3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
b'VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 30kDa protein
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
molecule tags Unknown function
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
2DS0A 1PWAA 1ONKB 5D61A 1BFBA 3CA3A 3AJ5A 2FDBM 2L5XA 1F31A 1PC8B 5BP5A 1L2HA 2Z48A 5DSSB 3FUOA 1SR4C 2X2SA 3CRGA 3BAQA 3O4CA 1EV2A 1NUNA 4LO3A 3UD9A 4AN7B 3BX1C 1FWUA 2VSAA 4EFQA 3ZC8A 4IHZA 2XOAA 1JLXA 2KLLA 3FJBA 2KH2A 4LO1C 3H6QA 4GAFA 1CVSA 4D8HA 41BIA 1WD4A 4EEEB 4KC3A 3CU1B 1P63A 4J23B 3S8JA 4EFRA 1JQZA 3T8SA 4OUJA 2BEBA 3IIRA 2VUAA 2FFUA 3FFZA 1XZZA 3VWCA 3IM7A 1MC9A 4LO7B 2AFGA 4IZEA 4I4VA 1YXWA 3RSJA 3F62B 5JMCA 3OGGA 1PUMB 3CAHA 4L4HA 4G9NA 4JRAA 4J2KA 2RG9B 1DZCA 1WD3A 4LO2C 1DQOA 2Q3NB 4KBBA 4LO0A 2D22A 2Y9GA 1BFGA 4P6AA 4X3AA 4J2YA 3AZWA 5BXRA 4Z9WB 4J2SA 3N7JA 3Q7XA 3KMVA 3QYDA 5BP5C 3BRDA 4LO3C 4D0TA 1K5VA 1D0HA 3NBNA 1DQGA 3VEQA 3POKA 4F34A 1J0SA 1S0GA 3FJIA 4OEFA 4IYBA 3BA7A 3N7LA 4ENDA 5FNXA 3OBRA 3CA6A 4R6UB 4QBCA 1VCLA 2AQZA 3CA5A 3OBTA 4I8MA 21BIA 2BFHA 4JQ0A 1G9AA 1HIBA 3A21A 2M49A 4Q9GA 4OW4A 3S8KA 2K8RA 3CA0A 4ZLBB 4GP0A 2FGFA 2DRYA 3N0KA 3UDAA 4GOYA 4QBVA 5HPZA 3O4OA 2MC2A 3ZC9A 4FVVA 4ZGRB 4JKQA 1JY0A 1WBAA 2ZQNA 1BFFA 4LO0C 4I4YA 2NP0A 4I4XA 1M16A 1JTCA 3B9UA 9ILBA 3D7WB 3F1RA 2NYYA 5E24E 1AF9A 4ZA3B 1A8DA 4I0YA 3BAHA 4ZFYB 1TP0A 2D20A 2VSEA 5BVPI 4ZOTA 1AVUA 1JT4A 5DZUA 1JT7A 3FJCA 3E8LC 3LLPA 3O49A 3PHZA 4OEEA 3AJ6A 3JUTA 2LIEA 2D7IA 3ZX7A 4P0LA 4H9WA 4I4SA 1S0BA 5FNWA 4I4UA 3UD8A 5F90A 4IONA 3BAUA 1IRPA 4I96A 4CJMA 1I1EA 4OWJA 3FJHA 4QKSA 3C9ZA 4QC4A 2HWAA 2LIQA 4QKRA 2QN4A 2WBCA 1IILA 1DLLA 1ISYA 2I1BA 5DVHA 5BOWA 2IHOA 1IJTA 3UJ4A 4GAIA 5FZYA 3VSZA 4OWKA 2AXMA 3P6JA 2NM1A 1G9DA 3RTIB 1AXMA 4IZXA 1T9FA 4IQPA 1BFCA 4JAWA 3MALA 3FGMA 4I2SA 4LO7C 3V0AB 3CRHA 4PC4A 1BA7A 4ZBVB 1JT3A 4DEPA 3BRFA 3BAGA 1V6VA 4X39A 1HCEA 3WINA 3CA4A 3JRRA 4HR6C 4OEGA 4QD2B 2P39A 3PG0A 2VU9A 2MIBA 3O4DA 3Q7YA 4I4OA 1FGAA 3VT0A 5F8SA 4Q9PA 2J3PA 1DFCA 2ET2A 4USPA 3R4SA 3PMEA 3I2XA 3OJMA 2KI4A 5BXPA 4F83A 4X37A 1ISXA 7I1BA 1S0FA 1XYFA 1IOBA 3EF2A 4A7KA 1FMMS 3FJDA 3AKHA 3RTJB 3FJ9A 3CA1A 2F2FA 3AKGA 3VT1A 1I1BA 1OQLB 3V79C 4LO8B 5D63A 1JT5A 1S0DA 1HWPB 3MPPG 4A7YA 4KEJA 1GGPB 3IM6A 3O4BA 4USOA 1TTUA 3ILAA 5EG6C 1FV3A 3AH2A 2HW9A 3R4UA 1JLYA 5DUYA 4A7ZA 3AZVA 4OWLA 1EVTA 4I1BA 1ISVA 1MD6A 2NZ9A 1S0CA 5F8YA 1YTOA 3OJVA 4I4PA 4DENA 3ZXDA 5BXSA 3WINC 2ESUA 1G82A 2R9KB 2WRYA 3FJEA 3V0BA 3H6SE 1UPSA 4P0JA 1G9CA 4EKXB 3FJAA 3AH4A 1QQKA 3V0AA 2D44A 4TLPA 2Y9FA 4I37A 1IT0A 1RZOB 3A22A 1N4KA 4I4RA 1FQ9A 3OJ2A 3WO3A 2GO2A 1ABRB 1DFQA 2RSTA 4I4QA 3UD7A 3VT2A 5JLVA 1RMLA 2P23A 3FJ8A 5F8WA 1Z0HA 1ILR1 3BRGC 2BEAA 4I1EA 2VLCA 3BAVA 1DIWA 4XFSA 2F2FC 3RMYA 1AVWB 4ISQA 2K4AB 1V6XA 3O5WB 1HWMB 1QXMA 3P6IA 3HOMA 1FMZA 4I6IA 3W9TA 1TFMB 4YOLA 3N7KA 5BQUA 1R8OA 2E4MA 3BTAA 4QALA 1BLDA 2RQ9A 1K5UA 3RMXA 3WA1A 4I7IA 3CQAA 4I3NA 1YBIA 3O3QA 1FV2A 3O4AA 3BAOA 1ISWA 5BXTA 3V0BB 1TWMA 1S0LA 2Y9WC 1PZZA 4P0KA 3QR5A 3IAGC 3BA4A 1XG6A 2ERMA 2X2TA 3AKFA 4IY8A 1Q03A 1Q04A 2QYIB 3H6RB 3FUQA 2Z49A 1PUUB 4JKXB 3K1XA 3A23A 1ISZA 3LTQA 4JPZA 4XFUA 3BADA 1IRAX 5G00A 1YF8B 1W3AA 3HBWA 4Q91A 2VXRA 3AKIA 3HN1A 2YUGA 1BASA 1RY7A 1KNMA 3VSFA 1HCDA 1BLAA 1S0EA 1RG8A 4QD2C 2D1ZA 3WMVA 4XKIA 4GOVA 1ITBA 1V6UA 2FFVA 2KKIA 2AAIB 1AVAC 4ZKTB 1TOOA 2VXTI 3WO4A 3ZXGA 4L4IA 1W3FA 1II4A 2NVHA 4XFTA 3FJKA 1WBCA 1IHKA 5FZZA 1R8NA 2ZR1B 3SNVA 5B2HA 4AN6A 5BQUC 2E4MC 5EC5A 5EHAA 4KEIA 2D7RA 2DREA 1AFCA 4X38A 1DJSB 1BARA 4Z8SB 4WBCA 1E0OA 1HWOB 2F8XC 2UUSA 4D0ZA 1W3GA 4H04A 1EYLA 2MLLB 4II0A 4EB2B 4ISRA 5GAQA 2D23A 5FZUA 4GP3A 4JP0A 1T4QA 1FN0A 3I2AA 1G9BA 4ZFWB 3VUOA 3O44A 3P53A 5D62A 3HMYA 3IM5A 1SR4A 1M2TB 3FJJA 3BA5A 4G6JA 8I1BA 4HA2A 3TC2A 4DCKC 1HKNA 1NZKA 1CE7B 4G9MA 1TWEA 3N7MA 4IY9A 1QQLA 3HALA 4LO1A 1SZ6B 4HJJA 2D43A 4EFPA 2DRZA 3UJ0A 1YYNA 2Y9XE 3AH1A 3NBCA 3H6RA 4G6MA 2ZQOA 1DZDA 1XHBA 3WMUA 1Z4SA 4QO3A 4J2XA 3NBDA 1TIEA 2NTDA 1Q1UA 2FO1A 2D24A 1AVXB 2HZ9A 3Q7WA 3OGFA 2HWMA 2Q9XA 31BIA 2IWTB 4KEKA 3NBEA 2KI6B 3FJFA 1FWVA 4FGFA 3A07A 4G1RA 2K43A 3HSMA 1EPWA 3I29B 3PUBA 3NJ5A 4ZFUB 5I1BA 3WO2A 2GZBA 3CRIA 1HWNB 4LO2A 6I1BA 1Z2VA 1V6WA 3BB2A
chains in the Genus database with same CATH superfamily
1PWAA 3CLOA 5HDNA 2A68F 2HTSA 2LBFB 4LK1F 4RMNA 3CA3A 4U0VA 2DQLA 1T8IA 2E19A 5GPAA 1L2HA 2IA2A 1B4AA 5DEQA 3FUOA 2BZTA 1DDNA 2FMYA 4ZC3A 1SR4C 2X2SA 3CRGA 2FXAA 3LSHA 4MEYF 2QBYB 4AN7B 4KN4X 4LK0F 4G7ZF 1OISA 3BDDA 2NS0A 1A6IA 4QPQA 3KP2A 3TP3A 2CV2A 4XOTA 1G6NA 3L7WA 4LMYA 5DS9A 1JLXA 2XKPA 4HG2A 1ZHFA 3KZZA 3H6QA 1QNTA 2WAEA 2HS5A 2FUG2 3AAFA 4EEEB 4KC3A 3E7LA 3IWZA 2W7NA 1IN4A 2Z33A 3S8JA 1OCPA 3T8SA 3HGYA 2WV0A 3CCJI 3I4PA 3B73A 1PUEE 4YELA 4Y3OA 3FFZA 3CMEI 2FRHA 3SXYA 3DBHB 3CCUI 2DXIA 1G3TA 4IZEA 3M07A 2OF7A 4ANJA 3NEUA 3F22A 2XVCA 3CDHA 1IXSB 2LSOA 2IT0A 1WJEA 3TOBA 2CYYA 1XPXA 4L4HA 3CUQA 3SZTA 3WE3A 4JRAA 4FASD 4QTRA 4YIIA 1JHFA 3IC7A 1BJZA 2DA4A 3FXUA 3BC8A 4I98B 3BG5A 3CC7I 3MFKA 1FWZA 1SFXA 4KBBA 2DCEA 4P9FA 3SHFA 5EG0B 2LDUA 5HS9A 2D22A 2K02A 1R9TJ 1Y1VJ 3PIOF 1QRYA 4HNTA 4CSWA 1K7AA 1FC3A 2WB1A 3ULQB 3UKGA 2L7MP 3E97A 2KJCA 3QQAA 4XSZF 2LRDA 3PSIA 1YX5A 3ZMUA 5B3SH 5JVGF 4A0XA 3NAUA 2NS7A 4A2UA 1DQGA 1VQMI 5E3MA 2LYCA 5LGTA 1XMXA 2KKOA 1J09A 3CP8A 1LQ1A 2NVXJ 3HM5A 2I5UA 3BA7A 4IYBA 3H9QA 4ENDA 5HNHA 1E3PA 4R6UB 1YE9A 2V9VA 4LOCA 2VONA 1D5YA 1MMGA 2Z99A 5KNLA 2ELJA 4LITA 3RDIA 1RKTA 3A21A 4FE4A 3G73A 2HYJA 3N05A 4K2EA 2VJ4A 2X85A 2K85A 1XCVA 1R22A 3EYIA 3Q0WA 1FYLA 2M34A 2MA3A 3CCMI 2H27A 2R7UA 4GP0A 4HX4A 1WJDA 3CCSI 1VTNC 1IUFA 1R1UA 2Y2ZA 3CUQC 5HPZA 1SFOJ 2OTJI 3CO6C 3WTXC 3JSPA 4L18B 4A3LJ 2DDAA 2X48A 2ZC2A 3FIWA 5DCMA 1TNTA 3WTUC 4Y52J 1WBAA 2ZQNA 3BZ6A 1JHHA 2FF4A 4JOMA 2LC2A 2NAZA 3DKXA 4W97A 3GLLA 2NP0A 1Z7UA 3LSKA 1LVKA 4NC6A 4RGXA 3OL3A 3FMSA 1XSDA 3B9UA 9ILBA 1RC9A 3I58A 2MD5A 3HSFA 2ELHA 2NVYJ 1TWGJ 2DA2A 1SANA 2PMHA 1Z7LA 1TNSA 4XKVA 3FF5A 5E24E 1AF9A 3F8MA 4I0YA 1MNMC 5FGMA 1JUSA 3BAHA 4ZFYB 1QPMA 2KLOA 3KCCA 4E7KA 2D20A 4UUTA 4KISA 1JT4A 1W7PD 5FKNA 1HA8A 4CGZA 4F52A 1N77A 2W85A 3MZ8A 1NHAA 4KN7X 3FMRA 1OCZH 4CCOA 5K7HA 2ZNZA 3LLPA 3D5SC 5D8KB 1R49A 2DQRA 1O7LA 1J7KA 1S6LA 2Z16A 1HBXG 2V1UA 2PJPA 2D7IA 2AXTC 4H9WA 4P0LA 5FNWA 1X1PA 2HR3A 4YFNF 2ID3A 2LP0A 2P7CB 1XGMA 2DYRH 3HRTA 1X58A 2JTVA 2ZFUA 2MBFA 2GZWA 2MSYA 3CJNA 3BAUA 1DGWY 3IL2A 2RNGA 4CJMA 3HRUA 1KQ0A 1G3SA 2FOKA 3R0JA 1SAXA 2IW5A 3BR6A 4QC4A 3H0DA 3WHCA 5D5UB 4DBRA 2DOEA 4OIPF 2KISA 3KE2A 2QZ8A 2QN4A 2GA1A 3FBNB 3OYDA 3P9CA 5EZHA 1ISYA 5BOWA 2VOPA 2IHOA 1N78A 3V8KA 4Y17A 3CQZJ 2AS5F 5FZYA 3A0HC 4UVAA 3H35A 5A2QZ 4M71A 1YHQI 3VSZA 3S3MA 2ESHA 4IQPA 1FP2A 1BFCA 4A3EJ 3WU0A 3ZQCA 3GTPJ 4I2SA 1I6XA 3BTLA 2M3AA 3DTIA 3I4MJ 1BA7A 1FMVA 2UUZA 2VQHA 3C18A 5IYBJ 1ZAOA 3DWLE 3RZDJ 4DEPA 3I0TA 3BRFA 3JW4A 3E6DA 4U0WA 1W36D 4UNOA 5GP9A 1HCEA 4X39A 5IYDJ 1R5ID 1MMDA 5CVUA 1IUYA 2MD0A 3NWSA 1B8IB 2ACJA 3K70C 5C3EJ 3MKWB 2IGKA 3ZMTA 4C2TA 1ORKA 1HW1A 3GZNB 2IGMA 5F8SA 2J3PA 4XL9A 2MGQA 4M6XA 1KYWA 2YX4A 2X1CA 3R4SA 1D1AA 2VKVA 4BKXA 2K9QA 5L3FA 2KI4A 3T8RA 4F83A 1IGNA 4X37A 1S0FA 5FB2A 4ESFA 5M5XJ 4P55A 3OS2A 1STZA 1FMMS 4HF1A 4N0BA 3HOYJ 3RTJB 3H9GA 3FJ9A 4UV9A 3IH2A 3ZQQA 3CA1A 4RB3C 4CXFA 3AKGA 4IZZA 2D5VA 1OQLB 3SFZA 4LO8B 2HGCA 4XMYA 5FKKA 3E5XA 4A6EA 4BHBA 4A7YA 1YG2A 5D5WB 3IM6A 2DJIA 5EF6A 2OTLI 4RLQA 4AM3A 3RYRA 3AH2A 1K6YA 5ICFA 5DUYA 5CVRA 3S93A 2KL4A 2FBKA 3D0SA 3ROUA 3ZMDA 3QPHA 4CYDA 3CTAA 3ELKA 1FYMA 3KP6A 1YX3A 4DGWB 5LBQA 5F0HA 3S1RJ 1TL8A 3OJVA 2OD5A 3C2HA 5FD5A 2JUCA 3A2KA 1ZLJA 2R7FA 2R9KB 3FJEA 3V0BA 2NOGA 4CHUA 3H6SE 4MZFB 3AH4A 4LG0A 4XQFA 4B47A 1YIJI 3V0AA 1FBSA 1Z67A 2UV1A 1TW2A 3KEYA 1K83J 1MBHA 5LEKA 1S7OA 1XMKA 4UY8I 2EIJH 3HC7A 4XIDA 2QSHX 4UUSB 2JVGA 3K1MA 3OS0A 5F04A 3PNYA 1N4KA 1ZYRF 3SZPA 2XC7A 4F92B 3AG1H 4P1WA 4R1HA 5ICCA 3ABLH 3OJ2A 2IXSA 1A5JA 2Q2EB 2DFFA 3UD7A 3LWFA 3VT2A 2R7OA 5JLVA 1RMLA 2Y0MA 1JKQC 1OKRA 2EQRA 5CKTA 1UFMA 3GBGA 3R0AA 3V42A 1X19A 4YFXF 1G8XA 3FHZA 3F6VA 2RAEA 2RN7A 3G1MA 1DU0A 1AVWB 4ISQA 2K4AB 1LPQA 3O5WB 1X3UA 1S9HA 3N97A 1USTA 1HWMB 5HDGA 1CGPA 3B6AA 3W9TA 2CW8A 4LIVA 2Y31A 1TFMB 3N7KA 2M2EA 1BLDA 2EV6A 2EZLA 2VJ5A 4HQEA 2RQ9A 2JA8J 4Y4RA 2YR2A 4M3FA 2IJLA 1XB4A 3CQAA 4ESBA 1YBIA 1GVDA 1HF0A 1XMAA 1BL0A 3O4AA 1ISWA 2M5WA 4IHSA 3EETA 3QRFF 2IAIA 5F08A 4CA0A 4PFOA 4S0HB 1S0LA 2Y9WC 1MBFA 1QGPA 1YS6A 3DPTA 1PZZA 2NS2A 3F72A 2K3PA 1IN7A 4NDLA 2QM3A 1JTYA 1R23A 4X0GA 1XG6A 3OYJA 4GRIA 4C2MJ 3O2PE 2ERMA 2V26A 3AKFA 4IY8A 5LRSA 2CS3A 3H6RB 4PCQA 4AIHA 3CF5F 2K9NA 1BR1A 2YSRA 3A23A 4XFUA 2R7QA 1VQNI 4B4CA 2W57A 3BADA 3CJRB 1IRAX 5JLXA 5G00A 1W3AA 3L9FA 4LB6B 1RUNA 1FLIA 3KP5A 4AVZA 1IV8A 3K4CA 3VSFA 4CCMA 1OCTC 4OAYA 3TKYA 4S04A 1V6UA 2KP6A 2XSDC 4RLFA 1APLC 1AVAC 1W0UA 2VB6A 2ZJRF 1XDSA 3MVPA 3RI4A 2A6EF 1ZGWA 1SFKA 2BXYA 2NVHA 1IHKA 1BOBA 1XDUA 4C3HJ 1NG6A 2ZR1B 3SNVA 1UCRA 2LREA 4PZJA 3J80K 2L4MA 1B1BA 2KDOA 1K78A 3IKVA 5L3BA 5EHAA 4BHCA 2D7RA 1UELB 3AG4H 2M7AA 4M3GA 4NUBA 4HQMA 3LOCA 4ITVA 4OIOF 2ZJPF 4WBCA 5BS6A 1REPC 1N25A 2QCOA 5ILVA 5KAFC 1P7IA 4JX4A 2MW8A 4GXOA 5CQEA 3WODF 4A3DJ 2VC1A 2XGCA 3BY6A 3C2GA 4EB2B 1JUMA 5GAQA 4XLNF 1UHWA 3VSLA 4OIQF 5EEAA 1T4QA 2COBA 3HPGA 3I2AA 3MKZA 3U2RA 2MC4A 2XKOA 5D62A 2IEKA 3IM5A 1X1AA 3WTYC 3JTHA 1ZGAA 5E17F 2FD5A 3GTQJ 1V54H 3HTSB 3OYHA 2EFPA 2HQNA 1UB9A 2CQ7A 4MQ9F 3RQ4A 1QU3A 3DEEA 4ON0A 4RB2C 5HLTA 4ZYHA 3LSPA 2DT7B 1WWXA 4I0AA 3DPUA 3S16J 3G1OA 3OWTA 2K3FA 1CE7B 1TWEA 2EA2A 2VE8A 4G9MA 5E3LA 1KZHA 2PLYA 4IY9A 3HALA 4L5EA 2F5VA 2L7ZA 4H4KC 2C6YA 4A0ZA 3CUQB 1Q1HA 2FEZA 2ZO4A 2DRZA 4EFPA 3PJRA 2LKPA 1T0FC 1T2KA 2HQAA 1R7JA 1XHBA 2HFHA 2DA3A 4QO3A 3MKLA 3LA2A 1JE8A 2V79A 3NBDA 1TIEA 4G6TB 2H94A 2FO1A 2D24A 3O8GA 3QYBA 2MYSA 4KMUX 5LD2C 1HKSA 3GTOJ 3NWTA 2D2WA 2L9RA 3I53A 3GUDA 1YYVA 4A3MJ 4Q48A 2DN0A 4D0PA 1O3QA 1K61A 2GOMA 2K43A 4HLYA 3HSMA 1J75A 4KDPA 1B9MA 5DTDA 5I1BA 4ZFUB 2GZBA 3LQRA 4LO2A 2ZSHB 3SEZA 3HGGA 4XLHA 6I1BA 4MNUA 3K1NA 4U7DA 2Y69H 4X1EA 4RAGA 4I02A 2DS0A 1ONKB 2RKHA 4XN0A 5JLWA 1T98A 3E3VA 2LY9A 2VPRA 3OYIA 2WBMA 2EBIA 2JRTA 2KIQA 2MLGA 2BY3A 1FBQA 5D4SA 1PC8B 2XIGA 5M5WJ 2ZXHA 5DSSB 5HLIA 3W6VA 2E7XA 4LO3A 1I3QJ 3O4CA 2EWNA 3JRBA 1NUNA 3VODA 1IF1A 1RIOH 3W3CA 4CUGA 4E70A 3BX1C 3MWMA 4L9TA 4BHPA 3FXQA 2HPIA 4OINF 3BG9A 3BR3A 1JI8A 2XOAA 4HV6A 1F43A 4WXCA 2LTPA 3I9V2 2KH2A 3OYCA 4M74A 2L01A 4X6AJ 1CVSA 2PJRA 4MQVA 1WD4A 4UV8A 3IAM2 3Q9SA 1P63A 3CU1B 1TLHB 3OV8A 1DPRA 5DCMB 5KHDA 2VPLA 1IRZA 4OUJA 2GXAA 2VUAA 1L0OC 2JA6J 2WV1A 4BBRJ 2Z9OA 1XZZA 3VWCA 1MC9A 4A93J 3WE2A 2AFGA 1FEXA 4DOZA 4ENMA 4CDGA 1WH5A 1ITYA 2STTA 3RSJA 4ZTFA 3WGHA 3CCQI 3K7AJ 1DQUA 2QKMB 2CV0A 3OGGA 4II3A 3IAS2 4ZYAA 3J7AO 1ZK8A 2WWYA 3KLOA 2RG9B 2K7LA 3W2WA 4HNVA 1Z0XA 5HLHA 4LO2C 3S1MJ 4LO0A 1FTTA 2Y9GA 2DU9A 2F5DA 1BI2A 2DT5A 1BFGA 4P6AA 3J81K 2E34A 2HQRA 4AD9A 1FSHA 1I1GA 3DEWA 3L2WA 5BXRA 4DNCA 1BR4A 3J80Z 4KMFA 1QBJA 1D8KA 4J2SA 3KMVA 2V1XA 5ILSA 3DU6A 1WHUA 3BRDA 1A6QA 2DBBA 4M3EA 1BI0A 4LO3C 2L9NA 3GXOA 3KP4A 2JA2A 5F6FA 3FXRA 1FJLA 3LSMA 3SQNA 5D4RA 2F48A 2K27A 