3PUBA

Crystal structure of the bombyx mori low molecular weight lipoprotein 7 (bmlp7)
Total Genus 76
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
76
sequence length
235
structure length
235
Chain Sequence
VPNDILEEQLYNSIVVADYDSAVEKSKHLYEEKKSEVITNVVNKLIRNNKMNCMEYAYQLWLQGSKDIVRDCFPVEFRLIFAENAIKLMYKRDGLALTLSNDVHGNDGRLAFGDGKDKTSPKVSWKFIALWENNKVYFKILNTERNQYLVLGVGTNPNGDHMAFGVNSVDSFRAQWYLQPAKYDKDNLFYIYNREYSKALTLSRTLETSGNRMAWGYNGRVIGSPEHYAWGVKAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords 30kDa protein
publication title Crystal structure of the 30 K protein from the silkworm Bombyx mori reveals a new member of the beta-trefoil superfamily
pubmed doi rcsb
source organism Bombyx mori
total genus 76
structure length 235
sequence length 235
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-12-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3pubA01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3pubA02
1S0GA 4IY8A 1HCEA 3I2XA 2K43A 3H6RB 1WD3A 2KKIA 1HWOB 3FJAA 3JUTA 1K5VA 4LO2C 4OWLA 2D1ZA 1VCLA 1I1EA 1BFBA 1ISZA 4A7KA 1Q03A 4OUJA 5EC5A 1QQLA 2ERMA 4X37A 1W3FA 3WA1A 4J2SA 3UJ4A 1S0BA 1Z0HA 2NTDA 4P0LA 4G6MA 3WO4A 3IM5A 5BXPA 4OWKA 3BAVA 3H6SE 2MIBA 5B2HA 1WBAA 5G00A 4HJJA 4QBVA 1CVSA 4IQPA 3N7KA 4A7YA 4H9WA 1PUMB 2VSAA 1DFQA 1IRAX 2LIEA 2BFHA 3NBCA 1HWMB 3A22A 4LO0A 3BRGC 4I4PA 4ZBVB 3PHZA 3OBRA 2FFUA 4H04A 4IYBA 4KEIA 1V6WA 1JT3A 5FZUA 1UPSA 1YBIA 2D43A 3UDAA 4G6JA 2HZ9A 3CA1A 3LTQA 1QXMA 2Q9XA 3CA6A 1BA7A 4GP3A 5FNWA 2X2SA 4LO3C 4PC4A 1IHKA 3O44A 1FMZA 3PUBA 1ONKB 1XHBA 1IOBA 4OEFA 3O4OA 3NBNA 9ILBA 2QN4A 4F83A 3BAQA 3QR5A 4JPZA 1XZZA 1IJTA 3EF2A 3O4DA 2ZQNA 4HR6C 3A23A 2NYYA 1P63A 4J2KA 1DFCA 3BADA 3HALA 3HSMA 3MPPG 1EVTA 4JRAA 1G9DA 4J23B 5F8SA 1J0SA 4XFSA 3IM6A 3RSJA 3POKA 3O4CA 3FUOA 1R8NA 3CA5A 4XFTA 3AZWA 41BIA 4IZXA 3I2AA 3A21A 2FFVA 1TFMB 3O5WB 3UD7A 3Q7XA 2GZBA 4Q9GA 2KLLA 3O3QA 4D0ZA 4G9MA 4I2SA 1TWMA 1BLAA 3F1RA 2AAIB 2F2FA 3IAGC 5D61A 1R8OA 1N4KA 3WINA 1K5UA 5HPZA 3Q7YA 4GOVA 2BEAA 3OJ2A 3WO2A 3AH2A 1HWNB 4EEEB 4QKSA 1S0EA 3FJ9A 4KEJA 1TIEA 3UJ0A 4X38A 1ISWA 4OEEA 5D62A 2NZ9A 1HWPB 21BIA 3RMXA 4EB2B 4G1RA 5JLVA 3HMYA 1SR4A 1BARA 4LO0C 2Y9GA 1F31A 2AXMA 3AZVA 3FJFA 3D7WB 1JLYA 1GGPB 4GP0A 1TWEA 4I4XA 3VT0A 4LO7B 4Z8SB 2X2TA 1ISXA 3CQAA 2Z48A 3N7MA 1Q1UA 4USPA 4ZA3B 3F62B 3H6RA 4TLPA 1S0FA 3RTJB 2Q3NB 4AN6A 1MC9A 1S0DA 2D23A 3NBEA 3H6QA 4I8MA 3K1XA 3O4AA 2D24A 4IY9A 5F8YA 1DIWA 6I1BA 1DZCA 4P6AA 1AFCA 1BLDA 1ISVA 1EYLA 3CAHA 2KI4A 2F8XC 4FVVA 2UUSA 3ZXDA 3FJDA 4IZEA 4L4IA 5BOWA 4I37A 2AFGA 1V6VA 4ZLBB 5JMCA 3P53A 3VWCA 1II4A 5BXSA 1JT7A 3V0BB 5F8WA 3ZC8A 4I0YA 1JY0A 3O4BA 1A8DA 3PG0A 3V0BA 1EPWA 1D0HA 2DS0A 3JRRA 4HA2A 3VSFA 1ILR1 3BAHA 4LO8B 3VSZA 2F2FC 4JAWA 4EFRA 3OGFA 5I1BA 2BEBA 3NBDA 1S0LA 1RMLA 2QYIB 3WINC 2P23A 4IONA 1WBCA 2D7RA 1BASA 2VXTI 1AVWB 1Q04A 1AVUA 3PMEA 3N7JA 1CE7B 5E24E 4LO1A 3AKHA 2DRYA 4Q91A 1AF9A 4II0A 2RG9B 2I1BA 1G9AA 2D7IA 2ESUA 3FJKA 2VLCA 2Y9XE 4KBBA 1SR4C 3B9UA 2MC2A 3MALA 1DQGA 5DZUA 4WBCA 4I4VA 4I1EA 1FGAA 3BB2A 3ZXGA 4X3AA 5BVPI 1EV2A 2VSEA 2NP0A 3Q7WA 1FN0A 1JLXA 4L4HA 4JQ0A 2L5XA 1T9FA 4LO7C 3BAOA 3C9ZA 2Z49A 3SNVA 3BAUA 2D20A 4QC4A 3N0KA 4R6UB 4I4QA 4FGFA 5BXRA 4QALA 2FGFA 3FJBA 2D44A 3FFZA 31BIA 4QBCA 3WMUA 2D22A 3FJCA 4P0JA 2M49A 1HCDA 1L2HA 1PZZA 3R4SA 3OGGA 4Q9PA 2K8RA 3S8KA 2KH2A 1FMMS 1IILA 4I4UA 4I4SA 2GO2A 2LIQA 1SZ6B 4QD2B 1M16A 4I4YA 4USOA 4EFQA 1ABRB 3AH4A 3AJ6A 4EKXB 1W3GA 3E8LC 5BP5A 2VUAA 2ZR1B 3BA5A 2HWMA 4GAFA 1T4QA 1M2TB 4D8HA 4X39A 1TOOA 4JKXB 3KMVA 4OW4A 4Z9WB 3ZC9A 4DCKC 3CA0A 4AN7B 2HW9A 4I7IA 3A07A 1KNMA 4ZFWB 1WD4A 4J2YA 3FUQA 3HBWA 4XKIA 1FWUA 1FV2A 3IM7A 1PWAA 3NJ5A 1Z4SA 2E4MA 3LLPA 3QYDA 2Y9WC 2RQ9A 3UD8A 1FWVA 5FNXA 1HIBA 3P6JA 2AQZA 4I96A 5BQUA 4LO1C 3V0AB 1TTUA 3V0AA 3CA4A 4ENDA 1JQZA 1YXWA 3P6IA 4G9NA 4P0KA 4CJMA 4JP0A 2KI6B 1G82A 4I6IA 1RY7A 3VT1A 4ZFYB 1BFGA 4YOLA 3BRFA 4KC3A 3BX1C 1BFCA 2IWTB 3OBTA 4GAIA 1V6UA 3OJMA 1MD6A 1YTOA 4ZKTB 1JT4A 3CU1B 2WRYA 8I1BA 1XYFA 3S8JA 4OEGA 4OWJA 3FJJA 3VUOA 1RZOB 5GAQA 3BTAA 5EG6C 5DSSB 4JKQA 2FO1A 3CRIA 3CRGA 4F34A 3FJHA 1QQKA 3AKIA 4DEPA 1I1BA 4KEKA 2K4AB 1Z2VA 4ZOTA 1JTCA 4QD2C 1DJSB 4EFPA 5BP5C 1PUUB 3WMVA 1V6XA 2YUGA 4I4OA 3AKFA 3BA7A 2IHOA 2WBCA 3RMYA 3RTIB 3CRHA 4I4RA 3UD9A 1DLLA 3BRDA 4LO2A 3I29B 1G9BA 3WO3A 4I3NA 4D0TA 1AVAC 2E4MC 3R4UA 3FGMA 3IIRA 2RSTA 4A7ZA 3AKGA 3T8SA 3ILAA 2P39A 3AJ5A 7I1BA 4XFUA 2NVHA 3BA4A 3HN1A 2HWAA 5BQUC 4J2XA 2J3PA 3FJ8A 5FZYA 1G9CA 2DRZA 3W9TA 1XG6A 4I1BA 4ZGRB 1YYNA 1IT0A 5F90A 1BFFA 1E0OA 2NM1A 4GOYA 3VEQA 1AVXB 1OQLB 5FZZA 1IRPA 1PC8B 4ISRA 3BAGA 1JT5A 5EHAA 1NUNA 2ET2A 1RG8A 4LO3A 2MLLB 1DQOA 5BXTA 4IHZA 5DVHA 1S0CA 3N7LA 3V79C 3AH1A 2FDBM 2XOAA 3VT2A 3CA3A 1DZDA 2DREA 1ITBA 5D63A 1FQ9A 1HKNA 5DUYA 2ZQOA 2Y9FA 1W3AA 1FV3A 2R9KB 3OJVA 4DENA 4ISQA 1NZKA 1TP0A 1AXMA 3TC2A 3HOMA 3FJIA 3FJEA 2VU9A 3ZX7A 4ZFUB 3O49A 2VXRA 1ISYA 4QKRA 1YF8B 4QO3A
chains in the Genus database with same CATH superfamily
1MJ9A 1XD7A 3MZYA 3F6VA 5KAIC 3CMAI 3UR3C 4HF2A 1B4AA 3I2XA 4KT6A 3LAJA 2QEXI 2K43A 4RM2A 2ZBKA 1JKQC 1P4WA 1S7AA 1OCOH 1LDDA 3KEYA 4NBQA 3VEPA 2JPBA 3QYFA 1QU3A 3FKIJ 4BYYA 3FXQA 3TGNA 5IY5H 2FOKA 1MMNA 4JOMA 1R00A 4HG2A 3IWFA 3CO7C 2R7WA 2WY7Q 2JN6A 2ZMEC 5LGUA 1IN7A 2BBYA 1BFBA 3BT9A 3MD2A 1ISZA 3I54A 4OUJA 2ECCA 3H5AA 4GXOA 2H09A 1HA8A 4G6MA 2Z33A 4WK8F 2XB5A 2VKVA 1HQCA 2M0MA 2QQ9A 5BXPA 1ZHFA 1J09A 3ASNH 4HJJA 1TP4A 4KDPA 3HOWJ 4GYGA 3K9TA 1TWAJ 2CFXA 4GGGA 2EQRA 4HX4A 5DDGA 1KU9A 2MSYA 5LEKA 1RUOA 2NVTJ 3N7KA 2M30A 2LIEA 3A4CA 2F5DA 5FO5A 2EIKH 2UUZA 3M07A 3SZTA 3CDLA 3OYDA 1U8RA 3CCJI 5E20A 5ILSA 2KLOA 3A22A 1GT0C 1I27A 4I4PA 2WWYA 3A1YA 4BACA 1I6HJ 1BC7C 3PHZA 2DA7A 4B8XA 1YG2A 2IBDA 4IYBA 5F04A 2VODA 2D43A 1SFEA 2HXIA 3RQ4A 1DU0A 2J5PA 2GA2A 4GP3A 1IF1A 4LO3C 4PC4A 4RMNA 2ZJQF 2DMTA 3PNVA 1LE8B 2NYXA 2KZVA 2Y31A 2IS4A 5LHHA 3PUBA 1XHBA 1LE8A 1FBQA 1F1ZA 1WGXA 4OEFA 1KQ0A 2GAUA 4IVNA 1Q1VA 3REOA 4KNYA 3QR5A 1XZZA 3CUQB 3EF2A 3FK7A 2BXZA 3KYCB 3TKYA 4D7NA 3CUQA 4A2UA 1DFCA 1FZPB 2E1NA 2IT0A 3LA7A 1LEBA 5F8SA 4GO1A 1S29A 2KMUA 3MN2A 4LMYA 2RKHA 1JUPA 5E18F 2W57A 3HUGB 4B47A 3E1SA 3PSIA 4KT5C 4DZPA 3BG6A 3JSOA 4EJOA 3AZWA 41BIA 3HUGA 1Q1HA 1FBUA 2COMA 4YFNF 2X48A 4DZJA 4A3KJ 3ZMVA 5J6XA 4EM2A 4IZXA 3I2AA 3E97A 3UD7A 2FD5A 1T95A 2EIJH 3VODA 1J75A 2VE8A 4MTDA 4Q9GA 1OFCX 2KLLA 2HTSA 4M3EA 2MD0A 2HDWA 1OCTC 4ESJA 2LYCA 1K61A 2HOTA 3OS1A 2K9SA 3IAGC 5GTIC 1STZA 3DLAA 3OL4A 5DUKA 1R8OA 5D61A 1H9GA 4PGGA 3CCRI 2EINH 2QQAA 2KIFA 5HPZA 3CCMI 4HV6A 1E0EA 2PFBA 1YITI 3OJ2A 4PSWA 2D1HA 1MH4A 1YW9A 2LOOA 3TP3A 2KFDA 3IH3A 1U5TB 1FIAA 1MMSA 5DEQA 2AHQA 1U5TA 4X38A 3VDXA 2P5KA 2K9QA 3P7NA 5D62A 2QKMB 1HWPB 3PM1A 2GM4A 4RB3C 3HMYA 4GYIA 1OR7A 3KLOA 3DP7A 3VPRA 2K5CA 2AXMA 2CGPA 3FJFA 1WHUA 3MVPA 2NS0A 4PZJA 3O3KA 1ZRDA 2GBYA 3K4JA 4A3CJ 3HKZN 4Q4ZF 2CW7A 1GGPB 4GP0A 2Z99A 3HOXJ 2WAQA 2ZFUA 2L7ZA 2X2TA 2KJCA 2VIXA 3L2WA 3CQAA 2QKLB 3FK6A 1AA7A 2Z48A 3N7MA 1VNDA 2ESHA 3LQRA 3SDBA 3VB2A 4G6DA 1WPKA 2P6SA 5J8CA 1UCRA 1Y0UA 2FMYA 2IGNA 3BR5A 1MJBA 2ZSHB 2NVYJ 4AN6A 1LEAA 2MLKA 3BZ6A 4E7IA 2W4SA 4P9UA 3RYRA 3G73A 2JTVA 1DZCA 1KA8A 2HQAA 4GFBA 1W1WE 1MIJA 2XGDA 4A0ZA 2K9NA 2ZXWH 5H6QA 2KDZA 3BTCA 3J80K 2F8XC 4FVVA 3DBHB 3KX2A 2E2HJ 5IYDJ 4N4OB 4PJMA 3HB9A 4A69C 2XROA 4A3FJ 4K2EA 4QLCU 5E3MA 4XRSA 1ZH5A 5D8KB 2AFGA 3F6OA 3KP6A 3IH2A 4YEJA 4UY4A 3LSMA 4S05A 1YHQI 3P53A 1IRFA 1UZCA 3HL2A 5LLQA 3CDHA 3CLQA 2HYGD 4AIJA 1JT7A 3TDUC 2OJED 2P4WA 3O4BA 1A8DA 3OYLA 3HOYJ 1D0HA 3HGGA 3ECOA 2XV4S 5F08A 2COBA 2FF4A 2VI6A 2Y0SN 3N05A 3VSFA 3L2UA 1ILR1 3BAHA 1CQTA 2OU2A 3OGFA 3GZ6A 3OYFA 2HOEA 3WINC 2IXSA 2B9SA 3K70C 3MAJA 2L01A 3IWZA 3GFIA 5CJ9A 1WBCA 3OL3A 2M8GX 4HDVA 1AVWB 1WZ2A 3KEQA 5HLGA 3MKLA 2IS1A 3S1NJ 1AVUA 4YRVA 4I6ZA 1RKWA 1CE7B 4NNJA 3S14J 3AKHA 1ZRFA 4IL6C 1BOBA 3OIQA 1YFHA 1PJRA 2FUG2 5TISC 4CHUA 2RG9B 2MD5A 1Z77A 4M3DA 1NK2P 3F0CA 1ENHA 1IN6A 3H3ZA 2Y9XE 2NNYA 4Y15A 3VYRB 1K83J 4KBBA 4DQ2A 3HOZJ 1J9IA 4E70A 5DZUA 3E5XA 2LH9A 1USSA 1Z1DA 5DCMB 3G1MA 2ZMEB 1JJ8C 1FGAA 3BB2A 4I1EA 5BVPI 2NP0A 1EV2A 4XKCA 4XKWA 2ZMEA 5HS7A 2A05A 1JLXA 4L4HA 2GIZA 2JA8J 2QQBA 2LR8A 5E79C 4C3JJ 3CMYA 4LO7C 3BAOA 2LLKA 3SNVA 2AXLA 3W2WA 2X1CA 1ITYA 2V1DA 4XORA 3W2AA 4O5VA 4OWRB 4MZHA 2D20A 4QC4A 5FB2A 3WGHA 4I4QA 1G3TA 4FGFA 5EG0B 3CQZJ 2FGFA 2STWA 5EG0A 31BIA 1GLNA 2QWWA 3GVAA 4CZCA 4Q9PA 4XICA 1IILA 4C3HJ 4A3GJ 1B9MA 4I4SA 2DA3A 2GO2A 2LIQA 2FBHA 1I1GA 1M16A 5FNWA 3NWSA 4NQWB 1DPUA 3R4KA 2QM3A 2X4HA 4XKVA 3AH4A 2X6YA 3E5QA 3AJ6A 4EFQA 4NQWA 2W00A 1EH8A 1VFCA 4HV5A 2LSOA 2M5WA 3F8FA 5DD8A 1OQYA 1T33A 3NWTA 3DPUA 4UV9A 3JRAA 3DQVC 3GTOJ 4DCKC 4Y52J 4W1UA 2OA4A 1WD4A 3EUAA 4IJAA 2DMUA 2ME0A 2VLAA 1UB9A 2EBIA 1VQOI 1YRNB 2L7FP 3HBWA 1FV2A 3KCCA 3FXLA 1ZK8A 5HLTA 2L4MA 2DTZA 4IHSA 4BE0A 1PWAA 1ZGAA 3DXJF 2AXTC 2B7EA 2H6CA 2Z3YA 2IJLA 3QWLA 5K5RA 4BHCA 3HSEA 1ZGJA 4N9HA 3F22A 1T08B 3K0LA 4N9IA 3GZ5A 2VJ5A 5FLXK 5DYMA 1FWVA 3HEFA 4BDZA 2GXGA 1R5ID 1X1AA 4HF0A 2OTJI 3P6JA 1QO0D 2NNNA 3FZVA 3B73A 5FKNA 3BY6A 4M9ZA 1A6QA 4LLGF 2HVQA 4EQQA 3P6IA 3K2ZA 4BY7J 4I99C 4MZGB 4ABZA 4P0KA 4DGWB 2H1KA 1ETXA 5M5WJ 4LD5A 3ELKA 3ERMA 1D8JA 3FHNA 1S3JA 1G82A 3CP8A 3IKTA 3VT1A 2OD5A 3AG2H 2DCEA 3WTTC 3RKQA 1BR2A 3KZZA 3CU1B 5LGTA 1UHSA 5F1JA 8I1BA 5IYBJ 3OSFA 3GLXA 2P5LC 4XLAA 2OC6A 2XHKA 1TC3C 3AL0B 4NDLA 1RZOB 3BTAA 5CKTA 2KIQA 4UVBA 2P7VB 3DFGA 3GFLA 3LSIA 1XB4A 4F34A 2XF5A 3FJHA 5DM6F 4DEPA 1I1BA 3G3ZA 1BI2A 4CDGA 1Z2VA 4PJJA 4ZOTA 1QHHD 1SVOA 2EZHA 2O7OA 2AO9A 5HS9A 1K4SA 3H3VK 1RZ4A 1PDNC 2WA0A 2A69F 1DJSB 2IS2A 3HRSA 4LK0F 4IX7A 2L4AA 4MHGA 3CMEI 1PUUB 3WMVA 4HNTA 2XGCA 3F8MA 5J4VA 4NC6A 3DWLE 5BNGA 4CO8A 1FJLA 2YUGA 2VC0A 3ZQFA 3S1RJ 1UG0A 2IHOA 1RI7A 2WBCA 2DK8A 1L3LA 1G59A 3RTIB 3UD9A 1O3TA 4A3EJ 4ZTFA 4Q5SF 1VZ0A 5K7FA 3BRDA 4L5IA 4LO2A 4LB6B 1VTNC 1IUYA 2PJRA 4ZDOA 2R3SA 1G9BA 1VQ5I 5JI6A 1PP8F 1X19A 4CUGA 4I7HA 3WG9A 2V9KA 1S8NA 1D8KA 2AQFA 4A12A 1WH7A 5IOZA 2RQQA 3OV8A 3FGMA 4FT8A 1X4OA 3X2QH 3TOBA 3ONQA 3BR2A 2EZIA 5M3MJ 2V1XA 3T8SA 1JT6A 1WRJA 3L9FA 2QLZA 3AJ5A 4EM0B 2WAQN 1IG7A 3IRRA 1XMXA 1VQNI 3QODA 4BBSJ 3BA4A 1UHMA 5TRDA 2J3PA 2RNJA 1G9CA 2JPCA 2ZKZA 1IN4A 2EPFA 2D1VA 1WSUA 1K79A 4CH7A 1VQ7I 4L0ZB 1XG6A 4MO7A 1AKHB 2F6CA 3J7AY 1LFPA 3D0SA 1IT0A 4RLFA 1BFFA 1BIBA 1YX3A 2A3SA 1ON2A 5HNFA 1ZELA 1AVXB 1YX5A 1S6LA 1OQLB 5FD6A 2DA2A 2HTJA 1B72B 3BCAA 4X0GA 4WXDA 1FIPA 5B1BH 1B72A 3AG3H 1S5LC 3DKYA 3SFZA 5KAFC 3DBRB 1E3OC 3AH1A 2D2WA 3NAUA 3PFIA 3I58A 1QA6A 4BQAA 2XVCA 4MQ9F 1FTZA 2L7MP 3BJ6A 4C2TA 2HKXA 3RIRA 2K9LA 1AOYA 3GTKJ 3HOMA 3FJIA 2CMPA 4CXFA 4A3LJ 2VU9A 3PQKA 1YS7A 3TO9A 3ZMDA 3EUKL 3BR1A 3O49A 2RGVA 2ZSIB 2K7LA 2XRLA 1MNDA 4I98B 3KEOA 1YF8B 3G2BA 3RPUA 4D1QA 1S0GA 1PUFA 2FOWA 2FQ4A 3EYYA 1HCEA 2HWVA 2F5VA 2G9WA 2M87A 2JSCA 1HDPA 5IPAA 5D8LB 3F23A 1Z6TA 1VQMI 2KKIA 5EGOA 2BE5F 3JUTA 1K5VA 2Z5UA 5DM7F 4RGUA 1JI8A 3LSHA 3MWMA 3ABTA 4OWLA 1VQLI 1UJ8A 2IGKA 1I1EA 2M7AA 2E1CA 1NK3P 2H94A 4X37A 4LFUA 4J2SA 5GTHC 4A5MA 1S0BA 1QGPA 3ABUA 4U87A 2E35A 1N78A 2FEZA 3IM5A 5CVVA 2R4GA 3FM3A 3BAVA 1FOWA 2LF7A 2RDPA 5E3NA 1ETWA 5B2HA 4EV0A 2XAHA 4BKXA 1SANA 2LRDA 4WXCA 1CVSA 2CV0A 1Z6RA 3L2QA 4IQPA 2V1UA 