4USPA

X-ray structure of the dimeric ccl2 lectin in native form
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
135
structure length
135
Chain Sequence
LSAGNYIIYNRVLSPRGEKLALTYPGRQRTPVTVSPLDGSSEQAWILRSYDSNSNTWTISPVGSPNSQIGWGAGNVPVVLPPNNYVWTLTLTSGGYNIQDGKRTVSWSLNNATAGEEVSIGADATFSGRWVIEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCL2 LECTIN
publication title Dimerization of the fungal defense lectin CCL2 is essential for its toxicity against nematodes.
pubmed doi rcsb
source organism Coprinopsis cinerea
molecule tags Sugar binding protein
total genus 34
structure length 135
sequence length 135
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4uspA00
3BAVA 4I4OA 3HMYA 4YOLA 2FDBM 4G6JA 3FJKA 4LO2C 4GAFA 3PHZA 4I0YA 4EKXB 3FJHA 3UDAA 4OWJA 1TWMA 4GP0A 3D7WB 4JRAA 4OEEA 1BA7A 3BAHA 4I2SA 2KI4A 2HWAA 4DCKC 2Z48A 2MLLB 4IHZA 4OWLA 3C9ZA 3HALA 3W9TA 3BRFA 2FFUA 1FQ9A 3UJ4A 1BLDA 3FJBA 3S8KA 1YYNA 2VSEA 4J23B 3NBCA 3BRDA 5DUYA 1JLXA 3BAUA 3O4DA 2YUGA 3BA7A 3I2AA 1CVSA 5FNWA 4JAWA 4D0TA 2IHOA 4JKQA 4LO1A 1S0DA 3NBNA 1DIWA 1HCEA 2NP0A 1FN0A 1FMZA 1R8NA 4I7IA 3V0AB 4GOVA 4XFUA 4AN7B 4I4QA 5D61A 4D8HA 2KLLA 1J0SA 4I37A 1TWEA 1ONKB 3OGGA 1JT5A 3VWCA 3ILAA 3O4AA 3AKFA 1DQGA 2KI6B 5G00A 4I4YA 3WA1A 1P63A 2K8RA 3TC2A 3BAQA 2K4AB 4IONA 3H6RB 2VUAA 1BASA 4LO8B 2HW9A 1PZZA 5BVPI 2F2FA 3POKA 2J3PA 2VXRA 4LO0C 5FZYA 1M16A 2D44A 3BRGC 3FJEA 3IM6A 1EVTA 3EF2A 3FJJA 2NVHA 3R4UA 4OWKA 1YTOA 3V79C 4G9NA 1VCLA 3A21A 3VSFA 3O4OA 1DZDA 3PMEA 5BQUA 3ZC8A 1K5UA 1FV3A 2Q3NB 4OEFA 4ENDA 1PUMB 3RMXA 1AVWB 4GOYA 3CA1A 3RSJA 3O3QA 3FJ8A 4QBVA 1V6VA 4ZFYB 3O44A 2LIQA 3FJCA 1RY7A 1A8DA 4G9MA 5FNXA 3K1XA 3ZC9A 4QO3A 4DEPA 4KEIA 2FFVA 5D63A 1G9AA 2P39A 1IHKA 1WD3A 3I2XA 4GP3A 1TFMB 3FFZA 4LO7C 3AH4A 1S0BA 3VSZA 3B9UA 2BEBA 3HOMA 3A22A 3JUTA 2WRYA 3WMVA 2ZQOA 4ZLBB 4ZFUB 1RMLA 3AH1A 1S0FA 1IILA 1QQLA 4QC4A 2VLCA 3BB2A 2NM1A 3AKGA 4I96A 3QR5A 4X38A 5DZUA 3JRRA 5FZUA 1IT0A 3WINA 1I1EA 2UUSA 1V6UA 1S0CA 2M49A 3BAGA 4ZKTB 3AZWA 1KNMA 3UD7A 3HN1A 3BAOA 4I4PA 4X39A 1Z2VA 3NBDA 1I1BA 4I3NA 3VT0A 2D24A 1HWPB 4A7KA 1BFGA 5BXPA 4EB2B 4KEJA 3RTIB 4QBCA 3AJ5A 3N0KA 4OEGA 4OUJA 5F8WA 4ZGRB 4IYBA 4ZFWB 1AF9A 3CQAA 4XKIA 1FMMS 1SR4A 2I1BA 3LLPA 3P6JA 2QN4A 4PC4A 3FJDA 1BARA 4R6UB 5BOWA 1DFCA 3LTQA 1RZOB 1S0LA 1FWVA 4LO1C 4HA2A 2R9KB 3OBRA 2DRYA 1ABRB 3HBWA 2KH2A 2X2SA 3V0AA 1IOBA 3CRGA 1FWUA 1ISXA 4IY8A 3N7KA 1NZKA 1ILR1 4JP0A 3SNVA 2ZQNA 2NYYA 5HPZA 4A7YA 4USOA 4LO3A 2F8XC 1L2HA 2KKIA 4ZA3B 3CA6A 3VT1A 1E0OA 3O4CA 21BIA 1HWOB 3CA5A 1JLYA 4I4UA 3FUQA 4JKXB 4EEEB 4G6MA 3H6RA 3V0BB 2F2FC 1BLAA 4ISQA 1Q03A 3N7JA 1FGAA 2ERMA 5F8SA 3BTAA 3N7LA 4EFPA 4P0JA 1T4QA 4X3AA 3CA4A 1TOOA 3CU1B 1AVAC 1MD6A 2GZBA 3MALA 3H6SE 4HR6C 4J2KA 2QYIB 5BP5A 4I8MA 5BQUC 1AVUA 4KBBA 2NTDA 4XFSA 1F31A 4KEKA 9ILBA 4OW4A 4QD2C 4X37A 3RTJB 2L5XA 2Q9XA 4WBCA 2AXMA 2Y9WC 3OGFA 4DENA 3FJIA 3NBEA 4USPA 1GGPB 2E4MC 4ZBVB 5BXTA 2X2TA 2RSTA 3IM7A 3O4BA 3Q7WA 2FGFA 1WD4A 3Q7XA 2ET2A 5FZZA 2D22A 3N7MA 1TP0A 1S0GA 1YF8B 1Q1UA 1JY0A 4Z9WB 4D0ZA 4QD2B 2D1ZA 1W3GA 4FVVA 2RG9B 1Q04A 2HZ9A 3AH2A 3A23A 4IZEA 1RG8A 3IIRA 3KMVA 2D23A 3P6IA 3WINC 4ISRA 4JPZA 2NZ9A 2D20A 3AZVA 2BFHA 1D0HA 5GAQA 2D7IA 1TIEA 2DRZA 3OJ2A 3H6QA 3FUOA 6I1BA 4KC3A 4LO7B 3OBTA 1AVXB 3FJFA 2MIBA 4P0LA 1IJTA 1JT3A 3AKIA 8I1BA 3S8JA 1G82A 1SR4C 4F83A 3T8SA 1W3FA 1AFCA 3P53A 1QXMA 3HSMA 4I4XA 3BA4A 1MC9A 1PWAA 4LO2A 2DREA 1DQOA 2RQ9A 1FV2A 1EYLA 2VU9A 5EC5A 1HWNB 4J2XA 3VUOA 3UD8A 3O49A 2GO2A 3WO3A 2P23A 2AFGA 3VT2A 3CA3A 2D7RA 2LIEA 4HJJA 7I1BA 4LO3C 3VEQA 4TLPA 5EG6C 3ZX7A 3PG0A 3R4SA 3CRIA 1EV2A 1UPSA 2Y9FA 2VSAA 3FJ9A 4P0KA 3UJ0A 1DZCA 3FGMA 2AQZA 2D43A 4L4HA 4A7ZA 4II0A 1OQLB 1PUUB 4ZOTA 1ISVA 4GAIA 1G9DA 3ZXGA 4I1BA 1BFBA 4I4VA 3F1RA 1Z0HA 3Q7YA 5BXRA 3BADA 4H04A 4EFRA 5I1BA 3V0BA 1DLLA 3F62B 1XG6A 1R8OA 3CA0A 4XFTA 1BFFA 