4ZFWB

Structural studies on a non-toxic homologue of type ii rips from momordica charantia (bitter gourd) in complex with galactose.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
261
structure length
261
Chain Sequence
NEQCSPQQRTTRISGRDGLCVDVYGALTADGSRVILYPCGQQQNQQWTFYPDNTIRSLGKCLATSALSSGSNVVITNCDYLRYDDGWMVSSSGTMMNKSSHLVLTANAATSRTNLTGENNVFAAKQAWRIGNYVEPIVTTIIGLRHMCLEATDNDTNVWLESCVKNKTKQYWALYSDDTIRVNNNRNLCVSSSTDSSSKLIVIRRCDGSINQRWVFTPQGTISNPGYEAVMDVAQNDVYLKKIVLSSATDKGNGQQWTVFY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords rRNA N-glycosidase
publication title Structural studies on a non-toxic homologue of type II RIPs from bitter gourd: Molecular basis of non-toxicity, conformational selection and glycan structure.
pubmed rcsb
molecule tags Hydrolase
total genus 82
structure length 261
sequence length 261
ec nomenclature ec 3.2.2.22: rRNA N-glycosylase.
pdb deposition date 2015-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00652 Ricin_B_lectin Ricin-type beta-trefoil lectin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfwB01
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4zfwB02
4ZFYB 2Z48A 2ZQNA 3OJVA 3W9TA 3RMYA 2BEBA 1IILA 1XYFA 5F8SA 1Q03A 2VXTI 3CA4A 2WRYA 3OJ2A 2KKIA 1BFGA 3O44A 1TTUA 3FJCA 3RSJA 3C9ZA 1G9DA 4JAWA 1SR4A 1EYLA 3JUTA 3NJ5A 3BRGC 3BB2A 2GO2A 1TFMB 4D0ZA 3V0BB 3VWCA 4QBVA 1MC9A 4OWJA 4I7IA 3FJEA 5DUYA 4ZBVB 3BAQA 1TWMA 3V0BA 3N7MA 4XFSA 2LIQA 2IWTB 4EKXB 4G9MA 3EF2A 4Z8SB 4ZFWB 1CVSA 3NBCA 4EB2B 1AVUA 4LO3C 1ISZA 1PUMB 1R8OA 4QO3A 1NZKA 1FWUA 4G1RA 1FQ9A 4GP3A 1WD4A 3VT2A 3I2AA 4FVVA 1K5VA 3VSZA 4DEPA 4J2XA 1MD6A 1S0FA 1JY0A 1HCDA 3V0AB 3BRDA 3FGMA 4IY8A 1RZOB 4AN6A 2KLLA 1DZCA 4A7ZA 2BFHA 3TC2A 1ILR1 3BTAA 1ISYA 2FFVA 4LO2C 1WBCA 5D62A 3BX1C 3IAGC 3BADA 1E0OA 3RTIB 1JLYA 3O49A 2VUAA 1M2TB 2MIBA 3V0AA 3P53A 5DZUA 2P23A 4A7YA 3S8KA 1GGPB 3LTQA 3RMXA 2VU9A 1QXMA 1JT5A 1Z4SA 4LO1C 2M49A 4JRAA 4R6UB 3ZC8A 1HCEA 2DRZA 4WBCA 3WINA 1S0GA 9ILBA 3ZXDA 4IONA 3HMYA 1IOBA 5BOWA 4LO7B 4GAFA 1BARA 3O5WB 2F8XC 1FWVA 3UJ0A 5B2HA 4P0JA 4X3AA 4I37A 3LLPA 4I1BA 1PZZA 4OEFA 3N7LA 1ISXA 3HOMA 2X2TA 5BQUA 3MALA 4DCKC 1DFQA 4YOLA 4OEGA 4KEJA 2E4MA 3I29B 3QR5A 4I4UA 3HBWA 8I1BA 1FMMS 1L2HA 3AH4A 3N7JA 3WO2A 1BASA 1OQLB 2AXMA 6I1BA 1I1EA 2HW9A 3Q7XA 1V6WA 1BFBA 1HWOB 1TOOA 4ENDA 4I4SA 2K43A 1S0CA 3D7WB 4I4OA 3AZVA 1WBAA 3RTJB 1AXMA 4I6IA 5EC5A 2Q3NB 1Z2VA 1W3AA 2VSAA 4OUJA 2NP0A 3ZX7A 4J2SA 2RSTA 4LO8B 3I2XA 3BRFA 1V6VA 1D0HA 2HWMA 3KMVA 2VXRA 2QN4A 4I4PA 2DREA 5FZUA 4G6JA 3BAGA 3A22A 4H9WA 4OW4A 1VCLA 2NVHA 2AQZA 3NBNA 1AVWB 4QKSA 1ITBA 3CA0A 4G9NA 5BXRA 3VUOA 1IHKA 1F31A 4JKXB 3K1XA 2KI4A 5BXPA 1T9FA 4P0LA 1SR4C 21BIA 4ZA3B 1V6XA 3HALA 2F2FA 2UUSA 1J0SA 1BLAA 3N0KA 2I1BA 4X38A 4ZLBB 1HWMB 4IY9A 2F2FC 2HZ9A 3CQAA 3CAHA 2ESUA 3WO3A 2D43A 2FDBM 1ONKB 3ZXGA 5GAQA 1QQKA 5BP5A 2P39A 4IYBA 3Q7YA 3FUQA 3A21A 1W3FA 2NTDA 3HN1A 1N4KA 2BEAA 1KNMA 1Z0HA 1UPSA 1SZ6B 3O4BA 4ISRA 4OEEA 3AKFA 2D22A 4I4QA 2Q9XA 4QD2B 1IT0A 5DSSB 3UDAA 5JLVA 4HJJA 2D1ZA 4PC4A 3P6IA 4I0YA 2Y9WC 4Q9PA 4J23B 5JMCA 5EG6C 4G6MA 4P6AA 3BAVA 2MLLB 3AKIA 3OGFA 4J2YA 1EPWA 3PG0A 1QQLA 1G9CA 1JT4A 3FJKA 4J2KA 2ET2A 3WMVA 1M16A 3QYDA 5FZYA 1S0LA 3CRGA 1Q04A 2GZBA 3B9UA 3CA1A 4IHZA 4X39A 3V79C 2Y9FA 1YF8B 3WINC 1DIWA 5E24E 2AAIB 4I4VA 3PUBA 4I2SA 1I1BA 3VSFA 3O4CA 1AF9A 3PHZA 5FZZA 3WA1A 2QYIB 3BA5A 2NM1A 4ZKTB 1ISVA 1FMZA 2J3PA 4ZFUB 3JRRA 1IRAX 4P0KA 5BQUC 3FJ9A 3VEQA 3E8LC 5BXTA 4LO7C 1G9AA 3FUOA 1FN0A 2E4MC 3ILAA 2KI6B 1AFCA 3BAHA 1EV2A 4I4YA 5BVPI 1BFCA 1EVTA 4XFTA 2WBCA 3R4UA 4D8HA 2DS0A 4HR6C 3N7KA 2D7RA 3MPPG 1JQZA 7I1BA 31BIA 4KEIA 1YYNA 3BA7A 3IM7A 3FJ8A 3FJDA 3BA4A 2ZQOA 1DQOA 4F34A 2Y9XE 3A23A 4EFQA 1DLLA 5FNXA 3O3QA 1RY7A 2K4AB 4ZGRB 2HWAA 3CA5A 5DVHA 4Z9WB 4GP0A 3CRIA 3PMEA 1PWAA 3H6RB 3BAUA 3F1RA 3CA6A 1XZZA 3UD8A 4Q9GA 1XHBA 3H6QA 3HSMA 5D63A 1V6UA 1JTCA 1TP0A 2XOAA 