2Y30A 2QBYB 4L9TA 2VSAA 1DFQA 3H0DA 1XC5A 1IRAX 2VKDA 3Q0UA 2F5FA 1YJWI 2M1BA 2BFHA 5IT9Z 4LITA 3BRGC 3CJTB 2FFUA 1QBJA 1Y56A 4FE4A 2DMQA 1YTYA 4Z2YA 2LD5A 1UPSA 5J8FA 4G6JA 2EIMH 1MNMC 3WHCA 1IN5A 2R7QA 3K4MA 4ZZDA 3CA1A 1IAWA 4WXHA 2Q9XA 2DK5A 3RYPA 1ZRCA 2AQEA 2QENA 4RS8A 2P5VA 1IHKA 5FGMA 3EUHC 4QSHA 2R7XA 3OYMA 4M3BA 2GIVA 2EILH 4H0EA 3A02A 1GHCA 3OIOA 4ZTJA 1W5SA 1XX5A 4L5EA 4DYCA 1AU7A 2OCEA 1IOBA 4O6JA 1CF7B 3L7WA 2R92J 3RKWA 3NBNA 1CF7A 2HZTA 3BAQA 4XONA 1Y0NA 1I6XA 2VQHA 4HR6C 1A35A 4MNUA 4J2KA 4B3AA 2Q2EA 3BADA 3NRVA 3HM5A 5LRRA 3HSMA 2CQXA 4JRAA 4L18B 5HOOA 1S9HA 2FQ3A 1OYYA 1JTYA 4XFSA 3POKA 3FDYA 1R49A 3JW4A 3FUOA 3KFWX 3CA5A 3KIOA 4B48A 2R0QC 4XFTA 3SDGA 5E8IA 2H27A 2E1MC 3CCQI 4E7LA 3S16J 3ZMTA 5CYVA 2EV0A 5JHFA 1SFXA 2X51A 1UG2A 3A21A 2FFVA 5F6FA 3Q7XA 2M34A 4P9FA 4RM3A 4MIMA 4ZH4F 1KYWA 2QCOA 2BEOA 2RVCA 3PIPF 4G7HF 5ICFA 3F1RA 3BC8A 4AWXB 1RESA 3KZIC 3M1CA 1T56A 2ID6A 4KUMA 2EA4A 3M8EA 3GF2A 4OMZA 2MA3A 3K70D 1HSJA 2BEAA 4FHTA 1ETKA 1TWHJ 3EPZA 3F8BA 5ED4A 1YQAA 2OQRA 4YG2F 1FX7A 1WWXA 1TL8A 3SJMA 4QKSA 3K4KA 3VYSB 1S0EA 3FJ9A 5CQEA 3BPVA 3E0JB 3F72A 3ML6A 2HKOA 1W5TA 4HA8A 3MFKA 4OEEA 2ETHA 3SYTA 2NZ9A 3O6BB 4EB2B 1T0FC 3KP3A 4KIGA 1RR7A 3QYEA 3LFUA 4HLXA 4F52A 5JLVA 3H1CA 4LO0C 5D6FA 1Y6IA 2Y9GA 1K78B 3LA2A 2LKSA 1U9NA 1RPWA 3F3XA 1K78A 2FU4A 2ELHA 4RLQA 1LDJA 2BY1A 1U8BA 5C4JJ 3BG3A 4XOTA 1TWEA 4IRGA 3RPUD 1W4MA 2B63J 2MW8A 4CYCB 4II2A 1NTCA 2LNBA 1Z3YA 2NVUB 3VOEA 4CYCA 4USPA 4WCGA 4ZA3B 3F62B 2CS3A 4TLPA 2PEXA 3TQNA 2CQ7A 2STTA 1OCCH 4CA0A 1IDYA 2HS5A 2F4OB 2HU9A 5IOYA 2M7BA 3IAM2 4LLLA 1FPQA 1Z3XA 1K4TA 1MC9A 2PMUA 3V8KA 4IO9F 2D23A 2VB6A 5F8YA 3K1XA 1MJAA 6I1BA 1SAXA 2CYYA 1FBSA 2ZJ2A 5EEGA 4EGYA 3G1OA 2B0LA 1YIJI 1OKRA 5FLMJ 1APLC 4E7SA 1PP7U 3M7GA 1EYLA 1XSVA 3C18A 2JZYA 1GUUA 3ZXDA 3KP7A 2ESNA 2WAEA 5IT3A 4KYWA 3FJDA 4IZEA 4L4IA 2A6HF 1T8IA 3ZN0A 3K6GA 1P2FA 2Z16A 4ZJZA 3HGYA 4BQQA 3VT0A 3IUOA 2HPMA 1VQKI 4ZLBB 2TDXA 2DOEA 2L5QA 4G94A 1MW7A 2XPVA 4Y4RA 4BQOA 2CV1A 2VBYA 3VWCA 3H5NA 1QRYA 2CU7A 4IHYA 5TGTA 5F8WA 3ZC8A 1MKMA 2XAJA 4I0YA 1WJFA 3PG0A 4KN7X 2EWNA 1HKSA 2WTEA 2OTLI 3JRRA 4EM1A 1Y8RB 3BTJA 5I1BA 2F2FC 3GCMA 1EV7A 2OUMA 2R7VA 4XIDA 3GTLJ 1I3AA 3VYTB 4XN0A 1S0LA 3NBDA 4B09A 4ENMA 3RI4A 2MH2A 5L3DA 1X4PA 3TO6A 2OPTA 3I71A 3V7CA 1BASA 5EZHA 1B1BA 3I5UA 3SHFA 3COAC 5LD2C 1I1SA 4OINF 1Y1WJ 1OLTA 3OIPA 4B1RA 3S3MA 2Q1ZB 2ZNYA 3JTHA 4LO1A 2ELJA 1R4NB 4XLFA 3H0GJ 3PFYA 1AHDP 2ZO4A 1AF9A 2DRYA 1YJNI 2I1BA 5KK1A 5CQGA 3HRMA 1FYKA 1HCRA 5EF6A 4HX7A 5GPAA 4HLYA 1HDDC 2ESUA 2VLCA 1SR4C 3B9UA 3LMMA 4B44A 4QPOA 1QPIA 2E71A 1DQGA 2VXZA 3U1KA 4BXFA 2HGCA 3KPHA 2HDCA 2Z2SB 2KHMA 1RETA 4J00A 1R6RA 2P8TA 2WC2A 2ZXIA 4R8HA 2VSEA 2XB0X 4LIVA 2L9SA 4TV7A 3BR6A 3W3CA 4DBQA 1T9FA 4JQ0A 1SFUA 2GLOA 4G7ZF 2XPUA 4A3IJ 1V55H 2EZLA 1EF4A 2HOAA 2VPLA 3A01B 5LRSA 1U2WA 3N0KA 1OPCA 4WX9A 3A01A 5BXRA 3TW7A 2MLGA 5CVUA 1IXRC 3WMUA 1ETOA 3FFZA 1TLHB 2D22A 1DGRM 1BL0A 3BR3A 2HZDA 3FHZA 2M49A 1PZZA 2L9VA 4M9XA 4UHTA 2Y0MA 1JTXA 2GZWA 2ZNZA 3HTSB 2ZXHA 1FMMS 4I4UA 2V9PA 2IA1A 2PQ8A 2CFOA 1RC9A 1SZ6B 4QD2B 1A31A 2O9LA 3F9KA 4KN4X 3CC4I 4I4YA 2P81A 4W97A 4USOA 1P7IA 3WTVC 4F55A 2G0EA 5BP5A 4NC7A 1EH6A 2VJIA 3FF5A 2ZR1B 3BA5A 1S72I 4LLNA 4ANJA 1M1EB 4NC8A 1M2TB 4GAFA 4D8HA 4D9JA 5K5OA 1GVJA 1VI0A 4UB6C 3V7RA 1TOOA 1FOKA 2LY9A 4PUSA 2DA6A 3AG1H 4Y7NJ 3KMVA 4OW4A 3ZC9A 5FJ8J 4A3DJ 4GDFA 3DTIA 3CA0A 4AN7B 1KNMA 1G4DA 5LBQA 2EV6A 4ZFWB 1MBEA 1BA5A 2E34A 2QF7A 4J2YA 3FUQA 4DIQA 1NHAA 5EJCA 1XCVA 1LQ1A 5F27A 1FWUA 1GDTA 2O8XA 3IM7A 1TTYA 2LC2A 3HRTA 2F4IA 5D4RA 4CGZA 1HXDA 4MFEA 3NJ5A 1RUNA 5LEJA 3WU0A 3HRUA 2YU3A 2V6CA 4IOCF 1R1TA 4BQNA 3LLPA 3MKZA 3S2HJ 5FNXA 4JX4A 3TP0A 4QWQA 5E3OA 2E1MB 1OCRH 1HIBA 2H1LA 2F5CA 4I96A 3V0AB 1LNWA 2A68F 2NXNB 2XASA 1O3RA 4BJTA 3V0AA 3CA4A 1JQZA 2G7UA 2DDAA 4U7BA 3K4LA 1R1UA 3HIFA 4F91B 2AS5F 3FIWA 3D5LA 4PCQA 4BJ5C 5GPCA 3BG9A 4CYDA 1JHFA 5L3BA 4ZYHA 4XMYA 2CQNA 4I6IA 4BNCA 2X1DA 3A2KA 3IKVA 1G8XA 3QPTA 1F36A 1WJBA 1VF9A 1X2NA 4RB1A 1BFCA 4GAIA 4KC3A 2M4KA 2Y75A 1MD6A 5IP9J 5M5YJ 1YTOA 1JT4A 3H5RA 1FLIA 4BL0B 3TBIA 3N4MA 4OWJA 3BROA 5D5WB 3VSLA 4Y13A 4BEHB 1O4XA 5IP6A 3K1MA 1BM9A 2PMHA 3ECHA 4UV8A 4BEHA 1ZR2A 4JKQA 1T38A 3PSFA 4C3IJ 3CRGA 3QYBA 2RV8A 3K4NA 4KICA 4CCLA 2ZFWA 1ZYRF 2CWEA 1N77A 4M72A 2R7UA 4KEKA 5EEAA 1X2MA 1JKOC 1W7PB 5D5XB 1KQ8A 3AFHA 1BR1A 3RDIA 5DD4A 1W7PA 3DKWA 1HW5A 1E3PA 1FYMA 3T8TA 1JE8A 1FP2A 4OIRF 4C9YA 4OMYA 1V6XA 1ULYA 5JLWA 2I10A 4EEFG 3GZNB 4G7OF 2BV6A 4ZDPA 3J7ZI 2LF8A 1OCPA 4IF4A 1IRGA 1XDSA 1YI2I 4IRHA 3JREA 3I4NJ 3WTWC 4MLOA 5DCMA 4IHTA 3OR2C 4PJNA 3OYCA 1F5TA 1JKPC 3D5SC 4S0HB 2KJBA 2PI0A 5A2QK 4I09A 4KISA 3IV5A 2XAFA 4OAZA 2E4MC 2DDBA 4M3GA 3L2VA 3AKGA 3F8NA 2KP6A 4WWCA 5FRMA 3F8CA 3T5XA 4XFUA 7I1BA 3DTEA 1ZG5A 3QU3A 1YJ9I 3LSRA 1FMWA 5BQUC 2YR2A 3Q3SA 3CMMA 3CD6I 1XGNA 1NH3A 2DA4A 5DV5A 1X1BA 3KP2A 1J5YA 3P5JA 3QOEA 5J1YA 1X3UA 2R7RA 2MG4A 2R7ZJ 4ESFA 1QVTA 2K9MA 4I1BA 2LY2A 4P5OA 4ZGRB 2IAIA 3RQIA 3TEDA 2X6WA 3FKJA 3EQLF 3DBLB 2V1NA 3DKXA 4IPAA 4RAYA 4GOYA 1WI3A 5AIQA 1PC8B 2VL8A 4PJLA 3LSGA 2MYSA 2E1OA 2R7DA 1ZREA 1XS9A 3ZPLA 3FX3A 2QA4I 3LOCA 5BS6A 2GQQA 1RG8A 4LO3A 1WCMJ 2P6TA 3LL7A 5KHDA 4IHZA 1O3SA 5DVHA 2F4MB 3HPGA 3OYBA 1TQIA 3KP5A 1B9NA 5FKMA 2ZJRF 1OYWA 3VT2A 2QSGX 2EFQA 1ETVA 3BJOA 2Z1DA 3J80Z 4AIKA 1FQ9A 1WFXA 1KU7A 4Y3OA 5L3EA 5KNLA 1W3AA 2R9KB 1YRNA 3OJVA 4ZYDA 3OY9A 2X6XA 2DOFA 1NZKA 2OCCH 3TC2A 1T6SA 4E7ZA 4ON0A 3G1LA 5C44J 1XTAA 5ERIA 3SZGA 4X1EA 3RZOJ 3ZMUA 3IHUA 4ZFUB 9ANTA 2BYVE 1ISYA 4QO3A 3QRFF 1Z05A 4IY8A 1YLFA 1XPXA 3OS0A 2IEKA 1E2XA 3H6RB 4HF1A 4RGSA 1HWOB 4ZDLA 2A5WA 3J7YJ 4BU2A 1IUFA 2MFZA 5C4XJ 4Q47A 3ASOH 2D1ZA 3CJNA 1LKXA 2K85A 1RNLA 2VOPA 2GXAA 2NS2A 4A7KA 1BC8C 3D1NI 1Q03A 1QQLA 5CVJA 4BJ6C 1W3FA 4BGDA 1Z9CA 4P1WA 3UJ4A 1MZBA 5BQTA 2NTDA 4P0LA 2X1EA 3WO4A 4C2UA 3CUOA 3ROUA 2EFOA 2HQNA 3H6SE 4OWKA 2VASA 2CUFA 5G00A 3FWEA 1QZEA 3DV8A 1FTTA 4JYKA 2VE9A 3HOUJ 1JKRC 1FYLA 2KPMA 2NVXJ 1PUMB 1X3ZB 5H20A 3NBCA 5J47A 1ZTRA 1HWMB 1IJWC 1F9NA 1QNTA 2ISZA 1ODDA 3OYKA 1W7PD 4BXXJ 1BI0A 1A6IA 1HBXG 2ME6A 2OAZA 4OOIA 4HSRA 1V6WA 2E7XA 5A2QZ 3OYHA 3GEZA 1V4RA 1YW8A 3LSJA 4FETA 1YBIA 1G3WA 5HVQC 1Z21A 1GV2A 2CO5A 4PDKA 2KKOA 2YPRA 3LTQA 1SD7A 1QXMA 1XSXA 3CJQB 1RRJA 1BA7A 4NUBA 1HSTA 3C2BA 2VBZA 3BTLA 1B8IB 1FEXA 2BY3A 2WB1A 1B8IA 3O44A 2FNAA 3H36A 3M8FA 3A0HC 3WTYC 3U9GA 5GADJ 1X1PA 3H9JA 2DU9A 2ZC2A 1IXSB 1IV8A 2FBKA 2XF6A 1P4XA 4B4CA 2OZUA 5KVRA 3HOSA 4OIQF 2QN4A 4F83A 2CRGA 2XF7A 1TT5B 3K4BA 2LK2A 3WTSC 4IQJA 2QGUA 5J1UA 4I2OA 2NYYA 3HALA 1BJZA 3Q5FA 4M6VA 3MPPG 3S3OA 5BMZA 5FRNA 2W48A 3OYAA 2HYJA 3B6CA 3LAPA 2K86A 1MBJA 1P4AA 3R60A 2IA0A 4OU0A 2CW0F 4HPQA 1XN7A 1ZAOA 1EKEA 2QSHX 4DBRA 3SXYA 2R7TA 2KIMA 2GZBA 4DJAA 1AKHA 1ORKA 3K1PA 3F21A 2PBIA 3E7LA 5EYRA 3QP6A 1TW3A 2LP0A 1ZG1A 2H8WA 2GA1A 4U88A 1BN5A 1PYVA 5FKKA 1HF0A 5FLXZ 1BJAA 1N4KA 4ENNA 5EDNA 3WINA 2VQLA 3U1DA 2GWRA 3HSRA 5JFRA 3Q7YA 4GOVA 3I4MJ 3WO2A 3AH2A 4ENJA 4C30A 2MC3A 2DTRA 5DUIA 2DT6A 2O8KA 3MKWB 2A07F 1D1AA 3JCUC 1MH3A 3FBNB 4KEJA 3JRHA 3R6SA 1TIEA 3UJ0A 2BHYA 1GXPA 2V26A 4LG3A 4ZZLA 1IXCA 4H4KC 4XNFA 4N0BA 3RMXA 5L3CA 2OBPA 2DOAA 1XGSA 3KLNA 4G1RA 2LKPA 2M3AA 1BARA 4FTHA 3GBGA 1ZR4A 3GUDA 4IHWA 2JK3A 1Z7LA 1ZQ3P 3LA3A 5E8GA 1G2HA 3D5RC 4XL9A 2R7SA 3AZVA 3D7WB 2BOLA 2LVSA 2PMZA 4RAGA 2CUEA 4XLPF 2EFPA 3CC7I 4S04A 4UUVA 4LO7B 4MTEA 1IRZA 4Z8SB 3JRFA 3H3UA 2Q0OA 5L3FA 1WI9A 2X9DA 4I0AA 3KP4A 3VFZA 4BS9A 4E6KG 1CGPA 1Z91A 3LFKA 1BW6A 4O3MA 2NS7A 4XSZF 1DP3A 1VQPI 1FSEA 2JRMA 3K1NA 4YIFA 2ADUA 2MBFA 3HG9A 2Q3NB 1EJ9A 3QOPA 1S0DA 3DCFA 4G6TB 1W0UA 2VQGA 2HFHA 1DIWA 1O57A 4E7HA 1SVLA 2DMPA 2JA2A 2ZXJA 3CUQC 1KQ9A 2VUMJ 3CAHA 2KI4A 5LFAA 2UUSA 5E1XA 1KU2A 1B6AA 4AYBN 5HLHA 1MBKA 3HJEA 1JJ6C 3MMYB 5BOWA 5CPRB 4U0YA 1AWCA 3RJPA 3BR0A 2HDDA 2QBYA 2DT5A 3PIOF 1MMDA 1FT9A 2KDOA 5JMCA 4HNVA 2UZKA 4KFCA 3LWFA 2Z9OA 3M3YJ 1S7OA 2DFFA 3I56I 3MQ0A 5ICGA 2IS6A 3V0BB 4ENKA 3HSFA 2DA5A 3V0BA 5H2FC 2DS0A 1IC8A 1K7AA 4E7KA 4RAZA 1WJEA 4JX5A 2KL4A 4LO8B 3VSZA 5H6RA 4UY8I 4JAWA 2BEBA 1LJ9A 3TMOA 3MZHA 1RMLA 4BE1A 4LB5A 2P23A 3HTUA 2HPIA 2W82A 4D7MA 1XG1A 3GTJJ 1J59A 2BHZA 3TOAA 2VXTI 1PVEA 5FFZA 2WV0A 3SQNA 2ELKA 1KU3A 3WE2A 3PMEA 2WADA 4MGRA 4V19K 5F0FA 1D5YA 5AIPA 4HEA2 5ILUA 5E24E 1U5TC 1G3YA 3CCLI 4II0A 2UXNA 1G9AA 1ETYA 2IPQX 5HDNA 3ZQGA 1FMVA 5ILVA 4YFKF 4CCMA 3MALA 1ON1A 3HXLA 4PFPA 4IXAA 1OR7C 4FQGA 4KIBA 4RGRA 3H92A 4XR6A 5K7HA 4X3AA 3ZXGA 1W36C 2BVMA 3Q7WA 4L9NA 2VPRA 1J7KA 3C7JA 4A3JJ 2KQRA 1SFOJ 1OCZH 2E60A 3C9ZA 2BW3B 2DODA 4IRIA 3IC7A 2BW3A 4XRMA 2BGCA 1LVAA 1HOMA 4QALA 3T8RA 1YYVA 4FE7A 4QBCA 1EA3A 2UV1A 4BH9A 3FJCA 1N75A 4RB0A 1L2HA 2NS8A 2TRTA 4A3MJ 5L3GA 1D0ZA 5DS9A 3IL2A 2KH2A 3ZQ7A 1R23A 3FMSA 2W7NA 3TO7A 2Q8KA 1FWZA 1ONVA 1H88C 4CICA 2IGMA 2E19A 2A5YB 4EKXB 3K2AA 2F48A 3WHBA 3CO6C 4BE2A 3E8LC 2VUAA 2R5ZB 3CCYA 2KIUA 2VKEA 2JA7J 2R5ZA 5B1AH 4ZC3A 3FXUA 3I53A 5FD5A 2BY0A 2RAEA 3P9CA 2TCTA 4JKXB 3ZQIA 3SEZA 4XN3A 3HOTA 3GWZA 1R5GA 2I5UA 2L0KA 3A07A 4I7IA 4HQEA 3JTGA 4AC0A 3JAMK 2LKXA 4C2MJ 2PN6A 3DPLC 2GXBA 4XKIA 3S15J 1U78A 3S93A 3Q0WA 4V2GA 5TJJA 2K4BA 2QSFX 3CJRB 2HR3A 3HC7A 2QYOA 1Z4SA 1UFMA 2XPWA 4NB5A 3E6MA 5HLIA 2L2OA 3QYDA 1TWGJ 4LIUA 4CCNA 2K02A 2DFEA 2RQ9A 2VT3A 3EETA 3FM5A 1LB2A 2OQGA 2AQZA 1JGGA 1TTUA 3RKYA 3S2DJ 4XRSG 1YXWA 2WB1N 4G9NA 1BIAA 1ZLJA 5M5XJ 1JT0A 3GMEA 1P92A 3QQAA 3SFIA 5K7ZA 1U6GA 4N4NB 5F1RA 3ERED 3E3VA 4RDUA 5D5UB 4EJTA 1DQUA 4AIDA 3DTKA 2KI6B 4IZZA 1RY7A 3S3NA 1JUMA 2R5YB 2ID3A 4EGZA 1TT0A 4L9JA 2JA5J 4YOLA 3BRFA 3I3LA 3BX1C 2R5YA 3OBTA 5J1RA 4MZFB 3OJMA 1R58A 3DU5A 1Y39A 2DQLA 2O03A 2VXDA 2V79A 2C6YA 4I0BA 3QPSA 3FJJA 5EEHA 4R1HA 1I3QJ 2DW4A 5FKOA 4M6XA 1UAAA 1RKTA 5EG6C 4AUXA 4B3XA 1UMQA 1WJDA 1GVDA 2XIGA 3RTRA 5GAEJ 4A6EA 3AKIA 3JRGA 4KIFA 2CG4A 1F4KA 1TNTA 4FX0A 2IVMA 3ZOBA 1XCBA 1JTCA 3G6EI 1E3HA 3DEWA 1FY7A 4EFPA 2O5RA 4M9SA 2PLYA 2ECBA 1NG7A 2FBIA 3B02A 3WGIA 1REPC 3I59B 4I4OA 3FMRA 4DYRA 3I59A 2LTPA 2DAOA 2DFIA 5JVTA 1H89C 4M73A 3I29B 1VQ8I 2L9RA 1VQ9I 4E7JA 2LDUA 3C1DA 3I4PA 5LHGA 3ZN1A 1C0WA 3WO3A 1V5FA 5FKLA 3W6KB 4DOZA 2R93J 4I3NA 2EFNA 2PX9A 4U0VA 1O3QA 2G7HA 3FXRA 4V2FA 2YU9J 2VBXA 2YUSA 3PO3J 4PJ0C 3R4UA 2ET2A 4WF2A 2RSTA 1BBYA 4A7ZA 2W25A 3J81K 5CVIA 2E2JJ 3ILAA 2PMZN 2DPUA 1HW1A 4HSTA 5ICEA 2NVHA 3CZ6A 2HWAA 4EJUA 4J2XA 3E6DA 2V4JC 3M1EA 2CH0A 1QHGA 3FJ8A 3JAMZ 5FZYA 3G4SI 2DRZA 2M0CA 1HKQA 1G3SA 2M9HA 3WTUC 3AG4H 3V7SA 4FASD 1TWCJ 4QTRA 1ETQA 2MABA 3BPXA 1JGSA 3DEUA 2FE3A 2VJJA 1UHWA 2DQRA 3K4CA 1JHHA 3E5UA 1E0OA 1R4MB 2FA5A 3VEQA 1U0JA 5FZZA 1LFBA 4QPQA 3M4OJ 2DYSH 4PFOA 1XGMA 4RBOA 2HVRA 1WQ2A 3BDDA 3H35A 2JMWA 1WVRA 5E1ZB 4ASNA 5M3FJ 2ACJA 3PJRA 4NHJA 3EUHA 3OMYA 2JUGA 3SEQA 2GOXB 1S0CA 3Q9VA 3I9V2 2FDBM 4L0YB 3CA3A 3PNTA 1DZDA 1ITBA 1BI1A 3HDDA 2VONA 1LVKA 4UXNA 2Y9FA 3OOUA 1MBGA 2WV1A 2FX0A 3AL0C 1DPRA 3GFMA 2JQ7A 4DENA 1KYZA 2DFHA 4U0WA 4ISQA 1TP0A 1E17A 1AXMA 4M74A 1XMAA 3UNGC 2P0WA 1TZLA 1SMTA 2K27A 1SAUA 3FJEA 3MKYB 3IAS2 5FFXA 3BQYA 3TW6A 1G6NA 1S7EA 3H9GA 3ZX7A 3V4GA 1ZN2A 4KJZA 4QKRA 4JP0A 1MMGA 4Z6YA 3JRIA 2H6BA 2HI3A 3N97A 3LSKA 2V7FA 2EJRA 4G6QA 5F0CA 2WAFA 4LK1F 1FNNA 3A03A 1WD3A 2XUBA 3C2GA 1U9OA 1WH5A 2EA2A 4A0YA 