1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
3H4DA 4WD3A 1ULZA 1XDNA 2GPSA 2W6MA 2Y0SE 5KFQA 2GLTA 4AQYH 3I4MG 3PW5A 3GTQA 5KFMA 2FP4B 4MV8A 1TWGA 3N44B 4A3BG 2AGOA 4MTEA 4ED8A 3JZIA 3GIIA 5GONF 3GIMA 4U7CA 2HGSA 4RZRA 1S68A 4XYLB 4RB3C 4QWCA 2XCPA 3T5LA 4ECTA 4LFCH 2JA6A 3KHGA 2YZGA 2YS7A 2I87A 2FKLA 2WE6A 3SE7A 5DGAA 2R6FA 5KFPA 4F4WA 2W71A 1DV1A 4O3PA 2FK1A 4GKJH 2QYZA 5BPHA 5KFGA 5KFDA 3PVXA 5DG8A 5JH7F 2WB1E 5LMNH 1B04A 2V59A 3JSNA 4ZI7F 3HOYG 2UXBH 2OWOA 3QZ8A 4BBSG 4IR1A 3KAJA 1XMOH 1IOVA 4ECUA 1V4YA 1Y1VG 1T94A 2FE3A 5C8YF 2C00A 3G6YA 3BAAA 3GIJA 2XD4A 2JEJA 1S0OA 2P0AA 4DV3H 1S9FA 3RFCA 2M05A 4IZOA 2C2EA 4LF9H 2YYAA 5IYBG 5KFHA 1DV2A 2WYOA 5KG1A 1Z2PX 4O3QA 1E4GT 4ETSA 5K2MA 1Z2OX 3GIPA 4HNVA 2HVQA 3R23A 1C30A 3UQ8A 5F9NA 1XNRH 3BJYA 3SI8A 1R9TA 5DQGA 4YR0A 2ASDA 1E4FT 5DQHA 1ZHQA 1TA8A 3LWBA 3GTGA 3T5JA 3JSLA 2W7PA 2O03A 4IRKA 2RDJA 4OX9H 3LMLA 4IAJA 2WDTA 3OHBA 4K0KH 3TIIA 3PW4A 2DIKA 5KFZA 1N32H 5C44G 2UVUA 2GPWA 2IP4A 3KXYT 3Q2OA 5KG0A 5D8DA 4BBRG 4C2MA 4RU9A 4DL3A 4ECRA 4EEQA 4ECVA 4YP3A 4NLGA 3MFIA 3WNZA 3MFHA 1EHIA 3GILA 5DLFA 4Q0YA 2VA3A 3TINA 2JEFA 5KG2A 4EYIB 5C1PA 3MR3A 4ED6A 2YL2A 1K83A 3GTLA 1Y14B 1S0NA 2E2HA 3GQCA 3TQ1A 2UVRA 1S0MA 2HJWA 3U9TA 2YU9A 2WAQA 1W93A 1UC8A 2BQ3A 4ED2A 2JA5G 2R92A 4J9MA 2BQUA 4YB8B 3HB9A 2VQDA 2JEGA 5C4XG 2CZGA 1C3OA 1SFOA 5LYJF 2R84A 4EYHB 2HVRA 3OUUA 2NVXA 4DL7A 5BMVF 4YQWA 2FJZA 2IMWP 1BGWA 1CE8A 2R7KA 2UVWA 2WB1A 4LF8H 4XZ3B 3MR6A 2XGQA 2OH2A 3PW7A 4YR3A 2R82A 2W57A 4ZQIA 4A3GG 2W6PA 2HVSA 4C5AA 2R8IA 4C5CA 4MAMA 1GSAA 3U9SA 3M9NB 1KJIA 1B6RA 4IRCA 2J6UA 2J6TA 1EUCB 4HNUA 5DLGA 4J9KA 4ECSA 4R7RA 5KFXA 1ZHSA 3E5NA 4BY1G 2UUBH 4YJ3F 4B3TH 4M7EA 4LH6A 2VR1A 4MA5A 2CW8A 3HXLA 4BWSC 3M9OB 2DLNA 4IWYA 1RK5A 3N8DA 5KG4A 4JI0H 4JV2A 5T14A 4RNOA 2FK2A 2W8LA 3MWDA 1JIHA 4YAKB 5CA1F 3RB6A 2V4QA 2YZMA 4QIWA 1XMQH 3Q8PB 2W9BA 3HBLA 3RV4A 2W6OA 5LA6F 4Q43A 4LFAH 1JDBB 3N43B 