJA A;  3F62 B;  2D23 A;  2NS2 A;  4JRA A;  4I4Q A;  4GP3 A;  2UUS A;  4LO3 A;  1OQL B;  1QQK A;  2P39 A;  3VSZ A;  8I1B A;  4ZFY B;  4J2Y A;  3FJ9 A;  1N4K A;  1HIB A;  3HOM A;  3VT2 A;  4I37 A;  3O4B A;  2BFH A;  3WIN A;  4GAI A;  1NZK A;  2Q3N B;  4JKQ A;  4I3N A;  5G00 A;  2E4M C;  5F8W A;  1I1E A;  1G9A A;  1JT4 A;  4OEG A;  2WBC A;  1XYF A;  3AJ6 A;  1IJT A;  1ISW A;  1V6W A;  2LIE A;  4CJM A;  5E24 E;  1BFB A;  1QQL A;  1TWM A;  2IHO A;  4X3A A;  3CA0 A;  1TFM B;  3O4O A;  4A7Z A;  3I29 B;  2R9K B;  2DRZ A;  4D0T A;  1BLA A;  3VEQ A;  1DQG A;  1BAS A;  4MZG B;  2M49 A;  1EV2 A;  3UJ4 A;  1AXM A;  3FGM A;  4J2K A;  4Z9W B;  4H04 A;  1HKN A;  1XHB A;  2NM1 A;  3CA3 A;  5FZZ A;  5BVP I;  3IAG C;  1PUU B;  2BEA A;  4FGF A;  1XZZ A;  2Y9W C;  3V79 C;  4ISQ A;  4OWL A;  1QXM A;  2GZB A;  4TLP A;  4KEJ A;  2F2F C;  3BRD A;  4USP A;  5FZU A;  4G6M A;  3RMX A;  4I4P A;  4G9N A;  2FGF A;  3Q7W A;  1HWM B;  4G9M A;  5GAQ A;  1AF9 A;  3FJH A;  2FFU A;  1AVU A;  3PME A;  3QR5 A;  1G9B A;  1DFC A;  4P0L A;  2DRE A;  4LO2 C;  2HWA A;  1T9F A;  4Q9P A;  3CA5 A;  1JQZ A;  3BAQ A;  4GP0 A;  5BXR A;  4EKX B;  4Q9G A;  4JAW A;  1V6U A;  1TTU A;  1DIW A;  3CRH A;  2FO1 A; 
#chains in the Genus database with same CATH homology
 1ONK B;  1JT5 A;  3H6R B;  2VSE A;  3UD8 A;  3CA4 A;  4A7Y A;  2QN4 A;  1ISX A;  1IOB A;  3AJ5 A;  2NP0 A;  4LO3 C;  3W9T A;  2DRY A;  1DFQ A;  4MZF B;  3N7K A;  1RG8 A;  3A23 A;  1K5V A;  1WBA A;  3WIN C;  4LO8 B;  1R8N A;  3HSM A;  2J3P A;  4ZFW B;  1AVA C;  3N7L A;  1JT7 A;  3AKI A;  3OBR A;  4Z8S B;  3WA1 A;  1FWV A;  3VSF A;  4HJJ A;  2X2T A;  4DCK C;  4R6U B;  4I6I A;  1UPS A;  1MD6 A;  1IRA X;  1I1B A;  3CAH A;  2X2S A;  2FDB M;  3BA4 A;  3E8L C;  3I2A A;  3N7M A;  3H6Q A;  2NVH A;  2D7R A;  5D61 A;  3PUB A;  1T4Q A;  1BFG A;  4HA2 A;  1JY0 A;  3PHZ A;  1D0H A;  4Q91 A;  3NBN A;  21BI A;  1FWU A;  4X39 A;  3AKH A;  5JMC A;  3CA6 A;  3V0A B;  5DSS B;  4IHZ A;  4H75 A;  4IZE A;  4I4U A;  2RQ9 A;  1ITB A;  3FJI A;  1S0D A;  1Q1U A;  1WD4 A;  4GOV A;  1SR4 A;  5D62 A;  3JUT A;  4OUJ A;  4D0Z A;  5D63 A;  4EFP A;  2D20 A;  1TP0 A;  3WO4 A;  3FJC A;  4LO7 C;  3RTJ B;  1EYL A;  5HPZ A;  3A22 A;  4JP0 A;  2HW9 A;  1W3G A;  5FNW A;  3P6I A;  4I4Y A;  3RTI B;  1G9C A;  4I8M A;  3EF2 A;  3V0B B;  3N0K A;  1AVW B;  1HWO B;  1IHK A;  1Z0H A;  2D24 A;  3BA5 A;  3BA7 A;  4DEN A;  3NBC A;  