3AH1A

Ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylneuramic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
283
Chain Sequence
TNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Main hemagglutinin component
publication title Sugar-binding sites of the HA1 subcomponent of Clostridium botulinum type C progenitor toxin
pubmed doi rcsb
source organism Clostridium botulinum
molecule tags Toxin
total genus 91
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ah1A02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ah1A01
3OGGA 3RTJB 4YOLA 4QD2B 1YXWA 1K5UA 3WMUA 2NYYA 3H6RA 2D23A 2FO1A 5B2HA 1JT3A 1HWNB 3HALA 3BA4A 3WO3A 1N4KA 1YBIA 5DVHA 1YTOA 4A7KA 5D63A 6I1BA 3WA1A 2ERMA 1AXMA 2Y9GA 4A7YA 3WO4A 5G00A 4DCKC 4I1BA 1JLXA 3UDAA 1M16A 1W3GA 3OJVA 4QO3A 4KEJA 5E24E 4AN7B 3N7MA 4QKSA 4X3AA 3R4UA 2HZ9A 4KEIA 1BA7A 1JT7A 2QN4A 2LIEA 1A8DA 3Q7XA 2ET2A 4EFQA 4QBVA 4LO1C 3EF2A 1WBAA 3AH1A 3O4CA 3JUTA 1GGPB 2AAIB 2L5XA 5D62A 3FJ9A 1ISYA 4GOYA 5BXSA 3UD7A 4HR6C 3AKFA 5I1BA 1II4A 3B9UA 2UUSA 4HA2A 1DZCA 3BRGC 2VLCA 2NVHA 1XYFA 3BX1C 2BFHA 4ZFUB 1QQLA 3CAHA 1IILA 3FJJA 4OWLA 4I96A 4G9MA 1Q03A 4II0A 1XHBA 5BQUC 1KNMA 31BIA 1I1EA 4D8HA 1WD3A 4I4UA 1V6UA 2Q9XA 4TLPA 4ZOTA 2Z48A 4OEEA 5BVPI 4OWKA 3O3QA 4P0JA 2AFGA 3AZWA 3BA5A 1RY7A 5FZUA 3NBCA 4Q91A 2K43A 2D43A 1SR4A 1XG6A 1AVWB 2F2FC 4QKRA 4P0LA 4J2XA 3HSMA 3Q7WA 4GAFA 4KEKA 4I6IA 1S0BA 3BAGA 3ILAA 1PUMB 4KBBA 3CA6A 2DREA 1UPSA 3FJBA 4Q9GA 1TFMB 3FGMA 4X37A 1PC8B 2Z49A 1HWMB 1SR4C 3PMEA 3V0BA 1G9CA 1IRPA 1ISXA 2GO2A 1WD4A 4IYBA 3E8LC 1AF9A 1ABRB 1BFBA 4IY8A 1G82A 3FJCA 2RQ9A 1IOBA 1RG8A 2VU9A 4ISRA 3CQAA 4FGFA 1DIWA 1BARA 1S0GA 1EYLA 4IQPA 4LO0C 4J2SA 8I1BA 2QYIB 3NBEA 1PZZA 4I4QA 3OJMA 4QD2C 1G9DA 3IM7A 2I1BA 2R9KB 4ENDA 3VUOA 2K4AB 3V0AB 1FV2A 3A21A 4QALA 1TTUA 4P0KA 1NUNA 2KH2A 1HCEA 4LO7B 3S8KA 4IZXA 2FFUA 3O5WB 1TWEA 2IHOA 5HPZA 4L4HA 4F34A 7I1BA 1JT4A 4FVVA 4LO1A 1FWVA 3OGFA 3CA0A 3O44A 2D24A 2RG9B 1L2HA 1R8OA 3AZVA 1MD6A 3FJFA 4ZBVB 1JQZA 4IHZA 3PHZA 4OWJA 4Q9PA 2X2TA 1SZ6B 5JLVA 3NBNA 3LLPA 1BLAA 4CJMA 1Z4SA 4ZKTB 3Q7YA 4I4VA 4JQ0A 3FJAA 2FGFA 4IONA 2Q3NB 4H9WA 2VXRA 2NZ9A 1ONKB 5BQUA 3D7WB 3FJ8A 4ZFYB 3CRHA 3BAVA 3FFZA 5BXPA 1FQ9A 1NZKA 3IIRA 3PG0A 1FGAA 4I4XA 3CRGA 4HJJA 5BP5C 4Z9WB 9ILBA 3BAUA 3ZC8A 1TIEA 1OQLB 3BAHA 1ISZA 2F2FA 4QC4A 1QXMA 2Y9WC 3N0KA 1DFCA 3ZXGA 4EFRA 4ZGRB 3AKIA 4LO2A 4JAWA 4LO8B 5JMCA 1TWMA 5EHAA 2P23A 1ITBA 5FNWA 1PWAA 3FUQA 3ZX7A 3BRFA 4ISQA 1WBCA 3WINA 2DRYA 1BFFA 1QQKA 3O4BA 4LO2C 3F62B 1YYNA 2VSEA 2AXMA 2KLLA 4I3NA 5EG6C 3FJEA 4G9NA 3P53A 2J3PA 5FZYA 2HWMA 3I2AA 3AH4A 3N7KA 3WINC 2BEAA 4I4PA 3OBRA 3IM6A 3RTIB 1DFQA 4GP3A 4ZA3B 3P6JA 3RSJA 4EEEB 3I29B 4IZEA 4LO0A 1EPWA 1V6WA 2XOAA 4XKIA 3T8SA 3AJ5A 5F8YA 1MC9A 1FMMS 1M2TB 3FJIA 3SNVA 5F8WA 3HN1A 4X39A 3QR5A 3VT2A 3NJ5A 4J2KA 1AVAC 2M49A 3R4SA 4IY9A 2ZQOA 4I0YA 5FZZA 3BAOA 2E4MC 1RZOB 3V0AA 2P39A 3A22A 4EFPA 3FJDA 1JT5A 1YF8B 2WRYA 3N7JA 1ISVA 2WBCA 4H04A 2VUAA 3AH2A 1S0FA 1XZZA 1Z0HA 3VEQA 1BFGA 1G9BA 4JKQA 2MC2A 2HW9A 3O4OA 3K1XA 1Q1UA 1DQGA 4R6UB 1CVSA 3POKA 3CRIA 1D0HA 2MLLB 3N7LA 1F31A 1R8NA 3MPPG 3ZC9A 2GZBA 4LO7C 3FJHA 1W3AA 2KKIA 1AVXB 4ZFWB 3UJ4A 4I7IA 3BADA 21BIA 1Z2VA 1DLLA 3WO2A 1HIBA 2ZR1B 3H6RB 4XFUA 4AN6A 2Y9FA 5F90A 2FDBM 1FV3A 1VCLA 5DZUA 4DEPA 1G9AA 1FWUA 1BLDA 3AKHA 3O49A 2VSAA 4J23B 4PC4A 4I1EA 4F83A 3CU1B 3CA3A 1DZDA 3AKGA 5BP5A 3H6SE 5BXRA 4XFSA 3VWCA 4G6MA 2NTDA 3BA7A 2HWAA 4I4SA 3VT0A 3W9TA 4JRAA 3RMXA 2D1ZA 3S8JA 1V6XA 3CA4A 3BRDA 4I4RA 1HWOB 2MIBA 5GAQA 5BOWA 3CA5A 4D0TA 1AVUA 4JKXB 3I2XA 3CA1A 4L4IA 3QYDA 4OW4A 1T9FA 3BB2A 3O4DA 4G1RA 2KI4A 4EKXB 3IM5A 3OJ2A 3H6QA 1HCDA 4GOVA 3MALA 1FN0A 4WBCA 3HOMA 3JRRA 2DS0A 5EC5A 1BASA 3A23A 4ZLBB 2AQZA 1K5VA 3V79C 1ISWA 2NP0A 2VXTI 2BEBA 4JPZA 1S0DA 4USOA 3F1RA 1JY0A 1S0LA 3BTAA 1Q04A 5DUYA 4OEFA 