3AH1A

Ha1 subcomponent of botulinum type c progenitor toxin complexed with n-acetylneuramic acid
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
283
structure length
283
Chain Sequence
TNANDLRNNEVFFISPSNNTNKVLDKISQSEVKLWNKLSGANQKWRLIYDTNKQAYKIKVMDNTSLILTWNAPLSSVSVKTDTNGDNQYWYLLQNYISRNVIIRNYMNPNLVLQYNIDDTLMVSTQTSSSNQFFKFSNCIYEALNNRNCKLQTQLNSDRFLSKNLNSQIIVLWQWFDSSRQKWIIEYNETKSAYTLKCQENNRYLTWIQNSNNYVETYQSTDSLIQYWNINYLDNDASKYILYNLQDTNRVLDVYNSQIANGTHVIVDSYHGNTNQQWIINLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sugar-binding sites of the HA1 subcomponent of Clostridium botulinum type C progenitor toxin
pubmed doi rcsb
molecule keywords Main hemagglutinin component
molecule tags Toxin
source organism Clostridium botulinum
total genus 91
structure length 283
sequence length 283
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-04-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ah1A02
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ah1A01
4H04A 4F83A 3HMYA 3CRIA 3S8JA 1M2TB 3FJHA 1II4A 1BFFA 1OQLB 1J0SA 3FJAA 5BXRA 5DUYA 1EPWA 1BLDA 1AVUA 3H6SE 5D63A 4P6AA 1Q04A 1HWNB 1G9DA 4JPZA 3HN1A 2HW9A 4LO1C 4ZBVB 4OWLA 3P53A 4XFSA 2FFVA 1G9BA 3N0KA 3A22A 1XG6A 3BAHA 3CA0A 5BQUC 2Y9XE 1IT0A 3RMYA 31BIA 3OJ2A 2Y9GA 3T8SA 4ISRA 5DZUA 1UPSA 4Z8SB 3BAVA 3O4OA 4J2XA 2E4MA 3FUQA 3RMXA 4ZFYB 3CRHA 3BRFA 1Z4SA 2Q3NB 3QR5A 4J2SA 3NBNA 4ISQA 1DIWA 3OBTA 2Q9XA 5D62A 1PUMB 3Q7YA 4I1BA 2DRZA 1IILA 3CA6A 3OGGA 2J3PA 1RZOB 1JT4A 3EF2A 1P63A 4USPA 3VSFA 1ABRB 2D22A 2D20A 5EHAA 3I2XA 5EG6C 1MD6A 1V6XA 1BASA 4I3NA 4XKIA 4KEKA 21BIA 3VSZA 3PG0A 4LO0A 3NJ5A 1AVAC 4ZFWB 4JQ0A 1QQLA 3LLPA 3KMVA 4QBCA 4I4RA 4I7IA 3FGMA 1WBCA 4X3AA 1AF9A 4ZOTA 3E8LC 2ERMA 1QQKA 1YYNA 1IHKA 4I4YA 4I4XA 1L2HA 1Q03A 2L5XA 1SZ6B 4FGFA 1TWEA 2GO2A 2ZQOA 2DS0A 1S0FA 3WMUA 2KH2A 3QYDA 4KC3A 4XFTA 2BEBA 1G82A 2MIBA 2Z49A 1WD4A 3SNVA 1I1EA 1BLAA 3FJFA 3OJMA 4CJMA 1HKNA 1RY7A 3S8KA 6I1BA 2IWTB 3O5WB 5BXSA 2FDBM 5DSSB 4EB2B 1KNMA 4OWJA 3O3QA 1K5UA 5GAQA 3BRDA 1V6UA 4TLPA 2HZ9A 3IM7A 4QD2B 1NUNA 2NM1A 3O4DA 1SR4C 3Q7WA 4I4QA 4YOLA 4GOYA 4QKSA 2NYYA 3RTIB 5EC5A 2D44A 2VXRA 3CQAA 5I1BA 5FZZA 4EKXB 2AFGA 1BFGA 4GAFA 3BA5A 3FJKA 4LO2C 4I37A 3VUOA 3JUTA 3PMEA 1MC9A 5D61A 3F1RA 4A7ZA 1TFMB 2NVHA 3WA1A 3AJ6A 3WO4A 1YTOA 3POKA 3ZX7A 2BFHA 4Z9WB 4A7YA 3FJJA 3V0AA 1PC8B 5DVHA 1TOOA 1ONKB 1PWAA 3O4AA 5F8WA 1XYFA 4F34A 5BXPA 4JP0A 4KEIA 4GP0A 4OEFA 1VCLA 4D0ZA 4JAWA 2NZ9A 4IY8A 3ZC8A 5JMCA 4JKXB 4JKQA 2VU9A 4ZFUB 2MLLB 2P39A 4X38A 3AZVA 3BTAA 2D7RA 3I29B 3VT1A 1GGPB 4ZLBB 3N7MA 2RG9B 1CE7B 1FMZA 1JT3A 5FNWA 1T4QA 1DQOA 2KLLA 5FZUA 3RTJB 4IYBA 3AKGA 3B9UA 3R4UA 1YBIA 2NTDA 3WO2A 4I4UA 4PC4A 2FFUA 3W9TA 1FV2A 1HIBA 1D0HA 2R9KB 4GP3A 1IJTA 8I1BA 1SR4A 3O4CA 1G9AA 3CU1B 4OW4A 1S0CA 3IIRA 3LTQA 3F62B 3Q7XA 4J2YA 3UJ0A 3H6RA 3P6IA 4ZA3B 4Q9GA 1HCEA 3NBCA 4II0A 1WD3A 3RSJA 3TC2A 1IRPA 1FWUA 3V0BA 2BEAA 2KKIA 2ZR1B 3HSMA 2DRYA 3ILAA 3WMVA 2IHOA 2QYIB 2LIEA 2D43A 4I0YA 4LO2A 3UD8A 4ZKTB 2XOAA 2Y9WC 4A7KA 1S0DA 4R6UB 3IAGC 1ISWA 3A21A 5JLVA 3BADA 2KI6B 3VT0A 1WBAA 4IY9A 2Z48A 3WINC 2VUAA 7I1BA 3D7WB 4AN7B 1JT7A 3BRGC 1V6WA 3BAOA 2WRYA 4LO7B 1HWPB 2F2FC 3AZWA 2K43A 2Y9FA 1EYLA 2AAIB 2QN4A 4I2SA 3BX1C 1FWVA 3MPPG 3UD9A 4G6JA 3A07A 1S0GA 4I6IA 3FUOA 1ITBA 3FJEA 4OUJA 4HJJA 4AN6A 1XHBA 5E24E 1FMMS 1FGAA 4I4PA 4G6MA 1AVXB 4LO8B 1Z0HA 4G9MA 4P0JA 3IM6A 3OJVA 3PUBA 3UD7A 4L4IA 2VSEA 5G00A 2X2TA 4I96A 3FJBA 3NBEA 1JQZA 4EFQA 1XZZA 1AVWB 4WBCA 3N7KA 2NP0A 1M16A 4I8MA 4G9NA 3C9ZA 1IOBA 1AXMA 4KBBA 1TP0A 4QKRA 3AH4A 3ZC9A 4IHZA 9ILBA 4JRAA 4L4HA 1BFCA 4IQPA 3VT2A 3AKIA 4LO3C 2D23A 2FGFA 1G9CA 3UDAA 4EEEB 2K8RA 3P6JA 4QBVA 4QD2C 5FNXA 5BVPI 1RMLA 1T9FA 1ISYA 2FO1A 2LIQA 4X39A 1Q1UA 3AH2A 4ZGRB 1AFCA 3O44A 1DLLA 4I4VA 1NZKA 4J2KA 3K1XA 2D7IA 3CA4A 2MC2A 3WINA 4GAIA 2HWAA 1PUUB 3HALA 3V0AB 3ZXGA 2F2FA 3O49A 4P0LA 4D0TA 3JRRA 