1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
1Z2NX 2FLPA 5T14A 3HBLA 4MV9A 2V58A 4O4IF 2RDIA 1B04A 3WNZA 1S10A 2R84A 3MWEA 5JH7F 5KG7A 3SE7A 4AYBE 3SI8A 2DIKA 2JEGA 2J6TA 4ED8A 5CB4F 5DGBA 3RFCA 3M9MB 1JLLB 4LSXA 4MV3A 1EUDB 5IYZF 2FPIB 3NGDA 4LFCH 1GSAA 4ZQIA 3GTPA 4RB2C 3BG5A 1S0NA 4EEQA 5C3EG 4QWAA 3JZIA 2XGPA 3PW4A 2UVVA 1I50A 4LF9H 1I94H 3RGXA 4YJ2F 3QZ7A 2RDJA 1XNRH 3RB3A 4X66H 3MR2A 3PW2A 4O3QA 3R23A 2OWOA 5KFXA 3KHGA 2AGPA 2FLLA 5C1OA 2HVQA 1GLVA 4C2MA 2W8KA 4J9QA 4X62H 2V4RA 2W6QA 1E4GT 1E4EB 1Y1VA 5KG6A 5IYCG 4AQYH 3V6HA 4F4XA 1Y1WG 2DPIA 4ED6A 1A0IA 4JI8H 2R6FA 4ECUA 3KALA 2XGQA 2R7KA 3GTOA 1EUCB 3Q1KA 2C28A 2YRWA 4ED3A 2JEJA 4IAJA 1T3NA 3HOYG 4DV0H 2Q2TA 4JV0A 4UCUA 2JA6G 1IBMH 1TWAA 3BQ0A 1UC8A 3L2PA 4HNVA 1RK5A 1X9NA 3KHLA 1S0MA 3Q8PB 5EOYA 3HOWG 3HXLA 4TQRA 4DL7A 4AYBA 5JQWA 4ECRA 4YAJB 1I7NA 4YHHH 1KEEA 3HB9A 1CQIB 5DG8A 2UVUA 2FKLA 2YL2A 3GTQA 4DR7H 4K0KH 4A2BA 5C44G 2GLTA 2C22A 3H0GA 2I8CA 5CAEB 1I3QA 4BBSG 2JEIA 5HV6A 4EEYA 4RNNA 4DR1H 3HOZG 5KFBA 4ETSA 3N6XA 4G3IA 2R7LA 2I87A 2W6NA 4LSAA 1RYSA 2E2HA 1HNXH 2R7MA 4F4YA 1N34H 5KFKA 3RV4A 5KFQA 2YU9A 2WAQE 5BPFA 3N42B 3QZ8A 3WO0A 2R93A 1C30A 3GILA 2ATLA 2CW8A 2RGRA 4FS2A 2W57A 1E4EA 1SEIA 1EHIA 5FLXW 1FKAH 2R92A 3MWMA 2CQYA 1RK6A 4ECZA 2CKZB 4ECQA 2JA5G 3OUUA 2UUBH 3PO2G 2WE6A 4FM9A 2YCHA 4XZ3B 1VBHA 2UU9H 1JDEA 4EYIB 1M7JA 3TINA 3I4NG 3K3VA 2R8HA 1DGSA 1N36H 5CA1F 4RAZA 3RBEA 4GLXA 4EBCA 2F4VH 4QW9A 1Z2PX 5KG4A 3JRXA 3OSPA 4J9SA 2FPPB 4BWSC 2RF4A 4GC6A 3V6JA 2NU7B 2VOBA 2ASLA 3GIPA 4YQWA 2HJWA 1K83A 2YW2A 1OWTA 5FPOA 4F4ZA 4B3RH 5KFDA 3Q8RB 1HNWH 3G6XA 2PMZA 4O3NA 1WSCA 1XMOH 2CZGA 4FU0A 4UCOA 2W6ZA 5KFJA 1BJTA 4RZRA 5KFMA 1N48A 3VMMA 4JI0H 4RNMA 2YZNA 1C3OA 3JRWA 3OHBA 4EBEA 5H80A 1K1QA 4MA0A 5EZYF 4QWBA 4R7RA 4DUYH 1KC7A 3T5KA 4L1KA 1N33H 3GIKA 2IA6A 3RTXA 3QFFA 4JUZA 4TV8F 1WH2A 4R8UA 1S68A 3JAMW 2R92G 2AU0A 1N56A 4JI6H 2PBZA 4MV8A 5KX5F 4QW8A 