3FJ8A

Crystal structure of c117i mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
b'HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSIKRGPRTHYGQKAILFLPLPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Heparin-binding growth factor 1
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hormone
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fj8A00
1Z0HA 3PHZA 3HN1A 1M16A 2FFVA 2KKIA 1ABRB 3I29B 3KMVA 1HWPB 3FGMA 3BRFA 5D61A 5DUYA 3P6IA 1S0CA 4JPZA 3VT0A 1F31A 1TP0A 1FV2A 2VXTI 3N7KA 3R4SA 3WA1A 1K5UA 4ISQA 1SR4A 3FJHA 4A7ZA 1QQKA 4GP3A 4Z8SB 2BEAA 2AXMA 4XFTA 1PC8B 3D7WB 3RMYA 1NUNA 2D44A 2Z49A 2F2FA 3C9ZA 3P6JA 4GOYA 3WINA 3RMXA 2VXRA 4II0A 4I4VA 1QQLA 3PMEA 1ISVA 4EFRA 4H04A 3O44A 1BFGA 3FJFA 3H6SE 4DENA 4I2SA 3NBEA 4I0YA 2GO2A 4JRAA 1IT0A 3AJ6A 3A21A 1TWEA 2RQ9A 4H9WA 5F8YA 2ERMA 1OQLB 1TWMA 1BFBA 3OBTA 3BAHA 1AVWB 1V6UA 2AAIB 4I8MA 1N4KA 4G6JA 3V79C 1V6WA 8I1BA 4X39A 4LO2C 3VSZA 2P23A 31BIA 5DVHA 2GZBA 1MD6A 4I1BA 3BAGA 2NM1A 1Z2VA 4IY8A 3N0KA 5B2HA 1RZOB 3BB2A 4GP0A 3Q7XA 4FVVA 4TLPA 1G82A 3W9TA 5F8SA 5G00A 3O49A 3A22A 4OUJA 4ZKTB 3CQAA 1BFCA 3CA6A 1Z4SA 2K4AB 2MIBA 1ISXA 4LO1C 2RG9B 3OGFA 1II4A 1BLAA 4X38A 4IQPA 3B9UA 4OEGA 3FJKA 1TTUA 1Q1UA 4LO2A 4OWKA 4LO7B 4EFQA 4LO0A 3O4AA 2HW9A 1FN0A 1JTCA 1CE7B 3NBDA 4EEEB 2M49A 3O4DA 3EF2A 4IZEA 3RTJB 1V6XA 4GAFA 1QXMA 2RSTA 4OWJA 9ILBA 5I1BA 2D7RA 4I37A 3VUOA 1JT3A 2LIEA 3O4OA 3T8SA 1EYLA 1BARA 3JUTA 4IHZA 1YYNA 4ZFYB 2D23A 4USPA 4OW4A 4I4RA 3NBCA 3ZC9A 3CA1A 2YUGA 1L2HA 4D8HA 4R6UB 1DFQA 3RSJA 4EB2B 3NJ5A 3K1XA 3WO4A 4EKXB 1KNMA 3FJ8A 3FJIA 1BA7A 3V0AB 1JT4A 2BFHA 1DQOA 4J23B 2D24A 3AH2A 3V0AA 1IOBA 3ZXGA 2F8XC 1DJSB 2D22A 1S0FA 2R9KB 1A8DA 3ZX7A 4J2KA 4D0ZA 3FFZA 4JKXB 4P0KA 3BRDA 4HJJA 2ZQNA 2FDBM 3HMYA 5BXRA 4JQ0A 2MC2A 4I96A 4OWLA 3I2XA 1S0DA 3FJ9A 3SNVA 3BRGC 4I4SA 1AVAC 2ZR1B 1SZ6B 3VWCA 5F8WA 4OEFA 1WD4A 2D43A 1FQ9A 2VLCA 4JKQA 1JT5A 2Q9XA 1IRPA 2AQZA 4I4UA 2FO1A 1FMZA 1AF9A 1XZZA 1RG8A 2IHOA 4L4IA 3LTQA 1ISZA 1HCDA 1YTOA 4QO3A 3CU1B 3UD9A 4QC4A 1YBIA 2QYIB 3F62B 4ZBVB 1DZDA 3PUBA 1V6VA 2D7IA 1DLLA 2VSAA 2D20A 4I4QA 5GAQA 5E24E 4HR6C 5JMCA 4IONA 3WMUA 3S8JA 1D0HA 3P53A 4ISRA 4LO0C 3IAGC 2NYYA 4LO7C 4J2XA 2Y9WC 3VT2A 1ITBA 1RY7A 3H6QA 5F90A 3UD7A 3WMVA 3OBRA 3UJ0A 2KI4A 3PG0A 1BFFA 2BEBA 1HKNA 4KEJA 1DZCA 3AKFA 4USOA 4I4YA 4IYBA 3HBWA 1NZKA 3IM7A 4G9NA 5HPZA 1AVXB 1XYFA 4Q9GA 3BAVA 1R8OA 1JLYA 1JLXA 4L4HA 4P6AA 3MALA 21BIA 2FFUA 4ZFUB 4P0LA 1I1EA 3CA5A 4PC4A 4QKSA 1W3GA 3BAUA 5BOWA 1JQZA 4ZA3B 3IM6A 2KLLA 4YOLA 5FNWA 2DRZA 1MC9A 3A23A 4DCKC 4XKIA 3V0BB 1HWMB 3OJMA 1WBCA 3JRRA 2P39A 3V0BA 5BXTA 4G6MA 3UDAA 5JLVA 2I1BA 1AXMA 4P0JA 2QN4A 2X2TA 4F34A 3Q7WA 3AJ5A 3HOMA 2E4MC 1CVSA 1HWOB 1PUMB 3O5WB 3FJCA 1EPWA 3RTIB 4CJMA 4HA2A 2ESUA 5FZZA 4FGFA 4WBCA 4KEKA 1P63A 3BX1C 3R4UA 4I4OA 1Q03A 2K8RA 5BXSA 1BLDA 3F1RA 1S0GA 1S0BA 4OEEA 1DQGA 2Y9FA 3AKGA 4D0TA 3LLPA 4QD2C 3OGGA 1S0LA 1T4QA 2ZQOA 1RMLA 1FMMS 2K43A 4JP0A 1DIWA 2Y9XE 5BQUC 4A7KA 2VUAA 4KC3A 1R8NA 2KI6B 1W3FA 4Q9PA 2HWAA 3CA4A 7I1BA 2UUSA 3FJBA 1G9AA 3VT1A 3AZWA 2E4MA 4KEIA 4Z9WB 2VU9A 1FGAA 2WRYA 5EG6C 3CRHA 3HSMA 3BADA 1TIEA 3POKA 2Y9GA 5BVPI 3CA0A 4QKRA 1UPSA 3O3QA 3QR5A 4GOVA 3UJ4A 4X3AA 4J2YA 1M2TB 4ZOTA 4Q91A 4DEPA 3FJEA 3AKIA 1ISWA 3NBNA 2J3PA 1ONKB 5DSSB 4QD2B 3FJAA 2DREA 3AKHA 2MLLB 1IHKA 4EFPA 3UD8A 1G9BA 3BA7A 6I1BA 2ET2A 3BTAA 5BQUA 3N7LA 3N7JA 4ZLBB 2NVHA 3FUQA 3A07A 1DFCA 3AH1A 1WBAA 3WO3A 3ZC8A 2WBCA 1IJTA 3E8LC 1IILA 5BP5C 4G9MA 1YF8B 1ILR1 4AN7B 1AFCA 2NP0A 3MPPG 4KBBA 1J0SA 2Q3NB 4ENDA 1WD3A 3CRGA 1Q04A 4ZFWB 1ISYA 2DS0A 4J2SA 1HCEA 1IRAX 1G9DA 2LIQA 4A7YA 1XG6A 1VCLA 2DRYA 4GAIA 4IZXA 2IWTB 4F83A 1TFMB 5FZYA 3VSFA 3FJJA 3CAHA 1G9CA 1FV3A 5EHAA 4AN6A 3TC2A 3BAOA 5D62A 3BA5A 3BAQA 3Q7YA 4LO3C 5BP5A 4I1EA 2HWMA 4JAWA 5DZUA 1EV2A 1FWUA 1W3AA 2NTDA 2D1ZA 3HALA 4X37A 4QALA 1HWNB 1AVUA 1GGPB 2Z48A 4I4PA 3OJ2A 3VEQA 2HZ9A 1E0OA 3FUOA 3S8KA 2X2SA 4IY9A 41BIA 5BXPA 3ZXDA 3IIRA 3IM5A 4LO8B 3H6RB 1JY0A 1PWAA 3BA4A 1BASA 1I1BA 3H6RA 3OJVA 4G1RA 4I3NA 2AFGA 3AH4A 5FNXA 3O4CA 3O4BA 4LO3A 4I7IA 3FJDA 1JT7A 5D63A 3AZVA 3N7MA 5FZUA 1PZZA 2NZ9A 3CA3A 2L5XA 1SR4C 2VSEA 1HIBA 3I2AA 1YXWA 5EC5A 2FGFA 4ZGRB 1K5VA 1TOOA 4LO1A 4QBCA 3ILAA 2F2FC 1EVTA 3WINC 1T9FA 4I4XA 4XFUA 1FWVA 1XHBA 2XOAA 4I6IA 3WO2A 3CRIA 3QYDA 1S0EA 2KH2A 4XFSA 1PUUB 4QBVA
