1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
3KXYT 4IWXA 3GIJA 4ED7A 5FLMG 4ED1A 1S0MA 4A93G 2DZDA 5LMUH 2ZJTA 4QJFA 1IBKH 4YJ3F 3L4JA 5KT5A 4GC6A 2VQFH 4LF8H 1ZHSA 5DG7A 4DL3A 4JI6H 1S03G 5KFPA 3GIQA 4J9OA 1RK5A 5C44G 5BPFA 5KT7A 2YW2A 3KAKA 3T5HA 4IR1A 2JA6A 1V51A 4LSXA 2C35B 2FB9A 2YZNA 3I4MG 2R8KA 4IRCA 5KT2A 4R8UA 4ZHQF 1GSAA 4UCSA 2RDJA 3MWDA 4ED6A 2R86A 1V4YA 2XCLA 4MV3A 1Y1WA 3V6JA 3RBDA 3OHBA 4J9SA 2Q2TA 3JZIA 1XNRH 4JV0A 2CKZB 3U9TA 5C1PA 3RGZA 4BBSG 4ECTA 1Y1VG 1K1SA 2W7OA 1W96A 4F4YA 2UUAH 4JI5H 3GQCA 5DLFA 5J2TF 3RAQA 5C3EG 3I12A 1JDEA 4IRKA 4O3QA 4EGJA 1E4EA 3OHAA 4UCRA 4Q0YA 1DGSA 2R8HA 4O3SA 4MV7A 3WO1A 4XZ3B 4J0MA 1S97A 4RZRA 2FE3A 4LFCH 3BABA 3PW2A 5KFSA 2E2IA 2R7ZA 4A3FG 3V4SA 3JAMW 2V4QA 5L1LA 4HQ6A 5D1PA 4GKJH 2YZGA 3K3VA 5DGAA 3Q8RB 4QIWA 3VPCA 3JSNA 1EHIA 1EUDB 1WH2A 3DF7A 3KHLA 2IBKA 3KAJA 1KJJA 2R87A 5L1KA 4R8UB 4O4HF 4GC7A 4EBDA 2YRXA 4DV1H 4DV4H 1S10A 5EOYA 3HOWG 3VPDA 5DG8A 4A3LG 3RV4A 3J7AK 3HKZA 4K0KH 4MTEA 3TINA 5T14A 2R7MA 4EFBA 5I47A 1XDNA 4YJ2F 4HNUA 3PVXA 1XMQH 4UCTA 2VQEH 5D8DA 5H80A 1JIHA 2GPSA 4R7RA 5JQWA 4TV9F 5DG9A 2ATLA 3RFCA 1ZETA 4A2BA 1JX4A 2WDTA 1E4EB 5L1JA 4RNMA 2GLTA 2YU9A 2I80A 3MR5A 3RAXA 2J6UA 2RDIA 1KJIA 2WB1A 1RK6A 5FJ8G 4ZOLF 5CAEB 4A3MG 4HNTA 2ZM6H 3N44B 2F4VH 3HB9A 4AYBA 1K1QA 4LF9H 4YB8B 5LXTF 4YR3A 4TQSA 3RB3A 3H20A 3GIDA 5JVDF 5KG5A 4QWBA 4MV9A 5BR8H 2YCHA 4CC6A 2R8IA 4DL6A 4LF7H 3JRXA 3R5FA 1IOWA 1EZ1A 1DV2A 4IWYA 4TQRA 3GIMA 1S0NA 4O3RA 4MA0A 3KHGA 4HYKA 3CQZA 2JEFA 2VUMG 4NXNH 1OWTA 4IAJA 4B3TH 4RUAA 3GV7B 4DV0H 4IRDA 2JA7A 2UXDH 2YS7A 4HNVA 5FD6A 4QWAA 3JSLA 4LH7A 2ASLA 2VUGA 5CB4F 5CA1F 1GLVA 3GTJA 1SCUB 3H40A 4DV2H 2FPGB 4WD3A 5IYCG 4RB1A 4FU0A 2DIKA 3N42B 4A3IG 2AGOA 2UVUA 2XGPA 3HOZG 4DR3H 3ETJA 3KALA 2C28A 2W71A 3T1YH 4MA5A 3C0FB 4C5AA 4E4TA 2C2RA 4I55F 1WR2A 2VR1A 4YAKB 3PO3G 1X9NA 4DR5H 1HNXH 2R92G 1TWHA 2QK4A 4LMYA 2JEJA 4L1KA 2VPQA 1HR0H 2JA5G 