5LOVF 2OH2A 3PW7A 3L4JA 4IWYA 4DV5H 2VA3A 3GTLA 1KJ8A 4UFZA 5KFUA 1PK8A 4MV6A 2W6OA 3K5IA 1XNQH 3GV5B 5KG5A 1SYXB 4I55F 4TQSA 4J9KA 5C4XG 1KBLA 3MWDA 3N43B 2ASJA 4GKKH 1ULZA 1WCMG 3M4IA 3LP8A 2PVPA 4LF5H 4OX9H 4PWQA 1TAEA 3ETHA 5KT5A 3RF2A 4EFBA 4DV4H 4DR5H 2NU6B 1BNCA 2W9BA 3IN5A 4CC6A 2FLNA 3JSNA 5DQGA 3BQ1A 4ECSA 2FPGB 3EYYA 4A3EG 5KG2A 3RB0A 4NLGA 4DV3H 1RJRA 4A3DG 1IOVA 2WB1E 3BA9A 2NU8B 3MFIA 5LP6F 3KTMA 4JV2A 1V51A 3RAXA 5HBRB 4DL3A 1SCUB 3U9SA 4DV1H 2GPSA 5KFYA 3KAJA 2JA5A 4TV9F 3GIQA 4BY1G 5DG9A 3ETJA 3T5HA 4A3KG 1R9TA 5FJ8G 2R7ZG 5F9NA 2ZDQA 3N40P 4MV7A 3V4SA 5FLMG 3V6KA 4A3FG 3GTJA 1FVIA 4YAKB 4X64H 2R8GA 3N8DA 3L4KA 1XMQH 4MV4A 4NXMH 2JA7G 5LL6b 4IHJF 1UNNC 3R5FA 2BQUA 4O2AF 2W9CB 2BQ3A 4ZOLF 2XC9A 3M9NB 2RGVA 2W8LA 2C2DA 2HVRA 1VAJA 2W6PA 2SCUB 4DR2H 3MR3A 4J9MA 5KFAA 2FJZA 4EGQA 3UQ8A 5KFHA 1JKJB 5KFSA 5L1IA 4JV1A 3M9OB 4JI4H 3GTKA 4C5BA 4F4WA 2FE3A 3GIJA 4RNOA 2NVYA 2I80A 4A3BG 4MTEA 5LMNH 3GV7B 4FBTA 1CE8A 4DLKA 1CS0A 1AUVA 5LMUH 4JYAH 2E5LH 3V4ZA 4RB0A 2W71A 4HNTA 1S9FA 2HHHH 4LFAH 1DV1A 1S97A 3GTMA 2XIGA 2Q2UA 1K1SA 1JX4A 4QIWE 3PN1A 1HNZH 4IRKA 4KHPH 4U7CA 1I7LA 4ECYA 2FK2A 4ED1A 1N32H 3HKZE 4ED2A 2ZM6H 3H4BA 3RUPA 4RUCA 2WB1A 4J9NA 2OLSA 5KG3A 5JVDF 4LFBH 4C5CA 5FPRA 3N44B 4YR2A 2DLNA 5KG1A 4QWCA 4A3JG 3MFHA 5KFEA 2AQ4A 4BXXG 3OHAA 5EDWA 3RBDA 2V59A 2VUGA 3H40A 3TQTA 1HR0H 4E4TA 3OUZA 5DGAA 4JI7H 3EPIA 4MA5A 5KT3A 1RJQA 3F8NA 3TIIA 1L2ZA 4U6PA 5D1PA 4Q44A 2BR0A 4I50F 1GSHA 5FD6A 2B63G 1WCMA 5JVLA 4LF8H 1TWCA 3G6VA 1ZHQA 3FMAA 4LF4H 4Q8EA 4ECXA 1I6UA 4JI5H 4I4TF 3J81W 2R8JA 1MZBA 1DIKA 1PX2A 2R82A 5DLFA 4J0MA 2R8KA 2W9CA 2VA2A 4B3TH 3RB4A 4BY7G 4LH6A 3K5HA 3UFXB 4IR1A 2NVXA 1AUXA 3LWBA 2R7NA 4I7HA 5KFCA 4ECVA 4WD3A 4Y8VB 4F50A 4DV6H 5KFGA 5FD5A 1B6SA 1KJJA 3GIDA 1RYRA 4TUYF 2YYAA 4YBZB 1ZETA 1M0WA 4FBUA 1EYZA 2UXBH 1GGOA 5J2UF 4J9OA 2W6MA 2R7ZA 1Z2OX 2R87A 1CQJB 1V9PA 2ALZA 4QIWA 1S0OA 5BMVF 2C2EA 2C2RA 