3O4AA 3H6RA 3UD9A 2Z49A 4IZEA 1IJTA 4AN7B 1TIEA 1K5UA 3FJIA 3NBDA 1HWPB 1DFCA 1RG8A 2R9KB 4I96A 4USPA 4I8MA 3SNVA 4JPZA 3WO4A 4X37A 1DQGA 2MC2A 3CU1B 3OGGA 1S0BA 2KH2A 2ERMA 2FO1A 5G00A 3O4OA 3A07A 4USOA 5BP5C 1FV2A 2RQ9A 3FJHA 4JP0A 1WD3A 3IM6A 1T4QA 3FJBA 1W3GA 5D61A 4LO3A 3F62B 4F83A 1ABRB 4JQ0A 3POKA 2D20A 3AKGA 4GOYA 1YBIA 1YTOA 1HWNB 3O4DA 4XKIA 3T8SA 1S0EA 4QALA 4TLPA 1S0DA 4I4RA 2Y9GA 1HIBA 4QKRA 1ISWA 4KC3A 4OWKA 4ZOTA 3CRHA 4LO0A 1A8DA 2LIEA 3AZWA 2X2SA 4GOVA 3BAOA 4LO2A 2VLCA 2NZ9A 3FJFA 3R4SA 4LO0C 3AJ5A 4EFPA 1Q1UA 3AJ6A 4QD2C 4H04A 4KEKA 5F90A 4D0TA 4II0A 4KBBA 2YUGA 3FJJA 3OJMA 3WMUA 1YXWA 3OBRA 4HA2A 4LO1A 1DZDA 3UD7A 4OWLA 2ZR1B 1JT3A 2VSEA 2D44A 2D23A 4Q91A 1AVXB 3S8JA 4EFRA 1P63A 5BXSA 5FNWA 3H6SE 4DENA 1R8NA 5I1BA 4A7KA 4XFUA 1DJSB 2D24A 4QBCA 4JKQA 1FGAA 4FGFA 4IZXA 4I4XA 2D7IA 3FFZA 1PC8B 2FGFA 1PUUB 1TWEA 3AH1A 5F8WA 1BA7A 3NBEA 4EEEB 4I1EA 1G9BA 2FFUA 2K8RA 4ISQA 2RG9B 3CA3A 5EHAA 3FJAA 2IHOA 3AH2A 1JLXA 1XG6A 3AKHA 4CJMA 1CE7B 2L5XA 1II4A 1FV3A 4L4IA 2AFGA 1BLDA 1G82A 1IRPA 3IM5A 3ZC9A 5HPZA 3VT1A 4IQPA 4L4HA 41BIA 3P6JA 4I3NA 3VT0A 1RMLA 3Q7WA 2NYYA 1HKNA 2DRYA 3OBTA 1AVAC 1NUNA 4QC4A 1BFFA 4GAIA 3UJ4A 1JT7A 5F8YA 3IIRA
chains in the Genus database with same CATH superfamily
4ZFYB 2Z48A 2ZQNA 3OJVA 3W9TA 3RMYA 2BEBA 1IILA 1XYFA 5F8SA 1Q03A 2VXTI 3CA4A 2WRYA 3OJ2A 2KKIA 2NS2A 1BFGA 3O44A 1TTUA 3FJCA 3RSJA 3C9ZA 1G9DA 4JAWA 1SR4A 1EYLA 3JUTA 3NJ5A 3BRGC 3BB2A 2GO2A 1TFMB 4D0ZA 3V0BB 3VWCA 4QBVA 1MC9A 4OWJA 4I7IA 3FJEA 5DUYA 4ZBVB 3BAQA 1TWMA 3V0BA 3N7MA 4XFSA 2LIQA 2IWTB 4EKXB 4G9MA 3EF2A 4Z8SB 4ZFWB 1CVSA 3NBCA 4EB2B 1AVUA 4LO3C 1ISZA 1PUMB 1R8OA 4QO3A 1NZKA 1FWUA 4G1RA 1FQ9A 4GP3A 1WD4A 3VT2A 3I2AA 4FVVA 1K5VA 4MZHA 3VSZA 4DEPA 4J2XA 1MD6A 1S0FA 1JY0A 1HCDA 3V0AB 3BRDA 3FGMA 4IY8A 1RZOB 4AN6A 2KLLA 1DZCA 4A7ZA 2BFHA 3TC2A 1ILR1 3BTAA 1ISYA 2FFVA 4LO2C 1WBCA 5D62A 3BX1C 3IAGC 3BADA 1E0OA 3RTIB 1JLYA 3O49A 2VUAA 1M2TB 2MIBA 3V0AA 3P53A 5DZUA 2P23A 4A7YA 3S8KA 1GGPB 3LTQA 3RMXA 2VU9A 1QXMA 1JT5A 1Z4SA 4LO1C 2M49A 4JRAA 4R6UB 3ZC8A 1HCEA 2DRZA 4WBCA 3WINA 1S0GA 9ILBA 3ZXDA 4IONA 3HMYA 1IOBA 5BOWA 4LO7B 4GAFA 1BARA 3O5WB 2F8XC 1FWVA 3UJ0A 5B2HA 4P0JA 4X3AA 4I37A 3LLPA 4I1BA 1PZZA 4OEFA 3N7LA 1ISXA 3HOMA 2X2TA 5BQUA 3MALA 4DCKC 1DFQA 4YOLA 4OEGA 4KEJA 2E4MA 3I29B 3QR5A 4I4UA 3HBWA 8I1BA 1FMMS 1L2HA 3AH4A 3N7JA 3WO2A 1BASA 1OQLB 2AXMA 6I1BA 1I1EA 2HW9A 3Q7XA 1V6WA 1BFBA 1HWOB 1TOOA 4ENDA 4I4SA 2K43A 1S0CA 3D7WB 4I4OA 3AZVA 1WBAA 3RTJB 1AXMA 4I6IA 5EC5A 2Q3NB 1Z2VA 4H75A 1W3AA 2VSAA 4OUJA 2NP0A 3ZX7A 4J2SA 2RSTA 4LO8B 3I2XA 3BRFA 1V6VA 1D0HA 2HWMA 3KMVA 2VXRA 2QN4A 4I4PA 2DREA 5FZUA 4G6JA 3BAGA 3A22A 4H9WA 4OW4A 1VCLA 2NVHA 2AQZA 3NBNA 1AVWB 4QKSA 1ITBA 3CA0A 4G9NA 5BXRA 3VUOA 1IHKA 1F31A 4JKXB 3K1XA 2KI4A 5BXPA 1T9FA 4P0LA 1SR4C 21BIA 4ZA3B 1V6XA 3HALA 2F2FA 2UUSA 1J0SA 1BLAA 3N0KA 2I1BA 4X38A 4ZLBB 1HWMB 4IY9A 2F2FC 2HZ9A 3CQAA 3CAHA 2ESUA 3WO3A 2D43A 2FDBM 1ONKB 3ZXGA 5GAQA 1QQKA 5BP5A 2P39A 4IYBA 3Q7YA 3FUQA 3A21A 1W3FA 2NTDA 3HN1A 1N4KA 2BEAA 1KNMA 1Z0HA 1UPSA 1SZ6B 3O4BA 4ISRA 4OEEA 3AKFA 2D22A 4I4QA 2Q9XA 4QD2B 1IT0A 4MZFB 5DSSB 3UDAA 5JLVA 4HJJA 2D1ZA 4PC4A 3P6IA 4I0YA 2Y9WC 4Q9PA 4J23B 5JMCA 5EG6C 4G6MA 4P6AA 3BAVA 2MLLB 3AKIA 3OGFA 4J2YA 1EPWA 3PG0A 1QQLA 1G9CA 1JT4A 3FJKA 4J2KA 2ET2A 3WMVA 1M16A 3QYDA 5FZYA 1S0LA 3CRGA 1Q04A 2GZBA 3B9UA 3CA1A 4IHZA 4X39A 3V79C 2Y9FA 1YF8B 3WINC 1DIWA 5E24E 2AAIB 4I4VA 3PUBA 4I2SA 1I1BA 3VSFA 3O4CA 1AF9A 3PHZA 5FZZA 3WA1A 2QYIB 3BA5A 2NM1A 4ZKTB 1ISVA 1FMZA 2J3PA 4ZFUB 3JRRA 1IRAX 4P0KA 5BQUC 3FJ9A 3VEQA 3E8LC 5BXTA 4LO7C 1G9AA 3FUOA 1FN0A 2E4MC 3ILAA 2KI6B 1AFCA 3BAHA 1EV2A 4I4YA 5BVPI 1BFCA 1EVTA 4XFTA 2WBCA 3R4UA 4D8HA 2DS0A 4HR6C 3N7KA 2D7RA 3MPPG 1JQZA 7I1BA 31BIA 4KEIA 1YYNA 3BA7A 3IM7A 3FJ8A 3FJDA 3BA4A 2ZQOA 1DQOA 4F34A 2Y9XE 3A23A 4EFQA 1DLLA 5FNXA 3O3QA 1RY7A 2K4AB 4ZGRB 2HWAA 3CA5A 5DVHA 4Z9WB 