3PO2G

Arrested rna polymerase ii elongation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po2G01
4R4TA 3G6EA 1EYGA 2E2IH 4GKJQ 3J81i 4EX5A 1EQQA 3AFQA 4LF6Q 1N32Q 1SFOH 2LXJA 4GLVB 3HKZG 3HOUH 4JI7Q 4NB3A 2HIVA 4DR5Q 4A3IH 3GTGH 2A19A 3TS0A 2K75A 1T9HA 4LFCQ 5IWAL 3CCEA 1CSPA 3U58A 1K0RA 2EIFA 3CP0A 4A93H 4DV1L 1GD7A 1LUZA 4GKKL 1X55A 4BA1I 3UDXA 3CCRA 4GKJL 4O0AA 2N3SA 4HIMA 4A3JG 4LF6L 1AE3A 1Q8KA 1N32L 4LNQA 1L1OB 3I7FA 4DR5L 4JI7L 4DV3Q 2H5XA 5JEAJ 4DNIA 2AWOA 3UDIA 3I55A 4LFCL 2GVBA 4HJ5A 1M90C 1D8LA 1YJWA 4R4QA 3G71A 3I4MG 3S14H 4HIOA 2PQAA 1WOCA 1IYJB 3B6YA 3KYHC 2E5LQ 3FKIG 3EN2A 1VQOA 3BZCA 3UDGA 2L15A 4DV5L 1YEZA 5IYBH 4IJLA 4DV2Q 2ZJRA 1LYLA 2HIXA 3SGIA 3TEHB 5BR8Q 2YYZA 3E0EA 2R7FA 4LUVA 3L0OA 4AH6A 3KF6B 3M4QA 4B3MQ 4YCUA 5IYCH 3L2PA 4HJ8A 2E5LL 1O7IA 1Z47A 3KDFB 1ASYA 4LF7Q 4X62Q 3UE1A 4DV2L 4KHZA 2UXCQ 4UPAA 1N33Q 3HKZE 2IHEA 3A5UA 3E9HA 5EAYA 1VQPA 5BR8L 2JA9A 4HIKA 2OWOA 4B3ML 2NN6I 4C2MH 4OXPA 1C7YA 4A3MG 4JBKA 1J6QA 1XNQQ 3MEFA 3GTMH 1MJEA 4LF7L 3JAMc 1K73C 4X62L 4DR4Q 1U5KA 4X64Q 3GDEA 1KD1C 1QVCA 3H3VI 2KENA 5C3EG 1HR0Q 2UXCL 2CWPA 1WCMH 3PUWA 4ME3A 1HR0W 1N33L 1X3EA 1YHAA 4OX9Q 4A3CH 3J7ZC 5M3FG 1K9MC 4P72A 1S72A 5JJKA 1B70B 5H1SE 3HOWG 4B3SQ 3CCVA 2RHQB 2JA5H 1XNQL 2YTYA 3PCOB 5GADC 2N78A 3M9BA 2HHHQ 5J3BA 4DR4L 1I6HH 1BBUA 4X64L 2Q2TA 2PQAB 2KCMA 4LF8Q 3RLNA 2IT1A 3A5ZB 1UE1A 2MQHA 5FLMH 1FGUA 1Q1BA 2OTJA 1XNRQ 1JE5A 3HOVH 1S3OA 4OX9L 2ZJQA 4JI5Q 1VQ7A 4POFA 1K8AC 3PUXA 1CKOA 4DAYB 4DKAC 1RIPA 1SROA 3EIVA 2VQEQ 4FDBA 4DUZQ 3F8TA 5GAEC 2E2HH 1CSQA 2CKZB 4UP7A 4DUYQ 2JA6H 2HHHL 2WAQG 2ES2A 1JB7A 2UUBQ 4A3EG 4AIMA 2BH2A 1I5FA 3ICEA 1V9PA 2CFMA 4MNOA 5GQOA 3CCSA 2VL6A 4DAMA 3PSIA 5IYDG 1MIUA 1VQ9A 1WYDA 1ASZA 2HT1A 1I94Q 4BXXH 1AE2A 3S1MH 4A3DH 4JYAQ 3S2DH 2VQEL 3I4NH 4DV0Q 1K8GA 1SRUA 5IP9H 4DUZL 2NZOA 2R7ZH 2QGQA 4A3BG 2B3GA 3U4VA 4DUYL 1XTDA 1KIXA 2JK8A 1PH5A 2UUBL 3GTQH 3H3VH 4OWWB 1U0LA 1OXXK 2JJQA 2XGTA 3AYHB 2AKWB 4JI8L 5C3EH 4GNXC 1KQSA 2Q2UA 2VZAA 3PUVA 3CC2A 4LF9Q 4IPCA 4DV6Q 1I50H 5M3FH 2AWNA 1EIFA 5M5YH 1I94L 1EFWA 4JYAL 2JEAI 2RHSB 4TQUS 4QJFA 1VQGA 4BBRH 5GAGC 4DV0L 1IZ6A 1Q1EA 1GKHA 2CQOA 4UP8A 4PMWA 2ZM6Q 1YITA 2EQSA 1E3PA 2E8GA 2F52A 3HOZH 2WB1G 3H15A 2JA8G 3S16H 4OO1G 3BU2A 1TXYA 2UXDQ 1JT8A 3KJOA 1HH2P 1BBWA 2JEBI 1SE8A 2K50A 4LF9L 3PO3H 1VQJA 2BA1A 4DV6L 4OWTB 1X3GA 3IRBA 1Y1WG 2OTLA 1TWGH 1WJJA 1XMOQ 1G6PA 4LW1A 2WP8J 3ERSX 2VQFQ 1VQ5A 1W2BA 4RMFA 5FJ8G 3BZKA 2ZM6L 1IBKQ 1Q81C 2EXDA 3W1GA 3OW2A 1KXLA 4A3LG 4L5RC 2JQOA 1VQMA 4A3EH 4HIDA 4IPDA 2UXDL 2BH8A 4GLAC 3HOXG 2BA0A 1PA6A 4QGUA 2NVTH 3RN2A 3STBC 4DV4Q 2Y0SG 1XPOA 1EUJA 3TQYA 5IYDH 4BBSG 1XMOL 2R93G 1Q86C 4JI0Q 2VQFL 1X56A 4MTNA 4GKKQ 4QL5A 1XJVA 4AYBE 1IBKL 2JA7H 3H0GG 4GN5A 5IT9c 3GTKH 5LMNQ 3CPWA 5C0XG 5LMNW 2V1CC 4O2DA 1X6OA 3UE0A 1PYBA 4LF5Q 1UWVA 2UU9Q 1NTGA 1VQHA 2HQLA 2I5HA 1Y1VG 3K81C 2UUAQ 4XTCS 3DLLA 4DV3L 1KRTA 3CXCA 4B3TQ 4J15A 1VCIA 1VQNA 1CKMA 3HOYH 4R4IA 1G51A 3TS2A 1K83H 2C35B 4WJ3M 4P74A 5LMNL 4YHHQ 3F2BA 4A75A 3GTLH 2JA8H 1QZHA 3GO5A 1PH2A 4GN3B 1GM5A 2VUMG 2R7DA 1PVOA 1Q12A 4QIWE 1IXRA 4L5SA 5JJIA 5M3MG 4LF4Q 1S40A 4LFBQ 4L5QA 4DR2Q 3A0JA 4QY7A 1PH7A 4R4OA 2UU9L 3CQZH 2UUCQ 4HJ7A 1HZBA 