4GAFA

Crystal structure of ebi-005, a chimera of human il-1beta and il-1ra, bound to human interleukin-1 receptor type 1
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
152
structure length
152
Chain Sequence
b'APVRSLNCRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWFLCTAMEADQPVSLTNMPDEGVMVTKFYMQFVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EBI-005
publication title Design of a superior cytokine antagonist for topical ophthalmic use.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 27
structure length 152
sequence length 152
ec nomenclature
pdb deposition date 2012-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00340 IL1 Interleukin-1 / 18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4gafA00
1FQ9A 5D62A 4GOYA 1RZOB 3EF2A 4ISRA 4D0ZA 4OEFA 1YF8B 1PUUB 3R4SA 3FJIA 4GP0A 2E4MA 1ISYA 1ILR1 1DLLA 1HIBA 2WBCA 3VT2A 2BEAA 3CA4A 2QYIB 1DFQA 1R8NA 2GO2A 5DVHA 3HOMA 2HW9A 3A22A 3VT0A 4LO2A 1DIWA 3VT1A 4JPZA 4I4YA 1JT5A 3CA6A 3A07A 4I4RA 2K4AB 1WD4A 2AXMA 4KBBA 3O3QA 4QALA 2K8RA 3AKIA 4ZLBB 1FV3A 4CJMA 4XFUA 4ISQA 4HJJA 2X2SA 3B9UA 4USPA 2D7IA 4P0KA 1G9AA 1JY0A 2AFGA 5FZUA 4ZA3B 1T4QA 3HSMA 3IIRA 3MPPG 3A21A 3C9ZA 3VWCA 2KKIA 3N0KA 1MC9A 1V6WA 5JMCA 1A8DA 5BOWA 1AVUA 1WBCA 1BLDA 3O4DA 4IY9A 1XYFA 5D61A 1YBIA 4OEGA 1AFCA 4KEKA 3FJKA 3V0BA 3POKA 5I1BA 3WMUA 2YUGA 5D63A 3UJ4A 3QR5A 4XFSA 2NYYA 5BXTA 21BIA 3ZXGA 4ZBVB 3NBDA 3AH1A 3LTQA 3AH2A 3CRHA 2WRYA 3BRFA 1GGPB 4LO0C 5BXSA 3ZC8A 3VSZA 4H04A 2LIEA 1FMMS 4JQ0A 3AKGA 2ZR1B 5DSSB 4I4OA 4QO3A 1XZZA 1BFBA 4J23B 3O49A 3RMYA 3RSJA 4Q9PA 4EKXB 2BEBA 4GOVA 2VU9A 4L4HA 1JT3A 4ENDA 3ILAA 5BP5C 3BRGC 3PG0A 4JKXB 3CA3A 4R6UB 4LO0A 3CU1B 1XG6A 1FMZA 2KLLA 2RQ9A 4G6JA 3BAOA 2D44A 2Y9WC 2FFUA 3N7MA 4I4XA 4USOA 3UJ0A 3JUTA 4A7YA 4FVVA 3N7KA 1ISWA 3WMVA 4EEEB 4GAIA 2ERMA 1DQOA 3NBEA 1EPWA 3FJ9A 5BP5A 2Q3NB 4LO7B 4QKRA 5FNXA 4KC3A 4X37A 3FUQA 2P23A 3AKHA 4J2KA 4JRAA 1FWUA 3FJFA 1EVTA 3A23A 1HWNB 1IILA 4FGFA 7I1BA 4ZKTB 4L4IA 4J2YA 1NUNA 4I96A 1K5VA 3F1RA 4LO2C 4LO7C 2VSAA 1TFMB 3BAHA 3IM7A 3O4OA 3RTJB 1TP0A 2K43A 1YXWA 2LIQA 3NBNA 2BFHA 1HCDA 3V0AA 2RSTA 2X2TA 5DUYA 1L2HA 1DQGA 3O5WB 1S0LA 3HN1A 1V6VA 3FJHA 4I4PA 1Z2VA 3IAGC 3V0BB 4ZGRB 1VCLA 5FZYA 5FNWA 2VSEA 4OWKA 1QQKA 4OUJA 1W3AA 1YYNA 3Q7YA 1MD6A 3FJ8A 4I7IA 4KEIA 3UD9A 5E24E 1AVWB 4TLPA 3PHZA 1EYLA 1RMLA 2RG9B 2NVHA 4JAWA 3R4UA 4I4QA 4IONA 3I2XA 3WO2A 1TTUA 2M49A 3P6IA 4J2XA 2F8XC 3FJCA 3AZWA 4JKQA 2D20A 1FGAA 4DCKC 4X38A 2VUAA 1N4KA 4OWJA 2UUSA 1R8OA 3OBTA 1JLXA 4HA2A 1BARA 1JLYA 3W9TA 2HWMA 2FO1A 3O44A 1M2TB 4EB2B 4I1EA 3H6SE 1NZKA 3KMVA 4EFPA 3O4CA 4A7KA 3I2AA 4F83A 2FDBM 1IHKA 2Y9GA 5DZUA 1WBAA 1P63A 3AZVA 1KNMA 4P0JA 2AQZA 1BFGA 1DZCA 4DENA 4P6AA 5B2HA 3WA1A 3V79C 1IT0A 4LO1C 4ZOTA 4F34A 4Z9WB 4I4UA 2KI4A 4ZFWB 1DZDA 4G9NA 1IRAX 1HWPB 1FV2A 5F90A 1QQLA 1G9DA 2KI6B 3FJEA 5BXRA 2NTDA 5F8YA 6I1BA 1I1BA 1Z4SA 1AVXB 3T8SA 4QBVA 3OBRA 1I1EA 1G9BA 2DRZA 3PUBA 2IHOA 3NJ5A 4X3AA 3VSFA 3AJ5A 4LO1A 2KH2A 5GAQA 5BXPA 4JP0A 3V0AB 5BQUA 3TC2A 4WBCA 8I1BA 3CRGA 1ABRB 1D0HA 3FGMA 3BAVA 3QYDA 1ONKB 2Y9XE 3BADA 3CA1A 3IM5A 2P39A 4I3NA 3WINC 3BA4A 3RMXA 1AF9A 2NM1A 4QKSA 4YOLA 2VXRA 9ILBA 1AVAC 4GAFA 1HWOB 3BA5A 3UD7A 3BTAA 3HALA 4EFQA 1IJTA 1BFFA 3N7JA 4I8MA 4J2SA 1OQLB 3WO4A 2Z49A 1ISXA 4IY8A 2ESUA 2MIBA 4LO3C 4OEEA 3VEQA 3CAHA 2MLLB 3BAQA 3S8JA 1J0SA 1BA7A 3WINA 1G82A 1K5UA 3CA0A 4IZEA 1RG8A 1ITBA 1CE7B 1UPSA 2QN4A 2D1ZA 1F31A 1M16A 4OWLA 1PUMB 4AN6A 1BASA 3CRIA 1W3FA 2F2FC 2D24A 5EG6C 4G9MA 4KEJA 4ZFYB 4IHZA 4LO3A 4I37A 1ISZA 3WO3A 1JQZA 1S0DA 1PC8B 3FJAA 4I2SA 5F8WA 3S8KA 1S0CA 2ZQNA 4XFTA 1Q1UA 4DEPA 1DJSB 5FZZA 1II4A 1XHBA 4P0LA 3JRRA 3P6JA 4I6IA 3ZC9A 3OJVA 5BVPI 3VUOA 2D7RA 2F2FA 2AAIB 3ZXDA 5JLVA 4A7ZA 3FFZA 4IQPA 4QC4A 2D43A 3LLPA 4GP3A 3CA5A 1S0FA 1S0BA 2NZ9A 3NBCA 2FFVA 3BX1C 1AXMA 2HWAA 1HWMB 1QXMA 4HR6C 