1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
b'GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
1WCMG 2W70A 4APMA 2BR0A 4IRDA 1GSHA 1E4FT 2CKZB 2X0SA 3OUZA 1DGSA 5C1OA 2QYZA 1KJQA 1TAEA 2YRXA 3V4SA 3WNZA 4ED7A 4JI0H 2R92A 5KX5F 1B33N 4B3RH 3MR6A 2W9BA 3SI8A 2ALZA 4YR3A 5L9XA 4MTEA 1FJGH 4ZI7F 4A3FG 4PDBA 3G8CA 1HR0H 2J6UA 1JKJB 4DLKA 4DL3A 5EWGA 4J9PA 4I50F 3RBEA 3VPCA 2NU9B 4FU0A 4A2BA 1GLVA 5CA1F 1Z2NX 2UU9H 4EYIB 4LMYA 2JEGA 5KFIA 2Y0SA 2IP4A 4WBNF 4JV5H 3H4BA 2KSWA 2E5LH 1HNWH 4Q0YA 3E5NA 3H0GA 1S03G 1C3OA 2RGRA 2W6MA 1KJJA 3TQTA 5D8DA 4ECYA 4JV2A 3GTGA 4DR4H 3R5HA 2YS6A 4LSXA 5KT5A 2DLNA 3R23A 5L1JA 1EZ1A 4O3NA 1XDNA 2YW2A 5BR8H 2YRWA 5LL6b 4ED6A 4TV9F 5LP6F 4Q45A 2WE6A 3MWEA 1VS0A 3C0FB 4TQRA 2CQYA 2JA6A 2V9WA 4RAZA 3JRXA 3PR5B 1HNXH 1XNRH 1S97A 3HKZA 3GTPA 4YY3H 4DR5H 4XYLB 4A3CG 5KFJA 1M0TA 3U9SA 2UVWA 4DV5H 1M0WA 5DLFA 4RUAA 2FPIB 3GV7B 2ASLA 2R8JA 5IYZF 2J6TA 3GV5B 3OHAA 3HXLA 3N42B 3JAMW 1S9FA 2R8KA 3GTMA 3N41B 2I8CA 4J0MA 2PMZE 2DPIA 1W96A 5KFLA 4RAYA 4IR1A 1DV1A 4DV2H 4LFAH 1WR2A 5DG7A 3PO3G 3V6KA 3GTJA 1EUDB 2JA5G 1WCMA 5DLGA 4MTDA 4XX0B 4DL4A 4A3KG 4YP3A 2DWCA 5JVLA 4ZQIA 5JUMA 5F9LA 4DV1H 4A3EG 4JV0A 2UVVA 5BPHA 4EG0A 4BY1G 4LF6H 5KFFA 3PVXA 2FLNA 4MV7A 3F8NA 1CQJB 4AQYH 3RJ0A 4O3RA 4O3OA 1L2ZA 1TWGA 2R85A 1ZHSA 1I50A 1WH2A 4IRCA 1Z2OX 5IP9G 2V58A 5KG7A 3J7AK 2C2EA 2R7ZG 2W57A 1BXRA 3OUUA 5D1PA 3PO2G 1BGWA 3GTOA 5DQGA 5KG3A 5J2TF 5KG0A 1UC9A 1TWAA 2C2DA 5FPOA 5HV6A 2C28A 1RYRA 3T5JA 4LF5H 2JA7G 1JXLA 1GYFA 1N33H 2CZGA 2UUCH 5FJ8G 5KKNB 4DR2H 4EBCA 4DV0H 4JI8H 1BNCA 1A0IA 3OHBA 1M6VA 3GIPA 3JSLA 4C5BA 4YBZB 1RJPA 2PBZA 4DV3H 1KBLA 4MV6A 1UNNC 4EFEA 4RZRA 2J6SA 4O3PA 3CQZA 3AYHB 3J80W 4NXMH 2I87A 3IG0A 2PN1A 2UXBH 1Y1VG 3BA8A 4A3GG 4JV1A 4HNUA 3RB6A 5DGAA 2VR1A 3H3VH 5F9NA 4O2BF 2CW8A 2XGQA 4ECZA 5KFYA 3Q8QB 4MV4A 2GPWA 3RFCA 3HOZG 1CS0A 2W9CB 4F4ZA 2UVUA 3Q8RB 4MV1A 5GONF 2VPQA 4QIWA 4YJ3F 5FLMG 3Q8SB 