4GP0A 3CRIA 3PMEA 1PWAA 3H6RB 3BAUA 3F1RA 3CA6A 1XZZA 3UD8A 4Q9GA 1XHBA 3H6QA 3HSMA 5D63A 1V6UA 1JTCA 1TP0A 2XOAA 3O4AA 3H6RA 3UD9A 2Z49A 4IZEA 1IJTA 4AN7B 1TIEA 1K5UA 3FJIA 3NBDA 1HWPB 1DFCA 1RG8A 2R9KB 4I96A 4USPA 4MZGB 4I8MA 3SNVA 4JPZA 3WO4A 4X37A 1DQGA 2MC2A 3CU1B 3OGGA 1S0BA 2KH2A 2ERMA 2FO1A 5G00A 3O4OA 3A07A 4USOA 5BP5C 1FV2A 2RQ9A 3FJHA 4JP0A 1WD3A 3IM6A 1T4QA 3FJBA 1W3GA 5D61A 4LO3A 3F62B 4F83A 1ABRB 4JQ0A 3POKA 2D20A 3AKGA 4GOYA 1YBIA 1YTOA 1HWNB 3O4DA 4XKIA 3T8SA 1S0EA 4QALA 4TLPA 1S0DA 4I4RA 2Y9GA 1HIBA 4QKRA 1ISWA 4KC3A 4OWKA 4ZOTA 3CRHA 4LO0A 1A8DA 2LIEA 3AZWA 2X2SA 4GOVA 3BAOA 4LO2A 2VLCA 2NZ9A 3FJFA 3R4SA 4LO0C 3AJ5A 4EFPA 1Q1UA 3AJ6A 4QD2C 4H04A 4KEKA 5F90A 4D0TA 4II0A 4KBBA 2YUGA 3FJJA 3OJMA 3WMUA 1YXWA 3OBRA 4HA2A 4LO1A 1DZDA 3UD7A 4OWLA 2ZR1B 1JT3A 2VSEA 2D44A 2D23A 4Q91A 1AVXB 3S8JA 4EFRA 1P63A 5BXSA 5FNWA 3H6SE 4DENA 4UY4A 1R8NA 5I1BA 4A7KA 4XFUA 1DJSB 2D24A 4QBCA 4JKQA 1FGAA 4FGFA 4IZXA 4I4XA 2D7IA 3FFZA 1PC8B 2FGFA 1PUUB 1TWEA 3AH1A 5F8WA 1BA7A 3NBEA 4EEEB 4I1EA 1G9BA 2FFUA 2K8RA 4ISQA 2RG9B 3CA3A 5EHAA 3FJAA 2IHOA 3AH2A 1JLXA 1XG6A 3AKHA 4CJMA 1CE7B 2L5XA 1II4A 1FV3A 4L4IA 2AFGA 1BLDA 1G82A 1IRPA 3IM5A 3ZC9A 5HPZA 3VT1A 4IQPA 4L4HA 41BIA 3P6JA 4I3NA 3VT0A 1RMLA 3Q7WA 2NYYA 1HKNA 2DRYA 3OBTA 1AVAC 1NUNA 4QC4A 1BFFA 4GAIA 3UJ4A 1JT7A 5F8YA 3IIRA
chains in the Genus database with same CATH topology
4ZFYB 2Z48A 2ZQNA 3OJVA 3W9TA 3RMYA 2BEBA 1IILA 1XYFA 5F8SA 1Q03A 2VXTI 3CA4A 2WRYA 3OJ2A 2KKIA 2NS2A 1BFGA 3O44A 1TTUA 3FJCA 3RSJA 3C9ZA 1G9DA 4JAWA 1SR4A 1EYLA 3JUTA 3NJ5A 3BRGC 3BB2A 2GO2A 1TFMB 4D0ZA 3V0BB 3VWCA 4QBVA 1MC9A 4OWJA 4I7IA 3FJEA 5DUYA 4ZBVB 3BAQA 1TWMA 3V0BA 3N7MA 4XFSA 2LIQA 2IWTB 4EKXB 4G9MA 3EF2A 4Z8SB 4ZFWB 1CVSA 3NBCA 4EB2B 1AVUA 4LO3C 1ISZA 1PUMB 1R8OA 4QO3A 1NZKA 1FWUA 4G1RA 1FQ9A 4GP3A 1WD4A 3VT2A 3I2AA 4FVVA 1K5VA 4MZHA 3VSZA 4DEPA 4J2XA 1MD6A 1S0FA 1JY0A 1HCDA 3V0AB 3BRDA 3FGMA 4IY8A 1RZOB 4AN6A 2KLLA 1DZCA 4A7ZA 2BFHA 3TC2A 1ILR1 3BTAA 1ISYA 2FFVA 4LO2C 1WBCA 5D62A 3BX1C 3IAGC 3BADA 1E0OA 3RTIB 1JLYA 3O49A 2VUAA 1M2TB 2MIBA 3V0AA 3P53A 5DZUA 2P23A 4A7YA 3S8KA 1GGPB 3LTQA 3RMXA 2VU9A 1QXMA 1JT5A 1Z4SA 4LO1C 2M49A 4JRAA 4R6UB 3ZC8A 1HCEA 2DRZA 4WBCA 3WINA 1S0GA 9ILBA 3ZXDA 4IONA 3HMYA 1IOBA 5BOWA 4LO7B 4GAFA 1BARA 3O5WB 2F8XC 1FWVA 3UJ0A 5B2HA 4P0JA 4X3AA 4I37A 3LLPA 4I1BA 1PZZA 4OEFA 3N7LA 1ISXA 3HOMA 2X2TA 5BQUA 3MALA 4DCKC 1DFQA 4YOLA 4OEGA 4KEJA 2E4MA 3I29B 3QR5A 4I4UA 3HBWA 8I1BA 1FMMS 1L2HA 3AH4A 3N7JA 3WO2A 1BASA 1OQLB 2AXMA 6I1BA 1I1EA 2HW9A 3Q7XA 1V6WA 1BFBA 1HWOB 1TOOA 4ENDA 4I4SA 2K43A 1S0CA 3D7WB 4I4OA 3AZVA 1WBAA 3RTJB 1AXMA 4I6IA 5EC5A 2Q3NB 1Z2VA 4H75A 1W3AA 2VSAA 4OUJA 2NP0A 3ZX7A 4J2SA 2RSTA 4LO8B 3I2XA 3BRFA 1V6VA 1D0HA 2HWMA 3KMVA 2VXRA 2QN4A 4I4PA 2DREA 5FZUA 4G6JA 3BAGA 3A22A 4H9WA 4OW4A 1VCLA 2NVHA 2AQZA 3NBNA 1AVWB 4QKSA 1ITBA 3CA0A 4G9NA 5BXRA 3VUOA 1IHKA 1F31A 4JKXB 3K1XA 2KI4A 5BXPA 1T9FA 4P0LA 1SR4C 21BIA 4ZA3B 1V6XA 3HALA 2F2FA 2UUSA 1J0SA 1BLAA 3N0KA 2I1BA 4X38A 4ZLBB 1HWMB 4IY9A 2F2FC 2HZ9A 3CQAA 3CAHA 2ESUA 3WO3A 2D43A 2FDBM 1ONKB 3ZXGA 5GAQA 1QQKA 5BP5A 2P39A 4IYBA 3Q7YA 3FUQA 3A21A 1W3FA 2NTDA 3HN1A 1N4KA 2BEAA 1KNMA 1Z0HA 1UPSA 1SZ6B 3O4BA 4ISRA 4OEEA 3AKFA 2D22A 4I4QA 2Q9XA 4QD2B 1IT0A 4MZFB 5DSSB 3UDAA 5JLVA 4HJJA 2D1ZA 4PC4A 3P6IA 4I0YA 2Y9WC 4Q9PA 4J23B 5JMCA 5EG6C 4G6MA 4P6AA 3BAVA 2MLLB 3AKIA 3OGFA 4J2YA 1EPWA 3PG0A 1QQLA 1G9CA 1JT4A 3FJKA 4J2KA 2ET2A 3WMVA 1M16A 3QYDA 5FZYA 1S0LA 3CRGA 1Q04A 2GZBA 3B9UA 3CA1A 4IHZA 4X39A 3V79C 2Y9FA 1YF8B 3WINC 1DIWA 5E24E 2AAIB 4I4VA 3PUBA 4I2SA 1I1BA 3VSFA 3O4CA 1AF9A 3PHZA 5FZZA 3WA1A 2QYIB 3BA5A 2NM1A 4ZKTB 1ISVA 1FMZA 2J3PA 4ZFUB 3JRRA 1IRAX 4P0KA 5BQUC 3FJ9A 3VEQA 3E8LC 5BXTA 4LO7C 1G9AA 3FUOA 1FN0A 2E4MC 3ILAA 2KI6B 1AFCA 3BAHA 1EV2A 4I4YA 5BVPI 1BFCA 1EVTA 4XFTA 2WBCA 3R4UA 4D8HA 2DS0A 4HR6C 3N7KA 2D7RA 3MPPG 1JQZA 7I1BA 31BIA 4KEIA 1YYNA 3BA7A 