4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Peroxide stress regulator PerR, FUR family
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
1XGNA 3FZVA 3BJAA 3HHGA 4EQQA 4U0YA 3K1NA 1CGPA 3WU0A 4LB6B 2P7VB 4RAZA 3F8FA 4RS8A 4I0BA 4YFKF 2DPUA 1HSTA 2G7HA 2Z9OA 4A0ZA 5CLSA 4RGRA 5ILSA 4WCGA 3KEQA 2XAGA 3WE3A 4LB5A 2VC1A 4Q47A 2EFQA 1U2WA 5FD5A 2PEXA 3HRUA 1R00A 4Z2YA 3I59B 1XCVA 2O6GE 4LGWA 2R3SA 5DD4A 2PI0A 4HA8A 1U5TB 5BPDA 1YTYA 4ENJA 2HDCA 3F22A 4M71A 3LA2A 4MQ9F 3T8RA 3VODA 4MEYF 2ETHA 4IXAA 1W4MA 3I64A 2FNAA 3ZMTA 4KN4X 4HQEA 2DFIA 3KP4A 4L5IA 1MJAA 3KLNA 1P4WA 4EJVA 2YPRA 2CYYA 1YYVA 3E6CC 4IRHA 3GX4X 5J8FA 3RYRA 1ZG3A 1FBUA 4N0BA 3KP7A 4G6DA 1HW5A 5CVJA 5LEKA 2HOEA 3BJOA 3GVAA 1TW2A 1OKRA 4GYGA 2A68F 5FB2A 1G3WA 1KGSA 2RV8A 4QLCU 3ECOA 1FT9A 2FBIA 3KP6A 1S3JA 5BOXA 3GF2A 2BYVE 4BQAA 1YW9A 2V1DA 5DCMB 1ON1A 3LQRA 3V8LA 1FP1D 3W6JB 2OBPA 1H9GA 5K1YA 2KIFA 1XSDA 4HQMA 4IF4A 1IW7F 1LDKB 1B1BA 5HVQC 1YFHA 3WG9A 3F8MA 5L3BA 4U7BA 4E70A 4UXNA 2QBYB 3DPLC 2GXGA 3I54A 5D4RA 2YX4A 3R60A 4M72A 2CSOA 1O7LA 5EEGA 2HZTA 1EH6A 2ZKZA 1IXRC 2K86A 3MFKA 4GXOA 1B4AA 5L3GA 4QWQA 1BBYA 2A61A 2M5WA 4YIIA 2COMA 3I4PA 1TNSA 3SFZA 2Z5UA 3WTTC 1S7AA 1I1GA 5D5UB 2V6CA 4H0EA 5JR3A 1ZARA 3WGGA 3QU3A 1Z05A 1WKMA 1KU3A 4XLNF 2K4JA 1DUXC 5AONA 3N4MA 3Q9VA 4RB1A 2DI3A 3T1BA 1K78A 1LQ1A 2RDPA 2FNPA 3M8FA 3CTAA 3GFJA 4RB3C 3J80Z 3Q9SA 5D8KB 2IPQX 3L9FA 1IF1A 1GHCA 3GXOA 4I02A 5EEHA 5LGTA 1DDNA 1G3TA 1PDNC 2R7FA 3U9GA 2O03A 3KETA 4CICA 3CO6C 2EB7A 2XROA 3TOBA 2IP2A 1TQIA 1ODDA 4BHBA 1FY7A 1UHMA 1YLFA 1I5ZA 4DNCA 1KQ9A 1TQMA 4GYIA 4BNCA 1RNLA 3DKWA 3O3KA 3E6DA 3I5UA 2GA1A 4O6JA 1RIOH 3ML6A 1UB9A 1KQ8A 5E1ZB 5DYMA 1B6AA 1A04A 3F8CA 5DV5A 4L18B 2UZKA 2DLLA 2L01A 2X0LA 4M9SA 4P9UA 2ZMEB 5LGUA 5KK1A 1TLHB 4HV5A 3GO5A 2HQNA 5E17F 2Q0OA 1K7AA 3S2WA 4ON0A 1R1VA 2KKOA 4PGGA 3FMRA 3QAHA 1D8JA 2AXLA 4O5VA 3ZN0A 1LVAA 3H3UA 1SFEA 1JHHA 4EGYA 1IN5A 1S6LA 4O3MA 1Z7UA 2W84A 4G94A 1AOYA 2GQQA 4GGGA 3VB2A 2VBXA 4CO8A 5E18F 1CF7B 4Y13A 3WTXC 3WE2A 2A6EF 1P92A 3K9TA 1R1TA 3HSRA 3LQQA 1KYWA 3C7JA 1T2KA 3TOAA 3V7SA 5D5VB 1KYZA 3FMSA 1H9TA 4UNOA 4AIJA 2V79A 2MBFA 2GWRA 3HYIA 4AIHA 3FF5A 3H92A 2YSRA 1FOKA 3KCCA 1GXPA 1IZ1A 2MA3A 5E20A 2E1NA 1IUYA 2IRFG 3NEUA 4ESJA 3E5UA 2ISZA 3MZHA 4CXFA 3ROUA 2QWWA 4XSXF 2E1CA 2IJLA 4G9YA 4EGZA 4CGZA 1ZGJA 1W7PD 2FBKA 2A5YB 5HOOA 1W5TA 3Q5FA 2QYOA 3FM3A 2VT3A 2FMYA 5TRDA 2P7CB 2QENA 1X3UA 3IWZA 3WTWC 1BM9A 3EUHA 1TW3A 3ABTA 4HW0A 5DEQA 4EM1A 3C3WA 4A0XA 2L4MA 3I71A 2VODA 2K4BA 3F72A 4JBAA 1XMAA 1IXCA 1O7FA 1IN4A 5BPIA 2YR2A 3V8JA 4EV0A 3E5QA 1WI9A 3F6OA 1UCRA 3ULQB 5LHHA 2G7UA 1B9NA 4YG2F 1ON2A 2G9WA 4XRFA 5LRSA 2LDUA 2PMHA 2OU2A 4P96A 1J0RA 4KNYA 4LFUA 2JSCA 2RN7A 4BYYA 3WTUC 2ZFWA 4EMSA 1W7PB 2P4WA 5BS6A 4S04A 4A6EA 4BXUA 4M74A 4PCQA 1PP8F 1RZ4A 1BI1A 1ZH5A 2KJCA 2DBBA 3BOQA 2CG4A 1O3QA 1BC8C 4KICA 4I7HA 1T38A 4PDKA 1ZGAA 2CFXA 3PQJA 4N9IA 3J81Z 1I1SA 1H0MA 3J80K 2NAZA 2BEOA 4I98B 2F5EA 3KP2A 1ZHFA 3KLOA 3M1EA 2C6YA 3VEPA 2FXAA 2OAZA 1FWZA 5J6XA 3LWFA 1OMIA 1YS7A 1ZAOA 4ENNA 3BWGA 1BIAA 3MZYA 3TO7A 2XVCA 2QUFA 5H6RA 1BI2A 3F23A 2ZXJA 4WX9A 2FRHA 1QPMA 4IJAA 5FFXA 3E3VA 2DK5A 3DPTA 4WXDA 5E8IA 4ENMA 1G3YA 4LLGF 4WK8F 5DCFA 5IT9Z 4KMFA 4ZZDA 1K6OA 3R0AA 1JXSA 4LK0F 1LNWA 1J75A 1R1UA 1REPC 2QQBA 3IKVA 1XDUA 1MGTA 1WRJA 2P5VA 3RDIA 1V3FA 3RI4A 5FD6A 1EH7A 2DQLA 4KMUX 4YFXF 3AAFA 4DQ2A 2LF7A 2EA4A 2Z99A 4ZH4F 1IXSB 2FU4A 2EFPA 4F7ZA 5H6QA 3HSFA 3O2PE 4U0VA 1Q1HA 3V7RA 1TTYA 2P5LC 1MDMA 2K7LA 3K0LA 2XAJA 1GVJA 2KRFA 4CZZA 2DU9A 2XAHA 2K27A 1WSUA 1OR7A 2O0YA 1F1ZA 2HKOA 2V9VA 1RUOA 2ZBKA 3CUOA 1O3SA 3M9AA 5FFZA 5HDGA 4RB0A 3CUQA 1ZLKA 3SQNA 2GZWA 1Y0UA 5ERIA 1F9NA 1TNTA 1YO5C 3O6BB 5HDKA 3IC7A 2DPDA 3RTRA 1BN5A 1USTA 4A2UA 1ZG5A 2CGPA 3RPQA 2LNBA 3ZQ7A 3L7WA 2L54A 5CJ9A 2FBHA 3TGNA 1Z1DA 1BI0A 5L3DA 1DPRA 4EM0B 5A2QZ 3RKYA 1BJAA 2LKPA 2LF8A 5LRRA 2P6SA 4ESBA 4UHTA 2P6TA 4U7DA 4B8XA 5DUKA 1JGSA 2GIVA 4NQWA 3RIRA 5BMZA 3GEZA 1IRFA 4ENKA 2J5PA 3MCZA 2XKPA 4LMYA 3KE2A 3TKYA 5LGNA 1QGPA 2VXZA 3F3XA 5CVUA 2L4AA 1QNTA 2FSWA 2HQRA 1C0WA 2YU3A 1L3LA 4BHCA 3WTZA 1O3RA 2E7XA 2A3SA 3E6MA 4AD9A 3F21A 4I2OA 3KZYA 3I59A 3ELKA 3ZMVA 3ZMUA 2EJRA 2EV5A 1U5TA 1LEBA 1R5HA 3QU6A 2XHKA 2HTSA 2HYGD 1FYMA 4OINF 2MH2A 4U0WA 2NNYA 1D3YA 3MEXA 1JHFA 3V8KA 1E2XA 3MQ0A 3VFZA 3CUQC 1BOAA 2DAOA 4UV9A 2IW5A 2WWYA 2P5KA 1FBSA 1HKSA 2VBWA 2BBYA 3J81K 4KFCA 2JPBA 2FF4A 5AIPA 2EFOA 1T98A 4NHJA 3JTHA 1HW1A 4LJZF 3HIFA 1F5TA 3ISPA 4KT5C 1OYYA 5ICFA 1J5YA 3PFIA 4LD5A 4MNUA 2Y48A 2D1VA 2QLZA 4KIGA 4TV7A 1ZRCA 3E6BA 4HX8A 2MLGA 3F6VA 2B0LA 3JW4A 1YIOA 3CO7C 1KQ0A 3VOEA 2GXBA 3C1DA 1NHAA 3R0JA 4PZJA 1FPQA 1S8NA 4B09A 3KZZA 2DW4A 3T5XA 1U78A 2PMUA 4CDGA 1D5VA 5HS7A 3P9IA 3J7AO 4UVAA 1IRGA 5HS9A 1XD7A 5DCMA 5IT9K 4BAYA 2IA2A 4Y17A 2O3FA 2FOKA 3H3ZA 1EV7A 3KP5A 3NRVA 4AWXB 4ZYDA 5FO5A 3KEOA 2QBYA 2W85A 5JI6A 4ZYHA 2P8TA 3FXUA 1YQAA 6PAXA 3E5XA 2IA1A 1VTNC 3JSPA 1I27A 2HWVA 2OQRA 1OPCA 2D1HA 3FHZA 5LBQA 1IN7A 3K2ZA 3KP3A 4LG0B 2STTA 1B9MA 1Z6RA 