3TC2A

Crystal structure of potato serine protease inhibitor.
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
186
structure length
181
Chain Sequence
PSDATPVLDVTGKELDPRLSYRIISTFWGALGGDVYLGKSPNSDAPCANGVFRYNSDVGPSGTPVRFIGSSSHFGQGIFEDELLNIQFAISTSKMCVSYTIWKVGDYDASLGTMLLETGGTIGQADSSWFKIVKSSQFGYNLLYCPVDQFCLKVGVVHQNGKRRLALVKDNPLDVSFKQVQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase inhibitor
molecule keywords Kunitz-type proteinase inhibitor P1H5
publication title Structure of a post-translationally processed heterodimeric double-headed Kunitz-type serine protease inhibitor from potato.
pubmed doi rcsb
total genus 37
structure length 181
sequence length 186
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3tc2A00
1EVTA 1JLXA 3PHZA 3VT1A 4FGFA 4QALA 1YBIA 3N7MA 3VSZA 4KBBA 3RTJB 1BFBA 2P39A 2E4MA 4I6IA 2MC2A 5B2HA 1S0FA 2VSEA 2Y9GA 2VU9A 3FJBA 3RMYA 3R4UA 4A7KA 4DENA 1D0HA 1RMLA 4AN6A 1JY0A 2D24A 4X3AA 4LO2A 3LTQA 3BRFA 3OJ2A 2DS0A 2D22A 4I37A 4KC3A 1II4A 3OJMA 2FDBM 3VT2A 4JPZA 7I1BA 1E0OA 3BAUA 5BP5C 1V6VA 3P6JA 4GOVA 4ZOTA 1EV2A 1JT3A 3ILAA 4I4UA 3POKA 1TP0A 4LO7C 3I29B 1HKNA 1ISXA 3ZX7A 3F1RA 4PC4A 3VUOA 2BEBA 1HCEA 2NVHA 3PG0A 5FZUA 9ILBA 1DQOA 2RG9B 3FJ9A 2X2TA 2VSAA 1G9AA 3ZC8A 4EB2B 4F83A 3V0AB 3TC2A 1HWOB 1I1EA 4FVVA 4Q91A 2IHOA 3ZXGA 4GP0A 4L4IA 4XFSA 3FJCA 2P23A 1TOOA 4JRAA 4LO1A 5E24E 3O4CA 2D1ZA 3A22A 4OEEA 1PUMB 4XFTA 1V6XA 3UJ0A 2ERMA 1AVAC 1JLYA 4DEPA 4ISRA 1CE7B 1AVUA 1TWEA 4LO8B 1V6WA 1AFCA 1PWAA 3UDAA 2DRYA 3N7KA 3SNVA 3VSFA 3AZWA 1SZ6B 3CA1A 1I1BA 2YUGA 3BAGA 3B9UA 3P53A 2X2SA 2QYIB 1P63A 1PUUB 3W9TA 1BFFA 3OBTA 1IT0A 4H9WA 1Z0HA 1EPWA 2KI6B 4I4RA 1CVSA 3O4OA 3P6IA 4IYBA 2NP0A 3FJ8A 2ESUA 1N4KA 3CA3A 4HJJA 3MPPG 5DUYA 3BTAA 1HWNB 3V0BA 1IJTA 5BP5A 1BFCA 2Z49A 4HA2A 1DZCA 3FJFA 4IZXA 3A07A 4TLPA 4OWJA 3BB2A 4EEEB 4KEKA 3ZXDA 1V6UA 3T8SA 5BXPA 2VUAA 3HMYA 4ZBVB 3N7JA 5BXRA 4I4PA 1QQLA 1MC9A 3C9ZA 4I7IA 2D43A 3O4DA 1BFGA 1W3GA 2K43A 1AF9A 2ZQNA 2BEAA 6I1BA 2Q9XA 4I1BA 1OQLB 4ZLBB 4USPA 5F8WA 2AQZA 4I4SA 3BX1C 1SR4C 4P0LA 3UJ4A 2HWAA 1WD3A 1QXMA 2IWTB 3OGGA 4OEFA 1AVWB 2WBCA 2MIBA 4I96A 2NZ9A 5I1BA 4L4HA 3A23A 4D8HA 1UPSA 4GOYA 1YXWA 3PMEA 4ZKTB 3BRGC 3JUTA 1HIBA 5D62A 1NZKA 5BQUC 4I4QA 5EC5A 4F34A 3H6QA 2VLCA 1AVXB 1FN0A 1ILR1 1NUNA 1IRPA 2NTDA 3FJJA 1WBAA 4P0JA 8I1BA 1S0DA 3NBDA 1Q03A 3WMUA 3HSMA 4HR6C 1S0GA 1DIWA 1HCDA 2Y9XE 4QC4A 3AH1A 3AJ6A 3AH2A 4ZFWB 1G9BA 4QKRA 3K1XA 4LO3C 4JKXB 4J2YA 1DFCA 3BADA 5FZYA 2Q3NB 1ISWA 4G1RA 1XG6A 3IM7A 3BA5A 2LIEA 3O3QA 1HWMB 3OBRA 3OJVA 3UD8A 5BOWA 1XYFA 3IAGC 1A8DA 3CRGA 4IY9A 1XZZA 4OUJA 2FGFA 3O5WB 4II0A 1BASA 3WMVA 3Q7WA 2Z48A 3WO4A 1XHBA 3WINC 5DZUA 3AKGA 4ZFYB 2FFUA 3NBEA 5G00A 1DFQA 1YTOA 4EFQA 4EKXB 3NBNA 4CJMA 3O4AA 4YOLA 4D0TA 2KH2A 5D61A 4USOA 1ISVA 3Q7YA 3MALA 1DJSB 3CA4A 2D7RA 3HN1A 3V79C 4DCKC 3N7LA 1G9DA 3A21A 4QD2C 1DZDA 4LO0C 2BFHA 1BA7A 4P6AA 3CA0A 3VT0A 1T9FA 5D63A 4JAWA 4G6MA 1AXMA 4I0YA 3QYDA 2RQ9A 1Z2VA 3IM6A 1JTCA 3H6RA 1S0LA 2D20A 5DVHA 4I2SA 5BQUA 3QR5A 1FV2A 3BAOA 1GGPB 5JMCA 5FZZA 3FJDA 5BXSA 4ENDA 3R4SA 1BLAA 2HZ9A 1G82A 4GAFA 4GAIA 1IRAX 3FJKA 4EFPA 5EHAA 2UUSA 1MD6A 1YYNA 1Z4SA 3Q7XA 4I8MA 4XFUA 4Q9GA 1RZOB 3HOMA 5F8SA 1K5UA 1M2TB 1DLLA 2GO2A 1F31A 3RSJA 4ZFUB 2FO1A 1WD4A 3AJ5A 4I3NA 2WRYA 4IQPA 4I1EA 3IIRA 5EG6C 4QKSA 4X37A 2AFGA 2ZQOA 3UD7A 3AZVA 5F90A 3WA1A 2F2FC 1VCLA 3V0BB 3ZC9A 2M49A 4J23B 2VXRA 3WINA 3JRRA 1TIEA 4JQ0A 1QQKA 3V0AA 2R9KB 4LO7B 4OWLA 3EF2A 1JQZA 4QBVA 5FNWA 1ITBA 1FV3A 1L2HA 4A7YA 4R6UB 1J0SA 4J2KA 4Z8SB 2RSTA 2GZBA 3VEQA 1TTUA 2D23A 3BA7A 1G9CA 2Y9FA 3AKFA 4J2SA 3D7WB 1T4QA 1W3FA 3CAHA 4JKQA 4EFRA 2KKIA 3VWCA 4LO0A 4ZGRB 1ISZA 2ET2A 3CU1B 5BVPI 2HW9A 4D0ZA 1R8OA 1IHKA 4QBCA 4OEGA 3OGFA 3WO2A 2D44A 5DSSB 4ZA3B 3HALA 2FFVA 2K8RA 3CQAA 2DREA 4IY8A 3IM5A 1IOBA 1JT7A 4WBCA 3HBWA 3I2XA 3BAQA 3FJEA 2L5XA 1WBCA 