3UD7A

Crystal structure analysis of fgf1-disaccharide(ni21) complexes
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
127
structure length
127
Chain Sequence
PKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title Divergent synthesis of 48 heparan sulfate-based disaccharides and probing the specific sugar-fibroblast growth factor-1 interaction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 27
structure length 127
sequence length 127
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-10-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3ud7A00
4I37A 1YBIA 3UJ4A 5EHAA 4WBCA 2NZ9A 1PUMB 4ZLBB 1PC8B 2RG9B 4LO3C 3AKIA 1EPWA 3ZC8A 4LO1C 4USOA 4IONA 3NJ5A 4J23B 1K5VA 4ZA3B 5DUYA 3HOMA 3ZXDA 3CAHA 4ZOTA 1G9BA 3BAUA 1AVUA 1MC9A 2IWTB 1TFMB 5BXRA 41BIA 2F2FC 4CJMA 2MC2A 7I1BA 1BARA 5BQUC 2D7RA 3S8JA 1G9CA 3BTAA 4X37A 1ITBA 1Q03A 1Q1UA 1RMLA 4QALA 3PHZA 4QO3A 4A7YA 1HWOB 2WRYA 2KI4A 3P6IA 2BFHA 3AH1A 1J0SA 4JRAA 1HCEA 1W3FA 5D61A 1SR4C 2FFVA 4LO0C 4IQPA 4ZFYB 3BAGA 1YF8B 1DFQA 4H04A 4G9NA 3OGGA 1IJTA 1S0LA 1BFBA 2YUGA 1CVSA 1DFCA 4I8MA 3CRHA 1YTOA 2F8XC 4EFRA 1DZDA 1M2TB 2NM1A 3F62B 5E24E 3O4OA 4I4OA 1KNMA 1Q04A 3VT2A 3I29B 4J2KA 3VWCA 3T8SA 1AF9A 2AAIB 1ISWA 3HALA 3BADA 2ZR1B 5FNXA 1Z0HA 3FJAA 3TC2A 1CE7B 4P0JA 4Q9GA 4P0LA 5B2HA 1IRPA 1Z2VA 3BRFA 1IRAX 4GOYA 3RSJA 3UD7A 3FJHA 5D63A 1S0DA 4Z9WB 1GGPB 3ZXGA 4ZGRB 2K43A 2M49A 1QXMA 4I4PA 1II4A 4KEKA 1BLAA 1DQGA 1T4QA 1S0FA 3CU1B 3P6JA 4I1BA 1G9DA 3H6QA 2D24A 4GAFA 4I4VA 3FGMA 1FWUA 2E4MA 3HSMA 4I4RA 1AXMA 3QYDA 3BA4A 4II0A 3N0KA 4I7IA 3SNVA 1K5UA 3OJVA 1HIBA 1HWPB 3CA6A 4FGFA 2Q9XA 4J2XA 4Q9PA 3FJKA 3BAVA 3ILAA 4LO1A 4ENDA 1M16A 4R6UB 3VEQA 1NZKA 4KEJA 2X2TA 4JPZA 4X3AA 2DRZA 2GO2A 4F34A 3CA1A 4EKXB 2KI6B 4Z8SB 1MD6A 2F2FA 2VU9A 5BXSA 1T9FA 2AXMA 3FUOA 5BXPA 4XKIA 1WD4A 3O4AA 3EF2A 4QD2B 5JMCA 2LIEA 2UUSA 4EEEB 3FJJA 4IZEA 4QKRA 2NTDA 2ERMA 5BVPI 3AZVA 4JP0A 5I1BA 3Q7YA 3W9TA 4I6IA 2NVHA 3WINA 3UD8A 3BAOA 2J3PA 4ZFWB 4OW4A 2R9KB 3MPPG 1IT0A 3O3QA 1BA7A 3PMEA 1TWMA 3FJDA 4OEEA 3F1RA 3BA7A 1UPSA 2GZBA 3JRRA 1JLYA 3POKA 4XFUA 1ISZA 3D7WB 2HWAA 1PUUB 1EYLA 5F8YA 1RG8A 2Q3NB 4HA2A 5EC5A 4D0ZA 3OBTA 4DENA 8I1BA 4LO7C 3VSZA 4G1RA 1W3GA 1YXWA 3PUBA 1V6XA 4HJJA 3WMVA 1JLXA 1S0BA 5G00A 3OJMA 4IY9A 4G6JA 4A7KA 1W3AA 3C9ZA 3E8LC 1P63A 2Z49A 1WBAA 4L4HA 4TLPA 3ZX7A 5EG6C 2D22A 1XZZA 5JLVA 1PWAA 4QBCA 1ISVA 3A07A 1IOBA 2KLLA 4OUJA 3V0AA 3BA5A 1TTUA 1AVXB 3N7LA 4L4IA 1DQOA 5DVHA 3AJ5A 3I2AA 4XFSA 2P39A 4JKQA 1G9AA 2D20A 1JT5A 1OQLB 3O4CA 4X38A 6I1BA 3FFZA 3BB2A 3LLPA 2WBCA 2HW9A 1JTCA 4OEGA 4ZBVB 4A7ZA 1JT7A 1V6VA 2Y9GA 1R8OA 3V0AB 5F8SA 2Y9FA 2NP0A 3FJEA 4QC4A 3S8KA 3CRIA 3OJ2A 2FFUA 4D8HA 1ISYA 1RZOB 3A23A 3UD9A 1ABRB 3IIRA 4ZFUB 4J2YA 1Z4SA 1BFFA 1FMMS 2RSTA 3FUQA 3Q7XA 2HZ9A 3RTJB 1WBCA 4OWLA 3MALA 3CA0A 4I4UA 4AN6A 1TIEA 1N4KA 1V6WA 2L5XA 2K4AB 2LIQA 4LO3A 3CA3A 4XFTA 2AQZA 4LO2C 2FDBM 4AN7B 1DIWA 3V0BA 2IHOA 3BX1C 3NBDA 9ILBA 3HBWA 1IHKA 4EFQA 3N7MA 1I1BA 4YOLA 3IM5A 1JT3A 3RMYA 3LTQA 3WO4A 3VT0A 2HWMA 4D0TA 1PZZA 2X2SA 3P53A 5FZUA 3CQAA 1ONKB 2E4MC 3N7KA 4P0KA 5BQUA 2FGFA 1DJSB 3V0BB 3FJIA 2D7IA 3IM7A 3RTIB 3AZWA 4GOVA 5BP5C 2VSEA 2RQ9A 4F83A 1G82A 4GP3A 2VSAA 4I0YA 1BLDA 3BAHA 5GAQA 4JAWA 1FV3A 1SR4A 31BIA 4EFPA 4LO0A 2QYIB 4KEIA 1JY0A 2MIBA 1A8DA 3OBRA 2DS0A 3KMVA 2ZQOA 3V79C 4I4QA 1FN0A 3H6SE 1AVAC 1TOOA 3HMYA 4QD2C 1XG6A 4G6MA 1D0HA 3ZC9A 3HN1A 4I3NA 1EV2A 4IHZA 2D23A 4DEPA 5BXTA 4J2SA 3FJFA 1XHBA 3AJ6A 3AH2A 3OGFA 3WO2A 3JUTA 5DSSB 4LO7B 2NYYA 3WO3A 1FWVA 5FZYA 2AFGA 5FZZA 2BEAA 1ISXA 1HWMB 2Y9XE 3FJ9A 4OWKA 2ESUA 1XYFA 3AKHA 5D62A 3RMXA 1VCLA 3R4SA 4H9WA 5BOWA 3NBCA 1FV2A 3BAQA 3O4BA 3VUOA 3AKFA 3CA4A 4I1EA 4PC4A 3WINC 1AVWB 4IYBA 1IILA 3AH4A 1JQZA 1V6UA 2K8RA 1NUNA 1FMZA 4IY8A 2ZQNA 3WA1A 3BRDA 2KKIA 4I4YA 2VLCA 3QR5A 4DCKC 2P23A 2BEBA 1RY7A 