3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
b'VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30kDa protein
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
molecule tags Unknown function
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
1HWMB 1Z2VA 3BAOA 2VXTI 2GZBA 1G82A 1JT4A 2X2TA 4G9MA 1HCEA 2J3PA 2HWAA 3AKFA 4IHZA 2K8RA 4LO1A 1HWOB 2I1BA 2D20A 2ET2A 1G9CA 4IYBA 5DVHA 3V0BA 5E24E 3CRHA 3O3QA 3CA4A 3HSMA 3FFZA 3V0AA 4KEIA 2Y9GA 3ZXGA 4DEPA 1IT0A 3WMVA 2Y9WC 4QD2B 3NJ5A 5FZUA 3BTAA 2WRYA 4IZEA 3VSFA 4KEJA 3N7KA 4H04A 2Z48A 3N7LA 4FVVA 4AN6A 1S0LA 1F31A 3UDAA 1FMMS 3FJJA 3PG0A 4X37A 2AAIB 1Q03A 1PUUB 3O5WB 2KKIA 1ISXA 3BX1C 4ZFYB 3UD8A 3OGGA 2VUAA 4A7YA 5GAQA 4J2SA 2ZQOA 4HJJA 4I4RA 3MPPG 31BIA 4LO0C 1L2HA 1FV2A 1S0CA 4ZGRB 3RMXA 2D44A 3AZVA 5D61A 3BRFA 5EHAA 4EFPA 1JT7A 4GP3A 3PHZA 4JRAA 5HPZA 2L5XA 4R6UB 5G00A 3BAGA 3IM7A 4LO2A 1S0DA 2ZQNA 1JQZA 4HA2A 1YXWA 2FFVA 4KC3A 5D62A 21BIA 2M49A 5DUYA 2HW9A 3D7WB 1CVSA 4FGFA 5BP5C 4ZLBB 3FJ9A 3NBCA 1V6XA 1BFFA 4I7IA 2D7IA 4J2KA 4LO8B 3BAUA 1EPWA 3RTIB 4L4IA 5BXSA 1G9DA 3Q7WA 4I1BA 4OWKA 3H6SE 4XKIA 5BXRA 1TWEA 4X38A 4Q9GA 1ISYA 1JLXA 4LO0A 3VWCA 4I4SA 2AFGA 2VSEA 1QXMA 3O44A 5F8YA 3BA7A 2LIEA 3A07A 1HWPB 4OUJA 3E8LC 4P0KA 3N7MA 5BQUC 1XZZA 1AVAC 1G9AA 2D23A 1JTCA 3K1XA 1PC8B 3AZWA 3Q7YA 1PZZA 3QYDA 2MLLB 4XFTA 1FWUA 3I2XA 1R8OA 3WMUA 4I4XA 2FGFA 3EF2A 5BP5A 3N0KA 2P23A 4IONA 4ISRA 4G1RA 1HIBA 4XFSA 1CE7B 1TFMB 2Q3NB 2NVHA 1E0OA 3CA6A 1DIWA 3CA3A 4J2XA 9ILBA 3V0AB 3IM5A 5DZUA 3ZX7A 1M2TB 5BQUA 4AN7B 5FZZA 4Z9WB 1XG6A 1HWNB 1XHBA 4EFQA 1W3FA 3FJBA 3VUOA 1TIEA 4I8MA 4I4UA 2WBCA 2XOAA 1IRAX 3O4BA 4KEKA 4X39A 1QQKA 2ESUA 2Y9XE 2DS0A 5I1BA 3CA0A 3ZXDA 4I6IA 4P0JA 1JT5A 1AVXB 2BFHA 4GOVA 3BAQA 2E4MA 4QBCA 3WO3A 1R8NA 2IWTB 1YF8B 5FNWA 4H9WA 4I37A 4J2YA 1HKNA 3NBEA 4A7ZA 3N7JA 3OBTA 3FJKA 3FJFA 1MC9A 5EC5A 3C9ZA 4ZFUB 4JQ0A 1DQGA 2HWMA 3BAVA 4G9NA 4LO2C 2BEBA 2KH2A 1PUMB 4X3AA 3A23A 1FWVA 1Q04A 5BVPI 1RG8A 1ILR1 1FGAA 3JUTA 3P6JA 3VEQA 1EV2A 4F34A 3PUBA 4G6MA 3UD9A 3NBDA 4DCKC 3R4SA 1ISVA 3LTQA 5FNXA 1S0BA 1YBIA 1RZOB 3CQAA 1NZKA 4Q91A 3UD7A 3V79C 2NP0A 2Z49A 1SR4C 5EG6C 4QO3A 1Z0HA 2D22A 4JPZA 4ENDA 3BA5A 1ISWA 1IHKA 3CU1B 1PWAA 4ZFWB 5F8SA 1VCLA 1BLAA 1V6UA 4L4HA 1I1BA 2DRZA 4GOYA 3P6IA 4F83A 1DZCA 4I4OA 1K5UA 3RSJA 2P39A 1DFQA 2K43A 3W9TA 3AH1A 1QQLA 4I4YA 3IIRA 1FV3A 2ERMA 5D63A 1JT3A 2NZ9A 1AFCA 4CJMA 1BFCA 1SR4A 2YUGA 3VSZA 4P6AA 5F90A 3HBWA 3CRIA 2D43A 1A8DA 1S0EA 4I4VA 3F62B 4YOLA 4ZKTB 1S0FA 2E4MC 1Q1UA 3ZC8A 41BIA 2X2SA 4GAFA 4GP0A 1KNMA 3T8SA 3WINA 3O4OA 3CA5A 1BA7A 4QBVA 4JKXB 3O4CA 2RSTA 2Y9FA 4IY8A 4D0TA 4ZOTA 2VLCA 2KI4A 4OWJA 3UJ4A 1IRPA 1TWMA 1DJSB 1T4QA 3ZC9A 3FJ8A 4II0A 3PMEA 2AQZA 4PC4A 3S8KA 2HZ9A 4OEFA 1TOOA 2AXMA 3FJAA 3FUQA 4I4PA 4JKQA 2DRYA 3OGFA 3NBNA 5BOWA 1FN0A 3FJEA 1ABRB 1I1EA 1BLDA 1YYNA 2KI6B 1TP0A 3CRGA 3AKHA 3F1RA 2GO2A 4USOA 4D8HA 3FJCA 2F2FA 3HOMA 3AJ5A 3OBRA 2MC2A 5BXPA 4TLPA 1IJTA 2D7RA 1V6VA 3JRRA 4LO7C 4I1EA 5BXTA 3VT1A 4OEEA 4ZA3B 3BRDA 3OJVA 2R9KB 4QALA 1V6WA 1ONKB 4DENA 1W3GA 4QD2C 4LO7B 1EYLA 4G6JA 1BARA 3RTJB 3H6RB 2NM1A 4IZXA 2RQ9A 4D0ZA 1II4A 3Q7XA 1TTUA 3AH2A 4EEEB 1W3AA 1DQOA 1MD6A 2BEAA 2RG9B 3ILAA 3WO2A 3BADA 1WD4A 3QR5A 3WO4A 6I1BA 3AKIA 3CAHA 1M16A 1AVUA 3BB2A 5DSSB 1WBAA 3IM6A 3I29B 4OWLA 2Q9XA 4JAWA 3TC2A 3A21A 3H6RA 1ISZA 3WA1A 3O4AA 1WD3A 1RMLA 3H6QA 2NTDA 4I96A 2QN4A 3VT2A 1J0SA 4ZBVB 1AF9A 3FJHA 7I1BA 4IY9A 4Z8SB 4EKXB 3WINC 4QKSA 3A22A 4JP0A 5JLVA 1G9BA 3IAGC 1DZDA 4EB2B 3OJMA 5FZYA 1N4KA 1GGPB 1AVWB 3VT0A 4KBBA 2K4AB 3FJIA 3BA4A 1IILA 2MIBA 4I4QA 4P0LA 1T9FA 3HALA 1RY7A 1BFGA 1WBCA 1P63A 2DREA 3FJDA 3FGMA 2VXRA 1Z4SA 2UUSA 1JLYA 4ISQA 2NYYA 5F8WA 4EFRA 1AXMA 4LO3C 2FO1A 4QC4A 4XFUA 3BAHA 3BRGC 1BFBA 3KMVA 3OJ2A 4I2SA 1D0HA 1DLLA 5B2HA 3CA1A 1YTOA 3FUOA 4WBCA 4I3NA 1BASA 4HR6C 2F2FC 3B9UA 4IQPA 2VU9A 2VSAA 2ZR1B 3AJ6A 2QYIB 3RMYA 5JMCA 1K5VA 1JY0A 4I0YA 8I1BA 1UPSA 4LO1C 3MALA 3O49A 4OW4A 1S0GA 2FFUA 1ITBA 3SNVA 4QKRA 3AH4A 2FDBM 2IHOA 3R4UA 3S8JA 2D1ZA 4A7KA 1FMZA 4J23B 4LO3A 3AKGA 3O4DA 1IOBA 4Q9PA 2KLLA 3HN1A 3POKA 3V0BB 1HCDA 2LIQA 1DFCA 1FQ9A 1OQLB 1NUNA 3I2AA 4USPA 2F8XC 2D24A 3LLPA 3HMYA 4GAIA 1SZ6B 3UJ0A 1XYFA 4OEGA 3P53A 1EVTA
chains in the Genus database with same CATH superfamily
2IS6A 3FMRA 2K9SA 3T0YA 3WODF 2QUFA 1DU0A 2QBYB 3V7CA 3QU6A 4A0ZA 1JHHA 4KNYA 4Y15A 1YJWI 4ESJA 1HWOB 3GMEA 3HRMA 4N4NB 2ET2A 3NAUA 4IYBA 1G9CA 2M9HA 5DVHA 1BJAA 5L3DA 1RESA 5DYMA 1E2XA 3TP0A 4UV8A 3IHUA 3LSTA 2EFOA 3HSMA 2R7QA 3S2HJ 3FFZA 3V0AA 1YE9A 2Y0MA 2Y9GA 2R7OA 1QNTA 3ZXGA 4MNUA 4DEPA 1HSTA 1B72A 3WMVA 3GTMJ 4ANJA 3L9FA 3DKXA 3MZ8A 4U88A 4R1HA 3BTAA 4IO9F 3VSFA 4MGRA 5HODA 1R1UA 1LE8B 4JBAA 4BS9A 4H04A 1FOXA 2YX7A 3CO6C 5M3FJ 4RB1A 4XKVA 2DU9A 1VQ7I 1V5EA 1TLHB 2RC4A 3W2WA 3ASOH 3BR5A 1FMMS 2HTJA 3ZN0A 1I6XA 2ID6A 1TQPA 3K6GA 5H6QA 4ZYAA 1YOVB 3WHBA 3DU6A 2X6OA 2I8DA 2V9VA 2XC7A 3O5WB 1R5GA 2VQLA 3LQRA 2ZCWA 3I56I 3JRAA 1BC8C 3ZPLA 1PYVA 3GWZA 3L09A 2V1UA 2X48A 3EUKL 1S8NA 1YI2I 2IS1A 1I3QJ 2CH0A 2IBDA 3TOAA 3JRBA 3IKTA 3DTIA 3MFKA 4EATA 1D8JA 2OC6A 3H9GA 3I54A 1W5CC 2M4KA 4XN3A 2VC1A 3LSHA 4XLNF 4RGXA 4BEHB 3I0TA 4GRIA 3VOEA 3RMXA 3S17J 3C2BA 1A04A 5HS8A 2F4OB 1PUFA 4CICA 1JT7A 1MNMC 3HRSA 4OIRF 5J47A 2WBMA 2HOTA 4PSWA 2L5XA 1QZZA 2DAOA 4I99C 5G00A 1V5FA 3BAGA 3G6EI 1T33A 1JQZA 5J40A 5DTDA 2XRNA 5H2FC 4EM1A 4CZZA 3W3CA 3R4KA 3GO5A 1I1GA 1E3HA 5DUYA 2L7FP 4AIDA 4FGFA 5BS6A 2Z3YA 3E6CC 5BPIA 3CC2I 4QPOA 1W4MA 1R4MB 4ZZDA 3Q5FA 3Q3SA 4F91B 4XLPF 1BA5A 2M3AA 2CUZA 4ZYGA 3NBCA 4J2KA 2ID3A 2LVSA 3EQLF 4UXNA 3HOYJ 1OISA 4XONA 4O6JA 4OWKA 4XKIA 1T38A 2NOJB 2X9DA 4P5OA 1TWEA 3S3MA 1G3YA 4Q9GA 1XS9A 3ABLH 1FNNA 4DOZA 3VWCA 2AFGA 2DA3A 1UHSA 3O44A 2LKSA 3S3OA 3F8BA 1E3OC 3A07A 4OUJA 1KQ0A 3T8RA 3IUOA 5F08A 4KA4A 1AVAC 1FSEA 2D23A 2RV8A 4F93B 3K70D 1FYKA 3HXLA 5IYBJ 1XB4A 2BY1A 4I02A 3PFYA 5GAEJ 3BTJA 2RNJA 1YFHA 2JA7J 3SEQA 1J59A 3WMUA 2XPWA 3HTUA 1VQOI 4L9TA 3VYUB 1XMAA 5J1YA 2ME0A 4EJVA 2YPRA 2M2EA 2P6TA 1LDKB 3HOSA 4N9IA 4HX8A 2K40A 1RIOH 1AKHB 2A6EF 2K02A 1I5ZA 4XORA 2QKLB 2BXZA 1CE7B 2VQGA 3WE2A 2V79A 2XF5A 5ILSA 4ENJA 1O7FA 4J2XA 4XBFA 3VFZA 1IRFA 3H3UA 2WAQA 3IM5A 2UV1A 1UG0A 3QPSA 1M2TB 4M9SA 5BQUA 3OYFA 4O3MA 2PG4A 5FZZA 3K4MA 3S93A 3RCOA 4BY1J 2NXNB 4I8MA 4XLFA 3F72A 4EGYA 1P4XA 2WBCA 1MSEC 2KKOA 4CCMA 4EJUA 3O4BA 4KEKA 4X39A 2IXSA 1X1AA 2EILH 1IN8A 2K27A 3H0DA 2Y9XE 1QPMA 2DOFA 2BFHA 3BAQA 3ZQQA 5EYRA 1R8NA 3I4MJ 2L02A 2OQGA 1B59A 2K4JA 4RMNA 4NQWB 3FIWA 3OYBA 3U2RA 1X2NA 2PMHA 1B1BA 4BDZA 2FF4A 2MABA 4MEXF 3OBTA 1V5GA 3FISA 2A6TA 2CQXA 2H94A 2V26A 3RTRA 2RGVA 1UFMA 4W97A 4HSTA 1MH3A 2R7VA 2ETHA 2M0CA 2CV2A 5B66C 3WGIA 4JQ0A 2CUEA 3S8PA 2QQAA 1NTCA 3TKYA 4LFUA 3S32A 2DN0A 1G4DA 4PGGA 1MJAA 1PUMB 3I71A 3OIPA 3AAFA 4CYCB 1I27A 4X3AA 2D1HA 3KYDB 6PAXA 4KIBA 2HGCA 3F21A 3IKVA 1FWVA 1SFXA 3J81K 2XHKA 3ZMVA 5BVPI 2XV4S 5K7ZA 4RLFA 4HLYA 5CVJA 2B9SA 3JUTA 4G6TB 3V8LA 2LC2A 1A31A 4F34A 1W0TA 1XGMA 1Z67A 3HOZJ 3A1YA 3DKWA 1RKTA 3UD9A 4KFCA 1GXQA 3RQIA 1RI7A 2DOEA 3CQZJ 4DCKC 2BZTA 1DGWY 2FRHA 4XN0A 5BOXA 1YO5C 2FA5A 1UHMA 3R60A 4Q91A 1IV8A 4OIOF 3HYIA 1FPQA 1K78A 2NP0A 2IJLA 2NYXA 3MWMA 4E4HA 5L3CA 4QTRA 1VQMI 4HF1A 1HXDA 3K1PA 1IDZA 2X85A 5ERIA 1K61A 1VZ0A 2D22A 1WJDA 1X2MA 4ENDA 5J6XA 2D45A 1ZYRF 1ISWA 1MGTA 1Q1HA 3B6AA 2K5CA 3VDXA 1K79A 2FMLA 4LLGF 1MDMB 4M74A 1BLAA 1IXCA 5FGMA 4U7BA 1OCOH 3I5UA 3HRUA 1LFBA 1R1VA 2LY1A 2LK2A 3E6MA 4UUVA 3KE2A 4KIGA 3OSFA 5D8KB 1HKTA 4ENKA 2KP6A 3P6IA 1R9TJ 1DZCA 3K2ZA 1SVOA 3D1NI 3GTPJ 1LPQA 1T0FC 2EA4A 4C2UA 2ZXJA 3OYMA 1R58A 2PBIA 2EIJH 1MBFA 3DBLB 2UZKA 4Y13A 2DCEA 5IOZA 1QQLA 3AH1A 4I4YA 2M5WA 3K0LA 2PJPA 1FV3A 1IRXA 5BQTA 2P4WA 1D0YA 5E3LA 2QZ8A 1IN5A 5D63A 3M7GA 2WA0A 1JT3A 2ZBKA 2OTJI 1PJRA 1TNSA 4HQMA 4II3A 3AL0C 2YUGA 2EFWA 4WK8F 1VQ9I 4M9ZA 4YEJA 5F90A 1J0RA 5E18F 2E71A 1OLTA 3FK6A 4XICA 2O8KA 3UNGC 5L3GA 3N4MA 3EETA 4YOLA 1ZK8A 3RZDJ 2OPTA 3ZC8A 1YJ9I 3MMYB 4UUSB 2OTLI 5GPAA 5FKOA 4HRIA 1R71A 2JRTA 5LHGA 4JKXB 3LSKA 4PJLA 2KIFA 4IY8A 1HCRA 1LFUP 4ZOTA 1FZPB 2VLCA 4LK1F 4KISA 2XGCA 1CF7B 4ZZLA 2VPLA 2P8TA 5DCFA 2ELHA 2KJCA 4PUSA 4LIVA 3W2AA 4F3QA 4JK1X 5DUKA 4OEFA 3QPLA 3MCZA 5TISC 3CUQB 4XLEA 4S0HB 2CMPA 2NVTJ 3FJAA 4JKQA 3BZ6A 5DV5A 4EM2A 1W0UA 4XSXF 5IP9J 1ZKGA 3MKYB 5FO5A 3AG4H 3I59B 3B02A 2HWVA 1FSHA 3ASNH 1QGPA 3DEWA 3M1CA 3JTGA 3HJEA 2X4HA 1BLDA 2CGPA 1YYNA 4DJAA 2KI6B 2W25A 1A6QA 2Q1ZB 4A2UA 2GO2A 3GZ6A 3R0JA 3ZXSA 4FASD 4DYCA 3AJ5A 3FJCA 3OBRA 2Y75A 2MC2A 5BXPA 3W6KB 3GTLJ 3JAMZ 3G4SI 4C3IJ 3LSGA 1RUNA 1AU7A 4I1EA 2VPRA 1ZH5A 4A3KJ 4H75A 2JK3A 3VT1A 1JJ8C 1KU2A 2O7OA 4V2GA 3OJVA 2P0WA 3FX3A 1Z21A 3FXKA 5GTIC 5DS9A 2VT3A 5K5RA 1NH3A 1V6WA 4QALA 1X1PA 3U1DA 1ONKB 3GCMA 3KIOA 1JT6A 3F22A 4QD2C 2KDOA 3CCVI 4LO7B 9ANTA 2IPQX 3C18A 1H89C 2FNAA 4G6JA 3VSLA 1YYVA 2NNYA 1X1DA 5E3OA 4IZXA 2LH9A 2XB5A 4BE1A 1WVRA 3AG1H 1FOYA 2VIXA 5EG0B 1PP8F 1JUSA 3V8KA 2AXTC 2VBXA 2RG9B 3WO2A 1MBJA 4CDGA 2HI3A 3QR5A 3P5JA 1JGSA 4GGGA 4YFXF 1R1TA 3WTXC 2L3DA 1M16A 3CAHA 3BB2A 5AIQA 3OYDA 1WBAA 3MKWB 3PJRA 2VI6A 3PNTA 3BCAA 3M1EA 2HQAA 4HAMA 4E6KG 1BW6A 3VODA 2VT2A 3SZGA 4YG2F 5K5OA 3LSJA 2KFDA 2QWWA 1FC3A 1R22A 3CTAA 3O4AA 1U0JA 2CJJA 1EV7A 3KP4A 2A6HF 2IGOA 3LSRA 1HA8A 4OU0A 1J0SA 4ZBVB 2DT6A 1LE8A 1AF9A 4A3DJ 3B73A 4MO7A 5B3SH 3FJHA 3G71I 2WV0A 1VQNI 3HKZN 7I1BA 2ZNZA 3VB2A 2V1DA 3K4BA 1RZ4A 2R7TA 1TWHJ 4Z8SB 4HOBA 1JKPC 4HPQA 2QA4I 2EZLA 4NC6A 5D5WB 3WINC 1ZHFA 1R00A 2FSWA 3FHNA 1DPRA 1LDJA 3QP5A 4QWQA 1OCTC 2Q2EA 3QYFA 1KQ9A 5DCMB 2GXAA 4EB2B 2FOKA 4ZYHA 3QYEA 5FZYA 5A2QZ 1KU7A 2CQKA 1S29A 2L0KA 2L7MP 4FT8A 3R6SA 2DI3A 5J1RA 2W7NA 2VODA 1EJ9A 2JTVA 4AU7A 4BEHA 3FMSA 2R7XA 3JRFA 1P63A 2N8GA 3FJDA 2CYYA 1LB2A 2VXRA 5LGUA 2XIGA 3LA3A 3E97A 2NYYA 2W48A 2VOPA 2VE9A 2FO1A 2E1OA 4XKCA 2HDCA 1WH5A 2ZXHA 3BRGC 3OJ2A 2BBYA 4R8HA 5GPCA 3BG7A 1KZHA 3FUOA 5HDGA 4BY7J 3K2AA 2X51A 4HR6C 2F2FC 2K85A 4H4KC 4IQPA 3IAS2 3IH4A 5FJ8J 2UWMA 2VSAA 2ZR1B 3OIQA 1QO0D 2ZJRF 2JUCA 2E2HJ 2DA5A 4EMSA 1BM9A 2CW7A 2DT5A 1O3QA 1UPSA 2F5FA 3OIOA 1S0GA 2NVUB 5ICCA 2A68F 2CFXA 3SNVA 2WAQN 3OYKA 2RVCA 2IHOA 3R4UA 1OYYA 5EEHA 1YRNB 1FMZA 3FKIJ 4Z2YA 4KT5C 2L7KA 2BY2A 1IOBA 4Q9PA 4YFNF 1G6NA 1E0EA 3POKA 3V0BB 3Q9VA 3JRIA 1FQ9A 1OQLB 4ON0A 2F8XC 3G73A 1F43A 4GAIA 1G8XA 3SDBA 1A36A 2G0EA 1EVTA 3DP7A 1SC7A 1ORKA 2VXTI 2GZBA 1DP3A 1G82A 3BAOA 4G9MA 1X19A 4ZTFA 4FISA 5F0CA 2J3PA 2HWAA 4DBRA 3AKFA 4IHZA 5DEQA 2K8RA 4LO1A 2F4MB 2I1BA 4BJ5C 3PQJA 1P7JA 1U8RA 3ZMUA 5FLXZ 5E24E 1VNDA 4CCOA 3G1MA 3CRHA 1JTYA 3JSPA 1IO2A 3TGNA 1IAWA 1FWZA 3VPRA 3T8TA 2NVQJ 5ICEA 1JKRC 3BTIA 1RUOA 1IT0A 1Z1DA 4B09A 1WZ2A 5FZUA 3NJ5A 4ZYDA 4GYGA 2QSGX 3GTOJ 1XG1A 4JYKA 1XSXA 1SD4A 4LG3A 1MMSA 2HEOA 2GAUA 4KUMA 5KHDA 1TWCJ 2HYFA 4RM3A 3N7LA 4DYRA 1SD6A 3ML6A 4AD9A 3GLXA 1XN7A 3BY6A 2RN7A 3L2CA 3BJ6A 3PG0A 1SVMA 2CQQA 4HX4A 5FD5A 2H6BA 4UVAA 1YTYA 4NQWA 1PUUB 2BY0A 4BKXA 4HV6A 1ISXA 4ZFYB 3UD8A 3OGGA 1BOAA 3A0HC 1P92A 2ME6A 2A07F 2VUAA 3E1SA 1W7PD 4A3FJ 3O8GA 3W6JB 2A5YB 2XF6A 1REPC 4J2SA 4DQ2A 2FEZA 3MPPG 1Y1VJ 31BIA 5HDKA 1FV2A 1OQYA 3OOUA 2JT1A 1S9HA 2CWEA 4I76A 