1BLDA

Basic fibroblast growth factor (fgf-2) mutant with cys 78 replaced by ser and cys 96 replaced by ser, nmr
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
155
structure length
155
Chain Sequence
b'MAEGEITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BASIC FIBROBLAST GROWTH FACTOR
publication title High-resolution solution structure of basic fibroblast growth factor determined by multidimensional heteronuclear magnetic resonance spectroscopy.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Growth factor
total genus 12
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 1996-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00167 FGF Fibroblast growth factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.50 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 1bldA00
3JRRA 4I7IA 3NJ5A 3BAUA 3VEQA 3CA0A 3RTIB 3K1XA 3N7JA 1Z2VA 1AF9A 1S0BA 2HWAA 4H9WA 5BP5C 2Y9WC 3BAHA 2IHOA 2HW9A 4I4SA 3RSJA 1N4KA 2YUGA 3TC2A 1XHBA 4FVVA 4KEKA 1MD6A 5G00A 4I37A 3JUTA 3EF2A 5FZZA 4ZGRB 1DLLA 4D0ZA 4XKIA 2P23A 5GAQA 4Q91A 4ZFUB 1I1BA 4X38A 2HZ9A 3QYDA 4I4RA 1K5UA 4P0KA 3AH4A 3A07A 4F83A 3BA4A 4QO3A 4I4YA 4QALA 2AAIB 2LIQA 3MPPG 3OJMA 4GP3A 1R8NA 2KI4A 1IRPA 1S0EA 4USOA 4IONA 1V6UA 31BIA 3ZC9A 4X39A 2I1BA 4I3NA 1S0FA 3PG0A 1ISYA 4R6UB 4D0TA 4G9NA 3D7WB 3FJJA 1HWOB 5FNWA 3LLPA 1WBCA 2ZQOA 1TIEA 3AKIA 1L2HA 4I4QA 3PUBA 1RMLA 4IYBA 2K43A 4A7ZA 2NTDA 4I1BA 4ISRA 2VXTI 4OWLA 1YYNA 2Q9XA 2D7RA 3BADA 2E4MA 1HWPB 1Q03A 3BAGA 1HKNA 4L4IA 4OUJA 1BASA 1TFMB 3CU1B 4PC4A 4DEPA 2DS0A 3BA5A 2D1ZA 4IY9A 1FWUA 2M49A 4I0YA 2MIBA 2BEAA 3FJEA 5F90A 1ISZA 2K8RA 3UD9A 2UUSA 1Q04A 1FV2A 4XFTA 1V6WA 1AVUA 4G9MA 4XFUA 4LO7B 3PHZA 2X2SA 1K5VA 1VCLA 2GO2A 3WO3A 2BFHA 4LO1A 2HWMA 5DVHA 5I1BA 4J2KA 1G9BA 3UD7A 1OQLB 1S0GA 3N7KA 3FJDA 3HALA 3CAHA 1FQ9A 5HPZA 4XFSA 2IWTB 3FJFA 4KC3A 4JRAA 1PC8B 3Q7YA 4OEGA 3WINC 3WA1A 1Z0HA 2Z49A 3BTAA 4QBCA 1FGAA 3BA7A 3OJ2A 8I1BA 2K4AB 2RQ9A 2NYYA 4ZKTB 3OGGA 3FJIA 5DZUA 3CA3A 5BQUC 1AXMA 4TLPA 4WBCA 1NZKA 3I2XA 3B9UA 3I29B 1HWNB 3V0AA 4HR6C 4GAFA 1DJSB 5EHAA 5BP5A 4FGFA 3HMYA 3O4CA 2Z48A 2D44A 1D0HA 5BVPI 1TOOA 5JMCA 3OJVA 3NBCA 1EV2A 5EC5A 1BFBA 3E8LC 4J2YA 3FJCA 1AFCA 4G6MA 4LO0C 4EB2B 5BXPA 4LO3C 3RMXA 4F34A 1HIBA 1SR4A 4QKSA 2J3PA 3FUQA 3WO4A 3FFZA 1DIWA 4I4OA 3OBRA 4KBBA 3V0BA 1KNMA 4II0A 3Q7WA 1M2TB 2VSAA 3PMEA 2VUAA 7I1BA 1F31A 1QQKA 2AXMA 4J2XA 1XZZA 2F2FA 4EFQA 4OW4A 4LO2C 5D63A 2D20A 1XYFA 3N0KA 3RMYA 2LIEA 3CRHA 3IM6A 2KH2A 2QN4A 2R9KB 4I4UA 1YXWA 3FJ9A 3AJ5A 1W3FA 41BIA 2AQZA 2D43A 4I1EA 4ENDA 2ESUA 4AN7B 3OGFA 3BRGC 1DZDA 4OWJA 4IHZA 1V6VA 3UD8A 3AKFA 2ZR1B 3CA6A 2KKIA 5FZUA 1SZ6B 4AN6A 1ILR1 1BFGA 3ZXDA 3QR5A 1DFCA 1EPWA 3S8KA 2F8XC 4OWKA 3WMVA 1W3GA 3VWCA 3BX1C 1FWVA 4P0JA 3NBEA 3Q7XA 1XG6A 1ISWA 1JLXA 3KMVA 3I2AA 1IILA 2RSTA 4JP0A 3F62B 4G1RA 3FUOA 3P6IA 5BXTA 1PZZA 2Y9GA 4KEIA 1JT7A 5DSSB 4JAWA 3FGMA 3ILAA 3R4SA 1G9CA 1WD3A 3IIRA 2FO1A 1JT4A 3CA1A 3AH2A 4GAIA 5F8YA 4EKXB 4P0LA 2NVHA 1T9FA 1I1EA 1ABRB 1TP0A 4IZEA 4OEEA 4JKXB 2VU9A 3VT2A 2DRYA 5F8SA 5BOWA 5E24E 3UJ4A 4J2SA 4I2SA 3FJKA 1BFCA 1FV3A 4Q9GA 4GP0A 1BFFA 1MC9A 3WINA 2NP0A 1JQZA 1M16A 4I4PA 3UDAA 1IHKA 2FDBM 1TWEA 4EFRA 4LO8B 4X3AA 3P6JA 2L5XA 4LO1C 5BQUA 3H6RB 2D22A 3CQAA 2MC2A 3V0AB 4I4VA 3IAGC 1EYLA 4IY8A 1JTCA 1BLDA 2Y9FA 3UJ0A 3A22A 4DENA 4Z9WB 9ILBA 1S0DA 1ONKB 2FGFA 2KI6B 1YBIA 2WRYA 1CVSA 3W9TA 3O4OA 3AJ6A 4QKRA 3LTQA 3OBTA 3T8SA 1PUUB 1V6XA 1RZOB 3MALA 4I4XA 4LO0A 3IM7A 4X37A 2KLLA 2VSEA 4LO3A 5F8WA 4HA2A 4GOVA 3VT1A 1FMZA 4ZFYB 4ZA3B 2Q3NB 4ZLBB 1BLAA 2AFGA 1R8OA 2X2TA 3CA5A 5BXSA 1EVTA 4D8HA 4JPZA 1PUMB 4LO2A 5FNXA 1AVXB 2D7IA 1QXMA 4G6JA 1JT5A 1TWMA 4QBVA 1T4QA 2VLCA 3VSFA 1UPSA 1YTOA 1GGPB 3H6QA 3NBDA 3A21A 1FN0A 1HCEA 2BEBA 4KEJA 3WO2A 3AKHA 3ZC8A 1BA7A 1FMMS 4ZOTA 1SR4C 3AKGA 4A7YA 4P6AA 4Z8SB 3AZVA 3F1RA 1HCDA 1G9DA 4I96A 