4QBVA 3O4DA 1DLLA 3VT1A 1FQ9A 2VXTI 3N7JA 2MLLB 1YYNA 2D43A 3A22A 2Z48A 4OWJA 3UJ0A 3VSFA 3AKGA 3UDAA 2DREA 3NBNA 3B9UA 1S0CA 2D1ZA 4I96A 4JKXB 2XOAA 1EVTA 4P6AA 4LO2A 3A21A 2QN4A 4GAIA 4IZXA 1DZCA 1HCDA 3K1XA 4ZKTB 2I1BA 1TP0A 1S0EA 1WD3A 2FO1A 3PG0A 1HKNA 4OEFA 1QQKA 1FGAA 4I2SA 5F8WA 1BASA 3WMUA 3Q7WA 1L2HA 5DZUA 4FVVA 1ILR1 1I1EA 1HWNB 4EB2B 5FNWA 4QKSA 3BRGC 4I4SA 5F90A 3NBEA 5BP5A 3FJ8A 4ISRA 3IAGC 4USPA 2KH2A 1F31A 4LO8B 4KC3A 4GP0A 2D44A 1QQLA 3H6RA 4HR6C 1R8NA 3CA5A 1S0GA 3IM6A 4X39A 3I2XA 2ET2A 3R4UA 1BFCA 4KBBA 4ISQA 3FJCA 1SZ6B 3O49A 3O44A 3FJBA 3CRGA 1BFGA 1AFCA 2DRYA 4Q91A 21BIA 5HPZA 1JT4A 1TWEA 1E0OA 2VUAA 4I4XA 2Y9WC 3H6RB 2VXRA 3O5WB 4G9MA 4JQ0A
chains in the Genus database with same CATH superfamily
4I37A 1YBIA 3UJ4A 5EHAA 4WBCA 2NZ9A 1PUMB 4ZLBB 4MZFB 1PC8B 2RG9B 4LO3C 3AKIA 1EPWA 3ZC8A 4LO1C 4USOA 4IONA 3NJ5A 4J23B 1K5VA 4ZA3B 5DUYA 3HOMA 3ZXDA 3CAHA 4ZOTA 1G9BA 3BAUA 1AVUA 1MC9A 2IWTB 1TFMB 5BXRA 41BIA 2F2FC 4CJMA 2MC2A 7I1BA 1BARA 5BQUC 2D7RA 3S8JA 1G9CA 3BTAA 4X37A 1ITBA 1Q03A 1Q1UA 1RMLA 4QALA 3PHZA 4QO3A 4A7YA 1HWOB 2WRYA 2KI4A 3P6IA 2BFHA 3AH1A 1J0SA 4JRAA 1HCEA 1W3FA 5D61A 1SR4C 2FFVA 4LO0C 4IQPA 4ZFYB 3BAGA 1YF8B 1DFQA 4H04A 4G9NA 3OGGA 1IJTA 1S0LA 4H75A 1BFBA 2YUGA 1CVSA 1DFCA 4I8MA 3CRHA 1YTOA 2F8XC 4EFRA 1DZDA 1M2TB 2NM1A 3F62B 5E24E 3O4OA 4I4OA 1KNMA 1Q04A 3VT2A 3I29B 4J2KA 3VWCA 3T8SA 1AF9A 2AAIB 1ISWA 3HALA 3BADA 2ZR1B 5FNXA 1Z0HA 3FJAA 3TC2A 1CE7B 4P0JA 4Q9GA 4P0LA 5B2HA 1IRPA 1Z2VA 3BRFA 1IRAX 4GOYA 3RSJA 3UD7A 3FJHA 5D63A 1S0DA 4Z9WB 1GGPB 3ZXGA 4ZGRB 2K43A 2M49A 1QXMA 4I4PA 1II4A 4KEKA 1BLAA 1DQGA 1T4QA 1S0FA 3CU1B 3P6JA 4I1BA 1G9DA 3H6QA 2D24A 4GAFA 4I4VA 3FGMA 1FWUA 2E4MA 3HSMA 4I4RA 1AXMA 3QYDA 3BA4A 4II0A 3N0KA 4I7IA 3SNVA 1K5UA 3OJVA 1HIBA 1HWPB 3CA6A 4FGFA 2Q9XA 4J2XA 4Q9PA 3FJKA 3BAVA 3ILAA 4LO1A 4ENDA 1M16A 4R6UB 3VEQA 1NZKA 4KEJA 2X2TA 4JPZA 4X3AA 2DRZA 2GO2A 4F34A 3CA1A 4EKXB 2KI6B 4Z8SB 1MD6A 2F2FA 2VU9A 5BXSA 1T9FA 2AXMA 3FUOA 5BXPA 4XKIA 1WD4A 3O4AA 3EF2A 4QD2B 5JMCA 2LIEA 2UUSA 4EEEB 3FJJA 4IZEA 4QKRA 2NTDA 2ERMA 5BVPI 3AZVA 4JP0A 5I1BA 3Q7YA 3W9TA 4I6IA 2NVHA 3WINA 3UD8A 3BAOA 2J3PA 4ZFWB 4OW4A 2R9KB 3MPPG 1IT0A 3O3QA 1BA7A 3PMEA 1TWMA 3FJDA 4OEEA 3F1RA 3BA7A 1UPSA 2GZBA 3JRRA 1JLYA 3POKA 4XFUA 1ISZA 3D7WB 2HWAA 1PUUB 1EYLA 5F8YA 1RG8A 2Q3NB 4HA2A 5EC5A 4D0ZA 3OBTA 4DENA 8I1BA 4LO7C 3VSZA 4G1RA 1W3GA 1YXWA 3PUBA 1V6XA 4HJJA 3WMVA 1JLXA 1S0BA 5G00A 3OJMA 4IY9A 4G6JA 4A7KA 1W3AA 3C9ZA 3E8LC 1P63A 2Z49A 1WBAA 4L4HA 4TLPA 3ZX7A 5EG6C 2D22A 1XZZA 5JLVA 4UY4A 1PWAA 4QBCA 1ISVA 3A07A 1IOBA 2KLLA 4OUJA 3V0AA 3BA5A 1TTUA 1AVXB 3N7LA 4L4IA 1DQOA 5DVHA 3AJ5A 3I2AA 4XFSA 2P39A 4JKQA 1G9AA 2D20A 1JT5A 1OQLB 3O4CA 4X38A 6I1BA 3FFZA 3BB2A 3LLPA 2WBCA 2HW9A 1JTCA 4OEGA 4ZBVB 4A7ZA 1JT7A 1V6VA 2Y9GA 1R8OA 3V0AB 5F8SA 2Y9FA 2NP0A 3FJEA 4QC4A 3S8KA 3CRIA 3OJ2A 2FFUA 4D8HA 1ISYA 1RZOB 3A23A 3UD9A 1ABRB 3IIRA 4ZFUB 4J2YA 1Z4SA 1BFFA 1FMMS 2RSTA 3FUQA 3Q7XA 2HZ9A 3RTJB 1WBCA 4OWLA 3MALA 3CA0A 4I4UA 4AN6A 1TIEA 1N4KA 1V6WA 2L5XA 2K4AB 2LIQA 4LO3A 3CA3A 4XFTA 2AQZA 4LO2C 2FDBM 4AN7B 1DIWA 3V0BA 2IHOA 3BX1C 3NBDA 9ILBA 3HBWA 1IHKA 4EFQA 3N7MA 1I1BA 4YOLA 3IM5A 1JT3A 3RMYA 3LTQA 3WO4A 3VT0A 2HWMA 4D0TA 1PZZA 4MZHA 2X2SA 3P53A 5FZUA 3CQAA 1ONKB 2E4MC 3N7KA 4P0KA 5BQUA 2FGFA 1DJSB 3V0BB 3FJIA 2D7IA 3IM7A 3RTIB 3AZWA 4GOVA 5BP5C 2VSEA 2RQ9A 4F83A 1G82A 4GP3A 2VSAA 4I0YA 1BLDA 3BAHA 5GAQA 4JAWA 1FV3A 1SR4A 31BIA 4EFPA 4LO0A 2QYIB 4KEIA 1JY0A 2MIBA 1A8DA 3OBRA 2DS0A 3KMVA 2ZQOA 3V79C 4I4QA 1FN0A 3H6SE 1AVAC 1TOOA 3HMYA 4QD2C 1XG6A 4G6MA 1D0HA 3ZC9A 3HN1A 4I3NA 1EV2A 4IHZA 2D23A 4DEPA 5BXTA 4J2SA 3FJFA 1XHBA 3AJ6A 3AH2A 3OGFA 3WO2A 3JUTA 5DSSB 4LO7B 2NYYA 3WO3A 1FWVA 5FZYA 2AFGA 5FZZA 2BEAA 1ISXA 1HWMB 2Y9XE 3FJ9A 4OWKA 2ESUA 1XYFA 3AKHA 5D62A 3RMXA 1VCLA 3R4SA 4H9WA 5BOWA 