4ZOTA

Crystal structure of bbki, a disulfide-free plasma kallikrein inhibitor at 1.4 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
163
structure length
163
Chain Sequence
b'SSVVVDTNGQPVSNGADAYYLVPVSHGHAGLALAKIGNEAEPRAVVLDPHHRPGLPVRFESPLRINIIKESYFLNIKFGPSSSDSGVWDVIQQDPIGLAVKVTDTKSLLGPFKVEKEGEGYKIVYYPERGQTGLDIGLVHRNDKYYLAVKDGEPCVFKIRKAT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Kunitz-type serine protease inhibitor BbKI
publication title Structure of BbKI, a disulfide-free plasma kallikrein inhibitor.
pubmed doi rcsb
source organism Bauhinia bauhinioides
molecule tags Protein binding
total genus 26
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zotA00
5HPZA 2MC2A 2K4AB 3VWCA 2UUSA 1BLDA 1IOBA 2M49A 3BA7A 4LO2A 4KBBA 5B2HA 3OGFA 4EFRA 31BIA 1XYFA 4ZOTA 1WBCA 2VU9A 3OJMA 1QQLA 4ZBVB 3ZC9A 4LO7C 5BP5C 3FJBA 4J2SA 4LO1C 2AXMA 3P6JA 4ISRA 1W3AA 3CU1B 3RTIB 4XKIA 2P23A 3V0BA 4JKQA 5E24E 2D22A 5DZUA 2D7IA 1S0DA 1PWAA 3HN1A 1FWVA 3EF2A 5FNXA 3IM7A 2L5XA 2BEAA 3BTAA 1NUNA 5BP5A 4USPA 4I1EA 3FGMA 4LO1A 1UPSA 1TWEA 3K1XA 3F62B 1ILR1 5FZYA 1AVAC 1I1EA 4GOVA 1BFFA 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1QQKA 3NBDA 3WO2A 4IZXA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1DQGA 4JKXB 3H6QA 4LO3A 2E4MC 3C9ZA 2K8RA 2HW9A 2VXRA 3Q7YA 3VT0A 1ISZA 4I8MA 4L4HA 4ZLBB 5JLVA 4LO0C 3BA5A 4OEEA 3FJ8A 1IRAX 4L4IA 3VEQA 3CRHA 5BOWA 1FV2A 2E4MA 5EC5A 1EV2A 1HCDA 3PMEA 1Z4SA 5BQUC 2DRZA 3PHZA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 1FV3A 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 2J3PA 4H9WA 3O4DA 4ZA3B 5F8WA 1VCLA 3I29B 1M2TB 4WBCA 5BQUA 2Y9GA 4KEJA 5BXPA 7I1BA 3A21A 3F1RA 1BFGA 3T8SA 3FJKA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1R8OA 4QKSA 4I4XA 4HJJA 2D7RA 3FJFA 4I4OA 4AN6A 4A7KA 3O4AA 4ZFWB 2MLLB 4OUJA 2HZ9A 1V6XA 3MALA 5BXRA 3CRIA 1TFMB 1DQOA 1NZKA 1IILA 1R8NA 2KH2A 4XFUA 3CA6A 3QR5A 1JLYA 2KI6B 3PG0A 1IT0A 2KI4A 3V0BB 3O4CA 1JLXA 3AJ6A 1AFCA 4I1BA 2RSTA 21BIA 2Y9FA 4FGFA 3UJ0A 3NBCA 2IWTB 2BEBA 5D63A 2NM1A 3FJCA 3AKFA 4ENDA 3HMYA 4G9NA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 4IZEA 1TOOA 2NYYA 1N4KA 4I7IA 1AVUA 3N0KA 3O44A 1WD4A 2KKIA 4QD2B 2GZBA 4XFTA 4I0YA 3HBWA 3H6SE 3O49A 4GOYA 4PC4A 4F83A 1HCEA 1ISYA 2ERMA 2HWAA 3OJ2A 4J2XA 1CVSA 4GAIA 4JQ0A 4ZKTB 5F8YA 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 3LTQA 3CRGA 4JPZA 3O4OA 1PUMB 3NJ5A 1M16A 2VLCA 1EVTA 4EFPA 4GAFA 3CA4A 5DVHA 4P0JA 2WRYA 3MPPG 3H6RB 1SR4C 4I2SA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1SZ6B 3FUOA 2Q9XA 4JRAA 3Q7WA 2VUAA 1W3GA 3NBEA 5DUYA 2Y9XE 2GO2A 3N7MA 2F2FC 2Z48A 3BRGC 2X2TA 2DREA 1HWOB 3AJ5A 4I4QA 1SR4A 4HA2A 1BASA 3O4BA 4I4SA 4XFSA 4TLPA 3P6IA 1TIEA 4EFQA 2D1ZA 3LLPA 1DZDA 2QN4A 3A22A 1J0SA 3POKA 2FGFA 2F2FA 4LO8B 5GAQA 4IQPA 4QALA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 1S0BA 1G9AA 2D23A 1FMMS 2NVHA 4G9MA 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1BLAA 2Y9WC 4USOA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 2KLLA 1RZOB 2AFGA 4JAWA 1JT7A 2NZ9A 1FMZA 4P0LA 1S0FA 3V0AB 3SNVA 3CQAA 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4X37A 1RMLA 3S8JA 3FJDA 5G00A 3WA1A 1DZCA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 3UD8A 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1KNMA 3OBTA 3CA5A 5I1BA 2R9KB 5DSSB 4FVVA 1FGAA 3O5WB 5FZZA 3WINA 4ISQA 1W3FA 4Q91A 2QYIB 1D0HA 1DLLA 4KEKA 4G6JA 1YBIA 1TTUA 2D20A 4I4YA 1QXMA 3A23A 5D61A 3UD9A 3AH2A 4AN7B 2Z49A 5JMCA 2RQ9A 2LIQA 1EYLA 4Z8SB 3FJHA 1HWMB 3RTJB 1Q1UA 4IY9A 2D24A 3FJEA 4CJMA 4R6UB 4I4UA 5BVPI 3OJVA 1WD3A 4JP0A 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 2AQZA 2NTDA 4J2YA 2ZQNA 1V6WA 3P53A 