4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxide stress regulator PerR, FUR family
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
3COAC 2Q2EA 3DEUA 1DPUA 2HGCA 3CO6C 5FD5A 4L9NA 3TGNA 1FOKA 1P4AA 4I0AA 4YG2F 5HOOA 1BI1A 1L0OC 1ULYA 4ASNA 2XAFA 2QYOA 1FC3A 4CHUA 1YYVA 1LDJA 2GA2A 3CLOA 4HX4A 1U6GA 3WTWC 1GXQA 1B6AA 1HSTA 4M9ZA 4LLGF 2JPCA 3KP5A 3PQJA 4IXAA 2E1CA 5K1YA 2D1HA 3V8LA 1P2FA 4FX0A 1KQ0A 2FNAA 3J80K 1LNWA 2VOOA 4ETSA 1K6OA 4OMZA 1O7LA 3R4KA 1IN6A 4FT8A 4AIJA 3O6BB 5LHIA 4U7DA 4L0ZB 3D0SA 1SD5A 3FHZA 2X4HA 4L5JA 1USTA 4M73A 1PDNC 1YG2A 1ZHFA 5LGTA 4UHTA 4NQWA 1YW9A 4JQFA 4EGYA 2O0YA 1FSEA 2ZXJA 3TDUC 4R8HA 5D5XB 1QBJA 5E18F 3CTAA 4Q4ZF 3FM5A 4DNCA 4LG0B 5BS6A 1K78A 3RYPA 2JTVA 2QBYA 5EEHA 4UXNA 1J0RA 1OR7A 4I98B 4NB5A 4D0PA 2O03A 3Q9VA 3JSOA 5DCMA 5D6EA 3K0LA 1R1TA 4O3MA 1V4RA 4KN4X 5CVRA 1QZYA 2HYFA 1ONVA 2A07F 3IC7A 3ECOA 2DI3A 1W7PA 3TOAA 2DQRA 1IN5A 5DDGA 1G3YA 2VXZA 3ZMTA 2KKOA 4MHGA 5D5WB 2O6GE 3M8EA 4HDUA 1FNNA 2P5LC 1G3SA 5D8LB 2YSRA 4RGUA 2QQ9A 2PEXA 1RZ4A 2VONA 2XKOA 5FGMA 4EMSA 2H09A 4EJOA 1ZLKA 3ZN0A 4YFNF 3E5UA 4WXDA 1H0MA 1EH7A 1S7AA 4L9VA 5HLIA 2LNBA 5AIQA 2ESHA 3E97A 4RGXA 1TQMA 5K5OA 5L3BA 3KCCA 3TKYA 4U0YA 4P5OA 3SHFA 5BPIA 2ZFWA 2V6CA 2Q0OA 2GZWA 2KJCA 4LD5A 4O5VA 5ILUA 2CGPA 3SFZA 3WODF 4BH9A 4JK1X 1V3FA 2A61A 3B73A 2IT0A 1T39A 4KMFA 4ENKA 4LFUA 1T6SA 2YPRA 1GHCA 4OIPF 1SFUA 2OZUA 5JHUA 4M74A 3FMRA 2DFIA 1K78B 1YLFA 3R6SA 2QBYB 5HLGA 5DD4A 2DU9A 3F22A 3RPQA 3DQVC 3R0JA 2GA1A 2ZBKA 2XASA 4WXHA 5DCMB 3L7WA 5ICCA 2ZKZA 1FP1D 2M30A 3P9CA 5ERIA 1G6NA 3F6OA 4G6QA 4UVBA 1W7PB 1XMKA 2WC2A 1IXRC 2O61A 4G7OF 3MAJA 3BY6A 3K1MA 3HUGA 1QGPA 3E6BA 1R1UA 4WK8F 3VODA 1ON2A 1YS7A 2CO5A 1U2WA 5CVUA 1UHMA 3ABTA 4Y13A 5L3EA 1F1ZA 2AS5F 3I4PA 4PDKA 3RIRA 3H3ZA 4RB3C 3J7AO 4ESJA 4KNYA 3KP2A 3T8TA 4OMYA 2EFOA 2YU3A 3HHGA 1LB2A 1XCVA 1IXSB 1J5YA 1T0FA 2V1XA 2VN2A 3E6MA 3F21A 4A5MA 1SAXA 3F72A 3TO6A 2BBYA 1ZRCA 3TQNA 5LHGA 2HKOA 1TLHB 3BPVA 3GWZA 5E17F 2COMA 3LAJA 4LK0F 4LMYA 3GX4X 5FFZA 2DQLA 5ILVA 1B4AA 4UVAA 4OIRF 4RS8A 3WTXC 3H3UA 2VBXA 3NEUA 1LEAA 3ZMZA 3L9FA 3AAFA 2A69F 4HLXA 3IKVA 3KP4A 1KQ8A 1FP2A 4KUMA 4BNCA 1W5SA 3G3ZA 1TBXA 3GO5A 1KYZA 1FWZA 1TQPA 4EM0B 5ICEA 2YR2A 2V79A 3WU1B 1LDDA 4HLYA 1U5TA 2E7WA 3TO7A 3ABUA 1XGSA 3BPXA 3ZMVA 4AIHA 1ZG1A 1IF1A 4M9SA 1BC7C 2EV6A 3KE2A 4N0BA 2IJLA 3F8NA 4XSXF 4ZYHA 5LRRA 4L9JA 3KLOA 2FBHA 1K7AA 3QP5A 5D4SA 4I02A 2G7HA 3EDPA 1RNLA 2IVMA 4OIOF 2DPUA 3N4MA 3HIFA 1XSVA 5ICGA 1ZRFA 4LB5A 1DP7P 5E8GA 2HQNA 3E5QA 1YTYA 1STZA 2XV4S 3IWFA 1R7JA 4CXFA 4OU0A 3HOSA 4MEXF 2Z33A 3CUQC 2BGCA 4U88A 2Y48A 1I6XA 3NQOA 2XGXA 5FFXA 5CVIA 3U9GA 2EV5A 5F64A 1O3TA 1WKMA 2UZKA 3TO9A 1I5ZA 5BMZA 5HS9A 3DV8A 3S2WA 3F23A 4HZFA 1MZBA 4R1HA 2ZCWA 4MEYF 2H6BA 2RDPA 1BI3A 2L02A 3OV8A 2FXAA 1ZGJA 1IRFA 2EFQA 1SMTA 3LA3A 4XBFA 2XAQA 4ENNA 3GLXA 4R79A 5ED4A 3ECHA 1Z7UA 3I64A 3L09A 4P55A 1U5TB 2QM3A 4IRGA 1BC8C 4MQ9F 3Q9SA 2P7CB 1ZAOA 3GUDA 3RDIA 1BIAA 2ELHA 2FSWA 2VT2A 2L54A 2A6EF 5IT9Z 4PCQA 2OA4A 2F5EA 3EYYA 2WTEA 3WTVC 1MDMA 2O3FA 2DAOA 1EH6A 3VOEA 4ZYGA 2A68F 5E8IA 3MQ0A 1KQ9A 1MJAA 4KIGA 5A2QZ 1IZ1A 3V7CA 4L18B 1HKSA 2EA4A 4KDPA 3DPLC 3EQLF 1OYYA 1P92A 4H0EA 2MLGA 4N9IA 2GQQA 2HTJA 2F5DA 4HF1A 1BJAA 3QU6A 4DQ2A 3FXRA 3IL2A 3HTSB 1YQAA 3F6VA 4I0BA 3GFLA 5J8CA 5HDNA 1SFXA 1XCBA 4AVPA 1U78A 4MTEA 1FSHA 4IF4A 1KU2A 4WXCA 3F3XA 4KMUX 3D5LA 4PGHA 3V7RA 2ADUA 4LLLA 4AWXB 4ESBA 5L3FA 3ZMDA 1KU7A 4EM2A 2GXBA 4EM1A 2ACJA 1JHFA 1H9GA 1MJ9A 3ELKA 3J81Z 5CLSA 1FPQA 2KRFA 1SD6A 2HQRA 3K1PA 2DK5A 5FLXZ 2V9VA 3HOTA 3FX3A 5H6RA 1DUXC 4YFKF 2K7LA 4XRFA 2XROA 3VB2A 1LJ9A 4I2OA 2TDXA 4EGZA 3WE2A 4CGZA 2VBYA 3I0TA 4TV7A 4HX7A 5AONA 4AIKA 2A3SA 4G94A 5LLQA 2MD5A 4HF0A 1X3UA 1FZPB 4G7HF 2EFNA 1MDMB 5IT3A 4B09A 1Z1DA 3ZMSA 5TRDA 1HKTA 4G9YA 1P4XA 4RGSA 3GVAA 3CO7C 3TDZC 4GCVA 1ZGAA 1J9IA 4EJWA 2RV8A 3T5XA 2J5PA 3ZMUA 3F8CA 4OIQF 4KIBA 4CYDA 4QLCU 3L00A 5BOXA 4G7ZF 5E1WA 5LEJA 2OD5A 3I53A 3BROA 1HW1A 1CF7A 2ZMEA 5D8KB 1FBSA 3DP7A 2HOEA 3MEXA 3QOPA 2BEOA 3HTUA 5HVQC 1R23A 4ESFA 4UVCA 2IA0A 4RGRA 3O3KA 3GZ6A 2PQ8A 4A6EA 1B59A 4IRHA 3SXYA 4GGGA 1HBXG 3FF5A 1ZN2A 5DCFA 4YIFA 2KIUA 4Q47A 1RIOH 3KP6A 5KK1A 4A0YA 5CJ9A 2Z9OA 4HBLA 4OINF 4U7BA 4Q5SF 2UWMA 4O6JA 2W24A 1FY7A 3W6JB 1IW7F 2FE3A 1XDSA 3GXOA 4WX9A 3RJPA 2HTSA 1I1SA 2UXNA 4A2UA 3ZQ7A 2NAZA 5ICFA 4G6DA 2P5VA 5D6FA 3WGGA 2W85A 1R58A 1RI7A 3BZ6A 1DDNA 3WGHA 3HRSA 1R00A 1E2XA 2EV0A 4BQAA 4RB0A 2OU2A 3WTTC 4B8XA 2Y0MA 4UV8A 2HWVA 3MZYA 4L9TA 2NRAC 1PP8F 2OQRA 2FMLA 2KJBA 2ESNA 1ZLJA 4XSZF 3HRUA 2R7DA 2PMHA 3RYRA 1EH8A 2CFXA 4A0XA 2OQGA 3R0AA 2Z99A 3ML6A 1MJBA 4M71A 3EYIA 1WI9A 3KP7A 2DTRA 1IXCA 1XGMA 2P7VB 3HHHA 1OMIA 3B02A 1TW3A 3CDHA 2XVCA 1EV7A 2JZYA 1S29A 2K4JA 2QVOA 3K9TA 4ZZLA 1BOAA 4M6YA 1YO5C 2OAZA 4KICA 1J7KA 1ON1A 4MNUA 1XDUA 2GAUA 1XSXA 3LFKA 4S04A 4XLNF 1XGOA 2F5FA 4ENMA 1WWXA 4KYWA 3M1EA 3DF8A 4AD9A 1Y0UA 2D2WA 3RKYA 4JBAA 3C18A 1HKQA 1KA8A 4YIIA 1O57A 2IPQX 3LA2A 2XAJA 5HS7A 2XAHA 3KEQA 4CZZA 2H6CA 3LQQA 1ZARA 