2D7IA

Crystal structure of pp-galnac-t10 with udp, galnac and mn2+
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
536
structure length
536
Chain Sequence
GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 157
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7iA01
1WT0A 3Q4SA 5CQOA 1NZKA 3F1YA 4EVWA 3BRKX 1VICA 1ISZA 1J0SA 1R7VA 3CKVA 2VS4A 1NQIB 3CA6A 5EHAA 2AESA 5C4CA 3S8JA 2BEAA 4KC3A 3AKGA 3VT0A 1FGXA 1YP4A 2AH9A 2UX8A 3PNNA 3ZLKA 4I96A 3T7OA 4D8HA 1INIA 1QQLA 2RSTA 2PX7A 2KH2A 1XZ6A 1ZI3A 5C1LA 1G95A 4M4KA 4H9WA 4M28A 2VUAA 5DDTA 4E1KA 3CKOA 2Z87A 1BFBA 2ZQOA 2VLCA 3TQDA 3OH3A 2XMHA 2KI4A 1PZYB 4G3QA 1HV9A 1DIWA 4I4XA 4IY8A 1RG8A 3VWCA 1FZWA 2FO1A 1KWSA 1QQKA 1MC9A 1VCLA 4ISRA 1EZIA 1HM9A 1ABRB 1SZ6B 3FFZA 1JQZA 4CVHA 3UD9A 3GUEA 3JRRA 3AZVA 1UPSA 3HOMA 1G9CA 4KC2A 4R7PA 4B42A 3RSJA 4JRAA 1H5SD 4KC1A 3S8KA 3D8VA 4Z8SB 4DEPA 2V0IA 3CAHA 3O4BA 1YP3A 1VGWA 8I1BA 1H4CA 2Y9XE 2CU2A 2XMEA 4FRBA 4FRDA 2Y9FA 1ZJ0A 1FN0A 1V6VA 5F90A 3U2XA 1G2VA 3HMYA 5FZUA 1DFCA 3WO4A 6I1BA 4M2BA 3V0PA 1S4PA 3UDAA 1KNMA 1NUNA 2HWMA 4P0KA 1AFCA 3V0AA 1R80A 4ZFYB 2NM1A 1ZI1A 2QKXA 3BAGA 2PGYA 3OH1A 3HL3A 4D11A 3C9ZA 3UD8A 1NWGB 1MP3A 5AJPA 1ON6A 2ET2A 4FCEA 5C4BA 3V0QA 2YC3A 1SR4A 3BA7A 4B3UA 1NKHB 3Q7UA 3SX7A 5FYEA 2UUSA 2Y9GA 3OBTA 3I0CA 4I2SA 1OMZA 1V82A 2V0JA 1HCDA 4IY9A 1DQOA 3BAHA 5BQUC 3BRGC 1G9AA 3UD7A 1HM0A 1W3AA 2W0WA 4OEFA 4GOYA 2O1HA 2XWMA 3E26A 1DFQA 2MLLB 3WMVA 3CU0A 4Q91A 2V0KA 5EG6C 1ZDGA 2WAWA 3EF2A 7I1BA 4LO1C 2AM3A 2VU9A 1AVWB 1HWPB 1QGSA 4CJMA 2FYAA 4DDZA 3ZX7A 1VPAA 3OGZA 4L4IA 4D48A 2RQ9A 1BARA 3A22A 1TWMA 2DPWA 3U2UA 2GGOA 1W3FA 4USPA 4A7YA 1I52A 2E8BA 4KC4A 1RY7A 5GAQA 4Y9XA 4KBBA 2YQCA 1WD3A 3NJ5A 3I0HA 2HZ9A 3BAUA 1G23A 3IM6A 3POKA 2D7RA 4ZFWB 2W0VA 5FU8A 2D0JA 4HJJA 4CJCA 4J2KA 4XKIA 2Z49A 3V8ZA 3U2VA 3AKIA 4KXOA 4DENA 1SS9A 1V83A 1H3MA 3N9WA 3O5WB 2NP0A 5FNXA 4J2XA 1H5SA 1H4DA 4G3SA 1FWVA 5CMFX 4LO0C 4ZOTA 2ERMA 3QVBA 3CA0A 3HN1A 1CVSA 1DZCA 2VSIA 4HCQA 3H6RA 1GWWA 3A21A 3OKRA 3O4AA 5AJNA 1K5UA 4BQHA 1JT5A 1FXOA 1ZJ2A 3P6IA 5B2HA 3H6QA 4ISQA 3AKFA 2RIXA 3OH2A 2YQJA 5BP5A 1JYLA 2A8WA 4HO5A 5CMGX 4Y63A 1FG5N 5F8YA 4YOLA 4JP0A 2MIBA 4KPZA 1IRPA 3IAGC 1ON8A 2X5SA 3OGGA 5C8RA 2BO6A 1ZCTA 1TTUA 3PHZA 3JUKA 4JAWA 4EFRA 1TP0A 1VH3A 4B2XA 2AGDA 3AKHA 4IHZA 3CGXA 3JTJA 5IFYA 3BADA 3WO2A 3I0IX 4BMAA 2D24A 2R9KB 1VZXA 4IYBA 3I0FA 2FFVA 31BIA 2YQSA 4ZBVB 1G8OA 1H7LA 1HJJA 1R7YA 1GQ9A 4LO8B 3A07A 3T7NA 1M16A 5D63A 3VUOA 3ZLLA 1YYNA 4AC3A 3SX8A 1WBAA 2D1ZA 2E4MA 2AM5A 4FRAA 3RTJB 4XFSA 3FJBA 3OGFA 3FJFA 3V0BA 41BIA 1BFGA 4ASJA 1ZJPA 2Y4JA 4XWIA 3RMWA 5C3DA 2I7BA 3OJMA 5BXCA 1JY0A 4AYLA 4EEAA 3N7MA 1YP2A 2FYDB 5CQMX 5EJ1A 1DZDA 4I4UA 1VM8A 2OEGA 3V0MA 1QWJA 3O4CA 5BOWA 3NGWA 1R7XA 4P02A 1Z0HA 1S0EA 4USOA 5HS2A 4HO8A 1O7QA 5C1GA 3FJKA 1WSZA 3K1XA 4FRPA 4IRPA 1FWYA 9ILBA 1Q04A 3HBWA 1I1BA 1S0LA 4Y7UA 4K6RA 2D20A 3H6SE 2WVLA 2J3PA 4CJ8A 3ZXDA 2RJ1A 3HALA 5C47A 1R7UA 1V6WA 2AFGA 2X5ZA 3ZC9A 3PKQA 3Q80A 2I1BA 2DRZA 1JTCA 1BLAA 3AH4A 4F34A 1JV1A 4QBVA 5DUYA 1G0RA 2APCA 3ZF8A 1IINA 1L2HA 3OBRA 4II0A 1LZJA 1S0GA 2WE9A 4HO3A 3BTAA 3I0JA 4FCUA 2Y4KA 4L4HA 3CA5A 2D43A 2BFHA 2RG9B 2AE7A 4EE5A 1V6UA 3N7JA 2K8RA 5C3BA 3N7KA 5FU0A 3B9UA 3CRHA 2Y4LA 1DJSB 3EE5A 3MPPG 2BEBA 1ONKB 4NAIA 2JCKA 1W3GA 1IRAX 2AXMA 2OI6A 2WVKA 5C1HA 2V0HA 4C2SA 4OEEA 4ECMA 3D7WB 2X60A 1YXWA 2AAIB 2GO2A 3NBDA 4QC4A 4ZA3B 1ZI5A 1HJLA 1IJTA 4KQLA 1YTOA 5EC5A 4EFPA 1FOAA 5FZYA 2BO7A 4GBPA 4KT7A 3RTIB 3F1CA 1BA7A 1XZZA 4MNDA 2DREA 1MD6A 1II4A 1SR4C 5CQNX 1AF9A 2IWTB 1WBCA 4LO2A 1IIMA 2X2SA 1TW1A 3BA5A 3SX5A 1QXMA 4I0YA 4QBCA 1QG8A 3DJ4A 3TC2A 1H7FA 3RMYA 4HO9A 5HPZA 1PC8B 2LIEA 4EEEB 2KI6B 4YS8A 4FVVA 3RSBA 5I1FA 4KEJA 1GX4A 2ZR1B 4LO3A 3N7LA 4P6AA 1ZDFA 2F8XC 5IDTA 3ZXGA 1W77A 4Y7FA 3SXBA 5C49A 5E24E 1ZIZA 3ZGGA 2F2FC 5IDSA 4AN6A 2YESA 3BAVA 3PMEA 1R81A 2Y7AA 2VD4A 1BFFA 2ICYA 2RJ5A 4GAFA 2KKIA 2NVHA 3SNVA 5BXPA 3WA1A 1P63A 4MYBA 3U2TA 1H5TB 2X2TA 3V90A 3UJ4A 3P53A 1ISXA 3CU1B 1S4OA 3AJ5A 4KPXA 2HW9A 4UEGA 2RJ0A 5I1BA 3I0KA 5C38A 3WINC 3O4OA 5FTSA 3SXAA 2RJ4A 3I0EA 3FUOA 2VSAA 3IM5A 4OW4A 3USRA 4JKQA 1S4NA 4AYJA 1ZCVA 5C4DA 4I1EA 2I5KA 2VFZA 4HOCA 3SX3A 2YUGA 1JVDA 3PG0A 3AZWA 1HKNA 3NBCA 4G6MA 3FGMA 1H7HA 1H5SC 1TOOA 3V0OA 5L6SA 4PC4A 5BQUA 2PGVA 4CJBA 3LLPA 5DVHA 2MZBA 2L5XA 1NHEB 3PKPA 3U2WA 3USQA 5FNWA 4ZLBB 4B2WA 5BXSA 3BCVA 3FJDA 4J2SA 5JMCA 3JUJA 1DQGA 3R3IA 3U0XA 1TFMB 1S0FA 5BP5C 1H4EA 2YQHA 4EEGA 4Q9GA 4LO1A 3BAOA 1PUMB 4G6JA 1VH1A 4KEIA 1N4KA 1JT7A 4FGFA 1JLYA 1LL3A 1W55A 3UJ0A 4FROA 1S0CA 1CE7B 1JT4A 1NMMB 1JYKA 1FQ9A 3FJCA 1K5VA 1GGPB 1TWEA 4P0LA 3D5NA 1XG6A 5J49A 4FRLA 3E25A 1ILR1 3FJHA 4Y6UA 1YBIA 1G97A 21BIA 1V84A 3CA3A 1H5RB 2YCMA 2D44A 2Y6PA 1MC3A 3I0DA 3VSZA 1AVAC 4TLPA 4GP3A 2VXTI 5FV9A 2E4MC 3F62B 4R6UB 4Y62A 1PZZA 2VXRA 5F8SA 2QGIA 3R2WA 1V6XA 2VSHA 1F31A 4I3NA 4JPZA 4QALA 2GZBA 1NF5B 3V0AB 4HO4A 2QYIB 4HO2A 1D0HA 3CQAA 2MC2A 2YC5A 2M49A 4D0TA 3POLA 4J23B 1ZI4A 3FJJA 3OH4A 2D23A 4QO3A 1WT1A 3ILAA 1VGUA 2FYBA 2Q4JA 1ISYA 1O23B 2AM4A 3V91A 2P23A 3O49A 1FWUA 4I7IA 4A7KA 3R4SA 4KEKA 1FR8A 2WVMA 1FV3A 1TZFA 4IZEA 1EVTA 2ZU7A 4KRVA 3ZGFA 2RJ7A 1GWVA 1E5KA 4M2AA 4F83A 4I4SA 1O0RA 1FGGA 1O7OA 4J18A 1G3LA 2OI7A 1AVXB 2D7IA 2ZU9A 3O4DA 3JUTA 4G9MA 5JQQA 1ITBA 2RIYA 3O3PA 1PZTA 2ZU8A 1G1LA 1K4VA 4I37A 2BO4A 3V8YA 4QKRA 3N0KA 2WEEA 1IT0A 4HG6A 2FGFA 1TVYA 2JCLA 3D98A 3T8SA 3WO3A 2BO8A 2FYCB 2D22A 2K4AB 1JT3A 3AH1A 4Q9PA 1QGQA 4FRQA 4HO6A 4EEMA 1GQCA 1HM8A 3CKQA 1VGTA 1WT2A 4QD2C 2V0LA 2E3DA 2DS0A 4FRMA 4B4MA 1HWMB 1ISVA 4LO7C 1MP5A 4OWJA 2I5EA 2NYYA 4I4VA 5G00A 3IOHA 4G3PA 3AH2A 1IOBA 3V0LA 4NALA 5EIYA 1TIEA 4JKXB 1H5SB 1Q03A 3OJ2A 3OJVA 3FJ8A 4I4RA 1RZOB 3I29B 3MALA 1IHKA 3NBEA 2O1FA 4IRQA 2IHOA 3H6RB 4Y7TA 4LO2C 2Y9WC 4D11C 1JVGA 3BX1C 5JLVA 3VT1A 1Z90A 5DSSB 1EPWA 3I0GA 1HIBA 4GP0A 1IILA 4EB2B 2OI5A 2P73A 1YF8B 1Z2VA 2FFUA 3QYDA 4DE7A 1LL0A 3CA4A 3E8LC 4I4PA 4FRHA 3SPTA 3SXCA 1BASA 3FJEA 4LO3C 4HR6C 1LZIA 3O44A 5F8WA 5AJOA 3O3QA 2O1GA 3V0NA 4WBCA 5CMJA 4QKSA 4ZFUB 2Q9XA 1WVCA 1OMXA 1H5RA 2GGQA 5FTVA 5BVPI 3NBNA 1R7TA 4ZDQA 4ZKTB 3Q7XA 2HWAA 1EYRA 2WRYA 2QH5A 3FUQA 1INJA 1BLDA 4ARWA 4A7ZA 4I4YA 5C3AA 1ZJOA 3R4UA 2VS3A 1LL2A 5DZUA 1PUUB 4KNXA 4I8MA 4OUJA 2WBCA 3HSMA 1S0BA 4I6IA 2OEFA 1ZJ3A 3SXDA 1A8DA 3V0BB 3TZTA 1JV3A 4DCKC 4EE3A 3PUBA 4GOVA 1VZTA 3I2AA 4LW3A 4NANA 2X65A 3FJIA 1TW5A 3DK5A 1FMMS 1HWNB 4AAWA 3AJ6A 4X38A 1OQMB 4B4GA 4GAIA 2K43A 3FJAA 2XWNA 3A23A 1ZHJA 4HO0A 4I1BA 1DLLA 4DECA 1W57A 1T9FA 3K8DA 4B5BA 1FXJA 2VXMA 3SXGA 3VT2A 1WT3A 4Y7VA 4I4OA 2AQZA 1FMZA 1G93A 1WD4A 3OAMA 2F2FA 4IZXA 1R8NA 4AN7B 2PA4A 2ESUA 2XOAA 1H7EA 2JCOA 2RITA 2FDBM 1LVWA 3I0LA 5DDVA 1G9RA 3ST8A 2RJ8A 2NZ9A 1BFCA 2VXLA 3U0YA 5C4EA 1ISWA 3CRIA 5L6VA 1PWAA 4OWKA 5CQLX 2LIQA 2JCJA 2P6WA 1FR9A 1RMLA 3Q7YA 3I2XA 5FZZA 3DUVA 2P39A 4X37A 3P6JA 3WINA 3F1RA 5BXTA 4B4BA 1EV2A 1ZJ1A 5FUHA 2DRYA 3LTQA 4JQ0A 2FY7A 5C4FA 4Y64A 4IQPA 2Z48A 1G9BA 5CMHA 1LZ0A 4QD2B 1GX0A 3SXEA 1OQLB 3BB2A 5D62A 4LO7B 4OWLA 4D0ZA 2QN4A 4XFUA 4I4QA 5BXRA 4Y7GA 2Q3NB 1GA8A 5C36A 3RMXA 3IM7A 1E0OA 4EFQA 2Y4MA 3KIAA 4EE4A 1HWOB 3RMVA 4L41C 1Q1UA 1FV2A 5C48A 4Y6NA 4J2YA 3FOQA 2ZQNA 4LO0A 1G82A 4Z9WB 1ZCYA 1Z4SA 3IOJA 4NAKA 1XHBA 1JLXA 2WGZA 2A8UA 1FGAA 1AVUA 1EYLA 1XYFA 3W9TA 5CMIA 3KMVA 2RJ9A 4G1RA 3VEQA 2P72A 3OH0A 3BRDA 3VSFA 1I1EA 4FREA 4KNRA 3FJ9A 1H7GA 3CA1A 2AECA 3IOIA 1VZUA 3ZC8A 4ZGRB 4IONA 1R8OA 3IIRA 1G9DA 1MP4A 4EKXB 1YROB 1VGZA 2NTDA 2RJ6A 4X39A 3FWWA 4X3AA 1H7TA 2XWLA 1FRWA 2VSEA 1ZCUA 2RIZA 4ASYA 1H7QA 3LW6A 3BRFA 4EEOA 3V79C 3QR5A 1M2TB 3K8EA 2VS5A 5CQPA 4P0JA 5EJZA 3WMUA 3OC9A 2NXVA 1FO9A 4LW6A 2KLLA 4G9NA 4OEGA 1S0DA 2Z86A 4G87A 4JD0A 1H5TA 3T7MA 2ICXA 5D61A 1T4QA 1R82A 4P00A 4FQWA 4HA2A 4ENDA 1LZ7A 3BA4A 3CRGA 1AXMA 3Q7WA 3BAQA 3CKJA 4JISA 4XFTA 3CKNA 4H04A 1HCEA 1FO8A
