1IILA

Crystal structure of pro253arg apert mutant fgf receptor 2 (fgfr2) in complex with fgf2
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
134
structure length
134
Chain Sequence
PPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEPARIN-BINDING GROWTH FACTOR 2
publication title Structural basis for fibroblast growth factor receptor 2 activation in Apert syndrome.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor/growth factor receptor
total genus 32
structure length 134
sequence length 134
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2001-04-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1iilA00
3O4BA 3FJFA 1RMLA 2FO1A 3FJHA 2QN4A 1Z4SA 4II0A 4QO3A 3JRRA 5FNXA 4X37A 1IILA 3N7JA 5GAQA 9ILBA 1PC8B 2KKIA 3CRHA 1DFQA 2FDBM 3RTIB 3R4SA 5B2HA 2GZBA 4OEEA 3AH1A 4I8MA 1JT4A 4A7KA 1YXWA 4EFPA 2WBCA 1JQZA 3HOMA 1YTOA 2DRYA 2VU9A 4KC3A 1F31A 3OJMA 1M16A 3FJ9A 4QC4A 2BFHA 1I1EA 4KEIA 2L5XA 4ZKTB 2Q3NB 1NUNA 3BADA 3CU1B 1ILR1 1W3GA 3HMYA 1R8NA 3ZX7A 3FJAA 1ISWA 3O3QA 4ZBVB 1W3AA 4H9WA 1AFCA 3FJ8A 2MIBA 4FGFA 4ZFUB 4OEGA 3BA5A 3WO3A 4ZGRB 1SZ6B 2X2SA 4KEJA 1BLAA 3H6RA 4I3NA 1RG8A 1YBIA 2DRZA 1GGPB 4J2YA 1N4KA 5BQUC 1XZZA 1HKNA 3V0AA 3P53A 4HR6C 2VSAA 5EC5A 1V6WA 3UJ0A 3FUQA 3MALA 3P6JA 4JP0A 2XOAA 5BVPI 1XHBA 1DIWA 4EFRA 2ZR1B 2QYIB 3ZXGA 4XKIA 3AZVA 4JKXB 3PUBA 3QR5A 2D43A 4R6UB 21BIA 3QYDA 3CA1A 3IM5A 4CJMA 4DEPA 1EVTA 2GO2A 5F90A 2MLLB 5DVHA 5FZUA 2X2TA 1I1BA 3H6QA 3BAVA 4ZA3B 3FJDA 1NZKA 5EHAA 4ZFYB 1P63A 3S8KA 4LO7C 4L4HA 4Q9PA 4EFQA 4P0JA 3BRGC 4L4IA 3LLPA 4G6JA 2IHOA 3O4DA 1MD6A 3AH2A 4X39A 6I1BA 4YOLA 4OWJA 5BXPA 4EB2B 1AVUA 3O4AA 4J2SA 3BAGA 3Q7YA 2KH2A 1FWVA 1TIEA 1BFFA 5FZZA 3PG0A 2AFGA 3O4OA 3RTJB 4IZEA 1J0SA 2K43A 2M49A 1JT3A 4I4YA 4I37A 1K5UA 4Q91A 4I4PA 5BP5A 2WRYA 4P0KA 4D8HA 5FZYA 1BLDA 4I4QA 4I0YA 1Z0HA 3SNVA 1FV3A 2HWAA 4QALA 2RG9B 1S0FA 3WO4A 2VXRA 3OJVA 3VT0A 3WMUA 1ISXA 1G9DA 1XG6A 2R9KB 3PMEA 3VT2A 1SR4A 4DCKC 2J3PA 3VWCA 1II4A 4PC4A 1ISVA 3OJ2A 1L2HA 4AN6A 5BXRA 1IT0A 5F8SA 4IHZA 3BA4A 4LO1A 2AXMA 1FMZA 2K8RA 3FUOA 1ISZA 2HZ9A 2LIQA 4WBCA 4GP0A 1TFMB 4I1BA 2ZQNA 1CVSA 3D7WB 1OQLB 3N0KA 3Q7WA 2VSEA 4J2XA 4F34A 4LO7B 3C9ZA 2ZQOA 4I1EA 5BOWA 2Y9XE 3A21A 3BB2A 4J2KA 3CAHA 4ZFWB 4QBCA 3ZC8A 3NJ5A 1FGAA 4P6AA 3O4CA 3FJEA 3P6IA 3V0BA 1S0BA 2YUGA 4USOA 3FJBA 3MPPG 3B9UA 2D22A 4XFTA 2ET2A 4XFUA 4LO2A 1QQLA 4I96A 1G9AA 1DQGA 7I1BA 1WBCA 5E24E 3R4UA 1AVXB 1Z2VA 3A22A 2DREA 3BAQA 3OGGA 3H6RB 4ISQA 5DUYA 5BP5C 2NVHA 2HWMA 3IIRA 3WO2A 3BRDA 4LO0A 3V0AB 5BXTA 2NTDA 1IRPA 3VT1A 2LIEA 1PWAA 1S0LA 3AJ5A 4ZLBB 1K5VA 5I1BA 1S0EA 1BFBA 1WD3A 4OUJA 3BX1C 4IQPA 1XYFA 1Q03A 2FFUA 4I4VA 3UJ4A 5DZUA 3VSFA 3JUTA 8I1BA 1VCLA 3CA0A 5DSSB 1SR4C 3N7MA 2RQ9A 3UD8A 4TLPA 3HALA 1S0GA 2VLCA 2Y9FA 3BA7A 3V79C 4D0TA 3WINA 4LO1C 2Y9WC 5D63A 4QD2C 2ERMA 1FQ9A 1UPSA 1W3FA 2D44A 2VUAA 4GOVA 2DS0A 4I4RA 3FJJA 4LO8B 2P23A 3O44A 3CA4A 2NM1A 1YF8B 1S0DA 1RZOB 2Z49A 4HA2A 3I29B 2FGFA 2AAIB 1BFCA 4G1RA 3O5WB 4JPZA 4IYBA 1ABRB 5FNWA 1TP0A 3KMVA 1Q1UA 1IHKA 2RSTA 4LO3A 4QKRA 3CQAA 3NBNA 4IY9A 4OW4A 3FJIA 4AN7B 1HIBA 4EEEB 31BIA 4ZOTA 4LO2C 3OBTA 3ILAA 1HCDA 4OEFA 2D20A 1DLLA 3VSZA 3BTAA 4Z8SB 4I4UA 2MC2A 5BXSA 1ONKB 4LO0C 4GAFA 2VXTI 1ISYA 1HCEA 1AVAC 3EF2A 3VEQA 4ENDA 1JLXA 2NP0A 2D7RA 1S0CA 2KI4A 1TTUA 5EG6C 1TWEA 1FWUA 4H04A 1HWPB 3AKIA 1V6XA 3FFZA 3E8LC 1HWMB 1G9BA 1DQOA 4QD2B 3WINC 3CA3A 3O49A 1DJSB 2AQZA 2D7IA 1JLYA 2FFVA 3NBDA 1FN0A 3AKHA 1BASA 1IRAX 3WA1A 2Z48A 3AZWA 3HN1A 2BEBA 3CRGA 3AJ6A 3N7LA 2NZ9A 1PZZA 1G9CA 1IJTA 3I2AA 1WD4A 1JTCA 2F2FA 3V0BB 2P39A 4OWKA 4LO3C 1JT5A 1V6VA 1T9FA 3AKGA 4Z9WB 1RY7A 4KBBA 2E4MA 2Y9GA 1A8DA 1CE7B 4USPA 4JQ0A 4I4XA 3RSJA 4IZXA 3NBEA 5JLVA 4X38A 4F83A 3IM7A 3VUOA 4IONA 3CA6A 3WMVA 1ITBA 4I4SA 1DZDA 2KLLA 3IM6A 4I6IA 5D62A 4Q9GA 3HSMA 3NBCA 4GP3A 4XFSA 4J23B 4A7ZA 3IAGC 