5EHAA

Crystal structure of recombinant mtal at 1.35 angstrom resolution
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
153
structure length
153
Chain Sequence
ARKIPLDLPGTRILNGANWANNSATENLATNSGTLIIFDQSTPGQDADRWLIHNYLDGYKIFNMGSNNWASVSRGNTVLGVSEFDGQTCKWSIEYSGNGEEFWIRVPREGGGGAVWTIKPASSQGPTTVFLDLLKETDPNQRIKFAVENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase
molecule keywords Lectin-like fold protein
publication title Crystal structure of recombinant tyrosinase-binding protein MtaL at 1.35 angstrom resolution.
pubmed doi rcsb
source organism Agaricus bisporus
total genus 34
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-10-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 5ehaA00
2R9KB 1DFCA 4WBCA 3A21A 3OJVA 1TFMB 1TP0A 4A7YA 3TC2A 4G6JA 1RZOB 3NBEA 3AZVA 4JP0A 4QALA 2RG9B 2VXTI 2WBCA 4G6MA 1WD4A 4HA2A 4QC4A 4GP3A 4P0JA 2Z49A 5F8YA 3P6JA 6I1BA 3R4SA 4OEEA 3F1RA 2VSAA 1P63A 1IRAX 3AKIA 3N0KA 1Q1UA 3PHZA 4JKXB 1RG8A 1FN0A 5BXTA 2Y9FA 4OEGA 4I2SA 4OWJA 3FJDA 1PZZA 1DLLA 3FJCA 4USPA 3S8KA 1HIBA 4IY8A 2VSEA 3FJFA 3CU1B 1DJSB 3NBNA 1K5UA 3BA5A 1K5VA 1AVUA 2Q3NB 1JQZA 3Q7YA 4ISRA 4DEPA 3FJ9A 1W3AA 3MALA 4FVVA 3RTJB 1S0DA 4JKQA 1FWVA 3BAVA 1QQKA 1S0FA 3O49A 1HWNB 2AXMA 3JUTA 3BAGA 2GO2A 2BEBA 1YF8B 3BAHA 4J2YA 1FV2A 5JMCA 1HWPB 2HWAA 3POKA 3CA6A 3CA0A 2MC2A 3V0AA 4ZFUB 1L2HA 5F90A 1AXMA 3R4UA 4ISQA 2MLLB 4JRAA 3VSFA 3W9TA 1AVWB 2D23A 1S0EA 1G9BA 3RMYA 2DS0A 2Y9XE 3WO4A 5FZYA 4QBVA 3IM7A 2LIQA 3MPPG 1DZCA 4EB2B 3BA4A 4HJJA 4X3AA 3S8JA 4X38A 2VXRA 3FGMA 4LO8B 3O4CA 3I2AA 1PWAA 1HWOB 3O4BA 1M16A 5FZZA 4Q9GA 4I4XA 3I29B 2D20A 2KI6B 3BRFA 1EVTA 1AVXB 3V0AB 4USOA 2BFHA 1TTUA 1TWEA 5JLVA 3VWCA 1QXMA 3OBTA 4H9WA 2RQ9A 1JT3A 2ET2A 2ZR1B 3CA5A 3UD7A 3OJ2A 3WA1A 1EV2A 1HCEA 3N7KA 2ZQOA 1IOBA 3FJHA 4FGFA 1V6XA 4EKXB 1BARA 1IJTA 4IZXA 4AN6A 1FMMS 1MD6A 5G00A 1A8DA 3VT1A 5I1BA 1SZ6B 3ZC8A 1BFFA 1ISYA 4G9NA 1JY0A 5EC5A 3P6IA 2Z48A 1EYLA 1S0GA 2XOAA 1YTOA 3C9ZA 3H6QA 3VSZA 4LO3C 3CRHA 3ZX7A 3E8LC 4ZLBB 4LO3A 2VU9A 4YOLA 1BFCA 1SR4C 1S0LA 1HKNA 1N4KA 4OWLA 4KEKA 3VEQA 4D0ZA 4Z8SB 1SR4A 2J3PA 4IYBA 4LO0C 1W3GA 3PG0A 2YUGA 4LO0A 3CQAA 4IY9A 3RTIB 1IILA 2BEAA 3CAHA 4I1EA 3FJ8A 2F2FC 3OGFA 2Y9GA 3LLPA 3BTAA 4LO7C 5DVHA 2HZ9A 4JPZA 1JTCA 2F2FA 1FMZA 4L4IA 1I1EA 2D7IA 3AZWA 4Z9WB 3HOMA 4QBCA 3FUOA 3A22A 3FJEA 2F8XC 4I4YA 5D63A 2Y9WC 4J2XA 2X2TA 4OUJA 4OW4A 5DSSB 5E24E 4G9MA 4I7IA 3ZC9A 4QKRA 1XHBA 3IIRA 3RSJA 3UD8A 3AJ5A 4X37A 1QQLA 1WBCA 1F31A 2LIEA 3OJMA 3N7LA 1DQGA 1HCDA 3NBDA 2D22A 2VLCA 2WRYA 8I1BA 5BP5C 3UD9A 3ZXGA 3Q7WA 2D1ZA 3H6RA 1WBAA 5BP5A 3T8SA 2VUAA 4I4RA 2M49A 3F62B 1XZZA 4I96A 2X2SA 5BOWA 2I1BA 3O4OA 5EHAA 2MIBA 3LTQA 1CVSA 4J23B 3WO2A 1IRPA 3QYDA 1XYFA 1ILR1 3VT2A 4CJMA 2K4AB 3AKFA 4II0A 4L4HA 3A07A 2D43A 3FJAA 4X39A 3N7JA 1PC8B 4H04A 4DCKC 1J0SA 2FFUA 1BFBA 1YXWA 4IZEA 4I1BA 3ILAA 3HN1A 4ZFWB 3OBRA 3UJ0A 1T4QA 3UDAA 3V0BB 4QD2C 4ZOTA 1S0CA 3KMVA 1JLXA 1I1BA 3WINC 3IM5A 1ISWA 2K8RA 1AVAC 1YYNA 5D61A 3WINA 4I4OA 3IM6A 3RMXA 4J2SA 1IHKA 2KLLA 4F83A 3BA7A 2NZ9A 1KNMA 3I2XA 1DQOA 1IT0A 4I0YA 4XFTA 1Z0HA 3IAGC 4ZBVB 3NJ5A 4XFSA 1ISZA 1FWUA 4OEFA 2HW9A 2FGFA 3BAUA 4JQ0A 4GAIA 1BFGA 2D24A 4HR6C 3N7MA 3OGGA 4GOYA 1RMLA 3AKHA 4KEIA 4F34A 4IONA 4LO2C 3WO3A 1M2TB 3P53A 3FJBA 4OWKA 4D0TA 3CRGA 4ZA3B 4I6IA 3CA1A 4I4SA 3WMVA 2L5XA 1TOOA 4I3NA 4A7KA 1PUMB 1G9AA 1JT5A 1JLYA 2IWTB 3BX1C 5F8SA 3CA3A 2AAIB 5BXRA 4LO1C 1FGAA 1TIEA 1Q04A 4LO1A 1JT4A 31BIA 3BB2A 3D7WB 1BLDA 1NUNA 4R6UB 1DFQA 2UUSA 3EF2A 5FNWA 1R8OA 3PMEA 3PUBA 3HBWA 3B9UA 4G1RA 5F8WA 1ABRB 5BXPA 4EFQA 1ITBA 1W3FA 4EEEB 5BVPI 2FDBM 4I8MA 2AFGA 1T9FA 2P23A 1DIWA 4Q9PA 3FUQA 3QR5A 4D8HA 1MC9A 1V6WA 4XKIA 4LO7B 4QKSA 1GGPB 4ZKTB 1R8NA 4I4UA 3FFZA 1Z4SA 3O3QA 3O44A 41BIA 4KBBA 7I1BA 3CRIA 3V79C 4XFUA 3AKGA 1D0HA 1XG6A 2DRYA 4J2KA 4IQPA 1E0OA 4I4VA 1BASA 1UPSA 5DZUA 