1GXPA 5D61A 2CU7A 2QM3A 2Y48A 5EHAA 4Y7NJ 1ZGJA 2ZB9A 2Y2ZA 3DQVC 3K10A 4CYCA 4JRAA 4WXDA 4KMUX 3S3NA 1HW1A 3BQYA 1F9NA 2WY7Q 4BQAA 2IA0A 2ZQNA 4GYIA 2LTPA 4MFEA 4XNFA 1MBHA 2DA6A 2M49A 1MJ9A 2L54A 1LVKA 1LFPA 2V7FA 2HTSA 3M07A 2WC2A 2JSCA 4EQQA 4I7IA 1MW7A 5K7HA 4F7ZA 5LFAA 5BXSA 1G9DA 2QQ8A 2VB6A 1IJWC 2M87A 1JXSA 1ISYA 2DDAA 2DJIA 2AQFA 3LFKA 2H1LA 3P9KA 2DFHA 5F8YA 3RKWA 3BG3A 2R7SA 4M3DA 2OJED 5JVGF 2R7UA 2FE3A 2W1OA 4U0WA 2M30A 1AOYA 3N7MA 1HC8A 4P0KA 5BQUC 2ISYA 3SZTA 3KP3A 4B43A 2GBYA 1JTCA 1D1AA 3O8HA 2V6EA 1MDMA 3Q7YA 1K6YA 1PZZA 2MLLB 3TEDA 5GTHC 3KP6A 3AKZA 1FWUA 1KGSA 1R8OA 2WB1A 5DM7F 3BJAA 3DPLC 2DMPA 5BPDA 2M0MA 3AG3H 4EV0A 2P23A 2R7DA 3PFIA 1O4XA 3HGGA 1MKMA 4G1RA 3J7ZI 2FBKA 4V2FA 5K5QA 1MMNA 3H36A 4UUTA 2JA6J 2UUZA 4FX0A 3QAHA 3CA6A 1D0ZA 2E60A 2QCOA 2PN6A 2EJRA 1DIWA 3CA3A 3GYHX 1GVJA 2W82A 1NG6A 4CHUA 4XMYA 3HRTA 3DLLF 1IN7A 4AN7B 2ELKA 2R4GA 3OYHA 2MSYA 3OWTA 4KN7X 1W3FA 5D5UB 1YW8A 4MQ9F 3HPHA 4LIUA 4UUSA 3GBGA 1IRAX 1QQKA 5KAIC 4IOAF 1G2HA 3CA0A 2L4MA 4P0JA 1JT5A 4GOVA 3FBNB 4PK4A 4CXFA 1SVLA 2IWTB 5FNWA 1P4WA 1CF7A 2DLLA 2W57A 2KPMA 1MMGA 3ZQ7A 2HFHA 2JN6A 2AXLA 1HKNA 3NBEA 2GA1A 4A7ZA 1IDYA 1YJNI 3FJFA 1MC9A 5E3NA 1WHUA 2V1XA 1BW5A 2NS7A 1VQLI 2CFOA 2K3FA 4GO1A 4IPAA 1WCMJ 1DQGA 1LDDA 3C2HA 4YIFA 5B5EC 2X6XA 1BL0A 2HWMA 1Z3XA 2P5KA 3BAVA 1ETYA 3I59A 3VYSB 2V6CA 3EPZA 2I10A 5H20A 5M3MJ 2ACJA 2TRTA 2W00A 2LKXA 2BEBA 4LO2C 1IG7A 1U5TA 2MH9A 2KH2A 5KAFC 2XAHA 2XPUA 2K86A 1WJEA 2Z2SB 2LOOA 3RJPA 1QHHD 1WGXA 4C3JJ 1Z6RA 3L2RA 2PX9A 3CUOA 3TO7A 4L18B 3A23A 1DP7P 3HM5A 1Q04A 4B8XA 4MIMA 2E1MB 1GDTA 3OR1C 1RG8A 4HA8A 5IP6A 1XMXA 1TWAJ 3P6JA 3WTSC 3CDLA 1XD7A 3ZRGA 4F52A 2ZFWA 2K3PA 3PUBA 2IVMA 2PI0A 3M8FA 2EV5A 2OBPA 2XVCA 4CUGA 2R93J 3CCEI 2H27A 4IHXA 4PJ0C 5FNXA 1S0BA 1X4OA 4F55A 2L2OA 3UD7A 5HVQC 3V79C 3ZMDA 2IA1A 4KYWA 2X6WA 5EG6C 4DW6A 4LB6B 1NHAA 3HKZA 2EBIA 2P81A 5EG0A 2AQEA 3I58A 2JA2A 3ISPA 4G12A 1U8BA 2KRCA 2FXAA 5J4VA 4E7JA 4HX7A 3F23A 2VL8A 3CJNA 2P5VA 2BHZA 1KQ8A 1N75A 2QYOA 2UXNA 1I1BA 2JPBA 3E5QA 2XAFA 1JKOC 2VJ5A 2IS4A 1SMTA 4I4OA 1K5UA 1IV6A 3RSJA 1VQPI 4U7DA 4HNVA 1IZ1A 4HDUA 1DFQA 1GV2A 2CV1A 5FLMJ 3J7AO 4QIWN 1VF9A 1YG2A 3JW4A 3IIRA 1E3PA 3JR9A 1EH7A 2OCEA 2KZVA 4MZHA 1GLNA 3ZQGA 2KIQA 3HG9A 1UMQA 1AFCA 4XOTA 5L3EA 1VQ5I 1BFCA 2R7FA 2Q0OA 2A69F 3UR3C 4CH7A 2F5DA 3GW2A 2BVLA 3FXMA 2OD5A 2FBHA 1XPXA 4XM3A 4ZJZA 1S0EA 2G7HA 3S2WA 1ZQ3P 3LWFA 4IEJA 2UXXA 3OYIA 1TQIA 3F62B 4LD5A 4ZKTB 4A3IJ 1LJ9A 2F5EA 5DCMA 4DNCA 3LSPA 3CO7C 2ZMEB 3COAC 1BC7C 3AL0B 2E4MC 2X2SA 1AWCA 4LGWA 4GP0A 2XSJC 2MH2A 5CKTA 4BE2A 3T8SA 3GLLA 1J7KA 1S7AA 4QBVA 2HR3A 1FT9A 2Y9FA 1EH6A 1Y39A 3S1NJ 4QLCU 3OS2A 1UHWA 3UJ4A 1HKSA 4HNUA 2R3SA 1PP7U 2V4JC 3FJ8A 1J2XA 4PC4A 3S8KA 2KMUA 4MFDA 3F9KA 1BR1A 3GFIA 3W6VA 2CV0A 3FUQA 2Y31A 1OR7C 2DRYA 4A69C 4C30A 3B6CA 4Y33A 1WFXA 3ZMZA 3NBNA 5J3LA 4ZTJA 3ABUA 3NWSA 4U0VA 4OIPF 2Z16A 2AHQA 1H0MA 5ICGA 2VJIA 1FN0A 2HOAA 1DQUA 3M8EA 1RR7A 3V4GA 2PJRB 3F8CA 1J9IA 1ABRB 1I1EA 1ETOA 2NS8A 1R5ID 1IN6A 2LBFB 3OYNA 5FRNA 3HOMA 3T5XA 4RB3C 3KCCA 3E0JB 2CW8A 3PIOF 4NDLA 1KU3A 1MBGA 3BT9A 1IXRC 2K4BA 5IOYA 1IC8A 1FIAA 2MFZA 2MLKA 3GZNB 1IUYA 3A02A 5BXTA 3HUGB 3JSOA 3H5AA 3LMMA 3BRDA 4OOIA 2R9KB 1XC5A 1DDNA 1LEAA 1EH8A 3P9CA 1V54H 2M1BA 3CLQA 3CCLI 4IQJA 3OOPA 3REOA 1EYLA 2DDBA 1BARA 3KLOA 2YU9J 2MC4A 2L9RA 3H3ZA 3BC8A 2NM1A 1KA8A 2RQ9A 2Z99A 5F0FA 3IH3A 1EA3A 3OYGA 1TZLA 4D0ZA 3Q7XA 1TTUA 2I5UA 2V1NA 3ABKH 1X4PA 2O0YA 1W3AA 1P2FA 1DQOA 3ABMH 1MD6A 3ILAA 1W7PB 3QQAA 4CA0A 2M7AA 4JX5A 5FFXA 3WO4A 2QSFX 2XGXA 4AM3A 1XSDA 2EQRA 4L9VA 2D1VA 1GT0C 3I29B 4OWLA 1LUJB 2ICWG 1B4AA 2Q9XA 5D6EA 4OMZA 5F27A 3A21A 3TC2A 3H6RA 1W36C 4UY8I 3I4PA 4XK4A 1ISZA 2NNNA 3LA2A 2V9PA 2E35A 1RMLA 4BE0A 1JTXA 2NTDA 2R0QC 2QN4A 2RAEA 2Q8KA 1EKEA 2FMYA 1BIBA 3F3XA 3IV5A 4RAYA 3J80K 5DDGA 3DLAA 4M72A 3RKQA 3HSRA 3M3YJ 1LKXA 3H92A 2R5ZB 4EKXB 1T08B 1Z05A 1FJLA 3VEPA 3A22A 1B8IB 4E70A 4HV5A 2BEOA 1WWXA 2L4AA 2ZO4A 1SFKA 2F2EA 4RM2A 4ZDLA 3S16J 2WY8Q 1FX7A 3PM1A 4XOPA 1YS7A 4RGRA 1POGA 3CJQB 4RLQA 4ENNA 1AVWB 2K4AB 3FJIA 2GXBA 1LVAA 2VOOA 3BA4A 1SAUA 4BQQA 3HALA 1RY7A 1BFGA 1WBCA 4Y4RA 3MEXA 4CCKA 2CG4A 3MD2A 2BGCA 2J5OA 4YRVA 5F8WA 2A5WA 5D8LB 4QC4A 4U0YA 2W85A 5FROA 4D5FA 1ETKA 1BFBA 4AUXA 2LFBA 2DJNA 2XROA 2L9SA 1R4NB 2VBZA 2ZJPF 1PVEA 1U78A 3MAJA 5DM6F 2DPUA 1X3WB 2WB1N 1YTOA 5HLHA 2VKEA 3HHHA 2DQRA 5HNHA 4I3NA 4ZYEA 1BI0A 1TBXA 5L3FA 2JUGA 2EINH 4G8XA 3QRFF 1VQKI 3RMYA 3RYPA 2K9NA 3JCUC 5B1AH 5JHUA 1JGGA 1JY0A 4M3EA 1TTYA 3BDDA 4LO1C 2K7LA 3ERMA 1W5TA 3IH2A 1ZN2A 4OW4A 3RPUD 2FFUA 1MD0A 4HYEA 1ITBA 3BZCA 4ABZA 1A5JA 4IRGA 3OS0A 1O7LA 3A01A 3AH4A 2QSHX 2D1ZA 3D0SA 1IN4A 2LSOA 2YU3A 4GFBA 4CGZA 4LO3A 4XRFA 2KLLA 3I3LA 4PJMA 4P9FA 4V19K 5CVIA 2LIQA 3E7LA 2NOGA 2ZXIA 4M73A 2HQ5A 3LLPA 3HMYA 1SZ6B 4Y17A 3HGYA 5ICFA 4OEGA 1BN5A 1HWMB 1Z2VA 3KEQA 5HNFA 2ISZA 3PO2J 2QLZA 1JT4A 2X2TA 1HCEA 3L7WA 1DU6A 2KL4A 4XQFA 2XAUA 3ZR8X 4ITVA 3LFUA 3LQQA 1R36A 4HEA2 1W5SA 3H5NA 3HZJA 3FF5A 4O5VA 3CLOA 4A0YA 4BBSJ 3WTZA 2L01A 4A3GJ 4I09A 1BOBA 4XR6A 2BE5F 5F04A 3HBLA 2WWYA 2VJJA 5KCMA 1CGPA 1FTTA 2MA3A 4Q5SF 1RPWA 2O03A 2XKPA 3BJOA 2E2JJ 2KDZA 2R7ZJ 4HA2A 2P7VB 2Y9WC 4G9YA 4IZEA 3ROUA 4KEJA 3RKYA 4HQEA 2QBYA 3MVPA 1XDUA 1V3FA 2IEKA 4M6XA 3G3ZA 3N7KA 3EUHA 3JRHA 3PNVA 1APLC 5E1XA 1WQ2A 2Z48A 4XKBA 3NWTA 4UVBA 4AN6A 2DA7A 1S0LA 3UDAA 3F6OA 1PUFB 4BUPA 2VN2A 3RKXA 2ECCA 2LR8A 2AAIB 2EZHA 4A6DA 5M5XJ 3J81Z 3D5RC 1OCPA 1OCRH 4I98B 2DFEA 3ERED 2FOWA 3BWGA 1X58A 1N78A 4NNJA 2ZQOA 3L00A 4HJJA 4OAYA 4D1QA 3QP6A 1L2HA 1Y8QB 2HYJA 1S0CA 4ZGRB 2D44A 4A5MA 3AZVA 3BRFA 3K4JA 1T98A 2L9NA 4G7HF 1MNDA 3S14J 4GP3A 4ESBA 4IHSA 3K4CA 4CO8A 2HKOA 4BHCA 1MZBA 3M4OJ 2RQQA 4R6UB 5F64A 5E8GA 2R92J 3IM7A 3CMAI 3M9AA 2KIUA 2JSPA 2JA8J 1W36D 4KC3A 3ZQHA 1MSFC 3FXJA 4UVCA 1I50J 2CRGA 2XSDC 3IAM2 3HHGA 2HW9A 1BBYA 3BCBA 3J80Z 1CVSA 5HS9A 5E8IA 2JVGA 4PJJA 1SANA 1V6XA 5E1ZB 4LO8B 1WJAA 1XMKA 5ED4A 2D7IA 1P4AA 3FM5A 4BQOA 1EPWA 3BAUA 4NBQA 2MW8A 3Q7WA 4I1BA 2OA4A 4GCVA 1QBJA 3H6SE 3OYAA 5BXRA 4X38A 2KQRA 1JLXA 3QPHA 4BXXJ 4LO0A 2ESHA 4E7SA 4I4SA 2KRFA 1QXMA 1YQAA 3DU5A 3SZPA 2QF7A 2YR2A 3GTKJ 5CVUA 2LIEA 1HWPB 2E5NA 4LMYA 3E8LC 2OUMA 3H1CA 4XL9A 4A3LJ 2VE8A 3R61A 1B9NA 4CCNA 4D0PA 2QEXI 1PC8B 2DK5A 2ZXWH 3ESWB 3AZWA 2LNBA 1PUEE 1EF4A 4XFTA 1HDPA 4BAYA 2ZC2A 1WJBA 5HLIA 2VC0A 3HB9A 2YS9A 1O3TA 5TJJA 2WADA 4Q47A 2FGFA 1MBKA 5BP5A 4IONA 1QVTA 5FKKA 4ISRA 3V7SA 3BR1A 3JRCA 5FKNA 1WRJA 3GFMA 4L0ZB 3R0AA 4XFSA 4ZDOA 4DZPA 1K4TA 4IHYA 1I6HJ 4BQNA 4R79A 3HDDA 3K1MA 1CQTA 1ZELA 2NVHA 5JFRA 1E0OA 2Q3NB 4BL0B 5E3MA 1TP4A 3BLYA 3Q0UA 1MBEA 5JVTA 3ZX7A 4L5IA 5F6FA 1TC3C 3PO3J 2EFNA 2LKPA 2RREA 3KYLA 3S2DJ 4G94A 3X2QH 1HWNB 3FJBA 4Z9WB 2F5VA 1M1EB 3IWFA 2ZMEA 3BTCA 1U5TC 3DBHB 4I4UA 1AKHA 2ECBA 2EIMH 4QSHA 3JTHA 2TCTA 2FD5A 1W1WE 3GTGJ 3ZXDA 2DA2A 4G7OF 1AVXB 3TO6A 4MQVA 2WAEA 3WO3A 3TW6A 4YELA 4H9WA 4RAFA 4RAGA 2H6CA 5KK1A 4IRHA 2CO5A 4MZGB 4PFOA 4M9XA 4BGDA 2J5PA 4PSXA 1O3RA 3VSKA 2HOSA 1WJCA 5LLQA 1BI3A 4BHPA 5M5WJ 4ZFUB 2H09A 1FBUA 1HSJA 2W4SA 5IP7J 5J8FA 1DPUA 1OFCX 4UB6C 4IL6C 3CMMA 4N9HA 3CCYA 4B1RA 4WCGA 1FY7A 1R23A 2XPVA 1FMVA 4XLAA 4UNOA 2ADUA 2L9VA 2GXGA 3WGHA 1E17A 5LHHA 4W1UA 2LBFA 4G6QA 4DZJA 2VXZA 2RQPA 5K1YA 2JPCA 3A4CA 4IKFA 3NEUA 2ZKZA 2XGEA 5HS7A 5C4JJ 1ETVA 3HUGA 3DKYA 1J5YA 3RIRA 1SFUA 2HZDA 3R4SA 1ETQA 1UJ8A 3OY9A 1ISVA 2KJBA 5CQEA 1YIJI 4EJTA 5IPAA 1YBIA 1G3WA 2HPIA 1NZKA 2WV1A 2BV6A 5F1RA 4KITB 4HZFA 2VBWA 4TV7A 2Z49A 1WSUA 1ETWA 2A3SA 1VQ4I 3IC7A 3DFGA 1OMIA 2BOLA 1YX5A 4KT6A 5CYVA 4AVPA 3CF5F 3E6DA 4JPZA 1XCVA 2HXOA 1ONVA 3SQNA 3BA5A 2KHMA 3N97A 4HF2A 1W7PA 4AWXB 3WTVC 1VQ8I 4RBOA 1PWAA 5F8SA 2FBIA 1OYWA 2OF7A 1BIAA 4G7ZF 5LRSA 4IRIA 2HVSA 1V6UA 4L4HA 4MTEA 4HLXA 4II2A 2M45A 5KVRA 2ESNA 4RS8A 2DRZA 1Z3YA 2VONA 1T56A 4GOYA 1FP1D 4F83A 4HBLA 3MQ0A 1H9TA 1PDNC 2R7RA 2IGKA 3OS1A 1QU3A 2DOAA 3C7JA 3HTSB 2LF7A 2WTEA 2K43A 3K70C 4OAZA 1GVDA 2K9QA 5TRDA 2ERMA 5D4SA 1QZEA 2HZTA 2NZ9A 3CJTB 4CJMA 1RRJA 1SR4A 2GZWA 3CC4I 2LY2A 4FE7A 4P6AA 1R7JA 2R5ZA 4ETSA 3HBWA 3CRIA 4BYYA 4IZZA 4FX4A 2EK5A 4Q48A 1RNLA 2QQ9A 3ZQFA 2Z33A 2DO7A 4IVNA 1B8IA 1S5LC 5E17F 1B6AA 1JHFA 3L2WA 3KZIC 2DMQA 1S0FA 1YW7A 5EDNA 1Q1UA 5EZGA 2Y0SA 2Y9ZA 3WINA 3O4OA 3CA5A 2VQHA 1BA7A 1XGSA 1OCZH 3H35A 3H0GJ 2DK8A 3SHFA 2RSTA 4P96A 1Y8RB 1L3LA 1H9GA 3PL8A 5C44J 1U3EM 2HDDA 3GZ5A 3O3KA 2ZSIB 3UKGA 2KI4A 1IRPA 2LF8A 4A93J 1TWMA 2LG4A 3D5LA 4E7ZA 3ZC9A 3T1BA 3KZYA 3RDIA 2K9LA 3GUDA 3H9JA 5IYCJ 2AXMA 4WXHA 4I4PA 4I7HA 2OCCH 3FZVA 3KP7A 3WU0A 3BPVA 1BJZA 3FM3A 1OKRA 1QHGA 2X0LA 3K4KA 4L0YB 1Z6TA 1D0XA 4EJWA 1SFOJ 1HLVA 1H8AC 2W24A 2YX4A 2HVRA 3BROA 5EF6A 1D1CA 4K2EA 1XX5A 2DYRH 3BOQA 4PFPA 3GTJJ 5BOWA 2WAFA 2BYVE 3VWBA 5F0HA 3OMYA 2CSOA 1TP0A 4X1EA 3AKHA 2CW0F 1FYLA 4D8HA 1N77A 1YIOA 2F2FA 5J8CA 2Z9OA 1O3SA 3FK7A 3WE3A 3LAPA 3CUQA 4HNTA 3NRVA 1SD7A 4TLPA 2D7RA 4B47A 2H8RA 2ZNYA 3IL2A 3JRRA 2XKOA 1U6GA 2QQBA 4OEEA 4ZA3B 1XDSA 5JHFA 3S1MJ 1YLFA 1QPIA 2F5CA 2DMNA 1P7IA 3HOVJ 1W3GA 2F4IA 1RR8C 4M3FA 2PQ8A 4A6EA 3RPQA 1B9MA 1D3YA 3K4LA 4LK0F 1N25A 1II4A 1TW2A 3L2UA 3F8NA 2M8EA 3AH2A 4EEEB 1FYMA 1IUFA 4FE4A 3CCJI 2OQRA 1R6RA 1S3JA 5LEKA 2Y69H 2JJ7A 4FCYA 4XLCA 3CCUI 1ON1A 3AKIA 1BR4A 2KLOA 2F6CA 1AVUA 3EYYA 4S05A 5DSSB 3IM6A 4NC7A 2O3FA 3O6BB 3QWLA 4N4OB 3GTQJ 3BQZA 3CMEI 4UB8C 2X6YA 1G3TA 4JAWA 1SAXA 1D8KA 2JMWA 2Q2EB 3A0BC 2FJ1A 3C2GA 5TGTA 4AIJA 2AS5F 1WD3A 3H6QA 3ECOA 1MMDA 4C2MJ 4PJNA 3FDYA 3VT2A 2VKVA 5EGOB 3CJRB 2KT0A 4NUBA 1Z7UA 4RB2C 1TWFJ 5D5VB 3SYTA 4IY9A 5DD4A 2E7XA 2O9LA 3HEFA 3SEZA 2NS0A 4L9NA 3LNQA 1HF0A 5LRRA 3MN2A 1FLIA 1ZG1A 4QKSA 4JP0A 2VQCA 4KN4X 3C1DA 4M71A 3IAGC 3DV8A 3CC7I 3K7AJ 3L2QA 3ZMTA 5GAGJ 3CD6I 1XGNA 3RYRA 2A05A 4L5EA 3KPHA 4KBBA 3QOEA 1L0OC 2BW3B 3PQKA 1IILA 3OL3A 3DF8A 1HW5A 3F8FA 4M3BA 2XAQA 2O6GE 1T9FA 2DREA 4MLOA 3HOWJ 1FBQA 1Z4SA 3FWEA 2UUSA 3OYJA 1OPCA 4ISQA 1USSA 1WJFA 1JUMA 2COBA 1WH7A 2IS2A 4LO3C 1FMWA 4CCJA 2BY3A 3PNYA 4EGZA 4XFUA 4Z6YA 1VQ6I 3S15J 1KONA 4H0EA 2RKHA 4I2SA 1HQCA 1D0HA 3RI4A 1DLLA 5B2HA 3CA1A 2HYGD 2Y30A 3HOXJ 4J19A 1K83J 3TOBA 2OAZA 2CUFA 5J4YA 3FXRA 1IF1A 2HPMA 2QYIB 4AIHA 5JMCA 2HOEA 1ZAOA 5CPRB 5E1WA 4JX6A 4I0YA 8I1BA 4Y3OA 1RKWA 2MD0A 4ESFA 3OV8A 3KEOA 2OV7A 3EDPA 1Y0NA 4MHGA 4HSRA 2DXIA 3H3VK 4RGUA 3P7NA 1SMYF 1YS6A 3ABTA 5IY5H 3BR3A 3CCRI 3O2PE 3O4DA 5GADJ 4IXAA 4A3CJ 3GVAA 3SFIA 1ZGWA 2EB7A 2MD5A 1NUNA 3I2AA 3QPTA 2E1CA 1HBXG 1IGNA 3E3VA 5BNGA 3EUHC 1VTNC 3TQNA 3AFHA 3MKZA 3ZOBA 4OIQF 5C3EJ 4WWCA 2ZFUA 2D2WA 2E5ZA 3FBIB 3JAMK 1HW2A 2IP2A 5LEJA 4M3GA 4UV9A 1YRNA 1WI9A 4AYBA 3BR0A 2D20A 3HOUJ 4A12A 2G7UA 3OSGA 4NHJA 2DBBA 4LITA 3V0BA 1FIPA 2E34A 1MJBA 3MKLA 1VI0A 5D4RA 1A6IA 5HLTA 3CA4A 3O3QA 1FP2A 2FNPA 3ZP5A 3DEEA 2COMA 2HU9A 4XLHA 3BG9A 1ACIA 4KEIA 1TT5B 3M8JA 3PSIA 3E5XA 4KICA 4YIIA 4BDYA 1Z77A 3L2VA 4QD2B 2YSRA 4RGSA 2DMTA 2WRYA 1FOKA 5E79C 1AHDP 4IHVA 3FMQA 1ZGAA 3D5SC 3FXLA 2QENA 2QGUA 3BR2A 3DPUA 4FVVA 2E1MC 2Z5UA 3RSNA 1F31A 2JQ7A 1P9QC 3FJJA 2PMZN 2M7BA 4X37A 4DGWB 4X6AJ 3J7YJ 1Q03A 2R5YB 3U21A 3NQOA 2KKIA 3BX1C 3CF2A 1FTZA 4BHBA 1D1BA 1IXSB 4AC0A 3RZOJ 3OYCA 4A7YA 