2D7IA

Crystal structure of pp-galnac-t10 with udp, galnac and mn2+
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
536
structure length
536
Chain Sequence
GQKLKDWHDKEAIRRDAQRVGNGEQGRPYPMTDAERVDQAYRENGFNIYVSDKISLNRSLPDIRHPNCNSKRYLETLPNTSIIIPFHNEGWSSLLRTVHSVLNRSPPELVAEIVLVDDFSDREHLKKPLEDYMALFPSVRILRTKKREGLIRTRMLGASVATGDVITFLDSHCEANVNWLPPLLDRIARNRKTIVCPMIDVIDHDDFRYETQAGDAMRGAFDWEMYYKRIPIPPELQKADPSDPFESPVMAGGLFAVDRKWFWELGGYDPGLEIWGGEQYEISFKVWMCGGRMEDIPCSRVGHIYRKYVPYKVPAGVSLARNLKRVAEVWMDEYAEYIYQRRPEYRHLSAGDVAVQKKLRSSLNCKSFKWFMTKIAWDLPKFYPPVEPPAAAWGEIRNVGTGLCADTKHGALGSPLRLEGCVRGRGEAAWNNMQVFTFTWREDIRPGDPQHTKKFCFDAISHTSPVTLYDCHSMKGNQLWKYRKDKTLYHPVSGSCMDCSESDHRIFMNTCNPSSLTQQWLFEHTNSTVLEKFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transferase
molecule keywords Polypeptide N-acetylgalactosaminyltransferase 10
publication title Structural basis of carbohydrate transfer activity by human UDP-GalNAc: polypeptide alpha-N-acetylgalactosaminyltransferase (pp-GalNAc-T10)
pubmed doi rcsb
source organism Homo sapiens
total genus 157
structure length 536
sequence length 536
ec nomenclature ec 2.4.1.41: Polypeptide N-acetylgalactosaminyltransferase.
pdb deposition date 2005-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00535 Glycos_transf_2 Glycosyl transferase family 2
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2d7iA02
3.90.550.10 Alpha Beta Alpha-Beta Complex Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 2d7iA01
3WA1A 3P6IA 3A22A 1FXJA 2APCA 4I96A 4J2YA 4I4PA 3T8SA 3F1CA 2AAIB 5FTSA 3Q7YA 4M2AA 4R6UB 5B2HA 1G9BA 2F2FC 2QYIB 1AVXB 4G3SA 4LW6A 3OJVA 3WINA 4HO6A 4IY9A 1H7LA 2I7BA 2XMHA 1BFBA 1H5TA 5C8RA 3OJMA 3WO3A 3I0IX 2VLCA 4EE3A 1JLYA 1BA7A 1Z0HA 2VXTI 5BVPI 4JISA 5FV9A 1LL3A 3SX7A 4HO8A 3FOQA 2VSIA 2NZ9A 4EE5A 2UUSA 2E4MA 4CJMA 1G9RA 4EVWA 3CA3A 5AJPA 4GOVA 3V0OA 2Y9FA 3HBWA 3H6SE 1ISWA 1IILA 2AXMA 3ZXDA 4X37A 1IT0A 3V0AB 1LZ0A 3RMYA 4F83A 3DJ4A 4B4BA 5C3DA 2AECA 2DPWA 4D48A 1FWUA 2MIBA 1FR8A 4Y9XA 4DECA 1G97A 4OEFA 3BAQA 4L4HA 4I4SA 1G93A 5CQNX 1TOOA 3BRDA 3PKQA 2RIYA 1A8DA 2Q3NB 3FJFA 1HV9A 3BAOA 1K4VA 1FO8A 3OH4A 3QR5A 3BRKX 4B5BA 1V6XA 4I0YA 3UD9A 3NBEA 5C1GA 7I1BA 2D7IA 2DS0A 3A23A 4F34A 4FCEA 3VSZA 5DDVA 5C4BA 1ZI5A 2OI7A 2VU9A 3U0YA 1AVAC 2HZ9A 3FUQA 4X39A 4IONA 1ILR1 1HJJA 1H5SC 4PC4A 4KC1A 4GAIA 3V0BB 2RJ4A 4XWIA 1OMXA 1WBCA 5CQMX 2RJ5A 1G0RA 1ZI3A 1FGXA 2HWAA 4A7ZA 3UD7A 1QQKA 2P6WA 1H5SD 1MP5A 1XZZA 2J3PA 1T4QA 4EEMA 1FWYA 1PUUB 3BRGC 1ZDGA 3IAGC 1V6WA 2GGQA 3BAVA 3CQAA 2GGOA 1PC8B 2I5KA 2X5SA 3OKRA 1G9AA 4FRDA 3WINC 4Q9PA 4HO3A 1Q1UA 4WBCA 5EHAA 1ZJ0A 3KIAA 2YESA 4EFQA 1G3LA 3ZLKA 3HOMA 4LO3A 2OEGA 1I1BA 1Q04A 2ET2A 4I3NA 4Y6UA 4QBCA 4KC4A 2VSHA 3CA5A 4M28A 3T7MA 4XFSA 3I0DA 4IRQA 3WMUA 4OWKA 1H7HA 3V0NA 4A7YA 4CJBA 1H4DA 3U2VA 1JYLA 3NJ5A 3HSMA 2MC2A 1HJLA 4FROA 1H5SB 3WO4A 1S0DA 3FFZA 1QGSA 3CKOA 1WT0A 2MLLB 3T7NA 4M2BA 1S0BA 5L6VA 2RITA 4EEGA 1MD6A 2X5ZA 2XOAA 4J18A 3SXAA 1TZFA 3PNNA 3IM6A 1FXOA 2O1HA 1V82A 4IZEA 1HM8A 1NF5B 3FJIA 3CRIA 3CGXA 6I1BA 1R81A 5I1FA 3CKJA 1G82A 1ZJPA 4J2KA 3NGWA 1OQMB 4DDZA 4IZXA 1SS9A 4IRPA 2WBCA 1V83A 1DFQA 3RMXA 5FU0A 2YUGA 5BQUA 3WMVA 1LVWA 5C47A 1WT2A 1BFCA 1SZ6B 1VGZA 2P73A 3E8LC 4NANA 4I4UA 3BAUA 4I4QA 1FWVA 1ISYA 2NTDA 1H7GA 1XZ6A 4FRAA 4NAKA 2WVLA 3Q4SA 1TP0A 1WBAA 3CRHA 4I2SA 3N7MA 2YCMA 3OH0A 1KNMA 1IJTA 2ZQNA 1YP2A 5DUYA 1DZCA 1QWJA 1ZIZA 5EG6C 3I2AA 4Q91A 2WEEA 1V84A 3FJJA 3O49A 4FVVA 4C2SA 4ZGRB 3P6JA 4IHZA 3OBRA 5DVHA 2YQHA 3VWCA 3VT1A 3RMVA 1PUMB 4LO0C 5C1HA 4E1KA 1S4PA 1MP4A 3CKVA 3N9WA 4KC2A 4KEKA 3USRA 4BMAA 1I52A 3PUBA 4OEGA 1EV2A 3O3PA 4KT7A 4B42A 4EKXB 2P72A 4HG6A 1EVTA 1L2HA 2FGFA 1S0GA 2Z49A 4LO8B 1FQ9A 4JQ0A 1BFGA 4L41C 2VS3A 5C36A 1F31A 3B9UA 4ENDA 5C3BA 1YROB 2NYYA 2PA4A 3U2TA 1TWEA 4YS8A 4I7IA 3SXBA 1FR9A 1PZZA 1QGQA 3U2UA 3E26A 1NQIB 1O0RA 3CAHA 3ZXGA 1G2VA 3I0JA 2Z48A 1DFCA 4P0JA 5D61A 3OGFA 4I37A 3RSJA 2KI6B 3OH1A 1GX0A 1JYKA 3H6RB 1R7YA 4JKQA 1ZJOA 2PX7A 1YTOA 3CRGA 1DIWA 2PGYA 2ESUA 2VS5A 3I0CA 1YF8B 3K1XA 1DLLA 5F8SA 3VSFA 1AF9A 5BXPA 1EYRA 4JPZA 2BO6A 5BP5C 2Y7AA 5BXCA 1GWVA 1FN0A 3BAHA 1UPSA 4II0A 4ZBVB 4HJJA 1H5RA 1I1EA 1HM9A 3VEQA 2AM5A 3FJCA 3N7KA 5E24E 4Y6NA 4CJ8A 1XG6A 3I0FA 1CE7B 3D8VA 5I1BA 3I29B 1G9DA 2LIQA 1QQLA 4XFUA 4I4VA 2FFVA 5D62A 4I4YA 4QALA 3H6QA 3MALA 3I0GA 2AFGA 3BX1C 2JCOA 2V0HA 2E8BA 3IOHA 5JQQA 4Y7VA 1VGWA 3AJ5A 2MZBA 4LO2C 3OBTA 4ECMA 2BFHA 1R80A 2RQ9A 3OJ2A 1W57A 1FV3A 3A07A 2V0KA 4KNRA 3F1RA 1ZJ3A 4HR6C 1YBIA 4KEIA 2NP0A 3Q80A 4KEJA 2X2SA 1YP4A 3F62B 4D0ZA 2P39A 1BASA 1J0SA 3UDAA 3RTJB 4ZKTB 3O4AA 1OMZA 4QD2C 1W3AA 1VM8A 2UX8A 3PKPA 1DJSB 1JT4A 4B4MA 5EIYA 4B2WA 1Z2VA 1NUNA 3CU1B 2Z86A 2D44A 2F8XC 1G95A 3AZWA 3V0MA 4CVHA 3LLPA 5C38A 1NKHB 3CU0A 4I1EA 3V0PA 2RIZA 4UEGA 1ISVA 4P0LA 1D0HA 2RJ9A 2WE9A 4BQHA 1AFCA 3BB2A 4I4RA 3SNVA 1WT3A 3R4SA 4I1BA 1VH1A 2JCLA 1JT3A 1T9FA 4DCKC 1ON6A 1R7VA 3AJ6A 1VGUA 2K8RA 2JCKA 4EB2B 2KH2A 4G6JA 4GOYA 2P23A 5CQOA 4G9NA 4DENA 4J2SA 2AM4A 2QGIA 2ERMA 1YYNA 2WAWA 2PGVA 2JCJA 5C4EA 4JP0A 4AN6A 1H3MA 2Y6PA 3AZVA 3P53A 3CA6A 5BXRA 5IDSA 3MPPG 5AJNA 3FJEA 4QD2B 4XFTA 3NBNA 3O4DA 4KBBA 3FJBA 1VGTA 4P00A 2FYBA 4DE7A 2E4MC 3TZTA 3HMYA 1K5UA 3POKA 1GWWA 5G00A 3IIRA 1NHEB 3FWWA 4FRPA 4G87A 4Q9GA 1INIA 4K6RA 3UJ0A 3AKHA 1R82A 3OH2A 4CJCA 1NZKA 1O7OA 3VT2A 1ZI1A 2X2TA 4AN7B 5EJZA 3A21A 1YP3A 4B2XA 2AESA 4EEAA 3SXDA 2VUAA 2Y4MA 3FJAA 1S4OA 1NWGB 1JQZA 3BADA 3ZF8A 3SXGA 3HL3A 2ZU7A 1QXMA 4ISRA 1BLDA 1ZCTA 2OI5A 4FRHA 4X38A 2XWNA 4FGFA 3I2XA 1IRAX 2DRZA 3BRFA 4FQWA 1MC9A 3I0EA 2KKIA 3ZGGA 1H5TB 4IYBA 4EEEB 4P02A 1RY7A 1VPAA 1H7FA 1II4A 4I4XA 4D8HA 4J2XA 2Y4LA 5CMFX 4ASYA 4D11A 3O4BA 4LO0A 4QO3A 2GO2A 3Q7XA 1QG8A 4YOLA 1FGGA 3JUKA 2FFUA 1ONKB 1S0CA 2O1GA 2D20A 2HW9A 3EE5A 4Y62A 4ZOTA 5C3AA 1BARA 2YQCA 1GGPB 5JMCA 3TQDA 1BFFA 1PWAA 1Z4SA 2BEBA 3O4CA 3NBCA 4ISQA 2FDBM 1ITBA 1WD3A 41BIA 1DQOA 1TW5A 1TVYA 5C49A 2RJ7A 1IOBA 1ZJ2A 4ARWA 1SR4A 2KLLA 3BAGA 4JAWA 4OEEA 1H4CA 3ZGFA 2AH9A 3SX5A 3RTIB 3KMVA 1TWMA 1ZI4A 3IM5A 4LO3C 3DK5A 3JUTA 3V0BA 4EEOA 1JV1A 1LZ7A 5AJOA 1KWSA 1V6UA 1XYFA 3AH2A 1EPWA 5C4DA 4QBVA 3CA0A 2YC5A 3QVBA 1ISXA 4LW3A 3FJ9A 4M4KA 2A8WA 1V6VA 5HPZA 1HWNB 1IRPA 3K8EA 2Q9XA 1VCLA 1JT7A 3K8DA 1HWPB 4A7KA 4G3QA 4I8MA 1M16A 1IHKA 1S0FA 5DDTA 2W0WA 1HKNA 3I0KA 3RSBA 1ABRB 2I1BA 2W0VA 3R4UA 2DREA 3JRRA 3S8JA 1GQCA 4B4GA 3QYDA 3D7WB 2D0JA 3F1YA 3PG0A 5CQLX 3U2XA 4GP3A 3AH4A 2E3DA 1H5SA 1HM0A 1WVCA 3FGMA 2D22A 4LO7C 2BO4A 5BQUC 2OEFA 2QKXA 4FRQA 1RG8A 1CVSA 3S8KA 1ZCUA 5FNWA 4ZFUB 5C4FA 2YQSA 3FJ8A 5BXSA 1VH3A 4FRMA 1NMMB 3OH3A 2R9KB 1W77A 2FYDB 5FTVA 5J49A 3HN1A 1PZYB 2Q4JA 1WT1A 3LW6A 5GAQA 3VUOA 1JY0A 3R3IA 3EF2A 1TIEA 2AQZA 3V8YA 1SR4C 3AKIA 4IQPA 4KPZA 4EFRA 2VXRA 1WD4A 4EE4A 3FJHA 2Y9XE 3NBDA 1LZIA 1G9CA 4KPXA 5FUHA 3USQA 1VZTA 2Y4KA 1FV2A 3CKQA 3O5WB 1VZXA 1IINA 2GZBA 3WO2A 1W3FA 3N0KA 4G6MA 3VT0A 4QC4A 1JVGA 2VXLA 2Y9WC 4Y64A 4LO7B 1R7XA 4Y7GA 4HO5A 2CU2A 1FO9A 2ICYA 2RJ8A 2ICXA 1BLAA 5F8WA 4LO1A 3LTQA 3SXCA 1TW1A 1DQGA 3JUJA 4ZDQA 2O1FA 2AM3A 3BA4A 3Q7WA 3V8ZA 4Z9WB 4DEPA 1LL2A 3U0XA 4OUJA 2ZR1B 1DZDA 1FMZA 2NM1A 1ZHJA 2DRYA 2VFZA 3PHZA 1JTCA 1R8OA 3W9TA 1R7TA 1S4NA 3I0LA 1JT5A 3RMWA 3AH1A 1AVUA 5F90A 1EZIA 4QKRA 4NALA 1MP3A 2RJ0A 4B3UA 3ILAA 5FYEA 1INJA 1HWOB 3D98A 1S0EA 1FGAA 2IWTB 3O4OA 2D23A 2D7RA 3OGGA 1MC3A 4KQLA 2BO8A 