4IHZA 3NBCA 3AJ6A 4TLPA 3BAOA 4EFPA 1AF9A 4GAFA 2E4MC 2NYYA 3FJKA 1FQ9A 2GZBA 2D7RA 3A23A 3BAQA 2ERMA 1ISVA 2E4MA 1FV3A 3Q7XA 4I4PA 4ZFYB 1Z2VA 3AH4A 1G9DA 3FJJA 4P0LA 2QN4A 1G82A 3HMYA 4I4QA 4JAWA 1VCLA 1EPWA 2Q9XA 1II4A 2DREA 5BXSA 3WMUA 2DRZA 4AN7B 4Q91A 1ISXA 3H6RB 2AQZA 3AH2A 4P0KA 1HWMB 3HSMA 3K1XA 1BA7A 3AH1A 3O5WB 3O4DA 1DZDA 2RSTA 3CA4A 3VT0A 5FZUA 4EFRA 2ESUA 4KC3A 1ONKB 1OQLB 1TWMA 3BRDA 1JT7A 5DUYA 2QYIB 4ENDA 2ZQNA 4P6AA 5BQUC 3VUOA 2KI4A 21BIA 4ZGRB 3BADA 5BQUA 4PC4A 5FNXA 3BRGC 5D62A 1NZKA 2K43A 2FFVA 1WD3A 2NTDA 5EG6C 2NM1A 5B2HA 2NVHA 4I37A 2P39A 4DENA 2NP0A 4QD2B 4LO2A 1AFCA 2FO1A 2IHOA 4QO3A 3O4AA 1V6VA 3V0BA 1V6UA 1Q03A 1G9CA 1S0BA 1YBIA 3UJ4A 4A7ZA 2D44A 4GOVA 4KEJA 3H6SE 4GP0A 5GAQA 9ILBA 3HALA 3FJIA 2HWMA 2KH2A 5HPZA 2KKIA 3JRRA 1BLAA 3ZXDA 1PUUB 1CE7B 1RY7A 3SNVA
chains in the Genus database with same CATH superfamily
2R9KB 1DFCA 4WBCA 3A21A 3OJVA 1TFMB 1TP0A 4A7YA 3TC2A 4G6JA 1RZOB 3NBEA 3AZVA 4JP0A 4QALA 2RG9B 2VXTI 2WBCA 4G6MA 1WD4A 4HA2A 4QC4A 4GP3A 4P0JA 2NS2A 2Z49A 5F8YA 3P6JA 6I1BA 3R4SA 4OEEA 3F1RA 2VSAA 1P63A 1IRAX 3AKIA 3N0KA 1Q1UA 3PHZA 4JKXB 1RG8A 1FN0A 5BXTA 2Y9FA 4OEGA 4I2SA 4OWJA 3FJDA 1PZZA 1DLLA 3FJCA 4USPA 3S8KA 1HIBA 4IY8A 2VSEA 3FJFA 3CU1B 1DJSB 3NBNA 1K5UA 3BA5A 1K5VA 1AVUA 2Q3NB 1JQZA 3Q7YA 4ISRA 4DEPA 3FJ9A 1W3AA 3MALA 4FVVA 3RTJB 1S0DA 4JKQA 1FWVA 3BAVA 1QQKA 1S0FA 3O49A 1HWNB 2AXMA 3JUTA 3BAGA 2GO2A 2BEBA 1YF8B 3BAHA 4J2YA 1FV2A 5JMCA 1HWPB 2HWAA 3POKA 3CA6A 3CA0A 2MC2A 3V0AA 4ZFUB 1L2HA 5F90A 1AXMA 3R4UA 4ISQA 2MLLB 4JRAA 3VSFA 3W9TA 1AVWB 2D23A 1S0EA 1G9BA 3RMYA 2DS0A 2Y9XE 3WO4A 4MZHA 5FZYA 4QBVA 3IM7A 2LIQA 3MPPG 1DZCA 4EB2B 3BA4A 4HJJA 4X3AA 3S8JA 4X38A 2VXRA 3FGMA 4LO8B 3O4CA 3I2AA 1PWAA 1HWOB 3O4BA 1M16A 5FZZA 4Q9GA 4I4XA 3I29B 2D20A 2KI6B 3BRFA 1EVTA 1AVXB 3V0AB 4USOA 2BFHA 1TTUA 1TWEA 5JLVA 3VWCA 1QXMA 3OBTA 4H9WA 2RQ9A 1JT3A 2ET2A 2ZR1B 3CA5A 3UD7A 3OJ2A 3WA1A 1EV2A 1HCEA 3N7KA 2ZQOA 1IOBA 3FJHA 4FGFA 1V6XA 4EKXB 1BARA 1IJTA 4IZXA 4AN6A 1FMMS 1MD6A 5G00A 1A8DA 3VT1A 5I1BA 1SZ6B 3ZC8A 1BFFA 1ISYA 4G9NA 1JY0A 5EC5A 3P6IA 2Z48A 1EYLA 1S0GA 2XOAA 1YTOA 3C9ZA 3H6QA 3VSZA 4LO3C 3CRHA 3ZX7A 3E8LC 4ZLBB 4LO3A 2VU9A 4YOLA 1BFCA 1SR4C 1S0LA 1HKNA 1N4KA 4OWLA 4KEKA 3VEQA 4D0ZA 4Z8SB 1SR4A 2J3PA 4IYBA 4LO0C 1W3GA 3PG0A 2YUGA 4LO0A 3CQAA 4IY9A 3RTIB 1IILA 2BEAA 3CAHA 4I1EA 3FJ8A 2F2FC 3OGFA 2Y9GA 3LLPA 3BTAA 4LO7C 5DVHA 2HZ9A 4JPZA 1JTCA 2F2FA 1FMZA 4L4IA 1I1EA 2D7IA 3AZWA 4Z9WB 3HOMA 4QBCA 3FUOA 3A22A 3FJEA 2F8XC 4I4YA 5D63A 2Y9WC 4J2XA 2X2TA 4OUJA 4OW4A 5DSSB 5E24E 4G9MA 4I7IA 3ZC9A 4QKRA 1XHBA 3IIRA 3RSJA 3UD8A 3AJ5A 4X37A 1QQLA 1WBCA 1F31A 2LIEA 3OJMA 3N7LA 1DQGA 1HCDA 3NBDA 2D22A 2VLCA 2WRYA 8I1BA 5BP5C 3UD9A 3ZXGA 3Q7WA 2D1ZA 3H6RA 1WBAA 5BP5A 3T8SA 2VUAA 4I4RA 2M49A 3F62B 1XZZA 4I96A 2X2SA 5BOWA 2I1BA 3O4OA 5EHAA 2MIBA 3LTQA 1CVSA 4J23B 3WO2A 1IRPA 3QYDA 1XYFA 1ILR1 3VT2A 4CJMA 2K4AB 3AKFA 4II0A 4L4HA 3A07A 2D43A 3FJAA 4X39A 3N7JA 1PC8B 4UY4A 4H04A 4DCKC 1J0SA 2FFUA 1BFBA 1YXWA 4IZEA 4I1BA 3ILAA 3HN1A 4ZFWB 3OBRA 3UJ0A 1T4QA 3UDAA 3V0BB 4QD2C 4ZOTA 1S0CA 3KMVA 1JLXA 1I1BA 3WINC 3IM5A 1ISWA 2K8RA 1AVAC 1YYNA 5D61A 3WINA 4I4OA 3IM6A 3RMXA 4J2SA 1IHKA 2KLLA 4F83A 3BA7A 4MZFB 2NZ9A 1KNMA 3I2XA 1DQOA 1IT0A 4I0YA 4XFTA 1Z0HA 3IAGC 4ZBVB 3NJ5A 4XFSA 1ISZA 1FWUA 4OEFA 2HW9A 2FGFA 3BAUA 4JQ0A 4GAIA 1BFGA 2D24A 4HR6C 3N7MA 3OGGA 4GOYA 1RMLA 3AKHA 4KEIA 4F34A 4IONA 4LO2C 3WO3A 1M2TB 3P53A 3FJBA 4OWKA 4D0TA 3CRGA 4ZA3B 4I6IA 3CA1A 4I4SA 3WMVA 2L5XA 1TOOA 4I3NA 4A7KA 1PUMB 1G9AA 1JT5A 1JLYA 2IWTB 3BX1C 5F8SA 3CA3A 2AAIB 5BXRA 4LO1C 1FGAA 1TIEA 1Q04A 4LO1A 1JT4A 31BIA 3BB2A 3D7WB 1BLDA 1NUNA 4R6UB 1DFQA 2UUSA 3EF2A 5FNWA 1R8OA 3PMEA 3PUBA 3HBWA 3B9UA 4G1RA 5F8WA 1ABRB 5BXPA 4EFQA 1ITBA 1W3FA 4EEEB 5BVPI 2FDBM 4H75A 4I8MA 2AFGA 1T9FA 2P23A 1DIWA 4Q9PA 3FUQA 3QR5A 4D8HA 1MC9A 1V6WA 