chains in the Genus database with same CATH superfamily
1Z0HA 3PHZA 3HN1A 1M16A 2FFVA 2KKIA 1ABRB 3I29B 3KMVA 1HWPB 3FGMA 3BRFA 5D61A 5DUYA 3P6IA 1S0CA 4JPZA 3VT0A 1F31A 1TP0A 1FV2A 2VXTI 3N7KA 3R4SA 3WA1A 1K5UA 4ISQA 1SR4A 3FJHA 4A7ZA 1QQKA 4GP3A 4Z8SB 2BEAA 2AXMA 4XFTA 1PC8B 3D7WB 3RMYA 1NUNA 2D44A 2Z49A 2F2FA 3C9ZA 3P6JA 4GOYA 3WINA 3RMXA 2VXRA 4II0A 4I4VA 1QQLA 3PMEA 1ISVA 4EFRA 4H04A 3O44A 1BFGA 3FJFA 3H6SE 4DENA 4I2SA 3NBEA 4I0YA 2GO2A 4JRAA 1IT0A 3AJ6A 3A21A 1TWEA 2RQ9A 4H9WA 5F8YA 2ERMA 1OQLB 1TWMA 1BFBA 3OBTA 3BAHA 1AVWB 1V6UA 2AAIB 4I8MA 1N4KA 4G6JA 3V79C 1V6WA 8I1BA 4X39A 4LO2C 3VSZA 2P23A 31BIA 5DVHA 2GZBA 1MD6A 4I1BA 3BAGA 2NM1A 1Z2VA 4IY8A 3N0KA 5B2HA 1RZOB 3BB2A 4GP0A 3Q7XA 4FVVA 4TLPA 1G82A 3W9TA 5F8SA 5G00A 3O49A 3A22A 4OUJA 4ZKTB 3CQAA 4MZHA 1BFCA 3CA6A 1Z4SA 2K4AB 2MIBA 1ISXA 4LO1C 2RG9B 3OGFA 1II4A 1BLAA 4X38A 4IQPA 3B9UA 4OEGA 3FJKA 1TTUA 1Q1UA 4LO2A 4OWKA 4LO7B 4EFQA 4LO0A 3O4AA 2HW9A 1FN0A 1JTCA 1CE7B 3NBDA 4EEEB 2M49A 3O4DA 3EF2A 4IZEA 3RTJB 1V6XA 4GAFA 1QXMA 2RSTA 4OWJA 9ILBA 5I1BA 2D7RA 4I37A 3VUOA 1JT3A 2LIEA 3O4OA 3T8SA 1EYLA 1BARA 3JUTA 4IHZA 1YYNA 4ZFYB 2D23A 4USPA 4OW4A 4I4RA 3NBCA 4H75A 3ZC9A 3CA1A 2YUGA 1L2HA 4D8HA 4R6UB 1DFQA 3RSJA 4EB2B 3NJ5A 3K1XA 3WO4A 4EKXB 1KNMA 3FJ8A 3FJIA 1BA7A 3V0AB 1JT4A 2BFHA 1DQOA 4J23B 2D24A 3AH2A 3V0AA 1IOBA 3ZXGA 2F8XC 1DJSB 2D22A 1S0FA 2R9KB 1A8DA 3ZX7A 4J2KA 4D0ZA 3FFZA 4JKXB 4P0KA 3BRDA 4HJJA 2ZQNA 2FDBM 3HMYA 5BXRA 4JQ0A 2MC2A 4I96A 4OWLA 3I2XA 1S0DA 3FJ9A 3SNVA 3BRGC 4I4SA 1AVAC 2ZR1B 1SZ6B 3VWCA 5F8WA 4OEFA 1WD4A 2D43A 1FQ9A 2VLCA 4JKQA 1JT5A 2Q9XA 1IRPA 2AQZA 4I4UA 2FO1A 1FMZA 1AF9A 1XZZA 1RG8A 2IHOA 4L4IA 3LTQA 1ISZA 1HCDA 1YTOA 4QO3A 3CU1B 3UD9A 4QC4A 1YBIA 2QYIB 3F62B 4ZBVB 1DZDA 3PUBA 1V6VA 2D7IA 1DLLA 2VSAA 2D20A 4I4QA 5GAQA 5E24E 4HR6C 5JMCA 4IONA 3WMUA 3S8JA 1D0HA 3P53A 4ISRA 4LO0C 3IAGC 2NYYA 4LO7C 4J2XA 2Y9WC 3VT2A 1ITBA 1RY7A 3H6QA 5F90A 3UD7A 3WMVA 3OBRA 3UJ0A 2KI4A 3PG0A 1BFFA 2BEBA 1HKNA 4KEJA 1DZCA 3AKFA 4USOA 4I4YA 4IYBA 3HBWA 1NZKA 3IM7A 4G9NA 5HPZA 1AVXB 1XYFA 4Q9GA 3BAVA 1R8OA 1JLYA 1JLXA 4L4HA 4P6AA 3MALA 21BIA 2FFUA 4UY4A 4P0LA 4ZFUB 1I1EA 3CA5A 4PC4A 4QKSA 1W3GA 3BAUA 5BOWA 1JQZA 4ZA3B 3IM6A 2KLLA 4YOLA 5FNWA 2DRZA 1MC9A 3A23A 4DCKC 4XKIA 3V0BB 1HWMB 3OJMA 1WBCA 3JRRA 2P39A 3V0BA 5BXTA 4G6MA 3UDAA 5JLVA 2I1BA 1AXMA 4P0JA 2QN4A 2X2TA 4F34A 3Q7WA 3AJ5A 3HOMA 2E4MC 1CVSA 1HWOB 1PUMB 3O5WB 3FJCA 1EPWA 3RTIB 4CJMA 4HA2A 2ESUA 5FZZA 4MZFB 2NS2A 4FGFA 4WBCA 4KEKA 1P63A 3BX1C 3R4UA 4I4OA 1Q03A 2K8RA 5BXSA 1BLDA 3F1RA 1S0GA 1S0BA 4OEEA 1DQGA 2Y9FA 3AKGA 4D0TA 3LLPA 4QD2C 3OGGA 1S0LA 1T4QA 2ZQOA 1RMLA 1FMMS 2K43A 4JP0A 1DIWA 2Y9XE 5BQUC 4A7KA 2VUAA 4KC3A 1R8NA 2KI6B 1W3FA 4Q9PA 2HWAA 3CA4A 7I1BA 2UUSA 3FJBA 1G9AA 3VT1A 3AZWA 2E4MA 4KEIA 4Z9WB 2VU9A 1FGAA 2WRYA 5EG6C 3CRHA 3HSMA 3BADA 1TIEA 3POKA 2Y9GA 5BVPI 3CA0A 4QKRA 1UPSA 3O3QA 3QR5A 4GOVA 3UJ4A 4X3AA 4J2YA 1M2TB 4ZOTA 4Q91A 4DEPA 3FJEA 3AKIA 1ISWA 3NBNA 2J3PA 1ONKB 5DSSB 4QD2B 3FJAA 2DREA 3AKHA 2MLLB 1IHKA 4EFPA 3UD8A 1G9BA 3BA7A 6I1BA 2ET2A 3BTAA 5BQUA 3N7LA 3N7JA 4ZLBB 2NVHA 3FUQA 3A07A 1DFCA 3AH1A 1WBAA 3WO3A 3ZC8A 2WBCA 1IJTA 3E8LC 1IILA 5BP5C 4G9MA 1YF8B 1ILR1 4AN7B 1AFCA 2NP0A 3MPPG 4KBBA 1J0SA 2Q3NB 4ENDA 1WD3A 3CRGA 1Q04A 4ZFWB 1ISYA 2DS0A 