1B33N

Structure of light harvesting complex of allophycocyanin alpha and beta chains/core-linker complex ap*lc7.8
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
67
structure length
67
Chain Sequence
GRLFKITACVPSQTRIRTQRELQNTYFTKLVPYENWFREQQRIQKMGGKIVKVELATGKQGINTGLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis at 2.2 A of orthorhombic crystals presents the asymmetry of the allophycocyanin-linker complex, AP.LC7.8, from phycobilisomes of Mastigocladus laminosus.
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords ALLOPHYCOCYANIN, ALPHA CHAIN
total genus 12
structure length 67
sequence length 67
chains with identical sequence O
ec nomenclature
pdb deposition date 1998-12-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
N PF01383 CpcD CpcD/allophycocyanin linker domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.170 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Allophycocyanin linker chain (domain) 1b33N01
1B33N
chains in the Genus database with same CATH superfamily
3EPIA 3H3VH 4LSAA 4DR4H 4GKJH 2FK1A 3RV4A 3G6YA 1S9FA 2JA7A 3V6HA 1S0OA 4BBSG 2RGVA 4A3DG 2WAQE 3SI8A 3JSLA 5CA0F 4M9UA 4I50F 5KT2A 5J2TF 1RK6A 2FLNA 1TWHA 4JUZA 5DLFA 3PW2A 4MV6A 5JH7F 3G8CA 4OX9H 2F4VH 1WCMG 3SE7A 5IYCG 5KKNB 2HJWA 1J5EH 4LF7H 4BWSC 5HV6A 3T5LA 5DGAA 5KG3A 3G6VA 2FKLA 4X64H 2BQ3A 2AGOA 2R8JA 1W96A 1WR2A 5KFSA 4RNMA 2IA6A 2UU9H 3T5HA 3OUZA 4AYBA 5DG8A 2OWOA 4LF4H 4C5BA 2V5AA 1KJ9A 4DR2H 4ECTA 2M05A 4O3NA 4O2AF 4A93G 4AQYH 2E5LH 1I3QA 4MV7A 4HQ6A 1N32H 5KT4A 3BABA 1BGWA 3M9NB 5FLXW 4O4LF 3VPCA 3VPBA 2WE6A 4QIWE 5LOVF 4RNOA 2JA6A 2NU6B 4IHJF 4TV8F 1Y1VG 1PK8A 1KBLA 5L1JA 3H20A 3Q2OA 1UC8A 2W6OA 1TA8A 4MTDA 1A9XA 4E4TA 3RUPA 3JRWA 1UC9A 2NUAB 3TQTA 4O4HF 4ED0A 1K83A 2V4RA 3GV5B 2R93G 1GSOA 4ME6A 4ZHQF 2ZDHA 4RZQA 3HOVG 3BA8A 5FJ8G 2GPWA 4M7EA 2YU9A 5CAEB 2W8LA 4LH6A 3EPGA 4ZQIA 4BY7G 4YB8B 2UUAH 3BJYA 1B33N 2Q2TA 3E5NA 5EWEA 1TWFA 4A3FG 4NXMH 3Q8SB 2UVUA 3OTOH 2XD4A 1ZHSA 3GIIA 2VUGA 1T3NA 1SCUB 4UCTA 1RK5A 3M9MB 3M9OB 2ZJTA 5LP6F 3V4ZA 4AYBE 4YR3A 