3PO2G

Arrested rna polymerase ii elongation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po2G01
2LSSA 2B29A 4A75A 1KC8C 4JI4Q 2UXDL 3TEHB 2JA6G 2MO0A 1X3FA 2RCNA 3U4ZA 5LMNQ 1HZCA 1XMQL 1WFQA 3OTOQ 4IO9A 4PZ6A 3FKIH 2ALYB 4DV3Q 3M9BA 3U50C 3HOVG 5IP9H 4JYAL 1AE2A 2VUMH 3GTQH 1Z9FA 3JAMc 3F2CA 1L1OB 1Q86C 4NXNQ 1IL2A 1CKNB 1PYSB 1Q81C 3KDFB 4DUYL 1VS0A 1LTLA 1FJGL 4JI3Q 1Y1WG 2YTVA 5IT9c 3HOUG 2ZJRA 4X64Q 2KBNA 4P73A 2ASBA 3J80i 4DV0Q 2B63G 5E7NA 4A3DG 1NE3A 3OTOL 2VUMG 2D0PA 1X54A 3E0EA 4NXMQ 1JJGA 1VQIA 1UE5A 4YCWA 2K5NA 4GKKL 4X6AH 5IYDH 4UP8A 1R9TH 4RG1A 4DR1Q 3WWVA 4B3MQ 2VQEL 2F3IA 1IBLQ 1JE5A 5GROA 4JI7L 3M4OH 4JI6Q 2L15A 2YTXA 3PUXA 1NJIC 2VQFQ 1SE8A 4BBRG 1YJWA 1VQ9A 1XPUA 3FP9A 1LUZA 1FGUA 4DV4Q 4JOIA 3CMEA 3RN2A 4GKJL 3AEVA 3VDYA 1M90C 1B8AA 1PH7A 4YCUA 4APVA 1Q82C 1E1OA 5M5WH 1YVCA 4GOPC 4A93G 2Q2TA 4YWMA 2NVTH 4GNXC 4PZ7A 4P71A 1XTDA 4A3KH 1YJ9A 1HNZL 2E2IH 3S17H 2UXCL 1H95A 1VQCA 4DV2Q 4GLXA 3JAMi 3T1HQ 1M1KC 1I5FA 1E7ZA 2K52A 1S72A 4GS3A 1SLJA 5GAGC 3CW2C 3A74A 3G6EA 4POFA 1PH4A 4GN4B 4C3JH 4A3GH 3CXCA 2RHSB 5LMNW 1A8VA 2JA9A 4IFDJ 3RLOA 3A5ZB 3W1BA 1X9NA 2R7FA 1HZ9A 1XNQL 1HR0W 1UE1A 1UE6A 4NXML 4BY7G 2R7ZG 2ZM6L 1WCMG 2GVAA 4GNXA 3KF6B 1E24A 5GADC 2JA8G 2BA0A 4B3RQ 1N8RC 1FVIA 1PH8A 4ALPA 2Q2HA 5ELOA 2HHHL 1D7QA 4OO1G 3K0XA 4K0KL 1IYJB 1K83H 2DGYA 4K0KQ 2VNUD 1VQBA 1EWIA 4R4QA 4JI1Q 1HH2P 4L5QA 2AHOB 4L5RC 4DR7L 2NN6I 2HIVA 1DGSA 3RR5A 3CP0A 1YHBA 4DR2Q 2UU9L 5IYBH 3CCSA 1U5KA 4LFCL 5GQOA 2JQOA 4DK6C 2DUDA 4WJ4A 1K9MC 4IFDG 4P75A 1HNZQ 5J3BA 3HOXG 4WJ3M 5C0XG 4QL5A 2CCZA 4C2MH 1VQ4A 4DR4L 3I55A 4JI0Q 1N32Q 4UY8C 1CKOA 4IPCA 1OXXK 1V9PA 5C4XH 1EQRA 3CF5A 1C7YA 1BVSA 1IBKL 4JI0L 4IPDA 1NTGA 3EBEA 2QEXA 3GTOH 3PO2H 1KQSA 1WYDA 4DR5L 2C35B 2MNAA 1I94Q 4BBSG 5AJ3L 1XJVA 2BA1A 1PH6A 1G291 1P8LA 1VCIA 1JJCB 4BXXH 1ASZA 4YY3Q 4XTCS 4B3SQ 4A3JG 4POGA 2YTYA 2R92H 1Q7YC 1HR0L 4LFBQ 5FJ8G 1L1OC 3HOZG 2CWAA 3F2DA 1VQ8A 1L2FA 3AQQA 4GOPA 2OTJA 2ATWA 1EIYB 4QQBX 3RZDH 4DR5Q 4HJ8A 4HIKA 3ULLA 2I5MX 2KCTA 1CKNA 1VQ6A 2ZTCA 1GD7A 4KLKA 3L7ZC 1BBWA 3BZKA 1TWAH 3CCMA 3NEMA 2GN5A 4DV6Q 1ASYA 3HKZE 1J6QA 4LF4Q 1X65A 2UUCQ 4GKKQ 4DR6Q 5DLQE 3K7AH 4LWCA 2I5LX 2JA5H 3T1YQ 4DR3Q 3TS2A 2BH2A 3FKIG 1IBLL 3HOVH 3KLWA 4A3FG 3CMAA 1N34Q 2Q2UA 1O7IA 3H3VH 2AWNA 4IPGA 2CQOA 4JOIC 2HQLA 2NZHA 4MTNA 1S3OA 3HOXH 4DV4L 4JI5Q 3HOYG 1Y1WH 1IXRA 1PFSA 1X55A 1YIJA 2IY5B 2PNHA 1YHQA 4TQUS 4LF8L 1QUQB 4JBKA 4DV5Q 2WAQG 5IP7G 1VQFA 4B3ML 3S1RH 1YITA 3GTMH 4A76A 3CPWA 2NN6G 3STBD 2XGTA 4Y7NH 2CKZB 1PHJA 1VQKA 1SMXA 5EAYA 1FL0A 3S1QH 3HOWG 3LGJA 3L2PA 2N49A 1PV4A 4O2DA 1VQLA 4JI1L 4JYAQ 2AWOA 4DV7Q 4AH6A 1Q1BA 1BBUA 4DK3C 1Y1VG 3S16H 5K36G 1QUQA 4IFDI 1KL9A 2IX1A 3HOUH 4DV6L 2JE6I 1FJGQ 3UDGA 3J81c 4L5TA 2IHFA 1HZAA 3MXNB 1Q8KA 4NXNL 2IX0A 2QGQA 4AQYQ 3I4OA 3RNUA 3GTPH 4Y52H 2Q2IA 3PUZA 1S40A 2NZOA 3RLNA 4A3CG 3PIPA 4HIMA 4JI5L 4HIOA 1QZGA 3I4MG 4BY1H 2GVBA 4P72A 4GN5A 4EQ5A 1MIUA 2YV5A 4R4TA 5IYCG 4DV1Q 1PH3A 4JI4L 3GTLH 4YHHL 1YI2A 2I5HA 4A3BG 2RHQB 4YHHQ 4LF6L 2B63H 4LUZA 1V43A 1CSPA 1X3GA 3TS0A 1VQ7A 2JA8H 4GKJQ 1AE3A 1TWCH 1KRTA 4DR3L 3CC7A 5M3FH 1N33L 4A3KG 2KCMA 3CC2A 1VQNA 1OTCA 2EXDA 4BBRH 4DV2L 5HGQA 3T1HL 1JJ2A 2Z0SA 3TRZA 4TVAB 4R4CA 2I0QA 3I4NG 4NB3A 3S1NH 4RMFA 3CCUA 2E5LL 5FLMG 2K5HA 4DPGA 1YJNA 3KFUA 2PI2A 4A3CH 4QY7A 1EFWA 1E3PA 4DAMA 1E22A 2VQFL 3KF8B 5JEAG 4L5SA 3M7NA 3E9HA 1J5EL 1N33Q 2UXCQ 1JT8A 1KXLA 1EOVA 4BBSH 1XNRL 3KYHC 2UUAL 4A93H 1NMGA 1KIXA 1HR0Q 4LNQA 2ID0A 3GO5A 3M4QA 3MEFA 1B70B 1G51A 1EQQA 3CCQA 5JJLA 1JMCA 5LMUQ 1OXUA 3HKZG 1KRSA 2WP8J 1I6HH 2NVYH 1CUKA 1TXYA 2K75A 3GTJH 1N34L 1K8AC 4B3RL 1SROA 3J7A5 4R4IA 2F4VL 3OYYA 4IJHA 1EUJA 3KJPA 3KJOA 5IYBG 4EX5A 4GOPB 3AFQA 1NMFA 4JC0A 2CFMA 5H1SE 4AYBE 1XNQQ 4GLAC 1VQOA 4OWWB 2OCEA 4HJ9A 2UUCL 4HJAA 3JC66 3UDXA 3TQYA 5HY6A 4R1JA 2ZTDA 5BR8Q 3F1ZA 1PH5A 4LF4L 4KHPQ 1PVOA 3PF4A 1MJEA 2EQSA 1EIFA 2JA5G 2JA7G 1X3EA 4IPHA 4XIGS 1VQEA 3D0FA 1WOCA 4B3TQ 2ES2A 1KHIA 2ZM6Q 1K3RA 2R7ZH 5IP7H 2D62A 4A3EH 3D31A 2OTLA 1TWFH 1TWGH 2CWPA 5C3EG 3S1MH 1K73C 1XMOQ 4JI6L 2JA6H 4IJLA 3PF5A 3CQZH 3GTGH 1Y14B 1UWVA 2WAQE 3I7FA 2K5VA 1XMQQ 3EIVA 1EYGA 4A3JH 3PGZA 4FDBA 2ZJQA 1YHAA 2MQHA 3F8TA 4JBJA 4DUZQ 4DV1L 3K80C 2UUAQ 2K50A 3HOWH 2RF4A 4PMWA 4YWLA 2LXJA 1UEBA 2PMZE 5ELNA 4A3EG 2AKWB 4R4OA 1K8GA 3UDFA 3CC4A 1W3SA 1QVGA 4DV3L 3HKSA 4OX9L 3G71A 3GD7A 5C0XI 3BU2A 1JB7A 3CCLA 2Y0SG 1IBMQ 4YCVA 2K4KA 4DV0L 2UXDQ 4JI8L 4JBWA 2A1AA 2HHHQ 5C44H 3DM3A 4OWXB 3U58A 2YYZA 3A0JA 3BJUA 1YEZA 4HIDA 3A5UA 4B3SL 2ZJPA 3S14H 3M3YH 4DUZL 5M3MG 2LXKA 5C0XJ 3M4PA 4JI2L 1L0WA 5IYDG 4ME3A 1E1TA 4PZ8A 4LFCQ 5C4XG 3I2ZA 2WB1E 2NVXH 1QVFA 2HT1A 2R92G 1HNWQ 4JBMA 3H15A 4LF5L 1HJPA 3ER0A 3ZJYC 4A3LH 5C44G 1SR3A 3RN5A 1GVPA 3PCOB 3W5OA 1CKMA 4DNIA 2YU9H 1LM0A 1QVCA 3PO3G 2VW9A 4DUYQ 5FLXc 5LMUL 3IRBA 1Z47A 4H02A 1GKHA 4GN3B 4QIWE 3CPFA 5IE8A 4C3IH 1I94L 3EN2A 5BR8L 3CAMA 4DR2L 4JCVE 2UU9Q 4X65L 4JI7Q 4KHPL 2VL6A 4X66L 4A3DH 3G48A 4X66Q 3HOZH 4BA2I 4DR1L 3S2HH 3NELA 3PUVA 3ICEA 2A19A 5C4JH 4DR4Q 4GLVB 4JG2A 3AFPA 1N32L 1BKBA 2EIFA 2N78A 4LUVA 4MNOA 4OXPA 4LF7Q 4DV5L 1GM5A 2JEBI 5IYCH 4QJFA 1TWHH 4DAYB 1B7YB 4J15A 5M5YH 4LFAQ 1YNXA 3Q8DA 3GDEA 3PO2G 3S2DH 3H3VI 1IBML 3PO3H 1UE7A 1AH9A 1HZBA 5LMNL 5JEAJ 3I56A 4LF9L 3UE1A 3K7UC 3PUWA 5IY0A 3KDFA 1KD1C 1V1QA 3RLFA 3HOYH 3J81i 3STBC 1XNRQ 1VQDA 2N3SA 2IT1A 5FLMH 4IOCA 2R93H 1XPRA 4OWTB 3RZOH 4KHZA 5C3EH 1N9WA 4AYBG 5GAHC 1HNWL 3J7ZC 4HJ5A 1RIPA 1I3QH 2D0OA 1SRUA 4O0AA 3I4MH 1PH1A 1MJCA 3S15H 3H0GG 5AJ3Q 3ULPA 1Q12A 1C9OA 4YWKA 3J81j 4A3BH 2Z6KC 3W1GA 1D8LA 3BZCA 4A3LG 1HNXL 3NBHB 3CCEA 1N36Q 4JV5L 3SGIA 3KOJA 1PH2A 3PUYA 3M85A 2QA4A 2IHEA 4BA1I 1Q1EA 3FHWA 5JJKA 1CSQA 2UXBL 1G6PA 5IP9G 1VQGA 1KAWA 1WCMH 1X56A 2N8NA 2VQEQ 1VQPA 4LFAL 4UP9A 2MO1A 4A3GG 2KENA 4DR7Q 3B6YA 4AIMA 4LF7L 1P16A 1MKHA 1VQ5A 2K14A 4LW1A 1WJJA 1Y1VH 1YZ6A 2FXQA 4A3IH 4A3MH 3L0OA 3H0GH 1NBWA 4QGUA 1IZ6A 2KHIA 3PIOA 2E2HH 3U4VA 3GTKH 4P74A 1X6OA 2Y0SE 4DV7L 1SFOH 4X65Q 3G4SA 4LFBL 1WI5A 3CD6A 2VS1A 3T1YL 2OQ0A 4MZ9A 5FJ8H 1IBKQ 2A8VA 2V1CC 1T9HA 4OX9Q 4IOAA 3UE0A 3NENA 4JI3L 5M3FG 1LYLA 5IWAL 3E9IA 4BXXG 2F52A 4A3IG 4A3MG 4UPAA 3I4NH 4X62L 4JI8Q 2VY3A 2MFIA 2WB1G 1OXSC 2R6GA 1VQHA 2ZTEA 3K8AA 4OONA 4UP7A 4C3HH 4HJ7A 1XPOA 2WFWA 2Z6KA 4DKAC 5GAEC 1PA6A 1J5EQ 1C0AA 1A63A 1YBYA 3CCRA 3OW2A 5JJIA 1U0LA 4GNXB 3KF6A 4KI0A 2JJQA 2PI2E 2H5XA 4JI2Q 3HFZB 2JA7H 4OO1I 2E5LQ 1PH9A 3AYHB 3S24A 2OQKA 2XTIA 4A4IA 1VQMA 4A3FH 4BY7H 4LUOA 4LF5Q 2E2JH 1I50H 2KHJA 3PV0A 3J80c 2JK8A 2UUBL 3F2BA 2UXBQ 1PYBA 1A0IA 2PQAA 4X62Q 3CCJA 5M3MH 1GO3E 2E8GA 2OWOA 4BY1G 1HNXQ 1K0RA 2R7DA 1N36L 4JV5Q 4NPSA 2F4VQ 2HIXA 2JEAI 4LF6Q 1NY4A 2B3GA 2R93G 4LF9Q 3ULJA 4YY3L 2BH8A 3DLLA 3CCVA 2AMCB 3TREA 1W2BA 1VQJA 1OXTA 1Q46A 5M5XH 4DR6L 1SN8A 2UUBQ 4LF8Q 1L1OA 2PQAB 4AQYL 1XMOL 3UDIA 2NVQH 4PG3A 3K81C 3PSIA 1VQAA 4B3TL 1QZHA 1A62A 5IWAQ 1RL2A 3ERSX 2VZAA 1OXVA 4X64L
chains in the Genus database with same CATH superfamily
2LSSA 4RUAA 4DR4H 1X3FA 2RCNA 5KG7A 4IO9A 1PRTF 2ALYB 2Z4IA 3M9BA 3U50C 1AE2A 2VUMH 3I72A 4GC7A 3F2CA 3ETJA 2EY1A 1Q86C 4ED0A 2V9WA 2SOBA 2O5JC 2WE6A 4JUZA 2R8KA 3ND8A 4IURA 4DUYL 1TT2A 1IKLA 1X3QA 2YTVA 1MBYA 1STEA 2FMCA 3A54A 3MWDA 4DV0Q 2B63G 2AGOA 1GUOA 5IGCA 4C2MA 2PPBC 2FK3A 1X54A 5ISRA 1TA8A 3P1HA 1VQIA 4YCWA 1KBLA 3J80W 4IAJA 3R23A 3BZDB 4X6AH 3PW4A 4R8UA 4YR3A 2JEGA 4A3BB 2F3IA 1JE5A 5JPMC 2XN9C 2IBKA 4JI7L 4YY3H 1JOKA 1R4QB 5CORA 5CBAE 1EWCA 3PUXA 5BPFA 2VQFQ 5BPHA 2FLPA 4PDBA 2Z6BA 4GKJL 3AEVA 5IT9L 4G4KA 1TR5A 4PNYA 4IN3A 2JP1A 4A93G 2EPBA 3PW7A 2Q2TA 4YWMA 1EQVA 4PZ7A 4CJ0B 4ETSA 3Q8QB 1HNZL 4JI0H 1LTTD 1TWAA 1HTPA 2GPSA 4FYDA 1E7ZA 2K52A 1S72A 4QWEA 1ZYRC 2MP1A 3A74A 4POFA 3N8DA 3BYYB 2KA7A 1A8VA 4DL5A 3W1BA 1PFBA 1K0SA 1EEFD 4MV3A 1WCMG 2FPPB 3RJ0A 3NQTA 1B44D 5JPNC 5GADC 2HHHH 3K58A 2E2HA 2HHHL 4OO1G 3KBXA 2FINB 4BBRB 2VUMA 3KAJA 3M4YA 1EWIA 4L5RC 2AHOB 3DHQA 2AQ3B 3RR5A 4A2BA 2HQEA 2UUAH 2EY6A 4FXDA 2V4DA 3VR5A 3T16A 2J7ZA 1HNZQ 3K7AB 1HXYD 3SDZA 2X0SA 4C2MH 5HV6A 3RIZA 4UY8C 5C4XH 1EQRA 5C4HA 1IBKL 4AYBA 2B2WC 4IPDA 5ELCA 3EBEA 3V2TA 2QEXA 3GTOH 1KC7A 3PO2H 1U4LA 1EY7A 1WYDA 4B3SH 4BBSG 5FO7B 5KG3A 4CKBA 4F4XA 4FNFA 1ZXTA 1BDOA 4XTCS 4F88A 5CC4A 4MIUA 1HR0L 5FJ8G 3HOZG 1PZKD 4UCSA 1VQ8A 2WACA 1DJRD 1JICA 3A56A 3MWMA 4HIKA 1TWCA 1S5CD 2KCTA 3ULLA 4DV6H 1Z6HA 2ZTCA 2R87A 3BZKA 1TWAH 2CW0D 5L37A 1ASYA 5DG8A 2DJGC 4LFCH 4LF4Q 4DR6Q 1X32A 3TSSA 3KTMA 1IOWA 4FP5D 4DR3Q 4DXFA 5C5MA 5C5LA 3GIPA 2F3WA 3FKIG 3HOVH 2G9DA 3KLWA 4RAYA 4J9NA 5FLXW 4C5BA 4QF4A 5KFLA 4DGZA 2BR0A 2I87A 2NVXA 4R8NA 4CKEA 2CQOA 2JN4A 4O4IF 4JOIC 2XRSD 2W6ZA 1AUXA 1YIJA 2BOSA 5C4XB 2C9OA 5KKNB 3N41B 3GTJA 4LF8L 4ZYSA 4DV5Q 3M4IA 5IP7G 1JWMD 1B4OA 4DV2H 4LF8H 1PFNA 5KFFA 3S1RH 4YP3A 3IFDA 2A74C 3TIIA 1GYFA 1RTOA 2A69C 4K2KA 1YNJC 2XGTA 1T5XD 4YIJA 4Y7NH 1I6UA 4HTHA 1FL0A 5EAYA 3S1QH 1ZEQX 3SEBA 1EOTA 5IT9W 1EU4A 4NKLA 1BCPD 4DV7Q 2JA8B 4AH6A 4FM9A 5K36G 4K0KH 3S16H 1S0NA 2A6HC 5EBDA 4ED6A 1TQOA 2LS01 4GKJH 4BWSC 3VYTA 4CGYB 3DMUA 1FJGQ 5DEHA 4J9QA 3UDGA 3J81c 3SE7A 4NXNL 3GIKA 3I4OA 4Y52H 2D9UA 1CE8A 4PMBA 4IWXA 3I4MG 3H20A 1B6SA 1HR0H 2YV5A 4JI4L 3MXUA 3GTLH 2Z8LA 4QIWB 1YI2A 1JKJB 2A68D 1VQ7A 1QCBD 1WTRA 2JA8H 3ONAB 3QZ7A 1TWCH 4DR3L 4UHVA 4WFN3 3CC7A 1N33L 3S16B 4HQ6A 4JI3H 3OHAA 4N9PA 5HGQA 3TRZA 4TVAB 4XDXA 4I4TF 2W7OA 4B9WA 3S1NH 4UDUC 5NUCA 4DPGA 4RGMA 4Q45A 4A2AA 2AGPA 1KJJA 4QY7A 4JV5H 5FLXE 2W8KA 1N32H 4K8IA 2B8FA 3E9HA 5KIXA 1N33Q 2O4XA 3PN1A 4RU9A 1JT8A 4YB8B 4H13C 3N6RA 4J6HA 1WH2A 3JRWA 1EQQA 1ZKOA 3Q8PB 1OXUA 2PMZA 2WP8J 1CUKA 1QNKA 3GTJH 1K8AC 5DG7A 3L3OC 1N36H 4BY1B 2Z1CA 1N34H 1EUJA 5H1SE 5I9OA 1XNQQ 4FBTA 2OCEA 1V1PA 1PH5A 2RSNA 3F1ZA 1ONLA 2JA5G 1X3EA 4PV1C 2FMAA 4J9MA 5EGTA 5KFSA 4KD3A 4RNMA 2PZWA 3H91A 2ZM6Q 1B3QA 4OIKA 2OTLA 1TWFH 3S1MH 3A7LA 5C3EG 1K73C 3GTGH 3CQZH 1SYDA 3I7FA 2K5VA 3NK9A 1HA5A 3T5LA 1ILPA 4DR7H 2ZJQA 4JBJA 3MXPA 4LFAH 2XD4A 3HOWH 5EQ0A 4PMWA 3OWFA 4M8AA 5ELNA 2PMZE 4S3SA 3ORQA 2KJXA 3RAQA 2AKWB 4BBSH 2UVUA 3VA5A 4OX9L 3G71A 4IFDH 5K2MA 5ELFA 2Q8TA 1A2UA 3MVVA 2Y0SG 1HPCA 1KEEA 4YCVA 1Y1WB 3K5OA 4B3RH 5C44H 3U58A 2OXPA 3A0JA 3BJUA 4A3DB 4HIDA 2ZJPA 3S14H 4RZRA 2LXKA 1Z2OX 4DAPA 3I3CA 5KNDA 4OHJA 3OMCA 1HFNA 3GTMB 2DPIA 4ME3A 2UUCH 4A3JB 1JOOA 4PZ8A 5C8YF 2WB1E 1QVFA 2R92G 3BABA 4JBMA 3H15A 1HJPA 2F0EA 2F0QA 2HGSA 3RN5A 4R8IA 1WR2A 1Y1WA 2YU9H 3RV3A 2E75C 3VYRA 4DUYQ 1FGBD 1E2ZA 1Z47A 4QIWE 4O2BF 1LV9A 1D5MC 2MUYA 4JI7Q 1CK1A 2XSCA 4IZOA 4A3DH 4X66Q 2ALZA 1RK6A 2JEFA 3S2HH 1MI2A 1SJHD 2OH2A 3SE0A 4K14A 2A19A 5C4JH 4GLVB 5E3FA 4KY7A 4LMYA 2EIFA 4G7ZC 2N78A 1SYXB 2F4IA 2VUMB 3KF8A 1TWHH 4DAYB 1S68A 2RCFA 4J15A 2GA4B 3I4LA 5M5YH 2B63B 4HNVA 5KFUA 5T1IA 3N6XA 5KFTA 1UE7A 1R9TA 3J81W 4DK1A 2FB9A 1HZBA 5LMNL 2LMCB 3I56A 2RGVA 1RYRA 1I4HA 5ELDA 3K7UC 2NN6H 5IY0A 1V1QA 5EOYA 5JVH3 3JSNA 2WTFA 4EQNA 3STBC 4C3HB 1CQVA 2KUMA 4ZLTF 1C8CA 3DUZA 3CQZA 5KFPA 4LF6H 4TQRA 1EY9A 5KFBA 1DM0B 1D5ZC 1I4PA 1PZID 2F0LA 4HJ5A 1I3QH 1YNND 1JWSD 1SRUA 2W6QA 5BR8H 4KHPH 1R9TB 3S15H 