2X2TA

Crystal structure of sclerotinia sclerotiorum agglutinin ssa in complex with gal-beta1,3-galnac
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
152
structure length
152
Chain Sequence
GFKGVGTYEIVPYQAPSLNLNAWEGKLEPGAVVRTYTRGDKPSDNAKWQVALVAGSGDSAEYLIINVHSGYFLTATKENHIVSTPQISPTDPSARWTIKPATTHQYEVFTINNKVSELGQLTVKDYSTHSGADVLSASAKTADNQKWYFDAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Cell adhesion
molecule keywords AGGLUTININ
publication title Crystal Structure of the Galnac/Gal-Specific Agglutinin from the Phytopathogenic Ascomycete Sclerotinia Sclerotiorum Reveals Novel Adaptation of a Beta-Trefoil Domain
pubmed doi rcsb
total genus 39
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2010-01-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF14200 RicinB_lectin_2 Ricin-type beta-trefoil lectin domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2x2tA00
5BP5A 1WD3A 3VT1A 4GP0A 3IIRA 3OBTA 4G1RA 3FJKA 1JLYA 1SR4C 1ISVA 4EFQA 1ISXA 2MLLB 1R8OA 2ET2A 4X39A 1FV3A 2K43A 1BLDA 2D43A 3BB2A 1N4KA 4EEEB 3BAHA 5DSSB 2WRYA 3UD9A 4EFPA 4J2XA 4IYBA 4H9WA 1XHBA 4JKXB 1Q04A 1DFQA 1D0HA 2WBCA 4IZXA 3R4UA 1ILR1 4I4QA 4F83A 3HSMA 2DRYA 3IM7A 3VT0A 3IAGC 5FZUA 3CA5A 1Q03A 1IOBA 5I1BA 4QO3A 3JUTA 3PMEA 3O4OA 4QKSA 2NVHA 4OW4A 3WMVA 1AVWB 4ENDA 4LO3A 4OUJA 8I1BA 2L5XA 3K1XA 3PUBA 3FJAA 41BIA 4QD2B 4LO7B 4I2SA 5BXTA 3AH2A 3ZC9A 4D8HA 2KH2A 2RSTA 5F8SA 3S8JA 3RMYA 4GOVA 3NBEA 1V6VA 3VEQA 1NUNA 4XFUA 2FFVA 4QALA 1IILA 3POKA 4USOA 2R9KB 5D61A 2KLLA 3V0BA 4D0TA 3VSFA 1BA7A 3HMYA 3UD8A 3BA4A 1W3GA 5F8WA 3ZC8A 1BFBA 1FWUA 2YUGA 3LTQA 4KEIA 3CU1B 4I1EA 2NM1A 4AN7B 3H6QA 3BTAA 1I1BA 2NTDA 4QD2C 4ZKTB 1YBIA 1G9AA 3CAHA 3Q7XA 4ZFWB 2RG9B 3IM5A 1XYFA 2QYIB 1YTOA 1RG8A 4I4PA 2HWMA 3WINC 1IJTA 1S0BA 1ITBA 3I29B 4HA2A 4OEGA 4GAIA 1AF9A 1JT7A 4X38A 1Z0HA 4FVVA 1SR4A 4KC3A 1G9BA 3CA4A 2MC2A 4XFTA 1FQ9A 3H6RB 4Z8SB 2E4MC 3AKFA 4X37A 5E24E 2D7IA 2Z49A 3BAOA 3OJVA 5G00A 5FZZA 4ZFYB 2I1BA 3UDAA 1AXMA 2X2SA 3ZX7A 3OGFA 3S8KA 4JPZA 3WO2A 4EFRA 4AN6A 3CA6A 1WBCA 5FZYA 3I2XA 1HWOB 2FFUA 3WA1A 5BQUC 4G6JA 4Z9WB 1DQGA 3HOMA 1S0EA 1ABRB 2Y9WC 1GGPB 4EKXB 4XFSA 3V0AB 1JT5A 4I4RA 3VWCA 5D62A 3H6SE 1P63A 4R6UB 4I96A 1PZZA 1JY0A 1S0CA 4EB2B 1PUMB 2AFGA 1DLLA 2BEAA 1G9DA 4I4UA 1Q1UA 1K5UA 2AQZA 2UUSA 1MD6A 2J3PA 2LIQA 3N7LA 2ESUA 3BAQA 3E8LC 5GAQA 1FGAA 3AH1A 3WO3A 4A7KA 1E0OA 2FDBM 3TC2A 3AKGA 1QQKA 3FJDA 6I1BA 5EG6C 1WD4A 4LO2C 3CRGA 2RQ9A 1PUUB 2VSEA 1JTCA 3FJJA 2IWTB 1DZDA 2VXTI 4I3NA 3RMXA 4ZLBB 1Z2VA 5BOWA 2M49A 2XOAA 1JT3A 4I7IA 5BXPA 4QC4A 3OJ2A 3LLPA 3BA5A 1A8DA 1F31A 1VCLA 3HBWA 5JLVA 5D63A 1ISWA 1QXMA 1RZOB 3FJIA 4OWLA 3VSZA 2D44A 3WMUA 3FUQA 3HALA 1K5VA 1RMLA 3RTIB 3FJEA 4L4IA 21BIA 4ZBVB 1JT4A 3WO4A 3BRFA 1DZCA 1AVXB 3JRRA 1XZZA 3CQAA 2VUAA 3N7KA 4LO8B 2ZQOA 2VLCA 1IRAX 2D22A 3VUOA 4ZA3B 2KI6B 4G9NA 2K8RA 4J2YA 5EC5A 3FJBA 5FNXA 4ZFUB 1RY7A 2E4MA 31BIA 4I4OA 2NP0A 1ISZA 1EV2A 2QN4A 2Y9FA 4GOYA 4OWJA 4LO7C 4II0A 5BXRA 3PHZA 2DS0A 3V0BB 1V6UA 5BXSA 4OEFA 3O4AA 4G6MA 4F34A 1NZKA 2D24A 3HN1A 1MC9A 2Q3NB 4LO3C 4WBCA 4GAFA 1S0DA 2P39A 3N7JA 3N0KA 4I37A 4PC4A 4D0ZA 1FN0A 3QR5A 3P53A 5DZUA 3CA0A 3BAVA 3NJ5A 3A22A 3PG0A 3O4DA 2P23A 4P6AA 3Q7WA 4I0YA 4IHZA 4I4VA 1EYLA 2BFHA 1BASA 1EPWA 1WBAA 1S0GA 2BEBA 2HZ9A 3O4CA 3O5WB 1J0SA 1IHKA 3FJ9A 1DFCA 1M2TB 1YXWA 3Q7YA 5HPZA 1PWAA 1BFGA 3T8SA 7I1BA 1FMZA 1TIEA 1YYNA 1FWVA 2DREA 1G82A 3BAUA 1L2HA 3OJMA 3CRIA 3P6JA 4L4HA 4P0LA 3CA1A 1TTUA 1AFCA 4QBVA 3BRDA 3NBDA 3BRGC 1M16A 4OEEA 1BFFA 4I4XA 3MALA 4DCKC 4J2KA 2D1ZA 1G9CA 4KBBA 4H04A 4LO1C 1T4QA 1TWMA 4A7ZA 9ILBA 4I1BA 4LO2A 4IQPA 3FUOA 2AAIB 3FGMA 1IRPA 3D7WB 3MPPG 1XG6A 1R8NA 1T9FA 1HWNB 1BLAA 1TWEA 1ONKB 1UPSA 3NBCA 2IHOA 3OBRA 4J23B 4X3AA 3IM6A 1TOOA 4QKRA 4IZEA 1KNMA 1W3FA 3RTJB 3BX1C 3AZVA 4JAWA 4IY9A 2NYYA 5B2HA 4LO0C 3QYDA 4IONA 1BFCA 4I8MA 4XKIA 3W9TA 4ISRA 3A21A 