1HCDA

Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
118
structure length
118
Chain Sequence
MGNRAFKSHHGHFLSAEGEAVKTHHGHHDHHTHFHVENHGGKVALKTHCGKYLSIGDHKQVYLSHHLHGDHSLFHLEHHGGKVSIKGHHHHYISADHHGHVSTKEHHDHDTTFEEIII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of hisactophilin is similar to interleukin-1 beta and fibroblast growth factor.
pubmed doi rcsb
molecule keywords HISACTOPHILIN
molecule tags Actin binding
source organism Dictyostelium discoideum
total genus 9
structure length 118
sequence length 118
ec nomenclature
pdb deposition date 1994-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06268 Fascin Fascin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1hcdA00
4D0ZA 1JTCA 1PWAA 1SR4C 4Q9GA 5BQUA 4IYBA 4H9WA 4ZFUB 2BFHA 4IZXA 2NVHA 1L2HA 1TOOA 3BTAA 5BP5A 1S0FA 3FUOA 4ISRA 3N7KA 3PHZA 1FQ9A 2NZ9A 4EKXB 1AVXB 3I29B 4XFTA 1WD3A 1V6XA 1ONKB 3CRHA 4LO0A 1Z4SA 1JQZA 4AN6A 2I1BA 2RQ9A 1QQLA 4A7ZA 2WRYA 1T9FA 4TLPA 3D7WB 4P0LA 4QKSA 3WA1A 2DS0A 5GAQA 4G9NA 3C9ZA 3O3QA 4USPA 2FO1A 2YUGA 2QN4A 1Q03A 3RMXA 3I2AA 1G9DA 1V6UA 2K4AB 4ZOTA 3HMYA 3V0AB 3ZX7A 2IHOA 2HWAA 4I4QA 2Y9XE 3A07A 2GZBA 4G6MA 4GP3A 3FFZA 3CA3A 2Y9GA 4LO0C 2K43A 4Q9PA 1BFGA 4X39A 4OEEA 1V6WA 1BFFA 3IM5A 1HCEA 2Q3NB 3AZVA 1XZZA 1SZ6B 3F1RA 2LIEA 2NM1A 5F90A 2HWMA 1XYFA 4KEJA 3AH1A 1M16A 4QBVA 1IOBA 2Z48A 3VT0A 4QO3A 1ILR1 4XFUA 4ZBVB 1BARA 1FN0A 4EB2B 5FZUA 4ZGRB 3FJHA 4J2XA 3Q7YA 1JLXA 1JT3A 1S0LA 4QALA 4Q91A 4LO7B 2BEAA 1AF9A 5D61A 1S0EA 1A8DA 1MD6A 1D0HA 4QD2C 3WMUA 1EVTA 2D7RA 1ITBA 5BXPA 1BLDA 4Z8SB 3NBNA 4A7YA 3H6RB 3CA5A 3O4CA 3HOMA 4LO3C 5HPZA 1RG8A 4IZEA 3KMVA 1S0DA 3OGGA 3RSJA 4I6IA 3JUTA 2FGFA 3IM7A 1IRAX 4I1EA 3BAGA 3N7MA 4J2KA 4QKRA 1KNMA 4USOA 1FMZA 4XKIA 5D62A 3O4AA 5DSSB 4IY8A 1F31A 1YF8B 2VUAA 3FJCA 4FGFA 1RZOB 3OGFA 4IQPA 4XFSA 3S8JA 3WINC 4JP0A 41BIA 2MIBA 2LIQA 3BB2A 3PMEA 2P39A 4HA2A 1HKNA 1EYLA 5G00A 3IM6A 1G82A 4HJJA 2D24A 4I4VA 1TTUA 1JT4A 4II0A 1AVUA 4ZKTB 1DZDA 3BAOA 3ZXDA 4D0TA 4ENDA 5I1BA 3BA5A 4JPZA 4ISQA 1GGPB 3R4SA 5DUYA 2R9KB 3V0AA 3CA4A 3A22A 2VSAA 4JQ0A 4I1BA 3H6QA 1TP0A 1UPSA 3POKA 4QBCA 4EEEB 2NP0A 4KC3A 2BEBA 1AXMA 1FMMS 3LTQA 2VXTI 4X3AA 4ZLBB 5BOWA 1AVWB 1S0GA 1DFCA 3S8KA 1I1EA 1K5VA 2UUSA 1ABRB 1AVAC 3EF2A 5BQUC 1BA7A 1IHKA 3FGMA 1S0CA 1XG6A 1FV3A 5BP5C 1WBCA 2Y9FA 5F8YA 4KBBA 1Z2VA 3FUQA 2P23A 2AQZA 5JLVA 2ET2A 2KI4A 1EV2A 2Q9XA 4EFPA 3O4DA 3HN1A 2AAIB 3BAUA 3BRGC 1G9CA 2L5XA 3Q7XA 1BLAA 2Z49A 4J23B 5FNWA 9ILBA 1W3AA 4KEKA 3VEQA 4X38A 5BXRA 1QXMA 3H6RA 3UD9A 3VWCA 2ZQNA 3O49A 4G1RA 4I3NA 4GAFA 2AFGA 4LO2A 4EFRA 1V6VA 4KEIA 2J3PA 1XHBA 3NBEA 3AKIA 4P0KA 3AJ6A 1II4A 1I1BA 1PC8B 3VT1A 3HBWA 2DRZA 3JRRA 1IRPA 2ZQOA 5EC5A 4GOYA 3V79C 4FVVA 4YOLA 1CVSA 4LO8B 2KH2A 2KLLA 3VSFA 4OWJA 1QQKA 6I1BA 4I4YA 4JAWA 1ISYA 5FZYA 3B9UA 3CAHA 1ISXA 3TC2A 3UD7A 3AKHA 3FJ8A 4F34A 1HWMB 2DRYA 4I0YA 3AJ5A 5JMCA 3BA7A 4OEGA 3W9TA 3UDAA 2ESUA 4ZA3B 2FDBM 2D7IA 4I8MA 4G9MA 1YBIA 3AH4A 4OWLA 2NTDA 5DVHA 1JT5A 3WO2A 4HR6C 4AN7B 4G6JA 3LLPA 4Z9WB 1TWEA 1G9AA 1ISVA 1HIBA 3IIRA 2D20A 3E8LC 1OQLB 3CA0A 1YYNA 3K1XA 4ZFWB 4D8HA 1FV2A 4X37A 3MPPG 4DCKC 1SR4A 2X2SA 4GP0A 3ZXGA 3A23A 3RTJB 3AZWA 3O4OA 4I4UA 3VUOA 5BVPI 3H6SE 3BAHA 2MC2A 1HWOB 1J0SA 4I4SA 5EHAA 4QC4A 2M49A 2ZR1B 2ERMA 4I96A 1DZCA 4JKXB 1JY0A 4DENA 4IHZA 3BADA 3OJMA 2DREA 2KKIA 1W3GA 3V0BB 2VXRA 4IONA 3UJ4A 2IWTB 3F62B 1T4QA 3IAGC 3FJDA 2VSEA 4ZFYB 2AXMA 3OBRA 3O44A 3PUBA 2D43A 1IILA 3N7JA 1WBAA 4OEFA 5BXTA 1W3FA 3ILAA 3FJBA 1N4KA 1CE7B 2E4MA 3N0KA 2D1ZA 1TIEA 3P6JA 4I4PA 7I1BA 3BRFA 2MLLB 4CJMA 3FJEA 1EPWA 1DFQA 3RTIB 3I2XA 3NBDA 3CRGA 4A7KA 1FGAA 3HALA 5EG6C 3FJJA 8I1BA 3FJFA 1DLLA 3VT2A 3BX1C 3FJIA 1Q1UA 3OBTA 1NZKA 4I4OA 1E0OA 3QYDA 4GOVA 3NBCA 1R8NA 3BAQA 4DEPA 1DQGA 3CU1B 1NUNA 1PUUB 5E24E 4OWKA 4PC4A 2D23A 3BRDA 1RY7A 3PG0A 4L4IA 3WO3A 1YXWA 2E4MC 4P6AA 