1JT4A

Human acidic fibroblast growth factor. 141 amino acid form with amino terminal his tag and val 109 replaced by leu (v109l)
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFLGLKKNGSCKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and stability effects of mutations designed to increase the primary sequence symmetry within the core region of a beta-trefoil.
pubmed doi rcsb
molecule keywords acidic fibroblast growth factor
molecule tags Hormone/growth factor
source organism Homo sapiens
total genus 37
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2001-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1jt4A00
3CA5A 3N7LA 3AKIA 3Q7YA 1HWMB 1HWNB 2D44A 2VSEA 3O3QA 3N7KA 2F2FA 2ZR1B 3CU1B 2QYIB 4OUJA 3AJ5A 5I1BA 1HCEA 1K5UA 3K1XA 1JT4A 1Z0HA 1FMZA 3CRGA 3PHZA 5DZUA 1BLAA 4I96A 4J2XA 1MC9A 5BQUA 3ZC8A 3AH4A 1DZDA 2Y9WC 5EC5A 3IM6A 4FVVA 3BA5A 5JLVA 3RMYA 1S0GA 1WD4A 2HW9A 1S0FA 2I1BA 4P0LA 5GAQA 4QC4A 3ZXDA 4LO3C 2NVHA 4I4XA 1FMMS 2AXMA 4I4PA 3PG0A 1HWOB 4X39A 3VT2A 4QD2B 4LO3A 2LIQA 2VXRA 2VSAA 4DEPA 1XZZA 1ABRB 3N7JA 3WMUA 4ZGRB 5DSSB 4DCKC 5FZYA 3HN1A 4EFQA 3CA3A 3I2XA 4I3NA 1WBCA 3PMEA 5BXSA 5F8YA 5D62A 2KI6B 3LLPA 2GO2A 2DRZA 3O4BA 2ERMA 1OQLB 4IZXA 3BAQA 3A21A 3O5WB 1G9BA 1KNMA 2KH2A 4I4OA 3NBCA 1W3AA 3FGMA 2L5XA 5BXPA 1EPWA 3WA1A 3NBNA 4EEEB 1RY7A 4D0TA 3VUOA 3V0BA 1QXMA 4QALA 1VCLA 3MPPG 4GAFA 4FGFA 3HMYA 4TLPA 4IY9A 3HBWA 1DIWA 2Z49A 1HIBA 1RMLA 3AZWA 1WD3A 2ZQNA 1V6XA 3A22A 3O4DA 3N7MA 4OWKA 3OJ2A 4GOYA 2R9KB 2MIBA 4IHZA 3QR5A 3ILAA 3FJDA 2LIEA 4IY8A 1P63A 5DVHA 1V6UA 1BARA 1AVAC 2D23A 1W3FA 4LO1C 2HWMA 1AVXB 4OEFA 5EG6C 4I6IA 3FJAA 3VSZA 5F8WA 3FJ8A 1XG6A 3OJVA 4LO1A 3VT0A 2P23A 1JT3A 3CA4A 3HALA 2Y9GA 3NBDA 4AN6A 1A8DA 4ZKTB 3BRDA 3F62B 1G9AA 3UD7A 1DJSB 3PUBA 4ZOTA 2DRYA 4ISQA 3UJ4A 2IHOA 4P6AA 4QD2C 4J2KA 41BIA 1AF9A 2FO1A 1FGAA 3Q7XA 1MD6A 5FNXA 1JLYA 3P6JA 3UD9A 4LO0C 4QKSA 1BFFA 3KMVA 5JMCA 1II4A 1HWPB 4USPA 3V79C 3EF2A 1G9CA 4LO0A 3CAHA 4J23B 3JUTA 5BQUC 2WBCA 3CA6A 2D7IA 3I29B 1CVSA 1FWUA 3ZC9A 3R4UA 3R4SA 4GAIA 4EFPA 3POKA 1L2HA 1Q1UA 4JQ0A 1DFQA 2HWAA 4JKXB 3BAVA 4J2YA 4KC3A 3S8JA 4J2SA 4JRAA 3WO2A 4EFRA 5DUYA 3O4OA 4EKXB 3MALA 1YYNA 4HA2A 2VLCA 2XOAA 1TP0A 3OBTA 4I4RA 1DQGA 4I4YA 3OJMA 1Z2VA 1BLDA 4A7YA 1IJTA 3BAHA 3UJ0A 4A7ZA 3C9ZA 3UDAA 1K5VA 1EV2A 2FDBM 4GP0A 3TC2A 4G1RA 1F31A 4DENA 3RMXA 1ITBA 1XHBA 4I1EA 7I1BA 2F8XC 4H9WA 3H6RA 3VSFA 4G9MA 4I4QA 4X38A 2D7RA 1N4KA 1SZ6B 5FZUA 1TOOA 1R8OA 4I7IA 3I2AA 4QO3A 1Q03A 3CA1A 1J0SA 5BP5C 1W3GA 3S8KA 4P0JA 1JTCA 1FN0A 1Q04A 1BASA 1ILR1 1IRPA 1PWAA 3BRFA 5BP5A 2Q3NB 4IONA 3LTQA 2J3PA 3FJCA 2D1ZA 4I37A 5BOWA 1HCDA 1SR4C 5D61A 1S0EA 1NUNA 3BX1C 2E4MC 4X37A 3BA7A 1V6VA 4I4UA 1SR4A 3H6RB 4D8HA 1AVUA 2D22A 1JT5A 4D0ZA 2E4MA 3FJKA 4H04A 4OEGA 4I8MA 4LO7C 21BIA 4OEEA 1GGPB 3FFZA 3FJHA 1AXMA 3A23A 1M16A 3AKFA 2FFVA 3AZVA 4KEKA 3F1RA 3N0KA 3D7WB 2FGFA 3RTJB 1S0CA 3Q7WA 1TTUA 1S0LA 2X2SA 4F34A 2NM1A 1PUMB 3WO3A 1IHKA 4KEJA 3JRRA 2K43A 2UUSA 1YTOA 2Y9XE 3BTAA 4OWLA 3OBRA 4I4SA 2QN4A 4G6MA 1XYFA 3CQAA 4USOA 2X2TA 4GP3A 3UD8A 1AFCA 2RQ9A 1TIEA 1V6WA 2RSTA 3RSJA 4ZBVB 4QBVA 1EYLA 2AFGA 1S0BA 1DZCA 3SNVA 3WINC 2ESUA 4ZFWB 3NBEA 1FV2A 1T9FA 6I1BA 3WINA 3ZXGA 4LO7B 1JLXA 3P53A 3AJ6A 3VWCA 2ZQOA 1S0DA 3W9TA 2BFHA 1G9DA 2AQZA 3E8LC 1QQKA 3VT1A 4JAWA 4Z9WB 1ISYA 1ISXA 3IIRA 2YUGA 1QQLA 4L4HA 1IRAX 31BIA 3VEQA 2VUAA 2NP0A 4LO2A 1FV3A 2D24A 3WO4A 1JT7A 1R8NA 3AH2A 4AN7B 4II0A 2IWTB 4I4VA 4ZLBB 2P39A 4ENDA 4Q9PA 3FUOA 1I1EA 1YBIA 1I1BA 1DFCA 5G00A 4PC4A 2NYYA 4R6UB 1PC8B 1T4QA 2NTDA 3FJJA 3BRGC 3OGGA 4QKRA 4HJJA 2FFUA 4I0YA 1IT0A 3V0AB 3T8SA 2K8RA 4KEIA 1UPSA 1CE7B 3FJIA 1DQOA 9ILBA 2M49A 4A7KA 3FJEA 3AKHA 3IM7A 3QYDA 5HPZA 2RG9B 1G82A 4EB2B 1HKNA 4IZEA 1Z4SA 3CA0A 1IOBA 3OGFA 4XFUA 4X3AA 4ZFUB 5B2HA 3BA4A 4GOVA 3A07A 5BXTA 3FJBA 1BFGA 4OWJA 3HOMA 