4ZOTA

Crystal structure of bbki, a disulfide-free plasma kallikrein inhibitor at 1.4 a resolution
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
163
structure length
163
Chain Sequence
SSVVVDTNGQPVSNGADAYYLVPVSHGHAGLALAKIGNEAEPRAVVLDPHHRPGLPVRFESPLRINIIKESYFLNIKFGPSSSDSGVWDVIQQDPIGLAVKVTDTKSLLGPFKVEKEGEGYKIVYYPERGQTGLDIGLVHRNDKYYLAVKDGEPCVFKIRKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Kunitz-type serine protease inhibitor BbKI
publication title Structure of BbKI, a disulfide-free plasma kallikrein inhibitor.
pubmed doi rcsb
source organism Bauhinia bauhinioides
total genus 26
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2015-05-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00197 Kunitz_legume Trypsin and protease inhibitor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zotA00
9ILBA 3CRGA 4LO7C 1BA7A 3CU1B 4D0ZA 3ZXGA 1F31A 1W3GA 5HPZA 4IY9A 1HWOB 3O4AA 3V0BA 4I8MA 4OEGA 4OWJA 1Q1UA 3S8JA 2R9KB 2KI6B 3VEQA 8I1BA 3MPPG 2NTDA 3BAUA 4USOA 2VSAA 1DJSB 1GGPB 2D20A 3F1RA 4TLPA 5BXRA 2D24A 4LO1C 4LO3A 1NZKA 3AH2A 3T8SA 2P39A 3Q7YA 1JT5A 2K43A 2J3PA 2WRYA 4QD2C 3KMVA 1HIBA 4I4UA 1FV3A 5EC5A 1AVUA 2UUSA 3CA1A 1QQLA 1IHKA 4USPA 4OWLA 5F8SA 2Y9WC 4I4RA 3UJ4A 1ITBA 3F62B 3VT1A 2FGFA 1ISXA 3A23A 1HWPB 1IJTA 2Y9XE 4ZOTA 1XHBA 3CRIA 3Q7WA 3BA4A 2IWTB 1ISWA 4F34A 2MLLB 3FJDA 4I4VA 4A7KA 4JPZA 3WINC 4X3AA 2P23A 3WMVA 3FJFA 1XG6A 1XYFA 5DSSB 3ZXDA 3NBDA 1JQZA 4QO3A 3BX1C 5BOWA 4I2SA 1EV2A 4ZA3B 2NP0A 2VUAA 2AFGA 3AH4A 4I4OA 1ISYA 3A21A 4I4QA 3H6RB 1T4QA 3I29B 1EYLA 2ERMA 4Q9PA 2RQ9A 2ET2A 5G00A 5FZUA 4EKXB 4QC4A 2FFUA 41BIA 1BFCA 4I1EA 4G6JA 4QBCA 4A7ZA 1HWMB 4X37A 4IHZA 2Z48A 3O4BA 3OBTA 4FGFA 4OEEA 3FFZA 1RZOB 1PZZA 1AFCA 2DRYA 3CA5A 3K1XA 4D0TA 3BAHA 4ENDA 4AN7B 3BA7A 3AKHA 4LO0A 4XKIA 1FN0A 3ZC8A 3O4DA 4ISRA 3O4CA 3B9UA 2Y9FA 3AZVA 7I1BA 2E4MA 3FJBA 2L5XA 2MC2A 1TTUA 3IM5A 4HJJA 1YF8B 1JT3A 2WBCA 3ZX7A 1DQOA 1DFQA 3IM6A 3P6JA 4GP0A 3UDAA 4OWKA 1JT4A 1R8NA 4ZFYB 2IHOA 1TFMB 4WBCA 1K5VA 3HSMA 1W3AA 3V0AA 3WO3A 4YOLA 1JLYA 3UJ0A 1KNMA 1RMLA 2HWMA 4ZGRB 5EG6C 5FNWA 3R4SA 3SNVA 3FGMA 1AVXB 4HR6C 3N0KA 1G9BA 1HCDA 1PC8B 3BADA 3A07A 1BLAA 2F8XC 3VT0A 3RSJA 3V79C 1JT7A 3FJ9A 2F2FA 3ZC9A 1SZ6B 4JAWA 1S0DA 4KBBA 3HALA 3FJHA 3NBCA 2M49A 5FZZA 4G6MA 1QQKA 3V0BB 1PWAA 2YUGA 4IQPA 3AKGA 4AN6A 1AVAC 4R6UB 1L2HA 4DENA 2FFVA 3WO4A 4JQ0A 3BB2A 2NYYA 4I4YA 4CJMA 1ABRB 4EFQA 1DFCA 3UD8A 2GO2A 2D23A 2ZQNA 4G9NA 4I4SA 4L4IA 3RTIB 3OGGA 3E8LC 2DRZA 3JRRA 5DVHA 5F8WA 4JRAA 5GAQA 1Z4SA 1AXMA 1W3FA 4ZFWB 2QYIB 4QKSA 3NBNA 1FQ9A 2KKIA 4J2KA 2RSTA 2AXMA 3FJJA 4JP0A 2X2TA 3RMXA 1YTOA 3LTQA 5FZYA 3LLPA 3BAGA 1S0EA 4LO2A 1IRPA 3AKIA 3HMYA 3CRHA 1V6WA 3IIRA 3MALA 3N7MA 1MC9A 3UD7A 3WO2A 2ZR1B 3NJ5A 3OJ2A 1DZDA 1S0FA 1S0LA 2NM1A 4J2YA 1G82A 4J2XA 4QALA 1A8DA 2BEBA 1WBCA 5BP5C 1PUUB 5FNXA 3HOMA 2HWAA 3C9ZA 3WMUA 1BFGA 1EVTA 3CAHA 3CA6A 3BRGC 1M16A 3FUOA 1TWMA 1EPWA 3PHZA 4QBVA 4GP3A 1XZZA 1FMMS 4EFPA 1K5UA 4J23B 1BFBA 4ZKTB 3AZWA 4I1BA 4I4PA 4GOYA 2DS0A 4GAFA 5I1BA 1R8OA 2LIEA 4JKQA 3POKA 1I1EA 1DIWA 1J0SA 5BQUC 2Q9XA 1II4A 4LO0C 3FJAA 4Q9GA 1UPSA 2FDBM 2ZQOA 1PUMB 1IOBA 1FV2A 2AQZA 5DUYA 2E4MC 4IYBA 1AF9A 4IZEA 1ISVA 4QKRA 4P6AA 4I4XA 2BEAA 1Z0HA 4H9WA 1SR4A 5EHAA 4Q91A 1HCEA 4D8HA 3VSZA 2NVHA 2NZ9A 3OJMA 3AJ6A 3BA5A 4G1RA 1V6UA 3AH1A 3D7WB 2KLLA 3WA1A 4PC4A 5JMCA 1IILA 4I96A 5F90A 3PUBA 3R4UA 4P0LA 4X38A 6I1BA 3V0AB 3CA4A 31BIA 4ZLBB 2D7RA 1M2TB 2KH2A 3O44A 3BAOA 4I7IA 2K4AB 1ONKB 5E24E 5BXTA 3NBEA 5D62A 1BASA 3BRFA 1IT0A 1V6XA 4X39A 1TWEA 3FJKA 2F2FC 3FUQA 4F83A 2MIBA 1WBAA 4II0A 1G9CA 4LO7B 2GZBA 3I2AA 1DZCA 3CQAA 2I1BA 1HWNB 4OW4A 3PG0A 1ISZA 1MD6A 5BVPI 4LO3C 1WD4A 2RG9B 1FGAA 2HZ9A 1AVWB 3AKFA 3OBRA 3OGFA 1TIEA 2HW9A 1Z2VA 4LO1A 3N7KA 3A22A 3H6SE 4FVVA 3W9TA 2DREA 3BTAA 4GAIA 3N7LA 3O3QA 1BARA 4Z9WB 5F8YA 3H6QA 3EF2A 3FJCA 4H04A 4I0YA 