1HCDA

Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
118
structure length
118
Chain Sequence
b'MGNRAFKSHHGHFLSAEGEAVKTHHGHHDHHTHFHVENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HISACTOPHILIN
publication title Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor.
pubmed doi rcsb
source organism Dictyostelium discoideum
molecule tags Actin binding
total genus 9
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06268 Fascin Fascin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1hcdA00
4JRAA 2E4MA 3A07A 3VT0A 2VXRA 3RTJB 1BFBA 1CE7B 4JAWA 1JLYA 2D1ZA 1MC9A 3W9TA 3IM5A 2L5XA 1EPWA 1DFQA 4II0A 3VT2A 1KNMA 3AJ5A 3IM6A 3UJ0A 4I0YA 5DVHA 5BQUC 1FN0A 3POKA 1AVAC 3FJIA 4AN7B 5EG6C 2F8XC 1P63A 3P6JA 4I1EA 3WMUA 3OJVA 2RSTA 2MC2A 2XOAA 2Y9WC 3FJHA 2BFHA 2K43A 4ZGRB 4Z9WB 4ZA3B 5DUYA 3RSJA 4I7IA 1HKNA 1PZZA 3Q7XA 1M16A 3VUOA 1YXWA 5BXPA 3WINC 3BA4A 4OUJA 2MLLB 3S8JA 3A23A 4KEIA 3OJ2A 2IHOA 4OWLA 4QD2C 4I4PA 3O5WB 4Z8SB 1ITBA 1D0HA 3UD9A 1HWNB 1MD6A 4X38A 1DQGA 4P6AA 4ZFYB 3V0BB 4OEEA 3AZVA 1V6VA 2QN4A 1ISYA 4IQPA 5FZUA 1W3AA 2AFGA 3K1XA 4LO3C 5DSSB 4H04A 4X39A 2P23A 2Z49A 3AKHA 4OW4A 3BRFA 3Q7YA 3AH1A 5G00A 1IRPA 4D8HA 5FZZA 1NUNA 3CA0A 4LO7B 3NBCA 3AZWA 4I4UA 3CRIA 5BOWA 6I1BA 4GOVA 4JPZA 1ISWA 4IONA 4L4IA 4I4VA 4XFTA 3A22A 1BFCA 2Z48A 4XFSA 1S0CA 3KMVA 5BXSA 3BAHA 3A21A 1AXMA 1XHBA 4GAIA 4GP0A 1FMMS 3JUTA 1PUMB 4ISQA 4KEKA 5JLVA 1BLDA 3O3QA 1YTOA 1SR4C 3JRRA 4OEGA 3OBTA 4QBCA 1PWAA 4IZXA 3VT1A 2WRYA 1WD4A 1VCLA 1JTCA 4CJMA 4J2SA 1G9BA 3WO2A 4I4RA 4ZLBB 2NP0A 1G9CA 4G1RA 4IY8A 3O44A 2GZBA 3O4AA 3AH4A 3MALA 4JKXB 4F34A 4TLPA 2FDBM 2K8RA 3TC2A 4Q91A 2D20A 1IILA 1HWMB 3VWCA 2DRZA 2DS0A 3FJKA 5EC5A 3O4OA 3BADA 4G9NA 3LLPA 1HIBA 2AQZA 3F1RA 1Z0HA 1M2TB 1YF8B 4I8MA 4QALA 5DZUA 2NZ9A 3BRGC 3S8KA 3RMYA 4I4YA 3N7MA 5F8YA 1CVSA 1Q03A 3V0BA 4I1BA 3BX1C 4G6MA 4D0ZA 3F62B 1YBIA 4DCKC 4I96A 2NVHA 2HWMA 4KEJA 2I1BA 3QYDA 3HALA 4ISRA 1F31A 3I2XA 4LO2C 2NM1A 3OBRA 1XYFA 1FWVA 2VXTI 4ZBVB 2KI6B 3CU1B 3FJ8A 4LO0C 2VSEA 1TWEA 5HPZA 1EVTA 3CA4A 2R9KB 1EV2A 2ESUA 1RZOB 3IAGC 31BIA 1DQOA 4EEEB 3BA7A 8I1BA 1E0OA 3FJEA 3NBNA 1YYNA 3CRHA 3R4SA 1ONKB 3C9ZA 5BP5C 1TIEA 1BFFA 2ET2A 3SNVA 1HCDA 5FNWA 4I2SA 2KLLA 3N0KA 3UJ4A 3NJ5A 1DFCA 4GP3A 1IJTA 4I4XA 3VSFA 4F83A 2D24A 4YOLA 1AVWB 4GOYA 2VUAA 1BARA 2KI4A 3V79C 3PUBA 1S0LA 1FWUA 3HMYA 2P39A 4P0JA 1V6WA 1JT5A 2HZ9A 1IOBA 2X2TA 3UD8A 4P0LA 1K5VA 3OGFA 3I29B 3CQAA 1XG6A 1EYLA 4EKXB 3NBDA 4FGFA 3BTAA 3BAGA 1S0FA 2E4MC 3BAOA 1OQLB 1V6UA 4L4HA 4A7ZA 3N7JA 5BQUA 5F90A 1JLXA 4I4OA 4I4QA 3FFZA 3RTIB 1A8DA 3O4BA 4ENDA 4OWJA 4P0KA 5FZYA 3ZXGA 3N7LA 1I1EA 2F2FA 4XFUA 3CRGA 3QR5A 1II4A 4X3AA 4A7KA 1SZ6B 2FFVA 5GAQA 3AKGA 4J2YA 4LO7C 2QYIB 1G9DA 2K4AB 1PC8B 4HA2A 1S0GA 4WBCA 2D23A 4IYBA 1BLAA 3UDAA 2D43A 4OEFA 4QBVA 4QKRA 2RG9B 4JQ0A 1DZCA 3FUOA 2HW9A 4G9MA 5F8SA 1ISXA 2Q9XA 3IM7A 2FGFA 1TOOA 4ZFWB 3AH2A 2Y9GA 1AF9A 4J2XA 1WD3A 2M49A 4LO3A 3CA5A 1IRAX 4IHZA 4JP0A 2RQ9A 3BA5A 2ZR1B 1S0DA 3D7WB 3Q7WA 2LIQA 4XKIA 3WMVA 3IIRA 3P53A 3ZXDA 1K5UA 2X2SA 3O49A 1FV3A 3PMEA 1Z2VA 4FVVA 1IHKA 2YUGA 2VU9A 3E8LC 1W3GA 1XZZA 3V0AA 1Q1UA 3FJFA 2FO1A 2D44A 2DREA 4USPA 4LO1A 1S0BA 1RY7A 5BXRA 2D22A 2KH2A 3UD7A 2VLCA 2NYYA 4EFQA 1AVUA 1JY0A 1V6XA 1G9AA 1DLLA 1PUUB 5BVPI 5EHAA 3VEQA 3AKFA 1RMLA 3I2AA 4J2KA 1HWPB 1AFCA 4AN6A 2UUSA 1SR4A 1FV2A 4GAFA 4DENA 3OGGA 4QD2B 1GGPB 4QC4A 1L2HA 3CAHA 1QQLA 1QXMA 1R8NA 1R8OA 1BASA 1FQ9A 3P6IA 4QKSA 3RMXA 2VSAA 3T8SA 1JT7A 2F2FC 1Q04A 1FGAA 3AKIA 3BRDA 3HBWA 1DJSB 5B2HA 9ILBA 2D7RA 3FGMA 3HN1A 4IZEA 4OWKA 2NTDA 5D62A 3HOMA 4G6JA 4X37A 3CA1A 3ZC9A 4R6UB 3V0AB 1HCEA 1G82A 1W3FA 3FJDA 3PHZA 1DZDA 3O4DA 5D63A 4I4SA 1IT0A 3NBEA 1FMZA 3ILAA 3FJ9A 4EFRA 2Y9FA 3CA3A 2BEAA 3FJJA 3OJMA 4HJJA 4JKQA 4I37A 1ISZA 4A7YA 3AJ6A 3PG0A 3FJAA 4USOA 1JT3A 1N4KA 4IY9A 2ZQNA 