2E4MA

Crystal structure of hemagglutinin subcomponent complex (ha-33/ha-17) from clostridium botulinum serotype d strain 4947
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
285
Chain Sequence
SQTNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYTIKVMDNTSLILTWDAPLSSVSVKTDTNTNNQYWYLLQDYISRNVILRNYMNPNLVLQYNTDDTLIVSTQTNSNNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWTIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQTANGTHVIVDSYHGNTNQQWIINLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Main hemagglutinin component
publication title A Novel Subunit Structure of Clostridium botulinum Serotype D Toxin Complex with Three Extended Arms
pubmed doi rcsb
molecule tags Toxin
total genus 92
structure length 285
sequence length 285
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2e4mA02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2e4mA01
1DQGA 4OWKA 5F8WA 2ET2A 2FFUA 3H6RB 1JT3A 3HALA 4L4IA 3H6SE 1VCLA 2X2SA 2ZQNA 4P0JA 3CA5A 2M49A 2WBCA 3BAQA 1AXMA 3FJDA 4J2XA 1II4A 3Q7XA 3R4SA 3V79C 3BAHA 3VT0A 3AH2A 4ZFUB 3H6QA 4LO3A 4I1BA 3O44A 4I7IA 5BQUA 4DENA 4JKQA 4QD2C 4XFUA 2XOAA 4J2KA 2IHOA 1MD6A 3AKFA 3BA5A 2KLLA 1IRAX 4I8MA 5BXSA 3BRDA 4GAFA 3A07A 4JAWA 4KEIA 3O4CA 3FJFA 3S8KA 3FJCA 4II0A 3P6JA 5DZUA 3BA4A 2F2FC 1T4QA 4G9NA 5JMCA 3HOMA 3ZXGA 2BEBA 4LO1A 2D7IA 7I1BA 4X38A 8I1BA 4J2SA 1FN0A 3F1RA 1AVUA 1NUNA 1ABRB 1S0CA 1WBAA 2Z49A 1BLAA 3NBNA 4I4QA 4WBCA 3VEQA 1AVAC 2MIBA 3BX1C 4I4PA 2BFHA 4IYBA 4FGFA 1TWEA 3POKA 4DEPA 1R8OA 3BADA 2ZR1B 1EPWA 3I2XA 2D22A 1K5UA 5G00A 3FJKA 3F62B 5DSSB 4EEEB 2VXRA 1TWMA 3AJ5A 4XFTA 2YUGA 3QYDA 1FQ9A 4I4YA 3ZXDA 5F8YA 2Y9FA 1BFBA 4G1RA 4I1EA 2FGFA 5BXRA 4ZKTB 1FV2A 2VU9A 1XYFA 3JUTA 2KI6B 1GGPB 1DZDA 1T9FA 4OWJA 4QKSA 4I4RA 1DFQA 1V6UA 5FZUA 3VT2A 1MC9A 2Z48A 1DLLA 3P53A 2KKIA 3BAVA 1ISYA 1JTCA 1K5VA 3NBDA 4JP0A 1CVSA 3FJHA 3UDAA 3OJVA 1SZ6B 3OBRA 4IZXA 4J23B 4I0YA 4IQPA 3ZX7A 3AZVA 3O3QA 4G6JA 1TOOA 4OEEA 5BOWA 2P23A 5GAQA 3N7KA 3Q7WA 2K4AB 1A8DA 5DVHA 1PUUB 3NJ5A 4D8HA 4ISQA 1R8NA 1EV2A 4D0TA 1DZCA 3TC2A 4EFRA 2NTDA 4Q9PA 3RMYA 4LO2A 3I29B 4XFSA 4HR6C 3BRFA 1DIWA 3BAOA 1JY0A 2MC2A 1JT4A 2D44A 1AF9A 3W9TA 1I1BA 3FUOA 3FJJA 2RSTA 1G9AA 2P39A 3O4DA 9ILBA 2J3PA 3BAGA 3UJ4A 2K8RA 4GAIA 4X3AA 3FJ9A 3ZC9A 1Q04A 4LO0C 3WA1A 1Z4SA 3NBEA 5BVPI 3IM5A 1FGAA 2IWTB 5BP5A 4QKRA 2VXTI 2DS0A 1JLXA 1W3FA 3CAHA 4X39A 1JLYA 3CA4A 3RMXA 6I1BA 1XG6A 4P0LA 4ZA3B 3RTJB 3WMUA 3HBWA 4G9MA 4QC4A 1HCEA 3CRIA 3T8SA 3HSMA 5BQUC 5B2HA 4DCKC 3V0AB 1HIBA 2KI4A 3V0BA 1YBIA 1N4KA 3LLPA 1SR4C 1ILR1 4A7ZA 2X2TA 4LO8B 4IY9A 2UUSA 1ISZA 1WD4A 2FFVA 31BIA 1ITBA 1ISVA 1ISXA 4X37A 1KNMA 3MALA 1IILA 5BXPA 3FGMA 2WRYA 3I2AA 1G9DA 4P0KA 3D7WB 2F2FA 1YTOA 2ESUA 3BA7A 3VT1A 1QQLA 3A21A 4QALA 4LO7B 1HWMB 3OBTA 3UJ0A 4QBCA 3P6IA 4I4VA 1BFGA 1JT5A 3BRGC 1V6WA 4OEFA 5I1BA 3WMVA 1BFCA 3LTQA 1S0LA 3B9UA 3UD7A 5HPZA 3O49A 3AKIA 3FFZA 3ILAA 2D23A 3OGGA 1FMZA 4G6MA 1P63A 4HA2A 4ZFWB 3N0KA 2KH2A 4FVVA 1DJSB 1G9CA 4USPA 4EFQA 3WINC 4ENDA 4EB2B 4USOA 3CU1B 4H04A 1PC8B 3UD8A 1WD3A 2E4MC 2GO2A 4QBVA 4Z8SB 1M2TB 4I3NA 1FMMS 5EG6C 3N7MA 4A7YA 1HWPB 2QN4A 4LO7C 5FZYA 1IHKA 3CA0A 1M16A 1S0GA 3WO2A 5DUYA 2D1ZA 3IAGC 3MPPG 3O4OA 4F34A 1QQKA 4I6IA 1TTUA 3O5WB 2HWMA 3FJIA 3UD9A 2NVHA 2NYYA 1TIEA 3CQAA 4ZGRB 4Q91A 1ISWA 5FNWA 4IHZA 4J2YA 5D62A 1D0HA 3AJ6A 3A23A 3WO3A 4ZBVB 2Q3NB 3ZC8A 1ONKB 4IONA 4Q9GA 1G9BA 3VUOA 1CE7B 4P6AA 4JPZA 4PC4A 3PHZA 5EHAA 2RQ9A 3FUQA 1HWNB 4IY8A 2L5XA 1OQLB 4F83A 4OW4A 3WO4A 4GOVA 3HN1A 3VSZA 4LO2C 3IM6A 1FWVA 1F31A 3N7LA 3SNVA 3NBCA 2D24A 3V0BB 2HW9A 3K1XA 4I4SA 2LIQA 3O4BA 3BTAA 3CA6A 4ZOTA 3OJ2A 1UPSA 2ERMA 2Y9GA 1HKNA 4JQ0A 1G82A 3OGFA 2BEAA 2NZ9A 4LO0A 4ZLBB 1RMLA 3PUBA 4OUJA 5JLVA 2FDBM 3S8JA 4XKIA 2I1BA 4LO3C 21BIA 5BP5C 2D7RA 3PG0A 1BA7A 2NP0A 1IT0A 2LIEA 1IOBA 5F90A 4I4UA 4HJJA 4QO3A 1FWUA 2VSAA 3AH1A 2Q9XA 1SR4A 