1XYFA 3I29B 3CAHA 4H9WA 3QYDA 4J2SA 2ESUA 4QALA 5F90A 4Q91A 2IWTB 3MPPG 1TTUA 1HKNA 5BP5C 4G1RA 1T9FA 1WBCA 3WO4A 4J2YA 1ISYA 4FGFA 3WO2A 4Z8SB 3OJVA 4QKRA 1ITBA 1DFQA 31BIA 5F8YA 4QKSA 2XOAA 4P6AA 1JT7A 1CE7B 2HWMA 2AAIB 3O5WB 3ZXDA 3OJMA 4Q9PA 1YXWA 1M2TB 4L4IA 4LO0A 2FO1A 1IRPA 3IM5A 3AJ6A 3WMUA 1EPWA 4I4RA 3RMYA 1SZ6B 2VXTI 3UD9A 4I6IA 3FJAA 1BFCA 3BA5A 1II4A 4AN6A 5D62A 2Z49A 3CRHA 4EFQA 1G9CA 1V6XA 1PC8B 4IQPA 1XHBA 2K43A 1QQKA 4I4SA 1S0EA 1ISWA 1JT4A 3E8LC 1N4KA 2Y9GA 5B2HA 4JQ0A 4I1EA 4F34A 5JMCA 2MC2A 3BX1C 1YBIA 3PUBA 41BIA 1XZZA 1JTCA 1DJSB 1WBAA 2E4MA 1AXMA 4Q9GA 1HIBA 1K5VA 1V6WA 2WBCA 2ZR1B 1HWMB 1ISZA 1W3AA 4IY9A 4CJMA 3IAGC 1JQZA 3AKHA 5JLVA 2BEAA 5DSSB 1NUNA 3A07A 1Z4SA 5DVHA 5EHAA 5BXSA 1HCDA 5E24E 2DS0A 2Y9XE 1G9BA 3NJ5A 1IRAX 4IZXA
chains in the Genus database with same CATH superfamily
3BAVA 4I4OA 3HMYA 4YOLA 2FDBM 4G6JA 3FJKA 4LO2C 4GAFA 3PHZA 4I0YA 4EKXB 3FJHA 3UDAA 4OWJA 1TWMA 4GP0A 3D7WB 4JRAA 4OEEA 1BA7A 3BAHA 4I2SA 2KI4A 2HWAA 4DCKC 2Z48A 2MLLB 4IHZA 4OWLA 3C9ZA 3HALA 3W9TA 3BRFA 2FFUA 1FQ9A 3UJ4A 1BLDA 3FJBA 3S8KA 1YYNA 2VSEA 4J23B 3NBCA 3BRDA 5DUYA 1JLXA 3BAUA 3O4DA 2YUGA 3BA7A 3I2AA 1CVSA 5FNWA 4JAWA 4D0TA 2IHOA 4JKQA 4LO1A 1S0DA 3NBNA 1DIWA 1HCEA 2NP0A 1FN0A 1FMZA 1R8NA 4I7IA 3V0AB 4GOVA 4XFUA 4AN7B 4I4QA 5D61A 4D8HA 2KLLA 1J0SA 4I37A 1TWEA 1ONKB 3OGGA 1JT5A 3VWCA 3ILAA 3O4AA 3AKFA 1DQGA 2KI6B 5G00A 4I4YA 3WA1A 1P63A 2K8RA 3TC2A 3BAQA 2K4AB 4IONA 3H6RB 2VUAA 1BASA 4LO8B 2HW9A 1PZZA 5BVPI 2F2FA 3POKA 2J3PA 2VXRA 4LO0C 5FZYA 1M16A 2D44A 3BRGC 3FJEA 3IM6A 1EVTA 3EF2A 3FJJA 2NVHA 3R4UA 4OWKA 1YTOA 3V79C 4G9NA 1VCLA 3A21A 3VSFA 3O4OA 1DZDA 3PMEA 5BQUA 3ZC8A 1K5UA 1FV3A 2Q3NB 4OEFA 4ENDA 1PUMB 3RMXA 1AVWB 4GOYA 3CA1A 3RSJA 3O3QA 3FJ8A 4QBVA 1V6VA 4ZFYB 3O44A 2LIQA 3FJCA 1RY7A 1A8DA 4G9MA 5FNXA 3K1XA 3ZC9A 4QO3A 4DEPA 4KEIA 2FFVA 5D63A 1G9AA 2P39A 1IHKA 1WD3A 3I2XA 4GP3A 1TFMB 3FFZA 4LO7C 3AH4A 1S0BA 3VSZA 3B9UA 2BEBA 3HOMA 3A22A 3JUTA 2WRYA 3WMVA 2ZQOA 4ZLBB 4ZFUB 1RMLA 3AH1A 1S0FA 1IILA 1QQLA 4QC4A 2VLCA 3BB2A 2NM1A 3AKGA 4I96A 3QR5A 4X38A 5DZUA 3JRRA 5FZUA 1IT0A 3WINA 1I1EA 2UUSA 1V6UA 1S0CA 2M49A 3BAGA 4ZKTB 3AZWA 1KNMA 3UD7A 3HN1A 3BAOA 4I4PA 4X39A 1Z2VA 3NBDA 1I1BA 4I3NA 3VT0A 2D24A 1HWPB 4A7KA 1BFGA 5BXPA 4EB2B 4KEJA 3RTIB 4QBCA 3AJ5A 3N0KA 4OEGA 4OUJA 5F8WA 4ZGRB 4IYBA 4ZFWB 1AF9A 3CQAA 4XKIA 1FMMS 1SR4A 2I1BA 3LLPA 3P6JA 2QN4A 4PC4A 4MZFB 3FJDA 1BARA 4R6UB 5BOWA 1DFCA 3LTQA 1RZOB 1S0LA 1FWVA 4LO1C 4HA2A 2R9KB 3OBRA 2DRYA 1ABRB 3HBWA 2KH2A 2X2SA 3V0AA 1IOBA 3CRGA 1FWUA 1ISXA 4IY8A 3N7KA 1NZKA 1ILR1 4JP0A 3SNVA 2ZQNA 2NYYA 5HPZA 4A7YA 4USOA 4LO3A 2F8XC 1L2HA 2KKIA 4ZA3B 3CA6A 3VT1A 1E0OA 3O4CA 21BIA 1HWOB 3CA5A 1JLYA 4I4UA 3FUQA 4JKXB 4EEEB 4G6MA 3H6RA 3V0BB 2F2FC 1BLAA 4ISQA 1Q03A 3N7JA 1FGAA 2ERMA 5F8SA 3BTAA 3N7LA 4EFPA 4P0JA 1T4QA 4X3AA 3CA4A 1TOOA 3CU1B 1AVAC 1MD6A 2GZBA 3MALA 3H6SE 4HR6C 4J2KA 2QYIB 5BP5A 4I8MA 4UY4A 5BQUC 1AVUA 4KBBA 2NTDA 4XFSA 1F31A 4KEKA 9ILBA 4OW4A 4QD2C 4X37A 3RTJB 2L5XA 2Q9XA 4WBCA 2AXMA 2Y9WC 3OGFA 4DENA 3FJIA 3NBEA 4USPA 1GGPB 2E4MC 4ZBVB 5BXTA 4H75A 2X2TA 2RSTA 3IM7A 3O4BA 3Q7WA 2FGFA 1WD4A 3Q7XA 2ET2A 5FZZA 2D22A 3N7MA 1TP0A 1S0GA 1YF8B 1Q1UA 1JY0A 4Z9WB 4D0ZA 4QD2B 2D1ZA 1W3GA 4FVVA 2RG9B 1Q04A 2HZ9A 3AH2A 3A23A 4IZEA 1RG8A 3IIRA 3KMVA 2D23A 3P6IA 3WINC 4ISRA 4JPZA 2NZ9A 2D20A 3AZVA 2BFHA 1D0HA 5GAQA 2D7IA 1TIEA 2DRZA 3OJ2A 3H6QA 3FUOA 6I1BA 4KC3A 4LO7B 3OBTA 1AVXB 3FJFA 2MIBA 4P0LA 1IJTA 1JT3A 3AKIA 8I1BA 3S8JA 1G82A 1SR4C 4F83A 3T8SA 1W3FA 1AFCA 3P53A 1QXMA 3HSMA 4I4XA 3BA4A 1MC9A 1PWAA 4LO2A 2DREA 1DQOA 2RQ9A 1FV2A 1EYLA 2VU9A 5EC5A 1HWNB 4J2XA 3VUOA 3UD8A 3O49A 2GO2A 3WO3A 2P23A 2AFGA 3VT2A 3CA3A 2D7RA 2LIEA 4HJJA 7I1BA 4LO3C 3VEQA 4TLPA 5EG6C 3ZX7A 3PG0A 3R4SA 3CRIA 1EV2A 1UPSA 2Y9FA 2VSAA 3FJ9A 4P0KA 3UJ0A 1DZCA 3FGMA 2AQZA 2D43A 4L4HA 4A7ZA 