3VWCA

High resolution structure of proteinase inhibitor from coprinopsis cinerea
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
146
structure length
146
Chain Sequence
SIKPGTYEVTSKVNGLHVGRPLAEDRSLLPKRIRVLPEDNNSGNSWVVEKDDDAYILYCKGAPVAPQEGKLFADLLGNMEDKKWIVTHQPQHGENVFTVVNASTEHGWVVPADAEELQQVEVRPLIAAPSYPPRYPATELFTFTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Serine protease inhibitor 1
publication title High resolution structure of proteinase inhibitor from Coprinopsis cinerea
rcsb
source organism Coprinopsis cinerea
molecule tags Hydrolase inhibitor
total genus 31
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2012-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vwcA00
4F34A 1AVUA 5FNXA 1JT7A 3FJDA 4JRAA 3VT0A 1ISXA 1YXWA 2HWMA 3W9TA 3N7KA 4KEIA 1ILR1 2DRYA 5EHAA 1TFMB 1EPWA 1NUNA 1OQLB 1VCLA 3BRDA 1S0DA 1IRAX 4X3AA 1HCEA 1XHBA 1M16A 3CA0A 2GO2A 1ISVA 2VSEA 4Q9GA 3KMVA 3R4SA 3AH1A 3LTQA 2VXTI 2XOAA 3Q7XA 4IY9A 2DS0A 3OBTA 2Z49A 1FMZA 2VUAA 4P6AA 1PWAA 5EC5A 2D7RA 3FJEA 4J2SA 2GZBA 3PG0A 5JLVA 1BLAA 4OWKA 3MALA 4GOVA 3WMVA 4QD2B 4Z8SB 3P53A 1XYFA 2AAIB 5BVPI 3P6IA 1BFFA 3FJAA 4I6IA 4ISQA 4DEPA 1T4QA 1SR4C 1Z2VA 1ISYA 2P39A 1WBAA 4G6JA 1HWPB 5BXPA 1G82A 1WD3A 2FDBM 4JQ0A 4I7IA 5F8SA 4OWLA 4IYBA 2FFUA 5BOWA 3LLPA 4D0TA 3RMYA 4LO0C 4I4QA 3AH2A 3NBDA 2M49A 4QALA 1K5VA 1M2TB 3IM6A 1I1BA 3O4OA 3V0BA 3Q7WA 2LIQA 5D63A 3H6QA 4I4XA 3FJ8A 1K5UA 4R6UB 4X37A 3JUTA 4USOA 5DVHA 1DFQA 1TOOA 2RQ9A 5BXTA 1SZ6B 2MIBA 1S0CA 2KLLA 4OEGA 1BA7A 3HALA 4ZFWB 2D24A 3FJHA 2MC2A 1DZCA 2X2SA 1KNMA 3OJVA 1ABRB 1DQGA 2VSAA 4JPZA 4YOLA 3BAVA 3QYDA 3VT1A 4A7YA 3D7WB 1Z0HA 3FGMA 4QBVA 1R8NA 4ZFYB 1FQ9A 1II4A 1S0BA 4IY8A 1IILA 3V0BB 2Y9FA 2HW9A 3TC2A 4I4YA 2VU9A 4I1EA 3AJ6A 1Z4SA 3EF2A 1S0FA 7I1BA 4LO7C 2FO1A 4P0KA 2J3PA 1E0OA 1YF8B 1TTUA 4AN7B 9ILBA 3HSMA 1HIBA 4XFUA 3N7MA 3IM5A 4I8MA 3BA5A 3E8LC 3AKFA 3O4BA 3QR5A 5I1BA 4CJMA 3A21A 1V6XA 1W3AA 3ZX7A 1V6UA 4G6MA 1TWMA 4I3NA 1JT5A 1UPSA 8I1BA 1D0HA 3F1RA 4HR6C 2DREA 1DJSB 4LO3C 1EYLA 31BIA 3WA1A 4I4SA 4LO2C 3R4UA 1Q1UA 3O49A 4L4HA 3CRHA 5BQUC 2D22A 1R8OA 3CA3A 3FJIA 4II0A 4TLPA 4XFSA 5FZZA 3RSJA 3IAGC 2HZ9A 1SR4A 6I1BA 1WD4A 4KEKA 4G9MA 1IRPA 1BFCA 1V6VA 1Q04A 1CE7B 1EV2A 2RSTA 3BTAA 5BP5C 2D7IA 1RMLA 2L5XA 3H6RA 4LO1C 3MPPG 5GAQA 2ET2A 4P0JA 3HBWA 4ISRA 1BFGA 3RMXA 4JP0A 3N7JA 1EVTA 2HWAA 1S0EA 2Y9WC 3OJ2A 5G00A 3BA4A 2Z48A 1BLDA 3O4AA 3CA4A 4G1RA 1IHKA 4F83A 3I2XA 4J23B 3NBCA 4OUJA 4IHZA 3IIRA 1HWOB 5E24E 4JKQA 4XFTA 1FV3A 3B9UA 1WBCA 2QN4A 3HOMA 3VEQA 1NZKA 3CA1A 1FWUA 1GGPB 2KI4A 3H6RB 4EFPA 2ZQNA 2NZ9A 4AN6A 3BB2A 3OGGA 4QD2C 1JLXA 2D44A 1JLYA 1BARA 1DFCA 3A07A 2FGFA 4WBCA 1AF9A 4I4RA 3BAQA 4Q91A 3PHZA 3POKA 1V6WA 4IQPA 3AZVA 3PUBA 4OEEA 2X2TA 5D61A 3N7LA 2BEBA 3FUOA 4I4PA 3N0KA 2K8RA 1QXMA 4P0LA 4DENA 4JKXB 1F31A 3CRGA 4DCKC 3V0AA 2ZR1B 4JAWA 3UJ0A 3WO2A 2WRYA 2K4AB 3AKIA 3BRGC 5EG6C 4QC4A 4LO8B 2VLCA 1IJTA 5FZUA 3O4CA 41BIA 2F2FC 3AKGA 4X39A 3BAOA 2K43A 2F8XC 1ITBA 2Q9XA 4ZA3B 1G9AA 4LO3A 3VWCA 4LO2A 1TIEA 1PZZA 2ESUA 2MLLB 3IM7A 3S8KA 2AQZA 1DLLA 3BAHA 4I96A 5JMCA 4LO7B 1RG8A 1HWNB 4G9NA 1FV2A 2QYIB 4QKSA 3V0AB 4J2YA 4ZLBB 2Y9XE 4I1BA 5BP5A 1DZDA 4D8HA 3BAGA 1AVWB 4LO1A 3ZXGA 2FFVA 4A7KA 1TP0A 3K1XA 1HWMB 4D0ZA 1QQKA 1W3GA 1AVAC 2UUSA 1JQZA 1PUMB 5F90A 5F8YA 3FJ9A 4QKRA 1IT0A 1IOBA 4XKIA 2Y9GA 3HN1A 1HKNA 5F8WA 5FZYA 5D62A 1ISZA 1JY0A 3ILAA 4GOYA 1RY7A 1DQOA 3UD7A 3UD8A 2D43A 2AXMA 3BRFA 1G9CA 2LIEA 1AFCA 3O4DA 4A7ZA 3I2AA 1P63A 4GP0A 4ZGRB 4LO0A 3V79C 3AH4A 3FUQA 2E4MC 2P23A 1MD6A 4HJJA 2IWTB 2NM1A 2NYYA 4I2SA 4L4IA 4X38A 2I1BA 3AKHA 4QBCA 3SNVA 4I37A 3A22A 4OWJA 3WMUA 2KI6B 2BEAA 4EEEB 4H04A 1HCDA 3VT2A 3VUOA 4EFQA 3WINC 3WO4A 5BXSA 1I1EA 4GP3A 3AJ5A 3HMYA 3ZC8A 4OEFA 5DZUA 1TWEA 2F2FA 3CQAA 3Q7YA 3PMEA 1ONKB 2ERMA 1BFBA 2NTDA 3CRIA 3P6JA 1FWVA 4PC4A 3NBNA 1J0SA 3A23A 