3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
molecule tags Unknown function
molecule keywords 30kDa protein
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
3N0KA 1JT3A 2X2TA 2RQ9A 4FVVA 4WBCA 2NYYA 4USOA 1RMLA 6I1BA 4QKSA 5BXTA 1JT4A 3WINC 3IAGC 3FJFA 4P0JA 2D7IA 5D61A 3AKFA 3EF2A 2KLLA 3FJCA 1N4KA 3IM5A 1NUNA 1XYFA 1IHKA 4IZEA 1JLXA 3N7KA 3WO4A 5BP5C 3ZXDA 4USPA 4X37A 5BQUC 3VSFA 1IILA 1BFGA 1FWUA 2VXTI 3OBTA 4H9WA 2DRZA 4X38A 1HIBA 4QALA 3H6RA 1IRPA 4JKXB 4D0TA 4OWLA 4JRAA 3FJJA 4I1BA 3RTIB 3FJ9A 1S0CA 2F2FC 3Q7YA 4GAIA 3N7JA 5F8YA 4JPZA 1DLLA 1HKNA 2D44A 1ONKB 5E24E 2LIQA 4I96A 1KNMA 2Q3NB 1J0SA 1V6UA 5FNXA 2HWMA 3FUQA 1G9CA 2IHOA 5EG6C 1K5VA 2ESUA 5EC5A 3WO2A 5BOWA 2J3PA 4XFUA 3AZWA 1IRAX 3HSMA 5EHAA 1JLYA 2KH2A 4DCKC 1MD6A 3ZXGA 1RG8A 3FJKA 1XZZA 3QR5A 4ZKTB 1Q1UA 4ENDA 1S0EA 3V79C 4KEKA 4LO3C 4HR6C 3OJMA 1AXMA 1HWMB 1ILR1 1WBAA 1ISVA 2K4AB 4OUJA 1PWAA 3VEQA 5FNWA 3O4DA 2E4MC 1R8OA 4DEPA 3CA4A 3BA4A 4GOVA 1MC9A 3H6QA 1FWVA 4L4IA 1TFMB 4J23B 3ILAA 4J2YA 1TIEA 3BAUA 3WO3A 4I37A 4ZOTA 1FMZA 3F1RA 1BFCA 3A07A 3VUOA 1EYLA 1IJTA 4Q91A 4G9MA 4Q9PA 3P6IA 4I4XA 1IT0A 2Z48A 3V0BB 4QD2C 4EKXB 1ISWA 1JQZA 3AH4A 1BFFA 3OBRA 3KMVA 1BARA 2D7RA 3RMXA 4CJMA 3O4OA 1YYNA 2FGFA 1Z4SA 3BAQA 2DS0A 4KEJA 41BIA 4I3NA 1IOBA 2GZBA 4TLPA 2NTDA 31BIA 4PC4A 3POKA 4I4SA 1T4QA 2VSAA 3LTQA 1ISYA 2FFVA 4I7IA 1I1BA 4OEFA 2BEAA 2QYIB 2F8XC 1S0FA 2NVHA 3ZX7A 2AXMA 5BXSA 4ZFUB 3BAHA 3BRFA 3I2AA 2ERMA 3FJAA 3FUOA 5DUYA 1F31A 1T9FA 3FJBA 3Q7XA 3T8SA 1Q04A 1HCDA 3Q7WA 3VT0A 1DJSB 3RMYA 4IZXA 4ZBVB 4AN6A 1QQKA 1YXWA 1PUUB 5BXRA 3UJ4A 1DQGA 1JT7A 1WBCA 3NBEA 3I29B 3BA5A 4A7YA 2D24A 4X3AA 3V0BA 3O4BA 3C9ZA 2K8RA 2L5XA 1JY0A 4GOYA 2KI6B 3PUBA 3P53A 1DFCA 2Y9FA 4I1EA 4ZGRB 4Z9WB 4GP0A 2X2SA 3BX1C 1P63A 1CVSA 4KEIA 3NJ5A 3VT1A 4J2XA 5B2HA 3N7LA 4GP3A 2QN4A 2NP0A 5DSSB 3UD8A 4I4QA 3NBCA 3I2XA 2K43A 1AVXB 2FO1A 4IYBA 4H04A 5HPZA 1DZCA 3OGFA 4IQPA 1S0GA 5F90A 1D0HA 1ISXA 3TC2A 4QD2B 4OEEA 5FZZA 1UPSA 1Z0HA 2M49A 2WRYA 1S0DA 3CA0A 2HZ9A 2D23A 2FFUA 2VU9A 1S0BA 4XFSA 1BFBA 4A7ZA 1NZKA 3BTAA 3CQAA 4ISRA 4FGFA 3A22A 1DIWA 1EVTA 2HW9A 5F8SA 4JKQA 4D0ZA 1TOOA 4X39A 3BAVA 2E4MA 3IM6A 2VXRA 1XG6A 4I4YA 1EV2A 4LO2A 3P6JA 2NZ9A 3WA1A 1TWEA 2P23A 1SZ6B 2LIEA 5I1BA 5JMCA 2D20A 4II0A 4LO7C 4EFPA 1RY7A 4I4PA 4HA2A 3MPPG 3WINA 1AFCA 1BLDA 3AJ5A 4G9NA 3WMUA 3FJHA 3FGMA 4IONA 2Y9XE 3R4SA 2MIBA 4ZFWB 2AFGA 3CRGA 3HN1A 1BLAA 2D43A 3BADA 4OWJA 3E8LC 3S8KA 2RG9B 1M16A 4ZLBB 4F83A 3O4AA 1PUMB 1FGAA 2GO2A 3CA6A 3O3QA 3O49A 4I4UA 1QXMA 1ABRB 3B9UA 2VSEA 4G6JA 4GAFA 4J2KA 2Z49A 2WBCA 1L2HA 3UD9A 3UJ0A 3F62B 1HCEA 2BFHA 4KC3A 4QBCA 4D8HA 2F2FA 2KKIA 3AKHA 4Z8SB 1DZDA 1WD3A 3H6SE 5DZUA 1DQOA 5GAQA 2DREA 1A8DA 4F34A 1VCLA 2AAIB 3BAGA 9ILBA 2ET2A 1G9AA 4I4OA 1FV3A 3AH1A 4LO8B 2MLLB 2HWAA 3RSJA 4AN7B 1BA7A 1YF8B 4XKIA 3H6RB 3OJ2A 1AVUA 4OW4A 4YOLA 7I1BA 3R4UA 5JLVA 2XOAA 2ZQNA 2VLCA 4J2SA 5FZYA 4DENA 2IWTB 4Q9GA 3BRGC 4LO0C 2YUGA 3VT2A 4I8MA 3V0AA 3HOMA 4ZFYB 1OQLB 3AKIA 4P0LA 3O4CA 2Y9GA 1RZOB 1SR4A 1AVAC 2DRYA 3CRIA 3OJVA 1TP0A 3AZVA 3CRHA 1V6XA 4JAWA 3VSZA 1PC8B 1W3AA 2D22A 4HJJA 4OEGA 3ZC9A 4LO3A 3JUTA 4EFRA 4I0YA 3UD7A 2VUAA 3N7MA 5D63A 3RTJB 1V6VA 3SNVA 3PHZA 3VWCA 4QBVA 1W3FA 2Q9XA 1FQ9A 1TWMA 4L4HA 1R8NA 5BP5A 3LLPA 1JT5A 3FFZA 4G1RA 1JTCA 4I2SA 5BQUA 1AF9A 4I4VA 5G00A 1DFQA 21BIA 1WD4A 2NM1A 5DVHA 1HWOB 1PZZA 1W3GA 2P39A 4LO2C 2KI4A 8I1BA 1TTUA 4R6UB 3FJEA 4JP0A 3JRRA 1YBIA 2AQZA 3FJDA 1S0LA 3AJ6A 1AVWB 5FZUA 4LO1C 4QO3A 3UDAA 3BAOA 3CA1A 3IM7A 4IY9A 1GGPB 1HWNB 5F8WA 1YTOA 4LO7B 3MALA 3A21A 4JQ0A 3CA5A 1QQLA 4P6AA 1SR4C 4EFQA 3FJIA 3D7WB 1V6WA 3CA3A 4IHZA 4EEEB 2MC2A 1G9DA 4G6MA 3NBNA 1FN0A 4QC4A 2ZQOA 4KBBA 2ZR1B 2UUSA 3O5WB 5BVPI 3BRDA 4ISQA 1G9BA 3HBWA 1M2TB 5D62A 2I1BA 4EB2B 1BASA 1K5UA 2FDBM 1XHBA 5BXPA 1I1EA 4QKRA 2R9KB 1FMMS 4OWKA 3AKGA 3WMVA 3BB2A 3QYDA 1FV2A 3CU1B 3O44A 4I6IA 1ISZA 1Q03A 3V0AB 3AH2A 3CAHA 3W9TA 2RSTA 3ZC8A 3IIRA 4I4RA 3OGGA 4IY8A 3HMYA 3HALA 3FJ8A 3K1XA 1E0OA 4P0KA 1Z2VA 4ZA3B 4LO0A 3BA7A 4XFTA 4LO1A 1EPWA 1G82A 2BEBA 1II4A 3PMEA 1ITBA 3NBDA 1CE7B 2D1ZA 4A7KA 2Y9WC 3S8JA 3PG0A 1HWPB 3A23A
chains in the Genus database with same CATH superfamily
4AIJA 2X2TA 4FVVA 4HG2A 4KJZA 4WBCA 5DDGA 6I1BA 1VQPI 3DQVC 4ZYGA 1JT4A 3WINC 3FJFA 4NC6A 3FJCA 3DWLE 3HZJA 3OOPA 4CCLA 1HKTA 3WTZA 3BG5A 5IPAA 5DEQA 2YS9A 3FXUA 3HIFA 4LOCA 1R4NB 3WTXC 4X37A 1EV7A 4DZJA 3ECOA 4Y13A 2FA5A 3I53A 3VPRA 2M0MA 2NVYJ 1XGMA 3HOWJ 5FKLA 3PNTA 4AWXB 3ZQIA 1BC8C 2WY7Q 3EDPA 3OOUA 2L0KA 3ABMH 4LLNA 4GFBA 4HX8A 4A3DJ 3CO6C 1VQMI 2HOAA 4PCQA 3GFIA 2L9VA 2R7VA 4G7HF 1BR2A 2L7MP 5J6XA 4OWLA 3BY6A 5H20A 5KVRA 1QVUA 2KHMA 2Z2SB 1EF4A 4JRAA 1HSTA 3BJOA 3RTIB 1YRNB 2N8GA 2DT5A 2VT2A 2KIFA 3CCJI 2VIXA 4N9HA 4DBRA 1FX7A 1MGTA 3EQLF 1IRXA 3MZ8A 4D7MA 5FB2A 4OAZA 1HKNA 3SZGA 2FNAA 2JUCA 2NYXA 5E24E 3BG7A 2M8GX 2Q3NB 1EA3A 4BYYA 1FBQA 1U9NA 3OL4A 2LY9A 1ON2A 1BL0A 2HWMA 3FUQA 2A6TA 1G9CA 1K5VA 4AU7A 4CCNA 4Q48A 2KMUA 4UY4A 4XFUA 1YITI 3RDIA 1JKQC 3BP8A 2RV8A 1T0FC 4LG0A 3HOYJ 2KH2A 3CMAI 4DCKC 3ZXGA 1MDMB 4M72A 1KA8A 1MBKA 3LSHA 2RGVA 1RG8A 1XZZA 1Q1UA 2NVUB 4M3FA 2CGPA 4BXXJ 2LY2A 1JI8A 2HS5A 3OJMA 1VQ8I 1USTA 5J4YA 3HB9A 1GLNA 4RB3C 2JSPA 5CQEA 4JX4A 4HZFA 2BY2A 1W0TA 1YG2A 2P7VB 4XK4A 3O4DA 3DEEA 3FK6A 1F5TA 2PFBA 4CZZA 4IHWA 4PDKA 3CA4A 3BA4A 3U1DA 4Z2YA 2KJCA 4XLAA 2AHQA 4J23B 4AIHA 4J2YA 3DPUA 2XAFA 1LE8B 2GQQA 1X4PA 2OF7A 2ZSIB 1J9IA 3WO3A 3TO7A 4ZOTA 3DLAA 3CMYA 2HQAA 1EYLA 2MC3A 1S8NA 1IJTA 3K4MA 2VBYA 2QF7A 1G4DA 2E7XA 3P6IA 3E3VA 1ETXA 4E7KA 2LY1A 4I98B 3HXLA 2DQRA 1ISWA 4BEHA 2BV6A 4QTRA 2XF6A 1BIAA 4ESFA 1Q1HA 2XASA 3Q5FA 3FX3A 1JHFA 2PMHA 3VFZA 4IKFA 1WZ2A 5DUKA 3WE2A 1Z4SA 3BAQA 4KEJA 2V6CA 3JW4A 3F8FA 4QPOA 3LSKA 4I3NA 5E3LA 5IYBJ 4TLPA 1Y1VJ 1O7FA 2ZC2A 3RTRA 3J80K 5D5UB 3I4NJ 2CG4A 4M9SA 2M8EA 2UV1A 3IH4A 3POKA 5FLXZ 1P4AA 3NWTA 4CUGA 4A5MA 1RC9A 1XX5A 2HQ5A 5K7HA 3R0AA 1FSHA 2K27A 3OYEA 1CF7B 4KICA 4OEFA 3KE2A 2BEAA 1QA6A 2QYIB 4U7BA 5EZHA 4IO9F 1YLFA 5F1JA 4A0XA 2H1KA 4G8XA 3ZX7A 4PUSA 3BRFA 3GZNB 4S05A 1JGGA 5D4SA 2H8RA 1ZYRF 2RNJA 3FJAA 3FUOA 5DUYA 3I59A 3DEWA 5L3GA 1T9FA 3FJBA 2VQGA 3Q7XA 3HJEA 1OMIA 1WI3A 5CYVA 4IX7A 1YS6A 1YTYA 2D1HA 2XRLA 3BCAA 3ZCOA 2VODA 1TT0A 2HWVA 2L9RA 4ZBVB 4AN6A 2JWTA 1YXWA 1PUUB 5ED4A 2OPTA 3PSFA 1FSEA 3O6BB 2ZMEB 2LF7A 3NBEA 5LHGA 4OIOF 3I29B 1RZ4A 4OMZA 1TC3C 1UHMA 1OCRH 2ELHA 4GOYA 3PFIA 4I7HA 3U21A 3PUBA 4I1EA 4ZGRB 3OMYA 1SFKA 3MN2A 4GP0A 4P5OA 2WAQA 1KU7A 2DA5A 3NJ5A 4XLCA 4I99C 2WTEA 3N7LA 2X6XA 2NP0A 1OFCX 2HOTA 5DSSB 1D8KA 5F08A 3S93A 2ZNZA 4ETSA 5JR3A 1LUJB 2K9MA 3ESWB 4GO1A 2K43A 3P9CA 1AVXB 4LB6B 2VBZA 1HKSA 3E0JB 3GMEA 1Z7LA 3M07A 1YI2I 3OR1C 1BW6A 2VLAA 2DW4A 4C2UA 4R1HA 1I3AA 1S29A 4G7ZF 5HPZA 1OLTA 3P5JA 4EEFG 1ISXA 3TC2A 4OEEA 2O5RA 2XGEA 2IGMA 3WODF 4EM1A 3L09A 1ZG1A 2DQLA 4RLQA 1A6QA 3Q0UA 3OYIA 3CA0A 2ME6A 2DJIA 1VQLI 2IT0A 5KNLA 1FEXA 4LD5A 4PSWA 3FHNA 2EWNA 1BFBA 2CRGA 2RQPA 4A12A 1HDDC 3Q0WA 3CD6I 3BTAA 2QSFX 4P9UA 4XL9A 1BOAA 3HKZA 1ZH5A 1UG2A 2KRCA 3BZCA 2HW9A 5J4VA 2F5DA 3PUFA 1AKHB 3G4SI 3GFJA 4D0ZA 3MKWB 3RZDJ 3GO5A 1RETA 4OOIA 1SFEA 2ZSHB 4WXCA 1O4XA 4BHBA 3IM6A 1XG6A 3BCBA 1EV2A 4CZCA 3P6JA 2E2JJ 1U8BA 5HLGA 1ZK8A 1TWEA 1UG0A 3JTHA 1BR1A 2OUMA 5I1BA 5J40A 2M5WA 4MQVA 1YJWI 4A3EJ 4II0A 2XUBA 3CJTB 3JRHA 4I4PA 2Y9YA 1EH8A 1T6SA 1QNTA 3REOA 3TKYA 4B3AA 1APLC 4HDVA 1AFCA 4WF2A 5F27A 4U7DA 2Y9XE 3JSPA 3BQYA 3R4SA 2DTZA 3HSRA 2RKHA 5GTIC 3K1NA 2K9LA 3R6SA 2ZXWH 4XKBA 2OU2A 3KZZA 3CDHA 4UVAA 3P9KA 1HC8A 2W7NA 5DD8A 2RG9B 4UV8A 1M16A 4ZLBB 4F83A 5D4RA 4UVBA 3G71I 3CDIA 1PUMB 3HRTA 1FGAA 5L3FA 2RAEA 3CA6A 3O49A 5DTDA 3B9UA 2L7KA 3JRFA 1Y39A 4G6JA 3HPHA 4GAFA 4EATA 1U6GA 2VC1A 2PX9A 3F62B 1ZR4A 1B6AA 2EZIA 1U3EM 1N77A 1HCEA 1LEAA 4AC0A 3S15J 3U9GA 2ISYA 2ADUA 2XPVA 4U87A 4D8HA 2QYOA 1JUMA 1POGA 3K2AA 1WD3A 3FMQA 3OSGA 3Q0VA 2A5WA 2FBKA 1H0MA 2R3SA 3ISPA 1DQOA 1I3QJ 2K7LA 1GT0C 5GAQA 1A8DA 4XONA 9ILBA 4UHTA 4RA2A 2L54A 1D1BA 5F0HA 4I4OA 3SHFA 4LO8B 3ZPLA 3V7CA 2BOLA 2DFFA 1BA7A 4IRHA 3H6RB 1TLHB 2E1OA 1EH7A 5DV5A 1VQ7I 1XC5A 3M7GA 4KUMA 1K6OA 3R4UA 4YFKF 1T56A 5JLVA 2XOAA 4UVCA 3IV5A 4J2SA 5FZYA 3HGYA 4DENA 1IF1A 3BRGC 2W00A 3E5UA 3P9IA 1B8IA 3V0AA 4I8MA 1SD6A 2PLYA 1IRGA 3BPXA 2STTA 2CSOA 2Y9GA 4DQ2A 5IYDJ 3OJVA 4JAWA 1D0ZA 2P0WA 3CRHA 5J8CA 1ETYA 2W1OA 4H75A 4RB2C 4HJJA 1FYKA 2QBYB 3H0GJ 2EPFA 1V5GA 4LO3A 2R7DA 4KT6A 2OC6A 1U5TA 1YE9A 3N7MA 5D63A 1UAAA 1NG6A 2ZJQF 2I10A 2WV0A 1ZRCA 4HSRA 3PHZA 2FMYA 2FX0A 2DK5A 2HVSA 4QBVA 3M8JA 2L9NA 4G6QA 3VSLA 4L4HA 1HDPA 3I71A 3GZ5A 3HOXJ 3FK7A 2EQRA 4CCKA 5TGTA 4IZZA 2CW0F 4CICA 3PJRA 4LJZF 1AF9A 3GLLA 3K4KA 1MBHA 3O2PE 4AYBA 2ZJRF 4UB6C 1PP8F 1W3GA 1WHUA 3M4OJ 3E97A 3H5NA 4R6UB 2D1VA 2DA6A 3JRCA 5DD4A 1ONVA 5EF6A 4FE4A 3FJDA 2AQZA 5FLMJ 1S0LA 3AJ6A 3MCZA 1J09A 1AVWB 1B59A 2PJRA 2HOEA 3I5UA 1XGOA 2QM3A 1QBJA 1MBFA 3CA1A 3JCUC 3ZN1A 1Y1WJ 1D0YA 1S3JA 1HWNB 3K10A 1WJFA 3EUHA 4IHSA 4I09A 4GYIA 5EEHA 4BJ6C 5IY5H 4E7LA 1MMDA 4RS8A 2ZXJA 3GTPJ 1UB9A 2FXAA 3UR3C 1S7EA 3E5XA 3MALA 2J5OA 2Y0MA 4IEJA 3D5RC 1UFMA 2JZYA 3L7WA 1DUXC 3TO6A 2X48A 3HM5A 4OWRB 4XNFA 3COAC 1UHSA 5AONA 4BE1A 2DFIA 1G9DA 2ELJA 3LFKA 3H3VK 1BC7C 4XLPF 4ISQA 2M7BA 1G9BA 3HBWA 2VONA 5LGUA 4EJOA 4EB2B 2HGCA 4RDUA 1MJBA 1OJLA 1SD4A 1XHBA 3FKIJ 3OGFA 2FF4A 2R9KB 1N25A 2LK2A 3CUQC 4OWKA 4L9JA 1PUEE 3CQZJ 3KCCA 1I39A 1R22A 3AKZA 3N4MA 3RJPA 5E20A 4HNVA 1YJ9I 3WTUC 3CU1B 3O44A 4ON0A 1HQCA 1J0RA 1YS7A 1FNNA 3A4CA 1F4KA 1FOXA 3AL0B 3V0AB 2YSRA 5M5YJ 3L2CA 1P4XA 2R5ZA 1IUYA 3AH2A 2RVCA 3E6MA 1QGPA 3GWZA 1DPRA 3GFLA 3ZGKA 4X0GA 2OTLI 2DT7B 3OGGA 5J3LA 2A61A 3RKYA 1A6IA 5JFRA 4ABZA 4LG3A 4UUVA 2MH2A 3LA7A 3K1XA 2PMZA 3IWZA 2P6SA 4ZA3B 2FEZA 2W24A 4LO0A 1BBYA 4LO1A 4MGRA 3VODA 1FLIA 1O3TA 2K5CA 2GIVA 1Y8QB 4C3IJ 2Z16A 4A3GJ 1ITBA 1HLVA 2E34A 1IGNA 3CUQB 4BY7J 4BGDA 3S8JA 5DCFA 3HRMA 3PG0A 1X3ZB 1HWPB 4Y7NJ 5K5RA 3MZHA 4JX6A 3A23A 3N0KA 1I5ZA 2LRDA 5D5VB 3ZMUA 2NYYA 5CVVA 1RMLA 3IAGC 2WWYA 4DYCA 2D7IA 3AKFA 4Y4RA 2EIKH 3H9GA 1NUNA 3BR5A 1XYFA 4RGSA 3LFUA 1JKPC 5AIQA 4BACA 5D5WB 1KYWA 3ZXDA 2F5VA 4YEJA 1LNWA 1BFGA 3MVPA 1J7KA 1RKTA 2W57A 4E7IA 3S17J 1R36A 2EZKA 2JUGA 5JLXA 5E18F 4DOZA 2DRZA 3MKZA 4EQQA 2IS2A 3BTLA 2FQ3A 1X1AA 2KT0A 1W5CC 4BKXA 4QALA 1R58A 4OIRF 5D6EA 2R7XA 4JKXB 4NNJA 4D0TA 3ZMVA 3W2WA 1DDNA 3WE3A 1OCOH 2JRMA 4IPAA 2CFOA 2R5YA 2F5CA 2HKXA 2HQRA 2M45A 5DM7F 2F2FC 5LEKA 2O6GE 5IP9J 1DU6A 4GAIA 5BS6A 1NTCA 1ODDA 1DGWY 4PSXA 4A6DA 5F8YA 1WJBA 3BR1A 2E1MC 2DMUA 1MJ9A 1FOKA 4B8XA 3U2RA 2D44A 5JLWA 2AO9A 3RCOA 1KNMA 1QVTA 2KDZA 1V6UA 2EV6A 1IV8A 2B0LA 3CZ6A 5EG6C 4QLCU 4DIQA 3HUGA 4A3KJ 2DI3A 1WJAA 1S7AA 2PEXA 3L2RA 5EC5A 3LSPA 3MKYB 2J3PA 5EHAA 1MZBA 3TQNA 4YIRX 3GUDA 1R00A 2EFWA 1U0JA 2L4MA 4CDGA 3D1NI 1Y8RB 3FMSA 3FXQA 2D5VA 1S0EA 1VQ4I 4XSZF 4LO3C 3T8TA 1HSJA 1AHDP 1NH3A 4NQWA 1VQ6I 4BHCA 3K4LA 4ESBA 3OYKA 3HOVJ 3DBRB 1ILR1 1ISVA 3WG7H 4ZH4F 1IG7A 4JYKA 5ICGA 1PWAA 3T1BA 2Y0SN 4FE7A 1JTXA 4XR6A 5FNWA 3H5AA 1LDDA 1GUUA 4A0ZA 3G2BA 4L9NA 1O7LA 2R4GA 1MC9A 3G1MA 4ZZDA 4I0BA 1X1BA 4S04A 1TFMB 1FMVA 3ILAA 2Z5UA 3S1RJ 2A69F 4J19A 4BE2A 