4D8HA 3AJ6A 1RY7A 1G9CA 4Z8SB 1SZ6B 2VLCA 4XKIA 31BIA 2DREA 2DRYA 4AN7B 1HCEA 5HPZA 3CQAA 3H6RB 3PMEA 3I29B 4IYBA 1Z0HA 1W3GA 2Y9FA 2L5XA 3OGGA 3HMYA 3MALA 2R9KB 3BB2A 1EV2A 2D23A 2MC2A 4Q9GA 4QBCA 3P53A 1TWMA 1V6UA 4I1BA 1BFCA 1CVSA 2ZQOA 1JTCA 1SR4C 2J3PA 1JT4A 3BA7A 5BQUC 4IZXA 3FJJA 1S0EA 4D0TA 2IWTB 1TWEA 2FGFA 3UD8A 3ZX7A 1T9FA 1Q03A 3AH4A 3D7WB 3BRDA 2VXTI 1BLAA 3F62B 3H6RA 5EC5A 5EHAA 4I4VA 1YTOA 1E0OA 1SR4A 1IRPA 4LO8B 1FWVA 5F8SA 3Q7WA 2NP0A 2D22A 1HKNA 2GZBA 1Q04A 3O4AA 3OJ2A 3Q7XA 4QD2B 3H6QA 3UDAA 1JT7A 41BIA 3AKFA 1V6XA 3K1XA 3RTIB 4G6MA 4PC4A 3FJDA 1TIEA 1TOOA 4Q91A 4OW4A 4X39A 3SNVA 4EFRA 2Z48A 3FUOA 4QD2C 3OGFA 3E8LC 2XOAA 4G1RA 1PZZA 1ISVA 1PWAA 3FJBA 2ET2A 1FN0A 1S0GA 2Q9XA 3HBWA 4H9WA 1WD3A 2I1BA 2E4MC 1IOBA 3O4BA 3OJMA 4II0A 3BAUA 3N7LA 4I0YA 1DFCA 2HZ9A 5G00A 2DS0A 4I4SA 4ZFUB 3BAGA 3IM6A
chains in the Genus database with same CATH superfamily
1FQ9A 5D62A 4GOYA 1RZOB 3EF2A 4ISRA 4D0ZA 4OEFA 1YF8B 1PUUB 3R4SA 3FJIA 4GP0A 2E4MA 1ISYA 1ILR1 1DLLA 1HIBA 2WBCA 3VT2A 2BEAA 3CA4A 2QYIB 1DFQA 1R8NA 2GO2A 5DVHA 3HOMA 2HW9A 3A22A 3VT0A 4LO2A 1DIWA 3VT1A 4JPZA 4I4YA 1JT5A 3CA6A 3A07A 4I4RA 2K4AB 1WD4A 2AXMA 4KBBA 3O3QA 4QALA 2K8RA 3AKIA 4ZLBB 1FV3A 4UY4A 4CJMA 4XFUA 4ISQA 4HJJA 2X2SA 3B9UA 4USPA 2D7IA 4P0KA 1G9AA 1JY0A 2AFGA 5FZUA 4ZA3B 1T4QA 3HSMA 3IIRA 3MPPG 3A21A 3C9ZA 3VWCA 2KKIA 3N0KA 1MC9A 1V6WA 5JMCA 1A8DA 5BOWA 1AVUA 1WBCA 1BLDA 3O4DA 4IY9A 1XYFA 5D61A 1YBIA 4OEGA 1AFCA 4KEKA 3FJKA 3V0BA 3POKA 5I1BA 3WMUA 2YUGA 5D63A 3UJ4A 3QR5A 4XFSA 2NYYA 5BXTA 21BIA 3ZXGA 4ZBVB 3NBDA 3AH1A 3LTQA 3AH2A 3CRHA 2WRYA 3BRFA 1GGPB 4LO0C 5BXSA 3ZC8A 3VSZA 4H04A 2LIEA 1FMMS 4JQ0A 3AKGA 2ZR1B 5DSSB 4I4OA 4QO3A 1XZZA 1BFBA 4J23B 3O49A 3RMYA 3RSJA 4Q9PA 4EKXB 2BEBA 4GOVA 2VU9A 4L4HA 1JT3A 4ENDA 3ILAA 5BP5C 3BRGC 3PG0A 4JKXB 3CA3A 4R6UB 4LO0A 3CU1B 1XG6A 1FMZA 2KLLA 2RQ9A 4G6JA 3BAOA 2D44A 2Y9WC 2FFUA 3N7MA 4I4XA 4USOA 3UJ0A 3JUTA 4A7YA 4FVVA 3N7KA 1ISWA 3WMVA 4EEEB 4GAIA 2ERMA 1DQOA 3NBEA 1EPWA 3FJ9A 5BP5A 2Q3NB 4LO7B 4QKRA 5FNXA 4KC3A 4X37A 3FUQA 2P23A 3AKHA 4J2KA 4JRAA 1FWUA 3FJFA 1EVTA 3A23A 1HWNB 1IILA 4FGFA 7I1BA 4ZKTB 4L4IA 4J2YA 1NUNA 4I96A 1K5VA 3F1RA 4LO2C 4LO7C 2VSAA 1TFMB 3BAHA 3IM7A 3O4OA 3RTJB 1TP0A 2K43A 1YXWA 2LIQA 3NBNA 2BFHA 1HCDA 3V0AA 2RSTA 2X2TA 5DUYA 1L2HA 1DQGA 3O5WB 1S0LA 3HN1A 1V6VA 3FJHA 4I4PA 1Z2VA 3IAGC 3V0BB 4ZGRB 1VCLA 5FZYA 5FNWA 2VSEA 4OWKA 1QQKA 4OUJA 1W3AA 1YYNA 3Q7YA 1MD6A 3FJ8A 4I7IA 4KEIA 3UD9A 5E24E 1AVWB 4TLPA 3PHZA 1EYLA 1RMLA 2RG9B 2NVHA 4JAWA 3R4UA 4I4QA 4IONA 3I2XA 3WO2A 1TTUA 2M49A 3P6IA 4J2XA 2F8XC 3FJCA 3AZWA 4JKQA 2D20A 1FGAA 4DCKC 4X38A 2VUAA 1N4KA 4OWJA 2UUSA 1R8OA 3OBTA 1JLXA 4HA2A 1BARA 1JLYA 3W9TA 2HWMA 2FO1A 3O44A 1M2TB 4EB2B 4I1EA 3H6SE 1NZKA 3KMVA 4EFPA 3O4CA 4A7KA 3I2AA 4F83A 2FDBM 1IHKA 2Y9GA 5DZUA 1WBAA 1P63A 3AZVA 1KNMA 4P0JA 4H75A 2AQZA 1BFGA 1DZCA 4DENA 4P6AA 5B2HA 3WA1A 3V79C 1IT0A 4LO1C 4ZOTA 4F34A 4Z9WB 4I4UA 2KI4A 4ZFWB 1DZDA 4G9NA 1IRAX 1HWPB 1FV2A 5F90A 1QQLA 1G9DA 2KI6B 3FJEA 5BXRA 2NTDA 5F8YA 6I1BA 1I1BA 1Z4SA 1AVXB 3T8SA 4QBVA 3OBRA 1I1EA 1G9BA 2DRZA 3PUBA 2IHOA 3NJ5A 4MZFB 4X3AA 3VSFA 3AJ5A 4LO1A 2KH2A 5GAQA 5BXPA 4JP0A 3V0AB 5BQUA 3TC2A 4WBCA 8I1BA 3CRGA 1ABRB 1D0HA 3FGMA 3BAVA 3QYDA 1ONKB 2Y9XE 3BADA 3CA1A 3IM5A 2P39A 4I3NA 3WINC 3BA4A 3RMXA 1AF9A 2NM1A 4QKSA 4YOLA 2VXRA 9ILBA 1AVAC 4GAFA 1HWOB 3BA5A 3UD7A 3BTAA 3HALA 4EFQA 1IJTA 1BFFA 3N7JA 4I8MA 4J2SA 1OQLB 3WO4A 2Z49A 1ISXA 4IY8A 2ESUA 2MIBA 4LO3C 4OEEA 3VEQA 3CAHA 2MLLB 3BAQA 3S8JA 1J0SA 1BA7A 3WINA 1G82A 1K5UA 3CA0A 4IZEA 1RG8A 1ITBA 1CE7B 1UPSA 2QN4A 2D1ZA 1F31A 1M16A 4OWLA 1PUMB 4AN6A 1BASA 3CRIA 1W3FA 2F2FC 2D24A 5EG6C 4G9MA 4KEJA 4ZFYB 4IHZA 4LO3A 4I37A 1ISZA 3WO3A 1JQZA 1S0DA 1PC8B 3FJAA 4I2SA 5F8WA 3S8KA 1S0CA 2ZQNA 4XFTA 1Q1UA 4DEPA 1DJSB 5FZZA 1II4A 1XHBA 4P0LA 3JRRA 3P6JA 4I6IA 3ZC9A 3OJVA 