3VWCA 2YUGA 2D1ZA 1JT5A 3FJ8A 4I1EA 5F90A 3UJ4A 3BAGA 3OGFA 4IZXA 1ILR1 1HCDA 1FQ9A 3CAHA 4OWKA 4ENDA 3ZXDA 1S0EA 3N7JA 3OBRA 2I1BA 3BB2A 1ISVA 4X37A 1Z2VA 3AH1A 5B2HA 1V6VA 1DZCA 5HPZA 3AKHA 1FV3A 1JLXA 2HWMA 3HOMA 2X2SA 1E0OA 2VLCA 3BAUA 3CRGA 1HWMB 1YXWA 1F31A 2RSTA 4FVVA 4OEEA 2GZBA 2WBCA 3PHZA 4GOVA 41BIA 1DZDA 3CA3A 1TWMA 4G1RA 2AXMA 2KI4A 4I4OA 4HA2A 4IONA 4I4SA 2D24A 3FFZA 3IM5A 4EFRA 1HWOB 1JY0A 3N7LA 3BAQA 3WO3A 3FJ9A 1A8DA 1FN0A 1DJSB 4J23B 4DCKC 3R4SA 5BP5A 3FJDA 4EFPA 2ET2A 4Q9PA 2VXTI 3CA5A 4D8HA 4P0KA 5BOWA 1QXMA 4LO3A 4HR6C 4DEPA 3H6RB 4QC4A 1ISXA 3I2AA 3V0BB 1W3AA 1R8NA 1S0LA 4OEGA 4DENA 2UUSA 1W3GA 3A23A 3AJ5A 4QALA 4QO3A 1CVSA 3FJIA 2E4MC 3MALA 1BFBA 2F8XC 2K4AB 1K5VA 3VEQA 1ISZA 3H6QA 1N4KA 4LO1A 5FZYA 1R8OA 4IZEA 5F8SA 3BA7A 3FJCA 1JLYA 1DQGA 2RQ9A 1DFQA 5BQUA 1IRAX 1YF8B 3CA1A 4KEJA 1RG8A 5F8YA 2AQZA 1S0BA 1EVTA 3O4BA 1TIEA 4LO7C 2M49A 1I1BA 1JTCA 1EV2A 4H9WA 4XFUA 1DFCA 5BP5C 2ZQNA 3HBWA 4Q91A 3V79C 4LO0C 5BXTA 1W3FA 1PZZA 2DREA 1TTUA 2ESUA 1BARA 2P23A 3AKFA 3NBDA 4USOA 3BA4A 1BA7A 2VSAA
chains in the Genus database with same CATH superfamily
4H04A 4F83A 3HMYA 3CRIA 4MZFB 1M2TB 3FJHA 3S8JA 1II4A 1BFFA 1OQLB 1J0SA 3FJAA 5BXRA 5DUYA 1EPWA 1BLDA 1AVUA 3H6SE 5D63A 4P6AA 1Q04A 1HWNB 1G9DA 4JPZA 3HN1A 2HW9A 4LO1C 4ZBVB 4OWLA 3P53A 4XFSA 2FFVA 1G9BA 3N0KA 3A22A 1XG6A 3BAHA 3CA0A 5BQUC 2Y9XE 1IT0A 3RMYA 31BIA 3OJ2A 2Y9GA 3T8SA 4ISRA 5DZUA 1UPSA 4Z8SB 3BAVA 3O4OA 4J2XA 2E4MA 3FUQA 3RMXA 4ZFYB 3CRHA 3BRFA 1Z4SA 2Q3NB 3QR5A 4J2SA 3NBNA 4ISQA 1DIWA 3OBTA 2Q9XA 5D62A 1PUMB 3Q7YA 4I1BA 2DRZA 1IILA 3CA6A 3OGGA 2J3PA 1RZOB 1JT4A 3EF2A 1P63A 4USPA 3VSFA 1ABRB 2D22A 2D20A 5EHAA 3I2XA 5EG6C 1MD6A 1V6XA 1BASA 4I3NA 4XKIA 4KEKA 21BIA 3VSZA 3PG0A 4LO0A 3NJ5A 1AVAC 4ZFWB 4JQ0A 1QQLA 3LLPA 3KMVA 4QBCA 4I4RA 4I7IA 3FGMA 1WBCA 4X3AA 1AF9A 4ZOTA 3E8LC 2ERMA 1QQKA 1YYNA 1IHKA 4I4YA 4I4XA 1L2HA 1Q03A 2L5XA 1SZ6B 4FGFA 1TWEA 2GO2A 2ZQOA 2DS0A 1S0FA 3WMUA 2KH2A 3QYDA 4KC3A 4XFTA 2BEBA 1G82A 2MIBA 2Z49A 1WD4A 3SNVA 1I1EA 1BLAA 3FJFA 3OJMA 4CJMA 1HKNA 1RY7A 3S8KA 6I1BA 2IWTB 3O5WB 5BXSA 2FDBM 5DSSB 4EB2B 1KNMA 4OWJA 3O3QA 1K5UA 5GAQA 3BRDA 1V6UA 4TLPA 2HZ9A 3IM7A 4QD2B 1NUNA 2NM1A 3O4DA 1SR4C 3Q7WA 4I4QA 4YOLA 4GOYA 4QKSA 2NYYA 3RTIB 5EC5A 2D44A 2VXRA 3CQAA 5I1BA 5FZZA 4EKXB 2AFGA 4UY4A 1BFGA 4GAFA 3BA5A 3FJKA 4LO2C 4I37A 3VUOA 3JUTA 3PMEA 1MC9A 5D61A 3F1RA 4A7ZA 1TFMB 2NVHA 3WA1A 3AJ6A 3WO4A 1YTOA 3POKA 3ZX7A 2BFHA 4Z9WB 4A7YA 3FJJA 3V0AA 1PC8B 5DVHA 1TOOA 1ONKB 1PWAA 3O4AA 5F8WA 1XYFA 4F34A 5BXPA 4JP0A 4KEIA 4GP0A 4OEFA 1VCLA 4D0ZA 4JAWA 2NZ9A 4IY8A 3ZC8A 5JMCA 4JKXB 4JKQA 2VU9A 4ZFUB 2MLLB 2P39A 4X38A 3AZVA 3BTAA 2D7RA 3I29B 3VT1A 1GGPB 4ZLBB 3N7MA 2RG9B 1CE7B 1FMZA 1JT3A 5FNWA 1T4QA 1DQOA 2KLLA 5FZUA 3RTJB 4IYBA 3AKGA 3B9UA 3R4UA 1YBIA 2NTDA 3WO2A 4I4UA 4PC4A 2FFUA 3W9TA 1FV2A 1HIBA 1D0HA 2R9KB 4GP3A 1IJTA 8I1BA 1SR4A 3O4CA 1G9AA 3CU1B 4OW4A 1S0CA 3IIRA 3LTQA 3F62B 3Q7XA 4J2YA 3UJ0A 3H6RA 3P6IA 4ZA3B 4Q9GA 1HCEA 3NBCA 4II0A 1WD3A 3RSJA 3TC2A 1IRPA 1FWUA 3V0BA 2BEAA 2KKIA 2ZR1B 3HSMA 2DRYA 3ILAA 3WMVA 2IHOA 2QYIB 2LIEA 2D43A 4I0YA 4LO2A 3UD8A 4ZKTB 2XOAA 2Y9WC 4A7KA 1S0DA 4R6UB 3IAGC 1ISWA 3A21A 5JLVA 3BADA 2KI6B 3VT0A 1WBAA 4IY9A 2Z48A 3WINC 2VUAA 7I1BA 3D7WB 4AN7B 1JT7A 3BRGC 1V6WA 3BAOA 2WRYA 4LO7B 1HWPB 2F2FC 3AZWA 2K43A 2Y9FA 1EYLA 2AAIB 2QN4A 4I2SA 3BX1C 1FWVA 3MPPG 3UD9A 4G6JA 3A07A 1S0GA 4I6IA 3FUOA 1ITBA 3FJEA 4OUJA 4HJJA 4AN6A 1XHBA 5E24E 1FMMS 1FGAA 4I4PA 4G6MA 1AVXB 4LO8B 1Z0HA 4G9MA 4P0JA 3IM6A 3OJVA 3PUBA 3UD7A 4L4IA 2VSEA 5G00A 2X2TA 4I96A 3FJBA 3NBEA 1JQZA 4EFQA 1XZZA 1AVWB 4WBCA 3N7KA 2NP0A 1M16A 4I8MA 4G9NA 3C9ZA 1IOBA 1AXMA 4KBBA 1TP0A 4QKRA 3AH4A 4MZGB 3ZC9A 4IHZA 9ILBA 4JRAA 4L4HA 1BFCA 4IQPA 3VT2A 3AKIA 4LO3C 2D23A 2FGFA 1G9CA 3UDAA 4EEEB 2K8RA 3P6JA 4QBVA 4QD2C 5FNXA 5BVPI 1RMLA 1T9FA 1ISYA 2FO1A 2LIQA 4X39A 1Q1UA 3AH2A 4ZGRB 1AFCA 