3VWCA

High resolution structure of proteinase inhibitor from coprinopsis cinerea
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
146
structure length
146
Chain Sequence
SIKPGTYEVTSKVNGLHVGRPLAEDRSLLPKRIRVLPEDNNSGNSWVVEKDDDAYILYCKGAPVAPQEGKLFADLLGNMEDKKWIVTHQPQHGENVFTVVNASTEHGWVVPADAEELQQVEVRPLIAAPSYPPRYPATELFTFTQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title High resolution structure of proteinase inhibitor from Coprinopsis cinerea
rcsb
molecule keywords Serine protease inhibitor 1
molecule tags Hydrolase inhibitor
source organism Coprinopsis cinerea
total genus 31
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2012-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3vwcA00
4X37A 1YYNA 3AKIA 3OJMA 5HPZA 4EFQA 2I1BA 1GGPB 1BARA 1EVTA 1YTOA 1BFFA 3VSZA 4EKXB 4LO7C 3PUBA 1HCDA 7I1BA 1R8NA 4EFRA 3POKA 5BXTA 3V0BB 3V0BA 4ZBVB 3FUQA 1ISXA 1ISZA 1FMMS 2IWTB 3IM6A 2LIEA 3AKHA 4I4SA 3S8JA 4WBCA 3FFZA 1JT3A 1WD4A 5FNWA 5JLVA 3H6QA 3BRGC 2Z49A 1DQGA 5DUYA 5BQUC 2ERMA 4I6IA 2Y9GA 3UD8A 1DJSB 1W3GA 4TLPA 4HA2A 2RSTA 3RSJA 1ONKB 4JPZA 1S0LA 3AKGA 4I1EA 1L2HA 3WINC 3FJJA 1IRAX 4QD2C 3AZWA 1RG8A 4OEGA 2Z48A 3P6IA 4ZKTB 1DLLA 6I1BA 5BVPI 3IIRA 2D22A 1S0DA 1S0GA 3CA1A 1QQLA 1DIWA 3HSMA 4ISQA 4I4OA 3ZC9A 4KEJA 1WBAA 4GP3A 3WO4A 31BIA 1QXMA 4LO3C 2Q9XA 3OBTA 1AVWB 2Y9WC 1RMLA 3VT0A 3RTJB 3H6RA 3H6RB 4OEFA 4IZXA 4P0KA 3CRIA 4USOA 3UJ0A 1V6XA 3NBDA 4Z8SB 1S0BA 2DRZA 1YXWA 2HWAA 3AZVA 3BADA 1W3FA 2D44A 2NVHA 3PMEA 4QALA 4G9MA 4EFPA 3HN1A 1TTUA 1AF9A 5BP5A 4LO1A 4DEPA 1HIBA 5JMCA 1XYFA 3VEQA 4ZFWB 4LO2C 5FZUA 3OBRA 3H6SE 1G9DA 4USPA 1JLYA 4I4UA 4QBCA 4L4IA 3N0KA 1MD6A 4LO0C 1E0OA 3BB2A 5F90A 1EV2A 1XG6A 2LIQA 4IZEA 3HBWA 4J2YA 3K1XA 3N7JA 2FDBM 3AH2A 3Q7XA 4GAIA 5BXPA 1XHBA 3JUTA 1BASA 1WD3A 1HWPB 3LTQA 1G82A 4XKIA 4J23B 2QN4A 1FGAA 3IM7A 2X2SA 3NBCA 3F62B 1HKNA 4HR6C 2XOAA 3O4AA 4OUJA 3A22A 5G00A 4II0A 5BQUA 4G6MA 2X2TA 3ZX7A 4GOVA 2UUSA 4QC4A 1FMZA 2VXTI 3CA5A 1FWUA 4ZLBB 1BA7A 4KBBA 2GO2A 4I4PA 4Z9WB 1JT4A 4GAFA 4DENA 2YUGA 2WBCA 2KLLA 4Q9GA 1DZDA 4D0ZA 4KEKA 4IQPA 2NM1A 3R4SA 2E4MC 1G9AA 3WO2A 3CQAA 3WMUA 3V0AA 5F8YA 4J2SA 5EG6C 3MPPG 4QKSA 4Q91A 1Q1UA 3FJBA 1TWMA 1MC9A 4X3AA 1FV2A 4OEEA 4JP0A 5BXRA 3NJ5A 1YF8B 1PUUB 1AVXB 1ITBA 4IY9A 3FJIA 2KH2A 1IRPA 1D0HA 3HOMA 3BX1C 4HJJA 2Y9FA 1IJTA 5GAQA 2WRYA 2HWMA 2GZBA 3BTAA 4EB2B 1N4KA 1EYLA 4I96A 4XFTA 2VSAA 1NZKA 2D43A 2ZR1B 1AVAC 3O49A 4I37A 4Q9PA 3R4UA 5E24E 2AQZA 2P23A 3ZXGA 2D1ZA 1I1EA 3O4BA 1PWAA 1A8DA 3I29B 4I4VA 2L5XA 4OWJA 4ZGRB 4LO0A 1PZZA 1TFMB 4I7IA 2QYIB 3CU1B 4ZFYB 1J0SA 1JLXA 4XFUA 3HALA 1VCLA 3FJDA 3BA5A 1RZOB 1IILA 2KKIA 1TWEA 3S8KA 1V6WA 3VT2A 4D0TA 1IHKA 3UJ4A 3CA6A 1TIEA 3V79C 4OW4A 3OGGA 4IYBA 4KC3A 2NZ9A 4LO8B 1WBCA 1ISVA 3Q7WA 3UD7A 4A7YA 4YOLA 4I1BA 1DZCA 4I0YA 5DVHA 5D63A 1HWMB 3ILAA 2P39A 2K43A 2F2FC 1V6UA 3AH1A 3I2AA 3BAOA 1Q04A 3ZC8A 1SZ6B 1XZZA 3FJKA 4DCKC 2R9KB 4X39A 2RQ9A 3I2XA 4H9WA 2E4MA 3QYDA 3VT1A 4AN6A 2NTDA 1FQ9A 4GOYA 3RMXA 2DRYA 2BEBA 2NP0A 4LO7B 1JY0A 1TOOA 1DFCA 4PC4A 2FGFA 1EPWA 1IT0A 3VUOA 1PUMB 1Z0HA 5DSSB 3O4DA 3CAHA 1Z4SA 4JKQA 1PC8B 5F8SA 1CVSA 2D24A 4EEEB 1KNMA 3OJ2A 2FFUA 3EF2A 3ZXDA 1S0CA 2M49A 3QR5A 2K8RA 4R6UB 4IONA 3NBEA 4IHZA 5FNXA 1JTCA 4G9NA 1BFCA 2VUAA 3FUOA 3P53A 3T8SA 3WINA 2MC2A 5EHAA 3VWCA 3IAGC 4KEIA 4QD2B 1QQKA 1S0EA 1OQLB 1FN0A 3Q7YA 1II4A 1Z2VA 3UDAA 3N7LA 4I8MA 3WA1A 1G9CA 1HCEA 3V0AB 3CRHA 2FO1A 2DS0A 5FZZA 3VSFA 1T4QA 5BP5C 3E8LC 1S0FA 3FJ9A 3BRDA 5FZYA 4LO3A 1AXMA 4ZA3B 4X38A 2BFHA 3BRFA 3HMYA 3P6JA 3CA0A 3FJ8A 3O4CA 1SR4C 2ET2A 2VXRA 4GP0A 1R8OA 1UPSA 4ZOTA 4I4YA 1F31A 3BAQA 5B2HA 2IHOA 1T9FA 3AJ5A 3OJVA 5F8WA 5BOWA 1BFGA 1BLDA 4I4RA 4I4XA 1ILR1 4ZFUB 1ABRB 2ZQNA 4A7ZA 2D7IA 2F2FA 3O5WB 4LO2A 3B9UA 1Q03A 3A23A 4F83A 1I1BA 4OWLA 2ZQOA 2NYYA 1V6VA 9ILBA 4FVVA 2DREA 21BIA 3W9TA 1AVUA 2Y9XE 3BAUA 5D61A 