4J2SA 1HCEA 1IRAX 1G9DA 2LIQA 4A7YA 1XG6A 1VCLA 2DRYA 4GAIA 4IZXA 2IWTB 4F83A 1TFMB 5FZYA 3VSFA 3FJJA 3CAHA 1G9CA 1FV3A 5EHAA 4AN6A 3TC2A 3BAOA 5D62A 3BA5A 3BAQA 3Q7YA 4LO3C 5BP5A 4I1EA 2HWMA 4JAWA 5DZUA 1EV2A 1FWUA 1W3AA 2NTDA 2D1ZA 3HALA 4X37A 4QALA 1HWNB 1AVUA 1GGPB 2Z48A 4I4PA 3OJ2A 3VEQA 2HZ9A 1E0OA 3FUOA 3S8KA 2X2SA 4IY9A 41BIA 5BXPA 3ZXDA 3IIRA 3IM5A 4LO8B 3H6RB 1JY0A 1PWAA 3BA4A 1BASA 1I1BA 3H6RA 3OJVA 4G1RA 4I3NA 2AFGA 3AH4A 5FNXA 3O4CA 3O4BA 4LO3A 4I7IA 3FJDA 1JT7A 5D63A 3AZVA 3N7MA 5FZUA 1PZZA 2NZ9A 3CA3A 2L5XA 1SR4C 2VSEA 1HIBA 3I2AA 1YXWA 5EC5A 2FGFA 4ZGRB 1K5VA 1TOOA 4LO1A 4QBCA 3ILAA 4MZGB 2F2FC 1EVTA 3WINC 1T9FA 4I4XA 4XFUA 1FWVA 1XHBA 2XOAA 4I6IA 3WO2A 3CRIA 3QYDA 1S0EA 2KH2A 4XFSA 1PUUB 4QBVA
chains in the Genus database with same CATH topology
1Z0HA 3PHZA 3HN1A 1M16A 2FFVA 2KKIA 1ABRB 3I29B 3KMVA 1HWPB 3FGMA 3BRFA 5D61A 5DUYA 3P6IA 1S0CA 4JPZA 3VT0A 1F31A 1TP0A 1FV2A 2VXTI 3N7KA 3R4SA 3WA1A 1K5UA 4ISQA 1SR4A 3FJHA 4A7ZA 1QQKA 4GP3A 4Z8SB 2BEAA 2AXMA 4XFTA 1PC8B 3D7WB 3RMYA 1NUNA 2D44A 2Z49A 2F2FA 3C9ZA 3P6JA 4GOYA 3WINA 3RMXA 2VXRA 4II0A 4I4VA 1QQLA 3PMEA 1ISVA 4EFRA 4H04A 3O44A 1BFGA 3FJFA 3H6SE 4DENA 4I2SA 3NBEA 4I0YA 2GO2A 4JRAA 1IT0A 3AJ6A 3A21A 1TWEA 2RQ9A 4H9WA 5F8YA 2ERMA 1OQLB 1TWMA 1BFBA 3OBTA 3BAHA 1AVWB 1V6UA 2AAIB 4I8MA 1N4KA 4G6JA 3V79C 1V6WA 8I1BA 4X39A 4LO2C 3VSZA 2P23A 31BIA 5DVHA 2GZBA 1MD6A 4I1BA 3BAGA 2NM1A 1Z2VA 4IY8A 3N0KA 5B2HA 1RZOB 3BB2A 4GP0A 3Q7XA 4FVVA 4TLPA 1G82A 3W9TA 5F8SA 5G00A 3O49A 3A22A 4OUJA 4ZKTB 3CQAA 4MZHA 1BFCA 3CA6A 1Z4SA 2K4AB 2MIBA 1ISXA 4LO1C 2RG9B 3OGFA 1II4A 1BLAA 4X38A 4IQPA 3B9UA 4OEGA 3FJKA 1TTUA 1Q1UA 4LO2A 4OWKA 4LO7B 4EFQA 4LO0A 3O4AA 2HW9A 1FN0A 1JTCA 1CE7B 3NBDA 4EEEB 2M49A 3O4DA 3EF2A 4IZEA 3RTJB 1V6XA 4GAFA 1QXMA 2RSTA 4OWJA 9ILBA 5I1BA 2D7RA 4I37A 3VUOA 1JT3A 2LIEA 3O4OA 3T8SA 1EYLA 1BARA 3JUTA 4IHZA 1YYNA 4ZFYB 2D23A 4USPA 4OW4A 4I4RA 3NBCA 4H75A 3ZC9A 3CA1A 2YUGA 1L2HA 4D8HA 4R6UB 1DFQA 3RSJA 4EB2B 3NJ5A 3K1XA 3WO4A 4EKXB 1KNMA 3FJ8A 3FJIA 1BA7A 3V0AB 1JT4A 2BFHA 1DQOA 4J23B 2D24A 3AH2A 3V0AA 1IOBA 3ZXGA 2F8XC 1DJSB 2D22A 1S0FA 2R9KB 1A8DA 3ZX7A 4J2KA 4D0ZA 3FFZA 4JKXB 4P0KA 3BRDA 4HJJA 2ZQNA 2FDBM 3HMYA 5BXRA 4JQ0A 2MC2A 4I96A 4OWLA 3I2XA 1S0DA 3FJ9A 3SNVA 3BRGC 4I4SA 1AVAC 2ZR1B 1SZ6B 3VWCA 5F8WA 4OEFA 1WD4A 2D43A 1FQ9A 2VLCA 4JKQA 1JT5A 2Q9XA 1IRPA 2AQZA 4I4UA 2FO1A 1FMZA 1AF9A 1XZZA 1RG8A 2IHOA 4L4IA 3LTQA 1ISZA 1HCDA 1YTOA 4QO3A 3CU1B 3UD9A 4QC4A 1YBIA 2QYIB 3F62B 4ZBVB 1DZDA 3PUBA 1V6VA 2D7IA 1DLLA 2VSAA 2D20A 4I4QA 5GAQA 5E24E 4HR6C 5JMCA 4IONA 3WMUA 3S8JA 1D0HA 3P53A 4ISRA 4LO0C 3IAGC 2NYYA 4LO7C 4J2XA 2Y9WC 3VT2A 1ITBA 1RY7A 3H6QA 5F90A 3UD7A 3WMVA 3OBRA 3UJ0A 2KI4A 3PG0A 1BFFA 2BEBA 1HKNA 4KEJA 1DZCA 3AKFA 4USOA 4I4YA 4IYBA 3HBWA 1NZKA 3IM7A 4G9NA 5HPZA 1AVXB 1XYFA 4Q9GA 3BAVA 1R8OA 1JLYA 1JLXA 4L4HA 4P6AA 3MALA 21BIA 2FFUA 4UY4A 4P0LA 4ZFUB 1I1EA 3CA5A 4PC4A 4QKSA 1W3GA 3BAUA 5BOWA 1JQZA 4ZA3B 3IM6A 2KLLA 4YOLA 5FNWA 2DRZA 1MC9A 3A23A 4DCKC 4XKIA 3V0BB 1HWMB 3OJMA 1WBCA 3JRRA 2P39A 3V0BA 5BXTA 4G6MA 3UDAA 5JLVA 2I1BA 1AXMA 4P0JA 2QN4A 2X2TA 4F34A 3Q7WA 3AJ5A 3HOMA 2E4MC 1CVSA 1HWOB 1PUMB 3O5WB 3FJCA 1EPWA 3RTIB 4CJMA 4HA2A 2ESUA 5FZZA 4MZFB 2NS2A 4FGFA 4WBCA 4KEKA 1P63A 3BX1C 3R4UA 4I4OA 1Q03A 2K8RA 5BXSA 1BLDA 3F1RA 1S0GA 1S0BA 4OEEA 1DQGA 2Y9FA 3AKGA 4D0TA 3LLPA 4QD2C 3OGGA 1S0LA 1T4QA 2ZQOA 1RMLA 1FMMS 2K43A 4JP0A 1DIWA 2Y9XE 5BQUC 4A7KA 2VUAA 4KC3A 1R8NA 2KI6B 1W3FA 4Q9PA 2HWAA 3CA4A 7I1BA 2UUSA 3FJBA 1G9AA 3VT1A 3AZWA 2E4MA 4KEIA 4Z9WB 2VU9A 1FGAA 2WRYA 5EG6C 3CRHA 3HSMA 3BADA 1TIEA 3POKA 2Y9GA 5BVPI 3CA0A 4QKRA 1UPSA 3O3QA 3QR5A 4GOVA 3UJ4A 4X3AA 4J2YA 1M2TB 4ZOTA 4Q91A 4DEPA 3FJEA 3AKIA 1ISWA 3NBNA 2J3PA 1ONKB 5DSSB 4QD2B 3FJAA 2DREA 3AKHA 2MLLB 1IHKA 4EFPA 3UD8A 1G9BA 3BA7A 6I1BA 2ET2A 