3O44A 1DLLA 4I4VA 1NZKA 4J2KA 3K1XA 2D7IA 3CA4A 2MC2A 3WINA 4GAIA 2HWAA 1PUUB 3HALA 3V0AB 3ZXGA 2F2FA 3O49A 4P0LA 4D0TA 3JRRA 3VWCA 2YUGA 2D1ZA 1JT5A 3FJ8A 4I1EA 5F90A 3UJ4A 3BAGA 3OGFA 4IZXA 1ILR1 1HCDA 1FQ9A 3CAHA 4OWKA 4ENDA 3ZXDA 1S0EA 3N7JA 3OBRA 2I1BA 3BB2A 1ISVA 4X37A 1Z2VA 3AH1A 5B2HA 1V6VA 1DZCA 5HPZA 3AKHA 1FV3A 1JLXA 2HWMA 3HOMA 4MZHA 2X2SA 1E0OA 2VLCA 3BAUA 3CRGA 1HWMB 1YXWA 1F31A 2RSTA 4FVVA 4OEEA 2GZBA 2WBCA 3PHZA 4GOVA 41BIA 1DZDA 3CA3A 1TWMA 4G1RA 2AXMA 2KI4A 4I4OA 4HA2A 4IONA 4I4SA 2D24A 3FFZA 3IM5A 4EFRA 1HWOB 1JY0A 3N7LA 3BAQA 3WO3A 3FJ9A 1A8DA 1FN0A 1DJSB 4J23B 4DCKC 3R4SA 5BP5A 3FJDA 4EFPA 2ET2A 4Q9PA 2VXTI 3CA5A 4D8HA 4P0KA 5BOWA 1QXMA 4LO3A 4HR6C 4DEPA 3H6RB 4QC4A 1ISXA 3I2AA 3V0BB 1W3AA 1R8NA 1S0LA 4OEGA 4DENA 2UUSA 1W3GA 3A23A 3AJ5A 4QALA 4QO3A 1CVSA 3FJIA 2E4MC 3MALA 1BFBA 2F8XC 2K4AB 1K5VA 3VEQA 1ISZA 3H6QA 1N4KA 4LO1A 5FZYA 1R8OA 4IZEA 5F8SA 3BA7A 3FJCA 4H75A 1JLYA 1DQGA 2RQ9A 1DFQA 5BQUA 1IRAX 1YF8B 3CA1A 4KEJA 1RG8A 5F8YA 2AQZA 1S0BA 1EVTA 3O4BA 1TIEA 4LO7C 2M49A 1I1BA 1JTCA 1EV2A 4H9WA 4XFUA 1DFCA 5BP5C 2NS2A 2ZQNA 3HBWA 4Q91A 3V79C 4LO0C 5BXTA 1W3FA 1PZZA 2DREA 1TTUA 2ESUA 1BARA 2P23A 3AKFA 3NBDA 4USOA 3BA4A 1BA7A 2VSAA
chains in the Genus database with same CATH topology
4H04A 4F83A 3HMYA 3CRIA 4MZFB 1M2TB 3FJHA 3S8JA 1II4A 1BFFA 1OQLB 1J0SA 3FJAA 5BXRA 5DUYA 1EPWA 1BLDA 1AVUA 3H6SE 5D63A 4P6AA 1Q04A 1HWNB 1G9DA 4JPZA 3HN1A 2HW9A 4LO1C 4ZBVB 4OWLA 3P53A 4XFSA 2FFVA 1G9BA 3N0KA 3A22A 1XG6A 3BAHA 3CA0A 5BQUC 2Y9XE 1IT0A 3RMYA 31BIA 3OJ2A 2Y9GA 3T8SA 4ISRA 5DZUA 1UPSA 4Z8SB 3BAVA 3O4OA 4J2XA 2E4MA 3FUQA 3RMXA 4ZFYB 3CRHA 3BRFA 1Z4SA 2Q3NB 3QR5A 4J2SA 3NBNA 4ISQA 1DIWA 3OBTA 2Q9XA 5D62A 1PUMB 3Q7YA 4I1BA 2DRZA 1IILA 3CA6A 3OGGA 2J3PA 1RZOB 1JT4A 3EF2A 1P63A 4USPA 3VSFA 1ABRB 2D22A 2D20A 5EHAA 3I2XA 5EG6C 1MD6A 1V6XA 1BASA 4I3NA 4XKIA 4KEKA 21BIA 3VSZA 3PG0A 4LO0A 3NJ5A 1AVAC 4ZFWB 4JQ0A 1QQLA 3LLPA 3KMVA 4QBCA 4I4RA 4I7IA 3FGMA 1WBCA 4X3AA 1AF9A 4ZOTA 3E8LC 2ERMA 1QQKA 1YYNA 1IHKA 4I4YA 4I4XA 1L2HA 1Q03A 2L5XA 1SZ6B 4FGFA 1TWEA 2GO2A 2ZQOA 2DS0A 1S0FA 3WMUA 2KH2A 3QYDA 4KC3A 4XFTA 2BEBA 1G82A 2MIBA 2Z49A 1WD4A 3SNVA 1I1EA 1BLAA 3FJFA 3OJMA 4CJMA 1HKNA 1RY7A 3S8KA 6I1BA 2IWTB 3O5WB 5BXSA 2FDBM 5DSSB 4EB2B 1KNMA 4OWJA 3O3QA 1K5UA 5GAQA 3BRDA 1V6UA 4TLPA 2HZ9A 3IM7A 4QD2B 1NUNA 2NM1A 3O4DA 1SR4C 3Q7WA 4I4QA 4YOLA 4GOYA 4QKSA 2NYYA 3RTIB 5EC5A 2D44A 2VXRA 3CQAA 5I1BA 5FZZA 4EKXB 2AFGA 4UY4A 1BFGA 4GAFA 3BA5A 3FJKA 4LO2C 4I37A 3VUOA 3JUTA 3PMEA 1MC9A 5D61A 3F1RA 4A7ZA 1TFMB 2NVHA 3WA1A 3AJ6A 3WO4A 1YTOA 3POKA 3ZX7A 2BFHA 4Z9WB 4A7YA 3FJJA 3V0AA 1PC8B 5DVHA 1TOOA 1ONKB 1PWAA 3O4AA 5F8WA 1XYFA 4F34A 5BXPA 4JP0A 4KEIA 4GP0A 4OEFA 1VCLA 4D0ZA 4JAWA 2NZ9A 4IY8A 3ZC8A 5JMCA 4JKXB 4JKQA 2VU9A 4ZFUB 2MLLB 2P39A 4X38A 3AZVA 3BTAA 2D7RA 3I29B 3VT1A 1GGPB 4ZLBB 3N7MA 2RG9B 1CE7B 1FMZA 1JT3A 5FNWA 1T4QA 1DQOA 2KLLA 5FZUA 3RTJB 4IYBA 3AKGA 3B9UA 3R4UA 1YBIA 2NTDA 3WO2A 4I4UA 4PC4A 2FFUA 3W9TA 1FV2A 1HIBA 1D0HA 2R9KB 4GP3A 1IJTA 8I1BA 1SR4A 3O4CA 1G9AA 3CU1B 4OW4A 1S0CA 3IIRA 3LTQA 3F62B 3Q7XA 4J2YA 3UJ0A 3H6RA 3P6IA 4ZA3B 4Q9GA 1HCEA 3NBCA 4II0A 1WD3A 3RSJA 3TC2A 1IRPA 1FWUA 3V0BA 2BEAA 2KKIA 2ZR1B 3HSMA 2DRYA 3ILAA 3WMVA 2IHOA 2QYIB 2LIEA 2D43A 4I0YA 4LO2A 3UD8A 4ZKTB 2XOAA 2Y9WC 4A7KA 1S0DA 4R6UB 3IAGC 1ISWA 3A21A 5JLVA 3BADA 2KI6B 3VT0A 1WBAA 4IY9A 2Z48A 3WINC 2VUAA 7I1BA 3D7WB 4AN7B 1JT7A 3BRGC 1V6WA 3BAOA 2WRYA 4LO7B 1HWPB 2F2FC 3AZWA 2K43A 2Y9FA 1EYLA 2AAIB 2QN4A 4I2SA 3BX1C 1FWVA 3MPPG 3UD9A 4G6JA 3A07A 1S0GA 4I6IA 3FUOA 1ITBA 3FJEA 4OUJA 4HJJA 4AN6A 1XHBA 5E24E 1FMMS 1FGAA 4I4PA 4G6MA 1AVXB 4LO8B 1Z0HA 4G9MA 4P0JA 3IM6A 3OJVA 3PUBA 3UD7A 4L4IA 2VSEA 5G00A 2X2TA 4I96A 3FJBA 3NBEA 1JQZA 4EFQA 1XZZA 1AVWB 4WBCA 3N7KA 2NP0A 1M16A 4I8MA 4G9NA 3C9ZA 1IOBA 1AXMA 4KBBA 1TP0A 4QKRA 3AH4A 4MZGB 3ZC9A 4IHZA 9ILBA 4JRAA 4L4HA 1BFCA 4IQPA 3VT2A 