3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30kDa protein
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
molecule tags Unknown function
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
4II0A 4X3AA 3NBNA 2F2FA 4LO0C 4GP0A 4X37A 4FVVA 2I1BA 3HSMA 2D1ZA 1I1BA 4H04A 2RQ9A 3UJ0A 21BIA 4QD2C 1K5VA 1JT5A 4GP3A 3O49A 3FJ8A 4ISQA 3HMYA 1HCEA 3WO4A 4XKIA 2UUSA 3QYDA 4HJJA 3WMVA 4I3NA 1ILR1 3JUTA 1AFCA 1HKNA 5F90A 3FJ9A 1BASA 1RG8A 3W9TA 1II4A 1YYNA 4ZOTA 1S0BA 4ZFYB 2ZQOA 2J3PA 3IAGC 2K8RA 4A7KA 3TC2A 3BAGA 3CU1B 1WD4A 2XOAA 4I4VA 3OJ2A 2NP0A 4Q9GA 2Y9GA 3VT1A 3HBWA 4G9MA 3O4BA 1Q04A 1V6VA 2KKIA 3N7MA 3C9ZA 3CAHA 4J2YA 4HR6C 4H9WA 4JKXB 4F34A 3FJJA 4AN7B 4OWLA 5D61A 1V6WA 1ITBA 5BP5A 3I2AA 2D43A 1I1EA 3V79C 3P53A 1PZZA 1FMMS 4QKSA 1Z0HA 3R4UA 3I2XA 3EF2A 3UD9A 1IRPA 1XG6A 4IONA 3AJ6A 1EV2A 4D0ZA 2KH2A 3BA7A 1PUUB 4DENA 1FN0A 4ZA3B 3S8JA 4I7IA 2D22A 4QD2B 2ZQNA 3OBTA 4R6UB 8I1BA 5E24E 4QO3A 4LO3C 3AKGA 3O4CA 1D0HA 3UD8A 1XHBA 1G82A 4LO2A 4ZLBB 1SZ6B 4LO0A 4EEEB 3WO2A 1HWMB 3I29B 3BAVA 1ISXA 3VT2A 1WBCA 3CA4A 2D7RA 3WO3A 1N4KA 4G6MA 2NZ9A 1XYFA 1JT7A 3OJVA 3ILAA 4QBCA 2YUGA 3NBEA 5FZYA 1EVTA 2HWAA 3KMVA 4G9NA 2WBCA 1G9AA 3V0AA 3WMUA 1UPSA 5BP5C 2HW9A 2GO2A 1PC8B 3FJKA 2X2SA 1DZDA 2FFVA 4I1EA 5FZUA 31BIA 3IIRA 3SNVA 1NZKA 2VXTI 1ONKB 2Q3NB 3IM6A 3CA3A 4Z8SB 2LIEA 5D63A 4LO7B 1FMZA 4HA2A 3WA1A 3O3QA 4X38A 4IZXA 2BFHA 4IHZA 4D8HA 4WBCA 5DVHA 4LO2C 1HWNB 3HOMA 2D44A 5FNXA 1YTOA 2VLCA 2NVHA 2P23A 3AKFA 2VXRA 3S8KA 1RZOB 5JMCA 2D23A 1P63A 3OBRA 1ISWA 1YXWA 3NBCA 4JPZA 4QC4A 2F8XC 2Y9XE 1K5UA 5BQUA 1JLYA 1MD6A 2DRZA 4AN6A 1ABRB 1ISVA 3FJIA 2FFUA 5GAQA 2FGFA 3CRHA 3AKIA 3BX1C 1E0OA 3VSZA 2ZR1B 1DZCA 4LO3A 4J2SA 3CA0A 4XFUA 1AVWB 2NM1A 5F8YA 2VUAA 1L2HA 3BA4A 3ZC8A 3BAUA 3BTAA 1Q1UA 3FJAA 3N7LA 4Q9PA 4GAIA 3BADA 4DEPA 3PUBA 4JQ0A 4ZFWB 7I1BA 3OGFA 3PMEA 4EFPA 1BA7A 41BIA 1CE7B 2K4AB 3K1XA 1BFBA 3BAHA 1SR4C 1YBIA 1IHKA 4P0JA 4LO1A 3AJ5A 4USPA 1W3GA 2Z48A 1S0GA 4LO7C 2E4MA 1G9CA 5FZZA 5BQUC 4J2XA 1IILA 3Q7XA 5DZUA 3BB2A 4ISRA 5EHAA 5D62A 4EFQA 1DIWA 2VU9A 3CA1A 1A8DA 4I8MA 1S0DA 4KEKA 4PC4A 4JRAA 3QR5A 4X39A 1M16A 1ISYA 1FQ9A 2Y9FA 2Y9WC 3H6RA 1NUNA 4QKRA 1TP0A 3V0AB 2KLLA 3JRRA 1W3AA 3A22A 4I4YA 1PWAA 1R8NA 2P39A 5G00A 4F83A 1WD3A 5BXPA 3MALA 3N7KA 2D7IA 2BEAA 1TWMA 1TTUA 3VWCA 2AFGA 1T4QA 4I37A 3FGMA 2MLLB 2MC2A 3PHZA 3FJDA 4LO8B 4LO1C 4QBVA 2IWTB 2HWMA 3A07A 2QYIB 4GOYA 3N0KA 3AH2A 1Z2VA 4EKXB 2E4MC 4L4IA 1RMLA 1BARA 3B9UA 2GZBA 3VSFA 1IJTA 2DRYA 3IM7A 1F31A 3E8LC 1PUMB 3O4OA 5DSSB 5F8WA 4I6IA 3RTIB 4I4RA 4P6AA 3UDAA 2RSTA 1FV2A 3FJHA 4A7ZA 1R8OA 2D24A 2VSAA 3LTQA 1SR4A 4I4OA 4I4SA 4QALA 1HIBA 4EB2B 1RY7A 3NJ5A 3VUOA 1BLDA 1TWEA 1XZZA 3FUOA 4IY9A 1QQLA 3AKHA 1MC9A 1KNMA 4I4UA 3ZXGA 2NYYA 5BOWA 1V6XA 5BXTA 1YF8B 1TIEA 2BEBA 1JY0A 2NTDA 3V0BB 2AXMA 3R4SA 3OGGA 2K43A 1S0FA 2Z49A 4IZEA 4EFRA 1QXMA 3WINC 4P0KA 5HPZA 3BRGC 2Q9XA 1DLLA 3PG0A 4YOLA 1DQOA 1JLXA 3UD7A 5JLVA 5FNWA 4I4PA 1CVSA 3LLPA 5I1BA 3VT0A 1AF9A 4XFSA 3RMYA 3O4AA 4IYBA 1S0LA 3V0BA 2IHOA 2KI6B 3ZX7A 4OW4A 4L4HA 2FO1A 3FFZA 3FJEA 4Z9WB 1JT3A 2MIBA 4P0LA 4JAWA 4J2KA 1S0EA 4I2SA 3POKA 4G6JA 1TFMB 4USOA 3HALA 1DQGA 3CA6A 4OEEA 3BA5A 3IM5A 2VSEA 4IQPA 4OUJA 3HN1A 4KEJA 3F62B 3CA5A 4IY8A 3H6RB 1TOOA 4XFTA 5EC5A 3FUQA 1QQKA 1M2TB 4OWKA 4I4XA 4I96A 4ZBVB 4Q91A 1FWUA 2WRYA 3P6IA 4OEGA 4GOVA 1BLAA 2HZ9A 1HWPB 4FGFA 4JP0A 2M49A 3BAQA 4J23B 1T9FA 4OWJA 1W3FA 2F2FC 3Q7YA 3P6JA 3ZC9A 4ZGRB 3H6QA 3ZXDA 3RSJA 5BXSA 1OQLB 1IRAX 4G1RA 1G9DA 1FGAA 3AH4A 5DUYA 2QN4A 1IOBA 3FJFA 1JTCA 3O44A 1V6UA 3VEQA 1HWOB 3FJBA 3CRIA 3UJ4A 2DS0A 3A23A 1HCDA 1S0CA 1AVXB 2AAIB 4KC3A 5EG6C 4I4QA 4D0TA 4TLPA 1DJSB 4ZKTB 1J0SA 6I1BA 4DCKC 4I1BA 1WBAA 4JKQA 2X2TA 2D20A 3WINA 1BFGA 4ENDA 9ILBA 4OEFA 4KBBA 4CJMA 3O4DA 2ERMA 3FJCA 1IT0A 3F1RA 3H6SE 3O5WB 3BAOA 2FDBM 5B2HA 1EPWA 1VCLA 2AQZA 3AZWA 4GAFA 2RG9B 1BFCA 3CRGA 1JT4A 5F8SA 3RMXA 3AH1A 1AVAC 4I0YA 3D7WB 2ESUA 2LIQA 5BVPI 1G9BA 1ISZA 1FWVA 2DREA 1DFCA 2R9KB 3BRFA 1Q03A 1Z4SA 3BRDA 1EYLA 1AVUA 3CQAA 3OJMA 3A21A 2L5XA 2KI4A 1DFQA 1AXMA 4ZFUB 5BXRA 1GGPB 3N7JA 4KEIA 1BFFA 4A7YA 3MPPG 2ET2A 1FV3A 1JQZA 3T8SA 3NBDA 3RTJB 3AZVA 3Q7WA
chains in the Genus database with same CATH superfamily
1UCRA 3LA3A 5J8CA 4RAYA 4GP0A 1F9NA 4X37A 3L2UA 2LRDA 3FMQA 3GF2A 2D1ZA 4YIFA 3CO6C 3CP8A 1I1BA 3PUFA 2JN6A 2KP6A 2RQ9A 4H04A 21BIA 1HKQA 4AVZA 4HF1A 4NDLA 2IA1A 1K5VA 1OJLA 4O3MA 1VQ9I 3A4CA 5LGTA 2QWWA 2IGKA 3F8NA 2EFNA 2OA4A 3FBIB 2DA4A 2Y0SA 3OIQA 2CV0A 4GP3A 3FJ8A 3HIFA 4ISQA 5JVGF 3MKWB 3KYLA 2O8XA 2QQ8A 1Z6RA 5AIQA 1P9QC 3WTZA 5EEAA 1UMQA 2EPFA 2UUSA 3L9FA 1WJAA 3CF2A 3OSFA 4N4OB 4I3NA 2V6CA 1AFCA 1LNWA 1UB9A 2K4BA 2XGDA 1HKNA 5A2QZ 5D5VB 2XASA 2EZLA 1X1CA 2WAQN 5JLXA 3FJ9A 2EFQA 1BASA 3HHHA 4RGRA 2GXGA 4RM3A 2F48A 1JHHA 1S0BA 1PYVA 3CF5F 2V9KA 1ZKGA 2VPRA 1WD4A 5HS9A 2XOAA 3F22A 5K7HA 3OJ2A 2Y9GA 1MBFA 2XSDC 2HQRA 1XS9A 1TP4A 3GZ6A 1TW3A 3WTSC 2EIJH 2WY7Q 4ZYHA 2CH0A 2LMDA 1RI7A 3LSGA 2DA1A 4HR6C 4JKXB 4AN7B 2R5YA 2X0LA 3ZQLA 4GDFA 3JTGA 4UUVA 3H9QA 1R00A 1TWFJ 3K4JA 3U9GA 2HDCA 2ZFWA 4G9YA 1ETWA 1RR7A 3HXLA 3IHUA 3K1PA 1DP7P 3AG4H 4MTDA 1XG6A 3UD9A 1YE9A 2IJLA 5HLHA 2CJJA 4ENNA 1R49A 3JSOA 1PUUB 3QODA 4ZA3B 5F0HA 3I59A 4I0AA 2D22A 4BKXA 5L3FA 1T0FA 4HBLA 1J75A 4QO3A 4LO3C 3C3WA 1OMIA 2H09A 1AKHB 3AKGA 2MLKA 4DNCA 1XSDA 1D1BA 5ICCA 3K4NA 3IP4B 4Y13A 2QA4I 1A5JA 4LO2A 1B8IB 4FT8A 3RYPA 4BDYA 5CPRB 1DDNA 3KLOA 5C3EJ 1ISXA 1X1AA 3FM5A 1FOWA 4I01A 5FKLA 4U0VA 3TBIA 2MC4A 3OYJA 4CZZA 3RZDJ 2D7RA 3GYHX 3CA4A 3WO3A 4HF0A 4Y15A 1BR4A 4LD5A 2O0YA 4M3EA 3CUQB 3ERMA 4B09A 1XYFA 1S3JA 5IYDJ 3CTAA 4XQFA 2ECBA 4ESFA 5GAEJ 2DFIA 5EF6A 1W5TA 5FZYA 5EG0A 4Y52J 1ACIA 1X3UA 1TTYA 1EVTA 4R8HA 1G9AA 1ONVA 3NWTA 1YW8A 2YS9A 3A0HC 2EFWA 1JXSA 3FJKA 4XKVA 2W00A 5FZUA 1XCVA 1NZKA 1P4AA 5F1JA 3EUAA 1SANA 4RGUA 4AIKA 1VQ4I 2P8TA 3T5XA 1H0MA 3E5XA 2X4HA 1MMDA 1T95A 1S72I 3I5UA 4MZGB 5D63A 5L3EA 2MYSA 4FETA 1EF4A 2YUSA 3E6BA 3NARA 1FMZA 1MMAA 1F5TA 1IRFA 1KU7A 3BJOA 3GTOJ 5J40A 4IHZA 4D8HA 1MMNA 2OTJI 3IRQA 2IBDA 2D44A 5HLTA 2L4AA 2M8GX 2ZXIA 2P23A 3AKFA 3CCMI 2VQLA 1Q1VA 1RETA 3M4OJ 2LH9A 5EJCA 3LSPA 3BY6A 1V5GA 3O2PE 4YIRX 1H9TA 1P63A 5KVRA 3OBRA 5LGNA 2F8XC 4JPZA 2K9QA 4QC4A 4MFEA 1I1GA 1MD6A 2WY8Q 3F8FA 5J1YA 3B6CA 1ABRB 5BQUA 1KU3A 2LKSA 3EUHC 5GAQA 2FXAA 2FGFA 1QNTA 2XV4S 2W24A 3AKIA 2LK2A 1O3RA 3BTCA 4BXFA 2VT3A 5CVIA 4OOIA 1WJBA 2ZJRF 1LQ1A 2D5VA 4XORA 4KICA 2EA2A 5ERIA 4E6KG 2KKOA 5HDKA 4BEHA 1UG2A 4XFUA 1IG7A 1HKSA 1V5EA 3H5RA 2RQPA 3QAHA 3HSRA 5ICFA 4S05A 2ECCA 2R5YB 4G6TB 3BP8A 3HRSA 4XLEA 2HVSA 2HPIA 3AG3H 3ECOA 3PIOF 3DTKA 3FK6A 3GWZA 3IV5A 1OCZH 2ZSIB 1MBHA 3WE3A 5D6EA 4JQ0A 3TEDA 1BW5A 2AQEA 41BIA 2M8EA 3LSKA 2CGPA 2R7TA 4A6EA 3I59B 1BFBA 1SR4C 2Z9OA 3Q3SA 3T8RA 3OYGA 4CCOA 4ZTFA 1HXDA 4OIOF 1Z7UA 3OYEA 4CGZA 4LO1A 3G6EI 2WA0A 4BYYA 1V5FA 2RGVA 4D7MA 1YIJI 5HVQC 3AKZA 1QVUA 3VYSB 3HOXJ 3GTMJ 1S0GA 2LREA 3QOEA 5FZZA 2WV0A 4C2TA 4BHBA 2WAQA 2Z1DA 1R1TA 5EHAA 1DIWA 2I5UA 2A68F 1YX5A 2O3FA 4XLNF 5J8FA 1PUFA 3IAM2 4NHJA 1EA3A 1MSEC 4D0PA 3S1MJ 1J7KA 4X39A 5IOYA 3WE2A 4ZDPA 2COMA 4WX9A 3KLNA 3TMOA 4IRHA 2CUZA 4ZC3A 3ULQB 4MZHA 1NUNA 4XOTA 5GAHJ 3OYAA 4CYDA 5EG0B 4QKRA 2DOEA 2IAIA 1RPWA 4A6DA 4M9SA 3RZOJ 3KP6A 1B4AA 4CCKA 1KGSA 2V26A 4XMYA 2ADUA 2M5WA 5GPAA 1PWAA 1OISA 1T6SA 4AD9A 2ZMEC 5G00A 2EILH 2JPCA 5BPIA 4HX4A 5TJJA 1T2KA 1FTTA 3MALA 2CW8A 3VOEA 1IRZA 2D7IA 2BEAA 2CSOA 2HKXA 4I37A 2MLLB 3IH2A 2XAJA 4PCQA 1MBGA 2XAFA 1NK3P 1TT0A 3EQLF 4BBSJ 4CYCB 2RC4A 2HWMA 1GDTA 2RREA 1SD5A 2STWA 4G94A 5IYBJ 2YR2A 2K3FA 4MTEA 4V2FA 5CYVA 4LB6B 3J7YJ 3ECHA 3K4MA 1U8BA 1IGNA 4NB5A 1XGOA 1YTYA 4A3GJ 4OU0A 3B9UA 2DI3A 5FD6A 2VBZA 3ZQGA 3WU0A 4D7NA 2KIFA 3GTJJ 4IHTA 2NS0A 3GFJA 2ELJA 4EM0B 1JHFA 2FOKA 1O57A 1EJ9A 3HJEA 3O4OA 4I6IA 2EV0A 2CV1A 4RB0A 1JTYA 3F6VA 4PJNA 2XAUA 5LBQA 4IHXA 1J2XA 3I3LA 4UB6C 1FV2A 4LGWA 2RSTA 3UDAA 4XKBA 4MLOA 2VSAA 3DCFA 2NRAC 5IP9J 1KU2A 4QALA 4EB2B 2NNYA 1BJAA 1BLDA 3HOVJ 3FUOA 3TP0A 5HLIA 1ZGJA 2MG4A 3IH4A 1KNMA 3ZXGA 2WADA 3HYIA 4RDUA 1HW5A 3HRUA 5E1ZB 3I4PA 1YF8B 3CCSI 2CUJA 2BEBA 1X1BA 3FWEA 1PJRA 2EZKA 2NTDA 2CU7A 2AO9A 4II2A 4NNJA 1OR7C 3JRCA 3H9JA 1OFCX 3MQ0A 5E8GA 1BOAA 1SFKA 4M6XA 3WG9A 3F23A 1QXMA 2M30A 1HCRA 3A03A 1S6LA 5FRNA 4XRSG 1ETVA 1DQOA 4M3FA 3W6KB 2LG4A 4PZJA 1A35A 3UD7A 1LVKA 5JLVA 1MBJA 5DV5A 2WBMA 1CVSA 1V54H 3OWTA 1T56A 3OYHA 1AF9A 3F0CA 3DEWA 4PFPA 1Y6IA 2QF7A 3O4AA 4H75A 3V0BA 2QSFX 2A05A 4E7KA 1U5TC 1H89C 2VC1A 2HKOA 3I9V2 4BAYA 1MH4A 2XDVA 1I5ZA 3WU1B 2OCCH 2R4GA 1JT3A 2L9SA 3HL2A 4J2KA 2R5ZB 1S0EA 4KIBA 3HZJA 1PUFB 3FX3A 1SAXA 4XONA 4ITVA 4BHPA 2O7OA 1REPC 1LUJB 2NOJB 4ZZDA 3KZYA 4USOA 2F5FA 2P6TA 1DQGA 3CA6A 2ZSHB 3BA5A 2LY9A 2VSEA 3HN1A 4UVAA 1Z3YA 5DD4A 3F62B 4U88A 3GX4X 1TT5B 4EJOA 5IY5H 1FYLA 4AM3A 4ASNA 2VPLA 1QQKA 4OWKA 4I4XA 2F5EA 3E3VA 2K9SA 1GLNA 1ON1A 4C3JJ 1V3FA 3JRHA 4EGYA 2ZNYA 1VTNC 2JA8J 1BLAA 1HWPB 4CXFA 4JP0A 2VLAA 2FUG2 3R61A 3BJ6A 5DD8A 4PJJA 2M3AA 2H94A 2R7QA 3JCUC 4ZGRB 4YFNF 2D1HA 3RSJA 3CC4I 2BW3A 3FXMA 4UUTA 2L9NA 3EPZA 2L01A 1WI3A 1FGAA 3N05A 3AH4A 1T08B 1BIAA 3O44A 5EZHA 2LLKA 5B3SH 3WU2C 2BY1A 3CCLI 2OZUA 1VF9A 5E8IA 1BI1A 1WQ2A 3I53A 1HCDA 4KC3A 4D0TA 1ULYA 3O8GA 2XHKA 4CA0A 5GTHC 5A2QK 2DA2A 2HI3A 2F5DA 2LNBA 3SQNA 2OQRA 2Y31A 2XGXA 5CVRA 2GA2A 4UVBA 4ENDA 4OEFA 4KBBA 2IGMA 2Z3YA 3PQKA 3ESWB 3FJCA 1D5VA 4XK4A 2A61A 1IT0A 2UXNA 1R1UA 1F1ZA 1TQIA 2X85A 2YU3A 3BAOA 5B2HA 5CVVA 4YIIA 4DBQA 1ETOA 1VCLA 1QZZA 2FU4A 4GAFA 4BGDA 1BFCA 2KRFA 4OINF 3CRGA 1IRGA 1VQ6I 2B0LA 3AH1A 3JRBA 1ZGWA 2DPDA 4P55A 3RDIA 5DDGA 1ZRCA 5BVPI 1FWVA 4HW0A 3OL3A 4PK4A 1T98A 1G6NA 1D1AA 4XNFA 1K61A 3GBGA 3AL0B 4IX7A 2FE3A 1AVUA 2IGOA 2LY1A 4PFOA 3CQAA 1A6IA 1FPQA 1K78B 3HM5A 2DCEA 5EZGA 5JHUA 1GXPA 4CICA 2RAEA 2HTSA 4F91B 5D5UB 1B72B 1D5YA 1RKWA 4QTRA 1GGPB 3ASNH 1BFFA 1QRYA 4A7YA 3GLXA 3NWSA 1FT9A 2ET2A 1JQZA 1AOYA 5HS7A 3T8SA 3MFKA 1RUNA 3H1CA 4NC6A 2DW4A 3AZVA 3ZN1A 2DN0A 3K2ZA 4DZJA 4II0A 3NBNA 2ME6A 5IT9Z 2LOOA 4MQ9F 1RKTA 2PMZN 1YRNA 2DMNA 4HSTA 4MHGA 1X19A 2QVOA 2MH2A 3CLQA 1USSA 3Q9VA 5F0CA 2FX0A 1MZBA 5E79C 3CDLA 2PMHA 2C6YA 1BN5A 2M34A 2X6XA 3RPQA 1FOXA 1ON2A 2LBFB 4PJMA 5E3LA 1KQ9A 2DLLA 2LR8A 4L9NA 3JAMZ 2XIGA 5BS6A 3ZQCA 3HMYA 4F52A 3WO4A 2L7MP 4I0BA 1D1CA 1IUYA 4XKIA 3PL8A 2F6CA 1JKOC 2HOSA 2COBA 1Q1HA 4HNUA 1S9HA 4E7JA 4HSRA 2UUZA 5F90A 2OF7A 3SFZA 2K9NA 3IL2A 1RG8A 3W9TA 1VQ8I 5FD5A 3CMAI 2XRNA 4ZFYB 2BW3B 4IVNA 5LEJA 1T39A 3IAGC 4X0GA 3CJRB 2FNPA 3CU1B 2P81A 4HF2A 2Q1ZB 4D5FA 4U7DA 5KHDA 1FC3A 4I4VA 4MFDA 2NP0A 2CQNA 4XLAA 3MN2A 4M72A 3WGGA 2HDDA 4I09A 1Q04A 5C4XJ 2R7OA 3BR6A 3KIOA 2DXIA 2KKIA 3C9ZA 2HTJA 5ICEA 2R7ZJ 1CQTA 3FJJA 5D61A 1V6WA 3I2AA 3RCOA 2PEXA 4IL6C 4GGGA 2OD5A 1Z0HA 2L7ZA 4U7BA 3I55I 3B6AA 4CSWA 1FEXA 1JI8A 4IONA 2KZVA 2OQGA 3PSIA 4D0ZA 5KNLA 9ANTA 4B47A 2UXXA 4GXOA 1P7JA 3S1RJ 2XROA 4DENA 4JX4A 4G8XA 4I7IA 3QPSA 5TRDA 2ZQNA 4LLNA 4QD2B 1I6HJ 3CCYA 3BZCA 3TW7A 2KQRA 4XN3A 3CCQI 3KP4A 1RUOA 2MBFA 4DYQA 2NVXJ 3UD8A 1XHBA 3RTRA 1PP7U 4ZLBB 2OCEA 2X6OA 4PSWA 1SZ6B 4EEEB 2MW8A 3GXOA 3BAVA 1ZG1A 3K9TA 2FF4A 1YI2I 4WWCA 3LQRA 