2BO7A 4USOA 2BEAA 2YC3A 5HS2A 4I4OA 2OI6A 2WGZA 4H04A 5FZYA 1FZWA 3ST8A 4OW4A 5CMHA 5BXTA 2YQJA 3TC2A 1E0OA 4AYLA 1K5VA 3H6RA 5JLVA 4JKXB 1P63A 4ZFWB 1HWMB 2A8UA 4Z8SB 2RJ1A 1S0LA 9ILBA 3CKNA 3D5NA 2AGDA 3R2WA 4Y63A 5EJ1A 5L6SA 3IM7A 2LIEA 4G9MA 4XKIA 2RJ6A 2RG9B 2KI4A 2D1ZA 3N7JA 4GAFA 4I6IA 3BA5A 4ZA3B 1ZCVA 2VD4A 2XWMA 4IY8A 3I0HA 4R7PA 4G1RA 3IOJA 3V90A 5DZUA 3V91A 3JTJA 5CMIA 3CA1A 1W55A 1OQLB 2RSTA 1TTUA 2ZU8A 5EC5A 2L5XA 4QKSA 1O23B 2V0LA 2ZU9A 3E25A 3OC9A 1WSZA 4HO9A 5FU8A 1PZTA 2WRYA 3V0AA 3UD8A 1VZUA 4FRBA 3SX8A 1H5RB 2FY7A 3V0LA 5IFYA 3ZX7A 3BCVA 5FNXA 1W3GA 1GX4A 4OWLA 4LO1C 3AKGA 5IDTA 1EYLA 2VXMA 1RZOB 3UJ4A 5C4CA 1Q03A 1E5KA 4USPA 2X60A 3T7OA 4ZFYB 2D24A 1FRWA 1G1LA 4Y7UA 4GP0A 3Q7UA 3OAMA 4FCUA 1M2TB 1GQ9A 1LL0A 4ZLBB 1HIBA 2F2FA 5FZUA 5FZZA 1IIMA 1GA8A 2I5EA 31BIA 4X3AA 2WVMA 1ISZA 2Y4JA 3POLA 1H7QA 1H4EA 5D63A 5BP5A 5C1LA 4EFPA 1AVWB 2XWLA 1G8OA 1ON8A 5CMJA 2FO1A 3AKFA 4GBPA 2NVHA 1JV3A 4P6AA 4FREA 2V0JA 4HOCA 5CMGX 4JD0A 4AC3A 4MYBA 1FOAA 1Z90A 1R8NA 3CA4A 3N7LA 4HA2A 1ZCYA 8I1BA 2V0IA 1LZJA 3O44A 4NAIA 1AXMA 4KC3A 3FUOA 1XHBA 2QH5A 1HCEA 2NXVA 2XMEA 1G23A 3DUVA 2VS4A 1FMMS 1JLXA 1ZJ1A 2WVKA 4G3PA 2D43A 4HO4A 1VICA 4LO2A 4L4IA 2K4AB 4HCQA 2Z87A 5C48A 1FG5N 4Y7FA 3BA7A 1ZDFA 3ZC9A 1N4KA 2VSAA 4KNXA 5DSSB 3ZLLA 4JRAA 1TFMB 2ZQOA 4KXOA 4J23B 4ASJA 2VSEA 3PMEA 2HWMA 4KRVA 3GUEA 3OGZA 4H9WA 4FRLA 5F8YA 2FYCB 1H7EA 2IHOA 21BIA 3BTAA 4TLPA 1R7UA 3SXEA 4D0TA 3V0QA 1RMLA 3HALA 3ZC8A 5BOWA 1JVDA 3U2WA 1HCDA 4HO0A 2Y9GA 4OWJA 4HO2A 3FJDA 1YXWA 2M49A 3V79C 2QN4A 2FYAA 3SX3A 3FJKA 4P0KA 4MNDA 2AE7A 4AYJA 3O3QA 2X65A 4Y7TA 4AAWA 3SPTA 1O7QA 5CQPA 4D11C 2RIXA 3C9ZA 2K43A 1H7TA 3IOIA
chains in the Genus database with same CATH superfamily
3WA1A 3P6IA 3A22A 1FXJA 2APCA 4I96A 4J2YA 4I4PA 3T8SA 3F1CA 2AAIB 5FTSA 3Q7YA 4M2AA 4R6UB 5B2HA 1G9BA 2F2FC 2QYIB 1AVXB 4G3SA 4LW6A 3OJVA 3WINA 4HO6A 4IY9A 1H7LA 2I7BA 2XMHA 1BFBA 1H5TA 5C8RA 3OJMA 3WO3A 3I0IX 2VLCA 4EE3A 1JLYA 1BA7A 1Z0HA 2VXTI 5BVPI 4JISA 5FV9A 1LL3A 2VK9A 3SX7A 4HO8A 3FOQA 2VSIA 2NZ9A 2J0BA 4EE5A 2UUSA 2E4MA 4CJMA 1G9RA 4EVWA 3CA3A 5AJPA 4GOVA 3V0OA 2Y9FA 3HBWA 3H6SE 1ISWA 1IILA 2AXMA 3ZXDA 4X37A 1IT0A 3V0AB 1LZ0A 3RMYA 4F83A 3DJ4A 4B4BA 5C3DA 2AECA 2DPWA 4D48A 1FWUA 2MIBA 1FR8A 4Y9XA 4DECA 1G97A 4OEFA 3BAQA 4L4HA 4I4SA 1G93A 5CQNX 1TOOA 3BRDA 3PKQA 2RIYA 1A8DA 2Q3NB 3FJFA 1HV9A 3BAOA 1K4VA 1FO8A 3OH4A 3QR5A 3BRKX 4B5BA 1V6XA 4I0YA 3UD9A 3NBEA 5C1GA 7I1BA 2D7IA 2DS0A 3A23A 4F34A 4FCEA 3VSZA 5DDVA 5C4BA 1ZI5A 2OI7A 2VU9A 3U0YA 1AVAC 2HZ9A 3FUQA 4X39A 4IONA 1ILR1 1HJJA 1H5SC 4PC4A 4KC1A 4GAIA 3V0BB 2RJ4A 4XWIA 1OMXA 1WBCA 5CQMX 2RJ5A 1G0RA 1ZI3A 1FGXA 2HWAA 4A7ZA 3UD7A 1QQKA 2P6WA 1H5SD 1MP5A 1XZZA 2J3PA 1T4QA 4EEMA 1FWYA 1PUUB 3BRGC 1ZDGA 3IAGC 1V6WA 2GGQA 3BAVA 3CQAA 2GGOA 1PC8B 2I5KA 2X5SA 3OKRA 1G9AA 4FRDA 3WINC 4Q9PA 4HO3A 1Q1UA 4WBCA 5EHAA 1ZJ0A 3KIAA 2YESA 4EFQA 1G3LA 3ZLKA 3HOMA 4LO3A 2OEGA 1I1BA 1Q04A 2ET2A 4I3NA 4Y6UA 4QBCA 4KC4A 2VSHA 3CA5A 4M28A 3T7MA 4XFSA 3I0DA 4IRQA 3WMUA 4OWKA 1H7HA 3V0NA 4A7YA 4CJBA 1H4DA 3U2VA 1JYLA 3NJ5A 3HSMA 2MC2A 1HJLA 4FROA 1H5SB 3WO4A 1S0DA 3FFZA 1QGSA 3CKOA 1WT0A 2MLLB 3T7NA 4M2BA 1S0BA 5L6VA 2RITA 4EEGA 1MD6A 2X5ZA 2XOAA 4FIXA 4J18A 3SXAA 1TZFA 3PNNA 3IM6A 1FXOA 2O1HA 1V82A 4IZEA 1HM8A 1NF5B 3FJIA 3CRIA 3CGXA 6I1BA 1R81A 5I1FA 3CKJA 1G82A 1ZJPA 4J2KA 4O6NA 3NGWA 1OQMB 4DDZA 4IZXA 1SS9A 4IRPA 2WBCA 1V83A 1DFQA 3RMXA 5FU0A 2YUGA 5BQUA 3WMVA 1LVWA 5C47A 1WT2A 1BFCA 1SZ6B 1VGZA 2P73A 3E8LC 4NANA 4I4UA 3BAUA 4I4QA 1FWVA 1ISYA 2NTDA 4MZHA 1H7GA 1XZ6A 4FRAA 2WVLA 3Q4SA 1TP0A 1WBAA 3CRHA 4I2SA 3N7MA 2YCMA 3OH0A 1KNMA 1IJTA 2ZQNA 1YP2A 5DUYA 1DZCA 1QWJA 1ZIZA 5EG6C 3I2AA 4Q91A 2WEEA 1V84A 3FJJA 3O49A 4FVVA 4C2SA 4ZGRB 3P6JA 4IHZA 3OBRA 5DVHA 2YQHA 3VWCA 3VT1A 3RMVA 1PUMB 4LO0C 5C1HA 4E1KA 1S4PA 1MP4A 3CKVA 3N9WA 4KC2A 4KEKA 3USRA 4BMAA 1I52A 3PUBA 4OEGA 1EV2A 3O3PA 4KT7A 4B42A 4EKXB 2P72A 4HG6A 1EVTA 1L2HA 2FGFA 1S0GA 2Z49A 4LO8B 1FQ9A 4JQ0A 1BFGA 4L41C 2VS3A 5C36A 1F31A 3B9UA 4ENDA 5C3BA 1YROB 2NYYA 2PA4A 3U2TA 1TWEA 4YS8A 4I7IA 3SXBA 1FR9A 1PZZA 1QGQA 3U2UA 3E26A 1NQIB 1O0RA 3CAHA 3ZXGA 1G2VA 3I0JA 5D92A 2Z48A 1DFCA 4P0JA 5D61A 3OGFA 4I37A 3RSJA 2KI6B 3OH1A 1GX0A 1JYKA 3H6RB 1R7YA 4JKQA 1ZJOA 2PX7A 1YTOA 3CRGA 1DIWA 2PGYA 2ESUA 2VS5A 3I0CA 1YF8B 3K1XA 1DLLA 5F8SA 3VSFA 1AF9A 5BXPA 1EYRA 4JPZA 2BO6A 5BP5C 2Y7AA 5BXCA 1GWVA 1FN0A 3BAHA 1UPSA 4II0A 4ZBVB 4HJJA 1H5RA 1I1EA 1HM9A 3VEQA 2AM5A 3FJCA 3N7KA 5E24E 4Y6NA 4CJ8A 1XG6A 3I0FA 1CE7B 3D8VA 5I1BA 3I29B 1G9DA 2LIQA 1QQLA 4XFUA 4I4VA 2FFVA 5D62A 4I4YA 4QALA 3H6QA 3MALA 3I0GA 2AFGA 3BX1C 2JCOA 2V0HA 2E8BA 3IOHA 5JQQA 4Y7VA 1VGWA 3AJ5A 2MZBA 4LO2C 3OBTA 4ECMA 2BFHA 1R80A 2RQ9A 3OJ2A 1W57A 1FV3A 3A07A 2V0KA 4KNRA 3F1RA 1ZJ3A 4HR6C 1YBIA 4KEIA 2NP0A 3Q80A 4KEJA 2X2SA 1YP4A 3F62B 4D0ZA 2P39A 1BASA 1J0SA 3UDAA 3RTJB 4ZKTB 3O4AA 1OMZA 4QD2C 1W3AA 1VM8A 2UX8A 3PKPA 1DJSB 1JT4A 4B4MA 5EIYA 4B2WA 1Z2VA 1NUNA 3CU1B 2Z86A 2D44A 2F8XC 1G95A 3AZWA 3V0MA 4CVHA 3LLPA 5C38A 1NKHB 3CU0A 4I1EA 3V0PA 2RIZA 4UEGA 1ISVA 4P0LA 1D0HA 2RJ9A 2WE9A 4BQHA 1AFCA 3BB2A 4I4RA 3SNVA 1WT3A 3R4SA 4I1BA 1VH1A 2JCLA 1JT3A 1T9FA 4DCKC 1ON6A 1R7VA 3AJ6A 1VGUA 2K8RA 2JCKA 4EB2B 2KH2A 4G6JA 4GOYA 2P23A 5CQOA 4G9NA 4DENA 4J2SA 2AM4A 2QGIA 2ERMA 1YYNA 2WAWA 2PGVA 2JCJA 5C4EA 4JP0A 4AN6A 1H3MA 2Y6PA 3AZVA 3P53A 3CA6A 5BXRA 5IDSA 3MPPG 5AJNA 3FJEA 4QD2B 4XFTA 3NBNA 3O4DA 4KBBA 3FJBA 1VGTA 4P00A 2FYBA 4DE7A 2E4MC 3TZTA 3HMYA 1K5UA 3POKA 1GWWA 5G00A 3IIRA 1NHEB 3FWWA 4FRPA 4G87A 4Q9GA 1INIA 4K6RA 3UJ0A 3AKHA 1R82A 3OH2A 4CJCA 1NZKA 1O7OA 3VT2A 1ZI1A 2X2TA 4AN7B 5EJZA 3A21A 1YP3A 4B2XA 2AESA 4EEAA 3SXDA 2VUAA 2NS2A 2Y4MA 3FJAA 1S4OA 1NWGB 1JQZA 3BADA 3ZF8A 3SXGA 3HL3A 2ZU7A 1QXMA 4ISRA 1BLDA 1ZCTA 2OI5A 4FRHA 4X38A 2XWNA 4FGFA 3I2XA 1IRAX 2DRZA 3BRFA 4FQWA 1MC9A 3I0EA 2KKIA 3ZGGA 1H5TB 4IYBA 4EEEB 4P02A 1RY7A 1VPAA 1H7FA 1II4A 4I4XA 4D8HA 4J2XA 2Y4LA 5CMFX 4ASYA 4D11A 3O4BA 4LO0A 4QO3A 2GO2A 3Q7XA 1QG8A 4YOLA 1FGGA 3JUKA 2FFUA 1ONKB 1S0CA 2O1GA 2D20A 2HW9A 3EE5A 4Y62A 4ZOTA 5C3AA 1BARA 2YQCA 1GGPB 5JMCA 3TQDA 1BFFA 1PWAA 1Z4SA 2BEBA 3O4CA 3NBCA 4ISQA 2FDBM 1ITBA 1WD3A 41BIA 1DQOA 1TW5A 1TVYA 2C0NA 5C49A 2RJ7A 1IOBA 1ZJ2A 4ARWA 1SR4A 2KLLA 3BAGA 4JAWA 4OEEA 1H4CA 3ZGFA 2AH9A 3SX5A 3RTIB 3KMVA 1TWMA 1ZI4A 3IM5A 4LO3C 3DK5A 3JUTA 3V0BA 4EEOA 1JV1A 1LZ7A 5AJOA 4UY4A 1KWSA 1V6UA 1XYFA 3AH2A 1EPWA 5C4DA 4QBVA 3CA0A 2YC5A 3QVBA 1ISXA 4LW3A 3FJ9A 4M4KA 2A8WA 1V6VA 5HPZA 1HWNB 1IRPA 3K8EA 2Q9XA 5D91A 1VCLA 1JT7A 3K8DA 4O6MA 1HWPB 4A7KA 4G3QA 4I8MA 1M16A 1IHKA 1S0FA 5DDTA 2W0WA 1HKNA 3I0KA 3RSBA 1ABRB 2I1BA 2W0VA 3R4UA 2DREA 3JRRA 3S8JA 1GQCA 4B4GA 4FIYA 3QYDA 3D7WB 2D0JA 3F1YA 3PG0A 5CQLX 3U2XA 4GP3A 3AH4A 2E3DA 1H5SA 1HM0A 1WVCA 3FGMA 2D22A 4LO7C 2BO4A 5BQUC 2OEFA 2QKXA 4FRQA 1RG8A 1CVSA 3S8KA 1ZCUA 5FNWA 4ZFUB 5C4FA 2YQSA 3FJ8A 5BXSA 1VH3A 4FRMA 1NMMB 3OH3A 2R9KB 4MZFB 1W77A 2FYDB 5FTVA 5J49A 3HN1A 1PZYB 2Q4JA 1WT1A 3LW6A 5GAQA 3VUOA 1JY0A 3R3IA 3EF2A 1TIEA 2AQZA 3V8YA 1SR4C 3AKIA 4IQPA 4KPZA 4EFRA 2VXRA 1WD4A 4EE4A 3FJHA 2Y9XE 3NBDA 1LZIA 1G9CA 4KPXA 5FUHA 3USQA 1VZTA 2Y4KA 1FV2A 2J0AA 3O5WB 1VZXA 1IINA 3CKQA 2GZBA 3WO2A 1W3FA 3N0KA 4G6MA 3VT0A 4QC4A 1JVGA 2VXLA 2Y9WC 4Y64A 4LO7B 1R7XA 4Y7GA 4HO5A 2CU2A 1FO9A 2ICYA 2RJ8A 2ICXA 1BLAA 5F8WA 4LO1A 3LTQA 3SXCA 1TW1A 1DQGA 3JUJA 4ZDQA 2O1FA 