3OSGA 1NH3A 1J0SA 1S0GA 1W5SA 3FJIA 1R1TA 3S1NJ 3TO9A 2OPTA 2AXLA 5FNXA 2BE5F 3CA6A 3RQIA 1C0WA 2GQQA 1HCRA 1X3WB 1VCLA 2O9LA 1WI3A 2AQZA 2DMUA 4JQ0A 2XB5A 1ZR4A 21BIA 1VI0A 2M45A 2Z3YA 3T8TA 2ECBA 1D0XA 1U5TA 5E3NA 2M49A 2EZKA 3A03A 4ZTJA 1WKMA 3BR2A 2H6BA 1MJAA 3S8KA 2XF7A 3TDZC 4C9YA 3GMEA 5CJ9A 3TGNA 1KGSA 3N0KA 3U21A 4GOYA 3BP8A 4XLAA 4CCJA 2RREA 4FVVA 1E3HA 4ZGRB 2K9SA 2V1NA 1YS7A 1IW7F 5CVVA 4CYCA 1EV7A 3BQYA 1VNDA 2VQGA 1K4TA 2BVMA 3DQVC 4LO0C 5K7ZA 4I4YA 3S3OA 5FJ8J 2HNHA 2CFOA 1Y8QB 1TWHJ 5H2FC 3K10A 1FOWA 1ZRCA 3D7WB 1P9QC 1YFHA 1AA7A 4XRMA 2W4SA 2BBYA 3S2HJ 4NBQA 3OYKA 2NYYA 3K4JA 2R7SA 3GTJJ 1H89C 4YIFA 2JK3A 4CZCA 2QVOA 3GVAA 3Q5FA 5BVPI 3IV5A 3TEDA 2CUZA 1XN7A 1K79A 3BPXA 1H88C 3ESWB 3GCMA 2JPBA 1TZLA 1RI7A 1UZCA 3GFJA 1USSA 3ZX7A 4I4SA 1S0BA 2A61A 1ONVA 2ZXWH 4P9UA 3UD8A 4V19K 5EEGA 3KP3A 3ABMH 1IO2A 2LF8A 3CCLI 5E1XA 2DPUA 4N4OB 5F1JA 4IONA 1S5LC 1A04A 4BDZA 4PJMA 1U9OA 2O7OA 1XGSA 1U5TC 2CU7A 4OAZA 1IRGA 3GEZA 1RR8C 4DYRA 2VOOA 4BJ5C 3FJHA 4OWJA 4QKSA 4OOIA 2A5YB 3VFZA 3BROA 1YI2I 4U88A 2BY1A 4MFDA 2HWAA 4J23B 1WJCA 1O57A 3CLQA 2HOTA 1H0MA 1IG7A 2UZKA 1DUXC 2VUMJ 4HAMA 1CF7A 2F4OB 1IILA 2I1BA 4XKCA 1BIBA 2BVLA 3UJ4A 3LSTA 3PSFA 1SVMA 4ZYGA 4IQ4A 1X4PA 4Y7NJ 1W5TA 2DW4A 3KYLA 4GAIA 2W24A 3ISPA 1P92A 4PK4A 2OA4A 3QP6A 1ON1A 2XF5A 1PYVA 1GXPA 1G9DA 3J7AY 3W2VA 1T9FA 3REOA 2OZUA 2DMTA 2NOJB 2EFWA 1EJ9A 1SVLA 3V0AB 1AKHA 4LO7C 1M1EB 2Z2SB 1YJ9I 3CRHA 1D0ZA 1HW2A 1R4NB 1IN5A 2KJBA 1ZELA 2P8TA 2V6EA 3EDPA 2QYOA 3BAGA 1R5GA 3K2AA 1T39A 3BT9A 1V6VA 4YG2F 2H8WA 3OYLA 5EJCA 3WINA 3CA4A 4HR6C 2FQ4A 3G3ZA 4KIFA 4OEGA 3QAHA 3FKJA 4XLCA 1U2WA 3OIPA 5DV5A 2VQLA 3J81Z 3ZOBA 3C1DA 3Q7YA 4A5MA 4BXXJ 4I4OA 1FGAA 5AIQA 5EGOA 2E1MC 4BQAA 4Q9PA 3CF2A 1YW7A 1MDMA 2WAQN 2ET2A 1QQIA 4G9YA 4M9XA 5ERIA 3OYAA 2D45A 4J00A 4QIWN 1MSFC 1ZREA 3IHUA 4BQOA 4V2GA 1J9IA 4DJAA 1O7FA 4XOPA 1V55H 1R36A 5M3MJ 2RQQA 1XYFA 3CO7C 4UVBA 5CPRB 2OC6A 3K69A 3GLXA 1MJ9A 2ETHA 3FJDA 3LSRA 4B3AA 1UG0A 4WXHA 1JJ8C 1MGTA 1P4AA 3C3WA 2M7BA 4C3JJ 1JT5A 2HOEA 4M6VA 5E3OA 3AL0B 3T5XA 1PP8F 2A6HF 4C30A 1GGPB 2XPVA 3O4BA 3FWEA 3F3XA 3HEFA 2BOLA 1WJAA 3R4UA 1SD5A 4BQQA 5KCMA 4LJZF 1VQ9I 4A7ZA 1HW5A 4DYCA 4OWLA 2QKLB 4D5FA 3UNGC 3V8LA 1QPIA 1Y8RB 3BTIA 4L0ZB 2FMLA 2RDPA 1ZGJA 3EQLF 2FOWA 4E7LA 1S72I 3M1CA 1ETQA 3O8HA 2M0CA 2JRMA 3FMQA 4BQNA 2LOOA 3WINC 3WU1B 2R5YA 4I76A 2X1EA 3VYTB 2CJJA 2HI3A 4ENNA 3ZN1A 4NHJA 1IV6A 2G7UA 3GF2A 3GZ5A 1HKTA 2LF7A 2XASA 1A35A 4P0JA 2VBXA 3HB9A 3LMMA 1QQKA 5FLXK 1PUFA 3MZHA 4BEHB 1J59A 2YUSA 1LE8A 4IHYA 4O3MA 3W2AA 3TW7A 3HL2A 4I37A 1UAAA 3JRDA 4L9NA 4M6YA 4I99C 3LAJA 2ZMEA 1K78B 2E1CA 5H6RA 3WO3A 3KIOA 2RSTA 2D1VA 3VB2A 3H36A 2P5KA 2P23A 5F8WA 3V7CA 4GDFA 2BEAA 3E6MA 3KFWX 2AHQA 1XG1A 4CO8A 1DIWA 2VLCA 3BAVA 3BTJA 4DZPA 3RMYA 2Y30A 4J19A 2BW3A 2PN6A 1LNWA 3FXOA 2XPUA 1X1DA 4D7MA 5L3GA 4YFKF 4FQGA 3P6IA 2P5VA 2O61A 3H1CA 1FMZA 1V3FA 5EZGA 4AIJA 1MIJA 2ECCA 3PIPF 3MAJA 5KAIC 1ZG5A 3OL4A 4ENKA 5BQUA 4KUMA 3BTAA 2P7VB 4OMZA 2ELKA 3I54A 3KPHA 1K5UA 3RMXA 1U8BA 5J6XA 3I3LA 2VXZA 4RM2A 1QVUA 4UB6C 2P4WA 3HJEA 3S2WA 3WTTC 3O3QA 1ZLKA 4L9JA 3S32A 2CQQA 2EV0A 4AIDA 3ONQA 1W7PB 1TQIA 1R1VA 4BY7J 3ZMZA 4FX0A 2VJJA 3TO7A 3JRHA 3QR5A 4BUPA 5IP6A 3BLYA 3GFLA 3BA4A 2LG4A 4CCKA 2DFEA 2BEOA 2GOXB 1T33A 4PGGA 4F93B 3F8NA 2X2TA 2ME0A 1MBKA 2Q8KA 2XGXA 4EJUA 1S7EA 1LKXA 1FTZA 5CYVA 2Z49A 4JKXB 4PSWA 1VQ5I 1QHGA 3K1XA 3H5NA 4P5OA 3LTQA 3OOUA 2QF7A 2FJ1A 3ZMSA 3OYGA 3HRSA 4WWCA 4HSTA 4WF2A 3KETA 2R7ZJ 3HN1A 3OMYA 4E7JA 2ZMEC 1RY7A 4HPQA 1AU7A 1S0EA 2X0LA 1RG8A 2DFHA 1IAWA 2KIUA 1EF4A 3L2RA 3OYBA 3FK7A 4L0YB 1Z6TA 4W1UA 4XRSG 4Y13A 3I56I 2L7KA 2FFVA 2EPFA 4YRVA 2XGDA 3D1NI 2R5ZB 1FBUA 4L4IA 2XHKA 5D8LB 2K40A 5E1ZB 3F23A 2P6TA 3J7YJ 1IXCA 1JGSA 2RQPA 1II4A 1WBCA 5LHHA 4MHGA 2K4BA 3VYRB 4EEFG 5BQUC 1LFPA 3OR2C 2WTEA 2DAOA 3TMOA 1QZEA 4D5CA 2WY8Q 4RGUA 4KEIA 5IT9K 2PQ8A 1AFCA 5J8CA 3TW6A 2CO5A 2HYFA 3ZN0A 4G7HF 1DJSB 5J47A 1BBYA 3K4MA 4HEA2 3W6KB 2CW0F 1YJWI 4ZJZA 4BBSJ 3ZQFA 5B1BH 3SDBA 1XCBA 4XLEA 1I1SA 1KQ8A 1W3GA 2MLLB 3IH3A 1FZPB 1POGA 2HVQA 4ISRA 3KZYA 4RS8A 1O3RA 2PJRB 1YOVB 3MCZA 4AUXA 5DDGA 4BJTA 2XV4S 1Y0NA 2LBFA 3O44A 1XSXA 2LK2A 4FT8A 3HMYA 1JT6A 2E2JJ 2WAQA 2HZDA 1B6AA 3BA5A 1UHMA 3ZQLA 4HA2A 5DUIA 3VSKA 1JXSA 2CWEA 3WG9A 1YITI 2STWA 2CH0A 4Y15A 1HKNA 1NZKA 1I3AA 3AKZA 4IHVA 2FE3A 4LO1A 4RM3A 1OCOH 4HJJA 3BWGA 2V4JC 3UJ0A 2Y9XE 2OV7A 5IP9J 4XSXF 2IP2A 2DPDA 4PSXA 3NBCA 4GO1A 2ZFWA 3OR1C 3WMUA 1Z4SA 2QWWA 4IEJA 4OIRF 1ETVA 1JKPC 2NTDA 2XDVA 2DJNA 2VBZA 1AVXB 3WGGA 3HOVJ 3OGFA 3ZGKA 5ILUA 3EUHA 3B6CA 2HWMA 1ETXA 2BY0A 3BR0A 4XKBA 4EATA 4XNFA 1KU9A 3FJFA 1IDYA 1FWVA 3HIFA 3EPZA 5B66C 4FGFA 3JAMK 2XF6A 4ZDLA 2QENA 4A12A 2ZJQF 1EPWA 3DKYA 1LFUP 1WRJA 4HX7A 3WO2A 3H0GJ 2NXNB 2XAHA 1LEAA 1NK2P 3GTGJ 1HOMA 2HOSA 4P96A 1V6WA 3BB2A 1U3EM 5ICGA 5CLSA 5D61A 5EG0A 1MMNA 1BFBA 3AJ5A 2FDBM 4XR6A 2DTRA 2WY7Q 5LLQA 2L5XA 3F9KA 4Q5SF 1ETYA 1XGNA 1WJ5A 2LLKA 1FY7A 1F31A 1WZ2A 5BP5A 3I71A 1S8NA 4Z2YA 3BAQA 1EV2A 1XTAA 4LG3A 1X2NA 2KPMA 1TWAJ 4EM2A 1U9NA 2EFQA 3DLAA 4EQQA 1SEUA 1MBGA 3ZC8A 4KICA 1WGXA 2KLLA 2AQFA 2PI0A 2VIXA 4F55A 2QQBA 1IXRC 4JK1X 3FJBA 4LO1C 3LSJA 4GAFA 2HEOA 2HDWA 2K5CA 3RYPA 1PDNC 41BIA 1IRXA 2DT6A 3JTGA 4CYCB 2LD5A 1SD6A 3LA3A 4BL0B 2BEBA 3DKWA 2E35A 2K9LA 4EJOA 1WJBA 1MH4A 2R93J 1IN8A 4ZDPA 4KNYA 3LSGA 3IIRA 2IS6A 2FFUA 4HA8A 3ZP5A 1MKMA 3IM7A 4LO7B 2L9VA 3ZR8X 2JA7J 4I4VA 3EUHC 1BOAA 3DBRB 2CUJA 2HVRA 3F62B 5JMCA 2D1HA 3HHGA 1P6RA 1T0FA 1B72A 1PUMB 2CQNA 1XX5A 2OBPA 4J2KA 1DZCA 3EUAA 2MLKA 3IH4A 5B5EC 2RGVA 1WD3A 1DQOA 2HDDA 1O3SA 2EA4A 1Y0UA 3M9AA 4J2YA 1SMTA 2NVTJ 2JVHA 2LNBA 4Z9WB 3RTRA 3RKXA 2E1MB 4D7NA 2JJ7A 3N7JA 1KU7A 3QYDA 5BP5C 2A6TA 2RC4A 1F1ZA 2UXNA 1HLVA 2EV5A 2VBWA 2ZNYA 4D0TA 3ECOA 3M8EA 1K5VA 2ZSIB 1JUPA 2JMWA 3POKA 4MEXF 4F34A 1R4MB 4F7ZA 3DCFA 3PFYA 2HPMA 4NNJA 4BXUA 5HNFA 2M30A 4RAZA 3FISA 5HODA 2B63J 2L4AA 1P2FA 4IXAA 3P7NA 3OBRA 3ZQ7A 4YIRX 1ZTRA 3D5RC 2LKSA 1E3OC 1WJFA 4QBCA 2E71A 4PDKA 3SEQA 5F0FA 5TISC 3ZPLA 1FP1D 3CA5A 3OBTA 2BFHA 1G9AA 3CJTB 1S7AA 1T08B 1BC8C 4CZZA 1LDJA 3H3UA 2WAFA 2G9WA 3BOQA 4QPOA 1AKHB 1ON2A 1YJNI 4OW4A 4Q9GA 2KIFA 4IO9F 1T56A 4EJWA 3CA0A 4ZLBB 1W5CC 3NARA 2DRYA 2FGFA 2QUFA 3SJMA 4KYWA 3UDAA 5EDNA 2GXGA 4KT5C 2BY2A 2F6CA 3DF8A 4QBVA 1I27A 2MC2A 5JI6A 2VXDA 4JKQA 3DTKA 1JJ6C 3GTMJ 2O3FA 5EEHA 5K5RA 2PMUA 3F8CA 5IOZA 4B8XA 3N4MA 1BFFA 1DGRM 3HKZN 4JYKA 4I4XA 1M16A 1JTCA 1D1BA 4FTHA 3LAPA 3DLLF 2G0EA 3BJ6A 5EGOB 1K6OA 1MDMB 3F1RA 3KZIC 3G6EI 2KHMA 1WH7A 2JSPA 3OYNA 4ZA3B 3CUOA 5CVJA 1A8DA 1P7JA 4PFPA 2Y48A 5DCFA 2QEXI 1TP0A 5F64A 2OJED 2FNAA 5DD8A 4ZOTA 5TGTA 1VQPI 4UHTA 1VQ8I 2MG4A 4B44A 1TP4A 4M9SA 1JKRC 3FDYA 3FJCA 2Z5UA 3DU5A 4M3DA 3E8LC 3R61A 4XICA 3O49A 3PHZA 4OEEA 5IOYA 2IS4A 1OCRH 1B8IA 4IF4A 2LIEA 4MTDA 2XROA 4I4UA 3GWZA 5DM6F 2DA5A 1VQ4I 3CCRI 2LVSA 1LUJB 2KT0A 4I96A 4BAYA 3L2QA 2J5PA 3DP7A 4EJVA 4A3GJ 2XAQA 4XRFA 4L9VA 1JTXA 1OQYA 2DDBA 2YS9A 3R60A 3K9TA 4MGRA 1WFXA 3TL4X 2DA7A 2N8GA 4MFEA 1F5TA 3C2BA 3CMYA 4QKRA 2XRNA 1R58A 3FM3A 5L3DA 2WBCA 5DVHA 2LMDA 3F8BA 5BOXA 3MZYA 4A0YA 2A3SA 3PUFA 1ERDA 4ZZLA 5JVTA 3AG2H 2JQ7A 4M72A 4R79A 2ME6A 3V8JA 3CC2I 3I55I 1X3ZB 2AXMA 3KEQA 2E7WA 3RTIB 4FX4A 1AXMA 3HUGA 3MMYB 2KRCA 4JAWA 3KYCB 3A4CA 1ZQ3P 4KITB 4EV0A 4F3QA 4I0BA 1LE8B 3ASNH 3LA7A 2LY2A 4KIGA 2W00A 1JT3A 3IWFA 2X9DA 2K86A 2HVSA 3I59A 2VKEA 1TQPA 2O5RA 1PP7U 5E1WA 5GPCA 4D9JA 2X6XA 1X4OA 2A05A 2EFOA 3A1YA 1S29A 3FKIJ 4PUSA 3Q3SA 2VU9A 2DI3A 2DMNA 5CVIA 1FOYA 4UUVA 4A6DA 3A0BC 1W0TA 4OU0A 4RGRA 5GAHJ 3HOXJ 1DFCA 2IBDA 2DK5A 3BR1A 3BCBA 1D1CA 2MH2A 3E5UA 3J7ZI 3PMEA 1FNNA 1OMIA 5J4VA 5BXPA 3F0CA 1D3YA 2X4HA 1HSTA 2XUBA 1OPCA 3JCUC 3CCVI 1ISXA 4WXDA 3TP0A 7I1BA 1RKWA 1FX7A 1IOBA 3G2BA 4BGDA 5IY5H 3EF2A 2DA6A 3BG7A 4A7KA 1VF9A 4N4NB 2Q2EA 4XM3A 3AKHA 2L5QA 5HS7A 3P9IA 1XGOA 2NVQJ 3S2DJ 5LRRA 3V79C 1U0JA 5D63A 2L54A 3WTVC 3MPPG 1HWPB 1GUUA 4TV7A 4HDUA 3RKQA 3QPSA 5C4XJ 4HRIA 1QHHD 4USOA 3PL8A 4B1RA 1YW8A 1ZR2A 3VYSB 4QLCU 1VFCA 1FV3A 1X1CA 1E0EA 1Q1VA 2JZYA 2AQEA 4I1BA 5CQGA 1MD6A 1F4KA 3X2QH 3PO3J 1Z3YA 2NZ9A 1J5YA 1S0CA 2ICWG 2DFIA 4QSHA 1BN5A 4HBLA 2V9PA 4CICA 1YTOA 4E7HA 3HSRA 3V7RA 2FSWA 1XC5A 1OR7A 2Y9YA 4NQWA 1PVEA 3ZXDA 4DENA 5BXSA 1UMQA 1G82A 2ESUA 2R7XA 1E2XA 5IP7J 2IS2A 4N9IA 3VDXA 1UPSA 1FOKA 5JFRA 4WCGA 3FJAA 3S8PA 5J1YA 3I64A 1KONA 2HKXA 2M8GX 4L5JA 2EZHA 1T38A 2O03A 3WU2C 5FO5A 2QLZA 3ZQIA 4TLPA 2E1NA 4G7OF 3OOPA 4AU7A 3SYTA 1IT0A 3WG7H 4J01A 3A22A 1ETOA 4OWRB 1BW5A 1MNEA 2R7TA 1MH3A 3MEXA 2GXBA 1FQ9A 3BTCA 4I4RA 3GW2A 2ISZA 2GO2A 1ABRB 1DFQA 5FKMA 5L3EA 4I4QA 4I01A 3QOPA 4O6JA 2LFBA 1DP3A 3FJ8A 1ILR1 3BRGC 2QQ9A 2UXXA 4IPAA 4I1EA 1DU6A 4C3IJ 4EMSA 4XFSA 2JWTA 1X2MA 3IUOA 4L5IA 5K5QA 3HOUJ 1QA6A 4M73A 2A07F 3CMAI 5C44J 4BY1J 1GV5A 1SD7A 1OYIA 3BR5A 3RIRA 4CCLA 3K2ZA 3ABUA 3HKZA 3ZMVA 4I6IA 2KRFA 4CH7A 5GAEJ 4A3IJ 2HQ5A 2KRHA 1Z9CA 2E2HJ 4GFBA 4YOLA 2E4MA 1V5FA 1G59A 2L7FP 4UY4A 2R7WA 4BH9A 5FRNA 2RVCA 4MTEA 4I3NA 5F27A 3W6JB 4G94A 3FM5A 2F5CA 1ZH5A 3V0BB 1OR7C 4P0KA 2MC3A 1TW3A 3IAGC 4HV5A 2FNPA 4LG0B 4A3BJ 2EK5A 2NVUB 5J4YA 1Q03A 2PBIA 1OLTA 2MFZA 1ZRDA 5BMZA 3FUQA 1RZ4A 1PUUB 2JSCA 4G6DA 1R00A 4FCYA 1YRNA 1ISZA 4LFUA 4DBQA 4JPZA 4HF2A 1LDKB 3PNVA 5GTIC 2V7FA 5A2QK 4LGWA 1YF8B 3HBWA 4HF0A 3I4NJ 3AKIA 4Q91A 2XAUA 1BASA 5H6QA 1KNMA 2H6CA 3LFUA 1BLAA 4A3KJ 1RRJA 4QD2C 3WMVA 1BC7C 2M9HA 4XKIA 2DO7A 4E7IA 4GOVA 1VQLI 2B0LA 3JRFA 1B9NA 2M4KA 2KKIA 4AVPA 1J0RA 4EM0B 1TOOA 2VXTI 3JRAA 3WO4A 4HNUA 2ZBKA 3RPUA 1W4MA 3G4SI 1G2HA 2HWVA 3BQZA 1W3FA 1VQ7I 4FHTA 3QODA 2R0QC 2TCTA 3FJKA 3GTKJ 2M8EA 5FZZA 1VQ6I 3QWLA 3MD2A 1WPKA 4AN6A 5D6FA 2E4MC 2WADA 2O6GE 5EC5A 4DYQA 5B1AH 5D5XB 4PJ0C 4H0EA 1I50J 4ZH4F 4E6KG 1TC3C 3OS1A 1ODDA 5BNGA 1LFBA 3H3ZA 4EVIA 4IRHA 5FROA 1BARA 2X51A 3O3KA 2RNJA 4U87A 5J8FA 1E0OA 4IOCF 2F8XC 4BE2A 4H04A 1EYLA 3ECHA 4GCVA 1RPWA 3TDUC 4LLLA 1MZBA 4EGZA 1WCMJ 2VJIA 2D23A 4JP0A 1BR2A 1G3WA 5JR3A 1FN0A 1G9BA 3U1KA 4NB5A 4IKFA 3VUOA 4YEJA 3P53A 2DMQA 2H09A 2PEXA 3DTEA 2HXIA 3PFIA 3K1PA 2NNNA 3H5RA 2R3SA 2E2IJ 1KQ9A 3A01A 5BPIA 2QGUA 8I1BA 2EB7A 5M3FJ 4G6JA 5LGUA 1MNDA 3JRIA 3KP7A 2H8RA 3TOAA 3LFKA 1MW7A 3FBIB 3PO2J 4RGSA 1A36A 2F2EA 4EM1A 1B72B 1N75A 1SMYF 3K4LA 1QVTA 4FISA 1IC8A 1SZ6B 2M1BA 2D43A 5LGNA 1YYNA 1GT0C 2LR8A 2OUMA 3AH1A 4CCNA 2M4GA 1GXQA 2ZQOA 3BJAA 1QO0D 5DYMA 1DZDA 4IX7A 3FHNA 3OY9A 3DV8A 4J2XA 2TDXA 1G4DA 4HSRA 4Y33A 3S17J 1I6HJ 3CP2A 1Q1UA 1B59A 2NS8A 2HZ9A 1UG2A 2PX9A 3FZVA 3Q7WA 1IRFA 1EH7A 1SFEA 2HXOA 2DYSH 5IT3A 2DOFA 4HZFA 1Y1WJ 31BIA 3DBLB 3EYYA 4XKWA 4KEKA 2CW7A 3PQKA 4ETSA 2GA2A 1Y56A 1RR7A 1RUOA 4LB5A 3K4BA 3BZKA 4G1RA 2YU3A 3Q0UA 2CMPA 1BI1A 3F21A 3I29B 4DZJA 5TRDA 3CRIA 3HG9A 1HWNB 4HX8A 3HXLA 3IP4B 1ACIA 3H92A 1S3JA 3QPLA 4BYYA 2HOAA 2OQGA 4BE0A 1MBEA 1U8RA 3QU3A 2ADUA 3WTSC 3LQQA 1OFCX 2R7RA 2HDCA 2LY1A 3DFGA 2ZXIA 4RBOA 2KDZA 3PM1A 4IQJA 1HXDA 1ENHA 2W84A 2Z48A 2F4IA 5FKLA 2GLOA 2V1DA 4A3CJ 2GM4A 3UD9A 2X6OA 1NK3P 3P9KA 1ZARA 3R4KA 2GBYA 4LIUA 3EUKL 5K1YA 1FWUA 2VSAA 4EFQA 4V2FA 2L02A 4RAFA 4IHZA 3JR9A 1WSUA 3NQOA 1TT5B 3M4OJ 4MLOA 3JRGA 3CCEI 1SFUA 1VQKI 3HTUA 2QA4I 