4X62H 1U4PA 1B9NA 1KNAA 2KECA 1WD0A 3J81j 3BQ2A 2Z6KC 3H09A 4DR1H 4X3TA 3KK7A 4EBEA 1EHIA 3NBHB 4GC6A 4JV5L 1NSNS 3RV4A 2YU9B 1T94A 1Q1EA 2BE5C 2UXBL 1HA6A 4MV9A 3OPOA 3BYTB 3NSWA 4ED2A 1STYA 2N8NA 4QMGA 3RB6A 1Y69U 2SDFA 2KENA 4DR7Q 2RDGA 2C2EA 3B6YA 4DL4A 4A3IH 1QWYA 3H0GH 1NBWA 5C4JB 1HFGA 1AP0A 2KHIA 3Q2OA 1H9MA 3LMLA 2YU9A 2Y0SE 4L1KA 1U4MA 4LFBL 1QG7A 4A3FB 4BY7B 2R7ZB 2SNSA 1IBKQ 4MZ9A 3LX0A 4F50A 4OX9Q 2R7NA 4K6LA 4O3RA 2CHBD 1LT4D 1LYLA 2VQDA 4BXXG 2F52A 4G57A 2L1BA 2NVQB 4RB1A 1B33N 1JDBB 5IWAH 1N48A 4IUVA 3ND9A 1B1ZA 5T1GA 3KBGA 4C3HH 5KFNA 2WFWA 1J5EQ 2A5HA 4L63B 5KYLA 2R7ZA 2PI2E 2H5XA 4IUTA 4CJ1B 4OO1I 1PRTC 3JRXA 4Q43A 3S24A 1U9RA 2EE1A 3TP7A 2XTIA 1J5EH 4LUOA 1O78A 1XXGA 3RBDA 2EYMA 2KHJA 4HNTA 2JK8A 3F2BA 4EFEA 2UXBQ 1MSHA 1BXTA 1D1IA 4EYIB 4FF3A 2R7DA 4MN3A 2R7KA 4JV5Q 2FE3A 2A69D 2F4VQ 2HIXA 4DL7A 2B2UC 4UAIA 1NY4A 3BJYA 2K04A 4DF7A 1A3TA 2R93G 1I3QA 3GTQB 4KV6A 3ULJA 1CTMA 5CV7A 1L0XB 3DLLA 3CCVA 3TREA 4FXGC 1VQJA 4DR6L 4K5XA 2MJ8A 2ATLA 1L1OA 1XMOL 3UDIA 5IT9E 2Q8IB 3EJIA 3U9OA 4XYOA 4ZOLF 3V6JA 2NVTB 1RL2A 2JA5A 3QG1A 3ERSX 4IR9A 4KN4C 2R82A 5EPJA 4QIWA 1KC8C 2IP4A 4RCNA 2JA6G 2YZMA 5HBRB 4EGJA 3MZ5A 3P75A 1EY8A 1HZCA 3NTIA 3OTOQ 1WTXA 1XMQL 1TS3A 3FPPA 1EYDA 3FKIH 3HOVG 4FU0A 2IMWP 1EYZA 2R8JA 2L5TA 5C3WA 1WD1A 2PO4A 4WBNF 5C1OA 3OIPA 5KG0A 1FJGH 1PYSB 1HNXH 1FJGL 5C0XH 3PW5A 3HOUG 1LT6D 2KBNA 3K5HA 5IODA 3A8IE 2WAQB 3OTOL 2VUMG 2K6AA 3E0EA 2BQRA 3T53B 4LH6A 3VR3A 4C5CA 3R8BA 3GP7A 3PIO3 4DR5H 2HVQA 4F4WA 3MWEA 3VYUA 4A3KB 2E2IB 5IYDH 1W93A 1F77A 4RG1A 4DU9A 3WWVA 3E3XA 5KT3A 5CV6A 1SMYD 1PTOH 2EY5A 3BDOA 4DXGA 3K3PA 5KFJA 1SE2A 5GROA 4C3JB 2WKDA 5L1LA 4DL2A 4QWDA 3LWBA 1YJWA 4BBRG 3GTPB 5DLGA 1HUMA 4DV4Q 4JOIA 4C56C 3CMEA 4J0MA 2W6OA 1PTOC 2EZVA 5FKAC 1Q82C 4X66H 1E1OA 1GUSA 5M5WH 1YVCA 4Q44A 1SYEA 4GOPC 2QK4A 5KGUA 4GNXC 1C3OA 3S17H 4A3KH 2E2IH 3V4ZA 1VQCA 3T1HQ 2B2VC 3JAMi 4MV4A 3T51B 2R92B 4GS3A 1SLJA 3PO2B 1PYWD 3G6EA 2R7LA 4GN4B 4C3JH 2B2TC 4A3GH 4I65A 1B53A 1EY4A 1TVXA 2PYKA 2RHSB 4RHRA 4CHTB 1SE4A 4RZQA 2FKLA 2R7FA 1HZ9A 1HR0W 1UE1A 1RJRA 1UE6A 1BO0A 4KKUA 4X3SA 1K3BC 5HURA 2DIKA 4GNXA 4B3RQ 2F0OA 1SJED 2BA0A 1N8RC 1FVIA 3K59A 3K3VA 3OOCA 2Q2HA 5ELOA 3D6CA 4ALPA 4J1MA 2ICEC 1K83H 2DGYA 1JLLB 4JYAH 3CU7A 4APMA 2NN6I 2HIVA 1SCUB 3BQ1A 2UU9L 5IYBH 5JVG3 4LFCL 1IKMA 2B2YA 2JQOA 5GQOA 3T56B 2R84A 3LWUA 1K9MC 3RAXA 5J3BA 4C1NK 4CBVA 3HOXB 4DN4M 3HOXG 4WJ3M 3EROA 2CCZA 5JEAH 2F0KA 1VBGA 1CKOA 4JI0L 1OXXK 1JE4A 1C7YA 3GTPH 1PX2A 1HNZH 3KHGA 3EYYA 5IGBA 2C2DA 1KABA 2PCFB 2RDIA 2YRWA 2F3VA 3J81E 2CQAA 4DR5L 1I94Q 2W6NA 3HXLA 3E5SA 4DV4H 1ET6A 2HD3A 1P8LA 3HB9A 5L1KA 1VCIA 4BXXH 4LSXA 1ILQA 3SK8A 5C5JA 1ENCA 4POGA 4K6DA 1XNQH 2KVMA 2F0VA 1SYFA 2E2DC 4FF1A 2HCIA 3AQQA 2SNMA 3K0YA 4HMIA 3I70A 4QQBX 1UAPA 4V190 4Y7NB 4DR5Q 1JXLA 1MHWC 4ZQ3A 2I5MX 3K5IA 3KLRA 1O7LA 5BN3A 2E2IA 4KLKA 2VB2X 3L7ZC 1TWFB 3NEMA 2GN5A 4EBDA 4QW9A 2L12A 1BOSA 1X65A 2K05A 4GKKQ 3NXWA 5DLQE 3K7AH 2I5LX 4ZCKA 1DIKA 4ZHQF 1AUVA 2FK1A 3TZUA 3TP6A 1E2VA 4TQSA 3TS2A 3T5HA 4YQWA 1Q8IA 4N8FA 2IX3A 4A3FG 3CMAA 2XIWA 1CHPD 1PXUA 3NP8A 5CMDA 2CZGA 3H3VH 3RB4A 2AWNA 3C46A 3GQCA 2NWGA 4UCTA 2NZHA 3HOXH 3NBHA 3Q1KA 1IXRA 5J1ZA 1EL0A 5C44B 5IYZF 3HOUB 4ECXA 5DGAA 3SVMA 4TQUS 3K5MA 1VQFA 4B3ML 4PQXA 5FLXL 4HR7B 3MFHA 4ED1A 2NN6G 3STBD 1S03G 1S5DD 1PHJA 3TP8A 1SMXA 2O5IC 1YNNC 3E6ZX 3HOWG 1AFPA 3LGJA 1EEID 1GSOA 4ED7A 3QWNA 4JI1L 1MD2D 2AWOA 2KEEA 4JYAQ 1CI3M 3Q6SA 1Q1BA 4UCOA 3Q8RB 3QJYA 1KDBA 5M3FB 1QUQA 4IFDI 1HUNA 1T3NA 3DWAA 3J7AV 5GONF 2UXBH 4HCSA 1LT5D 4L5TA 3TDQA 5FPRA 3NWTA 1B2TA 4EEQA 1I6VC 3RLNA 3N40P 2IL8A 2NVYB 1QZGA 1ESRA 2YCHA 5JOBA 4GN5A 4EQ5A 1MIUA 2LKVA 3QZ8A 2I5HA 4A3BG 2RHQB 3V6HA 3MEHA 3PO3B 1VDZA 1KRTA 2R86A 1VQNA 4KY6A 2R7MA 4ZUIA 2EXDA 3VYSA 3SK5A 4BBRH 4DV2L 1JJ2A 2Z0SA 1HHVA 3GIJA 1I94H 5K5PA 1Z7TA 3GV5B 4YAKB 2K5HA 1S5ED 3KFUA 3AU7A 3E0JA 4A3CH 2RA4A 1EFWA 3GTGB 1I3QB 4KTAA 4DAMA 4C2MB 3N43B 4L5SA 1J5EL 3VR2A 2V4RA 4ILWA 1XNRL 2R85A 5CGKA 1NMGA 1VBHA 4LNQA 2ID0A 3H94A 1Y8NB 3MEFA 5KNBA 4A3EB 4JI5H 5JJLA 1JMCA 3F8NA 2JA6B 1F2ZA 3SXHA 2K75A 4ECRA 4KKSA 3HGBA 3KJPA 3KJOA 5A2QE 5IYBG 4TRDA 3AFQA 2AU0A 3GTLB 4JC0A 3J7YW 2BDNA 4OWWB 3M3YB 4HJ9A 3KHLA 2BCOA 1L0YB 3C1EA 4C3JG 2UUCL 4LF4L 5BR8Q 3T4AC 4A3MB 4KHPQ 3V05A 5KFGA 3VPBA 3PF4A 2JA7G 1EIFA 4JW0A 1PDQA 1VQEA 3D0FA 2O2LD 5IIFA 2ES2A 1KHIA 2K03A 3U9TA 1SNOA 1TWAB 1D2BA 5M9OA 4IJLA 2F0NA 4KN7C 3WDNA 1Y14B 1FNVA 2EOTA 3PF5A 5K36H 1WSCA 1EYGA 4KY5A 1V1OA 2JXMB 1JR0D 4FDBA 2KQ3A 1LABA 1NAPA 2NVXB 4RA8A 4C5AA 2K5WA 2UUAQ 3S2DB 2E5LH 1SNPA 4YWLA 2KSWA 4RGOS 2LXJA 4ECVA 4EGQA 1CQJB 4UFZA 4A3EG 1K8GA 3CC4A 1W3SA 1QVGA 3HKSA 3GD7A 3BU2A 1JB7A 2E74C 2JSOA 1HQMC 2X6GA 3A7AB 4DV0L 1AW7A 4JBWA 4JI8L 2HHHQ 5M5YB 1EZ8A 2E2JB 5G3LD 1I4XA 4Q0FA 4B3SL 3A5UA 4F87A 2XIGA 3HEJA 4KJOA 5M3MG 1Q90A 3QR8A 3TIGA 1ZETA 2J9GA 3A8JE 1E1TA 4QUCA 5D14A 3I2ZA 2NVXH 1KJ9A 2HT1A 5DM73 1HNWQ 1Y1VA 5KT4A 1MSGA 4C3HG 1ML0D 4LF5L 3H3VC 4A3LH 2F1MA 1SR3A 3EQLC 1KLUD 3GTKA 4DNIA 1CT1D 1LM0A 4RGNA 4FXKC 5FLXc 5LMUL 5JUMA 4H02A 1BCPB 3Q0AA 4C3IH 3EN2A 5BR8L 4DNRB 4DR2L 5C4ZA 4KHPL 2VL6A 4X66L 4ECTA 2PW5A 3HOWB 3HRZC 2EDGA 2MHVA 3J80L 4JV1A 3MAQA 1UC8A 3TMEA 5ELEA 4XXEA 3AFPA 4QUFA 2VQFH 2M00A 4LF7Q 2JEBI 4DFAA 3K5LA 1R4PB 1B7YB 3UI2A 1EZ1A 4ECQA 4LFAQ 5EZYF 2VXWA 3Q8DA 3TP5A 4IR1A 2NBFA 1AH9A 1O7ZA 5KEEA 5L9XA 5CA1F 2KEDA 2F0WA 5JEAJ 3P7JA 4MV6A 3GV8B 5E4WC 1KD1C 2W57A 2J0TD 1G2SA 5I47A 5KG5A 3HOYH 4J9KA 1XNRQ 5FLMH 2KCNA 4WD3A 1WCMB 1CFMA 2AUJD 3L4JA 3NBIA 4N8X1 1N9WA 3MFYA 3GTLA 1HNWL 3J7ZC 1RIPA 2C2RA 4R9WA 3K57A 3A8KE 1PLFA 1PTOB 1I50B 3W1GA 1OWTA 1PK8A 4EG0A 3BZCA 1JORA 1ESFA 2AGQA 1HNXL 4OL7A 2IWHA 3CCEA 1N36Q 4KJNA 5KG2A 2HVRA 3M9OB 1FD7D 1Z2PX 3GV3A 3I8ZA 5FO8B 4DL3A 3WO1A 1S0MA 3PUYA 4O42A 3KAKA 4BA1I 3FHWA 4HEDA 3HOYB 5JJKA 4MV1A 3PR4A 5IP9G 4G7OC 1WCMH 2B2WA 1VQPA 4LFAL 1V1PB 4OEMB 5A2QW 4DUZH 3KXYT 5I6YA 1GHKA 3DXJC 4LF7L 3HKZB 1TS4A 1VQ5A 3FDSA 2CW0C 4N9TA 1Y1VH 2P5ZX 1B9MA 3RBEA 3RGZA 2UVVA 1GUGA 1EUDB 3GTKH 4XQJA 4OELB 2W9CB 4X65Q 3G4SA 1WI5A 2K33A 3T1YL 5FJ8H 3S1MB 4XX0B 5M3FG 1EIGA 5LA6F 3BA8A 5CV8A 1ENFA 4A3MG 5FO9B 1LTSD 4X62L 1EZ6A 3R5FA 5LXTF 2E5LQ 4O3OA 4JPBW 3J81L 1VQHA 4UP7A 5JVLA 1TIID 2L4NA 4DKAC 1A63A 2XGQA 2B2TA 1C0AA 2CVRA 3CCRA 1EU3A 5JJIA 1I7NA 4GNXB 3KF6A 4KI0A 2JJQA 4JI2Q 3HFZB 1JOQA 2DWCA 1PH9A 1RK5A 1QILA 1VQMA 2F0IA 5LOVF 2A73B 5KYIA 2H4OA 1GSHA 3PV0A 2UUBL 3N52A 1G91A 2ZXRA 4NLGA 2PQAA 1A0IA 4X62Q 3CCJA 2RSOA 2I8CA 1GO3E 4BY1G 2YZGA 2EYFA 1HNXQ 4DV7H 1RKNA 1N36L 3R3OA 4NPSA 2G9HD 2EJGC 4LF6Q 3DWQA 1LACA 3IL8A 4JK1C 1EIHA 4DLKA 2K5QA 4LF9Q 2YRXA 4YY3L 1I4GA 3OTOH 2D2CC 3ZYYX 3SK6A 1W2BA 5F9LA 1E4EA 3VMMA 2VPSA 2X6LA 5LHY1 4LF8Q 2PQAB 2EYLA 4PG3A 3K81C 3K5NA 1DV2A 3PSIA 4V0BA 3BVGA 1VQAA 4B3TL 1EY5A 3C0FB 3H4BA 1QZHA 3GV7B 5KFRA 5CA0F 2B29A 4A75A 3MR3A 2UXDL 2F0PA 2RDFA 2F03A 2MO0A 1WCMA 1EYCA 3U4ZA 4I7ZC 4U6PA 1S9FA 1WFQA 1SNQA 4PZ6A 4DV3Q 5IP9H 4X65H 1RCVD 1TWHB 1CKNB 1QJOA 4IWYA 4ZAIA 2QDBA 1LTLA 2B8GA 3M4OB 5KFVA 1F2YA 2GLTA 1Y1WG 4DUYH 5KG4A 2ZJRA 4P73A 2ZXPA 4RKBA 4A3DG 1GXDC 1NE3A 1E4GT 2B2YC 1JJGA 2IPKD 1TWHA 2AUKA 4GKKL 3MR5A 3OSOA 1PTOD 2HJWA 5COYA 1BQQT 4UP8A 3KALA 1R9TH 3S15B 4B3MQ 2VQEL 1F9RA 1H9JA 2W71A 5JVDF 3WO0A 2WKCA 2E76C 5IGGA 3M4OH 1GGOA 3QFFA 4TUYF 5EWEA 3FP9A 1IBKH 3VDYA 1IL8A 2Q8RE 1CA5A 1B8AA 3R5HA 4UCUA 1PH7A 4TSSA 4YCUA 4APVA 1XNRH 2FLLA 2F0JA 4P71A 1XTDA 2MGSA 5KFCA 3AB9A 4G7HC 1M1KC 4CDFC 4XZ3B 2SEBD 4DNTB 5FD5A 2A6HD 5KT6A 5C6AA 1GUTA 2KHSA 3A5ZB 4Q5VA 5DG9A 3KHRA 1X9NA 3SR1A 1IYVA 4J8QA 1XNQL 5G3LF 4OGQC 4CJ2C 1H9KA 2GVAA 3GTOB 1E24A 2XRQD 2UXDH 3KLSX 4Y8VB 3FPUB 5DQHA 4K0KQ 2W70A 4GKKH 4O3NA 1J8IA 3I91A 4LJZC 2VNUD 2J4XA 1M8AA 4R4QA 2XWJB 1KJIA 3CP0A 1AZQA 3CCSA 4KHVA 1WTVA 2R3ZA 2R8GA 3MFGA 4FF2A 2DUDA 3EFXD 4B08A 4QL5A 1N32Q 1VQ4A 4JI0Q 3H40A 4IPCA 3CF5A 3JZIA 4OIJA 5FOBB 1BVSA 3C3LA 1M6VA 3URYA 2L9HA 1KQSA 2C35B 2MNAA 5AJ3L 1XJVA 5D1OB 1QOHA 5EWGA 2BA1A 5KFOA 1PH6A 3I73A 3RTXA 2AQ1B 1GHJA 4YY3Q 5F2DA 4A3JG 2JA5B 1BJTA 2PN1A 5KFDA 2CWAA 4J9RA 3GIMA 1L2FA 4GOPA 2JEIA 1EIYB 5I2YA 1F9SA 3NTKA 3CHBD 1IW7D 5D1OA 4JVZA 4I7AA 4Z9CB 5FK9C 1GD7A 1BBWA 3G8CA 3CCMA 3O13A 4DV6Q 4RNOA 1Q3LA 2M9VA 4H7BA 2OLSA 4RNNA 4M1UB 5LL6b 2UUCQ 4TKOB 2CQYA 3KHHA 2VUGA 4LWCA 3H4DA 1SBBB 2JA5H 2WAQA 4IALA 1E0BA 4HSVA 3OUUA 1K1QA 4NDXA 4RKLA 1TWCB 5D3DA 3C2PA 2OF1A 2M05A 4JI5Q 4MTNA 2WB1A 4DV4L 2A6EC 3S1NB 3HOYG 2IY5B 1X55A 5JQWA 4U68A 1EY0A 1KNEA 1PTOF 1YHQA 4CC5A 3OW7A 1XWEA 4RWSC 2YS6A 4ED3A 2WAQG 1UEAB 3T1HH 4RB0A 3D4RA 3MFIA 3CPWA 2K32A 3M9NB 4NXMH 1V51A 2B39A 4R7RA 3HZXA 1PV4A 2N49A 2HUGA 2SCUB 4O2DA 3HBLA 1BNZA 1BBUA 1Y1VG 2IX1A 4C3IB 1CQFA 4C3IG 3D4DA 4DV6L 5T14A 4KKTA 2UVRA 4EVOA 4XT3B 1IOVA 4NXNH 1SXTA 1W6KA 5CYUA 4ME5A 1Q8KA 4AQYQ 3RNUA 4IHJF 1S40A 4A3CG 2NZOA 1TAEA 5H80A 5LMNH 3M9MB 1G6ZA 3PMFA 4JI5L 1W6JA 4HIMA 4HIOA 1EFID 3WOFA 1SNDA 3S1QB 4P72A 5EKIA 1STNA 3N44B 2Z9HA 1PH3A 1B04A 4LF6L 1V43A 2AQ2B 3OMGA 4AYBB 3MA2B 2W8LA 4MHEA 1KJQA 4P2CB 2KCMA 4ODGA 1OTCA 4UCRA 3QO2A 2WINB 1UUPA 4RCOA 1NR2A 4RMFA 2YZNA 5FLMG 2ASJA 2ASLA 2R8HA 4XQNA 3GIDA 4I50F 1SNMA 2ASDA 5KG6A 3MC0B 3R93A 5KFYA 2QILA 2VQFL 3KF8B 4DAYA 3M7NA 3GLKA 1M0TA 1SYCA 2UXCQ 1RDPD 1EOVA 1KXLA 5LYJF 1RTNA 2UUAL 1HR0Q 2NU8B 1D5XC 3GO5A 3M4QA 5DNFA 1K8OA 1B70B 2DPJA 3CCQA 5J2TF 1JC7A 2BQ3A 5LMUQ 1RODA 5EWFA 1SFOA 1KRSA 4NMZA 2NVYH 1TXYA 2PNRC 1XYIA 1N34L 5C3XA 1SROA 1DCZA 4R4IA 3P20A 2F4VL 4EX5A 3CRKC 3NGDA 2DN8A 1NCVA 3PIP3 2F4VH 4JI8H 4AYBE 4ZQIA 2EYJA 4GLAC 3GTPA 3DWPA 1DXMA 4XQQA 5BN4A 3JC66 5HY6A 1BCPF 4ZKBB 3TINA 1MJEA 2EQSA 2CW8A 2J6TA 3Q24A 2Z4HA 2NZ1D 3IFTA 5JJZA 5KX5F 1K3RA 3TBIB 2D62A 2DJFC 1BUVT 1TWGH 2CWPA 3H6MA 3NE5B 1Y8OB 1XMOQ 4JI6L 2R61A 2D5DA 2WAQE 2VOBA 1KDCA 3EIVA 1SEIA 5IGFA 4XYLB 4DV5H 4A3JH 1XX8A 3PGZA 1YHAA 2IJ0A 2MQHA 1U4RA 2OT2A 4DV1L 2K50A 2RF4A 4DR2H 1V4YA 4DAVA 1SSOA 2HDLA 4R4OA 4KMUC 3UDFA 4YR2A 1LTRD 5C0XI 4OX9H 1TU2B 3W3AA 4LSAA 2K4KA 2ZDQA 1K8MA 2WYOA 5HGTA 4OWXB 2IA6A 2YYZA 1YEZA 2UVWA 3M3YH 4EBCA 3VA7A 4TV9F 1NR4A 3G6VA 4DR6H 4IUQA 2DLNA 1STGA 4CDDC 4RB2C 5C4XG 4LFCQ 2F0SA 4ECUA 2CH4W 5E4XA 2VA3A 3PZPA 5A2QL 4E4TA 5KFEA 5DQGA 3QIAA 3LNNA 3ZJYC 5C44G 2QYZA 1GVPA 3PCOB 2VPQA 1QVCA 4K8JA 1M4VA 5L1JA 5CV4A 4HNUA 1J9OA 4GN3B 1BR9A 3F2UA 4QWBA 3CPFA 1QNUA 1I94L 3CAMA 1E4EB 5J2UF 1O80A 5KT7A 3G48A 2NVYA 4BA2I 2F0MA 4QB4A 2A68C 3NELA 3PUVA 1S5BD 3DM1A 4DR4Q 4BWGB 5I2XA 1BKBA 2RDJA 3CQZB 4LUVA 3VPCA 4OXPA 4J9OA 1NNXA 1UNSA 4DV5L 1GM5A 3PW0A 1L2ZA 1PFMA 4UCVA 2PW7A 1IBLH 1YNXA 3GDEA 1SNCA 3PO3H 1TY2A 3A55A 1X3PA 4LF9L 2RGRA 3PUWA 3CVZA 2W9AA 3RLFA 1SFOB 5J22A 1VMCA 1VQDA 2N3SA 4IOCA 5D1PA 5KFWA 2Y0SA 1HQRD 4OWTB 2L55A 1GOZA 1K1SA 1ZQ7A 4MA0A 3RUPA 4KHZA 4XT1B 5A35A 5C3EH 3BQ0A 5EPKA 4AYBG 5GAHC 2VB3X 4O0AA 3EA6A 3I4MH 4O4HF 1PH1A 3H0GG 5EPLA 3H0GB 3ULPA 1C9OA 3HP3A 4A3BH 1MGSA 1I7LA 1D8LA 3MR2A 4RAUC 1KAAA 3VPDA 3MJFA 1A15A 2KCCA 3SGIA 2TSSA 3KOJA 1PH2A 1JIHA 4EEYA 3VR4A 3J80E 1WTHA 2IHEA 3M85A 2LFNA 3Q22A 1JCKB 3TZDA 3W2DA 1VQGA 