1P63A 3CRGA 3H6SE 2MLLB 3NBNA 1NUNA 3O4AA 2F2FC 1E0OA 4I8MA 4ZFWB 1YF8B 6I1BA 3WMUA 3O49A 3N7MA 1RG8A 1ISVA 4I6IA 5BXRA 1JY0A 3HSMA 1CE7B 1ITBA 3AZWA 1S0LA 3A23A 2DRZA 1QQLA 1IRAX 1DQGA 1ISXA 1HWMB 1BARA 2NZ9A 3FJAA 3SNVA 4JQ0A 3C9ZA 1TTUA 2E4MC 2ERMA 3IM5A 3BB2A 3HN1A 1WBAA 3N7LA 3P53A 1IJTA 2WBCA 5D62A 3ZX7A 2ET2A 3S8JA 3BAOA 3O5WB 1IT0A 5B2HA 4DCKC 1Z4SA 3V79C 2QYIB 3VUOA 1JT3A 4JKQA 4H04A 3ZXGA 21BIA 3O44A 3BRDA 3HBWA 4QC4A 3VT0A 4CJMA 4A7KA 1G82A 4QD2B 1IOBA 1AVAC 5D61A 2XOAA 3O4BA 1PWAA 4J23B 1Q1UA 2GZBA 2P39A 2RG9B 4YOLA 3BRFA 4ISQA 3RTJB 2VXRA 1S0CA 2NM1A 3FJHA 4EFPA 2FFVA 3CA4A 3FJ8A 4Q9PA 4GOYA 1II4A 4ZBVB 3HOMA 1WD4A 4IZXA 4OEFA 4USPA 2FFUA 3R4UA 5FZYA 3BAQA 3O4DA 5DUYA 2DREA 3O3QA 4HJJA 1A8DA 1DFQA 1RY7A 2Y9XE 5EG6C 1DZCA 4EEEB 3AH1A 4IQPA 3V0BB 1AVWB 2ZQNA 3BAVA 3CRIA 5JLVA 1W3AA 2D24A 1J0SA 3VSZA 1DQOA 4LO7C 4QD2C 1JLYA 2D23A 3POKA 1G9AA 4L4HA 3H6RA 3FJBA
chains in the Genus database with same CATH superfamily
3JRRA 4I7IA 3NJ5A 3BAUA 3VEQA 3CA0A 4H75A 3RTIB 3K1XA 3N7JA 1Z2VA 1AF9A 1S0BA 2HWAA 4H9WA 5BP5C 2Y9WC 3BAHA 2IHOA 2HW9A 4I4SA 3RSJA 1N4KA 2YUGA 3TC2A 1XHBA 4FVVA 4KEKA 1MD6A 5G00A 4I37A 4MZFB 3JUTA 3EF2A 5FZZA 4ZGRB 1DLLA 4D0ZA 4XKIA 2P23A 5GAQA 4Q91A 4ZFUB 1I1BA 4X38A 2HZ9A 3QYDA 4I4RA 1K5UA 4P0KA 3AH4A 3A07A 4F83A 3BA4A 4QO3A 4I4YA 4QALA 2AAIB 2LIQA 3MPPG 3OJMA 4GP3A 1R8NA 2KI4A 1IRPA 1S0EA 4USOA 4IONA 1V6UA 31BIA 3ZC9A 4X39A 2I1BA 4I3NA 1S0FA 3PG0A 1ISYA 4R6UB 4D0TA 4G9NA 3D7WB 3FJJA 1HWOB 5FNWA 3LLPA 1WBCA 2ZQOA 1TIEA 3AKIA 1L2HA 4I4QA 3PUBA 1RMLA 4IYBA 2K43A 4A7ZA 2NTDA 4I1BA 4ISRA 2VXTI 4OWLA 1YYNA 2Q9XA 2D7RA 3BADA 2E4MA 1HWPB 1Q03A 3BAGA 1HKNA 4L4IA 4OUJA 1BASA 1TFMB 3CU1B 4PC4A 4DEPA 2DS0A 3BA5A 2D1ZA 4IY9A 1FWUA 2M49A 4I0YA 2MIBA 2BEAA 3FJEA 5F90A 1ISZA 2K8RA 3UD9A 2UUSA 1Q04A 1FV2A 4XFTA 1V6WA 1AVUA 4G9MA 4XFUA 4LO7B 3PHZA 2X2SA 1K5VA 1VCLA 2GO2A 3WO3A 2BFHA 4LO1A 2HWMA 5DVHA 5I1BA 4J2KA 1G9BA 3UD7A 1OQLB 1S0GA 3N7KA 3FJDA 3HALA 3CAHA 1FQ9A 5HPZA 4XFSA 2IWTB 3FJFA 4KC3A 4JRAA 1PC8B 3Q7YA 4OEGA 3WINC 3WA1A 1Z0HA 2Z49A 3BTAA 4QBCA 1FGAA 3BA7A 3OJ2A 8I1BA 2K4AB 2RQ9A 2NYYA 4ZKTB 3OGGA 3FJIA 5DZUA 3CA3A 5BQUC 1AXMA 4TLPA 4WBCA 1NZKA 3I2XA 3B9UA 3I29B 1HWNB 3V0AA 4HR6C 4GAFA 1DJSB 5EHAA 5BP5A 4FGFA 3HMYA 3O4CA 2Z48A 2D44A 1D0HA 5BVPI 1TOOA 5JMCA 3OJVA 3NBCA 1EV2A 5EC5A 1BFBA 3E8LC 4J2YA 3FJCA 1AFCA 4G6MA 2NS2A 4LO0C 4EB2B 5BXPA 4LO3C 3RMXA 4F34A 1HIBA 1SR4A 4QKSA 2J3PA 3FUQA 3WO4A 3FFZA 1DIWA 4I4OA 3OBRA 4KBBA 3V0BA 1KNMA 4II0A 3Q7WA 1M2TB 2VSAA 3PMEA 2VUAA 7I1BA 4UY4A 1F31A 1QQKA 2AXMA 4J2XA 1XZZA 2F2FA 4EFQA 4OW4A 4LO2C 5D63A 2D20A 1XYFA 3N0KA 3RMYA 2LIEA 3CRHA 3IM6A 2KH2A 2QN4A 2R9KB 4I4UA 1YXWA 3FJ9A 3AJ5A 1W3FA 41BIA 2AQZA 2D43A 4I1EA 4ENDA 2ESUA 4AN7B 3OGFA 3BRGC 1DZDA 4OWJA 4IHZA 1V6VA 3UD8A 3AKFA 2ZR1B 3CA6A 2KKIA 5FZUA 1SZ6B 4AN6A 1ILR1 1BFGA 3ZXDA 3QR5A 1DFCA 1EPWA 3S8KA 2F8XC 4OWKA 3WMVA 1W3GA 3VWCA 3BX1C 1FWVA 4P0JA 3NBEA 3Q7XA 1XG6A 1ISWA 1JLXA 3KMVA 3I2AA 1IILA 2RSTA 4JP0A 3F62B 4G1RA 3FUOA 3P6IA 5BXTA 1PZZA 2Y9GA 4KEIA 1JT7A 5DSSB 4JAWA 3FGMA 3ILAA 3R4SA 1G9CA 1WD3A 3IIRA 2FO1A 1JT4A 3CA1A 3AH2A 4GAIA 5F8YA 4EKXB 4P0LA 2NVHA 1T9FA 1I1EA 1ABRB 1TP0A 4IZEA 4OEEA 4JKXB 2VU9A 3VT2A 2DRYA 5F8SA 5BOWA 5E24E 3UJ4A 4J2SA 4I2SA 3FJKA 1BFCA 1FV3A 4Q9GA 4GP0A 1BFFA 1MC9A 3WINA 2NP0A 1JQZA 1M16A 4I4PA 3UDAA 1IHKA 2FDBM 1TWEA 4EFRA 4LO8B 4X3AA 3P6JA 2L5XA 4LO1C 5BQUA 3H6RB 2D22A 3CQAA 2MC2A 3V0AB 4I4VA 3IAGC 1EYLA 4IY8A 1JTCA 1BLDA 2Y9FA 3UJ0A 3A22A 4DENA 4Z9WB 9ILBA 1S0DA 1ONKB 2FGFA 2KI6B 1YBIA 2WRYA 1CVSA 3W9TA 3O4OA 3AJ6A 4QKRA 3LTQA 3OBTA 3T8SA 1PUUB 1V6XA 1RZOB 3MALA 4I4XA 4LO0A 3IM7A 4X37A 2KLLA 2VSEA 4LO3A 5F8WA 4HA2A 4GOVA 3VT1A 1FMZA 4ZFYB 4ZA3B 2Q3NB 4ZLBB 1BLAA 2AFGA 1R8OA 2X2TA 3CA5A 5BXSA 1EVTA 4D8HA 4JPZA 1PUMB 4LO2A 5FNXA 1AVXB 2D7IA 1QXMA 4G6JA 1JT5A 1TWMA 4QBVA 1T4QA 2VLCA 3VSFA 1UPSA 