4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
b'MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxide stress regulator PerR, FUR family
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
4QWQA 3WTUC 5CVRA 5HS8A 3E6MA 4LK1F 4EM1A 3KP5A 1QO0D 1G3YA 2P7VB 4XLPF 4HA8A 1LDKB 5BS6A 3TO6A 3KEQA 4ZZLA 3MQ0A 4O6JA 2DLLA 1WSUA 3JW4A 5F64A 1FP1D 4CICA 4EGYA 3RJPA 2EFNA 4WXCA 1RI7A 4OMZA 3J81Z 1J9IA 3HSEA 3L00A 2FEZA 2FBIA 3DEUA 4QLCU 4I01A 2KIUA 4CGZA 1FYLA 1R7JA 2FA5A 2Z5UA 5FD5A 1XGOA 2NAZA 3IKTA 2RC4A 2FSWA 4ENMA 2LSOA 1WWXA 5LEJA 2MLKA 4BHPA 3RYRA 1LQ1A 1H0MA 1QPMA 1MDMA 3WU1B 3FMQA 3S2WA 1LNWA 3QU3A 1S29A 3BJAA 1KYZA 1QBJA 3GFJA 3SHFA 3K9TA 5L3EA 5E8IA 1O3QA 2GXBA 1ZLKA 1OMIA 2HKOA 3CTAA 1Z05A 4A0YA 2BBYA 1D8JA 3HTSB 4I2OA 4HOBA 1LJ9A 2VBXA 1RUNA 4TV7A 3QU6A 2G7HA 4OOIA 4K2EA 5HOOA 3R60A 4HBLA 1XDUA 3FX3A 4KICA 3N4MA 2D1VA 1HKTA 4LLNA 2RN7A 5LHHA 3ECOA 1OKRA 3QPHA 4ON0A 1SD5A 1W7PD 4RGSA 2QYOA 1IN7A 4Q48A 3P9CA 2HEOA 2ZXJA 1TQIA 2K4BA 1R36A 1IXRC 5DUKA 3TO9A 1OPCA 1ZH5A 3RYPA 1YQAA 4HDVA 1O3RA 3MEXA 4M6XA 1YTYA 2CGPA 4A0ZA 2FBKA 2QENA 4ASNA 4FHTA 1K79A 3HRUA 1HQCA 5ERIA 2J5OA 3CUQC 3GFLA 3F8NA 3L09A 4HYEA 3ZQ7A 5KK1A 5LGNA 3DF8A 4HX4A 4LLGF 3CUQA 1C0WA 3O3KA 1NHAA 3PFIA 2Z33A 3R0JA 4DQ2A 2ESNA 3WTYC 4XBFA 5KVRA 4HLXA 1P92A 5FD6A 3WTSC 3U1DA 3E6BA 4BAYA 5FO5A 5D5VB 2EJRA 3TDUC 4YIFA 5FLXK 1EH7A 4BYYA 1B59A 3PQJA 5BPDA 2LF8A 5D5WB 2OBPA 1J5YA 1E17A 4O5VA 4GYIA 4XSXF 4UVBA 4M9SA 2LF7A 3JAMK 2PN6A 5LEKA 1BC7C 2HTJA 1ZG3A 3I71A 5HLGA 1YO5C 2W85A 3M8FA 3W6JB 1JHFA 4CDGA 2GIVA 2HYFA 2HS5A 4M6YA 4OIQF 2GA2A 5E1ZB 1R22A 4PGGA 1W5TA 5CJ9A 1MKMA 4L9TA 4HQEA 1BI2A 3U9GA 2DBBA 1R5GA 3GZ6A 2LDUA 4NHJA 2JSCA 2A61A 2JT1A 3ZMVA 4MEYF 4UUVA 1XD7A 1P2FA 1OYIA 3FXRA 2RQPA 1MJAA 2O0YA 3I4PA 4L9NA 5L3CA 4KN7X 4BHBA 5L3FA 3WTTC 5BOXA 1B4AA 1ZHFA 2C6YA 5DEQA 3QP6A 4AD9A 3DPLC 3JTHA 2P5VA 2V6CA 3WTWC 2HKXA 4UXNA 4EGZA 1CF7A 4RGRA 3P7NA 3T0YA 2OU2A 4HX8A 3RPUA 1J7KA 2Q2EA 3BPVA 3MWMA 3GFMA 3IL2A 5CVVA 2D2WA 4EJOA 4GGGA 5F6FA 2Y75A 3BOQA 5BQTA 3ZP5A 3ZMZA 2FMYA 4HZFA 4OIPF 2Z9OA 2JPBA 4MHGA 3O2PE 5D6FA 2P5LC 1GVJA 3IWFA 4IRIA 2VN2A 1W7PB 1K78B 2CFXA 3Q9SA 1YS7A 3EUHA 2P4WA 3WE3A 3M9AA 4ZYGA 3JTGA 1P6RA 1IN6A 2HQNA 5ICFA 1BOAA 2ESHA 2HTSA 4KYWA 3QPTA 4EQQA 3FHZA 3B73A 2FNAA 5DUIA 3ABUA 5ICEA 2V9VA 2QM3A 4IPAA 4MQ9F 4U7BA 1W5SA 4KUMA 1JGSA 1USSA 4M73A 4P55A 4RGUA 1VTNC 2YX7A 1ZAOA 2IA1A 1FBQA 3K0LA 5DYMA 4LFUA 2Z99A 4AWXB 1RZ4A 2IT0A 3HRMA 1IF1A 5K5OA 1XGNA 2YU3A 3EQLF 3F8CA 1XMKA 2A5YB 1EV7A 3LAJA 3QAHA 4L0ZB 1Z91A 3RDIA 2FOKA 3SXYA 2H6BA 1I1SA 3GVAA 3BDDA 3LQRA 2O8XA 1HKSA 5CVIA 1G3TA 3MAJA 2K7LA 1KYWA 4JK1X 1T2KA 1TTYA 5AIPA 4IRGA 1E2XA 3NRVA 2F5CA 1R1VA 1B1BA 2EV5A 2EFPA 2EV0A 1BI1A 2BGCA 1LEBA 1KA8A 3HOSA 2WV0A 4I0BA 3BY6A 3ZMUA 4M71A 4KNYA 4LD5A 1T6SA 1BM9A 2W84A 3TOAA 3I59A 3T1BA 4LB5A 5L3DA 4ESBA 3SFZA 2VODA 4N0BA 4Q47A 2JPCA 4HX7A 3L9FA 2OZUA 2H6CA 3SZTA 1OYYA 1G3WA 3HRTA 1Y0UA 1BI3A 5JR3A 1S7OA 1MD0A 3ZMSA 2OAZA 4A6EA 3ZMDA 1UCRA 1R23A 3COAC 2VC1A 2DPDA 4FX4A 4B09A 1B9NA 4H0EA 3LA3A 1TW2A 2KIMA 4I02A 3GLXA 3NQOA 1Z1DA 1TW3A 3QP5A 1ZREA 4WCGA 5JVTA 1IN8A 1SMTA 2DT5A 3F8MA 5K5QA 4WWCA 1ULYA 1IRGA 3WTXC 2B0LA 3VOEA 4KIBA 1WKMA 3LSTA 3MZYA 2K4JA 1D3YA 5DCFA 5JHUA 2CW0F 2CG4A 2JRTA 2Y48A 3I64A 4B8XA 3K1PA 4G6QA 3VODA 1FWZA 1SFEA 3HIFA 2F2EA 1R1UA 2TDXA 5ICGA 1FLIA 2DPUA 2MA3A 2A69F 2J5PA 2QQBA 1STZA 3CO7C 3MZHA 1AWCA 4EJVA 2A6HF 2PQ8A 2FQ3A 1PUEE 4A6DA 3ROUA 3L7WA 4UV8A 1MDMB 2DK8A 3B02A 3KETA 3GEZA 2HR3A 1KU9A 3FF5A 3P9KA 4FT8A 1G6NA 2R7DA 5CVUA 2NS0A 3D5LA 2IJLA 3GF2A 2XUBA 3M1EA 2STTA 3E5UA 1YYVA 4EV0A 4G6DA 1RNLA 4WXDA 4I0AA 5L3GA 4ESFA 2L54A 2HOEA 3FWEA 1IN5A 1O3SA 2ZMEA 1MJBA 1LDJA 3DXJF 3RKYA 1XSDA 5F1RA 2BEOA 2ACJA 3WU0A 1ZLJA 2NYXA 5E1WA 1HBXG 3WG9A 3KP2A 3AAFA 1F1ZA 3GX4X 4BQAA 4HV6A 4KA4A 4MTDA 5H20A 1OYWA 5HVQC 1ONVA 4KN4X 2DAOA 2M8EA 3HOTA 5D4SA 1JXSA 3J81K 5DCMA 1IRFA 3K2ZA 2HYGD 1RIOH 4XLNF 2H27A 1XSXA 1D8KA 3TQNA 1TNSA 2HGCA 1K6OA 3E6DA 5EEGA 2F5FA 2CQKA 1TQMA 2HZTA 2XAQA 3O6BB 3EDPA 4RB3C 2V1UA 3CUQB 2K02A 1SFUA 2XAHA 4S05A 3V7RA 4BHCA 2ISYA 4RB0A 4EVIA 1YW9A 2H09A 3ISPA 1PP7U 1LB2A 3HUGA 1U8RA 2ZO4A 4UVAA 1REPC 1HSJA 4OIOF 3GW2A 3R61A 1DDNA 3NEUA 2RNJA 5E18F 3KLOA 1FBSA 4CZZA 1CGPA 1J0RA 1P4XA 1MJ9A 3CO6C 2PLYA 2OQGA 2E1CA 2QLZA 3F22A 3LA2A 1HXDA 4L5IA 5HS7A 1XN7A 2QVOA 5LBQA 4RB1A 2HDCA 1JE8A 4KMFA 4ZYEA 1K7AA 1USTA 4IVNA 1Z7UA 2W24A 1OR7A 1FX7A 1U5TB 5E8GA 1GXQA 2XAJA 4Y15A 4I7HA 4CYDA 3VEPA 2VT2A 1ZGAA 3P9IA 1U5TC 4Q4ZF 2G7UA 6PAXA 3ZN0A 2DQRA 1KU2A 2DQLA 1J2XA 2XVCA 4CHUA 5LRRA 5CLSA 2O03A 1U5TA 4JBAA 2R3SA 4OU0A 1ZG5A 3DV8A 3J80Z 4RGXA 2MH9A 1SD7A 2YSRA 1XMAA 3CDHA 2HWVA 3SQNA 3RI4A 3GXOA 4RAZA 4KIGA 4I09A 3E3VA 3FM5A 2IPQX 1S6LA 2VBZA 3LFKA 3C18A 3F6VA 2M30A 2D45A 3KLNA 1YLFA 5A2QZ 3LQQA 4MQVA 4YFNF 4E70A 1CF7B 4MTEA 3E5QA 1DPUA 5HDGA 3MFKA 3FXQA 3DFGA 5LHIA 1IUYA 3T5XA 3H3ZA 5TJJA 2XROA 1B9MA 3DQVC 3CJNA 4HV5A 2YPRA 2Y0MA 2AS5F 1S8NA 2KRFA 3GUDA 4AVPA 3QOPA 3HRSA 2DW4A 2V1XA 2QZ8A 