3UD8A 2FFVA 2Y9XE 2RSTA 3VSFA 3FUOA 1TOOA 2KI6B 4LO3A 3TC2A 1HWPB 2D7IA 4I37A 4QBCA 5D61A 1FMZA 5F8SA 2D44A 1TP0A 1ILR1 5FNXA 1RMLA 1EV2A 3UJ0A 3ZXDA 5DSSB 3KMVA 3HMYA 4JP0A 3BAQA 3HBWA 1I1BA 1W3FA 2D7RA 3O4AA 4LO3C 4A7ZA 3UD9A 1JLYA 1E0OA 2LIQA 3PUBA 2D20A 3C9ZA 4G6JA 2IWTB 1DQOA 2DRZA 3P6IA 4GP0A 2E4MA 3OBTA 4GAIA 4I2SA 1BFCA 1HKNA 41BIA 4I4OA 2X2SA 3AJ6A 2YUGA 4DENA 4I8MA 4KC3A 1P63A 4USPA 1IHKA 2K8RA 2F8XC 4EB2B 4XFTA 1EVTA 5BXTA 3VSZA 2ESUA 3WMVA 3RMYA 3IAGC 1AFCA 3NBDA 4OUJA 1JTCA 1S0EA 2ZQNA 4OEGA 1V6VA 3V0BB 1IRAX 1PUUB 3FJKA 4X38A 2D22A 1DJSB 4J2YA 3LTQA 1J0SA 3A07A 1T4QA 1S0CA 3VT1A 1IJTA 1CE7B 4I4YA 4P6AA 4D0ZA 4Z8SB 1IT0A 2NM1A
chains in the Genus database with same CATH superfamily
3OGGA 3RTJB 4YOLA 4QD2B 1YXWA 1K5UA 3WMUA 2NYYA 3H6RA 2D23A 2FO1A 5B2HA 1JT3A 1HWNB 3HALA 3BA4A 3WO3A 1N4KA 1YBIA 5DVHA 1YTOA 4A7KA 5D63A 6I1BA 3WA1A 2ERMA 1AXMA 2Y9GA 4A7YA 3WO4A 5G00A 4DCKC 4I1BA 1JLXA 3UDAA 1M16A 1W3GA 3OJVA 4QO3A 4KEJA 5E24E 4AN7B 3N7MA 4QKSA 4X3AA 3R4UA 2HZ9A 4KEIA 1BA7A 1JT7A 2QN4A 2LIEA 1A8DA 3Q7XA 2ET2A 4EFQA 4QBVA 4LO1C 3EF2A 1WBAA 3AH1A 3O4CA 3JUTA 1GGPB 2AAIB 2L5XA 5D62A 3FJ9A 1ISYA 4GOYA 5BXSA 3UD7A 4HR6C 3AKFA 5I1BA 1II4A 3B9UA 2UUSA 4HA2A 1DZCA 3BRGC 2VLCA 2NVHA 1XYFA 3BX1C 2BFHA 4ZFUB 1QQLA 3CAHA 1IILA 3FJJA 4OWLA 4I96A 4G9MA 1Q03A 4II0A 1XHBA 5BQUC 1KNMA 31BIA 1I1EA 4D8HA 1WD3A 4I4UA 1V6UA 2Q9XA 4TLPA 4ZOTA 2Z48A 4OEEA 5BVPI 4OWKA 3O3QA 4P0JA 2AFGA 3AZWA 3BA5A 1RY7A 5FZUA 3NBCA 4Q91A 2K43A 2D43A 1SR4A 1XG6A 1AVWB 2F2FC 4QKRA 4P0LA 4J2XA 3HSMA 3Q7WA 4GAFA 4KEKA 4I6IA 1S0BA 3BAGA 3ILAA 1PUMB 4KBBA 3CA6A 2DREA 1UPSA 3FJBA 4Q9GA 1TFMB 3FGMA 4X37A 1PC8B 2Z49A 1HWMB 1SR4C 3PMEA 3V0BA 1G9CA 1IRPA 1ISXA 2GO2A 1WD4A 4IYBA 4MZFB 3E8LC 1AF9A 1ABRB 1BFBA 4IY8A 1G82A 3FJCA 2RQ9A 1IOBA 1RG8A 2VU9A 4ISRA 3CQAA 4FGFA 1DIWA 1BARA 1S0GA 1EYLA 4IQPA 4LO0C 4J2SA 8I1BA 2QYIB 3NBEA 1PZZA 4I4QA 3OJMA 4QD2C 1G9DA 3IM7A 2I1BA 2R9KB 4ENDA 3VUOA 2K4AB 3V0AB 1FV2A 3A21A 4QALA 1TTUA 4P0KA 1NUNA 2KH2A 1HCEA 4LO7B 3S8KA 4IZXA 2FFUA 3O5WB 1TWEA 2IHOA 5HPZA 4L4HA 4F34A 7I1BA 1JT4A 4FVVA 4LO1A 1FWVA 3OGFA 3CA0A 3O44A 2D24A 2RG9B 1L2HA 1R8OA 3AZVA 1MD6A 3FJFA 4ZBVB 1JQZA 4IHZA 3PHZA 4OWJA 4Q9PA 2X2TA 1SZ6B 5JLVA 3NBNA 3LLPA 1BLAA 4CJMA 1Z4SA 4ZKTB 3Q7YA 4I4VA 4JQ0A 3FJAA 2FGFA 4IONA 2Q3NB 4H9WA 2VXRA 2NZ9A 1ONKB 5BQUA 3D7WB 3FJ8A 4ZFYB 3CRHA 3BAVA 3FFZA 5BXPA 1FQ9A 1NZKA 3IIRA 3PG0A 1FGAA 4I4XA 3CRGA 4HJJA 5BP5C 4Z9WB 9ILBA 3BAUA 3ZC8A 1TIEA 1OQLB 3BAHA 1ISZA 2F2FA 4QC4A 1QXMA 2Y9WC 3N0KA 1DFCA 3ZXGA 4EFRA 4ZGRB 3AKIA 4LO2A 4JAWA 4LO8B 5JMCA 1TWMA 5EHAA 2P23A 1ITBA 5FNWA 1PWAA 3FUQA 3ZX7A 3BRFA 4ISQA 1WBCA 3WINA 2DRYA 1BFFA 1QQKA 3O4BA 4LO2C 3F62B 1YYNA 2VSEA 2AXMA 2KLLA 4I3NA 5EG6C 3FJEA 4G9NA 3P53A 2J3PA 5FZYA 2HWMA 3I2AA 3AH4A 3N7KA 3WINC 2BEAA 4I4PA 3OBRA 3IM6A 3RTIB 1DFQA 4GP3A 4ZA3B 3P6JA 3RSJA 4EEEB 3I29B 4IZEA 4LO0A 1EPWA 1V6WA 2XOAA 4XKIA 4H75A 3T8SA 3AJ5A 5F8YA 1MC9A 1FMMS 1M2TB 3FJIA 3SNVA 5F8WA 3HN1A 4X39A 3QR5A 3VT2A 3NJ5A 4J2KA 1AVAC 2M49A 3R4SA 4IY9A 2ZQOA 4I0YA 5FZZA 3BAOA 2E4MC 1RZOB 3V0AA 2P39A 3A22A 4EFPA 3FJDA 1JT5A 1YF8B 2WRYA 3N7JA 1ISVA 2WBCA 4H04A 2VUAA 3AH2A 1S0FA 1XZZA 1Z0HA 3VEQA 1BFGA 1G9BA 4JKQA 2MC2A 2HW9A 3O4OA 4MZHA 3K1XA 1Q1UA 1DQGA 4R6UB 1CVSA 3POKA 3CRIA 1D0HA 2MLLB 3N7LA 1F31A 1R8NA 3MPPG 3ZC9A 2GZBA 4LO7C 3FJHA 1W3AA 2KKIA 1AVXB 4ZFWB 3UJ4A 4I7IA 3BADA 21BIA 1Z2VA 1DLLA 3WO2A 1HIBA 2ZR1B 3H6RB 4XFUA 4AN6A 2Y9FA 5F90A 2FDBM 1FV3A 1VCLA 5DZUA 4DEPA 1G9AA 1FWUA 1BLDA 3AKHA 3O49A 2VSAA 4J23B 4PC4A 4I1EA 4F83A 3CU1B 3CA3A 1DZDA 3AKGA 5BP5A 3H6SE 5BXRA 4XFSA 3VWCA 4G6MA 2NTDA 3BA7A 2HWAA 4I4SA 3VT0A 3W9TA 4JRAA 3RMXA 2D1ZA 3S8JA 1V6XA 3CA4A 3BRDA 4I4RA 1HWOB 2MIBA 5GAQA 5BOWA 3CA5A 4D0TA 1AVUA 4JKXB 3I2XA 3CA1A 4L4IA 3QYDA 4OW4A 1T9FA 3BB2A 3O4DA 4G1RA 2KI4A 4EKXB 3IM5A 3OJ2A 