4LO7B 1WBAA 3H6RA 3WMUA 2D44A 4LO3C 1JQZA 3OGGA 1G82A 3AZVA 1RY7A 1GGPB 1FQ9A 1E0OA 2FFVA 3D7WB 3BA4A 1TP0A 1P63A 3VSFA 5D62A 2RG9B 1JT5A 41BIA 2DRYA 1HWPB 2YUGA 3BAQA 3FFZA 3B9UA 2WBCA 3FJJA 4J23B 3BADA 3HSMA 3FJIA 1HWNB 3RSJA 3N7KA 4IY8A 2FFUA 3W9TA 1I1BA 4OWJA 4IONA 3RMXA 1XG6A 3CA1A 3E8LC 3QYDA 1BFBA 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4D0TA 4QBCA 3AH4A 2IHOA 4I6IA 1DFCA 4D0ZA 1S0GA 2HWMA 1Z2VA 3IM5A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 3BAOA 1F31A 4ZFUB 1AF9A 4H04A 1IRPA 1BFCA 1DJSB 1EPWA 3PUBA 1MC9A 4A7YA 1AVWB 2VSEA 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 4OEFA 1ISVA 3V0AA 3WO3A 3BRDA 3R4UA 1CE7B 3UD7A 4OEGA 3BX1C 2K43A 3AH1A 4I4RA 1S0EA 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 1G9CA 3BRFA 4GP3A 5BXSA 1IHKA 4EEEB 4LO2C 1AXMA 4ZGRB 2ZQOA 1ONKB 1S0CA 2FDBM 2Q3NB 1ITBA 4IHZA 5EHAA 1K5VA 3NBNA 3VT1A 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH superfamily
5HPZA 2MC2A 2K4AB 3VWCA 2UUSA 1BLDA 1IOBA 2M49A 3BA7A 4LO2A 4KBBA 5B2HA 3OGFA 4EFRA 31BIA 1XYFA 4ZOTA 1WBCA 2VU9A 3OJMA 1QQLA 4ZBVB 3ZC9A 4LO7C 5BP5C 3FJBA 4J2SA 4LO1C 2AXMA 3P6JA 4ISRA 1W3AA 3CU1B 3RTIB 4XKIA 2P23A 3V0BA 4JKQA 5E24E 2D22A 5DZUA 2D7IA 1S0DA 1PWAA 3HN1A 1FWVA 3EF2A 5FNXA 3IM7A 2L5XA 2BEAA 3BTAA 1NUNA 5BP5A 4USPA 4I1EA 3FGMA 4LO1A 1UPSA 1TWEA 3K1XA 3F62B 1ILR1 5FZYA 1AVAC 1I1EA 4GOVA 1BFFA 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1QQKA 3NBDA 3WO2A 4IZXA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1DQGA 4JKXB 3H6QA 4LO3A 2E4MC 3C9ZA 2K8RA 2HW9A 2VXRA 3Q7YA 3VT0A 1ISZA 4I8MA 4L4HA 4ZLBB 5JLVA 4LO0C 3BA5A 4OEEA 3FJ8A 1IRAX 4L4IA 3VEQA 3CRHA 5BOWA 2NS2A 1FV2A 2E4MA 5EC5A 1EV2A 1HCDA 3PMEA 1Z4SA 5BQUC 2DRZA 3PHZA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 1FV3A 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 2J3PA 4H9WA 3O4DA 4ZA3B 5F8WA 1VCLA 3I29B 1M2TB 4WBCA 5BQUA 2Y9GA 4KEJA 5BXPA 7I1BA 3A21A 3F1RA 1BFGA 3T8SA 3FJKA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1R8OA 4QKSA 4I4XA 4HJJA 2D7RA 3FJFA 4I4OA 4AN6A 4A7KA 3O4AA 4ZFWB 2MLLB 4OUJA 2HZ9A 1V6XA 3MALA 5BXRA 3CRIA 1TFMB 1DQOA 1NZKA 1IILA 1R8NA 2KH2A 4XFUA 3CA6A 3QR5A 1JLYA 2KI6B 3PG0A 1IT0A 2KI4A 3V0BB 3O4CA 1JLXA 3AJ6A 1AFCA 4I1BA 2RSTA 21BIA 2Y9FA 4FGFA 3UJ0A 4H75A 3NBCA 2IWTB 2BEBA 5D63A 2NM1A 3FJCA 3AKFA 4ENDA 3HMYA 4G9NA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 4IZEA 1TOOA 2NYYA 1N4KA 4I7IA 1AVUA 3N0KA 3O44A 1WD4A 2KKIA 4QD2B 2GZBA 4XFTA 4I0YA 3HBWA 3H6SE 3O49A 4GOYA 4PC4A 4F83A 1HCEA 1ISYA 2ERMA 2HWAA 3OJ2A 4J2XA 1CVSA 4GAIA 4JQ0A 4ZKTB 5F8YA 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 3LTQA 3CRGA 4JPZA 3O4OA 1PUMB 3NJ5A 1M16A 2VLCA 1EVTA 4EFPA 4GAFA 3CA4A 5DVHA 4P0JA 2WRYA 3MPPG 3H6RB 1SR4C 4I2SA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1SZ6B 3FUOA 2Q9XA 4JRAA 3Q7WA 2VUAA 1W3GA 3NBEA 5DUYA 2Y9XE 2GO2A 3N7MA 2F2FC 2Z48A 3BRGC 2X2TA 2DREA 1HWOB 3AJ5A 4I4QA 1SR4A 4HA2A 1BASA 3O4BA 4I4SA 4XFSA 4TLPA 3P6IA 1TIEA 4EFQA 2D1ZA 3LLPA 1DZDA 2QN4A 3A22A 1J0SA 3POKA 2FGFA 2F2FA 4LO8B 5GAQA 4IQPA 4QALA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 1S0BA 1G9AA 2D23A 1FMMS 2NVHA 4G9MA 4MZGB 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1BLAA 2Y9WC 4USOA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 4UY4A 2KLLA 1RZOB 2AFGA 4JAWA 1JT7A 2NZ9A 1FMZA 4P0LA 1S0FA 3V0AB 3SNVA 3CQAA 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4X37A 1RMLA 3S8JA 3FJDA 4MZHA 5G00A 3WA1A 1DZCA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 3UD8A 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1KNMA 3OBTA 3CA5A 5I1BA 2R9KB 5DSSB 4FVVA 1FGAA 3O5WB 5FZZA 3WINA 4ISQA 1W3FA 4Q91A 2QYIB 