4D8HA 3TQNA 2H1LA 3HBLA 3HOZJ 1WVRA 4EGYA 4XK4A 2OU2A 4EFRA 2EIMH 1JQZA 2OAZA 2ESNA 3IRQA 4Q4ZF 2NNYA 1IJWC 2ZJ2A 3HRMA 1T95A 5K7FA 1WQ2A 3S15J 1BW6A 2B7EA 2FQ3A 4UXNA 2O0YA 1I39A 1F36A 1YXWA 3AG3H 3WTWC 3COAC 2LKXA 1MD0A 3KEOA 3CZ6A 1EH6A 5LEJA 2YPRA 1BA5A 2VT2A 1AHDP 3CAHA 4G9NA 2HZTA 2LH9A 4RB1A 1LJ9A 2Y75A 4LD5A 1GVJA 1YIOA 3ML6A 4A5NA 2Q3NB 5HVQC 4QWQA 5BPDA 1V4RA 2XB0X 4X3AA 2HTJA 3AZWA 2DA1A 4B09A 1LB2A 1FIAA 1TBXA 1Z21A 2EILH 3CCYA 3K4KA 1ZG1A 2IS1A 5AONA 3V7SA 1BJAA 5AIPA 1ETWA 4I2OA 4BACA 3Q7XA 4B3XA 3RSNA 4PJJA 2CGPA 2E1OA 5E79C 3GX4X 3E6CC 3NBNA 1D0HA 3E5QA 3UR3C 2I8DA 3VEQA 1NTCA 2L3DA 1H9TA 5TJJA 9ANTA 2FBIA 3FXMA 3HZJA 4OEFA 4HDVA 1V5EA 2HU9A 4B43A 1JGGA 3N7LA 4RB0A 2JUGA 4HLXA 4ABZA 3BJOA 3RPQA 2VQCA 1YW9A 2VN2A 2QSFX 4I09A 1ZRFA 4KFCA 3CD6I 3KLNA 2VASA 2X1DA 4NC8A 4I8MA 2GAUA 3HUGB 5E8GA 4A3JJ 1Z3XA 2QBYA 1HDDC 3MQ0A 3ZQGA 1P4XA 1HIBA 4FETA 2CSOA 4BS9A 2EFNA 3E6BA 3ABTA 1ZN2A 4UVCA 1HDPA 3QOEA 2K8RA 2A5WA 1FOXA 1FSEA 2MABA 2GIVA 4H75A 5HOOA 5FLXZ 2DODA 1YQAA 6PAXA 1FPQA 3I59B 3O4OA 2K4JA 3ZC9A 1FT9A 2E5NA 1JY0A 3PQJA 2IPQX 2ZKZA 2XAGA 4DW6A 3JRCA 4EJTA 3H5AA 3HOTA 3Q0VA 3ERED 5FLMJ 4IJAA 4D1QA 1GV2A 3GO5A 4GYGA 1ULYA 1OJLA 1AOYA 1O4XA 2M87A 2PMZN 3T1BA 3CJQB 2KZVA 2OQRA 2VODA 3WHBA 3KX2A 2XSJC 3K0LA 3G71I 1BM9A 2VSEA 5J3LA 1AWCA 4BJ6C 1AVUA 5DZUA 3TO6A 1WI9A 2WA0A 1R5HA 1GLNA 1JT7A 1V5GA 2V6CA 2DK8A 3VOEA 3U1DA 3AJ6A 3JUTA 2IVMA 4GGGA 5LHIA 2CV1A 2Y9ZA 1X1BA 5HLGA 4AIKA 5F90A 5J1UA 1QZZA 2OCEA 3HHHA 1U5TB 1FYKA 1IRPA 2QQ8A 2X6YA 4BE1A 2X6WA 5FFXA 1O3TA 5LFAA 2OCCH 3ABKH 5M5YJ 2EIKH 1I1EA 1QZYA 1YO5C 3DPLC 1HQCA 3C9ZA 2AO9A 3M8FA 3L2VA 2V9KA 2LIQA 2R7DA 4E7ZA 3CDIA 1P4WA 2XAJA 2G7HA 1MMSA 1DLLA 3L2CA 1ETKA 3GFMA 5DUKA 4I7HA 5KVRA 1JT0A 1IJTA 2FBHA 4NQWB 2W25A 3P5JA 4M9ZA 1D8JA 1IDZA 3RKWA 3JREA 2E36A 4R8HA 4BDYA 4OWKA 3P6JA 1NG7A 3OYEA 4XLFA 2E5ZA 4F91B 2NM1A 3IRRA 1EH8A 2P0WA 4IZXA 5HDKA 5FKOA 2KZGA 3MALA 3FGMA 5FD6A 2XRLA 2NRAC 2E60A 4KJZA 4Q47A 1EA3A 1JKOC 1SAUA 1ZKGA 2VKDA 4PC4A 5FLVA 2VC0A 4MZHA 1U78A 4ZBVB 4IHWA 1U6GA 4N9HA 3ZQHA 4G12A 3V4GA 3ZRGA 2JPCA 3VWBA 2L9SA 1T6SA 2BGCA 2FX0A 1H9GA 3U9GA 1OCCH 2BV6A 1MSEC 1Z6RA 5ED4A 3JRRA 2VBYA 1UHSA 4HW0A 4QD2B 2P39A 3PG0A 2MIBA 3O4DA 3FX3A 4MZGB 1RNLA 3S3NA 3O6BB 4DIQA 3GYHX 3VT0A 4WK8F 2IGOA 5IT9Z 3KYDB 4XRSA 4JQFA 3M3YJ 2F5EA 3E0JB 4USPA 2ZB9A 4Z6YA 2FA5A 2Q1ZB 4BEHA 3OYMA 3I2XA 3OJMA 5HS8A 1DPUA 4AWXB 2PFBA 3VYUB 3AFHA 4WX9A 1CF7B 5E18F 2WC2A 3MKYB 2DOAA 4ASNA 3B02A 2CFXA 3RPUD 2F2FA 3VT1A 1I1BA 5K5OA 5IYCJ 1S0DA 2BYVE 2M0MA 3RKYA 5IPAA 4KEJA 4IL6C 4LLNA 4RAYA 1BIAA 2P5LC 3AL0C 3L09A 4A3FJ 3ILAA 1TTUA 2B9SA 5EG6C 2CQKA 3M1EA 5JHUA 2O8XA 2HW9A 4BNCA 1JLYA 1PJRA 3AZVA 2Y0SN 2F4MB 1EVTA 3VEPA 4G8XA 4JX5A 1ISVA 1YRNB 1R6RA 2CQXA 4AYBN 1KU2A 2KFDA 1G3YA 1LVAA 5JHFA 5F8YA 2O8KA 4A69C 2MH9A 2VKHA 2IRFG 3CESA 4I4PA 3QU6A 4ZZDA 3QPTA 3L1PA 1TWCJ 2WRYA 1KA8A 1W7PA 1KU3A 3NRVA 1RETA 3M8JA 4C2UA 1HSJA 1G9CA 4XN3A 4EKXB 4LLGF 5J1RA 1GDTA 3JAMZ 1DP7P 2EINH 2J5OA 3RJPA 2D44A 3WGIA 3LNQA 2EJRA 1OYWA 2Y9FA 5DM7F 2PG4A 3HSEA 4ZYDA 2VT3A 1RZOB 3S1QJ 1W1WE 2R4GA 3OIQA 4RA2A 5L3CA 4HOBA 3T0YA 2NYXA 3FXKA 2KMUA 1Z0HA 1TTYA 2Q0OA 3GTLJ 2GIZA 3ASOH 2F2FC 4ZYEA 5D6EA 3G1LA 1FMWA 4ZDOA 2VLAA 1V6XA 1QXMA 2R5ZA 3HOMA 1Z1DA 3H3VK 1D5VA 2FU4A 3CDLA 4ENJA 1R8OA 4QALA 2HKOA 1L3LA 2YX7A 3OIOA 1SD4A 5GADJ 3WA1A 1OYYA 2DTZA 4I7IA 5FRMA 3TBIA 3BG3A 2PMZA 2JN6A 2Z1DA 5J40A 3A01B 3RZOJ 3BPVA 5C4JJ 1MBJA 1FV2A 1XD7A 2UUSA 3BAOA 3HPHA 4XONA 2XGEA 2R5YB 5BXTA 4KIBA 4G6QA 2KQRA 4ESJA 3JSOA 1TWMA 1MJBA 1YTYA 3F8FA 2HYGD 3K70D 2WB1N 3ZCOA 3IKTA 3M7GA 3A02A 4E7SA 4PJLA 2BHYA 1PUFB 2QQAA 3MN2A 4XORA 3DEUA 3E1SA 3RCOA 2QYIB 1R71A 2H1KA 1Q04A 2F5FA 2ZXJA 1D0YA 3HOSA 5GAGJ 3K6GA 3ERMA 1J2XA 3L2UA 1K4SA 1IN6A 4MIMA 4BXFA 2KIMA 4II2A 2W82A 5BQTA 3SFIA 2JA5J 1MMAA 1Z77A 2ZMEB 1GHCA 3QP5A 2VXRA 5E20A 3QYEA 1KYZA 2ID6A 5DD4A 3R6SA 2YUGA 2P6SA 1RESA 4U0YA 4KA4A 1HCDA 4U7BA 3HDDA 3HYIA 2D1ZA 5EYRA 2BXZA 1SVOA 5F0CA 4RDUA 2DLLA 1ITBA 3ZXSA 2BW3B 3QYFA 3FK6A 2ISYA 2AAIB 1TWFJ 1UJ8A 3BG6A 3DXJF 4ZKTB 3ZXGA 2JT1A 4HYEA 1Y39A 2ZCWA 5E8IA 2W48A 2CUEA 3LSIA 3VPRA 4NC7A 4XFTA 4E4HA 3OSFA 1R8NA 4UUSA 1F9NA 5B2HA 5GTHC 1VZ0A 4XLPF 3C7JA 1A31A 5ICEA 1TT0A 3SDGA 2K9MA 2DREA 4D0ZA 4XBFA 2RV8A 5FFZA 2QSGX 2P81A 4O5VA 4IHTA 4OMYA 2L2OA 3BZCA 4X38A 4AC0A 2XPWA 2COMA 4Z8SB 4IOAF 3Q9VA 1Z05A 1HWOB 1XS9A 2GWRA 4BU2A 1W36C 4II0A 2I10A 5FZUA 4GP3A 4IVNA 1H8AC 5KK1A 4ZFWB 2R92J 2IGNA 2VI6A 2IA0A 2OZ6A 2TRTA 3D5LA 1CQTA 4S05A 3SZGA 2R7VA 1M2TB 2W1OA 1SR4A 2DMPA 1HKQA 2IA1A 3FJJA 1ZG3A 1SC7A 1YLFA 4GYIA 4PGHA 3TC2A 1I5ZA 4DCKC 2UWMA 3FXJA 3I5UA 3WTZA 3BCAA 3N7MA 5D5VB 2VE9A 1QQLA 1TQMA 4B48A 4IHXA 2L0KA 4DQ2A 1HC8A 1LDDA 3F6OA 1FIPA 4FE7A 2EH3A 1XSVA 3H6RA 4G6MA 3S14J 3OYFA 1Y6IA 4JX6A 3HOWJ 2CG4A 5F1RA 4IRGA 4UB8C 4JBAA 4I6ZA 1LEBA 2CUFA 3H9JA 2Q9XA 5LHGA 2XAFA 3PNTA 2EZIA 4M3BA 2IWTB 3GFIA 2Y0SA 3FXLA 3GZ6A 2KI6B 2BHZA 4IRIA 3NBEA 3LL7A 2YU9J 1IZ1A 3A07A 4AYBA 3L00A 2VL8A 4MO7A 3CC4I 3PUBA 1Z91A 2A69F 1E17A 1VQOI 3NJ5A 1EKEA 3CMMA 4KT6A 1Z2VA 2CRGA 5H20A 3K4NA 4PJNA 1BI3A
chains in the Genus database with same CATH topology
1PWAA 2LBFB 3CA3A 4RMNA 1L2HA 3FUOA 1SR4C 2X2SA 4ZC3A 3CRGA 3LSHA 4AN7B 4QPQA 2CV2A 4XOTA 1JLXA 4HG2A 3H6QA 2WAEA 2FUG2 4EEEB 4KC3A 2W7NA 3S8JA 3T8SA 4YELA 4Y3OA 3FFZA 2DXIA 4IZEA 4ANJA 1WJEA 4L4HA 4JRAA 4FASD 3BC8A 4KBBA 2DCEA 2D22A 4HNTA 4CSWA 2WB1A 2LRDA 3PSIA 1YX5A 1DQGA 2LYCA 1J09A 3CP8A 4IYBA 3BA7A 3H9QA 4ENDA 5HNHA 4R6UB 1YE9A 1MMGA 5KNLA 2ELJA 4LITA 3A21A 3N05A 2VJ4A 2X85A 2R7UA 4GP0A 1WJDA 5HPZA 1WBAA 2ZQNA 4JOMA 2LC2A 3DKXA 2NP0A 3LSKA 1LVKA 3OL3A 3B9UA 9ILBA 1Z7LA 4XKVA 5E24E 1AF9A 4I0YA 3BAHA 4ZFYB 2KLOA 4E7KA 2D20A 4KISA 1JT4A 1HA8A 4F52A 1N77A 4CCOA 3LLPA 3D5SC 2Z16A 2D7IA 4P0LA 4H9WA 5FNWA 2ZFUA 3BAUA 1DGWY 2RNGA 4CJMA 4QC4A 3H0DA 4DBRA 2QN4A 3FBNB 3OYDA 1ISYA 5BOWA 2IHOA 1N78A 5FZYA 3VSZA 3H35A 3S3MA 4IQPA 1BFCA 4I2SA 2M3AA 3DTIA 1BA7A 1FMVA 2UUZA 2VQHA 3DWLE 4DEPA 3BRFA 4X39A 1W36D 1HCEA 1MMDA 2MD0A 3NWSA 3K70C 3MKWB 2IGKA 4C2TA 2IGMA 5F8SA 2J3PA 4XL9A 2X1CA 3R4SA 1D1AA 2KI4A 4F83A 4X37A 1S0FA 3OS2A 1FMMS 3RTJB 3H9GA 3FJ9A 3ZQQA 3CA1A 3AKGA 4IZZA 1OQLB 4LO8B 4XMYA 4A7YA 3IM6A 2DJIA 4RLQA 3AH2A 1K6YA 5DUYA 3S93A 2KL4A 1YX3A 4DGWB 3OJVA 3C2HA 3A2KA 2R9KB 3FJEA 3V0BA 3H6SE 4MZFB 3AH4A 4XQFA 4B47A 3V0AA 2UV1A 3KEYA 3HC7A 2JVGA 3OS0A 3PNYA 1N4KA 2XC7A 4F92B 4P1WA 3OJ2A 2IXSA 2Q2EB 3UD7A 3VT2A 5JLVA 2R7OA 1RMLA 5CKTA 3GBGA 3V42A 1X19A 1G8XA 1AVWB 4ISQA 2K4AB 3O5WB 1S9HA 1HWMB 3W9TA 2CW8A 4LIVA 1TFMB 3N7KA 1BLDA 2RQ9A 2VJ5A 4Y4RA 3CQAA 1YBIA 3O4AA 1ISWA 4CA0A 4PFOA 1S0LA 2Y9WC 3DPTA 1PZZA 2NS2A 2K3PA 4X0GA 1XG6A 3OYJA 4GRIA 2ERMA 4IY8A 3AKFA 2V26A 2CS3A 3H6RB 1BR1A 3A23A 4XFUA 2R7QA 3BADA 3CJRB 1IRAX 5G00A 1W3AA 4AVZA 3K4CA 3VSFA 4CCMA 4OAYA 1V6UA 2KP6A 1AVAC 4RLFA 2VB6A 1SFKA 2NVHA 1IHKA 1BOBA 1NG6A 2ZR1B 3SNVA 2LREA 2KDOA 5EHAA 2D7RA 1UELB 2M7AA 4NUBA 4ITVA 4WBCA 5CQEA 3C2GA 4EB2B 5GAQA 3VSLA 1T4QA 3HPGA 3I2AA 3MKZA 2MC4A 5D62A 3IM5A 1X1AA 3OYHA 3RQ4A 1QU3A 3DEEA 5HLTA 2DT7B 3DPUA 3OWTA 1CE7B 4G9MA 1TWEA 4IY9A 3HALA 2F5VA 4H4KC 4EFPA 2DRZA 3PJRA 1T0FC 2HQAA 1XHBA 4QO3A 3NBDA 1TIEA 4G6TB 2FO1A 2D24A 3QYBA 5LD2C 2MYSA 3NWTA 2GOMA 2K43A 3HSMA 5I1BA 4ZFUB 2GZBA 4LO2A 2ZSHB 3SEZA 6I1BA 4XLHA 2DS0A 1ONKB 4XN0A 3OYIA 2WBMA 1PC8B 2ZXHA 5DSSB 4LO3A 3O4CA 1NUNA 3W3CA 4CUGA 3BX1C 2HPIA 1JI8A 2XOAA 3I9V2 2KH2A 3OYCA 1CVSA 2PJRA 1WD4A 3IAM2 3CU1B 1P63A 4J23B 2VPLA 5KHDA 4OUJA 2VUAA 1XZZA 3VWCA 1MC9A 2AFGA 4DOZA 3RSJA 4ZTFA 1DQUA 2QKMB 2CV0A 3OGGA 4II3A 3IAS2 4ZYAA 2RG9B 3W2WA 4LO2C 4LO0A 2Y9GA 1BFGA 4P6AA 3L2WA 5BXRA 1BR4A 4J2SA 3KMVA 3DU6A 3BRDA 4LO3C 2L9NA 2JA2A 3LSMA 1J0SA 1S0GA 3FJIA 5FNXA 3CA6A 1VCLA 2AQZA 4JQ0A 21BIA 1D0XA 2M49A 4ZTJA 3S8KA 2XF7A 4C9YA 3N0KA 3U21A 4GOYA 4CCJA 4XLAA 2RREA 4FVVA 4ZGRB 2V1NA 2VQGA 4LO0C 2BVMA 3DQVC 4I4YA 3S3OA 2HNHA 2CFOA 3K10A 3D7WB 1P9QC 1AA7A 2W4SA 3OYKA 2NYYA 3K4JA 2R7SA 4CZCA 5BVPI 2CUZA 1TZLA 3ZX7A 4I4SA 1S0BA 3UD8A 4IONA 4N4OB 4BDZA 4PJMA 4OAZA 4OWJA 3FJHA 4QKSA 4BJ5C 2HWAA 1WJCA 1IILA 2I1BA 4XKCA 2BVLA 3UJ4A 3PSFA 4IQ4A 1X4PA 3KYLA 4GAIA 4PK4A 2XF5A 1PYVA 1G9DA 3J7AY 3W2VA 1T9FA 2NOJB 3V0AB 4LO7C 2Z2SB 3CRHA 1D0ZA 1ZELA 2V6EA 3BAGA 1V6VA 3OYLA 3WINA 3CA4A 4HR6C 4OEGA 3FKJA 4XLCA 3OIPA 2VQLA 3Q7YA 4I4OA 1FGAA 2E1MC 4Q9PA 3CF2A 2ET2A 3OYAA 4J00A 4BQOA 4DJAA 4XOPA 1XYFA 2RQQA 5CPRB 2OC6A 3FJDA 1UG0A 2M7BA 1JT5A 3AL0B 4C30A 1GGPB 3O4BA 2BOLA 1WJAA 3R4UA 4BQQA 5KCMA 4A7ZA 4OWLA 2QKLB 3UNGC 4E7LA 3M1CA 4BQNA 2LOOA 3WINC 2X1EA 3VYTB 4P0JA 3LMMA 1QQKA 4BEHB 3W2AA 4I37A 3HL2A 1UAAA 3WO3A 2RSTA 2P23A 5F8WA 2BEAA 2VLCA 3BAVA 1DIWA 3RMYA 2BW3A 1X1DA 3P6IA 1FMZA 3OL4A 5BQUA 3BTAA 3RMXA 1K5UA 3I3LA 2VXZA 4RM2A 3O3QA 3S32A 3ONQA 2VJJA 3QR5A 4BUPA 3BLYA 3BA4A 2LG4A 4CCKA 2GOXB 4F93B 2X2TA 1LKXA 2Z49A 4JKXB 4PSWA 1QHGA 3K1XA 3H5NA 4P5OA 3LTQA 3OOUA 3OYGA 4HSTA 3HN1A 3OMYA 4E7JA 1RY7A 4HPQA 1S0EA 1RG8A 3L2RA 3OYBA 2L7KA 2FFVA 4YRVA 4L4IA 1II4A 1WBCA 3VYRB 5BQUC 1LFPA 3OR2C 4KEIA 3TMOA 2WY8Q 1AFCA 1DJSB 3K4MA 4HEA2 4ZJZA 2UUSA 4D0ZA 3SDBA 1W3GA 4XLEA 2MLLB 2HVQA 4ISRA 2PJRB 4BJTA 3O44A 2LBFA 3HMYA 2WAQA 2HZDA 3BA5A 4HA2A 3VSKA 2CH0A 1HKNA 1NZKA 3AKZA 4LO1A 4RM3A 4HJJA 2V4JC 3UJ0A 2Y9XE 2OV7A 4PSXA 3NBCA 3OR1C 3WMUA 1Z4SA 2NTDA 2XDVA 1AVXB 3OGFA 3ZGKA 2HWMA 4XKBA 4EATA 4XNFA 3FJFA 1FWVA 4FGFA 3EPZA 2XF6A 4ZDLA 1EPWA 3DKYA 3WO2A 1V6WA 3BB2A 5D61A 1MMNA 1BFBA 3AJ5A 2FDBM 4XR6A 2WY7Q 2L5XA 3F9KA 1F31A 5BP5A 1WJ5A 3BAQA 1EV2A 4LG3A 2KPMA 3DLAA 3ZC8A 2KLLA 2AQFA 3FJBA 2VIXA 4F55A 4LO1C 4GAFA 2HDWA 2K5CA 41BIA 1IRXA 2DT6A 4BL0B 2BEBA 2K9LA 1WJBA 4ZDPA 3IIRA 3LSGA 2IS6A 2FFUA 3IM7A 4LO7B 3ZR8X 4I4VA 3EUHC 2CUJA 2HVRA 3F62B 5JMCA 1PUMB 4J2KA 1DZCA 3EUAA 1WD3A 1DQOA 4J2YA 2JVHA 4Z9WB 3RTRA 2E1MB 3N7JA 3QYDA 5BP5C 2A6TA 4D0TA 1K5VA 2ZSIB 3POKA 4F34A 3PFYA 2HPMA 4NNJA 5HNFA 3OBRA 3D5RC 1WJFA 4QBCA 3SEQA 3CA5A 3OBTA 2BFHA 1G9AA 2WAFA 4QPOA 4Q9GA 4OW4A 3CA0A 4ZLBB 2FGFA 2DRYA 3UDAA 4QBVA 2F6CA 2MC2A 2VXDA 4JKQA 3DTKA 1BFFA 1DGRM 4I4XA 1M16A 1JTCA 1D1BA 3F1RA 2KHMA 2JSPA 3OYNA 4ZA3B 1A8DA 4PFPA 1TP0A 4ZOTA 5TGTA 4B44A 3FDYA 3FJCA 3DU5A 3E8LC 3O49A 3PHZA 4OEEA 2IS4A 2LIEA 4I4UA 4I96A 3L2QA 3TL4X 1WFXA 4QKRA 2WBCA 5DVHA 1ERDA 4R79A 2AXMA 3RTIB 1AXMA 3MMYB 2KRCA 4JAWA 3A4CA 4KITB 4F3QA 2LY2A 2W00A 1JT3A 2HVSA 2O5RA 4D9JA 2X6XA 1X4OA 3A1YA 4PUSA 2VU9A 1DFCA 3BCBA 1D1CA 3PMEA 5BXPA 1ISXA 7I1BA 1IOBA 3G2BA 4BGDA 3EF2A 3BG7A 4A7KA 4N4NB 4XM3A 3AKHA 2L5QA 3V79C 1U0JA 5D63A 3MPPG 1HWPB 4HRIA 1QHHD 4USOA 3PL8A 3VYSB 1FV3A 1X1CA 1E0EA 2AQEA 4I1BA 5CQGA 1MD6A 2NZ9A 1Z3YA 1S0CA 1YTOA 4E7HA 4DENA 3ZXDA 5BXSA 2ESUA 1G82A 2R7XA 2IS2A 3VDXA 1UPSA 3FJAA 3S8PA 1KONA 4TLPA 1IT0A 4AU7A 3SYTA 4J01A 3A22A 4OWRB 1MNEA 2R7TA 4I4RA 1FQ9A 2GO2A 1ABRB 1DFQA 4I4QA 1DP3A 3FJ8A 1ILR1 3BRGC 4I1EA 4XFSA 3IUOA 4CCLA 3HKZA 4I6IA 4CH7A 2KRHA 4YOLA 2E4MA 1V5FA 1G59A 4UY4A 2R7WA 5FRNA 4I3NA 3V0BB 1OR7C 4P0KA 3IAGC 1Q03A 1OLTA 2MFZA 3FUQA 1PUUB 1ISZA 4DBQA 4JPZA 1LDKB 3PNVA 2V7FA 1YF8B 4Q91A 3HBWA 3AKIA 2XAUA 1BASA 1KNMA 3LFUA 1BLAA 4QD2C 3WMVA 4XKIA 