3TC2A 3K1XA 1QQKA 1KNMA 3BAHA 1PUMB 3FJKA 3FGMA 1BARA 3AH4A 1YYNA 3ZC9A 3RMXA 5F8WA 4G9MA 4FVVA 3UDAA 1E0OA 2K4AB 1EV2A 3FJCA 5G00A 1WBAA 4A7YA 1EPWA 4P0LA 1AXMA 4GAIA 4D0ZA 2D24A 1FMMS 3AKFA 4X3AA 3BRFA 3H6SE 4HJJA 1JT7A 1PUUB 2NYYA 3CA5A 3S8JA 4I2SA 4I4OA 2F8XC 1M2TB 3F62B 2D23A 1TWMA 4KEKA 1D0HA 2F2FC 3A23A 1Q04A 4QBVA 4JAWA 4OWLA 5D61A 4G6MA 1HWNB 2HW9A 2KI6B 3N7KA 3UD9A 4DENA 1G82A 1QXMA 1AF9A 1T4QA 3T8SA 41BIA 1IOBA 4EKXB 4I7IA 3Q7XA 3UD7A 2E4MC 3BAUA 1BA7A 3PHZA 3I2XA 1DZCA 3F1RA 1JY0A 4GOYA 3BAOA 1AVWB 2Q9XA 1MC9A 1BFGA 1R8OA 2UUSA 2D1ZA 2IWTB 4ISRA 4QKSA 3RMYA 3OGFA 4IY8A 1HWOB 3ZXDA 2I1BA 2BEAA 2ESUA 4JKQA 1V6UA 3POKA 4G9NA 3A07A 4JRAA 1TOOA 5BQUA 1EYLA 5HPZA 3HBWA 3OBRA 1DFCA 5JMCA 1FV2A 5F8YA 3W9TA 3CRIA 3LTQA
chains in the Genus database with same CATH superfamily
3O4BA 3FJFA 1RMLA 2FO1A 3FJHA 2QN4A 1Z4SA 4II0A 4QO3A 3JRRA 5FNXA 4X37A 1IILA 3N7JA 5GAQA 9ILBA 1PC8B 2KKIA 3CRHA 1DFQA 2FDBM 3RTIB 3R4SA 5B2HA 2GZBA 4OEEA 3AH1A 4I8MA 1JT4A 4A7KA 1YXWA 4EFPA 2WBCA 1JQZA 3HOMA 1YTOA 2DRYA 2VU9A 4KC3A 1F31A 3OJMA 1M16A 3FJ9A 4QC4A 2BFHA 1I1EA 4KEIA 2L5XA 4ZKTB 2Q3NB 1NUNA 4MZHA 3BADA 3CU1B 1ILR1 1W3GA 3HMYA 1R8NA 3ZX7A 4MZFB 3FJAA 1ISWA 3O3QA 4ZBVB 1W3AA 4H9WA 1AFCA 3FJ8A 2MIBA 4FGFA 4ZFUB 4OEGA 3BA5A 3WO3A 4ZGRB 1SZ6B 2X2SA 4KEJA 1BLAA 3H6RA 4I3NA 1RG8A 1YBIA 2DRZA 1GGPB 4J2YA 1N4KA 5BQUC 1XZZA 1HKNA 3V0AA 3P53A 4HR6C 2VSAA 5EC5A 1V6WA 3UJ0A 3FUQA 3MALA 3P6JA 4JP0A 2XOAA 5BVPI 1XHBA 1DIWA 4EFRA 2ZR1B 4MZGB 2QYIB 3ZXGA 4XKIA 4UY4A 3AZVA 4JKXB 3PUBA 4H75A 3QR5A 2D43A 4R6UB 21BIA 3QYDA 3CA1A 3IM5A 4CJMA 4DEPA 1EVTA 2GO2A 5F90A 2MLLB 5DVHA 5FZUA 2X2TA 1I1BA 3H6QA 3BAVA 4ZA3B 3FJDA 1NZKA 5EHAA 4ZFYB 1P63A 3S8KA 4LO7C 4L4HA 4Q9PA 4EFQA 4P0JA 3BRGC 4L4IA 3LLPA 4G6JA 2IHOA 3O4DA 1MD6A 3AH2A 4X39A 6I1BA 4YOLA 4OWJA 5BXPA 4EB2B 1AVUA 3O4AA 4J2SA 3BAGA 3Q7YA 2KH2A 1FWVA 1TIEA 1BFFA 5FZZA 3PG0A 2AFGA 3O4OA 3RTJB 4IZEA 1J0SA 2K43A 2M49A 1JT3A 4I4YA 4I37A 1K5UA 4Q91A 4I4PA 5BP5A 2WRYA 4P0KA 4D8HA 5FZYA 1BLDA 4I4QA 4I0YA 1Z0HA 3SNVA 1FV3A 2HWAA 4QALA 2RG9B 1S0FA 3WO4A 2VXRA 3OJVA 3VT0A 3WMUA 1ISXA 1G9DA 1XG6A 2R9KB 3PMEA 3VT2A 1SR4A 4DCKC 2J3PA 3VWCA 1II4A 4PC4A 1ISVA 3OJ2A 1L2HA 4AN6A 5BXRA 1IT0A 5F8SA 4IHZA 3BA4A 4LO1A 2AXMA 1FMZA 2K8RA 3FUOA 1ISZA 2HZ9A 2LIQA 4WBCA 4GP0A 1TFMB 4I1BA 2ZQNA 1CVSA 3D7WB 1OQLB 3N0KA 3Q7WA 2VSEA 4J2XA 4F34A 4LO7B 3C9ZA 2ZQOA 4I1EA 5BOWA 2Y9XE 3A21A 3BB2A 4J2KA 3CAHA 4ZFWB 4QBCA 3ZC8A 3NJ5A 1FGAA 4P6AA 3O4CA 3FJEA 3P6IA 3V0BA 1S0BA 2YUGA 4USOA 3FJBA 3MPPG 3B9UA 2D22A 4XFTA 2ET2A 4XFUA 4LO2A 1QQLA 4I96A 1G9AA 1DQGA 7I1BA 1WBCA 5E24E 3R4UA 1AVXB 1Z2VA 3A22A 2DREA 3BAQA 3OGGA 3H6RB 4ISQA 5DUYA 5BP5C 2NVHA 2HWMA 3IIRA 3WO2A 3BRDA 4LO0A 3V0AB 5BXTA 2NTDA 1IRPA 3VT1A 2LIEA 1PWAA 1S0LA 3AJ5A 4ZLBB 1K5VA 5I1BA 1S0EA 1BFBA 1WD3A 4OUJA 3BX1C 4IQPA 1XYFA 1Q03A 2FFUA 4I4VA 3UJ4A 5DZUA 3VSFA 3JUTA 8I1BA 1VCLA 3CA0A 5DSSB 1SR4C 3N7MA 2RQ9A 3UD8A 4TLPA 3HALA 1S0GA 2VLCA 2Y9FA 3BA7A 3V79C 4D0TA 3WINA 4LO1C 2Y9WC 5D63A 4QD2C 2ERMA 1FQ9A 1UPSA 1W3FA 2D44A 2VUAA 4GOVA 2DS0A 4I4RA 3FJJA 4LO8B 2P23A 3O44A 3CA4A 2NM1A 1YF8B 1S0DA 1RZOB 2Z49A 4HA2A 3I29B 2FGFA 2AAIB 1BFCA 4G1RA 3O5WB 4JPZA 4IYBA 1ABRB 5FNWA 2NS2A 1TP0A 3KMVA 1Q1UA 1IHKA 2RSTA 4LO3A 4QKRA 3CQAA 3NBNA 4IY9A 4OW4A 3FJIA 4AN7B 1HIBA 4EEEB 31BIA 4ZOTA 4LO2C 3OBTA 3ILAA 1HCDA 4OEFA 2D20A 1DLLA 3VSZA 3BTAA 4Z8SB 4I4UA 2MC2A 5BXSA 1ONKB 4LO0C 4GAFA 2VXTI 1ISYA 1HCEA 1AVAC 3EF2A 3VEQA 4ENDA 1JLXA 2NP0A 2D7RA 1S0CA 2KI4A 1TTUA 5EG6C 1TWEA 1FWUA 4H04A 1HWPB 3AKIA 1V6XA 3FFZA 3E8LC 1HWMB 1G9BA 1DQOA 4QD2B 3WINC 3CA3A 3O49A 1DJSB 2AQZA 2D7IA 1JLYA 2FFVA 3NBDA 1FN0A 3AKHA 1BASA 1IRAX 3WA1A 2Z48A 3AZWA 3HN1A 2BEBA 3CRGA 3AJ6A 3N7LA 2NZ9A 1PZZA 1G9CA 1IJTA 3I2AA 1WD4A 1JTCA 2F2FA 3V0BB 2P39A 4OWKA 4LO3C 1JT5A 1V6VA 1T9FA 3AKGA 4Z9WB 1RY7A 4KBBA 2E4MA 2Y9GA 