4QW9A 4F50A 2YRXA 4ZHQF 3J7AK 1CQIB 1B33N 4GC6A 1GSHA 2ZDQA 4JI1H 4EFBA 4LH7A 4UCTA 2R7LA 3RIZA 3N41B 1Y1WG 3JRWA 2R93G 4J0MA 3J80W 3FDSA 1N48A 4O4HF 4KHPH 4A93G 2W70A 3GTOA 2BQRA 3K5IA 4YY3H 2AU0A 5FJ8G 5HBRB 2Q2TA 4BXXG 2YZNA 4RUAA 3RTXA 4FM9A 3IN5A 4A2AA 3NGDA 4EG0A 1VKZA 4DV0H 3ETHA 2FB9A 3GTJA 5JVDF 4JI2H 4CC5A 4FBUA 4I55F 3PO2G 1S10A 4A3EG 4O4IF 2XCAA 4HYKA 2UU9H 1J5EH 1P8LA 2PMZA 3OHAA 2R7MA 3OUZA 3MR5A 3L4KA 5KT7A 5L1IA 4J9RA 5JUMA 5LL6b 2ZDGA 4JYAH 1N34H 1ZQ7A 4X62H 1VBGA 4QWAA 1BJTA 2NU7B 5L9XA 2VPSA 1KJ9A 4UFZA 5KT3A 5KG3A 2XGPA 4B3SH 1M7JA 4LSXA 3F8NA 4PDBA 3L2PA 4QWDA 2FMAA 2PVPA 3V4SA 4EBDA 3FMAA 2C2DA 3C0FB 5KKNB 3M4IA 4EGQA 1GGOA 4HQ6A 4TV9F 4O3NA 3RGXA 3OSNA 4TQSA 3GIQA 4X66H 3KHRA 4ECQA 1VS0A 2FPPB 4FS1A 5KFJA 4C5BA 4AYBE 5LMUH 1JKJB 3PR4A 3R5XA 5IYDG 4DL5A 2V9WA 2W6NA 5KFOA 3N6XA 4J9OA 1L2ZA 5KFNA 5FLXW 5BR8H 3HKZE 5KX5F 4DV7H 4O2AF 4A3FG 1K1QA 4IHJF 1I6UA 5FLMG 2W6ZA 3WO0A 4ED7A 1S97A 3GTMA 3PR5B 3MR2A 1ZETA 2MCTA 4FS2A 4UCRA 2C28A 5D1PA 1PX2A 4QWBA 1PK8A 4B3RH 1JX4A 4EBEA 1IOWA 2JA7G 3FKIG 4I4TF 2ASJA 1KJ8A 2V58A 4JI4H 4MV3A 1V51A 3IG0A 4XX0B 3RUPA 2Y0SA 4JI7H 2B63G 4DLKA 3N40P 2CW7A 3K3PA 1HNXH 5DGBA 3OTOH 2FPGB 5KFYA 3BQ2A 4LF6H 1Y1WA 4E4TA 2R93A 3ETJA 4DR6H 5KFIA 1TWFA 4LF7H 2W9AA 1W96A 1KJJA 3KHHA 4JI8H 4YR2A 2C35B 3GLKA 5EWFA 3H0GG 3G8CA 4J9QA 2UUAH 3MJFA 1WSCA 4UCUA 1IBKH 1DGSA 2VUMG 5J2TF 3V4ZA 3BQ1A 2FK3A 5KFUA 3RBEA 2J9GA 5CA0F 4LF4H 3KHLA 2DZDA 1CQJB 4I50F 5KFWA 2CKZB 1JLLB 3QFFA 1I50A 4EGJA 3RBDA 5IYZF 4CC6A 4RAYA 1VBHA 4JV5H 2QK4A 1TAEA 4I7HA 1T3NA 4MV7A 4A3IG 4ED1A 2BR0A 3GTPA 4HR7A 4APMA 3KTMA 2WTFA 1M0TA 3I12A 1SEIA 1TWAA 4J9PA 3BABA 1I7LA 5LP6F 2W9BB 3H3VH 4UCSA 4DR1H 4NXNH 5C3EG 1Y1VA 3HOZG 2YS6A 5F9LA 4Q8FA 1N36H 2ATLA 4J9LA 2ZJTA 1A9XA 4MV1A 4ED3A 4DR3H 3RB3A 1WCMG 1I3QA 2KSWA 2UVVA 3ORRA 2ZDHA 4DV6H 1RYRA 2YW2A 4RB2C 3RAQA 3PW2A 2AQ4A 3RAXA 2ASLA 4EEYA 3EYYA 2VUGA 4DL2A 4A3CG 5IP9G 