1Y1WH 1QVFA 1WI5A 3LGJA 3AEVA 4B3TL 2D0OA 5M5WH 3PO2G 2ZTCA 4YY3Q 2MNAA 3T1HQ 4R4CA 4A3KG 3AFPA 1PH1A 2B63G 3KOJA 4YHHL 4A3LH 5FLXc 3RZOH 1NJIC 2I0QA 1NY4A 4JI1Q 1VQAA 2LSSA 4JBJA 4JCVE 3CCMA 1XMQQ 5ELOA 4A76A 4LF4L 4KHPQ 4DR2L 3CPFA 3JC66 4A3JH 4LUOA 2UUCL 1TWAH 3K7AH 4EQ5A 3CCQA 2KBNA 4Y7NH 3U50C 2R6GA 3T1HL 2Y0SE 2IHFA 4GNXA 3CC4A 4JI4Q 3M7NA 3M3YH 4BA2I 2LXKA 2WFWA 3CCJA 1A63A 2QA4A 1OXTA 3I4MH 4YWMA 1YNXA 1EIYB 4BY7G 2Q2IA 4JI1L 3W5OA 4DR3Q 3NENA 2UXBQ 2I5MX 1KL9A 2OQKA 3J7A5 4KHPL 3FKIH 3J80c 1Y14B 1VQLA 3HKSA 1L0WA 5IP7G 2OCEA 1QZGA 2N8NA 1TWHH 5LMUQ 4IFDG 1PV4A 2VNUD 1NBWA 1HR0L 1YVCA 2MO1A 2KHIA 1E7ZA 3FP9A 1IBMQ 3EBEA 3S17H 3I2ZA 1VQ4A 1J5EQ 2B29A 4B3SL 2UXBL 4L5TA 4DV7Q 5GROA 4B3RQ 2I5LX 4X65Q 4LF8L 3T1YQ 1OXVA 1C9OA 2DUDA 4KLKA 4XIGS 3ER0A 4BY1G 4AQYQ 3GTOH 4IOAA 1YZ6A 2GVAA 3PUYA 4A4IA 1XNRL 2NVXH 3PO2H 2K14A 1IBML 2F3IA 1W3SA 2YTVA 1DGSA 2VY3A 4JI5L 3PF5A 4JI3Q 1J5EL 1PHJA 1PFSA 1X65A 4R1JA 4C3IH 4A3MH 1YBYA 4PG3A 3U4ZA 4DV7L 4B3RL 3HOUG 3M4OH 1HZ9A 5GAHC 4X65L 3TRZA 1CKNA 3CCUA 3T1YL 4P73A 4DR1Q 4AQYL 4JI6Q 3S1RH 1C0AA 1HZAA 2F4VQ 4NXMQ 1MJCA 3A74A 4NPSA 3RR5A 1YHQA 4A93G 1HNZQ 1IL2A 4JI3L 1GO3E 2RF4A 1OXUA 1YI2A 4BY7H 2YV5A 1V43A 4P75A 3HOWH 4GNXB 3CMEA 1YHBA 3S24A 2GN5A 3TREA 2K5HA 3RNUA 3RZDH 4DR6Q 1P16A 1BVSA 3HFZB 5AJ3Q 3I56A 4OO1I 1CUKA 4DR1L 4A3FG 1JMCA 4JI6L 1FL0A 1PYSB 1E22A 4GOPC 3Q8DA 1PH8A 4NXNQ 4QQBX 1E1TA 1Q7YC 4K0KQ 1G291 3DM3A 1UE7A 4PZ6A 4JOIC 3NELA 3KJPA 1HNZL 1VQ8A 4IFDJ 1HNXQ 2ASBA 2YTXA 2DGYA 3D0FA 3CCLA 4DR6L 5IYBG 5AJ3L 1N34Q 1VQCA 5IWAQ 1AH9A 4BY1H 4NXNL 3OTOQ 1FVIA 2WAQE 2D0PA 3MXNB 3K80C 4JBWA 5HY6A 1D7QA 1IBLQ 3CMAA 5IYCG 2CWAA 4YCWA 1GVPA 2Z6KC 1HNXL 4IO9A 2E2JH 4A3BH 1E1OA 3GTJH 3K7UC 3PGZA 1N34L 4C3JH 4RG1A 5C44G 5ELNA 4APVA 5C0XI 3J81c 1KC8C 3W1BA 5C4JH 3OTOL 1RL2A 1X3FA 1L2FA 4JC0A 1SLJA 4DV4L 1N36Q 1YJNA 1CKNB 1L1OC 1IBLL 3J81j 5C4XG 3UDFA 3CF5A 4JI0L 5DLQE 1H95A 3ULLA 1KAWA 2A1AA 2Z0SA 3L7ZC 3RLOA 3G48A 1SR3A 3AQQA 4DV5Q 1UEBA 4IPGA 3D31A 2VS1A 4P71A 1QUQA 1WCMG 5M5XH 4A3FH 4IJHA 4A3CG 2ZJPA 2WB1E 3NEMA 1EQRA 1N36L 4X66Q 4LF5L 1PH9A 1KHIA 3FHWA 2UUAL 4DPGA 2A8VA 2PNHA 3S1QH 2JA5G 1VS0A 1YJ9A 2NZHA 5FJ8H 3K8AA 5IY0A 1JJCB 2MO0A 1HJPA 3E9IA 4OWXB 4DR7Q 3RN5A 4C3HH 2XTIA 2ALYB 3CW2C 2IX0A 5FLMG 3JAMi 3ULPA 3HOVG 1A0IA 3HOXH 2JE6I 1JJGA 1WFQA 2AMCB 4LFBL 4X66L 1UE5A 4DK6C 3PV0A 4BBSH 2R93H 1QVGA 4JV5Q 1VQFA 2PI2E 4YY3L 2JA6G 2RCNA 4DR7L 2ZTEA 1NMFA 3H0GH 1OTCA 3J80i 3I4OA 2ID0A 3GD7A 5C44H 4X6AH 4LFAQ 1NMGA 3S2HH 1XMQL 1MKHA 3RLFA 1VQ6A 2K4KA 2PI2A 2R92G 4BXXG 1HZCA 2NN6G 4A3DG 1TWFH 3WWVA 1Y1VH 5C4XH 5C0XJ 4HJ9A 5IP9G 3I4NG 4IFDI 4PZ8A 2R7ZG 4JV5L 4A3GG 4JI4L 4MZ9A 4OONA 4GOPA 2K5VA 4JG2A 1Q82C 4JOIA 4GN4B 4DR3L 4LFAL 1VQKA 4TVAB 2VUMH 3KFUA 3KF8B 4HJAA 3PIPA 2NVQH 5M3MH 1M1KC 1K3RA 2KHJA 4ALPA 1XPRA 5IE8A 1FJGQ 1QUQB 4BBRG 3F1ZA 4H02A 5LMUL 3STBD 2YU9H 3S1NH 1A8VA 3CAMA 1P8LA 3HOZG 3CC7A 2KCTA 1B7YB 4IOCA 3F2DA 1KRSA 1SN8A 1VQEA 4A3KH 2B63H 1EWIA 2D62A 2PMZE 3S15H 2Z6KA 3PF4A 3PO3G 5K36G 3ZJYC 4JI2Q 3CD6A 4KI0A 4POGA 5HGQA 3VDYA 1SMXA 1EOVA 2AHOB 1FJGL 4A3IG 4UP9A 1Z9FA 3ULJA 4DK3C 1N8RC 1PH4A 4LUZA 1LM0A 2N49A 3BJUA 2VW9A 1TWCH 1PH6A 2IX1A 3GTPH 4Y52H 1E24A 1L1OA 1V1QA 5JEAG 3G4SA 4YCVA 1HNWQ 4JI8Q 4JI2L 4GS3A 4AYBG 1XPUA 2R92H 3NBHB 2NVYH 4IPHA 5IP7H 3PUZA 3M85A 2JA7G 4A3GH 2CCZA 2F4VL 4NXML 3M4PA 2QEXA 2IY5B 4LWCA 1JJ2A 2K5NA 3K0XA 4UY8C 1I3QH 1VQIA 3PIOA 1VQBA 1Q46A 2FXQA 2ZTDA 1HNWL 2K52A 2Q2HA 1B8AA 3F2CA 3OYYA 4GOPB 1X9NA 1PH3A 1BKBA 1NE3A 5E7NA 1UE6A 4YWLA 3KF6A 1N9WA 3KLWA 3HOYG 4YWKA 2ATWA 5JJLA 1VQDA 2MFIA 1OXSC 3KDFA 1YIJA 1A62A 4JBMA 2OQ0A 4K0KL 1LTLA 4PZ7A 4WJ4A 4DV1Q 4GLXA 1X54A 1R9TH