1ISWA 3OJVA 1HCDA 1G9BA 3FJ9A 3WMVA 3UJ0A 1Z0HA 5F8WA 4R6UB 3T8SA 2HZ9A 4GAIA 1BFCA 3OJ2A 1HWNB 21BIA 4LO7C 4F83A 3Q7WA 2RSTA 3BAVA 5F8SA 3QR5A 2VU9A 5BXSA 4LO3A 1K5UA 1FWVA 1M2TB 1TFMB 2HW9A 31BIA 1DIWA 3CRIA 3CA1A 3O4BA 2D22A 1P63A 2D44A 3N7LA 3MALA 3P53A 1IJTA 4LO2C 4I4XA 2KI6B 4QD2B 3CQAA 3FJAA 3HSMA 4LO1A 1HWPB 1RMLA 1WD4A 3WINA 1Q04A 1YTOA 1DQOA 3UD8A 4I2SA 3AH2A 3RMYA 2Y9WC 1IT0A 1S0BA 2VLCA 3SNVA 3NJ5A 3ZC8A 4I7IA 1JLYA 3R4UA 3BA4A 2FFVA 4IY9A 4J2YA 4WBCA 5D63A 3V0BA 4OUJA 2F2FA 5FZZA 1BFBA 1JT7A 1MC9A 1PZZA 2QYIB 1BASA 4P0JA 3AKFA 1VCLA 4JRAA 5B2HA 4LO1C 2RG9B 4JKQA 3A21A 1ISZA 3VSZA 2WBCA 1R8OA 2FFUA 4I37A 1AFCA 3WO4A 3ZC9A 3FJKA 4L4HA 5DZUA 3O5WB 4I4RA 3CA6A 3P6IA 2X2TA 1TWMA 2K8RA 4OW4A 5FNXA 4EFQA 1PUMB 3AKGA 1FWUA 2F2FC 4H04A 4J2SA 2F8XC 2XOAA 2NYYA 1DJSB 2GO2A
chains in the Genus database with same CATH superfamily
4D0ZA 1JTCA 1PWAA 1SR4C 4Q9GA 5BQUA 4IYBA 4H9WA 4ZFUB 2BFHA 4IZXA 2NVHA 1L2HA 1TOOA 3BTAA 5BP5A 1S0FA 3FUOA 4ISRA 3N7KA 3PHZA 1FQ9A 2NZ9A 4EKXB 1AVXB 3I29B 4XFTA 1WD3A 1V6XA 1ONKB 3CRHA 4LO0A 1Z4SA 1JQZA 4AN6A 2I1BA 2RQ9A 1QQLA 4A7ZA 2WRYA 1T9FA 4TLPA 3D7WB 4P0LA 4QKSA 3WA1A 2DS0A 5GAQA 4G9NA 3C9ZA 3O3QA 4USPA 2FO1A 2YUGA 2QN4A 1Q03A 3RMXA 3I2AA 1G9DA 1V6UA 2K4AB 4ZOTA 3HMYA 3V0AB 3ZX7A 2IHOA 2HWAA 4I4QA 2Y9XE 3A07A 2GZBA 4G6MA 4GP3A 3FFZA 3CA3A 2Y9GA 4LO0C 2K43A 4Q9PA 1BFGA 4X39A 4OEEA 1V6WA 1BFFA 3IM5A 1HCEA 2Q3NB 3AZVA 1XZZA 1SZ6B 3F1RA 2LIEA 2NM1A 5F90A 2HWMA 1XYFA 4KEJA 3AH1A 1M16A 4QBVA 1IOBA 2Z48A 3VT0A 4QO3A 1ILR1 4XFUA 4ZBVB 1BARA 1FN0A 4EB2B 5FZUA 4ZGRB 3FJHA 4J2XA 3Q7YA 1JLXA 1JT3A 1S0LA 4QALA 4Q91A 4LO7B 2BEAA 1AF9A 5D61A 1S0EA 1A8DA 1MD6A 1D0HA 4QD2C 3WMUA 1EVTA 2D7RA 1ITBA 5BXPA 1BLDA 4Z8SB 3NBNA 4A7YA 3H6RB 3CA5A 3O4CA 3HOMA 4LO3C 5HPZA 1RG8A 4IZEA 3KMVA 1S0DA 3OGGA 3RSJA 4I6IA 3JUTA 2FGFA 3IM7A 1IRAX 4I1EA 3BAGA 3N7MA 4J2KA 4QKRA 1KNMA 4USOA 1FMZA 4XKIA 5D62A 3O4AA 5DSSB 4IY8A 1F31A 1YF8B 2VUAA 3FJCA 4FGFA 1RZOB 3OGFA 4IQPA 4XFSA 3S8JA 3WINC 4JP0A 41BIA 2MIBA 2LIQA 3BB2A 4H75A 3PMEA 2P39A 4HA2A 1HKNA 1EYLA 5G00A 3IM6A 1G82A 4HJJA 2D24A 4I4VA 1TTUA 1JT4A 4II0A 1AVUA 4ZKTB 1DZDA 3BAOA 3ZXDA 4D0TA 4ENDA 5I1BA 3BA5A 4JPZA 4ISQA 1GGPB 3R4SA 4MZFB 5DUYA 4MZGB 2R9KB 3V0AA 3CA4A 3A22A 2VSAA 4JQ0A 4I1BA 3H6QA 1TP0A 1UPSA 3POKA 4QBCA 4EEEB 2NP0A 4KC3A 2BEBA 1AXMA 1FMMS 3LTQA 2VXTI 4X3AA 4ZLBB 5BOWA 1AVWB 1S0GA 1DFCA 3S8KA 1I1EA 1K5VA 2UUSA 1ABRB 1AVAC 3EF2A 5BQUC 1BA7A 1IHKA 3FGMA 1S0CA 1XG6A 1FV3A 5BP5C 1WBCA 2Y9FA 5F8YA 4KBBA 1Z2VA 3FUQA 2P23A 2AQZA 5JLVA 2ET2A 2KI4A 1EV2A 2Q9XA 4EFPA 3O4DA 3HN1A 2AAIB 3BAUA 3BRGC 1G9CA 2L5XA 3Q7XA 1BLAA 2Z49A 4J23B 5FNWA 9ILBA 1W3AA 4KEKA 3VEQA 4X38A 5BXRA 1QXMA 4UY4A 3H6RA 3UD9A 3VWCA 2ZQNA 3O49A 4G1RA 4I3NA 4GAFA 2AFGA 4LO2A 4EFRA 1V6VA 4KEIA 2J3PA 1XHBA 3NBEA 3AKIA 4P0KA 3AJ6A 1II4A 1I1BA 1PC8B 3VT1A 3HBWA 2DRZA 3JRRA 1IRPA 2ZQOA 5EC5A 4GOYA 3V79C 4FVVA 4YOLA 1CVSA 4LO8B 2KH2A 2KLLA 3VSFA 4OWJA 1QQKA 6I1BA 4I4YA 4JAWA 1ISYA 5FZYA 3B9UA 3CAHA 1ISXA 3TC2A 3UD7A 3AKHA 3FJ8A 4F34A 1HWMB 2DRYA 4I0YA 3AJ5A 5JMCA 3BA7A 4OEGA 3W9TA 3UDAA 2ESUA 4ZA3B 2FDBM 2D7IA 4I8MA 4G9MA 1YBIA 3AH4A 4OWLA 2NTDA 5DVHA 1JT5A 3WO2A 4HR6C 4AN7B 4G6JA 3LLPA 4Z9WB 1TWEA 1G9AA 1ISVA 1HIBA 3IIRA 2D20A 3E8LC 1OQLB 3CA0A 1YYNA 3K1XA 4ZFWB 4D8HA 1FV2A 4X37A 3MPPG 4DCKC 1SR4A 2X2SA 4GP0A 3ZXGA 3A23A 3RTJB 3AZWA 3O4OA 4I4UA 3VUOA 5BVPI 3H6SE 3BAHA 2MC2A 1HWOB 4MZHA 1J0SA 4I4SA 5EHAA 4QC4A 2M49A 2ZR1B 2ERMA 4I96A 1DZCA 4JKXB 1JY0A 4DENA 4IHZA 3BADA 3OJMA 2DREA 2KKIA 1W3GA 3V0BB 2VXRA 4IONA 3UJ4A 2IWTB 3F62B 1T4QA 3IAGC 3FJDA 2VSEA 4ZFYB 2AXMA 3OBRA 3O44A 3PUBA 2D43A 1IILA 3N7JA 1WBAA 4OEFA 5BXTA 1W3FA 3ILAA 3FJBA 1N4KA 1CE7B 2E4MA 3N0KA 2D1ZA 1TIEA 3P6JA 4I4PA 7I1BA 3BRFA 2MLLB 4CJMA 3FJEA 1EPWA 1DFQA 3RTIB 3I2XA 3NBDA 3CRGA 4A7KA 1FGAA 3HALA 5EG6C 3FJJA 8I1BA 3FJFA 1DLLA 3VT2A 3BX1C 