4XKIA 4LO7B 4QKSA 1GGPB 4ZKTB 1R8NA 4I4UA 3FFZA 1Z4SA 3O3QA 3O44A 41BIA 4KBBA 7I1BA 3CRIA 3V79C 4XFUA 3AKGA 1D0HA 1XG6A 2DRYA 4J2KA 4IQPA 1E0OA 4I4VA 1BASA 1UPSA 5DZUA 4IHZA 3NBCA 3AJ6A 4TLPA 3BAOA 4EFPA 1AF9A 4GAFA 2E4MC 2NYYA 3FJKA 1FQ9A 2GZBA 2D7RA 3A23A 3BAQA 2ERMA 1ISVA 2E4MA 1FV3A 3Q7XA 4I4PA 4ZFYB 1Z2VA 3AH4A 1G9DA 3FJJA 4P0LA 2QN4A 1G82A 3HMYA 4I4QA 4JAWA 1VCLA 1EPWA 2Q9XA 1II4A 2DREA 5BXSA 3WMUA 2DRZA 4AN7B 4Q91A 1ISXA 3H6RB 2AQZA 3AH2A 4P0KA 1HWMB 3HSMA 3K1XA 1BA7A 3AH1A 3O5WB 3O4DA 1DZDA 2RSTA 3CA4A 3VT0A 5FZUA 4EFRA 2ESUA 4KC3A 1ONKB 1OQLB 1TWMA 3BRDA 1JT7A 5DUYA 2QYIB 4MZGB 4ENDA 2ZQNA 4P6AA 5BQUC 3VUOA 2KI4A 21BIA 4ZGRB 3BADA 5BQUA 4PC4A 5FNXA 3BRGC 5D62A 1NZKA 2K43A 2FFVA 1WD3A 2NTDA 5EG6C 2NM1A 5B2HA 2NVHA 4I37A 2P39A 4DENA 2NP0A 4QD2B 4LO2A 1AFCA 2FO1A 2IHOA 4QO3A 3O4AA 1V6VA 3V0BA 1V6UA 1Q03A 1G9CA 1S0BA 1YBIA 3UJ4A 4A7ZA 2D44A 4GOVA 4KEJA 3H6SE 4GP0A 5GAQA 9ILBA 3HALA 3FJIA 2HWMA 2KH2A 5HPZA 2KKIA 3JRRA 1BLAA 3ZXDA 1PUUB 1CE7B 1RY7A 3SNVA
chains in the Genus database with same CATH topology
2R9KB 1DFCA 4WBCA 3A21A 3OJVA 1TFMB 1TP0A 4A7YA 3TC2A 4G6JA 1RZOB 3NBEA 3AZVA 4JP0A 4QALA 2RG9B 2VXTI 2WBCA 4G6MA 1WD4A 4HA2A 4QC4A 4GP3A 4P0JA 2NS2A 2Z49A 5F8YA 3P6JA 6I1BA 3R4SA 4OEEA 3F1RA 2VSAA 1P63A 1IRAX 3AKIA 3N0KA 1Q1UA 3PHZA 4JKXB 1RG8A 1FN0A 5BXTA 2Y9FA 4OEGA 4I2SA 4OWJA 3FJDA 1PZZA 1DLLA 3FJCA 4USPA 3S8KA 1HIBA 4IY8A 2VSEA 3FJFA 3CU1B 1DJSB 3NBNA 1K5UA 3BA5A 1K5VA 1AVUA 2Q3NB 1JQZA 3Q7YA 4ISRA 4DEPA 3FJ9A 1W3AA 3MALA 4FVVA 3RTJB 1S0DA 4JKQA 1FWVA 3BAVA 1QQKA 1S0FA 3O49A 1HWNB 2AXMA 3JUTA 3BAGA 2GO2A 2BEBA 1YF8B 3BAHA 4J2YA 1FV2A 5JMCA 1HWPB 2HWAA 3POKA 3CA6A 3CA0A 2MC2A 3V0AA 4ZFUB 1L2HA 5F90A 1AXMA 3R4UA 4ISQA 2MLLB 4JRAA 3VSFA 3W9TA 1AVWB 2D23A 1S0EA 1G9BA 3RMYA 2DS0A 2Y9XE 3WO4A 4MZHA 5FZYA 4QBVA 3IM7A 2LIQA 3MPPG 1DZCA 4EB2B 3BA4A 4HJJA 4X3AA 3S8JA 4X38A 2VXRA 3FGMA 4LO8B 3O4CA 3I2AA 1PWAA 1HWOB 3O4BA 1M16A 5FZZA 4Q9GA 4I4XA 3I29B 2D20A 2KI6B 3BRFA 1EVTA 1AVXB 3V0AB 4USOA 2BFHA 1TTUA 1TWEA 5JLVA 3VWCA 1QXMA 3OBTA 4H9WA 2RQ9A 1JT3A 2ET2A 2ZR1B 3CA5A 3UD7A 3OJ2A 3WA1A 1EV2A 1HCEA 3N7KA 2ZQOA 1IOBA 3FJHA 4FGFA 1V6XA 4EKXB 1BARA 1IJTA 4IZXA 4AN6A 1FMMS 1MD6A 5G00A 1A8DA 3VT1A 5I1BA 1SZ6B 3ZC8A 1BFFA 1ISYA 4G9NA 1JY0A 5EC5A 3P6IA 2Z48A 1EYLA 1S0GA 2XOAA 1YTOA 3C9ZA 3H6QA 3VSZA 4LO3C 3CRHA 3ZX7A 3E8LC 4ZLBB 4LO3A 2VU9A 4YOLA 1BFCA 1SR4C 1S0LA 1HKNA 1N4KA 4OWLA 4KEKA 3VEQA 4D0ZA 4Z8SB 1SR4A 2J3PA 4IYBA 4LO0C 1W3GA 3PG0A 2YUGA 4LO0A 3CQAA 4IY9A 3RTIB 1IILA 2BEAA 3CAHA 4I1EA 3FJ8A 2F2FC 3OGFA 2Y9GA 3LLPA 3BTAA 4LO7C 5DVHA 2HZ9A 4JPZA 1JTCA 2F2FA 1FMZA 4L4IA 1I1EA 2D7IA 3AZWA 4Z9WB 3HOMA 4QBCA 3FUOA 3A22A 3FJEA 2F8XC 4I4YA 5D63A 2Y9WC 4J2XA 2X2TA 4OUJA 4OW4A 5DSSB 5E24E 4G9MA 4I7IA 3ZC9A 4QKRA 1XHBA 3IIRA 3RSJA 3UD8A 3AJ5A 4X37A 1QQLA 1WBCA 1F31A 2LIEA 3OJMA 3N7LA 1DQGA 1HCDA 3NBDA 2D22A 2VLCA 2WRYA 8I1BA 5BP5C 3UD9A 3ZXGA 3Q7WA 2D1ZA 3H6RA 1WBAA 5BP5A 3T8SA 2VUAA 4I4RA 2M49A 3F62B 1XZZA 4I96A 2X2SA 5BOWA 2I1BA 3O4OA 5EHAA 2MIBA 3LTQA 1CVSA 4J23B 3WO2A 1IRPA 3QYDA 1XYFA 1ILR1 3VT2A 4CJMA 2K4AB 3AKFA 4II0A 4L4HA 3A07A 2D43A 3FJAA 4X39A 3N7JA 1PC8B 4UY4A 4H04A 4DCKC 1J0SA 2FFUA 1BFBA 1YXWA 4IZEA 4I1BA 3ILAA 3HN1A 4ZFWB 3OBRA 3UJ0A 1T4QA 3UDAA 3V0BB 4QD2C 4ZOTA 1S0CA 3KMVA 1JLXA 1I1BA 3WINC 3IM5A 1ISWA 2K8RA 1AVAC 1YYNA 5D61A 3WINA 4I4OA 3IM6A 3RMXA 4J2SA 1IHKA 2KLLA 4F83A 3BA7A 4MZFB 2NZ9A 1KNMA 3I2XA 1DQOA 1IT0A 4I0YA 4XFTA 1Z0HA 3IAGC 4ZBVB 3NJ5A 4XFSA 1ISZA 1FWUA 4OEFA 2HW9A 2FGFA 3BAUA 4JQ0A 4GAIA 1BFGA 2D24A 4HR6C 3N7MA 3OGGA 4GOYA 1RMLA 3AKHA 4KEIA 4F34A 4IONA 4LO2C 3WO3A 1M2TB 3P53A 3FJBA 4OWKA 4D0TA 3CRGA 4ZA3B 4I6IA 3CA1A 4I4SA 3WMVA 2L5XA 1TOOA 4I3NA 4A7KA 1PUMB 1G9AA 1JT5A 1JLYA 2IWTB 3BX1C 5F8SA 3CA3A 2AAIB 5BXRA 4LO1C 1FGAA 1TIEA 1Q04A 4LO1A 1JT4A 31BIA 3BB2A 3D7WB 1BLDA 1NUNA 4R6UB 1DFQA 2UUSA 