2ZQOA

Crystal structure of the earthworm r-type lectin c-half in complex with galnac
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
130
structure length
130
Chain Sequence
PKFFYIKSELNGKVLDIEGQNPAPGSKIITWDQKKGPTAVNQLWYTDQQGVIRSKLNDFAIDASHEQIETQPFDPNNPKRAWIVSGNTIAQLSDRDIVLDIIKSDKEAGAHICAWKQHGGPNQKFIIESE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Sugar binding protein
molecule keywords 29-kDa galactose-binding lectin
publication title Sugar-complex structures of the C-half domain of the galactose-binding lectin EW29 from the earthworm Lumbricus terrestris
pubmed doi rcsb
source organism Lumbricus terrestris
total genus 37
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 2zqoA00
2P23A 1EPWA 4I4UA 2BFHA 2ESUA 4EFPA 1OQLB 1RG8A 1S0EA 3WO3A 4JP0A 3A07A 5JMCA 1HKNA 1S0GA 1DQOA 3FUOA 3C9ZA 4Q9PA 3JRRA 3QR5A 4I6IA 4LO1A 3O4CA 4DENA 1D0HA 2WRYA 4IONA 2Y9GA 2QN4A 3O4BA 3N0KA 3OGFA 4QO3A 1AF9A 4WBCA 4TLPA 5DZUA 2DRYA 5F8WA 2HW9A 3HOMA 1TIEA 3N7LA 3A21A 1AVAC 1ISZA 3AH4A 4G1RA 2HWMA 1DFCA 1L2HA 8I1BA 1PUMB 2VUAA 1R8NA 2D24A 3NJ5A 3AJ6A 1HWPB 1IOBA 1JQZA 4J2KA 3HALA 1ABRB 2IWTB 3PUBA 1SR4C 2D23A 4JRAA 2LIQA 2F8XC 3O5WB 3RSJA 2Q9XA 3IM6A 3HBWA 3PHZA 3AH2A 3VSFA 3HN1A 5I1BA 1PWAA 5BXRA 1V6VA 1IRAX 1T9FA 3JUTA 1Z2VA 4QBVA 2GO2A 3AZWA 1YBIA 31BIA 3UJ0A 3O44A 4L4IA 3BAVA 4XFUA 1PZZA 1Q04A 2D44A 3SNVA 1TOOA 4OEGA 3H6SE 3NBCA 4I4PA 4IHZA 4LO8B 4JAWA 1AVWB 2R9KB 5BXPA 1F31A 1BARA 2D43A 1YYNA 4ZGRB 4KEJA 2KLLA 1A8DA 3TC2A 3WINC 5BOWA 1RY7A 2M49A 3AJ5A 3CRIA 4H9WA 1YF8B 4QBCA 2VXRA 2KI6B 4OEFA 2Y9XE 1IILA 3V0AB 4D0ZA 1W3FA 4D8HA 4YOLA 1ISVA 1EYLA 1BLDA 2LIEA 1SR4A 5F8SA 1PC8B 4I37A 3I29B 4DEPA 3AH1A 1SZ6B 1VCLA 4KC3A 2NZ9A 3WMUA 1S0DA 4IZEA 3ILAA 21BIA 4LO7B 4R6UB 3V0BA 1JTCA 3N7MA 1J0SA 1V6XA 4HJJA 2FGFA 1W3AA 3EF2A 3OJ2A 2VSAA 3BAUA 3BRDA 4A7YA 1FN0A 1FWVA 4I3NA 4GP0A 2Y9FA 3POKA 3CQAA 3RTJB 3FJIA 4I2SA 3B9UA 4Z8SB 3IAGC 2D1ZA 4XFSA 4EB2B 4I4QA 3UD8A 4ZA3B 4JKQA 2XOAA 1V6WA 2FFVA 3WA1A 2ZR1B 3FJHA 1JLXA 1QQLA 3NBEA 4ZBVB 1K5UA 2Q3NB 3BA4A 5EHAA 3WINA 4J23B 3VEQA 2VSEA 3A22A 5FNWA 3VSZA 2AFGA 3VT1A 3UD7A 3RMYA 2D22A 4X38A 3CRHA 3RTIB 4I96A 1S0FA 1MC9A 4LO3C 3P6IA 1XG6A 3BA7A 3AZVA 2F2FC 3P6JA 4I4OA 1FQ9A 3WO2A 3UD9A 5HPZA 4USOA 3RMXA 3FJ9A 1DFQA 3NBDA 1G9DA 4J2XA 1RZOB 1Z0HA 1IJTA 4KBBA 1FV3A 1HIBA 3BRGC 4ISRA 3HMYA 2D7IA 4XFTA 1N4KA 4ZKTB 1NZKA 1TFMB 2MLLB 5EG6C 3OBTA 4IY9A 9ILBA 3FJJA 2X2SA 2ZQNA 3O49A 3I2AA 3P53A 2Z48A 3V79C 4G9NA 2RSTA 3F62B 3I2XA 4DCKC 1GGPB 4G6MA 3N7KA 3CA5A 3BB2A 3UJ4A 4HA2A 2Z49A 2KI4A 3BA5A 3FJCA 1S0CA 2FO1A 1G9BA 2K4AB 3HSMA 2MIBA 1TWEA 1DZCA 1EV2A 4I4YA 5FZUA 5BP5C 4LO3A 3K1XA 1HWMB 3VT2A 4Q91A 2J3PA 3BTAA 5G00A 4JQ0A 2F2FA 2E4MC 3BAOA 4I0YA 3A23A 3WMVA 3CA0A 1DZDA 3FJDA 1TWMA 2VXTI 1T4QA 2K8RA 1R8OA 2YUGA 1W3GA 4LO2C 3FFZA 4X39A 1JT5A 1FWUA 1BFBA 4QKSA 3CA3A 1YTOA 2HWAA 1WBAA 3OGGA 3V0BB 1ILR1 3O3QA 4P0JA 2VLCA 4L4HA 4QD2B 4FGFA 1HWNB 3AKIA 4OWLA 1S0LA 3PG0A 4LO7C 1M2TB 3H6RA 4PC4A 2P39A 2AAIB 1XYFA 5FNXA 3MALA 5D62A 4KEIA 4ENDA 2AXMA 4OEEA 4GP3A 4HR6C 4Q9GA 4EFRA 4ZFYB 1II4A 1BA7A 2Y9WC 3OJVA 4XKIA 5BXTA 1WD4A 1JLYA 3FJKA 5BQUC 2FDBM 3CA4A 4LO1C 3Q7WA 4QC4A 1WD3A 5BP5A 4GAIA 2GZBA 3H6QA 2E4MA 3S8KA 3KMVA 4Z9WB 3E8LC 1AXMA 3O4AA 1MD6A 2D7RA 1RMLA 2NTDA 5JLVA 1G82A 2K43A 1AFCA 1P63A 4CJMA 1G9AA 3NBNA 4I8MA 1JT4A 3FJAA 4LO2A 3ZX7A 1DLLA 2UUSA 4I1BA 4EKXB 1Q1UA 41BIA 3R4SA 3S8JA 1PUUB 3FJBA 3CU1B 1FGAA 4F83A 3VUOA 3ZXGA 3LTQA 1TP0A 3IIRA 4OW4A 4P0LA 5E24E 3F1RA 3BAQA 4I4XA 1DIWA 1BFGA 1DJSB 3AKGA 1M16A 3FGMA 4GOVA 1E0OA 1I1BA 2ZQOA 5BQUA 2FFUA 2L5XA 1IT0A 1K5VA 1BFFA 2IHOA 2DRZA 2NYYA 3FJEA 3VWCA 3CRGA 2BEBA 3ZC9A 1EVTA 1HCDA 4OWKA 2NP0A 5D61A 1BLAA 1HWOB 1CE7B 4ISQA 4AN7B 4II0A 3N7JA 2KKIA 1S0BA 4X3AA 1FMMS 4G9MA 3D7WB 3FJFA 2DREA 2BEAA 5F8YA 5B2HA 2ET2A 4IY8A 2RQ9A 4OWJA 1ISXA 2VU9A 2X2TA 