2DRZA 1V6XA 2F2FC 3R4SA 3FJHA 3CRHA 4I4SA 4P0KA 1QQLA 1FMMS 3N7MA 5F8YA 2VU9A 4JP0A 3ZXDA 1HWMB 1PC8B 3BA7A 4IY8A 5BP5C 4G9MA 3UJ4A 4A7YA 4KEJA 4I6IA 4OWKA 2FO1A 4ZOTA 4ISQA 5DUYA 2D20A 3AKIA 4TLPA 3OGGA 1V6WA 4HR6C 3WINA 1W3AA 2K4AB 3SNVA 4J2SA 1BARA 1S0LA 1Z4SA 2D7RA 1DQOA 1AVUA 1AVAC 1HCDA 1CVSA 1EVTA 4YOLA 1TP0A 1TFMB 2FGFA 4FGFA 1ISYA 1I1EA 1HWPB 4JRAA 5EHAA 3F1RA 2ZQNA 1IT0A 4JQ0A 4Q91A 4DENA 3F62B 2GZBA 3A07A 3EF2A 1S0FA 4JKQA 5BQUA 5DVHA 3ZXGA 4Q9GA 3KMVA 3VT2A 2Q9XA 4LO1A 1HCEA 3AJ6A 3I2AA 2VXRA 3AJ5A 2Z48A 3ILAA 3FJCA 3FJFA 2D23A 4QBCA 3NBNA 2KI4A 4Q9PA 3C9ZA 1JLXA 2LIEA 3AZWA 2MIBA 1HKNA 2X2TA 3O4BA 3O44A 3H6RA 5BVPI 1CE7B 2NZ9A 3O3QA 4DEPA 1DJSB 1OQLB 3AH4A 2F8XC 5FNWA 1FV2A 3B9UA 3CA3A 4I4YA 3BADA 2HWAA 2Y9GA 3A23A 1II4A 3UJ0A 1JQZA 4USPA 3BAGA 2HW9A 2ZR1B 1SZ6B 2AXMA 3FFZA 4LO0A 5F90A 4ZGRB 1YF8B 5JMCA 4KEKA 3V0AA 3V79C 1HIBA 2ERMA 2F2FA 3P6IA 3FJ8A 4P0JA 3AKHA 3O49A 4CJMA 2Y9XE 4GP3A 2VSAA 3UD7A 2GO2A 3RSJA 2KKIA 1DIWA 4HJJA
chains in the Genus database with same CATH superfamily
5BP5A 1WD3A 3VT1A 4GP0A 3IIRA 3OBTA 4G1RA 3FJKA 1JLYA 1SR4C 1ISVA 4EFQA 1ISXA 2MLLB 1R8OA 2ET2A 4X39A 1FV3A 2K43A 1BLDA 2D43A 3BB2A 1N4KA 4EEEB 3BAHA 5DSSB 2WRYA 3UD9A 4EFPA 4J2XA 4IYBA 4H9WA 1XHBA 4JKXB 1Q04A 1DFQA 1D0HA 2WBCA 4IZXA 3R4UA 1ILR1 4I4QA 4F83A 3HSMA 2DRYA 3IM7A 3VT0A 3IAGC 5FZUA 3CA5A 1Q03A 1IOBA 5I1BA 4QO3A 3JUTA 3PMEA 3O4OA 4QKSA 2NVHA 4OW4A 3WMVA 1AVWB 4ENDA 4LO3A 4OUJA 8I1BA 2L5XA 3K1XA 3PUBA 3FJAA 41BIA 4QD2B 4LO7B 4I2SA 5BXTA 3AH2A 3ZC9A 4D8HA 2KH2A 2RSTA 5F8SA 3S8JA 3RMYA 4GOVA 3NBEA 1V6VA 3VEQA 1NUNA 4XFUA 2FFVA 4QALA 1IILA 3POKA 4USOA 2R9KB 5D61A 2KLLA 3V0BA 4D0TA 3VSFA 1BA7A 3HMYA 3UD8A 3BA4A 1W3GA 5F8WA 3ZC8A 1BFBA 1FWUA 2YUGA 3LTQA 4KEIA 3CU1B 4I1EA 2NM1A 4AN7B 3H6QA 3BTAA 1I1BA 2NTDA 4QD2C 4ZKTB 1YBIA 1G9AA 3CAHA 3Q7XA 4ZFWB 2RG9B 3IM5A 1XYFA 2QYIB 4MZGB 1YTOA 1RG8A 4I4PA 2HWMA 3WINC 1IJTA 1S0BA 1ITBA 3I29B 4HA2A 4OEGA 4GAIA 1AF9A 1JT7A 4X38A 1Z0HA 4FVVA 1SR4A 4KC3A 1G9BA 3CA4A 2MC2A 4XFTA 1FQ9A 3H6RB 4Z8SB 2E4MC 3AKFA 4X37A 5E24E 2D7IA 2Z49A 3BAOA 3OJVA 5G00A 5FZZA 4ZFYB 2I1BA 3UDAA 1AXMA 2X2SA 3ZX7A 3OGFA 3S8KA 4JPZA 3WO2A 4EFRA 4AN6A 3CA6A 1WBCA 5FZYA 3I2XA 1HWOB 2FFUA 3WA1A 5BQUC 4G6JA 4Z9WB 1DQGA 3HOMA 1S0EA 1ABRB 2Y9WC 1GGPB 4EKXB 4XFSA 3V0AB 1JT5A 4I4RA 3VWCA 5D62A 3H6SE 1P63A 4R6UB 4I96A 1PZZA 1JY0A 1S0CA 4EB2B 1PUMB 2AFGA 1DLLA 2BEAA 1G9DA 4I4UA 1Q1UA 1K5UA 2AQZA 2UUSA 1MD6A 2J3PA 2LIQA 3N7LA 2ESUA 3BAQA 3E8LC 5GAQA 1FGAA 3AH1A 3WO3A 4A7KA 1E0OA 2FDBM 3TC2A 3AKGA 1QQKA 3FJDA 6I1BA 5EG6C 1WD4A 4LO2C 3CRGA 2RQ9A 4UY4A 1PUUB 2VSEA 1JTCA 3FJJA 2IWTB 1DZDA 2VXTI 4I3NA 3RMXA 4ZLBB 1Z2VA 5BOWA 2M49A 2XOAA 1JT3A 4I7IA 5BXPA 4QC4A 3OJ2A 3LLPA 3BA5A 1A8DA 1F31A 1VCLA 3HBWA 5JLVA 5D63A 1ISWA 1QXMA 1RZOB 3FJIA 4OWLA 3VSZA 2D44A 3WMUA 3FUQA 3HALA 1K5VA 1RMLA 3RTIB 3FJEA 4L4IA 21BIA 4ZBVB 1JT4A 4MZHA 3WO4A 3BRFA 1DZCA 1AVXB 3JRRA 1XZZA 3CQAA 2VUAA 3N7KA 4LO8B 2ZQOA 2VLCA 1IRAX 2D22A 3VUOA 4ZA3B 2KI6B 4G9NA 2K8RA 4J2YA 5EC5A 3FJBA 5FNXA 4ZFUB 1RY7A 2E4MA 31BIA 4I4OA 2NP0A 1ISZA 1EV2A 2QN4A 2Y9FA 4GOYA 4OWJA 4LO7C 4II0A 5BXRA 3PHZA 2DS0A 2NS2A 3V0BB 1V6UA 5BXSA 4OEFA 3O4AA 4G6MA 4F34A 1NZKA 2D24A 3HN1A 1MC9A 2Q3NB 4LO3C 4WBCA 4GAFA 1S0DA 2P39A 3N7JA 3N0KA 4I37A 4PC4A 4D0ZA 1FN0A 3QR5A 3P53A 5DZUA 3CA0A 3BAVA 3NJ5A 3A22A 3PG0A 3O4DA 2P23A 4P6AA 3Q7WA 4I0YA 4IHZA 4I4VA 1EYLA 2BFHA 1BASA 1EPWA 1WBAA 1S0GA 2BEBA 2HZ9A 3O4CA 3O5WB 1J0SA 1IHKA 3FJ9A 1DFCA 1M2TB 1YXWA 3Q7YA 5HPZA 1PWAA 1BFGA 3T8SA 7I1BA 4MZFB 1FMZA 1TIEA 1YYNA 1FWVA 2DREA 1G82A 3BAUA 1L2HA 3OJMA 3CRIA 3P6JA 4L4HA 4P0LA 3CA1A 1TTUA 1AFCA 4QBVA 3BRDA 3NBDA 3BRGC 1M16A 4OEEA 1BFFA 4I4XA 3MALA 4DCKC 4J2KA 2D1ZA 1G9CA 4KBBA 4H04A 4LO1C 1T4QA 1TWMA 4A7ZA 9ILBA 4I1BA 4LO2A 4IQPA 3FUOA 2AAIB 3FGMA 1IRPA 3D7WB 3MPPG 1XG6A 1R8NA 1T9FA 1HWNB 1BLAA 1TWEA 1ONKB 1UPSA 3NBCA 2IHOA 