3EF2A 5FNWA 1R8OA 3PMEA 3PUBA 3HBWA 3B9UA 4G1RA 5F8WA 1ABRB 5BXPA 4EFQA 1ITBA 1W3FA 4EEEB 5BVPI 2FDBM 4H75A 4I8MA 2AFGA 1T9FA 2P23A 1DIWA 4Q9PA 3FUQA 3QR5A 4D8HA 1MC9A 1V6WA 4XKIA 4LO7B 4QKSA 1GGPB 4ZKTB 1R8NA 4I4UA 3FFZA 1Z4SA 3O3QA 3O44A 41BIA 4KBBA 7I1BA 3CRIA 3V79C 4XFUA 3AKGA 1D0HA 1XG6A 2DRYA 4J2KA 4IQPA 1E0OA 4I4VA 1BASA 1UPSA 5DZUA 4IHZA 3NBCA 3AJ6A 4TLPA 3BAOA 4EFPA 1AF9A 4GAFA 2E4MC 2NYYA 3FJKA 1FQ9A 2GZBA 2D7RA 3A23A 3BAQA 2ERMA 1ISVA 2E4MA 1FV3A 3Q7XA 4I4PA 4ZFYB 1Z2VA 3AH4A 1G9DA 3FJJA 4P0LA 2QN4A 1G82A 3HMYA 4I4QA 4JAWA 1VCLA 1EPWA 2Q9XA 1II4A 2DREA 5BXSA 3WMUA 2DRZA 4AN7B 4Q91A 1ISXA 3H6RB 2AQZA 3AH2A 4P0KA 1HWMB 3HSMA 3K1XA 1BA7A 3AH1A 3O5WB 3O4DA 1DZDA 2RSTA 3CA4A 3VT0A 5FZUA 4EFRA 2ESUA 4KC3A 1ONKB 1OQLB 1TWMA 3BRDA 1JT7A 5DUYA 2QYIB 4MZGB 4ENDA 2ZQNA 4P6AA 5BQUC 3VUOA 2KI4A 21BIA 4ZGRB 3BADA 5BQUA 4PC4A 5FNXA 3BRGC 5D62A 1NZKA 2K43A 2FFVA 1WD3A 2NTDA 5EG6C 2NM1A 5B2HA 2NVHA 4I37A 2P39A 4DENA 2NP0A 4QD2B 4LO2A 1AFCA 2FO1A 2IHOA 4QO3A 3O4AA 1V6VA 3V0BA 1V6UA 1Q03A 1G9CA 1S0BA 1YBIA 3UJ4A 4A7ZA 2D44A 4GOVA 4KEJA 3H6SE 4GP0A 5GAQA 9ILBA 3HALA 3FJIA 2HWMA 2KH2A 5HPZA 2KKIA 3JRRA 1BLAA 3ZXDA 1PUUB 1CE7B 1RY7A 3SNVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R9K B;  1DFC A;  4WBC A;  3A21 A;  3OJV A;  1TFM B;  1TP0 A;  4A7Y A;  3TC2 A;  4G6J A;  1RZO B;  3NBE A;  3AZV A;  4JP0 A;  4QAL A;  2RG9 B;  2VXT I;  2WBC A;  4G6M A;  1WD4 A;  4HA2 A;  4QC4 A;  4GP3 A;  4P0J A;  2Z49 A;  5F8Y A;  3P6J A;  6I1B A;  3R4S A;  4OEE A;  3F1R A;  2VSA A;  1P63 A;  1IRA X;  3AKI A;  3N0K A;  1Q1U A;  3PHZ A;  4JKX B;  1RG8 A;  1FN0 A;  5BXT A;  2Y9F A;  4OEG A;  4I2S A;  4OWJ A;  3FJD A;  1PZZ A;  1DLL A;  3FJC A;  4USP A;  3S8K A;  1HIB A;  4IY8 A;  2VSE A;  3FJF A;  3CU1 B;  1DJS B;  3NBN A;  1K5U A;  3BA5 A;  1K5V A;  1AVU A;  2Q3N B;  1JQZ A;  3Q7Y A;  4ISR A;  4DEP A;  3FJ9 A;  1W3A A;  3MAL A;  4FVV A;  3RTJ B;  1S0D A;  4JKQ A;  1FWV A;  3BAV A;  1QQK A;  1S0F A;  3O49 A;  1HWN B;  2AXM A;  3JUT A;  3BAG A;  2GO2 A;  2BEB A;  1YF8 B;  3BAH A;  4J2Y A;  1FV2 A;  5JMC A;  1HWP B;  2HWA A;  3POK A;  3CA6 A;  3CA0 A;  2MC2 A;  3V0A A;  4ZFU B;  1L2H A;  5F90 A;  1AXM A;  3R4U A;  4ISQ A;  2MLL B;  4JRA A;  3VSF A;  3W9T A;  1AVW B;  2D23 A;  1S0E A;  1G9B A;  3RMY A;  2DS0 A;  2Y9X E;  3WO4 A;  5FZY A;  4QBV A;  3IM7 A;  2LIQ A;  3MPP G;  1DZC A;  4EB2 B;  3BA4 A;  4HJJ A;  4X3A A;  3S8J A;  4X38 A;  2VXR A;  3FGM A;  4LO8 B;  3O4C A;  3I2A A;  1PWA A;  1HWO B;  3O4B A;  1M16 A;  5FZZ A;  4Q9G A;  4I4X A;  3I29 B;  2D20 A;  2KI6 B;  3BRF A;  1EVT A;  1AVX B;  3V0A B;  4USO A;  2BFH A;  1TTU A;  1TWE A;  5JLV A;  3VWC A;  1QXM A;  3OBT A;  4H9W A;  2RQ9 A;  1JT3 A;  2ET2 A;  2ZR1 B;  3CA5 A;  3UD7 A;  3OJ2 A;  3WA1 A;  1EV2 A;  1HCE A;  3N7K A;  2ZQO A;  1IOB A;  3FJH A;  4FGF A;  1V6X A;  4EKX B;  1BAR A;  1IJT A;  4IZX A;  4AN6 A;  1FMM S;  1MD6 A;  5G00 A;  1A8D A;  3VT1 A;  5I1B A;  1SZ6 B;  3ZC8 A;  1BFF A;  1ISY A;  4G9N A;  1JY0 A;  5EC5 A;  3P6I A;  2Z48 A;  1EYL A;  1S0G A;  2XOA A;  1YTO A;  3C9Z A;  3H6Q A;  3VSZ A;  4LO3 C;  3CRH A;  3ZX7 A;  3E8L C;  4ZLB B;  4LO3 A;  2VU9 A;  4YOL A;  1BFC A;  1SR4 C;  1S0L A;  1HKN A;  1N4K A;  4OWL A;  4KEK A;  3VEQ A;  4D0Z A;  4Z8S B;  1SR4 A;  2J3P A;  4IYB A;  4LO0 C;  1W3G A;  3PG0 A;  2YUG A;  4LO0 A;  3CQA A;  4IY9 A;  3RTI B;  1IIL A;  2BEA A;  3CAH A;  4I1E A;  3FJ8 A;  2F2F C;  3OGF A;  2Y9G A;  3LLP A;  3BTA A;  4LO7 C;  5DVH A;  2HZ9 A;  4JPZ A;  1JTC A;  2F2F A;  1FMZ A;  4L4I A;  1I1E A;  2D7I A;  3AZW A;  4Z9W B;  3HOM A;  4QBC A;  3FUO A;  3A22 A;  3FJE A;  2F8X C;  4I4Y A;  5D63 A;  2Y9W C;  4J2X A;  2X2T A;  4OUJ A;  4OW4 A;  5DSS B;  5E24 E;  4G9M A;  4I7I A;  3ZC9 A;  4QKR A;  1XHB A;  3IIR A;  3RSJ A;  3UD8 A;  3AJ5 A;  4X37 A;  1QQL A;  1WBC