4LLLA 4EJWA 3WGIA 1U6GA 2M1BA 4CXFA 1P4AA 1ZYRF 1DPRA 3BPXA 4G7HF 5ICCA 3KCCA 1SMYF 4U88A 4HW0A 1FOKA 1BBYA 5DD8A 5TRDA 5JFRA 4AIJA 4F7ZA 3WGHA 3WE2A 2IRFG 2QUFA 3HYIA 1G4DA 1TNTA 4JQFA 1SD6A 3V4GA 2P5KA 2XHKA 2L01A 1T98A 2EV6A 4EJTA 2JTVA 4U0YA 1YIOA 1P4WA 4Z2YA 1A04A 2FNPA 2XASA 1QZYA 3LAPA 3RPQA 5LRSA 1FYKA 4MNUA 4Q5SF 1MZBA 2ZBKA 3BJOA 3C7JA 5LHGA 1QZZA 3ERED 5AONA 3KZYA 5ILSA 5K1YA 4IRHA 5D6EA 2AXLA 2XRNA 3HTUA 3U2RA 2FMLA 3F8FA 4CO8A 1ON1A 1H9GA 1KQ0A 1UFMA 2IA0A 2L3DA 1FSEA 3M7GA 4UVCA 2KJCA 1Q1HA 3BWGA 4IF4A 3WGGA 3ZN1A 3I59B 1O7FA 4I98B 3WTZA 5IT9Z 2L4MA 4YG2F 4LG0A 1KQ9A 3IRQA 2R7FA 1R5HA 1QQIA 1ZN2A 3R4KA 2K27A 4L9JA 5K5RA 5E20A 1F4KA 4HLYA 1ON2A 3TOBA 5J8CA 2CO5A 1SD4A 5J6XA 1HW2A 4L18B 1FYMA 1ZGJA 3K69A 1QNTA 2UXNA 3EYYA 3TKYA 2M87A 1I1GA 3TDZC 1G3SA 1Z6TA 2OA4A 3GO5A 1FBUA 3W6KB 2PI0A 5H6RA 1FC3A 5CVJA 3V7CA 2NNYA 4MGRA 3BJ6A 3E97A 3M8EA 2XAFA 4DNCA 1D5VA 3T8RA 4LB6B 2PMHA 4OIRF 1FP2A 1Z6RA 1HW1A 4YIIA 1ZRFA 4LJZF 2CWEA 1FNNA 5LGTA 3TO7A 4Y13A 1QGPA 1BN5A 5HLIA 2IA2A 1BJAA 2VE8A 4L0YB 2DI3A 2ZFWA 3ULQB 4YFKF 3GWZA 1KQ8A 4LMYA 2VE9A 5LGUA 3KFWX 5JI6A 2PMUA 4IHTA 2A3SA 3BZ6A 1WQ2A 1F5TA 3G73A 2EA4A 4AIKA 1JHHA 5AIQA 4BH9A 4HQMA 1S7AA 2EFWA 1ZRDA 1L3LA 4HAMA 3E6CC 4G8XA 2GAUA 2H94A 1FPQA 1UHWA 2A68F 4G7OF 2GA1A 4MEXF 2O6GE 4D0PA 2V79A 3GFIA 2A07F 1L0OC 1V4RA 3MCZA 1SFXA 3V8LA 5D8LB 2ZMEB 2IW5A 2UZKA 5HDKA 2A6EF 1KGSA 2DU9A 3ML6A 2EFQA 4PCQA 5DD4A 1ZARA 4WX9A 4R79A 1DP7P 2VBWA 4KT5C 3OOPA 2XV4S 3OV8A 2VBYA 3LA7A 1XCVA 4ZZDA 1RUOA 3I54A 2FE3A 3KEOA 2ZNZA 1U2WA 4BXUA 3RTRA 5J8FA 4FX0A 2KKOA 1O7LA 1T0FA 3KP7A 2WWYA 2F5EA 2BYVE 1LVAA 1IAWA 4OMYA 4IJAA 5DCMB 5HS9A 3PQKA 2COMA 2HFHA 1YFHA 3Q9VA 3KE2A 3REOA 3DPTA 4XSZF 4WF2A 4R1HA 5IT3A 5HLHA 2WC2A 1J59A 1IN4A 4U7DA 4N9HA 5FLXZ 4YFXF 3D0SA 1X3UA 2FF4A 3I5UA 2M45A 1XB4A 1IZ1A 2KJBA 3BP8A 4U0WA 2DFIA 2ETHA 3JAMZ 2RVCA 5ILUA 3JSOA 2RKHA 4GXOA 2V1DA 1HSTA 3TGNA 4KFCA 3C1DA 1GXPA 2GXGA 1O57A 2ZNYA 3E5XA 4HDUA 4OINF 5FFXA 4BNCA 4IXAA 2Z3YA 3HHHA 1PP8F 2P7CB 2RDPA 2W25A 4R8HA 3C3WA 1MGTA 3ABTA 1TLHB 2PBIA 3F3XA 3IWZA 4A0XA 4UNOA 4GCVA 5E17F 3FXUA 2NRAC 4ENKA 2MBFA 1FY7A 3I58A 4A12A 2X0LA 4KIFA 4P9UA 2ADUA 1FSHA 2XAGA 4UHTA 2DO7A 1KU7A 2ZKZA 4ENJA 2NNNA 1S3JA 4RAYA 1I27A 2FXAA 4Y17A 2ZCWA 4S04A 4PDKA 1IXSB 2LNBA 3JSPA 5BPIA 3F6OA 3H92A 5D4RA 4ZYHA 1GHCA 4WXHA 3ELKA 1J75A 5CYVA 3FZVA 3GYHX 2P6TA 1V3FA 1SAXA 5BMZA 4G9YA 5HDNA 3CUOA 1I5ZA 2FRHA 4PZJA 4HF1A 2FBHA 1ZG1A 3ZPLA 2M5WA 2OQRA 3ECHA 3HSFA 1U3EM 2E7XA 4G94A 2MH2A 2O3FA 4XRFA 5D8KB 2UWMA 4RB2C 4ETSA 3R0AA 1WRJA 3WTVC 2IVMA 1UB9A 3K1NA 2D1HA 3IC7A 2JZYA 2EA2A 3EETA 3V7SA 3VB2A 4NB5A 3N97A 2P6SA 2YR2A 1IXCA 1YG2A 3I53A 4KDPA 2VOPA 2CYYA 3HSRA 5ILVA 3J7AO 4O3MA 1WI9A 3CLOA 2E7WA 2UXXA 4EJUA 2RV8A 2QQAA 3G3ZA 1YW8A 3RKXA 2YX4A 4HF0A 2EFOA 4N9IA 3V8KA 2F5DA 3KP4A 1FZPB 1LEAA 1BC8C 2BE5F 3T8TA 1XGSA 3BROA 2Q8KA 4ENNA 3J80K 1I6XA 3SZPA 3F21A 1DUXC 1AOYA 1TBXA 4RS8A 2PFBA 2O61A 1PDNC 2XKOA 1LDDA 4M74A 4P96A 2DTRA 4U0VA 3LWFA 4LGWA 3FM3A 4IHSA 5DDGA 5H6QA 1BIAA 2CSOA 2VXZA 3K1MA 3IKVA 5A2QK 1F9NA 3Q5FA 2VT3A 2GQQA 4L9VA 2ISZA 5D5XB 2PEXA 4A2UA 5ED4A 3RIRA 4M9XA 4KMUX 2XGXA 2L02A 1HW5A 2EB7A 3KZZA 5D5UB 1R00A 3QRFF 2KIFA 1EH8A 1XCBA 4G7ZF 1UHMA 1Z9CA 1W7PA 2VONA 2L4AA 4AIHA 3HHGA 1K78A 3RKWA 1BI0A 1W4MA 1H9TA 4LK0F 4L5JA 2WTEA 1B6AA 2W57A 1IW7F 2OD5A 1O3TA 2DK5A 2FU4A 1XGMA 4P9FA 3WODF 4EM2A 1T39A 4LG0B 3I0TA 1ODDA 1R1TA 1TQPA 4EMSA 2MC3A 3DP7A 2MD5A 4A5MA 4GO1A 4P5OA 4M9ZA 2EK5A 2E1NA 2PJPA 1XSVA 4ESJA 3V8JA 1FT9A 1KU3A 5FFZA 2QBYB 2VOOA 3FMSA 4GYGA 2BV6A 3GZ5A 4ZH4F 3DKWA 1HKQA 5DV5A 2ZJ2A 2X4HA 3L2CA 2STWA 2QBYA 4EM0B 2QQ9A 3VFZA 5LLQA 4A5NA 2GWRA 2Q0OA 3ZMTA 4NQWA 2LKPA 1YS6A 1BIBA 2K86A 2G9WA 2QWWA 2VC0A 4M72A 5L3BA 1ZRCA 2RGVA 5EEHA 4HF2A 3KP6A 2MLGA 4PGHA 1XDSA 2EWNA 3FMRA 3R6SA 3H3UA 2GZWA 3F8BA 1EH6A 1YW7A 1U78A 3F72A 2XIGA 2P8TA 5IT9K 5FGMA 2PG4A 2IP2A 2OZ6A 3F23A 5E1XA 2XKPA 3EYIA 4WK8F 5FB2A 3IRRA 2HQRA 3KP3A 4UV9A 1R58A 4ZYDA 1T38A 2ELHA 3IHUA
chains in the Genus database with same CATH superfamily
4PK4A 4QWQA 3V4ZA 3WTUC 1G8XA 3RFCA 3H0GG 2UUBH 1KC7A 5KT3A 5CVRA 5HS8A 2XF7A 3BZKA 1OCRH 3E6MA 4LK1F 4EM1A 3KP5A 1JKJB 4L1KA 1FOWA 2FUG2 4E7HA 2HOTA 4JI7H 1QO0D 3PJRA 4XMYA 1G3YA 2XGEA 2P7VB 2VKDA 3BC8A 3NWSA 4XLPF 1KJJA 4HA8A 4M3GA 5C5JA 5KT4A 1LDKB 3GTKA 2E19A 5BS6A 3TO6A 3KEQA 2QCOA 1W36C 2IS4A 2JA6A 2UXBH 5CA0F 2BVMA 4A3MG 4ZZLA 3MQ0A 3KYDB 4O6JA 3Q8RB 4TQSA 3GV7B 2DLLA 2E34A 2MABA 3JW4A 1WSUA 4J0MA 1I39A 5F64A 1FP1D 4CICA 4EGYA 3OYFA 3RJPA 1R49A 4ME6A 2EFNA 2F6CA 5L9XA 1MMAA 4WXCA 1JX4A 1RI7A 4OMZA 3J81Z 1J9IA 1LE8A 3HSEA 2BXYA 3L00A 3KX2A 3BQ2A 1ZR4A 2FEZA 2LBFA 5TGTA 2CV1A 2FBIA 2LD5A 2R7VA 3DEUA 4GC6A 4QLCU 3VPDA 4I01A 4C9YA 2KIUA 4CGZA 1FYLA 1R7JA 3OYAA 5JH7F 4KJZA 4YEJA 4YR0A 2FA5A 2LY1A 2EZHA 4DW6A 1SVLA 2Z5UA 2F4IA 4NXMH 2X6OA 5FD5A 2KLOA 1N25A 5C4XG 1XGOA 4HEA2 2NAZA 3IKTA 2RC4A 2FSWA 5B66C 3BA9A 3MKYB 1K83A 1I7NA 4FE7A 5GPAA 4ENMA 4A3JG 2LSOA 5T14A 2MYSA 2R84A 4MV4A 4YR3A 1T0FC 1WWXA 