41BIA 4H04A 5JLVA 4OW4A 4IHZA 4GP3A 4I4YA 4KEIA 1FWVA 3H6SE 1W3AA 2NYYA 3CRIA 1ONKB 3LLPA 1JT4A 1ISYA 1FWUA 2HWMA 3UD9A 1HWPB 1IILA 1TWMA 2E4MC 2D7IA 3BA4A 3O4BA 3RTIB 1FQ9A 4Q9PA 5FNXA 1FMZA 1BLDA 1Q04A 2LIQA 1R8NA 4QO3A 4XKIA 2KLLA 3F62B 1DQGA 4I4OA 4LO2C 21BIA 2J3PA 1JT5A 4QD2B 4X38A 4AN7B 3NBCA 4IONA 3FJAA 2F8XC 5GAQA 2Y9WC 3BAHA 2KI4A 4A7ZA 4I4XA 2AAIB 4JP0A 3I2AA 3O49A 1S0EA 2MLLB 1TFMB 4J2XA 1SR4A 1M16A 3FUOA 2I1BA 4IZEA 3AH4A 1BARA 4G6JA 4P0KA 2NM1A 3S8KA 2K4AB 2F2FA 4KEJA 3AKIA 3S8JA 3E8LC 1YF8B 5F8YA 1S0BA 4X39A 3BAVA 4I4VA 3N0KA 3AKHA 1Q1UA 3CA6A 4Z9WB 3O44A 2XOAA 4OWKA 3PUBA 3CRHA 3WO3A 1PZZA 1RY7A 3KMVA 1FMMS 1EYLA 3RMXA 31BIA 3CA5A 4LO3A 1PC8B 2QN4A 3NJ5A 2ZR1B 5HPZA 2AXMA 1ABRB 4LO1C 1FGAA 1K5VA 3FGMA 1S0CA 2VXTI 3FUQA 1KNMA 3FJHA 3FJIA 1RG8A 5BXTA 4G9NA 3BRDA 3FFZA 4G9MA 3H6RB 2DRZA 4ISQA
chains in the Genus database with same CATH superfamily
1EVTA 1JLXA 3PHZA 3VT1A 4FGFA 4QALA 1YBIA 3N7MA 3VSZA 4KBBA 3RTJB 1BFBA 2P39A 2E4MA 4I6IA 2MC2A 5B2HA 1S0FA 2VSEA 2Y9GA 2VU9A 3FJBA 3RMYA 3R4UA 4A7KA 4DENA 1D0HA 1RMLA 4AN6A 1JY0A 2D24A 4X3AA 4LO2A 3LTQA 3BRFA 3OJ2A 2DS0A 2D22A 4I37A 4KC3A 1II4A 3OJMA 2FDBM 3VT2A 4JPZA 7I1BA 1E0OA 3BAUA 5BP5C 1V6VA 3P6JA 4GOVA 4ZOTA 1EV2A 1JT3A 3ILAA 4I4UA 3POKA 1TP0A 4LO7C 3I29B 1HKNA 1ISXA 3ZX7A 3F1RA 4PC4A 3VUOA 2BEBA 1HCEA 2NVHA 3PG0A 5FZUA 9ILBA 1DQOA 2RG9B 3FJ9A 2X2TA 2VSAA 1G9AA 3ZC8A 4EB2B 4F83A 3V0AB 3TC2A 1HWOB 1I1EA 4FVVA 4Q91A 2IHOA 3ZXGA 4GP0A 4L4IA 4XFSA 3FJCA 2P23A 1TOOA 4JRAA 4LO1A 5E24E 3O4CA 2D1ZA 3A22A 4OEEA 1PUMB 4XFTA 1V6XA 3UJ0A 2ERMA 1AVAC 1JLYA 4DEPA 4ISRA 1CE7B 1AVUA 1TWEA 4LO8B 1V6WA 1AFCA 1PWAA 3UDAA 2DRYA 3N7KA 3SNVA 3VSFA 3AZWA 1SZ6B 3CA1A 1I1BA 2YUGA 3BAGA 3B9UA 3P53A 2X2SA 2QYIB 1P63A 1PUUB 3W9TA 1BFFA 3OBTA 1IT0A 4H9WA 1Z0HA 1EPWA 2KI6B 4I4RA 1CVSA 3O4OA 3P6IA 4IYBA 2NP0A 3FJ8A 2ESUA 1N4KA 3CA3A 4HJJA 3MPPG 5DUYA 3BTAA 1HWNB 3V0BA 1IJTA 5BP5A 1BFCA 2Z49A 4HA2A 1DZCA 3FJFA 4IZXA 3A07A 4TLPA 4OWJA 3BB2A 4EEEB 4KEKA 3ZXDA 1V6UA 3T8SA 5BXPA 2VUAA 3HMYA 4ZBVB 3N7JA 5BXRA 4I4PA 1QQLA 1MC9A 3C9ZA 4I7IA 2D43A 3O4DA 1BFGA 1W3GA 2K43A 1AF9A 2ZQNA 2BEAA 6I1BA 2Q9XA 4I1BA 1OQLB 4ZLBB 4USPA 5F8WA 2AQZA 4I4SA 3BX1C 1SR4C 4P0LA 3UJ4A 2HWAA 1WD3A 1QXMA 2IWTB 3OGGA 4OEFA 1AVWB 2WBCA 4MZFB 2MIBA 4I96A 2NZ9A 5I1BA 4L4HA 3A23A 4D8HA 1UPSA 4GOYA 1YXWA 3PMEA 4ZKTB 3BRGC 3JUTA 1HIBA 5D62A 1NZKA 5BQUC 4I4QA 5EC5A 4F34A 3H6QA 2VLCA 1AVXB 1FN0A 1ILR1 1NUNA 1IRPA 2NTDA 3FJJA 1WBAA 4P0JA 8I1BA 1S0DA 3NBDA 1Q03A 3WMUA 3HSMA 4HR6C 1S0GA 1DIWA 1HCDA 2Y9XE 4QC4A 3AH1A 3AJ6A 3AH2A 4ZFWB 1G9BA 4QKRA 3K1XA 4LO3C 4JKXB 4J2YA 1DFCA 3BADA 5FZYA 2Q3NB 1ISWA 4G1RA 1XG6A 3IM7A 3BA5A 2LIEA 3O3QA 1HWMB 3OBRA 3OJVA 3UD8A 5BOWA 1XYFA 3IAGC 1A8DA 3CRGA 4IY9A 2NS2A 1XZZA 4OUJA 2FGFA 3O5WB 4II0A 1BASA 3WMVA 3Q7WA 2Z48A 3WO4A 1XHBA 3WINC 5DZUA 3AKGA 4ZFYB 2FFUA 3NBEA 5G00A 1DFQA 1YTOA 4EFQA 4EKXB 3NBNA 4CJMA 3O4AA 4YOLA 4D0TA 2KH2A 5D61A 4USOA 1ISVA 3Q7YA 3MALA 1DJSB 3CA4A 2D7RA 3HN1A 3V79C 4DCKC 3N7LA 1G9DA 3A21A 4QD2C 1DZDA 4LO0C 2BFHA 1BA7A 4P6AA 3CA0A 3VT0A 1T9FA 5D63A 4JAWA 4G6MA 1AXMA 4I0YA 3QYDA 2RQ9A 1Z2VA 3IM6A 1JTCA 3H6RA 1S0LA 4H75A 2D20A 5DVHA 4I2SA 5BQUA 3QR5A 1FV2A 3BAOA 1GGPB 5JMCA 5FZZA 3FJDA 5BXSA 4ENDA 3R4SA 1BLAA 4MZHA 2HZ9A 1G82A 4GAFA 4GAIA 1IRAX 3FJKA 4EFPA 5EHAA 2UUSA 1MD6A 1YYNA 1Z4SA 3Q7XA 4I8MA 4XFUA 4Q9GA 1RZOB 3HOMA 5F8SA 1K5UA 1M2TB 1DLLA 2GO2A 1F31A 3RSJA 4ZFUB 2FO1A 1WD4A 3AJ5A 4I3NA 2WRYA 4IQPA 4I1EA 3IIRA 5EG6C 4QKSA 4X37A 2AFGA 2ZQOA 3UD7A 3AZVA 5F90A 3WA1A 2F2FC 1VCLA 3V0BB 3ZC9A 2M49A 4J23B 2VXRA 3WINA 3JRRA 1TIEA 4JQ0A 1QQKA 3V0AA 2R9KB 4MZGB 4LO7B 4OWLA 3EF2A 1JQZA 4QBVA 5FNWA 1ITBA 1FV3A 1L2HA 4A7YA 4R6UB 1J0SA 4J2KA 4Z8SB 2RSTA 2GZBA 3VEQA 1TTUA 2D23A 3BA7A 1G9CA 2Y9FA 3AKFA 4J2SA 3D7WB 1T4QA 1W3FA 3CAHA 4JKQA 4EFRA 2KKIA 3VWCA 4LO0A 4ZGRB 1ISZA 2ET2A 3CU1B 