3OBRA 4J23B 4X3AA 3IM6A 1TOOA 4QKRA 4IZEA 1KNMA 1W3FA 3RTJB 3BX1C 3AZVA 4JAWA 4IY9A 2NYYA 5B2HA 4LO0C 3QYDA 4IONA 1BFCA 4I8MA 4XKIA 3W9TA 4ISRA 3A21A 2DRZA 1V6XA 2F2FC 3R4SA 3FJHA 3CRHA 4I4SA 4P0KA 1QQLA 1FMMS 3N7MA 5F8YA 2VU9A 4JP0A 3ZXDA 1HWMB 1PC8B 3BA7A 4IY8A 5BP5C 4G9MA 3UJ4A 4A7YA 4KEJA 4I6IA 4OWKA 2FO1A 4ZOTA 4ISQA 5DUYA 2D20A 3AKIA 4TLPA 3OGGA 1V6WA 4HR6C 3WINA 1W3AA 2K4AB 3SNVA 4J2SA 1BARA 1S0LA 1Z4SA 2D7RA 1DQOA 1AVUA 1AVAC 1HCDA 1CVSA 1EVTA 4YOLA 1TP0A 1TFMB 2FGFA 4FGFA 1ISYA 1I1EA 1HWPB 4JRAA 5EHAA 3F1RA 2ZQNA 1IT0A 4JQ0A 4Q91A 4DENA 3F62B 2GZBA 3A07A 3EF2A 1S0FA 4JKQA 5BQUA 5DVHA 3ZXGA 4Q9GA 3KMVA 3VT2A 2Q9XA 4LO1A 1HCEA 3AJ6A 3I2AA 2VXRA 3AJ5A 2Z48A 3ILAA 3FJCA 3FJFA 2D23A 4QBCA 3NBNA 2KI4A 4Q9PA 3C9ZA 1JLXA 2LIEA 3AZWA 2MIBA 1HKNA 4H75A 2X2TA 3O4BA 3O44A 3H6RA 5BVPI 1CE7B 2NZ9A 3O3QA 4DEPA 1DJSB 1OQLB 3AH4A 2F8XC 5FNWA 1FV2A 3B9UA 3CA3A 4I4YA 3BADA 2HWAA 2Y9GA 3A23A 1II4A 3UJ0A 1JQZA 4USPA 3BAGA 2HW9A 2ZR1B 1SZ6B 2AXMA 3FFZA 4LO0A 5F90A 4ZGRB 1YF8B 5JMCA 4KEKA 3V0AA 3V79C 1HIBA 2ERMA 2F2FA 3P6IA 3FJ8A 4P0JA 3AKHA 3O49A 4CJMA 2Y9XE 4GP3A 2VSAA 3UD7A 2GO2A 3RSJA 2KKIA 1DIWA 4HJJA
chains in the Genus database with same CATH topology
5BP5A 1WD3A 3VT1A 4GP0A 3IIRA 3OBTA 4G1RA 3FJKA 1JLYA 1SR4C 1ISVA 4EFQA 1ISXA 2MLLB 1R8OA 2ET2A 4X39A 1FV3A 2K43A 1BLDA 2D43A 3BB2A 1N4KA 4EEEB 3BAHA 5DSSB 2WRYA 3UD9A 4EFPA 4J2XA 4IYBA 4H9WA 1XHBA 4JKXB 1Q04A 1DFQA 1D0HA 2WBCA 4IZXA 3R4UA 1ILR1 4I4QA 4F83A 3HSMA 2DRYA 3IM7A 3VT0A 3IAGC 5FZUA 3CA5A 1Q03A 1IOBA 5I1BA 4QO3A 3JUTA 3PMEA 3O4OA 4QKSA 2NVHA 4OW4A 3WMVA 1AVWB 4ENDA 4LO3A 4OUJA 8I1BA 2L5XA 3K1XA 3PUBA 3FJAA 41BIA 4QD2B 4LO7B 4I2SA 5BXTA 3AH2A 3ZC9A 4D8HA 2KH2A 2RSTA 5F8SA 3S8JA 3RMYA 4GOVA 3NBEA 1V6VA 3VEQA 1NUNA 4XFUA 2FFVA 4QALA 1IILA 3POKA 4USOA 2R9KB 5D61A 2KLLA 3V0BA 4D0TA 3VSFA 1BA7A 3HMYA 3UD8A 3BA4A 1W3GA 5F8WA 3ZC8A 1BFBA 1FWUA 2YUGA 3LTQA 4KEIA 3CU1B 4I1EA 2NM1A 4AN7B 3H6QA 3BTAA 1I1BA 2NTDA 4QD2C 4ZKTB 1YBIA 1G9AA 3CAHA 3Q7XA 4ZFWB 2RG9B 3IM5A 1XYFA 2QYIB 4MZGB 1YTOA 1RG8A 4I4PA 2HWMA 3WINC 1IJTA 1S0BA 1ITBA 3I29B 4HA2A 4OEGA 4GAIA 1AF9A 1JT7A 4X38A 1Z0HA 4FVVA 1SR4A 4KC3A 1G9BA 3CA4A 2MC2A 4XFTA 1FQ9A 3H6RB 4Z8SB 2E4MC 3AKFA 4X37A 5E24E 2D7IA 2Z49A 3BAOA 3OJVA 5G00A 5FZZA 4ZFYB 2I1BA 3UDAA 1AXMA 2X2SA 3ZX7A 3OGFA 3S8KA 4JPZA 3WO2A 4EFRA 4AN6A 3CA6A 1WBCA 5FZYA 3I2XA 1HWOB 2FFUA 3WA1A 5BQUC 4G6JA 4Z9WB 1DQGA 3HOMA 1S0EA 1ABRB 2Y9WC 1GGPB 4EKXB 4XFSA 3V0AB 1JT5A 4I4RA 3VWCA 5D62A 3H6SE 1P63A 4R6UB 4I96A 1PZZA 1JY0A 1S0CA 4EB2B 1PUMB 2AFGA 1DLLA 2BEAA 1G9DA 4I4UA 1Q1UA 1K5UA 2AQZA 2UUSA 1MD6A 2J3PA 2LIQA 3N7LA 2ESUA 3BAQA 3E8LC 5GAQA 1FGAA 3AH1A 3WO3A 4A7KA 1E0OA 2FDBM 3TC2A 3AKGA 1QQKA 3FJDA 6I1BA 5EG6C 1WD4A 4LO2C 3CRGA 2RQ9A 4UY4A 1PUUB 2VSEA 1JTCA 3FJJA 2IWTB 1DZDA 2VXTI 4I3NA 3RMXA 4ZLBB 1Z2VA 5BOWA 2M49A 2XOAA 1JT3A 4I7IA 5BXPA 4QC4A 3OJ2A 3LLPA 3BA5A 1A8DA 1F31A 1VCLA 3HBWA 5JLVA 5D63A 1ISWA 1QXMA 1RZOB 3FJIA 4OWLA 3VSZA 2D44A 3WMUA 3FUQA 3HALA 1K5VA 1RMLA 3RTIB 3FJEA 4L4IA 21BIA 4ZBVB 1JT4A 4MZHA 3WO4A 3BRFA 1DZCA 1AVXB 3JRRA 1XZZA 3CQAA 2VUAA 3N7KA 4LO8B 2ZQOA 2VLCA 1IRAX 2D22A 3VUOA 4ZA3B 2KI6B 4G9NA 2K8RA 4J2YA 5EC5A 3FJBA 5FNXA 4ZFUB 1RY7A 2E4MA 31BIA 4I4OA 2NP0A 1ISZA 1EV2A 2QN4A 2Y9FA 4GOYA 4OWJA 4LO7C 4II0A 5BXRA 3PHZA 2DS0A 2NS2A 3V0BB 1V6UA 5BXSA 4OEFA 3O4AA 4G6MA 4F34A 1NZKA 2D24A 3HN1A 1MC9A 2Q3NB 4LO3C 4WBCA 4GAFA 1S0DA 2P39A 3N7JA 3N0KA 4I37A 4PC4A 4D0ZA 1FN0A 3QR5A 3P53A 5DZUA 3CA0A 3BAVA 3NJ5A 3A22A 3PG0A 3O4DA 2P23A 4P6AA 3Q7WA 4I0YA 4IHZA 4I4VA 1EYLA 2BFHA 1BASA 1EPWA 1WBAA 1S0GA 2BEBA 2HZ9A 3O4CA 3O5WB 1J0SA 1IHKA 3FJ9A 1DFCA 1M2TB 1YXWA 3Q7YA 5HPZA 1PWAA 1BFGA 3T8SA 7I1BA 4MZFB 1FMZA 1TIEA 1YYNA 1FWVA 2DREA 1G82A 3BAUA 1L2HA 3OJMA 3CRIA 3P6JA 4L4HA 4P0LA 3CA1A 1TTUA 1AFCA 4QBVA 3BRDA 3NBDA 3BRGC 1M16A 4OEEA 1BFFA 4I4XA 3MALA 4DCKC 4J2KA 2D1ZA 1G9CA 4KBBA 