3PO2G

Arrested rna polymerase ii elongation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po2G01
1X3FA 4YWLA 2Q2HA 4BY7G 1VQHA 3CMEA 1WCMH 2HIXA 1IL2A 1LM0A 1UE6A 4DUYQ 1FVIA 4OO1I 4YCVA 4LF4Q 3GTOH 2YU9H 3GTMH 3CP0A 3PO2G 4LWCA 1V1QA 4B3MQ 1G6PA 1C7YA 4L5RC 4X6AH 3BU2A 4QJFA 4R4OA 2H5XA 4QGUA 1NJIC 1X3EA 4KI0A 2UUAL 3L2PA 3S1QH 3NEMA 4HIKA 4B3RQ 4DV3L 1P16A 2K52A 4YY3Q 1R9TH 1VQKA 4P75A 1IBML 1N33L 1TWFH 2F52A 5C0XG 3GTLH 1GKHA 1QVCA 2I0QA 1YZ6A 5HGQA 4IFDJ 3S24A 3PV0A 2MO1A 1PH4A 3HOXH 2YV5A 4KHZA 3S1MH 3OYYA 1CKNA 1Q82C 3EN2A 1FJGL 2YYZA 2XGTA 3LGJA 4TQUS 3W1BA 4GLXA 2UU9L 3HOYH 1A63A 2UUBQ 2K4KA 4JBWA 3HOWG 1K3RA 1S72A 3CMAA 1HNWL 4P73A 2NZHA 4P74A 1X54A 1VQNA 5LMNW 4L5SA 3G4SA 4B3TL 1T9HA 2JE6I 1IZ6A 3GD7A 4Y52H 3CCMA 1SROA 1BBWA 1HJPA 2CFMA 1Y14B 2E5LL 3S1NH 1YEZA 4L5TA 4NXMQ 3GTJH 1O7IA 4ME3A 1HZBA 2OWOA 4LF6Q 1TXYA 1WCMG 2LSSA 3Q8DA 1IBKL 5JJLA 2NVQH 4YCUA 2R6GA 4DR2L 4NXNQ 1KIXA 1EFWA 4DAYB 4UPAA 4XTCS 1FGUA 2LXKA 1GD7A 1VQCA 4HJAA 3ICEA 1G291 1A0IA 1K8GA 4B3SQ 4DUYL 3RN5A 3S17H 4DPGA 2K14A 4A3EG 4LF4L 3PF4A 2N3SA 1Y1VG 4A3CH 4LFAQ 2OQ0A 4GS3A 3SGIA 4B3ML 4BXXH 2ATWA 3I4MG 1JB7A 4GOPB 1EIFA 3F2DA 1VQAA 1TWHH 2EXDA 3RZOH 1SLJA 3U4VA 3E9IA 3KF6B 3I4NG 4B3RL 1VQBA 2GVBA 4YY3L 2UXBQ 4QY7A 1HNZQ 1JJGA 3K80C 4JI7Q 4A3DG 4QQBX 1XPRA 4DV4Q 5H1SE 3RN2A 2AWOA 1HR0Q 4QL5A 2DGYA 1CKMA 1RL2A 4IO9A 3M4PA 1VQ8A 1J6QA 1BKBA 1LTLA 3F8TA 1CKOA 2FXQA 5FLMH 3RLNA 3VDYA 2JA7G 2R92G 4DV6Q 4RG1A 5IT9c 3CW2C 1QVFA 2UUBL 4POGA 1X56A 2KBNA 2KCTA 2B29A 4BY1H 2VNUD 3PSIA 3RZDH 1VQDA 3KF8B 5C0XI 1OXUA 2ZTEA 4GNXA 4PG3A 4NXML 1V9PA 1A8VA 1ASYA 4IPGA 4LF6L 1WFQA 3M7NA 1OTCA 2VQFQ 1QUQB 3GTKH 3HOUH 3STBD 4NXNL 2ID0A 2ZTDA 3DM3A 4AH6A 1PH1A 3T1YQ 3PO3G 1EQQA 4DV3Q 2K5NA 3FKIH 4B3SL 1XMOQ 4KHPQ 2D0PA 1S3OA 3A74A 4C3JH 3G6EA 3CCLA 4LFAL 2JA6G 3HOVG 1BVSA 4A4IA 4JG2A 1PH9A 2ALYB 2KCMA 2A19A 4OONA 1OXSC 2JJQA 4PZ8A 5IP9H 1Q86C 5FLMG 4H02A 2Z6KC 2UXBL 2K75A 4A3IH 1X3GA 1HNZL 2D62A 1A62A 3PUWA 4JI7L 5C0XJ 4DV4L 4X62Q 2F4VQ 4B3TQ 1HR0L 3I4OA 4C3IH 4LFBQ 1JE5A 4WJ4A 1C9OA 3TS0A 2ZJPA 4A3FH 1YJWA 3HKSA 4BY1G 2QEXA 4IFDI 3CPFA 3EIVA 3OTOQ 3BZCA 4DV6L 1K8AC 3B6YA 1XJVA 3UDXA 2N49A 4A3FG 1VQPA 1PH6A 1UE7A 3K81C 5J3BA 1X65A 1SRUA 2I5HA 1Q81C 2E2HH 3HOUG 2JEBI 4A3BH 4JI6Q 5M5YH 5GADC 5M3FG 3FKIG 1VQ6A 4HJ7A 4DR6Q 1KAWA 2MQHA 2VQFL 2R7DA 1PH5A 2VL6A 3U58A 1YVCA 2RF4A 1C0AA 1D7QA 2RCNA 3S2HH 1CSQA 4GKJQ 1I6HH 4GKKQ 3HKZE 3T1YL 3TS2A 4R4QA 1FL0A 1XMOL 4KHPL 1VQOA 3CCQA 1EWIA 1HZAA 4LNQA 2R7ZG 3CCRA 5IWAQ 1B7YB 4O0AA 5IYBH 1KXLA 2PNHA 3G48A 3K7UC 4C2MH 4HIDA 4PMWA 1K73C 1AH9A 3BZKA 4MNOA 4YCWA 1VCIA 3HKZG 4AIMA 3K0XA 1Q12A 4EQ5A 4X65Q 2JA9A 1ASZA 4GOPC 1IBLQ 2NVYH 4LF8Q 4A3MH 1M90C 1JJ2A 2UUCQ 1Q1EA 3UDGA 2YTYA 3ERSX 4BBSH 4X62L 4R4IA 4DV1Q 2VZAA 4PZ6A 5IYCG 2F4VL 4LFBL 1PHJA 4L5QA 2PI2A 1UEBA 4JV5Q 4JI3Q 2VY3A 4GN4B 1MKHA 3D0FA 3AFPA 3I2ZA 1AE3A 3K7AH 3J7ZC 3OTOL 2JK8A 5FJ8H 1N36Q 3J80c 2GVAA 3FP9A 1KRTA 4JBKA 2WFWA 1L2FA 1YHBA 1MJEA 1L1OB 2K5HA 2AWNA 3BJUA 1K83H 4YWKA 3PCOB 3J81c 3G71A 4HJ5A 1PH2A 1I94Q 2RHQB 1E3PA 2I5LX 4JI6L 2NZOA 3NELA 4DR6L 1WYDA 3H3VI 1EYGA 5IP7H 1M1KC 1VQIA 1PFSA 2V1CC 4JYAQ 1HZCA 4A93H 4GKJL 4GOPA 1SR3A 3CCJA 3HOXG 3T1HQ 4GKKL 3PUVA 2QA4A 2NN6G 4NPSA 2PQAB 1NBWA 1WJJA 5JJIA 4AYBE 3KF6A 3CF5A 2Q2TA 3HOYG 4JOIC 3I56A 3RR5A 2CKZB 5IWAL 4R4TA 2N8NA 1KL9A 3I7FA 2UXDQ 3UDIA 4LUVA 4YHHQ 3K8AA 4DR1Q 1QVGA 2ZTCA 1I3QH 5C3EH 1I50H 2VQEQ 4X65L 1X55A 3KDFB 1Y1WH 1IBLL 2UXCQ 4LF8L 4DV7Q 5EAYA 3HFZB 5FJ8G 1WOCA 1EIYB 2UUCL 1XPOA 4DV1L 2IX0A 3FHWA 2IX1A 4DR4Q 4JV5L 1CSPA 1B8AA 1Q1BA 5E7NA 4JI2Q 4JI3L 5LMUQ 1YBYA 1HH2P 3MEFA 4OO1G 3W1GA 3GDEA 1N36L 2CQOA 4K0KQ 1QZGA 4A3JH 4BA1I 3MXNB 4A3CG 1E7ZA 1UWVA 4BXXG 1YHQA 2A1AA 1QUQA 1XMQQ 1XNQQ 4X66Q 1I94L 2JA5H 5ELNA 1EUJA 4LUZA 2QGQA 3PF5A 3GTPH 4ALPA 4A3KH 3CPWA 1BBUA 1E1OA 2IT1A 4JYAL 5M3MH 2CWAA 2BA0A 3A0JA 2IY5B 3I55A 4DV0Q 2IHEA 3RNUA 3J81i 3T1HL 2N78A 2JEAI 5BR8Q 1XNRL 2B63H 3TEHB 4JI5Q 4DNIA 3GO5A 1Y1WG 3M4QA 3CD6A 3S16H 1RIPA 1U0LA 4JBMA 3U4ZA 2UXDL 2R93H 3PO2H 4YHHL 4A75A 1N32Q 1MJCA 4DR1L 4JC0A 1E24A 3AYHB 4LF5Q 4DK3C 2AKWB 5M5WH 2VQEL 3ULJA 3TREA 3PUYA 1N8RC 2UXCL 3HOZH 4DAMA 1YNXA 4DV7L 3DLLA 1S40A 4DKAC 2AMCB 5GQOA 2NN6I 4P72A 1NTGA 3IRBA 4DR4L 1CUKA 4DR3Q 5C44H 4JI4Q 4JI8Q 5LMUL 4JI2L 2MO0A 4DR7L 2I5MX 4TVAB 1PYSB 2Q2IA 2JA8H 3J7A5 1VS0A 4HJ8A 1LUZA 1HNXQ 1TWGH 3ZJYC 1VQ5A 2VUMH 4K0KL 1PVOA 2MNAA 1KC8C 3TRZA 1UE5A 4LF7Q 1XMQL 2Z6KA 4DV2Q 4HIMA 1I5FA 4X66L 2K5VA 1PV4A 1XNQL 3HOWH 2CWPA 1GO3E 1LYLA 2KHIA 3JAMc 5IP9G 2HQLA 1TWCH 1L1OC 2VW9A 2OQKA 1VQEA 4HJ9A 2CCZA 1NMFA 4GN5A 4A3IG 3PUZA 4APVA 2OCEA 1VQFA 5GAEC 4JI0Q 3CCUA 2BH8A 4IJHA 3OW2A 4AQYQ 2B63G 5DLQE 3F2BA 3CCVA 1YI2A 1W2BA 1QZHA 3CC4A 4OWWB 3S14H 1HZ9A 4DV0L 2ZJQA 1N34Q 2Q2UA 1OXVA 4C3HH 1XPUA 2R93G 3W5OA 1YITA 1E1TA 3M9BA 2B3GA 5AJ3Q 5BR8L 3M4OH 1P8LA 4RMFA 4JI5L 4JCVE 3ULPA 5JEAG 3NENA 5HY6A 3CCEA 3M85A 3HOZG 4A3EH 2YTVA 4QIWE 1Y1VH 4OX9Q 2WAQE 1E22A 1VQ7A 4IOAA 2R7FA 1N32L 2LXJA 4A3LH 5IYDH 2ES2A 3I4MH 2HHHQ 5LMNQ 4A3BG 3U50C 5C44G 4IOCA 4LF5L 2NVXH 1SMXA 3KFUA 2KHJA 1VQMA 2JA8G 2HT1A 2BH2A 1CKNB 1YHAA 3AFQA 1GVPA 1Z47A 4X64Q 3KLWA 1OXTA 2E2IH 2VUMG 3I4NH 1VQJA 2K50A 4JI1Q 1L1OA 1KQSA 1K0RA 3KJPA 2A8VA 3E0EA 4A3DH 2OTJA 4DR3L 4JI4L 2WAQG 4JI8L 5M5XH 5C4XH 4DV5Q 3PIPA 4LFCQ 5IY0A 1YJNA 3RLOA 1U5KA 4UP9A 1HNXL 4O2DA 2JA7H 4EX5A 2R92H 3A5UA 1KHIA 2DUDA 1X9NA 3A5ZB 4LF7L 2EIFA 4MTNA 4OWXB 5IYBG 4DV2L 4HIOA 1D8LA 1J5EQ 3KOJA 3F2CA 1UE1A 2AHOB 2WP8J 4OWTB 2Z0SA 4GN3B 1XNRQ 2BA1A 2PQAA 3AQQA 1SE8A 4IJLA 1VQ9A 3CC7A 3ULLA 4LF9Q 4JI0L 4A3MG 5GAGC 4AQYL 1YIJA 4BBSG 1JT8A 4DK6C 3GTQH 3EBEA 5IE8A 3PUXA 1N34L 4IFDG 1KRSA 3H15A 4GNXC 4GLAC 5IYDG 3JAMi 4A3LG 3NBHB 1NMGA 5AJ3L 3UDFA 4AYBG 3PO3H 3KDFA 5K36G 1IXRA 2EQSA 2XTIA 1HR0W 5FLXc 2ASBA 3H0GH 4OX9L 4J15A 2E8GA 4DR7Q 1EOVA 2ZJRA 3TQYA 1PH7A 2JA6H 2MFIA 2VS1A 2OTLA 2HHHL 3STBC 5LMNL 3HOVH 2RHSB 3KJOA 2YTXA 3CC2A 3S2DH 4DR5Q 4R4CA 5C4XG 2PMZE 4GLVB 1Z9FA 1YJ9A 1JMCA 4X64L 5IP7G 1VQGA 1DGSA 2ZM6Q 4JI1L 4A93G 1Q46A 5GROA 1KD1C 1NY4A 4JOIA 4IPHA 1PA6A 3L0OA 4DV5L 4YWMA 4LFCL 4LW1A 4DUZQ 4KLKA 3H3VH 2D0OA 2HIVA 1IYJB 1G51A 3J80i 4BBRH 4GNXB 1N9WA 2WB1E 1SFOH 1VQLA 3L7ZC 3UE1A 5JJKA 1OXXK 1W3SA 4JBJA 4P71A 4POFA 3PIOA 5ELOA 4XIGS 1J5EL 2GN5A 3AEVA 3S15H 4A3GH 4Y7NH 1Q7YC 1V43A 2Y0SE 5C3EG 3J81j 4PZ7A 4BY7H 1SN8A 4WJ3M 2UUAQ 1GM5A 4LF9L 5M3FH 1XTDA 2WB1G 1N33Q 3D31A 1IBMQ 1L0WA 2JQOA 4MZ9A 1NE3A 3H0GG 3CAMA 3F1ZA 4R1JA 3CCSA 3M3YH 4OXPA 3GTGH 2E2JH 1VQ4A 2PI2E 2IHFA 2Y0SG 4A3JG 5JEAJ 4UY8C 3ER0A 3E9HA 5C4JH 1FJGQ 1EQRA 2UU9Q 3JC66 1TWAH 4FDBA 4NB3A 4UP8A 3UE0A 2R7ZH 4IPCA 1H95A 2JA5G 3CQZH 1HNWQ 1JJCB 1PH8A 1Q8KA 3PGZA 1K9MC 5GAHC 1AE2A 4DR5L 4A3KG 4UP7A 2F3IA 3CXCA 3S1RH 2E5LQ 4BA2I 2ZM6L 4LUOA 4BBRG 2NVTH 1PYBA 2C35B 3WWVA 1X6OA 4IPDA 3RLFA 5M3MG 1IBKQ 4A76A 1MIUA 1PH3A 2KENA 3KYHC 5IYCH 4DR2Q 1B70B 4DUZL 2L15A 1WI5A 4A3GG
chains in the Genus database with same CATH superfamily
1X3FA 2Q2HA 4KJNA 3CMEA 1GJXA 1DONA 3R5XA 1UUPA 3H3VC 1FVIA 2Q8RE 4MV6A 2JEIA 3H4DA 2UVVA 2KCCA 4YAKB 1DIKA 2WB1B 4YJ2F 1X3EA 2YZMA 3M9MB 3W2DA 3L2PA 3T53B 4MTKA 4K0KH 3NEMA 4B3RQ 5KT2A 1P16A 5G3LF 1QG7A 4P75A 5HGTA 3GTLH 1XNQH 1GKHA 1T94A 2EYJA 2F03A 2WTFA 2IP4A 2MO1A 3MJFA 4RNNA 3GIIA 4TQUS 2JSOA 1SE2A 3HOWG 4DV0H 3FDTA 3Q8PB 1SFOB 5L1LA 2R7KA 4BBRB 2A68C 3E6ZX 4XZ3B 4RWSC 1SROA 5BR8H 4S3SA 2JN4A 1ZHQA 2FK1A 3GTJH 4LF6Q 1CHQD 1WCMG 2LSSA 1O7LA 4K2LA 2NVQH 2K5WA 4YCUA 3HP3A 4BY7B 1B44D 2R6GA 1STBA 1SNMA 3OMCA 4MAMA 3CVZA 4UPAA 4XTCS 2B63A 4BWGB 2C22A 2CH4W 2RA4A 3KK7A 5KG0A 3RN5A 4J1MA 5M5WB 4A3EG 1EEID 5A2QE 2N3SA 2R84A 4KY5A 4LFAQ 1LT4D 3SGIA 1JB7A 4DR3H 1UNNC 3VYRA 1VQAA 1TWHH 4ZQ3A 3RZOH 3I72A 3A8JE 3I4NG 3EFXD 2GVBA 2K04A 3VR4A 3K80C 3M9OB 1EHIA 1LT3D 3RN2A 1HR0Q 4QL5A 2M2LA 1HA5A 5C8YF 3M4PA 2VUMA 4ED8A 3PVXA 1J6QA 3F8TA 1B04A 5EWEA 3EPIA 3RLNA 4J9RA 1SJHD 2VB2X 1ILQA 5M9OA 4DV6Q 1TWCB 4C1NI 4RG1A 4O3RA 1KJ8A 1QWYA 2KVMA 5CC4A 2D5DA 3TIIA 1G2TA 2NBFA 3PSIA 1CQVA 1VQDA 4EGQA 2W8LA 4C2MA 1A8VA 4IPGA 4BS9A 2QDBA 3K5MA 3V2TA 3CU7A 2VQFQ 4FVMA 4Q43A 3MZ5A 4NXNL 2W9AA 2FPGB 4ED1A 5LMNH 1S10A 1PH1A 3T1YQ 3FKIH 4B3SL 4DA2A 1CQJB 4IUNA 4PMBA 3DEPA 2D0PA 4X64H 1S5ED 2C9OA 3BG3A 2YYAA 3R5HA 3SE0A 2SOBA 2F3WA 4MV1A 4JI1H 1BBXC 4Q0YA 1AZPA 1AZQA 5FLXW 4JG2A 2ALYB 4DV5H 2A19A 4OONA 3RB0A 1UC8A 4FP5D 1HQRD 1X3GA 3SE7A 2D62A 4JI7L 4UHVA 5C0XJ 4DV4L 2DWCA 2W6NA 5KFFA 5KT4A 2RKSA 1C9OA 2F0QA 1XNRH 2HQEA 1YJWA 3L4KA 3HKSA 4IFDI 2FK3A 4DL7A 1IW7C 2BE5C 3B6YA 3LX0A 2V5AA 3UDXA 1PFMA 2C2EA 4Y8VB 2OEOA 1PH6A 5K2MA 1IKLA 5J3BA 2PPBC 1SNOA 5A35A 1SRUA 2PMZA 2NYZD 3HOUG 3A8IE 2AUJD 4A3BH 3S17B 1BDOA 5M5YH 1W6JA 2SNMA 1PZKD 3UQ8A 2F0IA 1KDCA 2DNCA 2B8FA 4CDDC 2MQHA 2ZDQA 5J39A 2CQYA 2VL6A 4C3JG 2RF4A 5KG4A 3J7YW 1S4ZA 1GYFA 2WB1A 1TY0A 3E5SA 5KFUA 5IIFA 2JA6B 1XMOL 2RVLA 3BQ2A 2A6HD 1KTKA 3CCQA 1BXRA 1EWIA 3L9AX 3QJYA 1SDFA 5IWAQ 2B2VA 1PRTB 3FRPB 3G48A 4HIDA 1K73C 1AH9A 4YCWA 3UI2A 4AIMA 1VCIA 1W6KA 3HKZG 3K0XA 1Q12A 4A3FG 1F2ZA 2JA9A 4WBNF 4GOPC 2NVYH 2W6OA 2NUCA 5KT5A 1TS3A 1M90C 3UDGA 2YTYA 4DV1Q 2R61A 3RZDB 4IQZA 4LFBL 1ICFB 1PYWD 1SFOA 1EZ6A 4IFDH 5C5LA 4DGZA 4X3TA 5CYUA 5LHY1 3MXUA 3OTOL 2JK8A 1HHVA 3J80c 2EY1A 3FP9A 1ILPA 4JBKA 5F9NA 1YHBA 1MJEA 2VA3A 2B2YA 2AWNA 5M3FB 3JRXA 1K83H 3V6HA 2QILA 5J1ZA 2FINB 1VDZA 2RHQB 4JI6L 4HSPA 4ZLTF 4DR6L 1WYDA 1WTRA 3MR2A 2F1MA 4V0BA 5IP7H 1SAPA 5L37A 4JYAQ 5C4JB 2A68D 3K6OA 3VYUA 4GKKL 3PUVA 4YIJA 2QA4A 2NN6G 1WJJA 1EWCA 3Q23A 5JJIA 1JOOA 1FYCA 3DHQA 3SK4A 4FXDA 3P1HA 3D8GA 4HN7A 1K1SA 2PN1A 2G5DA 4F7XA 1ZYRD 2M00A 2P5ZX 1R4PB 3H94A 4DAPA 3QOLA 3K8AA 4UCTA 5C5MA 4PWQA 1OWTA 4UCVA 1IBLL 1EU4A 3DM1A 4XXEA 1TWCA 4ULLA 2ZDHA 3T5LA 1EIYB 2E2HB 4UDUC 2IX1A 4ABNA 4DR4Q 1T5EA 3H20A 2KCNA 3RV4A 1B8AA 4CJ0B 1AN7A 3PIO3 4YR0A 3D4WA 2MHVA 1EU3A 1IYUA 1SEIA 4NDXA 4EYHB 4LH7A 1QZGA 1I4PA 3BDLA 2E76C 4A3CG 4QIWB 2L12A 3S2HB 1TAEA 5EPKA 4J9SA 4LSAA 2VXWA 1YNJC 1F9PA 3R8BA 4ME6A 5ELNA 2FFKB 4LUZA 4QB4A 3GTPH 4A3KH 3UFXB 2RDHA 4ECRA 1QILA 1I7LA 3GP7A 3IFDA 1HTPA 2BDNA 2C28A 3GQCA 3R2IA 1F9RA 2CWAA 3A0JA 3I55A 3RNUA 4GC6A 4G57A 4C5BA 2FP4B 5C5JA 1CK1A 1GUOA 1EUDB 4A3MB 4CJ1B 2B63H 4JI5Q 3WO0A 1Y1WG 3QFFA 4IUVA 4HSVA 3S16H 1U0LA 4Z9CB 5J2UF 4J6HA 3U4ZA 4NXNH 4DR1L 2A73B 1EYAA 4LSXA 3A7AB 3AYHB 2AKWB 4KJOA 3JAME 4NMZA 3ULJA 2VQEL 4MN3A 4ID6A 5FO9B 5DQIA 4B3SH 1N8RC 1M6VA 3HOZH 2HVRA 1STYA 2G9DA 1CUKA 1CTMA 3SXHA 2BQ3A 5C44H 1HUNA 2DJFC 4JI8Q 5LMUL 4JI2L 2I5MX 4RGMA 3ONAB 4LAAA 5KFAA 4HJ8A 1LUZA 2KEDA 2Z1CA 2VUMH 1PVOA 1TWHB 1CM9A 3X3MA 4JI7H 3HOWH 1RJTA 2CWPA 1QOHA 2PO4A 3R93A 1IW7D 1VQEA 2OQKA 5JOBA 2JA6A 2BE5D 2RSOA 3QR8A 4GN5A 3OMGA 1PRTD 2BH8A 3OW2A 2EYOA 3NSWA 3F2BA 4OWWB 3S14H 1I3QB 1W2BA 3CC4A 3M4IA 4RKLA 1I50B 1NAPA 1N34Q 1OXVA 2R93G 2O5IC 3M9BA 2B3GA 3PIP3 4DL3A 1ENFA 4OEMB 5GONF 3MA2B 5JEAG 5KNDA 3OHBA 2IA6A 1QJOA 3CCEA 4KHVA 4ED7A 1JWSD 4A3EH 3EYYA 3RGZA 1VQ7A 4IOAA 2HHHQ 3U50C 4EFEA 3KFUA 2KHSA 4YQWA 4ZOLF 1UNSA 1XMOH 2BH2A 1CKNB 2LY7A 1HQMC 5JQWA 1Z47A 4DFAA 