2E4MA

Crystal structure of hemagglutinin subcomponent complex (ha-33/ha-17) from clostridium botulinum serotype d strain 4947
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
b'SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYTIKVMDNTSLILTWDAPLSSVSVKTDTNTNNQYWYLLQDYISRNVILRNYMNPNLVLQYNTDDTLIVSTQTNSNNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWTIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQTANGTHVIVDSYHGNTNQQWIINLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Main hemagglutinin component
publication title A Novel Subunit Structure of Clostridium botulinum Serotype D Toxin Complex with Three Extended Arms
pubmed doi rcsb
molecule tags Toxin
total genus 92
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2e4mA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2e4mA01
1S0EA 3IAGC 3WINC 3N7MA 4ZFWB 4G6JA 4DCKC 1DQGA 1AF9A 3SNVA 3NBEA 3Q7XA 1IOBA 1R8NA 1DFQA 2ZQNA 3VSZA 4XFUA 1XZZA 1JT4A 4PC4A 1D0HA 2R9KB 1ONKB 2F2FA 3JUTA 1P63A 4QD2C 2ET2A 4F83A 5BXPA 3BRFA 5FNWA 1DIWA 3UJ4A 2RSTA 4LO7C 1DZDA 4FGFA 4II0A 5FZYA 4QALA 1S0BA 4KBBA 4I7IA 2YUGA 1MD6A 4EKXB 3UD9A 4I4QA 4IZXA 3RSJA 4OWLA 2GO2A 2Y9XE 3FJBA 3BA7A 1MC9A 1TWEA 2XOAA 4KEJA 3LTQA 6I1BA 4LO2C 3RTJB 3A23A 4EEEB 3HSMA 4I3NA 2DS0A 5HPZA 2KI4A 2IWTB 5BP5C 4L4HA 1A8DA 5EC5A 4D0ZA 2F8XC 1SR4A 1BFCA 3VT2A 1GGPB 1IHKA 2KI6B 2BEAA 5BQUA 5DVHA 4D0TA 1FQ9A 2DRYA 4XFTA 4ZGRB 4OWJA 3FFZA 1AVWB 3QYDA 4G1RA 5FNXA 1BLDA 4Z8SB 4USPA 1ISWA 4ZA3B 1K5VA 2D22A 2LIEA 3FJ8A 3CRIA 3E8LC 3O5WB 2I1BA 3PHZA 1NZKA 2AQZA 3CA1A 2D44A 2BEBA 3CA5A 1IILA 1TOOA 3VEQA 4P0KA 3ZXDA 3A22A 4L4IA 1V6VA 1K5UA 3CA6A 1T4QA 3A07A 1FMMS 1UPSA 1YYNA 4WBCA 2K4AB 4Z9WB 9ILBA 4P0LA 5F8YA 1FMZA 1DLLA 2GZBA 2Y9FA 3FJHA 3IM7A 1IJTA 1EVTA 3FJFA 4F34A 3I2XA 5BXTA 3FJAA 2HWAA 2NTDA 1WD3A 3CA3A 4I4PA 2X2SA 3OJVA 4LO3C 1JTCA 4KC3A 4EFPA 3VUOA 4D8HA 2Y9GA 1HWNB 4OEGA 5BXSA 4GP0A 5DUYA 3NJ5A 3PUBA 2HZ9A 4HJJA 3AH4A 1YXWA 1G9AA 1IRPA 2M49A 3VSFA 4JAWA 1E0OA 4HR6C 4I4YA 2P23A 1RMLA 3HALA 2VUAA 3WO4A 3CRGA 4I1EA 4X39A 3MPPG 4XFSA 1R8OA 4G6MA 1FV3A 2ZQOA 1Q1UA 1DQOA 1RY7A 5EHAA 2FFVA 3N7JA 4X3AA 3P6JA 1KNMA 2X2TA 4GOYA 2VU9A 3LLPA 4I2SA 4J2SA 1HWMB 1XHBA 1M16A 3JRRA 3TC2A 4H9WA 4OUJA 4HA2A 2NM1A 2D23A 3O4OA 4QKRA 3T8SA 1JQZA 4A7ZA 1HWOB 4JPZA 1RG8A 3FJDA 3S8KA 4AN7B 1HIBA 3N7KA 1V6XA 4I8MA 1YTOA 3S8JA 3KMVA 1V6UA 4I96A 4QBCA 2D7IA 2F2FC 5GAQA 1JT5A 2QN4A 3FJEA 4I1BA 3IM6A 3V0AA 2D7RA 2Y9WC 3V0BA 2NVHA 4EB2B 1T9FA 3ZC9A 4X37A 4I37A 4ZFUB 2AXMA 3OBRA 4IYBA 4QO3A 1HKNA 3UD7A 1SZ6B 3OGGA 3ZX7A 3RMYA 4LO0A 1G9CA 1M2TB 3O4BA 4H04A 5D61A 2J3PA 3CAHA 2BFHA 1AVXB 3O49A 2MIBA 4I4VA 2Q3NB 3BAHA 4IY9A 3O44A 1SR4C 2KKIA 3CRHA 4G9MA 1TTUA 4IQPA 3Q7YA 3K1XA 3MALA 4LO1A 2KH2A 5G00A 2VXRA 3NBDA 5BQUC 1JT3A 2DREA 3AKGA 2K8RA 31BIA 5D62A 3WA1A 2E4MA 3UD8A 2K43A 2UUSA 3FJCA 4I4SA 4EFQA 1OQLB 2D20A 1G82A 5BXRA 3ZXGA 4Q91A 3FJIA 3ZC8A 2VXTI 3F1RA 1IRAX 3N0KA 2NP0A 3AKIA 4IY8A 1I1EA 1Q03A 4IONA 4I4UA 4ENDA 1PWAA 4QD2B 3POKA 3CA4A 3F62B 4ZLBB 2FFUA 1W3AA 3BRDA 3BB2A 3HN1A 1JY0A 3R4SA 1F31A 2NYYA 1Q04A 5B2HA 1HCEA 3FUOA 2D24A 3AKFA 3FUQA 5JLVA 3V0AB 4DENA 21BIA 3O3QA 1BFBA 1BASA 1JT7A 1S0GA 5FZUA 3V0BB 1NUNA 1DJSB 5F8SA 4Q9PA 2IHOA 3AH1A 3WMUA 1I1BA 4P6AA 1HCDA 3H6SE 3PMEA 8I1BA 3OJMA 3FGMA 2RQ9A 4DEPA 1S0CA 3NBNA 3H6RA 3BA5A 3EF2A 3BAGA 1W3FA 5BVPI 2VSEA 4I4OA 3WINA 4CJMA 4EFRA 4KEKA 3V79C 4JQ0A 4I4RA 4R6UB 4LO8B 3P6IA 2WRYA 5I1BA 1ISZA 5JMCA 2Z48A 1II4A 3HBWA 4I4XA 1YBIA 4I0YA 4USOA 1XYFA 3H6QA 1FV2A 5E24E 1PUUB 4A7YA 3AH2A 2ERMA 1BARA 2Z49A 3RTIB 1Z2VA 3O4AA 1G9DA 2Q9XA 3B9UA 4GP3A 1S0LA 2RG9B 2ZR1B 4XKIA 1AXMA 4ISQA 3IIRA 1FN0A 4FVVA 3BX1C 4LO2A 5D63A 2MC2A 4JRAA 1DFCA 4GOVA 3CA0A 3OBTA 1ILR1 4ZOTA 4JKQA 5BP5A 3CQAA 4IHZA 1AVAC 1S0DA 4J23B 4OW4A 3BADA 3PG0A 3HMYA 3UJ0A 3AKHA 4X38A 2QYIB 3D7WB 2AAIB 1WBCA 4OEFA 1AVUA 2D43A 