3O4CA

Crystal structure of symfoil-4v: de novo designed beta-trefoil architecture with symmetric primary structure
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
124
structure length
124
Chain Sequence
PVLLKSTETGQYLRINPDGTVDGTRDRSDVHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDVHIQFQISPEGNGEVLLKSTETGQYLRINPDGTVDGTRDRSDVHIQFQISPEG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords de novo designed beta-trefoil architecture with symmetric pr
publication title Experimental support for the evolution of symmetric protein architecture from a simple peptide motif.
pubmed doi rcsb
source organism Synthetic construct
molecule tags De novo protein
total genus 34
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2010-07-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3o4cA00
1DFCA 2ZQOA 1Z2VA 3O4AA 5FNXA 3ZX7A 4ZA3B 21BIA 1V6XA 2KI4A 5BXRA 1GGPB 3V0BA 3O5WB 4XFTA 3ZXGA 1DLLA 3FJAA 2DS0A 4I0YA 3CU1B 3O4BA 1D0HA 3IM7A 4OEEA 4JAWA 8I1BA 2NTDA 3P6IA 4AN6A 2I1BA 4L4IA 4J2KA 1BLAA 1V6WA 1S0CA 2MC2A 3O4DA 1TP0A 4ISQA 1ONKB 2F8XC 4X38A 4GOVA 1S0LA 2RG9B 3PUBA 4GOYA 1P63A 4LO7C 3FJEA 2M49A 1DJSB 3BAHA 3LLPA 4ZOTA 1WD4A 4II0A 3H6RB 1BFCA 1DQOA 3HN1A 5JLVA 4GP0A 1CE7B 1BFBA 3VUOA 5DVHA 2DRYA 1RZOB 4IY9A 1ISVA 3A22A 3H6SE 4H9WA 4P0KA 3VT2A 3I29B 3UJ0A 1YTOA 5F8SA 3BX1C 3K1XA 5FZYA 3FFZA 1DZDA 4A7ZA 2DRZA 4HR6C 4JKXB 2X2SA 1PUUB 2FGFA 3IM5A 4I7IA 4OUJA 4R6UB 1WBCA 2Y9WC 3CA6A 3AKHA 5FZZA 1HWPB 3AKGA 3VSFA 1G9BA 1DFQA 3H6RA 4ENDA 4JQ0A 5BVPI 3HBWA 1FWUA 4I3NA 3RSJA 4LO2A 1K5UA 2NYYA 4F34A 1YF8B 2LIQA 4Z9WB 4I37A 4KC3A 3CAHA 1S0EA 1RMLA 1HWNB 3IIRA 1V6UA 2P39A 4OWKA 3OBRA 2HW9A 3O49A 1TWMA 4QKSA 1JY0A 3AZVA 4P6AA 3W9TA 2D23A 3Q7WA 3OBTA 1SR4A 4LO1C 3FJDA 4J23B 2E4MA 2F2FA 1DQGA 2AAIB 1AF9A 4J2YA 2GZBA 4P0LA 3TC2A 1JT5A 2L5XA 3BADA 3CA4A 2YUGA 1BFGA 2KH2A 5EG6C 1HCEA 2WRYA 3CQAA 4A7YA 3CA1A 1V6VA 4LO3C 3WO3A 1TFMB 3FJJA 5BXTA 2HWMA 3AJ6A 1I1EA 3A21A 3Q7XA 3E8LC 4D0TA 1UPSA 4EFRA 1FMMS 4XFUA 4X39A 3FJKA 3O4OA 4G9NA 1R8NA 2Q9XA 3HOMA 4KEJA 1E0OA 1SZ6B 1EVTA 2IHOA 4OEFA 2VU9A 3O4CA 1RG8A 4I4RA 1S0GA 1R8OA 4I4SA 4QKRA 3N7JA 3WINC 3O44A 2NZ9A 1G9DA 1ABRB 3CRHA 4G9MA 2WBCA 4FVVA 5JMCA 5D63A 3UD7A 2VXRA 5E24E 1TTUA 2BEAA 4LO7B 4IQPA 2ZR1B 1JT3A 3S8JA 1BFFA 3MALA 1IJTA 3A07A 3NBCA 1TIEA 4Q91A 1YXWA 3F1RA 3P53A 1F31A 3BTAA 2QN4A 3N7LA 4TLPA 3Q7YA 3FJFA 3RTJB 4AN7B 3H6QA 5DSSB 1N4KA 4QBCA 1IHKA 3AKFA 4F83A 3HALA 3OGGA 4I4UA 2D20A 2XOAA 3UDAA 3VT0A 3S8KA 1HIBA 1W3FA 3POKA 4HA2A 1MD6A 4I6IA 2NVHA 1JLXA 4I4PA 2J3PA 4GAFA 3NBDA 3LTQA 5EHAA 3FUQA 3FJIA 2RQ9A 1Q03A 3BA7A 31BIA 3N7KA 1ISYA 3HSMA 5HPZA 2MIBA 4IYBA 5BXSA 1Z0HA 1G9AA 2KLLA 4QO3A 5EC5A 1EYLA 4IHZA 3RMXA 4USOA 3RTIB 3ZC8A 2FDBM 3BAVA 5DUYA 2X2TA 2NM1A 2VSAA 1FMZA 1FGAA 1AVXB 2K43A 1CVSA 4J2XA 3ZXDA 3I2AA 2HZ9A 3PMEA 1I1BA 3EF2A 2Z48A 3R4SA 3WO2A 2KI6B 3N7MA 4I4VA 1A8DA 1S0FA 3SNVA 1VCLA 4ZFWB 3VT1A 1ISXA 4I4YA 1OQLB 1WBAA 1M16A 4ZFUB 3CA0A 4USPA 3OGFA 1JT7A 4DENA 1EV2A 2BFHA 2K8RA 2VUAA 1YBIA 4I8MA 3PG0A 3FJBA 4OWJA 2RSTA 3V0AB 3FGMA 2AXMA 1XYFA 1M2TB 2DREA 4X37A 3VEQA 5BQUC 1DIWA 1ILR1 3B9UA 3BAQA 1XZZA 2QYIB 4I4OA 4D0ZA 3BA4A 4LO1A 3KMVA 3WMVA 3O3QA 1IILA 3AJ5A 2AQZA 2FO1A 1PUMB 5G00A 2VLCA 5BP5C 7I1BA 3ILAA 2D7RA 3WMUA 1IRAX 4LO8B 4LO0C 3BB2A 1MC9A 3V0AA 4HJJA 4LO3A 5DZUA 1IOBA 3BA5A 2FFUA 5F8YA 3AH1A 2K4AB 3T8SA 3R4UA 2Q3NB 1HCDA 3AKIA 4ZKTB 2MLLB 3CA3A 4IY8A 2ESUA 4I2SA 3AH4A 4QC4A 2IWTB 3VWCA 1S0BA 2D43A 1QQLA 1ISWA 3WINA 4CJMA 3HMYA 1NZKA 4QBVA 1G82A 3FJ8A 4EB2B 1FQ9A 3BAOA 3C9ZA 1AXMA 3FUOA 1AVWB 4QD2C 4IZEA 1Z4SA 4G6JA 4I96A 4L4HA 4H04A 1Q04A 4IZXA 4D8HA 2R9KB 2Y9GA 3JUTA 3JRRA 4GAIA 1AVAC 2GO2A 4EKXB 2VSEA 1AVUA 1QQKA 2FFVA 1W3AA 4IONA 1RY7A 3RMYA 1HWOB 2Z49A 3BRDA 3N0KA 4Q9GA 5I1BA 1W3GA 5F8WA 1HKNA 2LIEA 4GP3A 4ZFYB 2ZQNA 3FJHA 3FJCA 2VXTI 5FNWA 1XG6A 5B2HA 1PZZA 4FGFA 