2VJ5A 2ZJ2A 3BAUA 4I37A 1K78B 3JRDA 1TNSA 3SDGA 1OCZH 3CF5F 4L18B 4ZYEA 2JA7J 5GPAA 4PGHA 1D5VA 1RKWA 2FD5A 1Y56A 2KIMA 3QP6A 1KZHA 4KT5C 2V9VA 2VJ4A 2FBIA 2XPWA 3H5RA 1QZYA 1YYVA 1V5EA 3AH4A 1R7JA 2ISZA 1BFFA 2XC7A 2ZMEA 2V1NA 3KMVA 3W3CA 1XG1A 3H3ZA 2D7RA 5DCMA 3CTAA 4OIPF 2NRAC 1ETVA 3CMEI 1SFOJ 4UUSB 4EMSA 1D5YA 1Z21A 4XLHA 1SEUA 4XLEA 6PAXA 4EJUA 41BIA 2XF7A 2LC2A 2TCTA 1AU7A 3OSFA 4BDYA 4V2GA 1FIAA 4AVPA 2NTDA 1WGXA 4XKWA 5ERIA 4J01A 4QPQA 3E6CC 2L01A 1D1CA 5CVJA 4PC4A 2DBBA 1A35A 2RNGA 1BM9A 4KDPA 3VWBA 2R5ZB 5B1AH 3ZN0A 4I4SA 1B72B 4Z6YA 2VSAA 4EM2A 2VPRA 2JPCA 2QA4I 3QWLA 3J7AY 1WVRA 3ABUA 4I7IA 5CVIA 1IV6A 1XMAA 2VT3A 4OIQF 4WK8F 2VKDA 1S0FA 5HDKA 1SFUA 4R79A 5HNFA 3W2AA 2AXLA 2UXXA 3BAHA 2F2EA 1QRYA 3RIRA 2OZUA 1IC8A 4A93J 2Y48A 2R7WA 4IHXA 2R92J 1UELB 1HCDA 3Q7WA 4IRIA 2LMDA 2MFZA 4KA4A 3J7AO 2X51A 3OWTA 4JK1X 4IZXA 3NEUA 1UCRA 1I1GA 3IH2A 3BTIA 5D5XB 2HDCA 3UJ4A 2CQQA 1DQGA 1JT7A 3T0YA 1TL8A 2COMA 2F5EA 1KQ0A 3CCLI 2LD5A 2VJJA 2HPIA 5F0CA 2W4SA 4MHGA 4EJTA 2D24A 3O4BA 3I3LA 2OTJI 2K8RA 3G6EI 2DOFA 1QPMA 2WV1A 4KIFA 2NS0A 1ZTRA 2NNYA 5FLXK 1QHGA 5F1RA 4KEIA 4UUTA 3KX2A 4J2XA 1JKRC 2EBIA 2IGOA 1YHQI 1F9NA 2TRTA 1QO0D 2LOOA 1Z9CA 3UD8A 1GXPA 1VQ9I 2Y75A 1WI9A 2V4JC 3HSFA 2HEOA 1FY7A 3MKLA 4D5CA 3FKJA 4RM2A 2FUG2 4HPQA 2FO1A 1TWAJ 2ID3A 2ME0A 3L2UA 4CHUA 4IYBA 2GA2A 4ESJA 3Q9VA 3R0JA 1LKXA 1VI0A 3DU6A 4CYDA 2LKXA 2CQNA 2D2WA 1OCPA 2ACJA 1RESA 1LDKB 1D0HA 4IQPA 2EIJH 5LRRA 5BPDA 4HF0A 1FZPB 5FZZA 4B3XA 1RR7A 3KPHA 4A3IJ 2L7ZA 2VKEA 3BJAA 3EPZA 4RGXA 2VJIA 2P5VA 5F64A 1DP3A 5LRSA 1HA8A 1S0DA 2HZ9A 2K85A 3ZQLA 1S0BA 3KEQA 2P7CB 2W84A 4E6KG 1AWCA 5HLTA 2YUSA 4LG0B 3GEZA 4M9XA 4A7ZA 3KZYA 1S5LC 3M3YJ 4BQAA 2VE8A 2JA8J 1ERDA 4U0YA 3OIOA 3KETA 4KIBA 3A22A 4DNCA 1MD0A 3KYLA 2ZKZA 5AIPA 3ZRGA 3PO3J 2CW7A 3JRGA 4JKQA 2DOAA 3E1SA 3OR2C 5M3FJ 3BROA 2E4MA 1LFPA 2CUFA 2Y69H 4ASNA 4I4YA 1ZRFA 2H27A 3LSJA 3IC7A 1IN7A 1N78A 3JR9A 1WH5A 2YR2A 3IH3A 2FMLA 3KP4A 1XDUA 3V8JA 2E7WA 2KISA 1XMXA 3FXRA 4ZYHA 1B8IB 1JGSA 1A04A 2BGCA 1AA7A 4HA8A 9ANTA 4IONA 3OYAA 4AIKA 2O61A 4II3A 3K4BA 3O3KA 2A5YB 1G3YA 4JX5A 4UV9A 3OY9A 1BOBA 2I8DA 1RR8C 3KFWX 3W6KB 4PFOA 3S8KA 2C6YA 2KDOA 4NB5A 2DTRA 4AD9A 2M4GA 2BXZA 4PJMA 2VQCA 3DKXA 4HV5A 1R9TJ 4X1EA 2F4OB 3OYNA 1ABRB 1QXMA 5FLVA 1YIJI 3TW6A 5J1UA 1X1CA 2Z49A 4YFXF 1DPUA 3GTMJ 1S7OA 3OYCA 2RQQA 1IN5A 2FOWA 2BVMA 3GLXA 4I01A 3JRBA 2M30A 3EYIA 3C7JA 2BFHA 3DBHB 2KIUA 4KC3A 4QBCA 1G3SA 2VE9A 2F2FA 2KKIA 1RNLA 5FJ8J 3H6SE 2V9KA 3I64A 2EFQA 4C30A 3HKZN 1YOVB 4YIFA 1ETKA 5IP6A 2K4JA 5CQGA 3K70D 2R7OA 4V19K 3GTJJ 2ET2A 1MMAA 1FV3A 3AH1A 1T39A 5F6FA 2CFXA 2HWAA 2BE5F 1FYLA 3F21A 2ZCWA 1Z77A 4OW4A 4OU0A 5M5XJ 1VQNI 1W5TA 1T0FA 5E17F 5HODA 2VLCA 5FKOA 1HW1A 3UNGC 2L2OA 4Q9GA 4R8HA 3VT2A 1ITYA 2XKOA 3H92A 1U9OA 1VQKI 5CPRB 4ZFYB 2EFPA 2OZ6A 4ZTJA 1Z3YA 3KLNA 3QYBA 3V42A 1CGPA 2E35A 4P0LA 5J47A 2R7TA 1TWFJ 2VN2A 3VYTB 2GA1A 1ENHA 5L3DA 2AS5F 1PC8B 5M5WJ 4RAGA 2HYFA 1MBJA 3PSIA 4MFEA 4G94A 4LB5A 1OR7A 4EFRA 4ITVA 4I0YA 3TMOA 3UD7A 1R1TA 3S1MJ 2IGNA 3RTJB 1TBXA 3AG4H 1V6VA 4RAZA 1X4OA 2DYRH 4OINF 3VWCA 3HHGA 2X1CA 2Y2ZA 4PFPA 1RUOA 2Q9XA 3QP5A 1ETWA 1B4AA 1XTAA 3JTGA 4G1RA 3FFZA 2BHYA 3ASNH 3F22A 5GTHC 3K0LA 1TWHJ 5JVTA 3IRRA 4I4VA 2PI0A 5DVHA 1TTYA 1XSXA 3ZMZA 3G3ZA 1PZZA 4RAYA 2QSGX 2BVLA 2ZMEC 2CV0A 3DCFA 3B6CA 3DTKA 2DAOA 4WXHA 2R93J 1DQUA 5HS8A 2KI4A 2L7FP 2K9SA 1FP1D 1P7JA 2RREA 3DLLF 1FTTA 2GXBA 3FJEA 1GV5A 3QYFA 3TBIA 1NHAA 4N0BA 3SXYA 4W97A 4CH7A 1LEBA 1W36C 4Y3OA 2IXSA 4LO1C 2M9HA 5BQTA 4G9YA 3DP7A 5F8WA 2X1DA 2B9SA 2HOSA 1MSEC 4A3CJ 3ZR8X 1YTOA 1WKMA 5C4JJ 4LO7B 3DFGA 1BA5A 4HV6A 1FT9A 4DYRA 4DZPA 3QAHA 3K1PA 1QQLA 1ZN2A 3HSEA 4P6AA 1T95A 2VKHA 3ZQFA 3CA3A 1F36A 4G6MA 4XRMA 3NBNA 5ILUA 4BE0A 1RI7A 1BW5A 1FN0A 2XF5A 4L5IA 4QC4A 2KP6A 2UUSA 4IQ4A 4B48A 4EVIA 1SMYF 3F6OA 3SDBA 2QSHX 1BASA 4A6EA 1BN5A 5A2QZ 3CCUI 3AL0C 4LITA 3SFIA 1U5TC 5BXPA 3I59B 2HU9A 3DPTA 3NWSA 1LB2A 2K9QA 3QRFF 3FWEA 3AKGA 4RAFA 2QCOA 4HW0A 3WMVA 4ENJA 2JRTA 1G8XA 2UZKA 3U1KA 1P9QC 2HFHA 2VQHA 3ZXSA 1CF7A 3ONQA 1ISZA 4U0WA 2KFDA 3I58A 3S2WA 5C3EJ 4CXFA 2MSYA 2L5QA 3S8PA 2M2EA 2M0CA 4P9FA 3PO2J 2B7EA 3V4GA 2NS2A 3IIRA 1LJ9A 3BZ6A 4I4RA 3C2HA 1N75A 1WRJA 1L3LA 3HMYA 1SAUA 3HALA 4NQWB 2UWMA 2F4IA 2GOXB 1OCCH 2GBYA 2OV7A 4L9VA 3BR0A 4L5JA 5EDNA 2KZVA 4PZJA 4ZDOA 3BA7A 2GM4A 1EPWA 4BQQA 3BR3A 2CUJA 3LL7A 2BEBA 4DBQA 1RPWA 1II4A 2XAHA 1MH3A 3W6VA 3PFYA 2Y9WC 2FOKA 1KYZA 1YW9A 3F8BA 4HX7A 2RQ9A 1EH6A 3CCYA 4USOA 4QKSA 4D5FA 2DYSH 1O3SA 3EF2A 2KLLA 3IM5A 1ZHFA 2JVGA 5EYRA 5LD2C 3BOQA 3N7KA 1XB4A 1X2NA 3CUOA 3R61A 2E60A 2R5YB 4USPA 5BQUC 1USSA 4H4KC 2ETHA 3LSIA 2XAUA 2R7QA 3QOPA 2QGUA 4M71A 3ULQB 3OS1A 2PBIA 3ERMA 1ZGWA 2A6EF 2X4HA 3M1EA 5EEGA 3CP8A 2HYJA 3C18A 4E7ZA 4IHYA 1D8JA 3OBTA 1T98A 2CV1A 5FD6A 4MO7A 4X38A 3CJRB 1HBXG 3KYCB 1FPQA 1JTYA 4PGGA 2HDWA 3PM1A 1WJDA 3MFKA 4Q4ZF 4J00A 3IAS2 4I1BA 2XV4S 3FJ9A 3L2QA 1MH4A 3N7JA 4JPZA 1G3WA 2KPMA 3OS2A 5EJCA 3VYRB 1YW8A 1R5HA 1ONKB 2LYCA 1J0SA 1X1PA 3E6DA 4XICA 5FNXA 2IJLA 1YW7A 3OYHA 2L9SA 1SVMA 3RSNA 2G7UA 2K02A 2ZFWA 5BOWA 2E36A 1IRAX 3BTCA 1TQMA 3AZWA 3CUQA 3HSMA 2DMPA 2MW8A 3QR5A 2NAZA 4ZKTB 4YELA 5J1YA 5E3MA 4ENDA 1YRNA 3V79C 1ZKGA 4BS9A 4E4HA 4IHTA 3LAPA 3S2HJ 1WBAA 3ZMTA 5L3BA 4E7HA 2K4AB 4HEA2 3VEQA 3K4NA 2Z9OA 1Z0XA 2IS4A 3SFZA 3T8RA 4A3LJ 5H6RA 4DJAA 1R8OA 2Y9ZA 4B09A 4KISA 4DEPA 3RI4A 1YQAA 2LF8A 2V79A 3CP2A 4FASD 5LGTA 4GOVA 5GPCA 2VC0A 4G6TB 1ZGJA 3H6QA 2WY8Q 5D6FA 3I0TA 1HOMA 4F93B 3ZOBA 4CGZA 4A3MJ 1V4RA 3F1RA 3CESA 1G2HA 2VBXA 3A07A 2EB7A 2DXIA 3VUOA 2KZGA 1IZ1A 2VPLA 3GX4X 1T8IA 4Q91A 2L4AA 4G9MA 4LIVA 3HDDA 2RN7A 3MQ0A 3HRUA 3BDDA 4I4XA 3V0BB 2XGXA 4QD2C 5JHFA 1D0XA 3SJMA 1JUPA 1VQ5I 1JQZA 1PJRA 5KHDA 1EKEA 1JHHA 4FISA 1NK3P 5HVQC 1BARA 1SVOA 3WG9A 4CJMA 4WX9A 2QVOA 4RB1A 3KIOA 4RLFA 1IDZA 2GLOA 2HR3A 1YYNA 1QZEA 2FGFA 2EFOA 3KYDB 3W2VA 1BI2A 2J5PA 3TP3A 1MNMC 3LSMA 1IOBA 2GZBA 1FTZA 4CCMA 1ON1A 5DUIA 5D8LB 3C3WA 5K7FA 1LVKA 4FX0A 5L3EA 2BXYA 2WB1N 4XKCA 1I6HJ 1T4QA 5KAIC 1R1UA 2DA7A 2H09A 3J81K 2FFVA 4ENKA 3BPVA 4BXFA 1ZG5A 1I1BA 3K69A 1JJ6C 1NG7A 1ORKA 1W1WE 4XSXF 2OQGA 4KITB 1HW5A 2NVHA 3Q3SA 5BXSA 4ZFUB 3FDYA 2PN6A 2UXNA 3IWFA 1DP7P 5K5OA 2NVTJ 1F31A 3VSKA 3L00A 3N05A 3T8SA 4C9YA 2CWEA 3A02A 3RQIA 2IW5A 5IT9K 1SAXA 3VT0A 3RMYA 2DMTA 3GYHX 2DPDA 3VYUB 4HLYA 1B1BA 1QQKA 5BXRA 2WC2A 2YPRA 3I9V2 4EM0B 4BHPA 2V6EA 1X3WB 1WBCA 2XRNA 2KJBA 2EZHA 4N4OB 3BA5A 2H94A 1QU3A 1U5TB 1XMKA 3C9ZA 5B1BH 1FOWA 3FXKA 3BR6A 2K3FA 2IS6A 2KI6B 2OAZA 1OCTC 2R7ZJ 2QBYA 3P53A 3HGGA 1B9MA 4HNTA 3T5XA 3OYMA 3NAUA 2R7RA 1F43A 1GV2A 3FXOA 2Y9FA 2GXAA 2VOOA 3BX1C 4L9TA 3IAM2 1UHWA 5EG0B 1CVSA 2ZB9A 3HBLA 1ZLJA 2V26A 2RDPA 3HG9A 1OPCA 4GP3A 1E0EA 2QN4A 2JQ7A 4MQ9F 3I54A 3I4MJ 1QHHD 2Q1ZB 3NBCA 4LLLA 4C3HJ 1XGSA 1J2XA 4Y15A 1B72A 2IGKA 2IEKA 1H89C 1YX3A 3O8GA 3H36A 4FQGA 1KQ9A 2ZBKA 4H04A 4UXNA 3CJQB 4B1RA 1DZCA 3M9AA 1S0GA 5F90A 3OS0A 2H6CA 3F23A 2CQKA 2HQNA 1RIOH 4QD2B 2MLKA 1FC3A 3HOUJ 1UPSA 1HXDA 2P4WA 4BBSJ 1S9HA 4I02A 4UUSA 4FCYA 2F48A 2VXZA 2WRYA 4KMFA 2OQRA 2D23A 1ZREA 2FFUA 2VU9A 4ZDLA 2A3SA 5FGMA 2DODA 5DCMB 4ANJA 4XFSA 3CC7I 2R7UA 3OL3A 3H9QA 3VDXA 2K86A 4FX4A 3K70C 4BU2A 4KFCA 4F52A 5HDGA 1NZKA 3TDZC 3HOTA 2Y30A 3CQAA 1V3FA 4ISRA 2IA0A 1LDJA 2FQ4A 3CO7C 4FGFA 1DIWA 2HZDA 1LQ1A 1P2FA 1D1AA 1I27A 4B47A 2MBFA 3WGGA 1Z3XA 4S0HB 3GCMA 1DU0A 1TOOA 4X39A 3BAVA 4HYEA 1PYVA 2KLOA 2MD0A 3PL8A 1K78A 2Z99A 2CJJA 2M34A 4MZHA 2NZ9A 2XSDC 1DGRM 1ETQA 3S1QJ 3CMMA 2LIEA 2WAFA 4XMYA 4G12A 2P23A 2D20A 4EFPA 1U78A 1H8AC 3GFMA 4LO7C 2IRFG 1RY7A 2BHZA 3S3MA 4HA2A 3WINA 1ZRDA 2YU3A 3F8MA 2VQLA 4WWCA 4IVNA 3F72A 1GXQA 3GXOA 2EA4A 3BT9A 2AFGA 4UB8C 3HN1A 4FETA 1BI1A 2R7SA 1BLAA 2QQ9A 4XM3A 2D43A 4OWJA 3E8LC 3LA3A 2DA1A 1H9TA 1ETOA 4K2EA 1JT0A 3ZQ7A 3O4AA 3SEQA 2FNPA 2A07F 2Q2EB 2QQAA 5H6QA 2I5UA 4Y17A 4BQOA 3O3QA 4I4UA 2FE3A 2JSCA 1KQ8A 2VSEA 2CMPA 2WBCA 3FXMA 2ICWG 3HUGB 1VTNC 5HDNA 3FBIB 3TW7A 1AKHA 3GW2A 3G73A 3I4PA 4MIMA 4W1UA 2STWA 1DZDA 1MJAA 1Z05A 2KRHA 3Q9SA 1R1VA 3AG2H 4D0PA 3CCQI 5DZUA 5CLSA 1J59A 2TDXA 4NHJA 1VCLA 1Z67A 1G59A 3KP3A 5E1XA 5DS9A 1W36D 2V1UA 3DKYA 4AN7B 3TEDA 3N97A 1YF8B 3DF8A 4A5NA 1VZ0A 2Y0SA 2ZXIA 3R60A 5E8GA 3OJ2A 4CYCA 2IVMA 2XB5A 2HZTA 3OIQA 3EUAA 4LK0F 3TOBA 1J5YA 3IKTA 2NVXJ 2IAIA 5ILSA 3WU2C 2HKOA 5B66C 3ERED 4EV0A 1XSDA 4KN4X 4IOCF 5EGOA 5HLHA 4V2FA 2IWTB 3OV8A 3RKWA 3HOMA 3A01B 1IXRC 4LIUA 3WTSC 1OQLB 2FJ1A 1WQ2A 5FRNA 5JI6A 3O4CA 1RZOB 4RM3A 2X9DA 4P96A 3R4KA 1SR4A 1AVAC 2G9WA 3V8LA 1E17A 2HYGD 3DPLC 3VSZA 2GXGA 1LFBA 4A3JJ 2CQ7A 2V1XA 1W3AA 3RPUA 2P8TA 3WGIA 4OEGA 1X2MA 5J1RA 2QENA 3KP6A 2QLZA 1W7PD 2ECBA 2XIGA 2LNBA 4C2MJ 3JUTA 5FKNA 2CQXA 1S72I 3WTYC 2Q8KA 5ICEA 2DLLA 1YJNI 3OYDA 4M6VA 3ZQHA 2VUAA 4UY8I 2PG4A 4KYWA 4YG2F 2JK3A 4XLFA 3BTJA 2R7FA 1FQ9A 1X19A 3ZMDA 1R8NA 3RYRA 2L02A 2LP0A 3ZMSA 1JT5A 4O3MA 5GAHJ 4QIWN 1ZLKA 5J8FA 4I2SA 3ROUA 2OD5A 1DFQA 2VBWA 2O8KA 2NM1A 3V7SA 2YX4A 3F0CA 4RBOA 2LG4A 2CYYA 1P92A 1PUFB 3S1NJ 2BEOA 4G7OF 4LO2C 2ZJPF 1TTUA 3JAMZ 1J75A 1MBGA 4JP0A 2IBDA 3CF2A 3MWMA 2V9PA 2COBA 2FU4A 1YBIA 4L5EA 3CCMI 4XN0A 2GOMA 3O8HA 2O7OA 2JMWA 5DYMA 5GP9A 1MSFC 1LFUP 5FZUA 5ICCA 4QSHA 1W0UA 2P6TA 2EV0A 2WAQN 3V8KA 3CC4I 4IY9A 1GGPB 2CU7A 2BYVE 1IN6A 2BZTA 5KCMA 2NS7A 3JREA 3C2GA 4MTDA 2ZXHA 4FTHA 3WTTC 1PUFA 2FRHA 2LBFB 3MZYA 3JRAA 2RC4A 2BW3A 3OYJA 2XGDA 2HVRA 1SC7A 1WJCA 5H2FC 4HNUA 3A21A 2NVQJ 4JQFA 2YU9J 1SR4C 4EFQA 3D7WB 1V6WA 2LKSA 3WGHA 1BR4A 4MEXF 3EYYA 1P7IA 4PJLA 5A2QK 4EEEB 1IXCA 5CJ9A 2ZQOA 1JT6A 2YX7A 1RRJA 2ZR1B 3NQOA 3O5WB 4DYQA 5BVPI 2H1LA 2MYSA 3BQZA 1M2TB 2JN6A 1O57A 5D62A 4Q47A 1R23A 1ZAOA 1K5UA 2FDBM 2DA2A 2ZO4A 5FKMA 3IHUA 3L9FA 4KIGA 3ML6A 1Z7UA 1PVEA 3KZIC 1FMMS 1FIPA 2E2HJ 1VQOI 4RB0A 2DU9A 4ZZLA 2ECCA 3PNVA 1XSVA 1MKMA 4E7JA 3LSRA 1LE8A 2HNHA 2BY0A 2PJRB 3QYDA 4D1QA 1C0WA 4I6IA 5HS9A 4HSTA 5TISC 3A01A 3S3NA 1MBEA 2VL8A 4LK1F 2X6WA 1RUNA 1Q03A 2DCEA 3CAHA 1G6NA 3F9KA 5EGOB 2GAUA 5LFAA 3CCSI 3HYIA 4N9IA 2MGQA 4OAYA 2NXNB 5B3SH 4A0YA 5LGNA 2P5KA 3ZC8A 5LLQA 4GYGA 3KEYA 1IW7F 3C1DA 3H35A 2KRFA 3A2KA 5E3NA 2ZNYA 3KLOA 5E79C 2DA3A 3LWFA 4PK4A 4XORA 1E0OA 1MNDA 3BJ6A 1Z2VA 4P0KA 1TP4A 2CS3A 2W85A 3RZOJ 2DMQA 4XFTA 4M3GA 3CCEI 2A6HF 4KMUX 4HQMA 2NOJB 1MW7A 1REPC 1I1SA 3PMEA 3DBLB 1WSUA 3NBDA 1CE7B 3WU1B 4HBLA 2M87A 2D1ZA 2LLKA 2MD5A 2MC4A 2VUMJ 1JT3A 2PMZN 3QPTA 3FM5A 4MLOA 2QUFA 1AOYA 5BXTA 1TZLA 1WPKA 2FBHA 4P0JA 5D61A 3SZTA 1TWGJ 1N4KA 4EJWA 3LSTA 1IHKA 4IZEA 4H0EA 1JLXA 3WO4A 5BP5C 2Q2EA 2A05A 1WFXA 1WJ5A 4GDFA 2A68F 2DO7A 3CJNA 1TQIA 2GIZA 5FRMA 3VSFA 1KGSA 5ICFA 1IILA 3K7AJ 3UKGA 4BBRJ 2QKMB 5DM6F 1OQYA 3TP0A 3IUOA 4AYBN 1W7PB 2M4KA 4IRGA 5FFXA 1FWUA 3K4CA 2VXTI 5TJJA 4XIDA 3LAJA 4RGRA 4H9WA 4XRSA 5ILVA 2EA2A 4LGWA 2DFEA 3BZKA 3FM3A 4LMYA 3OYFA 1IAWA 1HIBA 3H6RA 1IRPA 3X2QH 2BY3A 5B5EC 1HKQA 5C44J 2F6CA 3ZQGA 3FJJA 3F3XA 1S0CA 2O3FA 3LSGA 2WB1A 2NOGA 2V1DA 1R6RA 2IS1A 3Q7YA 1VFCA 1TT5B 3G1OA 3ZQQA 1DLLA 5FD5A 4D9JA 4F92B 2EV5A 2VXDA 2LIQA 4I96A 2BY1A 2ID6A 3VEPA 3EUHC 4M9ZA 2DA4A 1XS9A 2K9NA 2JA5J 2IHOA 1EJ9A 4LLGF 2ESUA 4NC7A 3TDUC 3WO2A 1V5FA 