3NBCA 1FV2A 3BAQA 3O4BA 3VUOA 3AKFA 3CA4A 4I1EA 4PC4A 3WINC 1AVWB 4IYBA 1IILA 3AH4A 1JQZA 1V6UA 2K8RA 1NUNA 1FMZA 4IY8A 2ZQNA 3WA1A 3BRDA 2KKIA 4I4YA 2VLCA 3QR5A 4DCKC 2P23A 2BEBA 1RY7A 4QBVA 3O4DA 1DLLA 3VT1A 1FQ9A 2VXTI 3N7JA 4MZGB 2MLLB 1YYNA 2D43A 3A22A 2Z48A 4OWJA 3UJ0A 3VSFA 3AKGA 3UDAA 2DREA 3NBNA 3B9UA 1S0CA 2D1ZA 4I96A 4JKXB 2XOAA 1EVTA 4P6AA 4LO2A 3A21A 2QN4A 4GAIA 4IZXA 1DZCA 1HCDA 3K1XA 4ZKTB 2I1BA 1TP0A 1S0EA 1WD3A 2NS2A 2FO1A 3PG0A 1HKNA 4OEFA 1QQKA 1FGAA 4I2SA 5F8WA 1BASA 3WMUA 3Q7WA 1L2HA 5DZUA 4FVVA 1ILR1 1I1EA 1HWNB 4EB2B 5FNWA 4QKSA 3BRGC 4I4SA 5F90A 3NBEA 5BP5A 3FJ8A 4ISRA 3IAGC 4USPA 2KH2A 1F31A 4LO8B 4KC3A 4GP0A 2D44A 1QQLA 3H6RA 4HR6C 1R8NA 3CA5A 1S0GA 3IM6A 4X39A 3I2XA 2ET2A 3R4UA 1BFCA 4KBBA 4ISQA 3FJCA 1SZ6B 3O49A 3O44A 3FJBA 3CRGA 1BFGA 1AFCA 2DRYA 4Q91A 21BIA 5HPZA 1JT4A 1TWEA 1E0OA 2VUAA 4I4XA 2Y9WC 3H6RB 2VXRA 3O5WB 4G9MA 4JQ0A
chains in the Genus database with same CATH topology
4I37A 1YBIA 3UJ4A 5EHAA 4WBCA 2NZ9A 1PUMB 4ZLBB 4MZFB 1PC8B 2RG9B 4LO3C 3AKIA 1EPWA 3ZC8A 4LO1C 4USOA 4IONA 3NJ5A 4J23B 1K5VA 4ZA3B 5DUYA 3HOMA 3ZXDA 3CAHA 4ZOTA 1G9BA 3BAUA 1AVUA 1MC9A 2IWTB 1TFMB 5BXRA 41BIA 2F2FC 4CJMA 2MC2A 7I1BA 1BARA 5BQUC 2D7RA 3S8JA 1G9CA 3BTAA 4X37A 1ITBA 1Q03A 1Q1UA 1RMLA 4QALA 3PHZA 4QO3A 4A7YA 1HWOB 2WRYA 2KI4A 3P6IA 2BFHA 3AH1A 1J0SA 4JRAA 1HCEA 1W3FA 5D61A 1SR4C 2FFVA 4LO0C 4IQPA 4ZFYB 3BAGA 1YF8B 1DFQA 4H04A 4G9NA 3OGGA 1IJTA 1S0LA 4H75A 1BFBA 2YUGA 1CVSA 1DFCA 4I8MA 3CRHA 1YTOA 2F8XC 4EFRA 1DZDA 1M2TB 2NM1A 3F62B 5E24E 3O4OA 4I4OA 1KNMA 1Q04A 3VT2A 3I29B 4J2KA 3VWCA 3T8SA 1AF9A 2AAIB 1ISWA 3HALA 3BADA 2ZR1B 5FNXA 1Z0HA 3FJAA 3TC2A 1CE7B 4P0JA 4Q9GA 4P0LA 5B2HA 1IRPA 1Z2VA 3BRFA 1IRAX 4GOYA 3RSJA 3UD7A 3FJHA 5D63A 1S0DA 4Z9WB 1GGPB 3ZXGA 4ZGRB 2K43A 2M49A 1QXMA 4I4PA 1II4A 4KEKA 1BLAA 1DQGA 1T4QA 1S0FA 3CU1B 3P6JA 4I1BA 1G9DA 3H6QA 2D24A 4GAFA 4I4VA 3FGMA 1FWUA 2E4MA 3HSMA 4I4RA 1AXMA 3QYDA 3BA4A 4II0A 3N0KA 4I7IA 3SNVA 1K5UA 3OJVA 1HIBA 1HWPB 3CA6A 4FGFA 2Q9XA 4J2XA 4Q9PA 3FJKA 3BAVA 3ILAA 4LO1A 4ENDA 1M16A 4R6UB 3VEQA 1NZKA 4KEJA 2X2TA 4JPZA 4X3AA 2DRZA 2GO2A 4F34A 3CA1A 4EKXB 2KI6B 4Z8SB 1MD6A 2F2FA 2VU9A 5BXSA 1T9FA 2AXMA 3FUOA 5BXPA 4XKIA 1WD4A 3O4AA 3EF2A 4QD2B 5JMCA 2LIEA 2UUSA 4EEEB 3FJJA 4IZEA 4QKRA 2NTDA 2ERMA 5BVPI 3AZVA 4JP0A 5I1BA 3Q7YA 3W9TA 4I6IA 2NVHA 3WINA 3UD8A 3BAOA 2J3PA 4ZFWB 4OW4A 2R9KB 3MPPG 1IT0A 3O3QA 1BA7A 3PMEA 1TWMA 3FJDA 4OEEA 3F1RA 3BA7A 1UPSA 2GZBA 3JRRA 1JLYA 3POKA 4XFUA 1ISZA 3D7WB 2HWAA 1PUUB 1EYLA 5F8YA 1RG8A 2Q3NB 4HA2A 5EC5A 4D0ZA 3OBTA 4DENA 8I1BA 4LO7C 3VSZA 4G1RA 1W3GA 1YXWA 3PUBA 1V6XA 4HJJA 3WMVA 1JLXA 1S0BA 5G00A 3OJMA 4IY9A 4G6JA 4A7KA 1W3AA 3C9ZA 3E8LC 1P63A 2Z49A 1WBAA 4L4HA 4TLPA 3ZX7A 5EG6C 2D22A 1XZZA 5JLVA 4UY4A 1PWAA 4QBCA 1ISVA 3A07A 1IOBA 2KLLA 4OUJA 3V0AA 3BA5A 1TTUA 1AVXB 3N7LA 4L4IA 1DQOA 5DVHA 3AJ5A 3I2AA 4XFSA 2P39A 4JKQA 1G9AA 2D20A 1JT5A 1OQLB 3O4CA 4X38A 6I1BA 3FFZA 3BB2A 3LLPA 2WBCA 2HW9A 1JTCA 4OEGA 4ZBVB 4A7ZA 1JT7A 1V6VA 2Y9GA 1R8OA 3V0AB 5F8SA 2Y9FA 2NP0A 3FJEA 4QC4A 3S8KA 3CRIA 3OJ2A 2FFUA 4D8HA 1ISYA 1RZOB 3A23A 3UD9A 1ABRB 3IIRA 4ZFUB 4J2YA 1Z4SA 1BFFA 1FMMS 2RSTA 3FUQA 3Q7XA 2HZ9A 3RTJB 1WBCA 4OWLA 3MALA 3CA0A 4I4UA 4AN6A 1TIEA 1N4KA 1V6WA 2L5XA 2K4AB 2LIQA 4LO3A 3CA3A 4XFTA 2AQZA 4LO2C 2FDBM 4AN7B 1DIWA 3V0BA 2IHOA 3BX1C 3NBDA 9ILBA 3HBWA 1IHKA 4EFQA 3N7MA 1I1BA 4YOLA 3IM5A 1JT3A 3RMYA 3LTQA 3WO4A 3VT0A 2HWMA 4D0TA 1PZZA 4MZHA 2X2SA 3P53A 5FZUA 3CQAA 1ONKB 2E4MC 3N7KA 4P0KA 5BQUA 2FGFA 1DJSB 3V0BB 3FJIA 2D7IA 3IM7A 3RTIB 3AZWA 4GOVA 5BP5C 2VSEA 2RQ9A 4F83A 1G82A 4GP3A 2VSAA 4I0YA 1BLDA 3BAHA 5GAQA 4JAWA 1FV3A 1SR4A 31BIA 4EFPA 4LO0A 2QYIB 4KEIA 1JY0A 2MIBA 1A8DA 3OBRA 2DS0A 3KMVA 2ZQOA 3V79C 4I4QA 1FN0A 3H6SE 1AVAC 1TOOA 3HMYA 4QD2C 1XG6A 4G6MA 1D0HA 3ZC9A 3HN1A 4I3NA 1EV2A 4IHZA 2D23A 4DEPA 5BXTA 