4L9JA 3ZMDA 2ELHA 1O3TA 3GFMA 2UWMA 1USSA 4OU0A 4HLYA 4L9TA 1J2XA 5HS8A 5K5RA 1OYWA 3DF8A 3F8BA 5D5XB 5D6EA 3WGHA 2HYFA 2VONA 3GYHX 1R23A 1D8KA 3ERED 4XBFA 1FP2A 2O8XA 3GWZA 2A07F 1Z9CA 2STWA 2OA4A 1B59A 4KIFA 2EFWA 1LDJA 2GA2A 1U6GA 4ASNA 5K5QA 4ESFA 4L0ZB 1G4DA 3WGIA 1HKTA 5E1WA 5E8GA 3QOPA 4I01A 3SZTA 1XDSA 1TQPA 3DXJF 5A2QK 1AWCA 4HV6A 2RVCA 5ICEA 1SFXA 3BY6A 1PP7U 2PG4A 3GZ5A 1S7OA 2EWNA 4R79A 4L5JA 4HLXA 3ABUA 3U1DA 1DP7P 4RGSA 2L3DA 4M9XA 3OOPA 3WTVC 4KIBA 2NRAC 2EV6A 2PJPA 2HR3A 4P9FA 2H6CA 2Y0MA 5FGMA 2HTJA 3HSEA 3PQKA 3ZN1A 2ZMEA 4L9VA 2XV4S 2Z33A 1S29A 4P55A 3JTGA 5D6FA 2F2EA 4FX0A 5CVIA 3BP8A 2Q2EA 2XKOA 1GXQA 2V1UA 4IRGA 1QO0D 2FQ3A 2RQPA 3SXYA 1KA8A 4KN7X 1BIBA 1QZYA 3RKXA 4N9HA 3ECHA 4WWCA 2H94A 4M9ZA 1MJ9A 3IRRA 4MEXF 1BC7C 1YG2A 5DDGA 4LK1F 4G7ZF 3FXQA 1P2FA 2CQKA 1LDDA 5KVRA 2M8EA 4YFNF 2BGCA 1IN6A 4HDVA 4G8XA 4Y15A 4OIPF 3K1PA 3GFLA 2Q8KA 3GLXA 2OQGA 3DP7A 4RGUA 1ZLJA 4ETSA 3QPHA 3HHHA 1XGOA 1CF7A 2ADUA 3HOSA 3ZPLA 4L0YB 4OMZA 3F8NA 1R7JA 2UXNA 1FSEA 4KUMA 2MD5A 4FX4A 2QQAA 3HTUA 4P5OA 2EV0A 1J59A 2CW0F 1U3EM 1QQIA 5JFRA 5TJJA 3EDPA 3MWMA 4MTEA 3HRMA 3TDUC 4HDUA 2H09A 2ISYA 1SD6A 1SMTA 2H6BA 4WXHA 3V7CA 3NQOA 5E1XA 2RGVA 5ED4A 4OIQF 1MD0A 4ZZLA 4KYWA 1XN7A 1R5GA 3OV8A 1RI7A 2ZNZA 3RPUA 2NYXA 3TO6A 4CYDA 3C18A 3G73A 5CVRA 3IWFA 3FMQA 3WODF 4GCVA 3TQNA 1IAWA 3BROA 3D5LA 4RB2C 4HF2A 3TO9A 2M87A 4G7OF 3ZMZA 3B73A 2J5OA 3GW2A 4A0YA 4EJOA 5FLXZ 4OIOF 2JT1A 1U8RA 4IPAA 4HOBA 5DD8A 4HZFA 2DQRA 4Q4ZF 2EFNA 2MLKA 1R36A 4UVBA 3R61A 4HX7A 4AIKA 3BPVA 3DV8A 3G3ZA 2QZ8A 2OZUA 1XSVA 1E17A 3K69A 1O57A 3DEUA 2NS0A 1K78B 1MZBA 4K2EA 4U88A 2M45A 2LSOA 2VC0A 3L2CA 1ZRFA 1W7PA 2RKHA 4FHTA 4HBLA 3LAPA 5ILVA 2XASA 2D45A 3B02A 4WF2A 3I58A 4HYEA 4D0PA 5CVVA 1LEAA 4IVNA 1UFMA 3T0YA 2ZO4A 2DTRA 1FLIA 5F6FA 3TDZC 3D0SA 4HAMA 2TDXA 2H27A 1T0FA 3EQLF 4XLPF 2IA0A 2VOPA 1KU9A 2KIUA 3QP5A 2WTEA 2Y75A 4JQFA 2XIGA 2QQ9A 3HOTA 3LAJA 3E97A 1F4KA 2RC4A 2ACJA 2EA2A 3LSTA 4AVPA 4LLNA 4R1HA 4R8HA 1Z6TA 3QPTA 4XSZF 3JAMZ 2A6HF 5LHIA 4Q5SF 1MJBA 4ZYGA 2W25A 3BPXA 1T39A 1G6NA 2JZYA 2CWEA 1SAXA 2A69F 1WQ2A 1FBQA 3CLOA 2XAQA 2YX7A 2PLYA 1J7KA 2VE9A 4OMYA 2PBIA 5K5OA 1SD5A 1YS6A 1XMKA 1I6XA 4A12A 1FC3A 1XSXA 3ZP5A 1G3SA 3IL2A 4RAYA 3QP6A 4EJUA 3SHFA 2X4HA 4M6XA 4I0AA 4IHTA 1K79A 3FM5A 3BJ6A 2L02A 4KA4A 2DO7A 2OZ6A 3BZ6A 1FSHA 2ZCWA 2FE3A 1P6RA 1YW7A 4G7HF 2OD5A 3WU1B 5LLQA 1ZN2A 3MAJA 2FA5A 4MGRA 2GAUA 2K02A 5ILUA 4BH9A 2HEOA 1QZZA 2EK5A 1SD7A 1BI3A 3LA3A 2ZNYA 2AS5F 4PGHA 5LEJA 2XUBA 1LB2A 3CJNA 2PN6A 3I0TA 2VBYA 2UXXA 2PFBA 2F5DA 1HXDA 1HW2A 2HFHA 4RGXA 4OIRF 2F5CA 2M1BA 2CO5A 2VN2A 3IRQA 3LA7A 5HLIA 4Q48A 4MTDA 3FWEA 4LLLA 3I53A 5BQTA 1FYLA 1Z91A 2JRTA 1ULYA 2ESHA 2ESNA 2FEZA 1U5TC 1XGMA 3RKWA 4WXCA 5FLXK 3GZ6A 2XRNA 4HF1A 1FYKA 4EVIA 2BE5F 2IVMA 4MHGA 4A6DA 2ZJ2A 1SMYF 5D8LB 1KU7A 1T6SA 2W57A 1HSJA 3KFWX 3LFKA 3T8TA 2F5FA 2VT2A 4FT8A 4M73A 3GUDA 1R58A 3P7NA 1ZRDA 1HQCA 1OYIA 5HLHA 1STZA 1YW8A 4ZYEA 1KU2A 2HGCA 4EJTA 1HBXG 4UV8A 2MC3A 4UUVA 2QVOA 4BHPA 1QBJA 3L00A 2HKXA 1HKQA 2O61A 2VBZA 2D2WA 1P4AA 3EETA 1XCBA 1R22A 3JSOA 4JK1X 1EH8A 4L9NA 5ICGA 3IKTA 2R7DA 2XGXA 3ZMSA 2JPCA 3HRSA 2E7WA 1W5SA 1ZYRF 3N97A 4M6YA 3WTSC 3COAC 3CDHA 2DT5A 3P9KA 2MH9A 3WTYC 2V1XA 1P4XA 3V4GA 2JTVA 3REOA 5CYVA 5L3EA 1RUNA 2VE8A 1J9IA 1V4RA 1FNNA 5F1RA 3L09A 1XB4A 5HDNA 4UVCA 1DPUA 1SFUA 5JVTA 3FX3A 1FX7A 2Z3YA 1FZPB 3P9CA 5DUIA 4IHSA 3HRTA 3JAMK 2FMLA 1XGSA 2WC2A 2VOOA 3U2RA 5L3CA 4G6QA 3EYYA 5H20A 1ZREA 2RNJA 2M30A 2IT0A 2PQ8A 1PUEE 5D5WB 4KDPA 4I09A 5D4SA 1JE8A 3M8EA 5F64A 5JHUA 1SD4A 2KJBA 1ZG1A 3W6KB 3EYIA 1MDMB 4EM2A 1IN8A 3FXRA 2QM3A 1MKMA 3HTSB 3R6SA 4CHUA 5HLGA 1LJ9A 4IRIA 4OOIA 3SZPA 3QRFF 2BV6A 4MQVA 3IHUA 1L0OC 5AIQA 2XAFA 2DK8A 3CUQB 1ONVA 5LHGA 4A5MA 3HUGA 4LG0A 3BDDA 2KIMA 1WWXA 5J8CA 5L3FA 1UHWA 5ICCA 4GO1A 4HF0A 2NNNA 2WV0A 3RYPA 3R4KA 5IT3A 3DQVC 4EJWA 3RJPA 3DFGA 2W24A 3K1MA 2HS5A 4NB5A 3GFIA 4YIFA 3M7GA 4HX4A 4A5NA 1TBXA 4S05A
chains in the Genus database with same CATH superfamily
1XGNA 1IRZA 2W8KA 4MV7A 3FZVA 3Q0WA 1ZHQA 3N42B 4UCTA 3BJAA 3H5AA 4S0HB 2C2DA 2A5WA 2FB9A 4C3JJ 2K85A 4A3JJ 3HHGA 1CQIB 1JDBB 3CMMA 4DYRA 4EQQA 3HOUJ 4U0YA 4XORA 2HI3A 5DGAA 4NQWB 3W3CA 1JKPC 1UG2A 3K1NA 4CCLA 3D1NI 3S3NA 1CGPA 1E3PA 3WU0A 4LB6B 2P7VB 1ERDA 1M0TA 4JI2H 3J80W 3Q8SB 4F4WA 3I9V2 1MMAA 4DR3H 4RAZA 2LD5A 3F8FA 4RS8A 3RBEA 2R82A 2IGOA 4I0BA 4HRIA 4Y8VB 4JV0A 1V51A 1N75A 4YFKF 1A5JA 2C28A 1EA3A 2DPUA 1HSTA 1Y56A 3TQ1A 2G7HA 1ORKA 3VPBA 3FXOA 4AIDA 4A3GJ 2KQRA 2I8CA 2CQNA 3BTIA 2JA2A 2Z9OA 2R92G 4A0ZA 1TWHA 5CLSA 4RGRA 4I99C 5ILSA 4WCGA 1OCRH 3KEQA 2XAGA 1BXRA 3BZCA 3WE3A 4LB5A 2RDIA 2VC1A 4Q47A 2FLNA 2EFQA 3JR9A 2EBIA 3P5JA 1U2WA 3PL8A 2QCOA 2L7KA 1GT0C 3N44B 2Z2SB 5FD5A 2PEXA 2WAQN 3HRUA 1R00A 4Z2YA 1ETKA 2M8GX 3RV3A 2R5ZB 4I55F 2JEIA 1B6SA 3I59B 1XCVA 2MGQA 2M7BA 4BQOA 3WU2C 4LGWA 2R3SA 2QA4I 2O6GE 5DD4A 4X6AJ 3GMEA 3EPIA 2R7ZG 3PO3G 4A3BG 1AA7A 4IQJA 2PI0A 5E3LA 4HA8A 3PO2G 1SVLA 5J40A 1KJJA 4DUYH 1U5TB 5EZHA 5BPDA 1YTYA 