3FJ8A

Crystal structure of c117i mutant of human acidic fibroblast growth factor
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
141
structure length
141
Chain Sequence
HHHHFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEKNWFVGLKKNGSIKRGPRTHYGQKAILFLPLPV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The interaction between thermodynamic stability and buried free cysteines in regulating the functional half-life of fibroblast growth factor-1.
pubmed doi rcsb
molecule keywords Heparin-binding growth factor 1
molecule tags Hormone
source organism Homo sapiens
total genus 36
structure length 141
sequence length 141
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-12-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 3fj8A00
1W3FA 3BAHA 3O4AA 4LO1C 3V79C 1G82A 3FFZA 4IQPA 3A07A 4J23B 3C9ZA 2YUGA 2D24A 3EF2A 1CVSA 1S0EA 2P23A 2VLCA 4JKQA 4QC4A 1EYLA 1T9FA 3VSZA 3N7LA 3WINA 2D7RA 1V6XA 2MLLB 2KI6B 3S8KA 1YTOA 3BAGA 4L4HA 4OW4A 5F90A 1DIWA 4I7IA 3HN1A 3OJVA 5D62A 3CA5A 3A21A 2AQZA 1L2HA 1XHBA 3A23A 3O5WB 3P53A 1GGPB 1ISYA 2F2FA 2FFVA 3FJJA 3UD7A 5BVPI 5F8YA 3VT1A 1BA7A 4ZOTA 4KEIA 4DEPA 3N7JA 1SZ6B 1CE7B 1DJSB 3HMYA 3V0BA 3WA1A 5G00A 1BLAA 1S0LA 3R4UA 4JKXB 3OBRA 4WBCA 1PWAA 1UPSA 4GOVA 4IY9A 3AZWA 2ZQOA 5EHAA 3N7MA 3OBTA 3P6IA 5EG6C 2RG9B 1YBIA 3BA7A 2FO1A 4QKRA 3FJEA 4USOA 4ZGRB 1JLXA 1N4KA 1P63A 4LO0C 3FJBA 1S0BA 2KKIA 1DQOA 2D44A 1XYFA 2Z49A 3OGGA 4GOYA 3HBWA 4LO2A 1RZOB 3B9UA 3IM5A 4QALA 1DLLA 8I1BA 3Q7YA 1ABRB 4Q91A 2VUAA 4QKSA 3V0AB 1FMMS 3WO2A 1YYNA 3AKIA 1IRPA 1WD4A 3WINC 2KH2A 3NBEA 4HA2A 2D20A 3O4BA 1DFQA 3O44A 3RTJB 1TWMA 3PMEA 3CRHA 4JAWA 4ZFYB 3V0BB 4JRAA 2RSTA 4L4IA 4JQ0A 4IZXA 1VCLA 3NBNA 3CRIA 2F2FC 4IHZA 3PHZA 2IHOA 4I4YA 3H6RB 4I96A 2KLLA 3PUBA 3A22A 4P0KA 3UD8A 2VXRA 3VSFA 4FVVA 5DVHA 4QO3A 1G9DA 5D63A 1JQZA 3O4CA 3CA6A 1BLDA 4KBBA 4J2SA 3CQAA 2D22A 5D61A 1I1EA 2P39A 1R8NA 41BIA 2ZQNA 3FJFA 5DZUA 5JMCA 4ZLBB 4QBCA 2NM1A 4QD2C 4XFSA 5GAQA 1II4A 2ET2A 4P0JA 1HWPB 2ZR1B 4F34A 4CJMA 2AFGA 4DENA 3NBCA 1AVAC 1Z4SA 1WD3A 3OJMA 1DZDA 1ISWA 3JRRA 4ENDA 3AKGA 4I4XA 3O4DA 2R9KB 4LO2C 3OGFA 2MC2A 3WO4A 5JLVA 1WBAA 2UUSA 2VXTI 5BOWA 1JT7A 2D23A 2HWMA 3AH1A 4KEJA 3UD9A 3AZVA 1G9CA 1HWNB 3BRGC 1QQKA 2Y9WC 4P6AA 4I3NA 4A7ZA 1S0GA 2K43A 4HR6C 1QQLA 4D0TA 3V0AA 2VSEA 1S0FA 2ESUA 3FJKA 1Z2VA 3FUOA 3IIRA 4TLPA 4USPA 2D1ZA 1YF8B 1PC8B 3S8JA 3R4SA 3TC2A 4I1EA 3FJ9A 4ZA3B 4DCKC 2K4AB 1XG6A 3RMXA 3O49A 1ISZA 1W3AA 4I37A 4II0A 2Q9XA 1M16A 1G9AA 2Y9XE 4R6UB 5F8WA 3K1XA 3IAGC 4I4UA 1BARA 3H6RA 4Z8SB 3HOMA 1M2TB 3FJ8A 3UDAA 5FNWA 3LLPA 3RSJA 4GAFA 4P0LA 3HALA 3BA4A 2QYIB 1AF9A 3E8LC 1K5UA 1S0DA 3BA5A 4ZKTB 3WO3A 2DRZA 4IYBA 3F1RA 3Q7XA 3QYDA 3AKFA 4I4PA 4XFUA 3O3QA 3PG0A 4XFTA 5BXSA 3FJAA 4EFRA 5FZZA 4JP0A 31BIA 3VWCA 4ZFWB 5F8SA 5FZYA 3I29B 5B2HA 1FV2A 1IRAX 2NP0A 3UJ4A 4I8MA 3W9TA 4I4OA 5BP5A 1JTCA 1ONKB 1W3GA 3OJ2A 4LO3A 3BRDA 3VEQA 1MD6A 2IWTB 4EFPA 1ITBA 3WMVA 4D8HA 4ZBVB 1NZKA 7I1BA 1DFCA 1FV3A 3BRFA 2HWAA 1JT3A 3D7WB 5BQUA 1TWEA 4J2XA 2Z48A 3P6JA 2FGFA 3RTIB 1OQLB 2DRYA 4Z9WB 2BEBA 2NZ9A 1RMLA 2M49A 4OEGA 4XKIA 4G1RA 5E24E 4Q9GA 4J2YA 3MALA 3BAVA 3VT0A 3NJ5A 3FJCA 3H6QA 2NTDA 4KEKA 4LO7B 4ISQA 1HIBA 2D43A 4EEEB 2BEAA 3WMUA 4KC3A 1JLYA 4G6MA 1BFGA 4OWJA 4G6JA 4AN7B 1IILA 4X37A 4A7YA 4IONA 4LO7C 2NVHA 3FJHA 3BAQA 2Y9FA 2MIBA 1IHKA 3ZX7A 1TP0A 1FMZA 3LTQA 1EPWA 1BFFA 3AJ6A 1SR4A 2GZBA 4EFQA 4EKXB 2LIEA 1TFMB 1AFCA 3N0KA 2D7IA 2ERMA 3BTAA 2FFUA 5BP5C 1AVXB 2FDBM 1XZZA 1J0SA 4LO3C 3MPPG 6I1BA 4GP3A 4I2SA 4I1BA 2Y9GA 3BADA 4JPZA 3KMVA 2LIQA 2DS0A 3VUOA 3HSMA 2VSAA 4IY8A 4X38A 3IM7A 3ZXGA 4YOLA 3I2AA 2HZ9A 3QR5A 1DQGA 4X39A 5BQUC 1IJTA 4GP0A 1HCEA 4I4QA 3VT2A 2F8XC 2HW9A 3AKHA 1QXMA 3F62B 1YXWA 3UJ0A 1V6WA 3NBDA 1BASA 1JT4A 1MC9A 1HWOB 21BIA 1PUUB 1Q1UA 4OWKA 4IZEA 1JT5A 1DZCA 2XOAA 3CU1B 4GAIA 2X2TA 4QBVA 2L5XA 