1J9IA 4LG0A 2YSRA 5KCMA 3WGHA 4IHVA 5K5RA 5J1RA 3OJVA 3EYYA 2GAUA 2K27A 1N77A 2O8KA 1KA8A 3ILAA 2JA7J 1W0TA 4EJTA 2NVYJ 1K79A 1TNSA 1WJEA 2EV6A 1B8IA 1LFUP 2DU9A 1JGSA 4MEYF 4G9NA 3V0AA 1IN8A 2FBHA 2DT7B 3EUKL 5BP5C 1DP3A 1G8XA 3RSNA 1QBJA 4I1EA 4YRVA 1G3TA 4LK0F 1MMGA 3LSIA 1MJBA 4A3CJ 3ZCOA 2VXTI 2HFHA 3CUQA 1HBXG 2XGEA 1FBQA 3CA3A 4KIFA 2ZJ2A 4BE2A 1U3EM 2HOAA 3S1NJ 2BGCA 3S2DJ 1D0YA 3UKGA 1JKPC 2RKHA 2LIEA 1NHAA 2VE8A 4J00A 2PBIA 4FASD 3F9KA 3ABUA 4A3JJ 4Y3OA 4HOBA 1CF7A 2EV5A 5M3FJ 4IZXA 3SFIA 1H88C 2A6EF 3QYEA 1ZHFA 4PJ0C 1W7PB 2FA5A 5E3NA 1O3QA 1AWCA 2YX7A 4RA2A 3BOQA 3V7CA 4B48A 2VLCA 3GZ5A 3IC7A 3COAC 4UY4A 1LEBA 3VDXA 4IRGA 2VT2A 3KE2A 3CZ6A 5JMCA 1ZELA 1TW2A 4YELA 3V42A 1WJFA 4C9YA 5EDNA 4PGGA 2KJCA 3E6MA 5K5OA 2OU2A 2M9HA 3D1NI 2DRZA 1F43A 3LSTA 2W84A 4HQMA 3M8JA 1DU6A 2ZO4A 2XPVA 4MIMA 5D5XB 4A3EJ 4U0YA 3U1DA 1KQ8A 2JVHA 4BH9A 2DFFA 2NS8A 1FX7A 2R7UA 3D5SC 1E0OA 4H0EA 2ZR1B 5AONA 4XKWA 2DDBA 3ZQIA 3GLLA 2K40A 3BQYA 3F21A 2FMYA 3HDDA 1ZYRF 1Z9CA 2XAHA 1M1EB 1L2HA 4U0WA 3FF5A 4HA8A 5JFRA 4A3IJ 1NTCA 5LD2C 3BTAA 4DOZA 1XTAA 1OYYA 4TV7A 4ZYAA 1Q1UA 3FJAA 1MJAA 2A5WA 3HPGA 3HPHA 2M7AA 3ZQ7A 4Q9PA 4GAIA 2XB0X 3BG7A 4ZDOA 3BADA 2WB1A 4U87A 3JRGA 1L3LA 2P4WA 3FMRA 3OGFA 1BA7A 4EFPA 2X48A 2CQXA 4M74A 1CE7B 3HUGA 3DEUA 4QIWN 1E0EA 4O6JA 1SEUA 3OR1C 5FROA 3CJNA 4UV8A 2ETHA 3PNVA 3KYCB 5M5YJ 1TWGJ 3R6SA 2M1BA 4KMFA 3DFGA 1IDYA 1ERDA 2Z48A 2VQGA 4WXDA 1HSJA 1EH6A 3G1LA 4FX4A 1MD0A 1R5HA 3E7LA 4IXAA 4LO7C 1YFHA 2E4MA 1G9CA 4OAYA 3QRFF 2WAEA 4F3QA 1HQCA 4EFQA 4XRMA 4PJLA 3KZIC 3TW6A 3LSJA 2TRTA 4LG0B 4KEKA 2VODA 3BTJA 2NS2A 3SXYA 4XKCA 1TWHJ 1FQ9A 3GZNB 3UNGC 5FGMA 1U2WA 5FKOA 3H6RA 2KPMA 2DJNA 3VSLA 3I64A 1EV7A 2KRHA 4QSHA 3V0AB 3BTIA 1LDKB 2PN6A 4IHYA 3JRRA 1O7LA 3VODA 1BL0A 5KAFC 2P39A 1D0ZA 3L1PA 4CCLA 4F83A 3J81Z 4I76A 1UHSA 1R4MB 1QZYA 2O9LA 4N4NB 1ZR2A 4LIUA 5F64A 3N7KA 5E3OA 1TTUA 1E2XA 1FYKA 3VWCA 5LRRA 3L2RA 2NVQJ 2BYVE 3HKZA 1X2NA 3QQAA 4MO7A 2KDZA 1JTXA 3DBRB 3FJDA 4LO8B 3OYNA 3H35A 4QBVA 2DT5A 4Q47A 2IWTB 3GFMA 1N25A 3R60A 2BY2A 3F6OA 3OYLA 1CF7B 4PGHA 5GADJ 1DPUA 4EKXB 1Y0NA 3I54A 4PDKA 4L4IA 4X6AJ 1Z0XA 1RIOH 2IA2A 1KU9A 2D2WA 2DYRH 5IPAA 2IS6A 3QP6A 1RMLA 3H3UA 3KZZA 1LE8A 2P5KA 1X1PA 3MKZA 3EYIA 2GZBA 2DRYA 2IEKA 2L5QA 1C0WA 1G3SA 3SEQA 3GCMA 1PUMB 1DPRA 1G59A 1QPIA 1UHWA 5F8WA 4CYCA 1HW2A 3HOUJ 3PO2J 4LITA 4I4RA 3M8EA 2CW0F 2HQNA 1Z05A 2IP2A 3FJHA 1OCCH 1BM9A 4XSXF 3J7AY 1R8OA 3LTQA 2IS1A 2BXYA 3G3ZA 2DAOA 4I4SA 2PI0A 1FWZA 3CMYA 3NJ5A 3G1OA 3LA7A 4GFBA 4CDGA 4IY9A 3OYMA 3DF8A 5E3MA 3OV8A 1IV8A 2E1MC 4LJZF 5BOWA 4UB8C 1TC3C 1Z6TA 5BXTA 4AYBA 3BG5A 1TIEA 2HNHA 3VPRA 1K6OA 3VYRB 4BXXJ 1JY0A 1ODDA 2KT0A 4XOPA 1HF0A 1TWCJ 3OGGA 2K3PA 4L5EA 1BIBA 2L2OA 1JJ8C 1RNLA 3ZQQA 4P0KA 1R6RA 1OPCA 1TLHB 3S15J 3KP5A 3JRFA 5BNGA 1XGSA 3F8CA 1MBKA 4ENMA 3G1MA 5FNWA 3HUGB 4W1UA 2KLOA 5F0FA 3V8JA 2Y9YA 2DPUA 1UZCA 4I4PA 4A3FJ 5I1BA 3FXKA 4XFSA 4CCMA 3RMYA 3RKQA 3JTHA 3ZMSA 4X1EA 1ZG3A 2X6WA 4YG2F 4RLQA 2E7WA 1IDZA 1S0LA 1FLIA 4DJAA 1U8RA 1MNMC 4RLFA 4MZFB 3PSFA 1ETQA 3ZX7A 4OIRF 2MH9A 2X9DA 1OYIA 4AU7A 1KYWA 1KYZA 4P0LA 1XG1A 3P5JA 2R7VA 2QGUA 3Q9SA 4IZZA 2CFOA 2H1KA 1TFMB 4XLHA 1DGRM 3HALA 1OLTA 6PAXA 1QA6A 3FHZA 2BVMA 3IKVA 4P1WA 4P9UA 1QZEA 2HR3A 4OUJA 3DU6A 4IY8A 1VQLI 1YJWI 3H6RB 4XFTA 1OQYA 5EC5A 2B63J 1M2TB 3TDZC 4XSZF 2I8DA 3L00A 2PLYA 2R5ZA 4OEGA 4LMYA 3S2HJ 5IT9K 2DTRA 3E6DA 2EINH 4R79A 4UHTA 3WHBA 3NRVA 3PM1A 2OJED 4AWXB 1FBSA 4IKFA 1Y1VJ 4RAZA 4ENJA 4I02A 3MEXA 4CO8A 3I71A 3H6QA 3OOPA 5HNHA 2KIMA 2IXSA 4ZYGA 1XPXA 2MD5A 1U78A 2QN4A 5E1XA 3FJFA 3DP7A 2VKEA 2HYJA 4BY7J 3JAMK 3D5RC 3I58A 1HWOB 2JA2A 5C44J 2N8GA 3FJBA 1SFEA 3CRIA 1LB2A 3OYDA 3W3CA 2DS0A 1GT0C 1S0CA 5EG6C 2JMWA 3OYIA 1W7PD 2XB5A 4WCGA 1E3OC 4I4QA 4RM2A 2E35A 1DJSB 2EA4A 4ZKTB 3P9KA 1J0SA 1LE8B 4HNVA 3CQZJ 5ILUA 4DCKC 4DZPA 4I1BA 5EEHA 5EGOA 4AIJA 5HDGA 1WBAA 2X2TA 4BHCA 2L3DA 3LAPA 1K6YA 4LLGF 3F8BA 4BACA 4ABZA 1BFGA 9ILBA 5AIPA 4QPOA 3MKYB 4KYWA 2DOAA 3M07A 1ZREA 2XUBA 4L9TA 5JLWA 2JJ7A 2VBWA 4LOCA 1EPWA 2VKVA 3L2CA 2JT1A 3DKYA 4HPQA 2GXBA 1JT4A 1G3YA 5CLSA 2R93J 1GV2A 2LIQA 1QHGA 1XN7A 1ISZA 4L0ZB 3BROA 2R7SA 1JE8A 2DREA 2H8RA 3FXLA 3ELKA 4PUSA 3G4SI 4IHWA 2HDWA 1W4MA 3W2WA 3WODF 1A31A 3WTXC 4EV0A 4Y4RA 2E2JJ 3M9AA 1BR2A 1EYLA 3HG9A 2KIQA 3OJMA 1FBUA 2LC2A 4UVCA 2RN7A 3A21A 1WRJA 3CJTB 3V4GA 4ZFUB 3BQZA 3DQVC 4G6DA 1D8KA 2AS5F 2E1OA 4UUSA 5DYMA 4XBFA 2P5LC 1I27A 3HEFA 5L3BA 4XIDA 3RTJB 3Q7WA 2VKDA 3SZGA 2JA5J 4C2MJ 4KN7X 1EH8A 2PJPA 3K10A 1SVMA 5F08A 2NXNB 3FKJA 1K78A 4FVVA 1K7AA 4Q4ZF 5LGUA 2NVTJ 5JI6A 1B72A 2Y75A 4EVIA 2OTLI 2DDAA 2XF7A 2ME0A 3UJ0A 2FBIA 4FISA 1U6GA 2P6SA 1FJLA 4F93B 4LIVA 5CVUA 4J19A 3J80Z 4HX7A 4E7ZA 4WXHA 1JT5A 1IO2A 1R5ID 2H8WA 1TQMA 3RJPA 4IOAF 1NH3A 2RQQA 3PNTA 4HJJA 4LFUA 1BBYA 4UXNA 3JRDA 1ILR1 2JZYA 5BOXA 2HOEA 1FOYA 3ZMZA 4BXUA 5EEGA 2V6EA 1IC8A 4L0YB 2X1DA 3CUQC 3A1YA 1II4A 4M3DA 4CHUA 2VASA 2DK5A 1YYNA 2LBFA 2V79A 5HLGA 4ZOTA 2Y69H 2L0KA 1BOBA 4HAMA 1GUUA 2VQCA 5J47A 3TC2A 1WSUA 3BAGA 3GVAA 3BT9A 1S29A 3HOZJ 4RGXA 3DXJF 3MAJA 3VT1A 2R7RA 4MNUA 2VE9A 3C18A 3GTKJ 4G9MA 1IXSB 3O4BA 2ISYA 2XAQA 3BJAA 4HEA2 1V6VA 3DPTA 4V2GA 3CAHA 3N7MA 3S8PA 1UFMA 2RVCA 4H4KC 2VJIA 4J2YA 1KONA 1JJ6C 4H9WA 3ZMUA 1XSVA 2M4GA 3ZXSA 2IRFG 4F34A 1XMXA 3X2QH 4OWLA 3OR2C 5EGOB 3R0JA 1XGNA 3Q0UA 3V8KA 4GO1A 3OS0A 3BG3A 4LB5A 1FMMS 4QKSA 3CESA 3VYTB 1LFBA 3R4UA 3I2XA 2Z16A 3BZKA 1IRPA 5D4SA 3VWBA 2M4KA 1EV2A 3LWFA 3KP2A 1B9NA 1FN0A 2BVLA 1XC5A 1Y1WJ 4M3GA 4P5OA 1Y56A 2VI6A 1GV5A 2BHYA 4DQ2A 4UV9A 2ZKZA 8I1BA 5E24E 2QKMB 3ABMH 3BPVA 2EFPA 2K7LA 2O5RA 3CP2A 4UY8I 3O4CA 2HEOA 1D0HA 2VB6A 4RB1A 2MFZA 1BI3A 2GQQA 1PUEE 2LD5A 3C2BA 1Y39A 3TQNA 4IHSA 2IW5A 4LO0A 3WO2A 3RKXA 1MNEA 1HLVA 2DT6A 2HXIA 3HOYJ 2HXOA 1KZHA 3JRAA 3CC2I 1B6AA 4KT5C 1MDMB 1FIPA 1QO0D 3LMMA 1R71A 2NZ9A 2BEOA 3S1QJ 1JUSA 1A04A 5B1AH 3OS1A 1JT7A 4CCJA 2GZWA 2QENA 3S3NA 1SD7A 2XF6A 4IF4A 2JUGA 3PIPF 1YITI 2NYXA 3DEEA 4QBCA 2LY2A 2IGNA 4XN0A 2V9PA 2YUGA 3NBEA 1LFPA 2L7KA 1R9TJ 5GP9A 3ZN0A 2ISZA 4CCNA 1W36C 4UUSB 1UPSA 2HW9A 3KP3A 1PC8B 4HZFA 2GO2A 1QQIA 4B8XA 4ESJA 1DZDA 2FFVA 4IPAA 1SD6A 1DQUA 2VJ5A 3KX2A 1YW7A 5IOZA 3IIRA 1QVTA 3ERED 3SNVA 3CJQB 3P9IA 3HSEA 1O4XA 3V7RA 3IM6A 1BR1A 1B1BA 3DPUA 2KFDA 2B7EA 3KEQA 1P2FA 4M6YA 4R1HA 4LO7B 1T0FC 4HA2A 1HOMA 3FISA 3WA1A 1XCBA 4X38A 2A07F 2ZCWA 2DYSH 2GOXB 4BU2A 5L3GA 2BFHA 2MA3A 1GXQA 2CQKA 3TO7A 5M3MJ 1NG7A 3N97A 4KNYA 4WBCA 5DVHA 1FMVA 4LO2C 1HWNB 3HOMA 4BBRJ 3LSRA 2CW7A 4RB2C 3J81K 4HQEA 2Q8KA 2NVHA 2DA7A 2Y0SN 5FLMJ 3K4BA 5L3DA 3GW2A 1FSEA 2DOFA 3RQ4A 2D23A 4D5CA 4EJVA 1ISWA 1YXWA 3NBCA 3HBLA 3S93A 1JLYA 2WWYA 5DUKA 2DODA 1BJZA 2W85A 2FFUA 2P7VB 1LEAA 2IPQX 4B1RA 3EETA 1MSFC 2E1CA 3CRHA 3D5LA 1W7PA 1VQNI 2CFXA 5H20A 5FKMA 3BRGC 1AHDP 2ZC2A 1FNNA 1S8NA 3GUDA 1Z91A 3G71I 1DZCA 2VC0A 3IWZA 4B3AA 2ESHA 2HU9A 1ZRFA 3CA0A 2JUCA 3GO5A 2NM1A 5F8YA 1BW6A 1O7FA 3TP3A 1HDDC 1IZ1A 3BA4A 3ZQFA 1N75A 3ZC8A 4XR6A 2IT0A 3BAUA 2JA6J 2ZMEA 5DCMA 5FLXZ 2ELKA 1MNDA 3G2BA 1OCPA 3QU6A 1G3WA 4ZFWB 5D8KB 4DEPA 1WCMJ 1QPMA 4KISA 2K4AB 3BAHA 1MIJA 2KIUA 1YBIA 1IHKA 1YIOA 1ZN2A 2LF8A 3K1MA 5M5WJ 3HOSA 3ROUA 2QLZA 4CZCA 2GWRA 3DKXA 4HG2A 3V8LA 3V7SA 5GTIC 4Y17A 3C1DA 3OYCA 5BQUC 4J2XA 1IILA 3OYKA 3LAJA 3Q7XA 5DZUA 1XMAA 5D62A 5FFZA 3K69A 3H0GJ 3ONQA 4IEJA 3FXOA 3HTUA 2X1CA 1S0DA 3WHCA 1G4DA 1I3QJ 2FD5A 2UV1A 3QYFA 1BI2A 5E18F 3J7AO 4JRAA 1ZLJA 5K7FA 1ISYA 3RKYA 1Z77A 4BQAA 1SFUA 1YG2A 5J3LA 4KFCA 2DA3A 2Q2EA 2Y9FA 2DJIA 3T8TA 2Y9WC 2P0WA 4JBAA 3R0AA 4FCYA 4I2OA 2KLLA 3F3XA 3HOTA 1W3AA 3A22A 2AHQA 2HOTA 4A69C 3M1CA 3S2WA 1WHUA 4EMSA 3A01A 1WD3A 4ESBA 1J0RA 5BXPA 1R22A 1IRXA 3M1EA 3BCAA 3HSFA 2GOMA 4DBRA 3TDUC 2ZJPF 4FX0A 3RPUD 3BR5A 5H6QA 2BHZA 2MC2A 3ML6A 3H0DA 5LHGA 4LO1C 1MJ9A 3DBHB 3PFIA 4C2UA 1RC9A 3R4KA 3A07A 4JYKA 2QYIB 2QCOA 1VQOI 3N0KA 3K2AA 4HV6A 2H6CA 3K70D 1J09A 4P0JA 2GLOA 3ZR8X 4FHTA 3WGIA 5JR3A 2K4JA 5CQEA 2JRTA 2ZJQF 1YX3A 3M3YJ 1Y8QB 1F31A 1X3WB 1U5TA 2HYFA 1G2HA 2VL8A 4RS8A 4HLYA 2JQ7A 2DO7A 2D45A 3E8LC 4MGRA 1D8JA 1RRJA 1IW7F 5DSSB 3ZPLA 2L9VA 1ZGAA 5F1RA 5DUIA 2PMUA 2VJ4A 3O8HA 3RTIB 5J4YA 5H2FC 3BPXA 4P6AA 4ZYEA 1FTZA 4BQQA 4A7ZA 1IV6A 4L18B 2D24A 4RB3C 1BA5A 3G73A 4I4OA 3DTIA 1HIBA 1RY7A 1PDNC 4M9ZA 3N4MA 1XZZA 3VUOA 4Y33A 1P6RA 3DPLC 4RMNA 4KUMA 3RYRA 3LA2A 3VSKA 1VQPI 3HHGA 4L5JA 1ZQ3P 2ELHA 4BQNA 2NYYA 4LLLA 1V6XA 2P5VA 4C30A 2V9VA 4A0ZA 2WAFA 3L7WA 2AXMA 3BC8A 4A5MA 2BY3A 2Y9ZA 2K43A 3JRIA 4BJ5C 1SMYF 1TQPA 4IOCF 3BTLA 2ZMEB 2E7XA 3KYDB 5DCMB 3PFYA 5HPZA 2L7FP 4AUXA 4DGWB 3RI4A 1VQ5I 4O5VA 3WTTC 1DLLA 4F55A 2Q9XA 2OZ6A 2CYYA 4AIHA 3PG0A 4OIQF 4ZZLA 4WF2A 3C7JA 1HW1A 1OCOH 1W1WE 2HQAA 3U21A 2L54A 3LLPA 3ZRGA 3K6GA 4A5NA 5HODA 3IKTA 3GTPJ 3AG1H 1DU0A 2E36A 4F7ZA 2M2EA 2VKHA 2EJRA 2XRLA 4B43A 4XLPF 1WPKA 3ZMDA 3H92A 1SMTA 5DM7F 4IYBA 4EQQA 5CVJA 2IHOA 2QBYB 3ABKH 3DTEA 4QLCU 4E7HA 2F4MB 2VQHA 3TO6A 2PMZA 1LPQA 2KI6B 5IP6A 1K4SA 1TZLA 3BDDA 4OW4A 2P7CB 2FMLA 4L4HA 2GM4A 4N9IA 3FFZA 2W82A 4Z9WB 1RZ4A 3U1KA 2R0QC 2MIBA 1QU3A 5BMZA 1P4WA 4AC0A 3FMSA 4I2SA 3CCVI 2E5ZA 4E7SA 4ZH4F 2VXZA 3NAUA 4XLCA 4G6JA 3E5UA 2HWVA 4A0XA 4EM2A 2M0MA 3ABLH 3K7AJ 1F4KA 4OEEA 3ISPA 5E1WA 2O6GE 2ID3A 1TNTA 2KZGA 4OMZA 1GVJA 1ENHA 4HNTA 4IQPA 4XRFA 3HRTA 3VB2A 4D9JA 3IRRA 2LKXA 2Q2EB 2DTZA 2G7UA 4DW6A 2CG4A 2DA6A 3BR1A 3PJRA 5IP7J 5HDNA 1V55H 3IH3A 1KQ0A 4I96A 2H1LA 1E3PA 2LDUA 2M87A 3DU5A 4Q91A 4JX6A 2O03A 1FWUA 3P6IA 5HS8A 5ED4A 2HZ9A 4E70A 4CH7A 4FGFA 3AL0C 1P4XA 2BXZA 2M49A 2ZNZA 3A01B 3BAQA 3GTQJ 1X2MA 3I0TA 4ZTJA 2CS3A 2WTEA 4I98B 5H6RA 2E2IJ 3Q7YA 3P6JA 2OV7A 3CCJI 3KEYA 3GEZA 4XM3A 3ZXDA 5KK1A 1YS7A 5BXSA 3W6VA 3J80K 1G9DA 3OIPA 2QZ8A 3TL4X 5DUYA 5M5XJ 5FKKA 1JTCA 2JK3A 5J6XA 3BZ6A 1Z1DA 4NQWB 1V6UA 4A2UA 3VEQA 1I50J 3UJ4A 1QGPA 2OBPA 3AAFA 2V1UA 5JVTA 2QKLB 4TLPA 1HC8A 1FY7A 3KCCA 2EBIA 1GVDA 1T33A 4XICA 3K4LA 1ZR4A 1NK2P 1U5TB 4HX8A 2GXAA 1BC7C 4OIPF 3BR3A 3C2HA 4HDUA 3WINA 1XGMA 2E60A 2E1NA 3IAS2 2KMUA 3OY9A 2ERMA 3FK7A 4EATA 3IUOA 2K85A 3F1RA 4OAZA 2IS2A 3EDPA 2PX9A 4NUBA 1IN7A 4BY1J 1X58A 5B66C 4E7IA 2PJRB 1YS6A 3AFHA 1BC8C 1MW7A 4KJZA 1ZRDA 4A3BJ 5F8SA 2M7BA 1OCTC 2HYGD 4AVPA 1AVAC 1G9BA 2BZTA 1JKQC 3MMYB 4G7OF 4Y7NJ 2R9KB 3SDGA 3BRFA 1ZLKA 3ZP5A 1Q03A 2H27A 1Z4SA 3BRDA 3I4MJ 3DKWA 4F92B 4YFKF 2HZDA 3DLAA 3SDBA 2LF7A 5LHIA 1SAUA 2CV2A 2KISA 3BG6A 1IUFA 1ETXA 2EWNA 4RGSA 1HA8A 2KI4A 2IS4A 3SYTA 2HVRA 3OYFA 1I39A 2FNAA 2CRGA 2ICWG 4ANJA 1OYWA 1LVAA 3FM3A 3GMEA 3RIRA 2X51A 3MPPG 2QEXI 1WH5A 3LOCA 1Z3XA 1R1VA 3L2WA 2QSHX 3JR9A 4X3AA 3H3VK 2F2FA 4LO0C 1YQAA 2TCTA 2I1BA 2ZXWH 2K02A 4L9VA 3HSMA 2V7FA 1J59A 4I7HA 2OC6A 2V1XA 3ZMVA 4HDVA 4M9XA 3QP5A 4QD2C 3PQJA 1R4NB 2E5NA 5FRMA 2PQ8A 4A3LJ 4AIDA 2WV1A 5TISC 3O49A 1AA7A 3D0SA 4IJAA 1XDSA 5J4VA 4ZYDA 5C4JJ 4N0BA 1HCEA 4JX5A 1U0JA 5DTDA 5ILVA 3KFWX 3QYDA 3WMVA 2NAZA 3CCUI 1ZG5A 3JUTA 4LG3A 3T0YA 1PP8F 2X1EA 3RPUA 3BR0A 1YO5C 2IVMA 5FFXA 1J5YA 3LNQA 4IRIA 4HV5A 1I3AA 4E7LA 1CGPA 4HRIA 2M45A 4M73A 4IO9F 1RR8C 3GFLA 4A3MJ 5LHHA 2M0CA 4D1QA 2VJJA 2ZQOA 2J3PA 4NC8A 2K8RA 1WJ5A 4A7KA 2Z2SB 3OOUA 1WFXA 1VI0A 4Q9GA 2V1DA 4N9HA 3HBWA 