1D0HA 1DLLA 4KEKA 4G6JA 1YBIA 1TTUA 2D20A 4I4YA 1QXMA 3A23A 5D61A 3UD9A 3AH2A 4AN7B 2Z49A 5JMCA 2RQ9A 2LIQA 1EYLA 4Z8SB 3FJHA 1HWMB 3RTJB 1Q1UA 4IY9A 2D24A 3FJEA 4CJMA 4R6UB 4I4UA 5BVPI 3OJVA 1WD3A 4JP0A 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 2AQZA 2NTDA 4J2YA 2ZQNA 1V6WA 3P53A 4LO7B 1WBAA 3H6RA 3WMUA 2D44A 4LO3C 1JQZA 3OGGA 1G82A 3AZVA 1RY7A 1GGPB 1FQ9A 1E0OA 2FFVA 3D7WB 3BA4A 1TP0A 1P63A 3VSFA 5D62A 2RG9B 1JT5A 41BIA 2DRYA 4MZFB 1HWPB 2YUGA 3BAQA 3FFZA 3B9UA 2WBCA 3FJJA 4J23B 3BADA 3HSMA 3FJIA 1HWNB 3RSJA 3N7KA 4IY8A 2FFUA 3W9TA 1I1BA 4OWJA 4IONA 3RMXA 1XG6A 3CA1A 3E8LC 3QYDA 1BFBA 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4D0TA 4QBCA 3AH4A 2IHOA 4I6IA 1DFCA 4D0ZA 1S0GA 2HWMA 1Z2VA 3IM5A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 3BAOA 1F31A 4ZFUB 1AF9A 4H04A 1IRPA 1BFCA 1DJSB 1EPWA 3PUBA 1MC9A 4A7YA 1AVWB 2VSEA 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 4OEFA 1ISVA 3V0AA 3WO3A 3BRDA 3R4UA 1CE7B 3UD7A 4OEGA 3BX1C 2K43A 3AH1A 4I4RA 1S0EA 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 1G9CA 3BRFA 4GP3A 5BXSA 1IHKA 4EEEB 4LO2C 1AXMA 4ZGRB 2ZQOA 1ONKB 1S0CA 2FDBM 2Q3NB 1ITBA 4IHZA 5EHAA 1K5VA 3NBNA 3VT1A 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH topology
5HPZA 2MC2A 2K4AB 3VWCA 2UUSA 1BLDA 1IOBA 2M49A 3BA7A 4LO2A 4KBBA 5B2HA 3OGFA 4EFRA 31BIA 1XYFA 4ZOTA 1WBCA 2VU9A 3OJMA 1QQLA 4ZBVB 3ZC9A 4LO7C 5BP5C 3FJBA 4J2SA 4LO1C 2AXMA 3P6JA 4ISRA 1W3AA 3CU1B 3RTIB 4XKIA 2P23A 3V0BA 4JKQA 5E24E 2D22A 5DZUA 2D7IA 1S0DA 1PWAA 3HN1A 1FWVA 3EF2A 5FNXA 3IM7A 2L5XA 2BEAA 3BTAA 1NUNA 5BP5A 4USPA 4I1EA 3FGMA 4LO1A 1UPSA 1TWEA 3K1XA 3F62B 1ILR1 5FZYA 1AVAC 1I1EA 4GOVA 1BFFA 1ABRB 2BFHA 1A8DA 1DFQA 3V79C 4I37A 4QO3A 3AZWA 1ISWA 1JY0A 3ZX7A 1QQKA 3NBDA 3WO2A 4IZXA 4OW4A 1JT4A 1Q04A 4I4VA 1XHBA 1K5UA 1II4A 1DQGA 4JKXB 3H6QA 4LO3A 2E4MC 3C9ZA 2K8RA 2HW9A 2VXRA 3Q7YA 3VT0A 1ISZA 4I8MA 4L4HA 4ZLBB 5JLVA 4LO0C 3BA5A 4OEEA 3FJ8A 1IRAX 4L4IA 3VEQA 3CRHA 5BOWA 2NS2A 1FV2A 2E4MA 5EC5A 1EV2A 1HCDA 3PMEA 1Z4SA 5BQUC 2DRZA 3PHZA 3ZC8A 3BAHA 2AAIB 4QKRA 4P6AA 3BB2A 3ZXGA 1YF8B 1JTCA 5FZUA 4LO0A 1FV3A 1FWUA 3R4SA 3BAGA 1IJTA 1FN0A 4Z9WB 2J3PA 4H9WA 3O4DA 4ZA3B 5F8WA 1VCLA 3I29B 1M2TB 4WBCA 5BQUA 2Y9GA 4KEJA 5BXPA 7I1BA 3A21A 3F1RA 1BFGA 3T8SA 3FJKA 2ET2A 3IIRA 4Q9PA 3ZXDA 1Z0HA 1OQLB 1PC8B 2VSAA 2F8XC 1R8OA 4QKSA 4I4XA 4HJJA 2D7RA 3FJFA 4I4OA 4AN6A 4A7KA 3O4AA 4ZFWB 2MLLB 4OUJA 2HZ9A 1V6XA 3MALA 5BXRA 3CRIA 1TFMB 1DQOA 1NZKA 1IILA 1R8NA 2KH2A 4XFUA 3CA6A 3QR5A 1JLYA 2KI6B 3PG0A 1IT0A 2KI4A 3V0BB 3O4CA 1JLXA 3AJ6A 1AFCA 4I1BA 2RSTA 21BIA 2Y9FA 4FGFA 3UJ0A 4H75A 3NBCA 2IWTB 2BEBA 5D63A 2NM1A 3FJCA 3AKFA 4ENDA 3HMYA 4G9NA 4EB2B 1YXWA 4Q9GA 8I1BA 3JRRA 4IZEA 1TOOA 2NYYA 1N4KA 4I7IA 1AVUA 3N0KA 3O44A 1WD4A 2KKIA 4QD2B 2GZBA 4XFTA 4I0YA 3HBWA 3H6SE 3O49A 4GOYA 4PC4A 4F83A 1HCEA 1ISYA 2ERMA 2HWAA 3OJ2A 4J2XA 1CVSA 4GAIA 4JQ0A 4ZKTB 5F8YA 3VSZA 2XOAA 2VXTI 1V6UA 3N7JA 4GP0A 1BARA 3LTQA 3CRGA 4JPZA 3O4OA 1PUMB 3NJ5A 1M16A 2VLCA 1EVTA 4EFPA 4GAFA 3CA4A 5DVHA 4P0JA 2WRYA 3MPPG 3H6RB 1SR4C 4I2SA 2DS0A 1Q03A 4X3AA 5FNWA 3RMYA 4DCKC 1SZ6B 3FUOA 2Q9XA 4JRAA 3Q7WA 2VUAA 1W3GA 3NBEA 5DUYA 2Y9XE 2GO2A 3N7MA 2F2FC 2Z48A 3BRGC 2X2TA 2DREA 1HWOB 3AJ5A 4I4QA 1SR4A 4HA2A 1BASA 3O4BA 4I4SA 4XFSA 4TLPA 3P6IA 1TIEA 4EFQA 2D1ZA 3LLPA 1DZDA 2QN4A 3A22A 1J0SA 3POKA 2FGFA 2F2FA 4LO8B 5GAQA 4IQPA 4QALA 3AKIA 2I1BA 3BAVA 9ILBA 4F34A 4DENA 3VUOA 1S0BA 1G9AA 2D23A 1FMMS 2NVHA 4G9MA 4MZGB 4X39A 3WMVA 1XZZA 4D8HA 3S8KA 3FJAA 3FJ9A 4DEPA 2FO1A 1BLAA 2Y9WC 4USOA 5F8SA 1MD6A 1TWMA 4I96A 4ZFYB 2NP0A 4UY4A 2KLLA 1RZOB 2AFGA 4JAWA 1JT7A 2NZ9A 1FMZA 4P0LA 1S0FA 3V0AB 3SNVA 3CQAA 3I2AA 4G6MA 2X2SA 3CA0A 1T4QA 3BAUA 3FUQA 4QC4A 4QBVA 3CA3A 4OWKA 3WINC 3CAHA 4KC3A 3IAGC 