1Q03A 1D0HA 2WRYA 4G9MA 3AH4A 3I2XA 4I4SA 4F83A 2DREA 2E4MA 1AXMA 5EC5A 4FGFA 2AAIB 3ZXDA 3O4OA 1R8OA 1EVTA 1S0CA 2GO2A 2VU9A 4I6IA 3ZC9A 1HWMB 1ISXA 3BAOA 1WBCA 1BFBA 2RQ9A 3CRGA 3BB2A 1SR4C 3JUTA 3ZC8A 4I4VA 4OEFA 3CAHA 4X3AA 1FN0A 4H9WA 1A8DA 5FNXA 1NUNA 4H04A 1K5VA 3FJDA 4LO1A 4AN6A 1HCDA 2QN4A 4HJJA 3BAUA 1BFCA 2KI4A 1I1BA 2BFHA 2J3PA 4ZFUB 4Q9PA 2K8RA 2NYYA 3POKA 3FUQA 1KNMA 4LO8B 1EV2A 3ILAA 1TOOA 4ISRA 4J2KA 3T8SA 2WBCA 1IT0A 4OWLA 5BXRA 1IOBA 2AXMA 1V6UA 1HKNA 4I4RA 4D0ZA 5FZUA 1FWVA 1PUMB 1Z0HA 3H6SE 3FJIA 1ILR1 4EB2B 4QD2B 3AH2A 1ISVA 2E4MC 4PC4A 1AVUA 2X2SA 2Q3NB 1PZZA 3CA3A 1JY0A 9ILBA 3AJ5A 3SNVA 3CA4A 1G9BA 5I1BA 2I1BA 1FGAA 1V6VA 3IM6A 1Q04A 1FWUA 5HPZA 3BX1C 5BXPA 3FGMA 4LO0A 1T4QA 4I0YA 4OEEA 3CA1A 3Q7WA 1FQ9A 1RY7A 1RG8A 3CA0A 4A7KA 4OUJA 5DSSB 1E0OA 3RMYA 5DUYA 4G9NA 5BXTA 3N7KA 1TTUA 1F31A 1AVWB 1TIEA
chains in the Genus database with same CATH superfamily
1W3FA 3BAHA 3O4AA 4LO1C 3V79C 1G82A 3FFZA 4IQPA 3A07A 4J23B 3C9ZA 2YUGA 2D24A 3EF2A 1CVSA 1S0EA 2P23A 2VLCA 4JKQA 4QC4A 1EYLA 1T9FA 3VSZA 3N7LA 3WINA 2D7RA 1V6XA 2MLLB 2KI6B 3S8KA 1YTOA 3BAGA 4L4HA 4OW4A 5F90A 1DIWA 4I7IA 3HN1A 3OJVA 5D62A 3CA5A 3A21A 2AQZA 1L2HA 1XHBA 3A23A 3O5WB 3P53A 1GGPB 1ISYA 2F2FA 2FFVA 3FJJA 3UD7A 5BVPI 5F8YA 3VT1A 1BA7A 4ZOTA 4KEIA 4DEPA 3N7JA 1SZ6B 1CE7B 1DJSB 3HMYA 3V0BA 3WA1A 5G00A 1BLAA 1S0LA 3R4UA 4JKXB 3OBRA 4WBCA 1PWAA 1UPSA 4GOVA 4IY9A 3AZWA 2ZQOA 5EHAA 3N7MA 3OBTA 3P6IA 5EG6C 2RG9B 1YBIA 3BA7A 2FO1A 4QKRA 3FJEA 4USOA 4ZGRB 1JLXA 1N4KA 1P63A 4LO0C 3FJBA 1S0BA 2KKIA 1DQOA 2D44A 1XYFA 2Z49A 3OGGA 4GOYA 2NS2A 3HBWA 4LO2A 1RZOB 3B9UA 3IM5A 4QALA 1DLLA 8I1BA 3Q7YA 1ABRB 4Q91A 2VUAA 4QKSA 3V0AB 1FMMS 3WO2A 1YYNA 3AKIA 1IRPA 1WD4A 3WINC 2KH2A 3NBEA 4HA2A 2D20A 3O4BA 1DFQA 3O44A 3RTJB 1TWMA 3PMEA 3CRHA 4JAWA 4ZFYB 3V0BB 4JRAA 2RSTA 4L4IA 4JQ0A 4IZXA 1VCLA 3NBNA 3CRIA 2F2FC 4IHZA 3PHZA 2IHOA 4I4YA 3H6RB 4I96A 2KLLA 3PUBA 3A22A 4P0KA 3UD8A 2VXRA 3VSFA 4FVVA 5DVHA 4QO3A 1G9DA 5D63A 1JQZA 3O4CA 3CA6A 1BLDA 4KBBA 4J2SA 3CQAA 2D22A 5D61A 1I1EA 2P39A 1R8NA 41BIA 2ZQNA 3FJFA 5DZUA 5JMCA 4ZLBB 4MZFB 4QBCA 2NM1A 4QD2C 4XFSA 5GAQA 1II4A 2ET2A 4P0JA 1HWPB 2ZR1B 4F34A 4CJMA 2AFGA 4DENA 3NBCA 1AVAC 1Z4SA 1WD3A 3OJMA 1DZDA 1ISWA 3JRRA 4ENDA 3AKGA 4I4XA 3O4DA 2R9KB 4LO2C 3OGFA 2MC2A 3WO4A 5JLVA 1WBAA 2UUSA 2VXTI 5BOWA 1JT7A 2D23A 2HWMA 3AH1A 4KEJA 3UD9A 3AZVA 1G9CA 1HWNB 3BRGC 4H75A 1QQKA 2Y9WC 4P6AA 4I3NA 4A7ZA 1S0GA 2K43A 4HR6C 1QQLA 4D0TA 3V0AA 2VSEA 1S0FA 2ESUA 3FJKA 1Z2VA 3FUOA 3IIRA 4TLPA 4USPA 2D1ZA 1YF8B 1PC8B 3S8JA 3R4SA 3TC2A 4I1EA 3FJ9A 4ZA3B 4DCKC 2K4AB 1XG6A 3RMXA 3O49A 1ISZA 1W3AA 4I37A 4II0A 2Q9XA 1M16A 1G9AA 2Y9XE 4R6UB 5F8WA 3K1XA 3IAGC 4I4UA 1BARA 3H6RA 4Z8SB 3HOMA 1M2TB 3FJ8A 3UDAA 5FNWA 3LLPA 3RSJA 4GAFA 4P0LA 3HALA 3BA4A 2QYIB 1AF9A 3E8LC 1K5UA 1S0DA 3BA5A 4ZKTB 3WO3A 2DRZA 4IYBA 3F1RA 3Q7XA 3QYDA 3AKFA 4I4PA 4XFUA 3O3QA 3PG0A 4XFTA 5BXSA 3FJAA 4EFRA 5FZZA 4JP0A 31BIA 3VWCA 4ZFWB 5F8SA 5FZYA 3I29B 5B2HA 1FV2A 1IRAX 2NP0A 3UJ4A 4I8MA 3W9TA 4I4OA 5BP5A 1JTCA 1ONKB 1W3GA 3OJ2A 4LO3A 3BRDA 3VEQA 1MD6A 2IWTB 4EFPA 1ITBA 3WMVA 4D8HA 4ZBVB 1NZKA 7I1BA 1DFCA 1FV3A 3BRFA 2HWAA 1JT3A 3D7WB 5BQUA 1TWEA 4J2XA 2Z48A 3P6JA 2FGFA 3RTIB 1OQLB 2DRYA 4Z9WB 2BEBA 2NZ9A 1RMLA 2M49A 4OEGA 4XKIA 4G1RA 5E24E 4Q9GA 4J2YA 3MALA 3BAVA 3VT0A 3NJ5A 3FJCA 3H6QA 2NTDA 4KEKA 4MZGB 4LO7B 4ISQA 1HIBA 2D43A 4EEEB 2BEAA 3WMUA 4KC3A 1JLYA 4G6MA 1BFGA 4OWJA 4G6JA 4AN7B 1IILA 4X37A 4A7YA 4IONA 4LO7C 2NVHA 3FJHA 3BAQA 2Y9FA 2MIBA 1IHKA 3ZX7A 1TP0A 1FMZA 3LTQA 1EPWA 1BFFA 3AJ6A 1SR4A 2GZBA 4EFQA 4EKXB 2LIEA 1TFMB 1AFCA 3N0KA 2D7IA 2ERMA 3BTAA 2FFUA 5BP5C 1AVXB 2FDBM 1XZZA 1J0SA 4LO3C 3MPPG 6I1BA 4GP3A 4I2SA 4I1BA 2Y9GA 3BADA 4JPZA 3KMVA 2LIQA 2DS0A 3VUOA 3HSMA 2VSAA 4IY8A 4X38A 3IM7A 3ZXGA 4YOLA 3I2AA 2HZ9A 3QR5A 1DQGA 4X39A 5BQUC 1IJTA 4GP0A 1HCEA 4I4QA 