chains in the Genus database with same CATH superfamily
4R4TA 2VR1A 2NYZD 1EYGA 2MP1A 3J81i 5E1FA 3GTMB 1B9NA 4GKJQ 3AFQA 1I50A 1M4VA 2E2DC 3HKZG 3GTGH 4KK7A 1KJIA 2R6FA 1WCMB 3P75A 1K28A 3DM1A 4I7AA 3T13A 4DK1A 4IWXA 3I3CA 4ED6A 3Q24A 5EQ0A 3T1YH 3R2TA 1LUZA 1IOWA 2JA5B 3UDXA 1BXTA 4A3JG 4LF6L 1AE3A 1N32L 3J7AV 2FPIB 4EBEA 3N6XA 3I7FA 4ZI7F 4GZYC 3GTGA 4DNIA 3I55A 2AWOA 5CC4A 1I4PA 1KAAA 2DIKA 2B2UA 2A6HC 3QOJA 1E0BA 1EZ8A 4R4QA 3VYUA 2AQ3B 4DXGA 2ATLA 3S14H 4NP5A 1E4EB 3B6YA 3DEOA 4K2KA 4CKBA 2E5LQ 2E2HB 2XRSD 3NQIA 1VQOA 4NXMH 3R93A 2RDIA 5L1KA 2FP4B 1HNZH 2EOTA 4DV2Q 2HDMA 4JK1C 4RB3C 3U9TA 4EBDA 4RKLA 5BR8Q 3E0EA 3P1HA 2Z9HA 2WYOA 5C3WA 3L2PA 5IYCH 1AP0A 3BS1A 2R7ZB 1LACA 1U4PA 1K1QA 4NXNH 1ASYA 1DV1A 2DJFC 4RGNA 3S9WA 4LF7Q 3F2UA 4CC6A 3GTQB 2UVRA 3R2IA 5JOBA 2KSWA 4G7HC 3H91A 2UXCQ 3TP5A 3A56A 5EBCA 2IHEA 5KEEA 5M5YB 4J1MA 1SE2A 4B3ML 3NWSA 1FNVA 4C3IG 1C7YA 4L6TB 4DF7A 2QEJC 2R61A 1J6QA 5IT9L 1WD1A 3HOZB 3MEFA 5JQWA 3I70A 1I7NA 1RJRA 4X62L 2J9GA 5A2QW 4X64Q 3GDEA 1QVCA 1V51A 4F88A 3PO3B 4ILWA 3ORQA 1X3EA 1JOOA 4A3CH 2B2TA 3NSWA 1VBHA 3RTXA 1TWGB 4P72A 4XQJA 4DR5H 1LT6D 4B3SQ 3PIP3 3SR1A 2VPSA 2YTYA 3D4DA 4HSPA 3M9BA 4DR4L 1BBUA 2PQAB 4KD4A 3RLNA 2DNEA 1F9PA 1UE1A 1Q1BA 2X6GA 3MEHA 2G9HD 3HOVH 4NLGA 2EYJA 2ZDQA 1X3PA 1D5MC 5KX5F 2XSCA 3OIQA 3T5JA 3A55A 4FM9A 2JA7B 5CBAE 3GP7A 4DUYQ 1XYIA 2HHHL 1UAPA 1HTPA 4RFBA 4KMUC 3E5SA 4A3EG 2PW5A 1V9PA 4ULLA 4OELB 1HA6A 1XXGA 4CDCC 1ZKOA 5DLFA 1EY6A 4TSSA 5IYDG 3S1MH 3JSNA 1ICFB 2VQEL 2EJGC 3HOYB 3MHBA 5IP9H 4XT3B 2NZOA 1W6KA 3MWEA 4QIWB 1WTVA 5G3LF 1KIXA 3GTLB 1PH5A 3ZYYX 2UUBL 4L8JA 5HBRB 3HXLA 5C3EH 2AKWB 4JI8L 4A2AA 4FF2A 4DV6Q 4IN3A 4HSVA 5M3FH 3M9NB 4N9PA 1I94L 2JEAI 4BBRH 4DV0L 1KDCA 4PDBA 1IZ6A 2E75C 2E8GA 2F52A 5I6YA 2X0SA 3H15A 4OO1G 4KKUA 4FF1A 3N8DA 4LF9L 2BA1A 2F0FA 1XMOQ 2VQFQ 2EYHA 1S5CD 4RMFA 5FJ8G 3MWDA 2EXDA 1KXLA 3V05A 2R7MA 1VQMA 2F0IA 3QZ8A 1TT2A 4IPDA 4GLAC 4C56C 1G8ZD 2BA0A 1H9SA 2I87A 1XPOA 1PDQA 4I50F 5ELBA 2F0UA 5C4HA 4QL5A 1F2YA 2DY7A 1XJVA 2H1EA 4XX0B 2PNRC 4AYBE 3D4WA 4K5WA 3H0GG 1PTOF 1B6SA 5D1OB 3JAME 5LMNQ 2NU6B 1LTBD 3BQ1A 1X6OA 5JUMA 2FHTA 5EKKA 2IPKD 1PYBA 5ELEA 4G57A 2HQLA 2I5HA 2A74C 1HNWH 4R4IA 3LWBA 1ZYRD 3TQ1A 3EROA 1EUDB 4JYAH 1QZHA 2VUMG 1PVOA 1RYRA 5JJIA 3KTMA 3LP8A 3BVGA 2J0TD 3BYTB 2UU9L 4R4OA 2UUCQ 2YZMA 3J81W 1Y1WH 3A8JE 2MCTA 4R8UB 5E3FA 2D0OA 4I7HA 2K01A 2QCPX 2MNAA 2M2LA 2VB3X 2SEBD 4R4CA 2W6ZA 1JE4A 2VB2X 1PH1A 1TQOA 4A3LH 5FLXc 2AQ4A 4G4KA 4CDFC 1NJIC 2I0QA 3OSOA 2FJ2A 4JCVE 3IAYA 2ZM6H 5ELOA 4LF4L 3CPFA 3TSSA 4A3JH 4MTDA 3VYRA 1Y1WA 2A6ED 4A2BA 5D3DA 2Y0SE 1ENAA 4GNXA 3CC4A 3M3YH 3CVZA 3KLSA 4WD3A 2WFWA 3N40P 2QA4A 4JI7H 4YWMA 1V4YA 2Q2IA 4DL7A 3NENA 3RAXA 2I5MX 2HD3A 4R9WA 