2D7IA

Crystal structure of pp-galnac-t10 with udp, galnac and mn2+
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
536
structure length
536
Chain Sequence
b'GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 157
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7iA01
3Q80A 4EEAA 3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 5C1LA 1LL2A 4LO1C 5CQOA 3FJDA 1VZXA 3FWWA 3SX7A 3ZGGA 1NF5B 1G9BA 3BRDA 1IOBA 1JTCA 2OEGA 2Q4JA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 1GQ9A 5F90A 3WA1A 1DFQA 2RG9B 4KPZA 4Y64A 4LO7B 1I52A 4OWJA 1VICA 5CMHA 5BQUC 1JT5A 3ZF8A 1F31A 3RSJA 1G9DA 2GGOA 3V0PA 3O4AA 5C4BA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 4KC2A 2QGIA 1WBCA 2KI4A 3O4DA 3UJ0A 2O1FA 3V0BA 5FTSA 1JT7A 3ILAA 4FVVA 3I0FA 2M49A 3CKVA 1JLXA 2WRYA 3IOJA 4Q9GA 4HOCA 4I6IA 4H9WA 5BOWA 3I0JA 1NUNA 1QWJA 1R81A 2D43A 4G3PA 1DFCA 3V8ZA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3OC9A 4Y6NA 3O4OA 1FZWA 3MALA 2FDBM 1XYFA 3BAOA 3I0EA 2L5XA 3DUVA 1H5SC 4I4PA 4QKSA 4B5BA 4EE3A 2WVLA 1H5SA 1FG5N 3RMVA 1QQLA 4FRHA 3QR5A 4XWIA 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 1R80A 4KC3A 1HWPB 4FCEA 1YROB 1RMLA 2E4MA 3AZWA 1JVGA 5FZUA 4OW4A 2OEFA 5L6VA 1S0DA 2NVHA 1YXWA 3P53A 1VPAA 3V0NA 1TW5A 2I5EA 1HCDA 4JAWA 1YYNA 3PMEA 3PKPA 3CA3A 3OH0A 3U2VA 3VSFA 1HV9A 1SZ6B 1XHBA 2X65A 5FNXA 3IM5A 3I0CA 4IZXA 2Y4LA 4FRDA 1SS9A 4KQLA 4Y62A 1RY7A 1NKHB 1WT0A 3N7MA 4Y6UA 3V0LA 4DE7A 5JQQA 3F1RA 4DENA 3HALA 1QGSA 2WAWA 3CKNA 3N0KA 4CJ8A 4I4RA 3FUOA 3KMVA 2CU2A 1G95A 3E8LC 3D8VA 3V8YA 3I0KA 3TC2A 2X5SA 4PC4A 3I2AA 1H7EA 1FGGA 1LZJA 3AJ6A 2RJ7A 3KIAA 1OQLB 4KEJA 1WT2A 2WVKA 4I7IA 1D0HA 4JPZA 4I4QA 2AM3A 3K1XA 2V0HA 3K8EA 1P63A 4G1RA 2KLLA 4HG6A 1VCLA 3Q7WA 1IHKA 4GOYA 1ZCUA 2Z86A 3T7MA 3USQA 4LW6A 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 1EZIA 1O0RA 3U2UA 2Y9XE 1IRAX 2VS3A 1ZIZA 3Q7YA 1GX4A 4DECA 4IYBA 1JY0A 4J2XA 1H5TA 3NBCA 2XMHA 4P02A 5IDSA 2F8XC 3K8DA 1V6XA 1UPSA 7I1BA 2APCA 4X39A 3CGXA 3ZGFA 2KKIA 1EYLA 3V0AA 3SXEA 5DSSB 4I4YA 1G0RA 3UJ4A 3JUKA 5AJOA 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4HO3A 3U2WA 4AN7B 4EEMA 2FFUA 2W0WA 3UD8A 1HM9A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 2FY7A 5I1BA 1FV2A 4B3UA 2RJ4A 5C3DA 1G9CA 4LO3C 1I1EA 5C36A 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 5I1FA 4LO3A 3VUOA 3SX5A 4AYLA 3Q7XA 5E24E 1H5SB 4CVHA 3VSZA 3PKQA 1ZHJA 3MPPG 4OWLA 1L2HA 1FN0A 4OEFA 1HKNA 1VZTA 4NAIA 1ZCVA 2JCKA 2A8WA 2A8UA 3JUTA 1BFBA 1S4PA 2P73A 2XMEA 2RIYA 2YQJA 5C1HA 3RMWA 5C48A 2XWMA 1M16A 2NP0A 3BRKX 1R7XA 4HO5A 3CKQA 4B4GA 1DZDA 1PUMB 4TLPA 4EKXB 2D0JA 1ZJ0A 2PGYA 4USOA 1MC9A 1T4QA 5CMJA 2BO7A 3O4BA 2YESA 4LO2A 3O5WB 1TVYA 2AM4A 3LTQA 1LVWA 4FCUA 2R9KB 3RSBA 2BO6A 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 3CKOA 4J2KA 1LZ0A 3OH1A 1JYKA 2ET2A 1YF8B 4R7PA 5F8YA 2FGFA 1R82A 4IQPA 4BQHA 2FO1A 1G82A 3CA1A 1BASA 2XWLA 4FRBA 4FRMA 4MNDA 3CA5A 3AKGA 1WVCA 3OBTA 2MIBA 1W3GA 5CQNX 4E1KA 1I1BA 1H4DA 2Y4MA 4EVWA 4GAIA 1T9FA 5DZUA 4B4MA 3OH2A 5DVHA 1S0LA 2D20A 1W77A 2OI5A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 4HO6A 3I0LA 1XG6A 4Z8SB 3OJ2A 1IRPA 1ZCYA 1EV2A 3IOHA 5C4DA 1ZJ2A 4IY8A 3F62B 3U2XA 4AN6A 5CQPA 4ZFUB 3F1CA 3FOQA 1JYLA 1ZJOA 3FJJA 3HBWA 3IOIA 3Q7UA 1W55A 1TFMB 4L4IA 3V0AB 1SR4C 2P6WA 1BA7A 3T7OA 4AAWA 1H5RB 3JUJA 1Z90A 5C38A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1R7TA 3SX8A 1DQGA 4CJCA 3BA7A 1FMZA 4FGFA 4Y7GA 4DEPA 2RSTA 5F8SA 3E26A 3I0HA 1WT1A 4J2SA 3ZX7A 2RJ9A 4IRPA 1ISZA 21BIA 4XFTA 1EYRA 1G9RA 1M2TB 5DDTA 2AAIB 4ZKTB 4EE4A 2Y9WC 1ITBA 1TTUA 4LW3A 1FXJA 2RJ8A 2E4MC 3ZXDA 2JCOA 1IIMA 5DDVA 1ISVA 4LO0A 3V79C 1MC3A 3HL3A 4NAKA 4HO8A 1H7HA 3V0OA 3HN1A 3PG0A 4ZFYB 1IILA 1V82A 4D11A 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 1ZI3A 3VT2A 1LZ7A 4JQ0A 2AH9A 2O1GA 2VU9A 3V91A 5CMGX 4JISA 9ILBA 3TZTA 1ILR1 2K8RA 4JRAA 1KWSA 2QH5A 2VFZA 3ZLLA 31BIA 3I0GA 4QD2C 1HWNB 3H6RA 1ZI1A 4OUJA 3P6JA 1FRWA 1ISWA 4I4UA 3OGFA 3BAGA 2UUSA 1H7FA 1ON6A 4P6AA 2GZBA 1HIBA 1ZI5A 5C49A 3VT1A 3U0XA 2DPWA 2J3PA 4Q91A 2FYCB 3CRHA 3SXGA 3O49A 2V0LA 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 2W0VA 4FROA 4EE5A 1TP0A 3FJCA 2D24A 1H4EA 5EJ1A 2FYBA 1S0CA 4ARWA 5AJNA 3EF2A 4HO4A 1G2VA 2FYDB 3S8KA 1FV3A 1AFCA 4B42A 5J49A 1HJLA 2YQCA 4I8MA 4LO8B 5C4CA 1V6VA 3NGWA 1VZUA 5EJZA 2ZQOA 3V0BB 1FR8A 2RQ9A 1FMMS 1H4CA 3AH1A 1FWYA 2AESA 5C8RA 1ZDGA 2YQHA 5BXCA 1G8OA 3R4SA 1E5KA 4M28A 4X37A 1S0GA 1WD4A 5DUYA 1R7VA 5JLVA 1YBIA 1S0FA 3U2TA 4KC1A 1IINA 1ON8A 2Z49A 2Y6PA 4G3QA 1GX0A 4ZA3B 1V6WA 2D7RA 1BLDA 4Y7VA 3V0MA 3S8JA 4QO3A 4QALA 3R2WA 1VM8A 1IT0A 4L41C 2JCLA 4Y7FA 2VXTI 1WD3A 2VSEA 1VGTA 1V6UA 4K6RA 5C47A 1G97A 1HM8A 1AVXB 1GWWA 1J0SA 3FJBA 3OGGA 2ZU9A 1CE7B 2KI6B 1ABRB 1H5SD 3H6QA 3N7LA 1ISYA 4I96A 4D48A 1JQZA 4JKXB 2V0JA 2VXMA 1S4OA 4M2AA 4L4HA 4HO0A 1Q03A 4LO2C 3NBNA 3LW6A 2IHOA 5FNWA 4G9MA 1LL3A 5BP5C 1S4NA 3BTAA 4ZOTA 5AJPA 5L6SA 1BARA 4GBPA 1HM0A 5BP5A 2OI6A 4KXOA 3OH3A 3FJHA 2VUAA 5C3AA 4ZDQA 4OEEA 2KH2A 4EFQA 1GQCA 1VH3A 2XWNA 4Q9PA 3IM6A 4QD2B 2ERMA 3N9WA 1WT3A 4ENDA 3CA4A 5BVPI 2QKXA 4KC4A 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 1LL0A 4HR6C 1JT3A 2FYAA 3OGZA 4M4KA 2VXRA 2VS4A 4Y7TA 3SXDA 1Z0HA 2NTDA 2K4AB 2WGZA 3JTJA 3E25A 2ICXA 4HO2A 1W3FA 2GGQA 1VH1A 1A8DA 2BEAA 5C4EA 3VWCA 3QYDA 1R7YA 1WSZA 3NBDA 1MP3A 2AE7A 3CRGA 4NALA 2Y9FA 4I4SA 2WE9A 3ST8A 2BFHA 1MD6A 4D0TA 1VGWA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 1H3MA 1H5TB 3CRIA 2WEEA 4G3SA 2YC5A 3DK5A 3QVBA 1W3AA 4P0KA 4Y63A 1FR9A 5C1GA 4EFPA 1FGXA 3WO3A 2X2SA 2ZU7A 1Z4SA 1O7OA 2RIZA 2AM5A 2ZU8A 4QBCA 4Y7UA 4P0LA 4A7KA 2RITA 3SX3A 1AVWB 1JT4A 3UD7A 2DRZA 3D5NA 3NJ5A 1OMZA 4ZBVB 2ZR1B 2X2TA 5D63A 2BO8A 1E0OA 2AXMA 4MYBA 3PUBA 2Z48A 3RMXA 1G23A 1BFGA 1FWVA 3IM7A 3CU0A 1JV3A 2AGDA 1KNMA 3R3IA 3I0DA 5CQMX 3SPTA 4I3NA 3ZLKA 2RJ6A 4B2WA 4JKQA 2QN4A 1GA8A 2Y4KA 2MZBA 1O7QA 4C2SA 5BXSA 1DZCA 1HJJA 1PZYB 3OKRA 2JCJA 2PX7A 4J23B 4LO0C 3F1YA 2DS0A 1BFFA 4NANA 3U0YA 4I1EA 4KNRA 5FZYA 1NMMB 3Q4SA 3VT0A 1H7GA 3SXCA 4II0A 4KT7A 4AC3A 2NYYA 4D11C 2DREA 4DCKC 1PC8B 3BCVA 4BMAA 1ISXA 1PZZA 1R7UA 2QYIB 2VSAA 2Q3NB 2VS5A 4CJMA 4P00A 3ZXGA 1CVSA 2D44A 1G93A 3SXBA 4AYJA 4EEGA 1H7TA 2NZ9A 3FJ9A 4ZLBB 1VGUA 1XZ6A 1AF9A 3HOMA 1OQMB 4XKIA 4B2XA 1HWOB 3BA4A 2HW9A 5HS2A 4HCQA 1YP2A 5FYEA 2D1ZA 3CA0A 4ISQA 1NQIB 2RJ1A 2NXVA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 3OAMA 4FRLA 1AVAC 1G9AA 1GGPB 3FUQA 1ZDFA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 4EEOA 4FRPA 1NZKA 2VD4A 3AZVA 4CJBA 2PA4A 3RTIB 3D7WB 1DQOA 8I1BA 2I5KA 2BEBA 4D8HA 3USRA 2RJ0A 1AXMA 1JLYA 1ZJPA 3POKA 5FZZA 1FWUA 1W57A 5CQLX 3SXAA 4GP0A 4H04A 5BXPA 2VSHA 3AH2A 3FJFA 3NBEA 3WMUA 2UX8A 4I4VA 2HWMA 3GUEA 3POLA 5CMFX 1JV1A 1ZJ1A 4EEEB 2Y7AA 4X3AA 1O23B 1DJSB 3DJ4A 2ESUA 5B2HA 1H7LA 3OH4A 3O3PA 3O3QA 1TW1A 2AFGA 2VXLA 4Y9XA 1QQKA 4FQWA 3WINC 2RJ5A 2Z87A 1EVTA 3V0QA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 2RIXA 4KPXA 3B9UA 4LO7C 3WINA 1K4VA 2O1HA 2DRYA 4USPA 3PNNA 5FUHA 3BRGC 5JMCA 2X60A 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1PZTA 5FU0A 1NWGB 1BFCA 3CU1B 4KEKA 1VGZA 5GAQA 3TQDA 2ICYA 2F2FC 1ZCTA 1GWVA 3EE5A 4JD0A 1FOAA 1QXMA 5G00A 3BRFA 1OMXA 1YP3A 4ASJA 4XFSA 5C3BA 2OI7A 4GAFA 4IY9A 4HO9A 2F2FA 2YCMA 4R6UB 2AQZA 3JRRA 3FJIA 2BO4A 1FXOA 2P72A 3BB2A 5EIYA 5IDTA 4KNXA 5FV9A 2V0IA 1G1LA 2E3DA 4G6JA 3WO2A 1H5RA 2XOAA 1YTOA 2IWTB 1QG8A 2E8BA 1H7QA 4M2BA 4GP3A 2YQSA 4UEGA 5C4FA 2VSIA 3AKFA 2VLCA 4QBVA 1G3LA 3PHZA 1FO8A 1R8NA 4G87A 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 1MP5A 4Z9WB 1INIA 2WVMA 3OJVA 5IFYA 3SNVA 3O44A 1TZFA 3T7NA 1MP4A 2PGVA 1BLAA 3FJEA 4YS8A 3A22A 4FRQA 3I29B 4J18A 1ZJ3A 5FU8A 3FJKA 4DDZA 3OBRA 2LIEA 3N7JA 1JVDA 1ZI4A 1QGQA 4ASYA 3FGMA 1LZIA 4B4BA 1FO9A 1II4A 1HWMB 4KRVA 2D22A 2P23A 3OJMA 2I7BA 1INJA 1NHEB 2D23A 3C9ZA 1V84A 2X5ZA 4FREA 4ZFWB 5FTVA 2ZQNA 2HZ9A 5CMIA 2V0KA 3V90A 5HPZA 4D0ZA 3BX1C 3I0IX 4G6MA 2Y4JA 2YC3A 2AECA 1YP4A 4ECMA 4FRAA 3D98A 1V83A 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 4IRQA 3I2XA 3CKJA