2R85A 2AGPA 1FJGH 2NU8B 4DR4H 4A3KG 1GSOA 2CQYA 3TQTA 1GYFA 2NUAB 4Q45A 5KFCA 4RUCA 5KG7A 2SCUB 2V4RA 1SCUB 4HNTA 1HNWH 3EPGA 5L1JA 1TWCA 5DG7A 4JV0A 5FD6A 5EWEA 5LOVF 1X9NA 5KT6A 3RB0A 1GLVA 5IT9W 4IRDA 4F4XA 2VA2A 3VPBA 5DG9A 1WH2A 5KFLA 1M6VA 2JA8G 4F4YA 2R86A 5KT4A 3I4NG 4ECYA 1RYSA 2RF4A 2R8JA 3FKIA 4TV8F 1UC9A 4A2BA 2NVYA 5EDWA 3PZPA 3LP8A 4DV4H 1RK6A 3PN1A 4IWXA 4YHHH 5IYCG 4GLXA 4IR9A 1UNNC 3R5HA 2B63A 4YAJB 4UCVA 4DUZH 3K5HA 3G6VA 1VAJA 2WAQE 2XCLA 2XIGA 2E5LH 3RB4A 3RV3A 4R8UB 3CVZA 5FPOA 5KFKA 4EBCA 3JAMW 3G6XA 4Y8VB 2JA5A 4RB1A 4O3RA 4YJ2F 5CB4F 2IA6A 3H40A 4DV5H 2Q2UA 1CS0A 4MV6A 3UFXB 4R8UA 1HR0H 4O4LF 4LFBH 3H0GA 1A0IA 2I80A 3KALA 3VPCA 1B6SA 1MZBA 5KFTA 1WR2A 5KFFA 2W8KA 4A3LG 1KC7A 2VUMA 5L1KA 5J2UF 4QW8A 4DL4A 4YBZB 2VPQA 5KFVA 5EZYF 4O3OA 2IBKA 4ZOLF 4DUYH 2R8GA 3GTKA 3VMMA 5A2QW 4ECWA 1GO3E 1AUXA 3K3VA 4UCOA 3M9MB 4A3JG 1BXRA 5JQWA 2C22A 2UUCH 2R7ZG 4DR7H 5IP7G 1Z2NX 3TIGA 3ORQA 4G3IA 3GIDA 1KEEA 2V5AA 3DF7A 3V6HA 4O2BF 1EUDB 5H80A 3WO1A 2W7OA 3PO3G 2ALZA 4MV9A 3T5KA 4QIWE 1SYXB 5CAEB 4J9SA 3HOWG 2OLSA 5L1LA 2X0SA 4FBTA 3GV7B 2W6QA 2W9CB 2J6SA 1WCMA 3CQZA 1KJQA 4QJFA 4RB0A 1I7NA 5FD5A 4X65H 1T36A 2JA6G 2NU9B 4RZQA 3T5HA 2C2RA 1I94H 3BA9A 4JUZA 3V6KA 2W9CA 4RAZA 3HOVG 5FPRA 3Q8RB 3H4BA 4FU0A 2R8KA 4ED0A 4BY7G 3VPDA 3KAKA 2R87A 1BNCA 1V9PA 1EZ1A 3EPIA 4DV1H 4GKKH 5KG5A 2PBZA 5KT5A 2RGVA 3BQ0A 2FLLA 5KFAA 4LF5H 1K1SA 4LSAA 4ECXA 1S03G 3PW0A 3MWEA 4MV4A 4RNNA 1OWTA 1AN7A 1RJRA 3BA8A 2E2IA 4TQRA 2PMZE 4M9UA 5D1OB 4JI5H 2NU6B 1JXLA 1EYZA 2I8CA 2PN1A 3QZ7A 5LXTF 4WBNF 1AUVA 2UXDH 2YRWA 3T1YH 5KFBA 5JVLA 3GIKA 5KFEA 5HV6A 4GC7A 2AGQA 1N33H 3Q8QB 3HOUG 5D1OA 5BPFA 4MTDA 4DR2H 3RF2A 4JV1A 5KT2A 1N56A 3MWMA 5KFRA 5EWGA 1FKAH 2VQEH 4JI3H 4J9NA 2UXCH 4AYBA 3Q1KA 4B3MH 5I47A 3HOXG 4XYMB 2RDIA 2XC9A 3T1HH 4A3MG 1RJPA 2DPJA 3AYHB 4Q8EA 4O3SA 2DPIA 4MA0A 4RNMA 4DV2H 4A3DG 2RGRA 3L4JA 3HKZA 1JDEA 1O75A 4QWEA 2FPIB 3V6JA 2DWCA 