3BTAA 5BQUA 3N7LA 3N7JA 4ZLBB 2NVHA 3FUQA 3A07A 1DFCA 3AH1A 1WBAA 3WO3A 3ZC8A 2WBCA 1IJTA 3E8LC 1IILA 5BP5C 4G9MA 1YF8B 1ILR1 4AN7B 1AFCA 2NP0A 3MPPG 4KBBA 1J0SA 2Q3NB 4ENDA 1WD3A 3CRGA 1Q04A 4ZFWB 1ISYA 2DS0A 4J2SA 1HCEA 1IRAX 1G9DA 2LIQA 4A7YA 1XG6A 1VCLA 2DRYA 4GAIA 4IZXA 2IWTB 4F83A 1TFMB 5FZYA 3VSFA 3FJJA 3CAHA 1G9CA 1FV3A 5EHAA 4AN6A 3TC2A 3BAOA 5D62A 3BA5A 3BAQA 3Q7YA 4LO3C 5BP5A 4I1EA 2HWMA 4JAWA 5DZUA 1EV2A 1FWUA 1W3AA 2NTDA 2D1ZA 3HALA 4X37A 4QALA 1HWNB 1AVUA 1GGPB 2Z48A 4I4PA 3OJ2A 3VEQA 2HZ9A 1E0OA 3FUOA 3S8KA 2X2SA 4IY9A 41BIA 5BXPA 3ZXDA 3IIRA 3IM5A 4LO8B 3H6RB 1JY0A 1PWAA 3BA4A 1BASA 1I1BA 3H6RA 3OJVA 4G1RA 4I3NA 2AFGA 3AH4A 5FNXA 3O4CA 3O4BA 4LO3A 4I7IA 3FJDA 1JT7A 5D63A 3AZVA 3N7MA 5FZUA 1PZZA 2NZ9A 3CA3A 2L5XA 1SR4C 2VSEA 1HIBA 3I2AA 1YXWA 5EC5A 2FGFA 4ZGRB 1K5VA 1TOOA 4LO1A 4QBCA 3ILAA 4MZGB 2F2FC 1EVTA 3WINC 1T9FA 4I4XA 4XFUA 1FWVA 1XHBA 2XOAA 4I6IA 3WO2A 3CRIA 3QYDA 1S0EA 2KH2A 4XFSA 1PUUB 4QBVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z0H A;  3PHZ A;  3HN1 A;  1M16 A;  2FFV A;  2KKI A;  1ABR B;  3I29 B;  3KMV A;  1HWP B;  3FGM A;  3BRF A;  5D61 A;  5DUY A;  3P6I A;  1S0C A;  4JPZ A;  3VT0 A;  1F31 A;  1TP0 A;  1FV2 A;  2VXT I;  3N7K A;  3R4S A;  3WA1 A;  1K5U A;  4ISQ A;  1SR4 A;  3FJH A;  4A7Z A;  1QQK A;  4GP3 A;  4Z8S B;  2BEA A;  2AXM A;  4XFT A;  1PC8 B;  3D7W B;  3RMY A;  1NUN A;  2D44 A;  2Z49 A;  2F2F A;  3C9Z A;  3P6J A;  4GOY A;  3WIN A;  3RMX A;  2VXR A;  4II0 A;  4I4V A;  1QQL A;  3PME A;  1ISV A;  4EFR A;  4H04 A;  3O44 A;  1BFG A;  3FJF A;  3H6S E;  4DEN A;  4I2S A;  3NBE A;  4I0Y A;  2GO2 A;  4JRA A;  1IT0 A;  3AJ6 A;  3A21 A;  1TWE A;  2RQ9 A;  4H9W A;  5F8Y A;  2ERM A;  1OQL B;  1TWM A;  1BFB A;  3OBT A;  3BAH A;  1AVW B;  1V6U A;  2AAI B;  4I8M A;  1N4K A;  4G6J A;  3V79 C;  1V6W A;  8I1B A;  4X39 A;  4LO2 C;  3VSZ A;  2P23 A;  31BI A;  5DVH A;  2GZB A;  1MD6 A;  4I1B A;  3BAG A;  2NM1 A;  1Z2V A;  4IY8 A;  3N0K A;  5B2H A;  1RZO B;  3BB2 A;  4GP0 A;  3Q7X A;  4FVV A;  4TLP A;  1G82 A;  3W9T A;  5F8S A;  5G00 A;  3O49 A;  3A22 A;  4OUJ A;  4ZKT B;  3CQA A;  1BFC A;  3CA6 A;  1Z4S A;  2K4A B;  2MIB A;  1ISX A;  4LO1 C;  2RG9 B;  3OGF A;  1II4 A;  1BLA A;  4X38 A;  4IQP A;  3B9U A;  4OEG A;  3FJK A;  1TTU A;  1Q1U A;  4LO2 A;  4OWK A;  4LO7 B;  4EFQ A;  4LO0 A;  3O4A A;  2HW9 A;  1FN0 A;  1JTC A;  1CE7 B;  3NBD A;  4EEE B;  2M49 A;  3O4D A;  3EF2 A;  4IZE A;  3RTJ B;  1V6X A;  4GAF A;  1QXM A;  2RST A;  4OWJ A;  9ILB A;  5I1B A;  2D7R A;  4I37 A;  3VUO A;  1JT3 A;  2LIE A;  3O4O A;  3T8S A;  1EYL A;  1BAR A;  3JUT A;  4IHZ A;  1YYN A;  4ZFY B;  2D23 A;  4USP A;  4OW4 A;  4I4R A;  3NBC A;  3ZC9 A;  3CA1 A;  2YUG A;  1L2H A;  4D8H A;  4R6U B;  1DFQ A;  3RSJ A;  4EB2 B;  3NJ5 A;  3K1X A;  3WO4 A;  4EKX B;  1KNM A;  3FJ8 A;  3FJI A;  1BA7 A;  3V0A B;  1JT4 A;  2BFH A;  1DQO A;  4J23 B;  2D24 A;  3AH2 A;  3V0A A;  1IOB A;  3ZXG A;  2F8X C;  1DJS B;  2D22 A;  1S0F A;  2R9K B;  1A8D A;  3ZX7 A;  4J2K A;  4D0Z A;  3FFZ A;  4JKX B;  4P0K A;  3BRD A;  4HJJ A;  2ZQN A;  2FDB M;  3HMY A;  5BXR A;  4JQ0 A;  2MC2 A;  4I96 A;  4OWL A;  3I2X A;  1S0D A;  3FJ9 A;  3SNV A;  3BRG C;  4I4S A;  1AVA C;  2ZR1 B;  1SZ6 B;  3VWC A;  5F8W A;  4OEF A;  1WD4 A;  2D43 A;  1FQ9 A;  2VLC A;  4JKQ A;  1JT5 A;  2Q9X A;  1IRP A;  2AQZ A;  4I4U A;  2FO1 A;  1FMZ A;  1AF9 A;  1XZZ A;  1RG8 A;  2IHO A;  4L4I A;  3LTQ A;  1ISZ A;  1HCD A;  1YTO A;  4QO3 A;  3CU1 B;  3UD9 A;  4QC4 A;  1YBI A;  2QYI B;  3F62 B;  4ZBV B;  1DZD A;  3PUB A;  1V6V A;  2D7I A;  1DLL A;  2VSA A;  2D20 A;  4I4Q A;  5GAQ A;  5E24 E;  4HR6 C;  5JMC A;  4ION A;  3WMU A;  3S8J A;  1D0H A;  3P53 A;  4ISR A;  4LO0 C;  3IAG C;  2NYY A;  4LO7 C;  4J2X A;  2Y9W C;  3VT2 A;  1ITB A;  1RY7 A;  3H6Q