1QQKA

The crystal structure of fibroblast growth factor 7 (keratinocyte growth factor)
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
132
structure length
129
Chain Sequence
b'DIRVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWGGEMFVALNQKGLPVKGKKTKKEQKTAHFLPMAIT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBROBLAST GROWTH FACTOR 7
publication title Structural basis for interaction of FGF-1, FGF-2, and FGF-7 with different heparan sulfate motifs.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Hormone/growth factor
total genus 16
structure length 129
sequence length 132
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-06-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1qqkA00
2RSTA 3BADA 4OEEA 1W3AA 1TWEA 2KH2A 3P6IA 3KMVA 1S0CA 5JMCA 4Z8SB 2D43A 4GP0A 1AFCA 4FVVA 3UD7A 4A7KA 3VT0A 3ZC9A 3H6RB 1R8OA 1XZZA 3FJJA 4Z9WB 3R4UA 1DZDA 3ILAA 1ISYA 4AN7B 3AKHA 1ISZA 3AKGA 3FFZA 3EF2A 4DEPA 3JUTA 2Y9WC 1VCLA 1S0DA 2QN4A 3CA6A 1BLDA 4PC4A 2NP0A 3S8JA 3WMUA 4P6AA 2HZ9A 3BAGA 5FZZA 1I1EA 4KEKA 1JQZA 3FJBA 1SR4A 4EFPA 3FJIA 41BIA 3ZX7A 1UPSA 3OBTA 4X39A 2VUAA 1BFCA 1DFQA 3VEQA 3V0BA 1HWOB 4QALA 2WBCA 5F8YA 4I4VA 4DENA 2HWAA 4D8HA 3UD8A 1Z4SA 2FGFA 5BXTA 4WBCA 3V0AB 1F31A 3N0KA 1TOOA 1JT4A 3BX1C 1AF9A 4Q9PA 2KLLA 3FUQA 2K43A 4I4QA 4IYBA 1MD6A 4KEIA 4LO2A 4QO3A 1QXMA 3BA4A 4KEJA 3I29B 2DREA 4EB2B 3BA5A 3BRDA 1ISVA 1JTCA 1S0BA 3HALA 1MC9A 4II0A 3IM7A 1HKNA 2LIQA 2P23A 1AVWB 3PUBA 3PHZA 2NVHA 1R8NA 4ZKTB 4P0JA 1EVTA 4ENDA 1ISWA 4QBCA 1BARA 6I1BA 1D0HA 4X3AA 4EKXB 3WO2A 3A22A 4IZEA 1FV2A 3WINA 1WD3A 1PUMB 1S0LA 5BQUA 1AXMA 3O5WB 5DVHA 2F2FC 4TLPA 3MALA 1DZCA 1JT3A 3C9ZA 1XHBA 4OWLA 4QBVA 1Q03A 3CA5A 4H9WA 5F8SA 4I4UA 2BEBA 3AZWA 5G00A 3BAQA 1WD4A 3RMYA 2DS0A 1V6VA 3FJEA 3AKFA 4A7ZA 3IM6A 3BAOA 4EEEB 4KBBA 5D61A 1V6UA 2R9KB 1JLXA 1E0OA 4OUJA 4P0KA 4H04A 4I8MA 3CU1B 4IQPA 31BIA 1YF8B 3BB2A 5D62A 2NTDA 2RG9B 3CRGA 3BAUA 3P53A 1BA7A 4I4OA 1G82A 4I4SA 1T9FA 1V6WA 2KI4A 7I1BA 4G1RA 5D63A 4IY9A 4KC3A 5B2HA 3P6JA 1ITBA 3BTAA 4LO8B 2NYYA 4J2XA 4G9MA 4LO1A 4D0ZA 1DIWA 4I2SA 4LO7C 3CRHA 1HIBA 1YYNA 2FFVA 1CVSA 1JY0A 1T4QA 4IZXA 2AAIB 2Z48A 1G9CA 4ZGRB 1Z0HA 1IILA 2GO2A 4ISRA 4HA2A 1BASA 3B9UA 3BA7A 2QYIB 4LO7B 5BP5A 3BAVA 3H6SE 4OEGA 3RSJA 5BXSA 5E24E 2MLLB 3UJ4A 3W9TA 3F62B 3RMXA 5FNWA 4J23B 2ZQOA 2K4AB 4F83A 3FJKA 3HSMA 3OGGA 4Q91A 3WMVA 1DJSB 2FDBM 1EPWA 1SR4C 1WBAA 1HCEA 2AXMA 2D23A 2IWTB 3FUOA 3T8SA 1HWPB 3OJVA 3FGMA 5DSSB 2VSAA 3HOMA 3QYDA 1DQGA 3IIRA 2I1BA 1BFFA 1A8DA 2L5XA 1K5VA 2AQZA 1JLYA 3A21A 3O4BA 3E8LC 3O44A 1AVAC 2RQ9A 3JRRA 1W3GA 3WA1A 1CE7B 3CQAA 2FFUA 5FZYA 1AVXB 4LO2C 5FZUA 3AJ5A 3TC2A 2ZQNA 2VLCA 2J3PA 3V0BB 4OWKA 5I1BA 5EHAA 3O4OA 3AH2A 1GGPB 4X37A 4JP0A 3N7KA 1FWUA 1NUNA 2VU9A 1P63A 4ZA3B 3VUOA 3F1RA 4J2YA 1EV2A 4GP3A 1J0SA 1BLAA 1ILR1 3RTIB 1DQOA 4LO0A 4USOA 1RG8A 3A07A 4GAIA 4OEFA 3CA4A 3HBWA 3NBNA 3POKA 1NZKA 4I0YA 4OWJA 3WINC 5BQUC 1IRAX 2MIBA 5EC5A 1FV3A 1RMLA 3CA0A 3CA3A 5GAQA 3VT1A 3UJ0A 5JLVA 3WO4A 5DZUA 1ISXA 4L4HA 3PMEA 3CRIA 1BFGA 1HWMB 2GZBA 4F34A 1G9DA 4GAFA 4LO3A 1ONKB 3K1XA 3UD9A 4J2SA 1IRPA 4EFRA 3OJMA 3ZXGA 4ZOTA 2E4MC 4QKRA 1FN0A 3N7LA 3NBCA 3FJAA 3HMYA 4JRAA 2UUSA 4I7IA 4D0TA 2FO1A 3H6RA 2X2TA 4EFQA 1FQ9A 1RY7A 4HR6C 2BEAA 3SNVA 5BVPI 3V79C 1N4KA 2IHOA 1PUUB 4X38A 4IY8A 4I1EA 1FMZA 3WO3A 1FMMS 1BFBA 4A7YA 2Y9GA 1S0GA 2X2SA 4DCKC 1KNMA 3OGFA 3FJ9A 3AZVA 3VT2A 2Z49A 4IONA 2HW9A 3O4DA 3BRFA 3VWCA 1HWNB 3IAGC 1DLLA 1M2TB 1RZOB 2KKIA 3N7MA 1OQLB 2MC2A 4HJJA 2K8RA 5BOWA 1YBIA 1QQLA 5BP5C 2Q9XA 1K5UA 1WBCA 2DRYA 3NBEA 3V0AA 2NZ9A 3FJHA 3MPPG 2ERMA 1S0EA 4I4XA 1IHKA 4I96A 3RTJB 4ZFYB 3UDAA 5FNXA 3O3QA 2VXTI 1TWMA 1W3FA 4I3NA 8I1BA 1PZZA 2YUGA 3R4SA 4CJMA 2F8XC 4JKXB 3O4CA 1M16A 4G9NA 1ABRB 4ZBVB 21BIA 4J2KA 2Q3NB 4I1BA 3FJCA 2D7RA 3Q7XA 2DRZA 1G9BA 3AKIA 4XFTA 4Q9GA 4XFSA 1FGAA 