1S0GA 2D22A 1RG8A 4QD2B 4IY8A 3TC2A 1NUNA 1OQLB 1RY7A 3FJIA 1FWUA 1G9AA 1I1BA 4IONA 3QYDA 1VCLA 1V6VA 3HBWA 3ILAA 3IM7A 4IZXA 3O5WB 4P0KA 4I37A 4LO2C 5D63A 4ZBVB 4EB2B 3CA0A 2VSEA 3QR5A 4KEIA 4P0JA 5BXPA 2BFHA 4DCKC 1WD3A 1BLDA 3WINA 1G9DA 1BFFA 1QXMA 3VUOA 5DZUA 1CVSA 2VLCA 2VXRA 1E0OA 4G9MA 4J2SA 3S8KA 1TOOA 2ESUA 3UD9A 1JLXA 3FJ8A 1P63A 4EEEB 1DLLA 1Q03A 3RMYA 3H6RA 4OEFA 4KEKA 4ISQA 3BAQA 3RTJB 1JY0A 3VSFA 3CA3A 1D0HA 2KI4A 2D7IA 3P6IA 5BP5A 3O49A 4DEPA 1HKNA 1YXWA 3HN1A 4GOVA 2D1ZA 3VT2A 3OJVA 4XFUA 3AJ5A 3BAVA 1ILR1 2XOAA 2D43A 1S0BA 3PMEA 21BIA 2D44A 4XFTA 5B2HA 1CE7B 5BQUA 3BRDA 1SR4C 2QN4A 1S0CA 4KC3A 1YYNA 2Y9GA 3I2XA 1YBIA 2Z49A 3Q7XA 4OUJA 3VWCA 3O4OA 5BXSA 4KEJA 4I6IA 4LO8B 2AAIB 1T9FA 1IRAX 1DQGA 4XFSA 4JKXB 4I3NA 2LIQA 3N7JA 4Z8SB 1FWVA 2FO1A 1TP0A 4EFRA 2VU9A 2X2SA 3IAGC 1JTCA 2Q3NB 4ZFUB 4L4HA 3FJEA 2VXTI 4A7YA 5JLVA 4HA2A 1N4KA 2K8RA 3JUTA 3P53A 5D61A 1FMZA 1Q04A
chains in the Genus database with same CATH superfamily
9ILBA 3CRGA 4LO7C 1BA7A 3CU1B 4D0ZA 3ZXGA 1F31A 1W3GA 5HPZA 4IY9A 1HWOB 3O4AA 3V0BA 4I8MA 4OEGA 4OWJA 1Q1UA 3S8JA 2R9KB 2KI6B 3VEQA 8I1BA 3MPPG 2NTDA 3BAUA 4USOA 2VSAA 1DJSB 1GGPB 2D20A 3F1RA 4TLPA 5BXRA 2D24A 4LO1C 4LO3A 1NZKA 3AH2A 3T8SA 2P39A 3Q7YA 1JT5A 2K43A 2J3PA 2WRYA 4QD2C 3KMVA 1HIBA 4I4UA 1FV3A 5EC5A 1AVUA 2UUSA 3CA1A 1QQLA 1IHKA 4MZFB 4USPA 4OWLA 5F8SA 2Y9WC 4I4RA 3UJ4A 1ITBA 3F62B 3VT1A 2FGFA 1ISXA 3A23A 1HWPB 1IJTA 2Y9XE 4ZOTA 1XHBA 3CRIA 3Q7WA 3BA4A 2IWTB 1ISWA 4F34A 2MLLB 3FJDA 4I4VA 4A7KA 4JPZA 3WINC 4X3AA 2P23A 3WMVA 3FJFA 1XG6A 1XYFA 5DSSB 3ZXDA 3NBDA 1JQZA 4QO3A 3BX1C 5BOWA 4I2SA 4UY4A 1EV2A 4ZA3B 2NP0A 2VUAA 2AFGA 3AH4A 4I4OA 1ISYA 3A21A 4I4QA 3H6RB 1T4QA 3I29B 1EYLA 2ERMA 4Q9PA 2RQ9A 2ET2A 5G00A 5FZUA 4EKXB 4QC4A 2FFUA 41BIA 1BFCA 4I1EA 4G6JA 4QBCA 4A7ZA 1HWMB 4MZHA 4X37A 4IHZA 2Z48A 3O4BA 3OBTA 4FGFA 4OEEA 3FFZA 1RZOB 1PZZA 1AFCA 2DRYA 3CA5A 3K1XA 4D0TA 3BAHA 4ENDA 4AN7B 3BA7A 3AKHA 4LO0A 4XKIA 1FN0A 3ZC8A 3O4DA 4ISRA 3O4CA 3B9UA 2Y9FA 3AZVA 7I1BA 2E4MA 3FJBA 2L5XA 2MC2A 1TTUA 3IM5A 4HJJA 1YF8B 1JT3A 2WBCA 3ZX7A 1DQOA 1DFQA 3IM6A 3P6JA 4GP0A 3UDAA 4OWKA 1JT4A 1R8NA 4ZFYB 2IHOA 1TFMB 4WBCA 1K5VA 3HSMA 1W3AA 3V0AA 3WO3A 4YOLA 1JLYA 3UJ0A 1KNMA 1RMLA 2HWMA 4ZGRB 5EG6C 5FNWA 3R4SA 3SNVA 3FGMA 1AVXB 4HR6C 3N0KA 1G9BA 1HCDA 1PC8B 3BADA 3A07A 1BLAA 2F8XC 3VT0A 3RSJA 3V79C 1JT7A 3FJ9A 2F2FA 3ZC9A 1SZ6B 4JAWA 1S0DA 4KBBA 3HALA 3FJHA 3NBCA 2M49A 5FZZA 4G6MA 1QQKA 3V0BB 1PWAA 2YUGA 4IQPA 3AKGA 4AN6A 1AVAC 4R6UB 1L2HA 4DENA 2FFVA 3WO4A 4JQ0A 3BB2A 2NYYA 4I4YA 4CJMA 1ABRB 4EFQA 1DFCA 3UD8A 2GO2A 2D23A 2ZQNA 4G9NA 4I4SA 4L4IA 3RTIB 3OGGA 3E8LC 2DRZA 3JRRA 5DVHA 5F8WA 4JRAA 5GAQA 1Z4SA 1AXMA 1W3FA 4ZFWB 2QYIB 4QKSA 3NBNA 1FQ9A 2KKIA 4J2KA 2RSTA 2AXMA 3FJJA 4JP0A 2X2TA 3RMXA 1YTOA 3LTQA 5FZYA 3LLPA 3BAGA 1S0EA 4LO2A 1IRPA 3AKIA 3HMYA 3CRHA 1V6WA 3IIRA 3MALA 3N7MA 1MC9A 3UD7A 3WO2A 2ZR1B 3NJ5A 3OJ2A 1DZDA 1S0FA 1S0LA 2NM1A 4J2YA 1G82A 4J2XA 4QALA 1A8DA 2BEBA 1WBCA 5BP5C 1PUUB 5FNXA 3HOMA 2HWAA 3C9ZA 3WMUA 1BFGA 1EVTA 3CAHA 3CA6A 3BRGC 1M16A 3FUOA 1TWMA 1EPWA 3PHZA 4QBVA 4GP3A 1XZZA 1FMMS 4EFPA 1K5UA 4J23B 1BFBA 4ZKTB 3AZWA 4I1BA 4I4PA 4GOYA 2DS0A 4GAFA 5I1BA 1R8OA 2LIEA 4JKQA 3POKA 1I1EA 1DIWA 1J0SA 5BQUC 2Q9XA 1II4A 4LO0C 3FJAA 4Q9GA 1UPSA 2FDBM 2ZQOA 1PUMB 1IOBA 1FV2A 2AQZA 5DUYA 2E4MC 4IYBA 1AF9A 4IZEA 1ISVA 4QKRA 4P6AA 4I4XA 2BEAA 1Z0HA 4H9WA 1SR4A 5EHAA 4Q91A 1HCEA 4D8HA 3VSZA 2NVHA 2NZ9A 3OJMA 3AJ6A 3BA5A 4G1RA 1V6UA 3AH1A 3D7WB 2KLLA 3WA1A 4PC4A 5JMCA 1IILA 4I96A 5F90A 3PUBA 3R4UA 4P0LA 4X38A 6I1BA 3V0AB 3CA4A 31BIA 4ZLBB 2D7RA 1M2TB 2KH2A 3O44A 3BAOA 4I7IA 2K4AB 1ONKB 5E24E 5BXTA 3NBEA 5D62A 1BASA 2NS2A 3BRFA 1IT0A 1V6XA 4X39A 1TWEA 3FJKA 2F2FC 3FUQA 4F83A 2MIBA 1WBAA 4II0A 1G9CA 4LO7B 2GZBA 3I2AA 1DZCA 3CQAA 2I1BA 1HWNB 4OW4A 3PG0A 1ISZA 1MD6A 5BVPI 4LO3C 1WD4A 2RG9B 1FGAA 2HZ9A 1AVWB 