1X56A 2VQEQ 4A3GG 1GSAA 4UP9A 3G6XA 2EXZA 4WJWA 3ETHA 1P16A 4PMCA 2ENBA 2K14A 5EKLA 3I4MB 2MCTA 3NHHA 4A3MH 1PRTD 3L0OA 1Z2NX 4EGVA 1AN8A 2E2HH 3PIOA 3U4VA 2FK2A 4FS2A 3BVMA 1X6OA 3BDLA 4DV7L 1KTKA 5KFKA 2VS1A 2OQ0A 2A8VA 2BDOA 2V1CC 5KNCA 5DM63 3UE0A 3NENA 2B2VA 2PQEA 5IWAL 3E9IA 5M3MB 3V6KA 4FS1A 3QOLA 4UPAA 5CR3A 2DNEA 4JI8Q 2FLNA 2WB1B 2WB1G 3K8AA 2R6GA 4LF5H 3FMCA 4OONA 1PA6A 2FJZA 1GUWA 4HYKA 1YBYA 5F9NA 1H9SB 2QCPX 1U0LA 3GTOA 5LMUH 2E2HB 1TS5A 3MWYW 1T5EA 3AYHB 4F4ZA 2C28A 2OQKA 1C30A 4A3FH 4BY7H 1A6XA 1N56A 4LF5Q 4DA2A 4J9PA 3SI8A 2E2JH 5BMVF 3DEOA 1OO9B 1RJTA 2RKSA 3SK4A 1PYBA 4YJ2F 4J9LA 2YS7A 5M3MH 2H1EA 1AZPA 4FVMA 1Y1VB 2E8GA 1M7JA 1ULZA 3FVQA 2V4QA 1H9SA 5CB4F 4IUUA 3FKIB 3OUZA 2B3GA 1IYUA 3MTSA 3JAMW 2O03A 4GZYC 2YW2A 1IBMH 4IRDA 1A3VA 1LTAD 2AMCB 3BVZA 2FFKB 1BCPC 5M5XH 4XYQA 1GLVA 1SN8A 2UUBQ 1SE3A 1VKZA 4CKCA 1FR3A 2PBZA 4MAMA 4J9SA 4ECYA 2F0HA 3M7GA 1LTID 1YNJD 5IWAQ 2VZAA 1OXVA 4BS9A 5IP7H 4X64L 4JI4Q 2FMMA 4QW8A 1XMQH 1FNWA 3TEHB 3EVQA 1VAJA 5LMNQ 1ZYRD 1ET9A 4JYAL 1MZBA 3DF7A 3GTQH 1Z9FA 3JAMc 1L1OB 4NXNQ 4U673 2JYOA 1IL2A 2UU9H 2N55A 3VR6A 1Q81C 3G7LA 3KDFB 5M5XB 1VS0A 2M2LA 4JI3Q 2K01A 5IT9c 4X64Q 2ASBA 3J80i 1KDAA 4M7EA 3EPGA 5E7NA 2W9BA 3RB3A 3Q23A 1H9RA 2D0PA 3I90A 2B2UA 3FDTA 4NXMQ 1BXRA 5EBCA 1UE5A 2NU6B 2K5NA 4KD4A 2XNAC 2I46A 3FRPB 3T5KA 4DR1Q 1EQTA 3L9AX 4ME6A 1UNNC 4EYHB 3RF2A 1AEXA 1IBLQ 5I6WA 1STAA 3V4SA 1UC9A 4TV8F 2R92A 4JI6Q 2L15A 2YTXA 1NJIC 4O4LF 1SE8A 3R2IA 1VQ9A 1XPUA 1EUCB 5DQIA 1LUZA 1FGUA 3CKIB 3IN5A 3RN2A 5DGBA 1M90C 1NUCA 1RHPA 1W96A 4CDCC 3T5JA 4FO2A 4O2AF 3G6JB 1F2MA 2NVTH 2UXCL 1YJ9A 5KFMA 1H95A 5LP6F 4MTDA 4DV2Q 4GLXA 2F0FA 2PVPA 1I5FA 3Q8SB 4MA5A 3OHXC 1WVLA 4YHHH 5GAGC 1A9XA 3CW2C 1D6EC 1PH4A 2K28A 3CXCA 3GILA 3BDCA 3PR5B 4YJ3F 1SEBD 5LMNW 2JA9A 4IFDJ 3RLOA 2W7PA 1DD2A 4ABNA 2XC9A 4NXML 4BY7G 2R7ZG 2ZM6L 2CH4A 4H44C 4I7HA 3KF6B 4JI7H 2JA8G 4F8MA 1O7YA 1PH8A 3S17B 4FF4A 1D7QA 3K0XA 4K0KL 1IYJB 2EYHA 5EDWA 3GTQA 2WV6D 1STHA 2NUAB 5FPOA 1VQBA 4F7XA 4JI1Q 1DYQA 1HH2P 4L5QA 4DR7L 1DGSA 3GTMA 4O3PA 1FYCA 1YHBA 3C1FA 4DR2Q 4A3GB 1U5KA 3DEPA 4O3SA 2FPIB 4L8JA 1ICWA 4DK6C 4YR0A 4WJ4A 4IFDG 4P75A 4LK1C 5JH7F 3I12A 5KG1A 4ZRZA 4ZUJA 5C0XG 1RF2D 3I55A 2ZXOA 4DR4L 1V9PA 3R5XA 2XWBB 3PVXA 1NTGA 4NP5A 3V96A 4ZK9B 5M5WB 1XTCD 1CM9A 3PW2A 1LLRD 4KK7A 1G291 2L11A 5KFHA 1JJCB 4LMQD 1ASZA 1TWFA 4B3SQ 3E5NA 2YTYA 3TQTA 2R92H 1Q7YC 3GTGA 4LFBQ 4HCEA 1IW7C 1L1OC 3D8GA 3F2DA 3T1YH 2DY8A 1JB3A 4LH7A 4HSPA 4ZI7F 1CA6A 2OTJA 2ATWA 3T13A 2B63A 3NTHA 4K2LA 3BS1A 3RZDH 4EFBA 4ED8A 4HJ8A 3BG5A 2J6UA 4ECSA 1CKNA 1SMYC 1VQ6A 2XVSA 4CC6A 3QOJA 2ZM6H 5KFQA 1CQIB 2UXCH 1AN7A 1TKWB 3HKZE 4X64H 1J6QA 2Y0SB 4OO1H 1BBXC 2W9CA 1FNUA 5KFXA 3L4KA 3T1YQ 5E1FA 3S9WA 3ORRA 1QE6A 1IBLL 2BH2A 2XCAA 1F2LA 1N34Q 1ZHQA 4HR7A 4U7CA 4BBSB 1JWUD 1O7IA 3KLSA 3RZDB 2Q2UA 4IPGA 2F0TA 4ZKCB 2HQLA 1S3OA 4JI4H 1Y1WH 1PFSA 1ICFB 3OSNA 1C48A 2PNHA 4B3MH 1N33H 1QUQB 4JBKA 1YITA 3GTMH 1HRJA 4F4YA 4A76A 2RVLA 4I55F 3HS0C 2QDLA 2RBMA 2CKZB 3IKJA 4HMJA 1VQKA 4AQYH 3TQ1A 3RMHA 1ZHSA 2X69A 3L2PA 4B3TH 5BN5A 2JEJA 1VQLA 3IAYA 4C1NI 4DK0A 4RB3C 4DK3C 3J7AF 4QWCA 1SYGA 5KRUA 1KL9A 1CHQD 3HOUH 2I07B 2JE6I 2V59A 5I4DA 3MXGA 2NUCA 1VMPA 3BA9A 1BF4A 4MV7A 2IHFA 1HZAA 3MXNB 1RYSA 2IX0A 1F9PA 2QGQA 5KFZA 5EJWA 5J39A 2Q2IA 3PUZA 1D1KA 4MTEA 3PIPA 4EQOA 4MV8A 4BY1H 2GVBA 5IYCG 4CDEC 4R4TA 4DV1Q 2FPGB 2P0AA 4YHHL 4LFBH 4YHHQ 2B63H 4DV0H 4LUZA 2LY7A 1CSPA 1X3GA 3TS0A 4FBUA 4X3KA 4GKJQ 1AE3A 5M3FH 4A3KG 3CC2A 2BQUA 5TSSA 3T1HL 3N42B 3NUCA 4K5VA 2KOLA 2WIIB 4R4CA 2I0QA 3I4NG 3MR6A 4NB3A 1O75A 3CCUA 2E5LL 4IRKA 4NW2A 1YJNA 2ZDGA 2EYOA 2PI2A 4IQZA 2R6FA 1E3PA 1S10A 4RHSA 1E22A 3D4WA 4JI6H 1JQYD 5JEAG 1KJ8A 2HCCA 1CS0A 1HTLD 1WTQA 2AQ4A 2EJMA 2G5DA 1B3AA 1LO5D 3KYHC 1DV1A 4A93H 1BNCA 1KIXA 3H0GA 4DV1H 2FJ2A 3OHBA 1G51A 4JI1H 3JAME 2DZDA 4R8UB 2C5CA 1DOMA 2F0UA 4JI2H 3D3RA 3HKZG 1I6HH 3J7AK 3KUPA 4B3RL 4Q8FA 3J7A5 2RQXA 5C1PA 5DAUA 3OYYA 4IJHA 1DZ1A 4GOPB 1SAPA 1NMFA 2NU7B 2CFMA 4DR3H 2BE5D 1I4QA 5CAEB 3S14B 2YYAA 1VQOA 3D6WA 1EYAA 2EJFC 4HJAA 1LTBD 3UDXA 3TQYA 1PVOA 4R1JA 2K7VA 2ZTDA 4IUNA 4A3IB 2W6MA 3OSPA 5LL6X 4LF4H 4Q0YA 3X3NA 4IPHA 4XIGS 2GPWA 1WOCA 3RD4A 3HOZB 4B3TQ 1DOLA 2R7ZH 4A3EH 3D31A 2ZT9C 2JA6H 1SDFA 1I6HB 5IGDA 3R2TA 3LP8A 2R93A 1UWVA 1XMQQ 1B6RA 4PWQA 4E6IA 1C4QA 4LAAA 1PMRA 3F8TA 4DUZQ 3U9SA 4EQPA 3K80C 2C00A 3HKZA 3HOVB 4X3UA 4B9XA 2EVBA 1PRTB 1UEBA 3S2HB 3IG0A 1TY0A 4DV3L 2FHTA 3CCLA 2NYZD 1IBMQ 3GTJB 1JDEA 2UXDQ 2I80A 1VF7A 2R93B 2A1AA 5I9PA 2XCPA 3DM3A 2F0DA 3RZOB 1BGWA 4A93B 4DUZL 1GJXA 3PQIA 5C0XJ 3M4PA 2F0GA 3SHLA 3NWSA 1L0WA 5IYDG 3S1RB 4JI2L 2ICIA 2EY2A 3RFCA 1S5FD 4IUPA 5D65A 2NTTA 3ER0A 5FD6A 3W5OA 5C3EB 1CKMA 1RJQA 4HN7A 3FKIA 3PO3G 2VW9A 3IRBA 2IW3A 4ULLA 1GKHA 2NTSA 5KT5A 5IE8A 1I4RA 2QW7A 2UU9Q 4JCVE 5EKKA 4X65L 2XGPA 3HOZH 2VR1A 1LT3D 4RAZA 2XCLA 4LF7H 4DR1L 3GIIA 4MTKA 2V5AA 2FP4B 3ICEA 1RD9D 4JV0A 2TMPA 4JG2A 1N32L 3GTKB 3LWEA 4MNOA 1VF5C 5IYCH 4QJFA 2JA7A 3PO2G 3S2DH 4K5WA 3H3VI 1S4ZA 1IBML 3FEWX 1T36A 2UUBH 3RGXA 1EY6A 1A2TA 2ZDHA 1I50A 3UE1A 4JV2A 3KDFA 2K5DA 3AMUA 1XMOH 2QKIC 4XYMB 2JA6A 3J81i 2VQEH 2QEJC 3ERQA 2IT1A 2R93H 2DNCA 1XPRA 3EPIA 1CZGA 3RB0A 1HNWH 3RZOH 4RUCA 5CV9A 2W9BB 2D0OA 1MJCA 2YL2A 5AJ3Q 3OWEB 1SYBA 3UFXB 2ZJTA 5DLFA 1Q12A 2A6ED 4YWKA 1LTGD 2OEOA 3JAML 4A3LG 4DV3H 1GUNA 2HDMA 3GIQA 3RUZA 4ECZA 3NQIA 4HAEA 1E2WA 1II3A 1IHZA 2QA4A 4RGTA 3G6YA 5IOCA 1CSQA 4IZ8A 3FMAA 1G6PA 1K28A 2N88A 4QWAA 1KAWA 2MO1A 1WTPA 1F9QA 1S0OA 1Y8PB 4AIMA 4QCLA 4DL6A 1MKHA 4LW1A 1WJJA 1YZ6A 2FXQA 3K6OA 2DY7A 1S97A 5D8DA 4QGUA 1IZ6A 5IGEA 1DOKA 4P74A 4LF9H 1SFOH 5CV5A 1K83A 4ECWA 2VA2A 3CRLC 1A3UA 1CZWA 3CD6A 2W6PA 1TWGB 1T9HA 4IOAA 5AFWA 4IRCA 4WORA 4JI3L 1QB5D 4RH6A 1M0WA 4Q8EA 1JX4A 2HVSA 4A3IG 1STBA 3ITPA 3I4NH 1FKAH 3GQBA 4WRDA 1WTWA 3BAAA 2VY3A 2MFIA 1OXSC 1XPOA 2ZTEA 4HJ7A 2L0CA 1G2TA 1ENAA 1E4FT 2Z6KA 5LL6S 5GAEC 1PZJD 1V8QA 3OIQA 1K83B 2EYPA 3MHBA 3OW2A 4YBZB 2JA7H 1XDNA 4G3IA 1KLGD 3QB3A 1EWHA 5ELBA 1TWGA 5KFIA 3WNZA 3GV6A 4A4IA 1G8ZD 5KFAA 4ID6A 4L6TB 5D3IB 2C22A 1I50H 2R8IA 3J80c 3WOEA 2J6SA 1HCZA 4O3QA 2PZUA 2RDHA 3TN2A 2OWOA 3BG3A 3JSLA 2PZTA 3I4NB 1K0RA 2CW7A 2JEAI 5CBEE 2QF7A 2WDTA 4RFBA 4M9UA 2BH8A 3NPPA 2JA7B 3UQ8A 4H0LC 3HG9A 5L1IA 4YAJB 1OXTA 1Q46A 3MXNA 2K1BA 4O1NA 1TS2A 5JAVA 4AQYL 1DONA 1RJPA 2NVQH 1B50A 2V58A 2NB0A 3X3MA 5KT2A 1A62A 2MPMA 2NU9B 2PMZB 1WTOA
chains in the Genus database with same CATH topology
2LSSA 2B29A 4A75A 1KC8C 4JI4Q 2UXDL 3TEHB 2JA6G 2MO0A 1X3FA 2RCNA 3U4ZA 5LMNQ 1HZCA 1XMQL 1WFQA 3OTOQ 4IO9A 4PZ6A 3FKIH 2ALYB 4DV3Q 3M9BA 3U50C 3HOVG 5IP9H 4JYAL 1AE2A 2VUMH 3GTQH 1Z9FA 3JAMc 3F2CA 1L1OB 1Q86C 4NXNQ 1IL2A 1CKNB 1PYSB 1Q81C 3KDFB 4DUYL 1VS0A 1LTLA 1FJGL 4JI3Q 1Y1WG 2YTVA 5IT9c 3HOUG 2ZJRA 4X64Q 2KBNA 4P73A 2ASBA 3J80i 4DV0Q 2B63G 5E7NA 4A3DG 1NE3A 3OTOL 2VUMG 2D0PA 1X54A 3E0EA 4NXMQ 1JJGA 1VQIA 1UE5A 4YCWA 2K5NA 4GKKL 4X6AH 5IYDH 4UP8A 1R9TH 4RG1A 4DR1Q 3WWVA 4B3MQ 2VQEL 2F3IA 1IBLQ 1JE5A 5GROA 4JI7L 3M4OH 4JI6Q 2L15A 2YTXA 3PUXA 1NJIC 2VQFQ 1SE8A 4BBRG 1YJWA 1VQ9A 1XPUA 3FP9A 1LUZA 1FGUA 4DV4Q 4JOIA 3CMEA 3RN2A 4GKJL 3AEVA 3VDYA 1M90C 1B8AA 1PH7A 4YCUA 4APVA 1Q82C 1E1OA 5M5WH 1YVCA 4GOPC 4A93G 2Q2TA 4YWMA 2NVTH 4GNXC 4PZ7A 4P71A 1XTDA 4A3KH 1YJ9A 1HNZL 2E2IH 3S17H 2UXCL 1H95A 1VQCA 4DV2Q 4GLXA 3JAMi 3T1HQ 1M1KC 1I5FA 1E7ZA 2K52A 1S72A 4GS3A 1SLJA 5GAGC 3CW2C 3A74A 3G6EA 4POFA 1PH4A 4GN4B 4C3JH 4A3GH 3CXCA 2RHSB 5LMNW 1A8VA 2JA9A 4IFDJ 3RLOA 3A5ZB 3W1BA 1X9NA 2R7FA 1HZ9A 1XNQL 1HR0W 1UE1A 1UE6A 4NXML 4BY7G 2R7ZG 2ZM6L 1WCMG 2GVAA 4GNXA 3KF6B 1E24A 5GADC 2JA8G 2BA0A 4B3RQ 1N8RC 1FVIA 1PH8A 4ALPA 2Q2HA 5ELOA 2HHHL 1D7QA 4OO1G 3K0XA 4K0KL 1IYJB 1K83H 2DGYA 4K0KQ 2VNUD 1VQBA 1EWIA 4R4QA 4JI1Q 1HH2P 4L5QA 2AHOB 4L5RC 4DR7L 2NN6I 2HIVA 1DGSA 3RR5A 3CP0A 1YHBA 4DR2Q 2UU9L 5IYBH 3CCSA 1U5KA 4LFCL 5GQOA 2JQOA 4DK6C 2DUDA 4WJ4A 1K9MC 4IFDG 4P75A 1HNZQ 5J3BA 3HOXG 4WJ3M 5C0XG 4QL5A 2CCZA 4C2MH 1VQ4A 4DR4L 3I55A 4JI0Q 1N32Q 4UY8C 1CKOA 4IPCA 1OXXK 1V9PA 5C4XH 1EQRA 3CF5A 1C7YA 1BVSA 1IBKL 4JI0L 4IPDA 1NTGA 3EBEA 2QEXA 3GTOH 3PO2H 1KQSA 1WYDA 4DR5L 2C35B 2MNAA 1I94Q 4BBSG 5AJ3L 1XJVA 2BA1A 1PH6A 1G291 1P8LA 1VCIA 1JJCB 4BXXH 1ASZA 4YY3Q 4XTCS 4B3SQ 4A3JG 4POGA 2YTYA 2R92H 1Q7YC 1HR0L 4LFBQ 5FJ8G 1L1OC 3HOZG 2CWAA 3F2DA 1VQ8A 1L2FA 3AQQA 4GOPA 2OTJA 2ATWA 1EIYB 4QQBX 3RZDH 4DR5Q 4HJ8A 4HIKA 3ULLA 2I5MX 2KCTA 1CKNA 1VQ6A 2ZTCA 1GD7A 4KLKA 3L7ZC 1BBWA 3BZKA 1TWAH 3CCMA 3NEMA 2GN5A 4DV6Q 1ASYA 3HKZE 1J6QA 4LF4Q 1X65A 2UUCQ 4GKKQ 4DR6Q 5DLQE 3K7AH 4LWCA 2I5LX 2JA5H 3T1YQ 4DR3Q 3TS2A 2BH2A 3FKIG 1IBLL 3HOVH 3KLWA 4A3FG 3CMAA 1N34Q 2Q2UA 1O7IA 3H3VH 2AWNA 4IPGA 2CQOA 4JOIC 2HQLA 2NZHA 4MTNA 1S3OA 3HOXH 4DV4L 4JI5Q 3HOYG 1Y1WH 1IXRA 1PFSA 1X55A 1YIJA 2IY5B 2PNHA 1YHQA 4TQUS 4LF8L 1QUQB 4JBKA 4DV5Q 2WAQG 5IP7G 1VQFA 4B3ML 3S1RH 1YITA 3GTMH 4A76A 3CPWA 2NN6G 3STBD 2XGTA 4Y7NH 2CKZB 1PHJA 1VQKA 1SMXA 5EAYA 1FL0A 3S1QH 3HOWG 3LGJA 3L2PA 2N49A 1PV4A 4O2DA 1VQLA 4JI1L 4JYAQ 2AWOA 4DV7Q 4AH6A 1Q1BA 1BBUA 4DK3C 1Y1VG 3S16H 5K36G 1QUQA 4IFDI 1KL9A 2IX1A 3HOUH 4DV6L 2JE6I 1FJGQ 3UDGA 3J81c 4L5TA 2IHFA 1HZAA 3MXNB 1Q8KA 4NXNL 2IX0A 2QGQA 4AQYQ 3I4OA 3RNUA 3GTPH 4Y52H 2Q2IA 3PUZA 1S40A 2NZOA 3RLNA 4A3CG 3PIPA 4HIMA 4JI5L 4HIOA 1QZGA 3I4MG 4BY1H 2GVBA 4P72A 4GN5A 4EQ5A 1MIUA 2YV5A 4R4TA 5IYCG 4DV1Q 1PH3A 4JI4L 3GTLH 4YHHL 1YI2A 2I5HA 4A3BG 2RHQB 4YHHQ 4LF6L 2B63H 4LUZA 1V43A 1CSPA 1X3GA 3TS0A 1VQ7A 2JA8H 4GKJQ 1AE3A 1TWCH 1KRTA 4DR3L 3CC7A 5M3FH 1N33L 4A3KG 2KCMA 3CC2A 1VQNA 1OTCA 2EXDA 4BBRH 4DV2L 5HGQA 3T1HL 1JJ2A 2Z0SA 3TRZA 4TVAB 4R4CA 2I0QA 3I4NG 4NB3A 3S1NH 4RMFA 3CCUA 2E5LL 5FLMG 2K5HA 4DPGA 1YJNA 3KFUA 2PI2A 4A3CH 4QY7A 1EFWA 1E3PA 4DAMA 1E22A 2VQFL 3KF8B 5JEAG 4L5SA 3M7NA 3E9HA 1J5EL 1N33Q 2UXCQ 1JT8A 1KXLA 1EOVA 4BBSH 1XNRL 3KYHC 2UUAL 4A93H 1NMGA 1KIXA 1HR0Q 4LNQA 2ID0A 3GO5A 3M4QA 3MEFA 1B70B 1G51A 1EQQA 3CCQA 5JJLA 1JMCA 5LMUQ 1OXUA 3HKZG 1KRSA 2WP8J 1I6HH 2NVYH 1CUKA 1TXYA 2K75A 3GTJH 1N34L 1K8AC 4B3RL 1SROA 3J7A5 4R4IA 2F4VL 3OYYA 4IJHA 1EUJA 3KJPA 3KJOA 5IYBG 4EX5A 4GOPB 3AFQA 1NMFA 4JC0A 2CFMA 5H1SE 4AYBE 1XNQQ 4GLAC 1VQOA 4OWWB 2OCEA 4HJ9A 2UUCL 4HJAA 3JC66 3UDXA 3TQYA 5HY6A 4R1JA 2ZTDA 5BR8Q 3F1ZA 1PH5A 4LF4L 4KHPQ 1PVOA 3PF4A 1MJEA 2EQSA 1EIFA 2JA5G 2JA7G 1X3EA 4IPHA 4XIGS 1VQEA 3D0FA 1WOCA 4B3TQ 2ES2A 1KHIA 2ZM6Q 1K3RA 2R7ZH 5IP7H 2D62A 4A3EH 3D31A 2OTLA 1TWFH 1TWGH 2CWPA 5C3EG 3S1MH 1K73C 1XMOQ 4JI6L 2JA6H 4IJLA 3PF5A 3CQZH 3GTGH 1Y14B 1UWVA 2WAQE 3I7FA 2K5VA 1XMQQ 3EIVA 1EYGA 4A3JH 3PGZA 4FDBA 2ZJQA 1YHAA 2MQHA 3F8TA 4JBJA 4DUZQ 4DV1L 3K80C 2UUAQ 2K50A 3HOWH 2RF4A 4PMWA 4YWLA 2LXJA 1UEBA 2PMZE 5ELNA 4A3EG 2AKWB 4R4OA 1K8GA 3UDFA 3CC4A 1W3SA 1QVGA 4DV3L 3HKSA 4OX9L 3G71A 3GD7A 5C0XI 3BU2A 1JB7A 3CCLA 2Y0SG 1IBMQ 4YCVA 2K4KA 4DV0L 2UXDQ 4JI8L 4JBWA 2A1AA 2HHHQ 5C44H 3DM3A 4OWXB 3U58A 2YYZA 3A0JA 3BJUA 1YEZA 4HIDA 3A5UA 4B3SL 2ZJPA 3S14H 3M3YH 4DUZL 5M3MG 2LXKA 5C0XJ 3M4PA 4JI2L 1L0WA 5IYDG 4ME3A 1E1TA 4PZ8A 4LFCQ 5C4XG 3I2ZA 2WB1E 2NVXH 1QVFA 2HT1A 