4A3LG 4J9RA 3KHHA 4ECWA 2WAQA 2DWCA 2Y0SE 5KFFA 1J5EH 2J6SA 1EZ1A 5L1JA 2PN1A 3TQ1A 1TWGA 3G8CA 4IWXA 2VPQA 4DL4A 2JA7A 5KFRA 2UUAH 2XCAA 2R85A 3PR4A 4LH7A 4DR6H 2UXCH 4LF7H 3CVZA 5KFOA 5EWFA 2ZDHA 2FB9A 2QK4A 3BA8A 3FDSA 2W70A 3PZPA 4RB3C 4RU9A 2DPJA 4FS1A 2JA8G 2AGQA 1BXRA 2WDTA 5IWAH 3BQ2A 3PVXA 3PR5B 1VBGA 2J9GA 5DG7A 5IP9G 1B33N 4YB8B 1M6VA 2MCTA 4EG0A 2HGSA 2YZMA 4MAMA 5DLGA 3FKIA 3AYHB 3LMLA 1BGWA 3U9TA 4XYMB 2J6UA 5F9LA 3MR5A 2R8IA 1VKZA 3R5HA 2IP4A 5GONF 3VPCA 4EGJA 4A2AA 4DL2A 2VQDA 3DF7A 3MJFA 5L9XA 4ED7A 3MR6A 4HYKA 4PDBA 2M05A 4EYHB 4A93G 1FJGH 3TIGA 1T36A 5EWEA 5C8YF 3KHRA 5KFLA 2W7PA 1RJPA 3CQZA 4XYLB 2C35B 4Q45A 2KSWA 3BJYA 1IOWA 1KJQA 4O4LF 3R5XA 4HR7A 3J7AK 5KFZA 3PW0A 2CW7A 4M9UA 5IYDG 2UVRA 3RV3A 4YR0A 1IBLH 3KAKA 4Q0YA 2FK3A 3OSNA 2UVWA 1Y14B 2QYZA 4HNUA 1M0TA 1E4FT 2Y0SA 4O4HF 4M7EA 5BPHA 1TWFA 3GIMA 3EPGA 3G6YA 3RJ0A 3H3VH 2B63A 4UCVA 2HVSA 3N41B 4JI3H 3HOXG 4ECTA 4NXNH 1B6RA 4O3SA 2YS7A 5KFPA 2XCPA 4WBNF 4DL5A 4QWEA 5IP7G 1S03G 5IT9W 5KT4A 4IRDA 4ME6A 3RGZA 3BAAA 3E5NA 2R93G 2WTFA 4RUAA 3T1YH 2VR1A 5DQIA 4YR3A 5KT6A 4DR3H 3PO3G 1XDNA 5JUMA 2YZGA 2ZJTA 4QJFA 4APMA 3FKIG 1DV2A 3Q8SB 5KT7A 1JIHA 2FP4B 4CC5A 4RAYA 3T5LA 1TA8A 1V4YA 5KFVA 3J80W 2NU9B 2FK1A 4O2BF 4DL6A 5LA6F 1GSOA 5KG0A 2E2IA 3RAQA 3T1HH 2BQRA 5L1LA 3ORQA 1GYFA 4DUZH 4DV7H 4HQ6A 5IYBG 4QWDA 5KFWA 3GTGA 5CA0F 5A2QW 2P0AA 3KXYT 3VPDA 5KFTA 2PMZE 4O3OA 4JI1H 5LYJF 3RIZA 2VPSA 4RB1A 5D1OB 1KJIA 5KT2A 3OTOH 2VUMA 3GIIA 3PW5A 2AGOA 3H20A 4A3MG 2GPWA 2VQEH 2UUCH 2YRXA 4B3SH 4RZQA 1ZHSA 3Q2OA 2W9AA 3JSLA 4EBDA 2JEFA 4YJ3F 1Y1VG 4MV1A 2YS6A 4R8UB 2FMAA 3I12A 4Q43A 2C00A 3I4MG 4UCRA 2IBKA 1AN7A 3GQCA 1JDBB 1SFOA 5D8DA 4A3CG 1ZQ7A 1WR2A 3ORRA 5I47A 4IZOA 2NUAB 5L1KA 3GLKA 4JV5H 5KFNA 4LF6H 3IG0A 4J9LA 4YP3A 2V9WA 4JI2H 3H4DA 1W93A 4UCSA 3HOVG 2V5AA 2O03A 2X0SA 1KJ9A 4XX0B 4ZHQF 4X65H 2VQFH 3BABA 4C5AA 1O75A 1W96A 3RB6A 5K2MA 2W7OA 4DV2H 1IBKH 4ED0A 3T5JA 