5F90A 1V6UA 4IZXA 4I4VA 1JT7A 4IYBA 4EFQA 4KEKA 4USPA 3BRFA 3PMEA 1CVSA 2ERMA 1DQGA 3AKFA 2WBCA 3H6RB 4A7ZA 3QYDA 2HZ9A 3O4DA 1FV2A 4IQPA 3AKHA 4QD2C 1IRPA 3BAGA 3O4OA 2MC2A 3VT0A 5DUYA 4D0TA 1BFCA 1ISWA 4I7IA 1KNMA 6I1BA 4X37A 3MPPG 3OBRA 4I1EA 4J2SA 4LO0C 3ZXDA 1QQKA 2KH2A 3CA1A 1I1EA 1XZZA 3BADA 4ZFWB 4QKRA 3FJ8A 3R4UA 4GOYA 3IM7A 1G9CA 1WBCA 3UDAA 3IM5A 1JT3A 7I1BA 4GAFA 1Q03A 3FUQA 4ZFUB 4I4SA 5BXSA 3LLPA 1HCEA 4JKXB 2I1BA 1TTUA 4OUJA 3W9TA 3ZC8A 3WO4A 2D20A 4I4RA 5DVHA 1XHBA 5D63A 4EEEB 1FMZA 5DSSB 2NVHA 3CA6A 4FVVA 5FZYA 1ITBA 3OJMA 4J2YA 1IHKA 4P6AA 4ZOTA 3V0AA 5GAQA 3CAHA 1BASA 2NM1A 4JPZA 4P0KA 3T8SA 1QXMA 3Q7XA 1YXWA 1AVUA 5BVPI 5FZZA 2QYIB 2DS0A 4F34A 4A7KA 5EC5A 1NUNA 3BX1C 4H04A 4ZLBB 3BAHA 1JY0A 4LO0A 1UPSA 1Z4SA 1ISYA 4QALA 1AVXB 4AN6A 1ONKB 3Q7YA 2RG9B 4G6JA 2AQZA
chains in the Genus database with same CATH superfamily
2P23A 1EPWA 4I4UA 2BFHA 2ESUA 4EFPA 1OQLB 1RG8A 1S0EA 3WO3A 4JP0A 3A07A 5JMCA 1HKNA 1S0GA 1DQOA 3FUOA 3C9ZA 4Q9PA 3JRRA 3QR5A 4I6IA 4LO1A 3O4CA 4DENA 1D0HA 2WRYA 4IONA 2Y9GA 2QN4A 3O4BA 3N0KA 3OGFA 4QO3A 1AF9A 4WBCA 4TLPA 5DZUA 4UY4A 2DRYA 5F8WA 2HW9A 3HOMA 1TIEA 3N7LA 3A21A 1AVAC 1ISZA 3AH4A 4G1RA 2HWMA 1DFCA 1L2HA 8I1BA 1PUMB 2VUAA 1R8NA 2D24A 3NJ5A 3AJ6A 1HWPB 1IOBA 1JQZA 4J2KA 3HALA 1ABRB 2IWTB 3PUBA 1SR4C 2D23A 4JRAA 2LIQA 2F8XC 3O5WB 3RSJA 2Q9XA 3IM6A 4H75A 3HBWA 3PHZA 3AH2A 3VSFA 3HN1A 5I1BA 1PWAA 5BXRA 1V6VA 1IRAX 1T9FA 3JUTA 1Z2VA 4QBVA 2GO2A 3AZWA 1YBIA 31BIA 3UJ0A 3O44A 4L4IA 3BAVA 4XFUA 1PZZA 1Q04A 2D44A 3SNVA 1TOOA 4OEGA 3H6SE 3NBCA 4I4PA 4IHZA 4LO8B 4JAWA 1AVWB 2R9KB 5BXPA 1F31A 1BARA 2D43A 1YYNA 4ZGRB 4KEJA 2KLLA 1A8DA 3TC2A 3WINC 5BOWA 1RY7A 2M49A 3AJ5A 3CRIA 4H9WA 1YF8B 4QBCA 2VXRA 2KI6B 4OEFA 2Y9XE 1IILA 3V0AB 4D0ZA 1W3FA 4D8HA 4YOLA 1ISVA 1EYLA 1BLDA 2LIEA 1SR4A 5F8SA 1PC8B 4I37A 3I29B 4DEPA 3AH1A 1SZ6B 1VCLA 4KC3A 2NZ9A 3WMUA 1S0DA 4IZEA 3ILAA 21BIA 4LO7B 4R6UB 3V0BA 1JTCA 3N7MA 1J0SA 1V6XA 4HJJA 2FGFA 1W3AA 3EF2A 3OJ2A 2VSAA 3BAUA 3BRDA 4A7YA 1FN0A 1FWVA 4I3NA 4GP0A 2Y9FA 3POKA 3CQAA 3RTJB 3FJIA 4I2SA 3B9UA 4Z8SB 3IAGC 2D1ZA 4XFSA 4EB2B 4I4QA 3UD8A 4ZA3B 4JKQA 2XOAA 1V6WA 2FFVA 3WA1A 2ZR1B 3FJHA 1JLXA 1QQLA 3NBEA 4ZBVB 1K5UA 2Q3NB 3BA4A 5EHAA 3WINA 4J23B 3VEQA 2VSEA 3A22A 5FNWA 3VSZA 2AFGA 3VT1A 3UD7A 3RMYA 2D22A 4X38A 3CRHA 3RTIB 4I96A 1S0FA 1MC9A 4LO3C 3P6IA 1XG6A 3BA7A 3AZVA 2F2FC 3P6JA 4I4OA 1FQ9A 3WO2A 3UD9A 5HPZA 4USOA 3RMXA 3FJ9A 1DFQA 3NBDA 1G9DA 4J2XA 1RZOB 1Z0HA 1IJTA 4KBBA 1FV3A 1HIBA 3BRGC 4ISRA 3HMYA 2D7IA 4XFTA 1N4KA 4ZKTB 1NZKA 1TFMB 2MLLB 5EG6C 3OBTA 4IY9A 4MZHA 3FJJA 9ILBA 2X2SA 2ZQNA 3O49A 3I2AA 3P53A 2Z48A 3V79C 4G9NA 2RSTA 3F62B 3I2XA 4DCKC 1GGPB 4G6MA 3N7KA 3CA5A 3BB2A 3UJ4A 4HA2A 2Z49A 4MZGB 2KI4A 3BA5A 3FJCA 1S0CA 2FO1A 1G9BA 2K4AB 3HSMA 2MIBA 1TWEA 1DZCA 1EV2A 4I4YA 5FZUA 5BP5C 4LO3A 3K1XA 1HWMB 3VT2A 4Q91A 2J3PA 3BTAA 2NS2A 5G00A 4JQ0A 2F2FA 2E4MC 3BAOA 4I0YA 3A23A 3WMVA 3CA0A 1DZDA 3FJDA 1TWMA 2VXTI 1T4QA 2K8RA 1R8OA 2YUGA 1W3GA 4LO2C 3FFZA 4X39A 1JT5A 1FWUA 1BFBA 4QKSA 3CA3A 1YTOA 2HWAA 1WBAA 3OGGA 3V0BB 1ILR1 3O3QA 4P0JA 2VLCA 4L4HA 4QD2B 4FGFA 1HWNB 3AKIA 4OWLA 1S0LA 3PG0A 4LO7C 1M2TB 3H6RA 4PC4A 2P39A 2AAIB 1XYFA 5FNXA 3MALA 5D62A 4KEIA 4ENDA 2AXMA 4OEEA 4GP3A 4HR6C 4Q9GA 4EFRA 4ZFYB 1II4A 1BA7A 2Y9WC 3OJVA 4XKIA 5BXTA 1WD4A 1JLYA 3FJKA 5BQUC 2FDBM 3CA4A 4LO1C 3Q7WA 4QC4A 1WD3A 5BP5A 4GAIA 4MZFB 2GZBA 3H6QA 2E4MA 3S8KA 3KMVA 4Z9WB 3E8LC 1AXMA 3O4AA 1MD6A 2D7RA 1RMLA 2NTDA 5JLVA 1G82A 2K43A 1AFCA 1P63A 4CJMA 1G9AA 3NBNA 4I8MA 1JT4A 3FJAA 4LO2A 3ZX7A 1DLLA 2UUSA 4I1BA 4EKXB 1Q1UA 41BIA 3R4SA 3S8JA 1PUUB 3FJBA 3CU1B 1FGAA 4F83A 3VUOA 3ZXGA 3LTQA 1TP0A 3IIRA 4OW4A 4P0LA 5E24E 3F1RA 3BAQA 4I4XA 1DIWA 1BFGA 1DJSB 3AKGA 1M16A 3FGMA 4GOVA 1E0OA 1I1BA 2ZQOA 5BQUA 2FFUA 2L5XA 1IT0A 1K5VA 1BFFA 2IHOA 2DRZA 2NYYA 3FJEA 3VWCA 3CRGA 2BEBA 3ZC9A 1EVTA 