4E7IA 4GOVA 2M4KA 2KKIA 1TOOA 2VXTI 3WO4A 4HNUA 1W3FA 3QODA 3FJKA 5FZZA 3MD2A 4AN6A 2E4MC 2WADA 5EC5A 4E6KG 3OS1A 5FROA 1BARA 2X51A 4U87A 1E0OA 2F8XC 4BE2A 4H04A 1EYLA 2VJIA 2D23A 4JP0A 1BR2A 1FN0A 1G9BA 3VUOA 4IKFA 4YEJA 3P53A 3DTEA 3H5RA 8I1BA 4G6JA 1MNDA 1MW7A 3FBIB 1SZ6B 1N75A 3K4LA 2D43A 1YYNA 2OUMA 3AH1A 4CCNA 2M4GA 2ZQOA 1DZDA 4IX7A 3FHNA 3OY9A 4J2XA 4HSRA 4Y33A 3CP2A 1Q1UA 3Q7WA 2HZ9A 31BIA 4XKWA 4KEKA 2CW7A 1Y56A 3K4BA 4G1RA 2CMPA 3I29B 3CRIA 3HG9A 1HWNB 3HXLA 3IP4B 4BE0A 2R7RA 2LY1A 2ZXIA 4IQJA 2Z48A 2F4IA 3UD9A 4LIUA 3EUKL 1FWUA 2VSAA 4EFQA 4IHZA 4MLOA 4D8HA 4EFRA 1JQZA 1T95A 1YXWA 3CZ6A 3CAHA 4G9NA 2LH9A 2Q3NB 5HVQC 4X3AA 3AZWA 2IS1A 1Z21A 3K4KA 3Q7XA 4BACA 4B3XA 3RSNA 4PJJA 3NBNA 1D0HA 3UR3C 2I8DA 3VEQA 4OEFA 1V5EA 2HU9A 4B43A 3N7LA 2JUGA 2VQCA 2VASA 2X1DA 4NC8A 4I8MA 3HUGB 1HIBA 1Z3XA 4FETA 4BS9A 3QOEA 2K8RA 2A5WA 2MABA 4H75A 5HOOA 3O4OA 3ZC9A 2E5NA 1JY0A 3H5AA 3HOTA 4D1QA 3CJQB 2KZVA 3KX2A 2XSJC 2VSEA 4BJ6C 1AVUA 5DZUA 2WA0A 1JT7A 1GLNA 1V5GA 3AJ6A 3JUTA 2CV1A 1X1BA 5F90A 1IRPA 2X6YA 4BE1A 2X6WA 5LFAA 1I1EA 3DPLC 3C9ZA 3L2VA 2V9KA 2LIQA 4E7ZA 1DLLA 1IJTA 4NQWB 4BDYA 4OWKA 3P6JA 1NG7A 3OYEA 4XLFA 2E5ZA 4F91B 2NM1A 2P0WA 4IZXA 3MALA 3FGMA 2E60A 4KJZA 1EA3A 1SAUA 4PC4A 2VKDA 4MZHA 4ZBVB 3ZRGA 3VWBA 2L9SA 3JRRA 4QD2B 2P39A 3PG0A 2MIBA 3O4DA 4MZGB 3S3NA 4DIQA 3VT0A 2IGOA 4JQFA 3E0JB 4USPA 2Q1ZB 4BEHA 3OYMA 3I2XA 3OJMA 3VYUB 3AFHA 3MKYB 2DOAA 3RPUD 2F2FA 3VT1A 1I1BA 1S0DA 2M0MA 4KEJA 3AL0C 1TTUA 3ILAA 5EG6C 2HW9A 1JLYA 1PJRA 3AZVA 1EVTA 1ISVA 1R6RA 5JHFA 5F8YA 2VKHA 3CESA 4I4PA 2WRYA 3M8JA 4C2UA 1G9CA 4XN3A 4EKXB 2D44A 2Y9FA 1RZOB 2R4GA 3OIQA 2KMUA 1Z0HA 2F2FC 1FMWA 4ZDOA 2VLAA 1V6XA 1QXMA 3HOMA 1R8OA 4QALA 3WA1A 4I7IA 5FRMA 3TBIA 2PMZA 2Z1DA 1FV2A 3BAOA 3HPHA 4XONA 5BXTA 2KQRA 1TWMA 3K70D 3ZCOA 4E7SA 4PJLA 4XORA 3E1SA 3RCOA 2QYIB 1Q04A 1D0YA 3HOSA 3K6GA 3L2UA 4BXFA 4II2A 2W82A 1MMAA 2VXRA 3QYEA 2YUGA 1HCDA 4U7BA 2D1ZA 1ITBA 3ZXSA 2BW3B 3QYFA 2AAIB 4ZKTB 3BG6A 3ZXGA 3LSIA 4NC7A 4XFTA 4E4HA 1R8NA 5B2HA 1VZ0A 1TT0A 2K9MA 2DREA 2L2OA 4X38A 4Z8SB 1HWOB 4BU2A 1W36C 4II0A 5FZUA 4GP3A 4ZFWB 2IGNA 3D5LA 1SR4A 3SZGA 2R7VA 1M2TB 2W1OA 3FJJA 3TC2A 4DCKC 2UWMA 3BCAA 3N7MA 1QQLA 4B48A 3H6RA 4G6MA 3OYFA 1Y6IA 3H9JA 2Q9XA 3PNTA 2IWTB 2Y0SA 3NBEA 2KI6B 3LL7A 3A07A 4AYBA 2VL8A 3PUBA 3NJ5A 3CMMA 4KT6A 1Z2VA 3K4NA 4PJNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DS0 A;  1PWA A;  1ONK B;  5D61 A;  1BFB A;  3CA3 A;  3AJ5 A;  2FDB M;  2L5X A;  1F31 A;  1PC8 B;  5BP5 A;  1L2H A;  2Z48 A;  5DSS B;  3FUO A;  1SR4 C;  2X2S A;  3CRG A;  3BAQ A;  3O4C A;  1EV2 A;  1NUN A;  4LO3 A;  3UD9 A;  4AN7 B;  3BX1 C;  1FWU A;  2VSA A;  4EFQ A;  3ZC8 A;  4IHZ A;  2XOA A;  1JLX A;  2KLL A;  3FJB A;  2KH2 A;  4LO1 C;  3H6Q A;  4GAF A;  1CVS A;  4D8H A;  41BI A;  1WD4 A;  4EEE B;  4KC3 A;  3CU1 B;  1P63 A;  4J23 B;  3S8J A;  4EFR A;  1JQZ A;  3T8S A;  4OUJ A;  2BEB A;  3IIR A;  2VUA A;  2FFU A;  3FFZ A;  1XZZ A;  3VWC A;  3IM7 A;  1MC9 A;  4LO7 B;  2AFG A;  4IZE A;  4I4V A;  1YXW A;  3RSJ A;  3F62 B;  5JMC A;  3OGG A;  1PUM B;  3CAH A;  4L4H A;  4G9N A;  4JRA A;  4J2K A;  2RG9 B;  1DZC A;  1WD3 A;  4LO2 C;  1DQO A;  2Q3N B;  4KBB A;  4LO0 A;  2D22 A;  2Y9G A;  1BFG A;  4P6A A;  4X3A A;  4J2Y A;  3AZW A;  5BXR A;  4Z9W B;  4J2S A;  3N7J A;  3Q7X A;  3KMV A;  3QYD A;  5BP5 C;  3BRD A;  4LO3 C;  4D0T A;  1K5V A;  1D0H A;  3NBN A;  1DQG A;  3VEQ A;  3POK A;  4F34 A;  1J0S A;  1S0G A;  3FJI A;  4OEF A;  4IYB A;  3BA7 A;  3N7L A;  4END A;  5FNX A;  3OBR A;  3CA6 A;  4R6U B;  4QBC A;  1VCL A;  2AQZ A;  3CA5 A;  3OBT A;  4I8M A;  21BI A;  2BFH A;  4JQ0 A;  1G9A A;  1HIB A;  3A21 A;  2M49 A;  4Q9G A;  4OW4 A;  3S8K A;  2K8R A;  3CA0 A;  4ZLB B;  4GP0 A;  2FGF A;  2DRY A;  3N0K A;  3UDA A;  4GOY A;  4QBV A;  5HPZ A;  3O4O A;  2MC2 A;  3ZC9 A;  4FVV A;  4ZGR B;  4JKQ A;  1JY0 A;  1WBA A;  2ZQN A;  1BFF A;  4LO0 C;  4I4Y A;  2NP0 A;  4I4X A;  1M16 A;  1JTC A;  3B9U A;  9ILB A;  3D7W B;  3F1R A;  2NYY A;  5E24 E;  1AF9 A;  4ZA3 B;  1A8D A;  4I0Y A;  3BAH A;  4ZFY B;  1TP0 A;  2D20 A;  2VSE A;  5BVP I;  4ZOT A;  1AVU A;  1JT4 A;  5DZU A;  1JT7 A;  3FJC A;  3E8L C;  3LLP A;  3O49 A;  3PHZ A;  4OEE A;  3AJ6 A;  3JUT A;  2LIE A;  2D7I A;  3ZX7 A;  4P0L A;  4H9W A;  4I4S A;  1S0B A;  5FNW A;  4I4U A;  3UD8 A;  5F90 A;  4ION A;  3BAU A;  1IRP A;  4I96 A;  4CJM A;  1I1E A;  4OWJ A;  3FJH A;  4QKS A;  3C9Z A;  4QC4 A;  2HWA A;  2LIQ A;  4QKR A;  2QN4 A;  2WBC A;  1IIL A;  1DLL A;  1ISY A;  2I1B A;  5DVH A;  5BOW A;  2IHO A;  1IJT A;  3UJ4 A;  4GAI A;  5FZY A;  3VSZ A;  4OWK A;  2AXM A;  3P6J A;  2NM1 A;  1G9D A;  3RTI B;  1AXM A;  4IZX A;  1T9F A;  4IQP A;  1BFC A;  4JAW A;  3MAL A;  3FGM A;  4I2S A;  4LO7 C;  3V0A B;  3CRH A;  4PC4 A;  1BA7 A;  4ZBV B;  1JT3 A;  4DEP A;  3BRF A;  3BAG A;  1V6V A;  4X39 A;  1HCE A;  3WIN A;  3CA4 A;  3JRR A;  4HR6 C;  4OEG A;  4QD2 B;  2P39 A;  3PG0 A;  2VU9 A;  2MIB A;  3O4D A;  3Q7Y A;  4I4O A;  1FGA A;  3VT0 A;  5F8S A;  4Q9P A;  2J3P A;  1DFC A;  2ET2 A;  4USP A;  3R4S A;  3PME A;  3I2X A;  3OJM A;  2KI4 A;  5BXP A;  4F83 A;  4X37 A;  1ISX A;  7I1B A;  1S0F A;  1XYF A;  1IOB A;  3EF2 A;  4A7K A;  1FMM S;  3FJD A;  3AKH A;  3RTJ B;  3FJ9 A;  3CA1 A;  2F2F A;  3AKG A;  3VT1 A;  1I1B A;  1OQL B;  3V79 C;  4LO8 B;  5D63 A;  1JT5 A;  1S0D A;  1HWP B;  3MPP G;  4A7Y A;  4KEJ A;  1GGP B;  3IM6 A;  3O4B A;  4USO A;  1TTU A;  3ILA A;  5EG6 C;  1FV3 A;  3AH2 A;  2HW9 A;  3R4U A;  1JLY A;  5DUY A;  4A7Z A;  3AZV A;  4OWL A;  1EVT A;  4I1B A;  1ISV A;  1MD6 A;  2NZ9 A;  1S0C A;  5F8Y A;  1YTO A;  3OJV A;  4I4P A;  4DEN A;  3ZXD A;  5BXS A;  3WIN C;  2ESU A;  1G82 A;  2R9K B;  2WRY A;  3FJE A;  3V0B A;  3H6S E;  1UPS A;  4P0J A;  1G9C A;  4EKX B;  3FJA A;  3AH4 A;  1QQK A;  3V0A A;  2D44 A;  4TLP A;  2Y9F A;  4I37 A;  1IT0 A;  1RZO B;  3A22 A;  1N4K A;  4I4R A;  1FQ9 A;  3OJ2 A;  3WO3 A;  2GO2 A;  1ABR B;  1DFQ A;  2RST A;  4I4Q A;  3UD7 A;  3VT2 A;  5JLV A;  1RML A;  2P23 A;  3FJ8 A;  5F8W A;  1Z0H A;  1ILR 1;  3BRG C;  2BEA A;  4I1E A;  2VLC A;  3BAV A;  1DIW A;  4XFS A;  2F2F C;  3RMY A;  1AVW B;  4ISQ A;  2K4A B;  1V6X A;  3O5W B;  1HWM B;  1QXM A;  3P6I A;  3HOM A;  1FMZ A;  4I6I A;  3W9T A;  1TFM B;  4YOL A;  3N7K A;  5BQU A;  1R8O A;  2E4M A;  3BTA A;  4QAL A;  1BLD A;  2RQ9 A;  1K5U A;  3RMX A;  3WA1 A;  4I7I A;  3CQA A;  4I3N A;  1YBI A;  3O3Q A;  1FV2 A;  3O4A A;  3BAO A;  1ISW A;  5BXT A;  3V0B B;  1TWM A;  1S0L A;  2Y9W C;  1PZZ A;  4P0K A;  3QR5 A;  3IAG C;  3BA4 A;  1XG6 A;  2ERM A;  2X2T A;  3AKF A;  4IY8 A;  1Q03 A;  1Q04 A;  2QYI B;  3H6R B;  3FUQ A;  2Z49 A;  1PUU B;  4JKX B;  3K1X A;  3A23 A;  1ISZ A;  3LTQ A;  4JPZ A;  4XFU A;  3BAD A;  1IRA X;  5G00 A;  1YF8 B;  1W3A A;  3HBW A;  4Q91 A;  2VXR A;  3AKI A;  3HN1 A;  2YUG A;  1BAS A;  1RY7 A;  1KNM A;  3VSF A;  1HCD A;  1BLA A;  1S0E A;  1RG8 A;  4QD2 C;  2D1Z A;  3WMV A;  4XKI A;  4GOV A;  1ITB A;  1V6U A;  2FFV A;  2KKI A;  2AAI B;  1AVA C;  4ZKT B;  1TOO A;  2VXT I;  3WO4 A;  3ZXG A;  4L4I A;  1W3F A;  1II4 A;  2NVH A;  4XFT A;  3FJK A;  1WBC A;  1IHK A;  5FZZ A;  1R8N A;  2ZR1 B;  3SNV A;  5B2H A;  4AN6 A;  5BQU C;  2E4M C;  5EC5 A;  5EHA A;  4KEI A;  2D7R A;  2DRE A;  1AFC A;  4X38 A;  1DJS B;  1BAR A;  4Z8S B;  4WBC A;  1E0O A;  1HWO B;  2F8X C;  2UUS A;  4D0Z A;  1W3G A;  4H04 A;  1EYL A;  2MLL B;  4II0 A;  4EB2 B;  4ISR A;  5GAQ A;  2D23 A;  5FZU A;  4GP3 A;  4JP0 A;  1T4Q A;  1FN0 A;  3I2A A;  1G9B A;  4ZFW B;  3VUO A;  3O44 A;  3P53 A;  5D62 A;  3HMY A;  3IM5 A;  1SR4 A;  1M2T B;  3FJJ A;  3BA5 A;  4G6J A;  8I1B A;  4HA2 A;  3TC2 A;  4DCK C;  1HKN A;  1NZK A;  1CE7 B;  4G9M A;  1TWE A;  3N7M A;  4IY9 A;  1QQL A;  3HAL A;  4LO1 A;  1SZ6 B;  4HJJ A;  2D43 A;  4EFP A;  2DRZ A;  3UJ0 A;  1YYN A;  2Y9X E;  3AH1 A;  3NBC A;  3H6R A;  4G6M A;  2ZQO A;  1DZD A;  1XHB A;  3WMU A;  1Z4S A;  4QO3 A;  4J2X A;  3NBD A;  1TIE A;  2NTD A;  1Q1U A;  2FO1 A;  2D24 A;  1AVX B;  2HZ9 A;  3Q7W A;  3OGF A;  2HWM A;  2Q9X A;  31BI A;  2IWT B;  4KEK A;  3NBE A;  2KI6 B;  3FJF A;  1FWV A;  4FGF A;  3A07 A;  4G1R A;  2K43 A;  3HSM A;  1EPW A;  3I29 B;  3PUB A;  3NJ5 A;  4ZFU B;  5I1B A;  3WO2 A;  2GZB A;  3CRI A;  1HWN B;  4LO2 A;  6I1B A;  1Z2V A;  1V6W A;  3BB2 A; 
#chains in the Genus database with same CATH topology
 1PWA A;  3CLO A;  5HDN A;  2A68 F;  2HTS A;  2LBF B;  4LK1 F;  4RMN A;  3CA3 A;  4U0V A;  2DQL A;  1T8I A;  2E19 A;  5GPA A;  1L2H A;  2IA2 A;  1B4A A;  5DEQ A;  3FUO A;  2BZT A;  1DDN A;  2FMY A;  4ZC3 A;  1SR4 C;  2X2S A;  3CRG A;  2FXA A;  3LSH A;  4MEY F;  2QBY B;  4AN7 B;  4KN4 X;  4LK0 F;  4G7Z F;  1OIS A;  3BDD A;  2NS0 A;  1A6I A;  4QPQ A;  3KP2 A;  3TP3 A;  2CV2 A;  4XOT A;  1G6N A;  3L7W A;  4LMY A;  5DS9 A;  1JLX A;  2XKP A;  4HG2 A;  1ZHF A;  3KZZ A;  3H6Q A;  1QNT A;  2WAE A;  2HS5 A;  2FUG 2;  3AAF A;  4EEE B;  4KC3 A;  3E7L A;  3IWZ A;  2W7N A;  1IN4 A;  2Z33 A;  3S8J A;  1OCP A;  3T8S A;  3HGY A;  2WV0 A;  3CCJ I;  3I4P A;  3B73 A;  1PUE E;  4YEL A;  4Y3O A;  3FFZ A;  3CME I;  2FRH A;  3SXY A;  3DBH B;  3CCU I;  2DXI A;  1G3T A;  4IZE A;  3M07 A;  2OF7 A;  4ANJ A;  3NEU A;  3F22 A;  2XVC A;  3CDH A;  1IXS B;  2LSO A;  2IT0 A;  1WJE A;  3TOB A;  2CYY A;  1XPX A;  4L4H A;  3CUQ A;  3SZT A;  3WE3 A;  4JRA A;  4FAS D;  4QTR A;  4YII A;  1JHF A;  3IC7 A;  1BJZ A;  2DA4 A;  3FXU A;  3BC8 A;  4I98 B;  3BG5 A;  3CC7 I;  3MFK A;  1FWZ A;  1SFX A;  4KBB A;  2DCE A;  4P9F A;  3SHF A;  5EG0 B;  2LDU A;  5HS9 A;  2D22 A;  2K02 A;  1R9T J;  1Y1V J;  3PIO F;  1QRY A;  4HNT A;  4CSW A;  1K7A A;  1FC3 A;  2WB1 A;  3ULQ B;  3UKG A;  2L7M P;  3E97 A;  2KJC A;  3QQA A;  4XSZ F;  2LRD A;  3PSI A;  1YX5 A;  3ZMU A;  5B3S H;  5JVG F;  4A0X A;  3NAU A;  2NS7 A;  4A2U A;  1DQG A;  1VQM I;  5E3M A;  2LYC A;  5LGT A;  1XMX A;  2KKO A;  1J09 A;  3CP8 A;  1LQ1 A;  2NVX J;  3HM5 A;  2I5U A;  3BA7 A;  4IYB A;  3H9Q A;  4END A;  5HNH A;  1E3P A;  4R6U B;  1YE9 A;  2V9V A;  4LOC A;  2VON A;  1D5Y A;  1MMG A;  2Z99 A;  5KNL A;  2ELJ A;  4LIT A;  3RDI A;  1RKT A;  3A21 A;  4FE4 A;  3G73 A;  2HYJ A;  3N05 A;  4K2E A;  2VJ4 A;  2X85 A;  2K85 A;  1XCV A;  1R22 A;  3EYI A;  3Q0W A;  1FYL A;  2M34 A;  2MA3 A;  3CCM I;  2H27 A;  2R7U A;  4GP0 A;  4HX4 A;  1WJD A;  3CCS I;  1VTN C;  1IUF A;  1R1U A;  2Y2Z A;  3CUQ C;  5HPZ A;  1SFO J;  2OTJ I;  3CO6 C;  3WTX C;  3JSP A;  4L18 B;  4A3L J;  2DDA A;  2X48 A;  2ZC2 A;  3FIW A;  5DCM A;  1TNT A;  3WTU C;  4Y52 J;  1WBA A;  2ZQN A;  3BZ6 A;  1JHH A;  2FF4 A;  4JOM A;  2LC2 A;  2NAZ A;  3DKX A;  4W97 A;  3GLL A;  2NP0 A;  1Z7U A;  3LSK A;  1LVK A;  4NC6 A;  4RGX A;  3OL3 A;  3FMS A;  1XSD A;  3B9U A;  9ILB A;  1RC9 A;  3I58 A;  2MD5 A;  3HSF A;  2ELH A;  2NVY J;  1TWG J;  2DA2 A;  1SAN A;  2PMH A;  1Z7L A;  1TNS A;  4XKV A;  3FF5 A;  5E24 E;  1AF9 A;  3F8M A;  4I0Y A;  1MNM C;  5FGM A;  1JUS A;  3BAH A;  4ZFY B;  1QPM A;  2KLO A;  3KCC A;  4E7K A;  2D20 A;  4UUT A;  4KIS