A;  5F90 A;  3UD7 A;  3WMV A;  3OBR A;  3UJ0 A;  2KI4 A;  3PG0 A;  1BFF A;  2BEB A;  1HKN A;  4KEJ A;  1DZC A;  3AKF A;  4USO A;  4I4Y A;  4IYB A;  3HBW A;  1NZK A;  3IM7 A;  4G9N A;  5HPZ A;  1AVX B;  1XYF A;  4Q9G A;  3BAV A;  1R8O A;  1JLY A;  1JLX A;  4L4H A;  4P6A A;  3MAL A;  21BI A;  2FFU A;  4ZFU B;  4P0L A;  1I1E A;  3CA5 A;  4PC4 A;  4QKS A;  1W3G A;  3BAU A;  5BOW A;  1JQZ A;  4ZA3 B;  3IM6 A;  2KLL A;  4YOL A;  5FNW A;  2DRZ A;  1MC9 A;  3A23 A;  4DCK C;  4XKI A;  3V0B B;  1HWM B;  3OJM A;  1WBC A;  3JRR A;  2P39 A;  3V0B A;  5BXT A;  4G6M A;  3UDA A;  5JLV A;  2I1B A;  1AXM A;  4P0J A;  2QN4 A;  2X2T A;  4F34 A;  3Q7W A;  3AJ5 A;  3HOM A;  2E4M C;  1CVS A;  1HWO B;  1PUM B;  3O5W B;  3FJC A;  1EPW A;  3RTI B;  4CJM A;  4HA2 A;  2ESU A;  5FZZ A;  4FGF A;  4WBC A;  4KEK A;  1P63 A;  3BX1 C;  3R4U A;  4I4O A;  1Q03 A;  2K8R A;  5BXS A;  1BLD A;  3F1R A;  1S0G A;  1S0B A;  4OEE A;  1DQG A;  2Y9F A;  3AKG A;  4D0T A;  3LLP A;  4QD2 C;  3OGG A;  1S0L A;  1T4Q A;  2ZQO A;  1RML A;  1FMM S;  2K43 A;  4JP0 A;  1DIW A;  2Y9X E;  5BQU C;  4A7K A;  2VUA A;  4KC3 A;  1R8N A;  2KI6 B;  1W3F A;  4Q9P A;  2HWA A;  3CA4 A;  7I1B A;  2UUS A;  3FJB A;  1G9A A;  3VT1 A;  3AZW A;  2E4M A;  4KEI A;  4Z9W B;  2VU9 A;  1FGA A;  2WRY A;  5EG6 C;  3CRH A;  3HSM A;  3BAD A;  1TIE A;  3POK A;  2Y9G A;  5BVP I;  3CA0 A;  4QKR A;  1UPS A;  3O3Q A;  3QR5 A;  4GOV A;  3UJ4 A;  4X3A A;  4J2Y A;  1M2T B;  4ZOT A;  4Q91 A;  4DEP A;  3FJE A;  3AKI A;  1ISW A;  3NBN A;  2J3P A;  1ONK B;  5DSS B;  4QD2 B;  3FJA A;  2DRE A;  3AKH A;  2MLL B;  1IHK A;  4EFP A;  3UD8 A;  1G9B A;  3BA7 A;  6I1B A;  2ET2 A;  3BTA A;  5BQU A;  3N7L A;  3N7J A;  4ZLB B;  2NVH A;  3FUQ A;  3A07 A;  1DFC A;  3AH1 A;  1WBA A;  3WO3 A;  3ZC8 A;  2WBC A;  1IJT A;  3E8L C;  1IIL A;  5BP5 C;  4G9M A;  1YF8 B;  1ILR 1;  4AN7 B;  1AFC A;  2NP0 A;  3MPP G;  4KBB A;  1J0S A;  2Q3N B;  4END A;  1WD3 A;  3CRG A;  1Q04 A;  4ZFW B;  1ISY A;  2DS0 A;  4J2S A;  1HCE A;  1IRA X;  1G9D A;  2LIQ A;  4A7Y A;  1XG6 A;  1VCL A;  2DRY A;  4GAI A;  4IZX A;  2IWT B;  4F83 A;  1TFM B;  5FZY A;  3VSF A;  3FJJ A;  3CAH A;  1G9C A;  1FV3 A;  5EHA A;  4AN6 A;  3TC2 A;  3BAO A;  5D62 A;  3BA5 A;  3BAQ A;  3Q7Y A;  4LO3 C;  5BP5 A;  4I1E A;  2HWM A;  4JAW A;  5DZU A;  1EV2 A;  1FWU A;  1W3A A;  2NTD A;  2D1Z A;  3HAL A;  4X37 A;  4QAL A;  1HWN B;  1AVU A;  1GGP B;  2Z48 A;  4I4P A;  3OJ2 A;  3VEQ A;  2HZ9 A;  1E0O A;  3FUO A;  3S8K A;  2X2S A;  4IY9 A;  41BI A;  5BXP A;  3ZXD A;  3IIR A;  3IM5 A;  4LO8 B;  3H6R B;  1JY0 A;  1PWA A;  3BA4 A;  1BAS A;  1I1B A;  3H6R A;  3OJV A;  4G1R A;  4I3N A;  2AFG A;  3AH4 A;  5FNX A;  3O4C A;  3O4B A;  4LO3 A;  4I7I A;  3FJD A;  1JT7 A;  5D63 A;  3AZV A;  3N7M A;  5FZU A;  1PZZ A;  2NZ9 A;  3CA3 A;  2L5X A;  1SR4 C;  2VSE A;  1HIB A;  3I2A A;  1YXW A;  5EC5 A;  2FGF A;  4ZGR B;  1K5V A;  1TOO A;  4LO1 A;  4QBC A;  3ILA A;  2F2F C;  1EVT A;  3WIN C;  1T9F A;  4I4X A;  4XFU A;  1FWV A;  1XHB A;  2XOA A;  4I6I A;  3WO2 A;  3CRI A;  3QYD A;  1S0E A;  2KH2 A;  4XFS A;  1PUU B;  4QBV A; 
#chains in the Genus database with same CATH topology
 1Z0H A;  3PHZ A;  3HN1 A;  1M16 A;  2FFV A;  2KKI A;  1ABR B;  3I29 B;  3KMV A;  1HWP B;  3FGM A;  3BRF A;  5D61 A;  5DUY A;  3P6I A;  1S0C A;  4JPZ A;  3VT0 A;  1F31 A;  1TP0 A;  1FV2 A;  2VXT I;  3N7K A;  3R4S A;  3WA1 A;  1K5U A;  4ISQ A;  1SR4 A;  3FJH A;  4A7Z A;  1QQK A;  4GP3 A;  4Z8S B;  2BEA A;  2AXM A;  4XFT A;  1PC8 B;  3D7W B;  3RMY A;  1NUN A;  2D44 A;  2Z49 A;  2F2F A;  3C9Z A;  3P6J A;  4GOY A;  3WIN A;  3RMX A;  2VXR A;  4II0 A;  4I4V A;  1QQL A;  3PME A;  1ISV A;  4EFR A;  4H04 A;  3O44 A;  1BFG A;  3FJF A;  3H6S E;  4DEN A;  4I2S A;  3NBE A;  4I0Y A;  2GO2 A;  4JRA A;  