2R93G 2YL2A 4EFEA 5KFOA 3J80W 1KJ8A 4J9MA 3RBEA 4NLGA 1C30A 3FKIA 4F4XA 2PMZA 3QFFA 4XYMB 1GYFA 3ORQA 4QWDA 1W93A 5KFBA 4BY7G 3V6KA 4ECRA 5F9LA 4TUYF 3G8CA 1T3NA 3G6XA 4X65H 2ASJA 1K83A 2B63A 1UNNC 2R85A 5KG1A 3NGDA 1WCMA 3GTGA 5EWEA 2W8KA 3MJFA 2OH2A 5BMVF 5KG7A 4ETSA 4GLXA 1VKZA 2WYOA 4JI4H 2HVSA 4JI7H 2XIGA 4EEYA 5IWAH 2R8GA 2I87A 1KEEA 5F9NA 2W7PA 3LWBA 1SYXB 4QIWE 4YR2A 4MAMA 4YBZB 2R7NA 2JA6G 3MFIA 1JDBB 2RF4A 4J9PA 1BXRA 1RJQA 4KHPH 3H0GA 1KJ9A 1GSHA 2FJZA 2WE6A 4UFZA 3CVZA 3MWMA 4M9UA 4O3NA 2R8JA 1ULZA 2IP4A 3PZPA 1Y1WG 3HKZE 3MR6A 1DIKA 4RB2C 3H3VH 3IG0A 3N41B 3GV8B 1SEIA 3AYHB 1S9FA 4ECYA 1B6RA 3PW0A 4I7HA 4ECZA 2UXCH 2X0SA 1ZHQA 4FBTA 4UCUA 3OSPA 2V5AA 2VA2A 4M7EA 3M9OB 5DQHA 2O03A 2W9CA 2YS6A 3OSNA 1E4FT 2WB1E 2HVQA 4JI3H 3EYYA 4AYBE 2AQ4A 1N36H 3M4IA 2ASDA 4ECQA 5K2MA 4LFBH 5KFAA 2R82A 3LP8A 3TIIA 5KT3A 2NU8B 2DLNA 4RB0A 5DGBA 2J6SA 2R7ZG 4DL7A 4JYAH 1O75A 2FPIB 2NU6B 5JUMA 2ZDGA 4NXMH 4BBRG 4B3RH 1IOVA 3SE7A 4EYIB 4LF5H 5KFDA 4QWEA 2ZDHA 1T36A 1FVIA 4O4IF 1BNCA 1JLLB 5KFCA 3N6XA 3U9SA 1TWFA 1VBGA 5C1OA 3I4NG 3BQ1A 4O3PA 3PR5B 2FLPA 3R5XA 3GV5B 4LH6A 1S0OA 2CQYA 2WAQA 3RB0A 3V4ZA 1MZBA 5JVLA 2W57A 4B3SH 1JXLA 1N33H 1UC8A 2SCUB 3ORRA 4ZQIA 1RJRA 4IHJF 2FKLA 3HXLA 1N48A 2W9CB 3FMAA 2NU9B 5DLGA 3TIGA 3M9MB 3OUUA 1CS0A 3J81W 4J9NA 5IYDG 4FS2A 2PBZA 1I50A 2PN1A 5J2UF 1TAEA 4JUZA 3HOUG 2CW7A 5KFJA 3GLKA 4EG0A 5C8YF 1V9PA 4HR7A 5KFLA 1GO3E 5HBRB 5KFWA 4QW8A 4AQYH 2VA3A 2NUAB 4GKKH 1M7JA 5KG6A 4C5BA 4YY3H 3H4DA 3RIZA 2DPIA 3GTKA 2JEIA 2PMZE 2UUCH 4JI0H 1GSOA 2AU0A 3GTQA 3MWEA 3OTOH 2XC9A 4ZI7F 2W6OA 5LMNH 4O2AF 3QZ7A 5C4XG 5LP6F 4MV1A 5KFXA 4QWCA 4A3KG 3ETHA 1C3OA 4LFAH 3PW5A 4IZOA 4XX0B 3GIKA 4A3JG 5KT6A 4J9KA 1A9XA 3GILA 2Q2UA 4A3GG 4Q44A 1CQIB 1I94H 4UCOA 3FDSA 2QYZA 1KC7A 3PO2G 4PDBA 3RB4A 4DR7H 4MTDA 5CA0F 5FLXW 3RF2A 2E5LH 4ED0A 2XCAA 3H4BA 1N56A 4WBNF 4DL4A 2VUMA 4APMA 5KFTA 3BA8A 2JEGA 2JA8G 2HVRA 4ECSA 2R7LA 