2VXRA 3ZC8A 2KI6B 3VSFA 2P39A 4GOYA 1Q04A 3AJ6A 3BAHA 4JQ0A 4ZLBB 2ESUA 2XOAA 3HN1A 3PG0A 1TP0A 3Q7YA 3LTQA 2D20A 1G9AA 4L4IA 1YTOA 5F90A 4I4YA 3FJFA 1XG6A 1TTUA 3VSZA 4P0LA 4AN6A 4YOLA 2LIEA 4I4RA 2HWMA 2D7IA 1TFMB 4ISQA 3AH4A 4JPZA 3FJDA 3O49A 1Z2VA 4I4PA 1IT0A 4IHZA 1AVUA 3I2AA 4I6IA 4LO0C 3CAHA 1XYFA 1SZ6B 2F2FA 3NJ5A 3OJ2A 2AFGA 3H6QA 2M49A 3A23A 3LLPA 4G6JA 3I2XA 4OW4A 1PWAA 4G6MA 1JT7A 4QKSA 5BXPA 2BFHA 3Q7WA 5HPZA 1QQKA 3O4AA 4GOVA 4USPA 9ILBA 4FGFA 3OBRA 4QD2C 3NBDA 1YXWA 3N7JA 5BXRA 2NM1A 2D44A 2D22A 4ZFUB 3IM5A 1Q1UA 3AH1A 1IJTA 4LO3C 4R6UB 3FJ8A 2Y9FA 3BRGC 2ZR1B 1FWVA 2D24A 4XKIA 2E4MA 4XFUA 3S8KA 4I37A 4QC4A 1DFCA 1HCDA 2VSEA 4JKQA 2Y9XE 4QD2B 2WRYA 1JT5A 1S0FA 4LO1C 3ZXDA 1IOBA 1II4A 1EYLA 1L2HA 3CA1A 3D7WB 4JAWA 5EG6C 3QR5A 4ZFWB 2ET2A 1I1BA 2D1ZA 1PC8B 5F8WA 1V6XA 1TIEA 5DUYA
chains in the Genus database with same CATH superfamily
2RSTA 3BADA 4OEEA 1W3AA 1TWEA 2KH2A 3P6IA 3KMVA 1S0CA 5JMCA 4Z8SB 2D43A 4GP0A 1AFCA 4FVVA 3UD7A 4A7KA 3VT0A 3ZC9A 3H6RB 1R8OA 1XZZA 3FJJA 4Z9WB 3R4UA 1DZDA 3ILAA 1ISYA 4AN7B 3AKHA 1ISZA 3AKGA 3FFZA 3EF2A 4DEPA 3JUTA 2Y9WC 1VCLA 1S0DA 2QN4A 3CA6A 1BLDA 4PC4A 2NP0A 3S8JA 3WMUA 4P6AA 2HZ9A 3BAGA 4MZFB 5FZZA 1I1EA 4KEKA 1JQZA 3FJBA 1SR4A 4EFPA 3FJIA 41BIA 3ZX7A 1UPSA 3OBTA 4X39A 2VUAA 1BFCA 1DFQA 3VEQA 3V0BA 1HWOB 4QALA 2WBCA 5F8YA 4I4VA 4DENA 2HWAA 4D8HA 3UD8A 1Z4SA 2FGFA 5BXTA 4WBCA 3V0AB 1F31A 3N0KA 1TOOA 1JT4A 3BX1C 1AF9A 4Q9PA 2KLLA 3FUQA 2K43A 4I4QA 4IYBA 1MD6A 4KEIA 4LO2A 4QO3A 1QXMA 3BA4A 4KEJA 3I29B 2DREA 4EB2B 3BA5A 3BRDA 1ISVA 1JTCA 1S0BA 3HALA 1MC9A 4II0A 3IM7A 1HKNA 2LIQA 2P23A 1AVWB 3PUBA 3PHZA 2NVHA 1R8NA 4ZKTB 4P0JA 1EVTA 4ENDA 1ISWA 4QBCA 1BARA 6I1BA 1D0HA 4X3AA 4EKXB 3WO2A 3A22A 4IZEA 1FV2A 3WINA 1WD3A 1PUMB 1S0LA 5BQUA 1AXMA 3O5WB 5DVHA 2F2FC 4TLPA 3MALA 1DZCA 1JT3A 3C9ZA 1XHBA 4OWLA 4QBVA 1Q03A 3CA5A 4H9WA 5F8SA 4I4UA 2BEBA 3AZWA 5G00A 3BAQA 1WD4A 3RMYA 2DS0A 1V6VA 3FJEA 3AKFA 4A7ZA 3IM6A 3BAOA 4EEEB 4KBBA 5D61A 1V6UA 2R9KB 1JLXA 4H75A 1E0OA 4OUJA 4P0KA 4H04A 4I8MA 3CU1B 4IQPA 31BIA 1YF8B 3BB2A 5D62A 2NTDA 2RG9B 3CRGA 3BAUA 3P53A 1BA7A 4I4OA 1G82A 4I4SA 1T9FA 1V6WA 2KI4A 7I1BA 4G1RA 5D63A 4IY9A 4KC3A 5B2HA 3P6JA 1ITBA 3BTAA 4LO8B 2NYYA 4J2XA 4G9MA 4LO1A 4D0ZA 1DIWA 4I2SA 4LO7C 3CRHA 1HIBA 1YYNA 2FFVA 1CVSA 1JY0A 1T4QA 4IZXA 2AAIB 2Z48A 1G9CA 4ZGRB 1Z0HA 1IILA 2GO2A 4ISRA 4HA2A 1BASA 3B9UA 3BA7A 2QYIB 4LO7B 5BP5A 3BAVA 3H6SE 4OEGA 3RSJA 5BXSA 5E24E 2MLLB 3UJ4A 3W9TA 3F62B 3RMXA 5FNWA 4J23B 2ZQOA 2K4AB 4F83A 3FJKA 3HSMA 3OGGA 4Q91A 3WMVA 1DJSB 2FDBM 1EPWA 1SR4C 1WBAA 1HCEA 2AXMA 2D23A 2IWTB 3FUOA 3T8SA 1HWPB 3OJVA 3FGMA 5DSSB 2VSAA 3HOMA 3QYDA 1DQGA 3IIRA 2I1BA 1BFFA 1A8DA 2L5XA 1K5VA 2AQZA 1JLYA 3A21A 3O4BA 3E8LC 3O44A 1AVAC 2RQ9A 3JRRA 1W3GA 3WA1A 1CE7B 3CQAA 2FFUA 5FZYA 1AVXB 4LO2C 5FZUA 3AJ5A 3TC2A 2ZQNA 2VLCA 2J3PA 3V0BB 4OWKA 5I1BA 5EHAA 3O4OA 3AH2A 1GGPB 4X37A 4JP0A 3N7KA 1FWUA 1NUNA 2VU9A 1P63A 4ZA3B 3VUOA 3F1RA 4J2YA 1EV2A 4GP3A 1J0SA 1BLAA 1ILR1 3RTIB 1DQOA 4LO0A 4USOA 1RG8A 3A07A 4GAIA 4OEFA 3CA4A 3HBWA 3NBNA 3POKA 1NZKA 4I0YA 4OWJA 3WINC 5BQUC 1IRAX 2MIBA 5EC5A 1FV3A 1RMLA 3CA0A 3CA3A 5GAQA 3VT1A 3UJ0A 5JLVA 3WO4A 5DZUA 1ISXA 4L4HA 3PMEA 3CRIA 1BFGA 1HWMB 2GZBA 4F34A 1G9DA 4GAFA 4LO3A 1ONKB 3K1XA 3UD9A 4J2SA 1IRPA 4EFRA 4MZHA 3OJMA 3ZXGA 4ZOTA 2E4MC 4QKRA 1FN0A 3N7LA 3NBCA 3FJAA 3HMYA 4JRAA 2UUSA 4I7IA 4D0TA 2FO1A 3H6RA 2X2TA 4EFQA 1FQ9A 1RY7A 4HR6C 2BEAA 3SNVA 5BVPI 3V79C 1N4KA 2IHOA 1PUUB 4X38A 4IY8A 4I1EA 1FMZA 3WO3A 1FMMS 1BFBA 4A7YA 2Y9GA 1S0GA 2X2SA 4DCKC 4UY4A 1KNMA 3OGFA 3FJ9A 3AZVA 3VT2A 2Z49A 4IONA 2HW9A 3O4DA 3BRFA 3VWCA 1HWNB 3IAGC 1DLLA 1M2TB 1RZOB 2KKIA 3N7MA 1OQLB 2MC2A 4HJJA 2K8RA 5BOWA 1YBIA 1QQLA 5BP5C 2Q9XA 1K5UA 1WBCA 2DRYA 3NBEA 3V0AA 2NZ9A 3FJHA 3MPPG 2ERMA 1S0EA 4I4XA 1IHKA 4I96A 3RTJB 4ZFYB 3UDAA 5FNXA 3O3QA 2VXTI 1TWMA 1W3FA 