4H04A 4LO1C 1T4QA 1TWMA 4A7ZA 9ILBA 4I1BA 4LO2A 4IQPA 3FUOA 2AAIB 3FGMA 1IRPA 3D7WB 3MPPG 1XG6A 1R8NA 1T9FA 1HWNB 1BLAA 1TWEA 1ONKB 1UPSA 3NBCA 2IHOA 3OBRA 4J23B 4X3AA 3IM6A 1TOOA 4QKRA 4IZEA 1KNMA 1W3FA 3RTJB 3BX1C 3AZVA 4JAWA 4IY9A 2NYYA 5B2HA 4LO0C 3QYDA 4IONA 1BFCA 4I8MA 4XKIA 3W9TA 4ISRA 3A21A 2DRZA 1V6XA 2F2FC 3R4SA 3FJHA 3CRHA 4I4SA 4P0KA 1QQLA 1FMMS 3N7MA 5F8YA 2VU9A 4JP0A 3ZXDA 1HWMB 1PC8B 3BA7A 4IY8A 5BP5C 4G9MA 3UJ4A 4A7YA 4KEJA 4I6IA 4OWKA 2FO1A 4ZOTA 4ISQA 5DUYA 2D20A 3AKIA 4TLPA 3OGGA 1V6WA 4HR6C 3WINA 1W3AA 2K4AB 3SNVA 4J2SA 1BARA 1S0LA 1Z4SA 2D7RA 1DQOA 1AVUA 1AVAC 1HCDA 1CVSA 1EVTA 4YOLA 1TP0A 1TFMB 2FGFA 4FGFA 1ISYA 1I1EA 1HWPB 4JRAA 5EHAA 3F1RA 2ZQNA 1IT0A 4JQ0A 4Q91A 4DENA 3F62B 2GZBA 3A07A 3EF2A 1S0FA 4JKQA 5BQUA 5DVHA 3ZXGA 4Q9GA 3KMVA 3VT2A 2Q9XA 4LO1A 1HCEA 3AJ6A 3I2AA 2VXRA 3AJ5A 2Z48A 3ILAA 3FJCA 3FJFA 2D23A 4QBCA 3NBNA 2KI4A 4Q9PA 3C9ZA 1JLXA 2LIEA 3AZWA 2MIBA 1HKNA 4H75A 2X2TA 3O4BA 3O44A 3H6RA 5BVPI 1CE7B 2NZ9A 3O3QA 4DEPA 1DJSB 1OQLB 3AH4A 2F8XC 5FNWA 1FV2A 3B9UA 3CA3A 4I4YA 3BADA 2HWAA 2Y9GA 3A23A 1II4A 3UJ0A 1JQZA 4USPA 3BAGA 2HW9A 2ZR1B 1SZ6B 2AXMA 3FFZA 4LO0A 5F90A 4ZGRB 1YF8B 5JMCA 4KEKA 3V0AA 3V79C 1HIBA 2ERMA 2F2FA 3P6IA 3FJ8A 4P0JA 3AKHA 3O49A 4CJMA 2Y9XE 4GP3A 2VSAA 3UD7A 2GO2A 3RSJA 2KKIA 1DIWA 4HJJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BP5 A;  1WD3 A;  3VT1 A;  4GP0 A;  3IIR A;  3OBT A;  4G1R A;  3FJK A;  1JLY A;  1SR4 C;  1ISV A;  4EFQ A;  1ISX A;  2MLL B;  1R8O A;  2ET2 A;  4X39 A;  1FV3 A;  2K43 A;  1BLD A;  2D43 A;  3BB2 A;  1N4K A;  4EEE B;  3BAH A;  5DSS B;  2WRY A;  3UD9 A;  4EFP A;  4J2X A;  4IYB A;  4H9W A;  1XHB A;  4JKX B;  1Q04 A;  1DFQ A;  1D0H A;  2WBC A;  4IZX A;  3R4U A;  1ILR 1;  4I4Q A;  4F83 A;  3HSM A;  2DRY A;  3IM7 A;  3VT0 A;  3IAG C;  5FZU A;  3CA5 A;  1Q03 A;  1IOB A;  5I1B A;  4QO3 A;  3JUT A;  3PME A;  3O4O A;  4QKS A;  2NVH A;  4OW4 A;  3WMV A;  1AVW B;  4END A;  4LO3 A;  4OUJ A;  8I1B A;  2L5X A;  3K1X A;  3PUB A;  3FJA A;  41BI A;  4QD2 B;  4LO7 B;  4I2S A;  5BXT A;  3AH2 A;  3ZC9 A;  4D8H A;  2KH2 A;  2RST A;  5F8S A;  3S8J A;  3RMY A;  4GOV A;  3NBE A;  1V6V A;  3VEQ A;  1NUN A;  4XFU A;  2FFV A;  4QAL A;  1IIL A;  3POK A;  4USO A;  2R9K B;  5D61 A;  2KLL A;  3V0B A;  4D0T A;  3VSF A;  1BA7 A;  3HMY A;  3UD8 A;  3BA4 A;  1W3G A;  5F8W A;  3ZC8 A;  1BFB A;  1FWU A;  2YUG A;  3LTQ A;  4KEI A;  3CU1 B;  4I1E A;  2NM1 A;  4AN7 B;  3H6Q A;  3BTA A;  1I1B A;  2NTD A;  4QD2 C;  4ZKT B;  1YBI A;  1G9A A;  3CAH A;  3Q7X A;  4ZFW B;  2RG9 B;  3IM5 A;  1XYF A;  2QYI B;  1YTO A;  1RG8 A;  4I4P A;  2HWM A;  3WIN C;  1IJT A;  1S0B A;  1ITB A;  3I29 B;  4HA2 A;  4OEG A;  4GAI A;  1AF9 A;  1JT7 A;  4X38 A;  1Z0H A;  4FVV A;  1SR4 A;  4KC3 A;  1G9B A;  3CA4 A;  2MC2 A;  4XFT A;  1FQ9 A;  3H6R B;  4Z8S B;  2E4M C;  3AKF A;  4X37 A;  5E24 E;  2D7I A;  2Z49 A;  3BAO A;  3OJV A;  5G00 A;  5FZZ A;  4ZFY B;  2I1B A;  3UDA A;  1AXM A;  2X2S A;  3ZX7 A;  3OGF A;  3S8K A;  4JPZ A;  3WO2 A;  4EFR A;  4AN6 A;  3CA6 A;  1WBC A;  5FZY A;  3I2X A;  1HWO B;  2FFU A;  3WA1 A;  5BQU C;  4G6J A;  4Z9W B;  1DQG A;  3HOM A;  1S0E A;  1ABR B;  2Y9W C;  1GGP B;  4EKX B;  4XFS A;  3V0A B;  1JT5 A;  4I4R A;  3VWC A;  5D62 A;  3H6S E;  1P63 A;  4R6U B;  4I96 A;  1PZZ A;  1JY0 A;  1S0C A;  4EB2 B;  1PUM B;  2AFG A;  1DLL A;  2BEA A;  1G9D A;  4I4U A;  1Q1U A;  1K5U A;  2AQZ A;  2UUS A;  1MD6 A;  2J3P A;  2LIQ A;  3N7L A;  2ESU A;  3BAQ A;  3E8L C;  5GAQ A;  1FGA A;  3AH1 A;  3WO3 A;  4A7K A;  1E0O A;  2FDB M;  3TC2 A;  3AKG A;  1QQK A;  3FJD A;  6I1B A;  5EG6 C;  1WD4 A;  4LO2 C;  3CRG A;  2RQ9 A;  1PUU B;  2VSE A;  1JTC A;  3FJJ A;  2IWT B;  1DZD A;  2VXT I;  4I3N A;  3RMX A;  4ZLB B;  1Z2V A;  5BOW A;  2M49 A;  2XOA A;  1JT3 A;  4I7I A;  5BXP A;  4QC4 A;  3OJ2 A;  3LLP A;  3BA5 A;  1A8D A;  1F31 