4LMYA

Structure of gas perr-zn-zn
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
149
structure length
149
Chain Sequence
MDIHSHQQALDAYENVLEHLREKHIRITETRKAIISYMIQSTEHPSADKIYRDLQPNFPNMSLATVYNNLKVLVDEGFVSELKISNDLTTYYDFMGHQHVNVVCEICGKIADFMDVDVMDIAKEAHEQTGYKVTRIPVIAYGICPDCQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Peroxide stress regulator PerR, FUR family
publication title Distinct structural features of the peroxide response regulator from group a streptococcus drive DNA binding
pubmed doi rcsb
source organism Streptococcus pyogenes
total genus 43
structure length 149
sequence length 149
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-07-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4lmyA01
3.30.1490.190 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 4lmyA02
5D5UB 5EEHA 1G3WA 1P92A 1I1SA 2R3SA 1TNSA 3E97A 2P4WA 3VOEA 2ZXJA 2P5LC 3GFLA 2ISYA 3C18A 2FOKA 3LWFA 3ISPA 2QUFA 5DCFA 2O6GE 4OIRF 5FLXK 2IJLA 1T6SA 5LEKA 2EA2A 3ROUA 3F3XA 4WCGA 2XAQA 2P5KA 1XSDA 3E5QA 2HEOA 4L9NA 1MD0A 1IN4A 2EV5A 5ERIA 4LJZF 3F8FA 2IA0A 4WXHA 1U5TC 5H6RA 5E17F 3P7NA 4FX0A 1YW8A 4EGYA 4Z2YA 2EWNA 1IZ1A 3FZVA 2ZCWA 5JHUA 1KYWA 1W7PD 3E5XA 3HHGA 2HKXA 3O2PE 1I1GA 1UB9A 4OU0A 1U3EM 3QAHA 3ULQB 2FMYA 4QWQA 1HSTA 1FBSA 5CVRA 3WG9A 2L54A 1PP8F 1WI9A 4EJWA 1P2FA 3KP3A 2DBBA 3ZMUA 3NEUA 1BI2A 1KQ0A 1SD4A 5D6EA 2EJRA 5BOXA 4KMFA 2KIUA 1D8KA 3KP7A 1TTYA 4M9SA 4HDVA 2HOEA 1KQ9A 1LDDA 3VODA 3ZQ7A 3ZMTA 2ZNYA 1E2XA 3Q5FA 4M74A 2DK5A 2OAZA 2ZMEA 1KQ8A 3CUQA 5JR3A 5HLGA 3G3ZA 4OMZA 2XAFA 5E8GA 3Q9VA 2IW5A 2LNBA 1TW3A 1ZRFA 2ZO4A 4R79A 1Q1HA 2IVMA 1XGOA 2BE5F 4YG2F 4Q4ZF 4Q5SF 4I09A 2UXNA 2OA4A 1OYWA 5K1YA 2ESNA 4GO1A 1J0RA 3GO5A 4MQVA 3F8NA 3MZYA 1U2WA 2LSOA 1H9GA 4WXCA 1FP2A 1P4XA 1TNTA 3M9AA 4PGGA 2DFIA 2YU3A 4ENKA 4MQ9F 4GYGA 1YTYA 1ZH5A 4IRHA 4PGHA 4D0PA 5D5VB 4BHPA 2G7UA 2VN2A 1KU2A 2M30A 3GZ5A 4GYIA 1SD6A 2LKPA 2BYVE 5HDNA 4ASNA 2W24A 4M72A 1IRFA 1B1BA 5BS6A 1J5YA 2XAJA 4G9YA 2H09A 2ZMEB 3EDPA 4BAYA 4EJTA 1HW1A 3MFKA 4WF2A 3L2CA 1ON1A 2NYXA 2XRNA 1QO0D 3G73A 4XBFA 3QRFF 1XMKA 3SZPA 5ILVA 3R4KA 2BV6A 4LG0B 2JSCA 2QLZA 3GZ6A 3LA2A 2QVOA 4TV7A 5LHGA 1FC3A 2KIMA 1S7OA 1ZG1A 4XSZF 4MHGA 3I0TA 4ENNA 5HLIA 4OIQF 5F64A 2OZ6A 3CO7C 2DO7A 2EFPA 2UXXA 1HSJA 1BC7C 1I27A 4ESBA 3E6CC 2GXGA 3FMQA 3SFZA 2CWEA 2EFOA 5LHIA 2Y75A 2QENA 1LEAA 2WC2A 1F4KA 5HS7A 4AIKA 2A3SA 4UNOA 4P9FA 2MH9A 2DPUA 1YLFA 1LJ9A 3BPXA 3K69A 1IAWA 3U2RA 4PDKA 4EJUA 3LAJA 3ABTA 3KP5A 1IXRC 3PQKA 1LNWA 5FB2A 1FNNA 2GIVA 5FFXA 2IA2A 1FSHA 1FYKA 3DP7A 5JFRA 2VOOA 4KYWA 2PI0A 3LQQA 3D5LA 5E1XA 3I54A 5HS9A 2O61A 2UWMA 1DP7P 4LK0F 4KUMA 2YX4A 3BJOA 3RJPA 1U6GA 2HFHA 1FPQA 3E5UA 5LLQA 1TLHB 2W57A 1PP7U 5AIQA 2FBHA 4UVBA 5IT9Z 5IT3A 4Y17A 3CO6C 4OOIA 5DD4A 1L0OC 4L18B 2ACJA 5HLHA 2QQAA 5DEQA 3J7AO 1YS6A 3ZN1A 1X3UA 2ZFWA 4OMYA 5KK1A 3TO7A 4G8XA 3RI4A 5D6FA 1RUOA 3HTSB 1KA8A 3E6MA 4XLNF 1OMIA 3PQJA 2GAUA 3VFZA 3JAMK 1U5TA 1ZG5A 1LB2A 1SFUA 1BN5A 4WWCA 3WTZA 4YIFA 3ECHA 1RI7A 3DPLC 4IXAA 2VC1A 3I59A 5DV5A 4UVCA 2DQRA 4L5IA 3WTTC 3E6DA 2XROA 3QU6A 1KU9A 2VE9A 1ZRCA 3M8FA 3V4GA 4I02A 3M8EA 4GGGA 4IPAA 3IKTA 3IL2A 1FY7A 1W5SA 4IRIA 3DV8A 2EV6A 4I0BA 5J8FA 3JSOA 3TO6A 2RV8A 2HYFA 4FHTA 2HTSA 2CGPA 1S8NA 3NRVA 3HOTA 3F6OA 1IN6A 3J80K 2PFBA 3WGIA 3GFJA 2HDCA 3FMSA 5LGUA 3B73A 4LLNA 1R5GA 4WK8F 1MGTA 1STZA 4CYDA 3MZHA 3BROA 1YG2A 2FNPA 3J81Z 2VT3A 3OOPA 1MKMA 2EA4A 5A2QZ 5BPIA 4ENJA 4AIHA 5JI6A 4H0EA 5LEJA 1OYYA 1R1UA 2YR2A 1XSXA 1MJAA 3TDUC 3ECOA 2K86A 1HKTA 2FU4A 4BHBA 4A5MA 2OZUA 2JPBA 3V8JA 3I71A 3ZMVA 2CQKA 3IKVA 2A07F 4YFNF 2CW0F 4LB5A 4RS8A 2L02A 2RGVA 2JZYA 3GFIA 3TKYA 2ELHA 2P5VA 2D1HA 1ZAOA 5K5QA 4CGZA 3P9KA 2FQ3A 3JTGA 3RYPA 2F5DA 1EH7A 4WXDA 3VB2A 2IA1A 2M5WA 2JPCA 4O3MA 4KN7X 3DKWA 1UHMA 1LDKB 4UHTA 1MDMB 2V6CA 3COAC 2DK8A 1D8JA 4O5VA 3REOA 1G3SA 2IT0A 2OQRA 4F7ZA 1LQ1A 3O3KA 2E7WA 3DQVC 1D5VA 4FX4A 3V7SA 3ZMZA 3FWEA 1K79A 1RNLA 2VE8A 3BJ6A 3FXQA 3KZYA 5ED4A 3TOBA 2CSOA 5E20A 1F9NA 2L01A 3ELKA 3HRMA 3WTXC 4LK1F 4UXNA 3HRSA 3SZTA 1HW2A 4CZZA 5D4SA 2A69F 1OKRA 1R5HA 2VBXA 3ZPLA 2P6TA 1DDNA 2RVCA 3GLXA 2O0YA 4M6YA 4MNUA 5D8LB 5AIPA 3F23A 3GFMA 5DCMA 2W25A 5E8IA 2HTJA 5FO5A 2KJBA 2EFWA 2DU9A 4HYEA 4HDUA 4IHSA 1KGSA 4L0ZB 4G7ZF 1UHWA 5LHHA 2P8TA 2WWYA 3FHZA 2NNNA 1P6RA 2LF8A 3T5XA 2W85A 3ZN0A 4EQQA 1WKMA 1QZZA 2RC4A 3QP6A 4RB0A 4U88A 4UVAA 2DT5A 4P5OA 4N9HA 5CVJA 3QPTA 1G4DA 5LRSA 1T2KA 4A0XA 1O57A 2ISZA 1NHAA 1HBXG 4CDGA 2O8XA 1YW9A 2PEXA 4LLGF 1K6OA 5FFZA 3TGNA 4ZZLA 3F21A 3L7WA 3QOPA 3FX3A 4OIOF 3LA7A 4KNYA 4UUVA 1IN8A 1Z91A 4KIBA 1BI3A 4BQAA 5BMZA 1YIOA 5ICGA 2FSWA 2HYGD 1R1VA 4S04A 3F8CA 4KIFA 4RB2C 4EVIA 4RB3C 2F5CA 1FOKA 3L09A 1RIOH 1K78A 3BDDA 3CUQB 4EGZA 2JRTA 2F5FA 1W5TA 3GW2A 4L5JA 4HQMA 5ILUA 2X4HA 1LDJA 2BGCA 3S2WA 2D2WA 3Q9SA 2C6YA 4I01A 4HAMA 1F1ZA 4ESJA 4MEXF 4HV6A 3P9CA 3K1PA 4KT5C 2IP2A 2FE3A 3L9FA 2G7HA 1J2XA 2K7LA 4HV5A 2QZ8A 4ESFA 5L3CA 3R61A 4JBAA 4BHCA 1B9NA 4PCQA 2FA5A 2CO5A 2V1UA 2Y48A 1IN5A 1W4MA 2K02A 1G3YA 1UFMA 3JSPA 2XGXA 1A04A 2JTVA 4U0YA 5D4RA 1TBXA 3RTRA 3U1DA 4A12A 3C7JA 1SFXA 5EEGA 1QZYA 3E6BA 4HX8A 2VBZA 2IPQX 2Z99A 1JE8A 2EB7A 3GXOA 5FD5A 2YSRA 2KRFA 3BWGA 4BH9A 2PLYA 1SAXA 1U8RA 3I53A 4HZFA 3DXJF 4IJAA 2YPRA 2VBYA 3OV8A 3CUOA 1W7PA 1ZYRF 3KE2A 2GZWA 4CHUA 4OINF 1P4AA 1CF7A 3H3UA 2D1VA 4ZYHA 1KYZA 1IXCA 5CVUA 3PFIA 1ON2A 5HDKA 1ZHFA 4I2OA 4L9VA 2MA3A 2NS0A 1HKQA 2QM3A 3KETA 2YX7A 2XKOA 3CUQC 2K27A 3MEXA 1ZLJA 1XMAA 4ON0A 5CYVA 2OU2A 5D5WB 1GVJA 1OR7A 1HQCA 4B8XA 1F5TA 1IRGA 3WE3A 3HTUA 3C3WA 4LB6B 2H27A 4ZZDA 2XASA 4KN4X 2OBPA 5BQTA 1XB4A 3HHHA 1I6XA 5L3BA 2PBIA 4RGXA 1D3YA 4HX4A 2H6CA 2AS5F 3TO9A 2MBFA 1BJAA 3E3VA 2XV4S 4HW0A 2MLKA 3WE2A 2PN6A 1H9TA 3FF5A 2WTEA 3V7RA 4KIGA 4A6EA 2HKOA 4EM0B 1YS7A 5J6XA 2LDUA 3V8KA 1XSVA 3ZMDA 4IRGA 1JXSA 3T1BA 5L3EA 3LAPA 4A0ZA 1YYVA 5L3FA 5CJ9A 4GXOA 5FGMA 1SD7A 1FX7A 2Z3YA 2QWWA 3DEUA 1QNTA 5FLXZ 2A61A 3R60A 5E18F 4G7OF 4FT8A 1FP1D 3TQNA 2VC0A 3B02A 1GXQA 4HQEA 1O3QA 4RB1A 4R1HA 2F2EA 3C1DA 4RGSA 4LMYA 3GX4X 2GWRA 2STTA 3KFWX 2A6HF 1ZN2A 1BOAA 2RQPA 5D5XB 2L4AA 3WTVC 4CXFA 2HQNA 5F1RA 1R00A 2UZKA 3IRRA 6PAXA 1USSA 4ENMA 1R7JA 1O3TA 1ZRDA 3LA3A 2V1DA 4BXUA 4U0VA 1T38A 1FZPB 2VT2A 1HXDA 3QP5A 4Y15A 5TJJA 2QBYA 1ODDA 2F5EA 4K2EA 2M8EA 4IHTA 2V79A 2HGCA 1GHCA 1QQIA 3I4PA 2K4JA 3K1MA 2KIFA 3GVAA 2ZKZA 4N0BA 1U5TB 4IF4A 2V1XA 4EJOA 4RGUA 4EM1A 4HF1A 1AOYA 5AONA 4ZYDA 3I58A 3I59B 3IC7A 3QPHA 3T0YA 1WWXA 2J5OA 1ZG3A 5LGNA 3KEQA 1U78A 3V7CA 2Z5UA 4L9TA 2R7DA 5HVQC 4A6DA 1Z9CA 1YQAA 2Q8KA 1OPCA 4UV9A 3D0SA 1R23A 5IT9K 4JK1X 2MC3A 1J7KA 2X0LA 1WRJA 2B0LA 3WGGA 4AVPA 3FMRA 3H92A 2ZJ2A 1XN7A 2H6BA 4P9UA 1MJBA 3RKXA 3SQNA 3RPQA 4LGWA 2O3FA 2A6EF 3L00A 4HLXA 5DYMA 3RKWA 2MH2A 3HSEA 3KP6A 4ZH4F 2GA2A 4BYYA 1B4AA 2COMA 1QBJA 3EQLF 3HSFA 1QPMA 1BBYA 2G9WA 1R36A 1JHHA 2CFXA 2L3DA 1IF1A 4A5NA 3I5UA 1G3TA 3IHUA 4A2UA 5K5OA 4M73A 5HDGA 1EH8A 3IWFA 4BNCA 1S29A 2NRAC 1REPC 3MCZA 1IW7F 4XSXF 4EV0A 3EUHA 4AIJA 1TQMA 3K0LA 4UV8A 3W6JB 1KU7A 1B9MA 2EV0A 3K2ZA 2ESHA 3ZP5A 3KZZA 1USTA 1CGPA 3R6SA 4U7DA 3AAFA 1XGNA 1SD5A 1Z6TA 2OQGA 2GQQA 3CDHA 3J81K 3KP2A 1JHFA 2FBIA 3IRQA 2DW4A 5A2QK 4M6XA 1B59A 4MTEA 1P4WA 5ICFA 4RAYA 2FBKA 2HWVA 1C0WA 2ZBKA 3DF8A 1T39A 3TOAA 4B09A 2XUBA 1H0MA 4HOBA 2MD5A 3N4MA 5J8CA 2QQBA 1R22A 1O3RA 1XGMA 2VONA 2VODA 1E17A 1ONVA 2P6SA 1V4RA 3CTAA 3O6BB 4QLCU 1O3SA 1YFHA 2LF7A 3WGHA 2FEZA 1T98A 4MGRA 1BC8C 4G6DA 2M1BA 5DUKA 3HRTA 1XCBA 4LG0A 1BIBA 2PMUA 3FM5A 1B6AA 3H3ZA 3WTYC 3JTHA 1Z1DA 2XHKA 1HW5A 4Q47A 3TDZC 5ICEA 5BPDA 4XLPF 4DNCA 4LLLA 3GWZA 4WX9A 4NB5A 3WU0A 4M71A 1K7AA 3GUDA 4G7HF 1VTNC 2DTRA 3HRUA 2L4MA 3ERED 5JVTA 3FM3A 1T0FA 2QYOA 2DPDA 2FRHA 3RIRA 3GEZA 3R0AA 5DCMB 3SXYA 4HBLA 2K4BA 1FYMA 5DD8A 2GXBA 3FXRA 1DPUA 1FYLA 1G6NA 1J9IA 1S3JA 3F6VA 3RKYA 3IWZA 1Y0UA 1YO5C 2XKPA 4KMUX 4PZJA 5KVRA 5E1ZB 2IRFG 2XVCA 3HOSA 2GA1A 1RUNA 2P7VB 3RYRA 2EFNA 4HA8A 2EK5A 4HX7A 4N9IA 1MJ9A 2ETHA 3MWMA 5K5RA 2KKOA 2M45A 3JAMZ 5FD6A 1RZ4A 2FMLA 2VOPA 1XCVA 3F72A 2RN7A 4Q48A 3F8MA 1BM9A 2DI3A 4O6JA 1KU3A 4HF2A 2R7FA 4KDPA 3WTSC 5CLSA 1ZGAA 2RDPA 3HYIA 3EYYA 4G6QA 4HF0A 3WODF 3GF2A 1EH6A 4I7HA 4KICA 1WQ2A 3BY6A 3P9IA 3BOQA 2HS5A 3T8RA 1K78B 2Q0OA 5CVIA 5F6FA 2DQLA 4Y13A 1IN7A 2XAGA 4LD5A 5TRDA 2PMHA 5HS8A 5L3DA 2A68F 1HKSA 1XDUA 1PUEE 4EM2A 2QQ9A 3M1EA 3J80Z 1TQPA 3DFGA 5LRRA 3RPUA 3VEPA 3BZ6A 1ZGJA 4MTDA 2KJCA 2J5PA 1AWCA 4RAZA 1BI0A 4U0WA 4KFCA 1SMYF 2JT1A 1JGSA 1DUXC 1BIAA 3F8BA 1O7FA 2Z9OA 3N97A 2VBWA 5L3GA 4NQWA 2HQRA 4JQFA 3V8LA 5D8KB 1LVAA 3KP4A 3BJAA 1R1TA 3BP8A 3KCCA 4OIPF 3ML6A 2W84A 2RKHA 3HIFA 2E1CA 4E70A 4DQ2A 2NAZA 1ULYA 2HR3A 4L9JA 1WSUA 4AD9A 1IUYA 5H6QA 4A0YA 1FLIA 3W6KB 1SFEA 2ADUA 2TDXA 3ABUA 1J59A 3WTWC 1ZREA 2PQ8A 2VXZA 5CVVA 2PG4A 4ZYEA 1ZLKA 2M87A 3WU1B 3ZMSA 3T8TA 1TW2A 1Z05A 1XDSA 1V3FA 1ZARA 1YW7A 1FBUA 1S7AA 1QGPA 2V9VA 1W7PB 3KLOA 3M7GA 1LEBA 4YIIA 3NQOA 2D45A 3RDIA 1CF7B 3KEOA 1UCRA 2DLLA 4AWXB 4YFXF 2HZTA 1J75A 2P7CB 4GCVA 1IXSB 1OYIA 3R0JA 4P96A 1FBQA 3LFKA 4IVNA 3FXUA 4NHJA 3CJNA 4R8HA 5E1WA 2A5YB 3GYHX 5LGTA 1R58A 3K9TA 2XAHA 4I0AA 2FXAA 5HOOA 2RNJA 3CLOA 1TQIA 1GXPA 3F22A 1FSEA 1MZBA 5DDGA 2CG4A 3HSRA 3MQ0A 1L3LA 2AXLA 5ICCA 3HUGA 2OD5A 2CYYA 4ZYGA 3I64A 2MLGA 2BEOA 3KLNA 4KA4A 2DAOA 4P55A 5H20A 2H94A 3BPVA 2PJPA 4EMSA 2Q2EA 3EETA 2E1NA 4U7BA 4RGRA 4EJVA 2ZNZA 3JW4A 2STWA 3SHFA 1I5ZA 1XGSA 2BBYA 2FNAA 1XD7A 4M9ZA 2E7XA 2FF4A 4G94A 4LFUA 4MEYF 3WTUC 2Z33A 1MDMA 1DPRA 1FT9A 3U9GA 3QU3A 1Z6RA 3LQRA 5DUIA 2WV0A 1O7LA 4M9XA 4L0YB 2Y0MA 1S6LA 3EYIA 4YFKF 4HLYA 4ETSA 2NNYA 1FWZA 4CO8A 1PDNC 3LSTA 5ILSA 2XIGA 2EFQA 1BI1A 1SMTA 4XRFA 5LBQA 1EV7A 4CICA 2O03A 4I98B 4S05A 3MAJA 1Z7UA 3K1NA 3DPTA 2QBYB
chains in the Genus database with same CATH superfamily