3QZ8A 4QIWN 1UG0A 4CZCA 3OHAA 2J6UA 4II2A 5LEJA 2MLKA 4BHPA 3K4CA 3RYRA 4BE0A 1LQ1A 1RYSA 2B63A 1M7JA 1H0MA 1BNCA 4DV5H 1OCZH 5KFXA 1QPMA 4BGDA 1GVDA 2VB6A 4B1RA 1MDMA 2CV2A 2BY3A 3WU1B 3SJMA 1A35A 3FMQA 4YP3A 4OX9H 3S2WA 1NG7A 2LH9A 1VQKI 1LNWA 3QU3A 3OSFA 2KZVA 1S29A 4S0HB 3BJAA 4QWAA 4YELA 4G3IA 4N4OB 1KYZA 1TWGA 1QBJA 4O2AF 2NU6B 3GFJA 3H9JA 3K9TA 3SHFA 5L3EA 2K9QA 5E8IA 3IG0A 1TT0A 4IHXA 4Q0YA 2QSHX 1S5LC 1O3QA 2XD4A 3U21A 4PFPA 4B3SH 1SFOA 5B1AH 2GXBA 1ZLKA 2WY7Q 3A2KA 2Z1DA 1OMIA 2HKOA 1W0UA 1S0MA 4LF7H 3CTAA 1Z05A 3C2GA 4A0YA 2SCUB 4FASD 3S3NA 4J9KA 4EEYA 2BBYA 1VQ4I 2ASLA 1D8JA 3HTSB 1Z3XA 4I2OA 2OTLI 4HOBA 1LJ9A 2VBXA 1DIKA 4DV0H 3A4CA 4DL4A 3O8GA 2E5LH 3QODA 2WV1A 1RUNA 5KCMA 3JRIA 4TV7A 4RLFA 4XOPA 3QU6A 2M3AA 3CDIA 4NXNH 2G7HA 4U87A 4OOIA 1XMQH 4EBEA 3PM1A 2I87A 5EDWA 4BY7J 4I4TF 4K2EA 5HOOA 3R60A 2FOWA 1Z2PX 2VQCA 2ME0A 4A69C 4HBLA 1XDUA 3FX3A 2LREA 4KICA 3UR3C 1A9XA 3N4MA 1ZQ7A 4XKCA 2D1VA 1HKTA 4LLNA 2B7EA 1VQPI 5KG6A 3OS1A 4IZZA 4B3RH 3S17J 2RN7A 1ITYA 1SANA 2HNHA 5LHHA 1RK6A 1Z2NX 3ECOA 3QPSA 2YU9J 2OCEA 3HOWG 4DR4H 5CQEA 4UUSB 3JRGA 1TT5B 3LSIA 1OKRA 1OLTA 2LP0A 3QPHA 4ON0A 1VKZA 2ID6A 1Y1WJ 4O4HF 1SD5A 1W7PD 4XK4A 4G12A 3MWEA 3RBDA 2HDWA 5IOZA 4RGSA 2KRHA 2QYOA 4M3FA 4QSHA 2C35B 1IN7A 4Q48A 3P9CA 2HEOA 2ZXJA 1WJCA 1TQIA 1JTXA 2K4BA 2R7ZJ 1HF0A 3VPCA 1R36A 3LSRA 2OJED 4AUXA 1IXRC 3H1CA 2R93G 3ASNH 5DUKA 3TO9A 1OPCA 1ZH5A 3RYPA 1YQAA 4LH6A 2HXOA 2WAQN 5LMNH 4A3CG 2P0AA 4HDVA 3HM5A 1U8BA 1O3RA 1V5FA 3MEXA 1HDPA 4M6XA 1YTYA 2WAFA 2CGPA 5KFZA 4A0ZA 4A3DG 2FBKA 4N4NB 4FCYA 1B04A 1VI0A 2QENA 4ASNA 4FHTA 3I12A 4RZRA 1K79A 3HRUA 1HQCA 5ERIA 2J5OA 3CUQC 3GFLA 3HOYG 3F8NA 3EUAA 3L09A 1Z67A 4HYEA 3ZQ7A 1GSHA 5KK1A 3Q2OA 5LGNA 3GTOA 2R82A 1A6IA 2BVLA 3DF8A 2WE6A 2NU8B 4HX4A 4LLGF 3CUQA 3GTGA 1C0WA 1QU3A 3BG3A 2W6ZA 2FK3A 2XPVA 3O3KA 1NHAA 3P5JA 3PFIA 2Z33A 5DGAA 3R0JA 4DQ2A 2ESNA 3S16J 3ORRA 2E71A 3WTYC 3H0GJ 4XBFA 3K4BA 5KVRA 4HLXA 3V6JA 3OYBA 5KFFA 1P92A 5FD6A 1YJWI 2DWCA 2W9BA 2KHMA 5E3OA 3WTSC 3U1DA 3E6BA 4ECTA 4O3QA 4BAYA 5FO5A 3ZQQA 1FJLA 2XB0X 2IGNA 4DUYH 5D5VB 4QPQA 1GSOA 5KFSA 2EJRA 3TDUC 4YIFA 4A3MJ 5FLXK 2H1LA 3QOEA 4QW8A 1EH7A 2XF6A 4BYYA 4CCNA 1B59A 4GFBA 4AYBN 3GTQJ 5GADJ 1VQ7I 3SFIA 4FETA 2LG4A 3PQJA 5BPDA 2LF8A 5D5WB 2M7BA 3VDXA 2MD0A 1EKEA 2W00A 2OBPA 1J5YA 1E17A 3JRBA 5FJ8G 1GT0C 1PVEA 4O5VA 1Z3YA 4GYIA 4XSXF 2L0KA 4UVBA 3SDGA 3CCRI 4M9SA 2LF7A 2VUMA 2YZNA 4AC0A 3LMLA 3JAMK 4O3RA 2PN6A 4NLGA 5LEKA 1BC7C 1GDTA 4DV7H 2HTJA 5IYBG 4L5EA 2WAEA 1ZG3A 3I71A 3JCUC 5HLGA 4RA2A 2VIXA 1YO5C 4C2TA 2W85A 4PUSA 1EHIA 4FS1A 5C4XJ 2JA8G 3M8FA 2EILH 4RDUA 3W6JB 1JHFA 1J5EH 1QPIA 2GOMA 2ZDHA 5JVDF 4J9QA 3ONQA 4XRSA 3D5SC 2C2DA 4A3JJ 3DTEA 3ZOBA 2JA5G 4LG3A 4PFOA 4CDGA 2GIVA 2HYFA 2HS5A 4M6YA 3TQ1A 1H89C 5IYDG 1LVKA 2UV1A 3RJ0A 4OIQF 2GA2A 2PBZA 5E1ZB 4TV8F 1R22A 2BQRA 5IY5H 4QIWA 4PJMA 3G1OA 1XPXA 3EPZA 4PGGA 2DJIA 1W5TA 3FIWA 5CJ9A 1MKMA 1XS9A 2DJNA 3UQ8A 2R7UA 4L9TA 4HQEA 2R7NA 1WH2A 4F50A 1FIPA 2HDDA 1BI2A 3U9GA 2M4GA 2DBBA 1R5GA 3GZ6A 1RK5A 5L1IA 3JR9A 1LFBA 2LDUA 3SEZA 1LPQA 2JSCA 4NHJA 2A61A 2JT1A 3ZMVA 3RZOJ 1W96A 1BW5A 4MEYF 4UUVA 1XD7A 4M3BA 1WSCA 5KFWA 1T33A 1P2FA 4E7SA 4LOCA 1OYIA 2PN1A 3FXRA 2I8CA 3BTCA 3K4MA 2RQPA 1S03G 2ZFUA 2HPMA 3OY9A 2EIJH 1MJAA 2O0YA 1I3QJ 1NG6A 3I4PA 3JRXA 4L9NA 1GO3E 5L3CA 4KN7X 4AVZA 2HJWA 4BHBA 1JDBB 5L3FA 1RR7A 2UUZA 3WTTC 4C30A 5C1PA 4DZJA 5BOXA 1B4AA 1ZHFA 2C6YA 3N6XA 5DEQA 3QP6A 4AD9A 3CD6I 3DPLC 1QVTA 3JTHA 5JUMA 2P5VA 2V6CA 3WTWC 3H0DA 4CA0A 4CC6A 4J9RA 2DA2A 5F9LA 2HKXA 4UXNA 2IMWP 2ZM6H 4EGZA 1S10A 1CF7A 5LL6b 1Y14B 1XC5A 1JKOC 2VKHA 2Y69H 1W0TA 3C2HA 3E7LA 4RGRA 2M9HA 3H36A 3P7NA 1LKXA 2OU2A 2XGCA 3ABKH 3T0YA 1O4XA 4HX8A 5J4YA 1GLNA 3RPUA 4MV9A 1J7KA 2ZXIA 1QZEA 2LTPA 2Q2EA 2V4QA 4U7CA 3BPVA 5K7FA 1RJPA 2JRMA 3L2RA 1A5JA 1IV6A 3MWMA 3HOWJ 2ZSHB 4MA0A 3GMEA 1PUFB 4A3BG 2GXAA 3A02A 5J1RA 3GFMA 3IL2A 4F93B 1IGNA 1X3ZB 5CVVA 2DT7B 2E2HA 2D2WA 3RIZA 3RB4A 2V1NA 1I7LA 2CW8A 4EJOA 4GGGA 1P8LA 5KFTA 5F6FA 2Y75A 3BOQA 1W36D 3K3PA 5BQTA 4HQ6A 5IWAH 3FKIG 3ZP5A 3ESWB 3ZMZA 4YQWA 2HHHH 2FMYA 4IOAF 4HZFA 5HV6A 1Z2OX 1WH7A 4Q43A 4OIPF 2Z9OA 1BJTA 2DOFA 2GOXB 2JPBA 2MFZA 1K83J 4MHGA 3O2PE 2R93J 3LNQA 5KG2A 4XRSG 3OSNA 4XKVA 1WJAA 1V9PA 5D1OB 5D6FA 4RU9A 1ETKA 2P5LC 1PUFA 3DEEA 3WNZA 1GVJA 3IWFA 4ZJZA 5DS9A 4IRIA 2VN2A 4ED0A 2B63J 1W7PB 1K78B 4F4YA 1IO2A 2CFXA 2RAEA 3Q9SA 4JI3H 1V5EA 2DA5A 1YS7A 2BHZA 2WAQA 3EUHA 3W3CA 2P4WA 3WE3A 3M9AA 1MNMC 4DV2H 2IBKA 5GTHC 2KPMA 3PIOF 4ZYGA 3FKJA 3JTGA 1FEXA 1P6RA 3ABMH 1VBHA 1IN6A 4XIDA 1CS0A 2HQNA 2X1EA 5ICFA 2BOLA 2R7LA 3BQ0A 2KISA 1BOAA 2ESHA 1SCUB 2HTSA 4KYWA 3BR3A 1TWGJ 3QPTA 3RCOA 4RM2A 1N77A 5BR8H 2LLKA 3GILA 3WHBA 2AGQA 4EQQA 3L2UA 4Y3OA 1BR2A 1V55H 3FHZA 3PUBA 1SFOJ 3B73A 1Z21A 4F55A 2FNAA 2RQQA 5DUIA 4JYAH 2L7KA 3ABUA 1S68A 3S15J 1B6RA 2ELKA 4QWBA 5ICEA 2V9VA 2KQRA 2QM3A 2JJ7A 5DLFA 4IPAA 4MQ9F 4U7BA 5KT5A 1W5SA 2E5NA 4KUMA 3J81W 3EUKL 1JGSA 4A3KG 1USSA 4B3AA 4M73A 4AIDA 3FXJA 4P55A 4XONA 2O5RA 3QYFA 4RGUA 