3FMQA 2IRFG 2M1BA 3BJOA 3R61A 5DUKA 2PI0A 2JRTA 1XMAA 3GZ5A 4BHCA 3U1DA 5TJJA 5HDGA 3KZZA 6PAXA 2EK5A 3OOPA 4PGGA 1UCRA 3FM3A 3P7NA 1UFMA 3ZN1A 3RI4A 3IWZA 2P4WA 3WGIA 3BDDA 3FXQA 1T38A 1IN7A 2FU4A 1Z05A 3E3VA 4XLPF 1W4MA 4RAYA 1OYIA 2Z5UA 1B1BA 3K2ZA 2X0LA 1YFHA 2FA5A 2XKPA 1KU3A 2OBPA 1P6RA 5JI6A 2FF4A 2MH9A 2STTA 5CYVA 4IHTA 3ROUA 4HV6A 2QQAA 4WCGA 5HS8A 5BPDA 1I1GA 3E6DA 3QP6A 4KA4A 4KT5C 1C0WA 4MGRA 2NS0A 4A0ZA 2HR3A 1BI2A 1F4KA 1R5HA 3CUQA 4ENJA 1S6LA 4CICA 1LDKB 2RKHA 3HSFA 4BHBA 3VFZA 5LBQA 5F6FA 1Z6TA 3M7GA 3JAMZ 3IRQA 2RNJA 1Q1HA 4MQVA 4EQQA 4BHPA 2FMYA 4HYEA 1IUYA 2M45A 5BQTA 5FO5A 2EJRA 3HRTA 4HDVA 1BI0A 1PP7U 2WV0A 2DO7A 3SZTA 1O3QA 2DK8A 4LLNA 2G9WA 3GYHX 2PFBA 1XB4A 3BOQA 4FX4A 2STWA 1TW2A 2FNPA 5ILSA 4IRIA 2P8TA 1W5TA 4Q48A 3MZHA 1FLIA 2GWRA 5L3GA 4LGWA 1R1VA 4RAZA 2XHKA 2M87A 1WQ2A 1R5GA 2GIVA 3C1DA 2D45A 3V8JA 2F2EA 5HDKA 1USSA 4M9XA 3G73A 3KEOA 1B9NA 2L3DA 5DUIA 5EEGA 4UUVA 1S7OA 3LAPA 4IVNA 3P9KA 2XUBA 3I58A 1QQIA 3MFKA 1JHHA 1IRGA 1D8JA 3K1NA 3QU3A 3FMSA 1T98A 5H6QA 2CYYA 5DV5A 3ERED 1YS6A 3KFWX 4KN7X 1FT9A 3P9IA 4BXUA 3DXJF 3J80Z 1FYMA 3ZP5A 1LQ1A 4RB2C 5LRSA 2EFWA 3ZPLA 3CUQB 1FBQA 5L3CA 5IT9K 1D5VA 2Y75A 3HSRA 3RKWA 3MWMA 4CO8A 3E5XA 5A2QK 1KYWA 3C7JA 2V1DA 2PMUA 2AXLA 5K5RA 1YW8A 4LJZF 4L5IA 3U2RA 1P4WA 2M5WA 5LGNA 2FQ3A 3I54A 1TNTA 2HZTA 5DD8A 3LQRA 1HSJA 1AOYA 4ZZDA 1BN5A 2Z3YA 1GXPA 2CSOA 3WTSC 2PJPA 3GW2A 5JFRA 1RUOA 1GVJA 3WTUC 3V7SA 2W25A 1TQIA 4MTDA 4IHSA 2LF8A 1G3WA 1A04A 2K86A 4EJTA 5JR3A 4UV9A 2HS5A 2PBIA 1R22A 1ZYRF 4KIFA 3JW4A 2YX7A 4ON0A 4P9UA 2JSCA 1IAWA 5H20A 1XGNA 4LK1F 1QPMA 2G7UA 2CG4A 2QWWA 3H92A 4U0WA 2EB7A 3J81K 2NNNA 2H27A 3V8KA 2P5KA 5AIPA 2JPBA 3ULQB 2LKPA 5FLXK 2CW0F 1UB9A 1L3LA 2HFHA 4UNOA 2VE9A 5LEKA 2ZO4A 2MC3A 3FXUA 2VBWA 3DPTA 1SD4A 3EUHA 1WRJA 2RGVA 3SQNA 3L2CA 1PUEE 4P96A 1XSDA 1JXSA 5JVTA 1HQCA 1XD7A 5E1XA 2LSOA 2EA2A 4Y15A 3JTHA 3IKTA 2FEZA 2ISZA 3T8RA 3M9AA 5DYMA 1J59A 2XRNA 3C3WA 2WWYA 2BE5F 2ZNYA 2LDUA 4HQMA 2R7FA 4HX8A 2DPDA 4LB6B 2MBFA 3KZYA 2MA3A 2Q8KA 4IPAA 4CDGA 1FX7A 4K2EA 5D5UB 3CUOA 3T1BA 2A5YB 1F5TA 3FZVA 2KIMA 3WG9A 4A12A 1MGTA 4WWCA 4E70A 3F8MA 1Z91A 1YW7A 1YIOA 1QNTA 4I7HA 2QZ8A 1U3EM 2QUFA 4PZJA 3SZPA 1BIBA 1Z9CA 2HDCA 2XAGA 2VE8A 5CVJA 2V1UA 5L3DA 1ZH5A 2QENA 2OZ6A 2LF7A 2QQBA 2R3SA 2W57A 3F8BA 2FBIA 4YFXF 5FB2A 4ZYEA 3WE3A 3JSPA 3M8FA 3RTRA 1E17A 1XN7A 3N97A 3F8FA 3I59A 3GFJA 5CVVA 3KLNA 1KU9A 4GXOA 3HSEA 4G8XA 4EVIA 4FHTA 3QPHA 4HOBA 3BJAA 1TNSA 3T0YA 2L4MA 3DKWA 1I27A 4HW0A 1UHWA 1CF7B 3V4GA 2ZMEB 2O8XA 1G4DA 1FYLA 4N9HA 3EETA 3FWEA 3K69A 1LVAA 1B9MA 1MD0A 2EWNA 1ODDA 2BV6A 1QZZA 1F9NA 3QAHA 3QPTA 5E20A 3RPUA 3NRVA 3KP3A 2P6SA 3Q5FA 2VT3A 2C6YA 1OYWA 1DPRA 3HYIA 1FYKA 2P6TA 3QRFF 2EFPA 3PFIA 1WSUA 2HEOA 1D3YA 4Z2YA 5KVRA 2GXGA 2XIGA 3CJNA 2JT1A 2IA2A 3GFIA 2PG4A 4I01A 2VBZA 5J8FA 2VC1A 4M6XA 5E1ZB 1AWCA 1O3SA 2MLKA 3E6CC 4HF2A 1T2KA 1TTYA 2PN6A 1QO0D 4NHJA 1K79A 3O2PE 4EJUA 4U0VA 4RB1A 3LSTA 4HV5A 4A5NA 5J6XA 4HQEA 2KIFA 4EV0A 5LHHA 1ZRDA 1J2XA 2E7XA 3ISPA 4IJAA 2MH2A 2QLZA 1HW5A 3I59B 3DFGA 4ZYDA 2A6HF 1U5TC 1IN4A 2ZNZA 2HYGD 3R60A 1D8KA 3BP8A 1RUNA 3PQKA 3IHUA 4GO1A 1HXDA 3MCZA 2VC0A 1SD7A 1LEBA 3RKXA 2NNYA 2ISYA 2DT5A 2CQKA 1R36A 1G3TA 1J75A 4GYIA 2HKXA 4F7ZA 2RQPA 3JTGA 3LWFA 2L01A 4M72A 2DW4A 2UXXA 3GEZA 2D1VA 2B0LA 3TOBA 3GFMA 2F5CA 1JE8A 2RN7A 1ZG5A 1S3JA 4GYGA 4WF2A 4Y17A 1IN8A 1JGSA 2FRHA 2K02A 1BBYA 1H9TA 1HW2A 5F1RA 4HAMA 2NYXA 1SMYF 2E1NA 3WTYC 4QWQA 2ETHA 2IW5A 3VEPA 1ZREA 1U8RA 3W6KB 2M8EA 4HA8A 4P9FA 5D5VB 2IA1A 2RVCA 4I09A 1KGSA 2J5OA 1VTNC 3REOA 1Z6RA 1ZG3A 2K27A 5DEQA 4KFCA 2ZJ2A 2VODA 2DBBA 3WU0A 3GF2A 2FOKA 5FD6A 4EJVA 1W7PD 1OKRA 1BM9A 2PLYA 2DLLA 4BAYA 1REPC 3BJ6A 4A6DA 2BYVE 4S05A 2IP2A 4L0YB 4BYYA 1FBUA 3KETA 3I71A 4OOIA 1NHAA 3HRMA 5LGUA 3I5UA 3JAMK 1O3RA 3BWGA 2FBKA 2RC4A 4LG0A 2W84A 1MKMA 1CGPA 5HLHA 2YX4A 1S8NA 1OPCA 4ZH4F 5D4RA 2VOPA 3IRRA 2L4AA 3LA7A 1SFEA 2K4BA 2CWEA 3WTZA 2H94A 5K5QA 1O7FA
chains in the Genus database with same CATH superfamily
4GDFA 4ITVA 2E5NA 3COAC 2F6CA 5KG4A 2Q2EA 3DEUA 1DPUA 1S9FA 2XDVA 1RC9A 3GTLA 2HGCA 2EZKA 3CO6C 5FD5A 3S3OA 4IQJA 4L9NA 4E7SA 4A93J 2R0QC 3TGNA 3TIGA 1FOKA 3GV5B 1P4AA 4I0AA 3KTMA 3WG7H 3H36A 3FDYA 5CQGA 4YG2F 3GTKJ 5HOOA 1BI1A 3CMEI 3A03A 1L0OC 5DG9A 3PW4A 1ULYA 4YEJA 4XYMB 4BBRG 3L2UA 1DIKA 1EF4A 3CD6I 5B1AH 4ASNA 2XAFA 2QYOA 1FC3A 4CHUA 1YYVA 1LDJA 1I3QJ 2GA2A 3A0HC 2C35B 5KCMA 1GLVA 2ZJTA 3CMYA 2CQYA 3A1YA 3CLOA 3FKIG 1TWAJ 4HX4A 2WY8Q 1U6GA 3WTWC 5C8YF 4BBSG 1GXQA 1B6AA 3GTGA 1HSTA 1Z3YA 2IGOA 4E7ZA 4IOAF 1FJGH 4M9ZA 4LLGF 4ZDLA 2KPMA 4PJLA 3GIPA 3SJMA 2W70A 4IRKA 1YHQI 2JPCA 1ERDA 4BBRJ 3KP5A 1JUMA 3PQJA 4IXAA 2E1CA 5K1YA 2D1HA 4PUSA 1VF9A 3V8LA 4DBQA 2ME6A 1P2FA 4FX0A 4O3QA 1KJIA 1RETA 4PJMA 1KQ0A 1E4EB 4PSWA 4BBSJ 3BR5A 1CQIB 2AQFA 2DMTA 2L9VA 2NU8B 1K1QA 2FNAA 3J80K 1LNWA 2VOOA 4ETSA 1K6OA 4OMZA 3GTMA 3HOYG 1O7LA 3R4KA 1IN6A 1W0TA 1ETKA 3L2VA 3AYHB 2UUAH 4XM3A 1TWHA 3R5FA 4I4TF 2DT6A 1Y56A 4FT8A 1WH5A 2FD5A 4AIJA 1B8IA 5LMUH 5IYCG 