1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
1JDBB 5KFLA 4ED3A 1WCMA 2W9AA 2W7PA 2R6FA 1S03G 3HOYG 2M05A 1I3QA 3QZ7A 1XDNA 5JH7F 4HNTA 5KFYA 3MR5A 2FMAA 3KHLA 4MV9A 1TA8A 4R8UA 2UVWA 2VQFH 4QJFA 1B6RA 2BR0A 2RDIA 4MTDA 2YW2A 3EPIA 1E4EB 2UVVA 4JI1H 4DV6H 4LFAH 3OHAA 4YHHH 4A3CG 4J9NA 1I7LA 1OWTA 3RGXA 1FJGH 5EDWA 5BPFA 1VS0A 2FPIB 3K3PA 5CAEB 5C1OA 5FJ8G 4HYKA 1WR2A 5C8YF 2JA5G 2J9GA 2NVXA 4DL3A 4TV9F 4Q8FA 4GKKH 3OSNA 3EPGA 1S0OA 1I94H 4JI6H 4JV0A 4IHJF 3K3VA 4KHPH 3RUPA 1Y1WG 1BGWA 3N40P 3T1HH 4ED8A 1K83A 4NXMH 4LH7A 5EOYA 4J9QA 3GTOA 3MJFA 4C2MA 4XYMB 5J2UF 2VPSA 1TWGA 4JI0H 4A3BG 1JKJB 1FVIA 5IYCG 5C3EG 4FBUA 3RBDA 5L9XA 4ED0A 4L1KA 1TWCA 2QYZA 2UUBH 3JRWA 3JRXA 2YRXA 3G6VA 1T94A 4R7RA 3PW2A 4CC5A 5DG9A 4LSAA 3RTXA 2FK2A 1BXRA 4IWYA 1IOVA 3V6KA 4YBZB 2NUAB 2W57A 5LP6F 1GSOA 5KFQA 5KT4A 5LMUH 4A3GG 3RB3A 1KBLA 2FE3A 2XIGA 2YCHA 3E5NA 2NU9B 4QWAA 1N34H 2OH2A 4HQ6A 3L4KA 4I4TF 3GV8B 2IA6A 3VPBA 5KG3A 2HHHH 5IWAH 2FP4B 2JA8G 1GYFA 1TWFA 3PW7A 3BJYA 3IN5A 3MFIA 3TINA 1HNZH 2RGRA 3KAKA 2WTFA 3SI8A 2DZDA 4NXNH 5KFOA 4ZHQF 2YL2A 4U7CA 2WB1E 4DV4H 4XX0B 2IMWP 1M0TA 3V4ZA 4A2AA 2R7LA 4DR3H 4JI5H 1M6VA 2RGVA 3CQZA 4ME6A 4JV1A 4B3RH 3LP8A 2JA7A 2AU0A 2W9BB 5KFVA 1FKAH 4B3MH 4UCTA 4BXXG 3UFXB 4YR3A 5LMNH 2FPPB 4TUYF 1KC7A 4GLXA 2PN1A 5LOVF 4EBCA 1TWHA 2CKZB 1I50A 3Q1KA 4X62H 3H0GA 5LYJF 3UQ8A 4JV2A 4JV5H 2GLTA 4FU0A 5FPOA 2C22A 2R8GA 2W6NA 1XMQH 3H3VH 3GQCA 4ED7A 4DV5H 3I4NG 4C5CA 1TAEA 1DV2A 2Y0SA 2FK1A 4O4HF 2FKLA 5FD6A 4C5BA 5C44G 2XC9A 5DLFA 3PW5A 4EFEA 4IWXA 1EZ1A 5KFNA 1A9XA 4J9LA 2B63G 3SE7A 5KT3A 2JEGA 3OTOH 3L4JA 1UNNC 2FJZA 1N36H 5KG6A 2ZDGA 4UCSA 3HKZA 2W9CA 1R9TA 4QWEA 4F50A 4ECUA 1KJIA 3KHGA 3GIDA 4ECXA 2NU8B 3K5HA 4TQRA 1RJQA 4EYHB 4ECWA 5BMVF 5FPRA 2C2EA 1S68A 2FB9A 4Y8VB 4APMA 4O2AF 4PWQA 1EHIA 5DG8A 1S9FA 1ZHSA 3FMAA 3DF7A 1KJJA 2VA2A 4J9OA 1C3OA 3H0GG 4DUZH 2V5AA 1BJTA 3M9MB 3GIJA 1KJ8A 5GONF 5FLXW 5DQHA 