4ZLBB 3PHZA 3CRIA 3BRGC 1PC8B 3I2XA 5BOWA 6I1BA 4ZBVB 5GAQA 4KBBA 2KKIA 1J0SA 1K5VA 3QR5A 4G1RA 4ISRA 1PWAA 2ERMA 1XHBA 4X3AA 1L2HA 1KNMA 1TWEA 2HWAA 1Q1UA 3UD9A 4I1EA 4I4QA 1BASA 5F90A 4P0JA 4OEGA 4Z8SB 4EEEB 4ZGRB 1ISZA 3CRGA 1HWMB 2D22A 1JLYA 5FZUA 1II4A 4G6MA 4OW4A 2P23A 4PC4A 5D61A 1BLDA 1FV2A 1TOOA 4JKQA 1T9FA 2D24A 3WO4A 4JP0A 4EFQA 5BQUA 1NUNA 1JT4A 4LO2C 2UUSA 2Y9XE 3QYDA 1IT0A 1ITBA 4I1BA 4Q9PA 4WBCA 1FWVA 1T4QA 2D44A 1QXMA 4OWLA 1DZCA 4EFPA 2NP0A 5BP5A 1WD3A 3F62B 4XFSA 3AZWA 3OJMA 3AH2A 4A7KA 2BEBA 1JQZA 4XKIA 3MPPG 3CA5A 3BAUA 1SR4C 1BARA 4I4XA 4LO0A 2E4MC 2F2FC 4JRAA 3V79C 4KEKA 4QD2B 1G9CA 3OJVA 1JTCA 1IRPA 2D7IA 1BA7A 2AFGA 4DEPA 3WA1A 3V0BB 1FV3A 1YYNA 4J2SA 2D1ZA 41BIA 1S0DA 1FN0A 3NBEA 3IM6A 5D62A 3BAGA 3BRFA 3FJ9A 5BXPA 3UJ4A 4KEIA 3VSZA 1AFCA 9ILBA 2Y9FA 3P6JA 4QALA 4YOLA 3A23A 3UD8A 3NJ5A 2ET2A 3ZC9A 3D7WB 3OJ2A 4DCKC 4JPZA 3IAGC 1EPWA 3NBNA
chains in the Genus database with same CATH superfamily
1DFCA 2ZQOA 1Z2VA 3O4AA 5FNXA 3ZX7A 4ZA3B 21BIA 1V6XA 2KI4A 5BXRA 1GGPB 3V0BA 3O5WB 4XFTA 3ZXGA 1DLLA 3FJAA 2DS0A 4I0YA 3CU1B 3O4BA 1D0HA 3IM7A 4OEEA 4JAWA 8I1BA 2NTDA 3P6IA 4AN6A 2I1BA 4L4IA 4J2KA 1BLAA 1V6WA 1S0CA 2MC2A 3O4DA 1TP0A 4ISQA 1ONKB 4MZHA 2F8XC 4X38A 4GOVA 1S0LA 2RG9B 3PUBA 4GOYA 1P63A 4LO7C 3FJEA 2M49A 1DJSB 3BAHA 3LLPA 4ZOTA 1WD4A 4II0A 3H6RB 1BFCA 1DQOA 3HN1A 5JLVA 4GP0A 1CE7B 1BFBA 3VUOA 5DVHA 2DRYA 1RZOB 4IY9A 1ISVA 3A22A 3H6SE 4H9WA 4P0KA 3VT2A 3I29B 3UJ0A 1YTOA 5F8SA 3BX1C 3K1XA 5FZYA 3FFZA 1DZDA 4A7ZA 2DRZA 4HR6C 4JKXB 2X2SA 1PUUB 2FGFA 3IM5A 4I7IA 4OUJA 4R6UB 1WBCA 2Y9WC 3CA6A 3AKHA 5FZZA 1HWPB 3AKGA 3VSFA 1G9BA 1DFQA 3H6RA 4ENDA 4JQ0A 5BVPI 3HBWA 2NS2A 1FWUA 4I3NA 3RSJA 4LO2A 1K5UA 2NYYA 4F34A 1YF8B 2LIQA 4Z9WB 4I37A 4KC3A 3CAHA 1S0EA 1RMLA 1HWNB 3IIRA 1V6UA 2P39A 4OWKA 3OBRA 2HW9A 3O49A 1TWMA 4QKSA 1JY0A 3AZVA 4P6AA 3W9TA 2D23A 3Q7WA 3OBTA 1SR4A 4LO1C 3FJDA 4J23B 2E4MA 2F2FA 1DQGA 2AAIB 1AF9A 4J2YA 2GZBA 4P0LA 3TC2A 1JT5A 2L5XA 3BADA 3CA4A 2YUGA 4MZGB 1BFGA 2KH2A 5EG6C 1HCEA 2WRYA 3CQAA 4A7YA 3CA1A 1V6VA 4LO3C 3WO3A 1TFMB 3FJJA 5BXTA 2HWMA 3AJ6A 1I1EA 3A21A 3Q7XA 3E8LC 4D0TA 1UPSA 4EFRA 1FMMS 4XFUA 4X39A 3FJKA 3O4OA 4G9NA 1R8NA 2Q9XA 3HOMA 4KEJA 1E0OA 1SZ6B 1EVTA 2IHOA 4OEFA 2VU9A 3O4CA 1RG8A 4I4RA 1S0GA 1R8OA 4I4SA 4QKRA 3N7JA 3WINC 3O44A 2NZ9A 1G9DA 1ABRB 3CRHA 4G9MA 2WBCA 4FVVA 5JMCA 5D63A 3UD7A 2VXRA 5E24E 1TTUA 2BEAA 4LO7B 4IQPA 2ZR1B 1JT3A 3S8JA 1BFFA 3MALA 1IJTA 3A07A 3NBCA 1TIEA 4Q91A 1YXWA 3F1RA 3P53A 1F31A 3BTAA 2QN4A 3N7LA 4TLPA 3Q7YA 3FJFA 3RTJB 4AN7B 3H6QA 5DSSB 1N4KA 4QBCA 1IHKA 3AKFA 4F83A 3HALA 3OGGA 4I4UA 2D20A 2XOAA 3UDAA 3VT0A 3S8KA 1HIBA 1W3FA 3POKA 4HA2A 1MD6A 4I6IA 2NVHA 1JLXA 4I4PA 2J3PA 4GAFA 4H75A 3NBDA 3LTQA 5EHAA 3FUQA 3FJIA 2RQ9A 1Q03A 3BA7A 31BIA 3N7KA 1ISYA 3HSMA 5HPZA 2MIBA 4IYBA 5BXSA 1Z0HA 1G9AA 2KLLA 4QO3A 5EC5A 1EYLA 4IHZA 3RMXA 4USOA 3RTIB 3ZC8A 2FDBM 3BAVA 5DUYA 2X2TA 2NM1A 2VSAA 1FMZA 1FGAA 1AVXB 2K43A 1CVSA 4J2XA 3ZXDA 3I2AA 2HZ9A 3PMEA 1I1BA 3EF2A 2Z48A 3R4SA 3WO2A 2KI6B 3N7MA 4I4VA 1A8DA 1S0FA 3SNVA 1VCLA 4ZFWB 3VT1A 1ISXA 4I4YA 1OQLB 1WBAA 1M16A 4ZFUB 3CA0A 4USPA 3OGFA 1JT7A 4DENA 1EV2A 2BFHA 2K8RA 2VUAA 1YBIA 4I8MA 3PG0A 3FJBA 4OWJA 2RSTA 3V0AB 3FGMA 2AXMA 1XYFA 1M2TB 2DREA 4X37A 3VEQA 5BQUC 1DIWA 1ILR1 3B9UA 3BAQA 1XZZA 2QYIB 4I4OA 4D0ZA 3BA4A 4LO1A 3KMVA 3WMVA 3O3QA 1IILA 3AJ5A 2AQZA 2FO1A 1PUMB 5G00A 2VLCA 5BP5C 7I1BA 3ILAA 2D7RA 3WMUA 1IRAX 4LO8B 4LO0C 3BB2A 1MC9A 3V0AA 4HJJA 4LO3A 5DZUA 1IOBA 3BA5A 2FFUA 5F8YA 3AH1A 2K4AB 3T8SA 3R4UA 2Q3NB 1HCDA 3AKIA 4ZKTB 2MLLB 3CA3A 4IY8A 2ESUA 4I2SA 3AH4A 4QC4A 2IWTB 3VWCA 1S0BA 2D43A 1QQLA 1ISWA 3WINA 4CJMA 3HMYA 1NZKA 4QBVA 1G82A 3FJ8A 4EB2B 1FQ9A 3BAOA 3C9ZA 1AXMA 3FUOA 1AVWB 4QD2C 4IZEA 1Z4SA 4G6JA 4I96A 4L4HA 4H04A 1Q04A 4IZXA 4D8HA 2R9KB 2Y9GA 3JUTA 3JRRA 4GAIA 1AVAC 2GO2A 4EKXB 2VSEA 1AVUA 1QQKA 