A;  1JT4 A;  1W7P D;  5FKN A;  1HA8 A;  4CGZ A;  4F52 A;  1N77 A;  2W85 A;  3MZ8 A;  1NHA A;  4KN7 X;  3FMR A;  1OCZ H;  4CCO A;  5K7H A;  2ZNZ A;  3LLP A;  3D5S C;  5D8K B;  1R49 A;  2DQR A;  1O7L A;  1J7K A;  1S6L A;  2Z16 A;  1HBX G;  2V1U A;  2PJP A;  2D7I A;  2AXT C;  4H9W A;  4P0L A;  5FNW A;  1X1P A;  2HR3 A;  4YFN F;  2ID3 A;  2LP0 A;  2P7C B;  1XGM A;  2DYR H;  3HRT A;  1X58 A;  2JTV A;  2ZFU A;  2MBF A;  2GZW A;  2MSY A;  3CJN A;  3BAU A;  1DGW Y;  3IL2 A;  2RNG A;  4CJM A;  3HRU A;  1KQ0 A;  1G3S A;  2FOK A;  3R0J A;  1SAX A;  2IW5 A;  3BR6 A;  4QC4 A;  3H0D A;  3WHC A;  5D5U B;  4DBR A;  2DOE A;  4OIP F;  2KIS A;  3KE2 A;  2QZ8 A;  2QN4 A;  2GA1 A;  3FBN B;  3OYD A;  3P9C A;  5EZH A;  1ISY A;  5BOW A;  2VOP A;  2IHO A;  1N78 A;  3V8K A;  4Y17 A;  3CQZ J;  2AS5 F;  5FZY A;  3A0H C;  4UVA A;  3H35 A;  5A2Q Z;  4M71 A;  1YHQ I;  3VSZ A;  3S3M A;  2ESH A;  4IQP A;  1FP2 A;  1BFC A;  4A3E J;  3WU0 A;  3ZQC A;  3GTP J;  4I2S A;  1I6X A;  3BTL A;  2M3A A;  3DTI A;  3I4M J;  1BA7 A;  1FMV A;  2UUZ A;  2VQH A;  3C18 A;  5IYB J;  1ZAO A;  3DWL E;  3RZD J;  4DEP A;  3I0T A;  3BRF A;  3JW4 A;  3E6D A;  4U0W A;  1W36 D;  4UNO A;  5GP9 A;  1HCE A;  4X39 A;  5IYD J;  1R5I D;  1MMD A;  5CVU A;  1IUY A;  2MD0 A;  3NWS A;  1B8I B;  2ACJ A;  3K70 C;  5C3E J;  3MKW B;  2IGK A;  3ZMT A;  4C2T A;  1ORK A;  1HW1 A;  3GZN B;  2IGM A;  5F8S A;  2J3P A;  4XL9 A;  2MGQ A;  4M6X A;  1KYW A;  2YX4 A;  2X1C A;  3R4S A;  1D1A A;  2VKV A;  4BKX A;  2K9Q A;  5L3F A;  2KI4 A;  3T8R A;  4F83 A;  1IGN A;  4X37 A;  1S0F A;  5FB2 A;  4ESF A;  5M5X J;  4P55 A;  3OS2 A;  1STZ A;  1FMM S;  4HF1 A;  4N0B A;  3HOY J;  3RTJ B;  3H9G A;  3FJ9 A;  4UV9 A;  3IH2 A;  3ZQQ A;  3CA1 A;  4RB3 C;  4CXF A;  3AKG A;  4IZZ A;  2D5V A;  1OQL B;  3SFZ A;  4LO8 B;  2HGC A;  4XMY A;  5FKK A;  3E5X A;  4A6E A;  4BHB A;  4A7Y A;  1YG2 A;  5D5W B;  3IM6 A;  2DJI A;  5EF6 A;  2OTL I;  4RLQ A;  4AM3 A;  3RYR A;  3AH2 A;  1K6Y A;  5ICF A;  5DUY A;  5CVR A;  3S93 A;  2KL4 A;  2FBK A;  3D0S A;  3ROU A;  3ZMD A;  3QPH A;  4CYD A;  3CTA A;  3ELK A;  1FYM A;  3KP6 A;  1YX3 A;  4DGW B;  5LBQ A;  5F0H A;  3S1R J;  1TL8 A;  3OJV A;  2OD5 A;  3C2H A;  5FD5 A;  2JUC A;  3A2K A;  1ZLJ A;  2R7F A;  2R9K B;  3FJE A;  3V0B A;  2NOG A;  4CHU A;  3H6S E;  4MZF B;  3AH4 A;  4LG0 A;  4XQF A;  4B47 A;  1YIJ I;  3V0A A;  1FBS A;  1Z67 A;  2UV1 A;  1TW2 A;  3KEY A;  1K83 J;  1MBH A;  5LEK A;  1S7O A;  1XMK A;  4UY8 I;  2EIJ H;  3HC7 A;  4XID A;  2QSH X;  4UUS B;  2JVG A;  3K1M A;  3OS0 A;  5F04 A;  3PNY A;  1N4K A;  1ZYR F;  3SZP A;  2XC7 A;  4F92 B;  3AG1 H;  4P1W A;  4R1H A;  5ICC A;  3ABL H;  3OJ2 A;  2IXS A;  1A5J A;  2Q2E B;  2DFF A;  3UD7 A;  3LWF A;  3VT2 A;  2R7O A;  5JLV A;  1RML A;  2Y0M A;  1JKQ C;  1OKR A;  2EQR A;  5CKT A;  1UFM A;  3GBG A;  3R0A A;  3V42 A;  1X19 A;  4YFX F;  1G8X A;  3FHZ A;  3F6V A;  2RAE A;  2RN7 A;  3G1M A;  1DU0 A;  1AVW B;  4ISQ A;  2K4A B;  1LPQ A;  3O5W B;  1X3U A;  1S9H A;  3N97 A;  1UST A;  1HWM B;  5HDG A;  1CGP A;  3B6A A;  3W9T A;  2CW8 A;  4LIV A;  2Y31 A;  1TFM B;  3N7K A;  2M2E A;  1BLD A;  2EV6 A;  2EZL A;  2VJ5 A;  4HQE A;  2RQ9 A;  2JA8 J;  4Y4R A;  2YR2 A;  4M3F A;  2IJL A;  1XB4 A;  3CQA A;  4ESB A;  1YBI A;  1GVD A;  1HF0 A;  1XMA A;  1BL0 A;  3O4A A;  1ISW A;  2M5W A;  4IHS A;  3EET A;  3QRF F;  2IAI A;  5F08 A;  4CA0 A;  4PFO A;  4S0H B;  1S0L A;  2Y9W C;  1MBF A;  1QGP A;  1YS6 A;  3DPT A;  1PZZ A;  2NS2 A;  3F72 A;  2K3P A;  1IN7 A;  4NDL A;  2QM3 A;  1JTY A;  1R23 A;  4X0G A;  1XG6 A;  3OYJ A;  4GRI A;  4C2M J;  3O2P E;  2ERM A;  2V26 A;  3AKF A;  4IY8 A;  5LRS A;  2CS3 A;  3H6R B;  4PCQ A;  4AIH A;  3CF5 F;  2K9N A;  1BR1 A;  2YSR A;  3A23 A;  4XFU A;  2R7Q A;  1VQN I;  4B4C A;  2W57 A;  3BAD A;  3CJR B;  1IRA X;  5JLX A;  5G00 A;  1W3A A;  3L9F A;  4LB6 B;  1RUN A;  1FLI A;  3KP5 A;  4AVZ A;  1IV8 A;  3K4C A;  3VSF A;  4CCM A;  1OCT C;  4OAY A;  3TKY A;  4S04 A;  1V6U A;  2KP6 A;  2XSD C;  4RLF A;  1APL C;  1AVA C;  1W0U A;  2VB6 A;  2ZJR F;  1XDS A;  3MVP A;  3RI4 A;  2A6E F;  1ZGW A;  1SFK A;  2BXY A;  2NVH A;  1IHK A;  1BOB A;  1XDU A;  4C3H J;  1NG6 A;  2ZR1 B;  3SNV A;  1UCR A;  2LRE A;  4PZJ A;  3J80 K;  2L4M A;  1B1B A;  2KDO A;  1K78 A;  3IKV A;  5L3B A;  5EHA A;  4BHC A;  2D7R A;  1UEL B;  3AG4 H;  2M7A A;  4M3G A;  4NUB A;  4HQM A;  3LOC A;  4ITV A;  4OIO F;  2ZJP F;  4WBC A;  5BS6 A;  1REP C;  1N25 A;  2QCO A;  5ILV A;  5KAF C;  1P7I A;  4JX4 A;  2MW8 A;  4GXO A;  5CQE A;  3WOD F;  4A3D J;  2VC1 A;  2XGC A;  3BY6 A;  3C2G A;  4EB2 B;  1JUM A;  5GAQ A;  4XLN F;  1UHW A;  3VSL A;  4OIQ F;  5EEA A;  1T4Q A;  2COB A;  3HPG A;  3I2A A;  3MKZ A;  3U2R A;  2MC4 A;  2XKO A;  5D62 A;  2IEK A;  3IM5 A;  1X1A A;  3WTY C;  3JTH A;  1ZGA A;  5E17 F;  2FD5 A;  3GTQ J;  1V54 H;  3HTS B;  3OYH A;  2EFP A;  2HQN A;  1UB9 A;  2CQ7 A;  4MQ9 F;  3RQ4 A;  1QU3 A;  3DEE A;  4ON0 A;  4RB2 C;  5HLT A;  4ZYH A;  3LSP A;  2DT7 B;  1WWX A;  4I0A A;  3DPU A;  3S16 J;  3G1O A;  3OWT A;  2K3F A;  1CE7 B;  1TWE A;  2EA2 A;  2VE8 A;  4G9M A;  5E3L A;  1KZH A;  2PLY A;  4IY9 A;  3HAL A;  4L5E A;  2F5V A;  2L7Z A;  4H4K C;  2C6Y A;  4A0Z A;  3CUQ B;  1Q1H A;  2FEZ A;  2ZO4 A;  2DRZ A;  4EFP A;  3PJR A;  2LKP A;  1T0F C;  1T2K A;  2HQA A;  1R7J A;  1XHB A;  2HFH A;  2DA3 A;  4QO3 A;  3MKL A;  3LA2 A;  1JE8 A;  2V79 A;  3NBD A;  1TIE A;  4G6T B;  2H94 A;  2FO1 A;  2D24 A;  3O8G A;  3QYB A;  2MYS A;  4KMU X;  5LD2 C;  1HKS A;  3GTO J;  3NWT A;  2D2W A;  2L9R A;  3I53 A;  3GUD A;  1YYV A;  4A3M J;  4Q48 A;  2DN0 A;  4D0P A;  1O3Q A;  1K61 A;  2GOM A;  2K43 A;  4HLY A;  3HSM A;  1J75 A;  4KDP A;  1B9M A;  5DTD A;  5I1B A;  4ZFU B;  2GZB A;  3LQR A;  4LO2 A;  2ZSH B;  3SEZ A;  3HGG A;  4XLH A;  6I1B A;  4MNU A;  3K1N A;  4U7D A;  2Y69 H;  4X1E A;  4RAG A;  4I02 A;  2DS0 A;  1ONK B;  2RKH A;  4XN0 A;  5JLW A;  1T98 A;  3E3V A;  2LY9 A;  2VPR A;  3OYI A;  2WBM A;  2EBI A;  2JRT A;  2KIQ A;  2MLG A;  2BY3 A;  1FBQ A;  5D4S A;  1PC8 B;  2XIG A;  5M5W J;  2ZXH A;  5DSS B;  5HLI A;  3W6V A;  2E7X A;  4LO3 A;  1I3Q J;  3O4C A;  2EWN A;  3JRB A;  1NUN A;  3VOD A;  1IF1 A;  1RIO H;  3W3C A;  4CUG A;  4E70 A;  3BX1 C;  3MWM A;  4L9T A;  4BHP A;  3FXQ A;  2HPI A;  4OIN F;  3BG9 A;  3BR3 A;  1JI8 A;  2XOA A;  4HV6 A;  1F43 A;  4WXC A;  2LTP A;  3I9V 2;  2KH2 A;  3OYC A;  4M74 A;  2L01 A;  4X6A J;  1CVS A;  2PJR A;  4MQV A;  1WD4 A;  4UV8 A;  3IAM 2;  3Q9S A;  1P63 A;  3CU1 B;  1TLH B;  3OV8 A;  1DPR A;  5DCM B;  5KHD A;  2VPL A;  1IRZ A;  4OUJ A;  2GXA A;  2VUA A;  1L0O C;  2JA6 J;  2WV1 A;  4BBR J;  2Z9O A;  1XZZ A;  3VWC A;  1MC9 A;  4A93 J;  3WE2 A;  2AFG A;  1FEX A;  4DOZ A;  4ENM A;  4CDG A;  1WH5 A;  1ITY A;  2STT A;  3RSJ A;  4ZTF A;  3WGH A;  3CCQ I;  3K7A J;  1DQU A;  2QKM B;  2CV0 A;  3OGG A;  4II3 A;  3IAS 2;  4ZYA A;  3J7A O;  1ZK8 A;  2WWY A;  3KLO A;  2RG9 B;  2K7L A;  3W2W A;  4HNV A;  1Z0X A;  5HLH A;  4LO2 C;  3S1M J;  4LO0 A;  1FTT A;  2Y9G A;  2DU9 A;  2F5D A;  1BI2 A;  2DT5 A;  1BFG A;  4P6A A;  3J81 K;  2E34 A;  2HQR A;  4AD9 A;  1FSH A;  1I1G A;  3DEW A;  3L2W A;  5BXR A;  4DNC A;  1BR4 A;  3J80 Z;  4KMF A;  1QBJ A;  1D8K A;  4J2S A;  3KMV A;  2V1X A;  5ILS A;  3DU6 A;  1WHU A;  3BRD A;  1A6Q A;  2DBB A;  4M3E A;  1BI0 A;  4LO3 C;  2L9N A;  3GXO A;  3KP4 A;  2JA2 A;  5F6F A;  3FXR A;  1FJL A;  3LSM A;  3SQN A;  5D4R A;  2F48 A;  2K27 A;  3OSG A;  1NH3 A;  1J0S A;  1S0G A;  1W5S A;  3FJI A;  1R1T A;  3S1N J;  3TO9 A;  2OPT A;  2AXL A;  5FNX A;  2BE5 F;  3CA6 A;  3RQI A;  1C0W A;  2GQQ A;  1HCR A;  1X3W B;  1VCL A;  2O9L A;  1WI3 A;  2AQZ A;  2DMU A;  4JQ0 A;  2XB5 A;  1ZR4 A;  21BI A;  1VI0 A;  2M45 A;  2Z3Y A;  3T8T A;  2ECB A;  1D0X A;  1U5T A;  5E3N A;  2M49 A;  2EZK A;  3A03 A;  4ZTJ A;  1WKM A;  3BR2 A;  2H6B A;  1MJA A;  3S8K A;  2XF7 A;  3TDZ C;  4C9Y A;  3GME A;  5CJ9 A;  3TGN A;  1KGS A;  3N0K A;  3U21 A;  4GOY A;  3BP8 A;  4XLA A;  4CCJ A;  2RRE A;  4FVV A;  1E3H A;  4ZGR B;  2K9S A;  2V1N A;  1YS7 A;  1IW7 F;  5CVV A;  4CYC A;  1EV7 A;  3BQY A;  1VND A;  2VQG A;  1K4T A;  2BVM A;  3DQV C;  4LO0 C;  5K7Z A;  4I4Y A;  3S3O A;  5FJ8 J;  2HNH A;  2CFO A;  1Y8Q B;  1TWH J;  5H2F C;  3K10 A;  1FOW A;  1ZRC A;  3D7W B;  1P9Q C;  1YFH A;  1AA7 A;  4XRM A;  2W4S A;  2BBY A;  3S2H J;  4NBQ A;  3OYK A;  2NYY A;  3K4J A;  2R7S A;  3GTJ J;  1H89 C;  4YIF A;  2JK3 A;  4CZC A;  2QVO A;  3GVA A;  3Q5F A;  5BVP I;  3IV5 A;  3TED A;  2CUZ A;  1XN7 A;  1K79 A;  3BPX A;  1H88 C;  3ESW B;  3GCM A;  2JPB A;  1TZL A;  1RI7 A;  1UZC A;  3GFJ A;  1USS A;  3ZX7 A;  4I4S A;  1S0B A;  2A61 A;  1ONV A;  2ZXW H;  4P9U A;  3UD8 A;  4V19 K;  5EEG A;  3KP3 A;  3ABM H;  1IO2 A;  2LF8 A;  3CCL I;  5E1X A;  2DPU A;  4N4O B;  5F1J A;  4ION A;  1S5L C;  1A04 A;  4BDZ A;  4PJM A;  1U9O A;  2O7O A;  1XGS A;  1U5T C;  2CU7 A;  4OAZ A;  1IRG A;  3GEZ A;  1RR8 C;  4DYR A;  2VOO A;  4BJ5 C;  3FJH A;  4OWJ A;  4QKS A;  4OOI A;  2A5Y B;  3VFZ A;  3BRO A;  1YI2 I;  4U88 A;  2BY1 A;  4MFD A;  2HWA A;  4J23 B;  1WJC A;  1O57 A;  3CLQ A;  2HOT A;  1H0M A;  1IG7 A;  2UZK A;  1DUX C;  2VUM J;  4HAM A;  1CF7 A;  2F4O B;  1IIL A;  2I1B A;  4XKC A;  1BIB A;  2BVL A;  3UJ4 A;  3LST A;  3PSF A;  1SVM A;  4ZYG A;  4IQ4 A;  1X4P A;  4Y7N J;  1W5T A;  2DW4 A;  3KYL A;  4GAI A;  2W24 A;  3ISP A;  1P92 A;  4PK4 A;  2OA4 A;  3QP6 A;  1ON1 A;  2XF5 A;  1PYV A;  1GXP A;  1G9D A;  3J7A Y;  3W2V A;  1T9F A;  3REO A;  2OZU A;  2DMT A;  2NOJ B;  2EFW A;  1EJ9 A;  1SVL A;  3V0A B;  1AKH A;  4LO7 C;  1M1E B;  2Z2S B;  1YJ9 I;  3CRH A;  1D0Z A;  1HW2 A;  1R4N B;  1IN5 A;  2KJB A;  1ZEL A;  2P8T A;  2V6E A;  3EDP A;  2QYO A;  3BAG A;  1R5G A;  3K2A A;  1T39 A;  3BT9 A;  1V6V A;  4YG2 F;  2H8W A;  3OYL A;  5EJC A;  3WIN A;  3CA4 A;  4HR6 C;  2FQ4 A;  3G3Z A;  4KIF A;  4OEG A;  3QAH A;  3FKJ A;  4XLC A;  1U2W A;  3OIP A;  5DV5 A;  2VQL A;  3J81 Z;  3ZOB A;  3C1D A;  3Q7Y A;  4A5M A;  4BXX J;  4I4O A;  1FGA A;  5AIQ A;  5EGO A;  2E1M C;  4BQA A;  4Q9P A;  3CF2 A;  1YW7 A;  1MDM A;  2WAQ N;  2ET2 A;  1QQI A;  4G9Y A;  4M9X A;  5ERI A;  3OYA A;  2D45 A;  4J00 A;  4QIW N;  1MSF C;  1ZRE A;  3IHU A;  4BQO A;  4V2G A;  1J9I A;  4DJA A;  1O7F A;  4XOP A;  1V55 H;  1R36 A;  5M3M J;  2RQQ A;  1XYF A;  3CO7 C;  4UVB A;  5CPR B;  2OC6 A;  3K69 A;  3GLX A;  1MJ9 A;  2ETH A;  3FJD A;  3LSR A;  4B3A A;  1UG0 A;  4WXH A;  1JJ8 C;  1MGT A;  1P4A A;  3C3W A;  2M7B A;  4C3J J;  1JT5 A;  2HOE A;  4M6V A;  5E3O A;  3AL0 B;  3T5X A;  1PP8 F;  2A6H F;  4C30 A;  1GGP B;  2XPV A;  3O4B A;  3FWE A;  3F3X A;  3HEF A;  2BOL A;  1WJA A;  3R4U A;  1SD5 A;  4BQQ A;  5KCM A;  4LJZ F;  1VQ9 I;  4A7Z A;  1HW5 A;  4DYC A;  4OWL A;  2QKL B;  4D5F A;  3UNG C;  3V8L A;  1QPI A;  1Y8R B;  3BTI A;  4L0Z B;  2FML A;  2RDP A;  1ZGJ A;  3EQL F;  2FOW A;  4E7L A;  1S72 I;  3M1C A;  1ETQ A;  3O8H A;  2M0C A;  2JRM A;  3FMQ A;  4BQN A;  2LOO A;  3WIN C;  3WU1 B;  2R5Y A;  4I76 