2R86A 4MV6A 1EUDB 5IYZF 4O3NA 1Y14B 4DR1H 5HV6A 4ECSA 3HOUG 5D8DA 1RYRA 1WSCA 4GC6A 1W93A 4FS1A 3PVXA 1BNCA 4K0KH 2ASLA 2YZMA 3RJ0A 4GKJH 3BQ1A 3JSLA 2ASDA 5F9NA 4DV3H 3TQ1A 1IBMH 3GIPA 4IRCA 4BY7G 5KFUA 2P0AA 2CW7A 4ECZA 1IBKH 1L2ZA 1PK8A 2XCAA 3GIIA 4IRDA 2VPQA 4LF6H 4ECRA 2DIKA 2PMZA 4YR0A 3LMLA 1ZETA 3Q8QB 5D1OB 4Q43A 3G8CA 4IZOA 2VR1A 2I87A 2RDJA 2YRWA 3BA9A 4HNUA 2BQUA 2W7OA 2ZJTA 3KHHA 2R7NA 4DL2A 3PO3G 1HR0H 3OUZA 5KFFA 4LF7H 4JYAH 5KFPA 3FKIA 1CQIB 1RJRA 4RB2C 2JEJA 4AYBE 2W6MA 4MA0A 4ZOLF 5CA1F 2UXDH 2GPSA 5C4XG 5L1IA 2E2HA 3RFCA 5KFWA 2FLNA 2R82A 3VPDA 3N6XA 3GTMA 2SCUB 4RB0A 2NU7B 5KFIA 1K1QA 5C5JA 2UU9H 2WYOA 5H80A 4M7EA 2R93A 5IYDG 2JEFA 4LSXA 4IRKA 1UC9A 4A3LG 5L1JA 1B6SA 4QW8A 4RUAA 3BABA 3WO0A 5KFJA 4M9UA 1XNQH 4RZRA 1CQJB 1VAJA 2O03A 4F4ZA 2HVSA 2OLSA 3N43B 2PMZE 4RB3C 4LF9H 4WBNF 2AGPA 1CE8A 4HR7A 5JUMA 2MCTA 2V58A 1P8LA 2NU6B 1Y1WA 4F4YA 3RB6A 2R85A 3H40A 4PDBA 2BQRA 5KKNB 4ECTA 1S97A 4X65H 2E2IA 2IP4A 2WB1A 3K5IA 1Y1VA 4F4XA 1JIHA 2JA6G 1M7JA 4A2BA 4EG0A 2E5LH 3RIZA 4IAJA 4LF4H 2J6UA 2YZNA 1DGSA 1EYZA 1JXLA 4TQSA 3HOWG 2QK4A 4MA5A 4DL7A 1A0IA 4AYBA 4IR9A 3KHRA 2DLNA 4ECQA 3RBEA 3T5JA 4Q44A 4U6PA 5HBRB 5LXTF 5KFDA 3HBLA 2JEIA 2R84A 3N8DA 5EWEA 4F4WA 2W9BA 1MZBA 1KEEA 1X9NA 1N33H 4O3RA 4A3KG 4YP3A 5BPHA 3AYHB 5JQWA 2UUCH 4WD3A 3BQ2A 4ED6A 4UFZA 3T5HA 1TWAA 3GTGA 2WDTA 3WNZA 4J9KA 1S0MA 5KFRA 2ZDQA 1SCUB 5KG5A 4DV0H 4DLKA 3G6YA 5KT5A 4ECYA 2XGQA 5KFGA 1J5EH 3MR2A 1B04A 3MR3A 3KALA 3TQTA 4CC6A 3H20A 5A2QW 3RB0A 4DR2H 2R7ZA 2R7ZG 2UXCH 4DL5A 3U9SA 4UCVA 4O3SA 5EZYF 4EGQA 3BA8A 5D1PA 4EGJA 5BR8H 4Q8EA 5KG7A 2JA7G 2WE6A 4R8UB 4O4IF 4RAZA 4TV8F 3PO2G 5IT9W 2PVPA 1E4EA 4NLGA 3N44B 5LA6F 4A3IG 2DPJA 4J9MA 2C28A 3MWMA 3RF2A 1GLVA 1I6UA 2RF4A 1IBLH 4OX9H 5FD5A 1V9PA 2R93G 4BBRG 2R7MA 3V6HA 4A3FG 5IYBG 5C1PA 1C30A 4GC7A 5DLGA 5T14A 3J81W 3GV7B 2VA3A 4JI7H 4AQYH 3MWEA 4JI8H 4LH6A 1WCMG 3Q8SB 2X0SA 1N32H 2DWCA 2W6ZA 