2E2HJ 5E20A 2ESNA 4G12A 3CDHA 1WH7A 3MCZA 4L9JA 2EB7A 4L5IA 2W4SA 4M71A 3ASOH 1JUMA 2LP0A 1FYMA 5CKTA 2A3SA 3UR3C 1YYVA 3O6BB 4OWRB 2MC3A 5IT3A 3Q5FA 2QQ9A 1O3SA 3NQOA 1ITBA 5BP5A 1UJ8A 2D43A 1I1EA 3V79C 3P53A 3O3KA 1PZZA 1POGA 1N78A 3FXRA 3EF2A 1UHMA 3HC7A 4GYGA 3AJ6A 4RBOA 2V1NA 2KH2A 2TDXA 3FXQA 1APLC 3BA7A 1HDPA 4DYRA 3CC7I 2EIMH 2GIVA 3I4NJ 3S8JA 1VQ7I 3JW4A 5GAGJ 4GYIA 2R7XA 3OBTA 1LDJA 4R6UB 1W5SA 2J5OA 3S14J 1G82A 3FXJA 1JKRC 2DA5A 3MKLA 1P92A 5FLXK 1ZK8A 5GPCA 3OS2A 1HWMB 2K86A 1Z21A 5F27A 4P9FA 3I29B 2ZXJA 3SHFA 1GHCA 2GA1A 2B9SA 3VT2A 4NC7A 5DS9A 1WBCA 2QM3A 1N4KA 4G6MA 2LSOA 2DMQA 2LFBA 2QYOA 3F72A 2FSWA 3OYBA 5CQGA 4GCVA 2HPMA 3LSHA 1IN6A 3H3ZA 2UZKA 2DMTA 1Z67A 1WJDA 2MLGA 2A5YB 1MH3A 2J5PA 3FBNB 5HOOA 4ENKA 2OPTA 1B59A 1XD7A 1X4OA 3MVPA 2HWAA 3KMVA 2WBCA 4KA4A 1YJ9I 3WMUA 2PFBA 2Z33A 5BQTA 2X2SA 1IN4A 2VBYA 1MDMA 2G9WA 31BIA 2JWTA 2QQBA 3CUOA 4I6ZA 2MD0A 1ONKB 1SD4A 2R7FA 2Q3NB 3A02A 2FJ1A 4YFXF 4BL0B 3OMYA 1FOKA 4Z8SB 5DM6F 3P7NA 1W5CC 4MQVA 1NG6A 3L2VA 4G7HF 3OSGA 2LTPA 2LYCA 4KN4X 3O3QA 2BBYA 1UELB 5FLVA 1YHQI 2BOLA 1YJNI 2XPUA 4EM1A 3C2GA 1TWAJ 5FNXA 1SC7A 4Z2YA 1IXCA 2EZHA 3MD2A 1YTOA 3IWFA 3QWLA 5LFAA 2W57A 3KEOA 1T8IA 4J01A 5CJ9A 2VXRA 2O61A 3E6CC 4WK8F 4M3BA 1S5LC 2FBKA 3E1SA 2Z5UA 2W7NA 3KETA 3S8KA 4BEHB 1RZOB 5K7ZA 2BY0A 1K5UA 2Y9XE 4AN6A 5D6FA 1ISVA 1R23A 2VBXA 3FJIA 1WKMA 1ZTRA 1FP2A 3QPTA 2F5VA 4HLXA 2LVSA 1JGGA 1UG0A 3SZTA 3DWLE 3BLYA 2E71A 3BX1C 4M6VA 4EJWA 3VSZA 2X6YA 4LO3A 4V19K 3HOWJ 4J2SA 1K4TA 1WJCA 1AVWB 2JVGA 4HYEA 3GTGJ 2VUAA 1E3HA 2WC2A 1MMSA 3FHNA 1IAWA 4A93J 1F36A 2JSPA 2KHMA 2ZXHA 2XF5A 3MZ8A 4K2EA 2V4JC 5FJ8J 1QHHD 3LFUA 5LLQA 2R7WA 3N7LA 5IYCJ 4FE7A 4DIQA 4EEFG 2NS7A 2AXLA 2D1VA 1T38A 1ZH5A 3ZGKA 1FSHA 3PUBA 7I1BA 1XX5A 1I1SA 1W0UA 2Q0OA 3PMEA 4CUGA 3PO3J 3Q0VA 5D8LB 3K1XA 3K4KA 2DMPA 3E97A 1IJWC 2EH3A 1HSTA 4QWQA 1RESA 4DYCA 3AJ5A 2ZB9A 3FXUA 4USPA 2G7HA 4BDZA 3H9GA 4RAGA 1W3GA 1A6QA 5F04A 1JT0A 4JQFA 4XLFA 3DLLF 3SZPA 2XVCA 2RDPA 4P96A 2JRMA 3L2QA 3BB2A 3W6JB 4Z6YA 3K0LA 3Q0WA 4ISRA 2ACJA 4BQOA 2VU9A 3WTWC 1JUPA 3CA1A 2EZIA 5B1BH 1A8DA 5BPDA 4PC4A 2F4OB 3QR5A 1VQKI 1M16A 3A2KA 4S0HB 1Y8RB 1SVLA 2Y30A 4XL9A 1P7IA 5FO5A 4BS9A 3W2AA 2W25A 2IA0A 2Y48A 1WVRA 4KMUX 2R3SA 5ICGA 2OUMA 2EK5A 1TP0A 2NVUB 2LKPA 1R7JA 1Y0UA 3TOAA 4BE1A 1IN5A 4ETSA 3E0JB 5K5QA 4I4YA 1R8NA 2FQ4A 3S3OA 3BCBA 2W48A 4C3HJ 2VOOA 1VQMI 2OAZA 3H5NA 1TWMA 2CO5A 3VEPA 2RV8A 1T4QA 3W2VA 2R7DA 5B5EC 2F5CA 2AFGA 3FGMA 4C3IJ 2F4IA 4A3KJ 3PHZA 1V4RA 3EUHA 5DCFA 1H9GA 2AXTC 2KRCA 2XGCA 1SVOA 4JK1X 5FKNA 4EJUA 3ZQHA 1R5GA 3PNYA 4KT6A 3REOA 1FP1D 4GOYA 4WXCA 3AH2A 2H6BA 2HVQA 1Z2VA 3F8MA 3BR2A 3CDIA 3TKYA 5E17F 1E17A 2E4MC 4B4CA 2NNNA 3CO7C 1TBXA 3ZOBA 1DGWY 2DQLA 1BARA 3TGNA 1BI0A 2K5CA 1IJTA 3VSFA 2DQRA 3GTLJ 3IM7A 1YOVB 1AU7A 4BJTA 1XB4A 5KAIC 4FE4A 4G7ZF 1TL8A 1STZA 4KITB 1S7AA 2EQRA 1W36D 3J7ZI 1WWXA 4I8MA 5F6FA 1S7OA 3WG7H 4A3DJ 2JSCA 3S17J 2K9MA 1D0XA 3LSMA 3DV8A 1SR4A 1WZ2A 4LK1F 4NBQA 5FB2A 1TWEA 3K4CA 3KP7A 3M7GA 1QQLA 3AKHA 1MC9A 4I4UA 2ZBKA 4BNCA 1XSXA 3QYBA 2BE5F 2FOWA 2A6HF 3TOBA 2CQ7A 2PG4A 1DUXC 3V0BB 1SFOJ 4Q5SF 2RNGA 2XKPA 3CMEI 3R4SA 3LQQA 1S0FA 3MZYA 2Z49A 2G0EA 2YU9J 4IZEA 4EFRA 2W1OA 3WINC 2RNJA 1ETYA 2MSYA 2DBBA 3BG9A 2VOPA 2F2EA 3CMMA 4YOLA 1OCRH 1JLXA 2EFOA 1JT6A 4UNOA 2XKOA 2L9RA 4S04A 2ZFUA 2XC7A 3CCEI 3VT0A 1ZARA 3CD6I 1EKEA 2WB1N 4I99C 2CWEA 1LKXA 3L09A 4A0YA 5K1YA 5DEQA 2GIZA 3WTUC 3LL7A 2YPRA 2FRHA 2MABA 2XPWA 1B9MA 2DK8A 3KPHA 1R36A 3WTVC 4KIGA 2Y2ZA 3I56I 2FO1A 3ABTA 4KDPA 1Z7LA 2DFHA 3FJEA 3K1NA 1L0OC 2CMPA 1VFCA 3H36A 4JAWA 1YLFA 4BE0A 3S32A 1H8AC 4BJ6C 1FZPB 2NOGA 3POKA 3MZHA 2FEZA 5J1UA 2L4MA 4MEXF 2I10A 2Y0MA 1HKTA 3VYUB 2MGQA 2KDOA 3AG2H 3LFKA 4RAFA 2JPBA 2HQ5A 3IM5A 4KEJA 3CA5A 4YEJA 2STTA 2QBYA 1D3YA 2VIXA 1TOOA 1MBEA 1LJ9A 2E19A 3FUQA 1R58A 3FDYA 2R92J 1S7EA 3B73A 5HNFA 4ZBVB 3HRMA 3NEUA 1YW9A 2CUFA 2KJBA 4JOMA 2WRYA 1EH7A 3VFZA 1IF1A 4GOVA 2EIKH 2A69F 2E34A 2L02A 3FIWA 4ZJZA 3WTYC 4EGZA 3B02A 2E1MB 4J23B 1T9FA 4OWJA 1W3FA 1XMKA 4B44A 2F2FC 3BWGA 3ZC9A 3HGYA 3S16J 2VN2A 3M8FA 5EYRA 1VNDA 5LEKA 1OQLB 1IRAX 2QUFA 4W97A 4G1RA 2K9LA 3SJMA 2HZTA 1ORKA 2DFEA 4G6QA 2VUMJ 1IOBA 4PSXA 1LDDA 3HKZN 5JHFA 1I6XA 2HGCA 3HGGA 3FKIJ 3A23A 1AVXB 2AAIB 1ETKA 1WGXA 2VXDA 3CCRI 1OKRA 6I1BA 3H5AA 4B3XA 3OIOA 1OR7A 3CLOA 4XRSA 2D20A 3JREA 1FMWA 4CJMA 2YX4A 3QU3A 1ZAOA 1K83J 2XSJC 4NQWA 3SEZA 3O4DA 2ID6A 1ITYA 1X4PA 3DBLB 1XDUA 3K70C 2BV6A 3H6SE 3A0BC 3O5WB 2VONA 2FDBM 3MWMA 1VZ0A 3JSPA 2AQZA 4FQGA 4FTHA 3AZWA 5D5WB 2RG9B 4A12A 2QQAA 2CQQA 1X1DA 2KL4A 1USTA 3RMXA 2HS5A 3RQIA 1AKHA 4I0YA 1X3ZB 3D7WB 2FQ3A 2ESUA 4Q48A 1U9OA 4QPQA 1DFCA 3QPHA 3T1BA 1IXRC 3GFIA 4II3A 3HB9A 2GBYA 2XAGA 4IQ4A 3ZMTA 4E4HA 4AYBN 1WI9A 2AQFA 4IQJA 3TO9A 2A6TA 3U2RA 1MKMA 2PJRA 3QPLA 4GRIA 1PVEA 2DMUA 3FZVA 2CUEA 1YRNB 2Z99A 3E5QA 3HTSB 2L5XA 1U9NA 1O3TA 3S3MA 5ILSA 1DFQA 4OMYA 1AXMA 1SFXA 1A36A 5D4RA 5L3CA 1UAAA 5TGTA 2JTVA 3N7JA 5BXRA 4KEIA 2UWMA 1MGTA 1FIAA 4ZDLA 5LRSA 1FV3A 3P9CA 4ON0A 3NBDA 3OL4A 2QSGX 3QOPA 4BUPA 4JKQA 3RKWA
chains in the Genus database with same CATH topology
4GP0A 4X37A 3L2UA 2LRDA 2D1ZA 1I1BA 3CP8A 4H04A 2RQ9A 2KP6A 21BIA 4AVZA 1K5VA 3A4CA 2IGKA 3FBIB 4GP3A 2Y0SA 3OIQA 2CV0A 3FJ8A 4ISQA 3MKWB 3KYLA 1P9QC 2UUSA 1WJAA 3CF2A 4N4OB 4I3NA 1AFCA 1HKNA 1X1CA 3FJ9A 1BASA 4RM3A 1S0BA 1PYVA 2V9KA 1WD4A 2XOAA 3OJ2A 2Y9GA 2WY7Q 2CH0A 3LSGA 4HR6C 4JKXB 4AN7B 3H9QA 3K4JA 3HXLA 3UD9A 1XG6A 1YE9A 1PUUB 3QODA 4ZA3B 2D22A 4QO3A 4LO3C 3AKGA 1D1BA 3K4NA 3IP4B 4LO2A 4BDYA 5CPRB 1ISXA 1X1AA 3TBIA 2MC4A 3OYJA 2D7RA 3CA4A 3WO3A 1BR4A 1XYFA 4XQFA 5FZYA 1EVTA 1G9AA 3NWTA 3FJKA 4XKVA 2W00A 5FZUA 1NZKA 3EUAA 1MMDA 1T95A 4MZGB 5D63A 2MYSA 4FETA 1FMZA 1MMAA 4D8HA 4IHZA 1MMNA 2D44A 5HLTA 2ZXIA 2P23A 3AKFA 2VQLA 2LH9A 1V5GA 1P63A 3OBRA 2F8XC 4JPZA 4QC4A 5BQUA 1MD6A 2WY8Q 1ABRB 3EUHC 5GAQA 2FGFA 3AKIA 4BXFA 1WJBA 4XORA 4E6KG 4BEHA 4XFUA 1V5EA 3H5RA 4G6TB 2HVSA 4XLEA 2HPIA 3DTKA 2ZSIB 4JQ0A 2AQEA 41BIA 3LSKA 2R7TA 1BFBA 1SR4C 3OYGA 4P0JA 4ZTFA 4CCOA 3OYEA 4LO1A 2WA0A 1V5FA 5HVQC 3AKZA 3VYSB 1S0GA 2LREA 3QOEA 5FZZA 4C2TA 2WAQA 2Z1DA 5EHAA 1DIWA 1YX5A 3IAM2 1EA3A 4X39A 4ZDPA 3TMOA 4ZC3A 2CUZA 4MZHA 1NUNA 4XOTA 3OYAA 4QKRA 4CCKA 2V26A 4XMYA 1PWAA 5G00A 3MALA 2CW8A 2D7IA 2BEAA 4I37A 2MLLB 1TT0A 2HWMA 2RREA 3K4MA 3B9UA 2ELJA 3O4OA 4I6IA 2CV1A 4PJNA 2XAUA 3I3LA 3UDAA 2RSTA 1FV2A 4XKBA 4MLOA 2VSAA 4QALA 4EB2B 1BLDA 3FUOA 1KNMA 3ZXGA 2WADA 1YF8B 2CUJA 2BEBA 1X1BA 1PJRA 2NTDA 4II2A 4NNJA 1OR7C 3H9JA 1SFKA 1QXMA 5FRNA 1DQOA 2LG4A 3UD7A 1LVKA 5JLVA 2WBMA 1CVSA 1AF9A 3OWTA 3OYHA 4PFPA 1Y6IA 3O4AA 4H75A 3V0BA 4E7KA 3I9V2 2XDVA 2R4GA 1JT3A 2L9SA 3HL2A 4J2KA 1S0EA 4XONA 4ITVA 2NOJB 4USOA 1DQGA 3CA6A 2ZSHB 3BA5A 2VSEA 3HN1A 3F62B 1Z3YA 2VPLA 1QQKA 4OWKA 4I4XA 1GLNA 1BLAA 1HWPB 4JP0A 2VLAA 2FUG2 4PJJA 2M3AA 2R7QA 4ZGRB 3RSJA 2BW3A 2L9NA 3EPZA 1FGAA 3N05A 3AH4A 3O44A 1HCDA 4KC3A 4D0TA 4CA0A 4ENDA 4OEFA 4KBBA 2IGMA 3FJCA 1IT0A 2X85A 3BAOA 5B2HA 4DBQA 1VCLA 4GAFA 4BGDA 1BFCA 3CRGA 3AH1A 5BVPI 1FWVA 3OL3A 4PK4A 1D1AA 4XNFA 3GBGA 3AL0B 4IX7A 1AVUA 2IGOA 2LY1A 4PFOA 3CQAA 2DCEA 4F91B 1GGPB 1BFFA 4A7YA 3NWSA 2ET2A 1JQZA 3T8SA 3AZVA 4II0A 3NBNA 2LOOA 4HSTA 1X19A 2X6XA 2LBFB 4PJMA 3HMYA 4F52A 3WO4A 1D1CA 4XKIA 3PL8A 2F6CA 4HNUA 1S9HA 4E7JA 4HSRA 2UUZA 5F90A 1RG8A 3W9TA 4ZFYB 2BW3B 3IAGC 4X0GA 3CJRB 3CU1B 2Q1ZB 5KHDA 4I4VA 2NP0A 4XLAA 1Q04A 2R7OA 2DXIA 2KKIA 3C9ZA 3FJJA 5D61A 1V6WA 3I2AA 3RCOA 1Z0HA 4U7BA 4CSWA 1JI8A 4IONA 2KZVA 3PSIA 4D0ZA 5KNLA 4B47A 4DENA 4I7IA 4QD2B 2ZQNA 2KQRA 4XN3A 3UD8A 1XHBA 3RTRA 4ZLBB 4PSWA 1SZ6B 4EEEB 3BAVA 5KCMA 3OJVA 1N77A 3ILAA 1WJEA 4G9NA 3V0AA 5BP5C 2DT7B 3EUKL 1DP3A 1G8XA 3RSNA 4I1EA 4YRVA 1MMGA 3LSIA 3ZCOA 2VXTI 3CA3A 4BE2A 2LIEA 1D0YA 4J00A 4FASD 3F9KA 4Y3OA 4IZXA 3QYEA 4B48A 2VLCA 4UY4A 3VDXA 3CZ6A 5JMCA 1ZELA 4YELA 3V42A 1WJFA 4C9YA 2DRZA 3M8JA 2JVHA 2R7UA 3D5SC 1E0OA 2ZR1B 4XKWA 1L2HA 5LD2C 3BTAA 4DOZA 4ZYAA 1Q1UA 3FJAA 2A5WA 3HPGA 3HPHA 2M7AA 4Q9PA 4GAIA 3BG7A 4ZDOA 3BADA 2WB1A 4U87A 3OGFA 4EFPA 1BA7A 1CE7B 1E0EA 3OR1C 5FROA 3PNVA 1ERDA 2Z48A 2VQGA 4LO7C 2E4MA 1G9CA 4OAYA 2WAEA 4F3QA 4EFQA 4PJLA 4KEKA 2NS2A 4XKCA 1FQ9A 3UNGC 3H6RA 2KPMA 3VSLA 2KRHA 3V0AB 1LDKB 3JRRA 2P39A 1D0ZA 4CCLA 4F83A 4N4NB 4LIUA 3N7KA 1TTUA 3VWCA 3L2RA 3HKZA 3FJDA 4LO8B 3OYNA 3H35A 4QBVA 2IWTB 3OYLA 4EKXB 4L4IA 2IS6A 1RMLA 3MKZA 2GZBA 2DRYA 2L5QA 3SEQA 1PUMB 1G59A 5F8WA 4LITA 4I4RA 3FJHA 3J7AY 1R8OA 3LTQA 2IS1A 4I4SA 3NJ5A 4IY9A 3OYMA 2E1MC 5BOWA 5BXTA 4AYBA 1TIEA 2HNHA 3VYRB 1JY0A 4XOPA 3OGGA 2K3PA 2L2OA 3ZQQA 4P0KA 1R6RA 5FNWA 3HUGB 4I4PA 2KLOA 5I1BA 4XFSA 4CCMA 3RMYA 2X6WA 1S0LA 4RLQA 4DJAA 4MZFB 4RLFA 3PSFA 3ZX7A 4AU7A 4P0LA 2R7VA 4IZZA 2CFOA 1TFMB 4XLHA 1DGRM 3HALA 1OLTA 2BVMA 4P1WA 4OUJA 3DU6A 4IY8A 3H6RB 4XFTA 5EC5A 1M2TB 2I8DA 4OEGA 4R79A 4IKFA 3H6QA 5HNHA 2IXSA 2QN4A 3FJFA 3D5RC 1HWOB 2JA2A 3FJBA 3CRIA 3OYDA 3W3CA 2DS0A 1S0CA 5EG6C 3OYIA 4I4QA 4RM2A 1DJSB 4ZKTB 1J0SA 4DCKC 4I1BA 1WBAA 2X2TA 1K6YA 4BACA 1BFGA 9ILBA 3MKYB 4QPOA 2DOAA 1EPWA 3DKYA 4HPQA 1JT4A 2LIQA 1QHGA 1ISZA 2DREA 2R7SA 4PUSA 2HDWA 3W2WA 4Y4RA 1BR2A 1EYLA 3HG9A 3OJMA 2LC2A 3A21A 4ZFUB 3DQVC 3RTJB 3Q7WA 2VKDA 3SZGA 3K10A 3FKJA 4FVVA 2XF7A 3UJ0A 4F93B 4LIVA 4E7ZA 1JT5A 2RQQA 3PNTA 4HJJA 1ILR1 2V6EA 2X1DA 3A1YA 1II4A 2VASA 1YYNA 2LBFA 4ZOTA 1BOBA 2VQCA 3TC2A 3BAGA 3VT1A 2R7RA 4G9MA 3O4BA 1V6VA 4HEA2 3DPTA 3N7MA 3CAHA 3S8PA 4H4KC 2VJIA 4J2YA 1KONA 4H9WA 2M4GA 3ZXSA 4F34A 4OWLA 3OR2C 3OS0A 1FMMS 4QKSA 3CESA 3VYTB 3R4UA 3I2XA 2Z16A 1IRPA 3VWBA 2M4KA 1EV2A 1FN0A 2BVLA 4P5OA 1Y56A 8I1BA 5E24E 2QKMB 3CP2A 2O5RA 3O4CA 1D0HA 2VB6A 2MFZA 4LO0A 3WO2A 1MNEA 2DT6A 3LMMA 2NZ9A 3OS1A 1JT7A 4CCJA 3S3NA 2XF6A 2JUGA 3DEEA 4QBCA 2LY2A 2IGNA 4XN0A 2YUGA 3NBEA 1LFPA 2L7KA 4CCNA 1W36C 1UPSA 2HW9A 2GO2A 1PC8B 1DZDA 2FFVA 1DQUA 2VJ5A 3KX2A 3IIRA 3SNVA 3CJQB 3IM6A 1BR1A 3DPUA 4LO7B 1T0FC 4HA2A 3WA1A 4X38A 2GOXB 4BU2A 2BFHA 4WBCA 5DVHA 1NG7A 1FMVA 4LO2C 1HWNB 3HOMA 2CW7A 2NVHA 3K4BA 3RQ4A 2D23A 1ISWA 1YXWA 3NBCA 3S93A 1JLYA 2FFUA 3CRHA 3D5LA 1DZCA 2HU9A 3CA0A 2NM1A 5F8YA 3BA4A 1N75A 3ZC8A 4XR6A 3BAUA 1MNDA 3G2BA 4DEPA 4ZFWB 4KISA 2K4AB 3BAHA 1YBIA 1IHKA 3HOSA 4CZCA 3DKXA 4HG2A 3OYCA 5BQUC 4J2XA 1IILA 3OYKA 3Q7XA 5DZUA 5D62A 3ONQA 4I8MA 2X1CA 1S0DA 4JRAA 2UV1A 3QYFA 1ISYA 2Y9FA 2DJIA 2Y9WC 2P0WA 2KLLA 3HOTA 1W3AA 3A22A 3M1CA 1WD3A 5BXPA 1IRXA 3BCAA 2GOMA 4DBRA 3RPUD 2MC2A 3H0DA 4LO1C 4C2UA 3A07A 2QYIB 3N0KA 3K70D 1J09A 3ZR8X 5CQEA 1YX3A 1F31A 2VL8A 3E8LC 5DSSB 3RTIB 2VJ4A 4P6AA 4BQQA 4A7ZA 2D24A 4I4OA 3DTIA 1HIBA 1RY7A 3VUOA 1XZZA 4Y33A 3DPLC 4RMNA 3VSKA 4BQNA 2NYYA 1V6XA 4C30A 2WAFA 2AXMA 3BC8A 2K43A 4BJ5C 5HPZA 3PFYA 3BRGC 4DGWB 2Q9XA 1DLLA 3PG0A 4F55A 2HQAA 3U21A 3LLPA 3ZRGA 3K6GA 2VKHA 4B43A 4IYBA 2IHOA 4E7HA 3DTEA 2KI6B 2VQHA 2PMZA 1TZLA 4OW4A 4L4HA 3FFZA 2W82A 4Z9WB 2MIBA 1QU3A 4I2SA 2E5ZA 4E7SA 2VXZA 4G6JA 4XLCA 2M0MA 4OEEA 4IQPA 4HNTA 4D9JA 2Q2EB 3PJRA 4I96A 3DU5A 4Q91A 1FWUA 3P6IA 2HZ9A 4CH7A 4FGFA 3AL0C 2M49A 3BAQA 4ZTJA 2CS3A 3Q7YA 3P6JA 2OV7A 3KEYA 4XM3A 3ZXDA 5BXSA 1G9DA 3OIPA 3TL4X 5DUYA 1JTCA 1V6UA 