5BVPI 3VUOA 2D7RA 2F2FA 2AAIB 3ZXDA 5JLVA 4A7ZA 3FFZA 4IQPA 4QC4A 2D43A 3LLPA 4GP3A 3CA5A 1S0FA 1S0BA 2NZ9A 3NBCA 2FFVA 3BX1C 1AXMA 2HWAA 1HWMB 1QXMA 4HR6C 4D8HA 3AJ6A 1RY7A 1G9CA 4Z8SB 1SZ6B 2VLCA 4XKIA 31BIA 2DREA 2DRYA 4AN7B 1HCEA 5HPZA 3CQAA 3H6RB 3PMEA 3I29B 2NS2A 4IYBA 1Z0HA 1W3GA 2Y9FA 2L5XA 3OGGA 3HMYA 3MALA 2R9KB 3BB2A 1EV2A 2D23A 2MC2A 4Q9GA 4QBCA 3P53A 1TWMA 1V6UA 4I1BA 1BFCA 1CVSA 2ZQOA 1JTCA 1SR4C 2J3PA 1JT4A 3BA7A 5BQUC 4IZXA 3FJJA 1S0EA 4D0TA 2IWTB 1TWEA 2FGFA 3UD8A 3ZX7A 1T9FA 1Q03A 3AH4A 3D7WB 3BRDA 2VXTI 1BLAA 3F62B 3H6RA 5EC5A 5EHAA 4I4VA 1YTOA 1E0OA 1SR4A 1IRPA 4LO8B 1FWVA 5F8SA 3Q7WA 2NP0A 2D22A 1HKNA 2GZBA 1Q04A 3O4AA 3OJ2A 3Q7XA 4QD2B 3H6QA 3UDAA 1JT7A 41BIA 3AKFA 1V6XA 3K1XA 3RTIB 4G6MA 4PC4A 3FJDA 1TIEA 1TOOA 4MZGB 4Q91A 4OW4A 4X39A 3SNVA 4MZHA 4EFRA 2Z48A 3FUOA 4QD2C 3OGFA 3E8LC 2XOAA 4G1RA 1PZZA 1ISVA 1PWAA 3FJBA 2ET2A 1FN0A 1S0GA 2Q9XA 3HBWA 4H9WA 1WD3A 2I1BA 2E4MC 1IOBA 3O4BA 3OJMA 4II0A 3BAUA 3N7LA 4I0YA 1DFCA 2HZ9A 5G00A 2DS0A 4I4SA 4ZFUB 3BAGA 3IM6A
chains in the Genus database with same CATH topology
1FQ9A 5D62A 4GOYA 1RZOB 3EF2A 4ISRA 4D0ZA 4OEFA 1YF8B 1PUUB 3R4SA 3FJIA 4GP0A 2E4MA 1ISYA 1ILR1 1DLLA 1HIBA 2WBCA 3VT2A 2BEAA 3CA4A 2QYIB 1DFQA 1R8NA 2GO2A 5DVHA 3HOMA 2HW9A 3A22A 3VT0A 4LO2A 1DIWA 3VT1A 4JPZA 4I4YA 1JT5A 3CA6A 3A07A 4I4RA 2K4AB 1WD4A 2AXMA 4KBBA 3O3QA 4QALA 2K8RA 3AKIA 4ZLBB 1FV3A 4UY4A 4CJMA 4XFUA 4ISQA 4HJJA 2X2SA 3B9UA 4USPA 2D7IA 4P0KA 1G9AA 1JY0A 2AFGA 5FZUA 4ZA3B 1T4QA 3HSMA 3IIRA 3MPPG 3A21A 3C9ZA 3VWCA 2KKIA 3N0KA 1MC9A 1V6WA 5JMCA 1A8DA 5BOWA 1AVUA 1WBCA 1BLDA 3O4DA 4IY9A 1XYFA 5D61A 1YBIA 4OEGA 1AFCA 4KEKA 3FJKA 3V0BA 3POKA 5I1BA 3WMUA 2YUGA 5D63A 3UJ4A 3QR5A 4XFSA 2NYYA 5BXTA 21BIA 3ZXGA 4ZBVB 3NBDA 3AH1A 3LTQA 3AH2A 3CRHA 2WRYA 3BRFA 1GGPB 4LO0C 5BXSA 3ZC8A 3VSZA 4H04A 2LIEA 1FMMS 4JQ0A 3AKGA 2ZR1B 5DSSB 4I4OA 4QO3A 1XZZA 1BFBA 4J23B 3O49A 3RMYA 3RSJA 4Q9PA 4EKXB 2BEBA 4GOVA 2VU9A 4L4HA 1JT3A 4ENDA 3ILAA 5BP5C 3BRGC 3PG0A 4JKXB 3CA3A 4R6UB 4LO0A 3CU1B 1XG6A 1FMZA 2KLLA 2RQ9A 4G6JA 3BAOA 2D44A 2Y9WC 2FFUA 3N7MA 4I4XA 4USOA 3UJ0A 3JUTA 4A7YA 4FVVA 3N7KA 1ISWA 3WMVA 4EEEB 4GAIA 2ERMA 1DQOA 3NBEA 1EPWA 3FJ9A 5BP5A 2Q3NB 4LO7B 4QKRA 5FNXA 4KC3A 4X37A 3FUQA 2P23A 3AKHA 4J2KA 4JRAA 1FWUA 3FJFA 1EVTA 3A23A 1HWNB 1IILA 4FGFA 7I1BA 4ZKTB 4L4IA 4J2YA 1NUNA 4I96A 1K5VA 3F1RA 4LO2C 4LO7C 2VSAA 1TFMB 3BAHA 3IM7A 3O4OA 3RTJB 1TP0A 2K43A 1YXWA 2LIQA 3NBNA 2BFHA 1HCDA 3V0AA 2RSTA 2X2TA 5DUYA 1L2HA 1DQGA 3O5WB 1S0LA 3HN1A 1V6VA 3FJHA 4I4PA 1Z2VA 3IAGC 3V0BB 4ZGRB 1VCLA 5FZYA 5FNWA 2VSEA 4OWKA 1QQKA 4OUJA 1W3AA 1YYNA 3Q7YA 1MD6A 3FJ8A 4I7IA 4KEIA 3UD9A 5E24E 1AVWB 4TLPA 3PHZA 1EYLA 1RMLA 2RG9B 2NVHA 4JAWA 3R4UA 4I4QA 4IONA 3I2XA 3WO2A 1TTUA 2M49A 3P6IA 4J2XA 2F8XC 3FJCA 3AZWA 4JKQA 2D20A 1FGAA 4DCKC 4X38A 2VUAA 1N4KA 4OWJA 2UUSA 1R8OA 3OBTA 1JLXA 4HA2A 1BARA 1JLYA 3W9TA 2HWMA 2FO1A 3O44A 1M2TB 4EB2B 4I1EA 3H6SE 1NZKA 3KMVA 4EFPA 3O4CA 4A7KA 3I2AA 4F83A 2FDBM 1IHKA 2Y9GA 5DZUA 1WBAA 1P63A 3AZVA 1KNMA 4P0JA 4H75A 2AQZA 1BFGA 1DZCA 4DENA 4P6AA 5B2HA 3WA1A 3V79C 1IT0A 4LO1C 4ZOTA 4F34A 4Z9WB 4I4UA 2KI4A 4ZFWB 1DZDA 4G9NA 1IRAX 1HWPB 1FV2A 5F90A 1QQLA 1G9DA 2KI6B 3FJEA 5BXRA 2NTDA 5F8YA 6I1BA 1I1BA 1Z4SA 1AVXB 3T8SA 4QBVA 3OBRA 1I1EA 1G9BA 2DRZA 3PUBA 2IHOA 3NJ5A 4MZFB 4X3AA 3VSFA 3AJ5A 4LO1A 2KH2A 5GAQA 5BXPA 4JP0A 3V0AB 5BQUA 3TC2A 4WBCA 8I1BA 3CRGA 1ABRB 1D0HA 3FGMA 3BAVA 3QYDA 1ONKB 2Y9XE 3BADA 3CA1A 3IM5A 2P39A 4I3NA 3WINC 3BA4A 3RMXA 1AF9A 2NM1A 4QKSA 4YOLA 2VXRA 9ILBA 1AVAC 4GAFA 1HWOB 3BA5A 3UD7A 3BTAA 3HALA 4EFQA 1IJTA 1BFFA 3N7JA 4I8MA 4J2SA 1OQLB 3WO4A 2Z49A 1ISXA 4IY8A 2ESUA 2MIBA 4LO3C 4OEEA 3VEQA 3CAHA 2MLLB 3BAQA 3S8JA 1J0SA 1BA7A 3WINA 1G82A 1K5UA 3CA0A 4IZEA 1RG8A 1ITBA 1CE7B 1UPSA 2QN4A 2D1ZA 1F31A 1M16A 4OWLA 1PUMB 4AN6A 1BASA 3CRIA 1W3FA 2F2FC 2D24A 5EG6C 4G9MA 4KEJA 