4UY4A

1.86 a structure of human spindlin-4 protein in complex with histone h3k4me3 peptide
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
213
structure length
203
Chain Sequence
SMTRRNIVGCRIQHGWKEGNEPVEQWKGTVLEQVSVKPTLYIIKYDGKDSVYGLELHRDKRVLALEILPERVPTPRIDSRLADSLIGKAVEHVFETKDEWKGMVLARAPVMDTWFYITYEKDPVLYMYTLLDDYKDGDLRIIPDSNYYFPTAEQESLVGKQVEHAKDDGSKRTGIFIHQVVAKPSVYFIKFDDDIHIYVYGLV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SPINDLIN-4
publication title 1.86 A Structure of Human Spindlin-4 Protein in Complex with Histone H3K4Me3 Peptide
rcsb
source organism Homo sapiens
molecule tags Peptide binding protein
total genus 40
structure length 203
sequence length 213
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-08-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02513 Spin-Ssty Spin/Ssty Family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.80.10.70 Mainly Beta Trefoil Trefoil (Acidic Fibroblast Growth Factor, subunit A) Trefoil (Acidic Fibroblast Growth Factor, subunit A) 4uy4A00
2NS2A 4H75A 4UY4A 4MZHA 4MZGB 4MZFB
chains in the Genus database with same CATH superfamily
1ISZA 4KC3A 4DEPA 3VT1A 5EHAA 4X39A 2HW9A 4JKQA 4WBCA 2MC2A 1PC8B 3WO3A 3P6IA 4LO2C 5EG6C 3N0KA 4D0TA 4IONA 1DIWA 1JT3A 6I1BA 4LO1A 3MALA 1D0HA 2K43A 1M2TB 1XYFA 4LO3C 1HWMB 4H9WA 2E4MC 4JAWA 3KMVA 4JRAA 3MPPG 4FGFA 4ZFYB 1JY0A 3WINC 4F83A 1ILR1 1AVXB 5FNWA 4G1RA 3RMYA 4OEFA 5BP5C 1ISYA 1G9CA 4XFUA 2D1ZA 1JQZA 1XZZA 4DENA 2D44A 2QN4A 3RTIB 1HWPB 4XFSA 4F34A 3ZC9A 3BRFA 2F2FC 1SR4C 3AH1A 3OJVA 4I7IA 1G9BA 1J0SA 2FGFA 4L4IA 3V79C 1MD6A 1GGPB 1K5UA 5D61A 1FN0A 4ZLBB 5F90A 1Z2VA 3UD8A 2VSEA 3BAQA 1Q1UA 3UJ4A 4I96A 4YOLA 5BVPI 5BQUC 3OGGA 4I6IA 4Q9PA 5FZZA 3N7MA 1PUUB 3POKA 5F8YA 3FJIA 2AAIB 4XKIA 4QALA 4JKXB 1YF8B 3ZXDA 4R6UB 3E8LC 3HALA 5GAQA 3QYDA 3P6JA 3AKIA 4I2SA 4LO0C 2ZR1B 3HOMA 4HA2A 3Q7WA 4EFRA 3I2XA 4IY9A 1BLDA 3FJCA 4P0JA 3R4UA 3FJDA 5E24E 3W9TA 3V0AB 4PC4A 3O4CA 4OUJA 4GOYA 1S0GA 2NVHA 4GAIA 1WD3A 2E4MA 5I1BA 3F1RA 3BADA 1EPWA 3AKFA 2BEBA 2D7RA 4G6MA 1ITBA 4KEJA 3WINA 3OJ2A 3Q7XA 2GO2A 3AZVA 1W3FA 3CQAA 1IOBA 3CA3A 1ISXA 4G6JA 5BP5A 2Y9XE 2FDBM 3WMVA 1HCEA 1YYNA 3F62B 1YBIA 3SNVA 3IM6A 5DUYA 3Q7YA 2LIEA 2LIQA 3CA1A 3OBRA 1E0OA 2GZBA 3FJJA 1Q03A 3HBWA 2F2FA 2WBCA 1SR4A 2WRYA 4EFPA 3UDAA 4J2XA 2P23A 1W3AA 2QYIB 4LO7B 4EKXB 1DQGA 3PMEA 4QBVA 1V6UA 2VU9A 3HSMA 3H6RA 4J2SA 3S8JA 1AXMA 3V0AA 1UPSA 3V0BA 4JP0A 1DQOA 1TTUA 2Y9GA 4I0YA 3BA7A 4IZXA 3LTQA 2FFVA 4TLPA 1JLYA 3LLPA 4USOA 4J23B 5D62A 1DZCA 4ZFWB 1XHBA 1HIBA 1HWNB 1HCDA 3OGFA 4LO0A 3ZXGA 1DFQA 1RMLA 4QC4A 1AFCA 3BAVA 3O49A 1NUNA 2DRZA 1OQLB 1FV2A 4ZA3B 2KI4A 