5BVPI 2HW9A 4D0ZA 1R8OA 1IHKA 4QBCA 4OEGA 3OGFA 3WO2A 2D44A 5DSSB 4ZA3B 3HALA 2FFVA 2K8RA 3CQAA 2DREA 4IY8A 3IM5A 1IOBA 1JT7A 4WBCA 3HBWA 3I2XA 3BAQA 3FJEA 2L5XA 1WBCA 41BIA 4H04A 5JLVA 4OW4A 4IHZA 4GP3A 4I4YA 4KEIA 1FWVA 3H6SE 1W3AA 2NYYA 3CRIA 1ONKB 3LLPA 1JT4A 1ISYA 1FWUA 2HWMA 3UD9A 1HWPB 1IILA 1TWMA 4UY4A 2E4MC 2D7IA 3BA4A 3O4BA 3RTIB 1FQ9A 4Q9PA 5FNXA 1FMZA 1BLDA 1Q04A 2LIQA 1R8NA 4QO3A 4XKIA 2KLLA 3F62B 1DQGA 4I4OA 4LO2C 21BIA 2J3PA 1JT5A 4QD2B 4X38A 4AN7B 3NBCA 4IONA 3FJAA 2F8XC 5GAQA 2Y9WC 3BAHA 2KI4A 4A7ZA 4I4XA 2AAIB 4JP0A 3I2AA 3O49A 1S0EA 2MLLB 1TFMB 4J2XA 1SR4A 1M16A 3FUOA 2I1BA 4IZEA 3AH4A 1BARA 4G6JA 4P0KA 2NM1A 3S8KA 2K4AB 2F2FA 4KEJA 3AKIA 3S8JA 3E8LC 1YF8B 5F8YA 1S0BA 4X39A 3BAVA 4I4VA 3N0KA 3AKHA 1Q1UA 3CA6A 4Z9WB 3O44A 2XOAA 4OWKA 3PUBA 3CRHA 3WO3A 1PZZA 1RY7A 3KMVA 1FMMS 1EYLA 3RMXA 31BIA 3CA5A 4LO3A 1PC8B 2QN4A 3NJ5A 2ZR1B 5HPZA 2AXMA 1ABRB 4LO1C 1FGAA 1K5VA 3FGMA 1S0CA 2VXTI 3FUQA 1KNMA 3FJHA 3FJIA 1RG8A 5BXTA 4G9NA 3BRDA 3FFZA 4G9MA 3H6RB 2DRZA 4ISQA
chains in the Genus database with same CATH topology
1EVTA 1JLXA 3PHZA 3VT1A 4FGFA 4QALA 1YBIA 3N7MA 3VSZA 4KBBA 3RTJB 1BFBA 2P39A 2E4MA 4I6IA 2MC2A 5B2HA 1S0FA 2VSEA 2Y9GA 2VU9A 3FJBA 3RMYA 3R4UA 4A7KA 4DENA 1D0HA 1RMLA 4AN6A 1JY0A 2D24A 4X3AA 4LO2A 3LTQA 3BRFA 3OJ2A 2DS0A 2D22A 4I37A 4KC3A 1II4A 3OJMA 2FDBM 3VT2A 4JPZA 7I1BA 1E0OA 3BAUA 5BP5C 1V6VA 3P6JA 4GOVA 4ZOTA 1EV2A 1JT3A 3ILAA 4I4UA 3POKA 1TP0A 4LO7C 3I29B 1HKNA 1ISXA 3ZX7A 3F1RA 4PC4A 3VUOA 2BEBA 1HCEA 2NVHA 3PG0A 5FZUA 9ILBA 1DQOA 2RG9B 3FJ9A 2X2TA 2VSAA 1G9AA 3ZC8A 4EB2B 4F83A 3V0AB 3TC2A 1HWOB 1I1EA 4FVVA 4Q91A 2IHOA 3ZXGA 4GP0A 4L4IA 4XFSA 3FJCA 2P23A 1TOOA 4JRAA 4LO1A 5E24E 3O4CA 2D1ZA 3A22A 4OEEA 1PUMB 4XFTA 1V6XA 3UJ0A 2ERMA 1AVAC 1JLYA 4DEPA 4ISRA 1CE7B 1AVUA 1TWEA 4LO8B 1V6WA 1AFCA 1PWAA 3UDAA 2DRYA 3N7KA 3SNVA 3VSFA 3AZWA 1SZ6B 3CA1A 1I1BA 2YUGA 3BAGA 3B9UA 3P53A 2X2SA 2QYIB 1P63A 1PUUB 3W9TA 1BFFA 3OBTA 1IT0A 4H9WA 1Z0HA 1EPWA 2KI6B 4I4RA 1CVSA 3O4OA 3P6IA 4IYBA 2NP0A 3FJ8A 2ESUA 1N4KA 3CA3A 4HJJA 3MPPG 5DUYA 3BTAA 1HWNB 3V0BA 1IJTA 5BP5A 1BFCA 2Z49A 4HA2A 1DZCA 3FJFA 4IZXA 3A07A 4TLPA 4OWJA 3BB2A 4EEEB 4KEKA 3ZXDA 1V6UA 3T8SA 5BXPA 2VUAA 3HMYA 4ZBVB 3N7JA 5BXRA 4I4PA 1QQLA 1MC9A 3C9ZA 4I7IA 2D43A 3O4DA 1BFGA 1W3GA 2K43A 1AF9A 2ZQNA 2BEAA 6I1BA 2Q9XA 4I1BA 1OQLB 4ZLBB 4USPA 5F8WA 2AQZA 4I4SA 3BX1C 1SR4C 4P0LA 3UJ4A 2HWAA 1WD3A 1QXMA 2IWTB 3OGGA 4OEFA 1AVWB 2WBCA 4MZFB 2MIBA 4I96A 2NZ9A 5I1BA 4L4HA 3A23A 4D8HA 1UPSA 4GOYA 1YXWA 3PMEA 4ZKTB 3BRGC 3JUTA 1HIBA 5D62A 1NZKA 5BQUC 4I4QA 5EC5A 4F34A 3H6QA 2VLCA 1AVXB 1FN0A 1ILR1 1NUNA 1IRPA 2NTDA 3FJJA 1WBAA 4P0JA 8I1BA 1S0DA 3NBDA 1Q03A 3WMUA 3HSMA 4HR6C 1S0GA 1DIWA 1HCDA 2Y9XE 4QC4A 3AH1A 3AJ6A 3AH2A 4ZFWB 1G9BA 4QKRA 3K1XA 4LO3C 4JKXB 4J2YA 1DFCA 3BADA 5FZYA 2Q3NB 1ISWA 4G1RA 1XG6A 3IM7A 3BA5A 2LIEA 3O3QA 1HWMB 3OBRA 3OJVA 3UD8A 5BOWA 1XYFA 3IAGC 1A8DA 3CRGA 4IY9A 2NS2A 1XZZA 4OUJA 2FGFA 3O5WB 4II0A 1BASA 3WMVA 3Q7WA 2Z48A 3WO4A 1XHBA 3WINC 5DZUA 3AKGA 4ZFYB 2FFUA 3NBEA 5G00A 1DFQA 1YTOA 4EFQA 4EKXB 3NBNA 4CJMA 3O4AA 4YOLA 4D0TA 2KH2A 5D61A 4USOA 1ISVA 3Q7YA 3MALA 1DJSB 3CA4A 2D7RA 3HN1A 3V79C 4DCKC 3N7LA 1G9DA 3A21A 4QD2C 1DZDA 4LO0C 2BFHA 1BA7A 4P6AA 3CA0A 3VT0A 1T9FA 5D63A 4JAWA 4G6MA 1AXMA 4I0YA 3QYDA 2RQ9A 1Z2VA 3IM6A 1JTCA 3H6RA 1S0LA 4H75A 2D20A 5DVHA 4I2SA 5BQUA 3QR5A 1FV2A 3BAOA 1GGPB 5JMCA 5FZZA 3FJDA 5BXSA 4ENDA 3R4SA 1BLAA 4MZHA 2HZ9A 1G82A 4GAFA 4GAIA 1IRAX 3FJKA 4EFPA 5EHAA 2UUSA 1MD6A 1YYNA 1Z4SA 3Q7XA 4I8MA 4XFUA 4Q9GA 1RZOB 3HOMA 5F8SA 1K5UA 1M2TB 1DLLA 2GO2A 1F31A 3RSJA 4ZFUB 2FO1A 1WD4A 3AJ5A 4I3NA 2WRYA 4IQPA 4I1EA 3IIRA 5EG6C 4QKSA 4X37A 2AFGA 2ZQOA 3UD7A 3AZVA 5F90A 3WA1A 2F2FC 1VCLA 3V0BB 3ZC9A 2M49A 4J23B 2VXRA 3WINA 3JRRA 1TIEA 4JQ0A 1QQKA 3V0AA 2R9KB 4MZGB 4LO7B 4OWLA 3EF2A 1JQZA 4QBVA 5FNWA 1ITBA 1FV3A 1L2HA 