chains in the Genus database with same CATH superfamily
1WT0A 3Q4SA 5CQOA 1NZKA 3F1YA 4EVWA 3BRKX 1VICA 1ISZA 1J0SA 1R7VA 3CKVA 2VS4A 1NQIB 4MZFB 3CA6A 5EHAA 2AESA 5C4CA 3S8JA 2BEAA 4KC3A 3AKGA 3VT0A 1FGXA 1YP4A 2AH9A 2UX8A 3PNNA 3ZLKA 4I96A 3T7OA 4D8HA 1INIA 1QQLA 2RSTA 2PX7A 2KH2A 1XZ6A 1ZI3A 5C1LA 1G95A 4M4KA 4H9WA 4M28A 2VUAA 5DDTA 4E1KA 3CKOA 2Z87A 1BFBA 2ZQOA 2VLCA 3TQDA 3OH3A 2XMHA 2KI4A 1PZYB 4G3QA 1HV9A 1DIWA 4I4XA 4IY8A 1RG8A 3VWCA 1FZWA 2FO1A 1KWSA 1QQKA 1MC9A 1VCLA 4ISRA 1EZIA 1HM9A 1ABRB 1SZ6B 3FFZA 1JQZA 4CVHA 3UD9A 3GUEA 3JRRA 3AZVA 1UPSA 3HOMA 1G9CA 4KC2A 4R7PA 4B42A 3RSJA 4JRAA 1H5SD 4KC1A 3S8KA 3D8VA 4Z8SB 4DEPA 2V0IA 3CAHA 3O4BA 1YP3A 1VGWA 8I1BA 1H4CA 2Y9XE 2CU2A 2XMEA 4FRBA 4FRDA 2Y9FA 1ZJ0A 1FN0A 1V6VA 5F90A 2J0AA 1G2VA 3U2XA 3HMYA 5FZUA 1DFCA 3WO4A 6I1BA 4M2BA 3V0PA 1S4PA 3UDAA 1KNMA 1NUNA 2HWMA 4P0KA 1AFCA 3V0AA 1R80A 4ZFYB 2NM1A 1ZI1A 2QKXA 3BAGA 2PGYA 3OH1A 3HL3A 4D11A 3C9ZA 3UD8A 1NWGB 1MP3A 5AJPA 1ON6A 2ET2A 4FCEA 5C4BA 3V0QA 2YC3A 1SR4A 3BA7A 4B3UA 1NKHB 3Q7UA 3SX7A 5FYEA 2UUSA 2Y9GA 3OBTA 3I0CA 4I2SA 1OMZA 1V82A 2V0JA 1HCDA 4IY9A 1DQOA 3BAHA 5BQUC 3BRGC 1G9AA 3UD7A 1HM0A 1W3AA 2W0WA 4OEFA 4GOYA 2O1HA 2XWMA 3E26A 1DFQA 2MLLB 3WMVA 2C0NA 4Q91A 2V0KA 3CU0A 5EG6C 1ZDGA 2WAWA 3EF2A 7I1BA 4LO1C 2AM3A 2VU9A 1AVWB 1HWPB 1QGSA 4CJMA 2FYAA 4DDZA 3ZX7A 1VPAA 3OGZA 4L4IA 4D48A 2RQ9A 1BARA 3A22A 1TWMA 2DPWA 3U2UA 2GGOA 1W3FA 4USPA 4A7YA 1I52A 2E8BA 4KC4A 1RY7A 5GAQA 4Y9XA 4KBBA 2YQCA 1WD3A 3NJ5A 3I0HA 2HZ9A 3BAUA 1G23A 3IM6A 3POKA 2D7RA 4ZFWB 2W0VA 5FU8A 2D0JA 4HJJA 4CJCA 4J2KA 4XKIA 2Z49A 3V8ZA 3U2VA 3AKIA 4KXOA 4DENA 1SS9A 1V83A 1H3MA 4H75A 3O5WB 2NP0A 5FNXA 4J2XA 1H5SA 1H4DA 3N9WA 1FWVA 4G3SA 4LO0C 4ZOTA 2ERMA 3QVBA 5CMFX 3CA0A 3HN1A 1CVSA 1DZCA 2VSIA 4HCQA 3H6RA 1GWWA 3A21A 3OKRA 3O4AA 4FIXA 1K5UA 5AJNA 1JT5A 1FXOA 5D91A 4BQHA 1ZJ2A 3P6IA 5B2HA 3H6QA 4ISQA 3AKFA 2RIXA 3OH2A 2YQJA 5BP5A 1JYLA 2A8WA 4HO5A 5CMGX 4Y63A 1FG5N 5F8YA 4YOLA 4JP0A 2MIBA 4KPZA 1IRPA 3IAGC 1ON8A 2X5SA 3OGGA 5C8RA 2BO6A 1ZCTA 1TTUA 3PHZA 3JUKA 4JAWA 4EFRA 1TP0A 1VH3A 4B2XA 2AGDA 3AKHA 4IHZA 3CGXA 3JTJA 5IFYA 3BADA 3WO2A 3I0IX 4BMAA 2D24A 2R9KB 1VZXA 4IYBA 3I0FA 2FFVA 31BIA 2YQSA 4ZBVB 1G8OA 1H7LA 1HJJA 1R7YA 1GQ9A 4LO8B 3A07A 3T7NA 1M16A 5D63A 3VUOA 3ZLLA 1YYNA 4AC3A 3SX8A 1WBAA 2D1ZA 2E4MA 2AM5A 4FRAA 3RTJB 4XFSA 3FJBA 3OGFA 3FJFA 3V0BA 41BIA 1BFGA 4ASJA 1ZJPA 2Y4JA 4XWIA 3RMWA 5C3DA 2I7BA 3OJMA 5BXCA 1JY0A 4AYLA 4EEAA 3N7MA 1YP2A 2FYDB 5CQMX 5EJ1A 1DZDA 4I4UA 1VM8A 2OEGA 3V0MA 1QWJA 3O4CA 5BOWA 3NGWA 1R7XA 4P02A 1Z0HA 1S0EA 4USOA 5HS2A 4HO8A 4FIYA 1O7QA 5C1GA 3FJKA 1WSZA 3K1XA 4FRPA 4IRPA 1FWYA 9ILBA 1Q04A 3HBWA 1I1BA 1S0LA 4Y7UA 4K6RA 2D20A 3H6SE 2WVLA 2J3PA 4CJ8A 3ZXDA 2NS2A 2RJ1A 3HALA 4O6MA 5C47A 1R7UA 1V6WA 2AFGA 2X5ZA 3ZC9A 3PKQA 3Q80A 2I1BA 2DRZA 1JTCA 1BLAA 3AH4A 4F34A 1JV1A 4QBVA 5DUYA 1G0RA 2APCA 3ZF8A 1IINA 1L2HA 3OBRA 4II0A 1LZJA 1S0GA 2VK9A 2WE9A 3BTAA 3I0JA 4FCUA 4HO3A 2Y4KA 4L4HA 3CA5A 2D43A 2BFHA 2RG9B 2AE7A 4EE5A 1V6UA 3N7JA 2K8RA 5C3BA 3N7KA 5FU0A 3B9UA 3CRHA 2Y4LA 1DJSB 3EE5A 3MPPG 2BEBA 1ONKB 4NAIA 2JCKA 1W3GA 1IRAX 2AXMA 2OI6A 2WVKA 5C1HA 2V0HA 4C2SA 4OEEA 4ECMA 3D7WB 2X60A 1YXWA 2AAIB 2GO2A 3NBDA 4QC4A 4ZA3B 1ZI5A 1HJLA 1IJTA 4KQLA 1YTOA 5EC5A 4EFPA 1FOAA 5FZYA 2BO7A 4GBPA 4KT7A 3RTIB 3F1CA 1BA7A 1XZZA 4MNDA 2DREA 1MD6A 1II4A 1SR4C 5CQNX 1AF9A 2IWTB 1WBCA 4LO2A 1IIMA 2X2SA 1TW1A 3BA5A 3SX5A 1QXMA 4I0YA 4QBCA 1QG8A 3DJ4A 3TC2A 1H7FA 3RMYA 4HO9A 5HPZA 1PC8B 2LIEA 4EEEB 2KI6B 5D92A 4YS8A 4FVVA 3RSBA 5I1FA 4KEJA 1GX4A 2ZR1B 4LO3A 3N7LA 4P6AA 1ZDFA 2F8XC 5IDTA 3ZXGA 1W77A 4Y7FA 3SXBA 5C49A 5E24E 1ZIZA 3ZGGA 2F2FC 5IDSA 4AN6A 2YESA 3BAVA 3PMEA 1R81A 2Y7AA 2VD4A 1BFFA 2ICYA 2RJ5A 4GAFA 4O6NA 2KKIA 2NVHA 3SNVA 5BXPA 3WA1A 1P63A 4MYBA 3U2TA 1H5TB 2X2TA 3V90A 3UJ4A 3P53A 1ISXA 3CU1B 1S4OA 3AJ5A 4KPXA 2HW9A 4UEGA 2RJ0A 5I1BA 3I0KA 5C38A 3WINC 3O4OA 5FTSA 3SXAA 2RJ4A 3I0EA 3FUOA 2VSAA 3IM5A 4OW4A 3USRA 4JKQA 1S4NA 4AYJA 1ZCVA 5C4DA 4I1EA 2I5KA 2VFZA 4HOCA 3SX3A 2YUGA 1JVDA 3PG0A 3AZWA 1HKNA 3NBCA 4G6MA 3FGMA 1H7HA 1H5SC 1TOOA 3V0OA 5L6SA 4PC4A 5BQUA 2PGVA 4CJBA 3LLPA 5DVHA 2MZBA 2L5XA 1NHEB 3PKPA 3U2WA 3USQA 5FNWA 4ZLBB 4B2WA 5BXSA 3BCVA 3FJDA 4J2SA 5JMCA 3JUJA 1DQGA 3R3IA 3U0XA 1TFMB 1S0FA 5BP5C 1H4EA 2YQHA 4EEGA 4Q9GA 4LO1A 3BAOA 1PUMB 4G6JA 1VH1A 4KEIA 1N4KA 1JT7A 4FGFA 1JLYA 1LL3A 1W55A 3UJ0A 4FROA 1S0CA 1CE7B 1JT4A 1NMMB 1JYKA 1FQ9A 3FJCA 1K5VA 1GGPB 1TWEA 4P0LA 3D5NA 1XG6A 5J49A 4FRLA 3E25A 1ILR1 3FJHA 4Y6UA 1YBIA 1G97A 21BIA 1V84A 3CA3A 1H5RB 2YCMA 2D44A 2Y6PA 1MC3A 3I0DA 3VSZA 1AVAC 4TLPA 4GP3A 2VXTI 5FV9A 2E4MC 3F62B 4R6UB 4Y62A 1PZZA 2VXRA 5F8SA 2QGIA 3R2WA 1V6XA 2VSHA 1F31A 4I3NA 4JPZA 4QALA 2GZBA 1NF5B 3V0AB 4HO4A 2QYIB 4HO2A 1D0HA 3CQAA 2MC2A 2YC5A 2M49A 4D0TA 3POLA 4J23B 1ZI4A 3FJJA 3OH4A 2D23A 4QO3A 1WT1A 3ILAA 1VGUA 2FYBA 2Q4JA 1ISYA 1O23B 2AM4A 3V91A 2P23A 3O49A 1FWUA 4I7IA 4A7KA 3R4SA 4KEKA 1FR8A 2WVMA 1FV3A 1TZFA 4IZEA 1EVTA 2J0BA 2ZU7A 4KRVA 3ZGFA 2RJ7A 1GWVA 1E5KA 4M2AA 4F83A 4I4SA 1O0RA 1FGGA 1O7OA 4J18A 4MZHA 1G3LA 2OI7A 1AVXB 2D7IA 2ZU9A 3O4DA 3JUTA 4G9MA 5JQQA 1ITBA 2RIYA 3O3PA 1PZTA 2ZU8A 1G1LA 1K4VA 4I37A 2BO4A 3V8YA 4QKRA 3N0KA 4MZGB 2WEEA 1IT0A 4Q7CA 4HG6A 2FGFA 1TVYA 2JCLA 3D98A 3T8SA 3WO3A 2BO8A 2FYCB 2D22A 2K4AB 1JT3A 3AH1A 4Q9PA 1QGQA 4FRQA 4HO6A 4EEMA 1GQCA 1HM8A 3CKQA 1VGTA 1WT2A 4QD2C 4UY4A 2V0LA 2E3DA 2DS0A 4FRMA 4B4MA 1HWMB 1ISVA 4LO7C 1MP5A 4OWJA 2I5EA 2NYYA 4I4VA 5G00A 3IOHA 4G3PA 3AH2A 1IOBA 3V0LA 4NALA 5EIYA 1TIEA 4JKXB 1H5SB 1Q03A 3OJ2A 3OJVA 3FJ8A 4I4RA 1RZOB 3I29B 3MALA 1IHKA 3NBEA 2O1FA 4IRQA 2IHOA 3H6RB 4Y7TA 4LO2C 2Y9WC 4D11C 1JVGA 3BX1C 5JLVA 3VT1A 1Z90A 5DSSB 1EPWA 3I0GA 1HIBA 4GP0A 1IILA 4EB2B 2OI5A 2P73A 1YF8B 1Z2VA 2FFUA 3QYDA 4DE7A 1LL0A 3CA4A 3E8LC 4I4PA 4FRHA 3SPTA 3SXCA 1BASA 3FJEA 4LO3C 4HR6C 1LZIA 3O44A 5F8WA 5AJOA 3O3QA 2O1GA 3V0NA 4WBCA 5CMJA 4QKSA 4ZFUB 2Q9XA 1WVCA 1OMXA 1H5RA 2GGQA 5FTVA 5BVPI 3NBNA 1R7TA 4ZDQA 4ZKTB 3Q7XA 2HWAA 1EYRA 2WRYA 2QH5A 3FUQA 1INJA 1BLDA 4ARWA 4A7ZA 4I4YA 5C3AA 1ZJOA 3R4UA 2VS3A 1LL2A 5DZUA 1PUUB 4KNXA 4I8MA 4OUJA 2WBCA 3HSMA 1S0BA 4I6IA 2OEFA 1ZJ3A 3SXDA 1A8DA 3V0BB 3TZTA 1JV3A 4DCKC 4EE3A 3PUBA 4GOVA 1VZTA 3I2AA 4LW3A 4NANA 2X65A 3FJIA 1TW5A 3DK5A 1FMMS 1HWNB 4AAWA 3AJ6A 4X38A 1OQMB 4B4GA 4GAIA 2K43A 3FJAA 2XWNA 3A23A 1ZHJA 4HO0A 4I1BA 1DLLA 4DECA 1W57A 1T9FA 3K8DA 4B5BA 1FXJA 2VXMA 3SXGA 3VT2A 1WT3A 4Y7VA 4I4OA 2AQZA 1FMZA 1G93A 1WD4A 3OAMA 2F2FA 4IZXA 1R8NA 4AN7B 2PA4A 2ESUA 2XOAA 1H7EA 2JCOA 2RITA 2FDBM 1LVWA 3I0LA 5DDVA 1G9RA 3ST8A 2RJ8A 2NZ9A 1BFCA 2VXLA 