1IT0 A;  3AJ6 A;  3A21 A;  1TWE A;  2RQ9 A;  4H9W A;  5F8Y A;  2ERM A;  1OQL B;  1TWM A;  1BFB A;  3OBT A;  3BAH A;  1AVW B;  1V6U A;  2AAI B;  4I8M A;  1N4K A;  4G6J A;  3V79 C;  1V6W A;  8I1B A;  4X39 A;  4LO2 C;  3VSZ A;  2P23 A;  31BI A;  5DVH A;  2GZB A;  1MD6 A;  4I1B A;  3BAG A;  2NM1 A;  1Z2V A;  4IY8 A;  3N0K A;  5B2H A;  1RZO B;  3BB2 A;  4GP0 A;  3Q7X A;  4FVV A;  4TLP A;  1G82 A;  3W9T A;  5F8S A;  5G00 A;  3O49 A;  3A22 A;  4OUJ A;  4ZKT B;  3CQA A;  4MZH A;  1BFC A;  3CA6 A;  1Z4S A;  2K4A B;  2MIB A;  1ISX A;  4LO1 C;  2RG9 B;  3OGF A;  1II4 A;  1BLA A;  4X38 A;  4IQP A;  3B9U A;  4OEG A;  3FJK A;  1TTU A;  1Q1U A;  4LO2 A;  4OWK A;  4LO7 B;  4EFQ A;  4LO0 A;  3O4A A;  2HW9 A;  1FN0 A;  1JTC A;  1CE7 B;  3NBD A;  4EEE B;  2M49 A;  3O4D A;  3EF2 A;  4IZE A;  3RTJ B;  1V6X A;  4GAF A;  1QXM A;  2RST A;  4OWJ A;  9ILB A;  5I1B A;  2D7R A;  4I37 A;  3VUO A;  1JT3 A;  2LIE A;  3O4O A;  3T8S A;  1EYL A;  1BAR A;  3JUT A;  4IHZ A;  1YYN A;  4ZFY B;  2D23 A;  4USP A;  4OW4 A;  4I4R A;  3NBC A;  4H75 A;  3ZC9 A;  3CA1 A;  2YUG A;  1L2H A;  4D8H A;  4R6U B;  1DFQ A;  3RSJ A;  4EB2 B;  3NJ5 A;  3K1X A;  3WO4 A;  4EKX B;  1KNM A;  3FJ8 A;  3FJI A;  1BA7 A;  3V0A B;  1JT4 A;  2BFH A;  1DQO A;  4J23 B;  2D24 A;  3AH2 A;  3V0A A;  1IOB A;  3ZXG A;  2F8X C;  1DJS B;  2D22 A;  1S0F A;  2R9K B;  1A8D A;  3ZX7 A;  4J2K A;  4D0Z A;  3FFZ A;  4JKX B;  4P0K A;  3BRD A;  4HJJ A;  2ZQN A;  2FDB M;  3HMY A;  5BXR A;  4JQ0 A;  2MC2 A;  4I96 A;  4OWL A;  3I2X A;  1S0D A;  3FJ9 A;  3SNV A;  3BRG C;  4I4S A;  1AVA C;  2ZR1 B;  1SZ6 B;  3VWC A;  5F8W A;  4OEF A;  1WD4 A;  2D43 A;  1FQ9 A;  2VLC A;  4JKQ A;  1JT5 A;  2Q9X A;  1IRP A;  2AQZ A;  4I4U A;  2FO1 A;  1FMZ A;  1AF9 A;  1XZZ A;  1RG8 A;  2IHO A;  4L4I A;  3LTQ A;  1ISZ A;  1HCD A;  1YTO A;  4QO3 A;  3CU1 B;  3UD9 A;  4QC4 A;  1YBI A;  2QYI B;  3F62 B;  4ZBV B;  1DZD A;  3PUB A;  1V6V A;  2D7I A;  1DLL A;  2VSA A;  2D20 A;  4I4Q A;  5GAQ A;  5E24 E;  4HR6 C;  5JMC A;  4ION A;  3WMU A;  3S8J A;  1D0H A;  3P53 A;  4ISR A;  4LO0 C;  3IAG C;  2NYY A;  4LO7 C;  4J2X A;  2Y9W C;  3VT2 A;  1ITB A;  1RY7 A;  3H6Q A;  5F90 A;  3UD7 A;  3WMV A;  3OBR A;  3UJ0 A;  2KI4 A;  3PG0 A;  1BFF A;  2BEB A;  1HKN A;  4KEJ A;  1DZC A;  3AKF A;  4USO A;  4I4Y A;  4IYB A;  3HBW A;  1NZK A;  3IM7 A;  4G9N A;  5HPZ A;  1AVX B;  1XYF A;  4Q9G A;  3BAV A;  1R8O A;  1JLY A;  1JLX A;  4L4H A;  4P6A A;  3MAL A;  21BI A;  2FFU A;  4UY4 A;  4P0L A;  4ZFU B;  1I1E A;  3CA5 A;  4PC4 A;  4QKS A;  1W3G A;  3BAU A;  5BOW A;  1JQZ A;  4ZA3 B;  3IM6 A;  2KLL A;  4YOL A;  5FNW A;  2DRZ A;  1MC9 A;  3A23 A;  4DCK C;  4XKI A;  3V0B B;  1HWM B;  3OJM A;  1WBC A;  3JRR A;  2P39 A;  3V0B A;  5BXT A;  4G6M A;  3UDA A;  5JLV A;  2I1B A;  1AXM A;  4P0J A;  2QN4 A;  2X2T A;  4F34 A;  3Q7W A;  3AJ5 A;  3HOM A;  2E4M C;  1CVS A;  1HWO B;  1PUM B;  3O5W B;  3FJC A;  1EPW A;  3RTI B;  4CJM A;  4HA2 A;  2ESU A;  5FZZ A;  4MZF B;  2NS2 A;  4FGF A;  4WBC A;  4KEK A;  1P63 A;  3BX1 C;  3R4U A;  4I4O A;  1Q03 A;  2K8R A;  5BXS A;  1BLD A;  3F1R A;  1S0G A;  1S0B A;  4OEE A;  1DQG A;  2Y9F A;  3AKG A;  4D0T A;  3LLP A;  4QD2 C;  3OGG A;  1S0L A;  1T4Q A;  2ZQO A;  1RML A;  1FMM S;  2K43 A;  4JP0 A;  1DIW A;  2Y9X E;  5BQU C;  4A7K A;  2VUA A;  4KC3 A;  1R8N A;  2KI6 B;  1W3F A;  4Q9P A;  2HWA A;  3CA4 A;  7I1B A;  2UUS A;  3FJB A;  1G9A A;  3VT1 A;  3AZW A;  2E4M A;  4KEI A;  4Z9W B;  2VU9 A;  1FGA A;  2WRY A;  5EG6 C;  3CRH A;  3HSM A;  3BAD A;  1TIE A;  3POK A;  2Y9G A;  5BVP I;  3CA0 A;  4QKR A;  1UPS A;  3O3Q A;  3QR5 A;  4GOV A;  3UJ4 A;  4X3A A;  4J2Y A;  1M2T B;  4ZOT A;  4Q91 A;  4DEP A;  3FJE A;  3AKI A;  1ISW A;  3NBN A;  2J3P A;  1ONK B;  5DSS B;  4QD2 B;  3FJA A;  2DRE A;  3AKH