1VTNC 2YX7A 4DYRA 2M34A 3S1RJ 1ZAOA 1Y8RB 2IA1A 1FBQA 3K0LA 2MCTA 5DYMA 2GPWA 4LFUA 1YOVB 2BZTA 2DLNA 3HOVG 1R4NB 4IWYA 4DL5A 2Z99A 4AWXB 1RZ4A 2ICWG 2IT0A 3HRMA 3RUPA 2DA4A 3VMMA 3S3OA 2CJJA 1IF1A 3PSIA 5K5OA 5L1LA 1XGNA 2C22A 2YU3A 3EQLF 4Y8VB 3F8CA 1XMKA 2K9LA 4AYBA 2A5YB 4Y4RA 4EFEA 1DGRM 1OJLA 5FJ8J 1EV7A 3IP4B 1BL0A 3GTLA 3LAJA 3QAHA 3DLLF 3TEDA 4L0ZB 4MV1A 1Z91A 3RDIA 2Y9ZA 2FOKA 3SXYA 3MMYB 4R7RA 2H6BA 1E3HA 2DZDA 2CQNA 1I1SA 5IYBJ 2R7XA 4BQOA 3GVAA 1XDNA 4UCVA 4JX4A 3BDDA 5KKNB 3LQRA 3OUUA 3BQZA 2JA8J 2O8XA 1HKSA 3NAUA 5CVIA 1WCMG 3HPHA 1G3TA 4C2MJ 1W93A 4HYKA 1ZK8A 1TC3C 4O3PA 3MAJA 1XMOH 3FDYA 3ZQCA 2K7LA 1WR2A 2JA5J 4EGJA 3CCMI 1KYWA 4JK1X 1T2KA 2X6YA 2YS7A 1TTYA 3WO0A 5AIPA 4I99C 3GTJJ 1VS0A 4IRGA 3UFXB 1E2XA 3NRVA 3I4NJ 2F5CA 2Z16A 5KX5F 3CJTB 2F5VA 4GDFA 1R1VA 1B1BA 1UJ8A 2EV5A 2EFPA 4NQWB 3MJFA 2EV0A 2M2EA 1BI1A 1U0JA 1I94H 2BGCA 2HYJA 1LEBA 1KA8A 3HOSA 2WV0A 4I0BA 3MKWB 5LMUH 1TWHJ 3BY6A 3HGGA 3S93A 2EZLA 3ZMUA 1IBMH 2R0QC 3AFHA 1R9TA 2YCHA 4M71A 4KNYA 1WJEA 2CV0A 4LD5A 3Q0VA 5BMVF 3GTMA 1T6SA 4ZI7F 1X4PA 3B6AA 1BM9A 2ZJRF 5KFMA 2UXCH 2W84A 2IBDA 3GTOJ 2QQ8A 3OYLA 4DV1H 2VA3A 3TOAA 4FBUA 1VQNI 3A01A 2ZC2A 1OFCX 1HNWH 2P0WA 3GTGJ 2JN6A 3I59A 2WA0A 4XKBA 2KZGA 2BY2A 2VJJA 3T1BA 5M3MJ 4LB5A 3N42B 3V4SA 3K3VA 5L3DA 4ESBA 5J2UF 3SFZA 2KDZA 3BG9A 1E4GT 3C2BA 2VODA 3DTKA 4N0BA 2HI3A 4ECQA 3OYDA 2JSPA 4Q47A 4ECUA 2JPCA 4HX7A 3L9FA 3QYEA 1PK8A 2OZUA 1YE9A 3FXKA 3K4JA 2H6CA 4ECWA 3SZTA 2MG4A 4DZPA 2WDTA 5KFDA 1X1CA 2Y31A 1Y1WG 1OYYA 1G3WA 2M0CA 3HRTA 4J00A 3PVXA 3OWTA 3W2VA 1EUCB 1X1DA 4JOMA 1XNQH 3PNVA 1Y0UA 1RJRA 1BI3A 2C2RA 2ECCA 2W6PA 5JR3A 1ETWA 1S7OA 3CF2A 1IOWA 1MD0A 3LSKA 3CCQI 3ZMSA 3S2DJ 2OAZA 3A03A 2VXDA 2R7ZG 2A6TA 3BLYA 1JTYA 4XLCA 4A6EA 4ZTFA 2BW3A 2L9SA 3ZMDA 4ED1A 1UCRA 1R23A 1RR8C 2W7PA 3COAC 2VC1A 2DPJA 1W1WE 4A3BJ 1C30A 3FHNA 2DPDA 4MV8A 4FX4A 2ASJA 4B09A 3GLLA 3T5LA 1B9NA 4H0EA 2VUMJ 3LA3A 1TW2A 2KIMA 4I02A 3GLXA 2A05A 3G71I 5KFPA 2W9AA 3NQOA 4O3OA 1BW6A 2V58A 4TQRA 2NOGA 3G4SI 3LSPA 1Z1DA 3G8CA 4AQYH 1TW3A 3QP5A 1AN7A 4XICA 2OC6A 1D1AA 2CQYA 3FKIJ 5C8YF 1UC8A 1RC9A 2D5VA 4PJLA 4XN3A 1ZREA 2AGOA 4WCGA 3OUZA 5F27A 1HOMA 2HZDA 3VYSB 5JVTA 2FLNA 3GIDA 1IN8A 2RDJA 4J19A 4ZC3A 3M9OB 1SMTA 2DT5A 3DCFA 3LWBA 3F8MA 5K5QA 5D8DA 4WWCA 2W8KA 1ULYA 1BJZA 1IRGA 3WTXC 1JXLA 2B0LA 4XOTA 3A1YA 3CQZA 3VOEA 1HLVA 4KIBA 1WKMA 3KIOA 3LSTA 3MZYA 1R6RA 1T08B 1JIHA 2I8DA 2VPSA 2K4JA 2JQ7A 3R23A 1D3YA 5DCFA 1LE8B 4CCKA 5JHUA 4EFBA 2VQEH 5K2MA 4GLXA 1OCOH 2CW0F 2OPTA 2CG4A 2JRTA 2LBFB 3FMAA 5DG7A 3HC7A 1ULZA 3RQ4A 2Y48A 3I64A 3N41B 1TL8A 4B8XA 3K1PA 1S97A 3OSGA 2V5AA 4DGWB 2DMUA 3PN1A 2FPPB 2K9NA 5KG0A 4JI6H 4G6QA 4QIWE 1JT0A 3VODA 1FWZA 3RBEA 3IUOA 3CC7I 5CQGA 3QZ7A 3JZIA 5C44G 1SFEA 5GAHJ 3HIFA 1TWAA 2F2EA 4UB8C 1R1UA 2TDXA 2K40A 5ICGA 9ANTA 1FLIA 2DPUA 3BCBA 2MA3A 2A69F 2J5PA 2QQBA 1STZA 4IKFA 3CO7C 4JV1A 1AUVA 4A3KJ 3MZHA 3CP8A 3S1MJ 1AWCA 1FKAH 4EJVA 3D1NI 1DV1A 2A6HF 2PQ8A 4K0KH 2FQ3A 2FKLA 1PUEE 2JVGA 4A6DA 3ROUA 3K70D 5KT2A 4Z6YA 3L7WA 2IS6A 4UV8A 1MDMB 2Y2ZA 1KJ9A 3NWTA 5GONF 2DK8A 3B02A 3KETA 1N56A 3GEZA 5KNLA 3OL3A 3HOVJ 2QF7A 4O3SA 2H8WA 2HR3A 5IOYA 2X0SA 1X19A 4F4WA 1KU9A 2BXZA 1U9NA 3FF5A 3P9KA 4FT8A 4BDZA 3G1LA 1ETXA 1G6NA 4DL7A 1X2NA 2DDAA 2JEIA 5KFCA 1KJQA 4XZ3B 3Q8PB 2VL8A 2KMUA 2R7DA 2Q1ZB 4J9PA 4DYQA 5CVUA 3S32A 2NS0A 3HOZJ 3H4BA 3D5LA 4B47A 3HKZN 2IJLA 4ED8A 2VOBA 2W71A 3GF2A 1OCPA 3OYCA 2XUBA 3FXOA 4Y7NJ 1ETQA 3M1EA 2AU0A 2STTA 3H3VH 4HPQA 1R5ID 4UUTA 1Y8QB 3E5UA 1R71A 2K3PA 1WCMJ 5JLWA 5GP9A 5EYRA 2DYSH 1YYVA 1ZELA 4BXFA 4EV0A 4P1WA 2H1KA 4G6DA 1RNLA 4WXDA 1SVMA 1M0WA 4I0AA 5L3GA 5EGOA 4UCTA 4ESFA 2VQDA 1WVRA 2X1DA 2L54A 2HOEA 3FWEA 2JMWA 2L5QA 2V6EA 1IN5A 2CRGA 1O3SA 2ZMEA 4A3EJ 3KAKA 3IH3A 2J9GA 1JUMA 3BAAA 1MJBA 2LK2A 4DL3A 3I9V2 1RRJA 1LDJA 4HG2A 3DXJF 3RKYA 2FLPA 3VWBA 4D5CA 1XSDA 5F1RA 5KFBA 5H80A 3DBRB 2AHQA 3S3MA 1JKQC 2BEOA 1JUSA 2FB9A 2ACJA 2JEGA 3WU0A 5DGBA 4I76A 2XF5A 1IC8A 1ZLJA 2NYXA 3K2AA 2HGSA 5KFVA 5IYZF 2WAQE 3CESA 2C28A 3E1SA 5E1WA 2MW8A 2JA6G 1HBXG 1VNDA 4YHHH 3WG9A 3WHCA 3BR6A 3KP2A 3ZR8X 1F1ZA 3AAFA 3GX4X 4EYHB 4BQAA 4HV6A 4KA4A 3OIOA 4LFCH 2XRLA 5H20A 4KT6A 1OYWA 5F1JA 4MTDA 1MH3A 4M7EA 4YBZB 5HVQC 1XTAA 1ONVA 4KN4X 3PIPF 2DAOA 2M8EA 3HOTA 5D4SA 1JXSA 4X66H 3J81K 2XCLA 4Q44A 1A6QA 5GAGJ 2O9LA 5DCMA 4RMNA 2WB1N 3ERMA 1NTCA 4QJFA 3G6VA 2M7AA 1IRFA 2DFHA 3ORQA 5LXTF 3K2ZA 1IDYA 2HYGD 2RDIA 1RIOH 1TWCA 3PNYA 4XLNF 4A3LJ 2H27A 1XSXA 1D8KA 3TQNA 1TNSA 2PJRA 4BBSG 2HGCA 4E7IA 2YL2A 5DQGA 1K6OA 4BKXA 3E6DA 4JP0A 2F5FA 2CQKA 5EEGA 4C5AA 4DV4H 4BL0B 3V6KA 3CMYA 1TQMA 3OYEA 5JQWA 3F9KA 3R5HA 3BJYA 2HZTA 2XAQA 3O6BB 1E4EA 2JUCA 3U9SA 2QKLB 3N40P 3EDPA 4RB3C 1PJRA 3HOUJ 2V1UA 3CUQB 2W6MA 2CU7A 3MR3A 2K02A 4MV3A 2XB5A 3RAQA 2VA2A 3GTLJ 3CMAI 4BBRG 1SFUA 1ZGWA 2EIKH 2XAHA 4S05A 1MMSA 3MR6A 2MGQA 2VQGA 3HB9A 1MSFC 1N32H 4FM9A 2B63G 3V7RA 4BHCA 2ISYA 2IXSA 4RB0A 4DR6H 4EVIA 2Q2TA 2X6WA 3RB3A 4XLEA 1YW9A 2R5YB 2IS2A 2FPIB 2W9BB 3CCSI 2H09A 3ISPA 4AYBE 3CF5F 2E2IJ 