4A7YA 4R6UB 1J0SA 4J2KA 4Z8SB 2RSTA 2GZBA 3VEQA 1TTUA 2D23A 3BA7A 1G9CA 2Y9FA 3AKFA 4J2SA 3D7WB 1T4QA 1W3FA 3CAHA 4JKQA 4EFRA 2KKIA 3VWCA 4LO0A 4ZGRB 1ISZA 2ET2A 3CU1B 5BVPI 2HW9A 4D0ZA 1R8OA 1IHKA 4QBCA 4OEGA 3OGFA 3WO2A 2D44A 5DSSB 4ZA3B 3HALA 2FFVA 2K8RA 3CQAA 2DREA 4IY8A 3IM5A 1IOBA 1JT7A 4WBCA 3HBWA 3I2XA 3BAQA 3FJEA 2L5XA 1WBCA 41BIA 4H04A 5JLVA 4OW4A 4IHZA 4GP3A 4I4YA 4KEIA 1FWVA 3H6SE 1W3AA 2NYYA 3CRIA 1ONKB 3LLPA 1JT4A 1ISYA 1FWUA 2HWMA 3UD9A 1HWPB 1IILA 1TWMA 4UY4A 2E4MC 2D7IA 3BA4A 3O4BA 3RTIB 1FQ9A 4Q9PA 5FNXA 1FMZA 1BLDA 1Q04A 2LIQA 1R8NA 4QO3A 4XKIA 2KLLA 3F62B 1DQGA 4I4OA 4LO2C 21BIA 2J3PA 1JT5A 4QD2B 4X38A 4AN7B 3NBCA 4IONA 3FJAA 2F8XC 5GAQA 2Y9WC 3BAHA 2KI4A 4A7ZA 4I4XA 2AAIB 4JP0A 3I2AA 3O49A 1S0EA 2MLLB 1TFMB 4J2XA 1SR4A 1M16A 3FUOA 2I1BA 4IZEA 3AH4A 1BARA 4G6JA 4P0KA 2NM1A 3S8KA 2K4AB 2F2FA 4KEJA 3AKIA 3S8JA 3E8LC 1YF8B 5F8YA 1S0BA 4X39A 3BAVA 4I4VA 3N0KA 3AKHA 1Q1UA 3CA6A 4Z9WB 3O44A 2XOAA 4OWKA 3PUBA 3CRHA 3WO3A 1PZZA 1RY7A 3KMVA 1FMMS 1EYLA 3RMXA 31BIA 3CA5A 4LO3A 1PC8B 2QN4A 3NJ5A 2ZR1B 5HPZA 2AXMA 1ABRB 4LO1C 1FGAA 1K5VA 3FGMA 1S0CA 2VXTI 3FUQA 1KNMA 3FJHA 3FJIA 1RG8A 5BXTA 4G9NA 3BRDA 3FFZA 4G9MA 3H6RB 2DRZA 4ISQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EVT A;  1JLX A;  3PHZ A;  3VT1 A;  4FGF A;  4QAL A;  1YBI A;  3N7M A;  3VSZ A;  4KBB A;  3RTJ B;  1BFB A;  2P39 A;  2E4M A;  4I6I A;  2MC2 A;  5B2H A;  1S0F A;  2VSE A;  2Y9G A;  2VU9 A;  3FJB A;  3RMY A;  3R4U A;  4A7K A;  4DEN A;  1D0H A;  1RML A;  4AN6 A;  1JY0 A;  2D24 A;  4X3A A;  4LO2 A;  3LTQ A;  3BRF A;  3OJ2 A;  2DS0 A;  2D22 A;  4I37 A;  4KC3 A;  1II4 A;  3OJM A;  2FDB M;  3VT2 A;  4JPZ A;  7I1B A;  1E0O A;  3BAU A;  5BP5 C;  1V6V A;  3P6J A;  4GOV A;  4ZOT A;  1EV2 A;  1JT3 A;  3ILA A;  4I4U A;  3POK A;  1TP0 A;  4LO7 C;  3I29 B;  1HKN A;  1ISX A;  3ZX7 A;  3F1R A;  4PC4 A;  3VUO A;  2BEB A;  1HCE A;  2NVH A;  3PG0 A;  5FZU A;  9ILB A;  1DQO A;  2RG9 B;  3FJ9 A;  2X2T A;  2VSA A;  1G9A A;  3ZC8 A;  4EB2 B;  4F83 A;  3V0A B;  3TC2 A;  1HWO B;  1I1E A;  4FVV A;  4Q91 A;  2IHO A;  3ZXG A;  4GP0 A;  4L4I A;  4XFS A;  3FJC A;  2P23 A;  1TOO A;  4JRA A;  4LO1 A;  5E24 E;  3O4C A;  2D1Z A;  3A22 A;  4OEE A;  1PUM B;  4XFT A;  1V6X A;  3UJ0 A;  2ERM A;  1AVA C;  1JLY A;  4DEP A;  4ISR A;  1CE7 B;  1AVU A;  1TWE A;  4LO8 B;  1V6W A;  1AFC A;  1PWA A;  3UDA A;  2DRY A;  3N7K A;  3SNV A;  3VSF A;  3AZW A;  1SZ6 B;  3CA1 A;  1I1B A;  2YUG A;  3BAG A;  3B9U A;  3P53 A;  2X2S A;  2QYI B;  1P63 A;  1PUU B;  3W9T A;  1BFF A;  3OBT A;  1IT0 A;  4H9W A;  1Z0H A;  1EPW A;  2KI6 B;  4I4R A;  1CVS A;  3O4O A;  3P6I A;  4IYB A;  2NP0 A;  3FJ8 A;  2ESU A;  1N4K A;  3CA3 A;  4HJJ A;  3MPP G;  5DUY A;  3BTA A;  1HWN B;  3V0B A;  1IJT A;  5BP5 A;  1BFC A;  2Z49 A;  4HA2 A;  1DZC A;  3FJF A;  4IZX A;  3A07 A;  4TLP A;  4OWJ A;  3BB2 A;  4EEE B;  4KEK A;  3ZXD A;  1V6U A;  3T8S A;  5BXP A;  2VUA A;  3HMY A;  4ZBV B;  3N7J A;  5BXR A;  4I4P A;  1QQL A;  1MC9 A;  3C9Z A;  4I7I A;  2D43 A;  3O4D A;  1BFG A;  1W3G A;  2K43 A;  1AF9 A;  2ZQN A;  2BEA A;  6I1B A;  2Q9X A;  4I1B A;  1OQL B;  4ZLB B;  4USP A;  5F8W A;  2AQZ A;  4I4S A;  3BX1 C;  1SR4 C;  4P0L A;  3UJ4 A;  2HWA A;  1WD3 A;  1QXM A;  2IWT B;  3OGG A;  4OEF A;  1AVW B;  2WBC A;  2MIB A;  4I96 A;  2NZ9 A;  5I1B A;  4L4H A;  3A23 A;  4D8H A;  1UPS A;  4GOY A;  1YXW A;  3PME A;  4ZKT B;  3BRG C;  3JUT A;  1HIB A;  5D62 A;  1NZK A;  5BQU C;  4I4Q A;  5EC5 A;  4F34 A;  3H6Q A;  2VLC A;  1AVX B;  1FN0 A;  1ILR 1;  1NUN A;  1IRP A;  2NTD A;  3FJJ A;  1WBA A;  4P0J A;  8I1B A;  1S0D A;  3NBD A;  1Q03 A;  3WMU A;  3HSM A;  4HR6 C;  1S0G A;  1DIW A;  1HCD A;  2Y9X E;  4QC4 A;  3AH1 A;  3AJ6 A;  3AH2 A;  4ZFW B;  1G9B A;  4QKR A;  3K1X A;  4LO3 C;  4JKX B;  4J2Y A;  1DFC A;  3BAD A;  5FZY A;  2Q3N B;  