A;  2MLL B;  1IHK A;  4EFP A;  3UD8 A;  1G9B A;  3BA7 A;  6I1B A;  2ET2 A;  3BTA A;  5BQU A;  3N7L A;  3N7J A;  4ZLB B;  2NVH A;  3FUQ A;  3A07 A;  1DFC A;  3AH1 A;  1WBA A;  3WO3 A;  3ZC8 A;  2WBC A;  1IJT A;  3E8L C;  1IIL A;  5BP5 C;  4G9M A;  1YF8 B;  1ILR 1;  4AN7 B;  1AFC A;  2NP0 A;  3MPP G;  4KBB A;  1J0S A;  2Q3N B;  4END A;  1WD3 A;  3CRG A;  1Q04 A;  4ZFW B;  1ISY A;  2DS0 A;  4J2S A;  1HCE A;  1IRA X;  1G9D A;  2LIQ A;  4A7Y A;  1XG6 A;  1VCL A;  2DRY A;  4GAI A;  4IZX A;  2IWT B;  4F83 A;  1TFM B;  5FZY A;  3VSF A;  3FJJ A;  3CAH A;  1G9C A;  1FV3 A;  5EHA A;  4AN6 A;  3TC2 A;  3BAO A;  5D62 A;  3BA5 A;  3BAQ A;  3Q7Y A;  4LO3 C;  5BP5 A;  4I1E A;  2HWM A;  4JAW A;  5DZU A;  1EV2 A;  1FWU A;  1W3A A;  2NTD A;  2D1Z A;  3HAL A;  4X37 A;  4QAL A;  1HWN B;  1AVU A;  1GGP B;  2Z48 A;  4I4P A;  3OJ2 A;  3VEQ A;  2HZ9 A;  1E0O A;  3FUO A;  3S8K A;  2X2S A;  4IY9 A;  41BI A;  5BXP A;  3ZXD A;  3IIR A;  3IM5 A;  4LO8 B;  3H6R B;  1JY0 A;  1PWA A;  3BA4 A;  1BAS A;  1I1B A;  3H6R A;  3OJV A;  4G1R A;  4I3N A;  2AFG A;  3AH4 A;  5FNX A;  3O4C A;  3O4B A;  4LO3 A;  4I7I A;  3FJD A;  1JT7 A;  5D63 A;  3AZV A;  3N7M A;  5FZU A;  1PZZ A;  2NZ9 A;  3CA3 A;  2L5X A;  1SR4 C;  2VSE A;  1HIB A;  3I2A A;  1YXW A;  5EC5 A;  2FGF A;  4ZGR B;  1K5V A;  1TOO A;  4LO1 A;  4QBC A;  3ILA A;  4MZG B;  2F2F C;  1EVT A;  3WIN C;  1T9F A;  4I4X A;  4XFU A;  1FWV A;  1XHB A;  2XOA A;  4I6I A;  3WO2 A;  3CRI A;  3QYD A;  1S0E A;  2KH2 A;  4XFS A;  1PUU B;  4QBV A; 
#chains in the Genus database with same CATH homology
 1Z0H A;  3PHZ A;  3HN1 A;  1M16 A;  2FFV A;  2KKI A;  1ABR B;  3I29 B;  3KMV A;  1HWP B;  3FGM A;  3BRF A;  5D61 A;  5DUY A;  3P6I A;  1S0C A;  4JPZ A;  3VT0 A;  1F31 A;  1TP0 A;  1FV2 A;  2VXT I;  3N7K A;  3R4S A;  3WA1 A;  1K5U A;  4ISQ A;  1SR4 A;  3FJH A;  4A7Z A;  1QQK A;  4GP3 A;  4Z8S B;  2BEA A;  2AXM A;  4XFT A;  1PC8 B;  3D7W B;  3RMY A;  1NUN A;  2D44 A;  2Z49 A;  2F2F A;  3C9Z A;  3P6J A;  4GOY A;  3WIN A;  3RMX A;  2VXR A;  4II0 A;  4I4V A;  1QQL A;  3PME A;  1ISV A;  4EFR A;  4H04 A;  3O44 A;  1BFG A;  3FJF A;  3H6S E;  4DEN A;  4I2S A;  3NBE A;  4I0Y A;  2GO2 A;  4JRA A;  1IT0 A;  3AJ6 A;  3A21 A;  1TWE A;  2RQ9 A;  4H9W A;  5F8Y A;  2ERM A;  1OQL B;  1TWM A;  1BFB A;  3OBT A;  3BAH A;  1AVW B;  1V6U A;  2AAI B;  4I8M A;  1N4K A;  4G6J A;  3V79 C;  1V6W A;  8I1B A;  4X39 A;  4LO2 C;  3VSZ A;  2P23 A;  31BI A;  5DVH A;  2GZB A;  1MD6 A;  4I1B A;  3BAG A;  2NM1 A;  1Z2V A;  4IY8 A;  3N0K A;  5B2H A;  1RZO B;  3BB2 A;  4GP0 A;  3Q7X A;  4FVV A;  4TLP A;  1G82 A;  3W9T A;  5F8S A;  5G00 A;  3O49 A;  3A22 A;  4OUJ A;  4ZKT B;  3CQA A;  4MZH A;  1BFC A;  3CA6 A;  1Z4S A;  2K4A B;  2MIB A;  1ISX A;  4LO1 C;  2RG9 B;  3OGF A;  1II4 A;  1BLA A;  4X38 A;  4IQP A;  3B9U A;  4OEG A;  3FJK A;  1TTU A;  1Q1U A;  4LO2 A;  4OWK A;  4LO7 B;  4EFQ A;  4LO0 A;  3O4A A;  2HW9 A;  1FN0 A;  1JTC A;  1CE7 B;  3NBD A;  4EEE B;  2M49 A;  3O4D A;  3EF2 A;  4IZE A;  3RTJ B;  1V6X A;  4GAF A;  1QXM A;  2RST A;  4OWJ A;  9ILB A;  5I1B A;  2D7R A;  4I37 A;  3VUO A;  1JT3 A;  2LIE A;  3O4O A;  3T8S A;  1EYL A;  1BAR A;  3JUT A;  4IHZ A;  1YYN A;  4ZFY B;  2D23 A;  4USP A;  4OW4 A;  4I4R A;  3NBC A;  4H75 A;  3ZC9 A;  3CA1 A;  2YUG A;  1L2H A;  4D8H A;  4R6U B;  1DFQ A;  3RSJ A;  4EB2 B;  3NJ5 A;  3K1X A;  3WO4 A;  4EKX B;  1KNM A;  3FJ8 A;  3FJI A;  1BA7 A;  3V0A B;  1JT4 A;  2BFH A;  1DQO A;  4J23 B;  2D24 A;  3AH2 A;  3V0A A;  1IOB A;  3ZXG A;  2F8X C;  1DJS B;  2D22 A;  1S0F A;  2R9K B;  1A8D A;  3ZX7 A;  4J2K A;  4D0Z A;  3FFZ A;  4JKX B;  4P0K A;  3BRD A;  4HJJ A;  2ZQN A;  2FDB M;  3HMY A;  5BXR A;  4JQ0 A;  2MC2 A;  4I96 A;  4OWL A;  3I2X A;  1S0D A;  3FJ9 A;  3SNV A;  3BRG C;  4I4S A;  