5F9LA 1UC8A 2WAQB 1TY2A 1LABA 3HKSA 4QB4A 5KFYA 3MTSA 2F0KA 4P2CB 1JDBB 4NDXA 1SCUB 2RKSA 3GIIA 2MO1A 5KFBA 4IRKA 4IUUA 3S17H 5TSSA 2Q8RE 3I2ZA 4ZYSA 1KDAA 5J1ZA 4B3SL 2B2UC 4TV8F 2UXBL 3RB3A 5KFCA 1F9RA 4DV7Q 5GROA 2PCFB 1C9OA 2DUDA 2IL8A 2SOBA 3D3RA 3ER0A 4BY1G 4IOAA 3T5LA 1CTMA 1YZ6A 3MXPA 3PUYA 4A4IA 2ZJTA 1GSOA 3GV8B 2YTVA 3PF5A 1J5EL 3BDLA 3MWYW 1X65A 4PMBA 4C3IH 3G6XA 1YBYA 4PG3A 4B3RL 2WB1B 2E74C 4IQZA 3T1YL 1DZ1A 1PFBA 2JA8B 4H0LC 2M05A 4FS1A 1ZYRC 4P73A 4DR1Q 4AQYL 2RVLA 3S1RH 3T56B 2DN8A 4DL2A 2F4VQ 4DR2H 1HQMC 4P75A 3TZUA 1BF4A 1PZID 3CMEA 5K5PA 3RZDH 1P16A 4OO1I 3RV3A 4A3FG 1DV2A 3HOXB 1M8AA 4Q8EA 1GUWA 4I7ZC 4NW2A 1WR2A 1E1TA 2OF1A 3Q22A 1SEBD 1EZ1A 4KHPH 1SE3A 1UE7A 4PZ6A 4JOIC 4S3SA 3KJPA 1HNZL 4BBSB 2ZXOA 2C5CA 2R93B 3HZXA 3RV4A 4HCSA 1GUSA 2ASBA 2A6EC 3D0FA 5IYBG 2ALZA 3QB3A 1VQCA 4KY5A 4NXNL 3OTOQ 2JXMB 5KFJA 3MXNB 4RGOS 3K80C 2Q8IB 1PRTD 5KFOA 1LO5D 1IBLQ 4LF8H 3TMEA 2BQ3A 1BCPC 4YCWA 1GVPA 3EQLC 5I47A 1XNRH 5KFQA 3GTJH 3K7UC 5EPLA 1I4RA 2RSNA 3HS0C 4RG1A 5ELNA 4APVA 5C44G 2RBMA 4DUZH 1RL2A 4JC0A 2SDFA 1QNKA 1SLJA 1L0YB 5ELFA 1N36Q 1CKNB 1L1OC 5AFWA 2YU9B 3J81j 1IYVA 3UDFA 3HG9A 4XYLB 5DLQE 3DHQA 3T5HA 5DGBA 4ZQIA 3DWAA 4JPBW 1WVLA 3AQQA 4FF4A 4DV5Q 3GTJA 3D31A 1BJTA 4JI3H 4OO1H 5JVDF 1SYGA 2ZJPA 4CJ2C 2F0HA 1SYEA 3FMAA 2EYOA 4X66Q 1PH9A 4DPGA 2KQ3A 4JI6H 3S1QH 5JVH3 2NZHA 3C2PA 5FJ8H 4CDDC 3HEJA 5IY0A 1JJCB 2PZWA 3DF7A 2ICIA 3QIAA 4DR7Q 2SCUB 2V4QA 3W2DA 3BABA 1YNNC 2ALYB 4BY7B 2IX0A 1EOTA 3TP7A 1JJGA 2AMCB 1BDOA 2XN9C 2NVYB 3PV0A 4RB1A 1QVGA 3KALA 2PI2E 1FGBD 3H0GH 4FVMA 3J80i 3I4OA 3VYTA 2JP1A 1EFID 4FU0A 4IZOA 4OHJA 2R87A 1LTRD 2R92G 2DWCA 1HZCA 4A3DG 1N34H 3WWVA 5C4XH 1SMYC 3I12A 4MZ9A 5KNCA 1EL0A 2R82A 5IGFA 2YW2A 2HUGA 4EGQA 4ED2A 1JOKA 3CKIB 1TS3A 1Q82C 4GN4B 2C00A 1B50A 2XD4A 2VUMH 3OIPA 4FBUA 4KKSA 5D8DA 3PIPA 3BQ2A 2NVQH 1MSGA 1QUQB 4H02A 5KFWA 4K14A 1A8VA 5KFGA 2PQEA 5EZYF 1P8LA 4ZKCB 2AQ1B 4MIUA 4ZCKA 4LF5H 1SN8A 5EWGA 2EYMA 2L4NA 1WTWA 1CFMA 3T5KA 2PMZE 1CQIB 4B3TH 4M9UA 3BDOA 2QKIC 2MHVA 2DPJA 5K36G 3JAMW 2VUMA 1XX8A 5HGQA 3Q6SA 5LHY1 2AHOB 3JZIA 4UP9A 1T36A 3MFGA 1PFMA 4N8X1 1N8RC 2NU9B 1LM0A 2LKVA 2VW9A 1TWCH 1HCZA 3GTPH 5FO9B 1E24A 5CYUA 3T1HH 1BOSA 4GS3A 4AYBG 5FD5A 1TY0A 4O3QA 2B2VC 2CCZA 2F4VL 1TWCA 2UVVA 4LWCA 1X3QA 2K5NA 3T4AC 3GTPA 3OOCA 1AEXA 3RD4A 3ND8A 2B2WA 4MV6A 1HNWL 3F2CA 5CGKA 4UCUA 4JI4H 1F77A 1D5XC 3SK5A 1BKBA 3VA5A 1HUNA 3LX0A 5LA6F 2W9BB 1N9WA 4LFAH 2ATWA 1YIJA 1OXSC 4FXKC 2WDTA 3HB9A 5KG3A 2ASJA 1FNWA 1D5ZC 4EX5A 3DEPA 1EQQA 3QWNA 1PXUA 4LF6Q 1N32Q 4ECYA 2LXJA 3L3OC 1V1PB 1EWCA 3FRPB 2A19A 2WTFA 1BCPB 4IZ8A 4C5BA 4RB2C 4EBCA 4ECSA 1O7ZA 2SNMA 4YIJA 3G7LA 4X65H 1AW7A 1GD7A 2X69A 1VBGA 3MFYA 4BA1I 1UNSA 3CCRA 2WACA 2N3SA 4HIMA 3MFIA 2VQDA 5HGTA 4LNQA 1L1OB 4JI7L 4DV3Q 1EQVA 2KVMA 4LFCL 1NNXA 3HOVB 1D8LA 1YJWA 3MR5A 3NUCA 3BG3A 1A3TA 1VF7A 4KN4C 3I4MG 4HIOA 1B4OA 4K5VA 3FKIG 3KHLA 3EN2A 1LTAD 2AGQA 2EYFA 4DV5L 5IYBH 4IJLA 2L55A 5EJWA 1VMCA 4HEDA 1NR2A 3OUZA 5CAEB 3TEHB 4IWYA 3GTKA 3G6JB 2HVRA 3L0OA 3SXHA 4AH6A 4B3MQ 3H3VC 3H20A 1Z47A 3OPOA 2G5DA 4A3GB 5KFSA 3V4SA 4M7EA 1I3QB 4X62Q 3UE1A 3A7AB 2K1BA 1AN7A 1SNDA 2BQUA 2CQYA 1HNXH 1PLFA 5CV7A 3KLRA 5EAYA 1VQPA 