1GGOA 2CZGA 3TQ1A 4Q43A 4B3MH 5KFGA 2E2HA 1RYRA 2WTFA 2V59A 5C5JA 3R5HA 3PR4A 1N32H 2UU9H 2UUBH 4F50A 3JRWA 4ED8A 2AGQA 5KFMA 2UXBH 2BQ3A 3Q8QB 2OWOA 5KFUA 3E5NA 1Y14B 5L1IA 1SFOA 4DR6H 1Z2NX 3RTXA 3MR3A 4EBCA 2B63G 1DV1A 5LL6b 2HJWA 3BQ0A 2W9AA 1WCMG 4X64H 4DR4H 5KG4A 1B33N 3N8DA 1T94A 2JA5A 2R7KA 3UQ8A 5KT4A 1CE8A 3GTPA 1R9TA 2Y0SA 1EUCB 4YR0A 1Z2OX 5IP9G 2W6NA 5FD5A 5BPHA 2C2EA 4JI1H 2NVYA 4LF6H 3F8NA 3GIIA 3T5JA 4A3CG 4DR1H 5D1OA 4O3OA 5EZYF 3K5HA 4DV5H 2FLLA 3M9NB 1VAJA 5LYJF 3H0GG 4J9RA 3UFXB 1I7NA 4F4WA 2XGQA 3BAAA 4FBUA 3T5LA 5KFZA 2VOBA 4RB3C 2W9BA 1M0TA 4ECUA 4OX9H 2RGVA 1B6SA 2WAQE 3IN5A 2FK1A 3T1HH 3Q2OA 3MFHA 2UVWA 4TV8F 3RJ0A 3GTMA 4RAZA 3N43B 2J9GA 3LMLA 4XYLB 2W8LA 2W6MA 2DPJA 4LF4H 4DLKA 4Q8EA 1FJGH 4LSAA 5L9XA 1TWGA 4BWSC 1I7LA 3KHHA 5KFFA 4C2MA 4JI2H 2CW8A 4I4TF 4DV6H 5LA6F 5KFVA 1N34H 5IP7G 3PN1A 4YAJB 5DQIA 1UC9A 4X62H 1FKAH 2UVVA 1I6UA 4A3DG 3HOYG 1J5EH 4YQWA 4FS1A 1Y1VA 5D1OB 5KFHA 4EGQA 2ALZA 2MCTA 1M0WA 5EDWA 1AUVA 4F4ZA 4A3BG 3SI8A 3KHRA 4J9QA 3L2PA 3BG5A 1TA8A 5DQGA 4QW9A 2W9BB 3Q1KA 5KFNA 4ED2A 4ED3A 2V9WA 2P0AA 4UCVA 4A2AA 1XMOH 3RUPA 4U6PA 4Q45A 4PWQA 4G3IA 1RYSA 2I8CA 3VMMA 3EPGA 4C5CA 2J6TA 2HHHH 3HBLA 5IYZF 1E4GT 3PW7A 4X66H 4MV4A 2YYAA 3VPBA 1TWAA 4I50F 2UVRA 1KJQA 4Q8FA 3G6YA 3GTOA 2FK3A 4RZQA 3K5IA 5FPOA 5A2QW 1VBHA 4DL5A 4CC5A 4DR2H 4J9LA 1B04A 1CQJB 2ZDQA 4IR9A 2M05A 2W6PA 5KG2A 5EWGA 2XD4A 4ECVA 4JI8H 2FP4B 4MV6A 1I3QA 3L4KA 1VS0A 4YHHH 1Z2PX 2C00A 4U7CA 2IA6A 2BQUA 1L2ZA 2V4RA 2FMAA 5KG3A 3GIPA 4RAYA 5JH7F 2XCPA 3RV3A 5KKNB 3EPIA 3RB6A 1ZQ7A 2R84A 3GTLA 5IYBG 4JV5H 3V6HA 2FLNA 4DUZH 5KFQA 2AGPA 3Q8SB 1PX2A 4A3EG 2W70A 2JA7G 3RGXA 2PVPA 4BXXG 2IMWP 4JV2A 3BA9A 4ME6A 3WNZA 5FPRA 4DV3H 2C2DA 2RGRA 4FM9A 1EYZA 1KBLA 4O4LF 5LOVF 4MV8A 1M6VA 2Y0SE 2V58A 5GONF 3WO0A 5KFKA 3T5KA 5IT9W 3HOVG 3K3PA 5KFEA 4EBEA 3PW4A 2W6ZA 5KFYA 2C22A 3G6VA 2DWCA 4RNNA 3HOXG 4EYHB 1BJTA 4DV7H 1A0IA 2OLSA 4DL2A 3QZ8A 