4LF4H 3MWDA 3ORRA 2VUGA 5FLXW 3T5HA 4UCVA 1TWHA 4BBRG 4F4XA 4JI3H 1I94H 2VUMA 3Q1KA 3Q2OA 2XGPA 2AGQA 4MV8A 3R5FA 2YZGA 5EWFA 3G6XA 5KG4A 3MR5A 2WTFA 1JIHA 5IP7G 4GC6A 2FLPA 2DIKA 4MV3A 4ZOLF 3VMMA 5KT7A 1PK8A 5KG6A 3MR3A 4L1KA 5C8YF 3LMLA 2NVYA 4F4WA 4R7RA 5KFAA 4CC6A 1P8LA 5KFHA 2FKLA 2HVRA 2WAQE 3I4NG 5D1OB 1Y1WA 2BQ3A 4BXXG 1T36A 2XC9A 5I47A 2B63G 1V51A 2NUAB 2AQ4A 3K3PA 3NGDA 4A3IG 2W6OA 3FKIG 2UUBH 1RJRA 5A2QW 1N32H 4J9NA 1SEIA 5KFQA 2Q2UA 2IMWP 2V4RA 3KHLA 4FS1A 3M9MB 3H40A 3BABA 1KJ8A 4DL6A 5KFUA 1E4EA 4M7EA 4X66H 4F50A 4LFCH 3K5HA 2AGPA 4I55F 1IBKH 3RV4A 5DG9A 3RTXA 4QWEA 2R7ZA 4J9OA 1V4YA 2YU9A 4UCRA 3I4MG 1SCUB 3FDSA 1WSCA 3L2PA 4TQSA 1GGOA 1CQIB 4EYHB 4MA0A 3HOXG 3VPDA 4QW8A 1VAJA 5DQHA 3WO1A 5T14A 4RUCA 4DR1H 1S0OA 5KFTA 1IBLH 4PWQA 3T1HH 2ZM6H 3G6VA 4CC5A 4ECRA 2R82A 5IYBG 4YAJB 4YQWA 3RB0A 4WD3A 1R9TA 5BPFA 3BQ0A 2W6ZA 3RGZA 4JI7H 5CAEB 5C4XG 1JDEA 2NU6B 4J9QA 3VPBA 3GIMA 4QW9A 4YAKB 4MAMA 2FJZA 5KFCA 2Y0SE 2R93A 3BG5A 5LA6F 4FBTA 2VQFH 5LXTF 5KFKA 2DPJA 4O3SA 4ME6A 4A3LG 3WO0A 3T1YH 4YR0A 5K2MA 3L4KA 1FKAH 3GLKA 4DV4H 3GV8B 4UCUA 3KHGA 1IOWA 3LWBA 5JQWA 1KEEA 5KFWA 4YHHH 4Q43A 5IT9W 3RIZA 1BJTA 4LSAA 2OH2A 4U7CA 3FMAA 3EYYA 1B6RA 2WB1A 4U6PA 4K0KH 3BJYA 2BQRA 5KG5A 2VA2A 4J9LA 3HKZE 3GIKA 2UUAH 1K1QA 4NXNH 2UXCH 4O4IF 4DUZH 2UXDH 4UCTA 3BAAA 1ZQ7A 4LH7A 4YR2A 3M9OB 4RB2C 1DIKA 3FKIA 1N34H 2VUMG 4F4YA 5J2UF 5L1LA 4DUYH 4IHJF 3RB3A 1J5EH 3N40P 3JZIA 3SE7A 1C30A 4EFBA 5KFBA 2W6QA 3QZ8A 4J9MA 1RYSA 2JEFA 1B04A 1FVIA 3I12A 5JH7F 4ED2A 3HOVG 2R84A 5KFMA 3GTLA 1RK6A 2YYAA 2RF4A 3T5KA 4A3DG 2W71A 3KAJA 5DQIA 5LMNH 4IAJA 4IR9A 1VBHA 2WB1E 2V59A 2YCHA 4DL5A 5IYCG 3ETJA 3H20A 2RDJA 1I7LA 1XMQH 2XIGA 5KT6A 4ED1A 2W9AA 1CE8A 4TUYF 3BQ1A 2GLTA 1S0MA 1ZHQA 2OLSA 4FBUA 1RJQA 2MCTA 4JI1H 2NU8B 5KT3A 4TV8F 4MV9A 2SCUB 5KFPA 2JEJA 4J9RA 5KFSA 3PN1A 3DF7A 1TWCA 5KFVA 2C2RA 3IN5A 4ED3A 1K83A 2NU7B 4XYMB 5LOVF 2M05A 1I3QA 4J9SA 4A2AA 