2AM3A 3BA4A 3Q7WA 3V8ZA 4Z9WB 4DEPA 1LL2A 3U0XA 4OUJA 2ZR1B 1DZDA 1FMZA 2NM1A 1ZHJA 2DRYA 2VFZA 3PHZA 1JTCA 1R8OA 3W9TA 1R7TA 1S4NA 3I0LA 1JT5A 3RMWA 3AH1A 1AVUA 5F90A 1EZIA 4QKRA 4NALA 1MP3A 2RJ0A 4NAKA 4B3UA 3ILAA 5FYEA 1INJA 1HWOB 3D98A 1S0EA 1FGAA 2IWTB 3O4OA 2D23A 2D7RA 3OGGA 1MC3A 4KQLA 2BO8A 2BO7A 4USOA 2BEAA 2YC3A 5HS2A 4I4OA 2OI6A 2WGZA 4H04A 5FZYA 1FZWA 3ST8A 4OW4A 5CMHA 5BXTA 2YQJA 3TC2A 1E0OA 4AYLA 1K5VA 3H6RA 5JLVA 4JKXB 1P63A 4ZFWB 1HWMB 2A8UA 4Z8SB 2RJ1A 1S0LA 9ILBA 3CKNA 3D5NA 2AGDA 3R2WA 4Y63A 5EJ1A 5L6SA 3IM7A 2LIEA 4G9MA 4XKIA 2RJ6A 2RG9B 2KI4A 2D1ZA 3N7JA 4GAFA 4I6IA 4MZGB 3BA5A 4ZA3B 1ZCVA 2VD4A 2XWMA 4IY8A 3I0HA 4R7PA 4G1RA 3IOJA 3V90A 5DZUA 3V91A 3JTJA 5CMIA 3CA1A 1W55A 1OQLB 2RSTA 1TTUA 2ZU8A 5EC5A 2L5XA 4QKSA 1O23B 2V0LA 2ZU9A 3E25A 3OC9A 4H75A 1WSZA 4HO9A 5FU8A 1PZTA 2WRYA 3V0AA 3UD8A 1VZUA 4FRBA 3SX8A 1H5RB 2FY7A 3V0LA 5IFYA 3ZX7A 3BCVA 5FNXA 1W3GA 1GX4A 4OWLA 4LO1C 3AKGA 5IDTA 1EYLA 2VXMA 1RZOB 3UJ4A 5C4CA 1Q03A 1E5KA 4USPA 2X60A 3T7OA 4ZFYB 2D24A 1FRWA 1G1LA 4Y7UA 4GP0A 3Q7UA 3OAMA 4FCUA 1M2TB 1GQ9A 1LL0A 4ZLBB 1HIBA 2F2FA 5FZUA 5FZZA 1IIMA 1GA8A 2I5EA 31BIA 4X3AA 2WVMA 1ISZA 2Y4JA 3POLA 1H7QA 1H4EA 5D63A 5BP5A 5C1LA 4EFPA 1AVWB 2XWLA 1G8OA 1ON8A 5CMJA 2FO1A 3AKFA 4GBPA 2NVHA 1JV3A 4P6AA 4FREA 2V0JA 4HOCA 5CMGX 4JD0A 4AC3A 4MYBA 1FOAA 1Z90A 1R8NA 3CA4A 3N7LA 4HA2A 1ZCYA 8I1BA 2V0IA 1LZJA 3O44A 4NAIA 1AXMA 4KC3A 3FUOA 1XHBA 2QH5A 1HCEA 2NXVA 2XMEA 1G23A 3DUVA 2VS4A 1FMMS 1JLXA 1ZJ1A 2WVKA 4G3PA 2D43A 4HO4A 1VICA 4LO2A 4L4IA 2K4AB 4HCQA 2Z87A 5C48A 1FG5N 4Y7FA 3BA7A 4Q7CA 1ZDFA 3ZC9A 1N4KA 2VSAA 4KNXA 5DSSB 3ZLLA 4JRAA 1TFMB 2ZQOA 4KXOA 4J23B 4ASJA 2VSEA 3PMEA 2HWMA 4KRVA 3GUEA 3OGZA 4H9WA 4FRLA 5F8YA 2FYCB 1H7EA 2IHOA 21BIA 3BTAA 4TLPA 1R7UA 3SXEA 4D0TA 3V0QA 1RMLA 3HALA 3ZC8A 5BOWA 1JVDA 3U2WA 1HCDA 4HO0A 2Y9GA 4OWJA 4HO2A 3FJDA 1YXWA 2M49A 3V79C 2QN4A 2FYAA 4MIXA 3SX3A 3FJKA 4P0KA 4MNDA 2AE7A 4AYJA 3O3QA 2X65A 4Y7TA 4AAWA 3SPTA 1O7QA 5CQPA 4D11C 2RIXA 3C9ZA 2K43A 1H7TA 3IOIA
chains in the Genus database with same CATH topology
3WA1A 3P6IA 3A22A 1FXJA 2APCA 4I96A 4J2YA 4I4PA 3T8SA 3F1CA 2AAIB 5FTSA 3Q7YA 4M2AA 4R6UB 5B2HA 1G9BA 2F2FC 2QYIB 1AVXB 4G3SA 4LW6A 3OJVA 3WINA 4HO6A 4IY9A 1H7LA 2I7BA 2XMHA 1BFBA 1H5TA 5C8RA 3OJMA 3WO3A 3I0IX 2VLCA 4EE3A 1JLYA 1BA7A 1Z0HA 2VXTI 5BVPI 4JISA 5FV9A 1LL3A 2VK9A 3SX7A 4HO8A 3FOQA 2VSIA 2NZ9A 2J0BA 4EE5A 2UUSA 2E4MA 4CJMA 1G9RA 4EVWA 3CA3A 5AJPA 4GOVA 3V0OA 2Y9FA 3HBWA 3H6SE 1ISWA 1IILA 2AXMA 3ZXDA 4X37A 1IT0A 3V0AB 1LZ0A 3RMYA 4F83A 3DJ4A 4B4BA 5C3DA 2AECA 2DPWA 4D48A 1FWUA 2MIBA 1FR8A 4Y9XA 4DECA 1G97A 4OEFA 3BAQA 4L4HA 4I4SA 1G93A 5CQNX 1TOOA 3BRDA 3PKQA 2RIYA 1A8DA 2Q3NB 3FJFA 1HV9A 3BAOA 1K4VA 1FO8A 3OH4A 3QR5A 3BRKX 4B5BA 1V6XA 4I0YA 3UD9A 3NBEA 5C1GA 7I1BA 2D7IA 2DS0A 3A23A 4F34A 4FCEA 3VSZA 5DDVA 5C4BA 1ZI5A 2OI7A 2VU9A 3U0YA 1AVAC 2HZ9A 3FUQA 4X39A 4IONA 1ILR1 1HJJA 1H5SC 4PC4A 4KC1A 4GAIA 3V0BB 2RJ4A 4XWIA 1OMXA 1WBCA 5CQMX 2RJ5A 1G0RA 1ZI3A 1FGXA 2HWAA 4A7ZA 3UD7A 1QQKA 2P6WA 1H5SD 1MP5A 1XZZA 2J3PA 1T4QA 4EEMA 1FWYA 1PUUB 3BRGC 1ZDGA 3IAGC 1V6WA 2GGQA 3BAVA 3CQAA 2GGOA 1PC8B 2I5KA 2X5SA 3OKRA 1G9AA 4FRDA 3WINC 4Q9PA 4HO3A 1Q1UA 4WBCA 5EHAA 1ZJ0A 3KIAA 2YESA 4EFQA 1G3LA 3ZLKA 3HOMA 4LO3A 2OEGA 1I1BA 1Q04A 2ET2A 4I3NA 4Y6UA 4QBCA 4KC4A 2VSHA 3CA5A 4M28A 3T7MA 4XFSA 3I0DA 4IRQA 3WMUA 4OWKA 1H7HA 3V0NA 4A7YA 4CJBA 1H4DA 3U2VA 1JYLA 3NJ5A 3HSMA 2MC2A 1HJLA 4FROA 1H5SB 3WO4A 1S0DA 3FFZA 1QGSA 3CKOA 1WT0A 2MLLB 3T7NA 4M2BA 1S0BA 5L6VA 2RITA 4EEGA 1MD6A 2X5ZA 2XOAA 4FIXA 4J18A 3SXAA 1TZFA 3PNNA 3IM6A 1FXOA 2O1HA 1V82A 4IZEA 1HM8A 1NF5B 3FJIA 3CRIA 3CGXA 6I1BA 1R81A 5I1FA 3CKJA 1G82A 1ZJPA 4J2KA 4O6NA 3NGWA 1OQMB 4DDZA 4IZXA 1SS9A 4IRPA 2WBCA 1V83A 1DFQA 3RMXA 5FU0A 2YUGA 5BQUA 3WMVA 1LVWA 5C47A 1WT2A 1BFCA 1SZ6B 1VGZA 2P73A 3E8LC 4NANA 4I4UA 3BAUA 4I4QA 1FWVA 1ISYA 2NTDA 4MZHA 1H7GA 1XZ6A 4FRAA 2WVLA 3Q4SA 1TP0A 1WBAA 3CRHA 4I2SA 3N7MA 2YCMA 3OH0A 1KNMA 1IJTA 2ZQNA 1YP2A 5DUYA 1DZCA 1QWJA 1ZIZA 5EG6C 3I2AA 4Q91A 2WEEA 1V84A 3FJJA 3O49A 4FVVA 4C2SA 4ZGRB 3P6JA 4IHZA 3OBRA 5DVHA 2YQHA 3VWCA 3VT1A 3RMVA 1PUMB 4LO0C 5C1HA 4E1KA 1S4PA 1MP4A 3CKVA 3N9WA 4KC2A 4KEKA 3USRA 4BMAA 1I52A 3PUBA 4OEGA 1EV2A 3O3PA 4KT7A 4B42A 4EKXB 2P72A 4HG6A 1EVTA 1L2HA 2FGFA 1S0GA 2Z49A 4LO8B 1FQ9A 4JQ0A 1BFGA 4L41C 2VS3A 5C36A 1F31A 3B9UA 4ENDA 5C3BA 1YROB 2NYYA 2PA4A 3U2TA 1TWEA 4YS8A 4I7IA 3SXBA 1FR9A 1PZZA 1QGQA 3U2UA 3E26A 1NQIB 1O0RA 3CAHA 3ZXGA 1G2VA 3I0JA 5D92A 2Z48A 1DFCA 4P0JA 5D61A 3OGFA 4I37A 3RSJA 2KI6B 3OH1A 1GX0A 1JYKA 3H6RB 1R7YA 4JKQA 1ZJOA 2PX7A 1YTOA 3CRGA 1DIWA 2PGYA 2ESUA 2VS5A 3I0CA 1YF8B 3K1XA 1DLLA 5F8SA 3VSFA 1AF9A 5BXPA 1EYRA 4JPZA 2BO6A 5BP5C 2Y7AA 5BXCA 1GWVA 1FN0A 3BAHA 1UPSA 4II0A 4ZBVB 4HJJA 1H5RA 1I1EA 1HM9A 3VEQA 2AM5A 3FJCA 3N7KA 5E24E 4Y6NA 4CJ8A 1XG6A 3I0FA 1CE7B 3D8VA 5I1BA 3I29B 1G9DA 2LIQA 1QQLA 4XFUA 4I4VA 2FFVA 5D62A 4I4YA 4QALA 3H6QA 3MALA 3I0GA 2AFGA 3BX1C 2JCOA 2V0HA 2E8BA 3IOHA 5JQQA 4Y7VA 1VGWA 3AJ5A 2MZBA 4LO2C 3OBTA 4ECMA 2BFHA 1R80A 2RQ9A 3OJ2A 1W57A 1FV3A 3A07A 2V0KA 4KNRA 3F1RA 1ZJ3A 4HR6C 1YBIA 4KEIA 2NP0A 3Q80A 4KEJA 2X2SA 1YP4A 3F62B 4D0ZA 2P39A 1BASA 1J0SA 3UDAA 3RTJB 4ZKTB 3O4AA 1OMZA 4QD2C 1W3AA 1VM8A 2UX8A 3PKPA 1DJSB 1JT4A 4B4MA 5EIYA 4B2WA 1Z2VA 1NUNA 3CU1B 2Z86A 2D44A 2F8XC 1G95A 3AZWA 3V0MA 4CVHA 3LLPA 5C38A 1NKHB 3CU0A 4I1EA 3V0PA 2RIZA 4UEGA 1ISVA 4P0LA 1D0HA 2RJ9A 2WE9A 4BQHA 1AFCA 3BB2A 4I4RA 3SNVA 1WT3A 3R4SA 4I1BA 1VH1A 2JCLA 1JT3A 1T9FA 4DCKC 1ON6A 1R7VA 3AJ6A 1VGUA 2K8RA 2JCKA 4EB2B 2KH2A 4G6JA 4GOYA 2P23A 5CQOA 4G9NA 4DENA 4J2SA 2AM4A 2QGIA 2ERMA 1YYNA 2WAWA 2PGVA 2JCJA 5C4EA 4JP0A 4AN6A 1H3MA 2Y6PA 3AZVA 3P53A 3CA6A 5BXRA 5IDSA 3MPPG 5AJNA 3FJEA 4QD2B 4XFTA 3NBNA 3O4DA 4KBBA 3FJBA 1VGTA 4P00A 2FYBA 4DE7A 2E4MC 3TZTA 3HMYA 1K5UA 3POKA 1GWWA 5G00A 3IIRA 1NHEB 3FWWA 4FRPA 4G87A 4Q9GA 1INIA 4K6RA 3UJ0A 3AKHA 1R82A 3OH2A 4CJCA 1NZKA 1O7OA 3VT2A 1ZI1A 2X2TA 4AN7B 5EJZA 3A21A 1YP3A 4B2XA 2AESA 4EEAA 3SXDA 2VUAA 2NS2A 2Y4MA 3FJAA 1S4OA 1NWGB 1JQZA 3BADA 3ZF8A 3SXGA 3HL3A 2ZU7A 1QXMA 4ISRA 1BLDA 1ZCTA 2OI5A 4FRHA 4X38A 2XWNA 4FGFA 3I2XA 1IRAX 2DRZA 3BRFA 4FQWA 1MC9A 3I0EA 2KKIA 3ZGGA 1H5TB 4IYBA 4EEEB 4P02A 1RY7A 1VPAA 1H7FA 1II4A 4I4XA 4D8HA 4J2XA 2Y4LA 5CMFX 4ASYA 4D11A 3O4BA 4LO0A 4QO3A 2GO2A 3Q7XA 1QG8A 4YOLA 1FGGA 3JUKA 2FFUA 1ONKB 1S0CA 2O1GA 2D20A 2HW9A 3EE5A 4Y62A 4ZOTA 5C3AA 1BARA 2YQCA 1GGPB 5JMCA 3TQDA 1BFFA 1PWAA 1Z4SA 2BEBA 3O4CA 3NBCA 4ISQA 2FDBM 1ITBA 1WD3A 41BIA 1DQOA 1TW5A 1TVYA 2C0NA 5C49A 2RJ7A 1IOBA 1ZJ2A 4ARWA 1SR4A 2KLLA 3BAGA 4JAWA 4OEEA 1H4CA 3ZGFA 2AH9A 3SX5A 3RTIB 3KMVA 1TWMA 1ZI4A 3IM5A 4LO3C 3DK5A 3JUTA 3V0BA 4EEOA 1JV1A 1LZ7A 5AJOA 4UY4A 1KWSA 1V6UA 1XYFA 3AH2A 1EPWA 5C4DA 4QBVA 3CA0A 2YC5A 3QVBA 1ISXA 4LW3A 3FJ9A 4M4KA 2A8WA 1V6VA 5HPZA 1HWNB 1IRPA 3K8EA 2Q9XA 5D91A 1VCLA 1JT7A 3K8DA 4O6MA 1HWPB 4A7KA 4G3QA 4I8MA 1M16A 1IHKA 1S0FA 5DDTA 2W0WA 1HKNA 3I0KA 3RSBA 1ABRB 2I1BA 2W0VA 3R4UA 2DREA 3JRRA 3S8JA 1GQCA 4B4GA 4FIYA 3QYDA 3D7WB 2D0JA 3F1YA 3PG0A 5CQLX 3U2XA 4GP3A 3AH4A 2E3DA 1H5SA 1HM0A 1WVCA 3FGMA 2D22A 4LO7C 2BO4A 5BQUC 2OEFA 2QKXA 4FRQA 1RG8A 1CVSA 3S8KA 1ZCUA 5FNWA 4ZFUB 5C4FA 2YQSA 3FJ8A 5BXSA 1VH3A 4FRMA 1NMMB 3OH3A 2R9KB 4MZFB 1W77A 2FYDB 5FTVA 5J49A 3HN1A 1PZYB 2Q4JA 1WT1A 3LW6A 5GAQA 3VUOA 1JY0A 3R3IA 3EF2A 1TIEA 2AQZA 3V8YA 1SR4C 