2G7HA 4U88A 2IPQX 4AM3A 1JLYA 4DGWB 4ZTFA 1ZQ3P 1MD6A 4I76A 3FJKA 1GVDA 4MTEA 2DK8A 3HTUA 1R5GA 2XROA 3TOAA 3LQRA 5LBQA 4KEKA 1IXSB 4HR6C 1SFXA 1AXMA 1HWMB 4MZGB 3JSOA 5BOXA 1Q1VA 4OUJA 4NBQA 4C3JJ 3QPSA 3A0BC 1E3OC 2E1NA 4BUPA 2HDDA 2E4MC 1W7PA 5BMZA 3TGNA 1QQIA 1S6LA 1I50J 4RGUA 3BG9A 2H6BA 4B44A 3DU5A 3K6GA 2DN0A 1Y0NA 2F4MB 5LHIA 1FWVA 4L4IA 3S2DJ 1YFHA 3BR2A 3K1MA 4KN7X 2IA1A 1IJWC 5EZGA 4AVZA 5E3OA 5GAEJ 3HTSB 1TIEA 1CQTA 5HOOA 1FMZA 3A03A 1BFCA 4YRVA 2JT1A 5KAFC 4ZDPA 1TNTA 1ACIA 2IP2A 2LFBA 2O03A 1UJ8A 2Z1DA 4ENNA 4PJ0C 1P4WA 3SYTA 3I55I 1HCRA 4Q9PA 5K5QA 2XDVA 2F5FA 4X6AJ 3GVAA 1IT0A 2Z48A 3HEFA 4M3EA 3ELKA 4OMYA 4EKXB 5F04A 3FXLA 3OYBA 3M8EA 3OBRA 3DKWA 1M1EB 2AQEA 3RMXA 3QODA 3QU6A 1XDSA 1K61A 3S32A 4BQNA 3O4OA 2XKPA 2EFNA 3BG3A 3AAFA 4NC8A 3GZ6A 3S14J 5D8KB 3ABKH 2DS0A 2D45A 2MH9A 2X1EA 2GWRA 3PQJA 2DT6A 3VB2A 31BIA 4XLNF 4BL0B 1LPQA 3DEUA 5CKTA 3H9JA 2ESHA 1ZARA 2AXTC 1IRZA 1KONA 1WJEA 1NK2P 3LTQA 3JRIA 1ISYA 3MD2A 2DFHA 3J80Z 3NRVA 3B6AA 3ECHA 2VOPA 2LR8A 4HX4A 2EH3A 4AIDA 2F8XC 2XVCA 3GBGA 3GF2A 3IP4B 2VASA 1WWXA 3WU0A 2AXMA 2OCEA 4I6ZA 2JA6J 1R71A 3J81Z 2ERMA 3I2AA 3I56I 2CW8A 3FIWA 2X85A 3LOCA 1D3YA 4M73A 4N4NB 4A69C 3AFHA 1SMTA 3H0DA 2EINH 4HF1A 5FFZA 4L0YB 1Q04A 3L1PA 1R4MB 1OYIA 3NARA 1UZCA 2B63J 3PQKA 3V7RA 3IL2A 3M1CA 3TO9A 4HDUA 1DJSB 5L3CA 4D7NA 2QEXI 3BC8A 4F91B 1K4SA 3HOSA 1WCMJ 1WH7A 1KU9A 3GTQJ 3ASOH 5FKKA 4A7YA 3V0BA 4X3AA 3H1CA 1E3PA 1SVLA 3CCVI 2MLGA 5HLIA 5BNGA 2L5XA 1JY0A 1Y6IA 1ZELA 3MEXA 3B73A 4P55A 4M3BA 1FBUA 3LMMA 5TRDA 1DFCA 2BW3B 3HPGA 2K40A 2ELKA 2LBFA 2DJNA 4XKVA 4BJTA 4Z9WB 4XN3A 2QZ8A 2X2SA 3CLOA 2MABA 1P63A 1BIBA 1XN7A 1BJZA 3D5SC 3VT1A 3PIPF 5B2HA 3AG3H 1G3TA 1HW2A 1E3HA 1X58A 3CLQA 4A3BJ 1XCBA 2JJ7A 2AQFA 2M3AA 2E2IJ 1SD7A 4I4QA 2K4BA 2OJED 4M6XA 2LVSA 3I2XA 1FOYA 4XOPA 3S16J 2ZFUA 4P1WA 1YX5A 4E7SA 1IO2A 3WTWC 3D0SA 5JVGF 2Q0OA 3HOZJ 5IT9Z 1STZA 1R49A 5JHUA 2OCCH 1MMGA 1Z91A 4MFDA 4YFNF 2W82A 2JPBA 2UUZA 4CSWA 3S3OA 3FBNB 1T33A 3FF5A 1Z0HA 2M49A 1B9NA 4WCGA 2EK5A 3QPLA 2XAJA 2W25A 3RPUD 4NDLA 1K7AA 1BLDA 4BEHB 3PIOF 5FO5A 2X6YA 2QQBA 3IKVA 5IT3A 2E19A 1L0OC 5GADJ 1V55H 4I0AA 4II2A 1EVTA 1ZG3A 1KU3A 3SEZA 5F8SA 3FISA 4Q5SF 5IYCJ 1OYWA 3EUKL 2P81A 2Y31A 2FSWA 1IDYA 4B43A 2NS8A 2JVHA 3WHCA 2M1BA 1XD7A 2VXRA 3BG6A 4LO2A 1Z6TA 3A1YA 3WA1A 2XAQA 5E1WA 1ULYA 4BY1J 1ZGAA 3F8NA 4MEYF 2EILH 3MMYB 1SZ6B 1FJLA 2DPUA 5JMCA 2O8XA 1BJAA 1GDTA 2M7AA 3FZVA 3MPPG 2HTJA 3AJ5A 1U2WA 4G9NA 3WMUA 3FJHA 2DDBA 3FGMA 3KEOA 4L0ZB 1K6YA 2MIBA 4ZFWB 4F7ZA 1FYMA 3CC2I 3CRGA 4CYCB 3B02A 3TL4X 1FBSA 3WTVC 3RQ4A 2KKOA 4E70A 1KU2A 3BADA 1PDNC 4HQEA 4BAYA 4CA0A 2NNNA 1IRFA 3QYEA 4C2TA 1T38A 1O3QA 4LFUA 1MDMA 2GO2A 3CDLA 1I6XA 4MNUA 5LEJA 2BBYA 4HRIA 2OBPA 4J2KA 2KIQA 1FWZA 4A3FJ 1IN4A 1L2HA 4M3DA 3MAJA 3UD9A 4IL6C 3UJ0A 1QPIA 1GHCA 2CO5A 5EEAA 3E6BA 1FP2A 2XHKA 1TWCJ 4XOTA 4AUXA 3K9TA 1ZR2A 1Z6RA 2QWWA 4ZYAA 3GTKJ 1E2XA 4HAMA 1PP7U 2LTPA 3AKHA 4GRIA 4B4CA 4Z8SB 1BI3A 1YIOA 4ZC3A 2WBMA 3SZPA 4PJJA 4ENMA 2DREA 3H3UA 1OYYA 1A5JA 2AAIB 5K7ZA 4F34A 4GXOA 3BAGA 4M74A 4IHVA 1TQPA 4IQJA 1G9AA 2QQ8A 2X0LA 3RPQA 1F1ZA 3QPHA 4UNOA 1LVAA 2PJPA 1P6RA 5F0FA 1UMQA 2MLLB 3RSJA 2DOEA 4XKIA 3CCRI 3WHBA 4BDZA 3G1LA 1AVUA 1XGNA 5BPIA 1T2KA 2HPMA 4YOLA 5LHHA 2LSOA 7I1BA 1K83J 2QKLB 2ZQNA 1X1DA 3LA2A 4JOMA 4IXAA 5CVRA 3VOEA 3F6VA 2YUGA 4LO0C 4DW6A 4MZFB 1O3RA 2OA4A 1VNDA 3GTGJ 3KP5A 4F55A 3AKIA 4HLXA 5KK1A 2MA3A 5M3MJ 2V7FA 2XB0X 2DRYA 3CRIA 1MMNA 3LNQA 1TP0A 3AZVA 1V6XA 2XGCA 1JXSA 4XBFA 2HXIA 1OISA 2JA2A 4GCVA 4YIIA 4ZYDA 3C2BA 2D22A 3ZC9A 4TV7A 4WXDA 2WA0A 3DV8A 2HXOA 3OYLA 2E71A 4G6DA 1A36A 2GZWA 3E7LA 2VI6A 3HRSA 2XPUA 3FMRA 4XRFA 5HS7A 3SNVA 3RYPA 4NUBA 4RMNA 1W3FA 2O0YA 2CUEA 3A0HC 1TWMA 4EGYA 2IA2A 2HI3A 3K2ZA 5BP5A 3W6JB 3LLPA 4GGGA 1JTCA 2W48A 3ABLH 4KNYA 2PQ8A 5BQUA 5G00A 1FMWA 1IN8A 5FROA 21BIA 1WD4A 5C4XJ 1BI0A 3L2WA 1HWOB 1GVJA 3ABTA 2P39A 1JUSA 2XSJC 3QQAA 8I1BA 2XAGA 3RKXA 1XPXA 3QU3A 4IOAF 3JRRA 2ESNA 3M8FA 4BH9A 4CO8A 3DTEA 1W4MA 3HHHA 4IF4A 4IJAA 2P5LC 4QO3A 1T08B 3ZQCA 3BAOA 3AG1H 3UDAA 3JAMK 2LKPA 3IM7A 3ZP5A 2JTVA 1TW3A 3OIPA 1QZZA 5EG0A 1VF9A 1OKRA 1OR7C 4M6YA 4QWQA 3RKQA 5IOZA 3DTIA 2H8WA 5CVUA 1YO5C 1XCVA 3F8CA 3KP2A 1SANA 2K3PA 1MNEA 4F3QA 2DMNA 3GTLJ 4JQ0A 3DXJF 3K4JA 3FXJA 3CA5A 1H9GA 3FJIA 1K4TA 5E1ZB 4ZJZA 2E1MB 3FHZA 4IHZA 2MC2A 2HVQA 2Z3YA 4XQFA 1HF0A 1JE8A 4O5VA 4KBBA 1W5SA 3E5QA 2EZLA 3BRDA 3PNYA 1SD5A 1MMSA 2I1BA 1V54H 3HL2A 3KP7A 4PJNA 3L2VA 2PMUA 1Z1DA 4O6JA 2HTSA 1I1EA 2EJRA 1R5ID 3GTOJ 1K79A 4QKRA 1X3UA 2Z33A 5HNHA 4FT8A 2KL4A 3QOEA 2DDAA 1JJ8C 2EIMH 2KQRA 4HF2A 3BB2A 2WAEA 3LQQA 4CCJA 2CUZA 4U0VA 2E5ZA 4Y33A 1TW2A 3D5LA 1U8RA 4BXUA 1FV2A 2LDUA 2O9LA 1Y0UA 4HOBA 4EJVA 4BJ5C 3W9TA 2CH0A 2R0QC 2E1CA 3HC7A 1IUFA 1MIJA 2MG4A 3EETA 3P7NA 5IOYA 3J7YJ 4EGZA 2CV2A 2RSTA 3BLYA 3J7ZI 4IY8A 4FHTA 3FJ8A 2LH9A 5E8IA 2VKVA 4BNCA 2VB6A 5IP7J 4XRSG 3OYGA 3VYSB 1A31A 2L3DA 4CCOA 4I2OA 1G82A 2G0EA 2X6OA 5GAGJ 2WADA 4A7KA 2LREA 4Y52J 4A2UA 3IRQA 4JBAA 2E5NA 3SQNA 5K1YA 1JKOC 3BWGA 1H88C
chains in the Genus database with same CATH topology
3N0KA 1JT3A 2X2TA 2RQ9A 4HG2A 2LRDA 4KJZA 4FVVA 2NYYA 4WBCA 4MLOA 1RMLA 4USOA 6I1BA 4QKSA 3DQVC 1TZLA 1JT4A 5BXTA 5E24E 3WINC 3IAGC 3FJFA 4P0JA 2D7IA 5D61A 3AKFA 4Y4RA 3EF2A 2KLLA 3FJCA 3DWLE 1N4KA 4CCLA 3H9GA 1NUNA 3IM5A 1XYFA 2JVGA 1IHKA 3LFUA 5LD2C 4IZEA 1JLXA 3N7KA 3WO4A 5BP5C 4BACA 1WFXA 1WJ5A 2E60A 3ZXDA 4USPA 4X37A 5BQUC 2F5VA 4H4KC 3LSIA 4YEJA 2XAUA 2R7QA 5FRMA 3VSFA 1IILA 1BFGA 3OS1A 4P0KA 2M0MA 4E7IA 2QKMB 3PNTA 3CP8A 3IUOA 2WY7Q 4E7ZA 2M4KA 3OOUA 1FWUA 2VXTI 2JUGA 3K4CA 2CV1A 3OBTA 4H9WA 4DOZA 2DRZA 3MKZA 4X38A 2IS2A 1X1AA 3CJRB 1HIBA 4QALA 3OYFA 3H6RA 1IRPA 2R7XA 4JKXB 2HDWA 2R7VA 4NNJA 4D0TA 1BR2A 4OWLA 3W2WA 1WJDA 4J00A 2KHMA 2Z2SB 3IAS2 3FJJA 4I1BA 2F6CA 2CFOA 4JRAA 3RTIB 3FJ9A 3L2QA 1S0CA 3LSGA 2WB1A 2VIXA 2F2FC 1R6RA 2IS1A 3N7JA 3Q7YA 4GAIA 4JPZA 1DGWY 4PSXA 2KPMA 4DBRA 3OS2A 3ZQQA 1DLLA 1IRXA 1WJBA 2E1MC 3VYRB 4D9JA 4OAZA 4F92B 3SZGA 1HKNA 1ONKB 2LYCA 2VXDA 2D44A 3BG7A 3RCOA 1KNMA 2LIQA 2Q3NB 1EA3A 3EUHC 4I96A 1V6UA 5F8YA 1J0SA 5FNXA 3OL4A 3CZ6A 3OYHA 2HWMA 3FUQA 2IHOA 2A6TA 2L9SA 5EG6C 1G9CA 4DIQA 1K5VA 3RSNA 4AU7A 4CCNA 2ESUA 2KMUA 1WJAA 4NC7A 5EC5A 3L2RA 3WO2A 3MKYB 4UY4A 2J3PA 1V5FA 3AZWA 1IRAX 3HSMA 4XFUA 5EHAA 1JLYA 4DGWB 1T0FC 4ZTFA 2KH2A 4DCKC 1MD6A 3ZXGA 1U0JA 1RG8A 3LSHA 1XZZA 3FJKA 3QR5A 4ZKTB 4YELA 1Q1UA 4ENDA 1S0EA 3V79C 4KEKA 4BS9A 2LY2A 1JI8A 4LO3C 4E4HA 3OJMA 4HR6C 1AXMA 1HWMB 4MZGB 1GLNA 3K4LA 3OYKA 2JSPA 5CQEA 4E7HA 1ILR1 1ISVA 1WBAA 4HEA2 1PWAA 3K4NA 2K4AB 4OUJA 3VEQA 2IS4A 4XR6A 3O4DA 3H5AA 5FNWA 4BUPA 3DEEA 4DJAA 1R8OA 2E4MC 4KISA 4DEPA 3CA4A 3BA4A 3CP2A 4GOVA 4FASD 3G2BA 4B44A 3DU5A 3K6GA 5BOWA 2R4GA 1MC9A 4G6TB 4XLAA 3H6QA 1FWVA 4L4IA 2WY8Q 1X1BA 1TFMB 4J23B 1FMVA 3ILAA 3DPUA 4J2YA 4AVZA 4F93B 4BE2A 1TIEA 1X4PA 2ZSIB 2VJ5A 3BAUA 5HOOA 4I37A 3WO3A 1FMZA 4ZOTA 3DLAA 3F1RA 2HQAA 3CESA 1BFCA 4YRVA 3A07A 2DXIA 1EYLA 4ZDPA 3VUOA 2VPLA 1IJTA 4Q91A 3K4MA 2Z1DA 1Y56A 4G9MA 4Q9PA 3SYTA 3P6IA 4LIVA 4E7KA 2XDVA 2VJ4A 2LY1A 4I4XA 3H5RA 1IT0A 2Z48A 3V0BB 1V5EA 4QD2C 4EKXB 3HXLA 5JHFA 1D0XA 4BEHA 1ISWA 1BFFA 1JQZA 3OYBA 1PJRA 5KHDA 2XF6A 2V1NA 2XC7A 3KMVA 3OBRA 3W3CA 5HVQC 1BARA 2D7RA 2AQEA 3RMXA 3QODA 4CJMA 4RLFA 3AH4A 3S32A 4BQNA 3O4OA 2WRYA 4IKFA 1YYNA 4NC8A 2FGFA 1Z4SA 3BAQA 3W2VA 2DS0A 5JMCA 4KEJA 1Z21A 4XLHA 4XLEA 41BIA 2X1EA 2XF7A 2LC2A 3LSKA 4QPOA 3LSMA 1IOBA 2GZBA 4BDYA 4CCMA 4I3NA 4TLPA 2DT6A 3RTRA 1LVKA 2NTDA 4XKWA 31BIA 4BL0B 4XKCA 4J01A 4QPQA 4PC4A 1D1CA 2UV1A 3H9JA 5CKTA 2RNGA 3VWBA 1KONA 3POKA 4I4SA 1T4QA 1WJEA 3NWTA 4CUGA 2VSAA 3LTQA 1ISYA 3MD2A 2FFVA 3J7AY 3OYEA 4BXFA 4I7IA 1I1BA 4OEFA 1NG7A 2BEAA 2VKDA 2QYIB 4U7BA 3GBGA 1S0FA 2F8XC 4KITB 4R79A 5HNFA 3W2AA 3IP4B 2NVHA 2VASA 3ZX7A 2AXMA 5BXSA 4PUSA 3FDYA 3BAHA 4ZFUB 3BRFA 3I2AA 2ERMA 3FJAA 3FUOA 5DUYA 2CW8A 2R7WA 2X85A 4N4NB 3VSKA 1F31A 3N05A 3AFHA 3H0DA 2VQGA 1T9FA 4C9YA 3FJBA 3Q7XA 1UELB 1Q04A 3T8SA 1HCDA 3Q7WA 4IX7A 2MFZA 3BCAA 3M1CA 2X51A 1DJSB 3RMYA 3OWTA 3ZCOA 4IZXA 3VT0A 1TT0A 4ZBVB 4AN6A 3VYUB 1QQKA 1YXWA 4ZA3B 3BC8A 1PUUB 4F91B 2V6EA 3I9V2 3PSFA 3HOSA 3UJ4A 5BXRA 1DQGA 1JT7A 1WBCA 3NBEA 4N4OB 3I29B 3BA5A 2VJJA 2HPIA 2D24A 2W4SA 4X3AA 1QU3A 4A7YA 3V0BA 3O4BA 3C9ZA 3I3LA 2K8RA 2L5XA 1JY0A 1Y6IA 1ZELA 2IS6A 4GOYA 2KI6B 3U21A 3PUBA 3P53A 3LMMA 4HNTA 2BW3B 3HPGA 3OYMA 3OMYA 1SFKA 2R7RA 1DFCA 2LBFA 4XKVA 4BJTA 4GP0A 4P5OA 2WAQA 1QHGA 4XN3A 2X2SA 3IAM2 2MABA 1P63A 3BX1C 1CVSA 4KEIA 3D5SC 2V26A 3KX2A 4XLCA 3NJ5A 3HG9A 2IGOA 3VT1A 3N7LA 4GP3A 1E0EA 2QN4A 2X6XA 5B2HA 2NP0A 3VWCA 2LOOA 5DSSB 2M3AA 2AQFA 3S93A 1QHHD 2Q1ZB 3UD8A 4I4QA 3NBCA 2K9MA 2V4JC 3I2XA 2K43A 1AVXB 4XOPA 2IGKA 3FKJA 1YX3A 2ZFUA 2FUG2 3E0JB 4P1WA 4RM2A 1YX5A 1Z7LA 4HPQA 2FO1A 3L2UA 4E7SA 4IYBA 4H04A 3OR1C 2VLAA 4C2UA 5HPZA 3CJQB 1LKXA 3OGFA 3DU6A 4IQPA 1S0GA 5F90A 1DZCA 1OLTA 3OS0A 1LDKB 1MMGA 1D0HA 2W82A 1ISXA 3TC2A 2UUZA 4QD2B 4OEEA 2O5RA 4CSWA 3S3OA 2IGMA 4B3XA 1UPSA 5FZZA 3FBNB 1Z0HA 1S9HA 1DP3A 3EPZA 2M49A 2VXZA 2VJIA 4RLQA 3OYIA 1HA8A 1S0DA 2HZ9A 2D23A 3CA0A 2DJIA 2FFUA 2VU9A 1S0BA 4ZDLA 5KNLA 1DZDA 4PSWA 4ANJA 4E6KG 3RPUD 3FHNA 5HLTA 4XFSA 2R7UA 1BFBA 3OL3A 3H9QA 3VDXA 3K70C 4BEHB 4BU2A 4A7ZA 2X6YA 4F52A 1NZKA 3BTAA 1ERDA 3HOTA 3CQAA 4ISRA 4XL9A 3HKZA 3A22A 3KYLA 1DIWA 4FGFA 4II2A 2KRCA 2HZDA 1EVTA 2HW9A 4B47A 1D1AA 3SEZA 5F8SA 3ZRGA 1Z3XA 2CW7A 3EUKL 4JKQA 4D0ZA 2DOAA 3MKWB 3E1SA 1TOOA 4X39A 3OR2C 3BAVA 4B43A 1PYVA 2KLOA 2ZSHB 2JVHA 1LFPA 2MD0A 3PL8A 2E4MA 3IM6A 2VXRA 1XG6A 3BG6A 3BCBA 1EV2A 4I4YA 4CZCA 3P6JA 4LO2A 4MZHA 2NZ9A 3A1YA 1DGRM 1N78A 3WA1A 1TWEA 1UG0A 1BR1A 2OUMA 2WAFA 3CMMA 4XMYA 1SZ6B 3MMYB 2LIEA 2P23A 5I1BA 2D20A 4II0A 4LO7C 4EFPA 2M7AA 1RY7A 4I4PA 3S3MA 3MPPG 4HA2A 1AFCA 3WINA 3AJ5A 1BLDA 4G9NA 2VQLA 3WMUA 3FJHA 1AA7A 3FGMA 4IONA 2Y9XE 3OYAA 1K6YA 3R4SA 2MIBA 4II3A 2AFGA 4ZFWB 3K4BA 3CRGA 3HN1A 4FETA 3TL4X 2K9LA 3OY9A 2R7SA 1BOBA 1BLAA 2I8DA 4XKBA 3RQ4A 4XM3A 2D43A 4PFOA 3BADA 4OWJA 3E8LC 2W7NA 3S8KA 2RG9B 2KDOA 4CA0A 1M16A 4ZLBB 4F83A 3QYEA 3O4AA 3SEQA 4C2TA 2M4GA 1PUMB 2Q2EB 4PJMA 2VQCA 3DKXA 1FGAA 2GO2A 3CA6A 4BQOA 3O3QA 3O49A 4I4UA 4ZGRB 3OYNA 1ABRB 2L7KA 1QXMA 3B9UA 2VSEA 3HPHA 4HRIA 4G6JA 4GAFA 4J2KA 2CMPA 4EATA 2Z49A 2WBCA 1X1CA 1L2HA 3UD9A 3UJ0A 3F62B 3OYCA 2RQQA 3HUGB 2BVMA 3FBIB 1N77A 1HCEA 4XOTA 2BFHA 4KC3A 4QBCA 4U87A 4ZYAA 4D8HA 2F2FA 2KKIA 3AKHA 4GRIA 4Z8SB 2KRHA 4ZC3A 1WD3A 3H6SE 2V9KA 2WBMA 2A5WA 4PJJA 4C30A 5DZUA 1DQOA 5GAQA 2DREA 1A8DA 4XONA 1VCLA 2AAIB 4F34A 1G59A 3BAGA 9ILBA 3NBNA 5CQGA 3K70D 2ET2A 2R7OA 4IQJA 1D1BA 1G9AA 1MMAA 4I4OA 1W36D 1FV3A 3AH1A 4LO8B 2MLLB 2HWAA 2BOLA 3DKYA 3RSJA 1BA7A 4AN7B 1YF8B 4XKIA 2ZXIA 1VZ0A 2Y0SA 3H6RB 4BDZA 3OJ2A 1AVUA 4OW4A 3OIQA 2HPMA 4YOLA 3EUAA 7I1BA 3R4UA 5JLVA 2QKLB 2XOAA 2VLCA 1X1DA 2ZQNA 4J2SA 5FZYA 4JOMA 3UNGC 4DENA 2L2OA 2IWTB 4Q9GA 3BRGC 2W00A 4LO0C 2YUGA 3VT2A 4I8MA 4MZFB 3HOMA 3V0AA 5CPRB 4ZFYB 4LIUA 1OQLB 4F55A 4ZTJA 1Z3YA 3AKIA 3QYBA 3V42A 5FRNA 3O4CA 2Y9GA 4P0LA 1RZOB 2V7FA 4RM3A 2R7TA 1AVAC 1SR4A 2DRYA 1MMNA 3CRIA 3OJVA 1TP0A 3AZVA 