1A8DA 1CE7B 4USPA 4JQ0A 4I4XA 3RSJA 4IZXA 3NBEA 5JLVA 4X38A 4F83A 3IM7A 3VUOA 4IONA 3CA6A 3WMVA 1ITBA 4I4SA 1DZDA 2KLLA 3IM6A 4I6IA 5D62A 4Q9GA 3HSMA 3NBCA 4GP3A 4XFSA 4J23B 4A7ZA 3IAGC 3TC2A 3K1XA 1QQKA 1KNMA 3BAHA 1PUMB 3FJKA 3FGMA 1BARA 3AH4A 1YYNA 3ZC9A 3RMXA 5F8WA 4G9MA 4FVVA 3UDAA 1E0OA 2K4AB 1EV2A 3FJCA 5G00A 1WBAA 4A7YA 1EPWA 4P0LA 1AXMA 4GAIA 4D0ZA 2D24A 1FMMS 3AKFA 4X3AA 3BRFA 3H6SE 4HJJA 1JT7A 1PUUB 2NYYA 3CA5A 3S8JA 4I2SA 4I4OA 2F8XC 1M2TB 3F62B 2D23A 1TWMA 4KEKA 1D0HA 2F2FC 3A23A 1Q04A 4QBVA 4JAWA 4OWLA 5D61A 4G6MA 1HWNB 2HW9A 2KI6B 3N7KA 3UD9A 4DENA 1G82A 1QXMA 1AF9A 1T4QA 3T8SA 41BIA 1IOBA 4EKXB 4I7IA 3Q7XA 3UD7A 2E4MC 3BAUA 1BA7A 3PHZA 3I2XA 1DZCA 3F1RA 1JY0A 4GOYA 3BAOA 1AVWB 2Q9XA 1MC9A 1BFGA 1R8OA 2UUSA 2D1ZA 2IWTB 4ISRA 4QKSA 3RMYA 3OGFA 4IY8A 1HWOB 3ZXDA 2I1BA 2BEAA 2ESUA 4JKQA 1V6UA 3POKA 4G9NA 3A07A 4JRAA 1TOOA 5BQUA 1EYLA 5HPZA 3HBWA 3OBRA 1DFCA 5JMCA 1FV2A 5F8YA 3W9TA 3CRIA 3LTQA
chains in the Genus database with same CATH topology
3O4BA 3FJFA 1RMLA 2FO1A 3FJHA 2QN4A 1Z4SA 4II0A 4QO3A 3JRRA 5FNXA 4X37A 1IILA 3N7JA 5GAQA 9ILBA 1PC8B 2KKIA 3CRHA 1DFQA 2FDBM 3RTIB 3R4SA 5B2HA 2GZBA 4OEEA 3AH1A 4I8MA 1JT4A 4A7KA 1YXWA 4EFPA 2WBCA 1JQZA 3HOMA 1YTOA 2DRYA 2VU9A 4KC3A 1F31A 3OJMA 1M16A 3FJ9A 4QC4A 2BFHA 1I1EA 4KEIA 2L5XA 4ZKTB 2Q3NB 1NUNA 4MZHA 3BADA 3CU1B 1ILR1 1W3GA 3HMYA 1R8NA 3ZX7A 4MZFB 3FJAA 1ISWA 3O3QA 4ZBVB 1W3AA 4H9WA 1AFCA 3FJ8A 2MIBA 4FGFA 4ZFUB 4OEGA 3BA5A 3WO3A 4ZGRB 1SZ6B 2X2SA 4KEJA 1BLAA 3H6RA 4I3NA 1RG8A 1YBIA 2DRZA 1GGPB 4J2YA 1N4KA 5BQUC 1XZZA 1HKNA 3V0AA 3P53A 4HR6C 2VSAA 5EC5A 1V6WA 3UJ0A 3FUQA 3MALA 3P6JA 4JP0A 2XOAA 5BVPI 1XHBA 1DIWA 4EFRA 2ZR1B 4MZGB 2QYIB 3ZXGA 4XKIA 4UY4A 3AZVA 4JKXB 3PUBA 4H75A 3QR5A 2D43A 4R6UB 21BIA 3QYDA 3CA1A 3IM5A 4CJMA 4DEPA 1EVTA 2GO2A 5F90A 2MLLB 5DVHA 5FZUA 2X2TA 1I1BA 3H6QA 3BAVA 4ZA3B 3FJDA 1NZKA 5EHAA 4ZFYB 1P63A 3S8KA 4LO7C 4L4HA 4Q9PA 4EFQA 4P0JA 3BRGC 4L4IA 3LLPA 4G6JA 2IHOA 3O4DA 1MD6A 3AH2A 4X39A 6I1BA 4YOLA 4OWJA 5BXPA 4EB2B 1AVUA 3O4AA 4J2SA 3BAGA 3Q7YA 2KH2A 1FWVA 1TIEA 1BFFA 5FZZA 3PG0A 2AFGA 3O4OA 3RTJB 4IZEA 1J0SA 2K43A 2M49A 1JT3A 4I4YA 4I37A 1K5UA 4Q91A 4I4PA 5BP5A 2WRYA 4P0KA 4D8HA 5FZYA 1BLDA 4I4QA 4I0YA 1Z0HA 3SNVA 1FV3A 2HWAA 4QALA 2RG9B 1S0FA 3WO4A 2VXRA 3OJVA 3VT0A 3WMUA 1ISXA 1G9DA 1XG6A 2R9KB 3PMEA 3VT2A 1SR4A 4DCKC 2J3PA 3VWCA 1II4A 4PC4A 1ISVA 3OJ2A 1L2HA 4AN6A 5BXRA 1IT0A 5F8SA 4IHZA 3BA4A 4LO1A 2AXMA 1FMZA 2K8RA 3FUOA 1ISZA 2HZ9A 2LIQA 4WBCA 4GP0A 1TFMB 4I1BA 2ZQNA 1CVSA 3D7WB 1OQLB 3N0KA 3Q7WA 2VSEA 4J2XA 4F34A 4LO7B 3C9ZA 2ZQOA 4I1EA 5BOWA 2Y9XE 3A21A 3BB2A 4J2KA 3CAHA 4ZFWB 4QBCA 3ZC8A 3NJ5A 1FGAA 4P6AA 3O4CA 3FJEA 3P6IA 3V0BA 1S0BA 2YUGA 4USOA 3FJBA 3MPPG 3B9UA 2D22A 4XFTA 2ET2A 4XFUA 4LO2A 1QQLA 4I96A 1G9AA 1DQGA 7I1BA 1WBCA 5E24E 3R4UA 1AVXB 1Z2VA 3A22A 2DREA 3BAQA 3OGGA 3H6RB 4ISQA 5DUYA 5BP5C 2NVHA 2HWMA 3IIRA 3WO2A 3BRDA 4LO0A 3V0AB 5BXTA 2NTDA 1IRPA 3VT1A 2LIEA 1PWAA 1S0LA 3AJ5A 4ZLBB 1K5VA 5I1BA 1S0EA 1BFBA 1WD3A 4OUJA 3BX1C 4IQPA 1XYFA 1Q03A 2FFUA 4I4VA 3UJ4A 5DZUA 3VSFA 3JUTA 8I1BA 1VCLA 3CA0A 5DSSB 1SR4C 3N7MA 2RQ9A 3UD8A 4TLPA 3HALA 1S0GA 2VLCA 2Y9FA 3BA7A 3V79C 4D0TA 3WINA 4LO1C 2Y9WC 5D63A 4QD2C 2ERMA 1FQ9A 1UPSA 1W3FA 2D44A 2VUAA 4GOVA 2DS0A 4I4RA 3FJJA 4LO8B 2P23A 3O44A 3CA4A 2NM1A 1YF8B 1S0DA 1RZOB 2Z49A 4HA2A 3I29B 2FGFA 2AAIB 1BFCA 4G1RA 3O5WB 4JPZA 4IYBA 1ABRB 5FNWA 2NS2A 1TP0A 3KMVA 1Q1UA 1IHKA 2RSTA 4LO3A 4QKRA 3CQAA 3NBNA 4IY9A 4OW4A 3FJIA 4AN7B 1HIBA 4EEEB 31BIA 4ZOTA 4LO2C 3OBTA 3ILAA 1HCDA 4OEFA 2D20A 1DLLA 3VSZA 3BTAA 4Z8SB 4I4UA 2MC2A 5BXSA 1ONKB 4LO0C 4GAFA 2VXTI 1ISYA 1HCEA 1AVAC 3EF2A 3VEQA 4ENDA 1JLXA 2NP0A 2D7RA 1S0CA 2KI4A 1TTUA 5EG6C 1TWEA 1FWUA 4H04A 1HWPB 3AKIA 1V6XA 3FFZA 3E8LC 1HWMB 1G9BA 1DQOA 4QD2B 3WINC 3CA3A 3O49A 1DJSB 2AQZA 2D7IA 1JLYA 2FFVA 3NBDA 1FN0A 3AKHA 1BASA 