2ID6A 3O6BB 5LHIA 4U7DA 4L0ZB 3D0SA 1SD5A 3FHZA 2X4HA 1B72B 1FVIA 4L5JA 1DU6A 1USTA 5L1LA 4M73A 1UNNC 3PN1A 4IWYA 1MNDA 1QZEA 3Q8PB 4PJNA 1PDNC 1YG2A 1ZHFA 1I94H 3H0GA 5LGTA 3AKZA 4UHTA 1V55H 3K70C 4K0KH 4NQWA 1YW9A 3KAKA 4JQFA 4BE2A 4EGYA 3IAM2 2E2IA 2O0YA 3HOYJ 2IBKA 1FSEA 4YRVA 2ZXJA 2AHQA 3QQAA 3TDUC 4R8HA 2DTZA 2MCTA 2L7KA 5D5XB 3GIJA 3TBIA 1QBJA 5E18F 3CTAA 4CA0A 3C2GA 4Q4ZF 3FM5A 1X19A 1X2MA 5GTIC 4DNCA 5HNHA 4B3XA 3ABMH 2VJ5A 2E36A 4EEFG 1EJ9A 4LG0B 1DGSA 1RRJA 4AYBE 5BS6A 1K78A 3RYPA 4HRIA 2JTVA 2QBYA 3Q1KA 3QODA 5EEHA 4UXNA 2IEKA 4RZRA 1HLVA 1J0RA 1OR7A 1T95A 3UKGA 5EZYF 4FE4A 4I98B 2R7VA 3OTOH 4NB5A 2VQDA 4JI4H 2W6ZA 3H9QA 4XLAA 4D0PA 2O03A 3Q9VA 3GZNB 1P7JA 2CUZA 1X3ZB 5DCMA 3JSOA 5KT4A 5D6EA 3K0LA 1R1TA 5FLVA 4ECVA 5JLXA 5CA0F 4O3MA 5EZHA 1V4RA 4KN4X 5CVRA 2JUCA 1QZYA 1SYXB 2VKVA 2HYFA 1ONVA 2XB5A 2A07F 4EBEA 3W2WA 1X2NA 3IC7A 2ASLA 3ECOA 1BR4A 4UY8I 2DDBA 1W7PA 2DI3A 1JTXA 3TOAA 3E0JB 1R5ID 2DQRA 4JV0A 1IN5A 4Y8VB 3TMOA 4B1RA 4DYCA 5E3MA 2J6TA 2Q2EB 5DDGA 2IS6A 4IHWA 1G3YA 3CCRI 3OL4A 3A0BC 1OCCH 2LD5A 2VXZA 3DTIA 2V26A 3G1OA 3ZMTA 4LSAA 3FHNA 2KKOA 4MHGA 5D5WB 2O6GE 2ZSIB 4E4TA 3M8EA 4HDUA 1FNNA 1BW5A 1JKPC 4CH7A 2P5LC 1G3SA 3BTCA 3HGYA 5J3LA 4D7NA 5D8LB 3Q3SA 2YSRA 4BDYA 4EYIB 4RGUA 1JXLA 2MFZA 5F0FA 1N78A 5KFJA 2ECBA 2ZJQF 2QQ9A 3G6EI 2PEXA 1LPQA 4MV8A 5HODA 1PJRA 5C4JJ 2K3FA 5FROA 5EG0A 1RZ4A 2VONA 2XKOA 1XNQH 5TISC 4A3GG 5FGMA 5HLTA 3HOZJ 4EMSA 3H9JA 1T56A 1WPKA 4LH6A 1IRXA 3GTJA 4NBQA 1Y14B 1EHIA 2H09A 4O3RA 1B6SA 4J00A 1MIJA 3S8PA 4EJOA 3PIPF 1ZLKA 4V19K 3ZN0A 2DOAA 4ZTFA 2R7TA 2H1LA 4YFNF 3E5UA 4DR3H 4WXDA 1Z67A 2WBMA 1H0MA 4LF6H 2BY0A 4YQWA 1WJBA 2KFDA 1B33N 1EH7A 4LIUA 1I7NA 2Y2ZA 5BNGA 2FK1A 1S7AA 4L9VA 5HLIA 2LNBA 4QWBA 4A3GJ 3ORRA 5AIQA 2FK2A 1S10A 4CCJA 2ESHA 4ECYA 3E97A 3MZ8A 4RGXA 2FPIB 4L1KA 1TQMA 5K5OA 5DLFA 5L3BA 3KCCA 3TKYA 4U0YA 2G0EA 9ANTA 4A69C 3IUOA 2VA3A 3FK6A 4P5OA 1VQ6I 5EYRA 3SHFA 5K7HA 1UHSA 3DU6A 4IO9F 4JI2H 2HOTA 5BPIA 2ZFWA 2V6CA 2Q0OA 2GZWA 2KJCA 3QYEA 2WAFA 4E6KG 4LD5A 4O5VA 5ILUA 2CGPA 3SFZA 3N40P 4MV6A 2DPIA 3WODF 2MC4A 3PUFA 4BH9A 4JK1X 3EPGA 2ZXWH 1V3FA 2A61A 2AXTC 2EBIA 1A36A 3OYCA 2WV1A 2TCTA 3B73A 4NQWB 1S0OA 2IT0A 3BR2A 3BQ1A 2VKDA 1T39A 2DPJA 1VKZA 2DFEA 4KMFA 4ENKA 4LFUA 1QHGA 2W6MA 5JQWA 3NARA 1T6SA 2YPRA 4ZTJA 2M9HA 3RUPA 1GHCA 4QWCA 3MR6A 4OIPF 4CC6A 4F52A 3TIIA 4MO7A 5M3MJ 1ZR4A 1SFUA 2OZUA 1FEXA 2LOOA 2BW3A 2CRGA 5JHUA 4M74A 2OJED 2KL4A 2GPWA 4G6TB 3TEDA 3FMRA 1T08B 2DFIA 1WZ2A 1K78B 2EH3A 1FKAH 1YLFA 3S1MJ 1MSEC 4R7RA 3R6SA 3OYIA 2QBYB 4FS2A 3OYEA 5IYZF 5HLGA 1R9TA 4BQNA 3MFHA 5DD4A 2DU9A 3F22A 2OLSA 3RPQA 3DQVC 3R0JA 1AUVA 2ZBKA 2GA1A 3BABA 1QU3A 2YUSA 4Q45A 2XASA 4WXHA 5DCMB 3L7WA 2OTLI 3AG4H 4F91B 5ICCA 2ZKZA 1FP1D 2M30A 2BZTA 4L5EA 4XQFA 3P9CA 5ERIA 1G6NA 4IRCA 3OYJA 3F6OA 4G6QA 1GSOA 4UVBA 5IT9W 5E79C 2JSPA 1SANA 1W7PB 1XMKA 2L5QA 2WC2A 3OYDA 3OSFA 4C2TA 1N32H 2WE6A 1IXRC 1XMXA 2O61A 1YX3A 5C4XG 3OYMA 2X51A 3T1HH 4G7OF 3MAJA 2JA5A 3BY6A 3K1MA 3HUGA 3L2WA 1QGPA 3ASOH 3MJFA 3E6BA 1R1UA 3H35A 3I3LA 4WK8F 5DG8A 3VODA 2OTJI 4JI8H 1ON2A 1YS7A 2CO5A 4RLQA 1TT5B 1ITYA 1U2WA 5CVUA 1UHMA 3ABTA 4Y13A 2JK3A 5L3EA 4ZYAA 4IQ4A 1F1ZA 2AS5F 3T5JA 1VQMI 5C44G 3I4PA 4PDKA 3RIRA 4YIRX 3H3ZA 5EG0B 4RB3C 4A3KG 2R8IA 3K5HA 3J7AO 5LL6b 4ESJA 4KNYA 3GTPA 1Z7LA 3NWSA 5KT7A 2VKEA 3KP2A 4A3JG 2AO9A 4JX5A 2VQHA 3P5JA 3T8TA 1XMQH 4LF4H 5J1YA 4OMYA 2EFOA 2YU3A 2YYAA 3V42A 3U9SA 4X66H 1T3NA 5LYJF 3HHGA 1VAJA 1LB2A 1XCVA 1IXSB 1J5YA 3BLYA 3A02A 4X6AJ 2C00A 2NU9B 4DV5H 1T0FA 5C44J 2YW2A 2JEIA 4A3KJ 2V1XA 3JCUC 2VN2A 1E3PA 1Z3XA 3E6MA 3F21A 1LVKA 4A5MA 4B3AA 4DBRA 4QTRA 1SAXA 3HOWJ 2CKZB 5GPAA 3A01A 4LFCH 3F72A 3TO6A 2BBYA 3QZ7A 2LC2A 1ZRCA 5BMVF 3RFCA 1UMQA 3KHHA 1ZR2A 1S72I 1S97A 2E5ZA 2KSWA 3TQNA 5LHGA 2HKOA 3RSNA 3AL0B 1TLHB 5KFHA 2P0AA 3BPVA 4M3FA 3GWZA 2XPUA 2Y0SE 1WJDA 1AHDP 2COMA 5E17F 3LAJA 5DLGA 3IN5A 4LK0F 4LMYA 1XG1A 5L1KA 1SFOA 2DWCA 3GX4X 5FFZA 2R7KA 2CH0A 2DQLA 4LITA 1TWGA 1IDYA 5ILVA 1B4AA 2YU9A 2W1OA 4UVAA 4OIRF 4XX0B 1A6IA 4RS8A 3WTXC 1V51A 3JRWA 3H3UA 3VYRB 3BZCA 2VBXA 3NEUA 1LEAA 2NOJB 5KFRA 4LF5H 3ZMZA 3PR5B 4XRSG 2XGCA 3L9FA 2L7ZA 1VZ0A 2RF4A 3AAFA 3N05A 3PSIA 1CS0A 2A69F 3CQZJ 4HLXA 3H4DA 3T5HA 3IKVA 3KP4A 1KQ8A 1FP2A 4KUMA 4BNCA 4PWQA 2B63A 5JLWA 2E1OA 2XF5A 1W5SA 3G3ZA 5KFFA 1R6RA 2MYSA 1WJAA 3BR6A 3BTJA 2OWOA 2BW3B 1TBXA 1GO3E 4YBZB 4BQQA 3GO5A 1KYZA 2VA2A 1N25A 1FWZA 4C2UA 1L2ZA 2C22A 4GKJH 3C0FB 1VQ4I 2L7FP 3HXLA 4B3MH 5FLXW 1TQPA 3EPZA 4DYQA 4IR1A 1F36A 4EM0B 5KT5A 5IOZA 2W71A 4BXFA 4J01A 1DU0A 1RK6A 1GSAA 5EGOA 5ICEA 4RZQA 2YR2A 2V79A 1QVUA 2R93G 3RV3A 3WU1B 1LDDA 4CC5A 4HLYA 1MBFA 5KFOA 4C3JJ 2AQEA 2ZDQA 1U5TA 2E7WA 1GVDA 1ZQ7A 5D1PA 3TO7A 4LOCA 3ABUA 1XDNA 3BR1A 1XGSA 1HCRA 4ZOLF 3CCUI 5KFUA 3BPXA 3MR5A 1BR1A 1FOXA 2FMAA 4DV2H 3ZMVA 3H0DA 5IP6A 4GFBA 1I6HJ 2WA0A 4AIHA 1ZG1A 1K61A 1IF1A 4M9SA 1BC7C 2EV6A 3ONQA 4TV8F 4V2FA 4RAGA 2ZB9A 3KE2A 4N0BA 3KX2A 2K40A 2IJLA 3KHLA 3F8NA 4XSXF 4ZYHA 5FKLA 3S1NJ 1QRYA 5LRRA 4L9JA 2UUBH 