4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
molecule tags Transcription
molecule keywords Peroxide stress regulator PerR, FUR family
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
1FNNA 1T39A 3ECHA 2XIGA 3PQKA 2E7WA 3B02A 5L3BA 2E1NA 2A69F 5KK1A 1D3YA 4XLPF 3K9TA 5AONA 3GO5A 2V1XA 1ZYRF 3LSTA 2KRFA 4DQ2A 1MDMB 1U5TA 3RPQA 1TQPA 1U3EM 1EH6A 4Q47A 4XLNF 2HOEA 4EGYA 5KVRA 4I2OA 2ESHA 2NNNA 1OR7A 3KLNA 4HOBA 2OU2A 2NRAC 2JPBA 2VT2A 2AXLA 1P4AA 2XAFA 5CVIA 4S04A 3R0AA 5A2QZ 2O6GE 2RQPA 3E6CC 2ZKZA 1HBXG 4FT8A 3V4GA 4D0PA 2QBYA 5L3EA 1YS6A 5J6XA 3MQ0A 1ZREA 4IHTA 4GYIA 2ADUA 1PP7U 2IVMA 4IRHA 3KP5A 5DEQA 2OAZA 2R7DA 1XGSA 3WTXC 1MGTA 4IJAA 3MWMA 2FBHA 1XMKA 1RI7A 2P6TA 2XKOA 1YIOA 5DDGA 4Y13A 1ZG1A 1ZH5A 1IF1A 1ZLJA 4IF4A 1L0OC 2HR3A 2UZKA 4LK1F 2F5EA 3SHFA 4HQMA 2O8XA 5DUKA 2K27A 1J7KA 3GFLA 2E1CA 3HSEA 5ICCA 2BYVE 2DQLA 1BM9A 2HYGD 1BIBA 1F5TA 1S3JA 4L9NA 3ZQ7A 2W84A 4KN7X 1T38A 1VTNC 2JTVA 3QPTA 1XCBA 5D4RA 1R23A 2EA2A 1IZ1A 2DQRA 4HZFA 2D45A 3R60A 3NQOA 1XGMA 2M30A 3LA3A 1LDKB 2L3DA 1G6NA 1JXSA 1FYLA 2H6BA 1USSA 3EYYA 1KU2A 2L4AA 4OIPF 4L9TA 1DP7P 1JE8A 3K69A 4BHCA 2W25A 1YQAA 2L54A 4KN4X 3T5XA 2HTSA 4RGUA 2V9VA 3QRFF 1SD6A 3Q9VA 2F5FA 4EMSA 3TO6A 2ETHA 3LA7A 2HQRA 2GA2A 1O3QA 2ELHA 4A12A 3PFIA 1LDJA 2VONA 3I59B 4O6JA 5JHUA 2ZFWA 1QZYA 4IRIA 3KP4A 3WTSC 3CLOA 1U6GA 4AVPA 2XAJA 4WK8F 4CGZA 5E18F 1OYWA 1S7OA 5DCFA 5K1YA 1CF7B 3CO6C 2Y0MA 4GCVA 3I71A 2DW4A 4M9SA 1U2WA 5E20A 1R22A 3DKWA 4RB3C 3FMRA 4UV9A 4M6YA 1LEBA 3I0TA 3HRMA 1YFHA 1ZG5A 5HS9A 2NAZA 2K02A 2IJLA 2QQAA 2ZMEB 4KICA 2CYYA 4WXHA 3FM5A 2LKPA 1HW5A 4JK1X 5ICGA 4LB5A 3TDZC 1JGSA 3OOPA 5F6FA 2HZTA 4MEYF 1XCVA 4KUMA 3LAJA 2CGPA 2A3SA 4A0ZA 4F7ZA 5ILUA 2EV5A 1ZGAA 4CZZA 2DLLA 3WTTC 3TQNA 1K78B 2EWNA 2DO7A 2Z33A 2EV0A 1XSVA 1LVAA 2NS0A 3Q5FA 2HGCA 3O6BB 4YIIA 1BC8C 2QBYB 5BS6A 4L18B 1IRFA 3CUQA 5EEGA 4KNYA 4AWXB 1B9NA 4OINF 2JT1A 3V7CA 3FM3A 5LEJA 1R5GA 1YO5C 3KP7A 3T8RA 4QWQA 3ZMDA 3U9GA 3SZPA 2OZUA 2HKOA 5K5QA 4HDVA 4P55A 4GYGA 2P5LC 1G3WA 3F8BA 4BYYA 2JZYA 3CJNA 4OIQF 5K5OA 5LHGA 5HLGA 3KFWX 4ENJA 3L00A 2VBYA 4MHGA 2DFIA 1P92A 3E6MA 3R4KA 2EJRA 2D1VA 5D8LB 2LSOA 2OQRA 4L9JA 3WGHA 2IP2A 3RIRA 2R3SA 4O3MA 2L4MA 2W57A 1MZBA 3HYIA 2GAUA 4LJZF 1BJAA 1PP8F 4G9YA 5BQTA 2G7UA 3MCZA 2Z9OA 5DD4A 3W6KB 2A61A 5E1XA 3HHGA 1ZGJA 1U8RA 3CUQB 1P4XA 4HX8A 2DAOA 2Z3YA 3LA2A 4CDGA 4NHJA 1U5TC 2FXAA 1FSEA 3GFJA 1STZA 1I1SA 1BN5A 2QQBA 3JTGA 4M9ZA 3IWFA 3C18A 1HQCA 1W7PD 3IKVA 3K1PA 3F3XA 5HS7A 4XSZF 2VE8A 4G6DA 3WTWC 1SD5A 3BZ6A 4OIOF 1ULYA 3PQJA 1WKMA 5LGTA 2TDXA 4WCGA 3IC7A 2A6HF 1ODDA 2JPCA 1K79A 4N9IA 1DPRA 3ZPLA 4LMYA 3TO7A 1S6LA 1XGOA 2KIUA 2W85A 4N9HA 1GXPA 4KYWA 3GZ5A 3VODA 1W7PB 1HW1A 3IHUA 1HKTA 3E3VA 3EYIA 3TOBA 3BJAA 4YFXF 3T1BA 5F1RA 4HAMA 2BBYA 3EDPA 2X4HA 1X3UA 3H3UA 4U7BA 3RPUA 5E8IA 1J75A 3WG9A 5DD8A 2A68F 3V8KA 4RGRA 2FA5A 1XDSA 4ESJA 5BMZA 2YR2A 3FXQA 1HW2A 1LB2A 2YX7A 2XUBA 1MJAA 1FP2A 2HDCA 2MD5A 2M45A 4WF2A 2QVOA 1CGPA 1QPMA 5LBQA 3W6JB 2PLYA 4I01A 3P9KA 1J5YA 2ISYA 2XASA 4HLYA 2LF8A 5CJ9A 3FMSA 1W5TA 1HSTA 4M9XA 3Q9SA 2OD5A 2FF4A 3QU6A 2ZO4A 3M8EA 2VBZA 1P6RA 1SFUA 4NB5A 4ON0A 2XV4S 1KU9A 1BI3A 1YG2A 5CVVA 2WV0A 3WU0A 3FHZA 3WODF 3IKTA 2Q2EA 1R1VA 3F22A 4HF1A 1YYVA 1O57A 1XB4A 4IPAA 5CLSA 4M6XA 1SFEA 1YLFA 2VODA 3E5QA 2VN2A 5JI6A 5ICFA 4JQFA 2P5VA 2STWA 2GZWA 3HRTA 3DP7A 4XRFA 4OOIA 2KIFA 5FLXZ 5LLQA 1B4AA 3D5LA 4HDUA 1P2FA 4H0EA 4BNCA 3CO7C 1R00A 5BPDA 4A5MA 4WX9A 1Y0UA 2MLGA 1BI0A 4U88A 3BOQA 2HYFA 3I54A 4L5JA 1WI9A 3LAPA 2V6CA 3SZTA 4LLNA 2XGXA 5L3FA 4ETSA 5ED4A 3FWEA 1KA8A 1WQ2A 4RAZA 1SD4A 1QBJA 3ECOA 1KGSA 2K4JA 2A5YB 3I58A 2DPDA 5ILVA 1FT9A 2PN6A 1GXQA 1IXRC 3SQNA 1BI1A 3ZMSA 1KQ9A 5FB2A 1IN7A 1IN8A 1F9NA 2LF7A 4Q5SF 2ZXJA 5HDGA 3BPVA 1IUYA 1MKMA 3NEUA 3M7GA 2LDUA 1FYKA 3G73A 4YFKF 3ZN1A 4DNCA 3J81K 3K2ZA 2OZ6A 1R1TA 2O3FA 1YW9A 2XRNA 4GXOA 1QNTA 1SFXA 1T98A 4KMFA 1H9TA 4TV7A 4UVCA 1K7AA 3OV8A 2MLKA 2VC1A 2VBWA 4P9UA 2O03A 3EUHA 3C1DA 2A07F 1UB9A 3GYHX 1Z7UA 4YFNF 2NYXA 5LGUA 3I5UA 1L3LA 3T8TA 1FWZA 4RGXA 3F8CA 1BBYA 4UHTA 4B09A 3JSOA 2W24A 4IRGA 1FC3A 4FX0A 3V7RA 3WTUC 1WSUA 4HX4A 3DF8A 5LRSA 1TLHB 5E8GA 5L3GA 5CVJA 3TGNA 4L0YB 4I09A 3QP5A 4ZH4F 5ICEA 3TOAA 3V8LA 2GIVA 5IT9K 3MZHA 3FZVA 2YX4A 1O3SA 1NHAA 4QLCU 2P8TA 2VE9A 2EFOA 1S8NA 3NRVA 4EJOA 4RB0A 6PAXA 1OPCA 1UFMA 1RNLA 4PCQA 1ZRFA 4IXAA 3EQLF 5BPIA 1QQIA 4G7HF 3J7AO 2PQ8A 4UXNA 4UVBA 4PGGA 2BV6A 3KETA 1ON2A 1O7LA 3WU1B 3HHHA 1Z9CA 3WTYC 2H94A 5DYMA 3T0YA 3QP6A 3R0JA 4UV8A 3FXUA 2ACJA 4EM2A 2H27A 2EFNA 3ZMTA 1HKSA 4EV0A 1O7FA 3H3ZA 2RN7A 2YU3A 2K7LA 4E70A 2VOOA 1Z05A 1ZG3A 4HBLA 3GFMA 2FNPA 4G94A 3AAFA 3L09A 2COMA 1OKRA 3DFGA 1R1UA 4I98B 2ZCWA 3DPLC 2PMUA 4OMZA 3B73A 2PEXA 1MJBA 4EJTA 5D8KB 1C0WA 4P96A 4CHUA 3ERED 4L5IA 2MH2A 5FD6A 3P9IA 2VXZA 5TJJA 4I0BA 1DUXC 1XDUA 4EM1A 2CO5A 2Q0OA 3TO9A 2FNAA 2RVCA 2YPRA 2EFWA 1XSDA 1TNSA 5L3CA 2YSRA 1ZAOA 5JR3A 5HLIA 3ML6A 2HQNA 4A0XA 4BH9A 2F2EA 1G3TA 4HV6A 1V3FA 2RDPA 4AIJA 4JBAA 1FOKA 2XAQA 3FMQA 2V1DA 2GA1A 2L02A 