1PRTF 5CA1F 4HIKA 4BBRB 3SDZA 4ABNA 5IWAH 5C5JA 1IW7C 4U68A 1S03G 4DR4Q 4IHJF 3V2TA 1KD1C 4LSAA 5C3EG 2VPQA 1VKZA 1H9SB 4GKJH 3L4KA 1HR0W 3J7ZC 5M3FG 4FS2A 2XC9A 1S72A 4RB0A 4A3IB 3VR3A 5F9NA 2IBKA 3BG5A 3CCVA 1PRTB 3MR6A 3NE5B 2NZ1D 1EYDA 4H44C 3GV5B 2PZUA 5KT6A 2YRWA 5GADC 5A2QL 1I6HH 2OT2A 5J3BA 2HHHQ 2Q2TA 2KCMA 4MA5A 3MZ5A 1EYZA 1DOKA 1LLRD 1JE5A 1GGOA 4OX9L 5JPNC 4XT1B 1J8IA 4JI5Q 2ENBA 1VQ7A 3IG0A 4MAMA 1CKOA 4DKAC 1L0XB 1RIPA 1SROA 2VQEQ 4J0MA 4I65A 3TZDA 2QK4A 3IFTA 1IL8A 1I4XA 2VUGA 2W6OA 2UUBQ 1TWHA 4AIMA 3MXGA 3PVXA 4DNRB 2E5LH 3J80W 5GQOA 1EIGA 1KJ9A 3PSIA 2HT1A 2IP4A 4B08A 1I94Q 4IAJA 1AE2A 4A3DH 1E4GT 4DV2H 4DV0Q 4DUZL 5IGCA 1HTLD 4A3BG 2B3GA 1D1KA 3ETJA 1B44D 4C3JG 1E4FT 2JK8A 1I7LA 1SSOA 2EXZA 2E76C 4HMIA 4ZLTF 2IX3A 3CC2A 2DY8A 4LF9Q 3PIO3 2Z4HA 2O03A 4LF7H 1I50H 3HKZB 3IKJA 1EIFA 3RGZA 5IT9E 4TQUS 4QJFA 1VQGA 1TVXA 5GAGC 2EY6A 3RUZA 2UXCH 3X3MA 5JPMC 3TQTA 2A5HA 1RJTA 5KFAA 4RA8A 3S16H 1M0WA 3BU2A 5GONF 2JEBI 2EYPA 1T3NA 4FP5D 4A3JB 5K36H 1Y1WG 1KLGD 2JEJA 1B53A 2WP8J 4LW1A 1VQ5A 3M3YB 2ZDGA 3BZKA 3TIGA 4C3HG 4A3LG 1FJGH 2JQOA 4HIDA 5K2MA 1HQRD 1SNQA 4QGUA 1C3OA 1U4RA 3STBC 4DV4Q 2KEDA 1EUJA 2IJ0A 1T94A 4JI0Q 5KFLA 3MXUA 1X56A 3KUPA 5E4XA 1EEID 3RAQA 1TKWB 1IBKL 4QW8A 4JI2H 5LP6F 2K5WA 5IT9c 4HQ6A 3P20A 3CPWA 2B2YA 4EGJA 1SYBA 2V1CC 2RCFA 2ZXPA 4DA2A 4DUYH 5I6WA 5KG7A 1O75A 1DM0B 2UU9Q 1NTGA 4AYBA 2WKCA 2UUAQ 4DV3L 4DAYA 1Z2OX 2DZDA 1KRTA 1PTOC 4J15A 1VQNA 1CKMA 3TS2A 4UFZA 1K83H 4K8JA 4ETSA 5KFNA 5KRUA 2L0CA 4C3IB 1B9MA 3GO5A 5LL6b 4GN3B 2CW0D 1MI2A 2TSSA 4LF4Q 4LFBQ 4L5QA 5D1PA 3A0JA 2PVPA 1EY9A 4BS9A 4HJ7A 4HNTA 3S1RB 4B3TL 1KJ8A 5JVG3 2ZTCA 2FB9A 2FK3A 1K83A 2HJWA 4DV6H 4A3KG 5T14A 3KOJA 5IGBA 4YHHL 4IUPA 1NY4A 2MUYA 2KUMA 3CCMA 3SK4A 3J81L 3JC66 4LUOA 3RJ0A 5DAUA 1G6ZA 4RUAA 4DV1H 1TWAH 3K7AH 2SNSA 3CCQA 3NHHA 4Y7NH 3U50C 2R6GA 3T1HL 2IHFA 1HFNA 2F0QA 3M7NA 3CCJA 3LWUA 3I4MH 3HBLA 2BE5D 1YNXA 1SYDA 4JI1L 2IWHA 3W5OA 5FOBB 2F0SA 4DR3Q 3JRWA 4ME5A 4ODGA 2UXBQ 2GLTA 1FKAH 3FKIH 1Y14B 2Y0SA 1GHJA 1L0WA 4A3EB 2OCEA 1QZGA 2N8NA 4RCOA 3PQIA 1TWAA 3KBGA 3IFDA 1NCVA 2L9HA 3EJIA 1K3BC 1H9MA 4HN7A 4C1NK 2NVTB 2KHIA 4ECWA 1E7ZA 3T53B 1RODA 4ZQ3A 4UCSA 2YRXA 1J5EQ 2B29A 4L5TA 3TDQA 1JWSD 4QUFA 3GTJB 4B3RQ 3FKIA 3LWEA 4F4YA 5LMNH 4MV9A 3T1YQ 1I6VC 1ZXTA 4XIGS 4AQYQ 5IIFA 1II3A 3PO2H 2KOLA 4ZUIA 2B8FA 4DFAA 1JOQA 3OWEB 1QJOA 1HA5A 4C1NI 1W3SA 2AUJD 4JI5L 2VY3A 3MR2A 3SE0A 2K33A 3EPIA 3HGBA 1PX2A 3U4ZA 4QF4A 4WBNF 3FMCA 1HZ9A 3CU7A 1S5ED 4X65L 4R8IA 2BQRA 5I4DA 2Z1CA 3SK8A 2WINB 4YP3A 1H9KA 1HZAA 4YR3A 4NXMQ 2KA7A 3GQBA 2XGQA 3CQZB 2CW0C 4NPSA 2UUCH 1HNZQ 4UCTA 4ZAIA 1IL2A 1S4ZA 3S1QB 2R7KA 1OXUA 2PZTA 3LMLA 1N33H 2GN5A 3TREA 3RBEA 1STBA 3N44B 4X3SA 3CHBD 1QG7A 2MGSA 5CV4A 1UNNC 1WSCA 3OWFA 1FL0A 2DJGC 1E22A 4GOPC 5DM63 4NXNQ 1XNQH 1F2ZA 3QOLA 4QQBX 3NELA 1JX4A 1VQ8A 1ML0D 4RH6A 2XIGA 1Y8OB 1WTQA 2YTXA 1HR0H 1HPCA 4DL3A 3H0GB 3NTHA 2CHBD 4YR2A 3CCLA 4DR6L 5EWEA 2W8LA 4DNTB 3GV7B 4Q0FA 3VR4A 3ETHA 2R7NA 3K5IA 2EE1A 3G6YA 1GUNA 4FBTA 1JIHA 2BE5C 2VA2A 1FVIA 1JQYD 2I80A 5C4XB 1RYSA 1S5FD 2W71A 5FLXE 2Z6KC 1HNXL 1Y8NB 2F0LA 3GV3A 2GPSA 1GSAA 4L63B 4A3BH 1KJJA 3MVVA 4XXEA 4C3JH 2VUMB 3OHBA 4MV1A 3NTIA 