3FJIA 1Q1UA 3OBTA 1NZKA 4I4OA 1E0OA 3QYDA 4GOVA 3NBCA 1R8NA 3BAQA 4DEPA 1DQGA 3CU1B 1NUNA 1PUUB 5E24E 4OWKA 4PC4A 2D23A 3BRDA 1RY7A 3PG0A 4L4IA 3WO3A 1YXWA 2E4MC 4P6AA 1ISWA 3OJVA 1HCDA 1G9BA 3FJ9A 3WMVA 2NS2A 3UJ0A 1Z0HA 5F8WA 4R6UB 3T8SA 2HZ9A 4GAIA 1BFCA 3OJ2A 1HWNB 21BIA 4LO7C 4F83A 3Q7WA 2RSTA 3BAVA 5F8SA 3QR5A 2VU9A 5BXSA 4LO3A 1K5UA 1FWVA 1M2TB 1TFMB 2HW9A 31BIA 1DIWA 3CRIA 3CA1A 3O4BA 2D22A 1P63A 2D44A 3N7LA 3MALA 3P53A 1IJTA 4LO2C 4I4XA 2KI6B 4QD2B 3CQAA 3FJAA 3HSMA 4LO1A 1HWPB 1RMLA 1WD4A 3WINA 1Q04A 1YTOA 1DQOA 3UD8A 4I2SA 3AH2A 3RMYA 2Y9WC 1IT0A 1S0BA 2VLCA 3SNVA 3NJ5A 3ZC8A 4I7IA 1JLYA 3R4UA 3BA4A 2FFVA 4IY9A 4J2YA 4WBCA 5D63A 3V0BA 4OUJA 2F2FA 5FZZA 1BFBA 1JT7A 1MC9A 1PZZA 2QYIB 1BASA 4P0JA 3AKFA 1VCLA 4JRAA 5B2HA 4LO1C 2RG9B 4JKQA 3A21A 1ISZA 3VSZA 2WBCA 1R8OA 2FFUA 4I37A 1AFCA 3WO4A 3ZC9A 3FJKA 4L4HA 5DZUA 3O5WB 4I4RA 3CA6A 3P6IA 2X2TA 1TWMA 2K8RA 4OW4A 5FNXA 4EFQA 1PUMB 3AKGA 1FWUA 2F2FC 4H04A 4J2SA 2F8XC 2XOAA 2NYYA 1DJSB 2GO2A
chains in the Genus database with same CATH topology
4D0ZA 1JTCA 1PWAA 1SR4C 4Q9GA 5BQUA 4IYBA 4H9WA 4ZFUB 2BFHA 4IZXA 2NVHA 1L2HA 1TOOA 3BTAA 5BP5A 1S0FA 3FUOA 4ISRA 3N7KA 3PHZA 1FQ9A 2NZ9A 4EKXB 1AVXB 3I29B 4XFTA 1WD3A 1V6XA 1ONKB 3CRHA 4LO0A 1Z4SA 1JQZA 4AN6A 2I1BA 2RQ9A 1QQLA 4A7ZA 2WRYA 1T9FA 4TLPA 3D7WB 4P0LA 4QKSA 3WA1A 2DS0A 5GAQA 4G9NA 3C9ZA 3O3QA 4USPA 2FO1A 2YUGA 2QN4A 1Q03A 3RMXA 3I2AA 1G9DA 1V6UA 2K4AB 4ZOTA 3HMYA 3V0AB 3ZX7A 2IHOA 2HWAA 4I4QA 2Y9XE 3A07A 2GZBA 4G6MA 4GP3A 3FFZA 3CA3A 2Y9GA 4LO0C 2K43A 4Q9PA 1BFGA 4X39A 4OEEA 1V6WA 1BFFA 3IM5A 1HCEA 2Q3NB 3AZVA 1XZZA 1SZ6B 3F1RA 2LIEA 2NM1A 5F90A 2HWMA 1XYFA 4KEJA 3AH1A 1M16A 4QBVA 1IOBA 2Z48A 3VT0A 4QO3A 1ILR1 4XFUA 4ZBVB 1BARA 1FN0A 4EB2B 5FZUA 4ZGRB 3FJHA 4J2XA 3Q7YA 1JLXA 1JT3A 1S0LA 4QALA 4Q91A 4LO7B 2BEAA 1AF9A 5D61A 1S0EA 1A8DA 1MD6A 1D0HA 4QD2C 3WMUA 1EVTA 2D7RA 1ITBA 5BXPA 1BLDA 4Z8SB 3NBNA 4A7YA 3H6RB 3CA5A 3O4CA 3HOMA 4LO3C 5HPZA 1RG8A 4IZEA 3KMVA 1S0DA 3OGGA 3RSJA 4I6IA 3JUTA 2FGFA 3IM7A 1IRAX 4I1EA 3BAGA 3N7MA 4J2KA 4QKRA 1KNMA 4USOA 1FMZA 4XKIA 5D62A 3O4AA 5DSSB 4IY8A 1F31A 1YF8B 2VUAA 3FJCA 4FGFA 1RZOB 3OGFA 4IQPA 4XFSA 3S8JA 3WINC 4JP0A 41BIA 2MIBA 2LIQA 3BB2A 4H75A 3PMEA 2P39A 4HA2A 1HKNA 1EYLA 5G00A 3IM6A 1G82A 4HJJA 2D24A 4I4VA 1TTUA 1JT4A 4II0A 1AVUA 4ZKTB 1DZDA 3BAOA 3ZXDA 4D0TA 4ENDA 5I1BA 3BA5A 4JPZA 4ISQA 1GGPB 3R4SA 4MZFB 5DUYA 4MZGB 2R9KB 3V0AA 3CA4A 3A22A 2VSAA 4JQ0A 4I1BA 3H6QA 1TP0A 1UPSA 3POKA 4QBCA 4EEEB 2NP0A 4KC3A 2BEBA 1AXMA 1FMMS 3LTQA 2VXTI 4X3AA 4ZLBB 5BOWA 1AVWB 1S0GA 1DFCA 3S8KA 1I1EA 1K5VA 2UUSA 1ABRB 1AVAC 3EF2A 5BQUC 1BA7A 1IHKA 3FGMA 1S0CA 1XG6A 1FV3A 5BP5C 1WBCA 2Y9FA 5F8YA 4KBBA 1Z2VA 3FUQA 2P23A 2AQZA 5JLVA 2ET2A 2KI4A 1EV2A 2Q9XA 4EFPA 3O4DA 3HN1A 2AAIB 3BAUA 3BRGC 1G9CA 2L5XA 3Q7XA 1BLAA 2Z49A 4J23B 5FNWA 9ILBA 1W3AA 4KEKA 3VEQA 4X38A 5BXRA 1QXMA 4UY4A 3H6RA 3UD9A 3VWCA 2ZQNA 3O49A 4G1RA 4I3NA 4GAFA 2AFGA 4LO2A 4EFRA 1V6VA 4KEIA 2J3PA 1XHBA 3NBEA 3AKIA 4P0KA 3AJ6A 1II4A 1I1BA 1PC8B 3VT1A 3HBWA 2DRZA 3JRRA 1IRPA 2ZQOA 5EC5A 4GOYA 3V79C 4FVVA 4YOLA 1CVSA 4LO8B 2KH2A 2KLLA 3VSFA 4OWJA 1QQKA 6I1BA 4I4YA 4JAWA 1ISYA 5FZYA 3B9UA 3CAHA 1ISXA 3TC2A 3UD7A 3AKHA 3FJ8A 4F34A 1HWMB 2DRYA 4I0YA 3AJ5A 5JMCA 3BA7A 4OEGA 3W9TA 3UDAA 2ESUA 4ZA3B 2FDBM 2D7IA 4I8MA 4G9MA 1YBIA 3AH4A 4OWLA 2NTDA 5DVHA 1JT5A 3WO2A 4HR6C 4AN7B 4G6JA 3LLPA 4Z9WB 1TWEA 1G9AA 1ISVA 1HIBA 3IIRA 2D20A 3E8LC 1OQLB 3CA0A 1YYNA 3K1XA 4ZFWB 4D8HA 1FV2A 4X37A 3MPPG 4DCKC 1SR4A 2X2SA 4GP0A 3ZXGA 3A23A 3RTJB 3AZWA 3O4OA 4I4UA 3VUOA 5BVPI 3H6SE 3BAHA 2MC2A 1HWOB 4MZHA 1J0SA 4I4SA 5EHAA 4QC4A 2M49A 2ZR1B 2ERMA 4I96A 1DZCA 4JKXB 1JY0A 4DENA 4IHZA 3BADA 3OJMA 2DREA 2KKIA 1W3GA 3V0BB 2VXRA 4IONA 3UJ4A 2IWTB 3F62B 1T4QA 3IAGC 3FJDA 2VSEA 4ZFYB 2AXMA 3OBRA 3O44A 3PUBA 2D43A 1IILA 3N7JA 1WBAA 4OEFA 5BXTA 1W3FA 3ILAA 