5I1BA 1JT5A 1HWNB 2VSEA 4QBVA 1AFCA 1JT7A 3KMVA 4P6AA 3BAVA 4F34A 4J2XA 3O4OA 3F1RA 2Q3NB 2D23A 3CA4A 4ENDA 4FGFA 1TP0A 1JQZA 4ISRA 3BAGA 1ISWA 3PHZA 3C9ZA 3AJ6A 2D20A 3FGMA 4G6JA 3AH4A 3TC2A 5BXSA 1CE7B 3MALA 1IOBA 3WO3A 4QKRA 3RTIB 3BAHA 3O44A 2VLCA 1DFQA 4XFSA 4I3NA 3O3QA 2AXMA 3UD9A 3FJFA 3A21A 3NBNA 1P63A 2BEAA 2HW9A 2VU9A 4L4HA 3JRRA 2D7RA 1BLAA 1BFBA 41BIA 3SNVA 1DQOA 4QO3A 8I1BA 3FJHA 4I4QA 3BA4A 3AKFA 1SR4A 3FJAA 4AN7B 4D8HA 2FFVA 4IY8A 3D7WB 3N7KA 2AAIB 4JRAA 4P0LA 3IM5A 2K4AB 3FJEA 1W3AA 1M16A 2J3PA 4J2KA 1M2TB 3OGFA 3LLPA 2KI4A 4A7KA 1FWVA 1G9BA 1FV3A 1YBIA 3BA7A 3A07A 1HWOB 1NUNA 3WMVA 1ISYA 2ESUA 4CJMA 3PG0A 3CA3A 2F8XC 4JAWA 5DZUA 2AFGA 3FJCA 4G1RA 4JQ0A 3RMYA 2KI6B 2RG9B 1RY7A 1K5VA 4I2SA 4JKXB 4LO1C 4P0JA 5D62A 4H04A 2HZ9A 2MLLB 1K5UA 2MIBA 5EC5A 3CRGA 4OWKA 3N7MA
chains in the Genus database with same CATH superfamily
4X37A 1YYNA 3AKIA 3OJMA 5HPZA 4EFQA 2I1BA 1GGPB 1BARA 1EVTA 1YTOA 1BFFA 3VSZA 4EKXB 4LO7C 3PUBA 1HCDA 7I1BA 1R8NA 4EFRA 3POKA 5BXTA 3V0BB 3V0BA 4ZBVB 3FUQA 1ISXA 1ISZA 1FMMS 2IWTB 3IM6A 2LIEA 3AKHA 4I4SA 3S8JA 4WBCA 3FFZA 1JT3A 1WD4A 5FNWA 5JLVA 3H6QA 3BRGC 2Z49A 1DQGA 5DUYA 5BQUC 2ERMA 4I6IA 2Y9GA 3UD8A 1DJSB 1W3GA 4TLPA 4HA2A 2RSTA 3RSJA 1ONKB 4JPZA 1S0LA 3AKGA 4I1EA 1L2HA 3WINC 3FJJA 1IRAX 4QD2C 3AZWA 1RG8A 4OEGA 2Z48A 3P6IA 4ZKTB 1DLLA 6I1BA 5BVPI 3IIRA 2D22A 1S0DA 1S0GA 3CA1A 1QQLA 1DIWA 3HSMA 4ISQA 4I4OA 3ZC9A 4KEJA 1WBAA 4GP3A 3WO4A 31BIA 1QXMA 4LO3C 2Q9XA 3OBTA 1AVWB 2Y9WC 1RMLA 3VT0A 3RTJB 3H6RA 3H6RB 4OEFA 4IZXA 4P0KA 3CRIA 4USOA 3UJ0A 4H75A 1V6XA 3NBDA 4Z8SB 1S0BA 2DRZA 1YXWA 2HWAA 3AZVA 3BADA 1W3FA 2D44A 2NVHA 3PMEA 4QALA 4G9MA 4EFPA 3HN1A 1TTUA 1AF9A 5BP5A 4LO1A 4DEPA 1HIBA 5JMCA 1XYFA 3VEQA 4ZFWB 4LO2C 5FZUA 3OBRA 3H6SE 1G9DA 4USPA 1JLYA 4I4UA 4QBCA 4L4IA 3N0KA 1MD6A 4LO0C 1E0OA 3BB2A 5F90A 1EV2A 1XG6A 2LIQA 4IZEA 3HBWA 4J2YA 3K1XA 3N7JA 2FDBM 3AH2A 3Q7XA 4GAIA 5BXPA 1XHBA 3JUTA 1BASA 1WD3A 1HWPB 3LTQA 1G82A 4XKIA 4UY4A 4J23B 2QN4A 1FGAA 3IM7A 2X2SA 3NBCA 3F62B 1HKNA 4HR6C 2XOAA 3O4AA 4OUJA 3A22A 5G00A 4II0A 5BQUA 4G6MA 2X2TA 3ZX7A 4GOVA 2UUSA 4QC4A 1FMZA 2VXTI 3CA5A 1FWUA 4ZLBB 1BA7A 4KBBA 2GO2A 4I4PA 4Z9WB 1JT4A 4GAFA 4DENA 2YUGA 2WBCA 2KLLA 4Q9GA 1DZDA 4D0ZA 4KEKA 4IQPA 2NM1A 3R4SA 2E4MC 1G9AA 3WO2A 3CQAA 3WMUA 3V0AA 5F8YA 4J2SA 5EG6C 3MPPG 4QKSA 4Q91A 1Q1UA 3FJBA 1TWMA 1MC9A 4X3AA 1FV2A 4OEEA 4JP0A 5BXRA 3NJ5A 1YF8B 1PUUB 1AVXB 1ITBA 4IY9A 3FJIA 2KH2A 1IRPA 1D0HA 3HOMA 3BX1C 4HJJA 2Y9FA 1IJTA 5GAQA 2WRYA 2HWMA 2GZBA 3BTAA 4EB2B 1N4KA 1EYLA 4I96A 4XFTA 2VSAA 1NZKA 2D43A 2ZR1B 1AVAC 3O49A 4I37A 4Q9PA 3R4UA 5E24E 2AQZA 2P23A 3ZXGA 2D1ZA 1I1EA 3O4BA 1PWAA 1A8DA 3I29B 4I4VA 2L5XA 4OWJA 4MZFB 4ZGRB 4LO0A 1PZZA 1TFMB 4I7IA 2QYIB 3CU1B 4ZFYB 1J0SA 1JLXA 4XFUA 3HALA 1VCLA 3FJDA 3BA5A 1RZOB 1IILA 2KKIA 1TWEA 3S8KA 1V6WA 3VT2A 4D0TA 1IHKA 3UJ4A 3CA6A 1TIEA 3V79C 4OW4A 3OGGA 4IYBA 4KC3A 2NZ9A 4LO8B 1WBCA 1ISVA 3Q7WA 3UD7A 4A7YA 4YOLA 4I1BA 1DZCA 4I0YA 5DVHA 5D63A 1HWMB 3ILAA 2P39A 2K43A 2F2FC 1V6UA 3AH1A 3I2AA 3BAOA 1Q04A 3ZC8A 1SZ6B 1XZZA 3FJKA 4DCKC 2R9KB 4X39A 2RQ9A 3I2XA 4H9WA 2E4MA 3QYDA 3VT1A 4AN6A 2NTDA 1FQ9A 4GOYA 3RMXA 2DRYA 2BEBA 2NP0A 4LO7B 1JY0A 1TOOA 1DFCA 4PC4A 2FGFA 1EPWA 1IT0A 3VUOA 1PUMB 1Z0HA 5DSSB 3O4DA 3CAHA 1Z4SA 4JKQA 1PC8B 5F8SA 1CVSA 2D24A 4EEEB 1KNMA 3OJ2A 2FFUA 3EF2A 3ZXDA 1S0CA 2M49A 3QR5A 2K8RA 4R6UB 4IONA 3NBEA 4IHZA 5FNXA 1JTCA 4G9NA 1BFCA 2VUAA 3FUOA 3P53A 3T8SA 3WINA 2MC2A 5EHAA 3VWCA 3IAGC 4KEIA 4QD2B 1QQKA 1S0EA 1OQLB 1FN0A 3Q7YA 1II4A 1Z2VA 3UDAA 3N7LA 4I8MA 3WA1A 1G9CA 1HCEA 3V0AB 3CRHA 2FO1A 2DS0A 5FZZA 3VSFA 1T4QA 5BP5C 3E8LC 1S0FA 3FJ9A 3BRDA 5FZYA 4LO3A 1AXMA 4ZA3B 4X38A 2BFHA 3BRFA 3HMYA 3P6JA 3CA0A 3FJ8A 3O4CA 1SR4C 2ET2A 2VXRA 4GP0A 1R8OA 1UPSA 4ZOTA 4I4YA 1F31A 3BAQA 5B2HA 2IHOA 1T9FA 3AJ5A 3OJVA 5F8WA 5BOWA 1BFGA 1BLDA 4I4RA 4I4XA 