3G6YA 3R5XA 2WYOA 1PX2A 3H0GG 4UCOA 4R8UA 4ECXA 1V9PA 1KC7A 1AN7A 4EEYA 4EGQA 2QK4A 2V5AA 3K3VA 4FS2A 2XCAA 3HOYG 1GO3E 3GTQA 3GIJA 2NVXA 3MWMA 1GSAA 1M7JA 3GTKA 1TWFA 2JA6G 2ZDHA 4UCSA 1GSOA 4A3MG 3QZ7A 2IBKA 2FK3A 4DL2A 3RAQA 3MR2A 2AGOA 4KHPH 4O2AF 5KG2A 4DR3H 4IZOA 2JA5A 3BA9A 4ECQA 3RBDA 4M9UA 5DG8A 2HHHH 4C5CA 2HVSA 2VQEH 2W9BB 2BQUA 4JI2H 2W9CA 5KFEA 4E4TA 4EEQA 2HGSA 4QIWE 4Q8FA 3TIIA 1ULZA 3KHRA 2ASJA 1T94A 4I7HA 1E4EB 4QWAA 1OWTA 4FM9A 3EPGA 2R7MA 3ETHA 2W8KA 1X9NA 4A3BG 4IWYA 2ZDQA 2HJWA 2XCLA 5LMUH 4DL7A 1IBMH 1W93A 3M4IA 1ZETA 2DZDA 3PW7A 1AUVA 4LH6A 3PW0A 4ED0A 2W6NA 5KFOA 5C5JA 4NLGA 3OTOH 5EOYA 5IYDG 1VBGA 2JA7A 5KFGA 3L4JA 2V4QA 1EHIA 1EYZA 1B6SA 2FE3A 1TA8A 1Y14B 4UFZA 4OX9H 3U9TA 5D1OA 4C2MA 5EWEA 1VKZA 3J81W 4C5AA 3HOWG 3PW2A 4RNOA 4B3TH 3V6JA 2C00A 2W8LA 4QWDA 2Q2TA 2FPPB 3N44B 4ECUA 4LFBH 4O4HF 4A3JG 2RGVA 1N48A 3RF2A 4HNTA 4O4LF 1Y1VA 5C44G 1K1SA 2YZMA 3M9NB 5L1KA 4AYBA 4X62H 2E2HA 1S68A 5CA0F 5FD6A 5C3EG 4YB8B 4HYKA 1EUCB 1IOVA 3GQCA 4GKJH 1SYXB 4BY7G 3RAXA 5KT4A 2PMZA 5KT2A 4JYAH 2FB9A 2R6FA 3KTMA 5EDWA 3GILA 4JI6H 2AU0A 4JUZA 5KFNA 4RB1A 4J9KA 3PW4A 3KALA 2ATLA 4O3QA 2OWOA 4GLXA 3TQ1A 1JLLB 4GKKH 3MFIA 4Q44A 2C35B 1I6UA 2F4VH 4RNMA 3V4ZA 2UVRA 3H4DA 1S10A 1KJ9A 2R7KA 4RU9A 3CVZA 1JDBB 1A9XA 2O03A 4AYBE 5C1PA 4Q8EA 4G3IA 1E4GT 4Y8VB 5KFDA 3GIDA 4RZQA 4ZHQF 3T5LA 2FLLA 1I7NA 3RB4A 2B63A 4QJFA 3EPIA 4DR6H 2JEIA 5BMVF 4YJ2F 3N8DA 2VOBA 3JSNA 4RNNA 2WDTA 4ECSA 3HBLA 4EBEA 1N36H 1AUXA 2R86A 3RGXA 1RK5A 2I80A 3HB9A 2R8IA 1Y1WG 2R92G 4EGJA 2FK2A 1S0NA 2FMAA 5KFRA 2ASDA 4HQ6A 3OSNA 4RB3C 1DV2A 3GIQA 4I4TF 3K5IA 4DR7H 3JRWA 2J9GA 2FP4B 3Q8PB 4XZ3B 4X65H 2R87A 1XNQH 4DV7H 3PR4A 1XMOH 4MA5A 4BBSG 2YL2A 5EZYF 2XCPA 2VPSA 4X64H 4JI5H 4GC7A 3KAKA 2YS7A 2HVQA 5KG1A 3V6HA 4QWCA 2E2IA 5FD5A 3N6XA 3UFXB 4R8UB 4ECVA 4B3SH 4JI4H 5KFZA 2R8HA 2YZNA 4IWXA 3RUPA 2JA8G 2R8GA 2PVPA 1O75A 4HR7A 2W6PA 4ECWA 2XD4A 2VA3A 3RV3A 5CB4F 1KJIA 