5TRDA 1KU7A 4RS8A 4KDPA 4ZYHA 3F21A 3RKYA 3RJPA 4UNOA 3LFKA 2IA1A 1FBSA 4EJWA 1Z6TA 2O0YA 3HIFA 4CO8A 2FEZA 3M8FA 2MH9A 3P7NA 4LB6B 3REOA 4UUVA 1PUEE 3IRRA 2PMHA 3GFIA 1R7JA 1J2XA 1EH8A 1H0MA 5H20A 3E97A 1IN5A 2Y75A 3BP8A 5J8CA 2GXBA 3GXOA 1T2KA 1Z6RA 2HFHA 2XKPA 4KIBA 2HEOA 1HKQA 1F4KA 3FF5A 3QPHA 3L2CA 1V4RA 4U0VA 2QM3A 1R58A 4ESFA 2P7CB 5LHHA 2HKXA 2LNBA 1JHHA 2KIMA 4Z2YA 4HX7A 1LNWA 1KYZA 1QZZA 4ENKA 3QAHA 3ZMZA 3CDHA 3HOSA 2M1BA 1TQIA 1HSJA 1J0RA 3CUQC 5HS8A 3J81Z 2XAGA 2XVCA 3EETA 4WWCA 2KKOA 4U0YA 4HF0A 4ESBA 5DUIA 1FLIA 2A6EF 2WWYA 1T0FA 4I7HA 5CVRA 4IVNA 2RC4A 4MGRA 4KIFA 3JTHA 2RGVA 1Z91A 3GZ6A 1FY7A 4U0WA 1RUOA 2ZBKA 1SD7A 3KP2A 5FFXA 1D5VA 4HQEA 1YTYA 2FSWA 3TKYA 3K1NA 4IHSA 2DBBA 1QGPA 5ERIA 2GWRA 4MQ9F 5FGMA 3RYPA 3KEQA 4OIRF 2QQ9A 5CVUA 4KMUX 4Y15A 1U5TB 2H6CA 3L7WA 2Z5UA 3QOPA 3BROA 3J80K 3SFZA 4BXUA 2J5OA 2P6SA 1MDMA 5FLXK 2PJPA 3DQVC 3R6SA 2GXGA 2VBXA 5DCMA 3N4MA 1B1BA 5HDKA 2KJBA 1O3TA 1B6AA 3KP3A 5J8FA 3E6BA 5JVTA 1FPQA 5A2QK 4G6QA 3E6DA 5LHIA 4RAYA 1KQ0A 4ZZLA 3F6OA 1MJ9A 2E7XA 1OYIA 3RYRA 4RGSA 4B8XA 4Q4ZF 1WRJA 1UCRA 1FBUA 2FOKA 3F8FA 3GWZA 3HTUA 2RKHA 3BY6A 1YW8A 2J5PA 3FXRA 3KZZA 4PZJA 1TBXA 1OMIA 5F64A 1FZPB 2V1UA 4FX4A 1SMTA 1FX7A 3ABTA 4GO1A 1IW7F 2MC3A 1J9IA 4XSXF 4EGZA 3WE2A 3CUOA 3F8NA 4N0BA 2PFBA 3QU3A 1TNTA 1G3YA 2DI3A 3J80Z 2EB7A 2IW5A 3RI4A 3I4PA 2M5WA 2GQQA 2X0LA 3F8MA 2Q8KA 3VB2A 3HRUA 3GF2A 2MA3A 3O3KA 2ISZA 4MEXF 2OQGA 4RB1A 5LGNA 1BOAA 4KFCA 2IA0A 4MQVA 1J59A 1SAXA 3I64A 4FHTA 4MTDA 2G9WA 1CF7A 2IRFG 1UHWA 1REPC 1K78A 3KZYA 2QUFA 2L01A 1BC7C 1WWXA 4O5VA 3K0LA 3KCCA 5E1WA 4UVAA 1LEAA 2ZJ2A 2F5DA 2VC0A 5LEKA 4ZYGA 5H6QA 1AWCA 5AIPA 2OA4A 1XD7A 1D8KA 3GEZA 5AIQA 4ENMA 2FRHA 3RDIA 2ZMEA 1I1GA 3F23A 3COAC 4LG0A 5D5XB 1U78A 2D2WA 1RUNA 3M9AA 1FYMA 2UXNA 1GHCA 2DTRA 1K6OA 2DPUA 3KEOA 1E17A 1FSHA 2H09A 3TDUC 5D5WB 4WXDA 2PI0A 4XBFA 3S2WA 3MFKA 4LLLA 4L9VA 3E5UA 2QENA 3ELKA 4S05A 1F1ZA 3I59A 2CW0F 2ZNYA 2RV8A 3JAMZ 3ABUA 2V79A 3KP6A 1G4DA 1T6SA 3P9CA 3L9FA 2G7HA 3K1MA 3RTRA 3IL2A 3F6VA 4ZYEA 2FBIA 1P4WA 3HOTA 3H92A 3VEPA 4G7ZF 2CQKA 3ZMVA 4I02A 1IXSB 3M1EA 4YIFA 2AS5F 2CSOA 1IAWA 3D0SA 1IN6A 2UXXA 1HXDA 3GW2A 4CYDA 2PG4A 4BHPA 4A0YA 2HWVA 5JFRA 3ZP5A 1S29A 3KE2A 3WGIA 2CG4A 3MAJA 2BE5F 2P4WA 4HYEA 4WXCA 3BJOA 3HUGA 4U7DA 1QO0D 1GVJA 4LLGF 4ASNA 5D5VB 1UHMA 4CICA 1I27A 5HDNA 5L3DA 1ZHFA 4R1HA 4M73A 5DCMB 2EK5A 1LDDA 2VOPA 1IRGA 5K5RA 1E2XA 1XGNA 4LD5A 2C6YA 2MBFA 4LFUA 4CXFA 1USTA 4AIKA 2P7VB 3JSPA 2STTA 3GLXA 5FO5A 3LQQA 2DT5A 2QYOA 2JRTA 2BGCA 3DV8A 3JW4A 4AIHA 2FMYA 2FQ3A 1ZN2A 1KYWA 4PDKA 3I53A 1A04A 2FU4A 1R5HA 1EH7A 2UWMA 1RIOH 4P5OA 1SMYF 2EV6A 2WC2A 3ULQB 1B9MA 4ENNA 3HSFA 2Z99A 4GGGA 1KU3A 3VFZA 1XSXA 2QZ8A 1FBQA 1W5SA 5D6EA 2O61A 2KJCA 5LRRA 3KLOA 3MEXA 1LJ9A 4HA8A 2XROA 2WTEA 1ZRCA 4L0ZB 1AOYA 3DEUA 1B59A 4HV5A 4AD9A 5FD5A 3WTVC 4KIGA 4MNUA 3C7JA 3DPTA 1BIAA 4HF2A 2JSCA 2D1HA 2BEOA 4HW0A 1XN7A 5HLHA 1KQ8A 2EFPA 3SXYA 1I5ZA 1S7AA 2NNYA 5IT9Z 4M74A 4KT5C 4EM0B 1TW2A 1TW3A 3GVAA 3MZYA 4G7OF 4EQQA 4I0AA 3BJ6A 1JHFA 2EA4A 4KA4A 3ISPA 5EEHA 1ZRDA 1Z1DA 2FE3A 4G8XA 5D5UB 5IT3A 3WE3A 5CYVA 2VT3A 4Q48A 3F72A 3IWZA 3U2RA 1ZARA 2FBKA 2R7FA 5BOXA 3FX3A 2XHKA 1FP1D 4K2EA 2FMLA 2DK5A 5HOOA 3WTZA 2F5CA 2ESNA 2XAHA 2M87A 1ON1A 1RZ4A 2RNJA 4Y17A 4LG0B 1O3RA 1TQMA 5H6RA 5DV5A 1ZLKA 2HTJA 4ZYDA 1R36A 2DU9A 4A5NA 3VOEA 2DK8A 4A6EA 1Q1HA 4A6DA 2OBPA 1TTYA 2CWEA 4M71A 4A2UA 1XMAA 3ZMUA 4ZZDA 3HTSB 4EJUA 3GUDA 2HS5A 3JAMK 2Y48A 2ZNZA 4M72A 3IRQA 3HRSA 4BQAA 4R79A 1MD0A 4NQWA 3LQRA 4P9FA 1G3SA 4R8HA 4YG2F 2P5KA 4HLXA 3C3WA 3RKXA 1DDNA 3ROUA 1IXCA 3U1DA 3O2PE 4OMYA 2K4BA 4LK0F 5ILSA 2EFQA 5E1ZB 3DXJF 1IN4A 1EV7A 2B0LA 3WGGA 1OYYA 3V8JA 5E17F 3V7SA 4LGWA 4PGHA 1W7PA 1YS7A 2IT0A 4EVIA 5D4SA 1DPUA 2PBIA 3BPXA 3G3ZA 3R61A 3N97A 5FFZA 4BAYA 4RB2C 3E5XA 1YW7A 2CFXA 3ZN0A 2IPQX 4OU0A 2IA2A 4EJVA 1LQ1A 4MTEA 1PDNC 1I6XA 3HSRA 3GX4X 2QWWA 3BDDA 3LWFA 1D8JA 1W4MA 1BI2A 1H9GA 2QLZA 5HVQC 2M8EA 4BHBA 5D6FA 3CTAA 3RKWA 2K86A 1ONVA 3BWGA
chains in the Genus database with same CATH superfamily
1FNNA 3C0FB 1T39A 3ECHA 1VF9A 3N8DA 2XIGA 1I39A 4ZTJA 4BE0A 3HOWG 1YJ9I 4O3PA 4RMNA 4NXNH 3PQKA 1QA6A 2E7WA 2EZHA 1XS9A 4F4YA 3B02A 5L3BA 2NVTJ 4JI4H 2MW8A 4BEHB 1OJLA 1ZR2A 4JOMA 2E1NA 2LC2A 3RQ4A 2FKLA 4UCUA 2A69F 3G1OA 3RUPA 3I3LA 2ATLA 5KK1A 1D3YA 3X2QH 2FPPB 2EILH 3IUOA 4XLPF 1E0EA 3K9TA 2WADA 2WAEA 1PK8A 5AONA 3GO5A 4RM2A 5KFCA 1XNRH 2V1XA 5KFVA 4FBTA 1ZYRF 3OWTA 1MBKA 4IEJA 3LSTA 3PSIA 4XRSA 1JX4A 2UXDH 2E60A 2KRFA 4XNFA 1BR4A 4DQ2A 1MDMB 3OSFA 1MMAA 1U5TA 2DA2A 4IQJA 2C2DA 3RPQA 5KCMA 4QIWE 1TQPA 4FTHA 3ABKH 1QU3A 3ZQCA 4M3GA 1U3EM 2EIJH 1EH6A 2NOJB 4Q47A 5J4YA 3MD2A 3ETJA 3H5NA 5EF6A 4XLFA 3RAQA 2FUG2 2DFHA 1MSFC 2YW2A 4XLNF 1JUSA 2V5AA 2HOEA 4G3IA 4N4NB 1I94H 4EGYA 4ZYAA 4XN0A 2XSJC 1SVMA 1YJWI 3ABMH 5KVRA 4I2OA 4DL4A 2UVVA 2ESHA 2NNNA 3ERMA 2IP4A 1OCPA 1YX3A 1OR7A 3KLNA 4HOBA 1IV8A 3FXLA 5GAGJ 3OYLA 2OU2A 3FXMA 2NRAC 2BQRA 3P5JA 2KZVA 1BR1A 2JPBA 1WJEA 2VT2A 3DLAA 2AXLA 4BQOA 3AL0B 2QYZA 1P4AA 