1S0FA 1G9BA 3FJJA 3BRGC 1TWMA 4I6IA 2VSAA 3CU1B 1W3GA 5DZUA 1BFFA 1CVSA 3BAVA 1YF8B 1FWUA 5FZZA 2MLLB 4LO0C 1JLYA 4TLPA 2FO1A 4KEIA 3VWCA 4JKXB 4G9NA 3FJ9A 3BAOA 3C9ZA 1HWPB 1QQKA 4OWKA 1RZOB 4QKSA 1WD4A 1FGAA 3H6RB 3RMXA 1ITBA 2VLCA 4ZBVB 1PC8B 3Q7WA 4LO1C 1PZZA 3A21A 3IM5A 2FGFA 2L5XA 2WBCA 3AZVA 1ISVA 41BIA 2AFGA 4IZEA 4A7KA 3AJ6A 1V6WA 3VT1A 1BLAA 2D1ZA 1PUMB 4YOLA 2E4MC 2HWMA 2P39A 3VT0A 1FWVA 4JP0A 4GAIA 1ISYA 2KLLA 4LO7B 3W9TA 1J0SA 5F90A 5EG6C 5BOWA 5DSSB 4GAFA 1QQLA 1EV2A 3NBCA 2ESUA 1QXMA 3I29B 1WBAA 4LO3A 4OEEA 3BAUA 4P0JA 2FDBM 3OJ2A 3AZWA 4J2KA 3BA4A 1AFCA 1CE7B 1N4KA 1TIEA 4QBVA 3UDAA 1XG6A 1IT0A 4J2XA 3QR5A 1BA7A 1JLXA 3O4CA 4ZKTB 4ISRA 1BFGA 3AJ5A 1ABRB 5F8WA 2HW9A 4J2YA 3N7LA 1TP0A 1VCLA 7I1BA 3O4DA 1EPWA 3I2AA 1TFMB 4Q9GA 2LIQA 1Z0HA 4ZFYB 3OGFA 3BTAA 3R4UA 1L2HA 3HOMA 3WO3A 1Z4SA 1EYLA 2NZ9A 4QC4A 1DZCA 3ILAA 3FJKA 3WMVA 3P53A 2DRZA 3BAQA 4AN6A 3WO2A 1ISXA
chains in the Genus database with same CATH superfamily
1S0EA 3IAGC 3WINC 3N7MA 4ZFWB 4G6JA 4DCKC 1DQGA 1AF9A 3SNVA 3NBEA 3Q7XA 1IOBA 1R8NA 1DFQA 2ZQNA 3VSZA 4XFUA 1XZZA 1JT4A 4PC4A 1D0HA 2R9KB 1ONKB 2F2FA 3JUTA 1P63A 4QD2C 2ET2A 4F83A 5BXPA 3BRFA 5FNWA 1DIWA 3UJ4A 2RSTA 4LO7C 1DZDA 4FGFA 4II0A 5FZYA 4QALA 1S0BA 4KBBA 4I7IA 2YUGA 1MD6A 4EKXB 3UD9A 4I4QA 4IZXA 3RSJA 4OWLA 2GO2A 2Y9XE 3FJBA 3BA7A 1MC9A 1TWEA 2XOAA 4KEJA 3LTQA 6I1BA 4LO2C 3RTJB 3A23A 4EEEB 3HSMA 4I3NA 2DS0A 5HPZA 2KI4A 2IWTB 5BP5C 4L4HA 1A8DA 5EC5A 4D0ZA 2F8XC 1SR4A 1BFCA 3VT2A 1GGPB 1IHKA 2KI6B 2BEAA 5BQUA 5DVHA 4D0TA 1FQ9A 2DRYA 4XFTA 4ZGRB 4OWJA 3FFZA 1AVWB 3QYDA 4G1RA 5FNXA 1BLDA 4Z8SB 4USPA 1ISWA 4ZA3B 1K5VA 2D22A 2LIEA 3FJ8A 3CRIA 3E8LC 4MZHA 3O5WB 2I1BA 3PHZA 1NZKA 2AQZA 3CA1A 2D44A 2BEBA 3CA5A 1IILA 1TOOA 3VEQA 4P0KA 3ZXDA 3A22A 4L4IA 1V6VA 1K5UA 3CA6A 1T4QA 3A07A 1FMMS 1UPSA 1YYNA 4WBCA 2K4AB 4Z9WB 9ILBA 4P0LA 5F8YA 1FMZA 1DLLA 2GZBA 2Y9FA 3FJHA 3IM7A 1IJTA 1EVTA 3FJFA 4F34A 3I2XA 5BXTA 3FJAA 2HWAA 2NTDA 1WD3A 3CA3A 4I4PA 2X2SA 3OJVA 4LO3C 1JTCA 4KC3A 4EFPA 3VUOA 4D8HA 2Y9GA 1HWNB 4OEGA 5BXSA 4GP0A 5DUYA 3NJ5A 3PUBA 2HZ9A 4HJJA 4MZGB 3AH4A 1YXWA 1G9AA 1IRPA 2M49A 3VSFA 4JAWA 1E0OA 4HR6C 4I4YA 2P23A 1RMLA 3HALA 2VUAA 3WO4A 3CRGA 4I1EA 4X39A 3MPPG 4XFSA 1R8OA 4G6MA 1FV3A 2ZQOA 1Q1UA 1DQOA 1RY7A 5EHAA 2FFVA 3N7JA 4X3AA 3P6JA 1KNMA 2X2TA 4GOYA 4UY4A 2VU9A 3LLPA 4I2SA 4J2SA 1HWMB 1XHBA 1M16A 3JRRA 3TC2A 4H9WA 4OUJA 4HA2A 2NM1A 2D23A 3O4OA 4QKRA 3T8SA 1JQZA 4A7ZA 1HWOB 4JPZA 1RG8A 3FJDA 3S8KA 4AN7B 1HIBA 3N7KA 1V6XA 4I8MA 1YTOA 3S8JA 3KMVA 1V6UA 4I96A 4QBCA 2D7IA 2F2FC 5GAQA 1JT5A 2QN4A 3FJEA 4I1BA 3IM6A 3V0AA 2D7RA 2Y9WC 3V0BA 2NVHA 4EB2B 1T9FA 3ZC9A 4X37A 4I37A 4ZFUB 2AXMA 3OBRA 4IYBA 4QO3A 1HKNA 3UD7A 1SZ6B 3OGGA 3ZX7A 3RMYA 4LO0A 1G9CA 1M2TB 3O4BA 4H04A 5D61A 2J3PA 3CAHA 2BFHA 1AVXB 3O49A 2MIBA 4I4VA 2Q3NB 3BAHA 4IY9A 3O44A 1SR4C 2KKIA 3CRHA 4G9MA 1TTUA 4IQPA 3Q7YA 3K1XA 3MALA 4LO1A 2KH2A 5G00A 2VXRA 3NBDA 5BQUC 1JT3A 2DREA 3AKGA 2K8RA 31BIA 4MZFB 5D62A 3WA1A 2E4MA 3UD8A 2K43A 2UUSA 3FJCA 4I4SA 4EFQA 1OQLB 2D20A 1G82A 5BXRA 3ZXGA 4Q91A 3FJIA 3ZC8A 2VXTI 3F1RA 1IRAX 3N0KA 2NP0A 3AKIA 4IY8A 1I1EA 1Q03A 4IONA 4I4UA 4ENDA 1PWAA 4QD2B 3POKA 3CA4A 3F62B 4ZLBB 2FFUA 1W3AA 3BRDA 3BB2A 3HN1A 1JY0A 3R4SA 1F31A 2NYYA 1Q04A 5B2HA 1HCEA 3FUOA 2D24A 3AKFA 3FUQA 5JLVA 3V0AB 4DENA 21BIA 3O3QA 1BFBA 1BASA 1JT7A 1S0GA 5FZUA 3V0BB 1NUNA 1DJSB 5F8SA 4Q9PA 2IHOA 3AH1A 3WMUA 1I1BA 4P6AA 1HCDA 3H6SE 3PMEA 8I1BA 3OJMA 3FGMA 2RQ9A 4DEPA 1S0CA 3NBNA 2NS2A 3H6RA 3BA5A 3EF2A 3BAGA 1W3FA 5BVPI 2VSEA 4I4OA 3WINA 4CJMA 4EFRA 4KEKA 3V79C 4JQ0A 4I4RA 4R6UB 4LO8B 3P6IA 2WRYA 5I1BA 1ISZA 5JMCA 2Z48A 1II4A 3HBWA 4I4XA 1YBIA 4I0YA 4USOA 1XYFA 3H6QA 1FV2A 5E24E 1PUUB 4A7YA 3AH2A 2ERMA 1BARA 2Z49A 3RTIB 1Z2VA 3O4AA 1G9DA 2Q9XA 3B9UA 4GP3A 1S0LA 2RG9B 2ZR1B 4XKIA 1AXMA 4ISQA 3IIRA 1FN0A 4FVVA 3BX1C 4LO2A 5D63A 2MC2A 4JRAA 1DFCA 