1Y1WJ 1D5YA 3PZPA 1TC3C 4IHVA 3LL7A 1AU7A 3CCVI 3F0CA 3ZGKA 3DTEA 4XLFA 3KLOA 1RJPA 2FBHA 1K7AA 2V59A 4BU2A 1ZGWA 3QP5A 4DR6H 3GLKA 5D4SA 4C2MJ 3ZRGA 4I02A 3QFFA 2G7HA 3U9TA 5GAGJ 3EDPA 1RNLA 2R7WA 1Y8QB 1GSHA 2IVMA 4M3GA 2HXIA 4OIOF 4X62H 2DPUA 3HIFA 3N4MA 2L9RA 2DA4A 2DA7A 3V6JA 2O5RA 1XSVA 4NDLA 4QWEA 2RGRA 5ICGA 2X1CA 1ZRFA 1J09A 4HSTA 5IPAA 4Q43A 4BKXA 4LB5A 1DP7P 1KJQA 5E8GA 3TQ1A 3QPSA 2OV7A 2HQNA 3E5QA 2DOEA 1YTYA 2ZXHA 3H3VH 1RKTA 5GTHC 3S17J 1STZA 2XV4S 4AYBA 1WCMA 4ECRA 3A01B 3IWFA 4ZJZA 1R7JA 4CXFA 1EA3A 2RQQA 3H5NA 4OU0A 3TL4X 4LSXA 5L1IA 2TRTA 3HOSA 2NVXA 1XTAA 4DL4A 3JSNA 1BJTA 4A3FG 4ZDPA 4BL0B 3KYLA 4MEXF 1OWTA 1K83A 2DT7B 1MNEA 2XF7A 2KRCA 3K70D 2Z33A 4A3LJ 3HB9A 2KZGA 3CUQC 2BGCA 3RZOJ 1SEUA 4U88A 1WR2A 2YRXA 2Y48A 4OAZA 3CCQI 1I6XA 3GIIA 4J9LA 3NQOA 2W7PA 2XGXA 1RPWA 1LFPA 2LH9A 4TV9F 5FFXA 2JMWA 3BJYA 5CVIA 3U9GA 2EV5A 5F64A 2KISA 4DV1H 1O3TA 1WKMA 2UZKA 4A3FJ 3G1LA 3TO9A 1I5ZA 4EATA 2XCAA 1PX2A 3I4NG 2OCCH 4G12A 2DA6A 3W3CA 2DA5A 5BMZA 5HS9A 1MMSA 4DL3A 3DV8A 3S2WA 3F23A 4HZFA 1MZBA 4R1HA 2ZCWA 3EPIA 5J2TF 3CF2A 1VBGA 1DV1A 3OYBA 4CCMA 4MEYF 3CJQB 4DV3H 1UJ8A 2H6BA 2YS9A 2F4VH 2RDPA 4QWDA 3N41B 4C3IJ 5JVDF 4ED6A 3A2KA 1BI3A 2L02A 1VQ7I 4V2GA 3OV8A 2FXAA 1ZGJA 3EUAA 4X1EA 3I4NJ 1IRFA 2D5VA 2EFQA 1SMTA 3X2QH 2R7MA 4I55F 4QIWA 3QYFA 2GM4A 3LA3A 4XBFA 5KFIA 2XAQA 4ENNA 3GLXA 4R79A 5ED4A 2K5CA 3ECHA 5E3LA 2EINH 1M7JA 1Z7UA 5EGOB 1N34H 1MMDA 3ETHA 5GONF 4F50A 3HBLA 2V9WA 4PSXA 3I64A 2R87A 3GQCA 5KG6A 3L09A 3PM1A 4P55A 2DJNA 3OUUA 1U5TB 3JRAA 4JI0H 2DIKA 2VUMA 2QM3A 4IRGA 3TP3A 1BC8C 4MQ9F 5DG7A 2K9QA 2VKHA 3Q9SA 3PO2G 2P7CB 4CSWA 3PSFA 3HKZN 1ZAOA 3GUDA 3RDIA 1BIAA 4WBNF 2ELHA 2FSWA 2HZDA 3HGGA 3GILA 1Y39A 2VT2A 2ASJA 2AGQA 3MWEA 2L54A 2CFOA 2JEFA 3OIOA 1LFUP 2A6EF 5IT9Z 4IRDA 2ELJA 4PCQA 2WB1N 2OA4A 2F5EA 4HG2A 2WDTA 3EYYA 1WJEA 4A3MG 2E71A 2WTEA 3WTVC 3OYFA 3GBGA 4DIQA 3UQ8A 1S03G 1X1PA 1MDMA 3PO2J 2QEXI 2O3FA 2DAOA 1EH6A 3R5HA 3VOEA 2XC7A 4WD3A 4ZYGA 3DPUA 2A68F 5E8IA 3MQ0A 1KQ9A 1S0NA 1MJAA 4ZHQF 3J7ZI 4KIGA 5GPCA 5A2QZ 5KFBA 1IZ1A 4XN3A 3V7CA 1VFCA 4ZQIA 4L18B 3PUBA 1HKSA 2EA4A 4KDPA 4XN0A 3DPLC 3EQLF 1OYYA 1WGXA 4BDZA 1P92A 4H0EA 2MLGA 4F4ZA 4A3MJ 3T5LA 4N9IA 4FU0A 4JP0A 2JA7A 2GQQA 2HOAA 2FPGB 4O4HF 5FKOA 2HTJA 1D0YA 2F5DA 5DGBA 4HF1A 4R8UA 1BJAA 3QU6A 4DQ2A 3FXRA 3OR2C 3IL2A 3HTSB 5LOVF 2BXYA 2L9SA 3BT9A 4JV1A 1YQAA 3F6VA 1W5CC 3HG9A 4J9SA 1I50J 3SEQA 4I0BA 2JN6A 3OYNA 4KHPH 5JVLA 4IHXA 2R92J 2R4GA 2IXSA 3I9V2 4N4NB 5C1OA 4ECWA 3GFLA 2BY2A 5J8CA 5HDNA 1SFXA 1XCBA 4NNJA 3KHGA 5M5XJ 4AVPA 1U78A 4MTEA 1WJFA 2DA1A 2J6UA 2RAEA 2JA8G 2R7ZG 5LA6F 4EG0A 3JRIA 3JRXA 3NAUA 1Z2PX 3K4LA 1FSHA 4FASD 2E34A 4IF4A 1KU2A 2ZJPF 4WXCA 1ZHQA 3AFHA 2CUEA 3F3XA 2I87A 5HBRB 4KMUX 4A3BG 3MKWB 2MG4A 3D5LA 2DFHA 3RB3A 4PGHA 2OPTA 4I6ZA 4LF8H 3V7RA 2ADUA 1ETYA 1YJNI 3ZQGA 1IBKH 2XCLA 3HEFA 4LLLA 4AWXB 3SYTA 3ABKH 3CJRB 2ZDHA 5J1RA 2NVYJ 4ESBA 2JA8J 2R7ZJ 5L3FA 4IR9A 3ZMDA 4D7MA 3OYLA 1KU7A 4EM2A 3HPGA 2GXBA 3DWLE 4UUSA 3ASNH 3CCLI 3FKIJ 2UV1A 1JGGA 2Q1ZB 4DUYH 4EM1A 3R23A 4A3BJ 4DR7H 2B9SA 1JHFA 5LD2C 2ACJA 2O9LA 5LP6F 1H9GA 2ASDA 4MA0A 1MJ9A 3ELKA 4M6VA 3CC7I 3J81Z 4QW9A 5CLSA 5KFXA 4IHYA 1ULZA 3MKYB 1FPQA 2KRFA 4B44A 2EIJH 1SVOA 5KG5A 1SD6A 4CCNA 2HQRA 1D0ZA 3PIOF 2JQ7A 3K1PA 1BR2A 4A2AA 4EBCA 4ED0A 1Y1VA 5IP7G 1HC8A 4MV1A 5IYBG 2DK5A 5FLXZ 4XRMA 2V9VA 4KITB 3M3YJ 1KEEA 5L1JA 3T5KA 3HOTA 2QSGX 3FX3A 4EEYA 4U6PA 3DBRB 3C2HA 2CW8A 5H6RA 3CMAI 2QKLB 3RCOA 4YFKF 1DUXC 4XYLB 1OFCX 4QSHA 3LFUA 1N48A 2K7LA 4BY7G 2W6OA 3ETJA 2XSDC 4XRFA 5F1JA 3WO0A 2XROA 3VB2A 5KHDA 1LJ9A 2CJJA 4I2OA 2TDXA 3OIQA 4EGZA 2FLNA 5IP7J 5JH7F 3WE2A 1TWFJ 5IYBJ 2VBYA 3OS0A 4CGZA 2A6TA 1UG2A 1P7IA 1S9HA 3I0TA 2P81A 4TV7A 4XKWA 3LOCA 3VSLA 4MV9A 4HX7A 5AONA 2VQFH 2R8JA 3LSGA 4AIKA 2EZIA 2A3SA 4G94A 5LLQA 2HVQA 4PFOA 4ZI7F 2MD5A 4HF0A 1X3UA 1FZPB 4ED7A 3I4MG 2EZHA 4BY7J 2NXNB 4G7HF 2EFNA 1XS9A 1MDMB 5IT3A 1TP4A 2M7BA 1BNCA 1EYZA 5KFCA 2PMZA 2YZNA 3T1YH 3K4JA 1H89C 2DYRH 1MH4A 4B09A 2IS1A 4QPOA 1Z1DA 3ZMSA 5TRDA 1HKTA 4G9YA 1P4XA 2W4SA 3GVAA 3E1SA 4RGSA 3JRHA 4XONA 5M5YJ 1POGA 1YE9A 3LSPA 3CO7C 3TDZC 2DFFA 3HM5A 4GCVA 1ZGAA 3ERMA 4ECZA 4LF9H 3ZQHA 2R5ZA 4A3EG 3TP0A 5TGTA 4EGJA 1J9IA 4MFDA 4EJWA 3VYUB 2W6PA 2VJJA 3GTKA 2HPIA 1UC8A 2RV8A 4BE1A 4EBDA 3T5XA 2J5PA 2Y0SN 2C28A 3HOVG 3ZMUA 3F8CA 4OIQF 3DEWA 3OSGA 2V4QA 3IG0A 3HKZE 4KIBA 3ZCOA 4NC8A 2BHYA 2LRDA 2WAQN 1ZHSA 4J9NA 2CV2A 3LSMA 3EUHC 4MLOA 3DLLF 1I3QA 2DOFA 1OLTA 4CYDA 3IV5A 2Q2UA 4QLCU 3A4CA 3L00A 4S0HB 2XGDA 1TWAA 3KALA 3K5IA 3ZQFA 4G7ZF 5BOXA 5KG1A 2ZMEC 5E1WA 1MW7A 5LEJA 4II2A 1RKWA 4FCYA 4A3EJ 2WB1E 2OD5A 4UCUA 2E2HJ 5KFNA 4Q0YA 3I53A 3BROA 2R8GA 1HW1A 1CF7A 2ZMEA 3PL8A 2LR8A 5D8KB 4OX9H 1VQOI 1FBSA 2QGUA 3DP7A 2VJ4A 2JEGA 3M9MB 2HOEA 5KAFC 3MEXA 4YY3H 1ORKA 3R5XA 1U9NA 4PFPA 2WADA 3QOPA 2BEOA 3HTUA 2XRLA 2XGEA 5HVQC 1K4SA 5J40A 1R23A 2UVVA 4ESFA 3CJTB 4UVCA 2IA0A 1JDEA 4RGRA 4BACA 1W0UA 3O3KA 3GZ6A 3RTXA 1D1BA 4JYKA 1OISA 2PQ8A 1ZELA 4A6EA 4UUSB 2AU0A 2C2DA 