3I4NH 5CV5A 2WYOA 1VQJA 2K50A 2I46A 1HTLD 2MP1A 3KJPA 3V05A 2I80A 5C4XH 2NU8B 3PIPA 3FEWX 4E4TA 1I4RA 1B9MA 1U5KA 4UP9A 3T4AC 1IYVA 2YZGA 2ZXOA 4EX5A 4H7BA 5KYIA 4EG0A 2PW5A 1D5ZC 1KHIA 4DN4M 1I4GA 2PZUA 5IYBG 4MTDA 4EEYA 4B3TH 4LFBH 2ZDGA 1BO0A 1UE1A 3NPPA 5KFQA 5LL6b 2IBKA 1XTCD 3AQQA 1SE8A 1VQ9A 3CC7A 3ULLA 3OTOH 5CV6A 3H6MA 1SNDA 4A3MG 4JI0L 5GAGC 4LF9Q 1KAAA 4O3NA 4FYDA 4DK6C 1ZHSA 4H13C 1CE8A 2H1EA 3GV3A 5E4WC 1S5DD 5IYDG 2N88A 4JI6H 1FNVA 1HPCA 2YS7A 1JICA 3RV3A 3OWFA 4DR6H 1IXRA 3C1EA 1EY8A 1KABA 2E2HA 1F77A 4OX9L 4ILWA 4N8FA 2JA8B 1C4QA 1EOVA 2PBZA 3TQYA 5JVDF 2YL2A 2OTLA 4G7ZC 4TRDA 4GKKH 2K6AA 3KJOA 1BGWA 4DR5Q 3TSSA 2J6SA 2ZM6Q 1VQGA 3K57A 4QIWA 3U9TA 3OHAA 2R85A 1NY4A 3H09A 4IPHA 3L0OA 3H3VH 1SFOH 4BBRH 4YP3A 1IBLH 1VQLA 2P0AA 3L7ZC 4C3HB 1SNCA 4CHTB 2F0GA 5ELOA 3TQTA 5LYJF 2GN5A 1V43A 5EKIA 5C3EG 4BY7H 4MA5A 5DG8A 1B50A 1SN8A 4WJ3M 3K5LA 5JVLA 1X3QA 2WACA 1SYCA 3N40P 2AQ4A 4JV2A 1JWMD 1IBMQ 3I4MB 1STGA 2JQOA 5JUMA 3CAMA 3F1ZA 1ENCA 4IALA 1YNJD 4KD3A 4R1JA 3T56B 3GTGH 2BQRA 3DUZA 2E2IB 2F0WA 2Z6BA 1K83B 4WRDA 4YR2A 3G6VA 4K14A 4Q0FA 5IGGA 1S97A 4UP8A 2C5CA 1QCBD 4IPCA 1O7ZA 2ALZA 1II3A 1ICWA 1JJCB 1EIGA 5EWGA 1Q8KA 2R92B 1AE2A 3MTSA 1ESFA 2IL8A 2E5LQ 2F3IA 4BA2I 1TWHA 1PYBA 4MA0A 4IPDA 4ZKCB 5KFSA 1PH3A 5C3WA 4DR2Q 4JUZA 4DR1H 4TV9F 4DUZL 1EWHA 4YWLA 2VQEH 2X6GA 2E74C 5JJZA 4FF1A 1LM0A 1UE6A 5E1FA 4DUYQ 1KJQA 4IHJF 4LF4Q 5COYA 1I3QA 1KLUD 4LWCA 4B3MQ 1G6PA 1I50A 4L5RC 4JI2H 5LMUH 5K5PA 2H5XA 4QGUA 4L1KA 5H80A 1VBHA 1E0BA 4KI0A 5EQ0A 2UUAL 5EPJA 3PW5A 1JLLB 3PW7A 4QWDA 4EGJA 4Q45A 2F52A 3CRKC 1QVCA 2W57A 1YZ6A 1H9RA 1RJQA 2F0NA 3NXWA 1DZ1A 2QDLA 2NN6H 2D2CC 3S1MH 3OYYA 1CKNA 1Q82C 2SDFA 3EN2A 4J0MA 2XGTA 4MV8A 4TSSA 2Z8LA 1EY0A 4GLXA 4TKOB 5DQGA 3GTPB 4J9QA 4A3KB 1HNWL 1LTSD 4P73A 4P74A 5LMNW 1IZ6A 4Y52H 3MXPA 5KG7A 1BBWA 1HJPA 1Y14B 4RB3C 2OWOA 1HZBA 2B2UC 1IBKL 4A3GB 5JJLA 4TQRA 4Y7NB 2ICEC 5IGEA 2ZT9C 1Z2OX 3SK8A 3TP6A 3TMEA 4DAYB 3DEOA 2FMCA 1GD7A 3IL8A 5ELFA 3MHBA 3L4JA 2FJZA 2YS6A 3TZUA 3S17H 1EYCA 1JQYD 3PF4A 4A3CH 5CBAE 4DAVA 2E2JB 1B3AA 2ATWA 3KBGA 3I4MG 3K3VA 5LXTF 3T5KA 2EXDA 1U4RA 3E9IA 4B3RL 5IYZF 4QY7A 1STHA 4N8X1 3GV7B 1JJGA 2EYFA 4GKJH 4ECQA 1A3TA 5CORA 1RL2A 1VQ8A 1D2BA 1PTOB 4O42A 1BKBA 1LTLA 5FLMH 1OO9B 3WOEA 3VDYA 2NVTB 4I7HA 2XCPA 3MC0B 3MXNA 2R92G 2VPSA 2XIGA 2E2DC 3QO2A 3Q8QB 4JI0H 4QWCA 3CW2C 4POGA 1X56A 2M05A 2KJXA 1WCMB 2VNUD 5KFMA 2VUGA 3RZDH 3EA6A 4RH6A 5C0XI 2TMPA 5CB4F 3GTOB 2YU9B 5KFIA 3GTMB 3HZXA 1ASYA 1X32A 4LF6L 2DIKA 4ZUIA 5HV6A 3QB3A 4OX9H 2IMWP 1QUQB 2L5TA 2NVYA 3S1QB 3DM3A 2B39A 2OH2A 5KT7A 4ECWA 2X6LA 1LACA 4KHPQ 2GPWA 1S3OA 1SYDA 3CCLA 4LFAL 4B9WA 2C2DA 1JB3A 5FKAC 1KNAA 4A4IA 2OT2A 1M0TA 3MR3A 1V4YA 1OXSC 2JJQA 2E2IA 1K83A 4XQQA 4N9PA 1E4GT 4H02A 3VMMA 3A56A 2AUKA 2K28A 4DNTB 3JSLA 1WTQA 5KG1A 4PQXA 4X62Q 5ELDA 2F4VQ 1HR0L 3MR5A 3S1NB 1PXUA 3TS0A 2ZJPA 2KOLA 4BY1G 1PZJD 2B2VC 3CPFA 1GHJA 3TINA 2KQ3A 4RHSA 4DV6L 1XJVA 3BA8A 5JEAH 3JZIA 1GLVA 1WR2A 4RA8A 1M0WA 1X65A 1EOTA 2I5HA 1BQQT 1S5BD 2K05A 4EQPA 2E2HH 4BWSC 2ZJTA 1VQ6A 4IURA 2VQFL 2R7DA 4FO2A 4DR7H 3GQBA 1RCVD 1JE4A 2I8CA 2RCNA 3S2HH 4HMJA 3HKZE 3T1YL 3TS2A 2B2YC 4R4QA 4RNOA 4HCSA 1STNA 1VQOA 5DQHA 3BZDB 1HZAA 3J80E 2BCOA 3A55A 1T36A 3A54A 1B7YB 4O0AA 1ET9A 5IYBH 4DL6A 1EQTA 4C3IG 2FLNA 2K7VA 2TSSA 4DUZH 4ECVA 2F0SA 3BZKA 3GV8B 1SSOA 4EQ5A 2ZXPA 2A69C 1SEBD 4ETSA 4A3MH 1SE4A 1Q1EA 4K6DA 5KFOA 2YCHA 3GTPA 5IYCG 2F0KA 1GUNA 1PHJA 3KALA 4PV1C 5DAUA 4JV5Q 3A7LA 5D65A 1EY7A 3E0JA 1MKHA 3D0FA 4GN4B 4U68A 2EJMA 3K7AH 1AE3A 2UUAH 5FJ8H 3H40A 3GTKB 3HOUB 2R6FA 1ZYRC 5AFWA 3HS0C 1L1OB 4MV9A 1F2MA 3VR2A 1HFGA 5DM73 3J81c 1I94Q 5KFBA 4DAYA 4IWYA 1E3PA 4K5VA 4B08A 4C3JB 4OHJA 2NZOA 3GTGB 1M1KC 4EBDA 2V1CC 3BJYA 4PMCA 1HZCA 3ORRA 3NBHA 3V4ZA 1HNWH 4R8UB 3T1HQ 3TDQA 4NPSA 3V96A 3BA9A 2SEBD 3NTHA 3MR6A 2Q2TA 3HOYG 4O3QA 1PTOD 2RDIA 1IBKH 1EY5A 4A3FB 3HKZB 5IWAL 4R4TA 2N8NA 4MV3A 1KL9A 2UXDQ 2B2UA 4LUVA 1C30A 2ZTCA 2ZXRA 1I3QH 4YJ3F 4JK1C 1UC9A 2BR0A 2PW7A 5I6YA 5C3EH 1I50H 2GLTA 4CKCA 4KTAA 2UXCQ 3GILA 4DV7Q 3HFZB 2WE6A 4DV1L 2IX0A 1XX8A 3F2UA 3K5NA 3IG0A 2FE3A 1CSPA 4XT3B 4YAJB 1WCMA 1YBYA 4LH6A 4K6LA 1C48A 4OO1G 2L11A 3GTOA 1AN8A 2X0SA 1B9NA 2YU9A 3GDEA 3GTMA 2CQOA 4B3RH 1O75A 3U9OA 1YHQA 1XMQQ 1QUQA 4X66Q 5L1IA 4M9UA 3VR5A 1LTAD 1EUJA 2IX3A 5D1OB 2O5JC 2QGQA 2O4XA 3PF5A 5KFPA 1WSCA 3CPWA 4CC6A 3F8NA 5D3DA 4JYAL 3S1MB 4UAIA 2BA0A 1JKJB 3H4BA 3PW2A 3J81i 1HCZA 3Q2OA 2JEAI 1W93A 3FDSA 2ICIA 3KAKA 1SNPA 4BBSB 1KC7A 4DNIA 3GO5A 3DXJC 1BCPB 4NLGA 4LF6H 1D6EC 3CD6A 1RIPA 1Z7TA 4IUUA 4JBMA 1SBBB 2C00A 3GIDA 5KG3A 2ATLA 1N32Q 3LWUA 1IL8A 1F2YA 4JC0A 1K1QA 4LF5Q 2B8GA 2V4DA 3TREA 3K5IA 3PUYA 3J81L 1PRTC 2NU9B 4ZYSA 3OWEB 1RF2D 1YNXA 2N55A 1G91A 2IW3A 4LFAH 3IRBA 2J6TA 4DR4L 4JI4Q 1G2SA 1U4PA 1PYSB 2JA8H 3J7A5 1Y8OB 2XN9C 1LT6D 1HNXQ 2L4NA 2LFNA 3W3AA 4ODGA 1KBLA 4L63B 4LF7Q 3HBLA 4DV2Q 4XX0B 1I5FA 1PV4A 1N48A 1D5XC 3N52A 5KFZA 1GO3E 1HR0H 5IP9G 2VW9A 5EBCA 2CCZA 4IZOA 4A3IG 4APVA 5CAEB 1RYSA 2OCEA 2B2WC 4DV6H 4AQYQ 2VR1A 1YI2A 3IFTA 3CCVA 4G7HC 2XCLA 1QZHA 4F50A 2DPJA 2Q2UA 4C3HH 1Y1WB 5HURA 1E1TA 5BN3A 5AJ3Q 4IRCA 2B2TC 1PFBA 1P8LA 4NW2A 4RMFA 4ZAIA 4JI5L 3VPDA 2RBMA 4ECYA 3C1FA 2HGSA 4QIWE 4F88A 2VQFH 4M7EA 2CW0D 2R7FA 2LXJA 4A3LH 4HMIA 3I4MH 2KEEA 1MGSA 3DWQA 3G7LA 4IOCA 1C8CA 1T5XD 1B3QA 3T1YH 1XXGA 4HAEA 1VQMA 3NK9A 1TR5A 3AFQA 1GVPA 3GTKA 1S5FD 2E2IH 2R87A 3FMAA 3BQ0A 3S9WA 1X3PA 3EJIA 5KFYA 1ET6A 1L1OA 4HNTA 4P2CB 3DWPA 2OTJA 2RGRA 2WAQG 4JI8L 1PX2A 1FR3A 1JX4A 4CKBA 4LFCQ 1Z2PX 1EZ8A 2A69D 4XQJA 5KFCA 5M3MB 3QZ7A 3GTGA 2R92H 1GHKA 4UCUA 2DUDA 1B53A 1X9NA 4XQNA 4MTNA 1STAA 1QE6A 2CVRA 1J5EQ 4R8UA 2K5QA 2AHOB 3ITPA 4OWTB 1O78A 1TS2A 2A74C 5C3XA 5KIXA 4IJLA 5KNCA 2W6QA 2R93B 4BBSG 1JT8A 1Z2NX 3HKZA 5IE8A 3O13A 3PUXA 1ZETA 3WOFA 5IOCA 1N34L 4KY6A 5IT9E 4GNXC 4O2BF 4DL4A 1WTVA 4MV4A 5K36G 1RK6A 3PQIA 1KEEA 2HVSA 2EQSA 2ASBA 4J15A 2JEJA 3R2TA 2FMAA 1PH7A 3KAJA 2MFIA 2UVRA 2VS1A 4NP5A 2HHHL 3SK6A 1TWGB 4B9XA 2QEJC 3SHLA 3KXYT 1ONLA 3TP7A 4GLVB 1Z9FA 1YJ9A 1JMCA 3FVQA 5LOVF 5IWAH 5GROA 4CBVA 3OUZA 1E2VA 1B6RA 1PA6A 1E2ZA 4KN4C 1JWUD 4I4TF 4LW1A 3OSNA 1GOZA 4ZK9B 5D1OA 5BPHA 1LO5D 3G6YA 3J80i 1G51A 4GNXB 2W8KA 1F2LA 1WTWA 4JBJA 5ELBA 4ZUJA 5E3FA 2YZNA 5LA6F 4DV1H 3PIOA 4I7AA 4J9NA 4A3GH 1BCPD 4Y7NH 4EQOA 1TT2A 4R9WA 1GM5A 1RD9D 1Y1VB 5KNBA 4LF9L 5EOYA 5A2QW 3J80L 1N33Q 1M8AA 3K7AB 1HA6A 5D3IB 2XGPA 1NE3A 3H0GG 3GLKA 1DYQA 2W7PA 2E2JH 1VQ4A 1IHZA 4IZ8A 3GIJA 2PI2E 2Y0SG 5DLFA 1CI3M 1S5CD 1FJGQ 2UU9Q 1DV2A 4NB3A 4JYAH 5M5XB 1H95A 2JA5G 2J6UA 2EOTA 3GIPA 5LL6S 4HCEA 3NTIA 2MPMA 2F0HA 1PH8A 2JA7B 2R82A 3SR1A 1MBYA 5GAHC 1K9MC 2R8IA 4DR5L 1A15A 1IOVA 1PTOH 3CXCA 4HEDA 4QF4A 2ZM6L 4LUOA 2NVTH 4DV4H 1S03G 2C35B 4LK1C 3WWVA 5M3MG 1PMRA 2DN8A 3SK5A 1WTPA 1MIUA 1CZGA 5IYCH 4K8JA 1L0YB 1PZID 1WH2A 2F0EA 4APMA 4G3IA 1A2UA 1VQHA 2Z9HA 4O4HF 4ZHQF 4I65A 1WCMH 5DGAA 1IL2A 4OO1I 4OELB 2EJFC 5C3EB 2YU9H 3GTOH 3GTMH 3CP0A 4Q8FA 4DR4H 1V1QA 1Y1WA 3BU2A 1Q3LA 3S1QH 4HIKA 4DV3L 4YY3Q 2K52A 1IBML 4PDBA 3HOVB 5C0XG 3NTKA 2I0QA 5HGQA 4IFDJ 3S24A 2JEGA 1GUSA 1PH4A 5T1GA 4DU9A 4QW9A 2YYZA 3LGJA 3W1BA 1A63A 4OIKA 5KFVA 3HOYH 2UUBQ 2K4KA 4JBWA 2B2WA 2V4QA 1S72A 3CMAA 2NZHA 1X54A 3PMFA 2BOSA 4LMQD 1JCKB 2WKDA 3Q0AA 2CFMA 3S1NH 2E5LL 2DZDA 4JI5H 1YEZA 4NXMQ 3OHXC 2B2TA 3HGBA 3NUCA 3Q8DA 3S15B 2QKIC 1JDEA 4DR2L 1NSNS 4DLKA 3RJ0A 3K3PA 1EZ1A 5L1JA 1A3UA 1VQCA 2EYMA 1G291 2J7ZA 2K33A 1K8GA 4OO1H 3H91A 3KLSX 4DUYL 2R93A 4DPGA 4LF4L 1BUVT 3M3YB 1Y1VG 4HR7B 2OQ0A 3U9SA 2EY5A 4B3ML 1WTOA 1MHWC 4O2AF 4JI8H 1EIFA 2F4IA 3QZ8A 3TZDA 1S0OA 2KA7A 1K3BC 1SLJA 5KFRA 3RGXA 1TWAB 4R8NA 4DK1A 4QUCA 2R7ZB 2UXBQ 1EUCB 2G9HD 4TV8F 1HNZQ 3CQZB 1LTGD 2AGOA 2MJ8A 4RKBA 1XPRA 2AWOA 2PYKA 4IO9A 1TWGA 1CKOA 3J7AF 3KLRA 2JA7G 1Z6HA 5IT9c 2L1BA 4IUTA 1QVFA 2HJWA 2EYPA 4XYOA 2AQ3B 2KBNA 2RCFA 1EYDA 2KECA 4XYQA 3WO1A 2A6ED 1RJPA 5IGCA 4RAZA 5NUCA 1N34H 2F0OA 5IGDA 4F4WA 2AGQA 1YNND 5KFWA 3KF8B 2ZTEA 4GNXA 4PG3A 1V9PA 2PVPA 4KMUC 4A2AA 3M7NA 1W96A 2PZWA 1MSGA 2IWHA 3M7GA 1TY2A 3GTKH 3HOUH 4QWAA 2ID0A 3NWSA 2HHHH 4AH6A 2K32A 2XRQD 1EQQA 1R9TB 1HFNA 4DV3Q 2K5NA 1TWFB 1Y1VA 4EGVA 3P75A 1K0SA 4C3JH 5EJWA 5LP6F 4TQSA 3I8ZA 3HOXB 3HOVG 2EXZA 1KDAA 4N9TA 2KCMA 3NP8A 1O80A 5IP9H 1I4XA 3BQ1A 4RUAA 5C4HA 2Z6KC 2K75A 4A3IH 1A62A 2GA4B 4RGTA 4WJ4A 4KKUA 5T14A 4A3FH 2JA7A 2VQDA 2QEXA 3EIVA 3ND9A 3BDCA 4LF9H 1FD7D 1MZBA 1SMYD 1U4MA 1CQIB 3BG5A 3LWBA 3VPCA 1CA5A 2N49A 3NGDA 1AUXA 3OUUA 5KFKA 1UE7A 1Q81C 4ECTA 3PW4A 1NR4A 4RUCA 3FKIG 1A2TA 3U58A 5EPLA 1AFPA 1SCUB 4GKJQ 5KG5A 3Q6SA 2K03A 4DR5H 3LMLA 2JXMB 1EFID 1ESRA 5LL6X 4KHPL 4HYKA 2ZM6H 5DNFA 5I6WA 4LNQA 2R7ZG 2A5HA 3VR3A 1L2ZA 5IT9L 3PZPA 4C5AA 3J81E 4UCRA 2XSCA 1GUWA 4MNOA 1ASZA 3SVMA 4X65Q 1VAJA 2HUGA 4RAYA 4LF8Q 1BJTA 2EYLA 1JJ2A 2UUCQ 4XT1B 3ERSX 2MGSA 5KEEA 4X62L 4R4IA 2Z4IA 3QIAA 4BY1B 2F4VL 4BBSH 2W6MA 4EEQA 2PI2A 3RTXA 4JI3Q 2VY3A 2FMMA 3JAMW 4YR3A 1N36Q 1PTOC 5K36H 5BMVF 5EBDA 5T1IA 3SEBA 1IBMH 3Q22A 2QYZA 2LS01 3BJUA 1T3NA 4YWKA 1PH2A 2NZ1D 4HJ5A 4EVOA 2I5LX 2SNSA 2DJGC 1F9QA 3BABA 3ETJA 3LP8A 2WINB 3MWEA 2OLSA 1EYGA 1PTOF 3KUPA 2NB0A 4ED3A 4JVZA 3TBIB 5FLXE 1SR3A 3CCJA 3HOXG 1JOQA 2PQAB 1M4VA 1TWAA 5L1KA 2E5LH 4XYMB 2R7ZA 4CGYB 4C3IB 3CQZA 4JOIC 3V6KA 3RR5A 2VOBA 3UDIA 1B6SA 4YHHQ 2I87A 5FPOA 1QVGA 4DR2H 4X3SA 2YW2A 3Q8RB 1GXDC 1DJRD 1Y1WH 1X55A 3KDFB 4RFBA 3GIMA 4DUYH 3RB3A 4LJZC 4LF4H 1WOCA 1XPOA 3FHWA 1TS4A 4B3MH 4ZQIA 4IRKA 5I2YA 4JV5L 4EFBA 1JR0D 4FM9A 1HH2P 3AU7A 3MEFA 3KF8A 2ASLA 3D3RA 4G4KA 4K0KQ 4ZKBB 4BA1I 4FS2A 1E7ZA 1I6HB 1UWVA 4BXXG 4FBUA 1XNQQ 3MWDA 1I94L 5EKKA 2JA5H 1K8OA 2J9GA 5D8DA 4GC7A 4QWEA 1O7YA 1IOWA 1FKAH 2WDTA 1R9TA 1SJED 3RD4A 3EROA 4ALPA 3VYSA 4CC5A 1CS0A 1BBUA 3MFYA 2NU7B 1ML0D 5M3MH 1NCVA 4IN3A 2IY5B 5FK9C 4DV0Q 3T1HL 1V51A 3HOYB 4JW0A 2CW8A 1M7JA 3MAQA 4QCLA 5BR8Q 3KLSA 2H4OA 1XNRL 4GZYC 5FD5A 1VKZA 5CMDA 5IODA 4QW8A 2UXDL 3VA5A 1PDQA 2EE1A 2O2LD 3RUZA 2R93H 2R92A 4H44C 4DK3C 1RYRA 5KFJA 1G8ZD 3V6JA 4QUFA 3QG1A 2UXCL 4DV7L 1S40A 5CV8A 4DKAC 2AMCB 5GQOA 5KFGA 3EPGA 5I4DA 1NTGA 4IR1A 2W9BB 5C0XH 1F9SA 5DM63 4DR3Q 4QWBA 3RUPA 1RJRA 2MO0A 3NE5B 4TVAB 2Q2IA 1I7NA 5KFXA 4RB0A 4RCNA 1VS0A 2K1BA 5D14A 4FF3A 2GPSA 1TWGH 1VQ5A 2J0TD 4ZCKA 4IWXA 4FU0A 3TRZA 2CW0C 1XMQL 2Z6KA 4HIMA 4X66L 1Y69U 1BNCA 5KGUA 1LTBD 1LYLA 1BXTA 2AGPA 2EDGA 2L9HA 1QNUA 1L1OC 3I12A 1NMFA 4XDXA 4ZI7F 3L3OC 3PUZA 3KHHA 1BOSA 5GAEC 2B63G 4O3OA 1HRJA 1CT1D 2EY2A 2FHTA 3BVZA 3RB6A 3URYA 2ZJQA 4MV7A 1D1IA 3W5OA 1CQFA 1YITA 1DOMA 1I6VC 1LTID 1KNEA 3ULPA 4JCVE 1A9XA 1GGOA 3NENA 5HY6A 3M85A 3HOZG 2YTVA 1Y1VH 2WAQE 1NNXA 1N32L 4DL5A 5IYDH 1RTNA 1TQOA 2ES2A 3IKJA 5LMNQ 5C44G 4LF5L 4A3JB 1VMCA 3I3CA 2NVXH 1SMXA 3E3XA 2FLLA 2F0DA 4KHPH 1VF7A 1YHAA 4X64Q 1OXTA 2VUMG 4EYIB 2WIIB 2CQAA 3OPOA 4XYLB 1FNWA 4JI1Q 1KQSA 1EY6A 4JI4L 3RB4A 4YB8B 4ED6A 3WDNA 5M5XH 4DV5Q 1E4EB 1Y8NB 1YJNA 2Q8IB 3RLOA 3I90A 1HNXL 4O2DA 2JA7H 5I47A 1I4QA 2OXPA 1RODA 1PK8A 3RIZA 4LF7L 2EIFA 4OWXB 4DV2L 2CW7A 1WVLA 4HQ6A 4X62H 2FLPA 2F3VA 1D8LA 2F4VH 