1HCDA 4OWKA 2NP0A 5D61A 1BLAA 1HWOB 1CE7B 4ISQA 4AN7B 4II0A 3N7JA 2KKIA 1S0BA 4X3AA 1FMMS 4G9MA 3D7WB 3FJFA 2DREA 2BEAA 5F8YA 5B2HA 2ET2A 4IY8A 2RQ9A 4OWJA 1ISXA 2VU9A 2X2TA 5F90A 1V6UA 4IZXA 4I4VA 1JT7A 4IYBA 4EFQA 4KEKA 4USPA 3BRFA 3PMEA 1CVSA 2ERMA 1DQGA 3AKFA 2WBCA 3H6RB 4A7ZA 3QYDA 2HZ9A 3O4DA 1FV2A 4IQPA 3AKHA 4QD2C 1IRPA 3BAGA 3O4OA 2MC2A 3VT0A 5DUYA 4D0TA 1BFCA 1ISWA 4I7IA 1KNMA 6I1BA 4X37A 3MPPG 3OBRA 4I1EA 4J2SA 4LO0C 3ZXDA 1QQKA 2KH2A 3CA1A 1I1EA 1XZZA 3BADA 4ZFWB 4QKRA 3FJ8A 3R4UA 4GOYA 3IM7A 1G9CA 1WBCA 3UDAA 3IM5A 1JT3A 7I1BA 4GAFA 1Q03A 3FUQA 4ZFUB 4I4SA 5BXSA 3LLPA 1HCEA 4JKXB 2I1BA 1TTUA 4OUJA 3W9TA 3ZC8A 3WO4A 2D20A 4I4RA 5DVHA 1XHBA 5D63A 4EEEB 1FMZA 5DSSB 2NVHA 3CA6A 4FVVA 5FZYA 1ITBA 3OJMA 4J2YA 1IHKA 4P6AA 4ZOTA 3V0AA 5GAQA 3CAHA 1BASA 2NM1A 4JPZA 4P0KA 3T8SA 1QXMA 3Q7XA 1YXWA 1AVUA 5BVPI 5FZZA 2QYIB 2DS0A 4F34A 4A7KA 5EC5A 1NUNA 3BX1C 4H04A 4ZLBB 3BAHA 1JY0A 4LO0A 1UPSA 1Z4SA 1ISYA 4QALA 1AVXB 4AN6A 1ONKB 3Q7YA 2RG9B 4G6JA 2AQZA
chains in the Genus database with same CATH topology
2P23A 1EPWA 4I4UA 2BFHA 2ESUA 4EFPA 1OQLB 1RG8A 1S0EA 3WO3A 4JP0A 3A07A 5JMCA 1HKNA 1S0GA 1DQOA 3FUOA 3C9ZA 4Q9PA 3JRRA 3QR5A 4I6IA 4LO1A 3O4CA 4DENA 1D0HA 2WRYA 4IONA 2Y9GA 2QN4A 3O4BA 3N0KA 3OGFA 4QO3A 1AF9A 4WBCA 4TLPA 5DZUA 4UY4A 2DRYA 5F8WA 2HW9A 3HOMA 1TIEA 3N7LA 3A21A 1AVAC 1ISZA 3AH4A 4G1RA 2HWMA 1DFCA 1L2HA 8I1BA 1PUMB 2VUAA 1R8NA 2D24A 3NJ5A 3AJ6A 1HWPB 1IOBA 1JQZA 4J2KA 3HALA 1ABRB 2IWTB 3PUBA 1SR4C 2D23A 4JRAA 2LIQA 2F8XC 3O5WB 3RSJA 2Q9XA 3IM6A 4H75A 3HBWA 3PHZA 3AH2A 3VSFA 3HN1A 5I1BA 1PWAA 5BXRA 1V6VA 1IRAX 1T9FA 3JUTA 1Z2VA 4QBVA 2GO2A 3AZWA 1YBIA 31BIA 3UJ0A 3O44A 4L4IA 3BAVA 4XFUA 1PZZA 1Q04A 2D44A 3SNVA 1TOOA 4OEGA 3H6SE 3NBCA 4I4PA 4IHZA 4LO8B 4JAWA 1AVWB 2R9KB 5BXPA 1F31A 1BARA 2D43A 1YYNA 4ZGRB 4KEJA 2KLLA 1A8DA 3TC2A 3WINC 5BOWA 1RY7A 2M49A 3AJ5A 3CRIA 4H9WA 1YF8B 4QBCA 2VXRA 2KI6B 4OEFA 2Y9XE 1IILA 3V0AB 4D0ZA 1W3FA 4D8HA 4YOLA 1ISVA 1EYLA 1BLDA 2LIEA 1SR4A 5F8SA 1PC8B 4I37A 3I29B 4DEPA 3AH1A 1SZ6B 1VCLA 4KC3A 2NZ9A 3WMUA 1S0DA 4IZEA 3ILAA 21BIA 4LO7B 4R6UB 3V0BA 1JTCA 3N7MA 1J0SA 1V6XA 4HJJA 2FGFA 1W3AA 3EF2A 3OJ2A 2VSAA 3BAUA 3BRDA 4A7YA 1FN0A 1FWVA 4I3NA 4GP0A 2Y9FA 3POKA 3CQAA 3RTJB 3FJIA 4I2SA 3B9UA 4Z8SB 3IAGC 2D1ZA 4XFSA 4EB2B 4I4QA 3UD8A 4ZA3B 4JKQA 2XOAA 1V6WA 2FFVA 3WA1A 2ZR1B 3FJHA 1JLXA 1QQLA 3NBEA 4ZBVB 1K5UA 2Q3NB 3BA4A 5EHAA 3WINA 4J23B 3VEQA 2VSEA 3A22A 5FNWA 3VSZA 2AFGA 3VT1A 3UD7A 3RMYA 2D22A 4X38A 3CRHA 3RTIB 4I96A 1S0FA 1MC9A 4LO3C 3P6IA 1XG6A 3BA7A 3AZVA 2F2FC 3P6JA 4I4OA 1FQ9A 3WO2A 3UD9A 5HPZA 4USOA 3RMXA 3FJ9A 1DFQA 3NBDA 1G9DA 4J2XA 1RZOB 1Z0HA 1IJTA 4KBBA 1FV3A 1HIBA 3BRGC 4ISRA 3HMYA 2D7IA 4XFTA 1N4KA 4ZKTB 1NZKA 1TFMB 2MLLB 5EG6C 3OBTA 4IY9A 4MZHA 3FJJA 9ILBA 2X2SA 2ZQNA 3O49A 3I2AA 3P53A 2Z48A 3V79C 4G9NA 2RSTA 3F62B 3I2XA 4DCKC 1GGPB 4G6MA 3N7KA 3CA5A 3BB2A 3UJ4A 4HA2A 2Z49A 4MZGB 2KI4A 3BA5A 3FJCA 1S0CA 2FO1A 1G9BA 2K4AB 3HSMA 2MIBA 1TWEA 1DZCA 1EV2A 4I4YA 5FZUA 5BP5C 4LO3A 3K1XA 1HWMB 3VT2A 4Q91A 2J3PA 3BTAA 2NS2A 5G00A 4JQ0A 2F2FA 2E4MC 3BAOA 4I0YA 3A23A 3WMVA 3CA0A 1DZDA 3FJDA 1TWMA 2VXTI 1T4QA 2K8RA 1R8OA 2YUGA 1W3GA 4LO2C 3FFZA 4X39A 1JT5A 1FWUA 1BFBA 4QKSA 3CA3A 1YTOA 2HWAA 1WBAA 3OGGA 3V0BB 1ILR1 3O3QA 4P0JA 2VLCA 4L4HA 4QD2B 4FGFA 1HWNB 3AKIA 4OWLA 1S0LA 3PG0A 4LO7C 1M2TB 3H6RA 4PC4A 2P39A 2AAIB 1XYFA 5FNXA 3MALA 5D62A 4KEIA 4ENDA 2AXMA 4OEEA 4GP3A 4HR6C 4Q9GA 4EFRA 4ZFYB 1II4A 1BA7A 2Y9WC 3OJVA 4XKIA 5BXTA 1WD4A 1JLYA 3FJKA 5BQUC 2FDBM 3CA4A 4LO1C 3Q7WA 4QC4A 1WD3A 5BP5A 4GAIA 4MZFB 2GZBA 3H6QA 2E4MA 3S8KA 3KMVA 4Z9WB 3E8LC 1AXMA 3O4AA 1MD6A 2D7RA 1RMLA 2NTDA 5JLVA 1G82A 2K43A 1AFCA 1P63A 4CJMA 1G9AA 3NBNA 4I8MA 1JT4A 3FJAA 4LO2A 3ZX7A 1DLLA 2UUSA 4I1BA 4EKXB 1Q1UA 41BIA 3R4SA 3S8JA 1PUUB 3FJBA 3CU1B 1FGAA 4F83A 3VUOA 3ZXGA 3LTQA 1TP0A 3IIRA 4OW4A 4P0LA 