1IBMH 1S68A 1HNWH 1XNQH 1PK8A 3KTMA 1HNZH 3FKIG 3N40P 5HV6A 2FPPB 1TWCA 4EEQA 1AN7A 4DUYH 3TQTA 3MR2A 4ECWA 5KX5F 2BQRA 4YP3A 2VQDA 3BJYA 1RJPA 4RNOA 4ECXA 3BQ2A 4RU9A 1WSCA 2NU7B 2YZMA 1IBLH 2NVXA 4RUCA 2R92A 2GPWA 5KFIA 2R93A 2R6FA 2W6QA 4JV1A 2HGSA 3R23A 4Y8VB 5KG0A 3OUZA 1JKJB 2BR0A 2KSWA 5EWFA 1BGWA 2YRWA 5KFRA 4O2BF 1P8LA 4BY1G 2FK2A 2VPSA 3Q8PB 1AUXA
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 3KXY T;  4IWX A;  3GIJ A;  4ED7 A;  5FLM G;  4ED1 A;  1S0M A;  4A93 G;  2DZD A;  5LMU H;  2ZJT A;  4QJF A;  1IBK H;  4YJ3 F;  3L4J A;  5KT5 A;  4GC6 A;  2VQF H;  4LF8 H;  1ZHS A;  5DG7 A;  4DL3 A;  4JI6 H;  1S03 G;  5KFP A;  3GIQ A;  4J9O A;  1RK5 A;  5C44 G;  5BPF A;  5KT7 A;  2YW2 A;  3KAK A;  3T5H A;  4IR1 A;  2JA6 A;  1V51 A;  4LSX A;  2C35 B;  2FB9 A;  2YZN A;  3I4M G;  2R8K A;  4IRC A;  5KT2 A;  4R8U A;  4ZHQ F;  1GSA A;  4UCS A;  2RDJ A;  3MWD A;  4ED6 A;  2R86 A;  1V4Y A;  2XCL A;  4MV3 A;  1Y1W A;  3V6J A;  3RBD A;  3OHB A;  4J9S A;  2Q2T A;  3JZI A;  1XNR H;  4JV0 A;  2CKZ B;  3U9T A;  5C1P A;  3RGZ A;  4BBS G;  4ECT A;  1Y1V G;  1K1S A;  2W7O A;  1W96 A;  4F4Y A;  2UUA H;  4JI5 H;  3GQC A;  5DLF A;  5J2T F;  3RAQ A;  5C3E G;  3I12 A;  1JDE A;  4IRK A;  4O3Q A;  4EGJ A;  1E4E A;  3OHA A;  4UCR A;  4Q0Y A;  1DGS A;  2R8H A;  4O3S A;  4MV7 A;  3WO1 A;  4XZ3 B;  4J0M A;  1S97 A;  4RZR A;  2FE3 A;  4LFC H;  3BAB A;  3PW2 A;  5KFS A;  2E2I A;  2R7Z A;  4A3F G;  3V4S A;  3JAM W;  2V4Q A;  5L1L A;  4HQ6 A;  5D1P A;  4GKJ H;  2YZG A;  3K3V A;  5DGA A;  3Q8R B;  4QIW A;  3VPC A;  3JSN A;  1EHI A;  1EUD B;  1WH2 A;  3DF7 A;  3KHL A;  2IBK A;  3KAJ A;  1KJJ A;  2R87 A;  5L1K A;  4R8U B;  4O4H F;  4GC7 A;  4EBD A;  2YRX A;  4DV1 H;  4DV4 H;  1S10 A;  5EOY A;  3HOW G;  3VPD A;  5DG8 A;  4A3L G;  3RV4 A;  3J7A K;  3HKZ A;  4K0K H;  4MTE A;  3TIN A;  5T14 A;  2R7M A;  4EFB A;  5I47 A;  1XDN A;  4YJ2 F;  4HNU A;  3PVX A;  