4I3NA 8I1BA 1PZZA 2YUGA 3R4SA 4CJMA 2F8XC 4JKXB 3O4CA 1M16A 4G9NA 1ABRB 4ZBVB 21BIA 4J2KA 2Q3NB 4I1BA 3FJCA 2D7RA 3Q7XA 2DRZA 1G9BA 3AKIA 4XFTA 4Q9GA 4XFSA 1FGAA 2VXRA 3ZC8A 2KI6B 3VSFA 2P39A 4GOYA 1Q04A 3AJ6A 3BAHA 4JQ0A 4ZLBB 2ESUA 2XOAA 3HN1A 3PG0A 1TP0A 4MZGB 3Q7YA 3LTQA 2D20A 1G9AA 4L4IA 1YTOA 5F90A 4I4YA 3FJFA 1XG6A 1TTUA 3VSZA 4P0LA 4AN6A 4YOLA 2LIEA 4I4RA 2HWMA 2D7IA 1TFMB 4ISQA 3AH4A 4JPZA 3FJDA 3O49A 1Z2VA 4I4PA 1IT0A 4IHZA 1AVUA 3I2AA 4I6IA 4LO0C 3CAHA 1XYFA 1SZ6B 2F2FA 3NJ5A 3OJ2A 2AFGA 3H6QA 2M49A 3A23A 3LLPA 4G6JA 3I2XA 4OW4A 1PWAA 4G6MA 1JT7A 4QKSA 5BXPA 2BFHA 3Q7WA 5HPZA 1QQKA 3O4AA 4GOVA 4USPA 9ILBA 4FGFA 3OBRA 4QD2C 3NBDA 1YXWA 3N7JA 5BXRA 2NM1A 2D44A 2D22A 4ZFUB 3IM5A 1Q1UA 3AH1A 1IJTA 4LO3C 4R6UB 3FJ8A 2Y9FA 3BRGC 2ZR1B 1FWVA 2D24A 4XKIA 2E4MA 4XFUA 3S8KA 4I37A 4QC4A 1DFCA 1HCDA 2VSEA 4JKQA 2Y9XE 4QD2B 2WRYA 1JT5A 1S0FA 4LO1C 3ZXDA 1IOBA 1II4A 1EYLA 1L2HA 3CA1A 3D7WB 4JAWA 5EG6C 2NS2A 3QR5A 4ZFWB 2ET2A 1I1BA 2D1ZA 1PC8B 5F8WA 1V6XA 1TIEA 5DUYA
chains in the Genus database with same CATH topology
2RSTA 3BADA 4OEEA 1W3AA 1TWEA 2KH2A 3P6IA 3KMVA 1S0CA 5JMCA 4Z8SB 2D43A 4GP0A 1AFCA 4FVVA 3UD7A 4A7KA 3VT0A 3ZC9A 3H6RB 1R8OA 1XZZA 3FJJA 4Z9WB 3R4UA 1DZDA 3ILAA 1ISYA 4AN7B 3AKHA 1ISZA 3AKGA 3FFZA 3EF2A 4DEPA 3JUTA 2Y9WC 1VCLA 1S0DA 2QN4A 3CA6A 1BLDA 4PC4A 2NP0A 3S8JA 3WMUA 4P6AA 2HZ9A 3BAGA 4MZFB 5FZZA 1I1EA 4KEKA 1JQZA 3FJBA 1SR4A 4EFPA 3FJIA 41BIA 3ZX7A 1UPSA 3OBTA 4X39A 2VUAA 1BFCA 1DFQA 3VEQA 3V0BA 1HWOB 4QALA 2WBCA 5F8YA 4I4VA 4DENA 2HWAA 4D8HA 3UD8A 1Z4SA 2FGFA 5BXTA 4WBCA 3V0AB 1F31A 3N0KA 1TOOA 1JT4A 3BX1C 1AF9A 4Q9PA 2KLLA 3FUQA 2K43A 4I4QA 4IYBA 1MD6A 4KEIA 4LO2A 4QO3A 1QXMA 3BA4A 4KEJA 3I29B 2DREA 4EB2B 3BA5A 3BRDA 1ISVA 1JTCA 1S0BA 3HALA 1MC9A 4II0A 3IM7A 1HKNA 2LIQA 2P23A 1AVWB 3PUBA 3PHZA 2NVHA 1R8NA 4ZKTB 4P0JA 1EVTA 4ENDA 1ISWA 4QBCA 1BARA 6I1BA 1D0HA 4X3AA 4EKXB 3WO2A 3A22A 4IZEA 1FV2A 3WINA 1WD3A 1PUMB 1S0LA 5BQUA 1AXMA 3O5WB 5DVHA 2F2FC 4TLPA 3MALA 1DZCA 1JT3A 3C9ZA 1XHBA 4OWLA 4QBVA 1Q03A 3CA5A 4H9WA 5F8SA 4I4UA 2BEBA 3AZWA 5G00A 3BAQA 1WD4A 3RMYA 2DS0A 1V6VA 3FJEA 3AKFA 4A7ZA 3IM6A 3BAOA 4EEEB 4KBBA 5D61A 1V6UA 2R9KB 1JLXA 4H75A 1E0OA 4OUJA 4P0KA 4H04A 4I8MA 3CU1B 4IQPA 31BIA 1YF8B 3BB2A 5D62A 2NTDA 2RG9B 3CRGA 3BAUA 3P53A 1BA7A 4I4OA 1G82A 4I4SA 1T9FA 1V6WA 2KI4A 7I1BA 4G1RA 5D63A 4IY9A 4KC3A 5B2HA 3P6JA 1ITBA 3BTAA 4LO8B 2NYYA 4J2XA 4G9MA 4LO1A 4D0ZA 1DIWA 4I2SA 4LO7C 3CRHA 1HIBA 1YYNA 2FFVA 1CVSA 1JY0A 1T4QA 4IZXA 2AAIB 2Z48A 1G9CA 4ZGRB 1Z0HA 1IILA 2GO2A 4ISRA 4HA2A 1BASA 3B9UA 3BA7A 2QYIB 4LO7B 5BP5A 3BAVA 3H6SE 4OEGA 3RSJA 5BXSA 5E24E 2MLLB 3UJ4A 3W9TA 3F62B 3RMXA 5FNWA 4J23B 2ZQOA 2K4AB 4F83A 3FJKA 3HSMA 3OGGA 4Q91A 3WMVA 1DJSB 2FDBM 1EPWA 1SR4C 1WBAA 1HCEA 2AXMA 2D23A 2IWTB 3FUOA 3T8SA 1HWPB 3OJVA 3FGMA 5DSSB 2VSAA 3HOMA 3QYDA 1DQGA 3IIRA 2I1BA 1BFFA 1A8DA 2L5XA 1K5VA 2AQZA 1JLYA 3A21A 3O4BA 3E8LC 3O44A 1AVAC 2RQ9A 3JRRA 1W3GA 3WA1A 1CE7B 3CQAA 2FFUA 5FZYA 1AVXB 4LO2C 5FZUA 3AJ5A 3TC2A 2ZQNA 2VLCA 2J3PA 3V0BB 4OWKA 5I1BA 5EHAA 3O4OA 3AH2A 1GGPB 4X37A 4JP0A 3N7KA 1FWUA 1NUNA 2VU9A 1P63A 4ZA3B 3VUOA 3F1RA 4J2YA 1EV2A 4GP3A 1J0SA 1BLAA 1ILR1 3RTIB 1DQOA 4LO0A 4USOA 1RG8A 3A07A 4GAIA 4OEFA 3CA4A 3HBWA 3NBNA 3POKA 1NZKA 4I0YA 4OWJA 3WINC 5BQUC 1IRAX 2MIBA 5EC5A 1FV3A 1RMLA 3CA0A 3CA3A 5GAQA 3VT1A 3UJ0A 5JLVA 3WO4A 5DZUA 1ISXA 4L4HA 3PMEA 3CRIA 1BFGA 1HWMB 2GZBA 4F34A 1G9DA 4GAFA 4LO3A 1ONKB 3K1XA 3UD9A 4J2SA 1IRPA 4EFRA 4MZHA 3OJMA 3ZXGA 4ZOTA 2E4MC 4QKRA 1FN0A 3N7LA 3NBCA 3FJAA 3HMYA 4JRAA 2UUSA 4I7IA 4D0TA 2FO1A 3H6RA 2X2TA 4EFQA 1FQ9A 1RY7A 4HR6C 2BEAA 3SNVA 5BVPI 3V79C 1N4KA 2IHOA 1PUUB 4X38A 4IY8A 4I1EA 1FMZA 3WO3A 1FMMS 1BFBA 4A7YA 2Y9GA 1S0GA 2X2SA 4DCKC 4UY4A 1KNMA 3OGFA 3FJ9A 3AZVA 3VT2A 2Z49A 4IONA 2HW9A 3O4DA 3BRFA 3VWCA 1HWNB 3IAGC 1DLLA 1M2TB 1RZOB 2KKIA 3N7MA 1OQLB 