4B3MH 4LF9H 3QFFA 3TINA 3PW5A 2W7OA 3MJFA 3MFHA 3TIGA 2R7NA 5IWAH 4A93G 1MZBA 3N43B 3UQ8A 5DGBA 4RB0A 2R7LA 2CW7A 4HNVA 5L1IA 4DV6H 2IA6A 2WAQA 2R93G 5JVDF 5H80A 3PZPA 3KHHA 2W7PA 1JX4A 3HOUG 4LF7H 4ETSA 4QWBA 1N56A 1Z2PX 2GPSA 2FK1A 5LYJF 4ED8A 1HNZH 3LP8A 4BWSC 1SFOA 4IRKA 3ORQA 2VQDA 3KXYT 5FPRA 3OSPA 3BQ2A 2ZJTA 5HBRB 2C22A 1UC8A 5KFXA 4ECTA 3GIIA 2P0AA 1T3NA 4LF8H 2RDIA 2FPGB 2ZDGA 4EBDA
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 1WCM G;  2W70 A;  4APM A;  2BR0 A;  4IRD A;  1GSH A;  1E4F T;  2CKZ B;  2X0S A;  3OUZ A;  1DGS A;  5C1O A;  2QYZ A;  1KJQ A;  1TAE A;  2YRX A;  3V4S A;  3WNZ A;  4ED7 A;  4JI0 H;  2R92 A;  5KX5 F;  1B33 N;  4B3R H;  3MR6 A;  2W9B A;  3SI8 A;  2ALZ A;  4YR3 A;  5L9X A;  4MTE A;  1FJG H;  4ZI7 F;  4A3F G;  4PDB A;  3G8C A;  1HR0 H;  2J6U A;  1JKJ B;  4DLK A;  4DL3 A;  5EWG A;  4J9P A;  4I50 F;  3RBE A;  3VPC A;  2NU9 B;  4FU0 A;  4A2B A;  1GLV A;  5CA1 F;  1Z2N X;  2UU9 H;  4EYI B;  4LMY A;  2JEG A;  5KFI A;  2Y0S A;  2IP4 A;  4WBN F;  4JV5 H;  3H4B A;  2KSW A;  2E5L H;  1HNW H;  4Q0Y A;  3E5N A;  3H0G A;  1S03 G;  1C3O A;  2RGR A;  2W6M A;  1KJJ A;  3TQT A;  5D8D A;  4ECY A;  4JV2 A;  3GTG A;  4DR4 H;  3R5H A;  2YS6 A;  4LSX A;  5KT5 A;  2DLN A;  3R23 A;  5L1J A;  1EZ1 A;  4O3N A;  1XDN A;  2YW2 A;  5BR8 H;  2YRW A;  5LL6 b;  4ED6 A;  4TV9 F;  5LP6 F;  4Q45 A;  2WE6 A;  3MWE A;  1VS0 A;  3C0F B;  4TQR A;  2CQY A;  2JA6 A;  2V9W A;  4RAZ A;  3JRX A;  3PR5 B;  1HNX H;  1XNR H;  1S97 A;  3HKZ A;  3GTP A;  4YY3 H;  4DR5 H;  4XYL B;  4A3C G;  5KFJ A;  1M0T A;  3U9S A;  2UVW A;  4DV5 H;  1M0W A;  5DLF A;  4RUA A;  2FPI B;  3GV7 B;  2ASL A;  2R8J A;  5IYZ F;  2J6T A;  3GV5 B;  3OHA A;  3HXL A;  3N42 B;  3JAM W;  1S9F A;  2R8K A;  3GTM A;  3N41 B;  2I8C A;  4J0M A;  2PMZ E;  2DPI A;  1W96 A;  5KFL A;  4RAY A;  4IR1 A;  1DV1 A;  4DV2 H;  4LFA H;  1WR2 A;  5DG7 A;  3PO3 G;  3V6K A;  3GTJ A;  1EUD B;  