3H6QA 1HCDA 4GOVA 3MALA 1FN0A 4WBCA 3HOMA 3JRRA 2DS0A 5EC5A 1BASA 3A23A 4ZLBB 2AQZA 1K5VA 3V79C 1ISWA 2NP0A 2VXTI 2BEBA 4JPZA 1S0DA 4USOA 3F1RA 1JY0A 1S0LA 3BTAA 1Q04A 5DUYA 4OEFA 3UD8A 2FFVA 2Y9XE 2RSTA 3VSFA 3FUOA 1TOOA 2KI6B 4LO3A 3TC2A 1HWPB 2D7IA 4I37A 4QBCA 5D61A 1FMZA 5F8SA 2D44A 1TP0A 1ILR1 5FNXA 1RMLA 1EV2A 3UJ0A 3ZXDA 5DSSB 3KMVA 3HMYA 4JP0A 3BAQA 3HBWA 1I1BA 1W3FA 2D7RA 3O4AA 4LO3C 4A7ZA 3UD9A 1JLYA 1E0OA 2LIQA 3PUBA 2D20A 3C9ZA 4G6JA 2IWTB 4MZGB 1DQOA 2DRZA 3P6IA 4GP0A 2E4MA 3OBTA 4GAIA 4I2SA 1BFCA 1HKNA 41BIA 4I4OA 2X2SA 3AJ6A 2NS2A 2YUGA 4DENA 4I8MA 4KC3A 1P63A 4USPA 1IHKA 2K8RA 2F8XC 4EB2B 4XFTA 1EVTA 5BXTA 3VSZA 2ESUA 3WMVA 3RMYA 3IAGC 1AFCA 3NBDA 4OUJA 4UY4A 1JTCA 1S0EA 2ZQNA 4OEGA 1V6VA 3V0BB 1IRAX 1PUUB 3FJKA 4X38A 2D22A 1DJSB 4J2YA 3LTQA 1J0SA 3A07A 1T4QA 1S0CA 3VT1A 1IJTA 1CE7B 4I4YA 4P6AA 4D0ZA 4Z8SB 1IT0A 2NM1A
chains in the Genus database with same CATH topology
3OGGA 3RTJB 4YOLA 4QD2B 1YXWA 1K5UA 3WMUA 2NYYA 3H6RA 2D23A 2FO1A 5B2HA 1JT3A 1HWNB 3HALA 3BA4A 3WO3A 1N4KA 1YBIA 5DVHA 1YTOA 4A7KA 5D63A 6I1BA 3WA1A 2ERMA 1AXMA 2Y9GA 4A7YA 3WO4A 5G00A 4DCKC 4I1BA 1JLXA 3UDAA 1M16A 1W3GA 3OJVA 4QO3A 4KEJA 5E24E 4AN7B 3N7MA 4QKSA 4X3AA 3R4UA 2HZ9A 4KEIA 1BA7A 1JT7A 2QN4A 2LIEA 1A8DA 3Q7XA 2ET2A 4EFQA 4QBVA 4LO1C 3EF2A 1WBAA 3AH1A 3O4CA 3JUTA 1GGPB 2AAIB 2L5XA 5D62A 3FJ9A 1ISYA 4GOYA 5BXSA 3UD7A 4HR6C 3AKFA 5I1BA 1II4A 3B9UA 2UUSA 4HA2A 1DZCA 3BRGC 2VLCA 2NVHA 1XYFA 3BX1C 2BFHA 4ZFUB 1QQLA 3CAHA 1IILA 3FJJA 4OWLA 4I96A 4G9MA 1Q03A 4II0A 1XHBA 5BQUC 1KNMA 31BIA 1I1EA 4D8HA 1WD3A 4I4UA 1V6UA 2Q9XA 4TLPA 4ZOTA 2Z48A 4OEEA 5BVPI 4OWKA 3O3QA 4P0JA 2AFGA 3AZWA 3BA5A 1RY7A 5FZUA 3NBCA 4Q91A 2K43A 2D43A 1SR4A 1XG6A 1AVWB 2F2FC 4QKRA 4P0LA 4J2XA 3HSMA 3Q7WA 4GAFA 4KEKA 4I6IA 1S0BA 3BAGA 3ILAA 1PUMB 4KBBA 3CA6A 2DREA 1UPSA 3FJBA 4Q9GA 1TFMB 3FGMA 4X37A 1PC8B 2Z49A 1HWMB 1SR4C 3PMEA 3V0BA 1G9CA 1IRPA 1ISXA 2GO2A 1WD4A 4IYBA 4MZFB 3E8LC 1AF9A 1ABRB 1BFBA 4IY8A 1G82A 3FJCA 2RQ9A 1IOBA 1RG8A 2VU9A 4ISRA 3CQAA 4FGFA 1DIWA 1BARA 1S0GA 1EYLA 4IQPA 4LO0C 4J2SA 8I1BA 2QYIB 3NBEA 1PZZA 4I4QA 3OJMA 4QD2C 1G9DA 3IM7A 2I1BA 2R9KB 4ENDA 3VUOA 2K4AB 3V0AB 1FV2A 3A21A 4QALA 1TTUA 4P0KA 1NUNA 2KH2A 1HCEA 4LO7B 3S8KA 4IZXA 2FFUA 3O5WB 1TWEA 2IHOA 5HPZA 4L4HA 4F34A 7I1BA 1JT4A 4FVVA 4LO1A 1FWVA 3OGFA 3CA0A 3O44A 2D24A 2RG9B 1L2HA 1R8OA 3AZVA 1MD6A 3FJFA 4ZBVB 1JQZA 4IHZA 3PHZA 4OWJA 4Q9PA 2X2TA 1SZ6B 5JLVA 3NBNA 3LLPA 1BLAA 4CJMA 1Z4SA 4ZKTB 3Q7YA 4I4VA 4JQ0A 3FJAA 2FGFA 4IONA 2Q3NB 4H9WA 2VXRA 2NZ9A 1ONKB 5BQUA 3D7WB 3FJ8A 4ZFYB 3CRHA 3BAVA 3FFZA 5BXPA 1FQ9A 1NZKA 3IIRA 3PG0A 1FGAA 4I4XA 3CRGA 4HJJA 5BP5C 4Z9WB 9ILBA 3BAUA 3ZC8A 1TIEA 1OQLB 3BAHA 1ISZA 2F2FA 4QC4A 1QXMA 2Y9WC 3N0KA 1DFCA 3ZXGA 4EFRA 4ZGRB 3AKIA 4LO2A 4JAWA 4LO8B 5JMCA 1TWMA 5EHAA 2P23A 1ITBA 5FNWA 1PWAA 3FUQA 3ZX7A 3BRFA 4ISQA 1WBCA 3WINA 2DRYA 1BFFA 1QQKA 3O4BA 4LO2C 3F62B 1YYNA 2VSEA 2AXMA 2KLLA 4I3NA 5EG6C 3FJEA 4G9NA 3P53A 2J3PA 5FZYA 2HWMA 3I2AA 3AH4A 3N7KA 3WINC 2BEAA 4I4PA 3OBRA 3IM6A 3RTIB 1DFQA 4GP3A 4ZA3B 3P6JA 3RSJA 4EEEB 3I29B 4IZEA 4LO0A 1EPWA 1V6WA 2XOAA 4XKIA 4H75A 3T8SA 3AJ5A 5F8YA 1MC9A 1FMMS 1M2TB 3FJIA 3SNVA 5F8WA 3HN1A 4X39A 3QR5A 3VT2A 3NJ5A 4J2KA 1AVAC 2M49A 3R4SA 4IY9A 2ZQOA 4I0YA 5FZZA 3BAOA 2E4MC 1RZOB 3V0AA 2P39A 3A22A 4EFPA 3FJDA 1JT5A 1YF8B 2WRYA 3N7JA 1ISVA 2WBCA 4H04A 2VUAA 3AH2A 1S0FA 1XZZA 1Z0HA 3VEQA 1BFGA 1G9BA 4JKQA 2MC2A 2HW9A 3O4OA 4MZHA 3K1XA 1Q1UA 1DQGA 4R6UB 1CVSA 3POKA 3CRIA 1D0HA 2MLLB 3N7LA 1F31A 1R8NA 3MPPG 3ZC9A 2GZBA 4LO7C 3FJHA 1W3AA 2KKIA 1AVXB 4ZFWB 3UJ4A 4I7IA 3BADA 21BIA 1Z2VA 1DLLA 3WO2A 1HIBA 2ZR1B 3H6RB 4XFUA 4AN6A 2Y9FA 5F90A 2FDBM 1FV3A 1VCLA 5DZUA 4DEPA 1G9AA 1FWUA 1BLDA 3AKHA 3O49A 2VSAA 4J23B 4PC4A 4I1EA 4F83A 3CU1B 3CA3A 1DZDA 3AKGA 5BP5A 3H6SE 5BXRA 4XFSA 3VWCA 4G6MA 2NTDA 3BA7A 