2KRHA 3FJAA 3LSPA 2XAQA 3JRDA 3L1PA 2Y48A 3OS2A 2E5ZA 2JA6J 4LO2C 5CLSA 4DYQA 1VCLA 5B5EC 1A36A 4J19A 2I8DA 2L7KA 5EC5A 2ERMA 1ZG3A 3WA1A 4A5NA 4XQFA 3NQOA 1Z0HA 4JQFA 4A6DA 3FXJA 4PSXA 2DA1A 3S17J 2FJ1A 1TW2A 4HYEA 2M8EA 2QQ8A 3GLLA 3W6JB 4A0XA 3VWBA 2MIBA 1WBAA 1MGTA 4FISA 4B43A 1ZLKA 4QBVA 2W84A 5B3SH 2W85A 2HNHA 3L09A 3GXOA 2XAUA 2E2IJ 4A7YA 4H9WA 3GO5A 3CP2A 1R36A 1T0FA 3IP4B 2BVLA 2O3FA 2DBBA 1I5ZA 1X1CA 2VJ4A 4LO0A 4G12A 1FP1D 3OYEA 4ZBVB 4X6AJ 3OBRA 4IHXA 3R0AA 4H04A 1R7JA 1XSDA 3O8GA 4KEIA 2X85A 3FXOA 3QAHA 1JT3A 2KISA 2XRNA 5FZUA 3UDAA 2CQQA 1YO5C 2R7FA 3WTZA 2HZ9A 4AD9A 4EVIA 4I02A 4BXUA 1T2KA 3SZPA 3J81Z 3K10A 2L3DA 3M9AA 3CA6A 3ZQHA 2LREA 2X2SA 2QUFA 1W0TA 2DPDA 2A6TA 2CW8A 4Y33A 2D45A 5BPIA 1FMZA 2E5NA 4MQVA 1MDMB 1P6RA 1ONKB 1FC3A 1MDMA 3DU6A 2YSRA 3PO2J 4YIRX 4AYBA 2ZCWA 4KITB 5J3LA 3O4OA 1R5HA 9ILBA 3BLYA 4JPZA 1IJTA 2RREA 4KMFA 3O4DA 2ZQNA 3A23A 1P63A 2M45A 2XSJC 4UVCA 1IV6A 1IDZA 1EVTA 1XDUA 2N8GA 1T98A 3CCSI 4J23B 1G9DA 1XMKA 1J0SA 3V8JA 3RSJA 4HRIA 3IM6A 4ETSA 3O4CA 3V8LA 1I39A 1R8NA 2DI3A 5FROA 4IHVA 5E17F 3HBLA 1U3EM 5LGNA 2EK5A 3T0YA 2L54A 3C3WA 1KZHA 3ESWB 4PGHA 3O5WB 3BG7A 3O2PE 1TFMB 2FXAA 3VSKA 3QP5A 4M71A 2L9NA 4OAYA 1WKMA 3KE2A 4QIWN 3CC2I 3WG7H 5C3EJ 2DLLA 3O3QA 1K6YA 4D0ZA 4G9MA 1T39A 1TWMA 4FCYA 4I2SA 1RIOH 1TNSA 5IYCJ 1BLAA 2AAIB 3S8PA 3PL8A 1R22A 2DYRH 4F93B 2F2FA 2A61A 3FXKA 2J5OA 2JT1A 3W2VA 3CCUI 5J4YA 1K5UA 3ZR8X 5D6EA 1B59A 3S1MJ 5EZGA 1K6OA 4UNOA 4RA2A 3V42A 2CQKA 2CJJA 3HZJA 1HKTA 4HZFA 2PJPA 1HWNB 4EEEB 2L02A 3RZDJ 1TBXA 2HQRA 3L2CA 2YX4A 1ISWA 3ISPA 3O8HA 3BG5A 1QPMA 1Z0XA 21BIA 3ZCOA 2ISYA 3PQJA 2LBFB 2W24A 3CCEI 2QZ8A 2KZGA 2JSPA 1SR4A 2CUZA 1UELB 2LBFA 4UUSB 3G71I 4F7ZA 3ZGKA 1F31A 1XGOA 4UUSA 1V54H 3JSPA 3BWGA 5LHIA 3UKGA 2X6OA 1JLYA 3C2HA 1KGSA 4XK4A 1LDKB 1W36D 4I4XA 1J2XA 2MC4A 3HPHA 4Q48A 3I64A 1D3YA 4XKBA 1ISXA 5B66C 3DF8A 2JVGA 3ZMSA 1Q1UA 1IRXA 1D1CA 3BP8A 2K3FA 3ABKH 4L9VA 1Z67A 5AONA 1FOXA 4G8XA 2HVSA 2OF7A 4XSXF 3I55I 3H6RA 4BHBA 1S0FA 2WBMA 3RTJB 3BTIA 4BY1J 3CDIA 4D0PA 2NOGA 2XKOA 1P7JA 5K5QA 2WY8Q 4CSWA 4LG0B 3NBEA 3H6QA 4I8MA 3M8JA 2LMDA 3MEXA 4LG0A 2D24A 2F5EA 3U2RA 4R79A 3O4AA 4IY9A 4P6AA 4IKFA 1AFCA 2ZB9A 1D5VA 4ITVA 1BLDA 1HLVA 4CCJA 3Q9SA 4HQMA 3DLLF 2W1OA 1ISVA 4CCKA 6PAXA 2RN7A 2UXXA 4LOCA 4JK1X 4LJZF 3GYHX 1MSEC 1R71A 1ZARA 5DCFA 2YX7A 2LG4A 2R7OA 4I37A 2GOMA 2F2EA 2HOSA 4EJWA 1V6VA 1KONA 4BUPA 3OWTA 4YIIA 2H8RA 4H75A 3CCVI 4ZYAA 3ZP5A 1SVMA 4M6YA 1F43A 1II4A 4YFXF 3QPLA 5BXSA 3VYUB 1IN8A 4BBRJ 3ULQB 2JRTA 2XDVA 4HW0A 5HS8A 2OV7A 1JY0A 4CCOA 4AVZA 1MNEA 1VQ4I 1EPWA 2JJ7A 3OSGA 2DN0A 3KZYA 4HA2A 3HHGA 3CF5F 3AAFA 3S1QJ 2BXYA 4EFRA 4UUTA 2DT7B 2QYIB 3ZXSA 4IONA 1DUXC 2D7RA 2VT2A 3H9QA 5GAHJ 1Q04A 1GV5A 2IW5A 1BI3A 4P55A 5D5VB 2RQPA 4A3BJ 2DJNA 3N7JA 3R61A 1SFKA 2O61A 1N25A 1MMAA 1DDNA 4Q91A 4XOPA 3NARA 1LPQA 3KYLA 1TWFJ 4MEXF 2D7IA 1QVUA 3ZQLA 3ABLH 3FJKA 2LY1A 3WGGA 4Y17A 2MC2A 2YS9A 4WBCA 1J0RA 5JHUA 1HC8A 4OIPF 3ZQCA 2Y69H 4I4VA 2PJRB 4XLHA 4J01A 3B6AA 2DXIA 5IT9K 3OYGA 1IGNA 1MBFA 4RAFA 1Y8QB 4AIHA 1FN0A 3KETA 1WJAA 1X3WB 3GW2A 5JVGF 2L5XA 1D0YA 5JR3A 3WODF 2Z49A 1V5GA 3TDZC 3BAUA 4GRIA 5D4SA 2NRAC 3I0TA 4I01A 3MZ8A 3CF2A 4HX8A 4R6UB 3K69A 1IZ1A 3NEUA 1R1VA 1HW2A 1YOVB 3FJBA 3L00A 2BZTA 4CZZA 2D44A 4P0JA 3HHHA 1HCDA 4HAMA 4HOBA 2KRFA 3R4SA 3OGGA 4JX6A 1YE9A 2K8RA 3S8KA 2FSWA 1YIOA 3TL4X 2EB7A 2OZ6A 3DEEA 4E4HA 4MFDA 2DMNA 3ZMZA 3P9KA 4F92B 1ABRB 1R9TJ 1W3GA 4EJVA 2CUJA 3HOVJ 2HWMA 1LFUP 1T4QA 2HQ5A 4X39A 3OR1C 5GAGJ 5E3LA 1A04A 1DGWY 2XAGA 1OISA 1JUSA 2HXOA 3PNYA 4XLNF 3GTQJ 4Z9WB 3RSNA 4F3QA 3E6CC 5IP7J 3GTPJ 2A6EF 3GX4X 1OJLA 5BPDA 2V9VA 2HW9A 4YELA 4II3A 2Y9ZA 4XRFA 3JRCA 2PG4A 3KYDB 2D5VA 4XM3A 5CVRA 1V5EA 1D0XA 1GXQA 1H9TA 1VQ6I 4UVAA 1P9QC 3JRBA 1O7LA 2DO7A 5HDGA 4UB8C 2E4MA 3BJAA 2VOOA 5F0HA 2XC7A 2NVQJ 2Y9WC 4P96A 2KT0A 3UD8A 2ZJPF 3ZQQA 1EH7A 3S2WA 4FX4A 2QVOA 3W6VA 5BQUA 1PUFB 4LO1C 2VBWA 1SD4A 3BZKA 3EDPA 4ENDA 2K40A 3U21A 4KA4A 5EGOB 2IA2A 4EATA 5HODA 1SEUA 5ICCA 2MH9A 5J40A 2NAZA 2O0YA 3CTAA 4CJMA 1PUEE 2UWMA 1H8AC 2IRFG 1SMYF 1TQPA 3Q0VA 3DPTA 4U7DA 4ZFYB 1BFGA 1ZGWA 1USTA 3ZRGA 2IWTB 4JBAA 1V6UA 3AKZA 3E6BA 4ZKTB 3QU6A 4DW6A 2JVHA 2WRYA 1XYFA 4I76A 1SD5A 2JWTA 4HBLA 4BAYA 2XSDC 4OEGA 3S8JA 4D5FA 2FMLA 2VN2A 2HEOA 3VUOA 2LFBA 3P9IA 5GAQA 1IO2A 3HKZA 5DSSB 2FO1A 3CRIA 1QQIA 3BOQA 2M4GA 2XGXA 1IW7F 1NG6A 3A0BC 4GCVA 2FNPA 1QQKA 1BW5A 3QPHA 4XLCA 1QZZA 2K4AB 2VC1A 1I50J 4PK4A 5FLVA 3GTGJ 3FXMA 1ERDA 4LGWA 4DNCA 2HYFA 2RNGA 3LSTA 4QD2C 3L2RA 2E7WA 5BP5C 4EMSA 2K3PA 4D5CA 3WTXC 3HYIA 3MCZA 3FMQA 5E1WA 4L5JA 1FSHA 1O7FA 3AKFA 2FRHA 3BA7A 3JR9A 3RMYA 1MBHA 2EH3A 3EYIA 3CRHA 3K7AJ 4I4RA 2Y2ZA 3FISA 1DP7P 4IEJA 3BZCA 4RB2C 1DLLA 1OMIA 2XGEA 3GTMJ 1YS6A 1QZYA 1ACIA 3R0JA 1Y1VJ 4A93J 3RPQA 2CV2A 2K4JA 5DTDA 4D0TA 2Q2EB 1D1BA 4M3FA 1X58A 4ZYEA 4BDYA 1AVAC 4RGXA 4MEYF 1SD6A 3J7AO 1WJCA 2EV5A 3IIRA 1DU6A 2IP2A 3LNQA 5BOXA 2IGOA 3IRQA 4G9YA 1X1DA 3LQQA 3RKXA 1OYIA 2P39A 3OYNA 4AM3A 4HNUA 2EFWA 1WJ5A 2ICWG 4OIOF 3HN1A 2Y0SA 1A5JA 3WE3A 1LUJB 3W9TA 2E36A 2EZKA 2KRCA 3OYJA 4IQ4A 1YW7A 3OYIA 1YYNA 5F90A 2V6EA 3S32A 1BOAA 2NM1A 4XBFA 5K1YA 2NOJB 3CESA 1RR8C 4AU7A 3ABMH 1IRPA 3BCBA 4ISRA 2M2EA 1TQMA 5HDKA 3BAGA 1JT5A 5EHAA 2BY2A 3CLOA 1NUNA 4XLEA 4AVPA 4ZYGA 2P7CB 1DQOA 2MLLB 5BXTA 1H0MA 3WU1B 3N7LA 3V79C 2VQCA 3BQZA 2Y9YA 2XOAA 1BR4A 2RC4A 2CSOA 2DJIA 2DREA 5D63A 2X0LA 2XKPA 2VKHA 4BHPA 3OOPA 3T1BA 1HKNA 3RCOA 1W5CC 1Z7UA 5HNHA 1L0OC 2O6GE 5DUYA 5F64A 2ZQOA 1V3FA 1FV3A 1JXSA 3IH4A 1POGA 4KMUX 1FOYA 1ZKGA 3PUFA 4IOAF 5GP9A 1MD0A 3GFJA 1MSFC 1SC7A 5KCMA 4HDUA 5JLXA 3WU2C 4ESBA 3FBIB 2VXRA 2JUCA 2MGQA
chains in the Genus database with same CATH topology
3UR3C 3I2XA 4KT6A 2K43A 4RM2A 3KEYA 3QYFA 1QU3A 1MMNA 4JOMA 4HG2A 2R7WA 2WY7Q 1BFBA 3MD2A 1ISZA 4OUJA 3H5AA 1HA8A 4G6MA 2M0MA 5BXPA 1J09A 4HJJA 3N7KA 2LIEA 3A4CA 2UUZA 3OYDA 3A22A 2KLOA 4I4PA 4BACA 3A1YA 3PHZA 4IYBA 2D43A 3RQ4A 4GP3A 4LO3C 4PC4A 4RMNA 3PNVA 2KZVA 2IS4A 3PUBA 1XHBA 4OEFA 3QR5A 1XZZA 3EF2A 1DFCA 5F8SA 2KMUA 4B47A 3HUGB 3E1SA 3PSIA 3BG6A 3AZWA 41BIA 4IZXA 3I2AA 3UD7A 1T95A 4Q9GA 2KLLA 2MD0A 2HDWA 2LYCA 3OS1A 3IAGC 5D61A 3DLAA 3OL4A 1R8OA 5HPZA 1E0EA 3OJ2A 4PSWA 2LOOA 4X38A 3VDXA 5D62A 2QKMB 1HWPB 3HMYA 2K5CA 2AXMA 3FJFA 3K4JA 2CW7A 1GGPB 4GP0A 2WAQA 2ZFUA 2X2TA 2VIXA 3L2WA 3CQAA 2QKLB 1AA7A 2Z48A 3N7MA 3SDBA 2IGNA 2ZSHB 4AN6A 4E7IA 2W4SA 1DZCA 2HQAA 2F8XC 4FVVA 3KX2A 4N4OB 4PJMA 2AFGA 4YEJA 4UY4A 3LSMA 3P53A 3HL2A 1JT7A 3O4BA 1A8DA 3OYLA 1D0HA 3VSFA 3N05A 3L2UA 1ILR1 3BAHA 3OGFA 3OYFA 3WINC 2IXSA 3K70C 1WBCA 3OL3A 1AVWB 2IS1A 1AVUA 4YRVA 1CE7B 4NNJA 3AKHA 1BOBA 3OIQA 1PJRA 2FUG2 2RG9B 2Y9XE 4KBBA 3VYRB 5DZUA 2LH9A 4I1EA 1FGAA 3BB2A 5BVPI 2NP0A 1EV2A 4XKCA 4XKWA 1JLXA 4L4HA 4LO7C 3BAOA 3SNVA 3W2WA 2X1CA 3W2AA 4XORA 4OWRB 4MZHA 2D20A 4QC4A 4I4QA 4FGFA 2FGFA 31BIA 1GLNA 4CZCA 4Q9PA 1IILA 4I4SA 2GO2A 2LIQA 1M16A 3NWSA 4NQWB 4EFQA 3AJ6A 4XKVA 3AH4A 2X6YA 2W00A 3NWTA 3DPUA 3DQVC 4DCKC 1WD4A 3EUAA 2VLAA 3HBWA 1FV2A 5HLTA 1PWAA 4BE0A 2VJ5A 1FWVA 4BDZA 1X1AA 3P6JA 2HVQA 3P6IA 4MZGB 4P0KA 4DGWB 3FHNA 1G82A 3CP8A 3VT1A 2DCEA 1BR2A 3CU1B 8I1BA 4XLAA 2OC6A 3AL0B 1RZOB 3BTAA 5CKTA 3LSIA 4F34A 2XF5A 3FJHA 4DEPA 1I1BA 1Z2VA 4PJJA 4ZOTA 1QHHD 2WA0A 1DJSB 2IS2A 4IX7A 1PUUB 3WMVA 4HNTA 3DWLE 2YUGA 1UG0A 2IHOA 2WBCA 3RTIB 1G59A 3UD9A 4ZTFA 1VZ0A 3BRDA 4LO2A 2PJRA 4ZDOA 1G9BA 1X19A 4CUGA 2V9KA 2AQFA 2RQQA 3FGMA 1X4OA 3ONQA 3T8SA 3AJ5A 3BA4A 3QODA 2J3PA 1G9CA 1XG6A 4CH7A 2F6CA 3J7AY 1LFPA 1IT0A 4RLFA 1BFFA 1YX3A 5HNFA 1ZELA 1AVXB 1YX5A 1OQLB 3BCAA 4X0GA 3DKYA 3AH1A 4C2TA 2K9LA 3HOMA 3FJIA 2CMPA 2VU9A 3EUKL 3O49A 2ZSIB 1MNDA 1YF8B 3G2BA 4D1QA 1S0GA 1HCEA 2F5VA 2KKIA 3JUTA 1K5VA 1JI8A 3LSHA 4OWLA 2IGKA 1I1EA 2M7AA 4X37A 4J2SA 1S0BA 4U87A 1N78A 3IM5A 2R4GA 3BAVA 5B2HA 2LRDA 1CVSA 2CV0A 3L2QA 4IQPA 2VSAA 1DFQA 3H0DA 1IRAX 2VKDA 2BFHA 4LITA 3BRGC 2FFUA 1Y56A 1UPSA 4G6JA 3K4MA 2R7QA 3CA1A 2Q9XA 2AQEA 1IHKA 3EUHC 2R7XA 3OYMA 4ZTJA 1IOBA 3NBNA 3BAQA 4XONA 2VQHA 4HR6C 4J2KA 3BADA 3HSMA 4JRAA 5HOOA 1S9HA 4XFSA 3POKA 3FDYA 3FUOA 3CA5A 4B48A 4XFTA 2E1MC 4E7LA 5JHFA 2X51A 3A21A 2FFVA 3Q7XA 4RM3A 3F1RA 3BC8A 3M1CA 3K70D 2BEAA 3EPZA 4QKSA 3K4KA 3VYSB 1S0EA 3FJ9A 5CQEA 3E0JB 4OEEA 3SYTA 2NZ9A 4EB2B 1T0FC 3QYEA 4F52A 3LFUA 5JLVA 4LO0C 1Y6IA 2Y9GA 4RLQA 4XOTA 1TWEA 3RPUD 4II2A 1Z3YA 4USPA 4ZA3B 3F62B 2CS3A 4TLPA 4CA0A 2HU9A 2M7BA 3IAM2 1MC9A 1Z3XA 2D23A 2VB6A 5F8YA 3K1XA 6I1BA 4E7SA 1EYLA 3ZXDA 2WAEA 3FJDA 4IZEA 4L4IA 3K6GA 2Z16A 4ZJZA 4BQQA 3IUOA 2HPMA 4ZLBB 2L5QA 1MW7A 4Y4RA 4BQOA 2CV1A 3VWCA 3H5NA 5TGTA 5F8WA 3ZC8A 4I0YA 1WJFA 3PG0A 3JRRA 5I1BA 2F2FC 2R7VA 2OUMA 3NBDA 3VYTB 4XN0A 1S0LA 1X4PA 1BASA 5LD2C 1OLTA 3OIPA 3S3MA 2Q1ZB 4LO1A 2ELJA 4XLFA 3PFYA 2DRYA 1AF9A 2I1BA 5CQGA 2ESUA 2VLCA 1SR4C 3B9UA 3LMMA 4B44A 4QPOA 1DQGA 2VXZA 4BXFA 2Z2SB 2KHMA 4J00A 1R6RA 2ZXIA 2VSEA 4LIVA 2L9SA 3W3CA 4DBQA 4JQ0A 1T9FA 2VPLA 3N0KA 5BXRA 3WMUA 3FFZA 2D22A 1DGRM 2M49A 2HZDA 1PZZA 2ZXHA 1FMMS 4I4UA 2CFOA 1SZ6B 4QD2B 3F9KA 4I4YA 4USOA 4F55A 5BP5A 4NC7A 2VJIA 2ZR1B 3BA5A 4ANJA 4GAFA 4NC8A 1M2TB 4D8HA 4D9JA 1TOOA 4PUSA 3KMVA 4OW4A 3ZC9A 3CA0A 3DTIA 4AN7B 1KNMA 4ZFWB 4J2YA 3FUQA 4DIQA 1FWUA 3IM7A 2LC2A 2F4IA 3NJ5A 4BQNA 3LLPA 3MKZA 5FNXA 2E1MB 1HIBA 4I96A 3V0AB 4BJTA 3V0AA 3CA4A 1JQZA 4U7BA 3K4LA 4F91B 3D5LA 4BJ5C 4XMYA 4I6IA 2X1DA 3A2KA 1G8XA 1WJBA 4KC3A 4GAIA 1BFCA 2M4KA 1MD6A 1YTOA 1JT4A 3H5RA 4BL0B 3TBIA 4OWJA 3VSLA 4BEHB 4BEHA 4JKQA 3PSFA 3CRGA 3QYBA 3K4NA 4CCLA 1N77A 2R7UA 4KEKA 3AFHA 1BR1A 4C9YA 1V6XA 4ZDPA 4MLOA 3OR2C 4PJNA 3OYCA 3D5SC 4KISA 4OAZA 2E4MC 3AKGA 3L2VA 2KP6A 5FRMA 7I1BA 4XFUA 3DTEA 1FMWA 5BQUC 3CMMA 1X1BA 3QOEA 2R7RA 4I1BA 2K9MA 4ZGRB 2LY2A 4P5OA 2X6WA 3FKJA 2V1NA 4GOYA 3DKXA 1PC8B 2VL8A 4PJLA 3LSGA 2MYSA 1RG8A 4LO3A 3LL7A 5KHDA 4IHZA 5DVHA 3HPGA 3OYBA 3VT2A 2Z1DA 1FQ9A 1WFXA 4Y3OA 5KNLA 1W3AA 2R9KB 3OJVA 3OY9A 2X6XA 1NZKA 3TC2A 4E7ZA 3SZGA 4ZFUB 1ISYA 4QO3A 4IY8A 3OS0A 3H6RB 1HWOB 4ZDLA 2A5WA 4BU2A 2MFZA 2D1ZA 1LKXA 2NS2A 4A7KA 1Q03A 1QQLA 4BJ6C 1W3FA 4BGDA 3UJ4A 4P1WA 2NTDA 4P0LA 2X1EA 3WO4A 4C2UA 4OWKA 3H6SE 2VASA 5G00A 2KPMA 1PUMB 3NBCA 1HWMB 3OYKA 4HSRA 1V6WA 3OYHA 4FETA 1YBIA 5HVQC 1Z21A 3LTQA 1QXMA 3CJQB 1BA7A 5FNWA 4NUBA 2WB1A 3O44A 3H9JA 2XF6A 3HOSA 2QN4A 4F83A 2XF7A 3K4BA 4IQJA 2NYYA 3HALA 3MPPG 3S3OA 5FRNA 3OYAA 4HPQA 4DBRA 2R7TA 2GZBA 4DJAA 1PYVA 1N4KA 3WINA 2VQLA 3Q7YA 4GOVA 3WO2A 3AH2A 4C30A 2DT6A 3MKWB 1D1AA 3FBNB 4KEJA 1TIEA 3UJ0A 2V26A 4LG3A 4H4KC 4XNFA 3RMXA 2DOAA 4G1RA 2M3AA 1BARA 3GBGA 1Z7LA 3D5RC 4XL9A 2R7SA 3AZVA 3D7WB 2BOLA 2PMZA 3VT0A 4LO7B 4Z8SB 4BS9A 4E6KG 1DP3A 3HG9A 2Q3NB 1S0DA 4G6TB 2VQGA 1DIWA 4E7HA 2JA2A 3CAHA 2KI4A 5LFAA 2UUSA 3MMYB 5BOWA 5CPRB 1MMDA 2KDOA 5JMCA 2IS6A 3V0BB 3V0BA 2DS0A 4E7KA 1WJEA 3VSZA 2KL4A 4LO8B 4JAWA 2BEBA 3TMOA 1RMLA 4BE1A 2P23A 2HPIA 2W82A 2VXTI 3PMEA 2WADA 4HEA2 5E24E 4II0A 1G9AA 1FMVA 4CCMA 3MALA 3HXLA 4PFPA 1OR7C 4XR6A 3ZXGA 4X3AA 1W36C 2BVMA 3Q7WA 2KQRA 2E60A 3C9ZA 2BW3B 2BW3A 4QALA 4QBCA 1EA3A 2UV1A 3FJCA 1N75A 1L2HA 1D0ZA 2KH2A 2W7NA 2IGMA 4EKXB 3E8LC 4BE2A 2VUAA 4ZC3A 4JKXB 3SEZA 4XN3A 3HOTA 4I7IA 3A07A 3DPLC 4XKIA 3S93A 3CJRB 3HC7A 1Z4SA 2L2OA 3QYDA 4LIUA 2RQ9A 4CCNA 2AQZA 