3LTQA 3B9UA 1J0SA 2DRYA 1RG8A 3WO3A 5D61A 3BAQA 3H6RA 7I1BA 4Q9GA 1HWOB 4LO2A 5E24E 1T4QA 2Q3NB 2ZQOA 2GO2A 1S0EA 4LO0A 3ZX7A 1ISVA 4LO1C 2J3PA 2LIEA 4ZFUB 3WA1A 1QQKA 3VSZA 4EB2B 3WINA 1Z4SA 3N7KA 4I3NA 3O4CA 1ABRB 3FJBA 4KBBA 5BXTA 3BB2A 4Q9PA 4H9WA 4DEPA 1T9FA 1TWMA 1I1BA 2BEBA 3H6QA 3FUQA 4PC4A 1DIWA 2KKIA 3BAUA 4D0TA 2MIBA 2Y9XE 5BP5A 1BFGA 3CA6A 3WO4A 3H6SE 5FNXA 4ZOTA 21BIA 4ZKTB 5JMCA 3MPPG 3R4UA 2D7IA 4EFPA 2WBCA 4LO8B 2FFUA 1NZKA 4KC3A 2HWAA 1JQZA 1TP0A 1TFMB 4J23B 3ZC8A 3HSMA 41BIA 2IWTB 3BAVA 1BA7A 5I1BA 4HR6C 2AAIB 3H6RB 1UPSA 1TTUA 4QO3A 1WBCA 2AXMA 5F8WA 2ERMA 1ILR1 1AVXB 1WBAA 4I6IA 3FJCA 3EF2A 1JT4A
chains in the Genus database with same CATH superfamily
4JRAA 2E4MA 3A07A 3VT0A 2VXRA 3RTJB 1BFBA 1CE7B 4UY4A 4JAWA 1JLYA 2D1ZA 1MC9A 3W9TA 3IM5A 2L5XA 1EPWA 1DFQA 4II0A 3VT2A 1KNMA 3AJ5A 3IM6A 3UJ0A 4I0YA 5DVHA 5BQUC 1FN0A 3POKA 1AVAC 3FJIA 4AN7B 5EG6C 2F8XC 1P63A 3P6JA 4I1EA 3WMUA 3OJVA 2RSTA 2MC2A 2XOAA 2Y9WC 3FJHA 2BFHA 2K43A 4ZGRB 4Z9WB 4ZA3B 5DUYA 3RSJA 4I7IA 1HKNA 1PZZA 3Q7XA 1M16A 3VUOA 1YXWA 5BXPA 4MZHA 3WINC 3BA4A 4OUJA 2MLLB 3S8JA 3A23A 4KEIA 3OJ2A 2IHOA 4OWLA 4QD2C 4I4PA 3O5WB 4Z8SB 1ITBA 1D0HA 3UD9A 1HWNB 1MD6A 4X38A 1DQGA 4P6AA 4ZFYB 3V0BB 4OEEA 3AZVA 1V6VA 2QN4A 1ISYA 4IQPA 5FZUA 1W3AA 2AFGA 3K1XA 4LO3C 5DSSB 4H04A 4X39A 2P23A 2Z49A 3AKHA 4OW4A 3BRFA 3Q7YA 4MZGB 3AH1A 5G00A 1IRPA 4D8HA 2NS2A 5FZZA 1NUNA 3CA0A 4LO7B 3NBCA 3AZWA 4I4UA 3CRIA 5BOWA 6I1BA 4GOVA 4JPZA 1ISWA 4IONA 4L4IA 4I4VA 4XFTA 3A22A 1BFCA 2Z48A 4XFSA 1S0CA 3KMVA 5BXSA 3BAHA 3A21A 1AXMA 1XHBA 4GAIA 4GP0A 1FMMS 3JUTA 1PUMB 4ISQA 4KEKA 5JLVA 1BLDA 3O3QA 1YTOA 1SR4C 3JRRA 4OEGA 3OBTA 4QBCA 1PWAA 4IZXA 3VT1A 2WRYA 1WD4A 1VCLA 1JTCA 4CJMA 4J2SA 1G9BA 3WO2A 4I4RA 4ZLBB 2NP0A 1G9CA 4G1RA 4IY8A 3O44A 2GZBA 3O4AA 3AH4A 3MALA 4JKXB 4F34A 4TLPA 2FDBM 2K8RA 3TC2A 4Q91A 2D20A 1IILA 1HWMB 3VWCA 2DRZA 2DS0A 3FJKA 5EC5A 3O4OA 3BADA 4G9NA 3LLPA 1HIBA 2AQZA 3F1RA 1Z0HA 1M2TB 1YF8B 4I8MA 4QALA 5DZUA 2NZ9A 3BRGC 3S8KA 3RMYA 4I4YA 3N7MA 5F8YA 1CVSA 1Q03A 3V0BA 4I1BA 3BX1C 4G6MA 4D0ZA 3F62B 1YBIA 4DCKC 4I96A 2NVHA 2HWMA 4KEJA 2I1BA 3QYDA 3HALA 4ISRA 1F31A 3I2XA 4LO2C 2NM1A 3OBRA 1XYFA 1FWVA 2VXTI 4ZBVB 2KI6B 3CU1B 3FJ8A 4LO0C 2VSEA 1TWEA 5HPZA 1EVTA 3CA4A 2R9KB 1EV2A 2ESUA 1RZOB 3IAGC 31BIA 1DQOA 4EEEB 3BA7A 8I1BA 1E0OA 3FJEA 3NBNA 1YYNA 3CRHA 3R4SA 1ONKB 3C9ZA 5BP5C 1TIEA 1BFFA 2ET2A 3SNVA 1HCDA 5FNWA 4I2SA 2KLLA 3N0KA 3UJ4A 3NJ5A 1DFCA 4GP3A 1IJTA 4I4XA 3VSFA 4F83A 2D24A 4YOLA 1AVWB 4GOYA 2VUAA 1BARA 2KI4A 3V79C 3PUBA 1S0LA 1FWUA 3HMYA 2P39A 4P0JA 1V6WA 1JT5A 2HZ9A 1IOBA 2X2TA 3UD8A 4P0LA 1K5VA 3OGFA 3I29B 3CQAA 1XG6A 1EYLA 4EKXB 3NBDA 4FGFA 3BTAA 3BAGA 1S0FA 2E4MC 4H75A 3BAOA 1OQLB 1V6UA 4L4HA 4A7ZA 3N7JA 5BQUA 5F90A 1JLXA 4I4OA 4I4QA 3FFZA 3RTIB 1A8DA 3O4BA 4ENDA 4OWJA 4P0KA 5FZYA 3ZXGA 3N7LA 1I1EA 2F2FA 4XFUA 3CRGA 3QR5A 1II4A 4X3AA 4A7KA 1SZ6B 2FFVA 5GAQA 3AKGA 4J2YA 4LO7C 2QYIB 1G9DA 2K4AB 1PC8B 4HA2A 1S0GA 4WBCA 2D23A 4IYBA 1BLAA 3UDAA 2D43A 4OEFA 4QBVA 4QKRA 2RG9B 4JQ0A 1DZCA 3FUOA 2HW9A 4G9MA 5F8SA 1ISXA 4MZFB 2Q9XA 3IM7A 2FGFA 1TOOA 4ZFWB 3AH2A 2Y9GA 1AF9A 4J2XA 1WD3A 2M49A 4LO3A 3CA5A 1IRAX 4IHZA 4JP0A 2RQ9A 3BA5A 2ZR1B 1S0DA 3D7WB 3Q7WA 2LIQA 4XKIA 3WMVA 3IIRA 3P53A 3ZXDA 1K5UA 2X2SA 3O49A 1FV3A 3PMEA 1Z2VA 4FVVA 1IHKA 2YUGA 2VU9A 3E8LC 1W3GA 1XZZA 3V0AA 1Q1UA 3FJFA 2FO1A 2D44A 2DREA 4USPA 4LO1A 1S0BA 1RY7A 5BXRA 2D22A 2KH2A 3UD7A 2VLCA 2NYYA 4EFQA 1AVUA 1JY0A 1V6XA 1G9AA 1DLLA 1PUUB 5BVPI 5EHAA 3VEQA 3AKFA 1RMLA 3I2AA 4J2KA 1HWPB 1AFCA 4AN6A 2UUSA 1SR4A 1FV2A 4GAFA 4DENA 3OGGA 4QD2B 1GGPB 4QC4A 1L2HA 3CAHA 1QQLA 1QXMA 1R8NA 1R8OA 1BASA 1FQ9A 3P6IA 4QKSA 3RMXA 2VSAA 3T8SA 1JT7A 2F2FC 1Q04A 1FGAA 3AKIA 3BRDA 3HBWA 1DJSB 5B2HA 9ILBA 2D7RA 3FGMA 3HN1A 4IZEA 4OWKA 2NTDA 5D62A 3HOMA 4G6JA 4X37A 3CA1A 3ZC9A 4R6UB 3V0AB 