1ILR1 4ZFUB 1ABRB 2ZQNA 4A7ZA 2D7IA 2F2FA 3O5WB 4LO2A 3B9UA 1Q03A 3A23A 4F83A 1I1BA 4OWLA 2ZQOA 2NYYA 1V6VA 9ILBA 4FVVA 2DREA 21BIA 3W9TA 1AVUA 2Y9XE 3BAUA 5D61A 5I1BA 1JT5A 1HWNB 2VSEA 4QBVA 1AFCA 1JT7A 3KMVA 4P6AA 3BAVA 2NS2A 4MZGB 4F34A 4J2XA 3O4OA 3F1RA 2Q3NB 2D23A 3CA4A 4ENDA 4FGFA 1TP0A 1JQZA 4ISRA 3BAGA 1ISWA 3PHZA 3C9ZA 3AJ6A 2D20A 3FGMA 4G6JA 3AH4A 3TC2A 5BXSA 1CE7B 3MALA 1IOBA 3WO3A 4QKRA 3RTIB 3BAHA 3O44A 2VLCA 1DFQA 4XFSA 4I3NA 3O3QA 2AXMA 3UD9A 3FJFA 3A21A 3NBNA 1P63A 2BEAA 2HW9A 2VU9A 4L4HA 3JRRA 2D7RA 1BLAA 1BFBA 41BIA 3SNVA 1DQOA 4QO3A 8I1BA 3FJHA 4I4QA 3BA4A 3AKFA 1SR4A 3FJAA 4AN7B 4D8HA 2FFVA 4IY8A 3D7WB 3N7KA 2AAIB 4JRAA 4P0LA 3IM5A 2K4AB 3FJEA 1W3AA 1M16A 2J3PA 4J2KA 1M2TB 3OGFA 3LLPA 2KI4A 4A7KA 1FWVA 1G9BA 1FV3A 1YBIA 3BA7A 3A07A 4MZHA 1HWOB 1NUNA 3WMVA 1ISYA 2ESUA 4CJMA 3PG0A 3CA3A 2F8XC 4JAWA 5DZUA 2AFGA 3FJCA 4G1RA 4JQ0A 3RMYA 2KI6B 2RG9B 1RY7A 1K5VA 4I2SA 4JKXB 4LO1C 4P0JA 5D62A 4H04A 2HZ9A 2MLLB 1K5UA 2MIBA 5EC5A 3CRGA 4OWKA 3N7MA
chains in the Genus database with same CATH topology
4X37A 1YYNA 3AKIA 3OJMA 5HPZA 4EFQA 2I1BA 1GGPB 1BARA 1EVTA 1YTOA 1BFFA 3VSZA 4EKXB 4LO7C 3PUBA 1HCDA 7I1BA 1R8NA 4EFRA 3POKA 5BXTA 3V0BB 3V0BA 4ZBVB 3FUQA 1ISXA 1ISZA 1FMMS 2IWTB 3IM6A 2LIEA 3AKHA 4I4SA 3S8JA 4WBCA 3FFZA 1JT3A 1WD4A 5FNWA 5JLVA 3H6QA 3BRGC 2Z49A 1DQGA 5DUYA 5BQUC 2ERMA 4I6IA 2Y9GA 3UD8A 1DJSB 1W3GA 4TLPA 4HA2A 2RSTA 3RSJA 1ONKB 4JPZA 1S0LA 3AKGA 4I1EA 1L2HA 3WINC 3FJJA 1IRAX 4QD2C 3AZWA 1RG8A 4OEGA 2Z48A 3P6IA 4ZKTB 1DLLA 6I1BA 5BVPI 3IIRA 2D22A 1S0DA 1S0GA 3CA1A 1QQLA 1DIWA 3HSMA 4ISQA 4I4OA 3ZC9A 4KEJA 1WBAA 4GP3A 3WO4A 31BIA 1QXMA 4LO3C 2Q9XA 3OBTA 1AVWB 2Y9WC 1RMLA 3VT0A 3RTJB 3H6RA 3H6RB 4OEFA 4IZXA 4P0KA 3CRIA 4USOA 3UJ0A 4H75A 1V6XA 3NBDA 4Z8SB 1S0BA 2DRZA 1YXWA 2HWAA 3AZVA 3BADA 1W3FA 2D44A 2NVHA 3PMEA 4QALA 4G9MA 4EFPA 3HN1A 1TTUA 1AF9A 5BP5A 4LO1A 4DEPA 1HIBA 5JMCA 1XYFA 3VEQA 4ZFWB 4LO2C 5FZUA 3OBRA 3H6SE 1G9DA 4USPA 1JLYA 4I4UA 4QBCA 4L4IA 3N0KA 1MD6A 4LO0C 1E0OA 3BB2A 5F90A 1EV2A 1XG6A 2LIQA 4IZEA 3HBWA 4J2YA 3K1XA 3N7JA 2FDBM 3AH2A 3Q7XA 4GAIA 5BXPA 1XHBA 3JUTA 1BASA 1WD3A 1HWPB 3LTQA 1G82A 4XKIA 4UY4A 4J23B 2QN4A 1FGAA 3IM7A 2X2SA 3NBCA 3F62B 1HKNA 4HR6C 2XOAA 3O4AA 4OUJA 3A22A 5G00A 4II0A 5BQUA 4G6MA 2X2TA 3ZX7A 4GOVA 2UUSA 4QC4A 1FMZA 2VXTI 3CA5A 1FWUA 4ZLBB 1BA7A 4KBBA 2GO2A 4I4PA 4Z9WB 1JT4A 4GAFA 4DENA 2YUGA 2WBCA 2KLLA 4Q9GA 1DZDA 4D0ZA 4KEKA 4IQPA 2NM1A 3R4SA 2E4MC 1G9AA 3WO2A 3CQAA 3WMUA 3V0AA 5F8YA 4J2SA 5EG6C 3MPPG 4QKSA 4Q91A 1Q1UA 3FJBA 1TWMA 1MC9A 4X3AA 1FV2A 4OEEA 4JP0A 5BXRA 3NJ5A 1YF8B 1PUUB 1AVXB 1ITBA 4IY9A 3FJIA 2KH2A 1IRPA 1D0HA 3HOMA 3BX1C 4HJJA 2Y9FA 1IJTA 5GAQA 2WRYA 2HWMA 2GZBA 3BTAA 4EB2B 1N4KA 1EYLA 4I96A 4XFTA 2VSAA 1NZKA 2D43A 2ZR1B 1AVAC 3O49A 4I37A 4Q9PA 3R4UA 5E24E 2AQZA 2P23A 3ZXGA 2D1ZA 1I1EA 3O4BA 1PWAA 1A8DA 3I29B 4I4VA 2L5XA 4OWJA 4MZFB 4ZGRB 4LO0A 1PZZA 1TFMB 4I7IA 2QYIB 3CU1B 4ZFYB 1J0SA 1JLXA 4XFUA 3HALA 1VCLA 3FJDA 3BA5A 1RZOB 1IILA 2KKIA 1TWEA 3S8KA 1V6WA 3VT2A 4D0TA 1IHKA 3UJ4A 3CA6A 1TIEA 3V79C 4OW4A 3OGGA 4IYBA 4KC3A 2NZ9A 4LO8B 1WBCA 1ISVA 3Q7WA 3UD7A 4A7YA 4YOLA 4I1BA 1DZCA 4I0YA 5DVHA 5D63A 1HWMB 3ILAA 2P39A 2K43A 2F2FC 1V6UA 3AH1A 3I2AA 3BAOA 1Q04A 3ZC8A 1SZ6B 1XZZA 3FJKA 4DCKC 2R9KB 4X39A 2RQ9A 3I2XA 4H9WA 2E4MA 3QYDA 3VT1A 4AN6A 2NTDA 1FQ9A 4GOYA 3RMXA 2DRYA 2BEBA 2NP0A 4LO7B 1JY0A 1TOOA 1DFCA 4PC4A 2FGFA 1EPWA 1IT0A 3VUOA 1PUMB 1Z0HA 5DSSB 3O4DA 3CAHA 1Z4SA 4JKQA 1PC8B 5F8SA 1CVSA 2D24A 4EEEB 1KNMA 3OJ2A 2FFUA 3EF2A 3ZXDA 1S0CA 2M49A 3QR5A 2K8RA 4R6UB 4IONA 3NBEA 4IHZA 5FNXA 1JTCA 4G9NA 1BFCA 2VUAA 3FUOA 3P53A 3T8SA 3WINA 2MC2A 5EHAA 3VWCA 3IAGC 4KEIA 4QD2B 1QQKA 1S0EA 1OQLB 1FN0A 3Q7YA 1II4A 1Z2VA 3UDAA 3N7LA 4I8MA 3WA1A 1G9CA 1HCEA 3V0AB 3CRHA 2FO1A 2DS0A 5FZZA 3VSFA 1T4QA 5BP5C 3E8LC 1S0FA 3FJ9A 3BRDA 5FZYA 4LO3A 1AXMA 4ZA3B 