4GOVA 3CA0A 3OBTA 1ILR1 4ZOTA 4JKQA 5BP5A 3CQAA 4IHZA 1AVAC 1S0DA 4J23B 4OW4A 3BADA 3PG0A 3HMYA 3UJ0A 3AKHA 4X38A 2QYIB 3D7WB 2AAIB 1WBCA 4OEFA 1AVUA 2D43A 1S0FA 1G9BA 3FJJA 3BRGC 1TWMA 4I6IA 2VSAA 3CU1B 1W3GA 5DZUA 1BFFA 1CVSA 3BAVA 1YF8B 1FWUA 5FZZA 2MLLB 4LO0C 1JLYA 4TLPA 2FO1A 4KEIA 3VWCA 4JKXB 4G9NA 3FJ9A 3BAOA 3C9ZA 1HWPB 1QQKA 4OWKA 1RZOB 4QKSA 1WD4A 1FGAA 3H6RB 3RMXA 1ITBA 2VLCA 4ZBVB 1PC8B 3Q7WA 4LO1C 1PZZA 3A21A 3IM5A 2FGFA 2L5XA 2WBCA 3AZVA 1ISVA 41BIA 2AFGA 4IZEA 4A7KA 3AJ6A 1V6WA 3VT1A 1BLAA 2D1ZA 1PUMB 4YOLA 2E4MC 2HWMA 2P39A 3VT0A 1FWVA 4JP0A 4GAIA 1ISYA 2KLLA 4LO7B 3W9TA 1J0SA 5F90A 5EG6C 5BOWA 5DSSB 4GAFA 1QQLA 1EV2A 3NBCA 2ESUA 1QXMA 3I29B 1WBAA 4LO3A 4OEEA 3BAUA 4P0JA 2FDBM 3OJ2A 3AZWA 4J2KA 3BA4A 1AFCA 1CE7B 1N4KA 1TIEA 4QBVA 3UDAA 1XG6A 1IT0A 4J2XA 3QR5A 1BA7A 1JLXA 3O4CA 4ZKTB 4ISRA 1BFGA 3AJ5A 1ABRB 5F8WA 2HW9A 4J2YA 3N7LA 1TP0A 1VCLA 7I1BA 3O4DA 1EPWA 3I2AA 1TFMB 4H75A 4Q9GA 2LIQA 1Z0HA 4ZFYB 3OGFA 3BTAA 3R4UA 1L2HA 3HOMA 3WO3A 1Z4SA 1EYLA 2NZ9A 4QC4A 1DZCA 3ILAA 3FJKA 3WMVA 3P53A 2DRZA 3BAQA 4AN6A 3WO2A 1ISXA
chains in the Genus database with same CATH topology
1S0EA 3IAGC 3WINC 3N7MA 4ZFWB 4G6JA 4DCKC 1DQGA 1AF9A 3SNVA 3NBEA 3Q7XA 1IOBA 1R8NA 1DFQA 2ZQNA 3VSZA 4XFUA 1XZZA 1JT4A 4PC4A 1D0HA 2R9KB 1ONKB 2F2FA 3JUTA 1P63A 4QD2C 2ET2A 4F83A 5BXPA 3BRFA 5FNWA 1DIWA 3UJ4A 2RSTA 4LO7C 1DZDA 4FGFA 4II0A 5FZYA 4QALA 1S0BA 4KBBA 4I7IA 2YUGA 1MD6A 4EKXB 3UD9A 4I4QA 4IZXA 3RSJA 4OWLA 2GO2A 2Y9XE 3FJBA 3BA7A 1MC9A 1TWEA 2XOAA 4KEJA 3LTQA 6I1BA 4LO2C 3RTJB 3A23A 4EEEB 3HSMA 4I3NA 2DS0A 5HPZA 2KI4A 2IWTB 5BP5C 4L4HA 1A8DA 5EC5A 4D0ZA 2F8XC 1SR4A 1BFCA 3VT2A 1GGPB 1IHKA 2KI6B 2BEAA 5BQUA 5DVHA 4D0TA 1FQ9A 2DRYA 4XFTA 4ZGRB 4OWJA 3FFZA 1AVWB 3QYDA 4G1RA 5FNXA 1BLDA 4Z8SB 4USPA 1ISWA 4ZA3B 1K5VA 2D22A 2LIEA 3FJ8A 3CRIA 3E8LC 4MZHA 3O5WB 2I1BA 3PHZA 1NZKA 2AQZA 3CA1A 2D44A 2BEBA 3CA5A 1IILA 1TOOA 3VEQA 4P0KA 3ZXDA 3A22A 4L4IA 1V6VA 1K5UA 3CA6A 1T4QA 3A07A 1FMMS 1UPSA 1YYNA 4WBCA 2K4AB 4Z9WB 9ILBA 4P0LA 5F8YA 1FMZA 1DLLA 2GZBA 2Y9FA 3FJHA 3IM7A 1IJTA 1EVTA 3FJFA 4F34A 3I2XA 5BXTA 3FJAA 2HWAA 2NTDA 1WD3A 3CA3A 4I4PA 2X2SA 3OJVA 4LO3C 1JTCA 4KC3A 4EFPA 3VUOA 4D8HA 2Y9GA 1HWNB 4OEGA 5BXSA 4GP0A 5DUYA 3NJ5A 3PUBA 2HZ9A 4HJJA 4MZGB 3AH4A 1YXWA 1G9AA 1IRPA 2M49A 3VSFA 4JAWA 1E0OA 4HR6C 4I4YA 2P23A 1RMLA 3HALA 2VUAA 3WO4A 3CRGA 4I1EA 4X39A 3MPPG 4XFSA 1R8OA 4G6MA 1FV3A 2ZQOA 1Q1UA 1DQOA 1RY7A 5EHAA 2FFVA 3N7JA 4X3AA 3P6JA 1KNMA 2X2TA 4GOYA 4UY4A 2VU9A 3LLPA 4I2SA 4J2SA 1HWMB 1XHBA 1M16A 3JRRA 3TC2A 4H9WA 4OUJA 4HA2A 2NM1A 2D23A 3O4OA 4QKRA 3T8SA 1JQZA 4A7ZA 1HWOB 4JPZA 1RG8A 3FJDA 3S8KA 4AN7B 1HIBA 3N7KA 1V6XA 4I8MA 1YTOA 3S8JA 3KMVA 1V6UA 4I96A 4QBCA 2D7IA 2F2FC 5GAQA 1JT5A 2QN4A 3FJEA 4I1BA 3IM6A 3V0AA 2D7RA 2Y9WC 3V0BA 2NVHA 4EB2B 1T9FA 3ZC9A 4X37A 4I37A 4ZFUB 2AXMA 3OBRA 4IYBA 4QO3A 1HKNA 3UD7A 1SZ6B 3OGGA 3ZX7A 3RMYA 4LO0A 1G9CA 1M2TB 3O4BA 4H04A 5D61A 2J3PA 3CAHA 2BFHA 1AVXB 3O49A 2MIBA 4I4VA 2Q3NB 3BAHA 4IY9A 3O44A 1SR4C 2KKIA 3CRHA 4G9MA 1TTUA 4IQPA 3Q7YA 3K1XA 3MALA 4LO1A 2KH2A 5G00A 2VXRA 3NBDA 5BQUC 1JT3A 2DREA 3AKGA 2K8RA 31BIA 4MZFB 5D62A 3WA1A 2E4MA 3UD8A 2K43A 2UUSA 3FJCA 4I4SA 4EFQA 1OQLB 2D20A 1G82A 5BXRA 3ZXGA 4Q91A 3FJIA 3ZC8A 2VXTI 3F1RA 1IRAX 3N0KA 2NP0A 3AKIA 4IY8A 1I1EA 1Q03A 4IONA 4I4UA 4ENDA 1PWAA 4QD2B 3POKA 3CA4A 3F62B 4ZLBB 2FFUA 1W3AA 3BRDA 3BB2A 3HN1A 1JY0A 3R4SA 1F31A 2NYYA 1Q04A 5B2HA 1HCEA 3FUOA 2D24A 3AKFA 3FUQA 5JLVA 3V0AB 4DENA 21BIA 3O3QA 1BFBA 1BASA 1JT7A 1S0GA 5FZUA 3V0BB 1NUNA 1DJSB 5F8SA 4Q9PA 2IHOA 3AH1A 3WMUA 1I1BA 4P6AA 1HCDA 3H6SE 3PMEA 8I1BA 3OJMA 3FGMA 2RQ9A 4DEPA 1S0CA 3NBNA 2NS2A 3H6RA 3BA5A 3EF2A 3BAGA 1W3FA 5BVPI 2VSEA 4I4OA 3WINA 4CJMA 4EFRA 4KEKA 3V79C 4JQ0A 4I4RA 4R6UB 4LO8B 3P6IA 2WRYA 5I1BA 1ISZA 5JMCA 2Z48A 1II4A 3HBWA 4I4XA 1YBIA 4I0YA 4USOA 1XYFA 3H6QA 1FV2A 5E24E 1PUUB 