2FQ3A 3QYBA 5GAQA 1WPKA 1RC9A 3ZQLA 2EH3A 2FQ4A 3CCSI 4BACA 2EA2A 1IRZA 3KLNA 4I4RA 4LJZF 3CDIA 4LO0C 2LRDA 4EEFG 1GUUA 2VKDA 3BP8A 1D5YA 1Y0UA 2KZGA 4I0AA 4EFPA 2IGNA 4OINF 3V7RA 2JWTA 4ZC3A 3PHZA 2CQ7A 3TP3A 5HPZA 3K9TA 3K1NA 2XB0X 4BH9A 2O61A 4LO2A 3FXOA 3K4NA 1YW9A 4BXUA 1TL8A 4LOCA 1S0DA 1X1BA 5A2QK 2LLKA 5CQGA 1YXWA 2FFVA 1JT0A 2JVHA 5D62A 5IT3A 21BIA 2DW4A 2EWNA 4KMFA 1KU9A 2EFQA 5CVVA 5DUIA 4LLNA 3D7WB 2A61A 2CQNA 3I64A 5BP5C 2DMUA 4ZLBB 1GHCA 3FJ9A 1BFFA 2MBFA 3RTIB 2GLOA 4L4IA 1XCBA 1QA6A 3IRRA 1X3UA 1IW7F 2HDWA 2VSEA 1ODDA 1WJ5A 1Z91A 1ZTRA 4DYQA 4KJZA 3FXQA 3BA7A 4LG0B 1JJ6C 3BZKA 3HSEA 1Z0XA 1UZCA 1TW3A 3WTTC 5HDNA 4I6ZA 1U9OA 1XZZA 1G9AA 1T6SA 5HLGA 3K1XA 1T39A 2Y0SN 4A3MJ 1I1SA 3RQ4A 1FEXA 2ZMEC 4CCLA 3QYDA 2L5QA 2GM4A 4GDFA 2DTRA 3I2XA 2HQNA 3GFJA 1F36A 4I4XA 3F6VA 5B1BH 3EF2A 4WX9A 3N0KA 4XRMA 4YIRX 2E19A 2M8GX 4N0BA 3TBIA 1HIBA 5IT9K 3BG5A 3J7AY 3ZQIA 3WTUC 1TFMB 4DBQA 3HIFA 3CMYA 3P9IA 1I3AA 3BR6A 3K69A 2OZUA 3PSFA 4A3JJ 3AG2H 3BPXA 3GX4X 9ILBA 1ZLJA 3KP5A 3V0AB 4AVZA 5DZUA 1ZREA 3WU2C 2HKXA 2ZJ2A 1B72B 4A0XA 1C0WA 4HG2A 1XG6A 1XHBA 4EFQA 3VUOA 1TIEA 1QVUA 3RPUA 3GXOA 1J09A 2JRMA 2XOAA 3FKJA 1UB9A 2M34A 2E1NA 3PIPF 2ESUA 2DS0A 5I1BA 3LOCA 4HW0A 4I6IA 1MMAA 3KEYA 3TO9A 1ULYA 1T2KA 2E4MA 2ELJA 2B7EA 4QBCA 1SEUA 1U5TB 2DYSH 1YF8B 1HDDC 5FLXK 4I37A 5IYDJ 4D9JA 3I55I 2P7CB 4BNCA 5KNLA 4J2YA 3CZ6A 5L3BA 4A5NA 2BXYA 2HNHA 4IOCF 3N7JA 1SFEA 3FJKA 5JI6A 1ZG3A 4MZFB 5EC5A 4C2TA 3C9ZA 2VJ4A 3QOPA 2XAJA 4JQFA 1G3SA 1V55H 3HSFA 5DD8A 2KRHA 5GP9A 3KYCB 4G9NA 4JOMA 2B63J 1OR7A 2XF7A 1UAAA 3BTLA 5AONA 2W84A 2KISA 4FHTA 2IAIA 2CUJA 2V9KA 4MTDA 2DFIA 1NG7A 3IP4B 3JRDA 4I2OA 2GIZA 1ILR1 1FGAA 4FTHA 3VEQA 3WU1B 1EV2A 2GA2A 4IQ4A 3G2BA 5J1UA 4G6MA 2ZJQF 4A3EJ 4A3BJ 2TDXA 5JLWA 1F4KA 3U9GA 3NBDA 4PGHA 2MG4A 1ETXA 2EV0A 3LTQA 5LGTA 3OR2C 1RZOB 3CQAA 2E36A 1S7EA 1YHQI 2E7WA 4XKWA 4BBRJ 4IHWA 4X0GA 5FLVA 5LD2C 1SR4C 1SD5A 4QO3A 5CLSA 4E7IA 2XGDA 2DA4A 5K7FA 2IT0A 2ZSHB 2LMDA 2X1CA 1Z0HA 1ENHA 3MZHA 1IHKA 3JRGA 3CU1B 5EZHA 5FFZA 3SFZA 4B44A 2EZKA 4ZFWB 1TNTA 3WGGA 1VCLA 4M6YA 2LREA 2XUBA 3A03A 1WKMA 3CDHA 3G1OA 5EEGA 4B3XA 2LY9A 1NK2P 2XRLA 3TW7A 3CP2A 4UY4A 5D5XB 1X3ZB 2P39A 4P1WA 5ILVA 4RA2A 3GF2A 3A2KA 2XAGA 2YUSA 2HVQA 4C9YA 5EGOA 5EEAA 1GV5A 1MH4A 2L7ZA 2DTZA 2NAZA 4I0BA 2CS3A 4ZDPA 3VSZA 3ZN1A 2VUMJ 5F1JA 4GXOA 2Z1DA 2D43A 3WHCA 4E7LA 1A8DA 1ZRDA 5H6RA 2NRAC 2DA1A 3GEZA 3KP2A 4RB0A 4XRSG 3ZQCA 2BHYA 4I4VA 5FKMA 3G1LA 5HOOA 3MZYA 1MNEA 4IJAA 1OCCH 3U1KA 4HDVA 3TMOA 41BIA 4ASNA 3CP8A 2VLAA 4GAFA 1KNMA 2F48A 3CESA 2NS2A 2VASA 3KETA 2NVXJ 3HPGA 3O4CA 3TL4X 2KIMA 2FUG2 3HL2A 1T0FA 2BW3A 4D0TA 3VYRB 3HC7A 3CUQC 3DCFA 4OWJA 2MC3A 1BI2A 1T8IA 2VXDA 1LQ1A 1DJSB 4EVIA 2EIKH 2RDPA 3EUAA 1T4QA 4II0A 4HF0A 4RAZA 4FETA 1U2WA 3PMEA 1ZR4A 2STTA 4JX4A 2D5VA 2AQZA 5LHIA 2HZ9A 1KYZA 2FX0A 1ZRFA 4FQGA 1TOOA 1I39A 4Y52J 3WTWC 3V8JA 1NK3P 2GOMA 3CCQI 2GOXB 3I9V2 2MLGA 4D7MA 1R49A 2MYSA 4BJTA 5IT9Z 1Y56A 4L5JA 4RDUA 3OGFA 1ZR2A 3F8MA 1F5TA 4B48A 2H1KA 4P9UA 1MIJA 3VYTB 1ZARA 3FXUA 4BJ6C 2LD5A 4MEYF 2XDVA 4I01A 2MGQA 2STWA 3KFWX 4BXFA 3S1QJ 3LL7A 2EFPA 3WG7H 4AYBN 1JE8A 3FJEA 2XASA 1FBSA 3CRGA 3LSIA 3F1RA 4USOA 4P55A 3E6BA 4IF4A 1XSVA 4CYDA 2B0LA 1IJTA 1FOWA 3IWZA 3DBRB 3KX2A 2HXIA 4AIKA 1V6VA 4LO7C 1T95A 5JR3A 2GQQA 2Y9YA 2OZ6A 2PMUA 2NVYJ 1ON2A 5AIPA 4DENA 2DPDA 4EJOA 1TQMA 3TDZC 2EZIA 2DQLA 2P6SA 2C6YA 3RTJB 2PJRA 4ZH4F 3H6RB 2OU2A 4E7KA 3ULQB 5EJCA 1K78B 4LB5A 5FKLA 1QZYA 4KDPA 1LEBA 1LNWA 2X1EA 4PCQA 3ZCOA 3H9QA 2JZYA 3DTEA 2DT7B 1ERDA 2PEXA 2BVMA 3NARA 4DIQA 4F92B 1R5HA 1TT0A 5JLXA 1Z9CA 2PMZA 2DODA 4OMYA 2BEAA 1J75A 3BADA 2LP0A 5E20A 3WG9A 1WD4A 3LSMA 4ENMA 1BI1A 6I1BA 4D5CA 1S6LA 1JUPA 3LAJA 1HKQA 3OYLA 4B4CA 1K7AA 1DGRM 4CZCA 4M6VA 3DPTA 1H88C 2EV6A 2IGMA 2QVOA 2P5LC 4UHTA 3WA1A 2EPFA 3DXJF 2VKHA 4I96A 5D6FA 1AA7A 1X1CA 4LLLA 4PZJA 3W9TA 1D5VA 2DFFA 1QRYA 3BG6A 4NC8A 3DTKA 5CVRA 2IRFG 4BU2A 1RETA 1Z7LA 2JA5J 4G6DA 4Q4ZF 4WXCA 1JI8A 2HQRA 1UELB 3DWLE 5GAHJ 5LGNA 1OJLA 2R7WA 1ITYA 4E7HA 5JLVA 2HS5A 4NB5A 2IW5A 2GIVA 2VBYA 2G9WA 3OL4A 3SDGA 2R5YA 5FRMA 1U9NA 1G9BA 3OJMA 1DZDA 1Y1WJ 2LDUA 1V4RA 2GWRA 4EM0B 4IX7A 3S1RJ 4XSZF 1USTA 3V42A 5ILUA 1A35A 2PLYA 3JREA 1JKQC 1N4KA 1GGPB 3SJMA 3VT0A 3DEUA 3WTYC 1Y6IA 4PDKA 3ELKA 2H8WA 5FB2A 1G59A 3TDUC 2MIBA 1DUXC 4I4QA 5LBQA 4P0LA 5CJ9A 1IRGA 3Q0WA 3LA7A 1ZRCA 4D7NA 3FGMA 2O8XA 1ZLKA 3N05A 1XGOA 1OYIA 3ONQA 2QKMB 3OYEA 2PFBA 1JLYA 4EFRA 4J00A 1AXMA 3F0CA 1S7OA 3ZMSA 3H5RA 1S72I 4QPQA 3EYIA 3QODA 5BMZA 3BAHA 1WI3A 3KMVA 1UCRA 3A01B 1K6OA 1TWGJ 4U87A 1VFCA 1STZA 4XIDA 1O57A 4WBCA 4OWRB 3ECHA 1HOMA 1BASA 3L1PA 3ZGKA 4B3AA 3GFLA 3B9UA 2E2IJ 1QQIA 2VU9A 3FHZA 3AJ6A 2LYCA 1F1ZA 3Q9SA 2O5RA 1YITI 1K5VA 1UG2A 3I4NJ 2M4GA 2K9MA 3I53A 4IHTA 1ZG5A 2X1DA 3HOTA 3MALA 2AO9A 3O49A 4L9JA 3E5UA 4KIFA 4QKRA 2IA2A 4J01A 2RNGA 2FDBM 4YFKF 5C4XJ 4A7KA 1K4SA 4LG0A 3S8JA 1KYWA 4J23B 1YX3A 1XTAA 3SXYA 5FD6A 3AKGA 1Q1VA 4WF2A 3PUFA 3IRQA 4XRSA 3HN1A 1HCDA 3Q0VA 3CCMI 1DFCA 3C3WA 4USPA 3QU3A 5M5YJ 2D24A 1P6RA 4CSWA 4C3HJ 3KZZA 1BR2A 3UJ0A 1XYFA 4S04A 3P53A 2FU4A 3W2VA
chains in the Genus database with same CATH topology
2IS6A 1HWOB 2ET2A 4N4NB 4IYBA 1G9CA 5DVHA 3HSMA 2R7QA 3FFZA 3V0AA 1YE9A 2Y9GA 2R7OA 3ZXGA 4DEPA 3WMVA 4ANJA 3DKXA 3BTAA 3VSFA 4BS9A 4H04A 4XKVA 1V5EA 3W2WA 1FMMS 4ZYAA 3K6GA 3DU6A 2I8DA 2XC7A 3O5WB 2VQLA 1PYVA 3EUKL 2IS1A 2CH0A 3DTIA 4EATA 2OC6A 3H9GA 2M4KA 4XN3A 3LSHA 4BEHB 4GRIA 3RMXA 1JT7A 2WBMA 4PSWA 2L5XA 5G00A 1V5FA 3BAGA 1JQZA 3W3CA 5DUYA 4FGFA 4QPOA 4F91B 3NBCA 2M3AA 2CUZA 4J2KA 4XONA 4OWKA 4XKIA 2NOJB 4P5OA 1TWEA 3S3MA 4Q9GA 3VWCA 4DOZA 2AFGA 3O44A 3S3OA 3A07A 4OUJA 3IUOA 1AVAC 2D23A 4F93B 3K70D 3HXLA 3PFYA 3SEQA 3WMUA 3VYUB 3HOSA 1LDKB 4XORA 2QKLB 1CE7B 2VQGA 2XF5A 4J2XA 2WAQA 3IM5A 2UV1A 1UG0A 1M2TB 5BQUA 3OYFA 5FZZA 3K4MA 3S93A 3RCOA 4I8MA 4XLFA 2WBCA 4KEKA 3O4BA 4CCMA 4X39A 2IXSA 1X1AA 3H0DA 2Y9XE 2BFHA 3BAQA 3ZQQA 1R8NA 4RMNA 4NQWB 3OYBA 4BDZA 2MABA 3OBTA 1V5GA 2A6TA 2V26A 3RTRA 4HSTA 2R7VA 2CV2A 4JQ0A 3S8PA 3S32A 1PUMB 3OIPA 4X3AA 1FWVA 5BVPI 4RLFA 3JUTA 4G6TB 2LC2A 4F34A 3A1YA 3UD9A 4DCKC 1DGWY 4XN0A 4Q91A 2NP0A 4E4HA 2X85A 1VZ0A 2D22A 1WJDA 4ENDA 1ISWA 2K5CA 3VDXA 1BLAA 4U7BA 2LY1A 2KP6A 3P6IA 1DZCA 1T0FC 4C2UA 3OYMA 3W9TA 3AH1A 2DCEA 1QQLA 4I4YA 1FV3A 1IRXA 1D0YA 5D63A 2WA0A 1JT3A 1PJRA 4II3A 3AL0C 2YUGA 4YEJA 5F90A 1OLTA 3UNGC 4YOLA 3ZC8A 3MMYB 4HRIA 4JKXB 3LSKA 4PJLA 4IY8A 4ZOTA 2VLCA 4KISA 2VPLA 4PUSA 4LIVA 3W2AA 4F3QA 4OEFA 4XLEA 4JKQA 2CMPA 3FJAA 3MKYB 3M1CA 1BLDA 1YYNA 4DJAA 2KI6B 2Q1ZB 2GO2A 3ZXSA 4FASD 3FJCA 3AJ5A 3OBRA 2MC2A 5BXPA 3LSGA 4I1EA 4H75A 3VT1A 3OJVA 2P0WA 1Z21A 4QALA 1V6WA 1ONKB 4QD2C 2KDOA 4LO7B 4G6JA 3VSLA 1X1DA 4IZXA 2LH9A 4BE1A 2VIXA 2RG9B 3WO2A 3QR5A 3CAHA 1M16A 3BB2A 3OYDA 1WBAA 3MKWB 3PJRA 3PNTA 3BCAA 2HQAA 4E6KG 3SZGA 3O4AA 1U0JA 2IGOA 1HA8A 1J0SA 4ZBVB 2DT6A 1AF9A 3FJHA 7I1BA 3K4BA 2R7TA 4Z8SB 4HPQA 3WINC 3FHNA 3QYFA 4EB2B 3QYEA 5FZYA 2W7NA 4AU7A 4BEHA 2R7XA 1P63A 3FJDA 2VXRA 2NYYA 2FO1A 4XKCA 2ZXHA 3BRGC 3OJ2A 3BG7A 3FUOA 2X51A 4HR6C 2F2FC 4H4KC 4IQPA 3IAS2 2UWMA 2VSAA 2ZR1B 3OIQA 2CW7A 1UPSA 1S0GA 3SNVA 3OYKA 2IHOA 3R4UA 1FMZA 2L7KA 1IOBA 4Q9PA 1E0EA 3POKA 3V0BB 1FQ9A 1OQLB 2F8XC 4GAIA 1G8XA 3SDBA 1EVTA 2VXTI 3BAOA 2GZBA 1DP3A 1G82A 4G9MA 1X19A 4ZTFA 2J3PA 2HWAA 4DBRA 3AKFA 4IHZA 2K8RA 4LO1A 2I1BA 4BJ5C 5E24E 4CCOA 3CRHA 1IT0A 5FZUA 3NJ5A 4LG3A 5KHDA 4RM3A 3N7LA 3PG0A 1PUUB 1ISXA 4ZFYB 3UD8A 3OGGA 2VUAA 3E1SA 2XF6A 4J2SA 3MPPG 31BIA 1FV2A 3OOUA 1S9HA 5D61A 5EHAA 3K10A 3DQVC 4JRAA 3S3NA 2WY7Q 2ZQNA 4XNFA 2M49A 1LVKA 1LFPA 2V7FA 4I7IA 1MW7A 5LFAA 5BXSA 1G9DA 2VB6A 1ISYA 2DJIA 2AQFA 5F8YA 2R7SA 2R7UA 2W1OA 4P0KA 3N7MA 5BQUC 1JTCA 4B43A 1D1AA 2V6EA 3Q7YA 1K6YA 1PZZA 2MLLB 3AKZA 1FWUA 1R8OA 2WB1A 3DPLC 2M0MA 2P23A 4G1RA 1MMNA 2UUZA 3CA6A 1D0ZA 2E60A 1DIWA 3CA3A 2W82A 1NG6A 4XMYA 4AN7B 2R4GA 3OYHA 3OWTA 1W3FA 3HPHA 4LIUA 3GBGA 1IRAX 1QQKA 3CA0A 4P0JA 1JT5A 4GOVA 3FBNB 4PK4A 2IWTB 5FNWA 2KPMA 1MMGA 1HKNA 3NBEA 4A7ZA 3FJFA 1MC9A 2CFOA 1DQGA 3C2HA 2X6XA 2HWMA 1Z3XA 3BAVA 3VYSB 3EPZA 4LO2C 2W00A 2BEBA 2KH2A 2Z2SB 1WJEA 2LOOA 1QHHD 3L2RA 3A23A 1Q04A 2E1MB 3OR1C 1RG8A 3P6JA 3ZRGA 4F52A 2K3PA 3PUBA 4CUGA 5FNXA 1S0BA 1X4OA 4F55A 2L2OA 3UD7A 5HVQC 3V79C 2X6WA 5EG6C 3HKZA 2AQEA 2JA2A 2KRCA 4E7JA 2VL8A 1N75A 1I1BA 2IS4A 2VJ5A 4I4OA 1K5UA 3RSJA 1DFQA 2CV1A 3IIRA 4MZHA 2KZVA 1GLNA 3HG9A 1AFCA 4XOTA 1BFCA 4CH7A 3UR3C 2BVLA 4XM3A 4ZJZA 1S0EA 3F62B 3OYIA 4ZKTB 3AL0B 2E4MC 2X2SA 4GP0A 3T8SA 2XSJC 5CKTA 4BE2A 4QBVA 2Y9FA 3OS2A 3UJ4A 4HNUA 2V4JC 3FJ8A 4PC4A 3S8KA 2KMUA 3F9KA 1BR1A 2CV0A 3FUQA 1OR7C 2DRYA 4C30A 4Y33A 1WFXA 3NBNA 4ZTJA 3NWSA 2Z16A 2VJIA 1FN0A 1DQUA 1ABRB 2PJRB 1I1EA 2LBFB 3OYNA 5FRNA 3HOMA 3E0JB 2CW8A 2MFZA 5BXTA 3HUGB 3H5AA 3LMMA 3BRDA 2R9KB 4IQJA 1EYLA 1BARA 2MC4A 3BC8A 2NM1A 2RQ9A 3OYGA 1EA3A 1TZLA 4D0ZA 3Q7XA 1TTUA 2V1NA 1X4PA 1W3AA 1DQOA 1MD6A 3ILAA 4CA0A 2M7AA 3WO4A 3I29B 4OWLA 2Q9XA 3TC2A 3A21A 3H6RA 1W36C 1ISZA 1RMLA 4BE0A 2NTDA 2QN4A 3DLAA 1LKXA 4EKXB 3A22A 1SFKA 4RM2A 4ZDLA 2WY8Q 4XOPA 3CJQB 4RLQA 1AVWB 2K4AB 3FJIA 3BA4A 1SAUA 4BQQA 3HALA 1RY7A 1BFGA 1WBCA 4Y4RA 4CCKA 3MD2A 4YRVA 5F8WA 2A5WA 4QC4A 5FROA 1BFBA 2L9SA 1YTOA 5HNHA 4I3NA 2JUGA 3RMYA 1JY0A 4LO1C 4OW4A 3RPUD 2FFUA 1ITBA 3OS0A 3AH4A 2D1ZA 4LO3A 2KLLA 3I3LA 4PJMA 2LIQA 2ZXIA 3LLPA 3HMYA 1SZ6B 4OEGA 1HWMB 1Z2VA 5HNFA 1JT4A 2X2TA 1HCEA 2KL4A 4XQFA 2XAUA 3ZR8X 4ITVA 3LFUA 4HEA2 3H5NA 1BOBA 4XR6A 2VJJA 5KCMA 2Y9WC 4IZEA 4KEJA 3N7KA 3PNVA 2Z48A 4XKBA 3NWTA 4AN6A 1S0LA 3UDAA 4BUPA 2AAIB 3D5RC 1N78A 4NNJA 2ZQOA 4HJJA 4OAYA 4D1QA 1L2HA 1S0CA 4ZGRB 2D44A 3AZVA 3BRFA 3K4JA 2L9NA 1MNDA 4GP3A 3K4CA 2RQQA 4R6UB 3IM7A 2JSPA 1W36D 4KC3A 2HW9A 3IAM2 1CVSA 3BCBA 2JVGA 4PJJA 1V6XA 4LO8B 1WJAA 2D7IA 3BAUA 4BQOA 1EPWA 3Q7WA 4I1BA 5BXRA 3H6SE 3OYAA 4X38A 2KQRA 1JLXA 4LO0A 4E7SA 4I4SA 1QXMA 3DU5A 2LIEA 1HWPB 2E5NA 3E8LC 2OUMA 4XL9A 4CCNA 1PC8B 3AZWA 4XFTA 1WJBA 2WADA 2FGFA 5BP5A 4IONA 4ISRA 4XFSA 4ZDOA 4BQNA 4R79A 2Q3NB 1ZELA 2NVHA 1E0OA 4BL0B 3BLYA 3ZX7A 2RREA 3KYLA 4Z9WB 1HWNB 3FJBA 2F5VA 4I4UA 3ZXDA 1AVXB 2WAEA 3WO3A 4YELA 4H9WA 4MZGB 4PFOA 4BGDA 4PSXA 3VSKA 1WJCA 4ZFUB 2W4SA 3CMMA 1FMVA 4XLAA 2LBFA 2VXZA 3A4CA 4IKFA 3DKYA 2HZDA 3R4SA 3OY9A 1ISVA 5CQEA 1YBIA 2HPIA 1NZKA 4KITB 2Z49A 2BOLA 1YX5A 4KT6A 4JPZA 3BA5A 2KHMA 1PWAA 5F8SA 2HVSA 1V6UA 4L4HA 4II2A 2DRZA 1Z3YA 4GOYA 4F83A 2R7RA 2IGKA 3OS1A 1QU3A 2DOAA 2K43A 3K70C 4OAZA 2ERMA 2NZ9A 4CJMA 1SR4A 2LY2A 4P6AA 3HBWA 3CRIA 4IZZA 3L2WA 1S0FA 1Q1UA 2Y0SA 3WINA 3O4OA 3CA5A 2VQHA 1BA7A 3H35A 2RSTA 3PL8A 2ZSIB 2KI4A 1IRPA 1TWMA 2LG4A 3D5LA 4E7ZA 3ZC9A 2K9LA 3H9JA 2AXMA 4I4PA 1QHGA 3K4KA 1D0XA 2HVRA 1D1CA 4PFPA 5BOWA 2WAFA 3VWBA 3OMYA 1TP0A 3AKHA 4D8HA 1N77A 2F2FA 4HNTA 4TLPA 2D7RA 4B47A 3JRRA 4OEEA 4ZA3B 5JHFA 1W3GA 2F4IA 3K4LA 1II4A 3L2UA 3AH2A 4EEEB 1R6RA 4XLCA 3AKIA 1BR4A 2KLOA 2F6CA 1AVUA 5DSSB 3IM6A 4NC7A 4N4OB 2X6YA 4JAWA 2Q2EB 3C2GA 5TGTA 1WD3A 3H6QA 1MMDA 4PJNA 3FDYA 3VT2A 3CJRB 4NUBA 3SYTA 4IY9A 3SEZA 4QKSA 4JP0A 2VQCA 3IAGC 3L2QA 4KBBA 3QOEA 2BW3B 1IILA 3OL3A 1T9FA 2DREA 4MLOA 1Z4SA 