4II0A 1OQLB 1PUUB 4ZOTA 1ISVA 4GAIA 1G9DA 3ZXGA 4I1BA 1BFBA 4I4VA 3F1RA 1Z0HA 3Q7YA 5BXRA 3BADA 4H04A 4EFRA 5I1BA 3V0BA 1DLLA 3F62B 1XG6A 1R8OA 3CA0A 4XFTA 1BFFA 1XYFA 3I29B 3CAHA 4MZGB 4H9WA 3QYDA 4J2SA 2ESUA 4QALA 5F90A 4Q91A 2IWTB 3MPPG 1TTUA 1HKNA 5BP5C 4G1RA 1T9FA 1WBCA 3WO4A 4J2YA 1ISYA 4FGFA 3WO2A 4Z8SB 3OJVA 4QKRA 1ITBA 1DFQA 31BIA 5F8YA 4QKSA 2XOAA 4P6AA 1JT7A 1CE7B 2HWMA 2AAIB 3O5WB 3ZXDA 3OJMA 4Q9PA 1YXWA 1M2TB 4L4IA 4LO0A 2FO1A 1IRPA 3IM5A 3AJ6A 3WMUA 1EPWA 4I4RA 3RMYA 1SZ6B 2VXTI 3UD9A 4I6IA 3FJAA 1BFCA 3BA5A 1II4A 4AN6A 5D62A 2Z49A 3CRHA 4EFQA 1G9CA 1V6XA 1PC8B 4IQPA 1XHBA 2K43A 1QQKA 4I4SA 1S0EA 1ISWA 1JT4A 3E8LC 1N4KA 2Y9GA 5B2HA 4JQ0A 4I1EA 4F34A 5JMCA 2MC2A 3BX1C 1YBIA 2NS2A 3PUBA 1XZZA 41BIA 1JTCA 1DJSB 1WBAA 2E4MA 1AXMA 4Q9GA 1HIBA 1K5VA 1V6WA 2WBCA 2ZR1B 1HWMB 1ISZA 1W3AA 4IY9A 4CJMA 3IAGC 1JQZA 3AKHA 5JLVA 2BEAA 5DSSB 1NUNA 3A07A 1Z4SA 5DVHA 4MZHA 5EHAA 5BXSA 1HCDA 5E24E 2DS0A 2Y9XE 1G9BA 3NJ5A 1IRAX 4IZXA
chains in the Genus database with same CATH topology
3BAVA 4I4OA 3HMYA 4YOLA 2FDBM 4G6JA 3FJKA 4LO2C 4GAFA 3PHZA 4I0YA 4EKXB 3FJHA 3UDAA 4OWJA 1TWMA 4GP0A 3D7WB 4JRAA 4OEEA 1BA7A 3BAHA 4I2SA 2KI4A 2HWAA 4DCKC 2Z48A 2MLLB 4IHZA 4OWLA 3C9ZA 3HALA 3W9TA 3BRFA 2FFUA 1FQ9A 3UJ4A 1BLDA 3FJBA 3S8KA 1YYNA 2VSEA 4J23B 3NBCA 3BRDA 5DUYA 1JLXA 3BAUA 3O4DA 2YUGA 3BA7A 3I2AA 1CVSA 5FNWA 4JAWA 4D0TA 2IHOA 4JKQA 4LO1A 1S0DA 3NBNA 1DIWA 1HCEA 2NP0A 1FN0A 1FMZA 1R8NA 4I7IA 3V0AB 4GOVA 4XFUA 4AN7B 4I4QA 5D61A 4D8HA 2KLLA 1J0SA 4I37A 1TWEA 1ONKB 3OGGA 1JT5A 3VWCA 3ILAA 3O4AA 3AKFA 1DQGA 2KI6B 5G00A 4I4YA 3WA1A 1P63A 2K8RA 3TC2A 3BAQA 2K4AB 4IONA 3H6RB 2VUAA 1BASA 4LO8B 2HW9A 1PZZA 5BVPI 2F2FA 3POKA 2J3PA 2VXRA 4LO0C 5FZYA 1M16A 2D44A 3BRGC 3FJEA 3IM6A 1EVTA 3EF2A 3FJJA 2NVHA 3R4UA 4OWKA 1YTOA 3V79C 4G9NA 1VCLA 3A21A 3VSFA 3O4OA 1DZDA 3PMEA 5BQUA 3ZC8A 1K5UA 1FV3A 2Q3NB 4OEFA 4ENDA 1PUMB 3RMXA 1AVWB 4GOYA 3CA1A 3RSJA 3O3QA 3FJ8A 4QBVA 1V6VA 4ZFYB 3O44A 2LIQA 3FJCA 1RY7A 1A8DA 4G9MA 5FNXA 3K1XA 3ZC9A 4QO3A 4DEPA 4KEIA 2FFVA 5D63A 1G9AA 2P39A 1IHKA 1WD3A 3I2XA 4GP3A 1TFMB 3FFZA 4LO7C 3AH4A 1S0BA 3VSZA 3B9UA 2BEBA 3HOMA 3A22A 3JUTA 2WRYA 3WMVA 2ZQOA 4ZLBB 4ZFUB 1RMLA 3AH1A 1S0FA 1IILA 1QQLA 4QC4A 2VLCA 3BB2A 2NM1A 3AKGA 4I96A 3QR5A 4X38A 5DZUA 3JRRA 5FZUA 1IT0A 3WINA 1I1EA 2UUSA 1V6UA 1S0CA 2M49A 3BAGA 4ZKTB 3AZWA 1KNMA 3UD7A 3HN1A 3BAOA 4I4PA 4X39A 1Z2VA 3NBDA 1I1BA 4I3NA 3VT0A 2D24A 1HWPB 4A7KA 1BFGA 5BXPA 4EB2B 4KEJA 3RTIB 4QBCA 3AJ5A 3N0KA 4OEGA 4OUJA 5F8WA 4ZGRB 4IYBA 4ZFWB 1AF9A 3CQAA 4XKIA 1FMMS 1SR4A 2I1BA 3LLPA 3P6JA 2QN4A 4PC4A 4MZFB 3FJDA 1BARA 4R6UB 5BOWA 1DFCA 3LTQA 1RZOB 1S0LA 1FWVA 4LO1C 4HA2A 2R9KB 3OBRA 2DRYA 1ABRB 3HBWA 2KH2A 2X2SA 3V0AA 1IOBA 3CRGA 1FWUA 1ISXA 4IY8A 3N7KA 1NZKA 1ILR1 4JP0A 3SNVA 2ZQNA 2NYYA 5HPZA 4A7YA 4USOA 4LO3A 2F8XC 1L2HA 2KKIA 4ZA3B 3CA6A 3VT1A 1E0OA 3O4CA 21BIA 1HWOB 3CA5A 1JLYA 4I4UA 3FUQA 4JKXB 4EEEB 4G6MA 3H6RA 3V0BB 2F2FC 1BLAA 4ISQA 1Q03A 3N7JA 1FGAA 2ERMA 5F8SA 3BTAA 3N7LA 4EFPA 4P0JA 1T4QA 4X3AA 3CA4A 1TOOA 3CU1B 1AVAC 1MD6A 2GZBA 3MALA 3H6SE 4HR6C 4J2KA 2QYIB 5BP5A 4I8MA 4UY4A 5BQUC 1AVUA 4KBBA 2NTDA 4XFSA 1F31A 4KEKA 9ILBA 4OW4A 4QD2C 4X37A 3RTJB 2L5XA 2Q9XA 4WBCA 2AXMA 2Y9WC 3OGFA 4DENA 3FJIA 3NBEA 4USPA 1GGPB 2E4MC 4ZBVB 5BXTA 4H75A 2X2TA 2RSTA 3IM7A 3O4BA 3Q7WA 2FGFA 1WD4A 3Q7XA 2ET2A 5FZZA 2D22A 3N7MA 1TP0A 1S0GA 1YF8B 1Q1UA 1JY0A 4Z9WB 4D0ZA 4QD2B 2D1ZA 1W3GA 4FVVA 2RG9B 1Q04A 2HZ9A 3AH2A 3A23A 4IZEA 1RG8A 3IIRA 3KMVA 2D23A 3P6IA 3WINC 4ISRA 4JPZA 2NZ9A 2D20A 3AZVA 2BFHA 1D0HA 5GAQA 2D7IA 1TIEA 2DRZA 3OJ2A 3H6QA 3FUOA 6I1BA 4KC3A 4LO7B 3OBTA 1AVXB 3FJFA 2MIBA 4P0LA 1IJTA 1JT3A 3AKIA 8I1BA 3S8JA 1G82A 1SR4C 4F83A 3T8SA 1W3FA 1AFCA 3P53A 1QXMA 3HSMA 4I4XA 3BA4A 1MC9A 1PWAA 4LO2A 2DREA 1DQOA 2RQ9A 1FV2A 1EYLA 2VU9A 5EC5A 1HWNB 4J2XA 3VUOA 3UD8A 3O49A 2GO2A 