2HWAA 4I4SA 3VT0A 3W9TA 4JRAA 3RMXA 2D1ZA 3S8JA 1V6XA 3CA4A 3BRDA 4I4RA 1HWOB 2MIBA 5GAQA 5BOWA 3CA5A 4D0TA 1AVUA 4JKXB 3I2XA 3CA1A 4L4IA 3QYDA 4OW4A 1T9FA 3BB2A 3O4DA 4G1RA 2KI4A 4EKXB 3IM5A 3OJ2A 3H6QA 1HCDA 4GOVA 3MALA 1FN0A 4WBCA 3HOMA 3JRRA 2DS0A 5EC5A 1BASA 3A23A 4ZLBB 2AQZA 1K5VA 3V79C 1ISWA 2NP0A 2VXTI 2BEBA 4JPZA 1S0DA 4USOA 3F1RA 1JY0A 1S0LA 3BTAA 1Q04A 5DUYA 4OEFA 3UD8A 2FFVA 2Y9XE 2RSTA 3VSFA 3FUOA 1TOOA 2KI6B 4LO3A 3TC2A 1HWPB 2D7IA 4I37A 4QBCA 5D61A 1FMZA 5F8SA 2D44A 1TP0A 1ILR1 5FNXA 1RMLA 1EV2A 3UJ0A 3ZXDA 5DSSB 3KMVA 3HMYA 4JP0A 3BAQA 3HBWA 1I1BA 1W3FA 2D7RA 3O4AA 4LO3C 4A7ZA 3UD9A 1JLYA 1E0OA 2LIQA 3PUBA 2D20A 3C9ZA 4G6JA 2IWTB 4MZGB 1DQOA 2DRZA 3P6IA 4GP0A 2E4MA 3OBTA 4GAIA 4I2SA 1BFCA 1HKNA 41BIA 4I4OA 2X2SA 3AJ6A 2NS2A 2YUGA 4DENA 4I8MA 4KC3A 1P63A 4USPA 1IHKA 2K8RA 2F8XC 4EB2B 4XFTA 1EVTA 5BXTA 3VSZA 2ESUA 3WMVA 3RMYA 3IAGC 1AFCA 3NBDA 4OUJA 4UY4A 1JTCA 1S0EA 2ZQNA 4OEGA 1V6VA 3V0BB 1IRAX 1PUUB 3FJKA 4X38A 2D22A 1DJSB 4J2YA 3LTQA 1J0SA 3A07A 1T4QA 1S0CA 3VT1A 1IJTA 1CE7B 4I4YA 4P6AA 4D0ZA 4Z8SB 1IT0A 2NM1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OGG A;  3RTJ B;  4YOL A;  4QD2 B;  1YXW A;  1K5U A;  3WMU A;  2NYY A;  3H6R A;  2D23 A;  2FO1 A;  5B2H A;  1JT3 A;  1HWN B;  3HAL A;  3BA4 A;  3WO3 A;  1N4K A;  1YBI A;  5DVH A;  1YTO A;  4A7K A;  5D63 A;  6I1B A;  3WA1 A;  2ERM A;  1AXM A;  2Y9G A;  4A7Y A;  3WO4 A;  5G00 A;  4DCK C;  4I1B A;  1JLX A;  3UDA A;  1M16 A;  1W3G A;  3OJV A;  4QO3 A;  4KEJ A;  5E24 E;  4AN7 B;  3N7M A;  4QKS A;  4X3A A;  3R4U A;  2HZ9 A;  4KEI A;  1BA7 A;  1JT7 A;  2QN4 A;  2LIE A;  1A8D A;  3Q7X A;  2ET2 A;  4EFQ A;  4QBV A;  4LO1 C;  3EF2 A;  1WBA A;  3AH1 A;  3O4C A;  3JUT A;  1GGP B;  2AAI B;  2L5X A;  5D62 A;  3FJ9 A;  1ISY A;  4GOY A;  5BXS A;  3UD7 A;  4HR6 C;  3AKF A;  5I1B A;  1II4 A;  3B9U A;  2UUS A;  4HA2 A;  1DZC A;  3BRG C;  2VLC A;  2NVH A;  1XYF A;  3BX1 C;  2BFH A;  4ZFU B;  1QQL A;  3CAH A;  1IIL A;  3FJJ A;  4OWL A;  4I96 A;  4G9M A;  1Q03 A;  4II0 A;  1XHB A;  5BQU C;  1KNM A;  31BI A;  1I1E A;  4D8H A;  1WD3 A;  4I4U A;  1V6U A;  2Q9X A;  4TLP A;  4ZOT A;  2Z48 A;  4OEE A;  5BVP I;  4OWK A;  3O3Q A;  4P0J A;  2AFG A;  3AZW A;  3BA5 A;  1RY7 A;  5FZU A;  3NBC A;  4Q91 A;  2K43 A;  2D43 A;  1SR4 A;  1XG6 A;  1AVW B;  2F2F C;  4QKR A;  4P0L A;  4J2X A;  3HSM A;  3Q7W A;  4GAF A;  4KEK A;  4I6I A;  1S0B A;  3BAG A;  3ILA A;  1PUM B;  4KBB A;  3CA6 A;  2DRE A;  1UPS A;  3FJB A;  4Q9G A;  1TFM B;  3FGM A;  4X37 A;  1PC8 B;  2Z49 A;  1HWM B;  1SR4 C;  3PME A;  3V0B A;  1G9C A;  1IRP A;  1ISX A;  2GO2 A;  1WD4 A;  4IYB A;  3E8L C;  1AF9 A;  1ABR B;  1BFB A;  4IY8 A;  1G82 A;  3FJC A;  2RQ9 A;  1IOB A;  1RG8 A;  2VU9 A;  4ISR A;  3CQA A;  4FGF A;  1DIW A;  1BAR A;  1S0G A;  1EYL A;  4IQP A;  4LO0 C;  4J2S A;  8I1B A;  2QYI B;  3NBE A;  1PZZ A;  4I4Q A;  3OJM A;  4QD2 C;  1G9D A;  3IM7 A;  2I1B A;  2R9K B;  4END A;  3VUO A;  2K4A B;  3V0A B;  1FV2 A;  3A21 A;  4QAL A;  1TTU A;  4P0K A;  1NUN A;  2KH2 A;  1HCE A;  4LO7 B;  3S8K A;  4IZX A;  2FFU A;  3O5W B;  1TWE A;  2IHO A;  5HPZ A;  4L4H A;  4F34 A;  7I1B A;  1JT4 A;  4FVV A;  4LO1 A;  1FWV A;  3OGF A;  3CA0 A;  3O44 A;  2D24 A;  2RG9 B;  1L2H A;  1R8O A;  3AZV A;  1MD6 A;  3FJF A;  4ZBV B;  1JQZ A;  4IHZ A;  3PHZ A;  4OWJ A;  4Q9P A;  2X2T A;  1SZ6 B;  5JLV A;  3NBN A;  3LLP A;  1BLA A;  4CJM A;  1Z4S A;  4ZKT B;  3Q7Y A;  4I4V A;  4JQ0 A;  3FJA A;  2FGF A;  4ION A;  2Q3N B;  4H9W A;  2VXR A;  2NZ9 A;  1ONK B;  5BQU A;  3D7W B;  3FJ8 A;  4ZFY B;  3CRH A;  3BAV A;  3FFZ A;  5BXP A;  1FQ9 A;  1NZK A;  3IIR A;  3PG0 A;  1FGA A;  4I4X A;  3CRG A;  4HJJ A;  5BP5 C;  4Z9W B;  9ILB A;  3BAU A;  3ZC8 A;  1TIE A;  1OQL B;  3BAH A;  1ISZ A;  2F2F A;  4QC4 A;  1QXM A;  2Y9W C;  3N0K A;  1DFC