1PUUB 3OBRA 3WO4A 4EKXB 4X37A 1RMLA 3S8JA 3FJDA 4MZHA 5G00A 3WA1A 1DZCA 4A7ZA 2LIEA 2D43A 3Q7XA 4QD2C 1HIBA 3UD8A 3AKGA 3KMVA 4P0KA 1AVXB 4YOLA 1KNMA 3OBTA 3CA5A 5I1BA 2R9KB 5DSSB 4FVVA 1FGAA 3O5WB 5FZZA 3WINA 4ISQA 1W3FA 4Q91A 2QYIB 1D0HA 1DLLA 4KEKA 4G6JA 1YBIA 1TTUA 2D20A 4I4YA 1QXMA 3A23A 5D61A 3UD9A 3AH2A 4AN7B 2Z49A 5JMCA 2RQ9A 2LIQA 1EYLA 4Z8SB 3FJHA 1HWMB 3RTJB 1Q1UA 4IY9A 2D24A 3FJEA 4CJMA 4R6UB 4I4UA 5BVPI 3OJVA 1WD3A 4JP0A 4X38A 3O3QA 6I1BA 1HKNA 1S0LA 2ZR1B 2AQZA 2NTDA 4J2YA 2ZQNA 1V6WA 3P53A 4LO7B 1WBAA 3H6RA 3WMUA 2D44A 4LO3C 1JQZA 3OGGA 1G82A 3AZVA 1RY7A 1GGPB 1FQ9A 1E0OA 2FFVA 3D7WB 3BA4A 1TP0A 1P63A 3VSFA 5D62A 2RG9B 1JT5A 41BIA 2DRYA 4MZFB 1HWPB 2YUGA 3BAQA 3FFZA 3B9UA 2WBCA 3FJJA 4J23B 3BADA 3HSMA 3FJIA 1HWNB 3RSJA 3N7KA 4IY8A 2FFUA 3W9TA 1I1BA 4OWJA 4IONA 3RMXA 1XG6A 3CA1A 3E8LC 3QYDA 1BFBA 1JT3A 1YTOA 3A07A 4II0A 1G9DA 4D0TA 4QBCA 3AH4A 2IHOA 4I6IA 1DFCA 4D0ZA 1S0GA 2HWMA 1Z2VA 3IM5A 1BA7A 1PZZA 4KEIA 3TC2A 3IM6A 3BAOA 1F31A 4ZFUB 1AF9A 4H04A 1IRPA 1BFCA 1DJSB 1EPWA 3PUBA 1MC9A 4A7YA 1AVWB 2VSEA 4J2KA 1V6VA 4I3NA 1L2HA 3UDAA 3N7LA 2MIBA 3HOMA 3VT2A 4OEFA 1ISVA 3V0AA 3WO3A 3BRDA 3R4UA 1CE7B 3UD7A 4OEGA 3BX1C 2K43A 3AH1A 4I4RA 1S0EA 5F90A 1ISXA 2ESUA 1RG8A 4HR6C 1YYNA 3UJ4A 2P39A 4IYBA 3ILAA 3JUTA 4I4PA 3I2XA 5EG6C 3AKHA 5BXTA 1DIWA 4OWLA 4G1RA 1G9CA 3BRFA 4GP3A 5BXSA 1IHKA 4EEEB 4LO2C 1AXMA 4ZGRB 2ZQOA 1ONKB 1S0CA 2FDBM 2Q3NB 1ITBA 4IHZA 5EHAA 1K5VA 3NBNA 3VT1A 1T9FA 3HALA 1G9BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HPZ A;  2MC2 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  1IOB A;  2M49 A;  3BA7 A;  4LO2 A;  4KBB A;  5B2H A;  3OGF A;  4EFR A;  31BI A;  1XYF A;  4ZOT A;  1WBC A;  2VU9 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  4LO7 C;  5BP5 C;  3FJB A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  4ISR A;  1W3A A;  3CU1 B;  3RTI B;  4XKI A;  2P23 A;  3V0B A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2D7I A;  1S0D A;  1PWA A;  3HN1 A;  1FWV A;  3EF2 A;  5FNX A;  3IM7 A;  2L5X A;  2BEA A;  3BTA A;  1NUN A;  5BP5 A;  4USP A;  4I1E A;  3FGM A;  4LO1 A;  1UPS A;  1TWE A;  3K1X A;  3F62 B;  1ILR 1;  5FZY A;  1AVA C;  1I1E A;  4GOV A;  1BFF A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1DQG A;  4JKX B;  3H6Q A;  4LO3 A;  2E4M C;  3C9Z A;  2K8R A;  2HW9 A;  2VXR A;  3Q7Y A;  3VT0 A;  1ISZ A;  4I8M A;  4L4H A;  4ZLB B;  5JLV A;  4LO0 C;  3BA5 A;  4OEE A;  3FJ8 A;  1IRA X;  4L4I A;  3VEQ A;  3CRH A;  5BOW A;  1FV2 A;  2E4M A;  5EC5 A;  1EV2 A;  1HCD A;  3PME A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  1FV3 A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  2J3P A;  4H9W A;  3O4D A;  4ZA3 B;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  4WBC A;  5BQU A;  2Y9G A;  4KEJ A;  5BXP A;  7I1B A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  3FJK A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1R8O A;  4QKS A;  4I4X A;  4HJJ A;  2D7R A;  3FJF A;  4I4O A;  4AN6 A;  4A7K A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2HZ9 A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  1TFM B;  1DQO A;  1NZK A;  1IIL A;  1R8N A;  2KH2 A;  4XFU A;  3CA6 A;  3QR5 A;  1JLY A;  2KI6 B;  3PG0 A;  1IT0 A;  2KI4 A;  3V0B B;  3O4C A;  1JLX A;  3AJ6 A;  1AFC A;  4I1B A;  2RST A;  21BI A;  2Y9F A;  4FGF A;  3UJ0 A;  3NBC A;  2IWT B;  2BEB A;  5D63 A;  2NM1 A;  3FJC A;  3AKF A;  4END A;  3HMY A;  4G9N A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  4IZE A;  1TOO A;  2NYY A;  1N4K A;  4I7I A;  1AVU A;  3N0K A;  3O44 A;  1WD4 A;  2KKI A;  4QD2 B;  2GZB A;  4XFT A;  4I0Y A;  3HBW A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  4F83 A;  1HCE A;  1ISY A;  