3H6RA 1Q1UA 4I4XA 1WBCA 1XZZA 2AAIB 2DRZA 3C9ZA 3CA1A 3RTIB 1IRPA 4LO1C 4EKXB 2HZ9A 4JRAA 3FJ8A 2NM1A 3A22A 1PZZA 2DREA 4ISRA 4L4HA 5E24E 4OEGA 4AN7B 1S0BA 2FO1A 1JQZA 1W3GA 1DQOA 3IM7A 1YXWA 1AFCA 1AVXB 1S0EA 2D43A 2K43A 2F8XC 1QXMA 1RZOB 2Y9XE 5D61A 1XHBA 1BFFA 1BLDA 1I1EA 3E8LC 1J0SA 1YF8B 1Z0HA 3N7JA 4I2SA 1PUMB 4IZEA 3R4UA 3RSJA 2HWAA 4CJMA 3V0AA 3EF2A 2AXMA 2MLLB 4KC3A 3VWCA 1V6XA 1E0OA 2QYIB 41BIA 3CRHA 4KBBA 3AZWA 3HMYA 4GP0A 4R6UB 3JRRA 1L2HA 3WINA 1BARA 1FV3A 3BB2A 4H9WA 2Y9WC 1YYNA 4EFPA 4ZFYB 1RY7A 4JKXB 2R9KB 1PWAA 1BASA 2E4MA 4Z9WB 3CA3A 3O4AA 2GZBA 4YOLA 4OWLA 3QR5A 2VSEA 1TFMB 1JT7A 3PMEA 5BXTA 4GOYA 3OJMA 1HCDA 1NZKA 2RG9B 3IIRA 4KEJA 3FJAA 3BAUA 2D20A 3FJBA 4A7KA 5FZZA 1HWOB 5F8SA 4AN6A 4I4OA 2DRYA 1IJTA 1TP0A 2VUAA 1EVTA 3AKGA 2VLCA 3AH4A 1DFCA 2ZQOA 5D63A 3VSFA 4I37A 5FNXA 3AKHA 2AFGA 1Z2VA 4D0ZA 1V6VA 3KMVA 1EYLA 4QD2B 1Q03A 1RG8A 5EC5A 1AVWB 3Q7YA 2AQZA 1S0DA 4I96A 3CRGA 4TLPA 1W3AA 1S0FA 4KEKA 3FJEA 4GP3A
chains in the Genus database with same CATH superfamily
1DQGA 4OWKA 5F8WA 2ET2A 2FFUA 3H6RB 1JT3A 3HALA 4L4IA 3H6SE 1VCLA 2X2SA 2ZQNA 4P0JA 3CA5A 2M49A 2WBCA 3BAQA 1AXMA 3FJDA 4J2XA 1II4A 3Q7XA 3R4SA 3V79C 3BAHA 3VT0A 3AH2A 4ZFUB 3H6QA 4LO3A 4I1BA 3O44A 4I7IA 5BQUA 4DENA 4JKQA 4QD2C 2NS2A 4XFUA 2XOAA 4J2KA 2IHOA 1MD6A 3AKFA 3BA5A 2KLLA 1IRAX 4I8MA 5BXSA 3BRDA 4GAFA 3A07A 4JAWA 4KEIA 3O4CA 3FJFA 3S8KA 3FJCA 4II0A 3P6JA 5DZUA 3BA4A 2F2FC 1T4QA 4G9NA 5JMCA 4UY4A 3HOMA 3ZXGA 2BEBA 4LO1A 2D7IA 7I1BA 4X38A 8I1BA 4J2SA 1FN0A 3F1RA 1AVUA 1NUNA 1ABRB 1S0CA 1WBAA 2Z49A 1BLAA 3NBNA 4I4QA 4WBCA 3VEQA 1AVAC 2MIBA 3BX1C 4I4PA 2BFHA 4IYBA 4FGFA 1TWEA 3POKA 4DEPA 1R8OA 3BADA 2ZR1B 1EPWA 3I2XA 2D22A 1K5UA 5G00A 3FJKA 3F62B 5DSSB 4EEEB 2VXRA 1TWMA 3AJ5A 4XFTA 2YUGA 3QYDA 1FQ9A 4I4YA 3ZXDA 5F8YA 2Y9FA 1BFBA 4G1RA 4I1EA 2FGFA 5BXRA 4ZKTB 1FV2A 2VU9A 1XYFA 3JUTA 2KI6B 1GGPB 1DZDA 1T9FA 4OWJA 4QKSA 4I4RA 1DFQA 1V6UA 5FZUA 4H75A 3VT2A 1MC9A 2Z48A 1DLLA 3P53A 2KKIA 3BAVA 1ISYA 1JTCA 1K5VA 3NBDA 4JP0A 1CVSA 3FJHA 3UDAA 3OJVA 1SZ6B 3OBRA 4IZXA 4J23B 4I0YA 4IQPA 3ZX7A 3AZVA 3O3QA 4G6JA 1TOOA 4OEEA 5BOWA 2P23A 5GAQA 3N7KA 3Q7WA 2K4AB 1A8DA 5DVHA 1PUUB 3NJ5A 4D8HA 4ISQA 1R8NA 1EV2A 4D0TA 1DZCA 3TC2A 4EFRA 2NTDA 4Q9PA 3RMYA 4LO2A 3I29B 4XFSA 4HR6C 3BRFA 1DIWA 3BAOA 1JY0A 2MC2A 1JT4A 2D44A 1AF9A 3W9TA 1I1BA 3FUOA 3FJJA 2RSTA 1G9AA 2P39A 3O4DA 9ILBA 2J3PA 3BAGA 3UJ4A 2K8RA 4GAIA 4X3AA 3FJ9A 3ZC9A 1Q04A 4LO0C 3WA1A 1Z4SA 3NBEA 5BVPI 3IM5A 1FGAA 2IWTB 5BP5A 4QKRA 2VXTI 2DS0A 1JLXA 1W3FA 3CAHA 4X39A 1JLYA 3CA4A 3RMXA 6I1BA 1XG6A 4P0LA 4ZA3B 3RTJB 3WMUA 3HBWA 4G9MA 4QC4A 1HCEA 3CRIA 3T8SA 3HSMA 5BQUC 5B2HA 4DCKC 3V0AB 1HIBA 2KI4A 3V0BA 1YBIA 1N4KA 3LLPA 1SR4C 1ILR1 4A7ZA 2X2TA 4LO8B 4IY9A 2UUSA 1ISZA 1WD4A 2FFVA 31BIA 1ITBA 1ISVA 1ISXA 4X37A 1KNMA 3MALA 1IILA 5BXPA 3FGMA 2WRYA 3I2AA 1G9DA 4P0KA 3D7WB 2F2FA 1YTOA 2ESUA 3BA7A 3VT1A 1QQLA 3A21A 4QALA 4LO7B 1HWMB 3OBTA 3UJ0A 4QBCA 3P6IA 4I4VA 1BFGA 4MZGB 1JT5A 3BRGC 1V6WA 4OEFA 5I1BA 3WMVA 1BFCA 3LTQA 1S0LA 3B9UA 3UD7A 5HPZA 3O49A 3AKIA 3FFZA 3ILAA 2D23A 3OGGA 1FMZA 4G6MA 1P63A 4HA2A 4ZFWB 3N0KA 2KH2A 4FVVA 1DJSB 1G9CA 4USPA 4EFQA 3WINC 4ENDA 4EB2B 4USOA 3CU1B 4H04A 1PC8B 3UD8A 1WD3A 2E4MC 2GO2A 4QBVA 4Z8SB 1M2TB 4I3NA 1FMMS 5EG6C 3N7MA 4A7YA 1HWPB 2QN4A 4LO7C 5FZYA 1IHKA 3CA0A 1M16A 1S0GA 3WO2A 5DUYA 2D1ZA 3IAGC 3MPPG 3O4OA 4F34A 1QQKA 4I6IA 1TTUA 3O5WB 2HWMA 3FJIA 3UD9A 2NVHA 2NYYA 1TIEA 3CQAA 4ZGRB 4Q91A 1ISWA 5FNWA 4IHZA 4J2YA 5D62A 1D0HA 3AJ6A 3A23A 3WO3A 4ZBVB 2Q3NB 3ZC8A 1ONKB 4IONA 4Q9GA 1G9BA 3VUOA 1CE7B 4P6AA 4JPZA 4PC4A 3PHZA 5EHAA 2RQ9A 3FUQA 1HWNB 4IY8A 2L5XA 1OQLB 4F83A 4OW4A 3WO4A 4GOVA 3HN1A 3VSZA 4LO2C 3IM6A 1FWVA 1F31A 3N7LA 3SNVA 3NBCA 2D24A 3V0BB 2HW9A 3K1XA 4I4SA 2LIQA 3O4BA 3BTAA 3CA6A 4ZOTA 3OJ2A 1UPSA 2ERMA 2Y9GA 1HKNA 4JQ0A 1G82A 3OGFA 2BEAA 2NZ9A 4LO0A 4ZLBB 1RMLA 3PUBA 4OUJA 