2NP0A 3FJKA 1L2HA 1QQLA 3CU1B 1JT3A 3C9ZA 2NVHA 3O3QA 2VXRA 4GAFA 4J2KA 3UD9A 3F62B 3VSFA 2BFHA 3CAHA 1JT4A 1PC8B 4FVVA 4IONA 5DSSB 5BXRA 1FN0A 1YBIA 3FJCA 1S0GA 1DIWA 3RTJB 3OJMA 4USPA 3CA6A 1N4KA 3BX1C 4EB2B 3FFZA 5B2HA 4IZEA 4H9WA 3ZC9A 1AVXB 3H6SE 5BQUA 5HPZA 5FNWA 2DRZA 1S0LA 1PUUB 3FJJA 3NBEA 3O44A 1YYNA 1T9FA 2KKIA 1G9BA 4I4UA 4Q9PA 3AZWA 4I4OA 1A8DA 4I4VA 21BIA 4HA2A 2RG9B 3FJFA 3UDAA 2YUGA 2AFGA 4GAIA 3S8JA 4QO3A 5DUYA 4KC3A 3WO3A 2E4MA 4KEJA 1FGAA 2D1ZA 3VSZA 2R9KB 2D23A 1YTOA 4I0YA 4ZKTB 1AXMA 3ZXDA 1ISWA 3BAUA 4FGFA 4ZOTA 3FJBA 3CA5A 2Q3NB 1W3FA 1BASA 4IZXA 2WBCA 2ZQOA 1XG6A 3BA7A 3RTIB 3BADA 4J2XA 1CVSA 2IHOA 3T8SA 3UJ4A 1JTCA 3O5WB 3JRRA 3WINA 3OBRA 1XZZA 2KH2A 4KBBA 4EKXB 4ZFUB 3I29B 1RZOB 4OW4A 1MC9A 1FMMS 3OGFA 4ZBVB 4EFRA 1G9DA 2D20A 1Q03A 4Z9WB 3NJ5A 4ENDA
chains in the Genus database with same CATH superfamily
4F34A 1AVUA 5FNXA 1JT7A 3FJDA 4JRAA 3VT0A 1ISXA 1YXWA 2HWMA 3W9TA 3N7KA 4KEIA 1ILR1 2DRYA 5EHAA 1TFMB 1EPWA 1NUNA 1OQLB 1VCLA 3BRDA 1S0DA 1IRAX 4X3AA 1HCEA 1XHBA 1M16A 3CA0A 2GO2A 1ISVA 2VSEA 4Q9GA 3KMVA 3R4SA 3AH1A 3LTQA 2VXTI 2XOAA 3Q7XA 4IY9A 2DS0A 3OBTA 2Z49A 1FMZA 2VUAA 4P6AA 1PWAA 5EC5A 4MZGB 2D7RA 3FJEA 4J2SA 2GZBA 3PG0A 5JLVA 1BLAA 4OWKA 3MALA 4GOVA 3WMVA 4QD2B 4Z8SB 3P53A 1XYFA 2AAIB 5BVPI 3P6IA 1BFFA 3FJAA 4I6IA 4ISQA 4DEPA 1T4QA 1SR4C 1Z2VA 1ISYA 2P39A 1WBAA 4G6JA 1HWPB 5BXPA 1G82A 1WD3A 2FDBM 4JQ0A 4I7IA 5F8SA 4OWLA 4IYBA 2FFUA 5BOWA 3LLPA 4D0TA 3RMYA 4LO0C 4I4QA 3AH2A 3NBDA 2M49A 4QALA 1K5VA 4H75A 1M2TB 4UY4A 3IM6A 1I1BA 3O4OA 3V0BA 3Q7WA 2LIQA 5D63A 3H6QA 4I4XA 3FJ8A 1K5UA 4R6UB 4X37A 3JUTA 4USOA 5DVHA 1DFQA 1TOOA 2RQ9A 5BXTA 1SZ6B 2MIBA 1S0CA 2KLLA 4OEGA 1BA7A 3HALA 4ZFWB 2D24A 3FJHA 2MC2A 1DZCA 2X2SA 1KNMA 3OJVA 1ABRB 1DQGA 2VSAA 4JPZA 4YOLA 3BAVA 3QYDA 3VT1A 4A7YA 3D7WB 1Z0HA 3FGMA 4QBVA 1R8NA 4ZFYB 1FQ9A 1II4A 1S0BA 4IY8A 1IILA 3V0BB 2Y9FA 2HW9A 3TC2A 4I4YA 2VU9A 4I1EA 3AJ6A 1Z4SA 3EF2A 1S0FA 7I1BA 4LO7C 2FO1A 4P0KA 4MZHA 2J3PA 1E0OA 1YF8B 1TTUA 4AN7B 9ILBA 3HSMA 1HIBA 4XFUA 3N7MA 3IM5A 4I8MA 3BA5A 3E8LC 3AKFA 3O4BA 3QR5A 5I1BA 4CJMA 3A21A 1V6XA 1W3AA 3ZX7A 1V6UA 4G6MA 1TWMA 4I3NA 1JT5A 1UPSA 8I1BA 1D0HA 3F1RA 4HR6C 2DREA 1DJSB 4LO3C 1EYLA 31BIA 3WA1A 4I4SA 4LO2C 3R4UA 1Q1UA 3O49A 4L4HA 3CRHA 5BQUC 2D22A 1R8OA 3CA3A 3FJIA 4II0A 4TLPA 4XFSA 5FZZA 3RSJA 3IAGC 2HZ9A 1SR4A 6I1BA 1WD4A 4KEKA 4G9MA 1IRPA 1BFCA 1V6VA 1Q04A 1CE7B 1EV2A 2RSTA 3BTAA 5BP5C 2D7IA 1RMLA 2L5XA 3H6RA 4LO1C 3MPPG 5GAQA 2ET2A 4P0JA 3HBWA 4ISRA 1BFGA 3RMXA 4JP0A 3N7JA 1EVTA 2HWAA 1S0EA 2Y9WC 3OJ2A 5G00A 3BA4A 2Z48A 1BLDA 3O4AA 3CA4A 4G1RA 1IHKA 4F83A 3I2XA 4J23B 3NBCA 4OUJA 4IHZA 3IIRA 1HWOB 5E24E 4JKQA 4XFTA 1FV3A 3B9UA 1WBCA 2QN4A 3HOMA 3VEQA 1NZKA 3CA1A 1FWUA 1GGPB 2KI4A 3H6RB 4EFPA 2ZQNA 2NZ9A 4AN6A 3BB2A 3OGGA 4QD2C 1JLXA 2D44A 1JLYA 1BARA 1DFCA 3A07A 2FGFA 4WBCA 1AF9A 4I4RA 3BAQA 4Q91A 3PHZA 3POKA 1V6WA 4IQPA 3AZVA 3PUBA 4OEEA 2X2TA 5D61A 3N7LA 2BEBA 3FUOA 4I4PA 3N0KA 2K8RA 1QXMA 4P0LA 4DENA 4JKXB 1F31A 3CRGA 4DCKC 3V0AA 2ZR1B 4JAWA 3UJ0A 3WO2A 2WRYA 2K4AB 3AKIA 3BRGC 5EG6C 4QC4A 4LO8B 2VLCA 1IJTA 5FZUA 3O4CA 41BIA 2F2FC 3AKGA 4X39A 3BAOA 2K43A 2F8XC 1ITBA 2Q9XA 4ZA3B 1G9AA 4LO3A 3VWCA 4LO2A 1TIEA 1PZZA 2ESUA 2MLLB 3IM7A 3S8KA 2AQZA 1DLLA 3BAHA 4I96A 5JMCA 4LO7B 1RG8A 1HWNB 4G9NA 1FV2A 2QYIB 4QKSA 3V0AB 4J2YA 4ZLBB 2Y9XE 4I1BA 5BP5A 1DZDA 4D8HA 3BAGA 1AVWB 4LO1A 3ZXGA 2FFVA 4A7KA 1TP0A 3K1XA 1HWMB 4D0ZA 1QQKA 1W3GA 1AVAC 2UUSA 1JQZA 1PUMB 5F90A 5F8YA 4MZFB 3FJ9A 4QKRA 1IT0A 1IOBA 4XKIA 2Y9GA 3HN1A 1HKNA 5F8WA 5FZYA 5D62A 1ISZA 1JY0A 3ILAA 4GOYA 1RY7A 1DQOA 3UD7A 3UD8A 2D43A 2AXMA 3BRFA 1G9CA 2LIEA 1AFCA 3O4DA 4A7ZA 3I2AA 1P63A 4GP0A 4ZGRB 4LO0A 3V79C 3AH4A 3FUQA 2E4MC 2P23A 1MD6A 4HJJA 2IWTB 2NM1A 2NYYA 4I2SA 4L4IA 4X38A 2I1BA 3AKHA 4QBCA 3SNVA 4I37A 3A22A 4OWJA 3WMUA 2KI6B 2BEAA 4EEEB 4H04A 1HCDA 