3AKFA 3OBRA 3OGFA 1TIEA 2HW9A 1Z2VA 4LO1A 3N7KA 3A22A 3H6SE 4FVVA 3W9TA 2DREA 3BTAA 4GAIA 3N7LA 3O3QA 1BARA 4Z9WB 5F8YA 3H6QA 3EF2A 3FJCA 4H04A 4I0YA 1S0GA 2D22A 1RG8A 4QD2B 4MZGB 4IY8A 3TC2A 1NUNA 1OQLB 1RY7A 3FJIA 1FWUA 1G9AA 1I1BA 4IONA 3QYDA 1VCLA 1V6VA 3HBWA 3ILAA 3IM7A 4IZXA 3O5WB 4P0KA 4I37A 4LO2C 5D63A 4ZBVB 4EB2B 3CA0A 2VSEA 3QR5A 4KEIA 4P0JA 5BXPA 2BFHA 4DCKC 1WD3A 1BLDA 3WINA 1G9DA 1BFFA 1QXMA 4H75A 3VUOA 5DZUA 1CVSA 2VLCA 2VXRA 1E0OA 4G9MA 4J2SA 3S8KA 1TOOA 2ESUA 3UD9A 1JLXA 3FJ8A 1P63A 4EEEB 1DLLA 1Q03A 3RMYA 3H6RA 4OEFA 4KEKA 4ISQA 3BAQA 3RTJB 1JY0A 3VSFA 3CA3A 1D0HA 2KI4A 2D7IA 3P6IA 5BP5A 3O49A 4DEPA 1HKNA 1YXWA 3HN1A 4GOVA 2D1ZA 3VT2A 3OJVA 4XFUA 3AJ5A 3BAVA 1ILR1 2XOAA 2D43A 1S0BA 3PMEA 21BIA 2D44A 4XFTA 5B2HA 1CE7B 5BQUA 3BRDA 1SR4C 2QN4A 1S0CA 4KC3A 1YYNA 2Y9GA 3I2XA 1YBIA 2Z49A 3Q7XA 4OUJA 3VWCA 3O4OA 5BXSA 4KEJA 4I6IA 4LO8B 2AAIB 1T9FA 1IRAX 1DQGA 4XFSA 4JKXB 4I3NA 2LIQA 3N7JA 4Z8SB 1FWVA 2FO1A 1TP0A 4EFRA 2VU9A 2X2SA 3IAGC 1JTCA 2Q3NB 4ZFUB 4L4HA 3FJEA 2VXTI 4A7YA 5JLVA 4HA2A 1N4KA 2K8RA 3JUTA 3P53A 5D61A 1FMZA 1Q04A
chains in the Genus database with same CATH topology
9ILBA 3CRGA 4LO7C 1BA7A 3CU1B 4D0ZA 3ZXGA 1F31A 1W3GA 5HPZA 4IY9A 1HWOB 3O4AA 3V0BA 4I8MA 4OEGA 4OWJA 1Q1UA 3S8JA 2R9KB 2KI6B 3VEQA 8I1BA 3MPPG 2NTDA 3BAUA 4USOA 2VSAA 1DJSB 1GGPB 2D20A 3F1RA 4TLPA 5BXRA 2D24A 4LO1C 4LO3A 1NZKA 3AH2A 3T8SA 2P39A 3Q7YA 1JT5A 2K43A 2J3PA 2WRYA 4QD2C 3KMVA 1HIBA 4I4UA 1FV3A 5EC5A 1AVUA 2UUSA 3CA1A 1QQLA 1IHKA 4MZFB 4USPA 4OWLA 5F8SA 2Y9WC 4I4RA 3UJ4A 1ITBA 3F62B 3VT1A 2FGFA 1ISXA 3A23A 1HWPB 1IJTA 2Y9XE 4ZOTA 1XHBA 3CRIA 3Q7WA 3BA4A 2IWTB 1ISWA 4F34A 2MLLB 3FJDA 4I4VA 4A7KA 4JPZA 3WINC 4X3AA 2P23A 3WMVA 3FJFA 1XG6A 1XYFA 5DSSB 3ZXDA 3NBDA 1JQZA 4QO3A 3BX1C 5BOWA 4I2SA 4UY4A 1EV2A 4ZA3B 2NP0A 2VUAA 2AFGA 3AH4A 4I4OA 1ISYA 3A21A 4I4QA 3H6RB 1T4QA 3I29B 1EYLA 2ERMA 4Q9PA 2RQ9A 2ET2A 5G00A 5FZUA 4EKXB 4QC4A 2FFUA 41BIA 1BFCA 4I1EA 4G6JA 4QBCA 4A7ZA 1HWMB 4MZHA 4X37A 4IHZA 2Z48A 3O4BA 3OBTA 4FGFA 4OEEA 3FFZA 1RZOB 1PZZA 1AFCA 2DRYA 3CA5A 3K1XA 4D0TA 3BAHA 4ENDA 4AN7B 3BA7A 3AKHA 4LO0A 4XKIA 1FN0A 3ZC8A 3O4DA 4ISRA 3O4CA 3B9UA 2Y9FA 3AZVA 7I1BA 2E4MA 3FJBA 2L5XA 2MC2A 1TTUA 3IM5A 4HJJA 1YF8B 1JT3A 2WBCA 3ZX7A 1DQOA 1DFQA 3IM6A 3P6JA 4GP0A 3UDAA 4OWKA 1JT4A 1R8NA 4ZFYB 2IHOA 1TFMB 4WBCA 1K5VA 3HSMA 1W3AA 3V0AA 3WO3A 4YOLA 1JLYA 3UJ0A 1KNMA 1RMLA 2HWMA 4ZGRB 5EG6C 5FNWA 3R4SA 3SNVA 3FGMA 1AVXB 4HR6C 3N0KA 1G9BA 1HCDA 1PC8B 3BADA 3A07A 1BLAA 2F8XC 3VT0A 3RSJA 3V79C 1JT7A 3FJ9A 2F2FA 3ZC9A 1SZ6B 4JAWA 1S0DA 4KBBA 3HALA 3FJHA 3NBCA 2M49A 5FZZA 4G6MA 1QQKA 3V0BB 1PWAA 2YUGA 4IQPA 3AKGA 4AN6A 1AVAC 4R6UB 1L2HA 4DENA 2FFVA 3WO4A 4JQ0A 3BB2A 2NYYA 4I4YA 4CJMA 1ABRB 4EFQA 1DFCA 3UD8A 2GO2A 2D23A 2ZQNA 4G9NA 4I4SA 4L4IA 3RTIB 3OGGA 3E8LC 2DRZA 3JRRA 5DVHA 5F8WA 4JRAA 5GAQA 1Z4SA 1AXMA 1W3FA 4ZFWB 2QYIB 4QKSA 3NBNA 1FQ9A 2KKIA 4J2KA 2RSTA 2AXMA 3FJJA 4JP0A 2X2TA 3RMXA 1YTOA 3LTQA 5FZYA 3LLPA 3BAGA 1S0EA 4LO2A 1IRPA 3AKIA 3HMYA 3CRHA 1V6WA 3IIRA 3MALA 3N7MA 1MC9A 3UD7A 3WO2A 2ZR1B 3NJ5A 3OJ2A 1DZDA 1S0FA 1S0LA 2NM1A 4J2YA 1G82A 4J2XA 4QALA 1A8DA 2BEBA 1WBCA 5BP5C 1PUUB 5FNXA 3HOMA 2HWAA 3C9ZA 3WMUA 1BFGA 1EVTA 3CAHA 3CA6A 3BRGC 1M16A 3FUOA 1TWMA 1EPWA 3PHZA 4QBVA 4GP3A 1XZZA 1FMMS 4EFPA 1K5UA 4J23B 1BFBA 4ZKTB 3AZWA 4I1BA 4I4PA 4GOYA 2DS0A 4GAFA 5I1BA 1R8OA 2LIEA 4JKQA 3POKA 1I1EA 1DIWA 1J0SA 5BQUC 2Q9XA 1II4A 4LO0C 3FJAA 4Q9GA 1UPSA 2FDBM 2ZQOA 1PUMB 1IOBA 1FV2A 2AQZA 5DUYA 2E4MC 4IYBA 1AF9A 4IZEA 1ISVA 4QKRA 4P6AA 4I4XA 2BEAA 1Z0HA 4H9WA 1SR4A 5EHAA 4Q91A 1HCEA 4D8HA 3VSZA 2NVHA 2NZ9A 3OJMA 3AJ6A 3BA5A 4G1RA 1V6UA 3AH1A 3D7WB 2KLLA 3WA1A 4PC4A 5JMCA 1IILA 4I96A 5F90A 3PUBA 3R4UA 4P0LA 4X38A 6I1BA 3V0AB 3CA4A 31BIA 4ZLBB 2D7RA 1M2TB 2KH2A 3O44A 3BAOA 4I7IA 2K4AB 1ONKB 5E24E 5BXTA 3NBEA 5D62A 1BASA 2NS2A 3BRFA 1IT0A 1V6XA 4X39A 