1D0ZA 2P0WA 3VYTB 3DPLC 1V6XA 3CRHA 4JAWA 3VSZA 2JA2A 2W1OA 1PC8B 1W3AA 2D22A 4H75A 4HJJA 4OEGA 3ZC9A 3PSIA 2WA0A 3OYLA 1V5GA 4LO3A 3JUTA 4EFRA 4ITVA 4I0YA 4KT6A 3TMOA 2OC6A 3UD7A 2IGNA 1YE9A 3OYDA 2VUAA 3N7MA 1UAAA 5D63A 1V6VA 3RTJB 1NG6A 3SNVA 1X4OA 4HSRA 3PHZA 4NUBA 4RMNA 4XLFA 2X1CA 2HVSA 1W3FA 2Q9XA 3M8JA 4PFPA 2L9NA 1FQ9A 4QBVA 1X19A 1TWMA 3VSLA 4L4HA 1R8NA 5BP5A 3LLPA 1JT5A 3FFZA 4G1RA 4CCKA 1JTCA 5TGTA 4IZZA 3PJRA 4I2SA 5BQUA 1AF9A 4I4VA 5G00A 1FMWA 5FROA 1DFQA 21BIA 3K4KA 1WD4A 4AYBA 2NM1A 5DVHA 3L2WA 1HWOB 1PZZA 1W3GA 2P39A 2BVLA 2LG4A 2CV0A 2XSJC 3DTKA 4LO2C 1DQUA 2KI4A 8I1BA 1TTUA 3H5NA 4R6UB 3FJEA 2RREA 4JP0A 3JRRA 3CF2A 3QYFA 3TBIA 3DTEA 1YBIA 2AQZA 3FJDA 4XN0A 2GOMA 4CH7A 1S0LA 3AJ6A 1W36C 1J09A 1AVWB 2PJRA 4Y3OA 5FZUA 2IXSA 4LO1C 4QO3A 3UDAA 3BAOA 3CA1A 3IM7A 4IY9A 1GGPB 1D0YA 5KCMA 3OIPA 1HWNB 4Z9WB 3C2GA 5F8WA 3K10A 2ZXHA 1WJFA 2X1DA 1OR7C 2LBFB 4BJ6C 4E7LA 3ZR8X 3DTIA 2BW3A 1MMDA 3OYJA 2HVRA 1YTOA 1WJCA 3UR3C 4LO7B 3MALA 2K3PA 1MNEA 4F3QA 4HNUA 3A21A 3D5RC 4JQ0A 3K4JA 4JQFA 1QQLA 3CA5A 4P6AA 1T95A 1SR4C 2VKHA 4EFQA 4OWRB 4XNFA 3D7WB 1V6WA 3FJIA 3CA3A 4ZJZA 1BR4A 2E1MB 4BE1A 4IHZA 4PJLA 2HVQA 4XQFA 4G6MA 2MC2A 2ELJA 4EEEB 1G9DA 4BE0A 1FN0A 4QC4A 2ZQOA 2XF5A 4KBBA 2KP6A 2ZR1B 2UUSA 3O5WB 5BVPI 3BRDA 2MYSA 3PNYA 2M7BA 4IQ4A 4B48A 3HBWA 4ISQA 1M2TB 1G9BA 5D62A 3SDBA 3HL2A 2I1BA 1BASA 1K5UA 4EB2B 2FDBM 4PJNA 3AL0C 3L2VA 4LITA 1XHBA 5BXPA 1I1EA 4QKRA 2HU9A 3DPTA 3NWSA 2R9KB 5HNHA 2KL4A 1FMMS 2Y9FA 4OWKA 3AKGA 3QOEA 3AKZA 3PNVA 3WMVA 2KQRA 3BB2A 1G8XA 2WAEA 4CCJA 4E7JA 2CUZA 3QYDA 2HNHA 2E5ZA 4Y33A 1P9QC 3D5LA 2PJRB 1FV2A 2VQHA 3ZXSA 4D1QA 3CU1B 3O44A 4I6IA 3ONQA 4HSTA 3A4CA 3S3NA 2VL8A 1ISZA 1Q03A 2X6WA 3AL0B 3V0AB 2DCEA 3AH2A 3CAHA 4BJ5C 3W9TA 3F9KA 5LFAA 2CH0A 4J2XA 2L5QA 3HC7A 3S8PA 4OAYA 3ZGKA 4X0GA 2CV2A 2RSTA 2NS2A 3IIRA 3ZC8A 3BLYA 2DT7B 3KEYA 3H35A 3OGGA 4I4RA 3C2HA 1N75A 4IY8A 3A2KA 3HMYA 1SAUA 3HALA 4NQWB 2UWMA 2F4IA 2LH9A 2GOXB 4LG3A 3FJ8A 3K1XA 2PMZA 2OV7A 4PK4A 4XORA 1E0OA 4I1EA 1MNDA 2KZVA 2VB6A 4ZDOA 1Z2VA 2CS3A 3BA7A 3OYGA 4LO0A 3VYSB 4LO1A 1EPWA 4XFTA 4CCOA 4BQQA 1G82A 3LL7A 2CUJA 2K5CA 4DBQA 2BEBA 1II4A 2NOJB 1MW7A 2Z16A 1ITBA 3PMEA 3NBDA 2WADA 1CE7B 2D1ZA 4A7KA 4BGDA 2LREA 3PFYA 2Y9WC 2E5NA 3S8JA 3PG0A 1HWPB 2MC4A 3A23A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N0K A;  1JT3 A;  2X2T A;  2RQ9 A;  4FVV A;  4WBC A;  2NYY A;  4USO A;  1RML A;  6I1B A;  4QKS A;  5BXT A;  1JT4 A;  3WIN C;  3IAG C;  3FJF A;  4P0J A;  2D7I A;  5D61 A;  3AKF A;  3EF2 A;  2KLL A;  3FJC A;  1N4K A;  3IM5 A;  1NUN A;  1XYF A;  1IHK A;  4IZE A;  1JLX A;  3N7K A;  3WO4 A;  5BP5 C;  3ZXD A;  4USP A;  4X37 A;  5BQU C;  3VSF A;  1IIL A;  1BFG A;  1FWU A;  2VXT I;  3OBT A;  4H9W A;  2DRZ A;  4X38 A;  1HIB A;  4QAL A;  3H6R A;  1IRP A;  4JKX B;  4D0T A;  4OWL A;  4JRA A;  3FJJ A;  4I1B A;  3RTI B;  3FJ9 A;  1S0C A;  2F2F C;  3Q7Y A;  4GAI A;  3N7J A;  5F8Y A;  4JPZ A;  1DLL A;  1HKN A;  2D44 A;  1ONK B;  5E24 E;  2LIQ A;  4I96 A;  1KNM A;  2Q3N B;  1J0S A;  1V6U A;  5FNX A;  2HWM A;  3FUQ A;  1G9C A;  2IHO A;  5EG6 C;  1K5V A;  2ESU A;  5EC5 A;  3WO2 A;  5BOW A;  2J3P A;  4XFU A;  3AZW A;  1IRA X;  3HSM A;  5EHA A;  1JLY A;  2KH2 A;  4DCK C;  1MD6 A;  3ZXG A;  1RG8 A;  3FJK A;  1XZZ A;  3QR5 A;  4ZKT B;  1Q1U A;  4END A;  1S0E A;  3V79 C;  4KEK A;  4LO3 C;  4HR6 C;  3OJM A;  1AXM A;  1HWM B;  1ILR 1;  1WBA A;  1ISV A;  2K4A B;  4OUJ A;  1PWA A;  3VEQ A;  5FNW A;  3O4D A;  2E4M C;  1R8O A;  4DEP A;  3CA4 A;  3BA4 A;  4GOV A;  1MC9 A;  3H6Q A;  1FWV A;  4L4I A;  1TFM B;  4J23 B;  3ILA A;  4J2Y A;  1TIE A;  3BAU A;  3WO3 A;  4I37 A;  4ZOT A;  1FMZ A;  3F1R A;  1BFC A;  3A07 A;  3VUO A;  1EYL A;  1IJT A;  4Q91 A;  4G9M A;  4Q9P A;  3P6I A;  4I4X A;  1IT0 A;  2Z48 A;  3V0B B;  4QD2 C;  4EKX B;  1ISW A;  1JQZ A;  3AH4 A;  1BFF A;  3OBR A;  3KMV A;  1BAR A;  2D7R A;  3RMX A;  4CJM A;  3O4O A;  1YYN A;  2FGF A;  1Z4S A;  3BAQ A;  2DS0 A;  4KEJ A;  41BI A;  4I3N A;  1IOB A;  2GZB A;  4TLP A;  2NTD A;  31BI A;  4PC4 A;  3POK A;  4I4S A;  1T4Q A;  2VSA A;  3LTQ A;  1ISY A;  2FFV A;  4I7I A;  1I1B A;  4OEF A;  2BEA A;  2QYI B;  2F8X C;  1S0F A;  2NVH A;  3ZX7 A;  2AXM A;  5BXS A;  4ZFU B;  3BAH A;  3BRF A;  3I2A A;  2ERM A;  3FJA A;  3FUO A;  5DUY A;  1F31 A;  1T9F A;  3FJB A;  3Q7X A;  3T8S A;  1Q04 A;  1HCD A;  3Q7W A;  3VT0 A;  1DJS B;  3RMY A;  4IZX A;  4ZBV B;  4AN6 A;  1QQK A;  1YXW A;  1PUU B;  5BXR A;  3UJ4 A;  1DQG A;  1JT7 A;  1WBC A;  3NBE A;  3I29 B;  3BA5 A;  4A7Y A;  2D24 A;  4X3A A;  3V0B A;  3O4B A;  3C9Z A;  2K8R A;  2L5X A;  1JY0 A;  4GOY A;  2KI6 B;  3PUB A;  3P53 A;  1DFC A;  2Y9F A;  4I1E A;  4ZGR B;  4Z9W B;  4GP0 A;  2X2S A;  3BX1 C;  1P63 A;  1CVS A;  4KEI A;  3NJ5 A;  3VT1 A;  4J2X A;  5B2H A;  3N7L A;  4GP3 A;  2QN4 A;  2NP0 A;  5DSS B;  3UD8 A;  4I4Q A;  3NBC A;  3I2X A;  2K43 A;  1AVX B;  2FO1 A;  4IYB A;  4H04 A;  5HPZ A;  1DZC A;  3OGF A;  4IQP A;  1S0G A;  5F90 A;  1D0H A;  1ISX A;  3TC2 A;  4QD2 B;  4OEE A;  5FZZ A;  1UPS A;  1Z0H A;  2M49 A;  2WRY A;  1S0D A;  3CA0 A;  2HZ9 A;  2D23 A;  2FFU A;  2VU9 A;  1S0B A;  4XFS A;  1BFB A;  4A7Z A;  1NZK A;  3BTA A;  3CQA A;  4ISR A;  4FGF A;  3A22 A;  1DIW A;  1EVT A;  2HW9 A;  5F8S A;  4JKQ A;  4D0Z A;  1TOO A;  4X39 A;  3BAV A;  2E4M A;  3IM6 A;  2VXR A;  1XG6 A;  4I4Y A;  1EV2 A;  4LO2 A;  3P6J A;  2NZ9 A;  3WA1 A;  1TWE A;  2P23 A;  1SZ6 B;  2LIE A;  5I1B A;  5JMC A;  2D20 A;  4II0 A;  4LO7 C;  4EFP A;  1RY7 A;  4I4P A;  4HA2 A;  3MPP G;  3WIN A;  1AFC A;  1BLD A;  3AJ5 A;  4G9N A;  3WMU A;  3FJH A;  3FGM A;  4ION A;  2Y9X E;  3R4S A;  2MIB A;  4ZFW B;  2AFG A;  3CRG A;  3HN1 A;  1BLA A;  2D43 A;  3BAD A;  4OWJ A;  3E8L C;  3S8K A;  2RG9 B;  1M16 A;  4ZLB B;  4F83 A;  3O4A A;  1PUM B;  1FGA A;  2GO2 A;  3CA6 A;  3O3Q A;  3O49 A;  4I4U A;  1QXM A;  1ABR B;  3B9U A;  2VSE A;  4G6J A;  4GAF A;  4J2K A;  2Z49 A;  2WBC A;  1L2H A;  3UD9 A;  3UJ0 A;  3F62 B;  1HCE A;  2BFH A;  4KC3 A;  4QBC A;  4D8H A;  2F2F A;  2KKI A;  3AKH A;  4Z8S B;  1DZD A;  1WD3 A;  3H6S E;  5DZU A;  1DQO A;  5GAQ A;  2DRE A;  1A8D A;  4F34 A;  1VCL A;  2AAI B;  3BAG A;  9ILB A;  2ET2 A;  1G9A A;  4I4O A;  1FV3 A;  3AH1 A;  4LO8 B;  2MLL B;  2HWA A;  3RSJ A;  4AN7 B;  1BA7 A;  1YF8 B;  4XKI A;  3H6R B;  3OJ2 A;  1AVU A;  4OW4 A;  4YOL A;  7I1B A;  3R4U A;  5JLV A;  2XOA A;  2ZQN A;  2VLC A;  4J2S A;  5FZY A;  4DEN A;  2IWT B;  4Q9G A;  3BRG C;  4LO0 C;  2YUG A;  3VT2 A;  4I8M A;  3V0A A;  3HOM A;  4ZFY B;  1OQL B;  3AKI A;  4P0L A;  3O4C A;  2Y9G A;  1RZO B;  1SR4 A;  1AVA C;  2DRY A;  3CRI A;  3OJV A;  1TP0 A;  3AZV A;  3CRH A;  1V6X A;  4JAW A;  3VSZ A;  1PC8 B;  1W3A A;  2D22 A;  4HJJ A;  4OEG A;  3ZC9 A;  4LO3 A;  3JUT A;  4EFR A;  4I0Y A;  3UD7 A;  2VUA A;  3N7M A;  5D63 A;  3RTJ B;  1V6V A;  3SNV A;  3PHZ A;  3VWC A;  4QBV A;  1W3F A;  2Q9X A;  1FQ9 A;  1TWM A;  4L4H A;  1R8N A;  5BP5 A;  3LLP A;  1JT5 A;  3FFZ A;  4G1R A;  1JTC A;  4I2S A;  5BQU A;  1AF9 A;  4I4V A;  5G00 A;  1DFQ A;  21BI A;  1WD4 A;  2NM1 A;  5DVH A;  1HWO B;  1PZZ A;  1W3G A;  2P39 A;  4LO2 C;  2KI4 A;  8I1B A;  1TTU A;  4R6U B;  3FJE A;  4JP0 A;  3JRR A;  1YBI A;  2AQZ A;  3FJD A;  1S0L A;  3AJ6 A;  1AVW B;  5FZU A;  4LO1 C;  4QO3 A;  3UDA A;  3BAO A;  3CA1 A;  3IM7 A;  4IY9 A;  1GGP B;  1HWN B;  5F8W A;  1YTO A;  4LO7 B;  3MAL A;  3A21 A;  4JQ0 A;  3CA5 A;  1QQL A;  4P6A A;  1SR4 C;  4EFQ A;  3FJI A;  3D7W B;  1V6W A;  3CA3 A;  4IHZ A;  4EEE B;  2MC2 A;  1G9D A;  4G6M A;  3NBN A;  1FN0 A;  4QC4 A;  2ZQO A;  4KBB A;  2ZR1 B;  2UUS A;  3O5W B;  5BVP I;  3BRD A;  4ISQ A;  1G9B A;  3HBW A;  1M2T B;  5D62 A;  2I1B A;  4EB2 B;  1BAS A;  1K5U A;  2FDB M;  1XHB A;  5BXP A;  1I1E A;  4QKR A;  2R9K B;  1FMM S;  4OWK A;  3AKG A;  3WMV A;  3BB2 A;  3QYD A;  1FV2 A;  3CU1 B;  3O44 A;  4I6I A;  1ISZ A;  1Q03 A;  3V0A B;  3AH2 A;  3CAH A;  3W9T A;  2RST A;  3ZC8 A;  3IIR A;  4I4R A;  3OGG A;  4IY8 A;  3HMY A;  3HAL A;  3FJ8 A;  3K1X A;  1E0O A;  4P0K A;  1Z2V A;  4ZA3 B;  4LO0 A;  3BA7 A;  4XFT A;  4LO1 A;  1EPW A;  1G82 A;  2BEB A;  1II4 A;  3PME A;  1ITB A;  3NBD A;  1CE7 B;  2D1Z A;  4A7K A;  2Y9W C;  3S8J A;  3PG0 A;  1HWP B;  3A23 A; 
#chains in the Genus database with same CATH topology
 4AIJ A;  2X2T A;  4FVV A;  4HG2 A;  4KJZ A;  4WBC A;  5DDG A;  6I1B A;  1VQP I;  3DQV C;  4ZYG A;  1JT4 A;  3WIN C;  3FJF A;  4NC6 A;  3FJC A;  3DWL E;  3HZJ A;  3OOP A;  4CCL A;  1HKT A;  3WTZ A;  3BG5 A;  5IPA A;  5DEQ A;  2YS9 A;  3FXU A;  3HIF A;  4LOC A;  1R4N B;  3WTX C;  4X37 A;  1EV7 A;  4DZJ A;  3ECO A;  4Y13 A;  2FA5 A;  3I53 A;  3VPR A;  2M0M A;  2NVY J;  1XGM A;  3HOW J;  5FKL A;  3PNT A;  4AWX B;  3ZQI A;  1BC8 C;  2WY7 Q;  3EDP A;  3OOU A;  2L0K A;  3ABM H;  4LLN A;  4GFB A;  4HX8 A;  4A3D J;  3CO6 C;  1VQM I;  2HOA A;  4PCQ A;  3GFI A;  2L9V A;  2R7V A;  4G7H F;  1BR2 A;  2L7M P;  5J6X A;  4OWL A;  3BY6 A;  5H20 A;  5KVR A;  1QVU A;  2KHM A;  2Z2S B;  1EF4 A;  4JRA A;  1HST A;  3BJO A;  3RTI B;  1YRN B;  2N8G A;  2DT5 A;  2VT2 A;  2KIF A;  3CCJ I;  2VIX A;  4N9H A;  4DBR A;  1FX7 A;  1MGT A;  3EQL F;  1IRX A;  3MZ8 A;  4D7M A;  5FB2 A;  4OAZ A;  1HKN A;  3SZG A;  2FNA A;  2JUC A;  2NYX A;  5E24 E;  3BG7 A;  2M8G X;  2Q3N B;  1EA3 A;  4BYY A;  1FBQ A;  1U9N A;  3OL4 A;  2LY9 A;  1ON2 A;  1BL0 A;  2HWM A;  3FUQ A;  2A6T A;  1G9C A;  1K5V A;  4AU7 A;  4CCN A;  4Q48 A;  2KMU A;  4UY4 A;  4XFU A;  1YIT I;  3RDI A;  1JKQ C;  3BP8 A;  2RV8 A;  1T0F C;  4LG0 A;  3HOY J;  2KH2 A;  3CMA I;  4DCK C;  3ZXG A;  1MDM B;  4M72 A;  1KA8 A;  1MBK A;  3LSH A;  2RGV A;  1RG8 A;  1XZZ A;  1Q1U A;  2NVU B;  4M3F A;  2CGP A;  4BXX J;  2LY2 A;  1JI8 A;  2HS5 A;  3OJM A;  1VQ8 I;  1UST A;  5J4Y A;  3HB9 A;  1GLN A;  4RB3 C;  2JSP A;  5CQE A;  4JX4 A;  4HZF A;  2BY2 A;  1W0T A;  1YG2 A;  2P7V B;  4XK4 A;  3O4D A;  3DEE A;  3FK6 A;  1F5T A;  2PFB A;  4CZZ A;  4IHW A;  4PDK A;  3CA4 A;  3BA4 A;  3U1D A;  4Z2Y A;  2KJC A;  4XLA A;  2AHQ A;  4J23 B;  4AIH A;  4J2Y A;  3DPU A;  2XAF A;  1LE8 B;  2GQQ A;  1X4P A;  2OF7 A;  2ZSI B;  1J9I A;  3WO3 A;  3TO7 A;  4ZOT A;  3DLA A;  3CMY A;  2HQA A;  1EYL A;  2MC3 A;  1S8N A;  1IJT A;  3K4M A;  2VBY A;  2QF7 A;  1G4D A;  2E7X A;  3P6I A;  3E3V A;  1ETX A;  4E7K A;  2LY1 A;  4I98 B;  3HXL A;  2DQR A;  1ISW A;  4BEH A;  2BV6 A;  4QTR A;  2XF6 A;  1BIA A;  4ESF A;  1Q1H A;  2XAS A;  3Q5F A;  3FX3 A;  1JHF A;  2PMH A;  3VFZ A;  4IKF A;  1WZ2 A;  5DUK A;  3WE2 A;  1Z4S A;  3BAQ A;  4KEJ A;  2V6C A;  3JW4 A;  3F8F A;  4QPO A;  3LSK A;  4I3N A;  5E3L A;  5IYB J;  4TLP A;  1Y1V J;  1O7F A;  2ZC2 A;  3RTR A;  3J80 K;  5D5U B;  3I4N J;  2CG4 A;  4M9S A;  2M8E A;  2UV1 A;  3IH4 A;  3POK A;  5FLX Z;  1P4A A;  3NWT A;  4CUG A;  4A5M A;  1RC9 A;  1XX5 A;  2HQ5 A;  5K7H A;  3R0A A;  1FSH A;  2K27 A;  3OYE A;  1CF7 B;  4KIC A;  4OEF A;  3KE2 A;  2BEA A;  1QA6 A;  2QYI B;  4U7B A;  5EZH A;  4IO9 F;  1YLF A;  5F1J A;  4A0X