1AVA C;  2ZR1 B;  1SZ6 B;  3VWC A;  5F8W A;  4OEF A;  1WD4 A;  2D43 A;  1FQ9 A;  2VLC A;  4JKQ A;  1JT5 A;  2Q9X A;  1IRP A;  2AQZ A;  4I4U A;  2FO1 A;  1FMZ A;  1AF9 A;  1XZZ A;  1RG8 A;  2IHO A;  4L4I A;  3LTQ A;  1ISZ A;  1HCD A;  1YTO A;  4QO3 A;  3CU1 B;  3UD9 A;  4QC4 A;  1YBI A;  2QYI B;  3F62 B;  4ZBV B;  1DZD A;  3PUB A;  1V6V A;  2D7I A;  1DLL A;  2VSA A;  2D20 A;  4I4Q A;  5GAQ A;  5E24 E;  4HR6 C;  5JMC A;  4ION A;  3WMU A;  3S8J A;  1D0H A;  3P53 A;  4ISR A;  4LO0 C;  3IAG C;  2NYY A;  4LO7 C;  4J2X A;  2Y9W C;  3VT2 A;  1ITB A;  1RY7 A;  3H6Q A;  5F90 A;  3UD7 A;  3WMV A;  3OBR A;  3UJ0 A;  2KI4 A;  3PG0 A;  1BFF A;  2BEB A;  1HKN A;  4KEJ A;  1DZC A;  3AKF A;  4USO A;  4I4Y A;  4IYB A;  3HBW A;  1NZK A;  3IM7 A;  4G9N A;  5HPZ A;  1AVX B;  1XYF A;  4Q9G A;  3BAV A;  1R8O A;  1JLY A;  1JLX A;  4L4H A;  4P6A A;  3MAL A;  21BI A;  2FFU A;  4UY4 A;  4P0L A;  4ZFU B;  1I1E A;  3CA5 A;  4PC4 A;  4QKS A;  1W3G A;  3BAU A;  5BOW A;  1JQZ A;  4ZA3 B;  3IM6 A;  2KLL A;  4YOL A;  5FNW A;  2DRZ A;  1MC9 A;  3A23 A;  4DCK C;  4XKI A;  3V0B B;  1HWM B;  3OJM A;  1WBC A;  3JRR A;  2P39 A;  3V0B A;  5BXT A;  4G6M A;  3UDA A;  5JLV A;  2I1B A;  1AXM A;  4P0J A;  2QN4 A;  2X2T A;  4F34 A;  3Q7W A;  3AJ5 A;  3HOM A;  2E4M C;  1CVS A;  1HWO B;  1PUM B;  3O5W B;  3FJC A;  1EPW A;  3RTI B;  4CJM A;  4HA2 A;  2ESU A;  5FZZ A;  4MZF B;  2NS2 A;  4FGF A;  4WBC A;  4KEK A;  1P63 A;  3BX1 C;  3R4U A;  4I4O A;  1Q03 A;  2K8R A;  5BXS A;  1BLD A;  3F1R A;  1S0G A;  1S0B A;  4OEE A;  1DQG A;  2Y9F A;  3AKG A;  4D0T A;  3LLP A;  4QD2 C;  3OGG A;  1S0L A;  1T4Q A;  2ZQO A;  1RML A;  1FMM S;  2K43 A;  4JP0 A;  1DIW A;  2Y9X E;  5BQU C;  4A7K A;  2VUA A;  4KC3 A;  1R8N A;  2KI6 B;  1W3F A;  4Q9P A;  2HWA A;  3CA4 A;  7I1B A;  2UUS A;  3FJB A;  1G9A A;  3VT1 A;  3AZW A;  2E4M A;  4KEI A;  4Z9W B;  2VU9 A;  1FGA A;  2WRY A;  5EG6 C;  3CRH A;  3HSM A;  3BAD A;  1TIE A;  3POK A;  2Y9G A;  5BVP I;  3CA0 A;  4QKR A;  1UPS A;  3O3Q A;  3QR5 A;  4GOV A;  3UJ4 A;  4X3A A;  4J2Y A;  1M2T B;  4ZOT A;  4Q91 A;  4DEP A;  3FJE A;  3AKI A;  1ISW A;  3NBN A;  2J3P A;  1ONK B;  5DSS B;  4QD2 B;  3FJA A;  2DRE A;  3AKH A;  2MLL B;  1IHK A;  4EFP A;  3UD8 A;  1G9B A;  3BA7 A;  6I1B A;  2ET2 A;  3BTA A;  5BQU A;  3N7L A;  3N7J A;  4ZLB B;  2NVH A;  3FUQ A;  3A07 A;  1DFC A;  3AH1 A;  1WBA A;  3WO3 A;  3ZC8 A;  2WBC A;  1IJT A;  3E8L C;  1IIL A;  5BP5 C;  4G9M A;  1YF8 B;  1ILR 1;  4AN7 B;  1AFC A;  2NP0 A;  3MPP G;  4KBB A;  1J0S A;  2Q3N B;  4END A;  1WD3 A;  3CRG A;  1Q04 A;  4ZFW B;  1ISY A;  2DS0 A;  4J2S A;  1HCE A;  1IRA X;  1G9D A;  2LIQ A;  4A7Y A;  1XG6 A;  1VCL A;  2DRY A;  4GAI A;  4IZX A;  2IWT B;  4F83 A;  1TFM B;  5FZY A;  3VSF A;  3FJJ A;  3CAH A;  1G9C A;  1FV3 A;  5EHA A;  4AN6 A;  3TC2 A;  3BAO A;  5D62 A;  3BA5 A;  3BAQ A;  3Q7Y A;  4LO3 C;  5BP5 A;  4I1E A;  2HWM A;  4JAW A;  5DZU A;  1EV2 A;  1FWU A;  1W3A A;  2NTD A;  2D1Z A;  3HAL A;  4X37 A;  4QAL A;  1HWN B;  1AVU A;  1GGP B;  2Z48 A;  4I4P A;  3OJ2 A;  3VEQ A;  2HZ9 A;  1E0O A;  3FUO A;  3S8K A;  2X2S A;  4IY9 A;  41BI A;  5BXP A;  3ZXD A;  3IIR A;  3IM5 A;  4LO8 B;  3H6R B;  1JY0 A;  1PWA A;  3BA4 A;  1BAS A;  1I1B A;  3H6R A;  3OJV A;  4G1R A;  4I3N A;  2AFG A;  3AH4 A;  5FNX A;  3O4C A;  3O4B A;  4LO3 A;  4I7I A;  3FJD A;  1JT7 A;  5D63 A;  3AZV A;  3N7M A;  5FZU A;  1PZZ A;  2NZ9 A;  3CA3 A;  2L5X A;  1SR4 C;  2VSE A;  1HIB A;  3I2A A;  1YXW A;  5EC5 A;  2FGF A;  4ZGR B;  1K5V A;  1TOO A;  4LO1 A;  4QBC A;  3ILA A;  4MZG B;  2F2F C;  1EVT A;  3WIN C;  1T9F A;  4I4X A;  4XFU A;  1FWV A;  1XHB A;  2XOA A;  4I6I A;  3WO2 A;  3CRI A;  3QYD A;  1S0E A;  2KH2 A;  4XFS A;  1PUU B;  4QBV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...