3HOUG 4IRCA 3K3PA 2XCLA 2V4QA 2W9BB 5LXTF 3C0FB 3HKZA 4IR9A 5EWGA 5BR8H 5J2TF 2WYOA 2ZDGA 1P8LA 4DR4H 3VPBA 1JXLA 3Q8QB 1VS0A 4Q8FA 5KKNB 4BBRG 2XD4A 2IMWP 2ASDA 4A3GG 1Y1WA 1TWHA 4J9PA 4EFEA 4O3RA 2R86A 3GV8B 3H0GG 1A9XA 4ZI7F 1UC9A 5C5JA 4MTDA 1T94A 2DZDA 4UCTA 4A3IG 5DQHA 1GO3E 4LMYA 5D1OA 4YY3H 2VUMG 5C1PA 4GC7A 4O3PA 5KFIA 2UXDH 4GKJH 3WO1A 2JA6A 4B3MH
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 1Z2N X;  2FLP A;  5T14 A;  3HBL A;  4MV9 A;  2V58 A;  4O4I F;  2RDI A;  1B04 A;  3WNZ A;  1S10 A;  2R84 A;  3MWE A;  5JH7 F;  5KG7 A;  3SE7 A;  4AYB E;  3SI8 A;  2DIK A;  2JEG A;  2J6T A;  4ED8 A;  5CB4 F;  5DGB A;  3RFC A;  3M9M B;  1JLL B;  4LSX A;  4MV3 A;  1EUD B;  5IYZ F;  2FPI B;  3NGD A;  4LFC H;  1GSA A;  4ZQI A;  3GTP A;  4RB2 C;  3BG5 A;  1S0N A;  4EEQ A;  5C3E G;  4QWA A;  3JZI A;  2XGP A;  3PW4 A;  2UVV A;  1I50 A;  4LF9 H;  1I94 H;  3RGX A;  4YJ2 F;  3QZ7 A;  2RDJ A;  1XNR H;  3RB3 A;  4X66 H;  3MR2 A;  3PW2 A;  4O3Q A;  3R23 A;  2OWO A;  5KFX A;  3KHG A;  2AGP A;  2FLL A;  5C1O A;  2HVQ A;  1GLV A;  4C2M A;  2W8K A;  4J9Q A;  4X62 H;  2V4R A;  2W6Q A;  1E4G T;  1E4E B;  1Y1V A;  5KG6 A;  5IYC G;  4AQY H;  3V6H A;  4F4X A;  1Y1W G;  2DPI A;  4ED6 A;  1A0I A;  4JI8 H;  2R6F A;  4ECU A;  3KAL A;  2XGQ A;  2R7K A;  3GTO A;  1EUC B;  3Q1K A;  2C28 A;  2YRW A;  4ED3 A;  2JEJ A;  4IAJ A;  1T3N A;  3HOY G;  4DV0 H;  2Q2T A;  4JV0 A;  4UCU A;  2JA6 G;  1IBM H;  1TWA A;  3BQ0 A;  1UC8 A;  3L2P A;  4HNV A;  1RK5 A;  1X9N A;  3KHL A;  1S0M A;  3Q8P B;  5EOY A;  3HOW G;  3HXL A;  4TQR A;  4DL7 A;  4AYB A;  5JQW A;  4ECR A;  4YAJ B;  1I7N A;  4YHH H;  1KEE A;  3HB9 A;  1CQI B;  5DG8 A;  2UVU A;  2FKL A;  2YL2 A;  3GTQ A;  4DR7 H;  4K0K H;  4A2B A;  5C44 G;  2GLT A;  2C22 A;  3H0G A;  2I8C A;  5CAE B;  1I3Q A;  4BBS G;  2JEI A;  5HV6 A;  4EEY A;  4RNN A;  4DR1 H;  3HOZ G;  5KFB A;  4ETS A;  3N6X A;  4G3I A;  2R7L A;  