chains in the Genus database with same CATH superfamily
3Q80A 4EEAA 3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 5C1LA 1LL2A 4LO1C 5CQOA 3FJDA 1VZXA 3FWWA 3SX7A 3ZGGA 1NF5B 1G9BA 3BRDA 1IOBA 1JTCA 2OEGA 2Q4JA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 1GQ9A 5F90A 3WA1A 1DFQA 2RG9B 4KPZA 4Y64A 4LO7B 1I52A 4OWJA 1VICA 5CMHA 5BQUC 1JT5A 3ZF8A 1F31A 3RSJA 1G9DA 2GGOA 3V0PA 3O4AA 5C4BA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 4KC2A 2QGIA 1WBCA 2KI4A 3O4DA 3UJ0A 2O1FA 3V0BA 5FTSA 1JT7A 3ILAA 4FVVA 3I0FA 2M49A 3CKVA 1JLXA 2WRYA 3IOJA 4Q9GA 4HOCA 4I6IA 4H9WA 5BOWA 3I0JA 1NUNA 1QWJA 1R81A 2D43A 4G3PA 1DFCA 3V8ZA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3OC9A 4Y6NA 3O4OA 1FZWA 3MALA 2FDBM 1XYFA 3BAOA 3I0EA 2L5XA 3DUVA 1H5SC 4I4PA 4QKSA 4B5BA 4EE3A 2WVLA 1H5SA 1FG5N 3RMVA 1QQLA 4FRHA 3QR5A 4XWIA 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 1R80A 4KC3A 2J0AA 1HWPB 4FCEA 1YROB 1RMLA 2E4MA 3AZWA 1JVGA 5FZUA 4OW4A 2OEFA 5L6VA 1S0DA 2NVHA 1YXWA 3P53A 1VPAA 3V0NA 1TW5A 2I5EA 1HCDA 4JAWA 1YYNA 3PMEA 3PKPA 3CA3A 3OH0A 3U2VA 3VSFA 1HV9A 1SZ6B 1XHBA 2X65A 5FNXA 3IM5A 3I0CA 4IZXA 2Y4LA 4FRDA 1SS9A 4KQLA 4Y62A 1RY7A 1NKHB 1WT0A 3N7MA 4Y6UA 3V0LA 4DE7A 5JQQA 3F1RA 4DENA 3HALA 1QGSA 2WAWA 3CKNA 3N0KA 4CJ8A 5D92A 4I4RA 3FUOA 3KMVA 2CU2A 1G95A 3E8LC 3D8VA 3V8YA 3I0KA 3TC2A 2X5SA 4PC4A 3I2AA 1H7EA 1FGGA 1LZJA 3AJ6A 2RJ7A 3KIAA 1OQLB 4KEJA 1WT2A 2WVKA 4I7IA 1D0HA 4JPZA 4I4QA 2AM3A 3K1XA 2V0HA 3K8EA 4FIXA 1P63A 4G1RA 2KLLA 4HG6A 1VCLA 3Q7WA 1IHKA 4GOYA 1ZCUA 2Z86A 3T7MA 3USQA 4LW6A 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 1EZIA 1O0RA 3U2UA 2Y9XE 1IRAX 2VS3A 1ZIZA 3Q7YA 1GX4A 4DECA 4IYBA 1JY0A 4J2XA 1H5TA 3NBCA 2XMHA 4P02A 5IDSA 2F8XC 3K8DA 1V6XA 1UPSA 7I1BA 2APCA 4X39A 3CGXA 3ZGFA 2KKIA 1EYLA 3V0AA 3SXEA 5DSSB 4I4YA 1G0RA 3UJ4A 3JUKA 5AJOA 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4HO3A 3U2WA 4AN7B 4EEMA 2FFUA 2W0WA 3UD8A 1HM9A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 2FY7A 5I1BA 1FV2A 4B3UA 2RJ4A 5C3DA 1G9CA 4LO3C 1I1EA 5C36A 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 5I1FA 4LO3A 3VUOA 3SX5A 4AYLA 3Q7XA 5E24E 1H5SB 4CVHA 3VSZA 3PKQA 1ZHJA 3MPPG 4OWLA 1L2HA 4O6MA 1FN0A 4OEFA 1HKNA 1VZTA 4NAIA 1ZCVA 2JCKA 2A8WA 2A8UA 3JUTA 1BFBA 1S4PA 2P73A 2XMEA 2RIYA 2YQJA 5C1HA 3RMWA 5C48A 2XWMA 1M16A 2NP0A 3BRKX 1R7XA 4HO5A 3CKQA 4B4GA 1DZDA 1PUMB 4TLPA 4EKXB 2D0JA 1ZJ0A 2PGYA 4Q7CA 4USOA 1MC9A 1T4QA 5CMJA 2BO7A 3O4BA 2YESA 4LO2A 3O5WB 1TVYA 2AM4A 3LTQA 1LVWA 4FCUA 2R9KB 3RSBA 2BO6A 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 3CKOA 4J2KA 1LZ0A 3OH1A 1JYKA 2ET2A 1YF8B 4R7PA 5F8YA 2FGFA 1R82A 4IQPA 4BQHA 2FO1A 1G82A 3CA1A 1BASA 2XWLA 4FRBA 4FRMA 4MNDA 3CA5A 3AKGA 1WVCA 3OBTA 2MIBA 1W3GA 5CQNX 4E1KA 1I1BA 1H4DA 2Y4MA 4EVWA 4GAIA 1T9FA 5DZUA 4B4MA 3OH2A 5DVHA 1S0LA 2D20A 1W77A 2OI5A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 4HO6A 3I0LA 1XG6A 4Z8SB 3OJ2A 1IRPA 1ZCYA 1EV2A 3IOHA 5C4DA 1ZJ2A 4IY8A 3F62B 3U2XA 4AN6A 5CQPA 4ZFUB 3F1CA 3FOQA 1JYLA 1ZJOA 3FJJA 3HBWA 3IOIA 3Q7UA 1W55A 1TFMB 4L4IA 3V0AB 1SR4C 2P6WA 1BA7A 3T7OA 4AAWA 1H5RB 3JUJA 1Z90A 5C38A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1R7TA 3SX8A 1DQGA 4CJCA 3BA7A 1FMZA 4FGFA 4Y7GA 4DEPA 2RSTA 5F8SA 3E26A 3I0HA 1WT1A 4J2SA 3ZX7A 2RJ9A 4IRPA 1ISZA 21BIA 4XFTA 1EYRA 1G9RA 1M2TB 5DDTA 2AAIB 4ZKTB 4EE4A 2Y9WC 1ITBA 1TTUA 4LW3A 1FXJA 2RJ8A 2E4MC 3ZXDA 2JCOA 1IIMA 5DDVA 1ISVA 4LO0A 3V79C 1MC3A 3HL3A 4NAKA 4HO8A 1H7HA 3V0OA 3HN1A 3PG0A 4ZFYB 1IILA 1V82A 4D11A 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 1ZI3A 3VT2A 1LZ7A 4JQ0A 2AH9A 2O1GA 2VU9A 3V91A 5CMGX 4JISA 9ILBA 3TZTA 1ILR1 2K8RA 4JRAA 1KWSA 2QH5A 2VFZA 3ZLLA 31BIA 3I0GA 4QD2C 1HWNB 3H6RA 1ZI1A 4OUJA 3P6JA 1FRWA 1ISWA 4I4UA 3OGFA 2J0BA 3BAGA 2UUSA 1H7FA 1ON6A 4P6AA 2GZBA 1HIBA 1ZI5A 2C0NA 5C49A 3VT1A 3U0XA 2DPWA 2J3PA 4Q91A 2FYCB 3CRHA 3SXGA 3O49A 2V0LA 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 2W0VA 4FROA 4EE5A 1TP0A 3FJCA 2D24A 1H4EA 5EJ1A 2FYBA 1S0CA 4ARWA 5AJNA 3EF2A 4HO4A 1G2VA 2FYDB 5D91A 3S8KA 1FV3A 1AFCA 4B42A 5J49A 1HJLA 2YQCA 4I8MA 4LO8B 5C4CA 1V6VA 3NGWA 1VZUA 5EJZA 2ZQOA 3V0BB 4MIXA 1FR8A 2RQ9A 1FMMS 1H4CA 3AH1A 1FWYA 2AESA 5C8RA 1ZDGA 2YQHA 5BXCA 1G8OA 3R4SA 1E5KA 4M28A 4X37A 1S0GA 1WD4A 5DUYA 1R7VA 5JLVA 4MZHA 1YBIA 1S0FA 2NS2A 3U2TA 4KC1A 1IINA 1ON8A 2Z49A 2Y6PA 4G3QA 1GX0A 4ZA3B 1V6WA 2D7RA 1BLDA 4Y7VA 3V0MA 3S8JA 4QO3A 4QALA 3R2WA 1VM8A 1IT0A 4L41C 2JCLA 4Y7FA 2VXTI 1WD3A 2VSEA 1VGTA 1V6UA 4K6RA 5C47A 1G97A 1HM8A 1AVXB 1GWWA 1J0SA 3FJBA 3OGGA 2ZU9A 1CE7B 2KI6B 1ABRB 1H5SD 3H6QA 3N7LA 1ISYA 4I96A 4D48A 1JQZA 4JKXB 2V0JA 2VXMA 4O6NA 1S4OA 4M2AA 4L4HA 4HO0A 1Q03A 4LO2C 3NBNA 3LW6A 2IHOA 5FNWA 4G9MA 1LL3A 5BP5C 1S4NA 3BTAA 4ZOTA 5AJPA 5L6SA 1BARA 4GBPA 1HM0A 5BP5A 2OI6A 4KXOA 3OH3A 3FJHA 2VUAA 5C3AA 4ZDQA 4OEEA 2KH2A 4EFQA 1GQCA 1VH3A 2XWNA 4Q9PA 3IM6A 4QD2B 2ERMA 3N9WA 1WT3A 4ENDA 3CA4A 5BVPI 2QKXA 4KC4A 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 1LL0A 4HR6C 1JT3A 2FYAA 3OGZA 4M4KA 2VXRA 2VS4A 4Y7TA 3SXDA 4MZFB 1Z0HA 2NTDA 2K4AB 2WGZA 3JTJA 3E25A 2ICXA 4HO2A 1W3FA 2GGQA 1VH1A 1A8DA 2BEAA 5C4EA 3VWCA 3QYDA 1R7YA 1WSZA 3NBDA 1MP3A 2AE7A 3CRGA 4NALA 2Y9FA 4I4SA 2WE9A 3ST8A 2BFHA 1MD6A 4D0TA 1VGWA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 4MZGB 1H3MA 3CRIA 1H5TB 2WEEA 2YC5A 3DK5A 3QVBA 4G3SA 1W3AA 4P0KA 4Y63A 1FR9A 5C1GA 4EFPA 1FGXA 3WO3A 2X2SA 2ZU7A 1Z4SA 1O7OA 2RIZA 2AM5A 2ZU8A 4QBCA 4Y7UA 4P0LA 4A7KA 2RITA 3SX3A 1AVWB 1JT4A 3UD7A 2DRZA 3D5NA 3NJ5A 1OMZA 4ZBVB 2ZR1B 2X2TA 5D63A 2BO8A 1E0OA 4UY4A 2AXMA 4MYBA 3PUBA 2Z48A 3RMXA 1G23A 1BFGA 1FWVA 3IM7A 3CU0A 1JV3A 2AGDA 1KNMA 3R3IA 3I0DA 5CQMX 3SPTA 4I3NA 3ZLKA 2RJ6A 4B2WA 4JKQA 2QN4A 1GA8A 2Y4KA 2MZBA 1O7QA 4C2SA 5BXSA 1DZCA 1HJJA 1PZYB 3OKRA 2JCJA 2PX7A 4J23B 4LO0C 3F1YA 2DS0A 1BFFA 4NANA 3U0YA 4I1EA 4KNRA 5FZYA 1NMMB 3Q4SA 3VT0A 1H7GA 3SXCA 4II0A 4KT7A 4AC3A 2NYYA 4D11C 2DREA 4DCKC 1PC8B 3BCVA 4BMAA 1ISXA 1PZZA 1R7UA 2QYIB 2VSAA 2Q3NB 2VS5A 4CJMA 4P00A 3ZXGA 1CVSA 2D44A 1G93A 3SXBA 4AYJA 4EEGA 1H7TA 2NZ9A 3FJ9A 4ZLBB 1VGUA 1XZ6A 1AF9A 3HOMA 1OQMB 4XKIA 4B2XA 1HWOB 3BA4A 2HW9A 5HS2A 4HCQA 1YP2A 5FYEA 2D1ZA 3CA0A 4ISQA 1NQIB 2RJ1A 2NXVA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 3OAMA 4FRLA 1AVAC 1G9AA 1GGPB 3FUQA 1ZDFA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 4EEOA 4FRPA 1NZKA 2VD4A 3AZVA 4CJBA 2PA4A 3RTIB 3D7WB 1DQOA 