2J6TA 4ED1A 4UCRA 2VQDA 4RB1A 3M4IA 4RNNA 3J7AK 2R92A 5KT2A 1JDEA 4I7HA 4O3QA 3ORQA 4Q0YA 4JUZA 3T1YH 2I8CA 3GIKA 2JA6A 2C00A 4EEQA 1W96A 2YZGA 3PN1A 2FLPA 3V4SA 1XNRH 1RJPA 2C35B 4E4TA 1K1SA 4YR2A 2W6OA 3ORRA 4JI2H 3R5HA 5KFKA 3C0FB 4LMYA 3JAMW 1O75A 2Q2TA 5KT7A 1IOWA 3IG0A 3R23A 5KFEA 5KT6A 4ECVA 2HJWA 1T3NA 1AUXA 2W70A 5IP7G 2AGQA 4C5AA 2UVRA 4J0MA 2HVRA 2CQYA 3Q2OA 3PW0A 5KFSA 4MV4A 3H4DA 3L2PA 2XGPA 3RAXA 2FLLA 3HOXG 3OHBA 2JA5A 4A3DG 3M9NB 2W6QA 4HNVA 3GTPA 4J9RA 1WH2A 4RNMA 4G3IA 4MAMA 4DL6A 3T5LA 3F8NA 2AQ4A 5KG0A 4DL4A 2R8KA 3WO1A 5I47A 3GLKA 5FLMG 4ZI7F 2Q2UA 3HXLA 2WAQA 3G6XA 3HKZE 4DR4H 2R87A 3N41B 5KFHA 1Z2PX 3GTLA 3PW4A 3H4BA 1DV1A 3ETHA 4EYIB 3JSNA 2ZM6H 1VBHA 2R7KA 5LL6b 3RAQA 3RB4A 3KTMA 5CA0F 3I12A 2OWOA 3MWDA 3BQ0A 1SEIA 4FS2A 4YAJB 4QW9A 4UCUA 5DGBA 2Y0SE 4O3OA 3Q8RB 4DR5H 4O3PA 4QWBA 1T36A 1XMOH 2VUMA 3T5KA 3GTKA 4QIWE 4X64H 2R8JA 1ULZA 3VPCA 2B63A 4RUCA 3MFHA 2YYAA 3HOVG 3V6JA 1E4FT 3RV4A 3TIIA 1GGOA 3QFFA 2W8LA 2BQ3A 3TIGA 2F4VH 4BBSG 1I7NA 4YAKB 3OUUA 3PZPA 2V9WA 1N48A 4XZ3B 1GSHA 2HGSA 4I55F 3PR4A 4J9PA 1ZQ7A 4X66H 4IR1A 2WAQE 2DPIA 3GV5B 2FPGB 4MV3A 5D1OA 4DV1H 3FDSA 4JI4H 5JVLA 3EYYA 4YY3H 2ALZA 3CVZA 4DR7H 2YS6A 4LFCH 2W8KA 1UC8A 1RYSA 4LFBH 3PR5B 4FBTA 1N56A 5KG4A 3BG5A 2FK3A 2V4RA 5KFTA 4ED2A 3GTJA 1HNWH 2ATLA 5KFAA 4UCOA 3BAAA 1VKZA 2W71A 4EEYA 4BY1G 2ZDHA 1GO3E 3KXYT 2I80A 4QIWA 4YQWA 4O2BF 2VQEH 2V59A 1S10A 2NVYA 4B3TH 4RNOA 4ETSA 4EBDA 2CZGA 2VUGA 5KFMA 2YS7A 3VMMA 1M0WA 3MR6A 1S0NA 4BWSC 5CB4F 2VOBA 4MV1A 5KFZA 2W6PA 5DQGA 2AGOA 3GIMA 4A3MG 3HB9A 1KJQA 4Q45A 4MTEA 5KFCA 5DG7A 4A3EG 5L1KA 3N42B 4QWDA 3RGZA 1V51A 1EUCB 5KG2A 4A93G 5DQIA 3GIQA 4FM9A 2GPWA 4RZQA 1Y1VG 3M9OB 1RK6A 4ZQIA 2HVQA 1VBGA 5JVDF 4DUYH 5EWFA 2XD4A 3U9TA 5DGAA 2J6SA 1JLLB 1E4GT 4MV8A 3NGDA 3QZ8A 4DV7H 1PX2A 5K2MA 3JZIA 4RAYA 2W9CB 2C2RA 1HNXH 3GILA 3I4MG 3GTQA 2PBZA 2R8IA 3R5XA 2R92G 1DIKA 1AUVA 5KFXA 5KG1A 3J80W 2UUAH 4B3SH 