2ERM A;  2HWA A;  3OJ2 A;  4J2X A;  1CVS A;  4GAI A;  4JQ0 A;  4ZKT B;  5F8Y A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  3LTQ A;  3CRG A;  4JPZ A;  3O4O A;  1PUM B;  3NJ5 A;  1M16 A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  3CA4 A;  5DVH A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1SR4 C;  4I2S A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1SZ6 B;  3FUO A;  2Q9X A;  4JRA A;  3Q7W A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  2Y9X E;  2GO2 A;  3N7M A;  2F2F C;  2Z48 A;  3BRG C;  2X2T A;  2DRE A;  1HWO B;  3AJ5 A;  4I4Q A;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  4I4S A;  4XFS A;  4TLP A;  3P6I A;  1TIE A;  4EFQ A;  2D1Z A;  3LLP A;  1DZD A;  2QN4 A;  3A22 A;  1J0S A;  3POK A;  2FGF A;  2F2F A;  4LO8 B;  5GAQ A;  4IQP A;  4QAL A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  1S0B A;  1G9A A;  2D23 A;  1FMM S;  2NVH A;  4G9M A;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1BLA A;  2Y9W C;  4USO A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  2KLL A;  1RZO B;  2AFG A;  4JAW A;  1JT7 A;  2NZ9 A;  1FMZ A;  4P0L A;  1S0F A;  3V0A B;  3SNV A;  3CQA A;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4X37 A;  1RML A;  3S8J A;  3FJD A;  5G00 A;  3WA1 A;  1DZC A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  3UD8 A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1KNM A;  3OBT A;  3CA5 A;  5I1B A;  2R9K B;  5DSS B;  4FVV A;  1FGA A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  1W3F A;  4Q91 A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  4G6J A;  1YBI A;  1TTU A;  2D20 A;  4I4Y A;  1QXM A;  3A23 A;  5D61 A;  3UD9 A;  3AH2 A;  4AN7 B;  2Z49 A;  5JMC A;  2RQ9 A;  2LIQ A;  1EYL A;  4Z8S B;  3FJH A;  1HWM B;  3RTJ B;  1Q1U A;  4IY9 A;  2D24 A;  3FJE A;  4CJM A;  4R6U B;  4I4U A;  5BVP I;  3OJV A;  1WD3 A;  4JP0 A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  2AQZ A;  2NTD A;  4J2Y A;  2ZQN A;  1V6W A;  3P53 A;  4LO7 B;  1WBA A;  3H6R A;  3WMU A;  2D44 A;  4LO3 C;  1JQZ A;  3OGG A;  1G82 A;  3AZV A;  1RY7 A;  1GGP B;  1FQ9 A;  1E0O A;  2FFV A;  3D7W B;  3BA4 A;  1TP0 A;  1P63 A;  3VSF A;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2DRY A;  1HWP B;  2YUG A;  3BAQ A;  3FFZ A;  3B9U A;  2WBC A;  3FJJ A;  4J23 B;  3BAD A;  3HSM A;  3FJI A;  1HWN B;  3RSJ A;  3N7K A;  4IY8 A;  2FFU A;  3W9T A;  1I1B A;  4OWJ A;  4ION A;  3RMX A;  1XG6 A;  3CA1 A;  3E8L C;  3QYD A;  1BFB A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4D0T A;  4QBC A;  3AH4 A;  2IHO A;  4I6I A;  1DFC A;  4D0Z A;  1S0G A;  2HWM A;  1Z2V A;  3IM5 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  3BAO A;  1F31 A;  4ZFU B;  1AF9 A;  4H04 A;  1IRP A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1MC9 A;  4A7Y A;  1AVW B;  2VSE A;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  4OEF A;  1ISV A;  3V0A A;  3WO3 A;  3BRD A;  3R4U A;  1CE7 B;  3UD7 A;  4OEG A;  3BX1 C;  2K43 A;  3AH1 A;  4I4R A;  1S0E A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  1G9C A;  3BRF A;  4GP3 A;  5BXS A;  1IHK A;  4EEE B;  4LO2 C;  1AXM A;  4ZGR B;  2ZQO A;  1ONK B;  1S0C A;  2FDB M;  2Q3N B;  1ITB A;  4IHZ A;  5EHA A;  1K5V A;  3NBN A;  3VT1 A;  1T9F A;  3HAL A;  1G9B A; 
#chains in the Genus database with same CATH topology