2FFVA 1W3AA 4IONA 1RY7A 3RMYA 1HWOB 2Z49A 3BRDA 3N0KA 4Q9GA 5I1BA 1W3GA 5F8WA 1HKNA 2LIEA 4GP3A 4ZFYB 2ZQNA 3FJHA 3FJCA 2VXTI 5FNWA 1XG6A 5B2HA 1PZZA 4FGFA 4ZLBB 3PHZA 3CRIA 3BRGC 1PC8B 3I2XA 5BOWA 6I1BA 4ZBVB 5GAQA 4KBBA 2KKIA 4UY4A 1J0SA 1K5VA 3QR5A 4G1RA 4ISRA 1PWAA 2ERMA 1XHBA 4X3AA 1L2HA 1KNMA 1TWEA 2HWAA 1Q1UA 3UD9A 4I1EA 4I4QA 1BASA 5F90A 4P0JA 4OEGA 4Z8SB 4EEEB 4ZGRB 1ISZA 3CRGA 1HWMB 2D22A 1JLYA 5FZUA 1II4A 4G6MA 4OW4A 2P23A 4PC4A 5D61A 1BLDA 1FV2A 1TOOA 4JKQA 1T9FA 2D24A 3WO4A 4JP0A 4EFQA 5BQUA 1NUNA 1JT4A 4LO2C 2UUSA 2Y9XE 3QYDA 1IT0A 1ITBA 4I1BA 4Q9PA 4WBCA 1FWVA 1T4QA 2D44A 1QXMA 4OWLA 1DZCA 4EFPA 2NP0A 5BP5A 1WD3A 3F62B 4XFSA 3AZWA 3OJMA 3AH2A 4A7KA 2BEBA 1JQZA 4XKIA 3MPPG 3CA5A 3BAUA 1SR4C 1BARA 4I4XA 4LO0A 2E4MC 2F2FC 4JRAA 3V79C 4KEKA 4QD2B 1G9CA 3OJVA 1JTCA 1IRPA 2D7IA 1BA7A 2AFGA 4DEPA 3WA1A 3V0BB 1FV3A 1YYNA 4J2SA 2D1ZA 41BIA 1S0DA 1FN0A 3NBEA 3IM6A 5D62A 3BAGA 3BRFA 3FJ9A 5BXPA 3UJ4A 4KEIA 3VSZA 1AFCA 9ILBA 2Y9FA 3P6JA 4QALA 4YOLA 3A23A 3UD8A 3NJ5A 2ET2A 3ZC9A 3D7WB 4MZFB 3OJ2A 4DCKC 4JPZA 3IAGC 1EPWA 3NBNA
chains in the Genus database with same CATH topology
1DFCA 2ZQOA 1Z2VA 3O4AA 5FNXA 3ZX7A 4ZA3B 21BIA 1V6XA 2KI4A 5BXRA 1GGPB 3V0BA 3O5WB 4XFTA 3ZXGA 1DLLA 3FJAA 2DS0A 4I0YA 3CU1B 3O4BA 1D0HA 3IM7A 4OEEA 4JAWA 8I1BA 2NTDA 3P6IA 4AN6A 2I1BA 4L4IA 4J2KA 1BLAA 1V6WA 1S0CA 2MC2A 3O4DA 1TP0A 4ISQA 1ONKB 4MZHA 2F8XC 4X38A 4GOVA 1S0LA 2RG9B 3PUBA 4GOYA 1P63A 4LO7C 3FJEA 2M49A 1DJSB 3BAHA 3LLPA 4ZOTA 1WD4A 4II0A 3H6RB 1BFCA 1DQOA 3HN1A 5JLVA 4GP0A 1CE7B 1BFBA 3VUOA 5DVHA 2DRYA 1RZOB 4IY9A 1ISVA 3A22A 3H6SE 4H9WA 4P0KA 3VT2A 3I29B 3UJ0A 1YTOA 5F8SA 3BX1C 3K1XA 5FZYA 3FFZA 1DZDA 4A7ZA 2DRZA 4HR6C 4JKXB 2X2SA 1PUUB 2FGFA 3IM5A 4I7IA 4OUJA 4R6UB 1WBCA 2Y9WC 3CA6A 3AKHA 5FZZA 1HWPB 3AKGA 3VSFA 1G9BA 1DFQA 3H6RA 4ENDA 4JQ0A 5BVPI 3HBWA 2NS2A 1FWUA 4I3NA 3RSJA 4LO2A 1K5UA 2NYYA 4F34A 1YF8B 2LIQA 4Z9WB 4I37A 4KC3A 3CAHA 1S0EA 1RMLA 1HWNB 3IIRA 1V6UA 2P39A 4OWKA 3OBRA 2HW9A 3O49A 1TWMA 4QKSA 1JY0A 3AZVA 4P6AA 3W9TA 2D23A 3Q7WA 3OBTA 1SR4A 4LO1C 3FJDA 4J23B 2E4MA 2F2FA 1DQGA 2AAIB 1AF9A 4J2YA 2GZBA 4P0LA 3TC2A 1JT5A 2L5XA 3BADA 3CA4A 2YUGA 4MZGB 1BFGA 2KH2A 5EG6C 1HCEA 2WRYA 3CQAA 4A7YA 3CA1A 1V6VA 4LO3C 3WO3A 1TFMB 3FJJA 5BXTA 2HWMA 3AJ6A 1I1EA 3A21A 3Q7XA 3E8LC 4D0TA 1UPSA 4EFRA 1FMMS 4XFUA 4X39A 3FJKA 3O4OA 4G9NA 1R8NA 2Q9XA 3HOMA 4KEJA 1E0OA 1SZ6B 1EVTA 2IHOA 4OEFA 2VU9A 3O4CA 1RG8A 4I4RA 1S0GA 1R8OA 4I4SA 4QKRA 3N7JA 3WINC 3O44A 2NZ9A 1G9DA 1ABRB 3CRHA 4G9MA 2WBCA 4FVVA 5JMCA 5D63A 3UD7A 2VXRA 5E24E 1TTUA 2BEAA 4LO7B 4IQPA 2ZR1B 1JT3A 3S8JA 1BFFA 3MALA 1IJTA 3A07A 3NBCA 1TIEA 4Q91A 1YXWA 3F1RA 3P53A 1F31A 3BTAA 2QN4A 3N7LA 4TLPA 3Q7YA 3FJFA 3RTJB 4AN7B 3H6QA 5DSSB 1N4KA 4QBCA 1IHKA 3AKFA 4F83A 3HALA 3OGGA 4I4UA 2D20A 2XOAA 3UDAA 3VT0A 3S8KA 1HIBA 1W3FA 3POKA 4HA2A 1MD6A 4I6IA 2NVHA 1JLXA 4I4PA 2J3PA 4GAFA 4H75A 3NBDA 3LTQA 5EHAA 3FUQA 3FJIA 2RQ9A 1Q03A 3BA7A 31BIA 3N7KA 1ISYA 3HSMA 5HPZA 2MIBA 4IYBA 5BXSA 1Z0HA 1G9AA 2KLLA 4QO3A 5EC5A 1EYLA 4IHZA 3RMXA 4USOA 3RTIB 3ZC8A 2FDBM 3BAVA 5DUYA 2X2TA 2NM1A 2VSAA 1FMZA 1FGAA 1AVXB 2K43A 1CVSA 4J2XA 3ZXDA 3I2AA 2HZ9A 3PMEA 1I1BA 3EF2A 2Z48A 3R4SA 3WO2A 2KI6B 3N7MA 4I4VA 1A8DA 1S0FA 3SNVA 1VCLA 4ZFWB 3VT1A 1ISXA 4I4YA 1OQLB 1WBAA 1M16A 4ZFUB 3CA0A 4USPA 3OGFA 1JT7A 4DENA 1EV2A 2BFHA 2K8RA 2VUAA 1YBIA 4I8MA 3PG0A 3FJBA 4OWJA 2RSTA 3V0AB 3FGMA 2AXMA 1XYFA 1M2TB 2DREA 4X37A 3VEQA 5BQUC 1DIWA 1ILR1 3B9UA 3BAQA 1XZZA 2QYIB 4I4OA 4D0ZA 3BA4A 4LO1A 3KMVA 3WMVA 3O3QA 1IILA 3AJ5A 2AQZA 2FO1A 1PUMB 5G00A 2VLCA 5BP5C 7I1BA 3ILAA 2D7RA 3WMUA 1IRAX 4LO8B 4LO0C 3BB2A 1MC9A 3V0AA 4HJJA 4LO3A 5DZUA 1IOBA 3BA5A 2FFUA 5F8YA 3AH1A 2K4AB 3T8SA 3R4UA 2Q3NB 1HCDA 3AKIA 4ZKTB 2MLLB 3CA3A 4IY8A 2ESUA 4I2SA 3AH4A 4QC4A 2IWTB 3VWCA 1S0BA 2D43A 1QQLA 1ISWA 3WINA 4CJMA 3HMYA 1NZKA 4QBVA 1G82A 3FJ8A 4EB2B 