A;  3ZXG A;  4EFR A;  4ZGR B;  3AKI A;  4LO2 A;  4JAW A;  4LO8 B;  5JMC A;  1TWM A;  5EHA A;  2P23 A;  1ITB A;  5FNW A;  1PWA A;  3FUQ A;  3ZX7 A;  3BRF A;  4ISQ A;  1WBC A;  3WIN A;  2DRY A;  1BFF A;  1QQK A;  3O4B A;  4LO2 C;  3F62 B;  1YYN A;  2VSE A;  2AXM A;  2KLL A;  4I3N A;  5EG6 C;  3FJE A;  4G9N A;  3P53 A;  2J3P A;  5FZY A;  2HWM A;  3I2A A;  3AH4 A;  3N7K A;  3WIN C;  2BEA A;  4I4P A;  3OBR A;  3IM6 A;  3RTI B;  1DFQ A;  4GP3 A;  4ZA3 B;  3P6J A;  3RSJ A;  4EEE B;  3I29 B;  4IZE A;  4LO0 A;  1EPW A;  1V6W A;  2XOA A;  4XKI A;  3T8S A;  3AJ5 A;  5F8Y A;  1MC9 A;  1FMM S;  1M2T B;  3FJI A;  3SNV A;  5F8W A;  3HN1 A;  4X39 A;  3QR5 A;  3VT2 A;  3NJ5 A;  4J2K A;  1AVA C;  2M49 A;  3R4S A;  4IY9 A;  2ZQO A;  4I0Y A;  5FZZ A;  3BAO A;  2E4M C;  1RZO B;  3V0A A;  2P39 A;  3A22 A;  4EFP A;  3FJD A;  1JT5 A;  1YF8 B;  2WRY A;  3N7J A;  1ISV A;  2WBC A;  4H04 A;  2VUA A;  3AH2 A;  1S0F A;  1XZZ A;  1Z0H A;  3VEQ A;  1BFG A;  1G9B A;  4JKQ A;  2MC2 A;  2HW9 A;  3O4O A;  3K1X A;  1Q1U A;  1DQG A;  4R6U B;  1CVS A;  3POK A;  3CRI A;  1D0H A;  2MLL B;  3N7L A;  1F31 A;  1R8N A;  3MPP G;  3ZC9 A;  2GZB A;  4LO7 C;  3FJH A;  1W3A A;  2KKI A;  1AVX B;  4ZFW B;  3UJ4 A;  4I7I A;  3BAD A;  21BI A;  1Z2V A;  1DLL A;  3WO2 A;  1HIB A;  2ZR1 B;  3H6R B;  4XFU A;  4AN6 A;  2Y9F A;  5F90 A;  2FDB M;  1FV3 A;  1VCL A;  5DZU A;  4DEP A;  1G9A A;  1FWU A;  1BLD A;  3AKH A;  3O49 A;  2VSA A;  4J23 B;  4PC4 A;  4I1E A;  4F83 A;  3CU1 B;  3CA3 A;  1DZD A;  3AKG A;  5BP5 A;  3H6S E;  5BXR A;  4XFS A;  3VWC A;  4G6M A;  2NTD A;  3BA7 A;  2HWA A;  4I4S A;  3VT0 A;  3W9T A;  4JRA A;  3RMX A;  2D1Z A;  3S8J A;  1V6X A;  3CA4 A;  3BRD A;  4I4R A;  1HWO B;  2MIB A;  5GAQ A;  5BOW A;  3CA5 A;  4D0T A;  1AVU A;  4JKX B;  3I2X A;  3CA1 A;  4L4I A;  3QYD A;  4OW4 A;  1T9F A;  3BB2 A;  3O4D A;  4G1R A;  2KI4 A;  4EKX B;  3IM5 A;  3OJ2 A;  3H6Q A;  1HCD A;  4GOV A;  3MAL A;  1FN0 A;  4WBC A;  3HOM A;  3JRR A;  2DS0 A;  5EC5 A;  1BAS A;  3A23 A;  4ZLB B;  2AQZ A;  1K5V A;  3V79 C;  1ISW A;  2NP0 A;  2VXT I;  2BEB A;  4JPZ A;  1S0D A;  4USO A;  3F1R A;  1JY0 A;  1S0L A;  3BTA A;  1Q04 A;  5DUY A;  4OEF A;  3UD8 A;  2FFV A;  2Y9X E;  2RST A;  3VSF A;  3FUO A;  1TOO A;  2KI6 B;  4LO3 A;  3TC2 A;  1HWP B;  2D7I A;  4I37 A;  4QBC A;  5D61 A;  1FMZ A;  5F8S A;  2D44 A;  1TP0 A;  1ILR 1;  5FNX A;  1RML A;  1EV2 A;  3UJ0 A;  3ZXD A;  5DSS B;  3KMV A;  3HMY A;  4JP0 A;  3BAQ A;  3HBW A;  1I1B A;  1W3F A;  2D7R A;  3O4A A;  4LO3 C;  4A7Z A;  3UD9 A;  1JLY A;  1E0O A;  2LIQ A;  3PUB A;  2D20 A;  3C9Z A;  4G6J A;  2IWT B;  1DQO A;  2DRZ A;  3P6I A;  4GP0 A;  2E4M A;  3OBT A;  4GAI A;  4I2S A;  1BFC A;  1HKN A;  41BI A;  4I4O A;  2X2S A;  3AJ6 A;  2YUG A;  4DEN A;  4I8M A;  4KC3 A;  1P63 A;  4USP A;  1IHK A;  2K8R A;  2F8X C;  4EB2 B;  4XFT A;  1EVT A;  5BXT A;  3VSZ A;  2ESU A;  3WMV A;  3RMY A;  3IAG C;  1AFC A;  3NBD A;  4OUJ A;  1JTC A;  1S0E A;  2ZQN A;  4OEG A;  1V6V A;  3V0B B;  1IRA X;  1PUU B;  3FJK A;  4X38 A;  2D22 A;  1DJS B;  4J2Y A;  3LTQ A;  1J0S A;  3A07 A;  1T4Q A;  1S0C A;  3VT1 A;  1IJT A;  1CE7 B;  4I4Y A;  4P6A A;  4D0Z A;  4Z8S B;  1IT0 A;  2NM1 A; 
#chains in the Genus database with same CATH topology