A;  2H1K A;  4G8X A;  3ZX7 A;  4PUS A;  3BRF A;  3GZN B;  4S05 A;  1JGG A;  5D4S A;  2H8R A;  1ZYR F;  2RNJ A;  3FJA A;  3FUO A;  5DUY A;  3I59 A;  3DEW A;  5L3G A;  1T9F A;  3FJB A;  2VQG A;  3Q7X A;  3HJE A;  1OMI A;  1WI3 A;  5CYV A;  4IX7 A;  1YS6 A;  1YTY A;  2D1H A;  2XRL A;  3BCA A;  3ZCO A;  2VOD A;  1TT0 A;  2HWV A;  2L9R A;  4ZBV B;  4AN6 A;  2JWT A;  1YXW A;  1PUU B;  5ED4 A;  2OPT A;  3PSF A;  1FSE A;  3O6B B;  2ZME B;  2LF7 A;  3NBE A;  5LHG A;  4OIO F;  3I29 B;  1RZ4 A;  4OMZ A;  1TC3 C;  1UHM A;  1OCR H;  2ELH A;  4GOY A;  3PFI A;  4I7H A;  3U21 A;  3PUB A;  4I1E A;  4ZGR B;  3OMY A;  1SFK A;  3MN2 A;  4GP0 A;  4P5O A;  2WAQ A;  1KU7 A;  2DA5 A;  3NJ5 A;  4XLC A;  4I99 C;  2WTE A;  3N7L A;  2X6X A;  2NP0 A;  1OFC X;  2HOT A;  5DSS B;  1D8K A;  5F08 A;  3S93 A;  2ZNZ A;  4ETS A;  5JR3 A;  1LUJ B;  2K9M A;  3ESW B;  4GO1 A;  2K43 A;  3P9C A;  1AVX B;  4LB6 B;  2VBZ A;  1HKS A;  3E0J B;  3GME A;  1Z7L A;  3M07 A;  1YI2 I;  3OR1 C;  1BW6 A;  2VLA A;  2DW4 A;  4C2U A;  4R1H A;  1I3A A;  1S29 A;  4G7Z F;  5HPZ A;  1OLT A;  3P5J A;  4EEF G;  1ISX A;  3TC2 A;  4OEE A;  2O5R A;  2XGE A;  2IGM A;  3WOD F;  4EM1 A;  3L09 A;  1ZG1 A;  2DQL A;  4RLQ A;  1A6Q A;  3Q0U A;  3OYI A;  3CA0 A;  2ME6 A;  2DJI A;  1VQL I;  2IT0 A;  5KNL A;  1FEX A;  4LD5 A;  4PSW A;  3FHN A;  2EWN A;  1BFB A;  2CRG A;  2RQP A;  4A12 A;  1HDD C;  3Q0W A;  3CD6 I;  3BTA A;  2QSF X;  4P9U A;  4XL9 A;  1BOA A;  3HKZ A;  1ZH5 A;  1UG2 A;  2KRC A;  3BZC A;  2HW9 A;  5J4V A;  2F5D A;  3PUF A;  1AKH B;  3G4S I;  3GFJ A;  4D0Z A;  3MKW B;  3RZD J;  3GO5 A;  1RET A;  4OOI A;  1SFE A;  2ZSH B;  4WXC A;  1O4X A;  4BHB A;  3IM6 A;  1XG6 A;  3BCB A;  1EV2 A;  4CZC A;  3P6J A;  2E2J J;  1U8B A;  5HLG A;  1ZK8 A;  1TWE A;  1UG0 A;  3JTH A;  1BR1 A;  2OUM A;  5I1B A;  5J40 A;  2M5W A;  4MQV A;  1YJW I;  4A3E J;  4II0 A;  2XUB A;  3CJT B;  3JRH A;  4I4P A;  2Y9Y A;  1EH8 A;  1T6S A;  1QNT A;  3REO A;  3TKY A;  4B3A A;  1APL C;  4HDV A;  1AFC A;  4WF2 A;  5F27 A;  4U7D A;  2Y9X E;  3JSP A;  3BQY A;  3R4S A;  2DTZ A;  3HSR A;  2RKH A;  5GTI C;  3K1N A;  2K9L A;  3R6S A;  2ZXW H;  4XKB A;  2OU2 A;  3KZZ A;  3CDH A;  4UVA A;  3P9K A;  1HC8 A;  2W7N A;  5DD8 A;  2RG9 B;  4UV8 A;  1M16 A;  4ZLB B;  4F83 A;  5D4R A;  4UVB A;  3G71 I;  3CDI A;  1PUM B;  3HRT A;  1FGA A;  5L3F A;  2RAE A;  3CA6 A;  3O49 A;  5DTD A;  3B9U A;  2L7K A;  3JRF A;  1Y39 A;  4G6J A;  3HPH A;  4GAF A;  4EAT A;  1U6G A;  2VC1 A;  2PX9 A;  3F62 B;  1ZR4 A;  1B6A A;  2EZI A;  1U3E M;  1N77 A;  1HCE A;  1LEA A;  4AC0 A;  3S15 J;  3U9G A;  2ISY A;  2ADU A;  2XPV A;  4U87 A;  4D8H A;  2QYO A;  1JUM A;  1POG A;  3K2A A;  1WD3 A;  3FMQ A;  3OSG A;  3Q0V A;  2A5W A;  2FBK A;  1H0M A;  2R3S A;  3ISP A;  1DQO A;  1I3Q J;  2K7L A;  1GT0 C;  5GAQ A;  1A8D A;  4XON A;  9ILB A;  4UHT A;  4RA2 A;  2L54 A;  1D1B A;  5F0H A;  4I4O A;  3SHF A;  4LO8 B;  3ZPL A;  3V7C A;  2BOL A;  2DFF A;  1BA7 A;  4IRH A;  3H6R B;  1TLH B;  2E1O A;  1EH7 A;  5DV5 A;  1VQ7 I;  1XC5 A;  3M7G A;  4KUM A;  1K6O A;  3R4U A;  4YFK F;  1T56 A;  5JLV A;  2XOA A;  4UVC A;  3IV5 A;  4J2S A;  5FZY A;  3HGY A;  4DEN A;  1IF1 A;  3BRG C;  2W00 A;  3E5U A;  3P9I A;  1B8I A;  3V0A A;  4I8M A;  1SD6 A;  2PLY A;  1IRG A;  3BPX A;  2STT A;  2CSO A;  2Y9G A;  4DQ2 A;  5IYD J;  3OJV A;  4JAW A;  1D0Z A;  2P0W A;  3CRH A;  5J8C A;  1ETY A;  2W1O A;  4H75 A;  4RB2 C;  4HJJ A;  1FYK A;  2QBY B;  3H0G J;  2EPF A;  1V5G A;  4LO3 A;  2R7D A;  4KT6 A;  2OC6 A;  1U5T A;  1YE9 A;  3N7M A;  5D63 A;  1UAA A;  1NG6 A;  2ZJQ F;  2I10 A;  2WV0 A;  1ZRC A;  4HSR A;  3PHZ A;  2FMY A;  2FX0 A;  2DK5 A;  2HVS A;  4QBV A;  3M8J A;  2L9N A;  4G6Q A;  3VSL A;  4L4H A;  1HDP A;  3I71 A;  3GZ5 A;  3HOX J;  3FK7 A;  2EQR A;  4CCK A;  5TGT A;  4IZZ A;  2CW0 F;  4CIC A;  3PJR A;  4LJZ F;  1AF9 A;  3GLL A;  3K4K A;  1MBH A;  3O2P E;  4AYB A;  2ZJR F;  4UB6 C;  1PP8 F;  1W3G A;  1WHU A;  3M4O J;  3E97 A;  3H5N A;  4R6U B;  2D1V A;  2DA6 A;  3JRC A;  5DD4 A;  1ONV A;  5EF6 A;  4FE4 A;  3FJD A;  2AQZ A;  5FLM J;  1S0L A;  3AJ6 A;  3MCZ A;  1J09 A;  1AVW B;  1B59 A;  2PJR A;  2HOE A;  3I5U A;  1XGO A;  2QM3 A;  1QBJ A;  1MBF A;  3CA1 A;  3JCU C;  3ZN1 A;  1Y1W J;  1D0Y A;  1S3J A;  1HWN B;  3K10 A;  1WJF A;  3EUH A;  4IHS A;  4I09 A;  4GYI A;  5EEH A;  4BJ6 C;  5IY5 H;  4E7L A;  1MMD A;  4RS8 A;  2ZXJ A;  3GTP J;  1UB9 A;  2FXA A;  3UR3 C;  1S7E A;  3E5X A;  3MAL A;  2J5O A;  2Y0M A;  4IEJ A;  3D5R C;  1UFM A;  2JZY A;  3L7W A;  1DUX C;  3TO6 A;  2X48 A;  3HM5 A;  4OWR B;  4XNF A;  3COA C;  1UHS A;  5AON A;  4BE1 A;  2DFI A;  1G9D A;  2ELJ A;  3LFK A;  3H3V K;  1BC7 C;  4XLP F;  4ISQ A;  2M7B A;  1G9B A;  3HBW A;  2VON A;  5LGU A;  4EJO A;  4EB2 B;  2HGC A;  4RDU A;  1MJB A;  1OJL A;  1SD4 A;  1XHB A;  3FKI J;  3OGF A;  2FF4 A;  2R9K B;  1N25 A;  2LK2 A;  3CUQ C;  4OWK A;  4L9J A;  1PUE E;  3CQZ J;  3KCC A;  1I39 A;  1R22 A;  3AKZ A;  3N4M A;  3RJP A;  5E20 A;  4HNV A;  1YJ9 I;  3WTU C;  3CU1 B;  3O44 A;  4ON0 A;  1HQC A;  1J0R A;  1YS7 A;  1FNN A;  3A4C A;  1F4K A;  1FOX A;  3AL0 B;  3V0A B;  2YSR A;  5M5Y J;  3L2C A;  1P4X A;  2R5Z A;  1IUY A;  3AH2 A;  2RVC A;  3E6M A;  1QGP A;  3GWZ A;  1DPR A;  3GFL A;  3ZGK A;  4X0G A;  2OTL I;  2DT7 B;  3OGG A;  5J3L A;  2A61 A;  3RKY A;  1A6I A;  5JFR A;  4ABZ A;  4LG3 A;  4UUV A;  2MH2 A;  3LA7 A;  3K1X A;  2PMZ A;  3IWZ A;  2P6S A;  4ZA3 B;  2FEZ A;  2W24 A;  4LO0 A;  1BBY A;  4LO1 A;  4MGR A;  3VOD A;  1FLI A;  1O3T A;  2K5C A;  2GIV A;  1Y8Q B;  4C3I J;  2Z16 A;  4A3G J;  1ITB A;  1HLV A;  2E34 A;  1IGN A;  3CUQ B;  4BY7 J;  4BGD A;  3S8J A;  5DCF A;  3HRM A;  3PG0 A;  1X3Z B;  1HWP B;  4Y7N J;  5K5R A;  3MZH A;  4JX6 A;  3A23 A;  3N0K A;  1I5Z A;  2LRD A;  5D5V B;  3ZMU A;  2NYY A;  5CVV A;  1RML A;  3IAG C;  2WWY A;  4DYC A;  2D7I A;  3AKF A;  4Y4R A;  2EIK H;  3H9G A;  1NUN A;  3BR5 A;  1XYF A;  4RGS A;  3LFU A;  1JKP C;  5AIQ A;  4BAC A;  5D5W B;  1KYW A;  3ZXD A;  2F5V A;  4YEJ A;  1LNW A;  1BFG A;  3MVP A;  1J7K A;  1RKT A;  2W57 A;  4E7I A;  3S17 J;  1R36 A;  2EZK A;  2JUG A;  5JLX A;  5E18 F;  4DOZ A;  2DRZ A;  3MKZ A;  4EQQ A;  2IS2 A;  3BTL A;  2FQ3 A;  1X1A A;  2KT0 A;  1W5C C;  4BKX A;  4QAL A;  1R58 A;  4OIR F;  5D6E A;  2R7X A;  4JKX B;  4NNJ A;  4D0T A;  3ZMV A;  3W2W A;  1DDN A;  3WE3 A;  1OCO H;  2JRM A;  4IPA A;  2CFO A;  2R5Y A;  2F5C A;  2HKX A;  2HQR A;  2M45 A;  5DM7 F;  2F2F C;  5LEK A;  2O6G E;  5IP9 J;  1DU6 A;  4GAI A;  5BS6 A;  1NTC A;  1ODD A;  1DGW Y;  4PSX A;  4A6D A;  5F8Y A;  1WJB A;  3BR1 A;  2E1M C;  2DMU A;  1MJ9 A;  1FOK A;  4B8X A;  3U2R A;  2D44 A;  5JLW A;  2AO9 A;  3RCO A;  1KNM A;  1QVT A;  2KDZ A;  1V6U A;  2EV6 A;  1IV8 A;  2B0L A;  3CZ6 A;  5EG6 C;  4QLC U;  4DIQ A;  3HUG A;  4A3K J;  2DI3 A;  1WJA A;  1S7A A;  2PEX A;  3L2R A;  5EC5 A;  3LSP A;  3MKY B;  2J3P A;  5EHA A;  1MZB A;  3TQN A;  4YIR X;  3GUD A;  1R00 A;  2EFW A;  1U0J A;  2L4M A;  4CDG A;  3D1N I;  1Y8R B;  3FMS A;  3FXQ A;  2D5V A;  1S0E A;  1VQ4 I;  4XSZ F;  4LO3 C;  3T8T A;  1HSJ A;  1AHD P;  1NH3 A;  4NQW A;  1VQ6 I;  4BHC A;  3K4L A;  4ESB A;  3OYK A;  3HOV J;  3DBR B;  1ILR 1;  1ISV A;  3WG7 H;  4ZH4 F;  1IG7 A;  4JYK A;  5ICG A;  1PWA A;  3T1B A;  2Y0S N;  4FE7 A;  1JTX A;  4XR6 A;  5FNW A;  3H5A A;  1LDD A;  1GUU A;  4A0Z A;  3G2B A;  4L9N A;  1O7L A;  2R4G A;  1MC9 A;  3G1M A;  4ZZD A;  4I0B A;  1X1B A;  4S04 A;  1TFM B;  1FMV A;  3ILA A;  2Z5U A;  3S1R J;  2A69 F;  4J19 A;  4BE2 A;  2VJ5 A;  2ZJ2 A;  3BAU A;  4I37 A;  1K78 B;  3JRD A;  1TNS A;  3SDG A;  1OCZ H;  3CF5 F;  4L18 B;  4ZYE A;  2JA7 J;  5GPA A;  4PGH A;  1D5V A;  1RKW A;  2FD5 A;  1Y56 A;  2KIM A;  3QP6 A;  1KZH A;  4KT5 C;  2V9V A;  2VJ4 A;  2FBI A;  2XPW A;  3H5R A;  1QZY A;  1YYV A;  1V5E A;  3AH4 A;  1R7J A;  2ISZ A;  1BFF A;  2XC7 A;  2ZME A;  2V1N A;  3KMV A;  3W3C A;  1XG1 A;  3H3Z A;  2D7R A;  5DCM A;  3CTA A;  4OIP F;  2NRA C;  1ETV A;  3CME I;  1SFO J;  4UUS B;  4EMS A;  1D5Y A;  1Z21 A;  4XLH A;  1SEU A;  4XLE A;  6PAX A;  4EJU A;  41BI A;  2XF7 A;  2LC2 A;  2TCT A;  1AU7 A;  3OSF A;  4BDY A;  4V2G A;  1FIA A;  4AVP A;  2NTD A;  1WGX A;  4XKW A;  5ERI A;  4J01 A;  4QPQ A;  3E6C C;  2L01 A;  1D1C A;  5CVJ A;  4PC4 A;  2DBB A;  1A35 A;  2RNG A;  1BM9 A;  4KDP A;  3VWB A;  2R5Z B;  5B1A H;  3ZN0 A;  4I4S A;  1B72 B;  4Z6Y A;  2VSA A;  4EM2 A;  2VPR A;  2JPC A;  2QA4 I;  3QWL A;  3J7A Y;  1WVR A;  3ABU A;  4I7I A;  5CVI A;  1IV6 A;  1XMA A;  2VT3 A;  4OIQ F;  4WK8 F;  2VKD A;  1S0F A;  5HDK A;  1SFU A;  4R79 A;  5HNF A;  3W2A A;  2AXL A;  2UXX A;  3BAH A;  2F2E A;  1QRY A;  3RIR A;  2OZU A;  1IC8 A;  4A93 J;  2Y48 A;  2R7W A;  4IHX A;  2R92 J;  1UEL B;  1HCD A;  3Q7W A;  4IRI A;  2LMD A;  2MFZ A;  4KA4 A;  3J7A O;  2X51 A;  3OWT A;  4JK1 X;  4IZX A;  3NEU A;  1UCR A;  1I1G A;  3IH2 A;  3BTI A;  5D5X B;  2HDC A;  3UJ4 A;  2CQQ A;  1DQG A;  1JT7 A;  3T0Y A;  1TL8 A;  2COM A;  2F5E A;  1KQ0 A;  3CCL I;  2LD5 A;  2VJJ A;  2HPI A;  5F0C A;  2W4S A;  4MHG A;  4EJT A;  2D24 A;  3O4B A;  3I3L A;  2OTJ I;  2K8R A;  3G6E I;  2DOF A;  1QPM A;  2WV1 A;  4KIF A;  2NS0 A;  1ZTR A;  2NNY A;  5FLX K;  1QHG A;  5F1R A;  4KEI A;  4UUT A;  3KX2 A;  4J2X A;  1JKR C;  2EBI A;  2IGO A;  1YHQ I;  1F9N A;  2TRT A;  1QO0 D;  2LOO A;  1Z9C A;  3UD8 A;  1GXP A;  1VQ9 I;  2Y75 A;  1WI9 A;  2V4J C;  3HSF A;  2HEO A;  1FY7 A;  3MKL A;  4D5C A;  3FKJ A;  4RM2 A;  2FUG 2;  4HPQ A;  2FO1 A;  1TWA J;  2ID3 A;  2ME0 A;  3L2U A;  4CHU A;  4IYB A;  2GA2 A;  4ESJ A;  3Q9V A;  3R0J A;  1LKX A;  1VI0 A;  3DU6 A;  4CYD A;  2LKX A;  2CQN A;  2D2W A;  1OCP A;  2ACJ A;  1RES A;  1LDK B;  1D0H A;  4IQP A;  2EIJ H;  5LRR A;  5BPD A;  4HF0 A;  1FZP B;  5FZZ A;  4B3X A;  1RR7 A;  3KPH A;  4A3I J;  2L7Z A;  2VKE A;  3BJA A;  3EPZ A;  4RGX A;  2VJI A;  2P5V A;  5F64 A;  1DP3 A;  5LRS A;  1HA8 A;  1S0D A;  2HZ9 A;  2K85 A;  3ZQL A;  1S0B A;  3KEQ A;  2P7C B;  2W84 A;  4E6K G;  1AWC A;  5HLT A;  2YUS A;  4LG0 B;  3GEZ A;  4M9X A;  4A7Z A;  3KZY A;  1S5L C;  3M3Y J;  4BQA A;  2VE8 A;  2JA8 J;  1ERD A;  4U0Y A;  3OIO A;  3KET A;  4KIB A;  3A22 A;  4DNC A;  1MD0 A;  3KYL A;  2ZKZ A;  5AIP A;  3ZRG A;  3PO3 J;  2CW7 A;  3JRG A;  4JKQ A;  2DOA A;  3E1S A;  3OR2 C;  5M3F J;  3BRO A;  2E4M A;  1LFP A;  2CUF A;  2Y69 H;  4ASN A;  4I4Y A;  1ZRF A;  2H27 A;  3LSJ A;  3IC7 A;  1IN7 A;  1N78 A;  3JR9 A;  1WH5 A;  2YR2 A;  3IH3 A;  2FML A;  3KP4 A;  1XDU A;  3V8J A;  2E7W A;  2KIS A;  1XMX A;  3FXR A;  4ZYH A;  1B8I B;  1JGS A;  1A04 A;  2BGC A;  1AA7 A;  4HA8 A;  9ANT A;  4ION A;  3OYA A;  4AIK A;  2O61 A;  4II3 A;  3K4B A;  3O3K A;  2A5Y B;  1G3Y A;  4JX5 A;  4UV9 A;  3OY9 A;  1BOB A;  2I8D A;  1RR8 C;  3KFW X;  3W6K B;  4PFO A;  3S8K A;  2C6Y A;  2KDO A;  4NB5 A;  2DTR A;  4AD9 A;  2M4G A;  2BXZ A;  4PJM A;  2VQC A;  3DKX A;  4HV5 A;  1R9T J;  4X1E A;  2F4O B;  3OYN A;  1ABR B;  1QXM A;  5FLV A;  1YIJ I;  3TW6 A;  5J1U