3AKIA 4LO3C 2D23A 2FGFA 1G9CA 3UDAA 4EEEB 2K8RA 3P6JA 4QBVA 4QD2C 5FNXA 5BVPI 1RMLA 1T9FA 1ISYA 2FO1A 2LIQA 4X39A 1Q1UA 3AH2A 4ZGRB 1AFCA 3O44A 1DLLA 4I4VA 1NZKA 4J2KA 3K1XA 2D7IA 3CA4A 2MC2A 3WINA 4GAIA 2HWAA 1PUUB 3HALA 3V0AB 3ZXGA 2F2FA 3O49A 4P0LA 4D0TA 3JRRA 3VWCA 2YUGA 2D1ZA 1JT5A 3FJ8A 4I1EA 5F90A 3UJ4A 3BAGA 3OGFA 4IZXA 1ILR1 1HCDA 1FQ9A 3CAHA 4OWKA 4ENDA 3ZXDA 1S0EA 3N7JA 3OBRA 2I1BA 3BB2A 1ISVA 4X37A 1Z2VA 3AH1A 5B2HA 1V6VA 1DZCA 5HPZA 3AKHA 1FV3A 1JLXA 2HWMA 3HOMA 4MZHA 2X2SA 1E0OA 2VLCA 3BAUA 3CRGA 1HWMB 1YXWA 1F31A 2RSTA 4FVVA 4OEEA 2GZBA 2WBCA 3PHZA 4GOVA 41BIA 1DZDA 3CA3A 1TWMA 4G1RA 2AXMA 2KI4A 4I4OA 4HA2A 4IONA 4I4SA 2D24A 3FFZA 3IM5A 4EFRA 1HWOB 1JY0A 3N7LA 3BAQA 3WO3A 3FJ9A 1A8DA 1FN0A 1DJSB 4J23B 4DCKC 3R4SA 5BP5A 3FJDA 4EFPA 2ET2A 4Q9PA 2VXTI 3CA5A 4D8HA 4P0KA 5BOWA 1QXMA 4LO3A 4HR6C 4DEPA 3H6RB 4QC4A 1ISXA 3I2AA 3V0BB 1W3AA 1R8NA 1S0LA 4OEGA 4DENA 2UUSA 1W3GA 3A23A 3AJ5A 4QALA 4QO3A 1CVSA 3FJIA 2E4MC 3MALA 1BFBA 2F8XC 2K4AB 1K5VA 3VEQA 1ISZA 3H6QA 1N4KA 4LO1A 5FZYA 1R8OA 4IZEA 5F8SA 3BA7A 3FJCA 4H75A 1JLYA 1DQGA 2RQ9A 1DFQA 5BQUA 1IRAX 1YF8B 3CA1A 4KEJA 1RG8A 5F8YA 2AQZA 1S0BA 1EVTA 3O4BA 1TIEA 4LO7C 2M49A 1I1BA 1JTCA 1EV2A 4H9WA 4XFUA 1DFCA 5BP5C 2NS2A 2ZQNA 3HBWA 4Q91A 3V79C 4LO0C 5BXTA 1W3FA 1PZZA 2DREA 1TTUA 2ESUA 1BARA 2P23A 3AKFA 3NBDA 4USOA 3BA4A 1BA7A 2VSAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H04 A;  4F83 A;  3HMY A;  3CRI A;  3S8J A;  1M2T B;  3FJH A;  1II4 A;  1BFF A;  1OQL B;  1J0S A;  3FJA A;  5BXR A;  5DUY A;  1EPW A;  1BLD A;  1AVU A;  3H6S E;  5D63 A;  4P6A A;  1Q04 A;  1HWN B;  1G9D A;  4JPZ A;  3HN1 A;  2HW9 A;  4LO1 C;  4ZBV B;  4OWL A;  3P53 A;  4XFS A;  2FFV A;  1G9B A;  3N0K A;  3A22 A;  1XG6 A;  3BAH A;  3CA0 A;  5BQU C;  2Y9X E;  1IT0 A;  3RMY A;  31BI A;  3OJ2 A;  2Y9G A;  3T8S A;  4ISR A;  5DZU A;  1UPS A;  4Z8S B;  3BAV A;  3O4O A;  4J2X A;  2E4M A;  3FUQ A;  3RMX A;  4ZFY B;  3CRH A;  3BRF A;  1Z4S A;  2Q3N B;  3QR5 A;  4J2S A;  3NBN A;  4ISQ A;  1DIW A;  3OBT A;  2Q9X A;  5D62 A;  1PUM B;  3Q7Y A;  4I1B A;  2DRZ A;  1IIL A;  3CA6 A;  3OGG A;  2J3P A;  1RZO B;  1JT4 A;  3EF2 A;  1P63 A;  4USP A;  3VSF A;  1ABR B;  2D22 A;  2D20 A;  5EHA A;  3I2X A;  5EG6 C;  1MD6 A;  1V6X A;  1BAS A;  4I3N A;  4XKI A;  4KEK A;  21BI A;  3VSZ A;  3PG0 A;  4LO0 A;  3NJ5 A;  1AVA C;  4ZFW B;  4JQ0 A;  1QQL A;  3LLP A;  3KMV A;  4QBC A;  4I4R A;  4I7I A;  3FGM A;  1WBC A;  4X3A A;  1AF9 A;  4ZOT A;  3E8L C;  2ERM A;  1QQK A;  1YYN A;  1IHK A;  4I4Y A;  4I4X A;  1L2H A;  1Q03 A;  2L5X A;  1SZ6 B;  4FGF A;  1TWE A;  2GO2 A;  2ZQO A;  2DS0 A;  1S0F A;  3WMU A;  2KH2 A;  3QYD A;  4KC3 A;  4XFT A;  2BEB A;  1G82 A;  2MIB A;  2Z49 A;  1WD4 A;  3SNV A;  1I1E A;  1BLA A;  3FJF A;  3OJM A;  4CJM A;  1HKN A;  1RY7 A;  3S8K A;  6I1B A;  2IWT B;  3O5W B;  5BXS A;  2FDB M;  5DSS B;  4EB2 B;  1KNM A;  4OWJ A;  3O3Q A;  1K5U A;  5GAQ A;  3BRD A;  1V6U A;  4TLP A;  2HZ9 A;  3IM7 A;  4QD2 B;  1NUN A;  2NM1 A;  3O4D A;  1SR4 C;  3Q7W A;  4I4Q A;  4YOL A;  4GOY A;  4QKS A;  2NYY A;  3RTI B;  5EC5 A;  2D44 A;  2VXR A;  3CQA A;  5I1B A;  5FZZ A;  4EKX B;  2AFG A;  1BFG A;  4GAF A;  3BA5 A;  3FJK A;  4LO2 C;  4I37 A;  3VUO A;  3JUT A;  3PME A;  1MC9 A;  5D61 A;  3F1R A;  4A7Z A;  1TFM B;  2NVH A;  3WA1 A;  3AJ6 A;  3WO4 A;  1YTO A;  3POK A;  3ZX7 A;  2BFH A;  4Z9W B;  4A7Y A;  3FJJ A;  3V0A A;  1PC8 B;  5DVH A;  1TOO A;  1ONK B;  1PWA A;  3O4A A;  5F8W A;  1XYF A;  4F34 A;  5BXP A;  4JP0 A;  4KEI A;  4GP0 A;  4OEF A;  1VCL A;  4D0Z A;  4JAW A;  2NZ9 A;  4IY8 A;  3ZC8 A;  5JMC A;  4JKX B;  4JKQ A;  2VU9 A;  4ZFU B;  2MLL B;  2P39 A;  4X38 A;  3AZV A;  3BTA A;  2D7R A;  3I29 B;  3VT1 A;  1GGP B;  4ZLB B;  3N7M A;  2RG9 B;  1CE7 B;  1FMZ A;  1JT3 A;  5FNW A;  1T4Q A;  1DQO A;  2KLL A;  5FZU A;  3RTJ B;  4IYB A;  3AKG A;  3B9U A;  