1HCEA 1G82A 1W3FA 3FJDA 3PHZA 1DZDA 3O4DA 5D63A 4I4SA 1IT0A 3NBEA 1FMZA 3ILAA 3FJ9A 4EFRA 2Y9FA 3CA3A 2BEAA 3FJJA 3OJMA 4HJJA 4JKQA 4I37A 1ISZA 4A7YA 3AJ6A 3PG0A 3FJAA 4USOA 1JT3A 1N4KA 4IY9A 2ZQNA 3LTQA 3B9UA 1J0SA 2DRYA 1RG8A 3WO3A 5D61A 3BAQA 3H6RA 7I1BA 4Q9GA 1HWOB 4LO2A 5E24E 1T4QA 2Q3NB 2ZQOA 2GO2A 1S0EA 4LO0A 3ZX7A 1ISVA 4LO1C 2J3PA 2LIEA 4ZFUB 3WA1A 1QQKA 3VSZA 4EB2B 3WINA 1Z4SA 3N7KA 4I3NA 3O4CA 1ABRB 3FJBA 4KBBA 5BXTA 3BB2A 4Q9PA 4H9WA 4DEPA 1T9FA 1TWMA 1I1BA 2BEBA 3H6QA 3FUQA 4PC4A 1DIWA 2KKIA 3BAUA 4D0TA 2MIBA 2Y9XE 5BP5A 1BFGA 3CA6A 3WO4A 3H6SE 5FNXA 4ZOTA 21BIA 4ZKTB 5JMCA 3MPPG 3R4UA 2D7IA 4EFPA 2WBCA 4LO8B 2FFUA 1NZKA 4KC3A 2HWAA 1JQZA 1TP0A 1TFMB 4J23B 3ZC8A 3HSMA 41BIA 2IWTB 3BAVA 1BA7A 5I1BA 4HR6C 2AAIB 3H6RB 1UPSA 1TTUA 4QO3A 1WBCA 2AXMA 5F8WA 2ERMA 1ILR1 1AVXB 1WBAA 4I6IA 3FJCA 3EF2A 1JT4A
chains in the Genus database with same CATH topology
4JRAA 2E4MA 3A07A 3VT0A 2VXRA 3RTJB 1BFBA 1CE7B 4UY4A 4JAWA 1JLYA 2D1ZA 1MC9A 3W9TA 3IM5A 2L5XA 1EPWA 1DFQA 4II0A 3VT2A 1KNMA 3AJ5A 3IM6A 3UJ0A 4I0YA 5DVHA 5BQUC 1FN0A 3POKA 1AVAC 3FJIA 4AN7B 5EG6C 2F8XC 1P63A 3P6JA 4I1EA 3WMUA 3OJVA 2RSTA 2MC2A 2XOAA 2Y9WC 3FJHA 2BFHA 2K43A 4ZGRB 4Z9WB 4ZA3B 5DUYA 3RSJA 4I7IA 1HKNA 1PZZA 3Q7XA 1M16A 3VUOA 1YXWA 5BXPA 4MZHA 3WINC 3BA4A 4OUJA 2MLLB 3S8JA 3A23A 4KEIA 3OJ2A 2IHOA 4OWLA 4QD2C 4I4PA 3O5WB 4Z8SB 1ITBA 1D0HA 3UD9A 1HWNB 1MD6A 4X38A 1DQGA 4P6AA 4ZFYB 3V0BB 4OEEA 3AZVA 1V6VA 2QN4A 1ISYA 4IQPA 5FZUA 1W3AA 2AFGA 3K1XA 4LO3C 5DSSB 4H04A 4X39A 2P23A 2Z49A 3AKHA 4OW4A 3BRFA 3Q7YA 4MZGB 3AH1A 5G00A 1IRPA 4D8HA 2NS2A 5FZZA 1NUNA 3CA0A 4LO7B 3NBCA 3AZWA 4I4UA 3CRIA 5BOWA 6I1BA 4GOVA 4JPZA 1ISWA 4IONA 4L4IA 4I4VA 4XFTA 3A22A 1BFCA 2Z48A 4XFSA 1S0CA 3KMVA 5BXSA 3BAHA 3A21A 1AXMA 1XHBA 4GAIA 4GP0A 1FMMS 3JUTA 1PUMB 4ISQA 4KEKA 5JLVA 1BLDA 3O3QA 1YTOA 1SR4C 3JRRA 4OEGA 3OBTA 4QBCA 1PWAA 4IZXA 3VT1A 2WRYA 1WD4A 1VCLA 1JTCA 4CJMA 4J2SA 1G9BA 3WO2A 4I4RA 4ZLBB 2NP0A 1G9CA 4G1RA 4IY8A 3O44A 2GZBA 3O4AA 3AH4A 3MALA 4JKXB 4F34A 4TLPA 2FDBM 2K8RA 3TC2A 4Q91A 2D20A 1IILA 1HWMB 3VWCA 2DRZA 2DS0A 3FJKA 5EC5A 3O4OA 3BADA 4G9NA 3LLPA 1HIBA 2AQZA 3F1RA 1Z0HA 1M2TB 1YF8B 4I8MA 4QALA 5DZUA 2NZ9A 3BRGC 3S8KA 3RMYA 4I4YA 3N7MA 5F8YA 1CVSA 1Q03A 3V0BA 4I1BA 3BX1C 4G6MA 4D0ZA 3F62B 1YBIA 4DCKC 4I96A 2NVHA 2HWMA 4KEJA 2I1BA 3QYDA 3HALA 4ISRA 1F31A 3I2XA 4LO2C 2NM1A 3OBRA 1XYFA 1FWVA 2VXTI 4ZBVB 2KI6B 3CU1B 3FJ8A 4LO0C 2VSEA 1TWEA 5HPZA 1EVTA 3CA4A 2R9KB 1EV2A 2ESUA 1RZOB 3IAGC 31BIA 1DQOA 4EEEB 3BA7A 8I1BA 1E0OA 3FJEA 3NBNA 1YYNA 3CRHA 3R4SA 1ONKB 3C9ZA 5BP5C 1TIEA 1BFFA 2ET2A 3SNVA 1HCDA 5FNWA 4I2SA 2KLLA 3N0KA 3UJ4A 3NJ5A 1DFCA 4GP3A 1IJTA 4I4XA 3VSFA 4F83A 2D24A 4YOLA 1AVWB 4GOYA 2VUAA 1BARA 2KI4A 3V79C 3PUBA 1S0LA 1FWUA 3HMYA 2P39A 4P0JA 1V6WA 1JT5A 2HZ9A 1IOBA 2X2TA 3UD8A 4P0LA 1K5VA 3OGFA 3I29B 3CQAA 1XG6A 1EYLA 4EKXB 3NBDA 4FGFA 3BTAA 3BAGA 1S0FA 2E4MC 4H75A 3BAOA 1OQLB 1V6UA 4L4HA 4A7ZA 3N7JA 5BQUA 5F90A 1JLXA 4I4OA 4I4QA 3FFZA 3RTIB 1A8DA 3O4BA 4ENDA 4OWJA 4P0KA 5FZYA 3ZXGA 3N7LA 1I1EA 2F2FA 4XFUA 3CRGA 3QR5A 1II4A 4X3AA 4A7KA 1SZ6B 2FFVA 5GAQA 3AKGA 4J2YA 4LO7C 2QYIB 1G9DA 2K4AB 1PC8B 4HA2A 1S0GA 4WBCA 2D23A 4IYBA 1BLAA 3UDAA 2D43A 4OEFA 4QBVA 4QKRA 2RG9B 4JQ0A 1DZCA 3FUOA 2HW9A 4G9MA 5F8SA 1ISXA 4MZFB 2Q9XA 3IM7A 2FGFA 1TOOA 4ZFWB 3AH2A 2Y9GA 1AF9A 4J2XA 1WD3A 2M49A 4LO3A 3CA5A 1IRAX 4IHZA 4JP0A 2RQ9A 3BA5A 2ZR1B 1S0DA 3D7WB 3Q7WA 2LIQA 4XKIA 3WMVA 3IIRA 3P53A 3ZXDA 1K5UA 2X2SA 3O49A 1FV3A 3PMEA 1Z2VA 4FVVA 1IHKA 2YUGA 2VU9A 3E8LC 1W3GA 1XZZA 3V0AA 1Q1UA 3FJFA 2FO1A 2D44A 2DREA 4USPA 4LO1A 1S0BA 1RY7A 5BXRA 2D22A 2KH2A 3UD7A 2VLCA 2NYYA 4EFQA 1AVUA 1JY0A 1V6XA 1G9AA 1DLLA 1PUUB 5BVPI 5EHAA 3VEQA 3AKFA 1RMLA 3I2AA 4J2KA 1HWPB 1AFCA 4AN6A 2UUSA 1SR4A 1FV2A 4GAFA 4DENA 3OGGA 4QD2B 1GGPB 4QC4A 1L2HA 3CAHA 1QQLA 1QXMA 