A;  1X1C A;  2Z49 A;  4YFX F;  1DPU A;  3GTM J;  1S7O A;  3OYC A;  2RQQ A;  1IN5 A;  2FOW A;  2BVM A;  3GLX A;  4I01 A;  3JRB A;  2M30 A;  3EYI A;  3C7J A;  2BFH A;  3DBH B;  2KIU A;  4KC3 A;  4QBC A;  1G3S A;  2VE9 A;  2F2F A;  2KKI A;  1RNL A;  5FJ8 J;  3H6S E;  2V9K A;  3I64 A;  2EFQ A;  4C30 A;  3HKZ N;  1YOV B;  4YIF A;  1ETK A;  5IP6 A;  2K4J A;  5CQG A;  3K70 D;  2R7O A;  4V19 K;  3GTJ J;  2ET2 A;  1MMA A;  1FV3 A;  3AH1 A;  1T39 A;  5F6F A;  2CFX A;  2HWA A;  2BE5 F;  1FYL A;  3F21 A;  2ZCW A;  1Z77 A;  4OW4 A;  4OU0 A;  5M5X J;  1VQN I;  1W5T A;  1T0F A;  5E17 F;  5HOD A;  2VLC A;  5FKO A;  1HW1 A;  3UNG C;  2L2O A;  4Q9G A;  4R8H A;  3VT2 A;  1ITY A;  2XKO A;  3H92 A;  1U9O A;  1VQK I;  5CPR B;  4ZFY B;  2EFP A;  2OZ6 A;  4ZTJ A;  1Z3Y A;  3KLN A;  3QYB A;  3V42 A;  1CGP A;  2E35 A;  4P0L A;  5J47 A;  2R7T A;  1TWF J;  2VN2 A;  3VYT B;  2GA1 A;  1ENH A;  5L3D A;  2AS5 F;  1PC8 B;  5M5W J;  4RAG A;  2HYF A;  1MBJ A;  3PSI A;  4MFE A;  4G94 A;  4LB5 A;  1OR7 A;  4EFR A;  4ITV A;  4I0Y A;  3TMO A;  3UD7 A;  1R1T A;  3S1M J;  2IGN A;  3RTJ B;  1TBX A;  3AG4 H;  1V6V A;  4RAZ A;  1X4O A;  2DYR H;  4OIN F;  3VWC A;  3HHG A;  2X1C A;  2Y2Z A;  4PFP A;  1RUO A;  2Q9X A;  3QP5 A;  1ETW A;  1B4A A;  1XTA A;  3JTG A;  4G1R A;  3FFZ A;  2BHY A;  3ASN H;  3F22 A;  5GTH C;  3K0L A;  1TWH J;  5JVT A;  3IRR A;  4I4V A;  2PI0 A;  5DVH A;  1TTY A;  1XSX A;  3ZMZ A;  3G3Z A;  1PZZ A;  4RAY A;  2QSG X;  2BVL A;  2ZME C;  2CV0 A;  3DCF A;  3B6C A;  3DTK A;  2DAO A;  4WXH A;  2R93 J;  1DQU A;  5HS8 A;  2KI4 A;  2L7F P;  2K9S A;  1FP1 D;  1P7J A;  2RRE A;  3DLL F;  1FTT A;  2GXB A;  3FJE A;  1GV5 A;  3QYF A;  3TBI A;  1NHA A;  4N0B A;  3SXY A;  4W97 A;  4CH7 A;  1LEB A;  1W36 C;  4Y3O A;  2IXS A;  4LO1 C;  2M9H A;  5BQT A;  4G9Y A;  3DP7 A;  5F8W A;  2X1D A;  2B9S A;  2HOS A;  1MSE C;  4A3C J;  3ZR8 X;  1YTO A;  1WKM A;  5C4J J;  4LO7 B;  3DFG A;  1BA5 A;  4HV6 A;  1FT9 A;  4DYR A;  4DZP A;  3QAH A;  3K1P A;  1QQL A;  1ZN2 A;  3HSE A;  4P6A A;  1T95 A;  2VKH A;  3ZQF A;  3CA3 A;  1F36 A;  4G6M A;  4XRM A;  3NBN A;  5ILU A;  4BE0 A;  1RI7 A;  1BW5 A;  1FN0 A;  2XF5 A;  4L5I A;  4QC4 A;  2KP6 A;  2UUS A;  4IQ4 A;  4B48 A;  4EVI A;  1SMY F;  3F6O A;  3SDB A;  2QSH X;  1BAS A;  4A6E A;  1BN5 A;  5A2Q Z;  3CCU I;  3AL0 C;  4LIT A;  3SFI A;  1U5T C;  5BXP A;  3I59 B;  2HU9 A;  3DPT A;  3NWS A;  1LB2 A;  2K9Q A;  3QRF F;  3FWE A;  3AKG A;  4RAF A;  2QCO A;  4HW0 A;  3WMV A;  4ENJ A;  2JRT A;  1G8X A;  2UZK A;  3U1K A;  1P9Q C;  2HFH A;  2VQH A;  3ZXS A;  1CF7 A;  3ONQ A;  1ISZ A;  4U0W A;  2KFD A;  3I58 A;  3S2W A;  5C3E J;  4CXF A;  2MSY A;  2L5Q A;  3S8P A;  2M2E A;  2M0C A;  4P9F A;  3PO2 J;  2B7E A;  3V4G A;  2NS2 A;  3IIR A;  1LJ9 A;  3BZ6 A;  4I4R A;  3C2H A;  1N75 A;  1WRJ A;  1L3L A;  3HMY A;  1SAU A;  3HAL A;  4NQW B;  2UWM A;  2F4I A;  2GOX B;  1OCC H;  2GBY A;  2OV7 A;  4L9V A;  3BR0 A;  4L5J A;  5EDN A;  2KZV A;  4PZJ A;  4ZDO A;  3BA7 A;  2GM4 A;  1EPW A;  4BQQ A;  3BR3 A;  2CUJ A;  3LL7 A;  2BEB A;  4DBQ A;  1RPW A;  1II4 A;  2XAH A;  1MH3 A;  3W6V A;  3PFY A;  2Y9W C;  2FOK A;  1KYZ A;  1YW9 A;  3F8B A;  4HX7 A;  2RQ9 A;  1EH6 A;  3CCY A;  4USO A;  4QKS A;  4D5F A;  2DYS H;  1O3S A;  3EF2 A;  2KLL A;  3IM5 A;  1ZHF A;  2JVG A;  5EYR A;  5LD2 C;  3BOQ A;  3N7K A;  1XB4 A;  1X2N A;  3CUO A;  3R61 A;  2E60 A;  2R5Y B;  4USP A;  5BQU C;  1USS A;  4H4K C;  2ETH A;  3LSI A;  2XAU A;  2R7Q A;  3QOP A;  2QGU A;  4M71 A;  3ULQ B;  3OS1 A;  2PBI A;  3ERM A;  1ZGW A;  2A6E F;  2X4H A;  3M1E A;  5EEG A;  3CP8 A;  2HYJ A;  3C18 A;  4E7Z A;  4IHY A;  1D8J A;  3OBT A;  1T98 A;  2CV1 A;  5FD6 A;  4MO7 A;  4X38 A;  3CJR B;  1HBX G;  3KYC B;  1FPQ A;  1JTY A;  4PGG A;  2HDW A;  3PM1 A;  1WJD A;  3MFK A;  4Q4Z F;  4J00 A;  3IAS 2;  4I1B A;  2XV4 S;  3FJ9 A;  3L2Q A;  1MH4 A;  3N7J A;  4JPZ A;  1G3W A;  2KPM A;  3OS2 A;  5EJC A;  3VYR B;  1YW8 A;  1R5H A;  1ONK B;  2LYC A;  1J0S A;  1X1P A;  3E6D A;  4XIC A;  5FNX A;  2IJL A;  1YW7 A;  3OYH A;  2L9S A;  1SVM A;  3RSN A;  2G7U A;  2K02 A;  2ZFW A;  5BOW A;  2E36 A;  1IRA X;  3BTC A;  1TQM A;  3AZW A;  3CUQ A;  3HSM A;  2DMP A;  2MW8 A;  3QR5 A;  2NAZ A;  4ZKT B;  4YEL A;  5J1Y A;  5E3M A;  4END A;  1YRN A;  3V79 C;  1ZKG A;  4BS9 A;  4E4H A;  4IHT A;  3LAP A;  3S2H J;  1WBA A;  3ZMT A;  5L3B A;  4E7H A;  2K4A B;  4HEA 2;  3VEQ A;  3K4N A;  2Z9O A;  1Z0X A;  2IS4 A;  3SFZ A;  3T8R A;  4A3L J;  5H6R A;  4DJA A;  1R8O A;  2Y9Z A;  4B09 A;  4KIS A;  4DEP A;  3RI4 A;  1YQA A;  2LF8 A;  2V79 A;  3CP2 A;  4FAS D;  5LGT A;  4GOV A;  5GPC A;  2VC0 A;  4G6T B;  1ZGJ A;  3H6Q A;  2WY8 Q;  5D6F A;  3I0T A;  1HOM A;  4F93 B;  3ZOB A;  4CGZ A;  4A3M J;  1V4R A;  3F1R A;  3CES A;  1G2H A;  2VBX A;  3A07 A;  2EB7 A;  2DXI A;  3VUO A;  2KZG A;  1IZ1 A;  2VPL A;  3GX4 X;  1T8I A;  4Q91 A;  2L4A A;  4G9M A;  4LIV A;  3HDD A;  2RN7 A;  3MQ0 A;  3HRU A;  3BDD A;  4I4X A;  3V0B B;  2XGX A;  4QD2 C;  5JHF A;  1D0X A;  3SJM A;  1JUP A;  1VQ5 I;  1JQZ A;  1PJR A;  5KHD A;  1EKE A;  1JHH A;  4FIS A;  1NK3 P;  5HVQ C;  1BAR A;  1SVO A;  3WG9 A;  4CJM A;  4WX9 A;  2QVO A;  4RB1 A;  3KIO A;  4RLF A;  1IDZ A;  2GLO A;  2HR3 A;  1YYN A;  1QZE A;  2FGF A;  2EFO A;  3KYD B;  3W2V A;  1BI2 A;  2J5P A;  3TP3 A;  1MNM C;  3LSM A;  1IOB A;  2GZB A;  1FTZ A;  4CCM A;  1ON1 A;  5DUI A;  5D8L B;  3C3W A;  5K7F A;  1LVK A;  4FX0 A;  5L3E A;  2BXY A;  2WB1 N;  4XKC A;  1I6H J;  1T4Q A;  5KAI C;  1R1U A;  2DA7 A;  2H09 A;  3J81 K;  2FFV A;  4ENK A;  3BPV A;  4BXF A;  1ZG5 A;  1I1B A;  3K69 A;  1JJ6 C;  1NG7 A;  1ORK A;  1W1W E;  4XSX F;  2OQG A;  4KIT B;  1HW5 A;  2NVH A;  3Q3S A;  5BXS A;  4ZFU B;  3FDY A;  2PN6 A;  2UXN A;  3IWF A;  1DP7 P;  5K5O A;  2NVT J;  1F31 A;  3VSK A;  3L00 A;  3N05 A;  3T8S A;  4C9Y A;  2CWE A;  3A02 A;  3RQI A;  2IW5 A;  5IT9 K;  1SAX A;  3VT0 A;  3RMY A;  2DMT A;  3GYH X;  2DPD A;  3VYU B;  4HLY A;  1B1B A;  1QQK A;  5BXR A;  2WC2 A;  2YPR A;  3I9V 2;  4EM0 B;  4BHP A;  2V6E A;  1X3W B;  1WBC A;  2XRN A;  2KJB A;  2EZH A;  4N4O B;  3BA5 A;  2H94 A;  1QU3 A;  1U5T B;  1XMK A;  3C9Z A;  5B1B H;  1FOW A;  3FXK A;  3BR6 A;  2K3F A;  2IS6 A;  2KI6 B;  2OAZ A;  1OCT C;  2R7Z J;  2QBY A;  3P53 A;  3HGG A;  1B9M A;  4HNT A;  3T5X A;  3OYM A;  3NAU A;  2R7R A;  1F43 A;  1GV2 A;  3FXO A;  2Y9F A;  2GXA A;  2VOO A;  3BX1 C;  4L9T A;  3IAM 2;  1UHW A;  5EG0 B;  1CVS A;  2ZB9 A;  3HBL A;  1ZLJ A;  2V26 A;  2RDP A;  3HG9 A;  1OPC A;  4GP3 A;  1E0E A;  2QN4 A;  2JQ7 A;  4MQ9 F;  3I54 A;  3I4M J;  1QHH D;  2Q1Z B;  3NBC A;  4LLL A;  4C3H J;  1XGS A;  1J2X A;  4Y15 A;  1B72 A;  2IGK A;  2IEK A;  1H89 C;  1YX3 A;  3O8G A;  3H36 A;  4FQG A;  1KQ9 A;  2ZBK A;  4H04 A;  4UXN A;  3CJQ B;  4B1R A;  1DZC A;  3M9A A;  1S0G A;  5F90 A;  3OS0 A;  2H6C A;  3F23 A;  2CQK A;  2HQN A;  1RIO H;  4QD2 B;  2MLK A;  1FC3 A;  3HOU J;  1UPS A;  1HXD A;  2P4W A;  4BBS J;  1S9H A;  4I02 A;  4UUS A;  4FCY A;  2F48 A;  2VXZ A;  2WRY A;  4KMF A;  2OQR A;  2D23 A;  1ZRE A;  2FFU A;  2VU9 A;  4ZDL A;  2A3S A;  5FGM A;  2DOD A;  5DCM B;  4ANJ A;  4XFS A;  3CC7 I;  2R7U A;  3OL3 A;  3H9Q A;  3VDX A;  2K86 A;  4FX4 A;  3K70 C;  4BU2 A;  4KFC A;  4F52 A;  5HDG A;  1NZK A;  3TDZ C;  3HOT A;  2Y30 A;  3CQA A;  1V3F A;  4ISR A;  2IA0 A;  1LDJ A;  2FQ4 A;  3CO7 C;  4FGF A;  1DIW A;  2HZD A;  1LQ1 A;  1P2F A;  1D1A A;  1I27 A;  4B47 A;  2MBF A;  3WGG A;  1Z3X A;  4S0H B;  3GCM A;  1DU0 A;  1TOO A;  4X39 A;  3BAV A;  4HYE A;  1PYV A;  2KLO A;  2MD0 A;  3PL8 A;  1K78 A;  2Z99 A;  2CJJ A;  2M34 A;  4MZH A;  2NZ9 A;  2XSD C;  1DGR M;  1ETQ A;  3S1Q J;  3CMM A;  2LIE A;  2WAF A;  4XMY A;  4G12 A;  2P23 A;  2D20 A;  4EFP A;  1U78 A;  1H8A C;  3GFM A;  4LO7 C;  2IRF G;  1RY7 A;  2BHZ A;  3S3M A;  4HA2 A;  3WIN A;  1ZRD A;  2YU3 A;  3F8M A;  2VQL A;  4WWC A;  4IVN A;  3F72 A;  1GXQ A;  3GXO A;  2EA4 A;  3BT9 A;  2AFG A;  4UB8 C;  3HN1 A;  4FET A;  1BI1 A;  2R7S A;  1BLA A;  2QQ9 A;  4XM3 A;  2D43 A;  4OWJ A;  3E8L C;  3LA3 A;  2DA1 A;  1H9T A;  1ETO A;  4K2E A;  1JT0 A;  3ZQ7 A;  3O4A A;  3SEQ A;  2FNP A;  2A07 F;  2Q2E B;  2QQA A;  5H6Q A;  2I5U A;  4Y17 A;  4BQO A;  3O3Q A;  4I4U A;  2FE3 A;  2JSC A;  1KQ8 A;  2VSE A;  2CMP A;  2WBC A;  3FXM A;  2ICW G;  3HUG B;  1VTN C;  5HDN A;  3FBI B;  3TW7 A;  1AKH A;  3GW2 A;  3G73 A;  3I4P A;  4MIM A;  4W1U A;  2STW A;  1DZD A;  1MJA A;  1Z05 A;  2KRH A;  3Q9S A;  1R1V A;  3AG2 H;  4D0P A;  3CCQ I;  5DZU A;  5CLS A;  1J59 A;  2TDX A;  4NHJ A;  1VCL A;  1Z67 A;  1G59 A;  3KP3 A;  5E1X A;  5DS9 A;  1W36 D;  2V1U A;  3DKY A;  4AN7 B;  3TED A;  3N97 A;  1YF8 B;  3DF8 A;  4A5N A;  1VZ0 A;  2Y0S A;  2ZXI A;  3R60 A;  5E8G A;  3OJ2 A;  4CYC A;  2IVM A;  2XB5 A;  2HZT A;  3OIQ A;  3EUA A;  4LK0 F;  3TOB A;  1J5Y A;  3IKT A;  2NVX J;  2IAI A;  5ILS A;  3WU2 C;  2HKO A;  5B66 C;  3ERE D;  4EV0 A;  1XSD A;  4KN4 X;  4IOC F;  5EGO A;  5HLH A;  4V2F A;  2IWT B;  3OV8 A;  3RKW A;  3HOM A;  3A01 B;  1IXR C;  4LIU A;  3WTS C;  1OQL B;  2FJ1 A;  1WQ2 A;  5FRN A;  5JI6 A;  3O4C A;  1RZO B;  4RM3 A;  2X9D A;  4P96 A;  3R4K A;  1SR4 A;  1AVA C;  2G9W A;  3V8L A;  1E17 A;  2HYG D;  3DPL C;  3VSZ A;  2GXG A;  1LFB A;  4A3J J;  2CQ7 A;  2V1X A;  1W3A A;  3RPU A;  2P8T A;  3WGI A;  4OEG A;  1X2M A;  5J1R A;  2QEN A;  3KP6 A;  2QLZ A;  1W7P D;  2ECB A;  2XIG A;  2LNB A;  4C2M J;  3JUT A;  5FKN A;  2CQX A;  1S72 I;  3WTY C;  2Q8K A;  5ICE A;  2DLL A;  1YJN I;  3OYD A;  4M6V A;  3ZQH A;  2VUA A;  4UY8 I;  2PG4 A;  4KYW A;  4YG2 F;  2JK3 A;  4XLF A;  3BTJ A;  2R7F A;  1FQ9 A;  1X19 A;  3ZMD A;  1R8N A;  3RYR A;  2L02 A;  2LP0 A;  3ZMS A;  1JT5 A;  4O3M A;  5GAH J;  4QIW N;  1ZLK A;  5J8F A;  4I2S A;  3ROU A;  2OD5 A;  1DFQ A;  2VBW A;  2O8K A;  2NM1 A;  3V7S A;  2YX4 A;  3F0C A;  4RBO A;  2LG4 A;  2CYY A;  1P92 A;  1PUF B;  3S1N J;  2BEO A;  4G7O F;  4LO2 C;  2ZJP F;  1TTU A;  3JAM Z;  1J75 A;  1MBG A;  4JP0 A;  2IBD A;  3CF2 A;  3MWM A;  2V9P A;  2COB A;  2FU4 A;  1YBI A;  4L5E A;  3CCM I;  4XN0 A;  2GOM A;  3O8H A;  2O7O A;  2JMW A;  5DYM A;  5GP9 A;  1MSF C;  1LFU P;  5FZU A;  5ICC A;  4QSH A;  1W0U A;  2P6T A;  2EV0 A;  2WAQ N;  3V8K A;  3CC4 I;  4IY9 A;  1GGP B;  2CU7 A;  2BYV E;  1IN6 A;  2BZT A;  5KCM A;  2NS7 A;  3JRE A;  3C2G A;  4MTD A;  2ZXH A;  4FTH A;  3WTT C;  1PUF A;  2FRH A;  2LBF B;  3MZY A;  3JRA A;  2RC4 A;  2BW3 A;  3OYJ A;  2XGD A;  2HVR A;  1SC7 A;  1WJC A;  5H2F C;  4HNU A;  3A21 A;  2NVQ J;  4JQF A;  2YU9 J;  1SR4 C;  4EFQ A;  3D7W B;  1V6W A;  2LKS A;  3WGH A;  1BR4 A;  4MEX F;  3EYY A;  1P7I A;  4PJL A;  5A2Q K;  4EEE B;  1IXC A;  5CJ9 A;  2ZQO A;  1JT6 A;  2YX7 A;  1RRJ A;  2ZR1 B;  3NQO A;  3O5W B;  4DYQ A;  5BVP I;  2H1L A;  2MYS A;  3BQZ A;  1M2T B;  2JN6 A;  1O57 A;  5D62 A;  4Q47 A;  1R23 A;  1ZAO A;  1K5U A;  2FDB M;  2DA2 A;  2ZO4 A;  5FKM A;  3IHU A;  3L9F A;  4KIG A;  3ML6 A;  1Z7U A;  1PVE A;  3KZI C;  1FMM S;  1FIP A;  2E2H