3BAUA 1JQZA 3RTIB 1TFMB 1RZOB 1YXWA 2Q9XA 1FWVA 3O4CA 4G6JA 4KBBA 4ISRA 3BAGA 3H6QA 4F83A 3NJ5A 2DS0A 1D0HA 4JPZA 4XKIA 5D63A 3FJ9A 3BADA 5F8SA 4Q91A 4I2SA 2KI4A 4WBCA 1FQ9A 1PZZA 3O49A 3FUQA 4JKQA 1BA7A 2WRYA 3IM5A 1AVWB 3O44A 5E24E 4IQPA 2Y9FA 2HZ9A 2VXTI 4ZA3B 2K4AB 3HSMA 1M2TB 2D20A 3AH1A 4CJMA 4I1BA 4L4IA 2KLLA 3IAGC 2AAIB 1ISWA 3P6IA 1ISVA 2VU9A 4OW4A 1PUUB 1RG8A 2Z48A 4YOLA 1JY0A 4IYBA 1ISZA 2NZ9A 4ZFYB 5FNWA 3V0BB 3WMVA 4HR6C 3ZX7A 2BEBA 2D43A 1IILA 1E0OA 3CRIA 1EVTA 2MC2A 1DLLA 3BB2A 8I1BA 3B9UA 2ET2A 2DREA 3O4AA 4QBCA 3CRHA 1YF8B 5FZZA 4P0KA 4JP0A 4XFSA 4G9NA 4Z8SB 3AKGA 3V0AA 1NZKA 1TWMA 4Q9GA 5BVPI 2KKIA 4XFTA 1BFCA 5F90A 3FJFA 2BEAA 4LO2C 1TWEA 3H6SE 5BXRA 4LO8B 1BFBA 1WBAA 2GZBA 5EHAA 2F2FC 2MLLB 3BAOA 1ONKB
chains in the Genus database with same CATH superfamily
3CA5A 3N7LA 3AKIA 3Q7YA 1HWMB 1HWNB 2D44A 2VSEA 3O3QA 3N7KA 2F2FA 2ZR1B 3CU1B 2QYIB 4OUJA 3AJ5A 5I1BA 1HCEA 1K5UA 3K1XA 1JT4A 1Z0HA 1FMZA 3CRGA 3PHZA 5DZUA 1BLAA 4I96A 4J2XA 1MC9A 5BQUA 3ZC8A 3AH4A 1DZDA 2Y9WC 5EC5A 3IM6A 4FVVA 3BA5A 5JLVA 3RMYA 1S0GA 1WD4A 2HW9A 1S0FA 2I1BA 4P0LA 5GAQA 4QC4A 3ZXDA 4LO3C 2NVHA 4I4XA 1FMMS 2AXMA 4I4PA 3PG0A 1HWOB 4X39A 3VT2A 4QD2B 4LO3A 2LIQA 2VXRA 2VSAA 4DEPA 1XZZA 1ABRB 3N7JA 3WMUA 4ZGRB 5DSSB 4DCKC 5FZYA 3HN1A 4EFQA 3CA3A 3I2XA 4I3NA 1WBCA 3PMEA 5BXSA 5F8YA 5D62A 2KI6B 3LLPA 2GO2A 2DRZA 3O4BA 2ERMA 1OQLB 4IZXA 3BAQA 3A21A 3O5WB 1G9BA 1KNMA 2KH2A 4I4OA 3NBCA 1W3AA 3FGMA 2L5XA 5BXPA 1EPWA 3WA1A 3NBNA 4EEEB 1RY7A 4D0TA 3VUOA 3V0BA 1QXMA 4QALA 1VCLA 3MPPG 4GAFA 4FGFA 3HMYA 4TLPA 4IY9A 3HBWA 1DIWA 2Z49A 1HIBA 1RMLA 3AZWA 1WD3A 2ZQNA 1V6XA 3A22A 3O4DA 3N7MA 4OWKA 3OJ2A 4MZFB 4GOYA 2R9KB 2MIBA 4IHZA 3QR5A 3ILAA 3FJDA 2LIEA 4IY8A 1P63A 5DVHA 1V6UA 1BARA 1AVAC 2D23A 1W3FA 4LO1C 2HWMA 1AVXB 4OEFA 5EG6C 4I6IA 3FJAA 3VSZA 5F8WA 3FJ8A 1XG6A 3OJVA 4LO1A 3VT0A 2P23A 1JT3A 3CA4A 3HALA 2Y9GA 3NBDA 4AN6A 1A8DA 4ZKTB 3BRDA 3F62B 1G9AA 3UD7A 1DJSB 3PUBA 4ZOTA 2DRYA 4ISQA 3UJ4A 2IHOA 4P6AA 4QD2C 4J2KA 41BIA 1AF9A 2FO1A 1FGAA 3Q7XA 1MD6A 5FNXA 1JLYA 3P6JA 3UD9A 4LO0C 4QKSA 1BFFA 3KMVA 5JMCA 1II4A 1HWPB 4USPA 3V79C 3EF2A 1G9CA 4LO0A 3CAHA 4J23B 3JUTA 5BQUC 2WBCA 3CA6A 2D7IA 3I29B 1CVSA 1FWUA 4MZHA 3ZC9A 3R4UA 3R4SA 4GAIA 4EFPA 3POKA 1L2HA 1Q1UA 4JQ0A 1DFQA 2HWAA 4JKXB 3BAVA 4J2YA 4KC3A 3S8JA 4H75A 4J2SA 4JRAA 3WO2A 4EFRA 5DUYA 3O4OA 4EKXB 3MALA 1YYNA 4HA2A 2VLCA 2XOAA 1TP0A 3OBTA 4I4RA 1DQGA 4I4YA 3OJMA 1Z2VA 1BLDA 4A7YA 1IJTA 3BAHA 3UJ0A 4A7ZA 3C9ZA 4UY4A 3UDAA 1K5VA 1EV2A 2FDBM 4GP0A 3TC2A 4G1RA 1F31A 4DENA 3RMXA 1ITBA 1XHBA 4I1EA 7I1BA 2F8XC 4H9WA 3H6RA 3VSFA 4G9MA 4I4QA 4X38A 2D7RA 1N4KA 1SZ6B 5FZUA 1TOOA 1R8OA 4I7IA 3I2AA 4QO3A 1Q03A 3CA1A 1J0SA 5BP5C 1W3GA 3S8KA 4P0JA 1JTCA 1FN0A 1Q04A 1BASA 1ILR1 1IRPA 1PWAA 3BRFA 5BP5A 2Q3NB 4IONA 3LTQA 2J3PA 3FJCA 2D1ZA 4I37A 5BOWA 1HCDA 1SR4C 5D61A 1S0EA 1NUNA 3BX1C 2E4MC 4X37A 3BA7A 1V6VA 4I4UA 1SR4A 3H6RB 4D8HA 1AVUA 2D22A 1JT5A 4D0ZA 2E4MA 3FJKA 4H04A 4OEGA 4I8MA 4LO7C 21BIA 4OEEA 1GGPB 3FFZA 3FJHA 1AXMA 3A23A 1M16A 3AKFA 2FFVA 3AZVA 4KEKA 3F1RA 3N0KA 3D7WB 2FGFA 3RTJB 1S0CA 3Q7WA 1TTUA 1S0LA 2X2SA 4F34A 2NM1A 1PUMB 3WO3A 1IHKA 4KEJA 4MZGB 3JRRA 2K43A 2UUSA 1YTOA 2Y9XE 3BTAA 4OWLA 3OBRA 4I4SA 2QN4A 4G6MA 1XYFA 3CQAA 4USOA 2X2TA 4GP3A 3UD8A 1AFCA 2RQ9A 1TIEA 1V6WA 2RSTA 3RSJA 4ZBVB 4QBVA 1EYLA 2AFGA 1S0BA 1DZCA 3SNVA 3WINC 2ESUA 4ZFWB 3NBEA 1FV2A 1T9FA 6I1BA 3WINA 3ZXGA 4LO7B 1JLXA 3P53A 3AJ6A 3VWCA 2ZQOA 1S0DA 3W9TA 2BFHA 1G9DA 2AQZA 3E8LC 1QQKA 3VT1A 4JAWA 4Z9WB 1ISYA 1ISXA 3IIRA 2YUGA 1QQLA 4L4HA 1IRAX 31BIA 3VEQA 2VUAA 2NP0A 4LO2A 1FV3A 2D24A 3WO4A 1JT7A 1R8NA 3AH2A 4AN7B 4II0A 2IWTB 4I4VA 4ZLBB 2P39A 4ENDA 4Q9PA 3FUOA 1I1EA 1YBIA 1I1BA 1DFCA 5G00A 4PC4A 2NYYA 4R6UB 1PC8B 1T4QA 2NTDA 3FJJA 3BRGC 3OGGA 4QKRA 4HJJA 2FFUA 4I0YA 1IT0A 3V0AB 3T8SA 2K8RA 4KEIA 1UPSA 1CE7B 3FJIA 