5JLVA 2FDBM 3S8JA 4XKIA 2I1BA 4LO3C 21BIA 5BP5C 2D7RA 3PG0A 1BA7A 2NP0A 1IT0A 2LIEA 1IOBA 5F90A 4I4UA 4HJJA 4QO3A 1FWUA 2VSAA 3AH1A 2Q9XA 1SR4A 3H6RA 1Q1UA 4I4XA 1WBCA 1XZZA 2AAIB 2DRZA 3C9ZA 3CA1A 3RTIB 1IRPA 4LO1C 4EKXB 2HZ9A 4JRAA 3FJ8A 2NM1A 3A22A 4MZHA 1PZZA 2DREA 4ISRA 4L4HA 5E24E 4OEGA 4AN7B 1S0BA 2FO1A 1JQZA 1W3GA 1DQOA 3IM7A 1YXWA 1AFCA 1AVXB 1S0EA 2D43A 2K43A 2F8XC 1QXMA 1RZOB 2Y9XE 5D61A 1XHBA 1BFFA 1BLDA 1I1EA 3E8LC 1J0SA 1YF8B 1Z0HA 3N7JA 4I2SA 1PUMB 4IZEA 3R4UA 3RSJA 2HWAA 4CJMA 3V0AA 3EF2A 2AXMA 2MLLB 4KC3A 3VWCA 1V6XA 1E0OA 2QYIB 41BIA 3CRHA 4KBBA 3AZWA 3HMYA 4GP0A 4R6UB 3JRRA 1L2HA 3WINA 1BARA 1FV3A 4MZFB 3BB2A 4H9WA 2Y9WC 1YYNA 4EFPA 4ZFYB 1RY7A 4JKXB 2R9KB 1PWAA 1BASA 2E4MA 4Z9WB 3CA3A 3O4AA 2GZBA 4YOLA 4OWLA 3QR5A 2VSEA 1TFMB 1JT7A 3PMEA 5BXTA 4GOYA 3OJMA 1HCDA 1NZKA 2RG9B 3IIRA 4KEJA 3FJAA 3BAUA 2D20A 3FJBA 4A7KA 5FZZA 1HWOB 5F8SA 4AN6A 4I4OA 2DRYA 1IJTA 1TP0A 2VUAA 1EVTA 3AKGA 2VLCA 3AH4A 1DFCA 2ZQOA 5D63A 3VSFA 4I37A 5FNXA 3AKHA 2AFGA 1Z2VA 4D0ZA 1V6VA 3KMVA 1EYLA 4QD2B 1Q03A 1RG8A 5EC5A 1AVWB 3Q7YA 2AQZA 1S0DA 4I96A 3CRGA 4TLPA 1W3AA 1S0FA 4KEKA 3FJEA 4GP3A
chains in the Genus database with same CATH topology
1DQGA 4OWKA 5F8WA 2ET2A 2FFUA 3H6RB 1JT3A 3HALA 4L4IA 3H6SE 1VCLA 2X2SA 2ZQNA 4P0JA 3CA5A 2M49A 2WBCA 3BAQA 1AXMA 3FJDA 4J2XA 1II4A 3Q7XA 3R4SA 3V79C 3BAHA 3VT0A 3AH2A 4ZFUB 3H6QA 4LO3A 4I1BA 3O44A 4I7IA 5BQUA 4DENA 4JKQA 4QD2C 2NS2A 4XFUA 2XOAA 4J2KA 2IHOA 1MD6A 3AKFA 3BA5A 2KLLA 1IRAX 4I8MA 5BXSA 3BRDA 4GAFA 3A07A 4JAWA 4KEIA 3O4CA 3FJFA 3S8KA 3FJCA 4II0A 3P6JA 5DZUA 3BA4A 2F2FC 1T4QA 4G9NA 5JMCA 4UY4A 3HOMA 3ZXGA 2BEBA 4LO1A 2D7IA 7I1BA 4X38A 8I1BA 4J2SA 1FN0A 3F1RA 1AVUA 1NUNA 1ABRB 1S0CA 1WBAA 2Z49A 1BLAA 3NBNA 4I4QA 4WBCA 3VEQA 1AVAC 2MIBA 3BX1C 4I4PA 2BFHA 4IYBA 4FGFA 1TWEA 3POKA 4DEPA 1R8OA 3BADA 2ZR1B 1EPWA 3I2XA 2D22A 1K5UA 5G00A 3FJKA 3F62B 5DSSB 4EEEB 2VXRA 1TWMA 3AJ5A 4XFTA 2YUGA 3QYDA 1FQ9A 4I4YA 3ZXDA 5F8YA 2Y9FA 1BFBA 4G1RA 4I1EA 2FGFA 5BXRA 4ZKTB 1FV2A 2VU9A 1XYFA 3JUTA 2KI6B 1GGPB 1DZDA 1T9FA 4OWJA 4QKSA 4I4RA 1DFQA 1V6UA 5FZUA 4H75A 3VT2A 1MC9A 2Z48A 1DLLA 3P53A 2KKIA 3BAVA 1ISYA 1JTCA 1K5VA 3NBDA 4JP0A 1CVSA 3FJHA 3UDAA 3OJVA 1SZ6B 3OBRA 4IZXA 4J23B 4I0YA 4IQPA 3ZX7A 3AZVA 3O3QA 4G6JA 1TOOA 4OEEA 5BOWA 2P23A 5GAQA 3N7KA 3Q7WA 2K4AB 1A8DA 5DVHA 1PUUB 3NJ5A 4D8HA 4ISQA 1R8NA 1EV2A 4D0TA 1DZCA 3TC2A 4EFRA 2NTDA 4Q9PA 3RMYA 4LO2A 3I29B 4XFSA 4HR6C 3BRFA 1DIWA 3BAOA 1JY0A 2MC2A 1JT4A 2D44A 1AF9A 3W9TA 1I1BA 3FUOA 3FJJA 2RSTA 1G9AA 2P39A 3O4DA 9ILBA 2J3PA 3BAGA 3UJ4A 2K8RA 4GAIA 4X3AA 3FJ9A 3ZC9A 1Q04A 4LO0C 3WA1A 1Z4SA 3NBEA 5BVPI 3IM5A 1FGAA 2IWTB 5BP5A 4QKRA 2VXTI 2DS0A 1JLXA 1W3FA 3CAHA 4X39A 1JLYA 3CA4A 3RMXA 6I1BA 1XG6A 4P0LA 4ZA3B 3RTJB 3WMUA 3HBWA 4G9MA 4QC4A 1HCEA 3CRIA 3T8SA 3HSMA 5BQUC 5B2HA 4DCKC 3V0AB 1HIBA 2KI4A 3V0BA 1YBIA 1N4KA 3LLPA 1SR4C 1ILR1 4A7ZA 2X2TA 4LO8B 4IY9A 2UUSA 1ISZA 1WD4A 2FFVA 31BIA 1ITBA 1ISVA 1ISXA 4X37A 1KNMA 3MALA 1IILA 5BXPA 3FGMA 2WRYA 3I2AA 1G9DA 4P0KA 3D7WB 2F2FA 1YTOA 2ESUA 3BA7A 3VT1A 1QQLA 3A21A 4QALA 4LO7B 1HWMB 3OBTA 3UJ0A 4QBCA 3P6IA 4I4VA 1BFGA 4MZGB 1JT5A 3BRGC 1V6WA 4OEFA 5I1BA 3WMVA 1BFCA 3LTQA 1S0LA 3B9UA 3UD7A 5HPZA 3O49A 3AKIA 3FFZA 3ILAA 2D23A 3OGGA 1FMZA 4G6MA 1P63A 4HA2A 4ZFWB 3N0KA 2KH2A 4FVVA 1DJSB 1G9CA 4USPA 4EFQA 3WINC 4ENDA 4EB2B 4USOA 3CU1B 4H04A 1PC8B 3UD8A 1WD3A 2E4MC 2GO2A 4QBVA 4Z8SB 1M2TB 4I3NA 1FMMS 5EG6C 3N7MA 4A7YA 1HWPB 2QN4A 4LO7C 5FZYA 1IHKA 3CA0A 1M16A 1S0GA 3WO2A 5DUYA 2D1ZA 3IAGC 3MPPG 3O4OA 4F34A 1QQKA 4I6IA 1TTUA 3O5WB 2HWMA 3FJIA 3UD9A 2NVHA 2NYYA 1TIEA 3CQAA 4ZGRB 4Q91A 1ISWA 5FNWA 4IHZA 4J2YA 5D62A 1D0HA 3AJ6A 3A23A 3WO3A 4ZBVB 2Q3NB 3ZC8A 1ONKB 4IONA 4Q9GA 1G9BA 3VUOA 1CE7B 4P6AA 4JPZA 4PC4A 3PHZA 5EHAA 2RQ9A 3FUQA 1HWNB 4IY8A 2L5XA 1OQLB 4F83A 4OW4A 3WO4A 4GOVA 3HN1A 3VSZA 4LO2C 3IM6A 1FWVA 1F31A 3N7LA 3SNVA 