A;  2X1E A;  3VYT B;  2CJJ A;  2HI3 A;  4ENN A;  3ZN1 A;  4NHJ A;  1IV6 A;  2G7U A;  3GF2 A;  3GZ5 A;  1HKT A;  2LF7 A;  2XAS A;  1A35 A;  4P0J A;  2VBX A;  3HB9 A;  3LMM A;  1QQK A;  5FLX K;  1PUF A;  3MZH A;  4BEH B;  1J59 A;  2YUS A;  1LE8 A;  4IHY A;  4O3M A;  3W2A A;  3TW7 A;  3HL2 A;  4I37 A;  1UAA A;  3JRD A;  4L9N A;  4M6Y A;  4I99 C;  3LAJ A;  2ZME A;  1K78 B;  2E1C A;  5H6R A;  3WO3 A;  3KIO A;  2RST A;  2D1V A;  3VB2 A;  3H36 A;  2P5K A;  2P23 A;  5F8W A;  3V7C A;  4GDF A;  2BEA A;  3E6M A;  3KFW X;  2AHQ A;  1XG1 A;  4CO8 A;  1DIW A;  2VLC A;  3BAV A;  3BTJ A;  4DZP A;  3RMY A;  2Y30 A;  4J19 A;  2BW3 A;  2PN6 A;  1LNW A;  3FXO A;  2XPU A;  1X1D A;  4D7M A;  5L3G A;  4YFK F;  4FQG A;  3P6I A;  2P5V A;  2O61 A;  3H1C A;  1FMZ A;  1V3F A;  5EZG A;  4AIJ A;  1MIJ A;  2ECC A;  3PIP F;  3MAJ A;  5KAI C;  1ZG5 A;  3OL4 A;  4ENK A;  5BQU A;  4KUM A;  3BTA A;  2P7V B;  4OMZ A;  2ELK A;  3I54 A;  3KPH A;  1K5U A;  3RMX A;  1U8B A;  5J6X A;  3I3L A;  2VXZ A;  4RM2 A;  1QVU A;  4UB6 C;  2P4W A;  3HJE A;  3S2W A;  3WTT C;  3O3Q A;  1ZLK A;  4L9J A;  3S32 A;  2CQQ A;  2EV0 A;  4AID A;  3ONQ A;  1W7P B;  1TQI A;  1R1V A;  4BY7 J;  3ZMZ A;  4FX0 A;  2VJJ A;  3TO7 A;  3JRH A;  3QR5 A;  4BUP A;  5IP6 A;  3BLY A;  3GFL A;  3BA4 A;  2LG4 A;  4CCK A;  2DFE A;  2BEO A;  2GOX B;  1T33 A;  4PGG A;  4F93 B;  3F8N A;  2X2T A;  2ME0 A;  1MBK A;  2Q8K A;  2XGX A;  4EJU A;  1S7E A;  1LKX A;  1FTZ A;  5CYV A;  2Z49 A;  4JKX B;  4PSW A;  1VQ5 I;  1QHG A;  3K1X A;  3H5N A;  4P5O A;  3LTQ A;  3OOU A;  2QF7 A;  2FJ1 A;  3ZMS A;  3OYG A;  3HRS A;  4WWC A;  4HST A;  4WF2 A;  3KET A;  2R7Z J;  3HN1 A;  3OMY A;  4E7J A;  2ZME C;  1RY7 A;  4HPQ A;  1AU7 A;  1S0E A;  2X0L A;  1RG8 A;  2DFH A;  1IAW A;  2KIU A;  1EF4 A;  3L2R A;  3OYB A;  3FK7 A;  4L0Y B;  1Z6T A;  4W1U A;  4XRS G;  4Y13 A;  3I56 I;  2L7K A;  2FFV A;  2EPF A;  4YRV A;  2XGD A;  3D1N I;  2R5Z B;  1FBU A;  4L4I A;  2XHK A;  5D8L B;  2K40 A;  5E1Z B;  3F23 A;  2P6T A;  3J7Y J;  1IXC A;  1JGS A;  2RQP A;  1II4 A;  1WBC A;  5LHH A;  4MHG A;  2K4B A;  3VYR B;  4EEF G;  5BQU C;  1LFP A;  3OR2 C;  2WTE A;  2DAO A;  3TMO A;  1QZE A;  4D5C A;  2WY8 Q;  4RGU A;  4KEI A;  5IT9 K;  2PQ8 A;  1AFC A;  5J8C A;  3TW6 A;  2CO5 A;  2HYF A;  3ZN0 A;  4G7H F;  1DJS B;  5J47 A;  1BBY A;  3K4M A;  4HEA 2;  3W6K B;  2CW0 F;  1YJW I;  4ZJZ A;  4BBS J;  3ZQF A;  5B1B H;  3SDB A;  1XCB A;  4XLE A;  1I1S A;  1KQ8 A;  1W3G A;  2MLL B;  3IH3 A;  1FZP B;  1POG A;  2HVQ A;  4ISR A;  3KZY A;  4RS8 A;  1O3R A;  2PJR B;  1YOV B;  3MCZ A;  4AUX A;  5DDG A;  4BJT A;  2XV4 S;  1Y0N A;  2LBF A;  3O44 A;  1XSX A;  2LK2 A;  4FT8 A;  3HMY A;  1JT6 A;  2E2J J;  2WAQ A;  2HZD A;  1B6A A;  3BA5 A;  1UHM A;  3ZQL A;  4HA2 A;  5DUI A;  3VSK A;  1JXS A;  2CWE A;  3WG9 A;  1YIT I;  2STW A;  2CH0 A;  4Y15 A;  1HKN A;  1NZK A;  1I3A A;  3AKZ A;  4IHV A;  2FE3 A;  4LO1 A;  4RM3 A;  1OCO H;  4HJJ A;  3BWG A;  2V4J C;  3UJ0 A;  2Y9X E;  2OV7 A;  5IP9 J;  4XSX F;  2IP2 A;  2DPD A;  4PSX A;  3NBC A;  4GO1 A;  2ZFW A;  3OR1 C;  3WMU A;  1Z4S A;  2QWW A;  4IEJ A;  4OIR F;  1ETV A;  1JKP C;  2NTD A;  2XDV A;  2DJN A;  2VBZ A;  1AVX B;  3WGG A;  3HOV J;  3OGF A;  3ZGK A;  5ILU A;  3EUH A;  3B6C A;  2HWM A;  1ETX A;  2BY0 A;  3BR0 A;  4XKB A;  4EAT A;  4XNF A;  1KU9 A;  3FJF A;  1IDY A;  1FWV A;  3HIF A;  3EPZ A;  5B66 C;  4FGF A;  3JAM K;  2XF6 A;  4ZDL A;  2QEN A;  4A12 A;  2ZJQ F;  1EPW A;  3DKY A;  1LFU P;  1WRJ A;  4HX7 A;  3WO2 A;  3H0G J;  2NXN B;  2XAH A;  1LEA A;  1NK2 P;  3GTG J;  1HOM A;  2HOS A;  4P96 A;  1V6W A;  3BB2 A;  1U3E M;  5ICG A;  5CLS A;  5D61 A;  5EG0 A;  1MMN A;  1BFB A;  3AJ5 A;  2FDB M;  4XR6 A;  2DTR A;  2WY7 Q;  5LLQ A;  2L5X A;  3F9K A;  4Q5S F;  1ETY A;  1XGN A;  1WJ5 A;  2LLK A;  1FY7 A;  1F31 A;  1WZ2 A;  5BP5 A;  3I71 A;  1S8N A;  4Z2Y A;  3BAQ A;  1EV2 A;  1XTA A;  4LG3 A;  1X2N A;  2KPM A;  1TWA J;  4EM2 A;  1U9N A;  2EFQ A;  3DLA A;  4EQQ A;  1SEU A;  1MBG A;  3ZC8 A;  4KIC A;  1WGX A;  2KLL A;  2AQF A;  2PI0 A;  2VIX A;  4F55 A;  2QQB A;  1IXR C;  4JK1 X;  3FJB A;  4LO1 C;  3LSJ A;  4GAF A;  2HEO A;  2HDW A;  2K5C A;  3RYP A;  1PDN C;  41BI A;  1IRX A;  2DT6 A;  3JTG A;  4CYC B;  2LD5 A;  1SD6 A;  3LA3 A;  4BL0 B;  2BEB A;  3DKW A;  2E35 A;  2K9L A;  4EJO A;  1WJB A;  1MH4 A;  2R93 J;  1IN8 A;  4ZDP A;  4KNY A;  3LSG A;  3IIR A;  2IS6 A;  2FFU A;  4HA8 A;  3ZP5 A;  1MKM A;  3IM7 A;  4LO7 B;  2L9V A;  3ZR8 X;  2JA7 J;  4I4V A;  3EUH C;  1BOA A;  3DBR B;  2CUJ A;  2HVR A;  3F62 B;  5JMC A;  2D1H A;  3HHG A;  1P6R A;  1T0F A;  1B72 A;  1PUM B;  2CQN A;  1XX5 A;  2OBP A;  4J2K A;  1DZC A;  3EUA A;  2MLK A;  3IH4 A;  5B5E C;  2RGV A;  1WD3 A;  1DQO A;  2HDD A;  1O3S A;  2EA4 A;  1Y0U A;  3M9A A;  4J2Y A;  1SMT A;  2NVT J;  2JVH A;  2LNB A;  4Z9W B;  3RTR A;  3RKX A;  2E1M B;  4D7N A;  2JJ7 A;  3N7J A;  1KU7 A;  3QYD A;  5BP5 C;  2A6T A;  2RC4 A;  1F1Z A;  2UXN A;  1HLV A;  2EV5 A;  2VBW A;  2ZNY A;  4D0T A;  3ECO A;  3M8E A;  1K5V A;  2ZSI B;  1JUP A;  2JMW A;  3POK A;  4MEX F;  4F34 A;  1R4M B;  4F7Z A;  3DCF A;  3PFY A;  2HPM A;  4NNJ A;  4BXU A;  5HNF A;  2M30 A;  4RAZ A;  3FIS A;  5HOD A;  2B63 J;  2L4A A;  1P2F A;  4IXA A;  3P7N A;  3OBR A;  3ZQ7 A;  4YIR X;  1ZTR A;  3D5R C;  2LKS A;  1E3O C;  1WJF A;  4QBC A;  2E71 A;  4PDK A;  3SEQ A;  5F0F A;  5TIS C;  3ZPL A;  1FP1 D;  3CA5 A;  3OBT A;  2BFH A;  1G9A A;  3CJT B;  1S7A A;  1T08 B;  1BC8 C;  4CZZ A;  1LDJ A;  3H3U A;  2WAF A;  2G9W A;  3BOQ A;  4QPO A;  1AKH B;  1ON2 A;  1YJN I;  4OW4 A;  4Q9G A;  2KIF A;  4IO9 F;  1T56 A;  4EJW A;  3CA0 A;  4ZLB B;  1W5C C;  3NAR A;  2DRY A;  2FGF A;  2QUF A;  3SJM A;  4KYW A;  3UDA A;  5EDN A;  2GXG A;  4KT5 C;  2BY2 A;  2F6C A;  3DF8 A;  4QBV A;  1I27 A;  2MC2 A;  5JI6 A;  2VXD A;  4JKQ A;  3DTK A;  1JJ6 C;  3GTM J;  2O3F A;  5EEH A;  5K5R A;  2PMU A;  3F8C A;  5IOZ A;  4B8X A;  3N4M A;  1BFF A;  1DGR M;  3HKZ N;  4JYK A;  4I4X A;  1M16 A;  1JTC A;  1D1B A;  4FTH A;  3LAP A;  3DLL F;  2G0E A;  3BJ6 A;  5EGO B;  1K6O A;  1MDM B;  3F1R A;  3KZI C;  3G6E I;  2KHM A;  1WH7 A;  2JSP A;  3OYN A;  4ZA3 B;  3CUO A;  5CVJ A;  1A8D A;  1P7J A;  4PFP A;  2Y48 A;  5DCF A;  2QEX I;  1TP0 A;  5F64 A;  2OJE D;  2FNA A;  5DD8 A;  4ZOT A;  5TGT A;  1VQP I;  4UHT A;  1VQ8 I;  2MG4 A;  4B44 A;  1TP4 A;  4M9S A;  1JKR C;  3FDY A;  3FJC A;  2Z5U A;  3DU5 A;  4M3D A;  3E8L C;  3R61 A;  4XIC A;  3O49 A;  3PHZ A;  4OEE A;  5IOY A;  2IS4 A;  1OCR H;  1B8I A;  4IF4 A;  2LIE A;  4MTD A;  2XRO A;  4I4U A;  3GWZ A;  5DM6 F;  2DA5 A;  1VQ4 I;  3CCR I;  2LVS A;  1LUJ B;  2KT0 A;  4I96 A;  4BAY A;  3L2Q A;  2J5P A;  3DP7 A;  4EJV A;  4A3G J;  2XAQ A;  4XRF A;  4L9V A;  1JTX A;  1OQY A;  2DDB A;  2YS9 A;  3R60 A;  3K9T A;  4MGR A;  1WFX A;  3TL4 X;  2DA7 A;  2N8G A;  4MFE A;  1F5T A;  3C2B A;  3CMY A;  4QKR A;  2XRN A;  1R58 A;  3FM3 A;  5L3D A;  2WBC A;  5DVH A;  2LMD A;  3F8B A;  5BOX A;  3MZY A;  4A0Y A;  2A3S A;  3PUF A;  1ERD A;  4ZZL A;  5JVT A;  3AG2 H;  2JQ7 A;  4M72 A;  4R79 A;  2ME6 A;  3V8J A;  3CC2 I;  3I55 I;  1X3Z B;  2AXM A;  3KEQ A;  2E7W A;  3RTI B;  4FX4 A;  1AXM A;  3HUG A;  3MMY B;  2KRC A;  4JAW A;  3KYC B;  3A4C A;  1ZQ3 P;  4KIT B;  4EV0 A;  4F3Q A;  4I0B A;  1LE8 B;  3ASN H;  3LA7 A;  2LY2 A;  4KIG A;  2W00 A;  1JT3 A;  3IWF A;  2X9D A;  2K86 A;  2HVS A;  3I59 A;  2VKE A;  1TQP A;  2O5R A;  1PP7 U;  5E1W A;  5GPC A;  4D9J A;  2X6X A;  1X4O A;  2A05 A;  2EFO A;  3A1Y A;  1S29 A;  3FKI J;  4PUS A;  3Q3S A;  2VU9 A;  2DI3 A;  2DMN A;  5CVI A;  1FOY A;  4UUV A;  4A6D A;  3A0B C;  1W0T A;  4OU0 A;  4RGR A;  5GAH J;  3HOX J;  1DFC A;  2IBD A;  2DK5 A;  3BR1 A;  3BCB A;  1D1C A;  2MH2 A;  3E5U A;  3J7Z I;  3PME A;  1FNN A;  1OMI A;  5J4V A;  5BXP A;  3F0C A;  1D3Y A;  2X4H A;  1HST A;  2XUB A;  1OPC A;  3JCU C;  3CCV I;  1ISX A;  4WXD A;  3TP0 A;  7I1B A;  1RKW A;  1FX7 A;  1IOB A;  3G2B A;  4BGD A;  5IY5 H;  3EF2 A;  2DA6 A;  3BG7 A;  4A7K A;  1VF9 A;  4N4N B;  2Q2E A;  4XM3 A;  3AKH A;  2L5Q A;  5HS7 A;  3P9I A;  1XGO A;  2NVQ J;  3S2D J;  5LRR A;  3V79 C;  1U0J A;  5D63 A;  2L54 A;  3WTV C;  3MPP G;  1HWP B;  1GUU A;  4TV7 A;  4HDU A;  3RKQ A;  3QPS A;  5C4X J;  4HRI A;  1QHH D;  4USO A;  3PL8 A;  4B1R A;  1YW8 A;  1ZR2 A;  3VYS B;  4QLC U;  1VFC A;  1FV3 A;  1X1C A;  1E0E A;  1Q1V A;  2JZY A;  2AQE A;  4I1B A;  5CQG A;  1MD6 A;  1F4K A;  3X2Q H;  3PO3 J;  1Z3Y A;  2NZ9 A;  1J5Y A;  1S0C A;  2ICW G;  2DFI A;  4QSH A;  1BN5 A;  4HBL A;  2V9P A;  4CIC A;  1YTO A;  4E7H A;  3HSR A;  3V7R A;  2FSW A;  1XC5 A;  1OR7 A;  2Y9Y A;  4NQW A;  1PVE A;  3ZXD A;  4DEN A;  5BXS A;  1UMQ A;  1G82 A;  2ESU A;  2R7X A;  1E2X A;  5IP7 J;  2IS2 A;  4N9I A;  3VDX A;  1UPS A;  1FOK A;  5JFR A;  4WCG A;  3FJA A;  3S8P A;  5J1Y A;  3I64 A;  1KON A;  2HKX A;  2M8G X;  4L5J A;  2EZH A;  1T38 A;  2O03 A;  3WU2 C;  5FO5 A;  2QLZ A;  3ZQI A;  4TLP A;  2E1N A;  4G7O F;  3OOP A;  4AU7 A;  3SYT A;  1IT0 A;  3WG7 H;  4J01 A;  3A22 A;  1ETO A;  4OWR B;  1BW5 A;  1MNE A;  2R7T A;  1MH3 A;  3MEX A;  2GXB A;  1FQ9 A;  3BTC A;  4I4R A;  3GW2 A;  2ISZ A;  2GO2 A;  1ABR B;  1DFQ A;  5FKM A;  5L3E A;  4I4Q A;  4I01 A;  3QOP A;  4O6J A;  2LFB A;  1DP3 A;  3FJ8 A;  1ILR 1;  3BRG C;  2QQ9 A;  2UXX A;  4IPA A;  4I1E A;  1DU6 A;  4C3I J;  4EMS A;  4XFS A;  2JWT A;  1X2M A;  3IUO A;  4L5I A;  5K5Q A;  3HOU J;  1QA6 A;  4M73 A;  2A07 F;  3CMA I;  5C44 J;  4BY1 J;  1GV5 A;  1SD7 A;  1OYI A;  3BR5 A;  3RIR A;  4CCL A;  3K2Z A;  3ABU A;  3HKZ A;  3ZMV A;  4I6I A;  2KRF A;  4CH7 A;  5GAE J;  4A3I J;  2HQ5 A;  2KRH A;  1Z9C A;  2E2H J;  4GFB A;  4YOL A;  2E4M A;  1V5F A;  1G59 A;  2L7F P;  4UY4 A;  2R7W A;  4BH9 A;  5FRN A;  2RVC A;  4MTE A;  4I3N A;  5F27 A;  3W6J B;  4G94 A;  3FM5 A;  2F5C A;  1ZH5 A;  3V0B B;  1OR7 C;  4P0K A;  2MC3 A;  1TW3 A;  3IAG C;  4HV5 A;  2FNP A;  4LG0 B;  4A3B J;  2EK5 A;  2NVU B;  5J4Y A;  1Q03 A;  2PBI A;  1OLT A;  2MFZ A;  1ZRD A;  5BMZ A;  3FUQ A;  1RZ4 A;  1PUU B;  2JSC A;  4G6D A;  1R00 A;  4FCY A;  1YRN A;  1ISZ A;  4LFU A;  4DBQ A;  4JPZ A;  4HF2 A;  1LDK B;  3PNV A;  5GTI C;  2V7F A;  5A2Q K;  4LGW A;  1YF8 B;  3HBW A;  4HF0 A;  3I4N J;  3AKI A;  4Q91 A;  2XAU A;  1BAS A;  5H6Q A;  1KNM A;  2H6C A;  3LFU A;  1BLA A;  4A3K J;  1RRJ A;  4QD2 C;  3WMV A;  1BC7 C;  2M9H A;  4XKI A;  2DO7 A;  4E7I A;  4GOV A;  1VQL I;  2B0L A;  3JRF A;  1B9N A;  2M4K A;  2KKI A;  4AVP A;  1J0R A;  4EM0 B;  1TOO A;  2VXT I;  3JRA A;  3WO4 A;  4HNU A;  2ZBK A;  3RPU A;  1W4M A;  3G4S I;  1G2H A;  2HWV A;  3BQZ A;  1W3F A;  1VQ7 I;  4FHT A;  3QOD A;  2R0Q C;  2TCT A;  3FJK A;  3GTK J;  2M8E A;  5FZZ A;  1VQ6 I;  3QWL A;  3MD2 A;  1WPK A;  4AN6 A;  5D6F A;  2E4M C;  2WAD A;  2O6G E;  5EC5 A;  4DYQ A;  5B1A H;  5D5X B;  4PJ0 C;  4H0E A;  1I50 J;  4ZH4 F;  4E6K G;  1TC3 C;  3OS1 A;  1ODD A;  5BNG A;  1LFB A;  3H3Z A;  4EVI A;  4IRH A;  5FRO A;  1BAR A;  2X51 A;  3O3K A;  2RNJ A;  4U87 