2W9CB 4O3OA 3KAKA 2FPIB 4XYLB 4Y8VB 4QWBA 4TQRA 4FS1A 2ALZA 4RAZA 3RIZA 4XYMB 4Q8EA 5KFTA 3OUUA 4C2MA 4A2BA 1S0MA 3N8DA 2VA2A 3FKIA 1RJPA 5KG1A 2XC9A 4Q8FA 4YAJB 4UCVA 1N48A 1JLLB 4DL5A 4A3GG 3OSPA 4EBEA 2FPPB 4QIWA 4LH7A 4XZ3B 2YW2A 3T1HH 2CQYA 4ECRA 3RBDA 1X9NA 4EFEA 2V58A 5KFCA 2VQEH 4ED8A 4YY3H 4TUYF 5LMNH 4FBTA 5KFFA 5DGBA 4U6PA 3H40A 1OWTA 3GIDA 2WTFA 1Y1WA 3R5XA 2R7KA 3N42B 5JVDF 3V4SA 2UVVA 1UNNC 3PR4A 1CQJB 3EYYA 3PZPA 2J6SA 1I6UA 3RJ0A 2YZMA 5IT9W 3V6JA 4JI2H 4DV6H 4JI6H 1IOVA 2R7ZA 3PW0A 3BAAA 4R8UA 2CW7A 4K0KH 5KFUA 4X62H 3TIIA 4DV5H 5IP9G 3T5KA 5FD5A 5LYJF 2RGRA 4MAMA 3H4BA 3IN5A 4CC6A 3GV8B 4EBDA 1IBLH 1I94H 3L4JA 4A3CG 3R5HA 4J9LA 2ATLA 1A0IA 3WNZA 3RGZA 4R7RA 4J9KA 3RFCA 5KT7A 1KC7A 3K3PA 4FBUA 2YL2A 2BQRA 4JV1A 1V51A 3ORQA 5KT3A 3GV7B 2XCLA 4ECYA 3LWBA 3KHLA 2C2EA 1B6SA 3ETJA 2R92G 5C5JA 1HR0H 2R93A 2R86A 3GTPA 5KX5F 1BXRA 3UFXB 2DPIA 4IRCA 4IZOA 2RDIA 3BA9A 4YJ3F 2R7ZG 4XX0B 5KG6A 1EYZA 3I12A 1IOWA 1EHIA 3RB0A 2RF4A 4LF9H 4I7HA 1S68A 3L4KA 2YS7A 4YJ2F 4U7CA 4UCRA 2ZM6H 1DV1A 3R5FA 3GIMA 2XCPA 3R23A 3HOWG 5EOYA 5IP7G 3KXYT 1K1QA 3U9TA 4TQSA 2J9GA 4MV3A 1KJQA 1E4FT 2JEIA 3H0GG 3JAMW 4TV9F 4A2AA 4ED6A 3T5JA 4G3IA 4J9QA 5H80A 3BQ2A 4GLXA 5LXTF 5KT5A 4YR2A 3RB4A 2HHHH 4MV1A 3KTMA 4DR7H 2PVPA 1I7NA 4MTEA 2FE3A 3MFIA 4RB1A 1GGOA 3VPDA 2YYAA 3N40P 4HNTA 2WAQA 4DR5H 2W9CA 2IP4A 1CE8A 2UUCH 4RB2C 2NU8B 2DIKA 5EWGA 4ED7A 4A3IG 3GTQA 2UXCH 4JI3H 3GQCA 4NXNH 2ZDGA 3U9SA 4RZRA 3MR5A 4QWDA 4ECZA 1M7JA 3LP8A 1SYXB 5BMVF 4DV4H 3V6KA 3RAQA 2HGSA 1IBMH 4PDBA 4Q43A 1ZHQA 1SEIA 2SCUB 4CC5A 4JI8H 4B3MH 4MV9A 4MV8A 3MFHA 1S0NA 4EGQA 3LMLA 2FLLA 2GPSA 4PWQA 4X65H 1HNWH 2HVSA 2UVRA 2DLNA 4ECXA 5BR8H 4R8UB 1TWCA 2VPQA 2JEFA 3PR5B 1I7LA 2W7PA 1GLVA 3JZIA 3Q1KA 2R7LA 4QWCA 3PN1A 3Q8QB 2R7NA 1RYSA 2QYZA 2VR1A 2Y0SA 2V4QA 3RAXA 1ZETA 4LMYA 4YR0A 2CZGA 3HB9A 5LL6b 2B63G 3PVXA 2V9WA 5I47A 3Q8RB 5F9NA 5KFQA 2AGPA 3G6XA 1V9PA 3CVZA 1WCMA 1IBKH 2HVQA 3N43B 4GKKH 3MWEA 3GTOA 2GLTA 2VUMA 1FKAH 4EYIB 1Z2OX 4GC6A 5KFGA 2C35B 3K5HA 3N41B 2J6TA 2DPJA 5L1IA 3GIQA 5KFPA 2YS6A 4LF5H 1GSHA 5L9XA 