4A7YA 3AH2A 2ERMA 1BARA 2Z49A 3RTIB 1Z2VA 3O4AA 1G9DA 2Q9XA 3B9UA 4GP3A 1S0LA 2RG9B 2ZR1B 4XKIA 1AXMA 4ISQA 3IIRA 1FN0A 4FVVA 3BX1C 4LO2A 5D63A 2MC2A 4JRAA 1DFCA 4GOVA 3CA0A 3OBTA 1ILR1 4ZOTA 4JKQA 5BP5A 3CQAA 4IHZA 1AVAC 1S0DA 4J23B 4OW4A 3BADA 3PG0A 3HMYA 3UJ0A 3AKHA 4X38A 2QYIB 3D7WB 2AAIB 1WBCA 4OEFA 1AVUA 2D43A 1S0FA 1G9BA 3FJJA 3BRGC 1TWMA 4I6IA 2VSAA 3CU1B 1W3GA 5DZUA 1BFFA 1CVSA 3BAVA 1YF8B 1FWUA 5FZZA 2MLLB 4LO0C 1JLYA 4TLPA 2FO1A 4KEIA 3VWCA 4JKXB 4G9NA 3FJ9A 3BAOA 3C9ZA 1HWPB 1QQKA 4OWKA 1RZOB 4QKSA 1WD4A 1FGAA 3H6RB 3RMXA 1ITBA 2VLCA 4ZBVB 1PC8B 3Q7WA 4LO1C 1PZZA 3A21A 3IM5A 2FGFA 2L5XA 2WBCA 3AZVA 1ISVA 41BIA 2AFGA 4IZEA 4A7KA 3AJ6A 1V6WA 3VT1A 1BLAA 2D1ZA 1PUMB 4YOLA 2E4MC 2HWMA 2P39A 3VT0A 1FWVA 4JP0A 4GAIA 1ISYA 2KLLA 4LO7B 3W9TA 1J0SA 5F90A 5EG6C 5BOWA 5DSSB 4GAFA 1QQLA 1EV2A 3NBCA 2ESUA 1QXMA 3I29B 1WBAA 4LO3A 4OEEA 3BAUA 4P0JA 2FDBM 3OJ2A 3AZWA 4J2KA 3BA4A 1AFCA 1CE7B 1N4KA 1TIEA 4QBVA 3UDAA 1XG6A 1IT0A 4J2XA 3QR5A 1BA7A 1JLXA 3O4CA 4ZKTB 4ISRA 1BFGA 3AJ5A 1ABRB 5F8WA 2HW9A 4J2YA 3N7LA 1TP0A 1VCLA 7I1BA 3O4DA 1EPWA 3I2AA 1TFMB 4H75A 4Q9GA 2LIQA 1Z0HA 4ZFYB 3OGFA 3BTAA 3R4UA 1L2HA 3HOMA 3WO3A 1Z4SA 1EYLA 2NZ9A 4QC4A 1DZCA 3ILAA 3FJKA 3WMVA 3P53A 2DRZA 3BAQA 4AN6A 3WO2A 1ISXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0E A;  3IAG C;  3WIN C;  3N7M A;  4ZFW B;  4G6J A;  4DCK C;  1DQG A;  1AF9 A;  3SNV A;  3NBE A;  3Q7X A;  1IOB A;  1R8N A;  1DFQ A;  2ZQN A;  3VSZ A;  4XFU A;  1XZZ A;  1JT4 A;  4PC4 A;  1D0H A;  2R9K B;  1ONK B;  2F2F A;  3JUT A;  1P63 A;  4QD2 C;  2ET2 A;  4F83 A;  5BXP A;  3BRF A;  5FNW A;  1DIW A;  3UJ4 A;  2RST A;  4LO7 C;  1DZD A;  4FGF A;  4II0 A;  5FZY A;  4QAL A;  1S0B A;  4KBB A;  4I7I A;  2YUG A;  1MD6 A;  4EKX B;  3UD9 A;  4I4Q A;  4IZX A;  3RSJ A;  4OWL A;  2GO2 A;  2Y9X E;  3FJB A;  3BA7 A;  1MC9 A;  1TWE A;  2XOA A;  4KEJ A;  3LTQ A;  6I1B A;  4LO2 C;  3RTJ B;  3A23 A;  4EEE B;  3HSM A;  4I3N A;  2DS0 A;  5HPZ A;  2KI4 A;  2IWT B;  5BP5 C;  4L4H A;  1A8D A;  5EC5 A;  4D0Z A;  2F8X C;  1SR4 A;  1BFC A;  3VT2 A;  1GGP B;  1IHK A;  2KI6 B;  2BEA A;  5BQU A;  5DVH A;  4D0T A;  1FQ9 A;  2DRY A;  4XFT A;  4ZGR B;  4OWJ A;  3FFZ A;  1AVW B;  3QYD A;  4G1R A;  5FNX A;  1BLD A;  4Z8S B;  4USP A;  1ISW A;  4ZA3 B;  1K5V A;  2D22 A;  2LIE A;  3FJ8 A;  3CRI A;  3E8L C;  3O5W B;  2I1B A;  3PHZ A;  1NZK A;  2AQZ A;  3CA1 A;  2D44 A;  2BEB A;  3CA5 A;  1IIL A;  1TOO A;  3VEQ A;  4P0K A;  3ZXD A;  3A22 A;  4L4I A;  1V6V A;  1K5U A;  3CA6 A;  1T4Q A;  3A07 A;  1FMM S;  1UPS A;  1YYN A;  4WBC A;  2K4A B;  4Z9W B;  9ILB A;  4P0L A;  5F8Y A;  1FMZ A;  1DLL A;  2GZB A;  2Y9F A;  3FJH A;  3IM7 A;  1IJT A;  1EVT A;  3FJF A;  4F34 A;  3I2X A;  5BXT A;  3FJA A;  2HWA A;  2NTD A;  1WD3 A;  3CA3 A;  4I4P A;  2X2S A;  3OJV A;  4LO3 C;  1JTC A;  4KC3 A;  4EFP A;  3VUO A;  4D8H A;  2Y9G A;  1HWN B;  4OEG A;  5BXS A;  4GP0 A;  5DUY A;  3NJ5 A;  3PUB A;  2HZ9 A;  4HJJ A;  3AH4 A;  1YXW A;  1G9A A;  1IRP A;  2M49 A;  3VSF A;  4JAW A;  1E0O A;  4HR6 C;  4I4Y A;  2P23 A;  1RML A;  3HAL A;  2VUA A;  3WO4 A;  3CRG A;  4I1E A;  4X39 A;  3MPP G;  4XFS A;  1R8O A;  4G6M A;  1FV3 A;  2ZQO A;  1Q1U A;  1DQO A;  1RY7 A;  5EHA A;  2FFV A;  3N7J A;  4X3A A;  3P6J A;  1KNM A;  2X2T A;  4GOY A;  2VU9 A;  3LLP A;  4I2S A;  4J2S A;  1HWM B;  1XHB A;  1M16 A;  3JRR A;  3TC2 A;  4H9W A;  4OUJ A;  4HA2 A;  2NM1 A;  2D23 A;  3O4O A;  4QKR A;  3T8S A;  1JQZ A;  4A7Z A;  1HWO B;  4JPZ A;  1RG8 A;  3FJD A;  3S8K A;  4AN7 B;  1HIB A;  3N7K A;  1V6X A;  4I8M A;  1YTO A;  3S8J A;  3KMV A;  1V6U A;  4I96 A;  4QBC A;  2D7I A;  2F2F C;  5GAQ A;  1JT5 A;  2QN4 A;  3FJE A;  4I1B A;  3IM6 A;  3V0A A;  2D7R A;  2Y9W C;  3V0B A;  2NVH A;  4EB2 B;  1T9F A;  3ZC9 A;  4X37 A;  4I37 A;  4ZFU B;  2AXM A;  3OBR A;  4IYB A;  4QO3 A;  1HKN A;  3UD7 