1V4YA 5KFBA 2XCLA 5EWGA 4QWCA 3KAJA 2V4QA 1ZHQA 4RU9A 4YJ2F 5KX5F 1SFOA 4JI3H 2ASJA 3ETJA 1JX4A 4LF5H 1Z2NX 1RK5A 3FKIG 4YJ3F 5F9LA 2R8HA 2IBKA 4I50F 4XYLB 5IP9G 4A3JG 3LWBA 4O4LF 2XCPA 4DV2H 4EBEA 1KJ9A 3RV3A 1SYXB 4DR6H 2YU9A 3HOZG 5L1LA 2KSWA 4YB8B 1CS0A 1AN7A 3OSPA 1Z2OX 4J9SA 1GSAA 2UVUA 2VUMG 4LF8H 4MV7A 1B33N 3R5FA 2C2DA 3Q8PB 2CW8A 2UXBH 5J2TF 4EFBA
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 1JDB B;  5KFL A;  4ED3 A;  1WCM A;  2W9A A;  2W7P A;  2R6F A;  1S03 G;  3HOY G;  2M05 A;  1I3Q A;  3QZ7 A;  1XDN A;  5JH7 F;  4HNT A;  5KFY A;  3MR5 A;  2FMA A;  3KHL A;  4MV9 A;  1TA8 A;  4R8U A;  2UVW A;  2VQF H;  4QJF A;  1B6R A;  2BR0 A;  2RDI A;  4MTD A;  2YW2 A;  3EPI A;  1E4E B;  2UVV A;  4JI1 H;  4DV6 H;  4LFA H;  3OHA A;  4YHH H;  4A3C G;  4J9N A;  1I7L A;  1OWT A;  3RGX A;  1FJG H;  5EDW A;  5BPF A;  1VS0 A;  2FPI B;  3K3P A;  5CAE B;  5C1O A;  5FJ8 G;  4HYK A;  1WR2 A;  5C8Y F;  2JA5 G;  2J9G A;  2NVX A;  4DL3 A;  4TV9 F;  4Q8F A;  4GKK H;  3OSN A;  3EPG A;  1S0O A;  1I94 H;  4JI6 H;  4JV0 A;  4IHJ F;  3K3V A;  4KHP H;  3RUP A;  1Y1W G;  1BGW A;  3N40 P;  3T1H H;  4ED8 A;  1K83 A;  4NXM H;  4LH7 A;  5EOY A;  4J9Q A;  3GTO A;  3MJF A;  4C2M A;  4XYM B;  5J2U F;  2VPS A;  1TWG A;  4JI0 H;  4A3B G;  1JKJ B;  1FVI A;  5IYC G;  5C3E G;  4FBU A;  3RBD A;  5L9X A;  4ED0 A;  4L1K A;  1TWC A;  2QYZ A;  2UUB H;  3JRW A;  3JRX A;  2YRX A;  3G6V A;  1T94 A;  4R7R A;  3PW2 A;  4CC5 A;  5DG9 A;  4LSA A;  3RTX A;  2FK2 A;  1BXR A;  4IWY A;  1IOV A;  3V6K A;  4YBZ B;  2NUA B;  2W57 A;  5LP6 F;  1GSO A;  5KFQ A;  5KT4 A;  5LMU H;  4A3G G;  3RB3 A;  1KBL A;  2FE3 A;  2XIG A;  2YCH A;  3E5N A;  2NU9 B;  4QWA A;  1N34 H;  2OH2 A;  4HQ6 A;  3L4K A;  4I4T F;  3GV8 B;  2IA6 A;  3VPB A;  5KG3 A;  2HHH H;  5IWA H;  2FP4 B;  2JA8 G;  1GYF A;  1TWF A;  3PW7 A;  3BJY A;  3IN5 A;  3MFI A;  3TIN A;  1HNZ H;  2RGR A;  3KAK A;  2WTF A;  