3AKIA 4IQPA 4KPZA 4EFRA 2VXRA 1WD4A 4EE4A 3FJHA 2Y9XE 3NBDA 1LZIA 1G9CA 4KPXA 5FUHA 3USQA 1VZTA 2Y4KA 1FV2A 2J0AA 3O5WB 1VZXA 1IINA 3CKQA 2GZBA 3WO2A 1W3FA 3N0KA 4G6MA 3VT0A 4QC4A 1JVGA 2VXLA 2Y9WC 4Y64A 4LO7B 1R7XA 4Y7GA 4HO5A 2CU2A 1FO9A 2ICYA 2RJ8A 2ICXA 1BLAA 5F8WA 4LO1A 3LTQA 3SXCA 1TW1A 1DQGA 3JUJA 4ZDQA 2O1FA 2AM3A 3BA4A 3Q7WA 3V8ZA 4Z9WB 4DEPA 1LL2A 3U0XA 4OUJA 2ZR1B 1DZDA 1FMZA 2NM1A 1ZHJA 2DRYA 2VFZA 3PHZA 1JTCA 1R8OA 3W9TA 1R7TA 1S4NA 3I0LA 1JT5A 3RMWA 3AH1A 1AVUA 5F90A 1EZIA 4QKRA 4NALA 1MP3A 2RJ0A 4NAKA 4B3UA 3ILAA 5FYEA 1INJA 1HWOB 3D98A 1S0EA 1FGAA 2IWTB 3O4OA 2D23A 2D7RA 3OGGA 1MC3A 4KQLA 2BO8A 2BO7A 4USOA 2BEAA 2YC3A 5HS2A 4I4OA 2OI6A 2WGZA 4H04A 5FZYA 1FZWA 3ST8A 4OW4A 5CMHA 5BXTA 2YQJA 3TC2A 1E0OA 4AYLA 1K5VA 3H6RA 5JLVA 4JKXB 1P63A 4ZFWB 1HWMB 2A8UA 4Z8SB 2RJ1A 1S0LA 9ILBA 3CKNA 3D5NA 2AGDA 3R2WA 4Y63A 5EJ1A 5L6SA 3IM7A 2LIEA 4G9MA 4XKIA 2RJ6A 2RG9B 2KI4A 2D1ZA 3N7JA 4GAFA 4I6IA 4MZGB 3BA5A 4ZA3B 1ZCVA 2VD4A 2XWMA 4IY8A 3I0HA 4R7PA 4G1RA 3IOJA 3V90A 5DZUA 3V91A 3JTJA 5CMIA 3CA1A 1W55A 1OQLB 2RSTA 1TTUA 2ZU8A 5EC5A 2L5XA 4QKSA 1O23B 2V0LA 2ZU9A 3E25A 3OC9A 4H75A 1WSZA 4HO9A 5FU8A 1PZTA 2WRYA 3V0AA 3UD8A 1VZUA 4FRBA 3SX8A 1H5RB 2FY7A 3V0LA 5IFYA 3ZX7A 3BCVA 5FNXA 1W3GA 1GX4A 4OWLA 4LO1C 3AKGA 5IDTA 1EYLA 2VXMA 1RZOB 3UJ4A 5C4CA 1Q03A 1E5KA 4USPA 2X60A 3T7OA 4ZFYB 2D24A 1FRWA 1G1LA 4Y7UA 4GP0A 3Q7UA 3OAMA 4FCUA 1M2TB 1GQ9A 1LL0A 4ZLBB 1HIBA 2F2FA 5FZUA 5FZZA 1IIMA 1GA8A 2I5EA 31BIA 4X3AA 2WVMA 1ISZA 2Y4JA 3POLA 1H7QA 1H4EA 5D63A 5BP5A 5C1LA 4EFPA 1AVWB 2XWLA 1G8OA 1ON8A 5CMJA 2FO1A 3AKFA 4GBPA 2NVHA 1JV3A 4P6AA 4FREA 2V0JA 4HOCA 5CMGX 4JD0A 4AC3A 4MYBA 1FOAA 1Z90A 1R8NA 3CA4A 3N7LA 4HA2A 1ZCYA 8I1BA 2V0IA 1LZJA 3O44A 4NAIA 1AXMA 4KC3A 3FUOA 1XHBA 2QH5A 1HCEA 2NXVA 2XMEA 1G23A 3DUVA 2VS4A 1FMMS 1JLXA 1ZJ1A 2WVKA 4G3PA 2D43A 4HO4A 1VICA 4LO2A 4L4IA 2K4AB 4HCQA 2Z87A 5C48A 1FG5N 4Y7FA 3BA7A 4Q7CA 1ZDFA 3ZC9A 1N4KA 2VSAA 4KNXA 5DSSB 3ZLLA 4JRAA 1TFMB 2ZQOA 4KXOA 4J23B 4ASJA 2VSEA 3PMEA 2HWMA 4KRVA 3GUEA 3OGZA 4H9WA 4FRLA 5F8YA 2FYCB 1H7EA 2IHOA 21BIA 3BTAA 4TLPA 1R7UA 3SXEA 4D0TA 3V0QA 1RMLA 3HALA 3ZC8A 5BOWA 1JVDA 3U2WA 1HCDA 4HO0A 2Y9GA 4OWJA 4HO2A 3FJDA 1YXWA 2M49A 3V79C 2QN4A 2FYAA 4MIXA 3SX3A 3FJKA 4P0KA 4MNDA 2AE7A 4AYJA 3O3QA 2X65A 4Y7TA 4AAWA 3SPTA 1O7QA 5CQPA 4D11C 2RIXA 3C9ZA 2K43A 1H7TA 3IOIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WA1 A;  3P6I A;  3A22 A;  1FXJ A;  2APC A;  4I96 A;  4J2Y A;  4I4P A;  3T8S A;  3F1C A;  2AAI B;  5FTS A;  3Q7Y A;  4M2A A;  4R6U B;  5B2H A;  1G9B A;  2F2F C;  2QYI B;  1AVX B;  4G3S A;  4LW6 A;  3OJV A;  3WIN A;  4HO6 A;  4IY9 A;  1H7L A;  2I7B A;  2XMH A;  1BFB A;  1H5T A;  5C8R A;  3OJM A;  3WO3 A;  3I0I X;  2VLC A;  4EE3 A;  1JLY A;  1BA7 A;  1Z0H A;  2VXT I;  5BVP I;  4JIS A;  5FV9 A;  1LL3 A;  3SX7 A;  4HO8 A;  3FOQ A;  2VSI A;  2NZ9 A;  4EE5 A;  2UUS A;  2E4M A;  4CJM A;  1G9R A;  4EVW A;  3CA3 A;  5AJP A;  4GOV A;  3V0O A;  2Y9F A;  3HBW A;  3H6S E;  1ISW A;  1IIL A;  2AXM A;  3ZXD A;  4X37 A;  1IT0 A;  3V0A B;  1LZ0 A;  3RMY A;  4F83 A;  3DJ4 A;  4B4B A;  5C3D A;  2AEC A;  2DPW A;  4D48 A;  1FWU A;  2MIB A;  1FR8 A;  4Y9X A;  4DEC A;  1G97 A;  4OEF A;  3BAQ A;  4L4H A;  4I4S A;  1G93 A;  5CQN X;  1TOO A;  3BRD A;  3PKQ A;  2RIY A;  1A8D A;  2Q3N B;  3FJF A;  1HV9 A;  3BAO A;  1K4V A;  1FO8 A;  3OH4 A;  3QR5 A;  3BRK X;  4B5B A;  1V6X A;  4I0Y A;  3UD9 A;  3NBE A;  5C1G A;  7I1B A;  2D7I A;  2DS0 A;  3A23 A;  4F34 A;  4FCE A;  3VSZ A;  5DDV A;  5C4B A;  1ZI5 A;  2OI7 A;  2VU9 A;  3U0Y A;  1AVA C;  2HZ9 A;  3FUQ A;  4X39 A;  4ION A;  1ILR 1;  1HJJ A;  1H5S C;  4PC4 A;  4KC1 A;  4GAI A;  3V0B B;  2RJ4 A;  4XWI A;  1OMX A;  1WBC A;  5CQM X;  2RJ5 A;  1G0R A;  1ZI3 A;  1FGX A;  2HWA A;  4A7Z A;  3UD7 A;  1QQK A;  2P6W A;  1H5S D;  1MP5 A;  1XZZ A;  2J3P A;  1T4Q A;  4EEM A;  1FWY A;  1PUU B;  3BRG C;  1ZDG A;  3IAG C;  1V6W A;  2GGQ A;  3BAV A;  3CQA A;  2GGO A;  1PC8 B;  2I5K A;  2X5S A;  3OKR A;  1G9A A;  4FRD A;  3WIN C;  4Q9P A;  4HO3 A;  1Q1U A;  4WBC A;  5EHA A;  1ZJ0 A;  3KIA A;  2YES A;  4EFQ A;  1G3L A;  3ZLK A;  3HOM A;  4LO3 A;  2OEG A;  1I1B A;  1Q04 A;  2ET2 A;  4I3N A;  4Y6U A;  4QBC A;  4KC4 A;  2VSH A;  3CA5 A;  4M28 A;  3T7M A;  4XFS A;  3I0D A;  4IRQ A;  3WMU A;  4OWK A;  1H7H A;  3V0N A;  4A7Y A;  4CJB A;  1H4D A;  3U2V A;  1JYL A;  3NJ5 A;  3HSM A;  2MC2 A;  1HJL A;  4FRO A;  1H5S B;  3WO4 A;  1S0D A;  3FFZ A;  1QGS A;  3CKO A;  1WT0 A;  2MLL B;  3T7N A;  4M2B A;  1S0B A;  5L6V A;  2RIT A;  4EEG A;  1MD6 A;  2X5Z A;  2XOA A;  4J18 A;  3SXA A;  1TZF A;  3PNN A;  3IM6 A;  1FXO A;  2O1H A;  1V82 A;  4IZE A;  1HM8 A;  1NF5 B;  3FJI A;  3CRI A;  3CGX A;  6I1B A;  1R81 A;  5I1F A;  3CKJ A;  1G82 A;  1ZJP A;  4J2K A;  3NGW A;  1OQM B;  4DDZ A;  4IZX A;  1SS9 A;  4IRP A;  2WBC A;  1V83 A;  1DFQ A;  3RMX A;  5FU0 A;  2YUG A;  5BQU A;  3WMV A;  1LVW A;  5C47 A;  1WT2 A;  1BFC A;  1SZ6 B;  1VGZ A;  2P73 A;  3E8L C;  4NAN A;  4I4U A;  3BAU A;  4I4Q A;  1FWV A;  1ISY A;  2NTD A;  1H7G A;  1XZ6 A;  4FRA A;  4NAK A;  2WVL A;  3Q4S A;  1TP0 A;  1WBA A;  3CRH A;  4I2S A;  3N7M A;  2YCM A;  3OH0 A;  1KNM A;  1IJT A;  2ZQN A;  1YP2 A;  5DUY A;  1DZC A;  1QWJ A;  1ZIZ A;  5EG6 C;  3I2A A;  4Q91 A;  2WEE A;  1V84 A;  3FJJ A;  3O49 A;  4FVV A;  4C2S A;  4ZGR B;  3P6J A;  4IHZ A;  3OBR A;  5DVH A;  2YQH A;  3VWC A;  3VT1 A;  3RMV A;  1PUM B;  4LO0 C;  5C1H A;  4E1K A;  1S4P A;  1MP4 A;  3CKV A;  3N9W A;  4KC2 A;  4KEK A;  3USR A;  4BMA A;  1I52 A;  3PUB A;  4OEG A;  1EV2 A;  3O3P A;  4KT7 A;  4B42 A;  4EKX B;  2P72 A;  4HG6 A;  1EVT A;  1L2H A;  2FGF A;  1S0G A;  2Z49 A;  4LO8 B;  1FQ9 A;  4JQ0 A;  1BFG A;  4L41 C;  2VS3 A;  5C36 A;  1F31 A;  3B9U A;  4END A;  5C3B A;  1YRO B;  2NYY A;  2PA4 A;  3U2T A;  1TWE A;  4YS8 A;  4I7I A;  3SXB A;  1FR9 A;  1PZZ A;  1QGQ A;  3U2U A;  3E26 A;  1NQI B;  1O0R A;  3CAH A;  3ZXG A;  1G2V A;  3I0J A;  2Z48 A;  1DFC A;  4P0J A;  5D61 A;  3OGF A;  4I37 A;  3RSJ A;  2KI6 B;  3OH1 A;  1GX0 A;  1JYK A;  3H6R B;  1R7Y A;  4JKQ A;  1ZJO A;  2PX7 A;  1YTO A;  3CRG A;  1DIW A;  2PGY A;  2ESU A;  2VS5 A;  3I0C A;  1YF8 B;  3K1X A;  1DLL A;  5F8S A;  3VSF A;  1AF9 A;  5BXP A;  1EYR A;  4JPZ A;  2BO6 A;  5BP5 C;  2Y7A A;  5BXC A;  1GWV A;  1FN0 A;  3BAH A;  1UPS A;  4II0 A;  4ZBV B;  4HJJ A;  1H5R A;  1I1E A;  1HM9 A;  3VEQ A;  2AM5 A;  3FJC A;  3N7K A;  5E24 E;  4Y6N A;  4CJ8 A;  1XG6 A;  3I0F A;  1CE7 B;  3D8V A;  5I1B A;  3I29 B;  1G9D A;  2LIQ A;  1QQL A;  4XFU A;  4I4V A;  2FFV A;  5D62 A;  4I4Y A;  4QAL A;  3H6Q A;  3MAL A;  3I0G A;  2AFG A;  3BX1 C;  2JCO A;  2V0H A;  2E8B A;  3IOH A;  5JQQ A;  4Y7V A;  1VGW A;  3AJ5 A;  2MZB A;  4LO2 C;  3OBT A;  4ECM A;  2BFH A;  1R80 A;  2RQ9 A;  3OJ2 A;  1W57 A;  1FV3 A;  3A07 A;  2V0K A;  4KNR A;  3F1R A;  1ZJ3 A;  4HR6 C;  1YBI A;  4KEI A;  2NP0 A;  3Q80 A;  4KEJ A;  2X2S A;  1YP4 A;  3F62 B;  4D0Z A;  2P39 A;  1BAS A;  1J0S A;  3UDA A;  3RTJ B;  4ZKT B;  3O4A A;  1OMZ A;  4QD2 C;  1W3A A;  1VM8 A;  2UX8 A;  3PKP A;  1DJS B;  1JT4 A;  4B4M A;  5EIY A;  4B2W A;  1Z2V A;  1NUN A;  3CU1 B;  2Z86 A;  2D44 A;  2F8X C;  1G95 A;  3AZW A;  3V0M A;  4CVH A;  3LLP A;  5C38 A;  1NKH B;  3CU0 A;  4I1E A;  3V0P A;  2RIZ A;  4UEG A;  1ISV A;  4P0L A;  