 3OGG A;  3RTJ B;  4YOL A;  4QD2 B;  1YXW A;  1K5U A;  3WMU A;  2NYY A;  3H6R A;  2D23 A;  2FO1 A;  5B2H A;  1JT3 A;  1HWN B;  3HAL A;  3BA4 A;  3WO3 A;  1N4K A;  1YBI A;  5DVH A;  1YTO A;  4A7K A;  5D63 A;  6I1B A;  3WA1 A;  2ERM A;  1AXM A;  2Y9G A;  4A7Y A;  3WO4 A;  5G00 A;  4DCK C;  4I1B A;  1JLX A;  3UDA A;  1M16 A;  1W3G A;  3OJV A;  4QO3 A;  4KEJ A;  5E24 E;  4AN7 B;  3N7M A;  4QKS A;  4X3A A;  3R4U A;  2HZ9 A;  4KEI A;  1BA7 A;  1JT7 A;  2QN4 A;  2LIE A;  1A8D A;  3Q7X A;  2ET2 A;  4EFQ A;  4QBV A;  4LO1 C;  3EF2 A;  1WBA A;  3AH1 A;  3O4C A;  3JUT A;  1GGP B;  2AAI B;  2L5X A;  5D62 A;  3FJ9 A;  1ISY A;  4GOY A;  5BXS A;  3UD7 A;  4HR6 C;  3AKF A;  5I1B A;  1II4 A;  3B9U A;  2UUS A;  4HA2 A;  1DZC A;  3BRG C;  2VLC A;  2NVH A;  1XYF A;  3BX1 C;  2BFH A;  4ZFU B;  1QQL A;  3CAH A;  1IIL A;  3FJJ A;  4OWL A;  4I96 A;  4G9M A;  1Q03 A;  4II0 A;  1XHB A;  5BQU C;  1KNM A;  31BI A;  1I1E A;  4D8H A;  1WD3 A;  4I4U A;  1V6U A;  2Q9X A;  4TLP A;  4ZOT A;  2Z48 A;  4OEE A;  5BVP I;  4OWK A;  3O3Q A;  4P0J A;  2AFG A;  3AZW A;  3BA5 A;  1RY7 A;  5FZU A;  3NBC A;  4Q91 A;  2K43 A;  2D43 A;  1SR4 A;  1XG6 A;  1AVW B;  2F2F C;  4QKR A;  4P0L A;  4J2X A;  3HSM A;  3Q7W A;  4GAF A;  4KEK A;  4I6I A;  1S0B A;  3BAG A;  3ILA A;  1PUM B;  4KBB A;  3CA6 A;  2DRE A;  1UPS A;  3FJB A;  4Q9G A;  1TFM B;  3FGM A;  4X37 A;  1PC8 B;  2Z49 A;  1HWM B;  1SR4 C;  3PME A;  3V0B A;  1G9C A;  1IRP A;  1ISX A;  2GO2 A;  1WD4 A;  4IYB A;  4MZF B;  3E8L C;  1AF9 A;  1ABR B;  1BFB A;  4IY8 A;  1G82 A;  3FJC A;  2RQ9 A;  1IOB A;  1RG8 A;  2VU9 A;  4ISR A;  3CQA A;  4FGF A;  1DIW A;  1BAR A;  1S0G A;  1EYL A;  4IQP A;  4LO0 C;  4J2S A;  8I1B A;  2QYI B;  3NBE A;  1PZZ A;  4I4Q A;  3OJM A;  4QD2 C;  1G9D A;  3IM7 A;  2I1B A;  2R9K B;  4END A;  3VUO A;  2K4A B;  3V0A B;  1FV2 A;  3A21 A;  4QAL A;  1TTU A;  4P0K A;  1NUN A;  2KH2 A;  1HCE A;  4LO7 B;  3S8K A;  4IZX A;  2FFU A;  3O5W B;  1TWE A;  2IHO A;  5HPZ A;  4L4H A;  4F34 A;  7I1B A;  1JT4 A;  4FVV A;  4LO1 A;  1FWV A;  3OGF A;  3CA0 A;  3O44 A;  2D24 A;  2RG9 B;  1L2H A;  1R8O A;  3AZV A;  1MD6 A;  3FJF A;  4ZBV B;  1JQZ A;  4IHZ A;  3PHZ A;  4OWJ A;  4Q9P A;  2X2T A;  1SZ6 B;  5JLV A;  3NBN A;  3LLP A;  1BLA A;  4CJM A;  1Z4S A;  4ZKT B;  3Q7Y A;  4I4V A;  4JQ0 A;  3FJA A;  2FGF A;  4ION A;  2Q3N B;  4H9W A;  2VXR A;  2NZ9 A;  1ONK B;  5BQU A;  3D7W B;  3FJ8 A;  4ZFY B;  3CRH A;  3BAV A;  3FFZ A;  5BXP A;  1FQ9 A;  1NZK A;  3IIR A;  3PG0 A;  1FGA A;  4I4X A;  3CRG A;  4HJJ A;  5BP5 C;  4Z9W B;  9ILB A;  3BAU A;  3ZC8 A;  1TIE A;  1OQL B;  3BAH A;  1ISZ A;  2F2F A;  4QC4 A;  1QXM A;  2Y9W C;  3N0K A;  1DFC A;  3ZXG A;  4EFR A;  4ZGR B;  3AKI A;  4LO2 A;  4JAW A;  4LO8 B;  5JMC A;  1TWM A;  5EHA A;  2P23 A;  1ITB A;  5FNW A;  1PWA A;  3FUQ A;  3ZX7 A;  3BRF A;  4ISQ A;  1WBC A;  3WIN A;  2DRY A;  1BFF A;  1QQK A;  3O4B A;  4LO2 C;  3F62 B;  1YYN A;  2VSE A;  2AXM A;  2KLL A;  4I3N A;  5EG6 C;  3FJE A;  4G9N A;  3P53 A;  2J3P A;  5FZY A;  2HWM A;  3I2A A;  3AH4 A;  3N7K A;  3WIN C;  2BEA A;  4I4P A;  3OBR A;  3IM6 A;  3RTI B;  1DFQ A;  4GP3 A;  4ZA3 B;  3P6J A;  3RSJ A;  4EEE B;  3I29 B;  4IZE A;  4LO0 A;  1EPW A;  1V6W A;  2XOA A;  4XKI A;  4H75 A;  3T8S A;  3AJ5 A;  5F8Y A;  1MC9 A;  1FMM S;  1M2T B;  3FJI A;  3SNV A;  5F8W A;  3HN1 A;  4X39 A;  3QR5 A;  3VT2 A;  3NJ5 A;  4J2K A;  1AVA C;  2M49 A;  3R4S A;  4IY9 A;  2ZQO A;  4I0Y A;  5FZZ A;  3BAO A;  2E4M C;  1RZO B;  3V0A A;  2P39 A;  3A22 A;  4EFP A;  3FJD A;  1JT5 A;  1YF8 B;  2WRY A;  3N7J A;  1ISV A;  2WBC A;  4H04 A;  2VUA A;  3AH2 A;  1S0F A;  1XZZ A;  1Z0H A;  3VEQ A;  1BFG A;  1G9B A;  4JKQ A;  2MC2 A;  2HW9 A;  3O4O A;  4MZH A;  3K1X A;  1Q1U A;  1DQG A;  4R6U B;  1CVS A;  3POK A;  3CRI A;  1D0H A;  2MLL B;  3N7L A;  1F31 A;  1R8N A;  3MPP G;  3ZC9 A;  2GZB A;  4LO7 C;  3FJH A;  1W3A A;  2KKI A;  1AVX B;  4ZFW B;  3UJ4 A;  4I7I A;  3BAD A;  21BI A;  1Z2V A;  1DLL A;  3WO2 A;  1HIB A;  2ZR1 B;  3H6R B;  4XFU A;  4AN6 A;  2Y9F A;  5F90 A;  2FDB M;  1FV3 A;  1VCL A;  5DZU A;  4DEP A;  1G9A A;  1FWU A;  1BLD A;  3AKH A;  3O49 A;  2VSA A;  4J23 B;  4PC4 A;  4I1E A;  4F83 A;  3CU1 B;  3CA3 A;  1DZD A;  3AKG A;  5BP5 A;  3H6S E;  5BXR A;  4XFS A;  3VWC A;  4G6M A;  2NTD A;  3BA7 A;  2HWA A;  4I4S A;  3VT0 A;  3W9T A;  4JRA A;  3RMX