3VT2A 2F8XC 2HW9A 3AKHA 1QXMA 3F62B 1YXWA 4UY4A 3UJ0A 1V6WA 3NBDA 1BASA 1JT4A 1MC9A 1HWOB 21BIA 1PUUB 1Q1UA 4OWKA 4IZEA 1JT5A 1DZCA 2XOAA 3CU1B 4GAIA 2X2TA 4QBVA 2L5XA 1Q03A 1D0HA 2WRYA 4G9MA 3AH4A 3I2XA 4I4SA 4F83A 2DREA 2E4MA 1AXMA 5EC5A 4FGFA 2AAIB 3ZXDA 3O4OA 1R8OA 1EVTA 1S0CA 2GO2A 2VU9A 4I6IA 3ZC9A 1HWMB 1ISXA 3BAOA 1WBCA 1BFBA 2RQ9A 3CRGA 3BB2A 1SR4C 3JUTA 3ZC8A 4I4VA 4OEFA 3CAHA 4X3AA 1FN0A 4H9WA 1A8DA 5FNXA 1NUNA 4H04A 1K5VA 3FJDA 4LO1A 4AN6A 4MZHA 1HCDA 2QN4A 4HJJA 3BAUA 1BFCA 2KI4A 1I1BA 2BFHA 2J3PA 4ZFUB 4Q9PA 2K8RA 2NYYA 3POKA 3FUQA 1KNMA 4LO8B 1EV2A 3ILAA 1TOOA 4ISRA 4J2KA 3T8SA 2WBCA 1IT0A 4OWLA 5BXRA 1IOBA 2AXMA 1V6UA 1HKNA 4I4RA 4D0ZA 5FZUA 1FWVA 1PUMB 1Z0HA 3H6SE 3FJIA 1ILR1 4EB2B 4QD2B 3AH2A 1ISVA 2E4MC 4PC4A 1AVUA 2X2SA 2Q3NB 1PZZA 3CA3A 1JY0A 9ILBA 3AJ5A 3SNVA 3CA4A 1G9BA 5I1BA 2I1BA 1FGAA 1V6VA 3IM6A 1Q04A 1FWUA 5HPZA 3BX1C 5BXPA 3FGMA 4LO0A 1T4QA 4I0YA 4OEEA 3CA1A 3Q7WA 1FQ9A 1RY7A 1RG8A 3CA0A 4A7KA 4OUJA 5DSSB 1E0OA 3RMYA 5DUYA 4G9NA 5BXTA 3N7KA 1TTUA 1F31A 1AVWB 1TIEA
chains in the Genus database with same CATH topology
1W3FA 3BAHA 3O4AA 4LO1C 3V79C 1G82A 3FFZA 4IQPA 3A07A 4J23B 3C9ZA 2YUGA 2D24A 3EF2A 1CVSA 1S0EA 2P23A 2VLCA 4JKQA 4QC4A 1EYLA 1T9FA 3VSZA 3N7LA 3WINA 2D7RA 1V6XA 2MLLB 2KI6B 3S8KA 1YTOA 3BAGA 4L4HA 4OW4A 5F90A 1DIWA 4I7IA 3HN1A 3OJVA 5D62A 3CA5A 3A21A 2AQZA 1L2HA 1XHBA 3A23A 3O5WB 3P53A 1GGPB 1ISYA 2F2FA 2FFVA 3FJJA 3UD7A 5BVPI 5F8YA 3VT1A 1BA7A 4ZOTA 4KEIA 4DEPA 3N7JA 1SZ6B 1CE7B 1DJSB 3HMYA 3V0BA 3WA1A 5G00A 1BLAA 1S0LA 3R4UA 4JKXB 3OBRA 4WBCA 1PWAA 1UPSA 4GOVA 4IY9A 3AZWA 2ZQOA 5EHAA 3N7MA 3OBTA 3P6IA 5EG6C 2RG9B 1YBIA 3BA7A 2FO1A 4QKRA 3FJEA 4USOA 4ZGRB 1JLXA 1N4KA 1P63A 4LO0C 3FJBA 1S0BA 2KKIA 1DQOA 2D44A 1XYFA 2Z49A 3OGGA 4GOYA 2NS2A 3HBWA 4LO2A 1RZOB 3B9UA 3IM5A 4QALA 1DLLA 8I1BA 3Q7YA 1ABRB 4Q91A 2VUAA 4QKSA 3V0AB 1FMMS 3WO2A 1YYNA 3AKIA 1IRPA 1WD4A 3WINC 2KH2A 3NBEA 4HA2A 2D20A 3O4BA 1DFQA 3O44A 3RTJB 1TWMA 3PMEA 3CRHA 4JAWA 4ZFYB 3V0BB 4JRAA 2RSTA 4L4IA 4JQ0A 4IZXA 1VCLA 3NBNA 3CRIA 2F2FC 4IHZA 3PHZA 2IHOA 4I4YA 3H6RB 4I96A 2KLLA 3PUBA 3A22A 4P0KA 3UD8A 2VXRA 3VSFA 4FVVA 5DVHA 4QO3A 1G9DA 5D63A 1JQZA 3O4CA 3CA6A 1BLDA 4KBBA 4J2SA 3CQAA 2D22A 5D61A 1I1EA 2P39A 1R8NA 41BIA 2ZQNA 3FJFA 5DZUA 5JMCA 4ZLBB 4MZFB 4QBCA 2NM1A 4QD2C 4XFSA 5GAQA 1II4A 2ET2A 4P0JA 1HWPB 2ZR1B 4F34A 4CJMA 2AFGA 4DENA 3NBCA 1AVAC 1Z4SA 1WD3A 3OJMA 1DZDA 1ISWA 3JRRA 4ENDA 3AKGA 4I4XA 3O4DA 2R9KB 4LO2C 3OGFA 2MC2A 3WO4A 5JLVA 1WBAA 2UUSA 2VXTI 5BOWA 1JT7A 2D23A 2HWMA 3AH1A 4KEJA 3UD9A 3AZVA 1G9CA 1HWNB 3BRGC 4H75A 1QQKA 2Y9WC 4P6AA 4I3NA 4A7ZA 1S0GA 2K43A 4HR6C 1QQLA 4D0TA 3V0AA 2VSEA 1S0FA 2ESUA 3FJKA 1Z2VA 3FUOA 3IIRA 4TLPA 4USPA 2D1ZA 1YF8B 1PC8B 3S8JA 3R4SA 3TC2A 4I1EA 3FJ9A 4ZA3B 4DCKC 2K4AB 1XG6A 3RMXA 3O49A 1ISZA 1W3AA 4I37A 4II0A 2Q9XA 1M16A 1G9AA 2Y9XE 4R6UB 5F8WA 3K1XA 3IAGC 4I4UA 1BARA 3H6RA 4Z8SB 3HOMA 1M2TB 3FJ8A 3UDAA 5FNWA 3LLPA 3RSJA 4GAFA 4P0LA 3HALA 3BA4A 2QYIB 1AF9A 3E8LC 1K5UA 1S0DA 3BA5A 4ZKTB 3WO3A 2DRZA 4IYBA 3F1RA 3Q7XA 3QYDA 3AKFA 4I4PA 4XFUA 3O3QA 3PG0A 4XFTA 5BXSA 3FJAA 4EFRA 5FZZA 4JP0A 31BIA 3VWCA 4ZFWB 5F8SA 5FZYA 3I29B 5B2HA 1FV2A 1IRAX 2NP0A 3UJ4A 4I8MA 3W9TA 4I4OA 5BP5A 1JTCA 1ONKB 1W3GA 3OJ2A 4LO3A 3BRDA 3VEQA 1MD6A 2IWTB 4EFPA 1ITBA 3WMVA 4D8HA 4ZBVB 1NZKA 7I1BA 1DFCA 1FV3A 3BRFA 2HWAA 1JT3A 3D7WB 5BQUA 1TWEA 4J2XA 2Z48A 3P6JA 2FGFA 3RTIB 1OQLB 2DRYA 4Z9WB 2BEBA 2NZ9A 1RMLA 2M49A 4OEGA 4XKIA 4G1RA 5E24E 4Q9GA 4J2YA 3MALA 3BAVA 3VT0A 3NJ5A 3FJCA 3H6QA 2NTDA 4KEKA 4MZGB 4LO7B 4ISQA 1HIBA 2D43A 4EEEB 2BEAA 3WMUA 4KC3A 1JLYA 4G6MA 1BFGA 4OWJA 4G6JA 4AN7B 1IILA 4X37A 4A7YA 4IONA 4LO7C 2NVHA 3FJHA 3BAQA 2Y9FA 2MIBA 1IHKA 3ZX7A 1TP0A 1FMZA 3LTQA 1EPWA 1BFFA 3AJ6A 1SR4A 2GZBA 4EFQA 4EKXB 2LIEA 1TFMB 1AFCA 3N0KA 2D7IA 2ERMA 3BTAA 2FFUA 5BP5C 1AVXB 2FDBM 1XZZA 1J0SA 4LO3C 3MPPG 6I1BA 