2R92G 1HNWQ 4JBMA 3H15A 4LF5L 1HJPA 3ER0A 3ZJYC 4A3LH 5C44G 1SR3A 3RN5A 1GVPA 3PCOB 3W5OA 1CKMA 4DNIA 2YU9H 1LM0A 1QVCA 3PO3G 2VW9A 4DUYQ 5FLXc 5LMUL 3IRBA 1Z47A 4H02A 1GKHA 4GN3B 4QIWE 3CPFA 5IE8A 4C3IH 1I94L 3EN2A 5BR8L 3CAMA 4DR2L 4JCVE 2UU9Q 4X65L 4JI7Q 4KHPL 2VL6A 4X66L 4A3DH 3G48A 4X66Q 3HOZH 4BA2I 4DR1L 3S2HH 3NELA 3PUVA 3ICEA 2A19A 5C4JH 4DR4Q 4GLVB 4JG2A 3AFPA 1N32L 1BKBA 2EIFA 2N78A 4LUVA 4MNOA 4OXPA 4LF7Q 4DV5L 1GM5A 2JEBI 5IYCH 4QJFA 1TWHH 4DAYB 1B7YB 4J15A 5M5YH 4LFAQ 1YNXA 3Q8DA 3GDEA 3PO2G 3S2DH 3H3VI 1IBML 3PO3H 1UE7A 1AH9A 1HZBA 5LMNL 5JEAJ 3I56A 4LF9L 3UE1A 3K7UC 3PUWA 5IY0A 3KDFA 1KD1C 1V1QA 3RLFA 3HOYH 3J81i 3STBC 1XNRQ 1VQDA 2N3SA 2IT1A 5FLMH 4IOCA 2R93H 1XPRA 4OWTB 3RZOH 4KHZA 5C3EH 1N9WA 4AYBG 5GAHC 1HNWL 3J7ZC 4HJ5A 1RIPA 1I3QH 2D0OA 1SRUA 4O0AA 3I4MH 1PH1A 1MJCA 3S15H 3H0GG 5AJ3Q 3ULPA 1Q12A 1C9OA 4YWKA 3J81j 4A3BH 2Z6KC 3W1GA 1D8LA 3BZCA 4A3LG 1HNXL 3NBHB 3CCEA 1N36Q 4JV5L 3SGIA 3KOJA 1PH2A 3PUYA 3M85A 2QA4A 2IHEA 4BA1I 1Q1EA 3FHWA 5JJKA 1CSQA 2UXBL 1G6PA 5IP9G 1VQGA 1KAWA 1WCMH 1X56A 2N8NA 2VQEQ 1VQPA 4LFAL 4UP9A 2MO1A 4A3GG 2KENA 4DR7Q 3B6YA 4AIMA 4LF7L 1P16A 1MKHA 1VQ5A 2K14A 4LW1A 1WJJA 1Y1VH 1YZ6A 2FXQA 4A3IH 4A3MH 3L0OA 3H0GH 1NBWA 4QGUA 1IZ6A 2KHIA 3PIOA 2E2HH 3U4VA 3GTKH 4P74A 1X6OA 2Y0SE 4DV7L 1SFOH 4X65Q 3G4SA 4LFBL 1WI5A 3CD6A 2VS1A 3T1YL 2OQ0A 4MZ9A 5FJ8H 1IBKQ 2A8VA 2V1CC 1T9HA 4OX9Q 4IOAA 3UE0A 3NENA 4JI3L 5M3FG 1LYLA 5IWAL 3E9IA 4BXXG 2F52A 4A3IG 4A3MG 4UPAA 3I4NH 4X62L 4JI8Q 2VY3A 2MFIA 2WB1G 1OXSC 2R6GA 1VQHA 2ZTEA 3K8AA 4OONA 4UP7A 4C3HH 4HJ7A 1XPOA 2WFWA 2Z6KA 4DKAC 5GAEC 1PA6A 1J5EQ 1C0AA 1A63A 1YBYA 3CCRA 3OW2A 5JJIA 1U0LA 4GNXB 3KF6A 4KI0A 2JJQA 2PI2E 2H5XA 4JI2Q 3HFZB 2JA7H 4OO1I 2E5LQ 1PH9A 3AYHB 3S24A 2OQKA 2XTIA 4A4IA 1VQMA 4A3FH 4BY7H 4LUOA 4LF5Q 2E2JH 1I50H 2KHJA 3PV0A 3J80c 2JK8A 2UUBL 3F2BA 2UXBQ 1PYBA 1A0IA 2PQAA 4X62Q 3CCJA 5M3MH 1GO3E 2E8GA 2OWOA 4BY1G 1HNXQ 1K0RA 2R7DA 1N36L 4JV5Q 4NPSA 2F4VQ 2HIXA 2JEAI 4LF6Q 1NY4A 2B3GA 2R93G 4LF9Q 3ULJA 4YY3L 2BH8A 3DLLA 3CCVA 2AMCB 3TREA 1W2BA 1VQJA 1OXTA 1Q46A 5M5XH 4DR6L 1SN8A 2UUBQ 4LF8Q 1L1OA 2PQAB 4AQYL 1XMOL 3UDIA 2NVQH 4PG3A 3K81C 3PSIA 1VQAA 4B3TL 1QZHA 1A62A 5IWAQ 1RL2A 3ERSX 2VZAA 1OXVA 4X64L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LSS A;  2B29 A;  4A75 A;  1KC8 C;  4JI4 Q;  2UXD L;  3TEH B;  2JA6 G;  2MO0 A;  1X3F A;  2RCN A;  3U4Z A;  5LMN Q;  1HZC A;  1XMQ L;  1WFQ A;  3OTO Q;  4IO9 A;  4PZ6 A;  3FKI H;  2ALY B;  4DV3 Q;  3M9B A;  3U50 C;  3HOV G;  5IP9 H;  4JYA L;  1AE2 A;  2VUM H;  3GTQ H;  1Z9F A;  3JAM c;  3F2C A;  1L1O B;  1Q86 C;  4NXN Q;  1IL2 A;  1CKN B;  1PYS B;  1Q81 C;  3KDF B;  4DUY L;  1VS0 A;  1LTL A;  1FJG L;  4JI3 Q;  1Y1W G;  2YTV A;  5IT9 c;  3HOU G;  2ZJR A;  4X64 Q;  2KBN A;  4P73 A;  2ASB A;  3J80 i;  4DV0 Q;  2B63 G;  5E7N A;  4A3D G;  1NE3 A;  3OTO L;  2VUM G;  2D0P A;  1X54 A;  3E0E A;  4NXM Q;  1JJG A;  1VQI A;  1UE5 A;  4YCW A;  2K5N A;  4GKK L;  4X6A H;  5IYD H;  4UP8 A;  1R9T H;  4RG1 A;  4DR1 Q;  3WWV A;  4B3M Q;  2VQE L;  2F3I A;  1IBL Q;  1JE5 A;  5GRO A;  4JI7 L;  3M4O H;  4JI6 Q;  2L15 A;  2YTX A;  3PUX A;  1NJI C;  2VQF Q;  1SE8 A;  4BBR G;  1YJW A;  1VQ9 A;  1XPU A;  3FP9 A;  1LUZ A;  1FGU A;  4DV4 Q;  4JOI A;  3CME A;  3RN2 A;  4GKJ L;  3AEV A;  3VDY A;  1M90 C;  1B8A A;  1PH7 A;  4YCU A;  4APV A;  1Q82 C;  1E1O A;  5M5W H;  1YVC A;  4GOP C;  4A93 G;  2Q2T A;  4YWM A;  2NVT H;  4GNX C;  4PZ7 A;  4P71 A;  1XTD A;  4A3K H;  1YJ9 A;  1HNZ L;  2E2I H;  3S17 H;  2UXC L;  1H95 A;  1VQC A;  4DV2 Q;  4GLX A;  3JAM i;  3T1H Q;  1M1K C;  1I5F A;  1E7Z A;  2K52 A;  1S72 A;  4GS3 A;  1SLJ A;  5GAG C;  3CW2 C;  3A74 A;  3G6E A;  4POF A;  1PH4 A;  4GN4 B;  4C3J H;  4A3G H;  3CXC A;  2RHS B;  5LMN W;  1A8V A;  2JA9 A;  4IFD J;  3RLO A;  3A5Z B;  3W1B A;  1X9N A;  2R7F A;  1HZ9 A;  1XNQ L;  1HR0 W;  1UE1 A;  1UE6 A;  4NXM L;  4BY7 G;  2R7Z G;  2ZM6 L;  1WCM G;  2GVA A;  4GNX A;  3KF6 B;  1E24 A;  5GAD C;  2JA8 G;  2BA0 A;  4B3R Q;  1N8R C;  1FVI A;  1PH8 A;  4ALP A;  2Q2H A;  5ELO A;  2HHH L;  1D7Q A;  4OO1 G;  3K0X A;  4K0K L;  1IYJ B;  1K83 H;  2DGY A;  4K0K Q;  2VNU D;  1VQB A;  1EWI A;  4R4Q A;  4JI1 Q;  1HH2 P;  4L5Q A;  2AHO B;  4L5R C;  4DR7 L;  2NN6 I;  2HIV A;  1DGS A;  3RR5 A;  3CP0 A;  1YHB A;  4DR2 Q;  2UU9 L;  5IYB H;  3CCS A;  1U5K A;  4LFC L;  5GQO A;  2JQO A;  4DK6 C;  2DUD A;  4WJ4 A;  1K9M C;  4IFD G;  4P75 A;  1HNZ Q;  5J3B A;  3HOX G;  4WJ3 M;  5C0X G;  4QL5 A;  2CCZ A;  4C2M H;  1VQ4 A;  4DR4 L;  3I55 A;  4JI0 Q;  1N32 Q;  4UY8 C;  1CKO A;  4IPC A;  1OXX K;  1V9P A;  5C4X H;  1EQR A;  3CF5 A;  1C7Y A;  1BVS A;  1IBK L;  4JI0 L;  4IPD A;  1NTG A;  3EBE A;  2QEX A;  3GTO H;  3PO2 H;  1KQS A;  1WYD A;  4DR5 L;  2C35 B;  2MNA A;  1I94 Q;  4BBS G;  5AJ3 L;  1XJV A;  2BA1 A;  1PH6 A;  1G29 1;  1P8L A;  1VCI A;  1JJC B;  4BXX H;  1ASZ A;  4YY3 Q;  4XTC S;  4B3S Q;  4A3J G;  4POG A;  2YTY A;  2R92 H;  1Q7Y C;  1HR0 L;  4LFB Q;  5FJ8 G;  1L1O C;  3HOZ G;  2CWA A;  3F2D A;  1VQ8 A;  1L2F A;  3AQQ A;  4GOP A;  2OTJ A;  2ATW A;  1EIY B;  4QQB X;  3RZD H;  4DR5 Q;  4HJ8 A;  4HIK A;  3ULL A;  2I5M X;  2KCT A;  1CKN A;  1VQ6 A;  2ZTC A;  1GD7 A;  4KLK A;  3L7Z C;  1BBW A;  3BZK A;  1TWA H;  3CCM A;  3NEM A;  2GN5 A;  4DV6 Q;  1ASY A;  3HKZ E;  1J6Q A;  4LF4 Q;  1X65 A;  2UUC Q;  4GKK Q;  4DR6 Q;  5DLQ E;  3K7A H;  4LWC A;  2I5L X;  2JA5 H;  3T1Y Q;  4DR3 Q;  3TS2 A;  2BH2 A;  3FKI G;  1IBL L;  3HOV H;  3KLW A;  4A3F G;  3CMA A;  1N34 Q;  2Q2U A;  1O7I A;  3H3V H;  2AWN A;  4IPG A;  2CQO A;  4JOI C;  2HQL A;  2NZH A;  4MTN A;  1S3O A;  3HOX H;  4DV4 L;  4JI5 Q;  3HOY G;  1Y1W H;  1IXR A;  1PFS A;  1X55 A;  1YIJ A;  2IY5 B;  2PNH A;  1YHQ A;  4TQU S;  4LF8 L;  1QUQ B;  4JBK A;  4DV5 Q;  2WAQ G;  5IP7 G;  1VQF A;  4B3M L;  3S1R H;  1YIT A;  3GTM H;  4A76 A;  3CPW A;  2NN6 G;  3STB D;  2XGT A;  4Y7N H;  2CKZ B;  1PHJ A;  1VQK A;  1SMX A;  5EAY A;  1FL0 A;  3S1Q H;  3HOW G;  3LGJ A;  3L2P A;  2N49 A;  1PV4 A;  4O2D A;  1VQL A;  4JI1 L;  4JYA Q;  2AWO A;  4DV7 Q;  4AH6 A;  1Q1B A;  1BBU A;  4DK3 C;  1Y1V G;  3S16 H;  5K36 G;  1QUQ A;  4IFD I;  1KL9 A;  2IX1 A;  3HOU H;  4DV6 L;  2JE6 I;  1FJG Q;  3UDG A;  3J81 c;  4L5T A;  2IHF A;  1HZA A;  3MXN B;  1Q8K A;  4NXN L;  2IX0 A;  2QGQ A;  4AQY Q;  3I4O A;  3RNU A;  3GTP H;  4Y52 H;  2Q2I A;  3PUZ A;  1S40 A;  2NZO A;  3RLN A;  4A3C G;  3PIP A;  4HIM A;  4JI5 L;  4HIO A;  1QZG A;  3I4M G;  4BY1 H;  2GVB A;  4P72 A;  4GN5 A;  4EQ5 A;  1MIU A;  2YV5 A;  4R4T A;  5IYC G;  4DV1 Q;  1PH3 A;  4JI4 L;  3GTL H;  4YHH L;  1YI2 A;  2I5H A;  4A3B G;  2RHQ B;  4YHH Q;  4LF6 L;  2B63 H;  4LUZ A;  1V43 A;  1CSP A;  1X3G A;  3TS0 A;  1VQ7 A;  2JA8 H;  4GKJ Q;  1AE3 A;  1TWC H;  1KRT A;  4DR3 L;  3CC7 A;  5M3F H;  1N33 L;  4A3K G;  2KCM A;  3CC2 A;  1VQN A;  1OTC A;  2EXD A;  4BBR H;  4DV2 L;  5HGQ A;  3T1H L;  1JJ2 A;  2Z0S A;  3TRZ A;  4TVA B;  4R4C A;  2I0Q A;  3I4N G;  4NB3 A;  3S1N H;  4RMF A;  3CCU A;  2E5L L;  5FLM G;  2K5H A;  4DPG A;  1YJN A;  3KFU A;  2PI2 A;  4A3C H;  4QY7 A;  1EFW A;  1E3P A;  4DAM A;  1E22 A;  2VQF L;  3KF8 B;  5JEA G;  4L5S A;  3M7N A;  3E9H A;  1J5E L;  1N33 Q;  2UXC Q;  1JT8 A;  1KXL A;  1EOV A;  4BBS H;  1XNR L;  3KYH C;  2UUA L;  4A93 H;  1NMG A;  1KIX A;  1HR0 Q;  4LNQ A;  2ID0 A;  3GO5 A;  3M4Q A;  3MEF A;  1B70 B;  1G51 A;  1EQQ A;  3CCQ A;  5JJL A;  1JMC A;  5LMU Q;  1OXU A;  3HKZ G;  1KRS A;  2WP8 J;  1I6H H;  2NVY H;  1CUK A;  1TXY A;  2K75 A;  3GTJ H;  1N34 L;  1K8A C;  4B3R L;  1SRO A;  3J7A 5;  4R4I A;  2F4V L;  3OYY A;  4IJH A;  1EUJ A;  3KJP A;  3KJO A;  5IYB G;  4EX5 A;  4GOP B;  3AFQ A;  1NMF A;  4JC0 A;  2CFM A;  5H1S E;  4AYB E;  1XNQ Q;  4GLA C;  1VQO A;  4OWW B;  2OCE A;  4HJ9 A;  2UUC L;  4HJA A;  3JC6 6;  3UDX A;  3TQY A;  5HY6 A;  4R1J A;  2ZTD A;  5BR8 Q;  3F1Z A;  1PH5 A;  4LF4 L;  4KHP Q;  1PVO A;  3PF4 A;  1MJE A;  2EQS A;  1EIF A;  2JA5 G;  2JA7 G;  1X3E A;  4IPH A;  4XIG S;  1VQE A;  3D0F A;  1WOC A;  4B3T Q;  2ES2 A;  1KHI A;  2ZM6 Q;  1K3R A;  2R7Z H;  5IP7 H;  2D62 A;  4A3E H;  3D31 A;  2OTL A;  1TWF H;  1TWG H;  2CWP A;  5C3E G;  3S1M H;  1K73 C;  1XMO Q;  4JI6 L;  2JA6 H;  4IJL A;  3PF5 A;  3CQZ H;  3GTG H;  1Y14 B;  1UWV A;  2WAQ E;  3I7F A;  2K5V A;  1XMQ Q;  3EIV A;  1EYG A;  4A3J H;  3PGZ A;  4FDB A;  2ZJQ A;  1YHA A;  2MQH A;  3F8T A;  4JBJ A;  4DUZ Q;  4DV1 L;  3K80 C;  2UUA Q;  2K50 A;  3HOW H;  2RF4 A;  4PMW A;  4YWL A;  2LXJ A;  1UEB A;  2PMZ E;  5ELN A;  4A3E G;  2AKW B;  4R4O A;  1K8G A;  3UDF A;  3CC4 A;  1W3S A;  1QVG A;  4DV3 L;  3HKS A;  4OX9 L;  3G71 A;  3GD7 A;  5C0X I;  3BU2 A;  1JB7 A;  3CCL A;  2Y0S G;  1IBM Q;  4YCV A;  2K4K A;  4DV0 L;  2UXD Q;  4JI8 L;  4JBW A;  2A1A A;  2HHH Q;  5C44 H;  3DM3 A;  4OWX B;  3U58 A;  2YYZ A;  3A0J A;  3BJU A;  1YEZ A;  4HID A;  3A5U A;  4B3S L;  2ZJP A;  3S14 H;  3M3Y H;  4DUZ L;  5M3M G;  2LXK A;  5C0X J;  3M4P A;  4JI2 L;  1L0W A;  5IYD G;  4ME3 A;  1E1T A;  4PZ8 A;  4LFC Q;  5C4X G;  3I2Z A;  2WB1 E;  2NVX H;  1QVF A;  2HT1 A;  2R92 G;  1HNW Q;  4JBM A;  3H15 A;  4LF5 L;  1HJP A;  3ER0 A;  3ZJY C;  4A3L H;  5C44 G;  1SR3 A;  3RN5 A;  1GVP A;  3PCO B;  3W5O A;  1CKM A;  4DNI A;  2YU9 H;  1LM0 A;  1QVC A;  3PO3 G;  2VW9 A;  4DUY Q;  5FLX c;  5LMU L;  3IRB A;  1Z47 A;  4H02 A;  1GKH A;  4GN3 B;  4QIW E;  3CPF A;  5IE8 A;  4C3I H;  1I94 L;  3EN2 A;  5BR8 L;  3CAM A;  4DR2 L;  4JCV E;  2UU9 Q;  4X65 L;  4JI7 Q;  4KHP L;  2VL6 A;  4X66 L;  4A3D H;  3G48 A;  4X66 Q;  3HOZ H;  4BA2 I;  4DR1 L;  3S2H H;  3NEL A;  3PUV A;  3ICE A;  2A19 A;  5C4J H;  4DR4 Q;  4GLV B;  4JG2 A;  3AFP A;  1N32 L;  1BKB A;  2EIF A;  2N78 A;  4LUV A;  4MNO A;  4OXP A;  4LF7 Q;  4DV5 L;  1GM5 A;  2JEB I;  5IYC H;  4QJF A;  1TWH H;  4DAY B;  1B7Y B;  4J15 A;  5M5Y H;  4LFA Q;  1YNX A;  3Q8D A;  3GDE A;  3PO2 G;  3S2D H;  3H3V I;  1IBM L;  3PO3 H;  1UE7 A;  1AH9 A;  1HZB A;  5LMN L;  5JEA J;  3I56 A;  4LF9 L;  3UE1 A;  3K7U C;  3PUW A;  5IY0 A;  3KDF A;  1KD1 C;  1V1Q A;  3RLF A;  3HOY H;  3J81 i;  3STB C;  1XNR Q;  1VQD A;  2N3S A;  2IT1 A;  5FLM H;  4IOC A;  2R93 H;  1XPR A;  4OWT B;  3RZO H;  4KHZ A;  5C3E H;  1N9W A;  4AYB G;  5GAH C;  1HNW L;  3J7Z C;  4HJ5 A;  1RIP A;  1I3Q H;  2D0O A;  1SRU A;  4O0A A;  3I4M H;  1PH1 A;  1MJC A;  3S15 H;  3H0G G;  5AJ3 Q;  3ULP A;  1Q12 A;  1C9O A;  4YWK A;  3J81 j;  4A3B H;  2Z6K C;  3W1G A;  1D8L A;  3BZC A;  4A3L G;  1HNX L;  3NBH B;  3CCE A;  1N36 Q;  4JV5 L;  3SGI A;  3KOJ A;  1PH2 A;  3PUY A;  3M85 A;  2QA4 A;  2IHE A;  4BA1 I;  1Q1E A;  3FHW A;  5JJK A;  1CSQ A;  2UXB L;  1G6P A;  5IP9 G;  1VQG A;  1KAW A;  1WCM H;  1X56 A;  2N8N A;  2VQE Q;  1VQP A;  4LFA L;  4UP9 A;  2MO1 A;  4A3G G;  2KEN A;  4DR7 Q;  3B6Y A;  4AIM A;  4LF7 L;  1P16 A;  1MKH A;  1VQ5 A;  2K14 A;  4LW1 A;  1WJJ A;  1Y1V H;  1YZ6 A;  2FXQ A;  4A3I H;  4A3M H;  3L0O A;  3H0G H;  1NBW A;  4QGU A;  1IZ6 A;  2KHI A;  3PIO A;  2E2H H;  3U4V A;  3GTK H;  4P74 A;  1X6O A;  2Y0S E;  4DV7 L;  1SFO H;  4X65 Q;  3G4S A;  4LFB L;  1WI5 A;  3CD6 A;  2VS1 A;  3T1Y L;  2OQ0 A;  4MZ9 A;  5FJ8 H;  1IBK Q;  2A8V A;  2V1C C;  1T9H A;  4OX9 Q;  4IOA A;  3UE0 A;  3NEN A;  4JI3 L;  5M3F G;  1LYL A;  5IWA L;  3E9I A;  4BXX G;  2F52 A;  4A3I G;  4A3M G;  4UPA A;  3I4N H;  4X62 L;  4JI8 Q;  2VY3 A;  2MFI A;  2WB1 G;  1OXS C;  2R6G A;  1VQH A;  2ZTE A;  3K8A A;  4OON A;  4UP7 A;  4C3H H;  4HJ7 A;  1XPO A;  2WFW A;  2Z6K A;  4DKA C;  5GAE C;  1PA6 A;  1J5E Q;  1C0A A;  1A63 A;  1YBY A;  3CCR A;  3OW2 A;  5JJI A;  1U0L A;  4GNX B;  3KF6 A;  4KI0 A;  2JJQ A;  2PI2 E;  2H5X A;  4JI2 Q;  3HFZ B;  2JA7 H;  4OO1 I;  2E5L Q;  1PH9 A;  3AYH B;  3S24 A;  2OQK A;  2XTI A;  4A4I A;  1VQM A;  4A3F H;  4BY7 H;  4LUO A;  4LF5 Q;  2E2J H;  1I50 H;  2KHJ A;  3PV0 A;  3J80 c;  2JK8 A;  2UUB L;  3F2B A;  2UXB Q;  1PYB A;  1A0I A;  2PQA A;  4X62 Q;  3CCJ A;  5M3M H;  1GO3 E;  2E8G A;  2OWO A;  4BY1 G;  1HNX Q;  1K0R A;  2R7D A;  1N36 L;  4JV5 Q;  4NPS A;  2F4V Q;  2HIX A;  2JEA I;  4LF6 Q;  1NY4 A;  2B3G A;  2R93 G;  4LF9 Q;  3ULJ A;  4YY3 L;  2BH8 A;  3DLL A;  3CCV A;  2AMC B;  3TRE A;  1W2B A;  1VQJ A;  1OXT A;  1Q46 A;  5M5X H;  4DR6 L;  1SN8 A;  2UUB Q;  4LF8 Q;  1L1O A;  2PQA B;  4AQY L;  1XMO L;  3UDI A;  2NVQ H;  4PG3 A;  3K81 C;  3PSI A;  1VQA A;  4B3T L;  1QZH A;  1A62 A;  5IWA Q;  1RL2 A;  3ERS X;  2VZA A;  1OXV A;  4X64 L; 