4ENJA 2HDCA 3F22A 5DM7F 4HYKA 1FIAA 1YIJI 4M9UA 3DLAA 4M71A 1Y1VA 4EEFG 4LSXA 3LA2A 3TBIA 1M1EB 2Y30A 2BXYA 1EF4A 3HPGA 1HLVA 4MQ9F 3T8RA 4BXFA 3VODA 4MEYF 4LH7A 2ETHA 2JA7J 3JRWA 4IXAA 1VS0A 3TW7A 3S1MJ 1IBKH 5KFIA 2MSYA 4UCRA 3CF2A 5KHDA 1W4MA 3K4MA 4LH6A 3RZDJ 5J1UA 3I64A 1IRXA 4EGJA 3G6XA 2ME0A 4YR3A 5IP9J 1VQOI 2FNAA 2K9SA 3ZQCA 3MD2A 1QVUA 1R71A 4M3DA 3ZMTA 2P0AA 4F4YA 4KN4X 2FK1A 2K9NA 4HQEA 2DFIA 3QZ8A 3KP4A 4L5IA 2DFFA 1NG6A 1MJAA 1MW7A 2LVSA 2BQ3A 3KLNA 1P4WA 1YI2I 3BQZA 5EYRA 4EJVA 2YPRA 2CYYA 1YYVA 1TWAJ 5EWFA 2BQUA 3E6CC 2A6TA 3PSIA 4IRHA 3GX4X 5J8FA 3RYRA 3V6HA 1ZG3A 5CA0F 1FBUA 3NWSA 1GV2A 4N0BA 2KT0A 3BABA 2HPMA 2MW8A 4A3JG 4UFZA 2R7MA 3KP7A 4G6DA 5LMUH 3HOUG 4O3RA 1HW5A 1XMXA 2KL4A 1MH3A 2MD0A 2HOEA 1Y0NA 1LUJB 3BJOA 5CVJA 3W2VA 5LEKA 2R7NA 3GVAA 4MFEA 2GPSA 3HOVG 5C44J 3FXJA 4BY7J 1TW2A 4NC8A 4F55A 4A3DJ 1OKRA 3H36A 4GYGA 1SC7A 2A68F 5FB2A 1NK3P 1GVDA 1G3WA 3N41B 2NVXJ 3ZOBA 1XTAA 1KGSA 2RV8A 3VYRB 4QLCU 1MMDA 3ECOA 1FT9A 2FBIA 2DT7B 1YX5A 4Q0YA 3KP6A 4A3GG 1DQUA 2ID3A 1S3JA 3LSKA 5BOXA 4MLOA 1LFUP 4IHYA 2IP4A 5KG5A 3L2PA 4IOCF 1XMOH 3GF2A 4KHPH 2MFZA 2BYVE 1S5LC 3GTJA 1X4PA 3G2BA 2LYCA 1SCUB 4ECWA 2UVUA 4AYBA 5C1OA 4F3QA 3C2GA 4BQAA 1VNDA 1YW9A 2V1DA 4DLKA 4DV1H 5DCMB 2YL2A 1ON1A 3A01A 1MBHA 3LQRA 1IJWC 4E7ZA 3CVZA 5J47A 3V8LA 5GPCA 1FP1D 3W6JB 4QWBA 2OBPA 4HSTA 1I3QA 3V6JA 1H9GA 5K1YA 3L4KA 2KIFA 1XSDA 1N77A 2V9WA 3VSLA 3T5KA 2DCEA 4P1WA 1CE8A 4HQMA 3H35A 4IF4A 2FMAA 1IW7F 2ECBA 2JUGA 1LDKB 1B1BA 4JYKA 2QEXI 5HVQC 1YFHA 4KJZA 3WG9A 2HVRA 3F8MA 2EIMH 4AU7A 5L3BA 2VPRA 2ELJA 2CMPA 4U7BA 1X2MA 4UXNA 4E70A 1X1CA 2QBYB 3DPLC 2GXGA 4F91B 3I54A 3RB6A 5D4RA 2YX4A 3R60A 4M72A 5KT6A 3OHBA 2CSOA 1D0YA 2KPMA 1O7LA 5EEGA 4RUCA 3LSIA 2JA7G 5KFQA 2LMDA 2HZTA 1EH6A 2ZKZA 1IXRC 5KFKA 2K86A 3BCBA 2X6YA 3MFKA 4GXOA 4CCNA 3C2BA 4NXNH 2K9MA 4MV9A 3ZQQA 1T08B 1ZR2A 1BL0A 2XPVA 3HKZE 2VQHA 5KG4A 2YS7A 2OV7A 1B4AA 1IDYA 3JCUC 5CQGA 4CCOA 1FKAH 4QJFA 4JYAH 2ZDHA 3FK7A 4FISA 2FOWA 5L3GA 4NC6A 4QWQA 1BBYA 2A61A 2M5WA 1IV6A 4IR9A 2E2IA 3HKZA 4YIIA 2COMA 1RJQA 3I4PA 1S9FA 1MMGA 5KKNB 5KFLA 4YB8B 3IAS2 2EQRA 4RZRA 1FEXA 4X66H 1TNSA 3SFZA 2Z5UA 3WTTC 1S7AA 3T5LA 1I1GA 3LOCA 2QKMB 5D5UB 1SYXB 3F9KA 2V6CA 2JJ7A 2V4JC 4BEHB 3BQYA 1K6YA 4IHJF 4WD3A 2DA6A 2QK4A 3BG3A 3LSRA 1RKWA 4H0EA 5JR3A 1ZARA 5F0HA 5IP6A 1Y1VJ 4CUGA 3WGGA 3QU3A 1U9NA 2NUAB 1Z05A 1WKMA 1KU3A 4XLNF 2IS2A 3RIZA 4DZJA 3VWBA 1UMQA 4MA0A 3BTJA 3G6YA 2K4JA 1DUXC 5AONA 3ZQIA 3JRGA 4V2GA 4ZYAA 3N4MA 3GIQA 3JSLA 4BY7G 4BBSJ 3K5IA 3QPLA 4B3SH 2DMNA 2UXCH 2AXTC 2TRTA 5IYZF 4U7CA 3Q9VA 1P9QC 4RB1A 2DI3A 3T1BA 1WCMA 4JX6A 1DP3A 1RR7A 1K78A 2QKLB 3O8HA 4J9KA 4IWXA 2LBFA 1LQ1A 4G12A 2RDPA 1EUDB 2FNPA 3M8FA 3CTAA 3GFJA 4ECZA 5K7FA 3DKXA 3DPUA 4RB3C 2M0CA 3J80Z 2XD4A 5DLFA 2W7NA 1T0FC 1B6RA 2J6TA 3CJTB 3Q9SA 5D8KB 2IPQX 3L9FA 4OAZA 1IF1A 5F04A 1GHCA 2V59A 3GXOA 2I5UA 4I02A 3FIWA 5EEHA 2UUZA 5LGTA 2WAQE 4Y33A 3DU5A 1DDNA 1G3TA 5HNFA 2AHQA 1WH5A 2HDWA 4YAKB 4NC7A 3LL7A 1PDNC 2IA6A 2R7FA 1YRNB 3BR2A 3U9GA 4TQRA 4DL6A 2O03A 3KETA 4CICA 3CO6C 3R23A 4ZI7F 5HV6A 2K9QA 4NNJA 2EB7A 2XROA 1PX2A 3TOBA 4PDBA 2IP2A 5M3FJ 1TQIA 1ODDA 4BHBA 4HQ6A 1WPKA 1FY7A 3GV8B 1UHMA 3PW4A 1R9TJ 2VXDA 4B48A 2YS6A 3BZKA 3DTIA 3VMMA 5JVDF 1G8XA 2DA7A 3GILA 5B3SH 1YLFA 1ZQ3P 3O8GA 1I5ZA 2L9VA 4DNCA 3RV4A 2E35A 1WJEA 1KQ9A 2Q2TA 1TQMA 4GYIA 2F48A 4MO7A 3L2UA 4BNCA 2X0SA 4XL9A 5HODA 3PW0A 1RNLA 3PNYA 2R5YB 3DKWA 2AQ4A 3S14J 3O3KA 1FIPA 1UC9A 4J9OA 2HOAA 3KXYT 4XKVA 2UU9H 3CMEI 3Q2OA 3E6DA 3I5UA 1S72I 1WI3A 2GA1A 3KYCB 4O6JA 3GTJJ 3T5JA 2KSWA 1RIOH 2HQ5A 2XB0X 3ML6A 3GTMA 2HGSA 2HXOA 3ZRGA 1IBMH 1UB9A 1CQJB 3FXKA 1KQ8A 5M5WJ 5E1ZB 1Z2OX 5DYMA 2JEFA 1B6AA 1A04A 3F8CA 3R5HA 1D1AA 4LFCH 5DV5A 4L18B 2VUMJ 2UZKA 2DLLA 2R7KA 4ECXA 2R92A 3PNVA 2L01A 4RZQA 2X0LA 2BOLA 4M9SA 2Y31A 4P9UA 5KFNA 2ZMEB 5KT7A 4F4XA 5LGUA 3U21A 5KK1A 5C3EJ 3SEZA 1TLHB 4HV5A 3GO5A 2WV1A 3K4JA 5HNHA 1Y1VG 2DFEA 2HQNA 1FMWA 5E17F 2Q0OA 2VA2A 2XCLA 4LITA 1K7AA 3M1CA 3S2WA 2R7SA 4ON0A 5FKKA 5BNGA 1R1VA 2Q2EB 2XC9A 2KFDA 2KKOA 1ETWA 2E19A 2XF7A 4PGGA 3WG7H 3OYJA 4ZOLF 4HPQA 4J9MA 4DR6H 3AFHA 2QSGX 4BBSG 3PZPA 4B3RH 4RU9A 1ZETA 1GYFA 1JKOC 2PMZN 1ZHSA 3FMRA 3QAHA 1D8JA 2AXLA 4O5VA 3ZN0A 3N43B 1LVAA 2W7PA 1VQ9I 3CCEI 3H3UA 5IT9W 1JJ6C 4GC6A 1WHUA 4NLGA 4XNFA 1LE8A 5KFGA 3GQCA 2E2IJ 1SFEA 1JHHA 4IAJA 4EGYA 1IN5A 1S6LA 3PIOF 4O3MA 2WBMA 1Z7UA 3UR3C 3RPUD 3SDBA 3HXLA 4E7LA 2W84A 4JX5A 1MBEA 4G94A 1AOYA 1V4YA 2GQQA 4GGGA 5GAEJ 3I4MJ 3PN1A 5GAHJ 4FS1A 3K3VA 2VJ4A 2NVTJ 1DGWY 1MMNA 3VB2A 5LRSA 5JVLA 1JTYA 2ZB9A 3FBIB 3CP8A 2VBXA 4CO8A 2KDOA 2WA0A 4FCYA 2V4RA 5E18F 1CF7B 4Y13A 3G6EI 4F93B 1Y39A 2BQRA 3B6AA 4EEQA 2H1LA 3WTXC 3WE2A 3CJQB 4YQWA 2A6EF 1TAEA 1RYSA 3BJYA 2BY1A 2B63G 1P92A 3H0GJ 1K1QA 1Z21A 3K9TA 4R8UA 3GLLA 2I8DA 1R1TA 1BW6A 3HSRA 3LQQA 3JRBA 1KYWA 2NOGA 2KDZA 4Q8EA 1WCMJ 3C7JA 1T2KA 3RZOJ 1I50J 3TOAA 3V7SA 3CJRB 2CRGA 5D5VB 3RTXA 1T3NA 1KYZA 2EIJH 2M4GA 4BJTA 2HDDA 3FMSA 1FVIA 2QF7A 1H9TA 4UNOA 2JA8J 1E3HA 4AIJA 1X19A 