2UUSA 3OYJA 4ISQA 1WJFA 2IS2A 4LO3C 1FMWA 4CCJA 3PNYA 4XFUA 1KONA 4I2SA 1D0HA 1DLLA 5B2HA 3CA1A 2HPMA 2QYIB 5JMCA 5CPRB 4I0YA 8I1BA 4Y3OA 2MD0A 2OV7A 4HSRA 2DXIA 3O4DA 1NUNA 3I2AA 3EUHC 3AFHA 3MKZA 2ZFUA 2E5ZA 3FBIB 4AYBA 2D20A 4LITA 3V0BA 3O3QA 5HLTA 3CA4A 3DEEA 2HU9A 4XLHA 4KEIA 3M8JA 3PSIA 4BDYA 3L2VA 4QD2B 2WRYA 3D5SC 3DPUA 4FVVA 2E1MC 3RSNA 1F31A 1P9QC 3FJJA 2M7BA 4X37A 4DGWB 1Q03A 3U21A 2KKIA 3BX1C 3CF2A 1D1BA 3OYCA 4A7YA 3QYBA 5GAQA 4BACA 4I4RA 4LO0C 2LRDA 2VKDA 4EFPA 2IGNA 4ZC3A 3PHZA 5HPZA 4LO2A 1S0DA 3K4NA 4HA2A 1X1BA 1YXWA 5CQGA 2FFVA 5D62A 2JVHA 21BIA 3D7WB 5BP5C 4ZLBB 3FJ9A 3RTIB 1BFFA 4L4IA 2HDWA 2VSEA 1WJ5A 4KJZA 3BA7A 1XZZA 1G9AA 3K1XA 3RQ4A 4CCLA 3QYDA 2L5QA 3I2XA 4I4XA 3EF2A 3N0KA 3TBIA 1HIBA 3J7AY 1TFMB 4DBQA 3PSFA 9ILBA 3V0AB 4AVZA 5DZUA 1XG6A 4HG2A 1XHBA 4EFQA 3VUOA 1TIEA 1J09A 2XOAA 3FKJA 2ESUA 2DS0A 5I1BA 4I6IA 1MMAA 3KEYA 2E4MA 2ELJA 4QBCA 1YF8B 4I37A 4D9JA 5KNLA 4J2YA 3CZ6A 2HNHA 3N7JA 3FJKA 4MZFB 5EC5A 4C2TA 3C9ZA 2VJ4A 4JQFA 2KRHA 4G9NA 4JOMA 2XF7A 1UAAA 2CUJA 2V9KA 1NG7A 3IP4B 1ILR1 1FGAA 3VEQA 1EV2A 4IQ4A 3G2BA 4G6MA 3NBDA 3LTQA 3OR2C 1RZOB 3CQAA 4XKWA 4X0GA 5LD2C 1SR4C 4QO3A 4E7IA 1Z0HA 2ZSHB 2X1CA 1IHKA 3CU1B 4ZFWB 4B44A 1VCLA 2LREA 4B3XA 3CP2A 4UY4A 2P39A 4P1WA 3A2KA 2HVQA 4C9YA 4ZDPA 2CS3A 3VSZA 2Z1DA 2D43A 4E7LA 1A8DA 4I4VA 5HOOA 1MNEA 3TMOA 41BIA 3CP8A 2VLAA 4GAFA 1KNMA 2NS2A 3CESA 2VASA 3HPGA 3O4CA 3TL4X 2FUG2 3HL2A 2BW3A 4D0TA 3VYRB 3HC7A 4OWJA 1DJSB 2VXDA 1T4QA 3EUAA 4II0A 4FETA 3PMEA 2AQZA 2HZ9A 1TOOA 2GOMA 2GOXB 3I9V2 2MYSA 4BJTA 1Y56A 3OGFA 4B48A 3VYTB 4BJ6C 2XDVA 4BXFA 3LL7A 3FJEA 3CRGA 3LSIA 3F1RA 4USOA 1IJTA 3KX2A 1V6VA 4LO7C 1T95A 4DENA 3RTJB 2PJRA 3H6RB 4E7KA 2X1EA 3ZCOA 3H9QA 3DTEA 2DT7B 1ERDA 2BVMA 4F92B 4DIQA 1TT0A 2BEAA 2PMZA 3BADA 1WD4A 3LSMA 6I1BA 3OYLA 1DGRM 4CZCA 3DPTA 2IGMA 3WA1A 4I96A 2VKHA 1AA7A 1X1CA 4NC8A 3BG6A 3DTKA 4BU2A 1Z7LA 1JI8A 1UELB 3DWLE 2R7WA 4E7HA 5JLVA 1G9BA 5FRMA 3OL4A 1DZDA 3OJMA 4IX7A 3V42A 1N4KA 1GGPB 3VT0A 1Y6IA 1G59A 2MIBA 4I4QA 4P0LA 3FGMA 3N05A 3ONQA 3OYEA 2QKMB 1JLYA 4EFRA 4J00A 1AXMA 3H5RA 4QPQA 3BAHA 3QODA 3KMVA 4U87A 4WBCA 4OWRB 1BASA 3ZGKA 3B9UA 2VU9A 3AJ6A 2LYCA 2O5RA 1K5VA 2M4GA 2K9MA 2X1DA 3HOTA 3MALA 3O49A 4QKRA 4J01A 2RNGA 2FDBM 4A7KA 3S8JA 4J23B 1YX3A 3AKGA 3HN1A 1HCDA 1DFCA 4USPA 2D24A 4CSWA 3UJ0A 1BR2A 1XYFA 3P53A 3W2VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HWM B;  1Z2V A;  3BAO A;  2VXT I;  2GZB A;  1G82 A;  1JT4 A;  2X2T A;  4G9M A;  1HCE A;  2J3P A;  2HWA A;  3AKF A;  4IHZ A;  2K8R A;  4LO1 A;  1HWO B;  2I1B A;  2D20 A;  2ET2 A;  1G9C A;  4IYB A;  5DVH A;  3V0B A;  5E24 E;  3CRH A;  3O3Q A;  3CA4 A;  3HSM A;  3FFZ A;  3V0A A;  4KEI A;  2Y9G A;  3ZXG A;  4DEP A;  1IT0 A;  3WMV A;  2Y9W C;  4QD2 B;  3NJ5 A;  5FZU A;  3BTA A;  2WRY A;  4IZE A;  3VSF A;  4KEJ A;  3N7K A;  4H04 A;  2Z48 A;  3N7L A;  4FVV A;  4AN6 A;  1S0L A;  1F31 A;  3UDA A;  1FMM S;  3FJJ A;  3PG0 A;  4X37 A;  2AAI B;  1Q03 A;  1PUU B;  3O5W B;  2KKI A;  1ISX A;  3BX1 C;  4ZFY B;  3UD8 A;  3OGG A;  2VUA A;  4A7Y A;  5GAQ A;  4J2S A;  2ZQO A;  4HJJ A;  4I4R A;  3MPP G;  31BI A;  4LO0 C;  1L2H A;  1FV2 A;  1S0C A;  4ZGR B;  3RMX A;  2D44 A;  3AZV A;  5D61 A;  3BRF A;  5EHA A;  4EFP A;  1JT7 A;  4GP3 A;  3PHZ A;  4JRA A;  5HPZ A;  2L5X A;  4R6U B;  5G00 A;  3BAG A;  3IM7 A;  4LO2 A;  1S0D A;  2ZQN A;  1JQZ A;  4HA2 A;  1YXW A;  2FFV A;  4KC3 A;  5D62 A;  21BI A;  2M49 A;  5DUY A;  2HW9 A;  3D7W B;  1CVS A;  4FGF A;  5BP5 C;  4ZLB B;  3FJ9 A;  3NBC A;  1V6X A;  1BFF A;  4I7I A;  2D7I A;  4J2K A;  4LO8 B;  3BAU A;  1EPW A;  3RTI B;  4L4I A;  5BXS A;  1G9D A;  3Q7W A;  4I1B A;  4OWK A;  3H6S E;  4XKI A;  5BXR A;  1TWE A;  4X38 A;  4Q9G A;  1ISY A;  1JLX A;  4LO0 A;  3VWC A;  4I4S A;  2AFG A;  2VSE A;  1QXM A;  3O44 A;  5F8Y A;  3BA7 A;  2LIE A;  3A07 A;  1HWP B;  4OUJ A;  3E8L C;  4P0K A;  3N7M A;  5BQU C;  1XZZ A;  1AVA C;  1G9A A;  2D23 A;  1JTC A;  3K1X A;  1PC8 B;  3AZW A;  3Q7Y A;  1PZZ A;  3QYD A;  2MLL B;  4XFT A;  1FWU A;  3I2X A;  1R8O A;  3WMU A;  4I4X A;  2FGF A;  3EF2 A;  5BP5 A;  3N0K A;  2P23 A;  4ION A;  4ISR A;  4G1R A;  1HIB A;  4XFS A;  1CE7 B;  1TFM B;  2Q3N B;  2NVH A;  1E0O A;  3CA6 A;  1DIW A;  3CA3 A;  4J2X A;  9ILB A;  3V0A B;  3IM5 A;  5DZU A;  3ZX7 A;  1M2T B;  5BQU A;  4AN7 B;  5FZZ A;  4Z9W B;  1XG6 A;  1HWN B;  1XHB A;  4EFQ A;  1W3F A;  3FJB A;  3VUO A;  1TIE A;  4I8M A;  4I4U A;  2WBC A;  2XOA A;  1IRA X;  3O4B A;  4KEK A;  4X39 A;  1QQK A;  2ESU A;  2Y9X E;  2DS0 A;  5I1B A;  3CA0 A;  3ZXD A;  4I6I A;  4P0J A;  1JT5 A;  1AVX B;  2BFH A;  4GOV A;  3BAQ A;  2E4M A;  4QBC A;  3WO3 A;  1R8N A;  2IWT B;  1YF8 B;  5FNW A;  4H9W A;  4I37 A;  4J2Y A;  1HKN A;  3NBE A;  4A7Z A;  3N7J A;  3OBT A;  3FJK A;  3FJF A;  1MC9 A;  5EC5 A;  3C9Z A;  4ZFU B;  4JQ0 A;  1DQG A;  2HWM A;  3BAV A;  4G9N A;  4LO2 C;  2BEB A;  2KH2 A;  1PUM B;  4X3A A;  3A23 A;  1FWV A;  1Q04 A;  5BVP I;  1RG8 A;  1ILR 1;  1FGA A;  3JUT A;  3P6J A;  3VEQ A;  1EV2 A;  4F34 A;  3PUB A;  4G6M A;  3UD9 A;  3NBD A;  4DCK C;  3R4S A;  1ISV A;  3LTQ A;  5FNX A;  1S0B A;  1YBI A;  1RZO B;  3CQA A;  1NZK A;  4Q91 A;  3UD7 A;  3V79 C;  2NP0 A;  2Z49 A;  1SR4 C;  5EG6 C;  4QO3 A;  1Z0H A;  2D22 A;  4JPZ A;  4END A;  3BA5 A;  1ISW A;  1IHK A;  3CU1 B;  1PWA A;  4ZFW B;  5F8S A;  1VCL A;  1BLA A;  1V6U A;  4L4H A;  1I1B A;  2DRZ A;  4GOY A;  3P6I A;  4F83 A;  1DZC A;  4I4O A;  1K5U A;  3RSJ A;  2P39 A;  1DFQ A;  2K43 A;  3W9T A;  3AH1 A;  1QQL A;  4I4Y A;  3IIR A;  1FV3 A;  2ERM A;  5D63 A;  1JT3 A;  2NZ9 A;  1AFC A;  4CJM A;  1BFC A;  1SR4 A;  2YUG A;  3VSZ A;  4P6A A;  5F90 A;  3HBW A;  3CRI A;  2D43 A;  1A8D A;  1S0E A;  4I4V A;  3F62 B;  4YOL A;  4ZKT B;  1S0F A;  2E4M C;  1Q1U A;  3ZC8 A;  41BI A;  2X2S A;  4GAF A;  4GP0 A;  1KNM A;  3T8S A;  3WIN A;  3O4O A;  3CA5 A;  1BA7 A;  4QBV A;  4JKX B;  3O4C A;  2RST A;  2Y9F A;  4IY8 A;  4D0T A;  4ZOT A;  2VLC A;  2KI4 A;  4OWJ A;  3UJ4 A;  1IRP A;  1TWM A;  1DJS B;  1T4Q A;  3ZC9 A;  3FJ8 A;  4II0 A;  3PME A;  2AQZ A;  4PC4 A;  3S8K A;  2HZ9 A;  4OEF A;  1TOO A;  2AXM A;  3FJA A;  3FUQ A;  4I4P A;  4JKQ A;  2DRY A;  3OGF A;  3NBN A;  5BOW A;  1FN0 A;  3FJE A;  1ABR B;  1I1E A;  1BLD A;  1YYN A;  2KI6 B;  1TP0 A;  3CRG A;  3AKH A;  3F1R A;  2GO2 A;  4USO A;  4D8H A;  3FJC A;  2F2F A;  3HOM A;  3AJ5 A;  3OBR A;  2MC2 A;  5BXP A;  4TLP A;  1IJT A;  2D7R A;  1V6V A;  3JRR A;  4LO7 C;  4I1E A;  5BXT A;  3VT1 A;  4OEE A;  4ZA3 B;  3BRD A;  3OJV A;  2R9K B;  4QAL A;  1V6W A;  1ONK B;  4DEN A;  1W3G A;  4QD2 C;  4LO7 B;  1EYL A;  4G6J A;  1BAR A;  3RTJ B;  3H6R B;  2NM1 A;  4IZX A;  2RQ9 A;  4D0Z A;  1II4 A;  3Q7X A;  1TTU A;  3AH2 A;  4EEE B;  1W3A A;  1DQO A;  1MD6 A;  2BEA A;  2RG9 B;  3ILA A;  3WO2 A;  3BAD A;  1WD4 A;  3QR5 A;  3WO4 A;  6I1B A;  3AKI A;  3CAH A;  1M16 A;  1AVU A;  3BB2 A;  5DSS B;  1WBA A;  3IM6 A;  3I29 B;  4OWL A;  2Q9X A;  4JAW A;  3TC2 A;  3A21 A;  3H6R A;  1ISZ A;  3WA1 A;  3O4A A;  1WD3 A;  1RML A;  3H6Q A;  2NTD A;  4I96 A;  2QN4 A;  3VT2 A;  1J0S A;  4ZBV B;  1AF9 A;  3FJH A;  7I1B A;  4IY9 A;  4Z8S B;  4EKX B;  3WIN C;  4QKS A;  3A22 A;  4JP0 A;  5JLV A;  1G9B A;  3IAG C;  1DZD A;  4EB2 B;  3OJM A;  5FZY A;  1N4K A;  1GGP B;  1AVW B;  3VT0 A;  4KBB A;  2K4A B;  3FJI A;  3BA4 A;  1IIL A;  2MIB A;  4I4Q A;  4P0L A;  1T9F A;  3HAL A;  1RY7 A;  1BFG A;  1WBC A;  1P63 A;  2DRE A;  3FJD A;  3FGM A;  2VXR A;  1Z4S A;  2UUS A;  1JLY A;  4ISQ A;  2NYY A;  5F8W A;  4EFR A;  1AXM A;  4LO3 C;  2FO1 A;  4QC4 A;  4XFU A;  3BAH A;  3BRG C;  1BFB A;  3KMV A;  3OJ2 A;  4I2S A;  1D0H A;  1DLL A;  5B2H A;  3CA1 A;  1YTO A;  3FUO A;  4WBC A;  4I3N A;  1BAS A;  4HR6 C;  2F2F C;  3B9U A;  4IQP A;  2VU9 A;  2VSA A;  2ZR1 B;  3AJ6 A;  2QYI B;  3RMY A;  5JMC A;  1K5V A;  1JY0 A;  4I0Y A;  8I1B A;  1UPS A;  4LO1 C;  3MAL A;  3O49 A;  4OW4 A;  1S0G A;  2FFU A;  1ITB A;  3SNV A;  4QKR A;  3AH4 A;  2FDB M;  2IHO A;  3R4U A;  3S8J A;  2D1Z A;  4A7K A;  1FMZ A;  4J23 B;  4LO3 A;  3AKG A;  3O4D A;  1IOB A;  4Q9P A;  2KLL A;  3HN1 A;  3POK A;  3V0B B;  1HCD A;  2LIQ A;  1DFC A;  1FQ9 A;  1OQL B;  1NUN A;  3I2A A;  4USP A;  2F8X C;  2D24 A;  3LLP A;  3HMY A;  4GAI A;  1SZ6 B;  3UJ0 A;  1XYF A;  4OEG A;  3P53 A;  1EVT A; 
#chains in the Genus database with same CATH topology
 2IS6 A;  3FMR A;  2K9S A;  3T0Y A;  3WOD F;  2QUF A;  1DU0 A;  2QBY B;  3V7C A;  3QU6 A;  4A0Z A;  1JHH A;  4KNY A;  4Y15 A;  1YJW I;  4ESJ A;  1HWO B;  3GME A;  3HRM A;  4N4N B;  2ET2 A;  3NAU A;  4IYB A;  1G9C A;  2M9H A;  5DVH A;  1BJA A;  5L3D A;  1RES A;  5DYM A;  1E2X A;  3TP0 A;  4UV8 A;  3IHU A;  3LST A;  2EFO A;  3HSM A;  2R7Q A;  3S2H J;  3FFZ A;  3V0A A;  1YE9 A;  2Y0M A;  2Y9G A;  2R7O A;  1QNT A;  3ZXG A;  4MNU A;  4DEP A;  1HST A;  1B72 A;  3WMV A;  3GTM J;  4ANJ A;  3L9F A;  3DKX A;  3MZ8 A;  4U88 A;  4R1H A;  3BTA A;  4IO9 F;  3VSF A;  4MGR A;  5HOD A;  1R1U A;  1LE8 B;  4JBA A;  4BS9 A;  4H04 A;  1FOX A;  2YX7 A;  3CO6 C;  5M3F J;  4RB1 A;  4XKV A;  2DU9 A;  1VQ7 I;  1V5E A;  1TLH B;  2RC4 A;  3W2W A;  3ASO H;  3BR5 A;  1FMM S;  2HTJ A;  3ZN0 A;  1I6X A;  2ID6 A;  1TQP A;  3K6G A;  5H6Q A;  4ZYA A;  1YOV B;  3WHB A;  3DU6 A;  2X6O A;  2I8D A;  2V9V A;  2XC7 A;  3O5W B;  1R5G A;  2VQL A;  3LQR A;  2ZCW A;  3I56 I;  3JRA A;  1BC8 C;  3ZPL A;  1PYV A;  3GWZ A;  3L09 A;  2V1U A;  2X48 A;  3EUK L;  1S8N A;  1YI2 I;  2IS1 A;  1I3Q J;  2CH0 A;  2IBD A;  3TOA A;  3JRB A;  3IKT A;  3DTI A;  3MFK A;  4EAT A;  1D8J A;  2OC6 A;  3H9G A;  3I54 A;  1W5C C;  2M4K A;  4XN3 A;  2VC1 A;  3LSH A;  4XLN F;  4RGX A;  4BEH B;  3I0T A;  4GRI A;  3VOE A;  3RMX A;  3S17 J;  3C2B A;  1A04 A;  5HS8 A;  2F4O B;  1PUF A;  4CIC A;  1JT7 A;  1MNM C;  3HRS A;  4OIR F;  5J47 A;  2WBM A;  2HOT A;  4PSW A;  2L5X A;  1QZZ A;  2DAO A;  4I99 C;  5G00 A;  1V5F A;  3BAG A;  3G6E I;  1T33 A;  1JQZ A;  5J40 A;  5DTD A;  2XRN A;  5H2F C;  4EM1 A;  4CZZ A;  3W3C A;  3R4K A;  3GO5 A;  1I1G A;  1E3H A;  5DUY A;  2L7F P;  4AID A;  4FGF A;  5BS6 A;  2Z3Y A;  3E6C C;  5BPI A;  3CC2 I;  4QPO A;  1W4M A;  1R4M B;  4ZZD A;  3Q5F A;  3Q3S A;  4F91 B;  4XLP F;  1BA5 A;  2M3A A;  2CUZ A;  4ZYG A;  3NBC A;  4J2K A;  2ID3 A;  2LVS A;  3EQL F;  4UXN A;  3HOY J;  1OIS A;  4XON A;  4O6J A;  4OWK A;  4XKI A;  1T38 A;  2NOJ B;  2X9D A;  4P5O A;  1TWE A;  3S3M A;  1G3Y A;  4Q9G A;  1XS9 A;  3ABL H;  1FNN A;  4DOZ A;  3VWC A;  2AFG A;  2DA3 A;  1UHS A;  3O44 A;  2LKS A;  3S3O A;  3F8B A;  1E3O C;  3A07 A;  4OUJ A;  1KQ0 A;  3T8R A;  3IUO A;  5F08 A;  4KA4 A;  1AVA C;  1FSE A;  2D23 A;  2RV8 A;  4F93 B;  3K70 D;  1FYK A;  3HXL A;  5IYB J;  1XB4 A;  2BY1 A;  4I02 A;  3PFY A;  5GAE J;  3BTJ A;  2RNJ A;  1YFH A;  2JA7 J;  3SEQ A;  1J59 A;  3WMU A;  2XPW A;  3HTU A;  1VQO I;  4L9T A;  3VYU B;  1XMA A;  5J1Y A;  2ME0 A;  4EJV A;  2YPR A;  2M2E A;  2P6T A;  1LDK B;  3HOS A;  4N9I A;  4HX8 A;  2K40 A;  1RIO H;  1AKH B;  2A6E F;  2K02 A;  1I5Z