1TTUA 1YXWA 4G9NA 4N4NB 1DQUA 3DTKA 2KI6B 4IZZA 1RY7A 3S3NA 1TT0A 4YOLA 3BRFA 3I3LA 3BX1C 3OBTA 4MZFB 3OJMA 3DU5A 2VXDA 3FJJA 1UAAA 5EG6C 4B3XA 1WJDA 3RTRA 3AKIA 1JTCA 4EFPA 2O5RA 1NG7A 4I4OA 3I29B 4E7JA 3WO3A 1V5FA 4DOZA 4I3NA 3R4UA 2RSTA 4A7ZA 3ILAA 4HSTA 2NVHA 3CZ6A 2HWAA 4J2XA 2V4JC 2CH0A 1QHGA 3FJ8A 5FZYA 2DRZA 4FASD 2MABA 2VJJA 1E0OA 3K4CA 3VEQA 1U0JA 5FZZA 4QPQA 4PFOA 2HVRA 2ET2A 3H35A 3PJRA 3OMYA 2JUGA 3SEQA 2GOXB 1S0CA 3I9V2 2FDBM 3CA3A 3PNTA 1DZDA 1ITBA 1LVKA 2Y9FA 3OOUA 3AL0C 4DENA 4ISQA 1TP0A 1AXMA 3UNGC 2P0WA 1TZLA 1SAUA 3FJEA 3MKYB 3IAS2 3H9GA 3ZX7A 4KJZA 4QKRA 4JP0A 1MMGA 3LSKA 2V7FA 2WAFA 1WD3A 3C2GA 3FJAA 2KRHA 3OS2A 2E5ZA 4LO2C 1VCLA 2I8DA 2L7KA 5EC5A 2ERMA 3WA1A 4XQFA 1Z0HA 4JQFA 4PSXA 3VWBA 2MIBA 1WBAA 4B43A 4QBVA 2HNHA 2XAUA 4A7YA 4H9WA 3CP2A 3IP4B 2BVLA 1X1CA 2VJ4A 4LO0A 4ZBVB 3OYEA 3OBRA 4H04A 4KEIA 2X85A 1JT3A 5FZUA 3UDAA 2HZ9A 3K10A 3CA6A 2LREA 2X2SA 2A6TA 2CW8A 4Y33A 1FMZA 2E5NA 1ONKB 3DU6A 4AYBA 4KITB 3O4OA 9ILBA 3BLYA 4JPZA 1IJTA 2RREA 3O4DA 2ZQNA 3A23A 1P63A 2XSJC 1EVTA 1G9DA 4J23B 1J0SA 3RSJA 4HRIA 3IM6A 3O4CA 1R8NA 5FROA 3O5WB 3BG7A 1TFMB 3VSKA 2L9NA 4OAYA 3O3QA 1K6YA 4D0ZA 4G9MA 4I2SA 1TWMA 1BLAA 2AAIB 3S8PA 3PL8A 4F93B 2F2FA 3W2VA 1K5UA 3ZR8X 3V42A 1HWNB 4EEEB 1ISWA 21BIA 3ZCOA 2LBFB 2JSPA 1SR4A 2CUZA 1UELB 2LBFA 3ZGKA 1F31A 1JLYA 3C2HA 1LDKB 1W36D 4I4XA 2MC4A 3HPHA 4XKBA 1ISXA 2JVGA 1Q1UA 1IRXA 1D1CA 3H6RA 2HVSA 1S0FA 2WBMA 3RTJB 2WY8Q 4CSWA 3NBEA 3H6QA 4I8MA 3M8JA 3O4AA 2D24A 4IY9A 4R79A 4P6AA 4IKFA 1AFCA 4ITVA 1BLDA 4CCJA 2W1OA 1ISVA 4CCKA 2LG4A 2R7OA 4I37A 2GOMA 1V6VA 1KONA 4BUPA 3OWTA 4H75A 4ZYAA 1II4A 5BXSA 3VYUB 2XDVA 2OV7A 1JY0A 4CCOA 4AVZA 1MNEA 1EPWA 4HA2A 4EFRA 2QYIB 2DT7B 3ZXSA 4IONA 2D7RA 3H9QA 1Q04A 3N7JA 1SFKA 1MMAA 4Q91A 4XOPA 3KYLA 2D7IA 3FJKA 2LY1A 2MC2A 4WBCA 4I4VA 2PJRB 4XLHA 4J01A 2DXIA 3OYGA 1FN0A 1WJAA 2L5XA 1D0YA 2Z49A 1V5GA 3BAUA 4GRIA 3CF2A 4R6UB 3FJBA 2D44A 4P0JA 1HCDA 3R4SA 3OGGA 1YE9A 2K8RA 3S8KA 3TL4X 3DEEA 4E4HA 4F92B 1ABRB 1W3GA 2CUJA 2HWMA 1T4QA 4X39A 3OR1C 1DGWY 3PNYA 4Z9WB 3RSNA 4F3QA 2HW9A 4YELA 4II3A 4XM3A 1V5EA 1D0XA 1P9QC 2E4MA 2XC7A 2Y9WC 3UD8A 3ZQQA 5BQUA 4LO1C 4ENDA 3U21A 4EATA 4CJMA 2UWMA 3DPTA 4ZFYB 1BFGA 3ZRGA 2IWTB 1V6UA 3AKZA 4ZKTB 2JVHA 2WRYA 1XYFA 3S8JA 4OEGA 3VUOA 5GAQA 3HKZA 5DSSB 2FO1A 3CRIA 2M4GA 1NG6A 1QQKA 4XLCA 2K4AB 4PK4A 1ERDA 2RNGA 4QD2C 3L2RA 5BP5C 2K3PA 3AKFA 3BA7A 3RMYA 3CRHA 4I4RA 1DLLA 2CV2A 4D0TA 2Q2EB 1D1BA 4BDYA 1AVAC 1WJCA 3IIRA 2IGOA 1X1DA 2P39A 3OYNA 4HNUA 1WJ5A 3HN1A 2Y0SA 3W9TA 3OYJA 2KRCA 4IQ4A 3OYIA 1YYNA 5F90A 2V6EA 3S32A 2NM1A 2NOJB 3CESA 4AU7A 1IRPA 3BCBA 4ISRA 3BAGA 1JT5A 5EHAA 1NUNA 4XLEA 2MLLB 1DQOA 5BXTA 3N7LA 3V79C 2VQCA 2XOAA 1BR4A 2DJIA 2DREA 5D63A 2VKHA 1HKNA 5DUYA 3RCOA 5HNHA 2ZQOA 1FV3A 5KCMA 3FBIB 2VXRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S0G A;  4IY8 A;  1HCE A;  3I2X A;  2K43 A;  3H6R B;  1WD3 A;  2KKI A;  1HWO B;  3FJA A;  3JUT A;  1K5V A;  4LO2 C;  4OWL A;  2D1Z A;  1VCL A;  1I1E A;  1BFB A;  1ISZ A;  4A7K A;  1Q03 A;  4OUJ A;  5EC5 A;  1QQL A;  2ERM A;  4X37 A;  1W3F A;  3WA1 A;  4J2S A;  3UJ4 A;  1S0B A;  1Z0H A;  2NTD A;  4P0L A;  4G6M A;  3WO4 A;  3IM5 A;  5BXP A;  4OWK A;  3BAV A;  3H6S E;  2MIB A;  5B2H A;  1WBA A;  5G00 A;  4HJJ A;  4QBV A;  1CVS A;  4IQP A;  3N7K A;  4A7Y A;  4H9W A;  1PUM B;  2VSA A;  1DFQ A;  1IRA X;  2LIE A;  2BFH A;  3NBC A;  1HWM B;  3A22 A;  4LO0 A;  3BRG C;  4I4P A;  4ZBV B;  3PHZ A;  3OBR A;  2FFU A;  4H04 A;  4IYB A;  4KEI A;  1V6W A;  1JT3 A;  5FZU A;  1UPS A;  1YBI A;  2D43 A;  3UDA A;  4G6J A;  2HZ9 A;  3CA1 A;  3LTQ A;  1QXM A;  2Q9X A;  3CA6 A;  1BA7 A;  4GP3 A;  5FNW A;  2X2S A;  4LO3 C;  4PC4 A;  1IHK A;  3O44 A;  1FMZ A;  3PUB A;  1ONK B;  1XHB A;  1IOB A;  4OEF A;  3O4O A;  3NBN A;  9ILB A;  2QN4 A;  4F83 A;  3BAQ A;  3QR5 A;  4JPZ A;  1XZZ A;  1IJT A;  3EF2 A;  3O4D A;  2ZQN A;  4HR6 C;  3A23 A;  2NYY A;  1P63 A;  4J2K A;  1DFC A;  3BAD A;  3HAL A;  3HSM A;  3MPP G;  1EVT A;  4JRA A;  1G9D A;  4J23 B;  5F8S A;  1J0S A;  4XFS A;  3IM6 A;  3RSJ A;  3POK A;  3O4C A;  3FUO A;  1R8N A;  3CA5 A;  4XFT A;  3AZW A;  41BI A;  4IZX A;  3I2A A;  3A21 A;  2FFV A;  1TFM B;  3O5W B;  3UD7 A;  3Q7X A;  2GZB A;  4Q9G A;  2KLL A;  3O3Q A;  4D0Z A;  4G9M A;  4I2S A;  1TWM A;  1BLA A;  3F1R A;  2AAI B;  2F2F A;  3IAG C;  5D61 A;  1R8O A;  1N4K A;  3WIN A;  1K5U A;  5HPZ A;  3Q7Y A;  4GOV A;  2BEA A;  3OJ2 A;  3WO2 A;  3AH2 A;  1HWN B;  4EEE B;  4QKS A;  1S0E A;  3FJ9 A;  4KEJ A;  1TIE A;  3UJ0 A;  4X38 A;  1ISW A;  4OEE A;  5D62 A;  2NZ9 A;  1HWP B;  21BI A;  3RMX A;  4EB2 B;  4G1R A;  5JLV A;  3HMY A;  1SR4 A;  1BAR A;  4LO0 C;  2Y9G A;  1F31 A;  2AXM A;  3AZV A;  3FJF A;  3D7W B;  1JLY A;  1GGP B;  4GP0 A;  1TWE A;  4I4X A;  3VT0 A;  4LO7 B;  4Z8S B;  2X2T A;  1ISX A;  3CQA A;  2Z48 A;  3N7M A;  1Q1U A;  4USP A;  4ZA3 B;  3F62 B;  3H6R A;  4TLP A;  1S0F A;  3RTJ B;  2Q3N B;  4AN6 A;  1MC9 A;  1S0D A;  2D23 A;  3NBE A;  3H6Q A;  4I8M A;  3K1X A;  3O4A A;  2D24 A;  4IY9 A;  5F8Y A;  1DIW A;  6I1B A;  1DZC A;  4P6A A;  1AFC A;  1BLD A;  1ISV A;  1EYL A;  3CAH A;  2KI4 A;  2F8X C;  4FVV A;  2UUS A;  3ZXD A;  3FJD A;  4IZE A;  4L4I A;  5BOW A;  4I37 A;  2AFG A;  1V6V A;  4ZLB B;  5JMC A;  3P53 A;  3VWC A;  1II4 A;  5BXS A;  1JT7 A;  3V0B B;  5F8W A;  3ZC8 A;  4I0Y A;  1JY0 A;  3O4B A;  1A8D A;  3PG0 A;  3V0B A;  1EPW A;  1D0H A;  2DS0 A;  3JRR A;  4HA2 A;  3VSF A;  1ILR 1;  3BAH A;  4LO8 B;  3VSZ A;  2F2F C;  4JAW A;  4EFR A;  3OGF A;  5I1B A;  2BEB A;  3NBD A;  1S0L A;  1RML A;  2QYI B;  3WIN C;  2P23 A;  4ION A;  1WBC A;  2D7R A;  1BAS A;  2VXT I;  1AVW B;  1Q04 A;  1AVU A;  3PME A;  3N7J A;  1CE7 B;  5E24 E;  4LO1 A;  3AKH A;  2DRY A;  4Q91 A;  1AF9 A;  4II0 A;  2RG9 B;  2I1B A;  1G9A A;  2D7I A;  2ESU A;  3FJK A;  2VLC A;  2Y9X E;  4KBB A;  1SR4 C;  3B9U A;  2MC2 A;  3MAL A;  1DQG A;  5DZU A;  4WBC A;  4I4V A;  4I1E A;  1FGA A;  3BB2 A;  3ZXG A;  4X3A A;  5BVP I;  1EV2 A;  2VSE A;  2NP0 A;  3Q7W A;  1FN0 A;  1JLX A;  4L4H A;  4JQ0 A;  2L5X A;  1T9F A;  4LO7 C;  3BAO A;  3C9Z A;  2Z49 A;  3SNV A;  3BAU A;  2D20 A;  4QC4 A;  3N0K A;  4R6U B;  4I4Q A;  4FGF A;  5BXR A;  4QAL A;  2FGF A;  3FJB A;  2D44 A;  3FFZ A;  31BI A;  4QBC A;  3WMU A;  2D22 A;  3FJC A;  4P0J A;  2M49 A;  1HCD A;  1L2H A;  1PZZ A;  3R4S A;  3OGG A;  4Q9P A;  2K8R A;  3S8K A;  2KH2 A;  1FMM S;  1IIL A;  4I4U A;  4I4S A;  2GO2 A;  2LIQ A;  1SZ6 B;  4QD2 B;  1M16 A;  4I4Y A;  4USO A;  4EFQ A;  1ABR B;  3AH4 A;  3AJ6 A;  4EKX B;  1W3G A;  3E8L C;  5BP5 A;  2VUA A;  2ZR1 B;  3BA5 A;  2HWM A;  4GAF A;  1T4Q A;  1M2T B;  4D8H A;  4X39 A;  1TOO A;  4JKX B;  3KMV A;  4OW4 A;  4Z9W B;  3ZC9 A;  4DCK C;  3CA0 A;  4AN7 B;  2HW9 A;  4I7I A;  3A07 A;  1KNM A;  4ZFW B;  1WD4 A;  4J2Y A;  3FUQ A;  3HBW A;  4XKI A;  1FWU A;  1FV2 A;  3IM7 A;  1PWA A;  3NJ5 A;  1Z4S A;  2E4M A;  3LLP A;  3QYD A;  2Y9W C;  2RQ9 A;  3UD8 A;  1FWV A;  5FNX A;  1HIB A;  3P6J A;  2AQZ A;  4I96 A;  5BQU A;  4LO1 C;  3V0A B;  1TTU A;  3V0A A;  3CA4 A;  4END A;  1JQZ A;  1YXW A;  3P6I A;  4G9N A;  4P0K A;  4CJM A;  4JP0 A;  2KI6 B;  1G82 A;  4I6I A;  1RY7 A;  3VT1 A;  4ZFY B;  1BFG A;  4YOL A;  3BRF A;  4KC3 A;  3BX1 C;  1BFC A;  2IWT B;  3OBT A;  4GAI A;  1V6U A;  3OJM A;  1MD6 A;  1YTO A;  4ZKT B;  1JT4 A;  3CU1 B;  2WRY A;  8I1B A;  1XYF A;  3S8J A;  4OEG A;  4OWJ A;  3FJJ A;  3VUO A;  1RZO B;  5GAQ A;  3BTA A;  5EG6 C;  5DSS B;  4JKQ A;  2FO1 A;  3CRI A;  3CRG A;  4F34 A;  3FJH A;  1QQK A;  3AKI A;  4DEP A;  1I1B A;  4KEK A;  2K4A B;  1Z2V A;  4ZOT A;  1JTC A;  4QD2 C;  1DJS B;  4EFP A;  5BP5 C;  1PUU B;  3WMV A;  1V6X A;  2YUG A;  4I4O A;  3AKF A;  3BA7 A;  2IHO A;  2WBC A;  3RMY A;  3RTI B;  3CRH A;  4I4R A;  3UD9 A;  1DLL A;  3BRD A;  4LO2 A;  3I29 B;  1G9B A;  3WO3 A;  4I3N A;  4D0T A;  1AVA C;  2E4M C;  3R4U A;  3FGM A;  3IIR A;  2RST A;  4A7Z A;  3AKG A;  3T8S A;  3ILA A;  2P39 A;  3AJ5 A;  7I1B A;  4XFU A;  2NVH A;  3BA4 A;  3HN1 A;  2HWA A;  5BQU C;  4J2X A;  2J3P A;  3FJ8 A;  5FZY A;  1G9C A;  2DRZ A;  3W9T A;  1XG6 A;  4I1B A;  4ZGR B;  1YYN A;  1IT0 A;  5F90 A;  1BFF A;  1E0O A;  2NM1 A;  4GOY A;  3VEQ A;  1AVX B;  1OQL B;  5FZZ A;  1IRP A;  1PC8 B;  4ISR A;  3BAG A;  1JT5 A;  5EHA A;  1NUN A;  2ET2 A;  1RG8 A;  4LO3 A;  2MLL B;  1DQO A;  5BXT A;  4IHZ A;  5DVH A;  1S0C A;  3N7L A;  3V79 C;  3AH1 A;  2FDB M;  2XOA A;  3VT2 A;  3CA3 A;  1DZD A;  2DRE A;  1ITB A;  5D63 A;  1FQ9 A;  1HKN A;  5DUY A;  2ZQO A;  2Y9F A;  1W3A A;  1FV3 A;  2R9K B;  3OJV A;  4DEN A;  4ISQ A;  1NZK A;  1TP0 A;  1AXM A;  3TC2 A;  3HOM A;  3FJI A;  3FJE A;  2VU9 A;  3ZX7 A;  4ZFU B;  3O49 A;  2VXR A;  1ISY A;  4QKR A;  1YF8 B;  4QO3 A; 
#chains in the Genus database with same CATH topology
 1MJ9 A;  1XD7 A;  3MZY A;  3F6V A;  5KAI C;  3CMA I;  3UR3 C;  4HF2 A;  1B4A A;  3I2X A;  4KT6 A;  3LAJ A;  2QEX I;  2K43 A;  4RM2 A;  2ZBK A;  1JKQ C;  1P4W A;  1S7A A;  1OCO H;  1LDD A;  3KEY A;  4NBQ A;  3VEP A;  2JPB A;  3QYF A;  1QU3 A;  3FKI J;  4BYY A;  3FXQ A;  3TGN A;  5IY5 H;  2FOK A;  1MMN A;  4JOM A;  1R00 A;  4HG2 A;  3IWF A;  3CO7 C;  2R7W A;  2WY7 Q;  2JN6 A;  2ZME C;  5LGU A;  1IN7 A;  2BBY A;  1BFB A;  3BT9 A;  3MD2 A;  1ISZ A;  3I54 A;  4OUJ A;  2ECC A;  3H5A A;  4GXO A;  2H09 A;  1HA8 A;  4G6M A;  2Z33 A;  4WK8 F;  2XB5 A;  2VKV A;  1HQC A;  2M0M A;  2QQ9 A;  5BXP A;  1ZHF A;  1J09 A;  3ASN H;  4HJJ A;  1TP4 A;  4KDP A;  3HOW J;  4GYG A;  3K9T A;  1TWA J;  2CFX A;  4GGG A;  2EQR A;  4HX4 A;  5DDG A;  1KU9 A;  2MSY A;  5LEK A;  1RUO A;  2NVT J;  3N7K A;  2M30 A;  2LIE A;  3A4C A;  2F5D A;  5FO5 A;  2EIK H;  2UUZ A;  3M07 A;  3SZT A;  3CDL A;  3OYD A;  1U8R A;  3CCJ I;  5E20 A;  5ILS A;  2KLO A;  3A22 A;  1GT0 C;  1I27 A;  4I4P A;  2WWY A;  3A1Y A;  4BAC A;  1I6H J;  1BC7 C;  3PHZ A;  2DA7 A;  4B8X A;  1YG2 A;  2IBD A;  4IYB A;  5F04 A;  2VOD A;  2D43 A;  1SFE A;  2HXI A;  3RQ4 A;  1DU0 A;  2J5P A;  2GA2 A;  4GP3 A;  1IF1 A;  4LO3 C;  4PC4 A;  4RMN A;  2ZJQ F;  2DMT A;  3PNV A;  1LE8 B;  2NYX A;  2KZV A;  2Y31 A;  2IS4 A;  5LHH A;  3PUB A;  1XHB A;  1LE8 A;  1FBQ A;  1F1Z A;  1WGX A;  4OEF A;  1KQ0 A;  2GAU A;  4IVN A;  1Q1V A;  3REO A;  4KNY A;  3QR5 A;  1XZZ A;  3CUQ B;  3EF2 A;  3FK7 A;  2BXZ A;  3KYC B;  3TKY A;  4D7N A;  3CUQ A;  4A2U A;  1DFC A;  1FZP B;  2E1N A;  2IT0 A;  3LA7 A;  1LEB A;  5F8S A;  4GO1 A;  1S29 A;  2KMU A;  3MN2 A;  4LMY A;  2RKH A;  1JUP A;  5E18 F;  2W57 A;  3HUG B;  4B47 A;  3E1S A;  3PSI A;  4KT5 C;  4DZP A;  3BG6 A;  3JSO A;  4EJO A;  3AZW A;  41BI A;  3HUG A;  1Q1H A;  1FBU A;  2COM A;  4YFN F;  2X48 A;  4DZJ A;  4A3K J;  3ZMV A;  5J6X A;  4EM2 A;  4IZX A;  3I2A A;  3E97 A;  3UD7 A;  2FD5 A;  1T95 A;  2EIJ H;  3VOD A;  1J75 A;  2VE8 A;  4MTD A;  4Q9G A;  1OFC X;  2KLL A;  2HTS A;  4M3E A;  2MD0 A;  2HDW A;  1OCT C;  4ESJ A;  2LYC A;  1K61 A;  2HOT A;  3OS1 A;  2K9S A;  3IAG C;  5GTI C;  1STZ A;  3DLA A;  3OL4 A;  5DUK A;  1R8O A;  5D61 A;  1H9G A;  4PGG A;  3CCR I;  2EIN H;  2QQA A;  2KIF A;  5HPZ A;  3CCM I;  