8I1BA 2I5KA 2BEBA 4H75A 4D8HA 3USRA 2RJ0A 1AXMA 1JLYA 1ZJPA 3POKA 5FZZA 1FWUA 1W57A 5CQLX 3SXAA 4GP0A 4H04A 5BXPA 2VSHA 3AH2A 3FJFA 3NBEA 3WMUA 2UX8A 4I4VA 2HWMA 3GUEA 3POLA 5CMFX 1JV1A 1ZJ1A 4EEEB 2Y7AA 4X3AA 1O23B 1DJSB 3DJ4A 2ESUA 5B2HA 1H7LA 3OH4A 3O3PA 3O3QA 1TW1A 2AFGA 2VXLA 4Y9XA 1QQKA 4FQWA 3WINC 2RJ5A 2Z87A 1EVTA 3V0QA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 2RIXA 4KPXA 3B9UA 4LO7C 3WINA 1K4VA 2O1HA 2DRYA 4USPA 3PNNA 5FUHA 3BRGC 5JMCA 2X60A 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1PZTA 5FU0A 1NWGB 1BFCA 3CU1B 4KEKA 1VGZA 5GAQA 3TQDA 2ICYA 2F2FC 1ZCTA 1GWVA 3EE5A 4JD0A 1FOAA 1QXMA 5G00A 3BRFA 1OMXA 1YP3A 4ASJA 4XFSA 5C3BA 2OI7A 4GAFA 4IY9A 4HO9A 2F2FA 2YCMA 4R6UB 2AQZA 3JRRA 3FJIA 2BO4A 1FXOA 2P72A 3BB2A 5EIYA 5IDTA 4KNXA 4FIYA 5FV9A 2V0IA 1G1LA 2E3DA 4G6JA 3WO2A 1H5RA 2XOAA 1YTOA 2IWTB 1QG8A 2E8BA 1H7QA 4M2BA 4GP3A 2YQSA 4UEGA 5C4FA 2VSIA 3AKFA 2VLCA 4QBVA 1G3LA 3PHZA 1FO8A 1R8NA 4G87A 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 1MP5A 4Z9WB 1INIA 2WVMA 3OJVA 5IFYA 3SNVA 3O44A 1TZFA 3T7NA 1MP4A 2PGVA 1BLAA 3FJEA 4YS8A 3A22A 4FRQA 3I29B 4J18A 1ZJ3A 5FU8A 3FJKA 4DDZA 3OBRA 2LIEA 3N7JA 1JVDA 1ZI4A 1QGQA 4ASYA 3FGMA 1LZIA 4B4BA 1FO9A 1II4A 1HWMB 4KRVA 2D22A 2P23A 3OJMA 2I7BA 1INJA 1NHEB 2D23A 3C9ZA 1V84A 2X5ZA 4FREA 4ZFWB 5FTVA 2ZQNA 2HZ9A 5CMIA 2V0KA 3V90A 5HPZA 4D0ZA 3BX1C 2VK9A 4G6MA 2Y4JA 2YC3A 2AECA 3I0IX 1YP4A 4ECMA 4FRAA 3D98A 1V83A 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 4IRQA 3I2XA 3CKJA
chains in the Genus database with same CATH topology
3Q80A 4EEAA 3UDAA 4QC4A 3N7KA 3O4CA 3VEQA 5D61A 5C1LA 1LL2A 4LO1C 5CQOA 3FJDA 1VZXA 3FWWA 3SX7A 3ZGGA 1NF5B 1G9BA 3BRDA 1IOBA 1JTCA 2OEGA 2Q4JA 3AKHA 4LO1A 3CQAA 4ISRA 5EC5A 1GQ9A 5F90A 3WA1A 1DFQA 2RG9B 4KPZA 4Y64A 4LO7B 1I52A 4OWJA 1VICA 5CMHA 5BQUC 1JT5A 3ZF8A 1F31A 3RSJA 1G9DA 2GGOA 3V0PA 3O4AA 5C4BA 2Y9GA 4A7ZA 4HA2A 3HSMA 5BQUA 41BIA 4KC2A 2QGIA 1WBCA 2KI4A 3O4DA 3UJ0A 2O1FA 3V0BA 5FTSA 1JT7A 3ILAA 4FVVA 3I0FA 2M49A 3CKVA 1JLXA 2WRYA 3IOJA 4Q9GA 4HOCA 4I6IA 4H9WA 5BOWA 3I0JA 1NUNA 1QWJA 1R81A 2D43A 4G3PA 1DFCA 3V8ZA 1SR4A 4HJJA 4WBCA 3FJ8A 1Q1UA 3OC9A 4Y6NA 3O4OA 1FZWA 3MALA 2FDBM 1XYFA 3BAOA 3I0EA 2L5XA 3DUVA 1H5SC 4I4PA 4QKSA 4B5BA 4EE3A 2WVLA 1H5SA 1FG5N 3RMVA 1QQLA 4FRHA 3QR5A 4XWIA 4EFRA 4I37A 5BXRA 2NM1A 1XZZA 3WO4A 4X38A 1R80A 4KC3A 2J0AA 1HWPB 4FCEA 1YROB 1RMLA 2E4MA 3AZWA 1JVGA 5FZUA 4OW4A 2OEFA 5L6VA 1S0DA 2NVHA 1YXWA 3P53A 1VPAA 3V0NA 1TW5A 2I5EA 1HCDA 4JAWA 1YYNA 3PMEA 3PKPA 3CA3A 3OH0A 3U2VA 3VSFA 1HV9A 1SZ6B 1XHBA 2X65A 5FNXA 3IM5A 3I0CA 4IZXA 2Y4LA 4FRDA 1SS9A 4KQLA 4Y62A 1RY7A 1NKHB 1WT0A 3N7MA 4Y6UA 3V0LA 4DE7A 5JQQA 3F1RA 4DENA 3HALA 1QGSA 2WAWA 3CKNA 3N0KA 4CJ8A 5D92A 4I4RA 3FUOA 3KMVA 2CU2A 1G95A 3E8LC 3D8VA 3V8YA 3I0KA 3TC2A 2X5SA 4PC4A 3I2AA 1H7EA 1FGGA 1LZJA 3AJ6A 2RJ7A 3KIAA 1OQLB 4KEJA 1WT2A 2WVKA 4I7IA 1D0HA 4JPZA 4I4QA 2AM3A 3K1XA 2V0HA 3K8EA 4FIXA 1P63A 4G1RA 2KLLA 4HG6A 1VCLA 3Q7WA 1IHKA 4GOYA 1ZCUA 2Z86A 3T7MA 3USQA 4LW6A 1DIWA 1TWMA 4G9NA 4EB2B 1RG8A 1EZIA 1O0RA 3U2UA 2Y9XE 1IRAX 2VS3A 1ZIZA 3Q7YA 1GX4A 4DECA 4IYBA 1JY0A 4J2XA 1H5TA 3NBCA 2XMHA 4P02A 5IDSA 2F8XC 3K8DA 1V6XA 1UPSA 7I1BA 2APCA 4X39A 3CGXA 3ZGFA 2KKIA 1EYLA 3V0AA 3SXEA 5DSSB 4I4YA 1G0RA 3UJ4A 3JUKA 5AJOA 3AH4A 1RZOB 3BAUA 3LLPA 4F34A 4HO3A 3U2WA 4AN7B 4EEMA 2FFUA 2W0WA 3UD8A 1HM9A 1Q04A 4P0JA 5EHAA 3T8SA 2D7IA 3AKIA 1ONKB 6I1BA 1R8OA 5BXTA 2FY7A 5I1BA 1FV2A 4B3UA 2RJ4A 5C3DA 1G9CA 4LO3C 1I1EA 5C36A 4IHZA 3UD9A 3RTJB 2HWAA 2P39A 1S0BA 4A7YA 5I1FA 4LO3A 3VUOA 3SX5A 4AYLA 3Q7XA 5E24E 1H5SB 4CVHA 3VSZA 3PKQA 1ZHJA 3MPPG 4OWLA 1L2HA 4O6MA 1FN0A 4OEFA 1HKNA 1VZTA 4NAIA 1ZCVA 2JCKA 2A8WA 2A8UA 3JUTA 1BFBA 1S4PA 2P73A 2XMEA 2RIYA 2YQJA 5C1HA 3RMWA 5C48A 2XWMA 1M16A 2NP0A 3BRKX 1R7XA 4HO5A 3CKQA 4B4GA 1DZDA 1PUMB 4TLPA 4EKXB 2D0JA 1ZJ0A 2PGYA 4Q7CA 4USOA 1MC9A 1T4QA 5CMJA 2BO7A 3O4BA 2YESA 4LO2A 3O5WB 1TVYA 2AM4A 3LTQA 1LVWA 4FCUA 2R9KB 3RSBA 2BO6A 3H6SE 1TOOA 3RMYA 1PWAA 1FQ9A 4F83A 3CKOA 4J2KA 1LZ0A 3OH1A 1JYKA 2ET2A 1YF8B 4R7PA 5F8YA 2FGFA 1R82A 4IQPA 4BQHA 2FO1A 1G82A 3CA1A 1BASA 2XWLA 4FRBA 4FRMA 4MNDA 3CA5A 3AKGA 1WVCA 3OBTA 2MIBA 1W3GA 5CQNX 4E1KA 1I1BA 1H4DA 2Y4MA 4EVWA 4GAIA 1T9FA 5DZUA 4B4MA 3OH2A 5DVHA 1S0LA 2D20A 1W77A 2OI5A 2K43A 3FJAA 4I4OA 4I4XA 3W9TA 2GO2A 3AJ5A 3IIRA 4HO6A 3I0LA 1XG6A 4Z8SB 3OJ2A 1IRPA 1ZCYA 1EV2A 3IOHA 5C4DA 1ZJ2A 4IY8A 3F62B 3U2XA 4AN6A 5CQPA 4ZFUB 3F1CA 3FOQA 1JYLA 1ZJOA 3FJJA 3HBWA 3IOIA 3Q7UA 1W55A 1TFMB 4L4IA 3V0AB 1SR4C 2P6WA 1BA7A 3T7OA 4AAWA 1H5RB 3JUJA 1Z90A 5C38A 4OWKA 2FFVA 2LIQA 3A21A 3CA6A 1R7TA 3SX8A 1DQGA 4CJCA 3BA7A 1FMZA 4FGFA 4Y7GA 4DEPA 2RSTA 5F8SA 3E26A 3I0HA 1WT1A 4J2SA 3ZX7A 2RJ9A 4IRPA 1ISZA 21BIA 4XFTA 1EYRA 1G9RA 1M2TB 5DDTA 2AAIB 4ZKTB 4EE4A 2Y9WC 1ITBA 1TTUA 4LW3A 1FXJA 2RJ8A 2E4MC 3ZXDA 2JCOA 1IIMA 5DDVA 1ISVA 4LO0A 3V79C 1MC3A 3HL3A 4NAKA 4HO8A 1H7HA 3V0OA 3HN1A 3PG0A 4ZFYB 1IILA 1V82A 4D11A 4ZGRB 1K5VA 2I1BA 4QKRA 5EG6C 1ZI3A 3VT2A 1LZ7A 4JQ0A 2AH9A 2O1GA 2VU9A 3V91A 5CMGX 4JISA 9ILBA 3TZTA 1ILR1 2K8RA 4JRAA 1KWSA 2QH5A 2VFZA 3ZLLA 31BIA 3I0GA 4QD2C 1HWNB 3H6RA 1ZI1A 4OUJA 3P6JA 1FRWA 1ISWA 4I4UA 3OGFA 2J0BA 3BAGA 2UUSA 1H7FA 1ON6A 4P6AA 2GZBA 1HIBA 1ZI5A 2C0NA 5C49A 3VT1A 3U0XA 2DPWA 2J3PA 4Q91A 2FYCB 3CRHA 3SXGA 3O49A 2V0LA 2Q9XA 4I2SA 3BADA 3WMVA 4IONA 2W0VA 4FROA 4EE5A 1TP0A 3FJCA 2D24A 1H4EA 5EJ1A 2FYBA 1S0CA 4ARWA 5AJNA 3EF2A 4HO4A 1G2VA 2FYDB 5D91A 3S8KA 1FV3A 1AFCA 4B42A 5J49A 1HJLA 2YQCA 4I8MA 4LO8B 5C4CA 1V6VA 3NGWA 1VZUA 5EJZA 2ZQOA 3V0BB 4MIXA 1FR8A 2RQ9A 1FMMS 1H4CA 3AH1A 1FWYA 2AESA 5C8RA 1ZDGA 2YQHA 5BXCA 1G8OA 3R4SA 1E5KA 4M28A 4X37A 1S0GA 1WD4A 5DUYA 1R7VA 5JLVA 4MZHA 1YBIA 1S0FA 2NS2A 3U2TA 4KC1A 1IINA 1ON8A 2Z49A 2Y6PA 4G3QA 1GX0A 4ZA3B 1V6WA 2D7RA 1BLDA 4Y7VA 3V0MA 3S8JA 4QO3A 4QALA 3R2WA 1VM8A 1IT0A 4L41C 2JCLA 4Y7FA 2VXTI 1WD3A 2VSEA 1VGTA 1V6UA 4K6RA 5C47A 1G97A 1HM8A 1AVXB 1GWWA 1J0SA 3FJBA 3OGGA 2ZU9A 1CE7B 2KI6B 1ABRB 1H5SD 3H6QA 3N7LA 1ISYA 4I96A 4D48A 1JQZA 4JKXB 2V0JA 2VXMA 4O6NA 1S4OA 4M2AA 4L4HA 4HO0A 1Q03A 4LO2C 3NBNA 3LW6A 2IHOA 5FNWA 4G9MA 1LL3A 5BP5C 1S4NA 3BTAA 4ZOTA 5AJPA 5L6SA 1BARA 4GBPA 1HM0A 5BP5A 2OI6A 4KXOA 3OH3A 3FJHA 2VUAA 5C3AA 4ZDQA 4OEEA 2KH2A 4EFQA 1GQCA 1VH3A 2XWNA 4Q9PA 3IM6A 4QD2B 2ERMA 3N9WA 1WT3A 4ENDA 3CA4A 5BVPI 2QKXA 4KC4A 1IJTA 3CAHA 1WBAA 3P6IA 4I1BA 1LL0A 4HR6C 1JT3A 2FYAA 3OGZA 4M4KA 2VXRA 2VS4A 4Y7TA 3SXDA 4MZFB 1Z0HA 2NTDA 2K4AB 2WGZA 3JTJA 3E25A 2ICXA 4HO2A 1W3FA 2GGQA 1VH1A 1A8DA 2BEAA 5C4EA 3VWCA 3QYDA 1R7YA 1WSZA 3NBDA 1MP3A 2AE7A 3CRGA 4NALA 2Y9FA 4I4SA 2WE9A 3ST8A 2BFHA 1MD6A 4D0TA 1VGWA 1TWEA 4JP0A 1S0EA 2MLLB 1HCEA 4MZGB 1H3MA 3CRIA 1H5TB 2WEEA 2YC5A 3DK5A 3QVBA 4G3SA 1W3AA 4P0KA 4Y63A 1FR9A 5C1GA 4EFPA 1FGXA 3WO3A 2X2SA 2ZU7A 1Z4SA 1O7OA 2RIZA 2AM5A 2ZU8A 4QBCA 4Y7UA 4P0LA 4A7KA 2RITA 3SX3A 1AVWB 1JT4A 3UD7A 2DRZA 3D5NA 3NJ5A 1OMZA 4ZBVB 2ZR1B 2X2TA 5D63A 2BO8A 1E0OA 4UY4A 2AXMA 4MYBA 3PUBA 2Z48A 3RMXA 1G23A 1BFGA 1FWVA 3IM7A 3CU0A 1JV3A 2AGDA 1KNMA 3R3IA 3I0DA 5CQMX 3SPTA 4I3NA 3ZLKA 2RJ6A 4B2WA 4JKQA 2QN4A 1GA8A 2Y4KA 2MZBA 1O7QA 4C2SA 5BXSA 1DZCA 1HJJA 1PZYB 3OKRA 2JCJA 2PX7A 4J23B 4LO0C 3F1YA 2DS0A 1BFFA 4NANA 3U0YA 4I1EA 4KNRA 5FZYA 1NMMB 3Q4SA 3VT0A 1H7GA 3SXCA 4II0A 4KT7A 4AC3A 2NYYA 4D11C 2DREA 4DCKC 1PC8B 3BCVA 4BMAA 1ISXA 1PZZA 1R7UA 2QYIB 2VSAA 2Q3NB 2VS5A 4CJMA 4P00A 3ZXGA 