4I4S A;  3BB2 A;  5EC5 A;  1WD3 A;  1S0L A;  1XG6 A;  3IM7 A;  3O49 A;  2KI4 A;  4YOL A;  5BP5 A;  3CA1 A;  1PC8 B;  1Q03 A;  2P23 A;  1R8O A;  3OGF A;  2YUG A;  2KI6 B;  2MC2 A;  1TIE A;  2ZQO A;  1AVX B;  3WO3 A;  2L5X A;  1A8D A;  3FJF A;  1M16 A;  1GGP B;  3MPP G;  3K1X A;  3AH1 A;  2IWT B;  2K8R A;  1SZ6 B;  4KC3 A;  3AH2 A;  4G1R A;  2Z49 A;  31BI A;  4QAL A;  3UJ0 A;  2D7I A;  3CU1 B;  4I4V A;  1FMZ A;  4KEK A;  5BQU A;  2MLL B;  3NBD A;  5F8S A;  2KLL A;  3Q7X A;  1ABR B;  4XKI A;  2Y9F A;  1FQ9 A;  4QD2 C;  3FUQ A;  4AN6 A;  1DLL A;  5I1B A;  1IIL A;  2KH2 A;  3PG0 A;  1CE7 B;  4I0Y A;  2VXT I;  4A7K A;  4ZKT B;  3Q7Y A;  3BAV A;  4X38 A;  9ILB A;  1FV3 A;  3HAL A;  3TC2 A;  2AQZ A;  4J23 B;  4LO1 C;  3S8K A;  3JRR A;  4I4R A;  3OJM A;  4XFS A;  2Y9G A;  3BRF A;  3ZXG A;  3O5W B;  4ZOT A;  1FV2 A;  2ESU A;  4J2S A;  2NYY A;  1G9D A;  3AZV A;  4EFR A;  1YYN A;  3S8J A;  4IY9 A;  2LIQ A;  2QYI B;  4OEE A;  5F8Y A;  4KBB A;  4LO7 B;  4I1E A;  5FZY A;  3OGG A;  1SR4 C;  4QKR A;  1S0E A;  2D44 A;  4I96 A;  3HBW A;  3IM6 A;  4IY8 A;  5BXP A;  41BI A;  1F31 A;  4MZH A;  4OWK A;  4END A;  2BEB A;  3UD7 A;  3CRI A;  3UDA A;  1IRP A;  4I4X A;  2NZ9 A;  1BAR A;  3HN1 A;  4QKS A;  3VWC A;  2F8X C;  3D7W B;  4II0 A;  4PC4 A;  3AZW A;  3ZC9 A;  1HWP B;  1ISV A;  4F83 A;  4LO0 A;  4L4I A;  3LTQ A;  3BAD A;  4L4H A;  3RSJ A;  1BLD A;  1RY7 A;  3BAG A;  1PUM B;  1S0F A;  1AFC A;  3P6J A;  4XFT A;  3FJ8 A;  5BP5 C;  2AXM A;  4LO1 A;  3B9U A;  1Q04 A;  2AAI B;  4HR6 C;  4GOY A;  4I7I A;  3AH4 A;  1YTO A;  1HWN B;  2ZR1 B;  4KEI A;  3O4C A;  4OWJ A;  4WBC A;  3BTA A;  3I2X A;  5DUY A;  3UD9 A;  3O44 A;  4QD2 B;  5FNX A;  3IM5 A;  5DZU A;  5BQU C;  1Z4S A;  1DZC A;  2RG9 B;  5BOW A;  4I2S A;  3ZX7 A;  3AKG A;  2GO2 A;  1WBC A;  3ILA A;  1VCL A;  7I1B A;  1FMM S;  1MC9 A;  3FFZ A;  2AFG A;  2ET2 A;  1S0B A;  2MIB A;  2VUA A;  4ZA3 B;  3FJJ A;  1W3F A;  3MAL A;  3HMY A;  1L2H A;  1YXW A;  2FFV A;  3FJB A;  2HZ9 A;  3N7J A;  4UY4 A;  1P63 A;  4EB2 B;  1EVT A;  5EG6 C;  3O3Q A;  3O4D A;  2VLC A;  4P6A A;  5DVH A;  1FN0 A;  2I1B A;  2K43 A;  1PWA A;  5EHA A;  2ERM A;  2K4A B;  1KNM A;  4F34 A;  1YBI A;  4FVV A;  4P0K A;  4QBV A;  4AN7 B;  3F1R A;  3BAO A;  1S0C A;  1G82 A;  2Y9X E;  2DS0 A;  4USO A;  3OJV A;  1ISY A;  5JLV A;  3FJK A;  4ZBV B;  3FJD A;  1DQO A;  3A07 A;  5B2H A;  2VXR A;  2XOA A;  5BXT