4X38A 2BFHA 3BRFA 3HMYA 3P6JA 3CA0A 3FJ8A 3O4CA 1SR4C 2ET2A 2VXRA 4GP0A 1R8OA 1UPSA 4ZOTA 4I4YA 1F31A 3BAQA 5B2HA 2IHOA 1T9FA 3AJ5A 3OJVA 5F8WA 5BOWA 1BFGA 1BLDA 4I4RA 4I4XA 1ILR1 4ZFUB 1ABRB 2ZQNA 4A7ZA 2D7IA 2F2FA 3O5WB 4LO2A 3B9UA 1Q03A 3A23A 4F83A 1I1BA 4OWLA 2ZQOA 2NYYA 1V6VA 9ILBA 4FVVA 2DREA 21BIA 3W9TA 1AVUA 2Y9XE 3BAUA 5D61A 5I1BA 1JT5A 1HWNB 2VSEA 4QBVA 1AFCA 1JT7A 3KMVA 4P6AA 3BAVA 2NS2A 4MZGB 4F34A 4J2XA 3O4OA 3F1RA 2Q3NB 2D23A 3CA4A 4ENDA 4FGFA 1TP0A 1JQZA 4ISRA 3BAGA 1ISWA 3PHZA 3C9ZA 3AJ6A 2D20A 3FGMA 4G6JA 3AH4A 3TC2A 5BXSA 1CE7B 3MALA 1IOBA 3WO3A 4QKRA 3RTIB 3BAHA 3O44A 2VLCA 1DFQA 4XFSA 4I3NA 3O3QA 2AXMA 3UD9A 3FJFA 3A21A 3NBNA 1P63A 2BEAA 2HW9A 2VU9A 4L4HA 3JRRA 2D7RA 1BLAA 1BFBA 41BIA 3SNVA 1DQOA 4QO3A 8I1BA 3FJHA 4I4QA 3BA4A 3AKFA 1SR4A 3FJAA 4AN7B 4D8HA 2FFVA 4IY8A 3D7WB 3N7KA 2AAIB 4JRAA 4P0LA 3IM5A 2K4AB 3FJEA 1W3AA 1M16A 2J3PA 4J2KA 1M2TB 3OGFA 3LLPA 2KI4A 4A7KA 1FWVA 1G9BA 1FV3A 1YBIA 3BA7A 3A07A 4MZHA 1HWOB 1NUNA 3WMVA 1ISYA 2ESUA 4CJMA 3PG0A 3CA3A 2F8XC 4JAWA 5DZUA 2AFGA 3FJCA 4G1RA 4JQ0A 3RMYA 2KI6B 2RG9B 1RY7A 1K5VA 4I2SA 4JKXB 4LO1C 4P0JA 5D62A 4H04A 2HZ9A 2MLLB 1K5UA 2MIBA 5EC5A 3CRGA 4OWKA 3N7MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X37 A;  1YYN A;  3AKI A;  3OJM A;  5HPZ A;  4EFQ A;  2I1B A;  1GGP B;  1BAR A;  1EVT A;  1YTO A;  1BFF A;  3VSZ A;  4EKX B;  4LO7 C;  3PUB A;  1HCD A;  7I1B A;  1R8N A;  4EFR A;  3POK A;  5BXT A;  3V0B B;  3V0B A;  4ZBV B;  3FUQ A;  1ISX A;  1ISZ A;  1FMM S;  2IWT B;  3IM6 A;  2LIE A;  3AKH A;  4I4S A;  3S8J A;  4WBC A;  3FFZ A;  1JT3 A;  1WD4 A;  5FNW A;  5JLV A;  3H6Q A;  3BRG C;  2Z49 A;  1DQG A;  5DUY A;  5BQU C;  2ERM A;  4I6I A;  2Y9G A;  3UD8 A;  1DJS B;  1W3G A;  4TLP A;  4HA2 A;  2RST A;  3RSJ A;  1ONK B;  4JPZ A;  1S0L A;  3AKG A;  4I1E A;  1L2H A;  3WIN C;  3FJJ A;  1IRA X;  4QD2 C;  3AZW A;  1RG8 A;  4OEG A;  2Z48 A;  3P6I A;  4ZKT B;  1DLL A;  6I1B A;  5BVP I;  3IIR A;  2D22 A;  1S0D A;  1S0G A;  3CA1 A;  1QQL A;  1DIW A;  3HSM A;  4ISQ A;  4I4O A;  3ZC9 A;  4KEJ A;  1WBA A;  4GP3 A;  3WO4 A;  31BI A;  1QXM A;  4LO3 C;  2Q9X A;  3OBT A;  1AVW B;  2Y9W C;  1RML A;  3VT0 A;  3RTJ B;  3H6R A;  3H6R B;  4OEF A;  4IZX A;  4P0K A;  3CRI A;  4USO A;  3UJ0 A;  1V6X A;  3NBD A;  4Z8S B;  1S0B A;  2DRZ A;  1YXW A;  2HWA A;  3AZV A;  3BAD A;  1W3F A;  2D44 A;  2NVH A;  3PME A;  4QAL A;  4G9M A;  4EFP A;  3HN1 A;  1TTU A;  1AF9 A;  5BP5 A;  4LO1 A;  4DEP A;  1HIB A;  5JMC A;  1XYF A;  3VEQ A;  4ZFW B;  4LO2 C;  5FZU A;  3OBR A;  3H6S E;  1G9D A;  4USP A;  1JLY A;  4I4U A;  4QBC A;  4L4I A;  3N0K A;  1MD6 A;  4LO0 C;  1E0O A;  3BB2 A;  5F90 A;  1EV2 A;  1XG6 A;  2LIQ A;  4IZE A;  3HBW A;  4J2Y A;  3K1X A;  3N7J A;  2FDB M;  3AH2 A;  3Q7X A;  4GAI A;  5BXP A;  1XHB A;  3JUT A;  1BAS A;  1WD3 A;  1HWP B;  3LTQ A;  1G82 A;  4XKI A;  4J23 B;  2QN4 A;  1FGA A;  3IM7 A;  2X2S A;  3NBC A;  3F62 B;  1HKN A;  4HR6 C;  2XOA A;  3O4A A;  4OUJ A;  3A22 A;  5G00 A;  4II0 A;  5BQU A;  4G6M A;  2X2T A;  3ZX7 A;  4GOV A;  2UUS A;  4QC4 A;  1FMZ A;  2VXT I;  3CA5 A;  1FWU A;  4ZLB B;  1BA7 A;  4KBB A;  2GO2 A;  4I4P A;  4Z9W B;  1JT4 A;  4GAF A;  4DEN A;  2YUG A;  2WBC A;  2KLL A;  4Q9G A;  1DZD A;  4D0Z A;  4KEK A;  4IQP A;  2NM1 A;  3R4S A;  2E4M C;  1G9A A;  3WO2 A;  3CQA A;  3WMU A;  3V0A A;  5F8Y A;  4J2S A;  5EG6 C;  3MPP G;  4QKS A;  4Q91 A;  1Q1U A;  3FJB A;  1TWM A;  1MC9 A;  4X3A A;  1FV2 A;  4OEE A;  4JP0 A;  5BXR A;  3NJ5 A;  1YF8 B;  1PUU B;  1AVX B;  1ITB A;  4IY9 A;  3FJI A;  2KH2 A;  1IRP A;  1D0H A;  3HOM A;  3BX1 C;  4HJJ A;  2Y9F A;  1IJT A;  5GAQ A;  2WRY A;  2HWM A;  2GZB A;  3BTA A;  4EB2 B;  1N4K A;  1EYL A;  4I96 A;  4XFT A;  2VSA A;  1NZK A;  2D43 A;  2ZR1 B;  1AVA C;  3O49 A;  4I37 A;  4Q9P A;  3R4U A;  5E24 E;  2AQZ A;  2P23 A;  3ZXG