2V79A 3HZJA 2MBFA 2FJZA 3G71I 2GWRA 3BR5A 3HYIA 1R6RA 4AIHA 4XICA 2DA4A 1W0TA 3OWTA 2DMQA 1S03G 3FF5A 3H92A 4OAYA 3L4JA 5D1OB 2BY2A 2Q2UA 2YSRA 1R4MB 4X62H 3ABKH 1FOKA 4ED7A 3MN2A 3HOYJ 2CH0A 3KCCA 5IYCJ 1MH4A 1GXPA 1IZ1A 1Y8RB 4QW9A 2MA3A 1N25A 5E20A 2LC2A 2B7EA 2O5RA 2YUSA 2E1NA 1JDEA 1IUYA 1G59A 2IRFG 1FJGH 4Q8FA 3NEUA 2VUMG 1L2ZA 4ESJA 3E5UA 3H5NA 3MZHA 2ISZA 2OTLI 3CP2A 5EOYA 4CXFA 3ROUA 5KFSA 2QWWA 4XSXF 2E1CA 2AU0A 2IJLA 4G9YA 4EGZA 3BLYA 4CGZA 1ZGJA 2FJ1A 1W7PD 2FBKA 3JRDA 2A5YB 1XG1A 2ZJQF 1B8IB 5HOOA 5IYBJ 1D1BA 3N6XA 2R85A 1W5TA 3Q5FA 1X1AA 2E2JJ 2QYOA 3FM3A 2VT3A 2FMYA 1MBJA 3CCJI 5TRDA 2W82A 2P7CB 4ZC3A 2QENA 1X3UA 2NU7B 5LMNH 4BXXJ 1QVTA 3IWZA 4FM9A 3WTWC 4XN3A 1BM9A 3EUHA 5FPRA 3CMAI 4ED2A 1TW3A 3ABTA 4R7RA 2XC7A 3T5HA 3OOUA 4HW0A 5DEQA 2Z16A 5K7HA 1V5FA 1SANA 1WGXA 2JMWA 4EM1A 3UKGA 3LMLA 2OH2A 2WDTA 4QPOA 5BPFA 3K7AJ 3OUUA 3C3WA 1UJ8A 2W1OA 2L4MA 2ZXWH 3I71A 4A0XA 1JGGA 2VODA 2W7OA 2ZXHA 1IOVA 2K4BA 3F72A 1GV5A 4JBAA 1XMAA 4YJ2F 1IXCA 4NBQA 1O7FA 1IN4A 5BPIA 2JA7A 5JQWA 2YR2A 3V8JA 3J7AK 1I6UA 4EV0A 3BA9A 1ETQA 5FKOA 3E5QA 1WI9A 2ECCA 3MR2A 3F6OA 3SE7A 3H4BA 1TL8A 1UCRA 2GOMA 5C5JA 1IC8A 1N34H 5A2QW 3ULQB 4AYBN 5LHHA 2G7UA 3GTOJ 1B9NA 3K70C 4YG2F 1ON2A 1ETVA 1BOBA 2G9WA 2LDUA 2PMHA 2OU2A 4P96A 4XRFA 2VI6A 5F0CA 2VQFH 4ECTA 1J0RA 4G6TB 4ED1A 4KNYA 2RNGA 5CB4F 3BR1A 3QOEA 2NU6B 4FBUA 4B47A 5FLMJ 4LFUA 1RPWA 4F4ZA 2JSCA 2RN7A 3HOZG 4LF6H 1VBGA 1POGA 1PUFA 4BYYA 3WTUC 2LKXA 2ZFWA 2YZGA 2W8LA 3KPHA 4JI0H 5EGOA 4XRSG 4DUZH 4ED3A 5C1PA 4EMSA 5I47A 3BTLA 1W7PB 2P4WA 2L9RA 5BS6A 1T95A 2LP0A 3H0GG 1IBLH 1QZEA 4A6EA 4S04A 4BXUA 2W9BA 1Y6IA 4M74A 3RJ0A 4PCQA 1M7JA 2IGKA 2X1DA 1PP8F 1WCMG 5DQGA 1RZ4A 1BI1A 2O9LA 1ZH5A 2KJCA 2DBBA 2J9GA 3BOQA 2CG4A 3JRIA 3RGZA 1O3QA 1VQKI 1BC8C 2YRWA 4KICA 2JA8G 4I7HA 5L1KA 1T38A 3MJFA 4PDKA 1JUSA 2FPIB 1OCZH 3H40A 2L9SA 4RDUA 2PVPA 2ELKA 5IOZA 2K3FA 5KFEA 1ZGAA 3L2VA 2CFXA 3PQJA 1RJPA 2NVXA 4N9IA 3J81Z 1KJIA 4YIRX 1I1SA 4L1KA 5KT5A 2VQGA 3HOYG 1H0MA 3J80K 2NAZA 4IWYA 2BEOA 3AG2H 3DEEA 2ZJRF 1HCRA 4I98B 4E7IA 5J1YA 2F5EA 3K4CA 1BW5A 3KP2A 1ZHFA 2QYZA 4LOCA 1B04A 3CD6I 1UG0A 2JA6J 1VKZA 3KLOA 3M1EA 2C6YA 2M34A 4RUAA 3VEPA 2FXAA 5IYBG 2OAZA 1PYVA 1FWZA 5J6XA 3RQ4A 4RAGA 2PJRB 3LWFA 1OMIA 2BY3A 1A35A 1YS7A 1ZAOA 2LOOA 4ENNA 3RB4A 1ENHA 2H8WA 3BWGA 1AKHA 4ED0A 2VR1A 4XZ3B 1BIAA 3FKIJ 3MZYA 4BXXG 3TO7A 1VQ7I 2XVCA 2QUFA 4CYCB 5GADJ 3LSPA 5H6RA 3GIJA 1BI2A 1AU7A 3F23A 1M0WA 3KAKA 2LY2A 2ZXJA 5JH7F 3HOVJ 2PMZA 3U9SA 1VF9A 3A2KA 3MMYB 5DG7A 4DR4H 3EUHC 1DGSA 1WJCA 2H8RA 2MABA 4WX9A 1R4NB 2FRHA 5EZGA 4B3TH 2XCAA 1QPMA 3GCMA 4IJAA 1S10A 5FFXA 1QHGA 2R93A 4UCOA 3E3VA 2DK5A 3KYDB 3DU6A 3DPTA 4WXDA 2Y0SN 5IP7J 5E8IA 4ENMA 1G3YA 4LLGF 4RAFA 1E0EA 3PUBA 4A69C 4WK8F 5DCFA 1FJLA 1S97A 5IT9Z 1W1WE 5IYDJ 4KMFA 5DQIA 2HYJA 3G8CA 4IL6C 1U8BA 4DL2A 4ZZDA 3OYBA 3R0AA 1K6OA 1JXSA 3GLKA 4LK0F 1LNWA 1J75A 1R1UA 2P0WA 1LFPA 2V6EA 2XGCA 1REPC 2QQBA 4IX7A 5FLMG 3IKVA 3HB9A 2L9NA 5CKTA 2FK3A 4GKJH 5DGBA 4MV3A 1XDUA 3PW7A 1MGTA 1YJ9I 2SCUB 4E7KA 4A3KG 4M3BA 1P7IA 1JT0A 2BXZA 3ABLH 4M3GA 1WRJA 2P5VA 2DJNA 4IEJA 3RDIA 3PIPF 1OWTA 1V3FA 3Q8QB 3RI4A 2XF5A 2DT6A 3PR5B 5FD6A 1G2HA 5KCMA 3H4DA 4XX0B 4DL5A 4TV9F 1EH7A 2YU9A 5F27A 3S2DJ 2XDVA 4M3FA 2DQLA 4KMUX 1B72B 4RM3A 4YFXF 3AAFA 2CQYA 4DQ2A 2LF7A 2EA4A 4X65H 5GTIC 5E3MA 2Z99A 4ED6A 4ZH4F 1IXSB 3SYTA 1QHHD 2O8KA 3PSFA 3NWTA 5KG3A 3PW5A 5L1IA 2FU4A 3RAXA 4AC0A 1IV8A 4XIDA 4EYIB 4C9YA 3AKZA 1HDDC 4FU0A 3KTMA 1T36A 2EFPA 4F7ZA 4B44A 3CF5F 4LSAA 2ID6A 3HSFA 3QYBA 5H6QA 3O2PE 4U0VA 2BHZA 2CUJA 4N4NB 1Q1HA 3V7RA 2JA6G 5L1LA 4C2UA 1TTYA 2P5LC 1MDMA 2BVLA 2K7LA 5F9NA 3K0LA 2XAJA 1GVJA 3QWLA 1XX5A 1AN7A 1Z3XA 2KRFA 4CZZA 2AGPA 3E5NA 3VPDA 2DU9A 5E3NA 4IQ4A 2HNHA 1VQ6I 1AUVA 2UXDH 3I55I 2XAHA 3FKIG 2K27A 1WSUA 1OR7A 2O0YA 1F1ZA 2HKOA 2V9VA 1RUOA 2ZBKA 4RNNA 4PWQA 5KG7A 4A3EJ 3CUOA 1ETOA 2CQ7A 1O3SA 3M9AA 1R9TA 5J4YA 4TV8F 4DV3H 1TP4A 1B33N 5FFZA 5HDGA 1FTZA 5LA6F 2B63A 4RB0A 3CUQA 2F6CA 2CZGA 4MV8A 4FTHA 1ZLKA 3CCQI 2GM4A 1E3OC 2QSFX 3SQNA 4X0GA 2GZWA 3OYMA 4RNOA 3EUKL 1Y0UA 5ERIA 4ZTJA 1F9NA 1TNTA 1YO5C 4D1QA 2E1MC 3O6BB 1XS9A 5IP7G 4DV6H 5HDKA 4AYBE 3IC7A 2DPDA 2I87A 2V7FA 5TISC 3RTRA 2VLAA 1JLLB 1BN5A 3DBRB 1USTA 4IR1A 3FK6A 2HU9A 2HPIA 1LPQA 5IYDG 5GAGJ 4Y4RA 4A2UA 1ZG5A 2CGPA 3FBNB 2XSDC 3RPQA 3IH4A 2LNBA 3ZQ7A 3L7WA 1E4EB 4DZPA 3GIIA 2L54A 2XF6A 1RYRA 1J5EH 5CJ9A 2FBHA 3TGNA 1Z1DA 4BKXA 1BI0A 4Q45A 4LIVA 5L3DA 3M8JA 1DPRA 4EM0B 5A2QZ 5B66C 1X2NA 4GLXA 2VUMA 4N4OB 4LIUA 3RKYA 3OHAA 4ECUA 3PFYA 3WHBA 4DJAA 1BJAA 4DW6A 2R7TA 3BG5A 4ZDLA 2AQFA 5KFYA 2LKPA 2LF8A 5LRRA 2P6SA 5JHFA 5C4JJ 2DOEA 3EUAA 4ESBA 1BNCA 1XPXA 3HGGA 2KIQA 4UHTA 1ZGWA 4YJ3F 2EINH 2P6TA 5CA1F 4U7DA 4B8XA 4MA5A 1AHDP 3TINA 5DUKA 4BACA 1JGSA 2GIVA 4NQWA 3RIRA 5BMZA 3GEZA 4V2FA 1IRFA 2R93J 4MV4A 4NXMH 2ZM6H 4L5EA 4ENKA 2J5PA 3E1SA 3MCZA 2XKPA 2YRXA 3OR2C 3SDGA 4LMYA 3RB3A 5GPAA 5B5EC 3D5SC 2W6OA 3KE2A 2CV0A 3TKYA 5LGNA 1QGPA 1UZCA 2MCTA 2XGQA 4BE1A 3IH2A 3PM1A 2VXZA 5D8DA 4LF4H 