2M4KA 1PP7U 1LB2A 4KITB 2MSYA 3HUGA 4IOCF 1U8RA 2R86A 1DGSA 2ZO4A 2DTZA 4UVAA 4LF9H 2NVXA 1REPC 1HSJA 2AGPA 5FROA 3GW2A 4OIOF 4QWCA 3R61A 1DDNA 3NEUA 2V4RA 1C3OA 1RPWA 2VQLA 1HA8A 2RNJA 3HZJA 4ED7A 1K6YA 5E18F 2W8LA 3KLOA 1A36A 1FBSA 3LSHA 4CZZA 1CGPA 2WTFA 1YIJI 3SZGA 1J0RA 5E3MA 1P4XA 2COBA 2W1OA 1MJ9A 4JX5A 3RGXA 1Z77A 3FXLA 3K7AJ 3CO6C 2OQGA 2PLYA 2E1CA 2YS6A 2NS8A 1AA7A 1OR7C 2QLZA 2R5YA 1VFCA 2VKVA 3LA2A 1HXDA 3F22A 5CKTA 2E5ZA 4Q45A 4L5IA 4GKJH 5HS7A 1XN7A 2QVOA 5LBQA 2NOJB 3BTIA 3I55I 4RB1A 2HDCA 3BR1A 1JE8A 4KMFA 4DR1H 2BQUA 4ZYEA 4DLKA 4OAYA 1K7AA 3TW7A 4RUAA 1WJBA 1USTA 2M0MA 4IVNA 1Z7UA 2CQQA 2W24A 1OR7A 1FX7A 2CMPA 1U5TB 3DPUA 5E8GA 1GXQA 1OCTC 3OYGA 3VPBA 2RNGA 4GC7A 1EUDB 5FLMG 5C44J 2XAJA 2L7ZA 1G2HA 4Y15A 4JV5H 2LY9A 2VKEA 3S2HJ 4I7HA 2FP4B 1FMVA 3GQCA 2PMZN 4CYDA 1JJ6C 3MR5A 2KP6A 3VEPA 2VT2A 1ZGAA 2FMAA 3JRHA 3P9IA 1U5TC 2WADA 3GIJA 4Q4ZF 4Q8FA 4MIMA 2G7UA 6PAXA 3ZN0A 1E0EA 4FU0A 4PWQA 2DQRA 2CH0A 2KFDA 1KU2A 2DQLA 1SAUA 3ZXSA 2K5CA 3K4NA 1J2XA 3K5IA 2XVCA 2JWTA 2AQ4A 3KHHA 1ERDA 4CHUA 1D5YA 5KFNA 3SYTA 5LRRA 2LR8A 2O03A 5CLSA 2F4OB 1U5TA 4JBAA 2R3SA 4OU0A 4YJ3F 1ZG5A 3PUFA 3DV8A 2OTJI 2CW7A 3TBIA 2WYOA 3J80Z 2J6SA 4RGXA 4XRMA 4BACA 3HPGA 2MH9A 1SD7A 4JX6A 5IP7G 2HVSA 2YSRA 1XMAA 3CDHA 3M1CA 2VLAA 1NK3P 2XGDA 2XCPA 2HWVA 3L4KA 4W97A 5E3LA 3SQNA 3RI4A 4X0GA 1YRNA 3GXOA 4RAZA 2VPLA 3VPRA 4KIGA 3AL0C 4I09A 2R5ZA 1SYXB 3I4NG 1OWTA 3E3VA 3FM5A 1H88C 1TZLA 2CZGA 4IO9F 3GTPA 2N8GA 4APMA 4NBQA 2DPIA 2IPQX 1PYVA 3AYHB 1S6LA 2VBZA 3HKZA 1VF9A 5LP6F 3GIQA 3CVZA 3LFKA 4M6VA 3IAM2 2DMQA 3C18A 3F6VA 2M30A 1ZHSA 4HR7A 3K70C 1ZKGA 2D45A 5EG0A 3KLNA 1YLFA 4A2BA 4J9NA 5A2QZ 3LQQA 4J9SA 4TV9F 2V26A 1JKRC 4V19K 4MQVA 4YFNF 4E70A 3C0FB 2XCAA 1CF7B 2CFOA 3JSNA 4MTEA 4B3XA 3E5QA 1DPUA 5BPHA 1RETA 2QGUA 3MD2A 1UELB 1WJ5A 2IA6A 5EZGA 1S0OA 4X6AJ 3Q0WA 2GLTA 2Q2EB 5HDGA 4ECVA 3CQZJ 3FXQA 3DFGA 3MFKA 2OV7A 4CYCA 2ECBA 5IYCG 5DG8A 2UUAH 1DU6A 4X1EA 3N05A 5KHDA 5LHIA 5EWFA 1MBGA 1CQJB 3O8HA 3ZQGA 1IUYA 3GTKJ 2V4JC 3T5XA 3HL2A 3H3ZA 5TJJA 3W6VA 4XLFA 5IP6A 4NC8A 1WJDA 2XROA 2DIKA 1B9MA 2RREA 2JA6J 1TWFA 2VJ5A 3DQVC 2GM4A 3CJNA 4HV5A 1RJQA 1I3AA 3H5RA 4ZOLF 3CZ6A 2QKMB 4B44A 1VZ0A 2YPRA 3JRFA 2ZXHA 2Y0MA 2AS5F 1OISA 3HBLA 3G2BA 3H9QA 4C3HJ 1S8NA 5KG3A 5EWEA 2VJIA 3RZDJ 3L4JA 2KRFA 3GUDA 5TISC 3OR2C 4AVPA 2V9WA 4HNUA 4HNTA 3QOPA 3HRSA 2DFFA 2R7MA 2DW4A 5EJCA 5DG9A 2V1XA 2QZ8A 1J09A 4LLLA 4EJWA 1APLC 3WGIA 1U6GA 2FJZA 1CQTA 2R87A 2VUMG 2C2EA 4DL2A 1BGWA 2IAIA 4XM3A 1JI8A 2WB1A 2M1BA 4IZOA 3PR5B 4CXFA 1XNRH 2QSGX 4DR5H 1P4AA 3W2WA 4BBSJ 1LUJB 5HNHA 2ASDA 4LSAA 4A3FG 1ZYRF 1DPRA 4M3EA 2XPWA 3BPXA 3EUHC 4G7HF 2GLOA 3EPIA 3L2QA 5ICCA 3KCCA 3CDLA 1SMYF 4U88A 1GUUA 4HW0A 5H2FC 4BBRJ 3K5HA 2L9VA 3BQYA 4NNJA 4XORA 4F91B 4PDBA 1EA3A 1FOKA 4R8UA 3CCVI 1BBYA 5DD8A 5JHFA 5TRDA 5JFRA 1RKTA 4AIJA 4F7ZA 3WGHA 3WE2A 3FISA 3LSJA 2IRFG 3V42A 2E36A 2TRTA 4BU2A 4PJ0C 3DTIA 3JRCA 2NUAB 2QUFA 1CQIB 3HYIA 1G4DA 1KBLA 5F0HA 2H8RA 4AM3A 3MN2A 1TNTA 4JQFA 1ZR2A 3DU5A 1YI2I 1SD6A 1EYZA 2KT0A 2YRXA 4LF6H 4QW9A 2HOAA 3V4GA 4UCRA 3PW4A 4NC7A 2P5KA 2XHKA 2E60A 2W6NA 5J1UA 1E4FT 1KZHA 4I55F 5EEAA 3J7AK 2L01A 1T98A 2L9RA 3L1PA 3Q8SB 2EV6A 1BOBA 4EJTA 2NXNB 2JTVA 4F3QA 2KL4A 4IR1A 3UNGC 4U0YA 1BR1A 1EF4A 1YIOA 2W9CA 1P4WA 1Z0XA 4C5BA 4Z2YA 1A04A 5J47A 4GRIA 1MBEA 2NS7A 2X6XA 4LITA 4YB8B 1AKHA 2FNPA 2XASA 1QZYA 3LAPA 4ECRA 3N8DA 5FLMJ 3RPQA 1UZCA 4DBQA 2G0EA 5DM6F 3OYJA 2XSDC 5LRSA 2RF4A 1FYKA 1I50A 4MNUA 5KFLA 2YU9A 4Q5SF 1MZBA 3PR4A 2ZBKA 3WG7H 2GIZA 3BJOA 4ZTJA 4X62H 5B3SH 4XYMB 4BY1J 4RNOA 3BQ1A 5JLXA 3C7JA 5LHGA 1QZZA 1X3WB 2YUSA 2W6QA 2PMZA 3ERED 1AU7A 5AONA 2JA7A 3KZYA 5ILSA 4FISA 5K1YA 1N75A 3HOZG 5GTIC 4IRHA 2Q2UA 2NVYA 4UCUA 5D6EA 2AXLA 2XRNA 2ELJA 3HTUA 3HJEA 4CSWA 2O8KA 2IS1A 1GYFA 3U2RA 3ZQLA 2GPSA 1ACIA 3UKGA 3VSKA 2DMTA 2LFBA 1MMNA 3X2QH 2FMLA 3F8FA 4CO8A 1ON1A 1B6SA 1H9GA 2IGMA 5IP7J 1YJNI 1KQ0A 1NK2P 1UFMA 2IA0A 2L3DA 2R8IA 3TP0A 4PJNA 3A01B 1FSEA 3M7GA 3K10A 3QWLA 2KJCA 4UVCA 2OF7A 3BG6A 1Q1HA 3BWGA 3K4KA 4IF4A 4NDLA 3WGGA 3ZN1A 3I56I 2R92A 2M8GX 2UUCH 3I59B 1O7FA 4I98B 4UFZA 2HVRA 2LRDA 3WTZA 5IT9Z 4A3EG 3AG4H 3BR2A 4LF5H 4XN0A 1WFXA 4MFEA 4XR6A 2L4MA 1B8IA 4ECXA 3KYCB 5CAEB 4YG2F 4LG0A 1KQ9A 2F4MB 4D7MA 3IRQA 2IEKA 2R7FA 1B72A 5GAEJ 2W7NA 1R5HA 2UXDH 4ITVA 2Y9YA 1TAEA 3M4IA 4ZQIA 1QQIA 1D1CA 1ZN2A 3R4KA 2NVXJ 2R7KA 2K27A 4L9JA 4C5CA 3CP2A 1S72I 1JLLB 2W7OA 5K5RA 3H0GA 5E20A 3GIPA 3MFHA 1HDDC 2BY0A 1F4KA 4HLYA 1ON2A 3TOBA 3QQAA 5KFHA 5J2TF 2DA7A 4LF8H 5J8CA 2CO5A 3MKZA 1ZHQA 2MC4A 2BW3B 1SD4A 4NC6A 5J6XA 1HW2A 5IYCJ 4L18B 4CCJA 3OOUA 1FYMA 1SVOA 1ZGJA 2CQXA 3K69A 3EPGA 4F4ZA 4UY8I 2LYCA 1RYRA 1QNTA 2UXNA 3EYYA 3TKYA 1FOXA 2M87A 2VR1A 4ED2A 1I1GA 4E4HA 3TDZC 5D1PA 1G3SA 1Z6TA 2R8HA 5FKNA 1D1BA 4A3LG 2OA4A 3HGYA 3GO5A 2OUMA 3OYNA 4D5FA 4DOZA 1N48A 2QK4A 4E7ZA 3IV5A 2BR0A 1FBUA 3W6KB 2LVSA 1MIJA 3BTLA 5J40A 3LSMA 3KTMA 2K3FA 2PI0A 4A2AA 3RB0A 3GCMA 4J9OA 5H6RA 1O75A 2XGPA 4CH7A 1FC3A 5CVJA 2HQAA 3V7CA 4E6KG 1QA6A 2NNYA 4MGRA 