1B59A 3CVZA 4IRHA 3SXYA 5DS9A 3M8JA 4GGGA 1E4FT 4Y52J 3OUZA 3S2HJ 1HBXG 3M4OJ 3FF5A 1KZHA 1ZN2A 3LMMA 5DCFA 4YIFA 2KIUA 4Q47A 4F92B 1RIOH 5CB4F 3RGXA 1XNRH 1JKQC 5K7ZA 3LSJA 3KP6A 5KK1A 2HU9A 5CJ9A 2MD0A 4A0YA 2Z9OA 2LFBA 4HBLA 4OINF 3ZQQA 2VR1A 4XLHA 2YZMA 5J2UF 3JSLA 3SZGA 1NTCA 2I5UA 2M4KA 4U7BA 4Q5SF 5T14A 2UWMA 4O6JA 2W24A 1B8IB 1I7LA 1T8IA 4JUZA 1ETWA 1FY7A 3W6JB 3AL0C 3BA8A 1IW7F 2FE3A 2XGQA 1XDSA 3GXOA 1WH7A 4WX9A 4IZZA 1EZ1A 3FDSA 1BJZA 3RJPA 3JRBA 4U7CA 1SVMA 2HTSA 4NUBA 2HQAA 4NC6A 1I1SA 2XPWA 2C2RA 2UXNA 3H5RA 4QW8A 4A2UA 3JAMW 2FB9A 3I56I 3EUKL 3FXKA 2GOXB 2NAZA 3ZQ7A 5ICFA 5GAHJ 4G6DA 2P5VA 3FXMA 5D6FA 1AN7A 3WGGA 2W85A 2Q2TA 1R58A 5M3FJ 2HOSA 2XGPA 4DL7A 3K4KA 5IY5H 3K4CA 4XZ3B 4RUAA 4A3CG 4CYCA 1TA8A 2AGOA 3IP4B 1RI7A 3BZ6A 4UB6C 4Y7NJ 3BQZA 3WGHA 1DDNA 2B63G 2YU9J 3HRSA 1IUFA 3D5SC 4BWSC 3S15J 1R00A 2UVWA 2RNGA 2UUCH 5KAIC 3BG6A 4B48A 2QKMB 1Z21A 1E2XA 2EV0A 1K6YA 4D1QA 3BA9A 3O8HA 3PNYA 4BQAA 3G71I 4NXMH 4XLCA 2JA6G 4RB0A 2OU2A 3WTTC 1S0MA 4B8XA 4E7HA 2Y0MA 3K4BA 4LFAH 4AUXA 1ETOA 4UV8A 4A3CJ 2HWVA 2DN0A 2W8KA 4XICA 4A3DG 4IZOA 3BTIA 4AIDA 4Y3OA 3L2QA 2I10A 3MZYA 1MNMC 4L9TA 2NRAC 3G4SI 1JI8A 1BOBA 1YI2I 2H8WA 1PP8F 5EWEA 3RJ0A 2OQRA 2FMLA 2KJBA 4J9PA 4JV2A 1PUFA 5F9NA 1RJRA 3QZ8A 1ETVA 1ZLJA 2ESNA 3DU5A 4XSZF 1H8AC 1A9XA 4APMA 3HRUA 5GP9A 2NVTJ 4A3IG 2DDAA 4JV5H 2MSYA 2JA6J 1Z2OX 4RNOA 3C2BA 5KG2A 3DLAA 3Q2OA 2LTPA 2R7DA 3BCAA 2PMHA 4IL6C 3RYRA 1EH8A 4F3QA 1BA5A 1IDZA 2CFXA 4JYAH 1MBJA 2COBA 3MKLA 4A0XA 4A3DJ 2R85A 5KKNB 2OQGA 1HA8A 3S14J 3R0AA 5A2QW 2VLAA 3G6XA 3Q8QB 3RB6A 2KT0A 2Z99A 4J9RA 2KMUA 3GTQJ 3ML6A 1MJBA 4CZCA 5EEAA 3SDGA 2V9PA 2EIKH 5EOYA 4X64H 3VYTB 5C4XJ 1FTZA 4M71A 3BQ2A 2H8RA 3EYIA 4UB8C 2ICWG 4YB8B 3VMMA 1WI9A 3KP7A 2DTRA 2ECCA 4O3PA 2HQ5A 5I47A 1IXCA 1XGMA 3K4MA 5EDWA 2P7VB 1MMNA 3HHHA 2VQEH 3GIKA 1OMIA 5FLMG 2BVLA 5J4YA 3B02A 3M1CA 2SCUB 1TW3A 4E7KA 3CDHA 3SI8A 2XVCA 2OC6A 4BXXG 3K6GA 1EV7A 2JZYA 1Q1VA 1S29A 1EKEA 2FX0A 2K4JA 2W82A 2QVOA 3CP8A 3K9TA 4ZZLA 1BOAA 4EGQA 3CDIA 3J80W 4M6YA 1Z0XA 3DBLB 3W6VA 1KJ9A 4Y4RA 4Y33A 1YO5C 2OAZA 1N75A 1K1SA 2V1NA 4A3JJ 1RJQA 3PW5A 1V5GA 2CW7A 4KICA 1YITI 1J7KA 4KISA 1ON1A 4MNUA 1OCZH 1WCMG 1XDUA 2GAUA 5FLMJ 1IJWC 1XSXA 3OL3A 5BR8H 3LFKA 1ZQ3P 4S04A 4XLNF 1XGOA 4J9MA 2F5FA 4ENMA 2WAQE 1WWXA 4KYWA 3M1EA 5J4VA 5DTDA 3DF8A 2ZFUA 4AD9A 1Y0UA 2D2WA 5KT3A 3BC8A 3RKYA 4JBAA 5KFWA 5FJ8G 3NWTA 2RDIA 3C18A 5EWFA 1HF0A 5FPOA 1HKQA 1JX4A 3AG1H 1KA8A 4YIIA 1N77A 1O57A 4XMYA 2IPQX 3LA2A 2XAJA 1E4GT 5HS7A 2YRWA 1G59A 2XAHA 3J81W 3KEQA 4CZZA 4XKVA 2C2EA 4XL9A 1ENHA 3BR0A 4PK4A 2H6CA 3LQQA 1XMOH 5FJ8J 1YRNA 4C5CA 1ZARA 3FMQA 2IRFG 2DA3A 1PK8A 2JUGA 2KQRA 2M1BA 3BJOA 3R61A 5DUKA 1ETXA 1RYRA 4DYRA 2PI0A 4IX7A 2JRTA 1DQUA 3VYSB 2OUMA 1IBMH 3J7AK 1OCRH 4FBTA 1UG0A 1XMAA 1YOVB 4I99C 2AQ4A 2GLOA 3VPCA 3GZ5A 3K3VA 2E19A 4BHCA 2M2EA 2M4GA 3U1DA 2QSFX 5GAEJ 5TJJA 5HDGA 3KZZA 1W36C 6PAXA 1E0EA 2EK5A 3OOPA 4PGGA 2NVQJ 1UCRA 1M6VA 3FM3A 3PFYA 3P7NA 5H2FC 1UFMA 3ZN1A 3RI4A 3IWZA 4DL6A 2PX9A 2P4WA 3WGIA 3H3VK 4C30A 3CCSI 1PUFB 1BW6A 2VUMG 4DV0H 4M7EA 4B3TH 3RF2A 2VB6A 2LLKA 3BDDA 3FXQA 2JJ7A 1IN7A 2XAUA 3HUGB 5J47A 1T38A 3S1QJ 2FU4A 3AG2H 2R93J 4ED3A 1Z05A 3E3VA 2M0MA 2V9KA 3V6HA 3L2RA 4XLPF 1W4MA 2E1MC 4RAYA 2KDZA 1MMAA 1OYIA 2Z5UA 1B1BA 4F4WA 3K2ZA 3HZJA 4DR5H 2DMNA 5EWGA 1FMVA 3ESWB 2X0LA 3TW7A 1YFHA 1HDPA 5KT6A 2FA5A 2XKPA 1C3OA 4TQRA 1RYSA 3BQYA 1PVEA 5JHFA 3BZKA 1KU3A 5FRMA 1OJLA 2OBPA 1V4YA 3RKQA 2PN1A 1P6RA 5JI6A 2FF4A 3FBIB 2UXDH 2MH9A 2STTA 5CYVA 4IHTA 3PW0A 2IGKA 2W6QA 3ROUA 4O4IF 4HV6A 4XR6A 2UXCH 3OS2A 2QQAA 3DKYA 4WCGA 5HS8A 5BPDA 3PJRA 1HR0H 1FIAA 1I1GA 4DR1H 3RBDA 3E6DA 3OHAA 2ALZA 3QP6A 2YCHA 4IAJA 4YAKB 5BPFA 4ECUA 1TWCJ 2KLOA 3H9GA 4KA4A 2DZDA 2DXIA 3I12A 4J0MA 4KT5C 1SVLA 1C0WA 2ZC2A 4MGRA 2NS0A 3LP8A 4A0ZA 2HR3A 2EZLA 3OMYA 1BI2A 1F4KA 1I6UA 3BAAA 1R5HA 2I8DA 2IS2A 3CUQA 4ENJA 1K4TA 1S68A 4XOPA 2EIMH 2GIZA 5FRNA 1S6LA 4EEQA 4NXNH 2W9CA 1V5FA 3VPDA 4C5AA 5HV6A 1JKJB 4RM3A 2VXDA 4CICA 2BY1A 1JIHA 1LDKB 3CQZA 1TAEA 2HDWA 2RKHA 3GTLJ 3HSFA 3G2BA 4BHBA 4EYHB 4J9KA 3FIWA 3VFZA 2YS6A 2FP4B 3H5AA 5LBQA 5FKNA 5F6FA 4DJAA 1VS0A 4DGWB 3HKZA 3FKJA 4LIVA 3VDXA 3Q8RB 3S32A 4G3IA 1Z6TA 3M7GA 2V5AA 4XRSA 2V4JC 3JAMZ 4YR0A 2KHMA 1VNDA 3IRQA 1YRNB 2RNJA 1Q1HA 2JRMA 4MQVA 4EQQA 3UR3C 4BHPA 4CCOA 2WB1A 2FMYA 4HEA2 1Y8RB 2MW8A 4HYEA 3GLLA 1VBHA 4ANJA 2K85A 2KDOA 3GTGJ 1IUYA 2IBDA 2YZGA 3SE7A 2M45A 4Q44A 5BQTA 5FO5A 2EJRA 2BXZA 2NS7A 3HRTA 1EUDB 1NK3P 4TUYF 1IOVA 2VJIA 4HDVA 1BI0A 1PP7U 1E4EA 1TZLA 2W48A 2R7XA 2WV0A 3S93A 2DO7A 3SZTA 4YR2A 2QQ8A 4BGDA 1O3QA 1JT6A 5CA1F 2DK8A 3CZ6A 4LLNA 2G9WA 2X1EA 1Y1VG 3MWDA 2QK4A 2L9NA 1VQ5I 3GYHX 5JUMA 2FLLA 3RIZA 3V4SA 2PFBA 2Y30A 1XB4A 3H0GG 4EFBA 4HYKA 3BOQA 2LBFA 4FX4A 2STWA 3GTMJ 1Y1WA 4QWAA 1TW2A 2FNPA 5ILSA 4M3BA 4TQSA 1TWHJ 5LFAA 4XLEA 3OYGA 1QA6A 4IRIA 2Y9YA 2EILH 1GT0C 3E5NA 2P8TA 1X1BA 2GOMA 3D5RC 1I39A 1W5TA 3LSIA 4Q48A 4BQOA 3MZHA 1A35A 1FLIA 2YL2A 4C2MA 3BQ0A 3GMEA 2GWRA 3LSRA 4IOCF 4BEHA 3OYAA 