3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
molecule tags Unknown function
molecule keywords 30kDa protein
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
3VWCA 1MD6A 4DEPA 1UPSA 2K8RA 2FDBM 2LIQA 2NZ9A 1EVTA 3S8JA 2Y9XE 1HWOB 3VSZA 1YF8B 3EF2A 4GOYA 4P0LA 4KEJA 3BADA 4X3AA 1FN0A 2VSEA 3BAQA 2M49A 3FJHA 2E4MA 4OUJA 4I7IA 4F34A 2BFHA 1WBCA 4G6MA 4J2SA 3AZVA 3IM5A 4QO3A 3BA5A 3VT2A 1R8OA 2HWAA 1AXMA 2RSTA 3I2XA 1SR4C 3CA3A 2E4MC 3CRIA 1S0CA 3CAHA 1BFBA 1PZZA 1SZ6B 2AFGA 3BX1C 1IJTA 3TC2A 4EB2B 2FO1A 4J2XA 3CRGA 2BEBA 4ZBVB 2VUAA 4I4SA 4IY8A 4QBCA 1BLDA 1DJSB 2Y9FA 2Y9WC 3HALA 4GP3A 4Z8SB 2D20A 4G1RA 3WA1A 3FJIA 1BA7A 4IZXA 3OJVA 1WD3A 2VU9A 3O44A 3P6IA 1FWUA 1HWNB 1IT0A 1E0OA 2GO2A 1FV3A 3BRDA 1S0EA 2P39A 3OGGA 3WINC 2F2FA 4F83A 3R4UA 1RY7A 3CA1A 5G00A 2D23A 1JLYA 3FJDA 3N7JA 3BAOA 3UJ4A 3RMYA 1QQKA 1BARA 4J2YA 3IAGC 4H9WA 3SNVA 2D24A 2WRYA 1S0LA 2DS0A 4YOLA 1AVWB 6I1BA 4I4VA 2KLLA 4IYBA 2Z48A 1FWVA 3CA5A 1Q04A 4PC4A 3H6SE 2K4AB 4LO3A 5F8WA 1D0HA 1MC9A 3A07A 5D63A 3OBRA 4IZEA 1G82A 5F8YA 2D22A 2KH2A 1L2HA 3P53A 3MALA 1BFFA 21BIA 2Y9GA 4IONA 3CA6A 1PUMB 4I2SA 4HJJA 1ISYA 2WBCA 4LO3C 4II0A 3FJ8A 2D43A 2KKIA 2K43A 1DZCA 3WO3A 3UDAA 3V0BB 2GZBA 3BRGC 1WBAA 3O4DA 2Q3NB 4J2KA 3O4CA 2D7RA 3O4BA 2UUSA 1G9DA 1G9BA 3OJ2A 3WMUA 3VUOA 2X2TA 4I4QA 2J3PA 5BP5C 1A8DA 1YXWA 4L4HA 3C9ZA 1BASA 3A23A 4QKSA 4JP0A 3O49A 5BQUC 3VEQA 2ZQNA 9ILBA 1I1EA 3R4SA 4LO0C 3V0BA 3MPPG 3A21A 2NP0A 3UJ0A 1BLAA 3ZX7A 2HZ9A 1BFGA 3BB2A 2IHOA 3PG0A 2AQZA 1JTCA 4I0YA 4I6IA 4ZOTA 4USOA 3WO2A 2R9KB 1I1BA 3H6RA 1ABRB 4X39A 1Q03A 2DREA 3VT1A 1JT4A 4ISQA 3CRHA 1S0BA 4LO8B 1G9CA 3UD7A 3T8SA 1EPWA 3O3QA 5FNXA 1XYFA 5F8SA 4ZFWB 4EFRA 1IHKA 3OBTA 5DUYA 1HCDA 1R8NA 41BIA 1M16A 2FFVA 4JKXB 3ZC9A 4IHZA 4ZGRB 1V6WA 3BA7A 4ZLBB 1ISVA 3O4AA 3W9TA 3AJ6A 3LLPA 4G9MA 2NTDA 4I4UA 2NYYA 3V0AA 3Q7YA 1RZOB 1YTOA 1Z0HA 4X37A 4AN6A 3HMYA 1FV2A 3V0AB 1S0FA 1S0GA 2FGFA 1Q1UA 3JRRA 4OEFA 5DVHA 1JQZA 3I29B 1DFQA 1FMMS 4FGFA 4FVVA 4I96A 1V6XA 5E24E 3CA0A 2HWMA 3BAVA 4QKRA 1VCLA 4KC3A 4OWJA 3O5WB 1G9AA 3AKGA 3FGMA 1GGPB 3FJEA 3ILAA 3FFZA 4EEEB 4LO7C 2VXTI 3QR5A 4L4IA 4OWLA 2RQ9A 4I4RA 4J23B 2F2FC 1HWMB 3NBDA 2KI4A 4Q9PA 4LO2C 4ZFUB 4JRAA 1AVXB 4H04A 2ZQOA 4LO1A 2VLCA 4TLPA 3IM6A 2MIBA 4OWKA 1P63A 1NZKA 5FZZA 5JLVA 4I3NA 3BTAA 4XFTA 3ZC8A 4DCKC 3HBWA 5DZUA 3E8LC 4LO1C 3BRFA 4OEEA 2P23A 2DRZA 4D0TA 1Z4SA 4I4XA 1TIEA 3F62B 3UD9A 1YYNA 2AXMA 4KEKA 4LO7B 3V79C 1TOOA 3FJBA 1JT5A 4CJMA 1HWPB 1JT3A 1FQ9A 1PWAA 1JY0A 2KI6B 1CVSA 4ZA3B 4Z9WB 4ZFYB 1ONKB 3HN1A 3O4OA 1OQLB 3BAUA 4HA2A 3S8KA 2NVHA 1DIWA 3BAGA 3H6RB 4Q91A 2D7IA 1KNMA 1DFCA 1HKNA 3ZXDA 1FGAA 2L5XA 5JMCA 4IQPA 5FNWA 3IIRA 3AJ5A 3CQAA 4D0ZA 1IRPA 4JKQA 1T9FA 3AH4A 4ZKTB 3FUQA 1M2TB 3POKA 3AKIA 4KBBA 1CE7B 3F1RA 3PHZA 1XZZA 4A7KA 1K5VA 1XG6A 1XHBA 2QYIB 4P6AA 4P0KA 2ZR1B 1DQGA 5FZYA 3RMXA 1JLXA 4OEGA 3AKFA 2HW9A 1DLLA 4LO2A 5EHAA 4QD2B 1EYLA 4GAIA 1WD4A 1TP0A 2DRYA 31BIA 3OJMA 4KEIA 1PUUB 4XKIA 2MC2A 3VT0A 3N7MA 5D61A 1NUNA 4LO0A 4I37A 1AF9A 1S0DA 3FJKA 3OGFA 1K5UA 4I4YA 5D62A 3NBCA 3A22A 1SR4A 4GAFA 4GOVA 1HIBA 3LTQA 3ZXGA 3WO4A 2Z49A 4USPA 4DENA 4EFQA 5DSSB 4XFSA 1ISWA 3FJAA 2QN4A 1PC8B 4I8MA 3RSJA 5BXSA 1N4KA 3IM7A 5B2HA 3WMVA 1F31A 5BOWA 1W3GA 3PMEA 1IOBA 2D1ZA 5HPZA 1ITBA 3CA4A 4QBVA 4QALA 1JT7A 3FJJA 7I1BA 1V6UA 2BEAA 3AH1A 1ISZA 3B9UA 3AKHA 3PUBA 4D8HA 3BAHA 1T4QA 4G9NA 1RMLA 3AZWA 3KMVA 2AAIB 5BXPA 4I1EA 2YUGA 3CU1B 4ENDA 1DZDA 3WINA 3NBEA 4EKXB 4HR6C 4I4OA 5EG6C 1AVAC 3D7WB 2F8XC 3I2AA 2MLLB 4AN7B 3Q7WA 1HCEA 1TWEA 1W3FA 1BFCA 4A7ZA 2ERMA 1QQLA 2ET2A 3HOMA 4QD2C 2IWTB 3FJCA 2X2SA 1IRAX 5F90A 4I1BA 3Q7XA 1EV2A 1TTUA 4XFUA 1FMZA 3K1XA 3NJ5A 1AVUA 3QYDA 5FZUA 5BP5A 1W3AA 2FFUA 3N7KA 4IY9A 3NBNA 2RG9B 5GAQA 1TWMA 2VXRA 5BQUA 3BA4A 3UD8A 1ILR1 4P0JA 3FJFA 3AH2A 3N7LA 3P6JA 1ISXA 1Z2VA 1QXMA 1V6VA 4Q9GA 1DQOA 2Q9XA 4JQ0A 3JUTA 4I4PA 3HSMA 4R6UB 5BXTA 4X38A 3N0KA 4JPZA 4WBCA 4QC4A 3RTJB 1II4A 4EFPA 3VSFA 4A7YA 5EC5A 4OW4A 4ISRA 8I1BA 3H6QA 1AFCA 5BXRA 4G6JA 2D44A 3RTIB 1IILA 4JAWA 5I1BA 3FUOA 4GP0A 2NM1A 2I1BA 2ESUA 3FJ9A 5BVPI 1RG8A 1YBIA 2LIEA 1J0SA 2VSAA 2XOAA 1TFMB
chains in the Genus database with same CATH superfamily
3VWCA 5GPCA 2NVUB 3B6CA 3WU2C 1HWOB 3REOA 1XMAA 2FBHA 2KHMA 2L7FP 2PEXA 1Y0UA 4L9JA 2O3FA 1AU7A 4P0LA 2LG4A 4CICA 4BBSJ 1BI2A 1N75A 5DM6F 3BG6A 2NS8A 5LHHA 3D1NI 2BGCA 2GQQA 3J81K 3BAQA 2ZBKA 3CMEI 3W6KB 5DM7F 2LY1A 2DW4A 4XNFA 5JHUA 2BFHA 2WTEA 5GAEJ 3E5XA 4I7IA 2DOEA 4G6MA 4J2SA 1X2MA 4HSTA 5IT3A 4XOPA 5E3NA 3JAMZ 1R49A 1JTXA 3HRUA 3K2ZA 5J40A 4ZJZA 3DPUA 3BA5A 1AA7A 2CJJA 2ID6A 1S5LC 5E3MA 2ADUA 3I2XA 2XPVA 4L0YB 1B9MA 4LJZF 4A6EA 1MJAA 5L3EA 3JSOA 2E4MC 1J5YA 4HDUA 3CA3A 5LEKA 2P6SA 3CAHA 5EDNA 2FO1A 1DPRA 2L4AA 2AHQA 3CRGA 2EK5A 4HBLA 4ZBVB 4A2UA 2B0LA 3VPRA 5BMZA 2AXTC 4I4SA 3S32A 2NVYJ 1I6XA 4Z2YA 4BQAA 1JJ8C 3IWZA 2XB5A 1S8NA 3IH4A 4FX0A 2QVOA 5FKNA 3OYLA 2ZXWH 4ZYAA 3PO3J 4Y13A 4AYBA 1FBUA 3JCUC 1OFCX 1TT5B 1QA6A 1K7AA 1PJRA 2ZXJA 1V5EA 3QPTA 3MKYB 1H0MA 4EATA 3HKZA 2PN6A 3I0TA 4BDZA 2DA4A 4IKFA 2HWVA 4XRMA 4PSXA 1HWNB 2OTJI 4P5OA 3OYMA 4F83A 1ODDA 1ON1A 4UB8C 1XB4A 3FBNB 2KRFA 3M3YJ 3FX3A 3AAFA 2UZKA 3BR2A 1TNTA 2VPLA 1B6AA 2UXXA 4YIIA 5G00A 5F08A 2GA2A 2L9RA 2DJIA 2H8WA 4PJMA 3RYRA 4P55A 1ACIA 1XGSA 4J2YA 3IAGC 4Y7NJ 5EEAA 2NVXJ 4HPQA 1VQ5I 2DS0A 3S14J 3IAS2 2X1DA 3AG3H 1SC7A 4I4VA 2R92J 2KLLA 1FWVA 1Q04A 4CO8A 2COMA 1RR7A 3M1EA 4JYKA 2IXSA 1BM9A 2FQ3A 4ZZDA 5K5QA 2FD5A 2MYSA 2FEZA 2VQGA 2VN2A 2HOTA 1S7EA 1EF4A 3NWSA 2HYGD 3FXRA 4EJUA 2H27A 1WH7A 1R1TA 3CCYA 3I71A 2R7TA 2VBZA 2Z2SB 4UY4A 1JGGA 5D4RA 3IUOA 5EGOA 3CUQA 4RLQA 2QA4I 1I5ZA 1XMKA 3ZR8X 2WBCA 4LO3C 3FBIB 3U1KA 3FJ8A 2Y0SA 4BACA 3CLOA 2D43A 1JUPA 2KKIA 5D8LB 2VJIA 4GXOA 3ERED 2K43A 1DZCA 5LBQA 3IRQA 3V0BB 4ETSA 5JVTA 2PMZN 4J2KA 2LBFA 2GA1A 3ZN1A 3HGGA 1BR4A 4GGGA 3DKYA 1B59A 5KK1A 3FIWA 1G9DA 2EFNA 2ECCA 3QPLA 2FJ1A 3FISA 3GX4X 2J3PA 4I4QA 3P5JA 1H88C 2I5UA 3E1SA 2L3DA 3QQAA 1BW5A 1BASA 3C9ZA 4QKSA 2OBPA 4NQWA 4JP0A 1ZLJA 3O49A 1TNSA 4OWRB 3R4SA 4IXAA 4LO0C 1R5ID 1UZCA 3IWFA 1STZA 2M7AA 3ZX7A 2RVCA 5J6XA 3FWEA 3DXJF 3EUAA 1BFGA 2QM3A 3BB2A 4XM3A 4A5MA 3T1BA 2X6OA 3EUHA 3HOSA 2LF8A 3L2VA 4ZYGA 3OS1A 1NK2P 2CQQA 4ZOTA 4D1QA 4I6ZA 1T8IA 2R9KB 4FT8A 2DI3A 1ZG1A 4PFOA 1ABRB 3E5UA 4X39A 1T0FC 1GUUA 5CVUA 3EYIA 3J80Z 2DREA 3DKWA 1G9CA 1S0BA 3O8HA 4HEA2 3R61A 4BXUA 1Z05A 1EPWA 1X19A 2IAIA 1XYFA 1H8AC 2IS6A 3MD2A 2GOMA 3F72A 5F8SA 1Q1VA 3WTYC 4EFRA 4IO9F 3D0SA 2ZMEC 2L9VA 1HCDA 1R8NA 5EGOB 3HXLA 2EBIA 41BIA 2PQ8A 1FJLA 1M16A 3TDZC 4XKCA 2OV7A 1K4SA 4JKXB 2R5ZA 2E7WA 1P4AA 1ORKA 3HB9A 3K6GA 2IP2A 2EILH 2ZFUA 4XRSG 3K10A 4KN7X 2ZSIB 3Q9SA 3JRFA 2MC3A 3LLPA 2KJCA 4G9MA 2OZUA 2QQBA 4OIOF 2O61A 3V0AA 2ZKZA 4E7SA 3Q7YA 3SEZA 1YTOA 5IP7J 1Z0HA 2F5DA 2PMUA 3BG7A 3BZ6A 4HSRA 3J80K 3ZGKA 1S0FA 4OOIA 2IGKA 3FXLA 4EQQA 1S0GA 1X2NA 4HAMA 3C3WA 2CUZA 2OF7A 4FGFA 1JXSA 1V6XA 2LLKA 3GUDA 1O7LA 5E8IA 2HWMA 4KC3A 3HUGA 4H0EA 1Z7UA 1ZREA 3GXOA 4N0BA 1F43A 1G9AA 2ZJQF 3ILAA 3FJEA 1USSA 3FFZA 1Y6IA 1ZLKA 4KUMA 3PNVA 3LA2A 1L3LA 3DPTA 3M8JA 2VXTI 4NHJA 1Z1DA 2P81A 2KMUA 4L5EA 4JK1X 3WTVC 5JFRA 3OSFA 2MD5A 2RN7A 3OYAA 4A6DA 1TLHB 3OYJA 3G4SI 3KP6A 2MGQA 3TQNA 3ZMVA 1AVXB 1KYZA 3KEQA 1K4TA 4LO1A 1SANA 1R23A 1E2XA 4EMSA 2D1VA 2MH9A 2F4MB 2R5YB 1LB2A 2VLCA 2WBMA 3ZCOA 2RQPA 3C2GA 1OCPA 1IN7A 3HDDA 3IM6A 2A5WA 2OTLI 4L18B 3ML6A 2HPMA 1X3WB 3E5QA 1Z77A 2O7OA 3H5NA 1LPQA 1ZRCA 3BTAA 1ZQ3P 4XFTA 1MD0A 3K1NA 1ZELA 1IG7A 2Q2EA 2JRMA 4PGGA 2DPUA 4C3JJ 2RV8A 2IS1A 1TQMA 4D0TA 2HR3A 3F8FA 1SFXA 4HF0A 1TIEA 1BA5A 2QF7A 2VBXA 1JKPC 1W36D 4LO7B 3BPVA 4RS8A 3FJBA 1JT5A 1S3JA 3SEQA 1TWCJ 4BHPA 1K6YA 2JUGA 2VC0A 4I98B 2VKEA 4ZYDA 5KAIC 4EJOA 4HRIA 1JT3A 2BY1A 4LD5A 4AU7A 1ZR4A 2GIVA 4F55A 3L2RA 1D5YA 1VI0A 5LGNA 4UNOA 1N25A 2M0CA 3LL7A 1X58A 2CS3A 2VQHA 1OQLB 2XRLA 5B1BH 4HA2A 3GVAA 1SAUA 2E36A 4PJ0C 1FOKA 3S8KA 2JA7J 1CF7A 2OCEA 2VKHA 2BHYA 5EF6A 3NEUA 4DYQA 1GXPA 3WU0A 4G7OF 1PUEE 4BL0B 2WAEA 2IBDA 5DS9A 1QVTA 1MBHA 1X1DA 1WZ2A 2XGDA 5JMCA 1SMYF 2EZKA 2OZ6A 2R3SA 2X1EA 2CQ7A 2X0LA 1JE8A 4ZYHA 2R4GA 3GTQJ 3S1MJ 1D0YA 2XDVA 3NWTA 1YHQI 2QCOA 4D0ZA 4JKQA 1HW5A 5E1XA 4PJNA 1T9FA 3AH4A 1ZARA 2E71A 3PO2J 3POKA 4IHYA 4OAYA 2HNHA 2Y75A 3DEEA 1Y8RB 3KEOA 3W2AA 3GFJA 3OV8A 2XAFA 4A12A 4OIQF 1XZZA 2H6BA 4QPQA 2STTA 4IL6C 5EG0A 2CG4A 3CMMA 4BE0A 2M9HA 3ZN0A 4EJWA 5ILVA 1GVJA 3BLYA 3MZ8A 4NDLA 4WF2A 2JUCA 4II2A 3TO7A 3V8JA 1RESA 1YJWI 2IT0A 1OYWA 2EIJH 2EV6A 1XX5A 2ZXHA 1DQGA 3ZQCA 2XVCA 5K5RA 1FSEA 1FTTA 1JLXA 2VT2A 2ESNA 3BR3A 1LQ1A 4IOAF 2CMPA 2W00A 5J3LA 2V1NA 5EZGA 1IRFA 3OOPA 2QUFA 3HM5A 3CDLA 3CF5F 2GZWA 3ECOA 5EHAA 3TP3A 2ETHA 2DRYA 2KIQA 2FOWA 4ASNA 4KYWA 3HOWJ 1PUUB 5J4VA 2FX0A 3PUFA 2E2HJ 3VT0A 3O6BB 2L01A 3AFHA 4E7HA 5IYDJ 1YOVB 3PQKA 4GYGA 3NBCA 1OR7A 3P7NA 2QENA 1HIBA 2M8GX 2F5EA 1R58A 2Z33A 3OWTA 4DENA 3HSEA 1A5JA 1B1BA 5DSSB 3FJAA 1P4XA 1WFXA 1PC8B 4GO1A 1IN8A 5BXSA 1HOMA 2VXZA 5ICCA 5A2QK 1WJEA 2COBA 2DA7A 5J4YA 4UUSB 1B8IA 1C0WA 4XQFA 1F31A 4DJAA 3PIOF 1QRYA 1FPQA 1VQKI 2LR8A 1TWFJ 1YRNB 4KITB 5CQEA 3FJJA 1ZG3A 5AIPA 3OYDA 2X1CA 5AONA 2ACJA 3RZDJ 2A69F 7I1BA 4JOMA 2KZVA 3FXQA 3PUBA 2JSCA 2VL8A 3QP5A 2Z9OA 4I01A 4L5IA 3V8LA 3AZWA 3ELKA 3KP4A 5BXPA 3P9KA 2YUGA 1KGSA 3LSJA 1KZHA 2QEXI 1MKMA 2JVGA 5DD8A 2Y0MA 1IJWC 4M74A 4HDVA 1DU6A 4BQOA 5C4JJ 2M5WA 4MZHA 3D7WB 2F8XC 3I2AA 3PNYA 4N9HA 4EJVA 4PGHA 1S29A 3Q7WA 2KT0A 1DDNA 1BFCA 4A7ZA 1GLNA 2JVHA 4XL9A 2Y30A 2BXZA 3CP2A 4D5FA 2IWTB 4KMUX 2EZHA 3FJCA 1P7IA 4B48A 1WKMA 5F90A 3FM3A 3ZPLA 3KX2A 5BPIA 1FMZA 4K2EA 3K1XA 4HF1A 1AVUA 4RAFA 2ME0A 3QU3A 4XN0A 4KJZA 2HVSA 2NRAC 5LEJA 5BP5A 2BV6A 2VPRA 4UVCA 4F92B 2KPMA 3ONQA 4I99C 4IVNA 1W3AA 5GTIC 2P0WA 9ANTA 5ICEA 5CVRA 2VXRA 4ZDLA 3M4OJ 4XORA 3QOPA 2K40A 4F91B 3HHHA 1MZBA 2LTPA 1XPXA 2DFFA 3LQRA 4P0JA 3COAC 3O2PE 4JX5A 5KVRA 3TO6A 4AM3A 3EUKL 3AH2A 2MD0A 3BG5A 4A3JJ 1K78A 1T33A 2M8EA 1ISXA 1V6VA 4Q9GA 2X6XA 1G59A 3TW6A 3ISPA 5HDGA 1ZAOA 1Z91A 4BBRJ 3HSMA 5BXTA 1VZ0A 2QZ8A 3ZQGA 3N0KA 3FKIJ 3HBLA 2Y48A 1I6HJ 3S3OA 3BCAA 4OINF 2ZC2A 1TWGJ 2EZLA 4CYDA 4ISRA 3W3CA 2D5VA 3I3LA 2D44A 1OJLA 3TBIA 2A5YB 2L7MP 2BZTA 1XMXA 3LA7A 1YIJI 3BCBA 3ZXSA 2P5LC 1PVEA 4JAWA 5I1BA 4FX4A 2L9SA 3TL4X 4Q48A 3CCUI 3CCEI 1FP2A 2FBIA 2JRTA 3CC7I 2MLKA 2N8GA 3DV8A 2GWRA 5FROA 1IN6A 3WG7H 1TFMB 3L9FA 2BY0A 5HDKA 2NZ9A 2NVQJ 2F4OB 4KN4X 3BJOA 1XGMA 2LH9A 2LSOA 5FO5A 5DYMA 4D7MA 3Q9VA 5E3OA 4KEJA 3GBGA 4U0VA 1ZTRA 1VQ6I 3UNGC 1IAWA 4E7JA 1HF0A 2M49A 3FJHA 2Q1ZB 2NYXA 3S15J 1E3OC 3GZ6A 3I59A 1WBCA 1MBEA 4U7BA 3DQVC 4XR6A 2DA2A 1J09A 4HNUA 5FRNA 2HDWA 2V9PA 2FU4A 3ZMZA 1TZLA 3OR1C 3DTIA 2A61A 2FNPA 1WPKA 2IEKA 3OYBA 1G3WA 1UFMA 2JQ7A 2RSTA 3S1NJ 4XKVA 2DOFA 3NAUA 5FJ8J 1QHHD 1U6GA 1PDNC 1SR4C 2DA5A 2ZSHB 4XLFA 3WTTC 2LBFB 3OYGA 3CRIA 1KQ9A 3I4NJ 4PJJA 1WWXA 3E6DA 3LA3A 1PZZA 1SZ6B 2L5QA 4NC8A 1LVKA 2AFGA 3TC2A 1DGRM 2WY7Q 3LSKA 3L2WA 1FOWA 4ZC3A 4JBAA 4L9VA 4YEJA 3J7YJ 5HODA 4G8XA 4L5JA 5ILUA 2Y9FA 1LVAA 3RJPA 5LFAA 4GP3A 3GYHX 2HOAA 2FOKA 1I3QJ 1Y1VJ 5EZHA 4FCYA 4IZXA 1FOYA 1LFUP 5F04A 1YX3A 2VU9A 3P6IA 5TGTA 3H9JA 2ISYA 2UXNA 