3VEQA 4NQWB 3UJ4A 2QKLB 4TLPA 3K4LA 3C2HA 3WINA 2E60A 3IAS2 2KMUA 3OY9A 2ERMA 4EATA 3IUOA 3F1RA 4OAZA 2IS2A 4NUBA 4E7IA 2PJRB 3AFHA 1MW7A 4KJZA 5F8SA 2M7BA 1AVAC 1G9BA 3MMYB 2R9KB 3BRFA 1Q03A 1Z4SA 3BRDA 4F92B 2HZDA 3DLAA 3SDBA 1SAUA 2CV2A 3BG6A 1HA8A 2KI4A 2IS4A 3SYTA 2HVRA 3OYFA 4ANJA 3MPPG 2X51A 1Z3XA 3L2WA 4X3AA 2F2FA 4LO0C 2I1BA 3HSMA 2V7FA 2OC6A 4QD2C 2E5NA 5FRMA 3O49A 1AA7A 1HCEA 1U0JA 3QYDA 3WMVA 3JUTA 4LG3A 2X1EA 4E7LA 4HRIA 4D1QA 2VJJA 2ZQOA 2J3PA 4NC8A 2K8RA 1WJ5A 4A7KA 2Z2SB 3OOUA 1WFXA 4Q9GA 3HBWA 2W4SA 5CKTA 3UR3C 4OWRB 1ITBA 5BP5A 2D43A 1I1EA 3V79C 3P53A 1PZZA 1N78A 3EF2A 3HC7A 3AJ6A 2V1NA 2KH2A 3BA7A 3S8JA 2R7XA 3OBTA 4R6UB 1G82A 1HWMB 3OS2A 3I29B 1Z21A 3VT2A 4NC7A 1WBCA 1N4KA 4G6MA 3OYBA 5CQGA 2HPMA 3LSHA 1WJDA 3FBNB 5HOOA 1X4OA 2HWAA 3KMVA 2WBCA 3WMUA 2X2SA 31BIA 2MD0A 1ONKB 2Q3NB 4BL0B 3OMYA 4Z8SB 1NG6A 3L2VA 2LYCA 3O3QA 1UELB 2BOLA 3C2GA 5FNXA 3MD2A 1YTOA 5LFAA 4J01A 2VXRA 3E1SA 2W7NA 3S8KA 4BEHB 1RZOB 1K5UA 2Y9XE 4AN6A 1ISVA 3FJIA 2F5VA 1UG0A 3DWLE 3BLYA 3BX1C 3VSZA 2X6YA 4LO3A 4J2SA 1WJCA 1AVWB 2JVGA 2VUAA 3FHNA 2JSPA 2KHMA 2ZXHA 2XF5A 2V4JC 1QHHD 3LFUA 2R7WA 3N7LA 4DIQA 3ZGKA 3PUBA 7I1BA 3PMEA 4CUGA 3K1XA 3K4KA 3AJ5A 4USPA 4BDZA 3H9GA 1W3GA 4JQFA 4XLFA 3BB2A 3L2QA 4ISRA 4BQOA 2VU9A 3CA1A 1A8DA 4PC4A 3QR5A 1M16A 3A2KA 4XL9A 4BS9A 3W2AA 2OUMA 1TP0A 4BE1A 3E0JB 4I4YA 1R8NA 3S3OA 3BCBA 3H5NA 1TWMA 2AFGA 1T4QA 3W2VA 3FGMA 2F4IA 3PHZA 2KRCA 3PNYA 4KT6A 4GOYA 3AH2A 2HVQA 1Z2VA 2E4MC 1BARA 1DGWY 2K5CA 1IJTA 3VSFA 3IM7A 4BJTA 4KITB 1W36D 2K9MA 1D0XA 3LSMA 1SR4A 1TWEA 3K4CA 1QQLA 3AKHA 1MC9A 4I4UA 3QYBA 3V0BB 2RNGA 3R4SA 1S0FA 2Z49A 4IZEA 4EFRA 2W1OA 3WINC 3CMMA 4YOLA 1JLXA 2ZFUA 2XC7A 3VT0A 1LKXA 3LL7A 2MABA 2FO1A 1Z7LA 3FJEA 2CMPA 4JAWA 4BE0A 3S32A 4BJ6C 3POKA 3VYUB 2KDOA 3IM5A 4KEJA 3CA5A 4YEJA 2VIXA 1TOOA 3FUQA 3FDYA 5HNFA 4ZBVB 2WRYA 4JOMA 4GOVA 4ZJZA 2E1MB 4J23B 1T9FA 4OWJA 1W3FA 2F2FC 4B44A 3ZC9A 1OQLB 1IRAX 4G1RA 2K9LA 1IOBA 4PSXA 5JHFA 3A23A 1AVXB 2AAIB 2VXDA 6I1BA 3H5AA 4B3XA 2D20A 1FMWA 4CJMA 3O4DA 2XSJC 3SEZA 1X4PA 3K70C 3O5WB 3H6SE 2FDBM 1VZ0A 2AQZA 3AZWA 2RG9B 1X1DA 2KL4A 3RMXA 4I0YA 3D7WB 2ESUA 4QPQA 1DFCA 4II3A 4IQ4A 4E4HA 2AQFA 4IQJA 2A6TA 2PJRA 4GRIA 2L5XA 3S3MA 1DFQA 1AXMA 5BXRA 1UAAA 3N7JA 5TGTA 4KEIA 2UWMA 4ZDLA 1FV3A 3NBDA 3OL4A 4BUPA 4JKQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4II0 A;  4X3A A;  3NBN A;  2F2F A;  4LO0 C;  4GP0 A;  4X37 A;  4FVV A;  2I1B A;  3HSM A;  2D1Z A;  1I1B A;  4H04 A;  2RQ9 A;  3UJ0 A;  21BI A;  4QD2 C;  1K5V A;  1JT5 A;  4GP3 A;  3O49 A;  3FJ8 A;  4ISQ A;  3HMY A;  1HCE A;  3WO4 A;  4XKI A;  2UUS A;  3QYD A;  4HJJ A;  3WMV A;  4I3N A;  1ILR 1;  3JUT A;  1AFC A;  1HKN A;  5F90 A;  3FJ9 A;  1BAS A;  1RG8 A;  3W9T A;  1II4 A;  1YYN A;  4ZOT A;  1S0B A;  4ZFY B;  2ZQO A;  2J3P A;  3IAG C;  2K8R A;  4A7K A;  3TC2 A;  3BAG A;  3CU1 B;  1WD4 A;  2XOA A;  4I4V A;  3OJ2 A;  2NP0 A;  4Q9G A;  2Y9G A;  3VT1 A;  3HBW A;  4G9M A;  3O4B A;  1Q04 A;  1V6V A;  2KKI A;  3N7M A;  3C9Z A;  3CAH A;  4J2Y A;  4HR6 C;  4H9W A;  4JKX B;  4F34 A;  3FJJ A;  4AN7 B;  4OWL A;  5D61 A;  1V6W A;  1ITB A;  5BP5 A;  3I2A A;  2D43 A;  1I1E A;  3V79 C;  3P53 A;  1PZZ A;  1FMM S;  4QKS A;  1Z0H A;  3R4U A;  3I2X A;  3EF2 A;  3UD9 A;  1IRP A;  1XG6 A;  4ION A;  3AJ6 A;  1EV2 A;  4D0Z A;  2KH2 A;  3BA7 A;  1PUU B;  4DEN A;  1FN0 A;  4ZA3 B;  3S8J A;  4I7I A;  2D22 A;  4QD2 B;  2ZQN A;  3OBT A;  4R6U B;  8I1B A;  5E24 E;  4QO3 A;  4LO3 C;  3AKG A;  3O4C A;  1D0H A;  3UD8 A;  1XHB A;  1G82 A;  4LO2 A;  4ZLB B;  1SZ6 B;  4LO0 A;  4EEE B;  3WO2 A;  1HWM B;  3I29 B;  3BAV A;  1ISX A;  3VT2 A;  1WBC A;  3CA4 A;  2D7R A;  3WO3 A;  1N4K A;  4G6M A;  2NZ9 A;  1XYF A;  1JT7 A;  3OJV A;  3ILA A;  4QBC A;  2YUG A;  3NBE A;  5FZY A;  1EVT A;  2HWA A;  3KMV A;  4G9N A;  2WBC A;  1G9A A;  3V0A A;  3WMU A;  1UPS A;  5BP5 C;  2HW9 A;  2GO2 A;  1PC8 B;  3FJK A;  2X2S A;  1DZD A;  2FFV A;  4I1E A;  5FZU A;  31BI A;  3IIR A;  3SNV A;  1NZK A;  2VXT I;  1ONK B;  2Q3N B;  3IM6 A;  3CA3 A;  4Z8S B;  2LIE A;  5D63 A;  4LO7 B;  1FMZ A;  4HA2 A;  3WA1 A;  3O3Q A;  4X38 A;  4IZX A;  2BFH A;  4IHZ A;  4D8H A;  4WBC A;  5DVH A;  4LO2 C;  1HWN B;  3HOM A;  2D44 A;  5FNX A;  1YTO A;  2VLC A;  2NVH A;  2P23 A;  3AKF A;  2VXR A;  3S8K A;  1RZO B;  5JMC A;  2D23 A;  1P63 A;  3OBR A;  1ISW A;  1YXW A;  3NBC A;  4JPZ A;  4QC4 A;  2F8X C;  2Y9X E;  1K5U A;  5BQU A;  1JLY A;  1MD6 A;  2DRZ A;  4AN6 A;  1ABR B;  1ISV A;  3FJI A;  2FFU A;  5GAQ A;  2FGF A;  3CRH A;  3AKI A;  3BX1 C;  1E0O A;  3VSZ A;  2ZR1 B;  1DZC A;  4LO3 A;  4J2S A;  3CA0 A;  4XFU A;  1AVW B;  2NM1 A;  5F8Y A;  2VUA A;  1L2H A;  3BA4 A;  3ZC8 A;  3BAU A;  3BTA A;  1Q1U A;  3FJA A;  3N7L A;  4Q9P A;  4GAI A;  3BAD A;  4DEP A;  3PUB A;  4JQ0 A;  4ZFW B;  7I1B A;  3OGF A;  3PME A;  4EFP A;  1BA7 A;  41BI A;  1CE7 B;  2K4A B;  3K1X A;  1BFB A;  3BAH A;  1SR4 C;  1YBI A;  1IHK A;  4P0J A;  4LO1 A;  3AJ5 A;  4USP A;  1W3G A;  2Z48 A;  1S0G A;  4LO7 C;  2E4M A;  1G9C A;  5FZZ A;  5BQU C;  4J2X A;  1IIL A;  3Q7X A;  5DZU A;  3BB2 A;  4ISR A;  5EHA A;  5D62 A;  4EFQ A;  1DIW A;  2VU9 A;  3CA1 A;  1A8D A;  4I8M A;  1S0D A;  4KEK A;  4PC4 A;  4JRA A;  3QR5 A;  4X39 A;  1M16 A;  1ISY A;  1FQ9 A;  2Y9F A;  2Y9W C;  3H6R A;  1NUN A;  4QKR A;  1TP0 A;  3V0A B;  2KLL A;  3JRR A;  1W3A A;  3A22 A;  4I4Y A;  1PWA A;  1R8N A;  2P39 A;  5G00 A;  4F83 A;  1WD3 A;  5BXP A;  3MAL A;  3N7K A;  2D7I A;  2BEA A;  1TWM A;  1TTU A;  3VWC A;  2AFG A;  1T4Q A;  4I37 A;  3FGM A;  2MLL B;  2MC2 A;  3PHZ A;  3FJD A;  4LO8 B;  4LO1 C;  4QBV A;  2IWT B;  2HWM A;  3A07 A;  2QYI B;  4GOY A;  3N0K A;  3AH2 A;  1Z2V A;  4EKX B;  2E4M C;  4L4I A;  1RML A;  1BAR A;  3B9U A;  2GZB A;  3VSF A;  1IJT A;  2DRY A;  3IM7 A;  1F31 A;  3E8L C;  1PUM B;  3O4O A;  5DSS B;  5F8W A;  4I6I A;  3RTI B;  4I4R A;  4P6A A;  3UDA A;  2RST A;  1FV2 A;  3FJH A;  4A7Z A;  1R8O A;  2D24 A;  2VSA A;  3LTQ A;  1SR4 A;  4I4O A;  4I4S A;  4QAL A;  1HIB A;  4EB2 B;  1RY7 A;  3NJ5 A;  3VUO A;  1BLD A;  1TWE A;  1XZZ A;  3FUO A;  4IY9 A;  1QQL A;  3AKH A;  1MC9 A;  1KNM A;  4I4U A;  3ZXG A;  2NYY A;  5BOW A;  1V6X A;  5BXT A;  1YF8 B;  1TIE A;  2BEB A;  1JY0 A;  2NTD A;  3V0B B;  2AXM A;  3R4S A;  3OGG A;  2K43 A;  1S0F A;  2Z49 A;  4IZE A;  4EFR A;  1QXM A;  3WIN C;  4P0K A;  5HPZ A;  3BRG C;  2Q9X A;  1DLL A;  3PG0 A;  4YOL A;  1DQO A;  1JLX A;  3UD7 A;  5JLV A;  5FNW A;  4I4P A;  1CVS A;  3LLP A;  5I1B A;  3VT0 A;  1AF9 A;  4XFS A;  3RMY A;  3O4A A;  4IYB A;  1S0L A;  3V0B A;  2IHO A;  2KI6 B;  3ZX7 A;  4OW4 A;  4L4H A;  2FO1 A;  3FFZ A;  3FJE A;  4Z9W B;  1JT3 A;  2MIB A;  4P0L A;  4JAW A;  4J2K A;  1S0E A;  4I2S A;  3POK A;  4G6J A;  1TFM B;  4USO A;  3HAL A;  1DQG A;  3CA6 A;  4OEE A;  3BA5 A;  3IM5 A;  2VSE A;  4IQP A;  4OUJ A;  3HN1 A;  4KEJ A;  3F62 B;  3CA5 A;  4IY8 A;  3H6R B;  1TOO A;  4XFT A;  5EC5 A;  3FUQ A;  1QQK A;  1M2T B;  4OWK A;  4I4X A;  4I96 A;  4ZBV B;  4Q91 A;  1FWU A;  2WRY A;  3P6I A;  4OEG A;  4GOV A;  1BLA A;  2HZ9 A;  1HWP B;  4FGF A;  4JP0 A;  2M49 A;  3BAQ A;  4J23 B;  1T9F A;  4OWJ A;  1W3F A;  2F2F C;  3Q7Y A;  3P6J A;  3ZC9 A;  4ZGR B;  3H6Q A;  3ZXD A;  3RSJ A;  5BXS A;  1OQL B;  1IRA X;  4G1R A;  1G9D A;  1FGA A;  3AH4 A;  5DUY A;  2QN4 A;  1IOB A;  3FJF A;  1JTC A;  3O44 A;  1V6U A;  3VEQ A;  1HWO B;  3FJB A;  3CRI A;  3UJ4 A;  2DS0 A;  3A23 A;  1HCD A;  1S0C A;  1AVX B;  2AAI B;  4KC3 A;  5EG6 C;  4I4Q A;  4D0T A;  4TLP A;  1DJS B;  4ZKT B;  1J0S A;  6I1B A;  4DCK C;  4I1B A;  1WBA A;  4JKQ A;  2X2T A;  2D20 A;  3WIN A;  1BFG A;  4END A;  9ILB A;  4OEF A;  4KBB A;  4CJM A;  3O4D A;  2ERM A;  3FJC A;  1IT0 A;  3F1R A;  3H6S E;  3O5W B;  3BAO A;  2FDB M;  5B2H A;  1EPW A;  1VCL A;  2AQZ A;  3AZW A;  4GAF A;  2RG9 B;  1BFC A;  3CRG A;  1JT4 A;  5F8S A;  3RMX A;  3AH1 A;  1AVA C;  4I0Y A;  3D7W B;  2ESU A;  2LIQ A;  5BVP I;  1G9B A;  1ISZ A;  1FWV A;  2DRE A;  1DFC A;  2R9K B;  3BRF A;  1Q03 A;  1Z4S A;  3BRD A;  1EYL A;  1AVU A;  3CQA A;  3OJM A;  3A21 A;  2L5X A;  2KI4 A;  1DFQ A;  1AXM A;  4ZFU B;  5BXR A;  1GGP B;  3N7J A;  4KEI A;  1BFF A;  4A7Y A;  3MPP G;  2ET2 A;  1FV3 A;  1JQZ A;  3T8S A;  3NBD A;  3RTJ B;  3AZV A;  3Q7W A; 
#chains in the Genus database with same CATH topology
 1UCR A;  3LA3 A;  5J8C A;  4RAY A;  4GP0 A;  1F9N A;  4X37 A;  3L2U A;  2LRD A;  3FMQ A;  3GF2 A;  2D1Z A;  4YIF A;  3CO6 C;  3CP8 A;  1I1B A;  3PUF A;  2JN6 A;  2KP6 A;  2RQ9 A;  4H04 A;  21BI A;  1HKQ A;  4AVZ A;  4HF1 A;  4NDL A;  2IA1 A;  1K5V A;  1OJL A;  4O3M A;  1VQ9 I;  3A4C A;  5LGT A;  2QWW A;  2IGK A;  3F8N A;  2EFN A;  2OA4 A;  3FBI B;  2DA4 A;  2Y0S A;  3OIQ A;  2CV0 A;  4GP3 A;  3FJ8 A;  3HIF A;  4ISQ A;  5JVG F;  3MKW B;  3KYL A;  2O8X A;  2QQ8 A;  1Z6R A;  5AIQ A;  1P9Q C;  3WTZ A;  5EEA A;  1UMQ A;  2EPF A;  2UUS A;  3L9F A;  1WJA A;  3CF2 A;  3OSF A;  4N4O B;  4I3N A;  2V6C A;  1AFC A;  1LNW A;  1UB9 A;  2K4B A;  2XGD A;  1HKN A;  5A2Q Z;  5D5V B;  2XAS A;  2EZL A;  1X1C A;  2WAQ N;  5JLX A;  3FJ9 A;  2EFQ A;  1BAS A;  3HHH A;  4RGR A;  2GXG A;  4RM3 A;  2F48 A;  1JHH A;  1S0B A;  1PYV A;  3CF5 F;  2V9K A;  1ZKG A;  2VPR A;  1WD4 A;  5HS9 A;  2XOA A;  3F22 A;  5K7H A;  3OJ2 A;  2Y9G A;  1MBF A;  2XSD C;  2HQR A;  1XS9 A;  1TP4 A;  3GZ6 A;  1TW3 A;  3WTS C;  2EIJ H;  2WY7 Q;  4ZYH A;  2CH0 A;  2LMD A;  1RI7 A;  3LSG A;  2DA1 A;  4HR6 C;  4JKX B;  4AN7 B;  2R5Y A;  2X0L A;  3ZQL A;  4GDF A;  3JTG A;  4UUV A;  3H9Q A;  1R00 A;  1TWF J;  3K4J A;  3U9G A;  2HDC A;  2ZFW A;  4G9Y A;  1ETW A;  1RR7 A;  3HXL A;  3IHU A;  3K1P A;  1DP7 P;  3AG4 H;  4MTD A;  1XG6 A;  3UD9 A;  1YE9 A;  2IJL A;  5HLH A;  2CJJ A;  4ENN A;  1R49 A;  3JSO A;  1PUU B;  3QOD A;  4ZA3 B;  5F0H A;  3I59 A;  4I0A A;  2D22 A;  4BKX A;  5L3F A;  1T0F A;  4HBL A;  1J75 A;  4QO3 A;  4LO3 C;  3C3W A;  1OMI A;  2H09 A;  1AKH B;  3AKG A;  2MLK A;  4DNC A;  1XSD A;  1D1B A;  5ICC A;  3K4N A;  3IP4 B;  4Y13 A;  2QA4 I;  1A5J A;  4LO2 A;  1B8I B;  4FT8 A;  3RYP A;  4BDY A;  5CPR B;  1DDN A;  3KLO A;  5C3E J;  1ISX A;  1X1A A;  3FM5 A;  1FOW A;  4I01 A;  5FKL A;  4U0V A;  3TBI A;  2MC4 A;  3OYJ A;  4CZZ A;  3RZD J;  2D7R A;  3GYH X;  3CA4 A;  3WO3 A;  4HF0 A;  4Y15 A;  1BR4 A;  4LD5 A;  2O0Y A;  4M3E A;  3CUQ B;  3ERM A;  4B09 A;  1XYF A;  1S3J A;  5IYD J;  3CTA A;  4XQF A;  2ECB A;  4ESF A;  5GAE J;  2DFI A;  5EF6 A;  1W5T A;  5FZY A;  5EG0 A;  4Y52 J;  1ACI A;  1X3U A;  1TTY A;  1EVT A;  4R8H A;  1G9A A;  1ONV A;  3NWT A;  1YW8 A;  2YS9 A;  3A0H C;  2EFW A;  1JXS A;  3FJK A;  4XKV A;  2W00 A;  5FZU A;  1XCV A;  1NZK A;  1P4A A;  5F1J A;  3EUA A;  1SAN A;  4RGU A;  4AIK A;  1VQ4 I;  2P8T A;  3T5X A;  1H0M A;  3E5X A;  2X4H A;  1MMD A;  1T95 A;  1S72 I;  3I5U A;  4MZG B;  5D63 A;  5L3E A;  2MYS A;  4FET A;  1EF4 A;  2YUS A;  3E6B A;  3NAR A;  1FMZ A;  1MMA A;  1F5T A;  1IRF A;  1KU7 A;  3BJO A;  3GTO J;  5J40 A;  4IHZ A;  4D8H A;  1MMN A;  2OTJ I;  3IRQ A;  2IBD A;  2D44 A;  5HLT A;  2L4A A;  2M8G X;  2ZXI A;  2P23 A;  3AKF A;  3CCM I;  2VQL A;  1Q1V A;  1RET A;  3M4O J;  2LH9 A;  5EJC A;  3LSP A;  3BY6 A;  1V5G A;  3O2P E;  4YIR X;  1H9T A;  1P63 A;  5KVR A;  3OBR A;  5LGN A;  2F8X C;  4JPZ A;  2K9Q A;  4QC4 A;  4MFE A;  1I1G A;  1MD6 A;  2WY8 Q;  3F8F A;  5J1Y A;  3B6C A;  1ABR B;  5BQU A;  1KU3 A;  2LKS A;  3EUH C;  5GAQ A;  2FXA A;  2FGF A;  1QNT A;  2XV4 S;  2W24 A;  3AKI A;  2LK2 A;  1O3R A;  3BTC A;  4BXF A;  2VT3 A;  5CVI A;  4OOI A;  1WJB A;  2ZJR F;  1LQ1 A;  2D5V A;  4XOR A;  4KIC A;  2EA2 A;  5ERI A;  4E6K G;  2KKO A;  5HDK A;  4BEH A;  1UG2 A;  4XFU A;  1IG7 A;  1HKS A;  1V5E A;  3H5R A;  2RQP A;  3QAH A;  3HSR A;  5ICF A;  4S05 A;  2ECC A;  2R5Y B;  4G6T B;  3BP8 A;  3HRS A;  4XLE A;  2HVS A;  2HPI A;  3AG3 H;  3ECO A;  3PIO F;  3DTK A;  3FK6 A;  3GWZ A;  3IV5 A;  1OCZ H;  2ZSI B;  1MBH A;  3WE3 A;  5D6E A;  4JQ0 A;  3TED A;  1BW5 A;  2AQE A;  41BI A;  2M8E A;  3LSK A;  2CGP A;  2R7T A;  4A6E A;  3I59 B;  1BFB A;  1SR4 C;  2Z9O A;  3Q3S A;  3T8R A;  3OYG A;  4CCO A;  4ZTF A;  1HXD A;  4OIO F;  1Z7U A;  3OYE A;  4CGZ A;  4LO1 A;  3G6E I;  2WA0 A;  4BYY A;  1V5F A;  2RGV A;  4D7M A;  1YIJ I;  5HVQ C;  3AKZ A;  1QVU A;  3VYS B;  3HOX J;  3GTM J;  1S0G A;  2LRE A;  3QOE A;  5FZZ A;  2WV0 A;  4C2T A;  4BHB A;  2WAQ A;  2Z1D A;  1R1T A;  5EHA A;  1DIW A;  2I5U A;  2A68 F;  1YX5 A;  2O3F A;  4XLN F;  5J8F A;  1PUF A;  3IAM 2;  4NHJ A;  1EA3 A;  1MSE C;  4D0P A;  3S1M J;  1J7K A;  4X39 A;  5IOY A;  3WE2 A;  4ZDP A;  2COM A;  4WX9 A;  3KLN A;  3TMO A;  4IRH A;  2CUZ A;  4ZC3 A;  3ULQ B;  4MZH A;  1NUN A;  4XOT A;  5GAH J;  3OYA A;  4CYD A;  5EG0 B;  4QKR A;  2DOE A;  2IAI A;  1RPW A;  4A6D A;  4M9S A;  3RZO J;  3KP6 A;  1B4A A;  4CCK A;  1KGS A;  2V26 A;  4XMY A;  2ADU A;  2M5W A;  5GPA A;  1PWA A;  1OIS A;  1T6S A;  4AD9 A;  2ZME C;  5G00 A;  2EIL H;  2JPC A;  5BPI A;  4HX4 A;  5TJJ A;  1T2K A;  1FTT A;  3MAL A;  2CW8 A;  3VOE A;  1IRZ A;  2D7I A;  2BEA A;  2CSO A;  2HKX A;  4I37 A;  2MLL B;  3IH2 A;  2XAJ A;  4PCQ A;  1MBG A;  2XAF A;  1NK3 P;  1TT0 A;  3EQL F;  4BBS J;  4CYC B;  2RC4 A;  2HWM A;  1GDT A;  2RRE A;  1SD5 A;  2STW A;  4G94 A;  5IYB J;  2YR2 A;  2K3F A;  4MTE A;  4V2F A;  5CYV A;  4LB6 B;  3J7Y J;  3ECH A;  3K4M A;  1U8B A;  1IGN A;  4NB5 A;  1XGO A;  1YTY A;  4A3G J;  4OU0 A;  3B9U A;  2DI3 A;  5FD6 A;  2VBZ A;  3ZQG A;  3WU0 A;  4D7N A;  2KIF A;  3GTJ J;  4IHT A;  2NS0 A;  3GFJ A;  2ELJ A;  4EM0 B;  1JHF A;  2FOK A;  1O57 A;  1EJ9 A;  3HJE A;  3O4O A;  4I6I A;  2EV0 A;  2CV1 A;  4RB0 A;  1JTY A;  3F6V A;  4PJN A;  2XAU A;  5LBQ A;  4IHX A;  1J2X A;  3I3L A;  4UB6 C;  1FV2 A;  4LGW A;  2RST A;  3UDA A;  4XKB A;  4MLO A;  2VSA A;  3DCF A;  2NRA C;  5IP9 J;  1KU2 A;  4QAL A;  4EB2 B;  2NNY A;  1BJA A;  1BLD A;  3HOV J;  3FUO A;  3TP0 A;  5HLI A;  1ZGJ A;  2MG4 A;  3IH4 A;  1KNM A;  3ZXG A;  2WAD A;  3HYI A;  4RDU A;  1HW5 A;  3HRU A;  5E1Z B;  3I4P A;  1YF8 B;  3CCS I;  2CUJ A;  2BEB A;  1X1B A;  3FWE A;  1PJR A;  2EZK A;  2NTD A;  2CU7 A;  2AO9 A;  4II2 A;  4NNJ A;  1OR7 C;  3JRC A;  3H9J A;  1OFC X;  3MQ0 A;  5E8G A;  1BOA A;  1SFK A;  4M6X A;  3WG9 A;  3F23 A;  1QXM A;  2M30 A;  1HCR A;  3A03 A;  1S6L A;  5FRN A;  4XRS G;  1ETV A;  1DQO A;  4M3F A;  3W6K B;  2LG4 A;  4PZJ A;  1A35 A;  3UD7 A;  1LVK A;  5JLV A;  1MBJ A;  5DV5 A;  2WBM A;  1CVS A;  1V54 H;  3OWT A;  1T56 A;  3OYH A;  1AF9 A;  3F0C A;  3DEW A;  4PFP A;  1Y6I A;  2QF7 A;  3O4A A;  4H75 A;  3V0B A;  2QSF X;  2A05 A;  4E7K A;  1U5T C;  1H89 C;  2VC1 A;  2HKO A;  3I9V 2;  4BAY A;  1MH4 A;  2XDV A;  1I5Z A;  3WU1 B;  2OCC H;  2R4G A;  1JT3 A;  2L9S A;  3HL2 A;  4J2K A;  2R5Z B;  1S0E A;  4KIB A;  3HZJ A;  1PUF B;  3FX3 A;  1SAX A;  4XON A;  4ITV A;  4BHP A;  2O7O A;  1REP C;  1LUJ B;  2NOJ B;  4ZZD A;  3KZY A;  4USO A;  2F5F A;  2P6T A;  1DQG A;  3CA6 A;  2ZSH B;  3BA5 A;  2LY9 A;  2VSE A;  3HN1 A;  4UVA A;  1Z3Y A;  5DD4 A;  3F62 B;  4U88 A;  3GX4 X;  1TT5 B;  4EJO A;  5IY5 H;  1FYL A;  4AM3 A;  4ASN A;  2VPL A;  1QQK A;  4OWK A;  4I4X A;  2F5E A;  3E3V A;  2K9S A;  1GLN A;  1ON1 A;  4C3J J;  1V3F A;  3JRH A;  4EGY A;  2ZNY A;  1VTN C;  2JA8 J;  1BLA A;  1HWP B;  4CXF A;  4JP0 A;  2VLA A;  2FUG 2;  3R61 A;  3BJ6 A;  5DD8 A;  4PJJ A;  2M3A A;  2H94 A;  2R7Q A;  3JCU C;  4ZGR B;  4YFN F;  2D1H A;  3RSJ A;  3CC4 I;  2BW3 A;  3FXM A;  4UUT A;  2L9N A;  3EPZ A;  2L01 A;  1WI3 A;  1FGA A;  3N05 A;  3AH4 A;  1T08 B;  1BIA A;  3O44 A;  5EZH A;  2LLK A;  5B3S H;  3WU2 C;  2BY1 A;  3CCL I;  2OZU A;  1VF9 A;  5E8I A;  1BI1 A;  1WQ2 A;  3I53 A;  1HCD A;  4KC3 A;  4D0T A;  1ULY A;  3O8G A;  2XHK A;  4CA0 A;  5GTH C;  5A2Q K;  2DA2 A;  2HI3 A;  2F5D A;  2LNB A;  3SQN A;  2OQR A;  2Y31 A;  2XGX A;  5CVR A;  2GA2 A;  4UVB A;  4END A;  4OEF A;  4KBB A;  2IGM A;  2Z3Y A;  3PQK A;  3ESW B;  3FJC A;  1D5V A;  4XK4 A;  2A61 A;  1IT0 A;  2UXN A;  1R1U A;  1F1Z A;  1TQI A;  2X85 A;  2YU3 A;  3BAO A;  5B2H A;  5CVV A;  4YII A;  4DBQ A;  1ETO A;  1VCL A;  1QZZ A;  2FU4 A;  4GAF A;  4BGD A;  1BFC A;  2KRF A;  4OIN F;  3CRG A;  1IRG A;  1VQ6 I;  2B0L A;  3AH1 A;  3JRB A;  1ZGW A;  2DPD A;  4P55 A;  3RDI A;  5DDG A;  1ZRC A;  5BVP I;  1FWV A;  4HW0 A;  3OL3 A;  4PK4 A;  1T98 A;  1G6N A;  1D1A A;  4XNF A;  1K61 A;  3GBG A;  3AL0 B;  4IX7 A;  2FE3 A;  1AVU A;  2IGO A;  2LY1 A;  4PFO A;  3CQA A;  1A6I A;  1FPQ A;  1K78 B;  3HM5 A;  2DCE A;  5EZG A;  5JHU A;  1GXP A;  4CIC A;  2RAE A;  2HTS A;  4F91 B;  5D5U B;  1B72 B;  1D5Y A;  1RKW A;  4QTR A;  1GGP B;  3ASN H;  1BFF A;  1QRY A;  4A7Y A;  3GLX A;  3NWS A;  1FT9 A;  2ET2 A;  1JQZ A;  1AOY A;  5HS7 A;  3T8S A;  3MFK A;  1RUN A;  3H1C A;  4NC6 A;  2DW4 A;  3AZV A;  3ZN1 A;  2DN0 A;  3K2Z A;  4DZJ A;  4II0 A;  3NBN A;  2ME6 A;  5IT9 Z;  2LOO A;  4MQ9 F;  1RKT A;  2PMZ N;  1YRN A;  2DMN A;  4HST A;  4MHG A;  1X19 A;  2QVO A;  2MH2 A;  3CLQ A;  1USS A;  3Q9V A;  5F0C A;  2FX0 A;  1MZB A;  5E79 C;  3CDL A;  2PMH A;  2C6Y A;  1BN5 A;  2M34 A;  2X6X A;  3RPQ A;  1FOX A;  1ON2 A;  2LBF B;  4PJM A;  5E3L A;  1KQ9 A;  2DLL A;  2LR8 A;  4L9N A;  3JAM Z;  2XIG A;  5BS6 A;  3ZQC A;  3HMY A;  4F52 A;  3WO4 A;  2L7M P;  4I0B A;  1D1C A;  1IUY A;  4XKI A;  3PL8 A;  2F6C A;  1JKO C;  2HOS A;  2COB A;  1Q1H A;  4HNU A;  1S9H A;  4E7J A;  4HSR A;  2UUZ A;  5F90 A;  2OF7 A;  3SFZ A;  2K9N A;  3IL2 A;  1RG8 A;  3W9T A;  1VQ8 I;  5FD5 A;  3CMA I;  2XRN A;  4ZFY B;  2BW3 B;  4IVN A;  5LEJ A;  1T39 A;  3IAG C;  4X0G A;  3CJR B;  2FNP A;  3CU1 B;  2P81 A;  4HF2 A;  2Q1Z B;  4D5F A;  4U7D A;  5KHD A;  1FC3 A;  4I4V A;  4MFD A;  2NP0 A;  2CQN A;  4XLA A;  3MN2 A;  4M72 A;  3WGG A;  2HDD A;  4I09 A;  1Q04 A;  5C4X J;  2R7O A;  3BR6 A;  3KIO A;  2DXI A;  2KKI A;  3C9Z A;  2HTJ A;  5ICE A;  2R7Z J;  1CQT A;  3FJJ A;  5D61 A;  1V6W A;  3I2A A;  3RCO A;  2PEX A;  4IL6 C;  4GGG A;  2OD5 A;  1Z0H A;  2L7Z A;  4U7B A;  3I55 I;  3B6A A;  4CSW A;  1FEX A;  1JI8 A;  4ION A;  2KZV A;  2OQG A;  3PSI A;  4D0Z A;  5KNL A;  9ANT A;  4B47 A;  2UXX A;  4GXO A;  1P7J A;  3S1R J;  2XRO A;  4DEN A;  4JX4 A;  4G8X A;  4I7I A;  3QPS A;  5TRD A;  2ZQN A;  4LLN A;  4QD2 B;  1I6H J;  3CCY A;  3BZC A;  3TW7 A;  2KQR A;  4XN3 A;  3CCQ I;  3KP4 A;  1RUO A;  2MBF A;  4DYQ A;  2NVX J;  3UD8 A;  1XHB A;  3RTR A;  1PP7 U;  4ZLB B;  2OCE A;  2X6O A;  4PSW A;  1SZ6 B;  4EEE B;  2MW8 A;  3GXO A;  3BAV A;  1ZG1 A;  3K9T A;  2FF4 A;  1YI2 I;  4WWC A;  3LQR A;  1J9I A;  4LG0 A;  2YSR A;  5KCM A;  3WGH A;  4IHV A;  5K5R A;  5J1R A;  3OJV A;  3EYY A;  2GAU A;  2K27 A;  1N77 A;  2O8K A;  1KA8 A;  3ILA A;  2JA7 J;  1W0T A;  4EJT A;  2NVY J;  1K79 A;  1TNS A;  1WJE A;  2EV6 A;  1B8I A;  1LFU P;  2DU9 A;  1JGS A;  4MEY F;  4G9N A;  3V0A A;  1IN8 A;  2FBH A;  2DT7 B;  3EUK L;  5BP5 C;  1DP3 A;  1G8X A;  3RSN A;  1QBJ A;  4I1E A;  4YRV A;  1G3T A;  4LK0 F;  1MMG A;  3LSI A;  1MJB A;  4A3C J;  3ZCO A;  2VXT I;  2HFH A;  3CUQ A;  1HBX G;  2XGE A;  1FBQ A;  3CA3 A;  4KIF A;  2ZJ2 A;  4BE2 A;  1U3E M;  2HOA A;  3S1N J;  2BGC A;  3S2D J;  1D0Y A;  3UKG A;  1JKP C;  2RKH A;  2LIE A;  1NHA A;  2VE8 A;  4J00 A;  2PBI A;  4FAS D;  3F9K A;  3ABU A;  4A3J J;  4Y3O A;  4HOB A;  1CF7 A;  2EV5 A;  5M3F J;  4IZX A;  3SFI A;  1H88 C;  2A6E F;  3QYE A;  1ZHF A;  4PJ0 C;  1W7P B;  2FA5 A;  5E3N A;  1O3Q A;  1AWC A;  2YX7 A;  4RA2 A;  3BOQ A;  3V7C A;  4B48 A;  2VLC A;  3GZ5 A;  3IC7 A;  3COA C;  4UY4 A;  1LEB A;  3VDX A;  4IRG A;  2VT2 A;  3KE2 A;  3CZ6 A;  5JMC A;  1ZEL A;  1TW2 A;  4YEL A;  3V42 A;  1WJF A;  4C9Y A;  5EDN A;  4PGG A;  2KJC A;  3E6M A;  5K5O A;  2OU2 A;  2M9H A;  3D1N I;  2DRZ A;  1F43 A;  3LST A;  2W84 A;  4HQM A;  3M8J A;  1DU6 A;  2ZO4 A;  2XPV A;  4MIM A;  5D5X B;  4A3E J;  4U0Y A;  3U1D A;  1KQ8 A;  2JVH A;  4BH9 A;  2DFF A;  2NS8 A;  1FX7 A;  2R7U A;  3D5S C;  1E0O A;  4H0E A;  2ZR1 B;  5AON A;  4XKW A;  2DDB A;  3ZQI A;  3GLL A;  2K40 A;  3BQY A;  3F21 A;  2FMY A;  3HDD A;  1ZYR F;  1Z9C A;  2XAH A;  1M1E B;  1L2H A;  4U0W A;  3FF5 A;  4HA8 A;  5JFR A;  4A3I J;  1NTC A;  5LD2 C;  3BTA A;  4DOZ A;  1XTA A;  1OYY A;  4TV7 A;  4ZYA A;  1Q1U A;  3FJA A;  1MJA A;  2A5W A;  3HPG A;  3HPH A;  2M7A A;  3ZQ7 A;  4Q9P A;  4GAI A;  2XB0 X;  3BG7 A;  4ZDO A;  3BAD A;  2WB1 A;  4U87 A;  3JRG A;  1L3L A;  2P4W A;  3FMR A;  3OGF A;  1BA7 A;  4EFP A;  2X48 A;  2CQX A;  4M74 A;  1CE7 B;  3HUG A;  3DEU A;  4QIW N;  1E0E A;  4O6J A;  1SEU A;  3OR1 C;  5FRO A;  3CJN A;  4UV8 A;  2ETH A;  3PNV A;  3KYC B;  5M5Y J;  1TWG J;  3R6S A;  2M1B A;  4KMF A;  3DFG A;  1IDY A;  1ERD A;  2Z48 A;  2VQG A;  4WXD A;  1HSJ A;  1EH6 A;  3G1L A;  4FX4 A;  1MD0 A;  1R5H A;  3E7L A;  4IXA A;  4LO7 C;  1YFH A;  2E4M A;  1G9C A;  4OAY A;  3QRF F;  2WAE A;  4F3Q A;  1HQC A;  4EFQ A;  4XRM A;  4PJL A;  3KZI C;  3TW6 A;  3LSJ A;  2TRT A;  4LG0 B;  4KEK A;  2VOD A;  3BTJ A;  2NS2 A;  3SXY A;  4XKC A;  1TWH J;  1FQ9 A;  3GZN B;  3UNG C;  5FGM A;  1U2W A;  5FKO A;  3H6R A;  2KPM A;  2DJN A;  3VSL A;  3I64 A;  1EV7 A;  2KRH A;  4QSH A;  3V0A B;  3BTI A;  1LDK B;  2PN6 A;  4IHY A;  3JRR A;  1O7L A;  3VOD A;  1BL0 A;  5KAF C;  2P39 A;  1D0Z A;  3L1P A;  4CCL A;  4F83 A;  3J81 Z;  4I76 A;  1UHS A;  1R4M B;  1QZY A;  2O9L A;  4N4N B;  1ZR2 A;  4LIU A;  5F64 A;  3N7K A;  5E3O A;  1TTU A;  1E2X A;  1FYK A;  3VWC A;  5LRR A;  3L2R A;  2NVQ J;  2BYV E;  3HKZ A;  1X2N A;  3QQA A;  4MO7 A;  2KDZ A;  1JTX A;  3DBR B;  3FJD A;  4LO8 B;  3OYN A;  3H35 A;  4QBV A;  2DT5 A;  4Q47 A;  2IWT B;  3GFM A;  1N25 A;  3R60 A;  2BY2 A;  3F6O A;  3OYL A;  1CF7 B;  4PGH A;  5GAD J;  1DPU A;  4EKX B;  1Y0N A;  3I54 A;  4PDK A;  4L4I A;  4X6A J;  1Z0X A;  1RIO H;  2IA2 A;  1KU9 A;  2D2W A;  2DYR H;  5IPA A;  2IS6 A;  3QP6 A;  1RML A;  3H3U A;  3KZZ A;  1LE8 A;  2P5K A;  1X1P A;  3MKZ A;  3EYI A;  2GZB A;  2DRY A;  2IEK A;  2L5Q A;  1C0W A;  1G3S A;  3SEQ A;  3GCM A;  1PUM B;  1DPR A;  1G59 A;  1QPI A;  1UHW A;  