A;  5J8F A;  1E0O A;  4IOC F;  2F8X C;  4BE2 A;  4H04 A;  1EYL A;  3ECH A;  4GCV A;  1RPW A;  3TDU C;  4LLL A;  1MZB A;  4EGZ A;  1WCM J;  2VJI A;  2D23 A;  4JP0 A;  1BR2 A;  1G3W A;  5JR3 A;  1FN0 A;  1G9B A;  3U1K A;  4NB5 A;  4IKF A;  3VUO A;  4YEJ A;  3P53 A;  2DMQ A;  2H09 A;  2PEX A;  3DTE A;  2HXI A;  3PFI A;  3K1P A;  2NNN A;  3H5R A;  2R3S A;  2E2I J;  1KQ9 A;  3A01 A;  5BPI A;  2QGU A;  8I1B A;  2EB7 A;  5M3F J;  4G6J A;  5LGU A;  1MND A;  3JRI A;  3KP7 A;  2H8R A;  3TOA A;  3LFK A;  1MW7 A;  3FBI B;  3PO2 J;  4RGS A;  1A36 A;  2F2E A;  4EM1 A;  1B72 B;  1N75 A;  1SMY F;  3K4L A;  1QVT A;  4FIS A;  1IC8 A;  1SZ6 B;  2M1B A;  2D43 A;  5LGN A;  1YYN A;  1GT0 C;  2LR8 A;  2OUM A;  3AH1 A;  4CCN A;  2M4G A;  1GXQ A;  2ZQO A;  3BJA A;  1QO0 D;  5DYM A;  1DZD A;  4IX7 A;  3FHN A;  3OY9 A;  3DV8 A;  4J2X A;  2TDX A;  1G4D A;  4HSR A;  4Y33 A;  3S17 J;  1I6H J;  3CP2 A;  1Q1U A;  1B59 A;  2NS8 A;  2HZ9 A;  1UG2 A;  2PX9 A;  3FZV A;  3Q7W A;  1IRF A;  1EH7 A;  1SFE A;  2HXO A;  2DYS H;  5IT3 A;  2DOF A;  4HZF A;  1Y1W J;  31BI A;  3DBL B;  3EYY A;  4XKW A;  4KEK A;  2CW7 A;  3PQK A;  4ETS A;  2GA2 A;  1Y56 A;  1RR7 A;  1RUO A;  4LB5 A;  3K4B A;  3BZK A;  4G1R A;  2YU3 A;  3Q0U A;  2CMP A;  1BI1 A;  3F21 A;  3I29 B;  4DZJ A;  5TRD A;  3CRI A;  3HG9 A;  1HWN B;  4HX8 A;  3HXL A;  3IP4 B;  1ACI A;  3H92 A;  1S3J A;  3QPL A;  4BYY A;  2HOA A;  2OQG A;  4BE0 A;  1MBE A;  1U8R A;  3QU3 A;  2ADU A;  3WTS C;  3LQQ A;  1OFC X;  2R7R A;  2HDC A;  2LY1 A;  3DFG A;  2ZXI A;  4RBO A;  2KDZ A;  3PM1 A;  4IQJ A;  1HXD A;  1ENH A;  2W84 A;  2Z48 A;  2F4I A;  5FKL A;  2GLO A;  2V1D A;  4A3C J;  2GM4 A;  3UD9 A;  2X6O A;  1NK3 P;  3P9K A;  1ZAR A;  3R4K A;  2GBY A;  4LIU A;  3EUK L;  5K1Y A;  1FWU A;  2VSA A;  4EFQ A;  4V2F A;  2L02 A;  4RAF A;  4IHZ A;  3JR9 A;  1WSU A;  3NQO A;  1TT5 B;  3M4O J;  4MLO A;  3JRG A;  3CCE I;  1SFU A;  1VQK I;  3HTU A;  2QA4 I;  4D8H A;  3TQN A;  2H1L A;  3HBL A;  3HOZ J;  1WVR A;  4EGY A;  4XK4 A;  2OU2 A;  4EFR A;  2EIM H;  1JQZ A;  2OAZ A;  2ESN A;  3IRQ A;  4Q4Z F;  2NNY A;  1IJW C;  2ZJ2 A;  3HRM A;  1T95 A;  5K7F A;  1WQ2 A;  3S15 J;  1BW6 A;  2B7E A;  2FQ3 A;  4UXN A;  2O0Y A;  1I39 A;  1F36 A;  1YXW A;  3AG3 H;  3WTW C;  3COA C;  2LKX A;  1MD0 A;  3KEO A;  3CZ6 A;  1EH6 A;  5LEJ A;  2YPR A;  1BA5 A;  2VT2 A;  1AHD P;  3CAH A;  4G9N A;  2HZT A;  2LH9 A;  4RB1 A;  1LJ9 A;  2Y75 A;  4LD5 A;  1GVJ A;  1YIO A;  3ML6 A;  4A5N A;  2Q3N B;  5HVQ C;  4QWQ A;  5BPD A;  1V4R A;  2XB0 X;  4X3A A;  2HTJ A;  3AZW A;  2DA1 A;  4B09 A;  1LB2 A;  1FIA A;  1TBX A;  1Z21 A;  2EIL H;  3CCY A;  3K4K A;  1ZG1 A;  2IS1 A;  5AON A;  3V7S A;  1BJA A;  5AIP A;  1ETW A;  4I2O A;  4BAC A;  3Q7X A;  4B3X A;  3RSN A;  4PJJ A;  2CGP A;  2E1O A;  5E79 C;  3GX4 X;  3E6C C;  3NBN A;  1D0H A;  3E5Q A;  3UR3 C;  2I8D A;  3VEQ A;  1NTC A;  2L3D A;  1H9T A;  5TJJ A;  9ANT A;  2FBI A;  3FXM A;  3HZJ A;  4OEF A;  4HDV A;  1V5E A;  2HU9 A;  4B43 A;  1JGG A;  3N7L A;  4RB0 A;  2JUG A;  4HLX A;  4ABZ A;  3BJO A;  3RPQ A;  2VQC A;  1YW9 A;  2VN2 A;  2QSF X;  4I09 A;  1ZRF A;  4KFC A;  3CD6 I;  3KLN A;  2VAS A;  2X1D A;  4NC8 A;  4I8M A;  2GAU A;  3HUG B;  5E8G A;  4A3J J;  1Z3X A;  2QBY A;  1HDD C;  3MQ0 A;  3ZQG A;  1P4X A;  1HIB A;  4FET A;  2CSO A;  4BS9 A;  2EFN A;  3E6B A;  3ABT A;  1ZN2 A;  4UVC A;  1HDP A;  3QOE A;  2K8R A;  2A5W A;  1FOX A;  1FSE A;  2MAB A;  2GIV A;  4H75 A;  5HOO A;  5FLX Z;  2DOD A;  1YQA A;  6PAX A;  1FPQ A;  3I59 B;  3O4O A;  2K4J A;  3ZC9 A;  1FT9 A;  2E5N A;  1JY0 A;  3PQJ A;  2IPQ X;  2ZKZ A;  2XAG A;  4DW6 A;  3JRC A;  4EJT A;  3H5A A;  3HOT A;  3Q0V A;  3ERE D;  5FLM J;  4IJA A;  4D1Q A;  1GV2 A;  3GO5 A;  4GYG A;  1ULY A;  1OJL A;  1AOY A;  1O4X A;  2M87 A;  2PMZ N;  3T1B A;  3CJQ B;  2KZV A;  2OQR A;  2VOD A;  3WHB A;  3KX2 A;  2XSJ C;  3K0L A;  3G71 I;  1BM9 A;  2VSE A;  5J3L A;  1AWC A;  4BJ6 C;  1AVU A;  5DZU A;  3TO6 A;  1WI9 A;  2WA0 A;  1R5H A;  1GLN A;  1JT7 A;  1V5G A;  2V6C A;  2DK8 A;  3VOE A;  3U1D A;  3AJ6 A;  3JUT A;  2IVM A;  4GGG A;  5LHI A;  2CV1 A;  2Y9Z A;  1X1B A;  5HLG A;  4AIK A;  5F90 A;  5J1U A;  1QZZ A;  2OCE A;  3HHH A;  1U5T B;  1FYK A;  1IRP A;  2QQ8 A;  2X6Y A;  4BE1 A;  2X6W A;  5FFX A;  1O3T A;  5LFA A;  2OCC H;  3ABK H;  5M5Y J;  2EIK H;  1I1E A;  1QZY A;  1YO5 C;  3DPL C;  1HQC A;  3C9Z A;  2AO9 A;  3M8F A;  3L2V A;  2V9K A;  2LIQ A;  2R7D A;  4E7Z A;  3CDI A;  1P4W A;  2XAJ A;  2G7H A;  1MMS A;  1DLL A;  3L2C A;  1ETK A;  3GFM A;  5DUK A;  4I7H A;  5KVR A;  1JT0 A;  1IJT A;  2FBH A;  4NQW B;  2W25 A;  3P5J A;  4M9Z A;  1D8J A;  1IDZ A;  3RKW A;  3JRE A;  2E36 A;  4R8H A;  4BDY A;  4OWK A;  3P6J A;  1NG7 A;  3OYE A;  4XLF A;  2E5Z A;  4F91 B;  2NM1 A;  3IRR A;  1EH8 A;  2P0W A;  4IZX A;  5HDK A;  5FKO A;  2KZG A;  3MAL A;  3FGM A;  5FD6 A;  2XRL A;  2NRA C;  2E60 A;  4KJZ A;  4Q47 A;  1EA3 A;  1JKO C;  1SAU A;  1ZKG A;  2VKD A;  4PC4 A;  5FLV A;  2VC0 A;  4MZH A;  1U78 A;  4ZBV B;  4IHW A;  1U6G A;  4N9H A;  3ZQH A;  4G12 A;  3V4G A;  3ZRG A;  2JPC A;  3VWB A;  2L9S A;  1T6S A;  2BGC A;  2FX0 A;  1H9G A;  3U9G A;  1OCC H;  2BV6 A;  1MSE C;  1Z6R A;  5ED4 A;  3JRR A;  2VBY A;  1UHS A;  4HW0 A;  4QD2 B;  2P39 A;  3PG0 A;  2MIB A;  3O4D A;  3FX3 A;  4MZG B;  1RNL A;  3S3N A;  3O6B B;  4DIQ A;  3GYH X;  3VT0 A;  4WK8 F;  2IGO A;  5IT9 Z;  3KYD B;  4XRS A;  4JQF A;  3M3Y J;  2F5E A;  3E0J B;  4USP A;  2ZB9 A;  4Z6Y A;  2FA5 A;  2Q1Z B;  4BEH A;  3OYM A;  3I2X A;  3OJM A;  5HS8 A;  1DPU A;  4AWX B;  2PFB A;  3VYU B;  3AFH A;  4WX9 A;  1CF7 B;  5E18 F;  2WC2 A;  3MKY B;  2DOA A;  4ASN A;  3B02 A;  2CFX A;  3RPU D;  2F2F A;  3VT1 A;  1I1B A;  5K5O A;  5IYC J;  1S0D A;  2BYV E;  2M0M A;  3RKY A;  5IPA A;  4KEJ A;  4IL6 C;  4LLN A;  4RAY A;  1BIA A;  2P5L C;  3AL0 C;  3L09 A;  4A3F J;  3ILA A;  1TTU A;  2B9S A;  5EG6 C;  2CQK A;  3M1E A;  5JHU A;  2O8X A;  2HW9 A;  4BNC A;  1JLY A;  1PJR A;  3AZV A;  2Y0S N;  2F4M B;  1EVT A;  3VEP A;  4G8X A;  4JX5 A;  1ISV A;  1YRN B;  1R6R A;  2CQX A;  4AYB N;  1KU2 A;  2KFD A;  1G3Y A;  1LVA A;  5JHF A;  5F8Y A;  2O8K A;  4A69 C;  2MH9 A;  2VKH A;  2IRF G;  3CES A;  4I4P A;  3QU6 A;  4ZZD A;  3QPT A;  3L1P A;  1TWC J;  2WRY A;  1KA8 A;  1W7P A;  1KU3 A;  3NRV A;  1RET A;  3M8J A;  4C2U A;  1HSJ A;  1G9C A;  4XN3 A;  4EKX B;  4LLG F;  5J1R A;  1GDT A;  3JAM Z;  1DP7 P;  2EIN H;  2J5O A;  3RJP A;  2D44 A;  3WGI A;  3LNQ A;  2EJR A;  1OYW A;  2Y9F A;  5DM7 F;  2PG4 A;  3HSE A;  4ZYD A;  2VT3 A;  1RZO B;  3S1Q J;  1W1W E;  2R4G A;  3OIQ A;  4RA2 A;  5L3C A;  4HOB A;  3T0Y A;  2NYX A;  3FXK A;  2KMU A;  1Z0H A;  1TTY A;  2Q0O A;  3GTL J;  2GIZ A;  3ASO H;  2F2F C;  4ZYE A;  5D6E A;  3G1L A;  1FMW A;  4ZDO A;  2VLA A;  1V6X A;  1QXM A;  2R5Z A;  3HOM A;  1Z1D A;  3H3V K;  1D5V A;  2FU4 A;  3CDL A;  4ENJ A;  1R8O A;  4QAL A;  2HKO A;  1L3L A;  2YX7 A;  3OIO A;  1SD4 A;  5GAD J;  3WA1 A;  1OYY A;  2DTZ A;  4I7I A;  5FRM A;  3TBI A;  3BG3 A;  2PMZ A;  2JN6 A;  2Z1D A;  5J40 A;  3A01 B;  3RZO J;  3BPV A;  5C4J J;  1MBJ A;  1FV2 A;  1XD7 A;  2UUS A;  3BAO A;  3HPH A;  4XON A;  2XGE A;  2R5Y B;  5BXT A;  4KIB A;  4G6Q A;  2KQR A;  4ESJ A;  3JSO A;  1TWM A;  1MJB A;  1YTY A;  3F8F A;  2HYG D;  3K70 D;  2WB1 N;  3ZCO A;  3IKT A;  3M7G A;  3A02 A;  4E7S A;  4PJL A;  2BHY A;  1PUF B;  2QQA A;  3MN2 A;  4XOR A;  3DEU A;  3E1S A;  3RCO A;  2QYI B;  1R71 A;  2H1K A;  1Q04 A;  2F5F A;  2ZXJ A;  1D0Y A;  3HOS A;  5GAG J;  3K6G A;  3ERM A;  1J2X A;  3L2U A;  1K4S A;  1IN6 A;  4MIM A;  4BXF A;  2KIM A;  4II2 A;  2W82 A;  5BQT A;  3SFI A;  2JA5 J;  1MMA A;  1Z77 A;  2ZME B;  1GHC A;  3QP5 A;  2VXR A;  5E20 A;  3QYE A;  1KYZ A;  2ID6 A;  5DD4 A;  3R6S A;  2YUG A;  2P6S A;  1RES A;  4U0Y A;  4KA4 A;  1HCD A;  4U7B A;  3HDD A;  3HYI A;  2D1Z A;  5EYR A;  2BXZ A;  1SVO A;  5F0C A;  4RDU A;  2DLL A;  1ITB A;  3ZXS A;  2BW3 B;  3QYF A;  3FK6 A;  2ISY A;  2AAI B;  1TWF J;  1UJ8 A;  3BG6 A;  3DXJ F;  4ZKT B;  3ZXG A;  2JT1 A;  4HYE A;  1Y39 A;  2ZCW A;  5E8I A;  2W48 A;  2CUE A;  3LSI A;  3VPR A;  4NC7 A;  4XFT A;  4E4H A;  3OSF A;  1R8N A;  4UUS A;  1F9N A;  5B2H A;  5GTH C;  1VZ0 A;  4XLP F;  3C7J A;  1A31 A;  5ICE A;  1TT0 A;  3SDG A;  2K9M A;  2DRE A;  4D0Z A;  4XBF A;  2RV8 A;  5FFZ A;  2QSG X;  2P81 A;  4O5V A;  4IHT A;  4OMY A;  2L2O A;  3BZC A;  4X38 A;  4AC0 A;  2XPW A;  2COM A;  4Z8S B;  4IOA F;  3Q9V A;  1Z05 A;  1HWO B;  1XS9 A;  2GWR A;  4BU2 A;  1W36 C;  4II0 A;  2I10 A;  5FZU A;  4GP3 A;  4IVN A;  1H8A C;  5KK1 A;  4ZFW B;  2R92 J;  2IGN A;  2VI6 A;  2IA0 A;  2OZ6 A;  2TRT A;  3D5L A;  1CQT A;  4S05 A;  3SZG A;  2R7V A;  1M2T B;  2W1O A;  1SR4 A;  2DMP A;  1HKQ A;  2IA1 A;  3FJJ A;  1ZG3 A;  1SC7 A;  1YLF A;  4GYI A;  4PGH A;  3TC2 A;  1I5Z A;  4DCK C;  2UWM A;  3FXJ A;  3I5U A;  3WTZ A;  3BCA A;  3N7M A;  5D5V B;  2VE9 A;  1QQL A;  1TQM A;  4B48 A;  4IHX A;  2L0K A;  4DQ2 A;  1HC8 A;  1LDD A;  3F6O A;  1FIP A;  4FE7 A;  2EH3 A;  1XSV A;  3H6R A;  4G6M A;  3S14 J;  3OYF A;  1Y6I A;  4JX6 A;  3HOW J;  2CG4 A;  5F1R A;  4IRG A;  4UB8 C;  4JBA A;  4I6Z A;  1LEB A;  2CUF A;  3H9J A;  2Q9X A;  5LHG A;  2XAF A;  3PNT A;  2EZI A;  4M3B A;  2IWT B;  3GFI A;  2Y0S A;  3FXL A;  3GZ6 A;  2KI6 B;  2BHZ A;  4IRI A;  3NBE A;  3LL7 A;  2YU9 J;  1IZ1 A;  3A07 A;  4AYB A;  3L00 A;  2VL8 A;  4MO7 A;  3CC4 I;  3PUB A;  1Z91 A;  2A69 F;  1E17 A;  1VQO I;  3NJ5 A;  1EKE A;  3CMM A;  4KT6 A;  1Z2V A;  2CRG A;  5H20 A;  3K4N A;  4PJN A;  1BI3 A; 
#chains in the Genus database with same CATH homology