1DQOA 9ILBA 2M49A 4A7KA 3FJEA 3AKHA 3IM7A 3QYDA 5HPZA 2RG9B 1G82A 4EB2B 1HKNA 4IZEA 1Z4SA 3CA0A 1IOBA 3OGFA 4XFUA 4X3AA 4ZFUB 5B2HA 3BA4A 4GOVA 3A07A 5BXTA 3FJBA 1BFGA 4OWJA 3HOMA 3BAUA 1JQZA 3RTIB 1TFMB 1RZOB 1YXWA 2Q9XA 2NS2A 1FWVA 3O4CA 4G6JA 4KBBA 4ISRA 3BAGA 3H6QA 4F83A 3NJ5A 2DS0A 1D0HA 4JPZA 4XKIA 5D63A 3FJ9A 3BADA 5F8SA 4Q91A 4I2SA 2KI4A 4WBCA 1FQ9A 1PZZA 3O49A 3FUQA 4JKQA 1BA7A 2WRYA 3IM5A 1AVWB 3O44A 5E24E 4IQPA 2Y9FA 2HZ9A 2VXTI 4ZA3B 2K4AB 3HSMA 1M2TB 2D20A 3AH1A 4CJMA 4I1BA 4L4IA 2KLLA 3IAGC 2AAIB 1ISWA 3P6IA 1ISVA 2VU9A 4OW4A 1PUUB 1RG8A 2Z48A 4YOLA 1JY0A 4IYBA 1ISZA 2NZ9A 4ZFYB 5FNWA 3V0BB 3WMVA 4HR6C 3ZX7A 2BEBA 2D43A 1IILA 1E0OA 3CRIA 1EVTA 2MC2A 1DLLA 3BB2A 8I1BA 3B9UA 2ET2A 2DREA 3O4AA 4QBCA 3CRHA 1YF8B 5FZZA 4P0KA 4JP0A 4XFSA 4G9NA 4Z8SB 3AKGA 3V0AA 1NZKA 1TWMA 4Q9GA 5BVPI 2KKIA 4XFTA 1BFCA 5F90A 3FJFA 2BEAA 4LO2C 1TWEA 3H6SE 5BXRA 4LO8B 1BFBA 1WBAA 2GZBA 5EHAA 2F2FC 2MLLB 3BAOA 1ONKB
chains in the Genus database with same CATH topology
3CA5A 3N7LA 3AKIA 3Q7YA 1HWMB 1HWNB 2D44A 2VSEA 3O3QA 3N7KA 2F2FA 2ZR1B 3CU1B 2QYIB 4OUJA 3AJ5A 5I1BA 1HCEA 1K5UA 3K1XA 1JT4A 1Z0HA 1FMZA 3CRGA 3PHZA 5DZUA 1BLAA 4I96A 4J2XA 1MC9A 5BQUA 3ZC8A 3AH4A 1DZDA 2Y9WC 5EC5A 3IM6A 4FVVA 3BA5A 5JLVA 3RMYA 1S0GA 1WD4A 2HW9A 1S0FA 2I1BA 4P0LA 5GAQA 4QC4A 3ZXDA 4LO3C 2NVHA 4I4XA 1FMMS 2AXMA 4I4PA 3PG0A 1HWOB 4X39A 3VT2A 4QD2B 4LO3A 2LIQA 2VXRA 2VSAA 4DEPA 1XZZA 1ABRB 3N7JA 3WMUA 4ZGRB 5DSSB 4DCKC 5FZYA 3HN1A 4EFQA 3CA3A 3I2XA 4I3NA 1WBCA 3PMEA 5BXSA 5F8YA 5D62A 2KI6B 3LLPA 2GO2A 2DRZA 3O4BA 2ERMA 1OQLB 4IZXA 3BAQA 3A21A 3O5WB 1G9BA 1KNMA 2KH2A 4I4OA 3NBCA 1W3AA 3FGMA 2L5XA 5BXPA 1EPWA 3WA1A 3NBNA 4EEEB 1RY7A 4D0TA 3VUOA 3V0BA 1QXMA 4QALA 1VCLA 3MPPG 4GAFA 4FGFA 3HMYA 4TLPA 4IY9A 3HBWA 1DIWA 2Z49A 1HIBA 1RMLA 3AZWA 1WD3A 2ZQNA 1V6XA 3A22A 3O4DA 3N7MA 4OWKA 3OJ2A 4MZFB 4GOYA 2R9KB 2MIBA 4IHZA 3QR5A 3ILAA 3FJDA 2LIEA 4IY8A 1P63A 5DVHA 1V6UA 1BARA 1AVAC 2D23A 1W3FA 4LO1C 2HWMA 1AVXB 4OEFA 5EG6C 4I6IA 3FJAA 3VSZA 5F8WA 3FJ8A 1XG6A 3OJVA 4LO1A 3VT0A 2P23A 1JT3A 3CA4A 3HALA 2Y9GA 3NBDA 4AN6A 1A8DA 4ZKTB 3BRDA 3F62B 1G9AA 3UD7A 1DJSB 3PUBA 4ZOTA 2DRYA 4ISQA 3UJ4A 2IHOA 4P6AA 4QD2C 4J2KA 41BIA 1AF9A 2FO1A 1FGAA 3Q7XA 1MD6A 5FNXA 1JLYA 3P6JA 3UD9A 4LO0C 4QKSA 1BFFA 3KMVA 5JMCA 1II4A 1HWPB 4USPA 3V79C 3EF2A 1G9CA 4LO0A 3CAHA 4J23B 3JUTA 5BQUC 2WBCA 3CA6A 2D7IA 3I29B 1CVSA 1FWUA 4MZHA 3ZC9A 3R4UA 3R4SA 4GAIA 4EFPA 3POKA 1L2HA 1Q1UA 4JQ0A 1DFQA 2HWAA 4JKXB 3BAVA 4J2YA 4KC3A 3S8JA 4H75A 4J2SA 4JRAA 3WO2A 4EFRA 5DUYA 3O4OA 4EKXB 3MALA 1YYNA 4HA2A 2VLCA 2XOAA 1TP0A 3OBTA 4I4RA 1DQGA 4I4YA 3OJMA 1Z2VA 1BLDA 4A7YA 1IJTA 3BAHA 3UJ0A 4A7ZA 3C9ZA 4UY4A 3UDAA 1K5VA 1EV2A 2FDBM 4GP0A 3TC2A 4G1RA 1F31A 4DENA 3RMXA 1ITBA 1XHBA 4I1EA 7I1BA 2F8XC 4H9WA 3H6RA 3VSFA 4G9MA 4I4QA 4X38A 2D7RA 1N4KA 1SZ6B 5FZUA 1TOOA 1R8OA 4I7IA 3I2AA 4QO3A 1Q03A 3CA1A 1J0SA 5BP5C 1W3GA 3S8KA 4P0JA 1JTCA 1FN0A 1Q04A 1BASA 1ILR1 1IRPA 1PWAA 3BRFA 5BP5A 2Q3NB 4IONA 3LTQA 2J3PA 3FJCA 2D1ZA 4I37A 5BOWA 1HCDA 1SR4C 5D61A 1S0EA 1NUNA 3BX1C 2E4MC 4X37A 3BA7A 1V6VA 4I4UA 1SR4A 3H6RB 4D8HA 1AVUA 2D22A 1JT5A 4D0ZA 2E4MA 3FJKA 4H04A 4OEGA 4I8MA 4LO7C 21BIA 4OEEA 1GGPB 3FFZA 3FJHA 1AXMA 3A23A 1M16A 3AKFA 2FFVA 3AZVA 4KEKA 3F1RA 3N0KA 3D7WB 2FGFA 3RTJB 1S0CA 3Q7WA 1TTUA 1S0LA 2X2SA 4F34A 2NM1A 1PUMB 3WO3A 1IHKA 4KEJA 4MZGB 3JRRA 2K43A 2UUSA 1YTOA 2Y9XE 3BTAA 4OWLA 3OBRA 4I4SA 2QN4A 4G6MA 1XYFA 3CQAA 4USOA 2X2TA 4GP3A 3UD8A 1AFCA 2RQ9A 1TIEA 1V6WA 2RSTA 3RSJA 4ZBVB 4QBVA 1EYLA 2AFGA 1S0BA 1DZCA 3SNVA 3WINC 2ESUA 4ZFWB 3NBEA 1FV2A 1T9FA 6I1BA 3WINA 3ZXGA 4LO7B 1JLXA 3P53A 3AJ6A 3VWCA 2ZQOA 1S0DA 3W9TA 2BFHA 1G9DA 2AQZA 3E8LC 1QQKA 3VT1A 4JAWA 4Z9WB 1ISYA 1ISXA 3IIRA 2YUGA 1QQLA 4L4HA 1IRAX 31BIA 3VEQA 2VUAA 2NP0A 4LO2A 1FV3A 2D24A 3WO4A 1JT7A 1R8NA 3AH2A 4AN7B 4II0A 2IWTB 4I4VA 4ZLBB 