1E3OC 3HOUG 4IL6C 4FTHA 3BJ6A 3E97A 3M8EA 1YHQI 1Y39A 4DV6H 2XAFA 4DNCA 1D5VA 4JI4H 2ALZA 3T8RA 1VQ9I 4LB6B 1ETYA 2JA7G 1M0TA 1FMWA 2PMHA 1P7IA 4OIRF 5DM7F 2DT6A 1FP2A 2CQ7A 4C2UA 3VYUB 4D7NA 1Z6RA 1VBGA 3CCLI 1IBKH 2WBMA 1HW1A 4YIIA 2FPGB 4A3FJ 1VQOI 3DKXA 2DODA 1ZRFA 4LJZF 2V7FA 5C1OA 2K9SA 3HOXG 2VQHA 2CWEA 1FNNA 1VQ8I 5LGTA 3T5HA 4GKKH 4EEFG 3TO7A 4Y13A 1QGPA 3JREA 1BN5A 4BE2A 2C00A 1VQMI 1YJ9I 4O2BF 5HLIA 4Y33A 2IA2A 1BJAA 2VE8A 4UB6C 2DMPA 2EINH 4L0YB 4JI0H 2DI3A 2ZFWA 2NVQJ 4DV3H 3ULQB 4NUBA 4YFKF 4XKWA 4TUYF 3OMYA 4HRIA 3GWZA 3Q3SA 1KQ8A 4FS2A 3MZ8A 2K9MA 4LMYA 5B1BH 2VE9A 3IAS2 4HNVA 4RNNA 2LOOA 5LGUA 3KFWX 4IHWA 5JI6A 2CUZA 2ZJQF 2PMUA 5EOYA 4DJAA 4IHTA 2A3SA 5CB4F 4DL6A 1OCCH 3BZ6A 1Y1VA 4ED3A 1IOVA 2OCCH 5KFGA 1K1QA 2F48A 1WQ2A 1F5TA 2IGKA 2R8JA 3G73A 1S7EA 2EA4A 4AIKA 3HKZE 4RLQA 3DLAA 4JI5H 1JHHA 5AIQA 4BH9A 3GV5B 1YX3A 5JVGF 4HSTA 4HQMA 1ZETA 1S7AA 2EFWA 1ZRDA 2M05A 2L9NA 1L3LA 3AG1H 4A3GG 4HAMA 2NU9B 4RM3A 3TL4X 3E6CC 2CUFA 4E7JA 1DP3A 4G8XA 2GAUA 5IP9J 4AU7A 4U6PA 2XC9A 2EQRA 3LOCA 2H94A 1EZ1A 2YW2A 1A31A 2ZB9A 1FPQA 1UHWA 1T3NA 3CJRB 2A68F 3DBLB 1EJ9A 3J80W 3H35A 3CCEI 4G7OF 1BA5A 3BCAA 4MFDA 1TWFJ 2FX0A 4YY3H 2GA1A 2Y0SN 4MEXF 4BQNA 2O6GE 4D0PA 1POGA 1T36A 2EH3A 2NVTJ 1UC9A 1DU0A 2V79A 3RQIA 3GFIA 3OS0A 2A07F 4IRKA 1L0OC 1V4RA 2E1OA 3MCZA 5EGOB 3LSGA 4EEQA 1SEIA 1SFXA 4LIUA 3ZCOA 3V8LA 3LL7A 4F52A 5D8LB 5EZYF 4ZYAA 3T5JA 4OWRB 2ZMEB 3E0JB 2IW5A 5HDKA 2A6EF 2UZKA 5B5EC 1KGSA 2JEFA 4A93G 4RAFA 2DU9A 1IRZA 4RUCA 2ID3A 3ML6A 3RPUD 2EFQA 2E2HJ 4PCQA 5DD4A 1ZARA 4WX9A 4R79A 1DP7P 4ZHQF 4LIVA 2R93A 1NH3A 4ECSA 2B9SA 2VBWA 5BPFA 4KT5C 4XLHA 5A2QW 3OOPA 2XV4S 3OV8A 2VBYA 3LA7A 2HOSA 4IHYA 5LOVF 1XCVA 2ZMEC 4B3TH 4PSWA 4ZZDA 1RUOA 4MO7A 3BR0A 5I47A 2ZXWH 3I54A 2FE3A 1V51A 1IV8A 2I80A 3KEOA 2ZNZA 1U2WA 5FRMA 2NVUB 3RTRA 4BXUA 2WB1E 5J8FA 4FX0A 1HNXH 2KKOA 1O7LA 3ASOH 5FPOA 1T0FA 3VSLA 3KP7A 5BNGA 3I4MJ 1A0IA 3LFUA 2WWYA 2F5EA 4JI1H 2BYVE 1UNNC 3KZIC 1LVAA 1IAWA 4EBDA 3WO1A 1Y6IA 3U1KA 4IJAA 4OMYA 4DBRA 2XPUA 4MLOA 4C3JJ 3GIIA 5L1JA 2W48A 5M5WJ 4BQQA 5HNFA 4DR3H 5DCMB 4X64H 4I50F 5HS9A 3PQKA 4LFBH 1T95A 1JGGA 2COMA 2HFHA 3HG9A 4CCLA 3KALA 1S9FA 1UHSA 3OYMA 3Q1KA 2A5WA 1GGOA 3CMMA 2PJRB 1Y1VG 1YFHA 3Q9VA 3WU2C 3QYBA 3KE2A 3REOA 3BT9A 3NGDA 4M3DA 1FVIA 3DPTA 4XSZF 4WF2A 2HQ5A 3FXMA 3PO3J 1IG7A 1K4TA 1YX5A 1K4SA 1AUXA 4XNFA 4R1HA 1E4EB 5IT3A 5HLHA 2WC2A 1J59A 2PX9A 3OIQA 4QPOA 2X1CA 1MNEA 1IN4A 2BQ3A 1RKWA 2JVHA 4FQGA 1JKPC 3TIGA 3MR2A 4U7DA 5KG4A 3T5KA 4N9HA 1WI3A 2FJ1A 1QHHD 5FLXZ 4YFXF 3D0SA 1X3UA 1I6HJ 2FF4A 3I5UA 2M45A 2CUEA 4IEJA 1AHDP 5HLTA 3JRDA 1XB4A 3OYKA 3RGZA 1IZ1A 2KJBA 3HUGB 3BP8A 4BJ6C 3PZPA 5EDNA 4U0WA 4IRCA 4ZDPA 1I50J 2YZMA 2DFIA 3S1NJ 2ATLA 2ZDQA 2ETHA 2TCTA 3JAMZ 4I6ZA 2RVCA 4IR9A 1PX2A 2R7SA 4DUZH 2RGRA 4XQFA 5ILUA 3JSOA 1GLVA 2RKHA 4GXOA 3CCJI 5K7HA 5C4JJ 5F0CA 3CC2I 2W6OA 2JA7J 4LFAH 4YR2A 3M3YJ 1IRXA 2V1DA 3A0BC 4C2MA 1HSTA 1X1AA 3TGNA 2V9KA 3C1DA 1GXPA 2GXGA 1O57A 2NVYJ 2ZNYA 4KFCA 2V59A 3E5XA 3OL4A 4HDUA 4OINF 2GBYA 2JK3A 5FFXA 2JA5A 4BXXG 1K61A 4BNCA 1KJ8A 5K7ZA 4IXAA 2Z3YA 3HHHA 3GTJA 1PP8F 3PW2A 2P7CB 2LC2A 4II3A 4XYLB 2PMZE 2RDPA 2W25A 3HOXJ 4R8HA 1K1SA 5FLVA 3MFIA 3C3WA 4UUSA 4CCMA 1N34H 3FBIB 3M9NB 1MGTA 3ABTA 3W2AA 2XDVA 1TLHB 2PBIA 3NARA 3F3XA 3IWZA 2DN0A 3PL8A 4A0XA 3H5NA 4UNOA 1TWHA 1FTZA 3T1YH 2AQFA 2R92J 4GCVA 1HCRA 3L2WA 1KONA 1LFUP 2BHYA 5E17F 3GZNB 5DQHA 2P81A 3FXUA 2NRAC 4ENKA 2R7RA 5DLGA 2MBFA 1FY7A 1P7JA 3I58A 4BJ5C 4A12A 4BE1A 2X0LA 4KIFA 1KJIA 4P9UA 4YAKB 4JV2A 4XX0B 1GV2A 2ADUA 3J7YJ 1FSHA 2HU9A 2XAGA 3V6HA 1R9TJ 1X2MA 4UHTA 4YJ2F 2DO7A 1KU7A 4EBCA 2ZKZA 2QA4I 3GTMJ 4JI2H 4ENJA 4JI8H 3FBNB 2NNNA 5FKMA 3AG2H 3OS2A 1SFKA 3H9GA 1DV2A 4WD3A 3GBGA 1N36H 1S3JA 5DTDA 2DMNA 4RAYA 4MAMA 1I27A 2FXAA 1WH5A 1XMXA 4EATA 4Y17A 3QPLA 2ZCWA 1FOYA 5CPRB 4S04A 4PDKA 4BY1G 3CC4I 1IXSB 2LNBA 1YRNB 4JYKA 3M8JA 4A3GJ 5EF6A 3JSPA 3LMMA 3K4LA 5BPIA 2R5ZB 1IUFA 2CS3A 3F6OA 3H92A 4CUGA 5D4RA 2KSWA 4ZYHA 5HODA 1HR0H 1GHCA 2EPFA 2I10A 3ELKA 4WXHA 1V5GA 3ABLH 1J75A 2L7FP 5J3LA 4A3IG 5CYVA 3PFYA 4MA5A 2UVUA 3FZVA 3GYHX 5KFIA 2F4VH 2ZJPF 2P6TA 3AL0B 4XLAA 5IPAA 2QYZA 1V3FA 1SAXA 2DA3A 5BMZA 1M6VA 4G9YA 5EG0B 2IGOA 5HDNA 1IBLH 5FKOA 2OH2A 2HPIA 2W82A 2BY1A 3KHRA 4DYCA 2EIMH 2Y0SA 3CUOA 5KFQA 1MH4A 2KRCA 1I5ZA 3TINA 4J9LA 1MNDA 2X51A 1Y56A 5FKKA 4J9MA 3AKZA 2UVRA 2FRHA 4PZJA 3S1QJ 1RESA 4HF1A 2FK2A 5IT9W 3FK7A 1LFPA 2FBHA 1YITI 1ZG1A 4A93J 3ETJA 3ZPLA 2VPQA 3FKIA 4X65H 3DWLE 2M5WA 2OQRA 3ECHA 3HSFA 5F04A 1U3EM 1FTTA 4IRDA 4CYCB 1U9OA 1IJWC 3A0HC 2PVPA 2AQEA 1W5CC 2E7XA 5GPCA 4G94A 2MH2A 3G1MA 3ZGKA 2YRWA 3BABA 1ETVA 5LD2C 2O3FA 4XRFA 1B33N 1UG2A 4O4LF 5D8KB 2UWMA 2DCEA 4JUZA 3HEFA 4RB2C 2ME6A 4ETSA 3TP3A 4B48A 1GV5A 3R0AA 1SEUA 3RB6A 1MBKA 1WRJA 2O7OA 3WTVC 2IVMA 1MBJA 1L2ZA 1UB9A 1WJFA 5KFYA 2DOAA 3K1NA 2D1HA 3IC7A 4HSRA 2JZYA 3CCUI 1H8AC 2EA2A 3EETA 3V7SA 3HXLA 3VB2A 3GLKA 4D9JA 2VJ4A 4NB5A 1ENHA 1F43A 4EYIB 4LSXA 1V4YA 3N97A 5FRNA 2R4GA 3BTJA 2P6SA 2YR2A 1TP4A 2KIQA 1IXCA 1T56A 2EBIA 3RV4A 3T1HH 3PO2G 4IHJF 3PW7A 2L2OA 2HXIA 4IAJA 1YG2A 2R85A 3I53A 4KDPA 2VOPA 1F36A 2CYYA 3HSRA 5KAFC 1DQUA 5ILVA 3H3VK 3J7AO 5KAIC 3LP8A 2OLSA 1V54H 3KPHA 4O3MA 1M1EB 1WI9A 3CLOA 1Y1VJ 3VYRB 2E7WA 2UXXA 3RAXA 2FD5A 1T8IA 1JUPA 3DEWA 4EJUA 1UMQA 2RV8A 2WY8Q 3SEQA 4CC5A 4BS9A 2QQAA 1TWAJ 3G3ZA 1YW8A 3RKXA 4IWXA 2YX4A 4HF0A 2V9PA 2EFOA 1SC7A 3ETHA 4N9IA 2CUJA 4BEHB 1Q1VA 3D5RC 4DR7H 3SDBA 5F9NA 1MBHA 3AG3H 3V8KA 4R8UB 5FPRA 2F5DA 3KP4A 1FZPB 3IN5A 3U9TA 1LEAA 1BC8C 2BE5F 3KHGA 3PW0A 4KISA 1XX5A 3RV3A 2FK1A 5L1KA 3T8TA 1XGSA 3BROA 4LF4H 2Q8KA 3PW5A 3DBHB 5M3FJ 3J80K 4ENNA 1I6XA 2IP4A 4MV7A 3JRWA 3SZPA 5EWGA 5C3EG 3F21A 4IQJA 3HDDA 2VI6A 1DUXC 1AOYA 1TBXA 4RS8A 2W4SA 1T94A 2PFBA 4MV6A 5J4VA 4BEHA 2Y30A 3MKLA 2O61A 3SI8A 2LY2A 1JDEA 1PDNC 3K6GA 2XKOA 4IQ4A 1WCMA 1LDDA 4M74A 1FJGH 4P96A 4IHVA 3VYTB 1MBFA 2DTRA 3LWFA 4U0VA 4V2GA 4YRVA 3TIIA 2YS9A 4LGWA 3FM3A 3ZRGA 4IHSA 3RF2A 3TQTA 1QVUA 3FK6A 3H5AA 2QEXI 4BXXJ 2W9CB 5DDGA 4RZQA 2EZKA 3DKYA 5H6QA 4ANJA 2VQFH 1BIAA 2CSOA 2VXZA 3K1MA 2R6FA 3MWDA 2XSJC 3H20A 4O3NA 3IKVA 5A2QK 4PSXA 3SE7A 1AKHB 1F9NA 4A3CJ 4D1QA 3BZCA 3Q5FA 3S14J 1MW7A 2VT3A 2GQQA 2OWOA 4A3DJ 1MMGA 4L9VA 1X1PA 1X1BA 4V2FA 4H4KC 4B4CA 1VQ5I 4E7KA 4FBTA 2XAUA 2ISZA 2Z2SB 5D5XB 2DOEA 2PEXA 4A2UA 5ED4A 4Y52J 1D0ZA 3HOYJ 2JUGA 1N33H 3KHLA 1QRYA 5KFUA 3RIRA 2FLLA 4M9XA 4QWEA 2ZDGA 4KMUX 2XGXA 2L02A 2L7MP 4LH7A 3N43B 1HW5A 2EB7A 3KZZA 5D5UB 5IP9G 1R00A 3BG5A 1QHGA 4EG0A 3QRFF 5D1OA 3G6YA 2KIFA 3BA8A 1EH8A 1XCBA 4G7ZF 1UHMA 2LKSA 2DFEA 1W7PA 4G6TB 1Z9CA 2VONA 2L4AA 4AIHA 3HHGA 4PJJA 1K78A 3RKWA 1GSAA 3TMOA 1JT6A 1BI0A 1W4MA 5M5XJ 4IX7A 1H9TA 3DU6A 3TW6A 2W70A 4LK0F 5HBRB 5DQIA 2UU9H 2LMDA 4L5JA 4KHPH 5KFAA 2WTEA 1B6AA 1E3PA 1G59A 3QFFA 2W57A 1IW7F 2OD5A 3GIMA 1Y1WA 1O3TA 2HVQA 2R7OA 5E3NA 3OYHA 3RKQA 5KG1A 5KFJA 2I5UA 3Q8QB 5EZHA 2ZJTA 2DK5A 4A3IJ 2FU4A 1XGMA 3PNTA 1B8IB 3GV8B 2QSFX 4P9FA 4W1UA 3WODF 4EM2A 1T39A 1Y0NA 4LG0B 3I0TA 5F0FA 3S8PA 1I6UA 1TWCJ 2R7ZA 1ODDA 1B72B 1R1TA 3ZQFA 3JSLA 1TQPA 5LFAA 4ED6A 4FE4A 4EMSA 2R8KA 2MC3A 1ZQ3P 2DA1A 3DP7A 4EGQA 5KT6A 2MD5A 3H40A 4A5MA 2YYAA 4GO1A 4P5OA 4BJTA 2R8GA 4M9ZA 3GIKA 4CCOA 2EK5A 2E1NA 4DR2H 1JJ8C 1BXRA 3KAJA 4YAJB 2PJPA 5KG5A 2E2IA 4QWDA 2UVWA 1XSVA 2KDOA 4ESJA 2LKXA 3V8JA 3I4MG 5F08A 5KFEA 1FT9A 5LYJF 4F4XA 2VPRA 1KU3A 5FFZA 2QBYB 1MSEC 5KFKA 2X85A 1X58A 3CMEI 4YIRX 3KEYA 1ORKA 4ZDLA 3H4DA 1HC8A 5IYDJ 5M5YJ 1DGWY 3M07A 3FMSA 3PSFA 2VOOA 2XGQA 4GYGA 4BDYA 2JA2A 1VQ6I 2BV6A 5LA6F 3GZ5A 1HNZH 4C3IJ 4ZH4F 3IH4A 3DKWA 3M9MB 1HKQA 3ZQHA 4WBNF 3OR1C 5DV5A 3RTXA 4B3MH 2ZJ2A 2X4HA 3PO3G 3L2CA 2STWA 4UCSA 1S0NA 2QBYA 4BUPA 1X4OA 3PO2J 4UCOA 3OTOH 3J7AY 4ECZA 4EM0B 4O4IF 2XC7A 5KG7A 3G6XA 3N44B 5FLXW 2QQ9A 5KT7A 3VFZA 1KEEA 2R7TA 3IH2A 3GTQA 2ZSIB 4BY7G 3ZQIA 5LLQA 2GWRA 4A5NA 4E4TA 1S9HA 5JVLA 5E79C 4ABZA 3E5NA 3CJQB 1X9NA 3BR5A 2Q0OA 2E35A 4ZDOA 3ZMTA 1P9QC 4NQWA 1ETOA 2FQ4A 4J01A 2LKPA 2VASA 1YS6A 3L2VA 1BIBA 3I3LA 2R7WA 1D0XA 4E7LA 4DIQA 1WPKA 3JAMW 4BWSC 2K86A 3RSNA 2NU7B 2YZGA 3CLQA 3DF7A 2G9WA 2QWWA 2VC0A 1BR4A 3KXYT 4M72A 5L3BA 4Q8EA 1ZTRA 3B6CA 1MMDA 1ZRCA 1UAAA 2RGVA 1IDZA 3Q0UA 2E2JJ 1CE8A 1WHUA 4RBOA 2UVVA 4RAGA 5EEHA 3F0CA 1D0YA 3R5FA 3R5XA 4HF2A 3KP6A 2X48A 4B43A 1R4MB 1VAJA 4F92B 4OAZA 2MLGA 1FIAA 2J6TA 2DXIA 4PGHA 1XDSA 2EWNA 3FMRA 5C3EJ 3R6SA 2VUGA 2AXTC 2E1MB 1WGXA 1Z7LA 3H3UA 1N78A 3FDSA 3OSPA 3J7ZI 1WZ2A 2GZWA 1OQYA 3M4OJ 2DA6A 3F8BA 1EH6A 3G6EI 1YW7A 3JRAA 2AO9A 1U78A 5J1YA 2EZIA 3F72A 2JEJA 2XIGA 2P8TA 4XL9A 2DDBA 3OYIA 5CA1F 3OHBA 3MVPA 2R92G 2X9DA 3GTPJ 4JV0A 2E1MC 1XG1A 5IT9K 5FGMA 2PG4A 2CKZB 2IP2A 5KFRA 2OZ6A 2R7QA 4ECYA 3CCYA 3F23A 5E1XA 1TA8A 2XKPA 3EYIA 5KFOA 4QTRA 3OIPA 2Y0SE 4WK8F 5FB2A 3IRRA 2HQRA 3BG7A 3KP3A 4UV9A 3KYLA 4M9UA 4RNMA 1VQLI 3L2PA 1R58A 1I3QA 4ZYDA 2DYRH 2ELHA 5FKLA 1T38A 3IHUA 2K85A
chains in the Genus database with same CATH topology
4QWQA 3WTUC 2UUBH 5CVRA 5HS8A 3E6MA 4LK1F 4JI7H 4EM1A 3KP5A 1QO0D 1G3YA 4JI0H 2P7VB 4XLPF 4HA8A 1LDKB 5BS6A 3TO6A 3KEQA 2UXBH 4ZZLA 3MQ0A 4O6JA 2DLLA 1WSUA 3JW4A 4J0MA 5F64A 1FP1D 4CICA 4EGYA 3RJPA 2EFNA 4WXCA 1RI7A 4OMZA 3J81Z 1J9IA 3HSEA 3L00A 2FEZA 2FBIA 3DEUA 4QLCU 4I01A 2KIUA 4CGZA 1FYLA 1R7JA 2FA5A 2Z5UA 4NXMH 5FD5A 1XGOA 2NAZA 3IKTA 2RC4A 2FSWA 3BA9A 4ENMA 2LSOA 1WWXA 5LEJA 2MLKA 4BHPA 3RYRA 1LQ1A 1H0MA 4DV5H 1QPMA 1MDMA 3WU1B 3FMQA 4OX9H 3S2WA 1LNWA 3QU3A 1S29A 3BJAA 1KYZA 1QBJA 3GFJA 3SHFA 3K9TA 5L3EA 3IG0A 5E8IA 4Q0YA 1O3QA 4B3SH 2GXBA 1ZLKA 1OMIA 2HKOA 4LF7H 3CTAA 1Z05A 4A0YA 2BBYA 1D8JA 3HTSB 4I2OA 4HOBA 1LJ9A 2VBXA 4DV0H 2E5LH 1RUNA 4TV7A 3QU6A 4NXNH 2G7HA 4OOIA 1XMQH 4K2EA 5HOOA 3R60A 1Z2PX 4HBLA 1XDUA 3FX3A 4KICA 3N4MA 2D1VA 1HKTA 4LLNA 4B3RH 2RN7A 5LHHA 1Z2NX 3ECOA 4DR4H 1OKRA 3QPHA 4ON0A 1SD5A 1W7PD 4RGSA 2QYOA 1IN7A 4Q48A 3P9CA 2HEOA 2ZXJA 1TQIA 2K4BA 1R36A 1IXRC 5DUKA 3TO9A 1OPCA 1ZH5A 3RYPA 1YQAA 4LH6A 5LMNH 4HDVA 1O3RA 3MEXA 4M6XA 1YTYA 2CGPA 4A0ZA 2FBKA 1B04A 2QENA 4ASNA 4FHTA 1K79A 3HRUA 1HQCA 5ERIA 2J5OA 3CUQC 3GFLA 3F8NA 3L09A 4HYEA 3ZQ7A 