1CVSA 2D44A 1G93A 3SXBA 4AYJA 4EEGA 1H7TA 2NZ9A 3FJ9A 4ZLBB 1VGUA 1XZ6A 1AF9A 3HOMA 1OQMB 4XKIA 4B2XA 1HWOB 3BA4A 2HW9A 5HS2A 4HCQA 1YP2A 5FYEA 2D1ZA 3CA0A 4ISQA 1NQIB 2RJ1A 2NXVA 1K5UA 1N4KA 3BAQA 4I0YA 1AVUA 3OAMA 4FRLA 1AVAC 1G9AA 1GGPB 3FUQA 1ZDFA 1PUUB 3A23A 2YUGA 5F8WA 1TIEA 4EEOA 4FRPA 1NZKA 2VD4A 3AZVA 4CJBA 2PA4A 3RTIB 3D7WB 1DQOA 8I1BA 2I5KA 2BEBA 4H75A 4D8HA 3USRA 2RJ0A 1AXMA 1JLYA 1ZJPA 3POKA 5FZZA 1FWUA 1W57A 5CQLX 3SXAA 4GP0A 4H04A 5BXPA 2VSHA 3AH2A 3FJFA 3NBEA 3WMUA 2UX8A 4I4VA 2HWMA 3GUEA 3POLA 5CMFX 1JV1A 1ZJ1A 4EEEB 2Y7AA 4X3AA 1O23B 1DJSB 3DJ4A 2ESUA 5B2HA 1H7LA 3OH4A 3O3PA 3O3QA 1TW1A 2AFGA 2VXLA 4Y9XA 1QQKA 4FQWA 3WINC 2RJ5A 2Z87A 1EVTA 3V0QA 4IZEA 4KBBA 3BA5A 3IAGC 3BAVA 2RIXA 4KPXA 3B9UA 4LO7C 3WINA 1K4VA 2O1HA 2DRYA 4USPA 3PNNA 5FUHA 3BRGC 5JMCA 2X60A 3ZC9A 1Z2VA 5D62A 3FFZA 1EPWA 1PZTA 5FU0A 1NWGB 1BFCA 3CU1B 4KEKA 1VGZA 5GAQA 3TQDA 2ICYA 2F2FC 1ZCTA 1GWVA 3EE5A 4JD0A 1FOAA 1QXMA 5G00A 3BRFA 1OMXA 1YP3A 4ASJA 4XFSA 5C3BA 2OI7A 4GAFA 4IY9A 4HO9A 2F2FA 2YCMA 4R6UB 2AQZA 3JRRA 3FJIA 2BO4A 1FXOA 2P72A 3BB2A 5EIYA 5IDTA 4KNXA 4FIYA 5FV9A 2V0IA 1G1LA 2E3DA 4G6JA 3WO2A 1H5RA 2XOAA 1YTOA 2IWTB 1QG8A 2E8BA 1H7QA 4M2BA 4GP3A 2YQSA 4UEGA 5C4FA 2VSIA 3AKFA 2VLCA 4QBVA 1G3LA 3PHZA 1FO8A 1R8NA 4G87A 1DLLA 2WBCA 4KEIA 4YOLA 3ZC8A 3H6RB 3R4UA 4OEGA 1MP5A 4Z9WB 1INIA 2WVMA 3OJVA 5IFYA 3SNVA 3O44A 1TZFA 3T7NA 1MP4A 2PGVA 1BLAA 3FJEA 4YS8A 3A22A 4FRQA 3I29B 4J18A 1ZJ3A 5FU8A 3FJKA 4DDZA 3OBRA 2LIEA 3N7JA 1JVDA 1ZI4A 1QGQA 4ASYA 3FGMA 1LZIA 4B4BA 1FO9A 1II4A 1HWMB 4KRVA 2D22A 2P23A 3OJMA 2I7BA 1INJA 1NHEB 2D23A 3C9ZA 1V84A 2X5ZA 4FREA 4ZFWB 5FTVA 2ZQNA 2HZ9A 5CMIA 2V0KA 3V90A 5HPZA 4D0ZA 3BX1C 2VK9A 4G6MA 2Y4JA 2YC3A 2AECA 3I0IX 1YP4A 4ECMA 4FRAA 3D98A 1V83A 3BAHA 4J2YA 3A07A 4GOVA 4XFUA 1FGAA 2MC2A 3HMYA 4IRQA 3I2XA 3CKJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q80 A;  4EEA A;  3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  5C1L A;  1LL2 A;  4LO1 C;  5CQO A;  3FJD A;  1VZX A;  3FWW A;  3SX7 A;  3ZGG A;  1NF5 B;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  2OEG A;  2Q4J A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  1GQ9 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4KPZ A;  4Y64 A;  4LO7 B;  1I52 A;  4OWJ A;  1VIC A;  5CMH A;  5BQU C;  1JT5 A;  3ZF8 A;  1F31 A;  3RSJ A;  1G9D A;  2GGO A;  3V0P A;  3O4A A;  5C4B A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  4KC2 A;  2QGI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  2O1F A;  3V0B A;  5FTS A;  1JT7 A;  3ILA A;  4FVV A;  3I0F A;  2M49 A;  3CKV A;  1JLX A;  2WRY A;  3IOJ A;  4Q9G A;  4HOC A;  4I6I A;  4H9W A;  5BOW A;  3I0J A;  1NUN A;  1QWJ A;  1R81 A;  2D43 A;  4G3P A;  1DFC A;  3V8Z A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3OC9 A;  4Y6N A;  3O4O A;  1FZW A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  3I0E A;  2L5X A;  3DUV A;  1H5S C;  4I4P A;  4QKS A;  4B5B A;  4EE3 A;  2WVL A;  1H5S A;  1FG5 N;  3RMV A;  1QQL A;  4FRH A;  3QR5 A;  4XWI A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  1R80 A;  4KC3 A;  1HWP B;  4FCE A;  1YRO B;  1RML A;  2E4M A;  3AZW A;  1JVG A;  5FZU A;  4OW4 A;  2OEF A;  5L6V A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1VPA A;  3V0N A;  1TW5 A;  2I5E A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3PKP A;  3CA3 A;  3OH0 A;  3U2V A;  3VSF A;  1HV9 A;  1SZ6 B;  1XHB A;  2X65 A;  5FNX A;  3IM5 A;  3I0C A;  4IZX A;  2Y4L A;  4FRD A;  1SS9 A;  4KQL A;  4Y62 A;  1RY7 A;  1NKH B;  1WT0 A;  3N7M A;  4Y6U A;  3V0L A;  4DE7 A;  5JQQ A;  3F1R A;  4DEN A;  3HAL A;  1QGS A;  2WAW A;  3CKN A;  3N0K A;  4CJ8 A;  4I4R A;  3FUO A;  3KMV A;  2CU2 A;  1G95 A;  3E8L C;  3D8V A;  3V8Y A;  3I0K A;  3TC2 A;  2X5S A;  4PC4 A;  3I2A A;  1H7E A;  1FGG A;  1LZJ A;  3AJ6 A;  2RJ7 A;  3KIA A;  1OQL B;  4KEJ A;  1WT2 A;  2WVK A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  2AM3 A;  3K1X A;  2V0H A;  3K8E A;  1P63 A;  4G1R A;  2KLL A;  4HG6 A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1ZCU A;  2Z86 A;  3T7M A;  3USQ A;  4LW6 A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  1EZI A;  1O0R A;  3U2U A;  2Y9X E;  1IRA X;  2VS3 A;  1ZIZ A;  3Q7Y A;  1GX4 A;  4DEC A;  4IYB A;  1JY0 A;  4J2X A;  1H5T A;  3NBC A;  2XMH A;  4P02 A;  5IDS A;  2F8X C;  3K8D A;  1V6X A;  1UPS A;  7I1B A;  2APC A;  4X39 A;  3CGX A;  3ZGF A;  2KKI A;  1EYL A;  3V0A A;  3SXE A;  5DSS B;  4I4Y A;  1G0R A;  3UJ4 A;  3JUK A;  5AJO A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4HO3 A;  3U2W A;  4AN7 B;  4EEM A;  2FFU A;  2W0W A;  3UD8 A;  1HM9 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  2FY7 A;  5I1B A;  1FV2 A;  4B3U A;  2RJ4 A;  5C3D A;  1G9C A;  4LO3 C;  1I1E A;  5C36 A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  5I1F A;  4LO3 A;  3VUO A;  3SX5 A;  4AYL A;  3Q7X A;  5E24 E;  1H5S B;  4CVH A;  3VSZ A;  3PKQ A;  1ZHJ A;  3MPP G;  4OWL A;  1L2H A;  1FN0 A;  4OEF A;  1HKN A;  1VZT A;  4NAI A;  1ZCV A;  2JCK A;  2A8W A;  2A8U A;  3JUT A;  1BFB A;  1S4P A;  2P73 A;  2XME A;  2RIY A;  2YQJ A;  5C1H A;  3RMW A;  5C48 A;  2XWM A;  1M16 A;  2NP0 A;  3BRK X;  1R7X A;  4HO5 A;  3CKQ A;  4B4G A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  2D0J A;  1ZJ0 A;  2PGY A;  4USO A;  1MC9 A;  1T4Q A;  5CMJ A;  2BO7 A;  3O4B A;  2YES A;  4LO2 A;  3O5W B;  1TVY A;  2AM4 A;  3LTQ A;  1LVW A;  4FCU A;  2R9K B;  3RSB A;  2BO6 A;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  3CKO A;  4J2K A;  1LZ0 A;  3OH1 A;  1JYK A;  2ET2 A;  1YF8 B;  4R7P A;  5F8Y A;  2FGF A;  1R82 A;  4IQP A;  4BQH A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  2XWL A;  4FRB A;  4FRM A;  4MND A;  3CA5 A;  3AKG A;  1WVC A;  3OBT A;  2MIB A;  1W3G A;  5CQN X;  4E1K A;  1I1B A;  1H4D A;  2Y4M A;  4EVW A;  4GAI A;  1T9F A;  5DZU A;  4B4M A;  3OH2 A;  5DVH A;  1S0L A;  2D20 A;  1W77 A;  2OI5 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  4HO6 A;  3I0L A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1ZCY A;  1EV2 A;  3IOH A;  5C4D A;  1ZJ2 A;  4IY8 A;  3F62 B;  3U2X A;  4AN6 A;  5CQP A;  4ZFU B;  3F1C A;  3FOQ A;  1JYL A;  1ZJO A;  3FJJ A;  3HBW A;  3IOI A;  3Q7U A;  1W55 A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  2P6W A;  1BA7 A;  3T7O A;  4AAW A;  1H5R B;  3JUJ A;  1Z90 A;  5C38 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1R7T A;  3SX8 A;  1DQG A;  4CJC A;  3BA7 A;  1FMZ A;  4FGF A;  4Y7G A;  4DEP A;  2RST A;  5F8S A;  3E26 A;  3I0H A;  1WT1 A;  4J2S A;  3ZX7 A;  2RJ9 A;  4IRP A;  1ISZ A;  21BI A;  4XFT A;  1EYR A;  1G9R A;  1M2T B;  5DDT A;  2AAI B;  4ZKT B;  4EE4 A;  2Y9W C;  1ITB A;  1TTU A;  4LW3 A;  1FXJ A;  2RJ8 A;  2E4M C;  3ZXD A;  2JCO A;  1IIM A;  5DDV A;  1ISV A;  4LO0 A;  3V79 C;  1MC3 A;  3HL3 A;  4NAK A;  4HO8 A;  1H7H A;  3V0O A;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  1V82 A;  4D11 A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  1ZI3 A;  3VT2 A;  1LZ7 A;  4JQ0 A;  2AH9 A;  2O1G A;  2VU9 A;  3V91 A;  5CMG X;  4JIS A;  9ILB A;  3TZT A;  1ILR 1;  2K8R A;  4JRA A;  1KWS A;  2QH5 A;  2VFZ A;  3ZLL A;  31BI A;  3I0G A;  4QD2 C;  1HWN B;  3H6R A;  1ZI1 A;  4OUJ A;  3P6J A;  1FRW A;  1ISW A;  4I4U A;  3OGF