3VT2A 3VUOA 4EFQA 3WINC 3WO4A 5BXSA 1I1EA 4GP3A 3AJ5A 3HMYA 3ZC8A 4OEFA 5DZUA 1TWEA 2F2FA 3CQAA 3Q7YA 3PMEA 1ONKB 2ERMA 1BFBA 2NTDA 3CRIA 3P6JA 1FWVA 4PC4A 3NBNA 1J0SA 3A23A 2NS2A 2NP0A 3FJKA 1L2HA 1QQLA 3CU1B 1JT3A 3C9ZA 2NVHA 3O3QA 2VXRA 4GAFA 4J2KA 3UD9A 3F62B 3VSFA 2BFHA 3CAHA 1JT4A 1PC8B 4FVVA 4IONA 5DSSB 5BXRA 1FN0A 1YBIA 3FJCA 1S0GA 1DIWA 3RTJB 3OJMA 4USPA 3CA6A 1N4KA 3BX1C 4EB2B 3FFZA 5B2HA 4IZEA 4H9WA 3ZC9A 1AVXB 3H6SE 5BQUA 5HPZA 5FNWA 2DRZA 1S0LA 1PUUB 3FJJA 3NBEA 3O44A 1YYNA 1T9FA 2KKIA 1G9BA 4I4UA 4Q9PA 3AZWA 4I4OA 1A8DA 4I4VA 21BIA 4HA2A 2RG9B 3FJFA 3UDAA 2YUGA 2AFGA 4GAIA 3S8JA 4QO3A 5DUYA 4KC3A 3WO3A 2E4MA 4KEJA 1FGAA 2D1ZA 3VSZA 2R9KB 2D23A 1YTOA 4I0YA 4ZKTB 1AXMA 3ZXDA 1ISWA 3BAUA 4FGFA 4ZOTA 3FJBA 3CA5A 2Q3NB 1W3FA 1BASA 4IZXA 2WBCA 2ZQOA 1XG6A 3BA7A 3RTIB 3BADA 4J2XA 1CVSA 2IHOA 3T8SA 3UJ4A 1JTCA 3O5WB 3JRRA 3WINA 3OBRA 1XZZA 2KH2A 4KBBA 4EKXB 4ZFUB 3I29B 1RZOB 4OW4A 1MC9A 1FMMS 3OGFA 4ZBVB 4EFRA 1G9DA 2D20A 1Q03A 4Z9WB 3NJ5A 4ENDA
chains in the Genus database with same CATH topology
4F34A 1AVUA 5FNXA 1JT7A 3FJDA 4JRAA 3VT0A 1ISXA 1YXWA 2HWMA 3W9TA 3N7KA 4KEIA 1ILR1 2DRYA 5EHAA 1TFMB 1EPWA 1NUNA 1OQLB 1VCLA 3BRDA 1S0DA 1IRAX 4X3AA 1HCEA 1XHBA 1M16A 3CA0A 2GO2A 1ISVA 2VSEA 4Q9GA 3KMVA 3R4SA 3AH1A 3LTQA 2VXTI 2XOAA 3Q7XA 4IY9A 2DS0A 3OBTA 2Z49A 1FMZA 2VUAA 4P6AA 1PWAA 5EC5A 4MZGB 2D7RA 3FJEA 4J2SA 2GZBA 3PG0A 5JLVA 1BLAA 4OWKA 3MALA 4GOVA 3WMVA 4QD2B 4Z8SB 3P53A 1XYFA 2AAIB 5BVPI 3P6IA 1BFFA 3FJAA 4I6IA 4ISQA 4DEPA 1T4QA 1SR4C 1Z2VA 1ISYA 2P39A 1WBAA 4G6JA 1HWPB 5BXPA 1G82A 1WD3A 2FDBM 4JQ0A 4I7IA 5F8SA 4OWLA 4IYBA 2FFUA 5BOWA 3LLPA 4D0TA 3RMYA 4LO0C 4I4QA 3AH2A 3NBDA 2M49A 4QALA 1K5VA 4H75A 1M2TB 4UY4A 3IM6A 1I1BA 3O4OA 3V0BA 3Q7WA 2LIQA 5D63A 3H6QA 4I4XA 3FJ8A 1K5UA 4R6UB 4X37A 3JUTA 4USOA 5DVHA 1DFQA 1TOOA 2RQ9A 5BXTA 1SZ6B 2MIBA 1S0CA 2KLLA 4OEGA 1BA7A 3HALA 4ZFWB 2D24A 3FJHA 2MC2A 1DZCA 2X2SA 1KNMA 3OJVA 1ABRB 1DQGA 2VSAA 4JPZA 4YOLA 3BAVA 3QYDA 3VT1A 4A7YA 3D7WB 1Z0HA 3FGMA 4QBVA 1R8NA 4ZFYB 1FQ9A 1II4A 1S0BA 4IY8A 1IILA 3V0BB 2Y9FA 2HW9A 3TC2A 4I4YA 2VU9A 4I1EA 3AJ6A 1Z4SA 3EF2A 1S0FA 7I1BA 4LO7C 2FO1A 4P0KA 4MZHA 2J3PA 1E0OA 1YF8B 1TTUA 4AN7B 9ILBA 3HSMA 1HIBA 4XFUA 3N7MA 3IM5A 4I8MA 3BA5A 3E8LC 3AKFA 3O4BA 3QR5A 5I1BA 4CJMA 3A21A 1V6XA 1W3AA 3ZX7A 1V6UA 4G6MA 1TWMA 4I3NA 1JT5A 1UPSA 8I1BA 1D0HA 3F1RA 4HR6C 2DREA 1DJSB 4LO3C 1EYLA 31BIA 3WA1A 4I4SA 4LO2C 3R4UA 1Q1UA 3O49A 4L4HA 3CRHA 5BQUC 2D22A 1R8OA 3CA3A 3FJIA 4II0A 4TLPA 4XFSA 5FZZA 3RSJA 3IAGC 2HZ9A 1SR4A 6I1BA 1WD4A 4KEKA 4G9MA 1IRPA 1BFCA 1V6VA 1Q04A 1CE7B 1EV2A 2RSTA 3BTAA 5BP5C 2D7IA 1RMLA 2L5XA 3H6RA 4LO1C 3MPPG 5GAQA 2ET2A 4P0JA 3HBWA 4ISRA 1BFGA 3RMXA 4JP0A 3N7JA 1EVTA 2HWAA 1S0EA 2Y9WC 3OJ2A 5G00A 3BA4A 2Z48A 1BLDA 3O4AA 3CA4A 4G1RA 1IHKA 4F83A 3I2XA 4J23B 3NBCA 4OUJA 4IHZA 3IIRA 1HWOB 5E24E 4JKQA 4XFTA 1FV3A 3B9UA 1WBCA 2QN4A 3HOMA 3VEQA 1NZKA 3CA1A 1FWUA 1GGPB 2KI4A 3H6RB 4EFPA 2ZQNA 2NZ9A 4AN6A 3BB2A 3OGGA 4QD2C 1JLXA 2D44A 1JLYA 1BARA 1DFCA 3A07A 2FGFA 4WBCA 1AF9A 4I4RA 3BAQA 4Q91A 3PHZA 3POKA 1V6WA 4IQPA 3AZVA 3PUBA 4OEEA 2X2TA 5D61A 3N7LA 2BEBA 3FUOA 4I4PA 3N0KA 2K8RA 1QXMA 4P0LA 4DENA 4JKXB 1F31A 3CRGA 4DCKC 3V0AA 2ZR1B 4JAWA 3UJ0A 3WO2A 2WRYA 2K4AB 3AKIA 3BRGC 5EG6C 4QC4A 4LO8B 2VLCA 1IJTA 5FZUA 3O4CA 41BIA 2F2FC 3AKGA 4X39A 3BAOA 2K43A 2F8XC 1ITBA 2Q9XA 4ZA3B 1G9AA 4LO3A 3VWCA 4LO2A 1TIEA 1PZZA 2ESUA 2MLLB 3IM7A 3S8KA 2AQZA 1DLLA 3BAHA 4I96A 5JMCA 4LO7B 1RG8A 1HWNB 4G9NA 1FV2A 2QYIB 4QKSA 3V0AB 4J2YA 4ZLBB 2Y9XE 4I1BA 5BP5A 1DZDA 4D8HA 3BAGA 1AVWB 4LO1A 3ZXGA 2FFVA 4A7KA 1TP0A 3K1XA 1HWMB 4D0ZA 1QQKA 1W3GA 1AVAC 2UUSA 1JQZA 1PUMB 5F90A 5F8YA 4MZFB 3FJ9A 4QKRA 1IT0A 1IOBA 4XKIA 2Y9GA 3HN1A 1HKNA 5F8WA 5FZYA 5D62A 1ISZA 1JY0A 3ILAA 4GOYA 1RY7A 1DQOA 3UD7A 3UD8A 2D43A 2AXMA 3BRFA 1G9CA 2LIEA 1AFCA 3O4DA 4A7ZA 3I2AA 1P63A 