3U0YA 5C4EA 1ISWA 3CRIA 5L6VA 1PWAA 4OWKA 5CQLX 2LIQA 2JCJA 2P6WA 1FR9A 1RMLA 3Q7YA 3I2XA 5FZZA 3DUVA 2P39A 4X37A 3P6JA 3WINA 3F1RA 5BXTA 4B4BA 1EV2A 1ZJ1A 5FUHA 2DRYA 3LTQA 4JQ0A 2FY7A 5C4FA 4MIXA 4IQPA 4Y64A 2Z48A 1G9BA 5CMHA 1LZ0A 4QD2B 1GX0A 3SXEA 1OQLB 3BB2A 5D62A 4LO7B 4OWLA 4D0ZA 2QN4A 4XFUA 4I4QA 5BXRA 4Y7GA 2Q3NB 1GA8A 5C36A 3RMXA 3IM7A 1E0OA 4EFQA 2Y4MA 3KIAA 4EE4A 1HWOB 3RMVA 4L41C 1Q1UA 1FV2A 5C48A 4Y6NA 4J2YA 3FOQA 2ZQNA 4LO0A 1G82A 4Z9WB 1ZCYA 1Z4SA 3IOJA 4NAKA 1XHBA 1JLXA 2WGZA 2A8UA 1FGAA 1AVUA 1EYLA 1XYFA 3W9TA 5CMIA 3KMVA 2RJ9A 4G1RA 3VEQA 2P72A 3OH0A 3BRDA 3VSFA 1I1EA 4FREA 4KNRA 3FJ9A 1H7GA 3CA1A 2AECA 3IOIA 1VZUA 3ZC8A 4ZGRB 4IONA 1R8OA 3IIRA 1G9DA 1MP4A 4EKXB 1YROB 1VGZA 2NTDA 2RJ6A 4X39A 3FWWA 4X3AA 1H7TA 2XWLA 1FRWA 2VSEA 1ZCUA 2RIZA 4ASYA 1H7QA 3LW6A 3BRFA 4EEOA 3V79C 3QR5A 1M2TB 3K8EA 2VS5A 5CQPA 4P0JA 5EJZA 3WMUA 3OC9A 2NXVA 1FO9A 4LW6A 2KLLA 4G9NA 4OEGA 1S0DA 2Z86A 4G87A 4JD0A 1H5TA 3T7MA 2ICXA 5D61A 1T4QA 1R82A 4P00A 4FQWA 4HA2A 4ENDA 1LZ7A 3BA4A 3CRGA 1AXMA 3Q7WA 3BAQA 3CKJA 4JISA 4XFTA 3CKNA 4H04A 1HCEA 1FO8A
chains in the Genus database with same CATH topology
1WT0A 3Q4SA 5CQOA 1NZKA 3F1YA 4EVWA 3BRKX 1VICA 1ISZA 1J0SA 1R7VA 3CKVA 2VS4A 1NQIB 4MZFB 3CA6A 5EHAA 2AESA 5C4CA 3S8JA 2BEAA 4KC3A 3AKGA 3VT0A 1FGXA 1YP4A 2AH9A 2UX8A 3PNNA 3ZLKA 4I96A 3T7OA 4D8HA 1INIA 1QQLA 2RSTA 2PX7A 2KH2A 1XZ6A 1ZI3A 5C1LA 1G95A 4M4KA 4H9WA 4M28A 2VUAA 5DDTA 4E1KA 3CKOA 2Z87A 1BFBA 2ZQOA 2VLCA 3TQDA 3OH3A 2XMHA 2KI4A 1PZYB 4G3QA 1HV9A 1DIWA 4I4XA 4IY8A 1RG8A 3VWCA 1FZWA 2FO1A 1KWSA 1QQKA 1MC9A 1VCLA 4ISRA 1EZIA 1HM9A 1ABRB 1SZ6B 3FFZA 1JQZA 4CVHA 3UD9A 3GUEA 3JRRA 3AZVA 1UPSA 3HOMA 1G9CA 4KC2A 4R7PA 4B42A 3RSJA 4JRAA 1H5SD 4KC1A 3S8KA 3D8VA 4Z8SB 4DEPA 2V0IA 3CAHA 3O4BA 1YP3A 1VGWA 8I1BA 1H4CA 2Y9XE 2CU2A 2XMEA 4FRBA 4FRDA 2Y9FA 1ZJ0A 1FN0A 1V6VA 5F90A 2J0AA 1G2VA 3U2XA 3HMYA 5FZUA 1DFCA 3WO4A 6I1BA 4M2BA 3V0PA 1S4PA 3UDAA 1KNMA 1NUNA 2HWMA 4P0KA 1AFCA 3V0AA 1R80A 4ZFYB 2NM1A 1ZI1A 2QKXA 3BAGA 2PGYA 3OH1A 3HL3A 4D11A 3C9ZA 3UD8A 1NWGB 1MP3A 5AJPA 1ON6A 2ET2A 4FCEA 5C4BA 3V0QA 2YC3A 1SR4A 3BA7A 4B3UA 1NKHB 3Q7UA 3SX7A 5FYEA 2UUSA 2Y9GA 3OBTA 3I0CA 4I2SA 1OMZA 1V82A 2V0JA 1HCDA 4IY9A 1DQOA 3BAHA 5BQUC 3BRGC 1G9AA 3UD7A 1HM0A 1W3AA 2W0WA 4OEFA 4GOYA 2O1HA 2XWMA 3E26A 1DFQA 2MLLB 3WMVA 2C0NA 4Q91A 2V0KA 3CU0A 5EG6C 1ZDGA 2WAWA 3EF2A 7I1BA 4LO1C 2AM3A 2VU9A 1AVWB 1HWPB 1QGSA 4CJMA 2FYAA 4DDZA 3ZX7A 1VPAA 3OGZA 4L4IA 4D48A 2RQ9A 1BARA 3A22A 1TWMA 2DPWA 3U2UA 2GGOA 1W3FA 4USPA 4A7YA 1I52A 2E8BA 4KC4A 1RY7A 5GAQA 4Y9XA 4KBBA 2YQCA 1WD3A 3NJ5A 3I0HA 2HZ9A 3BAUA 1G23A 3IM6A 3POKA 2D7RA 4ZFWB 2W0VA 5FU8A 2D0JA 4HJJA 4CJCA 4J2KA 4XKIA 2Z49A 3V8ZA 3U2VA 3AKIA 4KXOA 4DENA 1SS9A 1V83A 1H3MA 4H75A 3O5WB 2NP0A 5FNXA 4J2XA 1H5SA 1H4DA 3N9WA 1FWVA 4G3SA 4LO0C 4ZOTA 2ERMA 3QVBA 5CMFX 3CA0A 3HN1A 1CVSA 1DZCA 2VSIA 4HCQA 3H6RA 1GWWA 3A21A 3OKRA 3O4AA 4FIXA 1K5UA 5AJNA 1JT5A 1FXOA 5D91A 4BQHA 1ZJ2A 3P6IA 5B2HA 3H6QA 4ISQA 3AKFA 2RIXA 3OH2A 2YQJA 5BP5A 1JYLA 2A8WA 4HO5A 5CMGX 4Y63A 1FG5N 5F8YA 4YOLA 4JP0A 2MIBA 4KPZA 1IRPA 3IAGC 1ON8A 2X5SA 3OGGA 5C8RA 2BO6A 1ZCTA 1TTUA 3PHZA 3JUKA 4JAWA 4EFRA 1TP0A 1VH3A 4B2XA 2AGDA 3AKHA 4IHZA 3CGXA 3JTJA 5IFYA 3BADA 3WO2A 3I0IX 4BMAA 2D24A 2R9KB 1VZXA 4IYBA 3I0FA 2FFVA 31BIA 2YQSA 4ZBVB 1G8OA 1H7LA 1HJJA 1R7YA 1GQ9A 4LO8B 3A07A 3T7NA 1M16A 5D63A 3VUOA 3ZLLA 1YYNA 4AC3A 3SX8A 1WBAA 2D1ZA 2E4MA 2AM5A 4FRAA 3RTJB 4XFSA 3FJBA 3OGFA 3FJFA 3V0BA 41BIA 1BFGA 4ASJA 1ZJPA 2Y4JA 4XWIA 3RMWA 5C3DA 2I7BA 3OJMA 5BXCA 1JY0A 4AYLA 4EEAA 3N7MA 1YP2A 2FYDB 5CQMX 5EJ1A 1DZDA 4I4UA 1VM8A 2OEGA 3V0MA 1QWJA 3O4CA 5BOWA 3NGWA 1R7XA 4P02A 1Z0HA 1S0EA 4USOA 5HS2A 4HO8A 4FIYA 1O7QA 5C1GA 3FJKA 1WSZA 3K1XA 4FRPA 4IRPA 1FWYA 9ILBA 1Q04A 3HBWA 1I1BA 1S0LA 4Y7UA 4K6RA 2D20A 3H6SE 2WVLA 2J3PA 4CJ8A 3ZXDA 2NS2A 2RJ1A 3HALA 4O6MA 5C47A 1R7UA 1V6WA 2AFGA 2X5ZA 3ZC9A 3PKQA 3Q80A 2I1BA 2DRZA 1JTCA 1BLAA 3AH4A 4F34A 1JV1A 4QBVA 5DUYA 1G0RA 2APCA 3ZF8A 1IINA 1L2HA 3OBRA 4II0A 1LZJA 1S0GA 2VK9A 2WE9A 3BTAA 3I0JA 4FCUA 4HO3A 2Y4KA 4L4HA 3CA5A 2D43A 2BFHA 2RG9B 2AE7A 4EE5A 1V6UA 3N7JA 2K8RA 5C3BA 3N7KA 5FU0A 3B9UA 3CRHA 2Y4LA 1DJSB 3EE5A 3MPPG 2BEBA 1ONKB 4NAIA 2JCKA 1W3GA 1IRAX 2AXMA 2OI6A 2WVKA 5C1HA 2V0HA 4C2SA 4OEEA 4ECMA 3D7WB 2X60A 1YXWA 2AAIB 2GO2A 3NBDA 4QC4A 4ZA3B 1ZI5A 1HJLA 1IJTA 4KQLA 1YTOA 5EC5A 4EFPA 1FOAA 5FZYA 2BO7A 4GBPA 4KT7A 3RTIB 3F1CA 1BA7A 1XZZA 4MNDA 2DREA 1MD6A 1II4A 1SR4C 5CQNX 1AF9A 2IWTB 1WBCA 4LO2A 1IIMA 2X2SA 1TW1A 3BA5A 3SX5A 1QXMA 4I0YA 4QBCA 1QG8A 3DJ4A 3TC2A 1H7FA 3RMYA 4HO9A 5HPZA 1PC8B 2LIEA 4EEEB 2KI6B 5D92A 4YS8A 4FVVA 3RSBA 5I1FA 4KEJA 1GX4A 2ZR1B 4LO3A 3N7LA 4P6AA 1ZDFA 2F8XC 5IDTA 3ZXGA 1W77A 4Y7FA 3SXBA 5C49A 5E24E 1ZIZA 3ZGGA 2F2FC 5IDSA 4AN6A 2YESA 3BAVA 3PMEA 1R81A 2Y7AA 2VD4A 1BFFA 2ICYA 2RJ5A 4GAFA 4O6NA 2KKIA 2NVHA 3SNVA 5BXPA 3WA1A 1P63A 4MYBA 3U2TA 1H5TB 2X2TA 3V90A 3UJ4A 3P53A 1ISXA 3CU1B 1S4OA 3AJ5A 4KPXA 2HW9A 4UEGA 2RJ0A 5I1BA 3I0KA 5C38A 3WINC 3O4OA 5FTSA 3SXAA 2RJ4A 3I0EA 3FUOA 2VSAA 3IM5A 4OW4A 3USRA 4JKQA 1S4NA 4AYJA 1ZCVA 5C4DA 4I1EA 2I5KA 2VFZA 4HOCA 3SX3A 2YUGA 1JVDA 3PG0A 3AZWA 1HKNA 3NBCA 4G6MA 3FGMA 1H7HA 1H5SC 1TOOA 3V0OA 5L6SA 4PC4A 5BQUA 2PGVA 4CJBA 3LLPA 5DVHA 2MZBA 2L5XA 1NHEB 3PKPA 3U2WA 3USQA 5FNWA 4ZLBB 4B2WA 5BXSA 3BCVA 3FJDA 4J2SA 5JMCA 3JUJA 1DQGA 3R3IA 3U0XA 1TFMB 1S0FA 5BP5C 1H4EA 2YQHA 4EEGA 4Q9GA 4LO1A 3BAOA 1PUMB 4G6JA 1VH1A 4KEIA 1N4KA 1JT7A 4FGFA 1JLYA 1LL3A 1W55A 3UJ0A 4FROA 1S0CA 1CE7B 1JT4A 1NMMB 1JYKA 1FQ9A 3FJCA 1K5VA 1GGPB 1TWEA 4P0LA 3D5NA 1XG6A 5J49A 4FRLA 3E25A 1ILR1 3FJHA 4Y6UA 1YBIA 1G97A 21BIA 1V84A 3CA3A 1H5RB 2YCMA 2D44A 2Y6PA 1MC3A 3I0DA 3VSZA 1AVAC 4TLPA 4GP3A 2VXTI 5FV9A 2E4MC 3F62B 4R6UB 4Y62A 1PZZA 2VXRA 5F8SA 2QGIA 3R2WA 1V6XA 2VSHA 1F31A 4I3NA 4JPZA 4QALA 2GZBA 1NF5B 3V0AB 4HO4A 2QYIB 4HO2A 1D0HA 3CQAA 2MC2A 2YC5A 2M49A 4D0TA 3POLA 4J23B 1ZI4A 3FJJA 3OH4A 2D23A 4QO3A 1WT1A 3ILAA 1VGUA 2FYBA 2Q4JA 1ISYA 1O23B 2AM4A 3V91A 2P23A 3O49A 1FWUA 4I7IA 4A7KA 3R4SA 4KEKA 1FR8A 2WVMA 1FV3A 1TZFA 4IZEA 1EVTA 2J0BA 2ZU7A 4KRVA 3ZGFA 2RJ7A 1GWVA 1E5KA 4M2AA 4F83A 4I4SA 1O0RA 1FGGA 1O7OA 4J18A 4MZHA 1G3LA 2OI7A 1AVXB 2D7IA 2ZU9A 3O4DA 3JUTA 4G9MA 5JQQA 1ITBA 2RIYA 3O3PA 1PZTA 2ZU8A 1G1LA 1K4VA 4I37A 2BO4A 3V8YA 4QKRA 3N0KA 4MZGB 2WEEA 1IT0A 4Q7CA 4HG6A 2FGFA 1TVYA 2JCLA 3D98A 3T8SA 3WO3A 2BO8A 2FYCB 2D22A 2K4AB 1JT3A 3AH1A 4Q9PA 1QGQA 4FRQA 4HO6A 4EEMA 1GQCA 1HM8A 3CKQA 1VGTA 1WT2A 4QD2C 4UY4A 2V0LA 2E3DA 2DS0A 4FRMA 4B4MA 1HWMB 1ISVA 4LO7C 1MP5A 4OWJA 2I5EA 2NYYA 4I4VA 5G00A 3IOHA 4G3PA 3AH2A 1IOBA 3V0LA 4NALA 5EIYA 1TIEA 4JKXB 1H5SB 1Q03A 3OJ2A 3OJVA 3FJ8A 4I4RA 1RZOB 3I29B 3MALA 1IHKA 3NBEA 2O1FA 4IRQA 2IHOA 3H6RB 4Y7TA 4LO2C 2Y9WC 4D11C 1JVGA 3BX1C 5JLVA 3VT1A 1Z90A 5DSSB 1EPWA 3I0GA 1HIBA 4GP0A 1IILA 4EB2B 2OI5A 2P73A 1YF8B 1Z2VA 2FFUA 3QYDA 4DE7A 1LL0A 3CA4A 3E8LC 4I4PA 4FRHA 3SPTA 3SXCA 1BASA 3FJEA 4LO3C 4HR6C 1LZIA 3O44A 5F8WA 5AJOA 3O3QA 2O1GA 3V0NA 4WBCA 5CMJA 4QKSA 4ZFUB 2Q9XA 1WVCA 1OMXA 1H5RA 2GGQA 5FTVA 5BVPI 3NBNA 1R7TA 4ZDQA 4ZKTB 3Q7XA 2HWAA 1EYRA 2WRYA 2QH5A 3FUQA 1INJA 1BLDA 4ARWA 4A7ZA 4I4YA 5C3AA 1ZJOA 3R4UA 2VS3A 1LL2A 5DZUA 1PUUB 4KNXA 4I8MA 