4J2SA 3FJFA 1XHBA 3AJ6A 3AH2A 3OGFA 3WO2A 3JUTA 5DSSB 4LO7B 2NYYA 3WO3A 1FWVA 5FZYA 2AFGA 5FZZA 2BEAA 1ISXA 1HWMB 2Y9XE 3FJ9A 4OWKA 2ESUA 1XYFA 3AKHA 5D62A 3RMXA 1VCLA 3R4SA 4H9WA 5BOWA 3NBCA 1FV2A 3BAQA 3O4BA 3VUOA 3AKFA 3CA4A 4I1EA 4PC4A 3WINC 1AVWB 4IYBA 1IILA 3AH4A 1JQZA 1V6UA 2K8RA 1NUNA 1FMZA 4IY8A 2ZQNA 3WA1A 3BRDA 2KKIA 4I4YA 2VLCA 3QR5A 4DCKC 2P23A 2BEBA 1RY7A 4QBVA 3O4DA 1DLLA 3VT1A 1FQ9A 2VXTI 3N7JA 4MZGB 2MLLB 1YYNA 2D43A 3A22A 2Z48A 4OWJA 3UJ0A 3VSFA 3AKGA 3UDAA 2DREA 3NBNA 3B9UA 1S0CA 2D1ZA 4I96A 4JKXB 2XOAA 1EVTA 4P6AA 4LO2A 3A21A 2QN4A 4GAIA 4IZXA 1DZCA 1HCDA 3K1XA 4ZKTB 2I1BA 1TP0A 1S0EA 1WD3A 2NS2A 2FO1A 3PG0A 1HKNA 4OEFA 1QQKA 1FGAA 4I2SA 5F8WA 1BASA 3WMUA 3Q7WA 1L2HA 5DZUA 4FVVA 1ILR1 1I1EA 1HWNB 4EB2B 5FNWA 4QKSA 3BRGC 4I4SA 5F90A 3NBEA 5BP5A 3FJ8A 4ISRA 3IAGC 4USPA 2KH2A 1F31A 4LO8B 4KC3A 4GP0A 2D44A 1QQLA 3H6RA 4HR6C 1R8NA 3CA5A 1S0GA 3IM6A 4X39A 3I2XA 2ET2A 3R4UA 1BFCA 4KBBA 4ISQA 3FJCA 1SZ6B 3O49A 3O44A 3FJBA 3CRGA 1BFGA 1AFCA 2DRYA 4Q91A 21BIA 5HPZA 1JT4A 1TWEA 1E0OA 2VUAA 4I4XA 2Y9WC 3H6RB 2VXRA 3O5WB 4G9MA 4JQ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I37 A;  1YBI A;  3UJ4 A;  5EHA A;  4WBC A;  2NZ9 A;  1PUM B;  4ZLB B;  1PC8 B;  2RG9 B;  4LO3 C;  3AKI A;  1EPW A;  3ZC8 A;  4LO1 C;  4USO A;  4ION A;  3NJ5 A;  4J23 B;  1K5V A;  4ZA3 B;  5DUY A;  3HOM A;  3ZXD A;  3CAH A;  4ZOT A;  1G9B A;  3BAU A;  1AVU A;  1MC9 A;  2IWT B;  1TFM B;  5BXR A;  41BI A;  2F2F C;  4CJM A;  2MC2 A;  7I1B A;  1BAR A;  5BQU C;  2D7R A;  3S8J A;  1G9C A;  3BTA A;  4X37 A;  1ITB A;  1Q03 A;  1Q1U A;  1RML A;  4QAL A;  3PHZ A;  4QO3 A;  4A7Y A;  1HWO B;  2WRY A;  2KI4 A;  3P6I A;  2BFH A;  3AH1 A;  1J0S A;  4JRA A;  1HCE A;  1W3F A;  5D61 A;  1SR4 C;  2FFV A;  4LO0 C;  4IQP A;  4ZFY B;  3BAG A;  1YF8 B;  1DFQ A;  4H04 A;  4G9N A;  3OGG A;  1IJT A;  1S0L A;  1BFB A;  2YUG A;  1CVS A;  1DFC A;  4I8M A;  3CRH A;  1YTO A;  2F8X C;  4EFR A;  1DZD A;  1M2T B;  2NM1 A;  3F62 B;  5E24 E;  3O4O A;  4I4O A;  1KNM A;  1Q04 A;  3VT2 A;  3I29 B;  4J2K A;  3VWC A;  3T8S A;  1AF9 A;  2AAI B;  1ISW A;  3HAL A;  3BAD A;  2ZR1 B;  5FNX A;  1Z0H A;  3FJA A;  3TC2 A;  1CE7 B;  4P0J A;  4Q9G A;  4P0L A;  5B2H A;  1IRP A;  1Z2V A;  3BRF A;  1IRA X;  4GOY A;  3RSJ A;  3UD7 A;  3FJH A;  5D63 A;  1S0D A;  4Z9W B;  1GGP B;  3ZXG A;  4ZGR B;  2K43 A;  2M49 A;  1QXM A;  4I4P A;  1II4 A;  4KEK A;  1BLA A;  1DQG A;  1T4Q A;  1S0F A;  3CU1 B;  3P6J A;  4I1B A;  1G9D A;  3H6Q A;  2D24 A;  4GAF A;  4I4V A;  3FGM A;  1FWU A;  2E4M A;  3HSM A;  4I4R A;  1AXM A;  3QYD A;  3BA4 A;  4II0 A;  3N0K A;  4I7I A;  3SNV A;  1K5U A;  3OJV A;  1HIB A;  1HWP B;  3CA6 A;  4FGF A;  2Q9X A;  4J2X A;  4Q9P A;  3FJK A;  3BAV A;  3ILA A;  4LO1 A;  4END A;  1M16 A;  4R6U B;  3VEQ A;  1NZK A;  4KEJ A;  2X2T A;  4JPZ A;  4X3A A;  2DRZ A;  2GO2 A;  4F34 A;  3CA1 A;  4EKX B;  2KI6 B;  4Z8S B;  1MD6 A;  2F2F A;  2VU9 A;  5BXS A;  1T9F A;  2AXM A;  3FUO A;  5BXP A;  4XKI A;  1WD4 A;  3O4A A;  3EF2 A;  4QD2 B;  5JMC A;  2LIE A;  2UUS A;  4EEE B;  3FJJ A;  4IZE A;  4QKR A;  2NTD A;  2ERM A;  5BVP I;  3AZV A;  4JP0 A;  5I1B A;  3Q7Y A;  3W9T A;  4I6I A;  2NVH A;  3WIN A;  3UD8 A;  3BAO A;  2J3P A;  4ZFW B;  4OW4 A;  2R9K B;  3MPP G;  1IT0 A;  3O3Q A;  1BA7 A;  3PME A;  1TWM A;  3FJD A;  4OEE A;  3F1R A;  3BA7 A;  1UPS A;  2GZB A;  3JRR A;  1JLY A;  3POK A;  4XFU A;  1ISZ A;  3D7W B;  2HWA A;  1PUU B;  1EYL A;  5F8Y A;  1RG8 A;  2Q3N B;  4HA2 A;  5EC5 A;  4D0Z A;  3OBT A;  4DEN A;  8I1B A;  4LO7 C;  3VSZ A;  4G1R A;  1W3G A;  1YXW A;  3PUB A;  1V6X A;  4HJJ A;  3WMV A;  1JLX A;  1S0B A;  5G00 A;  3OJM A;  4IY9 A;  4G6J A;  4A7K A;  1W3A A;  3C9Z A;  3E8L C;  1P63 A;  2Z49 A;  1WBA A;  4L4H A;  4TLP A;  3ZX7 A;  5EG6 C;  2D22 A;  1XZZ A;  5JLV A;  