2I87 A;  2W6N A;  4LSA A;  1RYS A;  2E2H A;  1HNX H;  2R7M A;  4F4Y A;  1N34 H;  5KFK A;  3RV4 A;  5KFQ A;  2YU9 A;  2WAQ E;  5BPF A;  3N42 B;  3QZ8 A;  3WO0 A;  2R93 A;  1C30 A;  3GIL A;  2ATL A;  2CW8 A;  2RGR A;  4FS2 A;  2W57 A;  1E4E A;  1SEI A;  1EHI A;  5FLX W;  1FKA H;  2R92 A;  3MWM A;  2CQY A;  1RK6 A;  4ECZ A;  2CKZ B;  4ECQ A;  2JA5 G;  3OUU A;  2UUB H;  3PO2 G;  2WE6 A;  4FM9 A;  2YCH A;  4XZ3 B;  1VBH A;  2UU9 H;  1JDE A;  4EYI B;  1M7J A;  3TIN A;  3I4N G;  3K3V A;  2R8H A;  1DGS A;  1N36 H;  5CA1 F;  4RAZ A;  3RBE A;  4GLX A;  4EBC A;  2F4V H;  4QW9 A;  1Z2P X;  5KG4 A;  3JRX A;  3OSP A;  4J9S A;  2FPP B;  4BWS C;  2RF4 A;  4GC6 A;  3V6J A;  2NU7 B;  2VOB A;  2ASL A;  3GIP A;  4YQW A;  2HJW A;  1K83 A;  2YW2 A;  1OWT A;  5FPO A;  4F4Z A;  4B3R H;  5KFD A;  3Q8R B;  1HNW H;  3G6X A;  2PMZ A;  4O3N A;  1WSC A;  1XMO H;  2CZG A;  4FU0 A;  4UCO A;  2W6Z A;  5KFJ A;  1BJT A;  4RZR A;  5KFM A;  1N48 A;  3VMM A;  4JI0 H;  4RNM A;  2YZN A;  1C3O A;  3JRW A;  3OHB A;  4EBE A;  5H80 A;  1K1Q A;  4MA0 A;  5EZY F;  4QWB A;  4R7R A;  4DUY H;  1KC7 A;  3T5K A;  4L1K A;  1N33 H;  3GIK A;  2IA6 A;  3RTX A;  3QFF A;  4JUZ A;  4TV8 F;  1WH2 A;  4R8U A;  1S68 A;  3JAM W;  2R92 G;  2AU0 A;  1N56 A;  4JI6 H;  2PBZ A;  4MV8 A;  5KX5 F;  4QW8 A;  5LOV F;  2OH2 A;  3PW7 A;  3L4J A;  4IWY A;  4DV5 H;  2VA3 A;  3GTL A;  1KJ8 A;  4UFZ A;  5KFU A;  1PK8 A;  4MV6 A;  2W6O A;  3K5I A;  1XNQ H;  3GV5 B;  5KG5 A;  1SYX B;  4I55 F;  4TQS A;  4J9K A;  5C4X G;  1KBL A;  3MWD A;  3N43 B;  2ASJ A;  4GKK H;  1ULZ A;  1WCM G;  3M4I A;  3LP8 A;  2PVP A;  4LF5 H;  4OX9 H;  4PWQ A;  1TAE A;  3ETH A;  5KT5 A;  3RF2 A;  4EFB A;  4DV4 H;  4DR5 H;  2NU6 B;  1BNC A;  2W9B A;  3IN5 A;  4CC6 A;  2FLN A;  3JSN A;  5DQG A;  3BQ1 A;  4ECS A;  2FPG B;  3EYY A;  4A3E G;  5KG2 A;  3RB0 A;  4NLG A;  4DV3 H;  1RJR A;  4A3D G;  1IOV A;  2WB1 E;  3BA9 A;  2NU8 B;  3MFI