A;  1VCL A;  3HBW A;  5JLV A;  5D63 A;  1ISW A;  1QXM A;  1RZO B;  3FJI A;  4OWL A;  3VSZ A;  2D44 A;  3WMU A;  3FUQ A;  3HAL A;  1K5V A;  1RML A;  3RTI B;  3FJE A;  4L4I A;  21BI A;  4ZBV B;  1JT4 A;  3WO4 A;  3BRF A;  1DZC A;  1AVX B;  3JRR A;  1XZZ A;  3CQA A;  2VUA A;  3N7K A;  4LO8 B;  2ZQO A;  2VLC A;  1IRA X;  2D22 A;  3VUO A;  4ZA3 B;  2KI6 B;  4G9N A;  2K8R A;  4J2Y A;  5EC5 A;  3FJB A;  5FNX A;  4ZFU B;  1RY7 A;  2E4M A;  31BI A;  4I4O A;  2NP0 A;  1ISZ A;  1EV2 A;  2QN4 A;  2Y9F A;  4GOY A;  4OWJ A;  4LO7 C;  4II0 A;  5BXR A;  3PHZ A;  2DS0 A;  3V0B B;  1V6U A;  5BXS A;  4OEF A;  3O4A A;  4G6M A;  4F34 A;  1NZK A;  2D24 A;  3HN1 A;  1MC9 A;  2Q3N B;  4LO3 C;  4WBC A;  4GAF A;  1S0D A;  2P39 A;  3N7J A;  3N0K A;  4I37 A;  4PC4 A;  4D0Z A;  1FN0 A;  3QR5 A;  3P53 A;  5DZU A;  3CA0 A;  3BAV A;  3NJ5 A;  3A22 A;  3PG0 A;  3O4D A;  2P23 A;  4P6A A;  3Q7W A;  4I0Y A;  4IHZ A;  4I4V A;  1EYL A;  2BFH A;  1BAS A;  1EPW A;  1WBA A;  1S0G A;  2BEB A;  2HZ9 A;  3O4C A;  3O5W B;  1J0S A;  1IHK A;  3FJ9 A;  1DFC A;  1M2T B;  1YXW A;  3Q7Y A;  5HPZ A;  1PWA A;  1BFG A;  3T8S A;  7I1B A;  1FMZ A;  1TIE A;  1YYN A;  1FWV A;  2DRE A;  1G82 A;  3BAU A;  1L2H A;  3OJM A;  3CRI A;  3P6J A;  4L4H A;  4P0L A;  3CA1 A;  1TTU A;  1AFC A;  4QBV A;  3BRD A;  3NBD A;  3BRG C;  1M16 A;  4OEE A;  1BFF A;  4I4X A;  3MAL A;  4DCK C;  4J2K A;  2D1Z A;  1G9C A;  4KBB A;  4H04 A;  4LO1 C;  1T4Q A;  1TWM A;  4A7Z A;  9ILB A;  4I1B A;  4LO2 A;  4IQP A;  3FUO A;  2AAI B;  3FGM A;  1IRP A;  3D7W B;  3MPP G;  1XG6 A;  1R8N A;  1T9F A;  1HWN B;  1BLA A;  1TWE A;  1ONK B;  1UPS A;  3NBC A;  2IHO A;  3OBR A;  4J23 B;  4X3A A;  3IM6 A;  1TOO A;  4QKR A;  4IZE A;  1KNM A;  1W3F A;  3RTJ B;  3BX1 C;  3AZV A;  4JAW A;  4IY9 A;  2NYY A;  5B2H A;  4LO0 C;  3QYD A;  4ION A;  1BFC A;  4I8M A;  4XKI A;  3W9T A;  4ISR A;  3A21 A;  2DRZ A;  1V6X A;  2F2F C;  3R4S A;  3FJH A;  3CRH A;  4I4S A;  4P0K A;  1QQL A;  1FMM S;  3N7M A;  5F8Y A;  2VU9 A;  4JP0 A;  3ZXD A;  1HWM B;  1PC8 B;  3BA7 A;  4IY8 A;  5BP5 C;  4G9M A;  3UJ4 A;  4A7Y A;  4KEJ A;  4I6I A;  4OWK A;  2FO1 A;  4ZOT A;  4ISQ A;  5DUY A;  2D20 A;  3AKI A;  4TLP A;  3OGG A;  1V6W A;  4HR6 C;  3WIN A;  1W3A A;  2K4A B;  3SNV A;  4J2S A;  1BAR A;  1S0L A;  1Z4S A;  2D7R A;  1DQO A;  1AVU A;  1AVA C;  1HCD A;  1CVS A;  1EVT A;  4YOL A;  1TP0 A;  1TFM B;  2FGF A;  4FGF A;  1ISY A;  1I1E A;  1HWP B;  4JRA A;  5EHA A;  3F1R A;  2ZQN A;  1IT0 A;  4JQ0 A;  4Q91 A;  4DEN A;  3F62 B;  2GZB A;  3A07 A;  3EF2 A;  1S0F A;  4JKQ A;  5BQU A;  5DVH A;  3ZXG A;  4Q9G A;  3KMV A;  3VT2 A;  2Q9X A;  4LO1 A;  1HCE A;  3AJ6 A;  3I2A A;  2VXR A;  3AJ5 A;  2Z48 A;  3ILA A;  3FJC A;  3FJF A;  2D23 A;  4QBC A;  3NBN A;  2KI4 A;  4Q9P A;  3C9Z A;  1JLX A;  2LIE A;  3AZW A;  2MIB A;  1HKN A;  2X2T A;  3O4B A;  3O44 A;  3H6R A;  5BVP I;  1CE7 B;  2NZ9 A;  3O3Q A;  4DEP A;  1DJS B;  1OQL B;  3AH4 A;  2F8X C;  5FNW A;  1FV2 A;  3B9U A;  3CA3 A;  4I4Y A;  3BAD A;  2HWA A;  2Y9G A;  3A23 A;  1II4 A;  3UJ0 A;  1JQZ A;  4USP A;  3BAG A;  2HW9 A;  2ZR1 B;  1SZ6 B;  2AXM A;  3FFZ A;  4LO0 A;  5F90 A;  4ZGR B;  1YF8 B;  5JMC A;  4KEK A;  3V0A A;  3V79 C;  1HIB A;  2ERM A;  2F2F A;  3P6I A;  3FJ8 A;  4P0J A;  3AKH A;  3O49 A;  4CJM A;  2Y9X E;  4GP3 A;  2VSA A;  3UD7 A;  2GO2 A;  3RSJ A;  2KKI A;  1DIW A;  4HJJ A; 
#chains in the Genus database with same CATH topology