#chains in the Genus database with same CATH topology
 2LSS A;  4RUA A;  4DR4 H;  1X3F A;  2RCN A;  5KG7 A;  4IO9 A;  1PRT F;  2ALY B;  2Z4I A;  3M9B A;  3U50 C;  1AE2 A;  2VUM H;  3I72 A;  4GC7 A;  3F2C A;  3ETJ A;  2EY1 A;  1Q86 C;  4ED0 A;  2V9W A;  2SOB A;  2O5J C;  2WE6 A;  4JUZ A;  2R8K A;  3ND8 A;  4IUR A;  4DUY L;  1TT2 A;  1IKL A;  1X3Q A;  2YTV A;  1MBY A;  1STE A;  2FMC A;  3A54 A;  3MWD A;  4DV0 Q;  2B63 G;  2AGO A;  1GUO A;  5IGC A;  4C2M A;  2PPB C;  2FK3 A;  1X54 A;  5ISR A;  1TA8 A;  3P1H A;  1VQI A;  4YCW A;  1KBL A;  3J80 W;  4IAJ A;  3R23 A;  3BZD B;  4X6A H;  3PW4 A;  4R8U A;  4YR3 A;  2JEG A;  4A3B B;  2F3I A;  1JE5 A;  5JPM C;  2XN9 C;  2IBK A;  4JI7 L;  4YY3 H;  1JOK A;  1R4Q B;  5COR A;  5CBA E;  1EWC A;  3PUX A;  5BPF A;  2VQF Q;  5BPH A;  2FLP A;  4PDB A;  2Z6B A;  4GKJ L;  3AEV A;  5IT9 L;  4G4K A;  1TR5 A;  4PNY A;  4IN3 A;  2JP1 A;  4A93 G;  2EPB A;  3PW7 A;  2Q2T A;  4YWM A;  1EQV A;  4PZ7 A;  4CJ0 B;  4ETS A;  3Q8Q B;  1HNZ L;  4JI0 H;  1LTT D;  1TWA A;  1HTP A;  2GPS A;  4FYD A;  1E7Z A;  2K52 A;  1S72 A;  4QWE A;  1ZYR C;  2MP1 A;  3A74 A;  4POF A;  3N8D A;  3BYY B;  2KA7 A;  1A8V A;  4DL5 A;  3W1B A;  1PFB A;  1K0S A;  1EEF D;  4MV3 A;  1WCM G;  2FPP B;  3RJ0 A;  3NQT A;  1B44 D;  5JPN C;  5GAD C;  2HHH H;  3K58 A;  2E2H A;  2HHH L;  4OO1 G;  3KBX A;  2FIN B;  4BBR B;  2VUM A;  3KAJ A;  3M4Y A;  1EWI A;  4L5R C;  2AHO B;  3DHQ A;  2AQ3 B;  3RR5 A;  4A2B A;  2HQE A;  2UUA H;  2EY6 A;  4FXD A;  2V4D A;  3VR5 A;  3T16 A;  2J7Z A;  1HNZ Q;  3K7A B;  1HXY D;  3SDZ A;  2X0S A;  4C2M H;  5HV6 A;  3RIZ A;  4UY8 C;  5C4X H;  1EQR A;  5C4H A;  1IBK L;  4AYB A;  2B2W C;  4IPD A;  5ELC A;  3EBE A;  3V2T A;  2QEX A;  3GTO H;  1KC7 A;  3PO2 H;  1U4L A;  1EY7 A;  1WYD A;  4B3S H;  4BBS G;  5FO7 B;  5KG3 A;  4CKB A;  4F4X A;  4FNF A;  1ZXT A;  1BDO A;  4XTC S;  4F88 A;  5CC4 A;  4MIU A;  1HR0 L;  5FJ8 G;  3HOZ G;  1PZK D;  4UCS A;  1VQ8 A;  2WAC A;  1DJR D;  1JIC A;  3A56 A;  3MWM A;  4HIK A;  1TWC A;  1S5C D;  2KCT A;  3ULL A;  4DV6 H;  1Z6H A;  2ZTC A;  2R87 A;  3BZK A;  1TWA H;  2CW0 D;  5L37 A;  1ASY A;  5DG8 A;  2DJG C;  4LFC H;  4LF4 Q;  4DR6 Q;  1X32 A;  3TSS A;  3KTM A;  1IOW A;  4FP5 D;  4DR3 Q;  4DXF A;  5C5M A;  5C5L A;  3GIP A;  2F3W A;  3FKI G;  3HOV H;  2G9D A;  3KLW A;  4RAY A;  4J9N A;  5FLX W;  4C5B A;  4QF4 A;  5KFL A;  4DGZ A;  2BR0 A;  2I87 A;  2NVX A;  4R8N A;  4CKE A;  2CQO A;  2JN4 A;  4O4I F;  4JOI C;  2XRS D;  2W6Z A;  1AUX A;  1YIJ A;  2BOS A;  5C4X B;  2C9O A;  5KKN B;  3N41 B;  3GTJ A;  4LF8 L;  4ZYS A;  4DV5 Q;  3M4I A;  5IP7 G;  1JWM D;  1B4O A;  4DV2 H;  4LF8 H;  1PFN A;  5KFF A;  3S1R H;  4YP3 A;  3IFD A;  2A74 C;  3TII A;  1GYF A;  1RTO A;  2A69 C;  4K2K A;  1YNJ C;  2XGT A;  1T5X D;  4YIJ A;  4Y7N H;  1I6U A;  4HTH A;  1FL0 A;  5EAY A;  3S1Q H;  1ZEQ X;  3SEB A;  1EOT A;  5IT9 W;  1EU4 A;  4NKL A;  1BCP D;  4DV7 Q;  2JA8 B;  4AH6 A;  4FM9 A;  5K36 G;  4K0K H;  3S16 H;  1S0N A;  2A6H C;  5EBD A;  4ED6 A;  1TQO A;  2LS0 1;  4GKJ H;  4BWS C;  3VYT A;  4CGY B;  3DMU A;  1FJG Q;  5DEH A;  4J9Q A;  3UDG A;  3J81 c;  3SE7 A;  4NXN L;  3GIK A;  3I4O A;  4Y52 H;  2D9U A;  1CE8 A;  4PMB A;  4IWX A;  3I4M G;  3H20 A;  1B6S A;  1HR0 H;  2YV5 A;  4JI4 L;  3MXU A;  3GTL H;  2Z8L A;  4QIW B;  1YI2 A;  1JKJ B;  2A68 D;  1VQ7 A;  1QCB D;  1WTR A;  2JA8 H;  3ONA B;  3QZ7 A;  1TWC H;  4DR3 L;  4UHV A;  4WFN 3;  3CC7 A;  1N33 L;  3S16 B;  4HQ6 A;  4JI3 H;  3OHA A;  4N9P A;  5HGQ A;  3TRZ A;  4TVA B;  4XDX A;  4I4T F;  2W7O A;  4B9W A;  3S1N H;  4UDU C;  5NUC A;  4DPG A;  4RGM A;  4Q45 A;  4A2A A;  2AGP A;  1KJJ A;  4QY7 A;  4JV5 H;  5FLX E;  2W8K A;  1N32 H;  4K8I A;  2B8F A;  3E9H A;  5KIX A;  1N33 Q;  2O4X A;  3PN1 A;  4RU9 A;  1JT8 A;  4YB8 B;  4H13 C;  3N6R A;  4J6H A;  1WH2 A;  3JRW A;  1EQQ A;  1ZKO A;  3Q8P B;  1OXU A;  2PMZ A;  2WP8 J;  1CUK A;  1QNK A;  3GTJ H;  1K8A C;  5DG7 A;  3L3O C;  1N36 H;  4BY1 B;  2Z1C A;  1N34 H;  1EUJ A;  5H1S E;  5I9O A;  1XNQ Q;  4FBT A;  2OCE A;  1V1P A;  1PH5 A;  2RSN A;  3F1Z A;  1ONL A;  2JA5 G;  1X3E A;  4PV1 C;  2FMA A;  4J9M A;  5EGT A;  5KFS A;  4KD3 A;  4RNM A;  2PZW A;  3H91 A;  2ZM6 Q;  1B3Q A;  4OIK A;  2OTL A;  1TWF H;  3S1M H;  3A7L A;  5C3E G;  1K73 C;  3GTG H;  3CQZ H;  1SYD A;  3I7F A;  2K5V A;  3NK9 A;  1HA5 A;  3T5L A;  1ILP A;  4DR7 H;  2ZJQ A;  4JBJ A;  3MXP A;  4LFA H;  2XD4 A;  3HOW H;  5EQ0 A;  4PMW A;  3OWF A;  4M8A A;  5ELN A;  2PMZ E;  4S3S A;  3ORQ A;  2KJX A;  3RAQ A;  2AKW B;  4BBS H;  2UVU A;  3VA5 A;  4OX9 L;  3G71 A;  4IFD H;  5K2M A;  5ELF A;  2Q8T A;  1A2U A;  3MVV A;  2Y0S G;  1HPC A;  1KEE A;  4YCV A;  1Y1W B;  3K5O A;  4B3R H;  5C44 H;  3U58 A;  2OXP A;  3A0J A;  3BJU A;  4A3D B;  4HID A;  2ZJP A;  3S14 H;  4RZR A;  2LXK A;  1Z2O X;  4DAP A;  3I3C A;  5KND A;  4OHJ A;  3OMC A;  1HFN A;  3GTM B;  2DPI A;  4ME3 A;  2UUC H;  4A3J B;  1JOO A;  4PZ8 A;  5C8Y F;  2WB1 E;  1QVF A;  2R92 G;  3BAB A;  4JBM A;  3H15 A;  1HJP A;  2F0E A;  2F0Q A;  2HGS A;  3RN5 A;  4R8I A;  1WR2 A;  1Y1W A;  2YU9 H;  3RV3 A;  2E75 C;  3VYR A;  4DUY Q;  1FGB D;  1E2Z A;  1Z47 A;  4QIW E;  4O2B F;  1LV9 A;  1D5M C;  2MUY A;  4JI7 Q;  1CK1 A;  2XSC A;  4IZO A;  4A3D H;  4X66 Q;  2ALZ A;  1RK6 A;  2JEF A;  3S2H H;  1MI2 A;  1SJH D;  2OH2 A;  3SE0 A;  4K14 A;  2A19 A;  5C4J H;  4GLV B;  5E3F A;  4KY7 A;  4LMY A;  2EIF A;  4G7Z C;  2N78 A;  1SYX B;  2F4I A;  2VUM B;  3KF8 A;  1TWH H;  4DAY B;  1S68 A;  2RCF A;  4J15 A;  2GA4 B;  3I4L A;  5M5Y H;  2B63 B;  4HNV A;  5KFU A;  5T1I A;  3N6X A;  5KFT A;  1UE7 A;  1R9T A;  3J81 W;  4DK1 A;  2FB9 A;  1HZB A;  5LMN L;  2LMC B;  3I56 A;  2RGV A;  1RYR A;  1I4H A;  5ELD A;  3K7U C;  2NN6 H;  5IY0 A;  1V1Q A;  5EOY A;  5JVH 3;  3JSN A;  2WTF A;  4EQN A;  3STB C;  4C3H B;  1CQV A;  2KUM A;  4ZLT F;  1C8C A;  3DUZ A;  3CQZ A;  5KFP A;  4LF6 H;  4TQR A;  1EY9 A;  5KFB A;  1DM0 B;  1D5Z C;  1I4P A;  1PZI D;  2F0L A;  4HJ5 A;  1I3Q H;  1YNN D;  1JWS D;  1SRU A;  2W6Q A;  5BR8 H;  4KHP H;  1R9T B;  3S15 H;  4X62 H;  1U4P A;  1B9N A;  1KNA A;  2KEC A;  1WD0 A;  3J81 j;  3BQ2 A;  2Z6K C;  3H09 A;  4DR1 H;  4X3T A;  3KK7 A;  4EBE A;  1EHI A;  3NBH B;  4GC6 A;  4JV5 L;  1NSN S;  3RV4 A;  2YU9 B;  1T94 A;  1Q1E A;  2BE5 C;  2UXB L;  1HA6 A;  4MV9 A;  3OPO A;  3BYT B;  3NSW A;  4ED2 A;  1STY A;  2N8N A;  4QMG A;  3RB6 A;  1Y69 U;  2SDF A;  2KEN A;  4DR7 Q;  2RDG A;  2C2E A;  3B6Y A;  4DL4 A;  4A3I H;  1QWY A;  3H0G H;  1NBW A;  5C4J B;  1HFG A;  1AP0 A;  2KHI A;  3Q2O A;  1H9M A;  3LML A;  2YU9 A;  2Y0S E;  4L1K A;  1U4M A;  4LFB L;  1QG7 A;  4A3F B;  4BY7 B;  2R7Z B;  2SNS A;  1IBK Q;  4MZ9 A;  3LX0 A;  4F50 A;  4OX9 Q;  2R7N A;  4K6L A;  4O3R A;  2CHB D;  1LT4 D;  1LYL A;  2VQD A;  4BXX G;  2F52 A;  4G57 A;  2L1B A;  2NVQ B;  4RB1 A;  1B33 N;  1JDB B;  5IWA H;  1N48 A;  4IUV A;  3ND9 A;  1B1Z A;  5T1G A;  3KBG A;  4C3H H;  5KFN A;  2WFW A;  1J5E Q;  2A5H A;  4L63 B;  5KYL A;  2R7Z A;  2PI2 E;  2H5X A;  4IUT A;  4CJ1 B;  4OO1 I;  1PRT C;  3JRX A;  4Q43 A;  3S24 A;  1U9R A;  2EE1 A;  3TP7 A;  2XTI A;  1J5E H;  4LUO A;  1O78 A;  1XXG A;  3RBD A;  2EYM A;  2KHJ A;  4HNT A;  2JK8 A;  3F2B A;  4EFE A;  2UXB Q;  1MSH A;  1BXT A;  1D1I A;  4EYI B;  4FF3 A;  2R7D A;  4MN3 A;  2R7K A;  4JV5 Q;  2FE3 A;  2A69 D;  2F4V Q;  2HIX A;  4DL7 A;  2B2U C;  4UAI A;  1NY4 A;  3BJY A;  2K04 A;  4DF7 A;  1A3T A;  2R93 G;  1I3Q A;  3GTQ B;  4KV6 A;  3ULJ A;  1CTM A;  5CV7 A;  1L0X B;  3DLL A;  3CCV A;  3TRE A;  4FXG C;  1VQJ A;  4DR6 L;  4K5X A;  2MJ8 A;  2ATL A;  1L1O A;  1XMO L;  3UDI A;  5IT9 E;  2Q8I B;  3EJI A;  3U9O A;  4XYO A;  4ZOL F;  3V6J A;  2NVT B;  1RL2 A;  2JA5 A;  3QG1 A;  3ERS X;  4IR9 A;  4KN4 C;  2R82 A;  5EPJ A;  4QIW A;  1KC8 C;  2IP4 A;  4RCN A;  2JA6 G;  2YZM A;  5HBR B;  4EGJ A;  3MZ5 A;  3P75 A;  1EY8 A;  1HZC A;  3NTI A;  3OTO Q;  1WTX A;  1XMQ L;  1TS3 A;  3FPP A;  1EYD A;  3FKI H;  3HOV G;  4FU0 A;  2IMW P;  1EYZ A;  2R8J A;  2L5T A;  5C3W A;  1WD1 A;  2PO4 A;  4WBN F;  5C1O A;  3OIP A;  5KG0 A;  1FJG H;  1PYS B;  1HNX H;  1FJG L;  5C0X H;  3PW5 A;  3HOU G;  1LT6 D;  2KBN A;  3K5H A;  5IOD A;  3A8I E;  2WAQ B;  3OTO L;  2VUM G;  2K6A A;  3E0E A;  2BQR A;  3T53 B;  4LH6 A;  3VR3 A;  4C5C A;  3R8B A;  3GP7 A;  3PIO 3;  4DR5 H;  2HVQ A;  4F4W A;  3MWE A;  3VYU A;  4A3K B;  2E2I B;  5IYD H;  1W93 A;  1F77 A;  4RG1 A;  4DU9 A;  3WWV A;  3E3X A;  5KT3 A;  5CV6 A;  1SMY D;  1PTO H;  2EY5 A;  3BDO A;  4DXG A;  3K3P A;  5KFJ A;  1SE2 A;  5GRO A;  4C3J B;  2WKD A;  5L1L A;  4DL2 A;  4QWD A;  3LWB A;  1YJW A;  4BBR G;  3GTP B;  5DLG A;  1HUM A;  4DV4 Q;  4JOI A;  4C56 C;  3CME A;  4J0M A;  2W6O A;  1PTO C;  2EZV A;  5FKA C;  1Q82 C;  4X66 H;  1E1O A;  1GUS A;  5M5W H;  1YVC A;  4Q44 A;  1SYE A;  4GOP C;  2QK4 A;  5KGU A;  4GNX C;  1C3O A;  3S17 H;  4A3K H;  2E2I H;  3V4Z A;  1VQC A;  3T1H Q;  2B2V C;  3JAM i;  4MV4 A;  3T51 B;  2R92 B;  4GS3 A;  1SLJ A;  3PO2 B;  1PYW D;  3G6E A;  2R7L A;  4GN4 B;  4C3J H;  2B2T C;  4A3G H;  4I65 A;  1B53 A;  1EY4 A;  1TVX A;  2PYK A;  2RHS B;  4RHR A;  4CHT B;  1SE4 A;  4RZQ A;  2FKL A;  2R7F A;  1HZ9 A;  1HR0 W;  1UE1 A;  1RJR A;  1UE6 A;  1BO0 A;  4KKU A;  4X3S A;  1K3B C;  5HUR A;  2DIK A;  4GNX A;  4B3R Q;  2F0O A;  1SJE D;  2BA0 A;  1N8R C;  1FVI A;  3K59 A;  3K3V A;  3OOC A;  2Q2H A;  5ELO A;  3D6C A;  4ALP A;  4J1M A;  2ICE C;  1K83 H;  2DGY A;  