A;  1SZ6 B;  3OGG A;  3ZX7 A;  3RMY A;  4LO0 A;  1G9C A;  1M2T B;  3O4B A;  4H04 A;  5D61 A;  2J3P A;  3CAH A;  2BFH A;  1AVX B;  3O49 A;  2MIB A;  4I4V A;  2Q3N B;  3BAH A;  4IY9 A;  3O44 A;  1SR4 C;  2KKI A;  3CRH A;  4G9M A;  1TTU A;  4IQP A;  3Q7Y A;  3K1X A;  3MAL A;  4LO1 A;  2KH2 A;  5G00 A;  2VXR A;  3NBD A;  5BQU C;  1JT3 A;  2DRE A;  3AKG A;  2K8R A;  31BI A;  5D62 A;  3WA1 A;  2E4M A;  3UD8 A;  2K43 A;  2UUS A;  3FJC A;  4I4S A;  4EFQ A;  1OQL B;  2D20 A;  1G82 A;  5BXR A;  3ZXG A;  4Q91 A;  3FJI A;  3ZC8 A;  2VXT I;  3F1R A;  1IRA X;  3N0K A;  2NP0 A;  3AKI A;  4IY8 A;  1I1E A;  1Q03 A;  4ION A;  4I4U A;  4END A;  1PWA A;  4QD2 B;  3POK A;  3CA4 A;  3F62 B;  4ZLB B;  2FFU A;  1W3A A;  3BRD A;  3BB2 A;  3HN1 A;  1JY0 A;  3R4S A;  1F31 A;  2NYY A;  1Q04 A;  5B2H A;  1HCE A;  3FUO A;  2D24 A;  3AKF A;  3FUQ A;  5JLV A;  3V0A B;  4DEN A;  21BI A;  3O3Q A;  1BFB A;  1BAS A;  1JT7 A;  1S0G A;  5FZU A;  3V0B B;  1NUN A;  1DJS B;  5F8S A;  4Q9P A;  2IHO A;  3AH1 A;  3WMU A;  1I1B A;  4P6A A;  1HCD A;  3H6S E;  3PME A;  8I1B A;  3OJM A;  3FGM A;  2RQ9 A;  4DEP A;  1S0C A;  3NBN A;  3H6R A;  3BA5 A;  3EF2 A;  3BAG A;  1W3F A;  5BVP I;  2VSE A;  4I4O A;  3WIN A;  4CJM A;  4EFR A;  4KEK A;  3V79 C;  4JQ0 A;  4I4R A;  4R6U B;  4LO8 B;  3P6I A;  2WRY A;  5I1B A;  1ISZ A;  5JMC A;  2Z48 A;  1II4 A;  3HBW A;  4I4X A;  1YBI A;  4I0Y A;  4USO A;  1XYF A;  3H6Q A;  1FV2 A;  5E24 E;  1PUU B;  4A7Y A;  3AH2 A;  2ERM A;  1BAR A;  2Z49 A;  3RTI B;  1Z2V A;  3O4A A;  1G9D A;  2Q9X A;  3B9U A;  4GP3 A;  1S0L A;  2RG9 B;  2ZR1 B;  4XKI A;  1AXM A;  4ISQ A;  3IIR A;  1FN0 A;  4FVV A;  3BX1 C;  4LO2 A;  5D63 A;  2MC2 A;  4JRA A;  1DFC A;  4GOV A;  3CA0 A;  3OBT A;  1ILR 1;  4ZOT A;  4JKQ A;  5BP5 A;  3CQA A;  4IHZ A;  1AVA C;  1S0D A;  4J23 B;  4OW4 A;  3BAD A;  3PG0 A;  3HMY A;  3UJ0 A;  3AKH A;  4X38 A;  2QYI B;  3D7W B;  2AAI B;  1WBC A;  4OEF A;  1AVU A;  2D43 A;  1S0F A;  1G9B A;  3FJJ A;  3BRG C;  1TWM A;  4I6I A;  2VSA A;  3CU1 B;  1W3G A;  5DZU A;  1BFF A;  1CVS A;  3BAV A;  1YF8 B;  1FWU A;  5FZZ A;  2MLL B;  4LO0 C;  1JLY A;  4TLP A;  2FO1 A;  4KEI A;  3VWC A;  4JKX B;  4G9N A;  3FJ9 A;  3BAO A;  3C9Z A;  1HWP B;  1QQK A;  4OWK A;  1RZO B;  4QKS A;  1WD4 A;  1FGA A;  3H6R B;  3RMX A;  1ITB A;  2VLC A;  4ZBV B;  1PC8 B;  3Q7W A;  4LO1 C;  1PZZ A;  3A21 A;  3IM5 A;  2FGF A;  2L5X A;  2WBC A;  3AZV A;  1ISV A;  41BI A;  2AFG A;  4IZE A;  4A7K A;  3AJ6 A;  1V6W A;  3VT1 A;  1BLA A;  2D1Z A;  1PUM B;  4YOL A;  2E4M C;  2HWM A;  2P39 A;  3VT0 A;  1FWV A;  4JP0 A;  4GAI A;  1ISY A;  2KLL A;  4LO7 B;  3W9T A;  1J0S A;  5F90 A;  5EG6 C;  5BOW A;  5DSS B;  4GAF A;  1QQL A;  1EV2 A;  3NBC A;  2ESU A;  1QXM A;  3I29 B;  1WBA A;  4LO3 A;  4OEE A;  3BAU A;  4P0J A;  2FDB M;  3OJ2 A;  3AZW A;  4J2K A;  3BA4 A;  1AFC A;  1CE7 B;  1N4K A;  1TIE A;  4QBV A;  3UDA A;  1XG6 A;  1IT0 A;  4J2X A;  3QR5 A;  1BA7 A;  1JLX A;  3O4C A;  4ZKT B;  4ISR A;  1BFG A;  3AJ5 A;  1ABR B;  5F8W A;  2HW9 A;  4J2Y A;  3N7L A;  1TP0 A;  1VCL A;  7I1B A;  3O4D A;  1EPW A;  3I2A A;  1TFM B;  4Q9G A;  2LIQ A;  1Z0H A;  4ZFY B;  3OGF A;  3BTA A;  3R4U A;  1L2H A;  3HOM A;  3WO3 A;  1Z4S A;  1EYL A;  2NZ9 A;  4QC4 A;  1DZC A;  3ILA A;  3FJK A;  3WMV A;  3P53 A;  2DRZ A;  3BAQ A;  4AN6 A;  3WO2 A;  1ISX A; 
#chains in the Genus database with same CATH topology