1PWA A;  4QBC A;  1ISV A;  3A07 A;  1IOB A;  2KLL A;  4OUJ A;  3V0A A;  3BA5 A;  1TTU A;  1AVX B;  3N7L A;  4L4I A;  1DQO A;  5DVH A;  3AJ5 A;  3I2A A;  4XFS A;  2P39 A;  4JKQ A;  1G9A A;  2D20 A;  1JT5 A;  1OQL B;  3O4C A;  4X38 A;  6I1B A;  3FFZ A;  3BB2 A;  3LLP A;  2WBC A;  2HW9 A;  1JTC A;  4OEG A;  4ZBV B;  4A7Z A;  1JT7 A;  1V6V A;  2Y9G A;  1R8O A;  3V0A B;  5F8S A;  2Y9F A;  2NP0 A;  3FJE A;  4QC4 A;  3S8K A;  3CRI A;  3OJ2 A;  2FFU A;  4D8H A;  1ISY A;  1RZO B;  3A23 A;  3UD9 A;  1ABR B;  3IIR A;  4ZFU B;  4J2Y A;  1Z4S A;  1BFF A;  1FMM S;  2RST A;  3FUQ A;  3Q7X A;  2HZ9 A;  3RTJ B;  1WBC A;  4OWL A;  3MAL A;  3CA0 A;  4I4U A;  4AN6 A;  1TIE A;  1N4K A;  1V6W A;  2L5X A;  2K4A B;  2LIQ A;  4LO3 A;  3CA3 A;  4XFT A;  2AQZ A;  4LO2 C;  2FDB M;  4AN7 B;  1DIW A;  3V0B A;  2IHO A;  3BX1 C;  3NBD A;  9ILB A;  3HBW A;  1IHK A;  4EFQ A;  3N7M A;  1I1B A;  4YOL A;  3IM5 A;  1JT3 A;  3RMY A;  3LTQ A;  3WO4 A;  3VT0 A;  2HWM A;  4D0T A;  1PZZ A;  2X2S A;  3P53 A;  5FZU A;  3CQA A;  1ONK B;  2E4M C;  3N7K A;  4P0K A;  5BQU A;  2FGF A;  1DJS B;  3V0B B;  3FJI A;  2D7I A;  3IM7 A;  3RTI B;  3AZW A;  4GOV A;  5BP5 C;  2VSE A;  2RQ9 A;  4F83 A;  1G82 A;  4GP3 A;  2VSA A;  4I0Y A;  1BLD A;  3BAH A;  5GAQ A;  4JAW A;  1FV3 A;  1SR4 A;  31BI A;  4EFP A;  4LO0 A;  2QYI B;  4KEI A;  1JY0 A;  2MIB A;  1A8D A;  3OBR A;  2DS0 A;  3KMV A;  2ZQO A;  3V79 C;  4I4Q A;  1FN0 A;  3H6S E;  1AVA C;  1TOO A;  3HMY A;  4QD2 C;  1XG6 A;  4G6M A;  1D0H A;  3ZC9 A;  3HN1 A;  4I3N A;  1EV2 A;  4IHZ A;  2D23 A;  4DEP A;  5BXT A;  4J2S A;  3FJF A;  1XHB A;  3AJ6 A;  3AH2 A;  3OGF A;  3WO2 A;  3JUT A;  5DSS B;  4LO7 B;  2NYY A;  3WO3 A;  1FWV A;  5FZY A;  2AFG A;  5FZZ A;  2BEA A;  1ISX A;  1HWM B;  2Y9X E;  3FJ9 A;  4OWK A;  2ESU A;  1XYF A;  3AKH A;  5D62 A;  3RMX A;  1VCL A;  3R4S A;  4H9W A;  5BOW A;  3NBC A;  1FV2 A;  3BAQ A;  3O4B A;  3VUO A;  3AKF A;  3CA4 A;  4I1E A;  4PC4 A;  3WIN C;  1AVW B;  4IYB A;  1IIL A;  3AH4 A;  1JQZ A;  1V6U A;  2K8R A;  1NUN A;  1FMZ A;  4IY8 A;  2ZQN A;  3WA1 A;  3BRD A;  2KKI A;  4I4Y A;  2VLC A;  3QR5 A;  4DCK C;  2P23 A;  2BEB A;  1RY7 A;  4QBV A;  3O4D A;  1DLL A;  3VT1 A;  1FQ9 A;  2VXT I;  3N7J A;  2MLL B;  1YYN A;  2D43 A;  3A22 A;  2Z48 A;  4OWJ A;  3UJ0 A;  3VSF A;  3AKG A;  3UDA A;  2DRE A;  3NBN A;  3B9U A;  1S0C A;  2D1Z A;  4I96 A;  4JKX B;  2XOA A;  1EVT A;  4P6A A;  4LO2 A;  3A21 A;  2QN4 A;  4GAI A;  4IZX A;  1DZC A;  1HCD A;  3K1X A;  4ZKT B;  2I1B A;  1TP0 A;  1S0E A;  1WD3 A;  2FO1 A;  3PG0 A;  1HKN A;  4OEF A;  1QQK A;  1FGA A;  4I2S A;  5F8W A;  1BAS A;  3WMU A;  3Q7W A;  1L2H A;  5DZU A;  4FVV A;  1ILR 1;  1I1E A;  1HWN B;  4EB2 B;  5FNW A;  4QKS A;  3BRG C;  4I4S A;  5F90 A;  3NBE A;  5BP5 A;  3FJ8 A;  4ISR A;  3IAG C;  4USP A;  2KH2 A;  1F31 A;  4LO8 B;  4KC3 A;  4GP0 A;  2D44 A;  1QQL A;  3H6R A;  4HR6 C;  1R8N A;  3CA5 A;  1S0G A;  3IM6 A;  4X39 A;  3I2X A;  2ET2 A;  3R4U A;  1BFC A;  4KBB A;  4ISQ A;  3FJC A;  1SZ6 B;  3O49 A;  3O44 A;  3FJB A;  3CRG A;  1BFG A;  1AFC A;  2DRY A;  4Q91 A;  21BI A;  5HPZ A;  1JT4 A;  1TWE A;  1E0O A;  2VUA A;  4I4X A;  2Y9W C;  3H6R B;  2VXR A;  3O5W B;  4G9M A;  4JQ0 A; 
#chains in the Genus database with same CATH topology