4OUJA 2WBCA 3HSMA 1S0BA 4I6IA 2OEFA 1ZJ3A 3SXDA 1A8DA 3V0BB 3TZTA 1JV3A 4DCKC 4EE3A 3PUBA 4GOVA 1VZTA 3I2AA 4LW3A 4NANA 2X65A 3FJIA 1TW5A 3DK5A 1FMMS 1HWNB 4AAWA 3AJ6A 4X38A 1OQMB 4B4GA 4GAIA 2K43A 3FJAA 2XWNA 3A23A 1ZHJA 4HO0A 4I1BA 1DLLA 4DECA 1W57A 1T9FA 3K8DA 4B5BA 1FXJA 2VXMA 3SXGA 3VT2A 1WT3A 4Y7VA 4I4OA 2AQZA 1FMZA 1G93A 1WD4A 3OAMA 2F2FA 4IZXA 1R8NA 4AN7B 2PA4A 2ESUA 2XOAA 1H7EA 2JCOA 2RITA 2FDBM 1LVWA 3I0LA 5DDVA 1G9RA 3ST8A 2RJ8A 2NZ9A 1BFCA 2VXLA 3U0YA 5C4EA 1ISWA 3CRIA 5L6VA 1PWAA 4OWKA 5CQLX 2LIQA 2JCJA 2P6WA 1FR9A 1RMLA 3Q7YA 3I2XA 5FZZA 3DUVA 2P39A 4X37A 3P6JA 3WINA 3F1RA 5BXTA 4B4BA 1EV2A 1ZJ1A 5FUHA 2DRYA 3LTQA 4JQ0A 2FY7A 5C4FA 4MIXA 4IQPA 4Y64A 2Z48A 1G9BA 5CMHA 1LZ0A 4QD2B 1GX0A 3SXEA 1OQLB 3BB2A 5D62A 4LO7B 4OWLA 4D0ZA 2QN4A 4XFUA 4I4QA 5BXRA 4Y7GA 2Q3NB 1GA8A 5C36A 3RMXA 3IM7A 1E0OA 4EFQA 2Y4MA 3KIAA 4EE4A 1HWOB 3RMVA 4L41C 1Q1UA 1FV2A 5C48A 4Y6NA 4J2YA 3FOQA 2ZQNA 4LO0A 1G82A 4Z9WB 1ZCYA 1Z4SA 3IOJA 4NAKA 1XHBA 1JLXA 2WGZA 2A8UA 1FGAA 1AVUA 1EYLA 1XYFA 3W9TA 5CMIA 3KMVA 2RJ9A 4G1RA 3VEQA 2P72A 3OH0A 3BRDA 3VSFA 1I1EA 4FREA 4KNRA 3FJ9A 1H7GA 3CA1A 2AECA 3IOIA 1VZUA 3ZC8A 4ZGRB 4IONA 1R8OA 3IIRA 1G9DA 1MP4A 4EKXB 1YROB 1VGZA 2NTDA 2RJ6A 4X39A 3FWWA 4X3AA 1H7TA 2XWLA 1FRWA 2VSEA 1ZCUA 2RIZA 4ASYA 1H7QA 3LW6A 3BRFA 4EEOA 3V79C 3QR5A 1M2TB 3K8EA 2VS5A 5CQPA 4P0JA 5EJZA 3WMUA 3OC9A 2NXVA 1FO9A 4LW6A 2KLLA 4G9NA 4OEGA 1S0DA 2Z86A 4G87A 4JD0A 1H5TA 3T7MA 2ICXA 5D61A 1T4QA 1R82A 4P00A 4FQWA 4HA2A 4ENDA 1LZ7A 3BA4A 3CRGA 1AXMA 3Q7WA 3BAQA 3CKJA 4JISA 4XFTA 3CKNA 4H04A 1HCEA 1FO8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WT0 A;  3Q4S A;  5CQO A;  1NZK A;  3F1Y A;  4EVW A;  3BRK X;  1VIC A;  1ISZ A;  1J0S A;  1R7V A;  3CKV A;  2VS4 A;  1NQI B;  3CA6 A;  5EHA A;  2AES A;  5C4C A;  3S8J A;  2BEA A;  4KC3 A;  3AKG A;  3VT0 A;  1FGX A;  1YP4 A;  2AH9 A;  2UX8 A;  3PNN A;  3ZLK A;  4I96 A;  3T7O A;  4D8H A;  1INI A;  1QQL A;  2RST A;  2PX7 A;  2KH2 A;  1XZ6 A;  1ZI3 A;  5C1L A;  1G95 A;  4M4K A;  4H9W A;  4M28 A;  2VUA A;  5DDT A;  4E1K A;  3CKO A;  2Z87 A;  1BFB A;  2ZQO A;  2VLC A;  3TQD A;  3OH3 A;  2XMH A;  2KI4 A;  1PZY B;  4G3Q A;  1HV9 A;  1DIW A;  4I4X A;  4IY8 A;  1RG8 A;  3VWC A;  1FZW A;  2FO1 A;  1KWS A;  1QQK A;  1MC9 A;  1VCL A;  4ISR A;  1EZI A;  1HM9 A;  1ABR B;  1SZ6 B;  3FFZ A;  1JQZ A;  4CVH A;  3UD9 A;  3GUE A;  3JRR A;  3AZV A;  1UPS A;  3HOM A;  1G9C A;  4KC2 A;  4R7P A;  4B42 A;  3RSJ A;  4JRA A;  1H5S D;  4KC1 A;  3S8K A;  3D8V A;  4Z8S B;  4DEP A;  2V0I A;  3CAH A;  3O4B A;  1YP3 A;  1VGW A;  8I1B A;  1H4C A;  2Y9X E;  2CU2 A;  2XME A;  4FRB A;  4FRD A;  2Y9F A;  1ZJ0 A;  1FN0 A;  1V6V A;  5F90 A;  3U2X A;  1G2V A;  3HMY A;  5FZU A;  1DFC A;  3WO4 A;  6I1B A;  4M2B A;  3V0P A;  1S4P A;  3UDA A;  1KNM A;  1NUN A;  2HWM A;  4P0K A;  1AFC A;  3V0A A;  1R80 A;  4ZFY B;  2NM1 A;  1ZI1 A;  2QKX A;  3BAG A;  2PGY A;  3OH1 A;  3HL3 A;  4D11 A;  3C9Z A;  3UD8 A;  1NWG B;  1MP3 A;  5AJP A;  1ON6 A;  2ET2 A;  4FCE A;  5C4B A;  3V0Q A;  2YC3 A;  1SR4 A;  3BA7 A;  4B3U A;  1NKH B;  3Q7U A;  3SX7 A;  5FYE A;  2UUS A;  2Y9G A;  3OBT A;  3I0C A;  4I2S A;  1OMZ A;  1V82 A;  2V0J A;  1HCD A;  4IY9 A;  1DQO A;  3BAH A;  5BQU C;  3BRG C;  1G9A A;  3UD7 A;  1HM0 A;  1W3A A;  2W0W A;  4OEF A;  4GOY A;  2O1H A;  2XWM A;  3E26 A;  1DFQ A;  2MLL B;  3WMV A;  3CU0 A;  4Q91 A;  2V0K A;  5EG6 C;  1ZDG A;  2WAW A;  3EF2 A;  7I1B A;  4LO1 C;  2AM3 A;  2VU9 A;  1AVW B;  1HWP B;  1QGS A;  4CJM A;  2FYA A;  4DDZ A;  3ZX7 A;  1VPA A;  3OGZ A;  4L4I A;  4D48 A;  2RQ9 A;  1BAR A;  3A22 A;  1TWM A;  2DPW A;  3U2U A;  2GGO A;  1W3F A;  4USP A;  4A7Y A;  1I52 A;  2E8B A;  4KC4 A;  1RY7 A;  5GAQ A;  4Y9X A;  4KBB A;  2YQC A;  1WD3 A;  3NJ5 A;  3I0H A;  2HZ9 A;  3BAU A;  1G23 A;  3IM6 A;  3POK A;  2D7R A;  4ZFW B;  2W0V A;  5FU8 A;  2D0J A;  4HJJ A;  4CJC A;  4J2K A;  4XKI A;  2Z49 A;  3V8Z A;  3U2V A;  3AKI A;  4KXO A;  4DEN A;  1SS9 A;  1V83 A;  1H3M A;  3N9W A;  3O5W B;  2NP0 A;  5FNX A;  4J2X A;  1H5S A;  1H4D A;  4G3S A;  1FWV A;  5CMF X;  4LO0 C;  4ZOT A;  2ERM A;  3QVB A;  3CA0 A;  3HN1 A;  1CVS A;  1DZC A;  2VSI A;  4HCQ A;  3H6R A;  1GWW A;  3A21 A;  3OKR A;  3O4A A;  5AJN A;  1K5U A;  4BQH A;  1JT5 A;  1FXO A;  1ZJ2 A;  3P6I A;  5B2H A;  3H6Q A;  4ISQ A;  3AKF A;  2RIX A;  3OH2 A;  2YQJ A;  5BP5 A;  1JYL A;  2A8W A;  4HO5 A;  5CMG X;  4Y63 A;  1FG5 N;  5F8Y A;  4YOL A;  4JP0 A;  2MIB A;  4KPZ A;  1IRP A;  3IAG C;  1ON8 A;  2X5S A;  3OGG A;  5C8R A;  2BO6 A;  1ZCT A;  1TTU A;  3PHZ A;  3JUK A;  4JAW A;  4EFR A;  1TP0 A;  1VH3 A;  4B2X A;  2AGD A;  3AKH A;  4IHZ A;  3CGX A;  3JTJ A;  5IFY A;  3BAD A;  3WO2 A;  3I0I X;  4BMA A;  2D24 A;  2R9K B;  1VZX A;  4IYB A;  3I0F A;  2FFV A;  31BI A;  2YQS A;  4ZBV B;  1G8O A;  1H7L A;  1HJJ A;  1R7Y A;  1GQ9 A;  4LO8 B;  3A07 A;  3T7N A;  1M16 A;  5D63 A;  3VUO A;  3ZLL A;  1YYN A;  4AC3 A;  3SX8 A;  1WBA A;  2D1Z A;  2E4M A;  2AM5 A;  4FRA A;  3RTJ B;  4XFS A;  3FJB A;  3OGF A;  3FJF A;  3V0B A;  41BI A;  1BFG A;  4ASJ A;  1ZJP A;  2Y4J A;  4XWI A;  3RMW A;  5C3D A;  2I7B A;  3OJM A;  5BXC A;  1JY0 A;  4AYL A;  4EEA A;  3N7M A;  1YP2 A;  2FYD B;  5CQM X;  5EJ1 A;  1DZD A;  4I4U A;  1VM8 A;  2OEG A;  3V0M A;  1QWJ A;  3O4C A;  5BOW A;  3NGW A;  1R7X A;  4P02 A;  1Z0H A;  1S0E A;  4USO A;  5HS2 A;  4HO8 A;  1O7Q A;  5C1G A;  3FJK A;  1WSZ A;  3K1X A;  4FRP A;  4IRP A;  1FWY A;  9ILB A;  1Q04 A;  3HBW A;  1I1B A;  1S0L A;  4Y7U A;  4K6R A;  2D20 A;  3H6S E;  2WVL A;  2J3P A;  4CJ8 A;  3ZXD A;  2RJ1 A;  3HAL A;  5C47 A;  1R7U A;  1V6W A;  2AFG A;  2X5Z A;  3ZC9 A;  3PKQ A;  3Q80 A;  2I1B A;  2DRZ A;  1JTC A;  1BLA A;  3AH4 A;  4F34 A;  1JV1 A;  4QBV A;  5DUY A;  1G0R A;  2APC A;  3ZF8 A;  1IIN A;  1L2H A;  3OBR A;  4II0 A;  1LZJ A;  1S0G A;  2WE9 A;  4HO3 A;  3BTA A;  3I0J A;  4FCU A;  2Y4K A;  4L4H A;  3CA5 A;  2D43 A;  2BFH A;  2RG9 B;  2AE7 A;  4EE5 A;  1V6U A;  3N7J A;  2K8R A;  5C3B A;  3N7K A;  5FU0 A;  3B9U A;  3CRH A;  2Y4L A;  1DJS B;  3EE5 A;  3MPP G;  2BEB A;  1ONK B;  4NAI A;  2JCK A;  1W3G A;  1IRA X;  2AXM A;  2OI6 A;  2WVK A;  5C1H A;  2V0H A;  4C2S A;  4OEE A;  4ECM A;  3D7W B;  2X60 A;  1YXW A;  2AAI B;  2GO2 A;  3NBD A;  4QC4 A;  4ZA3 B;  1ZI5 A;  1HJL A;  1IJT A;  4KQL A;  1YTO A;  5EC5 A;  4EFP A;  1FOA A;  5FZY A;  2BO7 A;  4GBP A;  4KT7 A;  3RTI B;  3F1C A;  1BA7 A;  1XZZ A;  4MND A;  2DRE A;  1MD6 A;  1II4 A;  1SR4 C;  5CQN X;  1AF9 A;  2IWT B;  1WBC A;  4LO2 A;  1IIM A;  2X2S A;  1TW1 A;  3BA5 A;  3SX5 A;  1QXM A;  4I0Y A;  4QBC A;  1QG8 A;  3DJ4 A;  3TC2 A;  1H7F A;  3RMY A;  4HO9 A;  5HPZ A;  1PC8 B;  2LIE A;  4EEE B;  2KI6 B;  4YS8 A;  4FVV A;  3RSB A;  5I1F A;  4KEJ A;  1GX4 A;  2ZR1 B;  4LO3 A;  3N7L A;  4P6A A;  1ZDF A;  2F8X C;  5IDT A;  3ZXG A;  1W77 A;  4Y7F A;  3SXB A;  5C49 A;  5E24 E;  1ZIZ A;  3ZGG A;  2F2F C;  5IDS A;  4AN6 A;  2YES A;  3BAV A;  3PME A;  1R81 A;  2Y7A A;  2VD4 A;  1BFF A;  2ICY A;  2RJ5 A;  4GAF A;  2KKI A;  2NVH A;  3SNV A;  5BXP A;  3WA1 A;  1P63 A;  4MYB A;  3U2T A;  1H5T B;  2X2T A;  3V90 A;  3UJ4 A;  3P53 A;  1ISX A;  3CU1 