2P39A 4ENDA 4Q9PA 3FUOA 1I1EA 1YBIA 1I1BA 1DFCA 5G00A 4PC4A 2NYYA 4R6UB 1PC8B 1T4QA 2NTDA 3FJJA 3BRGC 3OGGA 4QKRA 4HJJA 2FFUA 4I0YA 1IT0A 3V0AB 3T8SA 2K8RA 4KEIA 1UPSA 1CE7B 3FJIA 1DQOA 9ILBA 2M49A 4A7KA 3FJEA 3AKHA 3IM7A 3QYDA 5HPZA 2RG9B 1G82A 4EB2B 1HKNA 4IZEA 1Z4SA 3CA0A 1IOBA 3OGFA 4XFUA 4X3AA 4ZFUB 5B2HA 3BA4A 4GOVA 3A07A 5BXTA 3FJBA 1BFGA 4OWJA 3HOMA 3BAUA 1JQZA 3RTIB 1TFMB 1RZOB 1YXWA 2Q9XA 2NS2A 1FWVA 3O4CA 4G6JA 4KBBA 4ISRA 3BAGA 3H6QA 4F83A 3NJ5A 2DS0A 1D0HA 4JPZA 4XKIA 5D63A 3FJ9A 3BADA 5F8SA 4Q91A 4I2SA 2KI4A 4WBCA 1FQ9A 1PZZA 3O49A 3FUQA 4JKQA 1BA7A 2WRYA 3IM5A 1AVWB 3O44A 5E24E 4IQPA 2Y9FA 2HZ9A 2VXTI 4ZA3B 2K4AB 3HSMA 1M2TB 2D20A 3AH1A 4CJMA 4I1BA 4L4IA 2KLLA 3IAGC 2AAIB 1ISWA 3P6IA 1ISVA 2VU9A 4OW4A 1PUUB 1RG8A 2Z48A 4YOLA 1JY0A 4IYBA 1ISZA 2NZ9A 4ZFYB 5FNWA 3V0BB 3WMVA 4HR6C 3ZX7A 2BEBA 2D43A 1IILA 1E0OA 3CRIA 1EVTA 2MC2A 1DLLA 3BB2A 8I1BA 3B9UA 2ET2A 2DREA 3O4AA 4QBCA 3CRHA 1YF8B 5FZZA 4P0KA 4JP0A 4XFSA 4G9NA 4Z8SB 3AKGA 3V0AA 1NZKA 1TWMA 4Q9GA 5BVPI 2KKIA 4XFTA 1BFCA 5F90A 3FJFA 2BEAA 4LO2C 1TWEA 3H6SE 5BXRA 4LO8B 1BFBA 1WBAA 2GZBA 5EHAA 2F2FC 2MLLB 3BAOA 1ONKB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CA5 A;  3N7L A;  3AKI A;  3Q7Y A;  1HWM B;  1HWN B;  2D44 A;  2VSE A;  3O3Q A;  3N7K A;  2F2F A;  2ZR1 B;  3CU1 B;  2QYI B;  4OUJ A;  3AJ5 A;  5I1B A;  1HCE A;  1K5U A;  3K1X A;  1JT4 A;  1Z0H A;  1FMZ A;  3CRG A;  3PHZ A;  5DZU A;  1BLA A;  4I96 A;  4J2X A;  1MC9 A;  5BQU A;  3ZC8 A;  3AH4 A;  1DZD A;  2Y9W C;  5EC5 A;  3IM6 A;  4FVV A;  3BA5 A;  5JLV A;  3RMY A;  1S0G A;  1WD4 A;  2HW9 A;  1S0F A;  2I1B A;  4P0L A;  5GAQ A;  4QC4 A;  3ZXD A;  4LO3 C;  2NVH A;  4I4X A;  1FMM S;  2AXM A;  4I4P A;  3PG0 A;  1HWO B;  4X39 A;  3VT2 A;  4QD2 B;  4LO3 A;  2LIQ A;  2VXR A;  2VSA A;  4DEP A;  1XZZ A;  1ABR B;  3N7J A;  3WMU A;  4ZGR B;  5DSS B;  4DCK C;  5FZY A;  3HN1 A;  4EFQ A;  3CA3 A;  3I2X A;  4I3N A;  1WBC A;  3PME A;  5BXS A;  5F8Y A;  5D62 A;  2KI6 B;  3LLP A;  2GO2 A;  2DRZ A;  3O4B A;  2ERM A;  1OQL B;  4IZX A;  3BAQ A;  3A21 A;  3O5W B;  1G9B A;  1KNM A;  2KH2 A;  4I4O A;  3NBC A;  1W3A A;  3FGM A;  2L5X A;  5BXP A;  1EPW A;  3WA1 A;  3NBN A;  4EEE B;  1RY7 A;  4D0T A;  3VUO A;  3V0B A;  1QXM A;  4QAL A;  1VCL A;  3MPP G;  4GAF A;  4FGF A;  3HMY A;  4TLP A;  4IY9 A;  3HBW A;  1DIW A;  2Z49 A;  1HIB A;  1RML A;  3AZW A;  1WD3 A;  2ZQN A;  1V6X A;  3A22 A;  3O4D A;  3N7M A;  4OWK A;  3OJ2 A;  4GOY A;  2R9K B;  2MIB A;  4IHZ A;  3QR5 A;  3ILA A;  3FJD A;  2LIE A;  4IY8 A;  1P63 A;  5DVH A;  1V6U A;  1BAR A;  1AVA C;  2D23 A;  1W3F A;  4LO1 C;  2HWM A;  1AVX B;  4OEF A;  5EG6 C;  4I6I A;  3FJA A;  3VSZ A;  5F8W A;  3FJ8 A;  1XG6 A;  3OJV A;  4LO1 A;  3VT0 A;  2P23 A;  1JT3 A;  3CA4 A;  3HAL A;  2Y9G A;  3NBD A;  4AN6 A;  1A8D A;  4ZKT B;  3BRD A;  3F62 B;  1G9A A;  3UD7 A;  1DJS B;  3PUB A;  4ZOT A;  2DRY A;  4ISQ A;  3UJ4 A;  2IHO A;  4P6A A;  4QD2 C;  4J2K A;  41BI A;  1AF9 A;  2FO1 A;  1FGA A;  3Q7X A;  1MD6 A;  5FNX A;  1JLY A;  3P6J A;  3UD9 A;  4LO0 C;  4QKS A;  1BFF A;  3KMV A;  5JMC A;  1II4 A;  1HWP B;  4USP A;  3V79 C;  3EF2 A;  1G9C A;  4LO0 A;  3CAH A;  4J23 B;  3JUT A;  5BQU C;  2WBC A;  3CA6 A;  2D7I A;  3I29 B;  1CVS A;  1FWU A;  3ZC9 A;  3R4U A;  3R4S A;  4GAI A;  4EFP A;  3POK A;  1L2H A;  1Q1U A;  4JQ0 A;  1DFQ A;  2HWA A;  4JKX B;  3BAV A;  4J2Y A;  4KC3 A;  3S8J A;  4J2S A;  4JRA A;  3WO2 A;  4EFR A;  5DUY A;  3O4O A;  4EKX B;  3MAL A;  1YYN A;  4HA2 A;  2VLC A;  2XOA A;  1TP0 A;  3OBT A;  4I4R A;  1DQG A;  4I4Y A;  3OJM A;  1Z2V A;  1BLD A;  4A7Y A;  1IJT A;  3BAH A;  3UJ0 A;  4A7Z A;  3C9Z A;  3UDA A;  1K5V A;  1EV2 A;  2FDB M;  4GP0 A;  3TC2 A;  4G1R A;  1F31 A;  4DEN A;  3RMX A;  1ITB A;  1XHB A;  4I1E A;  7I1B A;  2F8X C;  4H9W A;  3H6R A;  3VSF A;  4G9M