4A3IB 1ENAA 1I6UA 5TSSA 2CH4A 3F2CA 4M1UB 3NQTA 4GN3B 1XNRQ 1NR2A 2PQAA 3VYTA 2JYOA 4JPBW 1CZWA 4AQYL 3PO2B 1LTTD 4ED0A 3SDZA 4QMGA 1JOKA 1ZQ7A 5BN4A 1KRSA 3H15A 4GLAC 1XWEA 3C2PA 4WORA 1NMGA 5AJ3L 2ASJA 3UDFA 3KDFA 5CR3A 1TIID 2XTIA 5FLXc 1B33N 4J9OA 3OIQA 2UVUA 5FOBB 1BCPC 3HOVH 3STBC 1ULZA 3BVGA 2R3ZA 3ETHA 2VPQA 4PNYA 2YTXA 3CC2A 3S2DH 4R4CA 5C4XG 3J81W 1HXYD 1TVXA 2WAQB 1E4FT 5FD6A 4MTEA 4A93G 4EBCA 1Q46A 4JOIA 3MVVA 5EKLA 4YWMA 4LFCL 1BCPF 1MSHA 1S9FA 4KK7A 1JIHA 2HIVA 1IYJB 1EQVA 4J8QA 2FJ2A 4P71A 2F0PA 5DEHA 4A2BA 2SCUB 1J5EL 3N6RA 1J9OA 3M4OB 3S15H 4JV5H 5KKNB 4K5WA 3J81j 2Y0SE 2EPBA 4PZ7A 5EDWA 2F0VA 1FNUA 1S0NA 3TP5A 3CKIB 1R4QB 1XTDA 2PNRC 2WB1G 1DOKA 4O4IF 4MZ9A 2I07B 3FPPA 2R7MA 1I94H 3M3YH 5BN5A 4OXPA 4DXFA 1JDBB 2X69A 1IKMA 2FPIB 3DMUA 2IHFA 1WTHA 1Q8IA 3LWEA 5JEAJ 4A3JG 4UY8C 1RK5A 4A3DB 2W71A 3E9HA 1SYBA 1TWAH 3JC66 2R7ZH 5KFLA 2W9BA 2ASDA 4OIJA 2FKLA 1NUCA 3CQZH 2UVWA 3T1HH 3MFIA 2NTSA 4RGNA 1SYXB 4ME5A 2O03A 1PRTF 4U7CA 2FPPB 2XWJB 3S1RH 2HDLA 4BBRG 3T5JA 1X6OA 4A76A 2KENA 1TS5A 2UXDH 2V4RA 3MFHA 5EWFA 3K5HA 4DXGA 2EZVA 1H9SB 1WI5A 1WTXA 2XNAC 4BY7G 3GTQB 2HIXA 2UXCH 2W9CB 4DV7H 4U673 4YCVA 3WNZA 3PO2G 4EQNA 1C7YA 3PO3B 4X6AH 4QJFA 5FLXL 5KT6A 4R4OA 1NJIC 5EGTA 3H0GB 1MD2D 3PW0A 1N33L 1R9TH 1VQKA 1TWFH 4IAJA 1XMQH 2Y0SB 3AB9A 4X66H 3P20A 1LV9A 3PV0A 3HOXH 2R7NA 2YV5A 4ECUA 4KHZA 2JA5B 2QK4A 5G3LD 4F87A 1FJGL 1Y8PB 2UU9L 4UFZA 4ECXA 2R8GA 1K3RA 1C3OA 2WKCA 4R8IA 1VQNA 2FB9A 4L5SA 3G4SA 4B3TL 1T9HA 2JE6I 4J9MA 1E4EA 3GD7A 4RGOS 3CCMA 1XDNA 2QCPX 5I9PA 4L5TA 5KG6A 1O7IA 1LLRD 2HD3A 4ME3A 1TXYA 3A8KE 4O4LF 3C0FB 1N32H 4KV6A 4NXNQ 1KIXA 1EFWA 2R86A 3I4LA 4DK0A 1FGUA 2LXKA 4LF5H 4HJAA 2YRXA 4UCOA 3ICEA 1A0IA 4B3SQ 4M8AA 5FO7B 4FXGC 1D5MC 1BNZA 2K14A 1EYZA 2A6EC 4GS3A 4BXXH 1TKWB 4JI4H 4GOPB 1YNNC 2XD4A 3F2DA 5C1OA 3U4VA 1GUTA 1HNXH 3KF6B 1VQBA 2EY6A 4YY3L 3C3LA 2RDGA 3J80W 3G6XA 4RU9A 3GV5B 3KHRA 4JI7Q 4A3DG 4QQBX 3G8CA 4DV2H 4DV4Q 1G6ZA 4LF7H 1H9JA 5H1SE 4V190 2DGYA 1CKMA 3BS1A 4RB2C 2FXQA 3HXLA 4HNVA 2Z4HA 3RBEA 2WAQA 1U9RA 1VMPA 2MUYA 2K01A 3VR6A 2YRWA 3N6XA 4AQYH 2UUBL 2KCTA 2B29A 4J9PA 3RAXA 4ECZA 4BY1H 4JV1A 4WD3A 3PN1A 4L8JA 1OXUA 4NXML 3K5OA 5KX5F 2E75C 3MXGA 3E5NA 1I4HA 1B1ZA 2RGVA 1KJJA 1WFQA 4KD4A 1OTCA 4EBEA 2V9WA 2R8JA 4F4YA 1LTRD 3STBD 4HTHA 3BAAA 2ZTDA 3PO3G 4NKLA 1QNKA 1EEFD 1SMYC 2XVSA 4G7OC 1XMOQ 3T5HA 3GTLB 1KJIA 2NVXB 3A74A 3G6EA 5CV4A 1SNQA 2JA6G 1B2TA 1GUGA 2XWBB 4RZRA 4IRDA 1BVSA 1PH9A 4LFCH 3K0YA 4PZ8A 1Q86C 4RHRA 5FLMG 2AQ2B 1CA6A 2UXBL 3T16A 1HNZL 4I55F 3PUWA 2NUAB 1ZKOA 4RB1A 3PR4A 4Q44A 2RDFA 3D6WA 5L9XA 5E4XA 1Q90A 4OL7A 4B3TQ 3I4OA 4C3IH 4LFBQ 1J5EH 1JE5A 3FPUB 2F0TA 3GTJB 3NQIA 3BYYB 4F8MA 1LT5D 2F0UA 2NVQB 5JVG3 3OTOQ 3BZCA 4UCSA 1K8AC 2LMCB 2RQXA 2M9VA 5JVH3 2CZGA 1VQPA 1EY9A 3N8DA 3K81C 3MWYW 4ZRZA 4IR9A 1H9SA 2JEBI 4I7ZC 3N44B 4JI6Q 5GADC 4X3KA 5M3FG 4FF4A 3GTQA 2W9CA 4DR6Q 4HJ7A 1KAWA 5CGKA 4K2KA 3BDOA 4I50F 1PH5A 3RZOB 1YVCA 1DCZA 1C0AA 1D7QA 1CSQA 3TIGA 1I6HH 4GKKQ 1K8MA 1FL0A 1GSAA 3H0GA 1EY4A 3C46A 3S2DB 2DY7A 3CCRA 2Y0SA 5A2QL 4OGQC 5C1PA 1KXLA 2PNHA 3K7UC 2QF7A 4C2MH 4PMWA 2R8KA 2C2RA 3BVMA 3RBDA 3JSNA 3A5UA 2JA5A 5DLGA 1IBLQ 2XC9A 1EIHA 2DLNA 1V1OA 3T51B 4K5XA 5I2XA 2VZAA 4PZ6A 4O1NA 1CFMA 4L5QA 1K28A 2AQ1B 5CA0F 1UEBA 2AU0A 3AFPA 3I2ZA 3J7ZC 5FPRA 3NWTA 2GVAA 3DWAA 1KRTA 3ZYYX 3D4DA 2WFWA 3TN2A 5DGBA 1L2FA 1N33H 5IGBA 1H9MA 1DM0B 2K5HA 3K59A 3RAQA 4YBZB 3PCOB 3FKIB 3G71A 1V1PB 5FO8B 4ED2A 5KFHA 3NELA 1FJGH 3H3VI 4C5CA 2UU9H 1S68A 1A6XA 1VQIA 1PFSA 3CRLC 2PCFB 5KYLA 4FF2A 4A93H 1VF5C 4GKJL 1KJ9A 4J9KA 4GOPA 4CDFC 1J8IA 1S0MA 3AMUA 1DXMA 2D9UA 1GSHA 1NBWA 4AYBE 3KF6A 3QOJA 4WFN3 3CF5A 1SE3A 3JRWA 2F0LA 1A3VA 3I56A 1DOLA 2CKZB 3S1RB 1QB5D 3I7FA 4CKEA 1RTOA 1KDBA 4H0LC 4X3UA 3ERQA 3TP8A 4DR1Q 2XCAA 1UAPA 1D1KA 3HEJA 2VQEQ 4C56C 3QWNA 1KLGD 5ELEA 4X65L 4TUYF 3FMCA 2XIWA 4LF8L 5EAYA 5FJ8G 2UUCL 2QW7A 4O3SA 4KKTA 3OIPA 4A3BB 3RFCA 3RMHA 5M5YB 3PR5B 1Q1BA 5E7NA 4JI2Q 4JI3L 5LMUQ 3EQLC 2Q8TA 3D6CA 3VPBA 1ZXTA 2RSNA 3Q8SB 3MWMA 3W1GA 3NHHA 1N36L 4A3JH 4YY3H 4F4XA 3MXNB 1DV1A 1H9KA 1RKNA 2A1AA 4E6IA 1U4LA 3Q1KA 3GIKA 3BYTB 4L6TB 3IAYA 2HVQA 1AEXA 3OSOA 3GTLA 2NVXA 1E1OA 2IT1A 3HB9A 2UUBH 2DY8A 2IHEA 2NVYB 4C1NK 2N78A 5JAVA 5BPFA 2KSWA 3TEHB 4NXMH 3M4QA 5C4ZA 1N56A 3OW7A 5KT3A 3PO2H 4YHHL 4A75A 1MJCA 2R7LA 5IT9W 2NTTA 4AYBB 1E24A 1SXTA 2K5DA 1VBGA 3GTJA 4CJ2C 5M5WH 3GV6A 1ZEQX 2WV6D 1AW7A 4DAMA 4RAUC 1WD1A 3DLLA 1B4OA 5CA1F 2NN6I 1PFNA 4P72A 4FBTA 2EJGC 4J9LA 3I73A 4DR7L 3MFGA 4K8IA 5J2TF 4K0KL 3ZJYC 2KUMA 5C6AA 2UXBH 2MNAA 1HNZH 1SYEA 5IGFA 1KC8C 1UE5A 2CHBD 2L55A 1XNQL 2K5VA 5ISRA 3J7AK 2KHIA 3JAMc 2R8HA 2HQLA 1TWCH 4IUQA 1AUVA 4HJ9A 5F9LA 5CBEE 1VQFA 3M4YA 4JI0Q 3CCUA 4IJHA 3Q24A 3ORQA 2W70A 5DLQE 1SYGA 1HZ9A 4IUPA 1BF4A 5I9OA 4DV0L 3OSPA 1XPUA 2XRSD 5BR8L 3M4OH 2V58A 2VA2A 1JORA 3K58A 5DG7A 4OX9Q 3R3OA 1E22A 4RZQA 2BDOA 4A3BG 5KG2A 2KHJA 3D4RA 3I70A 2JA8G 4DV3H 2HT1A 1DD2A 4LMYA 1JXLA 2JEFA 3KLWA 1RDPD 2FK2A 2W6PA 1XYIA 1HUMA 2A8VA 1K0RA 4A3DH 3E0EA 4DR3L 2HDMA 3FKIA 1V1PA 3KHLA 1E2WA 3NBIA 5J22A 4KN7C 2EYHA 5IY0A 1SYFA 3I91A 3RF2A 4HR7A 5CV7A 2PQEA 2L0CA 3A5ZB 4HIOA 5D1PA 3TQ1A 5F2DA 2F0MA 3KOJA 1LABA 2NWGA 3EVQA 2B63B 2WP8J 5DG9A 4DNRB 2Z0SA 4U6PA 4C3HG 3M9NB 1FGBD 2BA1A 3S16B 3ND8A 4ECSA 1MI2A 2DNEA 1YIJA 4CDEC 3GTQH 3EBEA 1TA8A 5JPMC 2DPIA 4IFDG 3GIQA 1GSOA 3J7AV 1RHPA 4JV0A 4A3LG 3JAMi 3HOZB 3NBHB 4MHEA 4AYBG 3PO3H 3R23A 3OOCA 3G6JB 1EL0A 2ENBA 4WJWA 4RCOA 5C44B 1HR0W 3H0GH 2W7OA 2E8GA 4DR7Q 2BQUA 3KTMA 2ZJRA 1V8QA 2JA6H 3X3NA 1CHPD 5KFTA 2W6ZA 5LMNL 5ELCA 2RHSB 2VUMB 1WD0A 4HNUA 2PMZE 2OF1A 3JAML 3HG9A 4X64L 5IP7G 3HOWB 1DGSA 4Q5VA 2XGQA 3IN5A 3SI8A 5KFDA 4JI1L 3V4SA 1L0XB 1KD1C 1STEA 2IPKD 1TU2B 1PLFA 4CDCC 4DV5L 4DUZQ 1AP0A 1TWFA 2NU6B 5HBRB 4KLKA 2D0OA 4X65H 3S14B 1N9WA 2WB1E 5CV9A 3T13A 4C2MB 3UE1A 4MIUA 5JJKA 1OXXK 1W3SA 4LF8H 2UUCH 4DL2A 3N42B 4POFA 4XIGS 3N41B 2RDJA 3AEVA 5EZYF 3VA7A 4Q8EA 4JI3H 1Q7YC 3KBXA 1JC7A 3MEHA 4FXKC 4A3EB 2UUAQ 2J4XA 2VB3X 1N36H 2HCIA 3LNNA 5M3FH 3DF7A 3D31A 1L0WA 5JPNC 3CCSA 2F0FA 4AYBA 4R7RA 2F0JA 3I4NB 3N43B 4KKSA 4DF7A 3ER0A 5KFNA 2V59A 5C4JH 1EQRA 4FDBA 4FNFA 3R5FA 3P7JA 3UE0A 5C4XB 5JH7F 1HNWQ 2MCTA 3HRZC 1BR9A 3CHBD 1UEAB 2HCCA 3PGZA 2LKVA 4A3KG 4A93B 2PZTA 4RNMA 5KFEA 4UP7A 2EVBA 4O3PA 2A6HC 4FS1A 5KRUA 3RLFA 1IBKQ 2JP1A 4KY7A 2IJ0A 3KYHC 3KHGA 4YHHH 2PMZB 4F4ZA 1B70B 2L15A 4A3GG
chains in the Genus database with same CATH topology
1X3FA 4YWLA 2Q2HA 4BY7G 1VQHA 3CMEA 1WCMH 2HIXA 1IL2A 1LM0A 1UE6A 4DUYQ 1FVIA 4OO1I 4YCVA 4LF4Q 3GTOH 2YU9H 3GTMH 3CP0A 3PO2G 4LWCA 1V1QA 4B3MQ 1G6PA 1C7YA 4L5RC 4X6AH 3BU2A 4QJFA 4R4OA 2H5XA 4QGUA 1NJIC 1X3EA 4KI0A 2UUAL 3L2PA 3S1QH 3NEMA 4HIKA 4B3RQ 4DV3L 1P16A 2K52A 4YY3Q 1R9TH 1VQKA 4P75A 1IBML 1N33L 1TWFH 2F52A 5C0XG 3GTLH 1GKHA 1QVCA 2I0QA 1YZ6A 5HGQA 4IFDJ 3S24A 3PV0A 2MO1A 1PH4A 3HOXH 2YV5A 4KHZA 3S1MH 3OYYA 1CKNA 1Q82C 3EN2A 1FJGL 2YYZA 2XGTA 3LGJA 4TQUS 3W1BA 4GLXA 2UU9L 3HOYH 1A63A 2UUBQ 2K4KA 4JBWA 3HOWG 1K3RA 1S72A 3CMAA 1HNWL 4P73A 2NZHA 4P74A 1X54A 1VQNA 5LMNW 4L5SA 3G4SA 4B3TL 1T9HA 2JE6I 1IZ6A 3GD7A 4Y52H 3CCMA 1SROA 1BBWA 1HJPA 2CFMA 1Y14B 2E5LL 3S1NH 1YEZA 4L5TA 4NXMQ 3GTJH 1O7IA 4ME3A 1HZBA 2OWOA 4LF6Q 1TXYA 1WCMG 2LSSA 3Q8DA 1IBKL 5JJLA 2NVQH 4YCUA 2R6GA 4DR2L 4NXNQ 1KIXA 1EFWA 4DAYB 4UPAA 4XTCS 1FGUA 2LXKA 1GD7A 1VQCA 4HJAA 3ICEA 1G291 1A0IA 1K8GA 4B3SQ 4DUYL 3RN5A 3S17H 4DPGA 2K14A 4A3EG 4LF4L 3PF4A 2N3SA 1Y1VG 4A3CH 4LFAQ 2OQ0A 4GS3A 3SGIA 4B3ML 4BXXH 2ATWA 3I4MG 1JB7A 4GOPB 1EIFA 3F2DA 1VQAA 1TWHH 2EXDA 3RZOH 1SLJA 3U4VA 3E9IA 3KF6B 3I4NG 4B3RL 1VQBA 2GVBA 4YY3L 2UXBQ 4QY7A 1HNZQ 1JJGA 3K80C 4JI7Q 4A3DG 4QQBX 1XPRA 4DV4Q 5H1SE 3RN2A 2AWOA 1HR0Q 4QL5A 2DGYA 1CKMA 1RL2A 4IO9A 3M4PA 1VQ8A 1J6QA 1BKBA 1LTLA 3F8TA 1CKOA 2FXQA 5FLMH 3RLNA 3VDYA 2JA7G 2R92G 4DV6Q 4RG1A 5IT9c 3CW2C 1QVFA 2UUBL 4POGA 1X56A 2KBNA 2KCTA 2B29A 4BY1H 2VNUD 3PSIA 3RZDH 1VQDA 3KF8B 5C0XI 1OXUA 2ZTEA 4GNXA 4PG3A 4NXML 1V9PA 1A8VA 1ASYA 4IPGA 4LF6L 1WFQA 3M7NA 1OTCA 2VQFQ 1QUQB 3GTKH 3HOUH 3STBD 4NXNL 2ID0A 2ZTDA 3DM3A 4AH6A 1PH1A 3T1YQ 3PO3G 1EQQA 4DV3Q 2K5NA 3FKIH 4B3SL 1XMOQ 4KHPQ 2D0PA 1S3OA 3A74A 4C3JH 3G6EA 3CCLA 4LFAL 2JA6G 3HOVG 1BVSA 4A4IA 4JG2A 1PH9A 2ALYB 2KCMA 2A19A 4OONA 1OXSC 2JJQA 4PZ8A 5IP9H 1Q86C 5FLMG 4H02A 2Z6KC 2UXBL 2K75A 4A3IH 1X3GA 1HNZL 2D62A 1A62A 3PUWA 4JI7L 5C0XJ 4DV4L 4X62Q 2F4VQ 4B3TQ 1HR0L 3I4OA 4C3IH 4LFBQ 1JE5A 4WJ4A 1C9OA 3TS0A 2ZJPA 4A3FH 1YJWA 3HKSA 4BY1G 2QEXA 4IFDI 3CPFA 3EIVA 3OTOQ 3BZCA 4DV6L 1K8AC 3B6YA 1XJVA 3UDXA 2N49A 4A3FG 1VQPA 1PH6A 1UE7A 3K81C 5J3BA 1X65A 1SRUA 2I5HA 1Q81C 2E2HH 3HOUG 2JEBI 4A3BH 4JI6Q 5M5YH 5GADC 5M3FG 3FKIG 1VQ6A 4HJ7A 4DR6Q 1KAWA 2MQHA 2VQFL 2R7DA 1PH5A 2VL6A 3U58A 1YVCA 2RF4A 1C0AA 1D7QA 2RCNA 3S2HH 1CSQA 4GKJQ 1I6HH 4GKKQ 3HKZE 3T1YL 3TS2A 4R4QA 1FL0A 1XMOL 4KHPL 1VQOA 3CCQA 1EWIA 1HZAA 4LNQA 2R7ZG 3CCRA 5IWAQ 1B7YB 4O0AA 5IYBH 1KXLA 2PNHA 3G48A 3K7UC 4C2MH 4HIDA 4PMWA 1K73C 1AH9A 3BZKA 4MNOA 4YCWA 1VCIA 3HKZG 4AIMA 3K0XA 1Q12A 4EQ5A 4X65Q 2JA9A 1ASZA 4GOPC 1IBLQ 2NVYH 4LF8Q 4A3MH 1M90C 1JJ2A 2UUCQ 1Q1EA 3UDGA 2YTYA 3ERSX 4BBSH 4X62L 4R4IA 4DV1Q 2VZAA 4PZ6A 5IYCG 2F4VL 4LFBL 1PHJA 4L5QA 2PI2A 1UEBA 4JV5Q 4JI3Q 2VY3A 4GN4B 1MKHA 3D0FA 3AFPA 3I2ZA 1AE3A 3K7AH 3J7ZC 3OTOL 2JK8A 5FJ8H 1N36Q 3J80c 2GVAA 3FP9A 1KRTA 4JBKA 2WFWA 1L2FA 1YHBA 1MJEA 1L1OB 2K5HA 2AWNA 3BJUA 1K83H 4YWKA 3PCOB 3J81c 3G71A 4HJ5A 1PH2A 1I94Q 2RHQB 1E3PA 2I5LX 4JI6L 2NZOA 3NELA 4DR6L 1WYDA 3H3VI 1EYGA 5IP7H 1M1KC 1VQIA 1PFSA 2V1CC 4JYAQ 1HZCA 4A93H 4GKJL 4GOPA 1SR3A 3CCJA 3HOXG 3T1HQ 4GKKL 3PUVA 2QA4A 2NN6G 4NPSA 2PQAB 1NBWA 1WJJA 5JJIA 4AYBE 3KF6A 3CF5A 2Q2TA 3HOYG 4JOIC 3I56A 3RR5A 2CKZB 5IWAL 4R4TA 2N8NA 1KL9A 3I7FA 2UXDQ 3UDIA 4LUVA 4YHHQ 3K8AA 4DR1Q 1QVGA 2ZTCA 1I3QH 5C3EH 1I50H 2VQEQ 4X65L 1X55A 3KDFB 1Y1WH 1IBLL 2UXCQ 4LF8L 4DV7Q 5EAYA 3HFZB 5FJ8G 1WOCA 1EIYB 2UUCL 1XPOA 4DV1L 2IX0A 3FHWA 2IX1A 4DR4Q 4JV5L 1CSPA 1B8AA 1Q1BA 5E7NA 4JI2Q 4JI3L 5LMUQ 1YBYA 1HH2P 3MEFA 4OO1G 3W1GA 3GDEA 1N36L 2CQOA 4K0KQ 1QZGA 4A3JH 4BA1I 3MXNB 4A3CG 1E7ZA 1UWVA 4BXXG 1YHQA 2A1AA 1QUQA 1XMQQ 1XNQQ 4X66Q 1I94L 2JA5H 5ELNA 1EUJA 4LUZA 2QGQA 3PF5A 3GTPH 4ALPA 4A3KH 3CPWA 1BBUA 1E1OA 2IT1A 4JYAL 5M3MH 2CWAA 2BA0A 3A0JA 2IY5B 3I55A 4DV0Q 2IHEA 3RNUA 3J81i 3T1HL 2N78A 2JEAI 5BR8Q 1XNRL 2B63H 3TEHB 4JI5Q 4DNIA 3GO5A 1Y1WG 3M4QA 3CD6A 3S16H 1RIPA 1U0LA 4JBMA 3U4ZA 2UXDL 2R93H 3PO2H 4YHHL 4A75A 1N32Q 1MJCA 4DR1L 4JC0A 1E24A 3AYHB 4LF5Q 4DK3C 2AKWB 5M5WH 2VQEL 3ULJA 3TREA 3PUYA 1N8RC 2UXCL 3HOZH 4DAMA 1YNXA 4DV7L 3DLLA 1S40A 4DKAC 2AMCB 5GQOA 2NN6I 4P72A 1NTGA 3IRBA 4DR4L 1CUKA 4DR3Q 5C44H 4JI4Q 4JI8Q 5LMUL 4JI2L 2MO0A 4DR7L 2I5MX 4TVAB 1PYSB 2Q2IA 2JA8H 3J7A5 1VS0A 4HJ8A 1LUZA 1HNXQ 1TWGH 3ZJYC 1VQ5A 2VUMH 4K0KL 1PVOA 2MNAA 1KC8C 3TRZA 1UE5A 4LF7Q 1XMQL 2Z6KA 4DV2Q 4HIMA 1I5FA 4X66L 2K5VA 1PV4A 1XNQL 3HOWH 2CWPA 1GO3E 1LYLA 2KHIA 3JAMc 5IP9G 2HQLA 1TWCH 1L1OC 2VW9A 2OQKA 1VQEA 4HJ9A 2CCZA 1NMFA 4GN5A 4A3IG 3PUZA 4APVA 2OCEA 1VQFA 5GAEC 4JI0Q 3CCUA 