1IRAX 3WA1A 2Z48A 3AZWA 3HN1A 2BEBA 3CRGA 3AJ6A 3N7LA 2NZ9A 1PZZA 1G9CA 1IJTA 3I2AA 1WD4A 1JTCA 2F2FA 3V0BB 2P39A 4OWKA 4LO3C 1JT5A 1V6VA 1T9FA 3AKGA 4Z9WB 1RY7A 4KBBA 2E4MA 2Y9GA 1A8DA 1CE7B 4USPA 4JQ0A 4I4XA 3RSJA 4IZXA 3NBEA 5JLVA 4X38A 4F83A 3IM7A 3VUOA 4IONA 3CA6A 3WMVA 1ITBA 4I4SA 1DZDA 2KLLA 3IM6A 4I6IA 5D62A 4Q9GA 3HSMA 3NBCA 4GP3A 4XFSA 4J23B 4A7ZA 3IAGC 3TC2A 3K1XA 1QQKA 1KNMA 3BAHA 1PUMB 3FJKA 3FGMA 1BARA 3AH4A 1YYNA 3ZC9A 3RMXA 5F8WA 4G9MA 4FVVA 3UDAA 1E0OA 2K4AB 1EV2A 3FJCA 5G00A 1WBAA 4A7YA 1EPWA 4P0LA 1AXMA 4GAIA 4D0ZA 2D24A 1FMMS 3AKFA 4X3AA 3BRFA 3H6SE 4HJJA 1JT7A 1PUUB 2NYYA 3CA5A 3S8JA 4I2SA 4I4OA 2F8XC 1M2TB 3F62B 2D23A 1TWMA 4KEKA 1D0HA 2F2FC 3A23A 1Q04A 4QBVA 4JAWA 4OWLA 5D61A 4G6MA 1HWNB 2HW9A 2KI6B 3N7KA 3UD9A 4DENA 1G82A 1QXMA 1AF9A 1T4QA 3T8SA 41BIA 1IOBA 4EKXB 4I7IA 3Q7XA 3UD7A 2E4MC 3BAUA 1BA7A 3PHZA 3I2XA 1DZCA 3F1RA 1JY0A 4GOYA 3BAOA 1AVWB 2Q9XA 1MC9A 1BFGA 1R8OA 2UUSA 2D1ZA 2IWTB 4ISRA 4QKSA 3RMYA 3OGFA 4IY8A 1HWOB 3ZXDA 2I1BA 2BEAA 2ESUA 4JKQA 1V6UA 3POKA 4G9NA 3A07A 4JRAA 1TOOA 5BQUA 1EYLA 5HPZA 3HBWA 3OBRA 1DFCA 5JMCA 1FV2A 5F8YA 3W9TA 3CRIA 3LTQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O4B A;  3FJF A;  1RML A;  2FO1 A;  3FJH A;  2QN4 A;  1Z4S A;  4II0 A;  4QO3 A;  3JRR A;  5FNX A;  4X37 A;  1IIL A;  3N7J A;  5GAQ A;  9ILB A;  1PC8 B;  2KKI A;  3CRH A;  1DFQ A;  2FDB M;  3RTI B;  3R4S A;  5B2H A;  2GZB A;  4OEE A;  3AH1 A;  4I8M A;  1JT4 A;  4A7K A;  1YXW A;  4EFP A;  2WBC A;  1JQZ A;  3HOM A;  1YTO A;  2DRY A;  2VU9 A;  4KC3 A;  1F31 A;  3OJM A;  1M16 A;  3FJ9 A;  4QC4 A;  2BFH A;  1I1E A;  4KEI A;  2L5X A;  4ZKT B;  2Q3N B;  1NUN A;  3BAD A;  3CU1 B;  1ILR 1;  1W3G A;  3HMY A;  1R8N A;  3ZX7 A;  3FJA A;  1ISW A;  3O3Q A;  4ZBV B;  1W3A A;  4H9W A;  1AFC A;  3FJ8 A;  2MIB A;  4FGF A;  4ZFU B;  4OEG A;  3BA5 A;  3WO3 A;  4ZGR B;  1SZ6 B;  2X2S A;  4KEJ A;  1BLA A;  3H6R A;  4I3N A;  1RG8 A;  1YBI A;  2DRZ A;  1GGP B;  4J2Y A;  1N4K A;  5BQU C;  1XZZ A;  1HKN A;  3V0A A;  3P53 A;  4HR6 C;  2VSA A;  5EC5 A;  1V6W A;  3UJ0 A;  3FUQ A;  3MAL A;  3P6J A;  4JP0 A;  2XOA A;  5BVP I;  1XHB A;  1DIW A;  4EFR A;  2ZR1 B;  2QYI B;  3ZXG A;  4XKI A;  3AZV A;  4JKX B;  3PUB A;  3QR5 A;  2D43 A;  4R6U B;  21BI A;  3QYD A;  3CA1 A;  3IM5 A;  4CJM A;  4DEP A;  1EVT A;  2GO2 A;  5F90 A;  2MLL B;  5DVH A;  5FZU A;  2X2T A;  1I1B A;  3H6Q A;  3BAV A;  4ZA3 B;  3FJD A;  1NZK A;  5EHA A;  4ZFY B;  1P63 A;  3S8K A;  4LO7 C;  4L4H A;  4Q9P A;  4EFQ A;  4P0J A;  3BRG C;  4L4I A;  3LLP A;  4G6J A;  2IHO A;  3O4D A;  1MD6 A;  3AH2 A;  4X39 A;  6I1B A;  4YOL A;  4OWJ A;  5BXP A;  4EB2 B;  1AVU A;  3O4A A;  4J2S A;  3BAG A;  3Q7Y A;  2KH2 A;  1FWV A;  1TIE A;  1BFF A;  5FZZ A;  3PG0 A;  2AFG A;  3O4O A;  3RTJ B;  4IZE A;  1J0S A;  2K43 A;  2M49 A;  1JT3 A;  4I4Y A;  4I37 A;  1K5U A;  4Q91 A;  4I4P A;  5BP5 A;  2WRY A;  4P0K A;  4D8H A;  5FZY A;  1BLD A;  4I4Q A;  4I0Y A;  1Z0H A;  3SNV A;  1FV3 A;  2HWA A;  4QAL A;  2RG9 B;  1S0F A;  3WO4 A;  2VXR A;  3OJV A;  3VT0 A;  3WMU A;  1ISX A;  1G9D A;  1XG6 A;  2R9K B;  3PME A;  3VT2 A;  1SR4 A;  4DCK C;  2J3P A;  3VWC A;  1II4 A;  4PC4 A;  1ISV A;  3OJ2 A;  1L2H A;  4AN6 A;  5BXR A;  1IT0 A;  5F8S A;  4IHZ A;  3BA4 A;  4LO1 A;  2AXM A;  1FMZ A;  2K8R A;  3FUO A;  1ISZ A;  2HZ9 A;  2LIQ A;  4WBC A;  4GP0 A;  1TFM B;  4I1B A;  2ZQN A;  1CVS A;  3D7W B;  1OQL B;  3N0K A;  3Q7W A;  2VSE A;  4J2X A;  4F34 A;  4LO7 B;  3C9Z A;  2ZQO A;  4I1E A;  5BOW A;  2Y9X E;  3A21 A;  3BB2 A;  4J2K A;  3CAH A;  4ZFW B;  4QBC A;  3ZC8 A;  3NJ5 A;  1FGA A;  4P6A A;  3O4C A;  3FJE A;  3P6I A;  3V0B A;  1S0B A;  2YUG A;  4USO A;  3FJB A;  3MPP G;  3B9U A;  2D22 A;  4XFT A;  2ET2 A;  4XFU A;  4LO2 A;  1QQL A;  4I96 A;  1G9A A;  1DQG A;  7I1B A;  1WBC A;  5E24 E;  3R4U