A;  5LP6 F;  3KTM A;  4JV2 A;  1V51 A;  3RAX A;  5HBR B;  4DL3 A;  1SCU B;  3U9S A;  4DV1 H;  2GPS A;  5KFY A;  3KAJ A;  2JA5 A;  4TV9 F;  3GIQ A;  4BY1 G;  5DG9 A;  3ETJ A;  3T5H A;  4A3K G;  1R9T A;  5FJ8 G;  2R7Z G;  5F9N A;  2ZDQ A;  3N40 P;  4MV7 A;  3V4S A;  5FLM G;  3V6K A;  4A3F G;  3GTJ A;  1FVI A;  4YAK B;  4X64 H;  2R8G A;  3N8D A;  3L4K A;  1XMQ H;  4MV4 A;  4NXM H;  2JA7 G;  5LL6 b;  4IHJ F;  1UNN C;  3R5F A;  2BQU A;  4O2A F;  2W9C B;  2BQ3 A;  4ZOL F;  2XC9 A;  3M9N B;  2RGV A;  2W8L A;  2C2D A;  2HVR A;  1VAJ A;  2W6P A;  2SCU B;  4DR2 H;  3MR3 A;  4J9M A;  5KFA A;  2FJZ A;  4EGQ A;  3UQ8 A;  5KFH A;  1JKJ B;  5KFS A;  5L1I A;  4JV1 A;  3M9O B;  4JI4 H;  3GTK A;  4C5B A;  4F4W A;  2FE3 A;  3GIJ A;  4RNO A;  2NVY A;  2I80 A;  4A3B G;  4MTE A;  5LMN H;  3GV7 B;  4FBT A;  1CE8 A;  4DLK A;  1CS0 A;  1AUV A;  5LMU H;  4JYA H;  2E5L H;  3V4Z A;  4RB0 A;  2W71 A;  4HNT A;  1S9F A;  2HHH H;  4LFA H;  1DV1 A;  1S97 A;  3GTM A;  2XIG A;  2Q2U A;  1K1S A;  1JX4 A;  4QIW E;  3PN1 A;  1HNZ H;  4IRK A;  4KHP H;  4U7C A;  1I7L A;  4ECY A;  2FK2 A;  4ED1 A;  1N32 H;  3HKZ E;  4ED2 A;  2ZM6 H;  3H4B A;  3RUP A;  4RUC A;  2WB1 A;  4J9N A;  2OLS A;  5KG3 A;  5JVD F;  4LFB H;  4C5C A;  5FPR A;  3N44 B;  4YR2 A;  2DLN A;  5KG1 A;  4QWC A;  4A3J G;  3MFH A;  5KFE A;  2AQ4 A;  4BXX G;  3OHA A;  5EDW A;  3RBD A;  2V59 A;  2VUG A;  3H40 A;  3TQT A;  1HR0 H;  4E4T A;  3OUZ A;  5DGA A;  4JI7 H;  3EPI A;  4MA5 A;  5KT3 A;  1RJQ A;  3F8N A;  3TII A;  1L2Z A;  4U6P A;  5D1P A;  4Q44 A;  2BR0 A;  4I50 F;  1GSH A;  5FD6 A;  2B63 G;  1WCM A;  5JVL A;  4LF8 H;  1TWC A;  3G6V A;  1ZHQ A;  3FMA A;  4LF4 H;  4Q8E A;  4ECX A;  1I6U A;  4JI5 H;  4I4T F;  3J81 W;  2R8J A;  1MZB A;  1DIK A;  1PX2 A;  2R82 A;  5DLF A;  4J0M A;  2R8K A;  2W9C A;  2VA2 A;  4B3T H;  3RB4 A;  4BY7 G;  4LH6 A;  3K5H A;  3UFX B;  4IR1 A;  2NVX A;  1AUX A;  3LWB A;  2R7N