5B66C 5D5UB 5EEHA 3GBGA 1G3WA 1S97A 1P92A 5TISC 5JVGF 1I1SA 1JUMA 2R3SA 1TNSA 3RB4A 3E97A 1EZ1A 1RYRA 2Y30A 2L2OA 2P4WA 5L1LA 2AO9A 1YJWI 5C3EJ 1E4EB 3VOEA 2IXSA 2ZXJA 3K3PA 2IGMA 2P5LC 3BCBA 3GFLA 5DLGA 2R5ZB 4IO9F 1BGWA 3RBEA 2ISYA 1BR1A 1ENHA 2RNGA 3C18A 2FB9A 3A01B 2FOKA 3LWFA 3ISPA 2QUFA 4I76A 4B1RA 5E79C 1CQJB 5DCFA 1JUSA 2J6SA 4F92B 4DR4H 2O6GE 4OIRF 1HF0A 1AU7A 5FLXK 2IJLA 1T6SA 5LEKA 4RZQA 2EA2A 5T14A 1IBMH 3ROUA 3F3XA 4WCGA 2XAQA 4YQWA 2P5KA 1XSDA 3PM1A 1ERDA 3E5QA 2HEOA 4L9NA 4Y8VB 3LSJA 4J00A 1TAEA 1MD0A 1IN4A 2L5QA 3FK7A 3S17J 4DYRA 1S5LC 2OUMA 2LFBA 1ULZA 3Q8QB 4DV7H 2EV5A 2ASJA 5ERIA 1EJ9A 1LUJB 4LJZF 1PVEA 3F8FA 2LK2A 3IUOA 3OWTA 3OR1C 4A2BA 3QZ8A 2DPIA 2IA0A 4WXHA 4JI1H 1U5TC 2JA8G 5H6RA 2QA4I 4B3MH 5E17F 3P7NA 4RM3A 4FX0A 1VFCA 2P0WA 2XC9A 2LRDA 3QPLA 1SFKA 4WBNF 1YW8A 2VUMG 4EGYA 4Z2YA 1IZ1A 2EWNA 3FZVA 2ZCWA 5JHUA 3CC4I 1KYWA 1W7PD 4ED8A 3E5XA 2A6TA 3IV5A 2R7SA 4BEHB 2KP6A 3HHGA 2HKXA 4O3RA 3O2PE 2K3FA 3KX2A 4F4YA 3PN1A 1I1GA 3E5NA 1UB9A 4OU0A 1UG0A 4DYCA 1U3EM 3LMMA 3QAHA 3ULQB 2DWCA 2FMYA 1QRYA 4QWQA 3L2WA 4V2GA 5DQHA 1HSTA 1FBSA 5CVRA 3WG9A 2L54A 1PP8F 4RAGA 2GBYA 1WI9A 4EJWA 2BHZA 1P2FA 3KP3A 4XORA 2DBBA 4O3QA 2G0EA 3H35A 4ECSA 3VPRA 3CCSI 4J0MA 3PR4A 3HOUG 3ZMUA 3VYRB 4BQNA 1WGXA 2BXYA 3NEUA 3HC7A 1BI2A 3Q8PB 1KQ0A 1SD4A 4XL9A 5B3SH 3SDGA 5D6EA 2EJRA 4JI7H 2XPVA 2VJ5A 5BOXA 1FOWA 4KMFA 3QYBA 2KIUA 1KJ8A 2E5LH 3DTKA 3OSFA 1D8KA 3KP7A 3PO2J 4PFPA 1TTYA 1X19A 3CJRB 5IPAA 4M9SA 2PBZA 3GZNB 4D7NA 2HOEA 4HDVA 1K83J 1HA8A 1KQ9A 3KTMA 1DP3A 1LDDA 2OF7A 3VODA 3ZQ7A 3ZMTA 2VPLA 4IOAF 4LF9H 2ZNYA 2VUMA 3LP8A 5L9XA 5IYDJ 1E2XA 2NVXA 1QHHD 3Q5FA 4M74A 4D9JA 2DK5A 2R92J 2OAZA 2ZMEA 1Y39A 9ANTA 5IWAH 1KQ8A 3CUQA 4TV8F 5J3LA 5JR3A 4GC6A 5HLGA 4XIDA 4IQJA 3G3ZA 3DPUA 4OMZA 2XAFA 5E8GA 3IH2A 2IW5A 3Q9VA 2UVVA 3HOZG 1N32H 1H8AC 2LNBA 1NH3A 4BE1A 5JVDF 1TW3A 2XDVA 1ZRFA 2ZO4A 2CMPA 1BXRA 4LFBH 3QYEA 3WU2C 4R79A 4Q43A 2JA6J 1Q1HA 2IVMA 2MW8A 3RGXA 4OX9H 1XGOA 3A03A 2E2HA 2PVPA 3UFXB 2KHMA 2KDOA 4V19K 2BE5F 3RGZA 3FKIJ 4ED7A 4YG2F 4Q4ZF 3T5JA 1YRNA 3V4ZA 3OYFA 4NUBA 4Q5SF 1IDZA 4I09A 2FUG2 2Y2ZA 2UXNA 2OA4A 1OYWA 3G1MA 5K1YA 2ZJPF 2R0QC 1B72B 3VYUB 2ESNA 3M4OJ 2R7XA 3H4BA 2V4JC 4GO1A 1J0RA 4DL7A 3GO5A 2MFZA 1YHQI 2BY1A 4JI5H 4LFAH 2XGEA 1GV2A 2CW7A 4MQVA 3F8NA 4HSRA 1APLC 3MZYA 4J9RA 3DKXA 4I50F 3PZPA 3N42B 3CCQI 3S2DJ 3S15J 3KHRA 1WCMG 3J7AK 1S68A 3BAAA 1U2WA 2LSOA 4QPQA 1H9GA 4WXCA 4QJFA 1FP2A 5EG0A 3I3LA 1P4XA 5J4YA 1TNTA 3M9AA 4PGGA 3ZQCA 3HKZN 5BNGA 2DFIA 3UKGA 1VQ5I 3ZQLA 3N8DA 3KALA 5DS9A 2YU3A 4ENKA 4MQ9F 4GYGA 4F50A 3OS1A 4CA0A 2KQRA 4XN0A 1YTYA 5KT3A 1ZH5A 1HR0H 3I9V2 4IRHA 2DA5A 4PGHA 1MSFC 2FPPB 2JEJA 3DEWA 2KISA 4D0PA 2FLLA 4EG0A 4MAMA 2HYJA 3OYDA 3GTOA 5D5VB 3BCAA 2NU7B 4BHPA 3PO3J 1JI8A 2WE6A 5KFRA 2ALZA 3VWBA 5LXTF 2G7UA 3RFCA 2VN2A 1N33H 1KU2A 1B6RA 1MMGA 2M30A 1MNDA 3GZ5A 3GQCA 4GYIA 1HC8A 1SD6A 2LKPA 4II3A 2R7LA 2BYVE 2DYSH 3GTPA 2CH0A 3HEFA 5HDNA 4Y4RA 4ASNA 4IOCF 5DM7F 3Q8RB 2W24A 5HLTA 1LE8B 2R82A 4M72A 1T3NA 1IRFA 3SJMA 2PX9A 3HOYG 4D7MA 1B1BA 1YJ9I 4B3XA 5BS6A 3QQAA 3RAXA 1J5YA 2XAJA 3VPCA 5KFFA 2X1DA 4G9YA 2H09A 1XX5A 1UC9A 2LBFB 3IN5A 4Q44A 2ZMEB 3EDPA 4BAYA 4B3TH 4EJTA 1HW1A 3MFKA 4CYCA 1VBHA 4WF2A 4CZCA 2OCCH 4PJNA 3L2CA 1AN7A 1W5CC 1ON1A 2NYXA 2BQ3A 3U9SA 4Y3OA 4ZHQF 1EF4A 2CV1A 2UVUA 4IHXA 2XRNA 1QO0D 2GIZA 3ONQA 3NWTA 3G73A 3PUFA 4JI3H 2YU9A 4LSXA 2ZB9A 3MKZA 4XBFA 4UUSA 3QRFF 2V4QA 1XMKA 3SZPA 2CV2A 2TRTA 1ACIA 1I50A 5ILVA 5EDWA 3R4KA 2BV6A 3KHHA 4LG0B 3HB9A 5KFDA 4QWAA 2JSCA 1MW7A 4A93J 2DT7B 3MKYB 3Q0WA 2QLZA 2VLAA 3A4CA 3LA2A 3GZ6A 1FTZA 3PIOF 3DF7A 5KFGA 4R8UA 2QVOA 5EGOA 4A3IJ 2W9BA 4TV7A 5LHGA 4GKKH 1D0YA 1FC3A 1S7OA 2KIMA 5KCMA 3W3CA 2IGNA 1Y1WJ 1ZG1A 3FXLA 4XSZF 4MHGA 3KHLA 3I0TA 4XLAA 4ENNA 3UQ8A 3ASNH 5C44G 1X1PA 4BKXA 5HLIA 3M9MB 5LOVF 3FXOA 4OIQF 1QHGA 4HPQA 5F64A 2YL2A 2OZ6A 3QYFA 5F9NA 4IR9A 1LKXA 3CO7C 3L2VA 2DO7A 2BR0A 4XKWA 2EFPA 4AYBE 2UXXA 4UY8I 1HSJA 1BC7C 2HXIA 4N4OB 3EUHC 4CCKA 1I27A 4BY7J 4ESBA 3E6CC 3KAKA 5C5JA 2W6ZA 2GXGA 3FMQA 3SFZA 2K3PA 4C2MJ 2CWEA 2VA2A 3H5RA 4CC5A 4EBCA 5FROA 1B04A 4XNFA 2EFOA 1A6QA 1HDDC 3CJTB 3K4LA 5M5YJ 2M4GA 5LHIA 1OCOH 5FLMJ 5KFAA 4EYIB 5KT6A 2Y75A 2E2IJ 4YAJB 3TEDA 2QENA 1LEAA 2WC2A 3NARA 4DYQA 3M4IA 4YRVA 1F4KA 5HS7A 2DODA 4A3MJ 4BS9A 3K3VA 4AIKA 2A3SA 2UV1A 4P9FA 4UNOA 1ITYA 2MH9A 3DEEA 5CA1F 3FXKA 1XS9A 3RF2A 2DPUA 2NVQJ 2W8KA 1MIJA 1LJ9A 1YLFA 3BPXA 3HGGA 4A3GG 4KHPH 3K69A 3CCMI 2V9WA 3LL7A 3U2RA 1IAWA 4PDKA 2W7PA 3DU6A 4EJUA 5IYBJ 1NK3P 1TWCJ 3LAJA 4EGQA 4QPOA 4MV9A 3ABTA 2VKEA 4MV1A 3GTJJ 1TZLA 1ZR4A 2AU0A 5K2MA 3KP5A 1MBFA 4PWQA 1IXRC 3PQKA 4A3CG 1SFOJ 4ECVA 5C8YF 1LNWA 2VKHA 1JTYA 1FIPA 2CUJA 2E5NA 5FB2A 1FNNA 2GIVA 5KFPA 2R7OA 5FFXA 2IA2A 1FSHA 4RZRA 1K6YA 2R7VA 3JSNA 2OJED 2QEXI 3DP7A 5JFRA 1FYKA 2VOOA 4KYWA 2PI0A 2EIMH 3GTLA 3LQQA 2WDTA 3SYTA 3D5LA 5E1XA 3I54A 2LR8A 4AUXA 2EILH 2FOWA 4XKVA 3OIOA 5HS9A 2WYOA 5BPHA 3LSKA 1G59A 2YCHA 1ZQ3P 2O61A 2CQYA 2IS2A 2I8DA 2UWMA 2PMZE 3C0FB 4YJ3F 4ED3A 1V54H 3HBLA 1R6RA 1DP7P 4YAKB 1RR8C 1S9HA 1FOYA 4KUMA 4LK0F 4BUPA 1QVUA 2YX4A 3BJOA 3RJPA 1U6GA 3ORRA 1TWHJ 4Q45A 2WY7Q 2HFHA 1FPQA 2WA0A 3HOWJ 2P0AA 2FLNA 5KFBA 1O4XA 2YZNA 3E5UA 5FPRA 3K6GA 5LLQA 4XRMA 2YZGA 1HNXH 4ZJZA 1TLHB 2W57A 1PP7U 1UNNC 4ED1A 3G1OA 1RKTA 3UNGC 3GCMA 4O4LF 4B3AA 2XAUA 3CLQA 4DBQA 3TIGA 2IA6A 5AIQA 2O9LA 2FBHA 1YITI 2C28A 1ETKA 2C35B 2LMDA 4UVBA 3JSLA 4AVZA 1ETWA 1N36H 1A36A 3ZQQA 5IT9Z 5IT3A 4Y17A 2ZC2A 1I3QJ 3CO6C 1R71A 5GAGJ 4OOIA 5DD4A 1X2MA 1L0OC 4L18B 2BVLA 4DLKA 2ACJA 5HLHA 2QQAA 5DEQA 2JSPA 3J7AO 3RIZA 