 5BP5 A;  1WD3 A;  3VT1 A;  4GP0 A;  3IIR A;  3OBT A;  4G1R A;  3FJK A;  1JLY A;  1SR4 C;  1ISV A;  4EFQ A;  1ISX A;  2MLL B;  1R8O A;  2ET2 A;  4X39 A;  1FV3 A;  2K43 A;  1BLD A;  2D43 A;  3BB2 A;  1N4K A;  4EEE B;  3BAH A;  5DSS B;  2WRY A;  3UD9 A;  4EFP A;  4J2X A;  4IYB A;  4H9W A;  1XHB A;  4JKX B;  1Q04 A;  1DFQ A;  1D0H A;  2WBC A;  4IZX A;  3R4U A;  1ILR 1;  4I4Q A;  4F83 A;  3HSM A;  2DRY A;  3IM7 A;  3VT0 A;  3IAG C;  5FZU A;  3CA5 A;  1Q03 A;  1IOB A;  5I1B A;  4QO3 A;  3JUT A;  3PME A;  3O4O A;  4QKS A;  2NVH A;  4OW4 A;  3WMV A;  1AVW B;  4END A;  4LO3 A;  4OUJ A;  8I1B A;  2L5X A;  3K1X A;  3PUB A;  3FJA A;  41BI A;  4QD2 B;  4LO7 B;  4I2S A;  5BXT A;  3AH2 A;  3ZC9 A;  4D8H A;  2KH2 A;  2RST A;  5F8S A;  3S8J A;  3RMY A;  4GOV A;  3NBE A;  1V6V A;  3VEQ A;  1NUN A;  4XFU A;  2FFV A;  4QAL A;  1IIL A;  3POK A;  4USO A;  2R9K B;  5D61 A;  2KLL A;  3V0B A;  4D0T A;  3VSF A;  1BA7 A;  3HMY A;  3UD8 A;  3BA4 A;  1W3G A;  5F8W A;  3ZC8 A;  1BFB A;  1FWU A;  2YUG A;  3LTQ A;  4KEI A;  3CU1 B;  4I1E A;  2NM1 A;  4AN7 B;  3H6Q A;  3BTA A;  1I1B A;  2NTD A;  4QD2 C;  4ZKT B;  1YBI A;  1G9A A;  3CAH A;  3Q7X A;  4ZFW B;  2RG9 B;  3IM5 A;  1XYF A;  2QYI B;  4MZG B;  1YTO A;  1RG8 A;  4I4P A;  2HWM A;  3WIN C;  1IJT A;  1S0B A;  1ITB A;  3I29 B;  4HA2 A;  4OEG A;  4GAI A;  1AF9 A;  1JT7 A;  4X38 A;  1Z0H A;  4FVV A;  1SR4 A;  4KC3 A;  1G9B A;  3CA4 A;  2MC2 A;  4XFT A;  1FQ9 A;  3H6R B;  4Z8S B;  2E4M C;  3AKF A;  4X37 A;  5E24 E;  2D7I A;  2Z49 A;  3BAO A;  3OJV A;  5G00 A;  5FZZ A;  4ZFY B;  2I1B A;  3UDA A;  1AXM A;  2X2S A;  3ZX7 A;  3OGF A;  3S8K A;  4JPZ A;  3WO2 A;  4EFR A;  4AN6 A;  3CA6 A;  1WBC A;  5FZY A;  3I2X A;  1HWO B;  2FFU A;  3WA1 A;  5BQU C;  4G6J A;  4Z9W B;  1DQG A;  3HOM A;  1S0E A;  1ABR B;  2Y9W C;  1GGP B;  4EKX B;  4XFS A;  3V0A B;  1JT5 A;  4I4R A;  3VWC A;  5D62 A;  3H6S E;  1P63 A;  4R6U B;  4I96 A;  1PZZ A;  1JY0 A;  1S0C A;  4EB2 B;  1PUM B;  2AFG A;  1DLL A;  2BEA A;  1G9D A;  4I4U A;  1Q1U A;  1K5U A;  2AQZ A;  2UUS A;  1MD6 A;  2J3P A;  2LIQ A;  3N7L A;  2ESU A;  3BAQ A;  3E8L C;  5GAQ A;  1FGA A;  3AH1 A;  3WO3 A;  4A7K A;  1E0O A;  2FDB M;  3TC2 A;  3AKG A;  1QQK A;  3FJD A;  6I1B A;  5EG6 C;  1WD4 A;  4LO2 C;  3CRG A;  2RQ9 A;  4UY4 A;  1PUU B;  2VSE A;  1JTC A;  3FJJ A;  2IWT B;  1DZD A;  2VXT I;  4I3N A;  3RMX A;  4ZLB B;  1Z2V A;  5BOW A;  2M49 A;  2XOA A;  1JT3 A;  4I7I A;  5BXP A;  4QC4 A;  3OJ2 A;  3LLP A;  3BA5 A;  1A8D A;  1F31 A;  1VCL A;  3HBW A;  5JLV A;  5D63 A;  1ISW A;  1QXM A;  1RZO B;  3FJI A;  4OWL A;  3VSZ A;  2D44 A;  3WMU A;  3FUQ A;  3HAL A;  1K5V A;  1RML A;  3RTI B;  3FJE A;  4L4I A;  21BI A;  4ZBV B;  1JT4 A;  4MZH A;  3WO4 A;  3BRF A;  1DZC A;  1AVX B;  3JRR A;  1XZZ A;  3CQA A;  2VUA A;  3N7K A;  4LO8 B;  2ZQO A;  2VLC A;  1IRA X;  2D22 A;  3VUO A;  4ZA3 B;  2KI6 B;  4G9N A;  2K8R A;  4J2Y A;  5EC5 A;  3FJB A;  5FNX A;  4ZFU B;  1RY7 A;  2E4M A;  31BI A;  4I4O A;  2NP0 A;  1ISZ A;  1EV2 A;  2QN4 A;  2Y9F A;  4GOY A;  4OWJ A;  4LO7 C;  4II0 A;  5BXR A;  3PHZ A;  2DS0 A;  2NS2 A;  3V0B B;  1V6U A;  5BXS A;  4OEF A;  3O4A A;  4G6M A;  4F34 A;  1NZK A;  2D24 A;  3HN1 A;  1MC9 A;  2Q3N B;  4LO3 C;  4WBC A;  4GAF A;  1S0D A;  2P39 A;  3N7J A;  3N0K A;  4I37 A;  4PC4 A;  4D0Z A;  1FN0 A;  3QR5 A;  3P53 A;  5DZU A;  3CA0 A;  3BAV A;  3NJ5 A;  3A22 A;  3PG0 A;  3O4D A;  2P23 A;  4P6A A;  3Q7W A;  4I0Y A;  4IHZ A;  4I4V A;  1EYL A;  2BFH A;  1BAS A;  1EPW A;  1WBA A;  1S0G A;  2BEB A;  2HZ9 A;  3O4C A;  3O5W B;  1J0S A;  1IHK A;  3FJ9 A;  1DFC A;  1M2T B;  1YXW A;  3Q7Y A;  5HPZ A;  1PWA A;  1BFG A;  3T8S A;  7I1B A;  4MZF B;  1FMZ A;  1TIE A;  1YYN A;  1FWV A;  2DRE A;  1G82 A;  3BAU A;  1L2H A;  3OJM A;  3CRI A;  3P6J A;  4L4H A;  4P0L A;  3CA1 A;  1TTU A;  1AFC A;  4QBV A;  3BRD A;  3NBD A;  3BRG C;  1M16 A;  4OEE A;  1BFF A;  4I4X A;  3MAL A;  4DCK C;  4J2K A;  2D1Z A;  1G9C A;  4KBB A;  4H04 A;  4LO1 C;  1T4Q A;  1TWM A;  4A7Z A;  9ILB A;  4I1B A;  4LO2 A;  4IQP A;  3FUO A;  2AAI B;  3FGM A;  1IRP A;  3D7W B;  3MPP G;  1XG6 A;  1R8N A;  1T9F A;  1HWN B;  1BLA A;  1TWE A;  1ONK B;  1UPS A;  3NBC A;  2IHO A;  3OBR A;  4J23 B;  4X3A A;  3IM6 A;  1TOO A;  4QKR A;  4IZE A;  