A;  1F31 A;  2LIE A;  3OJM A;  3N7L A;  1DQG A;  1HCD A;  3NBD A;  2D22 A;  2VLC A;  2WRY A;  8I1B A;  5BP5 C;  3UD9 A;  3ZXG A;  3Q7W A;  2D1Z A;  3H6R A;  1WBA A;  5BP5 A;  3T8S A;  2VUA A;  4I4R A;  2M49 A;  3F62 B;  1XZZ A;  4I96 A;  2X2S A;  5BOW A;  2I1B A;  3O4O A;  5EHA A;  2MIB A;  3LTQ A;  1CVS A;  4J23 B;  3WO2 A;  1IRP A;  3QYD A;  1XYF A;  1ILR 1;  3VT2 A;  4CJM A;  2K4A B;  3AKF A;  4II0 A;  4L4H A;  3A07 A;  2D43 A;  3FJA A;  4X39 A;  3N7J A;  1PC8 B;  4H04 A;  4DCK C;  1J0S A;  2FFU A;  1BFB A;  1YXW A;  4IZE A;  4I1B A;  3ILA A;  3HN1 A;  4ZFW B;  3OBR A;  3UJ0 A;  1T4Q A;  3UDA A;  3V0B B;  4QD2 C;  4ZOT A;  1S0C A;  3KMV A;  1JLX A;  1I1B A;  3WIN C;  3IM5 A;  1ISW A;  2K8R A;  1AVA C;  1YYN A;  5D61 A;  3WIN A;  4I4O A;  3IM6 A;  3RMX A;  4J2S A;  1IHK A;  2KLL A;  4F83 A;  3BA7 A;  2NZ9 A;  1KNM A;  3I2X A;  1DQO A;  1IT0 A;  4I0Y A;  4XFT A;  1Z0H A;  3IAG C;  4ZBV B;  3NJ5 A;  4XFS A;  1ISZ A;  1FWU A;  4OEF A;  2HW9 A;  2FGF A;  3BAU A;  4JQ0 A;  4GAI A;  1BFG A;  2D24 A;  4HR6 C;  3N7M A;  3OGG A;  4GOY A;  1RML A;  3AKH A;  4KEI A;  4F34 A;  4ION A;  4LO2 C;  3WO3 A;  1M2T B;  3P53 A;  3FJB A;  4OWK A;  4D0T A;  3CRG A;  4ZA3 B;  4I6I A;  3CA1 A;  4I4S A;  3WMV A;  2L5X A;  1TOO A;  4I3N A;  4A7K A;  1PUM B;  1G9A A;  1JT5 A;  1JLY A;  2IWT B;  3BX1 C;  5F8S A;  3CA3 A;  2AAI B;  5BXR A;  4LO1 C;  1FGA A;  1TIE A;  1Q04 A;  4LO1 A;  1JT4 A;  31BI A;  3BB2 A;  3D7W B;  1BLD A;  1NUN A;  4R6U B;  1DFQ A;  2UUS A;  3EF2 A;  5FNW A;  1R8O A;  3PME A;  3PUB A;  3HBW A;  3B9U A;  4G1R A;  5F8W A;  1ABR B;  5BXP A;  4EFQ A;  1ITB A;  1W3F A;  4EEE B;  5BVP I;  2FDB M;  4I8M A;  2AFG A;  1T9F A;  2P23 A;  1DIW A;  4Q9P A;  3FUQ A;  3QR5 A;  4D8H A;  1MC9 A;  1V6W A;  4XKI A;  4LO7 B;  4QKS A;  1GGP B;  4ZKT B;  1R8N A;  4I4U A;  3FFZ A;  1Z4S A;  3O3Q A;  3O44 A;  41BI A;  4KBB A;  7I1B A;  3CRI A;  3V79 C;  4XFU A;  3AKG A;  1D0H A;  1XG6 A;  2DRY A;  4J2K A;  4IQP A;  1E0O A;  4I4V A;  1BAS A;  1UPS A;  5DZU A;  4IHZ A;  3NBC A;  3AJ6 A;  4TLP A;  3BAO A;  4EFP A;  1AF9 A;  4GAF A;  2E4M C;  2NYY A;  3FJK A;  1FQ9 A;  2GZB A;  2D7R A;  3A23 A;  3BAQ A;  2ERM A;  1ISV A;  2E4M A;  1FV3 A;  3Q7X A;  4I4P A;  4ZFY B;  1Z2V A;  3AH4 A;  1G9D A;  3FJJ A;  4P0L A;  2QN4 A;  1G82 A;  3HMY A;  4I4Q A;  4JAW A;  1VCL A;  1EPW A;  2Q9X A;  1II4 A;  2DRE A;  5BXS A;  3WMU A;  2DRZ A;  4AN7 B;  4Q91 A;  1ISX A;  3H6R B;  2AQZ A;  3AH2 A;  4P0K A;  1HWM B;  3HSM A;  3K1X A;  1BA7 A;  3AH1 A;  3O5W B;  3O4D A;  1DZD A;  2RST A;  3CA4 A;  3VT0 A;  5FZU A;  4EFR A;  2ESU A;  4KC3 A;  1ONK B;  1OQL B;  1TWM A;  3BRD A;  1JT7 A;  5DUY A;  2QYI B;  4END A;  2ZQN A;  4P6A A;  5BQU C;  3VUO A;  2KI4 A;  21BI A;  4ZGR B;  3BAD A;  5BQU A;  4PC4 A;  5FNX A;  3BRG C;  5D62 A;  1NZK A;  2K43 A;  2FFV A;  1WD3 A;  2NTD A;  5EG6 C;  2NM1 A;  5B2H A;  2NVH A;  4I37 A;  2P39 A;  4DEN A;  2NP0 A;  4QD2 B;  4LO2 A;  1AFC A;  2FO1 A;  2IHO A;  4QO3 A;  3O4A A;  1V6V A;  3V0B A;  1V6U A;  1Q03 A;  1G9C A;  1S0B A;  1YBI A;  3UJ4 A;  4A7Z A;  2D44 A;  4GOV A;  4KEJ A;  3H6S E;  4GP0 A;  5GAQ A;  9ILB A;  3HAL A;  3FJI A;  2HWM A;  2KH2 A;  5HPZ A;  2KKI A;  3JRR A;  1BLA A;  3ZXD A;  1PUU B;  1CE7 B;  1RY7 A;  3SNV A; 
#chains in the Genus database with same CATH topology