1YTOA 1GGPB 3H6QA 3NBDA 3A21A 1FN0A 1HCEA 2BEBA 4KEJA 3WO2A 3AKHA 3ZC8A 1BA7A 1FMMS 4ZOTA 1SR4C 3AKGA 4A7YA 4P6AA 4Z8SB 3AZVA 3F1RA 1HCDA 1G9DA 4I96A 1P63A 3CRGA 3H6SE 2MLLB 3NBNA 4MZGB 1NUNA 3O4AA 2F2FC 1E0OA 4I8MA 4ZFWB 1YF8B 6I1BA 3WMUA 3O49A 3N7MA 1RG8A 1ISVA 4I6IA 5BXRA 1JY0A 3HSMA 1CE7B 1ITBA 3AZWA 1S0LA 3A23A 2DRZA 1QQLA 1IRAX 1DQGA 1ISXA 1HWMB 1BARA 2NZ9A 3FJAA 3SNVA 4JQ0A 3C9ZA 1TTUA 2E4MC 2ERMA 3IM5A 3BB2A 3HN1A 1WBAA 3N7LA 3P53A 1IJTA 2WBCA 5D62A 3ZX7A 2ET2A 3S8JA 3BAOA 3O5WB 1IT0A 5B2HA 4DCKC 1Z4SA 3V79C 2QYIB 3VUOA 1JT3A 4JKQA 4H04A 3ZXGA 21BIA 3O44A 3BRDA 3HBWA 4QC4A 3VT0A 4CJMA 4A7KA 1G82A 4QD2B 1IOBA 1AVAC 5D61A 2XOAA 3O4BA 4MZHA 1PWAA 4J23B 1Q1UA 2GZBA 2P39A 2RG9B 4YOLA 3BRFA 4ISQA 3RTJB 2VXRA 1S0CA 2NM1A 3FJHA 4EFPA 2FFVA 3CA4A 3FJ8A 4Q9PA 4GOYA 1II4A 4ZBVB 3HOMA 1WD4A 4IZXA 4OEFA 4USPA 2FFUA 3R4UA 5FZYA 3BAQA 3O4DA 5DUYA 2DREA 3O3QA 4HJJA 1A8DA 1DFQA 1RY7A 2Y9XE 5EG6C 1DZCA 4EEEB 3AH1A 4IQPA 3V0BB 1AVWB 2ZQNA 3BAVA 3CRIA 5JLVA 1W3AA 2D24A 1J0SA 3VSZA 1DQOA 4LO7C 4QD2C 1JLYA 2D23A 3POKA 1G9AA 4L4HA 3H6RA 3FJBA
chains in the Genus database with same CATH topology
3JRRA 4I7IA 3NJ5A 3BAUA 3VEQA 3CA0A 4H75A 3RTIB 3K1XA 3N7JA 1Z2VA 1AF9A 1S0BA 2HWAA 4H9WA 5BP5C 2Y9WC 3BAHA 2IHOA 2HW9A 4I4SA 3RSJA 1N4KA 2YUGA 3TC2A 1XHBA 4FVVA 4KEKA 1MD6A 5G00A 4I37A 4MZFB 3JUTA 3EF2A 5FZZA 4ZGRB 1DLLA 4D0ZA 4XKIA 2P23A 5GAQA 4Q91A 4ZFUB 1I1BA 4X38A 2HZ9A 3QYDA 4I4RA 1K5UA 4P0KA 3AH4A 3A07A 4F83A 3BA4A 4QO3A 4I4YA 4QALA 2AAIB 2LIQA 3MPPG 3OJMA 4GP3A 1R8NA 2KI4A 1IRPA 1S0EA 4USOA 4IONA 1V6UA 31BIA 3ZC9A 4X39A 2I1BA 4I3NA 1S0FA 3PG0A 1ISYA 4R6UB 4D0TA 4G9NA 3D7WB 3FJJA 1HWOB 5FNWA 3LLPA 1WBCA 2ZQOA 1TIEA 3AKIA 1L2HA 4I4QA 3PUBA 1RMLA 4IYBA 2K43A 4A7ZA 2NTDA 4I1BA 4ISRA 2VXTI 4OWLA 1YYNA 2Q9XA 2D7RA 3BADA 2E4MA 1HWPB 1Q03A 3BAGA 1HKNA 4L4IA 4OUJA 1BASA 1TFMB 3CU1B 4PC4A 4DEPA 2DS0A 3BA5A 2D1ZA 4IY9A 1FWUA 2M49A 4I0YA 2MIBA 2BEAA 3FJEA 5F90A 1ISZA 2K8RA 3UD9A 2UUSA 1Q04A 1FV2A 4XFTA 1V6WA 1AVUA 4G9MA 4XFUA 4LO7B 3PHZA 2X2SA 1K5VA 1VCLA 2GO2A 3WO3A 2BFHA 4LO1A 2HWMA 5DVHA 5I1BA 4J2KA 1G9BA 3UD7A 1OQLB 1S0GA 3N7KA 3FJDA 3HALA 3CAHA 1FQ9A 5HPZA 4XFSA 2IWTB 3FJFA 4KC3A 4JRAA 1PC8B 3Q7YA 4OEGA 3WINC 3WA1A 1Z0HA 2Z49A 3BTAA 4QBCA 1FGAA 3BA7A 3OJ2A 8I1BA 2K4AB 2RQ9A 2NYYA 4ZKTB 3OGGA 3FJIA 5DZUA 3CA3A 5BQUC 1AXMA 4TLPA 4WBCA 1NZKA 3I2XA 3B9UA 3I29B 1HWNB 3V0AA 4HR6C 4GAFA 1DJSB 5EHAA 5BP5A 4FGFA 3HMYA 3O4CA 2Z48A 2D44A 1D0HA 5BVPI 1TOOA 5JMCA 3OJVA 3NBCA 1EV2A 5EC5A 1BFBA 3E8LC 4J2YA 3FJCA 1AFCA 4G6MA 2NS2A 4LO0C 4EB2B 5BXPA 4LO3C 3RMXA 4F34A 1HIBA 1SR4A 4QKSA 2J3PA 3FUQA 3WO4A 3FFZA 1DIWA 4I4OA 3OBRA 4KBBA 3V0BA 1KNMA 4II0A 3Q7WA 1M2TB 2VSAA 3PMEA 2VUAA 7I1BA 4UY4A 1F31A 1QQKA 2AXMA 4J2XA 1XZZA 2F2FA 4EFQA 4OW4A 4LO2C 5D63A 2D20A 1XYFA 3N0KA 3RMYA 2LIEA 3CRHA 3IM6A 2KH2A 2QN4A 2R9KB 4I4UA 1YXWA 3FJ9A 3AJ5A 1W3FA 41BIA 2AQZA 2D43A 4I1EA 4ENDA 2ESUA 4AN7B 3OGFA 3BRGC 1DZDA 4OWJA 4IHZA 1V6VA 3UD8A 3AKFA 2ZR1B 3CA6A 2KKIA 5FZUA 1SZ6B 4AN6A 1ILR1 1BFGA 3ZXDA 3QR5A 1DFCA 1EPWA 3S8KA 2F8XC 4OWKA 3WMVA 1W3GA 3VWCA 3BX1C 1FWVA 4P0JA 3NBEA 3Q7XA 1XG6A 1ISWA 1JLXA 3KMVA 3I2AA 1IILA 2RSTA 4JP0A 3F62B 4G1RA 3FUOA 3P6IA 5BXTA 1PZZA 2Y9GA 4KEIA 1JT7A 5DSSB 4JAWA 3FGMA 3ILAA 3R4SA 1G9CA 1WD3A 3IIRA 2FO1A 1JT4A 3CA1A 3AH2A 4GAIA 5F8YA 4EKXB 4P0LA 2NVHA 1T9FA 1I1EA 1ABRB 1TP0A 4IZEA 4OEEA 4JKXB 2VU9A 3VT2A 2DRYA 5F8SA 5BOWA 5E24E 3UJ4A 4J2SA 4I2SA 3FJKA 1BFCA 1FV3A 4Q9GA 4GP0A 1BFFA 1MC9A 3WINA 2NP0A 1JQZA 1M16A 4I4PA 3UDAA 1IHKA 2FDBM 1TWEA 4EFRA 4LO8B 4X3AA 3P6JA 2L5XA 4LO1C 5BQUA 3H6RB 2D22A 3CQAA 2MC2A 3V0AB 4I4VA 3IAGC 1EYLA 4IY8A 1JTCA 1BLDA 2Y9FA 3UJ0A 3A22A 4DENA 4Z9WB 9ILBA 1S0DA 1ONKB 2FGFA 2KI6B 1YBIA 2WRYA 1CVSA 3W9TA 3O4OA 3AJ6A 4QKRA 3LTQA 3OBTA 3T8SA 1PUUB 1V6XA 1RZOB 3MALA 4I4XA 4LO0A 3IM7A 4X37A 2KLLA 2VSEA 4LO3A 5F8WA 4HA2A 4GOVA 3VT1A 1FMZA 