4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
molecule keywords Peroxide stress regulator PerR, FUR family
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
3CJNA 3RYRA 3HSRA 1J0RA 5CVUA 1GXQA 2IVMA 3COAC 2K7LA 4KN4X 3G3ZA 4RAZA 2LF7A 4MTEA 2V1UA 5J8FA 2L54A 1CGPA 4S04A 4I98B 1SD5A 3ZMVA 3WTTC 1QGPA 1KQ8A 2BV6A 2VN2A 2KKOA 2YR2A 3ZMZA 1PDNC 1O7LA 1P4WA 2ISYA 3M9AA 3RKWA 2DTRA 5LHHA 2F5EA 2XAFA 1OPCA 3WTUC 2M5WA 1XB4A 5CVJA 1XMKA 5HDNA 3L09A 2DPUA 2G7HA 3JSPA 4TV7A 4EGYA 2JRTA 3CO7C 3WODF 3LAPA 2D45A 2H6BA 3QAHA 4CXFA 1IUYA 3I71A 4EMSA 1XCVA 1P4XA 4HDVA 1TNTA 1Q1HA 4A2UA 2ADUA 2GA2A 1GVJA 4R79A 2HKXA 3BOQA 1B6AA 2IJLA 4MQ9F 1XGNA 5DUIA 2PLYA 2Z9OA 2WC2A 4LG0B 2YX7A 1GXPA 1U5TC 1OYYA 1W7PD 1Z7UA 1G3WA 1QNTA 4I0BA 5HOOA 3WE3A 3WTWC 4EGZA 1IRGA 1T39A 2CGPA 2ISZA 1G4DA 1IAWA 3EUHA 1TNSA 2IA0A 1TQPA 3WE2A 4L9NA 3F21A 1TQIA 3E6DA 2ESNA 4BQAA 4BHPA 4HF1A 4LLGF 1SD6A 4EJTA 1LB2A 3WTVC 2PI0A 4BH9A 3JW4A 2XGXA 2LNBA 4UVBA 3LSTA 4UV9A 2BBYA 3DKWA 4IJAA 4NQWA 3FHZA 3ECHA 1ZG3A 1RIOH 1R58A 3PQKA 4KIGA 1KU2A 3WG9A 3BY6A 1TW2A 4YFXF 3MEXA 3WGHA 3KEQA 4XSZF 4L0ZB 4RB2C 3FF5A 4U0WA 5L3CA 1YS7A 5HLGA 5D6FA 4RGRA 1IN5A 1XGMA 3E6CC 1LQ1A 3R0AA 4LD5A 2E1CA 2MLKA 5HS9A 2F5CA 1R00A 2OZUA 2ESHA 5FLXK 4JK1X 2K4JA 3BDDA 3DF8A 4KT5C 3PFIA 5HS8A 3MWMA 3E5QA 3M1EA 4BHBA 4EJUA 3GVAA 5EEHA 3W6KB 2L3DA 1YIOA 4RAYA 1ULYA 4B09A 3F8BA 1MGTA 2FNAA 4M6YA 3RDIA 1G3SA 2Y48A 2Z99A 5DEQA 2HOEA 4IRIA 3J80K 1ZHFA 2VOPA 1ZLJA 4I09A 5ICCA 2HEOA 1HXDA 3T8RA 2O61A 4ZYHA 1BM9A 3FMRA 5F64A 3HUGA 5E17F 1BBYA 4JQFA 1IN6A 1O57A 3F8CA 3E6MA 2M8EA 1OYIA 3F72A 4EQQA 4HA8A 2NNYA 1HSJA 4YG2F 1IW7F 1CF7B 4F7ZA 1XDUA 4LGWA 1TTYA 1SMTA 1SD4A 5FO5A 3BP8A 5K5OA 1E2XA 4CYDA 2ZFWA 2G9WA 1MDMA 2STTA 2DFIA 4I2OA 1I27A 1T0FA 2Z3YA 1S3JA 4MNUA 5F6FA 1ODDA 4U7BA 2H6CA 2L4MA 2LDUA 3ZMTA 2FMYA 1K7AA 3ECOA 2EFNA 2Y0MA 1ZLKA 3I54A 4BHCA 2ELHA 4ZH4F 1O3QA 3HSFA 2JZYA 4A6EA 3T5XA 4XBFA 3J81Z 4ESJA 1X3UA 4M9XA 2A6EF 1U5TA 2XAGA 1O3SA 1PP8F 1LNWA 1YLFA 5CJ9A 2GZWA 4NB5A 3F8NA 2JPCA 1QPMA 1AOYA 4D0PA 5L3FA 4GCVA 1U2WA 4OIPF 1YO5C 3M7GA 1FBUA 3HOTA 4KMUX 4IHTA 2DK5A 2ZO4A 1BI0A 2RDPA 4PCQA 3HTUA 1S7OA 3CO6C 2FNPA 4OOIA 1FSHA 3CUOA 1FBSA 5JI6A 3L7WA 2IW5A 1R1VA 3QPHA 3GWZA 3FXUA 3FWEA 3ZN1A 4HF2A 3F23A 3DPTA 1FLIA 2YPRA 3KEOA 1JXSA 3FM3A 1E17A 2Q8KA 4HAMA 3GFMA 1DPUA 2FF4A 4CICA 4KYWA 4G94A 3NQOA 2UZKA 3RYPA 4WF2A 3I53A 1R5HA 2KRFA 2DO7A 1T2KA 5LLQA 5DD4A 1YG2A 3DQVC 3EQLF 3CTAA 4L5IA 5D5WB 1XSVA 1B9NA 4WWCA 4G8XA 3B02A 3IKVA 2L02A 3AAFA 1PP7U 2E1NA 1BJAA 4CGZA 2H27A 2BE5F 2HFHA 1XSXA 3SQNA 1T6SA 4QWQA 4LLLA 3ELKA 1MZBA 1YS6A 2GWRA 3KP7A 2XKPA 5LBQA 4DNCA 2TDXA 5ICGA 1ONVA 2NAZA 4EV0A 5L3BA 3MZYA 3O2PE 5HLIA 2DW4A 5AIPA 4RGSA 4A5MA 4HDUA 4U0VA 1P4AA 3IWZA 1R36A 3TO9A 5DV5A 3KP6A 1JHFA 2PQ8A 2P8TA 1SFUA 5D8KB 1F5TA 3DP7A 2JT1A 2F5FA 3I59A 4LB6B 1UFMA 2R7FA 5ILUA 4P55A 3EYIA 2HQNA 3KE2A 4R8HA 4GGGA 2DLLA 4CO8A 5JFRA 3I64A 3IL2A 5K5QA 4IVNA 1MD0A 5J6XA 2QWWA 2HYFA 2QBYA 1BIAA 2RNJA 3D5LA 3K1NA 1R1UA 4XLPF 1FSEA 5LGTA 3I0TA 2ACJA 1DPRA 2FQ3A 1FY7A 2VT2A 2W25A 1WWXA 4EJVA 2O03A 3K9TA 4N9IA 2VBZA 3LFKA 3C1DA 1W5TA 3BPVA 4G6DA 4CHUA 2CYYA 3BWGA 4P9FA 1FYMA 4Z2YA 1REPC 4IHSA 1LDJA 3ZPLA 1U3EM 5ILVA 3E6BA 2ZXJA 1V4RA 4HV5A 1H0MA 5LRRA 1W7PA 2OBPA 5IT9Z 2VBXA 5E1ZB 2WWYA 1B1BA 3E5XA 2EV5A 5D4RA 3ISPA 4O5VA 5E8IA 2HZTA 4KUMA 3HHHA 1USSA 4L9JA 3KP4A 3HOSA 3RI4A 1OYWA 2ZJ2A 3BZ6A 1Z9CA 1LDDA 2X0LA 3ZP5A 1LEBA 2GAUA 3G73A 2K4BA 3GO5A 5L3DA 1J75A 3GW2A 5AIQA 3KCCA 4ZYDA 4L0YB 4DQ2A 3F6VA 3TOBA 4EM1A 1J59A 2UXNA 4HX8A 3TOAA 2NRAC 1W5SA 2A61A 3Q9SA 3BJOA 3QRFF 1JGSA 1O7FA 1K78A 3W6JB 4AIKA 1FPQA 1OR7A 2RGVA 3ZQ7A 4ESFA 2V1XA 3LQRA 2CW0F 4AD9A 4KNYA 1XCBA 2C6YA 1I6XA 5A2QZ 3TO7A 2HTSA 4LK0F 2GQQA 3HRUA 3GEZA 2NS0A 2DI3A 4M9SA 4JBAA 2ZKZA 1DP7P 4HYEA 4MEXF 2V1DA 1EV7A 4FT8A 3RIRA 1O3TA 4U0YA 4UVAA 2O3FA 4WXCA 2PFBA 4GXOA 1ZARA 2XRNA 1QZYA 1IXRC 1HBXG 5K1YA 4A0YA 1L0OC 4IXAA 1DDNA 1FC3A 3L2CA 1XGOA 4S05A 1JE8A 3RPUA 2V6CA 4WCGA 3CDHA 4KA4A 5LRSA 1K79A 1AWCA 3LAJA 3N97A 2VONA 3VOEA 2A68F 5ICFA 4FHTA 1WKMA 5BMZA 3L00A 5DD8A 2HWVA 3O6BB 1RUOA 1ZAOA 4LB5A 2MC3A 1QBJA 2JPBA 1NHAA 3OV8A 5JVTA 1ZH5A 3ML6A 5K5RA 3WGIA 2F2EA 2IPQX 2M87A 3NRVA 3J81K 2P7VB 3I5UA 2FU4A 3EDPA 1KA8A 1KGSA 2W57A 2XAHA 3P9IA 4K2EA 1P6RA 4PDKA 1XN7A 3FXQA 4OMZA 1P92A 1IRFA 5D8LB 2J5PA 1B9MA 1U8RA 4HV6A 4Q48A 3RPQA 2EV0A 1HKQA 1BC8C 2A5YB 1J2XA 3R61A 4M71A 4XLNF 2JSCA 2FXAA 3CUQB 3TGNA 1ZG5A 2KJBA 1ZRDA 2VODA 2QLZA 5FGMA 3T8TA 2CG4A 3P9CA 2EA2A 2G7UA 2YSRA 3SZTA 1MDMB 3KZZA 3IRRA 3KP3A 2PBIA 4WXDA 4N9HA 2D2WA 4NHJA 5DCMA 4WXHA 1MJAA 2OU2A 5LHIA 3QP5A 1K78B 2STWA 3QOPA 3ROUA 2QYOA 5EEGA 3SFZA 3JTGA 3LA7A 1G6NA 1ZRCA 4WX9A 5BOXA 4A0XA 2IA1A 2ZMEA 2BYVE 4G7OF 4KMFA 1WSUA 4AVPA 2DT5A 1SD7A 2DK8A 2LSOA 2QQ9A 3TO6A 3ERED 4L9VA 5J8CA 1XD7A 2QM3A 3KP2A 3RKXA 2A07F 2PJPA 4HOBA 4Y15A 2E7XA 2VBWA 3B73A 3FZVA 2Q0OA 2GIVA 3DEUA 5IT3A 2E7WA 2LF8A 4HZFA 5IT9K 1I5ZA 5HLHA 3KFWX 4RB0A 3FM5A 1IXCA 4I0AA 1KU9A 2OQRA 4KIFA 2AS5F 