A;  3BAG A;  2UUS A;  1H7F A;  1ON6 A;  4P6A A;  2GZB A;  1HIB A;  1ZI5 A;  5C49 A;  3VT1 A;  3U0X A;  2DPW A;  2J3P A;  4Q91 A;  2FYC B;  3CRH A;  3SXG A;  3O49 A;  2V0L A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  2W0V A;  4FRO A;  4EE5 A;  1TP0 A;  3FJC A;  2D24 A;  1H4E A;  5EJ1 A;  2FYB A;  1S0C A;  4ARW A;  5AJN A;  3EF2 A;  4HO4 A;  1G2V A;  2FYD B;  3S8K A;  1FV3 A;  1AFC A;  4B42 A;  5J49 A;  1HJL A;  2YQC A;  4I8M A;  4LO8 B;  5C4C A;  1V6V A;  3NGW A;  1VZU A;  5EJZ A;  2ZQO A;  3V0B B;  1FR8 A;  2RQ9 A;  1FMM S;  1H4C A;  3AH1 A;  1FWY A;  2AES A;  5C8R A;  1ZDG A;  2YQH A;  5BXC A;  1G8O A;  3R4S A;  1E5K A;  4M28 A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  1R7V A;  5JLV A;  1YBI A;  1S0F A;  3U2T A;  4KC1 A;  1IIN A;  1ON8 A;  2Z49 A;  2Y6P A;  4G3Q A;  1GX0 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  4Y7V A;  3V0M A;  3S8J A;  4QO3 A;  4QAL A;  3R2W A;  1VM8 A;  1IT0 A;  4L41 C;  2JCL A;  4Y7F A;  2VXT I;  1WD3 A;  2VSE A;  1VGT A;  1V6U A;  4K6R A;  5C47 A;  1G97 A;  1HM8 A;  1AVX B;  1GWW A;  1J0S A;  3FJB A;  3OGG A;  2ZU9 A;  1CE7 B;  2KI6 B;  1ABR B;  1H5S D;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  4D48 A;  1JQZ A;  4JKX B;  2V0J A;  2VXM A;  1S4O A;  4M2A A;  4L4H A;  4HO0 A;  1Q03 A;  4LO2 C;  3NBN A;  3LW6 A;  2IHO A;  5FNW A;  4G9M A;  1LL3 A;  5BP5 C;  1S4N A;  3BTA A;  4ZOT A;  5AJP A;  5L6S A;  1BAR A;  4GBP A;  1HM0 A;  5BP5 A;  2OI6 A;  4KXO A;  3OH3 A;  3FJH A;  2VUA A;  5C3A A;  4ZDQ A;  4OEE A;  2KH2 A;  4EFQ A;  1GQC A;  1VH3 A;  2XWN A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  3N9W A;  1WT3 A;  4END A;  3CA4 A;  5BVP I;  2QKX A;  4KC4 A;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  1LL0 A;  4HR6 C;  1JT3 A;  2FYA A;  3OGZ A;  4M4K A;  2VXR A;  2VS4 A;  4Y7T A;  3SXD A;  1Z0H A;  2NTD A;  2K4A B;  2WGZ A;  3JTJ A;  3E25 A;  2ICX A;  4HO2 A;  1W3F A;  2GGQ A;  1VH1 A;  1A8D A;  2BEA A;  5C4E A;  3VWC A;  3QYD A;  1R7Y A;  1WSZ A;  3NBD A;  1MP3 A;  2AE7 A;  3CRG A;  4NAL A;  2Y9F A;  4I4S A;  2WE9 A;  3ST8 A;  2BFH A;  1MD6 A;  4D0T A;  1VGW A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  1H3M A;  1H5T B;  3CRI A;  2WEE A;  4G3S A;  2YC5 A;  3DK5 A;  3QVB A;  1W3A A;  4P0K A;  4Y63 A;  1FR9 A;  5C1G A;  4EFP A;  1FGX A;  3WO3 A;  2X2S A;  2ZU7 A;  1Z4S A;  1O7O A;  2RIZ A;  2AM5 A;  2ZU8 A;  4QBC A;  4Y7U A;  4P0L A;  4A7K A;  2RIT A;  3SX3 A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3D5N A;  3NJ5 A;  1OMZ A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  2BO8 A;  1E0O A;  2AXM A;  4MYB A;  3PUB A;  2Z48 A;  3RMX A;  1G23 A;  1BFG A;  1FWV A;  3IM7 A;  3CU0 A;  1JV3 A;  2AGD A;  1KNM A;  3R3I A;  3I0D A;  5CQM X;  3SPT A;  4I3N A;  3ZLK A;  2RJ6 A;  4B2W A;  4JKQ A;  2QN4 A;  1GA8 A;  2Y4K A;  2MZB A;  1O7Q A;  4C2S A;  5BXS A;  1DZC A;  1HJJ A;  1PZY B;  3OKR A;  2JCJ A;  2PX7 A;  4J23 B;  4LO0 C;  3F1Y A;  2DS0 A;  1BFF A;  4NAN A;  3U0Y A;  4I1E A;  4KNR A;  5FZY A;  1NMM B;  3Q4S A;  3VT0 A;  1H7G A;  3SXC A;  4II0 A;  4KT7 A;  4AC3 A;  2NYY A;  4D11 C;  2DRE A;  4DCK C;  1PC8 B;  3BCV A;  4BMA A;  1ISX A;  1PZZ A;  1R7U A;  2QYI B;  2VSA A;  2Q3N B;  2VS5 A;  4CJM A;  4P00 A;  3ZXG A;  1CVS A;  2D44 A;  1G93 A;  3SXB A;  4AYJ A;  4EEG A;  1H7T A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1VGU A;  1XZ6 A;  1AF9 A;  3HOM A;  1OQM B;  4XKI A;  4B2X A;  1HWO B;  3BA4 A;  2HW9 A;  5HS2 A;  4HCQ A;  1YP2 A;  5FYE A;  2D1Z A;  3CA0 A;  4ISQ A;  1NQI B;  2RJ1 A;  2NXV A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  3OAM A;  4FRL A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1ZDF A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  4EEO A;  4FRP A;  1NZK A;  2VD4 A;  3AZV A;  4CJB A;  2PA4 A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2I5K A;  2BEB A;  4D8H A;  3USR A;  2RJ0 A;  1AXM A;  1JLY A;  1ZJP A;  3POK A;  5FZZ A;  1FWU A;  1W57 A;  5CQL X;  3SXA A;  4GP0 A;  4H04 A;  5BXP A;  2VSH A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  2UX8 A;  4I4V A;  2HWM A;  3GUE A;  3POL A;  5CMF X;  1JV1 A;  1ZJ1 A;  4EEE B;  2Y7A A;  4X3A A;  1O23 B;  1DJS B;  3DJ4 A;  2ESU A;  5B2H A;  1H7L A;  3OH4 A;  3O3P A;  3O3Q A;  1TW1 A;  2AFG A;  2VXL A;  4Y9X A;  1QQK A;  4FQW A;  3WIN C;  2RJ5 A;  2Z87 A;  1EVT A;  3V0Q A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  2RIX A;  4KPX A;  3B9U A;  4LO7 C;  3WIN A;  1K4V A;  2O1H A;  2DRY A;  4USP A;  3PNN A;  5FUH A;  3BRG C;  5JMC A;  2X60 A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1PZT A;  5FU0 A;  1NWG B;  1BFC A;  3CU1 B;  4KEK A;  1VGZ A;  5GAQ A;  3TQD A;  2ICY A;  2F2F C;  1ZCT A;  1GWV A;  3EE5 A;  4JD0 A;  1FOA A;  1QXM A;  5G00 A;  3BRF A;  1OMX A;  1YP3 A;  4ASJ A;  4XFS A;  5C3B A;  2OI7 A;  4GAF A;  4IY9 A;  4HO9 A;  2F2F A;  2YCM A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  2BO4 A;  1FXO A;  2P72 A;  3BB2 A;  5EIY A;  5IDT A;  4KNX A;  5FV9 A;  2V0I A;  1G1L A;  2E3D A;  4G6J A;  3WO2 A;  1H5R A;  2XOA A;  1YTO A;  2IWT B;  1QG8 A;  2E8B A;  1H7Q A;  4M2B A;  4GP3 A;  2YQS A;  4UEG A;  5C4F A;  2VSI A;  3AKF A;  2VLC A;  4QBV A;  1G3L A;  3PHZ A;  1FO8 A;  1R8N A;  4G87 A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  1MP5 A;  4Z9W B;  1INI A;  2WVM A;  3OJV A;  5IFY A;  3SNV A;  3O44 A;  1TZF A;  3T7N A;  1MP4 A;  2PGV A;  1BLA A;  3FJE A;  4YS8 A;  3A22 A;  4FRQ A;  3I29 B;  4J18 A;  1ZJ3 A;  5FU8 A;  3FJK A;  4DDZ A;  3OBR A;  2LIE A;  3N7J A;  1JVD A;  1ZI4 A;  1QGQ A;  4ASY A;  3FGM A;  1LZI A;  4B4B A;  1FO9 A;  1II4 A;  1HWM B;  4KRV A;  2D22 A;  2P23 A;  3OJM A;  2I7B A;  1INJ A;  1NHE B;  2D23 A;  3C9Z A;  1V84 A;  2X5Z A;  4FRE A;  4ZFW B;  5FTV A;  2ZQN A;  2HZ9 A;  5CMI A;  2V0K A;  3V90 A;  5HPZ A;  4D0Z A;  3BX1 C;  3I0I X;  4G6M A;  2Y4J A;  2YC3 A;  2AEC A;  1YP4 A;  4ECM A;  4FRA A;  3D98 A;  1V83 A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  4IRQ A;  3I2X A;  3CKJ A; 
#chains in the Genus database with same CATH topology
 3Q80 A;  4EEA A;  3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  5C1L A;  1LL2 A;  4LO1 C;  5CQO A;  3FJD A;  1VZX A;  3FWW A;  3SX7 A;  3ZGG A;  1NF5 B;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  2OEG A;  2Q4J A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  1GQ9 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4KPZ A;  4Y64 A;  4LO7 B;  1I52 A;  4OWJ A;  1VIC A;  5CMH A;  5BQU C;  1JT5 A;  3ZF8 A;  1F31 A;  3RSJ A;  1G9D A;  2GGO A;  3V0P A;  3O4A A;  5C4B A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  4KC2 A;  2QGI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  2O1F A;  3V0B A;  5FTS A;  1JT7 A;  3ILA A;  4FVV A;  3I0F A;  2M49 A;  3CKV A;  1JLX A;  2WRY A;  3IOJ A;  4Q9G A;  4HOC A;  4I6I A;  4H9W A;  5BOW A;  3I0J A;  1NUN A;  1QWJ A;  1R81 A;  2D43 A;  4G3P A;  1DFC A;  3V8Z A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3OC9 A;  4Y6N A;  3O4O A;  1FZW A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  3I0E A;  2L5X A;  3DUV A;  1H5S C;  4I4P A;  4QKS A;  4B5B A;  4EE3 A;  2WVL A;  1H5S A;  1FG5 N;  3RMV A;  1QQL A;  4FRH A;  3QR5 A;  4XWI