2FMAA 4UFZA 2XAFA 3RTXA 1DU6A 2ZM6H 5CVIA 4X65H 1IC8A 3AKZA 4AYBE 4S04A 2XGDA 2Y31A 3R0AA 5A2QZ 3MR5A 2Z2SB 2O6GE 1W5CC 1BJZA 2RQPA 2ZSIB 1PYVA 3E6CC 2SCUB 2ZKZA 4QWCA 1HBXG 5FLMJ 3GTLA 4YR0A 3K2AA 1XG1A 4FT8A 5KT6A 1RYRA 2Y0SA 3FIWA 4MLOA 3V4GA 4D0PA 2QBYA 2JA7J 4DOZA 5L3EA 1I3QJ 1V5EA 4XYMB 4BY7G 1M0WA 4PK4A 2BXYA 1YS6A 2DYRH 5J6XA 3RB6A 3MQ0A 1ZREA 2C35B 3U9TA 4IHTA 4GYIA 3KYCB 4B3AA 1C3OA 2ADUA 3M9OB 5EGOA 2HZDA 1PP7U 4IR9A 1NG6A 3OY9A 2LLKA 2IVMA 4IRHA 3UR3C 2GIZA 1XTAA 3KP5A 5DEQA 2OAZA 2IAIA 2R7DA 2KDOA 2VKHA 4A3IG 1XGSA 3WTXC 1MGTA 3AG4H 4IJAA 3MWMA 3GTMJ 5HBRB 4F4ZA 1W36C 3OSPA 2FBHA 1XMKA 4J9QA 3HOYG 1TZLA 2Y30A 2OF7A 4DZPA 2GPSA 1RI7A 1ETYA 1V5GA 2XF5A 3CQZJ 2P6TA 1I50A 2XKOA 1JJ6C 5JVLA 2C2EA 2R92A 1YIOA 5D1OB 5DDGA 4A93G 3Q8SB 5CQGA 5IYCJ 4Y13A 1ZG1A 5HODA 2XC7A 1ZH5A 4QW9A 5B66C 1ZLJA 4BEHA 1IF1A 4IF4A 4IHXA 4LF9H 1FVIA 3TP0A 2VJ5A 1L0OC 3RKQA 2QKMB 2HR3A 3EUAA 4L5EA 1WPKA 1UG0A 4MV1A 3DTIA 2UZKA 4LK1F 2F5EA 2KPMA 5J3LA 3SHFA 4J9NA 1ETQA 3T5JA 4HQMA 2XF6A 2AQFA 3OS0A 3KYLA 2O8XA 1VI0A 2ECBA 5DUKA 1RJPA 2K27A 2YS9A 4RDUA 1J7KA 3GFLA 2E1CA 2E71A 3HSEA 5ICCA 5L1IA 4DYCA 2BYVE 2DQLA 1BM9A 2HYGD 1BIBA 1QVUA 1S3JA 1F5TA 2DWCA 3G1MA 2VQFH 5LXTF 4L9NA 3ZQ7A 5BMVF 3HOVG 2W84A 1VFCA 4LF8H 1RRJA 4YAKB 4KN7X 3QWLA 1T38A 1VTNC 2MG4A 2JTVA 2CW8A 3GTKJ 2R7SA 1W96A 1WFXA 1X4OA 3QPTA 1XCBA 3FKIG 5D4RA 1R23A 2EA2A 1IZ1A 4M7EA 3RBEA 2DQRA 4KHPH 3PO2J 3A1YA 4OAZA 3GIJA 4DR7H 2DA7A 4HZFA 5DLFA 2AGQA 2VA2A 2D45A 3BTIA 4TUYF 5JUMA 3R60A 3NQOA 1XGMA 2M30A 3LA3A 5JHFA 5FRNA 1LDKB 3OMYA 4A3CG 3BLYA 2L3DA 4ECWA 1BL0A 4D5CA 1PVEA 2AQEA 1G6NA 2QSGX 2LR8A 3VSLA 1JXSA 1FYLA 2V58A 2H6BA 1USSA 3EYYA 1KU2A 4ITVA 3G2BA 2L4AA 3HKZN 4OIPF 4L9TA 2MYSA 2K5CA 1DP7P 1JE8A 4ED6A 1TL8A 1JDEA 4UCOA 3K69A 3H0GG 3H9GA 3Q8PB 1FJGH 4BHCA 3L2VA 3SYTA 3QYFA 2W25A 2R5YA 3K7AJ 1RJRA 3CCLI 2XGQA 1YQAA 1RR7A 4NBQA 2L54A 2X1CA 2R92J 4KN4X 5CB4F 5J1RA 3T5XA 2HTSA 4RGUA 3GTQJ 5FKOA 3SE7A 2V9VA 2VPQA 2OV7A 3QRFF 1SD6A 2RF4A 3Q9VA 3GTMA 1MIJA 1X1DA 2F5FA 3TO6A 1QVTA 4EMSA 2ETHA 2NVYA 2EZIA 3LA7A 2XB0X 2HQRA 2GA2A 1O3QA 4ED2A 2ELHA 3I9V2 5E3LA 2VQHA 4IHVA 3JRIA 4A12A 3PFIA 3J80W 5BR8H 1LDJA 3ABLH 3I55I 4XLCA 2VONA 1IOVA 3I59B 4O6JA 5JHUA 2ZFWA 1QZYA 3M8JA 4IRIA 3KP4A 2F6CA 4BS9A 3WTSC 3CLOA 1U6GA 1WR2A 4DR4H 1I3QA 4AVPA 1IBLH 5C5JA 1MNEA 2XAJA 4NQWB 4WK8F 4CGZA 2KQRA 1IO2A 5E18F 3CP8A 2OTLI 2LD5A 4RA2A 5GONF 1N56A 1OYWA 2W9AA 1S7OA 3EUHC 4BACA 5D1PA 4MA0A 2EQRA 5DCFA 5K1YA 1CF7B 5KG5A 3CO6C 4Y8VB 2OWOA 1ZK8A 1DQUA 2WB1N 3A4CA 4BWSC 2Y0MA 2E19A 5DQHA 2R5ZB 3BG5A 2R7UA 2CJJA 2R7WA 4GCVA 3GTOJ 3L4JA 3I71A 2IS6A 2DW4A 4M9SA 1U2WA 1JUPA 5E20A 2ECCA 1SYXB 1MMGA 3K10A 1MBGA 4PJJA 1R22A 5KFTA 1P7IA 3H4BA 4B3TH 1K1SA 3DKWA 2VPLA 3TL4X 5KG1A 4RB3C 3FMRA 1XMXA 1WJAA 4UV9A 4F93B 4M6YA 1QPIA 1LEBA 3I0TA 3Q1KA 3HRMA 1ERDA 3PN1A 4ED1A 4YRVA 2NVXJ 4IX7A 1YFHA 1ZG5A 5HS9A 3OS2A 2NAZA 3RJ0A 2BQUA 5CA1F 2K02A 2IJLA 2QQAA 2ZMEB 4KICA 2CYYA 3W2VA 3U21A 4WXHA 2L9VA 3KYDB 5KFPA 3FM5A 2LKPA 3F0CA 2OLSA 2W6MA 1HW5A 4JK1X 4ANJA 1BW5A 5ICGA 3OUZA 2JUCA 3K6GA 4B48A 1IGNA 3TDZC 2GLOA 4LB5A 4XZ3B 3BZKA 4LH7A 2RQQA 1DGRM 1V55H 2ASDA 1WZ2A 3OTOH 4EBDA 1JGSA 3OR1C 3N40P 4BDZA 4DBRA 3OOPA 1B72B 5IYCG 4ED7A 2RNGA 5F6FA 2HZTA 4FCYA 4MEYF 1XCVA 3PJRA 2Y69H 2M0CA 2W71A 4KUMA 3LAJA 2CGPA 2A3SA 4ZJZA 4A0ZA 2JEJA 4F7ZA 2E35A 3BR3A 5FLVA 2R7ZA 5ILUA 5J4VA 3JRFA 1E3PA 2EV5A 1ZGAA 3H4DA 2DMPA 4CZZA 2DLLA 4I76A 3WTTC 2UVUA 3TQNA 2OC6A 3BR5A 1K78B 2EWNA 4FM9A 4JUZA 3A2KA 2W6ZA 3WG7H 2DO7A 4JI5H 5J1YA 2Z33A 1WH7A 2DJIA 2EV0A 4UUSA 3W6VA 2PX9A 1XSVA 2CW7A 2N8GA 1X3WB 1K61A 1LVAA 4B3SH 2Q2TA 2NS0A 2FLNA 3OIPA 3Q5FA 3JRAA 2HGCA 4AVZA 3O6BB 4YIIA 3V6JA 3SEZA 1BC8C 3WU2C 2QBYB 1R9TA 5BS6A 4L18B 4JV5H 1UZCA 4LFBH 3GZNB 1HR0H 1IRFA 5IP6A 4CYCA 3G8CA 2YRXA 3CUQA 3OL3A 5EEGA 2M7AA 4AWXB 4KNYA 1X4PA 1B9NA 4OINF 2JT1A 3V7CA 1U9OA 2R6FA 5C3EG 3KHGA 3FM3A 5D8DA 4A3DJ 5LEJA 3K4NA 3CCYA 2L7MP 1X1BA 5KT5A 5C1OA 1R5GA 1YO5C 4MV8A 3KP7A 4V2FA 3T8RA 3OYBA 4C9YA 4QWQA 1X2MA 2CS3A 3ZMDA 5BPFA 2I10A 2ID3A 3U9GA 3SZPA 5F1JA 2WAFA 4YB8B 1V9PA 1S03G 2OZUA 1GUUA 5IYBJ 4YQWA 4DYQA 2HKOA 5K5QA 3GIKA 4HDVA 3KTMA 4P55A 5F04A 2BXZA 2V9WA 4GYGA 1H8AC 1X2NA 2P5LC 3N05A 1G3WA 1SVLA 4QIWA 4A3BJ 5IOZA 3Q2OA 3JAMW 3F8BA 2NU8B 4BYYA 4TQSA 2JZYA 1E4GT 5KX5F 3CJNA 1Z2PX 4BBSJ 2D5VA 4OIQF 5K5OA 5LHGA 3JZIA 5HLGA 5CA0F 5GADJ 3KFWX 5FLXW 4ENJA 3QYEA 4PWQA 1EKEA 2VUMG 2CV0A 3L00A 2FK3A 2VBYA 4MHGA 4D5FA 2DFIA 1P92A 5JVDF 3DBRB 3E6MA 3QODA 1RJQA 3OYGA 4UB8C 3R4KA 2ZJTA 4DLKA 2EJRA 2QK4A 1EUCB 2D1VA 5D8LB 2VQEH 5M5YJ 2ZXIA 5EG0A 1UMQA 2WAQN 2LSOA 1EHIA 1SEUA 2OQRA 3G71I 4L9JA 3WGHA 2PBZA 2IP2A 3RIRA 3S17J 4XN3A 1TWAJ 2R3SA 4O3MA 1MH3A 2L4MA 2W57A 3CJTB 1MZBA 3DEWA 3HYIA 2GAUA 4LJZF 5KFDA 2XPUA 1BJAA 2B7EA 1PP8F 3JREA 4G9YA 2LBFA 1P9QC 4H4KC 2ME6A 5BQTA 3LSPA 4A3CJ 1SC7A 2YRWA 4QIWN 2NVXA 2G7UA 3MCZA 5JH7F 1VQMI 2X51A 2Z9OA 1X3ZB 1EUDB 3ASOH 5DD4A 3W6KB 2AGPA 3M3YJ 3ZQFA 2A61A 2BY1A 5E1XA 3HHGA 1ZGJA 1U8RA 2WDTA 3RF2A 1ETXA 2YUSA 