4HW0A 2HYGD 4XRFA 4RB3C 1OKRA 3CUQC 2MH9A 3HRSA 4I02A 4R1HA 4AIHA 4L5JA 5KVRA 3FXRA 2XUBA 3DV8A 3F8FA 3R6SA 1KU3A 2FEZA 3Q9VA 2MA3A 2V9VA 3JSOA 4G7ZF 4HLXA 3GYHX 2QBYB 1KYWA 1BN5A 3QPTA 1IN7A 3BJ6A 3QP6A 5DDGA 2Z33A 1R7JA 1LVAA 2OAZA 2Y75A 5BS6A 4LLNA 2F5DA 3GXOA 1JHHA 2KJCA 3KP5A 3O3KA 2RN7A 3K0LA 1FBQA 2FMLA 4IF4A 3NEUA 2HKOA 2CSOA 3TDUC 4M6XA 4ENJA 2YX4A 1A04A 3KZYA 3T1BA 4ENKA 3SHFA 3VEPA 4UNOA 3GF2A 4YFKF 3MCZA 5A2QK 2DU9A 2BGCA 1SAXA 3V8JA 2XV4S 2VC0A 4IRHA 1YW8A 1BOAA 3V7CA 3V8KA 3ZMDA 2P5VA 3K1PA 4EM0B 4EM2A 4OIRF 2HS5A 2K02A 1ZGJA 1BI2A 2NYXA 3U9GA 2RVCA 4RB1A 2IRFG 1HQCA 3SZPA 4P5OA 4PZJA 5F1RA 1R22A 1CF7A 2P7CB 4WK8F 2RQPA 4BAYA 2GA1A 3L9FA 1O3RA 4ETSA 2QZ8A 3WU0A 4GYGA 2PEXA 3FMQA 2WTEA 1TQMA 3N4MA 1STZA 1H9GA 1HW2A 4IRGA 3BROA 3HRMA 4BXUA 2M1BA 2OA4A 4KDPA 4U88A 1HSTA 3E5UA 4LK1F 1U6GA 1SMYF 3K69A 1TW3A 3H3ZA 3C18A 2HR3A 3CLOA 5FB2A 3R4KA 3PQJA 3DFGA 2D1HA 3TDZC 2EFOA 1F9NA 4P96A 2QVOA 4EJWA 2DPDA 5H20A 2Z5UA 3RJPA 3WTYC 4ENMA 4KIBA 2KIUA 3P9KA 1ZN2A 5FFZA 2XAQA 3RKYA 2CWEA 3T0YA 2OQGA 2PG4A 3ZMSA 3F8MA 2MD5A 2CO5A 4UVCA 1OMIA 4P9UA 1V3FA 4B8XA 5HDKA 5CVVA 4HBLA 2XROA 5LEKA 4CZZA 2QUFA 3D0SA 2NNNA 3MAJA 2DQRA 3HRTA 3FMSA 5HS7A 1UHWA 4Q5SF 4BYYA 2UXXA 4OINF 4E70A 3LA3A 2DAOA 2GXGA 1UCRA 1J5YA 5LEJA 4N0BA 1FYKA 1Z6TA 4A6DA 4M9ZA 1J9IA 1KQ0A 1T98A 5HVQC 1D3YA 5DCFA 5CVIA 4CDGA 2EFWA 3VODA 3R60A 2W84A 4O3MA 2EB7A 3ABUA 1FT9A 2IP2A 3WTZA 1IZ1A 2VXZA 5ILSA 2XHKA 4ZYGA 2RC4A 1HW1A 3KETA 2CFXA 1T38A 2IT0A 3GFJA 2EWNA 5E1WA 4OIQF 1S8NA 1YW9A 1YFHA 4Q4ZF 3EYYA 2FRHA 1F1ZA 5H6RA 1ZYRF 3M8FA 2COMA 4A12A 4AIJA 3GZ6A 3R0JA 5CLSA 5D5XB 3V4GA 3WU1B 2R7DA 2VE9A 4XSXF 5HDGA 1HKSA 4LFUA 3J7AO 1BI1A 1TBXA 2DQLA 2ZNZA 3IKTA 1MJBA 4I7HA 2QQAA 1K6OA 3GFIA 1YTYA 2L4AA 1RNLA 3U2RA 5LHGA 2MH2A 3BJAA 2M30A 1BIBA 2HGCA 3WGGA 4H0EA 1RUNA 2FOKA 3ABTA 3M8EA 1FOKA 1KU7A 1QZZA 2O8XA 4A0ZA 1H9TA 3TKYA 2H09A 1B59A 1U5TB 6PAXA 2M45A 1L3LA 1QQIA 3QU3A 3U1DA 1U78A 2PMHA 2P4WA 1IXSB 1UB9A 4M74A 3REOA 1FYLA 3DXJF 1XDSA 4BNCA 1PUEE 2O0YA 3P7NA 3BPXA 3GFLA 4UV8A 2W85A 2X4HA 1LEAA 3GLXA 5FD5A 1FWZA 2Q2EA 1FP2A 4IPAA 2FBIA 1IN4A 4HF0A 3RTRA 5BPDA 4YFNF 5FD6A 4ZYEA 2BEOA 1YW7A 1XMAA 5ERIA 2EFQA 5D4SA 1ON2A 4G6QA 5CVRA 4LJZF 2EK5A 3VFZA 4UXNA 2V79A 1J7KA 3CUQA 2KIMA 3K2ZA 3MFKA 1RZ4A 4MTDA 4OIOF 2VT3A 5L3GA 4KFCA 5CYVA 2UWMA 4L9TA 1IN8A 1ZG1A 3QU6A 5D5VB 3E3VA 1DUXC 1GHCA 2D1VA 1R1TA 3HHGA 3JAMK 4M73A 3TQNA 5D6EA 2XASA 4Y17A 3S2WA 2A69F 1D8JA 1I1SA 4RGUA 2ZNYA 3C7JA 1P2FA 1HKTA 3JAMZ 2K86A 2XKOA 5DUKA 2HDCA 2H94A 4G9YA 3V7SA 3H3UA 1YYVA 2R3SA 4GO1A 1HW5A 4OMYA 5E18F 1WQ2A 1I1GA 1C0WA 1S7AA 1Z91A 1WRJA 1S29A 4YIFA 4EVIA 2HQRA 4ON0A 1D8KA 4A5NA 2RV8A 2VOOA 2YU3A 3I4PA 4HQMA 1G3YA 4M72A 3F6OA 3HSEA 1ZGAA 5LGUA 3FX3A 3EETA 3KLNA 2P5LC 1G3TA 1WI9A 4KN7X 5H6QA 1MKMA 5JR3A 4MHGA 2O6GE 2QENA 3WTSC 1SFEA 1LJ9A 3SXYA 5DCMB 3K1MA 2B0LA 3VB2A 4UHTA 4PGGA 2VC1A 5D5UB 2JTVA 2FA5A 3H92A 4O6JA 2OD5A 3LWFA 5E1XA 4RGXA 2WV0A 3E97A 3IWFA 2ETHA 2XIGA 1ZREA 4ZZDA 5L3EA 3IHUA 2A6HF 1QO0D 2RKHA 3C3WA 1VTNC 2VBYA 2FSWA 2PMUA 4UUVA 2ZBKA 2XVCA 2VE8A 1EH8A 1ON1A 4PGHA 4HX7A 4GYIA 5AONA 2XAJA 1S6LA 5BPIA 5KK1A 4HLYA 4I01A 4FX0A 1EH7A 3LQQA 2FBKA 3GZ5A 3OOPA 3WTXC 3F22A 3Q5FA 1W7PB 1BI3A 5BQTA 1XGSA 1RI7A 1TLHB 5E8GA 4YIIA 1BC7C 1FX7A 4QLCU 4RS8A 2J5OA 4MQVA 2LKPA 5LGNA 1KQ9A 2P6TA 1KYZA 1R23A 3ZN0A 3JTHA 4G7HF 2IA2A 3HYIA 3MQ0A 5TJJA 2GXBA 1USTA 2MBFA 4Y13A 2ZCWA 4AWXB 4ZZLA 5ICEA 2MLGA 2AXLA 2OZ6A 3IRQA 4FX4A 1EH6A 1D5VA 2W24A 1LDKB 4HX4A 3ZMUA 5E20A 1R5GA 1W4MA 3I59B 4EJOA 4Q47A 3V8LA 3HTSB 3V7RA 2EA4A 2P6SA 4OU0A 3IC7A 5TRDA 1F4KA 1Z1DA 1XSDA 2P5KA 2PN6A 5DYMA 1IF1A 1ZRFA 3KLOA 5FLXZ 1FP1D 4ENNA 4LMYA 2CQKA 1Z05A 2ZMEB 3I58A 2HTJA 1FNNA 5ED4A 2FE3A 2KIFA 1YQAA 3HIFA 4HQEA 4MGRA 2EJRA 3GX4X 4L18B 4ASNA 4ESBA 1B4AA 4KICA 1Z6RA 3F3XA 2L01A 4MEYF 4U7DA 2A3SA 3GUDA 1MJ9A 3MZHA 2K27A 5FFXA 4LG0A 3DPLC 5JHUA 2QQBA 2EV6A 3LA2A 2EFPA 1FZPB 3ULQB 3J80Z 1Y0UA 1SFXA 2FBHA 1UHMA 2DBBA
chains in the Genus database with same CATH superfamily
4MIMA 3CJNA 1X1DA 3RYRA 3ZQQA 3HSRA 4PFPA 1J0RA 4LOCA 5CVUA 2DA5A 1GXQA 3G4SI 2IVMA 3DKYA 3COAC 2K7LA 2I80A 3OYDA 1I50A 2VA2A 3Q8RB 3K70C 4KN4X 1B72B 3G3ZA 1Z7LA 4RAZA 4DV3H 2LF7A 4MTEA 2V1UA 2WYOA 3TP0A 5J8FA 2L54A 3QQAA 4QWCA 2YZGA 1W0UA 2IS6A 2XB0X 1XPXA 3BCAA 1Z2NX 1CGPA 4S04A 4YR3A 4I98B 2BHZA 4II2A 2R93A 1SD5A 2R7ZA 2OLSA 1DGWY 4IQ4A 3RJ0A 2TRTA 2BOLA 1H8AC 3ZMVA 3WTTC 4ME6A 1QGPA 3PW4A 1KQ8A 2BV6A 2VN2A 1V5FA 2KKOA 2YR2A 5M5YJ 5J1UA 3ZMZA 1PDNC 3BR3A 3FISA 4V19K 2V1NA 1O7LA 1A35A 3CP2A 1IC8A 4A3JG 3IP4B 1P4WA 2ISYA 4AM3A 5J47A 3RTXA 3TEDA 3J7AY 2OTJI 3MD2A 4A3BJ 2N8GA 3M9AA 3LSHA 3HOYG 1U9NA 5EZHA 2ZC2A 3RKWA 1K4SA 5F0HA 2DXIA 4LITA 5J1RA 2DTRA 2B9SA 5LHHA 2F5EA 2AQFA 2UVRA 2XC9A 4JI3H 4CC6A 2XAFA 1OPCA 2MFZA 3WTUC 2M5WA 1C30A 1XB4A 5CVJA 4IHVA 3GTKA 4MA5A 1XMKA 5IP6A 3D5RC 3GV5B 1BR4A 2V7FA 2XF5A 3J7YJ 5HDNA 3KHLA 2EZIA 4NC6A 4YY3H 3PW5A 4DYRA 1E3PA 3L09A 2QEXI 4NBQA 2DPUA 2G7HA 1Z3XA 4OAZA 3JSPA 1K6YA 4YIRX 4TV7A 