3L09A 1TW3A 1BOAA 2HPIA 2GO2A 4UXNA 1BI1A 5E8GA 1FV3A 3F3XA 3PQJA 1S0EA 2ISZA 2YU9J 1ETOA 3E6MA 2EB7A 2VODA 2ZO4A 3L7WA 3RZOJ 4ON0A 1ON2A 1F36A 3RPUA 3K4NA 4M3BA 1W5CC 4N4NB 1IN5A 3N7JA 2KIMA 3CCQI 1FTZA 3RDIA 5AIQA 2ZB9A 5FKMA 3A02A 1QGPA 4QWQA 3RKXA 4CZZA 3BJAA 1K78B 3K4KA 1G2HA 2WRYA 3WTWC 2YX7A 3K70C 1XC5A 4YOLA 4I2OA 3WGGA 1MDMB 4Y3OA 4Z6YA 3AL0C 4HX7A 1VTNC 2YS9A 2KRCA 2Z48A 4PC4A 2BYVE 1HW1A 3SZTA 1KONA 3KYCB 3X2QH 3RQ4A 3AKZA 2R7SA 2W1OA 3WE3A 2IA0A 5E20A 5EYRA 3GTMJ 5JHFA 1D0HA 1P9QC 4Y15A 5HNFA 1ETKA 3H9QA 4PDKA 5IYBJ 3C18A 4C2UA 3IRRA 4BJ6C 2L7KA 2D22A 1L2HA 5L3BA 5DCMB 4YFXF 5FRMA 1Y8QB 1SVOA 4DYRA 1LE8A 1NH3A 1BFFA 21BIA 2Y9GA 4IONA 3ABMH 3CA6A 4OMZA 1E17A 3VWBA 4BDYA 2K9NA 4M9SA 2KIFA 4J19A 2KDOA 5FD6A 3GW2A 2QQAA 3VFZA 2DDBA 5JR3A 1OISA 4LGWA 3CCRI 3RTRA 5F1RA 2Q3NB 1OKRA 2ZMEB 3TEDA 4MQ9F 5LHIA 1Z9CA 4A0ZA 3I4MJ 3OJ2A 3JRBA 4XLNF 2DA3A 2ZJPF 1A8DA 1BBYA 4CSWA 3A23A 3ZMSA 5HS9A 1BI0A 2VKDA 1SEUA 2O6GE 3GTKJ 5BQUC 3VEQA 1FWZA 2B63J 4QLCU 4ENMA 1S7OA 3UJ0A 5HLTA 2VE8A 1YG2A 2IA1A 3BTCA 3QODA 4DOZA 1MH3A 1XS9A 3GZNB 4I0YA 4I6IA 2V7FA 4HOBA 4M3FA 2VI6A 2IS4A 4MO7A 2R7OA 2VLAA 3N97A 1N4KA 1Q03A 5B1AH 3EPZA 2O8XA 3VT1A 4MZGB 2VXDA 4LO8B 2EPFA 3J7ZI 2MC4A 3V42A 3UD7A 4A3MJ 2MG4A 3EUHC 1WHUA 2Q8KA 2QLZA 3O3QA 3AG2H 3A1YA 1D8JA 4ZFWB 4DQ2A 1LE8B 3BWGA 3LNQA 4UB6C 5L3GA 4D7NA 2HOSA 1YJ9I 4W97A 3SHFA 2V9KA 5KNLA 2FFVA 1FT9A 1W1WE 2JPCA 2DT7B 3DKXA 1OR7C 2QQ8A 4IRIA 1V6WA 3BA7A 1HQCA 1R9TJ 3L1PA 2R7FA 4BEHA 4B1RA 3W9TA 3CCLI 1WJ5A 1W5SA 3RIRA 1R5GA 3AJ6A 5HLGA 2EIMH 4XK4A 4XONA 2ZMEA 1Q1HA 2R7VA 1W7PB 1EJ9A 2Q2EB 4X37A 3K1MA 3O8GA 4XICA 3HMYA 4J01A 3V0AB 2KISA 5D5XB 2CV2A 4KNYA 2XKPA 1Y56A 1JQZA 3I29B 4H75A 4C2TA 3H92A 1XGNA 4I96A 2HZDA 5E24E 1CGPA 1MDMA 3CA0A 4EGYA 3PSFA 1RUNA 3AKGA 3CMAI 1GGPB 1BOBA 1IC8A 5HOOA 3OOUA 2P5KA 4ENNA 4KMFA 3SQNA 4MEXF 3S1QJ 2IRFG 4LO7C 2M4KA 5HVQC 1V4RA 2VASA 1LNWA 1S72I 1DQUA 2RQ9A 4OWLA 4XLCA 4PCQA 5HS8A 3WHBA 2IGOA 1KU9A 3MAJA 3R0AA 2F2FC 2KI4A 4Q9PA 2L02A 5GADJ 4ZFUB 4RB0A 2DN0A 1M1EB 4LK0F 5JLWA 4V19K 4DBRA 3BR6A 4A3IJ 1FZPB 1UHSA 3H36A 1U5TC 4HA8A 4D9JA 3VYSB 1J75A 4U88A 3G3ZA 5L3DA 2EFWA 3BZCA 1G6NA 4IJAA 3CQZJ 2F4IA 2P5VA 3VSKA 4FE7A 1XDSA 3HOTA 4I3NA 2H09A 4A3FJ 4HNTA 1MW7A 2R7QA 1U9NA 2X85A 3A03A 4DCKC 1YE9A 4LO1C 2A6EF 2DPDA 2P23A 5CYVA 2DAOA 4E6KG 4A3BJ 4CCNA 3D5RC 2DLLA 5M3FJ 4MFDA 1FMVA 3UD9A 1YYNA 4FE4A 3B6AA 4BY1J 2AXMA 1ETVA 5J1YA 1Y0NA 2CV0A 1J0RA 2IVMA 4BKXA 4LB5A 3Q3SA 2HFHA 2HI3A 1HWPB 2M0MA 1R71A 1FYMA 3WGIA 2ME6A 5B5EC 2DQRA 1JY0A 2KI6B 4HV5A 2OPTA 1BJZA 3BQZA 4IEJA 4BXFA 2OJED 1XG1A 4IRGA 5H6RA 5HS7A 4ZFYB 1ONKB 1BJAA 1WCMJ 2K3FA 1TTYA 3QYEA 3V7SA 4F7ZA 1IUYA 1IXRC 4HNVA 2WC2A 3LAJA 3BAGA 1X3ZB 4IX7A 2D7IA 2W48A 5IOYA 1UG0A 1G3TA 1DFCA 3IP4B 3ZXDA 1FGAA 1SFEA 3KZIC 5FNWA 4ZDPA 1X4OA 5J8FA 3G73A 1DUXC 1HCRA 3AJ5A 3CQAA 4HQEA 2I8DA 1SFOJ 1HKQA 3MFKA 2BY3A 1IRPA 3HOXJ 5F0CA 5E1WA 3GWZA 4NBQA 3HOYJ 2MBFA 3AKIA 3W6VA 1GXQA 2XAHA 4CCJA 3B02A 4RLFA 4A3EJ 4A7KA 2X9DA 5H2FC 1W0UA 2QYIB 4IQJA 3Q0WA 4P0KA 1IW7F 2GXBA 3FHZA 1MNDA 2J5OA 4X0GA 4F93B 1DP7P 3TOAA 1HDPA 1RR8C 2KJBA 3I9V2 3ABUA 3I56I 3FMSA 1WSUA 3AKFA 3JTHA 2EQRA 1R4MB 2R5ZB 3RKQA 1MBKA 5LRSA 2HW9A 1DLLA 1IGNA 4LO2A 3VYRB 3RI4A 4L9NA 4M9XA 1K79A 2FXAA 1EYLA 2CQXA 1I3AA 4PFPA 5L3FA 2XASA 2KL4A 4UVBA 3MN2A 4C2MJ 4A69C 4ZTJA 4RAZA 3AL0B 4XKIA 4N9IA 3NRVA 4XLHA 5D61A 2E35A 4LO0A 3CF2A 3PSIA 3HOUJ 1RRJA 1T08B 1K61A 5D4SA 5F0HA 1S0DA 2HOEA 1AKHB 1K5UA 5D62A 5GAHJ 4NUBA 3HZJA 2G0EA 3A22A 1OCOH 1SR4A 1MSEC 4OU0A 2B9SA 2CFOA 4XSXF 5CVVA 4CHUA 3KLOA 1VFCA 1FYLA 3F6OA 1ISWA 2E1MC 5IP9J 2ZJRF 4KDPA 3KP2A 6PAXA 3K69A 3S3MA 1JHFA 2HVQA 3RSJA 3IM7A 3S16J 2E19A 4PUSA 5BOWA 1W3GA 3PMEA 1IV6A 2NS0A 5LRRA 2X4HA 2D1ZA 3CA4A 4QBVA 1U2WA 4IRHA 2CFXA 4M6VA 1V6UA 3M8FA 1ISZA 5C4XJ 4YG2F 3AH1A 2WA0A 2M1BA 3V4GA 2BE5F 1LKXA 3AKHA 2NOJB 4A5NA 3C2BA 1SFUA 4G94A 1OCRH 1O3SA 3HOZJ 2W57A 3R6SA 1U78A 1ITYA 2AAIB 4I1EA 4GDFA 1DZDA 5J8CA 2EV5A 5GAGJ 1LEAA 3DPLC 3HC7A 1EH7A 2R7XA 2MH2A 4IHTA 5IT9K 1AVAC 4B43A 3F8NA 3OL4A 4Q47A 2DT6A 2K9LA 3FMRA 1W3FA 2A6TA 4HG2A 2ICWG 1QQLA 2ET2A 3HOMA 1T2KA 2NOGA 3V7RA 4KIBA 2LVSA 2DMUA 4BH9A 2E34A 2LF7A 1EV2A 1ERDA 3BOQA 1T6SA 3CTAA 3A01B 4XFUA 1LJ9A 2MFZA 1QZZA 1J9IA 4HF2A 3DU5A 4M3EA 2K86A 1H9TA 1FYKA 5CVIA 1POGA 1X4PA 4AIDA 3FHNA 2HDDA 1KYWA 2W85A 3F23A 4CCMA 5DUIA 2JA8J 1SFKA 1R22A 1W5TA 3RPUD 1TWMA 3KFWX 4WCGA 3ZQ7A 4CYCA 4C30A 3Q0VA 3K0LA 3OYEA 4XKBA 4UHTA 1HLVA 3UD8A 1ILR1 1ZN2A 1IDZA 4RMNA 2XV4S 4J00A 2QSGX 2JT1A 2PMZA 1MMSA 1T39A 3N7LA 2ZJ2A 2H1LA 1YTYA 1HSTA 1Z2VA 3N4MA 2P7VB 1DQOA 2IGMA 4JQ0A 3FDYA 4O6JA 2ZNZA 3OIPA 1X1BA 3JUTA 4B4CA 2XGCA 3DTKA 1ZG5A 3SFZA 4RGUA 1UAAA 2UUZA 4I4PA 2PBIA 3TW7A 1JT0A 4EM1A 1FBQA 4IOCF 3RTJB 2V79A 1TW2A 2FBKA 5FLVA 4U87A 2EFOA 4OW4A 1MBGA 3OYHA 1XD7A 5HLIA 5BXRA 2G7HA 3RPQA 2XF6A 3BR1A 1ZRDA 1TL8A 1X1AA 2NNYA 1GDTA 4ESJA 1BIBA 2WWYA 4GP0A 4P9FA 3FJ9A 2ESUA 3BR5A 4LIVA 4PZJA 4YIFA 1IUFA 5LGTA 1YBIA 5BVPI 1GT0C 2VSAA 2KRHA 2XOAA 5M5XJ 4HX8A 4E7LA 4AIHA 5FKOA 5D8KB 4EVIA 1JTYA 2RKHA 4CDGA 3A01A 4X6AJ 2K8RA 4Y17A 1EVTA 2QQ9A 3S8JA 2VJJA 1T38A 3DBRB 3F8MA 3VSZA 1IZ1A 3HHGA 3EF2A 1W7PD 3HJEA 3L2QA 1FOXA 3BADA 4CH7A 3TOBA 3SDBA 2XPUA 1FN0A 2YR2A 5K7HA 4OUJA 1ETQA 3CESA 5F1JA 5GP9A 5HNHA 1R7JA 2CW8A 5E3LA 1W0TA 3BTJA 3FXUA 5KCMA 2K9MA 3LSIA 1RC9A 4L0ZB 2JMWA 4FISA 2DFIA 3IH3A 2OCCH 4UUSA 1B8IB 1MBJA 3AZVA 4QO3A 3JW4A 3KP3A 2DK8A 4MHGA 2HWAA 1LDKB 2CSOA 5FB2A 3FF5A 3CUOA 3JRGA 4JX4A 3CJQB 3G6EI 2H94A 1YRNA 5IOZA 2ESHA 2KKOA 2K27A 4UUTA 5ERIA 4ZTFA 1JKQC 3GO5A 1KQ8A 1BFBA 4EB2B 2OQRA 4J2XA 3BJ6A 5D5WB 5FGMA 1IJTA 2BEBA 3I4PA 5FKLA 2CRGA 2NS7A 4A3LJ 4CGZA 1OCCH 4LG3A 2VUAA 1ENHA 3T8RA 4LB6B 4S04A 4KISA 4QBCA 1Z3YA 5F64A 1DJSB 2XRNA 1SD4A 2L0KA 5FLMJ 3S3NA 1MH4A 1WJAA 2VONA 2D20A 5A2QZ 3IH2A 4G1RA 3A2KA 5K5OA 3FJIA 2A05A 2XAQA 1VQ7I 4A93J 1ONVA 4BHCA 3O44A 4ZYEA 2XB0X 1FWUA 2ELHA 2F2EA 2Z99A 1T0FA 4CCLA 4G7ZF 3ABTA 3BRDA 3QWLA 2DTRA 3WINC 2F2FA 2K9QA 5K7FA 4F52A 1I1SA 3R4UA 4RGXA 4RB2C 3GTJJ 4KT6A 3QOEA 4AIKA 2E1MB 2TRTA 1ETYA 1RUOA 3CA1A 2D23A 1JLYA 3BQYA 3FJDA 2JTVA 2Z1DA 5K7ZA 4PK4A 3J7AY 3OR2C 3PJRA 4B47A 3N05A 1PUFA 1OCZH 1CQTA 1BARA 3NARA 3QPHA 4DW6A 4KT5C 4H9WA 2A07F 3B73A 3SNVA 2TCTA 2IPQX 3M7GA 2OD5A 3WTXC 1AVWB 4MZFB 4R8HA 5B66C 2NNNA 4B3AA 2HKXA 1OQYA 2L2OA 1TC3C 3CA5A 4IYBA 4XKWA 3ABLH 3H6SE 4YFKF 3HSRA 2DYSH 3OYNA 2K4AB 3HRTA 2XAJA 4BEHB 4C3IJ 4M73A 2NVTJ 4E4HA 5F8WA 3A07A 2D2WA 2OQGA 1Z0XA 2YU3A 1ZRFA 4LMYA 3JR9A 2ZCWA 1G82A 3MQ0A 3ROUA 4IZEA 2KH2A 2VUMJ 1LUJB 4P96A 3MALA 3GFLA 2JN6A 2DQLA 4I2SA 1T98A 3ECHA 4II0A 3HL2A 4RA2A 4Y52J 1Y39A 2NXNB 2XKOA 4RGSA 2W84A 4DIQA 3CC2I 3CMYA 5E17F 4WK8F 1WBAA 5HDNA 3O4BA 3O4CA 3QYBA 2CYYA 4IPAA 1G9BA 1KQ0A 1R1UA 2K9SA 3EETA 3WG9A 2VT3A 4MTEA 2X2TA 4CCKA 3R60A 5BP5C 2JWTA 2E1OA 3WTZA 1WI3A 1V55H 2QBYA 2GM4A 3H5RA 2ECBA 3K4BA 3ZQIA 2HTSA 1F4KA 3ERMA 2CO5A 3MPPG 3V0BA 3IAM2 3OS0A 1FMWA 4WXDA 2LC2A 4FETA 2L54A 1BLAA 1G3YA 2FMYA 2X51A 3UKGA 2HZ9A 2IHOA 3G1MA 3ASNH 3TMOA 2WAQN 4ENJA 1QU3A 5ILSA 2KLOA 3ZQLA 1GV5A 4USOA 3WO2A 2E5NA 1I1BA 1I1GA 2HU9A 3H6RA 4EEFG 3SJMA 4KIGA 4RB3C 2ELKA 1J7KA 4OIRF 4ISQA 3OSGA 4P1WA 1G8XA 3I58A 3T8SA 1QZYA 4RM2A 4AWXB 3ZQQA 2VE9A 1IHKA 2JJ7A 4E7KA 1YI2I 2E2IJ 3OBTA 1R6RA 1R4NB 1SAXA 1YQAA 3FXKA 2BBYA 1IDYA 2R7ZJ 1UHMA 1R5HA 1QPIA 3IL2A 3ULQB 2M30A 3W2VA 3SDGA 2KQRA 1VQ9I 1ISVA 1U5TB 3CJNA 1BC8C 3O4AA 1D1AA 3SZPA 2DU9A 3HG9A 3VEPA 1PP7U 4ABZA 4BAYA 1G4DA 2V1UA 3GTPJ 4I4UA 2RNGA 3BTLA 2NYYA 4ZDOA 1RZOB 2OA4A 2FUG2 2OAZA 1FV2A 2G7UA 4G12A 4BJTA 5B3SH 1QZEA 4HLXA 1A35A 1Q1UA 5DVHA 4PJLA 1DFQA 1FMMS 3HRMA 2HYFA 1WJDA 2HZTA 2M7BA 1TWAJ 3CUQC 4QKRA 1ZGJA 4OWJA 3D5SC 1USTA 3QPSA 1N78A 3FGMA 4EEEB 4BU2A 1HXDA 1I50J 3H3VK 1FLIA 1T56A 4MFEA 5ICFA 3QR5A 1RNLA 2XSJC 4I4RA 4QPOA 4RAYA 5DD4A 2HXIA 3HIFA 1HWMB 5IT9Z 4EM2A 4ITVA 2LMDA 3R4KA 2LFBA 1WH5A 4H04A 3FKJA 2LKSA 2ZQOA 4TLPA 1HSJA 4GCVA 3DP7A 2H6CA 5LGUA 1P63A 1TQIA 4ESFA 3ZRGA 4XIDA 4IF4A 1ZH5A 2P8TA 5J1RA 1F1ZA 3PNTA 2JSPA 2C6YA 4BS9A 2M3AA 2KIUA 5DCMA 1U8BA 2HQNA 3HBWA 1MMAA 3BRFA 4OEEA 3F8CA 3K4MA 1NG7A 2UWMA 2DRZA 1U5TA 2CWEA 1XCBA 1D1BA 3F62B 1RETA 3OYIA 3V79C 2DMNA 1ZYRF 5LLQA 3FXJA 1N77A 4CJMA 2VOOA 1SVMA 1YO5C 2L7ZA 3T0YA 5FLXK 1HBXG 1FQ9A 1MJBA 1MGTA 1CVSA 1D0ZA 4UV9A 4ZA3B 2MW8A 1IRXA 3S17J 3ASOH 4RDUA 3IHUA 2H8RA 2AO9A 2EFPA 4BYYA 2K5CA 2R0QC 1YJNI 2NVHA 2XROA 3MKZA 3F21A 4AD9A 1DIWA 4LLGF 2LKXA 3BDDA 1MIJA 3GCMA 3H6RB 2FE3A 3F22A 3QRFF 4Q91A 1UJ8A 5F0FA 3CDHA 5JVGF 1HKNA 5IYCJ 2PG4A 2WY8Q 5E18F 2L5XA 4MTDA 2RQQA 3IIRA 1BC7C 2M45A 1ZGAA 5H6QA 3SZGA 2HYJA 1AHDP 1ZR2A 4I09A 3V8KA 2XAGA 4ZKTB 3FUQA 2F5FA 1M2TB 4XN3A 1REPC 3DWLE 2FRHA 3M07A 4HZFA 3PHZA 1BL0A 4XRSA 1EA3A 1XG6A 1XHBA 2WB1N 2GIZA 4MLOA 3T5XA 5F6FA 3ZQHA 1O4XA 3IV5A 4JQFA 1LEBA 5H20A 3NQOA 2BVLA 2HQ5A 2IA2A 3M9AA 2ZR1B 2V6CA 2XF7A 3MWMA 2L9NA 3H3UA 3JRDA 1NG6A 3RMXA 2HXOA 1S9HA 2VBWA 3KETA 1AWCA 3LSMA 4O5VA 2LOOA 2LREA 3QP6A 4CYCB 3CO7C 5KHDA 3S8PA 1MBFA 3CCSI 5DTDA 5EG0B 4G9YA 1QNTA 5DEQA 1TP0A 1OMIA 1YS7A 2V4JC 4BE2A 2XGEA 31BIA 2FQ4A 2R7UA 3ZMTA 1W7PA 5BNGA 3AG1H 1NUNA 4BY7J 2BEOA 5DCFA 2D45A 1B72A 2CGPA 4I37A 1R1VA 3OGFA 1YW7A 1J2XA 4G6TB 4M72A 5IY5H 3LAPA 3EDPA 4GOVA 4IZZA 3K4JA 3SXYA 1YW8A 2P7CB 3WO4A 4DZJA 3ZXGA 2HEOA 3KE2A 4V2FA 2Z49A 5BS6A 5D6FA 1I39A 4LG0B 4EFQA 3MZYA 4LOCA 1VQLI 2QN4A 3OYFA 4MNUA 3F9KA 5CKTA 2PMHA 2QYOA 5B2HA 3WMVA 4IHSA 3VDXA 2KDZA 1IOBA 4FQGA 3E0JB 1A31A 1ITBA 1XTAA 1VQNI 3A0BC 3ZMUA 1WJFA 1Y1WJ 3VODA 4EM0B 2PJPA 3B9UA 4OAZA 2W7NA 4D8HA 4HLYA 4Q5SF 5CLSA 3BAHA 3KMVA 4Y4RA 4G9NA 2M34A 1S6LA 5ED4A 2RGVA 2DTZA 1A6QA 5CPRB 4ENDA 2GLOA 1SMTA 1BR1A 2V9VA 5IPAA 1O3TA 3WINA 4EKXB 3A0HC 1VQMI 5M5WJ 1U3EM 3BPXA 5EG6C 2BHZA 3W2WA 2MLLB 4AN7B 5FKKA 1HKSA 4IQ4A 1HCEA 3HSFA 4RAGA 1TWEA 1P6RA 3PIPF 1IXCA 1JGSA 2MSYA 4EGZA 2EJRA 1IXSB 3V7CA 5TISC 4D0PA 4UUVA 1IRAX 1QQIA 3LOCA 4U0WA 3RSNA 2O8KA 1YLFA 3DLLF 2WAFA 2F48A 4UY8I 3NJ5A 3DEWA 4GRIA 1XN7A 2XSDC 1B72B 4P9UA 5FZUA 1RI7A 2CQKA 3BR0A 3DBHB 2O03A 3HTUA 4NNJA 5KAFC 3J81Z 4GFBA 5K1YA 2W4SA 3CJTB 1RZ4A 4V2GA 2RG9B 4IY9A 4AVZA 5GAQA 2GAUA 3S93A 4UVAA 4LG0A 5JI6A 1FNNA 2CV1A 2E1NA 4BNCA 1ETWA 1HW2A 4A3CJ 3HUGB 2M87A 2TDXA 3FJFA 2DMTA 1TP4A 5J1UA 3RYPA 1AOYA 1DGWY 3GMEA 1RIOH 4XRFA 2I10A 3VSLA 1JUSA 3FZVA 3OL3A 4ANJA 4R6UB 2VJ4A 2DBBA 4X38A 3F6VA 1R00A 2DK5A 5LD2C 4D5CA 2A6HF 4EFPA 2FF4A 1QHGA 2GXGA 3R0JA 4OMYA 3DCFA 3LFUA 4M6XA 8I1BA 2EFQA 2DO7A 1AFCA 3H6QA 3BP8A 2P4WA 4N4OB 3RQIA 1FSHA 2YX4A 3RTIB 4FASD 1ETXA 2BW3A 1PUFB 1QBJA 4RGRA 3DFGA 1K6OA 2IW5A 3ZQFA 4BGDA 3I55I 1WJCA 2NM1A 3K9TA 4B44A 3PFYA 2LIEA 3HEFA 3MKWB 3C7JA 2AQEA 4BXXJ 1MD6A 2MLGA 4IHVA 2RDPA 1GHCA 3G2BA 1UPSA 2FDBM 2LIQA 4DEPA 1LDDA 2CUJA 3LQQA 2Y9XE 2HGCA 1YF8B 4GOYA 1HA8A 1D5VA 4X3AA 3S1RJ 2VSEA 1O7FA 3H1CA 3LSGA 1KA8A 3WGHA 2OUMA 1SD6A 2E4MA 5ICGA 3FXMA 4F34A 3U2RA 3U21A 1EH6A 3H5AA 4YFNF 3K4LA 1G3SA 2B7EA 5EEGA 1W36C 4EJTA 4I0BA 1MNEA 3BY6A 3E3VA 3IM5A 1QVUA 5D5UB 2E1CA 2JPBA 1XSXA 2DMPA 3VT2A 2DA6A 2DA1A 5BPDA 1MSFC 1AXMA 1R8OA 3K2AA 1H89C 1X1CA 4HX4A 1YYVA 1YFHA 2Z5UA 