3F3XA 5CVUA 4DL4A 2L4AA 2N8GA 3Q0VA 1QNTA 2FSWA 1ZQ7A 3VPCA 5FJ8J 5KFFA 2L7ZA 2HQRA 2JRMA 2YU3A 1C0WA 3CDLA 3DTEA 1L3LA 3OYNA 4BHCA 3MKLA 1MNDA 3WTZA 5DQHA 1O3RA 5C4XG 1Z2PX 1TT0A 2E7XA 3H3VH 3MVPA 1ZELA 1X3ZB 2A3SA 2R0QC 3E6MA 4AD9A 3F21A 1XNRH 4JOMA 2CV1A 2DXIA 4I2OA 2R5ZA 3KZYA 2BVMA 3I59A 2E36A 2XGEA 3ELKA 3ZMVA 2IGNA 4A3CJ 4KISA 3E7LA 3ZMUA 2EJRA 1MBGA 4HSRA 2LREA 3TMOA 4UCUA 3H9QA 3LSJA 2ZDGA 2L7FP 2LH9A 2EV5A 1U5TA 4A3EG 3OUZA 2YU9J 1YJWI 1LEBA 1R5HA 3KHGA 4XRSA 3QU6A 4J9LA 2QSHX 2XHKA 2BZTA 2BW3B 2HTSA 2HYGD 5DM6F 1OR7C 1FYMA 3D5RC 4OINF 2MH2A 1Z2NX 3H0GA 2EZKA 2ICWG 2X6OA 5HLTA 4PK4A 2DPIA 4U0WA 4AUXA 4DIQA 2VKVA 5KG2A 4FQGA 5DG9A 2Y0SE 2NNYA 1ACIA 5FKLA 4C5BA 1D3YA 3G1LA 1JHFA 3MEXA 1E2XA 4XONA 3V8KA 3HOWJ 3MQ0A 1I50A 2L5QA 3VFZA 4JUZA 3LP8A 2D5VA 2IAIA 3CUQC 2BR0A 1BOAA 2DAOA 4UV9A 3AL0C 2DDAA 1C30A 2Y0SA 1A0IA 2IW5A 1YHQI 2WWYA 2O7OA 2P5KA 2E71A 3BR0A 4JI5H 2ZJPF 3RSNA 1FOWA 3ASOH 3KZIC 4ZDOA 4ME6A 1FBSA 1HKSA 5EZYF 2VBWA 2BBYA 2Y9YA 3J81K 4KFCA 2CV2A 2F4MB 2JPBA 2FF4A 5AIPA 4DR7H 2ATLA 2EFOA 1T98A 3KHLA 4LF8H 4G3IA 2V9PA 3ONQA 4NHJA 3JTHA 3SEQA 1HW1A 2DMPA 1K1SA 5J2TF 2VJIA 5EG0B 4LJZF 3T1HH 3HIFA 1BR2A 2DA3A 2VJ5A 1F5TA 2JEGA 3VSKA 3PR4A 2F5VA 3ISPA 4KT5C 4LG3A 1OYYA 3I56I 4JV2A 5KFVA 4E4HA 5ICFA 2EZIA 4LF5H 1J5YA 2JK3A 1VQPI 2LY1A 2YZMA 4DV4H 2X9DA 2VL8A 3PFIA 4LD5A 4MNUA 1Z7LA 4JI3H 5M5YJ 2Y48A 2D1VA 4B43A 3GV5B 2LG4A 2QLZA 3KX2A 4KIGA 2B63J 3GBGA 1LFBA 3IUOA 2PX9A 4TV7A 1ZRCA 4EGQA 4YHHH 2W71A 3E6BA 3K10A 4HX8A 4A2BA 2MLGA 3MKZA 3F6VA 2B0LA 2R93G 1QU3A 5L1JA 5JLXA 3JW4A 1YIOA 5EF6A 3CO7C 3OSNA 1KQ0A 3J81W 4I6ZA 1A31A 3VOEA 2GXBA 2E5NA 5GONF 3G4SI 4HEA2 3OS0A 2JQ7A 1SAUA 3C1DA 3KALA 2RGRA 3CCRI 2CUEA 1W5CC 2OTJI 1NHAA 1C3OA 3R0JA 4TUYF 3N05A 4PZJA 1FPQA 1S8NA 1ZTRA 3KZZA 1OQYA 2DW4A 2IXSA 3T5XA 4B09A 4QTRA 4ZJZA 2R7VA 5IWAH 2MC4A 1U78A 2PMUA 4CDGA 1D5VA 5FJ8G 4DR1H 1APLC 1V5EA 1KEEA 3CCSI 5HS7A 3BR3A 3P9IA 3J7AO 1LVKA 4UVAA 1IRGA 5HS9A 2W9AA 5KT3A 1XD7A 5DCMA 5IT9K 1ETXA 4BAYA 4BE2A 5KG6A 4RLFA 4GFBA 2IA2A 4Y17A 5LD2C 3LNQA 3GTOA 2IEKA 1WJBA 2O3FA 2FOKA 3H3ZA 3S1NJ 1EV7A 4A3CG 3U9TA 4XYMB 5GP9A 5FPOA 3KP5A 5M5XJ 3NRVA 2RDJA 2CW8A 3S3OA 4AWXB 2L7MP 4ZYDA 5FO5A 1QA6A 3KEOA 1CS0A 2QBYA 2W85A 5JI6A 5DTDA 4ZYHA 2P8TA 3CQZA 4C3IJ 4H4KC 1X9NA 2RQQA 2G0EA 2EILH 1YQAA 2NS7A 3FXUA 1W96A 2W9CB 2DA5A 2OJED 4F52A 6PAXA 3HOWG 3E5XA 3LWBA 3RB0A 2XGPA 4C30A 2IA1A 2M9HA 3A4CA 3DWLE 4U6PA 1VTNC 1O4XA 3VYSB 4MAMA 4MIMA 3JSPA 3J7AY 4I4TF 3V6KA 3R5XA 1OFCX 1SVOA 4IRDA 2MG4A 2DDBA 3CDIA 1I27A 2HWVA 4UUSB 1SFOA 2OQRA 1OPCA 2D1HA 2JVHA 3H20A 2XRLA 3FHZA 4K0KH 5LBQA 1IN7A 5EJCA 3K2ZA 3LSMA 3KP3A 3HUGB 1HF0A 4LG0B 2STTA 1HDPA 4D9JA 3U1KA 3MWEA 1B9MA 3L1PA 1Z6RA 3ZQGA 4L9JA 4RA2A 3HOZJ 3ZMDA 1MIJA 2ELHA 5FLXW 4DGWB 2C2EA 1O3TA 4BEHA 2JA6A 2CUZA 3GFMA 2UWMA 1USSA 4E4TA 4OU0A 5BMVF 4IZZA 3ZQFA 4HLYA 1DIKA 4L9TA 1J2XA 5HS8A 1DV1A 4JI1H 5K5RA 1OYWA 4D5FA 2R4GA 3FMAA 1WH7A 2FPPB 2W6QA 3DF8A 3F8BA 3NARA 2I10A 2CQXA 1S68A 5D5XB 3BQ0A 3FKIA 1W36C 1RKTA 4PUSA 5FRNA 3PUFA 5D6EA 3WGHA 3RUPA 3I4MG 4J9QA 3S16J 1D0ZA 1WVRA 2PN1A 1RRJA 2HYFA 2XSJC 1N48A 2VONA 1XNQH 2V1NA 5IY5H 3GYHX 4IHXA 1R23A 3AG1H 4DV2H 3KEYA 2RF4A 1D8KA 1U9OA 4RNMA 3ERED 2GXAA 2FQ4A 2QGUA 3JRAA 5KFMA 4XBFA 1FP2A 2O8XA 2DFHA 3GWZA 2A07F 4XLAA 1V55H 2K9LA 1IG7A 3DLLF 1Z9CA 2STWA 4QIWA 4DV7H 4GC7A 2Y69H 3S15J 4EG0A 2JUCA 4D5CA 3BG6A 4A3IJ 3SI8A 2OA4A 4XRMA 5E3OA 2VPSA 2UUAH 4JV1A 4DYCA 5LOVF 1B59A 1J09A 1YRNA 4KIFA 2AGQA 4C2TA 2EFWA 3TQTA 1LDJA 2GA2A 1U6GA 2CW7A 4ASNA 5K5QA 4ESFA 4L0ZB 1G4DA 3WGIA 4BUPA 1HKTA 5E1WA 3N40P 5E8GA 1KJ9A 3QOPA 3FISA 4I01A 4EFBA 3SZTA 1XDSA 1Z0XA 3Q8PB 1TQPA 3DXJF 3BG9A 1VI0A 5A2QK 4ZQIA 1AWCA 3N8DA 4O3OA 2F4OB 4QSHA 4ECSA 3TL4X 2WAEA 1H89C 4HV6A 1WR2A 2WAFA 5KFCA 5T14A 3DCFA 1N36H 2RVCA 5ICEA 1HNZH 1SFXA 2OCCH 3BY6A 1PP7U 9ANTA 2PG4A 3GZ5A 5F08A 3V4SA 1S7OA 2EWNA 1BJTA 2WB1N 4R79A 4L5JA 4HLXA 1X58A 3M9MB 1GLNA 2ME6A 2R5YA 3ABUA 3M3YJ 4PSXA 1I6HJ 3U1DA 1DP7P 1K83A 3H3VK 4RGSA 2R86A 1PK8A 3C0FB 2R7QA 3OIPA 2L3DA 4ZTFA 3OSPA 1DV2A 2IBKA 4M9XA 2FP4B 3OOPA 3WTVC 4KIBA 2P81A 2NRAC 4ZDPA 1TWCA 2EV6A 1TZLA 2HOTA 4C5CA 4PSWA 3OIOA 4CSWA 2PJPA 2R8HA 1T94A 3RAQA 2HR3A 1S0NA 1OLTA 2H6CA 2Y0MA 4P9FA 5FGMA 4UCSA 2BHYA 3CCUI 3GIPA 5J2UF 1A6QA 1GLVA 2HTJA 4DV0H 3HSEA 3PQKA 3HJEA 4M6VA 3ZN1A 4RBOA 1GO3E 2ZMEA 4U87A 2R8IA 3MZ8A 4L9VA 2XV4S 3W6VA 2Z33A 3OS2A 2VKEA 2OUMA 1S29A 4A3KJ 3CCYA 4P55A 3JTGA 4RM2A 2FK2A 5D6FA 3S32A 2VPLA 2ZFUA 3CQZJ 2F2EA 3J7YJ 2JVGA 1K61A 4FX0A 4MFDA 4EBCA 5CVIA 2V26A 3BP8A 1BR1A 1D1CA 2DA1A 2QQ8A 2Q2EA 3K5HA 2XKOA 1GXQA 2V1UA 1K4TA 4IRGA 1QO0D 4Q44A 4BBRJ 2FLLA 2FQ3A 2RQPA 2XB5A 3SXYA 1KA8A 1XMQH 4KN7X 3JAMW 4XKCA 1F36A 2NVYA 1VQ8I 3BTCA 1BIBA 1QZYA 3A1YA 2F4IA 2E1OA 3RKXA 1RK5A 4N9HA 3ECHA 3S3MA 3BCAA 4WWCA 2H94A 1SFOJ 1X1PA 4M9ZA 1MJ9A 3IRRA 4EBDA 1GDTA 4MEXF 2J6SA 1BC7C 1YG2A 1I7NA 2GPWA 2VB6A 3QPSA 5DDGA 4LK1F 4G7ZF 3FXQA 1P2FA 4JI8H 2CQKA 1LDDA 2OWOA 4A3IG 1VQLI 3OTOH 3QZ7A 5KVRA 2M8EA 4YFNF 2BGCA 1IN6A 