4EGYA 2JRTA 1KJ9A 2JEGA 2JA5A 3CO7C 4JX5A 3PO3J 3WODF 3LAPA 2D45A 1TWCJ 1U9OA 1D5YA 3M9NB 3WHBA 1OCTC 2H6BA 4Y8VB 5J1YA 3QAHA 4CXFA 4MV9A 4BXXJ 2LH9A 3JR9A 1Y1VA 2JVHA 1IUYA 4RDUA 3I71A 1WSCA 4EMSA 1XCVA 2XSDC 2W9AA 1P4XA 2DA2A 4I99C 5IYDG 2IBKA 2J6UA 4HDVA 4GC6A 3FKIG 2CH0A 1TNTA 3NWTA 3VYSB 3BR5A 2H8RA 1I6HJ 1Q1HA 4A2UA 2R7XA 3OUZA 2ADUA 2GA2A 1OFCX 3K4KA 1GVJA 4R79A 2JA6G 2HKXA 2WAQA 4DZPA 1X19A 2VR1A 3BOQA 5F0CA 1B6AA 3S17J 2XAUA 2IJLA 4MQ9F 1DP3A 1XGNA 5DUIA 4A3JJ 2PLYA 2Z9OA 4JI5H 5KFXA 3MFHA 4FS1A 3ABMH 2WC2A 3H1CA 4QJFA 2M05A 5BPFA 3DBRB 2RGRA 1MH4A 2A05A 1WH7A 3KHRA 4LG0B 3PN1A 2YX7A 3TQTA 2W4SA 4C5BA 1GXPA 1W96A 1U5TC 3J7ZI 5EGOA 1OYYA 1W7PD 2HJWA 2M4GA 3OSFA 1Z7UA 1G3WA 3O8GA 3PM1A 1QNTA 2DT6A 1IDZA 3KEYA 4LFCH 3I4MG 2O8KA 4I0BA 5HOOA 1KJIA 3WE3A 2PX9A 4BKXA 5C1PA 2VPQA 1NG6A 3WTWC 3CJRB 1W5CC 4EGZA 1IRGA 2W6ZA 2V9WA 5FJ8J 3OTOH 1T39A 1RKTA 3HOVJ 1OQYA 2Y69H 4ZDLA 2W9BB 2CGPA 2ISZA 2PVPA 4JUZA 4EGJA 1G4DA 2ZDHA 3MN2A 3LMLA 1IAWA 2L9VA 3EUHA 4YR0A 4BXXG 3L2RA 1TNSA 2IA0A 2UXBH 1TQPA 1OCOH 3IH3A 3WE2A 4YHHH 2EZKA 4L9NA 3F21A 1VKZA 1TQIA 3E6DA 2ESNA 4BQAA 4BHPA 1TWHA 3MWDA 4DL5A 5LP6F 1P8LA 1B04A 5L1LA 2MSYA 5EGOB 4HF1A 4LLGF 1SD6A 5CKTA 4EJTA 1LB2A 3WTVC 1T0FC 2AO9A 4JI6H 2PI0A 2ELKA 2DOFA 3LSRA 5KFYA 3MVPA 3JRXA 2MGQA 4BH9A 4BBRG 1GGOA 3JW4A 5HBRB 2XGXA 2LNBA 4UVBA 4FASD 3LSTA 4UV9A 3AYHB 2EH3A 4LFAH 2BBYA 3DKWA 4IJAA 3VMMA 4ED8A 1OCPA 4NQWA 2K3FA 2JA7J 5D1PA 2KIQA 3RAQA 3FHZA 5KG0A 2K40A 3ECHA 1MSEC 1ZG3A 3SEQA 1RIOH 3PO2J 1R58A 4BQNA 1WVRA 3RZDJ 3PQKA 3R5XA 1CE8A 4KIGA 2VKDA 4GKKH 1KU2A 2M2EA 2VJJA 3BY6A 3PUBA 3WG9A 1SYXB 4JV2A 2ZJPF 2JA8G 1TW2A 4LIVA 3KXYT 4B3XA 3JRBA 4ECSA 4YFXF 3MEXA 3WGHA 4PJMA 3D1NI 1CQTA 2UUCH 3KEQA 4XSZF 4L0ZB 2UV1A 4RB2C 3FF5A 4U0WA 1JT6A 1AUXA 5L3CA 4O3NA 1A6IA 3OYFA 3K70D 1YS7A 4R8UB 2VQDA 5HLGA 5D6FA 4RGRA 1AA7A 1IN5A 1XGMA 3E6CC 2EQRA 1LQ1A 2NU7B 3FXOA 3R0AA 4LD5A 3OYBA 2E1CA 2MLKA 3M3YJ 5HS9A 3GTMA 2XGQA 2WE6A 1EZ1A 4QPOA 1KZHA 2EBIA 2W1OA 2F5CA 2OF7A 4DJAA 2XC7A 1R00A 2VJ5A 5HLTA 2OZUA 1GT0C 2ESHA 4X65H 5FLXK 1BW5A 1OCCH 2W7PA 4JK1X 2CUFA 2VLAA 3ORRA 5KX5F 2OWOA 2KMUA 4P1WA 5D1OA 3L2WA 1D1BA 2JVGA 2K4JA 3BDDA 5GPAA 3JRIA 2X1EA 4XRSG 1B6SA 3HOXG 5KAFC 3DF8A 2X6XA 4KT5C 2EZHA 3PFIA 5HS8A 3MWMA 3RB6A 3E5QA 3K4LA 3M1EA 1OCRH 3FKJA 3OOUA 4BHBA 4EJUA 1QZEA 3GVAA 4NXMH 5EEHA 3W6KB 2X1CA 4DW6A 5IY5H 1AHDP 4QW8A 4JV1A 3NGDA 2L3DA 1YIOA 4PSXA 2L7MP 2JA7G 4RAYA 2DA1A 1ULYA 2FX0A 2FK2A 4B09A 3CCYA 2QF7A 4Y3OA 4FETA 3ZQHA 4EATA 3F8BA 3WO0A 1MGTA 1UMQA 2DJNA 2FNAA 3BTJA 3H5NA 4M6YA 1G3SA 3RDIA 2HOSA 1M0TA 2Y48A 2FPGB 2Z99A 3EPIA 5DEQA 2HOEA 4ANJA 4IRIA 3J80K 1ZHFA 2DMPA 2VOPA 3CQZJ 2HXOA 1ZLJA 2OCEA 4RNNA 4IR9A 1V54H 4I09A 2HDDA 5ICCA 1ACIA 4FU0A 3VYTB 4UCUA 3W2WA 2HEOA 1HXDA 3T8RA 2O61A 4ZYHA 1BM9A 2CJJA 2WTFA 3FMRA 1MMSA 5F27A 3JRDA 4OX9H 5F64A 5KG4A 3HUGA 2KFDA 3HOZJ 5E17F 1BBYA 4J9SA 4JQFA 4DOZA 3SEZA 5K7HA 3OHBA 4EBDA 4UUSA 3G6XA 2AGPA 1IN6A 1O57A 1MBEA 3F8CA 1GUUA 2EINH 3E6MA 2M8EA 1OYIA 2JQ7A 2KLOA 3F72A 4EQQA 4HA8A 3ZGKA 5B3SH 2NNYA 1HSJA 4BY1G 5C5JA 2F48A 4YG2F 1IW7F 1I3AA 1T94A 1CF7B 4F7ZA 1ETOA 1XDUA 4JYAH 3G71I 2ZSHB 3PW2A 4LGWA 2V4JC 4DV0H 3B6CA 1TTYA 4XM3A 3K3PA 1SMTA 1SD4A 2DFHA 5FO5A 3BP8A 5K5OA 1E2XA 4CYDA 3FIWA 4X6AJ 2L2OA 2G9WA 2ZFWA 1MDMA 4XRSA 5M3MJ 1OR7C 3ZRGA 1S10A 2R0QC 2STTA 4NQWB 2DFIA 4LSXA 4I2OA 1I27A 1T0FA 3BTIA 4DV5H 2Z3YA 2LY1A 3AL0B 1WFXA 4LF6H 1S3JA 4ZJZA 1PK8A 3T1YH 4IKFA 1F36A 4MNUA 5F6FA 1ODDA 4U7BA 2B63A 2H6CA 2L4MA 3FDSA 2LDUA 3ZMTA 2PMZE 2FMYA 1MBJA 3AKZA 1K7AA 3ECOA 3W3CA 5IP9J 1OJLA 2EFNA 4X64H 4C2MA 3DLLF 1Q1VA 2Y0MA 2R7TA 1ZLKA 5C4XJ 4BXFA 3I54A 2VQGA 4BHCA 2ZM6H 2ELHA 2XGCA 4XORA 2W8KA 2W6MA 2R92J 4ZH4F 1N36H 4N4NB 1O3QA 1K1SA 4DZJA 5DG9A 3HSFA 2JZYA 4A6EA 3T5XA 4XBFA 3J81Z 4ESJA 2DMNA 3VSKA 4I76A 4IL6C 1S9HA 2DOEA 1XNQH 2E2IJ 1T08B 1GVDA 2PBZA 1X3UA 4M9XA 1HOMA 2A6EF 3IUOA 5F04A 1U5TA 4BACA 3QPLA 1TA8A 1Y6IA 3LWBA 1HDDC 2XAGA 1O3SA 1PP8F 3IH2A 1FOYA 1LNWA 1YLFA 5CJ9A 4YRVA 2GZWA 2I5UA 4NB5A 3F8NA 3FKIJ 5KFEA 2EIJH 2JPCA 3GIPA 1Y8RB 3QYEA 5BMVF 1QPMA 5KG2A 2CUJA 2HXIA 2CW8A 3MR2A 1AOYA 4BBSJ 3G1LA 3O8HA 4D0PA 4A3LJ 2FOWA 3ONQA 2YCHA 3MR3A 2EILH 5L3FA 4MFEA 4GCVA 1U2WA 4OIPF 5KFZA 2XGPA 1YO5C 3VPRA 3M7GA 2IS4A 1FBUA 3HOTA 1S0MA 4KMUX 4IHTA 5KFQA 4UY8I 2DK5A 2CS3A 2ZO4A 1BI0A 2RDPA 4PCQA 4IO9F 2VQCA 3HTUA 1S7OA 3CO6C 2FNPA 3SE7A 4OOIA 1FSHA 2F6CA 3CUOA 1FBSA 5JI6A 4IZZA 3L7WA 3CCQI 3CF2A 3I4MJ 5C4XG 4A3IG 3GIKA 5GONF 2IW5A 1R1VA 3QPHA 3GWZA 3SYTA 3Q8QB 4J9NA 4KITB 3FXUA 4DR7H 3FWEA 2MYSA 3ZN1A 4HF2A 3G8CA 3QZ7A 3EPGA 3F23A 2R92G 1W36D 3DPTA 1FLIA 4GC7A 2K9LA 3G2BA 3KYDB 2YPRA 1IV6A 3KEOA 2FK3A 1JXSA 3FM3A 5GAHJ 1X2NA 4IRDA 5C44G 5M5WJ 1E17A 4Q8EA 4MV1A 3VYRB 1YJ9I 3RGZA 1WCMG 2Q8KA 1UG2A 4A3GG 3IH4A 4XOPA 4HAMA 1X1BA 3GFMA 2NVYA 1DPUA 2ME6A 2FF4A 1PUFA 2FJZA 4CICA 4BL0B 4KYWA 1S72I 4G94A 3NQOA 4X66H 4A3KG 2UZKA 3RYPA 4WF2A 3I53A 1YRNB 3H40A 1R5HA 2VA3A 4W97A 2I87A 3AG1H 1Z77A 2R5ZA 1HNWH 2KRFA 2DO7A 3E5NA 1T2KA 2R6FA 