3NBCA 2D24A 3V0BB 2HW9A 3K1XA 4I4SA 2LIQA 3O4BA 3BTAA 3CA6A 4ZOTA 3OJ2A 1UPSA 2ERMA 2Y9GA 1HKNA 4JQ0A 1G82A 3OGFA 2BEAA 2NZ9A 4LO0A 4ZLBB 1RMLA 3PUBA 4OUJA 5JLVA 2FDBM 3S8JA 4XKIA 2I1BA 4LO3C 21BIA 5BP5C 2D7RA 3PG0A 1BA7A 2NP0A 1IT0A 2LIEA 1IOBA 5F90A 4I4UA 4HJJA 4QO3A 1FWUA 2VSAA 3AH1A 2Q9XA 1SR4A 3H6RA 1Q1UA 4I4XA 1WBCA 1XZZA 2AAIB 2DRZA 3C9ZA 3CA1A 3RTIB 1IRPA 4LO1C 4EKXB 2HZ9A 4JRAA 3FJ8A 2NM1A 3A22A 4MZHA 1PZZA 2DREA 4ISRA 4L4HA 5E24E 4OEGA 4AN7B 1S0BA 2FO1A 1JQZA 1W3GA 1DQOA 3IM7A 1YXWA 1AFCA 1AVXB 1S0EA 2D43A 2K43A 2F8XC 1QXMA 1RZOB 2Y9XE 5D61A 1XHBA 1BFFA 1BLDA 1I1EA 3E8LC 1J0SA 1YF8B 1Z0HA 3N7JA 4I2SA 1PUMB 4IZEA 3R4UA 3RSJA 2HWAA 4CJMA 3V0AA 3EF2A 2AXMA 2MLLB 4KC3A 3VWCA 1V6XA 1E0OA 2QYIB 41BIA 3CRHA 4KBBA 3AZWA 3HMYA 4GP0A 4R6UB 3JRRA 1L2HA 3WINA 1BARA 1FV3A 4MZFB 3BB2A 4H9WA 2Y9WC 1YYNA 4EFPA 4ZFYB 1RY7A 4JKXB 2R9KB 1PWAA 1BASA 2E4MA 4Z9WB 3CA3A 3O4AA 2GZBA 4YOLA 4OWLA 3QR5A 2VSEA 1TFMB 1JT7A 3PMEA 5BXTA 4GOYA 3OJMA 1HCDA 1NZKA 2RG9B 3IIRA 4KEJA 3FJAA 3BAUA 2D20A 3FJBA 4A7KA 5FZZA 1HWOB 5F8SA 4AN6A 4I4OA 2DRYA 1IJTA 1TP0A 2VUAA 1EVTA 3AKGA 2VLCA 3AH4A 1DFCA 2ZQOA 5D63A 3VSFA 4I37A 5FNXA 3AKHA 2AFGA 1Z2VA 4D0ZA 1V6VA 3KMVA 1EYLA 4QD2B 1Q03A 1RG8A 5EC5A 1AVWB 3Q7YA 2AQZA 1S0DA 4I96A 3CRGA 4TLPA 1W3AA 1S0FA 4KEKA 3FJEA 4GP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DQG A;  4OWK A;  5F8W A;  2ET2 A;  2FFU A;  3H6R B;  1JT3 A;  3HAL A;  4L4I A;  3H6S E;  1VCL A;  2X2S A;  2ZQN A;  4P0J A;  3CA5 A;  2M49 A;  2WBC A;  3BAQ A;  1AXM A;  3FJD A;  4J2X A;  1II4 A;  3Q7X A;  3R4S A;  3V79 C;  3BAH A;  3VT0 A;  3AH2 A;  4ZFU B;  3H6Q A;  4LO3 A;  4I1B A;  3O44 A;  4I7I A;  5BQU A;  4DEN A;  4JKQ A;  4QD2 C;  4XFU A;  2XOA A;  4J2K A;  2IHO A;  1MD6 A;  3AKF A;  3BA5 A;  2KLL A;  1IRA X;  4I8M A;  5BXS A;  3BRD A;  4GAF A;  3A07 A;  4JAW A;  4KEI A;  3O4C A;  3FJF A;  3S8K A;  3FJC A;  4II0 A;  3P6J A;  5DZU A;  3BA4 A;  2F2F C;  1T4Q A;  4G9N A;  5JMC A;  3HOM A;  3ZXG A;  2BEB A;  4LO1 A;  2D7I A;  7I1B A;  4X38 A;  8I1B A;  4J2S A;  1FN0 A;  3F1R A;  1AVU A;  1NUN A;  1ABR B;  1S0C A;  1WBA A;  2Z49 A;  1BLA A;  3NBN A;  4I4Q A;  4WBC A;  3VEQ A;  1AVA C;  2MIB A;  3BX1 C;  4I4P A;  2BFH A;  4IYB A;  4FGF A;  1TWE A;  3POK A;  4DEP A;  1R8O A;  3BAD A;  2ZR1 B;  1EPW A;  3I2X A;  2D22 A;  1K5U A;  5G00 A;  3FJK A;  3F62 B;  5DSS B;  4EEE B;  2VXR A;  1TWM A;  3AJ5 A;  4XFT A;  2YUG A;  3QYD A;  1FQ9 A;  4I4Y A;  3ZXD A;  5F8Y A;  2Y9F A;  1BFB A;  4G1R A;  4I1E A;  2FGF A;  5BXR A;  4ZKT B;  1FV2 A;  2VU9 A;  1XYF A;  3JUT A;  2KI6 B;  1GGP B;  1DZD A;  1T9F A;  4OWJ A;  4QKS A;  4I4R A;  1DFQ A;  1V6U A;  5FZU A;  3VT2 A;  1MC9 A;  2Z48 A;  1DLL A;  3P53 A;  2KKI A;  3BAV A;  1ISY A;  1JTC A;  1K5V A;  3NBD A;  4JP0 A;  1CVS A;  3FJH A;  3UDA A;  3OJV A;  1SZ6 B;  3OBR A;  4IZX A;  4J23 B;  4I0Y A;  4IQP A;  3ZX7 A;  3AZV A;  3O3Q A;  4G6J A;  1TOO A;  4OEE A;  5BOW A;  2P23 A;  5GAQ A;  3N7K A;  3Q7W A;  2K4A B;  1A8D A;  5DVH A;  1PUU B;  3NJ5 A;  4D8H A;  4ISQ A;  1R8N A;  1EV2 A;  4D0T A;  1DZC A;  3TC2 A;  4EFR A;  2NTD A;  4Q9P A;  3RMY A;  4LO2 A;  3I29 B;  4XFS A;  4HR6 C;  3BRF A;  1DIW A;  3BAO A;  1JY0 A;  2MC2 A;  1JT4 A;  2D44 A;  1AF9 A;  3W9T A;  1I1B A;  3FUO A;  3FJJ A;  2RST A;  1G9A A;  2P39 A;  3O4D A;  9ILB A;  2J3P A;  3BAG A;  3UJ4 A;  2K8R A;  4GAI A;  4X3A A;  3FJ9 A;  3ZC9 A;  1Q04 A;  4LO0 C;  3WA1 A;  1Z4S A;  3NBE A;  5BVP I;  3IM5 A;  1FGA A;  2IWT B;  5BP5 A;  4QKR A;  2VXT I;  2DS0 A;  1JLX A;  1W3F A;  3CAH A;  4X39 A;  1JLY A;  3CA4 A;  3RMX A;  6I1B A;  1XG6 A;  4P0L A;  4ZA3 B;  3RTJ B;  3WMU A;  3HBW A;  4G9M A;  4QC4 A;  1HCE A;  3CRI A;  3T8S A;  3HSM A;  5BQU C;  5B2H A;  4DCK C;  3V0A B;  1HIB A;  2KI4 A;  3V0B A;  1YBI A;  1N4K A;  3LLP A;  1SR4 C;  1ILR 1;  4A7Z A;  2X2T A;  4LO8 B;  