2JA5 G;  1WCM A;  5DLG A;  4MTD A;  4XX0 B;  4DL4 A;  4A3K G;  4YP3 A;  2DWC A;  5JVL A;  4ZQI A;  5JUM A;  5F9L A;  4DV1 H;  4A3E G;  4JV0 A;  2UVV A;  5BPH A;  4EG0 A;  4BY1 G;  4LF6 H;  5KFF A;  3PVX A;  2FLN A;  4MV7 A;  3F8N A;  1CQJ B;  4AQY H;  3RJ0 A;  4O3R A;  4O3O A;  1L2Z A;  1TWG A;  2R85 A;  1ZHS A;  1I50 A;  1WH2 A;  4IRC A;  1Z2O X;  5IP9 G;  2V58 A;  5KG7 A;  3J7A K;  2C2E A;  2R7Z G;  2W57 A;  1BXR A;  3OUU A;  5D1P A;  3PO2 G;  1BGW A;  3GTO A;  5DQG A;  5KG3 A;  5J2T F;  5KG0 A;  1UC9 A;  1TWA A;  2C2D A;  5FPO A;  5HV6 A;  2C28 A;  1RYR A;  3T5J A;  4LF5 H;  2JA7 G;  1JXL A;  1GYF A;  1N33 H;  2CZG A;  2UUC H;  5FJ8 G;  5KKN B;  4DR2 H;  4EBC A;  4DV0 H;  4JI8 H;  1BNC A;  1A0I A;  3OHB A;  1M6V A;  3GIP A;  3JSL A;  4C5B A;  4YBZ B;  1RJP A;  2PBZ A;  4DV3 H;  1KBL A;  4MV6 A;  1UNN C;  4EFE A;  4RZR A;  2J6S A;  4O3P A;  3CQZ A;  3AYH B;  3J80 W;  4NXM H;  2I87 A;  3IG0 A;  2PN1 A;  2UXB H;  1Y1V G;  3BA8 A;  4A3G G;  4JV1 A;  4HNU A;  3RB6 A;  5DGA A;  2VR1 A;  3H3V H;  5F9N A;  4O2B F;  2CW8 A;  2XGQ A;  4ECZ A;  5KFY A;  3Q8Q B;  4MV4 A;  2GPW A;  3RFC A;  3HOZ G;  1CS0 A;  2W9C B;  4F4Z A;  2UVU A;  3Q8R B;  4MV1 A;  5GON F;  2VPQ A;  4QIW A;  4YJ3 F;  5FLM G;  3Q8S B;  4LF4 H;  3MWD A;  3ORR A;  2VUG A;  5FLX W;  3T5H A;  4UCV A;  1TWH A;  4BBR G;  4F4X A;  4JI3 H;  1I94 H;  2VUM A;  3Q1K A;  3Q2O A;  2XGP A;  2AGQ A;  4MV8 A;  3R5F A;  2YZG A;  5EWF A;  3G6X A;  5KG4 A;  3MR5 A;  2WTF A;  1JIH A;  5IP7 G;  4GC6 A;  2FLP A;  2DIK A;  4MV3 A;  4ZOL F;  3VMM A;  5KT7 A;  1PK8 A;  5KG6 A;  3MR3 A;  4L1K A;  5C8Y F;  3LML A;  2NVY A;  4F4W A;  4R7R A;  5KFA A;  4CC6 A;  1P8L A;  5KFH A;  2FKL A;  2HVR A;  2WAQ E;  3I4N G;  5D1O B;  1Y1W A;  2BQ3 A;  4BXX G;  1T36 A;  2XC9 A;  5I47 A;  2B63 G;  1V51 A;  2NUA B;  2AQ4 A;  3K3P A;  3NGD A;  4A3I G;  2W6O A;  3FKI G;  2UUB H;  1RJR A;  5A2Q W;  1N32 H;  4J9N A;  