4GP3A 4I2SA 4I1BA 2Y9GA 3BADA 4JPZA 3KMVA 2LIQA 2DS0A 3VUOA 3HSMA 2VSAA 4IY8A 4X38A 3IM7A 3ZXGA 4YOLA 3I2AA 2HZ9A 3QR5A 1DQGA 4X39A 5BQUC 1IJTA 4GP0A 1HCEA 4I4QA 3VT2A 2F8XC 2HW9A 3AKHA 1QXMA 3F62B 1YXWA 4UY4A 3UJ0A 1V6WA 3NBDA 1BASA 1JT4A 1MC9A 1HWOB 21BIA 1PUUB 1Q1UA 4OWKA 4IZEA 1JT5A 1DZCA 2XOAA 3CU1B 4GAIA 2X2TA 4QBVA 2L5XA 1Q03A 1D0HA 2WRYA 4G9MA 3AH4A 3I2XA 4I4SA 4F83A 2DREA 2E4MA 1AXMA 5EC5A 4FGFA 2AAIB 3ZXDA 3O4OA 1R8OA 1EVTA 1S0CA 2GO2A 2VU9A 4I6IA 3ZC9A 1HWMB 1ISXA 3BAOA 1WBCA 1BFBA 2RQ9A 3CRGA 3BB2A 1SR4C 3JUTA 3ZC8A 4I4VA 4OEFA 3CAHA 4X3AA 1FN0A 4H9WA 1A8DA 5FNXA 1NUNA 4H04A 1K5VA 3FJDA 4LO1A 4AN6A 4MZHA 1HCDA 2QN4A 4HJJA 3BAUA 1BFCA 2KI4A 1I1BA 2BFHA 2J3PA 4ZFUB 4Q9PA 2K8RA 2NYYA 3POKA 3FUQA 1KNMA 4LO8B 1EV2A 3ILAA 1TOOA 4ISRA 4J2KA 3T8SA 2WBCA 1IT0A 4OWLA 5BXRA 1IOBA 2AXMA 1V6UA 1HKNA 4I4RA 4D0ZA 5FZUA 1FWVA 1PUMB 1Z0HA 3H6SE 3FJIA 1ILR1 4EB2B 4QD2B 3AH2A 1ISVA 2E4MC 4PC4A 1AVUA 2X2SA 2Q3NB 1PZZA 3CA3A 1JY0A 9ILBA 3AJ5A 3SNVA 3CA4A 1G9BA 5I1BA 2I1BA 1FGAA 1V6VA 3IM6A 1Q04A 1FWUA 5HPZA 3BX1C 5BXPA 3FGMA 4LO0A 1T4QA 4I0YA 4OEEA 3CA1A 3Q7WA 1FQ9A 1RY7A 1RG8A 3CA0A 4A7KA 4OUJA 5DSSB 1E0OA 3RMYA 5DUYA 4G9NA 5BXTA 3N7KA 1TTUA 1F31A 1AVWB 1TIEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1W3F A;  3BAH A;  3O4A A;  4LO1 C;  3V79 C;  1G82 A;  3FFZ A;  4IQP A;  3A07 A;  4J23 B;  3C9Z A;  2YUG A;  2D24 A;  3EF2 A;  1CVS A;  1S0E A;  2P23 A;  2VLC A;  4JKQ A;  4QC4 A;  1EYL A;  1T9F A;  3VSZ A;  3N7L A;  3WIN A;  2D7R A;  1V6X A;  2MLL B;  2KI6 B;  3S8K A;  1YTO A;  3BAG A;  4L4H A;  4OW4 A;  5F90 A;  1DIW A;  4I7I A;  3HN1 A;  3OJV A;  5D62 A;  3CA5 A;  3A21 A;  2AQZ A;  1L2H A;  1XHB A;  3A23 A;  3O5W B;  3P53 A;  1GGP B;  1ISY A;  2F2F A;  2FFV A;  3FJJ A;  3UD7 A;  5BVP I;  5F8Y A;  3VT1 A;  1BA7 A;  4ZOT A;  4KEI A;  4DEP A;  3N7J A;  1SZ6 B;  1CE7 B;  1DJS B;  3HMY A;  3V0B A;  3WA1 A;  5G00 A;  1BLA A;  1S0L A;  3R4U A;  4JKX B;  3OBR A;  4WBC A;  1PWA A;  1UPS A;  4GOV A;  4IY9 A;  3AZW A;  2ZQO A;  5EHA A;  3N7M A;  3OBT A;  3P6I A;  5EG6 C;  2RG9 B;  1YBI A;  3BA7 A;  2FO1 A;  4QKR A;  3FJE A;  4USO A;  4ZGR B;  1JLX A;  1N4K A;  1P63 A;  4LO0 C;  3FJB A;  1S0B A;  2KKI A;  1DQO A;  2D44 A;  1XYF A;  2Z49 A;  3OGG A;  4GOY A;  3HBW A;  4LO2 A;  1RZO B;  3B9U A;  3IM5 A;  4QAL A;  1DLL A;  8I1B A;  3Q7Y A;  1ABR B;  4Q91 A;  2VUA A;  4QKS A;  3V0A B;  1FMM S;  3WO2 A;  1YYN A;  3AKI A;  1IRP A;  1WD4 A;  3WIN C;  2KH2 A;  3NBE A;  4HA2 A;  2D20 A;  3O4B A;  1DFQ A;  3O44 A;  3RTJ B;  1TWM A;  3PME A;  3CRH A;  4JAW A;  4ZFY B;  3V0B B;  4JRA A;  2RST A;  4L4I A;  4JQ0 A;  4IZX A;  1VCL A;  3NBN A;  3CRI A;  2F2F C;  4IHZ A;  3PHZ A;  2IHO A;  4I4Y A;  3H6R B;  4I96 A;  2KLL A;  3PUB A;  3A22 A;  4P0K A;  3UD8 A;  2VXR A;  3VSF A;  4FVV A;  5DVH A;  4QO3 A;  1G9D A;  5D63 A;  1JQZ A;  3O4C A;  3CA6 A;  1BLD A;  4KBB A;  4J2S A;  3CQA A;  2D22 A;  5D61 A;  1I1E A;  2P39 A;  1R8N A;  41BI A;  2ZQN A;  3FJF A;  5DZU A;  5JMC A;  4ZLB B;  4QBC A;  2NM1 A;  4QD2 C;  4XFS A;  5GAQ A;  1II4 A;  2ET2 A;  4P0J A;  1HWP B;  2ZR1 B;  4F34 A;  4CJM A;  2AFG A;  4DEN A;  3NBC A;  1AVA C;  1Z4S A;  1WD3 A;  3OJM A;  1DZD A;  1ISW A;  3JRR A;  4END A;  3AKG A;  4I4X A;  3O4D A;  2R9K B;  4LO2 C;  3OGF A;  2MC2 A;  3WO4 A;  5JLV A;  1WBA A;  2UUS A;  2VXT I;  5BOW A;  1JT7 A;  2D23 A;  2HWM A;  3AH1 A;  4KEJ A;  3UD9 A;  3AZV A;  1G9C A;  1HWN B;  3BRG C;  1QQK A;  2Y9W C;  4P6A A;  4I3N A;  4A7Z A;  1S0G A;  2K43 A;  4HR6 C;  1QQL A;  4D0T A;  3V0A A;  2VSE A;  1S0F A;  2ESU A;  3FJK A;  1Z2V A;  3FUO A;  3IIR A;  4TLP A;  4USP A;  2D1Z A;  1YF8 B;  1PC8 B;  3S8J A;  3R4S A;  3TC2 A;  4I1E A;  3FJ9 A;  4ZA3 B;  4DCK C;  2K4A B;  1XG6 A;  3RMX A;  3O49 A;  1ISZ A;  1W3A A;  4I37 A;  4II0 A;  2Q9X A;  1M16 A;  1G9A A;  