1XMQ H;  4UCT A;  2VQE H;  5D8D A;  5H80 A;  1JIH A;  2GPS A;  4R7R A;  5JQW A;  4TV9 F;  5DG9 A;  2ATL A;  3RFC A;  1ZET A;  4A2B A;  1JX4 A;  2WDT A;  1E4E B;  5L1J A;  4RNM A;  2GLT A;  2YU9 A;  2I80 A;  3MR5 A;  3RAX A;  2J6U A;  2RDI A;  1KJI A;  2WB1 A;  1RK6 A;  5FJ8 G;  4ZOL F;  5CAE B;  4A3M G;  4HNT A;  2ZM6 H;  3N44 B;  2F4V H;  3HB9 A;  4AYB A;  1K1Q A;  4LF9 H;  4YB8 B;  5LXT F;  4YR3 A;  4TQS A;  3RB3 A;  3H20 A;  3GID A;  5JVD F;  5KG5 A;  4QWB A;  4MV9 A;  5BR8 H;  2YCH A;  4CC6 A;  2R8I A;  4DL6 A;  4LF7 H;  3JRX A;  3R5F A;  1IOW A;  1EZ1 A;  1DV2 A;  4IWY A;  4TQR A;  3GIM A;  1S0N A;  4O3R A;  4MA0 A;  3KHG A;  4HYK A;  3CQZ A;  2JEF A;  2VUM G;  4NXN H;  1OWT A;  4IAJ A;  4B3T H;  4RUA A;  3GV7 B;  4DV0 H;  4IRD A;  2JA7 A;  2UXD H;  2YS7 A;  4HNV A;  5FD6 A;  4QWA A;  3JSL A;  4LH7 A;  2ASL A;  2VUG A;  5CB4 F;  5CA1 F;  1GLV A;  3GTJ A;  1SCU B;  3H40 A;  4DV2 H;  2FPG B;  4WD3 A;  5IYC G;  4RB1 A;  4FU0 A;  2DIK A;  3N42 B;  4A3I G;  2AGO A;  2UVU A;  2XGP A;  3HOZ G;  4DR3 H;  3ETJ A;  3KAL A;  2C28 A;  2W71 A;  3T1Y H;  4MA5 A;  3C0F B;  4C5A A;  4E4T A;  2C2R A;  4I55 F;  1WR2 A;  2VR1 A;  4YAK B;  3PO3 G;  1X9N A;  4DR5 H;  1HNX H;  2R92 G;  1TWH A;  2QK4 A;  4LMY A;  2JEJ A;  4L1K A;  2VPQ A;  1HR0 H;  2JA5 G;  2R93 G;  2YL2 A;  4EFE A;  5KFO A;  3J80 W;  1KJ8 A;  4J9M A;  3RBE A;  4NLG A;  1C30 A;  3FKI A;  4F4X A;  2PMZ A;  3QFF A;  4XYM B;  1GYF A;  3ORQ A;  4QWD A;  1W93 A;  5KFB A;  4BY7 G;  3V6K A;  4ECR A;  5F9L A;  4TUY F;  3G8C A;  1T3N A;  3G6X A;  4X65 H;  2ASJ A;  1K83 A;  2B63 A;  1UNN C;  2R85 A;  5KG1 A;  3NGD A;  1WCM A;  3GTG A;  5EWE A;  2W8K A;  3MJF A;  2OH2 A;  5BMV F;  5KG7 A;  4ETS A;  4GLX A;  1VKZ A;  2WYO A;  4JI4 H;  2HVS A;  4JI7 H;  2XIG A;  4EEY A;  5IWA H;  2R8G A;  2I87 A;  1KEE A;  5F9N A;  2W7P A;  3LWB A;  1SYX B;  4QIW E;  4YR2 A;  4MAM A;  4YBZ B;  2R7N A;  2JA6 