1D0H A;  2RJ9 A;  2WE9 A;  4BQH A;  1AFC A;  3BB2 A;  4I4R A;  3SNV A;  1WT3 A;  3R4S A;  4I1B A;  1VH1 A;  2JCL A;  1JT3 A;  1T9F A;  4DCK C;  1ON6 A;  1R7V A;  3AJ6 A;  1VGU A;  2K8R A;  2JCK A;  4EB2 B;  2KH2 A;  4G6J A;  4GOY A;  2P23 A;  5CQO A;  4G9N A;  4DEN A;  4J2S A;  2AM4 A;  2QGI A;  2ERM A;  1YYN A;  2WAW A;  2PGV A;  2JCJ A;  5C4E A;  4JP0 A;  4AN6 A;  1H3M A;  2Y6P A;  3AZV A;  3P53 A;  3CA6 A;  5BXR A;  5IDS A;  3MPP G;  5AJN A;  3FJE A;  4QD2 B;  4XFT A;  3NBN A;  3O4D A;  4KBB A;  3FJB A;  1VGT A;  4P00 A;  2FYB A;  4DE7 A;  2E4M C;  3TZT A;  3HMY A;  1K5U A;  3POK A;  1GWW A;  5G00 A;  3IIR A;  1NHE B;  3FWW A;  4FRP A;  4G87 A;  4Q9G A;  1INI A;  4K6R A;  3UJ0 A;  3AKH A;  1R82 A;  3OH2 A;  4CJC A;  1NZK A;  1O7O A;  3VT2 A;  1ZI1 A;  2X2T A;  4AN7 B;  5EJZ A;  3A21 A;  1YP3 A;  4B2X A;  2AES A;  4EEA A;  3SXD A;  2VUA A;  2Y4M A;  3FJA A;  1S4O A;  1NWG B;  1JQZ A;  3BAD A;  3ZF8 A;  3SXG A;  3HL3 A;  2ZU7 A;  1QXM A;  4ISR A;  1BLD A;  1ZCT A;  2OI5 A;  4FRH A;  4X38 A;  2XWN A;  4FGF A;  3I2X A;  1IRA X;  2DRZ A;  3BRF A;  4FQW A;  1MC9 A;  3I0E A;  2KKI A;  3ZGG A;  1H5T B;  4IYB A;  4EEE B;  4P02 A;  1RY7 A;  1VPA A;  1H7F A;  1II4 A;  4I4X A;  4D8H A;  4J2X A;  2Y4L A;  5CMF X;  4ASY A;  4D11 A;  3O4B A;  4LO0 A;  4QO3 A;  2GO2 A;  3Q7X A;  1QG8 A;  4YOL A;  1FGG A;  3JUK A;  2FFU A;  1ONK B;  1S0C A;  2O1G A;  2D20 A;  2HW9 A;  3EE5 A;  4Y62 A;  4ZOT A;  5C3A A;  1BAR A;  2YQC A;  1GGP B;  5JMC A;  3TQD A;  1BFF A;  1PWA A;  1Z4S A;  2BEB A;  3O4C A;  3NBC A;  4ISQ A;  2FDB M;  1ITB A;  1WD3 A;  41BI A;  1DQO A;  1TW5 A;  1TVY A;  5C49 A;  2RJ7 A;  1IOB A;  1ZJ2 A;  4ARW A;  1SR4 A;  2KLL A;  3BAG A;  4JAW A;  4OEE A;  1H4C A;  3ZGF A;  2AH9 A;  3SX5 A;  3RTI B;  3KMV A;  1TWM A;  1ZI4 A;  3IM5 A;  4LO3 C;  3DK5 A;  3JUT A;  3V0B A;  4EEO A;  1JV1 A;  1LZ7 A;  5AJO A;  1KWS A;  1V6U A;  1XYF A;  3AH2 A;  1EPW A;  5C4D A;  4QBV A;  3CA0 A;  2YC5 A;  3QVB A;  1ISX A;  4LW3 A;  3FJ9 A;  4M4K A;  2A8W A;  1V6V A;  5HPZ A;  1HWN B;  1IRP A;  3K8E A;  2Q9X A;  1VCL A;  1JT7 A;  3K8D A;  1HWP B;  4A7K A;  4G3Q A;  4I8M A;  1M16 A;  1IHK A;  1S0F A;  5DDT A;  2W0W A;  1HKN A;  3I0K A;  3RSB A;  1ABR B;  2I1B A;  2W0V A;  3R4U A;  2DRE A;  3JRR A;  3S8J A;  1GQC A;  4B4G A;  3QYD A;  3D7W B;  2D0J A;  3F1Y A;  3PG0 A;  5CQL X;  3U2X A;  4GP3 A;  3AH4 A;  2E3D A;  1H5S A;  1HM0 A;  1WVC A;  3FGM A;  2D22 A;  4LO7 C;  2BO4 A;  5BQU C;  2OEF A;  2QKX A;  4FRQ A;  1RG8 A;  1CVS A;  3S8K A;  1ZCU A;  5FNW A;  4ZFU B;  5C4F A;  2YQS A;  3FJ8 A;  5BXS A;  1VH3 A;  4FRM A;  1NMM B;  3OH3 A;  2R9K B;  1W77 A;  2FYD B;  5FTV A;  5J49 A;  3HN1 A;  1PZY B;  2Q4J A;  1WT1 A;  3LW6 A;  5GAQ A;  3VUO A;  1JY0 A;  3R3I A;  3EF2 A;  1TIE A;  2AQZ A;  3V8Y A;  1SR4 C;  3AKI A;  4IQP A;  4KPZ A;  4EFR A;  2VXR A;  1WD4 A;  4EE4 A;  3FJH A;  2Y9X E;  3NBD A;  1LZI A;  1G9C A;  4KPX A;  5FUH A;  3USQ A;  1VZT A;  2Y4K A;  1FV2 A;  3CKQ A;  3O5W B;  1VZX A;  1IIN A;  2GZB A;  3WO2 A;  1W3F A;  3N0K A;  4G6M A;  3VT0 A;  4QC4 A;  1JVG A;  2VXL A;  2Y9W C;  4Y64 A;  4LO7 B;  1R7X A;  4Y7G A;  4HO5 A;  2CU2 A;  1FO9 A;  2ICY A;  2RJ8 A;  2ICX A;  1BLA A;  5F8W A;  4LO1 A;  3LTQ A;  3SXC A;  1TW1 A;  1DQG A;  3JUJ A;  4ZDQ A;  2O1F A;  2AM3 A;  3BA4 A;  3Q7W A;  3V8Z A;  4Z9W B;  4DEP A;  1LL2 A;  3U0X A;  4OUJ A;  2ZR1 B;  1DZD A;  1FMZ A;  2NM1 A;  1ZHJ A;  2DRY A;  2VFZ A;  3PHZ A;  1JTC A;  1R8O A;  3W9T A;  1R7T A;  1S4N A;  3I0L A;  1JT5 A;  3RMW A;  3AH1 A;  1AVU A;  5F90 A;  1EZI A;  4QKR A;  4NAL A;  1MP3 A;  2RJ0 A;  4B3U A;  3ILA A;  5FYE A;  1INJ A;  1HWO B;  3D98 A;  1S0E A;  1FGA A;  2IWT B;  3O4O A;  2D23 A;  2D7R A;  3OGG A;  1MC3 A;  4KQL A;  2BO8 A;  2BO7 A;  4USO A;  2BEA A;  2YC3 A;  5HS2 A;  4I4O A;  2OI6 A;  2WGZ A;  4H04 A;  5FZY A;  1FZW A;  3ST8 A;  4OW4 A;  5CMH A;  5BXT A;  2YQJ A;  3TC2 A;  1E0O A;  4AYL A;  1K5V A;  3H6R A;  5JLV A;  4JKX B;  1P63 A;  4ZFW B;  1HWM B;  2A8U A;  4Z8S B;  2RJ1 A;  1S0L A;  9ILB A;  3CKN A;  3D5N A;  2AGD A;  3R2W A;  4Y63 A;  5EJ1 A;  5L6S A;  3IM7 A;  2LIE A;  4G9M A;  4XKI A;  2RJ6 A;  2RG9 B;  2KI4 A;  2D1Z A;  3N7J A;  4GAF A;  4I6I A;  3BA5 A;  4ZA3 B;  1ZCV A;  2VD4 A;  2XWM A;  4IY8 A;  3I0H A;  4R7P A;  4G1R A;  3IOJ A;  3V90 A;  5DZU A;  3V91 A;  3JTJ A;  5CMI A;  3CA1 A;  1W55 A;  1OQL B;  2RST A;  1TTU A;  2ZU8 A;  5EC5 A;  2L5X A;  4QKS A;  1O23 B;  2V0L A;  2ZU9 A;  3E25 A;  3OC9 A;  1WSZ A;  4HO9 A;  5FU8 A;  1PZT A;  2WRY A;  3V0A A;  3UD8 A;  1VZU A;  4FRB A;  3SX8 A;  1H5R B;  2FY7 A;  3V0L A;  5IFY A;  3ZX7 A;  3BCV A;  5FNX A;  1W3G A;  1GX4 A;  4OWL A;  4LO1 C;  3AKG A;  5IDT A;  1EYL A;  2VXM A;  1RZO B;  3UJ4 A;  5C4C A;  1Q03 A;  1E5K A;  4USP A;  2X60 A;  3T7O A;  4ZFY B;  2D24 A;  1FRW A;  1G1L A;  4Y7U A;  4GP0 A;  3Q7U A;  3OAM A;  4FCU A;  1M2T B;  1GQ9 A;  1LL0 A;  4ZLB B;  1HIB A;  2F2F A;  5FZU A;  5FZZ A;  1IIM A;  1GA8 A;  2I5E A;  31BI A;  4X3A A;  2WVM A;  1ISZ A;  2Y4J A;  3POL A;  1H7Q A;  1H4E A;  5D63 A;  5BP5 A;  5C1L A;  4EFP A;  1AVW B;  2XWL A;  1G8O A;  1ON8 A;  5CMJ A;  2FO1 A;  3AKF A;  4GBP A;  2NVH A;  1JV3 A;  4P6A A;  4FRE A;  2V0J A;  4HOC A;  5CMG X;  4JD0 A;  4AC3 A;  4MYB A;  1FOA A;  1Z90 A;  1R8N A;  3CA4 A;  3N7L A;  4HA2 A;  1ZCY A;  8I1B A;  2V0I A;  1LZJ A;  3O44 A;  4NAI A;  1AXM A;  4KC3 A;  3FUO A;  1XHB A;  2QH5 A;  1HCE A;  2NXV A;  2XME A;  1G23 A;  3DUV A;  2VS4 A;  1FMM S;  1JLX A;  1ZJ1 A;  2WVK A;  4G3P A;  2D43 A;  4HO4 A;  1VIC A;  4LO2 A;  4L4I A;  2K4A B;  4HCQ A;  2Z87 A;  5C48 A;  1FG5 N;  4Y7F A;  3BA7 A;  1ZDF A;  3ZC9 A;  1N4K A;  2VSA A;  4KNX A;  5DSS B;  3ZLL A;  4JRA A;  1TFM B;  2ZQO A;  4KXO A;  4J23 B;  4ASJ A;  2VSE A;  3PME A;  2HWM A;  4KRV A;  3GUE A;  3OGZ A;  4H9W A;  4FRL A;  5F8Y A;  2FYC B;  1H7E A;  2IHO A;  21BI A;  3BTA A;  4TLP A;  1R7U A;  3SXE A;  4D0T A;  3V0Q A;  1RML A;  3HAL A;  3ZC8 A;  5BOW A;  1JVD A;  3U2W A;  1HCD A;  4HO0 A;  2Y9G A;  4OWJ A;  4HO2 A;  3FJD A;  1YXW A;  2M49 A;  3V79 C;  2QN4 A;  2FYA A;  3SX3 A;  3FJK A;  4P0K A;  4MND A;  2AE7 A;  4AYJ A;  3O3Q A;  2X65 A;  4Y7T A;  4AAW A;  3SPT A;  1O7Q A;  5CQP A;  4D11 C;  2RIX A;  3C9Z A;  2K43 A;  1H7T A;  3IOI A; 
#chains in the Genus database with same CATH topology