3WO3A 2P23A 2AFGA 3VT2A 3CA3A 2D7RA 2LIEA 4HJJA 7I1BA 4LO3C 3VEQA 4TLPA 5EG6C 3ZX7A 3PG0A 3R4SA 3CRIA 1EV2A 1UPSA 2Y9FA 2VSAA 3FJ9A 4P0KA 3UJ0A 1DZCA 3FGMA 2AQZA 2D43A 4L4HA 4A7ZA 4II0A 1OQLB 1PUUB 4ZOTA 1ISVA 4GAIA 1G9DA 3ZXGA 4I1BA 1BFBA 4I4VA 3F1RA 1Z0HA 3Q7YA 5BXRA 3BADA 4H04A 4EFRA 5I1BA 3V0BA 1DLLA 3F62B 1XG6A 1R8OA 3CA0A 4XFTA 1BFFA 1XYFA 3I29B 3CAHA 4MZGB 4H9WA 3QYDA 4J2SA 2ESUA 4QALA 5F90A 4Q91A 2IWTB 3MPPG 1TTUA 1HKNA 5BP5C 4G1RA 1T9FA 1WBCA 3WO4A 4J2YA 1ISYA 4FGFA 3WO2A 4Z8SB 3OJVA 4QKRA 1ITBA 1DFQA 31BIA 5F8YA 4QKSA 2XOAA 4P6AA 1JT7A 1CE7B 2HWMA 2AAIB 3O5WB 3ZXDA 3OJMA 4Q9PA 1YXWA 1M2TB 4L4IA 4LO0A 2FO1A 1IRPA 3IM5A 3AJ6A 3WMUA 1EPWA 4I4RA 3RMYA 1SZ6B 2VXTI 3UD9A 4I6IA 3FJAA 1BFCA 3BA5A 1II4A 4AN6A 5D62A 2Z49A 3CRHA 4EFQA 1G9CA 1V6XA 1PC8B 4IQPA 1XHBA 2K43A 1QQKA 4I4SA 1S0EA 1ISWA 1JT4A 3E8LC 1N4KA 2Y9GA 5B2HA 4JQ0A 4I1EA 4F34A 5JMCA 2MC2A 3BX1C 1YBIA 2NS2A 3PUBA 1XZZA 41BIA 1JTCA 1DJSB 1WBAA 2E4MA 1AXMA 4Q9GA 1HIBA 1K5VA 1V6WA 2WBCA 2ZR1B 1HWMB 1ISZA 1W3AA 4IY9A 4CJMA 3IAGC 1JQZA 3AKHA 5JLVA 2BEAA 5DSSB 1NUNA 3A07A 1Z4SA 5DVHA 4MZHA 5EHAA 5BXSA 1HCDA 5E24E 2DS0A 2Y9XE 1G9BA 3NJ5A 1IRAX 4IZXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BAV A;  4I4O A;  3HMY A;  4YOL A;  2FDB M;  4G6J A;  3FJK A;  4LO2 C;  4GAF A;  3PHZ A;  4I0Y A;  4EKX B;  3FJH A;  3UDA A;  4OWJ A;  1TWM A;  4GP0 A;  3D7W B;  4JRA A;  4OEE A;  1BA7 A;  3BAH A;  4I2S A;  2KI4 A;  2HWA A;  4DCK C;  2Z48 A;  2MLL B;  4IHZ A;  4OWL A;  3C9Z A;  3HAL A;  3W9T A;  3BRF A;  2FFU A;  1FQ9 A;  3UJ4 A;  1BLD A;  3FJB A;  3S8K A;  1YYN A;  2VSE A;  4J23 B;  3NBC A;  3BRD A;  5DUY A;  1JLX A;  3BAU A;  3O4D A;  2YUG A;  3BA7 A;  3I2A A;  1CVS A;  5FNW A;  4JAW A;  4D0T A;  2IHO A;  4JKQ A;  4LO1 A;  1S0D A;  3NBN A;  1DIW A;  1HCE A;  2NP0 A;  1FN0 A;  1FMZ A;  1R8N A;  4I7I A;  3V0A B;  4GOV A;  4XFU A;  4AN7 B;  4I4Q A;  5D61 A;  4D8H A;  2KLL A;  1J0S A;  4I37 A;  1TWE A;  1ONK B;  3OGG A;  1JT5 A;  3VWC A;  3ILA A;  3O4A A;  3AKF A;  1DQG A;  2KI6 B;  5G00 A;  4I4Y A;  3WA1 A;  1P63 A;  2K8R A;  3TC2 A;  3BAQ A;  2K4A B;  4ION A;  3H6R B;  2VUA A;  1BAS A;  4LO8 B;  2HW9 A;  1PZZ A;  5BVP I;  2F2F A;  3POK A;  2J3P A;  2VXR A;  4LO0 C;  5FZY A;  1M16 A;  2D44 A;  3BRG C;  3FJE A;  3IM6 A;  1EVT A;  3EF2 A;  3FJJ A;  2NVH A;  3R4U A;  4OWK A;  1YTO A;  3V79 C;  4G9N A;  1VCL A;  3A21 A;  3VSF A;  3O4O A;  1DZD A;  3PME A;  5BQU A;  3ZC8 A;  1K5U A;  1FV3 A;  2Q3N B;  4OEF A;  4END A;  1PUM B;  3RMX A;  1AVW B;  4GOY A;  3CA1 A;  3RSJ A;  3O3Q A;  3FJ8 A;  4QBV A;  1V6V A;  4ZFY B;  3O44 A;  2LIQ A;  3FJC A;  1RY7 A;  1A8D A;  4G9M A;  5FNX A;  3K1X A;  3ZC9 A;  4QO3 A;  4DEP A;  4KEI A;  2FFV A;  5D63 A;  1G9A A;  2P39 A;  1IHK A;  1WD3 A;  3I2X A;  4GP3 A;  1TFM B;  3FFZ A;  4LO7 C;  3AH4 A;  1S0B A;  3VSZ A;  3B9U A;  2BEB A;  3HOM A;  3A22 A;  3JUT A;  2WRY A;  3WMV A;  2ZQO A;  4ZLB B;  4ZFU B;  1RML A;  3AH1 A;  1S0F A;  1IIL A;  1QQL A;  4QC4 A;  2VLC A;  3BB2 A;  2NM1 A;  3AKG A;  4I96 A;  3QR5 A;  4X38 A;  5DZU A;  3JRR A;  5FZU A;  1IT0 A;  3WIN A;  1I1E A;  2UUS A;  1V6U A;  1S0C A;  2M49 A;  3BAG A;  4ZKT B;  3AZW A;  1KNM A;  3UD7 A;  3HN1 A;  3BAO A;  4I4P A;  4X39 A;  1Z2V A;  3NBD A;  1I1B A;  4I3N A;  3VT0 A;  2D24 A;  1HWP B;  4A7K A;  1BFG A;  5BXP A;  4EB2 B;  4KEJ A;  3RTI B;  4QBC A;  3AJ5 A;  3N0K A;  4OEG A;  4OUJ A;  5F8W A;  4ZGR B;  4IYB A;  4ZFW B;  1AF9 A;  3CQA A;  4XKI A;  1FMM S;  1SR4 A;  2I1B A;  3LLP A;  3P6J A;  2QN4 A;  4PC4 A;  3FJD A;  1BAR A;  4R6U B;  5BOW A;  1DFC A;  3LTQ A;  1RZO B;  1S0L A;  1FWV A;  4LO1 C;  4HA2 A;  2R9K B;  3OBR A;  2DRY A;  1ABR B;  3HBW A;  2KH2 A;  2X2S A;  3V0A A;  1IOB A;  3CRG A;  1FWU A;  1ISX A;  4IY8 A;  3N7K A;  1NZK A;  1ILR 1;  4JP0 A;  3SNV A;  2ZQN A;  2NYY