3CU1B 2AQZA 4J2KA 3FJAA 2DRYA 3A22A 3JRRA 5FNXA 1FQ9A 3N7KA 2NP0A 4QO3A 2DS0A 1FMZA 1Z4SA 3CA4A 3CAHA 1XG6A 2Q9XA 2P39A 4I4UA 3HMYA 4OEEA 1BFGA 4IHZA 1R8NA 2MLLB 4Q91A 21BIA 2IHOA 2YUGA 1T9FA 1RY7A 3BAHA 4QD2C 4ENDA 1I1BA 1VCLA 1I1EA 2M49A 1NZKA 1G82A 4I8MA 3BA5A 3FGMA 4X38A 2D43A 4JQ0A 3AZWA 3I2AA 4OWKA 4GAFA 2UUSA 3BAOA 1ONKB 3P53A 3PUBA 3RSJA 3QR5A 3AJ5A 1AVWB 2AXMA 2KI6B 3BRDA 2VUAA 3RTJB 4USPA 3UD7A 4P0LA 1EVTA 3EF2A 3BB2A 4D0ZA 1JLXA 1K5VA 4Z9WB 4AN7B 3NBNA 2R9KB 3H6QA 1V6VA 5DSSB 2D22A 3O44A 1W3GA 3BA4A 3H6RB 4LO2A 5BXSA 5DZUA 4QKRA 4OWJA 4I4YA 3V0BB 1RG8A 2ZQOA 3IIRA 4Q9GA 4LO3A 2KKIA 4HJJA 3O4DA 8I1BA 2KLLA 4OEGA 1ISWA 1IT0A 1ABRB 4I4RA 3CRIA 1HWOB 1JT4A 3O4AA 3A07A 4I37A 3VT0A 4I1BA 4EFQA 1RZOB 1BFCA 4FVVA 3FJEA 3A21A 4ZKTB 4MZFB 4P0KA 1CVSA 3OBTA 7I1BA 4KBBA 2D20A 1BFBA 1IRAX 3NBEA 3A23A 3NBCA 4ZOTA 2NTDA 3ILAA 1CE7B 1DZDA 4GP3A 3HN1A 1F31A 3AKHA 1TWEA 2HWAA 3FJBA 5DVHA 1DFCA 1P63A 3TC2A 1AVAC 1QXMA 3CA6A 3IM7A 1FMMS 1II4A 4GOVA 3IM5A 3WA1A 4MZHA 4I4XA 4X37A 5BQUA 4G9MA 3S8KA 4X3AA 1M16A 4A7KA 4CJMA 2Z49A 4H04A 2NM1A 4OW4A 3FUOA 2DREA 1ISVA 3NBDA 1Z0HA 3WO4A 3PHZA 1YTOA 2ESUA 4KEIA 1WBAA 4ZGRB 5BXTA 2D7IA 2K8RA 1KNMA 1TIEA 2RQ9A 3I29B 1A8DA 5FZUA 3AH4A 4I4PA 1IHKA 1BA7A 1IJTA 4OWLA 2NS2A 1S0LA 5F8WA 4P6AA 5G00A 2XOAA 3WMUA 5B2HA 3FJ9A 1AF9A 1PUMB 1S0EA 2D23A 3CRGA 3VSFA 2VSAA 4IY8A 4I3NA 2NZ9A 1V6XA 5BXRA 4QBCA 2X2SA 3FJKA 4D8HA 1BARA 3C9ZA 3FFZA 1WD4A 1G9DA 3VEQA 2RG9B 3FJHA 3B9UA 3K1XA 4A7ZA 2ERMA 5FZYA 1SZ6B 3WO2A 5JLVA 2HZ9A 4EB2B 1AVUA 1FWVA 4IZEA 1N4KA 3FUQA 4UY4A 2FFUA 41BIA 1IRPA 2Y9FA 2BFHA 3VUOA 3O4BA 1JT7A 3JUTA 3PG0A 9ILBA 1QQLA 5JMCA 3ZC8A 2J3PA 4IYBA 5D63A 3D7WB 3VWCA 4DCKC 4G9NA 1JTCA 1EV2A 4I4OA 1WBCA 5BOWA 2F8XC 3AKGA 4QD2B 5HPZA 3FJ8A 3AJ6A 3O4OA 1MC9A 2KH2A 3H6SE 3OJMA 3FJFA 3CA0A 5EC5A 1S0DA 1FGAA 4JPZA 3NJ5A 1Q04A 4LO1C 31BIA 4I4SA 1T4QA 4I1EA 4ISQA 1YXWA 1DLLA 2VLCA 1R8OA 1S0CA 3BAGA 4L4HA 4XFTA 2I1BA 1G9AA 3IAGC 4I4QA 3BRGC 1L2HA 1S0FA 2Y9WC 3AH2A 2VXTI 3CRHA 3N7JA 4AN6A 2AFGA 2Z48A 2L5XA 3UJ0A 4GP0A 3BX1C 1IILA 2Q3NB 4ZFUB 4KEKA 4ZBVB 2FO1A 3RMXA 4LO7C 1BFFA 1TWMA 3BTAA 3VSZA 1QQKA 5BXPA 1DJSB 2VXRA 2NYYA 3UD9A 1FWUA 1TFMB 4A7YA 4J2YA 4MZGB 3ZX7A 1EYLA 1BLAA 4QKSA 3BAUA 1TP0A 1V6WA 1FV3A 2BEAA 2ZQNA 1TOOA 2RSTA 2K4AB 3N7LA 4H75A 1S0BA 3CA5A 1JT5A 4I4VA 3R4SA 1PZZA 3O5WB 3VT2A 5F8SA 4EEEB 1HKNA 2D24A 2HWMA 4HR6C 3O3QA 1BASA 2MIBA 2IWTB 2X2TA 4LO8B 4Z8SB 4II0A 1PWAA 4IQPA 3T8SA 2ET2A 4ISRA
chains in the Genus database with same CATH topology