 5HPZ A;  2MC2 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  1IOB A;  2M49 A;  3BA7 A;  4LO2 A;  4KBB A;  5B2H A;  3OGF A;  4EFR A;  31BI A;  1XYF A;  4ZOT A;  1WBC A;  2VU9 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  4LO7 C;  5BP5 C;  3FJB A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  4ISR A;  1W3A A;  3CU1 B;  3RTI B;  4XKI A;  2P23 A;  3V0B A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2D7I A;  1S0D A;  1PWA A;  3HN1 A;  1FWV A;  3EF2 A;  5FNX A;  3IM7 A;  2L5X A;  2BEA A;  3BTA A;  1NUN A;  5BP5 A;  4USP A;  4I1E A;  3FGM A;  4LO1 A;  1UPS A;  1TWE A;  3K1X A;  3F62 B;  1ILR 1;  5FZY A;  1AVA C;  1I1E A;  4GOV A;  1BFF A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1DQG A;  4JKX B;  3H6Q A;  4LO3 A;  2E4M C;  3C9Z A;  2K8R A;  2HW9 A;  2VXR A;  3Q7Y A;  3VT0 A;  1ISZ A;  4I8M A;  4L4H A;  4ZLB B;  5JLV A;  4LO0 C;  3BA5 A;  4OEE A;  3FJ8 A;  1IRA X;  4L4I A;  3VEQ A;  3CRH A;  5BOW A;  2NS2 A;  1FV2 A;  2E4M A;  5EC5 A;  1EV2 A;  1HCD A;  3PME A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  1FV3 A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  2J3P A;  4H9W A;  3O4D A;  4ZA3 B;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  4WBC A;  5BQU A;  2Y9G A;  4KEJ A;  5BXP A;  7I1B A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  3FJK A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1R8O A;  4QKS A;  4I4X A;  4HJJ A;  2D7R A;  3FJF A;  4I4O A;  4AN6 A;  4A7K A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2HZ9 A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  1TFM B;  1DQO A;  1NZK A;  1IIL A;  1R8N A;  2KH2 A;  4XFU A;  3CA6 A;  3QR5 A;  1JLY A;  2KI6 B;  3PG0 A;  1IT0 A;  2KI4 A;  3V0B B;  3O4C A;  1JLX A;  3AJ6 A;  1AFC A;  4I1B A;  2RST A;  21BI A;  2Y9F A;  4FGF A;  3UJ0 A;  4H75 A;  3NBC A;  2IWT B;  2BEB A;  5D63 A;  2NM1 A;  3FJC A;  3AKF A;  4END A;  3HMY A;  4G9N A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  4IZE A;  1TOO A;  2NYY A;  1N4K A;  4I7I A;  1AVU A;  3N0K A;  3O44 A;  1WD4 A;  2KKI A;  4QD2 B;  2GZB A;  4XFT A;  4I0Y A;  3HBW A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  4F83 A;  1HCE A;  1ISY A;  2ERM A;  2HWA A;  3OJ2 A;  4J2X A;  1CVS A;  4GAI A;  4JQ0 A;  4ZKT B;  5F8Y A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  3LTQ A;  3CRG A;  4JPZ A;  3O4O A;  1PUM B;  3NJ5 A;  1M16 A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  3CA4 A;  5DVH A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1SR4 C;  4I2S A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1SZ6 B;  3FUO A;  2Q9X A;  4JRA A;  3Q7W A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  2Y9X E;  2GO2 A;  3N7M A;  2F2F C;  2Z48 A;  3BRG C;  2X2T A;  2DRE A;  1HWO B;  3AJ5 A;  4I4Q A;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  4I4S A;  4XFS A;  4TLP A;  3P6I A;  1TIE A;  4EFQ A;  2D1Z A;  3LLP A;  1DZD A;  2QN4 A;  3A22 A;  1J0S A;  3POK A;  2FGF A;  2F2F A;  4LO8 B;  5GAQ A;  4IQP A;  4QAL A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  1S0B A;  1G9A A;  2D23 A;  1FMM S;  2NVH A;  4G9M A;  4MZG B;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1BLA A;  2Y9W C;  4USO A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  4UY4 A;  2KLL A;  1RZO B;  2AFG A;  4JAW A;  1JT7 A;  2NZ9 A;  1FMZ A;  4P0L A;  1S0F A;  3V0A B;  3SNV A;  3CQA A;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4X37 A;  1RML A;  3S8J A;  3FJD A;  4MZH A;  5G00 A;  3WA1 A;  1DZC A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  3UD8 A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1KNM A;  3OBT A;  3CA5 A;  5I1B A;  2R9K B;  5DSS B;  4FVV A;  1FGA A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  1W3F A;  4Q91 A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  4G6J A;  1YBI A;  1TTU A;  2D20 A;  4I4Y A;  1QXM A;  3A23 A;  5D61 A;  3UD9 A;  3AH2 A;  4AN7 B;  2Z49 A;  5JMC A;  2RQ9 A;  2LIQ A;  1EYL A;  4Z8S B;  3FJH A;  1HWM B;  3RTJ B;  1Q1U A;  4IY9 A;  2D24 A;  3FJE A;  4CJM A;  