4ZFYB 4ZA3B 2Q3NB 4ZLBB 1BLAA 2AFGA 1R8OA 2X2TA 3CA5A 5BXSA 1EVTA 4D8HA 4JPZA 1PUMB 4LO2A 5FNXA 1AVXB 2D7IA 1QXMA 4G6JA 1JT5A 1TWMA 4QBVA 1T4QA 2VLCA 3VSFA 1UPSA 1YTOA 1GGPB 3H6QA 3NBDA 3A21A 1FN0A 1HCEA 2BEBA 4KEJA 3WO2A 3AKHA 3ZC8A 1BA7A 1FMMS 4ZOTA 1SR4C 3AKGA 4A7YA 4P6AA 4Z8SB 3AZVA 3F1RA 1HCDA 1G9DA 4I96A 1P63A 3CRGA 3H6SE 2MLLB 3NBNA 4MZGB 1NUNA 3O4AA 2F2FC 1E0OA 4I8MA 4ZFWB 1YF8B 6I1BA 3WMUA 3O49A 3N7MA 1RG8A 1ISVA 4I6IA 5BXRA 1JY0A 3HSMA 1CE7B 1ITBA 3AZWA 1S0LA 3A23A 2DRZA 1QQLA 1IRAX 1DQGA 1ISXA 1HWMB 1BARA 2NZ9A 3FJAA 3SNVA 4JQ0A 3C9ZA 1TTUA 2E4MC 2ERMA 3IM5A 3BB2A 3HN1A 1WBAA 3N7LA 3P53A 1IJTA 2WBCA 5D62A 3ZX7A 2ET2A 3S8JA 3BAOA 3O5WB 1IT0A 5B2HA 4DCKC 1Z4SA 3V79C 2QYIB 3VUOA 1JT3A 4JKQA 4H04A 3ZXGA 21BIA 3O44A 3BRDA 3HBWA 4QC4A 3VT0A 4CJMA 4A7KA 1G82A 4QD2B 1IOBA 1AVAC 5D61A 2XOAA 3O4BA 4MZHA 1PWAA 4J23B 1Q1UA 2GZBA 2P39A 2RG9B 4YOLA 3BRFA 4ISQA 3RTJB 2VXRA 1S0CA 2NM1A 3FJHA 4EFPA 2FFVA 3CA4A 3FJ8A 4Q9PA 4GOYA 1II4A 4ZBVB 3HOMA 1WD4A 4IZXA 4OEFA 4USPA 2FFUA 3R4UA 5FZYA 3BAQA 3O4DA 5DUYA 2DREA 3O3QA 4HJJA 1A8DA 1DFQA 1RY7A 2Y9XE 5EG6C 1DZCA 4EEEB 3AH1A 4IQPA 3V0BB 1AVWB 2ZQNA 3BAVA 3CRIA 5JLVA 1W3AA 2D24A 1J0SA 3VSZA 1DQOA 4LO7C 4QD2C 1JLYA 2D23A 3POKA 1G9AA 4L4HA 3H6RA 3FJBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3JRR A;  4I7I A;  3NJ5 A;  3BAU A;  3VEQ A;  3CA0 A;  3RTI B;  3K1X A;  3N7J A;  1Z2V A;  1AF9 A;  1S0B A;  2HWA A;  4H9W A;  5BP5 C;  2Y9W C;  3BAH A;  2IHO A;  2HW9 A;  4I4S A;  3RSJ A;  1N4K A;  2YUG A;  3TC2 A;  1XHB A;  4FVV A;  4KEK A;  1MD6 A;  5G00 A;  4I37 A;  3JUT A;  3EF2 A;  5FZZ A;  4ZGR B;  1DLL A;  4D0Z A;  4XKI A;  2P23 A;  5GAQ A;  4Q91 A;  4ZFU B;  1I1B A;  4X38 A;  2HZ9 A;  3QYD A;  4I4R A;  1K5U A;  4P0K A;  3AH4 A;  3A07 A;  4F83 A;  3BA4 A;  4QO3 A;  4I4Y A;  4QAL A;  2AAI B;  2LIQ A;  3MPP G;  3OJM A;  4GP3 A;  1R8N A;  2KI4 A;  1IRP A;  1S0E A;  4USO A;  4ION A;  1V6U A;  31BI A;  3ZC9 A;  4X39 A;  2I1B A;  4I3N A;  1S0F A;  3PG0 A;  1ISY A;  4R6U B;  4D0T A;  4G9N A;  3D7W B;  3FJJ A;  1HWO B;  5FNW A;  3LLP A;  1WBC A;  2ZQO A;  1TIE A;  3AKI A;  1L2H A;  4I4Q A;  3PUB A;  1RML A;  4IYB A;  2K43 A;  4A7Z A;  2NTD A;  4I1B A;  4ISR A;  2VXT I;  4OWL A;  1YYN A;  2Q9X A;  2D7R A;  3BAD A;  2E4M A;  1HWP B;  1Q03 A;  3BAG A;  1HKN A;  4L4I A;  4OUJ A;  1BAS A;  1TFM B;  3CU1 B;  4PC4 A;  4DEP A;  2DS0 A;  3BA5 A;  2D1Z A;  4IY9 A;  1FWU A;  2M49 A;  4I0Y A;  2MIB A;  2BEA A;  3FJE A;  5F90 A;  1ISZ A;  2K8R A;  3UD9 A;  2UUS A;  1Q04 A;  1FV2 A;  4XFT A;  1V6W A;  1AVU A;  4G9M A;  4XFU A;  4LO7 B;  3PHZ A;  2X2S A;  1K5V A;  1VCL A;  2GO2 A;  3WO3 A;  2BFH A;  4LO1 A;  2HWM A;  5DVH A;  5I1B A;  4J2K A;  1G9B A;  3UD7 A;  1OQL B;  1S0G A;  3N7K A;  3FJD A;  3HAL A;  3CAH A;  1FQ9 A;  5HPZ A;  4XFS A;  2IWT B;  3FJF A;  4KC3 A;  4JRA A;  1PC8 B;  3Q7Y A;  4OEG A;  3WIN C;  3WA1 A;  1Z0H A;  2Z49 A;  3BTA A;  4QBC A;  1FGA A;  3BA7 A;  3OJ2 A;  8I1B A;  2K4A B;  2RQ9 A;  2NYY A;  4ZKT B;  3OGG A;  3FJI A;  5DZU A;  3CA3 A;  5BQU C;  1AXM A;  4TLP A;  4WBC A;  1NZK A;  3I2X A;  3B9U A;  3I29 B;  1HWN B;  3V0A A;  4HR6 C;  4GAF A;  1DJS B;  5EHA A;  5BP5 A;  4FGF A;  3HMY A;  3O4C A;  2Z48 A;  2D44 A;  1D0H A;  5BVP I;  1TOO A;  5JMC A;  3OJV A;  3NBC A;  1EV2 A;  5EC5 A;  1BFB A;  3E8L C;  4J2Y A;  3FJC A;  1AFC A;  4G6M A;  4LO0 C;  4EB2 B;  5BXP A;  4LO3 C;  3RMX A;  4F34 A;  1HIB A;  1SR4 A;  4QKS A;  2J3P A;  3FUQ A;  3WO4 A;  3FFZ A;  1DIW A;  4I4O A;  3OBR A;  4KBB A;  3V0B A;  1KNM A;  4II0 A;  3Q7W A;  1M2T B;  2VSA A;  3PME A;  2VUA A;  7I1B A;  1F31 A;  1QQK A;  2AXM A;  4J2X A;  1XZZ A;  2F2F A;  4EFQ A;  4OW4 A;  4LO2 C;  5D63 A;  2D20 A;  1XYF A;  3N0K A;  3RMY A;  2LIE A;  3CRH A;  3IM6 A;  2KH2 A;  2QN4 A;  2R9K B;  4I4U A;  1YXW A;  3FJ9 A;  3AJ5 A;  1W3F A;  