2MC2A 4HJJA 2K8RA 5BOWA 1YBIA 1QQLA 5BP5C 2Q9XA 1K5UA 1WBCA 2DRYA 3NBEA 3V0AA 2NZ9A 3FJHA 3MPPG 2ERMA 1S0EA 4I4XA 1IHKA 4I96A 3RTJB 4ZFYB 3UDAA 5FNXA 3O3QA 2VXTI 1TWMA 1W3FA 4I3NA 8I1BA 1PZZA 2YUGA 3R4SA 4CJMA 2F8XC 4JKXB 3O4CA 1M16A 4G9NA 1ABRB 4ZBVB 21BIA 4J2KA 2Q3NB 4I1BA 3FJCA 2D7RA 3Q7XA 2DRZA 1G9BA 3AKIA 4XFTA 4Q9GA 4XFSA 1FGAA 2VXRA 3ZC8A 2KI6B 3VSFA 2P39A 4GOYA 1Q04A 3AJ6A 3BAHA 4JQ0A 4ZLBB 2ESUA 2XOAA 3HN1A 3PG0A 1TP0A 4MZGB 3Q7YA 3LTQA 2D20A 1G9AA 4L4IA 1YTOA 5F90A 4I4YA 3FJFA 1XG6A 1TTUA 3VSZA 4P0LA 4AN6A 4YOLA 2LIEA 4I4RA 2HWMA 2D7IA 1TFMB 4ISQA 3AH4A 4JPZA 3FJDA 3O49A 1Z2VA 4I4PA 1IT0A 4IHZA 1AVUA 3I2AA 4I6IA 4LO0C 3CAHA 1XYFA 1SZ6B 2F2FA 3NJ5A 3OJ2A 2AFGA 3H6QA 2M49A 3A23A 3LLPA 4G6JA 3I2XA 4OW4A 1PWAA 4G6MA 1JT7A 4QKSA 5BXPA 2BFHA 3Q7WA 5HPZA 1QQKA 3O4AA 4GOVA 4USPA 9ILBA 4FGFA 3OBRA 4QD2C 3NBDA 1YXWA 3N7JA 5BXRA 2NM1A 2D44A 2D22A 4ZFUB 3IM5A 1Q1UA 3AH1A 1IJTA 4LO3C 4R6UB 3FJ8A 2Y9FA 3BRGC 2ZR1B 1FWVA 2D24A 4XKIA 2E4MA 4XFUA 3S8KA 4I37A 4QC4A 1DFCA 1HCDA 2VSEA 4JKQA 2Y9XE 4QD2B 2WRYA 1JT5A 1S0FA 4LO1C 3ZXDA 1IOBA 1II4A 1EYLA 1L2HA 3CA1A 3D7WB 4JAWA 5EG6C 2NS2A 3QR5A 4ZFWB 2ET2A 1I1BA 2D1ZA 1PC8B 5F8WA 1V6XA 1TIEA 5DUYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RST A;  3BAD A;  4OEE A;  1W3A A;  1TWE A;  2KH2 A;  3P6I A;  3KMV A;  1S0C A;  5JMC A;  4Z8S B;  2D43 A;  4GP0 A;  1AFC A;  4FVV A;  3UD7 A;  4A7K A;  3VT0 A;  3ZC9 A;  3H6R B;  1R8O A;  1XZZ A;  3FJJ A;  4Z9W B;  3R4U A;  1DZD A;  3ILA A;  1ISY A;  4AN7 B;  3AKH A;  1ISZ A;  3AKG A;  3FFZ A;  3EF2 A;  4DEP A;  3JUT A;  2Y9W C;  1VCL A;  1S0D A;  2QN4 A;  3CA6 A;  1BLD A;  4PC4 A;  2NP0 A;  3S8J A;  3WMU A;  4P6A A;  2HZ9 A;  3BAG A;  5FZZ A;  1I1E A;  4KEK A;  1JQZ A;  3FJB A;  1SR4 A;  4EFP A;  3FJI A;  41BI A;  3ZX7 A;  1UPS A;  3OBT A;  4X39 A;  2VUA A;  1BFC A;  1DFQ A;  3VEQ A;  3V0B A;  1HWO B;  4QAL A;  2WBC A;  5F8Y A;  4I4V A;  4DEN A;  2HWA A;  4D8H A;  3UD8 A;  1Z4S A;  2FGF A;  5BXT A;  4WBC A;  3V0A B;  1F31 A;  3N0K A;  1TOO A;  1JT4 A;  3BX1 C;  1AF9 A;  4Q9P A;  2KLL A;  3FUQ A;  2K43 A;  4I4Q A;  4IYB A;  1MD6 A;  4KEI A;  4LO2 A;  4QO3 A;  1QXM A;  3BA4 A;  4KEJ A;  3I29 B;  2DRE A;  4EB2 B;  3BA5 A;  3BRD A;  1ISV A;  1JTC A;  1S0B A;  3HAL A;  1MC9 A;  4II0 A;  3IM7 A;  1HKN A;  2LIQ A;  2P23 A;  1AVW B;  3PUB A;  3PHZ A;  2NVH A;  1R8N A;  4ZKT B;  4P0J A;  1EVT A;  4END A;  1ISW A;  4QBC A;  1BAR A;  6I1B A;  1D0H A;  4X3A A;  4EKX B;  3WO2 A;  3A22 A;  4IZE A;  1FV2 A;  3WIN A;  1WD3 A;  1PUM B;  1S0L A;  5BQU A;  1AXM A;  3O5W B;  5DVH A;  2F2F C;  4TLP A;  3MAL A;  1DZC A;  1JT3 A;  3C9Z A;  1XHB A;  4OWL A;  4QBV A;  1Q03 A;  3CA5 A;  4H9W A;  5F8S A;  4I4U A;  2BEB A;  3AZW A;  5G00 A;  3BAQ A;  1WD4 A;  3RMY A;  2DS0 A;  1V6V A;  3FJE A;  3AKF A;  4A7Z A;  3IM6 A;  3BAO A;  4EEE B;  4KBB A;  5D61 A;  1V6U A;  2R9K B;  1JLX A;  1E0O A;  4OUJ A;  4P0K A;  4H04 A;  4I8M A;  3CU1 B;  4IQP A;  31BI A;  1YF8 B;  3BB2 A;  5D62 A;  2NTD A;  2RG9 B;  3CRG A;  3BAU A;  3P53 A;  1BA7 A;  4I4O A;  1G82 A;  4I4S A;  1T9F A;  1V6W A;  2KI4 A;  7I1B A;  4G1R A;  5D63 A;  4IY9 A;  4KC3 A;  5B2H A;  3P6J A;  1ITB A;  3BTA A;  4LO8 B;  2NYY A;  4J2X A;  4G9M A;  4LO1 A;  4D0Z A;  1DIW A;  4I2S A;  4LO7 C;  3CRH A;  1HIB A;  1YYN A;  2FFV A;  1CVS A;  1JY0 A;  1T4Q A;  4IZX A;  2AAI B;  2Z48 A;  1G9C A;  4ZGR B;  1Z0H A;  1IIL A;  2GO2 A;  4ISR A;  4HA2 A;  1BAS A;  3B9U A;  3BA7 A;  2QYI B;  4LO7 B;  5BP5 A;  3BAV A;  3H6S E;  4OEG A;  3RSJ A;  5BXS A;  5E24 E;  2MLL B;  3UJ4 A;  3W9T A;  3F62 B;  3RMX A;  5FNW A;  4J23 B;  2ZQO A;  2K4A B;  4F83 A;  3FJK A;  3HSM A;  3OGG A;  4Q91 A;  3WMV A;  1DJS B;  2FDB M;  1EPW A;  1SR4 C;  1WBA A;  1HCE A;  2AXM A;  2D23 A;  2IWT B;  3FUO A;  3T8S A;  1HWP B;  3OJV A;  3FGM A;  5DSS B;  