A;  4I7H A;  5KFC A;  4ECV A;  4WD3 A;  4Y8V B;  4F50 A;  4DV6 H;  5KFG A;  5FD5 A;  1B6S A;  1KJJ A;  3GID A;  1RYR A;  4TUY F;  2YYA A;  4YBZ B;  1ZET A;  1M0W A;  4FBU A;  1EYZ A;  2UXB H;  1GGO A;  5J2U F;  4J9O A;  2W6M A;  2R7Z A;  1Z2O X;  2R87 A;  1CQJ B;  1V9P A;  2ALZ A;  4QIW A;  1S0O A;  5BMV F;  2C2E A;  2C2R A;  4A3L G;  4J9R A;  3KHH A;  4ECW A;  2WAQ A;  2DWC A;  2Y0S E;  5KFF A;  1J5E H;  2J6S A;  1EZ1 A;  5L1J A;  2PN1 A;  3TQ1 A;  1TWG A;  3G8C A;  4IWX A;  2VPQ A;  4DL4 A;  2JA7 A;  5KFR A;  2UUA H;  2XCA A;  2R85 A;  3PR4 A;  4LH7 A;  4DR6 H;  2UXC H;  4LF7 H;  3CVZ A;  5KFO A;  5EWF A;  2ZDH A;  2FB9 A;  2QK4 A;  3BA8 A;  3FDS A;  2W70 A;  3PZP A;  4RB3 C;  4RU9 A;  2DPJ A;  4FS1 A;  2JA8 G;  2AGQ A;  1BXR A;  2WDT A;  5IWA H;  3BQ2 A;  3PVX A;  3PR5 B;  1VBG A;  2J9G A;  5DG7 A;  5IP9 G;  1B33 N;  4YB8 B;  1M6V A;  2MCT A;  4EG0 A;  2HGS A;  2YZM A;  4MAM A;  5DLG A;  3FKI A;  3AYH B;  3LML A;  1BGW A;  3U9T A;  4XYM B;  2J6U A;  5F9L A;  3MR5 A;  2R8I A;  1VKZ A;  3R5H A;  2IP4 A;  5GON F;  3VPC A;  4EGJ A;  4A2A A;  4DL2 A;  2VQD A;  3DF7 A;  3MJF A;  5L9X A;  4ED7 A;  3MR6 A;  4HYK A;  4PDB A;  2M05 A;  4EYH B;  4A93 G;  1FJG H;  3TIG A;  1T36 A;  5EWE A;  5C8Y F;  3KHR A;  5KFL A;  2W7P A;  1RJP A;  3CQZ A;  4XYL B;  2C35 B;  4Q45 A;  2KSW A;  3BJY A;  1IOW A;  1KJQ A;  4O4L F;  3R5X A;  4HR7 A;  3J7A K;  5KFZ A;  3PW0 A;  2CW7 A;  4M9U A;  5IYD G;  2UVR A;  3RV3 A;  4YR0 A;  1IBL H;  3KAK A;  4Q0Y A;  2FK3 A;  3OSN A;  2UVW A;  1Y14 B;  2QYZ A;  4HNU A;  1M0T A;  1E4F T;  2Y0S A;  4O4H F;  4M7E A;  5BPH A;  1TWF A;  3GIM A;  3EPG A;  3G6Y A;  3RJ0 A;  3H3V H;  2B63 A;  4UCV A;  2HVS A;  3N41 B;  4JI3 H;  3HOX G;  4ECT A;  4NXN H;  1B6R A;  4O3S A;  2YS7 A;  5KFP A;  2XCP A;  4WBN F;  4DL5 A;  4QWE A;  5IP7 G;  1S03 G;  5IT9 W;  5KT4 A;  4IRD A;  4ME6 A;  3RGZ A;  3BAA A;  3E5N A;  2R93 G;  2WTF