5L3GA 4LGWA 1R1VA 2F5VA 3H0GJ 3K10A 4RAZA 2JVHA 2XHKA 4J9QA 2M87A 2GLTA 1WQ2A 1R5GA 2EQRA 2GIVA 3C1DA 2D45A 2E2IJ 3V8JA 3W2AA 4RNNA 5IOYA 2F2EA 5HDKA 1USSA 2ID3A 4M9XA 3M07A 3KEOA 3G73A 1B9NA 2L3DA 2NOGA 5DUIA 2E2JJ 2CQXA 1WSCA 4DZJA 1I3AA 5GADJ 5EEGA 1LUJB 4UUVA 1S7OA 5IYCJ 2CQNA 3KIOA 3LAPA 4IVNA 1HNWH 2LP0A 3P9KA 4QIWN 2XUBA 3I58A 2DLNA 5LMNH 2ZSHB 4HQ6A 1QQIA 2PVPA 5KFAA 3MFKA 1S7EA 2KIQA 1JHHA 1IRGA 2L2OA 3K1NA 2X85A 3QU3A 3OS1A 1D8JA 3FMSA 4BS9A 2O7OA 1XPXA 2P0WA 4BUPA 5KFQA 4LF7H 1T98A 3KEYA 5H6QA 1IO2A 2CYYA 2LVSA 1JKRC 5DV5A 5F27A 3ERED 1YS6A 3KFWX 4KN7X 2W9AA 2ZDGA 1FT9A 3P9IA 3S3NA 4BXUA 3Q8SB 4XK4A 1MSFC 1R71A 3DXJF 1LE8A 3RB0A 3J80Z 1GYFA 1FYMA 2GPSA 3OWTA 3ZP5A 1LQ1A 2FK3A 4RB2C 2ELKA 3MMYB 5LRSA 2EFWA 3ZPLA 2VQCA 4D9JA 2R84A 3L4JA 3CUQB 1FBQA 2ATLA 5L3CA 5IT9K 1D5VA 2Y75A 3BCBA 4AC0A 4ME6A 2VPSA 2J6SA 2W9CB 1GV2A 4B3SH 1OCOH 3HSRA 1SC7A 4DL2A 3RKWA 3MWMA 2MGQA 1OCTC 5CQEA 3N8DA 5KFMA 3HPHA 2LKSA 5CAEB 1QPIA 4DV4H 2PBZA 2OH2A 1IBLH 2BY3A 2BQRA 4FISA 1D1AA 4CO8A 4MV3A 1MBEA 4RUCA 3LNQA 1U9OA 3GTOA 3E5XA 1B6RA 2FUG2 5A2QK 3L4KA 3FMAA 4NC7A 2I8CA 1M0WA 1KYWA 3PW2A 3C7JA 4W97A 1VQPI 3CDLA 1APLC 2GXAA 2V1DA 2PMUA 2AXLA 5K5RA 2R7NA 4OAYA 3V4ZA 1X3WB 1YW8A 2K9MA 4LJZF 2LMDA 3NGDA 4L5IA 2CV0A 3GTJJ 3WHCA 3IH3A 3U2RA 1IOWA 1XC5A 1P4WA 3H20A 5KFLA 2M5WA 4JI5H 2R82A 5LGNA 1JDBB 2FQ3A 1N36H 5KG3A 1N33H 3I54A 1WJ5A 1TNTA 4E7JA 4BJ6C 2HZTA 4O3NA 2VQLA 5DD8A 3LQRA 1HSJA 1AOYA 4M3DA 4I76A 4ZZDA 2LKXA 1BN5A 2IAIA 2Z3YA 1GXPA 1DGRM 5J1UA 3K3PA 2K9SA 4PJ0C 2R8HA 2CSOA 2UU9H 2CU7A 1KJ8A 2UVUA 3BG3A 4ED8A 2DYSH 3RZDJ 3WTSC 4RM2A 3GW2A 2PJPA 2R7SA 5F08A 5JFRA 1RUOA 1T94A 1GVJA 3WTUC 1RESA 3V7SA 2W25A 4GKKH 1TQIA 4AVZA 2XD4A 5KT2A 3GV7B 4MTDA 2X48A 3MVPA 2LF8A 2LBFB 4IHSA 1P9QC 2W7NA 1G3WA 1A04A 3KAJA 2AGPA 2K86A 4EJTA 1X1CA 2V6EA 3ZR8X 2XF6A 5JR3A 5KFPA 4UV9A 1JUPA 2HS5A 2PBIA 4RLFA 4C5BA 1R22A 4AQYH 4DL5A 1ZYRF 2Y0SA 4KIFA 3JW4A 3MN2A 2YX7A 3UFXB 4ON0A 1FOYA 1VI0A 4HNVA 4P9UA 3G8CA 5KX5F 2JSCA 2B7EA 1IAWA 2LY9A 5H20A 1XGNA 2HXOA 2WAQA 3FK7A 4LK1F 4BEHB 2HPMA 3PW7A 4IWXA 1QPMA 4F4XA 2BQUA 5F0CA 2FKLA 2G7UA 2JEJA 2BOLA 2CG4A 2QWWA 3HJEA 3H92A 4JX4A 4U0WA 4E4HA 1A5JA 3L2PA 3ZXSA 4FBUA 1GLNA 3PNVA 3VPBA 2YS7A 2EB7A 2UUZA 3RPUD 3J81K 2NNNA 2KRHA 2H27A 3V8KA 1W93A 3RAXA 2P5KA 1OR7C 3L1PA 5AIPA 2UXBH 2JPBA 5C3EG 5KFSA 3I4MJ 3ULQB 4J9OA 2KP6A 1JUSA 2L7MP 1G8XA 2QYZA 4HSRA 3B6AA 3GIDA 2LKPA 5KFEA 3ZQIA 1I50A 4DOZA 5C1PA 5FLXK 2R92A 2CW0F 1UB9A 5CPRB 1L3LA 4R8UB 3OSPA 4LH7A 2HFHA 3DCFA 2VE9A 1R9TJ 4UNOA 3GCMA 5LEKA 2ZO4A 4HPQA 3S16J 4XORA 1MBHA 2MC3A 1RR8C 2XSJC 3S1RJ 3FXUA 2JA5G 1QHHD 5C3EJ 3N42B 1W96A 1LE8B 2VBWA 4P1WA 2X6YA 3DPTA 2K3PA 3K7AJ 2QSHX 2O8KA 1SD4A 3EUHA 2BHZA 3FBNB 5FKMA 4FETA 1F43A 2Z16A 1WRJA 2R7LA 2VPQA 5D1OA 1WFXA 3RAQA 4JI7H 3HOZG 2RGVA 1IG7A 4QPQA 3SQNA 3L2CA 1PUEE 4O4LF 3HOVJ 4P96A 1XSDA 5DM7F 4ED1A 2IGNA 1JXSA 5JVTA 4AM3A 1HQCA 1XD7A 1VQ9I 2CQ7A 2NVYA 4UFZA 2DODA 5E1XA 2R7ZA 2LSOA 2BR0A 2JA5J 2DMQA 4H4KC 5KFTA 2EA2A 4XKCA 4Y15A 5F04A 3JTHA 3SDBA 2UVRA 5CKTA 4PJJA 3QYBA 3FKIA 3IKTA 2FEZA 2PMZN 2ISZA 2QCOA 3DEEA 3T8RA 3M9AA 4RMNA 5DYMA 4C3HJ 4HNTA 1J59A 5DQIA 2XRNA 3U21A 4QIWE 2FPPB 3OYKA 1N56A 3C3WA 2VI6A 2WWYA 4W1UA 4IKFA 2BE5F 2RDJA 5KFYA 1WVRA 1ACIA 2ZNYA 4ECQA 2VIXA 2LDUA 4HQMA 3GTPJ 2M0CA 3AG3H 2R7FA 5BPHA 4HX8A 1W36D 2DPDA 4LB6B 1YJWI 4RA2A 2MBFA 3KZYA 1M0TA 2VPLA 2MA3A 2WY7Q 2L0KA 2Q8KA 4IPAA 2K9LA 4CDGA 1FX7A 4K2EA 5D5UB 1YJ9I 3CUOA 3T1BA 2A5YB 3WO1A 5F9LA 1F5TA 3FZVA 3MD2A 4YELA 4GC6A 2R8KA 2KIMA 4O2AF 3OSNA 1BXRA 1BL0A 4UCVA 1FOWA 3WG9A 4A12A 4B3RH 3QOEA 1MGTA 4WWCA 1X58A 3HC7A 4E70A 4DV6H 3F8MA 4DV7H 1Z91A 1YW7A 1YIOA 3ZQLA 1QNTA 4EFEA 4I7HA 2QZ8A 2CS3A 2JWTA 3KPHA 1NH3A 3Q0UA 2V7FA 2HDDA 1TWFA 2R86A 1U3EM 3ABLH 2QUFA 4PZJA 2DCEA 3SZPA 2OCEA 1BIBA 1Z9CA 2HDCA 2HGSA 2F48A 4MV7A 3S2DJ 1SFOJ 3M4IA 4M3EA 2XAGA 2E60A 4D5FA 2VE8A 1TWGJ 5CVJA 2V1UA 4F55A 1FTTA 1JT0A 2JA2A 3TINA 2VQGA 5L3DA 5KG0A 1ZH5A 4U87A 4JX6A 2QENA 2OZ6A 1UZCA 2LF7A 2VL8A 3CCJI 2QQBA 2V4RA 4XKBA 1TT0A 4HR7A 1Z77A 2FQ4A 4KT6A 2R3SA 1KONA 4X65H 1IRZA 2LK2A 2QF7A 2W57A 3SFIA 5KFVA 3FXLA 1ZKGA 4CCLA 3JREA 2M34A 3F8BA 1B04A 2FBIA 4YFXF 5FB2A 1V54H 3VSKA 4ZYEA 3WE3A 2B63J 3JSPA 1VQKI 4XNFA 3J7AY 3DF7A 4BY1G 3M8FA 3PVXA 4MA5A 2HVRA 3RTRA 4UCTA 3TQTA 4NLGA 4O3OA 1E17A 1Z2NX 2R5ZB 1XN7A 3N97A 3F8FA 4PDBA 3I59A 5FPRA 3GFJA 4GC7A 5CVVA 3KLNA 1WJCA 5M5WJ 5KG7A 3DTKA 1KU9A 4GXOA 3HSEA 1RK5A 3RGZA 4G8XA 4XOTA 3ZQCA 3BTLA 4EVIA 2GBYA 4FHTA 4Q8EA 3QPHA 3O8GA 4HOBA 4BY1J 3BJAA 2E2HA 1TNSA 3T0YA 5B66C 2W9BA 2KZVA 1YIJI 1WI3A 4FTHA 2L4MA 4YHHH 3M9OB 2M05A 3RBEA 2Y69H 1O75A 3DKWA 3N43B 5D1OB 3I55I 5K7FA 4A3IJ 2V58A 1O4XA 4F93B 1I27A 4HW0A 1UHWA 1CF7B 3V4GA 2ZMEB 2O8XA 1G4DA 1FYLA 4N9HA 3EETA 2R7QA 3FWEA 4DZPA 3D1NI 1NK2P 3K69A 3KYDB 2Y31A 1LVAA 1T36A 5IYDG 2J9GA 2H1KA 2I80A 1ETQA 3M9NB 3KZIC 4ECSA 4E7LA 4JI6H 1EUCB 1B9MA 3BR3A 3DKXA 3Q0WA 1MD0A 4GRIA 4N4OB 2EWNA 2K9NA 3ZOBA 1ODDA 1JJ8C 3HOWG 2BV6A 5EZGA 1YX5A 2HJWA 1QZZA 4F4YA 