1FMWA 4DL2A 1YS6A 2VQGA 3ZN1A 3U9TA 2DLNA 2E1MC 1X3UA 4UCRA 3BTJA 1EHIA 2JVGA 2ZFWA 4V2FA 5C4JJ 4OMYA 2KRHA 2L9VA 5KK1A 3TO7A 4H4KC 3OYIA 1B6SA 3IG0A 4G8XA 3RI4A 1CS0A 5DGBA 4AU7A 5D6FA 1XMQH 1RUOA 1AA7A 1ZHSA 3Q8SB 2W9CA 3HTSB 2XGQA 4PFOA 5EWGA 1KA8A 4BBRG 3E6MA 4XLNF 2GLTA 1OMIA 5D1OA 2WAEA 2Y9YA 5KT7A 3DBLB 3PQJA 2GAUA 3VFZA 5IOZA 1DGRM 1R5ID 2DMQA 3JAMK 1U5TA 1ZG5A 1CE8A 2CJJA 1T0FC 2I8CA 2XGPA 1I7LA 1LB2A 1WH5A 2RDIA 1SFUA 1FVIA 2BQRA 1BN5A 2M7BA 4WWCA 5KT5A 4D5FA 2R92G 2HJWA 3WTZA 3PW5A 2LC2A 2FPGB 4YIFA 2ME0A 2L7KA 3ECHA 1RI7A 2C2EA 3CP2A 3DPLC 4IXAA 1VQLI 4GLXA 4G12A 2VC1A 3I59A 5IP9J 2H8RA 3I12A 5IYCG 4J9KA 3JAMW 5DV5A 3HM5A 4NQWB 4UVCA 2MD0A 2DQRA 4L5IA 3BR6A 2K9QA 4E7SA 2CV0A 4IWXA 2DMNA 5BPFA 1ZTRA 2CQNA 4UFZA 3WTTC 3E6DA 2XROA 3JCUC 3QU6A 1KU9A 2VE9A 1ZRCA 3M8FA 3CJQB 3V4GA 4I02A 3M8EA 4S0HB 4GGGA 2JA5G 5HNFA 1JT6A 4IPAA 1SANA 3MMYB 3IL2A 3IKTA 4AQYH 5EZGA 2R7QA 1T33A 1WI3A 2NS7A 1FY7A 3Q0VA 1W5SA 3GIQA 2HQAA 4IRIA 2BZTA 2EV6A 3DV8A 4HSTA 4I0BA 5J8FA 5JHFA 3K4BA 3JRDA 4MO7A 4LITA 4TUYF 3JSOA 4OAYA 3TO6A 4W97A 1CQIB 1W1WE 2RV8A 2HYFA 4FHTA 1HOMA 1S10A 2HTSA 3MVPA 2R85A 3TP3A 3U1KA 2CGPA 2XD4A 1S8NA 3NRVA 4AYBA 1MH4A 2C2DA 3HOTA 3F6OA 1IN6A 3J80K 2VB6A 3OUZA 2PFBA 3H0GA 3JRWA 3WGIA 1IBLH 3GFJA 3H9GA 4LSAA 2HDCA 2XCLA 3FMSA 5LGUA 1SEIA 3B73A 2FJ1A 3GMEA 1VQ9I 4LLNA 2RQQA 1R5GA 4PJLA 4WK8F 5GP9A 3PO3G 1MGTA 1STZA 2R8HA 4CYDA 3MZHA 4C5CA 3BROA 3S3OA 1YG2A 3J80W 2FNPA 1ZGWA 4A3FG 4BBSG 3OIQA 3J81Z 2VT3A 2CRGA 1E3HA 2C00A 5F1JA 3OOPA 4DV0H 4ECXA 4G3IA 2VPRA 1H88C 1MKMA 5GADJ 2EA4A 5A2QZ 3RJ0A 2QSGX 4RUAA 2VASA 5BPIA 2EQRA 1RJQA 2JA5A 1KEEA 3DBHB 3HXLA 3IAM2 4ENJA 3CMYA 1TWAJ 3F9KA 4AIHA 1VF9A 5JI6A 3JRHA 4UCOA 4H0EA 1W96A 5F0CA 3ZRGA 4QIWN 5LEJA 1GSAA 2LG4A 1OYYA 2VKVA 3ZCOA 4YR3A 2XCPA 3GV8B 4BDZA 4ED2A 1SVLA 1BA5A 2VOBA 4LIUA 1R1UA 1PYVA 2YR2A 2YS7A 3K4NA 2AQEA 1XSXA 1J5EH 3G71I 3QODA 2L9NA 1MJAA 2DOEA 1Y8QB 2YUSA 3D5SC 3ECOA 4XMYA 3TDUC 2VJJA 5JLWA 1MBHA 5DM6F 2CS3A 1PUFA 2V6EA 2K86A 1HKTA 2FU4A 4BHBA 4A5MA 2OZUA 2B63J 2E2JJ 5L1KA 1MMDA 2KT0A 2X85A 2JPBA 3V8JA 2JJ7A 3I71A 2JRMA 2PMZA 3ZMVA 1F43A 4EYHB 2DMUA 1TT0A 1WR2A 2CQKA 4A93G 1X58A 3BA9A 3IKVA 3CCRI 1OR7C 1FJLA 2A07F 3HOXG 1QU3A 4YFNF 1ZETA 2CW0F 2QQ8A 4L1KA 3L2UA 4LB5A 4O4IF 4RS8A 2L02A 3HUGB 3K4CA 4KJZA 5I47A 2J6TA 2EINH 2RGVA 1Y1WG 1DGWY 1TA8A 3LSRA 1JX4A 1FIAA 3S93A 3T5LA 2CUEA 2O5RA 2DMTA 4O2BF 3E7LA 4QWDA 4B48A 5KT4A 2JZYA 3GFIA 4J01A 1Y6IA 2HOAA 2R7MA 2NVTJ 3BR1A 2ELHA 4FE4A 3TKYA 4J9LA 3CF5F 2MCTA 2P5VA 2B9SA 4EBDA 2D1HA 1ZAOA 3S1MJ 4RLFA 5K5QA 4ZDLA 4CGZA 2HXOA 3IH4A 2Q2EB 5CQGA 2M0CA 4BY7G 3P9KA 1S0MA 4XQFA 1VQKI 1YOVB 4O3SA 2FQ3A 3S3NA 4YEJA 3JTGA 3RYPA 2CQQA 5KG1A 2DA3A 2CFOA 2F5DA 1EH7A 4X0GA 4EEQA 2XCAA 4UB6C 3ZQGA 4DJAA 3AG3H 4WXDA 3WHCA 5EZHA 5IP7J 4ECRA 1FKAH 3MR5A 5F08A 3VB2A 2FD5A 2IA1A 2M5WA 2JPCA 1Y1VG 1HNZH 4O3MA 4KN7X 4Z6YA 3WHBA 3DKWA 3OYAA 4MFEA 1UHMA 1WH2A 4J9SA 1LDKB 3VPBA 4UHTA 1MDMB 1T36A 2IS6A 2V6CA 3D5RC 1MBEA 3COAC 4A3MG 5KFYA 2DK8A 1WH7A 1GDTA 1D8JA 3OYHA 1TT5B 2DZDA 5EWEA 1MBGA 4O5VA 3TQTA 3REOA 4F4WA 1G3SA 2IT0A 2OQRA 1Y1WA 4F7ZA 4BXXJ 2IS4A 2ECCA 4IEJA 1YX5A 1LQ1A 3EPZA 4ZTJA 4BY1J 1BNCA 2Y31A 4F93B 2WY8Q 3OYGA 2BW3B 3O3KA 4M3EA 2E7WA 2V9KA 3DQVC 2JA7J 1TWFA 4NC6A 5HNHA 1D5VA 3OUUA 2DTZA 1XG1A 3V7SA 3ZMZA 4FX4A 3I4MG 2OCEA 4IHYA 3SEQA 5J2TF 3FWEA 5E3NA 1K79A 4IKFA 2K9LA 1RNLA 2CU7A 2VE8A 3BJ6A 3BTCA 4C2MA 3RPUD 3FXQA 3KZYA 5ED4A 3JRIA 4DL4A 1JKQC 4AM3A 1PJRA 2EZLA 3TOBA 1P8LA 2SCUB 3HOVG 2EIJH 3V6KA 2DFHA 3I55I 3WO1A 2CSOA 1Y1VA 2X6YA 4FU0A 5KG2A 3PSIA 2PN1A 5E20A 2WV1A 3OTOH 1F9NA 4A3DJ 3MR2A 2L01A 3ELKA 3HRMA 1GO3E 3RCOA 2E2IA 3WTXC 4LK1F 4X64H 3ZQIA 4RNOA 2NU8B 5IOYA 4RDUA 3DCFA 4J9QA 4UXNA 3HRSA 3V42A 2IAIA 3LSIA 1R49A 1NK2P 3SZTA 4FCYA 4J9PA 1HW2A 2E71A 1W0TA 2D5VA 3LSHA 3H4DA 3PL8A 5K7FA 3K7AJ 5LFAA 2IMWP 2DA4A 4CZZA 1TWCA 3RV4A 5D4SA 2F4MB 2BY3A 2A69F 3N40P 1N75A 1OKRA 5F27A 3G6EI 1G8XA 1R5HA 5M5XJ 1M7JA 2VBXA 2VQLA 3ZPLA 1VS0A 2P6TA 1X3ZB 1DDNA 2ZSHB 2RVCA 1KZHA 3KPHA 2EZHA 4YIRX 1JJ8C 1KJ9A 1VBGA 3JZIA 2GXAA 1VQ8I 3FDSA 4CC6A 3GLXA 2O0YA 2M8GX 3CP8A 4M6YA 4MNUA 4EFBA 5D8LB 5AIPA 5F0FA 4Q0YA 4YR0A 3RBDA 3OYNA 3F23A 3GFMA 1B8IA 4IHWA 3PUBA 5IY5H 5DCMA 2W25A 5E8IA 5JUMA 3LNQA 2HTJA 2ICWG 2VL8A 5FO5A 4JYAH 4IZOA 2NVYJ 2PJRA 3VMMA 3L4JA 3HZJA 2KJBA 5J2UF 2EZIA 2EFWA 2OTLI 2DU9A 4HYEA 1LFBA 2L0KA 1Z21A 4HDUA 4IHSA 4FQGA 4PK4A 1KGSA 4L0ZB 1DIKA 4G7ZF 2UUAH 4LH6A 5H80A 3GTQJ 1UHWA 5LHHA 3S14J 2P8TA 3PW0A 2WWYA 2Q2UA 1P7JA 3FHZA 3GTGJ 2NNNA 1P6RA 2ELJA 1TWHA 1F36A 2LF8A 4MV3A 2KMUA 3RB6A 3T5XA 3OL3A 2W85A 3ZOBA 3ZN0A 2X1EA 5KX5F 4DR3H 3EPGA 5KFOA 2C22A 4JOMA 4EQQA 2YZMA 2LVSA 1WKMA 1ZELA 1QZZA 5KHDA 3OYBA 2RC4A 3QP6A 4RB0A 4FM9A 4U88A 4UVAA 2DT5A 2B7EA 4P5OA 1H89C 3M1CA 4N9HA 4FETA 4C3IJ 4X62H 4N4NB 2L7ZA 3IAS2 2R93J 1T94A 4IX7A 5CVJA 1IV6A 3QPTA 1G4DA 3FXJA 2NXNB 5J47A 4DBRA 5LRSA 1T2KA 4Y7NJ 2VIXA 2XSJC 1D0XA 4A0XA 4NDLA 1O57A 1OLTA 2ISZA 4A3KJ 1NHAA 4C5BA 2ZDQA 1I3QA 2L7MP 2DJIA 2Y0SN 3RB0A 1P9QC 1HBXG 4CDGA 2O8XA 4CUGA 3GIIA 1YW9A 2PEXA 2NVUB 4LLGF 1K6OA 4YHHH 2NU6B 