 3WA1 A;  3P6I A;  3A22 A;  1FXJ A;  2APC A;  4I96 A;  4J2Y A;  4I4P A;  3T8S A;  3F1C A;  2AAI B;  5FTS A;  3Q7Y A;  4M2A A;  4R6U B;  5B2H A;  1G9B A;  2F2F C;  2QYI B;  1AVX B;  4G3S A;  4LW6 A;  3OJV A;  3WIN A;  4HO6 A;  4IY9 A;  1H7L A;  2I7B A;  2XMH A;  1BFB A;  1H5T A;  5C8R A;  3OJM A;  3WO3 A;  3I0I X;  2VLC A;  4EE3 A;  1JLY A;  1BA7 A;  1Z0H A;  2VXT I;  5BVP I;  4JIS A;  5FV9 A;  1LL3 A;  2VK9 A;  3SX7 A;  4HO8 A;  3FOQ A;  2VSI A;  2NZ9 A;  2J0B A;  4EE5 A;  2UUS A;  2E4M A;  4CJM A;  1G9R A;  4EVW A;  3CA3 A;  5AJP A;  4GOV A;  3V0O A;  2Y9F A;  3HBW A;  3H6S E;  1ISW A;  1IIL A;  2AXM A;  3ZXD A;  4X37 A;  1IT0 A;  3V0A B;  1LZ0 A;  3RMY A;  4F83 A;  3DJ4 A;  4B4B A;  5C3D A;  2AEC A;  2DPW A;  4D48 A;  1FWU A;  2MIB A;  1FR8 A;  4Y9X A;  4DEC A;  1G97 A;  4OEF A;  3BAQ A;  4L4H A;  4I4S A;  1G93 A;  5CQN X;  1TOO A;  3BRD A;  3PKQ A;  2RIY A;  1A8D A;  2Q3N B;  3FJF A;  1HV9 A;  3BAO A;  1K4V A;  1FO8 A;  3OH4 A;  3QR5 A;  3BRK X;  4B5B A;  1V6X A;  4I0Y A;  3UD9 A;  3NBE A;  5C1G A;  7I1B A;  2D7I A;  2DS0 A;  3A23 A;  4F34 A;  4FCE A;  3VSZ A;  5DDV A;  5C4B A;  1ZI5 A;  2OI7 A;  2VU9 A;  3U0Y A;  1AVA C;  2HZ9 A;  3FUQ A;  4X39 A;  4ION A;  1ILR 1;  1HJJ A;  1H5S C;  4PC4 A;  4KC1 A;  4GAI A;  3V0B B;  2RJ4 A;  4XWI A;  1OMX A;  1WBC A;  5CQM X;  2RJ5 A;  1G0R A;  1ZI3 A;  1FGX A;  2HWA A;  4A7Z A;  3UD7 A;  1QQK A;  2P6W A;  1H5S D;  1MP5 A;  1XZZ A;  2J3P A;  1T4Q A;  4EEM A;  1FWY A;  1PUU B;  3BRG C;  1ZDG A;  3IAG C;  1V6W A;  2GGQ A;  3BAV A;  3CQA A;  2GGO A;  1PC8 B;  2I5K A;  2X5S A;  3OKR A;  1G9A A;  4FRD A;  3WIN C;  4Q9P A;  4HO3 A;  1Q1U A;  4WBC A;  5EHA A;  1ZJ0 A;  3KIA A;  2YES A;  4EFQ A;  1G3L A;  3ZLK A;  3HOM A;  4LO3 A;  2OEG A;  1I1B A;  1Q04 A;  2ET2 A;  4I3N A;  4Y6U A;  4QBC A;  4KC4 A;  2VSH A;  3CA5 A;  4M28 A;  3T7M A;  4XFS A;  3I0D A;  4IRQ A;  3WMU A;  4OWK A;  1H7H A;  3V0N A;  4A7Y A;  4CJB A;  1H4D A;  3U2V A;  1JYL A;  3NJ5 A;  3HSM A;  2MC2 A;  1HJL A;  4FRO A;  1H5S B;  3WO4 A;  1S0D A;  3FFZ A;  1QGS A;  3CKO A;  1WT0 A;  2MLL B;  3T7N A;  4M2B A;  1S0B A;  5L6V A;  2RIT A;  4EEG A;  1MD6 A;  2X5Z A;  2XOA A;  4FIX A;  4J18 A;  3SXA A;  1TZF A;  3PNN A;  3IM6 A;  1FXO A;  2O1H A;  1V82 A;  4IZE A;  1HM8 A;  1NF5 B;  3FJI A;  3CRI A;  3CGX A;  6I1B A;  1R81 A;  5I1F A;  3CKJ A;  1G82 A;  1ZJP A;  4J2K A;  4O6N A;  3NGW A;  1OQM B;  4DDZ A;  4IZX A;  1SS9 A;  4IRP A;  2WBC A;  1V83 A;  1DFQ A;  3RMX A;  5FU0 A;  2YUG A;  5BQU A;  3WMV A;  1LVW A;  5C47 A;  1WT2 A;  1BFC A;  1SZ6 B;  1VGZ A;  2P73 A;  3E8L C;  4NAN A;  4I4U A;  3BAU A;  4I4Q A;  1FWV A;  1ISY A;  2NTD A;  4MZH A;  1H7G A;  1XZ6 A;  4FRA A;  2WVL A;  3Q4S A;  1TP0 A;  1WBA A;  3CRH A;  4I2S A;  3N7M A;  2YCM A;  3OH0 A;  1KNM A;  1IJT A;  2ZQN A;  1YP2 A;  5DUY A;  1DZC A;  1QWJ A;  1ZIZ A;  5EG6 C;  3I2A A;  4Q91 A;  2WEE A;  1V84 A;  3FJJ A;  3O49 A;  4FVV A;  4C2S A;  4ZGR B;  3P6J A;  4IHZ A;  3OBR A;  5DVH A;  2YQH A;  3VWC A;  3VT1 A;  3RMV A;  1PUM B;  4LO0 C;  5C1H A;  4E1K A;  1S4P A;  1MP4 A;  3CKV A;  3N9W A;  4KC2 A;  4KEK A;  3USR A;  4BMA A;  1I52 A;  3PUB A;  4OEG A;  1EV2 A;  3O3P A;  4KT7 A;  4B42 A;  4EKX B;  2P72 A;  4HG6 A;  1EVT A;  1L2H A;  2FGF A;  1S0G A;  2Z49 A;  4LO8 B;  1FQ9 A;  4JQ0 A;  1BFG A;  4L41 C;  2VS3 A;  5C36 A;  1F31 A;  3B9U A;  4END A;  5C3B A;  1YRO B;  2NYY A;  2PA4 A;  3U2T A;  1TWE A;  4YS8 A;  4I7I A;  3SXB A;  1FR9 A;  1PZZ A;  1QGQ A;  3U2U A;  3E26 A;  1NQI B;  1O0R A;  3CAH A;  3ZXG A;  1G2V A;  3I0J A;  5D92 A;  2Z48 A;  1DFC A;  4P0J A;  5D61 A;  3OGF A;  4I37 A;  3RSJ A;  2KI6 B;  3OH1 A;  1GX0 A;  1JYK A;  3H6R B;  1R7Y A;  4JKQ A;  1ZJO A;  2PX7 A;  1YTO A;  3CRG A;  1DIW A;  2PGY A;  2ESU A;  2VS5 A;  3I0C A;  1YF8 B;  3K1X A;  1DLL A;  5F8S A;  3VSF A;  1AF9 A;  5BXP A;  1EYR A;  4JPZ A;  2BO6 A;  5BP5 C;  2Y7A A;  5BXC A;  1GWV A;  1FN0 A;  3BAH A;  1UPS A;  4II0 A;  4ZBV B;  4HJJ A;  1H5R A;  1I1E A;  1HM9 A;  3VEQ A;  2AM5 A;  3FJC A;  3N7K A;  5E24 E;  4Y6N A;  4CJ8 A;  1XG6 A;  3I0F A;  1CE7 B;  3D8V A;  5I1B A;  3I29 B;  1G9D A;  2LIQ A;  1QQL A;  4XFU A;  4I4V A;  2FFV A;  5D62 A;  4I4Y A;  4QAL A;  3H6Q A;  3MAL A;  3I0G A;  2AFG A;  3BX1 C;  2JCO A;  2V0H A;  2E8B A;  3IOH A;  5JQQ A;  4Y7V A;  1VGW A;  3AJ5 A;  2MZB A;  4LO2 C;  3OBT A;  4ECM A;  2BFH A;  1R80 A;  2RQ9 A;  3OJ2 A;  1W57 A;  1FV3 A;  3A07 A;  2V0K A;  4KNR A;  3F1R A;  1ZJ3 A;  4HR6 C;  1YBI A;  4KEI A;  2NP0 A;  3Q80 A;  4KEJ A;  2X2S A;  1YP4 A;  3F62 B;  4D0Z A;  2P39 A;  1BAS A;  1J0S A;  3UDA A;  3RTJ B;  4ZKT B;  3O4A A;  1OMZ A;  4QD2 C;  1W3A A;  1VM8 A;  2UX8 A;  3PKP A;  1DJS B;  1JT4 A;  4B4M A;  5EIY A;  4B2W A;  1Z2V A;  1NUN A;  3CU1 B;  2Z86 A;  2D44 A;  2F8X C;  1G95 A;  3AZW A;  3V0M A;  4CVH A;  3LLP A;  5C38 A;  1NKH B;  3CU0 A;  4I1E A;  3V0P A;  2RIZ A;  4UEG A;  1ISV A;  4P0L A;  1D0H A;  2RJ9 A;  2WE9 A;  4BQH A;  1AFC A;  3BB2 A;  4I4R A;  3SNV A;  1WT3 A;  3R4S A;  4I1B A;  1VH1 A;  2JCL A;  1JT3 A;  1T9F A;  4DCK C;  1ON6 A;  1R7V A;  3AJ6 A;  1VGU A;  2K8R A;  2JCK A;  4EB2 B;  2KH2 A;  4G6J A;  4GOY A;  2P23 A;  5CQO A;  4G9N A;  4DEN A;  4J2S A;  2AM4 A;  2QGI A;  2ERM A;  1YYN A;  2WAW A;  2PGV A;  2JCJ A;  5C4E A;  4JP0 A;  4AN6 A;  1H3M A;  2Y6P A;  3AZV A;  3P53 A;  3CA6 A;  5BXR A;  5IDS A;  3MPP G;  5AJN A;  3FJE A;  4QD2 B;  4XFT A;  3NBN A;  3O4D A;  4KBB A;  3FJB A;  1VGT A;  4P00 A;  2FYB A;  4DE7 A;  2E4M C;  3TZT A;  3HMY A;  1K5U A;  3POK A;  1GWW A;  5G00 A;  3IIR A;  1NHE B;  3FWW A;  4FRP A;  4G87 A;  4Q9G A;  1INI A;  4K6R A;  3UJ0 A;  3AKH A;  1R82 A;  3OH2 A;  4CJC A;  1NZK A;  1O7O A;  3VT2 A;  1ZI1 A;  2X2T A;  4AN7 B;  5EJZ A;  3A21 A;  1YP3 A;  4B2X A;  2AES A;  4EEA A;  3SXD A;  2VUA A;  2NS2 A;  2Y4M A;  3FJA A;  1S4O A;  1NWG B;  1JQZ A;  3BAD A;  3ZF8 A;  3SXG A;  3HL3 A;  2ZU7 A;  1QXM A;  4ISR A;  1BLD A;  1ZCT A;  2OI5 A;  4FRH A;  4X38 A;  2XWN A;  4FGF A;  3I2X A;  1IRA X;  2DRZ A;  3BRF A;  4FQW A;  1MC9 A;  3I0E A;  2KKI A;  3ZGG A;  1H5T B;  4IYB A;  4EEE B;  4P02 A;  1RY7 A;  1VPA A;  1H7F A;  1II4 A;  4I4X A;  4D8H A;  4J2X A;  2Y4L A;  5CMF X;  4ASY A;  4D11 A;  3O4B A;  4LO0 A;  4QO3 A;  2GO2 A;  3Q7X A;  1QG8 A;  4YOL A;  1FGG A;  3JUK A;  2FFU A;  1ONK B;  1S0C A;  2O1G A;  2D20 A;  2HW9 A;  3EE5 A;  4Y62 A;  4ZOT A;  5C3A A;  1BAR A;  2YQC A;  1GGP B;  5JMC A;  3TQD A;  1BFF A;  1PWA A;  1Z4S A;  2BEB A;  3O4C A;  3NBC A;  4ISQ A;  2FDB M;  1ITB A;  1WD3 A;  41BI A;  1DQO A;  1TW5 A;  1TVY A;  2C0N A;  5C49 A;  2RJ7 A;  1IOB A;  1ZJ2 A;  4ARW A;  1SR4 A;  2KLL A;  3BAG A;  4JAW A;  4OEE A;  1H4C A;  3ZGF A;  2AH9 A;  3SX5 A;  3RTI B;  3KMV A;  1TWM A;  1ZI4 A;  3IM5 A;  4LO3 C;  3DK5 A;  3JUT A;  3V0B A;  4EEO A;  1JV1 A;  1LZ7 A;  5AJO A;  4UY4 A;  1KWS A;  1V6U A;  1XYF A;  3AH2 A;  1EPW A;  5C4D A;  4QBV A;  3CA0 A;  2YC5 A;  3QVB A;  1ISX A;  4LW3 A;  3FJ9 A;  4M4K A;  2A8W A;  1V6V A;  5HPZ A;  1HWN B;  1IRP A;  3K8E A;  2Q9X A;  5D91 A;  1VCL A;  1JT7 A;  3K8D A;  4O6M A;  1HWP B;  4A7K A;  4G3Q A;  4I8M A;  1M16 A;  1IHK A;  1S0F A;  5DDT A;  2W0W A;  1HKN A;  3I0K A;  3RSB A;  1ABR B;  2I1B A;  2W0V A;  3R4U A;  2DRE A;  3JRR A;  3S8J A;  1GQC A;  4B4G A;  4FIY A;  3QYD A;  3D7W B;  2D0J A;  3F1Y A;  3PG0 A;  5CQL X;  3U2X A;  4GP3 A;  3AH4 A;  2E3D A;  1H5S A;  1HM0 A;  1WVC A;  3FGM A;  2D22 A;  4LO7 C;  2BO4 A;  5BQU C;  2OEF A;  2QKX A;  4FRQ A;  1RG8 A;  1CVS A;  3S8K A;  1ZCU A;  5FNW A;  4ZFU B;  5C4F A;  2YQS A;  3FJ8 A;  5BXS A;  1VH3 A;  4FRM A;  1NMM B;  3OH3 A;  2R9K B;  4MZF B;  1W77 A;  2FYD B;  5FTV A;  5J49 A;  3HN1 A;  1PZY B;  2Q4J A;  1WT1 A;  3LW6 A;  5GAQ A;  3VUO A;  1JY0 A;  3R3I A;  3EF2 A;  1TIE A;  2AQZ A;  3V8Y A;  1SR4 C;  3AKI A;  4IQP A;  4KPZ A;  4EFR A;  2VXR A;  1WD4 A;  4EE4 A;  3FJH A;  2Y9X E;  3NBD A;  1LZI A;  1G9C A;  4KPX A;  5FUH A;  3USQ A;  1VZT A;  2Y4K A;  1FV2 A;  2J0A A;  3O5W B;  1VZX A;  1IIN A;  3CKQ A;  2GZB A;  3WO2 A;  1W3F A;  3N0K A;  4G6M A;  3VT0 A;  4QC4 A;  1JVG A;  2VXL A;  2Y9W C;  4Y64 A;  4LO7 B;  1R7X A;  4Y7G A;  4HO5 A;  2CU2 A;  1FO9 A;  2ICY A;  2RJ8 A;  2ICX A;  