1TWEA 3FJKA 2F2FC 3FUQA 4F83A 2MIBA 1WBAA 4II0A 1G9CA 4LO7B 2GZBA 3I2AA 1DZCA 3CQAA 2I1BA 1HWNB 4OW4A 3PG0A 1ISZA 1MD6A 5BVPI 4LO3C 1WD4A 2RG9B 1FGAA 2HZ9A 1AVWB 3AKFA 3OBRA 3OGFA 1TIEA 2HW9A 1Z2VA 4LO1A 3N7KA 3A22A 3H6SE 4FVVA 3W9TA 2DREA 3BTAA 4GAIA 3N7LA 3O3QA 1BARA 4Z9WB 5F8YA 3H6QA 3EF2A 3FJCA 4H04A 4I0YA 1S0GA 2D22A 1RG8A 4QD2B 4MZGB 4IY8A 3TC2A 1NUNA 1OQLB 1RY7A 3FJIA 1FWUA 1G9AA 1I1BA 4IONA 3QYDA 1VCLA 1V6VA 3HBWA 3ILAA 3IM7A 4IZXA 3O5WB 4P0KA 4I37A 4LO2C 5D63A 4ZBVB 4EB2B 3CA0A 2VSEA 3QR5A 4KEIA 4P0JA 5BXPA 2BFHA 4DCKC 1WD3A 1BLDA 3WINA 1G9DA 1BFFA 1QXMA 4H75A 3VUOA 5DZUA 1CVSA 2VLCA 2VXRA 1E0OA 4G9MA 4J2SA 3S8KA 1TOOA 2ESUA 3UD9A 1JLXA 3FJ8A 1P63A 4EEEB 1DLLA 1Q03A 3RMYA 3H6RA 4OEFA 4KEKA 4ISQA 3BAQA 3RTJB 1JY0A 3VSFA 3CA3A 1D0HA 2KI4A 2D7IA 3P6IA 5BP5A 3O49A 4DEPA 1HKNA 1YXWA 3HN1A 4GOVA 2D1ZA 3VT2A 3OJVA 4XFUA 3AJ5A 3BAVA 1ILR1 2XOAA 2D43A 1S0BA 3PMEA 21BIA 2D44A 4XFTA 5B2HA 1CE7B 5BQUA 3BRDA 1SR4C 2QN4A 1S0CA 4KC3A 1YYNA 2Y9GA 3I2XA 1YBIA 2Z49A 3Q7XA 4OUJA 3VWCA 3O4OA 5BXSA 4KEJA 4I6IA 4LO8B 2AAIB 1T9FA 1IRAX 1DQGA 4XFSA 4JKXB 4I3NA 2LIQA 3N7JA 4Z8SB 1FWVA 2FO1A 1TP0A 4EFRA 2VU9A 2X2SA 3IAGC 1JTCA 2Q3NB 4ZFUB 4L4HA 3FJEA 2VXTI 4A7YA 5JLVA 4HA2A 1N4KA 2K8RA 3JUTA 3P53A 5D61A 1FMZA 1Q04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 9ILB A;  3CRG A;  4LO7 C;  1BA7 A;  3CU1 B;  4D0Z A;  3ZXG A;  1F31 A;  1W3G A;  5HPZ A;  4IY9 A;  1HWO B;  3O4A A;  3V0B A;  4I8M A;  4OEG A;  4OWJ A;  1Q1U A;  3S8J A;  2R9K B;  2KI6 B;  3VEQ A;  8I1B A;  3MPP G;  2NTD A;  3BAU A;  4USO A;  2VSA A;  1DJS B;  1GGP B;  2D20 A;  3F1R A;  4TLP A;  5BXR A;  2D24 A;  4LO1 C;  4LO3 A;  1NZK A;  3AH2 A;  3T8S A;  2P39 A;  3Q7Y A;  1JT5 A;  2K43 A;  2J3P A;  2WRY A;  4QD2 C;  3KMV A;  1HIB A;  4I4U A;  1FV3 A;  5EC5 A;  1AVU A;  2UUS A;  3CA1 A;  1QQL A;  1IHK A;  4USP A;  4OWL A;  5F8S A;  2Y9W C;  4I4R A;  3UJ4 A;  1ITB A;  3F62 B;  3VT1 A;  2FGF A;  1ISX A;  3A23 A;  1HWP B;  1IJT A;  2Y9X E;  4ZOT A;  1XHB A;  3CRI A;  3Q7W A;  3BA4 A;  2IWT B;  1ISW A;  4F34 A;  2MLL B;  3FJD A;  4I4V A;  4A7K A;  4JPZ A;  3WIN C;  4X3A A;  2P23 A;  3WMV A;  3FJF A;  1XG6 A;  1XYF A;  5DSS B;  3ZXD A;  3NBD A;  1JQZ A;  4QO3 A;  3BX1 C;  5BOW A;  4I2S A;  1EV2 A;  4ZA3 B;  2NP0 A;  2VUA A;  2AFG A;  3AH4 A;  4I4O A;  1ISY A;  3A21 A;  4I4Q A;  3H6R B;  1T4Q A;  3I29 B;  1EYL A;  2ERM A;  4Q9P A;  2RQ9 A;  2ET2 A;  5G00 A;  5FZU A;  4EKX B;  4QC4 A;  2FFU A;  41BI A;  1BFC A;  4I1E A;  4G6J A;  4QBC A;  4A7Z A;  1HWM B;  4X37 A;  4IHZ A;  2Z48 A;  3O4B A;  3OBT A;  4FGF A;  4OEE A;  3FFZ A;  1RZO B;  1PZZ A;  1AFC A;  2DRY A;  3CA5 A;  3K1X A;  4D0T A;  3BAH A;  4END A;  4AN7 B;  3BA7 A;  3AKH A;  4LO0 A;  4XKI A;  1FN0 A;  3ZC8 A;  3O4D A;  4ISR A;  3O4C A;  3B9U A;  2Y9F A;  3AZV A;  7I1B A;  2E4M A;  3FJB A;  2L5X A;  2MC2 A;  1TTU A;  3IM5 A;  4HJJ A;  1YF8 B;  1JT3 A;  2WBC A;  3ZX7 A;  1DQO A;  1DFQ A;  3IM6 A;  3P6J A;  4GP0 A;  3UDA A;  4OWK A;  1JT4 A;  1R8N A;  4ZFY B;  2IHO A;  1TFM B;  4WBC A;  1K5V A;  3HSM A;  1W3A A;  3V0A A;  3WO3 A;  4YOL A;  1JLY A;  3UJ0 A;  1KNM A;  1RML A;  2HWM A;  4ZGR B;  5EG6 C;  5FNW A;  3R4S A;  3SNV A;  3FGM A;  1AVX B;  4HR6 C;  3N0K A;  1G9B A;  1HCD A;  1PC8 B;  3BAD A;  3A07 A;  1BLA A;  2F8X C;  3VT0 A;  3RSJ A;  3V79 C;  1JT7 A;  3FJ9 A;  2F2F A;  3ZC9 A;  1SZ6 B;  4JAW A;  1S0D A;  4KBB A;  3HAL A;  3FJH A;  3NBC A;  2M49 A;  5FZZ A;  4G6M A;  1QQK A;  3V0B B;  1PWA A;  2YUG A;  4IQP A;  3AKG A;  4AN6 A;  1AVA C;  4R6U B;  1L2H A;  4DEN A;  2FFV A;  3WO4 A;  4JQ0 A;  3BB2 A;  2NYY A;  4I4Y A;  4CJM A;  1ABR B;  4EFQ A;  1DFC A;  3UD8 A;  2GO2 A;  2D23 A;  2ZQN A;  4G9N A;  4I4S A;  4L4I A;  3RTI B;  3OGG A;  3E8L C;  2DRZ A;  3JRR A;  5DVH A;  5F8W A;  4JRA A;  5GAQ A;  1Z4S A;  1AXM A;  1W3F A;  4ZFW B;  