A;  4RUA A;  3T1Y H;  2VR1 A;  5DQI A;  4YR3 A;  5KT6 A;  4DR3 H;  3PO3 G;  1XDN A;  5JUM A;  2YZG A;  2ZJT A;  4QJF A;  4APM A;  3FKI G;  1DV2 A;  3Q8S B;  5KT7 A;  1JIH A;  2FP4 B;  4CC5 A;  4RAY A;  3T5L A;  1TA8 A;  1V4Y A;  5KFV A;  3J80 W;  2NU9 B;  2FK1 A;  4O2B F;  4DL6 A;  5LA6 F;  1GSO A;  5KG0 A;  2E2I A;  3RAQ A;  3T1H H;  2BQR A;  5L1L A;  3ORQ A;  1GYF A;  4DUZ H;  4DV7 H;  4HQ6 A;  5IYB G;  4QWD A;  5KFW A;  3GTG A;  5CA0 F;  5A2Q W;  2P0A A;  3KXY T;  3VPD A;  5KFT A;  2PMZ E;  4O3O A;  4JI1 H;  5LYJ F;  3RIZ A;  2VPS A;  4RB1 A;  5D1O B;  1KJI A;  5KT2 A;  3OTO H;  2VUM A;  3GII A;  3PW5 A;  2AGO A;  3H20 A;  4A3M G;  2GPW A;  2VQE H;  2UUC H;  2YRX A;  4B3S H;  4RZQ A;  1ZHS A;  3Q2O A;  2W9A A;  3JSL A;  4EBD A;  2JEF A;  4YJ3 F;  1Y1V G;  4MV1 A;  2YS6 A;  4R8U B;  2FMA A;  3I12 A;  4Q43 A;  2C00 A;  3I4M G;  4UCR A;  2IBK A;  1AN7 A;  3GQC A;  1JDB B;  1SFO A;  5D8D A;  4A3C G;  1ZQ7 A;  1WR2 A;  3ORR A;  5I47 A;  4IZO A;  2NUA B;  5L1K A;  3GLK A;  4JV5 H;  5KFN A;  4LF6 H;  3IG0 A;  4J9L A;  4YP3 A;  2V9W A;  4JI2 H;  3H4D A;  1W93 A;  4UCS A;  3HOV G;  2V5A A;  2O03 A;  2X0S A;  1KJ9 A;  4XX0 B;  4ZHQ F;  4X65 H;  2VQF H;  3BAB A;  4C5A A;  1O75 A;  1W96 A;  3RB6 A;  5K2M A;  2W7O A;  4DV2 H;  1IBK H;  4ED0 A;  3T5J A;  3HOU G;  4IRC A;  3K3P A;  2XCL A;  2V4Q A;  2W9B B;  5LXT F;  3C0F B;  3HKZ A;  4IR9 A;  5EWG A;  5BR8 H;  5J2T F;  2WYO A;  2ZDG A;  1P8L A;  4DR4 H;  3VPB A;  1JXL A;  3Q8Q B;  1VS0 A;  4Q8F A;  5KKN B;  4BBR G;  2XD4 A;  2IMW P;  2ASD A;  4A3G G;  1Y1W A;  1TWH A;  4J9P A;  4EFE A;  4O3R A;  2R86 A;  3GV8 B;  3H0G G;  1A9X A;  4ZI7 F;  1UC9 A;  5C5J A;  4MTD A;  1T94 A;  2DZD A;  4UCT A;  4A3I G;  5DQH A;  1GO3 E;  4LMY A;  5D1O A;  4YY3 H;  2VUM G;  5C1P A;  4GC7 A;  4O3P A;  5KFI A;  2UXD H;  4GKJ H;  3WO1 A;  2JA6 A;  4B3M H; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...