2BH8A 4IJHA 3OW2A 4AQYQ 2B63G 5DLQE 3F2BA 3CCVA 1YI2A 1W2BA 1QZHA 3CC4A 4OWWB 3S14H 1HZ9A 4DV0L 2ZJQA 1N34Q 2Q2UA 1OXVA 4C3HH 1XPUA 2R93G 3W5OA 1YITA 1E1TA 3M9BA 2B3GA 5AJ3Q 5BR8L 3M4OH 1P8LA 4RMFA 4JI5L 4JCVE 3ULPA 5JEAG 3NENA 5HY6A 3CCEA 3M85A 3HOZG 4A3EH 2YTVA 4QIWE 1Y1VH 4OX9Q 2WAQE 1E22A 1VQ7A 4IOAA 2R7FA 1N32L 2LXJA 4A3LH 5IYDH 2ES2A 3I4MH 2HHHQ 5LMNQ 4A3BG 3U50C 5C44G 4IOCA 4LF5L 2NVXH 1SMXA 3KFUA 2KHJA 1VQMA 2JA8G 2HT1A 2BH2A 1CKNB 1YHAA 3AFQA 1GVPA 1Z47A 4X64Q 3KLWA 1OXTA 2E2IH 2VUMG 3I4NH 1VQJA 2K50A 4JI1Q 1L1OA 1KQSA 1K0RA 3KJPA 2A8VA 3E0EA 4A3DH 2OTJA 4DR3L 4JI4L 2WAQG 4JI8L 5M5XH 5C4XH 4DV5Q 3PIPA 4LFCQ 5IY0A 1YJNA 3RLOA 1U5KA 4UP9A 1HNXL 4O2DA 2JA7H 4EX5A 2R92H 3A5UA 1KHIA 2DUDA 1X9NA 3A5ZB 4LF7L 2EIFA 4MTNA 4OWXB 5IYBG 4DV2L 4HIOA 1D8LA 1J5EQ 3KOJA 3F2CA 1UE1A 2AHOB 2WP8J 4OWTB 2Z0SA 4GN3B 1XNRQ 2BA1A 2PQAA 3AQQA 1SE8A 4IJLA 1VQ9A 3CC7A 3ULLA 4LF9Q 4JI0L 4A3MG 5GAGC 4AQYL 1YIJA 4BBSG 1JT8A 4DK6C 3GTQH 3EBEA 5IE8A 3PUXA 1N34L 4IFDG 1KRSA 3H15A 4GNXC 4GLAC 5IYDG 3JAMi 4A3LG 3NBHB 1NMGA 5AJ3L 3UDFA 4AYBG 3PO3H 3KDFA 5K36G 1IXRA 2EQSA 2XTIA 1HR0W 5FLXc 2ASBA 3H0GH 4OX9L 4J15A 2E8GA 4DR7Q 1EOVA 2ZJRA 3TQYA 1PH7A 2JA6H 2MFIA 2VS1A 2OTLA 2HHHL 3STBC 5LMNL 3HOVH 2RHSB 3KJOA 2YTXA 3CC2A 3S2DH 4DR5Q 4R4CA 5C4XG 2PMZE 4GLVB 1Z9FA 1YJ9A 1JMCA 4X64L 5IP7G 1VQGA 1DGSA 2ZM6Q 4JI1L 4A93G 1Q46A 5GROA 1KD1C 1NY4A 4JOIA 4IPHA 1PA6A 3L0OA 4DV5L 4YWMA 4LFCL 4LW1A 4DUZQ 4KLKA 3H3VH 2D0OA 2HIVA 1IYJB 1G51A 3J80i 4BBRH 4GNXB 1N9WA 2WB1E 1SFOH 1VQLA 3L7ZC 3UE1A 5JJKA 1OXXK 1W3SA 4JBJA 4P71A 4POFA 3PIOA 5ELOA 4XIGS 1J5EL 2GN5A 3AEVA 3S15H 4A3GH 4Y7NH 1Q7YC 1V43A 2Y0SE 5C3EG 3J81j 4PZ7A 4BY7H 1SN8A 4WJ3M 2UUAQ 1GM5A 4LF9L 5M3FH 1XTDA 2WB1G 1N33Q 3D31A 1IBMQ 1L0WA 2JQOA 4MZ9A 1NE3A 3H0GG 3CAMA 3F1ZA 4R1JA 3CCSA 3M3YH 4OXPA 3GTGH 2E2JH 1VQ4A 2PI2E 2IHFA 2Y0SG 4A3JG 5JEAJ 4UY8C 3ER0A 3E9HA 5C4JH 1FJGQ 1EQRA 2UU9Q 3JC66 1TWAH 4FDBA 4NB3A 4UP8A 3UE0A 2R7ZH 4IPCA 1H95A 2JA5G 3CQZH 1HNWQ 1JJCB 1PH8A 1Q8KA 3PGZA 1K9MC 5GAHC 1AE2A 4DR5L 4A3KG 4UP7A 2F3IA 3CXCA 3S1RH 2E5LQ 4BA2I 2ZM6L 4LUOA 4BBRG 2NVTH 1PYBA 2C35B 3WWVA 1X6OA 4IPDA 3RLFA 5M3MG 1IBKQ 4A76A 1MIUA 1PH3A 2KENA 3KYHC 5IYCH 4DR2Q 1B70B 4DUZL 2L15A 1WI5A 4A3GG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3F A;  4YWL A;  2Q2H A;  4BY7 G;  1VQH A;  3CME A;  1WCM H;  2HIX A;  1IL2 A;  1LM0 A;  1UE6 A;  4DUY Q;  1FVI A;  4OO1 I;  4YCV A;  4LF4 Q;  3GTO H;  2YU9 H;  3GTM H;  3CP0 A;  3PO2 G;  4LWC A;  1V1Q A;  4B3M Q;  1G6P A;  1C7Y A;  4L5R C;  4X6A H;  3BU2 A;  4QJF A;  4R4O A;  2H5X A;  4QGU A;  1NJI C;  1X3E A;  4KI0 A;  2UUA L;  3L2P A;  3S1Q H;  3NEM A;  4HIK A;  4B3R Q;  4DV3 L;  1P16 A;  2K52 A;  4YY3 Q;  1R9T H;  1VQK A;  4P75 A;  1IBM L;  1N33 L;  1TWF H;  2F52 A;  5C0X G;  3GTL H;  1GKH A;  1QVC A;  2I0Q A;  1YZ6 A;  5HGQ A;  4IFD J;  3S24 A;  3PV0 A;  2MO1 A;  1PH4 A;  3HOX H;  2YV5 A;  4KHZ A;  3S1M H;  3OYY A;  1CKN A;  1Q82 C;  3EN2 A;  1FJG L;  2YYZ A;  2XGT A;  3LGJ A;  4TQU S;  3W1B A;  4GLX A;  2UU9 L;  3HOY H;  1A63 A;  2UUB Q;  2K4K A;  4JBW A;  3HOW G;  1K3R A;  1S72 A;  3CMA A;  1HNW L;  4P73 A;  2NZH A;  4P74 A;  1X54 A;  1VQN A;  5LMN W;  4L5S A;  3G4S A;  4B3T L;  1T9H A;  2JE6 I;  1IZ6 A;  3GD7 A;  4Y52 H;  3CCM A;  1SRO A;  1BBW A;  1HJP A;  2CFM A;  1Y14 B;  2E5L L;  3S1N H;  1YEZ A;  4L5T A;  4NXM Q;  3GTJ H;  1O7I A;  4ME3 A;  1HZB A;  2OWO A;  4LF6 Q;  1TXY A;  1WCM G;  2LSS A;  3Q8D A;  1IBK L;  5JJL A;  2NVQ H;  4YCU A;  2R6G A;  4DR2 L;  4NXN Q;  1KIX A;  1EFW A;  4DAY B;  4UPA A;  4XTC S;  1FGU A;  2LXK A;  1GD7 A;  1VQC A;  4HJA A;  3ICE A;  1G29 1;  1A0I A;  1K8G A;  4B3S Q;  4DUY L;  3RN5 A;  3S17 H;  4DPG A;  2K14 A;  4A3E G;  4LF4 L;  3PF4 A;  2N3S A;  1Y1V G;  4A3C H;  4LFA Q;  2OQ0 A;  4GS3 A;  3SGI A;  4B3M L;  4BXX H;  2ATW A;  3I4M G;  1JB7 A;  4GOP B;  1EIF A;  3F2D A;  1VQA A;  1TWH H;  2EXD A;  3RZO H;  1SLJ A;  3U4V A;  3E9I A;  3KF6 B;  3I4N G;  4B3R L;  1VQB A;  2GVB A;  4YY3 L;  2UXB Q;  4QY7 A;  1HNZ Q;  1JJG A;  3K80 C;  4JI7 Q;  4A3D G;  4QQB X;  1XPR A;  4DV4 Q;  5H1S E;  3RN2 A;  2AWO A;  1HR0 Q;  4QL5 A;  2DGY A;  1CKM A;  1RL2 A;  4IO9 A;  3M4P A;  1VQ8 A;  1J6Q A;  1BKB A;  1LTL A;  3F8T A;  1CKO A;  2FXQ A;  5FLM H;  3RLN A;  3VDY A;  2JA7 G;  2R92 G;  4DV6 Q;  4RG1 A;  5IT9 c;  3CW2 C;  1QVF A;  2UUB L;  4POG A;  1X56 A;  2KBN A;  2KCT A;  2B29 A;  4BY1 H;  2VNU D;  3PSI A;  3RZD H;  1VQD A;  3KF8 B;  5C0X I;  1OXU A;  2ZTE A;  4GNX A;  4PG3 A;  4NXM L;  1V9P A;  1A8V A;  1ASY A;  4IPG A;  4LF6 L;  1WFQ A;  3M7N A;  1OTC A;  2VQF Q;  1QUQ B;  3GTK H;  3HOU H;  3STB D;  4NXN L;  2ID0 A;  2ZTD A;  3DM3 A;  4AH6 A;  1PH1 A;  3T1Y Q;  3PO3 G;  1EQQ A;  4DV3 Q;  2K5N A;  3FKI H;  4B3S L;  1XMO Q;  4KHP Q;  2D0P A;  1S3O A;  3A74 A;  4C3J H;  3G6E A;  3CCL A;  4LFA L;  2JA6 G;  3HOV G;  1BVS A;  4A4I A;  4JG2 A;  1PH9 A;  2ALY B;  2KCM A;  2A19 A;  4OON A;  1OXS C;  2JJQ A;  4PZ8 A;  5IP9 H;  1Q86 C;  5FLM G;  4H02 A;  2Z6K C;  2UXB L;  2K75 A;  4A3I H;  1X3G A;  1HNZ L;  2D62 A;  1A62 A;  3PUW A;  4JI7 L;  5C0X J;  4DV4 L;  4X62 Q;  2F4V Q;  4B3T Q;  1HR0 L;  3I4O A;  4C3I H;  4LFB Q;  1JE5 A;  4WJ4 A;  1C9O A;  3TS0 A;  2ZJP A;  4A3F H;  1YJW A;  3HKS A;  4BY1 G;  2QEX A;  4IFD I;  3CPF A;  3EIV A;  3OTO Q;  3BZC A;  4DV6 L;  1K8A C;  3B6Y A;  1XJV A;  3UDX A;  2N49 A;  4A3F G;  1VQP A;  1PH6 A;  1UE7 A;  3K81 C;  5J3B A;  1X65 A;  1SRU A;  2I5H A;  1Q81 C;  2E2H H;  3HOU G;  2JEB I;  4A3B H;  4JI6 Q;  5M5Y H;  5GAD C;  5M3F G;  3FKI G;  1VQ6 A;  4HJ7 A;  4DR6 Q;  1KAW A;  2MQH A;  2VQF L;  2R7D A;  1PH5 A;  2VL6 A;  3U58 A;  1YVC A;  2RF4 A;  1C0A A;  1D7Q A;  2RCN A;  3S2H H;  1CSQ A;  4GKJ Q;  1I6H H;  4GKK Q;  3HKZ E;  3T1Y L;  3TS2 A;  4R4Q A;  1FL0 A;  1XMO L;  4KHP L;  1VQO A;  3CCQ A;  1EWI A;  1HZA A;  4LNQ A;  2R7Z G;  3CCR A;  5IWA Q;  1B7Y B;  4O0A A;  5IYB H;  1KXL A;  2PNH A;  3G48 A;  3K7U C;  4C2M H;  4HID A;  4PMW A;  1K73 C;  1AH9 A;  3BZK A;  4MNO A;  4YCW A;  1VCI A;  3HKZ G;  4AIM A;  3K0X A;  1Q12 A;  4EQ5 A;  4X65 Q;  2JA9 A;  1ASZ A;  4GOP C;  1IBL Q;  2NVY H;  4LF8 Q;  4A3M H;  1M90 C;  1JJ2 A;  2UUC Q;  1Q1E A;  3UDG A;  2YTY A;  3ERS X;  4BBS H;  4X62 L;  4R4I A;  4DV1 Q;  2VZA A;  4PZ6 A;  5IYC G;  2F4V L;  4LFB L;  1PHJ A;  4L5Q A;  2PI2 A;  1UEB A;  4JV5 Q;  4JI3 Q;  2VY3 A;  4GN4 B;  1MKH A;  3D0F A;  3AFP A;  3I2Z A;  1AE3 A;  3K7A H;  3J7Z C;  3OTO L;  2JK8 A;  5FJ8 H;  1N36 Q;  3J80 c;  2GVA A;  3FP9 A;  1KRT A;  4JBK A;  2WFW A;  1L2F A;  1YHB A;  1MJE A;  1L1O B;  2K5H A;  2AWN A;  3BJU A;  1K83 H;  4YWK A;  3PCO B;  3J81 c;  3G71 A;  4HJ5 A;  1PH2 A;  1I94 Q;  2RHQ B;  1E3P A;  2I5L X;  4JI6 L;  2NZO A;  3NEL A;  4DR6 L;  1WYD A;  3H3V I;  1EYG A;  5IP7 H;  1M1K C;  1VQI A;  1PFS A;  2V1C C;  4JYA Q;  1HZC A;  4A93 H;  4GKJ L;  4GOP A;  1SR3 A;  3CCJ A;  3HOX G;  3T1H Q;  4GKK L;  3PUV A;  2QA4 A;  2NN6 G;  4NPS A;  2PQA B;  1NBW A;  1WJJ A;  5JJI A;  4AYB E;  3KF6 A;  3CF5 A;  2Q2T A;  3HOY G;  4JOI C;  3I56 A;  3RR5 A;  2CKZ B;  5IWA L;  4R4T A;  2N8N A;  1KL9 A;  3I7F A;  2UXD Q;  3UDI A;  4LUV A;  4YHH Q;  3K8A A;  4DR1 Q;  1QVG A;  2ZTC A;  1I3Q H;  5C3E H;  1I50 H;  2VQE Q;  4X65 L;  1X55 A;  3KDF B;  1Y1W H;  1IBL L;  2UXC Q;  4LF8 L;  4DV7 Q;  5EAY A;  3HFZ B;  5FJ8 G;  1WOC A;  1EIY B;  2UUC L;  1XPO A;  4DV1 L;  2IX0 A;  3FHW A;  2IX1 A;  4DR4 Q;  4JV5 L;  1CSP A;  1B8A A;  1Q1B A;  5E7N A;  4JI2 Q;  4JI3 L;  5LMU Q;  1YBY A;  1HH2 P;  3MEF A;  4OO1 G;  3W1G A;  3GDE A;  1N36 L;  2CQO A;  4K0K Q;  1QZG A;  4A3J H;  4BA1 I;  3MXN B;  4A3C G;  1E7Z A;  1UWV A;  4BXX G;  1YHQ A;  2A1A A;  1QUQ A;  1XMQ Q;  1XNQ Q;  4X66 Q;  1I94 L;  2JA5 H;  5ELN A;  1EUJ A;  4LUZ A;  2QGQ A;  3PF5 A;  3GTP H;  4ALP A;  4A3K H;  3CPW A;  1BBU A;  1E1O A;  2IT1 A;  4JYA L;  5M3M H;  2CWA A;  2BA0 A;  3A0J A;  2IY5 B;  3I55 A;  4DV0 Q;  2IHE A;  3RNU A;  3J81 i;  3T1H L;  2N78 A;  2JEA I;  5BR8 Q;  1XNR L;  2B63 H;  3TEH B;  4JI5 Q;  4DNI A;  3GO5 A;  1Y1W G;  3M4Q A;  3CD6 A;  3S16 H;  1RIP A;  1U0L A;  4JBM A;  3U4Z A;  2UXD L;  2R93 H;  3PO2 H;  4YHH L;  4A75 A;  1N32 Q;  1MJC A;  4DR1 L;  4JC0 A;  1E24 A;  3AYH B;  4LF5 Q;  4DK3 C;  2AKW B;  5M5W H;  2VQE L;  3ULJ A;  3TRE A;  3PUY A;  1N8R C;  2UXC L;  3HOZ H;  4DAM A;  1YNX A;  4DV7 L;  3DLL A;  1S40 A;  4DKA C;  2AMC B;  5GQO A;  2NN6 I;  4P72 A;  1NTG A;  3IRB A;  4DR4 L;  1CUK A;  4DR3 Q;  5C44 H;  4JI4 Q;  4JI8 Q;  5LMU L;  4JI2 L;  2MO0 A;  4DR7 L;  2I5M X;  4TVA B;  1PYS B;  2Q2I A;  2JA8 H;  3J7A 5;  1VS0 A;  4HJ8 A;  1LUZ A;  1HNX Q;  1TWG H;  3ZJY C;  1VQ5 A;  2VUM H;  4K0K L;  1PVO A;  2MNA A;  1KC8 C;  3TRZ A;  1UE5 A;  4LF7 Q;  1XMQ L;  2Z6K A;  4DV2 Q;  4HIM A;  1I5F A;  4X66 L;  2K5V A;  1PV4 A;  1XNQ L;  3HOW H;  2CWP A;  1GO3 E;  1LYL A;  2KHI A;  3JAM c;  5IP9 G;  2HQL A;  1TWC H;  1L1O C;  2VW9 A;  2OQK A;  1VQE A;  4HJ9 A;  2CCZ A;  1NMF A;  4GN5 A;  4A3I G;  3PUZ A;  4APV A;  2OCE A;  1VQF A;  5GAE C;  4JI0 Q;  3CCU A;  2BH8 A;  4IJH A;  3OW2 A;  4AQY Q;  2B63 G;  5DLQ E;  3F2B A;  3CCV A;  1YI2 A;  1W2B A;  1QZH A;  3CC4 A;  4OWW B;  3S14 H;  1HZ9 A;  4DV0 L;  2ZJQ A;  1N34 Q;  2Q2U A;  1OXV A;  4C3H H;  1XPU A;  2R93 G;  3W5O A;  1YIT A;  1E1T A;  3M9B A;  2B3G A;  5AJ3 Q;  5BR8 L;  3M4O H;  1P8L A;  4RMF A;  4JI5 L;  4JCV E;  3ULP A;  5JEA G;  3NEN A;  5HY6 A;  3CCE A;  3M85 A;  3HOZ G;  4A3E H;  2YTV A;  4QIW E;  1Y1V H;  4OX9 Q;  2WAQ E;  1E22 A;  1VQ7 A;  4IOA A;  2R7F A;  1N32 L;  2LXJ A;  4A3L H;  5IYD H;  2ES2 A;  3I4M H;  2HHH Q;  5LMN Q;  4A3B G;  3U50 C;  5C44 G;  4IOC A;  4LF5 L;  2NVX H;  1SMX A;  3KFU A;  2KHJ A;  1VQM A;  2JA8 G;  2HT1 A;  2BH2 A;  1CKN B;  1YHA A;  3AFQ A;  1GVP A;  1Z47 A;  4X64 Q;  3KLW A;  1OXT A;  2E2I H;  2VUM G;  3I4N H;  1VQJ A;  2K50 A;  4JI1 Q;  1L1O A;  1KQS A;  1K0R A;  3KJP A;  2A8V A;  3E0E A;  4A3D H;  2OTJ A;  4DR3 L;  4JI4 L;  2WAQ G;  4JI8 L;  5M5X H;  5C4X H;  4DV5 Q;  3PIP A;  4LFC Q;  5IY0 A;  1YJN A;  3RLO A;  1U5K A;  4UP9 A;  1HNX L;  4O2D A;  2JA7 H;  4EX5 A;  2R92 H;  3A5U A;  1KHI A;  2DUD A;  1X9N A;  3A5Z B;  4LF7 L;  2EIF A;  4MTN A;  4OWX B;  5IYB G;  4DV2 L;  4HIO A;  1D8L A;  1J5E Q;  3KOJ A;  3F2C A;  1UE1 A;  2AHO B;  2WP8 J;  4OWT B;  2Z0S A;  4GN3 B;  1XNR Q;  2BA1 A;  2PQA A;  3AQQ A;  1SE8 A;  4IJL A;  1VQ9 A;  3CC7 A;  3ULL A;  4LF9 Q;  4JI0 L;  4A3M G;  5GAG C;  4AQY L;  1YIJ A;  4BBS G;  1JT8 A;  4DK6 C;  3GTQ H;  3EBE A;  5IE8 A;  3PUX A;  1N34 L;  4IFD G;  1KRS A;  3H15 A;  4GNX C;  4GLA C;  5IYD G;  3JAM i;  4A3L G;  3NBH B;  1NMG A;  5AJ3 L;  3UDF A;  4AYB G;  3PO3 H;  3KDF A;  5K36 G;  1IXR A;  2EQS A;  2XTI A;  1HR0 W;  5FLX c;  2ASB A;  3H0G H;  4OX9 L;  4J15 A;  2E8G A;  4DR7 Q;  1EOV A;  2ZJR A;  3TQY A;  1PH7 A;  2JA6 H;  2MFI A;  2VS1 A;  2OTL A;  2HHH L;  3STB C;  5LMN L;  3HOV H;  2RHS B;  3KJO A;  2YTX A;  3CC2 A;  3S2D H;  4DR5 Q;  4R4C A;  5C4X G;  2PMZ E;  4GLV B;  1Z9F A;  1YJ9 A;  1JMC A;  4X64 L;  5IP7 G;  1VQG A;  1DGS A;  2ZM6 Q;  4JI1 L;  4A93 G;  1Q46 A;  5GRO A;  1KD1 C;  1NY4 A;  4JOI A;  4IPH A;  1PA6 A;  3L0O A;  4DV5 L;  4YWM A;  4LFC L;  4LW1 A;  4DUZ Q;  4KLK A;  3H3V H;  2D0O A;  2HIV A;  1IYJ B;  1G51 A;  3J80 i;  4BBR H;  4GNX B;  1N9W A;  2WB1 E;  1SFO H;  1VQL A;  3L7Z C;  3UE1 A;  5JJK A;  1OXX K;  1W3S A;  4JBJ A;  4P71 A;  4POF A;  3PIO A;  5ELO A;  4XIG S;  1J5E L;  2GN5 A;  3AEV A;  3S15 H;  4A3G H;  4Y7N H;  1Q7Y C;  1V43 A;  2Y0S E;  5C3E G;  3J81 j;  4PZ7 A;  4BY7 H;  1SN8 A;  4WJ3 M;  2UUA Q;  1GM5 A;  4LF9 L;  5M3F H;  1XTD A;  2WB1 G;  1N33 Q;  3D31 A;  1IBM Q;  1L0W A;  2JQO A;  4MZ9 A;  1NE3 A;  3H0G G;  3CAM A;  3F1Z A;  4R1J A;  3CCS A;  3M3Y H;  4OXP A;  3GTG H;  2E2J H;  1VQ4 A;  2PI2 E;  2IHF A;  2Y0S G;  4A3J G;  5JEA J;  4UY8 C;  3ER0 A;  3E9H A;  5C4J H;  1FJG Q;  1EQR A;  2UU9 Q;  3JC6 6;  1TWA H;  4FDB A;  4NB3 A;  4UP8 A;  3UE0 A;  2R7Z H;  4IPC A;  1H95 A;  2JA5 G;  3CQZ H;  1HNW Q;  1JJC B;  1PH8 A;  1Q8K A;  3PGZ A;  1K9M C;  5GAH C;  1AE2 A;  4DR5 L;  4A3K G;  4UP7 A;  2F3I A;  3CXC A;  3S1R H;  2E5L Q;  4BA2 I;  2ZM6 L;  4LUO A;  4BBR G;  2NVT H;  1PYB A;  2C35 B;  3WWV A;  1X6O A;  4IPD A;  3RLF A;  5M3M G;  1IBK Q;  4A76 A;  1MIU A;  1PH3 A;  2KEN A;  3KYH C;  5IYC H;  4DR2 Q;  1B70 B;  4DUZ L;  2L15 A;  1WI5 A;  4A3G G; 