3FJBA 1N4KA 1CE7B 2E4MA 3N0KA 2D1ZA 1TIEA 3P6JA 4I4PA 7I1BA 3BRFA 2MLLB 4CJMA 3FJEA 1EPWA 1DFQA 3RTIB 3I2XA 3NBDA 3CRGA 4A7KA 1FGAA 3HALA 5EG6C 3FJJA 8I1BA 3FJFA 1DLLA 3VT2A 3BX1C 3FJIA 1Q1UA 3OBTA 1NZKA 4I4OA 1E0OA 3QYDA 4GOVA 3NBCA 1R8NA 3BAQA 4DEPA 1DQGA 3CU1B 1NUNA 1PUUB 5E24E 4OWKA 4PC4A 2D23A 3BRDA 1RY7A 3PG0A 4L4IA 3WO3A 1YXWA 2E4MC 4P6AA 1ISWA 3OJVA 1HCDA 1G9BA 3FJ9A 3WMVA 2NS2A 3UJ0A 1Z0HA 5F8WA 4R6UB 3T8SA 2HZ9A 4GAIA 1BFCA 3OJ2A 1HWNB 21BIA 4LO7C 4F83A 3Q7WA 2RSTA 3BAVA 5F8SA 3QR5A 2VU9A 5BXSA 4LO3A 1K5UA 1FWVA 1M2TB 1TFMB 2HW9A 31BIA 1DIWA 3CRIA 3CA1A 3O4BA 2D22A 1P63A 2D44A 3N7LA 3MALA 3P53A 1IJTA 4LO2C 4I4XA 2KI6B 4QD2B 3CQAA 3FJAA 3HSMA 4LO1A 1HWPB 1RMLA 1WD4A 3WINA 1Q04A 1YTOA 1DQOA 3UD8A 4I2SA 3AH2A 3RMYA 2Y9WC 1IT0A 1S0BA 2VLCA 3SNVA 3NJ5A 3ZC8A 4I7IA 1JLYA 3R4UA 3BA4A 2FFVA 4IY9A 4J2YA 4WBCA 5D63A 3V0BA 4OUJA 2F2FA 5FZZA 1BFBA 1JT7A 1MC9A 1PZZA 2QYIB 1BASA 4P0JA 3AKFA 1VCLA 4JRAA 5B2HA 4LO1C 2RG9B 4JKQA 3A21A 1ISZA 3VSZA 2WBCA 1R8OA 2FFUA 4I37A 1AFCA 3WO4A 3ZC9A 3FJKA 4L4HA 5DZUA 3O5WB 4I4RA 3CA6A 3P6IA 2X2TA 1TWMA 2K8RA 4OW4A 5FNXA 4EFQA 1PUMB 3AKGA 1FWUA 2F2FC 4H04A 4J2SA 2F8XC 2XOAA 2NYYA 1DJSB 2GO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D0Z A;  1JTC A;  1PWA A;  1SR4 C;  4Q9G A;  5BQU A;  4IYB A;  4H9W A;  4ZFU B;  2BFH A;  4IZX A;  2NVH A;  1L2H A;  1TOO A;  3BTA A;  5BP5 A;  1S0F A;  3FUO A;  4ISR A;  3N7K A;  3PHZ A;  1FQ9 A;  2NZ9 A;  4EKX B;  1AVX B;  3I29 B;  4XFT A;  1WD3 A;  1V6X A;  1ONK B;  3CRH A;  4LO0 A;  1Z4S A;  1JQZ A;  4AN6 A;  2I1B A;  2RQ9 A;  1QQL A;  4A7Z A;  2WRY A;  1T9F A;  4TLP A;  3D7W B;  4P0L A;  4QKS A;  3WA1 A;  2DS0 A;  5GAQ A;  4G9N A;  3C9Z A;  3O3Q A;  4USP A;  2FO1 A;  2YUG A;  2QN4 A;  1Q03 A;  3RMX A;  3I2A A;  1G9D A;  1V6U A;  2K4A B;  4ZOT A;  3HMY A;  3V0A B;  3ZX7 A;  2IHO A;  2HWA A;  4I4Q A;  2Y9X E;  3A07 A;  2GZB A;  4G6M A;  4GP3 A;  3FFZ A;  3CA3 A;  2Y9G A;  4LO0 C;  2K43 A;  4Q9P A;  1BFG A;  4X39 A;  4OEE A;  1V6W A;  1BFF A;  3IM5 A;  1HCE A;  2Q3N B;  3AZV A;  1XZZ A;  1SZ6 B;  3F1R A;  2LIE A;  2NM1 A;  5F90 A;  2HWM A;  1XYF A;  4KEJ A;  3AH1 A;  1M16 A;  4QBV A;  1IOB A;  2Z48 A;  3VT0 A;  4QO3 A;  1ILR 1;  4XFU A;  4ZBV B;  1BAR A;  1FN0 A;  4EB2 B;  5FZU A;  4ZGR B;  3FJH A;  4J2X A;  3Q7Y A;  1JLX A;  1JT3 A;  1S0L A;  4QAL A;  4Q91 A;  4LO7 B;  2BEA A;  1AF9 A;  5D61 A;  1S0E A;  1A8D A;  1MD6 A;  1D0H A;  4QD2 C;  3WMU A;  1EVT A;  2D7R A;  1ITB A;  5BXP A;  1BLD A;  4Z8S B;  3NBN A;  4A7Y A;  3H6R B;  3CA5 A;  3O4C A;  3HOM A;  4LO3 C;  5HPZ A;  1RG8 A;  4IZE A;  3KMV A;  1S0D A;  3OGG A;  3RSJ A;  4I6I A;  3JUT A;  2FGF A;  3IM7 A;  1IRA X;  4I1E A;  3BAG A;  3N7M A;  4J2K A;  4QKR A;  1KNM A;  4USO A;  1FMZ A;  4XKI A;  5D62 A;  3O4A A;  5DSS B;  4IY8 A;  1F31 A;  1YF8 B;  2VUA A;  3FJC A;  4FGF A;  1RZO B;  3OGF A;  4IQP A;  4XFS A;  3S8J A;  3WIN C;  4JP0 A;  41BI A;  2MIB A;  2LIQ A;  3BB2 A;  3PME A;  2P39 A;  4HA2 A;  1HKN A;  1EYL A;  5G00 A;  3IM6 A;  1G82 A;  4HJJ A;  2D24 A;  4I4V A;  1TTU A;  1JT4 A;  4II0 A;  1AVU A;  4ZKT B;  1DZD A;  3BAO A;  3ZXD A;  4D0T A;  4END A;  5I1B A;  3BA5 A;  4JPZ A;  4ISQ A;  1GGP B;  3R4S A;  5DUY A;  2R9K B;  3V0A A;  3CA4 A;  3A22 A;  2VSA A;  4JQ0 A;  4I1B A;  3H6Q A;  1TP0 A;  1UPS A;  3POK A;  4QBC A;  4EEE B;  2NP0 A;  4KC3 A;  2BEB A;  1AXM A;  1FMM S;  3LTQ A;  2VXT I;  4X3A A;  4ZLB B;  5BOW A;  1AVW B;  1S0G A;  1DFC A;  3S8K A;  1I1E A;  1K5V A;  2UUS A;  1ABR B;  1AVA C;  3EF2 A;  5BQU C;  1BA7 A;  1IHK A;  3FGM A;  1S0C A;  1XG6 A;  1FV3 A;  5BP5 C;  1WBC A;  2Y9F A;  5F8Y A;  4KBB A;  1Z2V A;  3FUQ A;  2P23 A;  2AQZ A;  5JLV A;  2ET2 A;  2KI4 A;  1EV2 A;  2Q9X A;  4EFP A;  3O4D A;  3HN1 A;  2AAI B;  3BAU A;  3BRG C;  1G9C A;  2L5X A;  3Q7X A;  1BLA A;  2Z49 A;  4J23 B;  5FNW A;  9ILB A;  1W3A A;  4KEK A;  3VEQ A;  4X38 A;  5BXR A;  1QXM A;  3H6R A;  3UD9 A;  3VWC A;  2ZQN A;  3O49 A;  4G1R A;  4I3N A;  4GAF A;  2AFG A;  4LO2 A;  4EFR A;  1V6V A;  4KEI A;  2J3P A;  1XHB A;  3NBE A;  3AKI A;  4P0K A;  3AJ6 A;  1II4 A;  1I1B A;  1PC8 B;  3VT1 A;  3HBW A;  2DRZ A;  3JRR A;  1IRP A;  2ZQO A;  5EC5 A;  4GOY A;  3V79 C;  4FVV A;  4YOL A;  1CVS A;  4LO8 B;  2KH2 A;  2KLL A;  3VSF A;  4OWJ A;  1QQK A;  6I1B A;  4I4Y A;  4JAW A;  1ISY A;  5FZY A;  3B9U A;  3CAH A;  1ISX A;  3TC2 A;  3UD7 A;  3AKH A;  3FJ8 A;  4F34 A;  1HWM B;  2DRY A;  4I0Y A;  3AJ5 A;  5JMC A;  3BA7 A;  4OEG A;  3W9T A;  3UDA A;  2ESU A;  4ZA3 B;  2FDB M;  2D7I A;  4I8M A;  4G9M A;  1YBI A;  3AH4 A;  4OWL A;  2NTD A;  5DVH A;  1JT5 A;  3WO2 A;  4HR6 C;  4AN7 B;  4G6J A;  3LLP A;  4Z9W B;  1TWE A;  1G9A A;  1ISV A;  1HIB A;  3IIR A;  2D20 A;  3E8L C;  1OQL B;  3CA0 A;  1YYN A;  3K1X A;  4ZFW B;  4D8H A;  1FV2 A;  4X37 A;  3MPP G;  4DCK C;  1SR4 A;  2X2S A;  4GP0 A;  3ZXG A;  3A23 A;  3RTJ B;  3AZW A;  3O4O A;  4I4U A;  3VUO A;  5BVP I;  3H6S E;  3BAH A;  2MC2 A;  1HWO B;  1J0S A;  4I4S A;  5EHA A;  4QC4 A;  2M49 A;  2ZR1 B;  2ERM A;  4I96 A;  1DZC A;  4JKX B;  1JY0 A;  4DEN A;  4IHZ A;  3BAD A;  3OJM A;  2DRE A;  2KKI A;  1W3G A;  3V0B B;  2VXR A;  4ION A;  3UJ4 A;  2IWT B;  3F62 B;  1T4Q A;  3IAG C;  3FJD A;  2VSE A;  4ZFY B;  2AXM A;  3OBR A;  3O44 A;  3PUB A;  2D43 A;  1IIL A;  3N7J A;  1WBA A;  4OEF A;  5BXT A;  1W3F A;  3ILA A;  3FJB A;  1N4K A;  1CE7 B;  2E4M A;  3N0K A;  2D1Z A;  1TIE A;  3P6J A;  4I4P A;  7I1B A;  3BRF A;  2MLL B;  4CJM A;  3FJE A;  1EPW A;  1DFQ A;  3RTI B;  3I2X A;  3NBD A;  3CRG A;  4A7K A;  1FGA A;  3HAL A;  5EG6 C;  3FJJ A;  8I1B A;  3FJF A;  1DLL A;  3VT2 A;  3BX1 C;  3FJI A;  1Q1U A;  3OBT A;  1NZK A;  4I4O A;  1E0O A;  3QYD A;  4GOV A;  3NBC A;  1R8N A;  3BAQ A;  4DEP A;  1DQG A;  3CU1 B;  1NUN A;  1PUU B;  5E24 E;  4OWK A;  4PC4 A;  2D23 A;  3BRD A;  1RY7 A;  3PG0 A;  4L4I A;  3WO3 A;  1YXW A;  2E4M C;  4P6A A;  1ISW A;  3OJV A;  1HCD A;  1G9B A;  3FJ9 A;  3WMV A;  3UJ0 A;  1Z0H A;  5F8W A;  4R6U B;  3T8S A;  2HZ9 A;  4GAI A;  1BFC A;  3OJ2 A;  1HWN B;  21BI A;  4LO7 C;  4F83 A;  3Q7W A;  2RST A;  3BAV A;  5F8S A;  3QR5 A;  2VU9 A;  5BXS A;  4LO3 A;  1K5U A;  1FWV A;  1M2T B;  1TFM B;  2HW9 A;  31BI A;  1DIW A;  3CRI A;  3CA1 A;  3O4B A;  2D22 A;  1P63 A;  2D44 A;  3N7L A;  3MAL A;  3P53 A;  1IJT A;  4LO2 C;  4I4X A;  2KI6 B;  4QD2 B;  3CQA A;  3FJA A;  3HSM A;  4LO1 A;  1HWP B;  1RML A;  1WD4 A;  3WIN A;  1Q04 A;  1YTO A;  1DQO A;  3UD8 A;  4I2S A;  3AH2 A;  3RMY A;  2Y9W C;  1IT0 A;  1S0B A;  2VLC A;  3SNV A;  3NJ5 A;  3ZC8 A;  4I7I A;  1JLY A;  3R4U A;  3BA4 A;  2FFV A;  4IY9 A;  4J2Y A;  4WBC A;  5D63 A;  3V0B A;  4OUJ A;  2F2F A;  5FZZ A;  1BFB A;  1JT7 A;  1MC9 A;  1PZZ A;  2QYI B;  1BAS A;  4P0J A;  3AKF A;  1VCL A;  4JRA A;  5B2H A;  4LO1 C;  2RG9 B;  4JKQ A;  3A21 A;  1ISZ A;  3VSZ A;  2WBC A;  1R8O A;  2FFU A;  4I37 A;  1AFC A;  3WO4 A;  3ZC9 A;  3FJK A;  4L4H A;  5DZU A;  3O5W B;  4I4R A;  3CA6 A;  3P6I A;  2X2T A;  1TWM A;  2K8R A;  4OW4 A;  5FNX A;  4EFQ A;  1PUM B;  3AKG A;  1FWU A;  2F2F C;  4H04 A;  4J2S A;  2F8X C;  2XOA A;  2NYY A;  1DJS B;  2GO2 A; 
#chains in the Genus database with same CATH topology