4CZCA 3H0DA 1S0CA 1KU7A 4II3A 3BX1C 2GBYA 3FXOA 3I59B 1BR2A 4XLPF 5GTHC 3FM5A 3ESWB 2XIGA 3JREA 4PSWA 2K4JA 4IY8A 1UELB 1K83J 1BLDA 1YIOA 4M9ZA 2Y9WC 3HALA 2VB6A 4Z8SB 3WTSC 5CVJA 3KYLA 3WA1A 1Z6RA 2O9LA 1BA7A 3LSTA 3PL8A 3OJVA 1WD3A 1Z3XA 5EJCA 2CUFA 4NC6A 4Q4ZF 1OCTC 2HQRA 4BUPA 2MA3A 1FIAA 4LIUA 1IT0A 1E0OA 2EA4A 2JA5J 1OYIA 3T8TA 2ZXIA 2CUEA 1JI8A 2P39A 3OGGA 1X1PA 1RY7A 1IO2A 1D0XA 3DF8A 3BAOA 3UJ4A 3RMYA 2VIXA 2K3PA 1QQKA 5M3MJ 3S2DJ 3KIOA 1LFPA 2D24A 1FC3A 1UHWA 2QWWA 3IKVA 1S0LA 1U0JA 6I1BA 2EZIA 1J59A 3TDUC 3GZ5A 4BQQA 3EQLF 2DOAA 1RKTA 3C2HA 4LO3A 3U1DA 1UB9A 2V6EA 2P6TA 1MC9A 3KZZA 5CJ9A 5D63A 3MEXA 3MKLA 3OBRA 4C9YA 1DU0A 3L2UA 4M6YA 2EH3A 5F8YA 3E7LA 3MMYB 1X3UA 3CUQB 3JSPA 2V26A 1MNMC 3P53A 4HW0A 4KICA 5M5YJ 1L0OC 3CC4I 3CCVI 2DFEA 2Y69H 3SFIA 1PUMB 4HJJA 4YRVA 4MEYF 3HPGA 3I5UA 3MCZA 3MZHA 3TP0A 1ISYA 3BG9A 3BTIA 4G7HF 2JA2A 4M3DA 5GPAA 3P9IA 2NAZA 3WTUC 4FHTA 3HTSB 1TT0A 3WO3A 2E7XA 2M4GA 3CLQA 3J7AO 5FFZA 1R36A 4GYIA 3CO6C 2RREA 2GZBA 3O3KA 3UDAA 3BRGC 1FX7A 3OIQA 3O4DA 3E97A 2EV0A 2D7RA 2UUSA 3TO9A 4U0YA 3WMUA 3VUOA 1BW6A 4E70A 3ABKH 3E6CC 3TGNA 2LRDA 2ZNYA 1YXWA 4L4HA 1F9NA 1P7JA 4AVPA 3AG4H 2LP0A 1CF7B 4MQVA 1ZKGA 9ILBA 2ZQNA 1I1EA 1D1CA 2HKOA 2Z16A 4H4KC 3S2WA 2QBYB 3GTLJ 3A21A 2NP0A 2HVRA 2DCEA 3GTGJ 2R7DA 2O5RA 1BIAA 3PG0A 2AQZA 4WWCA 1FBSA 3KPHA 1JTCA 3DU6A 1MMGA 3CDIA 4G6QA 4EV0A 5DV5A 4OIPF 2M2EA 4HQMA 1EH8A 1YS6A 4XLAA 1V5GA 1MMDA 4WXCA 1WRJA 4MGRA 2PJRB 1JT4A 3CRHA 3CJRB 5FNXA 2WAQA 2ZFWA 2JK3A 2G9WA 5DUYA 3LWFA 2V1DA 2DMQA 2CU7A 2IJLA 4XMYA 3LMMA 5J47A 4O3MA 5BOXA 1V54H 2VOPA 4XBFA 4TV7A 1LFBA 2VQLA 4U7DA 4IHZA 3ZC9A 4ZGRB 3DBLB 4ZLBB 3LSRA 1RPWA 2LY2A 2XAUA 4NQWB 3A4CA 1H9GA 5D6EA 2AXLA 4YIRX 3CCJI 4WX9A 2NTDA 2K02A 1FP1D 1JKOC 1WQ2A 2UV1A 2W82A 1V3FA 2DT5A 4KA4A 2AQFA 4AN6A 1TWHJ 3VB2A 2VJ5A 2FGFA 2R7WA 1FEXA 3JRRA 4BQNA 4OEFA 4BHBA 4FVVA 1EKEA 2PLYA 2WV0A 3OY9A 3FK6A 3BAVA 1MJ9A 3BZKA 1VQOI 1JHHA 1MMNA 1VCLA 3PM1A 3O5WB 3KP5A 3KYDB 3IC7A 1JUMA 1Z21A 3CP8A 3E6BA 4LK1F 3VYTB 5C44J 4UV8A 1ZGWA 3BC8A 2GOXB 3GLLA 3L2CA 3QAHA 1VF9A 4L4IA 3KLNA 4S05A 2KFDA 3CZ6A 3JRHA 1WGXA 4B8XA 1UG2A 4J23B 2LNBA 2GXAA 3KCCA 3NBDA 4LO2C 3QYFA 2OC6A 4JRAA 2XPWA 3Q5FA 3G1LA 1XCVA 5TJJA 3UR3C 2R5YA 3U9GA 1OYYA 3DLAA 3GLXA 2PJRA 4XOTA 2XUBA 2PFBA 3I53A 3HPHA 4AYBN 4CCOA 2MIBA 4OWKA 4I76A 3PFIA 4KIFA 1NZKA 3H35A 2WADA 2DFHA 3KEYA 1O57A 3KZYA 4MIMA 5FZZA 5JLVA 3JRIA 4C3HJ 3GFMA 2R93J 3IKTA 3ZC8A 2FMLA 2LYCA 2CW7A 1A04A 3HRSA 2VC1A 4R1HA 5DZUA 3E8LC 1PYVA 3DTEA 2CW0F 1TBXA 1B9NA 2W25A 1GVDA 4A0YA 1D8KA 2A3SA 2X6WA 3OYKA 2LD5A 1Z4SA 1V5FA 2YUSA 5F27A 2DXIA 2VQCA 4YELA 4I4XA 1I27A 2IS2A 1KU3A 1NHAA 2QKMB 2Y0SN 3CD6I 2F5CA 5E79C 2XC7A 2E5ZA 3P9CA 3RCOA 1BN5A 1TOOA 1JKRC 1VNDA 2MABA 2QSFX 4DNCA 1TQPA 3L00A 2EINH 1PWAA 3BG3A 4Z9WB 3GEZA 2XHKA 2Y9ZA 3HN1A 3K7AJ 1DPUA 1UMQA 2K7LA 3O4OA 3BAUA 1W4MA 3FMQA 2DJNA 3HGYA 4KFCA 1D3YA 2BY2A 2HS5A 2HQAA 2VKVA 3TKYA 4QTRA 1IF1A 2EIKH 3LFKA 1YW9A 1XSDA 2FNAA 1KNMA 1S7AA 3GF2A 3ZOBA 4M71A 4IQPA 1PP8F 2X6YA 4FTHA 2K4BA 4DBQA 3LSPA 4AC0A 3BROA 1XGOA 3D5LA 3M8EA 4IHWA 3WU1B 4Y33A 4RB1A 5EEHA 2DODA 4CUGA 4KBBA 2LY9A 2J5PA 1CE7B 2VBYA 2Z3YA 3F1RA 4ZZLA 1K5VA 4KEKA 4P6AA 1RKWA 1QPMA 3VOEA 5IP6A 2DYRH 3MVPA 1APLC 3ZP5A 2JA6J 5TRDA 1A6IA 2FSWA 3K4CA 1Z6TA 1U9OA 3K70D 2X48A 1F5TA 4I7HA 3GTOJ 5FZYA 1SD7A 2RC4A 3LSHA 1AKHA 4OEGA 4AUXA 3C1DA 4HYEA 3H0GJ 1WI9A 4BE1A 3G1OA 4DYCA 4DGWB 1VQ8I 5FD5A 4QD2B 2D1HA 4ESBA 1WD4A 2BXYA 2E60A 4GAIA 5LHGA 1HDDC 1O3RA 2A68F 3GFIA 3OJMA 4KEIA 2Y31A 4LLNA 2MC2A 1NK3P 4RBOA 3N7MA 3RKWA 5FLXZ 4M3GA 5E1ZB 2PI0A 1AF9A 3FJKA 2ID3A 1LDJA 1ZHFA 4DZPA 3VYUB 4IHXA 4I4YA 4GAFA 3F8BA 3LTQA 2FA5A 1FIPA 2F5VA 2CQNA 2RAEA 4E7IA 2HDCA 5HLHA 4USPA 1WVRA 3I54A 4LLLA 1IRZA 3H3ZA 1NTCA 4XFSA 4A3DJ 1OPCA 4I8MA 1SD5A 3W6JB 1E3PA 2XGXA 1QO0D 2BW3B 5HPZA 4ZH4F 2Y2ZA 1IV8A 4QALA 1JT7A 1Z67A 2ELJA 1IRGA 2BEAA 4LFUA 4AIJA 1ULYA 3BT9A 1VQ4I 1JT6A 2OU2A 1T4QA 1RMLA 1WJBA 3SYTA 2LK2A 3ZMDA 4X1EA 5JLXA 4S0HB 5CQGA 1HKTA 3CU1B 2H1KA 1DP3A 2LKPA 1SVLA 4CA0A 3NBEA 2XF5A 4E7ZA 2O0YA 3RKYA 4HR6C 4I4OA 2QGUA 2EWNA 2WV1A 3FK7A 2QSHX 4B09A 5L3CA 3G71I 3OMYA 4F3QA 1T95A 2ERMA 4LITA 1HC8A 4QD2C 2BVMA 1P4WA 2YPRA 3JRCA 3KP7A 3H9GA 1GV2A 3OIOA 3QU6A 2X2SA 3K1PA 1P92A 1UCRA 1XSVA 3Q7XA 4I1BA 1TTUA 4I02A 4JX6A 1E0EA 4A3GJ 2NS2A 4R79A 1OLTA 2LDUA 2WB1A 3QYDA 3HKZN 4RM3A 2V1XA 1IN4A 2E2JJ 3HYIA 1ZK8A 2FFUA 3N7KA 3NBNA 2HTJA 4XSZF 5FFXA 3S2HJ 2KP6A 3JTGA 5BQUA 3BA4A 4NC7A 2IGNA 2L4MA 3OS2A 1YX5A 4WXHA 2W24A 4W1UA 2EA2A 2Y9YA 3WHCA 4XLEA 3OYCA 2QKLB 3P6JA 2CH0A 4QSHA 1KU2A 1E3HA 1QXMA 4HV6A 4I0AA 4B3XA 1FY7A 2Q9XA 1B4AA 1BI3A 2STWA 5DUKA 1YITI 1EV7A 4ENKA 3WODF 2DDAA 5D5VB 4JPZA 3JRAA 2BOLA 4WBCA 4QIWN 5DDGA 4QC4A 2K85A 4NB5A 1JJ6C 1II4A 3VSFA 4A7YA 3EYYA 5EC5A 4L9TA 1VQPI 2JZYA 2Q0OA 3F0CA 5C3EJ 3HOVJ 2AS5F 3I64A 1U8RA 4G6JA 2RNJA 1O3QA 1IILA 1A36A 3DEUA 2R7RA 4BJ5C 1Z7LA 2YSRA 3CCMI 3JAMK 3FUOA 1P2FA 4A3KJ 4G6DA 2I1BA 2F6CA 1XDUA 3M1CA 1RG8A 4CXFA 1J0SA 4A0XA 5BQTA 3WE2A 2KZGA 2PX9A 3Q0UA
chains in the Genus database with same CATH topology
3VWCA 1MD6A 4DEPA 1UPSA 2K8RA 3G2BA 2FDBM 2LIQA 1EVTA 2NZ9A 3S8JA 2CUJA 2VJJA 2Y9XE 1HWOB 2LH9A 2KHMA 3VSZA 1YF8B 3EF2A 4GOYA 1HA8A 4P0LA 4KEJA 2LG4A 3GBGA 3L2QA 1N75A 3BADA 4X3AA 3BG6A 4CH7A 3SDBA 1FN0A 2VSEA 3LSGA 3UNGC 2M49A 4E7JA 3BAQA 3FJHA 9ILBA 2OUMA 2Q1ZB 2E4MA 4OUJA 2LY1A 4XNFA 3CESA 4I7IA 2BFHA 4F34A 3U21A 5HNHA 2CW8A 3H5AA 3K4LA 1WBCA 4U7BA 4G6MA 4J2SA 3DQVC 4XR6A 5KCMA 1W36C 4HSTA 2K9MA 1J09A 3LSIA 4XOPA 4HNUA 5FRNA 2HDWA 1MNEA 4ZJZA 3AZVA 3DPUA 3BA5A 1TZLA 1AA7A 3OR1C 3DTIA 3IM5A 4QO3A 3OYBA 3VT2A 1R8OA 2HWAA 1AXMA 1LDKB 4XKVA 2RSTA 3I2XA 1QHHD 3CJQB 1X1CA 1SR4C 3CA3A 2E4MC 2ZSHB 4XLFA 4CZCA 2LBFB 3OYGA 3CRIA 3H0DA 1S0CA 3CAHA 4ZTFA 4II3A 4PJJA 1BFBA 1PZZA 1SZ6B 2AFGA 2L5QA 4NC8A 1LVKA 1IJTA 3BX1C 3TC2A 1DGRM 2BEBA 3CRGA 4ZBVB 1BR2A 2WY7Q 3LSKA 3L2WA 3JRRA 4LG3A 4ZC3A 2VUAA 4I4SA 3S32A 4PSWA 4YEJA 4KISA 4IY8A 1Z3YA 1UELB 4QBCA 1BLDA 1DJSB 3OYLA 2Y9FA 3S3NA 2Y9WC 4ZYAA 5LFAA 1WJAA 2VB6A 2D20A 3HALA 4GP3A 4Z8SB 4AYBA 4G1RA 3A2KA 3KYLA 3WA1A 3FJIA 1BA7A 4IZXA 3PL8A 1PJRA 3MKYB 1V5EA 1WD3A 3OJVA 1Z3XA 3HKZA 4EATA 2VU9A 1YX3A 4BDZA 3O44A 4BUPA 4IKFA 3P6IA 1FWUA 5TGTA 3H9JA 4PSXA 4LIUA 1HWNB 1IT0A 1E0OA 2HPIA 4CCLA 2GO2A 2ZXIA 1FV3A 4P5OA 3OYMA 3BRDA 1S0EA 1JI8A 2P39A 3OGGA 3WINC 2F2FA 4F83A 4EEEB 3FBNB 4F52A 3R4UA 3K4NA 4KT6A 3QOEA 2VPLA 2E1MB 1RY7A 3CA1A 5G00A 4N4NB 2D23A 1D0XA 1JLYA 3FJDA 3N7JA 2Z1DA 3BAOA 4PK4A 3J7AY 3UJ4A 3OR2C 3PJRA 2DJIA 2VIXA 3N05A 4PJMA 4B47A 2K3PA 3RMYA 1QQKA 1BARA 4J2YA 3IAGC 4H9WA 3K4KA 3SNVA 1LFPA 2D24A 2WRYA 4HPQA 3K70C 1S0LA 2DS0A 4YOLA 3IAS2 2X1DA 1U0JA 1AVWB 4Y3OA 4MZFB 4I4VA 6I1BA 3AL0C 5E24E 2KLLA 2L2OA 2KRCA 2Z48A 1FWVA 3CA5A 1Q04A 4IYBA 4XKWA 4BQQA 4PC4A 2DOAA 1KONA 3OYNA 3H6SE 2IXSA 2K4AB 3C2HA 3RQ4A 4BEHB 3AKZA 4LO3A 2R7SA 2W1OA 4E4HA 2V6EA 5F8WA 5BXSA 5JHFA 2MYSA 1D0HA 1P9QC 2VQGA 5HNFA 1MC9A 3A07A 3H9QA 3OBRA 5D63A 4OEFA 3NWSA 4C9YA 4C2UA 3L2UA 4BJ6C 1G82A 2L7KA 4IZEA 2D22A 2KH2A 3MMYB 5F8YA 1L2HA 2R7TA 4FVVA 3P53A 2V26A 2Z2SB 5FRMA 3MALA 4UY4A 1BFFA 21BIA 2Y9GA 4IONA 3CA6A 1PUMB 3IUOA 4I2SA 4RLQA 4HJJA 4YRVA 3VWBA 3HPGA 4BDYA 3ZR8X 1ISYA 2WBCA 4LO3C 3FBIB 3HL2A 4II0A 2JA2A 2Y0SA 4BACA 2D43A 3FJ8A 2KDOA 2KKIA 2VJIA 2K43A 1TT0A 3WO3A 2M4GA 1DZCA 3UDAA 3V0BB 2RREA 3RTRA 4DIQA 2GZBA 3BRGC 3OIQA 1WBAA 2Q3NB 2LBFA 3O4DA 4J2KA 1BR4A 3O4CA 2D7RA 3O4BA 3DKYA 2UUSA 1G9DA 3QYBA 1G9BA 3OJ2A 3WMUA 3VUOA 2X2TA 4CCKA 4I4QA 2J3PA 5BP5C 1A8DA 2LRDA 1YXWA 3C9ZA 3E1SA 1BASA 4CSWA 3A23A 4L4HA 4QKSA 4JP0A 3H5RA 2VKDA 3K4BA 3O49A 5BQUC 3VEQA 2ZQNA 4OWRB 1D1CA 2Z16A 3R4SA 4H4KC 3MPPG 3A21A 3IAM2 3OS0A 4LO0C 1FMWA 2HVRA 3V0BA 2NP0A 2LC2A 4FETA 3UJ0A 1BLAA 2DCEA 5HLTA 2M7AA 2X51A 3ZX7A 2HZ9A 2O5RA 1BFGA 3EUAA 2IHOA 3BB2A 3PG0A 4XM3A 2AQZA 3TMOA 3QODA 4DOZA 1QU3A 1JTCA 3DU6A 3HOSA 4I0YA 1MMGA 2KLOA 2V7FA 3L2VA 3OS1A 4I6IA 4ZOTA 4USOA 4D1QA 3WO2A 2R9KB 2E5NA 1I1BA 2IS4A 2HU9A 4XLAA 2R7OA 2VLAA 4PFOA 1V5GA 1ABRB 3H6RA 4X39A 1MMDA 1T0FC 1Q03A 3EPZA 2DREA 2PJRB 3VT1A 1JT4A 4ISQA 3CRHA 2VXDA 1S0BA 4LO8B 4MZGB 4HEA2 2MC4A 3V42A 1G9CA 3UD7A 4P1WA 1G8XA 3T8SA 3CJRB 3EUHC 1X19A 2WAQA 1EPWA 1XYFA 3O3QA 2IS6A 3A1YA 3MD2A 2GOMA 4RM2A 5F8SA 4ZFWB 4EFRA 3ZQQA 1IHKA 3OBTA 4E7KA 5DUYA 1HCDA 1R8NA 1R6RA 3HXLA 2V9KA 4XMYA 3LMMA 5KNLA 41BIA 1M16A 2FFVA 4XKCA 2OV7A 4JKXB 2DT7B 3DKXA 1OR7C 3W2VA 2VQLA 4IHZA 3ZC9A 2KQRA 1V6WA 3BA7A 4ZGRB 3K6GA 1ISVA 4ZLBB 3O4AA 4BEHA 2LY2A 3W9TA 2XAUA 1D1AA 2ZFUA 3A4CA 3K10A 1WJ5A 3HG9A 2ZSIB 4NQWB 3AJ6A 3LLPA 4G9MA 4XONA 2NTDA 4I4UA 2RNGA 2NYYA 2UV1A 2W82A 2R7VA 3V0AA 4E7SA 3Q7YA 3SEZA 4ZDOA 1RZOB 2AQFA 2Q2EB 1YTOA 1Z0HA 4X37A 4AN6A 2FUG2 3BG7A 4HSRA 4J01A 3HMYA 1FV2A 3V0AB 3ZGKA 4BJTA 1S0FA 2VJ5A 2IGKA 1S0GA 2CV2A 2FGFA 5DVHA 2R7WA 1Q1UA 1Y56A 2CUZA 4BQNA 1JQZA 4PJLA 1DFQA 1FMMS 4C2TA 1WJDA 3I29B 2M7BA 4FGFA 3OY9A 2HZDA 1V6XA 4H75A 3CA0A 2HWMA 3BAVA 4QKRA 1VCLA 4KC3A 4OWJA 1MMNA 3PSFA 3D5SC 3O5WB 1G9AA 3AKGA 1N78A 3FGMA 1GGPB 3FJEA 3ILAA 1BOBA 1Z21A 3CP8A 3OOUA 3VYTB 1Y6IA 4BU2A 5HOOA 3FFZA 3PNVA 3BC8A 3DPTA 3M8JA 4LO7C 2GOXB 2M4KA 2VXTI 5HVQC 2VASA 3QR5A 4L4IA 1DQUA 2RQ9A 2KMUA 3CZ6A 4XLCA 2XSJC 4I4RA 4QPOA 2IGOA 3OYAA 4J23B 2F2FC 1HWMB 3OYJA 3NBDA 2KI4A 4Q9PA 4LO2C 3QYFA 4ZFUB 2OC6A 4ITVA 4JRAA 3UR3C 3FKJA 1AVXB 4H04A 4DBRA 2ZQOA 4LO1A 3DLAA 2PJRA 4XOTA 2VLCA 3HPHA 4CCOA 4TLPA 2WBMA 3ZCOA 3C2GA 2MIBA 3IM6A 4D9JA 3VYSB 1P63A 4OWKA 2A5WA 3ZRGA 3H35A 2WADA 1NZKA 3KEYA 2HPMA 5FZZA 5JLVA 2F4IA 3VSKA 3PNTA 2JSPA 3H5NA 4BS9A 3HOTA 4I3NA 2LYCA 3BTAA 2M3AA 2CW7A 4XFTA 3ZC8A 4HNTA 1MW7A 2R7QA 2X85A 1ZELA 4DCKC 3HBWA 1MMAA 5DZUA 3E8LC 1PYVA 1YE9A 3DTEA 4LO1C 3BRFA 2XOAA 4OEEA 2P23A 3K4MA 1NG7A 2UWMA 2IS1A 2DRZA 2X6WA 4E6KG 3OYKA 1Z4SA 4D0TA 1V5FA 3D5RC 4CCNA 4I4XA 2DXIA 1TIEA 1FMVA 2VQCA 4YELA 1D1BA 3F62B 1YYNA 3UD9A 1W36D 2AXMA 4KEKA 3OYIA 2QKMB 1TOOA 4LO7B 2XC7A 3V79C 2CV0A 2E5ZA 3RCOA 1JT5A 3FJBA 1N77A 3SEQA 4CJMA 1K6YA 2JUGA 2MABA 1HWPB 2M0MA 4HRIA 1JT3A 1FQ9A 1PWAA 4AU7A 1JY0A 2KI6B 1CVSA 1D0ZA 4ZA3B 4BXFA 1IRXA 4Z9WB 4F55A 3L2RA 4ZFYB 1ONKB 3LL7A 2CS3A 2VQHA 3HN1A 3O4OA 1OQLB 3BAUA 4HA2A 1SAUA 3S8KA 3QYEA 2K5CA 2NVHA 2HQAA 3MKZA 2VKHA 1DIWA 3BAGA 3H6RB 4Q91A 4IX7A 4BL0B 2WAEA 1KNMA 2D7IA 1UG0A 1X1DA 1DFCA 1HKNA 3IP4B 3ZXDA 1FGAA 2WY8Q 2L5XA 5JMCA 4IQPA 5FNWA 2RQQA 2X6YA 2X1EA 1X4OA 4ZDPA 3IIRA 3AJ5A 3CQAA 3SZGA 2IS2A 2I8DA 2R4GA 4DBQA 1D0YA 2XDVA 3NWTA 3D5LA 4D0ZA 1IRPA 4JKQA 4Y33A 4PJNA 1T9FA 3AH4A 3FUQA 4ZKTB 1M2TB 4XN3A 3POKA 4CUGA 4OAYA 2HNHA 3DEEA 3AKIA 4KBBA 4CCJA 3DWLE 3W2AA 4RLFA 1CE7B 3F1RA 3PHZA 1XZZA 4A7KA 4QPQA 1K5VA 1EA3A 3CMMA 1XG6A 4BE0A 1XHBA 2QYIB 4MLOA 4P6AA 4IQJA 4P0KA 3BLYA 4JQFA 4II2A 1MNDA 2BVLA 4X0GA 4F93B 2ZR1B 3K4CA 2XF7A 3K70D 3I9V2 2ZXHA 1DQGA 2L9NA 5FZYA 3RMXA 1NG6A 2FO1A 1JLXA 4OEGA 3LSHA 1S9HA 3AKFA 4OWLA 3LSMA 2CMPA 2W00A 2LOOA 2LREA 2V1NA 5KHDA 3S8PA 2HW9A 4BE1A 1DLLA 4LO2A 3VYRB 4DGWB 5EHAA 4QD2B 1EYLA 4GAIA 1WD4A 2E60A 1TP0A 4PFPA 2DRYA 2V4JC 4BE2A 31BIA 2KL4A 3OJMA 4ZTJA 3AL0B 4KEIA 2R7UA 1PUUB 4XKIA 2MC2A 4XLHA 