1VBGA 1TL8A 1KJJA 3G1MA 4B3AA 5LA6F 3OHAA 4BU2A 2CQQA 4A3CG 2NOJB 5LLQA 1IOWA 5DD4A 2YU9J 1P9QC 1YG2A 3N8DA 2ZB9A 2QCOA 4IOCF 1TWGJ 3MWEA 3DQVC 3EQLF 2JA2A 1ZELA 3CTAA 2WAQN 1AN7A 1S9FA 3GIJA 2X6OA 2BY1A 4ABZA 4E7KA 2ME0A 3OSPA 4L5IA 5D5WB 1X4PA 1WPKA 2GM4A 1XSVA 1B9NA 2EIMH 3J81W 3FMAA 4JI7H 3OS0A 4WWCA 3KHGA 4G8XA 5B66C 2BXYA 3B02A 3HBLA 1YRNA 3IKVA 2GOXB 2L02A 3PVXA 2LC2A 4XLAA 3AAFA 2VJ4A 2C35B 2CV2A 1PP7U 1V4YA 3M07A 2YYAA 3UQ8A 3FBIB 2E1NA 2XB5A 3OYGA 5DLGA 3GV7B 4JI8H 1BJAA 3K4NA 4CGZA 3CJQB 2H27A 1DV1A 2BE5F 2HFHA 2K9MA 4O3SA 1XSXA 2W00A 3S93A 2HVRA 3BQ1A 3KZIC 1GYFA 2CU7A 4XLEA 1T6SA 4QWQA 5F08A 3SQNA 2LKXA 4LLLA 4A3EG 2J6TA 3ELKA 4BE0A 1MZBA 2UXDH 1YS6A 1KEEA 4YQWA 2OV7A 4IEJA 4C9YA 2W8LA 2GWRA 2E71A 2A5WA 3M8JA 3KP7A 5GAEJ 1A36A 3CQZA 2XKPA 1PX2A 5LBQA 4X62H 4DNCA 2DOAA 1G2HA 1FOWA 2WDTA 5KFOA 2TDXA 5ICGA 4O3QA 3T5HA 2XF6A 1ONVA 2NAZA 3SJMA 4DR4H 3T1HH 4EV0A 5L3BA 3MZYA 4D9JA 2QQ8A 4J9KA 2FJ1A 4PJ0C 1K61A 3O2PE 1M0WA 5HLIA 5IOZA 2WB1E 4ED2A 3GTPA 2DW4A 2OPTA 5AIPA 3ESWB 4RGSA 4A5MA 3A01A 5IP7J 1QPIA 4HDUA 4U0VA 1P4AA 2R8IA 4ZYAA 3IWZA 1R36A 4JOMA 4II3A 3TO9A 4MV6A 5DV5A 1U0JA 1XMQH 3KP6A 4IR1A 3S8PA 2E1MC 2UU9H 1JHFA 2PQ8A 2P8TA 5EG0B 1SFUA 5D8KB 1F5TA 1MMNA 1MH3A 3DP7A 1MMDA 2L0KA 1KJ8A 2JT1A 3ABKH 3CESA 3T5KA 3MJFA 2F5FA 1X1AA 5EF6A 3I59A 4LB6B 4E4HA 4XYLB 4EEQA 1SANA 1UFMA 2HDWA 2ZSIB 2R7FA 3BG9A 2WY8Q 3MKZA 3VYUB 5ILUA 2Z1DA 4P55A 3ETHA 3EYIA 2HQNA 3KE2A 2NUAB 3GTOA 4R8HA 4GGGA 3BQ2A 2DLLA 5KT7A 4EFEA 4CC5A 4CO8A 3HKZN 2B63G 1XX5A 1LFPA 3I64A 5JFRA 3IL2A 4TV9F 2UVUA 5K5QA 4L1KA 1R4NB 2ZXWH 2LRDA 1SVLA 3C0FB 4IVNA 1MD0A 5J6XA 1LUJB 1IDYA 2BHYA 2DN0A 4UCVA 3JZIA 3Q3SA 2QWWA 2HYFA 4DV4H 2QBYA 1FMVA 1Z2PX 2FMAA 5KFCA 1BIAA 1MBHA 2RNJA 3D5LA 1R9TJ 3K1NA 3JRCA 1R1UA 2MC4A 1IUFA 2PJRA 4XLPF 3G6YA 1FSEA 2W9CB 3VSLA 3E0JB 5LGTA 1KJQA 4JV0A 1ZK8A 3I0TA 1R4MB 1EJ9A 3RIZA 2R7KA 2ACJA 1SEUA 1DPRA 1BJZA 1IRZA 3E1SA 2FQ3A 1FY7A 2Z2SB 3C2BA 2VT2A 1WJ5A 2KP6A 3D5SC 3SFIA 1GO3E 2NVTJ 2W25A 2R7ZJ 3C2GA 1WWXA 4EJVA 2E2JJ 1F43A 5KFIA 2O03A 2OC6A 3OY9A 2ZXIA 3GZNB 3K9TA 4U6PA 4N9IA 2FQ4A 2VBZA 3OSGA 3LFKA 2C00A 4XKCA 3C1DA 2R86A 1B8IA 4E7SA 3N42B 1U8BA 1POGA 2GPSA 4B48A 2CMPA 1W5TA 3BPVA 1KBLA 2VUMJ 4G6DA 4CHUA 2CYYA 3BWGA 4P9FA 2P81A 1FYMA 5KT4A 4Z2YA 5EWGA 3H3VH 1XNRH 1D0YA 1REPC 2BR0A 4IRKA 4IHSA 2C28A 3OYHA 5L9XA 1LDJA 1U3EM 3ZPLA 2YUSA 3N41B 2FLLA 2Y0SN 5ILVA 3OYJA 4DLKA 2DTZA 3QYFA 2DDBA 3S1NJ 4BBSG 2WY7Q 2WB1A 5KG5A 5KFKA 2R7QA 1ETWA 3ZQIA 4RUCA 3E6BA 2ZXJA 4JI0H 3AG3H 1V4RA 1HDPA 3QYBA 4HV5A 4YJ3F 2KZVA 2JA5G 5J4YA 3PZPA 1H0MA 5LRRA 3L4JA 1W7PA 2OBPA 5IT9Z 2QSGX 2VBXA 3V6HA 2JA7A 5E1ZB 2AQ4A 2WWYA 4C5CA 3TW6A 4B4CA 3CZ6A 2DJIA 4YELA 1B1BA 3E5XA 1PJRA 2EV5A 3GIDA 5D4RA 1FMWA 5E3MA 3ISPA 4O5VA 5B1BH 5E8IA 2HZTA 4KUMA 4LF9H 3RFCA 3HHHA 4A3LG 4UCSA 1X58A 1X1CA 2PMZN 3CMMA 1USSA 2X51A 4L9JA 3KP4A 3HOSA 2V26A 1OWTA 3DTKA 3H9QA 3RI4A 5DQIA 4DYQA 1AKHB 1KC7A 4ZDOA 1OYWA 2ZJ2A 2PN1A 3BZ6A 1O4XA 1IO2A 2HPIA 1Z9CA 1JTYA 1JUPA 1LDDA 2X0LA 3ZP5A 2PMZA 1FIPA 1LEBA 2MG4A 2GAUA 3G73A 2K4BA 3GO5A 4EGQA 5L3DA 5CQEA 1J75A 2R7NA 3GW2A 4J00A 4LH7A 4RZRA 4J9LA 4JI1H 1EF4A 5AIQA 3KCCA 2W71A 5EZGA 4UFZA 4ZYDA 3U9SA 4AYBA 3I3LA 4L0YB 4DQ2A 1I7NA 4F4WA 1UHSA 4CCNA 4MV7A 2X0SA 3F6VA 3M9MB 3TOBA 4C3JJ 1JIHA 4EM1A 1J59A 2UXNA 3ZQCA 3CC4I 1UELB 3QPSA 3MR6A 1Y1VJ 2DMQA 4HX8A 3TOAA 4DR6H 2NRAC 1W5SA 2E5LH 2A61A 1D1CA 3Q9SA 1RJPA 3BJOA 3QRFF 1JGSA 3DU6A 1O7FA 3FK7A 3B6AA 4LIUA 3LSMA 4CCOA 2HQAA 4G6TB 5CA0F 1K78A 3W6JB 4AIKA 3CCVI 1FPQA 1S5LC 1WZ2A 5FLVA 1OR7A 3CCLI 2RGVA 3ZQ7A 2VI6A 3OYIA 1PVEA 4ESFA 4QWBA 3GIMA 2X6WA 2BZTA 4XIDA 4RAFA 2IXSA 2V1XA 3AL0C 2FUG2 1X4OA 3LQRA 5KFGA 1HR0H 3RPUD 4IX7A 2CW0F 2A6TA 5EEAA 4ECYA 4AD9A 3HPHA 3OL4A 4KNYA 2VL8A 1XCBA 2HQ5A 2C6YA 4QIWN 1I6XA 4F92B 5A2QZ 3TO7A 2HTSA 5L1IA 4LK0F 5GADJ 1I6UA 2XPVA 2GXAA 5KG1A 3HOUG 1N34H 2W82A 2GQQA 1ZGWA 3HRUA 4YB8B 2CQXA 5KFPA 1N32H 3GEZA 2P0WA 2NS0A 2KHMA 5IYDJ 2DI3A 4LF4H 4M9SA 1BOBA 4JBAA 2ZKZA 2OUMA 2X6YA 2DA7A 2LBFB 1JGGA 1DP7P 2WAQE 4HYEA 5GAGJ 1N56A 4MEXF 2V1DA 1LKXA 4Q43A 2FLPA 5JH7F 1EV7A 4V2GA 3IG0A 1X9NA 3GTOJ 3TINA 5IWAH 2YRXA 1DU0A 4FT8A 3RIRA 4A3DJ 1O3TA 4U0YA 4DL7A 1UG0A 4UVAA 1IRXA 1UC9A 3A1YA 3PIPF 1YOVB 2MABA 4DYCA 2P0AA 1V51A 4TQSA 2O3FA 4WXCA 2PFBA 4NC7A 3TIGA 4GXOA 1ZARA 3Q8SB 2XRNA 1QZYA 4RNOA 1IXRC 4YBZB 3X2QH 1HBXG 3WG7H 2CRGA 2RDIA 3N44B 2IAIA 2QK4A 2VQEH 5K1YA 2F4IA 4A0YA 1L0OC 4IXAA 1DDNA 1FC3A 1VNDA 4F91B 2R87A 3GTQA 3L2CA 3OS1A 1EKEA 1XGOA 4S05A 4XR6A 1JE8A 3N43B 2OTLI 3RPUA 2V6CA 2W7OA 4YP3A 3PW0A 4WCGA 3K5HA 3CDHA 3RGXA 4KA4A 5LRSA 2XD4A 5KFSA 1K79A 5T14A 3CMEI 1AWCA 3LAJA 1CQJB 1WJDA 3N97A 3U1KA 2ELJA 1JI8A 2VONA 3CC2I 3VOEA 2A68F 2X9DA 5ICFA 3WHCA 1M1EB 4J9QA 2M7BA 1T33A 5IPAA 1LPQA 4FHTA 1WKMA 5BMZA 2FKLA 2W6NA 3W2AA 3L00A 5E3OA 5DD8A 2HWVA 3O6BB 1RUOA 1ZAOA 4LB5A 2MC3A 3P5JA 1QBJA 2JPBA 4J9MA 2O7OA 1NHAA 1Y8QB 2DFEA 3OV8A 3ORQA 5JVTA 2EZLA 5C3EJ 3L1PA 5JLXA 1JTXA 5FKNA 1ITYA 2L7KA 4FCYA 3PSIA 2FP4B 3A03A 2L9RA 3BG3A 2R5YB 