1FQ9A 3BAOA 3C9ZA 1AXMA 3FUOA 1AVWB 4QD2C 4IZEA 1Z4SA 4G6JA 4I96A 4L4HA 4H04A 1Q04A 4IZXA 4D8HA 2R9KB 2Y9GA 3JUTA 3JRRA 4GAIA 1AVAC 2GO2A 4EKXB 2VSEA 1AVUA 1QQKA 2FFVA 1W3AA 4IONA 1RY7A 3RMYA 1HWOB 2Z49A 3BRDA 3N0KA 4Q9GA 5I1BA 1W3GA 5F8WA 1HKNA 2LIEA 4GP3A 4ZFYB 2ZQNA 3FJHA 3FJCA 2VXTI 5FNWA 1XG6A 5B2HA 1PZZA 4FGFA 4ZLBB 3PHZA 3CRIA 3BRGC 1PC8B 3I2XA 5BOWA 6I1BA 4ZBVB 5GAQA 4KBBA 2KKIA 4UY4A 1J0SA 1K5VA 3QR5A 4G1RA 4ISRA 1PWAA 2ERMA 1XHBA 4X3AA 1L2HA 1KNMA 1TWEA 2HWAA 1Q1UA 3UD9A 4I1EA 4I4QA 1BASA 5F90A 4P0JA 4OEGA 4Z8SB 4EEEB 4ZGRB 1ISZA 3CRGA 1HWMB 2D22A 1JLYA 5FZUA 1II4A 4G6MA 4OW4A 2P23A 4PC4A 5D61A 1BLDA 1FV2A 1TOOA 4JKQA 1T9FA 2D24A 3WO4A 4JP0A 4EFQA 5BQUA 1NUNA 1JT4A 4LO2C 2UUSA 2Y9XE 3QYDA 1IT0A 1ITBA 4I1BA 4Q9PA 4WBCA 1FWVA 1T4QA 2D44A 1QXMA 4OWLA 1DZCA 4EFPA 2NP0A 5BP5A 1WD3A 3F62B 4XFSA 3AZWA 3OJMA 3AH2A 4A7KA 2BEBA 1JQZA 4XKIA 3MPPG 3CA5A 3BAUA 1SR4C 1BARA 4I4XA 4LO0A 2E4MC 2F2FC 4JRAA 3V79C 4KEKA 4QD2B 1G9CA 3OJVA 1JTCA 1IRPA 2D7IA 1BA7A 2AFGA 4DEPA 3WA1A 3V0BB 1FV3A 1YYNA 4J2SA 2D1ZA 41BIA 1S0DA 1FN0A 3NBEA 3IM6A 5D62A 3BAGA 3BRFA 3FJ9A 5BXPA 3UJ4A 4KEIA 3VSZA 1AFCA 9ILBA 2Y9FA 3P6JA 4QALA 4YOLA 3A23A 3UD8A 3NJ5A 2ET2A 3ZC9A 3D7WB 4MZFB 3OJ2A 4DCKC 4JPZA 3IAGC 1EPWA 3NBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DFC A;  2ZQO A;  1Z2V A;  3O4A A;  5FNX A;  3ZX7 A;  4ZA3 B;  21BI A;  1V6X A;  2KI4 A;  5BXR A;  1GGP B;  3V0B A;  3O5W B;  4XFT A;  3ZXG A;  1DLL A;  3FJA A;  2DS0 A;  4I0Y A;  3CU1 B;  3O4B A;  1D0H A;  3IM7 A;  4OEE A;  4JAW A;  8I1B A;  2NTD A;  3P6I A;  4AN6 A;  2I1B A;  4L4I A;  4J2K A;  1BLA A;  1V6W A;  1S0C A;  2MC2 A;  3O4D A;  1TP0 A;  4ISQ A;  1ONK B;  2F8X C;  4X38 A;  4GOV A;  1S0L A;  2RG9 B;  3PUB A;  4GOY A;  1P63 A;  4LO7 C;  3FJE A;  2M49 A;  1DJS B;  3BAH A;  3LLP A;  4ZOT A;  1WD4 A;  4II0 A;  3H6R B;  1BFC A;  1DQO A;  3HN1 A;  5JLV A;  4GP0 A;  1CE7 B;  1BFB A;  3VUO A;  5DVH A;  2DRY A;  1RZO B;  4IY9 A;  1ISV A;  3A22 A;  3H6S E;  4H9W A;  4P0K A;  3VT2 A;  3I29 B;  3UJ0 A;  1YTO A;  5F8S A;  3BX1 C;  3K1X A;  5FZY A;  3FFZ A;  1DZD A;  4A7Z A;  2DRZ A;  4HR6 C;  4JKX B;  2X2S A;  1PUU B;  2FGF A;  3IM5 A;  4I7I A;  4OUJ A;  4R6U B;  1WBC A;  2Y9W C;  3CA6 A;  3AKH A;  5FZZ A;  1HWP B;  3AKG A;  3VSF A;  1G9B A;  1DFQ A;  3H6R A;  4END A;  4JQ0 A;  5BVP I;  3HBW A;  1FWU A;  4I3N A;  3RSJ A;  4LO2 A;  1K5U A;  2NYY A;  4F34 A;  1YF8 B;  2LIQ A;  4Z9W B;  4I37 A;  4KC3 A;  3CAH A;  1S0E A;  1RML A;  1HWN B;  3IIR A;  1V6U A;  2P39 A;  4OWK A;  3OBR A;  2HW9 A;  3O49 A;  1TWM A;  4QKS A;  1JY0 A;  3AZV A;  4P6A A;  3W9T A;  2D23 A;  3Q7W A;  3OBT A;  1SR4 A;  4LO1 C;  3FJD A;  4J23 B;  2E4M A;  2F2F A;  1DQG A;  2AAI B;  1AF9 A;  4J2Y A;  2GZB A;  4P0L A;  3TC2 A;  1JT5 A;  2L5X A;  3BAD A;  3CA4 A;  2YUG A;  1BFG A;  2KH2 A;  5EG6 C;  1HCE A;  2WRY A;  3CQA A;  4A7Y A;  3CA1 A;  1V6V A;  4LO3 C;  3WO3 A;  1TFM B;  3FJJ A;  5BXT A;  2HWM A;  3AJ6 A;  1I1E A;  3A21 A;  3Q7X A;  3E8L C;  4D0T A;  1UPS A;  4EFR A;  1FMM S;  4XFU A;  4X39 A;  3FJK A;  3O4O A;  4G9N A;  1R8N A;  2Q9X A;  3HOM A;  4KEJ A;  1E0O A;  1SZ6 B;  1EVT A;  2IHO A;  4OEF A;  2VU9 A;  3O4C A;  1RG8 A;  4I4R A;  1S0G A;  1R8O A;  4I4S A;  4QKR A;  3N7J A;  3WIN C;  3O44 A;  2NZ9 A;  1G9D A;  1ABR B;  3CRH A;  4G9M A;  2WBC A;  4FVV A;  5JMC A;  5D63 A;  3UD7 A;  2VXR A;  5E24 E;  1TTU A;  2BEA A;  4LO7 B;  4IQP A;  2ZR1 B;  1JT3 A;  3S8J A;  1BFF A;  3MAL A;  1IJT A;  3A07 A;  3NBC A;  1TIE A;  4Q91 A;  1YXW A;  3F1R A;  3P53 A;  1F31 A;  3BTA A;  2QN4 A;  3N7L A;  4TLP A;  3Q7Y A;  3FJF A;  3RTJ B;  4AN7 B;  3H6Q A;  5DSS B;  1N4K A;  4QBC A;  1IHK A;  3AKF A;  4F83 A;  3HAL A;  3OGG A;  4I4U A;  2D20 A;  2XOA A;  3UDA A;  3VT0 A;  3S8K A;  1HIB A;  1W3F A;  3POK A;  4HA2 A;  1MD6 A;  4I6I A;  2NVH A;  1JLX A;  4I4P A;  2J3P A;  4GAF A;  3NBD A;  3LTQ A;  5EHA A;  3FUQ A;  3FJI A;  2RQ9 A;  1Q03 A;  3BA7 A;  31BI A;  3N7K A;  1ISY A;  3HSM A;  5HPZ A;  2MIB A;  4IYB A;  5BXS A;  1Z0H A;  1G9A A;  2KLL A;  4QO3 A;  5EC5 A;  1EYL A;  4IHZ A;  3RMX A;  4USO A;  3RTI B;  3ZC8 A;  2FDB M;  3BAV A;  5DUY A;  2X2T A;  2NM1 A;  2VSA A;  1FMZ A;  1FGA A;  1AVX B;  2K43 A;  1CVS A;  4J2X A;  3ZXD A;  3I2A A;  2HZ9 A;  3PME A;  1I1B A;  3EF2 A;  2Z48 A;  3R4S A;  3WO2 A;  2KI6 B;  3N7M A;  4I4V A;  1A8D A;  1S0F A;  3SNV A;  1VCL A;  4ZFW B;  3VT1 A;  1ISX A;  4I4Y A;  1OQL B;  1WBA A;  1M16 A;  4ZFU B;  3CA0 A;  4USP A;  3OGF A;  1JT7 A;  4DEN A;  1EV2 A;  2BFH A;  2K8R A;  2VUA A;  1YBI A;  4I8M A;  3PG0 A;  3FJB A;  4OWJ A;  2RST A;  3V0A B;  3FGM A;  2AXM A;  1XYF A;  1M2T B;  2DRE A;  4X37 A;  3VEQ A;  5BQU C;  1DIW A;  1ILR 1;  3B9U A;  3BAQ A;  1XZZ A;  2QYI B;  4I4O A;  4D0Z A;  3BA4 A;  4LO1 A;  3KMV A;  3WMV A;  3O3Q A;  1IIL A;  3AJ5 A;  2AQZ A;  2FO1 A;  1PUM B;  5G00 A;  2VLC A;  5BP5 C;  7I1B A;  3ILA A;  2D7R A;  3WMU A;  1IRA X;  4LO8 B;  4LO0 C;  3BB2 A;  1MC9 A;  3V0A A;  4HJJ A;  4LO3 A;  5DZU A;  1IOB A;  3BA5 A;  2FFU A;  5F8Y A;  3AH1 A;  2K4A B;  3T8S A;  3R4U A;  2Q3N B;  1HCD A;  3AKI A;  4ZKT B;  2MLL B;  3CA3 A;  4IY8 A;  2ESU A;  4I2S A;  3AH4 A;  4QC4 A;  2IWT B;  3VWC A;  1S0B A;  2D43 A;  1QQL A;  1ISW A;  3WIN A;  4CJM A;  3HMY A;  1NZK A;  4QBV A;  1G82 A;  3FJ8 A;  4EB2 B;  1FQ9 A;  3BAO A;  3C9Z A;  1AXM A;  3FUO A;  1AVW B;  4QD2 C;  4IZE A;  1Z4S A;  4G6J A;  4I96 A;  4L4H A;  4H04 A;  1Q04 A;  4IZX A;  4D8H A;  2R9K B;  2Y9G A;  3JUT A;  3JRR A;  4GAI A;  1AVA C;  2GO2 A;  4EKX B;  2VSE A;  1AVU A;  1QQK A;  2FFV A;  1W3A A;  4ION A;  1RY7 A;  3RMY A;  1HWO B;  2Z49 A;  3BRD A;  3N0K A;  4Q9G A;  5I1B A;  1W3G A;  5F8W A;  1HKN A;  2LIE A;  4GP3 A;  4ZFY B;  2ZQN A;  3FJH A;  3FJC A;  2VXT I;  5FNW A;  1XG6 A;  5B2H A;  1PZZ A;  4FGF A;  4ZLB B;  3PHZ A;  3CRI A;  3BRG C;  1PC8 B;  3I2X A;  5BOW A;  6I1B A;  4ZBV B;  5GAQ A;  4KBB A;  2KKI A;  1J0S A;  1K5V A;  3QR5 A;  4G1R A;  4ISR A;  1PWA A;  2ERM A;  1XHB A;  4X3A A;  1L2H A;  1KNM A;  1TWE A;  2HWA A;  1Q1U A;  3UD9 A;  4I1E A;  4I4Q A;  1BAS A;  5F90 A;  4P0J A;  4OEG A;  4Z8S B;  4EEE B;  4ZGR B;  1ISZ A;  3CRG A;  1HWM B;  2D22 A;  1JLY A;  5FZU A;  1II4 A;  4G6M A;  4OW4 A;  2P23 A;  4PC4 A;  5D61 A;  1BLD A;  1FV2 A;  1TOO A;  4JKQ A;  1T9F A;  2D24 A;  3WO4 A;  4JP0 A;  4EFQ A;  5BQU A;  1NUN A;  1JT4 A;  4LO2 C;  2UUS A;  2Y9X E;  3QYD A;  1IT0 A;  1ITB A;  4I1B A;  4Q9P A;  4WBC A;  1FWV A;  1T4Q A;  2D44 A;  1QXM A;  4OWL A;  1DZC A;  4EFP A;  2NP0 A;  5BP5 A;  1WD3 A;  3F62 B;  4XFS A;  3AZW A;  3OJM A;  3AH2 A;  4A7K A;  2BEB A;  1JQZ A;  4XKI A;  3MPP G;  3CA5 A;  3BAU A;  1SR4 C;  1BAR A;  4I4X A;  4LO0 A;  2E4M C;  2F2F C;  4JRA A;  3V79 C;  4KEK A;  4QD2 B;  1G9C A;  3OJV A;  1JTC A;  1IRP A;  2D7I A;  1BA7 A;  2AFG A;  4DEP A;  3WA1 A;  3V0B B;  1FV3 A;  1YYN A;  4J2S A;  2D1Z A;  41BI A;  1S0D A;  1FN0 A;  3NBE A;  3IM6 A;  5D62 A;  3BAG A;  3BRF A;  3FJ9 A;  5BXP A;  3UJ4 A;  4KEI A;  3VSZ A;  1AFC A;  9ILB A;  2Y9F A;  3P6J A;  4QAL A;  4YOL A;  3A23 A;  3UD8 A;  3NJ5 A;  2ET2 A;  3ZC9 A;  3D7W B;  3OJ2 A;  4DCK C;  4JPZ A;  3IAG C;  1EPW A;  3NBN A; 
#chains in the Genus database with same CATH topology