1F9NA 2BVMA 2R7RA 3QAHA 3QPTA 5E20A 1JLLB 3N6XA 1AKHA 2ZM6H 5E3OA 3RPUA 1GUUA 3NRVA 1SCUB 3KP3A 2P6SA 4CUGA 2VT3A 3Q5FA 5IYDJ 1T0FC 3CC2I 1UAAA 2C6YA 2ZJRF 5B1BH 1OYWA 1DPRA 4BXXJ 2R5YA 1KC7A 1R4MB 3HYIA 1FYKA 2X0SA 2CUFA 2P6TA 4RU9A 2LG4A 2E35A 4D5CA 3QRFF 1CQJB 3G1MA 2HHHH 4AU7A 2EFPA 2M3AA 1V5EA 3PFIA 3HOUG 1DP3A 1VQ8I 1AUXA 1WSUA 2HEOA 1KJJA 1D3YA 4KJZA 4Z2YA 5KVRA 1G2HA 2GXGA 1X1AA 1U0JA 2XIGA 2ZXIA 2IS4A 1OCPA 3CJNA 1ZTRA 4GLXA 1WCMJ 5LXTF 2JT1A 4DW6A 1WHUA 2IA2A 5K2MA 3GFIA 1GV5A 2NVXJ 2PG4A 2CQQA 4I01A 4B47A 4B43A 2NUAB 5E3NA 1HOMA 1K83J 2VBZA 5J8FA 5EDNA 1MMGA 2VC1A 4M6XA 3HOUJ 5E1ZB 1AWCA 3CMMA 3J7YJ 1O3SA 1M1EB 3OY9A 4DR2H 5DM6F 2MLKA 3VWBA 2PMZE 3E6CC 4HF2A 2M7AA 1T2KA 1TTYA 3HL2A 1X9NA 2PN6A 4CYCB 2E5LH 3CF5F 1JKOC 2X6XA 4UUTA 1QO0D 5EJCA 1IGNA 5KFGA 1JJ6C 4NHJA 3RQIA 1PYVA 1K79A 2A05A 2N8GA 3O2PE 3Q0VA 4EJUA 2Z2SB 4IEJA 4U0VA 1FJLA 4RB1A 4QJFA 4YAJB 4II3A 3KYCB 2F4IA 3LSTA 3JZIA 5DQHA 3CCYA 4HV5A 4A5NA 2W00A 3FXJA 5J6XA 2FOWA 4YJ3F 4HQEA 2KIFA 1P8LA 3FXOA 4EV0A 4M9UA 5LHHA 1NG6A 3PR4A 1FMWA 1ZRDA 1J2XA 2E7XA 5KFDA 2IGMA 3ISPA 2JA6A 2NS8A 4IJAA 2VUGA 2MH2A 4BJTA 2QLZA 4ECTA 4UCSA 1JTYA 4YR3A 1HW5A 1UELB 3I59B 1MBGA 3DFGA 4OWRB 2ZNZA 2A6HF 1U5TC 1IN4A 3R60A 2HYGD 4ABZA 4ZYDA 2CUJA 3N44B 1D8KA 1DGWY 5EF6A 1SEIA 3BP8A 2LY1A 1RUNA 1D1CA 3GTQA 3SEZA 3PQKA 1Y1WG 3IHUA 4GO1A 4A2BA 1CQTA 2HYJA 3MR3A 1HXDA 3MCZA 4Z6YA 2W9BB 3CESA 2VC0A 3K4NA 4HNUA 5F0HA 4RNMA 4MFEA 2DMPA 2X9DA 1UC9A 3OR1C 5DGAA 2PJRA 3UNGC 2VUMJ 2HNHA 3OIPA 4JOMA 1SD7A 4UCRA 1LEBA 3BG7A 4ED2A 3RKXA 4FQGA 1IV6A 2NNYA 2DMUA 1RR7A 4JI3H 5B5EC 5DQGA 2RREA 2LYCA 3LSHA 2ISYA 2DT5A 5IP9G 2XC9A 2CQKA 1R36A 1G3TA 1FIPA 1J75A 4CCKA 3IH4A 2HKXA 4GYIA 2CZGA 4F7ZA 2RQPA 3JTGA 1HNZH 3LWFA 3LSKA 1R4NB 2L01A 3WNZA 4MV4A 1Y6IA 4M72A 2LREA 3JRFA 2F4OB 2DW4A 4FE7A 2NU6B 1GGOA 3PO3G 2UXXA 2W6NA 2JA7G 3QWLA 3GEZA 1AKHB 2D1VA 1MBKA 2B0LA 3TOBA 5IP9J 2BQ3A 3GFMA 4E7IA 3JRDA 2CV1A 4I50F 4RAFA 2F5CA 3JR9A 1JE8A 3MKZA 2RN7A 3WU2C 4A3LG 5L9XA 2R5YB 4MIMA 1D0XA 1ZG5A 2IA6A 3PNTA 4XIDA 1S3JA 1LFBA 2FJZA 3IAS2 4GYGA 1IN8A 1JGSA 2FRHA 2K02A 4WF2A 4Y17A 4BJ5C 1BBYA 2IMWP 3PO3J 5KFKA 3MFIA 2VASA 2JA7J 2X1DA 1H9TA 1GDTA 1HW2A 4IHJF 5F1RA 5H80A 4HAMA 2M8GX 2NYXA 3F9KA 3LMLA 4O3SA 4BE0A 1AA7A 1A6QA 2WAEA 5D8DA 3GIMA 1SMYF 2E1NA 3RQ4A 3HDDA 4LG3A 2XB0X 4B4CA 1TL8A 3WTYC 4QWQA 2QA4I 1C30A 5C5JA 4YJ2F 2ETHA 2VPRA 2IW5A 5KFZA 4ZC3A 3VEPA 1ZREA 3OYHA 2R6FA 1SFKA 1U8RA 3G6VA 3W6KB 3RV4A 2M8EA 1H88C 4HA8A 3HOXG 3CC4I 4P9FA 5D5VB 3H40A 2OF7A 1BGWA 2IA1A 2A5WA 3LWBA 1W1WE 4FM9A 4Q8FA 2W7OA 3JRCA 2RVCA 4JI1H 3E7LA 4I09A 1KGSA 1S5LC 1A31A 2J5OA 3CCEI 3BG9A 1VTNC 1IV8A 3REOA 2Y9ZA 1Z6RA 1ZG3A 1QVTA 2K27A 5DEQA 4X0GA 3CCMI 4MAMA 4AYBN 2F4MB 4KFCA 2VOBA 3G6YA 3B6CA 1T33A 1IC8A 3CP2A 2ZJ2A 2HVSA 2VODA 5KNLA 3HOXJ 1U8BA 3GTOJ 2DBBA 1R49A 4RDUA 3KXYT 1VQLI 3WU0A 4YP3A 3GF2A 3TW6A 2FOKA 2CMPA 2FJ1A 5FD6A 2NU7B 1LKXA 1KBLA 2ME0A 4EJVA 1J5EH 1W7PD 1Y0NA 1OKRA 2R93A 1BM9A 3K2AA 2PLYA 1V9PA 2EPFA 3RB4A 2DLLA 4BAYA 2JVGA 2Z1DA 1X4PA 3U1KA 2R7UA 1B72A 5HNFA 1REPC 5IWAH 3DBHB 3BJ6A 4A6DA 2BYVE 5JVGF 4S05A 1X4OA 1SAUA 3OOUA 2IP2A 4L0YB 1VQNI 2FLPA 1Y1VJ 3KHRA 4BYYA 1FBUA 1CE8A 3KETA 3I71A 4OOIA 1NHAA 3H1CA 2E1MB 2WYOA 1MH3A 3HRMA 3FISA 2X6OA 5LGUA 4DLKA 3I5UA 2PJRB 3OHBA 4J19A 2R7OA 3JRGA 2W8LA 3JAMK 2LY2A 1O3RA 4ECXA 3BWGA 1ZK8A 2FBKA 2X6WA 2RC4A 4LG0A 2W84A 3ORQA 1MKMA 1CGPA 5B3SH 4O2BF 3WHBA 5HLHA 2YX4A 1HDDC 3MR2A 4UCOA 1S8NA 2WTFA 3IH2A 3H4BA 4C9YA 4DUZH 3VPRA 1OPCA 1TWCA 4ZH4F 5D4RA 2VOPA 3IRRA 1E3OC 3S3MA 2IP4A 3V6KA 2L4AA 2HI3A 2MABA 3LA7A 1SFEA 2XCPA 2NVUB 2K4BA 1XX5A 2CWEA 3WTZA 3QPLA 5FKKA 4DR4H 2H94A 3CLQA 1WH2A 4RBOA 1HNXH 4LFBH 3GIQA 2XPVA 4FS1A 4A93G 5K5QA 1O7FA 1X1DA 4ZDOA 2DJIA 1ZETA 2R92G 2DA2A 1A0IA 1DV2A 3W2VA 1NG7A 3BG5A 1OQYA 3GV8B 1E3HA
chains in the Genus database with same CATH topology
3COAC 2Q2EA 3DEUA 1DPUA 2HGCA 3CO6C 5FD5A 4L9NA 3TGNA 1FOKA 1P4AA 4I0AA 4YG2F 5HOOA 1BI1A 1L0OC 1ULYA 4ASNA 2XAFA 2QYOA 1FC3A 4CHUA 1YYVA 1LDJA 2GA2A 2ZJTA 3CLOA 4HX4A 1U6GA 3WTWC 1GXQA 1B6AA 1HSTA 1FJGH 4M9ZA 4LLGF 2JPCA 3KP5A 3PQJA 4IXAA 2E1CA 5K1YA 2D1HA 3V8LA 1P2FA 4FX0A 1KQ0A 2FNAA 3J80K 1LNWA 2VOOA 4ETSA 1K6OA 4OMZA 1O7LA 3R4KA 1IN6A 2UUAH 4FT8A 4AIJA 5LMUH 3O6BB 5LHIA 4U7DA 4L0ZB 3D0SA 1SD5A 3FHZA 2X4HA 1FVIA 4L5JA 1USTA 4M73A 3PN1A 1PDNC 1YG2A 1ZHFA 1I94H 5LGTA 4UHTA 4K0KH 4NQWA 1YW9A 3KAKA 4JQFA 4EGYA 2O0YA 1FSEA 2ZXJA 3TDUC 4R8HA 2MCTA 5D5XB 1QBJA 5E18F 3CTAA 4Q4ZF 3FM5A 4DNCA 4LG0B 1DGSA 5BS6A 1K78A 3RYPA 2JTVA 2QBYA 5EEHA 4UXNA 1J0RA 1OR7A 4I98B 3OTOH 4NB5A 4JI4H 4D0PA 2O03A 3Q9VA 3JSOA 5DCMA 5D6EA 3K0LA 1R1TA 4O3MA 1V4RA 4KN4X 5CVRA 1QZYA 1SYXB 2HYFA 1ONVA 2A07F 3IC7A 3ECOA 2DI3A 1W7PA 3TOAA 2DQRA 1IN5A 5DDGA 1G3YA 2VXZA 3ZMTA 4LSAA 2KKOA 4MHGA 5D5WB 2O6GE 3M8EA 4HDUA 1FNNA 2P5LC 1G3SA 5D8LB 2YSRA 4RGUA 2QQ9A 2PEXA 1RZ4A 2VONA 2XKOA 1XNQH 5FGMA 4EMSA 4LH6A 2H09A 4EJOA 1ZLKA 3ZN0A 4YFNF 3E5UA 4DR3H 4WXDA 1H0MA 4LF6H 1EH7A 1S7AA 4L9VA 5HLIA 2LNBA 5AIQA 2ESHA 3E97A 4RGXA 1TQMA 5K5OA 5L3BA 3KCCA 3TKYA 4U0YA 4P5OA 3SHFA 4JI2H 5BPIA 2ZFWA 2V6CA 2Q0OA 2GZWA 2KJCA 3N40P 4LD5A 4O5VA 5ILUA 2CGPA 3SFZA 3WODF 4BH9A 4JK1X 1V3FA 2A61A 3B73A 2IT0A 1T39A 4KMFA 4ENKA 4LFUA 1T6SA 2YPRA 1GHCA 4OIPF 4CC6A 1SFUA 2OZUA 5JHUA 4M74A 3FMRA 2DFIA 1FKAH 1K78B 1YLFA 4R7RA 3R6SA 2QBYB 5HLGA 5DD4A 2DU9A 3F22A 3RPQA 3DQVC 3R0JA 2GA1A 2ZBKA 3BABA 2XASA 4WXHA 5DCMB 3L7WA 5ICCA 2ZKZA 1FP1D 2M30A 3P9CA 5ERIA 1G6NA 3F6OA 4G6QA 4UVBA 5IT9W 1W7PB 1XMKA 2WC2A 1N32H 2WE6A 1IXRC 2O61A 3T1HH 4G7OF 3MAJA 3BY6A 3K1MA 3HUGA 1QGPA 3E6BA 1R1UA 4WK8F 3VODA 4JI8H 1ON2A 1YS7A 2CO5A 1U2WA 5CVUA 1UHMA 3ABTA 4Y13A 5L3EA 1F1ZA 2AS5F 3I4PA 4PDKA 3RIRA 3H3ZA 4RB3C 3J7AO 5LL6b 4ESJA 4KNYA 3KP2A 3T8TA 4LF4H 1XMQH 4OMYA 2EFOA 2YU3A 4X66H 3HHGA 1LB2A 1XCVA 1IXSB 1J5YA 4DV5H 1T0FA 2V1XA 2VN2A 3E6MA 3F21A 4A5MA 1SAXA 4LFCH 3F72A 3TO6A 2BBYA 1ZRCA 2KSWA 3TQNA 5LHGA 2HKOA 1TLHB 3BPVA 3GWZA 5E17F 2COMA 3LAJA 4LK0F 4LMYA 3GX4X 5FFZA 2DQLA 5ILVA 1B4AA 4UVAA 4OIRF 4RS8A 3WTXC 3H3UA 2VBXA 3NEUA 1LEAA 4LF5H 3ZMZA 3L9FA 3AAFA 2A69F 4HLXA 3IKVA 3KP4A 1KQ8A 1FP2A 4KUMA 4BNCA 1W5SA 3G3ZA 2OWOA 1TBXA 3GO5A 1KYZA 1FWZA 1L2ZA 4GKJH 3C0FB 3HXLA 4B3MH 5FLXW 1TQPA 4EM0B 5ICEA 4RZQA 2YR2A 2V79A 3WU1B 1LDDA 4CC5A 4HLYA 1U5TA 2E7WA 5D1PA 3TO7A 3ABUA 1XDNA 1XGSA 3BPXA 4DV2H 3ZMVA 4AIHA 1ZG1A 1IF1A 4M9SA 1BC7C 2EV6A 3KE2A 4N0BA 2IJLA 3F8NA 4XSXF 4ZYHA 5LRRA 4L9JA 2UUBH 3KLOA 2FBHA 1K7AA 4DR6H 3QP5A 5D4SA 4I02A 2G7HA 3EDPA 1RNLA 2IVMA 4OIOF 4X62H 2DPUA 3N4MA 3HIFA 1XSVA 2RGRA 5ICGA 1ZRFA 4LB5A 1DP7P 5E8GA 2HQNA 3E5QA 1YTYA 1STZA 2XV4S 3IWFA 1R7JA 4CXFA 4LSXA 4OU0A 3HOSA 3JSNA 1BJTA 4MEXF 2Z33A 3CUQC 2BGCA 4U88A 2Y48A 1I6XA 3NQOA 2XGXA 5FFXA 5CVIA 3U9GA 2EV5A 5F64A 4DV1H 1O3TA 1WKMA 2UZKA 3TO9A 1I5ZA 5BMZA 5HS9A 3DV8A 3S2WA 3F23A 4HZFA 1MZBA 4R1HA 2ZCWA 4JV5H 4MEYF 4DV3H 2H6BA 2F4VH 2RDPA 3N41B 1BI3A 2L02A 3OV8A 2FXAA 1ZGJA 1IRFA 2EFQA 1SMTA 3LA3A 4XBFA 2XAQA 4ENNA 3GLXA 4R79A 5ED4A 3ECHA 1Z7UA 1N34H 3I64A 3L09A 4P55A 1U5TB 4JI0H 2QM3A 4IRGA 1BC8C 4MQ9F 3Q9SA 2P7CB 1ZAOA 3GUDA 3RDIA 1BIAA 2ELHA 2FSWA 2VT2A 2L54A 2A6EF 5IT9Z 4PCQA 2OA4A 2F5EA 2WDTA 3EYYA 2WTEA 3WTVC 3UQ8A 1S03G 1MDMA 2O3FA 2DAOA 1EH6A 3VOEA 4ZYGA 2A68F 5E8IA 3MQ0A 1KQ9A 1MJAA 4KIGA 5A2QZ 1IZ1A 3V7CA 4L18B 1HKSA 2EA4A 4KDPA 3DPLC 3EQLF 1OYYA 1P92A 4H0EA 2MLGA 4N9IA 2GQQA 2HTJA 2F5DA 4HF1A 1BJAA 3QU6A 4DQ2A 3FXRA 3IL2A 3HTSB 1YQAA 3F6VA 4KHPH 4I0BA 3GFLA 5J8CA 5HDNA 1SFXA 1XCBA 4AVPA 1U78A 4MTEA 1Z2PX 1FSHA 4IF4A 1KU2A 1ZHQA 4WXCA 3F3XA 4KMUX 3D5LA 4PGHA 4LF8H 3V7RA 2ADUA 1IBKH 4LLLA 4AWXB 4ESBA 5L3FA 3ZMDA 1KU7A 4EM2A 2GXBA 4DUYH 4EM1A 4DR7H 2ACJA 1JHFA 1H9GA 1MJ9A 3ELKA 3J81Z 5CLSA 1FPQA 2KRFA 1SD6A 2HQRA 3K1PA 4A2AA 2DK5A 5FLXZ 2V9VA 3HOTA 3FX3A 5H6RA 2CW8A 1DUXC 4YFKF 2K7LA 4XRFA 2XROA 3VB2A 1LJ9A 4I2OA 2TDXA 4EGZA 3WE2A 4CGZA 2VBYA 3I0TA 4TV7A 4MV9A 4HX7A 5AONA 2VQFH 4AIKA 2A3SA 4G94A 5LLQA 2HVQA 2MD5A 4HF0A 1X3UA 1FZPB 4G7HF 2EFNA 1MDMB 5IT3A 4B09A 1Z1DA 3ZMSA 5TRDA 1HKTA 4G9YA 1P4XA 4RGSA 3GVAA 3CO7C 3TDZC 4GCVA 1ZGAA 4LF9H 1J9IA 4EJWA 2RV8A 3T5XA 2J5PA 3ZMUA 3F8CA 4OIQF 3IG0A 4KIBA 1ZHSA 4CYDA 2Q2UA 4QLCU 3L00A 3KALA 5BOXA 4G7ZF 5E1WA 5LEJA 4UCUA 2OD5A 4Q0YA 3I53A 3BROA 1HW1A 1CF7A 2ZMEA 5D8KB 4OX9H 1FBSA 3DP7A 2HOEA 3MEXA 4YY3H 3QOPA 2BEOA 3HTUA 5HVQC 1R23A 4ESFA 4UVCA 2IA0A 4RGRA 3O3KA 3GZ6A 3RTXA 2PQ8A 4A6EA 1B59A 3CVZA 4IRHA 3SXYA 4GGGA 1E4FT 1HBXG 3FF5A 1ZN2A 5DCFA 3RGXA 4YIFA 2KIUA 4Q47A 1RIOH 1XNRH 3KP6A 5KK1A 4A0YA 5CJ9A 2Z9OA 4HBLA 4OINF 3JSLA 4U7BA 4Q5SF 2UWMA 4O6JA 2W24A 1FY7A 3W6JB 3BA8A 1IW7F 2FE3A 1XDSA 3GXOA 4WX9A 3RJPA 2HTSA 1I1SA 2UXNA 4A2UA 3JAMW 3ZQ7A 2NAZA 5ICFA 4G6DA 2P5VA 5D6FA 1AN7A 3WGGA 2W85A 2Q2TA 1R58A 1TA8A 1RI7A 3BZ6A 1DDNA 3WGHA 3HRSA 4BWSC 1R00A 2UUCH 1E2XA 2EV0A 3BA9A 4BQAA 4NXMH 4RB0A 2OU2A 3WTTC 4B8XA 2Y0MA 4LFAH 4UV8A 2HWVA 3MZYA 4L9TA 2NRAC 1PP8F 3RJ0A 2OQRA 2FMLA 2KJBA 2ESNA 1ZLJA 4XSZF 4APMA 3HRUA 1Z2OX 3T1YH 2R7DA 4JYAH 2PMHA 3RYRA 1EH8A 2CFXA 4A0XA 2OQGA 3R0AA 5A2QW 2Z99A 3ML6A 1MJBA 5EOYA 4X64H 4M71A 3EYIA 1WI9A 3KP7A 2DTRA 1IXCA 1XGMA 2P7VB 3HHHA 2VQEH 1OMIA 3B02A 1TW3A 3CDHA 2XVCA 1EV7A 2JZYA 1S29A 2K4JA 2QVOA 3K9TA 4ZZLA 1BOAA 3J80W 4M6YA 1YO5C 2OAZA 4KICA 2CW7A 1J7KA 1ON1A 4MNUA 1XDUA 2GAUA 1XSXA 5BR8H 3LFKA 4S04A 4XLNF 1XGOA 2F5FA 4ENMA 1WWXA 4KYWA 3M1EA 3DF8A 4AD9A 1Y0UA 2D2WA 3RKYA 4JBAA 3C18A 5FPOA 1HKQA 1KA8A 4YIIA 1O57A 2IPQX 3LA2A 2XAJA 1E4GT 5HS7A 3J81W 2XAHA 3KEQA 4CZZA 2H6CA 3LQQA 1XMOH 1ZARA 3FMQA 2IRFG 2M1BA 3BJOA 3R61A 5DUKA 2PI0A 2JRTA 1IBMH 3J7AK 1XMAA 3GZ5A 3K3VA 4BHCA 3U1DA 5TJJA 5HDGA 3KZZA 6PAXA 2EK5A 3OOPA 4PGGA 1UCRA 3FM3A 3P7NA 1UFMA 3ZN1A 3RI4A 3IWZA 2P4WA 3WGIA 4DV0H 4M7EA 4B3TH 3RF2A 3BDDA 3FXQA 1T38A 1IN7A 2FU4A 1Z05A 3E3VA 4XLPF 1W4MA 4RAYA 1OYIA 2Z5UA 1B1BA 3K2ZA 4DR5H 2X0LA 1YFHA 2FA5A 2XKPA 1KU3A 2OBPA 1P6RA 5JI6A 2FF4A 2UXDH 2MH9A 2STTA 5CYVA 4IHTA 3ROUA 4HV6A 2UXCH 2QQAA 4WCGA 5HS8A 5BPDA 1HR0H 1I1GA 4DR1H 3E6DA 3QP6A 2YCHA 4IAJA 4KA4A 4J0MA 4KT5C 1C0WA 4MGRA 2NS0A 4A0ZA 2HR3A