5FFZA 3HKZE 3TGNA 4ZZLA 3F21A 3L7WA 4JI4H 3QOPA 1W36C 1RJRA 3KYDB 2ZJTA 2E5ZA 2JUGA 3FX3A 4OIOF 3LA7A 4KNYA 4ZI7F 4JV2A 2LY1A 1P7IA 1JGGA 4UUVA 1IN8A 1Z91A 2QYZA 4KIBA 3PIPF 3K2AA 4GC7A 1BI3A 4BQAA 4DR1H 3J7ZI 3H1CA 5BMZA 3ORQA 4LOCA 5JVLA 3BG5A 1JDBB 4YP3A 1YIOA 2IGOA 5ICGA 2FSWA 3L2QA 2HYGD 1R1VA 2H8WA 4S04A 2KZGA 3G8CA 4DV6H 1Z3YA 3HL2A 3F8CA 4KIFA 2M7AA 4FS2A 1QZEA 4EVIA 4RB2C 2HVQA 2LKSA 2MYSA 5M3MJ 4RB3C 2NOGA 2F5CA 4E7IA 2L9RA 3DBRB 1I3AA 2R7ZG 1ETYA 3H0DA 2UXCH 4KISA 2XPWA 4A3LG 2QGUA 1FOKA 2DDAA 3I56I 5EF6A 3L09A 3LSPA 1RIOH 1WCMA 2OC6A 2ZSIB 2ATLA 2ZDHA 4C3JJ 2RGRA 2M05A 1X1AA 1K78A 5CPRB 1OCZH 1RK6A 3BDDA 3CUQB 3FIWA 5J1RA 4EGZA 2JRTA 4HRIA 2F5FA 5GTIC 3G6VA 1W5TA 4MV8A 3BR5A 2XGCA 4EATA 3GW2A 1N77A 1IG7A 3X2QH 2PJRB 1SYXB 4L5JA 4EBEA 4HQMA 5ILUA 2X4HA 1LDJA 1JJ6C 2BGCA 2XF5A 2XPUA 2D2WA 3S2WA 2HPMA 3B6CA 4GKJH 2QKMB 5D1PA 3Q9SA 1MH3A 4I01A 4HAMA 1F1ZA 2DOFA 2C6YA 3PSFA 4ESJA 4XRSG 3S3MA 3BG3A 2LKXA 1TC3C 1IRZA 5KFSA 3M9OB 1E4FT 5GAHJ 1YRNB 1EUCB 3Q1KA 4MEXF 3SDBA 4HV6A 3P5JA 4JV5H 2RDJA 3OIPA 2ZFUA 3DTEA 3VYTB 3KEYA 4UCVA 2GM4A 3PFYA 5KFUA 2F4OB 3P9CA 3VDXA 1LVKA 3K1PA 4KT5C 1BW5A 2UXDH 2IP2A 4HYKA 4PUSA 4XK4A 2FE3A 1UZCA 3L9FA 5LD2C 1MMNA 4PJ0C 2G7HA 1J2XA 2R7ZA 5EG0B 2VQHA 2K7LA 2YRWA 4HV5A 2I80A 1Y14B 2QZ8A 2I10A 3SI8A 4ESFA 5FKNA 3R61A 5L3CA 3GTKJ 4JBAA 1Q1VA 4BHCA 1B9NA 4PCQA 3I4NG 2FA5A 2CO5A 2V1UA 2Y48A 3L1PA 5EJCA 1IN5A 1W4MA 2K02A 1G3YA 1UFMA 1RR7A 3JSPA 2XGXA 2B63G 2X48A 1A04A 3BG9A 2JEIA 4BXFA 1JIHA 2JTVA 4U0YA 2OTJI 2LH9A 5D4RA 1BJZA 2COBA 2W7NA 1TBXA 3RTRA 3U1DA 1AUXA 1N25A 4A12A 1V5FA 4U7CA 2HNHA 1HCRA 3WNZA 1IRXA 3C7JA 4EGJA 2XSDC 1SFXA 1K4TA 5EEGA 1QZYA 3E6BA 1W36D 3NGDA 5KFTA 1GSOA 4HX8A 2VBZA 2IPQX 2EIKH 2Z99A 4DGWB 1JE8A 3TINA 2EB7A 3HDDA 3GXOA 5FD5A 2YSRA 2KRFA 3BWGA 4NLGA 4BH9A 2PLYA 4UUTA 1FOXA 3FBIB 2ELKA 2GOXB 2LOOA 2BXZA 1SAXA 4DW6A 1B33N 1TWAA 2FK1A 3ASOH 1M0WA 1U8RA 4W1UA 4JYKA 2H1LA 4K0KH 4M6VA 2K9SA 5GAEJ 3ABLH 2JN6A 2EZKA 5C3EG 2MGQA 3I53A 3KYLA 4HZFA 1E3OC 1AKHA 3DXJF 4XZ3B 4XLFA 4IJAA 2YPRA 2HU9A 4CYCB 1EUDB 3PW2A 1UAAA 2VBYA 2WB1N 3OV8A 4IHJF 3EUAA 3CUOA 1W7PA 1ZYRF 3KE2A 1MNEA 2GZWA 3H3VK 4CHUA 4M7EA 4CCJA 3LFUA 5CAEB 5IP7G 2FP4B 2XRLA 4NXNH 4OINF 5DLFA 1P4AA 2FK3A 1CF7A 2W9AA 3H3UA 5IYZF 2D1VA 2W00A 4ZYHA 1KYZA 5KFHA 1EYZA 5KFNA 1IXCA 5CVUA 3PFIA 2HVSA 3HGYA 1ON2A 3ETJA 4UUSB 3OHAA 2W1OA 4BL0B 2AHQA 4NBQA 2KLOA 2JA8J 5HDKA 1ZHFA 2VI6A 4L9VA 2LP0A 2MA3A 2NS0A 4ANJA 1HKQA 4CCNA 1GT0C 4I2OA 2QM3A 3S1NJ 5KFLA 1ETQA 1QA6A 2ZMEC 3KETA 2YX7A 1GUUA 4M3GA 5F9LA 2XKOA 3CUQC 2VUMJ 2K27A 3MEXA 1ZLJA 1XMAA 4ON0A 5L1IA 1UJ8A 5CYVA 1VAJA 3EUKL 3HJEA 4R8UB 2JWTA 2Y69H 2OU2A 5EGOB 2W9BB 1TL8A 5D5WB 1GVJA 1OR7A 1HQCA 3BG6A 4B8XA 1XNQH 2E34A 1F5TA 3TMOA 1IRGA 1V5GA 3WE3A 3HTUA 3C3WA 4LB6B 2H27A 4P1WA 4ZZDA 3ZQFA 2CQXA 2XASA 5LMUH 3HPGA 2JA7G 4F91B 1T95A 4KN4X 2HOTA 2OBPA 3HPHA 5BQTA 1XB4A 3HHHA 1I6XA 1ZK8A 5E3LA 4BQQA 3BR0A 5L3BA 1LFUP 2PBIA 3GV5B 2OH2A 1D0ZA 2E35A 4RGXA 3AL0B 1D3YA 2E2HJ 2EPFA 3BQYA 4HX4A 2H6CA 3PW4A 2AS5F 3A02A 1T08B 3TO9A 4DZPA 2MBFA 1BJAA 3E3VA 1JKRC 3GIPA 4LH7A 2XV4S 3ABMH 1LFPA 1X2NA 4HW0A 2MLKA 3WE2A 2PN6A 1TP4A 1H9TA 3HKZA 3FF5A 4RA2A 2BOLA 3RB3A 4A3DG 2WTEA 2IEKA 1I94H 3PJRA 3V7RA 1S72I 4KIGA 2VQDA 4II2A 1WJ5A 4BWSC 1ZKGA 2F4IA 4A6EA 4WD3A 2OLSA 2HKOA 4EM0B 2K5CA 5EEAA 4DV5H 2LYCA 3RTXA 2M4KA 3MR6A 1U9NA 4NC7A 1YS7A 2JVHA 4BQOA 5J6XA 3EPIA 3BABA 2LDUA 4M9UA 4YBZB 3PO2G 3K4JA 1SC7A 3AFHA 2R5YA 1ETOA 3V8KA 1XSVA 3ZMDA 4IRGA 2HZDA 2R6FA 1JXSA 2WTFA 3T1BA 5L3EA 3LAPA 1N78A 2CUFA 4BE2A 5IYDG 2JA7A 4A0ZA 4PJMA 2W6NA 1YX3A 4XOPA 3GTOJ 4IR1A 2W6QA 1A35A 4FBTA 3OYKA 1M0TA 1YYVA 5C4XJ 2YS9A 5L3FA 5CJ9A 4GXOA 4LF4H 3DU5A 3GV7B 1D1AA 5FGMA 3GTPJ 1E4GT 4J9MA 1SD7A 1X1CA 1FX7A 1IC8A 2VR1A 3T5HA 4FS1A 2JA6G 1U9OA 1Z7LA 5J40A 2Z3YA 3RQ4A 4HQ6A 2QWWA 2VXDA 3DEUA 3FKIG 1QNTA 5FLXZ 2XC7A 1Z2PX 3H3VH 3H5NA 2A61A 2N8GA 3R60A 2DA7A 4ECTA 5E18F 4RBOA 4G7OF 4BACA 2Q2TA 1JXLA 2X6XA 4FT8A 1FP1D 3J7AY 3TQNA 2VC0A 2F6CA 3B02A 3D1NI 1I6UA 4E7JA 2E1OA 2QSFX 1GXQA 5GPAA 4HQEA 1O3QA 4RB1A 4R1HA 5KG3A 2F2EA 2ID3A 3C1DA 4RGSA 2AGOA 4LMYA 3GX4X 1XDNA 2GWRA 2R87A 2V5AA 2STTA 3JRAA 3KFWX 2A6HF 1K83A 1BOAA 1ZN2A 2RQPA 5D5XB 2L4AA 1V9PA 4ZYAA 3WTVC 3WG7H 3E0JB 4CXFA 2HQNA 5F1RA 1R00A 2UZKA 3IRRA 2YU9J 2BVMA 3KXYT 3S8PA 6PAXA 1USSA 4DR6H 3RZOJ 3KZIC 4ENMA 4IAJA 2R92A 1R7JA 1O3TA 5LL6b 4DUZH 4DIQA 1ZRDA 1I50J 2R7WA 2GOMA 3LA3A 3S1RJ 1R4NB 5KFQA 3C2BA 2V1DA 4BXUA 4UCTA 4U0VA 1T38A 1FZPB 2VT2A 1HXDA 3QP5A 3OMYA 2HVRA 4A3EJ 2ZXHA 3T5KA 4Y15A 3OL4A 5TJJA 2DDBA 2QBYA 1UC8A 1MNMC 4E7HA 2UUCH 2W82A 1ODDA 2F5EA 4K2EA 3OYEA 1RC9A 2M8EA 4AIDA 5TGTA 4M3DA 2JUCA 4IHTA 2V79A 1JKOC 2JA6A 2HGCA 4C2UA 3HOYJ 4E4TA 1GHCA 4YELA 2FMAA 3FKIA 1QQIA 4LG3A 4JI8H 1OCCH 3I4PA 3J7YJ 2JQ7A 3CMMA 2K4JA 3K1MA 2KIFA 3PR5B 2W9CB 1E4EA 1UHSA 1MSEC 4E7ZA 4TQSA 3SZGA 2R5ZA 5KFKA 2IBDA 1JDEA 3GVAA 5D1OB 1KC7A 4F52A 3GIJA 1SVOA 2ZKZA 2HHHH 1JTXA 4N0BA 3R23A 2M3AA 2R7RA 3OY9A 1HNWH 3A01A 3OYJA 3PNVA 1U5TB 3KAJA 3LOCA 1RRJA 2DCEA 4IF4A 2V1XA 4EJOA 4RGUA 1Z67A 4EM1A 5KG5A 2W71A 5C1PA 2WAQN 