3IM7A 3FJ8A 3FJDA 3BA4A 2ZQOA 1DQOA 4F34A 2Y9XE 3A23A 4EFQA 1DLLA 5FNXA 3O3QA 1RY7A 2K4AB 4ZGRB 2HWAA 3CA5A 5DVHA 4Z9WB 4GP0A 3CRIA 3PMEA 1PWAA 3H6RB 3BAUA 3F1RA 3CA6A 1XZZA 3UD8A 4Q9GA 1XHBA 3H6QA 3HSMA 5D63A 1V6UA 1JTCA 1TP0A 2XOAA 3O4AA 3H6RA 3UD9A 2Z49A 4IZEA 1IJTA 4AN7B 1TIEA 1K5UA 3FJIA 3NBDA 1HWPB 1DFCA 1RG8A 2R9KB 4I96A 4USPA 4MZGB 4I8MA 3SNVA 4JPZA 3WO4A 4X37A 1DQGA 2MC2A 3CU1B 3OGGA 1S0BA 2KH2A 2ERMA 2FO1A 5G00A 3O4OA 3A07A 4USOA 5BP5C 1FV2A 2RQ9A 3FJHA 4JP0A 1WD3A 3IM6A 1T4QA 3FJBA 1W3GA 5D61A 4LO3A 3F62B 4F83A 1ABRB 4JQ0A 3POKA 2D20A 3AKGA 4GOYA 1YBIA 1YTOA 1HWNB 3O4DA 4XKIA 3T8SA 1S0EA 4QALA 4TLPA 1S0DA 4I4RA 2Y9GA 1HIBA 4QKRA 1ISWA 4KC3A 4OWKA 4ZOTA 3CRHA 4LO0A 1A8DA 2LIEA 3AZWA 2X2SA 4GOVA 3BAOA 4LO2A 2VLCA 2NZ9A 3FJFA 3R4SA 4LO0C 3AJ5A 4EFPA 1Q1UA 3AJ6A 4QD2C 4H04A 4KEKA 5F90A 4D0TA 4II0A 4KBBA 2YUGA 3FJJA 3OJMA 3WMUA 1YXWA 3OBRA 4HA2A 4LO1A 1DZDA 3UD7A 4OWLA 2ZR1B 1JT3A 2VSEA 2D44A 2D23A 4Q91A 1AVXB 3S8JA 4EFRA 1P63A 5BXSA 5FNWA 3H6SE 4DENA 4UY4A 1R8NA 5I1BA 4A7KA 4XFUA 1DJSB 2D24A 4QBCA 4JKQA 1FGAA 4FGFA 4IZXA 4I4XA 2D7IA 3FFZA 1PC8B 2FGFA 1PUUB 1TWEA 3AH1A 5F8WA 1BA7A 3NBEA 4EEEB 4I1EA 1G9BA 2FFUA 2K8RA 4ISQA 2RG9B 3CA3A 5EHAA 3FJAA 2IHOA 3AH2A 1JLXA 1XG6A 3AKHA 4CJMA 1CE7B 2L5XA 1II4A 1FV3A 4L4IA 2AFGA 1BLDA 1G82A 1IRPA 3IM5A 3ZC9A 5HPZA 3VT1A 4IQPA 4L4HA 41BIA 3P6JA 4I3NA 3VT0A 1RMLA 3Q7WA 2NYYA 1HKNA 2DRYA 3OBTA 1AVAC 1NUNA 4QC4A 1BFFA 4GAIA 3UJ4A 1JT7A 5F8YA 3IIRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZFY B;  2Z48 A;  2ZQN A;  3OJV A;  3W9T A;  3RMY A;  2BEB A;  1IIL A;  1XYF A;  5F8S A;  1Q03 A;  2VXT I;  3CA4 A;  2WRY A;  3OJ2 A;  2KKI A;  1BFG A;  3O44 A;  1TTU A;  3FJC A;  3RSJ A;  3C9Z A;  1G9D A;  4JAW A;  1SR4 A;  1EYL A;  3JUT A;  3NJ5 A;  3BRG C;  3BB2 A;  2GO2 A;  1TFM B;  4D0Z A;  3V0B B;  3VWC A;  4QBV A;  1MC9 A;  4OWJ A;  4I7I A;  3FJE A;  5DUY A;  4ZBV B;  3BAQ A;  1TWM A;  3V0B A;  3N7M A;  4XFS A;  2LIQ A;  2IWT B;  4EKX B;  4G9M A;  3EF2 A;  4Z8S B;  4ZFW B;  1CVS A;  3NBC A;  4EB2 B;  1AVU A;  4LO3 C;  1ISZ A;  1PUM B;  1R8O A;  4QO3 A;  1NZK A;  1FWU A;  4G1R A;  1FQ9 A;  4GP3 A;  1WD4 A;  3VT2 A;  3I2A A;  4FVV A;  1K5V A;  3VSZ A;  4DEP A;  4J2X A;  1MD6 A;  1S0F A;  1JY0 A;  1HCD A;  3V0A B;  3BRD A;  3FGM A;  4IY8 A;  1RZO B;  4AN6 A;  2KLL A;  1DZC A;  4A7Z A;  2BFH A;  3TC2 A;  1ILR 1;  3BTA A;  1ISY A;  2FFV A;  4LO2 C;  1WBC A;  5D62 A;  3BX1 C;  3IAG C;  3BAD A;  1E0O A;  3RTI B;  1JLY A;  3O49 A;  2VUA A;  1M2T B;  2MIB A;  3V0A A;  3P53 A;  5DZU A;  2P23 A;  4A7Y A;  3S8K A;  1GGP B;  3LTQ A;  3RMX A;  2VU9 A;  1QXM A;  1JT5 A;  1Z4S A;  4LO1 C;  2M49 A;  4JRA A;  4R6U B;  3ZC8 A;  1HCE A;  2DRZ A;  4WBC A;  3WIN A;  1S0G A;  9ILB A;  3ZXD A;  4ION A;  3HMY A;  1IOB A;  5BOW A;  4LO7 B;  4GAF A;  1BAR A;  3O5W B;  2F8X C;  1FWV A;  3UJ0 A;  5B2H A;  4P0J A;  4X3A A;  4I37 A;  3LLP A;  4I1B A;  1PZZ A;  4OEF A;  3N7L A;  1ISX A;  3HOM A;  2X2T A;  5BQU A;  3MAL A;  4DCK C;  1DFQ A;  4YOL A;  4OEG A;  4KEJ A;  2E4M A;  3I29 B;  3QR5 A;  4I4U A;  3HBW A;  8I1B A;  1FMM S;  1L2H A;  3AH4 A;  3N7J A;  3WO2 A;  1BAS A;  1OQL B;  2AXM A;  6I1B A;  1I1E A;  2HW9 A;  3Q7X A;  1V6W A;  1BFB A;  1HWO B;  1TOO A;  4END A;  4I4S A;  2K43 A;  1S0C A;  3D7W B;  4I4O A;  3AZV A;  1WBA A;  3RTJ B;  1AXM A;  4I6I A;  5EC5 A;  2Q3N B;  1Z2V A;  1W3A A;  2VSA A;  4OUJ A;  2NP0 A;  3ZX7 A;  4J2S A;  2RST A;  4LO8 B;  3I2X A;  3BRF A;  1V6V A;  1D0H A;  2HWM A;  3KMV A;  2VXR A;  2QN4 A;  4I4P A;  2DRE A;  5FZU A;  4G6J A;  3BAG A;  3A22 A;  4H9W A;  4OW4 A;  1VCL A;  2NVH A;  2AQZ A;  3NBN A;  1AVW B;  4QKS A;  1ITB A;  3CA0 A;  4G9N A;  5BXR A;  3VUO A;  1IHK A;  1F31 A;  4JKX B;  3K1X A;  2KI4 A;  5BXP A;  1T9F A;  4P0L A;  1SR4 C;  21BI A;  4ZA3 B;  1V6X A;  3HAL A;  2F2F A;  2UUS A;  1J0S A;  1BLA A;  3N0K A;  2I1B A;  