1X4OA 4HDVA 4G8XA 4Y15A 3K4LA 1GSHA 4OIPF 3K1PA 2R6FA 3GFLA 2IS6A 2Q8KA 3GLXA 2OQGA 3DP7A 4RGUA 1ZLJA 4KITB 4KT6A 4ETSA 5FLVA 3RGXA 3HPHA 1IO2A 2KLOA 3QPHA 3GTPA 3HHHA 5GTHC 2JN6A 1XGOA 1CF7A 2ADUA 4ITVA 3HOSA 3ZPLA 3DF7A 4L0YB 3BQ1A 2IBDA 3HM5A 4OMZA 2X51A 2J6UA 3F8NA 1R7JA 2DTZA 2UXNA 5KT4A 3GIKA 1S7EA 1FSEA 4KUMA 2PMZE 2MD5A 2WTFA 4FX4A 2VQDA 4Y52J 3W2WA 2DLNA 3AG4H 2QQAA 3HTUA 3A01B 4P5OA 3OYDA 1I7LA 2V9KA 3H5RA 1T8IA 1BJZA 4ECVA 2EV0A 1J59A 4M3EA 2FLPA 2CW0F 4QWEA 2DYRH 1U3EM 3CC2I 5F0FA 2DOFA 1OCCH 1QQIA 2NVUB 5JFRA 5TJJA 3EDPA 1X3WB 4WBNF 4O3SA 1DGRM 1ULZA 2M7AA 3MWMA 4MTEA 1Q1VA 3OYIA 4NUBA 3HRMA 3TEDA 3TDUC 4HDUA 1WJ5A 2H09A 5JLWA 1GGOA 2OF7A 1X1BA 1SD6A 1SMTA 2H6BA 2ISYA 1VQ5I 4WXHA 5D1OA 4J0MA 3M9NB 3IN5A 2ASDA 3V7CA 3NQOA 1T33A 2DYSH 5E1XA 2RGVA 4BU2A 1UELB 1OCTC 5ED4A 4OIQF 2DWCA 4DV5H 1MD0A 4ZZLA 4KYWA 4XK4A 1XN7A 4A3LJ 1R5GA 4DR5H 2VPQA 3UQ8A 3OV8A 1RI7A 4LFAH 4QPQA 2JWTA 2ZC2A 3JREA 1JKJB 3MFHA 2ZNZA 1WZ2A 4LFBH 4OWRB 3RPUA 2VQCA 2NYXA 3TO6A 4CYDA 5KT2A 2M4KA 1KJ8A 3ZQLA 3C18A 3GTGJ 3G73A 5CVRA 5KFAA 3ZCOA 2RAEA 3A0BC 1B8IA 3IWFA 3MR3A 3FMQA 4GCVA 3TQNA 4XLEA 3WODF 1IAWA 1E4GT 3A03A 3CCMI 3BROA 1MNEA 3SFIA 3D5LA 4RB2C 1R49A 1LKXA 1DU0A 4HF2A 3TO9A 1FOXA 2M87A 4G7OF 2ZMEC 4XM3A 3ZMZA 3TIGA 3B73A 2X48A 2J5OA 4C2MA 2CKZB 1VBHA 4JP0A 2UVVA 3GW2A 4A0YA 4X64H 4EJOA 5FLXZ 3TP0A 4CH7A 4OIOF 4BBRG 2JT1A 4F50A 2UVWA 2VUGA 1U8RA 4BQNA 1TWFA 2WYOA 2UXBH 4IPAA 3GIMA 4HOBA 4XKBA 1K83J 2CQQA 3T1YH 2BY0A 2VQEH 1M6VA 2EIKH 4W1UA 5DD8A 5KG0A 4HZFA 3TIIA 1W36D 2DQRA 4FETA 4Q4ZF 2GLOA 2EFNA 2MLKA 1R36A 4UVBA 3ASNH 1RESA 3R61A 2R84A 1F43A 1TWCJ 3IG0A 4HX7A 4AIKA 3BPVA 2R7OA 2AGOA 5M3MJ 4NDLA 3DV8A 4XKWA 1RK6A 1YITI 3G3ZA 5J1RA 1JXLA 2QZ8A 2XPUA 2OZUA 5EDWA 3GTLA 3GTKA 3MR6A 1XSVA 1E17A 5EWGA 4E7SA 4UUTA 1ITYA 3K69A 1O57A 3DEUA 2NS0A 1K78B 1HNXH 2LBFB 5C4XJ 1MZBA 1HC8A 1N56A 1GUUA 4K2EA 4U88A 2M45A 2LSOA 2VC0A 2DIKA 3L2CA 3ERMA 3I4NJ 3LSHA 1BA5A 4YRVA 4Y3OA 1ZRFA 1W7PA 2RKHA 5KFRA 2WB1E 3K3PA 1RR8C 3OYAA 4FHTA 2FD5A 4HBLA 1EUCB 3PW2A 1O75A 2HVQA 3LAPA 3OYGA 3OYEA 2HVSA 1I39A 2YZNA 5EDNA 1ZKGA 5BR8H 4OX9H 1YE9A 5ILVA 2NVYJ 1UC8A 4ED8A 2X6XA 2XASA 2D45A 4O2AF 3B02A 4WF2A 2WB1A 3I58A 4HYEA 4D0PA 4Y7NJ 5CVVA 4E7JA 4APMA 4YR0A 1LEAA 2OC6A 1I3AA 2GOXB 4IVNA 2WY8Q 1TWGA 3VYTB 1UFMA 3ESWB 1MNMC 3T0YA 1ETYA 2ZO4A 2ZDQA 3SJMA 2R8JA 2DTRA 1W93A 1JKQC 1FLIA 3QYEA 5F6FA 3S17J 4O3QA 5KFTA 3ZGKA 3S8PA 2DOAA 3TDZC 4FE7A 2ZSIB 3EPZA 1X1DA 3HL2A 3D0SA 3ORRA 4EBEA 4A3LG 4AQYH 1TT5B 4HAMA 2PBZA 4B3XA 3GTPJ 3HGYA 2RREA 3MR5A 2TDXA 3CCVI 2H27A 1JTXA 1T0FA 3EQLF 2IA0A 4XLPF 4IO9F 2UUCH 5KFDA 4J19A 2C35B 3K70D 2E2HA 3WHCA 2VOPA 1KU9A 4O3PA 3PJRA 2PJRA 3DBHB 2E34A 3Q0UA 4PJLA 2KIUA 3QP5A 1DU6A 1OCOH 3FHNA 2WTEA 1GSAA 1WJFA 2Y75A 4JQFA 5K7ZA 4CYCA 3HDDA 4E7HA 2XIGA 4UCVA 2QQ9A 1Y1WA 3R5FA 2HXIA 2X85A 3HOTA 2ALZA 1KC7A 4EEYA 3LAJA 4RMNA 3E97A 2KZGA 2W6ZA 2DPJA 4O4IF 2AO9A 4HNUA 1F4KA 4CC5A 3KIOA 2RC4A 2ACJA 2EA2A 3DEWA 2W6PA 3LSTA 4AVPA 4LLNA 2DA2A 4R1HA 4R8HA 1KONA 4A3MJ 1Z6TA 2K5CA 3BT9A 1KBLA 2GIZA 3EPGA 3UNGC 4DL7A 5C8YF 3OY9A 5F1JA 3QPTA 4XSZF 3JAMZ 1MSEC 2VKHA 3M9OB 5LXTF 2A6HF 5LHIA 4W97A 4DBRA 3CC7I 4Q5SF 4QIWN 3DKYA 1MJBA 1V54H 1XC5A 4ZYGA 2W25A 3GTQA 4HNVA 2JEJA 3M07A 4V19K 4LF9H 4IOAF 3BPXA 4HNTA 1T39A 1G6NA 1PVEA 2VJJA 2JZYA 5KG1A 3OYCA 1KZHA 2CWEA 4ABZA 5DS9A 1SAXA 5KFPA 2A69F 5FKMA 2IS4A 4II3A 3HOXJ 5KFHA 2F4VH 1LE8B 4XQFA 1WQ2A 4C2MJ 1FBQA 3S1RJ 3I4NG 3CLOA 1TWHJ 2IGMA 2XAQA 1YJNI 1NTCA 2YX7A 3RBDA 5IP9G 2PLYA 4CCJA 2M2EA 1UHSA 1J7KA 1HA8A 2GLTA 4QWAA 1TWFJ 2VE9A 2ZXIA 4ANJA 1E4FT 2L0KA 1Y8QB 3K2AA 4BJ6C 1H88C 4OMYA 2OCEA 2PBIA 5K5OA 3M4IA 4O4LF 1V5GA 2TCTA 1SD5A 1YS6A 1RJRA 3ETJA 1XMKA 2ASLA 5EEAA 2KRCA 3KYLA 1JJ8C 4CA0A 4RLQA 1B72A 3ZXSA 5CAEB 1I6XA 3TW6A 4J00A 3AYHB 4YBZB 4A12A 1FC3A 1XSXA 3ZP5A 1SEUA 1VQ4I 1I94H 3FKJA 4A2AA 3CLQA 4PJ0C 4A3FJ 4FE4A 5LYJF 2LTPA 3A02A 1G3SA 4C5AA 3IL2A 4R8UB 4RAYA 2FUG2 2VASA 3H1CA 3IP4B 3QP6A 3GTLJ 3GTKJ 2V4QA 4ZHQF 2XGDA 4EJUA 4IRCA 4PFOA 4JI4H 3JZIA 3SHFA 5C44G 1W0UA 2X4HA 1WJAA 1NH3A 4A3DG 2E5LH 3K4KA 2W6NA 1YX3A 5HBRB 3GIDA 4M6XA 4J9SA 3I3LA 4IHWA 4I0AA 5KNLA 4IHTA 4CCKA 1K79A 3FM5A 3J7ZI 1N32H 4CZCA 2COBA 3BJ6A 3V4ZA 2L02A 4KA4A 2DO7A 2YCHA 2OZ6A 3BZ6A 3OYLA 1TA8A 5KX5F 2W00A 5JVGF 3OYFA 1FSHA 2VKDA 2ZCWA 4I50F 1CQTA 2FE3A 2KISA 3CESA 1MBKA 3VDXA 1P6RA 1YW7A 4DOZA 4GRIA 4G7HF 1UAAA 2JA5A 2OD5A 5D1PA 4CCMA 3WU1B 1K4SA 3MKYB 5B1AH 5LLQA 1ZR4A 3IAM2 4J9PA 1ZN2A 2XAUA 3Q8RB 3MAJA 2FA5A 3HG9A 3RKQA 4MGRA 2GAUA 4AM3A 2K02A 5ILUA 3BR6A 4BH9A 1WSCA 3DTKA 3CZ6A 3IV5A 1TWGJ 5FRMA 2HEOA 2DJIA 5E79C 3GV7B 1QZZA 2EK5A 1SD7A 2WAQA 3S93A 1BI3A 1JUPA 2MYSA 2ZNYA 3LA3A 4PGHA 2AS5F 1WJDA 5LEJA 2XUBA 4XMYA 4IHVA 4QWDA 3OMYA 1LB2A 4A3MG 3CJNA 2PN6A 4O3NA 2R7RA 1Z67A 2LR8A 1A6IA 3I0TA 2OPTA 2LY9A 2VBYA 2R7XA 2M3AA 3Q3SA 2FKLA 5FKNA 3OIQA 4JX4A 4UB8C 2UXXA 4XOPA 2K3PA 3BG7A 1WFXA 4QWCA 2PFBA 2F5DA 2DMTA 1HXDA 1HW2A 2HFHA 2Q1ZB 3V42A 4RGXA 4GDFA 1E4EA 2IS1A 4OIRF 4XN0A 1EHIA 2ZSHB 4PJMA 