2VSA A;  3HOM A;  3QYD A;  1DQG A;  3IIR A;  2I1B A;  1BFF A;  1A8D A;  2L5X A;  1K5V A;  2AQZ A;  1JLY A;  3A21 A;  3O4B A;  3E8L C;  3O44 A;  1AVA C;  2RQ9 A;  3JRR A;  1W3G A;  3WA1 A;  1CE7 B;  3CQA A;  2FFU A;  5FZY A;  1AVX B;  4LO2 C;  5FZU A;  3AJ5 A;  3TC2 A;  2ZQN A;  2VLC A;  2J3P A;  3V0B B;  4OWK A;  5I1B A;  5EHA A;  3O4O A;  3AH2 A;  1GGP B;  4X37 A;  4JP0 A;  3N7K A;  1FWU A;  1NUN A;  2VU9 A;  1P63 A;  4ZA3 B;  3VUO A;  3F1R A;  4J2Y A;  1EV2 A;  4GP3 A;  1J0S A;  1BLA A;  1ILR 1;  3RTI B;  1DQO A;  4LO0 A;  4USO A;  1RG8 A;  3A07 A;  4GAI A;  4OEF A;  3CA4 A;  3HBW A;  3NBN A;  3POK A;  1NZK A;  4I0Y A;  4OWJ A;  3WIN C;  5BQU C;  1IRA X;  2MIB A;  5EC5 A;  1FV3 A;  1RML A;  3CA0 A;  3CA3 A;  5GAQ A;  3VT1 A;  3UJ0 A;  5JLV A;  3WO4 A;  5DZU A;  1ISX A;  4L4H A;  3PME A;  3CRI A;  1BFG A;  1HWM B;  2GZB A;  4F34 A;  1G9D A;  4GAF A;  4LO3 A;  1ONK B;  3K1X A;  3UD9 A;  4J2S A;  1IRP A;  4EFR A;  3OJM A;  3ZXG A;  4ZOT A;  2E4M C;  4QKR A;  1FN0 A;  3N7L A;  3NBC A;  3FJA A;  3HMY A;  4JRA A;  2UUS A;  4I7I A;  4D0T A;  2FO1 A;  3H6R A;  2X2T A;  4EFQ A;  1FQ9 A;  1RY7 A;  4HR6 C;  2BEA A;  3SNV A;  5BVP I;  3V79 C;  1N4K A;  2IHO A;  1PUU B;  4X38 A;  4IY8 A;  4I1E A;  1FMZ A;  3WO3 A;  1FMM S;  1BFB A;  4A7Y A;  2Y9G A;  1S0G A;  2X2S A;  4DCK C;  1KNM A;  3OGF A;  3FJ9 A;  3AZV A;  3VT2 A;  2Z49 A;  4ION A;  2HW9 A;  3O4D A;  3BRF A;  3VWC A;  1HWN B;  3IAG C;  1DLL A;  1M2T B;  1RZO B;  2KKI A;  3N7M A;  1OQL B;  2MC2 A;  4HJJ A;  2K8R A;  5BOW A;  1YBI A;  1QQL A;  5BP5 C;  2Q9X A;  1K5U A;  1WBC A;  2DRY A;  3NBE A;  3V0A A;  2NZ9 A;  3FJH A;  3MPP G;  2ERM A;  1S0E A;  4I4X A;  1IHK A;  4I96 A;  3RTJ B;  4ZFY B;  3UDA A;  5FNX A;  3O3Q A;  2VXT I;  1TWM A;  1W3F A;  4I3N A;  8I1B A;  1PZZ A;  2YUG A;  3R4S A;  4CJM A;  2F8X C;  4JKX B;  3O4C A;  1M16 A;  4G9N A;  1ABR B;  4ZBV B;  21BI A;  4J2K A;  2Q3N B;  4I1B A;  3FJC A;  2D7R A;  3Q7X A;  2DRZ A;  1G9B A;  3AKI A;  4XFT A;  4Q9G A;  4XFS A;  1FGA A;  2VXR A;  3ZC8 A;  2KI6 B;  3VSF A;  2P39 A;  4GOY A;  1Q04 A;  3AJ6 A;  3BAH A;  4JQ0 A;  4ZLB B;  2ESU A;  2XOA A;  3HN1 A;  3PG0 A;  1TP0 A;  3Q7Y A;  3LTQ A;  2D20 A;  1G9A A;  4L4I A;  1YTO A;  5F90 A;  4I4Y A;  3FJF A;  1XG6 A;  1TTU A;  3VSZ A;  4P0L A;  4AN6 A;  4YOL A;  2LIE A;  4I4R A;  2HWM A;  2D7I A;  1TFM B;  4ISQ A;  3AH4 A;  4JPZ A;  3FJD A;  3O49 A;  1Z2V A;  4I4P A;  1IT0 A;  4IHZ A;  1AVU A;  3I2A A;  4I6I A;  4LO0 C;  3CAH A;  1XYF A;  1SZ6 B;  2F2F A;  3NJ5 A;  3OJ2 A;  2AFG A;  3H6Q A;  2M49 A;  3A23 A;  3LLP A;  4G6J A;  3I2X A;  4OW4 A;  1PWA A;  4G6M A;  1JT7 A;  4QKS A;  5BXP A;  2BFH A;  3Q7W A;  5HPZ A;  1QQK A;  3O4A A;  4GOV A;  4USP A;  9ILB A;  4FGF A;  3OBR A;  4QD2 C;  3NBD A;  1YXW A;  3N7J A;  5BXR A;  2NM1 A;  2D44 A;  2D22 A;  4ZFU B;  3IM5 A;  1Q1U A;  3AH1 A;  1IJT A;  4LO3 C;  4R6U B;  3FJ8 A;  2Y9F A;  3BRG C;  2ZR1 B;  1FWV A;  2D24 A;  4XKI A;  2E4M A;  4XFU A;  3S8K A;  4I37 A;  4QC4 A;  1DFC A;  1HCD A;  2VSE A;  4JKQ A;  2Y9X E;  4QD2 B;  2WRY A;  1JT5 A;  1S0F A;  4LO1 C;  3ZXD A;  1IOB A;  1II4 A;  1EYL A;  1L2H A;  3CA1 A;  3D7W B;  4JAW A;  5EG6 C;  3QR5 A;  4ZFW B;  2ET2 A;  1I1B A;  2D1Z A;  1PC8 B;  5F8W A;  1V6X A;  1TIE A;  5DUY A; 
#chains in the Genus database with same CATH topology