3T51B 5C4JH 2FK2A 4LMQD 4DV7H 4ED7A 1L2FA 4DV4L 2F0NA 2K6AA 5C4XG 4JI0L 1S5DD 3P7JA 5KG5A 1KAWA 4TUYF 4E6IA 3F8NA 4LH6A 3VPBA 5KFEA 1PTOB 1OO9B 4IJHA 4FXDA 4DL6A 1KHIA 4CJ0B 3FHWA 2UUAL 4DR1H 4TQSA 2O5JC 1TWCB 3K8AA 3Q8SB 3PR4A 3H40A 4O4LF 2O5IC 1HJPA 4OWXB 3D8GA 4PNYA 4C3HH 3JAMi 3CW2C 3ULPA 3QJYA 1A0IA 4DN4M 5KFIA 1MGSA 4LFBL 1H9RA 1IHZA 2H4OA 2FE3A 2R8IA 5D14A 2J7ZA 3A8IE 4K2LA 2BR0A 1VQFA 2UXDH 1LTID 2JA6G 2RCNA 2KCNA 3TBIB 1A9XA 4HTHA 1T5XD 1OTCA 2OEOA 3MR3A 3QZ7A 3SVMA 1MKHA 2LFNA 2K4KA 2PI2A 4CHTB 4DLKA 1TWFH 3I4NG 1SNCA 3K57A 4BY1B 1STYA 3OTOH 4O3SA 1O80A 3RB6A 4JG2A 2IW3A 1IBLH 3OMCA 4ZHQF 4DR3L 3RB4A 1VQKA 4TVAB 3M4YA 3NP8A 2FPGB 1EUCB 1PFNA 4CKCA 4LK1C 1X32A 3AMUA 5JH7F 4ALPA 4N9TA 3KK7A 2B2YC 5IE8A 1SXTA 1TWFA 5H80A 3S1NH 3BAAA 3O13A 1N36H 4A3KH 1VQEA 1EWIA 5KIXA 2D62A 5NUCA 1SE4A 3ZJYC 2FMCA 3VDYA 1SMXA 1EOVA 2FMMA 2UVUA 3N43B 1FJGL 1STAA 4ID6A 4A3FB 5COYA 5KFZA 4RHSA 2XVSA 2N49A 2PMZA 4XQNA 4X66H 1CK1A 1MHWC 2F0VA 1M6VA 1V1QA 1RCVD 1HNWQ 4YY3H 4JI2L 2F0MA 2F0DA 4DGZA 3NGDA 1DONA 4OIJA 1IKMA 1BGWA 1E4EA 1E2WA 3MAQA 1RJPA 1ENFA 4RAZA 1XMQH 3OHXC 1CQJB 1GYFA 4NXML 3M4PA 2IA6A 3PIOA 1VQBA 1Q46A 2ZTDA 2K52A 3Q23A 2K32A 1G2SA 2B2TC 4GOPB 1AZPA 2W7PA 1Q3LA 3VYSA 2YS7A 1XWEA 1UE6A 5C44B 3KLWA 1B3QA 2MFIA 1AUXA 4WJ4A 2W9CA 4X3UA 5LMUH 1X54A 1R9TH 2E2IH 3DWQA 4RNOA 1JICA 3SHLA 5FO8B 1IBMH 4JI7Q 5LL6X 3TS0A 2K75A 4LFCQ 4ZOLF 3CCEA 3NWTA 3U58A 1K0RA 5CBEE 2EIFA 3CP0A 4DAPA 4DV1L 2F0JA 1R9TA 1X55A 1I4QA 4HAEA 2E2IA 4Q44A 4O0AA 1I6HB 3KF8A 3K5OA 1A2UA 1Q8KA 4ZKBB 5HV6A 1TWGA 4DR5L 1EY5A 2YCHA 2OTLA 4KD3A 4HJ5A 2GVBA 3KHHA 4O3OA 2BCOA 2F0EA 2RSOA 4RZRA 2PQAA 1WOCA 1IYJB 1EWHA 4FNFA 3KYHC 3DWPA 3M9MB 1S10A 2NU7B 4EYHB 3BZCA 3UDGA 2L15A 3KBXA 2FLLA 1YEZA 5KFTA 3K5MA 1PYWD 4OEMB 2XRQD 1LYLA 3EYYA 4F4WA 4CC5A 5C8YF 3K59A 5KT2A 2R92B 2D2CC 4A3DB 4LUVA 2C2EA 2RDGA 4KY7A 1PZKD 3KF6B 4YCUA 4HJ8A 1RTNA 3H09A 3KDFB 4EQPA 4X3TA 4K0KH 1AZQA 3MFHA 2XCLA 4UPAA 1TS5A 3HKZE 3A5UA 1I50B 3E9HA 5DG9A 2HCIA 5ISRA 2MPMA 2JA9A 4IUTA 2XWBB 4J8QA 2V4DA 2OWOA 3DXJC 1K8MA 4C2MH 4ECVA 2LY7A 4A3MG 3U9SA 4UDUC 1QOHA 1GOZA 1MJEA 2F0WA 1SYCA 1K73C 1CHQD 1K1SA 3S16B 4JV0A 4Y8VB 2PYKA 2KENA 1PRTC 2PW7A 3PUWA 1N33L 3Q8RB 2AGPA 1YHAA 4DAVA 4OX9Q 1RJQA 2EPBA 1K9MC 3GTGB 5JJKA 4C2MA 3HOWG 3NXWA 1XNQL 1B3AA 2F3WA 5FLXW 4MN3A 4LF8Q 3BZDB 2IT1A 3A5ZB 2MQHA 3VPDA 1FGUA 4G3IA 1XNRQ 5IGDA 2V59A 4YQWA 2ZJQA 4AYBB 3C1FA 4YBZB 1WTOA 4MV4A 3WO1A 1DD2A 4ED0A 4DAYB 3EIVA 3PN1A 4FDBA 4IALA 4DUZQ 1CSQA 4UP7A 2JA6H 1EY0A 3S14B 1E2ZA 1O7LA 3E6ZX 4LAAA 2BH2A 3ICEA 1JWMD 3CCSA 2J6UA 4DAMA 3NBIA 5D1OA 1ASZA 5C6AA 4K5XA 5FPOA 3S2DH 3I4NH 4CJ1B 1M0TA 4M1UB 3U4VA 4Q0YA 2JA6A 1XTDA 4PQXA 4OWWB 2F3VA 4JV5H 3AYHB 2XGTA 3J80L 1DYQA 4GNXC 1RHPA 2VZAA 3PUVA 5BMVF 4IPCA 1ESFA 1EFWA 2ASDA 4JYAL 2RHSB 4Q45A 3KLSX 1Q1EA 1GKHA 4PMWA 2FMAA 4BWSC 3GIMA 2L5TA 2OH2A 1SBBB 4R8UA 4JW0A 3VR6A 1JT8A 3OUUA 1BBWA 3R8BA 1SE8A 3GIKA 1VQJA 4OWTB 4DR4H 1CQFA 1X3GA 4RNNA 1TWAB 1W96A 1WJJA 3LNNA 4IUVA 1G6PA 4DL5A 1VDZA 1DXMA 1W2BA 1WD0A 3FEWX 2ZM6L 4G7ZC 3QFFA 5DQGA 1IBKQ 1Q81C 3I4MB 3W1GA 4L5RC 5LYJF 1SJHD 2L12A 2XGPA 4F50A 1JB3A 2UXDL 3FKIB 2A68D 3RN2A 2JEFA 2HHHH 2Y0SG 4O4HF 2AUKA 3K5LA 2C2DA 