41BI A;  2AQZ A;  2D43 A;  4I1E A;  4END A;  2ESU A;  4AN7 B;  3OGF A;  3BRG C;  1DZD A;  4OWJ A;  4IHZ A;  1V6V A;  3UD8 A;  3AKF A;  2ZR1 B;  3CA6 A;  2KKI A;  5FZU A;  1SZ6 B;  4AN6 A;  1ILR 1;  1BFG A;  3ZXD A;  3QR5 A;  1DFC A;  1EPW A;  3S8K A;  2F8X C;  4OWK A;  3WMV A;  1W3G A;  3VWC A;  3BX1 C;  1FWV A;  4P0J A;  3NBE A;  3Q7X A;  1XG6 A;  1ISW A;  1JLX A;  3KMV A;  3I2A A;  1IIL A;  2RST A;  4JP0 A;  3F62 B;  4G1R A;  3FUO A;  3P6I A;  5BXT A;  1PZZ A;  2Y9G A;  4KEI A;  1JT7 A;  5DSS B;  4JAW A;  3FGM A;  3ILA A;  3R4S A;  1G9C A;  1WD3 A;  3IIR A;  2FO1 A;  1JT4 A;  3CA1 A;  3AH2 A;  4GAI A;  5F8Y A;  4EKX B;  4P0L A;  2NVH A;  1T9F A;  1I1E A;  1ABR B;  1TP0 A;  4IZE A;  4OEE A;  4JKX B;  2VU9 A;  3VT2 A;  2DRY A;  5F8S A;  5BOW A;  5E24 E;  3UJ4 A;  4J2S A;  4I2S A;  3FJK A;  1BFC A;  1FV3 A;  4Q9G A;  4GP0 A;  1BFF A;  1MC9 A;  3WIN A;  2NP0 A;  1JQZ A;  1M16 A;  4I4P A;  3UDA A;  1IHK A;  2FDB M;  1TWE A;  4EFR A;  4LO8 B;  4X3A A;  3P6J A;  2L5X A;  4LO1 C;  5BQU A;  3H6R B;  2D22 A;  3CQA A;  2MC2 A;  3V0A B;  4I4V A;  3IAG C;  1EYL A;  4IY8 A;  1JTC A;  1BLD A;  2Y9F A;  3UJ0 A;  3A22 A;  4DEN A;  4Z9W B;  9ILB A;  1S0D A;  1ONK B;  2FGF A;  2KI6 B;  1YBI A;  2WRY A;  1CVS A;  3W9T A;  3O4O A;  3AJ6 A;  4QKR A;  3LTQ A;  3OBT A;  3T8S A;  1PUU B;  1V6X A;  1RZO B;  3MAL A;  4I4X A;  4LO0 A;  3IM7 A;  4X37 A;  2KLL A;  2VSE A;  4LO3 A;  5F8W A;  4HA2 A;  4GOV A;  3VT1 A;  1FMZ A;  4ZFY B;  4ZA3 B;  2Q3N B;  4ZLB B;  1BLA A;  2AFG A;  1R8O A;  2X2T A;  3CA5 A;  5BXS A;  1EVT A;  4D8H A;  4JPZ A;  1PUM B;  4LO2 A;  5FNX A;  1AVX B;  2D7I A;  1QXM A;  4G6J A;  1JT5 A;  1TWM A;  4QBV A;  1T4Q A;  2VLC A;  3VSF A;  1UPS A;  1YTO A;  1GGP B;  3H6Q A;  3NBD A;  3A21 A;  1FN0 A;  1HCE A;  2BEB A;  4KEJ A;  3WO2 A;  3AKH A;  3ZC8 A;  1BA7 A;  1FMM S;  4ZOT A;  1SR4 C;  3AKG A;  4A7Y A;  4P6A A;  4Z8S B;  3AZV A;  3F1R A;  1HCD A;  1G9D A;  4I96 A;  1P63 A;  3CRG A;  3H6S E;  2MLL B;  3NBN A;  1NUN A;  3O4A A;  2F2F C;  1E0O A;  4I8M A;  4ZFW B;  1YF8 B;  6I1B A;  3WMU A;  3O49 A;  3N7M A;  1RG8 A;  1ISV A;  4I6I A;  5BXR A;  1JY0 A;  3HSM A;  1CE7 B;  1ITB A;  3AZW A;  1S0L A;  3A23 A;  2DRZ A;  1QQL A;  1IRA X;  1DQG A;  1ISX A;  1HWM B;  1BAR A;  2NZ9 A;  3FJA A;  3SNV A;  4JQ0 A;  3C9Z A;  1TTU A;  2E4M C;  2ERM A;  3IM5 A;  3BB2 A;  3HN1 A;  1WBA A;  3N7L A;  3P53 A;  1IJT A;  2WBC A;  5D62 A;  3ZX7 A;  2ET2 A;  3S8J A;  3BAO A;  3O5W B;  1IT0 A;  5B2H A;  4DCK C;  1Z4S A;  3V79 C;  2QYI B;  3VUO A;  1JT3 A;  4JKQ A;  4H04 A;  3ZXG A;  21BI A;  3O44 A;  3BRD A;  3HBW A;  4QC4 A;  3VT0 A;  4CJM A;  4A7K A;  1G82 A;  4QD2 B;  1IOB A;  1AVA C;  5D61 A;  2XOA A;  3O4B A;  1PWA A;  4J23 B;  1Q1U A;  2GZB A;  2P39 A;  2RG9 B;  4YOL A;  3BRF A;  4ISQ A;  3RTJ B;  2VXR A;  1S0C A;  2NM1 A;  3FJH A;  4EFP A;  2FFV A;  3CA4 A;  3FJ8 A;  4Q9P A;  4GOY A;  1II4 A;  4ZBV B;  3HOM A;  1WD4 A;  4IZX A;  4OEF A;  4USP A;  2FFU A;  3R4U A;  5FZY A;  3BAQ A;  3O4D A;  5DUY A;  2DRE A;  3O3Q A;  4HJJ A;  1A8D A;  1DFQ A;  1RY7 A;  2Y9X E;  5EG6 C;  1DZC A;  4EEE B;  3AH1 A;  4IQP A;  3V0B B;  1AVW B;  2ZQN A;  3BAV A;  3CRI A;  5JLV A;  1W3A A;  2D24 A;  1J0S A;  3VSZ A;  1DQO A;  4LO7 C;  4QD2 C;  1JLY A;  2D23 A;  3POK A;  1G9A A;  4L4H A;  3H6R A;  3FJB A; 
#chains in the Genus database with same CATH topology