 2RST A;  3BAD A;  4OEE A;  1W3A A;  1TWE A;  2KH2 A;  3P6I A;  3KMV A;  1S0C A;  5JMC A;  4Z8S B;  2D43 A;  4GP0 A;  1AFC A;  4FVV A;  3UD7 A;  4A7K A;  3VT0 A;  3ZC9 A;  3H6R B;  1R8O A;  1XZZ A;  3FJJ A;  4Z9W B;  3R4U A;  1DZD A;  3ILA A;  1ISY A;  4AN7 B;  3AKH A;  1ISZ A;  3AKG A;  3FFZ A;  3EF2 A;  4DEP A;  3JUT A;  2Y9W C;  1VCL A;  1S0D A;  2QN4 A;  3CA6 A;  1BLD A;  4PC4 A;  2NP0 A;  3S8J A;  3WMU A;  4P6A A;  2HZ9 A;  3BAG A;  4MZF B;  5FZZ A;  1I1E A;  4KEK A;  1JQZ A;  3FJB A;  1SR4 A;  4EFP A;  3FJI A;  41BI A;  3ZX7 A;  1UPS A;  3OBT A;  4X39 A;  2VUA A;  1BFC A;  1DFQ A;  3VEQ A;  3V0B A;  1HWO B;  4QAL A;  2WBC A;  5F8Y A;  4I4V A;  4DEN A;  2HWA A;  4D8H A;  3UD8 A;  1Z4S A;  2FGF A;  5BXT A;  4WBC A;  3V0A B;  1F31 A;  3N0K A;  1TOO A;  1JT4 A;  3BX1 C;  1AF9 A;  4Q9P A;  2KLL A;  3FUQ A;  2K43 A;  4I4Q A;  4IYB A;  1MD6 A;  4KEI A;  4LO2 A;  4QO3 A;  1QXM A;  3BA4 A;  4KEJ A;  3I29 B;  2DRE A;  4EB2 B;  3BA5 A;  3BRD A;  1ISV A;  1JTC A;  1S0B A;  3HAL A;  1MC9 A;  4II0 A;  3IM7 A;  1HKN A;  2LIQ A;  2P23 A;  1AVW B;  3PUB A;  3PHZ A;  2NVH A;  1R8N A;  4ZKT B;  4P0J A;  1EVT A;  4END A;  1ISW A;  4QBC A;  1BAR A;  6I1B A;  1D0H A;  4X3A A;  4EKX B;  3WO2 A;  3A22 A;  4IZE A;  1FV2 A;  3WIN A;  1WD3 A;  1PUM B;  1S0L A;  5BQU A;  1AXM A;  3O5W B;  5DVH A;  2F2F C;  4TLP A;  3MAL A;  1DZC A;  1JT3 A;  3C9Z A;  1XHB A;  4OWL A;  4QBV A;  1Q03 A;  3CA5 A;  4H9W A;  5F8S A;  4I4U A;  2BEB A;  3AZW A;  5G00 A;  3BAQ A;  1WD4 A;  3RMY A;  2DS0 A;  1V6V A;  3FJE A;  3AKF A;  4A7Z A;  3IM6 A;  3BAO A;  4EEE B;  4KBB A;  5D61 A;  1V6U A;  2R9K B;  1JLX A;  4H75 A;  1E0O A;  4OUJ A;  4P0K A;  4H04 A;  4I8M A;  3CU1 B;  4IQP A;  31BI A;  1YF8 B;  3BB2 A;  5D62 A;  2NTD A;  2RG9 B;  3CRG A;  3BAU A;  3P53 A;  1BA7 A;  4I4O A;  1G82 A;  4I4S A;  1T9F A;  1V6W A;  2KI4 A;  7I1B A;  4G1R A;  5D63 A;  4IY9 A;  4KC3 A;  5B2H A;  3P6J A;  1ITB A;  3BTA A;  4LO8 B;  2NYY A;  4J2X A;  4G9M A;  4LO1 A;  4D0Z A;  1DIW A;  4I2S A;  4LO7 C;  3CRH A;  1HIB A;  1YYN A;  2FFV A;  1CVS A;  1JY0 A;  1T4Q A;  4IZX A;  2AAI B;  2Z48 A;  1G9C A;  4ZGR B;  1Z0H A;  1IIL A;  2GO2 A;  4ISR A;  4HA2 A;  1BAS A;  3B9U A;  3BA7 A;  2QYI B;  4LO7 B;  5BP5 A;  3BAV A;  3H6S E;  4OEG A;  3RSJ A;  5BXS A;  5E24 E;  2MLL B;  3UJ4 A;  3W9T A;  3F62 B;  3RMX A;  5FNW A;  4J23 B;  2ZQO A;  2K4A B;  4F83 A;  3FJK A;  3HSM A;  3OGG A;  4Q91 A;  3WMV A;  1DJS B;  2FDB M;  1EPW A;  1SR4 C;  1WBA A;  1HCE A;  2AXM A;  2D23 A;  2IWT B;  3FUO A;  3T8S A;  1HWP B;  3OJV A;  3FGM A;  5DSS B;  2VSA A;  3HOM A;  3QYD A;  1DQG A;  3IIR A;  2I1B A;  1BFF A;  1A8D A;  2L5X A;  1K5V A;  2AQZ A;  1JLY A;  3A21 A;  3O4B A;  3E8L C;  3O44 A;  1AVA C;  2RQ9 A;  3JRR A;  1W3G A;  3WA1 A;  1CE7 B;  3CQA A;  2FFU A;  5FZY A;  1AVX B;  4LO2 C;  5FZU A;  3AJ5 A;  3TC2 A;  2ZQN A;  2VLC A;  2J3P A;  3V0B B;  4OWK A;  5I1B A;  5EHA A;  3O4O A;  3AH2 A;  1GGP B;  4X37 A;  4JP0 A;  3N7K A;  1FWU A;  1NUN A;  2VU9 A;  1P63 A;  4ZA3 B;  3VUO A;  3F1R A;  4J2Y A;  1EV2 A;  4GP3 A;  1J0S A;  1BLA A;  1ILR 1;  3RTI B;  1DQO A;  4LO0 A;  4USO A;  1RG8 A;  3A07 A;  4GAI A;  4OEF A;  3CA4 A;  3HBW A;  3NBN A;  3POK A;  1NZK A;  4I0Y A;  4OWJ A;  3WIN C;  5BQU C;  1IRA X;  2MIB A;  5EC5 A;  1FV3 A;  1RML A;  3CA0 A;  3CA3 A;  5GAQ A;  3VT1 A;  3UJ0 A;  5JLV A;  3WO4 A;  5DZU A;  1ISX A;  4L4H A;  3PME A;  3CRI A;  1BFG A;  1HWM B;  2GZB A;  4F34 A;  1G9D A;  4GAF A;  4LO3 A;  1ONK B;  3K1X A;  3UD9 A;  4J2S A;  1IRP A;  4EFR A;  4MZH A;  3OJM A;  3ZXG A;  4ZOT A;  2E4M C;  4QKR A;  1FN0 A;  3N7L A;  3NBC A;  3FJA A;  3HMY A;  4JRA A;  2UUS A;  4I7I A;  4D0T A;  2FO1 A;  3H6R A;  2X2T A;  4EFQ A;  1FQ9 A;  1RY7 A;  4HR6 C;  2BEA A;  3SNV A;  5BVP I;  3V79 C;  1N4K A;  2IHO A;  1PUU B;  4X38 A;  4IY8 A;  4I1E A;  1FMZ A;  3WO3 A;  1FMM S;  1BFB A;  4A7Y A;  2Y9G A;  1S0G A;  2X2S A;  4DCK C;  4UY4 A;  1KNM A;  3OGF A;  3FJ9 A;  3AZV A;  3VT2 A;  2Z49 A;  4ION A;  2HW9 A;  3O4D A;  3BRF A;  3VWC A;  1HWN B;  3IAG C;  1DLL A;  1M2T B;  1RZO B;  2KKI A;  3N7M A;  1OQL B;  2MC2 A;  4HJJ A;  2K8R A;  5BOW A;  1YBI A;  1QQL A;  5BP5 C;  2Q9X A;  1K5U A;  1WBC A;  2DRY A;  3NBE A;  3V0A A;  2NZ9 A;  3FJH A;  3MPP G;  2ERM A;  1S0E A;  4I4X A;  