1SEI A;  5KFQ A;  2Q2U A;  2IMW P;  2V4R A;  3KHL A;  4FS1 A;  3M9M B;  3H40 A;  3BAB A;  1KJ8 A;  4DL6 A;  5KFU A;  1E4E A;  4M7E A;  4X66 H;  4F50 A;  4LFC H;  3K5H A;  2AGP A;  4I55 F;  1IBK H;  3RV4 A;  5DG9 A;  3RTX A;  4QWE A;  2R7Z A;  4J9O A;  1V4Y A;  2YU9 A;  4UCR A;  3I4M G;  1SCU B;  3FDS A;  1WSC A;  3L2P A;  4TQS A;  1GGO A;  1CQI B;  4EYH B;  4MA0 A;  3HOX G;  3VPD A;  4QW8 A;  1VAJ A;  5DQH A;  3WO1 A;  5T14 A;  4RUC A;  4DR1 H;  1S0O A;  5KFT A;  1IBL H;  4PWQ A;  3T1H H;  2ZM6 H;  3G6V A;  4CC5 A;  4ECR A;  2R82 A;  5IYB G;  4YAJ B;  4YQW A;  3RB0 A;  4WD3 A;  1R9T A;  5BPF A;  3BQ0 A;  2W6Z A;  3RGZ A;  4JI7 H;  5CAE B;  5C4X G;  1JDE A;  2NU6 B;  4J9Q A;  3VPB A;  3GIM A;  4QW9 A;  4YAK B;  4MAM A;  2FJZ A;  5KFC A;  2Y0S E;  2R93 A;  3BG5 A;  5LA6 F;  4FBT A;  2VQF H;  5LXT F;  5KFK A;  2DPJ A;  4O3S A;  4ME6 A;  4A3L G;  3WO0 A;  3T1Y H;  4YR0 A;  5K2M A;  3L4K A;  1FKA H;  3GLK A;  4DV4 H;  3GV8 B;  4UCU A;  3KHG A;  1IOW A;  3LWB A;  5JQW A;  1KEE A;  5KFW A;  4YHH H;  4Q43 A;  5IT9 W;  3RIZ A;  1BJT A;  4LSA A;  2OH2 A;  4U7C A;  3FMA A;  3EYY A;  1B6R A;  2WB1 A;  4U6P A;  4K0K H;  3BJY A;  2BQR A;  5KG5 A;  2VA2 A;  4J9L A;  3HKZ E;  3GIK A;  2UUA H;  1K1Q A;  4NXN H;  2UXC H;  4O4I F;  4DUZ H;  2UXD H;  4UCT A;  3BAA A;  1ZQ7 A;  4LH7 A;  4YR2 A;  3M9O B;  4RB2 C;  1DIK A;  3FKI A;  1N34 H;  2VUM G;  4F4Y A;  5J2U F;  5L1L A;  4DUY H;  4IHJ F;  3RB3 A;  1J5E H;  3N40 P;  3JZI A;  3SE7 A;  1C30 A;  4EFB A;  5KFB A;  2W6Q A;  3QZ8 A;  4J9M A;  1RYS A;  2JEF A;  1B04 A;  1FVI A;  3I12 A;  5JH7 F;  4ED2 A;  3HOV G;  2R84 A;  5KFM A;  3GTL A;  1RK6 A;  2YYA A;  2RF4 A;  3T5K A;  4A3D G;  2W71 A;  3KAJ A;  5DQI A;  5LMN H;  4IAJ A;  4IR9 A;  1VBH A;  2WB1 E;  2V59 A;  2YCH A;  4DL5 A;  5IYC G;  3ETJ A;  3H20 A;  2RDJ A;  1I7L A;  1XMQ H;  2XIG A;  5KT6 A;  4ED1 A;  2W9A A;  1CE8 A;  4TUY F;  3BQ1 A;  2GLT A;  