1O75A 3QZ8A 4NUBA 3JRAA 4O2AF 4NLGA 5KFDA 1ZH5A 3ML6A 2VUMA 5K5RA 3DCFA 1RETA 2DYSH 3WGIA 4O2BF 2F2EA 5LXTF 3GIIA 3FXMA 2C22A 2IPQX 2M87A 3NRVA 3HB9A 1W93A 3J81K 5KT5A 2L7ZA 5CB4F 2P7VB 4CA0A 1R6RA 3I5UA 3EDPA 2FU4A 1KA8A 1KGSA 2K9QA 2W57A 2XAHA 1MW7A 3P9IA 1AU7A 4K2EA 3JSNA 2UUBH 3GCMA 1P6RA 2UUZA 3LSKA 4PDKA 1Z21A 3H36A 3V6JA 4M3DA 1XN7A 3UR3C 1T8IA 3A01B 3S16J 2JA8J 3GTKJ 4ITVA 1Y1WG 4ED1A 1ETXA 3FXQA 1X3WB 4DL2A 4LG3A 4OMZA 1GV5A 1YE9A 1JUSA 1P92A 1BR2A 1TWFA 4L5EA 1IRFA 4IRCA 3ASNH 2VKVA 1ZR2A 3MR5A 5DG7A 2R7MA 5D8LB 2J5PA 2VASA 2Y9YA 1B9MA 1U8RA 1HC8A 3TP3A 4HV6A 4Q48A 3RPQA 2EV0A 1HKQA 1VAJA 1BC8C 1MIJA 1YJWI 2DA6A 4EFBA 2A5YB 1J2XA 1YX5A 3R61A 3OR2C 4M71A 3RZOJ 4DL4A 3RBDA 3SZGA 1J5EH 1FTTA 4XLNF 1ZTRA 2JSCA 2FXAA 2XSJC 1N75A 5JQWA 2X85A 4F4ZA 1XTAA 2ZMEC 2R7ZG 1UC8A 2HHHH 2AXTC 3CUQB 3TGNA 1JT0A 1ZG5A 2KJBA 1ZRDA 2VODA 2IBDA 2QLZA 5FGMA 3T8TA 2QA4I 1M6VA 4AIHA 3EUAA 3K2AA 2W6QA 1BXRA 2CG4A 4V2FA 2OCCH 1WJEA 1Y1WA 2ECBA 4UB8C 3GTQJ 3P9CA 2EA2A 4DL6A 2VPLA 4QWDA 2G7UA 1GLVA 1ORKA 2YSRA 3SZTA 2RF4A 3TW7A 1MDMB 3KZZA 3M4OJ 2AGQA 3PSFA 2Y9ZA 1QHHD 3IRRA 3KP3A 4FE4A 2PBIA 4WXDA 4UCRA 2V4QA 4N9HA 4IHJF 3TIIA 5CA1F 2D2WA 4DV1H 4NHJA 1TWAA 3BTLA 5DCMA 3DEEA 1MJAA 4WXHA 1E4EB 2OU2A 3KALA 5LHIA 1S7EA 2F4MB 3HEFA 3QP5A 2E5NA 1K78B 3N6XA 2STWA 3QOPA 3ROUA 2CUEA 1TZLA 2DA3A 2QYOA 5EEGA 3L2UA 2HGSA 4MFDA 5B5EC 3SFZA 4TQRA 3HOZG 2E1MB 3JTGA 3LA7A 1G6NA 3JAMW 4KHPH 1ZRCA 4DUZH 4WX9A 5BOXA 4A0XA 3DEWA 2JWTA 2IA1A 2ZMEA 1ZQ3P 1JXLA 2RQQA 2BYVE 4HEA2 3PJRA 4G7OF 2QKMB 4KMFA 2KQRA 2BQRA 3AG2H 2JEJA 4J19A 1SCUB 1T3NA 1RK6A 2R8JA 1WSUA 3TMOA 4IWXA 4DIQA 2R7OA 3OYLA 2GIZA 2DT5A 5EJCA 4AVPA 4CCKA 4E7JA 2DWCA 2R85A 4MV4A 3F9KA 1FVIA 4RZQA 2LR8A 3HKZE 1SD7A 5LOVF 2E2IA 1VFCA 5IYCG 2DK8A 5JHFA 5EWFA 2LSOA 2LY9A 2QQ9A 3DLAA 2DIKA 2HVQA 4E7IA 3RAXA 2JJ7A 3TO6A 3M9OB 4GKJH 5DS9A 3OWTA 3ERED 3GTLA 3G6EI 4L9VA 5J8CA 1XD7A 3L2QA 3MMYB 3CJTB 1Y1VG 2QM3A 5HNHA 5D1OB 3GTGA 3R23A 1I3QJ 1W1WE 3KP2A 2VPRA 3PNTA 3RKXA 3JREA 1RJQA 2A07F 2PJPA 2F4VH 4HOBA 1FJLA 5HV6A 2JSPA 4Y15A 4ECXA 2E7XA 2VBWA 4D5CA 3H20A 1VQ6I 2I8DA 3B73A 3FZVA 2Q0OA 4DR1H 2GIVA 3S3OA 2WB1N 3DEUA 2I10A 4PSWA 3PIOF 5KFUA 5FJ8G 1N77A 5IT3A 1VQ4I 3BA8A 2E19A 2E7WA 2LF8A 1DGRM 3DBLB 4HZFA 1TWGA 5IT9K 5IYZF 1DU6A 3LFUA 1IOVA 1I5ZA 2H8WA 2XDVA 2ZDGA 3ZOBA 3KFWX 4RB0A 5HLHA 3FM5A 5IYBG 3A0BC 3ZCOA 1IXCA 4BGDA 2HYJA 4I0AA 1KU9A 3CCSI 1VQMI 4U7CA 2OQRA 4KIFA 1BNCA 2JUCA 2AS5F 4HW0A 2HYGD 4RMNA 4XRFA 4RB3C 4EEFG 1R71A 3ASOH 3BG6A 3OYNA 1MSFC 4I50F 1OKRA 2ID3A 3HG9A 1QVUA 2ZDQA 3CUQC 4B3SH 2BVLA 4DV6H 3DWLE 2MH9A 3HRSA 3ZR8X 3L2PA 2TCTA 4I02A 4R1HA 1TT0A 4L5JA 3HC7A 2X1DA 3FXRA 3AFHA 4QSHA 5KVRA 4QW9A 3RB3A 4F4XA 1J09A 2XUBA 3DV8A 3F8FA 3R6SA 1X3ZB 1JUMA 5IYCJ 3K5IA 3KPHA 1IBLH 4PK4A 1GSAA 4FM9A 1KU3A 4JX4A 2FEZA 4CH7A 3Q9VA 2LKSA 4GRIA 2MA3A 1XMOH 3S3MA 2V9VA 2R5ZB 3GMEA 3JSOA 3KYLA 3L2VA 5DLFA 2BQ3A 1FOXA 2W6PA 4G7ZF 1TAEA 2IGNA 4HLXA 4AYBN 4N4OB 4QIWE 1L2ZA 4AIDA 2BW3B 4CCLA 2O9LA 4QPQA 4RA2A 3LSPA 3GYHX 2QBYB 3S32A 2ASJA 1KYWA 5EWEA 1BN5A 3S2HJ 3QPTA 1IN7A 3S2DJ 3BJ6A 3QP6A 5DDGA 1SAUA 1JX4A 3RF2A 4O3OA 4J9OA 2Z33A 2DFFA 2R7SA 1JDEA 1R7JA 1LVAA 2OAZA 5GTIC 2Y75A 3LOCA 3PO3G 5BS6A 4LLNA 3Q0UA 4ZHQF 2XRLA 3LNQA 2F5DA 3GXOA 1JHHA 4B3RH 4A3GJ 2COBA 2KJCA 3KP5A 2Y0SA 3O3KA 1ETKA 2RN7A 3K0LA 1FBQA 2IEKA 2FMLA 4IF4A 2Q2EB 1DGSA 5JVLA 3NEUA 1E4FT 2HKOA 4JP0A 2NVQJ 2M34A 2CSOA 5KFHA 1S0OA 3CCRI 5J4VA 3GTGJ 3TDUC 4M6XA 1JDBB 2LTPA 3EUKL 4PUSA 2XCAA 4ENJA 2YX4A 3NARA 5KT2A 1A04A 3KZYA 3T1BA 4ENKA 3H3VK 3SHFA 5C4JJ 3VEPA 4UNOA 2RNGA 4ZC3A 5C3EG 3GF2A 4YFKF 4E6KG 3MCZA 2H1KA 4YJ2F 2ICWG 5A2QK 5K2MA 2DU9A 3MZ8A 5EDWA 2BGCA 1SAXA 4F4YA 3DTIA 3V8JA 3HOXJ 2XV4S 3OIQA 4F52A 2VC0A 4IRHA 1YW8A 4BEHA 1JKQC 1BOAA 1A9XA 4NDLA 3U9TA 2D5VA 1SVOA 3V7CA 4CZCA 4J0MA 3V8KA 3PR4A 4M3FA 3ZMDA 1E3OC 2P5VA 3U21A 4XYMB 3K1PA 4NNJA 4EM0B 5DM7F 1FTZA 3K10A 4EM2A 2JUGA 5KAIC 4OIRF 2HS5A 2BY3A 2K02A 3H9JA 1VF9A 1ZGJA 1BI2A 2NYXA 3U9GA 2RVCA 2DT7B 4RB1A 2CV0A 1HQCA 1IG7A 4BQOA 5DM6F 2IRFG 3SZPA 2IP4A 5F1JA 1VQ7I 2BQUA 5KG3A 4P5OA 4PZJA 5F1RA 3OYKA 4HR7A 1S03G 4G3IA 1R22A 1CF7A 2P7CB 3HPGA 3CCEI 4M9UA 4LFBH 2K5CA 3K4CA 4WK8F 2RQPA 4QTRA 1BA5A 3JRWA 1I94H 4BAYA 3GTPJ 2GA1A 2UVVA 4XICA 3VPCA 4IHXA 3L9FA 3DF7A 1O3RA 2JEFA 3DTEA 2EPFA 4MA0A 3Q0VA 2E2HJ 4CSWA 2MCTA 4ETSA 2QZ8A 3CCUI 4M3BA 3BR0A 3WU0A 3CVZA 4GYGA 2PEXA 3FMQA 5CAEB 3RV3A 3A0HC 2Y0SE 4A3EJ 2VJIA 2NVXJ 4QWAA 3RB0A 4HYKA 1TWCA 2WTEA 2W48A 1RYRA 2RAEA 1TQMA 1APLC 3N4MA 1STZA 1H9GA 1HW2A 1JJ6C 5C8YF 3H0GJ 9ANTA 2NS8A 2QYZA 1YIJI 2V59A 4IRGA 4YR2A 1TC3C 3BROA 3FK6A 3HRMA 4BXUA 2LOOA 2H1LA 3HUGB 4Y7NJ 2M1BA 2OA4A 4BBRJ 5LFAA 2CKZB 4ZOLF 1LE8A 4MO7A 1N25A 4KDPA 3N40P 1B8IB 2V58A 4U88A 1H89C 1HSTA 3E5UA 2V5AA 4ECWA 1RKWA 1ERDA 4LK1F 1U6GA 3CF5F 5JVDF 2LVSA 2KZGA 3WO1A 5LMUH 1Z3YA 2VQFH 1SMYF 1BL0A 1HCRA 3K69A 3HOWJ 3LMMA 1GLNA 4HSTA 3H3ZA 1TW3A 3C18A 4BJ6C 3VPDA 4BY7G 2HR3A 3CLOA 5FB2A 3H5AA 3R4KA 3BC8A 2DMUA 4UB6C 4D7NA 3OYMA 1RYSA 3BQ0A 1E3HA 