4HV6 A;  1E0E A;  2PFB A;  1YIT I;  3OJ2 A;  4PSW A;  2D1H A;  1MH4 A;  1YW9 A;  2LOO A;  3TP3 A;  2KFD A;  3IH3 A;  1U5T B;  1FIA A;  1MMS A;  5DEQ A;  2AHQ A;  1U5T A;  4X38 A;  3VDX A;  2P5K A;  2K9Q A;  3P7N A;  5D62 A;  2QKM B;  1HWP B;  3PM1 A;  2GM4 A;  4RB3 C;  3HMY A;  4GYI A;  1OR7 A;  3KLO A;  3DP7 A;  3VPR A;  2K5C A;  2AXM A;  2CGP A;  3FJF A;  1WHU A;  3MVP A;  2NS0 A;  4PZJ A;  3O3K A;  1ZRD A;  2GBY A;  3K4J A;  4A3C J;  3HKZ N;  4Q4Z F;  2CW7 A;  1GGP B;  4GP0 A;  2Z99 A;  3HOX J;  2WAQ A;  2ZFU A;  2L7Z A;  2X2T A;  2KJC A;  2VIX A;  3L2W A;  3CQA A;  2QKL B;  3FK6 A;  1AA7 A;  2Z48 A;  3N7M A;  1VND A;  2ESH A;  3LQR A;  3SDB A;  3VB2 A;  4G6D A;  1WPK A;  2P6S A;  5J8C A;  1UCR A;  1Y0U A;  2FMY A;  2IGN A;  3BR5 A;  1MJB A;  2ZSH B;  2NVY J;  4AN6 A;  1LEA A;  2MLK A;  3BZ6 A;  4E7I A;  2W4S A;  4P9U A;  3RYR A;  3G73 A;  2JTV A;  1DZC A;  1KA8 A;  2HQA A;  4GFB A;  1W1W E;  1MIJ A;  2XGD A;  4A0Z A;  2K9N A;  2ZXW H;  5H6Q A;  2KDZ A;  3BTC A;  3J80 K;  2F8X C;  4FVV A;  3DBH B;  3KX2 A;  2E2H J;  5IYD J;  4N4O B;  4PJM A;  3HB9 A;  4A69 C;  2XRO A;  4A3F J;  4K2E A;  4QLC U;  5E3M A;  4XRS A;  1ZH5 A;  5D8K B;  2AFG A;  3F6O A;  3KP6 A;  3IH2 A;  4YEJ A;  4UY4 A;  3LSM A;  4S05 A;  1YHQ I;  3P53 A;  1IRF A;  1UZC A;  3HL2 A;  5LLQ A;  3CDH A;  3CLQ A;  2HYG D;  4AIJ A;  1JT7 A;  3TDU C;  2OJE D;  2P4W A;  3O4B A;  1A8D A;  3OYL A;  3HOY J;  1D0H A;  3HGG A;  3ECO A;  2XV4 S;  5F08 A;  2COB A;  2FF4 A;  2VI6 A;  2Y0S N;  3N05 A;  3VSF A;  3L2U A;  1ILR 1;  3BAH A;  1CQT A;  2OU2 A;  3OGF A;  3GZ6 A;  3OYF A;  2HOE A;  3WIN C;  2IXS A;  2B9S A;  3K70 C;  3MAJ A;  2L01 A;  3IWZ A;  3GFI A;  5CJ9 A;  1WBC A;  3OL3 A;  2M8G X;  4HDV A;  1AVW B;  1WZ2 A;  3KEQ A;  5HLG A;  3MKL A;  2IS1 A;  3S1N J;  1AVU A;  4YRV A;  4I6Z A;  1RKW A;  1CE7 B;  4NNJ A;  3S14 J;  3AKH A;  1ZRF A;  4IL6 C;  1BOB A;  3OIQ A;  1YFH A;  1PJR A;  2FUG 2;  5TIS C;  4CHU A;  2RG9 B;  2MD5 A;  1Z77 A;  4M3D A;  1NK2 P;  3F0C A;  1ENH A;  1IN6 A;  3H3Z A;  2Y9X E;  2NNY A;  4Y15 A;  3VYR B;  1K83 J;  4KBB A;  4DQ2 A;  3HOZ J;  1J9I A;  4E70 A;  5DZU A;  3E5X A;  2LH9 A;  1USS A;  1Z1D A;  5DCM B;  3G1M A;  2ZME B;  1JJ8 C;  1FGA A;  3BB2 A;  4I1E A;  5BVP I;  2NP0 A;  1EV2 A;  4XKC A;  4XKW A;  2ZME A;  5HS7 A;  2A05 A;  1JLX A;  4L4H A;  2GIZ A;  2JA8 J;  2QQB A;  2LR8 A;  5E79 C;  4C3J J;  3CMY A;  4LO7 C;  3BAO A;  2LLK A;  3SNV A;  2AXL A;  3W2W A;  2X1C A;  1ITY A;  2V1D A;  4XOR A;  3W2A A;  4O5V A;  4OWR B;  4MZH A;  2D20 A;  4QC4 A;  5FB2 A;  3WGH A;  4I4Q A;  1G3T A;  4FGF A;  5EG0 B;  3CQZ J;  2FGF A;  2STW A;  5EG0 A;  31BI A;  1GLN A;  2QWW A;  3GVA A;  4CZC A;  4Q9P A;  4XIC A;  1IIL A;  4C3H J;  4A3G J;  1B9M A;  4I4S A;  2DA3 A;  2GO2 A;  2LIQ A;  2FBH A;  1I1G A;  1M16 A;  5FNW A;  3NWS A;  4NQW B;  1DPU A;  3R4K A;  2QM3 A;  2X4H A;  4XKV A;  3AH4 A;  2X6Y A;  3E5Q A;  3AJ6 A;  4EFQ A;  4NQW A;  2W00 A;  1EH8 A;  1VFC A;  4HV5 A;  2LSO A;  2M5W A;  3F8F A;  5DD8 A;  1OQY A;  1T33 A;  3NWT A;  3DPU A;  4UV9 A;  3JRA A;  3DQV C;  3GTO J;  4DCK C;  4Y52 J;  4W1U A;  2OA4 A;  1WD4 A;  3EUA A;  4IJA A;  2DMU A;  2ME0 A;  2VLA A;  1UB9 A;  2EBI A;  1VQO I;  1YRN B;  2L7F P;  3HBW A;  1FV2 A;  3KCC A;  3FXL A;  1ZK8 A;  5HLT A;  2L4M A;  2DTZ A;  4IHS A;  4BE0 A;  1PWA A;  1ZGA A;  3DXJ F;  2AXT C;  2B7E A;  2H6C A;  2Z3Y A;  2IJL A;  3QWL A;  5K5R A;  4BHC A;  3HSE A;  1ZGJ A;  4N9H A;  3F22 A;  1T08 B;  3K0L A;  4N9I A;  3GZ5 A;  2VJ5 A;  5FLX K;  5DYM A;  1FWV A;  3HEF A;  4BDZ A;  2GXG A;  1R5I D;  1X1A A;  4HF0 A;  2OTJ I;  3P6J A;  1QO0 D;  2NNN A;  3FZV A;  3B73 A;  5FKN A;  3BY6 A;  4M9Z A;  1A6Q A;  4LLG F;  2HVQ A;  4EQQ A;  3P6I A;  3K2Z A;  4BY7 J;  4I99 C;  4MZG B;  4ABZ A;  4P0K A;  4DGW B;  2H1K A;  1ETX A;  5M5W J;  4LD5 A;  3ELK A;  3ERM A;  1D8J A;  3FHN A;  1S3J A;  1G82 A;  3CP8 A;  3IKT A;  3VT1 A;  2OD5 A;  3AG2 H;  2DCE A;  3WTT C;  3RKQ A;  1BR2 A;  3KZZ A;  3CU1 B;  5LGT A;  1UHS A;  5F1J A;  8I1B A;  5IYB J;  3OSF A;  3GLX A;  2P5L C;  4XLA A;  2OC6 A;  2XHK A;  1TC3 C;  3AL0 B;  4NDL A;  1RZO B;  3BTA A;  5CKT A;  2KIQ A;  4UVB A;  2P7V B;  3DFG A;  3GFL A;  3LSI A;  1XB4 A;  4F34 A;  2XF5 A;  3FJH A;  5DM6 F;  4DEP A;  1I1B A;  3G3Z A;  1BI2 A;  4CDG A;  1Z2V A;  4PJJ A;  4ZOT A;  1QHH D;  1SVO A;  2EZH A;  2O7O A;  2AO9 A;  5HS9 A;  1K4S A;  3H3V K;  1RZ4 A;  1PDN C;  2WA0 A;  2A69 F;  1DJS B;  2IS2 A;  3HRS A;  4LK0 F;  4IX7 A;  2L4A A;  4MHG A;  3CME I;  1PUU B;  3WMV A;  4HNT A;  2XGC A;  3F8M A;  5J4V A;  4NC6 A;  3DWL E;  5BNG A;  4CO8 A;  1FJL A;  2YUG A;  2VC0 A;  3ZQF A;  3S1R J;  1UG0 A;  2IHO A;  1RI7 A;  2WBC A;  2DK8 A;  1L3L A;  1G59 A;  3RTI B;  3UD9 A;  1O3T A;  4A3E J;  4ZTF A;  4Q5S F;  1VZ0 A;  5K7F A;  3BRD A;  4L5I A;  4LO2 A;  4LB6 B;  1VTN C;  1IUY A;  2PJR A;  4ZDO A;  2R3S A;  1G9B A;  1VQ5 I;  5JI6 A;  1PP8 F;  1X19 A;  4CUG A;  4I7H A;  3WG9 A;  2V9K A;  1S8N A;  1D8K A;  2AQF A;  4A12 A;  1WH7 A;  5IOZ A;  2RQQ A;  3OV8 A;  3FGM A;  4FT8 A;  1X4O A;  3X2Q H;  3TOB A;  3ONQ A;  3BR2 A;  2EZI A;  5M3M J;  2V1X A;  3T8S A;  1JT6 A;  1WRJ A;  3L9F A;  2QLZ A;  3AJ5 A;  4EM0 B;  2WAQ N;  1IG7 A;  3IRR A;  1XMX A;  1VQN I;  3QOD A;  4BBS J;  3BA4 A;  1UHM A;  5TRD A;  2J3P A;  2RNJ A;  1G9C A;  2JPC A;  2ZKZ A;  1IN4 A;  2EPF A;  2D1V A;  1WSU A;  1K79 A;  4CH7 A;  1VQ7 I;  4L0Z B;  1XG6 A;  4MO7 A;  1AKH B;  2F6C A;  3J7A Y;  1LFP A;  3D0S A;  1IT0 A;  4RLF A;  1BFF A;  1BIB A;  1YX3 A;  2A3S A;  1ON2 A;  5HNF A;  1ZEL A;  1AVX B;  1YX5 A;  1S6L A;  1OQL B;  5FD6 A;  2DA2 A;  2HTJ A;  1B72 B;  3BCA A;  4X0G A;  4WXD A;  1FIP A;  5B1B H;  1B72 A;  3AG3 H;  1S5L C;  3DKY A;  3SFZ A;  5KAF C;  3DBR B;  1E3O C;  3AH1 A;  2D2W A;  3NAU A;  3PFI A;  3I58 A;  1QA6 A;  4BQA A;  2XVC A;  4MQ9 F;  1FTZ A;  2L7M P;  3BJ6 A;  4C2T A;  2HKX A;  3RIR A;  2K9L A;  1AOY A;  3GTK J;  3HOM A;  3FJI A;  2CMP A;  4CXF A;  4A3L J;  2VU9 A;  3PQK A;  1YS7 A;  3TO9 A;  3ZMD A;  3EUK L;  3BR1 A;  3O49 A;  2RGV A;  2ZSI B;  2K7L A;  2XRL A;  1MND A;  4I98 B;  3KEO A;  1YF8 B;  3G2B A;  3RPU A;  4D1Q A;  1S0G A;  1PUF A;  2FOW A;  2FQ4 A;  3EYY A;  1HCE A;  2HWV A;  2F5V A;  2G9W A;  2M87 A;  2JSC A;  1HDP A;  5IPA A;  5D8L B;  3F23 A;  1Z6T A;  1VQM I;  2KKI A;  5EGO A;  2BE5 F;  3JUT A;  1K5V A;  2Z5U A;  5DM7 F;  4RGU A;  1JI8 A;  3LSH A;  3MWM A;  3ABT A;  4OWL A;  1VQL I;  1UJ8 A;  2IGK A;  1I1E A;  2M7A A;  2E1C A;  1NK3 P;  2H94 A;  4X37 A;  4LFU A;  4J2S A;  5GTH C;  4A5M A;  1S0B A;  1QGP A;  3ABU A;  4U87 A;  2E35 A;  1N78 A;  2FEZ A;  3IM5 A;  5CVV A;  2R4G A;  3FM3 A;  3BAV A;  1FOW A;  2LF7 A;  2RDP A;  5E3N A;  1ETW A;  5B2H A;  4EV0 A;  2XAH A;  4BKX A;  1SAN A;  2LRD A;  4WXC A;  1CVS A;  2CV0 A;  1Z6R A;  3L2Q A;  4IQP A;  2V1U A;  2Y30 A;  2QBY B;  4L9T A;  2VSA A;  1DFQ A;  3H0D A;  1XC5 A;  1IRA X;  2VKD A;  3Q0U A;  2F5F A;  1YJW I;  2M1B A;  2BFH A;  5IT9 Z;  4LIT A;  3BRG C;  3CJT B;  2FFU A;  1QBJ A;  1Y56 A;  4FE4 A;  2DMQ A;  1YTY A;  4Z2Y A;  2LD5 A;  1UPS A;  5J8F A;  4G6J A;  2EIM H;  1MNM C;  3WHC A;  1IN5 A;  2R7Q A;  3K4M A;  4ZZD A;  3CA1 A;  1IAW A;  4WXH A;  2Q9X A;  2DK5 A;  3RYP A;  1ZRC A;  2AQE A;  2QEN A;  4RS8 A;  2P5V A;  1IHK A;  5FGM A;  3EUH C;  4QSH A;  2R7X A;  3OYM A;  4M3B A;  2GIV A;  2EIL H;  4H0E A;  3A02 A;  1GHC A;  3OIO A;  4ZTJ A;  1W5S A;  1XX5 A;  4L5E A;  4DYC A;  1AU7 A;  2OCE A;  1IOB A;  4O6J A;  1CF7 B;  3L7W A;  2R92 J;  3RKW A;  3NBN A;  1CF7 A;  2HZT A;  3BAQ A;  4XON A;  1Y0N A;  1I6X A;  2VQH A;  4HR6 C;  1A35 A;  4MNU A;  4J2K A;  4B3A A;  2Q2E A;  3BAD A;  3NRV A;  3HM5 A;  5LRR A;  3HSM A;  2CQX A;  4JRA A;  4L18 B;  5HOO A;  1S9H A;  2FQ3 A;  1OYY A;  1JTY A;  4XFS A;  3POK A;  3FDY A;  1R49 A;  3JW4 A;  3FUO A;  3KFW X;  3CA5 A;  3KIO A;  4B48 A;  2R0Q C;  4XFT A;  3SDG A;  5E8I A;  2H27 A;  2E1M C;  3CCQ I;  4E7L A;  3S16 J;  3ZMT A;  5CYV A;  2EV0 A;  5JHF A;  1SFX A;  2X51 A;  1UG2 A;  3A21 A;  2FFV A;  5F6F A;  3Q7X A;  2M34 A;  4P9F A;  4RM3 A;  4MIM A;  4ZH4 F;  1KYW A;  2QCO A;  2BEO A;  2RVC A;  3PIP F;  4G7H F;  5ICF A;  3F1R A;  3BC8 A;  4AWX B;  1RES A;  3KZI C;  3M1C A;  1T56 A;  2ID6 A;  4KUM A;  2EA4 A;  3M8E A;  3GF2 A;  4OMZ A;  2MA3 A;  3K70 D;  1HSJ A;  2BEA A;  4FHT A;  1ETK A;  1TWH J;  3EPZ A;  3F8B A;  5ED4 A;  1YQA A;  2OQR A;  4YG2 F;  1FX7 A;  1WWX A;  1TL8 A;  3SJM A;  4QKS A;  3K4K A;  3VYS B;  1S0E A;  3FJ9 A;  5CQE A;  3BPV A;  3E0J B;  3F72 A;  3ML6 A;  2HKO A;  1W5T A;  4HA8 A;  3MFK A;  4OEE A;  2ETH A;  3SYT A;  2NZ9 A;  3O6B B;  4EB2 B;  1T0F C;  3KP3 A;  4KIG A;  1RR7 A;  3QYE A;  3LFU A;  4HLX A;  4F52 A;  5JLV A;  3H1C A;  4LO0 C;  5D6F A;  1Y6I A;  2Y9G A;  1K78 B;  3LA2 A;  2LKS A;  1U9N A;  1RPW A;  3F3X A;  1K78 A;  2FU4 A;  2ELH A;  4RLQ A;  1LDJ A;  2BY1 A;  1U8B A;  5C4J J;  3BG3 A;  4XOT A;  1TWE A;  4IRG A;  3RPU D;  1W4M A;  2B63 J;  2MW8 A;  4CYC B;  4II2 A;  1NTC A;  2LNB A;  1Z3Y A;  2NVU B;  3VOE A;  4CYC A;  4USP A;  4WCG A;  4ZA3 B;  3F62 B;  2CS3 A;  4TLP A;  2PEX A;  3TQN A;  2CQ7 A;  2STT A;  1OCC H;  4CA0 A;  1IDY A;  2HS5 A;  2F4O B;  2HU9 A;  5IOY A;  2M7B A;  3IAM 2;  4LLL A;  1FPQ A;  1Z3X A;  1K4T A;  1MC9 A;  2PMU A;  3V8K A;  4IO9 F;  2D23 A;  2VB6 A;  5F8Y A;  3K1X A;  1MJA A;  6I1B A;  1SAX A;  2CYY A;  1FBS A;  2ZJ2 A;  5EEG A;  4EGY A;  3G1O A;  2B0L A;  1YIJ I;  1OKR A;  5FLM J;  1APL C;  4E7S A;  1PP7 U;  3M7G A;  1EYL A;  1XSV A;  3C18 A;  2JZY A;  1GUU A;  3ZXD A;  3KP7 A;  2ESN A;  2WAE A;  5IT3 A;  4KYW A;  3FJD A;  4IZE A;  4L4I A;  2A6H F;  1T8I A;  3ZN0 A;  3K6G A;  1P2F A;  2Z16 A;  4ZJZ A;  3HGY A;  4BQQ A;  3VT0 A;  3IUO A;  2HPM A;  1VQK I;  4ZLB B;  2TDX A;  2DOE A;  2L5Q A;  4G94 A;  1MW7 A;  2XPV A;  4Y4R A;  4BQO A;  2CV1 A;  2VBY A;  3VWC A;  3H5N A;  1QRY A;  2CU7 A;  4IHY A;  5TGT A;  5F8W A;  3ZC8 A;  1MKM A;  2XAJ A;  4I0Y A;  1WJF A;  3PG0 A;  4KN7 X;  2EWN A;  1HKS A;  2WTE A;  2OTL I;  3JRR A;  4EM1 A;  1Y8R B;  3BTJ A;  5I1B A;  2F2F C;  3GCM A;  1EV7 A;  2OUM A;  2R7V A;  4XID A;  3GTL J;  1I3A A;  3VYT B;  4XN0 A;  1S0L A;  3NBD A;  4B09 A;  4ENM A;  3RI4 A;  2MH2 A;  5L3D A;  1X4P A;  3TO6 A;  2OPT A;  3I71 A;  3V7C A;  1BAS A;  5EZH A;  1B1B A;  3I5U A;  3SHF A;  3COA C;  5LD2 C;  1I1S A;  4OIN F;  1Y1W J;  1OLT A;  3OIP A;  4B1R A;  3S3M A;  2Q1Z B;  2ZNY A;  3JTH A;  4LO1 A;  2ELJ A;  1R4N B;  4XLF A;  3H0G J;  3PFY A;  1AHD P;  2ZO4 A;  1AF9 A;  2DRY A;  1YJN I;  2I1B A;  5KK1 A;  5CQG A;  3HRM A;  1FYK A;  1HCR A;  5EF6 A;  4HX7 A;  5GPA A;  4HLY A;  1HDD C;  2ESU A;  2VLC A;  1SR4 C;  3B9U A;  3LMM A;  4B44 A;  4QPO A;  1QPI A;  2E71 A;  1DQG A;  2VXZ A;  3U1K A;  4BXF A;  2HGC A;  3KPH A;  2HDC A;  2Z2S B;  2KHM A;  1RET A;  4J00 A;  1R6R A;  2P8T A;  2WC2 A;  2ZXI A;  4R8H A;  2VSE A;  2XB0 X;  4LIV A;  2L9S A;  4TV7 A;  3BR6 A;  3W3C A;  4DBQ A;  1T9F A;  4JQ0 A;  1SFU A;  2GLO A;  4G7Z F;  2XPU A;  4A3I J;  1V55 H;  2EZL