1R8NA 1R8OA 1BASA 1FQ9A 3P6IA 4QKSA 3RMXA 2VSAA 3T8SA 1JT7A 2F2FC 1Q04A 1FGAA 3AKIA 3BRDA 3HBWA 1DJSB 5B2HA 9ILBA 2D7RA 3FGMA 3HN1A 4IZEA 4OWKA 2NTDA 5D62A 3HOMA 4G6JA 4X37A 3CA1A 3ZC9A 4R6UB 3V0AB 1HCEA 1G82A 1W3FA 3FJDA 3PHZA 1DZDA 3O4DA 5D63A 4I4SA 1IT0A 3NBEA 1FMZA 3ILAA 3FJ9A 4EFRA 2Y9FA 3CA3A 2BEAA 3FJJA 3OJMA 4HJJA 4JKQA 4I37A 1ISZA 4A7YA 3AJ6A 3PG0A 3FJAA 4USOA 1JT3A 1N4KA 4IY9A 2ZQNA 3LTQA 3B9UA 1J0SA 2DRYA 1RG8A 3WO3A 5D61A 3BAQA 3H6RA 7I1BA 4Q9GA 1HWOB 4LO2A 5E24E 1T4QA 2Q3NB 2ZQOA 2GO2A 1S0EA 4LO0A 3ZX7A 1ISVA 4LO1C 2J3PA 2LIEA 4ZFUB 3WA1A 1QQKA 3VSZA 4EB2B 3WINA 1Z4SA 3N7KA 4I3NA 3O4CA 1ABRB 3FJBA 4KBBA 5BXTA 3BB2A 4Q9PA 4H9WA 4DEPA 1T9FA 1TWMA 1I1BA 2BEBA 3H6QA 3FUQA 4PC4A 1DIWA 2KKIA 3BAUA 4D0TA 2MIBA 2Y9XE 5BP5A 1BFGA 3CA6A 3WO4A 3H6SE 5FNXA 4ZOTA 21BIA 4ZKTB 5JMCA 3MPPG 3R4UA 2D7IA 4EFPA 2WBCA 4LO8B 2FFUA 1NZKA 4KC3A 2HWAA 1JQZA 1TP0A 1TFMB 4J23B 3ZC8A 3HSMA 41BIA 2IWTB 3BAVA 1BA7A 5I1BA 4HR6C 2AAIB 3H6RB 1UPSA 1TTUA 4QO3A 1WBCA 2AXMA 5F8WA 2ERMA 1ILR1 1AVXB 1WBAA 4I6IA 3FJCA 3EF2A 1JT4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRA A;  2E4M A;  3A07 A;  3VT0 A;  2VXR A;  3RTJ B;  1BFB A;  1CE7 B;  4JAW A;  1JLY A;  2D1Z A;  1MC9 A;  3W9T A;  3IM5 A;  2L5X A;  1EPW A;  1DFQ A;  4II0 A;  3VT2 A;  1KNM A;  3AJ5 A;  3IM6 A;  3UJ0 A;  4I0Y A;  5DVH A;  5BQU C;  1FN0 A;  3POK A;  1AVA C;  3FJI A;  4AN7 B;  5EG6 C;  2F8X C;  1P63 A;  3P6J A;  4I1E A;  3WMU A;  3OJV A;  2RST A;  2MC2 A;  2XOA A;  2Y9W C;  3FJH A;  2BFH A;  2K43 A;  4ZGR B;  4Z9W B;  4ZA3 B;  5DUY A;  3RSJ A;  4I7I A;  1HKN A;  1PZZ A;  3Q7X A;  1M16 A;  3VUO A;  1YXW A;  5BXP A;  3WIN C;  3BA4 A;  4OUJ A;  2MLL B;  3S8J A;  3A23 A;  4KEI A;  3OJ2 A;  2IHO A;  4OWL A;  4QD2 C;  4I4P A;  3O5W B;  4Z8S B;  1ITB A;  1D0H A;  3UD9 A;  1HWN B;  1MD6 A;  4X38 A;  1DQG A;  4P6A A;  4ZFY B;  3V0B B;  4OEE A;  3AZV A;  1V6V A;  2QN4 A;  1ISY A;  4IQP A;  5FZU A;  1W3A A;  2AFG A;  3K1X A;  4LO3 C;  5DSS B;  4H04 A;  4X39 A;  2P23 A;  2Z49 A;  3AKH A;  4OW4 A;  3BRF A;  3Q7Y A;  3AH1 A;  5G00 A;  1IRP A;  4D8H A;  5FZZ A;  1NUN A;  3CA0 A;  4LO7 B;  3NBC A;  3AZW A;  4I4U A;  3CRI A;  5BOW A;  6I1B A;  4GOV A;  4JPZ A;  1ISW A;  4ION A;  4L4I A;  4I4V A;  4XFT A;  3A22 A;  1BFC A;  2Z48 A;  4XFS A;  1S0C A;  3KMV A;  5BXS A;  3BAH A;  3A21 A;  1AXM A;  1XHB A;  4GAI A;  4GP0 A;  1FMM S;  3JUT A;  1PUM B;  4ISQ A;  4KEK A;  5JLV A;  1BLD A;  3O3Q A;  1YTO A;  1SR4 C;  3JRR A;  4OEG A;  3OBT A;  4QBC A;  1PWA A;  4IZX A;  3VT1 A;  2WRY A;  1WD4 A;  1VCL A;  1JTC A;  4CJM A;  4J2S A;  1G9B A;  3WO2 A;  4I4R A;  4ZLB B;  2NP0 A;  1G9C A;  4G1R A;  4IY8 A;  3O44 A;  2GZB A;  3O4A A;  3AH4 A;  3MAL A;  4JKX B;  4F34 A;  4TLP A;  2FDB M;  2K8R A;  3TC2 A;  4Q91 A;  2D20 A;  1IIL A;  1HWM B;  3VWC A;  2DRZ A;  2DS0 A;  3FJK A;  5EC5 A;  3O4O A;  3BAD A;  4G9N A;  3LLP A;  1HIB A;  2AQZ A;  3F1R A;  1Z0H A;  1M2T B;  1YF8 B;  4I8M A;  4QAL A;  5DZU A;  2NZ9 A;  3BRG C;  3S8K A;  3RMY A;  4I4Y A;  3N7M A;  5F8Y A;  1CVS A;  1Q03 A;  3V0B A;  4I1B A;  3BX1 C;  4G6M A;  4D0Z A;  3F62 B;  1YBI A;  4DCK C;  4I96 A;  2NVH A;  2HWM A;  4KEJ A;  2I1B A;  3QYD A;  3HAL A;  4ISR A;  1F31 A;  3I2X A;  4LO2 C;  2NM1 A;  3OBR A;  1XYF A;  1FWV A;  2VXT I;  4ZBV B;  2KI6 B;  3CU1 B;  3FJ8 A;  4LO0 C;  2VSE A;  1TWE A;  5HPZ A;  1EVT A;  3CA4 A;  2R9K B;  1EV2 A;  2ESU A;  1RZO B;  3IAG C;  31BI A;  1DQO A;  4EEE B;  3BA7 A;  8I1B A;  1E0O A;  3FJE A;  3NBN A;  1YYN A;  3CRH A;  3R4S A;  1ONK B;  3C9Z A;  5BP5 C;  1TIE A;  1BFF A;  2ET2 A;  3SNV A;  1HCD A;  5FNW A;  4I2S A;  2KLL A;  3N0K A;  3UJ4 A;  3NJ5 A;  1DFC A;  4GP3 A;  1IJT A;  4I4X A;  3VSF A;  4F83 A;  2D24 A;  4YOL A;  1AVW B;  4GOY A;  2VUA A;  1BAR A;  2KI4 A;  3V79 C;  3PUB