A;  2D1Z A;  1I1E A;  3O4B A;  1PWA A;  1A8D A;  3I29 B;  4I4V A;  2L5X A;  4OWJ A;  4ZGR B;  4LO0 A;  1PZZ A;  1TFM B;  4I7I A;  2QYI B;  3CU1 B;  4ZFY B;  1J0S A;  1JLX A;  4XFU A;  3HAL A;  1VCL A;  3FJD A;  3BA5 A;  1RZO B;  1IIL A;  2KKI A;  1TWE A;  3S8K A;  1V6W A;  3VT2 A;  4D0T A;  1IHK A;  3UJ4 A;  3CA6 A;  1TIE A;  3V79 C;  4OW4 A;  3OGG A;  4IYB A;  4KC3 A;  2NZ9 A;  4LO8 B;  1WBC A;  1ISV A;  3Q7W A;  3UD7 A;  4A7Y A;  4YOL A;  4I1B A;  1DZC A;  4I0Y A;  5DVH A;  5D63 A;  1HWM B;  3ILA A;  2P39 A;  2K43 A;  2F2F C;  1V6U A;  3AH1 A;  3I2A A;  3BAO A;  1Q04 A;  3ZC8 A;  1SZ6 B;  1XZZ A;  3FJK A;  4DCK C;  2R9K B;  4X39 A;  2RQ9 A;  3I2X A;  4H9W A;  2E4M A;  3QYD A;  3VT1 A;  4AN6 A;  2NTD A;  1FQ9 A;  4GOY A;  3RMX A;  2DRY A;  2BEB A;  2NP0 A;  4LO7 B;  1JY0 A;  1TOO A;  1DFC A;  4PC4 A;  2FGF A;  1EPW A;  1IT0 A;  3VUO A;  1PUM B;  1Z0H A;  5DSS B;  3O4D A;  3CAH A;  1Z4S A;  4JKQ A;  1PC8 B;  5F8S A;  1CVS A;  2D24 A;  4EEE B;  1KNM A;  3OJ2 A;  2FFU A;  3EF2 A;  3ZXD A;  1S0C A;  2M49 A;  3QR5 A;  2K8R A;  4R6U B;  4ION A;  3NBE A;  4IHZ A;  5FNX A;  1JTC A;  4G9N A;  1BFC A;  2VUA A;  3FUO A;  3P53 A;  3T8S A;  3WIN A;  2MC2 A;  5EHA A;  3VWC A;  3IAG C;  4KEI A;  4QD2 B;  1QQK A;  1S0E A;  1OQL B;  1FN0 A;  3Q7Y A;  1II4 A;  1Z2V A;  3UDA A;  3N7L A;  4I8M A;  3WA1 A;  1G9C A;  1HCE A;  3V0A B;  3CRH A;  2FO1 A;  2DS0 A;  5FZZ A;  3VSF A;  1T4Q A;  5BP5 C;  3E8L C;  1S0F A;  3FJ9 A;  3BRD A;  5FZY A;  4LO3 A;  1AXM A;  4ZA3 B;  4X38 A;  2BFH A;  3BRF A;  3HMY A;  3P6J A;  3CA0 A;  3FJ8 A;  3O4C A;  1SR4 C;  2ET2 A;  2VXR A;  4GP0 A;  1R8O A;  1UPS A;  4ZOT A;  4I4Y A;  1F31 A;  3BAQ A;  5B2H A;  2IHO A;  1T9F A;  3AJ5 A;  3OJV A;  5F8W A;  5BOW A;  1BFG A;  1BLD A;  4I4R A;  4I4X A;  1ILR 1;  4ZFU B;  1ABR B;  2ZQN A;  4A7Z A;  2D7I A;  2F2F A;  3O5W B;  4LO2 A;  3B9U A;  1Q03 A;  3A23 A;  4F83 A;  1I1B A;  4OWL A;  2ZQO A;  2NYY A;  1V6V A;  9ILB A;  4FVV A;  2DRE A;  21BI A;  3W9T A;  1AVU A;  2Y9X E;  3BAU A;  5D61 A;  5I1B A;  1JT5 A;  1HWN B;  2VSE A;  4QBV A;  1AFC A;  1JT7 A;  3KMV A;  4P6A A;  3BAV A;  4F34 A;  4J2X A;  3O4O A;  3F1R A;  2Q3N B;  2D23 A;  3CA4 A;  4END A;  4FGF A;  1TP0 A;  1JQZ A;  4ISR A;  3BAG A;  1ISW A;  3PHZ A;  3C9Z A;  3AJ6 A;  2D20 A;  3FGM A;  4G6J A;  3AH4 A;  3TC2 A;  5BXS A;  1CE7 B;  3MAL A;  1IOB A;  3WO3 A;  4QKR A;  3RTI B;  3BAH A;  3O44 A;  2VLC A;  1DFQ A;  4XFS A;  4I3N A;  3O3Q A;  2AXM A;  3UD9 A;  3FJF A;  3A21 A;  3NBN A;  1P63 A;  2BEA A;  2HW9 A;  2VU9 A;  4L4H A;  3JRR A;  2D7R A;  1BLA A;  1BFB A;  41BI A;  3SNV A;  1DQO A;  4QO3 A;  8I1B A;  3FJH A;  4I4Q A;  3BA4 A;  3AKF A;  1SR4 A;  3FJA A;  4AN7 B;  4D8H A;  2FFV A;  4IY8 A;  3D7W B;  3N7K A;  2AAI B;  4JRA A;  4P0L A;  3IM5 A;  2K4A B;  3FJE A;  1W3A A;  1M16 A;  2J3P A;  4J2K A;  1M2T B;  3OGF A;  3LLP A;  2KI4 A;  4A7K A;  1FWV A;  1G9B A;  1FV3 A;  1YBI A;  3BA7 A;  3A07 A;  1HWO B;  1NUN A;  3WMV A;  1ISY A;  2ESU A;  4CJM A;  3PG0 A;  3CA3 A;  2F8X C;  4JAW A;  5DZU A;  2AFG A;  3FJC A;  4G1R A;  4JQ0 A;  3RMY A;  2KI6 B;  2RG9 B;  1RY7 A;  1K5V A;  4I2S A;  4JKX B;  4LO1 C;  4P0J A;  5D62 A;  4H04 A;  2HZ9 A;  2MLL B;  1K5U A;  2MIB A;  5EC5 A;  3CRG A;  4OWK A;  3N7M A; 
#chains in the Genus database with same CATH topology