B;  1S4O A;  3AJ5 A;  4KPX A;  2HW9 A;  4UEG A;  2RJ0 A;  5I1B A;  3I0K A;  5C38 A;  3WIN C;  3O4O A;  5FTS A;  3SXA A;  2RJ4 A;  3I0E A;  3FUO A;  2VSA A;  3IM5 A;  4OW4 A;  3USR A;  4JKQ A;  1S4N A;  4AYJ A;  1ZCV A;  5C4D A;  4I1E A;  2I5K A;  2VFZ A;  4HOC A;  3SX3 A;  2YUG A;  1JVD A;  3PG0 A;  3AZW A;  1HKN A;  3NBC A;  4G6M A;  3FGM A;  1H7H A;  1H5S C;  1TOO A;  3V0O A;  5L6S A;  4PC4 A;  5BQU A;  2PGV A;  4CJB A;  3LLP A;  5DVH A;  2MZB A;  2L5X A;  1NHE B;  3PKP A;  3U2W A;  3USQ A;  5FNW A;  4ZLB B;  4B2W A;  5BXS A;  3BCV A;  3FJD A;  4J2S A;  5JMC A;  3JUJ A;  1DQG A;  3R3I A;  3U0X A;  1TFM B;  1S0F A;  5BP5 C;  1H4E A;  2YQH A;  4EEG A;  4Q9G A;  4LO1 A;  3BAO A;  1PUM B;  4G6J A;  1VH1 A;  4KEI A;  1N4K A;  1JT7 A;  4FGF A;  1JLY A;  1LL3 A;  1W55 A;  3UJ0 A;  4FRO A;  1S0C A;  1CE7 B;  1JT4 A;  1NMM B;  1JYK A;  1FQ9 A;  3FJC A;  1K5V A;  1GGP B;  1TWE A;  4P0L A;  3D5N A;  1XG6 A;  5J49 A;  4FRL A;  3E25 A;  1ILR 1;  3FJH A;  4Y6U A;  1YBI A;  1G97 A;  21BI A;  1V84 A;  3CA3 A;  1H5R B;  2YCM A;  2D44 A;  2Y6P A;  1MC3 A;  3I0D A;  3VSZ A;  1AVA C;  4TLP A;  4GP3 A;  2VXT I;  5FV9 A;  2E4M C;  3F62 B;  4R6U B;  4Y62 A;  1PZZ A;  2VXR A;  5F8S A;  2QGI A;  3R2W A;  1V6X A;  2VSH A;  1F31 A;  4I3N A;  4JPZ A;  4QAL A;  2GZB A;  1NF5 B;  3V0A B;  4HO4 A;  2QYI B;  4HO2 A;  1D0H A;  3CQA A;  2MC2 A;  2YC5 A;  2M49 A;  4D0T A;  3POL A;  4J23 B;  1ZI4 A;  3FJJ A;  3OH4 A;  2D23 A;  4QO3 A;  1WT1 A;  3ILA A;  1VGU A;  2FYB A;  2Q4J A;  1ISY A;  1O23 B;  2AM4 A;  3V91 A;  2P23 A;  3O49 A;  1FWU A;  4I7I A;  4A7K A;  3R4S A;  4KEK A;  1FR8 A;  2WVM A;  1FV3 A;  1TZF A;  4IZE A;  1EVT A;  2ZU7 A;  4KRV A;  3ZGF A;  2RJ7 A;  1GWV A;  1E5K A;  4M2A A;  4F83 A;  4I4S A;  1O0R A;  1FGG A;  1O7O A;  4J18 A;  1G3L A;  2OI7 A;  1AVX B;  2D7I A;  2ZU9 A;  3O4D A;  3JUT A;  4G9M A;  5JQQ A;  1ITB A;  2RIY A;  3O3P A;  1PZT A;  2ZU8 A;  1G1L A;  1K4V A;  4I37 A;  2BO4 A;  3V8Y A;  4QKR A;  3N0K A;  2WEE A;  1IT0 A;  4HG6 A;  2FGF A;  1TVY A;  2JCL A;  3D98 A;  3T8S A;  3WO3 A;  2BO8 A;  2FYC B;  2D22 A;  2K4A B;  1JT3 A;  3AH1 A;  4Q9P A;  1QGQ A;  4FRQ A;  4HO6 A;  4EEM A;  1GQC A;  1HM8 A;  3CKQ A;  1VGT A;  1WT2 A;  4QD2 C;  2V0L A;  2E3D A;  2DS0 A;  4FRM A;  4B4M A;  1HWM B;  1ISV A;  4LO7 C;  1MP5 A;  4OWJ A;  2I5E A;  2NYY A;  4I4V A;  5G00 A;  3IOH A;  4G3P A;  3AH2 A;  1IOB A;  3V0L A;  4NAL A;  5EIY A;  1TIE A;  4JKX B;  1H5S B;  1Q03 A;  3OJ2 A;  3OJV A;  3FJ8 A;  4I4R A;  1RZO B;  3I29 B;  3MAL A;  1IHK A;  3NBE A;  2O1F A;  4IRQ A;  2IHO A;  3H6R B;  4Y7T A;  4LO2 C;  2Y9W C;  4D11 C;  1JVG A;  3BX1 C;  5JLV A;  3VT1 A;  1Z90 A;  5DSS B;  1EPW A;  3I0G A;  1HIB A;  4GP0 A;  1IIL A;  4EB2 B;  2OI5 A;  2P73 A;  1YF8 B;  1Z2V A;  2FFU A;  3QYD A;  4DE7 A;  1LL0 A;  3CA4 A;  3E8L C;  4I4P A;  4FRH A;  3SPT A;  3SXC A;  1BAS A;  3FJE A;  4LO3 C;  4HR6 C;  1LZI A;  3O44 A;  5F8W A;  5AJO A;  3O3Q A;  2O1G A;  3V0N A;  4WBC A;  5CMJ A;  4QKS A;  4ZFU B;  2Q9X A;  1WVC A;  1OMX A;  1H5R A;  2GGQ A;  5FTV A;  5BVP I;  3NBN A;  1R7T A;  4ZDQ A;  4ZKT B;  3Q7X A;  2HWA A;  1EYR A;  2WRY A;  2QH5 A;  3FUQ A;  1INJ A;  1BLD A;  4ARW A;  4A7Z A;  4I4Y A;  5C3A A;  1ZJO A;  3R4U A;  2VS3 A;  1LL2 A;  5DZU A;  1PUU B;  4KNX A;  4I8M A;  4OUJ A;  2WBC A;  3HSM A;  1S0B A;  4I6I A;  2OEF A;  1ZJ3 A;  3SXD A;  1A8D A;  3V0B B;  3TZT A;  1JV3 A;  4DCK C;  4EE3 A;  3PUB A;  4GOV A;  1VZT A;  3I2A A;  4LW3 A;  4NAN A;  2X65 A;  3FJI A;  1TW5 A;  3DK5 A;  1FMM S;  1HWN B;  4AAW A;  3AJ6 A;  4X38 A;  1OQM B;  4B4G A;  4GAI A;  2K43 A;  3FJA A;  2XWN A;  3A23 A;  1ZHJ A;  4HO0 A;  4I1B A;  1DLL A;  4DEC A;  1W57 A;  1T9F A;  3K8D A;  4B5B A;  1FXJ A;  2VXM A;  3SXG A;  3VT2 A;  1WT3 A;  4Y7V A;  4I4O A;  2AQZ A;  1FMZ A;  1G93 A;  1WD4 A;  3OAM A;  2F2F A;  4IZX A;  1R8N A;  4AN7 B;  2PA4 A;  2ESU A;  2XOA A;  1H7E A;  2JCO A;  2RIT A;  2FDB M;  1LVW A;  3I0L A;  5DDV A;  1G9R A;  3ST8 A;  2RJ8 A;  2NZ9 A;  1BFC A;  2VXL A;  3U0Y A;  5C4E A;  1ISW A;  3CRI A;  5L6V A;  1PWA A;  4OWK A;  5CQL X;  2LIQ A;  2JCJ A;  2P6W A;  1FR9 A;  1RML A;  3Q7Y A;  3I2X A;  5FZZ A;  3DUV A;  2P39 A;  4X37 A;  3P6J A;  3WIN A;  3F1R A;  5BXT A;  4B4B A;  1EV2 A;  1ZJ1 A;  5FUH A;  2DRY A;  3LTQ A;  4JQ0 A;  2FY7 A;  5C4F A;  4Y64 A;  4IQP A;  2Z48 A;  1G9B A;  5CMH A;  1LZ0 A;  4QD2 B;  1GX0 A;  3SXE A;  1OQL B;  3BB2 A;  5D62 A;  4LO7 B;  4OWL A;  4D0Z A;  2QN4 A;  4XFU A;  4I4Q A;  5BXR A;  4Y7G A;  2Q3N B;  1GA8 A;  5C36 A;  3RMX A;  3IM7 A;  1E0O A;  4EFQ A;  2Y4M A;  3KIA A;  4EE4 A;  1HWO B;  3RMV A;  4L41 C;  1Q1U A;  1FV2 A;  5C48 A;  4Y6N A;  4J2Y A;  3FOQ A;  2ZQN A;  4LO0 A;  1G82 A;  4Z9W B;  1ZCY A;  1Z4S A;  3IOJ A;  4NAK A;  1XHB A;  1JLX A;  2WGZ A;  2A8U A;  1FGA A;  1AVU A;  1EYL A;  1XYF A;  3W9T A;  5CMI A;  3KMV A;  2RJ9 A;  4G1R A;  3VEQ A;  2P72 A;  3OH0 A;  3BRD A;  3VSF A;  1I1E A;  4FRE A;  4KNR A;  3FJ9 A;  1H7G A;  3CA1 A;  2AEC A;  3IOI A;  1VZU A;  3ZC8 A;  4ZGR B;  4ION A;  1R8O A;  3IIR A;  1G9D A;  1MP4 A;  4EKX B;  1YRO B;  1VGZ A;  2NTD A;  2RJ6 A;  4X39 A;  3FWW A;  4X3A A;  1H7T A;  2XWL A;  1FRW A;  2VSE A;  1ZCU A;  2RIZ A;  4ASY A;  1H7Q A;  3LW6 A;  3BRF A;  4EEO A;  3V79 C;  3QR5 A;  1M2T B;  3K8E A;  2VS5 A;  5CQP A;  4P0J A;  5EJZ A;  3WMU A;  3OC9 A;  2NXV A;  1FO9 A;  4LW6 A;  2KLL A;  4G9N A;  4OEG A;  1S0D A;  2Z86 A;  4G87 A;  4JD0 A;  1H5T A;  3T7M A;  2ICX A;  5D61 A;  1T4Q A;  1R82 A;  4P00 A;  4FQW A;  4HA2 A;  4END A;  1LZ7 A;  3BA4 A;  3CRG A;  1AXM A;  3Q7W A;  3BAQ A;  3CKJ A;  4JIS A;  4XFT A;  3CKN A;  4H04 A;  1HCE A;  1FO8 A; 
#chains in the Genus database with same CATH topology
 1WT0 A;  3Q4S A;  5CQO A;  1NZK A;  3F1Y A;  4EVW A;  3BRK X;  1VIC A;  1ISZ A;  1J0S A;  1R7V A;  3CKV A;  2VS4 A;  1NQI B;  4MZF B;  3CA6 A;  5EHA A;  2AES A;  5C4C A;  3S8J A;  2BEA A;  4KC3 A;  3AKG A;  3VT0 A;  1FGX A;  1YP4 A;  2AH9 A;  2UX8 A;  3PNN A;  3ZLK A;  4I96 A;  3T7O A;  4D8H A;  1INI A;  1QQL A;  2RST A;  2PX7 A;  2KH2 A;  1XZ6 A;  1ZI3 A;  5C1L A;  1G95 A;  4M4K A;  4H9W A;  4M28 A;  2VUA A;  5DDT A;  4E1K A;  3CKO A;  2Z87 A;  1BFB A;  2ZQO A;  2VLC A;  3TQD A;  3OH3 A;  2XMH A;  2KI4 A;  1PZY B;  4G3Q A;  1HV9 A;  1DIW A;  4I4X A;  4IY8 A;  1RG8 A;  3VWC A;  1FZW A;  2FO1 A;  1KWS A;  1QQK A;  1MC9 A;  1VCL A;  4ISR A;  1EZI A;  1HM9 A;  1ABR B;  1SZ6 B;  3FFZ A;  1JQZ A;  4CVH A;  3UD9 A;  3GUE A;  3JRR A;  3AZV A;  1UPS A;  3HOM A;  1G9C A;  4KC2 A;  4R7P A;  4B42 A;  3RSJ A;  4JRA A;  1H5S D;  4KC1 A;  3S8K A;  3D8V A;  4Z8S B;  4DEP A;  2V0I A;  3CAH A;  3O4B A;  1YP3 A;  1VGW A;  8I1B A;  1H4C A;  2Y9X E;  2CU2 A;  2XME A;  4FRB A;  4FRD A;  2Y9F A;  1ZJ0 A;  1FN0 A;  1V6V A;  5F90 A;  2J0A A;  1G2V A;  3U2X A;  3HMY A;  5FZU A;  1DFC A;  3WO4 A;  6I1B A;  4M2B A;  3V0P A;  1S4P A;  3UDA A;  1KNM A;  1NUN A;  2HWM A;  4P0K A;  1AFC A;  3V0A A;  1R80 A;  4ZFY B;  2NM1 A;  1ZI1 A;  2QKX A;  3BAG A;  2PGY A;  3OH1 A;  3HL3 A;  4D11 A;  3C9Z A;  3UD8 A;  1NWG B;  1MP3 A;  5AJP A;  1ON6 A;  2ET2 A;  4FCE