4R6U B;  4I4U A;  5BVP I;  3OJV A;  1WD3 A;  4JP0 A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  2AQZ A;  2NTD A;  4J2Y A;  2ZQN A;  1V6W A;  3P53 A;  4LO7 B;  1WBA A;  3H6R A;  3WMU A;  2D44 A;  4LO3 C;  1JQZ A;  3OGG A;  1G82 A;  3AZV A;  1RY7 A;  1GGP B;  1FQ9 A;  1E0O A;  2FFV A;  3D7W B;  3BA4 A;  1TP0 A;  1P63 A;  3VSF A;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2DRY A;  4MZF B;  1HWP B;  2YUG A;  3BAQ A;  3FFZ A;  3B9U A;  2WBC A;  3FJJ A;  4J23 B;  3BAD A;  3HSM A;  3FJI A;  1HWN B;  3RSJ A;  3N7K A;  4IY8 A;  2FFU A;  3W9T A;  1I1B A;  4OWJ A;  4ION A;  3RMX A;  1XG6 A;  3CA1 A;  3E8L C;  3QYD A;  1BFB A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4D0T A;  4QBC A;  3AH4 A;  2IHO A;  4I6I A;  1DFC A;  4D0Z A;  1S0G A;  2HWM A;  1Z2V A;  3IM5 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  3BAO A;  1F31 A;  4ZFU B;  1AF9 A;  4H04 A;  1IRP A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1MC9 A;  4A7Y A;  1AVW B;  2VSE A;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  4OEF A;  1ISV A;  3V0A A;  3WO3 A;  3BRD A;  3R4U A;  1CE7 B;  3UD7 A;  4OEG A;  3BX1 C;  2K43 A;  3AH1 A;  4I4R A;  1S0E A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  1G9C A;  3BRF A;  4GP3 A;  5BXS A;  1IHK A;  4EEE B;  4LO2 C;  1AXM A;  4ZGR B;  2ZQO A;  1ONK B;  1S0C A;  2FDB M;  2Q3N B;  1ITB A;  4IHZ A;  5EHA A;  1K5V A;  3NBN A;  3VT1 A;  1T9F A;  3HAL A;  1G9B A; 
#chains in the Genus database with same CATH homology
 5HPZ A;  2MC2 A;  2K4A B;  3VWC A;  2UUS A;  1BLD A;  1IOB A;  2M49 A;  3BA7 A;  4LO2 A;  4KBB A;  5B2H A;  3OGF A;  4EFR A;  31BI A;  1XYF A;  4ZOT A;  1WBC A;  2VU9 A;  3OJM A;  1QQL A;  4ZBV B;  3ZC9 A;  4LO7 C;  5BP5 C;  3FJB A;  4J2S A;  4LO1 C;  2AXM A;  3P6J A;  4ISR A;  1W3A A;  3CU1 B;  3RTI B;  4XKI A;  2P23 A;  3V0B A;  4JKQ A;  5E24 E;  2D22 A;  5DZU A;  2D7I A;  1S0D A;  1PWA A;  3HN1 A;  1FWV A;  3EF2 A;  5FNX A;  3IM7 A;  2L5X A;  2BEA A;  3BTA A;  1NUN A;  5BP5 A;  4USP A;  4I1E A;  3FGM A;  4LO1 A;  1UPS A;  1TWE A;  3K1X A;  3F62 B;  1ILR 1;  5FZY A;  1AVA C;  1I1E A;  4GOV A;  1BFF A;  1ABR B;  2BFH A;  1A8D A;  1DFQ A;  3V79 C;  4I37 A;  4QO3 A;  3AZW A;  1ISW A;  1JY0 A;  3ZX7 A;  1QQK A;  3NBD A;  3WO2 A;  4IZX A;  4OW4 A;  1JT4 A;  1Q04 A;  4I4V A;  1XHB A;  1K5U A;  1II4 A;  1DQG A;  4JKX B;  3H6Q A;  4LO3 A;  2E4M C;  3C9Z A;  2K8R A;  2HW9 A;  2VXR A;  3Q7Y A;  3VT0 A;  1ISZ A;  4I8M A;  4L4H A;  4ZLB B;  5JLV A;  4LO0 C;  3BA5 A;  4OEE A;  3FJ8 A;  1IRA X;  4L4I A;  3VEQ A;  3CRH A;  5BOW A;  2NS2 A;  1FV2 A;  2E4M A;  5EC5 A;  1EV2 A;  1HCD A;  3PME A;  1Z4S A;  5BQU C;  2DRZ A;  3PHZ A;  3ZC8 A;  3BAH A;  2AAI B;  4QKR A;  4P6A A;  3BB2 A;  3ZXG A;  1YF8 B;  1JTC A;  5FZU A;  4LO0 A;  1FV3 A;  1FWU A;  3R4S A;  3BAG A;  1IJT A;  1FN0 A;  4Z9W B;  2J3P A;  4H9W A;  3O4D A;  4ZA3 B;  5F8W A;  1VCL A;  3I29 B;  1M2T B;  4WBC A;  5BQU A;  2Y9G A;  4KEJ A;  5BXP A;  7I1B A;  3A21 A;  3F1R A;  1BFG A;  3T8S A;  3FJK A;  2ET2 A;  3IIR A;  4Q9P A;  3ZXD A;  1Z0H A;  1OQL B;  1PC8 B;  2VSA A;  2F8X C;  1R8O A;  4QKS A;  4I4X A;  4HJJ A;  2D7R A;  3FJF A;  4I4O A;  4AN6 A;  4A7K A;  3O4A A;  4ZFW B;  2MLL B;  4OUJ A;  2HZ9 A;  1V6X A;  3MAL A;  5BXR A;  3CRI A;  1TFM B;  1DQO A;  1NZK A;  1IIL A;  1R8N A;  2KH2 A;  4XFU A;  3CA6 A;  3QR5 A;  1JLY A;  2KI6 B;  3PG0 A;  1IT0 A;  2KI4 A;  3V0B B;  3O4C A;  1JLX A;  3AJ6 A;  1AFC A;  4I1B A;  2RST A;  21BI A;  2Y9F A;  4FGF A;  3UJ0 A;  4H75 A;  3NBC A;  2IWT B;  2BEB A;  5D63 A;  2NM1 A;  3FJC A;  3AKF A;  4END A;  3HMY A;  4G9N A;  4EB2 B;  1YXW A;  4Q9G A;  8I1B A;  3JRR A;  4IZE A;  1TOO A;  2NYY A;  1N4K A;  4I7I A;  1AVU A;  3N0K