5F8W A;  4CYC A;  1HW2 A;  3HOU J;  3PO2 J;  4LIT A;  4I4R A;  3M8E A;  2CW0 F;  2HQN A;  1Z05 A;  2IP2 A;  3FJH A;  1OCC H;  1BM9 A;  4XSX F;  3J7A Y;  1R8O A;  3LTQ A;  2IS1 A;  2BXY A;  3G3Z A;  2DAO A;  4I4S A;  2PI0 A;  1FWZ A;  3CMY A;  3NJ5 A;  3G1O A;  3LA7 A;  4GFB A;  4CDG A;  4IY9 A;  3OYM A;  3DF8 A;  5E3M A;  3OV8 A;  1IV8 A;  2E1M C;  4LJZ F;  5BOW A;  4UB8 C;  1TC3 C;  1Z6T A;  5BXT A;  4AYB A;  3BG5 A;  1TIE A;  2HNH A;  3VPR A;  1K6O A;  3VYR B;  4BXX J;  1JY0 A;  1ODD A;  2KT0 A;  4XOP A;  1HF0 A;  1TWC J;  3OGG A;  2K3P A;  4L5E A;  1BIB A;  2L2O A;  1JJ8 C;  1RNL A;  3ZQQ A;  4P0K A;  1R6R A;  1OPC A;  1TLH B;  3S15 J;  3KP5 A;  3JRF A;  5BNG A;  1XGS A;  3F8C A;  1MBK A;  4ENM A;  3G1M A;  5FNW A;  3HUG B;  4W1U A;  2KLO A;  5F0F A;  3V8J A;  2Y9Y A;  2DPU A;  1UZC A;  4I4P A;  4A3F J;  5I1B A;  3FXK A;  4XFS A;  4CCM A;  3RMY A;  3RKQ A;  3JTH A;  3ZMS A;  4X1E A;  1ZG3 A;  2X6W A;  4YG2 F;  4RLQ A;  2E7W A;  1IDZ A;  1S0L A;  1FLI A;  4DJA A;  1U8R A;  1MNM C;  4RLF A;  4MZF B;  3PSF A;  1ETQ A;  3ZX7 A;  4OIR F;  2MH9 A;  2X9D A;  1OYI A;  4AU7 A;  1KYW A;  1KYZ A;  4P0L A;  1XG1 A;  3P5J A;  2R7V A;  2QGU A;  3Q9S A;  4IZZ A;  2CFO A;  2H1K A;  1TFM B;  4XLH A;  1DGR M;  3HAL A;  1OLT A;  6PAX A;  1QA6 A;  3FHZ A;  2BVM A;  3IKV A;  4P1W A;  4P9U A;  1QZE A;  2HR3 A;  4OUJ A;  3DU6 A;  4IY8 A;  1VQL I;  1YJW I;  3H6R B;  4XFT A;  1OQY A;  5EC5 A;  2B63 J;  1M2T B;  3TDZ C;  4XSZ F;  2I8D A;  3L00 A;  2PLY A;  2R5Z A;  4OEG A;  4LMY A;  3S2H J;  5IT9 K;  2DTR A;  3E6D A;  2EIN H;  4R79 A;  4UHT A;  3WHB A;  3NRV A;  3PM1 A;  2OJE D;  4AWX B;  1FBS A;  4IKF A;  1Y1V J;  4RAZ A;  4ENJ A;  4I02 A;  3MEX A;  4CO8 A;  3I71 A;  3H6Q A;  3OOP A;  5HNH A;  2KIM A;  2IXS A;  4ZYG A;  1XPX A;  2MD5 A;  1U78 A;  2QN4 A;  5E1X A;  3FJF A;  3DP7 A;  2VKE A;  2HYJ A;  4BY7 J;  3JAM K;  3D5R C;  3I58 A;  1HWO B;  2JA2 A;  5C44 J;  2N8G A;  3FJB A;  1SFE A;  3CRI A;  1LB2 A;  3OYD A;  3W3C A;  2DS0 A;  1GT0 C;  1S0C A;  5EG6 C;  2JMW A;  3OYI A;  1W7P D;  2XB5 A;  4WCG A;  1E3O C;  4I4Q A;  4RM2 A;  2E35 A;  1DJS B;  2EA4 A;  4ZKT B;  3P9K A;  1J0S A;  1LE8 B;  4HNV A;  3CQZ J;  5ILU A;  4DCK C;  4DZP A;  4I1B A;  5EEH A;  5EGO A;  4AIJ A;  5HDG A;  1WBA A;  2X2T A;  4BHC A;  2L3D A;  3LAP A;  1K6Y A;  4LLG F;  3F8B A;  4BAC A;  4ABZ A;  1BFG A;  9ILB A;  5AIP A;  4QPO A;  3MKY B;  4KYW A;  2DOA A;  3M07 A;  1ZRE A;  2XUB A;  4L9T A;  5JLW A;  2JJ7 A;  2VBW A;  4LOC A;  1EPW A;  2VKV A;  3L2C A;  2JT1 A;  3DKY A;  4HPQ A;  2GXB A;  1JT4 A;  1G3Y A;  5CLS A;  2R93 J;  1GV2 A;  2LIQ A;  1QHG A;  1XN7 A;  1ISZ A;  4L0Z B;  3BRO A;  2R7S A;  1JE8 A;  2DRE A;  2H8R A;  3FXL A;  3ELK A;  4PUS A;  3G4S I;  4IHW A;  2HDW A;  1W4M A;  3W2W A;  3WOD F;  1A31 A;  3WTX C;  4EV0 A;  4Y4R A;  2E2J J;  3M9A A;  1BR2 A;  1EYL A;  3HG9 A;  2KIQ A;  3OJM A;  1FBU A;  2LC2 A;  4UVC A;  2RN7 A;  3A21 A;  1WRJ A;  3CJT B;  3V4G A;  4ZFU B;  3BQZ A;  3DQV C;  4G6D A;  1D8K A;  2AS5 F;  2E1O A;  4UUS A;  5DYM A;  4XBF A;  2P5L C;  1I27 A;  3HEF A;  5L3B A;  4XID A;  3RTJ B;  3Q7W A;  2VKD A;  3SZG A;  2JA5 J;  4C2M J;  4KN7 X;  1EH8 A;  2PJP A;  3K10 A;  1SVM A;  5F08 A;  2NXN B;  3FKJ A;  1K78 A;  4FVV A;  1K7A A;  4Q4Z F;  5LGU A;  2NVT J;  5JI6 A;  1B72 A;  2Y75 A;  4EVI A;  2OTL I;  2DDA A;  2XF7 A;  2ME0 A;  3UJ0 A;  2FBI A;  4FIS A;  1U6G A;  2P6S A;  1FJL A;  4F93 B;  4LIV A;  5CVU A;  4J19 A;  3J80 Z;  4HX7 A;  4E7Z A;  4WXH A;  1JT5 A;  1IO2 A;  1R5I D;  2H8W A;  1TQM A;  3RJP A;  4IOA F;  1NH3 A;  2RQQ A;  3PNT A;  4HJJ A;  4LFU A;  1BBY A;  4UXN A;  3JRD A;  1ILR 1;  2JZY A;  5BOX A;  2HOE A;  1FOY A;  3ZMZ A;  4BXU A;  5EEG A;  2V6E A;  1IC8 A;  4L0Y B;  2X1D A;  3CUQ C;  3A1Y A;  1II4 A;  4M3D A;  4CHU A;  2VAS A;  2DK5 A;  1YYN A;  2LBF A;  2V79 A;  5HLG A;  4ZOT A;  2Y69 H;  2L0K A;  1BOB A;  4HAM A;  1GUU A;  2VQC A;  5J47 A;  3TC2 A;  1WSU A;  3BAG A;  3GVA A;  3BT9 A;  1S29 A;  3HOZ J;  4RGX A;  3DXJ F;  3MAJ A;  3VT1 A;  2R7R A;  4MNU A;  2VE9 A;  3C18 A;  3GTK J;  4G9M A;  1IXS B;  3O4B A;  2ISY A;  2XAQ A;  3BJA A;  4HEA 2;  1V6V A;  3DPT A;  4V2G A;  3CAH A;  3N7M A;  3S8P A;  1UFM A;  2RVC A;  4H4K C;  2VJI A;  4J2Y A;  1KON A;  1JJ6 C;  4H9W A;  3ZMU A;  1XSV A;  2M4G A;  3ZXS A;  2IRF G;  4F34 A;  1XMX A;  3X2Q H;  4OWL A;  3OR2 C;  5EGO B;  3R0J A;  1XGN A;  3Q0U A;  3V8K A;  4GO1 A;  3OS0 A;  3BG3 A;  4LB5 A;  1FMM S;  4QKS A;  3CES A;  3VYT B;  1LFB A;  3R4U A;  3I2X A;  2Z16 A;  3BZK A;  1IRP A;  5D4S A;  3VWB A;  2M4K A;  1EV2 A;  3LWF A;  3KP2 A;  1B9N A;  1FN0 A;  2BVL A;  1XC5 A;  1Y1W J;  4M3G A;  4P5O A;  1Y56 A;  2VI6 A;  1GV5 A;  2BHY A;  4DQ2 A;  4UV9 A;  2ZKZ A;  8I1B A;  5E24 E;  2QKM B;  3ABM H;  3BPV A;  2EFP A;  2K7L A;  2O5R A;  3CP2 A;  4UY8 I;  3O4C A;  2HEO A;  1D0H A;  2VB6 A;  4RB1 A;  2MFZ A;  1BI3 A;  2GQQ A;  1PUE E;  2LD5 A;  3C2B A;  1Y39 A;  3TQN A;  4IHS A;  2IW5 A;  4LO0 A;  3WO2 A;  3RKX A;  1MNE A;  1HLV A;  2DT6 A;  2HXI A;  3HOY J;  2HXO A;  1KZH A;  3JRA A;  3CC2 I;  1B6A A;  4KT5 C;  1MDM B;  1FIP A;  1QO0 D;  3LMM A;  1R71 A;  2NZ9 A;  2BEO A;  3S1Q J;  1JUS A;  1A04 A;  5B1A H;  3OS1 A;  1JT7 A;  4CCJ A;  2GZW A;  2QEN A;  3S3N A;  1SD7 A;  2XF6 A;  4IF4 A;  2JUG A;  3PIP F;  1YIT I;  2NYX A;  3DEE A;  4QBC A;  2LY2 A;  2IGN A;  4XN0 A;  2V9P A;  2YUG A;  3NBE A;  1LFP A;  2L7K A;  1R9T J;  5GP9 A;  3ZN0 A;  2ISZ A;  4CCN A;  1W36 C;  4UUS B;  1UPS A;  2HW9 A;  3KP3 A;  1PC8 B;  4HZF A;  2GO2 A;  1QQI A;  4B8X A;  4ESJ A;  1DZD A;  2FFV A;  4IPA A;  1SD6 A;  1DQU A;  2VJ5 A;  3KX2 A;  1YW7 A;  5IOZ A;  3IIR A;  1QVT A;  3ERE D;  3SNV A;  3CJQ B;  3P9I A;  3HSE A;  1O4X A;  3V7R A;  3IM6 A;  1BR1 A;  1B1B A;  3DPU A;  2KFD A;  2B7E A;  3KEQ A;  1P2F A;  4M6Y A;  4R1H A;  4LO7 B;  1T0F C;  4HA2 A;  1HOM A;  3FIS A;  3WA1 A;  1XCB A;  4X38 A;  2A07 F;  2ZCW A;  2DYS H;  2GOX B;  4BU2 A;  5L3G A;  2BFH A;  2MA3 A;  1GXQ A;  2CQK A;  3TO7 A;  5M3M J;  1NG7 A;  3N97 A;  4KNY A;  4WBC A;  5DVH A;  1FMV A;  4LO2 C;  1HWN B;  3HOM A;  4BBR J;  3LSR A;  2CW7 A;  4RB2 C;  3J81 K;  4HQE A;  2Q8K A;  2NVH A;  2DA7 A;  2Y0S N;  5FLM J;  3K4B A;  5L3D A;  3GW2 A;  1FSE A;  2DOF A;  3RQ4 A;  2D23 A;  4D5C A;  4EJV A;  1ISW A;  1YXW A;  3NBC A;  3HBL A;  3S93 A;  1JLY A;  2WWY A;  5DUK A;  2DOD A;  1BJZ A;  2W85 A;  2FFU A;  2P7V B;  1LEA A;  2IPQ X;  4B1R A;  3EET A;  1MSF C;  2E1C A;  3CRH A;  3D5L A;  1W7P A;  1VQN I;  2CFX A;  5H20 A;  5FKM A;  3BRG C;  1AHD P;  2ZC2 A;  1FNN A;  1S8N A;  3GUD A;  1Z91 A;  3G71 I;  1DZC A;  2VC0 A;  3IWZ A;  4B3A A;  2ESH A;  2HU9 A;  1ZRF A;  3CA0 A;  2JUC A;  3GO5 A;  2NM1 A;  5F8Y A;  1BW6 A;  1O7F A;  3TP3 A;  1HDD C;  1IZ1 A;  3BA4 A;  3ZQF A;  1N75 A;  3ZC8 A;  4XR6 A;  2IT0 A;  3BAU A;  2JA6 J;  2ZME A;  5DCM A;  5FLX Z;  2ELK A;  1MND A;  3G2B A;  1OCP A;  3QU6 A;  1G3W A;  4ZFW B;  5D8K B;  4DEP A;  1WCM J;  1QPM A;  4KIS A;  2K4A B;  3BAH A;  1MIJ A;  2KIU A;  1YBI A;  1IHK A;  1YIO A;  1ZN2 A;  2LF8 A;  3K1M A;  5M5W J;  3HOS A;  3ROU A;  2QLZ A;  4CZC A;  2GWR A;  3DKX A;  4HG2 A;  3V8L A;  3V7S A;  5GTI C;  4Y17 A;  3C1D A;  3OYC A;  5BQU C;  4J2X A;  1IIL A;  3OYK A;  3LAJ A;  3Q7X A;  5DZU A;  1XMA A;  5D62 A;  5FFZ A;  3K69 A;  3H0G J;  3ONQ A;  4IEJ A;  3FXO A;  3HTU A;  2X1C A;  1S0D A;  3WHC A;  1G4D A;  1I3Q J;  2FD5 A;  2UV1 A;  3QYF A;  1BI2 A;  5E18 F;  3J7A O;  4JRA A;  1ZLJ A;  5K7F A;  1ISY A;  3RKY A;  1Z77 A;  4BQA A;  1SFU A;  1YG2 A;  5J3L A;  4KFC A;  2DA3 A;  2Q2E A;  2Y9F A;  2DJI A;  3T8T A;  2Y9W C;  2P0W A;  4JBA A;  3R0A A;  4FCY A;  4I2O A;  2KLL A;  3F3X A;  3HOT A;  1W3A A;  3A22 A;  2AHQ A;  2HOT A;  4A69 C;  3M1C A;  3S2W A;  1WHU A;  4EMS A;  3A01 A;  1WD3 A;  4ESB A;  1J0R A;  5BXP A;  1R22 A;  1IRX A;  3M1E A;  3BCA A;  3HSF A;  2GOM A;  4DBR A;  3TDU C;  2ZJP F;  4FX0 A;  3RPU D;  3BR5 A;  5H6Q A;  2BHZ A;  2MC2 A;  3ML6 A;  3H0D A;  5LHG A;  4LO1 C;  1MJ9 A;  3DBH B;  3PFI A;  4C2U A;  1RC9 A;  3R4K A;  3A07 A;  4JYK A;  2QYI B;  2QCO A;  1VQO I;  3N0K A;  3K2A A;  4HV6 A;  2H6C A;  3K70 D;  1J09 A;  4P0J A;  2GLO A;  3ZR8 X;  4FHT A;  3WGI A;  5JR3 A;  2K4J A;  5CQE A;  2JRT A;  2ZJQ F;  1YX3 A;  3M3Y J;  1Y8Q B;  1F31 A;  1X3W B;  1U5T A;  2HYF A;  1G2H A;  2VL8 A;  4RS8 A;  4HLY A;  2JQ7 A;  2DO7 A;  2D45 A;  3E8L C;  4MGR A;  1D8J A;  1RRJ A;  1IW7 F;  5DSS B;  3ZPL A;  2L9V A;  1ZGA A;  5F1R A;  5DUI A;  2PMU A;  2VJ4 A;  3O8H A;  3RTI B;  5J4Y A;  5H2F C;  3BPX A;  4P6A A;  4ZYE A;  1FTZ A;  4BQQ A;  4A7Z A;  1IV6 A;  4L18 B;  2D24 A;  4RB3 C;  1BA5 A;  3G73 A;  4I4O A;  3DTI A;  1HIB A;  1RY7 A;  1PDN C;  4M9Z A;  3N4M A;  1XZZ A;  3VUO A;  4Y33 A;  1P6R A;  3DPL C;  4RMN A;  4KUM A;  3RYR A;  3LA2 A;  3VSK A;  1VQP I;  3HHG A;  4L5J A;  1ZQ3 P;  2ELH A;  4BQN A;  2NYY A;  4LLL A;  1V6X A;  2P5V A;  4C30 A;  2V9V A;  4A0Z A;  2WAF A;  3L7W A;  2AXM A;  3BC8 A;  4A5M A;  2BY3 A;  2Y9Z A;  2K43 A;  3JRI A;  4BJ5 C;  1SMY F;  1TQP A;  4IOC F;  3BTL A;  2ZME B;  2E7X A;  3KYD B;  5DCM B;  3PFY A;  5HPZ A;  2L7F P;  4AUX A;  4DGW B;  3RI4 A;  1VQ5 I;  4O5V A;  3WTT C;  1DLL A;  4F55 A;  2Q9X A;  2OZ6 A;  2CYY A;  4AIH A;  3PG0 A;  4OIQ F;  4ZZL A;  4WF2 A;  3C7J A;  1HW1 A;  1OCO H;  1W1W E;  2HQA A;  3U21 A;  2L54 A;  3LLP A;  3ZRG A;  3K6G A;  4A5N A;  5HOD A;  3IKT A;  3GTP J;  3AG1 H;  1DU0 A;  2E36 A;  4F7Z A;  2M2E A;  2VKH A;  2EJR A;  2XRL A;  4B43 A;  4XLP F;  1WPK A;  3ZMD A;  3H92 A;  1SMT A;  5DM7 F;  4IYB A;  4EQQ A;  5CVJ A;  2IHO A;  2QBY B;  3ABK H;  3DTE A;  4QLC U;  4E7H A;  2F4M B;  2VQH A;  3TO6 A;  2PMZ A;  1LPQ A;  2KI6 B;  5IP6 A;  1K4S A;  1TZL A;  3BDD A;  4OW4 A;  2P7C B;  2FML A;  4L4H A;  2GM4 A;  4N9I A;  3FFZ A;  2W82 A;  4Z9W B;  1RZ4 A;  3U1K A;  2R0Q C;  2MIB A;  1QU3 A;  5BMZ A;  1P4W A;  4AC0 A;  3FMS A;  4I2S A;  3CCV I;  2E5Z A;  4E7S A;  4ZH4 F;  2VXZ A;  3NAU A;  4XLC A;  4G6J A;  3E5U A;  2HWV A;  4A0X A;  4EM2 A;  2M0M A;  3ABL H;  3K7A J;  1F4K A;  4OEE A;  3ISP A;  5E1W A;  2O6G E;  2ID3 A;  1TNT A;  2KZG A;  4OMZ A;  1GVJ A;  1ENH A;  4HNT A;  4IQP A;  4XRF A;  3HRT A;  3VB2 A;  4D9J A;  3IRR A;  2LKX A;  2Q2E B;  2DTZ A;  2G7U A;  4DW6 A;  2CG4 A;  2DA6 A;  3BR1 A;  3PJR A;  5IP7 J;  5HDN A;  1V55 H;  3IH3 A;  1KQ0 A;  4I96 A;  2H1L A;  1E3P A;  2LDU A;  2M87 A;  3DU5 A;  4Q91 A;  4JX6 A;  2O03 A;  1FWU A;  3P6I A;  5HS8 A;  5ED4 A;  2HZ9 A;  4E70 A;  4CH7 A;  4FGF A;  3AL0 C;  1P4X A;  2BXZ A;  2M49 A;  2ZNZ A;  3A01 B;  3BAQ A;  3GTQ J;  1X2M A;  3I0T A;  4ZTJ A;  2CS3 A;  2WTE A;  4I98 B;  5H6R A;  2E2I J;  3Q7Y A;  3P6J A;  2OV7 A;  3CCJ I;  3KEY A;  3GEZ A;  4XM3 A;  3ZXD A;  5KK1 A;  1YS7 A;  5BXS A;  3W6V A;  3J80 K;  1G9D A;  3OIP A;  2QZ8 A;  3TL4 X;  5DUY A;  5M5X J;  5FKK A;  1JTC A;  2JK3 A;  5J6X A;  3BZ6 A;  1Z1D A;  4NQW B;  1V6U A;  4A2U A;  3VEQ A;  