3N7MA 3VT0A 5D61A 1NUNA 4LO0A 3CF2A 3PSIA 3AFHA 5FNXA 4I37A 4E7HA 1AF9A 1S0DA 3FJKA 3OGFA 1K5UA 3VYUB 4I4YA 5D62A 4NUBA 4G6TB 3NBCA 3A22A 1SR4A 4GAFA 4GOVA 1HIBA 4IZZA 3LTQA 3K4JA 2CFOA 3WO4A 3ZXGA 2F5VA 4E7IA 2Z49A 3OWTA 4USPA 4J2XA 4DENA 4EFQA 5DSSB 4XFSA 1ISWA 2E1MC 3FJAA 1WFXA 2QN4A 3OYFA 1PC8B 3F9KA 2HVQA 5CKTA 3S3MA 2VXZA 1N4KA 4I8MA 1WJEA 3RSJA 3IM7A 5B2HA 3WMVA 1F31A 4XQFA 4DJAA 4PUSA 3VDXA 1W3GA 3PMEA 1IOBA 5BOWA 2BW3B 3E0JB 2D1ZA 5HPZA 1ITBA 3CA4A 4QBVA 4KITB 4QALA 5CQEA 1JT7A 3FJJA 2ELJA 7I1BA 1WJFA 3OYDA 2X1CA 1V6UA 2BEAA 3AH1A 1ISZA 4JOMA 2KZVA 3B9UA 2WA0A 4OAZA 3AKHA 3PUBA 1LKXA 2VL8A 2W7NA 2NOJB 4D8HA 3BAHA 1T4QA 4G9NA 1RMLA 3AZWA 1WJBA 4Y4RA 3KMVA 3SYTA 2AAIB 5BXPA 4I1EA 2YUGA 3CU1B 4I96A 5CPRB 5CQGA 4ENDA 1DZDA 1DP3A 1BR1A 2JVGA 4CA0A 3WINA 3NBEA 4EKXB 3DPLC 3HC7A 4BQOA 2XF5A 4E7ZA 4HR6C 2R7XA 4I4OA 4MZHA 5EG6C 1AVAC 4B43A 3D7WB 2F8XC 3OL4A 3PNYA 3W2WA 3I2AA 2MLLB 4AN7B 2DT6A 4IQ4A 2K9LA 1HCEA 3Q7WA 1TWEA 1W3FA 3OMYA 1BFCA 4A7ZA 4F3QA 1GLNA 2A6TA 1T95A 2JVHA 3CP2A 4HG2A 4LITA 4XL9A 1QQLA 2ERMA 2ET2A 2IWTB 3HOMA 2BVMA 4QD2C 3FJCA 3H9GA 4B48A 2X2SA 1IRAX 5F90A 4I1BA 3Q7XA 1EV2A 1TTUA 3RSNA 1ERDA 3KX2A 4XFUA 2WAFA 1FMZA 1E0EA 2MFZA 2NS2A 4R79A 3K1XA 1AVUA 3NJ5A 3DU5A 4GRIA 1OLTA 2WB1A 3QYDA 4RM3A 4EB2B 1X4PA 4XN0A 4KJZA 2HVSA 3FHNA 5FZUA 4NNJA 5BP5A 4F92B 2KPMA 3ONQA 4CCMA 1W3AA 2FFUA 1SFKA 3N7KA 2P0WA 2W4SA 4IY9A 3NBNA 3RPUD 2RG9B 4AVZA 5GAQA 1TWMA 3S93A 2VXRA 4C30A 4ZDLA 2KP6A 5BQUA 4XORA 3OYEA 4XKBA 2CV1A 3BA4A 3UD8A 4F91B 1ILR1 4NC7A 2IGNA 3HUGB 4RMNA 4P0JA 3OS2A 1YX5A 4J00A 3FJFA 2PMZA 3EUKL 3AH2A 4XLEA 2MD0A 3N7LA 3OYCA 2QKLB 3P6JA 1I1EA 1DGWY 2CH0A 1ISXA 1Z2VA 1QXMA 1V6VA 4Q9GA 1DQOA 2X6XA 4B3XA 1G59A 2IGMA 2Q9XA 3FDYA 3VSLA 4JQ0A 3OIPA 1X1BA 3JUTA 4I4PA 3DTKA 3HSMA 3OL3A 4ANJA 1UAAA 2UUZA 4R6UB 5BXTA 2VJ4A 4X38A 1VZ0A 3N0KA 4JPZA 2BOLA 4WBCA 5LD2C 4QC4A 3RTJB 3S3OA 1II4A 3BCAA 1QHGA 4U87A 3VSFA 4EFPA 4A7YA 5EC5A 4OW4A 3OYHA 3LFUA 4ISRA 3W3CA 8I1BA 3H6QA 1AFCA 3I3LA 5BXRA 4G6JA 4N4OB 2D44A 3RTIB 4FASD 3TBIA 1IILA 2XF6A 2BW3A 4BJ5C 1Z7LA 2R7RA 1X1AA 3BCBA 3ZXSA 4JAWA 3FUOA 5I1BA 2L9SA 4BGDA 3TL4X 1WJCA 4GP0A 2NM1A 2I1BA 2ESUA 2F6CA 4LIVA 3PFYA 4B44A 3M1CA 1RG8A 1YBIA 3FJ9A 5BVPI 2LIEA 1J0SA 2VSAA 3MKWB 2KRHA 5FROA 4E7LA 2AQEA 1TFMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VWC A;  1MD6 A;  4DEP A;  1UPS A;  2K8R A;  2FDB M;  2LIQ A;  2NZ9 A;  1EVT A;  3S8J A;  2Y9X E;  1HWO B;  3VSZ A;  1YF8 B;  3EF2 A;  4GOY A;  4P0L A;  4KEJ A;  3BAD A;  4X3A A;  1FN0 A;  2VSE A;  3BAQ A;  2M49 A;  3FJH A;  2E4M A;  4OUJ A;  4I7I A;  4F34 A;  2BFH A;  1WBC A;  4G6M A;  4J2S A;  3AZV A;  3IM5 A;  4QO3 A;  3BA5 A;  3VT2 A;  1R8O A;  2HWA A;  1AXM A;  2RST A;  3I2X A;  1SR4 C;  3CA3 A;  2E4M C;  3CRI A;  1S0C A;  3CAH A;  1BFB A;  1PZZ A;  1SZ6 B;  2AFG A;  3BX1 C;  1IJT A;  3TC2 A;  4EB2 B;  2FO1 A;  4J2X A;  3CRG A;  2BEB A;  4ZBV B;  2VUA A;  4I4S A;  4IY8 A;  4QBC A;  1BLD A;  1DJS B;  2Y9F A;  2Y9W C;  3HAL A;  4GP3 A;  4Z8S B;  2D20 A;  4G1R A;  3WA1 A;  3FJI A;  1BA7 A;  4IZX A;  3OJV A;  1WD3 A;  2VU9 A;  3O44 A;  3P6I A;  1FWU A;  1HWN B;  1IT0 A;  1E0O A;  2GO2 A;  1FV3 A;  3BRD A;  1S0E A;  2P39 A;  3OGG A;  3WIN C;  2F2F A;  4F83 A;  3R4U A;  1RY7 A;  3CA1 A;  5G00 A;  2D23 A;  1JLY A;  3FJD A;  3N7J A;  3BAO A;  3UJ4 A;  3RMY A;  1QQK A;  1BAR A;  4J2Y A;  3IAG C;  4H9W A;  3SNV A;  2D24 A;  2WRY A;  1S0L A;  2DS0 A;  4YOL A;  1AVW B;  6I1B A;  4I4V A;  2KLL A;  4IYB A;  2Z48 A;  1FWV A;  3CA5 A;  1Q04 A;  4PC4 A;  3H6S E;  2K4A B;  4LO3 A;  5F8W A;  1D0H A;  1MC9 A;  3A07 A;  5D63 A;  3OBR A;  4IZE A;  1G82 A;  5F8Y A;  2D22 A;  2KH2 A;  1L2H A;  3P53 A;  3MAL A;  1BFF A;  21BI A;  2Y9G A;  4ION A;  3CA6 A;  1PUM B;  4I2S A;  4HJJ A;  1ISY A;  2WBC A;  4LO3 C;  4II0 A;  3FJ8 A;  2D43 A;  2KKI A;  2K43 A;  1DZC A;  3WO3 A;  3UDA A;  3V0B B;  2GZB A;  3BRG C;  1WBA A;  3O4D A;  2Q3N B;  4J2K A;  3O4C A;  2D7R A;  3O4B A;  2UUS A;  1G9D A;  1G9B A;  3OJ2 A;  3WMU A;  3VUO A;  2X2T A;  4I4Q A;  2J3P A;  5BP5 C;  1A8D A;  1YXW A;  4L4H A;  3C9Z A;  1BAS A;  3A23 A;  4QKS A;  4JP0 A;  3O49 A;  5BQU C;  3VEQ A;  2ZQN A;  9ILB A;  1I1E A;  3R4S A;  4LO0 C;  3V0B A;  3MPP G;  3A21 A;  2NP0 A;  3UJ0 A;  1BLA A;  3ZX7 A;  2HZ9 A;  1BFG A;  3BB2 A;  2IHO A;  3PG0 A;  2AQZ A;  1JTC A;  4I0Y A;  4I6I A;  4ZOT A;  4USO A;  3WO2 A;  2R9K B;  1I1B A;  3H6R A;  1ABR B;  4X39 A;  1Q03 A;  2DRE A;  3VT1 A;  1JT4 A;  4ISQ A;  3CRH A;  1S0B A;  4LO8 B;  1G9C A;  3UD7 A;  3T8S A;  1EPW A;  3O3Q A;  5FNX A;  1XYF A;  5F8S A;  4ZFW B;  4EFR A;  1IHK A;  3OBT A;  5DUY A;  1HCD A;  1R8N A;  41BI A;  1M16 A;  2FFV A;  4JKX B;  3ZC9 A;  4IHZ A;  4ZGR B;  1V6W A;  3BA7 A;  4ZLB B;  1ISV A;  3O4A A;  3W9T A;  3AJ6 A;  3LLP A;  4G9M A;  2NTD A;  4I4U A;  2NYY A;  3V0A A;  3Q7Y A;  1RZO B;  1YTO A;  1Z0H A;  4X37 A;  4AN6 A;  3HMY A;  1FV2 A;  3V0A B;  1S0F A;  1S0G A;  2FGF A;  1Q1U A;  3JRR A;  4OEF A;  5DVH A;  1JQZ A;  3I29 B;  1DFQ A;  1FMM S;  4FGF A;  4FVV A;  4I96 A;  1V6X A;  5E24 E;  3CA0 A;  2HWM A;  3BAV A;  4QKR A;  1VCL A;  4KC3 A;  4OWJ A;  3O5W B;  1G9A A;  3AKG A;  3FGM A;  1GGP B;  3FJE A;  3ILA A;  3FFZ A;  4EEE B;  4LO7 C;  2VXT I;  3QR5 A;  4L4I A;  4OWL A;  2RQ9 A;  4I4R A;  4J23 B;  2F2F C;  1HWM B;  3NBD A;  2KI4 A;  4Q9P A;  4LO2 C;  4ZFU B;  4JRA A;  1AVX B;  4H04 A;  2ZQO A;  4LO1 A;  2VLC A;  4TLP A;  3IM6 A;  2MIB A;  4OWK A;  1P63 A;  1NZK A;  5FZZ A;  5JLV A;  4I3N A;  3BTA A;  4XFT A;  3ZC8 A;  4DCK C;  3HBW A;  5DZU A;  3E8L C;  4LO1 C;  3BRF A;  4OEE A;  2P23 A;  2DRZ A;  4D0T A;  1Z4S A;  4I4X A;  1TIE A;  3F62 B;  3UD9 A;  1YYN A;  2AXM A;  4KEK A;  4LO7 B;  3V79 C;  1TOO A;  3FJB A;  1JT5 A;  4CJM A;  1HWP B;  1JT3 A;  1FQ9 A;  1PWA A;  1JY0 A;  2KI6 B;  1CVS A;  4ZA3 B;  4Z9W B;  4ZFY B;  1ONK B;  3HN1 A;  3O4O A;  1OQL B;  3BAU A;  4HA2 A;  3S8K A;  2NVH A;  1DIW A;  3BAG A;  3H6R B;  4Q91 A;  2D7I A;  1KNM A;  1DFC A;  1HKN A;  3ZXD A;  1FGA A;  2L5X A;  5JMC A;  4IQP A;  5FNW A;  3IIR A;  3AJ5 A;  3CQA A;  4D0Z A;  1IRP A;  4JKQ A;  1T9F A;  3AH4 A;  4ZKT B;  3FUQ A;  1M2T B;  3POK A;  3AKI A;  4KBB A;  1CE7 B;  3F1R A;  3PHZ A;  1XZZ A;  4A7K A;  1K5V A;  1XG6 A;  1XHB A;  2QYI B;  4P6A A;  4P0K A;  2ZR1 B;  1DQG A;  5FZY A;  3RMX A;  1JLX A;  4OEG A;  3AKF A;  2HW9 A;  1DLL A;  4LO2 A;  5EHA A;  4QD2 B;  1EYL A;  4GAI A;  1WD4 A;  1TP0 A;  2DRY A;  31BI A;  3OJM A;  4KEI A;  1PUU B;  4XKI A;  2MC2 A;  3VT0 A;  3N7M A;  5D61 A;  1NUN A;  4LO0 A;  4I37 A;  1AF9 A;  1S0D A;  3FJK A;  3OGF A;  1K5U A;  4I4Y A;  5D62 A;  3NBC A;  3A22 A;  1SR4 A;  4GAF A;  4GOV A;  1HIB A;  3LTQ A;  3ZXG A;  3WO4 A;  2Z49 A;  4USP A;  4DEN A;  4EFQ A;  5DSS B;  4XFS A;  1ISW A;  3FJA A;  2QN4 A;  1PC8 B;  4I8M A;  3RSJ A;  5BXS A;  1N4K A;  3IM7 A;  5B2H A;  3WMV A;  1F31 A;  5BOW A;  1W3G A;  3PME A;  1IOB A;  2D1Z A;  5HPZ A;  1ITB A;  3CA4 A;  4QBV A;  4QAL A;  1JT7 A;  3FJJ A;  7I1B A;  1V6U A;  2BEA A;  3AH1 A;  1ISZ A;  3B9U A;  3AKH A;  3PUB A;  4D8H A;  3BAH A;  1T4Q A;  4G9N A;  1RML A;  3AZW A;  3KMV A;  2AAI B;  5BXP A;  4I1E A;  2YUG A;  3CU1 B;  4END A;  1DZD A;  3WIN A;  3NBE A;  4EKX B;  4HR6 C;  4I4O A;  5EG6 C;  1AVA C;  3D7W B;  2F8X C;  3I2A A;  2MLL B;  4AN7 B;  3Q7W A;  1HCE A;  1TWE A;  1W3F A;  1BFC A;  4A7Z A;  2ERM A;  1QQL A;  2ET2 A;  3HOM A;  4QD2 C;  2IWT B;  3FJC A;  2X2S A;  1IRA X;  5F90 A;  4I1B A;  3Q7X A;  1EV2 A;  1TTU A;  4XFU A;  1FMZ A;  3K1X A;  3NJ5 A;  1AVU A;  3QYD A;  5FZU A;  5BP5 A;  1W3A A;  2FFU A;  3N7K A;  4IY9 A;  3NBN A;  2RG9 B;  5GAQ A;  1TWM A;  2VXR A;  5BQU A;  3BA4 A;  3UD8 A;  1ILR 1;  4P0J A;  3FJF A;  3AH2 A;  3N7L A;  3P6J A;  1ISX A;  1Z2V A;  1QXM A;  1V6V A;  4Q9G A;  1DQO A;  2Q9X A;  4JQ0 A;  3JUT A;  4I4P A;  3HSM A;  4R6U B;  5BXT A;  4X38 A;  3N0K A;  4JPZ A;  4WBC A;  4QC4 A;  3RTJ B;  1II4 A;  4EFP A;  3VSF A;  4A7Y A;  5EC5 A;  4OW4 A;  4ISR A;  8I1B A;  3H6Q A;  1AFC A;  5BXR A;  4G6J A;  2D44 A;  3RTI B;  1IIL A;  4JAW A;  5I1B A;  3FUO A;  4GP0 A;  2NM1 A;  2I1B A;  2ESU A;  3FJ9 A;  5BVP I;  1RG8 A;  1YBI A;  2LIE A;  1J0S A;  2VSA A;  2XOA A;  1TFM B; 
#chains in the Genus database with same CATH topology
 3VWC A;  5GPC A;  2NVU B;  3B6C A;  3WU2 C;  1HWO B;  3REO A;  1XMA A;  2FBH A;  2KHM A;  2L7F P;  2PEX A;  1Y0U A;  4L9J A;  2O3F A;  1AU7 A;  4P0L A;  2LG4 A;  4CIC A;  4BBS J;  1BI2 A;  1N75 A;  5DM6 F;  3BG6 A;  2NS8 A;  5LHH A;  3D1N I;  2BGC A;  2GQQ A;  3J81 K;  3BAQ A;  2ZBK A;  3CME I;  3W6K B;  5DM7 F;  2LY1 A;  2DW4 A;  4XNF A;  5JHU A;  2BFH A;  2WTE A;  5GAE J;  3E5X A;  4I7I A;  2DOE A;  4G6M A;  4J2S A;  1X2M A;  4HST A;  5IT3 A;  4XOP A;  5E3N A;  3JAM Z;  1R49 A;  1JTX A;  3HRU A;  3K2Z A;  5J40 A;  4ZJZ A;  3DPU A;  3BA5 A;  1AA7 A;  2CJJ A;  2ID6 A;  1S5L C;  5E3M A;  2ADU A;  3I2X A;  2XPV A;  4L0Y B;  1B9M A;  4LJZ F;  4A6E A;  1MJA A;  5L3E A;  3JSO A;  2E4M C;  1J5Y A;  4HDU A;  3CA3 A;  5LEK A;  2P6S A;  3CAH A;  5EDN A;  2FO1 A;  1DPR A;  2L4A A;  2AHQ A;  3CRG A;  2EK5 A;  4HBL A;  4ZBV B;  4A2U A;  2B0L A;  3VPR A;  5BMZ A;  2AXT C;  4I4S A;  3S32 A;  2NVY J;  1I6X A;  4Z2Y A;  4BQA A;  1JJ8 C;  3IWZ A;  2XB5 A;  1S8N A;  3IH4 A;  4FX0 A;  2QVO A;  5FKN A;  3OYL A;  2ZXW H;  4ZYA A;  3PO3 J;  4Y13 A;  4AYB A;  1FBU A;  3JCU C;  1OFC X;  1TT5 B;  1QA6 A;  1K7A A;  1PJR A;  2ZXJ A;  1V5E A;  3QPT A;  3MKY B;  1H0M A;  4EAT A;  3HKZ A;  2PN6 A;  3I0T A;  4BDZ A;  2DA4 A;  4IKF A;  2HWV A;  4XRM A;  4PSX A;  1HWN B;  2OTJ I;  4P5O A;  3OYM A;  4F83 A;  1ODD A;  1ON1 A;  4UB8 C;  1XB4 A;  3FBN B;  2KRF A;  3M3Y J;  3FX3 A;  3AAF A;  2UZK A;  3BR2 A;  1TNT A;  2VPL A;  1B6A A;  2UXX A;  4YII A;  5G00 A;  5F08 A;  2GA2 A;  2L9R A;  2DJI A;  2H8W A;  4PJM A;  3RYR A;  4P55 A;  1ACI A;  1XGS A;  4J2Y A;  3IAG C;  4Y7N J;  5EEA A;  2NVX J;  4HPQ A;  1VQ5 I;  2DS0 A;  3S14 J;  3IAS 2;  2X1D A;  3AG3 H;  1SC7 A;  4I4V A;  2R92 J;  2KLL A;  1FWV A;  1Q04 A;  4CO8 A;  2COM A;  1RR7 A;  3M1E A;  4JYK A;  2IXS A;  1BM9 A;  2FQ3 A;  4ZZD A;  5K5Q A;  2FD5 A;  2MYS A;  2FEZ A;  2VQG A;  2VN2 A;  2HOT A;  1S7E A;  1EF4 A;  3NWS A;  2HYG D;  3FXR A;  4EJU A;  2H27 A;  1WH7 A;  1R1T A;  3CCY A;  3I71 A;  2R7T A;  2VBZ A;  2Z2S B;  4UY4 A;  1JGG A;  5D4R A;  3IUO A;  5EGO A;  3CUQ A;  4RLQ A;  2QA4 I;  1I5Z A;  1XMK A;  3ZR8 X;  2WBC A;  4LO3 C;  3FBI B;  3U1K A;  3FJ8 A;  2Y0S A;  4BAC A;  3CLO A;  2D43 A;  1JUP A;  2KKI A;  5D8L B;  2VJI A;  4GXO A;  3ERE D;  2K43 A;  1DZC A;  5LBQ A;  3IRQ A;  3V0B B;  4ETS A;  5JVT A;  2PMZ N;  4J2K A;  2LBF A;  2GA1 A;  3ZN1 A;  3HGG A;  1BR4 A;  4GGG A;  3DKY A;  1B59 A;  5KK1 A;  3FIW A;  1G9D A;  2EFN A;  2ECC A;  3QPL A;  2FJ1 A;  3FIS A;  3GX4 X;  2J3P A;  4I4Q A;  3P5J A;  1H88 C;  2I5U A;  3E1S A;  2L3D A;  3QQA A;  1BW5 A;  1BAS A;  3C9Z A;  4QKS A;  2OBP A;  4NQW A;  4JP0 A;  1ZLJ A;  3O49 A;  1TNS A;  4OWR B;  3R4S A;  4IXA A;  4LO0 C;  1R5I D;  1UZC A;  3IWF A;  1STZ A;  2M7A A;  3ZX7 A;  2RVC A;  5J6X A;  3FWE A;  3DXJ F;  3EUA A;  1BFG A;  2QM3 A;  3BB2 A;  4XM3 A;  4A5M A;  3T1B A;  2X6O A;  3EUH A;  3HOS A;  2LF8 A;  3L2V A;  4ZYG A;  3OS1 A;  1NK2 P;  2CQQ A;  4ZOT A;  4D1Q A;  4I6Z A;  1T8I A;  2R9K B;  4FT8 A;  2DI3 A;  1ZG1 A;  4PFO A;  1ABR B;  3E5U A;  4X39 A;  1T0F C;  1GUU A;  5CVU A;  3EYI A;  3J80 Z;  2DRE A;  3DKW A;  1G9C A;  1S0B A;  3O8H A;  4HEA 2;  3R61 A;  4BXU A;  1Z05 A;  1EPW A;  1X19 A;  2IAI A;  1XYF A;  1H8A C;  2IS6 A;  3MD2 A;  2GOM A;  3F72 A;  5F8S A;  1Q1V A;  3WTY C;  4EFR A;  4IO9 F;  3D0S A;  2ZME C;  2L9V A;  1HCD A;  1R8N A;  5EGO B;  3HXL A;  2EBI A;  41BI A;  2PQ8 A;  1FJL A;  1M16 A;  3TDZ C;  4XKC A;  2OV7 A;  1K4S A;  4JKX B;  2R5Z A;  2E7W A;  1P4A A;  1ORK A;  3HB9 A;  3K6G A;  2IP2 A;  2EIL H;  2ZFU A;  4XRS G;  3K10 A;  4KN7 X;  2ZSI B;  3Q9S A;  3JRF A;  2MC3 A;  3LLP A;  2KJC A;  4G9M A;  2OZU A;  2QQB A;  4OIO F;  2O61 A;  3V0A A;  2ZKZ A;  4E7S A;  3Q7Y A;  3SEZ A;  1YTO A;  5IP7 J;  1Z0H A;  2F5D A;  2PMU A;  3BG7 A;  3BZ6 A;  4HSR A;  3J80 K;  3ZGK A;  1S0F A;  4OOI A;  2IGK A;  3FXL A;  4EQQ A;  1S0G A;  1X2N A;  4HAM A;  3C3W A;  2CUZ A;  2OF7 A;  4FGF A;  1JXS A;  1V6X A;  2LLK A;  3GUD A;  1O7L A;  5E8I A;  2HWM A;  4KC3 A;  3HUG A;  4H0E A;  1Z7U A;  1ZRE A;  3GXO A;  4N0B A;  1F43 A;  1G9A A;  2ZJQ F;  3ILA A;  3FJE A;  1USS A;  3FFZ A;  1Y6I A;  1ZLK A;  4KUM A;  3PNV A;  3LA2 A;  1L3L A;  3DPT A;  3M8J A;  2VXT I;  4NHJ A;  1Z1D A;  2P81 A;  2KMU A;  4L5E A;  4JK1 X;  3WTV C;  5JFR A;  3OSF A;  2MD5 A;  2RN7 A;  3OYA A;  4A6D A;  1TLH B;  3OYJ A;  3G4S I;  3KP6 A;  2MGQ A;  3TQN A;  3ZMV A;  1AVX B;  1KYZ A;  3KEQ A;  1K4T A;  4LO1 A;  1SAN A;  1R23 A;  1E2X A;  4EMS A;  2D1V A;  2MH9 A;  2F4M B;  2R5Y B;  1LB2 A;  2VLC A;  2WBM A;  3ZCO A;  2RQP A;  3C2G A;  1OCP A;  1IN7 A;  3HDD A;  3IM6 A;  2A5W A;  2OTL I;  4L18 B;  3ML6 A;  2HPM A;  1X3W B;  3E5Q A;  1Z77 A;  2O7O A;  3H5N A;  1LPQ A;  1ZRC A;  3BTA A;  1ZQ3 P;  4XFT A;  1MD0 A;  3K1N A;  1ZEL A;  1IG7 A;  2Q2E A;  2JRM A;  4PGG A;  2DPU A;  4C3J J;  2RV8 A;  2IS1 A;  1TQM A;  4D0T A;  2HR3 A;  3F8F A;  1SFX A;  4HF0 A;  1TIE A;  1BA5 A;  2QF7 A;  2VBX A;  1JKP C;  1W36 D;  4LO7 B;  3BPV A;  4RS8 A;  3FJB A;  1JT5 A;  1S3J A;  3SEQ A;  1TWC J;  4BHP A;  1K6Y A;  2JUG A;  2VC0 A;  4I98 B;  2VKE A;  4ZYD A;  5KAI C;  4EJO A;  4HRI A;  1JT3 A;  2BY1 A;  4LD5 A;  4AU7 A;  1ZR4 A;  2GIV A;  4F55 A;  3L2R A;  1D5Y A;  1VI0 A;  5LGN A;  4UNO A;  1N25 A;  2M0C A;  3LL7 A;  1X58 A;  2CS3 A;  2VQH A;  1OQL B;  2XRL A;  5B1B H;  4HA2 A;  3GVA A;  1SAU A;  2E36 A;  4PJ0 C;  1FOK A;  3S8K A;  2JA7 J;  1CF7 A;  2OCE A;  2VKH A;  2BHY A;  5EF6 A;  3NEU A;  4DYQ A;  1GXP A;  3WU0 A;  4G7O F;  1PUE E;  4BL0 B;  2WAE A;  2IBD A;  5DS9 A;  1QVT A;  1MBH A;  1X1D A;  1WZ2 A;  2XGD A;  5JMC A;  1SMY F;  2EZK A;  2OZ6 A;  2R3S A;  2X1E A;  2CQ7 A;  2X0L A;  1JE8 A;  4ZYH A;  2R4G A;  3GTQ J;  3S1M J;  1D0Y A;  2XDV A;  3NWT A;  1YHQ I;  2QCO A;  4D0Z A;  4JKQ A;  1HW5 A;  5E1X A;  4PJN A;  1T9F A;  3AH4 A;  1ZAR A;  2E71 A;  3PO2 J;  3POK A;  4IHY A;  4OAY A;  2HNH A;  2Y75 A;  3DEE A;  1Y8R B;  3KEO A;  3W2A A;  3GFJ A;  3OV8 A;  2XAF A;  4A12 A;  4OIQ F;  1XZZ A;  2H6B A;  4QPQ A;  2STT A;  4IL6 C;  5EG0 A;  2CG4 A;  3CMM A;  4BE0 A;  2M9H A;  3ZN0 A;  4EJW A;  5ILV A;  1GVJ A;  3BLY A;  3MZ8 A;  4NDL A;  4WF2 A;  2JUC A;  4II2 A;  3TO7 A;  3V8J A;  1RES A;  1YJW I;  2IT0 A;  1OYW A;  2EIJ H;  2EV6 A;  1XX5 A;  2ZXH A;  1DQG A;  3ZQC A;  2XVC A;  5K5R A;  1FSE A;  1FTT A;  1JLX A;  2VT2 A;  2ESN A;  3BR3 A;  1LQ1 A;  4IOA F;  2CMP A;  2W00 A;  5J3L A;  2V1N A;  5EZG A;  1IRF A;  3OOP A;  2QUF A;  3HM5 A;  3CDL A;  3CF5 F;  2GZW A;  3ECO A;  5EHA A;  3TP3 A;  2ETH A;  2DRY A;  2KIQ A;  2FOW A;  4ASN A;  4KYW A;  3HOW J;  1PUU B;  5J4V A;  2FX0 A;  3PUF A;  2E2H J;  3VT0 A;  3O6B B;  2L01 A;  3AFH A;  4E7H A;  5IYD J;  1YOV B;  3PQK A;  4GYG A;  3NBC A;  1OR7 A;  3P7N A;  2QEN A;  1HIB A;  2M8G X;  2F5E A;  1R58 A;  2Z33 A;  3OWT A;  4DEN A;  3HSE A;  1A5J A;  1B1B A;  5DSS B;  3FJA A;  1P4X A;  1WFX A;  1PC8 B;  4GO1 A;  1IN8 A;  5BXS A;  1HOM A;  2VXZ A;  5ICC A;  5A2Q K;  1WJE A;  2COB A;  2DA7 A;  5J4Y A;  4UUS B;  1B8I A;  1C0W A;  4XQF A;  1F31 A;  4DJA A;  3PIO F;  1QRY A;  1FPQ A;  1VQK I;  2LR8 A;  1TWF J;  1YRN B;  4KIT B;  5CQE A;  3FJJ A;  1ZG3 A;  5AIP A;  3OYD A;  2X1C A;  5AON A;  2ACJ A;  3RZD J;  2A69 F;  7I1B A;  4JOM A;  2KZV A;  3FXQ A;  3PUB A;  2JSC A;  2VL8 A;  3QP5 A;  2Z9O A;  4I01 A;  4L5I A;  3V8L A;  3AZW A;  3ELK A;  3KP4 A;  5BXP A;  3P9K A;  2YUG A;  1KGS A;  3LSJ A;  1KZH A;  2QEX I;  1MKM A;  2JVG A;  5DD8 A;  2Y0M A;  1IJW C;  4M74 A;  4HDV A;  1DU6 A;  4BQO A;  5C4J J;  2M5W A;  4MZH A;  3D7W B;  2F8X C;  3I2A A;  3PNY A;  4N9H A;  4EJV A;  4PGH A;  1S29 A;  3Q7W A;  2KT0 A;  1DDN A;  1BFC A;  4A7Z A;  1GLN A;  2JVH A;  4XL9 A;  2Y30 A;  2BXZ A;  3CP2 A;  4D5F A;  2IWT B;  4KMU X;  2EZH A;  3FJC A;  1P7I A;  4B48 A;  1WKM A;  5F90 A;  3FM3 A;  3ZPL A;  3KX2 A;  5BPI A;  1FMZ A;  4K2E A;  3K1X A;  4HF1 A;  1AVU A;  4RAF A;  2ME0 A;  3QU3 A;  4XN0 A;  4KJZ A;  2HVS A;  2NRA C;  5LEJ A;  5BP5 A;  2BV6 A;  2VPR A;  4UVC A;  4F92 B;  2KPM A;  3ONQ A;  4I99 C;  4IVN A;  1W3A A;  5GTI C;  2P0W A;  9ANT A;  5ICE A;  5CVR A;  2VXR A;  4ZDL A;  3M4O J;  4XOR A;  3QOP A;  2K40 A;  4F91 B;  3HHH A;  1MZB A;  2LTP A;  1XPX A;  2DFF A;  3LQR A;  4P0J A;  3COA C;  3O2P E;  4JX5 A;  5KVR A;  3TO6 A;  4AM3 A;  3EUK L;  3AH2 A;  2MD0 A;  3BG5 A;  4A3J J;  1K78 A;  1T33 A;  2M8E A;  1ISX A;  1V6V A;  4Q9G A;  2X6X A;  1G59 A;  3TW6 A;  3ISP A;  5HDG A;  1ZAO A;  1Z91 A;  4BBR J;  3HSM A;  5BXT A;  1VZ0 A;  2QZ8 A;  3ZQG A;  3N0K A;  3FKI J;  3HBL A;  2Y48 A;  1I6H J;  3S3O A;  3BCA A;  4OIN F;  2ZC2 A;  1TWG J;  2EZL A;  4CYD A;  4ISR A;  3W3C A;  2D5V A;  3I3L A;  2D44 A;  1OJL A;  3TBI A;  2A5Y B;  2L7M P;  2BZT A;  1XMX A;  3LA7 A;  1YIJ I;  3BCB A;  3ZXS A;  2P5L C;  1PVE A;  4JAW A;  5I1B A;  4FX4 A;  2L9S A;  3TL4 X;  4Q48 A;  3CCU I;  3CCE I;  1FP2 A;  2FBI A;  2JRT A;  3CC7 I;  2MLK A;  2N8G A;  3DV8 A;  2GWR A;  5FRO A;  1IN6 A;  3WG7 H;  1TFM B;  3L9F A;  2BY0 A;  5HDK A;  2NZ9 A;  2NVQ J;  2F4O B;  4KN4 X;  3BJO A;  1XGM A;  2LH9 A;  2LSO A;  5FO5 A;  5DYM A;  4D7M A;  3Q9V A;  5E3O A;  4KEJ A;  3GBG A;  4U0V A;  1ZTR A;  1VQ6 I;  3UNG C;  1IAW A;  4E7J A;  1HF0 A;  2M49 A;  3FJH A;  2Q1Z B;  2NYX A;  3S15 J;  1E3O C;  3GZ6 A;  3I59 A;  1WBC A;  1MBE A;  4U7B A;  3DQV C;  4XR6 A;  2DA2 A;  1J09 A;  4HNU A;  5FRN A;  2HDW A;  2V9P A;  2FU4 A;  3ZMZ A;  1TZL A;  3OR1 C;  3DTI A;  2A61 A;  2FNP A;  1WPK A;  2IEK A;  3OYB A;  1G3W A;  1UFM A;  2JQ7 A;  2RST A;  3S1N J;  4XKV A;  2DOF A;  3NAU A;  5FJ8 J;  1QHH D;  1U6G A;  1PDN C;  1SR4 C;  2DA5 A;  2ZSH B;  4XLF A;  3WTT C;  2LBF B;  3OYG A;  3CRI A;  1KQ9 A;  3I4N J;  4PJJ A;  1WWX A;  3E6D A;  3LA3 A;  1PZZ A;  1SZ6 B;  2L5Q A;  4NC8 A;  1LVK A;  2AFG A;  3TC2 A;  1DGR M;  2WY7 Q;  3LSK A;  3L2W A;  1FOW A;  4ZC3 A;  4JBA A;  4L9V A;  4YEJ A;  3J7Y J;  5HOD A;  4G8X A;  4L5J A;  5ILU A;  2Y9F A;  1LVA A;  3RJP A;  5LFA A;  4GP3 A;  3GYH X;  2HOA A;  2FOK A;  1I3Q J;  1Y1V J;  5EZH A;  4FCY A;  4IZX A;  1FOY A;  1LFU P;  5F04 A;  1YX3 A;  2VU9 A;  3P6I A;  5TGT A;  3H9J A;  2ISY A;  2UXN A;  3L09 A;  1TW3 A;  1BOA A;  2HPI A;  2GO2 A;  4UXN A;  1BI1 A;  5E8G A;  1FV3 A;  3F3X A;  3PQJ A;  1S0E A;  2ISZ A;  2YU9 J;  1ETO A;  3E6M A;  2EB7 A;  2VOD A;  2ZO4 A;  3L7W A;  3RZO J;  4ON0 A;  1ON2 A;  1F36 A;  3RPU A;  3K4N A;  4M3B A;  1W5C C;  4N4N B;  1IN5 A;  3N7J A;  2KIM A;  3CCQ I;  1FTZ A;  3RDI A;  5AIQ A;  2ZB9 A;  5FKM A;  3A02 A;  1QGP A;  4QWQ A;  3RKX A;  4CZZ A;  3BJA A;  1K78 B;  3K4K A;  1G2H A;  2WRY A;  3WTW C;  2YX7 A;  3K70 C;  1XC5 A;  4YOL A;  4I2O A;  3WGG A;  1MDM B;  4Y3O A;  4Z6Y A;  3AL0 C;  4HX7 A;  1VTN C;  2YS9 A;  2KRC A;  2Z48 A;  4PC4 A;  2BYV E;  1HW1 A;  3SZT A;  1KON A;  3KYC B;  3X2Q H;  3RQ4 A;  3AKZ A;  2R7S A;  2W1O A;  3WE3 A;  2IA0 A;  5E20 A;  5EYR A;  3GTM J;  5JHF A;  1D0H A;  1P9Q C;  4Y15 A;  5HNF A;  1ETK A;  3H9Q A;  4PDK A;  5IYB J;  3C18 A;  4C2U A;  3IRR A;  4BJ6 C;  2L7K A;  2D22 A;  1L2H A;  5L3B A;  5DCM B;  4YFX F;  5FRM A;  1Y8Q B;  1SVO A;  4DYR A;  1LE8 A;  1NH3 A;  1BFF A;  21BI A;  2Y9G A;  4ION A;  3ABM H;  3CA6 A;  4OMZ A;  1E17 A;  3VWB A;  4BDY A;  2K9N A;  4M9S A;  2KIF A;  4J19 A;  2KDO A;  5FD6 A;  3GW2 A;  2QQA A;  3VFZ A;  2DDB A;  5JR3 A;  1OIS A;  4LGW A;  3CCR I;  3RTR A;  5F1R A;  2Q3N B;  1OKR A;  2ZME B;  3TED A;  4MQ9 F;  5LHI A;  1Z9C A;  4A0Z A;  3I4M J;  3OJ2 A;  3JRB A;  4XLN F;  2DA3 A;  2ZJP F;  1A8D A;  1BBY A;  4CSW A;  3A23 A;  3ZMS A;  5HS9 A;  1BI0 A;  2VKD A;  1SEU A;  2O6G E;  3GTK J;  5BQU C;  3VEQ A;  1FWZ A;  2B63 J;  4QLC U;  4ENM A;  1S7O A;  3UJ0 A;  5HLT A;  2VE8 A;  1YG2 A;  2IA1 A;  3BTC A;  3QOD A;  4DOZ A;  1MH3 A;  1XS9 A;  3GZN B;  4I0Y A;  4I6I A;  2V7F A;  4HOB A;  4M3F A;  2VI6 A;  2IS4 A;  4MO7 A;  2R7O A;  2VLA A;  3N97 A;  1N4K A;  1Q03 A;  5B1A H;  3EPZ A;  2O8X A;  3VT1 A;  4MZG B;  2VXD A;  4LO8 B;  2EPF A;  3J7Z I;  2MC4 A;  3V42 A;  3UD7 A;  4A3M J;  2MG4 A;  3EUH C;  1WHU A;  2Q8K A;  2QLZ A;  3O3Q A;  3AG2 H;  3A1Y A;  1D8J A;  4ZFW B;  4DQ2 A;  1LE8 B;  3BWG A;  3LNQ A;  4UB6 C;  5L3G A;  4D7N A;  2HOS A;  1YJ9 I;  4W97 A;  3SHF A;  2V9K A;  5KNL A;  2FFV A;  1FT9 A;  1W1W E;  2JPC A;  2DT7 B;  3DKX A;  1OR7 C;  2QQ8 A;  4IRI A;  1V6W A;  3BA7 A;  1HQC A;  1R9T J;  3L1P A;  2R7F A;  4BEH A;  4B1R A;  3W9T A;  3CCL I;  1WJ5 A;  1W5S A;  3RIR A;  1R5G A;  3AJ6 A;  5HLG A;  2EIM H;  4XK4 A;  4XON A;  2ZME A;  1Q1H A;  2R7V A;  1W7P B;  1EJ9 A;  2Q2E B;  4X37 A;  3K1M A;  3O8G A;  4XIC A;  3HMY A;  4J01 A;  3V0A B;  2KIS A;  5D5X B;  2CV2 A;  4KNY A;  2XKP A;  1Y56 A;  1JQZ A;  3I29 B;  4H75 A;  4C2T A;  3H92 A;  1XGN A;  4I96 A;  2HZD A;  5E24 E;  1CGP A;  1MDM A;  3CA0 A;  4EGY A;  3PSF A;  1RUN A;  3AKG A;  3CMA I;  1GGP B;  1BOB A;  1IC8 A;  5HOO A;  3OOU A;  2P5K A;  4ENN A;  4KMF A;  3SQN A;  4MEX F;  3S1Q J;  2IRF G;  4LO7 C;  2M4K A;  5HVQ C;  1V4R A;  2VAS A;  1LNW A;  1S72 I;  1DQU A;  2RQ9 A;  4OWL A;  4XLC A;  4PCQ A;  5HS8 A;  3WHB A;  2IGO A;  1KU9 A;  3MAJ A;  3R0A A;  2F2F C;  2KI4 A;  4Q9P A;  2L02 A;  5GAD J;  4ZFU B;  4RB0 A;  2DN0 A;  1M1E B;  4LK0 F;  5JLW A;  4V19 K;  4DBR A;  3BR6 A;  4A3I J;  1FZP B;  1UHS A;  3H36 A;  1U5T C;  4HA8 A;  4D9J A;  3VYS B;  1J75 A;  4U88 A;  3G3Z A;  5L3D A;  2EFW A;  3BZC A;  1G6N A;  4IJA A;  3CQZ J;  2F4I A;  2P5V A;  3VSK A;  4FE7 A;  1XDS A;  3HOT A;  4I3N A;  2H09 A;  4A3F J;  4HNT A;  1MW7 A;  2R7Q A;  1U9N A;  2X85 A;  3A03 A;  4DCK C;  1YE9 A;  4LO1 C;  2A6E F;  2DPD