A;  1EF4 A;  2HOA A;  2VPL A;  3A01 B;  5LRS A;  1U2W A;  3N0K A;  1OPC A;  4WX9 A;  3A01 A;  5BXR A;  3TW7 A;  2MLG A;  5CVU A;  1IXR C;  3WMU A;  1ETO A;  3FFZ A;  1TLH B;  2D22 A;  1DGR M;  1BL0 A;  3BR3 A;  2HZD A;  3FHZ A;  2M49 A;  1PZZ A;  2L9V A;  4M9X A;  4UHT A;  2Y0M A;  1JTX A;  2GZW A;  2ZNZ A;  3HTS B;  2ZXH A;  1FMM S;  4I4U A;  2V9P A;  2IA1 A;  2PQ8 A;  2CFO A;  1RC9 A;  1SZ6 B;  4QD2 B;  1A31 A;  2O9L A;  3F9K A;  4KN4 X;  3CC4 I;  4I4Y A;  2P81 A;  4W97 A;  4USO A;  1P7I A;  3WTV C;  4F55 A;  2G0E A;  5BP5 A;  4NC7 A;  1EH6 A;  2VJI A;  3FF5 A;  2ZR1 B;  3BA5 A;  1S72 I;  4LLN A;  4ANJ A;  1M1E B;  4NC8 A;  1M2T B;  4GAF A;  4D8H A;  4D9J A;  5K5O A;  1GVJ A;  1VI0 A;  4UB6 C;  3V7R A;  1TOO A;  1FOK A;  2LY9 A;  4PUS A;  2DA6 A;  3AG1 H;  4Y7N J;  3KMV A;  4OW4 A;  3ZC9 A;  5FJ8 J;  4A3D J;  4GDF A;  3DTI A;  3CA0 A;  4AN7 B;  1KNM A;  1G4D A;  5LBQ A;  2EV6 A;  4ZFW B;  1MBE A;  1BA5 A;  2E34 A;  2QF7 A;  4J2Y A;  3FUQ A;  4DIQ A;  1NHA A;  5EJC A;  1XCV A;  1LQ1 A;  5F27 A;  1FWU A;  1GDT A;  2O8X A;  3IM7 A;  1TTY A;  2LC2 A;  3HRT A;  2F4I A;  5D4R A;  4CGZ A;  1HXD A;  4MFE A;  3NJ5 A;  1RUN A;  5LEJ A;  3WU0 A;  3HRU A;  2YU3 A;  2V6C A;  4IOC F;  1R1T A;  4BQN A;  3LLP A;  3MKZ A;  3S2H J;  5FNX A;  4JX4 A;  3TP0 A;  4QWQ A;  5E3O A;  2E1M B;  1OCR H;  1HIB A;  2H1L A;  2F5C A;  4I96 A;  3V0A B;  1LNW A;  2A68 F;  2NXN B;  2XAS A;  1O3R A;  4BJT A;  3V0A A;  3CA4 A;  1JQZ A;  2G7U A;  2DDA A;  4U7B A;  3K4L A;  1R1U A;  3HIF A;  4F91 B;  2AS5 F;  3FIW A;  3D5L A;  4PCQ A;  4BJ5 C;  5GPC A;  3BG9 A;  4CYD A;  1JHF A;  5L3B A;  4ZYH A;  4XMY A;  2CQN A;  4I6I A;  4BNC A;  2X1D A;  3A2K A;  3IKV A;  1G8X A;  3QPT A;  1F36 A;  1WJB A;  1VF9 A;  1X2N A;  4RB1 A;  1BFC A;  4GAI A;  4KC3 A;  2M4K A;  2Y75 A;  1MD6 A;  5IP9 J;  5M5Y J;  1YTO A;  1JT4 A;  3H5R A;  1FLI A;  4BL0 B;  3TBI A;  3N4M A;  4OWJ A;  3BRO A;  5D5W B;  3VSL A;  4Y13 A;  4BEH B;  1O4X A;  5IP6 A;  3K1M A;  1BM9 A;  2PMH A;  3ECH A;  4UV8 A;  4BEH A;  1ZR2 A;  4JKQ A;  1T38 A;  3PSF A;  4C3I J;  3CRG A;  3QYB A;  2RV8 A;  3K4N A;  4KIC A;  4CCL A;  2ZFW A;  1ZYR F;  2CWE A;  1N77 A;  4M72 A;  2R7U A;  4KEK A;  5EEA A;  1X2M A;  1JKO C;  1W7P B;  5D5X B;  1KQ8 A;  3AFH A;  1BR1 A;  3RDI A;  5DD4 A;  1W7P A;  3DKW A;  1HW5 A;  1E3P A;  1FYM A;  3T8T A;  1JE8 A;  1FP2 A;  4OIR F;  4C9Y A;  4OMY A;  1V6X A;  1ULY A;  5JLW A;  2I10 A;  4EEF G;  3GZN B;  4G7O F;  2BV6 A;  4ZDP A;  3J7Z I;  2LF8 A;  1OCP A;  4IF4 A;  1IRG A;  1XDS A;  1YI2 I;  4IRH A;  3JRE A;  3I4N J;  3WTW C;  4MLO A;  5DCM A;  4IHT A;  3OR2 C;  4PJN A;  3OYC A;  1F5T A;  1JKP C;  3D5S C;  4S0H B;  2KJB A;  2PI0 A;  5A2Q K;  4I09 A;  4KIS A;  3IV5 A;  2XAF A;  4OAZ A;  2E4M C;  2DDB A;  4M3G A;  3L2V A;  3AKG A;  3F8N A;  2KP6 A;  4WWC A;  5FRM A;  3F8C A;  3T5X A;  4XFU A;  7I1B A;  3DTE A;  1ZG5 A;  3QU3 A;  1YJ9 I;  3LSR A;  1FMW A;  5BQU C;  2YR2 A;  3Q3S A;  3CMM A;  3CD6 I;  1XGN A;  1NH3 A;  2DA4 A;  5DV5 A;  1X1B A;  3KP2 A;  1J5Y A;  3P5J A;  3QOE A;  5J1Y A;  1X3U A;  2R7R A;  2MG4 A;  2R7Z J;  4ESF A;  1QVT A;  2K9M A;  4I1B A;  2LY2 A;  4P5O A;  4ZGR B;  2IAI A;  3RQI A;  3TED A;  2X6W A;  3FKJ A;  3EQL F;  3DBL B;  2V1N A;  3DKX A;  4IPA A;  4RAY A;  4GOY A;  1WI3 A;  5AIQ A;  1PC8 B;  2VL8 A;  4PJL A;  3LSG A;  2MYS A;  2E1O A;  2R7D A;  1ZRE A;  1XS9 A;  3ZPL A;  3FX3 A;  2QA4 I;  3LOC A;  5BS6 A;  2GQQ A;  1RG8 A;  4LO3 A;  1WCM J;  2P6T A;  3LL7 A;  5KHD A;  4IHZ A;  1O3S A;  5DVH A;  2F4M B;  3HPG A;  3OYB A;  1TQI A;  3KP5 A;  1B9N A;  5FKM A;  2ZJR F;  1OYW A;  3VT2 A;  2QSG X;  2EFQ A;  1ETV A;  3BJO A;  2Z1D A;  3J80 Z;  4AIK A;  1FQ9 A;  1WFX A;  1KU7 A;  4Y3O A;  5L3E A;  5KNL A;  1W3A A;  2R9K B;  1YRN A;  3OJV A;  4ZYD A;  3OY9 A;  2X6X A;  2DOF A;  1NZK A;  2OCC H;  3TC2 A;  1T6S A;  4E7Z A;  4ON0 A;  3G1L A;  5C44 J;  1XTA A;  5ERI A;  3SZG A;  4X1E A;  3RZO J;  3ZMU A;  3IHU A;  4ZFU B;  9ANT A;  2BYV E;  1ISY A;  4QO3 A;  3QRF F;  1Z05 A;  4IY8 A;  1YLF A;  1XPX A;  3OS0 A;  2IEK A;  1E2X A;  3H6R B;  4HF1 A;  4RGS A;  1HWO B;  4ZDL A;  2A5W A;  3J7Y J;  4BU2 A;  1IUF A;  2MFZ A;  5C4X J;  4Q47 A;  3ASO H;  2D1Z A;  3CJN A;  1LKX A;  2K85 A;  1RNL A;  2VOP A;  2GXA A;  2NS2 A;  4A7K A;  1BC8 C;  3D1N I;  1Q03 A;  1QQL A;  5CVJ A;  4BJ6 C;  1W3F A;  4BGD A;  1Z9C A;  4P1W A;  3UJ4 A;  1MZB A;  5BQT A;  2NTD A;  4P0L A;  2X1E A;  3WO4 A;  4C2U A;  3CUO A;  3ROU A;  2EFO A;  2HQN A;  3H6S E;  4OWK A;  2VAS A;  2CUF A;  5G00 A;  3FWE A;  1QZE A;  3DV8 A;  1FTT A;  4JYK A;  2VE9 A;  3HOU J;  1JKR C;  1FYL A;  2KPM A;  2NVX J;  1PUM B;  1X3Z B;  5H20 A;  3NBC A;  5J47 A;  1ZTR A;  1HWM B;  1IJW C;  1F9N A;  1QNT A;  2ISZ A;  1ODD A;  3OYK A;  1W7P D;  4BXX J;  1BI0 A;  1A6I A;  1HBX G;  2ME6 A;  2OAZ A;  4OOI A;  4HSR A;  1V6W A;  2E7X A;  5A2Q Z;  3OYH A;  3GEZ A;  1V4R A;  1YW8 A;  3LSJ A;  4FET A;  1YBI A;  1G3W A;  5HVQ C;  1Z21 A;  1GV2 A;  2CO5 A;  4PDK A;  2KKO A;  2YPR A;  3LTQ A;  1SD7 A;  1QXM A;  1XSX A;  3CJQ B;  1RRJ A;  1BA7 A;  4NUB A;  1HST A;  3C2B A;  2VBZ A;  3BTL A;  1B8I B;  1FEX A;  2BY3 A;  2WB1 A;  1B8I A;  3O44 A;  2FNA A;  3H36 A;  3M8F A;  3A0H C;  3WTY C;  3U9G A;  5GAD J;  1X1P A;  3H9J A;  2DU9 A;  2ZC2 A;  1IXS B;  1IV8 A;  2FBK A;  2XF6 A;  1P4X A;  4B4C A;  2OZU A;  5KVR A;  3HOS A;  4OIQ F;  2QN4 A;  4F83 A;  2CRG A;  2XF7 A;  1TT5 B;  3K4B A;  2LK2 A;  3WTS C;  4IQJ A;  2QGU A;  5J1U A;  4I2O A;  2NYY A;  3HAL A;  1BJZ A;  3Q5F A;  4M6V A;  3MPP G;  3S3O A;  5BMZ A;  5FRN A;  2W48 A;  3OYA A;  2HYJ A;  3B6C A;  3LAP A;  2K86 A;  1MBJ A;  1P4A A;  3R60 A;  2IA0 A;  4OU0 A;  2CW0 F;  4HPQ A;  1XN7 A;  1ZAO A;  1EKE A;  2QSH X;  4DBR A;  3SXY A;  2R7T A;  2KIM A;  2GZB A;  4DJA A;  1AKH A;  1ORK A;  3K1P A;  3F21 A;  2PBI A;  3E7L A;  5EYR A;  3QP6 A;  1TW3 A;  2LP0 A;  1ZG1 A;  2H8W A;  2GA1 A;  4U88 A;  1BN5 A;  1PYV A;  5FKK A;  1HF0 A;  5FLX Z;  1BJA A;  1N4K A;  4ENN A;  5EDN A;  3WIN A;  2VQL A;  3U1D A;  2GWR A;  3HSR A;  5JFR A;  3Q7Y A;  4GOV A;  3I4M J;  3WO2 A;  3AH2 A;  4ENJ A;  4C30 A;  2MC3 A;  2DTR A;  5DUI A;  2DT6 A;  2O8K A;  3MKW B;  2A07 F;  1D1A A;  3JCU C;  1MH3 A;  3FBN B;  4KEJ A;  3JRH A;  3R6S A;  1TIE A;  3UJ0 A;  2BHY A;  1GXP A;  2V26 A;  4LG3 A;  4ZZL A;  1IXC A;  4H4K C;  4XNF A;  4N0B A;  3RMX A;  5L3C A;  2OBP A;  2DOA A;  1XGS A;  3KLN A;  4G1R A;  2LKP A;  2M3A A;  1BAR A;  4FTH A;  3GBG A;  1ZR4 A;  3GUD A;  4IHW A;  2JK3 A;  1Z7L A;  1ZQ3 P;  3LA3 A;  5E8G A;  1G2H A;  3D5R C;  4XL9 A;  2R7S A;  3AZV A;  3D7W B;  2BOL A;  2LVS A;  2PMZ A;  4RAG A;  2CUE A;  4XLP F;  2EFP A;  3CC7 I;  4S04 A;  4UUV A;  4LO7 B;  4MTE A;  1IRZ A;  4Z8S B;  3JRF A;  3H3U A;  2Q0O A;  5L3F A;  1WI9 A;  2X9D A;  4I0A A;  3KP4 A;  3VFZ A;  4BS9 A;  4E6K G;  1CGP A;  1Z91 A;  3LFK A;  1BW6 A;  4O3M A;  2NS7 A;  4XSZ F;  1DP3 A;  1VQP I;  1FSE A;  2JRM A;  3K1N A;  4YIF A;  2ADU A;  2MBF A;  3HG9 A;  2Q3N B;  1EJ9 A;  3QOP A;  1S0D A;  3DCF A;  4G6T B;  1W0U A;  2VQG A;  2HFH A;  1DIW A;  1O57 A;  4E7H A;  1SVL A;  2DMP A;  2JA2 A;  2ZXJ A;  3CUQ C;  1KQ9 A;  2VUM J;  3CAH A;  2KI4 A;  5LFA A;  2UUS A;  5E1X A;  1KU2 A;  1B6A A;  4AYB N;  5HLH A;  1MBK A;  3HJE A;  1JJ6 C;  3MMY B;  5BOW A;  5CPR B;  4U0Y A;  1AWC A;  3RJP A;  3BR0 A;  2HDD A;  2QBY A;  2DT5 A;  3PIO F;  1MMD A;  1FT9 A;  2KDO A;  5JMC A;  4HNV A;  2UZK A;  4KFC A;  3LWF A;  2Z9O A;  3M3Y J;  1S7O A;  2DFF A;  3I56 I;  3MQ0 A;  5ICG A;  2IS6 A;  3V0B B;  4ENK A;  3HSF A;  2DA5 A;  3V0B A;  5H2F C;  2DS0 A;  1IC8 A;  1K7A A;  4E7K A;  4RAZ A;  1WJE A;  4JX5 A;  2KL4 A;  4LO8 B;  3VSZ A;  5H6R A;  4UY8 I;  4JAW A;  2BEB A;  1LJ9 A;  3TMO A;  3MZH A;  1RML A;  4BE1 A;  4LB5 A;  2P23 A;  3HTU A;  2HPI A;  2W82 A;  4D7M A;  1XG1 A;  3GTJ J;  1J59 A;  2BHZ A;  3TOA A;  2VXT I;  1PVE A;  5FFZ A;  2WV0 A;  3SQN A;  2ELK A;  1KU3 A;  3WE2 A;  3PME A;  2WAD A;  4MGR A;  4V19 K;  5F0F A;  1D5Y A;  5AIP A;  4HEA 2;  5ILU A;  5E24 E;  1U5T C;  1G3Y A;  3CCL I;  4II0 A;  2UXN A;  1G9A A;  1ETY A;  2IPQ X;  5HDN A;  3ZQG A;  1FMV A;  5ILV A;  4YFK F;  4CCM A;  3MAL A;  1ON1 A;  3HXL A;  4PFP A;  4IXA A;  1OR7 C;  4FQG A;  4KIB A;  4RGR A;  3H92 A;  4XR6 A;  5K7H A;  4X3A A;  3ZXG A;  1W36 C;  2BVM A;  3Q7W A;  4L9N A;  2VPR A;  1J7K A;  3C7J A;  4A3J J;  2KQR A;  1SFO J;  1OCZ H;  2E60 A;  3C9Z A;  2BW3 B;  2DOD A;  4IRI A;  3IC7 A;  2BW3 A;  4XRM A;  2BGC A;  1LVA A;  1HOM A;  4QAL A;  3T8R A;  1YYV A;  4FE7 A;  4QBC A;  1EA3 A;  2UV1 A;  4BH9 A;  3FJC A;  1N75 A;  4RB0 A;  1L2H A;  2NS8 A;  2TRT A;  4A3M J;  5L3G A;  1D0Z A;  5DS9 A;  3IL2 A;  2KH2 A;  3ZQ7 A;  1R23 A;  3FMS A;  2W7N A;  3TO7 A;  2Q8K A;  1FWZ A;  1ONV A;  1H88 C;  4CIC A;  2IGM A;  2E19 A;  2A5Y B;  4EKX B;  3K2A A;  2F48 A;  3WHB A;  3CO6 C;  4BE2 A;  3E8L C;  2VUA A;  2R5Z B;  3CCY A;  2KIU A;  2VKE A;  2JA7 J;  2R5Z A;  5B1A H;  4ZC3 A;  3FXU A;  3I53 A;  5FD5 A;  2BY0 A;  2RAE A;  3P9C A;  2TCT A;  4JKX B;  3ZQI A;  3SEZ A;  4XN3 A;  3HOT A;  3GWZ A;  1R5G A;  2I5U A;  2L0K A;  3A07 A;  4I7I A;  4HQE A;  3JTG A;  4AC0 A;  3JAM K;  2LKX A;  4C2M J;  2PN6 A;  3DPL C;  2GXB A;  4XKI A;  3S15 J;  1U78 A;  3S93 A;  3Q0W A;  4V2G A;  5TJJ A;  2K4B A;  2QSF X;  3CJR B;  2HR3 A;  3HC7 A;  2QYO A;  1Z4S A;  1UFM A;  2XPW A;  4NB5 A;  3E6M A;  5HLI A;  2L2O A;  3QYD A;  1TWG J;  4LIU A;  4CCN A;  2K02 A;  2DFE A;  2RQ9 A;  2VT3 A;  3EET A;  3FM5 A;  1LB2 A;  2OQG A;  2AQZ A;  1JGG A;  1TTU A;  3RKY A;  3S2D J;  4XRS G;  1YXW A;  2WB1 N;  4G9N A;  1BIA A;  1ZLJ A;  5M5X J;  1JT0 A;  3GME A;  1P92 A;  3QQA A;  3SFI A;  5K7Z A;  1U6G A;  4N4N B;  5F1R A;  3ERE D;  3E3V A;  4RDU A;  5D5U B;  4EJT A;  1DQU A;  4AID A;  3DTK A;  2KI6 B;  4IZZ A;  1RY7 A;  3S3N A;  1JUM A;  2R5Y B;  2ID3 A;  4EGZ A;  1TT0 A;  4L9J A;  2JA5 J;  4YOL A;  3BRF A;  3I3L A;  3BX1 C;  2R5Y A;  3OBT A;  5J1R A;  4MZF B;  3OJM A;  1R58 A;  3DU5 A;  1Y39 A;  2DQL A;  2O03 A;  2VXD A;  2V79 A;  2C6Y A;  4I0B A;  3QPS A;  3FJJ A;  5EEH A;  4R1H A;  1I3Q J;  2DW4 A;  5FKO A;  4M6X A;  1UAA A;  1RKT A;  5EG6 C;  4AUX A;  4B3X A;  1UMQ A;  1WJD A;  1GVD A;  2XIG A;  3RTR A;  5GAE J;  4A6E A;  3AKI A;  3JRG A;  4KIF A;  2CG4 A;  1F4K A;  1TNT A;  4FX0 A;  2IVM A;  3ZOB A;  1XCB A;  1JTC A;  3G6E I;  1E3H A;  3DEW A;  1FY7 A;  4EFP A;  2O5R A;  4M9S A;  2PLY A;  2ECB A;  1NG7 A;  2FBI A;  3B02 A;  3WGI A;  1REP C;  3I59 B;  4I4O A;  3FMR A;  4DYR A;  3I59 A;  2LTP A;  2DAO A;  2DFI A;  5JVT A;  1H89 C;  4M73 A;  3I29 B;  1VQ8 I;  2L9R A;  1VQ9 I;  4E7J A;  2LDU A;  3C1D A;  3I4P A;  5LHG A;  3ZN1 A;  1C0W A;  3WO3 A;  1V5F A;  5FKL A;  3W6K B;  4DOZ A;  2R93 J;  4I3N A;  2EFN A;  2PX9 A;  4U0V A;  1O3Q A;  2G7H A;  3FXR A;  4V2F A;  2YU9 J;  2VBX A;  2YUS A;  3PO3 J;  4PJ0 C;  3R4U A;  2ET2 A;  4WF2 A;  2RST A;  1BBY A;  4A7Z A;  2W25 A;  3J81 K;  5CVI A;  2E2J J;  3ILA A;  2PMZ N;  2DPU A;  1HW1 A;  4HST A;  5ICE A;  2NVH A;  