A;  1AVX B;  1Z2V A;  3A22 A;  2DRE A;  3BAQ A;  3OGG A;  3H6R B;  4ISQ A;  5DUY A;  5BP5 C;  2NVH A;  2HWM A;  3IIR A;  3WO2 A;  3BRD A;  4LO0 A;  3V0A B;  5BXT A;  2NTD A;  1IRP A;  3VT1 A;  2LIE A;  1PWA A;  1S0L A;  3AJ5 A;  4ZLB B;  1K5V A;  5I1B A;  1S0E A;  1BFB A;  1WD3 A;  4OUJ A;  3BX1 C;  4IQP A;  1XYF A;  1Q03 A;  2FFU A;  4I4V A;  3UJ4 A;  5DZU A;  3VSF A;  3JUT A;  8I1B A;  1VCL A;  3CA0 A;  5DSS B;  1SR4 C;  3N7M A;  2RQ9 A;  3UD8 A;  4TLP A;  3HAL A;  1S0G A;  2VLC A;  2Y9F A;  3BA7 A;  3V79 C;  4D0T A;  3WIN A;  4LO1 C;  2Y9W C;  5D63 A;  4QD2 C;  2ERM A;  1FQ9 A;  1UPS A;  1W3F A;  2D44 A;  2VUA A;  4GOV A;  2DS0 A;  4I4R A;  3FJJ A;  4LO8 B;  2P23 A;  3O44 A;  3CA4 A;  2NM1 A;  1YF8 B;  1S0D A;  1RZO B;  2Z49 A;  4HA2 A;  3I29 B;  2FGF A;  2AAI B;  1BFC A;  4G1R A;  3O5W B;  4JPZ A;  4IYB A;  1ABR B;  5FNW A;  1TP0 A;  3KMV A;  1Q1U A;  1IHK A;  2RST A;  4LO3 A;  4QKR A;  3CQA A;  3NBN A;  4IY9 A;  4OW4 A;  3FJI A;  4AN7 B;  1HIB A;  4EEE B;  31BI A;  4ZOT A;  4LO2 C;  3OBT A;  3ILA A;  1HCD A;  4OEF A;  2D20 A;  1DLL A;  3VSZ A;  3BTA A;  4Z8S B;  4I4U A;  2MC2 A;  5BXS A;  1ONK B;  4LO0 C;  4GAF A;  2VXT I;  1ISY A;  1HCE A;  1AVA C;  3EF2 A;  3VEQ A;  4END A;  1JLX A;  2NP0 A;  2D7R A;  1S0C A;  2KI4 A;  1TTU A;  5EG6 C;  1TWE A;  1FWU A;  4H04 A;  1HWP B;  3AKI A;  1V6X A;  3FFZ A;  3E8L C;  1HWM B;  1G9B A;  1DQO A;  4QD2 B;  3WIN C;  3CA3 A;  3O49 A;  1DJS B;  2AQZ A;  2D7I A;  1JLY A;  2FFV A;  3NBD A;  1FN0 A;  3AKH A;  1BAS A;  1IRA X;  3WA1 A;  2Z48 A;  3AZW A;  3HN1 A;  2BEB A;  3CRG A;  3AJ6 A;  3N7L A;  2NZ9 A;  1PZZ A;  1G9C A;  1IJT A;  3I2A A;  1WD4 A;  1JTC A;  2F2F A;  3V0B B;  2P39 A;  4OWK A;  4LO3 C;  1JT5 A;  1V6V A;  1T9F A;  3AKG A;  4Z9W B;  1RY7 A;  4KBB A;  2E4M A;  2Y9G A;  1A8D A;  1CE7 B;  4USP A;  4JQ0 A;  4I4X A;  3RSJ A;  4IZX A;  3NBE A;  5JLV A;  4X38 A;  4F83 A;  3IM7 A;  3VUO A;  4ION A;  3CA6 A;  3WMV A;  1ITB A;  4I4S A;  1DZD A;  2KLL A;  3IM6 A;  4I6I A;  5D62 A;  4Q9G A;  3HSM A;  3NBC A;  4GP3 A;  4XFS A;  4J23 B;  4A7Z A;  3IAG C;  3TC2 A;  3K1X A;  1QQK A;  1KNM A;  3BAH A;  1PUM B;  3FJK A;  3FGM A;  1BAR A;  3AH4 A;  1YYN A;  3ZC9 A;  3RMX A;  5F8W A;  4G9M A;  4FVV A;  3UDA A;  1E0O A;  2K4A B;  1EV2 A;  3FJC A;  5G00 A;  1WBA A;  4A7Y A;  1EPW A;  4P0L A;  1AXM A;  4GAI A;  4D0Z A;  2D24 A;  1FMM S;  3AKF A;  4X3A A;  3BRF A;  3H6S E;  4HJJ A;  1JT7 A;  1PUU B;  2NYY A;  3CA5 A;  3S8J A;  4I2S A;  4I4O A;  2F8X C;  1M2T B;  3F62 B;  2D23 A;  1TWM A;  4KEK A;  1D0H A;  2F2F C;  3A23 A;  1Q04 A;  4QBV A;  4JAW A;  4OWL A;  5D61 A;  4G6M A;  1HWN B;  2HW9 A;  2KI6 B;  3N7K A;  3UD9 A;  4DEN A;  1G82 A;  1QXM A;  1AF9 A;  1T4Q A;  3T8S A;  41BI A;  1IOB A;  4EKX B;  4I7I A;  3Q7X A;  3UD7 A;  2E4M C;  3BAU A;  1BA7 A;  3PHZ A;  3I2X A;  1DZC A;  3F1R A;  1JY0 A;  4GOY A;  3BAO A;  1AVW B;  2Q9X A;  1MC9 A;  1BFG A;  1R8O A;  2UUS A;  2D1Z A;  2IWT B;  4ISR A;  4QKS A;  3RMY A;  3OGF A;  4IY8 A;  1HWO B;  3ZXD A;  2I1B A;  2BEA A;  2ESU A;  4JKQ A;  1V6U A;  3POK A;  4G9N A;  3A07 A;  4JRA A;  1TOO A;  5BQU A;  1EYL A;  5HPZ A;  3HBW A;  3OBR A;  1DFC A;  5JMC A;  1FV2 A;  5F8Y A;  3W9T A;  3CRI A;  3LTQ A; 
#chains in the Genus database with same CATH topology