 1PWA A;  2LBF B;  3CA3 A;  4RMN A;  1L2H A;  3FUO A;  1SR4 C;  2X2S A;  4ZC3 A;  3CRG A;  3LSH A;  4AN7 B;  4QPQ A;  2CV2 A;  4XOT A;  1JLX A;  4HG2 A;  3H6Q A;  2WAE A;  2FUG 2;  4EEE B;  4KC3 A;  2W7N A;  3S8J A;  3T8S A;  4YEL A;  4Y3O A;  3FFZ A;  2DXI A;  4IZE A;  4ANJ A;  1WJE A;  4L4H A;  4JRA A;  4FAS D;  3BC8 A;  4KBB A;  2DCE A;  2D22 A;  4HNT A;  4CSW A;  2WB1 A;  2LRD A;  3PSI A;  1YX5 A;  1DQG A;  2LYC A;  1J09 A;  3CP8 A;  4IYB A;  3BA7 A;  3H9Q A;  4END A;  5HNH A;  4R6U B;  1YE9 A;  1MMG A;  5KNL A;  2ELJ A;  4LIT A;  3A21 A;  3N05 A;  2VJ4 A;  2X85 A;  2R7U A;  4GP0 A;  1WJD A;  5HPZ A;  1WBA A;  2ZQN A;  4JOM A;  2LC2 A;  3DKX A;  2NP0 A;  3LSK A;  1LVK A;  3OL3 A;  3B9U A;  9ILB A;  1Z7L A;  4XKV A;  5E24 E;  1AF9 A;  4I0Y A;  3BAH A;  4ZFY B;  2KLO A;  4E7K A;  2D20 A;  4KIS A;  1JT4 A;  1HA8 A;  4F52 A;  1N77 A;  4CCO A;  3LLP A;  3D5S C;  2Z16 A;  2D7I A;  4P0L A;  4H9W A;  5FNW A;  2ZFU A;  3BAU A;  1DGW Y;  2RNG A;  4CJM A;  4QC4 A;  3H0D A;  4DBR A;  2QN4 A;  3FBN B;  3OYD A;  1ISY A;  5BOW A;  2IHO A;  1N78 A;  5FZY A;  3VSZ A;  3H35 A;  3S3M A;  4IQP A;  1BFC A;  4I2S A;  2M3A A;  3DTI A;  1BA7 A;  1FMV A;  2UUZ A;  2VQH A;  3DWL E;  4DEP A;  3BRF A;  4X39 A;  1W36 D;  1HCE A;  1MMD A;  2MD0 A;  3NWS A;  3K70 C;  3MKW B;  2IGK A;  4C2T A;  2IGM A;  5F8S A;  2J3P A;  4XL9 A;  2X1C A;  3R4S A;  1D1A A;  2KI4 A;  4F83 A;  4X37 A;  1S0F A;  3OS2 A;  1FMM S;  3RTJ B;  3H9G A;  3FJ9 A;  3ZQQ A;  3CA1 A;  3AKG A;  4IZZ A;  1OQL B;  4LO8 B;  4XMY A;  4A7Y A;  3IM6 A;  2DJI A;  4RLQ A;  3AH2 A;  1K6Y A;  5DUY A;  3S93 A;  2KL4 A;  1YX3 A;  4DGW B;  3OJV A;  3C2H A;  3A2K A;  2R9K B;  3FJE A;  3V0B A;  3H6S E;  4MZF B;  3AH4 A;  4XQF A;  4B47 A;  3V0A A;  2UV1 A;  3KEY A;  3HC7 A;  2JVG A;  3OS0 A;  3PNY A;  1N4K A;  2XC7 A;  4F92 B;  4P1W A;  3OJ2 A;  2IXS A;  2Q2E B;  3UD7 A;  3VT2 A;  5JLV A;  2R7O A;  1RML A;  5CKT A;  3GBG A;  3V42 A;  1X19 A;  1G8X A;  1AVW B;  4ISQ A;  2K4A B;  3O5W B;  1S9H A;  1HWM B;  3W9T A;  2CW8 A;  4LIV A;  1TFM B;  3N7K A;  1BLD A;  2RQ9 A;  2VJ5 A;  4Y4R A;  3CQA A;  1YBI A;  3O4A A;  1ISW A;  4CA0 A;  4PFO A;  1S0L A;  2Y9W C;  3DPT A;  1PZZ A;  2NS2 A;  2K3P A;  4X0G A;  1XG6 A;  3OYJ A;  4GRI A;  2ERM A;  4IY8 A;  3AKF A;  2V26 A;  2CS3 A;  3H6R B;  1BR1 A;  3A23 A;  4XFU A;  2R7Q A;  3BAD A;  3CJR B;  1IRA X;  5G00 A;  1W3A A;  4AVZ A;  3K4C A;  3VSF A;  4CCM A;  4OAY A;  1V6U A;  2KP6 A;  1AVA C;  4RLF A;  2VB6 A;  1SFK A;  2NVH A;  1IHK A;  1BOB A;  1NG6 A;  2ZR1 B;  3SNV A;  2LRE A;  2KDO A;  5EHA A;  2D7R A;  1UEL B;  2M7A A;  4NUB A;  4ITV A;  4WBC A;  5CQE A;  3C2G A;  4EB2 B;  5GAQ A;  3VSL A;  1T4Q A;  3HPG A;  3I2A A;  3MKZ A;  2MC4 A;  5D62 A;  3IM5 A;  1X1A A;  3OYH A;  3RQ4 A;  1QU3 A;  3DEE A;  5HLT A;  2DT7 B;  3DPU A;  3OWT A;  1CE7 B;  4G9M A;  1TWE A;  4IY9 A;  3HAL A;  2F5V A;  4H4K C;  4EFP A;  2DRZ A;  3PJR A;  1T0F C;  2HQA A;  1XHB A;  4QO3 A;  3NBD A;  1TIE A;  4G6T B;  2FO1 A;  2D24 A;  3QYB A;  5LD2 C;  2MYS A;  3NWT A;  2GOM A;  2K43 A;  3HSM A;  5I1B A;  4ZFU B;  2GZB A;  4LO2 A;  2ZSH B;  3SEZ A;  6I1B A;  4XLH A;  2DS0 A;  1ONK B;  4XN0 A;  3OYI A;  2WBM A;  1PC8 B;  2ZXH A;  5DSS B;  4LO3 A;  3O4C A;  1NUN A;  3W3C A;  4CUG A;  3BX1 C;  2HPI A;  1JI8 A;  2XOA A;  3I9V 2;  2KH2 A;  3OYC A;  1CVS A;  2PJR A;  1WD4 A;  3IAM 2;  3CU1 B;  1P63 A;  4J23 B;  2VPL A;  5KHD A;  4OUJ A;  2VUA A;  1XZZ A;  3VWC A;  1MC9 A;  2AFG A;  4DOZ A;  3RSJ A;  4ZTF A;  1DQU A;  2QKM B;  2CV0 A;  3OGG A;  4II3 A;  3IAS 2;  4ZYA A;  2RG9 B;  3W2W A;  4LO2 C;  4LO0 A;  2Y9G A;  1BFG A;  4P6A A;  3L2W A;  5BXR A;  1BR4 A;  4J2S A;  3KMV A;  3DU6 A;  3BRD A;  4LO3 C;  2L9N A;  2JA2 A;  3LSM A;  1J0S A;  1S0G A;  3FJI A;  5FNX A;  3CA6 A;  1VCL A;  2AQZ A;  4JQ0 A;  21BI A;  1D0X A;  2M49 A;  4ZTJ A;  3S8K A;  2XF7 A;  4C9Y A;  3N0K A;  3U21 A;  4GOY A;  4CCJ A;  4XLA A;  2RRE A;  4FVV A;  4ZGR B;  2V1N A;  2VQG A;  4LO0 C;  2BVM A;  3DQV C;  4I4Y A;  3S3O A;  2HNH A;  2CFO A;  3K10 A;  3D7W B;  1P9Q C;  1AA7 A;  2W4S A;  3OYK A;  2NYY A;  3K4J A;  2R7S A;  4CZC A;  5BVP I;  2CUZ A;  1TZL A;  3ZX7 A;  4I4S A;  1S0B A;  3UD8 A;  4ION A;  4N4O B;  4BDZ A;  4PJM A;  4OAZ A;  4OWJ A;  3FJH A;  4QKS A;  4BJ5 C;  2HWA A;  1WJC A;  1IIL A;  2I1B A;  4XKC A;  2BVL A;  3UJ4 A;  3PSF A;  4IQ4 A;  1X4P A;  3KYL A;  4GAI A;  4PK4 A;  2XF5 A;  1PYV A;  1G9D A;  3J7A Y;  3W2V A;  1T9F A;  2NOJ B;  3V0A B;  4LO7 C;  2Z2S B;  3CRH A;  1D0Z A;  1ZEL A;  2V6E A;  3BAG A;  1V6V A;  3OYL A;  3WIN A;  3CA4 A;  4HR6 C;  4OEG A;  3FKJ A;  4XLC A;  3OIP A;  2VQL A;  3Q7Y A;  4I4O A;  1FGA A;  2E1M C;  4Q9P A;  3CF2 A;  2ET2 A;  3OYA A;  4J00 A;  4BQO A;  4DJA A;  4XOP A;  1XYF A;  2RQQ A;  5CPR B;  2OC6 A;  3FJD A;  1UG0 A;  2M7B A;  1JT5 A;  3AL0 B;  4C30 A;  1GGP B;  3O4B A;  2BOL A;  1WJA A;  3R4U A;  4BQQ A;  5KCM A;  4A7Z A;  4OWL A;  2QKL B;  3UNG C;  4E7L A;  3M1C A;  4BQN A;  2LOO A;  3WIN C;  2X1E A;  3VYT B;  4P0J A;  3LMM A;  1QQK A;  4BEH B;  3W2A A;  4I37 A;  3HL2 A;  1UAA A;  3WO3 A;  2RST A;  2P23 A;  5F8W A;  2BEA A;  2VLC A;  3BAV A;  1DIW A;  3RMY A;  2BW3 A;  1X1D A;  3P6I A;  1FMZ A;  3OL4 A;  5BQU A;  3BTA A;  3RMX A;  1K5U A;  3I3L A;  2VXZ A;  4RM2 A;  3O3Q A;  3S32 A;  3ONQ A;  2VJJ A;  3QR5 A;  4BUP A;  3BLY A;  3BA4 A;  2LG4 A;  4CCK A;  2GOX B;  4F93 B;  2X2T A;  1LKX A;  2Z49 A;  4JKX B;  4PSW A;  1QHG A;  3K1X A;  3H5N A;  4P5O A;  3LTQ A;  3OOU A;  3OYG A;  4HST A;  3HN1 A;  3OMY A;  4E7J A;  1RY7 A;  4HPQ A;  1S0E A;  1RG8 A;  3L2R A;  3OYB A;  2L7K A;  2FFV A;  4YRV A;  4L4I A;  1II4 A;  1WBC A;  3VYR B;  5BQU C;  1LFP A;  3OR2 C;  4KEI A;  3TMO A;  2WY8 Q;  1AFC A;  1DJS B;  3K4M A;  4HEA 2;  4ZJZ A;  2UUS A;  4D0Z A;  3SDB A;  1W3G A;  4XLE A;  2MLL B;  2HVQ A;  4ISR A;  2PJR B;  4BJT A;  3O44 A;  2LBF A;  3HMY A;  2WAQ A;  2HZD A;  3BA5 A;  4HA2 A;  3VSK A;  2CH0 A;  1HKN A;  1NZK A;  3AKZ A;  4LO1 A;  4RM3 A;  4HJJ A;  2V4J C;  3UJ0 A;  2Y9X E;  2OV7 A;  4PSX A;  3NBC A;  3OR1 C;  3WMU A;  1Z4S A;  2NTD A;  2XDV A;  1AVX B;  3OGF A;  3ZGK A;  2HWM A;  4XKB A;  4EAT A;  4XNF A;  3FJF A;  1FWV A;  4FGF A;  3EPZ A;  2XF6 A;  4ZDL A;  1EPW A;  3DKY A;  3WO2 A;  1V6W A;  3BB2 A;  5D61 A;  1MMN A;  1BFB A;  3AJ5 A;  2FDB M;  4XR6 A;  2WY7 Q;  2L5X A;  3F9K A;  1F31 A;  5BP5 A;  1WJ5 A;  3BAQ A;  1EV2 A;  4LG3 A;  2KPM A;  3DLA A;  3ZC8 A;  2KLL A;  2AQF A;  3FJB A;  2VIX A;  4F55 A;  4LO1 C;  4GAF A;  2HDW A;  2K5C A;  41BI A;  1IRX A;  2DT6 A;  4BL0 B;  2BEB A;  2K9L A;  1WJB A;  4ZDP A;  3IIR A;  3LSG A;  2IS6 A;  2FFU A;  3IM7 A;  4LO7 B;  3ZR8 X;  4I4V A;  3EUH C;  2CUJ A;  2HVR A;  3F62 B;  5JMC A;  1PUM B;  4J2K A;  1DZC A;  3EUA A;  1WD3 A;  1DQO A;  4J2Y A;  2JVH A;  4Z9W B;  3RTR A;  2E1M B;  3N7J A;  3QYD A;  5BP5 C;  2A6T A;  4D0T A;  1K5V A;  2ZSI B;  3POK A;  4F34 A;  3PFY A;  2HPM A;  4NNJ A;  5HNF A;  3OBR A;  3D5R C;  1WJF A;  4QBC A;  3SEQ A;  3CA5 A;  3OBT A;  2BFH A;  1G9A A;  2WAF A;  4QPO A;  4Q9G A;  4OW4 A;  3CA0 A;  4ZLB B;  2FGF A;  2DRY A;  3UDA A;  4QBV A;  2F6C A;  2MC2 A;  2VXD A;  4JKQ A;  3DTK A;  1BFF A;  1DGR M;  4I4X A;  1M16 A;  1JTC A;  1D1B A;  3F1R A;  2KHM A;  2JSP A;  3OYN A;  4ZA3 B;  1A8D A;  4PFP A;  1TP0 A;  4ZOT A;  5TGT A;  4B44 A;  3FDY A;  3FJC A;  3DU5 A;  3E8L C;  3O49 A;  3PHZ A;  4OEE A;  2IS4 A;  2LIE A;  4I4U A;  4I96 A;  3L2Q A;  3TL4 X;  1WFX A;  4QKR A;  2WBC A;  5DVH A;  1ERD A;  4R79 A;  2AXM A;  3RTI B;  1AXM A;  3MMY B;  2KRC A;  4JAW A;  3A4C A;  4KIT B;  4F3Q A;  2LY2 A;  2W00 A;  1JT3 A;  2HVS A;  2O5R A;  4D9J A;  2X6X A;  1X4O A;  3A1Y A;  4PUS A;  2VU9 A;  1DFC A;  3BCB A;  1D1C A;  3PME A;  5BXP A;  1ISX A;  7I1B A;  1IOB A;  3G2B A;  4BGD A;  3EF2 A;  3BG7 A;  4A7K A;  4N4N B;  4XM3 A;  3AKH A;  2L5Q A;  3V79 C;  1U0J A;  5D63 A;  3MPP G;  1HWP B;  4HRI A;  1QHH D;  4USO A;  3PL8 A;  3VYS B;  1FV3 A;  1X1C A;  1E0E A;  2AQE A;  4I1B A;  5CQG A;  1MD6 A;  2NZ9 A;  1Z3Y A;  1S0C A;  1YTO A;  4E7H A;  4DEN A;  3ZXD A;  5BXS A;  2ESU A;  1G82 A;  2R7X A;  2IS2 A;  3VDX A;  1UPS A;  3FJA A;  3S8P A;  1KON A;  4TLP A;  1IT0 A;  4AU7 A;  3SYT A;  4J01 A;  3A22 A;  4OWR B;  1MNE A;  2R7T A;  4I4R A;  1FQ9 A;  2GO2 A;  1ABR B;  1DFQ A;  4I4Q A;  1DP3 A;  3FJ8 A;  1ILR 1;  3BRG C;  4I1E A;  4XFS A;  3IUO A;  4CCL A;  3HKZ A;  4I6I A;  4CH7 A;  2KRH A;  4YOL A;  2E4M A;  1V5F A;  1G59 A;  4UY4 A;  2R7W A;  5FRN A;  4I3N A;  3V0B B;  1OR7 C;  4P0K A;  3IAG C;  1Q03 A;  1OLT A;  2MFZ A;  3FUQ A;  1PUU B;  1ISZ A;  4DBQ A;  4JPZ A;  1LDK B;  3PNV A;  2V7F A;  1YF8 B;  4Q91 A;  3HBW A;  3AKI A;  2XAU A;  1BAS A;  1KNM A;  3LFU A;  1BLA A;  4QD2 C;  3WMV A;  4XKI A;  4E7I A;  4GOV A;  2M4K A;  2KKI A;  1TOO A;  2VXT I;  3WO4 A;  4HNU A;  1W3F A;  3QOD A;  3FJK A;  5FZZ A;  3MD2 A;  4AN6 A;  2E4M C;  2WAD A;  5EC5 A;  4E6K G;  3OS1 A;  5FRO A;  1BAR A;  2X51 A;  4U87 A;  1E0O A;  2F8X C;  4BE2 A;  4H04 A;  1EYL A;  2VJI A;  2D23 A;  4JP0 A;  1BR2 A;  1FN0 A;  1G9B A;  3VUO A;  4IKF A;  4YEJ A;  3P53 A;  3DTE A;  3H5R A;  8I1B A;  4G6J A;  1MND A;  1MW7 A;  3FBI B;  1SZ6 B;  1N75 A;  3K4L A;  2D43 A;  1YYN A;  2OUM A;  3AH1 A;  4CCN A;  2M4G A;  2ZQO A;  1DZD A;  4IX7 A;  3FHN A;  3OY9 A;  4J2X A;  4HSR A;  4Y33 A;  3CP2 A;  1Q1U A;  3Q7W A;  2HZ9 A;  31BI A;  4XKW A;  4KEK A;  2CW7 A;  1Y56 A;  3K4B A;  4G1R A;  2CMP A;  3I29 B;  3CRI A;  3HG9 A;  1HWN B;  3HXL A;  3IP4 B;  4BE0 A;  2R7R A;  2LY1 A;  2ZXI A;  4IQJ A;  2Z48 A;  2F4I A;  3UD9 A;  4LIU A;  3EUK L;  1FWU A;  2VSA A;  4EFQ A;  4IHZ A;  4MLO A;  4D8H A;  4EFR A;  1JQZ A;  1T95 A;  1YXW A;  3CZ6 A;  3CAH A;  4G9N A;  2LH9 A;  2Q3N B;  5HVQ C;  4X3A A;  3AZW A;  2IS1 A;  1Z21 A;  3K4K A;  3Q7X A;  4BAC A;  4B3X A;  3RSN A;  4PJJ A;  3NBN A;  1D0H A;  3UR3 C;  2I8D A;  3VEQ A;  4OEF A;  1V5E A;  2HU9 A;  4B43 A;  3N7L A;  2JUG A;  2VQC A;  2VAS A;  2X1D A;  4NC8 A;  4I8M A;  3HUG B;  1HIB A;  1Z3X A;  4FET A;  4BS9 A;  3QOE A;  2K8R A;  2A5W A;  2MAB A;  4H75 A;  5HOO A;  3O4O A;  3ZC9 A;  2E5N A;  1JY0 A;  3H5A A;  3HOT A;  4D1Q A;  3CJQ B;  2KZV A;  3KX2 A;  2XSJ C;  2VSE A;  4BJ6 C;  1AVU A;  5DZU A;  2WA0 A;  1JT7 A;  1GLN A;  1V5G A;  3AJ6 A;  3JUT A;  2CV1 A;  1X1B A;  5F90 A;  1IRP A;  2X6Y A;  4BE1 A;  2X6W A;  5LFA A;  1I1E A;  3DPL C;  3C9Z A;  3L2V A;  2V9K A;  2LIQ A;  4E7Z A;  1DLL A;  1IJT A;  4NQW B;  4BDY A;  4OWK A;  3P6J A;  1NG7 A;  3OYE A;  4XLF A;  2E5Z A;  4F91 B;  2NM1 A;  2P0W A;  4IZX A;  3MAL A;  3FGM A;  2E60 A;  4KJZ A;  1EA3 A;  1SAU A;  4PC4 A;  2VKD A;  4MZH A;  4ZBV B;  3ZRG A;  3VWB A;  2L9S A;  3JRR A;  4QD2 B;  2P39 A;  3PG0 A;  2MIB A;  3O4D A;  4MZG B;  3S3N A;  4DIQ A;  3VT0 A;  2IGO A;  4JQF A;  3E0J B;  4USP A;  2Q1Z B;  4BEH A;  3OYM A;  3I2X A;  3OJM A;  3VYU B;  3AFH A;  3MKY B;  2DOA A;  3RPU D;  2F2F A;  3VT1 A;  1I1B A;  1S0D A;  2M0M A;  4KEJ A;  3AL0 C;  1TTU A;  3ILA A;  5EG6 C;  2HW9 A;  1JLY A;  1PJR A;  3AZV A;  1EVT A;  1ISV A;  1R6R A;  5JHF A;  5F8Y A;  2VKH A;  3CES A;  4I4P A;  2WRY A;  3M8J A;  4C2U A;  1G9C A;  4XN3 A;  4EKX B;  2D44 A;  2Y9F A;  1RZO B;  2R4G A;  3OIQ A;  2KMU A;  1Z0H A;  2F2F C;  1FMW A;  4ZDO A;  2VLA A;  1V6X A;  1QXM A;  3HOM A;  1R8O A;  4QAL A;  3WA1 A;  4I7I A;  5FRM A;  3TBI A;  2PMZ A;  2Z1D A;  1FV2 A;  3BAO A;  3HPH A;  4XON A;  5BXT A;  2KQR A;  1TWM A;  3K70 D;  3ZCO A;  4E7S A;  4PJL A;  4XOR A;  3E1S A;  3RCO A;  2QYI B;  1Q04 A;  1D0Y A;  3HOS A;  3K6G A;  3L2U A;  4BXF A;  4II2 A;  2W82 A;  1MMA A;  2VXR A;  3QYE A;  2YUG A;  1HCD A;  4U7B A;  2D1Z A;  1ITB A;  3ZXS A;  2BW3 B;  3QYF A;  2AAI B;  4ZKT B;  3BG6 A;  3ZXG A;  3LSI A;  4NC7 A;  4XFT A;  4E4H A;  1R8N A;  5B2H A;  1VZ0 A;  1TT0 A;  2K9M A;  2DRE A;  2L2O A;  4X38 A;  4Z8S B;  1HWO B;  4BU2 A;  1W36 C;  4II0 A;  5FZU A;  4GP3 A;  4ZFW B;  2IGN A;  3D5L A;  1SR4 A;  3SZG A;  2R7V A;  1M2T B;  2W1O A;  3FJJ A;  3TC2 A;  4DCK C;  2UWM A;  3BCA A;  3N7M A;  1QQL A;  4B48 A;  3H6R A;  4G6M A;  3OYF A;  1Y6I A;  3H9J A;  2Q9X A;  3PNT A;  2IWT B;  2Y0S A;  3NBE A;  2KI6 B;  3LL7 A;  3A07 A;  4AYB A;  2VL8 A;  3PUB A;  3NJ5 A;  3CMM A;  4KT6 A;  1Z2V A;  3K4N A;  4PJN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...