A;  5HPZ A;  4A7Y A;  4USO A;  4LO3 A;  2F8X C;  1L2H A;  2KKI A;  4ZA3 B;  3CA6 A;  3VT1 A;  1E0O A;  3O4C A;  21BI A;  1HWO B;  3CA5 A;  1JLY A;  4I4U A;  3FUQ A;  4JKX B;  4EEE B;  4G6M A;  3H6R A;  3V0B B;  2F2F C;  1BLA A;  4ISQ A;  1Q03 A;  3N7J A;  1FGA A;  2ERM A;  5F8S A;  3BTA A;  3N7L A;  4EFP A;  4P0J A;  1T4Q A;  4X3A A;  3CA4 A;  1TOO A;  3CU1 B;  1AVA C;  1MD6 A;  2GZB A;  3MAL A;  3H6S E;  4HR6 C;  4J2K A;  2QYI B;  5BP5 A;  4I8M A;  5BQU C;  1AVU A;  4KBB A;  2NTD A;  4XFS A;  1F31 A;  4KEK A;  9ILB A;  4OW4 A;  4QD2 C;  4X37 A;  3RTJ B;  2L5X A;  2Q9X A;  4WBC A;  2AXM A;  2Y9W C;  3OGF A;  4DEN A;  3FJI A;  3NBE A;  4USP A;  1GGP B;  2E4M C;  4ZBV B;  5BXT A;  2X2T A;  2RST A;  3IM7 A;  3O4B A;  3Q7W A;  2FGF A;  1WD4 A;  3Q7X A;  2ET2 A;  5FZZ A;  2D22 A;  3N7M A;  1TP0 A;  1S0G A;  1YF8 B;  1Q1U A;  1JY0 A;  4Z9W B;  4D0Z A;  4QD2 B;  2D1Z A;  1W3G A;  4FVV A;  2RG9 B;  1Q04 A;  2HZ9 A;  3AH2 A;  3A23 A;  4IZE A;  1RG8 A;  3IIR A;  3KMV A;  2D23 A;  3P6I A;  3WIN C;  4ISR A;  4JPZ A;  2NZ9 A;  2D20 A;  3AZV A;  2BFH A;  1D0H A;  5GAQ A;  2D7I A;  1TIE A;  2DRZ A;  3OJ2 A;  3H6Q A;  3FUO A;  6I1B A;  4KC3 A;  4LO7 B;  3OBT A;  1AVX B;  3FJF A;  2MIB A;  4P0L A;  1IJT A;  1JT3 A;  3AKI A;  8I1B A;  3S8J A;  1G82 A;  1SR4 C;  4F83 A;  3T8S A;  1W3F A;  1AFC A;  3P53 A;  1QXM A;  3HSM A;  4I4X A;  3BA4 A;  1MC9 A;  1PWA A;  4LO2 A;  2DRE A;  1DQO A;  2RQ9 A;  1FV2 A;  1EYL A;  2VU9 A;  5EC5 A;  1HWN B;  4J2X A;  3VUO A;  3UD8 A;  3O49 A;  2GO2 A;  3WO3 A;  2P23 A;  2AFG A;  3VT2 A;  3CA3 A;  2D7R A;  2LIE A;  4HJJ A;  7I1B A;  4LO3 C;  3VEQ A;  4TLP A;  5EG6 C;  3ZX7 A;  3PG0 A;  3R4S A;  3CRI A;  1EV2 A;  1UPS A;  2Y9F A;  2VSA A;  3FJ9 A;  4P0K A;  3UJ0 A;  1DZC A;  3FGM A;  2AQZ A;  2D43 A;  4L4H A;  4A7Z A;  4II0 A;  1OQL B;  1PUU B;  4ZOT A;  1ISV A;  4GAI A;  1G9D A;  3ZXG A;  4I1B A;  1BFB A;  4I4V A;  3F1R A;  1Z0H A;  3Q7Y A;  5BXR A;  3BAD A;  4H04 A;  4EFR A;  5I1B A;  3V0B A;  1DLL A;  3F62 B;  1XG6 A;  1R8O A;  3CA0 A;  4XFT A;  1BFF A;  1XYF A;  3I29 B;  3CAH A;  4H9W A;  3QYD A;  4J2S A;  2ESU A;  4QAL A;  5F90 A;  4Q91 A;  2IWT B;  3MPP G;  1TTU A;  1HKN A;  5BP5 C;  4G1R A;  1T9F A;  1WBC A;  3WO4 A;  4J2Y A;  1ISY A;  4FGF A;  3WO2 A;  4Z8S B;  3OJV A;  4QKR A;  1ITB A;  1DFQ A;  31BI A;  5F8Y A;  4QKS A;  2XOA A;  4P6A A;  1JT7 A;  1CE7 B;  2HWM A;  2AAI B;  3O5W B;  3ZXD A;  3OJM A;  4Q9P A;  1YXW A;  1M2T B;  4L4I A;  4LO0 A;  2FO1 A;  1IRP A;  3IM5 A;  3AJ6 A;  3WMU A;  1EPW A;  4I4R A;  3RMY A;  1SZ6 B;  2VXT I;  3UD9 A;  4I6I A;  3FJA A;  1BFC A;  3BA5 A;  1II4 A;  4AN6 A;  5D62 A;  2Z49 A;  3CRH A;  4EFQ A;  1G9C A;  1V6X A;  1PC8 B;  4IQP A;  1XHB A;  2K43 A;  1QQK A;  4I4S A;  1S0E A;  1ISW A;  1JT4 A;  3E8L C;  1N4K A;  2Y9G A;  5B2H A;  4JQ0 A;  4I1E A;  4F34 A;  5JMC A;  2MC2 A;  3BX1 C;  1YBI A;  3PUB A;  41BI A;  1XZZ A;  1JTC A;  1DJS B;  1WBA A;  2E4M A;  1AXM A;  4Q9G A;  1HIB A;  1K5V A;  1V6W A;  2WBC A;  2ZR1 B;  1HWM B;  1ISZ A;  1W3A A;  4IY9 A;  4CJM A;  3IAG C;  1JQZ A;  3AKH A;  5JLV A;  2BEA A;  5DSS B;  1NUN A;  3A07 A;  1Z4S A;  5DVH A;  5EHA A;  5BXS A;  1HCD A;  5E24 E;  2DS0 A;  2Y9X E;  1G9B A;  3NJ5 A;  1IRA X;  4IZX A; 
#chains in the Genus database with same CATH topology