1XNQH 2JA8G 2E2HA 1GSAA 2CKZB 5C1PA 1EZ1A 2C22A 2J6UA 3MR6A 3HKZE 4LFAH 4BXXG 4RB3C 1JXLA 4ETSA 3J7AK 5C8YF 2W57A 1T36A 1ULZA 3RB3A 2C2DA 5KT6A 4IWXA 2VA3A 5FLMG 5HBRB 2W9BB 4MA5A 4DV3H 4EEYA 2XCAA 3HOZG 4DR1H 2JA6G 3N6XA 2W7OA 2JA7G 4J9OA 4JI7H 3RBEA 4RAYA 5A2QW 3UQ8A 4HR7A 3PO3G 1N33H 1GYFA 2UXDH 2NVYA 4BY1G 3NGDA 4ECQA 3I4NG 2KSWA 4EGJA 3HBLA 5JVLA 4F4YA 5C3EG 3KHHA 2JA5G 4WBNF 1Z2PX 5EZYF 5KG0A 3TIGA 4UCOA 1WSCA 1JIHA 4FU0A 3OSNA 3JRXA 3J80W 4DV2H 2R87A 3JSNA 4I55F 4LFCH 2YRXA 4EG0A 2QK4A 5DQGA 1M0WA 3HOXG 2VPSA 3GIKA 4F50A 1M0TA 4F4WA 4EYHB 4A3BG 4IAJA 4QWEA 1KJIA 4DL2A 4JI5H 1Z2NX 1C3OA 5FPOA 4EEQA 2NVXA 1AUXA 1VBHA 5D1OA 2R92A 2OLSA 5LA6F 3OHBA 5KG5A 1JX4A 2JEJA 1BNCA 4F4ZA 4JI4H 1DGSA 1M6VA 1T94A 4IR9A 5KFNA 2R8IA 2IMWP 2AU0A 1TAEA 3MR2A 3HOUG 5KFAA 4BBRG 3N44B 2NU9B 4DUYH 4C5AA 4L1KA 4DV1H 4J9MA 1CS0A 2YZGA 5C1OA 2Q2UA 4IRDA 4KHPH 5KFYA 2OH2A 1P8LA 1RJQA 1C30A 5FPRA 2FMAA 5L1LA 4YHHH 2RDJA 2BQUA 5C4XG 2ASLA 1HNXH 3GILA 1RYRA 1E4GT 5JQWA 2MCTA 4J0MA 3Q8PB 1CQIB 4A3MG 5IYDG 5KFVA 3GTMA 4MV4A 3WO1A 5L1KA 2Y0SE 2VQDA 4O3SA 3RTXA 3QFFA 4A3LG 5KFWA 1DIKA 2W9AA 1N56A 5KFEA 1Y1WG 2YZNA 1FJGH 2UUBH 2FK2A 4C5CA 5EWFA 4YQWA 4J9RA 3RV3A 3CQZA 5KFJA 2R84A 4I4TF 4RUAA 4IR1A 3TINA 4B3TH 5KG4A 2VOBA 1S97A 2XGQA 1R9TA 2FB9A 1E4EB 2I8CA 1VBGA 5BPHA 4JV5H 5BPFA 2O03A 1KJ8A 1GO3E 3F8NA 1HNZH 2FK3A 2V59A 3IG0A 3BQ0A 2NU7B 3M4IA 4FM9A 3HKZA 1JDBB 4Q0YA 1VKZA 2JA5A 1FVIA 5K2MA 3K3VA 1XDNA 1V4YA 5LMUH 4J9NA 2VQFH 3HOYG 3PW4A 2FLPA 2R7MA 4EBCA 3HXLA 5DQHA 3GTJA 2P0AA 3PW5A 4DL7A 4EFBA 2PBZA 4JYAH 4JV0A 1B04A 5DQIA 5IYBG 4APMA 1KEEA 5IYZF 2I87A 1B6RA 5EDWA 5JUMA 2PMZA 3GTLA 2E2IA 4DL3A 1DV2A 1EUDB 1VS0A 2XIGA 4RUCA 5KG7A 4QJFA 5GONF 4GC7A 1AN7A 2ASJA 3MWDA 4A3KG 5KFKA 3QZ7A 2R8GA 2W6QA 3ETHA 2AGQA 4O4IF 3FKIG 3K5IA 4B3RH 1AUVA 2X0SA 2JEGA 5DLGA 1TWAA 3H0GA 1Y1VA 3KHRA 4IRKA 1ZQ7A 3VMMA 4DV0H 1S03G 2VUMG 1JKJB 1W93A 3MWMA 4ECWA 4NLGA 1WH2A 2UVWA 5KFOA 3GIJA 3KALA 2FJZA 3OHAA 1L2ZA 5D1OB 4X66H 2R8HA 3PW7A 2BR0A 4IWYA 4Q45A 5D8DA 2XGPA 5IWAH 2PN1A 4ECVA 2YRWA 1XMQH 4YAKB 4HNVA 2W70A 