G;  3MFI A;  1JDB B;  2RF4 A;  4J9P A;  1BXR A;  1RJQ A;  4KHP H;  3H0G A;  1KJ9 A;  1GSH A;  2FJZ A;  2WE6 A;  4UFZ A;  3CVZ A;  3MWM A;  4M9U A;  4O3N A;  2R8J A;  1ULZ A;  2IP4 A;  3PZP A;  1Y1W G;  3HKZ E;  3MR6 A;  1DIK A;  4RB2 C;  3H3V H;  3IG0 A;  3N41 B;  3GV8 B;  1SEI A;  3AYH B;  1S9F A;  4ECY A;  1B6R A;  3PW0 A;  4I7H A;  4ECZ A;  2UXC H;  2X0S A;  1ZHQ A;  4FBT A;  4UCU A;  3OSP A;  2V5A A;  2VA2 A;  4M7E A;  3M9O B;  5DQH A;  2O03 A;  2W9C A;  2YS6 A;  3OSN A;  1E4F T;  2WB1 E;  2HVQ A;  4JI3 H;  3EYY A;  4AYB E;  2AQ4 A;  1N36 H;  3M4I A;  2ASD A;  4ECQ A;  5K2M A;  4LFB H;  5KFA A;  2R82 A;  3LP8 A;  3TII A;  5KT3 A;  2NU8 B;  2DLN A;  4RB0 A;  5DGB A;  2J6S A;  2R7Z G;  4DL7 A;  4JYA H;  1O75 A;  2FPI B;  2NU6 B;  5JUM A;  2ZDG A;  4NXM H;  4BBR G;  4B3R H;  1IOV A;  3SE7 A;  4EYI B;  4LF5 H;  5KFD A;  4QWE A;  2ZDH A;  1T36 A;  1FVI A;  4O4I F;  1BNC A;  1JLL B;  5KFC A;  3N6X A;  3U9S A;  1TWF A;  1VBG A;  5C1O A;  3I4N G;  3BQ1 A;  4O3P A;  3PR5 B;  2FLP A;  3R5X A;  3GV5 B;  4LH6 A;  1S0O A;  2CQY A;  2WAQ A;  3RB0 A;  3V4Z A;  1MZB A;  5JVL A;  2W57 A;  4B3S H;  1JXL A;  1N33 H;  1UC8 A;  2SCU B;  3ORR A;  4ZQI A;  1RJR A;  4IHJ F;  2FKL A;  3HXL A;  1N48 A;  2W9C B;  3FMA A;  2NU9 B;  5DLG A;  3TIG A;  3M9M B;  3OUU A;  1CS0 A;  3J81 W;  4J9N A;  5IYD G;  4FS2 A;  2PBZ A;  1I50 A;  2PN1 A;  5J2U F;  1TAE A;  4JUZ A;  3HOU G;  2CW7 A;  5KFJ A;  3GLK A;  4EG0 A;  5C8Y F;  1V9P A;  4HR7 A;  5KFL A;  1GO3 E;  5HBR B;  5KFW A;  4QW8 A;  4AQY H;  2VA3 A;  2NUA B;  4GKK H;  1M7J A;  5KG6 A;  4C5B A;  4YY3 H;  3H4D A;  3RIZ A;  2DPI A;  3GTK A;  2JEI A;  2PMZ E;  2UUC H;  4JI0 H;  1GSO A;  2AU0 A;  3GTQ A;  3MWE A;  3OTO H;  2XC9 A;  4ZI7 F;  2W6O A;  5LMN H;  4O2A F;  3QZ7 A;  5C4X G;  5LP6 F;  4MV1 A;  5KFX A;  4QWC A;  4A3K G;  3ETH A;  1C3O A;  4LFA H;  3PW5 A;  4IZO A;  4XX0 B;  3GIK A;  4A3J G;  5KT6 