 3BAV A;  4I4O A;  3HMY A;  4YOL A;  2FDB M;  4G6J A;  3FJK A;  4LO2 C;  4GAF A;  3PHZ A;  4I0Y A;  4EKX B;  3FJH A;  3UDA A;  4OWJ A;  1TWM A;  4GP0 A;  3D7W B;  4JRA A;  4OEE A;  1BA7 A;  3BAH A;  4I2S A;  2KI4 A;  2HWA A;  4DCK C;  2Z48 A;  2MLL B;  4IHZ A;  4OWL A;  3C9Z A;  3HAL A;  3W9T A;  3BRF A;  2FFU A;  1FQ9 A;  3UJ4 A;  1BLD A;  3FJB A;  3S8K A;  1YYN A;  2VSE A;  4J23 B;  3NBC A;  3BRD A;  5DUY A;  1JLX A;  3BAU A;  3O4D A;  2YUG A;  3BA7 A;  3I2A A;  1CVS A;  5FNW A;  4JAW A;  4D0T A;  2IHO A;  4JKQ A;  4LO1 A;  1S0D A;  3NBN A;  1DIW A;  1HCE A;  2NP0 A;  1FN0 A;  1FMZ A;  1R8N A;  4I7I A;  3V0A B;  4GOV A;  4XFU A;  4AN7 B;  4I4Q A;  5D61 A;  4D8H A;  2KLL A;  1J0S A;  4I37 A;  1TWE A;  1ONK B;  3OGG A;  1JT5 A;  3VWC A;  3ILA A;  3O4A A;  3AKF A;  1DQG A;  2KI6 B;  5G00 A;  4I4Y A;  3WA1 A;  1P63 A;  2K8R A;  3TC2 A;  3BAQ A;  2K4A B;  4ION A;  3H6R B;  2VUA A;  1BAS A;  4LO8 B;  2HW9 A;  1PZZ A;  5BVP I;  2F2F A;  3POK A;  2J3P A;  2VXR A;  4LO0 C;  5FZY A;  1M16 A;  2D44 A;  3BRG C;  3FJE A;  3IM6 A;  1EVT A;  3EF2 A;  3FJJ A;  2NVH A;  3R4U A;  4OWK A;  1YTO A;  3V79 C;  4G9N A;  1VCL A;  3A21 A;  3VSF A;  3O4O A;  1DZD A;  3PME A;  5BQU A;  3ZC8 A;  1K5U A;  1FV3 A;  2Q3N B;  4OEF A;  4END A;  1PUM B;  3RMX A;  1AVW B;  4GOY A;  3CA1 A;  3RSJ A;  3O3Q A;  3FJ8 A;  4QBV A;  1V6V A;  4ZFY B;  3O44 A;  2LIQ A;  3FJC A;  1RY7 A;  1A8D A;  4G9M A;  5FNX A;  3K1X A;  3ZC9 A;  4QO3 A;  4DEP A;  4KEI A;  2FFV A;  5D63 A;  1G9A A;  2P39 A;  1IHK A;  1WD3 A;  3I2X A;  4GP3 A;  1TFM B;  3FFZ A;  4LO7 C;  3AH4 A;  1S0B A;  3VSZ A;  3B9U A;  2BEB A;  3HOM A;  3A22 A;  3JUT A;  2WRY A;  3WMV A;  2ZQO A;  4ZLB B;  4ZFU B;  1RML A;  3AH1 A;  1S0F A;  1IIL A;  1QQL A;  4QC4 A;  2VLC A;  3BB2 A;  2NM1 A;  3AKG A;  4I96 A;  3QR5 A;  4X38 A;  5DZU A;  3JRR A;  5FZU A;  1IT0 A;  3WIN A;  1I1E A;  2UUS A;  1V6U A;  1S0C A;  2M49 A;  3BAG A;  4ZKT B;  3AZW A;  1KNM A;  3UD7 A;  3HN1 A;  3BAO A;  4I4P A;  4X39 A;  1Z2V A;  3NBD A;  1I1B A;  4I3N A;  3VT0 A;  2D24 A;  1HWP B;  4A7K A;  1BFG A;  5BXP A;  4EB2 B;  4KEJ A;  3RTI B;  4QBC A;  3AJ5 A;  3N0K A;  4OEG A;  4OUJ A;  5F8W A;  4ZGR B;  4IYB A;  4ZFW B;  1AF9 A;  3CQA A;  4XKI A;  1FMM S;  1SR4 A;  2I1B A;  3LLP A;  3P6J A;  2QN4 A;  4PC4 A;  4MZF B;  3FJD A;  1BAR A;  4R6U B;  5BOW A;  1DFC A;  3LTQ A;  1RZO B;  1S0L A;  1FWV A;  4LO1 C;  4HA2 A;  2R9K B;  3OBR A;  2DRY A;  1ABR B;  3HBW A;  2KH2 A;  2X2S A;  3V0A A;  1IOB A;  3CRG A;  1FWU A;  1ISX A;  4IY8 A;  3N7K A;  1NZK A;  1ILR 1;  4JP0 A;  3SNV A;  2ZQN A;  2NYY A;  5HPZ A;  4A7Y A;  4USO A;  4LO3 A;  2F8X C;  1L2H A;  2KKI A;  4ZA3 B;  3CA6 A;  3VT1 A;  1E0O A;  3O4C A;  21BI A;  1HWO B;  3CA5 A;  1JLY A;  4I4U A;  3FUQ A;  4JKX B;  4EEE B;  4G6M A;  3H6R A;  3V0B B;  2F2F C;  1BLA A;  4ISQ A;  1Q03 A;  3N7J A;  1FGA A;  2ERM A;  5F8S A;  3BTA A;  3N7L A;  4EFP A;  4P0J A;  1T4Q A;  4X3A A;  3CA4 A;  1TOO A;  3CU1 B;  1AVA C;  1MD6 A;  2GZB A;  3MAL A;  3H6S E;  4HR6 C;  4J2K A;  2QYI B;  5BP5 A;  4I8M A;  4UY4 A;  5BQU C;  1AVU A;  4KBB A;  2NTD A;  4XFS A;  1F31 A;  4KEK A;  9ILB A;  4OW4 A;  4QD2 C;  4X37 A;  3RTJ B;  2L5X A;  2Q9X A;  4WBC A;  2AXM A;  2Y9W C;  3OGF A;  4DEN A;  3FJI A;  3NBE A;  4USP A;  1GGP B;  2E4M C;  4ZBV B;  5BXT A;  4H75 A;  2X2T A;  2RST A;  3IM7 A;  3O4B A;  3Q7W A;  2FGF A;  1WD4 A;  3Q7X A;  2ET2 A;  5FZZ A;  2D22 A;  3N7M A;  1TP0 A;  1S0G A;  1YF8 B;  1Q1U A;  1JY0 A;  4Z9W B;  4D0Z A;  4QD2 B;  2D1Z A;  1W3G A;  4FVV A;  2RG9 B;  1Q04 A;  2HZ9 A;  3AH2 A;  3A23 A;  4IZE A;  1RG8 A;  3IIR A;  3KMV A;  2D23 A;  3P6I A;  3WIN C;  4ISR A;  4JPZ A;  2NZ9 A;  2D20 A;  3AZV A;  2BFH A;  1D0H A;  5GAQ A;  2D7I A;  1TIE A;  2DRZ A;  3OJ2 A;  3H6Q A;  3FUO A;  6I1B A;  4KC3 A;  4LO7 B;  3OBT A;  1AVX B;  3FJF A;  2MIB A;  4P0L A;  1IJT A;  1JT3 A;  3AKI A;  8I1B A;  3S8J A;  1G82 A;  1SR4 C;  4F83 A;  3T8S A;  1W3F A;  1AFC A;  3P53 A;  1QXM A;  3HSM A;  4I4X A;  3BA4 A;  1MC9 A;  1PWA A;  4LO2 A;  2DRE A;  1DQO A;  2RQ9 A;  1FV2 A;  1EYL A;  2VU9 A;  5EC5 A;  1HWN B;  4J2X A;  3VUO A;  3UD8 A;  3O49 A;  2GO2 A;  3WO3 A;  2P23 A;  2AFG A;  3VT2 A;  3CA3 A;  2D7R A;  2LIE A;  4HJJ A;  7I1B A;  4LO3 C;  3VEQ A;  4TLP A;  5EG6 C;  3ZX7 A;  3PG0 A;  