4IY9 A;  2UUS A;  1ISZ A;  1WD4 A;  2FFV A;  31BI A;  1ITB A;  1ISV A;  1ISX A;  4X37 A;  1KNM A;  3MAL A;  1IIL A;  5BXP A;  3FGM A;  2WRY A;  3I2A A;  1G9D A;  4P0K A;  3D7W B;  2F2F A;  1YTO A;  2ESU A;  3BA7 A;  3VT1 A;  1QQL A;  3A21 A;  4QAL A;  4LO7 B;  1HWM B;  3OBT A;  3UJ0 A;  4QBC A;  3P6I A;  4I4V A;  1BFG A;  1JT5 A;  3BRG C;  1V6W A;  4OEF A;  5I1B A;  3WMV A;  1BFC A;  3LTQ A;  1S0L A;  3B9U A;  3UD7 A;  5HPZ A;  3O49 A;  3AKI A;  3FFZ A;  3ILA A;  2D23 A;  3OGG A;  1FMZ A;  4G6M A;  1P63 A;  4HA2 A;  4ZFW B;  3N0K A;  2KH2 A;  4FVV A;  1DJS B;  1G9C A;  4USP A;  4EFQ A;  3WIN C;  4END A;  4EB2 B;  4USO A;  3CU1 B;  4H04 A;  1PC8 B;  3UD8 A;  1WD3 A;  2E4M C;  2GO2 A;  4QBV A;  4Z8S B;  1M2T B;  4I3N A;  1FMM S;  5EG6 C;  3N7M A;  4A7Y A;  1HWP B;  2QN4 A;  4LO7 C;  5FZY A;  1IHK A;  3CA0 A;  1M16 A;  1S0G A;  3WO2 A;  5DUY A;  2D1Z A;  3IAG C;  3MPP G;  3O4O A;  4F34 A;  1QQK A;  4I6I A;  1TTU A;  3O5W B;  2HWM A;  3FJI A;  3UD9 A;  2NVH A;  2NYY A;  1TIE A;  3CQA A;  4ZGR B;  4Q91 A;  1ISW A;  5FNW A;  4IHZ A;  4J2Y A;  5D62 A;  1D0H A;  3AJ6 A;  3A23 A;  3WO3 A;  4ZBV B;  2Q3N B;  3ZC8 A;  1ONK B;  4ION A;  4Q9G A;  1G9B A;  3VUO A;  1CE7 B;  4P6A A;  4JPZ A;  4PC4 A;  3PHZ A;  5EHA A;  2RQ9 A;  3FUQ A;  1HWN B;  4IY8 A;  2L5X A;  1OQL B;  4F83 A;  4OW4 A;  3WO4 A;  4GOV A;  3HN1 A;  3VSZ A;  4LO2 C;  3IM6 A;  1FWV A;  1F31 A;  3N7L A;  3SNV A;  3NBC A;  2D24 A;  3V0B B;  2HW9 A;  3K1X A;  4I4S A;  2LIQ A;  3O4B A;  3BTA A;  3CA6 A;  4ZOT A;  3OJ2 A;  1UPS A;  2ERM A;  2Y9G A;  1HKN A;  4JQ0 A;  1G82 A;  3OGF A;  2BEA A;  2NZ9 A;  4LO0 A;  4ZLB B;  1RML A;  3PUB A;  4OUJ A;  5JLV A;  2FDB M;  3S8J A;  4XKI A;  2I1B A;  4LO3 C;  21BI A;  5BP5 C;  2D7R A;  3PG0 A;  1BA7 A;  2NP0 A;  1IT0 A;  2LIE A;  1IOB A;  5F90 A;  4I4U A;  4HJJ A;  4QO3 A;  1FWU A;  2VSA A;  3AH1 A;  2Q9X A;  1SR4 A;  3H6R A;  1Q1U A;  4I4X A;  1WBC A;  1XZZ A;  2AAI B;  2DRZ A;  3C9Z A;  3CA1 A;  3RTI B;  1IRP A;  4LO1 C;  4EKX B;  2HZ9 A;  4JRA A;  3FJ8 A;  2NM1 A;  3A22 A;  1PZZ A;  2DRE A;  4ISR A;  4L4H A;  5E24 E;  4OEG A;  4AN7 B;  1S0B A;  2FO1 A;  1JQZ A;  1W3G A;  1DQO A;  3IM7 A;  1YXW A;  1AFC A;  1AVX B;  1S0E A;  2D43 A;  2K43 A;  2F8X C;  1QXM A;  1RZO B;  2Y9X E;  5D61 A;  1XHB A;  1BFF A;  1BLD A;  1I1E A;  3E8L C;  1J0S A;  1YF8 B;  1Z0H A;  3N7J A;  4I2S A;  1PUM B;  4IZE A;  3R4U A;  3RSJ A;  2HWA A;  4CJM A;  3V0A A;  3EF2 A;  2AXM A;  2MLL B;  4KC3 A;  3VWC A;  1V6X A;  1E0O A;  2QYI B;  41BI A;  3CRH A;  4KBB A;  3AZW A;  3HMY A;  4GP0 A;  4R6U B;  3JRR A;  1L2H A;  3WIN A;  1BAR A;  1FV3 A;  3BB2 A;  4H9W A;  2Y9W C;  1YYN A;  4EFP A;  4ZFY B;  1RY7 A;  4JKX B;  2R9K B;  1PWA A;  1BAS A;  2E4M A;  4Z9W B;  3CA3 A;  3O4A A;  2GZB A;  4YOL A;  4OWL A;  3QR5 A;  2VSE A;  1TFM B;  1JT7 A;  3PME A;  5BXT A;  4GOY A;  3OJM A;  1HCD A;  1NZK A;  2RG9 B;  3IIR A;  4KEJ A;  3FJA A;  3BAU A;  2D20 A;  3FJB A;  4A7K A;  5FZZ A;  1HWO B;  5F8S A;  4AN6 A;  4I4O A;  2DRY A;  1IJT A;  1TP0 A;  2VUA A;  1EVT A;  3AKG A;  2VLC A;  3AH4 A;  1DFC A;  2ZQO A;  5D63 A;  3VSF A;  4I37 A;  5FNX A;  3AKH A;  2AFG A;  1Z2V A;  4D0Z A;  1V6V A;  3KMV A;  1EYL A;  4QD2 B;  1Q03 A;  1RG8 A;  5EC5 A;  1AVW B;  3Q7Y A;  2AQZ A;  1S0D A;  4I96 A;  3CRG A;  4TLP A;  1W3A A;  1S0F A;  4KEK A;  3FJE A;  4GP3 A; 
#chains in the Genus database with same CATH topology