4J9PA 1XNRH 1O75A 3ORRA 5KFBA 3GTKA 4J9SA 1KJJA 2W6MA 4ECSA 1PX2A 2ZDQA 4JI0H 1E4EA 2WDTA 4A3EG 4FS2A 2I80A 4A3JG 3DF7A 3I4MG 4DUZH 4WD3A 1EUCB 2R8KA 4DR6H 1VAJA 2HVRA 2C28A 5FD6A 4DL6A 3MJFA 5KG2A 1XMOH 4RB0A 5KFIA 2W6NA 3GIPA 2R85A 2WB1A 3GLKA 4LF6H 5KFMA 2ASDA 3WO0A 4LSXA 1BJTA 3GTGA 1RJRA 4Q44A 5F9LA 4QWAA 2W8KA 3J81W 2W9BA 5DG7A 4ECUA 4LFBH 1SFOA 4MA0A 2C00A 2UXBH 5J2UF 5KFRA 1TWGA 3FDSA 1I50A 3MR3A 2W6PA 3RF2A 2W6ZA 2FPGB 4QW8A 3QZ8A 2AQ4A 3RGXA 4DL4A 4UCUA 2WB1E 4HYKA 2FP4B 5CA1F 5DG9A 2DZDA 4YBZB 4ED3A 3H4DA 2B63A 4O3PA 3RB6A 4O3QA 5D1PA 5KFDA 4YP3A 3BQ1A 4HNUA 4DV7H 4O2BF 2W71A 4JV2A 1Y14B 1JDEA 4ED1A 3BG5A 3KHGA 5CB4F 1K1SA 5KFXA 3PO2G 2IBKA 2PMZE 4ED2A 4JI1H 4B3SH 1N34H 4UCSA 3T1YH 4QW9A 5KFLA 2DWCA 2R6FA 2YCHA 4ZOLF 5KFHA 5C44G 4RNNA 3L2PA 4DR3H 2C2RA 1S10A 3AYHB 1MZBA 5T14A 3FMAA 3C0FB 5KFZA 4DLKA 1N36H 4UFZA 4ZI7F 3KAJA 4RU9A 4O3RA 2R82A 2CW8A 3TQ1A 4F4XA 4LF8H 2WYOA
chains in the Genus database with same CATH topology
1B33N
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B33 N; 
#chains in the Genus database with same CATH topology
 3EPI A;  3H3V H;  4LSA A;  4DR4 H;  4GKJ H;  2FK1 A;  3RV4 A;  3G6Y A;  1S9F A;  2JA7 A;  3V6H A;  1S0O A;  4BBS G;  2RGV A;  4A3D G;  2WAQ E;  3SI8 A;  3JSL A;  5CA0 F;  4M9U A;  4I50 F;  5KT2 A;  5J2T F;  1RK6 A;  2FLN A;  1TWH A;  4JUZ A;  5DLF A;  3PW2 A;  4MV6 A;  5JH7 F;  3G8C A;  4OX9 H;  2F4V H;  1WCM G;  3SE7 A;  5IYC G;  5KKN B;  2HJW A;  1J5E H;  4LF7 H;  4BWS C;  5HV6 A;  3T5L A;  5DGA A;  5KG3 A;  3G6V A;  2FKL A;  4X64 H;  2BQ3 A;  2AGO A;  2R8J A;  1W96 A;  1WR2 A;  5KFS A;  4RNM A;  2IA6 A;  2UU9 H;  3T5H A;  3OUZ A;  4AYB A;  5DG8 A;  2OWO A;  4LF4 H;  4C5B A;  2V5A A;  1KJ9 A;  4DR2 H;  4ECT A;  2M05 A;  4O3N A;  4O2A F;  4A93 G;  4AQY H;  2E5L H;  1I3Q A;  4MV7 A;  4HQ6 A;  1N32 H;  5KT4 A;  3BAB A;  1BGW A;  3M9N B;  5FLX W;  4O4L F;  3VPC A;  3VPB A;  2WE6 A;  4QIW E;  5LOV F;  4RNO A;  2JA6 A;  2NU6 B;  4IHJ F;  4TV8 F;  1Y1V G;  1PK8 A;  1KBL A;  5L1J A;  3H20 A;  3Q2O A;  1UC8 A;  2W6O A;  