3R4S A;  3CRI A;  1EV2 A;  1UPS A;  2Y9F A;  2VSA A;  3FJ9 A;  4P0K A;  3UJ0 A;  1DZC A;  3FGM A;  2AQZ A;  2D43 A;  4L4H A;  4A7Z A;  4II0 A;  1OQL B;  1PUU B;  4ZOT A;  1ISV A;  4GAI A;  1G9D A;  3ZXG A;  4I1B A;  1BFB A;  4I4V A;  3F1R A;  1Z0H A;  3Q7Y A;  5BXR A;  3BAD A;  4H04 A;  4EFR A;  5I1B A;  3V0B A;  1DLL A;  3F62 B;  1XG6 A;  1R8O A;  3CA0 A;  4XFT A;  1BFF A;  1XYF A;  3I29 B;  3CAH A;  4MZG B;  4H9W A;  3QYD A;  4J2S A;  2ESU A;  4QAL A;  5F90 A;  4Q91 A;  2IWT B;  3MPP G;  1TTU A;  1HKN A;  5BP5 C;  4G1R A;  1T9F A;  1WBC A;  3WO4 A;  4J2Y A;  1ISY A;  4FGF A;  3WO2 A;  4Z8S B;  3OJV A;  4QKR A;  1ITB A;  1DFQ A;  31BI A;  5F8Y A;  4QKS A;  2XOA A;  4P6A A;  1JT7 A;  1CE7 B;  2HWM A;  2AAI B;  3O5W B;  3ZXD A;  3OJM A;  4Q9P A;  1YXW A;  1M2T B;  4L4I A;  4LO0 A;  2FO1 A;  1IRP A;  3IM5 A;  3AJ6 A;  3WMU A;  1EPW A;  4I4R A;  3RMY A;  1SZ6 B;  2VXT I;  3UD9 A;  4I6I A;  3FJA A;  1BFC A;  3BA5 A;  1II4 A;  4AN6 A;  5D62 A;  2Z49 A;  3CRH A;  4EFQ A;  1G9C A;  1V6X A;  1PC8 B;  4IQP A;  1XHB A;  2K43 A;  1QQK A;  4I4S A;  1S0E A;  1ISW A;  1JT4 A;  3E8L C;  1N4K A;  2Y9G A;  5B2H A;  4JQ0 A;  4I1E A;  4F34 A;  5JMC A;  2MC2 A;  3BX1 C;  1YBI A;  2NS2 A;  3PUB A;  1XZZ A;  41BI A;  1JTC A;  1DJS B;  1WBA A;  2E4M A;  1AXM A;  4Q9G A;  1HIB A;  1K5V A;  1V6W A;  2WBC A;  2ZR1 B;  1HWM B;  1ISZ A;  1W3A A;  4IY9 A;  4CJM A;  3IAG C;  1JQZ A;  3AKH A;  5JLV A;  2BEA A;  5DSS B;  1NUN A;  3A07 A;  1Z4S A;  5DVH A;  4MZH A;  5EHA A;  5BXS A;  1HCD A;  5E24 E;  2DS0 A;  2Y9X E;  1G9B A;  3NJ5 A;  1IRA X;  4IZX A; 
#chains in the Genus database with same CATH homology
 3BAV A;  4I4O A;  3HMY A;  4YOL A;  2FDB M;  4G6J A;  3FJK A;  4LO2 C;  4GAF A;  3PHZ A;  4I0Y A;  4EKX B;  3FJH A;  3UDA A;  4OWJ A;  1TWM A;  4GP0 A;  3D7W B;  4JRA A;  4OEE A;  1BA7 A;  3BAH A;  4I2S A;  2KI4 A;  2HWA A;  4DCK C;  2Z48 A;  2MLL B;  4IHZ A;  4OWL A;  3C9Z A;  3HAL A;  3W9T A;  3BRF A;  2FFU A;  1FQ9 A;  3UJ4 A;  1BLD A;  3FJB A;  3S8K A;  1YYN A;  2VSE A;  4J23 B;  3NBC A;  3BRD A;  5DUY A;  1JLX A;  3BAU A;  3O4D A;  2YUG A;  3BA7 A;  3I2A A;  1CVS A;  5FNW A;  4JAW A;  4D0T A;  2IHO A;  4JKQ A;  4LO1 A;  1S0D A;  3NBN A;  1DIW A;  1HCE A;  2NP0 A;  1FN0 A;  1FMZ A;  1R8N A;  4I7I A;  3V0A B;  4GOV A;  4XFU A;  4AN7 B;  4I4Q A;  5D61 A;  4D8H A;  2KLL A;  1J0S A;  4I37 A;  1TWE A;  1ONK B;  3OGG A;  1JT5 A;  3VWC A;  3ILA A;  3O4A A;  3AKF A;  1DQG A;  2KI6 B;  5G00 A;  4I4Y A;  3WA1 A;  1P63 A;  2K8R A;  3TC2 A;  3BAQ A;  2K4A B;  4ION A;  3H6R B;  2VUA A;  1BAS A;  4LO8 B;  2HW9 A;  1PZZ A;  5BVP I;  2F2F A;  3POK A;  2J3P A;  2VXR A;  4LO0 C;  5FZY A;  1M16 A;  2D44 A;  3BRG C;  3FJE A;  3IM6 A;  1EVT A;  3EF2 A;  3FJJ A;  2NVH A;  3R4U A;  4OWK A;  1YTO A;  3V79 C;  4G9N A;  1VCL A;  3A21 A;  3VSF A;  3O4O A;  1DZD A;  3PME A;  5BQU A;  3ZC8 A;  1K5U A;  1FV3 A;  2Q3N B;  4OEF A;  4END A;  1PUM B;  3RMX A;  1AVW B;  4GOY A;  3CA1 A;  3RSJ A;  3O3Q A;  3FJ8 A;  4QBV A;  1V6V A;  4ZFY B;  3O44 A;  2LIQ A;  3FJC A;  1RY7 A;  1A8D A;  4G9M A;  5FNX A;  3K1X A;  3ZC9 A;  4QO3 A;  4DEP A;  4KEI A;  2FFV A;  5D63 A;  1G9A A;  2P39 A;  1IHK A;  1WD3 A;  3I2X A;  4GP3 A;  1TFM B;  3FFZ A;  4LO7 C;  3AH4 A;  1S0B A;  3VSZ A;  3B9U A;  2BEB A;  3HOM A;  3A22 A;  3JUT A;  2WRY A;  3WMV A;  2ZQO A;  4ZLB B;  4ZFU B;  1RML A;  3AH1 A;  1S0F A;  1IIL A;  1QQL A;  4QC4 A;  2VLC A;  3BB2 A;  2NM1 A;  3AKG A;  4I96 A;  3QR5 A;  4X38 A;  5DZU A;  3JRR A;  5FZU A;  1IT0 A;  3WIN A;  1I1E A;  2UUS A;  1V6U A;  1S0C A;  2M49 A;  3BAG A;  4ZKT B;  3AZW A;  1KNM A;  3UD7 A;  3HN1 A;  3BAO A;  4I4P A;  4X39 A;  1Z2V A;  3NBD A;  1I1B A;  4I3N A;  3VT0 A;  2D24 A;  1HWP B;  4A7K A;  1BFG A;  5BXP A;  4EB2 B;  4KEJ A;  3RTI B;  4QBC A;  3AJ5 A;  