4ZFYB 4IHZA 4LO3A 4I37A 1ISZA 3WO3A 1JQZA 1S0DA 1PC8B 3FJAA 4I2SA 5F8WA 3S8KA 1S0CA 2ZQNA 4XFTA 1Q1UA 4DEPA 1DJSB 5FZZA 1II4A 1XHBA 4P0LA 3JRRA 3P6JA 4I6IA 3ZC9A 3OJVA 5BVPI 3VUOA 2D7RA 2F2FA 2AAIB 3ZXDA 5JLVA 4A7ZA 3FFZA 4IQPA 4QC4A 2D43A 3LLPA 4GP3A 3CA5A 1S0FA 1S0BA 2NZ9A 3NBCA 2FFVA 3BX1C 1AXMA 2HWAA 1HWMB 1QXMA 4HR6C 4D8HA 3AJ6A 1RY7A 1G9CA 4Z8SB 1SZ6B 2VLCA 4XKIA 31BIA 2DREA 2DRYA 4AN7B 1HCEA 5HPZA 3CQAA 3H6RB 3PMEA 3I29B 2NS2A 4IYBA 1Z0HA 1W3GA 2Y9FA 2L5XA 3OGGA 3HMYA 3MALA 2R9KB 3BB2A 1EV2A 2D23A 2MC2A 4Q9GA 4QBCA 3P53A 1TWMA 1V6UA 4I1BA 1BFCA 1CVSA 2ZQOA 1JTCA 1SR4C 2J3PA 1JT4A 3BA7A 5BQUC 4IZXA 3FJJA 1S0EA 4D0TA 2IWTB 1TWEA 2FGFA 3UD8A 3ZX7A 1T9FA 1Q03A 3AH4A 3D7WB 3BRDA 2VXTI 1BLAA 3F62B 3H6RA 5EC5A 5EHAA 4I4VA 1YTOA 1E0OA 1SR4A 1IRPA 4LO8B 1FWVA 5F8SA 3Q7WA 2NP0A 2D22A 1HKNA 2GZBA 1Q04A 3O4AA 3OJ2A 3Q7XA 4QD2B 3H6QA 3UDAA 1JT7A 41BIA 3AKFA 1V6XA 3K1XA 3RTIB 4G6MA 4PC4A 3FJDA 1TIEA 1TOOA 4MZGB 4Q91A 4OW4A 4X39A 3SNVA 4MZHA 4EFRA 2Z48A 3FUOA 4QD2C 3OGFA 3E8LC 2XOAA 4G1RA 1PZZA 1ISVA 1PWAA 3FJBA 2ET2A 1FN0A 1S0GA 2Q9XA 3HBWA 4H9WA 1WD3A 2I1BA 2E4MC 1IOBA 3O4BA 3OJMA 4II0A 3BAUA 3N7LA 4I0YA 1DFCA 2HZ9A 5G00A 2DS0A 4I4SA 4ZFUB 3BAGA 3IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FQ9 A;  5D62 A;  4GOY A;  1RZO B;  3EF2 A;  4ISR A;  4D0Z A;  4OEF A;  1YF8 B;  1PUU B;  3R4S A;  3FJI A;  4GP0 A;  2E4M A;  1ISY A;  1ILR 1;  1DLL A;  1HIB A;  2WBC A;  3VT2 A;  2BEA A;  3CA4 A;  2QYI B;  1DFQ A;  1R8N A;  2GO2 A;  5DVH A;  3HOM A;  2HW9 A;  3A22 A;  3VT0 A;  4LO2 A;  1DIW A;  3VT1 A;  4JPZ A;  4I4Y A;  1JT5 A;  3CA6 A;  3A07 A;  4I4R A;  2K4A B;  1WD4 A;  2AXM A;  4KBB A;  3O3Q A;  4QAL A;  2K8R A;  3AKI A;  4ZLB B;  1FV3 A;  4CJM A;  4XFU A;  4ISQ A;  4HJJ A;  2X2S A;  3B9U A;  4USP A;  2D7I A;  4P0K A;  1G9A A;  1JY0 A;  2AFG A;  5FZU A;  4ZA3 B;  1T4Q A;  3HSM A;  3IIR A;  3MPP G;  3A21 A;  3C9Z A;  3VWC A;  2KKI A;  3N0K A;  1MC9 A;  1V6W A;  5JMC A;  1A8D A;  5BOW A;  1AVU A;  1WBC A;  1BLD A;  3O4D A;  4IY9 A;  1XYF A;  5D61 A;  1YBI A;  4OEG A;  1AFC A;  4KEK A;  3FJK A;  3V0B A;  3POK A;  5I1B A;  3WMU A;  2YUG A;  5D63 A;  3UJ4 A;  3QR5 A;  4XFS A;  2NYY A;  5BXT A;  21BI A;  3ZXG A;  4ZBV B;  3NBD A;  3AH1 A;  3LTQ A;  3AH2 A;  3CRH A;  2WRY A;  3BRF A;  1GGP B;  4LO0 C;  5BXS A;  3ZC8 A;  3VSZ A;  4H04 A;  2LIE A;  1FMM S;  4JQ0 A;  3AKG A;  2ZR1 B;  5DSS B;  4I4O A;  4QO3 A;  1XZZ A;  1BFB A;  4J23 B;  3O49 A;  3RMY A;  3RSJ A;  4Q9P A;  4EKX B;  2BEB A;  4GOV A;  2VU9 A;  4L4H A;  1JT3 A;  4END A;  3ILA A;  5BP5 C;  3BRG C;  3PG0 A;  4JKX B;  3CA3 A;  4R6U B;  4LO0 A;  3CU1 B;  1XG6 A;  1FMZ A;  2KLL A;  2RQ9 A;  4G6J A;  3BAO A;  2D44 A;  2Y9W C;  2FFU A;  3N7M A;  4I4X A;  4USO A;  3UJ0 A;  3JUT A;  4A7Y A;  4FVV A;  3N7K A;  1ISW A;  3WMV A;  4EEE B;  4GAI A;  2ERM A;  1DQO A;  3NBE A;  1EPW A;  3FJ9 A;  5BP5 A;  2Q3N B;  4LO7 B;  4QKR A;  5FNX A;  4KC3 A;  4X37 A;  3FUQ A;  2P23 A;  3AKH A;  4J2K A;  4JRA A;  1FWU A;  3FJF A;  1EVT A;  3A23 A;  1HWN B;  1IIL A;  4FGF A;  7I1B A;  4ZKT B;  4L4I A;  4J2Y A;  1NUN A;  4I96 A;  1K5V A;  3F1R A;  4LO2 C;  4LO7 C;  2VSA A;  1TFM B;  3BAH A;  3IM7 A;  3O4O A;  3RTJ B;  1TP0 A;  2K43 A;  1YXW A;  2LIQ A;  3NBN A;  2BFH A;  1HCD A;  3V0A A;  2RST A;  2X2T A;  5DUY A;  1L2H A;  1DQG A;  3O5W B;  1S0L A;  3HN1 A;  1V6V A;  3FJH A;  4I4P A;  1Z2V A;  3IAG C;  3V0B B;  4ZGR B;  1VCL A;  5FZY A;  5FNW A;  2VSE A;  4OWK A;  1QQK A;  4OUJ A;  1W3A A;  1YYN A;  3Q7Y A;  1MD6 A;  3FJ8 A;  4I7I A;  4KEI A;  3UD9 A;  5E24 E;  1AVW B;  4TLP A;  3PHZ A;  1EYL A;  1RML A;  2RG9 B;  2NVH A;  4JAW A;  3R4U A;  4I4Q A;  4ION A;  3I2X A;  3WO2 A;  1TTU A;  2M49 A;  3P6I A;  4J2X A;  2F8X C;  3FJC A;  3AZW A;  4JKQ A;  2D20 A;  1FGA A;  4DCK C;  4X38 A;  2VUA A;  1N4K A;  