1IHK A;  4I96 A;  3RTJ B;  4ZFY B;  3UDA A;  5FNX A;  3O3Q A;  2VXT I;  1TWM A;  1W3F A;  4I3N A;  8I1B A;  1PZZ A;  2YUG A;  3R4S A;  4CJM A;  2F8X C;  4JKX B;  3O4C A;  1M16 A;  4G9N A;  1ABR B;  4ZBV B;  21BI A;  4J2K A;  2Q3N B;  4I1B A;  3FJC A;  2D7R A;  3Q7X A;  2DRZ A;  1G9B A;  3AKI A;  4XFT A;  4Q9G A;  4XFS A;  1FGA A;  2VXR A;  3ZC8 A;  2KI6 B;  3VSF A;  2P39 A;  4GOY A;  1Q04 A;  3AJ6 A;  3BAH A;  4JQ0 A;  4ZLB B;  2ESU A;  2XOA A;  3HN1 A;  3PG0 A;  1TP0 A;  4MZG B;  3Q7Y A;  3LTQ A;  2D20 A;  1G9A A;  4L4I A;  1YTO A;  5F90 A;  4I4Y A;  3FJF A;  1XG6 A;  1TTU A;  3VSZ A;  4P0L A;  4AN6 A;  4YOL A;  2LIE A;  4I4R A;  2HWM A;  2D7I A;  1TFM B;  4ISQ A;  3AH4 A;  4JPZ A;  3FJD A;  3O49 A;  1Z2V A;  4I4P A;  1IT0 A;  4IHZ A;  1AVU A;  3I2A A;  4I6I A;  4LO0 C;  3CAH A;  1XYF A;  1SZ6 B;  2F2F A;  3NJ5 A;  3OJ2 A;  2AFG A;  3H6Q A;  2M49 A;  3A23 A;  3LLP A;  4G6J A;  3I2X A;  4OW4 A;  1PWA A;  4G6M A;  1JT7 A;  4QKS A;  5BXP A;  2BFH A;  3Q7W A;  5HPZ A;  1QQK A;  3O4A A;  4GOV A;  4USP A;  9ILB A;  4FGF A;  3OBR A;  4QD2 C;  3NBD A;  1YXW A;  3N7J A;  5BXR A;  2NM1 A;  2D44 A;  2D22 A;  4ZFU B;  3IM5 A;  1Q1U A;  3AH1 A;  1IJT A;  4LO3 C;  4R6U B;  3FJ8 A;  2Y9F A;  3BRG C;  2ZR1 B;  1FWV A;  2D24 A;  4XKI A;  2E4M A;  4XFU A;  3S8K A;  4I37 A;  4QC4 A;  1DFC A;  1HCD A;  2VSE A;  4JKQ A;  2Y9X E;  4QD2 B;  2WRY A;  1JT5 A;  1S0F A;  4LO1 C;  3ZXD A;  1IOB A;  1II4 A;  1EYL A;  1L2H A;  3CA1 A;  3D7W B;  4JAW A;  5EG6 C;  2NS2 A;  3QR5 A;  4ZFW B;  2ET2 A;  1I1B A;  2D1Z A;  1PC8 B;  5F8W A;  1V6X A;  1TIE A;  5DUY A; 
#chains in the Genus database with same CATH homology
 2RST A;  3BAD A;  4OEE A;  1W3A A;  1TWE A;  2KH2 A;  3P6I A;  3KMV A;  1S0C A;  5JMC A;  4Z8S B;  2D43 A;  4GP0 A;  1AFC A;  4FVV A;  3UD7 A;  4A7K A;  3VT0 A;  3ZC9 A;  3H6R B;  1R8O A;  1XZZ A;  3FJJ A;  4Z9W B;  3R4U A;  1DZD A;  3ILA A;  1ISY A;  4AN7 B;  3AKH A;  1ISZ A;  3AKG A;  3FFZ A;  3EF2 A;  4DEP A;  3JUT A;  2Y9W C;  1VCL A;  1S0D A;  2QN4 A;  3CA6 A;  1BLD A;  4PC4 A;  2NP0 A;  3S8J A;  3WMU A;  4P6A A;  2HZ9 A;  3BAG A;  4MZF B;  5FZZ A;  1I1E A;  4KEK A;  1JQZ A;  3FJB A;  1SR4 A;  4EFP A;  3FJI A;  41BI A;  3ZX7 A;  1UPS A;  3OBT A;  4X39 A;  2VUA A;  1BFC A;  1DFQ A;  3VEQ A;  3V0B A;  1HWO B;  4QAL A;  2WBC A;  5F8Y A;  4I4V A;  4DEN A;  2HWA A;  4D8H A;  3UD8 A;  1Z4S A;  2FGF A;  5BXT A;  4WBC A;  3V0A B;  1F31 A;  3N0K A;  1TOO A;  1JT4 A;  3BX1 C;  1AF9 A;  4Q9P A;  2KLL A;  3FUQ A;  2K43 A;  4I4Q A;  4IYB A;  1MD6 A;  4KEI A;  4LO2 A;  4QO3 A;  1QXM A;  3BA4 A;  4KEJ A;  3I29 B;  2DRE A;  4EB2 B;  3BA5 A;  3BRD A;  1ISV A;  1JTC A;  1S0B A;  3HAL A;  1MC9 A;  4II0 A;  3IM7 A;  1HKN A;  2LIQ A;  2P23 A;  1AVW B;  3PUB A;  3PHZ A;  2NVH A;  1R8N A;  4ZKT B;  4P0J A;  1EVT A;  4END A;  1ISW A;  4QBC A;  1BAR A;  6I1B A;  1D0H A;  4X3A A;  4EKX B;  3WO2 A;  3A22 A;  4IZE A;  1FV2 A;  3WIN A;  1WD3 A;  1PUM B;  1S0L A;  5BQU A;  1AXM A;  3O5W B;  5DVH A;  2F2F C;  4TLP A;  3MAL A;  1DZC A;  1JT3 A;  3C9Z A;  1XHB A;  4OWL A;  4QBV A;  1Q03 A;  3CA5 A;  4H9W A;  5F8S A;  4I4U A;  2BEB A;  3AZW A;  5G00 A;  3BAQ A;  1WD4 A;  3RMY A;  2DS0 A;  1V6V A;  3FJE A;  3AKF A;  4A7Z A;  3IM6 A;  3BAO A;  4EEE B;  4KBB A;  5D61 A;  1V6U A;  2R9K B;  1JLX A;  4H75 A;  1E0O A;  4OUJ A;  4P0K A;  4H04 A;  4I8M A;  3CU1 B;  4IQP A;  31BI A;  1YF8 B;  3BB2 A;  5D62 A;  2NTD A;  2RG9 B;  3CRG A;  3BAU A;  3P53 A;  1BA7 A;  4I4O A;  1G82 A;  4I4S A;  1T9F A;  1V6W A;  2KI4 A;  7I1B A;  4G1R A;  5D63 A;  4IY9 A;  4KC3 A;  5B2H A;  3P6J A;  1ITB A;  3BTA A;  4LO8 B;  2NYY A;  4J2X A;  4G9M A;  4LO1 A;  4D0Z A;  1DIW A;  4I2S A;  4LO7 C;  3CRH A;  1HIB A;  1YYN A;  2FFV A;  1CVS A;  1JY0 A;  1T4Q A;  4IZX A;  2AAI B;  2Z48 A;  1G9C A;  