1TA8 A;  4MTD A;  1A9X A;  4E4T A;  3RUP A;  3JRW A;  1UC9 A;  2NUA B;  3TQT A;  4O4H F;  4ED0 A;  1K83 A;  2V4R A;  3GV5 B;  2R93 G;  1GSO A;  4ME6 A;  4ZHQ F;  2ZDH A;  4RZQ A;  3HOV G;  3BA8 A;  5FJ8 G;  2GPW A;  4M7E A;  2YU9 A;  5CAE B;  2W8L A;  4LH6 A;  3EPG A;  4ZQI A;  4BY7 G;  4YB8 B;  2UUA H;  3BJY A;  1B33 N;  2Q2T A;  3E5N A;  5EWE A;  1TWF A;  4A3F G;  4NXM H;  3Q8S B;  2UVU A;  3OTO H;  2XD4 A;  1ZHS A;  3GII A;  2VUG A;  1T3N A;  1SCU B;  4UCT A;  1RK5 A;  3M9M B;  3M9O B;  2ZJT A;  5LP6 F;  3V4Z A;  4AYB E;  4YR3 A;  2W9C B;  4O3O A;  3KAK A;  2FPI B;  4XYL B;  4Y8V B;  4QWB A;  4TQR A;  4FS1 A;  2ALZ A;  4RAZ A;  3RIZ A;  4XYM B;  4Q8E A;  5KFT A;  3OUU A;  4C2M A;  4A2B A;  1S0M A;  3N8D A;  2VA2 A;  3FKI A;  1RJP A;  5KG1 A;  2XC9 A;  4Q8F A;  4YAJ B;  4UCV A;  1N48 A;  1JLL B;  4DL5 A;  4A3G G;  3OSP A;  4EBE A;  2FPP B;  4QIW A;  4LH7 A;  4XZ3 B;  2YW2 A;  3T1H H;  2CQY A;  4ECR A;  3RBD A;  1X9N A;  4EFE A;  2V58 A;  5KFC A;  2VQE H;  4ED8 A;  4YY3 H;  4TUY F;  5LMN H;  4FBT A;  5KFF A;  5DGB A;  4U6P A;  3H40 A;  1OWT A;  3GID A;  2WTF A;  1Y1W A;  3R5X A;  2R7K A;  3N42 B;  5JVD F;  3V4S A;  2UVV A;  1UNN C;  3PR4 A;  1CQJ B;  3EYY A;  3PZP A;  2J6S A;  1I6U A;  3RJ0 A;  2YZM A;  5IT9 W;  3V6J A;  4JI2 H;  4DV6 H;  4JI6 H;  1IOV A;  2R7Z A;  3PW0 A;  3BAA A;  4R8U A;  2CW7 A;  4K0K H;  5KFU A;  4X62 H;  3TII A;  4DV5 H;  5IP9 G;  3T5K A;  5FD5 A;  5LYJ F;  2RGR A;  4MAM A;  3H4B A;  3IN5 A;  4CC6 A;  3GV8 B;  4EBD A;  1IBL H;  1I94 H;  3L4J A;  4A3C G;  3R5H A;  4J9L A;  2ATL A;  1A0I A;  3WNZ A;  3RGZ A;  4R7R A;  4J9K A;  3RFC A;  5KT7 A;  1KC7 A;  3K3P A;  4FBU A;  2YL2 A;  2BQR A;  4JV1 A;  1V51 A;  3ORQ A;  5KT3 A;  3GV7 B;  2XCL A;  4ECY A;  3LWB A;  3KHL A;  2C2E A;  1B6S A;  3ETJ A;  2R92 G;  5C5J A;  1HR0 H;  2R93 A;  2R86 A;  3GTP A;  5KX5 F;  1BXR A;  3UFX B;  2DPI A;  4IRC A;  4IZO A;  2RDI A;  3BA9 A;  4YJ3 F;  2R7Z G;  4XX0 B;  5KG6 A;  1EYZ A;  3I12 A;  1IOW A;  1EHI A;  3RB0 A;  2RF4 A;  4LF9 H;  4I7H A;  1S68 A;  3L4K A;  2YS7 