A;  5C4B A;  3V0Q A;  2YC3 A;  1SR4 A;  3BA7 A;  4B3U A;  1NKH B;  3Q7U A;  3SX7 A;  5FYE A;  2UUS A;  2Y9G A;  3OBT A;  3I0C A;  4I2S A;  1OMZ A;  1V82 A;  2V0J A;  1HCD A;  4IY9 A;  1DQO A;  3BAH A;  5BQU C;  3BRG C;  1G9A A;  3UD7 A;  1HM0 A;  1W3A A;  2W0W A;  4OEF A;  4GOY A;  2O1H A;  2XWM A;  3E26 A;  1DFQ A;  2MLL B;  3WMV A;  2C0N A;  4Q91 A;  2V0K A;  3CU0 A;  5EG6 C;  1ZDG A;  2WAW A;  3EF2 A;  7I1B A;  4LO1 C;  2AM3 A;  2VU9 A;  1AVW B;  1HWP B;  1QGS A;  4CJM A;  2FYA A;  4DDZ A;  3ZX7 A;  1VPA A;  3OGZ A;  4L4I A;  4D48 A;  2RQ9 A;  1BAR A;  3A22 A;  1TWM A;  2DPW A;  3U2U A;  2GGO A;  1W3F A;  4USP A;  4A7Y A;  1I52 A;  2E8B A;  4KC4 A;  1RY7 A;  5GAQ A;  4Y9X A;  4KBB A;  2YQC A;  1WD3 A;  3NJ5 A;  3I0H A;  2HZ9 A;  3BAU A;  1G23 A;  3IM6 A;  3POK A;  2D7R A;  4ZFW B;  2W0V A;  5FU8 A;  2D0J A;  4HJJ A;  4CJC A;  4J2K A;  4XKI A;  2Z49 A;  3V8Z A;  3U2V A;  3AKI A;  4KXO A;  4DEN A;  1SS9 A;  1V83 A;  1H3M A;  4H75 A;  3O5W B;  2NP0 A;  5FNX A;  4J2X A;  1H5S A;  1H4D A;  3N9W A;  1FWV A;  4G3S A;  4LO0 C;  4ZOT A;  2ERM A;  3QVB A;  5CMF X;  3CA0 A;  3HN1 A;  1CVS A;  1DZC A;  2VSI A;  4HCQ A;  3H6R A;  1GWW A;  3A21 A;  3OKR A;  3O4A A;  4FIX A;  1K5U A;  5AJN A;  1JT5 A;  1FXO A;  5D91 A;  4BQH A;  1ZJ2 A;  3P6I A;  5B2H A;  3H6Q A;  4ISQ A;  3AKF A;  2RIX A;  3OH2 A;  2YQJ A;  5BP5 A;  1JYL A;  2A8W A;  4HO5 A;  5CMG X;  4Y63 A;  1FG5 N;  5F8Y A;  4YOL A;  4JP0 A;  2MIB A;  4KPZ A;  1IRP A;  3IAG C;  1ON8 A;  2X5S A;  3OGG A;  5C8R A;  2BO6 A;  1ZCT A;  1TTU A;  3PHZ A;  3JUK A;  4JAW A;  4EFR A;  1TP0 A;  1VH3 A;  4B2X A;  2AGD A;  3AKH A;  4IHZ A;  3CGX A;  3JTJ A;  5IFY A;  3BAD A;  3WO2 A;  3I0I X;  4BMA A;  2D24 A;  2R9K B;  1VZX A;  4IYB A;  3I0F A;  2FFV A;  31BI A;  2YQS A;  4ZBV B;  1G8O A;  1H7L A;  1HJJ A;  1R7Y A;  1GQ9 A;  4LO8 B;  3A07 A;  3T7N A;  1M16 A;  5D63 A;  3VUO A;  3ZLL A;  1YYN A;  4AC3 A;  3SX8 A;  1WBA A;  2D1Z A;  2E4M A;  2AM5 A;  4FRA A;  3RTJ B;  4XFS A;  3FJB A;  3OGF A;  3FJF A;  3V0B A;  41BI A;  1BFG A;  4ASJ A;  1ZJP A;  2Y4J A;  4XWI A;  3RMW A;  5C3D A;  2I7B A;  3OJM A;  5BXC A;  1JY0 A;  4AYL A;  4EEA A;  3N7M A;  1YP2 A;  2FYD B;  5CQM X;  5EJ1 A;  1DZD A;  4I4U A;  1VM8 A;  2OEG A;  3V0M A;  1QWJ A;  3O4C A;  5BOW A;  3NGW A;  1R7X A;  4P02 A;  1Z0H A;  1S0E A;  4USO A;  5HS2 A;  4HO8 A;  4FIY A;  1O7Q A;  5C1G A;  3FJK A;  1WSZ A;  3K1X A;  4FRP A;  4IRP A;  1FWY A;  9ILB A;  1Q04 A;  3HBW A;  1I1B A;  1S0L A;  4Y7U A;  4K6R A;  2D20 A;  3H6S E;  2WVL A;  2J3P A;  4CJ8 A;  3ZXD A;  2NS2 A;  2RJ1 A;  3HAL A;  4O6M A;  5C47 A;  1R7U A;  1V6W A;  2AFG A;  2X5Z A;  3ZC9 A;  3PKQ A;  3Q80 A;  2I1B A;  2DRZ A;  1JTC A;  1BLA A;  3AH4 A;  4F34 A;  1JV1 A;  4QBV A;  5DUY A;  1G0R A;  2APC A;  3ZF8 A;  1IIN A;  1L2H A;  3OBR A;  4II0 A;  1LZJ A;  1S0G A;  2VK9 A;  2WE9 A;  3BTA A;  3I0J A;  4FCU A;  4HO3 A;  2Y4K A;  4L4H A;  3CA5 A;  2D43 A;  2BFH A;  2RG9 B;  2AE7 A;  4EE5 A;  1V6U A;  3N7J A;  2K8R A;  5C3B A;  3N7K A;  5FU0 A;  3B9U A;  3CRH A;  2Y4L A;  1DJS B;  3EE5 A;  3MPP G;  2BEB A;  1ONK B;  4NAI A;  2JCK A;  1W3G A;  1IRA X;  2AXM A;  2OI6 A;  2WVK A;  5C1H A;  2V0H A;  4C2S A;  4OEE A;  4ECM A;  3D7W B;  2X60 A;  1YXW A;  2AAI B;  2GO2 A;  3NBD A;  4QC4 A;  4ZA3 B;  1ZI5 A;  1HJL A;  1IJT A;  4KQL A;  1YTO A;  5EC5 A;  4EFP A;  1FOA A;  5FZY A;  2BO7 A;  4GBP A;  4KT7 A;  3RTI B;  3F1C A;  1BA7 A;  1XZZ A;  4MND A;  2DRE A;  1MD6 A;  1II4 A;  1SR4 C;  5CQN X;  1AF9 A;  2IWT B;  1WBC A;  4LO2 A;  1IIM A;  2X2S A;  1TW1 A;  3BA5 A;  3SX5 A;  1QXM A;  4I0Y A;  4QBC A;  1QG8 A;  3DJ4 A;  3TC2 A;  1H7F A;  3RMY A;  4HO9 A;  5HPZ A;  1PC8 B;  2LIE A;  4EEE B;  2KI6 B;  5D92 A;  4YS8 A;  4FVV A;  3RSB A;  5I1F A;  4KEJ A;  1GX4 A;  2ZR1 B;  4LO3 A;  3N7L A;  4P6A A;  1ZDF A;  2F8X C;  5IDT A;  3ZXG A;  1W77 A;  4Y7F A;  3SXB A;  5C49 A;  5E24 E;  1ZIZ A;  3ZGG A;  2F2F C;  5IDS A;  4AN6 A;  2YES A;  3BAV A;  3PME A;  1R81 A;  2Y7A A;  2VD4 A;  1BFF A;  2ICY A;  2RJ5 A;  4GAF A;  4O6N A;  2KKI A;  2NVH A;  3SNV A;  5BXP A;  3WA1 A;  1P63 A;  4MYB A;  3U2T A;  1H5T B;  2X2T A;  3V90 A;  3UJ4 A;  3P53 A;  1ISX A;  3CU1 B;  1S4O A;  3AJ5 A;  4KPX A;  2HW9 A;  4UEG A;  2RJ0 A;  5I1B A;  3I0K A;  5C38 A;  3WIN C;  3O4O A;  5FTS A;  3SXA A;  2RJ4 A;  3I0E A;  3FUO A;  2VSA A;  3IM5 A;  4OW4 A;  3USR A;  4JKQ A;  1S4N A;  4AYJ A;  1ZCV A;  5C4D A;  4I1E A;  2I5K A;  2VFZ A;  4HOC A;  3SX3 A;  2YUG A;  1JVD A;  3PG0 A;  3AZW A;  1HKN A;  3NBC A;  4G6M A;  3FGM A;  1H7H A;  1H5S C;  1TOO A;  3V0O A;  5L6S A;  4PC4 A;  5BQU A;  2PGV A;  4CJB A;  3LLP A;  5DVH A;  2MZB A;  2L5X A;  1NHE B;  3PKP A;  3U2W A;  3USQ A;  5FNW A;  4ZLB B;  4B2W A;  5BXS A;  3BCV A;  3FJD A;  4J2S A;  5JMC A;  3JUJ A;  1DQG A;  3R3I A;  3U0X A;  1TFM B;  1S0F A;  5BP5 C;  1H4E A;  2YQH A;  4EEG A;  4Q9G A;  4LO1 A;  3BAO A;  1PUM B;  4G6J A;  1VH1 A;  4KEI A;  1N4K A;  1JT7 A;  4FGF A;  1JLY A;  1LL3 A;  1W55 A;  3UJ0 A;  4FRO A;  1S0C A;  1CE7 B;  1JT4 A;  1NMM B;  1JYK A;  1FQ9 A;  3FJC A;  1K5V A;  1GGP B;  1TWE A;  4P0L A;  3D5N A;  1XG6 A;  5J49 A;  4FRL A;  3E25 A;  1ILR 1;  3FJH A;  4Y6U A;  1YBI A;  1G97 A;  21BI A;  1V84 A;  3CA3 A;  1H5R B;  2YCM A;  2D44 A;  2Y6P A;  1MC3 A;  3I0D A;  3VSZ A;  1AVA C;  4TLP A;  4GP3 A;  2VXT I;  5FV9 A;  2E4M C;  3F62 B;  4R6U B;  4Y62 A;  1PZZ A;  2VXR A;  5F8S A;  2QGI A;  3R2W A;  1V6X A;  2VSH A;  1F31 A;  4I3N A;  4JPZ A;  4QAL A;  2GZB A;  1NF5 B;  3V0A B;  4HO4 A;  2QYI B;  4HO2 A;  1D0H A;  3CQA A;  2MC2 A;  2YC5 A;  2M49 A;  4D0T A;  3POL A;  4J23 B;  1ZI4 A;  3FJJ A;  3OH4 A;  2D23 A;  4QO3 A;  1WT1 A;  3ILA A;  1VGU A;  2FYB A;  2Q4J A;  1ISY A;  1O23 B;  2AM4 A;  3V91 A;  2P23 A;  3O49 A;  1FWU A;  4I7I A;  4A7K A;  3R4S A;  4KEK A;  1FR8 A;  2WVM A;  1FV3 A;  1TZF A;  4IZE A;  1EVT A;  2J0B A;  2ZU7 A;  4KRV A;  3ZGF A;  2RJ7 A;  1GWV A;  1E5K A;  4M2A A;  4F83 A;  4I4S A;  1O0R A;  1FGG A;  1O7O A;  4J18 A;  4MZH A;  1G3L A;  2OI7 A;  1AVX B;  2D7I A;  2ZU9 A;  3O4D A;  3JUT A;  4G9M A;  5JQQ A;  1ITB A;  2RIY A;  3O3P A;  1PZT A;  2ZU8 A;  1G1L A;  1K4V A;  4I37 A;  2BO4 A;  3V8Y A;  4QKR A;  3N0K A;  4MZG B;  2WEE A;  1IT0 A;  4Q7C A;  4HG6 A;  2FGF A;  1TVY A;  2JCL A;  3D98 A;  3T8S A;  3WO3 A;  2BO8 A;  2FYC B;  2D22 A;  2K4A B;  1JT3 A;  3AH1 A;  4Q9P A;  1QGQ A;  4FRQ A;  4HO6 A;  4EEM A;  1GQC A;  1HM8 A;  3CKQ A;  1VGT A;  1WT2 A;  4QD2 C;  4UY4 A;  2V0L A;  2E3D A;  2DS0 A;  4FRM A;  4B4M A;  1HWM B;  1ISV A;  4LO7 C;  1MP5 A;  4OWJ A;  2I5E A;  2NYY A;  4I4V A;  5G00 A;  3IOH A;  4G3P A;  3AH2 A;  1IOB A;  3V0L A;  4NAL A;  5EIY A;  1TIE A;  4JKX B;  1H5S B;  1Q03 A;  3OJ2 A;  3OJV A;  3FJ8 A;  4I4R A;  1RZO B;  3I29 B;  3MAL A;  1IHK A;  3NBE A;  2O1F A;  4IRQ A;  2IHO A;  3H6R B;  4Y7T A;  4LO2 C;  2Y9W C;  4D11 C;  1JVG A;  3BX1 C;  5JLV A;  3VT1 A;  1Z90 A;  5DSS B;  1EPW A;  3I0G A;  1HIB A;  4GP0 A;  1IIL A;  4EB2 B;  2OI5 A;  2P73 A;  1YF8 B;  1Z2V A;  2FFU A;  3QYD A;  4DE7 A;  1LL0 A;  3CA4 A;  3E8L C;  4I4P A;  4FRH A;  3SPT