2F5CA 2M1BA 2E2HJ 1FOYA 2CO5A 2VA3A 3TP3A 3JRCA 1PJRA 4YELA 1S0OA 2VN2A 4DBQA 3HOXG 3G1OA 2KZVA 3IRQA 4Q43A 1Y14B 3LA7A 5HLIA 1FMVA 3Q1KA 4Q48A 4MTDA 3KHHA 1EJ9A 4XYLB 3FWEA 5CQEA 4LLLA 1UNNC 3I53A 3CC4I 5BQTA 3K4BA 1MMSA 3OL4A 1Y1WJ 1FYLA 4F92B 1Z91A 2JRTA 1ULYA 2NVQJ 2W4SA 1JUMA 1I3QJ 2ESHA 2EPFA 3RCOA 2ESNA 2AQEA 2FEZA 3L2WA 1U5TC 1XGMA 3RKWA 2NOJB 4WXCA 2VOBA 2E5ZA 5FLXK 3GZ6A 3FXMA 3IH3A 2XRNA 2A05A 1PUFB 4XR6A 1FYKA 4HF1A 3BA8A 5KFJA 4EVIA 5EGOB 3L2RA 2BE5F 4EATA 2NXNB 2IVMA 3OS1A 3OYHA 1VFCA 4MHGA 4A3FG 1EZ1A 4A6DA 3C2HA 3W2AA 2ZJ2A 1SMYF 5D8LB 1NG7A 3OR1C 3ZQHA 1KU7A 1T6SA 5L9XA 3WO0A 1S0MA 2W9BB 2DMUA 2W57A 3GTQJ 2R7ZA 4JV5H 3H0DA 2R7WA 2DN0A 2IMWP 1HSJA 1VQMI 2R8KA 3KFWX 3K6GA 4BY1J 2R8GA 3LFKA 3T8TA 3SZGA 1R5ID 1JKRC 2EH3A 1IOWA 3B6CA 2F5FA 2VT2A 4FT8A 4M73A 2DZDA 2YW2A 3GUDA 4MV1A 3KHRA 1R58A 3P7NA 1ZRDA 4UY8I 1T56A 1HOMA 2EZLA 1HQCA 4CC6A 4IZOA 4C3HJ 4FBTA 5KFXA 2JSPA 4HG2A 1OYIA 5HLHA 1STZA 3I12A 1YW8A 4ZYEA 4PJNA 1KU2A 2HGCA 4YEJA 2V58A 4EJTA 4QW8A 1HBXG 3L2QA 5KAIC 4UV8A 2MC3A 3HBLA 2R7UA 2X1EA 5H2FC 4UUVA 4FS2A 1SFKA 1P8LA 4UB6C 2Y9ZA 2BW3A 3AG3H 1AUXA 2QVOA 4BHPA 2C2RA 3KAJA 4B1RA 1WH2A 3ZR8X 4FASD 1QBJA 2FPGB 3MWDA 3L00A 2HKXA 2KMUA 2DODA 1HKQA 5TGTA 3LFUA 5LP6F 1D5YA 4I76A 2ASJA 4XLCA 2O61A 2VBZA 2KP6A 2HOSA 1AKHB 4A93J 4MV6A 4QIWE 4B3MH 5H80A 2HHHH 2D2WA 1P4AA 3QYFA 3EETA 4E6KG 3JRFA 2EZHA 4EYHB 3WO1A 4PJJA 1XCBA 3OYKA 1OISA 1R22A 1JI8A 2UV1A 2WY7Q 4D7MA 3JSOA 1YOVB 2XCPA 5FROA 5DG8A 2R7LA 4JK1X 5DLGA 5EWEA 1Z3YA 2XPWA 5LL6b 1EH8A 4L9NA 2YYAA 5ICGA 4IRKA 2E1MB 2YS9A 3VYUB 1NK2P 3IKTA 2R7DA 4BQQA 2K40A 1D0XA 4II2A 5EG0A 2XGXA 1N78A 2M05A 3LMMA 4BL0B 3ZMSA 5BPHA 1Z77A 2JPCA 2W6MA 3JRXA 2L2OA 3HRSA 2E7WA 1W5SA 1ZYRF 3N97A 2JA5J 4XOTA 5KFUA 3GTGA 4M6YA 3ABMH 3BC8A 3WTSC 3COAC 3H9JA 3G6VA 3CDHA 3FDYA 1VZ0A 2Z1DA 4BDZA 3QODA 4DR2H 1Y1WG 2DT5A 3HC7A 3P9KA 2MH9A 1A9XA 2C22A 3WTYC 1VQNI 2V1XA 1P4XA 3V4GA 2JTVA 4DL3A 4B4CA 3REOA 2NU9B 5CYVA 3OSFA 5L3EA 4J9NA 2V5AA 1RUNA 4BGDA 3FDSA 2VE8A 1J9IA 1V4RA 1FNNA 3RF2A 1EYZA 3ETHA 3LSGA 1QRYA 5C3EG 2E60A 5F1RA 3QQAA 1BGWA 3L09A 1XB4A 5HDNA 4GKKH 4UVCA 1KJQA 3NAUA 4YAJB 2B9SA 1EKEA 3G1MA 1DPUA 1SFUA 5JVTA 3JRHA 2W70A 3FX3A 4ECRA 2C00A 2VQLA 1FX7A 2Z3YA 1FZPB 3P9CA 2CUFA 5DUIA 2NU8B 4IHSA 1IUFA 1JX4A 3HRTA 4BY1G 3JAMK 4HR7A 3UFXB 2FMLA 1XGSA 2KHMA 2WC2A 5KAFC 2VOOA 2I80A 1U0JA 4BWSC 3U2RA 1OJLA 5B1BH 5L3CA 4G6QA 3RQIA 3EYYA 2W48A 5H20A 1ZREA 3PVXA 3MFIA 2M0MA 2CU7A 1H8AC 2ZJTA 2RNJA 3GTMJ 3ORQA 5KFOA 4ECYA 2M30A 1TC3C 3RFCA 2UVRA 1BR4A 2PQ8A 2IT0A 1V9PA 1PUEE 4D7NA 5D5WB 2CFOA 4YP3A 4KDPA 1JT6A 5IOYA 4M7EA 1RC9A 4BE0A 4I09A 3HEFA 1IGNA 5D4SA 1JE8A 1SVMA 3M8EA 5F64A 4DYQA 4Z6YA 5JHUA 1QPIA 2R92J 1XDNA 4O2BF 2X6WA 1SD4A 2KJBA 1ZG1A 2FX0A 2LFBA 2VIXA 4TQSA 3W6KB 3EYIA 3BAAA 4IKFA 5KFBA 1MDMB 1MBFA 2W9CA 1S9HA 4EM2A 1IN8A 3FXRA 3QFFA 2QM3A 1MKMA 4AVZA 4O4HF 5KFZA 3HTSB 3R6SA 4PFPA 5HLGA 4CHUA 3MKWB 1LJ9A 3GZNB 4A93G 4EFEA 2LKSA 2HJWA 4IRIA 2R7ZJ 3PO3J 4A3BJ 5JUMA 2LLKA 5J3LA 4OOIA 3PO2J 1TWAA 3SZPA 3QRFF 5LFAA 1HR0H 4BDYA 5KFWA 2BV6A 4MQVA 2GBYA 4UUSA 3IHUA 5K2MA 1P7JA 3WNZA 4BS9A 1SEIA 1L0OC 2KRHA 3CCLI 5AIQA 1N33H 2XAFA 3OSGA 4YY3H 2DK8A 3CUQB 1ONVA 2WE6A 3OL3A 3AL0B 2H1KA 3S1QJ 5LHGA 4A5MA 3HUGA 4LG0A 3BDDA 2KIMA 2OLSA 3JSNA 2UUBH 4BJ5C 5F9LA 3CMYA 1WWXA 2Y2ZA 2HQAA 5J8CA 2HZDA 5L3FA 4B3AA 1UHWA 4J9RA 1ZK8A 2CS3A 1A36A 1GSOA 5ICCA 2JA5G 4GO1A 2LK2A 4XLFA 3NGDA 5J4VA 4HF0A 5IYCG 2NNNA 5IPAA 3BQ2A 2WV0A 3RYPA 3R4KA 1FTTA 4XLHA 2X1CA 4X1EA 4YR2A 4JI6H 4LF7H 3S2HJ 2WADA 4JI7H 3HKZN 1RETA 1MSFC 2R87A 3PNTA 3E0JB 3DBLB 5IT3A 3K4NA 1VAJA 3DQVC 4EJWA 3RJPA 3DFGA 2W24A 3FXLA 1IDZA 4ECQA 3K1MA 2HS5A 4NB5A 3GFIA 4YIFA 3F0CA 1OCPA 5CPRB 2CJJA 4J01A 3X2QH 1JIHA 3M7GA 1HNWH 2NS8A 3VPRA 4HX4A 4A5NA 3M4OJ 2LRDA 1TBXA 3A0HC 4S05A 3H9GA
chains in the Genus database with same CATH topology
1XGNA 4MV7A 3FZVA 1ZHQA 3N42B 4UCTA 3BJAA 3HHGA 4EQQA 4U0YA 3K1NA 1M0TA 1CGPA 3WU0A 4LB6B 2P7VB 4JI2H 3J80W 4DR3H 4RAZA 3F8FA 4RS8A 4I0BA 4YFKF 2DPUA 1HSTA 2G7HA 2Z9OA 4A0ZA 5CLSA 4RGRA 5ILSA 4WCGA 3KEQA 2XAGA 3WE3A 4LB5A 2VC1A 4Q47A 2EFQA 1U2WA 3N44B 5FD5A 2PEXA 3HRUA 1R00A 4Z2YA 3I59B 1XCVA 2O6GE 4LGWA 2R3SA 5DD4A 2PI0A 4HA8A 4DUYH 1U5TB 5BPDA 1YTYA 4ENJA 2HDCA 3F22A 4LSXA 4M71A 3LA2A 4MQ9F 3T8RA 3VODA 4MEYF 4LH7A 2ETHA 4IXAA 1VS0A 1IBKH 4UCRA 1W4MA 4LH6A 3I64A 2FNAA 3ZMTA 4KN4X 4HQEA 2DFIA 3KP4A 4L5IA 1MJAA 3KLNA 1P4WA 4EJVA 2YPRA 2CYYA 1YYVA 3E6CC 4IRHA 3GX4X 5J8FA 3RYRA 1ZG3A 1FBUA 4N0BA 3BABA 4UFZA 5LMUH 3KP7A 4G6DA 1HW5A 5CVJA 5LEKA 2HOEA 3BJOA 3GVAA 1TW2A 1OKRA 4GYGA 2A68F 5FB2A 1G3WA 3N41B 1KGSA 2RV8A 4QLCU 3ECOA 1FT9A 2FBIA 4Q0YA 3KP6A 1S3JA 5BOXA 4KHPH 3L2PA 1XMOH 3GF2A 2BYVE 4BQAA 1YW9A 2V1DA 4DV1H 5DCMB 1ON1A 3LQRA 3CVZA 3V8LA 1FP1D 3W6JB 2OBPA 1H9GA 5K1YA 3L4KA 2KIFA 1XSDA 4HQMA 4IF4A 1IW7F 1LDKB 1B1BA 5HVQC 1YFHA 3WG9A 2HVRA 3F8MA 5L3BA 4U7BA 4E70A 4UXNA 2QBYB 3DPLC 2GXGA 3I54A 5D4RA 2YX4A 3R60A 4M72A 2CSOA 1O7LA 5EEGA 2HZTA 1EH6A 2ZKZA 1IXRC 2K86A 3MFKA 