3CZ6 A;  2HWA A;  4EJU A;  4J2X A;  3E6D A;  2V4J C;  3M1E A;  2CH0 A;  1QHG A;  3FJ8 A;  3JAM Z;  5FZY A;  3G4S I;  2DRZ A;  2M0C A;  1HKQ A;  1G3S A;  2M9H A;  3WTU C;  3AG4 H;  3V7S A;  4FAS D;  1TWC J;  4QTR A;  1ETQ A;  2MAB A;  3BPX A;  1JGS A;  3DEU A;  2FE3 A;  2VJJ A;  1UHW A;  2DQR A;  3K4C A;  1JHH A;  3E5U A;  1E0O A;  1R4M B;  2FA5 A;  3VEQ A;  1U0J A;  5FZZ A;  1LFB A;  4QPQ A;  3M4O J;  2DYS H;  4PFO A;  1XGM A;  4RBO A;  2HVR A;  1WQ2 A;  3BDD A;  3H35 A;  2JMW A;  1WVR A;  5E1Z B;  4ASN A;  5M3F J;  2ACJ A;  3PJR A;  4NHJ A;  3EUH A;  3OMY A;  2JUG A;  3SEQ A;  2GOX B;  1S0C A;  3Q9V A;  3I9V 2;  2FDB M;  4L0Y B;  3CA3 A;  3PNT A;  1DZD A;  1ITB A;  1BI1 A;  3HDD A;  2VON A;  1LVK A;  4UXN A;  2Y9F A;  3OOU A;  1MBG A;  2WV1 A;  2FX0 A;  3AL0 C;  1DPR A;  3GFM A;  2JQ7 A;  4DEN A;  1KYZ A;  2DFH A;  4U0W A;  4ISQ A;  1TP0 A;  1E17 A;  1AXM A;  4M74 A;  1XMA A;  3UNG C;  2P0W A;  1TZL A;  1SMT A;  2K27 A;  1SAU A;  3FJE A;  3MKY B;  3IAS 2;  5FFX A;  3BQY A;  3TW6 A;  1G6N A;  1S7E A;  3H9G A;  3ZX7 A;  3V4G A;  1ZN2 A;  4KJZ A;  4QKR A;  4JP0 A;  1MMG A;  4Z6Y A;  3JRI A;  2H6B A;  2HI3 A;  3N97 A;  3LSK A;  2V7F A;  2EJR A;  4G6Q A;  5F0C A;  2WAF A;  4LK1 F;  1FNN A;  3A03 A;  1WD3 A;  2XUB A;  3C2G A;  1U9O A;  1WH5 A;  2EA2 A;  4A0Y A;  2KRH A;  3FJA A;  3LSP A;  2XAQ A;  3JRD A;  3L1P A;  2Y48 A;  3OS2 A;  2E5Z A;  2JA6 J;  4LO2 C;  5CLS A;  4DYQ A;  1VCL A;  5B5E C;  1A36 A;  4J19 A;  2I8D A;  2L7K A;  5EC5 A;  2ERM A;  1ZG3 A;  3WA1 A;  4A5N A;  4XQF A;  3NQO A;  1Z0H A;  4JQF A;  4A6D A;  3FXJ A;  4PSX A;  2DA1 A;  3S17 J;  2FJ1 A;  1TW2 A;  4HYE A;  2M8E A;  2QQ8 A;  3GLL A;  3W6J B;  4A0X A;  3VWB A;  2MIB A;  1WBA A;  1MGT A;  4FIS A;  4B43 A;  1ZLK A;  4QBV A;  2W84 A;  5B3S H;  2W85 A;  2HNH A;  3L09 A;  3GXO A;  2XAU A;  2E2I J;  4A7Y A;  4H9W A;  3GO5 A;  3CP2 A;  1R36 A;  1T0F A;  3IP4 B;  2BVL A;  2O3F A;  2DBB A;  1I5Z A;  1X1C A;  2VJ4 A;  4LO0 A;  4G12 A;  1FP1 D;  3OYE A;  4ZBV B;  4X6A J;  3OBR A;  4IHX A;  3R0A A;  4H04 A;  1R7J A;  1XSD A;  3O8G A;  4KEI A;  2X85 A;  3FXO A;  3QAH A;  1JT3 A;  2KIS A;  2XRN A;  5FZU A;  3UDA A;  2CQQ A;  1YO5 C;  2R7F A;  3WTZ A;  2HZ9 A;  4AD9 A;  4EVI A;  4I02 A;  4BXU A;  1T2K A;  3SZP A;  3J81 Z;  3K10 A;  2L3D A;  3M9A A;  3CA6 A;  3ZQH A;  2LRE A;  2X2S A;  2QUF A;  1W0T A;  2DPD A;  2A6T A;  2CW8 A;  4Y33 A;  2D45 A;  5BPI A;  1FMZ A;  2E5N A;  4MQV A;  1MDM B;  1P6R A;  1ONK B;  1FC3 A;  1MDM A;  3DU6 A;  2YSR A;  3PO2 J;  4YIR X;  4AYB A;  2ZCW A;  4KIT B;  5J3L A;  3O4O A;  1R5H A;  9ILB A;  3BLY A;  4JPZ A;  1IJT A;  2RRE A;  4KMF A;  3O4D A;  2ZQN A;  3A23 A;  1P63 A;  2M45 A;  2XSJ C;  4UVC A;  1IV6 A;  1IDZ A;  1EVT A;  1XDU A;  2N8G A;  1T98 A;  3CCS I;  4J23 B;  1G9D A;  1XMK A;  1J0S A;  3V8J A;  3RSJ A;  4HRI A;  3IM6 A;  4ETS A;  3O4C A;  3V8L A;  1I39 A;  1R8N A;  2DI3 A;  5FRO A;  4IHV A;  5E17 F;  3HBL A;  1U3E M;  5LGN A;  2EK5 A;  3T0Y A;  2L54 A;  3C3W A;  1KZH A;  3ESW B;  4PGH A;  3O5W B;  3BG7 A;  3O2P E;  1TFM B;  2FXA A;  3VSK A;  3QP5 A;  4M71 A;  2L9N A;  4OAY A;  1WKM A;  3KE2 A;  4QIW N;  3CC2 I;  3WG7 H;  5C3E J;  2DLL A;  3O3Q A;  1K6Y A;  4D0Z A;  4G9M A;  1T39 A;  1TWM A;  4FCY A;  4I2S A;  1RIO H;  1TNS A;  5IYC J;  1BLA A;  2AAI B;  3S8P A;  3PL8 A;  1R22 A;  2DYR H;  4F93 B;  2F2F A;  2A61 A;  3FXK A;  2J5O A;  2JT1 A;  3W2V A;  3CCU I;  5J4Y A;  1K5U A;  3ZR8 X;  5D6E A;  1B59 A;  3S1M J;  5EZG A;  1K6O A;  4UNO A;  4RA2 A;  3V42 A;  2CQK A;  2CJJ A;  3HZJ A;  1HKT A;  4HZF A;  2PJP A;  1HWN B;  4EEE B;  2L02 A;  3RZD J;  1TBX A;  2HQR A;  3L2C A;  2YX4 A;  1ISW A;  3ISP A;  3O8H A;  3BG5 A;  1QPM A;  1Z0X A;  21BI A;  3ZCO A;  2ISY A;  3PQJ A;  2LBF B;  2W24 A;  3CCE I;  2QZ8 A;  2KZG A;  2JSP A;  1SR4 A;  2CUZ A;  1UEL B;  2LBF A;  4UUS B;  3G71 I;  4F7Z A;  3ZGK A;  1F31 A;  1XGO A;  4UUS A;  1V54 H;  3JSP A;  3BWG A;  5LHI A;  3UKG A;  2X6O A;  1JLY A;  3C2H A;  1KGS A;  4XK4 A;  1LDK B;  1W36 D;  4I4X A;  1J2X A;  2MC4 A;  3HPH A;  4Q48 A;  3I64 A;  1D3Y A;  4XKB A;  1ISX A;  5B66 C;  3DF8 A;  2JVG A;  3ZMS A;  1Q1U A;  1IRX A;  1D1C A;  3BP8 A;  2K3F A;  3ABK H;  4L9V A;  1Z67 A;  5AON A;  1FOX A;  4G8X A;  2HVS A;  2OF7 A;  4XSX F;  3I55 I;  3H6R A;  4BHB A;  1S0F A;  2WBM A;  3RTJ B;  3BTI A;  4BY1 J;  3CDI A;  4D0P A;  2NOG A;  2XKO A;  1P7J A;  5K5Q A;  2WY8 Q;  4CSW A;  4LG0 B;  3NBE A;  3H6Q A;  4I8M A;  3M8J A;  2LMD A;  3MEX A;  4LG0 A;  2D24 A;  2F5E A;  3U2R A;  4R79 A;  3O4A A;  4IY9 A;  4P6A A;  4IKF A;  1AFC A;  2ZB9 A;  1D5V A;  4ITV A;  1BLD A;  1HLV A;  4CCJ A;  3Q9S A;  4HQM A;  3DLL F;  2W1O A;  1ISV A;  4CCK A;  6PAX A;  2RN7 A;  2UXX A;  4LOC A;  4JK1 X;  4LJZ F;  3GYH X;  1MSE C;  1R71 A;  1ZAR A;  5DCF A;  2YX7 A;  2LG4 A;  2R7O A;  4I37 A;  2GOM A;  2F2E A;  2HOS A;  4EJW A;  1V6V A;  1KON A;  4BUP A;  3OWT A;  4YII A;  2H8R A;  4H75 A;  3CCV I;  4ZYA A;  3ZP5 A;  1SVM A;  4M6Y A;  1F43 A;  1II4 A;  4YFX F;  3QPL A;  5BXS A;  3VYU B;  1IN8 A;  4BBR J;  3ULQ B;  2JRT A;  2XDV A;  4HW0 A;  5HS8 A;  2OV7 A;  1JY0 A;  4CCO A;  4AVZ A;  1MNE A;  1VQ4 I;  1EPW A;  2JJ7 A;  3OSG A;  2DN0 A;  3KZY A;  4HA2 A;  3HHG A;  3CF5 F;  3AAF A;  3S1Q J;  2BXY A;  4EFR A;  4UUT A;  2DT7 B;  2QYI B;  3ZXS A;  4ION A;  1DUX C;  2D7R A;  2VT2 A;  3H9Q A;  5GAH J;  1Q04 A;  1GV5 A;  2IW5 A;  1BI3 A;  4P55 A;  5D5V B;  2RQP A;  4A3B J;  2DJN A;  3N7J A;  3R61 A;  1SFK A;  2O61 A;  1N25 A;  1MMA A;  1DDN A;  4Q91 A;  4XOP A;  3NAR A;  1LPQ A;  3KYL A;  1TWF J;  4MEX F;  2D7I A;  1QVU A;  3ZQL A;  3ABL H;  3FJK A;  2LY1 A;  3WGG A;  4Y17 A;  2MC2 A;  2YS9 A;  4WBC A;  1J0R A;  5JHU A;  1HC8 A;  4OIP F;  3ZQC A;  2Y69 H;  4I4V A;  2PJR B;  4XLH A;  4J01 A;  3B6A A;  2DXI A;  5IT9 K;  3OYG A;  1IGN A;  1MBF A;  4RAF A;  1Y8Q B;  4AIH A;  1FN0 A;  3KET A;  1WJA A;  1X3W B;  3GW2 A;  5JVG F;  2L5X A;  1D0Y A;  5JR3 A;  3WOD F;  2Z49 A;  1V5G A;  3TDZ C;  3BAU A;  4GRI A;  5D4S A;  2NRA C;  3I0T A;  4I01 A;  3MZ8 A;  3CF2 A;  4HX8 A;  4R6U B;  3K69 A;  1IZ1 A;  3NEU A;  1R1V A;  1HW2 A;  1YOV B;  3FJB A;  3L00 A;  2BZT A;  4CZZ A;  2D44 A;  4P0J A;  3HHH A;  1HCD A;  4HAM A;  4HOB A;  2KRF A;  3R4S A;  3OGG A;  4JX6 A;  1YE9 A;  2K8R A;  3S8K A;  2FSW A;  1YIO A;  3TL4 X;  2EB7 A;  2OZ6 A;  3DEE A;  4E4H A;  4MFD A;  2DMN A;  3ZMZ A;  3P9K A;  4F92 B;  1ABR B;  1R9T J;  1W3G A;  4EJV A;  2CUJ A;  3HOV J;  2HWM A;  1LFU P;  1T4Q A;  2HQ5 A;  4X39 A;  3OR1 C;  5GAG J;  5E3L A;  1A04 A;  1DGW Y;  2XAG A;  1OIS A;  1JUS A;  2HXO A;  3PNY A;  4XLN F;  3GTQ J;  4Z9W B;  3RSN A;  4F3Q A;  3E6C C;  5IP7 J;  3GTP J;  2A6E F;  3GX4 X;  1OJL A;  5BPD A;  2V9V A;  2HW9 A;  4YEL A;  4II3 A;  2Y9Z A;  4XRF A;  3JRC A;  2PG4 A;  3KYD B;  2D5V A;  4XM3 A;  5CVR A;  1V5E A;  1D0X A;  1GXQ A;  1H9T A;  1VQ6 I;  4UVA A;  1P9Q C;  3JRB A;  1O7L A;  2DO7 A;  5HDG A;  4UB8 C;  2E4M A;  3BJA A;  2VOO A;  5F0H A;  2XC7 A;  2NVQ J;  2Y9W C;  4P96 A;  2KT0 A;  3UD8 A;  2ZJP F;  3ZQQ A;  1EH7 A;  3S2W A;  4FX4 A;  2QVO A;  3W6V A;  5BQU A;  1PUF B;  4LO1 C;  2VBW A;  1SD4 A;  3BZK A;  3EDP A;  4END A;  2K40 A;  3U21 A;  4KA4 A;  5EGO B;  2IA2 A;  4EAT A;  5HOD A;  1SEU A;  5ICC A;  2MH9 A;  5J40 A;  2NAZ A;  2O0Y A;  3CTA A;  4CJM A;  1PUE E;  2UWM A;  1H8A C;  2IRF G;  1SMY F;  1TQP A;  3Q0V A;  3DPT A;  4U7D A;  4ZFY B;  1BFG A;  1ZGW A;  1UST A;  3ZRG A;  2IWT B;  4JBA A;  1V6U A;  3AKZ A;  3E6B A;  4ZKT B;  3QU6 A;  4DW6 A;  2JVH A;  2WRY A;  1XYF A;  4I76 A;  1SD5 A;  2JWT A;  4HBL A;  4BAY A;  2XSD C;  4OEG A;  3S8J A;  4D5F A;  2FML A;  2VN2 A;  2HEO A;  3VUO A;  2LFB A;  3P9I A;  5GAQ A;  1IO2 A;  3HKZ A;  5DSS B;  2FO1 A;  3CRI A;  1QQI A;  3BOQ A;  2M4G A;  2XGX A;  1IW7 F;  1NG6 A;  3A0B C;  4GCV A;  2FNP A;  1QQK A;  1BW5 A;  3QPH A;  4XLC A;  1QZZ A;  2K4A B;  2VC1 A;  1I50 J;  4PK4 A;  5FLV A;  3GTG J;  3FXM A;  1ERD A;  4LGW A;  4DNC A;  2HYF A;  2RNG A;  3LST A;  4QD2 C;  3L2R A;  2E7W A;  5BP5 C;  4EMS A;  2K3P A;  4D5C A;  3WTX C;  3HYI A;  3MCZ A;  3FMQ A;  5E1W A;  4L5J A;  1FSH A;  1O7F A;  3AKF A;  2FRH A;  3BA7 A;  3JR9 A;  3RMY A;  1MBH A;  2EH3 A;  3EYI A;  3CRH A;  3K7A J;  4I4R A;  2Y2Z A;  3FIS A;  1DP7 P;  4IEJ A;  3BZC A;  4RB2 C;  1DLL A;  1OMI A;  2XGE A;  3GTM J;  1YS6 A;  1QZY A;  1ACI A;  3R0J A;  1Y1V J;  4A93 J;  3RPQ A;  2CV2 A;  2K4J A;  5DTD A;  4D0T A;  2Q2E B;  1D1B A;  4M3F A;  1X58 A;  4ZYE A;  4BDY A;  1AVA C;  4RGX A;  4MEY F;  1SD6 A;  3J7A O;  1WJC A;  2EV5 A;  3IIR A;  1DU6 A;  2IP2 A;  3LNQ A;  5BOX A;  2IGO A;  3IRQ A;  4G9Y A;  1X1D A;  3LQQ A;  3RKX A;  1OYI A;  2P39 A;  3OYN A;  4AM3 A;  4HNU A;  2EFW A;  1WJ5 A;  2ICW G;  4OIO F;  3HN1 A;  2Y0S A;  1A5J A;  3WE3 A;  1LUJ B;  3W9T A;  2E36 A;  2EZK A;  2KRC A;  3OYJ A;  4IQ4 A;  1YW7 A;  3OYI A;  1YYN A;  5F90 A;  2V6E A;  3S32 A;  1BOA A;  2NM1 A;  4XBF A;  5K1Y A;  2NOJ B;  3CES A;  1RR8 C;  4AU7 A;  3ABM H;  1IRP A;  3BCB A;  4ISR A;  2M2E A;  1TQM A;  5HDK A;  3BAG A;  1JT5 A;  5EHA A;  2BY2 A;  3CLO A;  1NUN A;  4XLE A;  4AVP A;  4ZYG A;  2P7C B;  1DQO A;  2MLL B;  5BXT A;  1H0M A;  3WU1 B;  3N7L A;  3V79 C;  2VQC A;  3BQZ A;  2Y9Y A;  2XOA A;  1BR4 A;  2RC4 A;  2CSO A;  2DJI A;  2DRE A;  5D63 A;  2X0L A;  2XKP A;  2VKH A;  4BHP A;  3OOP A;  3T1B A;  1HKN A;  3RCO A;  1W5C C;  1Z7U A;  5HNH A;  1L0O C;  2O6G E;  5DUY A;  5F64 A;  2ZQO A;  1V3F A;  1FV3 A;  1JXS A;  3IH4 A;  1POG A;  4KMU X;  1FOY A;  1ZKG A;  3PUF A;  4IOA F;  5GP9 A;  1MD0 A;  3GFJ A;  1MSF C;  1SC7 A;  5KCM A;  4HDU A;  5JLX A;  3WU2 C;  4ESB A;  3FBI B;  2VXR A;  2JUC A;  2MGQ A; 
#chains in the Genus database with same CATH homology