A;  4I4Q A;  4X38 A;  2D7R A;  1N4K A;  1SZ6 B;  5FZU A;  1TOO A;  1R8O A;  4I7I A;  3I2A A;  4QO3 A;  1Q03 A;  3CA1 A;  1J0S A;  5BP5 C;  1W3G A;  3S8K A;  4P0J A;  1JTC A;  1FN0 A;  1Q04 A;  1BAS A;  1ILR 1;  1IRP A;  1PWA A;  3BRF A;  5BP5 A;  2Q3N B;  4ION A;  3LTQ A;  2J3P A;  3FJC A;  2D1Z A;  4I37 A;  5BOW A;  1HCD A;  1SR4 C;  5D61 A;  1S0E A;  1NUN A;  3BX1 C;  2E4M C;  4X37 A;  3BA7 A;  1V6V A;  4I4U A;  1SR4 A;  3H6R B;  4D8H A;  1AVU A;  2D22 A;  1JT5 A;  4D0Z A;  2E4M A;  3FJK A;  4H04 A;  4OEG A;  4I8M A;  4LO7 C;  21BI A;  4OEE A;  1GGP B;  3FFZ A;  3FJH A;  1AXM A;  3A23 A;  1M16 A;  3AKF A;  2FFV A;  3AZV A;  4KEK A;  3F1R A;  3N0K A;  3D7W B;  2FGF A;  3RTJ B;  1S0C A;  3Q7W A;  1TTU A;  1S0L A;  2X2S A;  4F34 A;  2NM1 A;  1PUM B;  3WO3 A;  1IHK A;  4KEJ A;  3JRR A;  2K43 A;  2UUS A;  1YTO A;  2Y9X E;  3BTA A;  4OWL A;  3OBR A;  4I4S A;  2QN4 A;  4G6M A;  1XYF A;  3CQA A;  4USO A;  2X2T A;  4GP3 A;  3UD8 A;  1AFC A;  2RQ9 A;  1TIE A;  1V6W A;  2RST A;  3RSJ A;  4ZBV B;  4QBV A;  1EYL A;  2AFG A;  1S0B A;  1DZC A;  3SNV A;  3WIN C;  2ESU A;  4ZFW B;  3NBE A;  1FV2 A;  1T9F A;  6I1B A;  3WIN A;  3ZXG A;  4LO7 B;  1JLX A;  3P53 A;  3AJ6 A;  3VWC A;  2ZQO A;  1S0D A;  3W9T A;  2BFH A;  1G9D A;  2AQZ A;  3E8L C;  1QQK A;  3VT1 A;  4JAW A;  4Z9W B;  1ISY A;  1ISX A;  3IIR A;  2YUG A;  1QQL A;  4L4H A;  1IRA X;  31BI A;  3VEQ A;  2VUA A;  2NP0 A;  4LO2 A;  1FV3 A;  2D24 A;  3WO4 A;  1JT7 A;  1R8N A;  3AH2 A;  4AN7 B;  4II0 A;  2IWT B;  4I4V A;  4ZLB B;  2P39 A;  4END A;  4Q9P A;  3FUO A;  1I1E A;  1YBI A;  1I1B A;  1DFC A;  5G00 A;  4PC4 A;  2NYY A;  4R6U B;  1PC8 B;  1T4Q A;  2NTD A;  3FJJ A;  3BRG C;  3OGG A;  4QKR A;  4HJJ A;  2FFU A;  4I0Y A;  1IT0 A;  3V0A B;  3T8S A;  2K8R A;  4KEI A;  1UPS A;  1CE7 B;  3FJI A;  1DQO A;  9ILB A;  2M49 A;  4A7K A;  3FJE A;  3AKH A;  3IM7 A;  3QYD A;  5HPZ A;  2RG9 B;  1G82 A;  4EB2 B;  1HKN A;  4IZE A;  1Z4S A;  3CA0 A;  1IOB A;  3OGF A;  4XFU A;  4X3A A;  4ZFU B;  5B2H A;  3BA4 A;  4GOV A;  3A07 A;  5BXT A;  3FJB A;  1BFG A;  4OWJ A;  3HOM A;  3BAU A;  1JQZ A;  3RTI B;  1TFM B;  1RZO B;  1YXW A;  2Q9X A;  1FWV A;  3O4C A;  4G6J A;  4KBB A;  4ISR A;  3BAG A;  3H6Q A;  4F83 A;  3NJ5 A;  2DS0 A;  1D0H A;  4JPZ A;  4XKI A;  5D63 A;  3FJ9 A;  3BAD A;  5F8S A;  4Q91 A;  4I2S A;  2KI4 A;  4WBC A;  1FQ9 A;  1PZZ A;  3O49 A;  3FUQ A;  4JKQ A;  1BA7 A;  2WRY A;  3IM5 A;  1AVW B;  3O44 A;  5E24 E;  4IQP A;  2Y9F A;  2HZ9 A;  2VXT I;  4ZA3 B;  2K4A B;  3HSM A;  1M2T B;  2D20 A;  3AH1 A;  4CJM A;  4I1B A;  4L4I A;  2KLL A;  3IAG C;  2AAI B;  1ISW A;  3P6I A;  1ISV A;  2VU9 A;  4OW4 A;  1PUU B;  1RG8 A;  2Z48 A;  4YOL A;  1JY0 A;  4IYB A;  1ISZ A;  2NZ9 A;  4ZFY B;  5FNW A;  3V0B B;  3WMV A;  4HR6 C;  3ZX7 A;  2BEB A;  2D43 A;  1IIL A;  1E0O A;  3CRI A;  1EVT A;  2MC2 A;  1DLL A;  3BB2 A;  8I1B A;  3B9U A;  2ET2 A;  2DRE A;  3O4A A;  4QBC A;  3CRH A;  1YF8 B;  5FZZ A;  4P0K A;  4JP0 A;  4XFS A;  4G9N A;  4Z8S B;  3AKG A;  3V0A A;  1NZK A;  1TWM A;  4Q9G A;  5BVP I;  2KKI A;  4XFT A;  1BFC A;  5F90 A;  3FJF A;  2BEA A;  4LO2 C;  1TWE A;  3H6S E;  5BXR A;  4LO8 B;  1BFB A;  1WBA A;  2GZB A;  5EHA A;  2F2F C;  2MLL B;  3BAO A;  1ONK B; 
#chains in the Genus database with same CATH topology