 1DQG A;  4OWK A;  5F8W A;  2ET2 A;  2FFU A;  3H6R B;  1JT3 A;  3HAL A;  4L4I A;  3H6S E;  1VCL A;  2X2S A;  2ZQN A;  4P0J A;  3CA5 A;  2M49 A;  2WBC A;  3BAQ A;  1AXM A;  3FJD A;  4J2X A;  1II4 A;  3Q7X A;  3R4S A;  3V79 C;  3BAH A;  3VT0 A;  3AH2 A;  4ZFU B;  3H6Q A;  4LO3 A;  4I1B A;  3O44 A;  4I7I A;  5BQU A;  4DEN A;  4JKQ A;  4QD2 C;  2NS2 A;  4XFU A;  2XOA A;  4J2K A;  2IHO A;  1MD6 A;  3AKF A;  3BA5 A;  2KLL A;  1IRA X;  4I8M A;  5BXS A;  3BRD A;  4GAF A;  3A07 A;  4JAW A;  4KEI A;  3O4C A;  3FJF A;  3S8K A;  3FJC A;  4II0 A;  3P6J A;  5DZU A;  3BA4 A;  2F2F C;  1T4Q A;  4G9N A;  5JMC A;  4UY4 A;  3HOM A;  3ZXG A;  2BEB A;  4LO1 A;  2D7I A;  7I1B A;  4X38 A;  8I1B A;  4J2S A;  1FN0 A;  3F1R A;  1AVU A;  1NUN A;  1ABR B;  1S0C A;  1WBA A;  2Z49 A;  1BLA A;  3NBN A;  4I4Q A;  4WBC A;  3VEQ A;  1AVA C;  2MIB A;  3BX1 C;  4I4P A;  2BFH A;  4IYB A;  4FGF A;  1TWE A;  3POK A;  4DEP A;  1R8O A;  3BAD A;  2ZR1 B;  1EPW A;  3I2X A;  2D22 A;  1K5U A;  5G00 A;  3FJK A;  3F62 B;  5DSS B;  4EEE B;  2VXR A;  1TWM A;  3AJ5 A;  4XFT A;  2YUG A;  3QYD A;  1FQ9 A;  4I4Y A;  3ZXD A;  5F8Y A;  2Y9F A;  1BFB A;  4G1R A;  4I1E A;  2FGF A;  5BXR A;  4ZKT B;  1FV2 A;  2VU9 A;  1XYF A;  3JUT A;  2KI6 B;  1GGP B;  1DZD A;  1T9F A;  4OWJ A;  4QKS A;  4I4R A;  1DFQ A;  1V6U A;  5FZU A;  4H75 A;  3VT2 A;  1MC9 A;  2Z48 A;  1DLL A;  3P53 A;  2KKI A;  3BAV A;  1ISY A;  1JTC A;  1K5V A;  3NBD A;  4JP0 A;  1CVS A;  3FJH A;  3UDA A;  3OJV A;  1SZ6 B;  3OBR A;  4IZX A;  4J23 B;  4I0Y A;  4IQP A;  3ZX7 A;  3AZV A;  3O3Q A;  4G6J A;  1TOO A;  4OEE A;  5BOW A;  2P23 A;  5GAQ A;  3N7K A;  3Q7W A;  2K4A B;  1A8D A;  5DVH A;  1PUU B;  3NJ5 A;  4D8H A;  4ISQ A;  1R8N A;  1EV2 A;  4D0T A;  1DZC A;  3TC2 A;  4EFR A;  2NTD A;  4Q9P A;  3RMY A;  4LO2 A;  3I29 B;  4XFS A;  4HR6 C;  3BRF A;  1DIW A;  3BAO A;  1JY0 A;  2MC2 A;  1JT4 A;  2D44 A;  1AF9 A;  3W9T A;  1I1B A;  3FUO A;  3FJJ A;  2RST A;  1G9A A;  2P39 A;  3O4D A;  9ILB A;  2J3P A;  3BAG A;  3UJ4 A;  2K8R A;  4GAI A;  4X3A A;  3FJ9 A;  3ZC9 A;  1Q04 A;  4LO0 C;  3WA1 A;  1Z4S A;  3NBE A;  5BVP I;  3IM5 A;  1FGA A;  2IWT B;  5BP5 A;  4QKR A;  2VXT I;  2DS0 A;  1JLX A;  1W3F A;  3CAH A;  4X39 A;  1JLY A;  3CA4 A;  3RMX A;  6I1B A;  1XG6 A;  4P0L A;  4ZA3 B;  3RTJ B;  3WMU A;  3HBW A;  4G9M A;  4QC4 A;  1HCE A;  3CRI A;  3T8S A;  3HSM A;  5BQU C;  5B2H A;  4DCK C;  3V0A B;  1HIB A;  2KI4 A;  3V0B A;  1YBI A;  1N4K A;  3LLP A;  1SR4 C;  1ILR 1;  4A7Z A;  2X2T A;  4LO8 B;  4IY9 A;  2UUS A;  1ISZ A;  1WD4 A;  2FFV A;  31BI A;  1ITB A;  1ISV A;  1ISX A;  4X37 A;  1KNM A;  3MAL A;  1IIL A;  5BXP A;  3FGM A;  2WRY A;  3I2A A;  1G9D A;  4P0K A;  3D7W B;  2F2F A;  1YTO A;  2ESU A;  3BA7 A;  3VT1 A;  1QQL A;  3A21 A;  4QAL A;  4LO7 B;  1HWM B;  3OBT A;  3UJ0 A;  4QBC A;  3P6I A;  4I4V A;  1BFG A;  4MZG B;  1JT5 A;  3BRG C;  1V6W A;  4OEF A;  5I1B A;  3WMV A;  1BFC A;  3LTQ A;  1S0L A;  3B9U A;  3UD7 A;  5HPZ A;  3O49 A;  3AKI A;  3FFZ A;  3ILA A;  2D23 A;  3OGG A;  1FMZ A;  4G6M A;  1P63 A;  4HA2 A;  4ZFW B;  3N0K A;  2KH2 A;  4FVV A;  1DJS B;  1G9C A;  4USP A;  4EFQ A;  3WIN C;  4END A;  4EB2 B;  4USO A;  3CU1 B;  4H04 A;  1PC8 B;  3UD8 A;  1WD3 A;  2E4M C;  2GO2 A;  4QBV A;  4Z8S B;  1M2T B;  4I3N A;  1FMM S;  5EG6 C;  3N7M A;  4A7Y A;  1HWP B;  2QN4 A;  4LO7 C;  5FZY A;  1IHK A;  3CA0 A;  1M16 A;  1S0G A;  3WO2 A;  5DUY A;  2D1Z A;  3IAG C;  3MPP G;  3O4O A;  4F34 A;  1QQK A;  4I6I A;  1TTU A;  3O5W B;  2HWM A;  3FJI A;  3UD9 A;  2NVH A;  2NYY A;  1TIE A;  3CQA A;  4ZGR B;  4Q91 A;  1ISW A;  5FNW A;  4IHZ A;  4J2Y A;  5D62 A;  1D0H A;  3AJ6 A;  3A23 A;  3WO3 A;  4ZBV B;  2Q3N B;  3ZC8 A;  1ONK B;  4ION A;  4Q9G A;  1G9B A;  3VUO A;  1CE7 B;  4P6A A;  4JPZ A;  4PC4 A;  3PHZ A;  5EHA A;  2RQ9 A;  3FUQ A;  1HWN B;  4IY8 A;  2L5X A;  1OQL B;  4F83 A;  4OW4 A;  3WO4 A;  4GOV A;  3HN1 A;  3VSZ A;  4LO2 C;  3IM6 A;  1FWV A;  1F31 A;  3N7L A;  3SNV A;  3NBC A;  2D24 A;  3V0B B;  2HW9 A;  3K1X A;  4I4S A;  2LIQ A;  3O4B A;  3BTA A;  3CA6 A;  4ZOT A;  3OJ2 A;  1UPS A;  2ERM A;  2Y9G A;  1HKN A;  4JQ0 A;  1G82 A;  3OGF A;  2BEA A;  2NZ9 A;  4LO0 A;  4ZLB B;  1RML A;  3PUB A;  4OUJ A;  5JLV A;  2FDB M;  3S8J A;  4XKI A;  2I1B A;  4LO3 