4X38 A;  4ZLB B;  1HWM B;  4IY9 A;  2F2F C;  2HZ9 A;  3CQA A;  3CAH A;  2ESU A;  3WO3 A;  2D43 A;  2FDB M;  1ONK B;  3ZXG A;  5GAQ A;  1QQK A;  5BP5 A;  2P39 A;  4IYB A;  3Q7Y A;  3FUQ A;  3A21 A;  1W3F A;  2NTD A;  3HN1 A;  1N4K A;  2BEA A;  1KNM A;  1Z0H A;  1UPS A;  1SZ6 B;  3O4B A;  4ISR A;  4OEE A;  3AKF A;  2D22 A;  4I4Q A;  2Q9X A;  4QD2 B;  1IT0 A;  5DSS B;  3UDA A;  5JLV A;  4HJJ A;  2D1Z A;  4PC4 A;  3P6I A;  4I0Y A;  2Y9W C;  4Q9P A;  4J23 B;  5JMC A;  5EG6 C;  4G6M A;  4P6A A;  3BAV A;  2MLL B;  3AKI A;  3OGF A;  4J2Y A;  1EPW A;  3PG0 A;  1QQL A;  1G9C A;  1JT4 A;  3FJK A;  4J2K A;  2ET2 A;  3WMV A;  1M16 A;  3QYD A;  5FZY A;  1S0L A;  3CRG A;  1Q04 A;  2GZB A;  3B9U A;  3CA1 A;  4IHZ A;  4X39 A;  3V79 C;  2Y9F A;  1YF8 B;  3WIN C;  1DIW A;  5E24 E;  2AAI B;  4I4V A;  3PUB A;  4I2S A;  1I1B A;  3VSF A;  3O4C A;  1AF9 A;  3PHZ A;  5FZZ A;  3WA1 A;  2QYI B;  3BA5 A;  2NM1 A;  4ZKT B;  1ISV A;  1FMZ A;  2J3P A;  4ZFU B;  3JRR A;  1IRA X;  4P0K A;  5BQU C;  3FJ9 A;  3VEQ A;  3E8L C;  5BXT A;  4LO7 C;  1G9A A;  3FUO A;  1FN0 A;  2E4M C;  3ILA A;  2KI6 B;  1AFC A;  3BAH A;  1EV2 A;  4I4Y A;  5BVP I;  1BFC A;  1EVT A;  4XFT A;  2WBC A;  3R4U A;  4D8H A;  2DS0 A;  4HR6 C;  3N7K A;  2D7R A;  3MPP G;  1JQZ A;  7I1B A;  31BI A;  4KEI A;  1YYN A;  3BA7 A;  3IM7 A;  3FJ8 A;  3FJD A;  3BA4 A;  2ZQO A;  1DQO A;  4F34 A;  2Y9X E;  3A23 A;  4EFQ A;  1DLL A;  5FNX A;  3O3Q A;  1RY7 A;  2K4A B;  4ZGR B;  2HWA A;  3CA5 A;  5DVH A;  4Z9W B;  4GP0 A;  3CRI A;  3PME A;  1PWA A;  3H6R B;  3BAU A;  3F1R A;  3CA6 A;  1XZZ A;  3UD8 A;  4Q9G A;  1XHB A;  3H6Q A;  3HSM A;  5D63 A;  1V6U A;  1JTC A;  1TP0 A;  2XOA A;  3O4A A;  3H6R A;  3UD9 A;  2Z49 A;  4IZE A;  1IJT A;  4AN7 B;  1TIE A;  1K5U A;  3FJI A;  3NBD A;  1HWP B;  1DFC A;  1RG8 A;  2R9K B;  4I96 A;  4USP A;  4I8M A;  3SNV A;  4JPZ A;  3WO4 A;  4X37 A;  1DQG A;  2MC2 A;  3CU1 B;  3OGG A;  1S0B A;  2KH2 A;  2ERM A;  2FO1 A;  5G00 A;  3O4O A;  3A07 A;  4USO A;  5BP5 C;  1FV2 A;  2RQ9 A;  3FJH A;  4JP0 A;  1WD3 A;  3IM6 A;  1T4Q A;  3FJB A;  1W3G A;  5D61 A;  4LO3 A;  3F62 B;  4F83 A;  1ABR B;  4JQ0 A;  3POK A;  2D20 A;  3AKG A;  4GOY A;  1YBI A;  1YTO A;  1HWN B;  3O4D A;  4XKI A;  3T8S A;  1S0E A;  4QAL A;  4TLP A;  1S0D A;  4I4R A;  2Y9G A;  1HIB A;  4QKR A;  1ISW A;  4KC3 A;  4OWK A;  4ZOT A;  3CRH A;  4LO0 A;  1A8D A;  2LIE A;  3AZW A;  2X2S A;  4GOV A;  3BAO A;  4LO2 A;  2VLC A;  2NZ9 A;  3FJF A;  3R4S A;  4LO0 C;  3AJ5 A;  4EFP A;  1Q1U A;  3AJ6 A;  4QD2 C;  4H04 A;  4KEK A;  5F90 A;  4D0T A;  4II0 A;  4KBB A;  2YUG A;  3FJJ A;  3OJM A;  3WMU A;  1YXW A;  3OBR A;  4HA2 A;  4LO1 A;  1DZD A;  3UD7 A;  4OWL A;  2ZR1 B;  1JT3 A;  2VSE A;  2D44 A;  2D23 A;  4Q91 A;  1AVX B;  3S8J A;  4EFR A;  1P63 A;  5BXS A;  5FNW A;  3H6S E;  4DEN A;  1R8N A;  5I1B A;  4A7K A;  4XFU A;  1DJS B;  2D24 A;  4QBC A;  4JKQ A;  1FGA A;  4FGF A;  4IZX A;  4I4X A;  2D7I A;  3FFZ A;  1PC8 B;  2FGF A;  1PUU B;  1TWE A;  3AH1 A;  5F8W A;  1BA7 A;  3NBE A;  4EEE B;  4I1E A;  1G9B A;  2FFU A;  2K8R A;  4ISQ A;  2RG9 B;  3CA3 A;  5EHA A;  3FJA A;  2IHO A;  3AH2 A;  1JLX A;  1XG6 A;  3AKH A;  4CJM A;  1CE7 B;  2L5X A;  1II4 A;  1FV3 A;  4L4I A;  2AFG A;  1BLD A;  1G82 A;  1IRP A;  3IM5 A;  3ZC9 A;  5HPZ A;  3VT1 A;  4IQP A;  4L4H A;  41BI A;  3P6J A;  4I3N A;  3VT0 A;  1RML A;  3Q7W A;  2NYY A;  1HKN A;  2DRY A;  3OBT A;  1AVA C;  1NUN A;  4QC4 A;  1BFF A;  4GAI A;  3UJ4 A;  1JT7 A;  5F8Y A;  3IIR A; 
#chains in the Genus database with same CATH topology