1XNQH 2FLNA 2F4VH 4F4ZA 4U6PA 5KFSA 4X64H 5KG6A 2JEIA 1HNZH 3H20A 1E4EB 4LMYA 5C1OA 3N42B 5IWAH 3J81W 4DL6A 2FLPA 4JI6H 3RGZA 3BG5A 3JRXA 5DQIA 4L1KA 3GV8B 1IBMH 2R7ZA 1IBLH 4Q44A 1KBLA 1M0WA 5C5JA 1E4EA 2ZM6H 1RJQA 3GV5B 4ECZA 2HHHH 2VQFH 3Q8SB 4DR5H 4PWQA 4NXMH 4ME6A 3OSPA 1FVIA 2R7NA 4EFEA 2R92G 1DIKA 2VOBA 3RJ0A 4TUYF 1TWHA 2YCHA 2JA7A 5EOYA 3R5FA 2R8HA
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 3H4D A;  4WD3 A;  1ULZ A;  1XDN A;  2GPS A;  2W6M A;  2Y0S E;  5KFQ A;  2GLT A;  4AQY H;  3I4M G;  3PW5 A;  3GTQ A;  5KFM A;  2FP4 B;  4MV8 A;  1TWG A;  3N44 B;  4A3B G;  2AGO A;  4MTE A;  4ED8 A;  3JZI A;  3GII A;  5GON F;  3GIM A;  4U7C A;  2HGS A;  4RZR A;  1S68 A;  4XYL B;  4RB3 C;  4QWC A;  2XCP A;  3T5L A;  4ECT A;  4LFC H;  2JA6 A;  3KHG A;  2YZG A;  2YS7 A;  2I87 A;  2FKL A;  2WE6 A;  3SE7 A;  5DGA A;  2R6F A;  5KFP A;  4F4W A;  2W71 A;  1DV1 A;  4O3P A;  2FK1 A;  4GKJ H;  2QYZ A;  5BPH A;  5KFG A;  5KFD A;  3PVX A;  5DG8 A;  5JH7 F;  2WB1 E;  5LMN H;  1B04 A;  2V59 A;  3JSN A;  4ZI7 F;  3HOY G;  2UXB H;  2OWO A;  3QZ8 A;  4BBS G;  4IR1 A;  3KAJ A;  1XMO H;  1IOV A;  4ECU A;  1V4Y A;  1Y1V G;  1T94 A;  2FE3 A;  5C8Y F;  2C00 A;  3G6Y A;  3BAA A;  3GIJ A;  2XD4 A;  2JEJ A;  1S0O A;  2P0A A;  4DV3 H;  1S9F A;  3RFC A;  2M05 A;  4IZO A;  2C2E A;  4LF9 H;  2YYA A;  5IYB G;  5KFH A;  1DV2 A;  2WYO A;  5KG1 A;  1Z2P X;  4O3Q A;  1E4G T;  4ETS A;  5K2M A;  1Z2O X;  3GIP A;  4HNV A;  2HVQ A;  3R23 A;  1C30 A;  3UQ8 A;  5F9N A;  1XNR H;  3BJY A;  3SI8 A;  1R9T A;  5DQG A;  4YR0 A;  2ASD A;  1E4F T;  5DQH A;  1ZHQ A;  1TA8 A;  3LWB A;  3GTG A;  3T5J A;  3JSL A;  2W7P A;  2O03 A;  4IRK A;  2RDJ A;  4OX9 H;  3LML A;  4IAJ A;  2WDT A;  3OHB A;  4K0K H;  3TII A;  3PW4 A;  2DIK A;  5KFZ A;  1N32 H;  5C44 G;  2UVU A;  2GPW A;  2IP4 A;  3KXY T;  3Q2O A;  5KG0 A;  5D8D A;  4BBR G;  4C2M A;  4RU9 A;  4DL3 A;  4ECR A;  4EEQ A;  