 1S0E A;  3IAG C;  3WIN C;  3N7M A;  4ZFW B;  4G6J A;  4DCK C;  1DQG A;  1AF9 A;  3SNV A;  3NBE A;  3Q7X A;  1IOB A;  1R8N A;  1DFQ A;  2ZQN A;  3VSZ A;  4XFU A;  1XZZ A;  1JT4 A;  4PC4 A;  1D0H A;  2R9K B;  1ONK B;  2F2F A;  3JUT A;  1P63 A;  4QD2 C;  2ET2 A;  4F83 A;  5BXP A;  3BRF A;  5FNW A;  1DIW A;  3UJ4 A;  2RST A;  4LO7 C;  1DZD A;  4FGF A;  4II0 A;  5FZY A;  4QAL A;  1S0B A;  4KBB A;  4I7I A;  2YUG A;  1MD6 A;  4EKX B;  3UD9 A;  4I4Q A;  4IZX A;  3RSJ A;  4OWL A;  2GO2 A;  2Y9X E;  3FJB A;  3BA7 A;  1MC9 A;  1TWE A;  2XOA A;  4KEJ A;  3LTQ A;  6I1B A;  4LO2 C;  3RTJ B;  3A23 A;  4EEE B;  3HSM A;  4I3N A;  2DS0 A;  5HPZ A;  2KI4 A;  2IWT B;  5BP5 C;  4L4H A;  1A8D A;  5EC5 A;  4D0Z A;  2F8X C;  1SR4 A;  1BFC A;  3VT2 A;  1GGP B;  1IHK A;  2KI6 B;  2BEA A;  5BQU A;  5DVH A;  4D0T A;  1FQ9 A;  2DRY A;  4XFT A;  4ZGR B;  4OWJ A;  3FFZ A;  1AVW B;  3QYD A;  4G1R A;  5FNX A;  1BLD A;  4Z8S B;  4USP A;  1ISW A;  4ZA3 B;  1K5V A;  2D22 A;  2LIE A;  3FJ8 A;  3CRI A;  3E8L C;  4MZH A;  3O5W B;  2I1B A;  3PHZ A;  1NZK A;  2AQZ A;  3CA1 A;  2D44 A;  2BEB A;  3CA5 A;  1IIL A;  1TOO A;  3VEQ A;  4P0K A;  3ZXD A;  3A22 A;  4L4I A;  1V6V A;  1K5U A;  3CA6 A;  1T4Q A;  3A07 A;  1FMM S;  1UPS A;  1YYN A;  4WBC A;  2K4A B;  4Z9W B;  9ILB A;  4P0L A;  5F8Y A;  1FMZ A;  1DLL A;  2GZB A;  2Y9F A;  3FJH A;  3IM7 A;  1IJT A;  1EVT A;  3FJF A;  4F34 A;  3I2X A;  5BXT A;  3FJA A;  2HWA A;  2NTD A;  1WD3 A;  3CA3 A;  4I4P A;  2X2S A;  3OJV A;  4LO3 C;  1JTC A;  4KC3 A;  4EFP A;  3VUO A;  4D8H A;  2Y9G A;  1HWN B;  4OEG A;  5BXS A;  4GP0 A;  5DUY A;  3NJ5 A;  3PUB A;  2HZ9 A;  4HJJ A;  4MZG B;  3AH4 A;  1YXW A;  1G9A A;  1IRP A;  2M49 A;  3VSF A;  4JAW A;  1E0O A;  4HR6 C;  4I4Y A;  2P23 A;  1RML A;  3HAL A;  2VUA A;  3WO4 A;  3CRG A;  4I1E A;  4X39 A;  3MPP G;  4XFS A;  1R8O A;  4G6M A;  1FV3 A;  2ZQO A;  1Q1U A;  1DQO A;  1RY7 A;  5EHA A;  2FFV A;  3N7J A;  4X3A A;  3P6J A;  1KNM A;  2X2T A;  4GOY A;  4UY4 A;  2VU9 A;  3LLP A;  4I2S A;  4J2S A;  1HWM B;  1XHB A;  1M16 A;  3JRR A;  3TC2 A;  4H9W A;  4OUJ A;  4HA2 A;  2NM1 A;  2D23 A;  3O4O A;  4QKR A;  3T8S A;  1JQZ A;  4A7Z A;  1HWO B;  4JPZ A;  1RG8 A;  3FJD A;  3S8K A;  4AN7 B;  1HIB A;  3N7K A;  1V6X A;  4I8M A;  1YTO A;  3S8J A;  3KMV A;  1V6U A;  4I96 A;  4QBC A;  2D7I A;  2F2F C;  5GAQ A;  1JT5 A;  2QN4 A;  3FJE A;  4I1B A;  3IM6 A;  3V0A A;  2D7R A;  2Y9W C;  3V0B A;  2NVH A;  4EB2 B;  1T9F A;  3ZC9 A;  4X37 A;  4I37 A;  4ZFU B;  2AXM A;  3OBR A;  4IYB A;  4QO3 A;  1HKN A;  3UD7 A;  1SZ6 B;  3OGG A;  3ZX7 A;  3RMY A;  4LO0 A;  1G9C A;  1M2T B;  3O4B A;  4H04 A;  5D61 A;  2J3P A;  3CAH A;  2BFH A;  1AVX B;  3O49 A;  2MIB A;  4I4V A;  2Q3N B;  3BAH A;  4IY9 A;  3O44 A;  1SR4 C;  2KKI A;  3CRH A;  4G9M A;  1TTU A;  4IQP A;  3Q7Y A;  3K1X A;  3MAL A;  4LO1 A;  2KH2 A;  5G00 A;  2VXR A;  3NBD A;  5BQU C;  1JT3 A;  2DRE A;  3AKG A;  2K8R A;  31BI A;  4MZF B;  5D62 A;  3WA1 A;  2E4M A;  3UD8 A;  2K43 A;  2UUS A;  3FJC A;  4I4S A;  4EFQ A;  1OQL B;  2D20 A;  1G82 A;  5BXR A;  3ZXG A;  4Q91 A;  3FJI A;  3ZC8 A;  2VXT I;  3F1R A;  1IRA X;  3N0K A;  2NP0 A;  3AKI A;  4IY8 A;  1I1E A;  1Q03 A;  4ION A;  4I4U A;  4END A;  1PWA A;  4QD2 B;  3POK A;  3CA4 A;  3F62 B;  4ZLB B;  2FFU A;  1W3A A;  3BRD A;  3BB2 A;  3HN1 A;  1JY0 A;  3R4S A;  1F31 A;  2NYY A;  1Q04 A;  5B2H A;  1HCE A;  3FUO A;  2D24 A;  3AKF A;  3FUQ A;  5JLV A;  3V0A B;  4DEN A;  21BI A;  3O3Q A;  1BFB A;  1BAS A;  1JT7 A;  1S0G A;  5FZU A;  3V0B B;  1NUN A;  1DJS B;  5F8S A;  4Q9P A;  2IHO A;  3AH1 A;  3WMU A;  1I1B A;  4P6A A;  1HCD A;  3H6S E;  3PME A;  8I1B A;  3OJM A;  3FGM A;  2RQ9 A;  4DEP A;  1S0C A;  3NBN A;  2NS2 A;  3H6R A;  3BA5 A;  3EF2 A;  3BAG A;  1W3F A;  5BVP I;  2VSE A;  4I4O A;  3WIN A;  4CJM A;  4EFR A;  4KEK A;  3V79 C;  4JQ0 A;  4I4R A;  4R6U B;  4LO8 B;  3P6I A;  2WRY A;  5I1B A;  1ISZ A;  5JMC A;  2Z48 A;  1II4 A;  3HBW A;  4I4X A;  1YBI A;  4I0Y A;  4USO A;  1XYF A;  3H6Q A;  1FV2 A;  5E24 E;  1PUU B;  4A7Y A;  3AH2 A;  2ERM A;  1BAR A;  2Z49 A;  3RTI B;  1Z2V A;  3O4A A;  1G9D A;  2Q9X A;  3B9U A;  4GP3 A;  1S0L A;  2RG9 B;  2ZR1 B;  4XKI A;  1AXM A;  4ISQ A;  3IIR A;  1FN0 A;  4FVV A;  3BX1 C;  4LO2 A;  5D63 A;  2MC2 A;  4JRA A;  