5KK1A 5LGNA 3DF8A 2WE6A 4HX4A 4LLGF 3CUQA 1C0WA 3O3KA 1NHAA 3PFIA 2Z33A 3R0JA 4DQ2A 2ESNA 3WTYC 4XBFA 5KVRA 4HLXA 1P92A 5FD6A 3WTSC 3U1DA 3E6BA 4BAYA 5FO5A 4DUYH 5D5VB 2EJRA 3TDUC 4YIFA 5FLXK 1EH7A 4BYYA 1B59A 3PQJA 5BPDA 2LF8A 5D5WB 2OBPA 1J5YA 1E17A 4O5VA 4GYIA 4XSXF 4UVBA 4M9SA 2LF7A 3LMLA 3JAMK 2PN6A 5LEKA 1BC7C 4DV7H 2HTJA 1ZG3A 3I71A 5HLGA 1YO5C 2W85A 3M8FA 3W6JB 1JHFA 1J5EH 4CDGA 2GIVA 2HYFA 2HS5A 4M6YA 3RJ0A 4OIQF 2GA2A 5E1ZB 1R22A 4PGGA 1W5TA 5CJ9A 1MKMA 3UQ8A 4L9TA 4HQEA 1WH2A 1BI2A 3U9GA 2DBBA 1R5GA 3GZ6A 2LDUA 4NHJA 2JSCA 2A61A 2JT1A 3ZMVA 4MEYF 4UUVA 1XD7A 1P2FA 1OYIA 3FXRA 1S03G 2RQPA 1MJAA 2O0YA 3I4PA 4L9NA 5L3CA 4KN7X 4BHBA 5L3FA 3WTTC 5BOXA 1B4AA 1ZHFA 2C6YA 3N6XA 5DEQA 3QP6A 4AD9A 3DPLC 3JTHA 2P5VA 2V6CA 3WTWC 4CC6A 2HKXA 4UXNA 2ZM6H 4EGZA 1CF7A 5LL6b 4RGRA 3P7NA 3T0YA 2OU2A 4HX8A 4MV9A 3RPUA 1J7KA 2Q2EA 3BPVA 3MWMA 3GFMA 3IL2A 5CVVA 2D2WA 3RIZA 4EJOA 1P8LA 4GGGA 2CW8A 5F6FA 2Y75A 3BOQA 5BQTA 5IWAH 3ZP5A 3ZMZA 2HHHH 2FMYA 4HZFA 1Z2OX 4OIPF 2Z9OA 1BJTA 2JPBA 4MHGA 3O2PE 1V9PA 5D1OB 5D6FA 2P5LC 1GVJA 3IWFA 4IRIA 2VN2A 1W7PB 1K78B 4JI3H 2CFXA 3Q9SA 1YS7A 3EUHA 4DV2H 2P4WA 3WE3A 3M9AA 4ZYGA 3JTGA 1P6RA 1IN6A 2HQNA 5ICFA 1BOAA 2ESHA 2HTSA 4KYWA 3QPTA 5BR8H 4EQQA 3FHZA 3B73A 2FNAA 5DUIA 4JYAH 3ABUA 1S68A 5ICEA 2V9VA 2QM3A 4IPAA 4MQ9F 4U7BA 3J81W 1W5SA 4KUMA 1JGSA 1USSA 4M73A 4P55A 4RGUA 1VTNC 2YX7A 1ZAOA 2IA1A 1FBQA 3K0LA 2MCTA 5DYMA 4LFUA 2Z99A 4AWXB 1RZ4A 2IT0A 3HRMA 1IF1A 5K5OA 1XGNA 2YU3A 3EQLF 3F8CA 1XMKA 2A5YB 4EFEA 1EV7A 3LAJA 3QAHA 4L0ZB 1Z91A 3RDIA 2FOKA 3SXYA 4R7RA 2H6BA 1I1SA 3GVAA 1XDNA 4UCVA 3BDDA 3LQRA 2O8XA 1HKSA 5CVIA 1G3TA 1XMOH 3MAJA 2K7LA 1KYWA 4JK1X 1T2KA 1TTYA 5AIPA 1VS0A 4IRGA 1E2XA 3NRVA 2F5CA 1R1VA 1B1BA 2EV5A 2EFPA 2EV0A 1BI1A 1I94H 2BGCA 1LEBA 1KA8A 3HOSA 2WV0A 4I0BA 5LMUH 3BY6A 1IBMH 3ZMUA 2YCHA 4M71A 4KNYA 4LD5A 1T6SA 1BM9A 2UXCH 2W84A 4DV1H 3TOAA 1HNWH 3I59A 3T1BA 4LB5A 3N42B 3K3VA 5L3DA 4ESBA 3SFZA 1E4GT 2VODA 4N0BA 4Q47A 2JPCA 4HX7A 3L9FA 2OZUA 2H6CA 3SZTA 2WDTA 1OYYA 1G3WA 3HRTA 1XNQH 1Y0UA 1BI3A 5JR3A 1S7OA 1MD0A 3ZMSA 2OAZA 4A6EA 3ZMDA 1UCRA 1R23A 3COAC 2VC1A 2DPDA 4FX4A 4B09A 1B9NA 4H0EA 3LA3A 1TW2A 2KIMA 4I02A 3GLXA 3NQOA 1Z1DA 4AQYH 1TW3A 3QP5A 1AN7A 1ZREA 4WCGA 5JVTA 1IN8A 1SMTA 2DT5A 3F8MA 5K5QA 4WWCA 1ULYA 1IRGA 3WTXC 2B0LA 3VOEA 4KIBA 1WKMA 3LSTA 3MZYA 2VPSA 2K4JA 1D3YA 5DCFA 5JHUA 4EFBA 2VQEH 4GLXA 2CW0F 2CG4A 2JRTA 3FMAA 2Y48A 3I64A 3N41B 4B8XA 3K1PA 3PN1A 4JI6H 4G6QA 3VODA 1FWZA 1SFEA 3HIFA 2F2EA 1R1UA 2TDXA 5ICGA 1FLIA 2DPUA 2MA3A 2A69F 2J5PA 2QQBA 1STZA 3CO7C 3MZHA 1AWCA 1FKAH 4EJVA 2A6HF 2PQ8A 4K0KH 2FQ3A 1PUEE 4A6DA 3ROUA 3L7WA 4UV8A 1MDMB 2DK8A 3B02A 3KETA 3GEZA 2HR3A 1KU9A 3FF5A 3P9KA 4FT8A 1G6NA 2R7DA 5CVUA 2NS0A 3D5LA 2IJLA 2VOBA 3GF2A 2XUBA 3M1EA 2STTA 3E5UA 1YYVA 4EV0A 4G6DA 1RNLA 4WXDA 1M0WA 4I0AA 5L3GA 4UCTA 4ESFA 2L54A 2HOEA 3FWEA 1IN5A 1O3SA 2ZMEA 3KAKA 3BAAA 1MJBA 1LDJA 3DXJF 3RKYA 1XSDA 5F1RA 2BEOA 2ACJA 3WU0A 1ZLJA 2NYXA 2HGSA 5E1WA 1HBXG 4YHHH 3WG9A 3KP2A 3AAFA 1F1ZA 3GX4X 4BQAA 4HV6A 4KA4A 4LFCH 4MTDA 5H20A 1OYWA 4M7EA 5HVQC 1ONVA 4KN4X 2DAOA 2M8EA 3HOTA 5D4SA 1JXSA 4X66H 3J81K 5DCMA 1IRFA 3K2ZA 2HYGD 1RIOH 4XLNF 2H27A 1XSXA 1D8KA 3TQNA 1TNSA 2HGCA 1K6OA 4DV4H 3E6DA 5EEGA 2F5FA 2CQKA 1TQMA 2HZTA 2XAQA 3O6BB 3N40P 3EDPA 4RB3C 2V1UA 3CUQB 2K02A 1SFUA 2XAHA 4S05A 1N32H 4FM9A 3V7RA 4BHCA 2ISYA 4RB0A 4DR6H 4EVIA 2Q2TA 1YW9A 2H09A 3ISPA 1PP7U 1LB2A 3HUGA 1U8RA 1DGSA 2ZO4A 4UVAA 4LF9H 1REPC 1HSJA 4OIOF 3GW2A 3R61A 1DDNA 3NEUA 2RNJA 5E18F 3KLOA 1FBSA 4CZZA 1CGPA 1J0RA 1P4XA 1MJ9A 3RGXA 3CO6C 2PLYA 2OQGA 2E1CA 2QLZA 3F22A 3LA2A 1HXDA 4L5IA 4GKJH 5HS7A 1XN7A 2QVOA 5LBQA 4RB1A 2HDCA 1JE8A 4KMFA 4DR1H 4ZYEA 1K7AA 1USTA 4IVNA 1Z7UA 2W24A 1OR7A 1FX7A 1U5TB 5E8GA 1GXQA 2XAJA 4Y15A 4JV5H 4I7HA 4CYDA 3VEPA 2VT2A 1ZGAA 3P9IA 1U5TC 4Q4ZF 2G7UA 6PAXA 3ZN0A 2DQRA 1KU2A 2DQLA 1J2XA 2XVCA 4CHUA 5LRRA 5CLSA 2O03A 1U5TA 4JBAA 2R3SA 4OU0A 1ZG5A 3DV8A 2CW7A 2WYOA 3J80Z 4RGXA 2MH9A 1SD7A 2HVSA 2YSRA 1XMAA 3CDHA 2HWVA 3L4KA 3SQNA 3RI4A 3GXOA 4RAZA 4KIGA 4I09A 1SYXB 3E3VA 3FM5A 4APMA 2IPQX 1S6LA 2VBZA 3CVZA 3LFKA 3C18A 3F6VA 2M30A 1ZHSA 2D45A 4A2BA 3KLNA 1YLFA 5A2QZ 3LQQA 4MQVA 4YFNF 4E70A 3C0FB 1CF7B 3JSNA 4MTEA 3E5QA 1DPUA 5HDGA 3MFKA 3FXQA 3DFGA 2UUAH 5LHIA 1IUYA 3T5XA 3H3ZA 5TJJA 2XROA 1B9MA 3DQVC 3CJNA 4HV5A 2YPRA 2Y0MA 2AS5F 1S8NA 3L4JA 2KRFA 3GUDA 4AVPA 3QOPA 3HRSA 2DW4A 2V1XA 2QZ8A 4LLLA 4EJWA 3WGIA 1U6GA 1BGWA 2M1BA 4CXFA 1XNRH 4DR5H 1P4AA 4LSAA 1ZYRF 1DPRA 3BPXA 4G7HF 5ICCA 3KCCA 1SMYF 4U88A 4HW0A 4PDBA 1FOKA 1BBYA 5DD8A 5TRDA 5JFRA 4AIJA 4F7ZA 3WGHA 3WE2A 2IRFG 2QUFA 3HYIA 1G4DA 1TNTA 4JQFA 4LF6H 1SD6A 3V4GA 4UCRA 2P5KA 2XHKA 1E4FT 3J7AK 2L01A 1T98A 2EV6A 4EJTA 2JTVA 4U0YA 1YIOA 1P4WA 4Z2YA 1A04A 2FNPA 2XASA 1QZYA 3LAPA 3RPQA 5LRSA 1FYKA 4MNUA 4Q5SF 1MZBA 2ZBKA 4X62H 3BJOA 3C7JA 5LHGA 1QZZA 3ERED 5AONA 3KZYA 5ILSA 5K1YA 4IRHA 2Q2UA 4UCUA 5D6EA 2AXLA 2XRNA 3HTUA 1GYFA 3U2RA 2FMLA 3F8FA 4CO8A 1ON1A 1H9GA 1KQ0A 1UFMA 2IA0A 2L3DA 1FSEA 3M7GA