1S0M A;  1ZHQ A;  2OLS A;  4FBU A;  1RJQ A;  2MCT A;  4JI1 H;  2NU8 B;  5KT3 A;  4TV8 F;  4MV9 A;  2SCU B;  5KFP A;  2JEJ A;  4J9R A;  5KFS A;  3PN1 A;  3DF7 A;  1TWC A;  5KFV A;  2C2R A;  3IN5 A;  4ED3 A;  1K83 A;  2NU7 B;  4XYM B;  5LOV F;  2M05 A;  1I3Q A;  4J9S A;  4A2A A;  3G6Y A;  3R5X A;  2WYO A;  1PX2 A;  3H0G G;  4UCO A;  4R8U A;  4ECX A;  1V9P A;  1KC7 A;  1AN7 A;  4EEY A;  4EGQ A;  2QK4 A;  2V5A A;  3K3V A;  4FS2 A;  2XCA A;  3HOY G;  1GO3 E;  3GTQ A;  3GIJ A;  2NVX A;  3MWM A;  1GSA A;  1M7J A;  3GTK A;  1TWF A;  2JA6 G;  2ZDH A;  4UCS A;  1GSO A;  4A3M G;  3QZ7 A;  2IBK A;  2FK3 A;  4DL2 A;  3RAQ A;  3MR2 A;  2AGO A;  4KHP H;  4O2A F;  5KG2 A;  4DR3 H;  4IZO A;  2JA5 A;  3BA9 A;  4ECQ A;  3RBD A;  4M9U A;  5DG8 A;  2HHH H;  4C5C A;  2HVS A;  2VQE H;  2W9B B;  2BQU A;  4JI2 H;  2W9C A;  5KFE A;  4E4T A;  4EEQ A;  2HGS A;  4QIW E;  4Q8F A;  3TII A;  1ULZ A;  3KHR A;  2ASJ A;  1T94 A;  4I7H A;  1E4E B;  4QWA A;  1OWT A;  4FM9 A;  3EPG A;  2R7M A;  3ETH A;  2W8K A;  1X9N A;  4A3B G;  4IWY A;  2ZDQ A;  2HJW A;  2XCL A;  5LMU H;  4DL7 A;  1IBM H;  1W93 A;  3M4I A;  1ZET A;  2DZD A;  3PW7 A;  1AUV A;  4LH6 A;  3PW0 A;  4ED0 A;  2W6N A;  5KFO A;  5C5J A;  4NLG A;  3OTO H;  5EOY A;  5IYD G;  1VBG A;  2JA7 A;  5KFG A;  3L4J A;  2V4Q A;  1EHI A;  1EYZ A;  1B6S A;  2FE3 A;  1TA8 A;  1Y14 B;  4UFZ A;  4OX9 H;  3U9T A;  5D1O A;  4C2M A;  5EWE A;  1VKZ A;  3J81 W;  4C5A A;  3HOW G;  3PW2 A;  4RNO A;  4B3T H;  3V6J A;  2C00 A;  2W8L A;  4QWD A;  2Q2T A;  2FPP B;  3N44 B;  4ECU A;  4LFB H;  4O4H F;  4A3J G;  2RGV A;  1N48 A;  3RF2 A;  4HNT A;  4O4L F;  1Y1V A;  5C44 G;  1K1S A;  2YZM A;  3M9N B;  5L1K A;  4AYB A;  4X62 H;  2E2H A;  1S68 A;  5CA0 F;  5FD6 A;  5C3E G;  4YB8 B;  4HYK A;  1EUC B;  1IOV A;  3GQC A;  4GKJ H;  1SYX B;  4BY7 G;  3RAX A;  5KT4 A;  2PMZ A;  5KT2 A;  4JYA H;  2FB9 A;  2R6F A;  3KTM A;  5EDW A;  3GIL A;  4JI6 H;  