4OWJ A;  2UUS A;  1R8O A;  3OBT A;  1JLX A;  4HA2 A;  1BAR A;  1JLY A;  3W9T A;  2HWM A;  2FO1 A;  3O44 A;  1M2T B;  4EB2 B;  4I1E A;  3H6S E;  1NZK A;  3KMV A;  4EFP A;  3O4C A;  4A7K A;  3I2A A;  4F83 A;  2FDB M;  1IHK A;  2Y9G A;  5DZU A;  1WBA A;  1P63 A;  3AZV A;  1KNM A;  4P0J A;  2AQZ A;  1BFG A;  1DZC A;  4DEN A;  4P6A A;  5B2H A;  3WA1 A;  3V79 C;  1IT0 A;  4LO1 C;  4ZOT A;  4F34 A;  4Z9W B;  4I4U A;  2KI4 A;  4ZFW B;  1DZD A;  4G9N A;  1IRA X;  1HWP B;  1FV2 A;  5F90 A;  1QQL A;  1G9D A;  2KI6 B;  3FJE A;  5BXR A;  2NTD A;  5F8Y A;  6I1B A;  1I1B A;  1Z4S A;  1AVX B;  3T8S A;  4QBV A;  3OBR A;  1I1E A;  1G9B A;  2DRZ A;  3PUB A;  2IHO A;  3NJ5 A;  4X3A A;  3VSF A;  3AJ5 A;  4LO1 A;  2KH2 A;  5GAQ A;  5BXP A;  4JP0 A;  3V0A B;  5BQU A;  3TC2 A;  4WBC A;  8I1B A;  3CRG A;  1ABR B;  1D0H A;  3FGM A;  3BAV A;  3QYD A;  1ONK B;  2Y9X E;  3BAD A;  3CA1 A;  3IM5 A;  2P39 A;  4I3N A;  3WIN C;  3BA4 A;  3RMX A;  1AF9 A;  2NM1 A;  4QKS A;  4YOL A;  2VXR A;  9ILB A;  1AVA C;  4GAF A;  1HWO B;  3BA5 A;  3UD7 A;  3BTA A;  3HAL A;  4EFQ A;  1IJT A;  1BFF A;  3N7J A;  4I8M A;  4J2S A;  1OQL B;  3WO4 A;  2Z49 A;  1ISX A;  4IY8 A;  2ESU A;  2MIB A;  4LO3 C;  4OEE A;  3VEQ A;  3CAH A;  2MLL B;  3BAQ A;  3S8J A;  1J0S A;  1BA7 A;  3WIN A;  1G82 A;  1K5U A;  3CA0 A;  4IZE A;  1RG8 A;  1ITB A;  1CE7 B;  1UPS A;  2QN4 A;  2D1Z A;  1F31 A;  1M16 A;  4OWL A;  1PUM B;  4AN6 A;  1BAS A;  3CRI A;  1W3F A;  2F2F C;  2D24 A;  5EG6 C;  4G9M A;  4KEJ A;  4ZFY B;  4IHZ A;  4LO3 A;  4I37 A;  1ISZ A;  3WO3 A;  1JQZ A;  1S0D A;  1PC8 B;  3FJA A;  4I2S A;  5F8W A;  3S8K A;  1S0C A;  2ZQN A;  4XFT A;  1Q1U A;  4DEP A;  1DJS B;  5FZZ A;  1II4 A;  1XHB A;  4P0L A;  3JRR A;  3P6J A;  4I6I A;  3ZC9 A;  3OJV A;  5BVP I;  3VUO A;  2D7R A;  2F2F A;  2AAI B;  3ZXD A;  5JLV A;  4A7Z A;  3FFZ A;  4IQP A;  4QC4 A;  2D43 A;  3LLP A;  4GP3 A;  3CA5 A;  1S0F A;  1S0B A;  2NZ9 A;  3NBC A;  2FFV A;  3BX1 C;  1AXM A;  2HWA A;  1HWM B;  1QXM A;  4HR6 C;  4D8H A;  3AJ6 A;  1RY7 A;  1G9C A;  4Z8S B;  1SZ6 B;  2VLC A;  4XKI A;  31BI A;  2DRE A;  2DRY A;  4AN7 B;  1HCE A;  5HPZ A;  3CQA A;  3H6R B;  3PME A;  3I29 B;  4IYB A;  1Z0H A;  1W3G A;  2Y9F A;  2L5X A;  3OGG A;  3HMY A;  3MAL A;  2R9K B;  3BB2 A;  1EV2 A;  2D23 A;  2MC2 A;  4Q9G A;  4QBC A;  3P53 A;  1TWM A;  1V6U A;  4I1B A;  1BFC A;  1CVS A;  2ZQO A;  1JTC A;  1SR4 C;  2J3P A;  1JT4 A;  3BA7 A;  5BQU C;  4IZX A;  3FJJ A;  1S0E A;  4D0T A;  2IWT B;  1TWE A;  2FGF A;  3UD8 A;  3ZX7 A;  1T9F A;  1Q03 A;  3AH4 A;  3D7W B;  3BRD A;  2VXT I;  1BLA A;  3F62 B;  3H6R A;  5EC5 A;  5EHA A;  4I4V A;  1YTO A;  1E0O A;  1SR4 A;  1IRP A;  4LO8 B;  1FWV A;  5F8S A;  3Q7W A;  2NP0 A;  2D22 A;  1HKN A;  2GZB A;  1Q04 A;  3O4A A;  3OJ2 A;  3Q7X A;  4QD2 B;  3H6Q A;  3UDA A;  1JT7 A;  41BI A;  3AKF A;  1V6X A;  3K1X A;  3RTI B;  4G6M A;  4PC4 A;  3FJD A;  1TIE A;  1TOO A;  4Q91 A;  4OW4 A;  4X39 A;  3SNV A;  4EFR A;  2Z48 A;  3FUO A;  4QD2 C;  3OGF A;  3E8L C;  2XOA A;  4G1R A;  1PZZ A;  1ISV A;  1PWA A;  3FJB A;  2ET2 A;  1FN0 A;  1S0G A;  2Q9X A;  3HBW A;  4H9W A;  1WD3 A;  2I1B A;  2E4M C;  1IOB A;  3O4B A;  3OJM A;  4II0 A;  3BAU A;  3N7L A;  4I0Y A;  1DFC A;  2HZ9 A;  5G00 A;  2DS0 A;  4I4S A;  4ZFU B;  3BAG A;  3IM6 A; 
#chains in the Genus database with same CATH topology