2QYI B;  4QKS A;  3NBN A;  1FQ9 A;  2KKI A;  4J2K A;  2RST A;  2AXM A;  3FJJ A;  4JP0 A;  2X2T A;  3RMX A;  1YTO A;  3LTQ A;  5FZY A;  3LLP A;  3BAG A;  1S0E A;  4LO2 A;  1IRP A;  3AKI A;  3HMY A;  3CRH A;  1V6W A;  3IIR A;  3MAL A;  3N7M A;  1MC9 A;  3UD7 A;  3WO2 A;  2ZR1 B;  3NJ5 A;  3OJ2 A;  1DZD A;  1S0F A;  1S0L A;  2NM1 A;  4J2Y A;  1G82 A;  4J2X A;  4QAL A;  1A8D A;  2BEB A;  1WBC A;  5BP5 C;  1PUU B;  5FNX A;  3HOM A;  2HWA A;  3C9Z A;  3WMU A;  1BFG A;  1EVT A;  3CAH A;  3CA6 A;  3BRG C;  1M16 A;  3FUO A;  1TWM A;  1EPW A;  3PHZ A;  4QBV A;  4GP3 A;  1XZZ A;  1FMM S;  4EFP A;  1K5U A;  4J23 B;  1BFB A;  4ZKT B;  3AZW A;  4I1B A;  4I4P A;  4GOY A;  2DS0 A;  4GAF A;  5I1B A;  1R8O A;  2LIE A;  4JKQ A;  3POK A;  1I1E A;  1DIW A;  1J0S A;  5BQU C;  2Q9X A;  1II4 A;  4LO0 C;  3FJA A;  4Q9G A;  1UPS A;  2FDB M;  2ZQO A;  1PUM B;  1IOB A;  1FV2 A;  2AQZ A;  5DUY A;  2E4M C;  4IYB A;  1AF9 A;  4IZE A;  1ISV A;  4QKR A;  4P6A A;  4I4X A;  2BEA A;  1Z0H A;  4H9W A;  1SR4 A;  5EHA A;  4Q91 A;  1HCE A;  4D8H A;  3VSZ A;  2NVH A;  2NZ9 A;  3OJM A;  3AJ6 A;  3BA5 A;  4G1R A;  1V6U A;  3AH1 A;  3D7W B;  2KLL A;  3WA1 A;  4PC4 A;  5JMC A;  1IIL A;  4I96 A;  5F90 A;  3PUB A;  3R4U A;  4P0L A;  4X38 A;  6I1B A;  3V0A B;  3CA4 A;  31BI A;  4ZLB B;  2D7R A;  1M2T B;  2KH2 A;  3O44 A;  3BAO A;  4I7I A;  2K4A B;  1ONK B;  5E24 E;  5BXT A;  3NBE A;  5D62 A;  1BAS A;  3BRF A;  1IT0 A;  1V6X A;  4X39 A;  1TWE A;  3FJK A;  2F2F C;  3FUQ A;  4F83 A;  2MIB A;  1WBA A;  4II0 A;  1G9C A;  4LO7 B;  2GZB A;  3I2A A;  1DZC A;  3CQA A;  2I1B A;  1HWN B;  4OW4 A;  3PG0 A;  1ISZ A;  1MD6 A;  5BVP I;  4LO3 C;  1WD4 A;  2RG9 B;  1FGA A;  2HZ9 A;  1AVW B;  3AKF A;  3OBR A;  3OGF A;  1TIE A;  2HW9 A;  1Z2V A;  4LO1 A;  3N7K A;  3A22 A;  3H6S E;  4FVV A;  3W9T A;  2DRE A;  3BTA A;  4GAI A;  3N7L A;  3O3Q A;  1BAR A;  4Z9W B;  5F8Y A;  3H6Q A;  3EF2 A;  3FJC A;  4H04 A;  4I0Y A;  1S0G A;  2D22 A;  1RG8 A;  4QD2 B;  4IY8 A;  3TC2 A;  1NUN A;  1OQL B;  1RY7 A;  3FJI A;  1FWU A;  1G9A A;  1I1B A;  4ION A;  3QYD A;  1VCL A;  1V6V A;  3HBW A;  3ILA A;  3IM7 A;  4IZX A;  3O5W B;  4P0K A;  4I37 A;  4LO2 C;  5D63 A;  4ZBV B;  4EB2 B;  3CA0 A;  2VSE A;  3QR5 A;  4KEI A;  4P0J A;  5BXP A;  2BFH A;  4DCK C;  1WD3 A;  1BLD A;  3WIN A;  1G9D A;  1BFF A;  1QXM A;  3VUO A;  5DZU A;  1CVS A;  2VLC A;  2VXR A;  1E0O A;  4G9M A;  4J2S A;  3S8K A;  1TOO A;  2ESU A;  3UD9 A;  1JLX A;  3FJ8 A;  1P63 A;  4EEE B;  1DLL A;  1Q03 A;  3RMY A;  3H6R A;  4OEF A;  4KEK A;  4ISQ A;  3BAQ A;  3RTJ B;  1JY0 A;  3VSF A;  3CA3 A;  1D0H A;  2KI4 A;  2D7I A;  3P6I A;  5BP5 A;  3O49 A;  4DEP A;  1HKN A;  1YXW A;  3HN1 A;  4GOV A;  2D1Z A;  3VT2 A;  3OJV A;  4XFU A;  3AJ5 A;  3BAV A;  1ILR 1;  2XOA A;  2D43 A;  1S0B A;  3PME A;  21BI A;  2D44 A;  4XFT A;  5B2H A;  1CE7 B;  5BQU A;  3BRD A;  1SR4 C;  2QN4 A;  1S0C A;  4KC3 A;  1YYN A;  2Y9G A;  3I2X A;  1YBI A;  2Z49 A;  3Q7X A;  4OUJ A;  3VWC A;  3O4O A;  5BXS A;  4KEJ A;  4I6I A;  4LO8 B;  2AAI B;  1T9F A;  1IRA X;  1DQG A;  4XFS A;  4JKX B;  4I3N A;  2LIQ A;  3N7J A;  4Z8S B;  1FWV A;  2FO1 A;  1TP0 A;  4EFR A;  2VU9 A;  2X2S A;  3IAG C;  1JTC A;  2Q3N B;  4ZFU B;  4L4H A;  3FJE A;  2VXT I;  4A7Y A;  5JLV A;  4HA2 A;  1N4K A;  2K8R A;  3JUT A;  3P53 A;  5D61 A;  1FMZ A;  1Q04 A; 
#chains in the Genus database with same CATH topology