1KNM A;  1W3F A;  3RTJ B;  3BX1 C;  3AZV A;  4JAW A;  4IY9 A;  2NYY A;  5B2H A;  4LO0 C;  3QYD A;  4ION A;  1BFC A;  4I8M A;  4XKI A;  3W9T A;  4ISR A;  3A21 A;  2DRZ A;  1V6X A;  2F2F C;  3R4S A;  3FJH A;  3CRH A;  4I4S A;  4P0K A;  1QQL A;  1FMM S;  3N7M A;  5F8Y A;  2VU9 A;  4JP0 A;  3ZXD A;  1HWM B;  1PC8 B;  3BA7 A;  4IY8 A;  5BP5 C;  4G9M A;  3UJ4 A;  4A7Y A;  4KEJ A;  4I6I A;  4OWK A;  2FO1 A;  4ZOT A;  4ISQ A;  5DUY A;  2D20 A;  3AKI A;  4TLP A;  3OGG A;  1V6W A;  4HR6 C;  3WIN A;  1W3A A;  2K4A B;  3SNV A;  4J2S A;  1BAR A;  1S0L A;  1Z4S A;  2D7R A;  1DQO A;  1AVU A;  1AVA C;  1HCD A;  1CVS A;  1EVT A;  4YOL A;  1TP0 A;  1TFM B;  2FGF A;  4FGF A;  1ISY A;  1I1E A;  1HWP B;  4JRA A;  5EHA A;  3F1R A;  2ZQN A;  1IT0 A;  4JQ0 A;  4Q91 A;  4DEN A;  3F62 B;  2GZB A;  3A07 A;  3EF2 A;  1S0F A;  4JKQ A;  5BQU A;  5DVH A;  3ZXG A;  4Q9G A;  3KMV A;  3VT2 A;  2Q9X A;  4LO1 A;  1HCE A;  3AJ6 A;  3I2A A;  2VXR A;  3AJ5 A;  2Z48 A;  3ILA A;  3FJC A;  3FJF A;  2D23 A;  4QBC A;  3NBN A;  2KI4 A;  4Q9P A;  3C9Z A;  1JLX A;  2LIE A;  3AZW A;  2MIB A;  1HKN A;  4H75 A;  2X2T A;  3O4B A;  3O44 A;  3H6R A;  5BVP I;  1CE7 B;  2NZ9 A;  3O3Q A;  4DEP A;  1DJS B;  1OQL B;  3AH4 A;  2F8X C;  5FNW A;  1FV2 A;  3B9U A;  3CA3 A;  4I4Y A;  3BAD A;  2HWA A;  2Y9G A;  3A23 A;  1II4 A;  3UJ0 A;  1JQZ A;  4USP A;  3BAG A;  2HW9 A;  2ZR1 B;  1SZ6 B;  2AXM A;  3FFZ A;  4LO0 A;  5F90 A;  4ZGR B;  1YF8 B;  5JMC A;  4KEK A;  3V0A A;  3V79 C;  1HIB A;  2ERM A;  2F2F A;  3P6I A;  3FJ8 A;  4P0J A;  3AKH A;  3O49 A;  4CJM A;  2Y9X E;  4GP3 A;  2VSA A;  3UD7 A;  2GO2 A;  3RSJ A;  2KKI A;  1DIW A;  4HJJ A; 
#chains in the Genus database with same CATH homology
 5BP5 A;  1WD3 A;  3VT1 A;  4GP0 A;  3IIR A;  3OBT A;  4G1R A;  3FJK A;  1JLY A;  1SR4 C;  1ISV A;  4EFQ A;  1ISX A;  2MLL B;  1R8O A;  2ET2 A;  4X39 A;  1FV3 A;  2K43 A;  1BLD A;  2D43 A;  3BB2 A;  1N4K A;  4EEE B;  3BAH A;  5DSS B;  2WRY A;  3UD9 A;  4EFP A;  4J2X A;  4IYB A;  4H9W A;  1XHB A;  4JKX B;  1Q04 A;  1DFQ A;  1D0H A;  2WBC A;  4IZX A;  3R4U A;  1ILR 1;  4I4Q A;  4F83 A;  3HSM A;  2DRY A;  3IM7 A;  3VT0 A;  3IAG C;  5FZU A;  3CA5 A;  1Q03 A;  1IOB A;  5I1B A;  4QO3 A;  3JUT A;  3PME A;  3O4O A;  4QKS A;  2NVH A;  4OW4 A;  3WMV A;  1AVW B;  4END A;  4LO3 A;  4OUJ A;  8I1B A;  2L5X A;  3K1X A;  3PUB A;  3FJA A;  41BI A;  4QD2 B;  4LO7 B;  4I2S A;  5BXT A;  3AH2 A;  3ZC9 A;  4D8H A;  2KH2 A;  2RST A;  5F8S A;  3S8J A;  3RMY A;  4GOV A;  3NBE A;  1V6V A;  3VEQ A;  1NUN A;  4XFU A;  2FFV A;  4QAL A;  1IIL A;  3POK A;  4USO A;  2R9K B;  5D61 A;  2KLL A;  3V0B A;  4D0T A;  3VSF A;  1BA7 A;  3HMY A;  3UD8 A;  3BA4 A;  1W3G A;  5F8W A;  3ZC8 A;  1BFB A;  1FWU A;  2YUG A;  3LTQ A;  4KEI A;  3CU1 B;  4I1E A;  2NM1 A;  4AN7 B;  3H6Q A;  3BTA A;  1I1B A;  2NTD A;  4QD2 C;  4ZKT B;  1YBI A;  1G9A A;  3CAH A;  3Q7X A;  4ZFW B;  2RG9 B;  3IM5 A;  1XYF A;  2QYI B;  4MZG B;  1YTO A;  1RG8 A;  4I4P A;  2HWM A;  3WIN C;  1IJT A;  1S0B A;  1ITB A;  3I29 B;  4HA2 A;  4OEG A;  4GAI A;  1AF9 A;  1JT7 A;  4X38 A;  1Z0H A;  4FVV A;  1SR4 A;  4KC3 A;  1G9B A;  3CA4 A;  2MC2 A;  4XFT A;  1FQ9 A;  3H6R B;  4Z8S B;  2E4M C;  3AKF A;  4X37 A;  5E24 E;  2D7I A;  2Z49 A;  3BAO A;  3OJV A;  5G00 A;  5FZZ A;  4ZFY B;  2I1B A;  3UDA A;  1AXM A;  2X2S A;  3ZX7 A;  3OGF A;  3S8K A;  4JPZ A;  3WO2 A;  4EFR A;  4AN6 A;  3CA6 A;  1WBC A;  5FZY A;  3I2X A;  1HWO B;  2FFU A;  3WA1 A;  5BQU C;  4G6J A;  4Z9W B;  1DQG A;  3HOM A;  1S0E A;  1ABR B;  2Y9W C;  1GGP B;  4EKX B;  4XFS A;  3V0A B;  1JT5 A;  4I4R A;  3VWC A;  5D62 A;  3H6S E;  1P63 A;  4R6U B;  4I96 A;  1PZZ A;  1JY0 A;  1S0C A;  4EB2 B;  1PUM B;  2AFG A;  1DLL A;  2BEA A;  1G9D A;  4I4U A;  1Q1U A;  1K5U A;  2AQZ A;  2UUS A;  1MD6 A;  2J3P A;  2LIQ A;  3N7L A;  2ESU A;  3BAQ A;  3E8L C;  