C;  21BI A;  5BP5 C;  2D7R A;  3PG0 A;  1BA7 A;  2NP0 A;  1IT0 A;  2LIE A;  1IOB A;  5F90 A;  4I4U A;  4HJJ A;  4QO3 A;  1FWU A;  2VSA A;  3AH1 A;  2Q9X A;  1SR4 A;  3H6R A;  1Q1U A;  4I4X A;  1WBC A;  1XZZ A;  2AAI B;  2DRZ A;  3C9Z A;  3CA1 A;  3RTI B;  1IRP A;  4LO1 C;  4EKX B;  2HZ9 A;  4JRA A;  3FJ8 A;  2NM1 A;  3A22 A;  4MZH A;  1PZZ A;  2DRE A;  4ISR A;  4L4H A;  5E24 E;  4OEG A;  4AN7 B;  1S0B A;  2FO1 A;  1JQZ A;  1W3G A;  1DQO A;  3IM7 A;  1YXW A;  1AFC A;  1AVX B;  1S0E A;  2D43 A;  2K43 A;  2F8X C;  1QXM A;  1RZO B;  2Y9X E;  5D61 A;  1XHB A;  1BFF A;  1BLD A;  1I1E A;  3E8L C;  1J0S A;  1YF8 B;  1Z0H A;  3N7J A;  4I2S A;  1PUM B;  4IZE A;  3R4U A;  3RSJ A;  2HWA A;  4CJM A;  3V0A A;  3EF2 A;  2AXM A;  2MLL B;  4KC3 A;  3VWC A;  1V6X A;  1E0O A;  2QYI B;  41BI A;  3CRH A;  4KBB A;  3AZW A;  3HMY A;  4GP0 A;  4R6U B;  3JRR A;  1L2H A;  3WIN A;  1BAR A;  1FV3 A;  4MZF B;  3BB2 A;  4H9W A;  2Y9W C;  1YYN A;  4EFP A;  4ZFY B;  1RY7 A;  4JKX B;  2R9K B;  1PWA A;  1BAS A;  2E4M A;  4Z9W B;  3CA3 A;  3O4A A;  2GZB A;  4YOL A;  4OWL A;  3QR5 A;  2VSE A;  1TFM B;  1JT7 A;  3PME A;  5BXT A;  4GOY A;  3OJM A;  1HCD A;  1NZK A;  2RG9 B;  3IIR A;  4KEJ A;  3FJA A;  3BAU A;  2D20 A;  3FJB A;  4A7K A;  5FZZ A;  1HWO B;  5F8S A;  4AN6 A;  4I4O A;  2DRY A;  1IJT A;  1TP0 A;  2VUA A;  1EVT A;  3AKG A;  2VLC A;  3AH4 A;  1DFC A;  2ZQO A;  5D63 A;  3VSF A;  4I37 A;  5FNX A;  3AKH A;  2AFG A;  1Z2V A;  4D0Z A;  1V6V A;  3KMV A;  1EYL A;  4QD2 B;  1Q03 A;  1RG8 A;  5EC5 A;  1AVW B;  3Q7Y A;  2AQZ A;  1S0D A;  4I96 A;  3CRG A;  4TLP A;  1W3A A;  1S0F A;  4KEK A;  3FJE A;  4GP3 A; 
#chains in the Genus database with same CATH homology
 1DQG A;  4OWK A;  5F8W A;  2ET2 A;  2FFU A;  3H6R B;  1JT3 A;  3HAL A;  4L4I A;  3H6S E;  1VCL A;  2X2S A;  2ZQN A;  4P0J A;  3CA5 A;  2M49 A;  2WBC A;  3BAQ A;  1AXM A;  3FJD A;  4J2X A;  1II4 A;  3Q7X A;  3R4S A;  3V79 C;  3BAH A;  3VT0 A;  3AH2 A;  4ZFU B;  3H6Q A;  4LO3 A;  4I1B A;  3O44 A;  4I7I A;  5BQU A;  4DEN A;  4JKQ A;  4QD2 C;  2NS2 A;  4XFU A;  2XOA A;  4J2K A;  2IHO A;  1MD6 A;  3AKF A;  3BA5 A;  2KLL A;  1IRA X;  4I8M A;  5BXS A;  3BRD A;  4GAF A;  3A07 A;  4JAW A;  4KEI A;  3O4C A;  3FJF A;  3S8K A;  3FJC A;  4II0 A;  3P6J A;  5DZU A;  3BA4 A;  2F2F C;  1T4Q A;  4G9N A;  5JMC A;  4UY4 A;  3HOM A;  3ZXG A;  2BEB A;  4LO1 A;  2D7I A;  7I1B A;  4X38 A;  8I1B A;  4J2S A;  1FN0 A;  3F1R A;  1AVU A;  1NUN A;  1ABR B;  1S0C A;  1WBA A;  2Z49 A;  1BLA A;  3NBN A;  4I4Q A;  4WBC A;  3VEQ A;  1AVA C;  2MIB A;  3BX1 C;  4I4P A;  2BFH A;  4IYB A;  4FGF A;  1TWE A;  3POK A;  4DEP A;  1R8O A;  3BAD A;  2ZR1 B;  1EPW A;  3I2X A;  2D22 A;  1K5U A;  5G00 A;  3FJK A;  3F62 B;  5DSS B;  4EEE B;  2VXR A;  1TWM A;  3AJ5 A;  4XFT A;  2YUG A;  3QYD A;  1FQ9 A;  4I4Y A;  3ZXD A;  5F8Y A;  2Y9F A;  1BFB A;  4G1R A;  4I1E A;  2FGF A;  5BXR A;  4ZKT B;  1FV2 A;  2VU9 A;  1XYF A;  3JUT A;  2KI6 B;  1GGP B;  1DZD A;  1T9F A;  4OWJ A;  4QKS A;  4I4R A;  1DFQ A;  1V6U A;  5FZU A;  4H75 A;  3VT2 A;  1MC9 A;  2Z48 A;  1DLL A;  3P53 A;  2KKI A;  3BAV A;  1ISY A;  1JTC A;  1K5V A;  3NBD A;  4JP0 A;  1CVS A;  3FJH A;  3UDA A;  3OJV A;  1SZ6 B;  3OBR A;  4IZX A;  4J23 B;  4I0Y A;  4IQP A;  3ZX7 A;  3AZV A;  3O3Q A;  4G6J A;  1TOO A;  4OEE A;  5BOW A;  2P23 A;  5GAQ A;  3N7K A;  3Q7W A;  2K4A B;  1A8D A;  5DVH A;  1PUU B;  3NJ5 A;  4D8H A;  4ISQ A;  1R8N A;  1EV2 A;  4D0T A;  1DZC A;  3TC2 A;  4EFR A;  2NTD A;  4Q9P A;  3RMY A;  4LO2 A;  3I29 B;  4XFS A;  4HR6 C;  3BRF A;  1DIW A;  3BAO A;  1JY0 A;  2MC2 A;  1JT4 A;  2D44 A;  1AF9 A;  3W9T A;  1I1B A;  3FUO A;  3FJJ A;  2RST A;  1G9A A;  2P39 A;  3O4D A;  9ILB A;  2J3P A;  3BAG A;  3UJ4 A;  2K8R A;  4GAI A;  4X3A A;  3FJ9 A;  3ZC9 A;  1Q04 A;  4LO0 C;  3WA1 A;  1Z4S A;  3NBE A;  5BVP I;  