3CUQB 3HOWJ 1P4XA 2LBFB 3U9SA 4HX8A 3G6VA 2DAOA 3PVXA 1S10A 3BJYA 3PNYA 4A3MJ 4R8UA 2Z3YA 1KJ9A 4DGWB 3LA2A 4CDGA 1ETWA 4NHJA 3OYIA 1U5TC 2FXAA 4EEQA 2OPTA 5KFBA 3KAKA 1FSEA 1D1CA 2F4IA 1KC7A 3GFJA 3S3OA 3JRWA 1HA8A 1STZA 1I1SA 1BN5A 2LTPA 2QQBA 2XCLA 1VQ9I 3JTGA 4M9ZA 5EWGA 3K4MA 3IWFA 3HPGA 5H2FC 2JEIA 3QOEA 1YJNI 3LSRA 3C18A 3DBHB 3HG9A 3PIPF 1HQCA 1W7PD 3IKVA 3L2UA 3FDSA 3K1PA 4LF6H 3F3XA 4ECVA 3B6CA 2R8HA 4DV3H 2AGOA 2V59A 5HS7A 1YRNB 4XSZF 2VE8A 4G6DA 3WTWC 1SD5A 3BZ6A 4OIOF 2NUAB 5DTDA 1ULYA 4G6TB 2NVYJ 3H5AA 1F43A 4DV5H 3PQJA 4FS1A 3Q0WA 1WKMA 5LGTA 4YJ2F 2IS2A 2M05A 2TDXA 4WCGA 4A3KG 4XL9A 3IC7A 2V26A 2R8KA 3GTQA 2A6HF 1ODDA 2QF7A 2JPCA 3ZQQA 1Y0NA 1FIAA 3H3VH 2ELKA 1K79A 1LFBA 4N9IA 3JRBA 1DPRA 4A3IJ 3MWDA 3ZPLA 2HXIA 2VI6A 3NWTA 1T8IA 4LMYA 3TO7A 2W82A 1S6LA 4JYAH 3V4SA 2UU9H 1XGOA 2KIUA 3SDGA 2W85A 3MR6A 3S14J 4N9HA 1BR2A 3SFIA 1GXPA 4KYWA 1I3AA 1Y1VJ 3GZ5A 3VODA 1W7PB 1TWFA 1HW1A 2DFFA 3IHUA 1HKTA 3E3VA 3EYIA 2UVWA 4A3LJ 3TOBA 2WY8Q 1I6UA 3BJAA 4YFXF 3T1BA 5F1RA 1EJ9A 1JI8A 4HAMA 2BBYA 3EDPA 2DOEA 3U1KA 1YITI 2WB1A 4CYCB 3CC7I 1T36A 1UJ8A 4QTRA 2X4HA 1X3UA 2W9CA 3TEDA 3GIPA 2DXIA 3H3UA 4U7BA 4XIDA 3I4NG 1ETOA 4J0MA 2KIQA 3RPUA 5E8IA 4HNVA 4HPQA 4MFEA 3WG9A 3JRCA 1J75A 3R5XA 5DD8A 1AU7A 2A68F 2VPRA 1V54H 5KFMA 3V8KA 4RNNA 1X1PA 3H9QA 2ASJA 4RGRA 5KT7A 2XCAA 2FA5A 4DJAA 1XDSA 2BVMA 4ESJA 4XR6A 4BUPA 2CV1A 5BMZA 4DR5H 2KT0A 2YR2A 1K83A 3FXQA 2EINH 5JLXA 4IOCF 4RZRA 5M5WJ 4JV1A 3MVPA 4XLEA 4QJFA 4A3FJ 1HW2A 2DMTA 2NS8A 3K70C 2F5VA 1LB2A 1RK6A 4YR2A 2YX7A 3S93A 4HG2A 2XUBA 1MJAA 5E3MA 2IGNA 1FP2A 2HI3A 2HDCA 1TA8A 2MD5A 2M45A 4WF2A 3G6YA 4XMYA 2LY2A 2QVOA 3OHAA 5HNFA 1N36H 1CGPA 1QPMA 3LSJA 1BNCA 5LBQA 3OYDA 4CA0A 3W6JB 5J40A 2PLYA 4XKWA 2JVHA 5KG3A 1KBLA 3ORRA 4E7LA 5FPOA 4I01A 3P9KA 1J5YA 2VPSA 2ISYA 2XASA 4HLYA 2LF8A 2B63J 1IG7A 1ZHQA 5CJ9A 2KMUA 3FMSA 1OQYA 2PMZN 3GTGJ 2VXDA 2WAQE 5B3SH 2XD4A 1W5TA 1HSTA 2E34A 2QKLB 3DTKA 2HDWA 3A03A 1TWHA 4WBNF 2HVQA 4Q0YA 3K4JA 2ALZA 2R5YB 4M9XA 1W0UA 3Q9SA 2OD5A 4IZOA 2QGUA 3VMMA 1E4FT 2FF4A 1IUFA 2ZC2A 3QU6A 4E6KG 1TWHJ 2W6OA 4IAJA 4BBRG 2ZO4A 1KEEA 4RNOA 3M8EA 2VBZA 2R7NA 1N48A 1YI2I 3A0BC 4LIVA 3BCAA 4B44A 2YYAA 1P6RA 1SFUA 4NB5A 1RR8C 1A0IA 4ON0A 4DV1H 1T95A 2XV4S 1D1AA 1BI3A 1KU9A 1S9HA 4OAYA 4DV0H 1U0JA 1VQ5I 1GLNA 1YG2A 4QWDA 5CVVA 2WV0A 2R5ZA 3RIZA 1ZGWA 3WU0A 3FHZA 1BOBA 4ZOLF 3OIQA 3HOZG 1OISA 3CP2A 3WODF 1N75A 3IKTA 3OL4A 5IYDG 5HV6A 2Q2EA 2ICWG 1R1VA 1A31A 3F22A 4HF1A 1L2ZA 1YYVA 4PJNA 5JVGF 3H40A 1O57A 2W1OA 1AKHA 2V7FA 1XB4A 4IPAA 5CLSA 2YZMA 1WJBA 4M6XA 4LFCH 1SFEA 1YLFA 2VODA 2OTJI 3S1NJ 3E5QA 2CRGA 2VN2A 2VB6A 2OUMA 2JRMA 5JI6A 5ICFA 4EGQA 1ENHA 4JQFA 2HU9A 2P5VA 5B1BH 3R5HA 2STWA 2GZWA 3HRTA 2M9HA 3DP7A 1WJFA 1EYZA 4XRFA 4Y33A 4OOIA 3LMMA 4O3OA 2KIFA 1XMQH 5FLXZ 2E1MB 2BHZA 5LLQA 2DA3A 3MKWB 1B4AA 3D5LA 1U9NA 4HDUA 4XRMA 1P2FA 4H0EA 4QSHA 4BQNA 3DU5A 4BNCA 2EPFA 5FJ8J 3CO7C 1R00A 5BPDA 3DKYA 4A5MA 3K4KA 4WX9A 1Y0UA 2MLGA 2DDAA 1P7JA 1BI0A 4U88A 4DIQA 3HGYA 3DBLB 4RUAA 3BT9A 3BOQA 2HYFA 1YOVB 3I54A 2GOXB 4AU7A 2H1KA 1DIKA 2L9SA 4L5JA 3MJFA 1FTTA 3OS1A 2XDVA 3N43B 1WI9A 2TCTA 2XAUA 4ZDOA 3LAPA 1MNMC 2V6CA 1VQPI 1OCTC 3WNZA 4HEA2 4LITA 3SZTA 4LLNA 5EGOB 1ACIA 2L7FP 4NC6A 1B6RA 2XGXA 3HL2A 2BY0A 2BZTA 5L3FA 4DL5A 4ETSA 5FKLA 2CQXA 1K1QA 5ED4A 3RGXA 3FWEA 2R92G 3E7LA 3K70D 4BBSG 1KA8A 2HVRA 1WQ2A 3E1SA 1A6IA 4RAZA 1SD4A 2MC4A 2K85A 3PUFA 2VQCA 1QBJA 3H0GJ 3CCSI 2XPVA 3GTGA 3OR2C 2W4SA 3IG0A 3ECOA 1KGSA 1ORKA 2K4JA 4YP3A 2A5YB 3I58A 2DPDA 2B63A 4ECSA 4BDYA 5ILVA 5IYBG 3BCBA 1WSCA 1W0TA 1FT9A 4EGJA 3PO3J 2R82A 3M9NB 2PN6A 1GXQA 3DLLF 4DV2H 2GXAA 1VAJA 3BAAA 1IXRC 3SQNA 1BI1A 3IH4A 3ZMSA 1G59A 2W6NA 4QWEA 2W9CB 4I55F 1KQ9A 2MGQA 2HPIA 4A3DG 5FB2A 1R6RA 1IN7A 1IN8A 1F9NA 2LH9A 4EEFG 5C3EJ 3TIGA 3OOUA 3PR4A 3L4KA 2LF7A 4Q5SF 2ZXJA 5HDGA 3BPVA 1TWGA 5EYRA 1IUYA 1MKMA 3CF2A 2PJRB 3NEUA 1D0YA 2LDUA 3M7GA 4LSAA 3G6XA 3FKIA 1FYKA 2CKZB 3G73A 2UV1A 4YFKF 1WCMG 2I8CA 1TT5B 3ZN1A 5D1OA 4J9MA 2KRCA 4DNCA 3J81K 2QEXI 1KJQA 3CMYA 3V6KA 2NXNB 3RV4A 2DPIA 4X66H 2YCHA 4F50A 3K2ZA 3UQ8A 2OZ6A 3E0JB 5F9LA 1IRXA 2XGEA 4EBEA 4E4HA 1VS0A 3JSNA 5F27A 2AU0A 2QA4I 4EFBA 1R1TA 1N33H 2DMNA 4BE1A 2O3FA 1YW9A 2XRNA 3VPBA 4DR6H 4GXOA 1F36A 5KG2A 3GILA 1QNTA 5KFAA 1T98A 1SFXA 1H9TA 4KMFA 4TV7A 4UVCA 1K7AA 1B6SA 2A6TA 3RB4A 3MR3A 3OV8A 4J00A 3HOZJ 2MLKA 2XGCA 2CUEA 4LFAH 2VC1A 2DYSH 1RETA 3BG9A 5KT4A 2VBWA 3JCUC 3VYTB 4P9UA 2O03A 1TP4A 4F91B 2E2HJ 4IOAF 1X1AA 3PNVA 3HOUG 3EUHA 1MNDA 2VJIA 3C1DA 5J47A 5L1KA 4R8UB 1GV5A 5FPRA 2A07F 4A93J 1UB9A 4C2UA 1DV1A 4BY1J 1DGWY 5KFRA 1X9NA 3GYHX 1LE8B 1N78A 1Z7UA 1QHHD 4YFNF 1VBGA 4E7KA 2NYXA 5LGUA 4ECYA 1MBHA 3I5UA 1L3LA 4CCNA 4A3JJ 3GQCA 3T8TA 1FWZA 4YHHH 4RGXA 1OCOH 2VKVA 3F8CA 3LL7A 1BBYA 4UHTA 4B09A 3JSOA 1JKQC 2XC9A 4DL2A 2W24A 4IRGA 1FC3A 4FX0A 3V7RA 4C3IJ 3WTUC 2J9GA 1PUFB 1JTYA 4F92B 4HX4A 1WSUA 2W8KA 5JLWA 4J9SA 3J7AK 3DF8A 2DMUA 1JKRC 5LOVF 4GKKH 1N77A 3SZGA 4IHWA 5KT2A 4M6VA 1TLHB 5LRSA 1JXLA 2OJED 3DCFA 5E8GA 