5E24E 3F1RA 3BAQA 4I4XA 1DIWA 1BFGA 1DJSB 3AKGA 1M16A 3FGMA 4GOVA 1E0OA 1I1BA 2ZQOA 5BQUA 2FFUA 2L5XA 1IT0A 1K5VA 1BFFA 2IHOA 2DRZA 2NYYA 3FJEA 3VWCA 3CRGA 2BEBA 3ZC9A 1EVTA 1HCDA 4OWKA 2NP0A 5D61A 1BLAA 1HWOB 1CE7B 4ISQA 4AN7B 4II0A 3N7JA 2KKIA 1S0BA 4X3AA 1FMMS 4G9MA 3D7WB 3FJFA 2DREA 2BEAA 5F8YA 5B2HA 2ET2A 4IY8A 2RQ9A 4OWJA 1ISXA 2VU9A 2X2TA 5F90A 1V6UA 4IZXA 4I4VA 1JT7A 4IYBA 4EFQA 4KEKA 4USPA 3BRFA 3PMEA 1CVSA 2ERMA 1DQGA 3AKFA 2WBCA 3H6RB 4A7ZA 3QYDA 2HZ9A 3O4DA 1FV2A 4IQPA 3AKHA 4QD2C 1IRPA 3BAGA 3O4OA 2MC2A 3VT0A 5DUYA 4D0TA 1BFCA 1ISWA 4I7IA 1KNMA 6I1BA 4X37A 3MPPG 3OBRA 4I1EA 4J2SA 4LO0C 3ZXDA 1QQKA 2KH2A 3CA1A 1I1EA 1XZZA 3BADA 4ZFWB 4QKRA 3FJ8A 3R4UA 4GOYA 3IM7A 1G9CA 1WBCA 3UDAA 3IM5A 1JT3A 7I1BA 4GAFA 1Q03A 3FUQA 4ZFUB 4I4SA 5BXSA 3LLPA 1HCEA 4JKXB 2I1BA 1TTUA 4OUJA 3W9TA 3ZC8A 3WO4A 2D20A 4I4RA 5DVHA 1XHBA 5D63A 4EEEB 1FMZA 5DSSB 2NVHA 3CA6A 4FVVA 5FZYA 1ITBA 3OJMA 4J2YA 1IHKA 4P6AA 4ZOTA 3V0AA 5GAQA 3CAHA 1BASA 2NM1A 4JPZA 4P0KA 3T8SA 1QXMA 3Q7XA 1YXWA 1AVUA 5BVPI 5FZZA 2QYIB 2DS0A 4F34A 4A7KA 5EC5A 1NUNA 3BX1C 4H04A 4ZLBB 3BAHA 1JY0A 4LO0A 1UPSA 1Z4SA 1ISYA 4QALA 1AVXB 4AN6A 1ONKB 3Q7YA 2RG9B 4G6JA 2AQZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P23 A;  1EPW A;  4I4U A;  2BFH A;  2ESU A;  4EFP A;  1OQL B;  1RG8 A;  1S0E A;  3WO3 A;  4JP0 A;  3A07 A;  5JMC A;  1HKN A;  1S0G A;  1DQO A;  3FUO A;  3C9Z A;  4Q9P A;  3JRR A;  3QR5 A;  4I6I A;  4LO1 A;  3O4C A;  4DEN A;  1D0H A;  2WRY A;  4ION A;  2Y9G A;  2QN4 A;  3O4B A;  3N0K A;  3OGF A;  4QO3 A;  1AF9 A;  4WBC A;  4TLP A;  5DZU A;  2DRY A;  5F8W A;  2HW9 A;  3HOM A;  1TIE A;  3N7L A;  3A21 A;  1AVA C;  1ISZ A;  3AH4 A;  4G1R A;  2HWM A;  1DFC A;  1L2H A;  8I1B A;  1PUM B;  2VUA A;  1R8N A;  2D24 A;  3NJ5 A;  3AJ6 A;  1HWP B;  1IOB A;  1JQZ A;  4J2K A;  3HAL A;  1ABR B;  2IWT B;  3PUB A;  1SR4 C;  2D23 A;  4JRA A;  2LIQ A;  2F8X C;  3O5W B;  3RSJ A;  2Q9X A;  3IM6 A;  3HBW A;  3PHZ A;  3AH2 A;  3VSF A;  3HN1 A;  5I1B A;  1PWA A;  5BXR A;  1V6V A;  1IRA X;  1T9F A;  3JUT A;  1Z2V A;  4QBV A;  2GO2 A;  3AZW A;  1YBI A;  31BI A;  3UJ0 A;  3O44 A;  4L4I A;  3BAV A;  4XFU A;  1PZZ A;  1Q04 A;  2D44 A;  3SNV A;  1TOO A;  4OEG A;  3H6S E;  3NBC A;  4I4P A;  4IHZ A;  4LO8 B;  4JAW A;  1AVW B;  2R9K B;  5BXP A;  1F31 A;  1BAR A;  2D43 A;  1YYN A;  4ZGR B;  4KEJ A;  2KLL A;  1A8D A;  3TC2 A;  3WIN C;  5BOW A;  1RY7 A;  2M49 A;  3AJ5 A;  3CRI A;  4H9W A;  1YF8 B;  4QBC A;  2VXR A;  2KI6 B;  4OEF A;  2Y9X E;  1IIL A;  3V0A B;  4D0Z A;  1W3F A;  4D8H A;  4YOL A;  1ISV A;  1EYL A;  1BLD A;  2LIE A;  1SR4 A;  5F8S A;  1PC8 B;  4I37 A;  3I29 B;  4DEP A;  3AH1 A;  1SZ6 B;  1VCL A;  4KC3 A;  2NZ9 A;  3WMU A;  1S0D A;  4IZE A;  3ILA A;  21BI A;  4LO7 B;  4R6U B;  3V0B A;  1JTC A;  3N7M A;  1J0S A;  1V6X A;  4HJJ A;  2FGF A;  1W3A A;  3EF2 A;  3OJ2 A;  2VSA A;  3BAU A;  3BRD A;  4A7Y A;  1FN0 A;  1FWV A;  4I3N A;  4GP0 A;  2Y9F A;  3POK A;  3CQA A;  3RTJ B;  3FJI A;  4I2S A;  3B9U A;  4Z8S B;  3IAG C;  2D1Z A;  4XFS A;  4EB2 B;  4I4Q A;  3UD8 A;  4ZA3 B;  4JKQ A;  2XOA A;  1V6W A;  2FFV A;  3WA1 A;  2ZR1 B;  3FJH A;  1JLX A;  1QQL A;  3NBE A;  4ZBV B;  1K5U A;  2Q3N B;  3BA4 A;  5EHA A;  3WIN A;  4J23 B;  3VEQ A;  2VSE A;  3A22 A;  5FNW A;  3VSZ A;  2AFG A;  3VT1 A;  3UD7 A;  3RMY A;  2D22 A;  4X38 A;  3CRH A;  3RTI B;  4I96 A;  1S0F A;  1MC9 A;  4LO3 C;  3P6I A;  1XG6 A;  3BA7 A;  3AZV A;  2F2F C;  3P6J A;  4I4O A;  1FQ9 A;  3WO2 A;  3UD9 A;  5HPZ A;  4USO A;  3RMX A;  3FJ9 A;  1DFQ A;  3NBD A;  1G9D A;  4J2X A;  1RZO B;  1Z0H A;  1IJT A;  4KBB A;  1FV3 A;  1HIB A;  3BRG C;  4ISR A;  3HMY A;  2D7I A;  4XFT A;  1N4K A;  4ZKT B;  1NZK A;  1TFM B;  2MLL B;  5EG6 C;  3OBT A;  4IY9 A;  9ILB A;  3FJJ A;  2X2S A;  2ZQN A;  3O49 A;  3I2A A;  3P53 A;  2Z48 A;  3V79 C;  4G9N A;  2RST A;  3F62 B;  3I2X A;  4DCK C;  1GGP B;  4G6M A;  3N7K A;  3CA5 A;  3BB2 A;  3UJ4 A;  4HA2 A;  2Z49 A;  2KI4 A;  3BA5 A;  3FJC A;  1S0C A;  2FO1 A;  1G9B A;  2K4A B;  3HSM A;  2MIB A;  1TWE A;  1DZC A;  1EV2 A;  4I4Y A;  5FZU A;  5BP5 C;  4LO3 A;  3K1X A;  1HWM B;  3VT2 A;  4Q91 A;  2J3P A;  3BTA A;  5G00 A;  4JQ0 A;  2F2F A;  2E4M C;  3BAO A;  4I0Y A;  3A23 A;  3WMV A;  3CA0 A;  1DZD A;  3FJD A;  1TWM A;  2VXT I;  1T4Q A;  2K8R A;  1R8O A;  2YUG A;  1W3G A;  4LO2 C;  3FFZ A;  4X39 A;  1JT5 A;  1FWU A;  1BFB A;  4QKS A;  3CA3 A;  1YTO A;  2HWA A;  1WBA A;  3OGG A;  3V0B B;  1ILR 1;  3O3Q A;  4P0J A;  2VLC A;  4L4H A;  4QD2 B;  4FGF A;  1HWN B;  3AKI A;  4OWL A;  1S0L A;  3PG0 A;  4LO7 C;  1M2T B;  3H6R A;  4PC4 A;  2P39 A;  2AAI B;  1XYF A;  5FNX A;  3MAL A;  5D62 A;  4KEI A;  4END A;  2AXM A;  4OEE A;  4GP3 A;  4HR6 C;  4Q9G A;  4EFR A;  4ZFY B;  1II4 A;  1BA7 A;  2Y9W C;  3OJV A;  4XKI A;  5BXT A;  1WD4 A;  1JLY A;  3FJK A;  5BQU C;  2FDB M;  3CA4 A;  4LO1 C;  3Q7W A;  4QC4 A;  1WD3 A;  5BP5 A;  4GAI A;  2GZB A;  3H6Q A;  2E4M A;  3S8K A;  3KMV A;  4Z9W B;  3E8L C;  1AXM A;  3O4A A;  1MD6 A;  2D7R A;  1RML A;  2NTD A;  5JLV A;  1G82 A;  2K43 A;  1AFC A;  1P63 A;  4CJM A;  1G9A A;  3NBN A;  4I8M A;  1JT4 A;  3FJA A;  4LO2 A;  3ZX7 A;  1DLL A;  2UUS A;  4I1B A;  4EKX B;  1Q1U A;  41BI A;  3R4S A;  3S8J A;  1PUU B;  3FJB A;  3CU1 B;  1FGA A;  4F83 A;  3VUO A;  3ZXG A;  3LTQ A;  1TP0 A;  3IIR A;  4OW4 A;  4P0L A;  5E24 E;  3F1R A;  3BAQ A;  4I4X A;  1DIW A;  1BFG A;  1DJS B;  3AKG A;  1M16 A;  3FGM A;  4GOV A;  1E0O A;  1I1B A;  2ZQO A;  5BQU A;  2FFU A;  2L5X A;  1IT0 A;  1K5V A;  1BFF A;  2IHO A;  2DRZ A;  2NYY A;  3FJE A;  3VWC A;  3CRG A;  2BEB A;  3ZC9 A;  1EVT A;  1HCD A;  4OWK A;  2NP0 A;  5D61 A;  1BLA A;  1HWO B;  1CE7 B;  4ISQ A;  4AN7 B;  4II0 A;  3N7J A;  2KKI A;  1S0B A;  4X3A A;  1FMM S;  4G9M A;  3D7W B;  3FJF A;  2DRE A;  2BEA A;  5F8Y A;  5B2H A;  2ET2 A;  4IY8 A;  2RQ9 A;  4OWJ A;  1ISX A;  2VU9 A;  2X2T A;  5F90 A;  1V6U A;  4IZX A;  4I4V A;  1JT7 A;  4IYB A;  4EFQ A;  4KEK A;  4USP A;  3BRF A;  3PME A;  1CVS A;  2ERM A;  1DQG A;  3AKF A;  2WBC A;  3H6R B;  4A7Z A;  3QYD A;  2HZ9 A;  3O4D A;  1FV2 A;  4IQP A;  3AKH A;  4QD2 C;  1IRP A;  3BAG A;  3O4O A;  2MC2 A;  3VT0 A;  5DUY A;  4D0T A;  1BFC A;  1ISW A;  4I7I A;  1KNM A;  6I1B A;  4X37 A;  3MPP G;  3OBR A;  4I1E A;  4J2S A;  4LO0 C;  3ZXD A;  1QQK A;  2KH2 A;  3CA1 A;  1I1E A;  1XZZ A;  3BAD A;  4ZFW B;  4QKR A;  3FJ8 A;  3R4U A;  4GOY A;  3IM7 A;  1G9C A;  1WBC A;  3UDA A;  3IM5 A;  1JT3 A;  7I1B A;  4GAF A;  1Q03 A;  3FUQ A;  4ZFU B;  4I4S A;  5BXS A;  3LLP A;  1HCE A;  4JKX B;  2I1B A;  1TTU A;  4OUJ A;  3W9T A;  3ZC8 A;  3WO4 A;  2D20 A;  4I4R A;  5DVH A;  1XHB A;  5D63 A;  4EEE B;  1FMZ A;  5DSS B;  2NVH A;  3CA6 A;  4FVV A;  5FZY A;  1ITB A;  3OJM A;  4J2Y A;  1IHK A;  4P6A A;  4ZOT A;  3V0A A;  5GAQ A;  3CAH A;  1BAS A;  2NM1 A;  4JPZ A;  4P0K A;  3T8S A;  1QXM A;  3Q7X A;  1YXW A;  1AVU A;  5BVP I;  5FZZ A;  2QYI B;  2DS0 A;  4F34 A;  4A7K A;  5EC5 A;  1NUN A;  3BX1 C;  4H04 A;  4ZLB B;  3BAH A;  1JY0 A;  4LO0 A;  1UPS A;  1Z4S A;  1ISY A;  4QAL A;  1AVX B;  4AN6 A;  1ONK B;  3Q7Y A;  2RG9 B;  4G6J A;  2AQZ A; 
#chains in the Genus database with same CATH topology