1DFC A;  4GOV A;  3CA0 A;  3OBT A;  1ILR 1;  4ZOT A;  4JKQ A;  5BP5 A;  3CQA A;  4IHZ A;  1AVA C;  1S0D A;  4J23 B;  4OW4 A;  3BAD A;  3PG0 A;  3HMY A;  3UJ0 A;  3AKH A;  4X38 A;  2QYI B;  3D7W B;  2AAI B;  1WBC A;  4OEF A;  1AVU A;  2D43 A;  1S0F A;  1G9B A;  3FJJ A;  3BRG C;  1TWM A;  4I6I A;  2VSA A;  3CU1 B;  1W3G A;  5DZU A;  1BFF A;  1CVS A;  3BAV A;  1YF8 B;  1FWU A;  5FZZ A;  2MLL B;  4LO0 C;  1JLY A;  4TLP A;  2FO1 A;  4KEI A;  3VWC A;  4JKX B;  4G9N A;  3FJ9 A;  3BAO A;  3C9Z A;  1HWP B;  1QQK A;  4OWK A;  1RZO B;  4QKS A;  1WD4 A;  1FGA A;  3H6R B;  3RMX A;  1ITB A;  2VLC A;  4ZBV B;  1PC8 B;  3Q7W A;  4LO1 C;  1PZZ A;  3A21 A;  3IM5 A;  2FGF A;  2L5X A;  2WBC A;  3AZV A;  1ISV A;  41BI A;  2AFG A;  4IZE A;  4A7K A;  3AJ6 A;  1V6W A;  3VT1 A;  1BLA A;  2D1Z A;  1PUM B;  4YOL A;  2E4M C;  2HWM A;  2P39 A;  3VT0 A;  1FWV A;  4JP0 A;  4GAI A;  1ISY A;  2KLL A;  4LO7 B;  3W9T A;  1J0S A;  5F90 A;  5EG6 C;  5BOW A;  5DSS B;  4GAF A;  1QQL A;  1EV2 A;  3NBC A;  2ESU A;  1QXM A;  3I29 B;  1WBA A;  4LO3 A;  4OEE A;  3BAU A;  4P0J A;  2FDB M;  3OJ2 A;  3AZW A;  4J2K A;  3BA4 A;  1AFC A;  1CE7 B;  1N4K A;  1TIE A;  4QBV A;  3UDA A;  1XG6 A;  1IT0 A;  4J2X A;  3QR5 A;  1BA7 A;  1JLX A;  3O4C A;  4ZKT B;  4ISR A;  1BFG A;  3AJ5 A;  1ABR B;  5F8W A;  2HW9 A;  4J2Y A;  3N7L A;  1TP0 A;  1VCL A;  7I1B A;  3O4D A;  1EPW A;  3I2A A;  1TFM B;  4H75 A;  4Q9G A;  2LIQ A;  1Z0H A;  4ZFY B;  3OGF A;  3BTA A;  3R4U A;  1L2H A;  3HOM A;  3WO3 A;  1Z4S A;  1EYL A;  2NZ9 A;  4QC4 A;  1DZC A;  3ILA A;  3FJK A;  3WMV A;  3P53 A;  2DRZ A;  3BAQ A;  4AN6 A;  3WO2 A;  1ISX A; 
#chains in the Genus database with same CATH homology
 1S0E A;  3IAG C;  3WIN C;  3N7M A;  4ZFW B;  4G6J A;  4DCK C;  1DQG A;  1AF9 A;  3SNV A;  3NBE A;  3Q7X A;  1IOB A;  1R8N A;  1DFQ A;  2ZQN A;  3VSZ A;  4XFU A;  1XZZ A;  1JT4 A;  4PC4 A;  1D0H A;  2R9K B;  1ONK B;  2F2F A;  3JUT A;  1P63 A;  4QD2 C;  2ET2 A;  4F83 A;  5BXP A;  3BRF A;  5FNW A;  1DIW A;  3UJ4 A;  2RST A;  4LO7 C;  1DZD A;  4FGF A;  4II0 A;  5FZY A;  4QAL A;  1S0B A;  4KBB A;  4I7I A;  2YUG A;  1MD6 A;  4EKX B;  3UD9 A;  4I4Q A;  4IZX A;  3RSJ A;  4OWL A;  2GO2 A;  2Y9X E;  3FJB A;  3BA7 A;  1MC9 A;  1TWE A;  2XOA A;  4KEJ A;  3LTQ A;  6I1B A;  4LO2 C;  3RTJ B;  3A23 A;  4EEE B;  3HSM A;  4I3N A;  2DS0 A;  5HPZ A;  2KI4 A;  2IWT B;  5BP5 C;  4L4H A;  1A8D A;  5EC5 A;  4D0Z A;  2F8X C;  1SR4 A;  1BFC A;  3VT2 A;  1GGP B;  1IHK A;  2KI6 B;  2BEA A;  5BQU A;  5DVH A;  4D0T A;  1FQ9 A;  2DRY A;  4XFT A;  4ZGR B;  4OWJ A;  3FFZ A;  1AVW B;  3QYD A;  4G1R A;  5FNX A;  1BLD A;  4Z8S B;  4USP A;  1ISW A;  4ZA3 B;  1K5V A;  2D22 A;  2LIE A;  3FJ8 A;  3CRI A;  3E8L C;  4MZH A;  3O5W B;  2I1B A;  3PHZ A;  1NZK A;  2AQZ A;  3CA1 A;  2D44 A;  2BEB A;  3CA5 A;  1IIL A;  1TOO A;  3VEQ A;  4P0K A;  3ZXD A;  3A22 A;  4L4I A;  1V6V A;  1K5U A;  3CA6 A;  1T4Q A;  3A07 A;  1FMM S;  1UPS A;  1YYN A;  4WBC A;  2K4A B;  4Z9W B;  9ILB A;  4P0L A;  5F8Y A;  1FMZ A;  1DLL A;  2GZB A;  2Y9F A;  3FJH A;  3IM7 A;  1IJT A;  1EVT A;  3FJF A;  4F34 A;  3I2X A;  5BXT A;  3FJA A;  2HWA A;  2NTD A;  1WD3 A;  3CA3 A;  4I4P A;  2X2S A;  3OJV A;  4LO3 C;  1JTC A;  4KC3 A;  4EFP A;  3VUO A;  4D8H A;  2Y9G A;  1HWN B;  4OEG A;  5BXS A;  4GP0 A;  5DUY A;  3NJ5 A;  3PUB A;  2HZ9 A;  4HJJ A;  4MZG B;  3AH4 A;  1YXW A;  1G9A A;  1IRP A;  2M49 A;  3VSF A;  4JAW A;  1E0O A;  4HR6 C;  4I4Y A;  2P23 A;  1RML A;  3HAL A;  2VUA A;  3WO4 A;  3CRG A;  4I1E A;  4X39 A;  3MPP G;  4XFS A;  1R8O A;  4G6M A;  1FV3 A;  2ZQO A;  1Q1U A;  1DQO A;  1RY7 A;  5EHA A;  2FFV A;  3N7J A;  4X3A A;  3P6J A;  1KNM A;  2X2T A;  4GOY A;  4UY4 A;  2VU9 A;  3LLP A;  4I2S A;  4J2S A;  1HWM B;  1XHB A;  1M16 A;  3JRR A;  3TC2 A;  4H9W A;  4OUJ A;  4HA2 A;  2NM1 A;  2D23 A;  3O4O A;  