1ISZA 4KC3A 4DEPA 3VT1A 5EHAA 4X39A 2HW9A 4JKQA 4WBCA 2MC2A 1PC8B 3WO3A 3P6IA 4LO2C 5EG6C 3N0KA 4D0TA 4IONA 1DIWA 1JT3A 6I1BA 4LO1A 3MALA 1D0HA 2K43A 1M2TB 1XYFA 4LO3C 1HWMB 4H9WA 2E4MC 4JAWA 3KMVA 4JRAA 3MPPG 4FGFA 4ZFYB 1JY0A 3WINC 4F83A 1ILR1 1AVXB 5FNWA 4G1RA 3RMYA 4OEFA 5BP5C 1ISYA 1G9CA 4XFUA 2D1ZA 1JQZA 1XZZA 4DENA 2D44A 2QN4A 3RTIB 1HWPB 4XFSA 4F34A 3ZC9A 3BRFA 2F2FC 1SR4C 3AH1A 3OJVA 4I7IA 1G9BA 1J0SA 2FGFA 4L4IA 3V79C 1MD6A 1GGPB 1K5UA 5D61A 1FN0A 4ZLBB 5F90A 1Z2VA 3UD8A 2VSEA 3BAQA 1Q1UA 3UJ4A 4I96A 4YOLA 5BVPI 5BQUC 3OGGA 4I6IA 4Q9PA 5FZZA 3N7MA 1PUUB 3POKA 5F8YA 3FJIA 2AAIB 4XKIA 4QALA 4JKXB 1YF8B 3ZXDA 4R6UB 3E8LC 3HALA 5GAQA 3QYDA 3P6JA 3AKIA 4I2SA 4LO0C 2ZR1B 3HOMA 4HA2A 3Q7WA 4EFRA 3I2XA 4IY9A 1BLDA 3FJCA 4P0JA 3R4UA 3FJDA 5E24E 3W9TA 3V0AB 4PC4A 3O4CA 4OUJA 4GOYA 1S0GA 2NVHA 4GAIA 1WD3A 2E4MA 5I1BA 3F1RA 3BADA 1EPWA 3AKFA 2BEBA 2D7RA 4G6MA 1ITBA 4KEJA 3WINA 3OJ2A 3Q7XA 2GO2A 3AZVA 1W3FA 3CQAA 1IOBA 3CA3A 1ISXA 4G6JA 5BP5A 2Y9XE 2FDBM 3WMVA 1HCEA 1YYNA 3F62B 1YBIA 3SNVA 3IM6A 5DUYA 3Q7YA 2LIEA 2LIQA 3CA1A 3OBRA 1E0OA 2GZBA 3FJJA 1Q03A 3HBWA 2F2FA 2WBCA 1SR4A 2WRYA 4EFPA 3UDAA 4J2XA 2P23A 1W3AA 2QYIB 4LO7B 4EKXB 1DQGA 3PMEA 4QBVA 1V6UA 2VU9A 3HSMA 3H6RA 4J2SA 3S8JA 1AXMA 3V0AA 1UPSA 3V0BA 4JP0A 1DQOA 1TTUA 2Y9GA 4I0YA 3BA7A 4IZXA 3LTQA 2FFVA 4TLPA 1JLYA 3LLPA 4USOA 4J23B 5D62A 1DZCA 4ZFWB 1XHBA 1HIBA 1HWNB 1HCDA 3OGFA 4LO0A 3ZXGA 1DFQA 1RMLA 4QC4A 1AFCA 3BAVA 3O49A 1NUNA 2DRZA 1OQLB 1FV2A 4ZA3B 2KI4A 3CU1B 2AQZA 4J2KA 3FJAA 2DRYA 3A22A 3JRRA 5FNXA 1FQ9A 3N7KA 2NP0A 4QO3A 2DS0A 1FMZA 1Z4SA 3CA4A 3CAHA 1XG6A 2Q9XA 2P39A 4I4UA 3HMYA 4OEEA 1BFGA 4IHZA 1R8NA 2MLLB 4Q91A 21BIA 2IHOA 2YUGA 1T9FA 1RY7A 3BAHA 4QD2C 4ENDA 1I1BA 1VCLA 1I1EA 2M49A 1NZKA 1G82A 4I8MA 3BA5A 3FGMA 4X38A 2D43A 4JQ0A 3AZWA 3I2AA 4OWKA 4GAFA 2UUSA 3BAOA 1ONKB 3P53A 3PUBA 3RSJA 3QR5A 3AJ5A 1AVWB 2AXMA 2KI6B 3BRDA 2VUAA 3RTJB 4USPA 3UD7A 4P0LA 1EVTA 3EF2A 3BB2A 4D0ZA 1JLXA 1K5VA 4Z9WB 4AN7B 3NBNA 2R9KB 3H6QA 1V6VA 5DSSB 2D22A 3O44A 1W3GA 3BA4A 3H6RB 4LO2A 5BXSA 5DZUA 4QKRA 4OWJA 4I4YA 3V0BB 1RG8A 2ZQOA 3IIRA 4Q9GA 4LO3A 2KKIA 4HJJA 3O4DA 8I1BA 2KLLA 4OEGA 1ISWA 1IT0A 1ABRB 4I4RA 3CRIA 1HWOB 1JT4A 3O4AA 3A07A 4I37A 3VT0A 4I1BA 4EFQA 1RZOB 1BFCA 4FVVA 3FJEA 3A21A 4ZKTB 4MZFB 4P0KA 1CVSA 3OBTA 7I1BA 4KBBA 2D20A 1BFBA 1IRAX 3NBEA 3A23A 3NBCA 4ZOTA 2NTDA 3ILAA 1CE7B 1DZDA 4GP3A 3HN1A 1F31A 3AKHA 1TWEA 2HWAA 3FJBA 5DVHA 1DFCA 1P63A 3TC2A 1AVAC 1QXMA 3CA6A 3IM7A 1FMMS 1II4A 4GOVA 3IM5A 3WA1A 4MZHA 4I4XA 4X37A 5BQUA 4G9MA 3S8KA 4X3AA 1M16A 4A7KA 4CJMA 2Z49A 4H04A 2NM1A 4OW4A 3FUOA 2DREA 1ISVA 3NBDA 1Z0HA 3WO4A 3PHZA 1YTOA 2ESUA 4KEIA 1WBAA 4ZGRB 5BXTA 2D7IA 2K8RA 1KNMA 1TIEA 2RQ9A 3I29B 1A8DA 5FZUA 3AH4A 4I4PA 1IHKA 1BA7A 1IJTA 4OWLA 2NS2A 1S0LA 5F8WA 4P6AA 5G00A 2XOAA 3WMUA 5B2HA 