4ZGR B;  1Z0H A;  1IIL A;  2GO2 A;  4ISR A;  4HA2 A;  1BAS A;  3B9U A;  3BA7 A;  2QYI B;  4LO7 B;  5BP5 A;  3BAV A;  3H6S E;  4OEG A;  3RSJ A;  5BXS A;  5E24 E;  2MLL B;  3UJ4 A;  3W9T A;  3F62 B;  3RMX A;  5FNW A;  4J23 B;  2ZQO A;  2K4A B;  4F83 A;  3FJK A;  3HSM A;  3OGG A;  4Q91 A;  3WMV A;  1DJS B;  2FDB M;  1EPW A;  1SR4 C;  1WBA A;  1HCE A;  2AXM A;  2D23 A;  2IWT B;  3FUO A;  3T8S A;  1HWP B;  3OJV A;  3FGM A;  5DSS B;  2VSA A;  3HOM A;  3QYD A;  1DQG A;  3IIR A;  2I1B A;  1BFF A;  1A8D A;  2L5X A;  1K5V A;  2AQZ A;  1JLY A;  3A21 A;  3O4B A;  3E8L C;  3O44 A;  1AVA C;  2RQ9 A;  3JRR A;  1W3G A;  3WA1 A;  1CE7 B;  3CQA A;  2FFU A;  5FZY A;  1AVX B;  4LO2 C;  5FZU A;  3AJ5 A;  3TC2 A;  2ZQN A;  2VLC A;  2J3P A;  3V0B B;  4OWK A;  5I1B A;  5EHA A;  3O4O A;  3AH2 A;  1GGP B;  4X37 A;  4JP0 A;  3N7K A;  1FWU A;  1NUN A;  2VU9 A;  1P63 A;  4ZA3 B;  3VUO A;  3F1R A;  4J2Y A;  1EV2 A;  4GP3 A;  1J0S A;  1BLA A;  1ILR 1;  3RTI B;  1DQO A;  4LO0 A;  4USO A;  1RG8 A;  3A07 A;  4GAI A;  4OEF A;  3CA4 A;  3HBW A;  3NBN A;  3POK A;  1NZK A;  4I0Y A;  4OWJ A;  3WIN C;  5BQU C;  1IRA X;  2MIB A;  5EC5 A;  1FV3 A;  1RML A;  3CA0 A;  3CA3 A;  5GAQ A;  3VT1 A;  3UJ0 A;  5JLV A;  3WO4 A;  5DZU A;  1ISX A;  4L4H A;  3PME A;  3CRI A;  1BFG A;  1HWM B;  2GZB A;  4F34 A;  1G9D A;  4GAF A;  4LO3 A;  1ONK B;  3K1X A;  3UD9 A;  4J2S A;  1IRP A;  4EFR A;  4MZH A;  3OJM A;  3ZXG A;  4ZOT A;  2E4M C;  4QKR A;  1FN0 A;  3N7L A;  3NBC A;  3FJA A;  3HMY A;  4JRA A;  2UUS A;  4I7I A;  4D0T A;  2FO1 A;  3H6R A;  2X2T A;  4EFQ A;  1FQ9 A;  1RY7 A;  4HR6 C;  2BEA A;  3SNV A;  5BVP I;  3V79 C;  1N4K A;  2IHO A;  1PUU B;  4X38 A;  4IY8 A;  4I1E A;  1FMZ A;  3WO3 A;  1FMM S;  1BFB A;  4A7Y A;  2Y9G A;  1S0G A;  2X2S A;  4DCK C;  4UY4 A;  1KNM A;  3OGF A;  3FJ9 A;  3AZV A;  3VT2 A;  2Z49 A;  4ION A;  2HW9 A;  3O4D A;  3BRF A;  3VWC A;  1HWN B;  3IAG C;  1DLL A;  1M2T B;  1RZO B;  2KKI A;  3N7M A;  1OQL B;  2MC2 A;  4HJJ A;  2K8R A;  5BOW A;  1YBI A;  1QQL A;  5BP5 C;  2Q9X A;  1K5U A;  1WBC A;  2DRY A;  3NBE A;  3V0A A;  2NZ9 A;  3FJH A;  3MPP G;  2ERM A;  1S0E A;  4I4X A;  1IHK A;  4I96 A;  3RTJ B;  4ZFY B;  3UDA A;  5FNX A;  3O3Q A;  2VXT I;  1TWM A;  1W3F A;  4I3N A;  8I1B A;  1PZZ A;  2YUG A;  3R4S A;  4CJM A;  2F8X C;  4JKX B;  3O4C A;  1M16 A;  4G9N A;  1ABR B;  4ZBV B;  21BI A;  4J2K A;  2Q3N B;  4I1B A;  3FJC A;  2D7R A;  3Q7X A;  2DRZ A;  1G9B A;  3AKI A;  4XFT A;  4Q9G A;  4XFS A;  1FGA A;  2VXR A;  3ZC8 A;  2KI6 B;  3VSF A;  2P39 A;  4GOY A;  1Q04 A;  3AJ6 A;  3BAH A;  4JQ0 A;  4ZLB B;  2ESU A;  2XOA A;  3HN1 A;  3PG0 A;  1TP0 A;  4MZG B;  3Q7Y A;  3LTQ A;  2D20 A;  1G9A A;  4L4I A;  1YTO A;  5F90 A;  4I4Y A;  3FJF A;  1XG6 A;  1TTU A;  3VSZ A;  4P0L A;  4AN6 A;  4YOL A;  2LIE A;  4I4R A;  2HWM A;  2D7I A;  1TFM B;  4ISQ A;  3AH4 A;  4JPZ A;  3FJD A;  3O49 A;  1Z2V A;  4I4P A;  1IT0 A;  4IHZ A;  1AVU A;  3I2A A;  4I6I A;  4LO0 C;  3CAH A;  1XYF A;  1SZ6 B;  2F2F A;  3NJ5 A;  3OJ2 A;  2AFG A;  3H6Q A;  2M49 A;  3A23 A;  3LLP A;  4G6J A;  3I2X A;  4OW4 A;  1PWA A;  4G6M A;  1JT7 A;  4QKS A;  5BXP A;  2BFH A;  3Q7W A;  5HPZ A;  1QQK A;  3O4A A;  4GOV A;  4USP A;  9ILB A;  4FGF A;  3OBR A;  4QD2 C;  3NBD A;  1YXW A;  3N7J A;  5BXR A;  2NM1 A;  2D44 A;  2D22 A;  4ZFU B;  3IM5 A;  1Q1U A;  3AH1 A;  1IJT A;  4LO3 C;  4R6U B;  3FJ8 A;  2Y9F A;  3BRG C;  2ZR1 B;  1FWV A;  2D24 A;  4XKI A;  2E4M A;  4XFU A;  3S8K A;  4I37 A;  4QC4 A;  1DFC A;  1HCD A;  2VSE A;  4JKQ A;  2Y9X E;  4QD2 B;  2WRY A;  1JT5 A;  1S0F A;  4LO1 C;  3ZXD A;  1IOB A;  1II4 A;  1EYL A;  1L2H A;  3CA1 A;  3D7W B;  4JAW A;  5EG6 C;  2NS2 A;  3QR5 A;  4ZFW B;  2ET2 A;  1I1B A;  2D1Z A;  1PC8 B;  5F8W A;  1V6X A;  1TIE A;  5DUY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...