 9ILB A;  3CRG A;  4LO7 C;  1BA7 A;  3CU1 B;  4D0Z A;  3ZXG A;  1F31 A;  1W3G A;  5HPZ A;  4IY9 A;  1HWO B;  3O4A A;  3V0B A;  4I8M A;  4OEG A;  4OWJ A;  1Q1U A;  3S8J A;  2R9K B;  2KI6 B;  3VEQ A;  8I1B A;  3MPP G;  2NTD A;  3BAU A;  4USO A;  2VSA A;  1DJS B;  1GGP B;  2D20 A;  3F1R A;  4TLP A;  5BXR A;  2D24 A;  4LO1 C;  4LO3 A;  1NZK A;  3AH2 A;  3T8S A;  2P39 A;  3Q7Y A;  1JT5 A;  2K43 A;  2J3P A;  2WRY A;  4QD2 C;  3KMV A;  1HIB A;  4I4U A;  1FV3 A;  5EC5 A;  1AVU A;  2UUS A;  3CA1 A;  1QQL A;  1IHK A;  4MZF B;  4USP A;  4OWL A;  5F8S A;  2Y9W C;  4I4R A;  3UJ4 A;  1ITB A;  3F62 B;  3VT1 A;  2FGF A;  1ISX A;  3A23 A;  1HWP B;  1IJT A;  2Y9X E;  4ZOT A;  1XHB A;  3CRI A;  3Q7W A;  3BA4 A;  2IWT B;  1ISW A;  4F34 A;  2MLL B;  3FJD A;  4I4V A;  4A7K A;  4JPZ A;  3WIN C;  4X3A A;  2P23 A;  3WMV A;  3FJF A;  1XG6 A;  1XYF A;  5DSS B;  3ZXD A;  3NBD A;  1JQZ A;  4QO3 A;  3BX1 C;  5BOW A;  4I2S A;  4UY4 A;  1EV2 A;  4ZA3 B;  2NP0 A;  2VUA A;  2AFG A;  3AH4 A;  4I4O A;  1ISY A;  3A21 A;  4I4Q A;  3H6R B;  1T4Q A;  3I29 B;  1EYL A;  2ERM A;  4Q9P A;  2RQ9 A;  2ET2 A;  5G00 A;  5FZU A;  4EKX B;  4QC4 A;  2FFU A;  41BI A;  1BFC A;  4I1E A;  4G6J A;  4QBC A;  4A7Z A;  1HWM B;  4MZH A;  4X37 A;  4IHZ A;  2Z48 A;  3O4B A;  3OBT A;  4FGF A;  4OEE A;  3FFZ A;  1RZO B;  1PZZ A;  1AFC A;  2DRY A;  3CA5 A;  3K1X A;  4D0T A;  3BAH A;  4END A;  4AN7 B;  3BA7 A;  3AKH A;  4LO0 A;  4XKI A;  1FN0 A;  3ZC8 A;  3O4D A;  4ISR A;  3O4C A;  3B9U A;  2Y9F A;  3AZV A;  7I1B A;  2E4M A;  3FJB A;  2L5X A;  2MC2 A;  1TTU A;  3IM5 A;  4HJJ A;  1YF8 B;  1JT3 A;  2WBC A;  3ZX7 A;  1DQO A;  1DFQ A;  3IM6 A;  3P6J A;  4GP0 A;  3UDA A;  4OWK A;  1JT4 A;  1R8N A;  4ZFY B;  2IHO A;  1TFM B;  4WBC A;  1K5V A;  3HSM A;  1W3A A;  3V0A A;  3WO3 A;  4YOL A;  1JLY A;  3UJ0 A;  1KNM A;  1RML A;  2HWM A;  4ZGR B;  5EG6 C;  5FNW A;  3R4S A;  3SNV A;  3FGM A;  1AVX B;  4HR6 C;  3N0K A;  1G9B A;  1HCD A;  1PC8 B;  3BAD A;  3A07 A;  1BLA A;  2F8X C;  3VT0 A;  3RSJ A;  3V79 C;  1JT7 A;  3FJ9 A;  2F2F A;  3ZC9 A;  1SZ6 B;  4JAW A;  1S0D A;  4KBB A;  3HAL A;  3FJH A;  3NBC A;  2M49 A;  5FZZ A;  4G6M A;  1QQK A;  3V0B B;  1PWA A;  2YUG A;  4IQP A;  3AKG A;  4AN6 A;  1AVA C;  4R6U B;  1L2H A;  4DEN A;  2FFV A;  3WO4 A;  4JQ0 A;  3BB2 A;  2NYY A;  4I4Y A;  4CJM A;  1ABR B;  4EFQ A;  1DFC A;  3UD8 A;  2GO2 A;  2D23 A;  2ZQN A;  4G9N A;  4I4S A;  4L4I A;  3RTI B;  3OGG A;  3E8L C;  2DRZ A;  3JRR A;  5DVH A;  5F8W A;  4JRA A;  5GAQ A;  1Z4S A;  1AXM A;  1W3F A;  4ZFW B;  2QYI B;  4QKS A;  3NBN A;  1FQ9 A;  2KKI A;  4J2K A;  2RST A;  2AXM A;  3FJJ A;  4JP0 A;  2X2T A;  3RMX A;  1YTO A;  3LTQ A;  5FZY A;  3LLP A;  3BAG A;  1S0E A;  4LO2 A;  1IRP A;  3AKI A;  3HMY A;  3CRH A;  1V6W A;  3IIR A;  3MAL A;  3N7M A;  1MC9 A;  3UD7 A;  3WO2 A;  2ZR1 B;  3NJ5 A;  3OJ2 A;  1DZD A;  1S0F A;  1S0L A;  2NM1 A;  4J2Y A;  1G82 A;  4J2X A;  4QAL A;  1A8D A;  2BEB A;  1WBC A;  5BP5 C;  1PUU B;  5FNX A;  3HOM A;  2HWA A;  3C9Z A;  3WMU A;  1BFG A;  1EVT A;  3CAH A;  3CA6 A;  3BRG C;  1M16 A;  3FUO A;  1TWM A;  1EPW A;  3PHZ A;  4QBV A;  4GP3 A;  1XZZ A;  1FMM S;  4EFP A;  1K5U A;  4J23 B;  1BFB A;  4ZKT B;  3AZW A;  4I1B A;  4I4P A;  4GOY A;  2DS0 A;  4GAF A;  5I1B A;  1R8O A;  2LIE A;  4JKQ A;  3POK A;  1I1E A;  1DIW A;  1J0S A;  5BQU C;  2Q9X A;  1II4 A;  4LO0 C;  3FJA A;  4Q9G A;  1UPS A;  2FDB M;  2ZQO A;  1PUM B;  1IOB A;  1FV2 A;  2AQZ A;  5DUY A;  2E4M C;  4IYB A;  1AF9 A;  4IZE A;  1ISV A;  4QKR A;  4P6A A;  4I4X A;  2BEA A;  1Z0H A;  4H9W A;  1SR4 A;  5EHA A;  4Q91 A;  1HCE A;  4D8H A;  3VSZ A;  2NVH A;  2NZ9 A;  3OJM A;  3AJ6 A;  3BA5 A;  4G1R A;  1V6U A;  3AH1 A;  3D7W B;  2KLL A;  3WA1 A;  4PC4 A;  5JMC A;  1IIL A;  4I96 A;  5F90 A;  3PUB A;  3R4U A;  4P0L A;  4X38 A;  6I1B A;  3V0A B;  3CA4 A;  31BI A;  4ZLB B;  2D7R A;  1M2T B;  2KH2 A;  3O44 A;  3BAO A;  4I7I A;  2K4A B;  1ONK B;  5E24 E;  5BXT A;  3NBE A;  5D62 A;  1BAS A;  2NS2 A;  3BRF A;  1IT0 A;  1V6X A;  4X39 A;  1TWE A;  3FJK A;  2F2F C;  3FUQ A;  4F83 A;  2MIB A;  1WBA A;  4II0 A;  1G9C A;  4LO7 B;  2GZB A;  3I2A A;  1DZC A;  3CQA A;  2I1B A;  1HWN B;  4OW4 A;  3PG0 A;  1ISZ A;  1MD6 A;  5BVP I;  4LO3 C;  1WD4 A;  2RG9 B;  1FGA A;  2HZ9 A;  1AVW B;  