4ECV A;  4YP3 A;  4NLG A;  3MFI A;  3WNZ A;  3MFH A;  1EHI A;  3GIL A;  5DLF A;  4Q0Y A;  2VA3 A;  3TIN A;  2JEF A;  5KG2 A;  4EYI B;  5C1P A;  3MR3 A;  4ED6 A;  2YL2 A;  1K83 A;  3GTL A;  1Y14 B;  1S0N A;  2E2H A;  3GQC A;  3TQ1 A;  2UVR A;  1S0M A;  2HJW A;  3U9T A;  2YU9 A;  2WAQ A;  1W93 A;  1UC8 A;  2BQ3 A;  4ED2 A;  2JA5 G;  2R92 A;  4J9M A;  2BQU A;  4YB8 B;  3HB9 A;  2VQD A;  2JEG A;  5C4X G;  2CZG A;  1C3O A;  1SFO A;  5LYJ F;  2R84 A;  4EYH B;  2HVR A;  3OUU A;  2NVX A;  4DL7 A;  5BMV F;  4YQW A;  2FJZ A;  2IMW P;  1BGW A;  1CE8 A;  2R7K A;  2UVW A;  2WB1 A;  4LF8 H;  4XZ3 B;  3MR6 A;  2XGQ A;  2OH2 A;  3PW7 A;  4YR3 A;  2R82 A;  2W57 A;  4ZQI A;  4A3G G;  2W6P A;  2HVS A;  4C5A A;  2R8I A;  4C5C A;  4MAM A;  1GSA A;  3U9S A;  3M9N B;  1KJI A;  1B6R A;  4IRC A;  2J6U A;  2J6T A;  1EUC B;  4HNU A;  5DLG A;  4J9K A;  4ECS A;  4R7R A;  5KFX A;  1ZHS A;  3E5N A;  4BY1 G;  2UUB H;  4YJ3 F;  4B3T H;  4M7E A;  4LH6 A;  2VR1 A;  4MA5 A;  2CW8 A;  3HXL A;  4BWS C;  3M9O B;  2DLN A;  4IWY A;  1RK5 A;  3N8D A;  5KG4 A;  4JI0 H;  4JV2 A;  5T14 A;  4RNO A;  2FK2 A;  2W8L A;  3MWD A;  1JIH A;  4YAK B;  5CA1 F;  3RB6 A;  2V4Q A;  2YZM A;  4QIW A;  1XMQ H;  3Q8P B;  2W9B A;  3HBL A;  3RV4 A;  2W6O A;  5LA6 F;  4Q43 A;  4LFA H;  1JDB B;  3N43 B;  4QW9 A;  4F50 A;  2YRX A;  4ZHQ F;  3J7A K;  1CQI B;  1B33 N;  4GC6 A;  1GSH A;  2ZDQ A;  4JI1 H;  4EFB A;  4LH7 A;  4UCT A;  2R7L A;  3RIZ A;  3N41 B;  1Y1W G;  3JRW A;  2R93 G;  4J0M A;  3J80 W;  3FDS A;  1N48 A;  4O4H F;  4KHP H;  4A93 G;  2W70 A;  3GTO A;  2BQR A;  3K5I A;  4YY3 H;  2AU0 A;  5FJ8 G;  5HBR B;  2Q2T A;  4BXX G;  2YZN A;  4RUA A;  3RTX A;  4FM9 A;  3IN5 A;  4A2A A;  3NGD A;  4EG0 A;  1VKZ A;  4DV0 H;  3ETH A;  2FB9 A;  3GTJ A;  5JVD F;  4JI2 H;  4CC5 A;  4FBU A;  4I55 F;  3PO2 G;  1S10 A;  4A3E G;  4O4I F;  2XCA A;  4HYK A;  2UU9 H;  1J5E H;  1P8L A;  2PMZ A;  3OHA A;  2R7M