 3JRR A;  4I7I A;  3NJ5 A;  3BAU A;  3VEQ A;  3CA0 A;  4H75 A;  3RTI B;  3K1X A;  3N7J A;  1Z2V A;  1AF9 A;  1S0B A;  2HWA A;  4H9W A;  5BP5 C;  2Y9W C;  3BAH A;  2IHO A;  2HW9 A;  4I4S A;  3RSJ A;  1N4K A;  2YUG A;  3TC2 A;  1XHB A;  4FVV A;  4KEK A;  1MD6 A;  5G00 A;  4I37 A;  4MZF B;  3JUT A;  3EF2 A;  5FZZ A;  4ZGR B;  1DLL A;  4D0Z A;  4XKI A;  2P23 A;  5GAQ A;  4Q91 A;  4ZFU B;  1I1B A;  4X38 A;  2HZ9 A;  3QYD A;  4I4R A;  1K5U A;  4P0K A;  3AH4 A;  3A07 A;  4F83 A;  3BA4 A;  4QO3 A;  4I4Y A;  4QAL A;  2AAI B;  2LIQ A;  3MPP G;  3OJM A;  4GP3 A;  1R8N A;  2KI4 A;  1IRP A;  1S0E A;  4USO A;  4ION A;  1V6U A;  31BI A;  3ZC9 A;  4X39 A;  2I1B A;  4I3N A;  1S0F A;  3PG0 A;  1ISY A;  4R6U B;  4D0T A;  4G9N A;  3D7W B;  3FJJ A;  1HWO B;  5FNW A;  3LLP A;  1WBC A;  2ZQO A;  1TIE A;  3AKI A;  1L2H A;  4I4Q A;  3PUB A;  1RML A;  4IYB A;  2K43 A;  4A7Z A;  2NTD A;  4I1B A;  4ISR A;  2VXT I;  4OWL A;  1YYN A;  2Q9X A;  2D7R A;  3BAD A;  2E4M A;  1HWP B;  1Q03 A;  3BAG A;  1HKN A;  4L4I A;  4OUJ A;  1BAS A;  1TFM B;  3CU1 B;  4PC4 A;  4DEP A;  2DS0 A;  3BA5 A;  2D1Z A;  4IY9 A;  1FWU A;  2M49 A;  4I0Y A;  2MIB A;  2BEA A;  3FJE A;  5F90 A;  1ISZ A;  2K8R A;  3UD9 A;  2UUS A;  1Q04 A;  1FV2 A;  4XFT A;  1V6W A;  1AVU A;  4G9M A;  4XFU A;  4LO7 B;  3PHZ A;  2X2S A;  1K5V A;  1VCL A;  2GO2 A;  3WO3 A;  2BFH A;  4LO1 A;  2HWM A;  5DVH A;  5I1B A;  4J2K A;  1G9B A;  3UD7 A;  1OQL B;  1S0G A;  3N7K A;  3FJD A;  3HAL A;  3CAH A;  1FQ9 A;  5HPZ A;  4XFS A;  2IWT B;  3FJF A;  4KC3 A;  4JRA A;  1PC8 B;  3Q7Y A;  4OEG A;  3WIN C;  3WA1 A;  1Z0H A;  2Z49 A;  3BTA A;  4QBC A;  1FGA A;  3BA7 A;  3OJ2 A;  8I1B A;  2K4A B;  2RQ9 A;  2NYY A;  4ZKT B;  3OGG A;  3FJI A;  5DZU A;  3CA3 A;  5BQU C;  1AXM A;  4TLP A;  4WBC A;  1NZK A;  3I2X A;  3B9U A;  3I29 B;  1HWN B;  3V0A A;  4HR6 C;  4GAF A;  1DJS B;  5EHA A;  5BP5 A;  4FGF A;  3HMY A;  3O4C A;  2Z48 A;  2D44 A;  1D0H A;  5BVP I;  1TOO A;  5JMC A;  3OJV A;  3NBC A;  1EV2 A;  5EC5 A;  1BFB A;  3E8L C;  4J2Y A;  3FJC A;  1AFC A;  4G6M A;  2NS2 A;  4LO0 C;  4EB2 B;  5BXP A;  4LO3 C;  3RMX A;  4F34 A;  1HIB A;  1SR4 A;  4QKS A;  2J3P A;  3FUQ A;  3WO4 A;  3FFZ A;  1DIW A;  4I4O A;  3OBR A;  4KBB A;  3V0B A;  1KNM A;  4II0 A;  3Q7W A;  1M2T B;  2VSA A;  3PME A;  2VUA A;  7I1B A;  4UY4 A;  1F31 A;  1QQK A;  2AXM A;  4J2X A;  1XZZ A;  2F2F A;  4EFQ A;  4OW4 A;  4LO2 C;  5D63 A;  2D20 A;  1XYF A;  3N0K A;  3RMY A;  2LIE A;  3CRH A;  3IM6 A;  2KH2 A;  2QN4 A;  2R9K B;  4I4U A;  1YXW A;  3FJ9 A;  3AJ5 A;  1W3F A;  41BI A;  2AQZ A;  2D43 A;  4I1E A;  4END A;  2ESU A;  4AN7 B;  3OGF A;  3BRG C;  1DZD A;  4OWJ A;  4IHZ A;  1V6V A;  3UD8 A;  3AKF A;  2ZR1 B;  3CA6 A;  2KKI A;  5FZU A;  1SZ6 B;  4AN6 A;  1ILR 1;  1BFG A;  3ZXD A;  3QR5 A;  1DFC A;  1EPW A;  3S8K A;  2F8X C;  4OWK A;  3WMV A;  1W3G A;  3VWC A;  3BX1 C;  1FWV A;  4P0J A;  3NBE A;  3Q7X A;  1XG6 A;  1ISW A;  1JLX A;  3KMV A;  3I2A A;  1IIL A;  2RST A;  4JP0 A;  3F62 B;  4G1R A;  3FUO A;  3P6I A;  5BXT A;  1PZZ A;  2Y9G A;  4KEI A;  1JT7 A;  5DSS B;  4JAW A;  3FGM A;  3ILA A;  3R4S A;  1G9C A;  1WD3 A;  3IIR A;  2FO1 A;  1JT4 A;  3CA1 A;  3AH2 A;  4GAI A;  5F8Y A;  4EKX B;  4P0L A;  2NVH A;  1T9F A;  1I1E A;  1ABR B;  1TP0 A;  4IZE A;  4OEE A;  4JKX B;  2VU9 A;  3VT2 A;  2DRY A;  5F8S A;  5BOW A;  5E24 E;  3UJ4 A;  4J2S A;  4I2S A;  3FJK A;  1BFC A;  1FV3 A;  4Q9G A;  4GP0 A;  1BFF A;  1MC9 A;  3WIN A;  2NP0 A;  1JQZ A;  1M16 A;  4I4P A;  3UDA A;  1IHK A;  2FDB M;  1TWE A;  4EFR A;  4LO8 B;  4X3A A;  3P6J A;  2L5X A;  4LO1 C;  5BQU A;  3H6R B;  2D22 A;  3CQA A;  2MC2 A;  3V0A B;  4I4V A;  3IAG C;  1EYL A;  4IY8 A;  1JTC A;  1BLD A;  2Y9F A;  3UJ0 A;  3A22 A;  4DEN A;  4Z9W B;  9ILB A;  1S0D A;  1ONK B;  2FGF A;  2KI6 B;  1YBI A;  2WRY A;  1CVS A;  3W9T A;  3O4O A;  3AJ6 A;  4QKR A;  3LTQ A;  3OBT A;  3T8S A;  1PUU B;  1V6X A;  1RZO B;  3MAL A;  4I4X A;  4LO0 A;  3IM7 A;  4X37 A;  2KLL A;  2VSE A;  4LO3 A;  5F8W A;  4HA2 A;  4GOV A;  3VT1 A;  1FMZ A;  4ZFY B;  4ZA3 B;  2Q3N B;  4ZLB B;  1BLA A;  2AFG A;  1R8O A;  2X2T A;  3CA5 A;  5BXS A;  1EVT A;  4D8H A;  4JPZ A;  1PUM B;  4LO2 A;  5FNX A;  1AVX B;  2D7I A;  1QXM A;  4G6J A;  1JT5 A;  1TWM A;  4QBV A;  1T4Q A;  2VLC A;  3VSF