A;  4XOR A;  2QKL B;  2BXZ A;  1CE7 B;  2VQG A;  3WE2 A;  2V79 A;  2XF5 A;  5ILS A;  4ENJ A;  1O7F A;  4J2X A;  4XBF A;  3VFZ A;  1IRF A;  3H3U A;  2WAQ A;  3IM5 A;  2UV1 A;  1UG0 A;  3QPS A;  1M2T B;  4M9S A;  5BQU A;  3OYF A;  4O3M A;  2PG4 A;  5FZZ A;  3K4M A;  3S93 A;  3RCO A;  4BY1 J;  2NXN B;  4I8M A;  4XLF A;  3F72 A;  4EGY A;  1P4X A;  2WBC A;  1MSE C;  2KKO A;  4CCM A;  4EJU A;  3O4B A;  4KEK A;  4X39 A;  2IXS A;  1X1A A;  2EIL H;  1IN8 A;  2K27 A;  3H0D A;  2Y9X E;  1QPM A;  2DOF A;  2BFH A;  3BAQ A;  3ZQQ A;  5EYR A;  1R8N A;  3I4M J;  2L02 A;  2OQG A;  1B59 A;  2K4J A;  4RMN A;  4NQW B;  3FIW A;  3OYB A;  3U2R A;  1X2N A;  2PMH A;  1B1B A;  4BDZ A;  2FF4 A;  2MAB A;  4MEX F;  3OBT A;  1V5G A;  3FIS A;  2A6T A;  2CQX A;  2H94 A;  2V26 A;  3RTR A;  2RGV A;  1UFM A;  4W97 A;  4HST A;  1MH3 A;  2R7V A;  2ETH A;  2M0C A;  2CV2 A;  5B66 C;  3WGI A;  4JQ0 A;  2CUE A;  3S8P A;  2QQA A;  1NTC A;  3TKY A;  4LFU A;  3S32 A;  2DN0 A;  1G4D A;  4PGG A;  1MJA A;  1PUM B;  3I71 A;  3OIP A;  3AAF A;  4CYC B;  1I27 A;  4X3A A;  2D1H A;  3KYD B;  6PAX A;  4KIB A;  2HGC A;  3F21 A;  3IKV A;  1FWV A;  1SFX A;  3J81 K;  2XHK A;  3ZMV A;  5BVP I;  2XV4 S;  5K7Z A;  4RLF A;  4HLY A;  5CVJ A;  2B9S A;  3JUT A;  4G6T B;  3V8L A;  2LC2 A;  1A31 A;  4F34 A;  1W0T A;  1XGM A;  1Z67 A;  3HOZ J;  3A1Y A;  3DKW A;  1RKT A;  3UD9 A;  4KFC A;  1GXQ A;  3RQI A;  1RI7 A;  2DOE A;  3CQZ J;  4DCK C;  2BZT A;  1DGW Y;  2FRH A;  4XN0 A;  5BOX A;  1YO5 C;  2FA5 A;  1UHM A;  3R60 A;  4Q91 A;  1IV8 A;  4OIO F;  3HYI A;  1FPQ A;  1K78 A;  2NP0 A;  2IJL A;  2NYX A;  3MWM A;  4E4H A;  5L3C A;  4QTR A;  1VQM I;  4HF1 A;  1HXD A;  3K1P A;  1IDZ A;  2X85 A;  5ERI A;  1K61 A;  1VZ0 A;  2D22 A;  1WJD A;  1X2M A;  4END A;  5J6X A;  2D45 A;  1ZYR F;  1ISW A;  1MGT A;  1Q1H A;  3B6A A;  2K5C A;  3VDX A;  1K79 A;  2FML A;  4LLG F;  1MDM B;  4M74 A;  1BLA A;  1IXC A;  5FGM A;  4U7B A;  1OCO H;  3I5U A;  3HRU A;  1LFB A;  1R1V A;  2LY1 A;  2LK2 A;  3E6M A;  4UUV A;  3KE2 A;  4KIG A;  3OSF A;  5D8K B;  1HKT A;  4ENK A;  2KP6 A;  3P6I A;  1R9T J;  1DZC A;  3K2Z A;  1SVO A;  3D1N I;  3GTP J;  1LPQ A;  1T0F C;  2EA4 A;  4C2U A;  2ZXJ A;  3OYM A;  1R58 A;  2PBI A;  2EIJ H;  1MBF A;  3DBL B;  2UZK A;  4Y13 A;  2DCE A;  5IOZ A;  1QQL A;  3AH1 A;  4I4Y A;  2M5W A;  3K0L A;  2PJP A;  1FV3 A;  1IRX A;  5BQT A;  2P4W A;  1D0Y A;  5E3L A;  2QZ8 A;  1IN5 A;  5D63 A;  3M7G A;  2WA0 A;  1JT3 A;  2ZBK A;  2OTJ I;  1PJR A;  1TNS A;  4HQM A;  4II3 A;  3AL0 C;  2YUG A;  2EFW A;  4WK8 F;  1VQ9 I;  4M9Z A;  4YEJ A;  5F90 A;  1J0R A;  5E18 F;  2E71 A;  1OLT A;  3FK6 A;  4XIC A;  2O8K A;  3UNG C;  5L3G A;  3N4M A;  3EET A;  4YOL A;  1ZK8 A;  3RZD J;  2OPT A;  3ZC8 A;  1YJ9 I;  3MMY B;  4UUS B;  2OTL I;  5GPA A;  5FKO A;  4HRI A;  1R71 A;  2JRT A;  5LHG A;  4JKX B;  3LSK A;  4PJL A;  2KIF A;  4IY8 A;  1HCR A;  1LFU P;  4ZOT A;  1FZP B;  2VLC A;  4LK1 F;  4KIS A;  2XGC A;  1CF7 B;  4ZZL A;  2VPL A;  2P8T A;  5DCF A;  2ELH A;  2KJC A;  4PUS A;  4LIV A;  3W2A A;  4F3Q A;  4JK1 X;  5DUK A;  4OEF A;  3QPL A;  3MCZ A;  5TIS C;  3CUQ B;  4XLE A;  4S0H B;  2CMP A;  2NVT J;  3FJA A;  4JKQ A;  3BZ6 A;  5DV5 A;  4EM2 A;  1W0U A;  4XSX F;  5IP9 J;  1ZKG A;  3MKY B;  5FO5 A;  3AG4 H;  3I59 B;  3B02 A;  2HWV A;  1FSH A;  3ASN H;  1QGP A;  3DEW A;  3M1C A;  3JTG A;  3HJE A;  2X4H A;  1BLD A;  2CGP A;  1YYN A;  4DJA A;  2KI6 B;  2W25 A;  1A6Q A;  2Q1Z B;  4A2U A;  2GO2 A;  3GZ6 A;  3R0J A;  3ZXS A;  4FAS D;  4DYC A;  3AJ5 A;  3FJC A;  3OBR A;  2Y75 A;  2MC2 A;  5BXP A;  3W6K B;  3GTL J;  3JAM Z;  3G4S I;  4C3I J;  3LSG A;  1RUN A;  1AU7 A;  4I1E A;  2VPR A;  1ZH5 A;  4A3K J;  4H75 A;  2JK3 A;  3VT1 A;  1JJ8 C;  1KU2 A;  2O7O A;  4V2G A;  3OJV A;  2P0W A;  3FX3 A;  1Z21 A;  3FXK A;  5GTI C;  5DS9 A;  2VT3 A;  5K5R A;  1NH3 A;  1V6W A;  4QAL A;  1X1P A;  3U1D A;  1ONK B;  3GCM A;  3KIO A;  1JT6 A;  3F22 A;  4QD2 C;  2KDO A;  3CCV I;  4LO7 B;  9ANT A;  2IPQ X;  3C18 A;  1H89 C;  2FNA A;  4G6J A;  3VSL A;  1YYV A;  2NNY A;  1X1D A;  5E3O A;  4IZX A;  2LH9 A;  2XB5 A;  4BE1 A;  1WVR A;  3AG1 H;  1FOY A;  2VIX A;  5EG0 B;  1PP8 F;  1JUS A;  3V8K A;  2AXT C;  2VBX A;  2RG9 B;  3WO2 A;  1MBJ A;  4CDG A;  2HI3 A;  3QR5 A;  3P5J A;  1JGS A;  4GGG A;  4YFX F;  1R1T A;  3WTX C;  2L3D A;  1M16 A;  3CAH A;  3BB2 A;  5AIQ A;  3OYD A;  1WBA A;  3MKW B;  3PJR A;  2VI6 A;  3PNT A;  3BCA A;  3M1E A;  2HQA A;  4HAM A;  4E6K G;  1BW6 A;  3VOD A;  2VT2 A;  3SZG A;  4YG2 F;  5K5O A;  3LSJ A;  2KFD A;  2QWW A;  1FC3 A;  1R22 A;  3CTA A;  3O4A A;  1U0J A;  2CJJ A;  1EV7 A;  3KP4 A;  2A6H F;  2IGO A;  3LSR A;  1HA8 A;  4OU0 A;  1J0S A;  4ZBV B;  2DT6 A;  1LE8 A;  1AF9 A;  4A3D J;  3B73 A;  4MO7 A;  5B3S H;  3FJH A;  3G71 I;  2WV0 A;  1VQN I;  3HKZ N;  7I1B A;  2ZNZ A;  3VB2 A;  2V1D A;  3K4B A;  1RZ4 A;  2R7T A;  1TWH J;  4Z8S B;  4HOB A;  1JKP C;  4HPQ A;  2QA4 I;  2EZL A;  4NC6 A;  5D5W B;  3WIN C;  1ZHF A;  1R00 A;  2FSW A;  3FHN A;  1DPR A;  1LDJ A;  3QP5 A;  4QWQ A;  1OCT C;  2Q2E A;  3QYF A;  1KQ9 A;  5DCM B;  2GXA A;  4EB2 B;  2FOK A;  4ZYH A;  3QYE A;  5FZY A;  5A2Q Z;  1KU7 A;  2CQK A;  1S29 A;  2L0K A;  2L7M P;  4FT8 A;  3R6S A;  2DI3 A;  5J1R A;  2W7N A;  2VOD A;  1EJ9 A;  2JTV A;  4AU7 A;  4BEH A;  3FMS A;  2R7X A;  3JRF A;  1P63 A;  2N8G A;  3FJD A;  2CYY A;  1LB2 A;  2VXR A;  5LGU A;  2XIG A;  3LA3 A;  3E97 A;  2NYY A;  2W48 A;  2VOP A;  2VE9 A;  2FO1 A;  2E1O A;  4XKC A;  2HDC A;  1WH5 A;  2ZXH A;  3BRG C;  3OJ2 A;  2BBY A;  4R8H A;  5GPC A;  3BG7 A;  1KZH A;  3FUO A;  5HDG A;  4BY7 J;  3K2A A;  2X51 A;  4HR6 C;  2F2F C;  2K85 A;  4H4K C;  4IQP A;  3IAS 2;  3IH4 A;  5FJ8 J;  2UWM A;  2VSA A;  2ZR1 B;  3OIQ A;  1QO0 D;  2ZJR F;  2JUC A;  2E2H J;  2DA5 A;  4EMS A;  1BM9 A;  2CW7 A;  2DT5 A;  1O3Q A;  1UPS A;  2F5F A;  3OIO A;  1S0G A;  2NVU B;  5ICC A;  2A68 F;  2CFX A;  3SNV A;  2WAQ N;  3OYK A;  2RVC A;  2IHO A;  3R4U A;  1OYY A;  5EEH A;  1YRN B;  1FMZ A;  3FKI J;  4Z2Y A;  4KT5 C;  2L7K A;  2BY2 A;  1IOB A;  4Q9P A;  4YFN F;  1G6N A;  1E0E A;  3POK A;  3V0B B;  3Q9V A;  3JRI A;  1FQ9 A;  1OQL B;  4ON0 A;  2F8X C;  3G73 A;  1F43 A;  4GAI A;  1G8X A;  3SDB A;  1A36 A;  2G0E A;  1EVT A;  3DP7 A;  1SC7 A;  1ORK A;  2VXT I;  2GZB A;  1DP3 A;  1G82 A;  3BAO A;  4G9M A;  1X19 A;  4ZTF A;  4FIS A;  5F0C A;  2J3P A;  2HWA A;  4DBR A;  3AKF A;  4IHZ A;  5DEQ A;  2K8R A;  4LO1 A;  2F4M B;  2I1B A;  4BJ5 C;  3PQJ A;  1P7J A;  1U8R A;  3ZMU A;  5FLX Z;  5E24 E;  1VND A;  4CCO A;  3G1M A;  3CRH A;  1JTY A;  3JSP A;  1IO2 A;  3TGN A;  1IAW A;  1FWZ A;  3VPR A;  3T8T A;  2NVQ J;  5ICE A;  1JKR C;  3BTI A;  1RUO A;  1IT0 A;  1Z1D A;  4B09 A;  1WZ2 A;  5FZU A;  3NJ5 A;  4ZYD A;  4GYG A;  2QSG X;  3GTO J;  1XG1 A;  4JYK A;  1XSX A;  1SD4 A;  4LG3 A;  1MMS A;  2HEO A;  2GAU A;  4KUM A;  5KHD A;  1TWC J;  2HYF A;  4RM3 A;  3N7L A;  4DYR A;  1SD6 A;  3ML6 A;  4AD9 A;  3GLX A;  1XN7 A;  3BY6 A;  2RN7 A;  3L2C A;  3BJ6 A;  3PG0 A;  1SVM A;  2CQQ A;  4HX4 A;  5FD5 A;  2H6B A;  4UVA A;  1YTY A;  4NQW A;  1PUU B;  2BY0 A;  4BKX A;  4HV6 A;  1ISX A;  4ZFY B;  3UD8 A;  3OGG A;  1BOA A;  3A0H C;  1P92 A;  2ME6 A;  2A07 F;  2VUA A;  3E1S A;  1W7P D;  4A3F J;  3O8G A;  3W6J B;  2A5Y B;  2XF6 A;  1REP C;  4J2S A;  4DQ2 A;  2FEZ A;  3MPP G;  1Y1V J;  31BI A;  5HDK A;  1FV2 A;  1OQY A;  3OOU A;  2JT1 A;  1S9H A;  2CWE A;  4I76 A;  1GXP A;  5D61 A;  2CU7 A;  2QM3 A;  2Y48 A;  5EHA A;  4Y7N J;  1ZGJ A;  2ZB9 A;  2Y2Z A;  3DQV C;  3K10 A;  4CYC A;  4JRA A;  4WXD A;  4KMU X;  3S3N A;  1HW1 A;  3BQY A;  1F9N A;  2WY7 Q;  4BQA A;  2IA0 A;  2ZQN A;  4GYI A;  2LTP A;  4MFE A;  4XNF A;  1MBH A;  2DA6 A;  2M49 A;  1MJ9 A;  2L54 A;  1LVK A;  1LFP A;  2V7F A;  2HTS A;  3M07 A;  2WC2 A;  2JSC A;  4EQQ A;  4I7I A;  1MW7 A;  5K7H A;  4F7Z A;  5LFA A;  5BXS A;  1G9D A;  2QQ8 A;  2VB6 A;  1IJW C;  2M87 A;  1JXS A;  1ISY A;  2DDA A;  2DJI A;  2AQF A;  3LFK A;  2H1L A;  3P9K A;  2DFH A;  5F8Y A;  3RKW A;  3BG3 A;  2R7S A;  4M3D A;  2OJE D;  5JVG F;  2R7U A;  2FE3 A;  2W1O A;  4U0W A;  2M30 A;  1AOY A;  3N7M A;  1HC8 A;  4P0K A;  5BQU C;  2ISY A;  3SZT A;  3KP3 A;  4B43 A;  2GBY A;  1JTC A;  1D1A A;  3O8H A;  2V6E A;  1MDM A;  3Q7Y A;  1K6Y A;  1PZZ A;  2MLL B;  3TED A;  5GTH C;  3KP6 A;  3AKZ A;  1FWU A;  1KGS A;  1R8O A;  2WB1 A;  5DM7 F;  3BJA A;  3DPL C;  2DMP A;  5BPD A;  2M0M A;  3AG3 H;  4EV0 A;  2P23 A;  2R7D A;  3PFI A;  1O4X A;  3HGG A;  1MKM A;  4G1R A;  3J7Z I;  2FBK A;  4V2F A;  5K5Q A;  1MMN A;  3H36 A;  4UUT A;  2JA6 J;  2UUZ A;  4FX0 A;  3QAH A;  3CA6 A;  1D0Z A;  2E60 A;  2QCO A;  2PN6 A;  2EJR A;  1DIW A;  3CA3 A;  3GYH X;  1GVJ A;  2W82 A;  1NG6 A;  4CHU A;  4XMY A;  3HRT A;  3DLL F;  1IN7 A;  4AN7 B;  2ELK A;  2R4G A;  3OYH A;  2MSY A;  3OWT A;  4KN7 X;  1W3F A;  5D5U B;  1YW8 A;  4MQ9 F;  3HPH A;  4LIU A;  4UUS A;  3GBG A;  1IRA X;  1QQK A;  5KAI C;  4IOA F;  1G2H A;  3CA0 A;  2L4M A;  4P0J A;  1JT5 A;  4GOV A;  3FBN B;  4PK4 A;  4CXF A;  1SVL A;  2IWT B;  5FNW A;  1P4W A;  1CF7 A;  2DLL A;  2W57 A;  2KPM A;  1MMG A;  3ZQ7 A;  2HFH A;  2JN6 A;  2AXL A;  1HKN A;  3NBE A;  2GA1 A;  4A7Z A;  1IDY A;  1YJN I;  3FJF A;  1MC9 A;  5E3N A;  1WHU A;  2V1X A;  1BW5 A;  2NS7 A;  1VQL I;  2CFO A;  2K3F A;  4GO1 A;  4IPA A;  1WCM J;  1DQG A;  1LDD A;  3C2H A;  4YIF A;  5B5E C;  2X6X A;  1BL0 A;  2HWM A;  1Z3X A;  2P5K A;  3BAV A;  1ETY A;  3I59 A;  3VYS B;  2V6C A;  3EPZ A;  2I10 A;  5H20 A;  5M3M J;  2ACJ A;  2TRT A;  2W00 A;  2LKX A;  2BEB A;  4LO2 C;  1IG7 A;  1U5T A;  2MH9 A;  2KH2 A;  5KAF C;  2XAH A;  2XPU A;  2K86 A;  1WJE A;  2Z2S B;  2LOO A;  3RJP A;  1QHH D;  1WGX A;  4C3J J;  1Z6R A;  3L2R A;  2PX9 A;  3CUO A;  3TO7 A;  4L18 B;  3A23 A;  1DP7 P;  3HM5 A;  1Q04 A;  4B8X A;  4MIM A;  2E1M B;  1GDT A;  3OR1 C;  1RG8 A;  4HA8 A;  5IP6 A;  1XMX A;  1TWA J;  3P6J A;  3WTS C;  3CDL A;  1XD7 A;  3ZRG A;  4F52 A;  2ZFW A;  2K3P A;  3PUB A;  2IVM A;  2PI0 A;  3M8F A;  2EV5 A;  2OBP A;  2XVC A;  4CUG A;  2R93 J;  3CCE I;  2H27 A;  4IHX A;  4PJ0 C;  5FNX A;  1S0B A;  1X4O A;  4F55 A;  2L2O A;  3UD7 A;  5HVQ C;  3V79 C;  3ZMD A;  2IA1 A;  4KYW A;  2X6W A;  5EG6 C;  4DW6 A;  4LB6 B;  1NHA A;  3HKZ A;  2EBI A;  2P81 A;  5EG0 A;  2AQE A;  3I58 A;  2JA2 A;  3ISP A;  4G12 A;  1U8B A;  2KRC A;  2FXA A;  5J4V A;  4E7J A;  4HX7 A;  3F23 A;  2VL8 A;  3CJN A;  2P5V A;  2BHZ A;  1KQ8 A;  1N75 A;  2QYO A;  2UXN A;  1I1B A;  2JPB A;  3E5Q A;  2XAF A;  1JKO C;  2VJ5 A;  2IS4 A;  1SMT A;  4I4O A;  1K5U A;  1IV6 A;  3RSJ A;  1VQP I;  4U7D A;  4HNV A;  1IZ1 A;  4HDU A;  1DFQ A;  1GV2 A;  2CV1 A;  5FLM J;  3J7A O;  4QIW N;  1VF9 A;  1YG2 A;  3JW4 A;  3IIR A;  1E3P A;  3JR9 A;  1EH7 A;  2OCE A;  2KZV A;  4MZH A;  1GLN A;  3ZQG A;  2KIQ A;  3HG9 A;  1UMQ A;  1AFC A;  4XOT A;  5L3E A;  1VQ5 I;  1BFC A;  2R7F A;  2Q0O A;  2A69 F;  3UR3 C;  4CH7 A;  2F5D A;  3GW2 A;  2BVL A;  3FXM A;  2OD5 A;  2FBH