A;  3SXC A;  1BAS A;  3FJE A;  4LO3 C;  4HR6 C;  1LZI A;  3O44 A;  5F8W A;  5AJO A;  3O3Q A;  2O1G A;  3V0N A;  4WBC A;  5CMJ A;  4QKS A;  4ZFU B;  2Q9X A;  1WVC A;  1OMX A;  1H5R A;  2GGQ A;  5FTV A;  5BVP I;  3NBN A;  1R7T A;  4ZDQ A;  4ZKT B;  3Q7X A;  2HWA A;  1EYR A;  2WRY A;  2QH5 A;  3FUQ A;  1INJ A;  1BLD A;  4ARW A;  4A7Z A;  4I4Y A;  5C3A A;  1ZJO A;  3R4U A;  2VS3 A;  1LL2 A;  5DZU A;  1PUU B;  4KNX A;  4I8M A;  4OUJ A;  2WBC A;  3HSM A;  1S0B A;  4I6I A;  2OEF A;  1ZJ3 A;  3SXD A;  1A8D A;  3V0B B;  3TZT A;  1JV3 A;  4DCK C;  4EE3 A;  3PUB A;  4GOV A;  1VZT A;  3I2A A;  4LW3 A;  4NAN A;  2X65 A;  3FJI A;  1TW5 A;  3DK5 A;  1FMM S;  1HWN B;  4AAW A;  3AJ6 A;  4X38 A;  1OQM B;  4B4G A;  4GAI A;  2K43 A;  3FJA A;  2XWN A;  3A23 A;  1ZHJ A;  4HO0 A;  4I1B A;  1DLL A;  4DEC A;  1W57 A;  1T9F A;  3K8D A;  4B5B A;  1FXJ A;  2VXM A;  3SXG A;  3VT2 A;  1WT3 A;  4Y7V A;  4I4O A;  2AQZ A;  1FMZ A;  1G93 A;  1WD4 A;  3OAM A;  2F2F A;  4IZX A;  1R8N A;  4AN7 B;  2PA4 A;  2ESU A;  2XOA A;  1H7E A;  2JCO A;  2RIT A;  2FDB M;  1LVW A;  3I0L A;  5DDV A;  1G9R A;  3ST8 A;  2RJ8 A;  2NZ9 A;  1BFC A;  2VXL A;  3U0Y A;  5C4E A;  1ISW A;  3CRI A;  5L6V A;  1PWA A;  4OWK A;  5CQL X;  2LIQ A;  2JCJ A;  2P6W A;  1FR9 A;  1RML A;  3Q7Y A;  3I2X A;  5FZZ A;  3DUV A;  2P39 A;  4X37 A;  3P6J A;  3WIN A;  3F1R A;  5BXT A;  4B4B A;  1EV2 A;  1ZJ1 A;  5FUH A;  2DRY A;  3LTQ A;  4JQ0 A;  2FY7 A;  5C4F A;  4MIX A;  4IQP A;  4Y64 A;  2Z48 A;  1G9B A;  5CMH A;  1LZ0 A;  4QD2 B;  1GX0 A;  3SXE A;  1OQL B;  3BB2 A;  5D62 A;  4LO7 B;  4OWL A;  4D0Z A;  2QN4 A;  4XFU A;  4I4Q A;  5BXR A;  4Y7G A;  2Q3N B;  1GA8 A;  5C36 A;  3RMX A;  3IM7 A;  1E0O A;  4EFQ A;  2Y4M A;  3KIA A;  4EE4 A;  1HWO B;  3RMV A;  4L41 C;  1Q1U A;  1FV2 A;  5C48 A;  4Y6N A;  4J2Y A;  3FOQ A;  2ZQN A;  4LO0 A;  1G82 A;  4Z9W B;  1ZCY A;  1Z4S A;  3IOJ A;  4NAK A;  1XHB A;  1JLX A;  2WGZ A;  2A8U A;  1FGA A;  1AVU A;  1EYL A;  1XYF A;  3W9T A;  5CMI A;  3KMV A;  2RJ9 A;  4G1R A;  3VEQ A;  2P72 A;  3OH0 A;  3BRD A;  3VSF A;  1I1E A;  4FRE A;  4KNR A;  3FJ9 A;  1H7G A;  3CA1 A;  2AEC A;  3IOI A;  1VZU A;  3ZC8 A;  4ZGR B;  4ION A;  1R8O A;  3IIR A;  1G9D A;  1MP4 A;  4EKX B;  1YRO B;  1VGZ A;  2NTD A;  2RJ6 A;  4X39 A;  3FWW A;  4X3A A;  1H7T A;  2XWL A;  1FRW A;  2VSE A;  1ZCU A;  2RIZ A;  4ASY A;  1H7Q A;  3LW6 A;  3BRF A;  4EEO A;  3V79 C;  3QR5 A;  1M2T B;  3K8E A;  2VS5 A;  5CQP A;  4P0J A;  5EJZ A;  3WMU A;  3OC9 A;  2NXV A;  1FO9 A;  4LW6 A;  2KLL A;  4G9N A;  4OEG A;  1S0D A;  2Z86 A;  4G87 A;  4JD0 A;  1H5T A;  3T7M A;  2ICX A;  5D61 A;  1T4Q A;  1R82 A;  4P00 A;  4FQW A;  4HA2 A;  4END A;  1LZ7 A;  3BA4 A;  3CRG A;  1AXM A;  3Q7W A;  3BAQ A;  3CKJ A;  4JIS A;  4XFT A;  3CKN A;  4H04 A;  1HCE A;  1FO8 A; 
#chains in the Genus database with same CATH homology
 1WT0 A;  3Q4S A;  5CQO A;  1NZK A;  3F1Y A;  4EVW A;  3BRK X;  1VIC A;  1ISZ A;  1J0S A;  1R7V A;  3CKV A;  2VS4 A;  1NQI B;  4MZF B;  3CA6 A;  5EHA A;  2AES A;  5C4C A;  3S8J A;  2BEA A;  4KC3 A;  3AKG A;  3VT0 A;  1FGX A;  1YP4 A;  2AH9 A;  2UX8 A;  3PNN A;  3ZLK A;  4I96 A;  3T7O A;  4D8H A;  1INI A;  1QQL A;  2RST A;  2PX7 A;  2KH2 A;  1XZ6 A;  1ZI3 A;  5C1L A;  1G95 A;  4M4K A;  4H9W A;  4M28 A;  2VUA A;  5DDT A;  4E1K A;  3CKO A;  2Z87 A;  1BFB A;  2ZQO A;  2VLC A;  3TQD A;  3OH3 A;  2XMH A;  2KI4 A;  1PZY B;  4G3Q A;  1HV9 A;  1DIW A;  4I4X A;  4IY8 A;  1RG8 A;  3VWC A;  1FZW A;  2FO1 A;  1KWS A;  1QQK A;  1MC9 A;  1VCL A;  4ISR A;  1EZI A;  1HM9 A;  1ABR B;  1SZ6 B;  3FFZ A;  1JQZ A;  4CVH A;  3UD9 A;  3GUE A;  3JRR A;  3AZV A;  1UPS A;  3HOM A;  1G9C A;  4KC2 A;  4R7P A;  4B42 A;  3RSJ A;  4JRA A;  1H5S D;  4KC1 A;  3S8K A;  3D8V A;  4Z8S B;  4DEP A;  2V0I A;  3CAH A;  3O4B A;  1YP3 A;  1VGW A;  8I1B A;  1H4C A;  2Y9X E;  2CU2 A;  2XME A;  4FRB A;  4FRD A;  2Y9F A;  1ZJ0 A;  1FN0 A;  1V6V A;  5F90 A;  2J0A A;  1G2V A;  3U2X A;  3HMY A;  5FZU A;  1DFC A;  3WO4 A;  6I1B A;  4M2B A;  3V0P A;  1S4P A;  3UDA A;  1KNM A;  1NUN A;  2HWM A;  4P0K A;  1AFC A;  3V0A A;  1R80 A;  4ZFY B;  2NM1 A;  1ZI1 A;  2QKX A;  3BAG A;  2PGY A;  3OH1 A;  3HL3 A;  4D11 A;  3C9Z A;  3UD8 A;  1NWG B;  1MP3 A;  5AJP A;  1ON6 A;  2ET2 A;  4FCE A;  5C4B A;  3V0Q A;  2YC3 A;  1SR4 A;  3BA7 A;  4B3U A;  1NKH B;  3Q7U A;  3SX7 A;  5FYE A;  2UUS A;  2Y9G A;  3OBT A;  3I0C A;  4I2S A;  1OMZ A;  1V82 A;  2V0J A;  1HCD A;  4IY9 A;  1DQO A;  3BAH A;  5BQU C;  3BRG C;  1G9A A;  3UD7 A;  1HM0 A;  1W3A A;  2W0W A;  4OEF A;  4GOY A;  2O1H A;  2XWM A;  3E26 A;  1DFQ A;  2MLL B;  3WMV A;  2C0N A;  4Q91 A;  2V0K A;  3CU0 A;  5EG6 C;  1ZDG A;  2WAW A;  3EF2 A;  7I1B A;  4LO1 C;  2AM3 A;  2VU9 A;  1AVW B;  1HWP B;  1QGS A;  4CJM A;  2FYA A;  4DDZ A;  3ZX7 A;  1VPA A;  3OGZ A;  4L4I A;  4D48 A;  2RQ9 A;  1BAR A;  3A22 A;  1TWM A;  2DPW A;  3U2U A;  2GGO A;  1W3F A;  4USP A;  4A7Y A;  1I52 A;  2E8B A;  4KC4 A;  1RY7 A;  5GAQ A;  4Y9X A;  4KBB A;  2YQC A;  1WD3 A;  3NJ5 A;  3I0H A;  2HZ9 A;  3BAU A;  1G23 A;  3IM6 A;  3POK A;  2D7R A;  4ZFW B;  2W0V A;  5FU8 A;  2D0J A;  4HJJ A;  4CJC A;  4J2K A;  4XKI A;  2Z49 A;  3V8Z A;  3U2V A;  3AKI A;  4KXO A;  4DEN A;  1SS9 A;  1V83 A;  1H3M A;  4H75 A;  3O5W B;  2NP0 A;  5FNX A;  4J2X A;  1H5S A;  1H4D A;  3N9W A;  1FWV A;  4G3S A;  4LO0 C;  4ZOT A;  2ERM A;  3QVB A;  5CMF X;  3CA0 A;  3HN1 A;  1CVS A;  1DZC A;  2VSI A;  4HCQ A;  3H6R A;  1GWW A;  3A21 A;  3OKR A;  3O4A A;  4FIX A;  1K5U A;  5AJN A;  1JT5 A;  1FXO A;  5D91 A;  4BQH A;  1ZJ2 A;  3P6I A;  5B2H A;  3H6Q A;  4ISQ A;  3AKF A;  2RIX A;  3OH2 A;  2YQJ A;  5BP5 A;  1JYL A;  2A8W A;  4HO5 A;  5CMG X;  4Y63 A;  1FG5 N;  5F8Y A;  4YOL A;  4JP0 A;  2MIB A;  4KPZ A;  1IRP A;  3IAG C;  1ON8 A;  2X5S A;  3OGG A;  5C8R A;  2BO6 A;  1ZCT A;  1TTU A;  3PHZ A;  3JUK A;  4JAW A;  4EFR A;  1TP0 A;  1VH3 A;  4B2X A;  2AGD A;  3AKH A;  4IHZ A;  3CGX A;  3JTJ A;  5IFY A;  3BAD A;  3WO2 A;  3I0I X;  4BMA A;  2D24 A;  2R9K B;  1VZX A;  4IYB A;  3I0F A;  2FFV A;  31BI A;  2YQS A;  4ZBV B;  1G8O A;  1H7L A;  1HJJ A;  1R7Y A;  1GQ9 A;  4LO8 B;  3A07 A;  3T7N A;  1M16 A;  5D63 A;  3VUO A;  3ZLL A;  1YYN A;  4AC3 A;  3SX8 A;  1WBA A;  2D1Z A;  2E4M A;  2AM5 A;  4FRA A;  3RTJ B;  4XFS A;  3FJB A;  3OGF A;  3FJF A;  3V0B A;  41BI A;  1BFG A;  4ASJ A;  1ZJP A;  2Y4J A;  4XWI A;  3RMW A;  5C3D A;  2I7B A;  3OJM A;  5BXC A;  1JY0 A;  4AYL A;  4EEA A;  3N7M A;  1YP2 A;  2FYD B;  5CQM X;  5EJ1 A;  1DZD A;  4I4U A;  1VM8 A;  2OEG A;  3V0M A;  1QWJ A;  3O4C A;  5BOW A;  3NGW A;  1R7X A;  4P02 A;  1Z0H A;  1S0E A;  4USO A;  5HS2 A;  4HO8 A;  4FIY A;  1O7Q A;  5C1G A;  3FJK A;  1WSZ A;  3K1X A;  4FRP A;  4IRP A;  1FWY A;  9ILB A;  1Q04 A;  3HBW A;  1I1B A;  1S0L A;  4Y7U A;  4K6R A;  2D20 A;  3H6S E;  2WVL A;  2J3P A;  4CJ8 A;  3ZXD A;  2NS2 A;  2RJ1 A;  3HAL A;  4O6M A;  5C47 A;  1R7U A;  1V6W A;  2AFG A;  2X5Z A;  3ZC9 A;  3PKQ A;  3Q80 A;  2I1B A;  2DRZ A;  1JTC A;  1BLA A;  3AH4 A;  4F34 A;  1JV1 A;  4QBV A;  5DUY A;  1G0R A;  2APC A;  3ZF8 A;  1IIN A;  1L2H A;  3OBR A;  4II0 A;  1LZJ A;  1S0G