 1DFC A;  2ZQO A;  1Z2V A;  3O4A A;  5FNX A;  3ZX7 A;  4ZA3 B;  21BI A;  1V6X A;  2KI4 A;  5BXR A;  1GGP B;  3V0B A;  3O5W B;  4XFT A;  3ZXG A;  1DLL A;  3FJA A;  2DS0 A;  4I0Y A;  3CU1 B;  3O4B A;  1D0H A;  3IM7 A;  4OEE A;  4JAW A;  8I1B A;  2NTD A;  3P6I A;  4AN6 A;  2I1B A;  4L4I A;  4J2K A;  1BLA A;  1V6W A;  1S0C A;  2MC2 A;  3O4D A;  1TP0 A;  4ISQ A;  1ONK B;  4MZH A;  2F8X C;  4X38 A;  4GOV A;  1S0L A;  2RG9 B;  3PUB A;  4GOY A;  1P63 A;  4LO7 C;  3FJE A;  2M49 A;  1DJS B;  3BAH A;  3LLP A;  4ZOT A;  1WD4 A;  4II0 A;  3H6R B;  1BFC A;  1DQO A;  3HN1 A;  5JLV A;  4GP0 A;  1CE7 B;  1BFB A;  3VUO A;  5DVH A;  2DRY A;  1RZO B;  4IY9 A;  1ISV A;  3A22 A;  3H6S E;  4H9W A;  4P0K A;  3VT2 A;  3I29 B;  3UJ0 A;  1YTO A;  5F8S A;  3BX1 C;  3K1X A;  5FZY A;  3FFZ A;  1DZD A;  4A7Z A;  2DRZ A;  4HR6 C;  4JKX B;  2X2S A;  1PUU B;  2FGF A;  3IM5 A;  4I7I A;  4OUJ A;  4R6U B;  1WBC A;  2Y9W C;  3CA6 A;  3AKH A;  5FZZ A;  1HWP B;  3AKG A;  3VSF A;  1G9B A;  1DFQ A;  3H6R A;  4END A;  4JQ0 A;  5BVP I;  3HBW A;  2NS2 A;  1FWU A;  4I3N A;  3RSJ A;  4LO2 A;  1K5U A;  2NYY A;  4F34 A;  1YF8 B;  2LIQ A;  4Z9W B;  4I37 A;  4KC3 A;  3CAH A;  1S0E A;  1RML A;  1HWN B;  3IIR A;  1V6U A;  2P39 A;  4OWK A;  3OBR A;  2HW9 A;  3O49 A;  1TWM A;  4QKS A;  1JY0 A;  3AZV A;  4P6A A;  3W9T A;  2D23 A;  3Q7W A;  3OBT A;  1SR4 A;  4LO1 C;  3FJD A;  4J23 B;  2E4M A;  2F2F A;  1DQG A;  2AAI B;  1AF9 A;  4J2Y A;  2GZB A;  4P0L A;  3TC2 A;  1JT5 A;  2L5X A;  3BAD A;  3CA4 A;  2YUG A;  4MZG B;  1BFG A;  2KH2 A;  5EG6 C;  1HCE A;  2WRY A;  3CQA A;  4A7Y A;  3CA1 A;  1V6V A;  4LO3 C;  3WO3 A;  1TFM B;  3FJJ A;  5BXT A;  2HWM A;  3AJ6 A;  1I1E A;  3A21 A;  3Q7X A;  3E8L C;  4D0T A;  1UPS A;  4EFR A;  1FMM S;  4XFU A;  4X39 A;  3FJK A;  3O4O A;  4G9N A;  1R8N A;  2Q9X A;  3HOM A;  4KEJ A;  1E0O A;  1SZ6 B;  1EVT A;  2IHO A;  4OEF A;  2VU9 A;  3O4C A;  1RG8 A;  4I4R A;  1S0G A;  1R8O A;  4I4S A;  4QKR A;  3N7J A;  3WIN C;  3O44 A;  2NZ9 A;  1G9D A;  1ABR B;  3CRH A;  4G9M A;  2WBC A;  4FVV A;  5JMC A;  5D63 A;  3UD7 A;  2VXR A;  5E24 E;  1TTU A;  2BEA A;  4LO7 B;  4IQP A;  2ZR1 B;  1JT3 A;  3S8J A;  1BFF A;  3MAL A;  1IJT A;  3A07 A;  3NBC A;  1TIE A;  4Q91 A;  1YXW A;  3F1R A;  3P53 A;  1F31 A;  3BTA A;  2QN4 A;  3N7L A;  4TLP A;  3Q7Y A;  3FJF A;  3RTJ B;  4AN7 B;  3H6Q A;  5DSS B;  1N4K A;  4QBC A;  1IHK A;  3AKF A;  4F83 A;  3HAL A;  3OGG A;  4I4U A;  2D20 A;  2XOA A;  3UDA A;  3VT0 A;  3S8K A;  1HIB A;  1W3F A;  3POK A;  4HA2 A;  1MD6 A;  4I6I A;  2NVH A;  1JLX A;  4I4P A;  2J3P A;  4GAF A;  4H75 A;  3NBD A;  3LTQ A;  5EHA A;  3FUQ A;  3FJI A;  2RQ9 A;  1Q03 A;  3BA7 A;  31BI A;  3N7K A;  1ISY A;  3HSM A;  5HPZ A;  2MIB A;  4IYB A;  5BXS A;  1Z0H A;  1G9A A;  2KLL A;  4QO3 A;  5EC5 A;  1EYL A;  4IHZ A;  3RMX A;  4USO A;  3RTI B;  3ZC8 A;  2FDB M;  3BAV A;  5DUY A;  2X2T A;  2NM1 A;  2VSA A;  1FMZ A;  1FGA A;  1AVX B;  2K43 A;  1CVS A;  4J2X A;  3ZXD A;  3I2A A;  2HZ9 A;  3PME A;  1I1B A;  3EF2 A;  2Z48 A;  3R4S A;  3WO2 A;  2KI6 B;  3N7M A;  4I4V A;  1A8D A;  1S0F A;  3SNV A;  1VCL A;  4ZFW B;  3VT1 A;  1ISX A;  4I4Y A;  1OQL B;  1WBA A;  1M16 A;  4ZFU B;  3CA0 A;  4USP A;  3OGF A;  1JT7 A;  4DEN A;  1EV2 A;  2BFH A;  2K8R A;  2VUA A;  1YBI A;  4I8M A;  3PG0 A;  3FJB A;  4OWJ A;  2RST A;  3V0A B;  3FGM A;  2AXM A;  1XYF A;  1M2T B;  2DRE A;  4X37 A;  3VEQ A;  5BQU C;  1DIW A;  1ILR 1;  3B9U A;  3BAQ A;  1XZZ A;  2QYI B;  4I4O A;  4D0Z A;  3BA4 A;  4LO1 A;  3KMV A;  3WMV A;  3O3Q A;  1IIL A;  3AJ5 A;  2AQZ A;  2FO1 A;  1PUM B;  5G00 A;  2VLC A;  5BP5 C;  7I1B A;  3ILA A;  2D7R A;  3WMU A;  1IRA X;  4LO8 B;  4LO0 C;  3BB2 A;  1MC9 A;  3V0A A;  4HJJ A;  4LO3 A;  5DZU A;  1IOB A;  3BA5 A;  2FFU A;  5F8Y A;  3AH1 A;  2K4A B;  3T8S A;  3R4U A;  2Q3N B;  1HCD A;  3AKI A;  4ZKT B;  2MLL B;  3CA3 A;  4IY8 A;  2ESU A;  4I2S A;  3AH4 A;  4QC4 A;  2IWT B;  3VWC A;  1S0B A;  2D43 A;  1QQL A;  1ISW A;  3WIN A;  4CJM A;  3HMY A;  1NZK A;  4QBV A;  1G82 A;  3FJ8 A;  4EB2 B;  1FQ9 A;  3BAO A;  3C9Z A;  1AXM A;  3FUO A;  1AVW B;  4QD2 C;  4IZE A;  1Z4S A;  4G6J A;  4I96 A;  4L4H A;  4H04 A;  1Q04 A;  4IZX A;  4D8H A;  2R9K B;  2Y9G A;  3JUT A;  3JRR A;  4GAI A;  1AVA C;  2GO2 A;  4EKX B;  2VSE A;  1AVU