4GP0A 4ZGRB 4LO0A 3V79C 3AH4A 3FUQA 2E4MC 2P23A 1MD6A 4HJJA 2IWTB 2NM1A 2NYYA 4I2SA 4L4IA 4X38A 2I1BA 3AKHA 4QBCA 3SNVA 4I37A 3A22A 4OWJA 3WMUA 2KI6B 2BEAA 4EEEB 4H04A 1HCDA 3VT2A 3VUOA 4EFQA 3WINC 3WO4A 5BXSA 1I1EA 4GP3A 3AJ5A 3HMYA 3ZC8A 4OEFA 5DZUA 1TWEA 2F2FA 3CQAA 3Q7YA 3PMEA 1ONKB 2ERMA 1BFBA 2NTDA 3CRIA 3P6JA 1FWVA 4PC4A 3NBNA 1J0SA 3A23A 2NS2A 2NP0A 3FJKA 1L2HA 1QQLA 3CU1B 1JT3A 3C9ZA 2NVHA 3O3QA 2VXRA 4GAFA 4J2KA 3UD9A 3F62B 3VSFA 2BFHA 3CAHA 1JT4A 1PC8B 4FVVA 4IONA 5DSSB 5BXRA 1FN0A 1YBIA 3FJCA 1S0GA 1DIWA 3RTJB 3OJMA 4USPA 3CA6A 1N4KA 3BX1C 4EB2B 3FFZA 5B2HA 4IZEA 4H9WA 3ZC9A 1AVXB 3H6SE 5BQUA 5HPZA 5FNWA 2DRZA 1S0LA 1PUUB 3FJJA 3NBEA 3O44A 1YYNA 1T9FA 2KKIA 1G9BA 4I4UA 4Q9PA 3AZWA 4I4OA 1A8DA 4I4VA 21BIA 4HA2A 2RG9B 3FJFA 3UDAA 2YUGA 2AFGA 4GAIA 3S8JA 4QO3A 5DUYA 4KC3A 3WO3A 2E4MA 4KEJA 1FGAA 2D1ZA 3VSZA 2R9KB 2D23A 1YTOA 4I0YA 4ZKTB 1AXMA 3ZXDA 1ISWA 3BAUA 4FGFA 4ZOTA 3FJBA 3CA5A 2Q3NB 1W3FA 1BASA 4IZXA 2WBCA 2ZQOA 1XG6A 3BA7A 3RTIB 3BADA 4J2XA 1CVSA 2IHOA 3T8SA 3UJ4A 1JTCA 3O5WB 3JRRA 3WINA 3OBRA 1XZZA 2KH2A 4KBBA 4EKXB 4ZFUB 3I29B 1RZOB 4OW4A 1MC9A 1FMMS 3OGFA 4ZBVB 4EFRA 1G9DA 2D20A 1Q03A 4Z9WB 3NJ5A 4ENDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F34 A;  1AVU A;  5FNX A;  1JT7 A;  3FJD A;  4JRA A;  3VT0 A;  1ISX A;  1YXW A;  2HWM A;  3W9T A;  3N7K A;  4KEI A;  1ILR 1;  2DRY A;  5EHA A;  1TFM B;  1EPW A;  1NUN A;  1OQL B;  1VCL A;  3BRD A;  1S0D A;  1IRA X;  4X3A A;  1HCE A;  1XHB A;  1M16 A;  3CA0 A;  2GO2 A;  1ISV A;  2VSE A;  4Q9G A;  3KMV A;  3R4S A;  3AH1 A;  3LTQ A;  2VXT I;  2XOA A;  3Q7X A;  4IY9 A;  2DS0 A;  3OBT A;  2Z49 A;  1FMZ A;  2VUA A;  4P6A A;  1PWA A;  5EC5 A;  2D7R A;  3FJE A;  4J2S A;  2GZB A;  3PG0 A;  5JLV A;  1BLA A;  4OWK A;  3MAL A;  4GOV A;  3WMV A;  4QD2 B;  4Z8S B;  3P53 A;  1XYF A;  2AAI B;  5BVP I;  3P6I A;  1BFF A;  3FJA A;  4I6I A;  4ISQ A;  4DEP A;  1T4Q A;  1SR4 C;  1Z2V A;  1ISY A;  2P39 A;  1WBA A;  4G6J A;  1HWP B;  5BXP A;  1G82 A;  1WD3 A;  2FDB M;  4JQ0 A;  4I7I A;  5F8S A;  4OWL A;  4IYB A;  2FFU A;  5BOW A;  3LLP A;  4D0T A;  3RMY A;  4LO0 C;  4I4Q A;  3AH2 A;  3NBD A;  2M49 A;  4QAL A;  1K5V A;  1M2T B;  3IM6 A;  1I1B A;  3O4O A;  3V0B A;  3Q7W A;  2LIQ A;  5D63 A;  3H6Q A;  4I4X A;  3FJ8 A;  1K5U A;  4R6U B;  4X37 A;  3JUT A;  4USO A;  5DVH A;  1DFQ A;  1TOO A;  2RQ9 A;  5BXT A;  1SZ6 B;  2MIB A;  1S0C A;  2KLL A;  4OEG A;  1BA7 A;  3HAL A;  4ZFW B;  2D24 A;  3FJH A;  2MC2 A;  1DZC A;  2X2S A;  1KNM A;  3OJV A;  1ABR B;  1DQG A;  2VSA A;  4JPZ A;  4YOL A;  3BAV A;  3QYD A;  3VT1 A;  4A7Y A;  3D7W B;  1Z0H A;  3FGM A;  4QBV A;  1R8N A;  4ZFY B;  1FQ9 A;  1II4 A;  1S0B A;  4IY8 A;  1IIL A;  3V0B B;  2Y9F A;  2HW9 A;  3TC2 A;  4I4Y A;  2VU9 A;  4I1E A;  3AJ6 A;  1Z4S A;  3EF2 A;  1S0F A;  7I1B A;  4LO7 C;  2FO1 A;  4P0K A;  2J3P A;  1E0O A;  1YF8 B;  1TTU A;  4AN7 B;  9ILB A;  3HSM A;  1HIB A;  4XFU A;  3N7M A;  3IM5 A;  4I8M A;  3BA5 A;  3E8L C;  3AKF A;  3O4B A;  3QR5 A;  5I1B A;  4CJM A;  3A21 A;  1V6X A;  1W3A A;  3ZX7 A;  1V6U A;  4G6M A;  1TWM A;  4I3N A;  1JT5 A;  1UPS A;  8I1B A;  1D0H A;  3F1R A;  4HR6 C;  2DRE A;  1DJS B;  4LO3 C;  1EYL A;  31BI A;  3WA1 A;  4I4S A;  4LO2 C;  3R4U A;  1Q1U A;  3O49 A;  4L4H A;  3CRH A;  5BQU C;  2D22 A;  1R8O A;  3CA3 A;  3FJI A;  4II0 A;  4TLP A;  4XFS A;  5FZZ A;  3RSJ A;  3IAG C;  2HZ9 A;  1SR4 A;  6I1B A;  1WD4 A;  4KEK A;  4G9M A;  1IRP A;  1BFC A;  1V6V A;  1Q04 A;  1CE7 B;  1EV2 A;  2RST A;  3BTA A;  5BP5 C;  2D7I A;  1RML A;  2L5X A;  3H6R A;  4LO1 C;  3MPP G;  5GAQ A;  2ET2 A;  4P0J A;  3HBW A;  4ISR A;  1BFG A;  3RMX A;  4JP0 A;  3N7J A;  1EVT A;  2HWA A;  1S0E A;  2Y9W C;  3OJ2 A;  5G00 A;  3BA4 A;  2Z48 A;  1BLD A;  3O4A A;  3CA4 A;  4G1R A;  1IHK A;  4F83 A;  3I2X A;  4J23 B;  3NBC A;  4OUJ A;  