 3O4B A;  3FJF A;  1RML A;  2FO1 A;  3FJH A;  2QN4 A;  1Z4S A;  4II0 A;  4QO3 A;  3JRR A;  5FNX A;  4X37 A;  1IIL A;  3N7J A;  5GAQ A;  9ILB A;  1PC8 B;  2KKI A;  3CRH A;  1DFQ A;  2FDB M;  3RTI B;  3R4S A;  5B2H A;  2GZB A;  4OEE A;  3AH1 A;  4I8M A;  1JT4 A;  4A7K A;  1YXW A;  4EFP A;  2WBC A;  1JQZ A;  3HOM A;  1YTO A;  2DRY A;  2VU9 A;  4KC3 A;  1F31 A;  3OJM A;  1M16 A;  3FJ9 A;  4QC4 A;  2BFH A;  1I1E A;  4KEI A;  2L5X A;  4ZKT B;  2Q3N B;  1NUN A;  4MZH A;  3BAD A;  3CU1 B;  1ILR 1;  1W3G A;  3HMY A;  1R8N A;  3ZX7 A;  4MZF B;  3FJA A;  1ISW A;  3O3Q A;  4ZBV B;  1W3A A;  4H9W A;  1AFC A;  3FJ8 A;  2MIB A;  4FGF A;  4ZFU B;  4OEG A;  3BA5 A;  3WO3 A;  4ZGR B;  1SZ6 B;  2X2S A;  4KEJ A;  1BLA A;  3H6R A;  4I3N A;  1RG8 A;  1YBI A;  2DRZ A;  1GGP B;  4J2Y A;  1N4K A;  5BQU C;  1XZZ A;  1HKN A;  3V0A A;  3P53 A;  4HR6 C;  2VSA A;  5EC5 A;  1V6W A;  3UJ0 A;  3FUQ A;  3MAL A;  3P6J A;  4JP0 A;  2XOA A;  5BVP I;  1XHB A;  1DIW A;  4EFR A;  2ZR1 B;  4MZG B;  2QYI B;  3ZXG A;  4XKI A;  4UY4 A;  3AZV A;  4JKX B;  3PUB A;  4H75 A;  3QR5 A;  2D43 A;  4R6U B;  21BI A;  3QYD A;  3CA1 A;  3IM5 A;  4CJM A;  4DEP A;  1EVT A;  2GO2 A;  5F90 A;  2MLL B;  5DVH A;  5FZU A;  2X2T A;  1I1B A;  3H6Q A;  3BAV A;  4ZA3 B;  3FJD A;  1NZK A;  5EHA A;  4ZFY B;  1P63 A;  3S8K A;  4LO7 C;  4L4H A;  4Q9P A;  4EFQ A;  4P0J A;  3BRG C;  4L4I A;  3LLP A;  4G6J A;  2IHO A;  3O4D A;  1MD6 A;  3AH2 A;  4X39 A;  6I1B A;  4YOL A;  4OWJ A;  5BXP A;  4EB2 B;  1AVU A;  3O4A A;  4J2S A;  3BAG A;  3Q7Y A;  2KH2 A;  1FWV A;  1TIE A;  1BFF A;  5FZZ A;  3PG0 A;  2AFG A;  3O4O A;  3RTJ B;  4IZE A;  1J0S A;  2K43 A;  2M49 A;  1JT3 A;  4I4Y A;  4I37 A;  1K5U A;  4Q91 A;  4I4P A;  5BP5 A;  2WRY A;  4P0K A;  4D8H A;  5FZY A;  1BLD A;  4I4Q A;  4I0Y A;  1Z0H A;  3SNV A;  1FV3 A;  2HWA A;  4QAL A;  2RG9 B;  1S0F A;  3WO4 A;  2VXR A;  3OJV A;  3VT0 A;  3WMU A;  1ISX A;  1G9D A;  1XG6 A;  2R9K B;  3PME A;  3VT2 A;  1SR4 A;  4DCK C;  2J3P A;  3VWC A;  1II4 A;  4PC4 A;  1ISV A;  3OJ2 A;  1L2H A;  4AN6 A;  5BXR A;  1IT0 A;  5F8S A;  4IHZ A;  3BA4 A;  4LO1 A;  2AXM A;  1FMZ A;  2K8R A;  3FUO A;  1ISZ A;  2HZ9 A;  2LIQ A;  4WBC A;  4GP0 A;  1TFM B;  4I1B A;  2ZQN A;  1CVS A;  3D7W B;  1OQL B;  3N0K A;  3Q7W A;  2VSE A;  4J2X A;  4F34 A;  4LO7 B;  3C9Z A;  2ZQO A;  4I1E A;  5BOW A;  2Y9X E;  3A21 A;  3BB2 A;  4J2K A;  3CAH A;  4ZFW B;  4QBC A;  3ZC8 A;  3NJ5 A;  1FGA A;  4P6A A;  3O4C A;  3FJE A;  3P6I A;  3V0B A;  1S0B A;  2YUG A;  4USO A;  3FJB A;  3MPP G;  3B9U A;  2D22 A;  4XFT A;  2ET2 A;  4XFU A;  4LO2 A;  1QQL A;  4I96 A;  1G9A A;  1DQG A;  7I1B A;  1WBC A;  5E24 E;  3R4U A;  1AVX B;  1Z2V A;  3A22 A;  2DRE A;  3BAQ A;  3OGG A;  3H6R B;  4ISQ A;  5DUY A;  5BP5 C;  2NVH A;  2HWM A;  3IIR A;  3WO2 A;  3BRD A;  4LO0 A;  3V0A B;  5BXT A;  2NTD A;  1IRP A;  3VT1 A;  2LIE A;  1PWA A;  1S0L A;  3AJ5 A;  4ZLB B;  1K5V A;  5I1B A;  1S0E A;  1BFB A;  1WD3 A;  4OUJ A;  3BX1 C;  4IQP A;  1XYF A;  1Q03 A;  2FFU A;  4I4V A;  3UJ4 A;  5DZU A;  3VSF A;  3JUT A;  8I1B A;  1VCL A;  3CA0 A;  5DSS B;  1SR4 C;  3N7M A;  2RQ9 A;  3UD8 A;  4TLP A;  3HAL A;  1S0G A;  2VLC A;  2Y9F A;  3BA7 A;  3V79 C;  4D0T A;  3WIN A;  4LO1 C;  2Y9W C;  5D63 A;  4QD2 C;  2ERM A;  1FQ9 A;  1UPS A;  1W3F A;  2D44 A;  2VUA A;  4GOV A;  2DS0 A;  4I4R A;  3FJJ A;  4LO8 B;  2P23 A;  3O44 A;  3CA4 A;  2NM1 A;  1YF8 B;  1S0D A;  1RZO B;  2Z49 A;  4HA2 A;  3I29 B;  2FGF A;  2AAI B;  1BFC A;  4G1R A;  3O5W B;  4JPZ A;  4IYB A;  1ABR B;  5FNW A;  2NS2 A;  1TP0 A;  3KMV A;  1Q1U A;  1IHK A;  2RST A;  4LO3 A;  4QKR A;  3CQA A;  3NBN A;  4IY9 A;  4OW4 A;  3FJI A;  4AN7 B;  1HIB A;  4EEE B;  31BI A;  4ZOT A;  4LO2 C;  3OBT A;  3ILA A;  1HCD A;  4OEF A;  2D20 A;  1DLL A;  3VSZ A;  3BTA A;  4Z8S B;  4I4U A;  2MC2 A;  5BXS A;  1ONK B;  4LO0 C;  4GAF A;  2VXT I;  1ISY A;  1HCE A;  1AVA C;  3EF2 A;  3VEQ A;  4END A;  1JLX A;  2NP0 A;  2D7R A;  1S0C A;  2KI4 A;  1TTU A;  5EG6 C;  1TWE A;  1FWU A;  4H04 A;  1HWP B;  3AKI A;  1V6X A;  3FFZ A;  3E8L C;  1HWM B;  1G9B A;  1DQO A;  4QD2 B;  3WIN C;  3CA3 A;  3O49 A;  1DJS B;  2AQZ A;  2D7I A;  1JLY A;  2FFV A;  3NBD A;  1FN0 A;  3AKH A;  1BAS A;  1IRA X;  3WA1 A;  2Z48 A;  3AZW A;  3HN1 A;  2BEB A;  3CRG A;  3AJ6 A;  3N7L A;  2NZ9 A;  1PZZ A;  1G9C A;  