 4ZFY B;  2Z48 A;  2ZQN A;  3OJV A;  3W9T A;  3RMY A;  2BEB A;  1IIL A;  1XYF A;  5F8S A;  1Q03 A;  2VXT I;  3CA4 A;  2WRY A;  3OJ2 A;  2KKI A;  2NS2 A;  1BFG A;  3O44 A;  1TTU A;  3FJC A;  3RSJ A;  3C9Z A;  1G9D A;  4JAW A;  1SR4 A;  1EYL A;  3JUT A;  3NJ5 A;  3BRG C;  3BB2 A;  2GO2 A;  1TFM B;  4D0Z A;  3V0B B;  3VWC A;  4QBV A;  1MC9 A;  4OWJ A;  4I7I A;  3FJE A;  5DUY A;  4ZBV B;  3BAQ A;  1TWM A;  3V0B A;  3N7M A;  4XFS A;  2LIQ A;  2IWT B;  4EKX B;  4G9M A;  3EF2 A;  4Z8S B;  4ZFW B;  1CVS A;  3NBC A;  4EB2 B;  1AVU A;  4LO3 C;  1ISZ A;  1PUM B;  1R8O A;  4QO3 A;  1NZK A;  1FWU A;  4G1R A;  1FQ9 A;  4GP3 A;  1WD4 A;  3VT2 A;  3I2A A;  4FVV A;  1K5V A;  4MZH A;  3VSZ A;  4DEP A;  4J2X A;  1MD6 A;  1S0F A;  1JY0 A;  1HCD A;  3V0A B;  3BRD A;  3FGM A;  4IY8 A;  1RZO B;  4AN6 A;  2KLL A;  1DZC A;  4A7Z A;  2BFH A;  3TC2 A;  1ILR 1;  3BTA A;  1ISY A;  2FFV A;  4LO2 C;  1WBC A;  5D62 A;  3BX1 C;  3IAG C;  3BAD A;  1E0O A;  3RTI B;  1JLY A;  3O49 A;  2VUA A;  1M2T B;  2MIB A;  3V0A A;  3P53 A;  5DZU A;  2P23 A;  4A7Y A;  3S8K A;  1GGP B;  3LTQ A;  3RMX A;  2VU9 A;  1QXM A;  1JT5 A;  1Z4S A;  4LO1 C;  2M49 A;  4JRA A;  4R6U B;  3ZC8 A;  1HCE A;  2DRZ A;  4WBC A;  3WIN A;  1S0G A;  9ILB A;  3ZXD A;  4ION A;  3HMY A;  1IOB A;  5BOW A;  4LO7 B;  4GAF A;  1BAR A;  3O5W B;  2F8X C;  1FWV A;  3UJ0 A;  5B2H A;  4P0J A;  4X3A A;  4I37 A;  3LLP A;  4I1B A;  1PZZ A;  4OEF A;  3N7L A;  1ISX A;  3HOM A;  2X2T A;  5BQU A;  3MAL A;  4DCK C;  1DFQ A;  4YOL A;  4OEG A;  4KEJ A;  2E4M A;  3I29 B;  3QR5 A;  4I4U A;  3HBW A;  8I1B A;  1FMM S;  1L2H A;  3AH4 A;  3N7J A;  3WO2 A;  1BAS A;  1OQL B;  2AXM A;  6I1B A;  1I1E A;  2HW9 A;  3Q7X A;  1V6W A;  1BFB A;  1HWO B;  1TOO A;  4END A;  4I4S A;  2K43 A;  1S0C A;  3D7W B;  4I4O A;  3AZV A;  1WBA A;  3RTJ B;  1AXM A;  4I6I A;  5EC5 A;  2Q3N B;  1Z2V A;  4H75 A;  1W3A A;  2VSA A;  4OUJ A;  2NP0 A;  3ZX7 A;  4J2S A;  2RST A;  4LO8 B;  3I2X A;  3BRF A;  1V6V A;  1D0H A;  2HWM A;  3KMV A;  2VXR A;  2QN4 A;  4I4P A;  2DRE A;  5FZU A;  4G6J A;  3BAG A;  3A22 A;  4H9W A;  4OW4 A;  1VCL A;  2NVH A;  2AQZ A;  3NBN A;  1AVW B;  4QKS A;  1ITB A;  3CA0 A;  4G9N A;  5BXR A;  3VUO A;  1IHK A;  1F31 A;  4JKX B;  3K1X A;  2KI4 A;  5BXP A;  1T9F A;  4P0L A;  1SR4 C;  21BI A;  4ZA3 B;  1V6X A;  3HAL A;  2F2F A;  2UUS A;  1J0S A;  1BLA A;  3N0K A;  2I1B A;  4X38 A;  4ZLB B;  1HWM B;  4IY9 A;  2F2F C;  2HZ9 A;  3CQA A;  3CAH A;  2ESU A;  3WO3 A;  2D43 A;  2FDB M;  1ONK B;  3ZXG A;  5GAQ A;  1QQK A;  5BP5 A;  2P39 A;  4IYB A;  3Q7Y A;  3FUQ A;  3A21 A;  1W3F A;  2NTD A;  3HN1 A;  1N4K A;  2BEA A;  1KNM A;  1Z0H A;  1UPS A;  1SZ6 B;  3O4B A;  4ISR A;  4OEE A;  3AKF A;  2D22 A;  4I4Q A;  2Q9X A;  4QD2 B;  1IT0 A;  4MZF B;  5DSS B;  3UDA A;  5JLV A;  4HJJ A;  2D1Z A;  4PC4 A;  3P6I A;  4I0Y A;  2Y9W C;  4Q9P A;  4J23 B;  5JMC A;  5EG6 C;  4G6M A;  4P6A A;  3BAV A;  2MLL B;  3AKI A;  3OGF A;  4J2Y A;  1EPW A;  3PG0 A;  1QQL A;  1G9C A;  1JT4 A;  3FJK A;  4J2K A;  2ET2 A;  3WMV A;  1M16 A;  3QYD A;  5FZY A;  1S0L A;  3CRG A;  1Q04 A;  2GZB A;  3B9U A;  3CA1 A;  4IHZ A;  4X39 A;  3V79 C;  2Y9F A;  1YF8 B;  3WIN C;  1DIW A;  5E24 E;  2AAI B;  4I4V A;  3PUB A;  4I2S A;  1I1B A;  3VSF A;  3O4C A;  1AF9 A;  3PHZ A;  5FZZ A;  3WA1 A;  2QYI B;  3BA5 A;  2NM1 A;  4ZKT B;  1ISV A;  1FMZ A;  2J3P A;  4ZFU B;  3JRR A;  1IRA X;  4P0K A;  5BQU C;  3FJ9 A;  3VEQ A;  3E8L C;  5BXT A;  4LO7 C;  1G9A A;  3FUO A;  1FN0 A;  2E4M C;  3ILA A;  2KI6 B;  1AFC A;  3BAH A;  1EV2 A;  4I4Y A;  5BVP I;  1BFC A;  1EVT A;  4XFT A;  2WBC A;  3R4U A;  4D8H A;  2DS0 A;  4HR6 C;  3N7K A;  2D7R A;  3MPP G;  1JQZ A;  7I1B A;  31BI A;  4KEI A;  1YYN A;  3BA7 A;  3IM7 A;  3FJ8 A;  3FJD A;  3BA4 A;  2ZQO A;  1DQO A;  4F34 A;  2Y9X E;  3A23 A;  4EFQ A;  1DLL A;  5FNX A;  3O3Q A;  1RY7 A;  2K4A B;  4ZGR B;  2HWA A;  3CA5 A;  5DVH A;  4Z9W B;  4GP0 A;  3CRI A;  3PME A;  1PWA A;  3H6R B;  3BAU A;  3F1R A;  3CA6 A;  1XZZ A;  3UD8 A;  4Q9G A;  1XHB A;  3H6Q A;  3HSM A;  5D63 A;  1V6U A;  1JTC A;  1TP0 A;  2XOA A;  3O4A A;  3H6R A;  3UD9 A;  2Z49 A;  4IZE A;  1IJT A;  4AN7 B;  1TIE A;  1K5U A;  3FJI A;  3NBD A;  1HWP