A;  4YJ2 F;  4U7C A;  4UCR A;  2ZM6 H;  1DV1 A;  3R5F A;  3GIM A;  2XCP A;  3R23 A;  3HOW G;  5EOY A;  5IP7 G;  3KXY T;  1K1Q A;  3U9T A;  4TQS A;  2J9G A;  4MV3 A;  1KJQ A;  1E4F T;  2JEI A;  3H0G G;  3JAM W;  4TV9 F;  4A2A A;  4ED6 A;  3T5J A;  4G3I A;  4J9Q A;  5H80 A;  3BQ2 A;  4GLX A;  5LXT F;  5KT5 A;  4YR2 A;  3RB4 A;  2HHH H;  4MV1 A;  3KTM A;  4DR7 H;  2PVP A;  1I7N A;  4MTE A;  2FE3 A;  3MFI A;  4RB1 A;  1GGO A;  3VPD A;  2YYA A;  3N40 P;  4HNT A;  2WAQ A;  4DR5 H;  2W9C A;  2IP4 A;  1CE8 A;  2UUC H;  4RB2 C;  2NU8 B;  2DIK A;  5EWG A;  4ED7 A;  4A3I G;  3GTQ A;  2UXC H;  4JI3 H;  3GQC A;  4NXN H;  2ZDG A;  3U9S A;  4RZR A;  3MR5 A;  4QWD A;  4ECZ A;  1M7J A;  3LP8 A;  1SYX B;  5BMV F;  4DV4 H;  3V6K A;  3RAQ A;  2HGS A;  1IBM H;  4PDB A;  4Q43 A;  1ZHQ A;  1SEI A;  2SCU B;  4CC5 A;  4JI8 H;  4B3M H;  4MV9 A;  4MV8 A;  3MFH A;  1S0N A;  4EGQ A;  3LML A;  2FLL A;  2GPS A;  4PWQ A;  4X65 H;  1HNW H;  2HVS A;  2UVR A;  2DLN A;  4ECX A;  5BR8 H;  4R8U B;  1TWC A;  2VPQ A;  2JEF A;  3PR5 B;  1I7L A;  2W7P A;  1GLV A;  3JZI A;  3Q1K A;  2R7L A;  4QWC A;  3PN1 A;  3Q8Q B;  2R7N A;  1RYS A;  2QYZ A;  2VR1 A;  2Y0S A;  2V4Q A;  3RAX A;  1ZET A;  4LMY A;  4YR0 A;  2CZG A;  3HB9 A;  5LL6 b;  2B63 G;  3PVX A;  2V9W A;  5I47 A;  3Q8R B;  5F9N A;  5KFQ A;  2AGP A;  3G6X A;  1V9P A;  3CVZ A;  1WCM A;  1IBK H;  2HVQ A;  3N43 B;  4GKK H;  3MWE A;  3GTO A;  2GLT A;  2VUM A;  1FKA H;  4EYI B;  1Z2O X;  4GC6 A;  5KFG A;  2C35 B;  3K5H A;  3N41 B;  2J6T A;  2DPJ A;  5L1I A;  3GIQ A;  5KFP A;  2YS6 A;  4LF5 H;  1GSH A;  5L9X A;  1XNQ H;  2JA8 G;  2E2H A;  1GSA A;  2CKZ B;  5C1P A;  1EZ1 A;  2C22 A;  2J6U A;  3MR6 A;  3HKZ E;  4LFA H;  4BXX G;  4RB3 C;  1JXL A;  4ETS A;  3J7A K;  5C8Y F;  2W57 A;  1T36 A;  1ULZ A;  3RB3 A;  2C2D A;  5KT6 A;  4IWX A;  2VA3 A;  5FLM G;  5HBR B;  2W9B B;  4MA5 A;  4DV3 H;  4EEY A;  2XCA A;  3HOZ G;  4DR1 H;  2JA6 G;  3N6X A;  2W7O A;  2JA7 G;  4J9O A;  4JI7 H;  3RBE A;  4RAY A;  5A2Q W;  3UQ8 A;  4HR7 A;  3PO3 G;  1N33 H;  1GYF A;  2UXD H;  2NVY