 4X37 A;  1YYN A;  3AKI A;  3OJM A;  5HPZ A;  4EFQ A;  2I1B A;  1GGP B;  1BAR A;  1EVT A;  1YTO A;  1BFF A;  3VSZ A;  4EKX B;  4LO7 C;  3PUB A;  1HCD A;  7I1B A;  1R8N A;  4EFR A;  3POK A;  5BXT A;  3V0B B;  3V0B A;  4ZBV B;  3FUQ A;  1ISX A;  1ISZ A;  1FMM S;  2IWT B;  3IM6 A;  2LIE A;  3AKH A;  4I4S A;  3S8J A;  4WBC A;  3FFZ A;  1JT3 A;  1WD4 A;  5FNW A;  5JLV A;  3H6Q A;  3BRG C;  2Z49 A;  1DQG A;  5DUY A;  5BQU C;  2ERM A;  4I6I A;  2Y9G A;  3UD8 A;  1DJS B;  1W3G A;  4TLP A;  4HA2 A;  2RST A;  3RSJ A;  1ONK B;  4JPZ A;  1S0L A;  3AKG A;  4I1E A;  1L2H A;  3WIN C;  3FJJ A;  1IRA X;  4QD2 C;  3AZW A;  1RG8 A;  4OEG A;  2Z48 A;  3P6I A;  4ZKT B;  1DLL A;  6I1B A;  5BVP I;  3IIR A;  2D22 A;  1S0D A;  1S0G A;  3CA1 A;  1QQL A;  1DIW A;  3HSM A;  4ISQ A;  4I4O A;  3ZC9 A;  4KEJ A;  1WBA A;  4GP3 A;  3WO4 A;  31BI A;  1QXM A;  4LO3 C;  2Q9X A;  3OBT A;  1AVW B;  2Y9W C;  1RML A;  3VT0 A;  3RTJ B;  3H6R A;  3H6R B;  4OEF A;  4IZX A;  4P0K A;  3CRI A;  4USO A;  3UJ0 A;  4H75 A;  1V6X A;  3NBD A;  4Z8S B;  1S0B A;  2DRZ A;  1YXW A;  2HWA A;  3AZV A;  3BAD A;  1W3F A;  2D44 A;  2NVH A;  3PME A;  4QAL A;  4G9M A;  4EFP A;  3HN1 A;  1TTU A;  1AF9 A;  5BP5 A;  4LO1 A;  4DEP A;  1HIB A;  5JMC A;  1XYF A;  3VEQ A;  4ZFW B;  4LO2 C;  5FZU A;  3OBR A;  3H6S E;  1G9D A;  4USP A;  1JLY A;  4I4U A;  4QBC A;  4L4I A;  3N0K A;  1MD6 A;  4LO0 C;  1E0O A;  3BB2 A;  5F90 A;  1EV2 A;  1XG6 A;  2LIQ A;  4IZE A;  3HBW A;  4J2Y A;  3K1X A;  3N7J A;  2FDB M;  3AH2 A;  3Q7X A;  4GAI A;  5BXP A;  1XHB A;  3JUT A;  1BAS A;  1WD3 A;  1HWP B;  3LTQ A;  1G82 A;  4XKI A;  4UY4 A;  4J23 B;  2QN4 A;  1FGA A;  3IM7 A;  2X2S A;  3NBC A;  3F62 B;  1HKN A;  4HR6 C;  2XOA A;  3O4A A;  4OUJ A;  3A22 A;  5G00 A;  4II0 A;  5BQU A;  4G6M A;  2X2T A;  3ZX7 A;  4GOV A;  2UUS A;  4QC4 A;  1FMZ A;  2VXT I;  3CA5 A;  1FWU A;  4ZLB B;  1BA7 A;  4KBB A;  2GO2 A;  4I4P A;  4Z9W B;  1JT4 A;  4GAF A;  4DEN A;  2YUG A;  2WBC A;  2KLL A;  4Q9G A;  1DZD A;  4D0Z A;  4KEK A;  4IQP A;  2NM1 A;  3R4S A;  2E4M C;  1G9A A;  3WO2 A;  3CQA A;  3WMU A;  3V0A A;  5F8Y A;  4J2S A;  5EG6 C;  3MPP G;  4QKS A;  4Q91 A;  1Q1U A;  3FJB A;  1TWM A;  1MC9 A;  4X3A A;  1FV2 A;  4OEE A;  4JP0 A;  5BXR A;  3NJ5 A;  1YF8 B;  1PUU B;  1AVX B;  1ITB A;  4IY9 A;  3FJI A;  2KH2 A;  1IRP A;  1D0H A;  3HOM A;  3BX1 C;  4HJJ A;  2Y9F A;  1IJT A;  5GAQ A;  2WRY A;  2HWM A;  2GZB A;  3BTA A;  4EB2 B;  1N4K A;  1EYL A;  4I96 A;  4XFT A;  2VSA A;  1NZK A;  2D43 A;  2ZR1 B;  1AVA C;  3O49 A;  4I37 A;  4Q9P A;  3R4U A;  5E24 E;  2AQZ A;  2P23 A;  3ZXG A;  2D1Z A;  1I1E A;  3O4B A;  1PWA A;  1A8D A;  3I29 B;  4I4V A;  2L5X A;  4OWJ A;  4MZF B;  4ZGR B;  4LO0 A;  1PZZ A;  1TFM B;  4I7I A;  2QYI B;  3CU1 B;  4ZFY B;  1J0S A;  1JLX A;  4XFU A;  3HAL A;  1VCL A;  3FJD A;  3BA5 A;  1RZO B;  1IIL A;  2KKI A;  1TWE A;  3S8K A;  1V6W A;  3VT2 A;  4D0T A;  1IHK A;  3UJ4 A;  3CA6 A;  1TIE A;  3V79 C;  4OW4 A;  3OGG A;  4IYB A;  4KC3 A;  2NZ9 A;  4LO8 B;  1WBC A;  1ISV A;  3Q7W A;  3UD7 A;  4A7Y A;  4YOL A;  4I1B A;  1DZC A;  4I0Y A;  5DVH A;  5D63 A;  1HWM B;  3ILA A;  2P39 A;  2K43 A;  2F2F C;  1V6U A;  3AH1 A;  3I2A A;  3BAO A;  1Q04 A;  3ZC8 A;  1SZ6 B;  1XZZ A;  3FJK A;  4DCK C;  2R9K B;  4X39 A;  2RQ9 A;  3I2X A;  4H9W A;  2E4M A;  3QYD A;  3VT1 A;  4AN6 A;  2NTD A;  1FQ9 A;  4GOY A;  3RMX A;  2DRY A;  2BEB A;  2NP0 A;  4LO7 B;  1JY0 A;  1TOO A;  1DFC A;  4PC4 A;  2FGF A;  1EPW A;  1IT0 A;  3VUO A;  1PUM B;  1Z0H A;  5DSS B;  3O4D A;  3CAH A;  1Z4S A;  4JKQ A;  1PC8 B;  5F8S A;  1CVS A;  2D24 A;  4EEE B;  1KNM A;  3OJ2 A;  2FFU A;  3EF2 A;  3ZXD A;  1S0C A;  2M49 A;  3QR5 A;  2K8R A;  4R6U B;  4ION A;  3NBE A;  4IHZ A;  5FNX A;  1JTC A;  4G9N A;  1BFC A;  2VUA A;  3FUO A;  3P53 A;  3T8S A;  3WIN A;  2MC2 A;  5EHA A;  3VWC A;  3IAG C;  4KEI A;  4QD2 B;  1QQK A;  1S0E A;  1OQL B;  1FN0 A;  3Q7Y A;  1II4 A;  1Z2V A;  3UDA A;  3N7L A;  4I8M A;  3WA1 A;  1G9C A;  1HCE A;  3V0A B;  3CRH A;  2FO1 A;  2DS0 A;  5FZZ A;  3VSF A;  1T4Q A;  5BP5 C;  3E8L C;  1S0F A;  3FJ9 A;  3BRD A;  5FZY A;  4LO3 A;  1AXM A;  4ZA3 B;  4X38 A;  2BFH A;  3BRF A;  3HMY A;  3P6J A;  3CA0 A;  3FJ8 A;  3O4C A;  1SR4 C;  2ET2 A;  2VXR A;  4GP0 A;  1R8O A;  1UPS A;  4ZOT A;  4I4Y A;  1F31 A;  3BAQ A;  