J;  1VQO I;  4RB0 A;  2DU9 A;  4ZZL A;  2ECC A;  3PNV A;  1XSV A;  1MKM A;  4E7J A;  3LSR A;  1LE8 A;  2HNH A;  2BY0 A;  2PJR B;  3QYD A;  4D1Q A;  1C0W A;  4I6I A;  5HS9 A;  4HST A;  5TIS C;  3A01 A;  3S3N A;  1MBE A;  2VL8 A;  4LK1 F;  2X6W A;  1RUN A;  1Q03 A;  2DCE A;  3CAH A;  1G6N A;  3F9K A;  5EGO B;  2GAU A;  5LFA A;  3CCS I;  3HYI A;  4N9I A;  2MGQ A;  4OAY A;  2NXN B;  5B3S H;  4A0Y A;  5LGN A;  2P5K A;  3ZC8 A;  5LLQ A;  4GYG A;  3KEY A;  1IW7 F;  3C1D A;  3H35 A;  2KRF A;  3A2K A;  5E3N A;  2ZNY A;  3KLO A;  5E79 C;  2DA3 A;  3LWF A;  4PK4 A;  4XOR A;  1E0O A;  1MND A;  3BJ6 A;  1Z2V A;  4P0K A;  1TP4 A;  2CS3 A;  2W85 A;  3RZO J;  2DMQ A;  4XFT A;  4M3G A;  3CCE I;  2A6H F;  4KMU X;  4HQM A;  2NOJ B;  1MW7 A;  1REP C;  1I1S A;  3PME A;  3DBL B;  1WSU A;  3NBD A;  1CE7 B;  3WU1 B;  4HBL A;  2M87 A;  2D1Z A;  2LLK A;  2MD5 A;  2MC4 A;  2VUM J;  1JT3 A;  2PMZ N;  3QPT A;  3FM5 A;  4MLO A;  2QUF A;  1AOY A;  5BXT A;  1TZL A;  1WPK A;  2FBH A;  4P0J A;  5D61 A;  3SZT A;  1TWG J;  1N4K A;  4EJW A;  3LST A;  1IHK A;  4IZE A;  4H0E A;  1JLX A;  3WO4 A;  5BP5 C;  2Q2E A;  2A05 A;  1WFX A;  1WJ5 A;  4GDF A;  2A68 F;  2DO7 A;  3CJN A;  1TQI A;  2GIZ A;  5FRM A;  3VSF A;  1KGS A;  5ICF A;  1IIL A;  3K7A J;  3UKG A;  4BBR J;  2QKM B;  5DM6 F;  1OQY A;  3TP0 A;  3IUO A;  4AYB N;  1W7P B;  2M4K A;  4IRG A;  5FFX A;  1FWU A;  3K4C A;  2VXT I;  5TJJ A;  4XID A;  3LAJ A;  4RGR A;  4H9W A;  4XRS A;  5ILV A;  2EA2 A;  4LGW A;  2DFE A;  3BZK A;  3FM3 A;  4LMY A;  3OYF A;  1IAW A;  1HIB A;  3H6R A;  1IRP A;  3X2Q H;  2BY3 A;  5B5E C;  1HKQ A;  5C44 J;  2F6C A;  3ZQG A;  3FJJ A;  3F3X A;  1S0C A;  2O3F A;  3LSG A;  2WB1 A;  2NOG A;  2V1D A;  1R6R A;  2IS1 A;  3Q7Y A;  1VFC A;  1TT5 B;  3G1O A;  3ZQQ A;  1DLL A;  5FD5 A;  4D9J A;  4F92 B;  2EV5 A;  2VXD A;  2LIQ A;  4I96 A;  2BY1 A;  2ID6 A;  3VEP A;  3EUH C;  4M9Z A;  2DA4 A;  1XS9 A;  2K9N A;  2JA5 J;  2IHO A;  1EJ9 A;  4LLG F;  2ESU A;  4NC7 A;  3TDU C;  3WO2 A;  1V5F A;  2G7H A;  4U88 A;  2IPQ X;  4AM3 A;  1JLY A;  4DGW B;  4ZTF A;  1ZQ3 P;  1MD6 A;  4I76 A;  3FJK A;  1GVD A;  4MTE A;  2DK8 A;  3HTU A;  1R5G A;  2XRO A;  3TOA A;  3LQR A;  5LBQ A;  4KEK A;  1IXS B;  4HR6 C;  1SFX A;  1AXM A;  1HWM B;  4MZG B;  3JSO A;  5BOX A;  1Q1V A;  4OUJ A;  4NBQ A;  4C3J J;  3QPS A;  3A0B C;  1E3O C;  2E1N A;  4BUP A;  2HDD A;  2E4M C;  1W7P A;  5BMZ A;  3TGN A;  1QQI A;  1S6L A;  1I50 J;  4RGU A;  3BG9 A;  2H6B A;  4B44 A;  3DU5 A;  3K6G A;  2DN0 A;  1Y0N A;  2F4M B;  5LHI A;  1FWV A;  4L4I A;  3S2D J;  1YFH A;  3BR2 A;  3K1M A;  4KN7 X;  2IA1 A;  1IJW C;  5EZG A;  4AVZ A;  5E3O A;  5GAE J;  3HTS B;  1TIE A;  1CQT A;  5HOO A;  1FMZ A;  3A03 A;  1BFC A;  4YRV A;  2JT1 A;  5KAF C;  4ZDP A;  1TNT A;  1ACI A;  2IP2 A;  2LFB A;  2O03 A;  1UJ8 A;  2Z1D A;  4ENN A;  4PJ0 C;  1P4W A;  3SYT A;  3I55 I;  1HCR A;  4Q9P A;  5K5Q A;  2XDV A;  2F5F A;  4X6A J;  3GVA A;  1IT0 A;  2Z48 A;  3HEF A;  4M3E A;  3ELK A;  4OMY A;  4EKX B;  5F04 A;  3FXL A;  3OYB A;  3M8E A;  3OBR A;  3DKW A;  1M1E B;  2AQE A;  3RMX A;  3QOD A;  3QU6 A;  1XDS A;  1K61 A;  3S32 A;  4BQN A;  3O4O A;  2XKP A;  2EFN A;  3BG3 A;  3AAF A;  4NC8 A;  3GZ6 A;  3S14 J;  5D8K B;  3ABK H;  2DS0 A;  2D45 A;  2MH9 A;  2X1E A;  2GWR A;  3PQJ A;  2DT6 A;  3VB2 A;  31BI A;  4XLN F;  4BL0 B;  1LPQ A;  3DEU A;  5CKT A;  3H9J A;  2ESH A;  1ZAR A;  2AXT C;  1IRZ A;  1KON A;  1WJE A;  1NK2 P;  3LTQ A;  3JRI A;  1ISY A;  3MD2 A;  2DFH A;  3J80 Z;  3NRV A;  3B6A A;  3ECH A;  2VOP A;  2LR8 A;  4HX4 A;  2EH3 A;  4AID A;  2F8X C;  2XVC A;  3GBG A;  3GF2 A;  3IP4 B;  2VAS A;  1WWX A;  3WU0 A;  2AXM A;  2OCE A;  4I6Z A;  2JA6 J;  1R71 A;  3J81 Z;  2ERM A;  3I2A A;  3I56 I;  2CW8 A;  3FIW A;  2X85 A;  3LOC A;  1D3Y A;  4M73 A;  4N4N B;  4A69 C;  3AFH A;  1SMT A;  3H0D A;  2EIN H;  4HF1 A;  5FFZ A;  4L0Y B;  1Q04 A;  3L1P A;  1R4M B;  1OYI A;  3NAR A;  1UZC A;  2B63 J;  3PQK A;  3V7R A;  3IL2 A;  3M1C A;  3TO9 A;  4HDU A;  1DJS B;  5L3C A;  4D7N A;  2QEX I;  3BC8 A;  4F91 B;  1K4S A;  3HOS A;  1WCM J;  1WH7 A;  1KU9 A;  3GTQ J;  3ASO H;  5FKK A;  4A7Y A;  3V0B A;  4X3A A;  3H1C A;  1E3P A;  1SVL A;  3CCV I;  2MLG A;  5HLI A;  5BNG A;  2L5X A;  1JY0 A;  1Y6I A;  1ZEL A;  3MEX A;  3B73 A;  4P55 A;  4M3B A;  1FBU A;  3LMM A;  5TRD A;  1DFC A;  2BW3 B;  3HPG A;  2K40 A;  2ELK A;  2LBF A;  2DJN A;  4XKV A;  4BJT A;  4Z9W B;  4XN3 A;  2QZ8 A;  2X2S A;  3CLO A;  2MAB A;  1P63 A;  1BIB A;  1XN7 A;  1BJZ A;  3D5S C;  3VT1 A;  3PIP F;  5B2H A;  3AG3 H;  1G3T A;  1HW2 A;  1E3H A;  1X58 A;  3CLQ A;  4A3B J;  1XCB A;  2JJ7 A;  2AQF A;  2M3A A;  2E2I J;  1SD7 A;  4I4Q A;  2K4B A;  2OJE D;  4M6X A;  2LVS A;  3I2X A;  1FOY A;  4XOP A;  3S16 J;  2ZFU A;  4P1W A;  1YX5 A;  4E7S A;  1IO2 A;  3WTW C;  3D0S A;  5JVG F;  2Q0O A;  3HOZ J;  5IT9 Z;  1STZ A;  1R49 A;  5JHU A;  2OCC H;  1MMG A;  1Z91 A;  4MFD A;  4YFN F;  2W82 A;  2JPB A;  2UUZ A;  4CSW A;  3S3O A;  3FBN B;  1T33 A;  3FF5 A;  1Z0H A;  2M49 A;  1B9N A;  4WCG A;  2EK5 A;  3QPL A;  2XAJ A;  2W25 A;  3RPU D;  4NDL A;  1K7A A;  1BLD A;  4BEH B;  3PIO F;  5FO5 A;  2X6Y A;  2QQB A;  3IKV A;  5IT3 A;  2E19 A;  1L0O C;  5GAD J;  1V55 H;  4I0A A;  4II2 A;  1EVT A;  1ZG3 A;  1KU3 A;  3SEZ A;  5F8S A;  3FIS A;  4Q5S F;  5IYC J;  1OYW A;  3EUK L;  2P81 A;  2Y31 A;  2FSW A;  1IDY A;  4B43 A;  2NS8 A;  2JVH A;  3WHC A;  2M1B A;  1XD7 A;  2VXR A;  3BG6 A;  4LO2 A;  1Z6T A;  3A1Y A;  3WA1 A;  2XAQ A;  5E1W A;  1ULY A;  4BY1 J;  1ZGA A;  3F8N A;  4MEY F;  2EIL H;  3MMY B;  1SZ6 B;  1FJL A;  2DPU A;  5JMC A;  2O8X A;  1BJA A;  1GDT A;  2M7A A;  3FZV A;  3MPP G;  2HTJ A;  3AJ5 A;  1U2W A;  4G9N A;  3WMU A;  3FJH A;  2DDB A;  3FGM A;  3KEO A;  4L0Z B;  1K6Y A;  2MIB A;  4ZFW B;  4F7Z A;  1FYM A;  3CC2 I;  3CRG A;  4CYC B;  3B02 A;  3TL4 X;  1FBS A;  3WTV C;  3RQ4 A;  2KKO A;  4E70 A;  1KU2 A;  3BAD A;  1PDN C;  4HQE A;  4BAY A;  4CA0 A;  2NNN A;  1IRF A;  3QYE A;  4C2T A;  1T38 A;  1O3Q A;  4LFU A;  1MDM A;  2GO2 A;  3CDL A;  1I6X A;  4MNU A;  5LEJ A;  2BBY A;  4HRI A;  2OBP A;  4J2K A;  2KIQ A;  1FWZ A;  4A3F J;  1IN4 A;  1L2H A;  4M3D A;  3MAJ A;  3UD9 A;  4IL6 C;  3UJ0 A;  1QPI A;  1GHC A;  2CO5 A;  5EEA A;  3E6B A;  1FP2 A;  2XHK A;  1TWC J;  4XOT A;  4AUX A;  3K9T A;  1ZR2 A;  1Z6R A;  2QWW A;  4ZYA A;  3GTK J;  1E2X A;  4HAM A;  1PP7 U;  2LTP A;  3AKH A;  4GRI A;  4B4C A;  4Z8S B;  1BI3 A;  1YIO A;  4ZC3 A;  2WBM A;  3SZP A;  4PJJ A;  4ENM A;  2DRE A;  3H3U A;  1OYY A;  1A5J A;  2AAI B;  5K7Z A;  4F34 A;  4GXO A;  3BAG A;  4M74 A;  4IHV A;  1TQP A;  4IQJ A;  1G9A A;  2QQ8 A;  2X0L A;  3RPQ A;  1F1Z A;  3QPH A;  4UNO A;  1LVA A;  2PJP A;  1P6R A;  5F0F A;  1UMQ A;  2MLL B;  3RSJ A;  2DOE A;  4XKI A;  3CCR I;  3WHB A;  4BDZ A;  3G1L A;  1AVU A;  1XGN A;  5BPI A;  1T2K A;  2HPM A;  4YOL A;  5LHH A;  2LSO A;  7I1B A;  1K83 J;  2QKL B;  2ZQN A;  1X1D A;  3LA2 A;  4JOM A;  4IXA A;  5CVR A;  3VOE A;  3F6V A;  2YUG A;  4LO0 C;  4DW6 A;  4MZF B;  1O3R A;  2OA4 A;  1VND A;  3GTG J;  3KP5 A;  4F55 A;  3AKI A;  4HLX A;  5KK1 A;  2MA3 A;  5M3M J;  2V7F A;  2XB0 X;  2DRY A;  3CRI A;  1MMN A;  3LNQ A;  1TP0 A;  3AZV A;  1V6X A;  2XGC A;  1JXS A;  4XBF A;  2HXI A;  1OIS A;  2JA2 A;  4GCV A;  4YII A;  4ZYD A;  3C2B A;  2D22 A;  3ZC9 A;  4TV7 A;  4WXD A;  2WA0 A;  3DV8 A;  2HXO A;  3OYL A;  2E71 A;  4G6D A;  1A36 A;  2GZW A;  3E7L A;  2VI6 A;  3HRS A;  2XPU A;  3FMR A;  4XRF A;  5HS7 A;  3SNV A;  3RYP A;  4NUB A;  4RMN A;  1W3F A;  2O0Y A;  2CUE A;  3A0H C;  1TWM A;  4EGY A;  2IA2 A;  2HI3 A;  3K2Z A;  5BP5 A;  3W6J B;  3LLP A;  4GGG A;  1JTC A;  2W48 A;  3ABL H;  4KNY A;  2PQ8 A;  5BQU A;  5G00 A;  1FMW A;  1IN8 A;  5FRO A;  21BI A;  1WD4 A;  5C4X J;  1BI0 A;  3L2W A;  1HWO B;  1GVJ A;  3ABT A;  2P39 A;  1JUS A;  2XSJ C;  3QQA A;  8I1B A;  2XAG A;  3RKX A;  1XPX A;  3QU3 A;  4IOA F;  3JRR A;  2ESN A;  3M8F A;  4BH9 A;  4CO8 A;  3DTE A;  1W4M A;  3HHH A;  4IF4 A;  4IJA A;  2P5L C;  4QO3 A;  1T08 B;  3ZQC A;  3BAO A;  3AG1 H;  3UDA A;  3JAM K;  2LKP A;  3IM7 A;  3ZP5 A;  2JTV A;  1TW3 A;  3OIP A;  1QZZ A;  5EG0 A;  1VF9 A;  1OKR A;  1OR7 C;  4M6Y A;  4QWQ A;  3RKQ A;  5IOZ A;  3DTI A;  2H8W A;  5CVU A;  1YO5 C;  1XCV A;  3F8C A;  3KP2 A;  1SAN A;  2K3P A;  1MNE A;  4F3Q A;  2DMN A;  3GTL J;  4JQ0 A;  3DXJ F;  3K4J A;  3FXJ A;  3CA5 A;  1H9G A;  3FJI A;  1K4T A;  5E1Z B;  4ZJZ A;  2E1M B;  3FHZ A;  4IHZ A;  2MC2 A;  2HVQ A;  2Z3Y A;  4XQF A;  1HF0 A;  1JE8 A;  4O5V A;  4KBB A;  1W5S A;  3E5Q A;  2EZL A;  3BRD A;  3PNY A;  1SD5 A;  1MMS A;  2I1B A;  1V54 H;  3HL2 A;  3KP7 A;  4PJN A;  3L2V A;  2PMU A;  1Z1D A;  4O6J A;  2HTS A;  1I1E A;  2EJR A;  1R5I D;  3GTO J;  1K79 A;  4QKR A;  1X3U A;  2Z33 A;  5HNH A;  4FT8 A;  2KL4 A;  3QOE A;  2DDA A;  1JJ8 C;  2EIM H;  2KQR A;  4HF2 A;  3BB2 A;  2WAE A;  3LQQ A;  4CCJ A;  2CUZ A;  4U0V A;  2E5Z A;  4Y33 A;  1TW2 A;  3D5L A;  1U8R A;  4BXU A;  1FV2 A;  2LDU A;  2O9L A;  1Y0U A;  4HOB A;  4EJV A;  4BJ5 C;  3W9T A;  2CH0 A;  2R0Q C;  2E1C A;  3HC7 A;  1IUF A;  1MIJ A;  2MG4 A;  3EET A;  3P7N A;  5IOY A;  3J7Y J;  4EGZ A;  2CV2 A;  2RST A;  3BLY A;  3J7Z I;  4IY8 A;  4FHT A;  3FJ8 A;  2LH9 A;  5E8I A;  2VKV A;  4BNC A;  2VB6 A;  5IP7 J;  4XRS G;  3OYG A;  3VYS B;  1A31 A;  2L3D A;  4CCO A;  4I2O A;  1G82 A;  2G0E A;  2X6O A;  5GAG J;  2WAD A;  4A7K A;  2LRE A;  4Y52 J;  4A2U A;  3IRQ A;  4JBA A;  2E5N A;  3SQN A;  5K1Y A;  1JKO C;  3BWG A;  1H88 C; 
#chains in the Genus database with same CATH homology