A;  1UPS A;  1YTO A;  1GGP B;  3H6Q A;  3NBD A;  3A21 A;  1FN0 A;  1HCE A;  2BEB A;  4KEJ A;  3WO2 A;  3AKH A;  3ZC8 A;  1BA7 A;  1FMM S;  4ZOT A;  1SR4 C;  3AKG A;  4A7Y A;  4P6A A;  4Z8S B;  3AZV A;  3F1R A;  1HCD A;  1G9D A;  4I96 A;  1P63 A;  3CRG A;  3H6S E;  2MLL B;  3NBN A;  4MZG B;  1NUN A;  3O4A A;  2F2F C;  1E0O A;  4I8M A;  4ZFW B;  1YF8 B;  6I1B A;  3WMU A;  3O49 A;  3N7M A;  1RG8 A;  1ISV A;  4I6I A;  5BXR A;  1JY0 A;  3HSM A;  1CE7 B;  1ITB A;  3AZW A;  1S0L A;  3A23 A;  2DRZ A;  1QQL A;  1IRA X;  1DQG A;  1ISX A;  1HWM B;  1BAR A;  2NZ9 A;  3FJA A;  3SNV A;  4JQ0 A;  3C9Z A;  1TTU A;  2E4M C;  2ERM A;  3IM5 A;  3BB2 A;  3HN1 A;  1WBA A;  3N7L A;  3P53 A;  1IJT A;  2WBC A;  5D62 A;  3ZX7 A;  2ET2 A;  3S8J A;  3BAO A;  3O5W B;  1IT0 A;  5B2H A;  4DCK C;  1Z4S A;  3V79 C;  2QYI B;  3VUO A;  1JT3 A;  4JKQ A;  4H04 A;  3ZXG A;  21BI A;  3O44 A;  3BRD A;  3HBW A;  4QC4 A;  3VT0 A;  4CJM A;  4A7K A;  1G82 A;  4QD2 B;  1IOB A;  1AVA C;  5D61 A;  2XOA A;  3O4B A;  4MZH A;  1PWA A;  4J23 B;  1Q1U A;  2GZB A;  2P39 A;  2RG9 B;  4YOL A;  3BRF A;  4ISQ A;  3RTJ B;  2VXR A;  1S0C A;  2NM1 A;  3FJH A;  4EFP A;  2FFV A;  3CA4 A;  3FJ8 A;  4Q9P A;  4GOY A;  1II4 A;  4ZBV B;  3HOM A;  1WD4 A;  4IZX A;  4OEF A;  4USP A;  2FFU A;  3R4U A;  5FZY A;  3BAQ A;  3O4D A;  5DUY A;  2DRE A;  3O3Q A;  4HJJ A;  1A8D A;  1DFQ A;  1RY7 A;  2Y9X E;  5EG6 C;  1DZC A;  4EEE B;  3AH1 A;  4IQP A;  3V0B B;  1AVW B;  2ZQN A;  3BAV A;  3CRI A;  5JLV A;  1W3A A;  2D24 A;  1J0S A;  3VSZ A;  1DQO A;  4LO7 C;  4QD2 C;  1JLY A;  2D23 A;  3POK A;  1G9A A;  4L4H A;  3H6R A;  3FJB A; 
#chains in the Genus database with same CATH homology
 3JRR A;  4I7I A;  3NJ5 A;  3BAU A;  3VEQ A;  3CA0 A;  4H75 A;  3RTI B;  3K1X A;  3N7J A;  1Z2V A;  1AF9 A;  1S0B A;  2HWA A;  4H9W A;  5BP5 C;  2Y9W C;  3BAH A;  2IHO A;  2HW9 A;  4I4S A;  3RSJ A;  1N4K A;  2YUG A;  3TC2 A;  1XHB A;  4FVV A;  4KEK A;  1MD6 A;  5G00 A;  4I37 A;  4MZF B;  3JUT A;  3EF2 A;  5FZZ A;  4ZGR B;  1DLL A;  4D0Z A;  4XKI A;  2P23 A;  5GAQ A;  4Q91 A;  4ZFU B;  1I1B A;  4X38 A;  2HZ9 A;  3QYD A;  4I4R A;  1K5U A;  4P0K A;  3AH4 A;  3A07 A;  4F83 A;  3BA4 A;  4QO3 A;  4I4Y A;  4QAL A;  2AAI B;  2LIQ A;  3MPP G;  3OJM A;  4GP3 A;  1R8N A;  2KI4 A;  1IRP A;  1S0E A;  4USO A;  4ION A;  1V6U A;  31BI A;  3ZC9 A;  4X39 A;  2I1B A;  4I3N A;  1S0F A;  3PG0 A;  1ISY A;  4R6U B;  4D0T A;  4G9N A;  3D7W B;  3FJJ A;  1HWO B;  5FNW A;  3LLP A;  1WBC A;  2ZQO A;  1TIE A;  3AKI A;  1L2H A;  4I4Q A;  3PUB A;  1RML A;  4IYB A;  2K43 A;  4A7Z A;  2NTD A;  4I1B A;  4ISR A;  2VXT I;  4OWL A;  1YYN A;  2Q9X A;  2D7R A;  3BAD A;  2E4M A;  1HWP B;  1Q03 A;  3BAG A;  1HKN A;  4L4I A;  4OUJ A;  1BAS A;  1TFM B;  3CU1 B;  4PC4 A;  4DEP A;  2DS0 A;  3BA5 A;  2D1Z A;  4IY9 A;  1FWU A;  2M49 A;  4I0Y A;  2MIB A;  2BEA A;  3FJE A;  5F90 A;  1ISZ A;  2K8R A;  3UD9 A;  2UUS A;  1Q04 A;  1FV2 A;  4XFT A;  1V6W A;  1AVU A;  4G9M A;  4XFU A;  4LO7 B;  3PHZ A;  2X2S A;  1K5V A;  1VCL A;  2GO2 A;  3WO3 A;  2BFH A;  4LO1 A;  2HWM A;  5DVH A;  5I1B A;  4J2K A;  1G9B A;  3UD7 A;  1OQL B;  1S0G A;  3N7K A;  3FJD A;  3HAL A;  3CAH A;  1FQ9 A;  5HPZ A;  4XFS A;  2IWT B;  3FJF A;  4KC3 A;  4JRA A;  1PC8 B;  3Q7Y A;  4OEG A;  3WIN C;  3WA1 A;  1Z0H A;  2Z49 A;  3BTA A;  4QBC A;  1FGA A;  3BA7 A;  3OJ2 A;  8I1B A;  2K4A B;  2RQ9 A;  2NYY A;  4ZKT B;  3OGG A;  3FJI A;  5DZU A;  3CA3 A;  5BQU C;  1AXM A;  4TLP A;  4WBC A;  1NZK A;  3I2X A;  3B9U A;  3I29 B;  1HWN B;  3V0A A;  4HR6 C;  4GAF A;  1DJS B;  5EHA A;  5BP5 A;  4FGF A;  3HMY A;  3O4C A;  2Z48 A;  2D44 A;  1D0H A;  5BVP I;  1TOO A;  5JMC A;  3OJV A;  3NBC A;  1EV2 A;  5EC5 A;  1BFB A;  3E8L C;  4J2Y A;  3FJC A;  1AFC A;  4G6M A;  2NS2 A;  4LO0 C;  4EB2 B;  5BXP A;  4LO3 C;  3RMX A;  4F34 A;  