A;  3H6R A;  1BFF A;  1W3A A;  1JTC A;  4DEP A;  4LO0 C;  1JLX A;  3C9Z A;  3QYD A;  1PZZ A;  1EPW A;  3VT0 A;  4I1B A;  2KKI A;  3LLP A;  2WRY A;  2E4M A;  5F90 A;  1J0S A;  1HCD A;  4G6J A;  4ISR A;  2D22 A;  2D43 A;  4GAF A;  1ILR 1;  1DZD A;  3A21 A;  3OJ2 A;  4J2X A;  3NJ5 A;  4ZFU B;  4D8H A;  1CVS A;  3CQA A;  4H9W A;  1BA7 A;  1S0G A;  4X37 A;  4OEF A;  1JT3 A;  3WMV A;  1RML A;  3AKF A;  1YF8 B;  3FUO A;  5BXS A;  3FJE A;  3IIR A;  4IYB A;  2ZQN A;  3ZC8 A;  3SNV A;  4QC4 A;  3VUO A;  2VU9 A;  4JQ0 A;  4EEE B;  3T8S A;  4ZGR B;  1DJS B;  3CRG A;  3BAU A;  3R4S A;  1TWE A;  3O4A A;  4IZX A;  4IQP A;  3BX1 C;  3OBT A;  3NBE A;  3ZXD A;  4P0J A;  4ION A;  2F2F A;  3V0A A;  3POK A;  1FGA A;  2NTD A;  1TOO A;  1E0O A;  1V6X A;  4JKX B;  4JPZ A;  6I1B A;  3R4U A;  3BRG C;  2D1Z A;  4QBC A;  4ZLB B;  1RZO B;  1HCE A;  2Q9X A;  1Z2V A;  3H6S E;  4LO2 A;  4XFU A;  3VT1 A;  1ISZ A;  4EFQ A;  3WO2 A;  1V6V A;  3KMV A;  3WMU A;  1II4 A;  1K5U A;  3BAH A;  4OW4 A;  2VSA A;  1JLY A;  3P53 A;  4QO3 A;  2Z48 A;  1IT0 A;  2RST A;  2HWM A;  4I4O A;  1BFC A;  1NUN A;  3RMY A;  3V0B A;  1M2T B;  3FJA A;  3F62 B;  2D23 A;  2NS2 A;  4JRA A;  4I4Q A;  4GP3 A;  2UUS A;  4LO3 A;  1OQL B;  1QQK A;  2P39 A;  3VSZ A;  8I1B A;  4ZFY B;  4J2Y A;  3FJ9 A;  1N4K A;  1HIB A;  3HOM A;  3VT2 A;  4I37 A;  3O4B A;  2BFH A;  3WIN A;  4GAI A;  1NZK A;  2Q3N B;  4JKQ A;  4I3N A;  5G00 A;  2E4M C;  5F8W A;  1I1E A;  1G9A A;  1JT4 A;  4OEG A;  2WBC A;  1XYF A;  3AJ6 A;  1IJT A;  1ISW A;  1V6W A;  2LIE A;  4CJM A;  5E24 E;  1BFB A;  1QQL A;  1TWM A;  2IHO A;  4X3A A;  3CA0 A;  1TFM B;  3O4O A;  4A7Z A;  3I29 B;  2R9K B;  2DRZ A;  4D0T A;  1BLA A;  3VEQ A;  1DQG A;  1BAS A;  4MZG B;  2M49 A;  1EV2 A;  3UJ4 A;  1AXM A;  3FGM A;  4J2K A;  4Z9W B;  4H04 A;  1HKN A;  1XHB A;  2NM1 A;  3CA3 A;  5FZZ A;  5BVP I;  3IAG C;  1PUU B;  2BEA A;  4FGF A;  1XZZ A;  2Y9W C;  3V79 C;  4ISQ A;  4OWL A;  1QXM A;  2GZB A;  4TLP A;  4KEJ A;  2F2F C;  3BRD A;  4USP A;  5FZU A;  4G6M A;  3RMX A;  4I4P A;  4G9N A;  2FGF A;  3Q7W A;  1HWM B;  4G9M A;  5GAQ A;  1AF9 A;  3FJH A;  2FFU A;  1AVU A;  3PME A;  3QR5 A;  1G9B A;  1DFC A;  4P0L A;  2DRE A;  4LO2 C;  2HWA A;  1T9F A;  4Q9P A;  3CA5 A;  1JQZ A;  3BAQ A;  4GP0 A;  5BXR A;  4EKX B;  4Q9G A;  4JAW A;  1V6U A;  1TTU A;  1DIW A;  3CRH A;  2FO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...