1ISW A;  4G1R A;  1XG6 A;  3IM7 A;  3BA5 A;  2LIE A;  3O3Q A;  1HWM B;  3OBR A;  3OJV A;  3UD8 A;  5BOW A;  1XYF A;  3IAG C;  1A8D A;  3CRG A;  4IY9 A;  1XZZ A;  4OUJ A;  2FGF A;  3O5W B;  4II0 A;  1BAS A;  3WMV A;  3Q7W A;  2Z48 A;  3WO4 A;  1XHB A;  3WIN C;  5DZU A;  3AKG A;  4ZFY B;  2FFU A;  3NBE A;  5G00 A;  1DFQ A;  1YTO A;  4EFQ A;  4EKX B;  3NBN A;  4CJM A;  3O4A A;  4YOL A;  4D0T A;  2KH2 A;  5D61 A;  4USO A;  1ISV A;  3Q7Y A;  3MAL A;  1DJS B;  3CA4 A;  2D7R A;  3HN1 A;  3V79 C;  4DCK C;  3N7L A;  1G9D A;  3A21 A;  4QD2 C;  1DZD A;  4LO0 C;  2BFH A;  1BA7 A;  4P6A A;  3CA0 A;  3VT0 A;  1T9F A;  5D63 A;  4JAW A;  4G6M A;  1AXM A;  4I0Y A;  3QYD A;  2RQ9 A;  1Z2V A;  3IM6 A;  1JTC A;  3H6R A;  1S0L A;  2D20 A;  5DVH A;  4I2S A;  5BQU A;  3QR5 A;  1FV2 A;  3BAO A;  1GGP B;  5JMC A;  5FZZ A;  3FJD A;  5BXS A;  4END A;  3R4S A;  1BLA A;  2HZ9 A;  1G82 A;  4GAF A;  4GAI A;  1IRA X;  3FJK A;  4EFP A;  5EHA A;  2UUS A;  1MD6 A;  1YYN A;  1Z4S A;  3Q7X A;  4I8M A;  4XFU A;  4Q9G A;  1RZO B;  3HOM A;  5F8S A;  1K5U A;  1M2T B;  1DLL A;  2GO2 A;  1F31 A;  3RSJ A;  4ZFU B;  2FO1 A;  1WD4 A;  3AJ5 A;  4I3N A;  2WRY A;  4IQP A;  4I1E A;  3IIR A;  5EG6 C;  4QKS A;  4X37 A;  2AFG A;  2ZQO A;  3UD7 A;  3AZV A;  5F90 A;  3WA1 A;  2F2F C;  1VCL A;  3V0B B;  3ZC9 A;  2M49 A;  4J23 B;  2VXR A;  3WIN A;  3JRR A;  1TIE A;  4JQ0 A;  1QQK A;  3V0A A;  2R9K B;  4LO7 B;  4OWL A;  3EF2 A;  1JQZ A;  4QBV A;  5FNW A;  1ITB A;  1FV3 A;  1L2H A;  4A7Y A;  4R6U B;  1J0S A;  4J2K A;  4Z8S B;  2RST A;  2GZB A;  3VEQ A;  1TTU A;  2D23 A;  3BA7 A;  1G9C A;  2Y9F A;  3AKF A;  4J2S A;  3D7W B;  1T4Q A;  1W3F A;  3CAH A;  4JKQ A;  4EFR A;  2KKI A;  3VWC A;  4LO0 A;  4ZGR B;  1ISZ A;  2ET2 A;  3CU1 B;  5BVP I;  2HW9 A;  4D0Z A;  1R8O A;  1IHK A;  4QBC A;  4OEG A;  3OGF A;  3WO2 A;  2D44 A;  5DSS B;  4ZA3 B;  3HAL A;  2FFV A;  2K8R A;  3CQA A;  2DRE A;  4IY8 A;  3IM5 A;  1IOB A;  1JT7 A;  4WBC A;  3HBW A;  3I2X A;  3BAQ A;  3FJE A;  2L5X A;  1WBC A;  41BI A;  4H04 A;  5JLV A;  4OW4 A;  4IHZ A;  4GP3 A;  4I4Y A;  4KEI A;  1FWV A;  3H6S E;  1W3A A;  2NYY A;  3CRI A;  1ONK B;  3LLP A;  1JT4 A;  1ISY A;  1FWU A;  2HWM A;  3UD9 A;  1HWP B;  1IIL A;  1TWM A;  2E4M C;  2D7I A;  3BA4 A;  3O4B A;  3RTI B;  1FQ9 A;  4Q9P A;  5FNX A;  1FMZ A;  1BLD A;  1Q04 A;  2LIQ A;  1R8N A;  4QO3 A;  4XKI A;  2KLL A;  3F62 B;  1DQG A;  4I4O A;  4LO2 C;  21BI A;  2J3P A;  1JT5 A;  4QD2 B;  4X38 A;  4AN7 B;  3NBC A;  4ION A;  3FJA A;  2F8X C;  5GAQ A;  2Y9W C;  3BAH A;  2KI4 A;  4A7Z A;  4I4X A;  2AAI B;  4JP0 A;  3I2A A;  3O49 A;  1S0E A;  2MLL B;  1TFM B;  4J2X A;  1SR4 A;  1M16 A;  3FUO A;  2I1B A;  4IZE A;  3AH4 A;  1BAR A;  4G6J A;  4P0K A;  2NM1 A;  3S8K A;  2K4A B;  2F2F A;  4KEJ A;  3AKI A;  3S8J A;  3E8L C;  1YF8 B;  5F8Y A;  1S0B A;  4X39 A;  3BAV A;  4I4V A;  3N0K A;  3AKH A;  1Q1U A;  3CA6 A;  4Z9W B;  3O44 A;  2XOA A;  4OWK A;  3PUB A;  3CRH A;  3WO3 A;  1PZZ A;  1RY7 A;  3KMV A;  1FMM S;  1EYL A;  3RMX A;  31BI A;  3CA5 A;  4LO3 A;  1PC8 B;  2QN4 A;  3NJ5 A;  2ZR1 B;  5HPZ A;  2AXM A;  1ABR B;  4LO1 C;  1FGA A;  1K5V A;  3FGM A;  1S0C A;  2VXT I;  3FUQ A;  1KNM A;  3FJH A;  3FJI A;  1RG8 A;  5BXT A;  4G9N A;  3BRD A;  3FFZ A;  4G9M A;  3H6R B;  2DRZ A;  4ISQ A; 
#chains in the Genus database with same CATH topology