4HF1A 4E4HA 4J9OA 4PDBA 2F4VH 4B3SH 1AOYA 4XLEA 5AONA 4ZYDA 4C2TA 3S2HJ 3I58A 3AKZA 3PNTA 5CQEA 1KBLA 3ZGKA 3I59B 3IC7A 4QIWE 1XMXA 2W4SA 3MD2A 3QPHA 3H9QA 5HBRB 3T0YA 1WJEA 1WWXA 2UVWA 4Y52J 2J5OA 2IP4A 4IRKA 3CQZJ 3MFHA 3H9JA 1SEUA 1ZG3A 4XYLB 3A1YA 2H1KA 5LGNA 3KEQA 2ZDGA 1U78A 3V7CA 4JX5A 3U21A 2Z5UA 3F0CA 1WHUA 4L9TA 2R7DA 5HVQC 3FBNB 4A6DA 1WVRA 4LF5H 1Z9CA 1YQAA 2Q8KA 1OPCA 1X1BA 4UV9A 2V26A 4I99C 3D0SA 4BJTA 4F4XA 2OV7A 5C44J 1XNRH 2HOSA 1K1QA 1FTTA 4DL3A 1R23A 1S7EA 5IT9K 1OISA 5LA6F 5KFEA 4X6AJ 4JK1X 2MC3A 4A3IG 3LWBA 2K85A 2CKZB 1J7KA 4BEHA 4A3BJ 1N34H 2X0LA 1EKEA 1WRJA 3A0BC 1JLLB 2K9MA 2B0LA 3WGGA 1DQUA 4AVPA 3FMRA 3R5XA 3H92A 1NTCA 3C2HA 3OYCA 3RKQA 3GTLJ 2VJ4A 3K4MA 2ZJ2A 1XN7A 2H6BA 2M34A 1MJBA 4P9UA 5KG0A 3RKXA 3SQNA 1O75A 5IT9W 1V55H 3MFIA 3RPQA 4XKBA 4LGWA 1G2HA 2W6MA 2O3FA 4FBUA 2A6EF 4EEYA 3L00A 4HLXA 2QKLB 5DYMA 1C30A 4BJ5C 3K5HA 3RKWA 1RETA 2MC4A 3M9NB 2BY0A 3DTIA 1T56A 5FRNA 1I39A 3AYHB 2MH2A 2X51A 2DIKA 4HG2A 3HSEA 3KP6A 2MSYA 4ZH4F 4O3PA 5CA0F 2GA2A 5KFMA 2KL4A 3W6VA 4BYYA 1B4AA 2COMA 1TWGJ 4ZC3A 1BL0A 5M3FJ 3EQLF 5CKTA 4FTHA 1Z77A 1QBJA 2CZGA 3ETHA 2P81A 2VQFH 2CQ7A 3HSFA 5B5EC 1QPMA 4A3GJ 1JKPC 3ZXSA 5FLMG 5FPOA 4JV0A 1BBYA 2Z1DA 2VPSA 4ME6A 2DJNA 1GSHA 4QWBA 3CMAI 3BTLA 5J4VA 2LLKA 3JRCA 1BJTA 2G9WA 3K70C 4TQRA 4JP0A 2ID6A 1R36A 1R9TJ 1GLVA 3TBIA 4A3CJ 1IOWA 1K1SA 1PX2A 2O8KA 5GONF 5JLXA 2YW2A 4CSWA 1JHHA 4ECQA 4O4HF 1R4MB 2CFXA 5IYBG 2KIQA 2L3DA 4Q8EA 3DWLE 1A9XA 1IF1A 4A5NA 4IWYA 1GV5A 3I5UA 3OS0A 3QZ7A 4F4ZA 3GIMA 5KFVA 2JK3A 1HLVA 1G3TA 3V4SA 3IHUA 1IJWC 4ECYA 4A2UA 3GTKA 1MMAA 1IUFA 4XN3A 4M73A 5K5OA 5FKOA 5EDNA 4O3OA 5HDGA 4BU2A 1EH8A 2A05A 3IWFA 3W2VA 4BNCA 1Y56A 1S29A 3OS2A 4DV2H 5LP6F 2L9SA 2NRAC 1WJCA 1REPC 1PUFB 5KFWA 5KG6A 2VUGA 5FLXW 3MCZA 1S0OA 4DR5H 4ZQIA 1IW7F 3FDYA 3N05A 4JI2H 1B72A 4XSXF 4EV0A 1IGNA 2HDDA 3EUHA 2NOJB 2CUZA 4AIJA 5GTHC 4MV7A 3PVXA 4RNNA 2DT6A 1TQMA 3K0LA 4UV8A 4J19A 1IDYA 3MN2A 3W6JB 1KU7A 2XB5A 4PSXA 2GPSA 3OHBA 1B9MA 3N43B 4E7LA 4QW8A 2EV0A 3K2ZA 1FMVA 1KONA 4CCLA 3SEZA 2ESHA 3HOWG 1DV2A 4E6KG 2X1CA 3BR3A 3ZP5A 2XGDA 2W6OA 3KZZA 3SE7A 4DR7H 5HV6A 3GLLA 1USTA 3ZR8X 4IHVA 3H20A 5KG7A 1CGPA 2QCOA 3R6SA 4U7DA 3AAFA 5F0HA 3E1SA 1XGNA 1SD5A 2R86A 1Z6TA 3QOEA 2OQGA 2R4GA 2GQQA 4UCSA 5EYRA 3CDHA 3J81K 2Z2SB 3KP2A 2VKDA 1JHFA 4IL6C 2BQUA 3HG9A 3GTJA 2FBIA 2DA2A 2A5WA 3IRQA 3JR9A 1WJDA 1Z2OX 1SFOA 2DW4A 4A69C 1UG2A 1WJFA 2QSHX 3WO0A 1GLNA 5A2QK 2F48A 1X4PA 4M6XA 1B59A 4MTEA 4D1QA 1P4WA 4ZOLF 2F5VA 5ICFA 4RAYA 1OCRH 1VI0A 5KNLA 3J81W 4NNJA 2FBKA 2BY2A 2HWVA 1DGSA 1C0WA 2ZBKA 1S9FA 3DF8A 2VA3A 1T39A 3TOAA 4B09A 2ECBA 4I6ZA 2AXTC 4BBRJ 1VKZA 3RZDJ 1SCUB 5A2QW 2XUBA 1LE8A 2FKLA 2KZVA 1K4SA 2UU9H 3A0HC 4DR2H 3ESWB 4HOBA 1H0MA 2MD5A 2J6UA 1FEXA 2FQ4A 3N4MA 2CW8A 5J8CA 2KPMA 2LBFA 1OQYA 2QQBA 1UMQA 1R22A 3RQIA 4G6TB 1XGMA 3ABKH 1O3RA 2VONA 2VODA 3K70D 1S0NA 1D5YA 3H0GJ 1T8IA 1E17A 1ONVA 1EA3A 4GRIA 4JI6H 2ME6A 3O8HA 2P6SA 1OWTA 3GTMJ 1V4RA 5IYCJ 2ZXWH 3CTAA 3O6BB 4QLCU 3G4SI 3N41B 1RYSA 3K10A 4DUYH 4TV9F 1O3SA 3L4KA 3BLYA 3OYLA 1YFHA 2LF7A 5C4XG 4JX6A 3WGHA 2YYAA 2FEZA 2VQEH 1T98A 3H36A 4MGRA 4LF8H 1BC8C 4G6DA 4FASD 5E3MA 4QIWA 5IP9G 2NS8A 1WJAA 2M1BA 2WAQA 5DUKA 1VQPI 3Q2OA 3HRTA 3V6HA 5K7HA 1PK8A 1OJLA 1XCBA 4LG0A 1BIBA 2PMUA 3DKYA 1D1CA 3FM5A 1U8BA 1B6AA 2JA5J 2NUAB 3H3ZA 2KRCA 3WTYC 1X9NA 3JTHA 1VQMI 1RKWA 3CD6I 3TW6A 5IP6A 3FISA 2DFFA 1VQ6I 3GILA 5EZYF 2V7FA 1Z1DA 3OOUA 4FISA 4XR6A 3VPDA 2K40A 2XHKA 4C9YA 2Y0SE 3RUPA 1HW5A 3LSGA 3CCYA 4Q47A 3TDZC 3N6XA 1XPXA 3K5IA 1RPWA 1AHDP 5ICEA 3FKJA 5BPDA 4XLPF 4DNCA 1D1BA 3CDIA 2HPIA 2FPIB 1NG6A 4LLLA 2JEGA 4JV1A 1VQNI 2KDZA 3GWZA 3L2PA 4XOTA 4WX9A 4NB5A 3WU0A 4M71A 3AG1H 3FK6A 2DN0A 1K7AA 3GUDA 4G7HF 1VTNC 3JREA 1M6VA 4M3FA 3V6JA 4RNMA 4APMA 2HQ5A 2DTRA 3HRUA 4RLQA 4AC0A 5DTDA 2L4MA 2JEFA 3ERED 5JVTA 1S03G 5FLVA 1QVTA 3OYMA 3PW7A 2AQ4A 2ZJQF 4OWRB 3DLLF 3FM3A 1T0FA 4A3FJ 2QYOA 4BBSJ 2DPDA 5KFXA 1OFCX 2FRHA 3RIRA 1B8IB 3GEZA 3R0AA 4A3EG 5DCMB 3SXYA 3MWDA 1DU6A 4HBLA 4F3QA 2K4BA 5FJ8J 5DD8A 1FYMA 3CMEI 2V9PA 3M8JA 1YI2I 2GXBA 3FXRA 2OWOA 4FE7A 1DPUA 1FYLA 3IP4B 1G6NA 2HGSA 4RAFA 2I87A 4EEFG 3W2WA 3BQ2A 1J9IA 1M1EB 2VPQA 1S3JA 3F6VA 2KFDA 2MG4A 2GLOA 3RKYA 3RSNA 3IWZA 3BC8A 1Y0UA 3B6AA 2L7FP 1YO5C 2XKPA 4KMUX 4PZJA 4UB8C 2AGPA 5KVRA 3O8GA 4A3JJ 5C1OA 3G2BA 5E1ZB 2IRFG 2XVCA 5KFIA 3HOSA 2GA1A 1RUNA 1OCTC 3FXMA 3QFFA 2P7VB 4NC8A 1KJQA 4EFEA 2LTPA 3RYRA 1QPIA 2EFNA 4HA8A 1A6IA 2EK5A 4HX7A 4N9IA 1MJ9A 1X3WB 2ETHA 3MWMA 4X1EA 4B43A 5K5RA 4ED0A 5DG9A 2TCTA 2KKOA 2M45A 3JAMZ 5FD6A 4BDYA 4DV1H 1KJIA 2YRXA 3G6XA 1RZ4A 2FMLA 3K4KA 2VOPA 1XCVA 4HR7A 3F72A 2RN7A 4Q48A 3F8MA 1BM9A 3HOXJ 4CH7A 5KFZA 3TW7A 4DZJA 2R7TA 3CVZA 2M2EA 5EOYA 2DI3A 3W2AA 4O6JA 2R7UA 1YJNI 1ZR2A 4AYBN 1VQ4I 4C5AA 1X1DA 1YE9A 1KU3A 4XRSA 1WFXA 5DG7A 4HF2A 5EWFA 2R7FA 4E7KA 4KDPA 2E1MB 2VQCA 1DU0A 3WTSC 1JKJB 5F04A 2NU9B 5CLSA 2R8GA 4A3BG 1ZGAA 2RDPA 2WAFA 3HYIA 4R7RA 1TWFJ 2ASDA 3EYYA 4G6QA 3S16J 4HF0A 4XM3A 3WODF 4DOZA 5H2FC 4Q8FA 1LPQA 2UXBH 3GF2A 1Y8RB 4X65H 1EH6A 1MBKA 3M07A 5B1AH 1YIJI 1HDPA 1VQOI 4ZDOA 2Q1ZB 4I7HA 