 3N0K A;  1JT3 A;  2X2T A;  2RQ9 A;  4HG2 A;  2LRD A;  4KJZ A;  4FVV A;  2NYY A;  4WBC A;  4MLO A;  1RML A;  4USO A;  6I1B A;  4QKS A;  3DQV C;  1TZL A;  1JT4 A;  5BXT A;  5E24 E;  3WIN C;  3IAG C;  3FJF A;  4P0J A;  2D7I A;  5D61 A;  3AKF A;  4Y4R A;  3EF2 A;  2KLL A;  3FJC A;  3DWL E;  1N4K A;  4CCL A;  3H9G A;  1NUN A;  3IM5 A;  1XYF A;  2JVG A;  1IHK A;  3LFU A;  5LD2 C;  4IZE A;  1JLX A;  3N7K A;  3WO4 A;  5BP5 C;  4BAC A;  1WFX A;  1WJ5 A;  2E60 A;  3ZXD A;  4USP A;  4X37 A;  5BQU C;  2F5V A;  4H4K C;  3LSI A;  4YEJ A;  2XAU A;  2R7Q A;  5FRM A;  3VSF A;  1IIL A;  1BFG A;  3OS1 A;  4P0K A;  2M0M A;  4E7I A;  2QKM B;  3PNT A;  3CP8 A;  3IUO A;  2WY7 Q;  4E7Z A;  2M4K A;  3OOU A;  1FWU A;  2VXT I;  2JUG A;  3K4C A;  2CV1 A;  3OBT A;  4H9W A;  4DOZ A;  2DRZ A;  3MKZ A;  4X38 A;  2IS2 A;  1X1A A;  3CJR B;  1HIB A;  4QAL A;  3OYF A;  3H6R A;  1IRP A;  2R7X A;  4JKX B;  2HDW A;  2R7V A;  4NNJ A;  4D0T A;  1BR2 A;  4OWL A;  3W2W A;  1WJD A;  4J00 A;  2KHM A;  2Z2S B;  3IAS 2;  3FJJ A;  4I1B A;  2F6C A;  2CFO A;  4JRA A;  3RTI B;  3FJ9 A;  3L2Q A;  1S0C A;  3LSG A;  2WB1 A;  2VIX A;  2F2F C;  1R6R A;  2IS1 A;  3N7J A;  3Q7Y A;  4GAI A;  4JPZ A;  1DGW Y;  4PSX A;  2KPM A;  4DBR A;  3OS2 A;  3ZQQ A;  1DLL A;  1IRX A;  1WJB A;  2E1M C;  3VYR B;  4D9J A;  4OAZ A;  4F92 B;  3SZG A;  1HKN A;  1ONK B;  2LYC A;  2VXD A;  2D44 A;  3BG7 A;  3RCO A;  1KNM A;  2LIQ A;  2Q3N B;  1EA3 A;  3EUH C;  4I96 A;  1V6U A;  5F8Y A;  1J0S A;  5FNX A;  3OL4 A;  3CZ6 A;  3OYH A;  2HWM A;  3FUQ A;  2IHO A;  2A6T A;  2L9S A;  5EG6 C;  1G9C A;  4DIQ A;  1K5V A;  3RSN A;  4AU7 A;  4CCN A;  2ESU A;  2KMU A;  1WJA A;  4NC7 A;  5EC5 A;  3L2R A;  3WO2 A;  3MKY B;  4UY4 A;  2J3P A;  1V5F A;  3AZW A;  1IRA X;  3HSM A;  4XFU A;  5EHA A;  1JLY A;  4DGW B;  1T0F C;  4ZTF A;  2KH2 A;  4DCK C;  1MD6 A;  3ZXG A;  1U0J A;  1RG8 A;  3LSH A;  1XZZ A;  3FJK A;  3QR5 A;  4ZKT B;  4YEL A;  1Q1U A;  4END A;  1S0E A;  3V79 C;  4KEK A;  4BS9 A;  2LY2 A;  1JI8 A;  4LO3 C;  4E4H A;  3OJM A;  4HR6 C;  1AXM A;  1HWM B;  4MZG B;  1GLN A;  3K4L A;  3OYK A;  2JSP A;  5CQE A;  4E7H A;  1ILR 1;  1ISV A;  1WBA A;  4HEA 2;  1PWA A;  3K4N A;  2K4A B;  4OUJ A;  3VEQ A;  2IS4 A;  4XR6 A;  3O4D A;  3H5A A;  5FNW A;  4BUP A;  3DEE A;  4DJA A;  1R8O A;  2E4M C;  4KIS A;  4DEP A;  3CA4 A;  3BA4 A;  3CP2 A;  4GOV A;  4FAS D;  3G2B A;  4B44 A;  3DU5 A;  3K6G A;  5BOW A;  2R4G A;  1MC9 A;  4G6T B;  4XLA A;  3H6Q A;  1FWV A;  4L4I A;  2WY8 Q;  1X1B A;  1TFM B;  4J23 B;  1FMV A;  3ILA A;  3DPU A;  4J2Y A;  4AVZ A;  4F93 B;  4BE2 A;  1TIE A;  1X4P A;  2ZSI B;  2VJ5 A;  3BAU A;  5HOO A;  4I37 A;  3WO3 A;  1FMZ A;  4ZOT A;  3DLA A;  3F1R A;  2HQA A;  3CES A;  1BFC A;  4YRV A;  3A07 A;  2DXI A;  1EYL A;  4ZDP A;  3VUO A;  2VPL A;  1IJT A;  4Q91 A;  3K4M A;  2Z1D A;  1Y56 A;  4G9M A;  4Q9P A;  3SYT A;  3P6I A;  4LIV A;  4E7K A;  2XDV A;  2VJ4 A;  2LY1 A;  4I4X A;  3H5R A;  1IT0 A;  2Z48 A;  3V0B B;  1V5E A;  4QD2 C;  4EKX B;  3HXL A;  5JHF A;  1D0X A;  4BEH A;  1ISW A;  1BFF A;  1JQZ A;  3OYB A;  1PJR A;  5KHD A;  2XF6 A;  2V1N A;  2XC7 A;  3KMV A;  3OBR A;  3W3C A;  5HVQ C;  1BAR A;  2D7R A;  2AQE A;  3RMX A;  3QOD A;  4CJM A;  4RLF A;  3AH4 A;  3S32 A;  4BQN A;  3O4O A;  2WRY A;  4IKF A;  1YYN A;  4NC8 A;  2FGF A;  1Z4S A;  3BAQ A;  3W2V A;  2DS0 A;  5JMC A;  4KEJ A;  1Z21 A;  4XLH A;  4XLE A;  41BI A;  2X1E A;  2XF7 A;  2LC2 A;  3LSK A;  4QPO A;  3LSM A;  1IOB A;  2GZB A;  4BDY A;  4CCM A;  4I3N A;  4TLP A;  2DT6 A;  3RTR A;  1LVK A;  2NTD A;  4XKW A;  31BI A;  4BL0 B;  4XKC A;  4J01 A;  4QPQ A;  4PC4 A;  1D1C A;  2UV1 A;  3H9J A;  5CKT A;  2RNG A;  3VWB A;  1KON A;  3POK A;  4I4S A;  1T4Q A;  1WJE A;  3NWT A;  4CUG A;  2VSA A;  3LTQ A;  1ISY A;  3MD2 A;  2FFV A;  3J7A Y;  3OYE A;  4BXF A;  4I7I A;  1I1B A;  4OEF A;  1NG7 A;  2BEA A;  2VKD A;  2QYI B;  4U7B A;  3GBG A;  1S0F A;  2F8X C;  4KIT B;  4R79 A;  5HNF A;  3W2A A;  3IP4 B;  2NVH A;  2VAS A;  3ZX7 A;  2AXM A;  5BXS A;  4PUS A;  3FDY A;  3BAH A;  4ZFU B;  3BRF A;  3I2A A;  2ERM A;  3FJA A;  3FUO A;  5DUY A;  2CW8 A;  2R7W A;  2X85 A;  4N4N B;  3VSK A;  1F31 A;  3N05 A;  3AFH A;  3H0D A;  2VQG A;  1T9F A;  4C9Y A;  3FJB A;  3Q7X A;  1UEL B;  1Q04 A;  3T8S A;  1HCD A;  3Q7W A;  4IX7 A;  2MFZ A;  3BCA A;  3M1C A;  2X51 A;  1DJS B;  3RMY A;  3OWT A;  3ZCO A;  4IZX A;  3VT0 A;  1TT0 A;  4ZBV B;  4AN6 A;  3VYU B;  1QQK A;  1YXW A;  4ZA3 B;  3BC8 A;  1PUU B;  4F91 B;  2V6E A;  3I9V 2;  3PSF A;  3HOS A;  3UJ4 A;  5BXR A;  1DQG A;  1JT7 A;  1WBC A;  3NBE A;  4N4O B;  3I29 B;  3BA5 A;  2VJJ A;  2HPI A;  2D24 A;  2W4S A;  4X3A A;  1QU3 A;  4A7Y A;  3V0B A;  3O4B A;  3C9Z A;  3I3L A;  2K8R A;  2L5X A;  1JY0 A;  1Y6I A;  1ZEL A;  2IS6 A;  4GOY A;  2KI6 B;  3U21 A;  3PUB A;  3P53 A;  3LMM A;  4HNT A;  2BW3 B;  3HPG A;  3OYM A;  3OMY A;  1SFK A;  2R7R A;  1DFC A;  2LBF A;  4XKV A;  4BJT A;  4GP0 A;  4P5O A;  2WAQ A;  1QHG A;  4XN3 A;  2X2S A;  3IAM 2;  2MAB A;  1P63 A;  3BX1 C;  1CVS A;  4KEI A;  3D5S C;  2V26 A;  3KX2 A;  4XLC A;  3NJ5 A;  3HG9 A;  2IGO A;  3VT1 A;  3N7L A;  4GP3 A;  1E0E A;  2QN4 A;  2X6X A;  5B2H A;  2NP0 A;  3VWC A;  2LOO A;  5DSS B;  2M3A A;  2AQF A;  3S93 A;  1QHH D;  2Q1Z B;  3UD8 A;  4I4Q A;  3NBC A;  2K9M A;  2V4J C;  3I2X A;  2K43 A;  1AVX B;  4XOP A;  2IGK A;  3FKJ A;  1YX3 A;  2ZFU A;  2FUG 2;  3E0J B;  4P1W A;  4RM2 A;  1YX5 A;  1Z7L A;  4HPQ A;  2FO1 A;  3L2U A;  4E7S A;  4IYB A;  4H04 A;  3OR1 C;  2VLA A;  4C2U A;  5HPZ A;  3CJQ B;  1LKX A;  3OGF A;  3DU6 A;  4IQP A;  1S0G A;  5F90 A;  1DZC A;  1OLT A;  3OS0 A;  1LDK B;  1MMG A;  1D0H A;  2W82 A;  1ISX A;  3TC2 A;  2UUZ A;  4QD2 B;  4OEE A;  2O5R A;  4CSW A;  3S3O A;  2IGM A;  4B3X A;  1UPS A;  5FZZ A;  3FBN B;  1Z0H A;  1S9H A;  1DP3 A;  3EPZ A;  2M49 A;  2VXZ A;  2VJI A;  4RLQ A;  3OYI A;  1HA8 A;  1S0D A;  2HZ9 A;  2D23 A;  3CA0 A;  2DJI A;  2FFU A;  2VU9 A;  1S0B A;  4ZDL A;  5KNL A;  1DZD A;  4PSW A;  4ANJ A;  4E6K G;  3RPU D;  3FHN A;  5HLT A;  4XFS A;  2R7U A;  1BFB A;  3OL3 A;  3H9Q A;  3VDX A;  3K70 C;  4BEH B;  4BU2 A;  4A7Z A;  2X6Y A;  4F52 A;  1NZK A;  3BTA A;  1ERD A;  3HOT A;  3CQA A;  4ISR A;  4XL9 A;  3HKZ A;  3A22 A;  3KYL A;  1DIW A;  4FGF A;  4II2 A;  2KRC A;  2HZD A;  1EVT A;  2HW9 A;  4B47 A;  1D1A A;  3SEZ A;  5F8S A;  3ZRG A;  1Z3X A;  2CW7 A;  3EUK L;  4JKQ A;  4D0Z A;  2DOA A;  3MKW B;  3E1S A;  1TOO A;  4X39 A;  3OR2 C;  3BAV A;  4B43 A;  1PYV A;  2KLO A;  2ZSH B;  2JVH A;  1LFP A;  2MD0 A;  3PL8 A;  2E4M A;  3IM6 A;  2VXR A;  1XG6 A;  3BG6 A;  3BCB A;  1EV2 A;  4I4Y A;  4CZC A;  3P6J A;  4LO2 A;  4MZH A;  2NZ9 A;  3A1Y A;  1DGR M;  1N78 A;  3WA1 A;  1TWE A;  1UG0 A;  1BR1 A;  2OUM A;  2WAF A;  3CMM A;  4XMY A;  1SZ6 B;  3MMY B;  2LIE A;  2P23 A;  5I1B A;  2D20 A;  4II0 A;  4LO7 C;  4EFP A;  2M7A A;  1RY7 A;  4I4P A;  3S3M A;  3MPP G;  4HA2 A;  1AFC A;  3WIN A;  3AJ5 A;  1BLD A;  4G9N A;  2VQL A;  3WMU A;  3FJH A;  1AA7 A;  3FGM A;  4ION A;  2Y9X E;  3OYA A;  1K6Y A;  3R4S A;  2MIB A;  4II3 A;  2AFG A;  4ZFW B;  3K4B A;  3CRG A;  3HN1 A;  4FET A;  3TL4 X;  2K9L A;  3OY9 A;  2R7S A;  1BOB A;  1BLA A;  2I8D A;  4XKB A;  3RQ4 A;  4XM3 A;  2D43 A;  4PFO A;  3BAD A;  4OWJ A;  3E8L C;  2W7N A;  3S8K A;  2RG9 B;  2KDO A;  4CA0 A;  1M16 A;  4ZLB B;  4F83 A;  3QYE A;  3O4A A;  3SEQ A;  4C2T A;  2M4G A;  1PUM B;  2Q2E B;  4PJM A;  2VQC A;  3DKX A;  1FGA A;  2GO2 A;  3CA6 A;  4BQO A;  3O3Q A;  3O49 A;  4I4U A;  4ZGR B;  3OYN A;  1ABR B;  2L7K A;  1QXM A;  3B9U A;  2VSE A;  3HPH A;  4HRI A;  4G6J A;  4GAF A;  4J2K A;  2CMP A;  4EAT A;  2Z49 A;  2WBC A;  1X1C A;  1L2H A;  3UD9 A;  3UJ0 A;  3F62 B;  3OYC A;  2RQQ A;  3HUG B;  2BVM A;  3FBI B;  1N77 A;  1HCE A;  4XOT A;  2BFH A;  4KC3 A;  4QBC A;  4U87 A;  4ZYA A;  4D8H A;  2F2F A;  2KKI A;  3AKH A;  4GRI A;  4Z8S B;  2KRH A;  4ZC3 A;  1WD3 A;  3H6S E;  2V9K A;  2WBM A;  2A5W A;  4PJJ A;  4C30 A;  5DZU A;  1DQO A;  5GAQ A;  2DRE A;  1A8D A;  4XON A;  1VCL A;  2AAI B;  4F34 A;  1G59 A;  3BAG A;  9ILB A;  3NBN A;  5CQG A;  3K70 D;  2ET2 A;  2R7O A;  4IQJ A;  1D1B A;  1G9A A;  1MMA A;  4I4O A;  1W36 D;  1FV3 A;  3AH1 A;  4LO8 B;  2MLL B;  2HWA A;  2BOL A;  3DKY A;  3RSJ A;  1BA7 A;  4AN7 B;  1YF8 B;  4XKI A;  2ZXI A;  1VZ0 A;  2Y0S A;  3H6R B;  4BDZ A;  3OJ2 A;  1AVU A;  4OW4 A;  3OIQ A;  2HPM A;  4YOL A;  3EUA A;  7I1B A;  3R4U A;  5JLV A;  2QKL B;  2XOA A;  2VLC A;  1X1D A;  2ZQN A;  4J2S A;  5FZY A;  4JOM A;  3UNG C;  4DEN A;  2L2O A;  2IWT B;  4Q9G A;  3BRG C;  2W00 A;  4LO0 C;  2YUG A;  3VT2 A;  4I8M A;  4MZF B;  3HOM A;  3V0A A;  5CPR B;  4ZFY B;  4LIU A;  1OQL B;  4F55 A;  4ZTJ A;  1Z3Y A;  3AKI A;  3QYB A;  3V42 A;  5FRN A;  3O4C A;  2Y9G A;  4P0L A;  1RZO B;  2V7F A;  4RM3 A;  2R7T A;  1AVA C;  1SR4 A;  2DRY A;  1MMN A;  3CRI A;  3OJV A;  1TP0 A;  3AZV A;  1D0Z A;  2P0W A;  3VYT B;  3DPL C;  1V6X A;  3CRH A;  4JAW A;  3VSZ A;  2JA2 A;  2W1O A;  1PC8 B;  1W3A A;  2D22 A;  4H75 A;  4HJJ A;  4OEG A;  3ZC9 A;  3PSI A;  2WA0 A;  3OYL A;  1V5G A;  4LO3 A;  3JUT A;  4EFR A;  4ITV A;  4I0Y A;  4KT6 A;  3TMO A;  2OC6 A;  3UD7 A;  2IGN A;  1YE9 A;  3OYD A;  2VUA A;  3N7M A;  1UAA A;  5D63 A;  1V6V A;  3RTJ B;  1NG6 A;  3SNV A;  1X4O A;  4HSR A;  3PHZ A;  4NUB A;  4RMN A;  4XLF A;  2X1C A;  2HVS A;  1W3F A;  2Q9X A;  3M8J A;  4PFP A;  2L9N A;  1FQ9 A;  4QBV A;  1X19 A;  1TWM A;  3VSL A;  4L4H A;  1R8N A;  5BP5 A;  3LLP A;  1JT5 A;  3FFZ A;  4G1R A;  4CCK A;  1JTC A;  5TGT A;  4IZZ A;  3PJR A;  4I2S A;  5BQU A;  1AF9 A;  4I4V A;  5G00 A;  1FMW A;  5FRO A;  1DFQ A;  21BI A;  3K4K A;  1WD4 A;  4AYB A;  2NM1 A;  5DVH A;  3L2W A;  1HWO B;  1PZZ A;  1W3G A;  2P39 A;  2BVL A;  2LG4 A;  2CV0 A;  2XSJ C;  3DTK A;  4LO2 C;  1DQU A;  2KI4 A;  8I1B A;  1TTU A;  3H5N A;  4R6U B;  3FJE A;  2RRE A;  4JP0 A;  3JRR A;  3CF2 A;  3QYF A;  3TBI A;  3DTE A;  1YBI A;  2AQZ A;  3FJD A;  4XN0 A;  2GOM A;  4CH7 A;  1S0L A;  3AJ6 A;  1W36 C;  1J09 A;  1AVW B;  2PJR A;  4Y3O A;  5FZU A;  2IXS A;  4LO1 C;  4QO3 A;  3UDA A;  3BAO A;  3CA1 A;  3IM7 A;  4IY9 A;  1GGP B;  1D0Y A;  5KCM A;  3OIP A;  1HWN B;  4Z9W B;  3C2G A;  5F8W A;  3K10 A;  2ZXH A;  1WJF A;  2X1D A;  1OR7 C;  2LBF B;  4BJ6 C;  4E7L A;  3ZR8 X;  3DTI A;  2BW3 A;  1MMD A;  3OYJ A;  2HVR A;  1YTO A;  1WJC A;  3UR3 C;  4LO7 B;  3MAL A;  2K3P A;  1MNE A;  4F3Q A;  4HNU A;  3A21 A;  3D5R C;  4JQ0 A;  3K4J A;  4JQF A;  1QQL A;  3CA5 A;  4P6A A;  1T95 A;  1SR4 C;  2VKH A;  4EFQ A;  4OWR B;  4XNF A;  3D7W B;  1V6W A;  3FJI A;  3CA3 A;  4ZJZ A;  1BR4 A;  2E1M B;  4BE1 A;  4IHZ A;  4PJL A;  2HVQ A;  4XQF A;  4G6M A;  2MC2 A;  2ELJ A;  4EEE B;  1G9D A;  4BE0 A;  1FN0 A;  4QC4 A;  2ZQO A;  2XF5 A;  4KBB A;  2KP6 A;  2ZR1 B;  2UUS A;  3O5W B;  5BVP I;  3BRD A;  2MYS A;  3PNY A;  2M7B A;  4IQ4 A;  4B48 A;  3HBW A;  4ISQ A;  1M2T B;  1G9B A;  5D62 A;  3SDB A;  3HL2 A;  2I1B A;  1BAS A;  1K5U A;  4EB2 B;  2FDB M;  4PJN A;  3AL0 C;  3L2V A;  4LIT A;  1XHB A;  5BXP A;  1I1E A;  4QKR A;  2HU9 A;  3DPT A;  3NWS A;  2R9K B;  5HNH A;  2KL4 A;  1FMM S;  2Y9F A;  4OWK A;  3AKG A;  3QOE A;  3AKZ A;  3PNV A;  3WMV A;  2KQR A;  3BB2 A;  1G8X A;  2WAE A;  4CCJ A;  4E7J A;  2CUZ A;  3QYD A;  2HNH A;  2E5Z A;  4Y33 A;  1P9Q C;  3D5L A;  2PJR B;  1FV2 A;  2VQH A;  3ZXS A;  4D1Q A;  3CU1 B;  3O44 A;  4I6I A;  3ONQ A;  4HST A;  3A4C A;  3S3N A;  2VL8 A;  1ISZ A;  1Q03 A;  2X6W A;  3AL0 B;  3V0A B;  2DCE A;  3AH2 A;  3CAH A;  4BJ5 C;  3W9T A;  3F9K A;  5LFA A;  2CH0 A;  4J2X A;  2L5Q A;  3HC7 A;  3S8P A;  4OAY A;  3ZGK A;  4X0G A;  2CV2 A;  2RST A;  2NS2 A;  3IIR A;  3ZC8 A;  3BLY A;  2DT7 B;  3KEY A;  3H35 A;  3OGG A;  4I4R A;  3C2H A;  1N75 A;  4IY8 A;  3A2K A;  3HMY A;  1SAU A;  3HAL A;  4NQW B;  2UWM A;  2F4I A;  2LH9 A;  2GOX B;  4LG3 A;  3FJ8 A;  3K1X A;  2PMZ A;  2OV7 A;  4PK4 A;  4XOR A;  1E0O A;  4I1E A;  1MND A;  2KZV A;  2VB6 A;  4ZDO A;  1Z2V A;  2CS3 A;  3BA7 A;  3OYG A;  4LO0 A;  3VYS B;  4LO1 A;  1EPW A;  4XFT A;  4CCO A;  4BQQ A;  1G82 A;  3LL7 A;  2CUJ A;  2K5C A;  4DBQ A;  2BEB A;  1II4 A;  2NOJ B;  1MW7 A;  2Z16 A;  1ITB A;  3PME A;  3NBD A;  2WAD A;  1CE7 B;  2D1Z A;  4A7K A;  4BGD A;  2LRE A;  3PFY A;  2Y9W C;  2E5N A;  3S8J A;  3PG0 A;  1HWP B;  2MC4 A;  3A23 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...