5L3GA 2YU9J 1FMWA 3K3VA 4CUGA 5CVJA 3TGNA 4L0YB 3UFXB 4GC6A 5KHDA 1T94A 1GV2A 4DR3H 4RLQA 3FDYA 4I09A 4TV9F 4YELA 2FJ1A 3QP5A 4ZH4F 5ICEA 3J7YJ 1GVDA 2DDBA 1VZ0A 2P0WA 3TOAA 2DJNA 5J1UA 4ZC3A 5FROA 3V8LA 2GIVA 2YL2A 5IT9K 3GV5B 3ZGKA 3MZHA 1IBKH 1YHQI 2R8IA 3FZVA 2YX4A 4UCVA 1O3SA 4XK4A 3H20A 1NHAA 4QLCU 4ME6A 1P8LA 3PW7A 4MFDA 1A5JA 2VL8A 2P8TA 2VE9A 1BXRA 3E5NA 4A2BA 2EFOA 1GSHA 1S8NA 3NRVA 3QPSA 2R93J 5A2QW 4EJOA 2JA5A 4RB0A 2KRHA 3FBNB 3HEFA 2C28A 4IRKA 2MCTA 2UXCH 3FK6A 1YE9A 3I4NJ 2F4OB 6PAXA 1KONA 1OPCA 3IH3A 1PX2A 4CC5A 2W9BA 4J9OA 1UFMA 1RNLA 4PCQA 1VQ8I 1GGOA 1V51A 2PJRA 3D1NI 2YZNA 3A0HC 1ZRFA 2R4GA 4IXAA 2VOBA 5CQEA 2JMWA 3J81W 3EQLF 4HNUA 5BPIA 1QQIA 4DV6H 2HQAA 1C30A 4G7HF 3FXKA 3J7AO 2JEGA 2M4KA 2ZDQA 2PQ8A 4UXNA 4UVBA 1SFOA 3OIOA 1NK3P 3BQ0A 2L2OA 4PGGA 4E7JA 1ZETA 2BV6A 3MKLA 3SI8A 3KETA 3GTJJ 1ON2A 1O7LA 3WU1B 4Y4RA 2R7ZG 3DEEA 3HHHA 1Z9CA 1SFOJ 1IRZA 4PSXA 1E3HA 4X62H 3WTYC 2FPGB 4DV4H 3CF5F 2H94A 5DYMA 1RPWA 2LVSA 5GPAA 2CH0A 5EZGA 3T0YA 4XKBA 2BQ3A 3QP6A 4C2MA 3R0JA 1DV2A 5FJ8G 4UV8A 3H0DA 3FXUA 4CCOA 2DA1A 2WBMA 2ACJA 4EM2A 1KJ8A 2VUGA 5F08A 2H27A 4RU9A 3OSGA 5KFXA 1HNZH 2EFNA 4NC8A 2ZFUA 3ZMTA 1HKSA 4JX4A 1GT0C 2JA5J 4EV0A 9ANTA 5KG0A 3H3ZA 1O7FA 2EH3A 2K9QA 2RN7A 5F9NA 4CC6A 2YU3A 5IY5H 2VKEA 2K7LA 3FKIJ 4E70A 2VOOA 1Z05A 1ZG3A 4HBLA 1JT6A 1UG2A 2JA2A 1JLLB 3GFMA 5LMNH 2FNPA 3RSNA 2WA0A 2IA6A 2M3AA 4G94A 3AAFA 3L09A 4PJLA 2COMA 4C2TA 2VR1A 2R84A 2X6YA 1OKRA 3IH2A 4O3QA 4X6AJ 4IWXA 1ZELA 4QWBA 2BY2A 3DFGA 5CAEB 2WAQA 3SJMA 2TRTA 1R1UA 4I98B 2ZCWA 3DPLC 1VQLI 2PMUA 4OMZA 2F4VH 1S0NA 1TT0A 2HGSA 3B73A 4MO7A 2W7OA 2L5QA 2I80A 2PEXA 2QCOA 4W97A 1R9TJ 1MJBA 4EFEA 2R7LA 4EJTA 5D8KB 3GMEA 1IDYA 3IAS2 3H0GA 5BPHA 1C0WA 5DGBA 1T56A 4P96A 4CHUA 1K4TA 1TWCJ 3ERED 1W36D 3KEYA 4FE4A 4L5IA 1VQOI 4MV9A 4ZI7F 2Q2UA 4XLAA 5LL6b 4DL3A 3I4MJ 3EPIA 1NK2P 2MH2A 5FD6A 4O2BF 3P9IA 3LNQA 5L1LA 4EYIB 2VXZA 4DV7H 2C22A 4BBRJ 3UKGA 5C4XJ 5TJJA 1N25A 4I0BA 4B3RH 1DUXC 4K0KH 1XDUA 4KISA 4N4OB 2KLOA 1FMVA 2MFZA 4EM1A 2CO5A 2C00A 2Q0OA 1EA3A 2FNAA 2RVCA 3TO9A 4OX9H 2YPRA 3J7AY 1JGGA 2WYOA 1AKHB 3SDBA 1J5EH 2EFWA 1XSDA 1TNSA 4C30A 5L3CA 3NARA 1IOWA 2Q2EB 2YSRA 4YJ3F 1OCZH 3S32A 2KISA 1Q1VA 3FKJA 2NVUB 1ZAOA 3CC2I 2JA6J 5JR3A 1UC9A 4YY3H 2COBA 4M3FA 5HLIA 2VUMJ 2NOGA 3S2DJ 3ML6A 1OWTA 4IKFA 3RBDA 4TV8F 1AUXA 4QWAA 5KFHA 2HQNA 1R4MB 4A0XA 4BH9A 3JR9A 2F2EA 1G3TA 3PW5A 2ZDGA 1OFCX 4HV6A 1O4XA 2XRLA 2DOAA 1V3FA 4E7ZA 4NDLA 2R93G 3A02A 2RDIA 2RDPA 4AIJA 3Q8QB 4MV6A 1S9FA 4JBAA 1FOKA 2KFDA 1R71A 1V5FA 2XAQA 3FMQA 3K5IA 2IGOA 3VPCA 4JI1H 1HNWH 2V1DA 2CQQA 1WJ5A 2GA1A 2L02A 1YIJI 2HHHH 4JI3H 2X9DA 1H88C 1VQ6I 3NAUA 2PN1A 3FXOA 2X6XA 5TRDA 3KAJA 1KU7A 3GTOA 1Y1WG 4RS8A 4KDPA 3ZCOA 2IGKA 3CMEI 1EF4A 4ZYHA 3LSHA 3F21A 3EPGA 4FU0A 3RKYA 3BC8A 3RJPA 4UNOA 1LFUP 3LFKA 3KZIC 2IA1A 3ASNH 1FBSA 1LVKA 2OCCH 4EJWA 4ABZA 2A05A 1Z6TA 1Z2NX 2O0YA 4UCSA 3HIFA 4CO8A 2FEZA 3M8FA 1RYSA 5IP9J 2MH9A 3FXJA 4LF7H 3P7NA 4LB6B 3REOA 4UUVA 2K9LA 4CCMA 1PUEE 1KJIA 2HPMA 3TW7A 3CC4I 3IRRA 2R8JA 2Z16A 2PMHA 2ZXWH 4NXMH 3GFIA 1R7JA 1BGWA 4X0GA 2ME0A 1J2XA 1EH8A 1H0MA 4DR2H 5H20A 2P81A 3E97A 3K3PA 1POGA 4A3JG 1IN5A 2Y75A 3BP8A 5J8CA 1GLVA 2GXBA 4ECZA 1VQNI 4XKVA 3BR0A 3OYFA 4BY1G 3GXOA 1T2KA 4NUBA 1Z6RA 4D9JA 4R7RA 2FOWA 2HFHA 2XKPA 1ZQ7A 4KIBA 2HEOA 1HKQA 1VBHA 3JRHA 1F4KA 3FF5A 2ZDHA 4EEYA 4NLGA 4QW8A 1FKAH 2X6OA 3PM1A 3QPHA 5DGAA 4IO9F 1LUJB 3L2CA 1V4RA 4V19K 3CD6I 5CPRB 2K9NA 4U0VA 4XOTA 1LFPA 4FQGA 4BJTA 3ONQA 2QM3A 3G6EI 1D0XA 3K4CA 3S1RJ 1R58A 5K2MA 4ESFA 2J6TA 2KSWA 2P7CB 5LHHA 2K9MA 1T08B 3BR2A 2HKXA 2DFEA 2LNBA 1JHHA 3OSNA 1X1CA 2KIMA 1M0TA 2FB9A 4Z2YA 4HX7A 5DQGA 5KFGA 4ED3A 1LNWA 1KYZA 1SVOA 1QZZA 4ENKA 4J19A 3QAHA 3AL0C 4II3A 3ZMZA 1MH4A 1WGXA 1K83J 3BG7A 3CDHA 4DZJA 1I7NA 3HOSA 4XONA 4IHYA 2M1BA 2X48A 2IEKA 3BZCA 1TQIA 1HSJA 3H36A 3CJRB 1J0RA 4ED0A 3DPUA 3CUQC 5HS8A 2XSDC 2FLLA 3J81Z 4O3SA 2R8GA 2XAGA 2XVCA 4XKCA 4TQRA 3O8GA 5E79C 3EETA 4AM3A 2RGRA 4WWCA 1T33A 2KL4A 1D5YA 2CMPA 2GOMA 2KKOA 4U0YA 4A3GJ 5DG8A 4Q44A 3DF7A 4HF0A 2UXBH 5C1PA 4ESBA 4B3MH 5DUIA 3FBIB 4ZTFA 2LFBA 5KG6A 3M1CA 2A6EF 1FLIA 1VNDA 1FOXA 2WWYA 3MN2A 2E2JJ 5FKNA 4F52A 3H3VK 3FK7A 1T0FA 4I7HA 5CVRA 4IVNA 2RC4A 3N42B 4MGRA 5F0HA 1RKWA 4KIFA 3PFYA 3JTHA 2RGVA 1Z91A 3GZ6A 4FS2A 2DOFA 5EWEA 1FY7A 3C2GA 4U0WA 2KZGA 1M6VA 3PW4A 1RUOA 2ZBKA 4LSXA 4A69C 1SD7A 3KP2A 5FFXA 2M2EA 2NU6B 2WTFA 1D5VA 4MV3A 4HQEA 4HSTA 3M4IA 1AN7A 4MA5A 1YTYA 2IMWP 3Q0UA 2FSWA 5TGTA 1I50J 3TKYA 1JKJB 3CQZA 4F4WA 5GP9A 3RCOA 1TC3C 3K1NA 2V9PA 4IHSA 4XM3A 1ULZA 4RUCA 3DTEA 2DBBA 3CMMA 2H1LA 5LD2C 2VIXA 2M8GX 4M3BA 3H9JA 3HUGB 2R7XA 3TBIA 1TWCA 3MMYB 1JKOC 1QGPA 4IRDA 2QSFX 5ERIA 3RB3A 5K7ZA 2GWRA 1M7JA 4MQ9F 4AYBN 5FGMA 2H8RA 3RYPA 3KEQA 1E4EB 5M3FJ 4JV0A 3PUBA 4OIRF 3GIIA 5KAIC 3GV7B 2QQ9A 4XQFA 3H1CA 4I50F 5CVUA 1AA7A 4KMUX 5KFYA 1ZR4A 5L1JA 1UHSA 2XPWA 1K6YA 1APLC 5EG0B 3GCMA 2VQGA 2ID6A 4IZZA 4Y15A 2W70A 3PSFA 2JA7A 2GM4A 1U5TB 4LG3A 2ZJQF 4IWYA 2H6CA 3L7WA 2R7QA 2VJJA 3QQAA 2Z5UA 3QOPA 