 1FQ9 A;  5D62 A;  4GOY A;  1RZO B;  3EF2 A;  4ISR A;  4D0Z A;  4OEF A;  1YF8 B;  1PUU B;  3R4S A;  3FJI A;  4GP0 A;  2E4M A;  1ISY A;  1ILR 1;  1DLL A;  1HIB A;  2WBC A;  3VT2 A;  2BEA A;  3CA4 A;  2QYI B;  1DFQ A;  1R8N A;  2GO2 A;  5DVH A;  3HOM A;  2HW9 A;  3A22 A;  3VT0 A;  4LO2 A;  1DIW A;  3VT1 A;  4JPZ A;  4I4Y A;  1JT5 A;  3CA6 A;  3A07 A;  4I4R A;  2K4A B;  1WD4 A;  2AXM A;  4KBB A;  3O3Q A;  4QAL A;  2K8R A;  3AKI A;  4ZLB B;  1FV3 A;  4UY4 A;  4CJM A;  4XFU A;  4ISQ A;  4HJJ A;  2X2S A;  3B9U A;  4USP A;  2D7I A;  4P0K A;  1G9A A;  1JY0 A;  2AFG A;  5FZU A;  4ZA3 B;  1T4Q A;  3HSM A;  3IIR A;  3MPP G;  3A21 A;  3C9Z A;  3VWC A;  2KKI A;  3N0K A;  1MC9 A;  1V6W A;  5JMC A;  1A8D A;  5BOW A;  1AVU A;  1WBC A;  1BLD A;  3O4D A;  4IY9 A;  1XYF A;  5D61 A;  1YBI A;  4OEG A;  1AFC A;  4KEK A;  3FJK A;  3V0B A;  3POK A;  5I1B A;  3WMU A;  2YUG A;  5D63 A;  3UJ4 A;  3QR5 A;  4XFS A;  2NYY A;  5BXT A;  21BI A;  3ZXG A;  4ZBV B;  3NBD A;  3AH1 A;  3LTQ A;  3AH2 A;  3CRH A;  2WRY A;  3BRF A;  1GGP B;  4LO0 C;  5BXS A;  3ZC8 A;  3VSZ A;  4H04 A;  2LIE A;  1FMM S;  4JQ0 A;  3AKG A;  2ZR1 B;  5DSS B;  4I4O A;  4QO3 A;  1XZZ A;  1BFB A;  4J23 B;  3O49 A;  3RMY A;  3RSJ A;  4Q9P A;  4EKX B;  2BEB A;  4GOV A;  2VU9 A;  4L4H A;  1JT3 A;  4END A;  3ILA A;  5BP5 C;  3BRG C;  3PG0 A;  4JKX B;  3CA3 A;  4R6U B;  4LO0 A;  3CU1 B;  1XG6 A;  1FMZ A;  2KLL A;  2RQ9 A;  4G6J A;  3BAO A;  2D44 A;  2Y9W C;  2FFU A;  3N7M A;  4I4X A;  4USO A;  3UJ0 A;  3JUT A;  4A7Y A;  4FVV A;  3N7K A;  1ISW A;  3WMV A;  4EEE B;  4GAI A;  2ERM A;  1DQO A;  3NBE A;  1EPW A;  3FJ9 A;  5BP5 A;  2Q3N B;  4LO7 B;  4QKR A;  5FNX A;  4KC3 A;  4X37 A;  3FUQ A;  2P23 A;  3AKH A;  4J2K A;  4JRA A;  1FWU A;  3FJF A;  1EVT A;  3A23 A;  1HWN B;  1IIL A;  4FGF A;  7I1B A;  4ZKT B;  4L4I A;  4J2Y A;  1NUN A;  4I96 A;  1K5V A;  3F1R A;  4LO2 C;  4LO7 C;  2VSA A;  1TFM B;  3BAH A;  3IM7 A;  3O4O A;  3RTJ B;  1TP0 A;  2K43 A;  1YXW A;  2LIQ A;  3NBN A;  2BFH A;  1HCD A;  3V0A A;  2RST A;  2X2T A;  5DUY A;  1L2H A;  1DQG A;  3O5W B;  1S0L A;  3HN1 A;  1V6V A;  3FJH A;  4I4P A;  1Z2V A;  3IAG C;  3V0B B;  4ZGR B;  1VCL A;  5FZY A;  5FNW A;  2VSE A;  4OWK A;  1QQK A;  4OUJ A;  1W3A A;  1YYN A;  3Q7Y A;  1MD6 A;  3FJ8 A;  4I7I A;  4KEI A;  3UD9 A;  5E24 E;  1AVW B;  4TLP A;  3PHZ A;  1EYL A;  1RML A;  2RG9 B;  2NVH A;  4JAW A;  3R4U A;  4I4Q A;  4ION A;  3I2X A;  3WO2 A;  1TTU A;  2M49 A;  3P6I A;  4J2X A;  2F8X C;  3FJC A;  3AZW A;  4JKQ A;  2D20 A;  1FGA A;  4DCK C;  4X38 A;  2VUA A;  1N4K A;  4OWJ A;  2UUS A;  1R8O A;  3OBT A;  1JLX A;  4HA2 A;  1BAR A;  1JLY A;  3W9T A;  2HWM A;  2FO1 A;  3O44 A;  1M2T B;  4EB2 B;  4I1E A;  3H6S E;  1NZK A;  3KMV A;  4EFP A;  3O4C A;  4A7K A;  3I2A A;  4F83 A;  2FDB M;  1IHK A;  2Y9G A;  5DZU A;  1WBA A;  1P63 A;  3AZV A;  1KNM A;  4P0J A;  4H75 A;  2AQZ A;  1BFG A;  1DZC A;  4DEN A;  4P6A A;  5B2H A;  3WA1 A;  3V79 C;  1IT0 A;  4LO1 C;  4ZOT A;  4F34 A;  4Z9W B;  4I4U A;  2KI4 A;  4ZFW B;  1DZD A;  4G9N A;  1IRA X;  1HWP B;  1FV2 A;  5F90 A;  1QQL A;  1G9D A;  2KI6 B;  3FJE A;  5BXR A;  2NTD A;  5F8Y A;  6I1B A;  1I1B A;  1Z4S A;  1AVX B;  3T8S A;  4QBV A;  3OBR A;  1I1E A;  1G9B A;  2DRZ A;  3PUB A;  2IHO A;  3NJ5 A;  4MZF B;  4X3A A;  3VSF A;  3AJ5 A;  4LO1 A;  2KH2 A;  5GAQ A;  5BXP A;  4JP0 A;  3V0A B;  5BQU A;  3TC2 A;  4WBC A;  8I1B A;  3CRG A;  1ABR B;  1D0H A;  3FGM A;  3BAV A;  3QYD A;  1ONK B;  2Y9X E;  3BAD A;  3CA1 A;  3IM5 A;  2P39 A;  4I3N A;  3WIN C;  3BA4 A;  3RMX A;  1AF9 A;  2NM1 A;  4QKS A;  4YOL A;  2VXR A;  9ILB A;  1AVA C;  4GAF A;  1HWO B;  3BA5 A;  3UD7 A;  3BTA A;  3HAL A;  4EFQ A;  1IJT A;  1BFF A;  3N7J A;  4I8M A;  4J2S A;  1OQL B;  3WO4 A;  2Z49 A;  1ISX A;  4IY8 A;  2ESU A;  2MIB A;  4LO3 C;  4OEE A;  3VEQ A;  3CAH A;  2MLL B;  3BAQ A;  3S8J A;  1J0S A;  1BA7 A;  3WIN A;  1G82 A;  1K5U A;  3CA0 A;  4IZE A;  1RG8 A;  1ITB A;  1CE7 B;  1UPS A;  2QN4 A;  2D1Z A;  1F31 A;  1M16 A;  4OWL A;  1PUM B;  4AN6 A;  1BAS A;  3CRI A;  1W3F A;  2F2F C;  2D24 A;  5EG6 C;  4G9M A;  4KEJ A;  4ZFY B;  4IHZ A;  4LO3 A;  4I37 A;  1ISZ A;  3WO3 A;  1JQZ A;  1S0D A;  1PC8 B;  3FJA A;  4I2S A;  5F8W A;  3S8K A;  1S0C A;  2ZQN A;  4XFT A;  1Q1U A;  4DEP A;  1DJS B;  5FZZ A;  