3N0K A;  4OEG A;  4OUJ A;  5F8W A;  4ZGR B;  4IYB A;  4ZFW B;  1AF9 A;  3CQA A;  4XKI A;  1FMM S;  1SR4 A;  2I1B A;  3LLP A;  3P6J A;  2QN4 A;  4PC4 A;  4MZF B;  3FJD A;  1BAR A;  4R6U B;  5BOW A;  1DFC A;  3LTQ A;  1RZO B;  1S0L A;  1FWV A;  4LO1 C;  4HA2 A;  2R9K B;  3OBR A;  2DRY A;  1ABR B;  3HBW A;  2KH2 A;  2X2S A;  3V0A A;  1IOB A;  3CRG A;  1FWU A;  1ISX A;  4IY8 A;  3N7K A;  1NZK A;  1ILR 1;  4JP0 A;  3SNV A;  2ZQN A;  2NYY A;  5HPZ A;  4A7Y A;  4USO A;  4LO3 A;  2F8X C;  1L2H A;  2KKI A;  4ZA3 B;  3CA6 A;  3VT1 A;  1E0O A;  3O4C A;  21BI A;  1HWO B;  3CA5 A;  1JLY A;  4I4U A;  3FUQ A;  4JKX B;  4EEE B;  4G6M A;  3H6R A;  3V0B B;  2F2F C;  1BLA A;  4ISQ A;  1Q03 A;  3N7J A;  1FGA A;  2ERM A;  5F8S A;  3BTA A;  3N7L A;  4EFP A;  4P0J A;  1T4Q A;  4X3A A;  3CA4 A;  1TOO A;  3CU1 B;  1AVA C;  1MD6 A;  2GZB A;  3MAL A;  3H6S E;  4HR6 C;  4J2K A;  2QYI B;  5BP5 A;  4I8M A;  4UY4 A;  5BQU C;  1AVU A;  4KBB A;  2NTD A;  4XFS A;  1F31 A;  4KEK A;  9ILB A;  4OW4 A;  4QD2 C;  4X37 A;  3RTJ B;  2L5X A;  2Q9X A;  4WBC A;  2AXM A;  2Y9W C;  3OGF A;  4DEN A;  3FJI A;  3NBE A;  4USP A;  1GGP B;  2E4M C;  4ZBV B;  5BXT A;  4H75 A;  2X2T A;  2RST A;  3IM7 A;  3O4B A;  3Q7W A;  2FGF A;  1WD4 A;  3Q7X A;  2ET2 A;  5FZZ A;  2D22 A;  3N7M A;  1TP0 A;  1S0G A;  1YF8 B;  1Q1U A;  1JY0 A;  4Z9W B;  4D0Z A;  4QD2 B;  2D1Z A;  1W3G A;  4FVV A;  2RG9 B;  1Q04 A;  2HZ9 A;  3AH2 A;  3A23 A;  4IZE A;  1RG8 A;  3IIR A;  3KMV A;  2D23 A;  3P6I A;  3WIN C;  4ISR A;  4JPZ A;  2NZ9 A;  2D20 A;  3AZV A;  2BFH A;  1D0H A;  5GAQ A;  2D7I A;  1TIE A;  2DRZ A;  3OJ2 A;  3H6Q A;  3FUO A;  6I1B A;  4KC3 A;  4LO7 B;  3OBT A;  1AVX B;  3FJF A;  2MIB A;  4P0L A;  1IJT A;  1JT3 A;  3AKI A;  8I1B A;  3S8J A;  1G82 A;  1SR4 C;  4F83 A;  3T8S A;  1W3F A;  1AFC A;  3P53 A;  1QXM A;  3HSM A;  4I4X A;  3BA4 A;  1MC9 A;  1PWA A;  4LO2 A;  2DRE A;  1DQO A;  2RQ9 A;  1FV2 A;  1EYL A;  2VU9 A;  5EC5 A;  1HWN B;  4J2X A;  3VUO A;  3UD8 A;  3O49 A;  2GO2 A;  3WO3 A;  2P23 A;  2AFG A;  3VT2 A;  3CA3 A;  2D7R A;  2LIE A;  4HJJ A;  7I1B A;  4LO3 C;  3VEQ A;  4TLP A;  5EG6 C;  3ZX7 A;  3PG0 A;  3R4S A;  3CRI A;  1EV2 A;  1UPS A;  2Y9F A;  2VSA A;  3FJ9 A;  4P0K A;  3UJ0 A;  1DZC A;  3FGM A;  2AQZ A;  2D43 A;  4L4H A;  4A7Z A;  4II0 A;  1OQL B;  1PUU B;  4ZOT A;  1ISV A;  4GAI A;  1G9D A;  3ZXG A;  4I1B A;  1BFB A;  4I4V A;  3F1R A;  1Z0H A;  3Q7Y A;  5BXR A;  3BAD A;  4H04 A;  4EFR A;  5I1B A;  3V0B A;  1DLL A;  3F62 B;  1XG6 A;  1R8O A;  3CA0 A;  4XFT A;  1BFF A;  1XYF A;  3I29 B;  3CAH A;  4MZG B;  4H9W A;  3QYD A;  4J2S A;  2ESU A;  4QAL A;  5F90 A;  4Q91 A;  2IWT B;  3MPP G;  1TTU A;  1HKN A;  5BP5 C;  4G1R A;  1T9F A;  1WBC A;  3WO4 A;  4J2Y A;  1ISY A;  4FGF A;  3WO2 A;  4Z8S B;  3OJV A;  4QKR A;  1ITB A;  1DFQ A;  31BI A;  5F8Y A;  4QKS A;  2XOA A;  4P6A A;  1JT7 A;  1CE7 B;  2HWM A;  2AAI B;  3O5W B;  3ZXD A;  3OJM A;  4Q9P A;  1YXW A;  1M2T B;  4L4I A;  4LO0 A;  2FO1 A;  1IRP A;  3IM5 A;  3AJ6 A;  3WMU A;  1EPW A;  4I4R A;  3RMY A;  1SZ6 B;  2VXT I;  3UD9 A;  4I6I A;  3FJA A;  1BFC A;  3BA5 A;  1II4 A;  4AN6 A;  5D62 A;  2Z49 A;  3CRH A;  4EFQ A;  1G9C A;  1V6X A;  1PC8 B;  4IQP A;  1XHB A;  2K43 A;  1QQK A;  4I4S A;  1S0E A;  1ISW A;  1JT4 A;  3E8L C;  1N4K A;  2Y9G A;  5B2H A;  4JQ0 A;  4I1E A;  4F34 A;  5JMC A;  2MC2 A;  3BX1 C;  1YBI A;  2NS2 A;  3PUB A;  1XZZ A;  41BI A;  1JTC A;  1DJS B;  1WBA A;  2E4M A;  1AXM A;  4Q9G A;  1HIB A;  1K5V A;  1V6W A;  2WBC A;  2ZR1 B;  1HWM B;  1ISZ A;  1W3A A;  4IY9 A;  4CJM A;  3IAG C;  1JQZ A;  3AKH A;  5JLV A;  2BEA A;  5DSS B;  1NUN A;  3A07 A;  1Z4S A;  5DVH A;  4MZH A;  5EHA A;  5BXS A;  1HCD A;  5E24 E;  2DS0 A;  2Y9X E;  1G9B A;  3NJ5 A;  1IRA X;  4IZX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...