#chains in the Genus database with same CATH topology
 1X3F A;  2Q2H A;  4KJN A;  3CME A;  1GJX A;  1DON A;  3R5X A;  1UUP A;  3H3V C;  1FVI A;  2Q8R E;  4MV6 A;  2JEI A;  3H4D A;  2UVV A;  2KCC A;  4YAK B;  1DIK A;  2WB1 B;  4YJ2 F;  1X3E A;  2YZM A;  3M9M B;  3W2D A;  3L2P A;  3T53 B;  4MTK A;  4K0K H;  3NEM A;  4B3R Q;  5KT2 A;  1P16 A;  5G3L F;  1QG7 A;  4P75 A;  5HGT A;  3GTL H;  1XNQ H;  1GKH A;  1T94 A;  2EYJ A;  2F03 A;  2WTF A;  2IP4 A;  2MO1 A;  3MJF A;  4RNN A;  3GII A;  4TQU S;  2JSO A;  1SE2 A;  3HOW G;  4DV0 H;  3FDT A;  3Q8P B;  1SFO B;  5L1L A;  2R7K A;  4BBR B;  2A68 C;  3E6Z X;  4XZ3 B;  4RWS C;  1SRO A;  5BR8 H;  4S3S A;  2JN4 A;  1ZHQ A;  2FK1 A;  3GTJ H;  4LF6 Q;  1CHQ D;  1WCM G;  2LSS A;  1O7L A;  4K2L A;  2NVQ H;  2K5W A;  4YCU A;  3HP3 A;  4BY7 B;  1B44 D;  2R6G A;  1STB A;  1SNM A;  3OMC A;  4MAM A;  3CVZ A;  4UPA A;  4XTC S;  2B63 A;  4BWG B;  2C22 A;  2CH4 W;  2RA4 A;  3KK7 A;  5KG0 A;  3RN5 A;  4J1M A;  5M5W B;  4A3E G;  1EEI D;  5A2Q E;  2N3S A;  2R84 A;  4KY5 A;  4LFA Q;  1LT4 D;  3SGI A;  1JB7 A;  4DR3 H;  1UNN C;  3VYR A;  1VQA A;  1TWH H;  4ZQ3 A;  3RZO H;  3I72 A;  3A8J E;  3I4N G;  3EFX D;  2GVB A;  2K04 A;  3VR4 A;  3K80 C;  3M9O B;  1EHI A;  1LT3 D;  3RN2 A;  1HR0 Q;  4QL5 A;  2M2L A;  1HA5 A;  5C8Y F;  3M4P A;  2VUM A;  4ED8 A;  3PVX A;  1J6Q A;  3F8T A;  1B04 A;  5EWE A;  3EPI A;  3RLN A;  4J9R A;  1SJH D;  2VB2 X;  1ILQ A;  5M9O A;  4DV6 Q;  1TWC B;  4C1N I;  4RG1 A;  4O3R A;  1KJ8 A;  1QWY A;  2KVM A;  5CC4 A;  2D5D A;  3TII A;  1G2T A;  2NBF A;  3PSI A;  1CQV A;  1VQD A;  4EGQ A;  2W8L A;  4C2M A;  1A8V A;  4IPG A;  4BS9 A;  2QDB A;  3K5M A;  3V2T A;  3CU7 A;  2VQF Q;  4FVM A;  4Q43 A;  3MZ5 A;  4NXN L;  2W9A A;  2FPG B;  4ED1 A;  5LMN H;  1S10 A;  1PH1 A;  3T1Y Q;  3FKI H;  4B3S L;  4DA2 A;  1CQJ B;  4IUN A;  4PMB A;  3DEP A;  2D0P A;  4X64 H;  1S5E D;  2C9O A;  3BG3 A;  2YYA A;  3R5H A;  3SE0 A;  2SOB A;  2F3W A;  4MV1 A;  4JI1 H;  1BBX C;  4Q0Y A;  1AZP A;  1AZQ A;  5FLX W;  4JG2 A;  2ALY B;  4DV5 H;  2A19 A;  4OON A;  3RB0 A;  1UC8 A;  4FP5 D;  1HQR D;  1X3G A;  3SE7 A;  2D62 A;  4JI7 L;  4UHV A;  5C0X J;  4DV4 L;  2DWC A;  2W6N A;  5KFF A;  5KT4 A;  2RKS A;  1C9O A;  2F0Q A;  1XNR H;  2HQE A;  1YJW A;  3L4K A;  3HKS A;  4IFD I;  2FK3 A;  4DL7 A;  1IW7 C;  2BE5 C;  3B6Y A;  3LX0 A;  2V5A A;  3UDX A;  1PFM A;  2C2E A;  4Y8V B;  2OEO A;  1PH6 A;  5K2M A;  1IKL A;  5J3B A;  2PPB C;  1SNO A;  5A35 A;  1SRU A;  2PMZ A;  2NYZ D;  3HOU G;  3A8I E;  2AUJ D;  4A3B H;  3S17 B;  1BDO A;  5M5Y H;  1W6J A;  2SNM A;  1PZK D;  3UQ8 A;  2F0I A;  1KDC A;  2DNC A;  2B8F A;  4CDD C;  2MQH A;  2ZDQ A;  5J39 A;  2CQY A;  2VL6 A;  4C3J G;  2RF4 A;  5KG4 A;  3J7Y W;  1S4Z A;  1GYF A;  2WB1 A;  1TY0 A;  3E5S A;  5KFU A;  5IIF A;  2JA6 B;  1XMO L;  2RVL A;  3BQ2 A;  2A6H D;  1KTK A;  3CCQ A;  1BXR A;  1EWI A;  3L9A X;  3QJY A;  1SDF A;  5IWA Q;  2B2V A;  1PRT B;  3FRP B;  3G48 A;  4HID A;  1K73 C;  1AH9 A;  4YCW A;  3UI2 A;  4AIM A;  1VCI A;  1W6K A;  3HKZ G;  3K0X A;  1Q12 A;  4A3F G;  1F2Z A;  2JA9 A;  4WBN F;  4GOP C;  2NVY H;  2W6O A;  2NUC A;  5KT5 A;  1TS3 A;  1M90 C;  3UDG A;  2YTY A;  4DV1 Q;  2R61 A;  3RZD B;  4IQZ A;  4LFB L;  1ICF B;  1PYW D;  1SFO A;  1EZ6 A;  4IFD H;  5C5L A;  4DGZ A;  4X3T A;  5CYU A;  5LHY 1;  3MXU A;  3OTO L;  2JK8 A;  1HHV A;  3J80 c;  2EY1 A;  3FP9 A;  1ILP A;  4JBK A;  5F9N A;  1YHB A;  1MJE A;  2VA3 A;  2B2Y A;  2AWN A;  5M3F B;  3JRX A;  1K83 H;  3V6H A;  2QIL A;  5J1Z A;  2FIN B;  1VDZ A;  2RHQ B;  4JI6 L;  4HSP A;  4ZLT F;  4DR6 L;  1WYD A;  1WTR A;  3MR2 A;  2F1M A;  4V0B A;  5IP7 H;  1SAP A;  5L37 A;  4JYA Q;  5C4J B;  2A68 D;  3K6O A;  3VYU A;  4GKK L;  3PUV A;  4YIJ A;  2QA4 A;  2NN6 G;  1WJJ A;  1EWC A;  3Q23 A;  5JJI A;  1JOO A;  1FYC A;  3DHQ A;  3SK4 A;  4FXD A;  3P1H A;  3D8G A;  4HN7 A;  1K1S A;  2PN1 A;  2G5D A;  4F7X A;  1ZYR D;  2M00 A;  2P5Z X;  1R4P B;  3H94 A;  4DAP A;  3QOL A;  3K8A A;  4UCT A;  5C5M A;  4PWQ A;  1OWT A;  4UCV A;  1IBL L;  1EU4 A;  3DM1 A;  4XXE A;  1TWC A;  4ULL A;  2ZDH A;  3T5L A;  1EIY B;  2E2H B;  4UDU C;  2IX1 A;  4ABN A;  4DR4 Q;  1T5E A;  3H20 A;  2KCN A;  3RV4 A;  1B8A A;  4CJ0 B;  1AN7 A;  3PIO 3;  4YR0 A;  3D4W A;  2MHV A;  1EU3 A;  1IYU A;  1SEI A;  4NDX A;  4EYH B;  4LH7 A;  1QZG A;  1I4P A;  3BDL A;  2E76 C;  4A3C G;  4QIW B;  2L12 A;  3S2H B;  1TAE A;  5EPK A;  4J9S A;  4LSA A;  2VXW A;  1YNJ C;  1F9P A;  3R8B A;  4ME6 A;  5ELN A;  2FFK B;  4LUZ A;  4QB4 A;  3GTP H;  4A3K H;  3UFX B;  2RDH A;  4ECR A;  1QIL A;  1I7L A;  3GP7 A;  3IFD A;  1HTP A;  2BDN A;  2C28 A;  3GQC A;  3R2I A;  1F9R A;  2CWA A;  3A0J A;  3I55 A;  3RNU A;  4GC6 A;  4G57 A;  4C5B A;  2FP4 B;  5C5J A;  1CK1 A;  1GUO A;  1EUD B;  4A3M B;  4CJ1 B;  2B63 H;  4JI5 Q;  3WO0 A;  1Y1W G;  3QFF A;  4IUV A;  4HSV A;  3S16 H;  1U0L A;  4Z9C B;  5J2U F;  4J6H A;  3U4Z A;  4NXN H;  4DR1 L;  2A73 B;  1EYA A;  4LSX A;  3A7A B;  3AYH B;  2AKW B;  4KJO A;  3JAM E;  4NMZ A;  3ULJ A;  2VQE L;  4MN3 A;  4ID6 A;  5FO9 B;  5DQI A;  4B3S H;  1N8R C;  1M6V A;  3HOZ H;  2HVR A;  1STY A;  2G9D A;  1CUK A;  1CTM A;  3SXH A;  2BQ3 A;  5C44 H;  1HUN A;  2DJF C;  4JI8 Q;  5LMU L;  4JI2 L;  2I5M X;  4RGM A;  3ONA B;  4LAA A;  5KFA A;  4HJ8 A;  1LUZ A;  2KED A;  2Z1C A;  2VUM H;  1PVO A;  1TWH B;  1CM9 A;  3X3M A;  4JI7 H;  3HOW H;  1RJT A;  2CWP A;  1QOH A;  2PO4 A;  3R93 A;  1IW7 D;  1VQE A;  2OQK A;  5JOB A;  2JA6 A;  2BE5 D;  2RSO A;  3QR8 A;  4GN5 A;  3OMG A;  1PRT D;  2BH8 A;  3OW2 A;  2EYO A;  3NSW A;  3F2B A;  4OWW B;  3S14 H;  1I3Q B;  1W2B A;  3CC4 A;  3M4I A;  4RKL A;  1I50 B;  1NAP A;  1N34 Q;  1OXV A;  2R93 G;  2O5I C;  3M9B A;  2B3G A;  3PIP 3;  4DL3 A;  1ENF A;  4OEM B;  5GON F;  3MA2 B;  5JEA G;  5KND A;  3OHB A;  2IA6 A;  1QJO A;  3CCE A;  4KHV A;  4ED7 A;  1JWS D;  4A3E H;  3EYY A;  3RGZ A;  1VQ7 A;  4IOA A;  2HHH Q;  3U50 C;  4EFE A;  3KFU A;  2KHS A;  4YQW A;  4ZOL F;  1UNS A;  1XMO H;  2BH2 A;  1CKN B;  2LY7 A;  1HQM C;  5JQW A;  1Z47 A;  4DFA A;  3I4N H;  5CV5 A;  2WYO A;  1VQJ A;  2K50 A;  2I46 A;  1HTL D;  2MP1 A;  3KJP A;  3V05 A;  2I80 A;  5C4X H;  2NU8 B;  3PIP A;  3FEW X;  4E4T A;  1I4R A;  1B9M A;  1U5K A;  4UP9 A;  3T4A C;  1IYV A;  2YZG A;  2ZXO A;  4EX5 A;  4H7B A;  5KYI A;  4EG0 A;  2PW5 A;  1D5Z C;  1KHI A;  4DN4 M;  1I4G A;  2PZU A;  5IYB G;  4MTD A;  4EEY A;  4B3T H;  4LFB H;  2ZDG A;  1BO0 A;  1UE1 A;  3NPP A;  5KFQ A;  5LL6 b;  2IBK A;  1XTC D;  3AQQ A;  1SE8 A;  1VQ9 A;  3CC7 A;  3ULL A;  3OTO H;  5CV6 A;  3H6M A;  1SND A;  4A3M G;  4JI0 L;  5GAG C;  4LF9 Q;  1KAA A;  4O3N A;  4FYD A;  4DK6 C;  1ZHS A;  4H13 C;  1CE8 A;  2H1E A;  3GV3 A;  5E4W C;  1S5D D;  5IYD G;  2N88 A;  4JI6 H;  1FNV A;  1HPC A;  2YS7 A;  1JIC A;  3RV3 A;  3OWF A;  4DR6 H;  1IXR A;  3C1E A;  1EY8 A;  1KAB A;  2E2H A;  1F77 A;  4OX9 L;  4ILW A;  4N8F A;  2JA8 B;  1C4Q A;  1EOV A;  2PBZ A;  3TQY A;  5JVD F;  2YL2 A;  2OTL A;  4G7Z C;  4TRD A;  4GKK H;  2K6A A;  3KJO A;  1BGW A;  4DR5 Q;  3TSS A;  2J6S A;  2ZM6 Q;  1VQG A;  3K57 A;  4QIW A;  3U9T A;  3OHA A;  2R85 A;  1NY4 A;  3H09 A;  4IPH A;  3L0O A;  3H3V H;  1SFO H;  4BBR H;  4YP3 A;  1IBL H;  1VQL A;  2P0A A;  3L7Z C;  4C3H B;  1SNC A;  4CHT B;  2F0G A;  5ELO A;  3TQT A;  5LYJ F;  2GN5 A;  1V43 A;  5EKI A;  5C3E G;  4BY7 H;  4MA5 A;  5DG8 A;  1B50 A;  1SN8 A;  4WJ3 M;  3K5L A;  5JVL A;  1X3Q A;  2WAC A;  1SYC A;  3N40 P;  2AQ4 A;  4JV2 A;  1JWM D;  1IBM Q;  3I4M B;  1STG A;  2JQO A;  5JUM A;  3CAM A;  3F1Z A;  1ENC A;  4IAL A;  1YNJ D;  4KD3 A;  4R1J A;  3T56 B;  3GTG H;  2BQR A;  3DUZ A;  2E2I B;  2F0W A;  2Z6B A;  1K83 B;  4WRD A;  4YR2 A;  3G6V A;  4K14 A;  4Q0F A;  5IGG A;  1S97 A;  4UP8 A;  2C5C A;  1QCB D;  4IPC A;  1O7Z A;  2ALZ A;  1II3 A;  1ICW A;  1JJC B;  1EIG A;  5EWG A;  1Q8K A;  2R92 B;  1AE2 A;  3MTS A;  1ESF A;  2IL8 A;  2E5L Q;  2F3I A;  4BA2 I;  1TWH A;  1PYB A;  4MA0 A;  4IPD A;  4ZKC B;  5KFS A;  1PH3 A;  5C3W A;  4DR2 Q;  4JUZ A;  4DR1 H;  4TV9 F;  4DUZ L;  1EWH A;  4YWL A;  2VQE H;  2X6G A;  2E74 C;  5JJZ A;  4FF1 A;  1LM0 A;  1UE6 A;  5E1F A;  4DUY Q;  1KJQ A;  4IHJ F;  4LF4 Q;  5COY A;  1I3Q A;  1KLU D;  4LWC A;  4B3M Q;  1G6P A;  1I50 A;  4L5R C;  4JI2 H;  5LMU H;  5K5P A;  2H5X A;  4QGU A;  4L1K A;  5H80 A;  1VBH A;  1E0B A;  4KI0 A;  5EQ0 A;  2UUA L;  5EPJ A;  3PW5 A;  1JLL B;  3PW7 A;  4QWD A;  4EGJ A;  4Q45 A;  2F52 A;  3CRK C;  1QVC A;  2W57 A;  1YZ6 A;  1H9R A;  1RJQ A;  2F0N A;  3NXW A;  1DZ1 A;  2QDL A;  2NN6 H;  2D2C C;  3S1M H;  3OYY A;  1CKN A;  1Q82 C;  2SDF A;  3EN2 A;  4J0M A;  2XGT A;  4MV8 A;  4TSS A;  2Z8L A;  1EY0 A;  4GLX A;  4TKO B;  5DQG A;  3GTP B;  4J9Q A;  4A3K B;  1HNW L;  1LTS D;  4P73 A;  4P74 A;  5LMN W;  1IZ6 A;  4Y52 H;  3MXP A;  5KG7 A;  1BBW A;  1HJP A;  1Y14 B;  4RB3 C;  2OWO A;  1HZB A;  2B2U C;  1IBK L;  4A3G B;  5JJL A;  4TQR A;  4Y7N B;  2ICE C;  5IGE A;  2ZT9 C;  1Z2O X;  3SK8 A;  3TP6 A;  3TME A;  4DAY B;  3DEO A;  2FMC A;  1GD7 A;  3IL8 A;  5ELF A;  3MHB A;  3L4J A;  2FJZ A;  2YS6 A;  3TZU A;  3S17 H;  1EYC A;  1JQY D;  3PF4 A;  4A3C H;  5CBA E;  4DAV A;  2E2J B;  1B3A A;  2ATW A;  3KBG A;  3I4M G;  3K3V A;  5LXT F;  3T5K A;  2EXD A;  1U4R A;  3E9I A;  4B3R L;  5IYZ F;  4QY7 A;  1STH A;  4N8X 1;  3GV7 B;  1JJG A;  2EYF A;  4GKJ H;  4ECQ A;  1A3T A;  5COR A;  1RL2 A;  1VQ8 A;  1D2B A;  1PTO B;  4O42 A;  1BKB A;  