2J6TA 2F0GA 4LH7A 1FYCA 1EYCA 2WKDA 2F1MA 2Z8LA 4GN5A 1WTHA 3GTKH 2WAQA 4YAKB 3RUPA 5C0XG 5LMNW 4F4ZA 4M8AA 1XDNA 4O2BF 4PMCA 3UE0A 3V96A 2RDFA 1UWVA 4LF5Q 4QWBA 3K81C 1Y1VG 2DNCA 2R8KA 1JR0D 4XTCS 1NR4A 4B3TQ 4JI8H 1B2TA 1JCKB 5KFRA 3S1MB 1I94H 2ZT9C 4YHHQ 3F2BA 3PW2A 3PW0A 2JA8H 4DV0H 2R7DA 4QIWE 4L5SA 5M3MG 5DGAA 5I9PA 3W3AA 5CV8A 4YJ3F 4QY7A 3J7AK 2W6QA 3K3VA 1WI5A 3LGJA 5C3EB 1LV9A 3BJYA 5M5WH 3PO2G 3T1HQ 4XQQA 1NAPA 5M3FB 2JEGA 3EFXD 3AFPA 2B63G 2EJFC 1MD2D 3MJFA 5KFPA 3C46A 1S9FA 3RZOH 3L9AX 2G9DA 4JI1Q 1VQAA 3WDNA 4ME6A 1AN8A 2AU0A 1STEA 1IOVA 4A76A 4DR2L 2QF7A 1CT1D 3RMHA 1BNCA 4XYOA 2EY5A 5KFKA 4GKKH 3K0YA 3MC0B 4JI4Q 4EVOA 4BA2I 2R3ZA 1A63A 1OXTA 1B1ZA 2JYOA 4LJZC 2FFKB 3N42B 1U4LA 3J7A5 4KHPL 4EEYA 3TIIA 1VQLA 3TP8A 1SDFA 3SK6A 1A6XA 3DUZA 1TWHH 5I2XA 4IFDG 1PV4A 5C1PA 2C22A 1LT4D 2LMCB 4IUNA 4UCVA 1RTOA 3EBEA 4DK0A 4UHVA 1Z2NX 4HNUA 4HR7A 4A3BB 4MV3A 1NSNS 3K6OA 2K5DA 5C5LA 4C3JB 2I5LX 4X65Q 4LF8L 2FKLA 2HGSA 1OXVA 1EIHA 3KAJA 4KLKA 5C4JB 3GTOH 1RK6A 5D65A 1QILA 2GVAA 1RF2D 3NQTA 5IOCA 2NVXH 1XNRL 5CORA 1KJQA 2D5DA 3OMGA 2K14A 3V4ZA 1IBML 4I4TF 1DGSA 2A6HD 4J6HA 4F87A 2Q8TA 4R1JA 4A3MH 2PBZA 1R4PB 1ULZA 3HOUG 3M4OH 5BR8H 5EBDA 3TRZA 1CKNA 4EEQA 2YU9A 2KJXA 2YYAA 2QW7A 5KT3A 3GTOA 1C0AA 4B9XA 1LTGD 4LF4H 2NVXA 3GQCA 5KG6A 1MJCA 3A74A 5CV6A 3RR5A 1YHQA 1Y1WB 4A93G 1K8OA 3C0FB 4JI3L 4Q5VA 2RF4A 1YI2A 4BY7H 3N52A 3J81E 2YV5A 1V43A 3HOWH 4GNXB 4U673 1YHBA 3BA9A 1BBXC 4ED3A 4CGYB 4C3HB 4DR6Q 2VXWA 4EQNA 3I56A 4JI6L 1JMCA 1PYSB 1PH8A 2CVRA 2F0TA 4QUCA 3KAKA 4GC6A 5CV5A 5FD6A 4X64H 4FF3A 1BR9A 3I90A 4IFDJ 1HNXQ 3UFXB 4YAJB 2C2RA 1QNUA 3M7GA 3E3XA 2NVYA 5AJ3L 5I2YA 1SNOA 4B3SH 5IWAQ 4RNMA 1SYFA 4K6DA 3QO2A 3A8KE 3PR5B 4JBWA 2WAQE 1BQQT 5HY6A 5DG8A 1TWFB 1D7QA 3CMAA 1JDEA 2VA3A 4J9MA 1CZGA 1ENCA 4IO9A 2E2JH 3S17B 3SEBA 1E2VA 1S5BD 1N34L 3UQ8A 1J5EH 5C0XI 3J81c 2EDGA 2QYZA 1EY7A 1JC7A 1KC8C 1X3FA 4B3RH 2EY1A 3ERQA 5KYIA 5L1JA 1TAEA 4V190 3S1NB 3CF5A 4ZK9B 3Q8QB 5KNBA 1C8CA 2JSOA 3ULLA 1G91A 2A1AA 1ZHQA 3L7ZC 4EFBA 2PMZB 3G8CA 3RLOA 4OIKA 4A3KB 4IPGA 4Q8FA 5J2UF 4P71A 1QUQA 4DU9A 1WCMG 5M5XH 3I8ZA 2B8GA 1DOMA 1F9SA 2NTSA 4KN7C 4PV1C 1KNAA 3R3OA 2WB1E 3NEMA 1EQRA 1VF5C 1JKJB 4LF5L 1B33N 3WNZA 5BN4A 1CZWA 3ONAB 3Q2OA 2B2WC 1ICWA 3GIDA 2JA5G 1ET9A 5CMDA 2MO0A 2A73B 1Z2PX 5BN5A 2XTIA 2NU8B 5KFFA 5FLMG 4O3PA 5HURA 1PK8A 3EA6A 5KFDA 2K03A 1WFQA 3JRXA 5FKAC 1WTXA 1UE5A 3RZDB 1KNEA 1QCBD 2I46A 2W57A 5IGGA 1WTPA 2L1BA 4PWQA 3EVQA 2ZTEA 3M9OB 2W9CB 1XMOH 2ID0A 3GD7A 5C0XH 2VQFH 5EOYA 3S2HH 1V1OA 1CA5A 3RLFA 1O78A 2F4IA 4IURA 4V0BA 4HYKA 4BXXG 2NN6G 5ELCA 4HJ9A 1Y1VH 4JV5L 3CRKC 3GV6A 2C9OA 3K5NA 2R7ZG 4IFDI 4J9SA 1GSHA 4JI4L 3ORRA 3G6VA 2K5VA 4XZ3B 4TRDA 4JOIA 1R9TB 2W9BA 2E2IB 4LFAL 1ZQ7A 4H13C 3KF8B 4HJAA 3KHRA 5M3MH 1U9RA 1K3RA 2HQEA 2KHJA 3ND9A 5FK9C 3D6WA 1FJGQ 1Y1VA 3F1ZA 2L11A 3X3NA 4BWGB 2R8HA 5CV9A 4R7RA 1F2MA 3CC7A 3HOZG 2KCTA 3F2DA 2OLSA 2DLNA 2B63H 2W9AA 1V1PA 5T1IA 3RFCA 4J9KA 3S15H 3PO3G 4ECZA 4ECTA 4JI2Q 3CD6A 4MTEA 3RF2A 4ECQA 3C1EA 4POGA 5DG7A 4MHEA 1GUGA 1CHPD 1SNMA 2D9UA 1Z9FA 3ULJA 4DK3C 4LUZA 2EY2A 2ZXRA 3BJUA 3FVQA 4RGMA 2B63A 2FINB 1L1OA 3G4SA 5JEAG 4Y52H 2RGVA 4ECXA 1VMPA 5BN3A 5J39A 5KKNB 1XPUA 