5B2H A;  2IHO A;  1T9F A;  3AJ5 A;  3OJV A;  5F8W A;  5BOW A;  1BFG A;  1BLD A;  4I4R A;  4I4X A;  1ILR 1;  4ZFU B;  1ABR B;  2ZQN A;  4A7Z A;  2D7I A;  2F2F A;  3O5W B;  4LO2 A;  3B9U A;  1Q03 A;  3A23 A;  4F83 A;  1I1B A;  4OWL A;  2ZQO A;  2NYY A;  1V6V A;  9ILB A;  4FVV A;  2DRE A;  21BI A;  3W9T A;  1AVU A;  2Y9X E;  3BAU A;  5D61 A;  5I1B A;  1JT5 A;  1HWN B;  2VSE A;  4QBV A;  1AFC A;  1JT7 A;  3KMV A;  4P6A A;  3BAV A;  2NS2 A;  4MZG B;  4F34 A;  4J2X A;  3O4O A;  3F1R A;  2Q3N B;  2D23 A;  3CA4 A;  4END A;  4FGF A;  1TP0 A;  1JQZ A;  4ISR A;  3BAG A;  1ISW A;  3PHZ A;  3C9Z A;  3AJ6 A;  2D20 A;  3FGM A;  4G6J A;  3AH4 A;  3TC2 A;  5BXS A;  1CE7 B;  3MAL A;  1IOB A;  3WO3 A;  4QKR A;  3RTI B;  3BAH A;  3O44 A;  2VLC A;  1DFQ A;  4XFS A;  4I3N A;  3O3Q A;  2AXM A;  3UD9 A;  3FJF A;  3A21 A;  3NBN A;  1P63 A;  2BEA A;  2HW9 A;  2VU9 A;  4L4H A;  3JRR A;  2D7R A;  1BLA A;  1BFB A;  41BI A;  3SNV A;  1DQO A;  4QO3 A;  8I1B A;  3FJH A;  4I4Q A;  3BA4 A;  3AKF A;  1SR4 A;  3FJA A;  4AN7 B;  4D8H A;  2FFV A;  4IY8 A;  3D7W B;  3N7K A;  2AAI B;  4JRA A;  4P0L A;  3IM5 A;  2K4A B;  3FJE A;  1W3A A;  1M16 A;  2J3P A;  4J2K A;  1M2T B;  3OGF A;  3LLP A;  2KI4 A;  4A7K A;  1FWV A;  1G9B A;  1FV3 A;  1YBI A;  3BA7 A;  3A07 A;  4MZH A;  1HWO B;  1NUN A;  3WMV A;  1ISY A;  2ESU A;  4CJM A;  3PG0 A;  3CA3 A;  2F8X C;  4JAW A;  5DZU A;  2AFG A;  3FJC A;  4G1R A;  4JQ0 A;  3RMY A;  2KI6 B;  2RG9 B;  1RY7 A;  1K5V A;  4I2S A;  4JKX B;  4LO1 C;  4P0J A;  5D62 A;  4H04 A;  2HZ9 A;  2MLL B;  1K5U A;  2MIB A;  5EC5 A;  3CRG A;  4OWK A;  3N7M A; 
#chains in the Genus database with same CATH homology
 4X37 A;  1YYN A;  3AKI A;  3OJM A;  5HPZ A;  4EFQ A;  2I1B A;  1GGP B;  1BAR A;  1EVT A;  1YTO A;  1BFF A;  3VSZ A;  4EKX B;  4LO7 C;  3PUB A;  1HCD A;  7I1B A;  1R8N A;  4EFR A;  3POK A;  5BXT A;  3V0B B;  3V0B A;  4ZBV B;  3FUQ A;  1ISX A;  1ISZ A;  1FMM S;  2IWT B;  3IM6 A;  2LIE A;  3AKH A;  4I4S A;  3S8J A;  4WBC A;  3FFZ A;  1JT3 A;  1WD4 A;  5FNW A;  5JLV A;  3H6Q A;  3BRG C;  2Z49 A;  1DQG A;  5DUY A;  5BQU C;  2ERM A;  4I6I A;  2Y9G A;  3UD8 A;  1DJS B;  1W3G A;  4TLP A;  4HA2 A;  2RST A;  3RSJ A;  1ONK B;  4JPZ A;  1S0L A;  3AKG A;  4I1E A;  1L2H A;  3WIN C;  3FJJ A;  1IRA X;  4QD2 C;  3AZW A;  1RG8 A;  4OEG A;  2Z48 A;  3P6I A;  4ZKT B;  1DLL A;  6I1B A;  5BVP I;  3IIR A;  2D22 A;  1S0D A;  1S0G A;  3CA1 A;  1QQL A;  1DIW A;  3HSM A;  4ISQ A;  4I4O A;  3ZC9 A;  4KEJ A;  1WBA A;  4GP3 A;  3WO4 A;  31BI A;  1QXM A;  4LO3 C;  2Q9X A;  3OBT A;  1AVW B;  2Y9W C;  1RML A;  3VT0 A;  3RTJ B;  3H6R A;  3H6R B;  4OEF A;  4IZX A;  4P0K A;  3CRI A;  4USO A;  3UJ0 A;  4H75 A;  1V6X A;  3NBD A;  4Z8S B;  1S0B A;  2DRZ A;  1YXW A;  2HWA A;  3AZV A;  3BAD A;  1W3F A;  2D44 A;  2NVH A;  3PME A;  4QAL A;  4G9M A;  4EFP A;  3HN1 A;  1TTU A;  1AF9 A;  5BP5 A;  4LO1 A;  4DEP A;  1HIB A;  5JMC A;  1XYF A;  3VEQ A;  4ZFW B;  4LO2 C;  5FZU A;  3OBR A;  3H6S E;  1G9D A;  4USP A;  1JLY A;  4I4U A;  4QBC A;  4L4I A;  3N0K A;  1MD6 A;  4LO0 C;  1E0O A;  3BB2 A;  5F90 A;  1EV2 A;  1XG6 A;  2LIQ A;  4IZE A;  3HBW A;  4J2Y A;  3K1X A;  3N7J A;  2FDB M;  3AH2 A;  3Q7X A;  4GAI A;  5BXP A;  1XHB A;  3JUT A;  1BAS A;  1WD3 A;  1HWP B;  3LTQ A;  1G82 A;  4XKI A;  4UY4 A;  4J23 B;  2QN4 A;  1FGA A;  3IM7 A;  2X2S A;  3NBC A;  3F62 B;  1HKN A;  4HR6 C;  2XOA A;  3O4A A;  4OUJ A;  3A22 A;  5G00 A;  4II0 A;  5BQU A;  4G6M A;  2X2T A;  3ZX7 A;  4GOV A;  2UUS A;  4QC4 A;  1FMZ A;  2VXT I;  3CA5 A;  1FWU A;  4ZLB B;  1BA7 A;  4KBB A;  2GO2 A;  4I4P A;  4Z9W B;  1JT4 A;  4GAF A;  4DEN A;  2YUG A;  2WBC A;  2KLL A;  4Q9G A;  1DZD A;  4D0Z A;  4KEK A;  4IQP A;  2NM1 A;  3R4S A;  2E4M C;  1G9A A;  3WO2 A;  3CQA A;  3WMU A;  3V0A A;  5F8Y A;  4J2S A;  5EG6 C;  3MPP G;  4QKS