1IJT A;  3I2A A;  1WD4 A;  1JTC A;  2F2F A;  3V0B B;  2P39 A;  4OWK A;  4LO3 C;  1JT5 A;  1V6V A;  1T9F A;  3AKG A;  4Z9W B;  1RY7 A;  4KBB A;  2E4M A;  2Y9G A;  1A8D A;  1CE7 B;  4USP A;  4JQ0 A;  4I4X A;  3RSJ A;  4IZX A;  3NBE A;  5JLV A;  4X38 A;  4F83 A;  3IM7 A;  3VUO A;  4ION A;  3CA6 A;  3WMV A;  1ITB A;  4I4S A;  1DZD A;  2KLL A;  3IM6 A;  4I6I A;  5D62 A;  4Q9G A;  3HSM A;  3NBC A;  4GP3 A;  4XFS A;  4J23 B;  4A7Z A;  3IAG C;  3TC2 A;  3K1X A;  1QQK A;  1KNM A;  3BAH A;  1PUM B;  3FJK A;  3FGM A;  1BAR A;  3AH4 A;  1YYN A;  3ZC9 A;  3RMX A;  5F8W A;  4G9M A;  4FVV A;  3UDA A;  1E0O A;  2K4A B;  1EV2 A;  3FJC A;  5G00 A;  1WBA A;  4A7Y A;  1EPW A;  4P0L A;  1AXM A;  4GAI A;  4D0Z A;  2D24 A;  1FMM S;  3AKF A;  4X3A A;  3BRF A;  3H6S E;  4HJJ A;  1JT7 A;  1PUU B;  2NYY A;  3CA5 A;  3S8J A;  4I2S A;  4I4O A;  2F8X C;  1M2T B;  3F62 B;  2D23 A;  1TWM A;  4KEK A;  1D0H A;  2F2F C;  3A23 A;  1Q04 A;  4QBV A;  4JAW A;  4OWL A;  5D61 A;  4G6M A;  1HWN B;  2HW9 A;  2KI6 B;  3N7K A;  3UD9 A;  4DEN A;  1G82 A;  1QXM A;  1AF9 A;  1T4Q A;  3T8S A;  41BI A;  1IOB A;  4EKX B;  4I7I A;  3Q7X A;  3UD7 A;  2E4M C;  3BAU A;  1BA7 A;  3PHZ A;  3I2X A;  1DZC A;  3F1R A;  1JY0 A;  4GOY A;  3BAO A;  1AVW B;  2Q9X A;  1MC9 A;  1BFG A;  1R8O A;  2UUS A;  2D1Z A;  2IWT B;  4ISR A;  4QKS A;  3RMY A;  3OGF A;  4IY8 A;  1HWO B;  3ZXD A;  2I1B A;  2BEA A;  2ESU A;  4JKQ A;  1V6U A;  3POK A;  4G9N A;  3A07 A;  4JRA A;  1TOO A;  5BQU A;  1EYL A;  5HPZ A;  3HBW A;  3OBR A;  1DFC A;  5JMC A;  1FV2 A;  5F8Y A;  3W9T A;  3CRI A;  3LTQ A; 
#chains in the Genus database with same CATH homology
 3O4B A;  3FJF A;  1RML A;  2FO1 A;  3FJH A;  2QN4 A;  1Z4S A;  4II0 A;  4QO3 A;  3JRR A;  5FNX A;  4X37 A;  1IIL A;  3N7J A;  5GAQ A;  9ILB A;  1PC8 B;  2KKI A;  3CRH A;  1DFQ A;  2FDB M;  3RTI B;  3R4S A;  5B2H A;  2GZB A;  4OEE A;  3AH1 A;  4I8M A;  1JT4 A;  4A7K A;  1YXW A;  4EFP A;  2WBC A;  1JQZ A;  3HOM A;  1YTO A;  2DRY A;  2VU9 A;  4KC3 A;  1F31 A;  3OJM A;  1M16 A;  3FJ9 A;  4QC4 A;  2BFH A;  1I1E A;  4KEI A;  2L5X A;  4ZKT B;  2Q3N B;  1NUN A;  4MZH A;  3BAD A;  3CU1 B;  1ILR 1;  1W3G A;  3HMY A;  1R8N A;  3ZX7 A;  4MZF B;  3FJA A;  1ISW A;  3O3Q A;  4ZBV B;  1W3A A;  4H9W A;  1AFC A;  3FJ8 A;  2MIB A;  4FGF A;  4ZFU B;  4OEG A;  3BA5 A;  3WO3 A;  4ZGR B;  1SZ6 B;  2X2S A;  4KEJ A;  1BLA A;  3H6R A;  4I3N A;  1RG8 A;  1YBI A;  2DRZ A;  1GGP B;  4J2Y A;  1N4K A;  5BQU C;  1XZZ A;  1HKN A;  3V0A A;  3P53 A;  4HR6 C;  2VSA A;  5EC5 A;  1V6W A;  3UJ0 A;  3FUQ A;  3MAL A;  3P6J A;  4JP0 A;  2XOA A;  5BVP I;  1XHB A;  1DIW A;  4EFR A;  2ZR1 B;  4MZG B;  2QYI B;  3ZXG A;  4XKI A;  4UY4 A;  3AZV A;  4JKX B;  3PUB A;  4H75 A;  3QR5 A;  2D43 A;  4R6U B;  21BI A;  3QYD A;  3CA1 A;  3IM5 A;  4CJM A;  4DEP A;  1EVT A;  2GO2 A;  5F90 A;  2MLL B;  5DVH A;  5FZU A;  2X2T A;  1I1B A;  3H6Q A;  3BAV A;  4ZA3 B;  3FJD A;  1NZK A;  5EHA A;  4ZFY B;  1P63 A;  3S8K A;  4LO7 C;  4L4H A;  4Q9P A;  4EFQ A;  4P0J A;  3BRG C;  4L4I A;  3LLP A;  4G6J A;  2IHO A;  3O4D A;  1MD6 A;  3AH2 A;  4X39 A;  6I1B A;  4YOL A;  4OWJ A;  5BXP A;  4EB2 B;  1AVU A;  3O4A A;  4J2S A;  3BAG A;  3Q7Y A;  2KH2 A;  1FWV A;  1TIE A;  1BFF A;  5FZZ A;  3PG0 A;  2AFG A;  3O4O A;  3RTJ B;  4IZE A;  1J0S A;  2K43 A;  2M49 A;  1JT3 A;  4I4Y A;  4I37 A;  1K5U A;  4Q91 A;  4I4P A;  5BP5 A;  2WRY A;  4P0K A;  4D8H A;  5FZY A;  1BLD A;  4I4Q A;  4I0Y A;  1Z0H A;  3SNV A;  1FV3 A;  2HWA A;  4QAL A;  2RG9 B;  1S0F A;  3WO4 A;  2VXR A;  3OJV A;  3VT0 A;  3WMU A;  1ISX A;  1G9D A;  1XG6 A;  2R9K B;  3PME A;  3VT2 A;  1SR4 A;  4DCK C;  2J3P A;  3VWC A;  1II4 A;  4PC4 A;  1ISV A;  3OJ2 A;  1L2H A;  4AN6 A;  5BXR A;  1IT0 A;  5F8S A;  4IHZ A;  3BA4 A;  4LO1 A;  2AXM A;  1FMZ A;  2K8R A;  3FUO A;  1ISZ A;  2HZ9 A;  2LIQ A;  4WBC A;  4GP0 A;  1TFM B;  4I1B A;  2ZQN A;  1CVS A;  3D7W B;  1OQL B;  3N0K A;  3Q7W A;  2VSE A;  4J2X A;  4F34 A;  4LO7 B;  3C9Z A;  2ZQO A;  4I1E A;  5BOW A;  2Y9X E;  3A21 A;  3BB2 A;  4J2K A;  3CAH A;  4ZFW B;  4QBC A;  3ZC8 A;  3NJ5 A;  1FGA A;  4P6A A;  3O4C A;  3FJE A;  3P6I A;  3V0B A;  1S0B A;  2YUG A;  4USO A;  3FJB A;  3MPP G;  3B9U A;  2D22 A;  4XFT A;  2ET2 A;  4XFU A;  4LO2 A;  1QQL A;  4I96 A;  1G9A A;  1DQG A;  7I1B A;  1WBC A;  5E24 E;  3R4U A;  1AVX B;  1Z2V A;  3A22 A;  2DRE A;  3BAQ A;  3OGG A;  3H6R B;  4ISQ A;  5DUY A;  5BP5 C;  2NVH A;  2HWM A;  3IIR A;  3WO2 A;  3BRD A;  4LO0 A;  3V0A B;  5BXT A;  2NTD A;  1IRP A;  3VT1 A;  2LIE A;  1PWA A;  1S0L A;  3AJ5 A;  4ZLB B;  1K5V A;  5I1B A;  1S0E A;  1BFB A;  1WD3 A;  4OUJ A;  3BX1 C;  4IQP A;  1XYF A;  1Q03 A;  2FFU A;  4I4V A;  3UJ4 A;  5DZU A;  3VSF A;  3JUT A;  8I1B A;  1VCL A;  3CA0 A;  5DSS B;  1SR4 C;  3N7M A;  2RQ9 A;  3UD8 A;  4TLP A;  3HAL A;  1S0G A;  2VLC A;  2Y9F A;  3BA7 A;  3V79 C;  4D0T A;  3WIN A;  4LO1 C;  2Y9W C;  5D63 A;  4QD2 C;  2ERM A;  1FQ9 A;  1UPS A;  1W3F A;  2D44 A;  2VUA A;  4GOV A;  2DS0 A;  4I4R A;  3FJJ A;  4LO8 B;  2P23 A;  3O44 A;  3CA4 A;  2NM1 A;  1YF8 B;  1S0D A;  1RZO B;  2Z49 A;  4HA2 A;  3I29 B;  2FGF A;  2AAI B;  1BFC A;  4G1R A;  3O5W B;  4JPZ A;  4IYB A;  1ABR B;  5FNW A;  2NS2 A;  1TP0 A;  3KMV A;  1Q1U A;  1IHK A;  2RST A;  4LO3 A;  4QKR A;  3CQA A;  3NBN A;  4IY9 A;  4OW4 A;  3FJI A;  4AN7 B;  1HIB A;  4EEE B;  31BI A;  4ZOT A;  4LO2 C;  3OBT A;  3ILA A;  1HCD A;  4OEF A;  2D20 A;  1DLL A;  3VSZ A;  3BTA A;  4Z8S B;  4I4U A;  2MC2 A;  5BXS A;  1ONK B;  4LO0 C;  4GAF A;  2VXT I;  1ISY A;  1HCE A;  1AVA C;  3EF2 A;  3VEQ A;  4END A;  1JLX A;  2NP0 A;  2D7R A;  1S0C A;  2KI4 A;  1TTU A;  5EG6 C;  1TWE A;  1FWU A;  4H04 A;  1HWP B;  3AKI A;  1V6X A;  3FFZ A;  3E8L C;  1HWM B;  1G9B A;  1DQO A;  4QD2 B;  3WIN C;  3CA3 A;  3O49 A;  1DJS B;  2AQZ A;  2D7I A;  1JLY A;  2FFV A;  3NBD A;  1FN0 A;  3AKH A;  1BAS A;  1IRA X;  3WA1 A;  2Z48 A;  3AZW A;  3HN1 A;  2BEB A;  3CRG A;  3AJ6 A;  3N7L A;  2NZ9 A;  1PZZ A;  1G9C A;  1IJT A;  3I2A A;  1WD4 A;  1JTC A;  2F2F A;  3V0B B;  2P39 A;  4OWK A;  4LO3 C;  1JT5 A;  1V6V A;  1T9F A;  3AKG A;  4Z9W B;  1RY7 A;  4KBB A;  2E4M A;  2Y9G A;  1A8D A;  1CE7 B;  4USP A;  4JQ0 A;  4I4X A;  3RSJ A;  4IZX A;  3NBE A;  5JLV A;  4X38 A;  4F83 A;  3IM7 A;  3VUO A;  4ION A;  3CA6 A;  3WMV A;  1ITB A;  4I4S A;  1DZD A;  2KLL A;  3IM6 A;  4I6I A;  5D62 A;  4Q9G A;  3HSM A;  3NBC A;  4GP3 A;  4XFS A;  4J23 B;  4A7Z A;  3IAG C;  3TC2 A;  3K1X A;  1QQK A;  1KNM A;  3BAH A;  1PUM B;  3FJK A;  3FGM A;  1BAR A;  3AH4 A;  1YYN A;  3ZC9 A;  3RMX A;  5F8W A;  4G9M A;  4FVV A;  3UDA A;  1E0O A;  2K4A B;  1EV2 A;  3FJC A;  5G00 A;  1WBA A;  4A7Y A;  1EPW A;  4P0L A;  1AXM A;  4GAI A;  4D0Z A;  2D24 A;  1FMM S;  3AKF A;  4X3A A;  3BRF A;  3H6S E;  4HJJ A;  1JT7 A;  1PUU B;  2NYY A;  3CA5 A;  3S8J A;  4I2S A;  4I4O A;  2F8X C;  1M2T B;  3F62 B;  2D23 A;  1TWM A;  4KEK A;  1D0H A;  2F2F C;  3A23 A;  1Q04 A;  4QBV A;  4JAW A;  4OWL A;  5D61 A;  4G6M A;  1HWN B;  2HW9 A;  2KI6 B;  3N7K A;  3UD9 A;  4DEN A;  1G82 A;  1QXM A;  1AF9 A;  1T4Q A;  3T8S A;  41BI A;  1IOB A;  4EKX B;  4I7I A;  3Q7X A;  3UD7 A;  2E4M C;  3BAU A;  1BA7 A;  3PHZ A;  3I2X A;  1DZC A;  3F1R A;  1JY0 A;  4GOY A;  3BAO A;  1AVW B;  2Q9X A;  1MC9 A;  1BFG A;  1R8O A;  2UUS A;  2D1Z A;  2IWT B;  4ISR A;  4QKS A;  3RMY A;  3OGF A;  4IY8 A;  1HWO B;  3ZXD A;  2I1B A;  2BEA A;  2ESU A;  4JKQ A;  1V6U A;  3POK A;  4G9N A;  3A07 A;  4JRA A;  1TOO A;  5BQU A;  1EYL A;  5HPZ A;  3HBW A;  3OBR A;  1DFC A;  5JMC A;  1FV2 A;  5F8Y A;  3W9T A;  3CRI A;  3LTQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...