1LTL A;  5FLM H;  1OO9 B;  3WOE A;  3VDY A;  2NVT B;  4I7H A;  2XCP A;  3MC0 B;  3MXN A;  2R92 G;  2VPS A;  2XIG A;  2E2D C;  3QO2 A;  3Q8Q B;  4JI0 H;  4QWC A;  3CW2 C;  4POG A;  1X56 A;  2M05 A;  2KJX A;  1WCM B;  2VNU D;  5KFM A;  2VUG A;  3RZD H;  3EA6 A;  4RH6 A;  5C0X I;  2TMP A;  5CB4 F;  3GTO B;  2YU9 B;  5KFI A;  3GTM B;  3HZX A;  1ASY A;  1X32 A;  4LF6 L;  2DIK A;  4ZUI A;  5HV6 A;  3QB3 A;  4OX9 H;  2IMW P;  1QUQ B;  2L5T A;  2NVY A;  3S1Q B;  3DM3 A;  2B39 A;  2OH2 A;  5KT7 A;  4ECW A;  2X6L A;  1LAC A;  4KHP Q;  2GPW A;  1S3O A;  1SYD A;  3CCL A;  4LFA L;  4B9W A;  2C2D A;  1JB3 A;  5FKA C;  1KNA A;  4A4I A;  2OT2 A;  1M0T A;  3MR3 A;  1V4Y A;  1OXS C;  2JJQ A;  2E2I A;  1K83 A;  4XQQ A;  4N9P A;  1E4G T;  4H02 A;  3VMM A;  3A56 A;  2AUK A;  2K28 A;  4DNT B;  3JSL A;  1WTQ A;  5KG1 A;  4PQX A;  4X62 Q;  5ELD A;  2F4V Q;  1HR0 L;  3MR5 A;  3S1N B;  1PXU A;  3TS0 A;  2ZJP A;  2KOL A;  4BY1 G;  1PZJ D;  2B2V C;  3CPF A;  1GHJ A;  3TIN A;  2KQ3 A;  4RHS A;  4DV6 L;  1XJV A;  3BA8 A;  5JEA H;  3JZI A;  1GLV A;  1WR2 A;  4RA8 A;  1M0W A;  1X65 A;  1EOT A;  2I5H A;  1BQQ T;  1S5B D;  2K05 A;  4EQP A;  2E2H H;  4BWS C;  2ZJT A;  1VQ6 A;  4IUR A;  2VQF L;  2R7D A;  4FO2 A;  4DR7 H;  3GQB A;  1RCV D;  1JE4 A;  2I8C A;  2RCN A;  3S2H H;  4HMJ A;  3HKZ E;  3T1Y L;  3TS2 A;  2B2Y C;  4R4Q A;  4RNO A;  4HCS A;  1STN A;  1VQO A;  5DQH A;  3BZD B;  1HZA A;  3J80 E;  2BCO A;  3A55 A;  1T36 A;  3A54 A;  1B7Y B;  4O0A A;  1ET9 A;  5IYB H;  4DL6 A;  1EQT A;  4C3I G;  2FLN A;  2K7V A;  2TSS A;  4DUZ H;  4ECV A;  2F0S A;  3BZK A;  3GV8 B;  1SSO A;  4EQ5 A;  2ZXP A;  2A69 C;  1SEB D;  4ETS A;  4A3M H;  1SE4 A;  1Q1E A;  4K6D A;  5KFO A;  2YCH A;  3GTP A;  5IYC G;  2F0K A;  1GUN A;  1PHJ A;  3KAL A;  4PV1 C;  5DAU A;  4JV5 Q;  3A7L A;  5D65 A;  1EY7 A;  3E0J A;  1MKH A;  3D0F A;  4GN4 B;  4U68 A;  2EJM A;  3K7A H;  1AE3 A;  2UUA H;  5FJ8 H;  3H40 A;  3GTK B;  3HOU B;  2R6F A;  1ZYR C;  5AFW A;  3HS0 C;  1L1O B;  4MV9 A;  1F2M A;  3VR2 A;  1HFG A;  5DM7 3;  3J81 c;  1I94 Q;  5KFB A;  4DAY A;  4IWY A;  1E3P A;  4K5V A;  4B08 A;  4C3J B;  4OHJ A;  2NZO A;  3GTG B;  1M1K C;  4EBD A;  2V1C C;  3BJY A;  4PMC A;  1HZC A;  3ORR A;  3NBH A;  3V4Z A;  1HNW H;  4R8U B;  3T1H Q;  3TDQ A;  4NPS A;  3V96 A;  3BA9 A;  2SEB D;  3NTH A;  3MR6 A;  2Q2T A;  3HOY G;  4O3Q A;  1PTO D;  2RDI A;  1IBK H;  1EY5 A;  4A3F B;  3HKZ B;  5IWA L;  4R4T A;  2N8N A;  4MV3 A;  1KL9 A;  2UXD Q;  2B2U A;  4LUV A;  1C30 A;  2ZTC A;  2ZXR A;  1I3Q H;  4YJ3 F;  4JK1 C;  1UC9 A;  2BR0 A;  2PW7 A;  5I6Y A;  5C3E H;  1I50 H;  2GLT A;  4CKC A;  4KTA A;  2UXC Q;  3GIL A;  4DV7 Q;  3HFZ B;  2WE6 A;  4DV1 L;  2IX0 A;  1XX8 A;  3F2U A;  3K5N A;  3IG0 A;  2FE3 A;  1CSP A;  4XT3 B;  4YAJ B;  1WCM A;  1YBY A;  4LH6 A;  4K6L A;  1C48 A;  4OO1 G;  2L11 A;  3GTO A;  1AN8 A;  2X0S A;  1B9N A;  2YU9 A;  3GDE A;  3GTM A;  2CQO A;  4B3R H;  1O75 A;  3U9O A;  1YHQ A;  1XMQ Q;  1QUQ A;  4X66 Q;  5L1I A;  4M9U A;  3VR5 A;  1LTA D;  1EUJ A;  2IX3 A;  5D1O B;  2O5J C;  2QGQ A;  2O4X A;  3PF5 A;  5KFP A;  1WSC A;  3CPW A;  4CC6 A;  3F8N A;  5D3D A;  4JYA L;  3S1M B;  4UAI A;  2BA0 A;  1JKJ B;  3H4B A;  3PW2 A;  3J81 i;  1HCZ A;  3Q2O A;  2JEA I;  1W93 A;  3FDS A;  2ICI A;  3KAK A;  1SNP A;  4BBS B;  1KC7 A;  4DNI A;  3GO5 A;  3DXJ C;  1BCP B;  4NLG A;  4LF6 H;  1D6E C;  3CD6 A;  1RIP A;  1Z7T A;  4IUU A;  4JBM A;  1SBB B;  2C00 A;  3GID A;  5KG3 A;  2ATL A;  1N32 Q;  3LWU A;  1IL8 A;  1F2Y A;  4JC0 A;  1K1Q A;  4LF5 Q;  2B8G A;  2V4D A;  3TRE A;  3K5I A;  3PUY A;  3J81 L;  1PRT C;  2NU9 B;  4ZYS A;  3OWE B;  1RF2 D;  1YNX A;  2N55 A;  1G91 A;  2IW3 A;  4LFA H;  3IRB A;  2J6T A;  4DR4 L;  4JI4 Q;  1G2S A;  1U4P A;  1PYS B;  2JA8 H;  3J7A 5;  1Y8O B;  2XN9 C;  1LT6 D;  1HNX Q;  2L4N A;  2LFN A;  3W3A A;  4ODG A;  1KBL A;  4L63 B;  4LF7 Q;  3HBL A;  4DV2 Q;  4XX0 B;  1I5F A;  1PV4 A;  1N48 A;  1D5X C;  3N52 A;  5KFZ A;  1GO3 E;  1HR0 H;  5IP9 G;  2VW9 A;  5EBC A;  2CCZ A;  4IZO A;  4A3I G;  4APV A;  5CAE B;  1RYS A;  2OCE A;  2B2W C;  4DV6 H;  4AQY Q;  2VR1 A;  1YI2 A;  3IFT A;  3CCV A;  4G7H C;  2XCL A;  1QZH A;  4F50 A;  2DPJ A;  2Q2U A;  4C3H H;  1Y1W B;  5HUR A;  1E1T A;  5BN3 A;  5AJ3 Q;  4IRC A;  2B2T C;  1PFB A;  1P8L A;  4NW2 A;  4RMF A;  4ZAI A;  4JI5 L;  3VPD A;  2RBM A;  4ECY A;  3C1F A;  2HGS A;  4QIW E;  4F88 A;  2VQF H;  4M7E A;  2CW0 D;  2R7F A;  2LXJ A;  4A3L H;  4HMI A;  3I4M H;  2KEE A;  1MGS A;  3DWQ A;  3G7L A;  4IOC A;  1C8C A;  1T5X D;  1B3Q A;  3T1Y H;  1XXG A;  4HAE A;  1VQM A;  3NK9 A;  1TR5 A;  3AFQ A;  1GVP A;  3GTK A;  1S5F D;  2E2I H;  2R87 A;  3FMA A;  3BQ0 A;  3S9W A;  1X3P A;  3EJI A;  5KFY A;  1ET6 A;  1L1O A;  4HNT A;  4P2C B;  3DWP A;  2OTJ A;  2RGR A;  2WAQ G;  4JI8 L;  1PX2 A;  1FR3 A;  1JX4 A;  4CKB A;  4LFC Q;  1Z2P X;  1EZ8 A;  2A69 D;  4XQJ A;  5KFC A;  5M3M B;  3QZ7 A;  3GTG A;  2R92 H;  1GHK A;  4UCU A;  2DUD A;  1B53 A;  1X9N A;  4XQN A;  4MTN A;  1STA A;  1QE6 A;  2CVR A;  1J5E Q;  4R8U A;  2K5Q A;  2AHO B;  3ITP A;  4OWT B;  1O78 A;  1TS2 A;  2A74 C;  5C3X A;  5KIX A;  4IJL A;  5KNC A;  2W6Q A;  2R93 B;  4BBS G;  1JT8 A;  1Z2N X;  3HKZ A;  5IE8 A;  3O13 A;  3PUX A;  1ZET A;  3WOF A;  5IOC A;  1N34 L;  4KY6 A;  5IT9 E;  4GNX C;  4O2B F;  4DL4 A;  1WTV A;  4MV4 A;  5K36 G;  1RK6 A;  3PQI A;  1KEE A;  2HVS A;  2EQS A;  2ASB A;  4J15 A;  2JEJ A;  3R2T A;  2FMA A;  1PH7 A;  3KAJ A;  2MFI A;  2UVR A;  2VS1 A;  4NP5 A;  2HHH L;  3SK6 A;  1TWG B;  4B9X A;  2QEJ C;  3SHL A;  3KXY T;  1ONL A;  3TP7 A;  4GLV B;  1Z9F A;  1YJ9 A;  1JMC A;  3FVQ A;  5LOV F;  5IWA H;  5GRO A;  4CBV A;  3OUZ A;  1E2V A;  1B6R A;  1PA6 A;  1E2Z A;  4KN4 C;  1JWU D;  4I4T F;  4LW1 A;  3OSN A;  1GOZ A;  4ZK9 B;  5D1O A;  5BPH A;  1LO5 D;  3G6Y A;  3J80 i;  1G51 A;  4GNX B;  2W8K A;  1F2L A;  1WTW A;  4JBJ A;  5ELB A;  4ZUJ A;  5E3F A;  2YZN A;  5LA6 F;  4DV1 H;  3PIO A;  4I7A A;  4J9N A;  4A3G H;  1BCP D;  4Y7N H;  4EQO A;  1TT2 A;  4R9W A;  1GM5 A;  1RD9 D;  1Y1V B;  5KNB A;  4LF9 L;  5EOY A;  5A2Q W;  3J80 L;  1N33 Q;  1M8A A;  3K7A B;  1HA6 A;  5D3I B;  2XGP A;  1NE3 A;  3H0G G;  3GLK A;  1DYQ A;  2W7P A;  2E2J H;  1VQ4 A;  1IHZ A;  4IZ8 A;  3GIJ A;  2PI2 E;  2Y0S G;  5DLF A;  1CI3 M;  1S5C D;  1FJG Q;  2UU9 Q;  1DV2 A;  4NB3 A;  4JYA H;  5M5X B;  1H95 A;  2JA5 G;  2J6U A;  2EOT A;  3GIP A;  5LL6 S;  4HCE A;  3NTI A;  2MPM A;  2F0H A;  1PH8 A;  2JA7 B;  2R82 A;  3SR1 A;  1MBY A;  5GAH C;  1K9M C;  2R8I A;  4DR5 L;  1A15 A;  1IOV A;  1PTO H;  3CXC A;  4HED A;  4QF4 A;  2ZM6 L;  4LUO A;  2NVT H;  4DV4 H;  1S03 G;  2C35 B;  4LK1 C;  3WWV A;  5M3M G;  1PMR A;  2DN8 A;  3SK5 A;  1WTP A;  1MIU A;  1CZG A;  5IYC H;  4K8J A;  1L0Y B;  1PZI D;  1WH2 A;  2F0E A;  4APM A;  4G3I A;  1A2U A;  1VQH A;  2Z9H A;  4O4H F;  4ZHQ F;  4I65 A;  1WCM H;  5DGA A;  1IL2 A;  4OO1 I;  4OEL B;  2EJF C;  5C3E B;  2YU9 H;  3GTO H;  3GTM H;  3CP0 A;  4Q8F A;  4DR4 H;  1V1Q A;  1Y1W A;  3BU2 A;  1Q3L A;  3S1Q H;  4HIK A;  4DV3 L;  4YY3 Q;  2K52 A;  1IBM L;  4PDB A;  3HOV B;  5C0X G;  3NTK A;  2I0Q A;  5HGQ A;  4IFD J;  3S24 A;  2JEG A;  1GUS A;  1PH4 A;  5T1G A;  4DU9 A;  4QW9 A;  2YYZ A;  3LGJ A;  3W1B A;  1A63 A;  4OIK A;  5KFV A;  3HOY H;  2UUB Q;  2K4K A;  4JBW A;  2B2W A;  2V4Q A;  1S72 A;  3CMA A;  2NZH A;  1X54 A;  3PMF A;  2BOS A;  4LMQ D;  1JCK B;  2WKD A;  3Q0A A;  2CFM A;  3S1N H;  2E5L L;  2DZD A;  4JI5 H;  1YEZ A;  4NXM Q;  3OHX C;  2B2T A;  3HGB A;  3NUC A;  3Q8D A;  3S15 B;  2QKI C;  1JDE A;  4DR2 L;  1NSN S;  4DLK A;  3RJ0 A;  3K3P A;  1EZ1 A;  5L1J A;  1A3U A;  1VQC A;  2EYM A;  1G29 1;  2J7Z A;  2K33 A;  1K8G A;  4OO1 H;  3H91 A;  3KLS X;  4DUY L;  2R93 A;  4DPG A;  4LF4 L;  1BUV T;  3M3Y B;  1Y1V G;  4HR7 B;  2OQ0 A;  3U9S A;  2EY5 A;  4B3M L;  1WTO A;  1MHW C;  4O2A F;  4JI8 H;  1EIF A;  2F4I A;  3QZ8 A;  3TZD A;  1S0O A;  2KA7 A;  1K3B C;  1SLJ A;  5KFR A;  3RGX A;  1TWA B;  4R8N A;  4DK1 A;  4QUC A;  2R7Z B;  2UXB Q;  1EUC B;  2G9H D;  4TV8 F;  1HNZ Q;  3CQZ B;  1LTG D;  2AGO A;  2MJ8 A;  4RKB A;  1XPR A;  2AWO A;  2PYK A;  4IO9 A;  1TWG A;  1CKO A;  3J7A F;  3KLR A;  2JA7 G;  1Z6H A;  5IT9 c;  2L1B A;  4IUT A;  1QVF A;  2HJW A;  2EYP A;  4XYO A;  2AQ3 B;  2KBN A;  2RCF A;  1EYD A;  2KEC A;  4XYQ A;  3WO1 A;  2A6E D;  1RJP A;  5IGC A;  4RAZ A;  5NUC A;  1N34 H;  2F0O A;  5IGD A;  4F4W A;  2AGQ A;  1YNN D;  5KFW A;  3KF8 B;  2ZTE A;  4GNX A;  4PG3 A;  1V9P A;  2PVP A;  4KMU C;  4A2A A;  3M7N A;  1W96 A;  2PZW A;  1MSG A;  2IWH A;  3M7G A;  1TY2 A;  3GTK H;  3HOU H;  4QWA A;  2ID0 A;  3NWS A;  2HHH H;  4AH6 A;  2K32 A;  2XRQ D;  1EQQ A;  1R9T B;  1HFN A;  4DV3 Q;  2K5N A;  1TWF B;  1Y1V A;  4EGV A;  3P75 A;  1K0S A;  4C3J H;  5EJW A;  5LP6 F;  4TQS A;  3I8Z A;  3HOX B;  3HOV G;  2EXZ A;  1KDA A;  4N9T A;  2KCM A;  3NP8 A;  1O80 A;  5IP9 H;  1I4X A;  3BQ1 A;  4RUA A;  5C4H A;  2Z6K C;  2K75 A;  4A3I H;  1A62 A;  2GA4 B;  4RGT A;  4WJ4 A;  4KKU A;  5T14 A;  4A3F H;  2JA7 A;  2VQD A;  2QEX A;  3EIV A;  3ND9 A;  3BDC A;  4LF9 H;  1FD7 D;  1MZB A;  1SMY D;  1U4M A;  1CQI B;  3BG5 A;  3LWB A;  3VPC A;  1CA5 A;  2N49 A;  3NGD A;  1AUX A;  3OUU A;  5KFK A;  1UE7 A;  1Q81 C;  4ECT A;  3PW4 A;  1NR4 A;  4RUC A;  3FKI G;  1A2T A;  3U58 A;  5EPL A;  1AFP A;  1SCU B;  4GKJ Q;  5KG5 A;  3Q6S A;  2K03 A;  4DR5 H;  3LML A;  2JXM B;  1EFI D;  1ESR A;  5LL6 X;  4KHP L;  4HYK A;  2ZM6 H;  5DNF A;  5I6W A;  4LNQ A;  2R7Z G;  2A5H A;  3VR3 A;  1L2Z A;  5IT9 L;  3PZP A;  4C5A A;  3J81 E;  4UCR A;  2XSC A;  1GUW A;  4MNO A;  1ASZ A;  3SVM A;  4X65 Q;  1VAJ A;  2HUG A;  4RAY A;  4LF8 Q;  1BJT A;  2EYL A;  1JJ2 A;  2UUC Q;  4XT1 B;  3ERS X;  2MGS A;  5KEE A;  4X62 L;  4R4I A;  2Z4I A;  3QIA A;  4BY1 B;  2F4V L;  4BBS H;  2W6M A;  4EEQ A;  2PI2 A;  3RTX A;  4JI3 Q;  2VY3 A;  2FMM A;  3JAM W;  4YR3 A;  1N36 Q;  1PTO C;  5K36 H;  5BMV F;  5EBD A;  5T1I A;  3SEB A;  1IBM H;  3Q22 A;  2QYZ A;  2LS0 1;  3BJU A;  1T3N A;  4YWK A;  1PH2 A;  2NZ1 D;  4HJ5 A;  4EVO A;  2I5L X;  2SNS A;  2DJG C;  1F9Q A;  3BAB A;  3ETJ A;  3LP8 A;  2WIN B;  3MWE A;  2OLS A;  1EYG A;  1PTO F;  3KUP A;  2NB0 A;  4ED3 A;  4JVZ A;  3TBI B;  5FLX E;  1SR3 A;  3CCJ A;  3HOX G;  1JOQ A;  2PQA B;  1M4V A;  1TWA A;  5L1K A;  2E5L H;  4XYM B;  2R7Z A;  4CGY B;  4C3I B;  3CQZ A;  4JOI C;  3V6K A;  3RR5 A;  2VOB A;  3UDI A;  1B6S A;  4YHH Q;  2I87 A;  5FPO A;  1QVG A;  4DR2 H;  4X3S A;  2YW2 A;  3Q8R B;  1GXD C;  1DJR D;  1Y1W H;  1X55 A;  3KDF B;  4RFB A;  3GIM A;  4DUY H;  3RB3 A;  4LJZ C;  4LF4 H;  1WOC A;  1XPO A;  3FHW A;  1TS4 A;  4B3M H;  4ZQI A;  4IRK A;  5I2Y A;  4JV5 L;  4EFB A;  1JR0 D;  4FM9 A;  1HH2 P;  3AU7 A;  3MEF A;  3KF8 A;  2ASL A;  3D3R A;  4G4K A;  4K0K Q;  4ZKB B;  4BA1 I;  4FS2 A;  1E7Z A;  1I6H B;  1UWV A;  4BXX G;  4FBU A;  1XNQ Q;  3MWD A;  1I94 L;  5EKK A;  2JA5 H;  1K8O A;  2J9G