B;  1DFC A;  1RG8 A;  2R9K B;  4I96 A;  4USP A;  4MZG B;  4I8M A;  3SNV A;  4JPZ A;  3WO4 A;  4X37 A;  1DQG A;  2MC2 A;  3CU1 B;  3OGG A;  1S0B A;  2KH2 A;  2ERM A;  2FO1 A;  5G00 A;  3O4O A;  3A07 A;  4USO A;  5BP5 C;  1FV2 A;  2RQ9 A;  3FJH A;  4JP0 A;  1WD3 A;  3IM6 A;  1T4Q A;  3FJB A;  1W3G A;  5D61 A;  4LO3 A;  3F62 B;  4F83 A;  1ABR B;  4JQ0 A;  3POK A;  2D20 A;  3AKG A;  4GOY A;  1YBI A;  1YTO A;  1HWN B;  3O4D A;  4XKI A;  3T8S A;  1S0E A;  4QAL A;  4TLP A;  1S0D A;  4I4R A;  2Y9G A;  1HIB A;  4QKR A;  1ISW A;  4KC3 A;  4OWK A;  4ZOT A;  3CRH A;  4LO0 A;  1A8D A;  2LIE A;  3AZW A;  2X2S A;  4GOV A;  3BAO A;  4LO2 A;  2VLC A;  2NZ9 A;  3FJF A;  3R4S A;  4LO0 C;  3AJ5 A;  4EFP A;  1Q1U A;  3AJ6 A;  4QD2 C;  4H04 A;  4KEK A;  5F90 A;  4D0T A;  4II0 A;  4KBB A;  2YUG A;  3FJJ A;  3OJM A;  3WMU A;  1YXW A;  3OBR A;  4HA2 A;  4LO1 A;  1DZD A;  3UD7 A;  4OWL A;  2ZR1 B;  1JT3 A;  2VSE A;  2D44 A;  2D23 A;  4Q91 A;  1AVX B;  3S8J A;  4EFR A;  1P63 A;  5BXS A;  5FNW A;  3H6S E;  4DEN A;  4UY4 A;  1R8N A;  5I1B A;  4A7K A;  4XFU A;  1DJS B;  2D24 A;  4QBC A;  4JKQ A;  1FGA A;  4FGF A;  4IZX A;  4I4X A;  2D7I A;  3FFZ A;  1PC8 B;  2FGF A;  1PUU B;  1TWE A;  3AH1 A;  5F8W A;  1BA7 A;  3NBE A;  4EEE B;  4I1E A;  1G9B A;  2FFU A;  2K8R A;  4ISQ A;  2RG9 B;  3CA3 A;  5EHA A;  3FJA A;  2IHO A;  3AH2 A;  1JLX A;  1XG6 A;  3AKH A;  4CJM A;  1CE7 B;  2L5X A;  1II4 A;  1FV3 A;  4L4I A;  2AFG A;  1BLD A;  1G82 A;  1IRP A;  3IM5 A;  3ZC9 A;  5HPZ A;  3VT1 A;  4IQP A;  4L4H A;  41BI A;  3P6J A;  4I3N A;  3VT0 A;  1RML A;  3Q7W A;  2NYY A;  1HKN A;  2DRY A;  3OBT A;  1AVA C;  1NUN A;  4QC4 A;  1BFF A;  4GAI A;  3UJ4 A;  1JT7 A;  5F8Y A;  3IIR A; 
#chains in the Genus database with same CATH homology
 4ZFY B;  2Z48 A;  2ZQN A;  3OJV A;  3W9T A;  3RMY A;  2BEB A;  1IIL A;  1XYF A;  5F8S A;  1Q03 A;  2VXT I;  3CA4 A;  2WRY A;  3OJ2 A;  2KKI A;  2NS2 A;  1BFG A;  3O44 A;  1TTU A;  3FJC A;  3RSJ A;  3C9Z A;  1G9D A;  4JAW A;  1SR4 A;  1EYL A;  3JUT A;  3NJ5 A;  3BRG C;  3BB2 A;  2GO2 A;  1TFM B;  4D0Z A;  3V0B B;  3VWC A;  4QBV A;  1MC9 A;  4OWJ A;  4I7I A;  3FJE A;  5DUY A;  4ZBV B;  3BAQ A;  1TWM A;  3V0B A;  3N7M A;  4XFS A;  2LIQ A;  2IWT B;  4EKX B;  4G9M A;  3EF2 A;  4Z8S B;  4ZFW B;  1CVS A;  3NBC A;  4EB2 B;  1AVU A;  4LO3 C;  1ISZ A;  1PUM B;  1R8O A;  4QO3 A;  1NZK A;  1FWU A;  4G1R A;  1FQ9 A;  4GP3 A;  1WD4 A;  3VT2 A;  3I2A A;  4FVV A;  1K5V A;  4MZH A;  3VSZ A;  4DEP A;  4J2X A;  1MD6 A;  1S0F A;  1JY0 A;  1HCD A;  3V0A B;  3BRD A;  3FGM A;  4IY8 A;  1RZO B;  4AN6 A;  2KLL A;  1DZC A;  4A7Z A;  2BFH A;  3TC2 A;  1ILR 1;  3BTA A;  1ISY A;  2FFV A;  4LO2 C;  1WBC A;  5D62 A;  3BX1 C;  3IAG C;  3BAD A;  1E0O A;  3RTI B;  1JLY A;  3O49 A;  2VUA A;  1M2T B;  2MIB A;  3V0A A;  3P53 A;  5DZU A;  2P23 A;  4A7Y A;  3S8K A;  1GGP B;  3LTQ A;  3RMX A;  2VU9 A;  1QXM A;  1JT5 A;  1Z4S A;  4LO1 C;  2M49 A;  4JRA A;  4R6U B;  3ZC8 A;  1HCE A;  2DRZ A;  4WBC A;  3WIN A;  1S0G A;  9ILB A;  3ZXD A;  4ION A;  3HMY A;  1IOB A;  5BOW A;  4LO7 B;  4GAF A;  1BAR A;  3O5W B;  2F8X C;  1FWV A;  3UJ0 A;  5B2H A;  4P0J A;  4X3A A;  4I37 A;  3LLP A;  4I1B A;  1PZZ A;  4OEF A;  3N7L A;  1ISX A;  3HOM A;  2X2T A;  5BQU A;  3MAL A;  4DCK C;  1DFQ A;  4YOL A;  4OEG A;  4KEJ A;  2E4M A;  3I29 B;  3QR5 A;  4I4U A;  3HBW A;  8I1B A;  1FMM S;  1L2H A;  3AH4 A;  3N7J A;  3WO2 A;  1BAS A;  1OQL B;  2AXM A;  6I1B A;  1I1E A;  2HW9 A;  3Q7X A;  1V6W A;  1BFB A;  1HWO B;  1TOO A;  4END A;  4I4S A;  2K43 A;  1S0C A;  3D7W B;  4I4O A;  3AZV A;  1WBA A;  3RTJ B;  1AXM A;  4I6I A;  5EC5 A;  2Q3N B;  1Z2V A;  4H75 A;  1W3A A;  2VSA A;  4OUJ A;  2NP0 A;  3ZX7 A;  4J2S A;  2RST A;  4LO8 B;  3I2X A;  3BRF A;  1V6V A;  1D0H A;  2HWM A;  3KMV A;  2VXR A;  2QN4 A;  4I4P A;  2DRE A;  5FZU A;  4G6J A;  3BAG A;  3A22 A;  4H9W