 4D0Z A;  1JTC A;  1PWA A;  1SR4 C;  4Q9G A;  5BQU A;  4IYB A;  4H9W A;  4ZFU B;  2BFH A;  4IZX A;  2NVH A;  1L2H A;  1TOO A;  3BTA A;  5BP5 A;  1S0F A;  3FUO A;  4ISR A;  3N7K A;  3PHZ A;  1FQ9 A;  2NZ9 A;  4EKX B;  1AVX B;  3I29 B;  4XFT A;  1WD3 A;  1V6X A;  1ONK B;  3CRH A;  4LO0 A;  1Z4S A;  1JQZ A;  4AN6 A;  2I1B A;  2RQ9 A;  1QQL A;  4A7Z A;  2WRY A;  1T9F A;  4TLP A;  3D7W B;  4P0L A;  4QKS A;  3WA1 A;  2DS0 A;  5GAQ A;  4G9N A;  3C9Z A;  3O3Q A;  4USP A;  2FO1 A;  2YUG A;  2QN4 A;  1Q03 A;  3RMX A;  3I2A A;  1G9D A;  1V6U A;  2K4A B;  4ZOT A;  3HMY A;  3V0A B;  3ZX7 A;  2IHO A;  2HWA A;  4I4Q A;  2Y9X E;  3A07 A;  2GZB A;  4G6M A;  4GP3 A;  3FFZ A;  3CA3 A;  2Y9G A;  4LO0 C;  2K43 A;  4Q9P A;  1BFG A;  4X39 A;  4OEE A;  1V6W A;  1BFF A;  3IM5 A;  1HCE A;  2Q3N B;  3AZV A;  1XZZ A;  1SZ6 B;  3F1R A;  2LIE A;  2NM1 A;  5F90 A;  2HWM A;  1XYF A;  4KEJ A;  3AH1 A;  1M16 A;  4QBV A;  1IOB A;  2Z48 A;  3VT0 A;  4QO3 A;  1ILR 1;  4XFU A;  4ZBV B;  1BAR A;  1FN0 A;  4EB2 B;  5FZU A;  4ZGR B;  3FJH A;  4J2X A;  3Q7Y A;  1JLX A;  1JT3 A;  1S0L A;  4QAL A;  4Q91 A;  4LO7 B;  2BEA A;  1AF9 A;  5D61 A;  1S0E A;  1A8D A;  1MD6 A;  1D0H A;  4QD2 C;  3WMU A;  1EVT A;  2D7R A;  1ITB A;  5BXP A;  1BLD A;  4Z8S B;  3NBN A;  4A7Y A;  3H6R B;  3CA5 A;  3O4C A;  3HOM A;  4LO3 C;  5HPZ A;  1RG8 A;  4IZE A;  3KMV A;  1S0D A;  3OGG A;  3RSJ A;  4I6I A;  3JUT A;  2FGF A;  3IM7 A;  1IRA X;  4I1E A;  3BAG A;  3N7M A;  4J2K A;  4QKR A;  1KNM A;  4USO A;  1FMZ A;  4XKI A;  5D62 A;  3O4A A;  5DSS B;  4IY8 A;  1F31 A;  1YF8 B;  2VUA A;  3FJC A;  4FGF A;  1RZO B;  3OGF A;  4IQP A;  4XFS A;  3S8J A;  3WIN C;  4JP0 A;  41BI A;  2MIB A;  2LIQ A;  3BB2 A;  4H75 A;  3PME A;  2P39 A;  4HA2 A;  1HKN A;  1EYL A;  5G00 A;  3IM6 A;  1G82 A;  4HJJ A;  2D24 A;  4I4V A;  1TTU A;  1JT4 A;  4II0 A;  1AVU A;  4ZKT B;  1DZD A;  3BAO A;  3ZXD A;  4D0T A;  4END A;  5I1B A;  3BA5 A;  4JPZ A;  4ISQ A;  1GGP B;  3R4S A;  4MZF B;  5DUY A;  4MZG B;  2R9K B;  3V0A A;  3CA4 A;  3A22 A;  2VSA A;  4JQ0 A;  4I1B A;  3H6Q A;  1TP0 A;  1UPS A;  3POK A;  4QBC A;  4EEE B;  2NP0 A;  4KC3 A;  2BEB A;  1AXM A;  1FMM S;  3LTQ A;  2VXT I;  4X3A A;  4ZLB B;  5BOW A;  1AVW B;  1S0G A;  1DFC A;  3S8K A;  1I1E A;  1K5V A;  2UUS A;  1ABR B;  1AVA C;  3EF2 A;  5BQU C;  1BA7 A;  1IHK A;  3FGM A;  1S0C A;  1XG6 A;  1FV3 A;  5BP5 C;  1WBC A;  2Y9F A;  5F8Y A;  4KBB A;  1Z2V A;  3FUQ A;  2P23 A;  2AQZ A;  5JLV A;  2ET2 A;  2KI4 A;  1EV2 A;  2Q9X A;  4EFP A;  3O4D A;  3HN1 A;  2AAI B;  3BAU A;  3BRG C;  1G9C A;  2L5X A;  3Q7X A;  1BLA A;  2Z49 A;  4J23 B;  5FNW A;  9ILB A;  1W3A A;  4KEK A;  3VEQ A;  4X38 A;  5BXR A;  1QXM A;  4UY4 A;  3H6R A;  3UD9 A;  3VWC A;  2ZQN A;  3O49 A;  4G1R A;  4I3N A;  4GAF A;  2AFG A;  4LO2 A;  4EFR A;  1V6V A;  4KEI A;  2J3P A;  1XHB A;  3NBE A;  3AKI A;  4P0K A;  3AJ6 A;  1II4 A;  1I1B A;  1PC8 B;  3VT1 A;  3HBW A;  2DRZ A;  3JRR A;  1IRP A;  2ZQO A;  5EC5 A;  4GOY A;  3V79 C;  4FVV A;  4YOL A;  1CVS A;  4LO8 B;  2KH2 A;  2KLL A;  3VSF A;  4OWJ A;  1QQK A;  6I1B A;  4I4Y A;  4JAW A;  1ISY A;  5FZY A;  3B9U A;  3CAH A;  1ISX A;  3TC2 A;  3UD7 A;  3AKH A;  3FJ8 A;  4F34 A;  1HWM B;  2DRY A;  4I0Y A;  3AJ5 A;  5JMC A;  3BA7 A;  4OEG A;  3W9T A;  3UDA A;  2ESU A;  4ZA3 B;  2FDB M;  2D7I A;  4I8M A;  4G9M A;  1YBI A;  3AH4 A;  4OWL A;  2NTD A;  5DVH A;  1JT5 A;  3WO2 A;  4HR6 C;  4AN7 B;  4G6J A;  3LLP A;  4Z9W B;  1TWE A;  1G9A A;  1ISV A;  1HIB A;  3IIR A;  2D20 A;  3E8L C;  1OQL B;  3CA0 A;  1YYN A;  3K1X A;  4ZFW B;  4D8H A;  1FV2 A;  4X37 A;  3MPP G;  4DCK C;  1SR4 A;  2X2S A;  4GP0 A;  3ZXG A;  3A23 A;  3RTJ B;  3AZW A;  3O4O A;  4I4U A;  3VUO A;  5BVP I;  3H6S E;  3BAH A;  2MC2 A;  1HWO B;  4MZH A;  1J0S A;  4I4S A;  5EHA A;  4QC4 A;  2M49 A;  2ZR1 B;  2ERM A;  4I96 A;  1DZC A;  4JKX B;  1JY0 A;  4DEN A;  4IHZ A;  3BAD A;  3OJM A;  2DRE A;  2KKI A;  1W3G A;  3V0B B;  2VXR A;  4ION A;  3UJ4 A;  2IWT B;  3F62 B;  1T4Q A;  3IAG C;  3FJD A;  2VSE A;  4ZFY B;  2AXM A;  3OBR A;  3O44 A;  3PUB A;  2D43 A;  1IIL A;  3N7J A;  1WBA A;  4OEF A;  5BXT A;  1W3F A;  3ILA A;  3FJB A;  1N4K A;  1CE7 B;  2E4M A;  3N0K A;  2D1Z A;  1TIE A;  3P6J A;  4I4P A;  7I1B A;  3BRF A;  2MLL B;  4CJM A;  3FJE A;  1EPW A;  1DFQ A;  3RTI B;  3I2X