A;  5D8D A;  4GC7 A;  4QWE A;  1O7Y A;  1IOW A;  1FKA H;  2WDT A;  1R9T A;  1SJE D;  3RD4 A;  3ERO A;  4ALP A;  3VYS A;  4CC5 A;  1CS0 A;  1BBU A;  3MFY A;  2NU7 B;  1ML0 D;  5M3M H;  1NCV A;  4IN3 A;  2IY5 B;  5FK9 C;  4DV0 Q;  3T1H L;  1V51 A;  3HOY B;  4JW0 A;  2CW8 A;  1M7J A;  3MAQ A;  4QCL A;  5BR8 Q;  3KLS A;  2H4O A;  1XNR L;  4GZY C;  5FD5 A;  1VKZ A;  5CMD A;  5IOD A;  4QW8 A;  2UXD L;  3VA5 A;  1PDQ A;  2EE1 A;  2O2L D;  3RUZ A;  2R93 H;  2R92 A;  4H44 C;  4DK3 C;  1RYR A;  5KFJ A;  1G8Z D;  3V6J A;  4QUF A;  3QG1 A;  2UXC L;  4DV7 L;  1S40 A;  5CV8 A;  4DKA C;  2AMC B;  5GQO A;  5KFG A;  3EPG A;  5I4D A;  1NTG A;  4IR1 A;  2W9B B;  5C0X H;  1F9S A;  5DM6 3;  4DR3 Q;  4QWB A;  3RUP A;  1RJR A;  2MO0 A;  3NE5 B;  4TVA B;  2Q2I A;  1I7N A;  5KFX A;  4RB0 A;  4RCN A;  1VS0 A;  2K1B A;  5D14 A;  4FF3 A;  2GPS A;  1TWG H;  1VQ5 A;  2J0T D;  4ZCK A;  4IWX A;  4FU0 A;  3TRZ A;  2CW0 C;  1XMQ L;  2Z6K A;  4HIM A;  4X66 L;  1Y69 U;  1BNC A;  5KGU A;  1LTB D;  1LYL A;  1BXT A;  2AGP A;  2EDG A;  2L9H A;  1QNU A;  1L1O C;  3I12 A;  1NMF A;  4XDX A;  4ZI7 F;  3L3O C;  3PUZ A;  3KHH A;  1BOS A;  5GAE C;  2B63 G;  4O3O A;  1HRJ A;  1CT1 D;  2EY2 A;  2FHT A;  3BVZ A;  3RB6 A;  3URY A;  2ZJQ A;  4MV7 A;  1D1I A;  3W5O A;  1CQF A;  1YIT A;  1DOM A;  1I6V C;  1LTI D;  1KNE A;  3ULP A;  4JCV E;  1A9X A;  1GGO A;  3NEN A;  5HY6 A;  3M85 A;  3HOZ G;  2YTV A;  1Y1V H;  2WAQ E;  1NNX A;  1N32 L;  4DL5 A;  5IYD H;  1RTN A;  1TQO A;  2ES2 A;  3IKJ A;  5LMN Q;  5C44 G;  4LF5 L;  4A3J B;  1VMC A;  3I3C A;  2NVX H;  1SMX A;  3E3X A;  2FLL A;  2F0D A;  4KHP H;  1VF7 A;  1YHA A;  4X64 Q;  1OXT A;  2VUM G;  4EYI B;  2WII B;  2CQA A;  3OPO A;  4XYL B;  1FNW A;  4JI1 Q;  1KQS A;  1EY6 A;  4JI4 L;  3RB4 A;  4YB8 B;  4ED6 A;  3WDN A;  5M5X H;  4DV5 Q;  1E4E B;  1Y8N B;  1YJN A;  2Q8I B;  3RLO A;  3I90 A;  1HNX L;  4O2D A;  2JA7 H;  5I47 A;  1I4Q A;  2OXP A;  1ROD A;  1PK8 A;  3RIZ A;  4LF7 L;  2EIF A;  4OWX B;  4DV2 L;  2CW7 A;  1WVL A;  4HQ6 A;  4X62 H;  2FLP A;  2F3V A;  1D8L A;  2F4V H;  4A3I B;  1ENA A;  1I6U A;  5TSS A;  2CH4 A;  3F2C A;  4M1U B;  3NQT A;  4GN3 B;  1XNR Q;  1NR2 A;  2PQA A;  3VYT A;  2JYO A;  4JPB W;  1CZW A;  4AQY L;  3PO2 B;  1LTT D;  4ED0 A;  3SDZ A;  4QMG A;  1JOK A;  1ZQ7 A;  5BN4 A;  1KRS A;  3H15 A;  4GLA C;  1XWE A;  3C2P A;  4WOR A;  1NMG A;  5AJ3 L;  2ASJ A;  3UDF A;  3KDF A;  5CR3 A;  1TII D;  2XTI A;  5FLX c;  1B33 N;  4J9O A;  3OIQ A;  2UVU A;  5FOB B;  1BCP C;  3HOV H;  3STB C;  1ULZ A;  3BVG A;  2R3Z A;  3ETH A;  2VPQ A;  4PNY A;  2YTX A;  3CC2 A;  3S2D H;  4R4C A;  5C4X G;  3J81 W;  1HXY D;  1TVX A;  2WAQ B;  1E4F T;  5FD6 A;  4MTE A;  4A93 G;  4EBC A;  1Q46 A;  4JOI A;  3MVV A;  5EKL A;  4YWM A;  4LFC L;  1BCP F;  1MSH A;  1S9F A;  4KK7 A;  1JIH A;  2HIV A;  1IYJ B;  1EQV A;  4J8Q A;  2FJ2 A;  4P71 A;  2F0P A;  5DEH A;  4A2B A;  2SCU B;  1J5E L;  3N6R A;  1J9O A;  3M4O B;  3S15 H;  4JV5 H;  5KKN B;  4K5W A;  3J81 j;  2Y0S E;  2EPB A;  4PZ7 A;  5EDW A;  2F0V A;  1FNU A;  1S0N A;  3TP5 A;  3CKI B;  1R4Q B;  1XTD A;  2PNR C;  2WB1 G;  1DOK A;  4O4I F;  4MZ9 A;  2I07 B;  3FPP A;  2R7M A;  1I94 H;  3M3Y H;  5BN5 A;  4OXP A;  4DXF A;  1JDB B;  2X69 A;  1IKM A;  2FPI B;  3DMU A;  2IHF A;  1WTH A;  1Q8I A;  3LWE A;  5JEA J;  4A3J G;  4UY8 C;  1RK5 A;  4A3D B;  2W71 A;  3E9H A;  1SYB A;  1TWA H;  3JC6 6;  2R7Z H;  5KFL A;  2W9B A;  2ASD A;  4OIJ A;  2FKL A;  1NUC A;  3CQZ H;  2UVW A;  3T1H H;  3MFI A;  2NTS A;  4RGN A;  1SYX B;  4ME5 A;  2O03 A;  1PRT F;  4U7C A;  2FPP B;  2XWJ B;  3S1R H;  2HDL A;  4BBR G;  3T5J A;  1X6O A;  4A76 A;  2KEN A;  1TS5 A;  2UXD H;  2V4R A;  3MFH A;  5EWF A;  3K5H A;  4DXG A;  2EZV A;  1H9S B;  1WI5 A;  1WTX A;  2XNA C;  4BY7 G;  3GTQ B;  2HIX A;  2UXC H;  2W9C B;  4DV7 H;  4U67 3;  4YCV A;  3WNZ A;  3PO2 G;  4EQN A;  1C7Y A;  3PO3 B;  4X6A H;  4QJF A;  5FLX L;  5KT6 A;  4R4O A;  1NJI C;  5EGT A;  3H0G B;  1MD2 D;  3PW0 A;  1N33 L;  1R9T H;  1VQK A;  1TWF H;  4IAJ A;  1XMQ H;  2Y0S B;  3AB9 A;  4X66 H;  3P20 A;  1LV9 A;  3PV0 A;  3HOX H;  2R7N A;  2YV5 A;  4ECU A;  4KHZ A;  2JA5 B;  2QK4 A;  5G3L D;  4F87 A;  1FJG L;  1Y8P B;  2UU9 L;  4UFZ A;  4ECX A;  2R8G A;  1K3R A;  1C3O A;  2WKC A;  4R8I A;  1VQN A;  2FB9 A;  4L5S A;  3G4S A;  4B3T L;  1T9H A;  2JE6 I;  4J9M A;  1E4E A;  3GD7 A;  4RGO S;  3CCM A;  1XDN A;  2QCP X;  5I9P A;  4L5T A;  5KG6 A;  1O7I A;  1LLR D;  2HD3 A;  4ME3 A;  1TXY A;  3A8K E;  4O4L F;  3C0F B;  1N32 H;  4KV6 A;  4NXN Q;  1KIX A;  1EFW A;  2R86 A;  3I4L A;  4DK0 A;  1FGU A;  2LXK A;  4LF5 H;  4HJA A;  2YRX A;  4UCO A;  3ICE A;  1A0I A;  4B3S Q;  4M8A A;  5FO7 B;  4FXG C;  1D5M C;  1BNZ A;  2K14 A;  1EYZ A;  2A6E C;  4GS3 A;  4BXX H;  1TKW B;  4JI4 H;  4GOP B;  1YNN C;  2XD4 A;  3F2D A;  5C1O A;  3U4V A;  1GUT A;  1HNX H;  3KF6 B;  1VQB A;  2EY6 A;  4YY3 L;  3C3L A;  2RDG A;  3J80 W;  3G6X A;  4RU9 A;  3GV5 B;  3KHR A;  4JI7 Q;  4A3D G;  4QQB X;  3G8C A;  4DV2 H;  4DV4 Q;  1G6Z A;  4LF7 H;  1H9J A;  5H1S E;  4V19 0;  2DGY A;  1CKM A;  3BS1 A;  4RB2 C;  2FXQ A;  3HXL A;  4HNV A;  2Z4H A;  3RBE A;  2WAQ A;  1U9R A;  1VMP A;  2MUY A;  2K01 A;  3VR6 A;  2YRW A;  3N6X A;  4AQY H;  2UUB L;  2KCT A;  2B29 A;  4J9P A;  3RAX A;  4ECZ A;  4BY1 H;  4JV1 A;  4WD3 A;  3PN1 A;  4L8J A;  1OXU A;  4NXM L;  3K5O A;  5KX5 F;  2E75 C;  3MXG A;  3E5N A;  1I4H A;  1B1Z A;  2RGV A;  1KJJ A;  1WFQ A;  4KD4 A;  1OTC A;  4EBE A;  2V9W A;  2R8J A;  4F4Y A;  1LTR D;  3STB D;  4HTH A;  3BAA A;  2ZTD A;  3PO3 G;  4NKL A;  1QNK A;  1EEF D;  1SMY C;  2XVS A;  4G7O C;  1XMO Q;  3T5H A;  3GTL B;  1KJI A;  2NVX B;  3A74 A;  3G6E A;  5CV4 A;  1SNQ A;  2JA6 G;  1B2T A;  1GUG A;  2XWB B;  4RZR A;  4IRD A;  1BVS A;  1PH9 A;  4LFC H;  3K0Y A;  4PZ8 A;  1Q86 C;  4RHR A;  5FLM G;  2AQ2 B;  1CA6 A;  2UXB L;  3T16 A;  1HNZ L;  4I55 F;  3PUW A;  2NUA B;  1ZKO A;  4RB1 A;  3PR4 A;  4Q44 A;  2RDF A;  3D6W A;  5L9X A;  5E4X A;  1Q90 A;  4OL7 A;  4B3T Q;  3I4O A;  4C3I H;  4LFB Q;  1J5E H;  1JE5 A;  3FPU B;  2F0T A;  3GTJ B;  3NQI A;  3BYY B;  4F8M A;  1LT5 D;  2F0U A;  2NVQ B;  5JVG 3;  3OTO Q;  3BZC A;  4UCS A;  1K8A C;  2LMC B;  2RQX A;  2M9V A;  5JVH 3;  2CZG A;  1VQP A;  1EY9 A;  3N8D A;  3K81 C;  3MWY W;  4ZRZ A;  4IR9 A;  1H9S A;  2JEB I;  4I7Z C;  3N44 B;  4JI6 Q;  5GAD C;  4X3K A;  5M3F G;  4FF4 A;  3GTQ A;  2W9C A;  4DR6 Q;  4HJ7 A;  1KAW A;  5CGK A;  4K2K A;  3BDO A;  4I50 F;  1PH5 A;  3RZO B;  1YVC A;  1DCZ A;  1C0A A;  1D7Q A;  1CSQ A;  3TIG A;  1I6H H;  4GKK Q;  1K8M A;  1FL0 A;  1GSA A;  3H0G A;  1EY4 A;  3C46 A;  3S2D B;  2DY7 A;  3CCR A;  2Y0S A;  5A2Q L;  4OGQ C;  5C1P A;  1KXL A;  2PNH A;  3K7U C;  2QF7 A;  4C2M H;  4PMW A;  2R8K A;  2C2R A;  3BVM A;  3RBD A;  3JSN A;  3A5U A;  2JA5 A;  5DLG A;  1IBL Q;  2XC9 A;  1EIH A;  2DLN A;  1V1O A;  3T51 B;  4K5X A;  5I2X A;  2VZA A;  4PZ6 A;  4O1N A;  1CFM A;  4L5Q A;  1K28 A;  2AQ1 B;  5CA0 F;  1UEB A;  2AU0 A;  3AFP A;  3I2Z A;  3J7Z C;  5FPR A;  3NWT A;  2GVA A;  3DWA A;  1KRT A;  3ZYY X;  3D4D A;  2WFW A;  3TN2 A;  5DGB A;  1L2F A;  1N33 H;  5IGB A;  1H9M A;  1DM0 B;  2K5H A;  3K59 A;  3RAQ A;  4YBZ B;  3PCO B;  3FKI B;  3G71 A;  1V1P B;  5FO8 B;  4ED2 A;  5KFH A;  3NEL A;  1FJG H;  3H3V I;  4C5C A;  2UU9 H;  1S68 A;  1A6X A;  1VQI A;  1PFS A;  3CRL C;  2PCF B;  5KYL A;  4FF2 A;  4A93 H;  1VF5 C;  4GKJ L;  1KJ9 A;  4J9K A;  4GOP A;  4CDF C;  1J8I A;  1S0M A;  3AMU A;  1DXM A;  2D9U A;  1GSH A;  1NBW A;  4AYB E;  3KF6 A;  3QOJ A;  4WFN 3;  3CF5 A;  1SE3 A;  3JRW A;  2F0L A;  1A3V A;  3I56 A;  1DOL A;  2CKZ B;  3S1R B;  1QB5 D;  3I7F A;  4CKE A;  1RTO A;  1KDB A;  4H0L C;  4X3U A;  3ERQ A;  3TP8 A;  4DR1 Q;  2XCA A;  1UAP A;  1D1K A;  3HEJ A;  2VQE Q;  4C56 C;  3QWN A;  1KLG D;  5ELE A;  4X65 L;  4TUY F;  3FMC A;  2XIW A;  4LF8 L;  5EAY A;  5FJ8 G;  2UUC L;  2QW7 A;  4O3S A;  4KKT A;  3OIP A;  4A3B B;  3RFC A;  3RMH A;  5M5Y B;  3PR5 B;  1Q1B A;  5E7N A;  4JI2 Q;  4JI3 L;  5LMU Q;  3EQL C;  2Q8T A;  3D6C A;  3VPB A;  1ZXT A;  2RSN A;  3Q8S B;  3MWM A;  3W1G A;  3NHH A;  1N36 L;  4A3J H;  4YY3 H;  4F4X A;  3MXN B;  1DV1 A;  1H9K A;  1RKN A;  2A1A A;  4E6I A;  1U4L A;  3Q1K A;  3GIK A;  3BYT B;  4L6T B;  3IAY A;  2HVQ A;  1AEX A;  3OSO A;  3GTL A;  2NVX A;  1E1O A;  2IT1 A;  3HB9 A;  2UUB H;  2DY8 A;  2IHE A;  2NVY B;  4C1N K;  2N78 A;  5JAV A;  5BPF A;  2KSW A;  3TEH B;  4NXM H;  3M4Q A;  5C4Z A;  1N56 A;  3OW7 A;  5KT3 A;  3PO2 H;  4YHH L;  4A75 A;  1MJC A;  2R7L A;  5IT9 W;  2NTT A;  4AYB B;  1E24 A;  1SXT A;  2K5D A;  1VBG A;  3GTJ A;  4CJ2 C;  5M5W H;  3GV6 A;  1ZEQ X;  2WV6 D;  1AW7 A;  4DAM A;  4RAU C;  1WD1 A;  3DLL A;  1B4O A;  5CA1 F;  2NN6 I;  1PFN A;  4P72 A;  4FBT A;  2EJG C;  4J9L A;  3I73 A;  4DR7 L;  3MFG A;  4K8I A;  5J2T F;  4K0K L;  3ZJY C;  2KUM A;  5C6A A;  2UXB H;  2MNA A;  1HNZ H;  1SYE A;  5IGF A;  1KC8 C;  1UE5 A;  2CHB D;  2L55 A;  1XNQ L;  2K5V A;  5ISR A;  3J7A K;  2KHI A;  3JAM c;  2R8H A;  2HQL A;  1TWC H;  4IUQ A;  1AUV A;  4HJ9 A;  5F9L A;  5CBE E;  1VQF A;  3M4Y A;  4JI0 Q;  3CCU A;  4IJH A;  3Q24 A;  3ORQ A;  2W70 A;  5DLQ E;  1SYG A;  1HZ9 A;  4IUP A;  1BF4 A;  5I9O A;  4DV0 L;  3OSP A;  1XPU A;  2XRS D;  5BR8 L;  3M4O H;  2V58 A;  2VA2 A;  1JOR A;  3K58 A;  5DG7 A;  4OX9 Q;  3R3O A;  1E22 A;  4RZQ A;  2BDO A;  4A3B G;  5KG2 A;  2KHJ A;  3D4R A;  3I70 A;  2JA8 G;  4DV3 H;  2HT1 A;  1DD2 A;  4LMY A;  1JXL A;  2JEF A;  3KLW A;  1RDP D;  2FK2 A;  2W6P A;  1XYI A;  1HUM A;  2A8V A;  1K0R A;  4A3D H;  3E0E A;  4DR3 L;  2HDM A;  3FKI A;  1V1P A;  3KHL A;  1E2W A;  3NBI A;  5J22 A;  4KN7 C;  2EYH A;  5IY0 A;  1SYF A;  3I91 A;  3RF2 A;  4HR7 A;  5CV7 A;  2PQE A;  2L0C A;  3A5Z B;  4HIO A;  5D1P A;  3TQ1 A;  5F2D A;  2F0M A;  3KOJ A;  1LAB A;  2NWG A;  3EVQ A;  2B63 B;  2WP8 J;  5DG9 A;  4DNR B;  2Z0S A;  4U6P A;  4C3H G;  3M9N B;  1FGB D;  2BA1 A;  3S16 B;  3ND8 A;  4ECS A;  1MI2 A;  2DNE A;  1YIJ A;  4CDE C;  3GTQ H;  3EBE A;  1TA8 A;  5JPM C;  2DPI A;  4IFD G;  3GIQ A;  1GSO A;  3J7A V;  1RHP A;  4JV0 A;  4A3L G;  3JAM i;  3HOZ B;  3NBH B;  4MHE A;  4AYB G;  3PO3 H;  3R23 A;  3OOC A;  3G6J B;  1EL0 A;  2ENB A;  4WJW A;  4RCO A;  5C44 B;  1HR0 W;  3H0G H;  2W7O A;  2E8G A;  4DR7 Q;  2BQU A;  3KTM A;  2ZJR A;  1V8Q A;  2JA6 H;  3X3N A;  1CHP D;  5KFT A;  2W6Z A;  5LMN L;  5ELC A;  2RHS B;  2VUM B;  1WD0 A;  4HNU A;  2PMZ E;  2OF1 A;  3JAM L;  3HG9 A;  4X64 L;  5IP7 G;  3HOW B;  1DGS A;  4Q5V A;  2XGQ A;  3IN5 A;  3SI8 A;  5KFD A;  4JI1 L;  3V4S A;  1L0X B;  1KD1 C;  1STE A;  2IPK D;  1TU2 B;  1PLF A;  4CDC C;  4DV5 L;  4DUZ Q;  1AP0 A;  1TWF A;  2NU6 B;  5HBR B;  4KLK A;  2D0O A;  4X65 H;  3S14 B;  1N9W A;  2WB1 E;  5CV9 A;  3T13 A;  4C2M B;  3UE1 A;  4MIU A;  5JJK A;  1OXX K;  1W3S A;  4LF8 H;  2UUC H;  4DL2 A;  3N42 B;  4POF A;  4XIG S;  3N41 B;  2RDJ A;  3AEV A;  5EZY F;  3VA7 A;  4Q8E A;  4JI3 H;  1Q7Y C;  3KBX A;  1JC7 A;  3MEH A;  4FXK C;  4A3E B;  2UUA Q;  2J4X A;  2VB3 X;  1N36 H;  2HCI A;  3LNN A;  5M3F H;  3DF7 A;  3D31 A;  1L0W A;  5JPN C;  3CCS A;  2F0F A;  4AYB A;  4R7R A;  2F0J A;  3I4N B;  3N43 B;  4KKS A;  4DF7 A;  3ER0 A;  5KFN A;  2V59 A;  5C4J H;  1EQR A;  4FDB A;  4FNF A;  3R5F A;  3P7J A;  3UE0 A;  5C4X B;  5JH7 F;  1HNW Q;  2MCT A;  3HRZ C;  1BR9 A;  3CHB D;  1UEA B;  2HCC A;  3PGZ A;  2LKV A;  4A3K G;  4A93 B;  2PZT A;  4RNM A;  5KFE A;  4UP7 A;  2EVB A;  4O3P A;  2A6H C;  4FS1 A;  5KRU A;  3RLF A;  1IBK Q;  2JP1 A;  4KY7 A;  2IJ0 A;  3KYH C;  3KHG A;  4YHH H;  2PMZ B;  4F4Z A;  1B70 B;  2L15 A;  4A3G G; 