1JLL B;  4JYA H;  3CU7 A;  4APM A;  2NN6 I;  2HIV A;  1SCU B;  3BQ1 A;  2UU9 L;  5IYB H;  5JVG 3;  4LFC L;  1IKM A;  2B2Y A;  2JQO A;  5GQO A;  3T56 B;  2R84 A;  3LWU A;  1K9M C;  3RAX A;  5J3B A;  4C1N K;  4CBV A;  3HOX B;  4DN4 M;  3HOX G;  4WJ3 M;  3ERO A;  2CCZ A;  5JEA H;  2F0K A;  1VBG A;  1CKO A;  4JI0 L;  1OXX K;  1JE4 A;  1C7Y A;  3GTP H;  1PX2 A;  1HNZ H;  3KHG A;  3EYY A;  5IGB A;  2C2D A;  1KAB A;  2PCF B;  2RDI A;  2YRW A;  2F3V A;  3J81 E;  2CQA A;  4DR5 L;  1I94 Q;  2W6N A;  3HXL A;  3E5S A;  4DV4 H;  1ET6 A;  2HD3 A;  1P8L A;  3HB9 A;  5L1K A;  1VCI A;  4BXX H;  4LSX A;  1ILQ A;  3SK8 A;  5C5J A;  1ENC A;  4POG A;  4K6D A;  1XNQ H;  2KVM A;  2F0V A;  1SYF A;  2E2D C;  4FF1 A;  2HCI A;  3AQQ A;  2SNM A;  3K0Y A;  4HMI A;  3I70 A;  4QQB X;  1UAP A;  4V19 0;  4Y7N B;  4DR5 Q;  1JXL A;  1MHW C;  4ZQ3 A;  2I5M X;  3K5I A;  3KLR A;  1O7L A;  5BN3 A;  2E2I A;  4KLK A;  2VB2 X;  3L7Z C;  1TWF B;  3NEM A;  2GN5 A;  4EBD A;  4QW9 A;  2L12 A;  1BOS A;  1X65 A;  2K05 A;  4GKK Q;  3NXW A;  5DLQ E;  3K7A H;  2I5L X;  4ZCK A;  1DIK A;  4ZHQ F;  1AUV A;  2FK1 A;  3TZU A;  3TP6 A;  1E2V A;  4TQS A;  3TS2 A;  3T5H A;  4YQW A;  1Q8I A;  4N8F A;  2IX3 A;  4A3F G;  3CMA A;  2XIW A;  1CHP D;  1PXU A;  3NP8 A;  5CMD A;  2CZG A;  3H3V H;  3RB4 A;  2AWN A;  3C46 A;  3GQC A;  2NWG A;  4UCT A;  2NZH A;  3HOX H;  3NBH A;  3Q1K A;  1IXR A;  5J1Z A;  1EL0 A;  5C44 B;  5IYZ F;  3HOU B;  4ECX A;  5DGA A;  3SVM A;  4TQU S;  3K5M A;  1VQF A;  4B3M L;  4PQX A;  5FLX L;  4HR7 B;  3MFH A;  4ED1 A;  2NN6 G;  3STB D;  1S03 G;  1S5D D;  1PHJ A;  3TP8 A;  1SMX A;  2O5I C;  1YNN C;  3E6Z X;  3HOW G;  1AFP A;  3LGJ A;  1EEI D;  1GSO A;  4ED7 A;  3QWN A;  4JI1 L;  1MD2 D;  2AWO A;  2KEE A;  4JYA Q;  1CI3 M;  3Q6S A;  1Q1B A;  4UCO A;  3Q8R B;  3QJY A;  1KDB A;  5M3F B;  1QUQ A;  4IFD I;  1HUN A;  1T3N A;  3DWA A;  3J7A V;  5GON F;  2UXB H;  4HCS A;  1LT5 D;  4L5T A;  3TDQ A;  5FPR A;  3NWT A;  1B2T A;  4EEQ A;  1I6V C;  3RLN A;  3N40 P;  2IL8 A;  2NVY B;  1QZG A;  1ESR A;  2YCH A;  5JOB A;  4GN5 A;  4EQ5 A;  1MIU A;  2LKV A;  3QZ8 A;  2I5H A;  4A3B G;  2RHQ B;  3V6H A;  3MEH A;  3PO3 B;  1VDZ A;  1KRT A;  2R86 A;  1VQN A;  4KY6 A;  2R7M A;  4ZUI A;  2EXD A;  3VYS A;  3SK5 A;  4BBR H;  4DV2 L;  1JJ2 A;  2Z0S A;  1HHV A;  3GIJ A;  1I94 H;  5K5P A;  1Z7T A;  3GV5 B;  4YAK B;  2K5H A;  1S5E D;  3KFU A;  3AU7 A;  3E0J A;  4A3C H;  2RA4 A;  1EFW A;  3GTG B;  1I3Q B;  4KTA A;  4DAM A;  4C2M B;  3N43 B;  4L5S A;  1J5E L;  3VR2 A;  2V4R A;  4ILW A;  1XNR L;  2R85 A;  5CGK A;  1NMG A;  1VBH A;  4LNQ A;  2ID0 A;  3H94 A;  1Y8N B;  3MEF A;  5KNB A;  4A3E B;  4JI5 H;  5JJL A;  1JMC A;  3F8N A;  2JA6 B;  1F2Z A;  3SXH A;  2K75 A;  4ECR A;  4KKS A;  3HGB A;  3KJP A;  3KJO A;  5A2Q E;  5IYB G;  4TRD A;  3AFQ A;  2AU0 A;  3GTL B;  4JC0 A;  3J7Y W;  2BDN A;  4OWW B;  3M3Y B;  4HJ9 A;  3KHL A;  2BCO A;  1L0Y B;  3C1E A;  4C3J G;  2UUC L;  4LF4 L;  5BR8 Q;  3T4A C;  4A3M B;  4KHP Q;  3V05 A;  5KFG A;  3VPB A;  3PF4 A;  2JA7 G;  1EIF A;  4JW0 A;  1PDQ A;  1VQE A;  3D0F A;  2O2L D;  5IIF A;  2ES2 A;  1KHI A;  2K03 A;  3U9T A;  1SNO A;  1TWA B;  1D2B A;  5M9O A;  4IJL A;  2F0N A;  4KN7 C;  3WDN A;  1Y14 B;  1FNV A;  2EOT A;  3PF5 A;  5K36 H;  1WSC A;  1EYG A;  4KY5 A;  1V1O A;  2JXM B;  1JR0 D;  4FDB A;  2KQ3 A;  1LAB A;  1NAP A;  2NVX B;  4RA8 A;  4C5A A;  2K5W A;  2UUA Q;  3S2D B;  2E5L H;  1SNP A;  4YWL A;  2KSW A;  4RGO S;  2LXJ A;  4ECV A;  4EGQ A;  1CQJ B;  4UFZ A;  4A3E G;  1K8G A;  3CC4 A;  1W3S A;  1QVG A;  3HKS A;  3GD7 A;  3BU2 A;  1JB7 A;  2E74 C;  2JSO A;  1HQM C;  2X6G A;  3A7A B;  4DV0 L;  1AW7 A;  4JBW A;  4JI8 L;  2HHH Q;  5M5Y B;  1EZ8 A;  2E2J B;  5G3L D;  1I4X A;  4Q0F A;  4B3S L;  3A5U A;  4F87 A;  2XIG A;  3HEJ A;  4KJO A;  5M3M G;  1Q90 A;  3QR8 A;  3TIG A;  1ZET A;  2J9G A;  3A8J E;  1E1T A;  4QUC A;  5D14 A;  3I2Z A;  2NVX H;  1KJ9 A;  2HT1 A;  5DM7 3;  1HNW Q;  1Y1V A;  5KT4 A;  1MSG A;  4C3H G;  1ML0 D;  4LF5 L;  3H3V C;  4A3L H;  2F1M A;  1SR3 A;  3EQL C;  1KLU D;  3GTK A;  4DNI A;  1CT1 D;  1LM0 A;  4RGN A;  4FXK C;  5FLX c;  5LMU L;  5JUM A;  4H02 A;  1BCP B;  3Q0A A;  4C3I H;  3EN2 A;  5BR8 L;  4DNR B;  4DR2 L;  5C4Z A;  4KHP L;  2VL6 A;  4X66 L;  4ECT A;  2PW5 A;  3HOW B;  3HRZ C;  2EDG A;  2MHV A;  3J80 L;  4JV1 A;  3MAQ A;  1UC8 A;  3TME A;  5ELE A;  4XXE A;  3AFP A;  4QUF A;  2VQF H;  2M00 A;  4LF7 Q;  2JEB I;  4DFA A;  3K5L A;  1R4P B;  1B7Y B;  3UI2 A;  1EZ1 A;  4ECQ A;  4LFA Q;  5EZY F;  2VXW A;  3Q8D A;  3TP5 A;  4IR1 A;  2NBF A;  1AH9 A;  1O7Z A;  5KEE A;  5L9X A;  5CA1 F;  2KED A;  2F0W A;  5JEA J;  3P7J A;  4MV6 A;  3GV8 B;  5E4W C;  1KD1 C;  2W57 A;  2J0T D;  1G2S A;  5I47 A;  5KG5 A;  3HOY H;  4J9K A;  1XNR Q;  5FLM H;  2KCN A;  4WD3 A;  1WCM B;  1CFM A;  2AUJ D;  3L4J A;  3NBI A;  4N8X 1;  1N9W A;  3MFY A;  3GTL A;  1HNW L;  3J7Z C;  1RIP A;  2C2R A;  4R9W A;  3K57 A;  3A8K E;  1PLF A;  1PTO B;  1I50 B;  3W1G A;  1OWT A;  1PK8 A;  4EG0 A;  3BZC A;  1JOR A;  1ESF A;  2AGQ A;  1HNX L;  4OL7 A;  2IWH A;  3CCE A;  1N36 Q;  4KJN A;  5KG2 A;  2HVR A;  3M9O B;  1FD7 D;  1Z2P X;  3GV3 A;  3I8Z A;  5FO8 B;  4DL3 A;  3WO1 A;  1S0M A;  3PUY A;  4O42 A;  3KAK A;  4BA1 I;  3FHW A;  4HED A;  3HOY B;  5JJK A;  4MV1 A;  3PR4 A;  5IP9 G;  4G7O C;  1WCM H;  2B2W A;  1VQP A;  4LFA L;  1V1P B;  4OEM B;  5A2Q W;  4DUZ H;  3KXY T;  5I6Y A;  1GHK A;  3DXJ C;  4LF7 L;  3HKZ B;  1TS4 A;  1VQ5 A;  3FDS A;  2CW0 C;  4N9T A;  1Y1V H;  2P5Z X;  1B9M A;  3RBE A;  3RGZ A;  2UVV A;  1GUG A;  1EUD B;  3GTK H;  4XQJ A;  4OEL B;  2W9C B;  4X65 Q;  3G4S A;  1WI5 A;  2K33 A;  3T1Y L;  5FJ8 H;  3S1M B;  4XX0 B;  5M3F G;  1EIG A;  5LA6 F;  3BA8 A;  5CV8 A;  1ENF A;  4A3M G;  5FO9 B;  1LTS D;  4X62 L;  1EZ6 A;  3R5F A;  5LXT F;  2E5L Q;  4O3O A;  4JPB W;  3J81 L;  1VQH A;  4UP7 A;  5JVL A;  1TII D;  2L4N A;  4DKA C;  1A63 A;  2XGQ A;  2B2T A;  1C0A A;  2CVR A;  3CCR A;  1EU3 A;  5JJI A;  1I7N A;  4GNX B;  3KF6 A;  4KI0 A;  2JJQ A;  4JI2 Q;  3HFZ B;  1JOQ A;  2DWC A;  1PH9 A;  1RK5 A;  1QIL A;  1VQM A;  2F0I A;  5LOV F;  2A73 B;  5KYI A;  2H4O A;  1GSH A;  3PV0 A;  2UUB L;  3N52 A;  1G91 A;  2ZXR A;  4NLG A;  2PQA A;  1A0I A;  4X62 Q;  3CCJ A;  2RSO A;  2I8C A;  1GO3 E;  4BY1 G;  2YZG A;  2EYF A;  1HNX Q;  4DV7 H;  1RKN A;  1N36 L;  3R3O A;  4NPS A;  2G9H D;  2EJG C;  4LF6 Q;  3DWQ A;  1LAC A;  3IL8 A;  4JK1 C;  1EIH A;  4DLK A;  2K5Q A;  4LF9 Q;  2YRX A;  4YY3 L;  1I4G A;  3OTO H;  2D2C C;  3ZYY X;  3SK6 A;  1W2B A;  5F9L A;  1E4E A;  3VMM A;  2VPS A;  2X6L A;  5LHY 1;  4LF8 Q;  2PQA B;  2EYL A;  4PG3 A;  3K81 C;  3K5N A;  1DV2 A;  3PSI A;  4V0B A;  3BVG A;  1VQA A;  4B3T L;  1EY5 A;  3C0F B;  3H4B A;  1QZH A;  3GV7 B;  5KFR A;  5CA0 F;  2B29 A;  4A75 A;  3MR3 A;  2UXD L;  2F0P A;  2RDF A;  2F03 A;  2MO0 A;  1WCM A;  1EYC A;  3U4Z A;  4I7Z C;  4U6P A;  1S9F A;  1WFQ A;  1SNQ A;  4PZ6 A;  4DV3 Q;  5IP9 H;  4X65 H;  1RCV D;  1TWH B;  1CKN B;  1QJO A;  4IWY A;  4ZAI A;  2QDB A;  1LTL A;  2B8G A;  3M4O B;  5KFV A;  1F2Y A;  2GLT A;  1Y1W G;  4DUY H;  5KG4 A;  2ZJR A;  4P73 A;  2ZXP A;  4RKB A;  4A3D G;  1GXD C;  1NE3 A;  1E4G T;  2B2Y C;  1JJG A;  2IPK D;  1TWH A;  2AUK A;  4GKK L;  3MR5 A;  3OSO A;  1PTO D;  2HJW A;  5COY A;  1BQQ T;  4UP8 A;  3KAL A;  1R9T H;  3S15 B;  4B3M Q;  2VQE L;  1F9R A;  1H9J A;  2W71 A;  5JVD F;  3WO0 A;  2WKC A;  2E76 C;  5IGG A;  3M4O H;  1GGO A;  3QFF A;  4TUY F;  5EWE A;  3FP9 A;  1IBK H;  3VDY A;  1IL8 A;  2Q8R E;  1CA5 A;  1B8A A;  3R5H A;  4UCU A;  1PH7 A;  4TSS A;  4YCU A;  4APV A;  1XNR H;  2FLL A;  2F0J A;  4P71 A;  1XTD A;  2MGS A;  5KFC A;  3AB9 A;  4G7H C;  1M1K C;  4CDF C;  4XZ3 B;  2SEB D;  4DNT B;  5FD5 A;  2A6H D;  5KT6 A;  5C6A A;  1GUT A;  2KHS A;  3A5Z B;  4Q5V A;  5DG9 A;  3KHR A;  1X9N A;  3SR1 A;  1IYV A;  4J8Q A;  1XNQ L;  5G3L F;  4OGQ C;  4CJ2 C;  1H9K A;  2GVA A;  3GTO B;  1E24 A;  2XRQ D;  2UXD H;  3KLS X;  4Y8V B;  3FPU B;  5DQH A;  4K0K Q;  2W70 A;  4GKK H;  4O3N A;  1J8I A;  3I91 A;  4LJZ C;  2VNU D;  2J4X A;  1M8A A;  4R4Q A;  2XWJ B;  1KJI A;  3CP0 A;  1AZQ A;  3CCS A;  4KHV A;  1WTV A;  2R3Z A;  2R8G A;  3MFG A;  4FF2 A;  2DUD A;  3EFX D;  4B08 A;  4QL5 A;  1N32 Q;  1VQ4 A;  4JI0 Q;  3H40 A;  4IPC A;  3CF5 A;  3JZI A;  4OIJ A;  5FOB B;  1BVS A;  3C3L A;  1M6V A;  3URY A;  2L9H A;  1KQS A;  2C35 B;  2MNA A;  5AJ3 L;  1XJV A;  5D1O B;  1QOH A;  5EWG A;  2BA1 A;  5KFO A;  1PH6 A;  3I73 A;  3RTX A;  2AQ1 B;  1GHJ A;  4YY3 Q;  5F2D A;  4A3J G;  2JA5 B;  1BJT A;  2PN1 A;  5KFD A;  2CWA A;  4J9R A;  3GIM A;  1L2F A;  4GOP A;  2JEI A;  1EIY B;  5I2Y A;  1F9S A;  3NTK A;  3CHB D;  1IW7 D;  5D1O A;  4JVZ A;  4I7A A;  4Z9C B;  5FK9 C;  1GD7 A;  1BBW A;  3G8C A;  3CCM A;  3O13 A;  4DV6 Q;  4RNO A;  1Q3L A;  2M9V A;  4H7B A;  2OLS A;  4RNN A;  4M1U B;  5LL6 b;  2UUC Q;  4TKO B;  2CQY A;  3KHH A;  2VUG A;  4LWC A;  3H4D A;  1SBB B;  2JA5 H;  2WAQ A;  4IAL A;  1E0B A;  4HSV A;  3OUU A;  1K1Q A;  4NDX A;  4RKL A;  1TWC B;  5D3D A;  3C2P A;  2OF1 A;  2M05 A;  4JI5 Q;  4MTN A;  2WB1 A;  4DV4 L;  2A6E C;  3S1N B;  3HOY G;  2IY5 B;  1X55 A;  5JQW A;  4U68 A;  1EY0 A;  1KNE A;  1PTO F;  1YHQ A;  4CC5 A;  3OW7 A;  1XWE A;  4RWS C;  2YS6 A;  4ED3 A;  2WAQ G;  1UEA B;  3T1H H;  4RB0 A;  3D4R A;  3MFI A;  3CPW A;  2K32 A;  3M9N B;  4NXM H;  1V51 A;  2B39 A;  4R7R A;  3HZX A;  1PV4 A;  2N49 A;  2HUG A;  2SCU B;  4O2D A;  3HBL A;  1BNZ A;  1BBU A;  1Y1V G;  2IX1 A;  4C3I B;  1CQF A;  4C3I G;  3D4D A;  4DV6 L;  5T14 A;  4KKT A;  2UVR A;  4EVO A;  4XT3 B;  1IOV A;  4NXN H;  1SXT A;  1W6K A;  5CYU A;  4ME5 A;  1Q8K A;  4AQY Q;  3RNU A;  4IHJ F;  1S40 A;  4A3C G;  2NZO A;  1TAE A;  5H80 A;  5LMN H;  3M9M B;  1G6Z A;  3PMF A;  4JI5 L;  1W6J A;  4HIM A;  4HIO A;  1EFI D;  3WOF A;  1SND A;  3S1Q B;  4P72 A;  5EKI A;  1STN A;  3N44 B;  2Z9H A;  1PH3 A;  1B04 A;  4LF6 L;  1V43 A;  2AQ2 B;  3OMG A;  4AYB B;  3MA2 B;  2W8L A;  4MHE A;  1KJQ A;  4P2C B;  2KCM A;  4ODG A;  1OTC A;  4UCR A;  3QO2 A;  2WIN B;  1UUP A;  4RCO A;  1NR2 A;  4RMF A;  2YZN A;  5FLM G;  2ASJ A;  2ASL A;  2R8H A;  4XQN A;  3GID A;  4I50 F;  1SNM A;  2ASD A;  5KG6 A;  3MC0 B;  3R93 A;  5KFY A;  2QIL A;  2VQF L;  3KF8 B;  4DAY A;  3M7N A;  3GLK A;  1M0T A;  1SYC A;  2UXC Q;  1RDP D;  1EOV A;  1KXL A;  5LYJ F;  1RTN A;  2UUA L;  1HR0 Q;  2NU8 B;  1D5X C;  3GO5 A;  3M4Q A;  5DNF A;  1K8O A;  1B70 B;  2DPJ A;  3CCQ A;  5J2T F;  1JC7 A;  2BQ3 A;  5LMU Q;  1ROD A;  5EWF A;  1SFO A;  1KRS A;  4NMZ A;  2NVY H;  1TXY A;  2PNR C;  1XYI A;  1N34 L;  5C3X A;  1SRO A;  1DCZ A;  4R4I A;  3P20 A;  2F4V L;  4EX5 A;  3CRK C;  3NGD A;  2DN8 A;  1NCV A;  3PIP 3;  2F4V H;  4JI8 H;  4AYB E;  4ZQI A;  2EYJ A;  4GLA C;  3GTP A;  3DWP A;  1DXM A;  4XQQ A;  5BN4 A;  3JC6 6;  5HY6 A;  1BCP F;  4ZKB B;  3TIN A;  1MJE A;  2EQS A;  2CW8 A;  2J6T A;  3Q24 