1II4 A;  1XHB A;  4P0L A;  3JRR A;  3P6J A;  4I6I A;  3ZC9 A;  3OJV A;  5BVP I;  3VUO A;  2D7R A;  2F2F A;  2AAI B;  3ZXD A;  5JLV A;  4A7Z A;  3FFZ A;  4IQP A;  4QC4 A;  2D43 A;  3LLP A;  4GP3 A;  3CA5 A;  1S0F A;  1S0B A;  2NZ9 A;  3NBC A;  2FFV A;  3BX1 C;  1AXM A;  2HWA A;  1HWM B;  1QXM A;  4HR6 C;  4D8H A;  3AJ6 A;  1RY7 A;  1G9C A;  4Z8S B;  1SZ6 B;  2VLC A;  4XKI A;  31BI A;  2DRE A;  2DRY A;  4AN7 B;  1HCE A;  5HPZ A;  3CQA A;  3H6R B;  3PME A;  3I29 B;  2NS2 A;  4IYB A;  1Z0H A;  1W3G A;  2Y9F A;  2L5X A;  3OGG A;  3HMY A;  3MAL A;  2R9K B;  3BB2 A;  1EV2 A;  2D23 A;  2MC2 A;  4Q9G A;  4QBC A;  3P53 A;  1TWM A;  1V6U A;  4I1B A;  1BFC A;  1CVS A;  2ZQO A;  1JTC A;  1SR4 C;  2J3P A;  1JT4 A;  3BA7 A;  5BQU C;  4IZX A;  3FJJ A;  1S0E A;  4D0T A;  2IWT B;  1TWE A;  2FGF A;  3UD8 A;  3ZX7 A;  1T9F A;  1Q03 A;  3AH4 A;  3D7W B;  3BRD A;  2VXT I;  1BLA A;  3F62 B;  3H6R A;  5EC5 A;  5EHA A;  4I4V A;  1YTO A;  1E0O A;  1SR4 A;  1IRP A;  4LO8 B;  1FWV A;  5F8S A;  3Q7W A;  2NP0 A;  2D22 A;  1HKN A;  2GZB A;  1Q04 A;  3O4A A;  3OJ2 A;  3Q7X A;  4QD2 B;  3H6Q A;  3UDA A;  1JT7 A;  41BI A;  3AKF A;  1V6X A;  3K1X A;  3RTI B;  4G6M A;  4PC4 A;  3FJD A;  1TIE A;  1TOO A;  4MZG B;  4Q91 A;  4OW4 A;  4X39 A;  3SNV A;  4MZH A;  4EFR A;  2Z48 A;  3FUO A;  4QD2 C;  3OGF A;  3E8L C;  2XOA A;  4G1R A;  1PZZ A;  1ISV A;  1PWA A;  3FJB A;  2ET2 A;  1FN0 A;  1S0G A;  2Q9X A;  3HBW A;  4H9W A;  1WD3 A;  2I1B A;  2E4M C;  1IOB A;  3O4B A;  3OJM A;  4II0 A;  3BAU A;  3N7L A;  4I0Y A;  1DFC A;  2HZ9 A;  5G00 A;  2DS0 A;  4I4S A;  4ZFU B;  3BAG A;  3IM6 A; 
#chains in the Genus database with same CATH homology
 1FQ9 A;  5D62 A;  4GOY A;  1RZO B;  3EF2 A;  4ISR A;  4D0Z A;  4OEF A;  1YF8 B;  1PUU B;  3R4S A;  3FJI A;  4GP0 A;  2E4M A;  1ISY A;  1ILR 1;  1DLL A;  1HIB A;  2WBC A;  3VT2 A;  2BEA A;  3CA4 A;  2QYI B;  1DFQ A;  1R8N A;  2GO2 A;  5DVH A;  3HOM A;  2HW9 A;  3A22 A;  3VT0 A;  4LO2 A;  1DIW A;  3VT1 A;  4JPZ A;  4I4Y A;  1JT5 A;  3CA6 A;  3A07 A;  4I4R A;  2K4A B;  1WD4 A;  2AXM A;  4KBB A;  3O3Q A;  4QAL A;  2K8R A;  3AKI A;  4ZLB B;  1FV3 A;  4UY4 A;  4CJM A;  4XFU A;  4ISQ A;  4HJJ A;  2X2S A;  3B9U A;  4USP A;  2D7I A;  4P0K A;  1G9A A;  1JY0 A;  2AFG A;  5FZU A;  4ZA3 B;  1T4Q A;  3HSM A;  3IIR A;  3MPP G;  3A21 A;  3C9Z A;  3VWC A;  2KKI A;  3N0K A;  1MC9 A;  1V6W A;  5JMC A;  1A8D A;  5BOW A;  1AVU A;  1WBC A;  1BLD A;  3O4D A;  4IY9 A;  1XYF A;  5D61 A;  1YBI A;  4OEG A;  1AFC A;  4KEK A;  3FJK A;  3V0B A;  3POK A;  5I1B A;  3WMU A;  2YUG A;  5D63 A;  3UJ4 A;  3QR5 A;  4XFS A;  2NYY A;  5BXT A;  21BI A;  3ZXG A;  4ZBV B;  3NBD A;  3AH1 A;  3LTQ A;  3AH2 A;  3CRH A;  2WRY A;  3BRF A;  1GGP B;  4LO0 C;  5BXS A;  3ZC8 A;  3VSZ A;  4H04 A;  2LIE A;  1FMM S;  4JQ0 A;  3AKG A;  2ZR1 B;  5DSS B;  4I4O A;  4QO3 A;  1XZZ A;  1BFB A;  4J23 B;  3O49 A;  3RMY A;  3RSJ A;  4Q9P A;  4EKX B;  2BEB A;  4GOV A;  2VU9 A;  4L4H A;  1JT3 A;  4END A;  3ILA A;  5BP5 C;  3BRG C;  3PG0 A;  4JKX B;  3CA3 A;  4R6U B;  4LO0 A;  3CU1 B;  1XG6 A;  1FMZ A;  2KLL A;  2RQ9 A;  4G6J A;  3BAO A;  2D44 A;  2Y9W C;  2FFU A;  3N7M A;  4I4X A;  4USO A;  3UJ0 A;  3JUT A;  4A7Y A;  4FVV A;  3N7K A;  1ISW A;  3WMV A;  4EEE B;  4GAI A;  2ERM A;  1DQO A;  3NBE A;  1EPW A;  3FJ9 A;  5BP5 A;  2Q3N B;  4LO7 B;  4QKR A;  5FNX A;  4KC3 A;  4X37 A;  3FUQ A;  2P23 A;  3AKH A;  4J2K A;  4JRA A;  1FWU A;  3FJF A;  1EVT A;  3A23 A;  1HWN B;  1IIL A;  4FGF A;  7I1B A;  4ZKT B;  4L4I A;  4J2Y A;  1NUN A;  4I96 A;  1K5V A;  3F1R A;  4LO2 C;  4LO7 C;  2VSA A;  1TFM B;  3BAH A;  3IM7 A;  3O4O A;  3RTJ B;  1TP0 A;  2K43 A;  1YXW A;  2LIQ A;  3NBN A;  2BFH A;  1HCD A;  3V0A A;  2RST A;  2X2T A;  5DUY A;  1L2H A;  1DQG A;  3O5W B;  1S0L A;  3HN1 A;  1V6V A;  3FJH A;  4I4P A;  1Z2V