4IHZ A;  3IIR A;  1HWO B;  5E24 E;  4JKQ A;  4XFT A;  1FV3 A;  3B9U A;  1WBC A;  2QN4 A;  3HOM A;  3VEQ A;  1NZK A;  3CA1 A;  1FWU A;  1GGP B;  2KI4 A;  3H6R B;  4EFP A;  2ZQN A;  2NZ9 A;  4AN6 A;  3BB2 A;  3OGG A;  4QD2 C;  1JLX A;  2D44 A;  1JLY A;  1BAR A;  1DFC A;  3A07 A;  2FGF A;  4WBC A;  1AF9 A;  4I4R A;  3BAQ A;  4Q91 A;  3PHZ A;  3POK A;  1V6W A;  4IQP A;  3AZV A;  3PUB A;  4OEE A;  2X2T A;  5D61 A;  3N7L A;  2BEB A;  3FUO A;  4I4P A;  3N0K A;  2K8R A;  1QXM A;  4P0L A;  4DEN A;  4JKX B;  1F31 A;  3CRG A;  4DCK C;  3V0A A;  2ZR1 B;  4JAW A;  3UJ0 A;  3WO2 A;  2WRY A;  2K4A B;  3AKI A;  3BRG C;  5EG6 C;  4QC4 A;  4LO8 B;  2VLC A;  1IJT A;  5FZU A;  3O4C A;  41BI A;  2F2F C;  3AKG A;  4X39 A;  3BAO A;  2K43 A;  2F8X C;  1ITB A;  2Q9X A;  4ZA3 B;  1G9A A;  4LO3 A;  3VWC A;  4LO2 A;  1TIE A;  1PZZ A;  2ESU A;  2MLL B;  3IM7 A;  3S8K A;  2AQZ A;  1DLL A;  3BAH A;  4I96 A;  5JMC A;  4LO7 B;  1RG8 A;  1HWN B;  4G9N A;  1FV2 A;  2QYI B;  4QKS A;  3V0A B;  4J2Y A;  4ZLB B;  2Y9X E;  4I1B A;  5BP5 A;  1DZD A;  4D8H A;  3BAG A;  1AVW B;  4LO1 A;  3ZXG A;  2FFV A;  4A7K A;  1TP0 A;  3K1X A;  1HWM B;  4D0Z A;  1QQK A;  1W3G A;  1AVA C;  2UUS A;  1JQZ A;  1PUM B;  5F90 A;  5F8Y A;  3FJ9 A;  4QKR A;  1IT0 A;  1IOB A;  4XKI A;  2Y9G A;  3HN1 A;  1HKN A;  5F8W A;  5FZY A;  5D62 A;  1ISZ A;  1JY0 A;  3ILA A;  4GOY A;  1RY7 A;  1DQO A;  3UD7 A;  3UD8 A;  2D43 A;  2AXM A;  3BRF A;  1G9C A;  2LIE A;  1AFC A;  3O4D A;  4A7Z A;  3I2A A;  1P63 A;  4GP0 A;  4ZGR B;  4LO0 A;  3V79 C;  3AH4 A;  3FUQ A;  2E4M C;  2P23 A;  1MD6 A;  4HJJ A;  2IWT B;  2NM1 A;  2NYY A;  4I2S A;  4L4I A;  4X38 A;  2I1B A;  3AKH A;  4QBC A;  3SNV A;  4I37 A;  3A22 A;  4OWJ A;  3WMU A;  2KI6 B;  2BEA A;  4EEE B;  4H04 A;  1HCD A;  3VT2 A;  3VUO A;  4EFQ A;  3WIN C;  3WO4 A;  5BXS A;  1I1E A;  4GP3 A;  3AJ5 A;  3HMY A;  3ZC8 A;  4OEF A;  5DZU A;  1TWE A;  2F2F A;  3CQA A;  3Q7Y A;  3PME A;  1ONK B;  2ERM A;  1BFB A;  2NTD A;  3CRI A;  3P6J A;  1FWV A;  4PC4 A;  3NBN A;  1J0S A;  3A23 A;  2NP0 A;  3FJK A;  1L2H A;  1QQL A;  3CU1 B;  1JT3 A;  3C9Z A;  2NVH A;  3O3Q A;  2VXR A;  4GAF A;  4J2K A;  3UD9 A;  3F62 B;  3VSF A;  2BFH A;  3CAH A;  1JT4 A;  1PC8 B;  4FVV A;  4ION A;  5DSS B;  5BXR A;  1FN0 A;  1YBI A;  3FJC A;  1S0G A;  1DIW A;  3RTJ B;  3OJM A;  4USP A;  3CA6 A;  1N4K A;  3BX1 C;  4EB2 B;  3FFZ A;  5B2H A;  4IZE A;  4H9W A;  3ZC9 A;  1AVX B;  3H6S E;  5BQU A;  5HPZ A;  5FNW A;  2DRZ A;  1S0L A;  1PUU B;  3FJJ A;  3NBE A;  3O44 A;  1YYN A;  1T9F A;  2KKI A;  1G9B A;  4I4U A;  4Q9P A;  3AZW A;  4I4O A;  1A8D A;  4I4V A;  21BI A;  4HA2 A;  2RG9 B;  3FJF A;  3UDA A;  2YUG A;  2AFG A;  4GAI A;  3S8J A;  4QO3 A;  5DUY A;  4KC3 A;  3WO3 A;  2E4M A;  4KEJ A;  1FGA A;  2D1Z A;  3VSZ A;  2R9K B;  2D23 A;  1YTO A;  4I0Y A;  4ZKT B;  1AXM A;  3ZXD A;  1ISW A;  3BAU A;  4FGF A;  4ZOT A;  3FJB A;  3CA5 A;  2Q3N B;  1W3F A;  1BAS A;  4IZX A;  2WBC A;  2ZQO A;  1XG6 A;  3BA7 A;  3RTI B;  3BAD A;  4J2X A;  1CVS A;  2IHO A;  3T8S A;  3UJ4 A;  1JTC A;  3O5W B;  3JRR A;  3WIN A;  3OBR A;  1XZZ A;  2KH2 A;  4KBB A;  4EKX B;  4ZFU B;  3I29 B;  1RZO B;  4OW4 A;  1MC9 A;  1FMM S;  3OGF A;  4ZBV B;  4EFR A;  1G9D A;  2D20 A;  1Q03 A;  4Z9W B;  3NJ5 A;  4END A; 
#chains in the Genus database with same CATH topology