A;  2Z4H A;  2NZ1 D;  3IFT A;  5JJZ A;  5KX5 F;  1K3R A;  3TBI B;  2D62 A;  2DJF C;  1BUV T;  1TWG H;  2CWP A;  3H6M A;  3NE5 B;  1Y8O B;  1XMO Q;  4JI6 L;  2R61 A;  2D5D A;  2WAQ E;  2VOB A;  1KDC A;  3EIV A;  1SEI A;  5IGF A;  4XYL B;  4DV5 H;  4A3J H;  1XX8 A;  3PGZ A;  1YHA A;  2IJ0 A;  2MQH A;  1U4R A;  2OT2 A;  4DV1 L;  2K50 A;  2RF4 A;  4DR2 H;  1V4Y A;  4DAV A;  1SSO A;  2HDL A;  4R4O A;  4KMU C;  3UDF A;  4YR2 A;  1LTR D;  5C0X I;  4OX9 H;  1TU2 B;  3W3A A;  4LSA A;  2K4K A;  2ZDQ A;  1K8M A;  2WYO A;  5HGT A;  4OWX B;  2IA6 A;  2YYZ A;  1YEZ A;  2UVW A;  3M3Y H;  4EBC A;  3VA7 A;  4TV9 F;  1NR4 A;  3G6V A;  4DR6 H;  4IUQ A;  2DLN A;  1STG A;  4CDD C;  4RB2 C;  5C4X G;  4LFC Q;  2F0S A;  4ECU A;  2CH4 W;  5E4X A;  2VA3 A;  3PZP A;  5A2Q L;  4E4T A;  5KFE A;  5DQG A;  3QIA A;  3LNN A;  3ZJY C;  5C44 G;  2QYZ A;  1GVP A;  3PCO B;  2VPQ A;  1QVC A;  4K8J A;  1M4V A;  5L1J A;  5CV4 A;  4HNU A;  1J9O A;  4GN3 B;  1BR9 A;  3F2U A;  4QWB A;  3CPF A;  1QNU A;  1I94 L;  3CAM A;  1E4E B;  5J2U F;  1O80 A;  5KT7 A;  3G48 A;  2NVY A;  4BA2 I;  2F0M A;  4QB4 A;  2A68 C;  3NEL A;  3PUV A;  1S5B D;  3DM1 A;  4DR4 Q;  4BWG B;  5I2X A;  1BKB A;  2RDJ A;  3CQZ B;  4LUV A;  3VPC A;  4OXP A;  4J9O A;  1NNX A;  1UNS A;  4DV5 L;  1GM5 A;  3PW0 A;  1L2Z A;  1PFM A;  4UCV A;  2PW7 A;  1IBL H;  1YNX A;  3GDE A;  1SNC A;  3PO3 H;  1TY2 A;  3A55 A;  1X3P A;  4LF9 L;  2RGR A;  3PUW A;  3CVZ A;  2W9A A;  3RLF A;  1SFO B;  5J22 A;  1VMC A;  1VQD A;  2N3S A;  4IOC A;  5D1P A;  5KFW A;  2Y0S A;  1HQR D;  4OWT B;  2L55 A;  1GOZ A;  1K1S A;  1ZQ7 A;  4MA0 A;  3RUP A;  4KHZ A;  4XT1 B;  5A35 A;  5C3E H;  3BQ0 A;  5EPK A;  4AYB G;  5GAH C;  2VB3 X;  4O0A A;  3EA6 A;  3I4M H;  4O4H F;  1PH1 A;  3H0G G;  5EPL A;  3H0G B;  3ULP A;  1C9O A;  3HP3 A;  4A3B H;  1MGS A;  1I7L A;  1D8L A;  3MR2 A;  4RAU C;  1KAA A;  3VPD A;  3MJF A;  1A15 A;  2KCC A;  3SGI A;  2TSS A;  3KOJ A;  1PH2 A;  1JIH A;  4EEY A;  3VR4 A;  3J80 E;  1WTH A;  2IHE A;  3M85 A;  2LFN A;  3Q22 A;  1JCK B;  3TZD A;  3W2D A;  1VQG A;  1X56 A;  2VQE Q;  4A3G G;  1GSA A;  4UP9 A;  3G6X A;  2EXZ A;  4WJW A;  3ETH A;  1P16 A;  4PMC A;  2ENB A;  2K14 A;  5EKL A;  3I4M B;  2MCT A;  3NHH A;  4A3M H;  1PRT D;  3L0O A;  1Z2N X;  4EGV A;  1AN8 A;  2E2H H;  3PIO A;  3U4V A;  2FK2 A;  4FS2 A;  3BVM A;  1X6O A;  3BDL A;  4DV7 L;  1KTK A;  5KFK A;  2VS1 A;  2OQ0 A;  2A8V A;  2BDO A;  2V1C C;  5KNC A;  5DM6 3;  3UE0 A;  3NEN A;  2B2V A;  2PQE A;  5IWA L;  3E9I A;  5M3M B;  3V6K A;  4FS1 A;  3QOL A;  4UPA A;  5CR3 A;  2DNE A;  4JI8 Q;  2FLN A;  2WB1 B;  2WB1 G;  3K8A A;  2R6G A;  4LF5 H;  3FMC A;  4OON A;  1PA6 A;  2FJZ A;  1GUW A;  4HYK A;  1YBY A;  5F9N A;  1H9S B;  2QCP X;  1U0L A;  3GTO A;  5LMU H;  2E2H B;  1TS5 A;  3MWY W;  1T5E A;  3AYH B;  4F4Z A;  2C28 A;  2OQK A;  1C30 A;  4A3F H;  4BY7 H;  1A6X A;  1N56 A;  4LF5 Q;  4DA2 A;  4J9P A;  3SI8 A;  2E2J H;  5BMV F;  3DEO A;  1OO9 B;  1RJT A;  2RKS A;  3SK4 A;  1PYB A;  4YJ2 F;  4J9L A;  2YS7 A;  5M3M H;  2H1E A;  1AZP A;  4FVM A;  1Y1V B;  2E8G A;  1M7J A;  1ULZ A;  3FVQ A;  2V4Q A;  1H9S A;  5CB4 F;  4IUU A;  3FKI B;  3OUZ A;  2B3G A;  1IYU A;  3MTS A;  3JAM W;  2O03 A;  4GZY C;  2YW2 A;  1IBM H;  4IRD A;  1A3V A;  1LTA D;  2AMC B;  3BVZ A;  2FFK B;  1BCP C;  5M5X H;  4XYQ A;  1GLV A;  1SN8 A;  2UUB Q;  1SE3 A;  1VKZ A;  4CKC A;  1FR3 A;  2PBZ A;  4MAM A;  4J9S A;  4ECY A;  2F0H A;  3M7G A;  1LTI D;  1YNJ D;  5IWA Q;  2VZA A;  1OXV A;  4BS9 A;  5IP7 H;  4X64 L;  4JI4 Q;  2FMM A;  4QW8 A;  1XMQ H;  1FNW A;  3TEH B;  3EVQ A;  1VAJ A;  5LMN Q;  1ZYR D;  1ET9 A;  4JYA L;  1MZB A;  3DF7 A;  3GTQ H;  1Z9F A;  3JAM c;  1L1O B;  4NXN Q;  4U67 3;  2JYO A;  1IL2 A;  2UU9 H;  2N55 A;  3VR6 A;  1Q81 C;  3G7L A;  3KDF B;  5M5X B;  1VS0 A;  2M2L A;  4JI3 Q;  2K01 A;  5IT9 c;  4X64 Q;  2ASB A;  3J80 i;  1KDA A;  4M7E A;  3EPG A;  5E7N A;  2W9B A;  3RB3 A;  3Q23 A;  1H9R A;  2D0P A;  3I90 A;  2B2U A;  3FDT A;  4NXM Q;  1BXR A;  5EBC A;  1UE5 A;  2NU6 B;  2K5N A;  4KD4 A;  2XNA C;  2I46 A;  3FRP B;  3T5K A;  4DR1 Q;  1EQT A;  3L9A X;  4ME6 A;  1UNN C;  4EYH B;  3RF2 A;  1AEX A;  1IBL Q;  5I6W A;  1STA A;  3V4S A;  1UC9 A;  4TV8 F;  2R92 A;  4JI6 Q;  2L15 A;  2YTX A;  1NJI C;  4O4L F;  1SE8 A;  3R2I A;  1VQ9 A;  1XPU A;  1EUC B;  5DQI A;  1LUZ A;  1FGU A;  3CKI B;  3IN5 A;  3RN2 A;  5DGB A;  1M90 C;  1NUC A;  1RHP A;  1W96 A;  4CDC C;  3T5J A;  4FO2 A;  4O2A F;  3G6J B;  1F2M A;  2NVT H;  2UXC L;  1YJ9 A;  5KFM A;  1H95 A;  5LP6 F;  4MTD A;  4DV2 Q;  4GLX A;  2F0F A;  2PVP A;  1I5F A;  3Q8S B;  4MA5 A;  3OHX C;  1WVL A;  4YHH H;  5GAG C;  1A9X A;  3CW2 C;  1D6E C;  1PH4 A;  2K28 A;  3CXC A;  3GIL A;  3BDC A;  3PR5 B;  4YJ3 F;  1SEB D;  5LMN W;  2JA9 A;  4IFD J;  3RLO A;  2W7P A;  1DD2 A;  4ABN A;  2XC9 A;  4NXM L;  4BY7 G;  2R7Z G;  2ZM6 L;  2CH4 A;  4H44 C;  4I7H A;  3KF6 B;  4JI7 H;  2JA8 G;  4F8M A;  1O7Y A;  1PH8 A;  3S17 B;  4FF4 A;  1D7Q A;  3K0X A;  4K0K L;  1IYJ B;  2EYH A;  5EDW A;  3GTQ A;  2WV6 D;  1STH A;  2NUA B;  5FPO A;  1VQB A;  4F7X A;  4JI1 Q;  1DYQ A;  1HH2 P;  4L5Q A;  4DR7 L;  1DGS A;  3GTM A;  4O3P A;  1FYC A;  1YHB A;  3C1F A;  4DR2 Q;  4A3G B;  1U5K A;  3DEP A;  4O3S A;  2FPI B;  4L8J A;  1ICW A;  4DK6 C;  4YR0 A;  4WJ4 A;  4IFD G;  4P75 A;  4LK1 C;  5JH7 F;  3I12 A;  5KG1 A;  4ZRZ A;  4ZUJ A;  5C0X G;  1RF2 D;  3I55 A;  2ZXO A;  4DR4 L;  1V9P A;  3R5X A;  2XWB B;  3PVX A;  1NTG A;  4NP5 A;  3V96 A;  4ZK9 B;  5M5W B;  1XTC D;  1CM9 A;  3PW2 A;  1LLR D;  4KK7 A;  1G29 1;  2L11 A;  5KFH A;  1JJC B;  4LMQ D;  1ASZ A;  1TWF A;  4B3S Q;  3E5N A;  2YTY A;  3TQT A;  2R92 H;  1Q7Y C;  3GTG A;  4LFB Q;  4HCE A;  1IW7 C;  1L1O C;  3D8G A;  3F2D A;  3T1Y H;  2DY8 A;  1JB3 A;  4LH7 A;  4HSP A;  4ZI7 F;  1CA6 A;  2OTJ A;  2ATW A;  3T13 A;  2B63 A;  3NTH A;  4K2L A;  3BS1 A;  3RZD H;  4EFB A;  4ED8 A;  4HJ8 A;  3BG5 A;  2J6U A;  4ECS A;  1CKN A;  1SMY C;  1VQ6 A;  2XVS A;  4CC6 A;  3QOJ A;  2ZM6 H;  5KFQ A;  1CQI B;  2UXC H;  1AN7 A;  1TKW B;  3HKZ E;  4X64 H;  1J6Q A;  2Y0S B;  4OO1 H;  1BBX C;  2W9C A;  1FNU A;  5KFX A;  3L4K A;  3T1Y Q;  5E1F A;  3S9W A;  3ORR A;  1QE6 A;  1IBL L;  2BH2 A;  2XCA A;  1F2L A;  1N34 Q;  1ZHQ A;  4HR7 A;  4U7C A;  4BBS B;  1JWU D;  1O7I A;  3KLS A;  3RZD B;  2Q2U A;  4IPG A;  2F0T A;  4ZKC B;  2HQL A;  1S3O A;  4JI4 H;  1Y1W H;  1PFS A;  1ICF B;  3OSN A;  1C48 A;  2PNH A;  4B3M H;  1N33 H;  1QUQ B;  4JBK A;  1YIT A;  3GTM H;  1HRJ A;  4F4Y A;  4A76 A;  2RVL A;  4I55 F;  3HS0 C;  2QDL A;  2RBM A;  2CKZ B;  3IKJ A;  4HMJ A;  1VQK A;  4AQY H;  3TQ1 A;  3RMH A;  1ZHS A;  2X69 A;  3L2P A;  4B3T H;  5BN5 A;  2JEJ A;  1VQL A;  3IAY A;  4C1N I;  4DK0 A;  4RB3 C;  4DK3 C;  3J7A F;  4QWC A;  1SYG A;  5KRU A;  1KL9 A;  1CHQ D;  3HOU H;  2I07 B;  2JE6 I;  2V59 A;  5I4D A;  3MXG A;  2NUC A;  1VMP A;  3BA9 A;  1BF4 A;  4MV7 A;  2IHF A;  1HZA A;  3MXN B;  1RYS A;  2IX0 A;  1F9P A;  2QGQ A;  5KFZ A;  5EJW A;  5J39 A;  2Q2I A;  3PUZ A;  1D1K A;  4MTE A;  3PIP A;  4EQO A;  4MV8 A;  4BY1 H;  2GVB A;  5IYC G;  4CDE C;  4R4T A;  4DV1 Q;  2FPG B;  2P0A A;  4YHH L;  4LFB H;  4YHH Q;  2B63 H;  4DV0 H;  4LUZ A;  2LY7 A;  1CSP A;  1X3G A;  3TS0 A;  4FBU A;  4X3K A;  4GKJ Q;  1AE3 A;  5M3F H;  4A3K G;  3CC2 A;  2BQU A;  5TSS A;  3T1H L;  3N42 B;  3NUC A;  4K5V A;  2KOL A;  2WII B;  4R4C A;  2I0Q A;  3I4N G;  3MR6 A;  4NB3 A;  1O75 A;  3CCU A;  2E5L L;  4IRK A;  4NW2 A;  1YJN A;  2ZDG A;  2EYO A;  2PI2 A;  4IQZ A;  2R6F A;  1E3P A;  1S10 A;  4RHS A;  1E22 A;  3D4W A;  4JI6 H;  1JQY D;  5JEA G;  1KJ8 A;  2HCC A;  1CS0 A;  1HTL D;  1WTQ A;  2AQ4 A;  2EJM A;  2G5D A;  1B3A A;  1LO5 D;  3KYH C;  1DV1 A;  4A93 H;  1BNC A;  1KIX A;  3H0G A;  4DV1 H;  2FJ2 A;  3OHB A;  1G51 A;  4JI1 H;  3JAM E;  2DZD A;  4R8U B;  2C5C A;  1DOM A;  2F0U A;  4JI2 H;  3D3R A;  3HKZ G;  1I6H H;  3J7A K;  3KUP A;  4B3R L;  4Q8F A;  3J7A 5;  2RQX A;  5C1P A;  5DAU A;  3OYY A;  4IJH A;  1DZ1 A;  4GOP B;  1SAP A;  1NMF A;  2NU7 B;  2CFM A;  4DR3 H;  2BE5 D;  1I4Q A;  5CAE B;  3S14 B;  2YYA A;  1VQO A;  3D6W A;  1EYA A;  2EJF C;  4HJA A;  1LTB D;  3UDX A;  3TQY A;  1PVO A;  4R1J A;  2K7V A;  2ZTD A;  4IUN A;  4A3I B;  2W6M A;  3OSP A;  5LL6 X;  4LF4 H;  4Q0Y A;  3X3N A;  4IPH A;  4XIG S;  2GPW A;  1WOC A;  3RD4 A;  3HOZ B;  4B3T Q;  1DOL A;  2R7Z H;  4A3E H;  3D31 A;  2ZT9 C;  2JA6 H;  1SDF A;  1I6H B;  5IGD A;  3R2T A;  3LP8 A;  2R93 A;  1UWV A;  1XMQ Q;  1B6R A;  4PWQ A;  4E6I A;  1C4Q A;  4LAA A;  1PMR A;  3F8T A;  4DUZ Q;  3U9S A;  4EQP A;  3K80 C;  2C00 A;  3HKZ A;  3HOV B;  4X3U A;  4B9X A;  2EVB A;  1PRT B;  1UEB A;  3S2H B;  3IG0 A;  1TY0 A;  4DV3 L;  2FHT A;  3CCL A;  2NYZ D;  1IBM Q;  3GTJ B;  1JDE A;  2UXD Q;  2I80 A;  1VF7 A;  2R93 B;  2A1A A;  5I9P A;  2XCP A;  3DM3 A;  2F0D A;  3RZO B;  1BGW A;  4A93 B;  4DUZ L;  1GJX A;  3PQI A;  5C0X J;  3M4P A;  2F0G A;  3SHL A;  3NWS A;  1L0W A;  5IYD G;  3S1R B;  4JI2 L;  2ICI A;  2EY2 A;  3RFC A;  1S5F D;  4IUP A;  5D65 A;  2NTT A;  3ER0 A;  5FD6 A;  3W5O A;  5C3E B;  1CKM A;  1RJQ A;  4HN7 A;  3FKI A;  3PO3 G;  2VW9 A;  3IRB A;  2IW3 A;  4ULL A;  1GKH A;  2NTS A;  5KT5 A;  5IE8 A;  1I4R A;  2QW7 A;  2UU9 Q;  4JCV E;  5EKK A;  4X65 L;  2XGP A;  3HOZ H;  2VR1 A;  1LT3 D;  4RAZ A;  2XCL A;  4LF7 H;  4DR1 L;  3GII A;  4MTK A;  2V5A A;  2FP4 B;  3ICE A;  1RD9 D;  4JV0 A;  2TMP A;  4JG2 A;  1N32 L;  3GTK B;  3LWE A;  4MNO A;  1VF5 C;  5IYC H;  4QJF A;  2JA7 A;  3PO2 G;  3S2D H;  4K5W A;  3H3V I;  1S4Z A;  1IBM L;  3FEW X;  1T36 A;  2UUB H;  3RGX A;  1EY6 A;  1A2T A;  2ZDH A;  1I50 A;  3UE1 A;  4JV2 A;  3KDF A;  2K5D A;  3AMU A;  1XMO H;  2QKI C;  4XYM B;  2JA6 A;  3J81 i;  2VQE H;  2QEJ C;  3ERQ A;  2IT1 A;  2R93 H;  2DNC A;  1XPR A;  3EPI A;  1CZG A;  3RB0 A;  1HNW H;  3RZO H;  4RUC A;  5CV9 A;  2W9B B;  2D0O A;  1MJC A;  2YL2 A;  5AJ3 Q;  3OWE B;  1SYB A;  3UFX B;  2ZJT A;  5DLF A;  1Q12 A;  2A6E D;  4YWK A;  1LTG D;  2OEO A;  3JAM L;  4A3L G;  4DV3 H;  1GUN A;  2HDM A;  3GIQ A;  3RUZ A;  4ECZ A;  3NQI A;  4HAE A;  1E2W A;  1II3 A;  1IHZ A;  2QA4 A;  4RGT A;  3G6Y A;  5IOC A;  1CSQ A;  4IZ8 A;  3FMA A;  1G6P A;  1K28 A;  2N88 A;  4QWA A;  1KAW A;  2MO1 A;  1WTP A;  1F9Q A;  1S0O A;  1Y8P B;  4AIM A;  4QCL A;  4DL6 A;  1MKH A;  4LW1 A;  1WJJ A;  1YZ6 A;  2FXQ A;  3K6O A;  2DY7 A;  1S97 A;  5D8D A;  4QGU A;  1IZ6 A;  5IGE A;  1DOK A;  4P74 A;  4LF9 H;  1SFO H;  5CV5 A;  1K83 A;  4ECW A;  2VA2 A;  3CRL C;  1A3U A;  1CZW A;  3CD6 A;  2W6P A;  1TWG B;  1T9H A;  4IOA A;  5AFW A;  4IRC A;  4WOR A;  4JI3 L;  1QB5 D;  4RH6 A;  1M0W A;  4Q8E A;  1JX4 A;  2HVS A;  4A3I G;  1STB A;  3ITP A;  3I4N H;  1FKA H;  3GQB A;  4WRD A;  1WTW A;  3BAA A;  2VY3 A;  2MFI A;  1OXS C;  1XPO A;  2ZTE A;  4HJ7 A;  2L0C A;  1G2T A;  1ENA A;  1E4F T;  2Z6K A;  5LL6 S;  5GAE C;  1PZJ D;  1V8Q A;  3OIQ A;  1K83 B;  2EYP A;  3MHB A;  3OW2 A;  4YBZ B;  2JA7 H;  1XDN A;  4G3I A;  1KLG D;  3QB3 A;  1EWH A;  5ELB A;  1TWG A;  5KFI A;  3WNZ A;  3GV6 A;  4A4I A;  1G8Z D;  5KFA A;  4ID6 A;  4L6T B;  5D3I B;  2C22 A;  1I50 H;  2R8I A;  3J80 c;  3WOE A;  2J6S A;  1HCZ A;  4O3Q A;  2PZU A;  2RDH A;  3TN2 A;  2OWO A;  3BG3 A;  3JSL A;  2PZT A;  3I4N B;  1K0R A;  2CW7 A;  2JEA I;  5CBE E;  2QF7 A;  2WDT A;  4RFB A;  4M9U A;  2BH8 A;  3NPP A;  2JA7 B;  3UQ8 A;  4H0L C;  3HG9 A;  5L1I A;  4YAJ B;  1OXT A;  1Q46 A;  3MXN A;  2K1B A;  4O1N A;  1TS2 A;  5JAV A;  4AQY L;  1DON A;  1RJP A;  2NVQ H;  1B50 A;  2V58 A;  2NB0 A;  3X3M A;  5KT2 A;  1A62 A;  2MPM A;  2NU9 B;  2PMZ B;  1WTO A; 