3SI8 A;  2DZD A;  4NXN H;  5KFO A;  4ZHQ F;  2YL2 A;  4U7C A;  2WB1 E;  4DV4 H;  4XX0 B;  2IMW P;  1M0T A;  3V4Z A;  4A2A A;  2R7L A;  4DR3 H;  4JI5 H;  1M6V A;  2RGV A;  3CQZ A;  4ME6 A;  4JV1 A;  4B3R H;  3LP8 A;  2JA7 A;  2AU0 A;  2W9B B;  5KFV A;  1FKA H;  4B3M H;  4UCT A;  4BXX G;  3UFX B;  4YR3 A;  5LMN H;  2FPP B;  4TUY F;  1KC7 A;  4GLX A;  2PN1 A;  5LOV F;  4EBC A;  1TWH A;  2CKZ B;  1I50 A;  3Q1K A;  4X62 H;  3H0G A;  5LYJ F;  3UQ8 A;  4JV2 A;  4JV5 H;  2GLT A;  4FU0 A;  5FPO A;  2C22 A;  2R8G A;  2W6N A;  1XMQ H;  3H3V H;  3GQC A;  4ED7 A;  4DV5 H;  3I4N G;  4C5C A;  1TAE A;  1DV2 A;  2Y0S A;  2FK1 A;  4O4H F;  2FKL A;  5FD6 A;  4C5B A;  5C44 G;  2XC9 A;  5DLF A;  3PW5 A;  4EFE A;  4IWX A;  1EZ1 A;  5KFN A;  1A9X A;  4J9L A;  2B63 G;  3SE7 A;  5KT3 A;  2JEG A;  3OTO H;  3L4J A;  1UNN C;  2FJZ A;  1N36 H;  5KG6 A;  2ZDG A;  4UCS A;  3HKZ A;  2W9C A;  1R9T A;  4QWE A;  4F50 A;  4ECU A;  1KJI A;  3KHG A;  3GID A;  4ECX A;  2NU8 B;  3K5H A;  4TQR A;  1RJQ A;  4EYH B;  4ECW A;  5BMV F;  5FPR A;  2C2E A;  1S68 A;  2FB9 A;  4Y8V B;  4APM A;  4O2A F;  4PWQ A;  1EHI A;  5DG8 A;  1S9F A;  1ZHS A;  3FMA A;  3DF7 A;  1KJJ A;  2VA2 A;  4J9O A;  1C3O A;  3H0G G;  4DUZ H;  2V5A A;  1BJT A;  3M9M B;  3GIJ A;  1KJ8 A;  5GON F;  5FLX W;  5DQH A;  2R86 A;  4MV6 A;  1EUD B;  5IYZ F;  4O3N A;  1Y14 B;  4DR1 H;  5HV6 A;  4ECS A;  3HOU G;  5D8D A;  1RYR A;  1WSC A;  4GC6 A;  1W93 A;  4FS1 A;  3PVX A;  1BNC A;  4K0K H;  2ASL A;  2YZM A;  3RJ0 A;  4GKJ H;  3BQ1 A;  3JSL A;  2ASD A;  5F9N A;  4DV3 H;  3TQ1 A;  1IBM H;  3GIP A;  4IRC A;  4BY7 G;  5KFU A;  2P0A A;  2CW7 A;  4ECZ A;  1IBK H;  1L2Z A;  1PK8 A;  2XCA A;  3GII A;  4IRD A;  2VPQ A;  4LF6 H;  4ECR A;  2DIK A;  2PMZ A;  4YR0 A;  3LML A;  1ZET A;  3Q8Q B;  5D1O B;  4Q43 A;  3G8C A;  4IZO A;  2VR1 A;  2I87 A;  2RDJ A;  2YRW A;  3BA9 A;  4HNU A;  2BQU A;  2W7O A;  2ZJT A;  3KHH A;  2R7N