 3CA5 A;  3N7L A;  3AKI A;  3Q7Y A;  1HWM B;  1HWN B;  2D44 A;  2VSE A;  3O3Q A;  3N7K A;  2F2F A;  2ZR1 B;  3CU1 B;  2QYI B;  4OUJ A;  3AJ5 A;  5I1B A;  1HCE A;  1K5U A;  3K1X A;  1JT4 A;  1Z0H A;  1FMZ A;  3CRG A;  3PHZ A;  5DZU A;  1BLA A;  4I96 A;  4J2X A;  1MC9 A;  5BQU A;  3ZC8 A;  3AH4 A;  1DZD A;  2Y9W C;  5EC5 A;  3IM6 A;  4FVV A;  3BA5 A;  5JLV A;  3RMY A;  1S0G A;  1WD4 A;  2HW9 A;  1S0F A;  2I1B A;  4P0L A;  5GAQ A;  4QC4 A;  3ZXD A;  4LO3 C;  2NVH A;  4I4X A;  1FMM S;  2AXM A;  4I4P A;  3PG0 A;  1HWO B;  4X39 A;  3VT2 A;  4QD2 B;  4LO3 A;  2LIQ A;  2VXR A;  2VSA A;  4DEP A;  1XZZ A;  1ABR B;  3N7J A;  3WMU A;  4ZGR B;  5DSS B;  4DCK C;  5FZY A;  3HN1 A;  4EFQ A;  3CA3 A;  3I2X A;  4I3N A;  1WBC A;  3PME A;  5BXS A;  5F8Y A;  5D62 A;  2KI6 B;  3LLP A;  2GO2 A;  2DRZ A;  3O4B A;  2ERM A;  1OQL B;  4IZX A;  3BAQ A;  3A21 A;  3O5W B;  1G9B A;  1KNM A;  2KH2 A;  4I4O A;  3NBC A;  1W3A A;  3FGM A;  2L5X A;  5BXP A;  1EPW A;  3WA1 A;  3NBN A;  4EEE B;  1RY7 A;  4D0T A;  3VUO A;  3V0B A;  1QXM A;  4QAL A;  1VCL A;  3MPP G;  4GAF A;  4FGF A;  3HMY A;  4TLP A;  4IY9 A;  3HBW A;  1DIW A;  2Z49 A;  1HIB A;  1RML A;  3AZW A;  1WD3 A;  2ZQN A;  1V6X A;  3A22 A;  3O4D A;  3N7M A;  4OWK A;  3OJ2 A;  4MZF B;  4GOY A;  2R9K B;  2MIB A;  4IHZ A;  3QR5 A;  3ILA A;  3FJD A;  2LIE A;  4IY8 A;  1P63 A;  5DVH A;  1V6U A;  1BAR A;  1AVA C;  2D23 A;  1W3F A;  4LO1 C;  2HWM A;  1AVX B;  4OEF A;  5EG6 C;  4I6I A;  3FJA A;  3VSZ A;  5F8W A;  3FJ8 A;  1XG6 A;  3OJV A;  4LO1 A;  3VT0 A;  2P23 A;  1JT3 A;  3CA4 A;  3HAL A;  2Y9G A;  3NBD A;  4AN6 A;  1A8D A;  4ZKT B;  3BRD A;  3F62 B;  1G9A A;  3UD7 A;  1DJS B;  3PUB A;  4ZOT A;  2DRY A;  4ISQ A;  3UJ4 A;  2IHO A;  4P6A A;  4QD2 C;  4J2K A;  41BI A;  1AF9 A;  2FO1 A;  1FGA A;  3Q7X A;  1MD6 A;  5FNX A;  1JLY A;  3P6J A;  3UD9 A;  4LO0 C;  4QKS A;  1BFF A;  3KMV A;  5JMC A;  1II4 A;  1HWP B;  4USP A;  3V79 C;  3EF2 A;  1G9C A;  4LO0 A;  3CAH A;  4J23 B;  3JUT A;  5BQU C;  2WBC A;  3CA6 A;  2D7I A;  3I29 B;  1CVS A;  1FWU A;  4MZH A;  3ZC9 A;  3R4U A;  3R4S A;  4GAI A;  4EFP A;  3POK A;  1L2H A;  1Q1U A;  4JQ0 A;  1DFQ A;  2HWA A;  4JKX B;  3BAV A;  4J2Y A;  4KC3 A;  3S8J A;  4H75 A;  4J2S A;  4JRA A;  3WO2 A;  4EFR A;  5DUY A;  3O4O A;  4EKX B;  3MAL A;  1YYN A;  4HA2 A;  2VLC A;  2XOA A;  1TP0 A;  3OBT A;  4I4R A;  1DQG A;  4I4Y A;  3OJM A;  1Z2V A;  1BLD A;  4A7Y A;  1IJT A;  3BAH A;  3UJ0 A;  4A7Z A;  3C9Z A;  4UY4 A;  3UDA A;  1K5V A;  1EV2 A;  2FDB M;  4GP0 A;  3TC2 A;  4G1R A;  1F31 A;  4DEN A;  3RMX A;  1ITB A;  1XHB A;  4I1E A;  7I1B A;  2F8X C;  4H9W A;  3H6R A;  3VSF A;  4G9M A;  4I4Q A;  4X38 A;  2D7R A;  1N4K A;  1SZ6 B;  5FZU A;  1TOO A;  1R8O A;  4I7I A;  3I2A A;  4QO3 A;  1Q03 A;  3CA1 A;  1J0S A;  5BP5 C;  1W3G A;  3S8K A;  4P0J A;  1JTC A;  1FN0 A;  1Q04 A;  1BAS A;  1ILR 1;  1IRP A;  1PWA A;  3BRF A;  5BP5 A;  2Q3N B;  4ION A;  3LTQ A;  2J3P A;  3FJC A;  2D1Z A;  4I37 A;  5BOW A;  1HCD A;  1SR4 C;  5D61 A;  1S0E A;  1NUN A;  3BX1 C;  2E4M C;  4X37 A;  3BA7 A;  1V6V A;  4I4U A;  1SR4 A;  3H6R B;  4D8H A;  1AVU A;  2D22 A;  1JT5 A;  4D0Z A;  2E4M A;  3FJK A;  4H04 A;  4OEG A;  4I8M A;  4LO7 C;  21BI A;  4OEE A;  1GGP B;  3FFZ A;  3FJH A;  1AXM A;  3A23 A;  1M16 A;  3AKF A;  2FFV A;  3AZV A;  4KEK A;  3F1R A;  3N0K A;  3D7W B;  2FGF A;  3RTJ B;  1S0C A;  3Q7W A;  1TTU A;  1S0L A;  2X2S A;  4F34 A;  2NM1 A;  1PUM B;  3WO3 A;  1IHK A;  4KEJ A;  4MZG B;  3JRR A;  2K43 A;  2UUS A;  1YTO A;  2Y9X E;  3BTA A;  4OWL A;  3OBR A;  4I4S A;  2QN4 A;  4G6M A;  1XYF A;  3CQA A;  4USO A;  2X2T A;  4GP3 A;  3UD8 A;  1AFC A;  2RQ9 A;  1TIE A;  1V6W A;  2RST A;  3RSJ A;  4ZBV B;  4QBV A;  1EYL A;  2AFG A;  1S0B A;  1DZC A;  3SNV A;  3WIN C;  2ESU A;  4ZFW B;  3NBE A;  1FV2 A;  1T9F A;  6I1B A;  3WIN A;  3ZXG A;  4LO7 B;  1JLX A;  3P53 A;  3AJ6 A;  3VWC A;  2ZQO A;  1S0D A;  3W9T A;  2BFH A;  1G9D A;  2AQZ A;  3E8L C;  1QQK A;  3VT1 A;  4JAW A;  4Z9W B;  1ISY A;  1ISX A;  3IIR A;  2YUG A;  1QQL A;  4L4H A;  1IRA X;  31BI A;  3VEQ A;  2VUA A;  2NP0 A;  4LO2 A;  1FV3 A;  2D24 A;  3WO4 A;  1JT7 A;  1R8N A;  3AH2 A;  4AN7 B;  4II0 A;  2IWT B;  4I4V A;  4ZLB B;  2P39 A;  4END A;  4Q9P A;  3FUO A;  1I1E A;  1YBI A;  1I1B A;  1DFC A;  5G00 A;  4PC4 A;  2NYY A;  4R6U B;  