A;  2P23 A;  5CYV A;  2DAO A;  4E6K G;  4A3B J;  4CCN A;  3D5R C;  2DLL A;  5M3F J;  4MFD A;  1FMV A;  3UD9 A;  1YYN A;  4FE4 A;  3B6A A;  4BY1 J;  2AXM A;  1ETV A;  5J1Y A;  1Y0N A;  2CV0 A;  1J0R A;  2IVM A;  4BKX A;  4LB5 A;  3Q3S A;  2HFH A;  2HI3 A;  1HWP B;  2M0M A;  1R71 A;  1FYM A;  3WGI A;  2ME6 A;  5B5E C;  2DQR A;  1JY0 A;  2KI6 B;  4HV5 A;  2OPT A;  1BJZ A;  3BQZ A;  4IEJ A;  4BXF A;  2OJE D;  1XG1 A;  4IRG A;  5H6R A;  5HS7 A;  4ZFY B;  1ONK B;  1BJA A;  1WCM J;  2K3F A;  1TTY A;  3QYE A;  3V7S A;  4F7Z A;  1IUY A;  1IXR C;  4HNV A;  2WC2 A;  3LAJ A;  3BAG A;  1X3Z B;  4IX7 A;  2D7I A;  2W48 A;  5IOY A;  1UG0 A;  1G3T A;  1DFC A;  3IP4 B;  3ZXD A;  1FGA A;  1SFE A;  3KZI C;  5FNW A;  4ZDP A;  1X4O A;  5J8F A;  3G73 A;  1DUX C;  1HCR A;  3AJ5 A;  3CQA A;  4HQE A;  2I8D A;  1SFO J;  1HKQ A;  3MFK A;  2BY3 A;  1IRP A;  3HOX J;  5F0C A;  5E1W A;  3GWZ A;  4NBQ A;  3HOY J;  2MBF A;  3AKI A;  3W6V A;  1GXQ A;  2XAH A;  4CCJ A;  3B02 A;  4RLF A;  4A3E J;  4A7K A;  2X9D A;  5H2F C;  1W0U A;  2QYI B;  4IQJ A;  3Q0W A;  4P0K A;  1IW7 F;  2GXB A;  3FHZ A;  1MND A;  2J5O A;  4X0G A;  4F93 B;  1DP7 P;  3TOA A;  1HDP A;  1RR8 C;  2KJB A;  3I9V 2;  3ABU A;  3I56 I;  3FMS A;  1WSU A;  3AKF A;  3JTH A;  2EQR A;  1R4M B;  2R5Z B;  3RKQ A;  1MBK A;  5LRS A;  2HW9 A;  1DLL A;  1IGN A;  4LO2 A;  3VYR B;  3RI4 A;  4L9N A;  4M9X A;  1K79 A;  2FXA A;  1EYL A;  2CQX A;  1I3A A;  4PFP A;  5L3F A;  2XAS A;  2KL4 A;  4UVB A;  3MN2 A;  4C2M J;  4A69 C;  4ZTJ A;  4RAZ A;  3AL0 B;  4XKI A;  4N9I A;  3NRV A;  4XLH A;  5D61 A;  2E35 A;  4LO0 A;  3CF2 A;  3PSI A;  3HOU J;  1RRJ A;  1T08 B;  1K61 A;  5D4S A;  5F0H A;  1S0D A;  2HOE A;  1AKH B;  1K5U A;  5D62 A;  5GAH J;  4NUB A;  3HZJ A;  2G0E A;  3A22 A;  1OCO H;  1SR4 A;  1MSE C;  4OU0 A;  2B9S A;  2CFO A;  4XSX F;  5CVV A;  4CHU A;  3KLO A;  1VFC A;  1FYL A;  3F6O A;  1ISW A;  2E1M C;  5IP9 J;  2ZJR F;  4KDP A;  3KP2 A;  6PAX A;  3K69 A;  3S3M A;  1JHF A;  2HVQ A;  3RSJ A;  3IM7 A;  3S16 J;  2E19 A;  4PUS A;  5BOW A;  1W3G A;  3PME A;  1IV6 A;  2NS0 A;  5LRR A;  2X4H A;  2D1Z A;  3CA4 A;  4QBV A;  1U2W A;  4IRH A;  2CFX A;  4M6V A;  1V6U A;  3M8F A;  1ISZ A;  5C4X J;  4YG2 F;  3AH1 A;  2WA0 A;  2M1B A;  3V4G A;  2BE5 F;  1LKX A;  3AKH A;  2NOJ B;  4A5N A;  3C2B A;  1SFU A;  4G94 A;  1OCR H;  1O3S A;  3HOZ J;  2W57 A;  3R6S A;  1U78 A;  1ITY A;  2AAI B;  4I1E A;  4GDF A;  1DZD A;  5J8C A;  2EV5 A;  5GAG J;  1LEA A;  3DPL C;  3HC7 A;  1EH7 A;  2R7X A;  2MH2 A;  4IHT A;  5IT9 K;  1AVA C;  4B43 A;  3F8N A;  3OL4 A;  4Q47 A;  2DT6 A;  2K9L A;  3FMR A;  1W3F A;  2A6T A;  4HG2 A;  2ICW G;  1QQL A;  2ET2 A;  3HOM A;  1T2K A;  2NOG A;  3V7R A;  4KIB A;  2LVS A;  2DMU A;  4BH9 A;  2E34 A;  2LF7 A;  1EV2 A;  1ERD A;  3BOQ A;  1T6S A;  3CTA A;  3A01 B;  4XFU A;  1LJ9 A;  2MFZ A;  1QZZ A;  1J9I A;  4HF2 A;  3DU5 A;  4M3E A;  2K86 A;  1H9T A;  1FYK A;  5CVI A;  1POG A;  1X4P A;  4AID A;  3FHN A;  2HDD A;  1KYW A;  2W85 A;  3F23 A;  4CCM A;  5DUI A;  2JA8 J;  1SFK A;  1R22 A;  1W5T A;  3RPU D;  1TWM A;  3KFW X;  4WCG A;  3ZQ7 A;  4CYC A;  4C30 A;  3Q0V A;  3K0L A;  3OYE A;  4XKB A;  4UHT A;  1HLV A;  3UD8 A;  1ILR 1;  1ZN2 A;  1IDZ A;  4RMN A;  2XV4 S;  4J00 A;  2QSG X;  2JT1 A;  2PMZ A;  1MMS A;  1T39 A;  3N7L A;  2ZJ2 A;  2H1L A;  1YTY A;  1HST A;  1Z2V A;  3N4M A;  2P7V B;  1DQO A;  2IGM A;  4JQ0 A;  3FDY A;  4O6J A;  2ZNZ A;  3OIP A;  1X1B A;  3JUT A;  4B4C A;  2XGC A;  3DTK A;  1ZG5 A;  3SFZ A;  4RGU A;  1UAA A;  2UUZ A;  4I4P A;  2PBI A;  3TW7 A;  1JT0 A;  4EM1 A;  1FBQ A;  4IOC F;  3RTJ B;  2V79 A;  1TW2 A;  2FBK A;  5FLV A;  4U87 A;  2EFO A;  4OW4 A;  1MBG A;  3OYH A;  1XD7 A;  5HLI A;  5BXR A;  2G7H A;  3RPQ A;  2XF6 A;  3BR1 A;  1ZRD A;  1TL8 A;  1X1A A;  2NNY A;  1GDT A;  4ESJ A;  1BIB A;  2WWY A;  4GP0 A;  4P9F A;  3FJ9 A;  2ESU A;  3BR5 A;  4LIV A;  4PZJ A;  4YIF A;  1IUF A;  5LGT A;  1YBI A;  5BVP I;  1GT0 C;  2VSA A;  2KRH A;  2XOA A;  5M5X J;  4HX8 A;  4E7L A;  4AIH A;  5FKO A;  5D8K B;  4EVI A;  1JTY A;  2RKH A;  4CDG A;  3A01 A;  4X6A J;  2K8R A;  4Y17 A;  1EVT A;  2QQ9 A;  3S8J A;  2VJJ A;  1T38 A;  3DBR B;  3F8M A;  3VSZ A;  1IZ1 A;  3HHG A;  3EF2 A;  1W7P D;  3HJE A;  3L2Q A;  1FOX A;  3BAD A;  4CH7 A;  3TOB A;  3SDB A;  2XPU A;  1FN0 A;  2YR2 A;  5K7H A;  4OUJ A;  1ETQ A;  3CES A;  5F1J A;  5GP9 A;  5HNH A;  1R7J A;  2CW8 A;  5E3L A;  1W0T A;  3BTJ A;  3FXU A;  5KCM A;  2K9M A;  3LSI A;  1RC9 A;  4L0Z B;  2JMW A;  4FIS A;  2DFI A;  3IH3 A;  2OCC H;  4UUS A;  1B8I B;  1MBJ A;  3AZV A;  4QO3 A;  3JW4 A;  3KP3 A;  2DK8 A;  4MHG A;  2HWA A;  1LDK B;  2CSO A;  5FB2 A;  3FF5 A;  3CUO A;  3JRG A;  4JX4 A;  3CJQ B;  3G6E I;  2H94 A;  1YRN A;  5IOZ A;  2ESH A;  2KKO A;  2K27 A;  4UUT A;  5ERI A;  4ZTF A;  1JKQ C;  3GO5 A;  1KQ8 A;  1BFB A;  4EB2 B;  2OQR A;  4J2X A;  3BJ6 A;  5D5W B;  5FGM A;  1IJT A;  2BEB A;  3I4P A;  5FKL A;  2CRG A;  2NS7 A;  4A3L J;  4CGZ A;  1OCC H;  4LG3 A;  2VUA A;  1ENH A;  3T8R A;  4LB6 B;  4S04 A;  4KIS A;  4QBC A;  1Z3Y A;  5F64 A;  1DJS B;  2XRN A;  1SD4 A;  2L0K A;  5FLM J;  3S3N A;  1MH4 A;  1WJA A;  2VON A;  2D20 A;  5A2Q Z;  3IH2 A;  4G1R A;  3A2K A;  5K5O A;  3FJI A;  2A05 A;  2XAQ A;  1VQ7 I;  4A93 J;  1ONV A;  4BHC A;  3O44 A;  4ZYE A;  2XB0 X;  1FWU A;  2ELH A;  2F2E A;  2Z99 A;  1T0F A;  4CCL A;  4G7Z F;  3ABT A;  3BRD A;  3QWL A;  2DTR A;  3WIN C;  2F2F A;  2K9Q A;  5K7F A;  4F52 A;  1I1S A;  3R4U A;  4RGX A;  4RB2 C;  3GTJ J;  4KT6 A;  3QOE A;  4AIK A;  2E1M B;  2TRT A;  1ETY A;  1RUO A;  3CA1 A;  2D23 A;  1JLY A;  3BQY A;  3FJD A;  2JTV A;  2Z1D A;  5K7Z A;  4PK4 A;  3J7A Y;  3OR2 C;  3PJR A;  4B47 A;  3N05 A;  1PUF A;  1OCZ H;  1CQT A;  1BAR A;  3NAR A;  3QPH A;  4DW6 A;  4KT5 C;  4H9W A;  2A07 F;  3B73 A;  3SNV A;  2TCT A;  2IPQ X;  3M7G A;  2OD5 A;  3WTX C;  1AVW B;  4MZF B;  4R8H A;  5B66 C;  2NNN A;  4B3A A;  2HKX A;  1OQY A;  2L2O A;  1TC3 C;  3CA5 A;  4IYB A;  4XKW A;  3ABL H;  3H6S E;  4YFK F;  3HSR A;  2DYS H;  3OYN A;  2K4A B;  3HRT A;  2XAJ A;  4BEH B;  4C3I J;  4M73 A;  2NVT J;  4E4H A;  5F8W A;  3A07 A;  2D2W A;  2OQG A;  1Z0X A;  2YU3 A;  1ZRF A;  4LMY A;  3JR9 A;  2ZCW A;  1G82 A;  3MQ0 A;  3ROU A;  4IZE A;  2KH2 A;  2VUM J;  1LUJ B;  4P96 A;  3MAL A;  3GFL A;  2JN6 A;  2DQL A;  4I2S A;  1T98 A;  3ECH A;  4II0 A;  3HL2 A;  4RA2 A;  4Y52 J;  1Y39 A;  2NXN B;  2XKO A;  4RGS A;  2W84 A;  4DIQ A;  3CC2 I;  3CMY A;  5E17 F;  4WK8 F;  1WBA A;  5HDN A;  3O4B A;  3O4C A;  3QYB A;  2CYY A;  4IPA A;  1G9B A;  1KQ0 A;  1R1U A;  2K9S A;  3EET A;  3WG9 A;  2VT3 A;  4MTE A;  2X2T A;  4CCK A;  3R60 A;  5BP5 C;  2JWT A;  2E1O A;  3WTZ A;  1WI3 A;  1V55 H;  2QBY A;  2GM4 A;  3H5R A;  2ECB A;  3K4B A;  3ZQI A;  2HTS A;  1F4K A;  3ERM A;  2CO5 A;  3MPP G;  3V0B A;  3IAM 2;  3OS0 A;  1FMW A;  4WXD A;  2LC2 A;  4FET A;  2L54 A;  1BLA A;  1G3Y A;  2FMY A;  2X51 A;  3UKG A;  2HZ9 A;  2IHO A;  3G1M A;  3ASN H;  3TMO A;  2WAQ N;  4ENJ A;  1QU3 A;  5ILS A;  2KLO A;  3ZQL A;  1GV5 A;  4USO A;  3WO2 A;  2E5N A;  1I1B A;  1I1G A;  2HU9 A;  3H6R A;  4EEF G;  3SJM A;  4KIG A;  4RB3 C;  2ELK A;  1J7K A;  4OIR F;  4ISQ A;  3OSG A;  4P1W A;  1G8X A;  3I58 A;  3T8S A;  1QZY A;  4RM2 A;  4AWX B;  3ZQQ A;  2VE9 A;  1IHK A;  2JJ7 A;  4E7K A;  1YI2 I;  2E2I J;  3OBT A;  1R6R A;  1R4N B;  1SAX A;  1YQA A;  3FXK A;  2BBY A;  1IDY A;  2R7Z J;  1UHM A;  1R5H A;  1QPI A;  3IL2 A;  3ULQ B;  2M30 A;  3W2V A;  3SDG A;  2KQR A;  1VQ9 I;  1ISV A;  1U5T B;  3CJN A;  1BC8 C;  3O4A A;  1D1A A;  3SZP A;  2DU9 A;  3HG9 A;  3VEP A;  1PP7 U;  4ABZ A;  4BAY A;  1G4D A;  2V1U A;  3GTP J;  4I4U A;  2RNG A;  3BTL A;  2NYY A;  4ZDO A;  1RZO B;  2OA4 A;  2FUG 2;  2OAZ A;  1FV2 A;  2G7U A;  4G12 A;  4BJT A;  5B3S H;  1QZE A;  4HLX A;  1A35 A;  1Q1U A;  5DVH A;  4PJL A;  1DFQ A;  1FMM S;  3HRM A;  2HYF A;  1WJD A;  2HZT A;  2M7B A;  1TWA J;  3CUQ C;  4QKR A;  1ZGJ A;  4OWJ A;  3D5S C;  1UST A;  3QPS A;  1N78 A;  3FGM A;  4EEE B;  4BU2 A;  1HXD A;  1I50 J;  3H3V K;  1FLI A;  1T56 A;  4MFE A;  5ICF A;  3QR5 A;  1RNL A;  2XSJ C;  4I4R A;  4QPO A;  4RAY A;  5DD4 A;  2HXI A;  3HIF A;  1HWM B;  5IT9 Z;  4EM2 A;  4ITV A;  2LMD A;  3R4K A;  2LFB A;  1WH5 A;  4H04 A;  3FKJ A;  2LKS A;  2ZQO A;  4TLP A;  1HSJ A;  4GCV A;  3DP7 A;  2H6C A;  5LGU A;  1P63 A;  1TQI A;  4ESF A;  3ZRG A;  4XID A;  4IF4 A;  1ZH5 A;  2P8T A;  5J1R A;  1F1Z A;  3PNT A;  2JSP A;  2C6Y A;  4BS9 A;  2M3A A;  2KIU A;  5DCM A;  1U8B A;  2HQN A;  3HBW A;  1MMA A;  3BRF A;  4OEE A;  3F8C A;  3K4M A;  1NG7 A;  2UWM A;  2DRZ A;  1U5T A;  2CWE A;  1XCB A;  1D1B A;  3F62 B;  1RET A;  3OYI A;  3V79 C;  2DMN A;  1ZYR F;  5LLQ A;  3FXJ A;  1N77 A;  4CJM A;  2VOO A;  1SVM A;  1YO5 C;  2L7Z A;  3T0Y A;  5FLX K;  1HBX G;  1FQ9 A;  1MJB A;  1MGT A;  1CVS A;  1D0Z A;  4UV9 A;  4ZA3 B;  2MW8 A;  1IRX A;  3S17 J;  3ASO H;  4RDU A;  3IHU A;  2H8R A;  2AO9 A;  2EFP A;  4BYY A;  2K5C A;  2R0Q C;  1YJN I;  2NVH A;  2XRO A;  3MKZ A;  3F21 A;  4AD9 A;  1DIW A;  4LLG F;  2LKX A;  3BDD A;  1MIJ A;  3GCM A;  3H6R B;  2FE3 A;  3F22 A;  3QRF F;  4Q91 A;  1UJ8 A;  5F0F A;  3CDH A;  5JVG F;  1HKN A;  5IYC J;  2PG4 A;  2WY8 Q;  5E18 F;  2L5X A;  4MTD A;  2RQQ A;  3IIR A;  1BC7 C;  2M45 A;  1ZGA A;  5H6Q A;  3SZG A;  2HYJ A;  1AHD P;  1ZR2 A;  4I09 A;  3V8K A;  2XAG A;  4ZKT B;  3FUQ A;  2F5F A;  1M2T B;  4XN3 A;  1REP C;  3DWL E;  2FRH A;  3M07 A;  4HZF A;  3PHZ A;  1BL0 A;  4XRS A;  1EA3 A;  1XG6 A;  1XHB A;  2WB1 N;  2GIZ A;  4MLO A;  3T5X A;  5F6F A;  3ZQH A;  1O4X A;  3IV5 A;  4JQF A;  1LEB A;  5H20 A;  3NQO A;  2BVL A;  2HQ5 A;  2IA2 A;  3M9A A;  2ZR1 B;  2V6C A;  2XF7 A;  3MWM A;  2L9N A;  3H3U A;  3JRD A;  1NG6 A;  3RMX A;  2HXO A;  1S9H A;  2VBW A;  3KET A;  1AWC A;  3LSM A;  4O5V A;  2LOO A;  2LRE A;  3QP6 A;  4CYC B;  3CO7 C;  5KHD A;  3S8P A;  1MBF A;  3CCS I;  5DTD A;  5EG0 B;  4G9Y A;  1QNT A;  5DEQ A;  1TP0 A;  1OMI A;  1YS7 A;  2V4J C;  4BE2 A;  2XGE A;  31BI A;  2FQ4 A;  2R7U A;  3ZMT A;  1W7P A;  5BNG A;  3AG1 H;  1NUN A;  4BY7 J;  2BEO A;  5DCF A;  2D45 A;  1B72 A;  2CGP A;  4I37 A;  1R1V A;  3OGF A;  1YW7 A;  1J2X A;  4G6T B;  4M72 A;  5IY5 H;  3LAP A;  3EDP A;  4GOV A;  4IZZ A;  3K4J A;  3SXY A;  1YW8 A;  2P7C B;  3WO4 A;  4DZJ A;  3ZXG A;  2HEO A;  3KE2 A;  4V2F A;  2Z49 A;  5BS6 A;  5D6F A;  1I39 A;  4LG0 B;  4EFQ A;  3MZY A;  4LOC A;  1VQL I;  2QN4 A;  3OYF A;  4MNU A;  3F9K A;  5CKT A;  2PMH A;  2QYO A;  5B2H A;  3WMV A;  4IHS A;  3VDX A;  2KDZ A;  1IOB A;  4FQG A;  3E0J B;  1A31 A;  1ITB A;  1XTA A;  1VQN I;  3A0B C;  3ZMU A;  1WJF A;  1Y1W J;  3VOD A;  4EM0 B;  2PJP A;  3B9U A;  4OAZ A;  2W7N A;  4D8H A;  4HLY A;  4Q5S F;  5CLS A;  3BAH A;  3KMV A;  4Y4R A;  4G9N A;  2M34 A;  1S6L A;  5ED4 A;  2RGV A;  2DTZ A;  1A6Q A;  5CPR B;  4END A;  2GLO A;  1SMT A;  1BR1 A;  2V9V A;  5IPA A;  1O3T A;  3WIN A;  4EKX B;  3A0H C;  1VQM I;  5M5W J;  1U3E M;  