2Y9X E;  4R6U B;  5F8W A;  3K1X A;  3IAG C;  4I4U A;  1BAR A;  3H6R A;  4Z8S B;  3HOM A;  1M2T B;  3FJ8 A;  3UDA A;  5FNW A;  3LLP A;  3RSJ A;  4GAF A;  4P0L A;  3HAL A;  3BA4 A;  2QYI B;  1AF9 A;  3E8L C;  1K5U A;  1S0D A;  3BA5 A;  4ZKT B;  3WO3 A;  2DRZ A;  4IYB A;  3F1R A;  3Q7X A;  3QYD A;  3AKF A;  4I4P A;  4XFU A;  3O3Q A;  3PG0 A;  4XFT A;  5BXS A;  3FJA A;  4EFR A;  5FZZ A;  4JP0 A;  31BI A;  3VWC A;  4ZFW B;  5F8S A;  5FZY A;  3I29 B;  5B2H A;  1FV2 A;  1IRA X;  2NP0 A;  3UJ4 A;  4I8M A;  3W9T A;  4I4O A;  5BP5 A;  1JTC A;  1ONK B;  1W3G A;  3OJ2 A;  4LO3 A;  3BRD A;  3VEQ A;  1MD6 A;  2IWT B;  4EFP A;  1ITB A;  3WMV A;  4D8H A;  4ZBV B;  1NZK A;  7I1B A;  1DFC A;  1FV3 A;  3BRF A;  2HWA A;  1JT3 A;  3D7W B;  5BQU A;  1TWE A;  4J2X A;  2Z48 A;  3P6J A;  2FGF A;  3RTI B;  1OQL B;  2DRY A;  4Z9W B;  2BEB A;  2NZ9 A;  1RML A;  2M49 A;  4OEG A;  4XKI A;  4G1R A;  5E24 E;  4Q9G A;  4J2Y A;  3MAL A;  3BAV A;  3VT0 A;  3NJ5 A;  3FJC A;  3H6Q A;  2NTD A;  4KEK A;  4LO7 B;  4ISQ A;  1HIB A;  2D43 A;  4EEE B;  2BEA A;  3WMU A;  4KC3 A;  1JLY A;  4G6M A;  1BFG A;  4OWJ A;  4G6J A;  4AN7 B;  1IIL A;  4X37 A;  4A7Y A;  4ION A;  4LO7 C;  2NVH A;  3FJH A;  3BAQ A;  2Y9F A;  2MIB A;  1IHK A;  3ZX7 A;  1TP0 A;  1FMZ A;  3LTQ A;  1EPW A;  1BFF A;  3AJ6 A;  1SR4 A;  2GZB A;  4EFQ A;  4EKX B;  2LIE A;  1TFM B;  1AFC A;  3N0K A;  2D7I A;  2ERM A;  3BTA A;  2FFU A;  5BP5 C;  1AVX B;  2FDB M;  1XZZ A;  1J0S A;  4LO3 C;  3MPP G;  6I1B A;  4GP3 A;  4I2S A;  4I1B A;  2Y9G A;  3BAD A;  4JPZ A;  3KMV A;  2LIQ A;  2DS0 A;  3VUO A;  3HSM A;  2VSA A;  4IY8 A;  4X38 A;  3IM7 A;  3ZXG A;  4YOL A;  3I2A A;  2HZ9 A;  3QR5 A;  1DQG A;  4X39 A;  5BQU C;  1IJT A;  4GP0 A;  1HCE A;  4I4Q A;  3VT2 A;  2F8X C;  2HW9 A;  3AKH A;  1QXM A;  3F62 B;  1YXW A;  3UJ0 A;  1V6W A;  3NBD A;  1BAS A;  1JT4 A;  1MC9 A;  1HWO B;  21BI A;  1PUU B;  1Q1U A;  4OWK A;  4IZE A;  1JT5 A;  1DZC A;  2XOA A;  3CU1 B;  4GAI A;  2X2T A;  4QBV A;  2L5X A;  1Q03 A;  1D0H A;  2WRY A;  4G9M A;  3AH4 A;  3I2X A;  4I4S A;  4F83 A;  2DRE A;  2E4M A;  1AXM A;  5EC5 A;  4FGF A;  2AAI B;  3ZXD A;  3O4O A;  1R8O A;  1EVT A;  1S0C A;  2GO2 A;  2VU9 A;  4I6I A;  3ZC9 A;  1HWM B;  1ISX A;  3BAO A;  1WBC A;  1BFB A;  2RQ9 A;  3CRG A;  3BB2 A;  1SR4 C;  3JUT A;  3ZC8 A;  4I4V A;  4OEF A;  3CAH A;  4X3A A;  1FN0 A;  4H9W A;  1A8D A;  5FNX A;  1NUN A;  4H04 A;  1K5V A;  3FJD A;  4LO1 A;  4AN6 A;  1HCD A;  2QN4 A;  4HJJ A;  3BAU A;  1BFC A;  2KI4 A;  1I1B A;  2BFH A;  2J3P A;  4ZFU B;  4Q9P A;  2K8R A;  2NYY A;  3POK A;  3FUQ A;  1KNM A;  4LO8 B;  1EV2 A;  3ILA A;  1TOO A;  4ISR A;  4J2K A;  3T8S A;  2WBC A;  1IT0 A;  4OWL A;  5BXR A;  1IOB A;  2AXM A;  1V6U A;  1HKN A;  4I4R A;  4D0Z A;  5FZU A;  1FWV A;  1PUM B;  1Z0H A;  3H6S E;  3FJI A;  1ILR 1;  4EB2 B;  4QD2 B;  3AH2 A;  1ISV A;  2E4M C;  4PC4 A;  1AVU A;  2X2S A;  2Q3N B;  1PZZ A;  3CA3 A;  1JY0 A;  9ILB A;  3AJ5 A;  3SNV A;  3CA4 A;  1G9B A;  5I1B A;  2I1B A;  1FGA A;  1V6V A;  3IM6 A;  1Q04 A;  1FWU A;  5HPZ A;  3BX1 C;  5BXP A;  3FGM A;  4LO0 A;  1T4Q A;  4I0Y A;  4OEE A;  3CA1 A;  3Q7W A;  1FQ9 A;  1RY7 A;  1RG8 A;  3CA0 A;  4A7K A;  4OUJ A;  5DSS B;  1E0O A;  3RMY A;  5DUY A;  4G9N A;  5BXT A;  3N7K A;  1TTU A;  1F31 A;  1AVW B;  1TIE A; 
#chains in the Genus database with same CATH topology