 4F34 A;  1AVU A;  5FNX A;  1JT7 A;  3FJD A;  4JRA A;  3VT0 A;  1ISX A;  1YXW A;  2HWM A;  3W9T A;  3N7K A;  4KEI A;  1ILR 1;  2DRY A;  5EHA A;  1TFM B;  1EPW A;  1NUN A;  1OQL B;  1VCL A;  3BRD A;  1S0D A;  1IRA X;  4X3A A;  1HCE A;  1XHB A;  1M16 A;  3CA0 A;  2GO2 A;  1ISV A;  2VSE A;  4Q9G A;  3KMV A;  3R4S A;  3AH1 A;  3LTQ A;  2VXT I;  2XOA A;  3Q7X A;  4IY9 A;  2DS0 A;  3OBT A;  2Z49 A;  1FMZ A;  2VUA A;  4P6A A;  1PWA A;  5EC5 A;  4MZG B;  2D7R A;  3FJE A;  4J2S A;  2GZB A;  3PG0 A;  5JLV A;  1BLA A;  4OWK A;  3MAL A;  4GOV A;  3WMV A;  4QD2 B;  4Z8S B;  3P53 A;  1XYF A;  2AAI B;  5BVP I;  3P6I A;  1BFF A;  3FJA A;  4I6I A;  4ISQ A;  4DEP A;  1T4Q A;  1SR4 C;  1Z2V A;  1ISY A;  2P39 A;  1WBA A;  4G6J A;  1HWP B;  5BXP A;  1G82 A;  1WD3 A;  2FDB M;  4JQ0 A;  4I7I A;  5F8S A;  4OWL A;  4IYB A;  2FFU A;  5BOW A;  3LLP A;  4D0T A;  3RMY A;  4LO0 C;  4I4Q A;  3AH2 A;  3NBD A;  2M49 A;  4QAL A;  1K5V A;  4H75 A;  1M2T B;  4UY4 A;  3IM6 A;  1I1B A;  3O4O A;  3V0B A;  3Q7W A;  2LIQ A;  5D63 A;  3H6Q A;  4I4X A;  3FJ8 A;  1K5U A;  4R6U B;  4X37 A;  3JUT A;  4USO A;  5DVH A;  1DFQ A;  1TOO A;  2RQ9 A;  5BXT A;  1SZ6 B;  2MIB A;  1S0C A;  2KLL A;  4OEG A;  1BA7 A;  3HAL A;  4ZFW B;  2D24 A;  3FJH A;  2MC2 A;  1DZC A;  2X2S A;  1KNM A;  3OJV A;  1ABR B;  1DQG A;  2VSA A;  4JPZ A;  4YOL A;  3BAV A;  3QYD A;  3VT1 A;  4A7Y A;  3D7W B;  1Z0H A;  3FGM A;  4QBV A;  1R8N A;  4ZFY B;  1FQ9 A;  1II4 A;  1S0B A;  4IY8 A;  1IIL A;  3V0B B;  2Y9F A;  2HW9 A;  3TC2 A;  4I4Y A;  2VU9 A;  4I1E A;  3AJ6 A;  1Z4S A;  3EF2 A;  1S0F A;  7I1B A;  4LO7 C;  2FO1 A;  4P0K A;  4MZH A;  2J3P A;  1E0O A;  1YF8 B;  1TTU A;  4AN7 B;  9ILB A;  3HSM A;  1HIB A;  4XFU A;  3N7M A;  3IM5 A;  4I8M A;  3BA5 A;  3E8L C;  3AKF A;  3O4B A;  3QR5 A;  5I1B A;  4CJM A;  3A21 A;  1V6X A;  1W3A A;  3ZX7 A;  1V6U A;  4G6M A;  1TWM A;  4I3N A;  1JT5 A;  1UPS A;  8I1B A;  1D0H A;  3F1R A;  4HR6 C;  2DRE A;  1DJS B;  4LO3 C;  1EYL A;  31BI A;  3WA1 A;  4I4S A;  4LO2 C;  3R4U A;  1Q1U A;  3O49 A;  4L4H A;  3CRH A;  5BQU C;  2D22 A;  1R8O A;  3CA3 A;  3FJI A;  4II0 A;  4TLP A;  4XFS A;  5FZZ A;  3RSJ A;  3IAG C;  2HZ9 A;  1SR4 A;  6I1B A;  1WD4 A;  4KEK A;  4G9M A;  1IRP A;  1BFC A;  1V6V A;  1Q04 A;  1CE7 B;  1EV2 A;  2RST A;  3BTA A;  5BP5 C;  2D7I A;  1RML A;  2L5X A;  3H6R A;  4LO1 C;  3MPP G;  5GAQ A;  2ET2 A;  4P0J A;  3HBW A;  4ISR A;  1BFG A;  3RMX A;  4JP0 A;  3N7J A;  1EVT A;  2HWA A;  1S0E A;  2Y9W C;  3OJ2 A;  5G00 A;  3BA4 A;  2Z48 A;  1BLD A;  3O4A A;  3CA4 A;  4G1R A;  1IHK A;  4F83 A;  3I2X A;  4J23 B;  3NBC A;  4OUJ A;  4IHZ A;  3IIR A;  1HWO B;  5E24 E;  4JKQ A;  4XFT A;  1FV3 A;  3B9U A;  1WBC A;  2QN4 A;  3HOM A;  3VEQ A;  1NZK A;  3CA1 A;  1FWU A;  1GGP B;  2KI4 A;  3H6R B;  4EFP A;  2ZQN A;  2NZ9 A;  4AN6 A;  3BB2 A;  3OGG A;  4QD2 C;  1JLX A;  2D44 A;  1JLY A;  1BAR A;  1DFC A;  3A07 A;  2FGF A;  4WBC A;  1AF9 A;  4I4R A;  3BAQ A;  4Q91 A;  3PHZ A;  3POK A;  1V6W A;  4IQP A;  3AZV A;  3PUB A;  4OEE A;  2X2T A;  5D61 A;  3N7L A;  2BEB A;  3FUO A;  4I4P A;  3N0K A;  2K8R A;  1QXM A;  4P0L A;  4DEN A;  4JKX B;  1F31 A;  3CRG A;  4DCK C;  3V0A A;  2ZR1 B;  4JAW A;  3UJ0 A;  3WO2 A;  2WRY A;  2K4A B;  3AKI A;  3BRG C;  5EG6 C;  4QC4 A;  4LO8 B;  2VLC A;  1IJT A;  5FZU A;  3O4C A;  41BI A;  2F2F C;  3AKG A;  4X39 A;  3BAO A;  2K43 A;  2F8X C;  1ITB A;  2Q9X A;  4ZA3 B;  1G9A A;  4LO3 A;  3VWC A;  4LO2 A;  1TIE A;  1PZZ A;  2ESU A;  2MLL B;  3IM7 A;  3S8K A;  2AQZ A;  1DLL A;  3BAH A;  4I96 A;  5JMC A;  4LO7 B;  1RG8 A;  1HWN B;  4G9N A;  1FV2 A;  2QYI B;  4QKS A;  3V0A B;  4J2Y A;  4ZLB B;  2Y9X E;  4I1B A;  5BP5 A;  1DZD A;  4D8H A;  3BAG A;  1AVW B;  4LO1 A;  3ZXG A;  2FFV A;  4A7K A;  1TP0 A;  3K1X A;  1HWM B;  4D0Z A;  1QQK A;  1W3G A;  1AVA C;  2UUS A;  1JQZ A;  1PUM B;  5F90 A;  5F8Y A;  4MZF B;  3FJ9 A;  4QKR A;  1IT0 A;  1IOB A;  4XKI A;  2Y9G A;  3HN1 A;  1HKN A;  5F8W A;  5FZY A;  5D62 A;  1ISZ A;  1JY0 A;  3ILA A;  4GOY A;  1RY7 A;  1DQO A;  3UD7 A;  3UD8 A;  2D43 A;  2AXM A;  3BRF A;  1G9C A;  2LIE A;  1AFC A;  3O4D A;  4A7Z A;  3I2A A;  1P63 A;  4GP0 A;  4ZGR B;  4LO0 A;  3V79 C;  3AH4 A;  3FUQ A;  2E4M C;  2P23 A;  1MD6 A;  4HJJ A;  2IWT B;  2NM1 A;  2NYY A;  4I2S A;  4L4I A;  4X38 A;  2I1B A;  3AKH