3FJ9A 1AF9A 1PUMB 1S0EA 2D23A 3CRGA 3VSFA 2VSAA 4IY8A 4I3NA 2NZ9A 1V6XA 5BXRA 4QBCA 2X2SA 3FJKA 4D8HA 1BARA 3C9ZA 3FFZA 1WD4A 1G9DA 3VEQA 2RG9B 3FJHA 3B9UA 3K1XA 4A7ZA 2ERMA 5FZYA 1SZ6B 3WO2A 5JLVA 2HZ9A 4EB2B 1AVUA 1FWVA 4IZEA 1N4KA 3FUQA 4UY4A 2FFUA 41BIA 1IRPA 2Y9FA 2BFHA 3VUOA 3O4BA 1JT7A 3JUTA 3PG0A 9ILBA 1QQLA 5JMCA 3ZC8A 2J3PA 4IYBA 5D63A 3D7WB 3VWCA 4DCKC 4G9NA 1JTCA 1EV2A 4I4OA 1WBCA 5BOWA 2F8XC 3AKGA 4QD2B 5HPZA 3FJ8A 3AJ6A 3O4OA 1MC9A 2KH2A 3H6SE 3OJMA 3FJFA 3CA0A 5EC5A 1S0DA 1FGAA 4JPZA 3NJ5A 1Q04A 4LO1C 31BIA 4I4SA 1T4QA 4I1EA 4ISQA 1YXWA 1DLLA 2VLCA 1R8OA 1S0CA 3BAGA 4L4HA 4XFTA 2I1BA 1G9AA 3IAGC 4I4QA 3BRGC 1L2HA 1S0FA 2Y9WC 3AH2A 2VXTI 3CRHA 3N7JA 4AN6A 2AFGA 2Z48A 2L5XA 3UJ0A 4GP0A 3BX1C 1IILA 2Q3NB 4ZFUB 4KEKA 4ZBVB 2FO1A 3RMXA 4LO7C 1BFFA 1TWMA 3BTAA 3VSZA 1QQKA 5BXPA 1DJSB 2VXRA 2NYYA 3UD9A 1FWUA 1TFMB 4A7YA 4J2YA 4MZGB 3ZX7A 1EYLA 1BLAA 4QKSA 3BAUA 1TP0A 1V6WA 1FV3A 2BEAA 2ZQNA 1TOOA 2RSTA 2K4AB 3N7LA 4H75A 1S0BA 3CA5A 1JT5A 4I4VA 3R4SA 1PZZA 3O5WB 3VT2A 5F8SA 4EEEB 1HKNA 2D24A 2HWMA 4HR6C 3O3QA 1BASA 2MIBA 2IWTB 2X2TA 4LO8B 4Z8SB 4II0A 1PWAA 4IQPA 3T8SA 2ET2A 4ISRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS2 A;  4H75 A;  4UY4 A;  4MZH A;  4MZG B;  4MZF B; 
#chains in the Genus database with same CATH topology
 1ISZ A;  4KC3 A;  4DEP A;  3VT1 A;  5EHA A;  4X39 A;  2HW9 A;  4JKQ A;  4WBC A;  2MC2 A;  1PC8 B;  3WO3 A;  3P6I A;  4LO2 C;  5EG6 C;  3N0K A;  4D0T A;  4ION A;  1DIW A;  1JT3 A;  6I1B A;  4LO1 A;  3MAL A;  1D0H A;  2K43 A;  1M2T B;  1XYF A;  4LO3 C;  1HWM B;  4H9W A;  2E4M C;  4JAW A;  3KMV A;  4JRA A;  3MPP G;  4FGF A;  4ZFY B;  1JY0 A;  3WIN C;  4F83 A;  1ILR 1;  1AVX B;  5FNW A;  4G1R A;  3RMY A;  4OEF A;  5BP5 C;  1ISY A;  1G9C A;  4XFU A;  2D1Z A;  1JQZ A;  1XZZ A;  4DEN A;  2D44 A;  2QN4 A;  3RTI B;  1HWP B;  4XFS A;  4F34 A;  3ZC9 A;  3BRF A;  2F2F C;  1SR4 C;  3AH1 A;  3OJV A;  4I7I A;  1G9B A;  1J0S A;  2FGF A;  4L4I A;  3V79 C;  1MD6 A;  1GGP B;  1K5U A;  5D61 A;  1FN0 A;  4ZLB B;  5F90 A;  1Z2V A;  3UD8 A;  2VSE A;  3BAQ A;  1Q1U A;  3UJ4 A;  4I96 A;  4YOL A;  5BVP I;  5BQU C;  3OGG A;  4I6I A;  4Q9P A;  5FZZ A;  3N7M A;  1PUU B;  3POK A;  5F8Y A;  3FJI A;  2AAI B;  4XKI A;  4QAL A;  4JKX B;  1YF8 B;  3ZXD A;  4R6U B;  3E8L C;  3HAL A;  5GAQ A;  3QYD A;  3P6J A;  3AKI A;  4I2S A;  4LO0 C;  2ZR1 B;  3HOM A;  4HA2 A;  3Q7W A;  4EFR A;  3I2X A;  4IY9 A;  1BLD A;  3FJC A;  4P0J A;  3R4U A;  3FJD A;  5E24 E;  3W9T A;  3V0A B;  4PC4 A;  3O4C A;  4OUJ A;  4GOY A;  1S0G A;  2NVH A;  4GAI A;  1WD3 A;  2E4M A;  5I1B A;  3F1R A;  3BAD A;  1EPW A;  3AKF A;  2BEB A;  2D7R A;  4G6M A;  1ITB A;  4KEJ A;  3WIN A;  3OJ2 A;  3Q7X A;  2GO2 A;  3AZV A;  1W3F A;  3CQA A;  1IOB A;  3CA3 A;  1ISX A;  4G6J A;  5BP5 A;  2Y9X E;  2FDB M;  3WMV A;  1HCE A;  1YYN A;  3F62 B;  1YBI A;  3SNV A;  3IM6 A;  5DUY A;  3Q7Y A;  2LIE A;  2LIQ A;  3CA1 A;  3OBR A;  1E0O A;  2GZB A;  3FJJ A;  1Q03 A;  3HBW A;  2F2F A;  2WBC A;  1SR4 A;  2WRY A;  4EFP A;  3UDA A;  4J2X A;  2P23 A;  1W3A A;  2QYI B;  4LO7 B;  4EKX B;  1DQG A;  3PME A;  4QBV A;  1V6U A;  2VU9 A;  3HSM A;  3H6R A;  4J2S A;  3S8J A;  1AXM A;  3V0A A;  1UPS A;  3V0B A;  4JP0 A;  1DQO A;  1TTU A;  2Y9G A;  4I0Y A;  3BA7 A;  4IZX A;  3LTQ A;  2FFV A;  4TLP A;  1JLY A;  3LLP A;  4USO A;  4J23 B;  5D62 A;  1DZC A;  4ZFW B;  1XHB A;  1HIB A;  1HWN B;  1HCD A;  3OGF A;  4LO0 A;  3ZXG A;  1DFQ A;  1RML A;  4QC4 A;  1AFC A;  3BAV A;  3O49 A;  1NUN A;  2DRZ A;  1OQL B;  1FV2 A;  4ZA3 B;  2KI4 A;  3CU1 B;  2AQZ A;  4J2K A;  3FJA A;  2DRY A;  3A22 A;  3JRR A;  5FNX A;  1FQ9 A;  3N7K A;  2NP0 A;  4QO3 A;  2DS0 A;  1FMZ A;  1Z4S A;  3CA4 A;  3CAH A;  1XG6 A;  2Q9X A;  2P39 A;  4I4U A;  3HMY A;  4OEE A;  1BFG A;  4IHZ A;  1R8N A;  2MLL B;  4Q91 A;  21BI A;  2IHO A;  2YUG A;  1T9F A;  1RY7 A;  3BAH A;  4QD2 C;  4END A;  1I1B A;  1VCL A;  1I1E A;  2M49 A;  1NZK A;  1G82 A;  4I8M A;  3BA5 A;  3FGM A;  4X38 A;  2D43 A;  4JQ0 A;  3AZW A;  3I2A A;  4OWK A;  4GAF A;  2UUS A;  3BAO A;  1ONK B;  3P53 A;  3PUB A;  3RSJ A;  3QR5 A;  3AJ5 A;  1AVW B;  2AXM A;  2KI6 B;  3BRD A;  2VUA A;  3RTJ B;  4USP A;  3UD7 A;  4P0L A;  1EVT A;  3EF2 A;  3BB2 A;  4D0Z A;  1JLX A;  1K5V A;  4Z9W B;  4AN7 B;  3NBN A;  2R9K B;  3H6Q A;  1V6V A;  5DSS B;  2D22 A;  3O44 A;  1W3G A;  3BA4 A;  3H6R B;  4LO2 A;  5BXS A;  5DZU A;  4QKR A;  4OWJ A;  4I4Y A;  3V0B B;  1RG8 A;  2ZQO A;  3IIR A;  4Q9G A;  4LO3 A;  2KKI A;  4HJJ A;  3O4D A;  8I1B A;  2KLL A;  4OEG A;  1ISW A;  1IT0 A;  1ABR B;  4I4R A;  3CRI A;  1HWO B;  1JT4 A;  3O4A A;  3A07 A;  4I37 A;  3VT0 A;  4I1B A;  4EFQ A;  1RZO B;  1BFC A;  4FVV A;  3FJE A;  3A21 A;  4ZKT B;  4MZF B;  4P0K A;  1CVS A;  3OBT A;  7I1B A;  4KBB A;  2D20 A;  1BFB A;  1IRA X;  3NBE A;  3A23 A;  3NBC A;  4ZOT A;  2NTD A;  3ILA A;  1CE7 B;  1DZD A;  4GP3 A;  3HN1 A;  1F31 A;  3AKH A;  1TWE A;  2HWA A;  3FJB A;  5DVH A;  1DFC A;  1P63 A;  3TC2 A;  1AVA C;  1QXM A;  3CA6 A;  3IM7 A;  1FMM S;  1II4 A;  4GOV A;  3IM5 A;  3WA1 A;  4MZH A;  4I4X A;  4X37 A;  5BQU A;  4G9M A;  3S8K A;  4X3A A;  1M16 A;  4A7K A;  4CJM A;  2Z49 A;  4H04 A;  2NM1 A;  4OW4 A;  3FUO A;  2DRE A;  1ISV A;  3NBD A;  1Z0H A;  3WO4 A;  3PHZ A;  1YTO A;  2ESU A;  4KEI A;  1WBA A;  4ZGR B;  5BXT