A;  1S0L A;  1FWU A;  3HMY A;  2P39 A;  4P0J A;  1V6W A;  1JT5 A;  2HZ9 A;  1IOB A;  2X2T A;  3UD8 A;  4P0L A;  1K5V A;  3OGF A;  3I29 B;  3CQA A;  1XG6 A;  1EYL A;  4EKX B;  3NBD A;  4FGF A;  3BTA A;  3BAG A;  1S0F A;  2E4M C;  3BAO A;  1OQL B;  1V6U A;  4L4H A;  4A7Z A;  3N7J A;  5BQU A;  5F90 A;  1JLX A;  4I4O A;  4I4Q A;  3FFZ A;  3RTI B;  1A8D A;  3O4B A;  4END A;  4OWJ A;  4P0K A;  5FZY A;  3ZXG A;  3N7L A;  1I1E A;  2F2F A;  4XFU A;  3CRG A;  3QR5 A;  1II4 A;  4X3A A;  4A7K A;  1SZ6 B;  2FFV A;  5GAQ A;  3AKG A;  4J2Y A;  4LO7 C;  2QYI B;  1G9D A;  2K4A B;  1PC8 B;  4HA2 A;  1S0G A;  4WBC A;  2D23 A;  4IYB A;  1BLA A;  3UDA A;  2D43 A;  4OEF A;  4QBV A;  4QKR A;  2RG9 B;  4JQ0 A;  1DZC A;  3FUO A;  2HW9 A;  4G9M A;  5F8S A;  1ISX A;  2Q9X A;  3IM7 A;  2FGF A;  1TOO A;  4ZFW B;  3AH2 A;  2Y9G A;  1AF9 A;  4J2X A;  1WD3 A;  2M49 A;  4LO3 A;  3CA5 A;  1IRA X;  4IHZ A;  4JP0 A;  2RQ9 A;  3BA5 A;  2ZR1 B;  1S0D A;  3D7W B;  3Q7W A;  2LIQ A;  4XKI A;  3WMV A;  3IIR A;  3P53 A;  3ZXD A;  1K5U A;  2X2S A;  3O49 A;  1FV3 A;  3PME A;  1Z2V A;  4FVV A;  1IHK A;  2YUG A;  2VU9 A;  3E8L C;  1W3G A;  1XZZ A;  3V0A A;  1Q1U A;  3FJF A;  2FO1 A;  2D44 A;  2DRE A;  4USP A;  4LO1 A;  1S0B A;  1RY7 A;  5BXR A;  2D22 A;  2KH2 A;  3UD7 A;  2VLC A;  2NYY A;  4EFQ A;  1AVU A;  1JY0 A;  1V6X A;  1G9A A;  1DLL A;  1PUU B;  5BVP I;  5EHA A;  3VEQ A;  3AKF A;  1RML A;  3I2A A;  4J2K A;  1HWP B;  1AFC A;  4AN6 A;  2UUS A;  1SR4 A;  1FV2 A;  4GAF A;  4DEN A;  3OGG A;  4QD2 B;  1GGP B;  4QC4 A;  1L2H A;  3CAH A;  1QQL A;  1QXM A;  1R8N A;  1R8O A;  1BAS A;  1FQ9 A;  3P6I A;  4QKS A;  3RMX A;  2VSA A;  3T8S A;  1JT7 A;  2F2F C;  1Q04 A;  1FGA A;  3AKI A;  3BRD A;  3HBW A;  1DJS B;  5B2H A;  9ILB A;  2D7R A;  3FGM A;  3HN1 A;  4IZE A;  4OWK A;  2NTD A;  5D62 A;  3HOM A;  4G6J A;  4X37 A;  3CA1 A;  3ZC9 A;  4R6U B;  3V0A B;  1HCE A;  1G82 A;  1W3F A;  3FJD A;  3PHZ A;  1DZD A;  3O4D A;  5D63 A;  4I4S A;  1IT0 A;  3NBE A;  1FMZ A;  3ILA A;  3FJ9 A;  4EFR A;  2Y9F A;  3CA3 A;  2BEA A;  3FJJ A;  3OJM A;  4HJJ A;  4JKQ A;  4I37 A;  1ISZ A;  4A7Y A;  3AJ6 A;  3PG0 A;  3FJA A;  4USO A;  1JT3 A;  1N4K A;  4IY9 A;  2ZQN A;  3LTQ A;  3B9U A;  1J0S A;  2DRY A;  1RG8 A;  3WO3 A;  5D61 A;  3BAQ A;  3H6R A;  7I1B A;  4Q9G A;  1HWO B;  4LO2 A;  5E24 E;  1T4Q A;  2Q3N B;  2ZQO A;  2GO2 A;  1S0E A;  4LO0 A;  3ZX7 A;  1ISV A;  4LO1 C;  2J3P A;  2LIE A;  4ZFU B;  3WA1 A;  1QQK A;  3VSZ A;  4EB2 B;  3WIN A;  1Z4S A;  3N7K A;  4I3N A;  3O4C A;  1ABR B;  3FJB A;  4KBB A;  5BXT A;  3BB2 A;  4Q9P A;  4H9W A;  4DEP A;  1T9F A;  1TWM A;  1I1B A;  2BEB A;  3H6Q A;  3FUQ A;  4PC4 A;  1DIW A;  2KKI A;  3BAU A;  4D0T A;  2MIB A;  2Y9X E;  5BP5 A;  1BFG A;  3CA6 A;  3WO4 A;  3H6S E;  5FNX A;  4ZOT A;  21BI A;  4ZKT B;  5JMC A;  3MPP G;  3R4U A;  2D7I A;  4EFP A;  2WBC A;  4LO8 B;  2FFU A;  1NZK A;  4KC3 A;  2HWA A;  1JQZ A;  1TP0 A;  1TFM B;  4J23 B;  3ZC8 A;  3HSM A;  41BI A;  2IWT B;  3BAV A;  1BA7 A;  5I1B A;  4HR6 C;  2AAI B;  3H6R B;  1UPS A;  1TTU A;  4QO3 A;  1WBC A;  2AXM A;  5F8W A;  2ERM A;  1ILR 1;  1AVX B;  1WBA A;  4I6I A;  3FJC A;  3EF2 A;  1JT4 A; 
#chains in the Genus database with same CATH topology