A;  1XPX A;  4XM3 A;  4ZJZ A;  1S0E A;  2G7H A;  3S2W A;  1ZQ3 P;  3LWF A;  4IEJ A;  2UXX A;  3OYI A;  1TQI A;  3F62 B;  4LD5 A;  4ZKT B;  4A3I J;  1LJ9 A;  2F5E A;  5DCM A;  4DNC A;  3LSP A;  3CO7 C;  2ZME B;  3COA C;  1BC7 C;  3AL0 B;  2E4M C;  2X2S A;  1AWC A;  4LGW A;  4GP0 A;  2XSJ C;  2MH2 A;  5CKT A;  4BE2 A;  3T8S A;  3GLL A;  1J7K A;  1S7A A;  4QBV A;  2HR3 A;  1FT9 A;  2Y9F A;  1EH6 A;  1Y39 A;  3S1N J;  4QLC U;  3OS2 A;  1UHW A;  3UJ4 A;  1HKS A;  4HNU A;  2R3S A;  1PP7 U;  2V4J C;  3FJ8 A;  1J2X A;  4PC4 A;  3S8K A;  2KMU A;  4MFD A;  3F9K A;  1BR1 A;  3GFI A;  3W6V A;  2CV0 A;  3FUQ A;  2Y31 A;  1OR7 C;  2DRY A;  4A69 C;  4C30 A;  3B6C A;  4Y33 A;  1WFX A;  3ZMZ A;  3NBN A;  5J3L A;  4ZTJ A;  3ABU A;  3NWS A;  4U0V A;  4OIP F;  2Z16 A;  2AHQ A;  1H0M A;  5ICG A;  2VJI A;  1FN0 A;  2HOA A;  1DQU A;  3M8E A;  1RR7 A;  3V4G A;  2PJR B;  3F8C A;  1J9I A;  1ABR B;  1I1E A;  1ETO A;  2NS8 A;  1R5I D;  1IN6 A;  2LBF B;  3OYN A;  5FRN A;  3HOM A;  3T5X A;  4RB3 C;  3KCC A;  3E0J B;  2CW8 A;  3PIO F;  4NDL A;  1KU3 A;  1MBG A;  3BT9 A;  1IXR C;  2K4B A;  5IOY A;  1IC8 A;  1FIA A;  2MFZ A;  2MLK A;  3GZN B;  1IUY A;  3A02 A;  5BXT A;  3HUG B;  3JSO A;  3H5A A;  3LMM A;  3BRD A;  4OOI A;  2R9K B;  1XC5 A;  1DDN A;  1LEA A;  1EH8 A;  3P9C A;  1V54 H;  2M1B A;  3CLQ A;  3CCL I;  4IQJ A;  3OOP A;  3REO A;  1EYL A;  2DDB A;  1BAR A;  3KLO A;  2YU9 J;  2MC4 A;  2L9R A;  3H3Z A;  3BC8 A;  2NM1 A;  1KA8 A;  2RQ9 A;  2Z99 A;  5F0F A;  3IH3 A;  1EA3 A;  3OYG A;  1TZL A;  4D0Z A;  3Q7X A;  1TTU A;  2I5U A;  2V1N A;  3ABK H;  1X4P A;  2O0Y A;  1W3A A;  1P2F A;  1DQO A;  3ABM H;  1MD6 A;  3ILA A;  1W7P B;  3QQA A;  4CA0 A;  2M7A A;  4JX5 A;  5FFX A;  3WO4 A;  2QSF X;  2XGX A;  4AM3 A;  1XSD A;  2EQR A;  4L9V A;  2D1V A;  1GT0 C;  3I29 B;  4OWL A;  1LUJ B;  2ICW G;  1B4A A;  2Q9X A;  5D6E A;  4OMZ A;  5F27 A;  3A21 A;  3TC2 A;  3H6R A;  1W36 C;  4UY8 I;  3I4P A;  4XK4 A;  1ISZ A;  2NNN A;  3LA2 A;  2V9P A;  2E35 A;  1RML A;  4BE0 A;  1JTX A;  2NTD A;  2R0Q C;  2QN4 A;  2RAE A;  2Q8K A;  1EKE A;  2FMY A;  1BIB A;  3F3X A;  3IV5 A;  4RAY A;  3J80 K;  5DDG A;  3DLA A;  4M72 A;  3RKQ A;  3HSR A;  3M3Y J;  1LKX A;  3H92 A;  2R5Z B;  4EKX B;  1T08 B;  1Z05 A;  1FJL A;  3VEP A;  3A22 A;  1B8I B;  4E70 A;  4HV5 A;  2BEO A;  1WWX A;  2L4A A;  2ZO4 A;  1SFK A;  2F2E A;  4RM2 A;  4ZDL A;  3S16 J;  2WY8 Q;  1FX7 A;  3PM1 A;  4XOP A;  1YS7 A;  4RGR A;  1POG A;  3CJQ B;  4RLQ A;  4ENN A;  1AVW B;  2K4A B;  3FJI A;  2GXB A;  1LVA A;  2VOO A;  3BA4 A;  1SAU A;  4BQQ A;  3HAL A;  1RY7 A;  1BFG A;  1WBC A;  4Y4R A;  3MEX A;  4CCK A;  2CG4 A;  3MD2 A;  2BGC A;  2J5O A;  4YRV A;  5F8W A;  2A5W A;  5D8L B;  4QC4 A;  4U0Y A;  2W85 A;  5FRO A;  4D5F A;  1ETK A;  1BFB A;  4AUX A;  2LFB A;  2DJN A;  2XRO A;  2L9S A;  1R4N B;  2VBZ A;  2ZJP F;  1PVE A;  1U78 A;  3MAJ A;  5DM6 F;  2DPU A;  1X3W B;  2WB1 N;  1YTO A;  5HLH A;  2VKE A;  3HHH A;  2DQR A;  5HNH A;  4I3N A;  4ZYE A;  1BI0 A;  1TBX A;  5L3F A;  2JUG A;  2EIN H;  4G8X A;  3QRF F;  1VQK I;  3RMY A;  3RYP A;  2K9N A;  3JCU C;  5B1A H;  5JHU A;  1JGG A;  1JY0 A;  4M3E A;  1TTY A;  3BDD A;  4LO1 C;  2K7L A;  3ERM A;  1W5T A;  3IH2 A;  1ZN2 A;  4OW4 A;  3RPU D;  2FFU A;  1MD0 A;  4HYE A;  1ITB A;  3BZC A;  4ABZ A;  1A5J A;  4IRG A;  3OS0 A;  1O7L A;  3A01 A;  3AH4 A;  2QSH X;  2D1Z A;  3D0S A;  1IN4 A;  2LSO A;  2YU3 A;  4GFB A;  4CGZ A;  4LO3 A;  4XRF A;  2KLL A;  3I3L A;  4PJM A;  4P9F A;  4V19 K;  5CVI A;  2LIQ A;  3E7L A;  2NOG A;  2ZXI A;  4M73 A;  2HQ5 A;  3LLP A;  3HMY A;  1SZ6 B;  4Y17 A;  3HGY A;  5ICF A;  4OEG A;  1BN5 A;  1HWM B;  1Z2V A;  3KEQ A;  5HNF A;  2ISZ A;  3PO2 J;  2QLZ A;  1JT4 A;  2X2T A;  1HCE A;  3L7W A;  1DU6 A;  2KL4 A;  4XQF A;  2XAU A;  3ZR8 X;  4ITV A;  3LFU A;  3LQQ A;  1R36 A;  4HEA 2;  1W5S A;  3H5N A;  3HZJ A;  3FF5 A;  4O5V A;  3CLO A;  4A0Y A;  4BBS J;  3WTZ A;  2L01 A;  4A3G J;  4I09 A;  1BOB A;  4XR6 A;  2BE5 F;  5F04 A;  3HBL A;  2WWY A;  2VJJ A;  5KCM A;  1CGP A;  1FTT A;  2MA3 A;  4Q5S F;  1RPW A;  2O03 A;  2XKP A;  3BJO A;  2E2J J;  2KDZ A;  2R7Z J;  4HA2 A;  2P7V B;  2Y9W C;  4G9Y A;  4IZE A;  3ROU A;  4KEJ A;  3RKY A;  4HQE A;  2QBY A;  3MVP A;  1XDU A;  1V3F A;  2IEK A;  4M6X A;  3G3Z A;  3N7K A;  3EUH A;  3JRH A;  3PNV A;  1APL C;  5E1X A;  1WQ2 A;  2Z48 A;  4XKB A;  3NWT A;  4UVB A;  4AN6 A;  2DA7 A;  1S0L A;  3UDA A;  3F6O A;  1PUF B;  4BUP A;  2VN2 A;  3RKX A;  2ECC A;  2LR8 A;  2AAI B;  2EZH A;  4A6D A;  5M5X J;  3J81 Z;  3D5R C;  1OCP A;  1OCR H;  4I98 B;  2DFE A;  3ERE D;  2FOW A;  3BWG A;  1X58 A;  1N78 A;  4NNJ A;  2ZQO A;  3L00 A;  4HJJ A;  4OAY A;  4D1Q A;  3QP6 A;  1L2H A;  1Y8Q B;  2HYJ A;  1S0C A;  4ZGR B;  2D44 A;  4A5M A;  3AZV A;  3BRF A;  3K4J A;  1T98 A;  2L9N A;  4G7H F;  1MND A;  3S14 J;  4GP3 A;  4ESB A;  4IHS A;  3K4C A;  4CO8 A;  2HKO A;  4BHC A;  1MZB A;  3M4O J;  2RQQ A;  4R6U B;  5F64 A;  5E8G A;  2R92 J;  3IM7 A;  3CMA I;  3M9A A;  2KIU A;  2JSP A;  2JA8 J;  1W36 D;  4KC3 A;  3ZQH A;  1MSF C;  3FXJ A;  4UVC A;  1I50 J;  2CRG A;  2XSD C;  3IAM 2;  3HHG A;  2HW9 A;  1BBY A;  3BCB A;  3J80 Z;  1CVS A;  5HS9 A;  5E8I A;  2JVG A;  4PJJ A;  1SAN A;  1V6X A;  5E1Z B;  4LO8 B;  1WJA A;  1XMK A;  5ED4 A;  2D7I A;  1P4A A;  3FM5 A;  4BQO A;  1EPW A;  3BAU A;  4NBQ A;  2MW8 A;  3Q7W A;  4I1B A;  2OA4 A;  4GCV A;  1QBJ A;  3H6S E;  3OYA A;  5BXR A;  4X38 A;  2KQR A;  1JLX A;  3QPH A;  4BXX J;  4LO0 A;  2ESH A;  4E7S A;  4I4S A;  2KRF A;  1QXM A;  1YQA A;  3DU5 A;  3SZP A;  2QF7 A;  2YR2 A;  3GTK J;  5CVU A;  2LIE A;  1HWP B;  2E5N A;  4LMY A;  3E8L C;  2OUM A;  3H1C A;  4XL9 A;  4A3L J;  2VE8 A;  3R61 A;  1B9N A;  4CCN A;  4D0P A;  2QEX I;  1PC8 B;  2DK5 A;  2ZXW H;  3ESW B;  3AZW A;  2LNB A;  1PUE E;  1EF4 A;  4XFT A;  1HDP A;  4BAY A;  2ZC2 A;  1WJB A;  5HLI A;  2VC0 A;  3HB9 A;  2YS9 A;  1O3T A;  5TJJ A;  2WAD A;  4Q47 A;  2FGF A;  1MBK A;  5BP5 A;  4ION A;  1QVT A;  5FKK A;  4ISR A;  3V7S A;  3BR1 A;  3JRC A;  5FKN A;  1WRJ A;  3GFM A;  4L0Z B;  3R0A A;  4XFS A;  4ZDO A;  4DZP A;  1K4T A;  4IHY A;  1I6H J;  4BQN A;  4R79 A;  3HDD A;  3K1M A;  1CQT A;  1ZEL A;  2NVH A;  5JFR A;  1E0O A;  2Q3N B;  4BL0 B;  5E3M A;  1TP4 A;  3BLY A;  3Q0U A;  1MBE A;  5JVT A;  3ZX7 A;  4L5I A;  5F6F A;  1TC3 C;  3PO3 J;  2EFN A;  2LKP A;  2RRE A;  3KYL A;  3S2D J;  4G94 A;  3X2Q H;  1HWN B;  3FJB A;  4Z9W B;  2F5V A;  1M1E B;  3IWF A;  2ZME A;  3BTC A;  1U5T C;  3DBH B;  4I4U A;  1AKH A;  2ECB A;  2EIM H;  4QSH A;  3JTH A;  2TCT A;  2FD5 A;  1W1W E;  3GTG J;  3ZXD A;  2DA2 A;  4G7O F;  1AVX B;  3TO6 A;  4MQV A;  2WAE A;  3WO3 A;  3TW6 A;  4YEL A;  4H9W A;  4RAF A;  4RAG A;  2H6C A;  5KK1 A;  4IRH A;  2CO5 A;  4MZG B;  4PFO A;  4M9X A;  4BGD A;  2J5P A;  4PSX A;  1O3R A;  3VSK A;  2HOS A;  1WJC A;  5LLQ A;  1BI3 A;  4BHP A;  5M5W J;  4ZFU B;  2H09 A;  1FBU A;  1HSJ A;  2W4S A;  5IP7 J;  5J8F A;  1DPU A;  1OFC X;  4UB6 C;  4IL6 C;  3CMM A;  4N9H A;  3CCY A;  4B1R A;  4WCG A;  1FY7 A;  1R23 A;  2XPV A;  1FMV A;  4XLA A;  4UNO A;  2ADU A;  2L9V A;  2GXG A;  3WGH A;  1E17 A;  5LHH A;  4W1U A;  2LBF A;  4G6Q A;  4DZJ A;  2VXZ A;  2RQP A;  5K1Y A;  2JPC A;  3A4C A;  4IKF A;  3NEU A;  2ZKZ A;  2XGE A;  5HS7 A;  5C4J J;  1ETV A;  3HUG A;  3DKY A;  1J5Y A;  3RIR A;  1SFU A;  2HZD A;  3R4S A;  1ETQ A;  1UJ8 A;  3OY9 A;  1ISV A;  2KJB A;  5CQE A;  1YIJ I;  4EJT A;  5IPA A;  1YBI A;  1G3W A;  2HPI A;  1NZK A;  2WV1 A;  2BV6 A;  5F1R A;  4KIT B;  4HZF A;  2VBW A;  4TV7 A;  2Z49 A;  1WSU A;  1ETW A;  2A3S A;  1VQ4 I;  3IC7 A;  3DFG A;  1OMI A;  2BOL A;  1YX5 A;  4KT6 A;  5CYV A;  4AVP A;  3CF5 F;  3E6D A;  4JPZ A;  1XCV A;  2HXO A;  1ONV A;  3SQN A;  3BA5 A;  2KHM A;  3N97 A;  4HF2 A;  1W7P A;  4AWX B;  3WTV C;  1VQ8 I;  4RBO A;  1PWA A;  5F8S A;  2FBI A;  1OYW A;  2OF7 A;  1BIA A;  4G7Z F;  5LRS A;  4IRI A;  2HVS A;  1V6U A;  4L4H A;  4MTE A;  4HLX A;  4II2 A;  2M45 A;  5KVR A;  2ESN A;  4RS8 A;  2DRZ A;  1Z3Y A;  2VON A;  1T56 A;  4GOY A;  1FP1 D;  4F83 A;  4HBL A;  3MQ0 A;  1H9T A;  1PDN C;  2R7R A;  2IGK A;  3OS1 A;  1QU3 A;  2DOA A;  3C7J A;  3HTS B;  2LF7 A;  2WTE A;  2K43 A;  3K70 C;  4OAZ A;  1GVD A;  2K9Q A;  5TRD A;  2ERM A;  5D4S A;  1QZE A;  2HZT A;  2NZ9 A;  3CJT B;  4CJM A;  1RRJ A;  1SR4 A;  2GZW A;  3CC4 I;  2LY2 A;  4FE7 A;  4P6A A;  1R7J A;  2R5Z A;  4ETS A;  3HBW A;  3CRI A;  4BYY A;  4IZZ A;  4FX4 A;  2EK5 A;  4Q48 A;  1RNL A;  2QQ9 A;  3ZQF A;  2Z33 A;  2DO7 A;  4IVN A;  1B8I A;  1S5L C;  5E17 F;  1B6A A;  1JHF A;  3L2W A;  3KZI C;  2DMQ A;  1S0F A;  1YW7 A;  5EDN A;  1Q1U A;  5EZG A;  2Y0S A;  2Y9Z A;  3WIN A;  3O4O A;  3CA5 A;  2VQH A;  1BA7 A;  1XGS A;  1OCZ H;  3H35 A;  3H0G J;  2DK8 A;  3SHF A;  2RST A;  4P96 A;  1Y8R B;  1L3L A;  1H9G A;  3PL8 A;  5C44 J;  1U3E M;  2HDD A;  3GZ5 A;  3O3K A;  2ZSI B;  3UKG A;  2KI4 A;  1IRP A;  2LF8 A;  4A93 J;  1TWM A;  2LG4 A;  3D5L A;  4E7Z A;  3ZC9 A;  3T1B A;  3KZY A;  3RDI A;  2K9L A;  3GUD A;  3H9J A;  5IYC J;  2AXM A;  4WXH A;  4I4P A;  4I7H A;  2OCC H;  3FZV A;  3KP7 A;  3WU0 A;  3BPV A;  1BJZ A;  3FM3 A;  1OKR A;  1QHG A;  2X0L A;  3K4K A;  4L0Y B;  1Z6T A;  1D0X A;  4EJW A;  1SFO J;  1HLV A;  1H8A C;  2W24 A;  2YX4 A;  2HVR A;  3BRO A;  5EF6 A;  1D1C A;  4K2E A;  1XX5 A;  2DYR H;  3BOQ A;  4PFP A;  3GTJ J;  5BOW A;  2WAF A;  2BYV E;  3VWB A;  5F0H A;  3OMY A;  2CSO A;  1TP0 A;  4X1E A;  3AKH A;  2CW0 F;  1FYL A;  4D8H A;  1N77 A;  1YIO A;  2F2F A;  5J8C A;  2Z9O A;  1O3S A;  3FK7 A;  3WE3 A;  3LAP A;  3CUQ A;  4HNT A;  3NRV A;  1SD7 A;  4TLP A;  2D7R A;  4B47 A;  2H8R A;  2ZNY A;  3IL2 A;  3JRR A;  2XKO A;  1U6G A;  2QQB A;  4OEE A;  4ZA3 B;  1XDS A;  5JHF A;  3S1M J;  1YLF A;  1QPI A;  2F5C A;  2DMN A;  1P7I A;  3HOV J;  1W3G A;  2F4I A;  1RR8 C;  4M3F A;  2PQ8 A;  4A6E A;  3RPQ A;  1B9M A;  1D3Y A;  3K4L A;  4LK0 F;  1N25 A;  1II4 A;  1TW2 A;  3L2U A;  3F8N A;  2M8E A;  3AH2 A;  4EEE B;  1FYM A;  1IUF A;  4FE4 A;  3CCJ I;  2OQR A;  1R6R A;  1S3J A;  5LEK A;  2Y69 H;  2JJ7 A;  4FCY A;  4XLC A;  3CCU I;  1ON1 A;  3AKI A;  1BR4 A;  2KLO A;  2F6C A;  1AVU A;  3EYY A;  4S05 A;  5DSS B;  3IM6 A;  4NC7 A;  2O3F A;  3O6B B;  3QWL A;  4N4O B;  3GTQ J;  3BQZ A;  3CME I;  4UB8 C;  2X6Y A;  1G3T A;  4JAW A;  1SAX A;  1D8K A;  2JMW A;  2Q2E B;  3A0B C;  2FJ1 A;  3C2G A;  5TGT A;  4AIJ A;  2AS5 F;  1WD3 A;  3H6Q A;  3ECO A;  1MMD A;  4C2M J;  4PJN A;  3FDY A;  3VT2 A;  2VKV A;  5EGO B;  3CJR B;  2KT0 A;  4NUB A;  1Z7U A;  4RB2 C;  1TWF J;  5D5V B;  3SYT A;  4IY9 A;  5DD4 A;  2E7X A;  2O9L A;  3HEF A;  3SEZ A;  2NS0 A;  4L9N A;  3LNQ A;  1HF0 A;  5LRR A;  3MN2 A;  1FLI A;  1ZG1 A;  4QKS A;  4JP0 A;  2VQC A;  4KN4 X;  3C1D A;  4M71 A;  3IAG C;  3DV8 A;  3CC7 I;  3K7A J;  3L2Q A;  3ZMT A;  5GAG J;  3CD6 I;  1XGN A;  3RYR A;  2A05 A;  4L5E A;  3KPH A;  4KBB A;  3QOE A;  1L0O C;  2BW3 B;  3PQK A;  1IIL A;  3OL3 A;  3DF8 A;  1HW5 A;  3F8F