3R4U A;  1YBI A;  2NTD A;  3WO2 A;  4I4U A;  4PC4 A;  2FFU A;  3W9T A;  1FV2 A;  1HIB A;  1D0H A;  2R9K B;  4GP3 A;  1IJT A;  8I1B A;  1SR4 A;  3O4C A;  1G9A A;  3CU1 B;  4OW4 A;  1S0C A;  3IIR A;  3LTQ A;  3F62 B;  3Q7X A;  4J2Y A;  3UJ0 A;  3H6R A;  3P6I A;  4ZA3 B;  4Q9G A;  1HCE A;  3NBC A;  4II0 A;  1WD3 A;  3RSJ A;  3TC2 A;  1IRP A;  1FWU A;  3V0B A;  2BEA A;  2KKI A;  2ZR1 B;  3HSM A;  2DRY A;  3ILA A;  3WMV A;  2IHO A;  2QYI B;  2LIE A;  2D43 A;  4I0Y A;  4LO2 A;  3UD8 A;  4ZKT B;  2XOA A;  2Y9W C;  4A7K A;  1S0D A;  4R6U B;  3IAG C;  1ISW A;  3A21 A;  5JLV A;  3BAD A;  2KI6 B;  3VT0 A;  1WBA A;  4IY9 A;  2Z48 A;  3WIN C;  2VUA A;  7I1B A;  3D7W B;  4AN7 B;  1JT7 A;  3BRG C;  1V6W A;  3BAO A;  2WRY A;  4LO7 B;  1HWP B;  2F2F C;  3AZW A;  2K43 A;  2Y9F A;  1EYL A;  2AAI B;  2QN4 A;  4I2S A;  3BX1 C;  1FWV A;  3MPP G;  3UD9 A;  4G6J A;  3A07 A;  1S0G A;  4I6I A;  3FUO A;  1ITB A;  3FJE A;  4OUJ A;  4HJJ A;  4AN6 A;  1XHB A;  5E24 E;  1FMM S;  1FGA A;  4I4P A;  4G6M A;  1AVX B;  4LO8 B;  1Z0H A;  4G9M A;  4P0J A;  3IM6 A;  3OJV A;  3PUB A;  3UD7 A;  4L4I A;  2VSE A;  5G00 A;  2X2T A;  4I96 A;  3FJB A;  3NBE A;  1JQZ A;  4EFQ A;  1XZZ A;  1AVW B;  4WBC A;  3N7K A;  2NP0 A;  1M16 A;  4I8M A;  4G9N A;  3C9Z A;  1IOB A;  1AXM A;  4KBB A;  1TP0 A;  4QKR A;  3AH4 A;  3ZC9 A;  4IHZ A;  9ILB A;  4JRA A;  4L4H A;  1BFC A;  4IQP A;  3VT2 A;  3AKI A;  4LO3 C;  2D23 A;  2FGF A;  1G9C A;  3UDA A;  4EEE B;  2K8R A;  3P6J A;  4QBV A;  4QD2 C;  5FNX A;  5BVP I;  1RML A;  1T9F A;  1ISY A;  2FO1 A;  2LIQ A;  4X39 A;  1Q1U A;  3AH2 A;  4ZGR B;  1AFC A;  3O44 A;  1DLL A;  4I4V A;  1NZK A;  4J2K A;  3K1X A;  2D7I A;  3CA4 A;  2MC2 A;  3WIN A;  4GAI A;  2HWA A;  1PUU B;  3HAL A;  3V0A B;  3ZXG A;  2F2F A;  3O49 A;  4P0L A;  4D0T A;  3JRR A;  3VWC A;  2YUG A;  2D1Z A;  1JT5 A;  3FJ8 A;  4I1E A;  5F90 A;  3UJ4 A;  3BAG A;  3OGF A;  4IZX A;  1ILR 1;  1HCD A;  1FQ9 A;  3CAH A;  4OWK A;  4END A;  3ZXD A;  1S0E A;  3N7J A;  3OBR A;  2I1B A;  3BB2 A;  1ISV A;  4X37 A;  1Z2V A;  3AH1 A;  5B2H A;  1V6V A;  1DZC A;  5HPZ A;  3AKH A;  1FV3 A;  1JLX A;  2HWM A;  3HOM A;  2X2S A;  1E0O A;  2VLC A;  3BAU A;  3CRG A;  1HWM B;  1YXW A;  1F31 A;  2RST A;  4FVV A;  4OEE A;  2GZB A;  2WBC A;  3PHZ A;  4GOV A;  41BI A;  1DZD A;  3CA3 A;  1TWM A;  4G1R A;  2AXM A;  2KI4 A;  4I4O A;  4HA2 A;  4ION A;  4I4S A;  2D24 A;  3FFZ A;  3IM5 A;  4EFR A;  1HWO B;  1JY0 A;  3N7L A;  3BAQ A;  3WO3 A;  3FJ9 A;  1A8D A;  1FN0 A;  1DJS B;  4J23 B;  4DCK C;  3R4S A;  5BP5 A;  3FJD A;  4EFP A;  2ET2 A;  4Q9P A;  2VXT I;  3CA5 A;  4D8H A;  4P0K A;  5BOW A;  1QXM A;  4LO3 A;  4HR6 C;  4DEP A;  3H6R B;  4QC4 A;  1ISX A;  3I2A A;  3V0B B;  1W3A A;  1R8N A;  1S0L A;  4OEG A;  4DEN A;  2UUS A;  1W3G A;  3A23 A;  3AJ5 A;  4QAL A;  4QO3 A;  1CVS A;  3FJI A;  2E4M C;  3MAL A;  1BFB A;  2F8X C;  2K4A B;  1K5V A;  3VEQ A;  1ISZ A;  3H6Q A;  1N4K A;  4LO1 A;  5FZY A;  1R8O A;  4IZE A;  5F8S A;  3BA7 A;  3FJC A;  1JLY A;  1DQG A;  2RQ9 A;  1DFQ A;  5BQU A;  1IRA X;  1YF8 B;  3CA1 A;  4KEJ A;  1RG8 A;  5F8Y A;  2AQZ A;  1S0B A;  1EVT A;  3O4B A;  1TIE A;  4LO7 C;  2M49 A;  1I1B A;  1JTC A;  1EV2 A;  4H9W A;  4XFU A;  1DFC A;  5BP5 C;  2ZQN A;  3HBW A;  4Q91 A;  3V79 C;  4LO0 C;  5BXT A;  1W3F A;  1PZZ A;  2DRE A;  1TTU A;  2ESU A;  1BAR A;  2P23 A;  3AKF A;  3NBD A;  4USO A;  3BA4 A;  1BA7 A;  2VSA A; 
#chains in the Genus database with same CATH topology