4XNFA 3CC7I 3PQJA 2VUGA 3HGGA 1RR8C 5L1KA 3DFGA 2LY2A 2D1HA 3RCOA 3TDZC 2EFOA 2W7NA 1F9NA 5KCMA 4P96A 2QVOA 4M3GA 5FRMA 2G0EA 4IOAF 3H9GA 4EJWA 1B6RA 2DPDA 5H20A 2NXNB 2Z5UA 3RJPA 1PUFB 2HPMA 3VDXA 4YAJB 3Q0WA 2XF7A 3SDGA 3WTYC 4KIBA 4ENMA 1WGXA 1FKAH 2UUAH 2KIUA 3P9KA 3JRFA 4JX6A 1ZN2A 4GFBA 1V5GA 5FFZA 2XAQA 3RKYA 2JEIA 2CWEA 2B63J 3T0YA 2OQGA 3K4JA 2PG4A 2KDOA 4GDFA 1OISA 5F9LA 2VXDA 3F8MA 3ZMSA 1RK5A 2M3AA 2MD5A 2CO5A 2E36A 1OMIA 4UVCA 4P9UA 1V3FA 4B8XA 4E7LA 5HDKA 4FS2A 5CVVA 4HBLA 1WJBA 2XROA 4XN0A 5LEKA 1HA8A 4CZZA 5EG0A 4YAKB 2QUFA 3D0SA 4PWQA 2NNNA 1Y14B 4K0KH 3BJYA 1NTCA 3MAJA 2NVUB 2DQRA 4DBRA 3TL4X 3HRTA 5J2TF 4R8UA 3VPBA 3FMSA 5HS7A 1UHWA 4Q5SF 4QWEA 2YW2A 1V5EA 4BE1A 4BYYA 5GP9A 1ZHQA 2UXXA 5LL6b 4OINF 1JKPC 4E70A 3LA3A 2DAOA 2XGDA 2GXGA 4BY7J 1GV2A 1UCRA 1J5YA 1Z0XA 5KFBA 2C2DA 2E34A 5LEJA 1WJCA 2NS7A 4N0BA 1FYKA 2FLNA 3H35A 1SEIA 4CUGA 2FB9A 4LF7H 1Z6TA 4XK4A 1MMGA 4A3IJ 4A6DA 4M9ZA 5HODA 1J9IA 3RV4A 2ID6A 5M3FJ 1KQ0A 1Y56A 1T98A 2E60A 5J40A 5HVQC 1D3YA 5DCFA 2Y30A 5CVIA 4CDGA 2EFWA 3VODA 5CPRB 4AU7A 3R60A 3K6GA 1W36C 2W84A 4C5AA 5C1OA 2LBFA 4O3MA 1R5ID 1BW6A 2M4KA 4F3QA 1MNMC 4LH6A 2EB7A 3LP8A 2CQ7A 3RSNA 4EEYA 2WAFA 1OCZH 2DYRH 1ZR4A 1X1PA 5IYBJ 4ZTFA 1NK3P 1WCMJ 1VS0A 4NXNH 1UZCA 4TV8F 3FXKA 2DMTA 3ABUA 1FT9A 2C2EA 4A69C 2IP2A 2Y2ZA 4PJLA 3WTZA 1IZ1A 1LFBA 4ECQA 2E35A 3NAUA 2MD0A 2YRWA 2VXZA 5ILSA 3N05A 2XHKA 1WH5A 4DUYH 4HSRA 4ZYGA 1A5JA 1M7JA 2RC4A 3FKIA 2FPIB 2ALZA 1HW1A 1QVTA 3KETA 2CFXA 1JKOC 2Q1ZB 2J6SA 3BG5A 1T38A 2IT0A 5KFRA 2IGOA 3GTMJ 4LF8H 3BABA 1A6QA 5D8DA 3GQCA 3GFJA 5JUMA 2EWNA 2VB6A 1V55H 3NWSA 2Y31A 5J3LA 5E1WA 2HNHA 5KG6A 4OIQF 2W9BA 4E7HA 4XLHA 1S8NA 1YW9A 4B1RA 4Q4ZF 3EYYA 1YFHA 2FRHA 1F1ZA 5H6RA 3OYAA 4FTHA 1WCMA 5H80A 1QHGA 4ED3A 2IS2A 1ZYRF 3VWBA 3M8FA 2COMA 2R8GA 4OWRB 2LG4A 3I55I 4A12A 4AIJA 4HNVA 3GTJJ 3GZ6A 3R0JA 4A3MJ 5CLSA 5D5XB 2KRCA 3V4GA 3WU1B 2IS1A 4IQJA 2R7DA 2VE9A 1WHUA 4XSXF 4F93B 2DPIA 5HDGA 1R9TA 1HKSA 3DKXA 4LFUA 4AC0A 3J7AO 1YHQI 1BI1A 2R7RA 1K83J 3KIOA 1TBXA 2DQLA 2ZNZA 3CMAI 4DBQA 2AQEA 1HLVA 1H88C 4EG0A 2Q2UA 3M1CA 1Z2OX 3IKTA 1MJBA 4Q0YA 3HOVG 3LSGA 4I7HA 4D5FA 2R82A 3CCMI 1YI2I 3QOEA 5KFNA 5DGAA 1YJNI 2QQAA 4O4HF 4HG2A 1K4TA 2DODA 1K6OA 3GIQA 3GFIA 1YTYA 2ZXHA 2L4AA 2LD5A 3GTJA 2XPWA 1RNLA 3U2RA 5LHGA 2MH2A 3BJAA 2RREA 4DGWB 4APMA 4XZ3B 4HQ6A 2M30A 1BIBA 5EYRA 2AU0A 5E3LA 3BCBA 1VQLI 5KFWA 2LFBA 2ASLA 2HGCA 1T56A 1QA6A 3H5RA 4FBUA 3WGGA 4H0EA 4XKVA 4PFOA 1CQIB 2NU6B 1RUNA 2R93G 2FOKA 3ABTA 5I47A 3M8EA 2ZJRF 5H2FC 1FOKA 1KU7A 4ECRA 1QZZA 4C2TA 3A02A 2O8XA 2YZMA 3CDLA 4A0ZA 1H9TA 2H09A 3TKYA 1B59A 4BS9A 1U5TB 4HNUA 3BQZA 6PAXA 3QFFA 4WD3A 3I12A 2M45A 1L3LA 3HJEA 5E3NA 4A3FJ 2MW8A 3OL3A 3K4BA 4RLQA 5F9NA 4A3MG 4G12A 4PJJA 1QQIA 3QU3A 4UCOA 3U1DA 1U78A 3HDDA 2CQYA 1YX3A 2PMHA 4TUYF 3SI8A 1JKRC 3TBIA 1CS0A 2V9KA 1HNZH 4RM3A 3QODA 4IZOA 2P4WA 2GBYA 5FROA 1IXSB 1RPWA 2LLKA 4IHYA 2ATLA 2E1OA 5HNFA 3CCJI 1B72A 1UB9A 2KL4A 4O3PA 2KISA 4M74A 3KAKA 4J9RA 4BJTA 4U87A 3IAM2 3REOA 4MLOA 1FYLA 3DXJF 4XRMA 1G8XA 2XPUA 4XLFA 4FQGA 3CLQA 4XQFA 1XDSA 1DIKA 2IGKA 1E4EA 3ZQLA 4BNCA 2YS7A 1PUEE 1E0EA 4AQYH 1AKHA 1WJAA 2O0YA 2B7EA 3P7NA 3HM5A 2XCLA 2FD5A 3BPXA 5DQGA 3GFLA 4JI4H 4UV8A 4ECZA 5LMNH 2W85A 5FLMJ 2X4HA 1Y39A 1LEAA 3GLXA 5FD5A 2R93J 3IN5A 1VQOI 1FWZA 3H0GG 2Q2EA 1FP2A 3HL2A 2NVXA 4R7RA 3I9V2 1ZKGA 4IPAA 2JMWA 1RJRA 4RU9A 1BJTA 5IT9W 1TT5B 2VIXA 1S68A 1TWAJ 2K3PA 5LD2C 4DR3H 5M5XJ 2FBIA 1IN4A 4HF0A 3RTRA 3OUUA 4AUXA 5BPDA 4YFNF 4IHWA 2GOMA 2DA4A 5FD6A 3BA9A 1R49A 4ZYEA 2BEOA 3V42A 3G6VA 1YW7A 3E7LA 1XMAA 5ERIA 2IA6A 3PNYA 5FKMA 2EFQA 5D4SA 1ON2A 4G6QA 4RBOA 5CVRA 5FPRA 2YZNA 4UUSB 4A3FG 2CW7A 3UFXB 1E4GT 2R7UA 2R7WA 1VQ8I 4LJZF 1C3OA 3K4MA 2EK5A 2ZFUA 4UXNA 4Y4RA 3VFZA 3ZQGA 2V79A 1J7KA 3CUQA 4CCJA 4M6VA 1VQ9I 3FHNA 1NH3A 3EUHC 4ZDPA 1S0NA 2KIMA 2XGEA 3K2ZA 4BE2A 2R8HA 5FKLA 3MFKA 2M0MA 2GLTA 3RUPA 4A2BA 1RZ4A 4AYBE 4MTDA 4OIOF 5BR8H 2VT3A 3A2KA 5L3GA 4KFCA 4MV8A 1EA3A 2R7LA 2R92A 2KRHA 2NVYJ 2QKLB 5CYVA 4IAJA 3S15J 5EDNA 2UWMA 4L9TA 1VQKI 4B44A 2HVSA 2UVWA 2JA6A 5DGBA 2BXZA 1IN8A 1GSOA 3TQ1A 1MMAA 4DR2H 3FXJA 1ZG1A 3QU6A 5D5VB 1Y1WJ 4EBEA 4BY1J 2K9SA 2R5YA 4ZTJA 4CYCA 4BQQA 3OYCA 2L7FP 3E3VA 1DUXC 1GHCA 1UJ8A 4B3TH 2LP0A 2D1VA 1K83A 1R1TA 3L4KA 3F0CA 1SFOJ 3HHGA 3BLYA 3JAMK 5FLMG 4YEJA 3QWLA 4RUAA 5KKNB 1D0ZA 4Y52J 4M73A 3TQNA 5D6EA 5KHDA 2XASA 4Y17A 3S2WA 1N33H 4ED6A 1WH2A 2A69F 4MAMA 4LSAA 1D8JA 4J01A 1A31A 2F4OB 4MV3A 4XL9A 1I1SA 4RGUA 1I50J 2ZNYA 3C7JA 2RDJA 4RAGA 5B1AH 5J2UF 4XONA 1P2FA 4M3EA 1HKTA 4JYKA 4ZI7F 3JAMZ 2K86A 5FKKA 2XKOA 4NC8A 5DUKA 2BVMA 4CCMA 2HDCA 2V6EA 4X1EA 2CV1A 4JV5H 5IP7G 2H94A 2LMDA 4G9YA 3RKQA 5IP9G 4S0HB 2ASDA 1MBFA 1IBMH 3V7SA 2R8KA 1XC5A 4C3HJ 5E79C 1UAAA 3H3UA 2CQNA 4XN3A 1YYVA 2R3SA 4GO1A 1HW5A 1K1QA 1IJWC 4OMYA 5DG8A 5E18F 2GLOA 1S97A 4I4TF 1WQ2A 1XS9A 2E5ZA 1I1GA 3BZCA 1C0WA 1D0XA 2ZJQF 5K7ZA 1QRYA 1S7AA 3FXLA 4F50A 1Z91A 1WRJA 3OS2A 3MKYB 4A93J 1DV2A 1S29A 4YIFA 1V9PA 4EVIA 2QGUA 2HQRA 3KX2A 4ON0A 1D8KA 3BR1A 