 2R9K B;  1DFC A;  4WBC A;  3A21 A;  3OJV A;  1TFM B;  1TP0 A;  4A7Y A;  3TC2 A;  4G6J A;  1RZO B;  3NBE A;  3AZV A;  4JP0 A;  4QAL A;  2RG9 B;  2VXT I;  2WBC A;  4G6M A;  1WD4 A;  4HA2 A;  4QC4 A;  4GP3 A;  4P0J A;  2NS2 A;  2Z49 A;  5F8Y A;  3P6J A;  6I1B A;  3R4S A;  4OEE A;  3F1R A;  2VSA A;  1P63 A;  1IRA X;  3AKI A;  3N0K A;  1Q1U A;  3PHZ A;  4JKX B;  1RG8 A;  1FN0 A;  5BXT A;  2Y9F A;  4OEG A;  4I2S A;  4OWJ A;  3FJD A;  1PZZ A;  1DLL A;  3FJC A;  4USP A;  3S8K A;  1HIB A;  4IY8 A;  2VSE A;  3FJF A;  3CU1 B;  1DJS B;  3NBN A;  1K5U A;  3BA5 A;  1K5V A;  1AVU A;  2Q3N B;  1JQZ A;  3Q7Y A;  4ISR A;  4DEP A;  3FJ9 A;  1W3A A;  3MAL A;  4FVV A;  3RTJ B;  1S0D A;  4JKQ A;  1FWV A;  3BAV A;  1QQK A;  1S0F A;  3O49 A;  1HWN B;  2AXM A;  3JUT A;  3BAG A;  2GO2 A;  2BEB A;  1YF8 B;  3BAH A;  4J2Y A;  1FV2 A;  5JMC A;  1HWP B;  2HWA A;  3POK A;  3CA6 A;  3CA0 A;  2MC2 A;  3V0A A;  4ZFU B;  1L2H A;  5F90 A;  1AXM A;  3R4U A;  4ISQ A;  2MLL B;  4JRA A;  3VSF A;  3W9T A;  1AVW B;  2D23 A;  1S0E A;  1G9B A;  3RMY A;  2DS0 A;  2Y9X E;  3WO4 A;  4MZH A;  5FZY A;  4QBV A;  3IM7 A;  2LIQ A;  3MPP G;  1DZC A;  4EB2 B;  3BA4 A;  4HJJ A;  4X3A A;  3S8J A;  4X38 A;  2VXR A;  3FGM A;  4LO8 B;  3O4C A;  3I2A A;  1PWA A;  1HWO B;  3O4B A;  1M16 A;  5FZZ A;  4Q9G A;  4I4X A;  3I29 B;  2D20 A;  2KI6 B;  3BRF A;  1EVT A;  1AVX B;  3V0A B;  4USO A;  2BFH A;  1TTU A;  1TWE A;  5JLV A;  3VWC A;  1QXM A;  3OBT A;  4H9W A;  2RQ9 A;  1JT3 A;  2ET2 A;  2ZR1 B;  3CA5 A;  3UD7 A;  3OJ2 A;  3WA1 A;  1EV2 A;  1HCE A;  3N7K A;  2ZQO A;  1IOB A;  3FJH A;  4FGF A;  1V6X A;  4EKX B;  1BAR A;  1IJT A;  4IZX A;  4AN6 A;  1FMM S;  1MD6 A;  5G00 A;  1A8D A;  3VT1 A;  5I1B A;  1SZ6 B;  3ZC8 A;  1BFF A;  1ISY A;  4G9N A;  1JY0 A;  5EC5 A;  3P6I A;  2Z48 A;  1EYL A;  1S0G A;  2XOA A;  1YTO A;  3C9Z A;  3H6Q A;  3VSZ A;  4LO3 C;  3CRH A;  3ZX7 A;  3E8L C;  4ZLB B;  4LO3 A;  2VU9 A;  4YOL A;  1BFC A;  1SR4 C;  1S0L A;  1HKN A;  1N4K A;  4OWL A;  4KEK A;  3VEQ A;  4D0Z A;  4Z8S B;  1SR4 A;  2J3P A;  4IYB A;  4LO0 C;  1W3G A;  3PG0 A;  2YUG A;  4LO0 A;  3CQA A;  4IY9 A;  3RTI B;  1IIL A;  2BEA A;  3CAH A;  4I1E A;  3FJ8 A;  2F2F C;  3OGF A;  2Y9G A;  3LLP A;  3BTA A;  4LO7 C;  5DVH A;  2HZ9 A;  4JPZ A;  1JTC A;  2F2F A;  1FMZ A;  4L4I A;  1I1E A;  2D7I A;  3AZW A;  4Z9W B;  3HOM A;  4QBC A;  3FUO A;  3A22 A;  3FJE A;  2F8X C;  4I4Y A;  5D63 A;  2Y9W C;  4J2X A;  2X2T A;  4OUJ A;  4OW4 A;  5DSS B;  5E24 E;  4G9M A;  4I7I A;  3ZC9 A;  4QKR A;  1XHB A;  3IIR A;  3RSJ A;  3UD8 A;  3AJ5 A;  4X37 A;  1QQL A;  1WBC A;  1F31 A;  2LIE A;  3OJM A;  3N7L A;  1DQG A;  1HCD A;  3NBD A;  2D22 A;  2VLC A;  2WRY A;  8I1B A;  5BP5 C;  3UD9 A;  3ZXG A;  3Q7W A;  2D1Z A;  3H6R A;  1WBA A;  5BP5 A;  3T8S A;  2VUA A;  4I4R A;  2M49 A;  3F62 B;  1XZZ A;  4I96 A;  2X2S A;  5BOW A;  2I1B A;  3O4O A;  5EHA A;  2MIB A;  3LTQ A;  1CVS A;  4J23 B;  3WO2 A;  1IRP A;  3QYD A;  1XYF A;  1ILR 1;  3VT2 A;  4CJM A;  2K4A B;  3AKF A;  4II0 A;  4L4H A;  3A07 A;  2D43 A;  3FJA A;  4X39 A;  3N7J A;  1PC8 B;  4UY4 A;  4H04 A;  4DCK C;  1J0S A;  2FFU A;  1BFB A;  1YXW A;  4IZE A;  4I1B A;  3ILA A;  3HN1 A;  4ZFW B;  3OBR A;  3UJ0 A;  1T4Q A;  3UDA A;  3V0B B;  4QD2 C;  4ZOT A;  1S0C A;  3KMV A;  1JLX A;  1I1B A;  3WIN C;  3IM5 A;  1ISW A;  2K8R A;  1AVA C;  1YYN A;  5D61 A;  3WIN A;  4I4O A;  3IM6 A;  3RMX A;  4J2S A;  1IHK A;  2KLL A;  4F83 A;  3BA7 A;  4MZF B;  2NZ9 A;  1KNM A;  3I2X A;  1DQO A;  1IT0 A;  4I0Y A;  4XFT A;  1Z0H A;  3IAG C;  4ZBV B;  3NJ5 A;  4XFS A;  1ISZ A;  1FWU A;  4OEF A;  2HW9 A;  2FGF A;  3BAU A;  4JQ0 A;  4GAI A;  1BFG A;  2D24 A;  4HR6 C;  3N7M A;  3OGG A;  4GOY A;  1RML A;  3AKH A;  4KEI A;  4F34 A;  4ION A;  4LO2 C;  3WO3 A;  1M2T B;  3P53 A;  3FJB A;  4OWK A;  4D0T A;  3CRG A;  4ZA3 B;  4I6I A;  3CA1 A;  4I4S A;  3WMV A;  2L5X A;  1TOO A;  4I3N A;  4A7K A;  1PUM B;  1G9A A;  1JT5 A;  1JLY A;  2IWT B;  3BX1 C;  5F8S A;  3CA3 A;  2AAI B;  5BXR A;  4LO1 C;  1FGA A;  1TIE A;  1Q04 A;  4LO1 A;  1JT4 A;  31BI A;  3BB2 A;  3D7W B;  1BLD A;  1NUN A;  4R6U B;  1DFQ A;  2UUS A;  3EF2 A;  5FNW A;  1R8O A;  3PME A;  3PUB A;  3HBW A;  3B9U A;  4G1R A;  5F8W A;  1ABR B;  5BXP A;  4EFQ A;  1ITB A;  1W3F A;  4EEE B;  5BVP I;  2FDB M;  4H75 A;  