A;  4DL2 A;  3PO3 G;  1HR0 H;  3OUZ A;  5KFF A;  4LF7 H;  4JYA H;  5KFP A;  3FKI A;  1CQI B;  1RJR A;  4RB2 C;  2JEJ A;  4AYB E;  2W6M A;  4MA0 A;  4ZOL F;  5CA1 F;  2UXD H;  2GPS A;  5C4X G;  5L1I A;  2E2H A;  3RFC A;  5KFW A;  2FLN A;  2R82 A;  3VPD A;  3N6X A;  3GTM A;  2SCU B;  4RB0 A;  2NU7 B;  5KFI A;  1K1Q A;  5C5J A;  2UU9 H;  2WYO A;  5H80 A;  4M7E A;  2R93 A;  5IYD G;  2JEF A;  4LSX A;  4IRK A;  1UC9 A;  4A3L G;  5L1J A;  1B6S A;  4QW8 A;  4RUA A;  3BAB A;  3WO0 A;  5KFJ A;  4M9U A;  1XNQ H;  4RZR A;  1CQJ B;  1VAJ A;  2O03 A;  4F4Z A;  2HVS A;  2OLS A;  3N43 B;  2PMZ E;  4RB3 C;  4LF9 H;  4WBN F;  2AGP A;  1CE8 A;  4HR7 A;  5JUM A;  2MCT A;  2V58 A;  1P8L A;  2NU6 B;  1Y1W A;  4F4Y A;  3RB6 A;  2R85 A;  3H40 A;  4PDB A;  2BQR A;  5KKN B;  4ECT A;  1S97 A;  4X65 H;  2E2I A;  2IP4 A;  2WB1 A;  3K5I A;  1Y1V A;  4F4X A;  1JIH A;  2JA6 G;  1M7J A;  4A2B A;  4EG0 A;  2E5L H;  3RIZ A;  4IAJ A;  4LF4 H;  2J6U A;  2YZN A;  1DGS A;  1EYZ A;  1JXL A;  4TQS A;  3HOW G;  2QK4 A;  4MA5 A;  4DL7 A;  1A0I A;  4AYB A;  4IR9 A;  3KHR A;  2DLN A;  4ECQ A;  3RBE A;  3T5J A;  4Q44 A;  4U6P A;  5HBR B;  5LXT F;  5KFD A;  3HBL A;  2JEI A;  2R84 A;  3N8D A;  5EWE A;  4F4W A;  2W9B A;  1MZB A;  1KEE A;  1X9N A;  1N33 H;  4O3R A;  4A3K G;  4YP3 A;  5BPH A;  3AYH B;  5JQW A;  2UUC H;  4WD3 A;  3BQ2 A;  4ED6 A;  4UFZ A;  3T5H A;  1TWA A;  3GTG A;  2WDT A;  3WNZ A;  4J9K A;  1S0M A;  5KFR A;  2ZDQ A;  1SCU B;  5KG5 A;  4DV0 H;  4DLK A;  3G6Y A;  5KT5 A;  4ECY A;  2XGQ A;  5KFG A;  1J5E H;  3MR2 A;  1B04 A;  3MR3 A;  3KAL A;  3TQT A;  4CC6 A;  3H20 A;  5A2Q W;  3RB0 A;  4DR2 H;  2R7Z A;  2R7Z G;  2UXC H;  4DL5 A;  3U9S A;  4UCV A;  4O3S A;  5EZY F;  4EGQ A;  3BA8 A;  5D1P A;  4EGJ A;  5BR8 H;  4Q8E A;  5KG7 A;  2JA7 G;  2WE6 A;  4R8U B;  4O4I F;  4RAZ A;  4TV8 F;  3PO2 G;  5IT9 W;  2PVP A;  1E4E A;  4NLG A;  3N44 B;  5LA6 F;  4A3I G;  2DPJ A;  4J9M A;  2C28 A;  3MWM A;  3RF2 A;  1GLV A;  1I6U A;  2RF4 A;  1IBL H;  4OX9 H;  5FD5 A;  1V9P A;  2R93 G;  4BBR G;  2R7M A;  3V6H A;  4A3F G;  5IYB G;  5C1P A;  1C30 A;  4GC7 A;  5DLG A;  5T14 A;  3J81 W;  3GV7 B;  2VA3 A;  4JI7 H;  4AQY H;  3MWE A;  4JI8 H;  4LH6 A;  1WCM G;  3Q8S B;  2X0S A;  1N32 H;  2DWC A;  2W6Z A;  2J6T A;  4ED1 A;  4UCR A;  2VQD A;  4RB1 A;  3M4I A;  4RNN A;  3J7A K;  2R92 A;  5KT2 A;  1JDE A;  4I7H A;  4O3Q A;  3ORQ A;  4Q0Y A;  4JUZ A;  3T1Y H;  2I8C A;  3GIK A;  2JA6 A;  2C00 A;  4EEQ A;  1W96 A;  2YZG A;  3PN1 A;  2FLP A;  3V4S A;  1XNR H;  1RJP A;  2C35 B;  4E4T A;  1K1S A;  4YR2 A;  2W6O A;  3ORR A;  4JI2 H;  3R5H A;  5KFK A;  3C0F B;  4LMY A;  3JAM W;  1O75 A;  2Q2T A;  5KT7 A;  1IOW A;  3IG0 A;  3R23 A;  5KFE A;  5KT6 A;  4ECV A;  2HJW A;  1T3N A;  1AUX A;  2W70 A;  5IP7 G;  2AGQ A;  4C5A A;  2UVR A;  4J0M A;  2HVR A;  2CQY A;  3Q2O A;  3PW0 A;  5KFS A;  4MV4 A;  3H4D A;  3L2P A;  2XGP A;  3RAX A;  2FLL A;  3HOX G;  3OHB A;  2JA5 A;  4A3D G;  3M9N B;  2W6Q A;  4HNV A;  3GTP A;  4J9R A;  1WH2 A;  4RNM A;  4G3I A;  4MAM A;  4DL6 A;  3T5L A;  3F8N A;  2AQ4 A;  5KG0 A;  4DL4 A;  2R8K A;  3WO1 A;  5I47 A;  3GLK A;  5FLM G;  4ZI7 F;  2Q2U A;  3HXL A;  2WAQ A;  3G6X A;  3HKZ E;  4DR4 H;  2R87 A;  3N41 B;  5KFH A;  1Z2P X;  3GTL A;  3PW4 A;  3H4B A;  1DV1 A;  3ETH A;  4EYI B;  3JSN A;  2ZM6 H;  1VBH A;  2R7K A;  5LL6 b;  3RAQ A;  3RB4 A;  3KTM A;  5CA0 F;  3I12 A;  2OWO A;  3MWD A;  3BQ0 A;  1SEI A;  4FS2 A;  4YAJ B;  4QW9 A;  4UCU A;  5DGB A;  2Y0S E;  4O3O A;  3Q8R B;  4DR5 H;  4O3P A;  4QWB A;  1T36 A;  1XMO H;  2VUM A;  3T5K A;  3GTK A;  4QIW E;  4X64 H;  2R8J A;  1ULZ A;  3VPC A;  2B63 A;  4RUC A;  3MFH A;  2YYA A;  3HOV G;  3V6J A;  1E4F T;  3RV4 A;  3TII A;  1GGO A;  3QFF A;  2W8L A;  2BQ3 A;  3TIG A;  2F4V H;  4BBS G;  1I7N A;  4YAK B;  3OUU A;  3PZP A;  2V9W A;  1N48 A;  4XZ3 B;  1GSH