3IM5 A;  1FGA A;  2IWT B;  5BP5 A;  4QKR A;  2VXT I;  2DS0 A;  1JLX A;  1W3F A;  3CAH A;  4X39 A;  1JLY A;  3CA4 A;  3RMX A;  6I1B A;  1XG6 A;  4P0L A;  4ZA3 B;  3RTJ B;  3WMU A;  3HBW A;  4G9M A;  4QC4 A;  1HCE A;  3CRI A;  3T8S A;  3HSM A;  5BQU C;  5B2H A;  4DCK C;  3V0A B;  1HIB A;  2KI4 A;  3V0B A;  1YBI A;  1N4K A;  3LLP A;  1SR4 C;  1ILR 1;  4A7Z A;  2X2T A;  4LO8 B;  4IY9 A;  2UUS A;  1ISZ A;  1WD4 A;  2FFV A;  31BI A;  1ITB A;  1ISV A;  1ISX A;  4X37 A;  1KNM A;  3MAL A;  1IIL A;  5BXP A;  3FGM A;  2WRY A;  3I2A A;  1G9D A;  4P0K A;  3D7W B;  2F2F A;  1YTO A;  2ESU A;  3BA7 A;  3VT1 A;  1QQL A;  3A21 A;  4QAL A;  4LO7 B;  1HWM B;  3OBT A;  3UJ0 A;  4QBC A;  3P6I A;  4I4V A;  1BFG A;  4MZG B;  1JT5 A;  3BRG C;  1V6W A;  4OEF A;  5I1B A;  3WMV A;  1BFC A;  3LTQ A;  1S0L A;  3B9U A;  3UD7 A;  5HPZ A;  3O49 A;  3AKI A;  3FFZ A;  3ILA A;  2D23 A;  3OGG A;  1FMZ A;  4G6M A;  1P63 A;  4HA2 A;  4ZFW B;  3N0K A;  2KH2 A;  4FVV A;  1DJS B;  1G9C A;  4USP A;  4EFQ A;  3WIN C;  4END A;  4EB2 B;  4USO A;  3CU1 B;  4H04 A;  1PC8 B;  3UD8 A;  1WD3 A;  2E4M C;  2GO2 A;  4QBV A;  4Z8S B;  1M2T B;  4I3N A;  1FMM S;  5EG6 C;  3N7M A;  4A7Y A;  1HWP B;  2QN4 A;  4LO7 C;  5FZY A;  1IHK A;  3CA0 A;  1M16 A;  1S0G A;  3WO2 A;  5DUY A;  2D1Z A;  3IAG C;  3MPP G;  3O4O A;  4F34 A;  1QQK A;  4I6I A;  1TTU A;  3O5W B;  2HWM A;  3FJI A;  3UD9 A;  2NVH A;  2NYY A;  1TIE A;  3CQA A;  4ZGR B;  4Q91 A;  1ISW A;  5FNW A;  4IHZ A;  4J2Y A;  5D62 A;  1D0H A;  3AJ6 A;  3A23 A;  3WO3 A;  4ZBV B;  2Q3N B;  3ZC8 A;  1ONK B;  4ION A;  4Q9G A;  1G9B A;  3VUO A;  1CE7 B;  4P6A A;  4JPZ A;  4PC4 A;  3PHZ A;  5EHA A;  2RQ9 A;  3FUQ A;  1HWN B;  4IY8 A;  2L5X A;  1OQL B;  4F83 A;  4OW4 A;  3WO4 A;  4GOV A;  3HN1 A;  3VSZ A;  4LO2 C;  3IM6 A;  1FWV A;  1F31 A;  3N7L A;  3SNV A;  3NBC A;  2D24 A;  3V0B B;  2HW9 A;  3K1X A;  4I4S A;  2LIQ A;  3O4B A;  3BTA A;  3CA6 A;  4ZOT A;  3OJ2 A;  1UPS A;  2ERM A;  2Y9G A;  1HKN A;  4JQ0 A;  1G82 A;  3OGF A;  2BEA A;  2NZ9 A;  4LO0 A;  4ZLB B;  1RML A;  3PUB A;  4OUJ A;  5JLV A;  2FDB M;  3S8J A;  4XKI A;  2I1B A;  4LO3 C;  21BI A;  5BP5 C;  2D7R A;  3PG0 A;  1BA7 A;  2NP0 A;  1IT0 A;  2LIE A;  1IOB A;  5F90 A;  4I4U A;  4HJJ A;  4QO3 A;  1FWU A;  2VSA A;  3AH1 A;  2Q9X A;  1SR4 A;  3H6R A;  1Q1U A;  4I4X A;  1WBC A;  1XZZ A;  2AAI B;  2DRZ A;  3C9Z A;  3CA1 A;  3RTI B;  1IRP A;  4LO1 C;  4EKX B;  2HZ9 A;  4JRA A;  3FJ8 A;  2NM1 A;  3A22 A;  4MZH A;  1PZZ A;  2DRE A;  4ISR A;  4L4H A;  5E24 E;  4OEG A;  4AN7 B;  1S0B A;  2FO1 A;  1JQZ A;  1W3G A;  1DQO A;  3IM7 A;  1YXW A;  1AFC A;  1AVX B;  1S0E A;  2D43 A;  2K43 A;  2F8X C;  1QXM A;  1RZO B;  2Y9X E;  5D61 A;  1XHB A;  1BFF A;  1BLD A;  1I1E A;  3E8L C;  1J0S A;  1YF8 B;  1Z0H A;  3N7J A;  4I2S A;  1PUM B;  4IZE A;  3R4U A;  3RSJ A;  2HWA A;  4CJM A;  3V0A A;  3EF2 A;  2AXM A;  2MLL B;  4KC3 A;  3VWC A;  1V6X A;  1E0O A;  2QYI B;  41BI A;  3CRH A;  4KBB A;  3AZW A;  3HMY A;  4GP0 A;  4R6U B;  3JRR A;  1L2H A;  3WIN A;  1BAR A;  1FV3 A;  4MZF B;  3BB2 A;  4H9W A;  2Y9W C;  1YYN A;  4EFP A;  4ZFY B;  1RY7 A;  4JKX B;  2R9K B;  1PWA A;  1BAS A;  2E4M A;  4Z9W B;  3CA3 A;  3O4A A;  2GZB A;  4YOL A;  4OWL A;  3QR5 A;  2VSE A;  1TFM B;  1JT7 A;  3PME A;  5BXT A;  4GOY A;  3OJM A;  1HCD A;  1NZK A;  2RG9 B;  3IIR A;  4KEJ A;  3FJA A;  3BAU A;  2D20 A;  3FJB A;  4A7K A;  5FZZ A;  1HWO B;  5F8S A;  4AN6 A;  4I4O A;  2DRY A;  1IJT A;  1TP0 A;  2VUA A;  1EVT A;  3AKG A;  2VLC A;  3AH4 A;  1DFC A;  2ZQO A;  5D63 A;  3VSF A;  4I37 A;  5FNX A;  3AKH A;  2AFG A;  1Z2V A;  4D0Z A;  1V6V A;  3KMV A;  1EYL A;  4QD2 B;  1Q03 A;  1RG8 A;  5EC5 A;  1AVW B;  3Q7Y A;  2AQZ A;  1S0D A;  4I96 A;  3CRG A;  4TLP A;  1W3A A;  1S0F A;  4KEK A;  3FJE A;  4GP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...