A;  2D7I A;  2K8R A;  1KNM A;  1TIE A;  2RQ9 A;  3I29 B;  1A8D A;  5FZU A;  3AH4 A;  4I4P A;  1IHK A;  1BA7 A;  1IJT A;  4OWL A;  2NS2 A;  1S0L A;  5F8W A;  4P6A A;  5G00 A;  2XOA A;  3WMU A;  5B2H A;  3FJ9 A;  1AF9 A;  1PUM B;  1S0E A;  2D23 A;  3CRG A;  3VSF A;  2VSA A;  4IY8 A;  4I3N A;  2NZ9 A;  1V6X A;  5BXR A;  4QBC A;  2X2S A;  3FJK A;  4D8H A;  1BAR A;  3C9Z A;  3FFZ A;  1WD4 A;  1G9D A;  3VEQ A;  2RG9 B;  3FJH A;  3B9U A;  3K1X A;  4A7Z A;  2ERM A;  5FZY A;  1SZ6 B;  3WO2 A;  5JLV A;  2HZ9 A;  4EB2 B;  1AVU A;  1FWV A;  4IZE A;  1N4K A;  3FUQ A;  4UY4 A;  2FFU A;  41BI A;  1IRP A;  2Y9F A;  2BFH A;  3VUO A;  3O4B A;  1JT7 A;  3JUT A;  3PG0 A;  9ILB A;  1QQL A;  5JMC A;  3ZC8 A;  2J3P A;  4IYB A;  5D63 A;  3D7W B;  3VWC A;  4DCK C;  4G9N A;  1JTC A;  1EV2 A;  4I4O A;  1WBC A;  5BOW A;  2F8X C;  3AKG A;  4QD2 B;  5HPZ A;  3FJ8 A;  3AJ6 A;  3O4O A;  1MC9 A;  2KH2 A;  3H6S E;  3OJM A;  3FJF A;  3CA0 A;  5EC5 A;  1S0D A;  1FGA A;  4JPZ A;  3NJ5 A;  1Q04 A;  4LO1 C;  31BI A;  4I4S A;  1T4Q A;  4I1E A;  4ISQ A;  1YXW A;  1DLL A;  2VLC A;  1R8O A;  1S0C A;  3BAG A;  4L4H A;  4XFT A;  2I1B A;  1G9A A;  3IAG C;  4I4Q A;  3BRG C;  1L2H A;  1S0F A;  2Y9W C;  3AH2 A;  2VXT I;  3CRH A;  3N7J A;  4AN6 A;  2AFG A;  2Z48 A;  2L5X A;  3UJ0 A;  4GP0 A;  3BX1 C;  1IIL A;  2Q3N B;  4ZFU B;  4KEK A;  4ZBV B;  2FO1 A;  3RMX A;  4LO7 C;  1BFF A;  1TWM A;  3BTA A;  3VSZ A;  1QQK A;  5BXP A;  1DJS B;  2VXR A;  2NYY A;  3UD9 A;  1FWU A;  1TFM B;  4A7Y A;  4J2Y A;  4MZG B;  3ZX7 A;  1EYL A;  1BLA A;  4QKS A;  3BAU A;  1TP0 A;  1V6W A;  1FV3 A;  2BEA A;  2ZQN A;  1TOO A;  2RST A;  2K4A B;  3N7L A;  4H75 A;  1S0B A;  3CA5 A;  1JT5 A;  4I4V A;  3R4S A;  1PZZ A;  3O5W B;  3VT2 A;  5F8S A;  4EEE B;  1HKN A;  2D24 A;  2HWM A;  4HR6 C;  3O3Q A;  1BAS A;  2MIB A;  2IWT B;  2X2T A;  4LO8 B;  4Z8S B;  4II0 A;  1PWA A;  4IQP A;  3T8S A;  2ET2 A;  4ISR A; 
#chains in the Genus database with same CATH homology
 1ISZ A;  4KC3 A;  4DEP A;  3VT1 A;  5EHA A;  4X39 A;  2HW9 A;  4JKQ A;  4WBC A;  2MC2 A;  1PC8 B;  3WO3 A;  3P6I A;  4LO2 C;  5EG6 C;  3N0K A;  4D0T A;  4ION A;  1DIW A;  1JT3 A;  6I1B A;  4LO1 A;  3MAL A;  1D0H A;  2K43 A;  1M2T B;  1XYF A;  4LO3 C;  1HWM B;  4H9W A;  2E4M C;  4JAW A;  3KMV A;  4JRA A;  3MPP G;  4FGF A;  4ZFY B;  1JY0 A;  3WIN C;  4F83 A;  1ILR 1;  1AVX B;  5FNW A;  4G1R A;  3RMY A;  4OEF A;  5BP5 C;  1ISY A;  1G9C A;  4XFU A;  2D1Z A;  1JQZ A;  1XZZ A;  4DEN A;  2D44 A;  2QN4 A;  3RTI B;  1HWP B;  4XFS A;  4F34 A;  3ZC9 A;  3BRF A;  2F2F C;  1SR4 C;  3AH1 A;  3OJV A;  4I7I A;  1G9B A;  1J0S A;  2FGF A;  4L4I A;  3V79 