3UNGC 1RC9A 1MBGA 1ETQA 4A5NA 2NU8B 4CYCB 1EUDB 2JN6A 4LF5H 5FPOA 4A2AA 3MFIA 2RV8A 3GLKA 3R5FA 2VOOA 3IAS2 1VQNI 2YU3A 4KJZA 3I4PA 4HQMA 2LREA 3BR2A 4H4KC 1G3YA 2R84A 4M72A 3BG7A 4RNMA 3H4DA 1SFKA 1N48A 3S14J 4XX0B 3S1RJ 3F6OA 1T95A 1X2MA 2PJRB 3W2VA 4C2MJ 3HSEA 1A0IA 1ZGAA 5LGUA 3FX3A 2LK2A 3EETA 2JRMA 3Q8PB 1IV8A 3KLNA 4ECVA 2P5LC 1G3TA 3RB4A 5LYJF 1WI9A 4KN7X 3BR6A 3HOUJ 1IGNA 1RESA 4C2UA 5H6QA 1MKMA 5JR3A 3PW7A 2M7AA 4MHGA 2O6GE 2QENA 4BDZA 3WTSC 4BUPA 2M8GX 3HKZA 4C30A 1SFEA 2DLNA 1TP4A 1LJ9A 4Q44A 3SXYA 5DCMB 3MKWB 3K1MA 2B0LA 3VB2A 4B47A 1VQ5I 1OLTA 5TGTA 5A2QW 4UHTA 4AVZA 2UXCH 3DPUA 3LL7A 4PGGA 1XDNA 3JRHA 4C3IJ 3RQIA 4M7EA 5CQGA 4RLFA 4HPQA 4O4IF 4A3DG 2VUMG 2VC1A 2F5VA 1NK2P 5D5UB 2JTVA 2FA5A 3H92A 2FPPB 4O6JA 2OD5A 3H0GA 3CDIA 3LWFA 5E1XA 3A4CA 1I3QA 3AG4H 2BW3A 4RGXA 3HOYJ 4ED7A 3V4SA 4IWYA 3PNVA 3PUFA 2WV0A 3DBHB 3E97A 2I8CA 3H4BA 3IWFA 2ETHA 2XIGA 4EBCA 5C44J 2L9SA 2VKEA 3ZQFA 1ZREA 4ZZDA 5L3EA 2JK3A 3K7AJ 3S1MJ 3IHUA 2A6HF 5FLXW 1Y0NA 1QO0D 2HI3A 2W70A 2RKHA 1LFUP 3I4NJ 1ETYA 1HNXH 1SVMA 3C3WA 1VTNC 2VBYA 2JA5J 2FSWA 2PMUA 3ERMA 4UUVA 2ZBKA 4W1UA 1ENHA 1AUVA 2J9GA 2XCPA 4A3KJ 2XVCA 2VE8A 1EH8A 1ON1A 1QU3A 2ECCA 5GTHC 2KDZA 4PGHA 3LSIA 5L1JA 3G1OA 2HOTA 2WBMA 2YS9A 1LE8B 3HXLA 4HX7A 4GYIA 5AONA 2VPSA 4ED0A 1MNDA 2XAJA 2DDAA 2VQHA 3ZXSA 4PDBA 2CZGA 1S6LA 2DZDA 5BPIA 5FKOA 5KK1A 4HLYA 4E7ZA 3I56I 4B43A 2OH2A 3SDBA 3JSLA 4I01A 4A3CJ 2KPMA 1I39A 3FBNB 4FX0A 1EH7A 3LQQA 5FRNA 2FBKA 3GZ5A 1VZ0A 3OOPA 3WTXC 1I7LA 3W6VA 3F22A 4QIWA 1Z67A 2IMWP 3C2HA 3Q5FA 3GBGA 5KNLA 1GDTA 1W7PB 1BI3A 1RR7A 2HZDA 3MKLA 3Q2OA 2JA6J 2NOGA 3FDYA 1XGSA 5BQTA 2L9NA 3H0DA 3KYCB 3HGYA 1RI7A 1TLHB 4OAYA 5F0FA 3ABLH 1FIAA 5E8GA 4YIIA 1BC7C 2K9NA 1VI0A 1FX7A 2DCEA 3S3NA 5KFJA 4QLCU 4RS8A 4HNTA 4FISA 1RRJA 3BZKA 3PL8A 1WR2A 2J5OA 4MQVA 1YITI 2C2RA 1ZHSA 1TWHJ 4XKWA 2YU9A 2KT0A 5GPCA 2LKPA 5EZYF 4I55F 5LGNA 1NG7A 1KQ9A 2P6TA 5KFMA 3RQ4A 4ZQIA 3I4NG 1KYZA 1R23A 3ZN0A 2DPJA 2E2HA 2CUZA 2K85A 1VBHA 3JTHA 3KAJA 1KONA 4UUTA 1N78A 3ETJA 2V4RA 3OSNA 3LSJA 4DV7H 4D1QA 3GLLA 5JVGF 4X0GA 5BNGA 1EUCB 1EHIA 1T36A 2OJED 3KHHA 3BAAA 5IOYA 4G7HF 5KFFA 2IA2A 3HYIA 2M9HA 4BEHB 3J80W 3Q1KA 4FE7A 1WJFA 3MQ0A 5K7FA 1HF0A 5TJJA 2FK1A 4O3RA 4GLXA 2GXBA 5EOYA 1USTA 3M4IA 2MBFA 4Y33A 2AGOA 3IV5A 1IBKH 3V4ZA 4RM2A 4XOTA 3OYEA 1ETVA 3BQYA 4Y13A 2ZCWA 5KFTA 4DL3A 2ZJTA 1D1AA 2WAEA 3WU2C 4KT6A 3EPZA 4AWXB 4Z6YA 4ZZLA 5ICEA 3K3VA 2MLGA 2AXLA 2OZ6A 2R4GA 3IRQA 4I6ZA 2VQLA 1ULZA 2V9PA 1EH6A 4FX4A 2O5RA 1D5VA 2X48A 2W24A 2L5QA 3PR5B 3RBEA 1LDKB 5KFLA 4HX4A 5KT6A 4D7MA 5DTDA 3ZMUA 1ZQ7A 4XKBA 5E20A 1P7JA 3JRGA 5KT3A 4Q45A 4XMYA 3GILA 2HOAA 1R5GA 1W4MA 3CD6I 3I59B 3OR1C 4BDYA 4DR5H 3OIPA 4EJOA 2W9CA 3PO2G 4Q47A 3V8LA 4XLCA 3JCUC 3S1QJ 5BPHA 4EYHB 3HTSB 2VOBA 1FJGH 4F55A 3PFYA 3V7RA 1XMXA 2EA4A 1FEXA 2SCUB 2M0CA 4HRIA 2GPWA 2P6SA 4OU0A 3IC7A 5TRDA 3UKGA 2YS6A 4WBNF 3BT9A 1F4KA 1G59A 1Z1DA 1XSDA 3KTMA 1TWFJ 2P5KA 1JLLB 2PN6A 5DYMA 1IF1A 1ZRFA 3GTLJ 3V6KA 3KLOA 4Q8FA 1MNEA 5FLXZ 1FP1D 2Q2TA 3HZJA 4ENNA 2BY0A 1ZETA 4LMYA 2CQKA 3OMYA 1EYZA 2WADA 2EIKH 4ECTA 5DQHA 2HU9A 1Z05A 2ZMEB 3CP8A 3T5LA 2BY2A 2HTJA 3I58A 1FNNA 1XG1A 5ED4A 1SC7A 2FE3A 3T5JA 4FBTA 4BWSC 2WV1A 2KIFA 1SFOA 5TISC 1YQAA 3HIFA 4HQEA 5KFAA 1WI3A 4MGRA 2EJRA 2W6OA 1DQUA 2YL2A 1P7IA 1BR1A 3BTCA 2KSWA 2LYCA 3GX4X 4PJNA 4L18B 4ASNA 4ESBA 1B4AA 4ECUA 2WA0A 3OIOA 4KICA 1Z6RA 3F3XA 1VQPI 2L01A 4MEYF 5KFVA 4U7DA 2A3SA 4DV2H 1W0TA 3GUDA 5JLWA 1MJ9A 1BGWA 1GSHA 5KG7A 2AHQA 2QSHX 3MZHA 1LVKA 3J7AK 4A3BG 2QSFX 3HOWG 2IGMA 3CMYA 1JKJB 2K27A 3R5HA 5FFXA 3DU5A 2NU9B 3WNZA 2VKHA 4E4TA 1MBKA 3DPLC 1PYVA 4LG0A 2CFOA 4BJ5C 5JHUA 2R7VA 2QQBA 4O4LF 2EV6A 3LA2A 4KISA 2EFPA 1FZPB 4UCTA 3GV8B 3ULQB 1UNNC 4A93G 4EYIB 4J9PA 3J80Z 4JI2H 2Z16A 1Y0UA 1SFXA 4B3MH 2FBHA 1JJ8C 1UHMA 2DBBA 1B33N
chains in the Genus database with same CATH topology
3CJNA 3RYRA 3HSRA 1J0RA 5CVUA 1GXQA 2IVMA 3COAC 2K7LA 4KN4X 3G3ZA 4RAZA 4DV3H 2LF7A 4MTEA 2V1UA 2WYOA 5J8FA 2L54A 1Z2NX 1CGPA 4S04A 4I98B 1SD5A 3RJ0A 3ZMVA 3WTTC 1QGPA 1KQ8A 2BV6A 2VN2A 2KKOA 2YR2A 3ZMZA 1PDNC 1O7LA 1P4WA 2ISYA 3RTXA 3M9AA 3RKWA 2DTRA 5LHHA 2F5EA 4JI3H 4CC6A 2XAFA 1OPCA 3WTUC 2M5WA 1XB4A 5CVJA 1XMKA 5HDNA 4YY3H 3L09A 2DPUA 2G7HA 3JSPA 4TV7A 4EGYA 2JRTA 3CO7C 3WODF 3LAPA 2D45A 2H6BA 3QAHA 4CXFA 4MV9A 1IUYA 3I71A 4EMSA 1XCVA 1P4XA 4HDVA 1TNTA 1Q1HA 4A2UA 2ADUA 2GA2A 1GVJA 4R79A 2HKXA 3BOQA 1B6AA 2IJLA 4MQ9F 1XGNA 5DUIA 2PLYA 2Z9OA 4JI5H 2WC2A 2RGRA 4LG0B 3PN1A 2YX7A 1GXPA 1U5TC 1OYYA 1W7PD 1Z7UA 1G3WA 1QNTA 4LFCH 4I0BA 5HOOA 3WE3A 3WTWC 4EGZA 1IRGA 3OTOH 1T39A 2CGPA 2ISZA 1G4DA 3LMLA 1IAWA 3EUHA 1TNSA 2IA0A 2UXBH 1TQPA 3WE2A 4YHHH 4L9NA 3F21A 1TQIA 3E6DA 2ESNA 4BQAA 4BHPA 1P8LA 1B04A 4HF1A 4LLGF 1SD6A 4EJTA 1LB2A 3WTVC 4JI6H 2PI0A 4BH9A 3JW4A 2XGXA 2LNBA 4UVBA 3LSTA 4UV9A 4LFAH 2BBYA 3DKWA 4IJAA 4NQWA 5D1PA 3FHZA 3ECHA 1ZG3A 1RIOH 1R58A 3PQKA 4KIGA 4GKKH 1KU2A 3WG9A 3BY6A 1SYXB 1TW2A 3KXYT 4YFXF 3MEXA 3WGHA 2UUCH 3KEQA 4XSZF 4L0ZB 4RB2C 3FF5A 4U0WA 5L3CA 