4QKR A;  3T8S A;  1JQZ A;  4A7Z A;  1HWO B;  4JPZ A;  1RG8 A;  3FJD A;  3S8K A;  4AN7 B;  1HIB A;  3N7K A;  1V6X A;  4I8M A;  1YTO A;  3S8J A;  3KMV A;  1V6U A;  4I96 A;  4QBC A;  2D7I A;  2F2F C;  5GAQ A;  1JT5 A;  2QN4 A;  3FJE A;  4I1B A;  3IM6 A;  3V0A A;  2D7R A;  2Y9W C;  3V0B A;  2NVH A;  4EB2 B;  1T9F A;  3ZC9 A;  4X37 A;  4I37 A;  4ZFU B;  2AXM A;  3OBR A;  4IYB A;  4QO3 A;  1HKN A;  3UD7 A;  1SZ6 B;  3OGG A;  3ZX7 A;  3RMY A;  4LO0 A;  1G9C A;  1M2T B;  3O4B A;  4H04 A;  5D61 A;  2J3P A;  3CAH A;  2BFH A;  1AVX B;  3O49 A;  2MIB A;  4I4V A;  2Q3N B;  3BAH A;  4IY9 A;  3O44 A;  1SR4 C;  2KKI A;  3CRH A;  4G9M A;  1TTU A;  4IQP A;  3Q7Y A;  3K1X A;  3MAL A;  4LO1 A;  2KH2 A;  5G00 A;  2VXR A;  3NBD A;  5BQU C;  1JT3 A;  2DRE A;  3AKG A;  2K8R A;  31BI A;  4MZF B;  5D62 A;  3WA1 A;  2E4M A;  3UD8 A;  2K43 A;  2UUS A;  3FJC A;  4I4S A;  4EFQ A;  1OQL B;  2D20 A;  1G82 A;  5BXR A;  3ZXG A;  4Q91 A;  3FJI A;  3ZC8 A;  2VXT I;  3F1R A;  1IRA X;  3N0K A;  2NP0 A;  3AKI A;  4IY8 A;  1I1E A;  1Q03 A;  4ION A;  4I4U A;  4END A;  1PWA A;  4QD2 B;  3POK A;  3CA4 A;  3F62 B;  4ZLB B;  2FFU A;  1W3A A;  3BRD A;  3BB2 A;  3HN1 A;  1JY0 A;  3R4S A;  1F31 A;  2NYY A;  1Q04 A;  5B2H A;  1HCE A;  3FUO A;  2D24 A;  3AKF A;  3FUQ A;  5JLV A;  3V0A B;  4DEN A;  21BI A;  3O3Q A;  1BFB A;  1BAS A;  1JT7 A;  1S0G A;  5FZU A;  3V0B B;  1NUN A;  1DJS B;  5F8S A;  4Q9P A;  2IHO A;  3AH1 A;  3WMU A;  1I1B A;  4P6A A;  1HCD A;  3H6S E;  3PME A;  8I1B A;  3OJM A;  3FGM A;  2RQ9 A;  4DEP A;  1S0C A;  3NBN A;  2NS2 A;  3H6R A;  3BA5 A;  3EF2 A;  3BAG A;  1W3F A;  5BVP I;  2VSE A;  4I4O A;  3WIN A;  4CJM A;  4EFR A;  4KEK A;  3V79 C;  4JQ0 A;  4I4R A;  4R6U B;  4LO8 B;  3P6I A;  2WRY A;  5I1B A;  1ISZ A;  5JMC A;  2Z48 A;  1II4 A;  3HBW A;  4I4X A;  1YBI A;  4I0Y A;  4USO A;  1XYF A;  3H6Q A;  1FV2 A;  5E24 E;  1PUU B;  4A7Y A;  3AH2 A;  2ERM A;  1BAR A;  2Z49 A;  3RTI B;  1Z2V A;  3O4A A;  1G9D A;  2Q9X A;  3B9U A;  4GP3 A;  1S0L A;  2RG9 B;  2ZR1 B;  4XKI A;  1AXM A;  4ISQ A;  3IIR A;  1FN0 A;  4FVV A;  3BX1 C;  4LO2 A;  5D63 A;  2MC2 A;  4JRA A;  1DFC A;  4GOV A;  3CA0 A;  3OBT A;  1ILR 1;  4ZOT A;  4JKQ A;  5BP5 A;  3CQA A;  4IHZ A;  1AVA C;  1S0D A;  4J23 B;  4OW4 A;  3BAD A;  3PG0 A;  3HMY A;  3UJ0 A;  3AKH A;  4X38 A;  2QYI B;  3D7W B;  2AAI B;  1WBC A;  4OEF A;  1AVU A;  2D43 A;  1S0F A;  1G9B A;  3FJJ A;  3BRG C;  1TWM A;  4I6I A;  2VSA A;  3CU1 B;  1W3G A;  5DZU A;  1BFF A;  1CVS A;  3BAV A;  1YF8 B;  1FWU A;  5FZZ A;  2MLL B;  4LO0 C;  1JLY A;  4TLP A;  2FO1 A;  4KEI A;  3VWC A;  4JKX B;  4G9N A;  3FJ9 A;  3BAO A;  3C9Z A;  1HWP B;  1QQK A;  4OWK A;  1RZO B;  4QKS A;  1WD4 A;  1FGA A;  3H6R B;  3RMX A;  1ITB A;  2VLC A;  4ZBV B;  1PC8 B;  3Q7W A;  4LO1 C;  1PZZ A;  3A21 A;  3IM5 A;  2FGF A;  2L5X A;  2WBC A;  3AZV A;  1ISV A;  41BI A;  2AFG A;  4IZE A;  4A7K A;  3AJ6 A;  1V6W A;  3VT1 A;  1BLA A;  2D1Z A;  1PUM B;  4YOL A;  2E4M C;  2HWM A;  2P39 A;  3VT0 A;  1FWV A;  4JP0 A;  4GAI A;  1ISY A;  2KLL A;  4LO7 B;  3W9T A;  1J0S A;  5F90 A;  5EG6 C;  5BOW A;  5DSS B;  4GAF A;  1QQL A;  1EV2 A;  3NBC A;  2ESU A;  1QXM A;  3I29 B;  1WBA A;  4LO3 A;  4OEE A;  3BAU A;  4P0J A;  2FDB M;  3OJ2 A;  3AZW A;  4J2K A;  3BA4 A;  1AFC A;  1CE7 B;  1N4K A;  1TIE A;  4QBV A;  3UDA A;  1XG6 A;  1IT0 A;  4J2X A;  3QR5 A;  1BA7 A;  1JLX A;  3O4C A;  4ZKT B;  4ISR A;  1BFG A;  3AJ5 A;  1ABR B;  5F8W A;  2HW9 A;  4J2Y A;  3N7L A;  1TP0 A;  1VCL A;  7I1B A;  3O4D A;  1EPW A;  3I2A A;  1TFM B;  4H75 A;  4Q9G A;  2LIQ A;  1Z0H A;  4ZFY B;  3OGF A;  3BTA A;  3R4U A;  1L2H A;  3HOM A;  3WO3 A;  1Z4S A;  1EYL A;  2NZ9 A;  4QC4 A;  1DZC A;  3ILA A;  3FJK A;  3WMV A;  3P53 A;  2DRZ A;  3BAQ A;  4AN6 A;  3WO2 A;  1ISX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...