 4I37 A;  1YBI A;  3UJ4 A;  5EHA A;  4WBC A;  2NZ9 A;  1PUM B;  4ZLB B;  4MZF B;  1PC8 B;  2RG9 B;  4LO3 C;  3AKI A;  1EPW A;  3ZC8 A;  4LO1 C;  4USO A;  4ION A;  3NJ5 A;  4J23 B;  1K5V A;  4ZA3 B;  5DUY A;  3HOM A;  3ZXD A;  3CAH A;  4ZOT A;  1G9B A;  3BAU A;  1AVU A;  1MC9 A;  2IWT B;  1TFM B;  5BXR A;  41BI A;  2F2F C;  4CJM A;  2MC2 A;  7I1B A;  1BAR A;  5BQU C;  2D7R A;  3S8J A;  1G9C A;  3BTA A;  4X37 A;  1ITB A;  1Q03 A;  1Q1U A;  1RML A;  4QAL A;  3PHZ A;  4QO3 A;  4A7Y A;  1HWO B;  2WRY A;  2KI4 A;  3P6I A;  2BFH A;  3AH1 A;  1J0S A;  4JRA A;  1HCE A;  1W3F A;  5D61 A;  1SR4 C;  2FFV A;  4LO0 C;  4IQP A;  4ZFY B;  3BAG A;  1YF8 B;  1DFQ A;  4H04 A;  4G9N A;  3OGG A;  1IJT A;  1S0L A;  4H75 A;  1BFB A;  2YUG A;  1CVS A;  1DFC A;  4I8M A;  3CRH A;  1YTO A;  2F8X C;  4EFR A;  1DZD A;  1M2T B;  2NM1 A;  3F62 B;  5E24 E;  3O4O A;  4I4O A;  1KNM A;  1Q04 A;  3VT2 A;  3I29 B;  4J2K A;  3VWC A;  3T8S A;  1AF9 A;  2AAI B;  1ISW A;  3HAL A;  3BAD A;  2ZR1 B;  5FNX A;  1Z0H A;  3FJA A;  3TC2 A;  1CE7 B;  4P0J A;  4Q9G A;  4P0L A;  5B2H A;  1IRP A;  1Z2V A;  3BRF A;  1IRA X;  4GOY A;  3RSJ A;  3UD7 A;  3FJH A;  5D63 A;  1S0D A;  4Z9W B;  1GGP B;  3ZXG A;  4ZGR B;  2K43 A;  2M49 A;  1QXM A;  4I4P A;  1II4 A;  4KEK A;  1BLA A;  1DQG A;  1T4Q A;  1S0F A;  3CU1 B;  3P6J A;  4I1B A;  1G9D A;  3H6Q A;  2D24 A;  4GAF A;  4I4V A;  3FGM A;  1FWU A;  2E4M A;  3HSM A;  4I4R A;  1AXM A;  3QYD A;  3BA4 A;  4II0 A;  3N0K A;  4I7I A;  3SNV A;  1K5U A;  3OJV A;  1HIB A;  1HWP B;  3CA6 A;  4FGF A;  2Q9X A;  4J2X A;  4Q9P A;  3FJK A;  3BAV A;  3ILA A;  4LO1 A;  4END A;  1M16 A;  4R6U B;  3VEQ A;  1NZK A;  4KEJ A;  2X2T A;  4JPZ A;  4X3A A;  2DRZ A;  2GO2 A;  4F34 A;  3CA1 A;  4EKX B;  2KI6 B;  4Z8S B;  1MD6 A;  2F2F A;  2VU9 A;  5BXS A;  1T9F A;  2AXM A;  3FUO A;  5BXP A;  4XKI A;  1WD4 A;  3O4A A;  3EF2 A;  4QD2 B;  5JMC A;  2LIE A;  2UUS A;  4EEE B;  3FJJ A;  4IZE A;  4QKR A;  2NTD A;  2ERM A;  5BVP I;  3AZV A;  4JP0 A;  5I1B A;  3Q7Y A;  3W9T A;  4I6I A;  2NVH A;  3WIN A;  3UD8 A;  3BAO A;  2J3P A;  4ZFW B;  4OW4 A;  2R9K B;  3MPP G;  1IT0 A;  3O3Q A;  1BA7 A;  3PME A;  1TWM A;  3FJD A;  4OEE A;  3F1R A;  3BA7 A;  1UPS A;  2GZB A;  3JRR A;  1JLY A;  3POK A;  4XFU A;  1ISZ A;  3D7W B;  2HWA A;  1PUU B;  1EYL A;  5F8Y A;  1RG8 A;  2Q3N B;  4HA2 A;  5EC5 A;  4D0Z A;  3OBT A;  4DEN A;  8I1B A;  4LO7 C;  3VSZ A;  4G1R A;  1W3G A;  1YXW A;  3PUB A;  1V6X A;  4HJJ A;  3WMV A;  1JLX A;  1S0B A;  5G00 A;  3OJM A;  4IY9 A;  4G6J A;  4A7K A;  1W3A A;  3C9Z A;  3E8L C;  1P63 A;  2Z49 A;  1WBA A;  4L4H A;  4TLP A;  3ZX7 A;  5EG6 C;  2D22 A;  1XZZ A;  5JLV A;  4UY4 A;  1PWA A;  4QBC A;  1ISV A;  3A07 A;  1IOB A;  2KLL A;  4OUJ A;  3V0A A;  3BA5 A;  1TTU A;  1AVX B;  3N7L A;  4L4I A;  1DQO A;  5DVH A;  3AJ5 A;  3I2A A;  4XFS A;  2P39 A;  4JKQ A;  1G9A A;  2D20 A;  1JT5 A;  1OQL B;  3O4C A;  4X38 A;  6I1B A;  3FFZ A;  3BB2 A;  3LLP A;  2WBC A;  2HW9 A;  1JTC A;  4OEG A;  4ZBV B;  4A7Z A;  1JT7 A;  1V6V A;  2Y9G A;  1R8O A;  3V0A B;  5F8S A;  2Y9F A;  2NP0 A;  3FJE A;  4QC4 A;  3S8K A;  3CRI A;  3OJ2 A;  2FFU A;  4D8H A;  1ISY A;  1RZO B;  3A23 A;  3UD9 A;  1ABR B;  3IIR A;  4ZFU B;  4J2Y A;  1Z4S A;  1BFF A;  1FMM S;  2RST A;  3FUQ A;  3Q7X A;  2HZ9 A;  3RTJ B;  1WBC A;  4OWL A;  3MAL A;  3CA0 A;  4I4U A;  4AN6 A;  1TIE A;  1N4K A;  1V6W A;  2L5X A;  2K4A B;  2LIQ A;  4LO3 A;  3CA3 A;  4XFT A;  2AQZ A;  4LO2 C;  2FDB M;  4AN7 B;  1DIW A;  3V0B A;  2IHO A;  3BX1 C;  3NBD A;  9ILB A;  3HBW A;  1IHK A;  4EFQ A;  3N7M A;  1I1B A;  4YOL A;  3IM5 A;  1JT3 A;  3RMY A;  3LTQ A;  3WO4 A;  3VT0 A;  2HWM A;  4D0T A;  1PZZ A;  4MZH A;  2X2S A;  3P53 A;  5FZU A;  3CQA A;  1ONK B;  2E4M C;  3N7K A;  4P0K A;  5BQU A;  2FGF A;  1DJS B;  3V0B B;  3FJI A;  2D7I A;  3IM7 A;  3RTI B;  3AZW A;  4GOV A;  5BP5 C;  2VSE A;  2RQ9 A;  4F83 A;  1G82 A;  4GP3 A;  2VSA A;  4I0Y A;  1BLD A;  3BAH A;  5GAQ A;  4JAW A;  1FV3 A;  1SR4 A;  31BI A;  4EFP A;  4LO0 A;  2QYI B;  4KEI A;  1JY0 A;  2MIB A;  1A8D A;  3OBR A;  2DS0 A;  3KMV A;  2ZQO A;  3V79 C;  4I4Q A;  1FN0 A;  3H6S E;  1AVA C;  1TOO A;  3HMY A;  4QD2 C;  1XG6 A;  4G6M A;  1D0H A;  3ZC9 A;  3HN1 A;  4I3N A;  1EV2 A;  4IHZ A;  2D23 A;  4DEP A;  5BXT A;  4J2S A;  3FJF A;  1XHB A;  3AJ6 A;  3AH2 A;  3OGF A;  3WO2 A;  