1HIB A;  1SR4 A;  4QKS A;  2J3P A;  3FUQ A;  3WO4 A;  3FFZ A;  1DIW A;  4I4O A;  3OBR A;  4KBB A;  3V0B A;  1KNM A;  4II0 A;  3Q7W A;  1M2T B;  2VSA A;  3PME A;  2VUA A;  7I1B A;  4UY4 A;  1F31 A;  1QQK A;  2AXM A;  4J2X A;  1XZZ A;  2F2F A;  4EFQ A;  4OW4 A;  4LO2 C;  5D63 A;  2D20 A;  1XYF A;  3N0K A;  3RMY A;  2LIE A;  3CRH A;  3IM6 A;  2KH2 A;  2QN4 A;  2R9K B;  4I4U A;  1YXW A;  3FJ9 A;  3AJ5 A;  1W3F A;  41BI A;  2AQZ A;  2D43 A;  4I1E A;  4END A;  2ESU A;  4AN7 B;  3OGF A;  3BRG C;  1DZD A;  4OWJ A;  4IHZ A;  1V6V A;  3UD8 A;  3AKF A;  2ZR1 B;  3CA6 A;  2KKI A;  5FZU A;  1SZ6 B;  4AN6 A;  1ILR 1;  1BFG A;  3ZXD A;  3QR5 A;  1DFC A;  1EPW A;  3S8K A;  2F8X C;  4OWK A;  3WMV A;  1W3G A;  3VWC A;  3BX1 C;  1FWV A;  4P0J A;  3NBE A;  3Q7X A;  1XG6 A;  1ISW A;  1JLX A;  3KMV A;  3I2A A;  1IIL A;  2RST A;  4JP0 A;  3F62 B;  4G1R A;  3FUO A;  3P6I A;  5BXT A;  1PZZ A;  2Y9G A;  4KEI A;  1JT7 A;  5DSS B;  4JAW A;  3FGM A;  3ILA A;  3R4S A;  1G9C A;  1WD3 A;  3IIR A;  2FO1 A;  1JT4 A;  3CA1 A;  3AH2 A;  4GAI A;  5F8Y A;  4EKX B;  4P0L A;  2NVH A;  1T9F A;  1I1E A;  1ABR B;  1TP0 A;  4IZE A;  4OEE A;  4JKX B;  2VU9 A;  3VT2 A;  2DRY A;  5F8S A;  5BOW A;  5E24 E;  3UJ4 A;  4J2S A;  4I2S A;  3FJK A;  1BFC A;  1FV3 A;  4Q9G A;  4GP0 A;  1BFF A;  1MC9 A;  3WIN A;  2NP0 A;  1JQZ A;  1M16 A;  4I4P A;  3UDA A;  1IHK A;  2FDB M;  1TWE A;  4EFR A;  4LO8 B;  4X3A A;  3P6J A;  2L5X A;  4LO1 C;  5BQU A;  3H6R B;  2D22 A;  3CQA A;  2MC2 A;  3V0A B;  4I4V A;  3IAG C;  1EYL A;  4IY8 A;  1JTC A;  1BLD A;  2Y9F A;  3UJ0 A;  3A22 A;  4DEN A;  4Z9W B;  9ILB A;  1S0D A;  1ONK B;  2FGF A;  2KI6 B;  1YBI A;  2WRY A;  1CVS A;  3W9T A;  3O4O A;  3AJ6 A;  4QKR A;  3LTQ A;  3OBT A;  3T8S A;  1PUU B;  1V6X A;  1RZO B;  3MAL A;  4I4X A;  4LO0 A;  3IM7 A;  4X37 A;  2KLL A;  2VSE A;  4LO3 A;  5F8W A;  4HA2 A;  4GOV A;  3VT1 A;  1FMZ A;  4ZFY B;  4ZA3 B;  2Q3N B;  4ZLB B;  1BLA A;  2AFG A;  1R8O A;  2X2T A;  3CA5 A;  5BXS A;  1EVT A;  4D8H A;  4JPZ A;  1PUM B;  4LO2 A;  5FNX A;  1AVX B;  2D7I A;  1QXM A;  4G6J A;  1JT5 A;  1TWM A;  4QBV A;  1T4Q A;  2VLC A;  3VSF A;  1UPS A;  1YTO A;  1GGP B;  3H6Q A;  3NBD A;  3A21 A;  1FN0 A;  1HCE A;  2BEB A;  4KEJ A;  3WO2 A;  3AKH A;  3ZC8 A;  1BA7 A;  1FMM S;  4ZOT A;  1SR4 C;  3AKG A;  4A7Y A;  4P6A A;  4Z8S B;  3AZV A;  3F1R A;  1HCD A;  1G9D A;  4I96 A;  1P63 A;  3CRG A;  3H6S E;  2MLL B;  3NBN A;  4MZG B;  1NUN A;  3O4A A;  2F2F C;  1E0O A;  4I8M A;  4ZFW B;  1YF8 B;  6I1B A;  3WMU A;  3O49 A;  3N7M A;  1RG8 A;  1ISV A;  4I6I A;  5BXR A;  1JY0 A;  3HSM A;  1CE7 B;  1ITB A;  3AZW A;  1S0L A;  3A23 A;  2DRZ A;  1QQL A;  1IRA X;  1DQG A;  1ISX A;  1HWM B;  1BAR A;  2NZ9 A;  3FJA A;  3SNV A;  4JQ0 A;  3C9Z A;  1TTU A;  2E4M C;  2ERM A;  3IM5 A;  3BB2 A;  3HN1 A;  1WBA A;  3N7L A;  3P53 A;  1IJT A;  2WBC A;  5D62 A;  3ZX7 A;  2ET2 A;  3S8J A;  3BAO A;  3O5W B;  1IT0 A;  5B2H A;  4DCK C;  1Z4S A;  3V79 C;  2QYI B;  3VUO A;  1JT3 A;  4JKQ A;  4H04 A;  3ZXG A;  21BI A;  3O44 A;  3BRD A;  3HBW A;  4QC4 A;  3VT0 A;  4CJM A;  4A7K A;  1G82 A;  4QD2 B;  1IOB A;  1AVA C;  5D61 A;  2XOA A;  3O4B A;  4MZH A;  1PWA A;  4J23 B;  1Q1U A;  2GZB A;  2P39 A;  2RG9 B;  4YOL A;  3BRF A;  4ISQ A;  3RTJ B;  2VXR A;  1S0C A;  2NM1 A;  3FJH A;  4EFP A;  2FFV A;  3CA4 A;  3FJ8 A;  4Q9P A;  4GOY A;  1II4 A;  4ZBV B;  3HOM A;  1WD4 A;  4IZX A;  4OEF A;  4USP A;  2FFU A;  3R4U A;  5FZY A;  3BAQ A;  3O4D A;  5DUY A;  2DRE A;  3O3Q A;  4HJJ A;  1A8D A;  1DFQ A;  1RY7 A;  2Y9X E;  5EG6 C;  1DZC A;  4EEE B;  3AH1 A;  4IQP A;  3V0B B;  1AVW B;  2ZQN A;  3BAV A;  3CRI A;  5JLV A;  1W3A A;  2D24 A;  1J0S A;  3VSZ A;  1DQO A;  4LO7 C;  4QD2 C;  1JLY A;  2D23 A;  3POK A;  1G9A A;  4L4H A;  3H6R A;  3FJB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...