4I8M A;  2AFG A;  1T9F A;  2P23 A;  1DIW A;  4Q9P A;  3FUQ A;  3QR5 A;  4D8H A;  1MC9 A;  1V6W A;  4XKI A;  4LO7 B;  4QKS A;  1GGP B;  4ZKT B;  1R8N A;  4I4U A;  3FFZ A;  1Z4S A;  3O3Q A;  3O44 A;  41BI A;  4KBB A;  7I1B A;  3CRI A;  3V79 C;  4XFU A;  3AKG A;  1D0H A;  1XG6 A;  2DRY A;  4J2K A;  4IQP A;  1E0O A;  4I4V A;  1BAS A;  1UPS A;  5DZU A;  4IHZ A;  3NBC A;  3AJ6 A;  4TLP A;  3BAO A;  4EFP A;  1AF9 A;  4GAF A;  2E4M C;  2NYY A;  3FJK A;  1FQ9 A;  2GZB A;  2D7R A;  3A23 A;  3BAQ A;  2ERM A;  1ISV A;  2E4M A;  1FV3 A;  3Q7X A;  4I4P A;  4ZFY B;  1Z2V A;  3AH4 A;  1G9D A;  3FJJ A;  4P0L A;  2QN4 A;  1G82 A;  3HMY A;  4I4Q A;  4JAW A;  1VCL A;  1EPW A;  2Q9X A;  1II4 A;  2DRE A;  5BXS A;  3WMU A;  2DRZ A;  4AN7 B;  4Q91 A;  1ISX A;  3H6R B;  2AQZ A;  3AH2 A;  4P0K A;  1HWM B;  3HSM A;  3K1X A;  1BA7 A;  3AH1 A;  3O5W B;  3O4D A;  1DZD A;  2RST A;  3CA4 A;  3VT0 A;  5FZU A;  4EFR A;  2ESU A;  4KC3 A;  1ONK B;  1OQL B;  1TWM A;  3BRD A;  1JT7 A;  5DUY A;  2QYI B;  4MZG B;  4END A;  2ZQN A;  4P6A A;  5BQU C;  3VUO A;  2KI4 A;  21BI A;  4ZGR B;  3BAD A;  5BQU A;  4PC4 A;  5FNX A;  3BRG C;  5D62 A;  1NZK A;  2K43 A;  2FFV A;  1WD3 A;  2NTD A;  5EG6 C;  2NM1 A;  5B2H A;  2NVH A;  4I37 A;  2P39 A;  4DEN A;  2NP0 A;  4QD2 B;  4LO2 A;  1AFC A;  2FO1 A;  2IHO A;  4QO3 A;  3O4A A;  1V6V A;  3V0B A;  1V6U A;  1Q03 A;  1G9C A;  1S0B A;  1YBI A;  3UJ4 A;  4A7Z A;  2D44 A;  4GOV A;  4KEJ A;  3H6S E;  4GP0 A;  5GAQ A;  9ILB A;  3HAL A;  3FJI A;  2HWM A;  2KH2 A;  5HPZ A;  2KKI A;  3JRR A;  1BLA A;  3ZXD A;  1PUU B;  1CE7 B;  1RY7 A;  3SNV A; 
#chains in the Genus database with same CATH homology
 2R9K B;  1DFC A;  4WBC A;  3A21 A;  3OJV A;  1TFM B;  1TP0 A;  4A7Y A;  3TC2 A;  4G6J A;  1RZO B;  3NBE A;  3AZV A;  4JP0 A;  4QAL A;  2RG9 B;  2VXT I;  2WBC A;  4G6M A;  1WD4 A;  4HA2 A;  4QC4 A;  4GP3 A;  4P0J A;  2NS2 A;  2Z49 A;  5F8Y A;  3P6J A;  6I1B A;  3R4S A;  4OEE A;  3F1R A;  2VSA A;  1P63 A;  1IRA X;  3AKI A;  3N0K A;  1Q1U A;  3PHZ A;  4JKX B;  1RG8 A;  1FN0 A;  5BXT A;  2Y9F A;  4OEG A;  4I2S A;  4OWJ A;  3FJD A;  1PZZ A;  1DLL A;  3FJC A;  4USP A;  3S8K A;  1HIB A;  4IY8 A;  2VSE A;  3FJF A;  3CU1 B;  1DJS B;  3NBN A;  1K5U A;  3BA5 A;  1K5V A;  1AVU A;  2Q3N B;  1JQZ A;  3Q7Y A;  4ISR A;  4DEP A;  3FJ9 A;  1W3A A;  3MAL A;  4FVV A;  3RTJ B;  1S0D A;  4JKQ A;  1FWV A;  3BAV A;  1QQK A;  1S0F A;  3O49 A;  1HWN B;  2AXM A;  3JUT A;  3BAG A;  2GO2 A;  2BEB A;  1YF8 B;  3BAH A;  4J2Y A;  1FV2 A;  5JMC A;  1HWP B;  2HWA A;  3POK A;  3CA6 A;  3CA0 A;  2MC2 A;  3V0A A;  4ZFU B;  1L2H A;  5F90 A;  1AXM A;  3R4U A;  4ISQ A;  2MLL B;  4JRA A;  3VSF A;  3W9T A;  1AVW B;  2D23 A;  1S0E A;  1G9B A;  3RMY A;  2DS0 A;  2Y9X E;  3WO4 A;  4MZH A;  5FZY A;  4QBV A;  3IM7 A;  2LIQ A;  3MPP G;  1DZC A;  4EB2 B;  3BA4 A;  4HJJ A;  4X3A A;  3S8J A;  4X38 A;  2VXR A;  3FGM A;  4LO8 B;  3O4C A;  3I2A A;  1PWA A;  1HWO B;  3O4B A;  1M16 A;  5FZZ A;  4Q9G A;  4I4X A;  3I29 B;  2D20 A;  2KI6 B;  3BRF A;  1EVT A;  1AVX B;  3V0A B;  4USO A;  2BFH A;  1TTU A;  1TWE A;  5JLV A;  3VWC A;  1QXM A;  3OBT A;  4H9W A;  2RQ9 A;  1JT3 A;  2ET2 A;  2ZR1 B;  3CA5 A;  3UD7 A;  3OJ2 A;  3WA1 A;  1EV2 A;  1HCE A;  3N7K A;  2ZQO A;  1IOB A;  3FJH A;  4FGF A;  1V6X A;  4EKX B;  1BAR A;  1IJT A;  4IZX A;  4AN6 A;  1FMM S;  1MD6 A;  5G00 A;  1A8D A;  3VT1 A;  5I1B A;  1SZ6 B;  3ZC8 A;  1BFF A;  1ISY A;  4G9N A;  1JY0 A;  5EC5 A;  3P6I A;  2Z48 A;  1EYL A;  1S0G A;  2XOA A;  1YTO A;  3C9Z A;  3H6Q A;  3VSZ A;  4LO3 C;  3CRH A;  3ZX7 A;  3E8L C;  4ZLB B;  4LO3 A;  2VU9 A;  4YOL A;  1BFC A;  1SR4 C;  1S0L A;  1HKN A;  1N4K A;  4OWL A;  4KEK A;  3VEQ A;  4D0Z A;  4Z8S B;  1SR4 A;  2J3P A;  4IYB A;  4LO0 C;  1W3G A;  3PG0 A;  2YUG A;  4LO0 A;  3CQA A;  4IY9 A;  3RTI B;  1IIL