3R23A 3AG3H 3BROA 4XX0B 4CH7A 3J80K 3VYUB 4C5BA 5KFNA 2RDJA 1S0MA 4UB6C 3SFZA 3S15J 3TINA 3C2HA 4BXUA 3T1YH 2J5OA 1A6QA 2PMZE 1CQJB 2P6SA 4YBZB 3H35A 1MDMA 1WVRA 5FLXK 2PJPA 2O5RA 4Z6YA 4GLXA 2RREA 3DQVC 2KHMA 3R6SA 3HOVJ 2K3PA 2AXTC 2GXGA 2VBXA 1PUFA 3PW0A 5DCMA 2R0QC 3N4MA 3MFIA 4C2MJ 1B1BA 2UVRA 5HDKA 2KJBA 4XLHA 1B6AA 3KPHA 1O3TA 1VQ7I 3M4OJ 1A9XA 3KP3A 5J8FA 1HNXH 5EDWA 3E6BA 5JVTA 1FPQA 4U87A 1TWAA 5IYDJ 5A2QK 4G6QA 2F48A 1Z67A 2QSHX 1LE8A 4F55A 3E6DA 5LHIA 2EZLA 4RAYA 1KQ0A 4ZZLA 5IP7J 4XICA 3MWEA 2R7VA 3F6OA 1MJ9A 3J7ZI 2E7XA 1OYIA 1SCUB 1Y1VA 2E2IA 1W1WE 3RYRA 2JA6A 4RGSA 4B8XA 4Q4ZF 3W3CA 3CDLA 1WRJA 1UCRA 1FBUA 2FOKA 3F8FA 3GWZA 4UUTA 3HTUA 2RKHA 3CCQI 2I87A 3BY6A 3JRXA 1YW8A 2J5PA 3FXRA 3KZZA 4I99C 3CCUI 4PZJA 4IL6C 2BW3B 5K7FA 1DU0A 1JIHA 4CCJA 1TBXA 2K9SA 4AIDA 4P1WA 1OMIA 5F64A 1FZPB 2HDDA 1GSAA 3IN5A 1BW6A 3HDDA 3S1MJ 3V42A 2V1UA 1WH2A 1HOMA 3RFCA 4C5CA 3RB0A 3BG6A 4FX4A 2VLAA 3TQ1A 1SMTA 3RV3A 1FX7A 2DZDA 3ESWB 2JJ7A 5LA6F 3ABTA 4GO1A 2DCEA 4EYHB 1IW7F 4BY7J 2MC3A 3OYEA 1J9IA 4XSXF 3T5LA 3AFHA 4EGZA 3WE2A 3CUOA 1FOWA 4Y3OA 1MMNA 3F8NA 2J6SA 4FETA 4N0BA 3DU6A 1WCMJ 2PFBA 4CZCA 1O75A 4NNJA 3QU3A 3Q3SA 1TNTA 1G3YA 2DI3A 3J80Z 5FLMG 2EB7A 2IW5A 2W00A 3H5RA 3VYSB 4PSWA 3RI4A 4J9KA 3OHBA 3ORQA 3PW2A 3I4PA 3TP3A 5J2TF 4A3FG 1GO3E 2M5WA 2GQQA 2M7BA 1YX5A 4QPQA 3S8PA 2LK2A 1RC9A 1WCMA 2X0LA 2R87A 3KHHA 5KFEA 2YU9A 1SEIA 3F8MA 2VQLA 2Q8KA 3VB2A 3HRUA 3N6XA 5TISC 3GF2A 1GYFA 2MA3A 1NTCA 4IR1A 2ASLA 3O3KA 1HDDC 1S5LC 2ISZA 4MEXF 2OQGA 1BA5A 4RB1A 5LGNA 4LOCA 1BOAA 5KFSA 4KFCA 2IA0A 2JEFA 5DM6F 5L9XA 2CUJA 1M1EB 4MQVA 1J59A 3BQYA 2W7PA 1SAXA 4JI6H 1ETKA 2FLPA 4UUSB 3I64A 4FHTA 2X1EA 4MTDA 2LMDA 5EJCA 5FKMA 2G9WA 1CF7A 2IRFG 5IWAH 1UHWA 2G0EA 1REPC 1K78A 3KZYA 5KFQA 2QUFA 4XRSG 1LKXA 2L01A 1Y6IA 4J9LA 1BC7C 2E2HA 4JI2H 2ZB9A 1WWXA 4O5VA 3O8HA 3K0LA 5B1AH 4GDFA 5KFLA 3KCCA 1XC5A 5E1WA 5KFFA 2DODA 2BHYA 3D5SC 4UVAA 2CZGA 1LEAA 2AO9A 5C4XG 2ZJ2A 1RESA 1XX5A 2F5DA 4M3EA 5DS9A 1B72A 2VC0A 3GV8B 5LEKA 4A3EG 4ZYGA 4AYBA 5M5XJ 4CCLA 4CCKA 4JP0A 5H6QA 1AWCA 5AIPA 5C8YF 3BA8A 2OA4A 1XD7A 3DKXA 4A3GG 3BR1A 3GEZA 1D8KA 2E36A 4KJZA 2K3FA 5AIQA 2LG4A 2K40A 1WH5A 4ENMA 1Z3XA 2W6QA 1WHUA 5LP6F 2FRHA 3KIOA 5K7HA 2DLNA 4PUSA 3BTCA 3RDIA 2ZMEA 1I1GA 5IOYA 2VJ4A 5DLGA 1SFKA 1Z2OX 1KJJA 2R7MA 1TWGJ 3V4ZA 2JUGA 2W48A 3F23A 4B3XA 4LG0A 5C44J 3COAC 4O2AF 3PR5B 2DPJA 1DGSA 2DTZA 1Z0XA 5D5XB 5GAEJ 3HKZA 1S72I 1U78A 1FEXA 2D2WA 1MSEC 1RUNA 3M9AA 5C44G 2UUZA 1FYMA 1FOYA 3OYCA 2UXNA 4ZHQF 2CUFA 4RAFA 4B43A 2DTRA 1GHCA 4YAJB 4A3MG 1K6OA 2Z1DA 2DA4A 4DR1H 4O3RA 3RAXA 2R7RA 2GLTA 2DPUA 1OCRH 3KEOA 1E17A 3Q8RB 1FSHA 2DT7B 2H09A 1MBFA 3TDUC 5HLTA 5D5WB 4JX6A 3WO1A 2CV2A 3FHNA 4A2AA 4YR3A 3VPDA 4XOPA 4WXDA 5GTIC 2PI0A 4XBFA 4HSRA 3S2WA 4RAGA 3W2AA 2HYJA 3ZXSA 2BW3A 4LLLA 3MFKA 1IV6A 1N34H 1PJRA 3CZ6A 4L9VA 3ZQHA 4BJ5C 5KNLA 4C5AA 3E5UA 2QENA 3ELKA 4JV2A 4RZQA 4S05A 4V2GA 1F1ZA 3I12A 4ECTA 3I59A 2CW0F 4PFPA 2ZNYA 2J6UA 2RV8A 3JAMZ 3ABUA 2V79A 4JX5A 2V4RA 3HPHA 3W2WA 3HOYJ 3KP6A 4XORA 1G4DA 4MV7A 1K4SA 1RKTA 1T6SA 2R7ZJ 3P9CA 3DWLE 3L9FA 2G7HA 4FISA 1UNNC 1S68A 2R85A 5KFUA 2IBKA 3LSKA 3QYBA 4BQQA 2HOAA 3K1MA 4IQ4A 3RTRA 5EOYA 2UUBH 3IL2A 5IPAA 2E2IJ 2B63G 5IP9G 4IHJF 3F6VA 4S0HB 1ZTRA 4ZYEA 2FBIA 1P4WA 2VKDA 5EDNA 3HOTA 2X85A 1XMOH 2DIKA 2BVLA 4G12A 4ZQIA 1GDTA 3KALA 2Y0SN 3H92A 3VEPA 4G7ZF 4UY8I 2CQKA 4J9PA 3ZMVA 4I02A 2LY1A 4JI7H 1MBJA 3S3NA 2FPIB 5KFZA 2W9BB 2M4GA 3LOCA 2IS1A 1IXSB 4ZDPA 4Q43A 3M1EA 3GIDA 3GTPA 3UNGC 4YIFA 1Y1WJ 2AS5F 1XPXA 2CSOA 1HLVA 1FJLA 2KDZA 1IAWA 4ECUA 2VA3A 5F0CA 1R5ID 3AYHB 1AHDP 3D0SA 1HDPA 3OYJA 5EZYF 1IN6A 2UXXA 1V4YA 1HXDA 1ZHSA 3GW2A 2CQ7A 4NC7A 4CYDA 1X58A 2PG4A 4BHPA 4U7CA 2CUZA 3MR2A 3CCRI 1Y14B 4A0YA 2HWVA 5JFRA 3N44B 4W1UA 1S29A 3ZP5A 4MIMA 3KE2A 2O9LA 3HOXJ 3L2RA 3JRGA 4X64H 2XCPA 2E1MC 5IYZF 3VPRA 3WGIA 2CG4A 4RM3A 3MAJA 5JQWA 1E4EA 2BE5F 3CDIA 2P4WA 3BTLA 4ECRA 4HYEA 5LMUH 3MFHA 4WXCA 3BJOA 3ZOBA 3HUGA 4DYRA 1ETVA 4D1QA 5KG7A 1BJTA 4A3LG 4GKJH 2MABA 1T3NA 1XDNA 3LP8A 4U7DA 1HC8A 4HQ6A 1QO0D 4PJ0C 3KHLA 2V1NA 1GVJA 4LLGF 3M07A 3BR6A 4UCRA 1R4NB 1B8IA 3CJQB 3LFUA 4ASNA 1UHMA 5D5VB 3IV5A 2WV1A 4CICA 1I27A 4HRIA 4ECQA 1Y8QB 2O8KA 4PFOA 5LFAA 3LSIA 5L3DA 5HDNA 1H89C 1J09A 1ZHFA 4R1HA 4M73A 5DCMB 3RGZA 3KXYT 2AHQA 2EK5A 1LDDA 2LKXA 4E7SA 3D5RC 2VOPA 1IRGA 2F4MB 5K5RA 5EWFA 1E2XA 2LYCA 5IT9W 3IAM2 1XGNA 3PNTA 4KITB 1G8XA 4LD5A 3CVZA 3MZ8A 2C6YA 2P0AA 2MBFA 3I4MG 4PDBA 1ZQ3P 3ZR8X 3BTJA 2X6WA 2M34A 4LFUA 4CXFA 4E7HA 1JDBB 2FJZA 4BL0B 1CS0A 4XYLB 3HOUJ 2EBIA 1USTA 4JYKA 5DG7A 4HYKA 4F4XA 1Z3YA 4AIKA 3GIQA 5IP7G 2P7VB 4AC0A 2L0KA 3JSPA 2W6PA 2STTA 3WHCA 5DG9A 2CFOA 1T0FC 2JWTA 3GLXA 5FO5A 3HZJA 3LQQA 4MV4A 3S16J 2OH2A 1OCCH 2EIKH 4BJ6C 4HR7A 3VWBA 1Z77A 2FK1A 2DT5A 1N32H 2QYOA 2ELJA 2JRTA 2BGCA 3DV8A 3JW4A 4AIHA 3HKZE 2V4JC 2ZMEC 2E5LH 2FMYA 3CCVI 2FQ3A 1ZN2A 1KYWA 3JRDA 3N41B 4DW6A 4PDKA 3I53A 1A04A 4O4IF 2FU4A 4J9RA 1R5HA 4FBUA 3ZQLA 1EH7A 5FRMA 5I47A 3AG2H 3RQIA 1B8IB 2BY3A 3S3MA 1RIOH 4P5OA 