3JUT A;  5DSS B;  4LO7 B;  2NYY A;  3WO3 A;  1FWV A;  5FZY A;  2AFG A;  5FZZ A;  2BEA A;  1ISX A;  1HWM B;  2Y9X E;  3FJ9 A;  4OWK A;  2ESU A;  1XYF A;  3AKH A;  5D62 A;  3RMX A;  1VCL A;  3R4S A;  4H9W A;  5BOW A;  3NBC A;  1FV2 A;  3BAQ A;  3O4B A;  3VUO A;  3AKF A;  3CA4 A;  4I1E A;  4PC4 A;  3WIN C;  1AVW B;  4IYB A;  1IIL A;  3AH4 A;  1JQZ A;  1V6U A;  2K8R A;  1NUN A;  1FMZ A;  4IY8 A;  2ZQN A;  3WA1 A;  3BRD A;  2KKI A;  4I4Y A;  2VLC A;  3QR5 A;  4DCK C;  2P23 A;  2BEB A;  1RY7 A;  4QBV A;  3O4D A;  1DLL A;  3VT1 A;  1FQ9 A;  2VXT I;  3N7J A;  4MZG B;  2MLL B;  1YYN A;  2D43 A;  3A22 A;  2Z48 A;  4OWJ A;  3UJ0 A;  3VSF A;  3AKG A;  3UDA A;  2DRE A;  3NBN A;  3B9U A;  1S0C A;  2D1Z A;  4I96 A;  4JKX B;  2XOA A;  1EVT A;  4P6A A;  4LO2 A;  3A21 A;  2QN4 A;  4GAI A;  4IZX A;  1DZC A;  1HCD A;  3K1X A;  4ZKT B;  2I1B A;  1TP0 A;  1S0E A;  1WD3 A;  2NS2 A;  2FO1 A;  3PG0 A;  1HKN A;  4OEF A;  1QQK A;  1FGA A;  4I2S A;  5F8W A;  1BAS A;  3WMU A;  3Q7W A;  1L2H A;  5DZU A;  4FVV A;  1ILR 1;  1I1E A;  1HWN B;  4EB2 B;  5FNW A;  4QKS A;  3BRG C;  4I4S A;  5F90 A;  3NBE A;  5BP5 A;  3FJ8 A;  4ISR A;  3IAG C;  4USP A;  2KH2 A;  1F31 A;  4LO8 B;  4KC3 A;  4GP0 A;  2D44 A;  1QQL A;  3H6R A;  4HR6 C;  1R8N A;  3CA5 A;  1S0G A;  3IM6 A;  4X39 A;  3I2X A;  2ET2 A;  3R4U A;  1BFC A;  4KBB A;  4ISQ A;  3FJC A;  1SZ6 B;  3O49 A;  3O44 A;  3FJB A;  3CRG A;  1BFG A;  1AFC A;  2DRY A;  4Q91 A;  21BI A;  5HPZ A;  1JT4 A;  1TWE A;  1E0O A;  2VUA A;  4I4X A;  2Y9W C;  3H6R B;  2VXR A;  3O5W B;  4G9M A;  4JQ0 A; 
#chains in the Genus database with same CATH homology
 4I37 A;  1YBI A;  3UJ4 A;  5EHA A;  4WBC A;  2NZ9 A;  1PUM B;  4ZLB B;  4MZF B;  1PC8 B;  2RG9 B;  4LO3 C;  3AKI A;  1EPW A;  3ZC8 A;  4LO1 C;  4USO A;  4ION A;  3NJ5 A;  4J23 B;  1K5V A;  4ZA3 B;  5DUY A;  3HOM A;  3ZXD A;  3CAH A;  4ZOT A;  1G9B A;  3BAU A;  1AVU A;  1MC9 A;  2IWT B;  1TFM B;  5BXR A;  41BI A;  2F2F C;  4CJM A;  2MC2 A;  7I1B A;  1BAR A;  5BQU C;  2D7R A;  3S8J A;  1G9C A;  3BTA A;  4X37 A;  1ITB A;  1Q03 A;  1Q1U A;  1RML A;  4QAL A;  3PHZ A;  4QO3 A;  4A7Y A;  1HWO B;  2WRY A;  2KI4 A;  3P6I A;  2BFH A;  3AH1 A;  1J0S A;  4JRA A;  1HCE A;  1W3F A;  5D61 A;  1SR4 C;  2FFV A;  4LO0 C;  4IQP A;  4ZFY B;  3BAG A;  1YF8 B;  1DFQ A;  4H04 A;  4G9N A;  3OGG A;  1IJT A;  1S0L A;  4H75 A;  1BFB A;  2YUG A;  1CVS A;  1DFC A;  4I8M A;  3CRH A;  1YTO A;  2F8X C;  4EFR A;  1DZD A;  1M2T B;  2NM1 A;  3F62 B;  5E24 E;  3O4O A;  4I4O A;  1KNM A;  1Q04 A;  3VT2 A;  3I29 B;  4J2K A;  3VWC A;  3T8S A;  1AF9 A;  2AAI B;  1ISW A;  3HAL A;  3BAD A;  2ZR1 B;  5FNX A;  1Z0H A;  3FJA A;  3TC2 A;  1CE7 B;  4P0J A;  4Q9G A;  4P0L A;  5B2H A;  1IRP A;  1Z2V A;  3BRF A;  1IRA X;  4GOY A;  3RSJ A;  3UD7 A;  3FJH A;  5D63 A;  1S0D A;  4Z9W B;  1GGP B;  3ZXG A;  4ZGR B;  2K43 A;  2M49 A;  1QXM A;  4I4P A;  1II4 A;  4KEK A;  1BLA A;  1DQG A;  1T4Q A;  1S0F A;  3CU1 B;  3P6J A;  4I1B A;  1G9D A;  3H6Q A;  2D24 A;  4GAF A;  4I4V A;  3FGM A;  1FWU A;  2E4M A;  3HSM A;  4I4R A;  1AXM A;  3QYD A;  3BA4 A;  4II0 A;  3N0K A;  4I7I A;  3SNV A;  1K5U A;  3OJV A;  1HIB A;  1HWP B;  3CA6 A;  4FGF A;  2Q9X A;  4J2X A;  4Q9P A;  3FJK A;  3BAV A;  3ILA A;  4LO1 A;  4END A;  1M16 A;  4R6U B;  3VEQ A;  1NZK A;  4KEJ A;  2X2T A;  4JPZ A;  4X3A A;  2DRZ A;  2GO2 A;  4F34 A;  3CA1 A;  4EKX B;  2KI6 B;  4Z8S B;  1MD6 A;  2F2F A;  2VU9 A;  5BXS A;  1T9F A;  2AXM A;  3FUO A;  5BXP A;  4XKI A;  1WD4 A;  3O4A A;  3EF2 A;  4QD2 B;  5JMC A;  2LIE A;  2UUS A;  4EEE B;  3FJJ A;  4IZE A;  4QKR A;  2NTD A;  2ERM A;  5BVP I;  3AZV A;  4JP0 A;  5I1B A;  3Q7Y A;  3W9T A;  4I6I A;  2NVH A;  3WIN A;  3UD8 A;  3BAO A;  2J3P A;  4ZFW B;  4OW4 A;  2R9K B;  3MPP G;  1IT0 A;  3O3Q A;  1BA7 A;  3PME A;  