 1W3F A;  3BAH A;  3O4A A;  4LO1 C;  3V79 C;  1G82 A;  3FFZ A;  4IQP A;  3A07 A;  4J23 B;  3C9Z A;  2YUG A;  2D24 A;  3EF2 A;  1CVS A;  1S0E A;  2P23 A;  2VLC A;  4JKQ A;  4QC4 A;  1EYL A;  1T9F A;  3VSZ A;  3N7L A;  3WIN A;  2D7R A;  1V6X A;  2MLL B;  2KI6 B;  3S8K A;  1YTO A;  3BAG A;  4L4H A;  4OW4 A;  5F90 A;  1DIW A;  4I7I A;  3HN1 A;  3OJV A;  5D62 A;  3CA5 A;  3A21 A;  2AQZ A;  1L2H A;  1XHB A;  3A23 A;  3O5W B;  3P53 A;  1GGP B;  1ISY A;  2F2F A;  2FFV A;  3FJJ A;  3UD7 A;  5BVP I;  5F8Y A;  3VT1 A;  1BA7 A;  4ZOT A;  4KEI A;  4DEP A;  3N7J A;  1SZ6 B;  1CE7 B;  1DJS B;  3HMY A;  3V0B A;  3WA1 A;  5G00 A;  1BLA A;  1S0L A;  3R4U A;  4JKX B;  3OBR A;  4WBC A;  1PWA A;  1UPS A;  4GOV A;  4IY9 A;  3AZW A;  2ZQO A;  5EHA A;  3N7M A;  3OBT A;  3P6I A;  5EG6 C;  2RG9 B;  1YBI A;  3BA7 A;  2FO1 A;  4QKR A;  3FJE A;  4USO A;  4ZGR B;  1JLX A;  1N4K A;  1P63 A;  4LO0 C;  3FJB A;  1S0B A;  2KKI A;  1DQO A;  2D44 A;  1XYF A;  2Z49 A;  3OGG A;  4GOY A;  2NS2 A;  3HBW A;  4LO2 A;  1RZO B;  3B9U A;  3IM5 A;  4QAL A;  1DLL A;  8I1B A;  3Q7Y A;  1ABR B;  4Q91 A;  2VUA A;  4QKS A;  3V0A B;  1FMM S;  3WO2 A;  1YYN A;  3AKI A;  1IRP A;  1WD4 A;  3WIN C;  2KH2 A;  3NBE A;  4HA2 A;  2D20 A;  3O4B A;  1DFQ A;  3O44 A;  3RTJ B;  1TWM A;  3PME A;  3CRH A;  4JAW A;  4ZFY B;  3V0B B;  4JRA A;  2RST A;  4L4I A;  4JQ0 A;  4IZX A;  1VCL A;  3NBN A;  3CRI A;  2F2F C;  4IHZ A;  3PHZ A;  2IHO A;  4I4Y A;  3H6R B;  4I96 A;  2KLL A;  3PUB A;  3A22 A;  4P0K A;  3UD8 A;  2VXR A;  3VSF A;  4FVV A;  5DVH A;  4QO3 A;  1G9D A;  5D63 A;  1JQZ A;  3O4C A;  3CA6 A;  1BLD A;  4KBB A;  4J2S A;  3CQA A;  2D22 A;  5D61 A;  1I1E A;  2P39 A;  1R8N A;  41BI A;  2ZQN A;  3FJF A;  5DZU A;  5JMC A;  4ZLB B;  4MZF B;  4QBC A;  2NM1 A;  4QD2 C;  4XFS A;  5GAQ A;  1II4 A;  2ET2 A;  4P0J A;  1HWP B;  2ZR1 B;  4F34 A;  4CJM A;  2AFG A;  4DEN A;  3NBC A;  1AVA C;  1Z4S A;  1WD3 A;  3OJM A;  1DZD A;  1ISW A;  3JRR A;  4END A;  3AKG A;  4I4X A;  3O4D A;  2R9K B;  4LO2 C;  3OGF A;  2MC2 A;  3WO4 A;  5JLV A;  1WBA A;  2UUS A;  2VXT I;  5BOW A;  1JT7 A;  2D23 A;  2HWM A;  3AH1 A;  4KEJ A;  3UD9 A;  3AZV A;  1G9C A;  1HWN B;  3BRG C;  4H75 A;  1QQK A;  2Y9W C;  4P6A A;  4I3N A;  4A7Z A;  1S0G A;  2K43 A;  4HR6 C;  1QQL A;  4D0T A;  3V0A A;  2VSE A;  1S0F A;  2ESU A;  3FJK A;  1Z2V A;  3FUO A;  3IIR A;  4TLP A;  4USP A;  2D1Z A;  1YF8 B;  1PC8 B;  3S8J A;  3R4S A;  3TC2 A;  4I1E A;  3FJ9 A;  4ZA3 B;  4DCK C;  2K4A B;  1XG6 A;  3RMX A;  3O49 A;  1ISZ A;  1W3A A;  4I37 A;  4II0 A;  2Q9X A;  1M16 A;  1G9A A;  2Y9X E;  4R6U B;  5F8W A;  3K1X A;  3IAG C;  4I4U A;  1BAR A;  3H6R A;  4Z8S B;  3HOM A;  1M2T B;  3FJ8 A;  3UDA A;  5FNW A;  3LLP A;  3RSJ A;  4GAF A;  4P0L A;  3HAL A;  3BA4 A;  2QYI B;  1AF9 A;  3E8L C;  1K5U A;  1S0D A;  3BA5 A;  4ZKT B;  3WO3 A;  2DRZ A;  4IYB A;  3F1R A;  3Q7X A;  3QYD A;  3AKF A;  4I4P A;  4XFU A;  3O3Q A;  3PG0 A;  4XFT A;  5BXS A;  3FJA A;  4EFR A;  5FZZ A;  4JP0 A;  31BI A;  3VWC A;  4ZFW B;  5F8S A;  5FZY A;  3I29 B;  5B2H A;  1FV2 A;  1IRA X;  2NP0 A;  3UJ4 A;  4I8M A;  3W9T A;  4I4O A;  5BP5 A;  1JTC A;  1ONK B;  1W3G A;  3OJ2 A;  4LO3 A;  3BRD A;  3VEQ A;  1MD6 A;  2IWT B;  4EFP A;  1ITB A;  3WMV A;  4D8H A;  4ZBV B;  1NZK A;  7I1B A;  1DFC A;  1FV3 A;  3BRF A;  2HWA A;  1JT3 A;  3D7W B;  5BQU A;  1TWE A;  4J2X A;  2Z48 A;  3P6J A;  2FGF A;  3RTI B;  1OQL B;  2DRY A;  4Z9W B;  2BEB A;  2NZ9 A;  1RML A;  2M49 A;  4OEG A;  4XKI A;  4G1R A;  5E24 E;  4Q9G A;  4J2Y A;  3MAL A;  3BAV A;  3VT0 A;  3NJ5 A;  3FJC A;  3H6Q A;  2NTD A;  4KEK A;  4MZG B;  4LO7 B;  4ISQ A;  1HIB A;  2D43 A;  4EEE B;  2BEA A;  3WMU A;  4KC3 A;  1JLY A;  4G6M A;  1BFG A;  4OWJ A;  4G6J A;  4AN7 B;  1IIL A;  4X37 A;  4A7Y A;  4ION A;  4LO7 C;  2NVH A;  3FJH A;  3BAQ A;  2Y9F A;  2MIB A;  1IHK A;  3ZX7 A;  1TP0 A;  1FMZ A;  3LTQ A;  1EPW A;  1BFF A;  3AJ6 A;  1SR4 A;  2GZB A;  4EFQ A;  4EKX B;  2LIE A;  1TFM B;  1AFC A;  3N0K A;  2D7I A;  2ERM A;  3BTA A;  2FFU A;  5BP5 C;  1AVX B;  2FDB M;  1XZZ A;  1J0S A;  4LO3 C;  3MPP G;  6I1B A;  4GP3 A;  4I2S A;  4I1B A;  2Y9G A;  3BAD A;  4JPZ A;  3KMV A;  2LIQ A;  2DS0 A;  3VUO A;  3HSM A;  2VSA A;  4IY8 A;  4X38 A;  3IM7 A;  3ZXG A;  4YOL A;  3I2A A;  2HZ9 A;  3QR5 A;  1DQG A;  