3AKF A;  3OBR A;  3OGF A;  1TIE A;  2HW9 A;  1Z2V A;  4LO1 A;  3N7K A;  3A22 A;  3H6S E;  4FVV A;  3W9T A;  2DRE A;  3BTA A;  4GAI A;  3N7L A;  3O3Q A;  1BAR A;  4Z9W B;  5F8Y A;  3H6Q A;  3EF2 A;  3FJC A;  4H04 A;  4I0Y A;  1S0G A;  2D22 A;  1RG8 A;  4QD2 B;  4MZG B;  4IY8 A;  3TC2 A;  1NUN A;  1OQL B;  1RY7 A;  3FJI A;  1FWU A;  1G9A A;  1I1B A;  4ION A;  3QYD A;  1VCL A;  1V6V A;  3HBW A;  3ILA A;  3IM7 A;  4IZX A;  3O5W B;  4P0K A;  4I37 A;  4LO2 C;  5D63 A;  4ZBV B;  4EB2 B;  3CA0 A;  2VSE A;  3QR5 A;  4KEI A;  4P0J A;  5BXP A;  2BFH A;  4DCK C;  1WD3 A;  1BLD A;  3WIN A;  1G9D A;  1BFF A;  1QXM A;  4H75 A;  3VUO A;  5DZU A;  1CVS A;  2VLC A;  2VXR A;  1E0O A;  4G9M A;  4J2S A;  3S8K A;  1TOO A;  2ESU A;  3UD9 A;  1JLX A;  3FJ8 A;  1P63 A;  4EEE B;  1DLL A;  1Q03 A;  3RMY A;  3H6R A;  4OEF A;  4KEK A;  4ISQ A;  3BAQ A;  3RTJ B;  1JY0 A;  3VSF A;  3CA3 A;  1D0H A;  2KI4 A;  2D7I A;  3P6I A;  5BP5 A;  3O49 A;  4DEP A;  1HKN A;  1YXW A;  3HN1 A;  4GOV A;  2D1Z A;  3VT2 A;  3OJV A;  4XFU A;  3AJ5 A;  3BAV A;  1ILR 1;  2XOA A;  2D43 A;  1S0B A;  3PME A;  21BI A;  2D44 A;  4XFT A;  5B2H A;  1CE7 B;  5BQU A;  3BRD A;  1SR4 C;  2QN4 A;  1S0C A;  4KC3 A;  1YYN A;  2Y9G A;  3I2X A;  1YBI A;  2Z49 A;  3Q7X A;  4OUJ A;  3VWC A;  3O4O A;  5BXS A;  4KEJ A;  4I6I A;  4LO8 B;  2AAI B;  1T9F A;  1IRA X;  1DQG A;  4XFS A;  4JKX B;  4I3N A;  2LIQ A;  3N7J A;  4Z8S B;  1FWV A;  2FO1 A;  1TP0 A;  4EFR A;  2VU9 A;  2X2S A;  3IAG C;  1JTC A;  2Q3N B;  4ZFU B;  4L4H A;  3FJE A;  2VXT I;  4A7Y A;  5JLV A;  4HA2 A;  1N4K A;  2K8R A;  3JUT A;  3P53 A;  5D61 A;  1FMZ A;  1Q04 A; 
#chains in the Genus database with same CATH homology
 9ILB A;  3CRG A;  4LO7 C;  1BA7 A;  3CU1 B;  4D0Z A;  3ZXG A;  1F31 A;  1W3G A;  5HPZ A;  4IY9 A;  1HWO B;  3O4A A;  3V0B A;  4I8M A;  4OEG A;  4OWJ A;  1Q1U A;  3S8J A;  2R9K B;  2KI6 B;  3VEQ A;  8I1B A;  3MPP G;  2NTD A;  3BAU A;  4USO A;  2VSA A;  1DJS B;  1GGP B;  2D20 A;  3F1R A;  4TLP A;  5BXR A;  2D24 A;  4LO1 C;  4LO3 A;  1NZK A;  3AH2 A;  3T8S A;  2P39 A;  3Q7Y A;  1JT5 A;  2K43 A;  2J3P A;  2WRY A;  4QD2 C;  3KMV A;  1HIB A;  4I4U A;  1FV3 A;  5EC5 A;  1AVU A;  2UUS A;  3CA1 A;  1QQL A;  1IHK A;  4MZF B;  4USP A;  4OWL A;  5F8S A;  2Y9W C;  4I4R A;  3UJ4 A;  1ITB A;  3F62 B;  3VT1 A;  2FGF A;  1ISX A;  3A23 A;  1HWP B;  1IJT A;  2Y9X E;  4ZOT A;  1XHB A;  3CRI A;  3Q7W A;  3BA4 A;  2IWT B;  1ISW A;  4F34 A;  2MLL B;  3FJD A;  4I4V A;  4A7K A;  4JPZ A;  3WIN C;  4X3A A;  2P23 A;  3WMV A;  3FJF A;  1XG6 A;  1XYF A;  5DSS B;  3ZXD A;  3NBD A;  1JQZ A;  4QO3 A;  3BX1 C;  5BOW A;  4I2S A;  4UY4 A;  1EV2 A;  4ZA3 B;  2NP0 A;  2VUA A;  2AFG A;  3AH4 A;  4I4O A;  1ISY A;  3A21 A;  4I4Q A;  3H6R B;  1T4Q A;  3I29 B;  1EYL A;  2ERM A;  4Q9P A;  2RQ9 A;  2ET2 A;  5G00 A;  5FZU A;  4EKX B;  4QC4 A;  2FFU A;  41BI A;  1BFC A;  4I1E A;  4G6J A;  4QBC A;  4A7Z A;  1HWM B;  4MZH A;  4X37 A;  4IHZ A;  2Z48 A;  3O4B A;  3OBT A;  4FGF A;  4OEE A;  3FFZ A;  1RZO B;  1PZZ A;  1AFC A;  2DRY A;  3CA5 A;  3K1X A;  4D0T A;  3BAH A;  4END A;  4AN7 B;  3BA7 A;  3AKH A;  4LO0 A;  4XKI A;  1FN0 A;  3ZC8 A;  3O4D A;  4ISR A;  3O4C A;  3B9U A;  2Y9F A;  3AZV A;  7I1B A;  2E4M A;  3FJB A;  2L5X A;  2MC2 A;  1TTU A;  3IM5 A;  4HJJ A;  1YF8 B;  1JT3 A;  2WBC A;  3ZX7 A;  1DQO A;  1DFQ A;  3IM6 A;  3P6J A;  4GP0 A;  3UDA A;  4OWK A;  1JT4 A;  1R8N A;  4ZFY B;  2IHO A;  1TFM B;  4WBC A;  1K5V A;  3HSM A;  1W3A A;  3V0A A;  3WO3 A;  4YOL A;  1JLY A;  3UJ0 A;  1KNM A;  1RML A;  2HWM A;  4ZGR B;  5EG6 C;  5FNW A;  3R4S A;  3SNV A;  3FGM A;  1AVX B;  4HR6 C;  3N0K A;  1G9B A;  1HCD A;  1PC8 B;  3BAD A;  3A07 A;  1BLA A;  2F8X C;  3VT0 A;  3RSJ A;  3V79 C;  1JT7 A;  3FJ9 A;  2F2F A;  3ZC9 A;  1SZ6 B;  4JAW A;  1S0D A;  4KBB A;  3HAL A;  3FJH A;  3NBC