A;  3OUZ A;  3MR5 A;  3L4K A;  5KT7 A;  5L1I A;  4J9R A;  5JUM A;  5LL6 b;  2ZDG A;  4JYA H;  1N34 H;  1ZQ7 A;  4X62 H;  1VBG A;  4QWA A;  1BJT A;  2NU7 B;  5L9X A;  2VPS A;  1KJ9 A;  4UFZ A;  5KT3 A;  5KG3 A;  2XGP A;  4B3S H;  1M7J A;  4LSX A;  3F8N A;  4PDB A;  3L2P A;  4QWD A;  2FMA A;  2PVP A;  3V4S A;  4EBD A;  3FMA A;  2C2D A;  3C0F B;  5KKN B;  3M4I A;  4EGQ A;  1GGO A;  4HQ6 A;  4TV9 F;  4O3N A;  3RGX A;  3OSN A;  4TQS A;  3GIQ A;  4X66 H;  3KHR A;  4ECQ A;  1VS0 A;  2FPP B;  4FS1 A;  5KFJ A;  4C5B A;  4AYB E;  5LMU H;  1JKJ B;  3PR4 A;  3R5X A;  5IYD G;  4DL5 A;  2V9W A;  2W6N A;  5KFO A;  3N6X A;  4J9O A;  1L2Z A;  5KFN A;  5FLX W;  5BR8 H;  3HKZ E;  5KX5 F;  4DV7 H;  4O2A F;  4A3F G;  1K1Q A;  4IHJ F;  1I6U A;  5FLM G;  2W6Z A;  3WO0 A;  4ED7 A;  1S97 A;  3GTM A;  3PR5 B;  3MR2 A;  1ZET A;  2MCT A;  4FS2 A;  4UCR A;  2C28 A;  5D1P A;  1PX2 A;  4QWB A;  1PK8 A;  4B3R H;  1JX4 A;  4EBE A;  1IOW A;  2JA7 G;  3FKI G;  4I4T F;  2ASJ A;  1KJ8 A;  2V58 A;  4JI4 H;  4MV3 A;  1V51 A;  3IG0 A;  4XX0 B;  3RUP A;  2Y0S A;  4JI7 H;  2B63 G;  4DLK A;  3N40 P;  2CW7 A;  3K3P A;  1HNX H;  5DGB A;  3OTO H;  2FPG B;  5KFY A;  3BQ2 A;  4LF6 H;  1Y1W A;  4E4T A;  2R93 A;  3ETJ A;  4DR6 H;  5KFI A;  1TWF A;  4LF7 H;  2W9A A;  1W96 A;  1KJJ A;  3KHH A;  4JI8 H;  4YR2 A;  2C35 B;  3GLK A;  5EWF A;  3H0G G;  3G8C A;  4J9Q A;  2UUA H;  3MJF A;  1WSC A;  4UCU A;  1IBK H;  1DGS A;  2VUM G;  5J2T F;  3V4Z A;  3BQ1 A;  2FK3 A;  5KFU A;  3RBE A;  2J9G A;  5CA0 F;  4LF4 H;  3KHL A;  2DZD A;  1CQJ B;  4I50 F;  5KFW A;  2CKZ B;  1JLL B;  3QFF A;  1I50 A;  4EGJ A;  3RBD A;  5IYZ F;  4CC6 A;  4RAY A;  1VBH A;  4JV5 H;  2QK4 A;  1TAE A;  4I7H A;  1T3N A;  4MV7 A;  4A3I G;  4ED1 A;  2BR0 A;  3GTP A;  4HR7 A;  4APM A;  3KTM A;  2WTF A;  1M0T A;  3I12 A;  1SEI A;  1TWA A;  4J9P A;  3BAB A;  1I7L A;  5LP6 F;  2W9B B;  3H3V H;  4UCS A;  4DR1 H;  4NXN