5GAQ A;  1FGA A;  3AH1 A;  3WO3 A;  4A7K A;  1E0O A;  2FDB M;  3TC2 A;  3AKG A;  1QQK A;  3FJD A;  6I1B A;  5EG6 C;  1WD4 A;  4LO2 C;  3CRG A;  2RQ9 A;  4UY4 A;  1PUU B;  2VSE A;  1JTC A;  3FJJ A;  2IWT B;  1DZD A;  2VXT I;  4I3N A;  3RMX A;  4ZLB B;  1Z2V A;  5BOW A;  2M49 A;  2XOA A;  1JT3 A;  4I7I A;  5BXP A;  4QC4 A;  3OJ2 A;  3LLP A;  3BA5 A;  1A8D A;  1F31 A;  1VCL A;  3HBW A;  5JLV A;  5D63 A;  1ISW A;  1QXM A;  1RZO B;  3FJI A;  4OWL A;  3VSZ A;  2D44 A;  3WMU A;  3FUQ A;  3HAL A;  1K5V A;  1RML A;  3RTI B;  3FJE A;  4L4I A;  21BI A;  4ZBV B;  1JT4 A;  4MZH A;  3WO4 A;  3BRF A;  1DZC A;  1AVX B;  3JRR A;  1XZZ A;  3CQA A;  2VUA A;  3N7K A;  4LO8 B;  2ZQO A;  2VLC A;  1IRA X;  2D22 A;  3VUO A;  4ZA3 B;  2KI6 B;  4G9N A;  2K8R A;  4J2Y A;  5EC5 A;  3FJB A;  5FNX A;  4ZFU B;  1RY7 A;  2E4M A;  31BI A;  4I4O A;  2NP0 A;  1ISZ A;  1EV2 A;  2QN4 A;  2Y9F A;  4GOY A;  4OWJ A;  4LO7 C;  4II0 A;  5BXR A;  3PHZ A;  2DS0 A;  2NS2 A;  3V0B B;  1V6U A;  5BXS A;  4OEF A;  3O4A A;  4G6M A;  4F34 A;  1NZK A;  2D24 A;  3HN1 A;  1MC9 A;  2Q3N B;  4LO3 C;  4WBC A;  4GAF A;  1S0D A;  2P39 A;  3N7J A;  3N0K A;  4I37 A;  4PC4 A;  4D0Z A;  1FN0 A;  3QR5 A;  3P53 A;  5DZU A;  3CA0 A;  3BAV A;  3NJ5 A;  3A22 A;  3PG0 A;  3O4D A;  2P23 A;  4P6A A;  3Q7W A;  4I0Y A;  4IHZ A;  4I4V A;  1EYL A;  2BFH A;  1BAS A;  1EPW A;  1WBA A;  1S0G A;  2BEB A;  2HZ9 A;  3O4C A;  3O5W B;  1J0S A;  1IHK A;  3FJ9 A;  1DFC A;  1M2T B;  1YXW A;  3Q7Y A;  5HPZ A;  1PWA A;  1BFG A;  3T8S A;  7I1B A;  4MZF B;  1FMZ A;  1TIE A;  1YYN A;  1FWV A;  2DRE A;  1G82 A;  3BAU A;  1L2H A;  3OJM A;  3CRI A;  3P6J A;  4L4H A;  4P0L A;  3CA1 A;  1TTU A;  1AFC A;  4QBV A;  3BRD A;  3NBD A;  3BRG C;  1M16 A;  4OEE A;  1BFF A;  4I4X A;  3MAL A;  4DCK C;  4J2K A;  2D1Z A;  1G9C A;  4KBB A;  4H04 A;  4LO1 C;  1T4Q A;  1TWM A;  4A7Z A;  9ILB A;  4I1B A;  4LO2 A;  4IQP A;  3FUO A;  2AAI B;  3FGM A;  1IRP A;  3D7W B;  3MPP G;  1XG6 A;  1R8N A;  1T9F A;  1HWN B;  1BLA A;  1TWE A;  1ONK B;  1UPS A;  3NBC A;  2IHO A;  3OBR A;  4J23 B;  4X3A A;  3IM6 A;  1TOO A;  4QKR A;  4IZE A;  1KNM A;  1W3F A;  3RTJ B;  3BX1 C;  3AZV A;  4JAW A;  4IY9 A;  2NYY A;  5B2H A;  4LO0 C;  3QYD A;  4ION A;  1BFC A;  4I8M A;  4XKI A;  3W9T A;  4ISR A;  3A21 A;  2DRZ A;  1V6X A;  2F2F C;  3R4S A;  3FJH A;  3CRH A;  4I4S A;  4P0K A;  1QQL A;  1FMM S;  3N7M A;  5F8Y A;  2VU9 A;  4JP0 A;  3ZXD A;  1HWM B;  1PC8 B;  3BA7 A;  4IY8 A;  5BP5 C;  4G9M A;  3UJ4 A;  4A7Y A;  4KEJ A;  4I6I A;  4OWK A;  2FO1 A;  4ZOT A;  4ISQ A;  5DUY A;  2D20 A;  3AKI A;  4TLP A;  3OGG A;  1V6W A;  4HR6 C;  3WIN A;  1W3A A;  2K4A B;  3SNV A;  4J2S A;  1BAR A;  1S0L A;  1Z4S A;  2D7R A;  1DQO A;  1AVU A;  1AVA C;  1HCD A;  1CVS A;  1EVT A;  4YOL A;  1TP0 A;  1TFM B;  2FGF A;  4FGF A;  1ISY A;  1I1E A;  1HWP B;  4JRA A;  5EHA A;  3F1R A;  2ZQN A;  1IT0 A;  4JQ0 A;  4Q91 A;  4DEN A;  3F62 B;  2GZB A;  3A07 A;  3EF2 A;  1S0F A;  4JKQ A;  5BQU A;  5DVH A;  3ZXG A;  4Q9G A;  3KMV A;  3VT2 A;  2Q9X A;  4LO1 A;  1HCE A;  3AJ6 A;  3I2A A;  2VXR A;  3AJ5 A;  2Z48 A;  3ILA A;  3FJC A;  3FJF A;  2D23 A;  4QBC A;  3NBN A;  2KI4 A;  4Q9P A;  3C9Z A;  1JLX A;  2LIE A;  3AZW A;  2MIB A;  1HKN A;  4H75 A;  2X2T A;  3O4B A;  3O44 A;  3H6R A;  5BVP I;  1CE7 B;  2NZ9 A;  3O3Q A;  4DEP A;  1DJS B;  1OQL B;  3AH4 A;  2F8X C;  5FNW A;  1FV2 A;  3B9U A;  3CA3 A;  4I4Y A;  3BAD A;  2HWA A;  2Y9G A;  3A23 A;  1II4 A;  3UJ0 A;  1JQZ A;  4USP A;  3BAG A;  2HW9 A;  2ZR1 B;  1SZ6 B;  2AXM A;  3FFZ A;  4LO0 A;  5F90 A;  4ZGR B;  1YF8 B;  5JMC A;  4KEK A;  3V0A A;  3V79 C;  1HIB A;  2ERM A;  2F2F A;  3P6I A;  3FJ8 A;  4P0J A;  3AKH A;  3O49 A;  4CJM A;  2Y9X E;  4GP3 A;  2VSA A;  3UD7 A;  2GO2 A;  3RSJ A;  2KKI A;  1DIW A;  4HJJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...