A;  2D1Z A;  3S8J A;  1V6X A;  3CA4 A;  3BRD A;  4I4R A;  1HWO B;  2MIB A;  5GAQ A;  5BOW A;  3CA5 A;  4D0T A;  1AVU A;  4JKX B;  3I2X A;  3CA1 A;  4L4I A;  3QYD A;  4OW4 A;  1T9F A;  3BB2 A;  3O4D A;  4G1R A;  2KI4 A;  4EKX B;  3IM5 A;  3OJ2 A;  3H6Q A;  1HCD A;  4GOV A;  3MAL A;  1FN0 A;  4WBC A;  3HOM A;  3JRR A;  2DS0 A;  5EC5 A;  1BAS A;  3A23 A;  4ZLB B;  2AQZ A;  1K5V A;  3V79 C;  1ISW A;  2NP0 A;  2VXT I;  2BEB A;  4JPZ A;  1S0D A;  4USO A;  3F1R A;  1JY0 A;  1S0L A;  3BTA A;  1Q04 A;  5DUY A;  4OEF A;  3UD8 A;  2FFV A;  2Y9X E;  2RST A;  3VSF A;  3FUO A;  1TOO A;  2KI6 B;  4LO3 A;  3TC2 A;  1HWP B;  2D7I A;  4I37 A;  4QBC A;  5D61 A;  1FMZ A;  5F8S A;  2D44 A;  1TP0 A;  1ILR 1;  5FNX A;  1RML A;  1EV2 A;  3UJ0 A;  3ZXD A;  5DSS B;  3KMV A;  3HMY A;  4JP0 A;  3BAQ A;  3HBW A;  1I1B A;  1W3F A;  2D7R A;  3O4A A;  4LO3 C;  4A7Z A;  3UD9 A;  1JLY A;  1E0O A;  2LIQ A;  3PUB A;  2D20 A;  3C9Z A;  4G6J A;  2IWT B;  4MZG B;  1DQO A;  2DRZ A;  3P6I A;  4GP0 A;  2E4M A;  3OBT A;  4GAI A;  4I2S A;  1BFC A;  1HKN A;  41BI A;  4I4O A;  2X2S A;  3AJ6 A;  2NS2 A;  2YUG A;  4DEN A;  4I8M A;  4KC3 A;  1P63 A;  4USP A;  1IHK A;  2K8R A;  2F8X C;  4EB2 B;  4XFT A;  1EVT A;  5BXT A;  3VSZ A;  2ESU A;  3WMV A;  3RMY A;  3IAG C;  1AFC A;  3NBD A;  4OUJ A;  4UY4 A;  1JTC A;  1S0E A;  2ZQN A;  4OEG A;  1V6V A;  3V0B B;  1IRA X;  1PUU B;  3FJK A;  4X38 A;  2D22 A;  1DJS B;  4J2Y A;  3LTQ A;  1J0S A;  3A07 A;  1T4Q A;  1S0C A;  3VT1 A;  1IJT A;  1CE7 B;  4I4Y A;  4P6A A;  4D0Z A;  4Z8S B;  1IT0 A;  2NM1 A; 
#chains in the Genus database with same CATH homology
 3OGG A;  3RTJ B;  4YOL A;  4QD2 B;  1YXW A;  1K5U A;  3WMU A;  2NYY A;  3H6R A;  2D23 A;  2FO1 A;  5B2H A;  1JT3 A;  1HWN B;  3HAL A;  3BA4 A;  3WO3 A;  1N4K A;  1YBI A;  5DVH A;  1YTO A;  4A7K A;  5D63 A;  6I1B A;  3WA1 A;  2ERM A;  1AXM A;  2Y9G A;  4A7Y A;  3WO4 A;  5G00 A;  4DCK C;  4I1B A;  1JLX A;  3UDA A;  1M16 A;  1W3G A;  3OJV A;  4QO3 A;  4KEJ A;  5E24 E;  4AN7 B;  3N7M A;  4QKS A;  4X3A A;  3R4U A;  2HZ9 A;  4KEI A;  1BA7 A;  1JT7 A;  2QN4 A;  2LIE A;  1A8D A;  3Q7X A;  2ET2 A;  4EFQ A;  4QBV A;  4LO1 C;  3EF2 A;  1WBA A;  3AH1 A;  3O4C A;  3JUT A;  1GGP B;  2AAI B;  2L5X A;  5D62 A;  3FJ9 A;  1ISY A;  4GOY A;  5BXS A;  3UD7 A;  4HR6 C;  3AKF A;  5I1B A;  1II4 A;  3B9U A;  2UUS A;  4HA2 A;  1DZC A;  3BRG C;  2VLC A;  2NVH A;  1XYF A;  3BX1 C;  2BFH A;  4ZFU B;  1QQL A;  3CAH A;  1IIL A;  3FJJ A;  4OWL A;  4I96 A;  4G9M A;  1Q03 A;  4II0 A;  1XHB A;  5BQU C;  1KNM A;  31BI A;  1I1E A;  4D8H A;  1WD3 A;  4I4U A;  1V6U A;  2Q9X A;  4TLP A;  4ZOT A;  2Z48 A;  4OEE A;  5BVP I;  4OWK A;  3O3Q A;  4P0J A;  2AFG A;  3AZW A;  3BA5 A;  1RY7 A;  5FZU A;  3NBC A;  4Q91 A;  2K43 A;  2D43 A;  1SR4 A;  1XG6 A;  1AVW B;  2F2F C;  4QKR A;  4P0L A;  4J2X A;  3HSM A;  3Q7W A;  4GAF A;  4KEK A;  4I6I A;  1S0B A;  3BAG A;  3ILA A;  1PUM B;  4KBB A;  3CA6 A;  2DRE A;  1UPS A;  3FJB A;  4Q9G A;  1TFM B;  3FGM A;  4X37 A;  1PC8 B;  2Z49 A;  1HWM B;  1SR4 C;  3PME A;  3V0B A;  1G9C A;  1IRP A;  1ISX A;  2GO2 A;  1WD4 A;  4IYB A;  4MZF B;  3E8L C;  1AF9 A;  1ABR B;  1BFB A;  4IY8 A;  1G82 A;  3FJC A;  2RQ9 A;  1IOB A;  1RG8 A;  2VU9 A;  4ISR A;  3CQA A;  4FGF A;  1DIW A;  1BAR A;  1S0G A;  1EYL A;  4IQP A;  4LO0 C;  4J2S A;  8I1B A;  2QYI B;  3NBE A;  1PZZ A;  4I4Q A;  3OJM A;  4QD2 C;  1G9D A;  3IM7 A;  2I1B A;  2R9K B;  4END A;  3VUO A;  2K4A B;  3V0A B;  1FV2 A;  3A21 A;  4QAL A;  1TTU A;  4P0K A;  1NUN A;  2KH2 A;  1HCE A;  4LO7 B;  3S8K A;  4IZX A;  2FFU A;  3O5W B;  1TWE A;  2IHO A;  5HPZ A;  4L4H A;  4F34 A;  7I1B A;  1JT4 A;  4FVV A;  4LO1 A;  1FWV A;  3OGF A;  3CA0 A;  3O44 A;  2D24 A;  2RG9 B;  1L2H A;  1R8O A;  3AZV A;  1MD6 A;  3FJF A;  4ZBV B;  1JQZ A;  4IHZ A;  3PHZ A;  4OWJ A;  4Q9P A;  2X2T A;  1SZ6 B;  5JLV A;  3NBN A;  3LLP A;  1BLA A;  4CJM A;  1Z4S A;  4ZKT B;  3Q7Y A;  4I4V A;  4JQ0 A;  3FJA A;  2FGF A;  4ION A;  2Q3N B;  4H9W A;  2VXR A;  2NZ9 A;  1ONK B;  5BQU A;  3D7W B;  3FJ8 A;  4ZFY B;  3CRH A;  3BAV A;  3FFZ A;  5BXP A;  1FQ9 A;  1NZK A;  3IIR A;  3PG0 A;  1FGA A;  4I4X A;  3CRG A;  4HJJ A;  5BP5 C;  4Z9W B;  9ILB A;  3BAU A;  3ZC8 A;  1TIE A;  1OQL B;  3BAH A;  1ISZ A;  2F2F A;  4QC4 A;  1QXM A;  2Y9W C;  3N0K A;  1DFC A;  3ZXG A;  4EFR A;  4ZGR B;  3AKI A;  4LO2 A;  4JAW A;  4LO8 B;  5JMC A;  1TWM A;  5EHA A;  2P23 A;  1ITB A;  5FNW A;  1PWA A;  3FUQ A;  3ZX7 A;  3BRF A;  4ISQ A;  1WBC A;  3WIN A;  2DRY A;  1BFF A;  1QQK A;  3O4B A;  4LO2 C;  3F62 B;  1YYN A;  2VSE A;  2AXM A;  2KLL A;  4I3N A;  5EG6 C;  3FJE A;  4G9N A;  3P53 A;  2J3P A;  5FZY A;  2HWM A;  3I2A A;  3AH4 A;  3N7K A;  3WIN C;  2BEA A;  4I4P A;  3OBR A;  3IM6 A;  3RTI B;  1DFQ A;  4GP3 A;  4ZA3 B;  3P6J A;  3RSJ A;  4EEE B;  3I29 B;  4IZE A;  4LO0 A;  1EPW A;  1V6W A;  2XOA A;  4XKI A;  4H75 A;  3T8S A;  3AJ5 A;  5F8Y A;  1MC9 A;  1FMM S;  1M2T B;  3FJI A;  3SNV A;  5F8W A;  3HN1 A;  4X39 A;  3QR5 A;  3VT2 A;  3NJ5 A;  4J2K A;  1AVA C;  2M49 A;  3R4S A;  4IY9 A;  2ZQO A;  4I0Y A;  5FZZ A;  3BAO A;  2E4M C;  1RZO B;  3V0A A;  2P39 A;  3A22 A;  4EFP A;  3FJD A;  1JT5 A;  1YF8 B;  2WRY A;  3N7J A;  1ISV A;  2WBC A;  4H04 A;  2VUA A;  3AH2 A;  1S0F A;  1XZZ A;  1Z0H A;  3VEQ A;  1BFG A;  1G9B A;  4JKQ A;  2MC2 A;  2HW9 A;  3O4O A;  4MZH A;  3K1X A;  1Q1U A;  1DQG A;  4R6U B;  1CVS A;  3POK A;  3CRI A;  1D0H A;  2MLL B;  3N7L A;  1F31 A;  1R8N A;  3MPP G;  3ZC9 A;  2GZB A;  4LO7 C;  3FJH A;  1W3A A;  2KKI A;  1AVX B;  4ZFW B;  3UJ4 A;  4I7I A;  3BAD A;  21BI A;  1Z2V A;  1DLL A;  3WO2 A;  1HIB A;  2ZR1 B;  3H6R B;  4XFU A;  4AN6 A;  2Y9F A;  5F90 A;  2FDB M;  1FV3 A;  1VCL A;  5DZU A;  4DEP A;  1G9A A;  1FWU A;  1BLD A;  3AKH A;  3O49 A;  2VSA A;  4J23 B;  4PC4 A;  4I1E A;  4F83 A;  3CU1 B;  3CA3 A;  1DZD A;  3AKG A;  5BP5 A;  3H6S E;  5BXR A;  4XFS A;  3VWC A;  4G6M A;  2NTD A;  3BA7 A;  2HWA A;  4I4S A;  3VT0 A;  3W9T A;  4JRA A;  3RMX A;  2D1Z A;  3S8J A;  1V6X A;  3CA4 A;  3BRD A;  4I4R A;  1HWO B;  2MIB A;  5GAQ A;  5BOW A;  3CA5 A;  4D0T A;  1AVU A;  4JKX B;  3I2X A;  3CA1 A;  4L4I A;  3QYD A;  4OW4 A;  1T9F A;  3BB2 A;  3O4D A;  4G1R A;  2KI4 A;  4EKX B;  3IM5 A;  3OJ2 A;  3H6Q A;  1HCD A;  4GOV A;  3MAL A;  1FN0 A;  4WBC A;  3HOM A;  3JRR A;  2DS0 A;  5EC5 A;  1BAS A;  3A23 A;  4ZLB B;  2AQZ A;  1K5V A;  3V79 C;  1ISW A;  2NP0 A;  2VXT I;  2BEB A;  4JPZ A;  1S0D A;  4USO A;  3F1R A;  1JY0 A;  1S0L A;  3BTA A;  1Q04 A;  5DUY A;  4OEF A;  3UD8 A;  2FFV A;  2Y9X E;  2RST A;  3VSF A;  3FUO A;  1TOO A;  2KI6 B;  4LO3 A;  3TC2 A;  1HWP B;  2D7I A;  4I37 A;  4QBC A;  5D61 A;  1FMZ A;  5F8S A;  2D44 A;  1TP0 A;  1ILR 1;  5FNX A;  1RML A;  1EV2 A;  3UJ0 A;  3ZXD A;  5DSS B;  3KMV A;  3HMY A;  4JP0 A;  3BAQ A;  3HBW A;  1I1B A;  1W3F A;  2D7R A;  3O4A A;  4LO3 C;  4A7Z A;  3UD9 A;  1JLY A;  1E0O A;  2LIQ A;  3PUB A;  2D20 A;  3C9Z A;  4G6J A;  2IWT B;  4MZG B;  1DQO A;  2DRZ A;  3P6I A;  4GP0 A;  2E4M A;  3OBT A;  4GAI A;  4I2S A;  1BFC A;  1HKN A;  41BI A;  4I4O A;  2X2S A;  3AJ6 A;  2NS2 A;  2YUG A;  4DEN A;  4I8M A;  4KC3 A;  1P63 A;  4USP A;  1IHK A;  2K8R A;  2F8X C;  4EB2 B;  4XFT A;  1EVT A;  5BXT A;  3VSZ A;  2ESU A;  3WMV A;  3RMY A;  3IAG C;  1AFC A;  3NBD A;  4OUJ A;  4UY4 A;  1JTC A;  1S0E A;  2ZQN A;  4OEG A;  1V6V A;  3V0B B;  1IRA X;  1PUU B;  3FJK A;  4X38 A;  2D22 A;  1DJS B;  4J2Y A;  3LTQ A;  1J0S A;  3A07 A;  1T4Q A;  1S0C A;  3VT1 A;  1IJT A;  1CE7 B;  4I4Y A;  4P6A A;  4D0Z A;  4Z8S B;  1IT0 A;  2NM1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...