1TWM A;  3FJD A;  4OEE A;  3F1R A;  3BA7 A;  1UPS A;  2GZB A;  3JRR A;  1JLY A;  3POK A;  4XFU A;  1ISZ A;  3D7W B;  2HWA A;  1PUU B;  1EYL A;  5F8Y A;  1RG8 A;  2Q3N B;  4HA2 A;  5EC5 A;  4D0Z A;  3OBT A;  4DEN A;  8I1B A;  4LO7 C;  3VSZ A;  4G1R A;  1W3G A;  1YXW A;  3PUB A;  1V6X A;  4HJJ A;  3WMV A;  1JLX A;  1S0B A;  5G00 A;  3OJM A;  4IY9 A;  4G6J A;  4A7K A;  1W3A A;  3C9Z A;  3E8L C;  1P63 A;  2Z49 A;  1WBA A;  4L4H A;  4TLP A;  3ZX7 A;  5EG6 C;  2D22 A;  1XZZ A;  5JLV A;  4UY4 A;  1PWA A;  4QBC A;  1ISV A;  3A07 A;  1IOB A;  2KLL A;  4OUJ A;  3V0A A;  3BA5 A;  1TTU A;  1AVX B;  3N7L A;  4L4I A;  1DQO A;  5DVH A;  3AJ5 A;  3I2A A;  4XFS A;  2P39 A;  4JKQ A;  1G9A A;  2D20 A;  1JT5 A;  1OQL B;  3O4C A;  4X38 A;  6I1B A;  3FFZ A;  3BB2 A;  3LLP A;  2WBC A;  2HW9 A;  1JTC A;  4OEG A;  4ZBV B;  4A7Z A;  1JT7 A;  1V6V A;  2Y9G A;  1R8O A;  3V0A B;  5F8S A;  2Y9F A;  2NP0 A;  3FJE A;  4QC4 A;  3S8K A;  3CRI A;  3OJ2 A;  2FFU A;  4D8H A;  1ISY A;  1RZO B;  3A23 A;  3UD9 A;  1ABR B;  3IIR A;  4ZFU B;  4J2Y A;  1Z4S A;  1BFF A;  1FMM S;  2RST A;  3FUQ A;  3Q7X A;  2HZ9 A;  3RTJ B;  1WBC A;  4OWL A;  3MAL A;  3CA0 A;  4I4U A;  4AN6 A;  1TIE A;  1N4K A;  1V6W A;  2L5X A;  2K4A B;  2LIQ A;  4LO3 A;  3CA3 A;  4XFT A;  2AQZ A;  4LO2 C;  2FDB M;  4AN7 B;  1DIW A;  3V0B A;  2IHO A;  3BX1 C;  3NBD A;  9ILB A;  3HBW A;  1IHK A;  4EFQ A;  3N7M A;  1I1B A;  4YOL A;  3IM5 A;  1JT3 A;  3RMY A;  3LTQ A;  3WO4 A;  3VT0 A;  2HWM A;  4D0T A;  1PZZ A;  4MZH A;  2X2S A;  3P53 A;  5FZU A;  3CQA A;  1ONK B;  2E4M C;  3N7K A;  4P0K A;  5BQU A;  2FGF A;  1DJS B;  3V0B B;  3FJI A;  2D7I A;  3IM7 A;  3RTI B;  3AZW A;  4GOV A;  5BP5 C;  2VSE A;  2RQ9 A;  4F83 A;  1G82 A;  4GP3 A;  2VSA A;  4I0Y A;  1BLD A;  3BAH A;  5GAQ A;  4JAW A;  1FV3 A;  1SR4 A;  31BI A;  4EFP A;  4LO0 A;  2QYI B;  4KEI A;  1JY0 A;  2MIB A;  1A8D A;  3OBR A;  2DS0 A;  3KMV A;  2ZQO A;  3V79 C;  4I4Q A;  1FN0 A;  3H6S E;  1AVA C;  1TOO A;  3HMY A;  4QD2 C;  1XG6 A;  4G6M A;  1D0H A;  3ZC9 A;  3HN1 A;  4I3N A;  1EV2 A;  4IHZ A;  2D23 A;  4DEP A;  5BXT A;  4J2S A;  3FJF A;  1XHB A;  3AJ6 A;  3AH2 A;  3OGF A;  3WO2 A;  3JUT A;  5DSS B;  4LO7 B;  2NYY A;  3WO3 A;  1FWV A;  5FZY A;  2AFG A;  5FZZ A;  2BEA A;  1ISX A;  1HWM B;  2Y9X E;  3FJ9 A;  4OWK A;  2ESU A;  1XYF A;  3AKH A;  5D62 A;  3RMX A;  1VCL A;  3R4S A;  4H9W A;  5BOW A;  3NBC A;  1FV2 A;  3BAQ A;  3O4B A;  3VUO A;  3AKF A;  3CA4 A;  4I1E A;  4PC4 A;  3WIN C;  1AVW B;  4IYB A;  1IIL A;  3AH4 A;  1JQZ A;  1V6U A;  2K8R A;  1NUN A;  1FMZ A;  4IY8 A;  2ZQN A;  3WA1 A;  3BRD A;  2KKI A;  4I4Y A;  2VLC A;  3QR5 A;  4DCK C;  2P23 A;  2BEB A;  1RY7 A;  4QBV A;  3O4D A;  1DLL A;  3VT1 A;  1FQ9 A;  2VXT I;  3N7J A;  4MZG B;  2MLL B;  1YYN A;  2D43 A;  3A22 A;  2Z48 A;  4OWJ A;  3UJ0 A;  3VSF A;  3AKG A;  3UDA A;  2DRE A;  3NBN A;  3B9U A;  1S0C A;  2D1Z A;  4I96 A;  4JKX B;  2XOA A;  1EVT A;  4P6A A;  4LO2 A;  3A21 A;  2QN4 A;  4GAI A;  4IZX A;  1DZC A;  1HCD A;  3K1X A;  4ZKT B;  2I1B A;  1TP0 A;  1S0E A;  1WD3 A;  2NS2 A;  2FO1 A;  3PG0 A;  1HKN A;  4OEF A;  1QQK A;  1FGA A;  4I2S A;  5F8W A;  1BAS A;  3WMU A;  3Q7W A;  1L2H A;  5DZU A;  4FVV A;  1ILR 1;  1I1E A;  1HWN B;  4EB2 B;  5FNW A;  4QKS A;  3BRG C;  4I4S A;  5F90 A;  3NBE A;  5BP5 A;  3FJ8 A;  4ISR A;  3IAG C;  4USP A;  2KH2 A;  1F31 A;  4LO8 B;  4KC3 A;  4GP0 A;  2D44 A;  1QQL A;  3H6R A;  4HR6 C;  1R8N A;  3CA5 A;  1S0G A;  3IM6 A;  4X39 A;  3I2X A;  2ET2 A;  3R4U A;  1BFC A;  4KBB A;  4ISQ A;  3FJC A;  1SZ6 B;  3O49 A;  3O44 A;  3FJB A;  3CRG A;  1BFG A;  1AFC A;  2DRY A;  4Q91 A;  21BI A;  5HPZ A;  1JT4 A;  1TWE A;  1E0O A;  2VUA A;  4I4X A;  2Y9W C;  3H6R B;  2VXR A;  3O5W B;  4G9M A;  4JQ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...