A;  3NBD A;  3CRG A;  4A7K A;  1FGA A;  3HAL A;  5EG6 C;  3FJJ A;  8I1B A;  3FJF A;  1DLL A;  3VT2 A;  3BX1 C;  3FJI A;  1Q1U A;  3OBT A;  1NZK A;  4I4O A;  1E0O A;  3QYD A;  4GOV A;  3NBC A;  1R8N A;  3BAQ A;  4DEP A;  1DQG A;  3CU1 B;  1NUN A;  1PUU B;  5E24 E;  4OWK A;  4PC4 A;  2D23 A;  3BRD A;  1RY7 A;  3PG0 A;  4L4I A;  3WO3 A;  1YXW A;  2E4M C;  4P6A A;  1ISW A;  3OJV A;  1HCD A;  1G9B A;  3FJ9 A;  3WMV A;  2NS2 A;  3UJ0 A;  1Z0H A;  5F8W A;  4R6U B;  3T8S A;  2HZ9 A;  4GAI A;  1BFC A;  3OJ2 A;  1HWN B;  21BI A;  4LO7 C;  4F83 A;  3Q7W A;  2RST A;  3BAV A;  5F8S A;  3QR5 A;  2VU9 A;  5BXS A;  4LO3 A;  1K5U A;  1FWV A;  1M2T B;  1TFM B;  2HW9 A;  31BI A;  1DIW A;  3CRI A;  3CA1 A;  3O4B A;  2D22 A;  1P63 A;  2D44 A;  3N7L A;  3MAL A;  3P53 A;  1IJT A;  4LO2 C;  4I4X A;  2KI6 B;  4QD2 B;  3CQA A;  3FJA A;  3HSM A;  4LO1 A;  1HWP B;  1RML A;  1WD4 A;  3WIN A;  1Q04 A;  1YTO A;  1DQO A;  3UD8 A;  4I2S A;  3AH2 A;  3RMY A;  2Y9W C;  1IT0 A;  1S0B A;  2VLC A;  3SNV A;  3NJ5 A;  3ZC8 A;  4I7I A;  1JLY A;  3R4U A;  3BA4 A;  2FFV A;  4IY9 A;  4J2Y A;  4WBC A;  5D63 A;  3V0B A;  4OUJ A;  2F2F A;  5FZZ A;  1BFB A;  1JT7 A;  1MC9 A;  1PZZ A;  2QYI B;  1BAS A;  4P0J A;  3AKF A;  1VCL A;  4JRA A;  5B2H A;  4LO1 C;  2RG9 B;  4JKQ A;  3A21 A;  1ISZ A;  3VSZ A;  2WBC A;  1R8O A;  2FFU A;  4I37 A;  1AFC A;  3WO4 A;  3ZC9 A;  3FJK A;  4L4H A;  5DZU A;  3O5W B;  4I4R A;  3CA6 A;  3P6I A;  2X2T A;  1TWM A;  2K8R A;  4OW4 A;  5FNX A;  4EFQ A;  1PUM B;  3AKG A;  1FWU A;  2F2F C;  4H04 A;  4J2S A;  2F8X C;  2XOA A;  2NYY A;  1DJS B;  2GO2 A; 
#chains in the Genus database with same CATH homology
 4D0Z A;  1JTC A;  1PWA A;  1SR4 C;  4Q9G A;  5BQU A;  4IYB A;  4H9W A;  4ZFU B;  2BFH A;  4IZX A;  2NVH A;  1L2H A;  1TOO A;  3BTA A;  5BP5 A;  1S0F A;  3FUO A;  4ISR A;  3N7K A;  3PHZ A;  1FQ9 A;  2NZ9 A;  4EKX B;  1AVX B;  3I29 B;  4XFT A;  1WD3 A;  1V6X A;  1ONK B;  3CRH A;  4LO0 A;  1Z4S A;  1JQZ A;  4AN6 A;  2I1B A;  2RQ9 A;  1QQL A;  4A7Z A;  2WRY A;  1T9F A;  4TLP A;  3D7W B;  4P0L A;  4QKS A;  3WA1 A;  2DS0 A;  5GAQ A;  4G9N A;  3C9Z A;  3O3Q A;  4USP A;  2FO1 A;  2YUG A;  2QN4 A;  1Q03 A;  3RMX A;  3I2A A;  1G9D A;  1V6U A;  2K4A B;  4ZOT A;  3HMY A;  3V0A B;  3ZX7 A;  2IHO A;  2HWA A;  4I4Q A;  2Y9X E;  3A07 A;  2GZB A;  4G6M A;  4GP3 A;  3FFZ A;  3CA3 A;  2Y9G A;  4LO0 C;  2K43 A;  4Q9P A;  1BFG A;  4X39 A;  4OEE A;  1V6W A;  1BFF A;  3IM5 A;  1HCE A;  2Q3N B;  3AZV A;  1XZZ A;  1SZ6 B;  3F1R A;  2LIE A;  2NM1 A;  5F90 A;  2HWM A;  1XYF A;  4KEJ A;  3AH1 A;  1M16 A;  4QBV A;  1IOB A;  2Z48 A;  3VT0 A;  4QO3 A;  1ILR 1;  4XFU A;  4ZBV B;  1BAR A;  1FN0 A;  4EB2 B;  5FZU A;  4ZGR B;  3FJH A;  4J2X A;  3Q7Y A;  1JLX A;  1JT3 A;  1S0L A;  4QAL A;  4Q91 A;  4LO7 B;  2BEA A;  1AF9 A;  5D61 A;  1S0E A;  1A8D A;  1MD6 A;  1D0H A;  4QD2 C;  3WMU A;  1EVT A;  2D7R A;  1ITB A;  5BXP A;  1BLD A;  4Z8S B;  3NBN A;  4A7Y A;  3H6R B;  3CA5 A;  3O4C A;  3HOM A;  4LO3 C;  5HPZ A;  1RG8 A;  4IZE A;  3KMV A;  1S0D A;  3OGG A;  3RSJ A;  4I6I A;  3JUT A;  2FGF A;  3IM7 A;  1IRA X;  4I1E A;  3BAG A;  3N7M A;  4J2K A;  4QKR A;  1KNM A;  4USO A;  1FMZ A;  4XKI A;  5D62 A;  3O4A A;  5DSS B;  4IY8 A;  1F31 A;  1YF8 B;  2VUA A;  3FJC A;  4FGF A;  1RZO B;  3OGF A;  4IQP A;  4XFS A;  3S8J A;  3WIN C;  4JP0 A;  41BI A;  2MIB A;  2LIQ A;  3BB2 A;  4H75 A;  3PME A;  2P39 A;  4HA2 A;  1HKN A;  1EYL A;  5G00 A;  3IM6 A;  1G82 A;  4HJJ A;  2D24 A;  4I4V A;  1TTU A;  1JT4 A;  4II0 A;  1AVU A;  4ZKT B;  1DZD A;  3BAO A;  3ZXD A;  4D0T A;  4END A;  5I1B A;  3BA5 A;  4JPZ A;  4ISQ A;  1GGP B;  3R4S A;  4MZF B;  5DUY A;  4MZG B;  2R9K B;  3V0A A;  3CA4 A;  3A22 A;  2VSA A;  4JQ0 A;  4I1B A;  3H6Q A;  1TP0 A;  1UPS A;  3POK A;  4QBC A;  4EEE B;  2NP0 A;  4KC3 A;  2BEB