A;  2VK9 A;  2WE9 A;  3BTA A;  3I0J A;  4FCU A;  4HO3 A;  2Y4K A;  4L4H A;  3CA5 A;  2D43 A;  2BFH A;  2RG9 B;  2AE7 A;  4EE5 A;  1V6U A;  3N7J A;  2K8R A;  5C3B A;  3N7K A;  5FU0 A;  3B9U A;  3CRH A;  2Y4L A;  1DJS B;  3EE5 A;  3MPP G;  2BEB A;  1ONK B;  4NAI A;  2JCK A;  1W3G A;  1IRA X;  2AXM A;  2OI6 A;  2WVK A;  5C1H A;  2V0H A;  4C2S A;  4OEE A;  4ECM A;  3D7W B;  2X60 A;  1YXW A;  2AAI B;  2GO2 A;  3NBD A;  4QC4 A;  4ZA3 B;  1ZI5 A;  1HJL A;  1IJT A;  4KQL A;  1YTO A;  5EC5 A;  4EFP A;  1FOA A;  5FZY A;  2BO7 A;  4GBP A;  4KT7 A;  3RTI B;  3F1C A;  1BA7 A;  1XZZ A;  4MND A;  2DRE A;  1MD6 A;  1II4 A;  1SR4 C;  5CQN X;  1AF9 A;  2IWT B;  1WBC A;  4LO2 A;  1IIM A;  2X2S A;  1TW1 A;  3BA5 A;  3SX5 A;  1QXM A;  4I0Y A;  4QBC A;  1QG8 A;  3DJ4 A;  3TC2 A;  1H7F A;  3RMY A;  4HO9 A;  5HPZ A;  1PC8 B;  2LIE A;  4EEE B;  2KI6 B;  5D92 A;  4YS8 A;  4FVV A;  3RSB A;  5I1F A;  4KEJ A;  1GX4 A;  2ZR1 B;  4LO3 A;  3N7L A;  4P6A A;  1ZDF A;  2F8X C;  5IDT A;  3ZXG A;  1W77 A;  4Y7F A;  3SXB A;  5C49 A;  5E24 E;  1ZIZ A;  3ZGG A;  2F2F C;  5IDS A;  4AN6 A;  2YES A;  3BAV A;  3PME A;  1R81 A;  2Y7A A;  2VD4 A;  1BFF A;  2ICY A;  2RJ5 A;  4GAF A;  4O6N A;  2KKI A;  2NVH A;  3SNV A;  5BXP A;  3WA1 A;  1P63 A;  4MYB A;  3U2T A;  1H5T B;  2X2T A;  3V90 A;  3UJ4 A;  3P53 A;  1ISX A;  3CU1 B;  1S4O A;  3AJ5 A;  4KPX A;  2HW9 A;  4UEG A;  2RJ0 A;  5I1B A;  3I0K A;  5C38 A;  3WIN C;  3O4O A;  5FTS A;  3SXA A;  2RJ4 A;  3I0E A;  3FUO A;  2VSA A;  3IM5 A;  4OW4 A;  3USR A;  4JKQ A;  1S4N A;  4AYJ A;  1ZCV A;  5C4D A;  4I1E A;  2I5K A;  2VFZ A;  4HOC A;  3SX3 A;  2YUG A;  1JVD A;  3PG0 A;  3AZW A;  1HKN A;  3NBC A;  4G6M A;  3FGM A;  1H7H A;  1H5S C;  1TOO A;  3V0O A;  5L6S A;  4PC4 A;  5BQU A;  2PGV A;  4CJB A;  3LLP A;  5DVH A;  2MZB A;  2L5X A;  1NHE B;  3PKP A;  3U2W A;  3USQ A;  5FNW A;  4ZLB B;  4B2W A;  5BXS A;  3BCV A;  3FJD A;  4J2S A;  5JMC A;  3JUJ A;  1DQG A;  3R3I A;  3U0X A;  1TFM B;  1S0F A;  5BP5 C;  1H4E A;  2YQH A;  4EEG A;  4Q9G A;  4LO1 A;  3BAO A;  1PUM B;  4G6J A;  1VH1 A;  4KEI A;  1N4K A;  1JT7 A;  4FGF A;  1JLY A;  1LL3 A;  1W55 A;  3UJ0 A;  4FRO A;  1S0C A;  1CE7 B;  1JT4 A;  1NMM B;  1JYK A;  1FQ9 A;  3FJC A;  1K5V A;  1GGP B;  1TWE A;  4P0L A;  3D5N A;  1XG6 A;  5J49 A;  4FRL A;  3E25 A;  1ILR 1;  3FJH A;  4Y6U A;  1YBI A;  1G97 A;  21BI A;  1V84 A;  3CA3 A;  1H5R B;  2YCM A;  2D44 A;  2Y6P A;  1MC3 A;  3I0D A;  3VSZ A;  1AVA C;  4TLP A;  4GP3 A;  2VXT I;  5FV9 A;  2E4M C;  3F62 B;  4R6U B;  4Y62 A;  1PZZ A;  2VXR A;  5F8S A;  2QGI A;  3R2W A;  1V6X A;  2VSH A;  1F31 A;  4I3N A;  4JPZ A;  4QAL A;  2GZB A;  1NF5 B;  3V0A B;  4HO4 A;  2QYI B;  4HO2 A;  1D0H A;  3CQA A;  2MC2 A;  2YC5 A;  2M49 A;  4D0T A;  3POL A;  4J23 B;  1ZI4 A;  3FJJ A;  3OH4 A;  2D23 A;  4QO3 A;  1WT1 A;  3ILA A;  1VGU A;  2FYB A;  2Q4J A;  1ISY A;  1O23 B;  2AM4 A;  3V91 A;  2P23 A;  3O49 A;  1FWU A;  4I7I A;  4A7K A;  3R4S A;  4KEK A;  1FR8 A;  2WVM A;  1FV3 A;  1TZF A;  4IZE A;  1EVT A;  2J0B A;  2ZU7 A;  4KRV A;  3ZGF A;  2RJ7 A;  1GWV A;  1E5K A;  4M2A A;  4F83 A;  4I4S A;  1O0R A;  1FGG A;  1O7O A;  4J18 A;  4MZH A;  1G3L A;  2OI7 A;  1AVX B;  2D7I A;  2ZU9 A;  3O4D A;  3JUT A;  4G9M A;  5JQQ A;  1ITB A;  2RIY A;  3O3P A;  1PZT A;  2ZU8 A;  1G1L A;  1K4V A;  4I37 A;  2BO4 A;  3V8Y A;  4QKR A;  3N0K A;  4MZG B;  2WEE A;  1IT0 A;  4Q7C A;  4HG6 A;  2FGF A;  1TVY A;  2JCL A;  3D98 A;  3T8S A;  3WO3 A;  2BO8 A;  2FYC B;  2D22 A;  2K4A B;  1JT3 A;  3AH1 A;  4Q9P A;  1QGQ A;  4FRQ A;  4HO6 A;  4EEM A;  1GQC A;  1HM8 A;  3CKQ A;  1VGT A;  1WT2 A;  4QD2 C;  4UY4 A;  2V0L A;  2E3D A;  2DS0 A;  4FRM A;  4B4M A;  1HWM B;  1ISV A;  4LO7 C;  1MP5 A;  4OWJ A;  2I5E A;  2NYY A;  4I4V A;  5G00 A;  3IOH A;  4G3P A;  3AH2 A;  1IOB A;  3V0L A;  4NAL A;  5EIY A;  1TIE A;  4JKX B;  1H5S B;  1Q03 A;  3OJ2 A;  3OJV A;  3FJ8 A;  4I4R A;  1RZO B;  3I29 B;  3MAL A;  1IHK A;  3NBE A;  2O1F A;  4IRQ A;  2IHO A;  3H6R B;  4Y7T A;  4LO2 C;  2Y9W C;  4D11 C;  1JVG A;  3BX1 C;  5JLV A;  3VT1 A;  1Z90 A;  5DSS B;  1EPW A;  3I0G A;  1HIB A;  4GP0 A;  1IIL A;  4EB2 B;  2OI5 A;  2P73 A;  1YF8 B;  1Z2V A;  2FFU A;  3QYD A;  4DE7 A;  1LL0 A;  3CA4 A;  3E8L C;  4I4P A;  4FRH A;  3SPT A;  3SXC A;  1BAS A;  3FJE A;  4LO3 C;  4HR6 C;  1LZI A;  3O44 A;  5F8W A;  5AJO A;  3O3Q A;  2O1G A;  3V0N A;  4WBC A;  5CMJ A;  4QKS A;  4ZFU B;  2Q9X A;  1WVC A;  1OMX A;  1H5R A;  2GGQ A;  5FTV A;  5BVP I;  3NBN A;  1R7T A;  4ZDQ A;  4ZKT B;  3Q7X A;  2HWA A;  1EYR A;  2WRY A;  2QH5 A;  3FUQ A;  1INJ A;  1BLD A;  4ARW A;  4A7Z A;  4I4Y A;  5C3A A;  1ZJO A;  3R4U A;  2VS3 A;  1LL2 A;  5DZU A;  1PUU B;  4KNX A;  4I8M A;  4OUJ A;  2WBC A;  3HSM A;  1S0B A;  4I6I A;  2OEF A;  1ZJ3 A;  3SXD A;  1A8D A;  3V0B B;  3TZT A;  1JV3 A;  4DCK C;  4EE3 A;  3PUB A;  4GOV A;  1VZT A;  3I2A A;  4LW3 A;  4NAN A;  2X65 A;  3FJI A;  1TW5 A;  3DK5 A;  1FMM S;  1HWN B;  4AAW A;  3AJ6 A;  4X38 A;  1OQM B;  4B4G A;  4GAI A;  2K43 A;  3FJA A;  2XWN A;  3A23 A;  1ZHJ A;  4HO0 A;  4I1B A;  1DLL A;  4DEC A;  1W57 A;  1T9F A;  3K8D A;  4B5B A;  1FXJ A;  2VXM A;  3SXG A;  3VT2 A;  1WT3 A;  4Y7V A;  4I4O A;  2AQZ A;  1FMZ A;  1G93 A;  1WD4 A;  3OAM A;  2F2F A;  4IZX A;  1R8N A;  4AN7 B;  2PA4 A;  2ESU A;  2XOA A;  1H7E A;  2JCO A;  2RIT A;  2FDB M;  1LVW A;  3I0L A;  5DDV A;  1G9R A;  3ST8 A;  2RJ8 A;  2NZ9 A;  1BFC A;  2VXL A;  3U0Y A;  5C4E A;  1ISW A;  3CRI A;  5L6V A;  1PWA A;  4OWK A;  5CQL X;  2LIQ A;  2JCJ A;  2P6W A;  1FR9 A;  1RML A;  3Q7Y A;  3I2X A;  5FZZ A;  3DUV A;  2P39 A;  4X37 A;  3P6J A;  3WIN A;  3F1R A;  5BXT A;  4B4B A;  1EV2 A;  1ZJ1 A;  5FUH A;  2DRY A;  3LTQ A;  4JQ0 A;  2FY7 A;  5C4F A;  4MIX A;  4IQP A;  4Y64 A;  2Z48 A;  1G9B A;  5CMH A;  1LZ0 A;  4QD2 B;  1GX0 A;  3SXE A;  1OQL B;  3BB2 A;  5D62 A;  4LO7 B;  4OWL A;  4D0Z A;  2QN4 A;  4XFU A;  4I4Q A;  5BXR A;  4Y7G A;  2Q3N B;  1GA8 A;  5C36 A;  3RMX A;  3IM7 A;  1E0O A;  4EFQ A;  2Y4M A;  3KIA A;  4EE4 A;  1HWO B;  3RMV A;  4L41 C;  1Q1U A;  1FV2 A;  5C48 A;  4Y6N A;  4J2Y A;  3FOQ A;  2ZQN A;  4LO0 A;  1G82 A;  4Z9W B;  1ZCY A;  1Z4S A;  3IOJ A;  4NAK A;  1XHB A;  1JLX A;  2WGZ A;  2A8U A;  1FGA A;  1AVU A;  1EYL A;  1XYF A;  3W9T A;  5CMI A;  3KMV A;  2RJ9 A;  4G1R A;  3VEQ A;  2P72 A;  3OH0 A;  3BRD A;  3VSF A;  1I1E A;  4FRE A;  4KNR A;  3FJ9 A;  1H7G A;  3CA1 A;  2AEC A;  3IOI A;  1VZU A;  3ZC8 A;  4ZGR B;  4ION A;  1R8O A;  3IIR A;  1G9D A;  1MP4 A;  4EKX B;  1YRO B;  1VGZ A;  2NTD A;  2RJ6 A;  4X39 A;  3FWW A;  4X3A A;  1H7T A;  2XWL A;  1FRW A;  2VSE A;  1ZCU A;  2RIZ A;  4ASY A;  1H7Q A;  3LW6 A;  3BRF A;  4EEO A;  3V79 C;  3QR5 A;  1M2T B;  3K8E A;  2VS5 A;  5CQP A;  4P0J A;  5EJZ A;  3WMU A;  3OC9 A;  2NXV A;  1FO9 A;  4LW6 A;  2KLL A;  4G9N A;  4OEG A;  1S0D A;  2Z86 A;  4G87 A;  4JD0 A;  1H5T A;  3T7M A;  2ICX A;  5D61 A;  1T4Q A;  1R82 A;  4P00 A;  4FQW A;  4HA2 A;  4END A;  1LZ7 A;  3BA4 A;  3CRG A;  1AXM A;  3Q7W A;  3BAQ A;  3CKJ A;  4JIS A;  4XFT A;  3CKN A;  4H04 A;  1HCE A;  1FO8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...