A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  1R80 A;  4KC3 A;  2J0A A;  1HWP B;  4FCE A;  1YRO B;  1RML A;  2E4M A;  3AZW A;  1JVG A;  5FZU A;  4OW4 A;  2OEF A;  5L6V A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1VPA A;  3V0N A;  1TW5 A;  2I5E A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3PKP A;  3CA3 A;  3OH0 A;  3U2V A;  3VSF A;  1HV9 A;  1SZ6 B;  1XHB A;  2X65 A;  5FNX A;  3IM5 A;  3I0C A;  4IZX A;  2Y4L A;  4FRD A;  1SS9 A;  4KQL A;  4Y62 A;  1RY7 A;  1NKH B;  1WT0 A;  3N7M A;  4Y6U A;  3V0L A;  4DE7 A;  5JQQ A;  3F1R A;  4DEN A;  3HAL A;  1QGS A;  2WAW A;  3CKN A;  3N0K A;  4CJ8 A;  5D92 A;  4I4R A;  3FUO A;  3KMV A;  2CU2 A;  1G95 A;  3E8L C;  3D8V A;  3V8Y A;  3I0K A;  3TC2 A;  2X5S A;  4PC4 A;  3I2A A;  1H7E A;  1FGG A;  1LZJ A;  3AJ6 A;  2RJ7 A;  3KIA A;  1OQL B;  4KEJ A;  1WT2 A;  2WVK A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  2AM3 A;  3K1X A;  2V0H A;  3K8E A;  4FIX A;  1P63 A;  4G1R A;  2KLL A;  4HG6 A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1ZCU A;  2Z86 A;  3T7M A;  3USQ A;  4LW6 A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  1EZI A;  1O0R A;  3U2U A;  2Y9X E;  1IRA X;  2VS3 A;  1ZIZ A;  3Q7Y A;  1GX4 A;  4DEC A;  4IYB A;  1JY0 A;  4J2X A;  1H5T A;  3NBC A;  2XMH A;  4P02 A;  5IDS A;  2F8X C;  3K8D A;  1V6X A;  1UPS A;  7I1B A;  2APC A;  4X39 A;  3CGX A;  3ZGF A;  2KKI A;  1EYL A;  3V0A A;  3SXE A;  5DSS B;  4I4Y A;  1G0R A;  3UJ4 A;  3JUK A;  5AJO A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4HO3 A;  3U2W A;  4AN7 B;  4EEM A;  2FFU A;  2W0W A;  3UD8 A;  1HM9 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  2FY7 A;  5I1B A;  1FV2 A;  4B3U A;  2RJ4 A;  5C3D A;  1G9C A;  4LO3 C;  1I1E A;  5C36 A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  5I1F A;  4LO3 A;  3VUO A;  3SX5 A;  4AYL A;  3Q7X A;  5E24 E;  1H5S B;  4CVH A;  3VSZ A;  3PKQ A;  1ZHJ A;  3MPP G;  4OWL A;  1L2H A;  4O6M A;  1FN0 A;  4OEF A;  1HKN A;  1VZT A;  4NAI A;  1ZCV A;  2JCK A;  2A8W A;  2A8U A;  3JUT A;  1BFB A;  1S4P A;  2P73 A;  2XME A;  2RIY A;  2YQJ A;  5C1H A;  3RMW A;  5C48 A;  2XWM A;  1M16 A;  2NP0 A;  3BRK X;  1R7X A;  4HO5 A;  3CKQ A;  4B4G A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  2D0J A;  1ZJ0 A;  2PGY A;  4Q7C A;  4USO A;  1MC9 A;  1T4Q A;  5CMJ A;  2BO7 A;  3O4B A;  2YES A;  4LO2 A;  3O5W B;  1TVY A;  2AM4 A;  3LTQ A;  1LVW A;  4FCU A;  2R9K B;  3RSB A;  2BO6 A;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  3CKO A;  4J2K A;  1LZ0 A;  3OH1 A;  1JYK A;  2ET2 A;  1YF8 B;  4R7P A;  5F8Y A;  2FGF A;  1R82 A;  4IQP A;  4BQH A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  2XWL A;  4FRB A;  4FRM A;  4MND A;  3CA5 A;  3AKG A;  1WVC A;  3OBT A;  2MIB A;  1W3G A;  5CQN X;  4E1K A;  1I1B A;  1H4D A;  2Y4M A;  4EVW A;  4GAI A;  1T9F A;  5DZU A;  4B4M A;  3OH2 A;  5DVH A;  1S0L A;  2D20 A;  1W77 A;  2OI5 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  4HO6 A;  3I0L A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1ZCY A;  1EV2 A;  3IOH A;  5C4D A;  1ZJ2 A;  4IY8 A;  3F62 B;  3U2X A;  4AN6 A;  5CQP A;  4ZFU B;  3F1C A;  3FOQ A;  1JYL A;  1ZJO A;  3FJJ A;  3HBW A;  3IOI A;  3Q7U A;  1W55 A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  2P6W A;  1BA7 A;  3T7O A;  4AAW A;  1H5R B;  3JUJ A;  1Z90 A;  5C38 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1R7T A;  3SX8 A;  1DQG A;  4CJC A;  3BA7 A;  1FMZ A;  4FGF A;  4Y7G A;  4DEP A;  2RST A;  5F8S A;  3E26 A;  3I0H A;  1WT1 A;  4J2S A;  3ZX7 A;  2RJ9 A;  4IRP A;  1ISZ A;  21BI A;  4XFT A;  1EYR A;  1G9R A;  1M2T B;  5DDT A;  2AAI B;  4ZKT B;  4EE4 A;  2Y9W C;  1ITB A;  1TTU A;  4LW3 A;  1FXJ A;  2RJ8 A;  2E4M C;  3ZXD A;  2JCO A;  1IIM A;  5DDV A;  1ISV A;  4LO0 A;  3V79 C;  1MC3 A;  3HL3 A;  4NAK A;  4HO8 A;  1H7H A;  3V0O A;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  1V82 A;  4D11 A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  1ZI3 A;  3VT2 A;  1LZ7 A;  4JQ0 A;  2AH9 A;  2O1G A;  2VU9 A;  3V91 A;  5CMG X;  4JIS A;  9ILB A;  3TZT A;  1ILR 1;  2K8R A;  4JRA A;  1KWS A;  2QH5 A;  2VFZ A;  3ZLL A;  31BI A;  3I0G A;  4QD2 C;  1HWN B;  3H6R A;  1ZI1 A;  4OUJ A;  3P6J A;  1FRW A;  1ISW A;  4I4U A;  3OGF A;  2J0B A;  3BAG A;  2UUS A;  1H7F A;  1ON6 A;  4P6A A;  2GZB A;  1HIB A;  1ZI5 A;  2C0N A;  5C49 A;  3VT1 A;  3U0X A;  2DPW A;  2J3P A;  4Q91 A;  2FYC B;  3CRH A;  3SXG A;  3O49 A;  2V0L A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  2W0V A;  4FRO A;  4EE5 A;  1TP0 A;  3FJC A;  2D24 A;  1H4E A;  5EJ1 A;  2FYB A;  1S0C A;  4ARW A;  5AJN A;  3EF2 A;  4HO4 A;  1G2V A;  2FYD B;  5D91 A;  3S8K A;  1FV3 A;  1AFC A;  4B42 A;  5J49 A;  1HJL A;  2YQC A;  4I8M A;  4LO8 B;  5C4C A;  1V6V A;  3NGW A;  1VZU A;  5EJZ A;  2ZQO A;  3V0B B;  4MIX A;  1FR8 A;  2RQ9 A;  1FMM S;  1H4C A;  3AH1 A;  1FWY A;  2AES A;  5C8R A;  1ZDG A;  2YQH A;  5BXC A;  1G8O A;  3R4S A;  1E5K A;  4M28 A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  1R7V A;  5JLV A;  4MZH A;  1YBI A;  1S0F A;  2NS2 A;  3U2T A;  4KC1 A;  1IIN A;  1ON8 A;  2Z49 A;  2Y6P A;  4G3Q A;  1GX0 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  4Y7V A;  3V0M A;  3S8J A;  4QO3 A;  4QAL A;  3R2W A;  1VM8 A;  1IT0 A;  4L41 C;  2JCL A;  4Y7F A;  2VXT I;  1WD3 A;  2VSE A;  1VGT A;  1V6U A;  4K6R A;  5C47 A;  1G97 A;  1HM8 A;  1AVX B;  1GWW A;  1J0S A;  3FJB A;  3OGG A;  2ZU9 A;  1CE7 B;  2KI6 B;  1ABR B;  1H5S D;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  4D48 A;  1JQZ A;  4JKX B;  2V0J A;  2VXM A;  4O6N A;  1S4O A;  4M2A A;  4L4H A;  4HO0 A;  1Q03 A;  4LO2 C;  3NBN A;  3LW6 A;  2IHO A;  5FNW A;  4G9M A;  1LL3 A;  5BP5 C;  1S4N A;  3BTA A;  4ZOT A;  5AJP A;  5L6S A;  1BAR A;  4GBP A;  1HM0 A;  5BP5 A;  2OI6 A;  4KXO A;  3OH3 A;  3FJH A;  2VUA A;  5C3A A;  4ZDQ A;  4OEE A;  2KH2 A;  4EFQ A;  1GQC A;  1VH3 A;  2XWN A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  3N9W A;  1WT3 A;  4END A;  3CA4 A;  5BVP I;  2QKX A;  4KC4 A;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  1LL0 A;  4HR6 C;  1JT3 A;  2FYA A;  3OGZ A;  4M4K A;  2VXR A;  2VS4 A;  4Y7T A;  3SXD A;  4MZF B;  1Z0H A;  2NTD A;  2K4A B;  2WGZ A;  3JTJ A;  3E25 A;  2ICX A;  4HO2 A;  1W3F A;  2GGQ A;  1VH1 A;  1A8D A;  2BEA A;  5C4E A;  3VWC A;  3QYD A;  1R7Y A;  1WSZ A;  3NBD A;  1MP3 A;  2AE7 A;  3CRG A;  4NAL A;  2Y9F A;  4I4S A;  2WE9 A;  3ST8 A;  2BFH A;  1MD6 A;  4D0T A;  1VGW A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  4MZG B;  1H3M A;  3CRI A;  1H5T B;  2WEE A;  2YC5 A;  3DK5 A;  3QVB A;  4G3S A;  1W3A A;  4P0K A;  4Y63 A;  1FR9 A;  5C1G A;  4EFP A;  1FGX A;  3WO3 A;  2X2S A;  2ZU7 A;  1Z4S A;  1O7O A;  2RIZ A;  2AM5 A;  2ZU8 A;  4QBC A;  4Y7U A;  4P0L A;  4A7K A;  2RIT A;  3SX3 A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3D5N A;  3NJ5 A;  1OMZ A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  2BO8 A;  1E0O A;  4UY4 A;  2AXM A;  4MYB A;  3PUB A;  2Z48 A;  3RMX A;  1G23 A;  1BFG A;  1FWV A;  3IM7 A;  3CU0 A;  1JV3 A;  2AGD A;  1KNM A;  3R3I A;  3I0D A;  5CQM X;  3SPT A;  4I3N A;  3ZLK A;  2RJ6 A;  4B2W A;  4JKQ A;  2QN4 A;  1GA8 A;  2Y4K A;  2MZB A;  1O7Q A;  4C2S A;  5BXS A;  1DZC A;  