1I50 J;  3UJ4 A;  1QGP A;  2OBP A;  3AAF A;  2V1U A;  5JVT A;  2QKL B;  4TLP A;  1HC8 A;  1FY7 A;  3KCC A;  2EBI A;  1GVD A;  1T33 A;  4XIC A;  3K4L A;  1ZR4 A;  1NK2 P;  1U5T B;  4HX8 A;  2GXA A;  1BC7 C;  4OIP F;  3BR3 A;  3C2H A;  4HDU A;  3WIN A;  1XGM A;  2E60 A;  2E1N A;  3IAS 2;  2KMU A;  3OY9 A;  2ERM A;  3FK7 A;  4EAT A;  3IUO A;  2K85 A;  3F1R A;  4OAZ A;  2IS2 A;  3EDP A;  2PX9 A;  4NUB A;  1IN7 A;  4BY1 J;  1X58 A;  5B66 C;  4E7I A;  2PJR B;  1YS6 A;  3AFH A;  1BC8 C;  1MW7 A;  4KJZ A;  1ZRD A;  4A3B J;  5F8S A;  2M7B A;  1OCT C;  2HYG D;  4AVP A;  1AVA C;  1G9B A;  2BZT A;  1JKQ C;  3MMY B;  4G7O F;  4Y7N J;  2R9K B;  3SDG A;  3BRF A;  1ZLK A;  3ZP5 A;  1Q03 A;  2H27 A;  1Z4S A;  3BRD A;  3I4M J;  3DKW A;  4F92 B;  4YFK F;  2HZD A;  3DLA A;  3SDB A;  2LF7 A;  5LHI A;  1SAU A;  2CV2 A;  2KIS A;  3BG6 A;  1IUF A;  1ETX A;  2EWN A;  4RGS A;  1HA8 A;  2KI4 A;  2IS4 A;  3SYT A;  2HVR A;  3OYF A;  1I39 A;  2FNA A;  2CRG A;  2ICW G;  4ANJ A;  1OYW A;  1LVA A;  3FM3 A;  3GME A;  3RIR A;  2X51 A;  3MPP G;  2QEX I;  1WH5 A;  3LOC A;  1Z3X A;  1R1V A;  3L2W A;  2QSH X;  3JR9 A;  4X3A A;  3H3V K;  2F2F A;  4LO0 C;  1YQA A;  2TCT A;  2I1B A;  2ZXW H;  2K02 A;  4L9V A;  3HSM A;  2V7F A;  1J59 A;  4I7H A;  2OC6 A;  2V1X A;  3ZMV A;  4HDV A;  4M9X A;  3QP5 A;  4QD2 C;  3PQJ A;  1R4N B;  2E5N A;  5FRM A;  2PQ8 A;  4A3L J;  4AID A;  2WV1 A;  5TIS C;  3O49 A;  1AA7 A;  3D0S A;  4IJA A;  1XDS A;  5J4V A;  4ZYD A;  5C4J J;  4N0B A;  1HCE A;  4JX5 A;  1U0J A;  5DTD A;  5ILV A;  3KFW X;  3QYD A;  3WMV A;  2NAZ A;  3CCU I;  1ZG5 A;  3JUT A;  4LG3 A;  3T0Y A;  1PP8 F;  2X1E A;  3RPU A;  3BR0 A;  1YO5 C;  2IVM A;  5FFX A;  1J5Y A;  3LNQ A;  4IRI A;  4HV5 A;  1I3A A;  4E7L A;  1CGP A;  4HRI A;  2M45 A;  4M73 A;  4IO9 F;  1RR8 C;  3GFL A;  4A3M J;  5LHH A;  2M0C A;  4D1Q A;  2VJJ A;  2ZQO A;  2J3P A;  4NC8 A;  2K8R A;  1WJ5 A;  4A7K A;  2Z2S B;  3OOU A;  1WFX A;  1VI0 A;  4Q9G A;  2V1D A;  4N9H A;  3HBW A;  2E2H J;  5E20 A;  2ESN A;  4G12 A;  3CDH A;  1WH7 A;  3MCZ A;  4L9J A;  2EB7 A;  4L5I A;  2W4S A;  4M71 A;  3ASO H;  1JUM A;  2LP0 A;  1FYM A;  5CKT A;  2A3S A;  3UR3 C;  1YYV A;  3O6B B;  4OWR B;  2MC3 A;  5IT3 A;  3Q5F A;  2QQ9 A;  1O3S A;  3NQO A;  1ITB A;  5BP5 A;  1UJ8 A;  2D43 A;  1I1E A;  3V79 C;  3P53 A;  3O3K A;  1PZZ A;  1POG A;  1N78 A;  3FXR A;  3EF2 A;  1UHM A;  3HC7 A;  4GYG A;  3AJ6 A;  4RBO A;  2V1N A;  2KH2 A;  2TDX A;  3FXQ A;  1APL C;  3BA7 A;  1HDP A;  4DYR A;  3CC7 I;  2EIM H;  2GIV A;  3I4N J;  3S8J A;  1VQ7 I;  3JW4 A;  5GAG J;  4GYI A;  2R7X A;  3OBT A;  1LDJ A;  4R6U B;  1W5S A;  2J5O A;  3S14 J;  1G82 A;  3FXJ A;  1JKR C;  2DA5 A;  3MKL A;  1P92 A;  5FLX K;  1ZK8 A;  5GPC A;  3OS2 A;  1HWM B;  2K86 A;  1Z21 A;  5F27 A;  4P9F A;  3I29 B;  2ZXJ A;  3SHF A;  1GHC A;  2GA1 A;  2B9S A;  3VT2 A;  4NC7 A;  5DS9 A;  1WBC A;  2QM3 A;  1N4K A;  4G6M A;  2LSO A;  2DMQ A;  2LFB A;  2QYO A;  3F72 A;  2FSW A;  3OYB A;  5CQG A;  4GCV A;  2HPM A;  3LSH A;  1IN6 A;  3H3Z A;  2UZK A;  2DMT A;  1Z67 A;  1WJD A;  2MLG A;  2A5Y B;  1MH3 A;  2J5P A;  3FBN B;  5HOO A;  4ENK A;  2OPT A;  1B59 A;  1XD7 A;  1X4O A;  3MVP A;  2HWA A;  3KMV A;  2WBC A;  4KA4 A;  1YJ9 I;  3WMU A;  2PFB A;  2Z33 A;  5BQT A;  2X2S A;  1IN4 A;  2VBY A;  1MDM A;  2G9W A;  31BI A;  2JWT A;  2QQB A;  3CUO A;  4I6Z A;  2MD0 A;  1ONK B;  1SD4 A;  2R7F A;  2Q3N B;  3A02 A;  2FJ1 A;  4YFX F;  4BL0 B;  3OMY A;  1FOK A;  4Z8S B;  5DM6 F;  3P7N A;  1W5C C;  4MQV A;  1NG6 A;  3L2V A;  4G7H F;  3OSG A;  2LTP A;  2LYC A;  4KN4 X;  3O3Q A;  2BBY A;  1UEL B;  5FLV A;  1YHQ I;  2BOL A;  1YJN I;  2XPU A;  4EM1 A;  3C2G A;  1TWA J;  5FNX A;  1SC7 A;  4Z2Y A;  1IXC A;  2EZH A;  3MD2 A;  1YTO A;  3IWF A;  3QWL A;  5LFA A;  2W57 A;  3KEO A;  1T8I A;  4J01 A;  5CJ9 A;  2VXR A;  2O61 A;  3E6C C;  4WK8 F;  4M3B A;  1S5L C;  2FBK A;  3E1S A;  2Z5U A;  2W7N A;  3KET A;  3S8K A;  4BEH B;  1RZO B;  5K7Z A;  2BY0 A;  1K5U A;  2Y9X E;  4AN6 A;  5D6F A;  1ISV A;  1R23 A;  2VBX A;  3FJI A;  1WKM A;  1ZTR A;  1FP2 A;  3QPT A;  2F5V A;  4HLX A;  2LVS A;  1JGG A;  1UG0 A;  3SZT A;  3DWL E;  3BLY A;  2E71 A;  3BX1 C;  4M6V A;  4EJW A;  3VSZ A;  2X6Y A;  4LO3 A;  4V19 K;  3HOW J;  4J2S A;  1K4T A;  1WJC A;  1AVW B;  2JVG A;  4HYE A;  3GTG J;  2VUA A;  1E3H A;  2WC2 A;  1MMS A;  3FHN A;  1IAW A;  4A93 J;  1F36 A;  2JSP A;  2KHM A;  2ZXH A;  2XF5 A;  3MZ8 A;  4K2E A;  2V4J C;  5FJ8 J;  1QHH D;  3LFU A;  5LLQ A;  2R7W A;  3N7L A;  5IYC J;  4FE7 A;  4DIQ A;  4EEF G;  2NS7 A;  2AXL A;  2D1V A;  1T38 A;  1ZH5 A;  3ZGK A;  1FSH A;  3PUB A;  7I1B A;  1XX5 A;  1I1S A;  1W0U A;  2Q0O A;  3PME A;  4CUG A;  3PO3 J;  3Q0V A;  5D8L B;  3K1X A;  3K4K A;  2DMP A;  3E97 A;  1IJW C;  2EH3 A;  1HST A;  4QWQ A;  1RES A;  4DYC A;  3AJ5 A;  2ZB9 A;  3FXU A;  4USP A;  2G7H A;  4BDZ A;  3H9G A;  4RAG A;  1W3G A;  1A6Q A;  5F04 A;  1JT0 A;  4JQF A;  4XLF A;  3DLL F;  3SZP A;  2XVC A;  2RDP A;  4P96 A;  2JRM A;  3L2Q A;  3BB2 A;  3W6J B;  4Z6Y A;  3K0L A;  3Q0W A;  4ISR A;  2ACJ A;  4BQO A;  2VU9 A;  3WTW C;  1JUP A;  3CA1 A;  2EZI A;  5B1B H;  1A8D A;  5BPD A;  4PC4 A;  2F4O B;  3QR5 A;  1VQK I;  1M16 A;  3A2K A;  4S0H B;  1Y8R B;  1SVL A;  2Y30 A;  4XL9 A;  1P7I A;  5FO5 A;  4BS9 A;  3W2A A;  2W25 A;  2IA0 A;  2Y48 A;  1WVR A;  4KMU X;  2R3S A;  5ICG A;  2OUM A;  2EK5 A;  1TP0 A;  2NVU B;  2LKP A;  1R7J A;  1Y0U A;  3TOA A;  4BE1 A;  1IN5 A;  4ETS A;  3E0J B;  5K5Q A;  4I4Y A;  1R8N A;  2FQ4 A;  3S3O A;  3BCB A;  2W48 A;  4C3H J;  2VOO A;  1VQM I;  2OAZ A;  3H5N A;  1TWM A;  2CO5 A;  3VEP A;  2RV8 A;  1T4Q A;  3W2V A;  2R7D A;  5B5E C;  2F5C A;  2AFG A;  3FGM A;  4C3I J;  2F4I A;  4A3K J;  3PHZ A;  1V4R A;  3EUH A;  5DCF A;  1H9G A;  2AXT C;  2KRC A;  2XGC A;  1SVO A;  4JK1 X;  5FKN A;  4EJU A;  3ZQH A;  1R5G A;  3PNY A;  4KT6 A;  3REO A;  1FP1 D;  4GOY A;  4WXC A;  3AH2 A;  2H6B A;  2HVQ A;  1Z2V A;  3F8M A;  3BR2 A;  3CDI A;  3TKY A;  5E17 F;  1E17 A;  2E4M C;  4B4C A;  2NNN A;  3CO7 C;  1TBX A;  3ZOB A;  1DGW Y;  2DQL A;  1BAR A;  3TGN A;  1BI0 A;  2K5C A;  1IJT A;  3VSF A;  2DQR A;  3GTL J;  3IM7 A;  1YOV B;  1AU7 A;  4BJT A;  1XB4 A;  5KAI C;  4FE4 A;  4G7Z F;  1TL8 A;  1STZ A;  4KIT B;  1S7A A;  2EQR A;  1W36 D;  3J7Z I;  1WWX A;  4I8M A;  5F6F A;  1S7O A;  3WG7 H;  4A3D J;  2JSC A;  3S17 J;  2K9M A;  1D0X A;  3LSM A;  3DV8 A;  1SR4 A;  1WZ2 A;  4LK1 F;  4NBQ A;  5FB2 A;  1TWE A;  3K4C A;  3KP7 A;  3M7G A;  1QQL A;  3AKH A;  1MC9 A;  4I4U A;  2ZBK A;  4BNC A;  1XSX A;  3QYB A;  2BE5 F;  2FOW A;  2A6H F;  3TOB A;  2CQ7 A;  2PG4 A;  1DUX C;  3V0B B;  1SFO J;  4Q5S F;  2RNG A;  2XKP A;  3CME I;  3R4S A;  3LQQ A;  1S0F A;  3MZY A;  2Z49 A;  2G0E A;  2YU9 J;  4IZE A;  4EFR A;  2W1O A;  3WIN C;  2RNJ A;  1ETY A;  2MSY A;  2DBB A;  3BG9 A;  2VOP A;  2F2E A;  3CMM A;  4YOL A;  1OCR H;  1JLX A;  2EFO A;  1JT6 A;  4UNO A;  2XKO A;  2L9R A;  4S04 A;  2ZFU A;  2XC7 A;  3CCE I;  3VT0 A;  1ZAR A;  3CD6 I;  1EKE A;  2WB1 N;  4I99 C;  2CWE A;  1LKX A;  3L09 A;  4A0Y A;  5K1Y A;  5DEQ A;  2GIZ A;  3WTU C;  3LL7 A;  2YPR A;  2FRH A;  2MAB A;  2XPW A;  1B9M A;  2DK8 A;  3KPH A;  1R36 A;  3WTV C;  4KIG A;  2Y2Z A;  3I56 I;  2FO1 A;  3ABT A;  4KDP A;  1Z7L A;  2DFH A;  3FJE A;  3K1N A;  1L0O C;  2CMP A;  1VFC A;  3H36 A;  4JAW A;  1YLF A;  4BE0 A;  3S32 A;  1H8A C;  4BJ6 C;  1FZP B;  2NOG A;  3POK A;  3MZH A;  2FEZ A;  5J1U A;  2L4M A;  4MEX F;  2I10 A;  2Y0M A;  1HKT A;  3VYU B;  2MGQ A;  2KDO A;  3AG2 H;  3LFK A;  4RAF A;  2JPB A;  2HQ5 A;  3IM5 A;  4KEJ A;  3CA5 A;  4YEJ A;  2STT A;  2QBY A;  1D3Y A;  2VIX A;  1TOO A;  1MBE A;  1LJ9 A;  2E19 A;  3FUQ A;  1R58 A;  3FDY A;  2R92 J;  1S7E A;  3B73 A;  5HNF A;  4ZBV B;  3HRM A;  3NEU A;  1YW9 A;  2CUF A;  2KJB A;  4JOM A;  2WRY A;  1EH7 A;  3VFZ A;  1IF1 A;  4GOV A;  2EIK H;  2A69 F;  2E34 A;  2L02 A;  3FIW A;  4ZJZ A;  3WTY C;  4EGZ A;  3B02 A;  2E1M B;  4J23 B;  1T9F A;  4OWJ A;  1W3F A;  1XMK A;  4B44 A;  2F2F C;  3BWG A;  3ZC9 A;  3HGY A;  3S16 J;  2VN2 A;  3M8F A;  5EYR A;  1VND A;  5LEK A;  1OQL B;  1IRA X;  2QUF A;  4W97 A;  4G1R A;  2K9L A;  3SJM A;  2HZT A;  1ORK A;  2DFE A;  4G6Q A;  2VUM J;  1IOB A;  4PSX A;  1LDD A;  3HKZ N;  5JHF A;  1I6X A;  2HGC A;  3HGG A;  3FKI J;  3A23 A;  1AVX B;  2AAI B;  1ETK A;  1WGX A;  2VXD A;  3CCR I;  1OKR A;  6I1B A;  3H5A A;  4B3X A;  3OIO A;  1OR7 A;  3CLO A;  4XRS A;  2D20 A;  3JRE A;  1FMW A;  4CJM A;  2YX4 A;  3QU3 A;  1ZAO A;  1K83 J;  2XSJ C;  4NQW A;  3SEZ A;  3O4D A;  2ID6 A;  1ITY A;  1X4P A;  3DBL B;  1XDU A;  3K70 C;  2BV6 A;  3H6S E;  3A0B C;  3O5W B;  2VON A;  2FDB M;  3MWM A;  1VZ0 A;  3JSP A;  2AQZ A;  4FQG A;  4FTH A;  3AZW A;  5D5W B;  2RG9 B;  4A12 A;  2QQA A;  2CQQ A;  1X1D A;  2KL4 A;  1UST A;  3RMX A;  2HS5 A;  3RQI A;  1AKH A;  4I0Y A;  1X3Z B;  3D7W B;  2FQ3 A;  2ESU A;  4Q48 A;  1U9O A;  4QPQ A;  1DFC A;  3QPH A;  3T1B A;  1IXR C;  3GFI A;  4II3 A;  3HB9 A;  2GBY A;  2XAG A;  4IQ4 A;  3ZMT A;  4E4H A;  4AYB N;  1WI9 A;  2AQF A;  4IQJ A;  3TO9 A;  2A6T A;  3U2R A;  1MKM A;  2PJR A;  3QPL A;  4GRI A;  1PVE A;  2DMU A;  3FZV A;  2CUE A;  1YRN B;  2Z99 A;  3E5Q A;  3HTS B;  2L5X A;  1U9N A;  1O3T A;  3S3M A;  5ILS A;  1DFQ A;  4OMY A;  1AXM A;  1SFX A;  1A36 A;  5D4R A;  5L3C A;  1UAA A;  5TGT A;  2JTV A;  3N7J A;  5BXR A;  4KEI A;  2UWM A;  1MGT A;  1FIA A;  4ZDL A;  5LRS A;  1FV3 A;  3P9C A;  4ON0 A;  3NBD A;  3OL4 A;  2QSG X;  3QOP A;  4BUP A;  4JKQ A;  3RKW A; 
#chains in the Genus database with same CATH homology