2AU0 A;  4JUZ A;  5KFN A;  4RB1 A;  4J9K A;  3PW4 A;  3KAL A;  2ATL A;  4O3Q A;  2OWO A;  4GLX A;  3TQ1 A;  1JLL B;  4GKK H;  3MFI A;  4Q44 A;  2C35 B;  1I6U A;  2F4V H;  4RNM A;  3V4Z A;  2UVR A;  3H4D A;  1S10 A;  1KJ9 A;  2R7K A;  4RU9 A;  3CVZ A;  1JDB B;  1A9X A;  2O03 A;  4AYB E;  5C1P A;  4Q8E A;  4G3I A;  1E4G T;  4Y8V B;  5KFD A;  3GID A;  4RZQ A;  4ZHQ F;  3T5L A;  2FLL A;  1I7N A;  3RB4 A;  2B63 A;  4QJF A;  3EPI A;  4DR6 H;  2JEI A;  5BMV F;  4YJ2 F;  3N8D A;  2VOB A;  3JSN A;  4RNN A;  2WDT A;  4ECS A;  3HBL A;  4EBE A;  1N36 H;  1AUX A;  2R86 A;  3RGX A;  1RK5 A;  2I80 A;  3HB9 A;  2R8I A;  1Y1W G;  2R92 G;  4EGJ A;  2FK2 A;  1S0N A;  2FMA A;  5KFR A;  2ASD A;  4HQ6 A;  3OSN A;  4RB3 C;  1DV2 A;  3GIQ A;  4I4T F;  3K5I A;  4DR7 H;  3JRW A;  2J9G A;  2FP4 B;  3Q8P B;  4XZ3 B;  4X65 H;  2R87 A;  1XNQ H;  4DV7 H;  3PR4 A;  1XMO H;  4MA5 A;  4BBS G;  2YL2 A;  5EZY F;  2XCP A;  2VPS A;  4X64 H;  4JI5 H;  4GC7 A;  3KAK A;  2YS7 A;  2HVQ A;  5KG1 A;  3V6H A;  4QWC A;  2E2I A;  5FD5 A;  3N6X A;  3UFX B;  4R8U B;  4ECV A;  4B3S H;  4JI4 H;  5KFZ A;  2R8H A;  2YZN A;  4IWX A;  3RUP A;  2JA8 G;  2R8G A;  2PVP A;  1O75 A;  4HR7 A;  2W6P A;  4ECW A;  2XD4 A;  2VA3 A;  3RV3 A;  5CB4 F;  1KJI A;  4B3M H;  4LF9 H;  3QFF A;  3TIN A;  3PW5 A;  2W7O A;  3MJF A;  3MFH A;  3TIG A;  2R7N A;  5IWA H;  4A93 G;  1MZB A;  3N43 B;  3UQ8 A;  5DGB A;  4RB0 A;  2R7L A;  2CW7 A;  4HNV A;  5L1I A;  4DV6 H;  2IA6 A;  2WAQ A;  2R93 G;  5JVD F;  5H80 A;  3PZP A;  3KHH A;  2W7P A;  1JX4 A;  3HOU G;  4LF7 H;  4ETS A;  4QWB A;  1N56 A;  1Z2P X;  2GPS A;  2FK1 A;  5LYJ F;  4ED8 A;  1HNZ H;  3LP8 A;  4BWS C;  1SFO A;  4IRK A;  3ORQ A;  2VQD A;  3KXY T;  5FPR A;  3OSP A;  3BQ2 A;  2ZJT A;  5HBR B;  2C22 A;  1UC8 A;  5KFX A;  4ECT A;  3GII A;  2P0A A;  1T3N A;  4LF8 H;  2RDI A;  2FPG B;  2ZDG A;  4EBD A; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...