A;  4M3B A;  2XAQ A;  2O6G E;  1T9F A;  2DRE A;  4MLO A;  3HOW J;  1FBQ A;  1Z4S A;  3FWE A;  2UUS A;  3OYJ A;  1OPC A;  4ISQ A;  1USS A;  1WJF A;  1JUM A;  2COB A;  1WH7 A;  2IS2 A;  4LO3 C;  1FMW A;  4CCJ A;  2BY3 A;  3PNY A;  4EGZ A;  4XFU A;  4Z6Y A;  1VQ6 I;  3S15 J;  1KON A;  4H0E A;  2RKH A;  4I2S A;  1HQC A;  1D0H A;  3RI4 A;  1DLL A;  5B2H A;  3CA1 A;  2HYG D;  2Y30 A;  3HOX J;  4J19 A;  1K83 J;  3TOB A;  2OAZ A;  2CUF A;  5J4Y A;  3FXR A;  1IF1 A;  2HPM A;  2QYI B;  4AIH A;  5JMC A;  2HOE A;  1ZAO A;  5CPR B;  5E1W A;  4JX6 A;  4I0Y A;  8I1B A;  4Y3O A;  1RKW A;  2MD0 A;  4ESF A;  3OV8 A;  3KEO A;  2OV7 A;  3EDP A;  1Y0N A;  4MHG A;  4HSR A;  2DXI A;  3H3V K;  4RGU A;  3P7N A;  1SMY F;  1YS6 A;  3ABT A;  5IY5 H;  3BR3 A;  3CCR I;  3O2P E;  3O4D A;  5GAD J;  4IXA A;  4A3C J;  3GVA A;  3SFI A;  1ZGW A;  2EB7 A;  2MD5 A;  1NUN A;  3I2A A;  3QPT A;  2E1C A;  1HBX G;  1IGN A;  3E3V A;  5BNG A;  3EUH C;  1VTN C;  3TQN A;  3AFH A;  3MKZ A;  3ZOB A;  4OIQ F;  5C3E J;  4WWC A;  2ZFU A;  2D2W A;  2E5Z A;  3FBI B;  3JAM K;  1HW2 A;  2IP2 A;  5LEJ A;  4M3G A;  4UV9 A;  1YRN A;  1WI9 A;  4AYB A;  3BR0 A;  2D20 A;  3HOU J;  4A12 A;  2G7U A;  3OSG A;  4NHJ A;  2DBB A;  4LIT A;  3V0B A;  1FIP A;  2E34 A;  1MJB A;  3MKL A;  1VI0 A;  5D4R A;  1A6I A;  5HLT A;  3CA4 A;  3O3Q A;  1FP2 A;  2FNP A;  3ZP5 A;  3DEE A;  2COM A;  2HU9 A;  4XLH A;  3BG9 A;  1ACI A;  4KEI A;  1TT5 B;  3M8J A;  3PSI A;  3E5X A;  4KIC A;  4YII A;  4BDY A;  1Z77 A;  3L2V A;  4QD2 B;  2YSR A;  4RGS A;  2DMT A;  2WRY A;  1FOK A;  5E79 C;  1AHD P;  4IHV A;  3FMQ A;  1ZGA A;  3D5S C;  3FXL A;  2QEN A;  2QGU A;  3BR2 A;  3DPU A;  4FVV A;  2E1M C;  2Z5U A;  3RSN A;  1F31 A;  2JQ7 A;  1P9Q C;  3FJJ A;  2PMZ N;  2M7B A;  4X37 A;  4DGW B;  4X6A J;  3J7Y J;  1Q03 A;  2R5Y B;  3U21 A;  3NQO A;  2KKI A;  3BX1 C;  3CF2 A;  1FTZ A;  4BHB A;  1D1B A;  1IXS B;  4AC0 A;  3RZO J;  3OYC A;  4A7Y A;  2FQ3 A;  3QYB A;  5GAQ A;  1WPK A;  1RC9 A;  3ZQL A;  2EH3 A;  2FQ4 A;  3CCS I;  4BAC A;  2EA2 A;  1IRZ A;  3KLN A;  4I4R A;  4LJZ F;  3CDI A;  4LO0 C;  2LRD A;  4EEF G;  1GUU A;  2VKD A;  3BP8 A;  1D5Y A;  1Y0U A;  2KZG A;  4I0A A;  4EFP A;  2IGN A;  4OIN F;  3V7R A;  2JWT A;  4ZC3 A;  3PHZ A;  2CQ7 A;  3TP3 A;  5HPZ A;  3K9T A;  3K1N A;  2XB0 X;  4BH9 A;  2O61 A;  4LO2 A;  3FXO A;  3K4N A;  1YW9 A;  4BXU A;  1TL8 A;  4LOC A;  1S0D A;  1X1B A;  5A2Q K;  2LLK A;  5CQG A;  1YXW A;  2FFV A;  1JT0 A;  2JVH A;  5D62 A;  5IT3 A;  21BI A;  2DW4 A;  2EWN A;  4KMF A;  1KU9 A;  2EFQ A;  5CVV A;  5DUI A;  4LLN A;  3D7W B;  2A61 A;  2CQN A;  3I64 A;  5BP5 C;  2DMU A;  4ZLB B;  1GHC A;  3FJ9 A;  1BFF A;  2MBF A;  3RTI B;  2GLO A;  4L4I A;  1XCB A;  1QA6 A;  3IRR A;  1X3U A;  1IW7 F;  2HDW A;  2VSE A;  1ODD A;  1WJ5 A;  1Z91 A;  1ZTR A;  4DYQ A;  4KJZ A;  3FXQ A;  3BA7 A;  4LG0 B;  1JJ6 C;  3BZK A;  3HSE A;  1Z0X A;  1UZC A;  1TW3 A;  3WTT C;  5HDN A;  4I6Z A;  1U9O A;  1XZZ A;  1G9A A;  1T6S A;  5HLG A;  3K1X A;  1T39 A;  2Y0S N;  4A3M J;  1I1S A;  3RQ4 A;  1FEX A;  2ZME C;  4CCL A;  3QYD A;  2L5Q A;  2GM4 A;  4GDF A;  2DTR A;  3I2X A;  2HQN A;  3GFJ A;  1F36 A;  4I4X A;  3F6V A;  5B1B H;  3EF2 A;  4WX9 A;  3N0K A;  4XRM A;  4YIR X;  2E19 A;  2M8G X;  4N0B A;  3TBI A;  1HIB A;  5IT9 K;  3BG5 A;  3J7A Y;  3ZQI A;  3WTU C;  1TFM B;  4DBQ A;  3HIF A;  3CMY A;  3P9I A;  1I3A A;  3BR6 A;  3K69 A;  2OZU A;  3PSF A;  4A3J J;  3AG2 H;  3BPX A;  3GX4 X;  9ILB A;  1ZLJ A;  3KP5 A;  3V0A B;  4AVZ A;  5DZU A;  1ZRE A;  3WU2 C;  2HKX A;  2ZJ2 A;  1B72 B;  4A0X A;  1C0W A;  4HG2 A;  1XG6 A;  1XHB A;  4EFQ A;  3VUO A;  1TIE A;  1QVU A;  3RPU A;  3GXO A;  1J09 A;  2JRM A;  2XOA A;  3FKJ A;  1UB9 A;  2M34 A;  2E1N A;  3PIP F;  2ESU A;  2DS0 A;  5I1B A;  3LOC A;  4HW0 A;  4I6I A;  1MMA A;  3KEY A;  3TO9 A;  1ULY A;  1T2K A;  2E4M A;  2ELJ A;  2B7E A;  4QBC A;  1SEU A;  1U5T B;  2DYS H;  1YF8 B;  1HDD C;  5FLX K;  4I37 A;  5IYD J;  4D9J A;  3I55 I;  2P7C B;  4BNC A;  5KNL A;  4J2Y A;  3CZ6 A;  5L3B A;  4A5N A;  2BXY A;  2HNH A;  4IOC F;  3N7J A;  1SFE A;  3FJK A;  5JI6 A;  1ZG3 A;  4MZF B;  5EC5 A;  4C2T A;  3C9Z A;  2VJ4 A;  3QOP A;  2XAJ A;  4JQF A;  1G3S A;  1V55 H;  3HSF A;  5DD8 A;  2KRH A;  5GP9 A;  3KYC B;  4G9N A;  4JOM A;  2B63 J;  1OR7 A;  2XF7 A;  1UAA A;  3BTL A;  5AON A;  2W84 A;  2KIS A;  4FHT A;  2IAI A;  2CUJ A;  2V9K A;  4MTD A;  2DFI A;  1NG7 A;  3IP4 B;  3JRD A;  4I2O A;  2GIZ A;  1ILR 1;  1FGA A;  4FTH A;  3VEQ A;  3WU1 B;  1EV2 A;  2GA2 A;  4IQ4 A;  3G2B A;  5J1U A;  4G6M A;  2ZJQ F;  4A3E J;  4A3B J;  2TDX A;  5JLW A;  1F4K A;  3U9G A;  3NBD A;  4PGH A;  2MG4 A;  1ETX A;  2EV0 A;  3LTQ A;  5LGT A;  3OR2 C;  1RZO B;  3CQA A;  2E36 A;  1S7E A;  1YHQ I;  2E7W A;  4XKW A;  4BBR J;  4IHW A;  4X0G A;  5FLV A;  5LD2 C;  1SR4 C;  1SD5 A;  4QO3 A;  5CLS A;  4E7I A;  2XGD A;  2DA4 A;  5K7F A;  2IT0 A;  2ZSH B;  2LMD A;  2X1C A;  1Z0H A;  1ENH A;  3MZH A;  1IHK A;  3JRG A;  3CU1 B;  5EZH A;  5FFZ A;  3SFZ A;  4B44 A;  2EZK A;  4ZFW B;  1TNT A;  3WGG A;  1VCL A;  4M6Y A;  2LRE A;  2XUB A;  3A03 A;  1WKM A;  3CDH A;  3G1O A;  5EEG A;  4B3X A;  2LY9 A;  1NK2 P;  2XRL A;  3TW7 A;  3CP2 A;  4UY4 A;  5D5X B;  1X3Z B;  2P39 A;  4P1W A;  5ILV A;  4RA2 A;  3GF2 A;  3A2K A;  2XAG A;  2YUS A;  2HVQ A;  4C9Y A;  5EGO A;  5EEA A;  1GV5 A;  1MH4 A;  2L7Z A;  2DTZ A;  2NAZ A;  4I0B A;  2CS3 A;  4ZDP A;  3VSZ A;  3ZN1 A;  2VUM J;  5F1J A;  4GXO A;  2Z1D A;  2D43 A;  3WHC A;  4E7L A;  1A8D A;  1ZRD A;  5H6R A;  2NRA C;  2DA1 A;  3GEZ A;  3KP2 A;  4RB0 A;  4XRS G;  3ZQC A;  2BHY A;  4I4V A;  5FKM A;  3G1L A;  5HOO A;  3MZY A;  1MNE A;  4IJA A;  1OCC H;  3U1K A;  4HDV A;  3TMO A;  41BI A;  4ASN A;  3CP8 A;  2VLA A;  4GAF A;  1KNM A;  2F48 A;  3CES A;  2NS2 A;  2VAS A;  3KET A;  2NVX J;  3HPG A;  3O4C A;  3TL4 X;  2KIM A;  2FUG 2;  3HL2 A;  1T0F A;  2BW3 A;  4D0T A;  3VYR B;  3HC7 A;  3CUQ C;  3DCF A;  4OWJ A;  2MC3 A;  1BI2 A;  1T8I A;  2VXD A;  1LQ1 A;  1DJS B;  4EVI A;  2EIK H;  2RDP A;  3EUA A;  1T4Q A;  4II0 A;  4HF0 A;  4RAZ A;  4FET A;  1U2W A;  3PME A;  1ZR4 A;  2STT A;  4JX4 A;  2D5V A;  2AQZ A;  5LHI A;  2HZ9 A;  1KYZ A;  2FX0 A;  1ZRF A;  4FQG A;  1TOO A;  1I39 A;  4Y52 J;  3WTW C;  3V8J A;  1NK3 P;  2GOM A;  3CCQ I;  2GOX B;  3I9V 2;  2MLG A;  4D7M A;  1R49 A;  2MYS A;  4BJT A;  5IT9 Z;  1Y56 A;  4L5J A;  4RDU A;  3OGF A;  1ZR2 A;  3F8M A;  1F5T A;  4B48 A;  2H1K A;  4P9U A;  1MIJ A;  3VYT B;  1ZAR A;  3FXU A;  4BJ6 C;  2LD5 A;  4MEY F;  2XDV A;  4I01 A;  2MGQ A;  2STW A;  3KFW X;  4BXF A;  3S1Q J;  3LL7 A;  2EFP A;  3WG7 H;  4AYB N;  1JE8 A;  3FJE A;  2XAS A;  1FBS A;  3CRG A;  3LSI A;  3F1R A;  4USO A;  4P55 A;  3E6B A;  4IF4 A;  1XSV A;  4CYD A;  2B0L A;  1IJT A;  1FOW A;  3IWZ A;  3DBR B;  3KX2 A;  2HXI A;  4AIK A;  1V6V A;  4LO7 C;  1T95 A;  5JR3 A;  2GQQ A;  2Y9Y A;  2OZ6 A;  2PMU A;  2NVY J;  1ON2 A;  5AIP A;  4DEN A;  2DPD A;  4EJO A;  1TQM A;  3TDZ C;  2EZI A;  2DQL A;  2P6S A;  2C6Y A;  3RTJ B;  2PJR A;  4ZH4 F;  3H6R B;  2OU2 A;  4E7K A;  3ULQ B;  5EJC A;  1K78 B;  4LB5 A;  5FKL A;  1QZY A;  4KDP A;  1LEB A;  1LNW A;  2X1E A;  4PCQ A;  3ZCO A;  3H9Q A;  2JZY A;  3DTE A;  2DT7 B;  1ERD A;  2PEX A;  2BVM A;  3NAR A;  4DIQ A;  4F92 B;  1R5H A;  1TT0 A;  5JLX A;  1Z9C A;  2PMZ A;  2DOD A;  4OMY A;  2BEA A;  1J75 A;  3BAD A;  2LP0 A;  5E20 A;  3WG9 A;  1WD4 A;  3LSM A;  4ENM A;  1BI1 A;  6I1B A;  4D5C A;  1S6L A;  1JUP A;  3LAJ A;  1HKQ A;  3OYL A;  4B4C A;  1K7A A;  1DGR M;  4CZC A;  4M6V A;  3DPT A;  1H88 C;  2EV6 A;  2IGM A;  2QVO A;  2P5L C;  4UHT A;  3WA1 A;  2EPF A;  3DXJ F;  2VKH A;  4I96 A;  5D6F A;  1AA7 A;  1X1C A;  4LLL A;  4PZJ A;  3W9T A;  1D5V A;  2DFF A;  1QRY A;  3BG6 A;  4NC8 A;  3DTK A;  5CVR A;  2IRF G;  4BU2 A;  1RET A;  1Z7L A;  2JA5 J;  4G6D A;  4Q4Z F;  4WXC A;  1JI8 A;  2HQR A;  1UEL B;  3DWL E;  5GAH J;  5LGN A;  1OJL A;  2R7W A;  1ITY A;  4E7H A;  5JLV A;  2HS5 A;  4NB5 A;  2IW5 A;  2GIV A;  2VBY A;  2G9W A;  3OL4 A;  3SDG A;  2R5Y A;  5FRM A;  1U9N A;  1G9B A;  3OJM A;  1DZD A;  1Y1W J;  2LDU A;  1V4R A;  2GWR A;  4EM0 B;  4IX7 A;  3S1R J;  4XSZ F;  1UST A;  3V42 A;  5ILU A;  1A35 A;  2PLY A;  3JRE A;  1JKQ C;  1N4K A;  1GGP B;  3SJM A;  3VT0 A;  3DEU A;  3WTY C;  1Y6I A;  4PDK A;  3ELK A;  2H8W A;  5FB2 A;  1G59 A;  3TDU C;  2MIB A;  1DUX C;  4I4Q A;  5LBQ A;  4P0L A;  5CJ9 A;  1IRG A;  3Q0W A;  3LA7 A;  1ZRC A;  4D7N A;  3FGM A;  2O8X A;  1ZLK A;  3N05 A;  1XGO A;  1OYI A;  3ONQ A;  2QKM B;  3OYE A;  2PFB A;  1JLY A;  4EFR A;  4J00 A;  1AXM A;  3F0C A;  1S7O A;  3ZMS A;  3H5R A;  1S72 I;  4QPQ A;  3EYI A;  3QOD A;  5BMZ A;  3BAH A;  1WI3 A;  3KMV A;  1UCR A;  3A01 B;  1K6O A;  1TWG J;  4U87 A;  1VFC A;  1STZ A;  4XID A;  1O57 A;  4WBC A;  4OWR B;  3ECH A;  1HOM A;  1BAS A;  3L1P A;  3ZGK A;  4B3A A;  3GFL A;  3B9U A;  2E2I J;  1QQI A;  2VU9 A;  3FHZ A;  3AJ6 A;  2LYC A;  1F1Z A;  3Q9S A;  2O5R A;  1YIT I;  1K5V A;  1UG2 A;  3I4N J;  2M4G A;  2K9M A;  3I53 A;  4IHT A;  1ZG5 A;  2X1D A;  3HOT A;  3MAL A;  2AO9 A;  3O49 A;  4L9J A;  3E5U A;  4KIF A;  4QKR A;  2IA2 A;  4J01 A;  2RNG A;  2FDB M;  4YFK F;  5C4X J;  4A7K A;  1K4S A;  4LG0 A;  3S8J A;  1KYW A;  4J23 B;  1YX3 A;  1XTA A;  3SXY A;  5FD6 A;  3AKG A;  1Q1V A;  4WF2 A;  3PUF A;  3IRQ A;  4XRS A;  3HN1 A;  1HCD A;  3Q0V A;  3CCM I;  1DFC A;  3C3W A;  4USP A;  3QU3 A;  5M5Y J;  2D24 A;  1P6R A;  4CSW A;  4C3H J;  3KZZ A;  1BR2 A;  3UJ0 A;  1XYF A;  4S04 A;  3P53 A;  2FU4 A;  3W2V A; 
#chains in the Genus database with same CATH homology