A;  2HGS A;  4I55 F;  3PR4 A;  4J9P A;  1ZQ7 A;  4X66 H;  4IR1 A;  2WAQ E;  2DPI A;  3GV5 B;  2FPG B;  4MV3 A;  5D1O A;  4DV1 H;  3FDS A;  4JI4 H;  5JVL A;  3EYY A;  4YY3 H;  2ALZ A;  3CVZ A;  4DR7 H;  2YS6 A;  4LFC H;  2W8K A;  1UC8 A;  1RYS A;  4LFB H;  3PR5 B;  4FBT A;  1N56 A;  5KG4 A;  3BG5 A;  2FK3 A;  2V4R A;  5KFT A;  4ED2 A;  3GTJ A;  1HNW H;  2ATL A;  5KFA A;  4UCO A;  3BAA A;  1VKZ A;  2W71 A;  4EEY A;  4BY1 G;  2ZDH A;  1GO3 E;  3KXY T;  2I80 A;  4QIW A;  4YQW A;  4O2B F;  2VQE H;  2V59 A;  1S10 A;  2NVY A;  4B3T H;  4RNO A;  4ETS A;  4EBD A;  2CZG A;  2VUG A;  5KFM A;  2YS7 A;  3VMM A;  1M0W A;  3MR6 A;  1S0N A;  4BWS C;  5CB4 F;  2VOB A;  4MV1 A;  5KFZ A;  2W6P A;  5DQG A;  2AGO A;  3GIM A;  4A3M G;  3HB9 A;  1KJQ A;  4Q45 A;  4MTE A;  5KFC A;  5DG7 A;  4A3E G;  5L1K A;  3N42 B;  4QWD A;  3RGZ A;  1V51 A;  1EUC B;  5KG2 A;  4A93 G;  5DQI A;  3GIQ A;  4FM9 A;  2GPW A;  4RZQ A;  1Y1V G;  3M9O B;  1RK6 A;  4ZQI A;  2HVQ A;  1VBG A;  5JVD F;  4DUY H;  5EWF A;  2XD4 A;  3U9T A;  5DGA A;  2J6S A;  1JLL B;  1E4G T;  4MV8 A;  3NGD A;  3QZ8 A;  4DV7 H;  1PX2 A;  5K2M A;  3JZI A;  4RAY A;  2W9C B;  2C2R A;  1HNX H;  3GIL A;  3I4M G;  3GTQ A;  2PBZ A;  2R8I A;  3R5X A;  2R92 G;  1DIK A;  1AUV A;  5KFX A;  5KG1 A;  3J80 W;  2UUA H;  4B3S H;  1V4Y A;  5KFB A;  2XCL A;  5EWG A;  4QWC A;  3KAJ A;  2V4Q A;  1ZHQ A;  4RU9 A;  4YJ2 F;  5KX5 F;  1SFO A;  4JI3 H;  2ASJ A;  3ETJ A;  1JX4 A;  4LF5 H;  1Z2N X;  1RK5 A;  3FKI G;  4YJ3 F;  5F9L A;  2R8H A;  2IBK A;  4I50 F;  4XYL B;  5IP9 G;  4A3J G;  3LWB A;  4O4L F;  2XCP A;  4DV2 H;  4EBE A;  1KJ9 A;  3RV3 A;  1SYX B;  4DR6 H;  2YU9 A;  3HOZ G;  5L1L A;  2KSW A;  4YB8 B;  1CS0 A;  1AN7 A;  3OSP A;  1Z2O X;  4J9S A;  1GSA A;  2UVU A;  2VUM G;  4LF8 H;  4MV7 A;  1B33 N;  3R5F A;  2C2D A;  3Q8P B;  2CW8 A;  2UXB H;  5J2T F;  4EFB A; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...