H;  5C3E G;  1Y1V A;  3HOZ G;  2YS6 A;  5F9L A;  4Q8F A;  1N36 H;  2ATL A;  4J9L A;  2ZJT A;  1A9X A;  4MV1 A;  4ED3 A;  4DR3 H;  3RB3 A;  1WCM G;  1I3Q A;  2KSW A;  2UVV A;  3ORR A;  2ZDH A;  4DV6 H;  1RYR A;  2YW2 A;  4RB2 C;  3RAQ A;  3PW2 A;  2AQ4 A;  3RAX A;  2ASL A;  4EEY A;  3EYY A;  2VUG A;  4DL2 A;  4A3C G;  5IP9 G;  2R85 A;  2AGP A;  1FJG H;  2NU8 B;  4DR4 H;  4A3K G;  1GSO A;  2CQY A;  3TQT A;  1GYF A;  2NUA B;  4Q45 A;  5KFC A;  4RUC A;  5KG7 A;  2SCU B;  2V4R A;  1SCU B;  4HNT A;  1HNW H;  3EPG A;  5L1J A;  1TWC A;  5DG7 A;  4JV0 A;  5FD6 A;  5EWE A;  5LOV F;  1X9N A;  5KT6 A;  3RB0 A;  1GLV A;  5IT9 W;  4IRD A;  4F4X A;  2VA2 A;  3VPB A;  5DG9 A;  1WH2 A;  5KFL A;  1M6V A;  2JA8 G;  4F4Y A;  2R86 A;  5KT4 A;  3I4N G;  4ECY A;  1RYS A;  2RF4 A;  2R8J A;  3FKI A;  4TV8 F;  1UC9 A;  4A2B A;  2NVY A;  5EDW A;  3PZP A;  3LP8 A;  4DV4 H;  1RK6 A;  3PN1 A;  4IWX A;  4YHH H;  5IYC G;  4GLX A;  4IR9 A;  1UNN C;  3R5H A;  2B63 A;  4YAJ B;  4UCV A;  4DUZ H;  3K5H A;  3G6V A;  1VAJ A;  2WAQ E;  2XCL A;  2XIG A;  2E5L H;  3RB4 A;  3RV3 A;  4R8U B;  3CVZ A;  5FPO A;  5KFK A;  4EBC A;  3JAM W;  3G6X A;  4Y8V B;  2JA5 A;  4RB1 A;  4O3R A;  4YJ2 F;  5CB4 F;  2IA6 A;  3H40 A;  4DV5 H;  2Q2U A;  1CS0 A;  4MV6 A;  3UFX B;  4R8U A;  1HR0 H;  4O4L F;  4LFB H;  3H0G A;  1A0I A;  2I80 A;  3KAL A;  3VPC A;  1B6S A;  1MZB A;  5KFT A;  1WR2 A;  5KFF A;  2W8K A;  4A3L G;  1KC7 A;  2VUM A;  5L1K A;  5J2U F;  4QW8 A;  4DL4 A;  4YBZ B;  2VPQ A;  5KFV A;  5EZY F;  4O3O A;  2IBK A;  4ZOL F;  4DUY H;  2R8G A;  3GTK A;  3VMM A;  5A2Q W;  4ECW A;  1GO3 E;  1AUX A;  3K3V A;  4UCO A;  3M9M B;  4A3J G;  1BXR A;  5JQW A;  2C22 A;  2UUC H;  2R7Z G;  4DR7 H;  5IP7 G;  1Z2N X;  3TIG A;  3ORQ A;  4G3I A;  3GID A;  1KEE A;  2V5A A;  3DF7 A;  3V6H A;  4O2B F;  1EUD B;  5H80 A;  3WO1 A;  2W7O A;  3PO3 G;  2ALZ A;  4MV9 A;  3T5K A;  4QIW E;  1SYX B;  5CAE