1HJJ A;  1PZY B;  3OKR A;  2JCJ A;  2PX7 A;  4J23 B;  4LO0 C;  3F1Y A;  2DS0 A;  1BFF A;  4NAN A;  3U0Y A;  4I1E A;  4KNR A;  5FZY A;  1NMM B;  3Q4S A;  3VT0 A;  1H7G A;  3SXC A;  4II0 A;  4KT7 A;  4AC3 A;  2NYY A;  4D11 C;  2DRE A;  4DCK C;  1PC8 B;  3BCV A;  4BMA A;  1ISX A;  1PZZ A;  1R7U A;  2QYI B;  2VSA A;  2Q3N B;  2VS5 A;  4CJM A;  4P00 A;  3ZXG A;  1CVS A;  2D44 A;  1G93 A;  3SXB A;  4AYJ A;  4EEG A;  1H7T A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1VGU A;  1XZ6 A;  1AF9 A;  3HOM A;  1OQM B;  4XKI A;  4B2X A;  1HWO B;  3BA4 A;  2HW9 A;  5HS2 A;  4HCQ A;  1YP2 A;  5FYE A;  2D1Z A;  3CA0 A;  4ISQ A;  1NQI B;  2RJ1 A;  2NXV A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  3OAM A;  4FRL A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1ZDF A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  4EEO A;  4FRP A;  1NZK A;  2VD4 A;  3AZV A;  4CJB A;  2PA4 A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2I5K A;  2BEB A;  4H75 A;  4D8H A;  3USR A;  2RJ0 A;  1AXM A;  1JLY A;  1ZJP A;  3POK A;  5FZZ A;  1FWU A;  1W57 A;  5CQL X;  3SXA A;  4GP0 A;  4H04 A;  5BXP A;  2VSH A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  2UX8 A;  4I4V A;  2HWM A;  3GUE A;  3POL A;  5CMF X;  1JV1 A;  1ZJ1 A;  4EEE B;  2Y7A A;  4X3A A;  1O23 B;  1DJS B;  3DJ4 A;  2ESU A;  5B2H A;  1H7L A;  3OH4 A;  3O3P A;  3O3Q A;  1TW1 A;  2AFG A;  2VXL A;  4Y9X A;  1QQK A;  4FQW A;  3WIN C;  2RJ5 A;  2Z87 A;  1EVT A;  3V0Q A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  2RIX A;  4KPX A;  3B9U A;  4LO7 C;  3WIN A;  1K4V A;  2O1H A;  2DRY A;  4USP A;  3PNN A;  5FUH A;  3BRG C;  5JMC A;  2X60 A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1PZT A;  5FU0 A;  1NWG B;  1BFC A;  3CU1 B;  4KEK A;  1VGZ A;  5GAQ A;  3TQD A;  2ICY A;  2F2F C;  1ZCT A;  1GWV A;  3EE5 A;  4JD0 A;  1FOA A;  1QXM A;  5G00 A;  3BRF A;  1OMX A;  1YP3 A;  4ASJ A;  4XFS A;  5C3B A;  2OI7 A;  4GAF A;  4IY9 A;  4HO9 A;  2F2F A;  2YCM A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  2BO4 A;  1FXO A;  2P72 A;  3BB2 A;  5EIY A;  5IDT A;  4KNX A;  4FIY A;  5FV9 A;  2V0I A;  1G1L A;  2E3D A;  4G6J A;  3WO2 A;  1H5R A;  2XOA A;  1YTO A;  2IWT B;  1QG8 A;  2E8B A;  1H7Q A;  4M2B A;  4GP3 A;  2YQS A;  4UEG A;  5C4F A;  2VSI A;  3AKF A;  2VLC A;  4QBV A;  1G3L A;  3PHZ A;  1FO8 A;  1R8N A;  4G87 A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  1MP5 A;  4Z9W B;  1INI A;  2WVM A;  3OJV A;  5IFY A;  3SNV A;  3O44 A;  1TZF A;  3T7N A;  1MP4 A;  2PGV A;  1BLA A;  3FJE A;  4YS8 A;  3A22 A;  4FRQ A;  3I29 B;  4J18 A;  1ZJ3 A;  5FU8 A;  3FJK A;  4DDZ A;  3OBR A;  2LIE A;  3N7J A;  1JVD A;  1ZI4 A;  1QGQ A;  4ASY A;  3FGM A;  1LZI A;  4B4B A;  1FO9 A;  1II4 A;  1HWM B;  4KRV A;  2D22 A;  2P23 A;  3OJM A;  2I7B A;  1INJ A;  1NHE B;  2D23 A;  3C9Z A;  1V84 A;  2X5Z A;  4FRE A;  4ZFW B;  5FTV A;  2ZQN A;  2HZ9 A;  5CMI A;  2V0K A;  3V90 A;  5HPZ A;  4D0Z A;  3BX1 C;  2VK9 A;  4G6M A;  2Y4J A;  2YC3 A;  2AEC A;  3I0I X;  1YP4 A;  4ECM A;  4FRA A;  3D98 A;  1V83 A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  4IRQ A;  3I2X A;  3CKJ A; 
#chains in the Genus database with same CATH homology
 3Q80 A;  4EEA A;  3UDA A;  4QC4 A;  3N7K A;  3O4C A;  3VEQ A;  5D61 A;  5C1L A;  1LL2 A;  4LO1 C;  5CQO A;  3FJD A;  1VZX A;  3FWW A;  3SX7 A;  3ZGG A;  1NF5 B;  1G9B A;  3BRD A;  1IOB A;  1JTC A;  2OEG A;  2Q4J A;  3AKH A;  4LO1 A;  3CQA A;  4ISR A;  5EC5 A;  1GQ9 A;  5F90 A;  3WA1 A;  1DFQ A;  2RG9 B;  4KPZ A;  4Y64 A;  4LO7 B;  1I52 A;  4OWJ A;  1VIC A;  5CMH A;  5BQU C;  1JT5 A;  3ZF8 A;  1F31 A;  3RSJ A;  1G9D A;  2GGO A;  3V0P A;  3O4A A;  5C4B A;  2Y9G A;  4A7Z A;  4HA2 A;  3HSM A;  5BQU A;  41BI A;  4KC2 A;  2QGI A;  1WBC A;  2KI4 A;  3O4D A;  3UJ0 A;  2O1F A;  3V0B A;  5FTS A;  1JT7 A;  3ILA A;  4FVV A;  3I0F A;  2M49 A;  3CKV A;  1JLX A;  2WRY A;  3IOJ A;  4Q9G A;  4HOC A;  4I6I A;  4H9W A;  5BOW A;  3I0J A;  1NUN A;  1QWJ A;  1R81 A;  2D43 A;  4G3P A;  1DFC A;  3V8Z A;  1SR4 A;  4HJJ A;  4WBC A;  3FJ8 A;  1Q1U A;  3OC9 A;  4Y6N A;  3O4O A;  1FZW A;  3MAL A;  2FDB M;  1XYF A;  3BAO A;  3I0E A;  2L5X A;  3DUV A;  1H5S C;  4I4P A;  4QKS A;  4B5B A;  4EE3 A;  2WVL A;  1H5S A;  1FG5 N;  3RMV A;  1QQL A;  4FRH A;  3QR5 A;  4XWI A;  4EFR A;  4I37 A;  5BXR A;  2NM1 A;  1XZZ A;  3WO4 A;  4X38 A;  1R80 A;  4KC3 A;  2J0A A;  1HWP B;  4FCE A;  1YRO B;  1RML A;  2E4M A;  3AZW A;  1JVG A;  5FZU A;  4OW4 A;  2OEF A;  5L6V A;  1S0D A;  2NVH A;  1YXW A;  3P53 A;  1VPA A;  3V0N A;  1TW5 A;  2I5E A;  1HCD A;  4JAW A;  1YYN A;  3PME A;  3PKP A;  3CA3 A;  3OH0 A;  3U2V A;  3VSF A;  1HV9 A;  1SZ6 B;  1XHB A;  2X65 A;  5FNX A;  3IM5 A;  3I0C A;  4IZX A;  2Y4L A;  4FRD A;  1SS9 A;  4KQL A;  4Y62 A;  1RY7 A;  1NKH B;  1WT0 A;  3N7M A;  4Y6U A;  3V0L A;  4DE7 A;  5JQQ A;  3F1R A;  4DEN A;  3HAL A;  1QGS A;  2WAW A;  3CKN A;  3N0K A;  4CJ8 A;  5D92 A;  4I4R A;  3FUO A;  3KMV A;  2CU2 A;  1G95 A;  3E8L C;  3D8V A;  3V8Y A;  3I0K A;  3TC2 A;  2X5S A;  4PC4 A;  3I2A A;  1H7E A;  1FGG A;  1LZJ A;  3AJ6 A;  2RJ7 A;  3KIA A;  1OQL B;  4KEJ A;  1WT2 A;  2WVK A;  4I7I A;  1D0H A;  4JPZ A;  4I4Q A;  2AM3 A;  3K1X A;  2V0H A;  3K8E A;  4FIX A;  1P63 A;  4G1R A;  2KLL A;  4HG6 A;  1VCL A;  3Q7W A;  1IHK A;  4GOY A;  1ZCU A;  2Z86 A;  3T7M A;  3USQ A;  4LW6 A;  1DIW A;  1TWM A;  4G9N A;  4EB2 B;  1RG8 A;  1EZI A;  1O0R A;  3U2U A;  2Y9X E;  1IRA X;  2VS3 A;  1ZIZ A;  3Q7Y A;  1GX4 A;  4DEC A;  4IYB A;  1JY0 A;  4J2X A;  1H5T A;  3NBC A;  2XMH A;  4P02 A;  5IDS A;  2F8X C;  3K8D A;  1V6X A;  1UPS A;  7I1B A;  2APC A;  4X39 A;  3CGX A;  3ZGF A;  2KKI A;  1EYL A;  3V0A A;  3SXE A;  5DSS B;  4I4Y A;  1G0R A;  3UJ4 A;  3JUK A;  5AJO A;  3AH4 A;  1RZO B;  3BAU A;  3LLP A;  4F34 A;  4HO3 A;  3U2W A;  4AN7 B;  4EEM A;  2FFU A;  2W0W A;  3UD8 A;  1HM9 A;  1Q04 A;  4P0J A;  5EHA A;  3T8S A;  2D7I A;  3AKI A;  1ONK B;  6I1B A;  1R8O A;  5BXT A;  2FY7 A;  5I1B A;  1FV2 A;  4B3U A;  2RJ4 A;  5C3D A;  1G9C A;  4LO3 C;  1I1E A;  5C36 A;  4IHZ A;  3UD9 A;  3RTJ B;  2HWA A;  2P39 A;  1S0B A;  4A7Y A;  5I1F A;  4LO3 A;  3VUO A;  3SX5 A;  4AYL A;  3Q7X A;  5E24 E;  1H5S B;  4CVH A;  3VSZ A;  3PKQ A;  1ZHJ A;  3MPP G;  4OWL A;  1L2H A;  4O6M A;  1FN0 A;  4OEF A;  1HKN A;  1VZT A;  4NAI A;  1ZCV A;  2JCK A;  2A8W A;  2A8U A;  3JUT A;  1BFB A;  1S4P A;  2P73 A;  2XME A;  2RIY A;  2YQJ A;  5C1H A;  3RMW A;  5C48 A;  2XWM A;  1M16 A;  2NP0 A;  3BRK X;  1R7X A;  4HO5 A;  3CKQ A;  4B4G A;  1DZD A;  1PUM B;  4TLP A;  4EKX B;  2D0J A;  1ZJ0 A;  2PGY A;  4Q7C A;  4USO A;  1MC9 A;  1T4Q A;  5CMJ A;  2BO7 A;  3O4B A;  2YES A;  4LO2 A;  3O5W B;  1TVY A;  2AM4 A;  3LTQ A;  1LVW A;  4FCU A;  2R9K B;  3RSB A;  2BO6 A;  3H6S E;  1TOO A;  3RMY A;  1PWA A;  1FQ9 A;  4F83 A;  3CKO A;  4J2K A;  1LZ0 A;  3OH1 A;  1JYK A;  2ET2 A;  1YF8 B;  4R7P A;  5F8Y A;  2FGF A;  1R82 A;  4IQP A;  4BQH A;  2FO1 A;  1G82 A;  3CA1 A;  1BAS A;  2XWL A;  4FRB A;  4FRM A;  4MND A;  3CA5 A;  3AKG A;  1WVC A;  3OBT A;  2MIB A;  1W3G A;  5CQN X;  4E1K A;  1I1B A;  1H4D A;  2Y4M A;  4EVW A;  4GAI A;  1T9F A;  5DZU A;  4B4M A;  3OH2 A;  5DVH A;  1S0L A;  2D20 A;  1W77 A;  2OI5 A;  2K43 A;  3FJA A;  4I4O A;  4I4X A;  3W9T A;  2GO2 A;  3AJ5 