 1EVT A;  1JLX A;  3PHZ A;  3VT1 A;  4FGF A;  4QAL A;  1YBI A;  3N7M A;  3VSZ A;  4KBB A;  3RTJ B;  1BFB A;  2P39 A;  2E4M A;  4I6I A;  2MC2 A;  5B2H A;  1S0F A;  2VSE A;  2Y9G A;  2VU9 A;  3FJB A;  3RMY A;  3R4U A;  4A7K A;  4DEN A;  1D0H A;  1RML A;  4AN6 A;  1JY0 A;  2D24 A;  4X3A A;  4LO2 A;  3LTQ A;  3BRF A;  3OJ2 A;  2DS0 A;  2D22 A;  4I37 A;  4KC3 A;  1II4 A;  3OJM A;  2FDB M;  3VT2 A;  4JPZ A;  7I1B A;  1E0O A;  3BAU A;  5BP5 C;  1V6V A;  3P6J A;  4GOV A;  4ZOT A;  1EV2 A;  1JT3 A;  3ILA A;  4I4U A;  3POK A;  1TP0 A;  4LO7 C;  3I29 B;  1HKN A;  1ISX A;  3ZX7 A;  3F1R A;  4PC4 A;  3VUO A;  2BEB A;  1HCE A;  2NVH A;  3PG0 A;  5FZU A;  9ILB A;  1DQO A;  2RG9 B;  3FJ9 A;  2X2T A;  2VSA A;  1G9A A;  3ZC8 A;  4EB2 B;  4F83 A;  3V0A B;  3TC2 A;  1HWO B;  1I1E A;  4FVV A;  4Q91 A;  2IHO A;  3ZXG A;  4GP0 A;  4L4I A;  4XFS A;  3FJC A;  2P23 A;  1TOO A;  4JRA A;  4LO1 A;  5E24 E;  3O4C A;  2D1Z A;  3A22 A;  4OEE A;  1PUM B;  4XFT A;  1V6X A;  3UJ0 A;  2ERM A;  1AVA C;  1JLY A;  4DEP A;  4ISR A;  1CE7 B;  1AVU A;  1TWE A;  4LO8 B;  1V6W A;  1AFC A;  1PWA A;  3UDA A;  2DRY A;  3N7K A;  3SNV A;  3VSF A;  3AZW A;  1SZ6 B;  3CA1 A;  1I1B A;  2YUG A;  3BAG A;  3B9U A;  3P53 A;  2X2S A;  2QYI B;  1P63 A;  1PUU B;  3W9T A;  1BFF A;  3OBT A;  1IT0 A;  4H9W A;  1Z0H A;  1EPW A;  2KI6 B;  4I4R A;  1CVS A;  3O4O A;  3P6I A;  4IYB A;  2NP0 A;  3FJ8 A;  2ESU A;  1N4K A;  3CA3 A;  4HJJ A;  3MPP G;  5DUY A;  3BTA A;  1HWN B;  3V0B A;  1IJT A;  5BP5 A;  1BFC A;  2Z49 A;  4HA2 A;  1DZC A;  3FJF A;  4IZX A;  3A07 A;  4TLP A;  4OWJ A;  3BB2 A;  4EEE B;  4KEK A;  3ZXD A;  1V6U A;  3T8S A;  5BXP A;  2VUA A;  3HMY A;  4ZBV B;  3N7J A;  5BXR A;  4I4P A;  1QQL A;  1MC9 A;  3C9Z A;  4I7I A;  2D43 A;  3O4D A;  1BFG A;  1W3G A;  2K43 A;  1AF9 A;  2ZQN A;  2BEA A;  6I1B A;  2Q9X A;  4I1B A;  1OQL B;  4ZLB B;  4USP A;  5F8W A;  2AQZ A;  4I4S A;  3BX1 C;  1SR4 C;  4P0L A;  3UJ4 A;  2HWA A;  1WD3 A;  1QXM A;  2IWT B;  3OGG A;  4OEF A;  1AVW B;  2WBC A;  4MZF B;  2MIB A;  4I96 A;  2NZ9 A;  5I1B A;  4L4H A;  3A23 A;  4D8H A;  1UPS A;  4GOY A;  1YXW A;  3PME A;  4ZKT B;  3BRG C;  3JUT A;  1HIB A;  5D62 A;  1NZK A;  5BQU C;  4I4Q A;  5EC5 A;  4F34 A;  3H6Q A;  2VLC A;  1AVX B;  1FN0 A;  1ILR 1;  1NUN A;  1IRP A;  2NTD A;  3FJJ A;  1WBA A;  4P0J A;  8I1B A;  1S0D A;  3NBD A;  1Q03 A;  3WMU A;  3HSM A;  4HR6 C;  1S0G A;  1DIW A;  1HCD A;  2Y9X E;  4QC4 A;  3AH1 A;  3AJ6 A;  3AH2 A;  4ZFW B;  1G9B A;  4QKR A;  3K1X A;  4LO3 C;  4JKX B;  4J2Y A;  1DFC A;  3BAD A;  5FZY A;  2Q3N B;  1ISW A;  4G1R A;  1XG6 A;  3IM7 A;  3BA5 A;  2LIE A;  3O3Q A;  1HWM B;  3OBR A;  3OJV A;  3UD8 A;  5BOW A;  1XYF A;  3IAG C;  1A8D A;  3CRG A;  4IY9 A;  2NS2 A;  1XZZ A;  4OUJ A;  2FGF A;  3O5W B;  4II0 A;  1BAS A;  3WMV A;  3Q7W A;  2Z48 A;  3WO4 A;  1XHB A;  3WIN C;  5DZU A;  3AKG A;  4ZFY B;  2FFU A;  3NBE A;  5G00 A;  1DFQ A;  1YTO A;  4EFQ A;  4EKX B;  3NBN A;  4CJM A;  3O4A A;  4YOL A;  4D0T A;  2KH2 A;  5D61 A;  4USO A;  1ISV A;  3Q7Y A;  3MAL A;  1DJS B;  3CA4 A;  2D7R A;  3HN1 A;  3V79 C;  4DCK C;  3N7L A;  1G9D A;  3A21 A;  4QD2 C;  1DZD A;  4LO0 C;  2BFH A;  1BA7 A;  4P6A A;  3CA0 A;  3VT0 A;  1T9F A;  5D63 A;  4JAW A;  4G6M A;  1AXM A;  4I0Y A;  3QYD A;  2RQ9 A;  1Z2V A;  3IM6 A;  1JTC A;  3H6R A;  1S0L A;  4H75 A;  2D20 A;  5DVH A;  4I2S A;  5BQU A;  3QR5 A;  1FV2 A;  3BAO A;  1GGP B;  5JMC A;  5FZZ A;  3FJD A;  5BXS A;  4END A;  3R4S A;  1BLA A;  4MZH A;  2HZ9 A;  1G82 A;  4GAF A;  4GAI A;  1IRA X;  3FJK A;  4EFP A;  5EHA A;  2UUS A;  1MD6 A;  1YYN A;  1Z4S A;  3Q7X A;  4I8M A;  4XFU A;  4Q9G A;  1RZO B;  3HOM A;  5F8S A;  1K5U A;  1M2T B;  1DLL A;  2GO2 A;  1F31 A;  3RSJ A;  4ZFU B;  2FO1 A;  1WD4 A;  3AJ5 A;  4I3N A;  2WRY A;  4IQP A;  4I1E A;  3IIR A;  5EG6 C;  4QKS A;  4X37 A;  2AFG A;  2ZQO A;  3UD7 A;  3AZV A;  5F90 A;  3WA1 A;  2F2F C;  1VCL A;  3V0B B;  3ZC9 A;  2M49 A;  4J23 B;  2VXR A;  3WIN A;  3JRR A;  1TIE A;  4JQ0 A;  1QQK A;  3V0A A;  2R9K B;  4MZG B;  4LO7 B;  4OWL A;  3EF2 A;  1JQZ A;  4QBV A;  5FNW A;  1ITB A;  1FV3 A;  1L2H A;  4A7Y A;  4R6U B;  1J0S A;  4J2K A;  4Z8S B;  2RST A;  2GZB A;  3VEQ A;  1TTU A;  2D23 A;  3BA7 A;  1G9C A;  2Y9F A;  3AKF A;  4J2S A;  3D7W B;  1T4Q A;  1W3F A;  3CAH A;  4JKQ A;  4EFR A;  2KKI A;  3VWC A;  4LO0 A;  4ZGR B;  1ISZ A;  2ET2 A;  3CU1 B;  5BVP I;  2HW9 A;  4D0Z A;  1R8O A;  1IHK A;  4QBC A;  4OEG A;  3OGF A;  3WO2 A;  2D44 A;  5DSS B;  4ZA3 B;  3HAL A;  2FFV A;  2K8R A;  3CQA A;  2DRE A;  4IY8 A;  3IM5 A;  1IOB A;  1JT7 A;  4WBC A;  3HBW A;  3I2X A;  3BAQ A;  3FJE A;  2L5X A;  1WBC A;  41BI A;  4H04 A;  5JLV A;  4OW4 A;  4IHZ A;  4GP3 A;  4I4Y A;  4KEI A;  1FWV A;  3H6S E;  1W3A A;  2NYY A;  3CRI A;  1ONK B;  3LLP A;  1JT4 A;  1ISY A;  1FWU A;  2HWM A;  3UD9 A;  1HWP B;  1IIL A;  1TWM A;  4UY4 A;  2E4M C;  2D7I A;  3BA4 A;  3O4B A;  3RTI B;  1FQ9 A;  4Q9P A;  5FNX A;  1FMZ A;  1BLD A;  1Q04 A;  2LIQ A;  1R8N A;  4QO3 A;  4XKI A;  2KLL A;  3F62 B;  1DQG A;  4I4O A;  4LO2 C;  21BI A;  2J3P A;  1JT5 A;  4QD2 B;  4X38 A;  4AN7 B;  3NBC A;  4ION A;  3FJA A;  2F8X C;  5GAQ A;  2Y9W C;  3BAH A;  2KI4 A;  4A7Z A;  4I4X A;  2AAI B;  4JP0 A;  3I2A A;  3O49 A;  1S0E A;  2MLL B;  1TFM B;  4J2X A;  1SR4 A;  1M16 A;  3FUO A;  2I1B A;  4IZE A;  3AH4 A;  1BAR A;  4G6J A;  4P0K A;  2NM1 A;  3S8K A;  2K4A B;  2F2F A;  4KEJ A;  3AKI A;  3S8J A;  3E8L C;  1YF8 B;  5F8Y A;  1S0B A;  4X39 A;  3BAV A;  4I4V A;  3N0K A;  3AKH A;  1Q1U A;  3CA6 A;  4Z9W B;  3O44 A;  2XOA A;  4OWK A;  3PUB A;  3CRH A;  3WO3 A;  1PZZ A;  1RY7 A;  3KMV A;  1FMM S;  1EYL A;  3RMX A;  31BI A;  3CA5 A;  4LO3 A;  1PC8 B;  2QN4 A;  3NJ5 A;  2ZR1 B;  5HPZ A;  2AXM A;  1ABR B;  4LO1 C;  1FGA A;  1K5V A;  3FGM A;  1S0C A;  2VXT I;  3FUQ A;  1KNM A;  3FJH A;  3FJI A;  1RG8 A;  5BXT A;  4G9N A;  3BRD A;  3FFZ A;  4G9M A;  3H6R B;  2DRZ A;  4ISQ A; 
#chains in the Genus database with same CATH homology
 1EVT A;  1JLX A;  3PHZ A;  3VT1 A;  4FGF A;  4QAL A;  1YBI A;  3N7M A;  3VSZ A;  4KBB A;  3RTJ B;  1BFB A;  2P39 A;  2E4M A;  4I6I A;  2MC2 A;  5B2H A;  1S0F A;  2VSE A;  2Y9G A;  2VU9 A;  3FJB A;  3RMY A;  3R4U A;  4A7K A;  4DEN A;  1D0H A;  1RML A;  4AN6 A;  1JY0 A;  2D24 A;  4X3A A;  4LO2 A;  3LTQ A;  3BRF A;  3OJ2 A;  2DS0 A;  2D22 A;  4I37 A;  4KC3 A;  1II4 A;  3OJM A;  2FDB M;  3VT2 A;  4JPZ A;  7I1B A;  1E0O A;  3BAU A;  5BP5 C;  1V6V A;  3P6J A;  4GOV A;  4ZOT A;  1EV2 A;  1JT3 A;  3ILA A;  4I4U A;  3POK A;  1TP0 A;  4LO7 C;  3I29 B;  1HKN A;  1ISX A;  3ZX7 A;  3F1R A;  4PC4 A;  3VUO A;  2BEB A;  1HCE A;  2NVH A;  3PG0 A;  5FZU A;  9ILB A;  1DQO A;  2RG9 B;  3FJ9 A;  2X2T A;  2VSA A;  1G9A A;  3ZC8 A;  4EB2 B;  4F83 A;  3V0A B;  3TC2 A;  1HWO B;  1I1E A;  4FVV A;  4Q91 A;  2IHO A;  3ZXG A;  4GP0 A;  4L4I A;  4XFS A;  3FJC A;  2P23 A;  1TOO A;  4JRA A;  4LO1 A;  5E24 E;  3O4C A;  2D1Z A;  3A22 A;  4OEE A;  1PUM B;  4XFT A;  1V6X A;  3UJ0 A;  2ERM A;  1AVA C;  1JLY A;  4DEP A;  4ISR A;  1CE7 B;  1AVU A;  1TWE A;  4LO8 B;  1V6W A;  1AFC A;  1PWA A;  3UDA A;  2DRY A;  3N7K A;  3SNV A;  3VSF A;  3AZW A;  1SZ6 B;  3CA1 A;  1I1B A;  2YUG A;  3BAG A;  3B9U A;  3P53 A;  2X2S A;  2QYI B;  1P63 A;  1PUU B;  3W9T A;  1BFF A;  3OBT A;  1IT0 A;  4H9W A;  1Z0H A;  1EPW A;  2KI6 B;  4I4R A;  1CVS A;  3O4O A;  3P6I A;  4IYB A;  2NP0 A;  3FJ8 A;  2ESU A;  1N4K A;  3CA3 A;  4HJJ A;  3MPP G;  5DUY A;  3BTA A;  1HWN B;  3V0B A;  1IJT A;  5BP5 A;  1BFC A;  2Z49 A;  4HA2 A;  1DZC A;  3FJF A;  4IZX A;  3A07 A;  4TLP A;  4OWJ A;  3BB2 A;  4EEE B;  4KEK A;  3ZXD A;  1V6U A;  3T8S A;  5BXP A;  2VUA A;  3HMY A;  4ZBV B;  3N7J A;  5BXR A;  4I4P A;  1QQL A;  1MC9 A;  3C9Z A;  4I7I A;  2D43 A;  3O4D A;  1BFG A;  1W3G A;  2K43 A;  1AF9 A;  2ZQN A;  2BEA A;  6I1B A;  2Q9X A;  4I1B A;  1OQL B;  4ZLB B;  4USP A;  5F8W A;  2AQZ A;  4I4S A;  3BX1 C;  1SR4 C;  4P0L A;  3UJ4 A;  2HWA A;  1WD3 A;  1QXM A;  2IWT B;  3OGG A;  4OEF A;  1AVW B;  2WBC A;  4MZF B;  2MIB A;  4I96 A;  2NZ9 A;  5I1B A;  4L4H A;  3A23 A;  4D8H A;  1UPS A;  4GOY A;  1YXW A;  3PME A;  4ZKT B;  