2ZJRF 4KICA 4HEA2 1WQ2A 3BY6A 3P9IA 3H5AA 3BOQA 2HS5A 2VJIA 2GPWA 3MJFA 4RU9A 3BR2A 3T8RA 1BR4A 2DOAA 3MKWB 5LYJF 1K78B 3TIIA 2Q0OA 4CCMA 3PNYA 1Y1VJ 1MBJA 5CVIA 1DV1A 5F6FA 2M9HA 4MIMA 4CCOA 4PJJA 4XICA 4QTRA 4XX0B 5KFCA 1BW6A 1ETVA 4ITVA 5J1UA 3UR3C 1KJJA 3RV3A 1IOVA 2DQLA 4Y13A 5M5WJ 3CF2A 4B3RH 3LSMA 2RAEA 4DV3H 1AUVA 1IN7A 2XAGA 2MABA 4LD5A 2RF4A 3DLAA 5TRDA 2PMHA 5HS8A 2A68F 5L3DA 1HKSA 1XDUA 1PUEE 4EM2A 2QQ9A 2W6PA 3M1EA 3J80Z 4IZZA 5BMVF 3CQZA 4MV6A 2V4RA 1TQPA 3DFGA 2B63A 2R7KA 3BQZA 2WB1E 5LRRA 3RPUA 3VEPA 5KAFC 3BZ6A 4Y33A 1L2ZA 1N48A 3CCVI 5DG8A 4XKCA 5BR8H 1ZGJA 1VQ7I 3Q0UA 2XF7A 3GIKA 4MTDA 2KJCA 4QWCA 4LF6H 3MWEA 2J5PA 1U0JA 1AWCA 3CZ6A 4RAZA 1BI0A 2Z16A 1A0IA 2KSWA 4ECZA 1A5JA 4U0WA 1RJPA 2NVXJ 3QWLA 3CESA 4KFCA 4BXXG 1I6HJ 1SMYF 3C2GA 2JT1A 4XLHA 2E19A 1JGSA 3I4MJ 4YR2A 4QW9A 4QWEA 2IGKA 1WPKA 1DUXC 1RESA 4HNUA 2PMZN 5FRMA 1I7NA 4BY1G 1BIAA 4MFDA 3F8BA 1O7FA 1GVDA 2J9GA 2Z9OA 1SAUA 3QPSA 5DGAA 3N97A 4LFCH 2VBWA 1POGA 5L3GA 4NQWA 3KHGA 3T1HH 4DV4H 3FHNA 2HQRA 3R5HA 3HOVJ 4XONA 4JQFA 3V8LA 1C3OA 5D8KB 1LVAA 1N56A 5JQWA 3KP4A 3BJAA 3L2RA 1R1TA 3BP8A 1VNDA 3KCCA 2DMPA 4OIPF 3S1QJ 5KKNB 3RAQA 2R8IA 4MA5A 3ML6A 5L1JA 2W84A 3HOUJ 1E0EA 2RKHA 1OCPA 3CDLA 3HIFA 2E1CA 2QF7A 4JI0H 4E70A 1TWGA 1E3PA 4DQ2A 2NAZA 5D8DA 1ULYA 2FJZA 2HR3A 4PSWA 2C2RA 4L9JA 1WSUA 4AD9A 4DL5A 2LY9A 5J1YA 1IUYA 2EBIA 5H6QA 4UCUA 3LMLA 2Y0SA 4A0YA 1FLIA 3W6KB 3CCJI 1SFEA 2ADUA 2JA2A 2TDXA 3ABUA 2RREA 2K9NA 1J59A 3ERMA 3TP0A 1W0UA 2M0MA 4GDFA 2W7OA 3BTIA 4QSHA 3WTWC 1ZREA 3KYCB 1BR2A 3IH3A 1R9TA 3BA8A 4I4TF 2PQ8A 4RM2A 2VXZA 5CVVA 2PG4A 4ZYEA 3CCUI 2E60A 4L5EA 3VYSB 4J9NA 1ZLKA 2M87A 4NXMH 1NG7A 2DFEA 1A31A 3WU1B 3ZMSA 3T8TA 1IV8A 1TW2A 1Z05A 1XDSA 1V3FA 4ZTFA 1AKHB 1ZARA 1WSCA 1YW7A 1FBUA 4MA0A 1S7AA 5DQIA 1QGPA 2V9VA 3HOZJ 1V5EA 3JRGA 5K7ZA 1W7PB 3KLOA 3M7GA 1LEBA 4YIIA 3BQ1A 1ETXA 2Y9ZA 1Y0NA 5FKMA 3NQOA 2D45A 1JT0A 4I55F 3RDIA 3TL4X 4B47A 1CF7B 3KEOA 2LD5A 1UCRA 4B44A 3BZKA 1RK5A 2DLLA 4AWXB 4YFXF 2HZTA 4GFBA 4RUCA 4ECWA 5KG4A 1MMSA 2FLPA 2E36A 3ZQHA 2BHYA 3CC7I 1J75A 1ZHQA 2P7CB 1XMOH 3GIDA 4ED6A 5HODA 2I5UA 3JRBA 4RMNA 2IBKA 4GCVA 1WCMJ 3NAUA 2ZM6H 1IXSB 1OYIA 3H0GG 4IRCA 4U6PA 4HNTA 4IRDA 3R0JA 4P96A 1FBQA 4O3NA 3LFKA 4IVNA 5KT2A 5GPCA 5CB4F 3M3YJ 1JUPA 3FXUA 4NHJA 3FMAA 2W48A 3CJNA 4R8HA 5E1WA 3OSGA 2FK2A 2A5YB 2R93G 2LY2A 5FKLA 3MR3A 2OPTA 4JX4A 2W70A 3GYHX 5LGTA 3NWSA 1V51A 1R58A 3K9TA 2XAHA 4I0AA 3VSKA 3H40A 2FXAA 4A3KG 3A2KA 5HOOA 4YB8B 1ORKA 2AQFA 3MZ8A 3N44B 2RNJA 2X6OA 3CLOA 2V58A 3OSNA 1TQIA 1GXPA 2DYRH 1FSEA 1UELB 3F22A 2DA1A 1MZBA 3G6YA 5DDGA 4XLCA 2CG4A 1CQTA 3HSRA 3MQ0A 3JRFA 3CCEI 4HNVA 1L3LA 4XYMB 2AGQA 2AXLA 5ICCA 3KIOA 4B4CA 2NVYA 2YS6A 2LREA 5KAIC 3HUGA 2OD5A 2CYYA 4ZYGA 3I64A 2WADA 2UVRA 2MLGA 4BJ6C 4C3HJ 2DPJA 2X6WA 2BEOA 4MV4A 1FJGH 3BZCA 2QK4A 3KLNA 2V59A 2R7ZJ 3GTQA 3BJYA 1V4YA 3BQ0A 4A3LJ 1WZ2A 3GTGA 1IO2A 4KA4A 3AL0C 2DAOA 4BE0A 4P55A 5H20A 2H94A 3BPVA 3MKLA 3VSLA 2PJPA 4EMSA 1IBKH 4MLOA 2Q2EA 2W8LA 4LF7H 1K61A 3EETA 2E1NA 4ABZA 4U7BA 4RGRA 2R5YB 4EJVA 2ZNZA 4IQ4A 4LIVA 3GTMA 3JW4A 2DA6A 4ECUA 2STWA 3SHFA 3AG2H 1I5ZA 1X4OA 4JUZA 1BOBA 1XGSA 2BBYA 2FNAA 5FKKA 2R93A 1XD7A 4M9ZA 4YY3H 2E7XA 2FF4A 4G94A 1ZQ7A 3CCLI 5LMNH 3OSPA 2UUZA 4LFUA 4MEYF 3WTUC 3GLKA 2Z33A 3BT9A 5FJ8G 1MDMA 5E3OA 1DPRA 1FT9A 4D5CA 2ASLA 3U9GA 2FX0A 2HI3A 2JMWA 3QU3A 1Z6RA 3S32A 2R8KA 3AG4H 2WB1A 2WAQE 2DXIA 3LQRA 5DUIA 1J09A 2R7NA 2WV0A 2R84A 1O7LA 2XF6A 3JRXA 4YJ2F 1W93A 1Z3XA 5KFJA 4M9XA 2WBMA 4L0YB 2Y0MA 1S6LA 3EYIA 3OR2C 2R8JA 4YFKF 4HLYA 4ETSA 1Z2NX 2BW3A 3TQ1A 4A3JG 2NNYA 3T1YH 3Q3SA 4OAZA 4U87A 1FWZA 4CO8A 4KT6A 4DL6A 1XC5A 3LSTA 1PDNC 3SFIA 5ILSA 4BGDA 3I4NJ 2XIGA 4M3BA 2EFQA 1Z0XA 4A2AA 4X66H 2O7OA 2XB0X 5B1BH 1BI1A 1SMTA 4XRFA 4KITB 2UUBH 5LBQA 1EV7A 2HDWA 4CICA 3R5FA 5JH7F 1WJBA 4F55A 5DQGA 2X0SA 2O03A 4I98B 3CC2I 4S05A 2ZXIA 4C30A 3MAJA 3BG7A 1VZ0A 3G1LA 1Z7UA 3K1NA 3DPTA 2X9DA 1XTAA 1SVMA 2V1NA 4ZDPA 1GGOA 1GYFA 4O2AF 2IS1A 2QBYB 2EH3A
chains in the Genus database with same CATH topology
5D5UB 5EEHA 1G3WA 1P92A 1I1SA 2R3SA 1TNSA 3E97A 2P4WA 3VOEA 2ZXJA 2P5LC 3GFLA 1BGWA 2ISYA 3C18A 2FOKA 3LWFA 3ISPA 2QUFA 5DCFA 4DR4H 2O6GE 4OIRF 5FLXK 2IJLA 1T6SA 5LEKA 4RZQA 2EA2A 1IBMH 3ROUA 3F3XA 4WCGA 2XAQA 2P5KA 1XSDA 3E5QA 2HEOA 4L9NA 1TAEA 1MD0A 1IN4A 4DV7H 2EV5A 5ERIA 4LJZF 3F8FA 4A2BA 2IA0A 4WXHA 4JI1H 1U5TC 5H6RA 4B3MH 5E17F 3P7NA 4FX0A 1YW8A 4EGYA 4Z2YA 2EWNA 1IZ1A 3FZVA 2ZCWA 5JHUA 1KYWA 1W7PD 3E5XA 3HHGA 2HKXA 3O2PE 3PN1A 1I1GA 1UB9A 4OU0A 1U3EM 3QAHA 3ULQB 2FMYA 4QWQA 1HSTA 1FBSA 5CVRA 3WG9A 2L54A 1PP8F 1WI9A 4EJWA 1P2FA 3KP3A 2DBBA 4J0MA 3ZMUA 3NEUA 1BI2A 1KQ0A 1SD4A 5D6EA 2EJRA 4JI7H 5BOXA 4KMFA 2KIUA 2E5LH 1D8KA 3KP7A 1TTYA 4M9SA 4HDVA 2HOEA 1KQ9A 1LDDA 3VODA 3ZQ7A 3ZMTA 4LF9H 2ZNYA 1E2XA 3Q5FA 4M74A 2DK5A 2OAZA 2ZMEA 5IWAH 1KQ8A 3CUQA 5JR3A 5HLGA 3G3ZA 4OMZA 2XAFA 5E8GA 3Q9VA 2IW5A 1N32H 2LNBA 1TW3A 1ZRFA 2ZO4A 4LFBH 4R79A 1Q1HA 2IVMA 3RGXA 4OX9H 1XGOA 2BE5F 4YG2F 4Q4ZF 1XNRH 4Q5SF 4I09A 2UXNA 2OA4A 1OYWA 5K1YA 2ESNA 4GO1A 1J0RA 3GO5A 4JI5H 4LFAH 4MQVA 2CW7A 3F8NA 3MZYA 