 2P23 A;  1EPW A;  4I4U A;  2BFH A;  2ESU A;  4EFP A;  1OQL B;  1RG8 A;  1S0E A;  3WO3 A;  4JP0 A;  3A07 A;  5JMC A;  1HKN A;  1S0G A;  1DQO A;  3FUO A;  3C9Z A;  4Q9P A;  3JRR A;  3QR5 A;  4I6I A;  4LO1 A;  3O4C A;  4DEN A;  1D0H A;  2WRY A;  4ION A;  2Y9G A;  2QN4 A;  3O4B A;  3N0K A;  3OGF A;  4QO3 A;  1AF9 A;  4WBC A;  4TLP A;  5DZU A;  4UY4 A;  2DRY A;  5F8W A;  2HW9 A;  3HOM A;  1TIE A;  3N7L A;  3A21 A;  1AVA C;  1ISZ A;  3AH4 A;  4G1R A;  2HWM A;  1DFC A;  1L2H A;  8I1B A;  1PUM B;  2VUA A;  1R8N A;  2D24 A;  3NJ5 A;  3AJ6 A;  1HWP B;  1IOB A;  1JQZ A;  4J2K A;  3HAL A;  1ABR B;  2IWT B;  3PUB A;  1SR4 C;  2D23 A;  4JRA A;  2LIQ A;  2F8X C;  3O5W B;  3RSJ A;  2Q9X A;  3IM6 A;  4H75 A;  3HBW A;  3PHZ A;  3AH2 A;  3VSF A;  3HN1 A;  5I1B A;  1PWA A;  5BXR A;  1V6V A;  1IRA X;  1T9F A;  3JUT A;  1Z2V A;  4QBV A;  2GO2 A;  3AZW A;  1YBI A;  31BI A;  3UJ0 A;  3O44 A;  4L4I A;  3BAV A;  4XFU A;  1PZZ A;  1Q04 A;  2D44 A;  3SNV A;  1TOO A;  4OEG A;  3H6S E;  3NBC A;  4I4P A;  4IHZ A;  4LO8 B;  4JAW A;  1AVW B;  2R9K B;  5BXP A;  1F31 A;  1BAR A;  2D43 A;  1YYN A;  4ZGR B;  4KEJ A;  2KLL A;  1A8D A;  3TC2 A;  3WIN C;  5BOW A;  1RY7 A;  2M49 A;  3AJ5 A;  3CRI A;  4H9W A;  1YF8 B;  4QBC A;  2VXR A;  2KI6 B;  4OEF A;  2Y9X E;  1IIL A;  3V0A B;  4D0Z A;  1W3F A;  4D8H A;  4YOL A;  1ISV A;  1EYL A;  1BLD A;  2LIE A;  1SR4 A;  5F8S A;  1PC8 B;  4I37 A;  3I29 B;  4DEP A;  3AH1 A;  1SZ6 B;  1VCL A;  4KC3 A;  2NZ9 A;  3WMU A;  1S0D A;  4IZE A;  3ILA A;  21BI A;  4LO7 B;  4R6U B;  3V0B A;  1JTC A;  3N7M A;  1J0S A;  1V6X A;  4HJJ A;  2FGF A;  1W3A A;  3EF2 A;  3OJ2 A;  2VSA A;  3BAU A;  3BRD A;  4A7Y A;  1FN0 A;  1FWV A;  4I3N A;  4GP0 A;  2Y9F A;  3POK A;  3CQA A;  3RTJ B;  3FJI A;  4I2S A;  3B9U A;  4Z8S B;  3IAG C;  2D1Z A;  4XFS A;  4EB2 B;  4I4Q A;  3UD8 A;  4ZA3 B;  4JKQ A;  2XOA A;  1V6W A;  2FFV A;  3WA1 A;  2ZR1 B;  3FJH A;  1JLX A;  1QQL A;  3NBE A;  4ZBV B;  1K5U A;  2Q3N B;  3BA4 A;  5EHA A;  3WIN A;  4J23 B;  3VEQ A;  2VSE A;  3A22 A;  5FNW A;  3VSZ A;  2AFG A;  3VT1 A;  3UD7 A;  3RMY A;  2D22 A;  4X38 A;  3CRH A;  3RTI B;  4I96 A;  1S0F A;  1MC9 A;  4LO3 C;  3P6I A;  1XG6 A;  3BA7 A;  3AZV A;  2F2F C;  3P6J A;  4I4O A;  1FQ9 A;  3WO2 A;  3UD9 A;  5HPZ A;  4USO A;  3RMX A;  3FJ9 A;  1DFQ A;  3NBD A;  1G9D A;  4J2X A;  1RZO B;  1Z0H A;  1IJT A;  4KBB A;  1FV3 A;  1HIB A;  3BRG C;  4ISR A;  3HMY A;  2D7I A;  4XFT A;  1N4K A;  4ZKT B;  1NZK A;  1TFM B;  2MLL B;  5EG6 C;  3OBT A;  4IY9 A;  4MZH A;  3FJJ A;  9ILB A;  2X2S A;  2ZQN A;  3O49 A;  3I2A A;  3P53 A;  2Z48 A;  3V79 C;  4G9N A;  2RST A;  3F62 B;  3I2X A;  4DCK C;  1GGP B;  4G6M A;  3N7K A;  3CA5 A;  3BB2 A;  3UJ4 A;  4HA2 A;  2Z49 A;  4MZG B;  2KI4 A;  3BA5 A;  3FJC A;  1S0C A;  2FO1 A;  1G9B A;  2K4A B;  3HSM A;  2MIB A;  1TWE A;  1DZC A;  1EV2 A;  4I4Y A;  5FZU A;  5BP5 C;  4LO3 A;  3K1X A;  1HWM B;  3VT2 A;  4Q91 A;  2J3P A;  3BTA A;  2NS2 A;  5G00 A;  4JQ0 A;  2F2F A;  2E4M C;  3BAO A;  4I0Y A;  3A23 A;  3WMV A;  3CA0 A;  1DZD A;  3FJD A;  1TWM A;  2VXT I;  1T4Q A;  2K8R A;  1R8O A;  2YUG A;  1W3G A;  4LO2 C;  3FFZ A;  4X39 A;  1JT5 A;  1FWU A;  1BFB A;  4QKS A;  3CA3 A;  1YTO A;  2HWA A;  1WBA A;  3OGG A;  3V0B B;  1ILR 1;  3O3Q A;  4P0J A;  2VLC A;  4L4H A;  4QD2 B;  4FGF A;  1HWN B;  3AKI A;  4OWL A;  1S0L A;  3PG0 A;  4LO7 C;  1M2T B;  3H6R A;  4PC4 A;  2P39 A;  2AAI B;  1XYF A;  5FNX A;  3MAL A;  5D62 A;  4KEI A;  4END A;  2AXM A;  4OEE A;  4GP3 A;  4HR6 C;  4Q9G A;  4EFR A;  4ZFY B;  1II4 A;  1BA7 A;  2Y9W C;  3OJV A;  4XKI A;  5BXT A;  1WD4 A;  1JLY A;  3FJK A;  5BQU C;  2FDB M;  3CA4 A;  4LO1 C;  3Q7W A;  4QC4 A;  1WD3 A;  5BP5 A;  4GAI A;  4MZF B;  2GZB A;  3H6Q A;  2E4M A;  3S8K A;  3KMV A;  4Z9W B;  3E8L C;  1AXM A;  3O4A A;  1MD6 A;  2D7R A;  1RML A;  2NTD A;  5JLV A;  1G82 A;  2K43 A;  1AFC A;  1P63 A;  4CJM A;  1G9A A;  3NBN A;  4I8M A;  1JT4 A;  3FJA A;  4LO2 A;  3ZX7 A;  1DLL A;  2UUS A;  4I1B A;  4EKX B;  1Q1U A;  41BI A;  3R4S A;  3S8J A;  1PUU B;  3FJB A;  3CU1 B;  1FGA A;  4F83 A;  3VUO A;  3ZXG A;  3LTQ A;  1TP0 A;  3IIR A;  4OW4 A;  4P0L A;  5E24 E;  3F1R A;  3BAQ A;  4I4X A;  1DIW A;  1BFG A;  1DJS B;  3AKG A;  1M16 A;  3FGM A;  4GOV A;  1E0O A;  1I1B A;  2ZQO A;  5BQU A;  2FFU A;  2L5X A;  