A;  4QBC A;  3SNV A;  4I37 A;  3A22 A;  4OWJ A;  3WMU A;  2KI6 B;  2BEA A;  4EEE B;  4H04 A;  1HCD A;  3VT2 A;  3VUO A;  4EFQ A;  3WIN C;  3WO4 A;  5BXS A;  1I1E A;  4GP3 A;  3AJ5 A;  3HMY A;  3ZC8 A;  4OEF A;  5DZU A;  1TWE A;  2F2F A;  3CQA A;  3Q7Y A;  3PME A;  1ONK B;  2ERM A;  1BFB A;  2NTD A;  3CRI A;  3P6J A;  1FWV A;  4PC4 A;  3NBN A;  1J0S A;  3A23 A;  2NS2 A;  2NP0 A;  3FJK A;  1L2H A;  1QQL A;  3CU1 B;  1JT3 A;  3C9Z A;  2NVH A;  3O3Q A;  2VXR A;  4GAF A;  4J2K A;  3UD9 A;  3F62 B;  3VSF A;  2BFH A;  3CAH A;  1JT4 A;  1PC8 B;  4FVV A;  4ION A;  5DSS B;  5BXR A;  1FN0 A;  1YBI A;  3FJC A;  1S0G A;  1DIW A;  3RTJ B;  3OJM A;  4USP A;  3CA6 A;  1N4K A;  3BX1 C;  4EB2 B;  3FFZ A;  5B2H A;  4IZE A;  4H9W A;  3ZC9 A;  1AVX B;  3H6S E;  5BQU A;  5HPZ A;  5FNW A;  2DRZ A;  1S0L A;  1PUU B;  3FJJ A;  3NBE A;  3O44 A;  1YYN A;  1T9F A;  2KKI A;  1G9B A;  4I4U A;  4Q9P A;  3AZW A;  4I4O A;  1A8D A;  4I4V A;  21BI A;  4HA2 A;  2RG9 B;  3FJF A;  3UDA A;  2YUG A;  2AFG A;  4GAI A;  3S8J A;  4QO3 A;  5DUY A;  4KC3 A;  3WO3 A;  2E4M A;  4KEJ A;  1FGA A;  2D1Z A;  3VSZ A;  2R9K B;  2D23 A;  1YTO A;  4I0Y A;  4ZKT B;  1AXM A;  3ZXD A;  1ISW A;  3BAU A;  4FGF A;  4ZOT A;  3FJB A;  3CA5 A;  2Q3N B;  1W3F A;  1BAS A;  4IZX A;  2WBC A;  2ZQO A;  1XG6 A;  3BA7 A;  3RTI B;  3BAD A;  4J2X A;  1CVS A;  2IHO A;  3T8S A;  3UJ4 A;  1JTC A;  3O5W B;  3JRR A;  3WIN A;  3OBR A;  1XZZ A;  2KH2 A;  4KBB A;  4EKX B;  4ZFU B;  3I29 B;  1RZO B;  4OW4 A;  1MC9 A;  1FMM S;  3OGF A;  4ZBV B;  4EFR A;  1G9D A;  2D20 A;  1Q03 A;  4Z9W B;  3NJ5 A;  4END A; 
#chains in the Genus database with same CATH homology
 4F34 A;  1AVU A;  5FNX A;  1JT7 A;  3FJD A;  4JRA A;  3VT0 A;  1ISX A;  1YXW A;  2HWM A;  3W9T A;  3N7K A;  4KEI A;  1ILR 1;  2DRY A;  5EHA A;  1TFM B;  1EPW A;  1NUN A;  1OQL B;  1VCL A;  3BRD A;  1S0D A;  1IRA X;  4X3A A;  1HCE A;  1XHB A;  1M16 A;  3CA0 A;  2GO2 A;  1ISV A;  2VSE A;  4Q9G A;  3KMV A;  3R4S A;  3AH1 A;  3LTQ A;  2VXT I;  2XOA A;  3Q7X A;  4IY9 A;  2DS0 A;  3OBT A;  2Z49 A;  1FMZ A;  2VUA A;  4P6A A;  1PWA A;  5EC5 A;  4MZG B;  2D7R A;  3FJE A;  4J2S A;  2GZB A;  3PG0 A;  5JLV A;  1BLA A;  4OWK A;  3MAL A;  4GOV A;  3WMV A;  4QD2 B;  4Z8S B;  3P53 A;  1XYF A;  2AAI B;  5BVP I;  3P6I A;  1BFF A;  3FJA A;  4I6I A;  4ISQ A;  4DEP A;  1T4Q A;  1SR4 C;  1Z2V A;  1ISY A;  2P39 A;  1WBA A;  4G6J A;  1HWP B;  5BXP A;  1G82 A;  1WD3 A;  2FDB M;  4JQ0 A;  4I7I A;  5F8S A;  4OWL A;  4IYB A;  2FFU A;  5BOW A;  3LLP A;  4D0T A;  3RMY A;  4LO0 C;  4I4Q A;  3AH2 A;  3NBD A;  2M49 A;  4QAL A;  1K5V A;  4H75 A;  1M2T B;  4UY4 A;  3IM6 A;  1I1B A;  3O4O A;  3V0B A;  3Q7W A;  2LIQ A;  5D63 A;  3H6Q A;  4I4X A;  3FJ8 A;  1K5U A;  4R6U B;  4X37 A;  3JUT A;  4USO A;  5DVH A;  1DFQ A;  1TOO A;  2RQ9 A;  5BXT A;  1SZ6 B;  2MIB A;  1S0C A;  2KLL A;  4OEG A;  1BA7 A;  3HAL A;  4ZFW B;  2D24 A;  3FJH A;  2MC2 A;  1DZC A;  2X2S A;  1KNM A;  3OJV A;  1ABR B;  1DQG A;  2VSA A;  4JPZ A;  4YOL A;  3BAV A;  3QYD A;  3VT1 A;  4A7Y A;  3D7W B;  1Z0H A;  3FGM A;  4QBV A;  1R8N A;  4ZFY B;  1FQ9 A;  1II4 A;  1S0B A;  4IY8 A;  1IIL A;  3V0B B;  2Y9F A;  2HW9 A;  3TC2 A;  4I4Y A;  2VU9 A;  4I1E A;  3AJ6 A;  1Z4S A;  3EF2 A;  1S0F A;  7I1B A;  4LO7 C;  2FO1 A;  4P0K A;  4MZH A;  2J3P A;  1E0O A;  1YF8 B;  1TTU A;  4AN7 B;  9ILB A;  3HSM A;  1HIB A;  4XFU A;  3N7M A;  3IM5 A;  4I8M A;  3BA5 A;  3E8L C;  3AKF A;  3O4B A;  3QR5 A;  5I1B A;  4CJM A;  3A21 A;  1V6X A;  1W3A A;  3ZX7 A;  1V6U A;  4G6M A;  1TWM A;  4I3N A;  1JT5 A;  1UPS A;  8I1B A;  1D0H A;  3F1R A;  4HR6 C;  2DRE A;  1DJS B;  4LO3 C;  1EYL A;  31BI A;  3WA1 A;  4I4S A;  4LO2 C;  3R4U A;  1Q1U A;  3O49 A;  4L4H A;  3CRH A;  5BQU C;  2D22 A;  1R8O A;  3CA3 A;  3FJI A;  4II0 A;  4TLP A;  4XFS A;  5FZZ A;  3RSJ A;  3IAG C;  2HZ9 A;  1SR4 A;  6I1B A;  1WD4 A;  4KEK A;  4G9M A;  1IRP A;  1BFC A;  1V6V A;  1Q04 A;  1CE7 B;  1EV2 A;  2RST A;  3BTA A;  5BP5 C;  2D7I A;  1RML A;  2L5X A;  3H6R A;  4LO1 C;  3MPP G;  5GAQ A;  2ET2 A;  4P0J A;  3HBW A;  4ISR A;  1BFG A;  3RMX A;  4JP0 A;  3N7J A;  1EVT A;  2HWA A;  1S0E A;  2Y9W C;  3OJ2 A;  5G00 A;  3BA4 A;  2Z48 A;  1BLD A;  3O4A A;  3CA4 A;  4G1R A;  1IHK A;  4F83 A;  3I2X A;  4J23 B;  3NBC A;  4OUJ A;  4IHZ A;  3IIR A;  1HWO B;  5E24 E;  4JKQ A;  4XFT A;  1FV3 A;  3B9U A;  1WBC A;  2QN4 A;  3HOM A;  3VEQ A;  1NZK A;  3CA1 A;  1FWU A;  1GGP B;  2KI4 A;  3H6R B;  4EFP A;  2ZQN A;  2NZ9 A;  4AN6 A;  3BB2 A;  3OGG A;  4QD2 C;  1JLX A;  2D44 A;  1JLY A;  1BAR A;  1DFC A;  3A07 A;  2FGF A;  4WBC A;  1AF9 A;  4I4R A;  3BAQ A;  4Q91 A;  3PHZ A;  3POK A;  1V6W A;  4IQP A;  3AZV A;  3PUB A;  4OEE A;  2X2T A;  5D61 A;  3N7L A;  2BEB A;  3FUO A;  4I4P A;  3N0K A;  2K8R A;  1QXM A;  4P0L A;  4DEN A;  4JKX B;  1F31 A;  3CRG A;  4DCK C;  3V0A A;  2ZR1 B;  4JAW A;  3UJ0 A;  3WO2 A;  2WRY A;  2K4A B;  3AKI A;  3BRG C;  5EG6 C;  4QC4 A;  4LO8 B;  2VLC A;  1IJT A;  5FZU A;  3O4C A;  41BI A;  2F2F C;  3AKG A;  4X39 A;  3BAO A;  2K43 A;  2F8X C;  1ITB A;  2Q9X A;  4ZA3 B;  1G9A A;  4LO3 A;  3VWC A;  4LO2 A;  1TIE A;  1PZZ A;  2ESU A;  2MLL B;  3IM7 A;  3S8K A;  2AQZ A;  1DLL A;  3BAH A;  4I96 A;  5JMC A;  4LO7 B;  1RG8 A;  1HWN B;  4G9N A;  1FV2 A;  2QYI B;  4QKS A;  3V0A B;  4J2Y A;  4ZLB B;  2Y9X E;  4I1B A;  5BP5 A;  1DZD A;  4D8H A;  3BAG A;  1AVW B;  4LO1 A;  3ZXG A;  2FFV A;  4A7K A;  1TP0 A;  3K1X A;  1HWM B;  4D0Z A;  1QQK A;  1W3G A;  1AVA C;  2UUS A;  1JQZ A;  1PUM B;  5F90 A;  5F8Y A;  4MZF B;  3FJ9 A;  4QKR A;  1IT0 A;  1IOB A;  4XKI A;  2Y9G A;  3HN1 A;  1HKN A;  5F8W A;  5FZY A;  5D62 A;  1ISZ A;  1JY0 A;  3ILA A;  4GOY A;  1RY7 A;  1DQO A;  3UD7 A;  3UD8 A;  2D43 A;  2AXM A;  3BRF A;  1G9C A;  2LIE A;  1AFC A;  3O4D A;  4A7Z A;  3I2A A;  1P63 A;  4GP0 A;  4ZGR B;  4LO0 A;  3V79 C;  3AH4 A;  3FUQ A;  2E4M C;  2P23 A;  1MD6 A;  4HJJ A;  2IWT B;  2NM1 A;  2NYY A;  4I2S A;  4L4I A;  4X38 A;  2I1B A;  3AKH A;  4QBC A;  3SNV A;  4I37 A;  3A22 A;  4OWJ A;  3WMU A;  2KI6 B;  2BEA A;  4EEE B;  4H04 A;  1HCD A;  3VT2 A;  3VUO A;  4EFQ A;  3WIN C;  3WO4 A;  5BXS A;  1I1E A;  4GP3 A;  3AJ5 A;  3HMY A;  3ZC8 A;  4OEF A;  5DZU A;  1TWE A;  2F2F A;  3CQA A;  3Q7Y A;  3PME A;  1ONK B;  2ERM A;  1BFB A;  2NTD A;  3CRI A;  3P6J A;  1FWV A;  4PC4 A;  3NBN A;  1J0S A;  3A23 A;  2NS2 A;  2NP0 A;  3FJK A;  1L2H A;  1QQL A;  3CU1 B;  1JT3 A;  3C9Z A;  2NVH A;  3O3Q A;  2VXR A;  4GAF A;  4J2K A;  3UD9 A;  3F62 B;  3VSF A;  2BFH A;  3CAH A;  1JT4 A;  1PC8 B;  4FVV A;  4ION A;  5DSS B;  5BXR A;  1FN0 A;  1YBI A;  3FJC A;  1S0G A;  1DIW A;  3RTJ B;  3OJM A;  4USP A;  3CA6 A;  1N4K A;  3BX1 C;  4EB2 B;  3FFZ A;  5B2H A;  4IZE A;  4H9W A;  3ZC9 A;  1AVX B;  3H6S E;  5BQU A;  5HPZ A;  5FNW A;  2DRZ A;  1S0L A;  1PUU B;  3FJJ A;  3NBE A;  3O44 A;  1YYN A;  1T9F A;  2KKI A;  1G9B A;  4I4U A;  4Q9P A;  3AZW A;  4I4O A;  1A8D A;  4I4V A;  21BI A;  4HA2 A;  2RG9 B;  3FJF A;  3UDA A;  2YUG A;  2AFG A;  4GAI A;  3S8J A;  4QO3 A;  5DUY A;  4KC3 A;  3WO3 A;  2E4M A;  4KEJ A;  1FGA A;  2D1Z A;  3VSZ A;  2R9K B;  2D23 A;  1YTO A;  4I0Y A;  4ZKT B;  1AXM A;  3ZXD A;  1ISW A;  3BAU A;  4FGF A;  4ZOT A;  3FJB A;  3CA5 A;  2Q3N B;  1W3F A;  1BAS A;  4IZX A;  2WBC A;  2ZQO A;  1XG6 A;  3BA7 A;  3RTI B;  3BAD A;  4J2X A;  1CVS A;  2IHO A;  3T8S A;  3UJ4 A;  1JTC A;  3O5W B;  3JRR A;  3WIN A;  3OBR A;  1XZZ A;  2KH2 A;  4KBB A;  4EKX B;  4ZFU B;  3I29 B;  1RZO B;  4OW4 A;  1MC9 A;  1FMM S;  3OGF A;  4ZBV B;  4EFR A;  1G9D A;  2D20 A;  1Q03 A;  4Z9W B;  3NJ5 A;  4END A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...