2UWMA 3TW6A 1SMYF 1W93A 2EV6A 2X0SA 3GLKA 2WC2A 3ULQB 1U8BA 3GTKA 1Y1WA 1B9MA 5H80A 4ENNA 3GTPJ 5T14A 3HSFA 4QPOA 2XB5A 3F9KA 3K4LA 2JA5G 2Z99A 4GGGA 1FTZA 4O4HF 3NGDA 2WE6A 2AQ4A 1KU3A 3VFZA 2NS7A 2R7OA 5J2UF 5LYJF 1XSXA 2QZ8A 4LH6A 1FBQA 1W5SA 5D6EA 3FMAA 2O61A 1MMDA 3SEQA 5EZHA 2KJCA 2CU7A 2LY9A 3LSGA 5LRRA 2W7NA 1VQ4I 2CQNA 4A3EJ 3KLOA 3MEXA 3PO3G 5KAFC 1LJ9A 1HCRA 1R49A 5E3NA 2BR0A 4HA8A 4M3DA 5BNGA 2XROA 4LF5H 4Q45A 2WTEA 4U6PA 1ZRCA 5EEAA 1UELB 2HQ5A 4L0ZB 1GSOA 3BQZA 2NVQJ 4X1EA 3OYNA 1AOYA 4E7IA 1D0ZA 2I8DA 3DEUA 2GPWA 4JI0H 4GRIA 1B59A 1NG7A 1Y56A 1XNQH 5CKTA 4HV5A 1X19A 2DT6A 5GAHJ 4AD9A 1JT0A 4D7MA 3BABA 2OCEA 5FD5A 2DN0A 3WTVC 2Y0SE 4DL7A 5KT3A 4KIGA 3S2HJ 4MNUA 3C7JA 3DPTA 3CCMI 1IJWC 1BIAA 5E3OA 1WI3A 4HF2A 1WJCA 2LRDA 1WJDA 4A3BG 2JSCA 2Y9YA 2D1HA 2BEOA 3CMAI 4BKXA 4HW0A 3I56I 2LREA 3MKZA 1XN7A 5HLHA 5GTHC 3OYMA 1KQ8A 2HVSA 2EFPA 3SXYA 1I5ZA 1JUMA 1S7AA 3AG1H 3VDXA 4B1RA 4DBQA 3GIMA 1FIPA 2NNYA 5IT9Z 3B6AA 3HB9A 1DP3A 2R7KA 4M74A 3EPZA 4KT5C 3VYRB 4EM0B 1TW2A 5KFKA 1TW3A 3GVAA 3MZYA 2IBDA 3GTLJ 4G7OF 3QFFA 4EQQA 4I0AA 4LIUA 3BJ6A 1JHFA 2EA4A 5DM7F 4KA4A 1A36A 4D7NA 3ISPA 4O3NA 2Y9ZA 3HM5A 1AUVA 2UUCH 5EEHA 1ZRDA 1Z1DA 2FE3A 4G8XA 5D5UB 5IT3A 4Q8EA 2FQ4A 4BXXJ 3WE3A 2R7TA 2PVPA 5CYVA 1MMSA 2VT3A 3M9MB 4IRCA 4O4LF 3T1HH 4Q48A 3F72A 4M9UA 2GBYA 5GPCA 3OYHA 3IWZA 1Z21A 3HGGA 3RZDJ 3EUKL 2YS6A 4MAMA 3U2RA 1ZARA 3OYKA 1EZ1A 2HJWA 2KP6A 4GC7A 4C3HJ 2FBKA 3PL8A 2R7FA 3BQ2A 5BOXA 3FX3A 2XHKA 2JN6A 4BU2A 1B33N 5M3MJ 4CSWA 1FP1D 3QZ8A 4K2EA 4YEJA 3CCEI 3LMLA 2E1OA 2FMLA 4F3QA 2DK5A 5HOOA 2JSPA 3WTZA 2F5CA 2ESNA 2XAHA 1ITYA 2M87A 1CE8A 1ON1A 1RZ4A 2RNJA 4Y17A 1TAEA 3GTJA 4EATA 3OYAA 4LG0B 2VUMA 3A01A 4ZDLA 1TWFJ 1O3RA 1Z7LA 4ECXA 1TQMA 5H6RA 2L9NA 5DV5A 1ZLKA 3GLLA 3QPLA 2O7OA 4FE7A 3IP4B 2HTJA 5KFJA 4LF4H 3LSMA 4ZYDA 1R36A 4L1KA 2YZGA 2DU9A 2VASA 3WO0A 3V6HA 2H8WA 2VQDA 4A5NA 1SAUA 2JVGA 2JA8J 3VOEA 2DK8A 2XF7A 2YS7A 2V9KA 4A6EA 3ZQGA 3K4BA 3L2QA 1A35A 2E5ZA 4E4TA 1Q1HA 4A6DA 5DQIA 2R93A 3S1QJ 2OBPA 2V6EA 2MSYA 1RK5A 3CLQA 4DUYH 2FD5A 2DMQA 2LKSA 1TTYA 2CWEA 2HOSA 4ED8A 2RAEA 2JA7G 4M71A 4EG0A 2JA8G 4A2UA 3PIOF 1B04A 4PJMA 1XMAA 3HXLA 2XGPA 3ZMUA 4ZZDA 4DL6A 1S7EA 4UCTA 3HTSB 3R5FA 4BXXG 1G2HA 1Y39A 4EJUA 3GUDA 2HS5A 3JAMK 2ZJPF 4B4CA 2Y48A 1VQKI 1OR7C 1QRYA 2ZNZA 3HBLA 4M72A 3L2PA 3HOXG 3IRQA 4Y7NJ 3HRSA 1HF0A 4BQAA 1JTXA 1VKZA 2FK2A 3BA9A 5KG4A 4R79A 3TIIA 4WD3A 1MD0A 2IXSA 2W8LA 4NQWA 4BGDA 3LQRA 5F0FA 1NH3A 2NU9B 4P9FA 1G3SA 4R8HA 3LWBA 4YIRX 4YG2F 2NU7B 2P5KA 4HLXA 3ZRGA 2HXOA 1UC8A 1Y8RB 3TMOA 1SANA 3C3WA 3RKXA 2MD0A 1DDNA 2M0MA 3C2BA 3GBGA 3FISA 2DA5A 5B5EC 3TQTA 3KHRA 3ROUA 1E3OC 1IXCA 3U1DA 4Y52J 3O2PE 4OMYA 2K4BA 4LK0F 1MW7A 4I6ZA 3HC7A 4GFBA 3K5HA 3OUUA 4APMA 2C2RA 4AUXA 4BE2A 5ILSA 2EFQA 3BG3A 5E1ZB 2Y2ZA 3DXJF 2PMZA 3NWSA 4RBOA 2IS4A 2EIMH 3ETHA 2WB1E 1IN4A 1EV7A 2ZJRF 2B0LA 1QZEA 3MKYB 5C4JJ 2E5NA 3WGGA 5KKNB 2HOTA 5KFWA 1OYYA 3V8JA 1JJ8C 5E17F 5HNHA 1Y1VG 4DUZH 4B47A 4OWRB 3V7SA 4HNTA 4LGWA 3VSKA 4PGHA 2JA6G 2ZSHB 4RNMA 2DA6A 1W7PA 1YS7A 2QQ8A 3PZPA 3RZOJ 1I7LA 2IT0A 2A5WA 2X1DA 4EVIA 5D4SA 4FASD 2CQYA 1DPUA 2PBIA 5KFOA 1ZKGA 3BPXA 3G3ZA 3R61A 1QHGA 3N97A 5FFZA 3Q0VA 3L1PA 4BAYA 2FP4B 4RB2C 1I6HJ 2WY7Q 3E5XA 2V4QA 1JKPC 3JSLA 1YW7A 1IDZA 4EBCA 2UUAH 2CFXA 4C3JJ 3ZN0A 4J01A 3BQ1A 2IPQX 4BXFA 2L9RA 5FKKA 2FX0A 4OU0A 2IA2A 1MBEA 2BOLA 3ZQIA 4A3KJ 4EJVA 3A01B 1LPQA 3QZ7A 2ZXHA 1LQ1A 4RLFA 4MTEA 1PDNC 1S97A 1I6XA 3HSRA 2EZKA 3GX4X 4AQYH 3CESA 1S0OA 2QWWA 1D1BA 3BDDA 3LWFA 1KZHA 4JI8H 4Q8FA 2L7ZA 2LOOA 2HNHA 2Q1ZB 2L7KA 1UAAA 1CQIB 1IBMH 2JQ7A 2LP0A 3L2WA 3T5KA 1D8JA 3PO2G 1W4MA 1BI2A 3T5HA 1H9GA 1YRNA 3WHBA 2B9SA 3G4SI 2JK3A 3CCJI 4KT6A 2QLZA 3HJEA 5HVQC 4II2A 2M8EA 3G1LA 4BHBA 4I4TF 5KFIA 5D6FA 3CTAA 3RKWA 2I5UA 2IGMA 2R86A 3KX2A 3RPUD 1OLTA 1CQTA 2K86A 1ONVA 3BWGA
chains in the Genus database with same CATH topology
1FNNA 3C0FB 1T39A 3ECHA 2XIGA 4NXNH 3PQKA 2E7WA 3B02A 5L3BA 4JI4H 2E1NA 4UCUA 2A69F 5KK1A 1D3YA 4XLPF 3K9TA 5AONA 3GO5A 1XNRH 2V1XA 1ZYRF 3LSTA 2UXDH 2KRFA 4DQ2A 1MDMB 1U5TA 3RPQA 1TQPA 1U3EM 1EH6A 4Q47A 4XLNF 2HOEA 1I94H 4EGYA 5KVRA 4I2OA 2ESHA 2NNNA 1OR7A 3KLNA 4HOBA 2OU2A 2NRAC 2JPBA 2VT2A 2AXLA 1P4AA 4UFZA 2XAFA 3RTXA 2ZM6H 5CVIA 4X65H 4S04A 3R0AA 5A2QZ 2O6GE 2RQPA 3E6CC 2ZKZA 1HBXG 4FT8A 3V4GA 4D0PA 2QBYA 5L3EA 1M0WA 1YS6A 5J6XA 3MQ0A 1ZREA 4IHTA 4GYIA 2ADUA 1PP7U 2IVMA 4IRHA 3KP5A 5DEQA 2OAZA 2R7DA 1XGSA 3WTXC 1MGTA 4IJAA 3MWMA 2FBHA 1XMKA 1RI7A 2P6TA 2XKOA 1YIOA 5D1OB 5DDGA 4Y13A 1ZG1A 1ZH5A 1IF1A 1ZLJA 4IF4A 4LF9H 1FVIA 1L0OC 2HR3A 2UZKA 4LK1F 2F5EA 3SHFA 4HQMA 2O8XA 5DUKA 2K27A 1J7KA 3GFLA 2E1CA 3HSEA 5ICCA 2BYVE 2DQLA 1BM9A 2HYGD 1BIBA 1F5TA 1S3JA 2VQFH 4L9NA 3ZQ7A 2W84A 4LF8H 4KN7X 1T38A 1VTNC 2JTVA 2CW8A 3QPTA 1XCBA 5D4RA 1R23A 2EA2A 1IZ1A 4M7EA 2DQRA 4KHPH 4DR7H 4HZFA 2D45A 3R60A 3NQOA 1XGMA 2M30A 3LA3A 1LDKB 2L3DA 1G6NA 1JXSA 1FYLA 2H6BA 1USSA 3EYYA 1KU2A 2L4AA 4OIPF 4L9TA 1DP7P 1JE8A 4UCOA 3K69A 1FJGH 4BHCA 2W25A 1YQAA 2L54A 4KN4X 3T5XA 2HTSA 4RGUA 2V9VA 