1IT0 A;  1K5V A;  1BFF A;  2IHO A;  2DRZ A;  2NYY A;  3FJE A;  3VWC A;  3CRG A;  2BEB A;  3ZC9 A;  1EVT A;  1HCD A;  4OWK A;  2NP0 A;  5D61 A;  1BLA A;  1HWO B;  1CE7 B;  4ISQ A;  4AN7 B;  4II0 A;  3N7J A;  2KKI A;  1S0B A;  4X3A A;  1FMM S;  4G9M A;  3D7W B;  3FJF A;  2DRE A;  2BEA A;  5F8Y A;  5B2H A;  2ET2 A;  4IY8 A;  2RQ9 A;  4OWJ A;  1ISX A;  2VU9 A;  2X2T A;  5F90 A;  1V6U A;  4IZX A;  4I4V A;  1JT7 A;  4IYB A;  4EFQ A;  4KEK A;  4USP A;  3BRF A;  3PME A;  1CVS A;  2ERM A;  1DQG A;  3AKF A;  2WBC A;  3H6R B;  4A7Z A;  3QYD A;  2HZ9 A;  3O4D A;  1FV2 A;  4IQP A;  3AKH A;  4QD2 C;  1IRP A;  3BAG A;  3O4O A;  2MC2 A;  3VT0 A;  5DUY A;  4D0T A;  1BFC A;  1ISW A;  4I7I A;  1KNM A;  6I1B A;  4X37 A;  3MPP G;  3OBR A;  4I1E A;  4J2S A;  4LO0 C;  3ZXD A;  1QQK A;  2KH2 A;  3CA1 A;  1I1E A;  1XZZ A;  3BAD A;  4ZFW B;  4QKR A;  3FJ8 A;  3R4U A;  4GOY A;  3IM7 A;  1G9C A;  1WBC A;  3UDA A;  3IM5 A;  1JT3 A;  7I1B A;  4GAF A;  1Q03 A;  3FUQ A;  4ZFU B;  4I4S A;  5BXS A;  3LLP A;  1HCE A;  4JKX B;  2I1B A;  1TTU A;  4OUJ A;  3W9T A;  3ZC8 A;  3WO4 A;  2D20 A;  4I4R A;  5DVH A;  1XHB A;  5D63 A;  4EEE B;  1FMZ A;  5DSS B;  2NVH A;  3CA6 A;  4FVV A;  5FZY A;  1ITB A;  3OJM A;  4J2Y A;  1IHK A;  4P6A A;  4ZOT A;  3V0A A;  5GAQ A;  3CAH A;  1BAS A;  2NM1 A;  4JPZ A;  4P0K A;  3T8S A;  1QXM A;  3Q7X A;  1YXW A;  1AVU A;  5BVP I;  5FZZ A;  2QYI B;  2DS0 A;  4F34 A;  4A7K A;  5EC5 A;  1NUN A;  3BX1 C;  4H04 A;  4ZLB B;  3BAH A;  1JY0 A;  4LO0 A;  1UPS A;  1Z4S A;  1ISY A;  4QAL A;  1AVX B;  4AN6 A;  1ONK B;  3Q7Y A;  2RG9 B;  4G6J A;  2AQZ A; 
#chains in the Genus database with same CATH homology
 2P23 A;  1EPW A;  4I4U A;  2BFH A;  2ESU A;  4EFP A;  1OQL B;  1RG8 A;  1S0E A;  3WO3 A;  4JP0 A;  3A07 A;  5JMC A;  1HKN A;  1S0G A;  1DQO A;  3FUO A;  3C9Z A;  4Q9P A;  3JRR A;  3QR5 A;  4I6I A;  4LO1 A;  3O4C A;  4DEN A;  1D0H A;  2WRY A;  4ION A;  2Y9G A;  2QN4 A;  3O4B A;  3N0K A;  3OGF A;  4QO3 A;  1AF9 A;  4WBC A;  4TLP A;  5DZU A;  4UY4 A;  2DRY A;  5F8W A;  2HW9 A;  3HOM A;  1TIE A;  3N7L A;  3A21 A;  1AVA C;  1ISZ A;  3AH4 A;  4G1R A;  2HWM A;  1DFC A;  1L2H A;  8I1B A;  1PUM B;  2VUA A;  1R8N A;  2D24 A;  3NJ5 A;  3AJ6 A;  1HWP B;  1IOB A;  1JQZ A;  4J2K A;  3HAL A;  1ABR B;  2IWT B;  3PUB A;  1SR4 C;  2D23 A;  4JRA A;  2LIQ A;  2F8X C;  3O5W B;  3RSJ A;  2Q9X A;  3IM6 A;  4H75 A;  3HBW A;  3PHZ A;  3AH2 A;  3VSF A;  3HN1 A;  5I1B A;  1PWA A;  5BXR A;  1V6V A;  1IRA X;  1T9F A;  3JUT A;  1Z2V A;  4QBV A;  2GO2 A;  3AZW A;  1YBI A;  31BI A;  3UJ0 A;  3O44 A;  4L4I A;  3BAV A;  4XFU A;  1PZZ A;  1Q04 A;  2D44 A;  3SNV A;  1TOO A;  4OEG A;  3H6S E;  3NBC A;  4I4P A;  4IHZ A;  4LO8 B;  4JAW A;  1AVW B;  2R9K B;  5BXP A;  1F31 A;  1BAR A;  2D43 A;  1YYN A;  4ZGR B;  4KEJ A;  2KLL A;  1A8D A;  3TC2 A;  3WIN C;  5BOW A;  1RY7 A;  2M49 A;  3AJ5 A;  3CRI A;  4H9W A;  1YF8 B;  4QBC A;  2VXR A;  2KI6 B;  4OEF A;  2Y9X E;  1IIL A;  3V0A B;  4D0Z A;  1W3F A;  4D8H A;  4YOL A;  1ISV A;  1EYL A;  1BLD A;  2LIE A;  1SR4 A;  5F8S A;  1PC8 B;  4I37 A;  3I29 B;  4DEP A;  3AH1 A;  1SZ6 B;  1VCL A;  4KC3 A;  2NZ9 A;  3WMU A;  1S0D A;  4IZE A;  3ILA A;  21BI A;  4LO7 B;  4R6U B;  3V0B A;  1JTC A;  3N7M A;  1J0S A;  1V6X A;  4HJJ A;  2FGF A;  1W3A A;  3EF2 A;  3OJ2 A;  2VSA A;  3BAU A;  3BRD A;  4A7Y A;  1FN0 A;  1FWV A;  4I3N A;  4GP0 A;  2Y9F A;  3POK A;  3CQA A;  3RTJ B;  3FJI A;  4I2S A;  3B9U A;  4Z8S B;  3IAG C;  2D1Z A;  4XFS A;  4EB2 B;  4I4Q A;  3UD8 A;  4ZA3 B;  4JKQ A;  2XOA A;  1V6W A;  2FFV A;  3WA1 A;  2ZR1 B;  3FJH A;  1JLX A;  1QQL A;  3NBE A;  4ZBV B;  1K5U A;  2Q3N B;  3BA4 A;  5EHA A;  3WIN A;  4J23 B;  3VEQ A;  2VSE A;  3A22 A;  5FNW A;  3VSZ A;  2AFG A;  3VT1 A;  3UD7 A;  3RMY A;  2D22 A;  4X38 A;  3CRH A;  3RTI B;  4I96 A;  1S0F