 4H04 A;  4F83 A;  3HMY A;  3CRI A;  4MZF B;  1M2T B;  3FJH A;  3S8J A;  1II4 A;  1BFF A;  1OQL B;  1J0S A;  3FJA A;  5BXR A;  5DUY A;  1EPW A;  1BLD A;  1AVU A;  3H6S E;  5D63 A;  4P6A A;  1Q04 A;  1HWN B;  1G9D A;  4JPZ A;  3HN1 A;  2HW9 A;  4LO1 C;  4ZBV B;  4OWL A;  3P53 A;  4XFS A;  2FFV A;  1G9B A;  3N0K A;  3A22 A;  1XG6 A;  3BAH A;  3CA0 A;  5BQU C;  2Y9X E;  1IT0 A;  3RMY A;  31BI A;  3OJ2 A;  2Y9G A;  3T8S A;  4ISR A;  5DZU A;  1UPS A;  4Z8S B;  3BAV A;  3O4O A;  4J2X A;  2E4M A;  3FUQ A;  3RMX A;  4ZFY B;  3CRH A;  3BRF A;  1Z4S A;  2Q3N B;  3QR5 A;  4J2S A;  3NBN A;  4ISQ A;  1DIW A;  3OBT A;  2Q9X A;  5D62 A;  1PUM B;  3Q7Y A;  4I1B A;  2DRZ A;  1IIL A;  3CA6 A;  3OGG A;  2J3P A;  1RZO B;  1JT4 A;  3EF2 A;  1P63 A;  4USP A;  3VSF A;  1ABR B;  2D22 A;  2D20 A;  5EHA A;  3I2X A;  5EG6 C;  1MD6 A;  1V6X A;  1BAS A;  4I3N A;  4XKI A;  4KEK A;  21BI A;  3VSZ A;  3PG0 A;  4LO0 A;  3NJ5 A;  1AVA C;  4ZFW B;  4JQ0 A;  1QQL A;  3LLP A;  3KMV A;  4QBC A;  4I4R A;  4I7I A;  3FGM A;  1WBC A;  4X3A A;  1AF9 A;  4ZOT A;  3E8L C;  2ERM A;  1QQK A;  1YYN A;  1IHK A;  4I4Y A;  4I4X A;  1L2H A;  1Q03 A;  2L5X A;  1SZ6 B;  4FGF A;  1TWE A;  2GO2 A;  2ZQO A;  2DS0 A;  1S0F A;  3WMU A;  2KH2 A;  3QYD A;  4KC3 A;  4XFT A;  2BEB A;  1G82 A;  2MIB A;  2Z49 A;  1WD4 A;  3SNV A;  1I1E A;  1BLA A;  3FJF A;  3OJM A;  4CJM A;  1HKN A;  1RY7 A;  3S8K A;  6I1B A;  2IWT B;  3O5W B;  5BXS A;  2FDB M;  5DSS B;  4EB2 B;  1KNM A;  4OWJ A;  3O3Q A;  1K5U A;  5GAQ A;  3BRD A;  1V6U A;  4TLP A;  2HZ9 A;  3IM7 A;  4QD2 B;  1NUN A;  2NM1 A;  3O4D A;  1SR4 C;  3Q7W A;  4I4Q A;  4YOL A;  4GOY A;  4QKS A;  2NYY A;  3RTI B;  5EC5 A;  2D44 A;  2VXR A;  3CQA A;  5I1B A;  5FZZ A;  4EKX B;  2AFG A;  4UY4 A;  1BFG A;  4GAF A;  3BA5 A;  3FJK A;  4LO2 C;  4I37 A;  3VUO A;  3JUT A;  3PME A;  1MC9 A;  5D61 A;  3F1R A;  4A7Z A;  1TFM B;  2NVH A;  3WA1 A;  3AJ6 A;  3WO4 A;  1YTO A;  3POK A;  3ZX7 A;  2BFH A;  4Z9W B;  4A7Y A;  3FJJ A;  3V0A A;  1PC8 B;  5DVH A;  1TOO A;  1ONK B;  1PWA A;  3O4A A;  5F8W A;  1XYF A;  4F34 A;  5BXP A;  4JP0 A;  4KEI A;  4GP0 A;  4OEF A;  1VCL A;  4D0Z A;  4JAW A;  2NZ9 A;  4IY8 A;  3ZC8 A;  5JMC A;  4JKX B;  4JKQ A;  2VU9 A;  4ZFU B;  2MLL B;  2P39 A;  4X38 A;  3AZV A;  3BTA A;  2D7R A;  3I29 B;  3VT1 A;  1GGP B;  4ZLB B;  3N7M A;  2RG9 B;  1CE7 B;  1FMZ A;  1JT3 A;  5FNW A;  1T4Q A;  1DQO A;  2KLL A;  5FZU A;  3RTJ B;  4IYB A;  3AKG A;  3B9U A;  3R4U A;  1YBI A;  2NTD A;  3WO2 A;  4I4U A;  4PC4 A;  2FFU A;  3W9T A;  1FV2 A;  1HIB A;  1D0H A;  2R9K B;  4GP3 A;  1IJT A;  8I1B A;  1SR4 A;  3O4C A;  1G9A A;  3CU1 B;  4OW4 A;  1S0C A;  3IIR A;  3LTQ A;  3F62 B;  3Q7X A;  4J2Y A;  3UJ0 A;  3H6R A;  3P6I A;  4ZA3 B;  4Q9G A;  1HCE A;  3NBC A;  4II0 A;  1WD3 A;  3RSJ A;  3TC2 A;  1IRP A;  1FWU A;  3V0B A;  2BEA A;  2KKI A;  2ZR1 B;  3HSM A;  2DRY A;  3ILA A;  3WMV A;  2IHO A;  2QYI B;  2LIE A;  2D43 A;  4I0Y A;  4LO2 A;  3UD8 A;  4ZKT B;  2XOA A;  2Y9W C;  4A7K A;  1S0D A;  4R6U B;  3IAG C;  1ISW A;  3A21 A;  5JLV A;  3BAD A;  2KI6 B;  3VT0 A;  1WBA A;  4IY9 A;  2Z48 A;  3WIN C;  2VUA A;  7I1B A;  3D7W B;  4AN7 B;  1JT7 A;  3BRG C;  1V6W A;  3BAO A;  2WRY A;  4LO7 B;  1HWP B;  2F2F C;  3AZW A;  2K43 A;  2Y9F A;  1EYL A;  2AAI B;  2QN4 A;  4I2S A;  3BX1 C;  1FWV A;  3MPP G;  3UD9 A;  4G6J A;  3A07 A;  1S0G A;  4I6I A;  3FUO A;  1ITB A;  3FJE A;  4OUJ A;  4HJJ A;  4AN6 A;  1XHB A;  5E24 E;  1FMM S;  1FGA A;  4I4P A;  4G6M A;  1AVX B;  4LO8 B;  1Z0H A;  4G9M A;  4P0J A;  3IM6 A;  3OJV A;  3PUB A;  3UD7 A;  4L4I A;  2VSE A;  5G00 A;  2X2T A;  4I96 A;  3FJB A;  3NBE A;  1JQZ A;  4EFQ A;  1XZZ A;  1AVW B;  4WBC A;  3N7K A;  2NP0 A;  1M16 A;  4I8M A;  4G9N A;  3C9Z A;  1IOB A;  1AXM A;  4KBB A;  1TP0 A;  4QKR A;  3AH4 A;  4MZG B;  3ZC9 A;  4IHZ A;  9ILB A;  4JRA A;  4L4H A;  1BFC A;  4IQP A;  3VT2 A;  3AKI A;  4LO3 C;  2D23 A;  2FGF A;  1G9C A;  3UDA A;  4EEE B;  2K8R A;  3P6J A;  4QBV A;  4QD2 C;  5FNX A;  5BVP I;  1RML A;  1T9F A;  1ISY A;  2FO1 A;  2LIQ A;  4X39 A;  1Q1U A;  3AH2 A;  4ZGR B;  1AFC A;  3O44 A;  1DLL A;  4I4V A;  1NZK A;  4J2K A;  3K1X A;  2D7I A;  3CA4 A;  2MC2 A;  3WIN A;  4GAI A;  2HWA A;  1PUU B;  3HAL A;  3V0A B;  