 4JRA A;  2E4M A;  3A07 A;  3VT0 A;  2VXR A;  3RTJ B;  1BFB A;  1CE7 B;  4UY4 A;  4JAW A;  1JLY A;  2D1Z A;  1MC9 A;  3W9T A;  3IM5 A;  2L5X A;  1EPW A;  1DFQ A;  4II0 A;  3VT2 A;  1KNM A;  3AJ5 A;  3IM6 A;  3UJ0 A;  4I0Y A;  5DVH A;  5BQU C;  1FN0 A;  3POK A;  1AVA C;  3FJI A;  4AN7 B;  5EG6 C;  2F8X C;  1P63 A;  3P6J A;  4I1E A;  3WMU A;  3OJV A;  2RST A;  2MC2 A;  2XOA A;  2Y9W C;  3FJH A;  2BFH A;  2K43 A;  4ZGR B;  4Z9W B;  4ZA3 B;  5DUY A;  3RSJ A;  4I7I A;  1HKN A;  1PZZ A;  3Q7X A;  1M16 A;  3VUO A;  1YXW A;  5BXP A;  4MZH A;  3WIN C;  3BA4 A;  4OUJ A;  2MLL B;  3S8J A;  3A23 A;  4KEI A;  3OJ2 A;  2IHO A;  4OWL A;  4QD2 C;  4I4P A;  3O5W B;  4Z8S B;  1ITB A;  1D0H A;  3UD9 A;  1HWN B;  1MD6 A;  4X38 A;  1DQG A;  4P6A A;  4ZFY B;  3V0B B;  4OEE A;  3AZV A;  1V6V A;  2QN4 A;  1ISY A;  4IQP A;  5FZU A;  1W3A A;  2AFG A;  3K1X A;  4LO3 C;  5DSS B;  4H04 A;  4X39 A;  2P23 A;  2Z49 A;  3AKH A;  4OW4 A;  3BRF A;  3Q7Y A;  4MZG B;  3AH1 A;  5G00 A;  1IRP A;  4D8H A;  2NS2 A;  5FZZ A;  1NUN A;  3CA0 A;  4LO7 B;  3NBC A;  3AZW A;  4I4U A;  3CRI A;  5BOW A;  6I1B A;  4GOV A;  4JPZ A;  1ISW A;  4ION A;  4L4I A;  4I4V A;  4XFT A;  3A22 A;  1BFC A;  2Z48 A;  4XFS A;  1S0C A;  3KMV A;  5BXS A;  3BAH A;  3A21 A;  1AXM A;  1XHB A;  4GAI A;  4GP0 A;  1FMM S;  3JUT A;  1PUM B;  4ISQ A;  4KEK A;  5JLV A;  1BLD A;  3O3Q A;  1YTO A;  1SR4 C;  3JRR A;  4OEG A;  3OBT A;  4QBC A;  1PWA A;  4IZX A;  3VT1 A;  2WRY A;  1WD4 A;  1VCL A;  1JTC A;  4CJM A;  4J2S A;  1G9B A;  3WO2 A;  4I4R A;  4ZLB B;  2NP0 A;  1G9C A;  4G1R A;  4IY8 A;  3O44 A;  2GZB A;  3O4A A;  3AH4 A;  3MAL A;  4JKX B;  4F34 A;  4TLP A;  2FDB M;  2K8R A;  3TC2 A;  4Q91 A;  2D20 A;  1IIL A;  1HWM B;  3VWC A;  2DRZ A;  2DS0 A;  3FJK A;  5EC5 A;  3O4O A;  3BAD A;  4G9N A;  3LLP A;  1HIB A;  2AQZ A;  3F1R A;  1Z0H A;  1M2T B;  1YF8 B;  4I8M A;  4QAL A;  5DZU A;  2NZ9 A;  3BRG C;  3S8K A;  3RMY A;  4I4Y A;  3N7M A;  5F8Y A;  1CVS A;  1Q03 A;  3V0B A;  4I1B A;  3BX1 C;  4G6M A;  4D0Z A;  3F62 B;  1YBI A;  4DCK C;  4I96 A;  2NVH A;  2HWM A;  4KEJ A;  2I1B A;  3QYD A;  3HAL A;  4ISR A;  1F31 A;  3I2X A;  4LO2 C;  2NM1 A;  3OBR A;  1XYF A;  1FWV A;  2VXT I;  4ZBV B;  2KI6 B;  3CU1 B;  3FJ8 A;  4LO0 C;  2VSE A;  1TWE A;  5HPZ A;  1EVT A;  3CA4 A;  2R9K B;  1EV2 A;  2ESU A;  1RZO B;  3IAG C;  31BI A;  1DQO A;  4EEE B;  3BA7 A;  8I1B A;  1E0O A;  3FJE A;  3NBN A;  1YYN A;  3CRH A;  3R4S A;  1ONK B;  3C9Z A;  5BP5 C;  1TIE A;  1BFF A;  2ET2 A;  3SNV A;  1HCD A;  5FNW A;  4I2S A;  2KLL A;  3N0K A;  3UJ4 A;  3NJ5 A;  1DFC A;  4GP3 A;  1IJT A;  4I4X A;  3VSF A;  4F83 A;  2D24 A;  4YOL A;  1AVW B;  4GOY A;  2VUA A;  1BAR A;  2KI4 A;  3V79 C;  3PUB A;  1S0L A;  1FWU A;  3HMY A;  2P39 A;  4P0J A;  1V6W A;  1JT5 A;  2HZ9 A;  1IOB A;  2X2T A;  3UD8 A;  4P0L A;  1K5V A;  3OGF A;  3I29 B;  3CQA A;  1XG6 A;  1EYL A;  4EKX B;  3NBD A;  4FGF A;  3BTA A;  3BAG A;  1S0F A;  2E4M C;  4H75 A;  3BAO A;  1OQL B;  1V6U A;  4L4H A;  4A7Z A;  3N7J A;  5BQU A;  5F90 A;  1JLX A;  4I4O A;  4I4Q A;  3FFZ A;  3RTI B;  1A8D A;  3O4B A;  4END A;  4OWJ A;  4P0K A;  5FZY A;  3ZXG A;  3N7L A;  1I1E A;  2F2F A;  4XFU A;  3CRG A;  3QR5 A;  1II4 A;  4X3A A;  4A7K A;  1SZ6 B;  2FFV A;  5GAQ A;  3AKG A;  4J2Y A;  4LO7 C;  2QYI B;  1G9D A;  2K4A B;  1PC8 B;  4HA2 A;  1S0G A;  4WBC A;  2D23 A;  4IYB A;  1BLA A;  3UDA A;  2D43 A;  4OEF A;  4QBV A;  4QKR A;  2RG9 B;  4JQ0 A;  1DZC A;  3FUO A;  2HW9 A;  4G9M A;  5F8S A;  1ISX A;  4MZF B;  2Q9X A;  3IM7 A;  2FGF A;  1TOO A;  4ZFW B;  3AH2 A;  2Y9G A;  1AF9 A;  4J2X A;  1WD3 A;  2M49 A;  4LO3 A;  3CA5 A;  1IRA X;  4IHZ A;  4JP0 A;  2RQ9 A;  3BA5 A;  2ZR1 B;  1S0D A;  3D7W B;  3Q7W A;  2LIQ A;  4XKI A;  3WMV A;  3IIR A;  3P53 A;  3ZXD A;  1K5U A;  2X2S A;  3O49 A;  1FV3 A;  3PME A;  1Z2V A;  4FVV A;  1IHK A;  2YUG A;  2VU9 A;  3E8L C;  1W3G A;  1XZZ A;  3V0A A;  1Q1U A;  3FJF A;  2FO1 A;  2D44 A;  2DRE A;  4USP A;  4LO1 A;  1S0B A;  1RY7 A;  5BXR A;  2D22 A;  2KH2 A;  3UD7 A;  2VLC A;  2NYY A;  4EFQ A;  1AVU A;  1JY0 A;  1V6X A;  1G9A A;  1DLL A;  1PUU B;  5BVP I;  5EHA A;  3VEQ A;  3AKF A;  1RML A;  3I2A A;  4J2K A;  1HWP B;  1AFC A;  4AN6 A;  2UUS A;  1SR4 A;  1FV2 A;  4GAF A;  4DEN A;  3OGG A;  4QD2 B;  1GGP B;  4QC4 A;  1L2H A;  3CAH A;  1QQL A;  1QXM A;  1R8N A;  1R8O A;  1BAS A;  1FQ9 A;  3P6I A;  4QKS A;  3RMX A;  2VSA A;  3T8S A;  1JT7 A;  2F2F C;  1Q04 A;  1FGA A;  3AKI A;  3BRD A;  3HBW A;  1DJS B;  5B2H A;  9ILB A;  2D7R A;  3FGM A;  3HN1 A;  4IZE A;  4OWK A;  2NTD A;  5D62 A;  3HOM A;  4G6J A;  4X37 A;  3CA1 A;  3ZC9 A;  4R6U B;  3V0A B;  1HCE A;  1G82 A;  1W3F A;  3FJD A;  3PHZ A;  1DZD A;  3O4D A;  5D63 A;  4I4S A;  1IT0 A;  3NBE A;  1FMZ A;  3ILA A;  3FJ9 A;  4EFR A;  2Y9F A;  3CA3 A;  2BEA A;  3FJJ A;  3OJM A;  4HJJ A;  4JKQ A;  4I37 A;  1ISZ A;  4A7Y A;  3AJ6 A;  3PG0 A;  3FJA A;  4USO A;  1JT3 A;  1N4K A;  4IY9 A;  2ZQN A;  3LTQ A;  3B9U A;  1J0S A;  2DRY A;  1RG8 A;  3WO3 A;  5D61 A;  3BAQ A;  3H6R A;  7I1B A;  4Q9G A;  1HWO B;  4LO2 A;  5E24 E;  1T4Q A;  2Q3N B;  2ZQO A;  2GO2 A;  1S0E A;  4LO0 A;  3ZX7 A;  1ISV A;  4LO1 C;  2J3P A;  2LIE A;  4ZFU B;  3WA1 A;  1QQK A;  3VSZ A;  4EB2 B;  3WIN A;  1Z4S A;  3N7K A;  4I3N A;  3O4C A;  1ABR B;  3FJB A;  4KBB A;  5BXT A;  3BB2 A;  4Q9P A;  4H9W A;  4DEP A;  1T9F A;  1TWM A;  1I1B A;  2BEB A;  3H6Q A;  3FUQ A;  4PC4 A;  1DIW A;  2KKI A;  3BAU A;  4D0T A;  2MIB A;  2Y9X E;  5BP5 A;  1BFG A;  3CA6 A;  3WO4 A;  3H6S E;  5FNX A;  4ZOT A;  21BI A;  4ZKT B;  5JMC A;  3MPP G;  3R4U A;  2D7I A;  4EFP A;  2WBC A;  4LO8 B;  2FFU A;  1NZK A;  4KC3 A;  2HWA A;  1JQZ A;  1TP0 A;  1TFM B;  4J23 B;  3ZC8 A;  3HSM A;  41BI A;  2IWT B;  3BAV A;  1BA7 A;  5I1B A;  4HR6 C;  2AAI B;  3H6R B;  1UPS A;  1TTU A;  4QO3 A;  1WBC A;  2AXM A;  5F8W A;  2ERM A;  1ILR 1;  1AVX B;  1WBA A;  4I6I A;  3FJC A;  3EF2 A;  1JT4 A; 
#chains in the Genus database with same CATH homology
 4JRA A;  2E4M A;  3A07 A;  3VT0 A;  2VXR A;  3RTJ B;  1BFB A;  1CE7 B;  4UY4 A;  4JAW A;  1JLY A;  2D1Z A;  1MC9 A;  3W9T A;  3IM5 A;  2L5X A;  1EPW A;  1DFQ A;  4II0 A;  3VT2 A;  1KNM A;  3AJ5 A;  3IM6 A;  3UJ0 A;  4I0Y A;  5DVH A;  5BQU C;  1FN0 A;  3POK A;  1AVA C;  3FJI A;  4AN7 B;  5EG6 C;  2F8X C;  1P63 A;  3P6J A;  4I1E A;  3WMU A;  3OJV A;  2RST A;  2MC2 A;  2XOA A;  2Y9W C;  3FJH A;  2BFH A;  2K43 A;  4ZGR B;  4Z9W B;  4ZA3 B;  5DUY A;  3RSJ A;  4I7I A;  1HKN A;  1PZZ A;  3Q7X A;  1M16 A;  3VUO A;  1YXW A;  5BXP A;  4MZH A;  3WIN C;  3BA4 A;  4OUJ A;  2MLL B;  3S8J A;  3A23 A;  4KEI A;  3OJ2 A;  2IHO A;  4OWL A;  4QD2 C;  4I4P A;  3O5W B;  4Z8S B;  1ITB A;  1D0H A;  3UD9 A;  1HWN B;  1MD6 A;  4X38 A;  1DQG A;  4P6A A;  4ZFY B;  3V0B B;  4OEE A;  3AZV A;  1V6V A;  2QN4 A;  1ISY A;  4IQP A;  5FZU A;  1W3A A;  2AFG A;  3K1X A;  4LO3 C;  5DSS B;  4H04 A;  4X39 A;  2P23 A;  2Z49 A;  3AKH A;  4OW4 A;  3BRF A;  3Q7Y A;  4MZG B;  3AH1 A;  5G00 A;  1IRP A;  4D8H A;  2NS2 A;  5FZZ A;  1NUN A;  3CA0 A;  4LO7 B;  3NBC A;  3AZW A;  4I4U A;  3CRI A;  5BOW A;  6I1B A;  4GOV A;  4JPZ A;  1ISW A;  4ION A;  4L4I A;  4I4V A;  4XFT A;  3A22 A;  1BFC A;  2Z48 A;  4XFS A;  1S0C A;  3KMV A;  5BXS A;  3BAH A;  3A21 A;  1AXM A;  1XHB A;  4GAI A;  4GP0 A;  1FMM S;  3JUT A;  1PUM B;  4ISQ A;  4KEK A;  5JLV A;  1BLD A;  3O3Q A;  1YTO A;  1SR4 C;  3JRR A;  4OEG A;  3OBT A;  4QBC A;  1PWA A;  4IZX A;  3VT1 A;  2WRY A;  1WD4 A;  1VCL A;  1JTC A;  4CJM A;  4J2S A;  1G9B A;  3WO2 A;  4I4R A;  4ZLB B;  2NP0 A;  1G9C A;  4G1R A;  4IY8 A;  3O44 A;  2GZB A;  3O4A A;  3AH4 A;  3MAL A;  4JKX B;  4F34 A;  4TLP A;  2FDB M;  2K8R A;  3TC2 A;  4Q91 A;  2D20 A;  1IIL A;  1HWM B;  3VWC A;  2DRZ A;  2DS0 A;  3FJK A;  5EC5 A;  3O4O A;  3BAD A;  4G9N A;  3LLP A;  1HIB A;  2AQZ A;  3F1R A;  1Z0H A;  1M2T B;  1YF8 B;  4I8M A;  4QAL A;  5DZU A;  2NZ9 A;  3BRG C;  3S8K A;  3RMY A;  4I4Y A;  3N7M A;  5F8Y A;  1CVS A;  1Q03 A;  3V0B A;  4I1B A;  3BX1 C;  4G6M A;  4D0Z A;  3F62 B;  1YBI A;  4DCK C;  4I96 A;  2NVH A;  2HWM A;  4KEJ A;  2I1B A;  3QYD A;  3HAL A;  4ISR A;  1F31 A;  3I2X A;  4LO2 C;  2NM1 A;  