A;  4J9K A;  1A9X A;  3GIL A;  2Q2U A;  4A3G G;  4Q44 A;  1CQI B;  1I94 H;  4UCO A;  3FDS A;  2QYZ A;  1KC7 A;  3PO2 G;  4PDB A;  3RB4 A;  4DR7 H;  4MTD A;  5CA0 F;  5FLX W;  3RF2 A;  2E5L H;  4ED0 A;  2XCA A;  3H4B A;  1N56 A;  4WBN F;  4DL4 A;  2VUM A;  4APM A;  5KFT A;  3BA8 A;  2JEG A;  2JA8 G;  2HVR A;  4ECS A;  2R7L A;  1GGO A;  2CZG A;  3TQ1 A;  4Q43 A;  4B3M H;  5KFG A;  2E2H A;  1RYR A;  2WTF A;  2V59 A;  5C5J A;  3R5H A;  3PR4 A;  1N32 H;  2UU9 H;  2UUB H;  4F50 A;  3JRW A;  4ED8 A;  2AGQ A;  5KFM A;  2UXB H;  2BQ3 A;  3Q8Q B;  2OWO A;  5KFU A;  3E5N A;  1Y14 B;  5L1I A;  1SFO A;  4DR6 H;  1Z2N X;  3RTX A;  3MR3 A;  4EBC A;  2B63 G;  1DV1 A;  5LL6 b;  2HJW A;  3BQ0 A;  2W9A A;  1WCM G;  4X64 H;  4DR4 H;  5KG4 A;  1B33 N;  3N8D A;  1T94 A;  2JA5 A;  2R7K A;  3UQ8 A;  5KT4 A;  1CE8 A;  3GTP A;  1R9T A;  2Y0S A;  1EUC B;  4YR0 A;  1Z2O X;  5IP9 G;  2W6N A;  5FD5 A;  5BPH A;  2C2E A;  4JI1 H;  2NVY A;  4LF6 H;  3F8N A;  3GII A;  3T5J A;  4A3C G;  4DR1 H;  5D1O A;  4O3O A;  5EZY F;  3K5H A;  4DV5 H;  2FLL A;  3M9N B;  1VAJ A;  5LYJ F;  3H0G G;  4J9R A;  3UFX B;  1I7N A;  4F4W A;  2XGQ A;  3BAA A;  4FBU A;  3T5L A;  5KFZ A;  2VOB A;  4RB3 C;  2W9B A;  1M0T A;  4ECU A;  4OX9 H;  2RGV A;  1B6S A;  2WAQ E;  3IN5 A;  2FK1 A;  3T1H H;  3Q2O A;  3MFH A;  2UVW A;  4TV8 F;  3RJ0 A;  3GTM A;  4RAZ A;  3N43 B;  2J9G A;  3LML A;  4XYL B;  2W8L A;  2W6M A;  2DPJ A;  4LF4 H;  4DLK A;  4Q8E A;  1FJG H;  4LSA A;  5L9X A;  1TWG A;  4BWS C;  1I7L A;  3KHH A;  5KFF A;  4C2M A;  4JI2 H;  2CW8 A;  4I4T F;  4DV6 H;  5LA6 F;  5KFV A;  1N34 H;  5IP7 G;  3PN1 A;  4YAJ B;  5DQI A;  1UC9 A;  4X62 H;  1FKA H;  2UVV A;  1I6U A;  4A3D G;  3HOY G;  1J5E H;  4YQW A;  4FS1 A;  1Y1V A;  5D1O B;  5KFH A;  4EGQ A;  2ALZ A;  2MCT A;  1M0W A;  5EDW A;  1AUV A;  4F4Z A;  4A3B G;  3SI8 A;  3KHR A;  4J9Q A;  3L2P A;  3BG5 A;  1TA8 A;  5DQG A;  4QW9 A;  2W9B