3J7AK 1S68A 3BAAA 1U2WA 2LSOA 1H9GA 4WXCA 1FP2A 1P4XA 1TNTA 3M9AA 4PGGA 2DFIA 3KALA 2YU3A 4ENKA 4MQ9F 4GYGA 1YTYA 1ZH5A 1HR0H 4IRHA 4PGHA 4D0PA 5D5VB 4BHPA 2WE6A 2G7UA 1N33H 2VN2A 1KU2A 2M30A 3GZ5A 4GYIA 1SD6A 2LKPA 2BYVE 5HDNA 4ASNA 2W24A 4M72A 1IRFA 1B1BA 5BS6A 1J5YA 2XAJA 4G9YA 2H09A 2ZMEB 3EDPA 4BAYA 4B3TH 4EJTA 1HW1A 3MFKA 4WF2A 3L2CA 1AN7A 1ON1A 2NYXA 2XRNA 1QO0D 3G73A 4JI3H 4LSXA 4XBFA 3QRFF 1XMKA 3SZPA 5ILVA 3R4KA 2BV6A 4LG0B 2JSCA 2QLZA 3GZ6A 3LA2A 3DF7A 2QVOA 4TV7A 5LHGA 4GKKH 1FC3A 2KIMA 1S7OA 1ZG1A 4XSZF 4MHGA 3I0TA 4ENNA 3UQ8A 5HLIA 4OIQF 5F64A 2OZ6A 3CO7C 2DO7A 2EFPA 2UXXA 1HSJA 1BC7C 1I27A 4ESBA 3E6CC 3KAKA 2GXGA 3FMQA 3SFZA 2CWEA 4CC5A 1B04A 2EFOA 5LHIA 2Y75A 2QENA 1LEAA 2WC2A 3M4IA 1F4KA 5HS7A 3K3VA 4AIKA 2A3SA 4UNOA 4P9FA 2MH9A 3RF2A 2DPUA 4KHPH 1YLFA 1LJ9A 3BPXA 3K69A 1IAWA 3U2RA 4PDKA 4EJUA 3LAJA 4MV9A 3ABTA 3KP5A 1IXRC 3PQKA 1LNWA 5FB2A 1FNNA 2GIVA 5FFXA 2IA2A 1FSHA 3JSNA 1FYKA 3DP7A 5JFRA 2VOOA 4KYWA 2PI0A 3LQQA 2WDTA 3D5LA 5E1XA 3I54A 5HS9A 2WYOA 2YCHA 2O61A 2UWMA 3C0FB 1DP7P 4LK0F 4KUMA 2YX4A 3BJOA 3RJPA 1U6GA 2HFHA 1FPQA 5FPRA 3E5UA 5LLQA 1HNXH 1TLHB 2W57A 1PP7U 5AIQA 2FBHA 3JSLA 4UVBA 1N36H 5IT9Z 5IT3A 4Y17A 3CO6C 4OOIA 5DD4A 1L0OC 4L18B 2ACJA 5HLHA 2QQAA 5DEQA 3J7AO 3RIZA 1YS6A 3ZN1A 1X3UA 4UCRA 2ZFWA 4OMYA 5KK1A 3TO7A 3IG0A 4G8XA 3RI4A 1XMQH 5D6FA 1RUOA 1ZHSA 3HTSB 1KA8A 3E6MA 4XLNF 5D1OA 1OMIA 3PQJA 2GAUA 3VFZA 3JAMK 1U5TA 1ZG5A 1LB2A 1SFUA 1FVIA 1BN5A 4WWCA 3WTZA 4YIFA 3ECHA 1RI7A 3DPLC 4IXAA 4GLXA 2VC1A 3I59A 3JAMW 5DV5A 4UVCA 2DQRA 4L5IA 4UFZA 3WTTC 3E6DA 2XROA 3QU6A 1KU9A 2VE9A 1ZRCA 3M8FA 3V4GA 4I02A 3M8EA 4GGGA 4IPAA 3IKTA 4AQYH 3IL2A 3RGZA 1FY7A 1W5SA 4IRIA 3DV8A 2EV6A 4I0BA 5J8FA 3JSOA 3TO6A 2RV8A 2HYFA 4FHTA 2HTSA 2CGPA 1S8NA 3NRVA 3HOTA 3F6OA 1IN6A 3J80K 2PFBA 3WGIA 1IBLH 3GFJA 4LSAA 2HDCA 3FMSA 5LGUA 1SEIA 3B73A 4LLNA 1R5GA 4WK8F 1MGTA 1STZA 4CYDA 3MZHA 3BROA 1YG2A 3J80W 2FNPA 3J81Z 2VT3A 3OOPA 4DV0H 1MKMA 2EA4A 5A2QZ 3RJ0A 5BPIA 3HXLA 4ENJA 4AIHA 5JI6A 4UCOA 4H0EA 5LEJA 1OYYA 2VOBA 1R1UA 2YR2A 1XSXA 1J5EH 1MJAA 3TDUC 3ECOA 2K86A 1HKTA 2FU4A 4BHBA 4A5MA 2OZUA 2JPBA 3V8JA 3I71A 3ZMVA 2CQKA 3BA9A 3IKVA 2A07F 4YFNF 2CW0F 4LB5A 4RS8A 2L02A 2RGVA 1TA8A 2JZYA 3GFIA 3TKYA 2ELHA 2MCTA 2P5VA 2D1HA 1ZAOA 5K5QA 4CGZA 3P9KA 2FQ3A 3JTGA 3RYPA 2F5DA 1EH7A 4EEQA 4WXDA 1FKAH 3VB2A 2IA1A 2M5WA 1HNZH 2JPCA 4O3MA 4KN7X 3DKWA 1UHMA 1WH2A 1LDKB 4UHTA 1MDMB 2V6CA 3COAC 2DK8A 1D8JA 4O5VA 3REOA 1G3SA 2IT0A 2OQRA 4F7ZA 1LQ1A 3O3KA 2E7WA 3DQVC 1D5VA 4FX4A 3V7SA 3ZMZA 3FWEA 1K79A 1RNLA 2VE8A 3BJ6A 3FXQA 3KZYA 5ED4A 3TOBA 1P8LA 2CSOA 5E20A 3OTOH 1F9NA 2L01A 3ELKA 3HRMA 3WTXC 4LK1F 4X64H 4UXNA 3HRSA 3SZTA 1HW2A 4CZZA 5D4SA 3N40P 2A69F 1OKRA 1R5HA 2VBXA 3ZPLA 1VS0A 2P6TA 1DDNA 2RVCA 4CC6A 3GLXA 2O0YA 4M6YA 4MNUA 4EFBA 5D8LB 5AIPA 4Q0YA 3F23A 3GFMA 5DCMA 2W25A 5E8IA 4JYAH 2HTJA 5FO5A 3L4JA 2KJBA 2EFWA 2DU9A 4HYEA 4HDUA 4IHSA 1KGSA 4L0ZB 4G7ZF 2UUAH 4LH6A 1UHWA 5LHHA 2P8TA 2Q2UA 2WWYA 3FHZA 2NNNA 1P6RA 2LF8A 3T5XA 2W85A 3ZN0A 4DR3H 4EQQA 1WKMA 1QZZA 2RC4A 3QP6A 4RB0A 4FM9A 4U88A 4UVAA 2DT5A 4P5OA 4N9HA 4X62H 5CVJA 3QPTA 1G4DA 5LRSA 1T2KA 4A0XA 1O57A 2ISZA 1NHAA 1HBXG 4CDGA 2O8XA 1YW9A 2PEXA 4LLGF 1K6OA 4YHHH 5FFZA 3TGNA 4ZZLA 3F21A 3L7WA 4JI4H 3QOPA 2ZJTA 3FX3A 4OIOF 3LA7A 4KNYA 4UUVA 1IN8A 1Z91A 4KIBA 1BI3A 4BQAA 4DR1H 5BMZA 1YIOA 5ICGA 2FSWA 2HYGD 1R1VA 4S04A 4DV6H 3F8CA 4KIFA 4RB2C 4EVIA 4RB3C 2HVQA 2F5CA 2UXCH 1FOKA 3L09A 1RIOH 2RGRA 1K78A 3BDDA 3CUQB 4EGZA 2JRTA 2F5FA 1W5TA 3GW2A 1SYXB 4L5JA 4HQMA 5ILUA 2X4HA 1LDJA 2BGCA 3S2WA 2D2WA 4GKJH 5D1PA 3Q9SA 2C6YA 4I01A 4HAMA 1F1ZA 4ESJA 1E4FT 4MEXF 4HV6A 4JV5H 4UCVA 3P9CA 3K1PA 4KT5C 2UXDH 2IP2A 2FE3A 3L9FA 2G7HA 1J2XA 2K7LA 4HV5A 2QZ8A 4ESFA 5L3CA 3R61A 4JBAA 4BHCA 1B9NA 4PCQA 2FA5A 2CO5A 2V1UA 2Y48A 1IN5A 1W4MA 2K02A 1G3YA 1UFMA 3JSPA 2XGXA 1A04A 2JTVA 4U0YA 5D4RA 1TBXA 3RTRA 3U1DA 4A12A 3C7JA 1SFXA 5EEGA 1QZYA 3E6BA 4HX8A 2VBZA 2IPQX 2Z99A 1JE8A 2EB7A 3GXOA 5FD5A 2YSRA 2KRFA 3BWGA 4BH9A 2PLYA 1SAXA 1M0WA 1U8RA 4K0KH 3I53A 4HZFA 3DXJF 4IJAA 2YPRA 2VBYA 3OV8A 3CUOA 1W7PA 1ZYRF 3KE2A 2GZWA 4CHUA 4M7EA 4NXNH 4OINF 1P4AA 1CF7A 3H3UA 2D1VA 4ZYHA 1KYZA 1IXCA 5CVUA 3PFIA 2HVSA 1ON2A 3N42B 5HDKA 1ZHFA 4I2OA 4L9VA 2MA3A 2NS0A 1HKQA 2QM3A 3KETA 2YX7A 2XKOA 3CUQC 2K27A 3MEXA 1ZLJA 1XMAA 4ON0A 5CYVA 2OU2A 5D5WB 1GVJA 1OR7A 1HQCA 4B8XA 1XNQH 1F5TA 1IRGA 3WE3A 3HTUA 3C3WA 4LB6B 2H27A 5LMUH 4ZZDA 2XASA 4KN4X 2OBPA 5BQTA 1XB4A 3HHHA 1I6XA 5L3BA 2PBIA 4RGXA 1D3YA 4HX4A 2H6CA 2AS5F 3TO9A 2MBFA 1BJAA 3E3VA 4LH7A 2XV4S 4HW0A 2MLKA 3WE2A 2PN6A 1H9TA 3FF5A 2WTEA 1I94H 3V7RA 4KIGA 4BWSC 4A6EA 2HKOA 4EM0B 4DV5H 3RTXA 1YS7A 5J6XA 3BABA 2LDUA 3V8KA 1XSVA 3ZMDA 4IRGA 1JXSA 3T1BA 5L3EA 3LAPA 4A0ZA 1M0TA 1YYVA 5L3FA 5CJ9A 4GXOA 4LF4H 5FGMA 1E4GT 1SD7A 1FX7A 2Z3YA 2QWWA 3DEUA 1QNTA 5FLXZ 1Z2PX 2A61A 3R60A 5E18F 4G7OF 2Q2TA 4FT8A 1FP1D 3TQNA 2VC0A 3B02A 1I6UA 1GXQA 4HQEA 1O3QA 4RB1A 4R1HA 2F2EA 3C1DA 4RGSA 4LMYA 3GX4X 1XDNA 2GWRA 2STTA 3KFWX 2A6HF 1ZN2A 1BOAA 2RQPA 5D5XB 2L4AA 1V9PA 3WTVC 4CXFA 2HQNA 5F1RA 1R00A 2UZKA 3IRRA 3KXYT 6PAXA 1USSA