3QRFF 1SD6A 3Q9VA 2F5FA 4EMSA 3TO6A 2ETHA 3LA7A 2HQRA 2GA2A 1O3QA 2ELHA 4A12A 3PFIA 3J80W 5BR8H 1LDJA 2VONA 3I59B 4O6JA 5JHUA 2ZFWA 1QZYA 4IRIA 3KP4A 4DR4H 3WTSC 3CLOA 1U6GA 4AVPA 1IBLH 2XAJA 4WK8F 4CGZA 5E18F 1OYWA 1S7OA 5D1PA 5DCFA 5K1YA 1CF7B 3CO6C 2OWOA 4BWSC 2Y0MA 4GCVA 3L4JA 3I71A 2DW4A 4M9SA 1U2WA 5E20A 1SYXB 1R22A 4B3TH 3DKWA 4RB3C 3FMRA 4UV9A 4M6YA 1LEBA 3I0TA 3HRMA 3PN1A 1YFHA 1ZG5A 5HS9A 2NAZA 3RJ0A 2K02A 2IJLA 2QQAA 2ZMEB 4KICA 2CYYA 4WXHA 3FM5A 2LKPA 1HW5A 4JK1X 5ICGA 4LB5A 3TDZC 4LH7A 3OTOH 1JGSA 3N40P 3OOPA 5F6FA 2HZTA 4MEYF 1XCVA 4KUMA 3LAJA 2CGPA 2A3SA 4A0ZA 4F7ZA 5ILUA 2EV5A 1ZGAA 4CZZA 2DLLA 3WTTC 3TQNA 1K78B 2EWNA 4FM9A 2DO7A 4JI5H 2Z33A 2EV0A 1XSVA 2CW7A 1LVAA 4B3SH 2Q2TA 2NS0A 3Q5FA 2HGCA 3O6BB 4YIIA 1BC8C 2QBYB 5BS6A 4L18B 4JV5H 4LFBH 1HR0H 1IRFA 3CUQA 5EEGA 4KNYA 4AWXB 1B9NA 4OINF 2JT1A 3V7CA 3FM3A 5LEJA 1R5GA 1YO5C 3KP7A 3T8RA 4QWQA 3ZMDA 3U9GA 3SZPA 1V9PA 1S03G 2OZUA 2HKOA 5K5QA 4HDVA 4P55A 4GYGA 2P5LC 1G3WA 3JAMW 3F8BA 4BYYA 2JZYA 1E4GT 3CJNA 1Z2PX 4OIQF 5K5OA 5LHGA 5HLGA 3KFWX 5FLXW 4ENJA 3L00A 2VBYA 4MHGA 2DFIA 1P92A 3E6MA 3R4KA 2ZJTA 2EJRA 2D1VA 5D8LB 2VQEH 2LSOA 2OQRA 4L9JA 3WGHA 2IP2A 3RIRA 2R3SA 4O3MA 2L4MA 2W57A 1MZBA 3HYIA 2GAUA 4LJZF 1BJAA 1PP8F 4G9YA 5BQTA 2G7UA 3MCZA 2Z9OA 5DD4A 3W6KB 2WDTA 2A61A 5E1XA 3HHGA 1ZGJA 1U8RA 3RF2A 3CUQB 1P4XA 4HX8A 2DAOA 2Z3YA 3LA2A 4CDGA 4NHJA 1U5TC 2FXAA 4EEQA 3KAKA 1FSEA 3GFJA 1STZA 1I1SA 1BN5A 2QQBA 3JTGA 4M9ZA 3IWFA 3C18A 4LF6H 1HQCA 1W7PD 3IKVA 3K1PA 3F3XA 4DV3H 5HS7A 4XSZF 2VE8A 4G6DA 3WTWC 1SD5A 3BZ6A 4OIOF 1ULYA 4DV5H 3PQJA 1WKMA 5LGTA 2TDXA 4WCGA 3IC7A 2A6HF 1ODDA 2JPCA 1K79A 4N9IA 1DPRA 3ZPLA 4LMYA 3TO7A 1S6LA 4JYAH 2UU9H 1XGOA 2KIUA 2W85A 4N9HA 1GXPA 4KYWA 3GZ5A 3VODA 3RIZA 1W7PB 1HW1A 3IHUA 1HKTA 3E3VA 3EYIA 3TOBA 1I6UA 3BJAA 4YFXF 3T1BA 5F1RA 4HAMA 2BBYA 3EDPA 2X4HA 1X3UA 3H3UA 4U7BA 4J0MA 3RPUA 5E8IA 1J75A 3WG9A 5DD8A 2A68F 3V8KA 4RGRA 2FA5A 1XDSA 4DR5H 4ESJA 5BMZA 2YR2A 3FXQA 1HW2A 1LB2A 2YX7A 2XUBA 1MJAA 1FP2A 2HDCA 1TA8A 2MD5A 2M45A 4WF2A 2QVOA 1N36H 1CGPA 1QPMA 5LBQA 3W6JB 2PLYA 5FPOA 4I01A 3P9KA 1J5YA 2VPSA 2ISYA 2XASA 4HLYA 2LF8A 1ZHQA 5CJ9A 3FMSA 1W5TA 1HSTA 2HVQA 4Q0YA 4M9XA 3Q9SA 2OD5A 1E4FT 2FF4A 3QU6A 4IAJA 2ZO4A 3M8EA 2VBZA 1P6RA 1SFUA 4NB5A 1A0IA 4ON0A 4DV1H 2XV4S 1KU9A 1BI3A 4DV0H 1YG2A 5CVVA 2WV0A 3WU0A 3FHZA 3WODF 3IKTA 2Q2EA 1R1VA 3F22A 4HF1A 1L2ZA 1YYVA 1O57A 1XB4A 4IPAA 5CLSA 4M6XA 4LFCH 1SFEA 1YLFA 2VODA 3E5QA 2VN2A 5JI6A 5ICFA 4JQFA 2P5VA 2STWA 2GZWA 3HRTA 3DP7A 4XRFA 4OOIA 2KIFA 1XMQH 5FLXZ 5LLQA 1B4AA 3D5LA 4HDUA 1P2FA 4H0EA 4BNCA 3CO7C 1R00A 5BPDA 4A5MA 4WX9A 1Y0UA 2MLGA 1BI0A 4U88A 3BOQA 2HYFA 3I54A 4L5JA 3N43B 1WI9A 3LAPA 2V6CA 3SZTA 4LLNA 2XGXA 5L3FA 4ETSA 3RGXA 5ED4A 3FWEA 1KA8A 2HVRA 1WQ2A 4RAZA 1SD4A 1QBJA 3IG0A 3ECOA 1KGSA 2K4JA 2A5YB 3I58A 2DPDA 5ILVA 1FT9A 2PN6A 1GXQA 4DV2H 3BAAA 1IXRC 3SQNA 1BI1A 3ZMSA 1KQ9A 5FB2A 1IN7A 1IN8A 1F9NA 3L4KA 2LF7A 4Q5SF 2ZXJA 5HDGA 3BPVA 1IUYA 1MKMA 3NEUA 3M7GA 2LDUA 4LSAA 1FYKA 3G73A 4YFKF 3ZN1A 5D1OA 4DNCA 3J81K 4X66H 2YCHA 3K2ZA 3UQ8A 2OZ6A 1VS0A 3JSNA 4EFBA 1R1TA 1N33H 2O3FA 1YW9A 2XRNA 4GXOA 1QNTA 1SFXA 1T98A 4KMFA 1H9TA 4TV7A 4UVCA 1K7AA 3OV8A 2MLKA 4LFAH 2VC1A 2VBWA 4P9UA 2O03A 3EUHA 3C1DA 5FPRA 2A07F 1UB9A 1X9NA 3GYHX 1Z7UA 4YFNF 2NYXA 5LGUA 3I5UA 1L3LA 3T8TA 1FWZA 4YHHH 4RGXA 3F8CA 1BBYA 4UHTA 4B09A 3JSOA 2W24A 4IRGA 1FC3A 4FX0A 3V7RA 3WTUC 1WSUA 4HX4A 3J7AK 3DF8A 4GKKH 5LRSA 1TLHB 5E8GA 5L3GA 3K3VA 5CVJA 3TGNA 4L0YB 4DR3H 4I09A 3QP5A 4ZH4F 5ICEA 3TOAA 3V8LA 2GIVA 5IT9K 3MZHA 1IBKH 3FZVA 2YX4A 4UCVA 1O3SA 3H20A 1NHAA 4QLCU 1P8LA 2P8TA 2VE9A 4A2BA 2EFOA 1S8NA 3NRVA 5A2QW 4EJOA 4RB0A 2MCTA 2UXCH 6PAXA 1OPCA 4CC5A 1UFMA 1RNLA 4PCQA 1ZRFA 4IXAA 2VOBA 4DV6H 3J81W 3EQLF 5BPIA 1QQIA 4G7HF 3J7AO 2PQ8A 4UXNA 4UVBA 4PGGA 2BV6A 3KETA 1ON2A 1O7LA 3WU1B 3HHHA 1Z9CA 4X62H 3WTYC 4DV4H 2H94A 5DYMA 3T0YA 3QP6A 3R0JA 4UV8A 3FXUA 2ACJA 2VUGA 4EM2A 2H27A 1HNZH 2EFNA 3ZMTA 1HKSA 4EV0A 1O7FA 3H3ZA 2RN7A 4CC6A 2YU3A 2K7LA 4E70A 2VOOA 1Z05A 1ZG3A 4HBLA 3GFMA 5LMNH 2FNPA 4G94A 3AAFA 3L09A 2COMA 1OKRA 3DFGA 1R1UA 4I98B 2ZCWA 3DPLC 2PMUA 4OMZA 2F4VH 2HGSA 3B73A 2PEXA 1MJBA 4EFEA 4EJTA 5D8KB 1C0WA 4P96A 4CHUA 3ERED 4L5IA 4MV9A 2Q2UA 5LL6b 2MH2A 5FD6A 3P9IA 2VXZA 4DV7H 5TJJA 4I0BA 4B3RH 1DUXC 4K0KH 1XDUA 4EM1A 4OX9H 2CO5A 2Q0OA 3TO9A 2FNAA 2RVCA 2YPRA 2WYOA 1J5EH 2EFWA 1XSDA 1TNSA 5L3CA 2YSRA 1ZAOA 5JR3A 4YY3H 5HLIA 3ML6A 2HQNA 4A0XA 4BH9A 2F2EA 1G3TA 4HV6A 1V3FA 2RDPA 4AIJA 4JBAA 1FOKA 2XAQA 3FMQA 4JI1H 1HNWH 2V1DA 2GA1A 2L02A 2HHHH 4JI3H 5TRDA 3KAJA 1KU7A 4RS8A 4KDPA 4ZYHA 3F21A 3RKYA 3RJPA 4UNOA 3LFKA 2IA1A 1FBSA 4EJWA 1Z6TA 1Z2NX 2O0YA 4UCSA 3HIFA 4CO8A 2FEZA 3M8FA 2MH9A 4LF7H 3P7NA 4LB6B 3REOA 4UUVA 1PUEE 3IRRA 2PMHA 4NXMH 3GFIA 1R7JA 1BGWA 4DR2H 1J2XA 1EH8A 1H0MA 5H20A 3E97A 1IN5A 2Y75A 3BP8A 5J8CA 2GXBA 3GXOA 1T2KA 1Z6RA 4R7RA 2HFHA 2XKPA 4KIBA 2HEOA 1HKQA 1F4KA 3FF5A 1FKAH 3QPHA 3L2CA 1V4RA 4U0VA 2QM3A 1R58A 4ESFA 2KSWA 2P7CB 5LHHA 2HKXA 2LNBA 1JHHA 2KIMA 1M0