B;  4J9S A;  3HOW G;  2OLS A;  5L1L A;  2X0S A;  4FBT A;  3GV7 B;  2W6Q A;  2W9C B;  2J6S A;  1WCM A;  3CQZ A;  1KJQ A;  4QJF A;  4RB0 A;  1I7N A;  5FD5 A;  4X65 H;  1T36 A;  2JA6 G;  2NU9 B;  4RZQ A;  3T5H A;  2C2R A;  1I94 H;  3BA9 A;  4JUZ A;  3V6K A;  2W9C A;  4RAZ A;  3HOV G;  5FPR A;  3Q8R B;  3H4B A;  4FU0 A;  2R8K A;  4ED0 A;  4BY7 G;  3VPD A;  3KAK A;  2R87 A;  1BNC A;  1V9P A;  1EZ1 A;  3EPI A;  4DV1 H;  4GKK H;  5KG5 A;  2PBZ A;  5KT5 A;  2RGV A;  3BQ0 A;  2FLL A;  5KFA A;  4LF5 H;  1K1S A;  4LSA A;  4ECX A;  1S03 G;  3PW0 A;  3MWE A;  4MV4 A;  4RNN A;  1OWT A;  1AN7 A;  1RJR A;  3BA8 A;  2E2I A;  4TQR A;  2PMZ E;  4M9U A;  5D1O B;  4JI5 H;  2NU6 B;  1JXL A;  1EYZ A;  2I8C A;  2PN1 A;  3QZ7 A;  5LXT F;  4WBN F;  1AUV A;  2UXD H;  2YRW A;  3T1Y H;  5KFB A;  5JVL A;  3GIK A;  5KFE A;  5HV6 A;  4GC7 A;  2AGQ A;  1N33 H;  3Q8Q B;  3HOU G;  5D1O A;  5BPF A;  4MTD A;  4DR2 H;  3RF2 A;  4JV1 A;  5KT2 A;  1N56 A;  3MWM A;  5KFR A;  5EWG A;  1FKA H;  2VQE H;  4JI3 H;  4J9N A;  2UXC H;  4AYB A;  3Q1K A;  4B3M H;  5I47 A;  3HOX G;  4XYM B;  2RDI A;  2XC9 A;  3T1H H;  4A3M G;  1RJP A;  2DPJ A;  3AYH B;  4Q8E A;  4O3S A;  2DPI A;  4MA0 A;  4RNM A;  4DV2 H;  4A3D G;  2RGR A;  3L4J A;  3HKZ A;  1JDE A;  1O75 A;  4QWE A;  2FPI B;  3V6J A;  2DWC A;  1XNQ H;  2FLN A;  2F4V H;  4F4Z A;  4U6P A;  5KFS A;  4X64 H;  5KG6 A;  2JEI A;  1HNZ H;  3H20 A;  1E4E B;  4LMY A;  5C1O A;  3N42 B;  5IWA H;  3J81 W;  4DL6 A;  2FLP A;  4JI6 H;  3RGZ A;  3BG5 A;  3JRX A;  5DQI A;  4L1K A;  3GV8 B;  1IBM H;  2R7Z A;  1IBL H;  4Q44 A;  1KBL A;  1M0W A;  5C5J A;  1E4E A;  2ZM6 H;  1RJQ A;  3GV5 B;  4ECZ A;  2HHH H;  2VQF H;  3Q8S B;  4DR5 H;  4PWQ A;  4NXM H;  4ME6 A;  3OSP A;  1FVI A;  2R7N A;  4EFE A;  2R92 G;  1DIK A;  2VOB A;  3RJ0 A;  4TUY F;  1TWH A;  2YCH A;  2JA7 A;  5EOY A;  3R5F A;  2R8H A; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...