A;  1MC9 A;  4LO3 C;  3P6I A;  1XG6 A;  3BA7 A;  3AZV A;  2F2F C;  3P6J A;  4I4O A;  1FQ9 A;  3WO2 A;  3UD9 A;  5HPZ A;  4USO A;  3RMX A;  3FJ9 A;  1DFQ A;  3NBD A;  1G9D A;  4J2X A;  1RZO B;  1Z0H A;  1IJT A;  4KBB A;  1FV3 A;  1HIB A;  3BRG C;  4ISR A;  3HMY A;  2D7I A;  4XFT A;  1N4K A;  4ZKT B;  1NZK A;  1TFM B;  2MLL B;  5EG6 C;  3OBT A;  4IY9 A;  4MZH A;  3FJJ A;  9ILB A;  2X2S A;  2ZQN A;  3O49 A;  3I2A A;  3P53 A;  2Z48 A;  3V79 C;  4G9N A;  2RST A;  3F62 B;  3I2X A;  4DCK C;  1GGP B;  4G6M A;  3N7K A;  3CA5 A;  3BB2 A;  3UJ4 A;  4HA2 A;  2Z49 A;  4MZG B;  2KI4 A;  3BA5 A;  3FJC A;  1S0C A;  2FO1 A;  1G9B A;  2K4A B;  3HSM A;  2MIB A;  1TWE A;  1DZC A;  1EV2 A;  4I4Y A;  5FZU A;  5BP5 C;  4LO3 A;  3K1X A;  1HWM B;  3VT2 A;  4Q91 A;  2J3P A;  3BTA A;  2NS2 A;  5G00 A;  4JQ0 A;  2F2F A;  2E4M C;  3BAO A;  4I0Y A;  3A23 A;  3WMV A;  3CA0 A;  1DZD A;  3FJD A;  1TWM A;  2VXT I;  1T4Q A;  2K8R A;  1R8O A;  2YUG A;  1W3G A;  4LO2 C;  3FFZ A;  4X39 A;  1JT5 A;  1FWU A;  1BFB A;  4QKS A;  3CA3 A;  1YTO A;  2HWA A;  1WBA A;  3OGG A;  3V0B B;  1ILR 1;  3O3Q A;  4P0J A;  2VLC A;  4L4H A;  4QD2 B;  4FGF A;  1HWN B;  3AKI A;  4OWL A;  1S0L A;  3PG0 A;  4LO7 C;  1M2T B;  3H6R A;  4PC4 A;  2P39 A;  2AAI B;  1XYF A;  5FNX A;  3MAL A;  5D62 A;  4KEI A;  4END A;  2AXM A;  4OEE A;  4GP3 A;  4HR6 C;  4Q9G A;  4EFR A;  4ZFY B;  1II4 A;  1BA7 A;  2Y9W C;  3OJV A;  4XKI A;  5BXT A;  1WD4 A;  1JLY A;  3FJK A;  5BQU C;  2FDB M;  3CA4 A;  4LO1 C;  3Q7W A;  4QC4 A;  1WD3 A;  5BP5 A;  4GAI A;  4MZF B;  2GZB A;  3H6Q A;  2E4M A;  3S8K A;  3KMV A;  4Z9W B;  3E8L C;  1AXM A;  3O4A A;  1MD6 A;  2D7R A;  1RML A;  2NTD A;  5JLV A;  1G82 A;  2K43 A;  1AFC A;  1P63 A;  4CJM A;  1G9A A;  3NBN A;  4I8M A;  1JT4 A;  3FJA A;  4LO2 A;  3ZX7 A;  1DLL A;  2UUS A;  4I1B A;  4EKX B;  1Q1U A;  41BI A;  3R4S A;  3S8J A;  1PUU B;  3FJB A;  3CU1 B;  1FGA A;  4F83 A;  3VUO A;  3ZXG A;  3LTQ A;  1TP0 A;  3IIR A;  4OW4 A;  4P0L A;  5E24 E;  3F1R A;  3BAQ A;  4I4X A;  1DIW A;  1BFG A;  1DJS B;  3AKG A;  1M16 A;  3FGM A;  4GOV A;  1E0O A;  1I1B A;  2ZQO A;  5BQU A;  2FFU A;  2L5X A;  1IT0 A;  1K5V A;  1BFF A;  2IHO A;  2DRZ A;  2NYY A;  3FJE A;  3VWC A;  3CRG A;  2BEB A;  3ZC9 A;  1EVT A;  1HCD A;  4OWK A;  2NP0 A;  5D61 A;  1BLA A;  1HWO B;  1CE7 B;  4ISQ A;  4AN7 B;  4II0 A;  3N7J A;  2KKI A;  1S0B A;  4X3A A;  1FMM S;  4G9M A;  3D7W B;  3FJF A;  2DRE A;  2BEA A;  5F8Y A;  5B2H A;  2ET2 A;  4IY8 A;  2RQ9 A;  4OWJ A;  1ISX A;  2VU9 A;  2X2T A;  5F90 A;  1V6U A;  4IZX A;  4I4V A;  1JT7 A;  4IYB A;  4EFQ A;  4KEK A;  4USP A;  3BRF A;  3PME A;  1CVS A;  2ERM A;  1DQG A;  3AKF A;  2WBC A;  3H6R B;  4A7Z A;  3QYD A;  2HZ9 A;  3O4D A;  1FV2 A;  4IQP A;  3AKH A;  4QD2 C;  1IRP A;  3BAG A;  3O4O A;  2MC2 A;  3VT0 A;  5DUY A;  4D0T A;  1BFC A;  1ISW A;  4I7I A;  1KNM A;  6I1B A;  4X37 A;  3MPP G;  3OBR A;  4I1E A;  4J2S A;  4LO0 C;  3ZXD A;  1QQK A;  2KH2 A;  3CA1 A;  1I1E A;  1XZZ A;  3BAD A;  4ZFW B;  4QKR A;  3FJ8 A;  3R4U A;  4GOY A;  3IM7 A;  1G9C A;  1WBC A;  3UDA A;  3IM5 A;  1JT3 A;  7I1B A;  4GAF A;  1Q03 A;  3FUQ A;  4ZFU B;  4I4S A;  5BXS A;  3LLP A;  1HCE A;  4JKX B;  2I1B A;  1TTU A;  4OUJ A;  3W9T A;  3ZC8 A;  3WO4 A;  2D20 A;  4I4R A;  5DVH A;  1XHB A;  5D63 A;  4EEE B;  1FMZ A;  5DSS B;  2NVH A;  3CA6 A;  4FVV A;  5FZY A;  1ITB A;  3OJM A;  4J2Y A;  1IHK A;  4P6A A;  4ZOT A;  3V0A A;  5GAQ A;  3CAH A;  1BAS A;  2NM1 A;  4JPZ A;  4P0K A;  3T8S A;  1QXM A;  3Q7X A;  1YXW A;  1AVU A;  5BVP I;  5FZZ A;  2QYI B;  2DS0 A;  4F34 A;  4A7K A;  5EC5 A;  1NUN A;  3BX1 C;  4H04 A;  4ZLB B;  3BAH A;  1JY0 A;  4LO0 A;  1UPS A;  1Z4S A;  1ISY A;  4QAL A;  1AVX B;  4AN6 A;  1ONK B;  3Q7Y A;  2RG9 B;  4G6J A;  2AQZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...