A;  1AXM A;  1FMM S;  3LTQ A;  2VXT I;  4X3A A;  4ZLB B;  5BOW A;  1AVW B;  1S0G A;  1DFC A;  3S8K A;  1I1E A;  1K5V A;  2UUS A;  1ABR B;  1AVA C;  3EF2 A;  5BQU C;  1BA7 A;  1IHK A;  3FGM A;  1S0C A;  1XG6 A;  1FV3 A;  5BP5 C;  1WBC A;  2Y9F A;  5F8Y A;  4KBB A;  1Z2V A;  3FUQ A;  2P23 A;  2AQZ A;  5JLV A;  2ET2 A;  2KI4 A;  1EV2 A;  2Q9X A;  4EFP A;  3O4D A;  3HN1 A;  2AAI B;  3BAU A;  3BRG C;  1G9C A;  2L5X A;  3Q7X A;  1BLA A;  2Z49 A;  4J23 B;  5FNW A;  9ILB A;  1W3A A;  4KEK A;  3VEQ A;  4X38 A;  5BXR A;  1QXM A;  4UY4 A;  3H6R A;  3UD9 A;  3VWC A;  2ZQN A;  3O49 A;  4G1R A;  4I3N A;  4GAF A;  2AFG A;  4LO2 A;  4EFR A;  1V6V A;  4KEI A;  2J3P A;  1XHB A;  3NBE A;  3AKI A;  4P0K A;  3AJ6 A;  1II4 A;  1I1B A;  1PC8 B;  3VT1 A;  3HBW A;  2DRZ A;  3JRR A;  1IRP A;  2ZQO A;  5EC5 A;  4GOY A;  3V79 C;  4FVV A;  4YOL A;  1CVS A;  4LO8 B;  2KH2 A;  2KLL A;  3VSF A;  4OWJ A;  1QQK A;  6I1B A;  4I4Y A;  4JAW A;  1ISY A;  5FZY A;  3B9U A;  3CAH A;  1ISX A;  3TC2 A;  3UD7 A;  3AKH A;  3FJ8 A;  4F34 A;  1HWM B;  2DRY A;  4I0Y A;  3AJ5 A;  5JMC A;  3BA7 A;  4OEG A;  3W9T A;  3UDA A;  2ESU A;  4ZA3 B;  2FDB M;  2D7I A;  4I8M A;  4G9M A;  1YBI A;  3AH4 A;  4OWL A;  2NTD A;  5DVH A;  1JT5 A;  3WO2 A;  4HR6 C;  4AN7 B;  4G6J A;  3LLP A;  4Z9W B;  1TWE A;  1G9A A;  1ISV A;  1HIB A;  3IIR A;  2D20 A;  3E8L C;  1OQL B;  3CA0 A;  1YYN A;  3K1X A;  4ZFW B;  4D8H A;  1FV2 A;  4X37 A;  3MPP G;  4DCK C;  1SR4 A;  2X2S A;  4GP0 A;  3ZXG A;  3A23 A;  3RTJ B;  3AZW A;  3O4O A;  4I4U A;  3VUO A;  5BVP I;  3H6S E;  3BAH A;  2MC2 A;  1HWO B;  4MZH A;  1J0S A;  4I4S A;  5EHA A;  4QC4 A;  2M49 A;  2ZR1 B;  2ERM A;  4I96 A;  1DZC A;  4JKX B;  1JY0 A;  4DEN A;  4IHZ A;  3BAD A;  3OJM A;  2DRE A;  2KKI A;  1W3G A;  3V0B B;  2VXR A;  4ION A;  3UJ4 A;  2IWT B;  3F62 B;  1T4Q A;  3IAG C;  3FJD A;  2VSE A;  4ZFY B;  2AXM A;  3OBR A;  3O44 A;  3PUB A;  2D43 A;  1IIL A;  3N7J A;  1WBA A;  4OEF A;  5BXT A;  1W3F A;  3ILA A;  3FJB A;  1N4K A;  1CE7 B;  2E4M A;  3N0K A;  2D1Z A;  1TIE A;  3P6J A;  4I4P A;  7I1B A;  3BRF A;  2MLL B;  4CJM A;  3FJE A;  1EPW A;  1DFQ A;  3RTI B;  3I2X A;  3NBD A;  3CRG A;  4A7K A;  1FGA A;  3HAL A;  5EG6 C;  3FJJ A;  8I1B A;  3FJF A;  1DLL A;  3VT2 A;  3BX1 C;  3FJI A;  1Q1U A;  3OBT A;  1NZK A;  4I4O A;  1E0O A;  3QYD A;  4GOV A;  3NBC A;  1R8N A;  3BAQ A;  4DEP A;  1DQG A;  3CU1 B;  1NUN A;  1PUU B;  5E24 E;  4OWK A;  4PC4 A;  2D23 A;  3BRD A;  1RY7 A;  3PG0 A;  4L4I A;  3WO3 A;  1YXW A;  2E4M C;  4P6A A;  1ISW A;  3OJV A;  1HCD A;  1G9B A;  3FJ9 A;  3WMV A;  2NS2 A;  3UJ0 A;  1Z0H A;  5F8W A;  4R6U B;  3T8S A;  2HZ9 A;  4GAI A;  1BFC A;  3OJ2 A;  1HWN B;  21BI A;  4LO7 C;  4F83 A;  3Q7W A;  2RST A;  3BAV A;  5F8S A;  3QR5 A;  2VU9 A;  5BXS A;  4LO3 A;  1K5U A;  1FWV A;  1M2T B;  1TFM B;  2HW9 A;  31BI A;  1DIW A;  3CRI A;  3CA1 A;  3O4B A;  2D22 A;  1P63 A;  2D44 A;  3N7L A;  3MAL A;  3P53 A;  1IJT A;  4LO2 C;  4I4X A;  2KI6 B;  4QD2 B;  3CQA A;  3FJA A;  3HSM A;  4LO1 A;  1HWP B;  1RML A;  1WD4 A;  3WIN A;  1Q04 A;  1YTO A;  1DQO A;  3UD8 A;  4I2S A;  3AH2 A;  3RMY A;  2Y9W C;  1IT0 A;  1S0B A;  2VLC A;  3SNV A;  3NJ5 A;  3ZC8 A;  4I7I A;  1JLY A;  3R4U A;  3BA4 A;  2FFV A;  4IY9 A;  4J2Y A;  4WBC A;  5D63 A;  3V0B A;  4OUJ A;  2F2F A;  5FZZ A;  1BFB A;  1JT7 A;  1MC9 A;  1PZZ A;  2QYI B;  1BAS A;  4P0J A;  3AKF A;  1VCL A;  4JRA A;  5B2H A;  4LO1 C;  2RG9 B;  4JKQ A;  3A21 A;  1ISZ A;  3VSZ A;  2WBC A;  1R8O A;  2FFU A;  4I37 A;  1AFC A;  3WO4 A;  3ZC9 A;  3FJK A;  4L4H A;  5DZU A;  3O5W B;  4I4R A;  3CA6 A;  3P6I A;  2X2T A;  1TWM A;  2K8R A;  4OW4 A;  5FNX A;  4EFQ A;  1PUM B;  3AKG A;  1FWU A;  2F2F C;  4H04 A;  4J2S A;  2F8X C;  2XOA A;  2NYY A;  1DJS B;  2GO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...