1BLA A;  5F8W A;  4LO1 A;  3LTQ A;  3SXC A;  1TW1 A;  1DQG A;  3JUJ A;  4ZDQ A;  2O1F A;  2AM3 A;  3BA4 A;  3Q7W A;  3V8Z A;  4Z9W B;  4DEP A;  1LL2 A;  3U0X A;  4OUJ A;  2ZR1 B;  1DZD A;  1FMZ A;  2NM1 A;  1ZHJ A;  2DRY A;  2VFZ A;  3PHZ A;  1JTC A;  1R8O A;  3W9T A;  1R7T A;  1S4N A;  3I0L A;  1JT5 A;  3RMW A;  3AH1 A;  1AVU A;  5F90 A;  1EZI A;  4QKR A;  4NAL A;  1MP3 A;  2RJ0 A;  4NAK A;  4B3U A;  3ILA A;  5FYE A;  1INJ A;  1HWO B;  3D98 A;  1S0E A;  1FGA A;  2IWT B;  3O4O A;  2D23 A;  2D7R A;  3OGG A;  1MC3 A;  4KQL A;  2BO8 A;  2BO7 A;  4USO A;  2BEA A;  2YC3 A;  5HS2 A;  4I4O A;  2OI6 A;  2WGZ A;  4H04 A;  5FZY A;  1FZW A;  3ST8 A;  4OW4 A;  5CMH A;  5BXT A;  2YQJ A;  3TC2 A;  1E0O A;  4AYL A;  1K5V A;  3H6R A;  5JLV A;  4JKX B;  1P63 A;  4ZFW B;  1HWM B;  2A8U A;  4Z8S B;  2RJ1 A;  1S0L A;  9ILB A;  3CKN A;  3D5N A;  2AGD A;  3R2W A;  4Y63 A;  5EJ1 A;  5L6S A;  3IM7 A;  2LIE A;  4G9M A;  4XKI A;  2RJ6 A;  2RG9 B;  2KI4 A;  2D1Z A;  3N7J A;  4GAF A;  4I6I A;  4MZG B;  3BA5 A;  4ZA3 B;  1ZCV A;  2VD4 A;  2XWM A;  4IY8 A;  3I0H A;  4R7P A;  4G1R A;  3IOJ A;  3V90 A;  5DZU A;  3V91 A;  3JTJ A;  5CMI A;  3CA1 A;  1W55 A;  1OQL B;  2RST A;  1TTU A;  2ZU8 A;  5EC5 A;  2L5X A;  4QKS A;  1O23 B;  2V0L A;  2ZU9 A;  3E25 A;  3OC9 A;  4H75 A;  1WSZ A;  4HO9 A;  5FU8 A;  1PZT A;  2WRY A;  3V0A A;  3UD8 A;  1VZU A;  4FRB A;  3SX8 A;  1H5R B;  2FY7 A;  3V0L A;  5IFY A;  3ZX7 A;  3BCV A;  5FNX A;  1W3G A;  1GX4 A;  4OWL A;  4LO1 C;  3AKG A;  5IDT A;  1EYL A;  2VXM A;  1RZO B;  3UJ4 A;  5C4C A;  1Q03 A;  1E5K A;  4USP A;  2X60 A;  3T7O A;  4ZFY B;  2D24 A;  1FRW A;  1G1L A;  4Y7U A;  4GP0 A;  3Q7U A;  3OAM A;  4FCU A;  1M2T B;  1GQ9 A;  1LL0 A;  4ZLB B;  1HIB A;  2F2F A;  5FZU A;  5FZZ A;  1IIM A;  1GA8 A;  2I5E A;  31BI A;  4X3A A;  2WVM A;  1ISZ A;  2Y4J A;  3POL A;  1H7Q A;  1H4E A;  5D63 A;  5BP5 A;  5C1L A;  4EFP A;  1AVW B;  2XWL A;  1G8O A;  1ON8 A;  5CMJ A;  2FO1 A;  3AKF A;  4GBP A;  2NVH A;  1JV3 A;  4P6A A;  4FRE A;  2V0J A;  4HOC A;  5CMG X;  4JD0 A;  4AC3 A;  4MYB A;  1FOA A;  1Z90 A;  1R8N A;  3CA4 A;  3N7L A;  4HA2 A;  1ZCY A;  8I1B A;  2V0I A;  1LZJ A;  3O44 A;  4NAI A;  1AXM A;  4KC3 A;  3FUO A;  1XHB A;  2QH5 A;  1HCE A;  2NXV A;  2XME A;  1G23 A;  3DUV A;  2VS4 A;  1FMM S;  1JLX A;  1ZJ1 A;  2WVK A;  4G3P A;  2D43 A;  4HO4 A;  1VIC A;  4LO2 A;  4L4I A;  2K4A B;  4HCQ A;  2Z87 A;  5C48 A;  1FG5 N;  4Y7F A;  3BA7 A;  4Q7C A;  1ZDF A;  3ZC9 A;  1N4K A;  2VSA A;  4KNX A;  5DSS B;  3ZLL A;  4JRA A;  1TFM B;  2ZQO A;  4KXO A;  4J23 B;  4ASJ A;  2VSE A;  3PME A;  2HWM A;  4KRV A;  3GUE A;  3OGZ A;  4H9W A;  4FRL A;  5F8Y A;  2FYC B;  1H7E A;  2IHO A;  21BI A;  3BTA A;  4TLP A;  1R7U A;  3SXE A;  4D0T A;  3V0Q A;  1RML A;  3HAL A;  3ZC8 A;  5BOW A;  1JVD A;  3U2W A;  1HCD A;  4HO0 A;  2Y9G A;  4OWJ A;  4HO2 A;  3FJD A;  1YXW A;  2M49 A;  3V79 C;  2QN4 A;  2FYA A;  4MIX A;  3SX3 A;  3FJK A;  4P0K A;  4MND A;  2AE7 A;  4AYJ A;  3O3Q A;  2X65 A;  4Y7T A;  4AAW A;  3SPT A;  1O7Q A;  5CQP A;  4D11 C;  2RIX A;  3C9Z A;  2K43 A;  1H7T A;  3IOI A; 
#chains in the Genus database with same CATH homology
 3WA1 A;  3P6I A;  3A22 A;  1FXJ A;  2APC A;  4I96 A;  4J2Y A;  4I4P A;  3T8S A;  3F1C A;  2AAI B;  5FTS A;  3Q7Y A;  4M2A A;  4R6U B;  5B2H A;  1G9B A;  2F2F C;  2QYI B;  1AVX B;  4G3S A;  4LW6 A;  3OJV A;  3WIN A;  4HO6 A;  4IY9 A;  1H7L A;  2I7B A;  2XMH A;  1BFB A;  1H5T A;  5C8R A;  3OJM A;  3WO3 A;  3I0I X;  2VLC A;  4EE3 A;  1JLY A;  1BA7 A;  1Z0H A;  2VXT I;  5BVP I;  4JIS A;  5FV9 A;  1LL3 A;  2VK9 A;  3SX7 A;  4HO8 A;  3FOQ A;  2VSI A;  2NZ9 A;  2J0B A;  4EE5 A;  2UUS A;  2E4M A;  4CJM A;  1G9R A;  4EVW A;  3CA3 A;  5AJP A;  4GOV A;  3V0O A;  2Y9F A;  3HBW A;  3H6S E;  1ISW A;  1IIL A;  2AXM A;  3ZXD A;  4X37 A;  1IT0 A;  3V0A B;  1LZ0 A;  3RMY A;  4F83 A;  3DJ4 A;  4B4B A;  5C3D A;  2AEC A;  2DPW A;  4D48 A;  1FWU A;  2MIB A;  1FR8 A;  4Y9X A;  4DEC A;  1G97 A;  4OEF A;  3BAQ A;  4L4H A;  4I4S A;  1G93 A;  5CQN X;  1TOO A;  3BRD A;  3PKQ A;  2RIY A;  1A8D A;  2Q3N B;  3FJF A;  1HV9 A;  3BAO A;  1K4V A;  1FO8 A;  3OH4 A;  3QR5 A;  3BRK X;  4B5B A;  1V6X A;  4I0Y A;  3UD9 A;  3NBE A;  5C1G A;  7I1B A;  2D7I A;  2DS0 A;  3A23 A;  4F34 A;  4FCE A;  3VSZ A;  5DDV A;  5C4B A;  1ZI5 A;  2OI7 A;  2VU9 A;  3U0Y A;  1AVA C;  2HZ9 A;  3FUQ A;  4X39 A;  4ION A;  1ILR 1;  1HJJ A;  1H5S C;  4PC4 A;  4KC1 A;  4GAI A;  3V0B B;  2RJ4 A;  4XWI A;  1OMX A;  1WBC A;  5CQM X;  2RJ5 A;  1G0R A;  1ZI3 A;  1FGX A;  2HWA A;  4A7Z A;  3UD7 A;  1QQK A;  2P6W A;  1H5S D;  1MP5 A;  1XZZ A;  2J3P A;  1T4Q A;  4EEM A;  1FWY A;  1PUU B;  3BRG C;  1ZDG A;  3IAG C;  1V6W A;  2GGQ A;  3BAV A;  3CQA A;  2GGO A;  1PC8 B;  2I5K A;  2X5S A;  3OKR A;  1G9A A;  4FRD A;  3WIN C;  4Q9P A;  4HO3 A;  1Q1U A;  4WBC A;  5EHA A;  1ZJ0 A;  3KIA A;  2YES A;  4EFQ A;  1G3L A;  3ZLK A;  3HOM A;  4LO3 A;  2OEG A;  1I1B A;  1Q04 A;  2ET2 A;  4I3N A;  4Y6U A;  4QBC A;  4KC4 A;  2VSH A;  3CA5 A;  4M28 A;  3T7M A;  4XFS A;  3I0D A;  4IRQ A;  3WMU A;  4OWK A;  1H7H A;  3V0N A;  4A7Y A;  4CJB A;  1H4D A;  3U2V A;  1JYL A;  3NJ5 A;  3HSM A;  2MC2 A;  1HJL A;  4FRO A;  1H5S B;  3WO4 A;  1S0D A;  3FFZ A;  1QGS A;  3CKO A;  1WT0 A;  2MLL B;  3T7N A;  4M2B A;  1S0B A;  5L6V A;  2RIT A;  4EEG A;  1MD6 A;  2X5Z A;  2XOA A;  4FIX A;  4J18 A;  3SXA A;  1TZF A;  3PNN A;  3IM6 A;  1FXO A;  2O1H A;  1V82 A;  4IZE A;  1HM8 A;  1NF5 B;  3FJI A;  3CRI A;  3CGX A;  6I1B A;  1R81 A;  5I1F A;  3CKJ A;  1G82 A;  1ZJP A;  4J2K A;  4O6N A;  3NGW A;  1OQM B;  4DDZ A;  4IZX A;  1SS9 A;  4IRP A;  2WBC A;  1V83 A;  1DFQ A;  3RMX A;  5FU0 A;  2YUG A;  5BQU A;  3WMV A;  1LVW A;  5C47 A;  1WT2 A;  1BFC A;  1SZ6 B;  1VGZ A;  2P73 A;  3E8L C;  4NAN A;  4I4U A;  3BAU A;  4I4Q A;  1FWV A;  1ISY A;  2NTD A;  4MZH A;  1H7G A;  1XZ6 A;  4FRA A;  2WVL A;  3Q4S A;  1TP0 A;  1WBA A;  3CRH A;  4I2S A;  3N7M A;  2YCM A;  3OH0 A;  1KNM A;  1IJT A;  2ZQN A;  1YP2 A;  5DUY A;  1DZC A;  1QWJ A;  1ZIZ A;  5EG6 C;  3I2A A;  4Q91 A;  2WEE A;  1V84 A;  3FJJ A;  3O49 A;  4FVV A;  4C2S A;  4ZGR B;  3P6J A;  4IHZ A;  3OBR A;  5DVH A;  2YQH A;  3VWC A;  3VT1 A;  3RMV A;  1PUM B;  4LO0 C;  5C1H A;  4E1K A;  1S4P A;  1MP4 A;  3CKV A;  3N9W A;  4KC2 A;  4KEK A;  3USR A;  4BMA A;  1I52 A;  3PUB A;  4OEG A;  1EV2 A;  3O3P A;  4KT7 A;  4B42 A;  4EKX B;  2P72 A;  4HG6 A;  1EVT A;  1L2H A;  2FGF A;  1S0G A;  2Z49 A;  4LO8 B;  1FQ9 A;  4JQ0 A;  1BFG A;  4L41 C;  2VS3 A;  5C36 A;  1F31 A;  3B9U A;  4END A;  5C3B A;  1YRO B;  2NYY A;  2PA4 A;  3U2T A;  1TWE A;  4YS8 A;  4I7I A;  3SXB A;  1FR9 A;  1PZZ A;  1QGQ A;  3U2U A;  3E26 A;  1NQI B;  1O0R A;  3CAH A;  3ZXG A;  1G2V A;  3I0J A;  5D92 A;  2Z48 A;  1DFC A;  4P0J A;  5D61 A;  3OGF A;  4I37 A;  3RSJ A;  2KI6 B;  3OH1 A;  1GX0 A;  1JYK A;  3H6R B;  1R7Y A;  4JKQ A;  1ZJO A;  2PX7 A;  1YTO A;  3CRG A;  1DIW A;  2PGY A;  2ESU A;  2VS5 A;  3I0C A;  1YF8 B;  3K1X A;  1DLL A;  5F8S A;  3VSF A;  1AF9 A;  5BXP A;  1EYR A;  4JPZ A;  2BO6 A;  5BP5 C;  2Y7A A;  5BXC A;  1GWV A;  1FN0 A;  3BAH A;  1UPS A;  4II0 A;  4ZBV B;  4HJJ A;  1H5R A;  1I1E A;  1HM9 A;  3VEQ A;  2AM5 A;  3FJC A;  3N7K A;  5E24 E;  4Y6N A;  4CJ8 A;  1XG6 A;  3I0F A;  1CE7 B;  