3ZXG A;  2F2F A;  3O49 A;  4P0L A;  4D0T A;  3JRR A;  3VWC A;  2YUG A;  2D1Z A;  1JT5 A;  3FJ8 A;  4I1E A;  5F90 A;  3UJ4 A;  3BAG A;  3OGF A;  4IZX A;  1ILR 1;  1HCD A;  1FQ9 A;  3CAH A;  4OWK A;  4END A;  3ZXD A;  1S0E A;  3N7J A;  3OBR A;  2I1B A;  3BB2 A;  1ISV A;  4X37 A;  1Z2V A;  3AH1 A;  5B2H A;  1V6V A;  1DZC A;  5HPZ A;  3AKH A;  1FV3 A;  1JLX A;  2HWM A;  3HOM A;  4MZH A;  2X2S A;  1E0O A;  2VLC A;  3BAU A;  3CRG A;  1HWM B;  1YXW A;  1F31 A;  2RST A;  4FVV A;  4OEE A;  2GZB A;  2WBC A;  3PHZ A;  4GOV A;  41BI A;  1DZD A;  3CA3 A;  1TWM A;  4G1R A;  2AXM A;  2KI4 A;  4I4O A;  4HA2 A;  4ION A;  4I4S A;  2D24 A;  3FFZ A;  3IM5 A;  4EFR A;  1HWO B;  1JY0 A;  3N7L A;  3BAQ A;  3WO3 A;  3FJ9 A;  1A8D A;  1FN0 A;  1DJS B;  4J23 B;  4DCK C;  3R4S A;  5BP5 A;  3FJD A;  4EFP A;  2ET2 A;  4Q9P A;  2VXT I;  3CA5 A;  4D8H A;  4P0K A;  5BOW A;  1QXM A;  4LO3 A;  4HR6 C;  4DEP A;  3H6R B;  4QC4 A;  1ISX A;  3I2A A;  3V0B B;  1W3A A;  1R8N A;  1S0L A;  4OEG A;  4DEN A;  2UUS A;  1W3G A;  3A23 A;  3AJ5 A;  4QAL A;  4QO3 A;  1CVS A;  3FJI A;  2E4M C;  3MAL A;  1BFB A;  2F8X C;  2K4A B;  1K5V A;  3VEQ A;  1ISZ A;  3H6Q A;  1N4K A;  4LO1 A;  5FZY A;  1R8O A;  4IZE A;  5F8S A;  3BA7 A;  3FJC A;  4H75 A;  1JLY A;  1DQG A;  2RQ9 A;  1DFQ A;  5BQU A;  1IRA X;  1YF8 B;  3CA1 A;  4KEJ A;  1RG8 A;  5F8Y A;  2AQZ A;  1S0B A;  1EVT A;  3O4B A;  1TIE A;  4LO7 C;  2M49 A;  1I1B A;  1JTC A;  1EV2 A;  4H9W A;  4XFU A;  1DFC A;  5BP5 C;  2NS2 A;  2ZQN A;  3HBW A;  4Q91 A;  3V79 C;  4LO0 C;  5BXT A;  1W3F A;  1PZZ A;  2DRE A;  1TTU A;  2ESU A;  1BAR A;  2P23 A;  3AKF A;  3NBD A;  4USO A;  3BA4 A;  1BA7 A;  2VSA A; 
#chains in the Genus database with same CATH homology
 4H04 A;  4F83 A;  3HMY A;  3CRI A;  4MZF B;  1M2T B;  3FJH A;  3S8J A;  1II4 A;  1BFF A;  1OQL B;  1J0S A;  3FJA A;  5BXR A;  5DUY A;  1EPW A;  1BLD A;  1AVU A;  3H6S E;  5D63 A;  4P6A A;  1Q04 A;  1HWN B;  1G9D A;  4JPZ A;  3HN1 A;  2HW9 A;  4LO1 C;  4ZBV B;  4OWL A;  3P53 A;  4XFS A;  2FFV A;  1G9B A;  3N0K A;  3A22 A;  1XG6 A;  3BAH A;  3CA0 A;  5BQU C;  2Y9X E;  1IT0 A;  3RMY A;  31BI A;  3OJ2 A;  2Y9G A;  3T8S A;  4ISR A;  5DZU A;  1UPS A;  4Z8S B;  3BAV A;  3O4O A;  4J2X A;  2E4M A;  3FUQ A;  3RMX A;  4ZFY B;  3CRH A;  3BRF A;  1Z4S A;  2Q3N B;  3QR5 A;  4J2S A;  3NBN A;  4ISQ A;  1DIW A;  3OBT A;  2Q9X A;  5D62 A;  1PUM B;  3Q7Y A;  4I1B A;  2DRZ A;  1IIL A;  3CA6 A;  3OGG A;  2J3P A;  1RZO B;  1JT4 A;  3EF2 A;  1P63 A;  4USP A;  3VSF A;  1ABR B;  2D22 A;  2D20 A;  5EHA A;  3I2X A;  5EG6 C;  1MD6 A;  1V6X A;  1BAS A;  4I3N A;  4XKI A;  4KEK A;  21BI A;  3VSZ A;  3PG0 A;  4LO0 A;  3NJ5 A;  1AVA C;  4ZFW B;  4JQ0 A;  1QQL A;  3LLP A;  3KMV A;  4QBC A;  4I4R A;  4I7I A;  3FGM A;  1WBC A;  4X3A A;  1AF9 A;  4ZOT A;  3E8L C;  2ERM A;  1QQK A;  1YYN A;  1IHK A;  4I4Y A;  4I4X A;  1L2H A;  1Q03 A;  2L5X A;  1SZ6 B;  4FGF A;  1TWE A;  2GO2 A;  2ZQO A;  2DS0 A;  1S0F A;  3WMU A;  2KH2 A;  3QYD A;  4KC3 A;  4XFT A;  2BEB A;  1G82 A;  2MIB A;  2Z49 A;  1WD4 A;  3SNV A;  1I1E A;  1BLA A;  3FJF A;  3OJM A;  4CJM A;  1HKN A;  1RY7 A;  3S8K A;  6I1B A;  2IWT B;  3O5W B;  5BXS A;  2FDB M;  5DSS B;  4EB2 B;  1KNM A;  4OWJ A;  3O3Q A;  1K5U A;  5GAQ A;  3BRD A;  1V6U A;  4TLP A;  2HZ9 A;  3IM7 A;  4QD2 B;  1NUN A;  2NM1 A;  3O4D A;  1SR4 C;  3Q7W A;  4I4Q A;  4YOL A;  4GOY A;  4QKS A;  2NYY A;  3RTI B;  5EC5 A;  2D44 A;  2VXR A;  3CQA A;  5I1B A;  5FZZ A;  4EKX B;  2AFG A;  4UY4 A;  1BFG A;  4GAF A;  3BA5 A;  3FJK A;  4LO2 C;  4I37 A;  3VUO A;  3JUT A;  3PME A;  1MC9 A;  5D61 A;  3F1R A;  4A7Z A;  1TFM B;  2NVH A;  3WA1 A;  3AJ6 A;  3WO4 A;  1YTO A;  3POK A;  3ZX7 A;  2BFH A;  4Z9W B;  4A7Y A;  3FJJ A;  3V0A A;  1PC8 B;  5DVH A;  1TOO A;  1ONK B;  1PWA A;  3O4A A;  5F8W A;  1XYF A;  4F34 A;  5BXP A;  4JP0 A;  4KEI