C;  1MD6 A;  1GGP B;  1K5U A;  5D61 A;  1FN0 A;  4ZLB B;  5F90 A;  1Z2V A;  3UD8 A;  2VSE A;  3BAQ A;  1Q1U A;  3UJ4 A;  4I96 A;  4YOL A;  5BVP I;  5BQU C;  3OGG A;  4I6I A;  4Q9P A;  5FZZ A;  3N7M A;  1PUU B;  3POK A;  5F8Y A;  3FJI A;  2AAI B;  4XKI A;  4QAL A;  4JKX B;  1YF8 B;  3ZXD A;  4R6U B;  3E8L C;  3HAL A;  5GAQ A;  3QYD A;  3P6J A;  3AKI A;  4I2S A;  4LO0 C;  2ZR1 B;  3HOM A;  4HA2 A;  3Q7W A;  4EFR A;  3I2X A;  4IY9 A;  1BLD A;  3FJC A;  4P0J A;  3R4U A;  3FJD A;  5E24 E;  3W9T A;  3V0A B;  4PC4 A;  3O4C A;  4OUJ A;  4GOY A;  1S0G A;  2NVH A;  4GAI A;  1WD3 A;  2E4M A;  5I1B A;  3F1R A;  3BAD A;  1EPW A;  3AKF A;  2BEB A;  2D7R A;  4G6M A;  1ITB A;  4KEJ A;  3WIN A;  3OJ2 A;  3Q7X A;  2GO2 A;  3AZV A;  1W3F A;  3CQA A;  1IOB A;  3CA3 A;  1ISX A;  4G6J A;  5BP5 A;  2Y9X E;  2FDB M;  3WMV A;  1HCE A;  1YYN A;  3F62 B;  1YBI A;  3SNV A;  3IM6 A;  5DUY A;  3Q7Y A;  2LIE A;  2LIQ A;  3CA1 A;  3OBR A;  1E0O A;  2GZB A;  3FJJ A;  1Q03 A;  3HBW A;  2F2F A;  2WBC A;  1SR4 A;  2WRY A;  4EFP A;  3UDA A;  4J2X A;  2P23 A;  1W3A A;  2QYI B;  4LO7 B;  4EKX B;  1DQG A;  3PME A;  4QBV A;  1V6U A;  2VU9 A;  3HSM A;  3H6R A;  4J2S A;  3S8J A;  1AXM A;  3V0A A;  1UPS A;  3V0B A;  4JP0 A;  1DQO A;  1TTU A;  2Y9G A;  4I0Y A;  3BA7 A;  4IZX A;  3LTQ A;  2FFV A;  4TLP A;  1JLY A;  3LLP A;  4USO A;  4J23 B;  5D62 A;  1DZC A;  4ZFW B;  1XHB A;  1HIB A;  1HWN B;  1HCD A;  3OGF A;  4LO0 A;  3ZXG A;  1DFQ A;  1RML A;  4QC4 A;  1AFC A;  3BAV A;  3O49 A;  1NUN A;  2DRZ A;  1OQL B;  1FV2 A;  4ZA3 B;  2KI4 A;  3CU1 B;  2AQZ A;  4J2K A;  3FJA A;  2DRY A;  3A22 A;  3JRR A;  5FNX A;  1FQ9 A;  3N7K A;  2NP0 A;  4QO3 A;  2DS0 A;  1FMZ A;  1Z4S A;  3CA4 A;  3CAH A;  1XG6 A;  2Q9X A;  2P39 A;  4I4U A;  3HMY A;  4OEE A;  1BFG A;  4IHZ A;  1R8N A;  2MLL B;  4Q91 A;  21BI A;  2IHO A;  2YUG A;  1T9F A;  1RY7 A;  3BAH A;  4QD2 C;  4END A;  1I1B A;  1VCL A;  1I1E A;  2M49 A;  1NZK A;  1G82 A;  4I8M A;  3BA5 A;  3FGM A;  4X38 A;  2D43 A;  4JQ0 A;  3AZW A;  3I2A A;  4OWK A;  4GAF A;  2UUS A;  3BAO A;  1ONK B;  3P53 A;  3PUB A;  3RSJ A;  3QR5 A;  3AJ5 A;  1AVW B;  2AXM A;  2KI6 B;  3BRD A;  2VUA A;  3RTJ B;  4USP A;  3UD7 A;  4P0L A;  1EVT A;  3EF2 A;  3BB2 A;  4D0Z A;  1JLX A;  1K5V A;  4Z9W B;  4AN7 B;  3NBN A;  2R9K B;  3H6Q A;  1V6V A;  5DSS B;  2D22 A;  3O44 A;  1W3G A;  3BA4 A;  3H6R B;  4LO2 A;  5BXS A;  5DZU A;  4QKR A;  4OWJ A;  4I4Y A;  3V0B B;  1RG8 A;  2ZQO A;  3IIR A;  4Q9G A;  4LO3 A;  2KKI A;  4HJJ A;  3O4D A;  8I1B A;  2KLL A;  4OEG A;  1ISW A;  1IT0 A;  1ABR B;  4I4R A;  3CRI A;  1HWO B;  1JT4 A;  3O4A A;  3A07 A;  4I37 A;  3VT0 