4GXOA 4NXNH 4MV9A 1B4AA 4JYAH 1FKAH 5L3GA 4QWQA 1BBYA 2A61A 2M5WA 4YIIA 2COMA 3I4PA 4X66H 1TNSA 3SFZA 2Z5UA 3WTTC 1S7AA 1I1GA 1SYXB 5D5UB 2V6CA 4H0EA 5JR3A 1ZARA 3WGGA 3QU3A 1Z05A 1WKMA 1KU3A 4XLNF 3RIZA 2K4JA 1DUXC 5AONA 3N4MA 3JSLA 4B3SH 2UXCH 3Q9VA 4RB1A 2DI3A 3T1BA 1K78A 1LQ1A 2RDPA 2FNPA 3M8FA 3CTAA 3GFJA 4RB3C 3J80Z 3Q9SA 5D8KB 2IPQX 3L9FA 1IF1A 1GHCA 3GXOA 4I02A 5EEHA 5LGTA 1DDNA 1G3TA 1PDNC 2R7FA 3U9GA 2O03A 3KETA 4CICA 3CO6C 2EB7A 2XROA 3TOBA 4PDBA 2IP2A 1TQIA 1ODDA 4BHBA 1FY7A 1UHMA 1YLFA 1I5ZA 4DNCA 1KQ9A 2Q2TA 1TQMA 4GYIA 4BNCA 1RNLA 3DKWA 3O3KA 3KXYT 2UU9H 3E6DA 3I5UA 2GA1A 4O6JA 2KSWA 1RIOH 3ML6A 2HGSA 1IBMH 1UB9A 1KQ8A 5E1ZB 1Z2OX 5DYMA 1B6AA 1A04A 3F8CA 4LFCH 5DV5A 4L18B 2UZKA 2DLLA 2L01A 4RZQA 2X0LA 4M9SA 4P9UA 2ZMEB 5LGUA 5KK1A 1TLHB 4HV5A 3GO5A 2HQNA 5E17F 2Q0OA 1K7AA 3S2WA 4ON0A 1R1VA 2KKOA 4PGGA 4DR6H 4B3RH 1GYFA 1ZHSA 3FMRA 3QAHA 1D8JA 2AXLA 4O5VA 3ZN0A 3N43B 1LVAA 3H3UA 5IT9W 1SFEA 1JHHA 4IAJA 4EGYA 1IN5A 1S6LA 4O3MA 1Z7UA 3HXLA 2W84A 4G94A 1AOYA 2GQQA 4GGGA 3PN1A 3K3VA 3VB2A 2VBXA 4CO8A 5E18F 1CF7B 4Y13A 4EEQA 3WTXC 3WE2A 2A6EF 1TAEA 1P92A 3K9TA 1R1TA 3HSRA 3LQQA 1KYWA 3C7JA 1T2KA 3TOAA 3V7SA 5D5VB 3RTXA 1KYZA 3FMSA 1FVIA 1H9TA 4UNOA 4AIJA 2V79A 2MBFA 2GWRA 3HYIA 4AIHA 1S03G 3FF5A 3H92A 3L4JA 5D1OB 2Q2UA 2YSRA 4X62H 1FOKA 3KCCA 1GXPA 1IZ1A 2MA3A 5E20A 2E1NA 1IUYA 2IRFG 1FJGH 3NEUA 1L2ZA 4ESJA 3E5UA 2ISZA 3MZHA 5EOYA 4CXFA 3ROUA 2QWWA 4XSXF 2E1CA 2IJLA 4G9YA 4EGZA 4CGZA 1ZGJA 1W7PD 2FBKA 2A5YB 5HOOA 3N6XA 1W5TA 3Q5FA 2QYOA 3FM3A 2VT3A 2FMYA 5TRDA 2P7CB 2QENA 1X3UA 5LMNH 3IWZA 4FM9A 3WTWC 1BM9A 3EUHA 5FPRA 1TW3A 3ABTA 4R7RA 4HW0A 5DEQA 4EM1A 3LMLA 2WDTA 3C3WA 4A0XA 2L4MA 3I71A 2VODA 2K4BA 3F72A 4JBAA 1XMAA 1IXCA 1O7FA 1IN4A 5BPIA 2YR2A 3V8JA 3J7AK 1I6UA 4EV0A 3BA9A 3E5QA 1WI9A 3F6OA 1UCRA 1N34H 5A2QW 3ULQB 5LHHA 2G7UA 1B9NA 4YG2F 1ON2A 2G9WA 4XRFA 5LRSA 2LDUA 2PMHA 2OU2A 4P96A 1BJTA 2VQFH 1J0RA 4KNYA 4LFUA 2JSCA 2RN7A 4LF6H 4BYYA 3WTUC 2ZFWA 4JI0H 4DUZH 4EMSA 1W7PB 2P4WA 5BS6A 1IBLH 4S04A 4A6EA 4BXUA 4M74A 3RJ0A 4PCQA 1PP8F 1RZ4A 1BI1A 1ZH5A 2KJCA 2DBBA 3BOQA 2CG4A 3RGZA 1O3QA 1BC8C 4KICA 4I7HA 1T38A 4PDKA 1ZGAA 2CFXA 3PQJA 4N9IA 3J81Z 1I1SA 1H0MA 3J80K 2NAZA 2BEOA 4I98B 2F5EA 3KP2A 1ZHFA 1B04A 3KLOA 3M1EA 2C6YA 3VEPA 2FXAA 2OAZA 1FWZA 5J6XA 3LWFA 1OMIA 1YS7A 1ZAOA 4ENNA 3BWGA 1BIAA 3MZYA 3TO7A 2XVCA 2QUFA 5H6RA 1BI2A 1M0WA 3F23A 3KAKA 2ZXJA 4DR4H 1DGSA 4WX9A 2FRHA 4B3TH 1QPMA 4IJAA 5FFXA 4UCOA 3E3VA 2DK5A 3DPTA 4WXDA 5E8IA 4ENMA 1G3YA 4LLGF 4WK8F 5DCFA 5IT9Z 4KMFA 4ZZDA 1K6OA 3R0AA 1JXSA 4LK0F 1LNWA 1J75A 1R1UA 1REPC 2QQBA 3IKVA 4GKJH 1XDUA 1MGTA 1WRJA 2P5VA 3RDIA 1V3FA 3RI4A 5FD6A 1EH7A 2DQLA 4KMUX 4YFXF 3AAFA 4DQ2A 2LF7A 2EA4A 4X65H 2Z99A 4ZH4F 1IXSB 2FU4A 2EFPA 4F7ZA 4LSAA 5H6QA 3HSFA 3O2PE 4U0VA 1Q1HA 3V7RA 1TTYA 2P5LC 1MDMA 2K7LA 3K0LA 2XAJA 1GVJA 1AN7A 2KRFA 4CZZA 2DU9A 2UXDH 2XAHA 2K27A 1WSUA 1OR7A 2O0YA 1F1ZA 2HKOA 2V9VA 1RUOA 2ZBKA 3CUOA 1O3SA 3M9AA 4DV3H 5FFZA 5HDGA 4RB0A 3CUQA 1ZLKA 3SQNA 2GZWA 1Y0UA 5ERIA 1F9NA 1TNTA 1YO5C 3O6BB 4DV6H 5HDKA 3IC7A 2DPDA 3RTRA 1BN5A 1USTA 4A2UA 1ZG5A 2CGPA 3RPQA 2LNBA 3ZQ7A 3L7WA 2L54A 1J5EH 5CJ9A 2FBHA 3TGNA 1Z1DA 1BI0A 5L3DA 1DPRA 4EM0B 5A2QZ 4GLXA 3RKYA 1BJAA 2LKPA 2LF8A 5LRRA 2P6SA 4ESBA 4UHTA 2P6TA 4U7DA 4B8XA 5DUKA 1JGSA 2GIVA 4NQWA 3RIRA 5BMZA 3GEZA 1IRFA 4NXMH 2ZM6H 4ENKA 2J5PA 3MCZA 2XKPA 4LMYA 3KE2A 3TKYA 5LGNA 1QGPA 2MCTA 2VXZA 4LF4H 3F3XA 5CVUA 2L4AA 1QNTA 2FSWA 2HQRA 1C0WA 2YU3A 1L3LA 4BHCA 3WTZA 1O3RA 1Z2PX 2E7XA 2A3SA 3E6MA 4AD9A 3F21A 1XNRH 4I2OA 3KZYA 3I59A 3ELKA 3ZMVA 3ZMUA 2EJRA 4UCUA 2EV5A 1U5TA 1LEBA 1R5HA 3QU6A 2XHKA 2HTSA 2HYGD 1FYMA 4OINF 2MH2A 1Z2NX 4U0WA 2NNYA 1D3YA 3MEXA 1JHFA 3V8KA 1E2XA 3MQ0A 3VFZA 3CUQC 1BOAA 2DAOA 4UV9A 1A0IA 2IW5A 2WWYA 2P5KA 4JI5H 1FBSA 1HKSA 2VBWA 2BBYA 3J81K 4KFCA 2JPBA 2FF4A 5AIPA 4DR7H 2EFOA 1T98A 4LF8H 4NHJA 3JTHA 3T1HH 1HW1A 4LJZF 3HIFA 1F5TA 3ISPA 4KT5C 1OYYA 4LF5H 5ICFA 1J5YA 4DV4H 3PFIA 4LD5A 4MNUA 4JI3H 2Y48A 2D1VA 2QLZA 4KIGA 4TV7A 1ZRCA 4YHHH 3E6BA 4HX8A 4A2BA 2MLGA 3F6VA 2B0LA 3JW4A 1YIOA 3CO7C 1KQ0A 3J81W 3VOEA 2GXBA 3C1DA 3KALA 2RGRA 1NHAA 3R0JA 4PZJA 1FPQA 1S8NA 4B09A 3KZZA 2DW4A 5IWAH 3T5XA 4DR1H 1U78A 2PMUA 4CDGA 1D5VA 5HS7A 3P9IA 3J7AO 4UVAA 1IRGA 5HS9A 1XD7A 5DCMA 5IT9K 4BAYA 2IA2A 4Y17A 2O3FA 2FOKA 3H3ZA 1EV7A 5FPOA 3KP5A 3NRVA 2CW8A 4AWXB 4ZYDA 5FO5A 3KEOA 2QBYA 2W85A 5JI6A 4ZYHA 2P8TA 1X9NA 3FXUA 1YQAA 6PAXA 3E5XA 2IA1A 1VTNC 3JSPA 1I27A 2HWVA 2OQRA 1OPCA 2D1HA 3H20A 3FHZA 4K0KH 5LBQA 1IN7A 3K2ZA 3KP3A 4LG0B 2STTA 1B9MA 1Z6RA 4L9JA 3ZMDA 2ELHA 5FLXW 1O3TA 3GFMA 2UWMA 1USSA 4OU0A 4HLYA 4L9TA 1J2XA 5HS8A 4JI1H 5K5RA 1OYWA 3FMAA 3DF8A 3F8BA 1S68A 5D5XB 5D6EA 3WGHA 2HYFA 2VONA 1XNQH 3GYHX 1R23A 4DV2H 1D8KA 3ERED 4XBFA 1FP2A 2O8XA 3GWZA 2A07F 1Z9CA 2STWA 4DV7H 2OA4A 2VPSA 2UUAH 1B59A 4KIFA 2EFWA 1LDJA 2GA2A 1U6GA 2CW7A 4ASNA 5K5QA 4ESFA 4L0ZB 1G4DA 3WGIA 1HKTA 5E1WA 3N40P 5E8GA 3QOPA 4I01A 4EFBA 3SZTA 1XDSA 1TQPA 3DXJF 5A2QK 1AWCA 1N36H 4HV6A 1HNZH 2RVCA