A;  1QQK A;  2FFV A;  1W3A A;  4ION A;  1RY7 A;  3RMY A;  1HWO B;  2Z49 A;  3BRD A;  3N0K A;  4Q9G A;  5I1B A;  1W3G A;  5F8W A;  1HKN A;  2LIE A;  4GP3 A;  4ZFY B;  2ZQN A;  3FJH A;  3FJC A;  2VXT I;  5FNW A;  1XG6 A;  5B2H A;  1PZZ A;  4FGF A;  4ZLB B;  3PHZ A;  3CRI A;  3BRG C;  1PC8 B;  3I2X A;  5BOW A;  6I1B A;  4ZBV B;  5GAQ A;  4KBB A;  2KKI A;  4UY4 A;  1J0S A;  1K5V A;  3QR5 A;  4G1R A;  4ISR A;  1PWA A;  2ERM A;  1XHB A;  4X3A A;  1L2H A;  1KNM A;  1TWE A;  2HWA A;  1Q1U A;  3UD9 A;  4I1E A;  4I4Q A;  1BAS A;  5F90 A;  4P0J A;  4OEG A;  4Z8S B;  4EEE B;  4ZGR B;  1ISZ A;  3CRG A;  1HWM B;  2D22 A;  1JLY A;  5FZU A;  1II4 A;  4G6M A;  4OW4 A;  2P23 A;  4PC4 A;  5D61 A;  1BLD A;  1FV2 A;  1TOO A;  4JKQ A;  1T9F A;  2D24 A;  3WO4 A;  4JP0 A;  4EFQ A;  5BQU A;  1NUN A;  1JT4 A;  4LO2 C;  2UUS A;  2Y9X E;  3QYD A;  1IT0 A;  1ITB A;  4I1B A;  4Q9P A;  4WBC A;  1FWV A;  1T4Q A;  2D44 A;  1QXM A;  4OWL A;  1DZC A;  4EFP A;  2NP0 A;  5BP5 A;  1WD3 A;  3F62 B;  4XFS A;  3AZW A;  3OJM A;  3AH2 A;  4A7K A;  2BEB A;  1JQZ A;  4XKI A;  3MPP G;  3CA5 A;  3BAU A;  1SR4 C;  1BAR A;  4I4X A;  4LO0 A;  2E4M C;  2F2F C;  4JRA A;  3V79 C;  4KEK A;  4QD2 B;  1G9C A;  3OJV A;  1JTC A;  1IRP A;  2D7I A;  1BA7 A;  2AFG A;  4DEP A;  3WA1 A;  3V0B B;  1FV3 A;  1YYN A;  4J2S A;  2D1Z A;  41BI A;  1S0D A;  1FN0 A;  3NBE A;  3IM6 A;  5D62 A;  3BAG A;  3BRF A;  3FJ9 A;  5BXP A;  3UJ4 A;  4KEI A;  3VSZ A;  1AFC A;  9ILB A;  2Y9F A;  3P6J A;  4QAL A;  4YOL A;  3A23 A;  3UD8 A;  3NJ5 A;  2ET2 A;  3ZC9 A;  3D7W B;  4MZF B;  3OJ2 A;  4DCK C;  4JPZ A;  3IAG C;  1EPW A;  3NBN A; 
#chains in the Genus database with same CATH homology
 1DFC A;  2ZQO A;  1Z2V A;  3O4A A;  5FNX A;  3ZX7 A;  4ZA3 B;  21BI A;  1V6X A;  2KI4 A;  5BXR A;  1GGP B;  3V0B A;  3O5W B;  4XFT A;  3ZXG A;  1DLL A;  3FJA A;  2DS0 A;  4I0Y A;  3CU1 B;  3O4B A;  1D0H A;  3IM7 A;  4OEE A;  4JAW A;  8I1B A;  2NTD A;  3P6I A;  4AN6 A;  2I1B A;  4L4I A;  4J2K A;  1BLA A;  1V6W A;  1S0C A;  2MC2 A;  3O4D A;  1TP0 A;  4ISQ A;  1ONK B;  4MZH A;  2F8X C;  4X38 A;  4GOV A;  1S0L A;  2RG9 B;  3PUB A;  4GOY A;  1P63 A;  4LO7 C;  3FJE A;  2M49 A;  1DJS B;  3BAH A;  3LLP A;  4ZOT A;  1WD4 A;  4II0 A;  3H6R B;  1BFC A;  1DQO A;  3HN1 A;  5JLV A;  4GP0 A;  1CE7 B;  1BFB A;  3VUO A;  5DVH A;  2DRY A;  1RZO B;  4IY9 A;  1ISV A;  3A22 A;  3H6S E;  4H9W A;  4P0K A;  3VT2 A;  3I29 B;  3UJ0 A;  1YTO A;  5F8S A;  3BX1 C;  3K1X A;  5FZY A;  3FFZ A;  1DZD A;  4A7Z A;  2DRZ A;  4HR6 C;  4JKX B;  2X2S A;  1PUU B;  2FGF A;  3IM5 A;  4I7I A;  4OUJ A;  4R6U B;  1WBC A;  2Y9W C;  3CA6 A;  3AKH A;  5FZZ A;  1HWP B;  3AKG A;  3VSF A;  1G9B A;  1DFQ A;  3H6R A;  4END A;  4JQ0 A;  5BVP I;  3HBW A;  2NS2 A;  1FWU A;  4I3N A;  3RSJ A;  4LO2 A;  1K5U A;  2NYY A;  4F34 A;  1YF8 B;  2LIQ A;  4Z9W B;  4I37 A;  4KC3 A;  3CAH A;  1S0E A;  1RML A;  1HWN B;  3IIR A;  1V6U A;  2P39 A;  4OWK A;  3OBR A;  2HW9 A;  3O49 A;  1TWM A;  4QKS A;  1JY0 A;  3AZV A;  4P6A A;  3W9T A;  2D23 A;  3Q7W A;  3OBT A;  1SR4 A;  4LO1 C;  3FJD A;  4J23 B;  2E4M A;  2F2F A;  1DQG A;  2AAI B;  1AF9 A;  4J2Y A;  2GZB A;  4P0L A;  3TC2 A;  1JT5 A;  2L5X A;  3BAD A;  3CA4 A;  2YUG A;  4MZG B;  1BFG A;  2KH2 A;  5EG6 C;  1HCE A;  2WRY A;  3CQA A;  4A7Y A;  3CA1 A;  1V6V A;  4LO3 C;  3WO3 A;  1TFM B;  3FJJ A;  5BXT A;  2HWM A;  3AJ6 A;  1I1E A;  3A21 A;  3Q7X A;  3E8L C;  4D0T A;  1UPS A;  4EFR A;  1FMM S;  4XFU A;  4X39 A;  3FJK A;  3O4O A;  4G9N A;  1R8N A;  2Q9X A;  3HOM A;  4KEJ A;  1E0O A;  1SZ6 B;  1EVT A;  2IHO A;  4OEF A;  2VU9 A;  3O4C A;  1RG8 A;  4I4R A;  1S0G A;  1R8O A;  4I4S A;  4QKR A;  3N7J A;  3WIN C;  3O44 A;  2NZ9 A;  1G9D A;  1ABR B;  3CRH A;  4G9M A;  2WBC A;  4FVV A;  5JMC A;  5D63 A;  3UD7 A;  2VXR A;  5E24 E;  1TTU A;  2BEA A;  4LO7 B;  