 2IS6 A;  1HWO B;  2ET2 A;  4N4N B;  4IYB A;  1G9C A;  5DVH A;  3HSM A;  2R7Q A;  3FFZ A;  3V0A A;  1YE9 A;  2Y9G A;  2R7O A;  3ZXG A;  4DEP A;  3WMV A;  4ANJ A;  3DKX A;  3BTA A;  3VSF A;  4BS9 A;  4H04 A;  4XKV A;  1V5E A;  3W2W A;  1FMM S;  4ZYA A;  3K6G A;  3DU6 A;  2I8D A;  2XC7 A;  3O5W B;  2VQL A;  1PYV A;  3EUK L;  2IS1 A;  2CH0 A;  3DTI A;  4EAT A;  2OC6 A;  3H9G A;  2M4K A;  4XN3 A;  3LSH A;  4BEH B;  4GRI A;  3RMX A;  1JT7 A;  2WBM A;  4PSW A;  2L5X A;  5G00 A;  1V5F A;  3BAG A;  1JQZ A;  3W3C A;  5DUY A;  4FGF A;  4QPO A;  4F91 B;  3NBC A;  2M3A A;  2CUZ A;  4J2K A;  4XON A;  4OWK A;  4XKI A;  2NOJ B;  4P5O A;  1TWE A;  3S3M A;  4Q9G A;  3VWC A;  4DOZ A;  2AFG A;  3O44 A;  3S3O A;  3A07 A;  4OUJ A;  3IUO A;  1AVA C;  2D23 A;  4F93 B;  3K70 D;  3HXL A;  3PFY A;  3SEQ A;  3WMU A;  3VYU B;  3HOS A;  1LDK B;  4XOR A;  2QKL B;  1CE7 B;  2VQG A;  2XF5 A;  4J2X A;  2WAQ A;  3IM5 A;  2UV1 A;  1UG0 A;  1M2T B;  5BQU A;  3OYF A;  5FZZ A;  3K4M A;  3S93 A;  3RCO A;  4I8M A;  4XLF A;  2WBC A;  4KEK A;  3O4B A;  4CCM A;  4X39 A;  2IXS A;  1X1A A;  3H0D A;  2Y9X E;  2BFH A;  3BAQ A;  3ZQQ A;  1R8N A;  4RMN A;  4NQW B;  3OYB A;  4BDZ A;  2MAB A;  3OBT A;  1V5G A;  2A6T A;  2V26 A;  3RTR A;  4HST A;  2R7V A;  2CV2 A;  4JQ0 A;  3S8P A;  3S32 A;  1PUM B;  3OIP A;  4X3A A;  1FWV A;  5BVP I;  4RLF A;  3JUT A;  4G6T B;  2LC2 A;  4F34 A;  3A1Y A;  3UD9 A;  4DCK C;  1DGW Y;  4XN0 A;  4Q91 A;  2NP0 A;  4E4H A;  2X85 A;  1VZ0 A;  2D22 A;  1WJD A;  4END A;  1ISW A;  2K5C A;  3VDX A;  1BLA A;  4U7B A;  2LY1 A;  2KP6 A;  3P6I A;  1DZC A;  1T0F C;  4C2U A;  3OYM A;  3W9T A;  3AH1 A;  2DCE A;  1QQL A;  4I4Y A;  1FV3 A;  1IRX A;  1D0Y A;  5D63 A;  2WA0 A;  1JT3 A;  1PJR A;  4II3 A;  3AL0 C;  2YUG A;  4YEJ A;  5F90 A;  1OLT A;  3UNG C;  4YOL A;  3ZC8 A;  3MMY B;  4HRI A;  4JKX B;  3LSK A;  4PJL A;  4IY8 A;  4ZOT A;  2VLC A;  4KIS A;  2VPL A;  4PUS A;  4LIV A;  3W2A A;  4F3Q A;  4OEF A;  4XLE A;  4JKQ A;  2CMP A;  3FJA A;  3MKY B;  3M1C A;  1BLD A;  1YYN A;  4DJA A;  2KI6 B;  2Q1Z B;  2GO2 A;  3ZXS A;  4FAS D;  3FJC A;  3AJ5 A;  3OBR A;  2MC2 A;  5BXP A;  3LSG A;  4I1E A;  4H75 A;  3VT1 A;  3OJV A;  2P0W A;  1Z21 A;  4QAL A;  1V6W A;  1ONK B;  4QD2 C;  2KDO A;  4LO7 B;  4G6J A;  3VSL A;  1X1D A;  4IZX A;  2LH9 A;  4BE1 A;  2VIX A;  2RG9 B;  3WO2 A;  3QR5 A;  3CAH A;  1M16 A;  3BB2 A;  3OYD A;  1WBA A;  3MKW B;  3PJR A;  3PNT A;  3BCA A;  2HQA A;  4E6K G;  3SZG A;  3O4A A;  1U0J A;  2IGO A;  1HA8 A;  1J0S A;  4ZBV B;  2DT6 A;  1AF9 A;  3FJH A;  7I1B A;  3K4B A;  2R7T A;  4Z8S B;  4HPQ A;  3WIN C;  3FHN A;  3QYF A;  4EB2 B;  3QYE A;  5FZY A;  2W7N A;  4AU7 A;  4BEH A;  2R7X A;  1P63 A;  3FJD A;  2VXR A;  2NYY A;  2FO1 A;  4XKC A;  2ZXH A;  3BRG C;  3OJ2 A;  3BG7 A;  3FUO A;  2X51 A;  4HR6 C;  2F2F C;  4H4K C;  4IQP A;  3IAS 2;  2UWM A;  2VSA A;  2ZR1 B;  3OIQ A;  2CW7 A;  1UPS A;  1S0G A;  3SNV A;  3OYK A;  2IHO A;  3R4U A;  1FMZ A;  2L7K A;  1IOB A;  4Q9P A;  1E0E A;  3POK A;  3V0B B;  1FQ9 A;  1OQL B;  2F8X C;  4GAI A;  1G8X A;  3SDB A;  1EVT A;  2VXT I;  3BAO A;  2GZB A;  1DP3 A;  1G82 A;  4G9M A;  1X19 A;  4ZTF A;  2J3P A;  2HWA A;  4DBR A;  3AKF A;  4IHZ A;  2K8R A;  4LO1 A;  2I1B A;  4BJ5 C;  5E24 E;  4CCO A;  3CRH A;  1IT0 A;  5FZU A;  3NJ5 A;  4LG3 A;  5KHD A;  4RM3 A;  3N7L A;  3PG0 A;  1PUU B;  1ISX A;  4ZFY B;  3UD8 A;  3OGG A;  2VUA A;  3E1S A;  2XF6 A;  4J2S A;  3MPP G;  31BI A;  1FV2 A;  3OOU A;  1S9H A;  5D61 A;  5EHA A;  3K10 A;  3DQV C;  4JRA A;  3S3N A;  2WY7 Q;  2ZQN A;  4XNF A;  2M49 A;  1LVK A;  1LFP A;  2V7F A;  4I7I A;  1MW7 A;  5LFA A;  5BXS A;  1G9D A;  2VB6 A;  1ISY A;  2DJI A;  2AQF A;  5F8Y A;  2R7S A;  2R7U A;  2W1O A;  4P0K A;  3N7M A;  5BQU C;  1JTC A;  4B43 A;  1D1A A;  2V6E A;  3Q7Y A;  1K6Y A;  1PZZ A;  2MLL B;  3AKZ A;  1FWU A;  1R8O A;  2WB1 A;  3DPL C;  2M0M A;  2P23 A;  4G1R A;  1MMN A;  2UUZ A;  3CA6 A;  1D0Z A;  2E60 A;  1DIW A;  3CA3 A;  2W82 A;  1NG6 A;  4XMY A;  4AN7 B;  2R4G A;  3OYH A;  3OWT A;  1W3F A;  3HPH A;  4LIU A;  3GBG A;  1IRA X;  1QQK A;  3CA0 A;  4P0J A;  1JT5 A;  4GOV A;  3FBN B;  4PK4 A;  2IWT B;  5FNW A;  2KPM A;  1MMG A;  1HKN A;  3NBE A;  4A7Z A;  3FJF A;  1MC9 A;  2CFO A;  1DQG A;  3C2H A;  2X6X A;  2HWM A;  1Z3X A;  3BAV A;  3VYS B;  3EPZ A;  4LO2 C;  2W00 A;  2BEB A;  2KH2 A;  2Z2S B;  1WJE A;  2LOO A;  1QHH D;  3L2R A;  3A23 A;  1Q04 A;  2E1M B;  3OR1 C;  1RG8 A;  3P6J A;  3ZRG A;  4F52 A;  2K3P A;  3PUB A;  4CUG A;  5FNX A;  1S0B A;  1X4O A;  4F55 A;  2L2O A;  3UD7 A;  5HVQ C;  3V79 C;  2X6W A;  5EG6 C;  3HKZ A;  2AQE A;  2JA2 A;  2KRC A;  4E7J A;  2VL8 A;  1N75 A;  1I1B A;  2IS4 A;  2VJ5 A;  4I4O A;  1K5U A;  3RSJ A;  1DFQ A;  2CV1 A;  3IIR A;  4MZH A;  2KZV A;  1GLN A;  3HG9 A;  1AFC A;  4XOT A;  1BFC A;  4CH7 A;  3UR3 C;  2BVL A;  4XM3 A;  4ZJZ A;  1S0E A;  3F62 B;  3OYI A;  4ZKT B;  3AL0 B;  2E4M C;  2X2S A;  4GP0 A;  3T8S A;  2XSJ C;  5CKT A;  4BE2 A;  4QBV A;  2Y9F A;  3OS2 A;  3UJ4 A;  4HNU A;  2V4J C;  3FJ8 A;  4PC4 A;  3S8K A;  2KMU A;  3F9K A;  1BR1 A;  2CV0 A;  3FUQ A;  1OR7 C;  2DRY A;  4C30 A;  4Y33 A;  1WFX A;  3NBN A;  4ZTJ A;  3NWS A;  2Z16 A;  2VJI A;  1FN0 A;  1DQU A;  1ABR B;  2PJR B;  1I1E A;  2LBF B;  3OYN A;  5FRN A;  3HOM A;  3E0J B;  2CW8 A;  2MFZ A;  5BXT A;  3HUG B;  3H5A A;  3LMM A;  3BRD A;  2R9K B;  4IQJ A;  1EYL A;  1BAR A;  2MC4 A;  3BC8 A;  2NM1 A;  2RQ9 A;  3OYG A;  1EA3 A;  1TZL A;  4D0Z A;  3Q7X A;  1TTU A;  2V1N A;  1X4P A;  1W3A A;  1DQO A;  1MD6 A;  3ILA A;  4CA0 A;  2M7A A;  3WO4 A;  3I29 B;  4OWL A;  2Q9X A;  3TC2 A;  3A21 A;  3H6R A;  1W36 C;  1ISZ A;  1RML A;  4BE0 A;  2NTD A;  2QN4 A;  3DLA A;  1LKX A;  4EKX B;  3A22 A;  1SFK A;  4RM2 A;  4ZDL A;  2WY8 Q;  4XOP A;  3CJQ B;  4RLQ A;  1AVW B;  2K4A B;  3FJI A;  3BA4 A;  1SAU A;  4BQQ A;  3HAL A;  1RY7 A;  1BFG A;  1WBC A;  4Y4R A;  4CCK A;  3MD2 A;  4YRV A;  5F8W A;  2A5W A;  4QC4 A;  5FRO A;  1BFB A;  2L9S A;  1YTO A;  5HNH A;  4I3N A;  2JUG A;  3RMY A;  1JY0 A;  4LO1 C;  4OW4 A;  3RPU D;  2FFU A;  1ITB A;  3OS0 A;  3AH4 A;  2D1Z A;  4LO3 A;  2KLL A;  3I3L A;  4PJM A;  2LIQ A;  2ZXI A;  3LLP A;  3HMY A;  1SZ6 B;  4OEG A;  1HWM B;  1Z2V A;  5HNF A;  1JT4 A;  2X2T A;  1HCE A;  2KL4 A;  4XQF A;  2XAU A;  3ZR8 X;  4ITV A;  3LFU A;  4HEA 2;  3H5N A;  1BOB A;  4XR6 A;  2VJJ A;  5KCM A;  2Y9W C;  4IZE A;  4KEJ A;  3N7K A;  3PNV A;  2Z48 A;  4XKB A;  3NWT A;  4AN6 A;  1S0L A;  3UDA A;  4BUP A;  2AAI B;  3D5R C;  1N78 A;  4NNJ A;  2ZQO A;  4HJJ A;  4OAY A;  4D1Q A;  1L2H A;  1S0C A;  4ZGR B;  2D44 A;  3AZV A;  3BRF A;  3K4J A;  2L9N A;  1MND A;  4GP3 A;  3K4C A;  2RQQ A;  4R6U B;  3IM7 A;  2JSP A;  1W36 D;  4KC3 A;  2HW9 A;  3IAM 2;  1CVS A;  3BCB A;  2JVG A;  4PJJ A;  1V6X A;  4LO8 B;  1WJA A;  2D7I A;  3BAU A;  4BQO A;  1EPW A;  3Q7W A;  4I1B A;  5BXR A;  3H6S E;  3OYA A;  4X38 A;  2KQR A;  1JLX A;  4LO0 A;  4E7S A;  4I4S A;  1QXM A;  3DU5 A;  2LIE A;  1HWP B;  2E5N A;  3E8L C;  2OUM A;  4XL9 A;  4CCN A;  1PC8 B;  3AZW A;  4XFT A;  1WJB A;  2WAD A;  2FGF A;  5BP5 A;  4ION A;  4ISR A;  4XFS A;  4ZDO A;  4BQN A;  4R79 A;  2Q3N B;  1ZEL A;  2NVH A;  1E0O A;  4BL0 B;  3BLY A;  3ZX7 A;  2RRE A;  3KYL A;  4Z9W B;  1HWN B;  3FJB A;  2F5V A;  4I4U A;  3ZXD A;  1AVX B;  2WAE A;  3WO3 A;  4YEL A;  4H9W A;  4MZG B;  4PFO A;  4BGD A;  4PSX A;  3VSK A;  1WJC A;  4ZFU B;  2W4S A;  3CMM A;  1FMV A;  4XLA A;  2LBF A;  2VXZ A;  3A4C A;  4IKF A;  3DKY A;  2HZD A;  3R4S A;  3OY9 A;  1ISV A;  5CQE A;  1YBI A;  2HPI A;  1NZK A;  4KIT B;  2Z49 A;  2BOL A;  1YX5 A;  4KT6 A;  4JPZ A;  3BA5 A;  2KHM A;  1PWA A;  5F8S A;  2HVS A;  1V6U A;  4L4H A;  4II2 A;  2DRZ A;  1Z3Y A;  4GOY A;  4F83 A;  2R7R A;  2IGK A;  3OS1 A;  1QU3 A;  2DOA A;  2K43 A;  3K70 C;  4OAZ A;  2ERM A;  2NZ9 A;  4CJM A;  1SR4 A;  2LY2 A;  4P6A A;  3HBW A;  3CRI A;  4IZZ A;  3L2W A;  1S0F A;  1Q1U A;  2Y0S A;  3WIN A;  3O4O A;  3CA5 A;  2VQH A;  1BA7 A;  3H35 A;  2RST A;  3PL8 A;  2ZSI B;  2KI4 A;  1IRP A;  1TWM A;  2LG4 A;  3D5L A;  4E7Z A;  3ZC9 A;  2K9L A;  3H9J A;  2AXM A;  4I4P A;  1QHG A;  3K4K A;  1D0X A;  2HVR A;  1D1C A;  4PFP A;  5BOW A;  2WAF A;  3VWB A;  3OMY A;  1TP0 A;  3AKH A;  4D8H A;  1N77 A;  2F2F A;  4HNT A;  4TLP A;  2D7R A;  4B47 A;  3JRR A;  4OEE A;  4ZA3 B;  5JHF A;  1W3G A;  2F4I A;  3K4L A;  1II4 A;  3L2U A;  3AH2 A;  4EEE B;  1R6R A;  4XLC A;  3AKI A;  1BR4 A;  2KLO A;  2F6C A;  1AVU A;  5DSS B;  3IM6 A;  4NC7 A;  4N4O B;  2X6Y A;  4JAW A;  2Q2E B;  3C2G A;  5TGT A;  1WD3 A;  3H6Q A;  1MMD A;  4PJN A;  3FDY A;  3VT2 A;  3CJR B;  4NUB A;  3SYT A;  4IY9 A;  3SEZ A;  4QKS A;  4JP0 A;  2VQC A;  3IAG C;  3L2Q A;  4KBB A;  3QOE A;  2BW3 B;  1IIL A;  3OL3 A;  1T9F A;  2DRE A;  4MLO A;  1Z4S A;  2UUS A;  3OYJ A;  4ISQ A;  1WJF A;  2IS2 A;  4LO3 C;  1FMW A;  4CCJ A;  3PNY A;  4XFU A;  1KON A;  4I2S A;  1D0H A;  1DLL A;  5B2H A;  3CA1 A;  2HPM A;  2QYI B;  5JMC A;  5CPR B;  4I0Y A;  8I1B A;  4Y3O A;  2MD0 A;  2OV7 A;  4HSR A;  2DXI A;  3O4D A;  1NUN A;  3I2A A;  3EUH C;  3AFH A;  3MKZ A;  2ZFU A;  2E5Z A;  3FBI B;  4AYB A;  2D20 A;  4LIT A;  3V0B A;  3O3Q A;  5HLT A;  3CA4 A;  3DEE A;  2HU9 A;  4XLH A;  4KEI A;  3M8J A;  3PSI A;  4BDY A;  3L2V A;  4QD2 B;  2WRY A;  3D5S C;  3DPU A;  4FVV A;  2E1M C;  3RSN A;  1F31 A;  1P9Q C;  3FJJ A;  2M7B A;  4X37 A;  4DGW B;  1Q03 A;  3U21 A;  2KKI A;  3BX1 C;  3CF2 A;  1D1B A;  3OYC A;  4A7Y A;  3QYB A;  5GAQ A;  4BAC A;  4I4R A;  4LO0 C;  2LRD A;  2VKD A;  4EFP A;  2IGN A;  4ZC3 A;  3PHZ A;  5HPZ A;  4LO2 A;  1S0D A;  3K4N A;  4HA2 A;  1X1B A;  1YXW A;  5CQG A;  2FFV A;  5D62 A;  2JVH A;  21BI A;  3D7W B;  5BP5 C;  4ZLB B;  3FJ9 A;  3RTI B;  1BFF A;  4L4I A;  2HDW A;  2VSE A;  1WJ5 A;  4KJZ A;  3BA7 A;  1XZZ A;  1G9A A;  3K1X A;  3RQ4 A;  4CCL A;  3QYD A;  2L5Q A;  3I2X A;  4I4X A;  3EF2 A;  3N0K A;  3TBI A;  1HIB A;  3J7A Y;  1TFM B;  4DBQ A;  3PSF A;  9ILB A;  3V0A B;  4AVZ A;  5DZU A;  1XG6 A;  4HG2 A;  1XHB A;  4EFQ A;  3VUO A;  1TIE A;  1J09 A;  2XOA A;  3FKJ A;  2ESU A;  2DS0 A;  5I1B A;  4I6I A;  1MMA A;  3KEY A;  2E4M A;  2ELJ A;  4QBC A;  1YF8 B;  4I37 A;  4D9J A;  5KNL A;  4J2Y A;  3CZ6 A;  2HNH A;  3N7J A;  3FJK A;  4MZF B;  5EC5 A;  4C2T A;  3C9Z A;  2VJ4 A;  4JQF A;  2KRH A;  4G9N A;  4JOM A;  2XF7 A;  1UAA A;  2CUJ A;  2V9K A;  1NG7 A;  3IP4 B;  1ILR 1;  1FGA A;  3VEQ A;  1EV2 A;  4IQ4 A;  3G2B A;  4G6M A;  3NBD A;  3LTQ A;  3OR2 C;  1RZO B;  3CQA A;  4XKW A;  4X0G A;  5LD2 C;  1SR4 C;  4QO3 A;  4E7I A;  1Z0H A;  2ZSH B;  2X1C A;  1IHK A;  3CU1 B;  4ZFW B;  4B44 A;  1VCL A;  2LRE A;  4B3X A;  3CP2 A;  4UY4 A;  2P39 A;  4P1W A;  3A2K A;  2HVQ A;  4C9Y A;  4ZDP A;  2CS3 A;  3VSZ A;  2Z1D A;  2D43 A;  4E7L A;  1A8D A;  4I4V A;  5HOO A;  1MNE A;  3TMO A;  41BI A;  3CP8 A;  2VLA A;  4GAF A;  1KNM A;  2NS2 A;  3CES A;  2VAS A;  3HPG A;  3O4C A;  3TL4 X;  2FUG 2;  3HL2 A;  2BW3 A;  4D0T A;  3VYR B;  3HC7 A;  4OWJ A;  1DJS B;  2VXD A;  1T4Q A;  3EUA A;  4II0 A;  4FET A;  3PME A;  2AQZ A;  2HZ9 A;  1TOO A;  2GOM A;  2GOX B;  3I9V 2;  2MYS A;  4BJT A;  1Y56 A;  3OGF A;  4B48 A;  3VYT B;  4BJ6 C;  2XDV A;  4BXF A;  3LL7 A;  3FJE A;  3CRG A;  3LSI A;  3F1R A;  4USO A;  1IJT A;  3KX2 A;  1V6V A;  4LO7 C;  1T95 A;  4DEN A;  3RTJ B;  2PJR A;  3H6R B;  4E7K A;  2X1E A;  3ZCO A;  3H9Q A;  3DTE A;  2DT7 B;  1ERD A;  2BVM A;  4F92 B;  4DIQ A;  1TT0 A;  2BEA A;  2PMZ A;  3BAD A;  1WD4 A;  3LSM A;  6I1B A;  3OYL A;  1DGR M;  4CZC A;  3DPT A;  2IGM A;  3WA1 A;  4I96 A;  2VKH A;  1AA7 A;  1X1C A;  4NC8 A;  3BG6 A;  3DTK A;  4BU2 A;  1Z7L A;  1JI8 A;  1UEL B;  3DWL E;  2R7W A;  4E7H A;  5JLV A;  1G9B A;  5FRM A;  3OL4 A;  1DZD A;  3OJM A;  4IX7 A;  3V42 A;  1N4K A;  1GGP B;  3VT0 A;  1Y6I A;  1G59 A;  2MIB A;  4I4Q A;  4P0L A;  3FGM A;  3N05 A;  3ONQ A;  3OYE A;  2QKM B;  1JLY A;  4EFR A;  4J00 A;  1AXM A;  3H5R A;  4QPQ A;  3BAH A;  3QOD A;  3KMV A;  4U87 A;  4WBC A;  4OWR B;  1BAS A;  3ZGK A;  3B9U A;  2VU9 A;  3AJ6 A;  2LYC A;  2O5R A;  1K5V A;  2M4G A;  2K9M A;  2X1D A;  3HOT A;  3MAL A;  3O49 A;  4QKR A;  4J01 A;  2RNG A;  2FDB M;  4A7K A;  3S8J A;  4J23 B;  1YX3 A;  3AKG A;  3HN1 A;  1HCD A;  1DFC A;  4USP A;  2D24 A;  4CSW A;  3UJ0 A;  1BR2 A;  1XYF A;  3P53 A;  3W2V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...