A;  3IIR A;  4HO6 A;  3I0L A;  1XG6 A;  4Z8S B;  3OJ2 A;  1IRP A;  1ZCY A;  1EV2 A;  3IOH A;  5C4D A;  1ZJ2 A;  4IY8 A;  3F62 B;  3U2X A;  4AN6 A;  5CQP A;  4ZFU B;  3F1C A;  3FOQ A;  1JYL A;  1ZJO A;  3FJJ A;  3HBW A;  3IOI A;  3Q7U A;  1W55 A;  1TFM B;  4L4I A;  3V0A B;  1SR4 C;  2P6W A;  1BA7 A;  3T7O A;  4AAW A;  1H5R B;  3JUJ A;  1Z90 A;  5C38 A;  4OWK A;  2FFV A;  2LIQ A;  3A21 A;  3CA6 A;  1R7T A;  3SX8 A;  1DQG A;  4CJC A;  3BA7 A;  1FMZ A;  4FGF A;  4Y7G A;  4DEP A;  2RST A;  5F8S A;  3E26 A;  3I0H A;  1WT1 A;  4J2S A;  3ZX7 A;  2RJ9 A;  4IRP A;  1ISZ A;  21BI A;  4XFT A;  1EYR A;  1G9R A;  1M2T B;  5DDT A;  2AAI B;  4ZKT B;  4EE4 A;  2Y9W C;  1ITB A;  1TTU A;  4LW3 A;  1FXJ A;  2RJ8 A;  2E4M C;  3ZXD A;  2JCO A;  1IIM A;  5DDV A;  1ISV A;  4LO0 A;  3V79 C;  1MC3 A;  3HL3 A;  4NAK A;  4HO8 A;  1H7H A;  3V0O A;  3HN1 A;  3PG0 A;  4ZFY B;  1IIL A;  1V82 A;  4D11 A;  4ZGR B;  1K5V A;  2I1B A;  4QKR A;  5EG6 C;  1ZI3 A;  3VT2 A;  1LZ7 A;  4JQ0 A;  2AH9 A;  2O1G A;  2VU9 A;  3V91 A;  5CMG X;  4JIS A;  9ILB A;  3TZT A;  1ILR 1;  2K8R A;  4JRA A;  1KWS A;  2QH5 A;  2VFZ A;  3ZLL A;  31BI A;  3I0G A;  4QD2 C;  1HWN B;  3H6R A;  1ZI1 A;  4OUJ A;  3P6J A;  1FRW A;  1ISW A;  4I4U A;  3OGF A;  2J0B A;  3BAG A;  2UUS A;  1H7F A;  1ON6 A;  4P6A A;  2GZB A;  1HIB A;  1ZI5 A;  2C0N A;  5C49 A;  3VT1 A;  3U0X A;  2DPW A;  2J3P A;  4Q91 A;  2FYC B;  3CRH A;  3SXG A;  3O49 A;  2V0L A;  2Q9X A;  4I2S A;  3BAD A;  3WMV A;  4ION A;  2W0V A;  4FRO A;  4EE5 A;  1TP0 A;  3FJC A;  2D24 A;  1H4E A;  5EJ1 A;  2FYB A;  1S0C A;  4ARW A;  5AJN A;  3EF2 A;  4HO4 A;  1G2V A;  2FYD B;  5D91 A;  3S8K A;  1FV3 A;  1AFC A;  4B42 A;  5J49 A;  1HJL A;  2YQC A;  4I8M A;  4LO8 B;  5C4C A;  1V6V A;  3NGW A;  1VZU A;  5EJZ A;  2ZQO A;  3V0B B;  4MIX A;  1FR8 A;  2RQ9 A;  1FMM S;  1H4C A;  3AH1 A;  1FWY A;  2AES A;  5C8R A;  1ZDG A;  2YQH A;  5BXC A;  1G8O A;  3R4S A;  1E5K A;  4M28 A;  4X37 A;  1S0G A;  1WD4 A;  5DUY A;  1R7V A;  5JLV A;  4MZH A;  1YBI A;  1S0F A;  2NS2 A;  3U2T A;  4KC1 A;  1IIN A;  1ON8 A;  2Z49 A;  2Y6P A;  4G3Q A;  1GX0 A;  4ZA3 B;  1V6W A;  2D7R A;  1BLD A;  4Y7V A;  3V0M A;  3S8J A;  4QO3 A;  4QAL A;  3R2W A;  1VM8 A;  1IT0 A;  4L41 C;  2JCL A;  4Y7F A;  2VXT I;  1WD3 A;  2VSE A;  1VGT A;  1V6U A;  4K6R A;  5C47 A;  1G97 A;  1HM8 A;  1AVX B;  1GWW A;  1J0S A;  3FJB A;  3OGG A;  2ZU9 A;  1CE7 B;  2KI6 B;  1ABR B;  1H5S D;  3H6Q A;  3N7L A;  1ISY A;  4I96 A;  4D48 A;  1JQZ A;  4JKX B;  2V0J A;  2VXM A;  4O6N A;  1S4O A;  4M2A A;  4L4H A;  4HO0 A;  1Q03 A;  4LO2 C;  3NBN A;  3LW6 A;  2IHO A;  5FNW A;  4G9M A;  1LL3 A;  5BP5 C;  1S4N A;  3BTA A;  4ZOT A;  5AJP A;  5L6S A;  1BAR A;  4GBP A;  1HM0 A;  5BP5 A;  2OI6 A;  4KXO A;  3OH3 A;  3FJH A;  2VUA A;  5C3A A;  4ZDQ A;  4OEE A;  2KH2 A;  4EFQ A;  1GQC A;  1VH3 A;  2XWN A;  4Q9P A;  3IM6 A;  4QD2 B;  2ERM A;  3N9W A;  1WT3 A;  4END A;  3CA4 A;  5BVP I;  2QKX A;  4KC4 A;  1IJT A;  3CAH A;  1WBA A;  3P6I A;  4I1B A;  1LL0 A;  4HR6 C;  1JT3 A;  2FYA A;  3OGZ A;  4M4K A;  2VXR A;  2VS4 A;  4Y7T A;  3SXD A;  4MZF B;  1Z0H A;  2NTD A;  2K4A B;  2WGZ A;  3JTJ A;  3E25 A;  2ICX A;  4HO2 A;  1W3F A;  2GGQ A;  1VH1 A;  1A8D A;  2BEA A;  5C4E A;  3VWC A;  3QYD A;  1R7Y A;  1WSZ A;  3NBD A;  1MP3 A;  2AE7 A;  3CRG A;  4NAL A;  2Y9F A;  4I4S A;  2WE9 A;  3ST8 A;  2BFH A;  1MD6 A;  4D0T A;  1VGW A;  1TWE A;  4JP0 A;  1S0E A;  2MLL B;  1HCE A;  4MZG B;  1H3M A;  3CRI A;  1H5T B;  2WEE A;  2YC5 A;  3DK5 A;  3QVB A;  4G3S A;  1W3A A;  4P0K A;  4Y63 A;  1FR9 A;  5C1G A;  4EFP A;  1FGX A;  3WO3 A;  2X2S A;  2ZU7 A;  1Z4S A;  1O7O A;  2RIZ A;  2AM5 A;  2ZU8 A;  4QBC A;  4Y7U A;  4P0L A;  4A7K A;  2RIT A;  3SX3 A;  1AVW B;  1JT4 A;  3UD7 A;  2DRZ A;  3D5N A;  3NJ5 A;  1OMZ A;  4ZBV B;  2ZR1 B;  2X2T A;  5D63 A;  2BO8 A;  1E0O A;  4UY4 A;  2AXM A;  4MYB A;  3PUB A;  2Z48 A;  3RMX A;  1G23 A;  1BFG A;  1FWV A;  3IM7 A;  3CU0 A;  1JV3 A;  2AGD A;  1KNM A;  3R3I A;  3I0D A;  5CQM X;  3SPT A;  4I3N A;  3ZLK A;  2RJ6 A;  4B2W A;  4JKQ A;  2QN4 A;  1GA8 A;  2Y4K A;  2MZB A;  1O7Q A;  4C2S A;  5BXS A;  1DZC A;  1HJJ A;  1PZY B;  3OKR A;  2JCJ A;  2PX7 A;  4J23 B;  4LO0 C;  3F1Y A;  2DS0 A;  1BFF A;  4NAN A;  3U0Y A;  4I1E A;  4KNR A;  5FZY A;  1NMM B;  3Q4S A;  3VT0 A;  1H7G A;  3SXC A;  4II0 A;  4KT7 A;  4AC3 A;  2NYY A;  4D11 C;  2DRE A;  4DCK C;  1PC8 B;  3BCV A;  4BMA A;  1ISX A;  1PZZ A;  1R7U A;  2QYI B;  2VSA A;  2Q3N B;  2VS5 A;  4CJM A;  4P00 A;  3ZXG A;  1CVS A;  2D44 A;  1G93 A;  3SXB A;  4AYJ A;  4EEG A;  1H7T A;  2NZ9 A;  3FJ9 A;  4ZLB B;  1VGU A;  1XZ6 A;  1AF9 A;  3HOM A;  1OQM B;  4XKI A;  4B2X A;  1HWO B;  3BA4 A;  2HW9 A;  5HS2 A;  4HCQ A;  1YP2 A;  5FYE A;  2D1Z A;  3CA0 A;  4ISQ A;  1NQI B;  2RJ1 A;  2NXV A;  1K5U A;  1N4K A;  3BAQ A;  4I0Y A;  1AVU A;  3OAM A;  4FRL A;  1AVA C;  1G9A A;  1GGP B;  3FUQ A;  1ZDF A;  1PUU B;  3A23 A;  2YUG A;  5F8W A;  1TIE A;  4EEO A;  4FRP A;  1NZK A;  2VD4 A;  3AZV A;  4CJB A;  2PA4 A;  3RTI B;  3D7W B;  1DQO A;  8I1B A;  2I5K A;  2BEB A;  4H75 A;  4D8H A;  3USR A;  2RJ0 A;  1AXM A;  1JLY A;  1ZJP A;  3POK A;  5FZZ A;  1FWU A;  1W57 A;  5CQL X;  3SXA A;  4GP0 A;  4H04 A;  5BXP A;  2VSH A;  3AH2 A;  3FJF A;  3NBE A;  3WMU A;  2UX8 A;  4I4V A;  2HWM A;  3GUE A;  3POL A;  5CMF X;  1JV1 A;  1ZJ1 A;  4EEE B;  2Y7A A;  4X3A A;  1O23 B;  1DJS B;  3DJ4 A;  2ESU A;  5B2H A;  1H7L A;  3OH4 A;  3O3P A;  3O3Q A;  1TW1 A;  2AFG A;  2VXL A;  4Y9X A;  1QQK A;  4FQW A;  3WIN C;  2RJ5 A;  2Z87 A;  1EVT A;  3V0Q A;  4IZE A;  4KBB A;  3BA5 A;  3IAG C;  3BAV A;  2RIX A;  4KPX A;  3B9U A;  4LO7 C;  3WIN A;  1K4V A;  2O1H A;  2DRY A;  4USP A;  3PNN A;  5FUH A;  3BRG C;  5JMC A;  2X60 A;  3ZC9 A;  1Z2V A;  5D62 A;  3FFZ A;  1EPW A;  1PZT A;  5FU0 A;  1NWG B;  1BFC A;  3CU1 B;  4KEK A;  1VGZ A;  5GAQ A;  3TQD A;  2ICY A;  2F2F C;  1ZCT A;  1GWV A;  3EE5 A;  4JD0 A;  1FOA A;  1QXM A;  5G00 A;  3BRF A;  1OMX A;  1YP3 A;  4ASJ A;  4XFS A;  5C3B A;  2OI7 A;  4GAF A;  4IY9 A;  4HO9 A;  2F2F A;  2YCM A;  4R6U B;  2AQZ A;  3JRR A;  3FJI A;  2BO4 A;  1FXO A;  2P72 A;  3BB2 A;  5EIY A;  5IDT A;  4KNX A;  4FIY A;  5FV9 A;  2V0I A;  1G1L A;  2E3D A;  4G6J A;  3WO2 A;  1H5R A;  2XOA A;  1YTO A;  2IWT B;  1QG8 A;  2E8B A;  1H7Q A;  4M2B A;  4GP3 A;  2YQS A;  4UEG A;  5C4F A;  2VSI A;  3AKF A;  2VLC A;  4QBV A;  1G3L A;  3PHZ A;  1FO8 A;  1R8N A;  4G87 A;  1DLL A;  2WBC A;  4KEI A;  4YOL A;  3ZC8 A;  3H6R B;  3R4U A;  4OEG A;  1MP5 A;  4Z9W B;  1INI A;  2WVM A;  3OJV A;  5IFY A;  3SNV A;  3O44 A;  1TZF A;  3T7N A;  1MP4 A;  2PGV A;  1BLA A;  3FJE A;  4YS8 A;  3A22 A;  4FRQ A;  3I29 B;  4J18 A;  1ZJ3 A;  5FU8 A;  3FJK A;  4DDZ A;  3OBR A;  2LIE A;  3N7J A;  1JVD A;  1ZI4 A;  1QGQ A;  4ASY A;  3FGM A;  1LZI A;  4B4B A;  1FO9 A;  1II4 A;  1HWM B;  4KRV A;  2D22 A;  2P23 A;  3OJM A;  2I7B A;  1INJ A;  1NHE B;  2D23 A;  3C9Z A;  1V84 A;  2X5Z A;  4FRE A;  4ZFW B;  5FTV A;  2ZQN A;  2HZ9 A;  5CMI A;  2V0K A;  3V90 A;  5HPZ A;  4D0Z A;  3BX1 C;  2VK9 A;  4G6M A;  2Y4J A;  2YC3 A;  2AEC A;  3I0I X;  1YP4 A;  4ECM A;  4FRA A;  3D98 A;  1V83 A;  3BAH A;  4J2Y A;  3A07 A;  4GOV A;  4XFU A;  1FGA A;  2MC2 A;  3HMY A;  4IRQ A;  3I2X A;  3CKJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...