4X39 A;  5BQU C;  1IJT A;  4GP0 A;  1HCE A;  4I4Q A;  3VT2 A;  2F8X C;  2HW9 A;  3AKH A;  1QXM A;  3F62 B;  1YXW A;  4UY4 A;  3UJ0 A;  1V6W A;  3NBD A;  1BAS A;  1JT4 A;  1MC9 A;  1HWO B;  21BI A;  1PUU B;  1Q1U A;  4OWK A;  4IZE A;  1JT5 A;  1DZC A;  2XOA A;  3CU1 B;  4GAI A;  2X2T A;  4QBV A;  2L5X A;  1Q03 A;  1D0H A;  2WRY A;  4G9M A;  3AH4 A;  3I2X A;  4I4S A;  4F83 A;  2DRE A;  2E4M A;  1AXM A;  5EC5 A;  4FGF A;  2AAI B;  3ZXD A;  3O4O A;  1R8O A;  1EVT A;  1S0C A;  2GO2 A;  2VU9 A;  4I6I A;  3ZC9 A;  1HWM B;  1ISX A;  3BAO A;  1WBC A;  1BFB A;  2RQ9 A;  3CRG A;  3BB2 A;  1SR4 C;  3JUT A;  3ZC8 A;  4I4V A;  4OEF A;  3CAH A;  4X3A A;  1FN0 A;  4H9W A;  1A8D A;  5FNX A;  1NUN A;  4H04 A;  1K5V A;  3FJD A;  4LO1 A;  4AN6 A;  4MZH A;  1HCD A;  2QN4 A;  4HJJ A;  3BAU A;  1BFC A;  2KI4 A;  1I1B A;  2BFH A;  2J3P A;  4ZFU B;  4Q9P A;  2K8R A;  2NYY A;  3POK A;  3FUQ A;  1KNM A;  4LO8 B;  1EV2 A;  3ILA A;  1TOO A;  4ISR A;  4J2K A;  3T8S A;  2WBC A;  1IT0 A;  4OWL A;  5BXR A;  1IOB A;  2AXM A;  1V6U A;  1HKN A;  4I4R A;  4D0Z A;  5FZU A;  1FWV A;  1PUM B;  1Z0H A;  3H6S E;  3FJI A;  1ILR 1;  4EB2 B;  4QD2 B;  3AH2 A;  1ISV A;  2E4M C;  4PC4 A;  1AVU A;  2X2S A;  2Q3N B;  1PZZ A;  3CA3 A;  1JY0 A;  9ILB A;  3AJ5 A;  3SNV A;  3CA4 A;  1G9B A;  5I1B A;  2I1B A;  1FGA A;  1V6V A;  3IM6 A;  1Q04 A;  1FWU A;  5HPZ A;  3BX1 C;  5BXP A;  3FGM A;  4LO0 A;  1T4Q A;  4I0Y A;  4OEE A;  3CA1 A;  3Q7W A;  1FQ9 A;  1RY7 A;  1RG8 A;  3CA0 A;  4A7K A;  4OUJ A;  5DSS B;  1E0O A;  3RMY A;  5DUY A;  4G9N A;  5BXT A;  3N7K A;  1TTU A;  1F31 A;  1AVW B;  1TIE A; 
#chains in the Genus database with same CATH homology
 1W3F A;  3BAH A;  3O4A A;  4LO1 C;  3V79 C;  1G82 A;  3FFZ A;  4IQP A;  3A07 A;  4J23 B;  3C9Z A;  2YUG A;  2D24 A;  3EF2 A;  1CVS A;  1S0E A;  2P23 A;  2VLC A;  4JKQ A;  4QC4 A;  1EYL A;  1T9F A;  3VSZ A;  3N7L A;  3WIN A;  2D7R A;  1V6X A;  2MLL B;  2KI6 B;  3S8K A;  1YTO A;  3BAG A;  4L4H A;  4OW4 A;  5F90 A;  1DIW A;  4I7I A;  3HN1 A;  3OJV A;  5D62 A;  3CA5 A;  3A21 A;  2AQZ A;  1L2H A;  1XHB A;  3A23 A;  3O5W B;  3P53 A;  1GGP B;  1ISY A;  2F2F A;  2FFV A;  3FJJ A;  3UD7 A;  5BVP I;  5F8Y A;  3VT1 A;  1BA7 A;  4ZOT A;  4KEI A;  4DEP A;  3N7J A;  1SZ6 B;  1CE7 B;  1DJS B;  3HMY A;  3V0B A;  3WA1 A;  5G00 A;  1BLA A;  1S0L A;  3R4U A;  4JKX B;  3OBR A;  4WBC A;  1PWA A;  1UPS A;  4GOV A;  4IY9 A;  3AZW A;  2ZQO A;  5EHA A;  3N7M A;  3OBT A;  3P6I A;  5EG6 C;  2RG9 B;  1YBI A;  3BA7 A;  2FO1 A;  4QKR A;  3FJE A;  4USO A;  4ZGR B;  1JLX A;  1N4K A;  1P63 A;  4LO0 C;  3FJB A;  1S0B A;  2KKI A;  1DQO A;  2D44 A;  1XYF A;  2Z49 A;  3OGG A;  4GOY A;  2NS2 A;  3HBW A;  4LO2 A;  1RZO B;  3B9U A;  3IM5 A;  4QAL A;  1DLL A;  8I1B A;  3Q7Y A;  1ABR B;  4Q91 A;  2VUA A;  4QKS A;  3V0A B;  1FMM S;  3WO2 A;  1YYN A;  3AKI A;  1IRP A;  1WD4 A;  3WIN C;  2KH2 A;  3NBE A;  4HA2 A;  2D20 A;  3O4B A;  1DFQ A;  3O44 A;  3RTJ B;  1TWM A;  3PME A;  3CRH A;  4JAW A;  4ZFY B;  3V0B B;  4JRA A;  2RST A;  4L4I A;  4JQ0 A;  4IZX A;  1VCL A;  3NBN A;  3CRI A;  2F2F C;  4IHZ A;  3PHZ A;  2IHO A;  4I4Y A;  3H6R B;  4I96 A;  2KLL A;  3PUB A;  3A22 A;  4P0K A;  3UD8 A;  2VXR A;  3VSF A;  4FVV A;  5DVH A;  4QO3 A;  1G9D A;  5D63 A;  1JQZ A;  3O4C A;  3CA6 A;  1BLD A;  4KBB A;  4J2S A;  3CQA A;  2D22 A;  5D61 A;  1I1E A;  2P39 A;  1R8N A;  41BI A;  2ZQN A;  3FJF A;  5DZU A;  5JMC A;  4ZLB B;  4MZF B;  4QBC A;  2NM1 A;  4QD2 C;  4XFS A;  5GAQ A;  1II4 A;  2ET2 A;  4P0J A;  1HWP B;  2ZR1 B;  4F34 A;  4CJM A;  2AFG A;  4DEN A;  3NBC A;  1AVA C;  1Z4S A;  1WD3 A;  3OJM A;  1DZD A;  1ISW A;  3JRR A;  4END A;  3AKG A;  4I4X A;  3O4D A;  2R9K B;  4LO2 C;  3OGF A;  2MC2 A;  3WO4 A;  5JLV A;  1WBA A;  2UUS A;  2VXT I;  5BOW A;  1JT7 A;  2D23 A;  2HWM A;  3AH1 A;  4KEJ A;  3UD9 A;  3AZV A;  1G9C A;  1HWN B;  3BRG C;  4H75 A;  1QQK A;  2Y9W C;  4P6A A;  4I3N A;  4A7Z A;  1S0G A;  2K43 A;  4HR6 C;  1QQL A;  4D0T A;  3V0A A;  2VSE A;  1S0F A;  2ESU A;  3FJK A;  1Z2V A;  3FUO A;  3IIR A;  4TLP A;  4USP A;  2D1Z A;  1YF8 B;  1PC8 B;  3S8J A;  3R4S A;  3TC2 A;  4I1E A;  3FJ9 A;  4ZA3 B;  4DCK C;  2K4A B;  1XG6 A;  3RMX A;  3O49 A;  1ISZ A;  1W3A A;  4I37 A;  4II0 A;  2Q9X A;  1M16 A;  1G9A A;  2Y9X E;  4R6U B;  5F8W A;  3K1X A;  3IAG C;  4I4U A;  1BAR A;  3H6R A;  4Z8S B;  3HOM A;  1M2T B;  3FJ8 A;  3UDA A;  5FNW A;  3LLP A;  3RSJ A;  4GAF A;  4P0L A;  3HAL A;  3BA4 A;  2QYI B;  1AF9 A;  3E8L C;  1K5U A;  1S0D A;  3BA5 A;  4ZKT B;  3WO3 A;  2DRZ A;  4IYB A;  3F1R A;  3Q7X A;  3QYD A;  3AKF A;  4I4P A;  4XFU A;  3O3Q A;  3PG0 A;  4XFT A;  5BXS A;  3FJA A;  4EFR A;  5FZZ A;  4JP0 A;  31BI A;  3VWC A;  4ZFW B;  5F8S A;  5FZY A;  3I29 B;  5B2H A;  1FV2 A;  1IRA X;  2NP0 A;  3UJ4 A;  4I8M A;  3W9T A;  4I4O A;  5BP5 A;  1JTC A;  1ONK B;  1W3G A;  3OJ2 A;  4LO3 A;  3BRD A;  3VEQ A;  1MD6 A;  2IWT B;  4EFP A;  1ITB A;  3WMV A;  4D8H A;  4ZBV B;  1NZK A;  7I1B A;  1DFC A;  1FV3 A;  3BRF A;  2HWA A;  1JT3 A;  3D7W B;  5BQU A;  1TWE A;  4J2X A;  2Z48 A;  3P6J A;  2FGF A;  3RTI B;  1OQL B;  2DRY A;  4Z9W B;  2BEB A;  2NZ9 A;  1RML A;  2M49 A;  4OEG A;  4XKI A;  4G1R A;  5E24 E;  4Q9G A;  4J2Y A;  3MAL A;  3BAV A;  3VT0 A;  3NJ5 A;  3FJC A;  3H6Q A;  2NTD A;  4KEK A;  4MZG B;  4LO7 B;  4ISQ A;  1HIB A;  2D43 A;  4EEE B;  2BEA A;  3WMU A;  4KC3 A;  1JLY A;  4G6M A;  1BFG A;  4OWJ A;  4G6J A;  4AN7 B;  1IIL A;  4X37 A;  4A7Y A;  4ION A;  4LO7 C;  2NVH A;  3FJH A;  3BAQ A;  2Y9F A;  2MIB A;  1IHK A;  3ZX7 A;  1TP0 A;  1FMZ A;  3LTQ A;  1EPW A;  1BFF A;  3AJ6 A;  1SR4 A;  2GZB A;  4EFQ A;  4EKX B;  2LIE A;  1TFM B;  1AFC A;  3N0K A;  2D7I A;  2ERM A;  3BTA A;  2FFU A;  5BP5 C;  1AVX B;  2FDB M;  1XZZ A;  1J0S A;  4LO3 C;  3MPP G;  6I1B A;  4GP3 A;  4I2S A;  4I1B A;  2Y9G A;  3BAD A;  4JPZ A;  3KMV A;  2LIQ A;  2DS0 A;  3VUO A;  3HSM A;  2VSA A;  4IY8 A;  4X38 A;  3IM7 A;  3ZXG A;  4YOL A;  3I2A A;  2HZ9 A;  3QR5 A;  1DQG A;  4X39 A;  5BQU C;  1IJT A;  4GP0 A;  1HCE A;  4I4Q A;  3VT2 A;  2F8X C;  2HW9 A;  3AKH A;  1QXM A;  3F62 B;  1YXW A;  4UY4 A;  3UJ0 A;  1V6W A;  3NBD A;  1BAS A;  1JT4 A;  1MC9 A;  1HWO B;  21BI A;  1PUU B;  1Q1U A;  4OWK A;  4IZE A;  1JT5 A;  1DZC A;  2XOA A;  3CU1 B;  4GAI A;  2X2T A;  4QBV A;  2L5X A;  1Q03 A;  1D0H A;  2WRY A;  4G9M A;  3AH4 A;  3I2X A;  4I4S A;  4F83 A;  2DRE A;  2E4M A;  1AXM A;  5EC5 A;  4FGF A;  2AAI B;  3ZXD A;  3O4O A;  1R8O A;  1EVT A;  1S0C A;  2GO2 A;  2VU9 A;  4I6I A;  3ZC9 A;  1HWM B;  1ISX A;  3BAO A;  1WBC A;  1BFB A;  2RQ9 A;  3CRG A;  3BB2 A;  1SR4 C;  3JUT A;  3ZC8 A;  4I4V A;  4OEF A;  3CAH A;  4X3A A;  1FN0 A;  4H9W A;  1A8D A;  5FNX A;  1NUN A;  4H04 A;  1K5V A;  3FJD A;  4LO1 A;  4AN6 A;  4MZH A;  1HCD A;  2QN4 A;  4HJJ A;  3BAU A;  1BFC A;  2KI4 A;  1I1B A;  2BFH A;  2J3P A;  4ZFU B;  4Q9P A;  2K8R A;  2NYY A;  3POK A;  3FUQ A;  1KNM A;  4LO8 B;  1EV2 A;  3ILA A;  1TOO A;  4ISR A;  4J2K A;  3T8S A;  2WBC A;  1IT0 A;  4OWL A;  5BXR A;  1IOB A;  2AXM A;  1V6U A;  1HKN A;  4I4R A;  4D0Z A;  5FZU A;  1FWV A;  1PUM B;  1Z0H A;  3H6S E;  3FJI A;  1ILR 1;  4EB2 B;  4QD2 B;  3AH2 A;  1ISV A;  2E4M C;  4PC4 A;  1AVU A;  2X2S A;  2Q3N B;  1PZZ A;  3CA3 A;  1JY0 A;  9ILB A;  3AJ5 A;  3SNV A;  3CA4 A;  1G9B A;  5I1B A;  2I1B A;  1FGA A;  1V6V A;  3IM6 A;  1Q04 A;  1FWU A;  5HPZ A;  3BX1 C;  5BXP A;  3FGM A;  4LO0 A;  1T4Q A;  4I0Y A;  4OEE A;  3CA1 A;  3Q7W A;  1FQ9 A;  1RY7 A;  1RG8 A;  3CA0 A;  4A7K A;  4OUJ A;  5DSS B;  1E0O A;  3RMY A;  5DUY A;  4G9N A;  5BXT A;  3N7K A;  1TTU A;  1F31 A;  1AVW B;  1TIE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...