A;  4Q91 A;  1Q1U A;  3FJB A;  1TWM A;  1MC9 A;  4X3A A;  1FV2 A;  4OEE A;  4JP0 A;  5BXR A;  3NJ5 A;  1YF8 B;  1PUU B;  1AVX B;  1ITB A;  4IY9 A;  3FJI A;  2KH2 A;  1IRP A;  1D0H A;  3HOM A;  3BX1 C;  4HJJ A;  2Y9F A;  1IJT A;  5GAQ A;  2WRY A;  2HWM A;  2GZB A;  3BTA A;  4EB2 B;  1N4K A;  1EYL A;  4I96 A;  4XFT A;  2VSA A;  1NZK A;  2D43 A;  2ZR1 B;  1AVA C;  3O49 A;  4I37 A;  4Q9P A;  3R4U A;  5E24 E;  2AQZ A;  2P23 A;  3ZXG A;  2D1Z A;  1I1E A;  3O4B A;  1PWA A;  1A8D A;  3I29 B;  4I4V A;  2L5X A;  4OWJ A;  4MZF B;  4ZGR B;  4LO0 A;  1PZZ A;  1TFM B;  4I7I A;  2QYI B;  3CU1 B;  4ZFY B;  1J0S A;  1JLX A;  4XFU A;  3HAL A;  1VCL A;  3FJD A;  3BA5 A;  1RZO B;  1IIL A;  2KKI A;  1TWE A;  3S8K A;  1V6W A;  3VT2 A;  4D0T A;  1IHK A;  3UJ4 A;  3CA6 A;  1TIE A;  3V79 C;  4OW4 A;  3OGG A;  4IYB A;  4KC3 A;  2NZ9 A;  4LO8 B;  1WBC A;  1ISV A;  3Q7W A;  3UD7 A;  4A7Y A;  4YOL A;  4I1B A;  1DZC A;  4I0Y A;  5DVH A;  5D63 A;  1HWM B;  3ILA A;  2P39 A;  2K43 A;  2F2F C;  1V6U A;  3AH1 A;  3I2A A;  3BAO A;  1Q04 A;  3ZC8 A;  1SZ6 B;  1XZZ A;  3FJK A;  4DCK C;  2R9K B;  4X39 A;  2RQ9 A;  3I2X A;  4H9W A;  2E4M A;  3QYD A;  3VT1 A;  4AN6 A;  2NTD A;  1FQ9 A;  4GOY A;  3RMX A;  2DRY A;  2BEB A;  2NP0 A;  4LO7 B;  1JY0 A;  1TOO A;  1DFC A;  4PC4 A;  2FGF A;  1EPW A;  1IT0 A;  3VUO A;  1PUM B;  1Z0H A;  5DSS B;  3O4D A;  3CAH A;  1Z4S A;  4JKQ A;  1PC8 B;  5F8S A;  1CVS A;  2D24 A;  4EEE B;  1KNM A;  3OJ2 A;  2FFU A;  3EF2 A;  3ZXD A;  1S0C A;  2M49 A;  3QR5 A;  2K8R A;  4R6U B;  4ION A;  3NBE A;  4IHZ A;  5FNX A;  1JTC A;  4G9N A;  1BFC A;  2VUA A;  3FUO A;  3P53 A;  3T8S A;  3WIN A;  2MC2 A;  5EHA A;  3VWC A;  3IAG C;  4KEI A;  4QD2 B;  1QQK A;  1S0E A;  1OQL B;  1FN0 A;  3Q7Y A;  1II4 A;  1Z2V A;  3UDA A;  3N7L A;  4I8M A;  3WA1 A;  1G9C A;  1HCE A;  3V0A B;  3CRH A;  2FO1 A;  2DS0 A;  5FZZ A;  3VSF A;  1T4Q A;  5BP5 C;  3E8L C;  1S0F A;  3FJ9 A;  3BRD A;  5FZY A;  4LO3 A;  1AXM A;  4ZA3 B;  4X38 A;  2BFH A;  3BRF A;  3HMY A;  3P6J A;  3CA0 A;  3FJ8 A;  3O4C A;  1SR4 C;  2ET2 A;  2VXR A;  4GP0 A;  1R8O A;  1UPS A;  4ZOT A;  4I4Y A;  1F31 A;  3BAQ A;  5B2H A;  2IHO A;  1T9F A;  3AJ5 A;  3OJV A;  5F8W A;  5BOW A;  1BFG A;  1BLD A;  4I4R A;  4I4X A;  1ILR 1;  4ZFU B;  1ABR B;  2ZQN A;  4A7Z A;  2D7I A;  2F2F A;  3O5W B;  4LO2 A;  3B9U A;  1Q03 A;  3A23 A;  4F83 A;  1I1B A;  4OWL A;  2ZQO A;  2NYY A;  1V6V A;  9ILB A;  4FVV A;  2DRE A;  21BI A;  3W9T A;  1AVU A;  2Y9X E;  3BAU A;  5D61 A;  5I1B A;  1JT5 A;  1HWN B;  2VSE A;  4QBV A;  1AFC A;  1JT7 A;  3KMV A;  4P6A A;  3BAV A;  2NS2 A;  4MZG B;  4F34 A;  4J2X A;  3O4O A;  3F1R A;  2Q3N B;  2D23 A;  3CA4 A;  4END A;  4FGF A;  1TP0 A;  1JQZ A;  4ISR A;  3BAG A;  1ISW A;  3PHZ A;  3C9Z A;  3AJ6 A;  2D20 A;  3FGM A;  4G6J A;  3AH4 A;  3TC2 A;  5BXS A;  1CE7 B;  3MAL A;  1IOB A;  3WO3 A;  4QKR A;  3RTI B;  3BAH A;  3O44 A;  2VLC A;  1DFQ A;  4XFS A;  4I3N A;  3O3Q A;  2AXM A;  3UD9 A;  3FJF A;  3A21 A;  3NBN A;  1P63 A;  2BEA A;  2HW9 A;  2VU9 A;  4L4H A;  3JRR A;  2D7R A;  1BLA A;  1BFB A;  41BI A;  3SNV A;  1DQO A;  4QO3 A;  8I1B A;  3FJH A;  4I4Q A;  3BA4 A;  3AKF A;  1SR4 A;  3FJA A;  4AN7 B;  4D8H A;  2FFV A;  4IY8 A;  3D7W B;  3N7K A;  2AAI B;  4JRA A;  4P0L A;  3IM5 A;  2K4A B;  3FJE A;  1W3A A;  1M16 A;  2J3P A;  4J2K A;  1M2T B;  3OGF A;  3LLP A;  2KI4 A;  4A7K A;  1FWV A;  1G9B A;  1FV3 A;  1YBI A;  3BA7 A;  3A07 A;  4MZH A;  1HWO B;  1NUN A;  3WMV A;  1ISY A;  2ESU A;  4CJM A;  3PG0 A;  3CA3 A;  2F8X C;  4JAW A;  5DZU A;  2AFG A;  3FJC A;  4G1R A;  4JQ0 A;  3RMY A;  2KI6 B;  2RG9 B;  1RY7 A;  1K5V A;  4I2S A;  4JKX B;  4LO1 C;  4P0J A;  5D62 A;  4H04 A;  2HZ9 A;  2MLL B;  1K5U A;  2MIB A;  5EC5 A;  3CRG A;  4OWK A;  3N7M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...