3OBR A;  1XYF A;  1FWV A;  2VXT I;  4ZBV B;  2KI6 B;  3CU1 B;  3FJ8 A;  4LO0 C;  2VSE A;  1TWE A;  5HPZ A;  1EVT A;  3CA4 A;  2R9K B;  1EV2 A;  2ESU A;  1RZO B;  3IAG C;  31BI A;  1DQO A;  4EEE B;  3BA7 A;  8I1B A;  1E0O A;  3FJE A;  3NBN A;  1YYN A;  3CRH A;  3R4S A;  1ONK B;  3C9Z A;  5BP5 C;  1TIE A;  1BFF A;  2ET2 A;  3SNV A;  1HCD A;  5FNW A;  4I2S A;  2KLL A;  3N0K A;  3UJ4 A;  3NJ5 A;  1DFC A;  4GP3 A;  1IJT A;  4I4X A;  3VSF A;  4F83 A;  2D24 A;  4YOL A;  1AVW B;  4GOY A;  2VUA A;  1BAR A;  2KI4 A;  3V79 C;  3PUB A;  1S0L A;  1FWU A;  3HMY A;  2P39 A;  4P0J A;  1V6W A;  1JT5 A;  2HZ9 A;  1IOB A;  2X2T A;  3UD8 A;  4P0L A;  1K5V A;  3OGF A;  3I29 B;  3CQA A;  1XG6 A;  1EYL A;  4EKX B;  3NBD A;  4FGF A;  3BTA A;  3BAG A;  1S0F A;  2E4M C;  4H75 A;  3BAO A;  1OQL B;  1V6U A;  4L4H A;  4A7Z A;  3N7J A;  5BQU A;  5F90 A;  1JLX A;  4I4O A;  4I4Q A;  3FFZ A;  3RTI B;  1A8D A;  3O4B A;  4END A;  4OWJ A;  4P0K A;  5FZY A;  3ZXG A;  3N7L A;  1I1E A;  2F2F A;  4XFU A;  3CRG A;  3QR5 A;  1II4 A;  4X3A A;  4A7K A;  1SZ6 B;  2FFV A;  5GAQ A;  3AKG A;  4J2Y A;  4LO7 C;  2QYI B;  1G9D A;  2K4A B;  1PC8 B;  4HA2 A;  1S0G A;  4WBC A;  2D23 A;  4IYB A;  1BLA A;  3UDA A;  2D43 A;  4OEF A;  4QBV A;  4QKR A;  2RG9 B;  4JQ0 A;  1DZC A;  3FUO A;  2HW9 A;  4G9M A;  5F8S A;  1ISX A;  4MZF B;  2Q9X A;  3IM7 A;  2FGF A;  1TOO A;  4ZFW B;  3AH2 A;  2Y9G A;  1AF9 A;  4J2X A;  1WD3 A;  2M49 A;  4LO3 A;  3CA5 A;  1IRA X;  4IHZ A;  4JP0 A;  2RQ9 A;  3BA5 A;  2ZR1 B;  1S0D A;  3D7W B;  3Q7W A;  2LIQ A;  4XKI A;  3WMV A;  3IIR A;  3P53 A;  3ZXD A;  1K5U A;  2X2S A;  3O49 A;  1FV3 A;  3PME A;  1Z2V A;  4FVV A;  1IHK A;  2YUG A;  2VU9 A;  3E8L C;  1W3G A;  1XZZ A;  3V0A A;  1Q1U A;  3FJF A;  2FO1 A;  2D44 A;  2DRE A;  4USP A;  4LO1 A;  1S0B A;  1RY7 A;  5BXR A;  2D22 A;  2KH2 A;  3UD7 A;  2VLC A;  2NYY A;  4EFQ A;  1AVU A;  1JY0 A;  1V6X A;  1G9A A;  1DLL A;  1PUU B;  5BVP I;  5EHA A;  3VEQ A;  3AKF A;  1RML A;  3I2A A;  4J2K A;  1HWP B;  1AFC A;  4AN6 A;  2UUS A;  1SR4 A;  1FV2 A;  4GAF A;  4DEN A;  3OGG A;  4QD2 B;  1GGP B;  4QC4 A;  1L2H A;  3CAH A;  1QQL A;  1QXM A;  1R8N A;  1R8O A;  1BAS A;  1FQ9 A;  3P6I A;  4QKS A;  3RMX A;  2VSA A;  3T8S A;  1JT7 A;  2F2F C;  1Q04 A;  1FGA A;  3AKI A;  3BRD A;  3HBW A;  1DJS B;  5B2H A;  9ILB A;  2D7R A;  3FGM A;  3HN1 A;  4IZE A;  4OWK A;  2NTD A;  5D62 A;  3HOM A;  4G6J A;  4X37 A;  3CA1 A;  3ZC9 A;  4R6U B;  3V0A B;  1HCE A;  1G82 A;  1W3F A;  3FJD A;  3PHZ A;  1DZD A;  3O4D A;  5D63 A;  4I4S A;  1IT0 A;  3NBE A;  1FMZ A;  3ILA A;  3FJ9 A;  4EFR A;  2Y9F A;  3CA3 A;  2BEA A;  3FJJ A;  3OJM A;  4HJJ A;  4JKQ A;  4I37 A;  1ISZ A;  4A7Y A;  3AJ6 A;  3PG0 A;  3FJA A;  4USO A;  1JT3 A;  1N4K A;  4IY9 A;  2ZQN A;  3LTQ A;  3B9U A;  1J0S A;  2DRY A;  1RG8 A;  3WO3 A;  5D61 A;  3BAQ A;  3H6R A;  7I1B A;  4Q9G A;  1HWO B;  4LO2 A;  5E24 E;  1T4Q A;  2Q3N B;  2ZQO A;  2GO2 A;  1S0E A;  4LO0 A;  3ZX7 A;  1ISV A;  4LO1 C;  2J3P A;  2LIE A;  4ZFU B;  3WA1 A;  1QQK A;  3VSZ A;  4EB2 B;  3WIN A;  1Z4S A;  3N7K A;  4I3N A;  3O4C A;  1ABR B;  3FJB A;  4KBB A;  5BXT A;  3BB2 A;  4Q9P A;  4H9W A;  4DEP A;  1T9F A;  1TWM A;  1I1B A;  2BEB A;  3H6Q A;  3FUQ A;  4PC4 A;  1DIW A;  2KKI A;  3BAU A;  4D0T A;  2MIB A;  2Y9X E;  5BP5 A;  1BFG A;  3CA6 A;  3WO4 A;  3H6S E;  5FNX A;  4ZOT A;  21BI A;  4ZKT B;  5JMC A;  3MPP G;  3R4U A;  2D7I A;  4EFP A;  2WBC A;  4LO8 B;  2FFU A;  1NZK A;  4KC3 A;  2HWA A;  1JQZ A;  1TP0 A;  1TFM B;  4J23 B;  3ZC8 A;  3HSM A;  41BI A;  2IWT B;  3BAV A;  1BA7 A;  5I1B A;  4HR6 C;  2AAI B;  3H6R B;  1UPS A;  1TTU A;  4QO3 A;  1WBC A;  2AXM A;  5F8W A;  2ERM A;  1ILR 1;  1AVX B;  1WBA A;  4I6I A;  3FJC A;  3EF2 A;  1JT4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...