A;  3IAG C;  3V0B B;  4ZGR B;  1VCL A;  5FZY A;  5FNW A;  2VSE A;  4OWK A;  1QQK A;  4OUJ A;  1W3A A;  1YYN A;  3Q7Y A;  1MD6 A;  3FJ8 A;  4I7I A;  4KEI A;  3UD9 A;  5E24 E;  1AVW B;  4TLP A;  3PHZ A;  1EYL A;  1RML A;  2RG9 B;  2NVH A;  4JAW A;  3R4U A;  4I4Q A;  4ION A;  3I2X A;  3WO2 A;  1TTU A;  2M49 A;  3P6I A;  4J2X A;  2F8X C;  3FJC A;  3AZW A;  4JKQ A;  2D20 A;  1FGA A;  4DCK C;  4X38 A;  2VUA A;  1N4K A;  4OWJ A;  2UUS A;  1R8O A;  3OBT A;  1JLX A;  4HA2 A;  1BAR A;  1JLY A;  3W9T A;  2HWM A;  2FO1 A;  3O44 A;  1M2T B;  4EB2 B;  4I1E A;  3H6S E;  1NZK A;  3KMV A;  4EFP A;  3O4C A;  4A7K A;  3I2A A;  4F83 A;  2FDB M;  1IHK A;  2Y9G A;  5DZU A;  1WBA A;  1P63 A;  3AZV A;  1KNM A;  4P0J A;  4H75 A;  2AQZ A;  1BFG A;  1DZC A;  4DEN A;  4P6A A;  5B2H A;  3WA1 A;  3V79 C;  1IT0 A;  4LO1 C;  4ZOT A;  4F34 A;  4Z9W B;  4I4U A;  2KI4 A;  4ZFW B;  1DZD A;  4G9N A;  1IRA X;  1HWP B;  1FV2 A;  5F90 A;  1QQL A;  1G9D A;  2KI6 B;  3FJE A;  5BXR A;  2NTD A;  5F8Y A;  6I1B A;  1I1B A;  1Z4S A;  1AVX B;  3T8S A;  4QBV A;  3OBR A;  1I1E A;  1G9B A;  2DRZ A;  3PUB A;  2IHO A;  3NJ5 A;  4MZF B;  4X3A A;  3VSF A;  3AJ5 A;  4LO1 A;  2KH2 A;  5GAQ A;  5BXP A;  4JP0 A;  3V0A B;  5BQU A;  3TC2 A;  4WBC A;  8I1B A;  3CRG A;  1ABR B;  1D0H A;  3FGM A;  3BAV A;  3QYD A;  1ONK B;  2Y9X E;  3BAD A;  3CA1 A;  3IM5 A;  2P39 A;  4I3N A;  3WIN C;  3BA4 A;  3RMX A;  1AF9 A;  2NM1 A;  4QKS A;  4YOL A;  2VXR A;  9ILB A;  1AVA C;  4GAF A;  1HWO B;  3BA5 A;  3UD7 A;  3BTA A;  3HAL A;  4EFQ A;  1IJT A;  1BFF A;  3N7J A;  4I8M A;  4J2S A;  1OQL B;  3WO4 A;  2Z49 A;  1ISX A;  4IY8 A;  2ESU A;  2MIB A;  4LO3 C;  4OEE A;  3VEQ A;  3CAH A;  2MLL B;  3BAQ A;  3S8J A;  1J0S A;  1BA7 A;  3WIN A;  1G82 A;  1K5U A;  3CA0 A;  4IZE A;  1RG8 A;  1ITB A;  1CE7 B;  1UPS A;  2QN4 A;  2D1Z A;  1F31 A;  1M16 A;  4OWL A;  1PUM B;  4AN6 A;  1BAS A;  3CRI A;  1W3F A;  2F2F C;  2D24 A;  5EG6 C;  4G9M A;  4KEJ A;  4ZFY B;  4IHZ A;  4LO3 A;  4I37 A;  1ISZ A;  3WO3 A;  1JQZ A;  1S0D A;  1PC8 B;  3FJA A;  4I2S A;  5F8W A;  3S8K A;  1S0C A;  2ZQN A;  4XFT A;  1Q1U A;  4DEP A;  1DJS B;  5FZZ A;  1II4 A;  1XHB A;  4P0L A;  3JRR A;  3P6J A;  4I6I A;  3ZC9 A;  3OJV A;  5BVP I;  3VUO A;  2D7R A;  2F2F A;  2AAI B;  3ZXD A;  5JLV A;  4A7Z A;  3FFZ A;  4IQP A;  4QC4 A;  2D43 A;  3LLP A;  4GP3 A;  3CA5 A;  1S0F A;  1S0B A;  2NZ9 A;  3NBC A;  2FFV A;  3BX1 C;  1AXM A;  2HWA A;  1HWM B;  1QXM A;  4HR6 C;  4D8H A;  3AJ6 A;  1RY7 A;  1G9C A;  4Z8S B;  1SZ6 B;  2VLC A;  4XKI A;  31BI A;  2DRE A;  2DRY A;  4AN7 B;  1HCE A;  5HPZ A;  3CQA A;  3H6R B;  3PME A;  3I29 B;  2NS2 A;  4IYB A;  1Z0H A;  1W3G A;  2Y9F A;  2L5X A;  3OGG A;  3HMY A;  3MAL A;  2R9K B;  3BB2 A;  1EV2 A;  2D23 A;  2MC2 A;  4Q9G A;  4QBC A;  3P53 A;  1TWM A;  1V6U A;  4I1B A;  1BFC A;  1CVS A;  2ZQO A;  1JTC A;  1SR4 C;  2J3P A;  1JT4 A;  3BA7 A;  5BQU C;  4IZX A;  3FJJ A;  1S0E A;  4D0T A;  2IWT B;  1TWE A;  2FGF A;  3UD8 A;  3ZX7 A;  1T9F A;  1Q03 A;  3AH4 A;  3D7W B;  3BRD A;  2VXT I;  1BLA A;  3F62 B;  3H6R A;  5EC5 A;  5EHA A;  4I4V A;  1YTO A;  1E0O A;  1SR4 A;  1IRP A;  4LO8 B;  1FWV A;  5F8S A;  3Q7W A;  2NP0 A;  2D22 A;  1HKN A;  2GZB A;  1Q04 A;  3O4A A;  3OJ2 A;  3Q7X A;  4QD2 B;  3H6Q A;  3UDA A;  1JT7 A;  41BI A;  3AKF A;  1V6X A;  3K1X A;  3RTI B;  4G6M A;  4PC4 A;  3FJD A;  1TIE A;  1TOO A;  4MZG B;  4Q91 A;  4OW4 A;  4X39 A;  3SNV A;  4MZH A;  4EFR A;  2Z48 A;  3FUO A;  4QD2 C;  3OGF A;  3E8L C;  2XOA A;  4G1R A;  1PZZ A;  1ISV A;  1PWA A;  3FJB A;  2ET2 A;  1FN0 A;  1S0G A;  2Q9X A;  3HBW A;  4H9W A;  1WD3 A;  2I1B A;  2E4M C;  1IOB A;  3O4B A;  3OJM A;  4II0 A;  3BAU A;  3N7L A;  4I0Y A;  1DFC A;  2HZ9 A;  5G00 A;  2DS0 A;  4I4S A;  4ZFU B;  3BAG A;  3IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...