1YS7A 5HLGA 5D6FA 4RGRA 1IN5A 1XGMA 3E6CC 1LQ1A 3R0AA 4LD5A 2E1CA 2MLKA 5HS9A 2WE6A 2F5CA 1R00A 2OZUA 2ESHA 4X65H 5FLXK 4JK1X 2OWOA 5D1OA 2K4JA 3BDDA 3DF8A 4KT5C 3PFIA 5HS8A 3MWMA 3E5QA 3M1EA 4BHBA 4EJUA 3GVAA 4NXMH 5EEHA 3W6KB 2L3DA 1YIOA 4RAYA 1ULYA 4B09A 3F8BA 1MGTA 2FNAA 4M6YA 3RDIA 1M0TA 1G3SA 2Y48A 2Z99A 5DEQA 2HOEA 4IRIA 3J80K 1ZHFA 2VOPA 1ZLJA 4I09A 5ICCA 4UCUA 2HEOA 1HXDA 3T8RA 2O61A 4ZYHA 1BM9A 3FMRA 4OX9H 5F64A 3HUGA 5E17F 1BBYA 4JQFA 1IN6A 1O57A 3F8CA 3E6MA 2M8EA 1OYIA 3F72A 4EQQA 4HA8A 2NNYA 1HSJA 4YG2F 1IW7F 1CF7B 4F7ZA 1XDUA 4JYAH 4LGWA 4DV0H 1TTYA 1SMTA 1SD4A 5FO5A 3BP8A 5K5OA 1E2XA 4CYDA 2ZFWA 2G9WA 1MDMA 2STTA 2DFIA 4LSXA 4I2OA 1I27A 1T0FA 4DV5H 2Z3YA 4LF6H 1S3JA 3T1YH 4MNUA 5F6FA 1ODDA 4U7BA 2H6CA 2L4MA 2LDUA 3ZMTA 2FMYA 1K7AA 3ECOA 4X64H 2EFNA 2Y0MA 1ZLKA 3I54A 4BHCA 2ZM6H 2ELHA 4ZH4F 1O3QA 3HSFA 2JZYA 4A6EA 3T5XA 4XBFA 3J81Z 4ESJA 1XNQH 1X3UA 4M9XA 2A6EF 1U5TA 1TA8A 2XAGA 1O3SA 1PP8F 1LNWA 1YLFA 5CJ9A 2GZWA 4NB5A 3F8NA 2JPCA 1QPMA 2CW8A 1AOYA 4D0PA 2YCHA 5L3FA 4GCVA 1U2WA 4OIPF 1YO5C 3M7GA 1FBUA 3HOTA 4KMUX 4IHTA 2DK5A 2ZO4A 1BI0A 2RDPA 4PCQA 3HTUA 1S7OA 3CO6C 2FNPA 4OOIA 1FSHA 3CUOA 1FBSA 5JI6A 3L7WA 2IW5A 1R1VA 3QPHA 3GWZA 3FXUA 4DR7H 3FWEA 3ZN1A 4HF2A 3F23A 3DPTA 1FLIA 2YPRA 3KEOA 1JXSA 3FM3A 1E17A 3RGZA 2Q8KA 4HAMA 3GFMA 1DPUA 2FF4A 4CICA 4KYWA 4G94A 3NQOA 4X66H 2UZKA 3RYPA 4WF2A 3I53A 1R5HA 1HNWH 2KRFA 2DO7A 1T2KA 5LLQA 5DD4A 1YG2A 3DQVC 3EQLF 3CTAA 1AN7A 4L5IA 5D5WB 1XSVA 1B9NA 3J81W 3FMAA 4JI7H 4WWCA 4G8XA 3B02A 3IKVA 2L02A 3AAFA 1PP7U 3UQ8A 2E1NA 4JI8H 1BJAA 4CGZA 2H27A 2BE5F 2HFHA 1XSXA 2HVRA 1GYFA 3SQNA 1T6SA 4QWQA 4LLLA 3ELKA 1MZBA 2UXDH 1YS6A 2GWRA 3KP7A 2XKPA 5LBQA 4X62H 4DNCA 2WDTA 2TDXA 5ICGA 1ONVA 2NAZA 4DR4H 3T1HH 4EV0A 5L3BA 3MZYA 3O2PE 1M0WA 5HLIA 2DW4A 5AIPA 4RGSA 4A5MA 4HDUA 4U0VA 1P4AA 3IWZA 1R36A 3TO9A 1XMQH 5DV5A 3KP6A 2UU9H 1JHFA 2PQ8A 2P8TA 1SFUA 5D8KB 1F5TA 3DP7A 2JT1A 2F5FA 3I59A 4LB6B 4EEQA 1UFMA 2R7FA 5ILUA 4P55A 3EYIA 2HQNA 3KE2A 4R8HA 4GGGA 2DLLA 4EFEA 4CC5A 4CO8A 5JFRA 3I64A 3IL2A 5K5QA 3C0FB 4IVNA 1MD0A 5J6XA 4UCVA 4DV4H 2QWWA 2HYFA 2QBYA 1Z2PX 1BIAA 2RNJA 3D5LA 3K1NA 1R1UA 4XLPF 1FSEA 5LGTA 3I0TA 3RIZA 2ACJA 1DPRA 2FQ3A 1FY7A 2VT2A 2W25A 1WWXA 4EJVA 2O03A 3K9TA 4N9IA 2VBZA 3LFKA 3C1DA 3N42B 1W5TA 3BPVA 4G6DA 4CHUA 2CYYA 3BWGA 4P9FA 1FYMA 4Z2YA 1XNRH 1REPC 4IHSA 1LDJA 3ZPLA 1U3EM 3N41B 5ILVA 3E6BA 2ZXJA 4JI0H 1V4RA 4HV5A 1H0MA 5LRRA 3L4JA 1W7PA 2OBPA 5IT9Z 2VBXA 5E1ZB 2WWYA 1B1BA 3E5XA 2EV5A 5D4RA 3ISPA 4O5VA 5E8IA 2HZTA 4KUMA 4LF9H 3HHHA 4UCSA 1USSA 4L9JA 3KP4A 3HOSA 3RI4A 1OYWA 2ZJ2A 3BZ6A 1Z9CA 1LDDA 2X0LA 3ZP5A 1LEBA 2GAUA 3G73A 2K4BA 3GO5A 5L3DA 1J75A 3GW2A 4LH7A 4JI1H 5AIQA 3KCCA 4UFZA 4ZYDA 4L0YB 4DQ2A 4MV7A 3F6VA 3TOBA 4EM1A 1J59A 2UXNA 4HX8A 3TOAA 4DR6H 2NRAC 1W5SA 2E5LH 2A61A 3Q9SA 3BJOA 3QRFF 1JGSA 1O7FA 1K78A 3W6JB 4AIKA 1FPQA 1OR7A 2RGVA 3ZQ7A 4ESFA 2V1XA 1HR0H 3LQRA 2CW0F 4AD9A 4KNYA 1XCBA 2C6YA 1I6XA 5A2QZ 3TO7A 2HTSA 4LK0F 1I6UA 1N34H 2GQQA 3HRUA 1N32H 3GEZA 2NS0A 4LF4H 2DI3A 4M9SA 4JBAA 2ZKZA 1DP7P 4HYEA 4MEXF 2V1DA 1EV7A 3IG0A 1X9NA 5IWAH 4FT8A 3RIRA 1O3TA 4U0YA 4UVAA 2O3FA 4WXCA 2PFBA 4GXOA 1ZARA 2XRNA 1QZYA 1IXRC 1HBXG 3N44B 2VQEH 5K1YA 4A0YA 1L0OC 4IXAA 1DDNA 1FC3A 3L2CA 1XGOA 4S05A 1JE8A 3N43B 3RPUA 2V6CA 4WCGA 3CDHA 3RGXA 4KA4A 5LRSA 1K79A 1AWCA 3LAJA 3N97A 2VONA 3VOEA 2A68F 5ICFA 4FHTA 1WKMA 5BMZA 3L00A 5DD8A 2HWVA 3O6BB 1RUOA 1ZAOA 4LB5A 2MC3A 1QBJA 2JPBA 1NHAA 3OV8A 5JVTA 1O75A 1ZH5A 3ML6A 5K5RA 3WGIA 2F2EA 2IPQX 2M87A 3NRVA 3J81K 2P7VB 3I5UA 2FU4A 3EDPA 1KA8A 1KGSA 2UUBH 2W57A 2XAHA 3P9IA 3JSNA 4K2EA 1P6RA 4PDKA 1XN7A 3FXQA 4OMZA 1P92A 1IRFA 5D8LB 2J5PA 1B9MA 1U8RA 4HV6A 4Q48A 3RPQA 2EV0A 1HKQA 1BC8C 4EFBA 2A5YB 1J2XA 3R61A 4M71A 1J5EH 4XLNF 2JSCA 2FXAA 2HHHH 3CUQB 3TGNA 1ZG5A 2KJBA 1ZRDA 2VODA 2QLZA 5FGMA 3T8TA 2CG4A 3P9CA 2EA2A 2G7UA 2YSRA 3SZTA 1MDMB 3KZZA 3IRRA 3KP3A 2PBIA 4WXDA 4UCRA 4N9HA 4DV1H 2D2WA 4NHJA 5DCMA 4WXHA 1MJAA 3KALA 2OU2A 5LHIA 3QP5A 1K78B 3N6XA 2STWA 3QOPA 3ROUA 2QYOA 5EEGA 2HGSA 3SFZA 3JTGA 3LA7A 1G6NA 3JAMW 4KHPH 1ZRCA 4DUZH 4WX9A 5BOXA 4A0XA 2IA1A 2ZMEA 2BYVE 4G7OF 4KMFA 1WSUA 4AVPA 2DT5A 1FVIA 4RZQA 1SD7A 2DK8A 2LSOA 2QQ9A 2HVQA 3TO6A 4GKJH 3ERED 4L9VA 5J8CA 1XD7A 2QM3A 5D1OB 3KP2A 3RKXA 2A07F 2PJPA 2F4VH 4HOBA 4Y15A 2E7XA 2VBWA 3H20A 3B73A 3FZVA 2Q0OA 4DR1H 2GIVA 3DEUA 3BA8A 5IT3A 2E7WA 2LF8A 4HZFA 5IT9K 1I5ZA 5HLHA 3KFWX 4RB0A 3FM5A 1IXCA 4I0AA 1KU9A 2OQRA 4KIFA 2AS5F 4HW0A 2HYGD 4XRFA 4RB3C 1OKRA 3CUQC 4B3SH 4DV6H 2MH9A 3HRSA 3L2PA 4I02A 4R1HA 4AIHA 4L5JA 5KVRA 3FXRA 2XUBA 3DV8A 3F8FA 3R6SA 1IBLH 4FM9A 1KU3A 2FEZA 3Q9VA 2MA3A 1XMOH 2V9VA 3JSOA 4G7ZF 1TAEA 4HLXA 1L2ZA 3GYHX 2QBYB 1KYWA 1BN5A 3QPTA 1IN7A 3BJ6A 3QP6A 5DDGA 3RF2A 2Z33A 1R7JA 1LVAA 2OAZA 2Y75A 5BS6A 4LLNA 2F5DA 3GXOA 1JHHA 2KJCA 3KP5A 3O3KA 2RN7A 3K0LA 1FBQA 2FMLA 4IF4A 1DGSA 3NEUA 1E4FT 2HKOA 2CSOA 3TDUC 4M6XA 4ENJA 2YX4A 1A04A 3KZYA 3T1BA 4ENKA 3SHFA 3VEPA 4UNOA 3GF2A 4YFKF 3MCZA 5A2QK 2DU9A 2BGCA 1SAXA 3V8JA 2XV4S 2VC