 4GP0 A;  4X37 A;  3L2U A;  2LRD A;  2D1Z A;  1I1B A;  3CP8 A;  4H04 A;  2RQ9 A;  2KP6 A;  21BI A;  4AVZ A;  1K5V A;  3A4C A;  2IGK A;  3FBI B;  4GP3 A;  2Y0S A;  3OIQ A;  2CV0 A;  3FJ8 A;  4ISQ A;  3MKW B;  3KYL A;  1P9Q C;  2UUS A;  1WJA A;  3CF2 A;  4N4O B;  4I3N A;  1AFC A;  1HKN A;  1X1C A;  3FJ9 A;  1BAS A;  4RM3 A;  1S0B A;  1PYV A;  2V9K A;  1WD4 A;  2XOA A;  3OJ2 A;  2Y9G A;  2WY7 Q;  2CH0 A;  3LSG A;  4HR6 C;  4JKX B;  4AN7 B;  3H9Q A;  3K4J A;  3HXL A;  3UD9 A;  1XG6 A;  1YE9 A;  1PUU B;  3QOD A;  4ZA3 B;  2D22 A;  4QO3 A;  4LO3 C;  3AKG A;  1D1B A;  3K4N A;  3IP4 B;  4LO2 A;  4BDY A;  5CPR B;  1ISX A;  1X1A A;  3TBI A;  2MC4 A;  3OYJ A;  2D7R A;  3CA4 A;  3WO3 A;  1BR4 A;  1XYF A;  4XQF A;  5FZY A;  1EVT A;  1G9A A;  3NWT A;  3FJK A;  4XKV A;  2W00 A;  5FZU A;  1NZK A;  3EUA A;  1MMD A;  1T95 A;  4MZG B;  5D63 A;  2MYS A;  4FET A;  1FMZ A;  1MMA A;  4D8H A;  4IHZ A;  1MMN A;  2D44 A;  5HLT A;  2ZXI A;  2P23 A;  3AKF A;  2VQL A;  2LH9 A;  1V5G A;  1P63 A;  3OBR A;  2F8X C;  4JPZ A;  4QC4 A;  5BQU A;  1MD6 A;  2WY8 Q;  1ABR B;  3EUH C;  5GAQ A;  2FGF A;  3AKI A;  4BXF A;  1WJB A;  4XOR A;  4E6K G;  4BEH A;  4XFU A;  1V5E A;  3H5R A;  4G6T B;  2HVS A;  4XLE A;  2HPI A;  3DTK A;  2ZSI B;  4JQ0 A;  2AQE A;  41BI A;  3LSK A;  2R7T A;  1BFB A;  1SR4 C;  3OYG A;  4P0J A;  4ZTF A;  4CCO A;  3OYE A;  4LO1 A;  2WA0 A;  1V5F A;  5HVQ C;  3AKZ A;  3VYS B;  1S0G A;  2LRE A;  3QOE A;  5FZZ A;  4C2T A;  2WAQ A;  2Z1D A;  5EHA A;  1DIW A;  1YX5 A;  3IAM 2;  1EA3 A;  4X39 A;  4ZDP A;  3TMO A;  4ZC3 A;  2CUZ A;  4MZH A;  1NUN A;  4XOT A;  3OYA A;  4QKR A;  4CCK A;  2V26 A;  4XMY A;  1PWA A;  5G00 A;  3MAL A;  2CW8 A;  2D7I A;  2BEA A;  4I37 A;  2MLL B;  1TT0 A;  2HWM A;  2RRE A;  3K4M A;  3B9U A;  2ELJ A;  3O4O A;  4I6I A;  2CV1 A;  4PJN A;  2XAU A;  3I3L A;  3UDA A;  2RST A;  1FV2 A;  4XKB A;  4MLO A;  2VSA A;  4QAL A;  4EB2 B;  1BLD A;  3FUO A;  1KNM A;  3ZXG A;  2WAD A;  1YF8 B;  2CUJ A;  2BEB A;  1X1B A;  1PJR A;  2NTD A;  4II2 A;  4NNJ A;  1OR7 C;  3H9J A;  1SFK A;  1QXM A;  5FRN A;  1DQO A;  2LG4 A;  3UD7 A;  1LVK A;  5JLV A;  2WBM A;  1CVS A;  1AF9 A;  3OWT A;  3OYH A;  4PFP A;  1Y6I A;  3O4A A;  4H75 A;  3V0B A;  4E7K A;  3I9V 2;  2XDV A;  2R4G A;  1JT3 A;  2L9S A;  3HL2 A;  4J2K A;  1S0E A;  4XON A;  4ITV A;  2NOJ B;  4USO A;  1DQG A;  3CA6 A;  2ZSH B;  3BA5 A;  2VSE A;  3HN1 A;  3F62 B;  1Z3Y A;  2VPL A;  1QQK A;  4OWK A;  4I4X A;  1GLN A;  1BLA A;  1HWP B;  4JP0 A;  2VLA A;  2FUG 2;  4PJJ A;  2M3A A;  2R7Q A;  4ZGR B;  3RSJ A;  2BW3 A;  2L9N A;  3EPZ A;  1FGA A;  3N05 A;  3AH4 A;  3O44 A;  1HCD A;  4KC3 A;  4D0T A;  4CA0 A;  4END A;  4OEF A;  4KBB A;  2IGM A;  3FJC A;  1IT0 A;  2X85 A;  3BAO A;  5B2H A;  4DBQ A;  1VCL A;  4GAF A;  4BGD A;  1BFC A;  3CRG A;  3AH1 A;  5BVP I;  1FWV A;  3OL3 A;  4PK4 A;  1D1A A;  4XNF A;  3GBG A;  3AL0 B;  4IX7 A;  1AVU A;  2IGO A;  2LY1 A;  4PFO A;  3CQA A;  2DCE A;  4F91 B;  1GGP B;  1BFF A;  4A7Y A;  3NWS A;  2ET2 A;  1JQZ A;  3T8S A;  3AZV A;  4II0 A;  3NBN A;  2LOO A;  4HST A;  1X19 A;  2X6X A;  2LBF B;  4PJM A;  3HMY A;  4F52 A;  3WO4 A;  1D1C A;  4XKI A;  3PL8 A;  2F6C A;  4HNU A;  1S9H A;  4E7J A;  4HSR A;  2UUZ A;  5F90 A;  1RG8 A;  3W9T A;  4ZFY B;  2BW3 B;  3IAG C;  4X0G A;  3CJR B;  3CU1 B;  2Q1Z B;  5KHD A;  4I4V A;  2NP0 A;  4XLA A;  1Q04 A;  2R7O A;  2DXI A;  2KKI A;  3C9Z A;  3FJJ A;  5D61 A;  1V6W A;  3I2A A;  3RCO A;  1Z0H A;  4U7B A;  4CSW A;  1JI8 A;  4ION A;  2KZV A;  3PSI A;  4D0Z A;  5KNL A;  4B47 A;  4DEN A;  4I7I A;  4QD2 B;  2ZQN A;  2KQR A;  4XN3 A;  3UD8 A;  1XHB A;  3RTR A;  4ZLB B;  4PSW A;  1SZ6 B;  4EEE B;  3BAV A;  5KCM A;  3OJV A;  1N77 A;  3ILA A;  1WJE A;  4G9N A;  3V0A A;  5BP5 C;  2DT7 B;  3EUK L;  1DP3 A;  1G8X A;  3RSN A;  4I1E A;  4YRV A;  1MMG A;  3LSI A;  3ZCO A;  2VXT I;  3CA3 A;  4BE2 A;  2LIE A;  1D0Y A;  4J00 A;  4FAS D;  3F9K A;  4Y3O A;  4IZX A;  3QYE A;  4B48 A;  2VLC A;  4UY4 A;  3VDX A;  3CZ6 A;  5JMC A;  1ZEL A;  4YEL A;  3V42 A;  1WJF A;  4C9Y A;  2DRZ A;  3M8J A;  2JVH A;  2R7U A;  3D5S C;  1E0O A;  2ZR1 B;  4XKW A;  1L2H A;  5LD2 C;  3BTA A;  4DOZ A;  4ZYA A;  1Q1U A;  3FJA A;  2A5W A;  3HPG A;  3HPH A;  2M7A A;  4Q9P A;  4GAI A;  3BG7 A;  4ZDO A;  3BAD A;  2WB1 A;  4U87 A;  3OGF A;  4EFP A;  1BA7 A;  1CE7 B;  1E0E A;  3OR1 C;  5FRO A;  3PNV A;  1ERD A;  2Z48 A;  2VQG A;  4LO7 C;  2E4M A;  1G9C A;  4OAY A;  2WAE A;  4F3Q A;  4EFQ A;  4PJL A;  4KEK A;  2NS2 A;  4XKC A;  1FQ9 A;  3UNG C;  3H6R A;  2KPM A;  3VSL A;  2KRH A;  3V0A B;  1LDK B;  3JRR A;  2P39 A;  1D0Z A;  4CCL A;  4F83 A;  4N4N B;  4LIU A;  3N7K A;  1TTU A;  3VWC A;  3L2R A;  3HKZ A;  3FJD A;  4LO8 B;  3OYN A;  3H35 A;  4QBV A;  2IWT B;  3OYL A;  4EKX B;  4L4I A;  2IS6 A;  1RML A;  3MKZ A;  2GZB A;  2DRY A;  2L5Q A;  3SEQ A;  1PUM B;  1G59 A;  5F8W A;  4LIT A;  4I4R A;  3FJH A;  3J7A Y;  1R8O A;  3LTQ A;  2IS1 A;  4I4S A;  3NJ5 A;  4IY9 A;  3OYM A;  2E1M C;  5BOW A;  5BXT A;  4AYB A;  1TIE A;  2HNH A;  3VYR B;  1JY0 A;  4XOP A;  3OGG A;  2K3P A;  2L2O A;  3ZQQ A;  4P0K A;  1R6R A;  5FNW A;  3HUG B;  4I4P A;  2KLO A;  5I1B A;  4XFS A;  4CCM A;  3RMY A;  2X6W A;  1S0L A;  4RLQ A;  4DJA A;  4MZF B;  4RLF A;  3PSF A;  3ZX7 A;  4AU7 A;  4P0L A;  2R7V A;  4IZZ A;  2CFO A;  1TFM B;  4XLH A;  1DGR M;  3HAL A;  1OLT A;  2BVM A;  4P1W A;  4OUJ A;  3DU6 A;  4IY8 A;  3H6R B;  4XFT A;  5EC5 A;  1M2T B;  2I8D A;  4OEG A;  4R79 A;  4IKF A;  3H6Q A;  5HNH A;  2IXS A;  2QN4 A;  3FJF A;  3D5R C;  1HWO B;  2JA2 A;  3FJB A;  3CRI A;  3OYD A;  3W3C A;  2DS0 A;  1S0C A;  5EG6 C;  3OYI A;  4I4Q A;  4RM2 A;  1DJS B;  4ZKT B;  1J0S A;  4DCK C;  4I1B A;  1WBA A;  2X2T A;  1K6Y A;  4BAC A;  1BFG A;  9ILB A;  3MKY B;  4QPO A;  2DOA A;  1EPW A;  3DKY A;  4HPQ A;  1JT4 A;  2LIQ A;  1QHG A;  1ISZ A;  2DRE A;  2R7S A;  4PUS A;  2HDW A;  3W2W A;  4Y4R A;  1BR2 A;  1EYL A;  3HG9 A;  3OJM A;  2LC2 A;  3A21 A;  4ZFU B;  3DQV C;  3RTJ B;  3Q7W A;  2VKD A;  3SZG A;  3K10 A;  3FKJ A;  4FVV A;  2XF7 A;  3UJ0 A;  4F93 B;  4LIV A;  4E7Z A;  1JT5 A;  2RQQ A;  3PNT A;  4HJJ A;  1ILR 1;  2V6E A;  2X1D A;  3A1Y A;  1II4 A;  2VAS A;  1YYN A;  2LBF A;  4ZOT A;  1BOB A;  2VQC A;  3TC2 A;  3BAG A;  3VT1 A;  2R7R A;  4G9M A;  3O4B A;  1V6V A;  4HEA 2;  3DPT A;  3N7M A;  3CAH A;  3S8P A;  4H4K C;  2VJI A;  4J2Y A;  1KON A;  4H9W A;  2M4G A;  3ZXS A;  4F34 A;  4OWL A;  3OR2 C;  3OS0 A;  1FMM S;  4QKS A;  3CES A;  3VYT B;  3R4U A;  3I2X A;  2Z16 A;  1IRP A;  3VWB A;  2M4K A;  1EV2 A;  1FN0 A;  2BVL A;  4P5O A;  1Y56 A;  8I1B A;  5E24 E;  2QKM B;  3CP2 A;  2O5R A;  3O4C A;  1D0H A;  2VB6 A;  2MFZ A;  4LO0 A;  3WO2 A;  1MNE A;  2DT6 A;  3LMM A;  2NZ9 A;  3OS1 A;  1JT7 A;  4CCJ A;  3S3N A;  2XF6 A;  2JUG A;  3DEE A;  4QBC A;  2LY2 A;  2IGN A;  4XN0 A;  2YUG A;  3NBE A;  1LFP A;  2L7K A;  4CCN A;  1W36 C;  1UPS A;  2HW9 A;  2GO2 A;  1PC8 B;  1DZD A;  2FFV A;  1DQU A;  2VJ5 A;  3KX2 A;  3IIR A;  3SNV A;  3CJQ B;  3IM6 A;  1BR1 A;  3DPU A;  4LO7 B;  1T0F C;  4HA2 A;  3WA1 A;  4X38 A;  2GOX B;  4BU2 A;  2BFH A;  4WBC A;  5DVH A;  1NG7 A;  1FMV A;  4LO2 C;  1HWN B;  3HOM A;  2CW7 A;  2NVH A;  3K4B A;  3RQ4 A;  2D23 A;  1ISW A;  1YXW A;  3NBC A;  3S93 A;  1JLY A;  2FFU A;  3CRH A;  3D5L A;  1DZC A;  2HU9 A;  3CA0 A;  2NM1 A;  5F8Y A;  3BA4 A;  1N75 A;  3ZC8 A;  4XR6 A;  3BAU A;  1MND A;  3G2B A;  4DEP A;  4ZFW B;  4KIS A;  2K4A B;  3BAH A;  1YBI A;  1IHK A;  3HOS A;  4CZC A;  3DKX A;  4HG2 A;  3OYC A;  5BQU C;  4J2X A;  1IIL A;  3OYK A;  3Q7X A;  5DZU A;  5D62 A;  3ONQ A;  4I8M A;  2X1C A;  1S0D A;  4JRA A;  2UV1 A;  3QYF A;  1ISY A;  2Y9F A;  2DJI A;  2Y9W C;  2P0W A;  2KLL A;  3HOT A;  1W3A A;  3A22 A;  3M1C A;  1WD3 A;  5BXP A;  1IRX A;  3BCA A;  2GOM A;  4DBR A;  3RPU D;  2MC2 A;  3H0D A;  4LO1 C;  4C2U A;  3A07 A;  2QYI B;  3N0K A;  3K70 D;  1J09 A;  3ZR8 X;  5CQE A;  1YX3 A;  1F31 A;  2VL8 A;  3E8L C;  5DSS B;  3RTI B;  2VJ4 A;  4P6A A;  4BQQ A;  4A7Z A;  2D24 A;  4I4O A;  3DTI A;  1HIB A;  1RY7 A;  3VUO A;  1XZZ A;  4Y33 A;  3DPL C;  4RMN A;  3VSK A;  4BQN A;  2NYY A;  1V6X A;  4C30 A;  2WAF A;  2AXM A;  3BC8 A;  2K43 A;  4BJ5 C;  5HPZ A;  3PFY A;  3BRG C;  4DGW B;  2Q9X A;  1DLL A;  3PG0 A;  4F55 A;  2HQA A;  3U21 A;  3LLP A;  3ZRG A;  3K6G A;  2VKH A;  4B43 A;  4IYB A;  2IHO A;  4E7H A;  3DTE A;  2KI6 B;  2VQH A;  2PMZ A;  1TZL A;  4OW4 A;  4L4H A;  3FFZ A;  2W82 A;  4Z9W B;  2MIB A;  1QU3 A;  4I2S A;  2E5Z A;  4E7S A;  2VXZ A;  4G6J A;  4XLC A;  2M0M A;  4OEE A;  4IQP A;  4HNT A;  4D9J A;  2Q2E B;  3PJR A;  4I96 A;  3DU5 A;  4Q91 A;  1FWU A;  3P6I A;  2HZ9 A;  4CH7 A;  4FGF A;  3AL0 C;  2M49 A;  3BAQ A;  4ZTJ A;  2CS3 A;  3Q7Y A;  3P6J A;  2OV7 A;  3KEY A;  4XM3 A;  3ZXD A;  5BXS A;  1G9D A;  3OIP A;  3TL4 X;  5DUY A;  1JTC A;  1V6U A;  3VEQ A;  4NQW B;  3UJ4 A;  2QKL B;  4TLP A;  3K4L A;  3C2H A;  3WIN A;  2E60 A;  3IAS 2;  2KMU A;  3OY9 A;  2ERM A;  4EAT A;  3IUO A;  3F1R A;  4OAZ A;  2IS2 A;  4NUB A;  4E7I A;  2PJR B;  3AFH A;  1MW7 A;  4KJZ A;  5F8S A;  2M7B A;  1AVA C;  1G9B A;  3MMY B;  2R9K B;  3BRF A;  1Q03 A;  1Z4S A;  3BRD A;  4F92 B;  2HZD A;  3DLA A;  3SDB A;  1SAU A;  2CV2 A;  3BG6 A;  1HA8 A;  2KI4 A;  2IS4 A;  3SYT A;  2HVR A;  3OYF A;  4ANJ A;  3MPP G;  2X51 A;  1Z3X A;  3L2W A;  4X3A A;  2F2F A;  4LO0 C;  2I1B A;  3HSM A;  2V7F A;  2OC6 A;  4QD2 C;  2E5N A;  5FRM A;  3O49 A;  1AA7 A;  1HCE A;  1U0J A;  3QYD A;  3WMV A;  3JUT A;  4LG3 A;  2X1E A;  4E7L A;  4HRI A;  4D1Q A;  2VJJ A;  2ZQO A;  2J3P A;  4NC8 A;  2K8R A;  1WJ5 A;  4A7K A;  2Z2S B;  3OOU A;  1WFX A;  4Q9G A;  3HBW A;  2W4S A;  5CKT A;  3UR3 C;  4OWR B;  1ITB A;  5BP5 A;  2D43 A;  1I1E A;  3V79 C;  3P53 A;  1PZZ A;  1N78 A;  3EF2 A;  3HC7 A;  3AJ6 A;  2V1N A;  2KH2 A;  3BA7 A;  3S8J A;  2R7X A;  3OBT A;  4R6U B;  1G82 A;  1HWM B;  3OS2 A;  3I29 B;  1Z21 A;  3VT2 A;  4NC7 A;  1WBC A;  1N4K A;  4G6M A;  3OYB A;  5CQG A;  2HPM A;  3LSH A;  1WJD A;  3FBN B;  5HOO A;  1X4O A;  2HWA A;  3KMV A;  2WBC A;  3WMU A;  2X2S A;  31BI A;  2MD0 A;  1ONK B;  2Q3N B;  4BL0 B;  3OMY A;  4Z8S B;  1NG6 A;  3L2V A;  2LYC A;  3O3Q A;  1UEL B;  2BOL A;  3C2G A;  5FNX A;  3MD2 A;  1YTO A;  5LFA A;  4J01 A;  2VXR A;  3E1S A;  2W7N A;  3S8K A;  4BEH B;  1RZO B;  1K5U A;  2Y9X E;  4AN6 A;  1ISV A;  3FJI A;  2F5V A;  1UG0 A;  3DWL E;  3BLY A;  3BX1 C;  3VSZ A;  2X6Y A;  4LO3 A;  4J2S A;  1WJC A;  1AVW B;  2JVG A;  2VUA A;  3FHN A;  2JSP A;  2KHM A;  2ZXH A;  2XF5 A;  2V4J C;  1QHH D;  3LFU A;  2R7W A;  3N7L A;  4DIQ A;  3ZGK A;  3PUB A;  7I1B A;  3PME A;  4CUG A;  3K1X A;  3K4K A;  3AJ5 A;  4USP A;  4BDZ A;  3H9G A;  1W3G A;  4JQF A;  4XLF A;  3BB2 A;  3L2Q A;  4ISR A;  4BQO A;  2VU9 A;  3CA1 A;  1A8D A;  4PC4 A;  3QR5 A;  1M16 A;  3A2K A;  4XL9 A;  4BS9 A;  3W2A A;  2OUM A;  1TP0 A;  4BE1 A;  3E0J B;  4I4Y A;  1R8N A;  3S3O A;  3BCB A;  3H5N A;  1TWM A;  2AFG A;  1T4Q A;  3W2V A;  3FGM A;  2F4I A;  3PHZ A;  2KRC A;  3PNY A;  4KT6 A;  4GOY A;  3AH2 A;  2HVQ A;  1Z2V A;  2E4M C;  1BAR A;  1DGW Y;  2K5C A;  1IJT A;  3VSF A;  3IM7 A;  4BJT A;  4KIT B;  1W36 D;  2K9M A;  1D0X A;  3LSM A;  1SR4 A;  1TWE A;  3K4C A;  1QQL A;  3AKH A;  1MC9 A;  4I4U A;  3QYB A;  3V0B B;  2RNG A;  3R4S A;  1S0F A;  2Z49 A;  4IZE A;  4EFR A;  2W1O A;  3WIN C;  3CMM A;  4YOL A;  1JLX A;  2ZFU A;  2XC7 A;  3VT0 A;  1LKX A;  3LL7 A;  2MAB A;  2FO1 A;  1Z7L A;  3FJE A;  2CMP A;  4JAW A;  4BE0 A;  3S32 A;  4BJ6 C;  3POK A;  3VYU B;  2KDO A;  3IM5 A;  4KEJ A;  3CA5 A;  4YEJ A;  2VIX A;  1TOO A;  3FUQ A;  3FDY A;  5HNF A;  4ZBV B;  2WRY A;  4JOM A;  4GOV A;  4ZJZ A;  2E1M B;  4J23 B;  1T9F A;  4OWJ A;  1W3F A;  2F2F C;  4B44 A;  3ZC9 A;  1OQL B;  1IRA X;  4G1R A;  2K9L A;  1IOB A;  4PSX A;  5JHF A;  3A23 A;  1AVX B;  2AAI B;  2VXD A;  6I1B A;  3H5A A;  4B3X A;  2D20 A;  1FMW A;  4CJM A;  3O4D A;  2XSJ C;  3SEZ A;  1X4P A;  3K70 C;  3O5W B;  3H6S E;  2FDB M;  1VZ0 A;  2AQZ A;  3AZW A;  2RG9 B;  1X1D A;  2KL4 A;  3RMX A;  4I0Y A;  3D7W B;  2ESU A;  4QPQ A;  1DFC A;  4II3 A;  4IQ4 A;  4E4H A;  2AQF A;  4IQJ A;  2A6T A;  2PJR A;  4GRI A;  2L5X A;  3S3M A;  1DFQ A;  1AXM A;  5BXR A;  1UAA A;  3N7J A;  5TGT A;  4KEI A;  2UWM A;  4ZDL A;  1FV3 A;  3NBD A;  3OL4 A;  4BUP A;  4JKQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...