A;  4GP0 A;  4OEF A;  1VCL A;  4D0Z A;  4JAW A;  2NZ9 A;  4IY8 A;  3ZC8 A;  5JMC A;  4JKX B;  4JKQ A;  2VU9 A;  4ZFU B;  2MLL B;  2P39 A;  4X38 A;  3AZV A;  3BTA A;  2D7R A;  3I29 B;  3VT1 A;  1GGP B;  4ZLB B;  3N7M A;  2RG9 B;  1CE7 B;  1FMZ A;  1JT3 A;  5FNW A;  1T4Q A;  1DQO A;  2KLL A;  5FZU A;  3RTJ B;  4IYB A;  3AKG A;  3B9U A;  3R4U A;  1YBI A;  2NTD A;  3WO2 A;  4I4U A;  4PC4 A;  2FFU A;  3W9T A;  1FV2 A;  1HIB A;  1D0H A;  2R9K B;  4GP3 A;  1IJT A;  8I1B A;  1SR4 A;  3O4C A;  1G9A A;  3CU1 B;  4OW4 A;  1S0C A;  3IIR A;  3LTQ A;  3F62 B;  3Q7X A;  4J2Y A;  3UJ0 A;  3H6R A;  3P6I A;  4ZA3 B;  4Q9G A;  1HCE A;  3NBC A;  4II0 A;  1WD3 A;  3RSJ A;  3TC2 A;  1IRP A;  1FWU A;  3V0B A;  2BEA A;  2KKI A;  2ZR1 B;  3HSM A;  2DRY A;  3ILA A;  3WMV A;  2IHO A;  2QYI B;  2LIE A;  2D43 A;  4I0Y A;  4LO2 A;  3UD8 A;  4ZKT B;  2XOA A;  2Y9W C;  4A7K A;  1S0D A;  4R6U B;  3IAG C;  1ISW A;  3A21 A;  5JLV A;  3BAD A;  2KI6 B;  3VT0 A;  1WBA A;  4IY9 A;  2Z48 A;  3WIN C;  2VUA A;  7I1B A;  3D7W B;  4AN7 B;  1JT7 A;  3BRG C;  1V6W A;  3BAO A;  2WRY A;  4LO7 B;  1HWP B;  2F2F C;  3AZW A;  2K43 A;  2Y9F A;  1EYL A;  2AAI B;  2QN4 A;  4I2S A;  3BX1 C;  1FWV A;  3MPP G;  3UD9 A;  4G6J A;  3A07 A;  1S0G A;  4I6I A;  3FUO A;  1ITB A;  3FJE A;  4OUJ A;  4HJJ A;  4AN6 A;  1XHB A;  5E24 E;  1FMM S;  1FGA A;  4I4P A;  4G6M A;  1AVX B;  4LO8 B;  1Z0H A;  4G9M A;  4P0J A;  3IM6 A;  3OJV A;  3PUB A;  3UD7 A;  4L4I A;  2VSE A;  5G00 A;  2X2T A;  4I96 A;  3FJB A;  3NBE A;  1JQZ A;  4EFQ A;  1XZZ A;  1AVW B;  4WBC A;  3N7K A;  2NP0 A;  1M16 A;  4I8M A;  4G9N A;  3C9Z A;  1IOB A;  1AXM A;  4KBB A;  1TP0 A;  4QKR A;  3AH4 A;  4MZG B;  3ZC9 A;  4IHZ A;  9ILB A;  4JRA A;  4L4H A;  1BFC A;  4IQP A;  3VT2 A;  3AKI A;  4LO3 C;  2D23 A;  2FGF A;  1G9C A;  3UDA A;  4EEE B;  2K8R A;  3P6J A;  4QBV A;  4QD2 C;  5FNX A;  5BVP I;  1RML A;  1T9F A;  1ISY A;  2FO1 A;  2LIQ A;  4X39 A;  1Q1U A;  3AH2 A;  4ZGR B;  1AFC A;  3O44 A;  1DLL A;  4I4V A;  1NZK A;  4J2K A;  3K1X A;  2D7I A;  3CA4 A;  2MC2 A;  3WIN A;  4GAI A;  2HWA A;  1PUU B;  3HAL A;  3V0A B;  3ZXG A;  2F2F A;  3O49 A;  4P0L A;  4D0T A;  3JRR A;  3VWC A;  2YUG A;  2D1Z A;  1JT5 A;  3FJ8 A;  4I1E A;  5F90 A;  3UJ4 A;  3BAG A;  3OGF A;  4IZX A;  1ILR 1;  1HCD A;  1FQ9 A;  3CAH A;  4OWK A;  4END A;  3ZXD A;  1S0E A;  3N7J A;  3OBR A;  2I1B A;  3BB2 A;  1ISV A;  4X37 A;  1Z2V A;  3AH1 A;  5B2H A;  1V6V A;  1DZC A;  5HPZ A;  3AKH A;  1FV3 A;  1JLX A;  2HWM A;  3HOM A;  4MZH A;  2X2S A;  1E0O A;  2VLC A;  3BAU A;  3CRG A;  1HWM B;  1YXW A;  1F31 A;  2RST A;  4FVV A;  4OEE A;  2GZB A;  2WBC A;  3PHZ A;  4GOV A;  41BI A;  1DZD A;  3CA3 A;  1TWM A;  4G1R A;  2AXM A;  2KI4 A;  4I4O A;  4HA2 A;  4ION A;  4I4S A;  2D24 A;  3FFZ A;  3IM5 A;  4EFR A;  1HWO B;  1JY0 A;  3N7L A;  3BAQ A;  3WO3 A;  3FJ9 A;  1A8D A;  1FN0 A;  1DJS B;  4J23 B;  4DCK C;  3R4S A;  5BP5 A;  3FJD A;  4EFP A;  2ET2 A;  4Q9P A;  2VXT I;  3CA5 A;  4D8H A;  4P0K A;  5BOW A;  1QXM A;  4LO3 A;  4HR6 C;  4DEP A;  3H6R B;  4QC4 A;  1ISX A;  3I2A A;  3V0B B;  1W3A A;  1R8N A;  1S0L A;  4OEG A;  4DEN A;  2UUS A;  1W3G A;  3A23 A;  3AJ5 A;  4QAL A;  4QO3 A;  1CVS A;  3FJI A;  2E4M C;  3MAL A;  1BFB A;  2F8X C;  2K4A B;  1K5V A;  3VEQ A;  1ISZ A;  3H6Q A;  1N4K A;  4LO1 A;  5FZY A;  1R8O A;  4IZE A;  5F8S A;  3BA7 A;  3FJC A;  4H75 A;  1JLY A;  1DQG A;  2RQ9 A;  1DFQ A;  5BQU A;  1IRA X;  1YF8 B;  3CA1 A;  4KEJ A;  1RG8 A;  5F8Y A;  2AQZ A;  1S0B A;  1EVT A;  3O4B A;  1TIE A;  4LO7 C;  2M49 A;  1I1B A;  1JTC A;  1EV2 A;  4H9W A;  4XFU A;  1DFC A;  5BP5 C;  2NS2 A;  2ZQN A;  3HBW A;  4Q91 A;  3V79 C;  4LO0 C;  5BXT A;  1W3F A;  1PZZ A;  2DRE A;  1TTU A;  2ESU A;  1BAR A;  2P23 A;  3AKF A;  3NBD A;  4USO A;  3BA4 A;  1BA7 A;  2VSA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...