 3UR3 C;  3I2X A;  4KT6 A;  2K43 A;  4RM2 A;  3KEY A;  3QYF A;  1QU3 A;  1MMN A;  4JOM A;  4HG2 A;  2R7W A;  2WY7 Q;  1BFB A;  3MD2 A;  1ISZ A;  4OUJ A;  3H5A A;  1HA8 A;  4G6M A;  2M0M A;  5BXP A;  1J09 A;  4HJJ A;  3N7K A;  2LIE A;  3A4C A;  2UUZ A;  3OYD A;  3A22 A;  2KLO A;  4I4P A;  4BAC A;  3A1Y A;  3PHZ A;  4IYB A;  2D43 A;  3RQ4 A;  4GP3 A;  4LO3 C;  4PC4 A;  4RMN A;  3PNV A;  2KZV A;  2IS4 A;  3PUB A;  1XHB A;  4OEF A;  3QR5 A;  1XZZ A;  3EF2 A;  1DFC A;  5F8S A;  2KMU A;  4B47 A;  3HUG B;  3E1S A;  3PSI A;  3BG6 A;  3AZW A;  41BI A;  4IZX A;  3I2A A;  3UD7 A;  1T95 A;  4Q9G A;  2KLL A;  2MD0 A;  2HDW A;  2LYC A;  3OS1 A;  3IAG C;  5D61 A;  3DLA A;  3OL4 A;  1R8O A;  5HPZ A;  1E0E A;  3OJ2 A;  4PSW A;  2LOO A;  4X38 A;  3VDX A;  5D62 A;  2QKM B;  1HWP B;  3HMY A;  2K5C A;  2AXM A;  3FJF A;  3K4J A;  2CW7 A;  1GGP B;  4GP0 A;  2WAQ A;  2ZFU A;  2X2T A;  2VIX A;  3L2W A;  3CQA A;  2QKL B;  1AA7 A;  2Z48 A;  3N7M A;  3SDB A;  2IGN A;  2ZSH B;  4AN6 A;  4E7I A;  2W4S A;  1DZC A;  2HQA A;  2F8X C;  4FVV A;  3KX2 A;  4N4O B;  4PJM A;  2AFG A;  4YEJ A;  4UY4 A;  3LSM A;  3P53 A;  3HL2 A;  1JT7 A;  3O4B A;  1A8D A;  3OYL A;  1D0H A;  3VSF A;  3N05 A;  3L2U A;  1ILR 1;  3BAH A;  3OGF A;  3OYF A;  3WIN C;  2IXS A;  3K70 C;  1WBC A;  3OL3 A;  1AVW B;  2IS1 A;  1AVU A;  4YRV A;  1CE7 B;  4NNJ A;  3AKH A;  1BOB A;  3OIQ A;  1PJR A;  2FUG 2;  2RG9 B;  2Y9X E;  4KBB A;  3VYR B;  5DZU A;  2LH9 A;  4I1E A;  1FGA A;  3BB2 A;  5BVP I;  2NP0 A;  1EV2 A;  4XKC A;  4XKW A;  1JLX A;  4L4H A;  4LO7 C;  3BAO A;  3SNV A;  3W2W A;  2X1C A;  3W2A A;  4XOR A;  4OWR B;  4MZH A;  2D20 A;  4QC4 A;  4I4Q A;  4FGF A;  2FGF A;  31BI A;  1GLN A;  4CZC A;  4Q9P A;  1IIL A;  4I4S A;  2GO2 A;  2LIQ A;  1M16 A;  3NWS A;  4NQW B;  4EFQ A;  3AJ6 A;  4XKV A;  3AH4 A;  2X6Y A;  2W00 A;  3NWT A;  3DPU A;  3DQV C;  4DCK C;  1WD4 A;  3EUA A;  2VLA A;  3HBW A;  1FV2 A;  5HLT A;  1PWA A;  4BE0 A;  2VJ5 A;  1FWV A;  4BDZ A;  1X1A A;  3P6J A;  2HVQ A;  3P6I A;  4MZG B;  4P0K A;  4DGW B;  3FHN A;  1G82 A;  3CP8 A;  3VT1 A;  2DCE A;  1BR2 A;  3CU1 B;  8I1B A;  4XLA A;  2OC6 A;  3AL0 B;  1RZO B;  3BTA A;  5CKT A;  3LSI A;  4F34 A;  2XF5 A;  3FJH A;  4DEP A;  1I1B A;  1Z2V A;  4PJJ A;  4ZOT A;  1QHH D;  2WA0 A;  1DJS B;  2IS2 A;  4IX7 A;  1PUU B;  3WMV A;  4HNT A;  3DWL E;  2YUG A;  1UG0 A;  2IHO A;  2WBC A;  3RTI B;  1G59 A;  3UD9 A;  4ZTF A;  1VZ0 A;  3BRD A;  4LO2 A;  2PJR A;  4ZDO A;  1G9B A;  1X19 A;  4CUG A;  2V9K A;  2AQF A;  2RQQ A;  3FGM A;  1X4O A;  3ONQ A;  3T8S A;  3AJ5 A;  3BA4 A;  3QOD A;  2J3P A;  1G9C A;  1XG6 A;  4CH7 A;  2F6C A;  3J7A Y;  1LFP A;  1IT0 A;  4RLF A;  1BFF A;  1YX3 A;  5HNF A;  1ZEL A;  1AVX B;  1YX5 A;  1OQL B;  3BCA A;  4X0G A;  3DKY A;  3AH1 A;  4C2T A;  2K9L A;  3HOM A;  3FJI A;  2CMP A;  2VU9 A;  3EUK L;  3O49 A;  2ZSI B;  1MND A;  1YF8 B;  3G2B A;  4D1Q A;  1S0G A;  1HCE A;  2F5V A;  2KKI A;  3JUT A;  1K5V A;  1JI8 A;  3LSH A;  4OWL A;  2IGK A;  1I1E A;  2M7A A;  4X37 A;  4J2S A;  1S0B A;  4U87 A;  1N78 A;  3IM5 A;  2R4G A;  3BAV A;  5B2H A;  2LRD A;  1CVS A;  2CV0 A;  3L2Q A;  4IQP A;  2VSA A;  1DFQ A;  3H0D A;  1IRA X;  2VKD A;  2BFH A;  4LIT A;  3BRG C;  2FFU A;  1Y56 A;  1UPS A;  4G6J A;  3K4M A;  2R7Q A;  3CA1 A;  2Q9X A;  2AQE A;  1IHK A;  3EUH C;  2R7X A;  3OYM A;  4ZTJ A;  1IOB A;  3NBN A;  3BAQ A;  4XON A;  2VQH A;  4HR6 C;  4J2K A;  3BAD A;  3HSM A;  4JRA A;  5HOO A;  1S9H A;  4XFS A;  3POK A;  3FDY A;  3FUO A;  3CA5 A;  4B48 A;  4XFT A;  2E1M C;  4E7L A;  5JHF A;  2X51 A;  3A21 A;  2FFV A;  3Q7X A;  4RM3 A;  3F1R A;  3BC8 A;  3M1C A;  3K70 D;  2BEA A;  3EPZ A;  4QKS A;  3K4K A;  3VYS B;  1S0E A;  3FJ9 A;  5CQE A;  3E0J B;  4OEE A;  3SYT A;  2NZ9 A;  4EB2 B;  1T0F C;  3QYE A;  4F52 A;  3LFU A;  5JLV A;  4LO0 C;  1Y6I A;  2Y9G A;  4RLQ A;  4XOT A;  1TWE A;  3RPU D;  4II2 A;  1Z3Y A;  4USP A;  4ZA3 B;  3F62 B;  2CS3 A;  4TLP A;  4CA0 A;  2HU9 A;  2M7B A;  3IAM 2;  1MC9 A;  1Z3X A;  2D23 A;  2VB6 A;  5F8Y A;  3K1X A;  6I1B A;  4E7S A;  1EYL A;  3ZXD A;  2WAE A;  3FJD A;  4IZE A;  4L4I A;  3K6G A;  2Z16 A;  4ZJZ A;  4BQQ A;  3IUO A;  2HPM A;  4ZLB B;  2L5Q A;  1MW7 A;  4Y4R A;  4BQO A;  2CV1 A;  3VWC A;  3H5N A;  5TGT A;  5F8W A;  3ZC8 A;  4I0Y A;  1WJF A;  3PG0 A;  3JRR A;  5I1B A;  2F2F C;  2R7V A;  2OUM A;  3NBD A;  3VYT B;  4XN0 A;  1S0L A;  1X4P A;  1BAS A;  5LD2 C;  1OLT A;  3OIP A;  3S3M A;  2Q1Z B;  4LO1 A;  2ELJ A;  4XLF A;  3PFY A;  2DRY A;  1AF9 A;  2I1B A;  5CQG A;  2ESU A;  2VLC A;  1SR4 C;  3B9U A;  3LMM A;  4B44 A;  4QPO A;  1DQG A;  2VXZ A;  4BXF A;  2Z2S B;  2KHM A;  4J00 A;  1R6R A;  2ZXI A;  2VSE A;  4LIV A;  2L9S A;  3W3C A;  4DBQ A;  4JQ0 A;  1T9F A;  2VPL A;  3N0K A;  5BXR A;  3WMU A;  3FFZ A;  2D22 A;  1DGR M;  2M49 A;  2HZD A;  1PZZ A;  2ZXH A;  1FMM S;  4I4U A;  2CFO A;  1SZ6 B;  4QD2 B;  3F9K A;  4I4Y A;  4USO A;  4F55 A;  5BP5 A;  4NC7 A;  2VJI A;  2ZR1 B;  3BA5 A;  4ANJ A;  4GAF A;  4NC8 A;  1M2T B;  4D8H A;  4D9J A;  1TOO A;  4PUS A;  3KMV A;  4OW4 A;  3ZC9 A;  3CA0 A;  3DTI A;  4AN7 B;  1KNM A;  4ZFW B;  4J2Y A;  3FUQ A;  4DIQ A;  1FWU A;  3IM7 A;  2LC2 A;  2F4I A;  3NJ5 A;  4BQN A;  3LLP A;  3MKZ A;  5FNX A;  2E1M B;  1HIB A;  4I96 A;  3V0A B;  4BJT A;  3V0A A;  3CA4 A;  1JQZ A;  4U7B A;  3K4L A;  4F91 B;  3D5L A;  4BJ5 C;  4XMY A;  4I6I A;  2X1D A;  3A2K A;  1G8X A;  1WJB A;  4KC3 A;  4GAI A;  1BFC A;  2M4K A;  1MD6 A;  1YTO A;  1JT4 A;  3H5R A;  4BL0 B;  3TBI A;  4OWJ A;  3VSL A;  4BEH B;  4BEH A;  4JKQ A;  3PSF A;  3CRG A;  3QYB A;  3K4N A;  4CCL A;  1N77 A;  2R7U A;  4KEK A;  3AFH A;  1BR1 A;  4C9Y A;  1V6X A;  4ZDP A;  4MLO A;  3OR2 C;  4PJN A;  3OYC A;  3D5S C;  4KIS A;  4OAZ A;  2E4M C;  3AKG A;  3L2V A;  2KP6 A;  5FRM A;  7I1B A;  4XFU A;  3DTE A;  1FMW A;  5BQU C;  3CMM A;  1X1B A;  3QOE A;  2R7R A;  4I1B A;  2K9M A;  4ZGR B;  2LY2 A;  4P5O A;  2X6W A;  3FKJ A;  2V1N A;  4GOY A;  3DKX A;  1PC8 B;  2VL8 A;  4PJL A;  3LSG A;  2MYS A;  1RG8 A;  4LO3 A;  3LL7 A;  5KHD A;  4IHZ A;  5DVH A;  3HPG A;  3OYB A;  3VT2 A;  2Z1D A;  1FQ9 A;  1WFX A;  4Y3O A;  5KNL A;  1W3A A;  2R9K B;  3OJV A;  3OY9 A;  2X6X A;  1NZK A;  3TC2 A;  4E7Z A;  3SZG A;  4ZFU B;  1ISY A;  4QO3 A;  4IY8 A;  3OS0 A;  3H6R B;  1HWO B;  4ZDL A;  2A5W A;  4BU2 A;  2MFZ A;  2D1Z A;  1LKX A;  2NS2 A;  4A7K A;  1Q03 A;  1QQL A;  4BJ6 C;  1W3F A;  4BGD A;  3UJ4 A;  4P1W A;  2NTD A;  4P0L A;  2X1E A;  3WO4 A;  4C2U A;  4OWK A;  3H6S E;  2VAS A;  5G00 A;  2KPM A;  1PUM B;  3NBC A;  1HWM B;  3OYK A;  4HSR A;  1V6W A;  3OYH A;  4FET A;  1YBI A;  5HVQ C;  1Z21 A;  3LTQ A;  1QXM A;  3CJQ B;  1BA7 A;  5FNW A;  4NUB A;  2WB1 A;  3O44 A;  3H9J A;  2XF6 A;  3HOS A;  2QN4 A;  4F83 A;  2XF7 A;  3K4B A;  4IQJ A;  2NYY A;  3HAL A;  3MPP G;  3S3O A;  5FRN A;  3OYA A;  4HPQ A;  4DBR A;  2R7T A;  2GZB A;  4DJA A;  1PYV A;  1N4K A;  3WIN A;  2VQL A;  3Q7Y A;  4GOV A;  3WO2 A;  3AH2 A;  4C30 A;  2DT6 A;  3MKW B;  1D1A A;  3FBN B;  4KEJ A;  1TIE A;  3UJ0 A;  2V26 A;  4LG3 A;  4H4K C;  4XNF A;  3RMX A;  2DOA A;  4G1R A;  2M3A A;  1BAR A;  3GBG A;  1Z7L A;  3D5R C;  4XL9 A;  2R7S A;  3AZV A;  3D7W B;  2BOL A;  2PMZ A;  3VT0 A;  4LO7 B;  4Z8S B;  4BS9 A;  4E6K G;  1DP3 A;  3HG9 A;  2Q3N B;  1S0D A;  4G6T B;  2VQG A;  1DIW A;  4E7H A;  2JA2 A;  3CAH A;  2KI4 A;  5LFA A;  2UUS A;  3MMY B;  5BOW A;  5CPR B;  1MMD A;  2KDO A;  5JMC A;  2IS6 A;  3V0B B;  3V0B A;  2DS0 A;  4E7K A;  1WJE A;  3VSZ A;  2KL4 A;  4LO8 B;  4JAW A;  2BEB A;  3TMO A;  1RML A;  4BE1 A;  2P23 A;  2HPI A;  2W82 A;  2VXT I;  3PME A;  2WAD A;  4HEA 2;  5E24 E;  4II0 A;  1G9A A;  1FMV A;  4CCM A;  3MAL A;  3HXL A;  4PFP A;  1OR7 C;  4XR6 A;  3ZXG A;  4X3A A;  1W36 C;  2BVM A;  3Q7W A;  2KQR A;  2E60 A;  3C9Z A;  2BW3 B;  2BW3 A;  4QAL A;  4QBC A;  1EA3 A;  2UV1 A;  3FJC A;  1N75 A;  1L2H A;  1D0Z A;  2KH2 A;  2W7N A;  2IGM A;  4EKX B;  3E8L C;  4BE2 A;  2VUA A;  4ZC3 A;  4JKX B;  3SEZ A;  4XN3 A;  3HOT A;  4I7I A;  3A07 A;  3DPL C;  4XKI A;  3S93 A;  3CJR B;  3HC7 A;  1Z4S A;  2L2O A;  3QYD A;  4LIU A;  2RQ9 A;  4CCN A;  2AQZ A;  1TTU A;  1YXW A;  4G9N A;  4N4N B;  1DQU A;  3DTK A;  2KI6 B;  4IZZ A;  1RY7 A;  3S3N A;  1TT0 A;  4YOL A;  3BRF A;  3I3L A;  3BX1 C;  3OBT A;  4MZF B;  3OJM A;  3DU5 A;  2VXD A;  3FJJ A;  1UAA A;  5EG6 C;  4B3X A;  1WJD A;  3RTR A;  3AKI A;  1JTC A;  4EFP A;  2O5R A;  1NG7 A;  4I4O A;  3I29 B;  4E7J A;  3WO3 A;  1V5F A;  4DOZ A;  4I3N A;  3R4U A;  2RST A;  4A7Z A;  3ILA A;  4HST A;  2NVH A;  3CZ6 A;  2HWA A;  4J2X A;  2V4J C;  2CH0 A;  1QHG A;  3FJ8 A;  5FZY A;  2DRZ A;  4FAS D;  2MAB A;  2VJJ A;  1E0O A;  3K4C A;  3VEQ A;  1U0J A;  5FZZ A;  4QPQ A;  4PFO A;  2HVR A;  2ET2 A;  3H35 A;  3PJR A;  3OMY A;  2JUG A;  3SEQ A;  2GOX B;  1S0C A;  3I9V 2;  2FDB M;  3CA3 A;  3PNT A;  1DZD A;  1ITB A;  1LVK A;  2Y9F A;  3OOU A;  3AL0 C;  4DEN A;  4ISQ A;  1TP0 A;  1AXM A;  3UNG C;  2P0W A;  1TZL A;  1SAU A;  3FJE A;  3MKY B;  3IAS 2;  3H9G A;  3ZX7 A;  4KJZ A;  4QKR A;  4JP0 A;  1MMG A;  3LSK A;  2V7F A;  2WAF A;  1WD3 A;  3C2G A;  3FJA A;  2KRH A;  3OS2 A;  2E5Z A;  4LO2 C;  1VCL A;  2I8D A;  2L7K A;  5EC5 A;  2ERM A;  3WA1 A;  4XQF A;  1Z0H A;  4JQF A;  4PSX A;  3VWB A;  2MIB A;  1WBA A;  4B43 A;  4QBV A;  2HNH A;  2XAU A;  4A7Y A;  4H9W A;  3CP2 A;  3IP4 B;  2BVL A;  1X1C A;  2VJ4 A;  4LO0 A;  4ZBV B;  3OYE A;  3OBR A;  4H04 A;  4KEI A;  2X85 A;  1JT3 A;  5FZU A;  3UDA A;  2HZ9 A;  3K10 A;  3CA6 A;  2LRE A;  2X2S A;  2A6T A;  2CW8 A;  4Y33 A;  1FMZ A;  2E5N A;  1ONK B;  3DU6 A;  4AYB A;  4KIT B;  3O4O A;  9ILB A;  3BLY A;  4JPZ A;  1IJT A;  2RRE A;  3O4D A;  2ZQN A;  3A23 A;  1P63 A;  2XSJ C;  1EVT A;  1G9D A;  4J23 B;  1J0S A;  3RSJ A;  4HRI A;  3IM6 A;  3O4C A;  1R8N A;  5FRO A;  3O5W B;  3BG7 A;  1TFM B;  3VSK A;  2L9N A;  4OAY A;  3O3Q A;  1K6Y A;  4D0Z A;  4G9M A;  4I2S A;  1TWM A;  1BLA A;  2AAI B;  3S8P A;  3PL8 A;  4F93 B;  2F2F A;  3W2V A;  1K5U A;  3ZR8 X;  3V42 A;  1HWN B;  4EEE B;  1ISW A;  21BI A;  3ZCO A;  2LBF B;  2JSP A;  1SR4 A;  2CUZ A;  1UEL B;  2LBF A;  3ZGK A;  1F31 A;  1JLY A;  3C2H A;  1LDK B;  1W36 D;  4I4X A;  2MC4 A;  3HPH A;  4XKB A;  1ISX A;  2JVG A;  1Q1U A;  1IRX A;  1D1C A;  3H6R A;  2HVS A;  1S0F A;  2WBM A;  3RTJ B;  2WY8 Q;  4CSW A;  3NBE A;  3H6Q A;  4I8M A;  3M8J A;  3O4A A;  2D24 A;  4IY9 A;  4R79 A;  4P6A A;  4IKF A;  1AFC A;  4ITV A;  1BLD A;  4CCJ A;  2W1O A;  1ISV A;  4CCK A;  2LG4 A;  2R7O A;  4I37 A;  2GOM A;  1V6V A;  1KON A;  4BUP A;  3OWT A;  4H75 A;  4ZYA A;  1II4 A;  5BXS A;  3VYU B;  2XDV A;  2OV7 A;  1JY0 A;  4CCO A;  4AVZ A;  1MNE A;  1EPW A;  4HA2 A;  4EFR A;  2QYI B;  2DT7 B;  3ZXS A;  4ION A;  2D7R A;  3H9Q A;  1Q04 A;  3N7J A;  1SFK A;  1MMA A;  4Q91 A;  4XOP A;  3KYL A;  2D7I A;  3FJK A;  2LY1 A;  2MC2 A;  4WBC A;  4I4V A;  2PJR B;  4XLH A;  4J01 A;  2DXI A;  3OYG A;  1FN0 A;  1WJA A;  2L5X A;  1D0Y A;  2Z49 A;  1V5G A;  3BAU A;  4GRI A;  3CF2 A;  4R6U B;  3FJB A;  2D44 A;  4P0J A;  1HCD A;  3R4S A;  3OGG A;  1YE9 A;  2K8R A;  3S8K A;  3TL4 X;  3DEE A;  4E4H A;  4F92 B;  1ABR B;  1W3G A;  2CUJ A;  2HWM A;  1T4Q A;  4X39 A;  3OR1 C;  1DGW Y;  3PNY A;  4Z9W B;  3RSN A;  4F3Q A;  2HW9 A;  4YEL A;  4II3 A;  4XM3 A;  1V5E A;  1D0X A;  1P9Q C;  2E4M A;  2XC7 A;  2Y9W C;  3UD8 A;  3ZQQ A;  5BQU A;  4LO1 C;  4END A;  3U21 A;  4EAT A;  4CJM A;  2UWM A;  3DPT A;  4ZFY B;  1BFG A;  3ZRG A;  2IWT B;  1V6U A;  3AKZ A;  4ZKT B;  2JVH A;  2WRY A;  1XYF A;  3S8J A;  4OEG A;  3VUO A;  5GAQ A;  3HKZ A;  5DSS B;  2FO1 A;  3CRI A;  2M4G A;  1NG6 A;  1QQK A;  4XLC A;  2K4A B;  4PK4 A;  1ERD A;  2RNG A;  4QD2 C;  3L2R A;  5BP5 C;  2K3P A;  3AKF A;  3BA7 A;  3RMY A;  3CRH A;  4I4R A;  1DLL A;  2CV2 A;  4D0T A;  2Q2E B;  1D1B A;  4BDY A;  1AVA C;  1WJC A;  3IIR A;  2IGO A;  1X1D A;  2P39 A;  3OYN A;  4HNU A;  1WJ5 A;  3HN1 A;  2Y0S A;  3W9T A;  3OYJ A;  2KRC A;  4IQ4 A;  3OYI A;  1YYN A;  5F90 A;  2V6E A;  3S32 A;  2NM1 A;  2NOJ B;  3CES A;  4AU7 A;  1IRP A;  3BCB A;  4ISR A;  3BAG A;  1JT5 A;  5EHA A;  1NUN A;  4XLE A;  2MLL B;  1DQO A;  5BXT A;  3N7L A;  3V79 C;  2VQC A;  2XOA A;  1BR4 A;  2DJI A;  2DRE A;  5D63 A;  2VKH A;  1HKN A;  5DUY A;  3RCO A;  5HNH A;  2ZQO A;  1FV3 A;  5KCM A;  3FBI B;  2VXR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...