A;  2M49 A;  5FZZ A;  4G6M A;  1QQK A;  3V0B B;  1PWA A;  2YUG A;  4IQP A;  3AKG A;  4AN6 A;  1AVA C;  4R6U B;  1L2H A;  4DEN A;  2FFV A;  3WO4 A;  4JQ0 A;  3BB2 A;  2NYY A;  4I4Y A;  4CJM A;  1ABR B;  4EFQ A;  1DFC A;  3UD8 A;  2GO2 A;  2D23 A;  2ZQN A;  4G9N A;  4I4S A;  4L4I A;  3RTI B;  3OGG A;  3E8L C;  2DRZ A;  3JRR A;  5DVH A;  5F8W A;  4JRA A;  5GAQ A;  1Z4S A;  1AXM A;  1W3F A;  4ZFW B;  2QYI B;  4QKS A;  3NBN A;  1FQ9 A;  2KKI A;  4J2K A;  2RST A;  2AXM A;  3FJJ A;  4JP0 A;  2X2T A;  3RMX A;  1YTO A;  3LTQ A;  5FZY A;  3LLP A;  3BAG A;  1S0E A;  4LO2 A;  1IRP A;  3AKI A;  3HMY A;  3CRH A;  1V6W A;  3IIR A;  3MAL A;  3N7M A;  1MC9 A;  3UD7 A;  3WO2 A;  2ZR1 B;  3NJ5 A;  3OJ2 A;  1DZD A;  1S0F A;  1S0L A;  2NM1 A;  4J2Y A;  1G82 A;  4J2X A;  4QAL A;  1A8D A;  2BEB A;  1WBC A;  5BP5 C;  1PUU B;  5FNX A;  3HOM A;  2HWA A;  3C9Z A;  3WMU A;  1BFG A;  1EVT A;  3CAH A;  3CA6 A;  3BRG C;  1M16 A;  3FUO A;  1TWM A;  1EPW A;  3PHZ A;  4QBV A;  4GP3 A;  1XZZ A;  1FMM S;  4EFP A;  1K5U A;  4J23 B;  1BFB A;  4ZKT B;  3AZW A;  4I1B A;  4I4P A;  4GOY A;  2DS0 A;  4GAF A;  5I1B A;  1R8O A;  2LIE A;  4JKQ A;  3POK A;  1I1E A;  1DIW A;  1J0S A;  5BQU C;  2Q9X A;  1II4 A;  4LO0 C;  3FJA A;  4Q9G A;  1UPS A;  2FDB M;  2ZQO A;  1PUM B;  1IOB A;  1FV2 A;  2AQZ A;  5DUY A;  2E4M C;  4IYB A;  1AF9 A;  4IZE A;  1ISV A;  4QKR A;  4P6A A;  4I4X A;  2BEA A;  1Z0H A;  4H9W A;  1SR4 A;  5EHA A;  4Q91 A;  1HCE A;  4D8H A;  3VSZ A;  2NVH A;  2NZ9 A;  3OJM A;  3AJ6 A;  3BA5 A;  4G1R A;  1V6U A;  3AH1 A;  3D7W B;  2KLL A;  3WA1 A;  4PC4 A;  5JMC A;  1IIL A;  4I96 A;  5F90 A;  3PUB A;  3R4U A;  4P0L A;  4X38 A;  6I1B A;  3V0A B;  3CA4 A;  31BI A;  4ZLB B;  2D7R A;  1M2T B;  2KH2 A;  3O44 A;  3BAO A;  4I7I A;  2K4A B;  1ONK B;  5E24 E;  5BXT A;  3NBE A;  5D62 A;  1BAS A;  2NS2 A;  3BRF A;  1IT0 A;  1V6X A;  4X39 A;  1TWE A;  3FJK A;  2F2F C;  3FUQ A;  4F83 A;  2MIB A;  1WBA A;  4II0 A;  1G9C A;  4LO7 B;  2GZB A;  3I2A A;  1DZC A;  3CQA A;  2I1B A;  1HWN B;  4OW4 A;  3PG0 A;  1ISZ A;  1MD6 A;  5BVP I;  4LO3 C;  1WD4 A;  2RG9 B;  1FGA A;  2HZ9 A;  1AVW B;  3AKF A;  3OBR A;  3OGF A;  1TIE A;  2HW9 A;  1Z2V A;  4LO1 A;  3N7K A;  3A22 A;  3H6S E;  4FVV A;  3W9T A;  2DRE A;  3BTA A;  4GAI A;  3N7L A;  3O3Q A;  1BAR A;  4Z9W B;  5F8Y A;  3H6Q A;  3EF2 A;  3FJC A;  4H04 A;  4I0Y A;  1S0G A;  2D22 A;  1RG8 A;  4QD2 B;  4MZG B;  4IY8 A;  3TC2 A;  1NUN A;  1OQL B;  1RY7 A;  3FJI A;  1FWU A;  1G9A A;  1I1B A;  4ION A;  3QYD A;  1VCL A;  1V6V A;  3HBW A;  3ILA A;  3IM7 A;  4IZX A;  3O5W B;  4P0K A;  4I37 A;  4LO2 C;  5D63 A;  4ZBV B;  4EB2 B;  3CA0 A;  2VSE A;  3QR5 A;  4KEI A;  4P0J A;  5BXP A;  2BFH A;  4DCK C;  1WD3 A;  1BLD A;  3WIN A;  1G9D A;  1BFF A;  1QXM A;  4H75 A;  3VUO A;  5DZU A;  1CVS A;  2VLC A;  2VXR A;  1E0O A;  4G9M A;  4J2S A;  3S8K A;  1TOO A;  2ESU A;  3UD9 A;  1JLX A;  3FJ8 A;  1P63 A;  4EEE B;  1DLL A;  1Q03 A;  3RMY A;  3H6R A;  4OEF A;  4KEK A;  4ISQ A;  3BAQ A;  3RTJ B;  1JY0 A;  3VSF A;  3CA3 A;  1D0H A;  2KI4 A;  2D7I A;  3P6I A;  5BP5 A;  3O49 A;  4DEP A;  1HKN A;  1YXW A;  3HN1 A;  4GOV A;  2D1Z A;  3VT2 A;  3OJV A;  4XFU A;  3AJ5 A;  3BAV A;  1ILR 1;  2XOA A;  2D43 A;  1S0B A;  3PME A;  21BI A;  2D44 A;  4XFT A;  5B2H A;  1CE7 B;  5BQU A;  3BRD A;  1SR4 C;  2QN4 A;  1S0C A;  4KC3 A;  1YYN A;  2Y9G A;  3I2X A;  1YBI A;  2Z49 A;  3Q7X A;  4OUJ A;  3VWC A;  3O4O A;  5BXS A;  4KEJ A;  4I6I A;  4LO8 B;  2AAI B;  1T9F A;  1IRA X;  1DQG A;  4XFS A;  4JKX B;  4I3N A;  2LIQ A;  3N7J A;  4Z8S B;  1FWV A;  2FO1 A;  1TP0 A;  4EFR A;  2VU9 A;  2X2S A;  3IAG C;  1JTC A;  2Q3N B;  4ZFU B;  4L4H A;  3FJE A;  2VXT I;  4A7Y A;  5JLV A;  4HA2 A;  1N4K A;  2K8R A;  3JUT A;  3P53 A;  5D61 A;  1FMZ A;  1Q04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...