3BRG C;  3JUT A;  1HIB A;  5D62 A;  1NZK A;  5BQU C;  4I4Q A;  5EC5 A;  4F34 A;  3H6Q A;  2VLC A;  1AVX B;  1FN0 A;  1ILR 1;  1NUN A;  1IRP A;  2NTD A;  3FJJ A;  1WBA A;  4P0J A;  8I1B A;  1S0D A;  3NBD A;  1Q03 A;  3WMU A;  3HSM A;  4HR6 C;  1S0G A;  1DIW A;  1HCD A;  2Y9X E;  4QC4 A;  3AH1 A;  3AJ6 A;  3AH2 A;  4ZFW B;  1G9B A;  4QKR A;  3K1X A;  4LO3 C;  4JKX B;  4J2Y A;  1DFC A;  3BAD A;  5FZY A;  2Q3N B;  1ISW A;  4G1R A;  1XG6 A;  3IM7 A;  3BA5 A;  2LIE A;  3O3Q A;  1HWM B;  3OBR A;  3OJV A;  3UD8 A;  5BOW A;  1XYF A;  3IAG C;  1A8D A;  3CRG A;  4IY9 A;  2NS2 A;  1XZZ A;  4OUJ A;  2FGF A;  3O5W B;  4II0 A;  1BAS A;  3WMV A;  3Q7W A;  2Z48 A;  3WO4 A;  1XHB A;  3WIN C;  5DZU A;  3AKG A;  4ZFY B;  2FFU A;  3NBE A;  5G00 A;  1DFQ A;  1YTO A;  4EFQ A;  4EKX B;  3NBN A;  4CJM A;  3O4A A;  4YOL A;  4D0T A;  2KH2 A;  5D61 A;  4USO A;  1ISV A;  3Q7Y A;  3MAL A;  1DJS B;  3CA4 A;  2D7R A;  3HN1 A;  3V79 C;  4DCK C;  3N7L A;  1G9D A;  3A21 A;  4QD2 C;  1DZD A;  4LO0 C;  2BFH A;  1BA7 A;  4P6A A;  3CA0 A;  3VT0 A;  1T9F A;  5D63 A;  4JAW A;  4G6M A;  1AXM A;  4I0Y A;  3QYD A;  2RQ9 A;  1Z2V A;  3IM6 A;  1JTC A;  3H6R A;  1S0L A;  4H75 A;  2D20 A;  5DVH A;  4I2S A;  5BQU A;  3QR5 A;  1FV2 A;  3BAO A;  1GGP B;  5JMC A;  5FZZ A;  3FJD A;  5BXS A;  4END A;  3R4S A;  1BLA A;  4MZH A;  2HZ9 A;  1G82 A;  4GAF A;  4GAI A;  1IRA X;  3FJK A;  4EFP A;  5EHA A;  2UUS A;  1MD6 A;  1YYN A;  1Z4S A;  3Q7X A;  4I8M A;  4XFU A;  4Q9G A;  1RZO B;  3HOM A;  5F8S A;  1K5U A;  1M2T B;  1DLL A;  2GO2 A;  1F31 A;  3RSJ A;  4ZFU B;  2FO1 A;  1WD4 A;  3AJ5 A;  4I3N A;  2WRY A;  4IQP A;  4I1E A;  3IIR A;  5EG6 C;  4QKS A;  4X37 A;  2AFG A;  2ZQO A;  3UD7 A;  3AZV A;  5F90 A;  3WA1 A;  2F2F C;  1VCL A;  3V0B B;  3ZC9 A;  2M49 A;  4J23 B;  2VXR A;  3WIN A;  3JRR A;  1TIE A;  4JQ0 A;  1QQK A;  3V0A A;  2R9K B;  4MZG B;  4LO7 B;  4OWL A;  3EF2 A;  1JQZ A;  4QBV A;  5FNW A;  1ITB A;  1FV3 A;  1L2H A;  4A7Y A;  4R6U B;  1J0S A;  4J2K A;  4Z8S B;  2RST A;  2GZB A;  3VEQ A;  1TTU A;  2D23 A;  3BA7 A;  1G9C A;  2Y9F A;  3AKF A;  4J2S A;  3D7W B;  1T4Q A;  1W3F A;  3CAH A;  4JKQ A;  4EFR A;  2KKI A;  3VWC A;  4LO0 A;  4ZGR B;  1ISZ A;  2ET2 A;  3CU1 B;  5BVP I;  2HW9 A;  4D0Z A;  1R8O A;  1IHK A;  4QBC A;  4OEG A;  3OGF A;  3WO2 A;  2D44 A;  5DSS B;  4ZA3 B;  3HAL A;  2FFV A;  2K8R A;  3CQA A;  2DRE A;  4IY8 A;  3IM5 A;  1IOB A;  1JT7 A;  4WBC A;  3HBW A;  3I2X A;  3BAQ A;  3FJE A;  2L5X A;  1WBC A;  41BI A;  4H04 A;  5JLV A;  4OW4 A;  4IHZ A;  4GP3 A;  4I4Y A;  4KEI A;  1FWV A;  3H6S E;  1W3A A;  2NYY A;  3CRI A;  1ONK B;  3LLP A;  1JT4 A;  1ISY A;  1FWU A;  2HWM A;  3UD9 A;  1HWP B;  1IIL A;  1TWM A;  4UY4 A;  2E4M C;  2D7I A;  3BA4 A;  3O4B A;  3RTI B;  1FQ9 A;  4Q9P A;  5FNX A;  1FMZ A;  1BLD A;  1Q04 A;  2LIQ A;  1R8N A;  4QO3 A;  4XKI A;  2KLL A;  3F62 B;  1DQG A;  4I4O A;  4LO2 C;  21BI A;  2J3P A;  1JT5 A;  4QD2 B;  4X38 A;  4AN7 B;  3NBC A;  4ION A;  3FJA A;  2F8X C;  5GAQ A;  2Y9W C;  3BAH A;  2KI4 A;  4A7Z A;  4I4X A;  2AAI B;  4JP0 A;  3I2A A;  3O49 A;  1S0E A;  2MLL B;  1TFM B;  4J2X A;  1SR4 A;  1M16 A;  3FUO A;  2I1B A;  4IZE A;  3AH4 A;  1BAR A;  4G6J A;  4P0K A;  2NM1 A;  3S8K A;  2K4A B;  2F2F A;  4KEJ A;  3AKI A;  3S8J A;  3E8L C;  1YF8 B;  5F8Y A;  1S0B A;  4X39 A;  3BAV A;  4I4V A;  3N0K A;  3AKH A;  1Q1U A;  3CA6 A;  4Z9W B;  3O44 A;  2XOA A;  4OWK A;  3PUB A;  3CRH A;  3WO3 A;  1PZZ A;  1RY7 A;  3KMV A;  1FMM S;  1EYL A;  3RMX A;  31BI A;  3CA5 A;  4LO3 A;  1PC8 B;  2QN4 A;  3NJ5 A;  2ZR1 B;  5HPZ A;  2AXM A;  1ABR B;  4LO1 C;  1FGA A;  1K5V A;  3FGM A;  1S0C A;  2VXT I;  3FUQ A;  1KNM A;  3FJH A;  3FJI A;  1RG8 A;  5BXT A;  4G9N A;  3BRD A;  3FFZ A;  4G9M A;  3H6R B;  2DRZ A;  4ISQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...