1PC8 B;  1T4Q A;  2NTD A;  3FJJ A;  3BRG C;  3OGG A;  4QKR A;  4HJJ A;  2FFU A;  4I0Y A;  1IT0 A;  3V0A B;  3T8S A;  2K8R A;  4KEI A;  1UPS A;  1CE7 B;  3FJI A;  1DQO A;  9ILB A;  2M49 A;  4A7K A;  3FJE A;  3AKH A;  3IM7 A;  3QYD A;  5HPZ A;  2RG9 B;  1G82 A;  4EB2 B;  1HKN A;  4IZE A;  1Z4S A;  3CA0 A;  1IOB A;  3OGF A;  4XFU A;  4X3A A;  4ZFU B;  5B2H A;  3BA4 A;  4GOV A;  3A07 A;  5BXT A;  3FJB A;  1BFG A;  4OWJ A;  3HOM A;  3BAU A;  1JQZ A;  3RTI B;  1TFM B;  1RZO B;  1YXW A;  2Q9X A;  2NS2 A;  1FWV A;  3O4C A;  4G6J A;  4KBB A;  4ISR A;  3BAG A;  3H6Q A;  4F83 A;  3NJ5 A;  2DS0 A;  1D0H A;  4JPZ A;  4XKI A;  5D63 A;  3FJ9 A;  3BAD A;  5F8S A;  4Q91 A;  4I2S A;  2KI4 A;  4WBC A;  1FQ9 A;  1PZZ A;  3O49 A;  3FUQ A;  4JKQ A;  1BA7 A;  2WRY A;  3IM5 A;  1AVW B;  3O44 A;  5E24 E;  4IQP A;  2Y9F A;  2HZ9 A;  2VXT I;  4ZA3 B;  2K4A B;  3HSM A;  1M2T B;  2D20 A;  3AH1 A;  4CJM A;  4I1B A;  4L4I A;  2KLL A;  3IAG C;  2AAI B;  1ISW A;  3P6I A;  1ISV A;  2VU9 A;  4OW4 A;  1PUU B;  1RG8 A;  2Z48 A;  4YOL A;  1JY0 A;  4IYB A;  1ISZ A;  2NZ9 A;  4ZFY B;  5FNW A;  3V0B B;  3WMV A;  4HR6 C;  3ZX7 A;  2BEB A;  2D43 A;  1IIL A;  1E0O A;  3CRI A;  1EVT A;  2MC2 A;  1DLL A;  3BB2 A;  8I1B A;  3B9U A;  2ET2 A;  2DRE A;  3O4A A;  4QBC A;  3CRH A;  1YF8 B;  5FZZ A;  4P0K A;  4JP0 A;  4XFS A;  4G9N A;  4Z8S B;  3AKG A;  3V0A A;  1NZK A;  1TWM A;  4Q9G A;  5BVP I;  2KKI A;  4XFT A;  1BFC A;  5F90 A;  3FJF A;  2BEA A;  4LO2 C;  1TWE A;  3H6S E;  5BXR A;  4LO8 B;  1BFB A;  1WBA A;  2GZB A;  5EHA A;  2F2F C;  2MLL B;  3BAO A;  1ONK B; 
#chains in the Genus database with same CATH homology
 3CA5 A;  3N7L A;  3AKI A;  3Q7Y A;  1HWM B;  1HWN B;  2D44 A;  2VSE A;  3O3Q A;  3N7K A;  2F2F A;  2ZR1 B;  3CU1 B;  2QYI B;  4OUJ A;  3AJ5 A;  5I1B A;  1HCE A;  1K5U A;  3K1X A;  1JT4 A;  1Z0H A;  1FMZ A;  3CRG A;  3PHZ A;  5DZU A;  1BLA A;  4I96 A;  4J2X A;  1MC9 A;  5BQU A;  3ZC8 A;  3AH4 A;  1DZD A;  2Y9W C;  5EC5 A;  3IM6 A;  4FVV A;  3BA5 A;  5JLV A;  3RMY A;  1S0G A;  1WD4 A;  2HW9 A;  1S0F A;  2I1B A;  4P0L A;  5GAQ A;  4QC4 A;  3ZXD A;  4LO3 C;  2NVH A;  4I4X A;  1FMM S;  2AXM A;  4I4P A;  3PG0 A;  1HWO B;  4X39 A;  3VT2 A;  4QD2 B;  4LO3 A;  2LIQ A;  2VXR A;  2VSA A;  4DEP A;  1XZZ A;  1ABR B;  3N7J A;  3WMU A;  4ZGR B;  5DSS B;  4DCK C;  5FZY A;  3HN1 A;  4EFQ A;  3CA3 A;  3I2X A;  4I3N A;  1WBC A;  3PME A;  5BXS A;  5F8Y A;  5D62 A;  2KI6 B;  3LLP A;  2GO2 A;  2DRZ A;  3O4B A;  2ERM A;  1OQL B;  4IZX A;  3BAQ A;  3A21 A;  3O5W B;  1G9B A;  1KNM A;  2KH2 A;  4I4O A;  3NBC A;  1W3A A;  3FGM A;  2L5X A;  5BXP A;  1EPW A;  3WA1 A;  3NBN A;  4EEE B;  1RY7 A;  4D0T A;  3VUO A;  3V0B A;  1QXM A;  4QAL A;  1VCL A;  3MPP G;  4GAF A;  4FGF A;  3HMY A;  4TLP A;  4IY9 A;  3HBW A;  1DIW A;  2Z49 A;  1HIB A;  1RML A;  3AZW A;  1WD3 A;  2ZQN A;  1V6X A;  3A22 A;  3O4D A;  3N7M A;  4OWK A;  3OJ2 A;  4MZF B;  4GOY A;  2R9K B;  2MIB A;  4IHZ A;  3QR5 A;  3ILA A;  3FJD A;  2LIE A;  4IY8 A;  1P63 A;  5DVH A;  1V6U A;  1BAR A;  1AVA C;  2D23 A;  1W3F A;  4LO1 C;  2HWM A;  1AVX B;  4OEF A;  5EG6 C;  4I6I A;  3FJA A;  3VSZ A;  5F8W A;  3FJ8 A;  1XG6 A;  3OJV A;  4LO1 A;  3VT0 A;  2P23 A;  1JT3 A;  3CA4 A;  3HAL A;  2Y9G A;  3NBD A;  4AN6 A;  1A8D A;  4ZKT B;  3BRD A;  3F62 B;  1G9A A;  3UD7 A;  1DJS B;  3PUB A;  4ZOT A;  2DRY A;  4ISQ A;  3UJ4 A;  2IHO A;  4P6A A;  4QD2 C;  4J2K A;  41BI A;  1AF9 A;  2FO1 A;  1FGA A;  3Q7X A;  1MD6 A;  5FNX A;  1JLY A;  3P6J A;  3UD9 A;  4LO0 C;  4QKS A;  1BFF A;  3KMV A;  5JMC A;  1II4 A;  1HWP B;  4USP A;  3V79 C;  3EF2 A;  1G9C A;  4LO0 A;  3CAH A;  4J23 B;  3JUT A;  5BQU C;  2WBC A;  3CA6 A;  2D7I A;  3I29 B;  1CVS A;  1FWU A;  4MZH A;  3ZC9 A;  3R4U A;  3R4S A;  4GAI A;  4EFP A;  3POK A;  1L2H A;  1Q1U A;  4JQ0 A;  1DFQ A;  2HWA A;  4JKX B;  3BAV A;  4J2Y A;  4KC3 A;  3S8J A;  4H75 A;  4J2S A;  4JRA A;  3WO2 A;  4EFR A;  5DUY A;  3O4O A;  4EKX B;  3MAL A;  1YYN A;  4HA2 A;  2VLC A;  2XOA A;  1TP0 A;  3OBT A;  4I4R A;  1DQG A;  4I4Y A;  3OJM A;  1Z2V A;  1BLD A;  4A7Y A;  1IJT A;  3BAH A;  3UJ0 A;  4A7Z A;  3C9Z A;  4UY4 A;  3UDA A;  1K5V A;  1EV2 A;  2FDB M;  4GP0 A;  3TC2 A;  4G1R A;  1F31 A;  4DEN A;  3RMX A;  1ITB A;  1XHB A;  4I1E A;  7I1B A;  2F8X C;  4H9W A;  3H6R A;  3VSF A;  4G9M A;  4I4Q A;  4X38 A;  2D7R A;  1N4K A;  1SZ6 B;  5FZU A;  1TOO A;  1R8O A;  4I7I A;  3I2A A;  4QO3 A;  1Q03 A;  3CA1 A;  1J0S A;  5BP5 C;  1W3G A;  3S8K A;  4P0J A;  1JTC A;  1FN0 A;  1Q04 A;  1BAS A;  1ILR 1;  1IRP A;  1PWA A;  3BRF A;  5BP5 A;  2Q3N B;  4ION A;  3LTQ A;  2J3P A;  3FJC A;  2D1Z A;  4I37 A;  5BOW A;  1HCD A;  1SR4 C;  5D61 A;  1S0E A;  1NUN A;  3BX1 C;  2E4M C;  4X37 A;  3BA7 A;  1V6V A;  4I4U A;  1SR4 A;  3H6R B;  4D8H A;  1AVU A;  2D22 A;  1JT5 A;  4D0Z A;  2E4M A;  3FJK A;  4H04 A;  4OEG A;  4I8M A;  4LO7 C;  21BI A;  4OEE A;  1GGP B;  3FFZ A;  3FJH A;  1AXM A;  3A23 A;  1M16 A;  3AKF A;  2FFV A;  3AZV A;  4KEK A;  3F1R A;  3N0K A;  3D7W B;  2FGF A;  3RTJ B;  1S0C A;  3Q7W A;  1TTU A;  1S0L A;  2X2S A;  4F34 A;  2NM1 A;  1PUM B;  3WO3 A;  1IHK A;  4KEJ A;  4MZG B;  3JRR A;  2K43 A;  2UUS A;  1YTO A;  2Y9X E;  3BTA A;  4OWL A;  3OBR A;  4I4S A;  2QN4 A;  4G6M A;  1XYF A;  3CQA A;  4USO A;  2X2T A;  4GP3 A;  3UD8 A;  1AFC A;  2RQ9 A;  1TIE A;  1V6W A;  2RST A;  3RSJ A;  4ZBV B;  4QBV A;  1EYL A;  2AFG A;  1S0B A;  1DZC A;  3SNV A;  3WIN C;  2ESU A;  4ZFW B;  3NBE A;  1FV2 A;  1T9F A;  6I1B A;  3WIN A;  3ZXG A;  4LO7 B;  1JLX A;  3P53 A;  3AJ6 A;  3VWC A;  2ZQO A;  1S0D A;  3W9T A;  2BFH A;  1G9D A;  2AQZ A;  3E8L C;  1QQK A;  3VT1 A;  4JAW A;  4Z9W B;  1ISY A;  1ISX A;  3IIR A;  2YUG A;  1QQL A;  4L4H A;  1IRA X;  31BI A;  3VEQ A;  2VUA A;  2NP0 A;  4LO2 A;  1FV3 A;  2D24 A;  3WO4 A;  1JT7 A;  1R8N A;  3AH2 A;  4AN7 B;  4II0 A;  2IWT B;  4I4V A;  4ZLB B;  2P39 A;  4END A;  4Q9P A;  3FUO A;  1I1E A;  1YBI A;  1I1B A;  1DFC A;  5G00 A;  4PC4 A;  2NYY A;  4R6U B;  1PC8 B;  1T4Q A;  2NTD A;  3FJJ A;  3BRG C;  3OGG A;  4QKR A;  4HJJ A;  2FFU A;  4I0Y A;  1IT0 A;  3V0A B;  3T8S A;  2K8R A;  4KEI A;  1UPS A;  1CE7 B;  3FJI A;  1DQO A;  9ILB A;  2M49 A;  4A7K A;  3FJE A;  3AKH A;  3IM7 A;  3QYD A;  5HPZ A;  2RG9 B;  1G82 A;  4EB2 B;  1HKN A;  4IZE A;  1Z4S A;  3CA0 A;  1IOB A;  3OGF A;  4XFU A;  4X3A A;  4ZFU B;  5B2H A;  3BA4 A;  4GOV A;  3A07 A;  5BXT A;  3FJB A;  1BFG A;  4OWJ A;  3HOM A;  3BAU A;  1JQZ A;  3RTI B;  1TFM B;  1RZO B;  1YXW A;  2Q9X A;  2NS2 A;  1FWV A;  3O4C A;  4G6J A;  4KBB A;  4ISR A;  3BAG A;  3H6Q A;  4F83 A;  3NJ5 A;  2DS0 A;  1D0H A;  4JPZ A;  4XKI A;  5D63 A;  3FJ9 A;  3BAD A;  5F8S A;  4Q91 A;  4I2S A;  2KI4 A;  4WBC A;  1FQ9 A;  1PZZ A;  3O49 A;  3FUQ A;  4JKQ A;  1BA7 A;  2WRY A;  3IM5 A;  1AVW B;  3O44 A;  5E24 E;  4IQP A;  2Y9F A;  2HZ9 A;  2VXT I;  4ZA3 B;  2K4A B;  3HSM A;  1M2T B;  2D20 A;  3AH1 A;  4CJM A;  4I1B A;  4L4I A;  2KLL A;  3IAG C;  2AAI B;  1ISW A;  3P6I A;  1ISV A;  2VU9 A;  4OW4 A;  1PUU B;  1RG8 A;  2Z48 A;  4YOL A;  1JY0 A;  4IYB A;  1ISZ A;  2NZ9 A;  4ZFY B;  5FNW A;  3V0B B;  3WMV A;  4HR6 C;  3ZX7 A;  2BEB A;  2D43 A;  1IIL A;  1E0O A;  3CRI A;  1EVT A;  2MC2 A;  1DLL A;  3BB2 A;  8I1B A;  3B9U A;  2ET2 A;  2DRE A;  3O4A A;  4QBC A;  3CRH A;  1YF8 B;  5FZZ A;  4P0K A;  4JP0 A;  4XFS A;  4G9N A;  4Z8S B;  3AKG A;  3V0A A;  1NZK A;  1TWM A;  4Q9G A;  5BVP I;  2KKI A;  4XFT A;  1BFC A;  5F90 A;  3FJF A;  2BEA A;  4LO2 C;  1TWE A;  3H6S E;  5BXR A;  4LO8 B;  1BFB A;  1WBA A;  2GZB A;  5EHA A;  2F2F C;  2MLL B;  3BAO A;  1ONK B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...