4IQP A;  2ZR1 B;  1JT3 A;  3S8J A;  1BFF A;  3MAL A;  1IJT A;  3A07 A;  3NBC A;  1TIE A;  4Q91 A;  1YXW A;  3F1R A;  3P53 A;  1F31 A;  3BTA A;  2QN4 A;  3N7L A;  4TLP A;  3Q7Y A;  3FJF A;  3RTJ B;  4AN7 B;  3H6Q A;  5DSS B;  1N4K A;  4QBC A;  1IHK A;  3AKF A;  4F83 A;  3HAL A;  3OGG A;  4I4U A;  2D20 A;  2XOA A;  3UDA A;  3VT0 A;  3S8K A;  1HIB A;  1W3F A;  3POK A;  4HA2 A;  1MD6 A;  4I6I A;  2NVH A;  1JLX A;  4I4P A;  2J3P A;  4GAF A;  4H75 A;  3NBD A;  3LTQ A;  5EHA A;  3FUQ A;  3FJI A;  2RQ9 A;  1Q03 A;  3BA7 A;  31BI A;  3N7K A;  1ISY A;  3HSM A;  5HPZ A;  2MIB A;  4IYB A;  5BXS A;  1Z0H A;  1G9A A;  2KLL A;  4QO3 A;  5EC5 A;  1EYL A;  4IHZ A;  3RMX A;  4USO A;  3RTI B;  3ZC8 A;  2FDB M;  3BAV A;  5DUY A;  2X2T A;  2NM1 A;  2VSA A;  1FMZ A;  1FGA A;  1AVX B;  2K43 A;  1CVS A;  4J2X A;  3ZXD A;  3I2A A;  2HZ9 A;  3PME A;  1I1B A;  3EF2 A;  2Z48 A;  3R4S A;  3WO2 A;  2KI6 B;  3N7M A;  4I4V A;  1A8D A;  1S0F A;  3SNV A;  1VCL A;  4ZFW B;  3VT1 A;  1ISX A;  4I4Y A;  1OQL B;  1WBA A;  1M16 A;  4ZFU B;  3CA0 A;  4USP A;  3OGF A;  1JT7 A;  4DEN A;  1EV2 A;  2BFH A;  2K8R A;  2VUA A;  1YBI A;  4I8M A;  3PG0 A;  3FJB A;  4OWJ A;  2RST A;  3V0A B;  3FGM A;  2AXM A;  1XYF A;  1M2T B;  2DRE A;  4X37 A;  3VEQ A;  5BQU C;  1DIW A;  1ILR 1;  3B9U A;  3BAQ A;  1XZZ A;  2QYI B;  4I4O A;  4D0Z A;  3BA4 A;  4LO1 A;  3KMV A;  3WMV A;  3O3Q A;  1IIL A;  3AJ5 A;  2AQZ A;  2FO1 A;  1PUM B;  5G00 A;  2VLC A;  5BP5 C;  7I1B A;  3ILA A;  2D7R A;  3WMU A;  1IRA X;  4LO8 B;  4LO0 C;  3BB2 A;  1MC9 A;  3V0A A;  4HJJ A;  4LO3 A;  5DZU A;  1IOB A;  3BA5 A;  2FFU A;  5F8Y A;  3AH1 A;  2K4A B;  3T8S A;  3R4U A;  2Q3N B;  1HCD A;  3AKI A;  4ZKT B;  2MLL B;  3CA3 A;  4IY8 A;  2ESU A;  4I2S A;  3AH4 A;  4QC4 A;  2IWT B;  3VWC A;  1S0B A;  2D43 A;  1QQL A;  1ISW A;  3WIN A;  4CJM A;  3HMY A;  1NZK A;  4QBV A;  1G82 A;  3FJ8 A;  4EB2 B;  1FQ9 A;  3BAO A;  3C9Z A;  1AXM A;  3FUO A;  1AVW B;  4QD2 C;  4IZE A;  1Z4S A;  4G6J A;  4I96 A;  4L4H A;  4H04 A;  1Q04 A;  4IZX A;  4D8H A;  2R9K B;  2Y9G A;  3JUT A;  3JRR A;  4GAI A;  1AVA C;  2GO2 A;  4EKX B;  2VSE A;  1AVU A;  1QQK A;  2FFV A;  1W3A A;  4ION A;  1RY7 A;  3RMY A;  1HWO B;  2Z49 A;  3BRD A;  3N0K A;  4Q9G A;  5I1B A;  1W3G A;  5F8W A;  1HKN A;  2LIE A;  4GP3 A;  4ZFY B;  2ZQN A;  3FJH A;  3FJC A;  2VXT I;  5FNW A;  1XG6 A;  5B2H A;  1PZZ A;  4FGF A;  4ZLB B;  3PHZ A;  3CRI A;  3BRG C;  1PC8 B;  3I2X A;  5BOW A;  6I1B A;  4ZBV B;  5GAQ A;  4KBB A;  2KKI A;  4UY4 A;  1J0S A;  1K5V A;  3QR5 A;  4G1R A;  4ISR A;  1PWA A;  2ERM A;  1XHB A;  4X3A A;  1L2H A;  1KNM A;  1TWE A;  2HWA A;  1Q1U A;  3UD9 A;  4I1E A;  4I4Q A;  1BAS A;  5F90 A;  4P0J A;  4OEG A;  4Z8S B;  4EEE B;  4ZGR B;  1ISZ A;  3CRG A;  1HWM B;  2D22 A;  1JLY A;  5FZU A;  1II4 A;  4G6M A;  4OW4 A;  2P23 A;  4PC4 A;  5D61 A;  1BLD A;  1FV2 A;  1TOO A;  4JKQ A;  1T9F A;  2D24 A;  3WO4 A;  4JP0 A;  4EFQ A;  5BQU A;  1NUN A;  1JT4 A;  4LO2 C;  2UUS A;  2Y9X E;  3QYD A;  1IT0 A;  1ITB A;  4I1B A;  4Q9P A;  4WBC A;  1FWV A;  1T4Q A;  2D44 A;  1QXM A;  4OWL A;  1DZC A;  4EFP A;  2NP0 A;  5BP5 A;  1WD3 A;  3F62 B;  4XFS A;  3AZW A;  3OJM A;  3AH2 A;  4A7K A;  2BEB A;  1JQZ A;  4XKI A;  3MPP G;  3CA5 A;  3BAU A;  1SR4 C;  1BAR A;  4I4X A;  4LO0 A;  2E4M C;  2F2F C;  4JRA A;  3V79 C;  4KEK A;  4QD2 B;  1G9C A;  3OJV A;  1JTC A;  1IRP A;  2D7I A;  1BA7 A;  2AFG A;  4DEP A;  3WA1 A;  3V0B B;  1FV3 A;  1YYN A;  4J2S A;  2D1Z A;  41BI A;  1S0D A;  1FN0 A;  3NBE A;  3IM6 A;  5D62 A;  3BAG A;  3BRF A;  3FJ9 A;  5BXP A;  3UJ4 A;  4KEI A;  3VSZ A;  1AFC A;  9ILB A;  2Y9F A;  3P6J A;  4QAL A;  4YOL A;  3A23 A;  3UD8 A;  3NJ5 A;  2ET2 A;  3ZC9 A;  3D7W B;  4MZF B;  3OJ2 A;  4DCK C;  4JPZ A;  3IAG C;  1EPW A;  3NBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...