A;  4OW4 A;  1VCL A;  2NVH A;  2AQZ A;  3NBN A;  1AVW B;  4QKS A;  1ITB A;  3CA0 A;  4G9N A;  5BXR A;  3VUO A;  1IHK A;  1F31 A;  4JKX B;  3K1X A;  2KI4 A;  5BXP A;  1T9F A;  4P0L A;  1SR4 C;  21BI A;  4ZA3 B;  1V6X A;  3HAL A;  2F2F A;  2UUS A;  1J0S A;  1BLA A;  3N0K A;  2I1B A;  4X38 A;  4ZLB B;  1HWM B;  4IY9 A;  2F2F C;  2HZ9 A;  3CQA A;  3CAH A;  2ESU A;  3WO3 A;  2D43 A;  2FDB M;  1ONK B;  3ZXG A;  5GAQ A;  1QQK A;  5BP5 A;  2P39 A;  4IYB A;  3Q7Y A;  3FUQ A;  3A21 A;  1W3F A;  2NTD A;  3HN1 A;  1N4K A;  2BEA A;  1KNM A;  1Z0H A;  1UPS A;  1SZ6 B;  3O4B A;  4ISR A;  4OEE A;  3AKF A;  2D22 A;  4I4Q A;  2Q9X A;  4QD2 B;  1IT0 A;  4MZF B;  5DSS B;  3UDA A;  5JLV A;  4HJJ A;  2D1Z A;  4PC4 A;  3P6I A;  4I0Y A;  2Y9W C;  4Q9P A;  4J23 B;  5JMC A;  5EG6 C;  4G6M A;  4P6A A;  3BAV A;  2MLL B;  3AKI A;  3OGF A;  4J2Y A;  1EPW A;  3PG0 A;  1QQL A;  1G9C A;  1JT4 A;  3FJK A;  4J2K A;  2ET2 A;  3WMV A;  1M16 A;  3QYD A;  5FZY A;  1S0L A;  3CRG A;  1Q04 A;  2GZB A;  3B9U A;  3CA1 A;  4IHZ A;  4X39 A;  3V79 C;  2Y9F A;  1YF8 B;  3WIN C;  1DIW A;  5E24 E;  2AAI B;  4I4V A;  3PUB A;  4I2S A;  1I1B A;  3VSF A;  3O4C A;  1AF9 A;  3PHZ A;  5FZZ A;  3WA1 A;  2QYI B;  3BA5 A;  2NM1 A;  4ZKT B;  1ISV A;  1FMZ A;  2J3P A;  4ZFU B;  3JRR A;  1IRA X;  4P0K A;  5BQU C;  3FJ9 A;  3VEQ A;  3E8L C;  5BXT A;  4LO7 C;  1G9A A;  3FUO A;  1FN0 A;  2E4M C;  3ILA A;  2KI6 B;  1AFC A;  3BAH A;  1EV2 A;  4I4Y A;  5BVP I;  1BFC A;  1EVT A;  4XFT A;  2WBC A;  3R4U A;  4D8H A;  2DS0 A;  4HR6 C;  3N7K A;  2D7R A;  3MPP G;  1JQZ A;  7I1B A;  31BI A;  4KEI A;  1YYN A;  3BA7 A;  3IM7 A;  3FJ8 A;  3FJD A;  3BA4 A;  2ZQO A;  1DQO A;  4F34 A;  2Y9X E;  3A23 A;  4EFQ A;  1DLL A;  5FNX A;  3O3Q A;  1RY7 A;  2K4A B;  4ZGR B;  2HWA A;  3CA5 A;  5DVH A;  4Z9W B;  4GP0 A;  3CRI A;  3PME A;  1PWA A;  3H6R B;  3BAU A;  3F1R A;  3CA6 A;  1XZZ A;  3UD8 A;  4Q9G A;  1XHB A;  3H6Q A;  3HSM A;  5D63 A;  1V6U A;  1JTC A;  1TP0 A;  2XOA A;  3O4A A;  3H6R A;  3UD9 A;  2Z49 A;  4IZE A;  1IJT A;  4AN7 B;  1TIE A;  1K5U A;  3FJI A;  3NBD A;  1HWP B;  1DFC A;  1RG8 A;  2R9K B;  4I96 A;  4USP A;  4MZG B;  4I8M A;  3SNV A;  4JPZ A;  3WO4 A;  4X37 A;  1DQG A;  2MC2 A;  3CU1 B;  3OGG A;  1S0B A;  2KH2 A;  2ERM A;  2FO1 A;  5G00 A;  3O4O A;  3A07 A;  4USO A;  5BP5 C;  1FV2 A;  2RQ9 A;  3FJH A;  4JP0 A;  1WD3 A;  3IM6 A;  1T4Q A;  3FJB A;  1W3G A;  5D61 A;  4LO3 A;  3F62 B;  4F83 A;  1ABR B;  4JQ0 A;  3POK A;  2D20 A;  3AKG A;  4GOY A;  1YBI A;  1YTO A;  1HWN B;  3O4D A;  4XKI A;  3T8S A;  1S0E A;  4QAL A;  4TLP A;  1S0D A;  4I4R A;  2Y9G A;  1HIB A;  4QKR A;  1ISW A;  4KC3 A;  4OWK A;  4ZOT A;  3CRH A;  4LO0 A;  1A8D A;  2LIE A;  3AZW A;  2X2S A;  4GOV A;  3BAO A;  4LO2 A;  2VLC A;  2NZ9 A;  3FJF A;  3R4S A;  4LO0 C;  3AJ5 A;  4EFP A;  1Q1U A;  3AJ6 A;  4QD2 C;  4H04 A;  4KEK A;  5F90 A;  4D0T A;  4II0 A;  4KBB A;  2YUG A;  3FJJ A;  3OJM A;  3WMU A;  1YXW A;  3OBR A;  4HA2 A;  4LO1 A;  1DZD A;  3UD7 A;  4OWL A;  2ZR1 B;  1JT3 A;  2VSE A;  2D44 A;  2D23 A;  4Q91 A;  1AVX B;  3S8J A;  4EFR A;  1P63 A;  5BXS A;  5FNW A;  3H6S E;  4DEN A;  4UY4 A;  1R8N A;  5I1B A;  4A7K A;  4XFU A;  1DJS B;  2D24 A;  4QBC A;  4JKQ A;  1FGA A;  4FGF A;  4IZX A;  4I4X A;  2D7I A;  3FFZ A;  1PC8 B;  2FGF A;  1PUU B;  1TWE A;  3AH1 A;  5F8W A;  1BA7 A;  3NBE A;  4EEE B;  4I1E A;  1G9B A;  2FFU A;  2K8R A;  4ISQ A;  2RG9 B;  3CA3 A;  5EHA A;  3FJA A;  2IHO A;  3AH2 A;  1JLX A;  1XG6 A;  3AKH A;  4CJM A;  1CE7 B;  2L5X A;  1II4 A;  1FV3 A;  4L4I A;  2AFG A;  1BLD A;  1G82 A;  1IRP A;  3IM5 A;  3ZC9 A;  5HPZ A;  3VT1 A;  4IQP A;  4L4H A;  41BI A;  3P6J A;  4I3N A;  3VT0 A;  1RML A;  3Q7W A;  2NYY A;  1HKN A;  2DRY A;  3OBT A;  1AVA C;  1NUN A;  4QC4 A;  1BFF A;  4GAI A;  3UJ4 A;  1JT7 A;  5F8Y A;  3IIR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...