3BPX A;  5EG6 C;  2BHZ A;  3W2W A;  2MLL B;  4AN7 B;  5FKK A;  1HKS A;  4IQ4 A;  1HCE A;  3HSF A;  4RAG A;  1TWE A;  1P6R A;  3PIP F;  1IXC A;  1JGS A;  2MSY A;  4EGZ A;  2EJR A;  1IXS B;  3V7C A;  5TIS C;  4D0P A;  4UUV A;  1IRA X;  1QQI A;  3LOC A;  4U0W A;  3RSN A;  2O8K A;  1YLF A;  3DLL F;  2WAF A;  2F48 A;  4UY8 I;  3NJ5 A;  3DEW A;  4GRI A;  1XN7 A;  2XSD C;  1B72 B;  4P9U A;  5FZU A;  1RI7 A;  2CQK A;  3BR0 A;  3DBH B;  2O03 A;  3HTU A;  4NNJ A;  5KAF C;  3J81 Z;  4GFB A;  5K1Y A;  2W4S A;  3CJT B;  1RZ4 A;  4V2G A;  2RG9 B;  4IY9 A;  4AVZ A;  5GAQ A;  2GAU A;  3S93 A;  4UVA A;  4LG0 A;  5JI6 A;  1FNN A;  2CV1 A;  2E1N A;  4BNC A;  1ETW A;  1HW2 A;  4A3C J;  3HUG B;  2M87 A;  2TDX A;  3FJF A;  2DMT A;  1TP4 A;  5J1U A;  3RYP A;  1AOY A;  1DGW Y;  3GME A;  1RIO H;  4XRF A;  2I10 A;  3VSL A;  1JUS A;  3FZV A;  3OL3 A;  4ANJ A;  4R6U B;  2VJ4 A;  2DBB A;  4X38 A;  3F6V A;  1R00 A;  2DK5 A;  5LD2 C;  4D5C A;  2A6H F;  4EFP A;  2FF4 A;  1QHG A;  2GXG A;  3R0J A;  4OMY A;  3DCF A;  3LFU A;  4M6X A;  8I1B A;  2EFQ A;  2DO7 A;  1AFC A;  3H6Q A;  3BP8 A;  2P4W A;  4N4O B;  3RQI A;  1FSH A;  2YX4 A;  3RTI B;  4FAS D;  1ETX A;  2BW3 A;  1PUF B;  1QBJ A;  4RGR A;  3DFG A;  1K6O A;  2IW5 A;  3ZQF A;  4BGD A;  3I55 I;  1WJC A;  2NM1 A;  3K9T A;  4B44 A;  3PFY A;  2LIE A;  3HEF A;  3MKW B;  3C7J A;  2AQE A;  4BXX J;  1MD6 A;  2MLG A;  4IHV A;  2RDP A;  1GHC A;  3G2B A;  1UPS A;  2FDB M;  2LIQ A;  4DEP A;  1LDD A;  2CUJ A;  3LQQ A;  2Y9X E;  2HGC A;  1YF8 B;  4GOY A;  1HA8 A;  1D5V A;  4X3A A;  3S1R J;  2VSE A;  1O7F A;  3H1C A;  3LSG A;  1KA8 A;  3WGH A;  2OUM A;  1SD6 A;  2E4M A;  5ICG A;  3FXM A;  4F34 A;  3U2R A;  3U21 A;  1EH6 A;  3H5A A;  4YFN F;  3K4L A;  1G3S A;  2B7E A;  5EEG A;  1W36 C;  4EJT A;  4I0B A;  1MNE A;  3BY6 A;  3E3V A;  3IM5 A;  1QVU A;  5D5U B;  2E1C A;  2JPB A;  1XSX A;  2DMP A;  3VT2 A;  2DA6 A;  2DA1 A;  5BPD A;  1MSF C;  1AXM A;  1R8O A;  3K2A A;  1H89 C;  1X1C A;  4HX4 A;  1YYV A;  1YFH A;  2Z5U A;  4CZC A;  3H0D A;  1S0C A;  1KU7 A;  4II3 A;  3BX1 C;  2GBY A;  3FXO A;  3I59 B;  1BR2 A;  4XLP F;  5GTH C;  3FM5 A;  3ESW B;  2XIG A;  3JRE A;  4PSW A;  2K4J A;  4IY8 A;  1UEL B;  1K83 J;  1BLD A;  1YIO A;  4M9Z A;  2Y9W C;  3HAL A;  2VB6 A;  4Z8S B;  3WTS C;  5CVJ A;  3KYL A;  3WA1 A;  1Z6R A;  2O9L A;  1BA7 A;  3LST A;  3PL8 A;  3OJV A;  1WD3 A;  1Z3X A;  5EJC A;  2CUF A;  4NC6 A;  4Q4Z F;  1OCT C;  2HQR A;  4BUP A;  2MA3 A;  1FIA A;  4LIU A;  1IT0 A;  1E0O A;  2EA4 A;  2JA5 J;  1OYI A;  3T8T A;  2ZXI A;  2CUE A;  1JI8 A;  2P39 A;  3OGG A;  1X1P A;  1RY7 A;  1IO2 A;  1D0X A;  3DF8 A;  3BAO A;  3UJ4 A;  3RMY A;  2VIX A;  2K3P A;  1QQK A;  5M3M J;  3S2D J;  3KIO A;  1LFP A;  2D24 A;  1FC3 A;  1UHW A;  2QWW A;  3IKV A;  1S0L A;  1U0J A;  6I1B A;  2EZI A;  1J59 A;  3TDU C;  3GZ5 A;  4BQQ A;  3EQL F;  2DOA A;  1RKT A;  3C2H A;  4LO3 A;  3U1D A;  1UB9 A;  2V6E A;  2P6T A;  1MC9 A;  3KZZ A;  5CJ9 A;  5D63 A;  3MEX A;  3MKL A;  3OBR A;  4C9Y A;  1DU0 A;  3L2U A;  4M6Y A;  2EH3 A;  5F8Y A;  3E7L A;  3MMY B;  1X3U A;  3CUQ B;  3JSP A;  2V26 A;  1MNM C;  3P53 A;  4HW0 A;  4KIC A;  5M5Y J;  1L0O C;  3CC4 I;  3CCV I;  2DFE A;  2Y69 H;  3SFI A;  1PUM B;  4HJJ A;  4YRV A;  4MEY F;  3HPG A;  3I5U A;  3MCZ A;  3MZH A;  3TP0 A;  1ISY A;  3BG9 A;  3BTI A;  4G7H F;  2JA2 A;  4M3D A;  5GPA A;  3P9I A;  2NAZ A;  3WTU C;  4FHT A;  3HTS B;  1TT0 A;  3WO3 A;  2E7X A;  2M4G A;  3CLQ A;  3J7A O;  5FFZ A;  1R36 A;  4GYI A;  3CO6 C;  2RRE A;  2GZB A;  3O3K A;  3UDA A;  3BRG C;  1FX7 A;  3OIQ A;  3O4D A;  3E97 A;  2EV0 A;  2D7R A;  2UUS A;  3TO9 A;  4U0Y A;  3WMU A;  3VUO A;  1BW6 A;  4E70 A;  3ABK H;  3E6C C;  3TGN A;  2LRD A;  2ZNY A;  1YXW A;  4L4H A;  1F9N A;  1P7J A;  4AVP A;  3AG4 H;  2LP0 A;  1CF7 B;  4MQV A;  1ZKG A;  9ILB A;  2ZQN A;  1I1E A;  1D1C A;  2HKO A;  2Z16 A;  4H4K C;  3S2W A;  2QBY B;  3GTL J;  3A21 A;  2NP0 A;  2HVR A;  2DCE A;  3GTG J;  2R7D A;  2O5R A;  1BIA A;  3PG0 A;  2AQZ A;  4WWC A;  1FBS A;  3KPH A;  1JTC A;  3DU6 A;  1MMG A;  3CDI A;  4G6Q A;  4EV0 A;  5DV5 A;  4OIP F;  2M2E A;  4HQM A;  1EH8 A;  1YS6 A;  4XLA A;  1V5G A;  1MMD A;  4WXC A;  1WRJ A;  4MGR A;  2PJR B;  1JT4 A;  3CRH A;  3CJR B;  5FNX A;  2WAQ A;  2ZFW A;  2JK3 A;  2G9W A;  5DUY A;  3LWF A;  2V1D A;  2DMQ A;  2CU7 A;  2IJL A;  4XMY A;  3LMM A;  5J47 A;  4O3M A;  5BOX A;  1V54 H;  2VOP A;  4XBF A;  4TV7 A;  1LFB A;  2VQL A;  4U7D A;  4IHZ A;  3ZC9 A;  4ZGR B;  3DBL B;  4ZLB B;  3LSR A;  1RPW A;  2LY2 A;  2XAU A;  4NQW B;  3A4C A;  1H9G A;  5D6E A;  2AXL A;  4YIR X;  3CCJ I;  4WX9 A;  2NTD A;  2K02 A;  1FP1 D;  1JKO C;  1WQ2 A;  2UV1 A;  2W82 A;  1V3F A;  2DT5 A;  4KA4 A;  2AQF A;  4AN6 A;  1TWH J;  3VB2 A;  2VJ5 A;  2FGF A;  2R7W A;  1FEX A;  3JRR A;  4BQN A;  4OEF A;  4BHB A;  4FVV A;  1EKE A;  2PLY A;  2WV0 A;  3OY9 A;  3FK6 A;  3BAV A;  1MJ9 A;  3BZK A;  1VQO I;  1JHH A;  1MMN A;  1VCL A;  3PM1 A;  3O5W B;  3KP5 A;  3KYD B;  3IC7 A;  1JUM A;  1Z21 A;  3CP8 A;  3E6B A;  4LK1 F;  3VYT B;  5C44 J;  4UV8 A;  1ZGW A;  3BC8 A;  2GOX B;  3GLL A;  3L2C A;  3QAH A;  1VF9 A;  4L4I A;  3KLN A;  4S05 A;  2KFD A;  3CZ6 A;  3JRH A;  1WGX A;  4B8X A;  1UG2 A;  4J23 B;  2LNB A;  2GXA A;  3KCC A;  3NBD A;  4LO2 C;  3QYF A;  2OC6 A;  4JRA A;  2XPW A;  3Q5F A;  3G1L A;  1XCV A;  5TJJ A;  3UR3 C;  2R5Y A;  3U9G A;  1OYY A;  3DLA A;  3GLX A;  2PJR A;  4XOT A;  2XUB A;  2PFB A;  3I53 A;  3HPH A;  4AYB N;  4CCO A;  2MIB A;  4OWK A;  4I76 A;  3PFI A;  4KIF A;  1NZK A;  3H35 A;  2WAD A;  2DFH A;  3KEY A;  1O57 A;  3KZY A;  4MIM A;  5FZZ A;  5JLV A;  3JRI A;  4C3H J;  3GFM A;  2R93 J;  3IKT A;  3ZC8 A;  2FML A;  2LYC A;  2CW7 A;  1A04 A;  3HRS A;  2VC1 A;  4R1H A;  5DZU A;  3E8L C;  1PYV A;  3DTE A;  2CW0 F;  1TBX A;  1B9N A;  2W25 A;  1GVD A;  4A0Y A;  1D8K A;  2A3S A;  2X6W A;  3OYK A;  2LD5 A;  1Z4S A;  1V5F A;  2YUS A;  5F27 A;  2DXI A;  2VQC A;  4YEL A;  4I4X A;  1I27 A;  2IS2 A;  1KU3 A;  1NHA A;  2QKM B;  2Y0S N;  3CD6 I;  2F5C A;  5E79 C;  2XC7 A;  2E5Z A;  3P9C A;  3RCO A;  1BN5 A;  1TOO A;  1JKR C;  1VND A;  2MAB A;  2QSF X;  4DNC A;  1TQP A;  3L00 A;  2EIN H;  1PWA A;  3BG3 A;  4Z9W B;  3GEZ A;  2XHK A;  2Y9Z A;  3HN1 A;  3K7A J;  1DPU A;  1UMQ A;  2K7L A;  3O4O A;  3BAU A;  1W4M A;  3FMQ A;  2DJN A;  3HGY A;  4KFC A;  1D3Y A;  2BY2 A;  2HS5 A;  2HQA A;  2VKV A;  3TKY A;  4QTR A;  1IF1 A;  2EIK H;  3LFK A;  1YW9 A;  1XSD A;  2FNA A;  1KNM A;  1S7A A;  3GF2 A;  3ZOB A;  4M71 A;  4IQP A;  1PP8 F;  2X6Y A;  4FTH A;  2K4B A;  4DBQ A;  3LSP A;  4AC0 A;  3BRO A;  1XGO A;  3D5L A;  3M8E A;  4IHW A;  3WU1 B;  4Y33 A;  4RB1 A;  5EEH A;  2DOD A;  4CUG A;  4KBB A;  2LY9 A;  2J5P A;  1CE7 B;  2VBY A;  2Z3Y A;  3F1R A;  4ZZL A;  1K5V A;  4KEK A;  4P6A A;  1RKW A;  1QPM A;  3VOE A;  5IP6 A;  2DYR H;  3MVP A;  1APL C;  3ZP5 A;  2JA6 J;  5TRD A;  1A6I A;  2FSW A;  3K4C A;  1Z6T A;  1U9O A;  3K70 D;  2X48 A;  1F5T A;  4I7H A;  3GTO J;  5FZY A;  1SD7 A;  2RC4 A;  3LSH A;  1AKH A;  4OEG A;  4AUX A;  3C1D A;  4HYE A;  3H0G J;  1WI9 A;  4BE1 A;  3G1O A;  4DYC A;  4DGW B;  1VQ8 I;  5FD5 A;  4QD2 B;  2D1H A;  4ESB A;  1WD4 A;  2BXY A;  2E60 A;  4GAI A;  5LHG A;  1HDD C;  1O3R A;  2A68 F;  3GFI A;  3OJM A;  4KEI A;  2Y31 A;  4LLN A;  2MC2 A;  1NK3 P;  4RBO A;  3N7M A;  3RKW A;  5FLX Z;  4M3G A;  5E1Z B;  2PI0 A;  1AF9 A;  3FJK A;  2ID3 A;  1LDJ A;  1ZHF A;  4DZP A;  3VYU B;  4IHX A;  4I4Y A;  4GAF A;  3F8B A;  3LTQ A;  2FA5 A;  1FIP A;  2F5V A;  2CQN A;  2RAE A;  4E7I A;  2HDC A;  5HLH A;  4USP A;  1WVR A;  3I54 A;  4LLL A;  1IRZ A;  3H3Z A;  1NTC A;  4XFS A;  4A3D J;  1OPC A;  4I8M A;  1SD5 A;  3W6J B;  1E3P A;  2XGX A;  1QO0 D;  2BW3 B;  5HPZ A;  4ZH4 F;  2Y2Z A;  1IV8 A;  4QAL A;  1JT7 A;  1Z67 A;  2ELJ A;  1IRG A;  2BEA A;  4LFU A;  4AIJ A;  1ULY A;  3BT9 A;  1VQ4 I;  1JT6 A;  2OU2 A;  1T4Q A;  1RML A;  1WJB A;  3SYT A;  2LK2 A;  3ZMD A;  4X1E A;  5JLX A;  4S0H B;  5CQG A;  1HKT A;  3CU1 B;  2H1K A;  1DP3 A;  2LKP A;  1SVL A;  4CA0 A;  3NBE A;  2XF5 A;  4E7Z A;  2O0Y A;  3RKY A;  4HR6 C;  4I4O A;  2QGU A;  2EWN A;  2WV1 A;  3FK7 A;  2QSH X;  4B09 A;  5L3C A;  3G71 I;  3OMY A;  4F3Q A;  1T95 A;  2ERM A;  4LIT A;  1HC8 A;  4QD2 C;  2BVM A;  1P4W A;  2YPR A;  3JRC A;  3KP7 A;  3H9G A;  1GV2 A;  3OIO A;  3QU6 A;  2X2S A;  3K1P A;  1P92 A;  1UCR A;  1XSV A;  3Q7X A;  4I1B A;  1TTU A;  4I02 A;  4JX6 A;  1E0E A;  4A3G J;  2NS2 A;  4R79 A;  1OLT A;  2LDU A;  2WB1 A;  3QYD A;  3HKZ N;  4RM3 A;  2V1X A;  1IN4 A;  2E2J J;  3HYI A;  1ZK8 A;  2FFU A;  3N7K A;  3NBN A;  2HTJ A;  4XSZ F;  5FFX A;  3S2H J;  2KP6 A;  3JTG A;  5BQU A;  3BA4 A;  4NC7 A;  2IGN A;  2L4M A;  3OS2 A;  1YX5 A;  4WXH A;  2W24 A;  4W1U A;  2EA2 A;  2Y9Y A;  3WHC A;  4XLE A;  3OYC A;  2QKL B;  3P6J A;  2CH0 A;  4QSH A;  1KU2 A;  1E3H A;  1QXM A;  4HV6 A;  4I0A A;  4B3X A;  1FY7 A;  2Q9X A;  1B4A A;  1BI3 A;  2STW A;  5DUK A;  1YIT I;  1EV7 A;  4ENK A;  3WOD F;  2DDA A;  5D5V B;  4JPZ A;  3JRA A;  2BOL A;  4WBC A;  4QIW N;  5DDG A;  4QC4 A;  2K85 A;  4NB5 A;  1JJ6 C;  1II4 A;  3VSF A;  4A7Y A;  3EYY A;  5EC5 A;  4L9T A;  1VQP I;  2JZY A;  2Q0O A;  3F0C A;  5C3E J;  3HOV J;  2AS5 F;  3I64 A;  1U8R A;  4G6J A;  2RNJ A;  1O3Q A;  1IIL A;  1A36 A;  3DEU A;  2R7R A;  4BJ5 C;  1Z7L A;  2YSR A;  3CCM I;  3JAM K;  3FUO A;  1P2F A;  4A3K J;  4G6D A;  2I1B A;  2F6C A;  1XDU A;  3M1C A;  1RG8 A;  4CXF A;  1J0S A;  4A0X A;  5BQT A;  3WE2 A;  2KZG A;  2PX9 A;  3Q0U A; 
#chains in the Genus database with same CATH homology
 3VWC A;  1MD6 A;  4DEP A;  1UPS A;  2K8R A;  3G2B A;  2FDB M;  2LIQ A;  1EVT A;  2NZ9 A;  3S8J A;  2CUJ A;  2VJJ A;  2Y9X E;  1HWO B;  2LH9 A;  2KHM A;  3VSZ A;  1YF8 B;  3EF2 A;  4GOY A;  1HA8 A;  4P0L A;  4KEJ A;  2LG4 A;  3GBG A;  3L2Q A;  1N75 A;  3BAD A;  4X3A A;  3BG6 A;  4CH7 A;  3SDB A;  1FN0 A;  2VSE A;  3LSG A;  3UNG C;  2M49 A;  4E7J A;  3BAQ A;  3FJH A;  9ILB A;  2OUM A;  2Q1Z B;  2E4M A;  4OUJ A;  2LY1 A;  4XNF A;  3CES A;  4I7I A;  2BFH A;  4F34 A;  3U21 A;  5HNH A;  2CW8 A;  3H5A A;  3K4L A;  1WBC A;  4U7B A;  4G6M A;  4J2S A;  3DQV C;  4XR6 A;  5KCM A;  1W36 C;  4HST A;  2K9M A;  1J09 A;  3LSI A;  4XOP A;  4HNU A;  5FRN A;  2HDW A;  1MNE A;  4ZJZ A;  3AZV A;  3DPU A;  3BA5 A;  1TZL A;  1AA7 A;  3OR1 C;  3DTI A;  3IM5 A;  4QO3 A;  3OYB A;  3VT2 A;  1R8O A;  2HWA A;  1AXM A;  1LDK B;  4XKV A;  2RST A;  3I2X A;  1QHH D;  3CJQ B;  1X1C A;  1SR4 C;  3CA3 A;  2E4M C;  2ZSH B;  4XLF A;  4CZC A;  2LBF B;  3OYG A;  3CRI A;  3H0D A;  1S0C A;  3CAH A;  4ZTF A;  4II3 A;  4PJJ A;  1BFB A;  1PZZ A;  1SZ6 B;  2AFG A;  2L5Q A;  4NC8 A;  1LVK A;  1IJT A;  3BX1 C;  3TC2 A;  1DGR M;  2BEB A;  3CRG A;  4ZBV B;  1BR2 A;  2WY7 Q;  3LSK A;  3L2W A;  3JRR A;  4LG3 A;  4ZC3 A;  2VUA A;  4I4S A;  3S32 A;  4PSW A;  4YEJ A;  4KIS A;  4IY8 A;  1Z3Y A;  1UEL B;  4QBC A;  1BLD A;  1DJS B;  3OYL A;  2Y9F A;  3S3N A;  2Y9W C;  4ZYA A;  5LFA A;  1WJA A;  2VB6 A;  2D20 A;  3HAL A;  4GP3 A;  4Z8S B;  4AYB A;  4G1R A;  3A2K A;  3KYL A;  3WA1 A;  3FJI A;  1BA7 A;  4IZX A;  3PL8 A;  1PJR A;  3MKY B;  1V5E A;  1WD3 A;  3OJV A;  1Z3X A;  3HKZ A;  4EAT A;  2VU9 A;  1YX3 A;  4BDZ A;  3O44 A;  4BUP A;  4IKF A;  3P6I A;  1FWU A;  5TGT A;  3H9J A;  4PSX A;  4LIU A;  1HWN B;  1IT0 A;  1E0O A;  2HPI A;  4CCL A;  2GO2 A;  2ZXI A;  1FV3 A;  4P5O A;  3OYM A;  3BRD A;  1S0E A;  1JI8 A;  2P39 A;  3OGG A;  3WIN C;  2F2F A;  4F83 A;  4EEE B;  3FBN B;  4F52 A;  3R4U A;  3K4N A;  4KT6 A;  3QOE A;  2VPL A;  2E1M B;  1RY7 A;  3CA1 A;  5G00 A;  4N4N B;  2D23 A;  1D0X A;  1JLY A;  3FJD A;  3N7J A;  2Z1D A;  3BAO A;  4PK4 A;  3J7A Y;  3UJ4 A;  3OR2 C;  3PJR A;  2DJI A;  2VIX A;  3N05 A;  4PJM A;  4B47 A;  2K3P A;  3RMY A;  1QQK A;  1BAR A;  4J2Y A;  3IAG C;  4H9W A;  3K4K A;  3SNV A;  1LFP A;  2D24 A;  2WRY A;  4HPQ A;  3K70 C;  1S0L A;  2DS0 A;  4YOL A;  3IAS 2;  2X1D A;  1U0J A;  1AVW B;  4Y3O A;  4MZF B;  4I4V A;  6I1B A;  3AL0 C;  5E24 E;  2KLL A;  2L2O A;  2KRC A;  2Z48 A;  1FWV A;  3CA5 A;  1Q04 A;  4IYB A;  4XKW A;  4BQQ A;  4PC4 A;  2DOA A;  1KON A;  3OYN A;  3H6S E;  2IXS A;  2K4A B;  3C2H A;  3RQ4 A;  4BEH B;  3AKZ A;  4LO3 A;  2R7S A;  2W1O A;  4E4H A;  2V6E A;  5F8W A;  5BXS A;  5JHF A;  2MYS A;  1D0H A;  1P9Q C;  2VQG A;  5HNF A;  1MC9 A;  3A07 A;  3H9Q A;  3OBR A;  5D63 A;  4OEF A;  3NWS A;  4C9Y A;  4C2U A;  3L2U A;  4BJ6 C;  1G82 A;  2L7K A;  4IZE A;  2D22 A;  2KH2 A;  3MMY B;  5F8Y A;  1L2H A;  2R7T A;  4FVV A;  3P53 A;  2V26 A;  2Z2S B;  5FRM A;  3MAL A;  4UY4 A;  1BFF A;  21BI A;  2Y9G A;  4ION A;  3CA6 A;  1PUM B;  3IUO A;  4I2S A;  4RLQ A;  4HJJ A;  4YRV A;  3VWB A;  3HPG A;  4BDY A;  3ZR8 X;  1ISY A;  2WBC A;  4LO3 C;  3FBI B;  3HL2 A;  4II0 A;  2JA2 A;  2Y0S A;  4BAC A;  2D43 A;  3FJ8 A;  2KDO A;  2KKI A;  2VJI A;  2K43 A;  1TT0 A;  3WO3 A;  2M4G A;  1DZC A;  3UDA A;  3V0B B;  2RRE A;  3RTR A;  4DIQ A;  2GZB A;  3BRG C;  3OIQ A;  1WBA A;  2Q3N B;  2LBF A;  3O4D A;  4J2K A;  1BR4 A;  3O4C A;  2D7R A;  3O4B A;  3DKY A;  2UUS A;  1G9D A;  3QYB A;  1G9B A;  3OJ2 A;  3WMU A;  3VUO A;  2X2T A;  4CCK A;  4I4Q A;  2J3P A;  5BP5 C;  1A8D A;  2LRD A;  1YXW A;  3C9Z A;  3E1S A;  1BAS A;  4CSW A;  3A23 A;  4L4H A;  4QKS A;  4JP0 A;  3H5R A;  2VKD A;  3K4B A;  3O49 A;  5BQU C;  3VEQ A;  2ZQN A;  4OWR B;  1D1C A;  2Z16 A;  3R4S A;  4H4K C;  3MPP G;  3A21 A;  3IAM 2;  3OS0 A;  4LO0 C;  1FMW A;  2HVR A;  3V0B A;  2NP0 A;  2LC2 A;  4FET A;  3UJ0 A;  1BLA A;  2DCE A;  5HLT A;  2M7A A;  2X51 A;  3ZX7 A;  2HZ9 A;  2O5R A;  1BFG A;  3EUA A;  2IHO A;  3BB2 A;  3PG0 A;  4XM3 A;  2AQZ A;  3TMO A;  3QOD A;  4DOZ A;  1QU3 A;  1JTC A;  3DU6 A;  3HOS A;  4I0Y A;  1MMG A;  2KLO A;  2V7F A;  3L2V A;  3OS1 A;  4I6I A;  4ZOT A;  4USO A;  4D1Q A;  3WO2 A;  2R9K B;  2E5N A;  1I1B A;  2IS4 A;  2HU9 A;  4XLA A;  2R7O A;  2VLA A;  4PFO A;  1V5G A;  1ABR B;  3H6R A;  4X39 A;  1MMD A;  1T0F C;  1Q03 A;  3EPZ A;  2DRE A;  2PJR B;  3VT1 A;  1JT4 A;  4ISQ A;  3CRH A;  2VXD A;  1S0B A;  4LO8 B;  4MZG B;  4HEA 2;  2MC4 A;  3V42 A;  1G9C A;  3UD7 A;  4P1W A;  1G8X A;  3T8S A;  3CJR B;  3EUH C;  1X19 A;  2WAQ A;  1EPW A;  1XYF A;  3O3Q A;  2IS6 A;  3A1Y A;  3MD2 A;  2GOM A;  4RM2 A;  5F8S A;  4ZFW B;  4EFR A;  3ZQQ A;  1IHK A;  3OBT A;  4E7K A;  5DUY A;  1HCD A;  1R8N A;  1R6R A;  3HXL A;  2V9K A;  4XMY A;  3LMM A;  5KNL A;  41BI A;  1M16 A;  2FFV A;  4XKC A;  2OV7 A;  4JKX B;  2DT7 B;  3DKX A;  1OR7 C;  3W2V A;  2VQL A;  4IHZ A;  3ZC9 A;  2KQR A;  1V6W A;  3BA7 A;  4ZGR B;  3K6G A;  1ISV A;  4ZLB B;  3O4A A;  4BEH A;  2LY2 A;  3W9T A;  2XAU A;  1D1A A;  2ZFU A;  3A4C A;  3K10 A;  1WJ5 A;  3HG9 A;  2ZSI B;  4NQW B;  3AJ6 A;  3LLP A;  4G9M A;  4XON A;  2NTD A;  4I4U A;  2RNG A;  2NYY A;  2UV1 A;  2W82 A;  2R7V A;  3V0A A;  4E7S A;  3Q7Y A;  3SEZ A;  4ZDO A;  1RZO B;  2AQF A;  2Q2E B;  1YTO A;  1Z0H A;  4X37 A;  4AN6 A;  2FUG 2;  3BG7 A;  4HSR A;  4J01 A;  3HMY A;  1FV2 A;  3V0A B;  3ZGK A;  4BJT A;  1S0F A;  2VJ5 A;  2IGK A;  1S0G A;  2CV2 A;  2FGF A;  5DVH A;  2R7W A;  1Q1U A;  1Y56 A;  2CUZ A;  4BQN A;  1JQZ A;  4PJL A;  1DFQ A;  1FMM S;  4C2T A;  1WJD A;  3I29 B;  2M7B A;  4FGF A;  3OY9 A;  2HZD A;  1V6X A;  4H75 A;  3CA0 A;  2HWM A;  3BAV A;  4QKR A;  1VCL A;  4KC3 A;  4OWJ A;  1MMN A;  3PSF A;  3D5S C;  3O5W B;  1G9A A;  3AKG A;  1N78 A;  3FGM A;  1GGP B;  3FJE A;  3ILA A;  1BOB A;  1Z21 A;  3CP8 A;  3OOU A;  3VYT B;  1Y6I A;  4BU2 A;  5HOO A;  3FFZ A;  3PNV A;  3BC8 A;  3DPT A;  3M8J A;  4LO7 C;  2GOX B;  2M4K A;  2VXT I;  5HVQ C;  2VAS A;  3QR5 A;  4L4I A;  1DQU A;  2RQ9 A;  2KMU A;  3CZ6 A;  4XLC A;  2XSJ C;  4I4R A;  4QPO A;  2IGO A;  3OYA A;  4J23 B;  2F2F C;  1HWM B;  3OYJ A;  3NBD A;  2KI4 A;  4Q9P A;  4LO2 C;  3QYF A;  4ZFU B;  2OC6 A;  4ITV A;  4JRA A;  3UR3 C;  3FKJ A;  1AVX B;  4H04 A;  4DBR A;  2ZQO A;  4LO1 A;  3DLA A;  2PJR A;  4XOT A;  2VLC A;  3HPH A;  4CCO A;  4TLP A;  2WBM A;  3ZCO A;  3C2G A;  2MIB A;  3IM6 A;  4D9J A;  3VYS B;  1P63 A;  4OWK A;  2A5W A;  3ZRG A;  3H35 A;  2WAD A;  1NZK A;  3KEY A;  2HPM A;  5FZZ A;  5JLV A;  2F4I A;  3VSK A;  3PNT A;  2JSP A;  3H5N A;  4BS9 A;  3HOT A;  4I3N A;  2LYC A;  3BTA A;  2M3A A;  2CW7 A;  4XFT A;  3ZC8 A;  4HNT A;  1MW7 A;  2R7Q A;  2X85 A;  1ZEL A;  4DCK C;  3HBW A;  1MMA A;  5DZU A;  3E8L C;  1PYV A;  1YE9 A;  3DTE A;  4LO1 C;  3BRF A;  2XOA A;  4OEE A;  2P23 A;  3K4M A;  1NG7 A;  2UWM A;  2IS1 A;  2DRZ A;  2X6W A;  4E6K G;  3OYK A;  1Z4S A;  4D0T A;  1V5F A;  3D5R C;  4CCN A;  4I4X A;  2DXI A;  1TIE A;  1FMV A;  2VQC A;  4YEL A;  1D1B A;  3F62 B;  1YYN A;  3UD9 A;  1W36 D;  2AXM A;  4KEK A;  3OYI A;  2QKM B;  1TOO A;  4LO7 B;  2XC7 A;  3V79 C;  2CV0 A;  2E5Z A;  3RCO A;  1JT5 A;  3FJB A;  1N77 A;  3SEQ A;  4CJM A;  1K6Y A;  2JUG A;  2MAB A;  1HWP B;  2M0M A;  4HRI A;  1JT3 A;  1FQ9 A;  1PWA A;  4AU7 A;  1JY0 A;  2KI6 B;  1CVS A;  1D0Z A;  4ZA3 B;  4BXF A;  1IRX A;  4Z9W B;  4F55 A;  3L2R A;  4ZFY B;  1ONK B;  3LL7 A;  2CS3 A;  2VQH A;  3HN1 A;  3O4O A;  1OQL B;  3BAU A;  4HA2 A;  1SAU A;  3S8K A;  3QYE A;  2K5C A;  2NVH A;  2HQA A;  3MKZ A;  2VKH A;  1DIW A;  3BAG A;  3H6R B;  4Q91 A;  4IX7 A;  4BL0 B;  2WAE A;  1KNM A;  2D7I A;  1UG0 A;  1X1D A;  1DFC A;  1HKN A;  3IP4 B;  3ZXD A;  1FGA A;  2WY8 Q;  2L5X A;  5JMC A;  4IQP A;  5FNW A;  2RQQ A;  2X6Y A;  2X1E A;  1X4O A;  4ZDP A;  3IIR A;  3AJ5 A;  3CQA A;  3SZG A;  2IS2 A;  2I8D A;  2R4G A;  4DBQ A;  1D0Y A;  2XDV A;  3NWT A;  3D5L A;  4D0Z A;  1IRP A;  4JKQ A;  4Y33 A;  4PJN A;  1T9F A;  3AH4 A;  3FUQ A;  4ZKT B;  1M2T B;  4XN3 A;  3POK A;  4CUG A;  4OAY A;  2HNH A;  3DEE A;  3AKI A;  4KBB A;  4CCJ A;  3DWL E;  3W2A A;  4RLF A;  1CE7 B;  3F1R A;  3PHZ A;  1XZZ A;  4A7K A;  4QPQ A;  1K5V A;  1EA3 A;  3CMM A;  1XG6 A;  4BE0 A;  1XHB A;  2QYI B;  4MLO A;  4P6A A;  4IQJ A;  4P0K A;  3BLY A;  4JQF A;  4II2 A;  1MND A;  2BVL A;  4X0G A;  4F93 B;  2ZR1 B;  3K4C A;  2XF7 A;  3K70 D;  3I9V 2;  2ZXH A;  1DQG A;  2L9N A;  5FZY A;  3RMX A;  1NG6 A;  2FO1 A;  1JLX A;  4OEG A;  3LSH A;  1S9H A;  3AKF A;  4OWL A;  3LSM A;  2CMP A;  2W00 A;  2LOO A;  2LRE A;  2V1N A;  5KHD A;  3S8P A;  2HW9 A;  4BE1 A;  1DLL A;  4LO2 A;  3VYR B;  4DGW B;  5EHA A;  4QD2 B;  1EYL A;  4GAI A;  1WD4 A;  2E60 A;  1TP0 A;  4PFP A;  2DRY A;  2V4J C;  4BE2 A;  31BI A;  2KL4 A;  3OJM A;  4ZTJ A;  3AL0 B;  4KEI A;  2R7U A;  1PUU B;  4XKI A;  2MC2 A;  4XLH A;  3N7M A;  3VT0 A;  5D61 A;  1NUN A;  4LO0 A;  3CF2 A;  3PSI A;  3AFH A;  5FNX A;  4I37 A;  4E7H A;  1AF9 A;  1S0D A;  3FJK A;  3OGF A;  1K5U A;  3VYU B;  4I4Y A;  5D62 A;  4NUB A;  4G6T B;  3NBC A;  3A22 A;  1SR4 A;  4GAF A;  4GOV A;  1HIB A;  4IZZ A;  3LTQ A;  3K4J A;  2CFO A;  3WO4 A;  3ZXG A;  2F5V A;  4E7I A;  2Z49 A;  3OWT A;  4USP A;  4J2X A;  4DEN A;  4EFQ A;  5DSS B;  4XFS A;  1ISW A;  2E1M C;  3FJA A;  1WFX A;  2QN4 A;  3OYF A;  1PC8 B;  3F9K A;  2HVQ A;  5CKT A;  3S3M A;  2VXZ A;  1N4K A;  4I8M A;  1WJE A;  3RSJ A;  3IM7 A;  5B2H A;  3WMV A;  1F31 A;  4XQF A;  4DJA A;  4PUS A;  3VDX A;  1W3G A;  3PME A;  1IOB A;  5BOW A;  2BW3 B;  3E0J B;  2D1Z A;  5HPZ A;  1ITB A;  3CA4 A;  4QBV A;  4KIT B;  4QAL A;  5CQE A;  1JT7 A;  3FJJ A;  2ELJ A;  7I1B A;  1WJF A;  3OYD A;  2X1C A;  1V6U A;  2BEA A;  3AH1 A;  1ISZ A;  4JOM A;  2KZV A;  3B9U A;  2WA0 A;  4OAZ A;  3AKH A;  3PUB A;  1LKX A;  2VL8 A;  2W7N A;  2NOJ B;  4D8H A;  3BAH A;  1T4Q A;  4G9N A;  1RML A;  3AZW A;  1WJB A;  4Y4R A;  3KMV A;  3SYT A;  2AAI B;  5BXP A;  4I1E A;  2YUG A;  3CU1 B;  4I96 A;  5CPR B;  5CQG A;  4END A;  1DZD A;  1DP3 A;  1BR1 A;  2JVG A;  4CA0 A;  3WIN A;  3NBE A;  4EKX B;  3DPL C;  3HC7 A;  4BQO A;  2XF5 A;  4E7Z A;  4HR6 C;  2R7X A;  4I4O A;  4MZH A;  5EG6 C;  1AVA C;  4B43 A;  3D7W B;  2F8X C;  3OL4 A;  3PNY A;  3W2W A;  3I2A A;  2MLL B;  4AN7 B;  2DT6 A;  4IQ4 A;  2K9L A;  1HCE A;  3Q7W A;  1TWE A;  1W3F A;  3OMY A;  1BFC A;  4A7Z A;  4F3Q A;  1GLN A;  2A6T A;  1T95 A;  2JVH A;  3CP2 A;  4HG2 A;  4LIT A;  4XL9 A;  1QQL A;  2ERM A;  2ET2 A;  2IWT B;  3HOM A;  2BVM A;  4QD2 C;  3FJC A;  3H9G A;  4B48 A;  2X2S A;  1IRA X;  5F90 A;  4I1B A;  3Q7X A;  1EV2 A;  1TTU A;  3RSN A;  1ERD A;  3KX2 A;  4XFU A;  2WAF A;  1FMZ A;  1E0E A;  2MFZ A;  2NS2 A;  4R79 A;  3K1X A;  1AVU A;  3NJ5 A;  3DU5 A;  4GRI A;  1OLT A;  2WB1 A;  3QYD A;  4RM3 A;  4EB2 B;  1X4P A;  4XN0 A;  4KJZ A;  2HVS A;  3FHN A;  5FZU A;  4NNJ A;  5BP5 A;  4F92 B;  2KPM A;  3ONQ A;  4CCM A;  1W3A A;  2FFU A;  1SFK A;  3N7K A;  2P0W A;  2W4S A;  4IY9 A;  3NBN A;  3RPU D;  2RG9 B;  4AVZ A;  5GAQ A;  1TWM A;  3S93 A;  2VXR A;  4C30 A;  4ZDL A;  2KP6 A;  5BQU A;  4XOR A;  3OYE A;  4XKB A;  2CV1 A;  3BA4 A;  3UD8 A;  4F91 B;  1ILR 1;  4NC7 A;  2IGN A;  3HUG B;  4RMN A;  4P0J A;  3OS2 A;  1YX5 A;  4J00 A;  3FJF A;  2PMZ A;  3EUK L;  3AH2 A;  4XLE A;  2MD0 A;  3N7L A;  3OYC A;  2QKL B;  3P6J A;  1I1E A;  1DGW Y;  2CH0 A;  1ISX A;  1Z2V A;  1QXM A;  1V6V A;  4Q9G A;  1DQO A;  2X6X A;  4B3X A;  1G59 A;  2IGM A;  2Q9X A;  3FDY A;  3VSL A;  4JQ0 A;  3OIP A;  1X1B A;  3JUT A;  4I4P A;  3DTK A;  3HSM A;  3OL3 A;  4ANJ A;  1UAA A;  2UUZ A;  4R6U B;  5BXT A;  2VJ4 A;  4X38 A;  1VZ0 A;  3N0K A;  4JPZ A;  2BOL A;  4WBC A;  5LD2 C;  4QC4 A;  3RTJ B;  3S3O A;  1II4 A;  3BCA A;  1QHG A;  4U87 A;  3VSF A;  4EFP A;  4A7Y A;  5EC5 A;  4OW4 A;  3OYH A;  3LFU A;  4ISR A;  3W3C A;  8I1B A;  3H6Q A;  1AFC A;  3I3L A;  5BXR A;  4G6J A;  4N4O B;  2D44 A;  3RTI B;  4FAS D;  3TBI A;  1IIL A;  2XF6 A;  2BW3 A;  4BJ5 C;  1Z7L A;  2R7R A;  1X1A A;  3BCB A;  3ZXS A;  4JAW A;  3FUO A;  5I1B A;  2L9S A;  4BGD A;  3TL4 X;  1WJC A;  4GP0 A;  2NM1 A;  2I1B A;  2ESU A;  2F6C A;  4LIV A;  3PFY A;  4B44 A;  3M1C A;  1RG8 A;  1YBI A;  3FJ9 A;  5BVP I;  2LIE A;  1J0S A;  2VSA A;  3MKW B;  2KRH A;  5FRO A;  4E7L A;  2AQE A;  1TFM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...