#chains in the Genus database with same CATH homology
 1X3F A;  4YWL A;  2Q2H A;  4BY7 G;  1VQH A;  3CME A;  1WCM H;  2HIX A;  1IL2 A;  1LM0 A;  1UE6 A;  4DUY Q;  1FVI A;  4OO1 I;  4YCV A;  4LF4 Q;  3GTO H;  2YU9 H;  3GTM H;  3CP0 A;  3PO2 G;  4LWC A;  1V1Q A;  4B3M Q;  1G6P A;  1C7Y A;  4L5R C;  4X6A H;  3BU2 A;  4QJF A;  4R4O A;  2H5X A;  4QGU A;  1NJI C;  1X3E A;  4KI0 A;  2UUA L;  3L2P A;  3S1Q H;  3NEM A;  4HIK A;  4B3R Q;  4DV3 L;  1P16 A;  2K52 A;  4YY3 Q;  1R9T H;  1VQK A;  4P75 A;  1IBM L;  1N33 L;  1TWF H;  2F52 A;  5C0X G;  3GTL H;  1GKH A;  1QVC A;  2I0Q A;  1YZ6 A;  5HGQ A;  4IFD J;  3S24 A;  3PV0 A;  2MO1 A;  1PH4 A;  3HOX H;  2YV5 A;  4KHZ A;  3S1M H;  3OYY A;  1CKN A;  1Q82 C;  3EN2 A;  1FJG L;  2YYZ A;  2XGT A;  3LGJ A;  4TQU S;  3W1B A;  4GLX A;  2UU9 L;  3HOY H;  1A63 A;  2UUB Q;  2K4K A;  4JBW A;  3HOW G;  1K3R A;  1S72 A;  3CMA A;  1HNW L;  4P73 A;  2NZH A;  4P74 A;  1X54 A;  1VQN A;  5LMN W;  4L5S A;  3G4S A;  4B3T L;  1T9H A;  2JE6 I;  1IZ6 A;  3GD7 A;  4Y52 H;  3CCM A;  1SRO A;  1BBW A;  1HJP A;  2CFM A;  1Y14 B;  2E5L L;  3S1N H;  1YEZ A;  4L5T A;  4NXM Q;  3GTJ H;  1O7I A;  4ME3 A;  1HZB A;  2OWO A;  4LF6 Q;  1TXY A;  1WCM G;  2LSS A;  3Q8D A;  1IBK L;  5JJL A;  2NVQ H;  4YCU A;  2R6G A;  4DR2 L;  4NXN Q;  1KIX A;  1EFW A;  4DAY B;  4UPA A;  4XTC S;  1FGU A;  2LXK A;  1GD7 A;  1VQC A;  4HJA A;  3ICE A;  1G29 1;  1A0I A;  1K8G A;  4B3S Q;  4DUY L;  3RN5 A;  3S17 H;  4DPG A;  2K14 A;  4A3E G;  4LF4 L;  3PF4 A;  2N3S A;  1Y1V G;  4A3C H;  4LFA Q;  2OQ0 A;  4GS3 A;  3SGI A;  4B3M L;  4BXX H;  2ATW A;  3I4M G;  1JB7 A;  4GOP B;  1EIF A;  3F2D A;  1VQA A;  1TWH H;  2EXD A;  3RZO H;  1SLJ A;  3U4V A;  3E9I A;  3KF6 B;  3I4N G;  4B3R L;  1VQB A;  2GVB A;  4YY3 L;  2UXB Q;  4QY7 A;  1HNZ Q;  1JJG A;  3K80 C;  4JI7 Q;  4A3D G;  4QQB X;  1XPR A;  4DV4 Q;  5H1S E;  3RN2 A;  2AWO A;  1HR0 Q;  4QL5 A;  2DGY A;  1CKM A;  1RL2 A;  4IO9 A;  3M4P A;  1VQ8 A;  1J6Q A;  1BKB A;  1LTL A;  3F8T A;  1CKO A;  2FXQ A;  5FLM H;  3RLN A;  3VDY A;  2JA7 G;  2R92 G;  4DV6 Q;  4RG1 A;  5IT9 c;  3CW2 C;  1QVF A;  2UUB L;  4POG A;  1X56 A;  2KBN A;  2KCT A;  2B29 A;  4BY1 H;  2VNU D;  3PSI A;  3RZD H;  1VQD A;  3KF8 B;  5C0X I;  1OXU A;  2ZTE A;  4GNX A;  4PG3 A;  4NXM L;  1V9P A;  1A8V A;  1ASY A;  4IPG A;  4LF6 L;  1WFQ A;  3M7N A;  1OTC A;  2VQF Q;  1QUQ B;  3GTK H;  3HOU H;  3STB D;  4NXN L;  2ID0 A;  2ZTD A;  3DM3 A;  4AH6 A;  1PH1 A;  3T1Y Q;  3PO3 G;  1EQQ A;  4DV3 Q;  2K5N A;  3FKI H;  4B3S L;  1XMO Q;  4KHP Q;  2D0P A;  1S3O A;  3A74 A;  4C3J H;  3G6E A;  3CCL A;  4LFA L;  2JA6 G;  3HOV G;  1BVS A;  4A4I A;  4JG2 A;  1PH9 A;  2ALY B;  2KCM A;  2A19 A;  4OON A;  1OXS C;  2JJQ A;  4PZ8 A;  5IP9 H;  1Q86 C;  5FLM G;  4H02 A;  2Z6K C;  2UXB L;  2K75 A;  4A3I H;  1X3G A;  1HNZ L;  2D62 A;  1A62 A;  3PUW A;  4JI7 L;  5C0X J;  4DV4 L;  4X62 Q;  2F4V Q;  4B3T Q;  1HR0 L;  3I4O A;  4C3I H;  4LFB Q;  1JE5 A;  4WJ4 A;  1C9O A;  3TS0 A;  2ZJP A;  4A3F H;  1YJW A;  3HKS A;  4BY1 G;  2QEX A;  4IFD I;  3CPF A;  3EIV A;  3OTO Q;  3BZC A;  4DV6 L;  1K8A C;  3B6Y A;  1XJV A;  3UDX A;  2N49 A;  4A3F G;  1VQP A;  1PH6 A;  1UE7 A;  3K81 C;  5J3B A;  1X65 A;  1SRU A;  2I5H A;  1Q81 C;  2E2H H;  3HOU G;  2JEB I;  4A3B H;  4JI6 Q;  5M5Y H;  5GAD C;  5M3F G;  3FKI G;  1VQ6 A;  4HJ7 A;  4DR6 Q;  1KAW A;  2MQH A;  2VQF L;  2R7D A;  1PH5 A;  2VL6 A;  3U58 A;  1YVC A;  2RF4 A;  1C0A A;  1D7Q A;  2RCN A;  3S2H H;  1CSQ A;  4GKJ Q;  1I6H H;  4GKK Q;  3HKZ E;  3T1Y L;  3TS2 A;  4R4Q A;  1FL0 A;  1XMO L;  4KHP L;  1VQO A;  3CCQ A;  1EWI A;  1HZA A;  4LNQ A;  2R7Z G;  3CCR A;  5IWA Q;  1B7Y B;  4O0A A;  5IYB H;  1KXL A;  2PNH A;  3G48 A;  3K7U C;  4C2M H;  4HID A;  4PMW A;  1K73 C;  1AH9 A;  3BZK A;  4MNO A;  4YCW A;  1VCI A;  3HKZ G;  4AIM A;  3K0X A;  1Q12 A;  4EQ5 A;  4X65 Q;  2JA9 A;  1ASZ A;  4GOP C;  1IBL Q;  2NVY H;  4LF8 Q;  4A3M H;  1M90 C;  1JJ2 A;  2UUC Q;  1Q1E A;  3UDG A;  2YTY A;  3ERS X;  4BBS H;  4X62 L;  4R4I A;  4DV1 Q;  2VZA A;  4PZ6 A;  5IYC G;  2F4V L;  4LFB L;  1PHJ A;  4L5Q A;  2PI2 A;  1UEB A;  4JV5 Q;  4JI3 Q;  2VY3 A;  4GN4 B;  1MKH A;  3D0F A;  3AFP A;  3I2Z A;  1AE3 A;  3K7A H;  3J7Z C;  3OTO L;  2JK8 A;  5FJ8 H;  1N36 Q;  3J80 c;  2GVA A;  3FP9 A;  1KRT A;  4JBK A;  2WFW A;  1L2F A;  1YHB A;  1MJE A;  1L1O B;  2K5H A;  2AWN A;  3BJU A;  1K83 H;  4YWK A;  3PCO B;  3J81 c;  3G71 A;  4HJ5 A;  1PH2 A;  1I94 Q;  2RHQ B;  1E3P A;  2I5L X;  4JI6 L;  2NZO A;  3NEL A;  4DR6 L;  1WYD A;  3H3V I;  1EYG A;  5IP7 H;  1M1K C;  1VQI A;  1PFS A;  2V1C C;  4JYA Q;  1HZC A;  4A93 H;  4GKJ L;  4GOP A;  1SR3 A;  3CCJ A;  3HOX G;  3T1H Q;  4GKK L;  3PUV A;  2QA4 A;  2NN6 G;  4NPS A;  2PQA B;  1NBW A;  1WJJ A;  5JJI A;  4AYB E;  3KF6 A;  3CF5 A;  2Q2T A;  3HOY G;  4JOI C;  3I56 A;  3RR5 A;  2CKZ B;  5IWA L;  4R4T A;  2N8N A;  1KL9 A;  3I7F A;  2UXD Q;  3UDI A;  4LUV A;  4YHH Q;  3K8A A;  4DR1 Q;  1QVG A;  2ZTC A;  1I3Q H;  5C3E H;  1I50 H;  2VQE Q;  4X65 L;  1X55 A;  3KDF B;  1Y1W H;  1IBL L;  2UXC Q;  4LF8 L;  4DV7 Q;  5EAY A;  3HFZ B;  5FJ8 G;  1WOC A;  1EIY B;  2UUC L;  1XPO A;  4DV1 L;  2IX0 A;  3FHW A;  2IX1 A;  4DR4 Q;  4JV5 L;  1CSP A;  1B8A A;  1Q1B A;  5E7N A;  4JI2 Q;  4JI3 L;  5LMU Q;  1YBY A;  1HH2 P;  3MEF A;  4OO1 G;  3W1G A;  3GDE A;  1N36 L;  2CQO A;  4K0K Q;  1QZG A;  4A3J H;  4BA1 I;  3MXN B;  4A3C G;  1E7Z A;  1UWV A;  4BXX G;  1YHQ A;  2A1A A;  1QUQ A;  1XMQ Q;  1XNQ Q;  4X66 Q;  1I94 L;  2JA5 H;  5ELN A;  1EUJ A;  4LUZ A;  2QGQ A;  3PF5 A;  3GTP H;  4ALP A;  4A3K H;  3CPW A;  1BBU A;  1E1O A;  2IT1 A;  4JYA L;  5M3M H;  2CWA A;  2BA0 A;  3A0J A;  2IY5 B;  3I55 A;  4DV0 Q;  2IHE A;  3RNU A;  3J81 i;  3T1H L;  2N78 A;  2JEA I;  5BR8 Q;  1XNR L;  2B63 H;  3TEH B;  4JI5 Q;  4DNI A;  3GO5 A;  1Y1W G;  3M4Q A;  3CD6 A;  3S16 H;  1RIP A;  1U0L A;  4JBM A;  3U4Z A;  2UXD L;  2R93 H;  3PO2 H;  4YHH L;  4A75 A;  1N32 Q;  1MJC A;  4DR1 L;  4JC0 A;  1E24 A;  3AYH B;  4LF5 Q;  4DK3 C;  2AKW B;  5M5W H;  2VQE L;  3ULJ A;  3TRE A;  3PUY A;  1N8R C;  2UXC L;  3HOZ H;  4DAM A;  1YNX A;  4DV7 L;  3DLL A;  1S40 A;  4DKA C;  2AMC B;  5GQO A;  2NN6 I;  4P72 A;  1NTG A;  3IRB A;  4DR4 L;  1CUK A;  4DR3 Q;  5C44 H;  4JI4 Q;  4JI8 Q;  5LMU L;  4JI2 L;  2MO0 A;  4DR7 L;  2I5M X;  4TVA B;  1PYS B;  2Q2I A;  2JA8 H;  3J7A 5;  1VS0 A;  4HJ8 A;  1LUZ A;  1HNX Q;  1TWG H;  3ZJY C;  1VQ5 A;  2VUM H;  4K0K L;  1PVO A;  2MNA A;  1KC8 C;  3TRZ A;  1UE5 A;  4LF7 Q;  1XMQ L;  2Z6K A;  4DV2 Q;  4HIM A;  1I5F A;  4X66 L;  2K5V A;  1PV4 A;  1XNQ L;  3HOW H;  2CWP A;  1GO3 E;  1LYL A;  2KHI A;  3JAM c;  5IP9 G;  2HQL A;  1TWC H;  1L1O C;  2VW9 A;  2OQK A;  1VQE A;  4HJ9 A;  2CCZ A;  1NMF A;  4GN5 A;  4A3I G;  3PUZ A;  4APV A;  2OCE A;  1VQF A;  5GAE C;  4JI0 Q;  3CCU A;  2BH8 A;  4IJH A;  3OW2 A;  4AQY Q;  2B63 G;  5DLQ E;  3F2B A;  3CCV A;  1YI2 A;  1W2B A;  1QZH A;  3CC4 A;  4OWW B;  3S14 H;  1HZ9 A;  4DV0 L;  2ZJQ A;  1N34 Q;  2Q2U A;  1OXV A;  4C3H H;  1XPU A;  2R93 G;  3W5O A;  1YIT A;  1E1T A;  3M9B A;  2B3G A;  5AJ3 Q;  5BR8 L;  3M4O H;  1P8L A;  4RMF A;  4JI5 L;  4JCV E;  3ULP A;  5JEA G;  3NEN A;  5HY6 A;  3CCE A;  3M85 A;  3HOZ G;  4A3E H;  2YTV A;  4QIW E;  1Y1V H;  4OX9 Q;  2WAQ E;  1E22 A;  1VQ7 A;  4IOA A;  2R7F A;  1N32 L;  2LXJ A;  4A3L H;  5IYD H;  2ES2 A;  3I4M H;  2HHH Q;  5LMN Q;  4A3B G;  3U50 C;  5C44 G;  4IOC A;  4LF5 L;  2NVX H;  1SMX A;  3KFU A;  2KHJ A;  1VQM A;  2JA8 G;  2HT1 A;  2BH2 A;  1CKN B;  1YHA A;  3AFQ A;  1GVP A;  1Z47 A;  4X64 Q;  3KLW A;  1OXT A;  2E2I H;  2VUM G;  3I4N H;  1VQJ A;  2K50 A;  4JI1 Q;  1L1O A;  1KQS A;  1K0R A;  3KJP A;  2A8V A;  3E0E A;  4A3D H;  2OTJ A;  4DR3 L;  4JI4 L;  2WAQ G;  4JI8 L;  5M5X H;  5C4X H;  4DV5 Q;  3PIP A;  4LFC Q;  5IY0 A;  1YJN A;  3RLO A;  1U5K A;  4UP9 A;  1HNX L;  4O2D A;  2JA7 H;  4EX5 A;  2R92 H;  3A5U A;  1KHI A;  2DUD A;  1X9N A;  3A5Z B;  4LF7 L;  2EIF A;  4MTN A;  4OWX B;  5IYB G;  4DV2 L;  4HIO A;  1D8L A;  1J5E Q;  3KOJ A;  3F2C A;  1UE1 A;  2AHO B;  2WP8 J;  4OWT B;  2Z0S A;  4GN3 B;  1XNR Q;  2BA1 A;  2PQA A;  3AQQ A;  1SE8 A;  4IJL A;  1VQ9 A;  3CC7 A;  3ULL A;  4LF9 Q;  4JI0 L;  4A3M G;  5GAG C;  4AQY L;  1YIJ A;  4BBS G;  1JT8 A;  4DK6 C;  3GTQ H;  3EBE A;  5IE8 A;  3PUX A;  1N34 L;  4IFD G;  1KRS A;  3H15 A;  4GNX C;  4GLA C;  5IYD G;  3JAM i;  4A3L G;  3NBH B;  1NMG A;  5AJ3 L;  3UDF A;  4AYB G;  3PO3 H;  3KDF A;  5K36 G;  1IXR A;  2EQS A;  2XTI A;  1HR0 W;  5FLX c;  2ASB A;  3H0G H;  4OX9 L;  4J15 A;  2E8G A;  4DR7 Q;  1EOV A;  2ZJR A;  3TQY A;  1PH7 A;  2JA6 H;  2MFI A;  2VS1 A;  2OTL A;  2HHH L;  3STB C;  5LMN L;  3HOV H;  2RHS B;  3KJO A;  2YTX A;  3CC2 A;  3S2D H;  4DR5 Q;  4R4C A;  5C4X G;  2PMZ E;  4GLV B;  1Z9F A;  1YJ9 A;  1JMC A;  4X64 L;  5IP7 G;  1VQG A;  1DGS A;  2ZM6 Q;  4JI1 L;  4A93 G;  1Q46 A;  5GRO A;  1KD1 C;  1NY4 A;  4JOI A;  4IPH A;  1PA6 A;  3L0O A;  4DV5 L;  4YWM A;  4LFC L;  4LW1 A;  4DUZ Q;  4KLK A;  3H3V H;  2D0O A;  2HIV A;  1IYJ B;  1G51 A;  3J80 i;  4BBR H;  4GNX B;  1N9W A;  2WB1 E;  1SFO H;  1VQL A;  3L7Z C;  3UE1 A;  5JJK A;  1OXX K;  1W3S A;  4JBJ A;  4P71 A;  4POF A;  3PIO A;  5ELO A;  4XIG S;  1J5E L;  2GN5 A;  3AEV A;  3S15 H;  4A3G H;  4Y7N H;  1Q7Y C;  1V43 A;  2Y0S E;  5C3E G;  3J81 j;  4PZ7 A;  4BY7 H;  1SN8 A;  4WJ3 M;  2UUA Q;  1GM5 A;  4LF9 L;  5M3F H;  1XTD A;  2WB1 G;  1N33 Q;  3D31 A;  1IBM Q;  1L0W A;  2JQO A;  4MZ9 A;  1NE3 A;  3H0G G;  3CAM A;  3F1Z A;  4R1J A;  3CCS A;  3M3Y H;  4OXP A;  3GTG H;  2E2J H;  1VQ4 A;  2PI2 E;  2IHF A;  2Y0S G;  4A3J G;  5JEA J;  4UY8 C;  3ER0 A;  3E9H A;  5C4J H;  1FJG Q;  1EQR A;  2UU9 Q;  3JC6 6;  1TWA H;  4FDB A;  4NB3 A;  4UP8 A;  3UE0 A;  2R7Z H;  4IPC A;  1H95 A;  2JA5 G;  3CQZ H;  1HNW Q;  1JJC B;  1PH8 A;  1Q8K A;  3PGZ A;  1K9M C;  5GAH C;  1AE2 A;  4DR5 L;  4A3K G;  4UP7 A;  2F3I A;  3CXC A;  3S1R H;  2E5L Q;  4BA2 I;  2ZM6 L;  4LUO A;  4BBR G;  2NVT H;  1PYB A;  2C35 B;  3WWV A;  1X6O A;  4IPD A;  3RLF A;  5M3M G;  1IBK Q;  4A76 A;  1MIU A;  1PH3 A;  2KEN A;  3KYH C;  5IYC H;  4DR2 Q;  1B70 B;  4DUZ L;  2L15 A;  1WI5 A;  4A3G G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...