B;  3Q1K A;  5KFN A;  4ED2 A;  4ED3 A;  2V9W A;  2P0A A;  4UCV A;  4A2A A;  1XMO H;  3RUP A;  4U6P A;  4Q45 A;  4PWQ A;  4G3I A;  1RYS A;  2I8C A;  3VMM A;  3EPG A;  4C5C A;  2J6T A;  2HHH H;  3HBL A;  5IYZ F;  1E4G T;  3PW7 A;  4X66 H;  4MV4 A;  2YYA A;  3VPB A;  1TWA A;  4I50 F;  2UVR A;  1KJQ A;  4Q8F A;  3G6Y A;  3GTO A;  2FK3 A;  4RZQ A;  3K5I A;  5FPO A;  5A2Q W;  1VBH A;  4DL5 A;  4CC5 A;  4DR2 H;  4J9L A;  1B04 A;  1CQJ B;  2ZDQ A;  4IR9 A;  2M05 A;  2W6P A;  5KG2 A;  5EWG A;  2XD4 A;  4ECV A;  4JI8 H;  2FP4 B;  4MV6 A;  1I3Q A;  3L4K A;  1VS0 A;  4YHH H;  1Z2P X;  2C00 A;  4U7C A;  2IA6 A;  2BQU A;  1L2Z A;  2V4R A;  2FMA A;  5KG3 A;  3GIP A;  4RAY A;  5JH7 F;  2XCP A;  3RV3 A;  5KKN B;  3EPI A;  3RB6 A;  1ZQ7 A;  2R84 A;  3GTL A;  5IYB G;  4JV5 H;  3V6H A;  2FLN A;  4DUZ H;  5KFQ A;  2AGP A;  3Q8S B;  1PX2 A;  4A3E G;  2W70 A;  2JA7 G;  3RGX A;  2PVP A;  4BXX G;  2IMW P;  4JV2 A;  3BA9 A;  4ME6 A;  3WNZ A;  5FPR A;  4DV3 H;  2C2D A;  2RGR A;  4FM9 A;  1EYZ A;  1KBL A;  4O4L F;  5LOV F;  4MV8 A;  1M6V A;  2Y0S E;  2V58 A;  5GON F;  3WO0 A;  5KFK A;  3T5K A;  5IT9 W;  3HOV G;  3K3P A;  5KFE A;  4EBE A;  3PW4 A;  2W6Z A;  5KFY A;  2C22 A;  3G6V A;  2DWC A;  4RNN A;  3HOX G;  4EYH B;  1BJT A;  4DV7 H;  1A0I A;  2OLS A;  4DL2 A;  3QZ8 A;  1IBM H;  1S68 A;  1HNW H;  1XNQ H;  1PK8 A;  3KTM A;  1HNZ H;  3FKI G;  3N40 P;  5HV6 A;  2FPP B;  1TWC A;  4EEQ A;  1AN7 A;  4DUY H;  3TQT A;  3MR2 A;  4ECW A;  5KX5 F;  2BQR A;  4YP3 A;  2VQD A;  3BJY A;  1RJP A;  4RNO A;  4ECX A;  3BQ2 A;  4RU9 A;  1WSC A;  2NU7 B;  2YZM A;  1IBL H;  2NVX A;  4RUC A;  2R92 A;  2GPW A;  5KFI A;  2R93 A;  2R6F A;  2W6Q A;  4JV1 A;  2HGS A;  3R23 A;  4Y8V B;  5KG0 A;  3OUZ A;  1JKJ B;  2BR0 A;  2KSW A;  5EWF A;  1BGW A;  2YRW A;  5KFR A;  4O2B F;  1P8L A;  4BY1 G;  2FK2 A;  2VPS A;  3Q8P B;  1AUX A; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...