3D8V A;  5I1B A;  3I29 B;  1G9D A;  2LIQ A;  1QQL A;  4XFU A;  4I4V A;  2FFV A;  5D62 A;  4I4Y A;  4QAL A;  3H6Q A;  3MAL A;  3I0G A;  2AFG A;  3BX1 C;  2JCO A;  2V0H A;  2E8B A;  3IOH A;  5JQQ A;  4Y7V A;  1VGW A;  3AJ5 A;  2MZB A;  4LO2 C;  3OBT A;  4ECM A;  2BFH A;  1R80 A;  2RQ9 A;  3OJ2 A;  1W57 A;  1FV3 A;  3A07 A;  2V0K A;  4KNR A;  3F1R A;  1ZJ3 A;  4HR6 C;  1YBI A;  4KEI A;  2NP0 A;  3Q80 A;  4KEJ A;  2X2S A;  1YP4 A;  3F62 B;  4D0Z A;  2P39 A;  1BAS A;  1J0S A;  3UDA A;  3RTJ B;  4ZKT B;  3O4A A;  1OMZ A;  4QD2 C;  1W3A A;  1VM8 A;  2UX8 A;  3PKP A;  1DJS B;  1JT4 A;  4B4M A;  5EIY A;  4B2W A;  1Z2V A;  1NUN A;  3CU1 B;  2Z86 A;  2D44 A;  2F8X C;  1G95 A;  3AZW A;  3V0M A;  4CVH A;  3LLP A;  5C38 A;  1NKH B;  3CU0 A;  4I1E A;  3V0P A;  2RIZ A;  4UEG A;  1ISV A;  4P0L A;  1D0H A;  2RJ9 A;  2WE9 A;  4BQH A;  1AFC A;  3BB2 A;  4I4R A;  3SNV A;  1WT3 A;  3R4S A;  4I1B A;  1VH1 A;  2JCL A;  1JT3 A;  1T9F A;  4DCK C;  1ON6 A;  1R7V A;  3AJ6 A;  1VGU A;  2K8R A;  2JCK A;  4EB2 B;  2KH2 A;  4G6J A;  4GOY A;  2P23 A;  5CQO A;  4G9N A;  4DEN A;  4J2S A;  2AM4 A;  2QGI A;  2ERM A;  1YYN A;  2WAW A;  2PGV A;  2JCJ A;  5C4E A;  4JP0 A;  4AN6 A;  1H3M A;  2Y6P A;  3AZV A;  3P53 A;  3CA6 A;  5BXR A;  5IDS A;  3MPP G;  5AJN A;  3FJE A;  4QD2 B;  4XFT A;  3NBN A;  3O4D A;  4KBB A;  3FJB A;  1VGT A;  4P00 A;  2FYB A;  4DE7 A;  2E4M C;  3TZT A;  3HMY A;  1K5U A;  3POK A;  1GWW A;  5G00 A;  3IIR A;  1NHE B;  3FWW A;  4FRP A;  4G87 A;  4Q9G A;  1INI A;  4K6R A;  3UJ0 A;  3AKH A;  1R82 A;  3OH2 A;  4CJC A;  1NZK A;  1O7O A;  3VT2 A;  1ZI1 A;  2X2T A;  4AN7 B;  5EJZ A;  3A21 A;  1YP3 A;  4B2X A;  2AES A;  4EEA A;  3SXD A;  2VUA A;  2NS2 A;  2Y4M A;  3FJA A;  1S4O A;  1NWG B;  1JQZ A;  3BAD A;  3ZF8 A;  3SXG A;  3HL3 A;  2ZU7 A;  1QXM A;  4ISR A;  1BLD A;  1ZCT A;  2OI5 A;  4FRH A;  4X38 A;  2XWN A;  4FGF A;  3I2X A;  1IRA X;  2DRZ A;  3BRF A;  4FQW A;  1MC9 A;  3I0E A;  2KKI A;  3ZGG A;  1H5T B;  4IYB A;  4EEE B;  4P02 A;  1RY7 A;  1VPA A;  1H7F A;  1II4 A;  4I4X A;  4D8H A;  4J2X A;  2Y4L A;  5CMF X;  4ASY A;  4D11 A;  3O4B A;  4LO0 A;  4QO3 A;  2GO2 A;  3Q7X A;  1QG8 A;  4YOL A;  1FGG A;  3JUK A;  2FFU A;  1ONK B;  1S0C A;  2O1G A;  2D20 A;  2HW9 A;  3EE5 A;  4Y62 A;  4ZOT A;  5C3A A;  1BAR A;  2YQC A;  1GGP B;  5JMC A;  3TQD A;  1BFF A;  1PWA A;  1Z4S A;  2BEB A;  3O4C A;  3NBC A;  4ISQ A;  2FDB M;  1ITB A;  1WD3 A;  41BI A;  1DQO A;  1TW5 A;  1TVY A;  2C0N A;  5C49 A;  2RJ7 A;  1IOB A;  1ZJ2 A;  4ARW A;  1SR4 A;  2KLL A;  3BAG A;  4JAW A;  4OEE A;  1H4C A;  3ZGF A;  2AH9 A;  3SX5 A;  3RTI B;  3KMV A;  1TWM A;  1ZI4 A;  3IM5 A;  4LO3 C;  3DK5 A;  3JUT A;  3V0B A;  4EEO A;  1JV1 A;  1LZ7 A;  5AJO A;  4UY4 A;  1KWS A;  1V6U A;  1XYF A;  3AH2 A;  1EPW A;  5C4D A;  4QBV A;  3CA0 A;  2YC5 A;  3QVB A;  1ISX A;  4LW3 A;  3FJ9 A;  4M4K A;  2A8W A;  1V6V A;  5HPZ A;  1HWN B;  1IRP A;  3K8E A;  2Q9X A;  5D91 A;  1VCL A;  1JT7 A;  3K8D A;  4O6M A;  1HWP B;  4A7K A;  4G3Q A;  4I8M A;  1M16 A;  1IHK A;  1S0F A;  5DDT A;  2W0W A;  1HKN A;  3I0K A;  3RSB A;  1ABR B;  2I1B A;  2W0V A;  3R4U A;  2DRE A;  3JRR A;  3S8J A;  1GQC A;  4B4G A;  4FIY A;  3QYD A;  3D7W B;  2D0J A;  3F1Y A;  3PG0 A;  5CQL X;  3U2X A;  4GP3 A;  3AH4 A;  2E3D A;  1H5S A;  1HM0 A;  1WVC A;  3FGM A;  2D22 A;  4LO7 C;  2BO4 A;  5BQU C;  2OEF A;  2QKX A;  4FRQ A;  1RG8 A;  1CVS A;  3S8K A;  1ZCU A;  5FNW A;  4ZFU B;  5C4F A;  2YQS A;  3FJ8 A;  5BXS A;  1VH3 A;  4FRM A;  1NMM B;  3OH3 A;  2R9K B;  4MZF B;  1W77 A;  2FYD B;  5FTV A;  5J49 A;  3HN1 A;  1PZY B;  2Q4J A;  1WT1 A;  3LW6 A;  5GAQ A;  3VUO A;  1JY0 A;  3R3I A;  3EF2 A;  1TIE A;  2AQZ A;  3V8Y A;  1SR4 C;  3AKI A;  4IQP A;  4KPZ A;  4EFR A;  2VXR A;  1WD4 A;  4EE4 A;  3FJH A;  2Y9X E;  3NBD A;  1LZI A;  1G9C A;  4KPX A;  5FUH A;  3USQ A;  1VZT A;  2Y4K A;  1FV2 A;  2J0A A;  3O5W B;  1VZX A;  1IIN A;  3CKQ A;  2GZB A;  3WO2 A;  1W3F A;  3N0K A;  4G6M A;  3VT0 A;  4QC4 A;  1JVG A;  2VXL A;  2Y9W C;  4Y64 A;  4LO7 B;  1R7X A;  4Y7G A;  4HO5 A;  2CU2 A;  1FO9 A;  2ICY A;  2RJ8 A;  2ICX A;  1BLA A;  5F8W A;  4LO1 A;  3LTQ A;  3SXC A;  1TW1 A;  1DQG A;  3JUJ A;  4ZDQ A;  2O1F A;  2AM3 A;  3BA4 A;  3Q7W A;  3V8Z A;  4Z9W B;  4DEP A;  1LL2 A;  3U0X A;  4OUJ A;  2ZR1 B;  1DZD A;  1FMZ A;  2NM1 A;  1ZHJ A;  2DRY A;  2VFZ A;  3PHZ A;  1JTC A;  1R8O A;  3W9T A;  1R7T A;  1S4N A;  3I0L A;  1JT5 A;  3RMW A;  3AH1 A;  1AVU A;  5F90 A;  1EZI A;  4QKR A;  4NAL A;  1MP3 A;  2RJ0 A;  4NAK A;  4B3U A;  3ILA A;  5FYE A;  1INJ A;  1HWO B;  3D98 A;  1S0E A;  1FGA A;  2IWT B;  3O4O A;  2D23 A;  2D7R A;  3OGG A;  1MC3 A;  4KQL A;  2BO8 A;  2BO7 A;  4USO A;  2BEA A;  2YC3 A;  5HS2 A;  4I4O A;  2OI6 A;  2WGZ A;  4H04 A;  5FZY A;  1FZW A;  3ST8 A;  4OW4 A;  5CMH A;  5BXT A;  2YQJ A;  3TC2 A;  1E0O A;  4AYL A;  1K5V A;  3H6R A;  5JLV A;  4JKX B;  1P63 A;  4ZFW B;  1HWM B;  2A8U A;  4Z8S B;  2RJ1 A;  1S0L A;  9ILB A;  3CKN A;  3D5N A;  2AGD A;  3R2W A;  4Y63 A;  5EJ1 A;  5L6S A;  3IM7 A;  2LIE A;  4G9M A;  4XKI A;  2RJ6 A;  2RG9 B;  2KI4 A;  2D1Z A;  3N7J A;  4GAF A;  4I6I A;  4MZG B;  3BA5 A;  4ZA3 B;  1ZCV A;  2VD4 A;  2XWM A;  4IY8 A;  3I0H A;  4R7P A;  4G1R A;  3IOJ A;  3V90 A;  5DZU A;  3V91 A;  3JTJ A;  5CMI A;  3CA1 A;  1W55 A;  1OQL B;  2RST A;  1TTU A;  2ZU8 A;  5EC5 A;  2L5X A;  4QKS A;  1O23 B;  2V0L A;  2ZU9 A;  3E25 A;  3OC9 A;  4H75 A;  1WSZ A;  4HO9 A;  5FU8 A;  1PZT A;  2WRY A;  3V0A A;  3UD8 A;  1VZU A;  4FRB A;  3SX8 A;  1H5R B;  2FY7 A;  3V0L A;  5IFY A;  3ZX7 A;  3BCV A;  5FNX A;  1W3G A;  1GX4 A;  4OWL A;  4LO1 C;  3AKG A;  5IDT A;  1EYL A;  2VXM A;  1RZO B;  3UJ4 A;  5C4C A;  1Q03 A;  1E5K A;  4USP A;  2X60 A;  3T7O A;  4ZFY B;  2D24 A;  1FRW A;  1G1L A;  4Y7U A;  4GP0 A;  3Q7U A;  3OAM A;  4FCU A;  1M2T B;  1GQ9 A;  1LL0 A;  4ZLB B;  1HIB A;  2F2F A;  5FZU A;  5FZZ A;  1IIM A;  1GA8 A;  2I5E A;  31BI A;  4X3A A;  2WVM A;  1ISZ A;  2Y4J A;  3POL A;  1H7Q A;  1H4E A;  5D63 A;  5BP5 A;  5C1L A;  4EFP A;  1AVW B;  2XWL A;  1G8O A;  1ON8 A;  5CMJ A;  2FO1 A;  3AKF A;  4GBP A;  2NVH A;  1JV3 A;  4P6A A;  4FRE A;  2V0J A;  4HOC A;  5CMG X;  4JD0 A;  4AC3 A;  4MYB A;  1FOA A;  1Z90 A;  1R8N A;  3CA4 A;  3N7L A;  4HA2 A;  1ZCY A;  8I1B A;  2V0I A;  1LZJ A;  3O44 A;  4NAI A;  1AXM A;  4KC3 A;  3FUO A;  1XHB A;  2QH5 A;  1HCE A;  2NXV A;  2XME A;  1G23 A;  3DUV A;  2VS4 A;  1FMM S;  1JLX A;  1ZJ1 A;  2WVK A;  4G3P A;  2D43 A;  4HO4 A;  1VIC A;  4LO2 A;  4L4I A;  2K4A B;  4HCQ A;  2Z87 A;  5C48 A;  1FG5 N;  4Y7F A;  3BA7 A;  4Q7C A;  1ZDF A;  3ZC9 A;  1N4K A;  2VSA A;  4KNX A;  5DSS B;  3ZLL A;  4JRA A;  1TFM B;  2ZQO A;  4KXO A;  4J23 B;  4ASJ A;  2VSE A;  3PME A;  2HWM A;  4KRV A;  3GUE A;  3OGZ A;  4H9W A;  4FRL A;  5F8Y A;  2FYC B;  1H7E A;  2IHO A;  21BI A;  3BTA A;  4TLP A;  1R7U A;  3SXE A;  4D0T A;  3V0Q A;  1RML A;  3HAL A;  3ZC8 A;  5BOW A;  1JVD A;  3U2W A;  1HCD A;  4HO0 A;  2Y9G A;  4OWJ A;  4HO2 A;  3FJD A;  1YXW A;  2M49 A;  3V79 C;  2QN4 A;  2FYA A;  4MIX A;  3SX3 A;  3FJK A;  4P0K A;  4MND A;  2AE7 A;  4AYJ A;  3O3Q A;  2X65 A;  4Y7T A;  4AAW A;  3SPT A;  1O7Q A;  5CQP A;  4D11 C;  2RIX A;  3C9Z A;  2K43 A;  1H7T A;  3IOI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...