A;  4BY1 G;  3NGD A;  4ECQ A;  3I4N G;  2KSW A;  4EGJ A;  3HBL A;  5JVL A;  4F4Y A;  5C3E G;  3KHH A;  2JA5 G;  4WBN F;  1Z2P X;  5EZY F;  5KG0 A;  3TIG A;  4UCO A;  1WSC A;  1JIH A;  4FU0 A;  3OSN A;  3JRX A;  3J80 W;  4DV2 H;  2R87 A;  3JSN A;  4I55 F;  4LFC H;  2YRX A;  4EG0 A;  2QK4 A;  5DQG A;  1M0W A;  3HOX G;  2VPS A;  3GIK A;  4F50 A;  1M0T A;  4F4W A;  4EYH B;  4A3B G;  4IAJ A;  4QWE A;  1KJI A;  4DL2 A;  4JI5 H;  1Z2N X;  1C3O A;  5FPO A;  4EEQ A;  2NVX A;  1AUX A;  1VBH A;  5D1O A;  2R92 A;  2OLS A;  5LA6 F;  3OHB A;  5KG5 A;  1JX4 A;  2JEJ A;  1BNC A;  4F4Z A;  4JI4 H;  1DGS A;  1M6V A;  1T94 A;  4IR9 A;  5KFN A;  2R8I A;  2IMW P;  2AU0 A;  1TAE A;  3MR2 A;  3HOU G;  5KFA A;  4BBR G;  3N44 B;  2NU9 B;  4DUY H;  4C5A A;  4L1K A;  4DV1 H;  4J9M A;  1CS0 A;  2YZG A;  5C1O A;  2Q2U A;  4IRD A;  4KHP H;  5KFY A;  2OH2 A;  1P8L A;  1RJQ A;  1C30 A;  5FPR A;  2FMA A;  5L1L A;  4YHH H;  2RDJ A;  2BQU A;  5C4X G;  2ASL A;  1HNX H;  3GIL A;  1RYR A;  1E4G T;  5JQW A;  2MCT A;  4J0M A;  3Q8P B;  1CQI B;  4A3M G;  5IYD G;  5KFV A;  3GTM A;  4MV4 A;  3WO1 A;  5L1K A;  2Y0S E;  2VQD A;  4O3S A;  3RTX A;  3QFF A;  4A3L G;  5KFW A;  1DIK A;  2W9A A;  1N56 A;  5KFE A;  1Y1W G;  2YZN A;  1FJG H;  2UUB H;  2FK2 A;  4C5C A;  5EWF A;  4YQW A;  4J9R A;  3RV3 A;  3CQZ A;  5KFJ A;  2R84 A;  4I4T F;  4RUA A;  4IR1 A;  3TIN A;  4B3T H;  5KG4 A;  2VOB A;  1S97 A;  2XGQ A;  1R9T A;  2FB9 A;  1E4E B;  2I8C A;  1VBG A;  5BPH A;  4JV5 H;  5BPF A;  2O03 A;  1KJ8 A;  1GO3 E;  3F8N A;  1HNZ H;  2FK3 A;  2V59 A;  3IG0 A;  3BQ0 A;  2NU7 B;  3M4I A;  4FM9 A;  3HKZ A;  1JDB B;  4Q0Y A;  1VKZ A;  2JA5 A;  1FVI A;  5K2M A;  3K3V A;  1XDN A;  1V4Y A;  5LMU H;  4J9N A;  2VQF H;  3HOY G;  3PW4 A;  2FLP A;  2R7M A;  4EBC A;  3HXL A;  5DQH A;  3GTJ A;  2P0A A;  3PW5 A;  4DL7 A;  4EFB A;  2PBZ A;  4JYA H;  4JV0 A;  1B04 A;  5DQI A;  5IYB G;  4APM A;  1KEE A;  5IYZ F;  2I87 A;  1B6R A;  5EDW A;  5JUM A;  2PMZ A;  3GTL A;  2E2I A;  4DL3 A;  1DV2 A;  1EUD B;  1VS0 A;  2XIG A;  4RUC A;  5KG7 A;  4QJF A;  