A;  3O44 A;  1WD4 A;  2KKI A;  4QD2 B;  2GZB A;  4XFT A;  4I0Y A;  3HBW A;  3H6S E;  3O49 A;  4GOY A;  4PC4 A;  4F83 A;  1HCE A;  1ISY A;  2ERM A;  2HWA A;  3OJ2 A;  4J2X A;  1CVS A;  4GAI A;  4JQ0 A;  4ZKT B;  5F8Y A;  3VSZ A;  2XOA A;  2VXT I;  1V6U A;  3N7J A;  4GP0 A;  1BAR A;  3LTQ A;  3CRG A;  4JPZ A;  3O4O A;  1PUM B;  3NJ5 A;  1M16 A;  2VLC A;  1EVT A;  4EFP A;  4GAF A;  3CA4 A;  5DVH A;  4P0J A;  2WRY A;  3MPP G;  3H6R B;  1SR4 C;  4I2S A;  2DS0 A;  1Q03 A;  4X3A A;  5FNW A;  3RMY A;  4DCK C;  1SZ6 B;  3FUO A;  2Q9X A;  4JRA A;  3Q7W A;  2VUA A;  1W3G A;  3NBE A;  5DUY A;  2Y9X E;  2GO2 A;  3N7M A;  2F2F C;  2Z48 A;  3BRG C;  2X2T A;  2DRE A;  1HWO B;  3AJ5 A;  4I4Q A;  1SR4 A;  4HA2 A;  1BAS A;  3O4B A;  4I4S A;  4XFS A;  4TLP A;  3P6I A;  1TIE A;  4EFQ A;  2D1Z A;  3LLP A;  1DZD A;  2QN4 A;  3A22 A;  1J0S A;  3POK A;  2FGF A;  2F2F A;  4LO8 B;  5GAQ A;  4IQP A;  4QAL A;  3AKI A;  2I1B A;  3BAV A;  9ILB A;  4F34 A;  4DEN A;  3VUO A;  1S0B A;  1G9A A;  2D23 A;  1FMM S;  2NVH A;  4G9M A;  4MZG B;  4X39 A;  3WMV A;  1XZZ A;  4D8H A;  3S8K A;  3FJA A;  3FJ9 A;  4DEP A;  2FO1 A;  1BLA A;  2Y9W C;  4USO A;  5F8S A;  1MD6 A;  1TWM A;  4I96 A;  4ZFY B;  2NP0 A;  4UY4 A;  2KLL A;  1RZO B;  2AFG A;  4JAW A;  1JT7 A;  2NZ9 A;  1FMZ A;  4P0L A;  1S0F A;  3V0A B;  3SNV A;  3CQA A;  3I2A A;  4G6M A;  2X2S A;  3CA0 A;  1T4Q A;  3BAU A;  3FUQ A;  4QC4 A;  4QBV A;  3CA3 A;  4OWK A;  3WIN C;  3CAH A;  4KC3 A;  3IAG C;  1PUU B;  3OBR A;  3WO4 A;  4EKX B;  4X37 A;  1RML A;  3S8J A;  3FJD A;  4MZH A;  5G00 A;  3WA1 A;  1DZC A;  4A7Z A;  2LIE A;  2D43 A;  3Q7X A;  4QD2 C;  1HIB A;  3UD8 A;  3AKG A;  3KMV A;  4P0K A;  1AVX B;  4YOL A;  1KNM A;  3OBT A;  3CA5 A;  5I1B A;  2R9K B;  5DSS B;  4FVV A;  1FGA A;  3O5W B;  5FZZ A;  3WIN A;  4ISQ A;  1W3F A;  4Q91 A;  2QYI B;  1D0H A;  1DLL A;  4KEK A;  4G6J A;  1YBI A;  1TTU A;  2D20 A;  4I4Y A;  1QXM A;  3A23 A;  5D61 A;  3UD9 A;  3AH2 A;  4AN7 B;  2Z49 A;  5JMC A;  2RQ9 A;  2LIQ A;  1EYL A;  4Z8S B;  3FJH A;  1HWM B;  3RTJ B;  1Q1U A;  4IY9 A;  2D24 A;  3FJE A;  4CJM A;  4R6U B;  4I4U A;  5BVP I;  3OJV A;  1WD3 A;  4JP0 A;  4X38 A;  3O3Q A;  6I1B A;  1HKN A;  1S0L A;  2ZR1 B;  2AQZ A;  2NTD A;  4J2Y A;  2ZQN A;  1V6W A;  3P53 A;  4LO7 B;  1WBA A;  3H6R A;  3WMU A;  2D44 A;  4LO3 C;  1JQZ A;  3OGG A;  1G82 A;  3AZV A;  1RY7 A;  1GGP B;  1FQ9 A;  1E0O A;  2FFV A;  3D7W B;  3BA4 A;  1TP0 A;  1P63 A;  3VSF A;  5D62 A;  2RG9 B;  1JT5 A;  41BI A;  2DRY A;  4MZF B;  1HWP B;  2YUG A;  3BAQ A;  3FFZ A;  3B9U A;  2WBC A;  3FJJ A;  4J23 B;  3BAD A;  3HSM A;  3FJI A;  1HWN B;  3RSJ A;  3N7K A;  4IY8 A;  2FFU A;  3W9T A;  1I1B A;  4OWJ A;  4ION A;  3RMX A;  1XG6 A;  3CA1 A;  3E8L C;  3QYD A;  1BFB A;  1JT3 A;  1YTO A;  3A07 A;  4II0 A;  1G9D A;  4D0T A;  4QBC A;  3AH4 A;  2IHO A;  4I6I A;  1DFC A;  4D0Z A;  1S0G A;  2HWM A;  1Z2V A;  3IM5 A;  1BA7 A;  1PZZ A;  4KEI A;  3TC2 A;  3IM6 A;  3BAO A;  1F31 A;  4ZFU B;  1AF9 A;  4H04 A;  1IRP A;  1BFC A;  1DJS B;  1EPW A;  3PUB A;  1MC9 A;  4A7Y A;  1AVW B;  2VSE A;  4J2K A;  1V6V A;  4I3N A;  1L2H A;  3UDA A;  3N7L A;  2MIB A;  3HOM A;  3VT2 A;  4OEF A;  1ISV A;  3V0A A;  3WO3 A;  3BRD A;  3R4U A;  1CE7 B;  3UD7 A;  4OEG A;  3BX1 C;  2K43 A;  3AH1 A;  4I4R A;  1S0E A;  5F90 A;  1ISX A;  2ESU A;  1RG8 A;  4HR6 C;  1YYN A;  3UJ4 A;  2P39 A;  4IYB A;  3ILA A;  3JUT A;  4I4P A;  3I2X A;  5EG6 C;  3AKH A;  5BXT A;  1DIW A;  4OWL A;  4G1R A;  1G9C A;  3BRF A;  4GP3 A;  5BXS A;  1IHK A;  4EEE B;  4LO2 C;  1AXM A;  4ZGR B;  2ZQO A;  1ONK B;  1S0C A;  2FDB M;  2Q3N B;  1ITB A;  4IHZ A;  5EHA A;  1K5V A;  3NBN A;  3VT1 A;  1T9F A;  3HAL A;  1G9B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...