A;  2BEA A;  3CAH A;  4I1E A;  3FJ8 A;  2F2F C;  3OGF A;  2Y9G A;  3LLP A;  3BTA A;  4LO7 C;  5DVH A;  2HZ9 A;  4JPZ A;  1JTC A;  2F2F A;  1FMZ A;  4L4I A;  1I1E A;  2D7I A;  3AZW A;  4Z9W B;  3HOM A;  4QBC A;  3FUO A;  3A22 A;  3FJE A;  2F8X C;  4I4Y A;  5D63 A;  2Y9W C;  4J2X A;  2X2T A;  4OUJ A;  4OW4 A;  5DSS B;  5E24 E;  4G9M A;  4I7I A;  3ZC9 A;  4QKR A;  1XHB A;  3IIR A;  3RSJ A;  3UD8 A;  3AJ5 A;  4X37 A;  1QQL A;  1WBC A;  1F31 A;  2LIE A;  3OJM A;  3N7L A;  1DQG A;  1HCD A;  3NBD A;  2D22 A;  2VLC A;  2WRY A;  8I1B A;  5BP5 C;  3UD9 A;  3ZXG A;  3Q7W A;  2D1Z A;  3H6R A;  1WBA A;  5BP5 A;  3T8S A;  2VUA A;  4I4R A;  2M49 A;  3F62 B;  1XZZ A;  4I96 A;  2X2S A;  5BOW A;  2I1B A;  3O4O A;  5EHA A;  2MIB A;  3LTQ A;  1CVS A;  4J23 B;  3WO2 A;  1IRP A;  3QYD A;  1XYF A;  1ILR 1;  3VT2 A;  4CJM A;  2K4A B;  3AKF A;  4II0 A;  4L4H A;  3A07 A;  2D43 A;  3FJA A;  4X39 A;  3N7J A;  1PC8 B;  4UY4 A;  4H04 A;  4DCK C;  1J0S A;  2FFU A;  1BFB A;  1YXW A;  4IZE A;  4I1B A;  3ILA A;  3HN1 A;  4ZFW B;  3OBR A;  3UJ0 A;  1T4Q A;  3UDA A;  3V0B B;  4QD2 C;  4ZOT A;  1S0C A;  3KMV A;  1JLX A;  1I1B A;  3WIN C;  3IM5 A;  1ISW A;  2K8R A;  1AVA C;  1YYN A;  5D61 A;  3WIN A;  4I4O A;  3IM6 A;  3RMX A;  4J2S A;  1IHK A;  2KLL A;  4F83 A;  3BA7 A;  4MZF B;  2NZ9 A;  1KNM A;  3I2X A;  1DQO A;  1IT0 A;  4I0Y A;  4XFT A;  1Z0H A;  3IAG C;  4ZBV B;  3NJ5 A;  4XFS A;  1ISZ A;  1FWU A;  4OEF A;  2HW9 A;  2FGF A;  3BAU A;  4JQ0 A;  4GAI A;  1BFG A;  2D24 A;  4HR6 C;  3N7M A;  3OGG A;  4GOY A;  1RML A;  3AKH A;  4KEI A;  4F34 A;  4ION A;  4LO2 C;  3WO3 A;  1M2T B;  3P53 A;  3FJB A;  4OWK A;  4D0T A;  3CRG A;  4ZA3 B;  4I6I A;  3CA1 A;  4I4S A;  3WMV A;  2L5X A;  1TOO A;  4I3N A;  4A7K A;  1PUM B;  1G9A A;  1JT5 A;  1JLY A;  2IWT B;  3BX1 C;  5F8S A;  3CA3 A;  2AAI B;  5BXR A;  4LO1 C;  1FGA A;  1TIE A;  1Q04 A;  4LO1 A;  1JT4 A;  31BI A;  3BB2 A;  3D7W B;  1BLD A;  1NUN A;  4R6U B;  1DFQ A;  2UUS A;  3EF2 A;  5FNW A;  1R8O A;  3PME A;  3PUB A;  3HBW A;  3B9U A;  4G1R A;  5F8W A;  1ABR B;  5BXP A;  4EFQ A;  1ITB A;  1W3F A;  4EEE B;  5BVP I;  2FDB M;  4H75 A;  4I8M A;  2AFG A;  1T9F A;  2P23 A;  1DIW A;  4Q9P A;  3FUQ A;  3QR5 A;  4D8H A;  1MC9 A;  1V6W A;  4XKI A;  4LO7 B;  4QKS A;  1GGP B;  4ZKT B;  1R8N A;  4I4U A;  3FFZ A;  1Z4S A;  3O3Q A;  3O44 A;  41BI A;  4KBB A;  7I1B A;  3CRI A;  3V79 C;  4XFU A;  3AKG A;  1D0H A;  1XG6 A;  2DRY A;  4J2K A;  4IQP A;  1E0O A;  4I4V A;  1BAS A;  1UPS A;  5DZU A;  4IHZ A;  3NBC A;  3AJ6 A;  4TLP A;  3BAO A;  4EFP A;  1AF9 A;  4GAF A;  2E4M C;  2NYY A;  3FJK A;  1FQ9 A;  2GZB A;  2D7R A;  3A23 A;  3BAQ A;  2ERM A;  1ISV A;  2E4M A;  1FV3 A;  3Q7X A;  4I4P A;  4ZFY B;  1Z2V A;  3AH4 A;  1G9D A;  3FJJ A;  4P0L A;  2QN4 A;  1G82 A;  3HMY A;  4I4Q A;  4JAW A;  1VCL A;  1EPW A;  2Q9X A;  1II4 A;  2DRE A;  5BXS A;  3WMU A;  2DRZ A;  4AN7 B;  4Q91 A;  1ISX A;  3H6R B;  2AQZ A;  3AH2 A;  4P0K A;  1HWM B;  3HSM A;  3K1X A;  1BA7 A;  3AH1 A;  3O5W B;  3O4D A;  1DZD A;  2RST A;  3CA4 A;  3VT0 A;  5FZU A;  4EFR A;  2ESU A;  4KC3 A;  1ONK B;  1OQL B;  1TWM A;  3BRD A;  1JT7 A;  5DUY A;  2QYI B;  4MZG B;  4END A;  2ZQN A;  4P6A A;  5BQU C;  3VUO A;  2KI4 A;  21BI A;  4ZGR B;  3BAD A;  5BQU A;  4PC4 A;  5FNX A;  3BRG C;  5D62 A;  1NZK A;  2K43 A;  2FFV A;  1WD3 A;  2NTD A;  5EG6 C;  2NM1 A;  5B2H A;  2NVH A;  4I37 A;  2P39 A;  4DEN A;  2NP0 A;  4QD2 B;  4LO2 A;  1AFC A;  2FO1 A;  2IHO A;  4QO3 A;  3O4A A;  1V6V A;  3V0B A;  1V6U A;  1Q03 A;  1G9C A;  1S0B A;  1YBI A;  3UJ4 A;  4A7Z A;  2D44 A;  4GOV A;  4KEJ A;  3H6S E;  4GP0 A;  5GAQ A;  9ILB A;  3HAL A;  3FJI A;  2HWM A;  2KH2 A;  5HPZ A;  2KKI A;  3JRR A;  1BLA A;  3ZXD A;  1PUU B;  1CE7 B;  1RY7 A;  3SNV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...