A;  4I1B A;  4EFQ A;  1RZO B;  1BFC A;  4FVV A;  3FJE A;  3A21 A;  4ZKT B;  4MZF B;  4P0K A;  1CVS A;  3OBT A;  7I1B A;  4KBB A;  2D20 A;  1BFB A;  1IRA X;  3NBE A;  3A23 A;  3NBC A;  4ZOT A;  2NTD A;  3ILA A;  1CE7 B;  1DZD A;  4GP3 A;  3HN1 A;  1F31 A;  3AKH A;  1TWE A;  2HWA A;  3FJB A;  5DVH A;  1DFC A;  1P63 A;  3TC2 A;  1AVA C;  1QXM A;  3CA6 A;  3IM7 A;  1FMM S;  1II4 A;  4GOV A;  3IM5 A;  3WA1 A;  4MZH A;  4I4X A;  4X37 A;  5BQU A;  4G9M A;  3S8K A;  4X3A A;  1M16 A;  4A7K A;  4CJM A;  2Z49 A;  4H04 A;  2NM1 A;  4OW4 A;  3FUO A;  2DRE A;  1ISV A;  3NBD A;  1Z0H A;  3WO4 A;  3PHZ A;  1YTO A;  2ESU A;  4KEI A;  1WBA A;  4ZGR B;  5BXT A;  2D7I A;  2K8R A;  1KNM A;  1TIE A;  2RQ9 A;  3I29 B;  1A8D A;  5FZU A;  3AH4 A;  4I4P A;  1IHK A;  1BA7 A;  1IJT A;  4OWL A;  2NS2 A;  1S0L A;  5F8W A;  4P6A A;  5G00 A;  2XOA A;  3WMU A;  5B2H A;  3FJ9 A;  1AF9 A;  1PUM B;  1S0E A;  2D23 A;  3CRG A;  3VSF A;  2VSA A;  4IY8 A;  4I3N A;  2NZ9 A;  1V6X A;  5BXR A;  4QBC A;  2X2S A;  3FJK A;  4D8H A;  1BAR A;  3C9Z A;  3FFZ A;  1WD4 A;  1G9D A;  3VEQ A;  2RG9 B;  3FJH A;  3B9U A;  3K1X A;  4A7Z A;  2ERM A;  5FZY A;  1SZ6 B;  3WO2 A;  5JLV A;  2HZ9 A;  4EB2 B;  1AVU A;  1FWV A;  4IZE A;  1N4K A;  3FUQ A;  4UY4 A;  2FFU A;  41BI A;  1IRP A;  2Y9F A;  2BFH A;  3VUO A;  3O4B A;  1JT7 A;  3JUT A;  3PG0 A;  9ILB A;  1QQL A;  5JMC A;  3ZC8 A;  2J3P A;  4IYB A;  5D63 A;  3D7W B;  3VWC A;  4DCK C;  4G9N A;  1JTC A;  1EV2 A;  4I4O A;  1WBC A;  5BOW A;  2F8X C;  3AKG A;  4QD2 B;  5HPZ A;  3FJ8 A;  3AJ6 A;  3O4O A;  1MC9 A;  2KH2 A;  3H6S E;  3OJM A;  3FJF A;  3CA0 A;  5EC5 A;  1S0D A;  1FGA A;  4JPZ A;  3NJ5 A;  1Q04 A;  4LO1 C;  31BI A;  4I4S A;  1T4Q A;  4I1E A;  4ISQ A;  1YXW A;  1DLL A;  2VLC A;  1R8O A;  1S0C A;  3BAG A;  4L4H A;  4XFT A;  2I1B A;  1G9A A;  3IAG C;  4I4Q A;  3BRG C;  1L2H A;  1S0F A;  2Y9W C;  3AH2 A;  2VXT I;  3CRH A;  3N7J A;  4AN6 A;  2AFG A;  2Z48 A;  2L5X A;  3UJ0 A;  4GP0 A;  3BX1 C;  1IIL A;  2Q3N B;  4ZFU B;  4KEK A;  4ZBV B;  2FO1 A;  3RMX A;  4LO7 C;  1BFF A;  1TWM A;  3BTA A;  3VSZ A;  1QQK A;  5BXP A;  1DJS B;  2VXR A;  2NYY A;  3UD9 A;  1FWU A;  1TFM B;  4A7Y A;  4J2Y A;  4MZG B;  3ZX7 A;  1EYL A;  1BLA A;  4QKS A;  3BAU A;  1TP0 A;  1V6W A;  1FV3 A;  2BEA A;  2ZQN A;  1TOO A;  2RST A;  2K4A B;  3N7L A;  4H75 A;  1S0B A;  3CA5 A;  1JT5 A;  4I4V A;  3R4S A;  1PZZ A;  3O5W B;  3VT2 A;  5F8S A;  4EEE B;  1HKN A;  2D24 A;  2HWM A;  4HR6 C;  3O3Q A;  1BAS A;  2MIB A;  2IWT B;  2X2T A;  4LO8 B;  4Z8S B;  4II0 A;  1PWA A;  4IQP A;  3T8S A;  2ET2 A;  4ISR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...