#chains in the Genus database with same CATH homology
 2LSS A;  2B29 A;  4A75 A;  1KC8 C;  4JI4 Q;  2UXD L;  3TEH B;  2JA6 G;  2MO0 A;  1X3F A;  2RCN A;  3U4Z A;  5LMN Q;  1HZC A;  1XMQ L;  1WFQ A;  3OTO Q;  4IO9 A;  4PZ6 A;  3FKI H;  2ALY B;  4DV3 Q;  3M9B A;  3U50 C;  3HOV G;  5IP9 H;  4JYA L;  1AE2 A;  2VUM H;  3GTQ H;  1Z9F A;  3JAM c;  3F2C A;  1L1O B;  1Q86 C;  4NXN Q;  1IL2 A;  1CKN B;  1PYS B;  1Q81 C;  3KDF B;  4DUY L;  1VS0 A;  1LTL A;  1FJG L;  4JI3 Q;  1Y1W G;  2YTV A;  5IT9 c;  3HOU G;  2ZJR A;  4X64 Q;  2KBN A;  4P73 A;  2ASB A;  3J80 i;  4DV0 Q;  2B63 G;  5E7N A;  4A3D G;  1NE3 A;  3OTO L;  2VUM G;  2D0P A;  1X54 A;  3E0E A;  4NXM Q;  1JJG A;  1VQI A;  1UE5 A;  4YCW A;  2K5N A;  4GKK L;  4X6A H;  5IYD H;  4UP8 A;  1R9T H;  4RG1 A;  4DR1 Q;  3WWV A;  4B3M Q;  2VQE L;  2F3I A;  1IBL Q;  1JE5 A;  5GRO A;  4JI7 L;  3M4O H;  4JI6 Q;  2L15 A;  2YTX A;  3PUX A;  1NJI C;  2VQF Q;  1SE8 A;  4BBR G;  1YJW A;  1VQ9 A;  1XPU A;  3FP9 A;  1LUZ A;  1FGU A;  4DV4 Q;  4JOI A;  3CME A;  3RN2 A;  4GKJ L;  3AEV A;  3VDY A;  1M90 C;  1B8A A;  1PH7 A;  4YCU A;  4APV A;  1Q82 C;  1E1O A;  5M5W H;  1YVC A;  4GOP C;  4A93 G;  2Q2T A;  4YWM A;  2NVT H;  4GNX C;  4PZ7 A;  4P71 A;  1XTD A;  4A3K H;  1YJ9 A;  1HNZ L;  2E2I H;  3S17 H;  2UXC L;  1H95 A;  1VQC A;  4DV2 Q;  4GLX A;  3JAM i;  3T1H Q;  1M1K C;  1I5F A;  1E7Z A;  2K52 A;  1S72 A;  4GS3 A;  1SLJ A;  5GAG C;  3CW2 C;  3A74 A;  3G6E A;  4POF A;  1PH4 A;  4GN4 B;  4C3J H;  4A3G H;  3CXC A;  2RHS B;  5LMN W;  1A8V A;  2JA9 A;  4IFD J;  3RLO A;  3A5Z B;  3W1B A;  1X9N A;  2R7F A;  1HZ9 A;  1XNQ L;  1HR0 W;  1UE1 A;  1UE6 A;  4NXM L;  4BY7 G;  2R7Z G;  2ZM6 L;  1WCM G;  2GVA A;  4GNX A;  3KF6 B;  1E24 A;  5GAD C;  2JA8 G;  2BA0 A;  4B3R Q;  1N8R C;  1FVI A;  1PH8 A;  4ALP A;  2Q2H A;  5ELO A;  2HHH L;  1D7Q A;  4OO1 G;  3K0X A;  4K0K L;  1IYJ B;  1K83 H;  2DGY A;  4K0K Q;  2VNU D;  1VQB A;  1EWI A;  4R4Q A;  4JI1 Q;  1HH2 P;  4L5Q A;  2AHO B;  4L5R C;  4DR7 L;  2NN6 I;  2HIV A;  1DGS A;  3RR5 A;  3CP0 A;  1YHB A;  4DR2 Q;  2UU9 L;  5IYB H;  3CCS A;  1U5K A;  4LFC L;  5GQO A;  2JQO A;  4DK6 C;  2DUD A;  4WJ4 A;  1K9M C;  4IFD G;  4P75 A;  1HNZ Q;  5J3B A;  3HOX G;  4WJ3 M;  5C0X G;  4QL5 A;  2CCZ A;  4C2M H;  1VQ4 A;  4DR4 L;  3I55 A;  4JI0 Q;  1N32 Q;  4UY8 C;  1CKO A;  4IPC A;  1OXX K;  1V9P A;  5C4X H;  1EQR A;  3CF5 A;  1C7Y A;  1BVS A;  1IBK L;  4JI0 L;  4IPD A;  1NTG A;  3EBE A;  2QEX A;  3GTO H;  3PO2 H;  1KQS A;  1WYD A;  4DR5 L;  2C35 B;  2MNA A;  1I94 Q;  4BBS G;  5AJ3 L;  1XJV A;  2BA1 A;  1PH6 A;  1G29 1;  1P8L A;  1VCI A;  1JJC B;  4BXX H;  1ASZ A;  4YY3 Q;  4XTC S;  4B3S Q;  4A3J G;  4POG A;  2YTY A;  2R92 H;  1Q7Y C;  1HR0 L;  4LFB Q;  5FJ8 G;  1L1O C;  3HOZ G;  2CWA A;  3F2D A;  1VQ8 A;  1L2F A;  3AQQ A;  4GOP A;  2OTJ A;  2ATW A;  1EIY B;  4QQB X;  3RZD H;  4DR5 Q;  4HJ8 A;  4HIK A;  3ULL A;  2I5M X;  2KCT A;  1CKN A;  1VQ6 A;  2ZTC A;  1GD7 A;  4KLK A;  3L7Z C;  1BBW A;  3BZK A;  1TWA H;  3CCM A;  3NEM A;  2GN5 A;  4DV6 Q;  1ASY A;  3HKZ E;  1J6Q A;  4LF4 Q;  1X65 A;  2UUC Q;  4GKK Q;  4DR6 Q;  5DLQ E;  3K7A H;  4LWC A;  2I5L X;  2JA5 H;  3T1Y Q;  4DR3 Q;  3TS2 A;  2BH2 A;  3FKI G;  1IBL L;  3HOV H;  3KLW A;  4A3F G;  3CMA A;  1N34 Q;  2Q2U A;  1O7I A;  3H3V H;  2AWN A;  4IPG A;  2CQO A;  4JOI C;  2HQL A;  2NZH A;  4MTN A;  1S3O A;  3HOX H;  4DV4 L;  4JI5 Q;  3HOY G;  1Y1W H;  1IXR A;  1PFS A;  1X55 A;  1YIJ A;  2IY5 B;  2PNH A;  1YHQ A;  4TQU S;  4LF8 L;  1QUQ B;  4JBK A;  4DV5 Q;  2WAQ G;  5IP7 G;  1VQF A;  4B3M L;  3S1R H;  1YIT A;  3GTM H;  4A76 A;  3CPW A;  2NN6 G;  3STB D;  2XGT A;  4Y7N H;  2CKZ B;  1PHJ A;  1VQK A;  1SMX A;  5EAY A;  1FL0 A;  3S1Q H;  3HOW G;  3LGJ A;  3L2P A;  2N49 A;  1PV4 A;  4O2D A;  1VQL A;  4JI1 L;  4JYA Q;  2AWO A;  4DV7 Q;  4AH6 A;  1Q1B A;  1BBU A;  4DK3 C;  1Y1V G;  3S16 H;  5K36 G;  1QUQ A;  4IFD I;  1KL9 A;  2IX1 A;  3HOU H;  4DV6 L;  2JE6 I;  1FJG Q;  3UDG A;  3J81 c;  4L5T A;  2IHF A;  1HZA A;  3MXN B;  1Q8K A;  4NXN L;  2IX0 A;  2QGQ A;  4AQY Q;  3I4O A;  3RNU A;  3GTP H;  4Y52 H;  2Q2I A;  3PUZ A;  1S40 A;  2NZO A;  3RLN A;  4A3C G;  3PIP A;  4HIM A;  4JI5 L;  4HIO A;  1QZG A;  3I4M G;  4BY1 H;  2GVB A;  4P72 A;  4GN5 A;  4EQ5 A;  1MIU A;  2YV5 A;  4R4T A;  5IYC G;  4DV1 Q;  1PH3 A;  4JI4 L;  3GTL H;  4YHH L;  1YI2 A;  2I5H A;  4A3B G;  2RHQ B;  4YHH Q;  4LF6 L;  2B63 H;  4LUZ A;  1V43 A;  1CSP A;  1X3G A;  3TS0 A;  1VQ7 A;  2JA8 H;  4GKJ Q;  1AE3 A;  1TWC H;  1KRT A;  4DR3 L;  3CC7 A;  5M3F H;  1N33 L;  4A3K G;  2KCM A;  3CC2 A;  1VQN A;  1OTC A;  2EXD A;  4BBR H;  4DV2 L;  5HGQ A;  3T1H L;  1JJ2 A;  2Z0S A;  3TRZ A;  4TVA B;  4R4C A;  2I0Q A;  3I4N G;  4NB3 A;  3S1N H;  4RMF A;  3CCU A;  2E5L L;  5FLM G;  2K5H A;  4DPG A;  1YJN A;  3KFU A;  2PI2 A;  4A3C H;  4QY7 A;  1EFW A;  1E3P A;  4DAM A;  1E22 A;  2VQF L;  3KF8 B;  5JEA G;  4L5S A;  3M7N A;  3E9H A;  1J5E L;  1N33 Q;  2UXC Q;  1JT8 A;  1KXL A;  1EOV A;  4BBS H;  1XNR L;  3KYH C;  2UUA L;  4A93 H;  1NMG A;  1KIX A;  1HR0 Q;  4LNQ A;  2ID0 A;  3GO5 A;  3M4Q A;  3MEF A;  1B70 B;  1G51 A;  1EQQ A;  3CCQ A;  5JJL A;  1JMC A;  5LMU Q;  1OXU A;  3HKZ G;  1KRS A;  2WP8 J;  1I6H H;  2NVY H;  1CUK A;  1TXY A;  2K75 A;  3GTJ H;  1N34 L;  1K8A C;  4B3R L;  1SRO A;  3J7A 5;  4R4I A;  2F4V L;  3OYY A;  4IJH A;  1EUJ A;  3KJP A;  3KJO A;  5IYB G;  4EX5 A;  4GOP B;  3AFQ A;  1NMF A;  4JC0 A;  2CFM A;  5H1S E;  4AYB E;  1XNQ Q;  4GLA C;  1VQO A;  4OWW B;  2OCE A;  4HJ9 A;  2UUC L;  4HJA A;  3JC6 6;  3UDX A;  3TQY A;  5HY6 A;  4R1J A;  2ZTD A;  5BR8 Q;  3F1Z A;  1PH5 A;  4LF4 L;  4KHP Q;  1PVO A;  3PF4 A;  1MJE A;  2EQS A;  1EIF A;  2JA5 G;  2JA7 G;  1X3E A;  4IPH A;  4XIG S;  1VQE A;  3D0F A;  1WOC A;  4B3T Q;  2ES2 A;  1KHI A;  2ZM6 Q;  1K3R A;  2R7Z H;  5IP7 H;  2D62 A;  4A3E H;  3D31 A;  2OTL A;  1TWF H;  1TWG H;  2CWP A;  5C3E G;  3S1M H;  1K73 C;  1XMO Q;  4JI6 L;  2JA6 H;  4IJL A;  3PF5 A;  3CQZ H;  3GTG H;  1Y14 B;  1UWV A;  2WAQ E;  3I7F A;  2K5V A;  1XMQ Q;  3EIV A;  1EYG A;  4A3J H;  3PGZ A;  4FDB A;  2ZJQ A;  1YHA A;  2MQH A;  3F8T A;  4JBJ A;  4DUZ Q;  4DV1 L;  3K80 C;  2UUA Q;  2K50 A;  3HOW H;  2RF4 A;  4PMW A;  4YWL A;  2LXJ A;  1UEB A;  2PMZ E;  5ELN A;  4A3E G;  2AKW B;  4R4O A;  1K8G A;  3UDF A;  3CC4 A;  1W3S A;  1QVG A;  4DV3 L;  3HKS A;  4OX9 L;  3G71 A;  3GD7 A;  5C0X I;  3BU2 A;  1JB7 A;  3CCL A;  2Y0S G;  1IBM Q;  4YCV A;  2K4K A;  4DV0 L;  2UXD Q;  4JI8 L;  4JBW A;  2A1A A;  2HHH Q;  5C44 H;  3DM3 A;  4OWX B;  3U58 A;  2YYZ A;  3A0J A;  3BJU A;  1YEZ A;  4HID A;  3A5U A;  4B3S L;  2ZJP A;  3S14 H;  3M3Y H;  4DUZ L;  5M3M G;  2LXK A;  5C0X J;  3M4P A;  4JI2 L;  1L0W A;  5IYD G;  4ME3 A;  1E1T A;  4PZ8 A;  4LFC Q;  5C4X G;  3I2Z A;  2WB1 E;  2NVX H;  1QVF A;  2HT1 A;  2R92 G;  1HNW Q;  4JBM A;  3H15 A;  4LF5 L;  1HJP A;  3ER0 A;  3ZJY C;  4A3L H;  5C44 G;  1SR3 A;  3RN5 A;  1GVP A;  3PCO B;  3W5O A;  1CKM A;  4DNI A;  2YU9 H;  1LM0 A;  1QVC A;  3PO3 G;  2VW9 A;  4DUY Q;  5FLX c;  5LMU L;  3IRB A;  1Z47 A;  4H02 A;  1GKH A;  4GN3 B;  4QIW E;  3CPF A;  5IE8 A;  4C3I H;  1I94 L;  3EN2 A;  5BR8 L;  3CAM A;  4DR2 L;  4JCV E;  2UU9 Q;  4X65 L;  4JI7 Q;  4KHP L;  2VL6 A;  4X66 L;  4A3D H;  3G48 A;  4X66 Q;  3HOZ H;  4BA2 I;  4DR1 L;  3S2H H;  3NEL A;  3PUV A;  3ICE A;  2A19 A;  5C4J H;  4DR4 Q;  4GLV B;  4JG2 A;  3AFP A;  1N32 L;  1BKB A;  2EIF A;  2N78 A;  4LUV A;  4MNO A;  4OXP A;  4LF7 Q;  4DV5 L;  1GM5 A;  2JEB I;  5IYC H;  4QJF A;  1TWH H;  4DAY B;  1B7Y B;  4J15 A;  5M5Y H;  4LFA Q;  1YNX A;  3Q8D A;  3GDE A;  3PO2 G;  3S2D H;  3H3V I;  1IBM L;  3PO3 H;  1UE7 A;  1AH9 A;  1HZB A;  5LMN L;  5JEA J;  3I56 A;  4LF9 L;  3UE1 A;  3K7U C;  3PUW A;  5IY0 A;  3KDF A;  1KD1 C;  1V1Q A;  3RLF A;  3HOY H;  3J81 i;  3STB C;  1XNR Q;  1VQD A;  2N3S A;  2IT1 A;  5FLM H;  4IOC A;  2R93 H;  1XPR A;  4OWT B;  3RZO H;  4KHZ A;  5C3E H;  1N9W A;  4AYB G;  5GAH C;  1HNW L;  3J7Z C;  4HJ5 A;  1RIP A;  1I3Q H;  2D0O A;  1SRU A;  4O0A A;  3I4M H;  1PH1 A;  1MJC A;  3S15 H;  3H0G G;  5AJ3 Q;  3ULP A;  1Q12 A;  1C9O A;  4YWK A;  3J81 j;  4A3B H;  2Z6K C;  3W1G A;  1D8L A;  3BZC A;  4A3L G;  1HNX L;  3NBH B;  3CCE A;  1N36 Q;  4JV5 L;  3SGI A;  3KOJ A;  1PH2 A;  3PUY A;  3M85 A;  2QA4 A;  2IHE A;  4BA1 I;  1Q1E A;  3FHW A;  5JJK A;  1CSQ A;  2UXB L;  1G6P A;  5IP9 G;  1VQG A;  1KAW A;  1WCM H;  1X56 A;  2N8N A;  2VQE Q;  1VQP A;  4LFA L;  4UP9 A;  2MO1 A;  4A3G G;  2KEN A;  4DR7 Q;  3B6Y A;  4AIM A;  4LF7 L;  1P16 A;  1MKH A;  1VQ5 A;  2K14 A;  4LW1 A;  1WJJ A;  1Y1V H;  1YZ6 A;  2FXQ A;  4A3I H;  4A3M H;  3L0O A;  3H0G H;  1NBW A;  4QGU A;  1IZ6 A;  2KHI A;  3PIO A;  2E2H H;  3U4V A;  3GTK H;  4P74 A;  1X6O A;  2Y0S E;  4DV7 L;  1SFO H;  4X65 Q;  3G4S A;  4LFB L;  1WI5 A;  3CD6 A;  2VS1 A;  3T1Y L;  2OQ0 A;  4MZ9 A;  5FJ8 H;  1IBK Q;  2A8V A;  2V1C C;  1T9H A;  4OX9 Q;  4IOA A;  3UE0 A;  3NEN A;  4JI3 L;  5M3F G;  1LYL A;  5IWA L;  3E9I A;  4BXX G;  2F52 A;  4A3I G;  4A3M G;  4UPA A;  3I4N H;  4X62 L;  4JI8 Q;  2VY3 A;  2MFI A;  2WB1 G;  1OXS C;  2R6G A;  1VQH A;  2ZTE A;  3K8A A;  4OON A;  4UP7 A;  4C3H H;  4HJ7 A;  1XPO A;  2WFW A;  2Z6K A;  4DKA C;  5GAE C;  1PA6 A;  1J5E Q;  1C0A A;  1A63 A;  1YBY A;  3CCR A;  3OW2 A;  5JJI A;  1U0L A;  4GNX B;  3KF6 A;  4KI0 A;  2JJQ A;  2PI2 E;  2H5X A;  4JI2 Q;  3HFZ B;  2JA7 H;  4OO1 I;  2E5L Q;  1PH9 A;  3AYH B;  3S24 A;  2OQK A;  2XTI A;  4A4I A;  1VQM A;  4A3F H;  4BY7 H;  4LUO A;  4LF5 Q;  2E2J H;  1I50 H;  2KHJ A;  3PV0 A;  3J80 c;  2JK8 A;  2UUB L;  3F2B A;  2UXB Q;  1PYB A;  1A0I A;  2PQA A;  4X62 Q;  3CCJ A;  5M3M H;  1GO3 E;  2E8G A;  2OWO A;  4BY1 G;  1HNX Q;  1K0R A;  2R7D A;  1N36 L;  4JV5 Q;  4NPS A;  2F4V Q;  2HIX A;  2JEA I;  4LF6 Q;  1NY4 A;  2B3G A;  2R93 G;  4LF9 Q;  3ULJ A;  4YY3 L;  2BH8 A;  3DLL A;  3CCV A;  2AMC B;  3TRE A;  1W2B A;  1VQJ A;  1OXT A;  1Q46 A;  5M5X H;  4DR6 L;  1SN8 A;  2UUB Q;  4LF8 Q;  1L1O A;  2PQA B;  4AQY L;  1XMO L;  3UDI A;  2NVQ H;  4PG3 A;  3K81 C;  3PSI A;  1VQA A;  4B3T L;  1QZH A;  1A62 A;  5IWA Q;  1RL2 A;  3ERS X;  2VZA A;  1OXV A;  4X64 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...