5GON F;  4GC7 A;  1AN7 A;  2ASJ A;  3MWD A;  4A3K G;  5KFK A;  3QZ7 A;  2R8G A;  2W6Q A;  3ETH A;  2AGQ A;  4O4I F;  3FKI G;  3K5I A;  4B3R H;  1AUV A;  2X0S A;  2JEG A;  5DLG A;  1TWA A;  3H0G A;  1Y1V A;  3KHR A;  4IRK A;  1ZQ7 A;  3VMM A;  4DV0 H;  1S03 G;  2VUM G;  1JKJ B;  1W93 A;  3MWM A;  4ECW A;  4NLG A;  1WH2 A;  2UVW A;  5KFO A;  3GIJ A;  3KAL A;  2FJZ A;  3OHA A;  1L2Z A;  5D1O B;  4X66 H;  2R8H A;  3PW7 A;  2BR0 A;  4IWY A;  4Q45 A;  5D8D A;  2XGP A;  5IWA H;  2PN1 A;  4ECV A;  2YRW A;  1XMQ H;  4YAK B;  4HNV A;  2W70 A;  4J9P A;  1XNR H;  1O75 A;  3ORR A;  5KFB A;  3GTK A;  4J9S A;  1KJJ A;  2W6M A;  4ECS A;  1PX2 A;  2ZDQ A;  4JI0 H;  1E4E A;  2WDT A;  4A3E G;  4FS2 A;  2I80 A;  4A3J G;  3DF7 A;  3I4M G;  4DUZ H;  4WD3 A;  1EUC B;  2R8K A;  4DR6 H;  1VAJ A;  2HVR A;  2C28 A;  5FD6 A;  4DL6 A;  3MJF A;  5KG2 A;  1XMO H;  4RB0 A;  5KFI A;  2W6N A;  3GIP A;  2R85 A;  2WB1 A;  3GLK A;  4LF6 H;  5KFM A;  2ASD A;  3WO0 A;  4LSX A;  1BJT A;  3GTG A;  1RJR A;  4Q44 A;  5F9L A;  4QWA A;  2W8K A;  3J81 W;  2W9B A;  5DG7 A;  4ECU A;  4LFB H;  1SFO A;  4MA0 A;  2C00 A;  2UXB H;  5J2U F;  5KFR A;  1TWG A;  3FDS A;  1I50 A;  3MR3 A;  2W6P A;  3RF2 A;  2W6Z A;  2FPG B;  4QW8 A;  3QZ8 A;  2AQ4 A;  3RGX A;  4DL4 A;  4UCU A;  2WB1 E;  4HYK A;  2FP4 B;  5CA1 F;  5DG9 A;  2DZD A;  4YBZ B;  4ED3 A;  3H4D A;  2B63 A;  4O3P A;  3RB6 A;  4O3Q A;  5D1P A;  5KFD A;  4YP3 A;  3BQ1 A;  4HNU A;  4DV7 H;  4O2B F;  2W71 A;  4JV2 A;  1Y14 B;  1JDE A;  4ED1 A;  3BG5 A;  3KHG A;  5CB4 F;  1K1S A;  5KFX A;  3PO2 G;  2IBK A;  2PMZ E;  4ED2 A;  4JI1 H;  4B3S H;  1N34 H;  4UCS A;  3T1Y H;  4QW9 A;  5KFL A;  2DWC A;  2R6F A;  2YCH A;  4ZOL F;  5KFH A;  5C44 G;  4RNN A;  3L2P A;  4DR3 H;  2C2R A;  1S10 A;  3AYH B;  1MZB A;  5T14 A;  3FMA A;  3C0F B;  5KFZ A;  4DLK A;  1N36 H;  4UFZ A;  4ZI7 F;  3KAJ A;  4RU9 A;  4O3R A;  2R82 A;  2CW8 A;  3TQ1 A;  4F4X A;  4LF8 H;  2WYO A; 
#chains in the Genus database with same CATH homology
 1B33 N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...