1C30A 4U7CA 1QB5D 2EJMA 4NMZA 5KT4A 4IFDH 2JA7G 4A3GH 2GPWA 5L9XA 3BQ0A 1H9JA 5IGEA 3K0XA 4UY8C 1I3QH 4LMYA 1VQIA 2FXQA 3I4LA 1FR3A 2Q2HA 1IKLA 1RK5A 1F9QA 5E7NA 1BXRA 1LTSD 1EEFD 1GLVA 2TMPA 1KDBA 2HDLA 3HOYG 3H94A 5JJLA 3WO0A 4JBMA 1A62A 3N6RA 2OQ0A 1BO0A 1AUVA 5DLGA 5KGUA 1I3QA 1LTLA 4C2MB 4DV1Q 1K0SA 4RGTA 4RHRA 3G6EA 3I73A 1A3VA 4F4XA 1SFOH 4GLVB 3HOUH 4RU9A 4NB3A 2HIVA 4DR5Q 4A3IH 4IR1A 1T9HA 5IWAL 5EKLA 1CSPA 2PO4A 2NVQB 5KFVA 2BDOA 2CH4A 5LL6S 4A93H 1F2LA 3VPCA 4OGQC 4GKKL 1CE8A 4XDXA 4GKJL 1Q8IA 1CS0A 1CM9A 1SFOA 1N48A 1KABA 4CBVA 4QWDA 2H5XA 5JEAJ 4N8FA 3UDIA 1M90C 5DQIA 2CZGA 3OHAA 4JVZA 1XTCD 5CB4F 3IN5A 1STHA 3G71A 1RD9D 5C1OA 4F8MA 3QR8A 4AQYH 2JA6B 1SYXB 1Y69U 2F4VH 1RKNA 2J4XA 4FXGC 3GTPB 2W6PA 1S0MA 2V4RA 5CR3A 2ZJRA 2YL2A 4X3KA 1D1IA 2HIXA 3MA2B 4IRCA 3SGIA 3MWMA 2YYZA 2R7FA 3S2DB 3M4QA 3I4NB 2E5LL 1GHKA 1O7IA 5JVLA 5IT9W 1TS2A 2HVSA 5KYLA 1OWTA 4E4TA 1UUPA 3NBHA 4DV2L 5JAVA 2LS01 4KHZA 5J22A 3R5HA 1STNA 3U9OA 1N33Q 2PN1A 5BR8L 2F0PA 2NN6I 4OXPA 4UAIA 4JBKA 2B2VA 3IL8A 1XNQQ 3GTMH 1S0OA 4LF7L 3JAMc 1U5KA 3HKZA 1TU2B 3H3VI 4WRDA 1HR0Q 2UXCL 2CWPA 1WCMH 3AU7A 4ME3A 2YZGA 3N41B 4IR9A 4TV9F 2XNAC 1HXYD 2R7LA 4YR0A 3FPPA 5L1IA 1AFPA 1B70B 5H1SE 1M7JA 4LFCH 2RHQB 2JA5H 5KT5A 1HUMA 4RZQA 3PCOB 1BCPD 2R8JA 2N78A 3GTMA 4J9OA 4X64L 4QCLA 5J2TF 5FLMH 1SJED 5A35A 2OTJA 1WCMA 2OXPA 2ASLA 4NKLA 4RKBA 1S3OA 2GA4B 1T5EA 4APMA 4DV5H 5T1GA 4POFA 3PUXA 1K8AC 3GLKA 1JXLA 2JA5A 3F8TA 1Y8PB 5GAEC 2E2HH 5FLXL 2CKZB 3GTKB 4C5CA 4XYMB 2WAQG 2ES2A 1JB7A 5EWFA 5KFUA 2NTTA 2WV6D 1I5FA 2HCCA 2CFMA 2NWGA 2XWJB 4MNOA 3JAML 1EHIA 2VL6A 1UC9A 4DR7H 1MIUA 1VQ9A 1WYDA 2K28A 4BXXH 4JV1A 2HVQA 2NN6H 4JYAQ 1BUVT 1EY8A 1K8GA 1SRUA 1GJXA 2E2HA 2R7ZH 2QGQA 4DUYL 5KFMA 5KG2A 2V58A 1RDPD 3AB9A 3GTQH 3H3VH 3C3LA 1U0LA 1IYUA 1KLUD 1OXXK 2JJQA 4ZRZA 2Q2UA 1KQSA 1HHVA 1YNND 4UCOA 3PW7A 5L37A 4WJWA 2AWNA 5M5YH 2VOBA 4EQOA 5M5WB 5EDWA 3K3PA 1YITA 2CQOA 2F0OA 4UP8A 2ZM6Q 2R7ZA 2EQSA 1E3PA 5EGTA 3HOZH 3RZOB 2KECA 2WB1G 3EPGA 4O4IF 1ZETA 3GTQA 2JA8G 2ZDHA 1TXYA 2NUCA 2UXDQ 1SEIA 3KJOA 1HH2P 2K50A 3PO3H 4DV6L 3IRBA 1UEAB 2CQAA 3PW5A 1TWGH 2CW7A 2R8GA 1ILQA 3TP6A 4HNVA 3ERSX 2QILA 2P5ZX 2K5QA 3Q8PB 1CQVA 2AQ2B 4CDEC 4OX9H 4EGVA 1SMYD 2YS6A 3OW2A 4EG0A 4O1NA 4A3EH 5JEAH 1TS4A 2BH8A 4HR7B 3PZPA 3HOXG 1PA6A 1A2TA 2BOSA 2NVTH 1CA6A 3T16A 1DIKA 5KG1A 5IYDH 3TQYA 1TWHB 4BBSG 1XMOL 2R93G 1Q86C 2VQFL 4UCRA 4MTNA 2FJZA 4HMJA 2JEIA 1WH2A 3BYYB 2JA7H 4J9QA 4MV7A 4TQRA 5E4WC 4WFN3 1Z7TA 2ICEC 2V5AA 3WOFA 4O2DA 3VR5A 2RGRA 2K7VA 3J7AF 3RBDA 4KJNA 3FPUB 1VQHA 2P0AA 3GTOB 3DLLA 3CXCA 1GUTA 1VCIA 5C4ZA 3K58A 2NVXB 5KG0A 5C5MA 3HOYH 1G51A 2JA7A 1JLLB 2C35B 2EZVA 3KXYT 2X6LA 3J80E 4WJ3M 4P74A 5LMNL 2AGOA 4A75A 3GTLH 2O2LD 4A3MB 1PH2A 1GM5A 1DOLA 3PMFA 4MA0A 1I4HA 1Q12A 1IXRA 3M4OB 4R8NA 2YZNA 1S40A 4DR2Q 1PH7A 4ZUJA 3CQZH 1HZBA 1QVFA 3AEVA 1A15A 3PW4A 4YY3Q 1I6UA 4QIWA 5DM73 2BDNA 2A69D 3R23A 3V6JA 3GTLA 3HOWB 3I91A 5ELDA 2LSSA 4JBJA 1XMQQ 5L1LA 3GILA 4J9RA 4KHPQ 4L1KA 5KG4A 2UUCL 3CQZA 5EPJA 4EQ5A 5BPFA 5IODA 2KBNA 4B9WA 2NBFA 4FO2A 4QMGA 1AH9A 2LXKA 2N55A 4LF6H 1N32H 5JJZA 2RQXA 1C48A 5FO7B 1EIYB 3SE7A 2XCPA 4BY7G 3OSPA 1DCZA 1S97A 4DL4A 1KL9A 1EU4A 3D6CA 2OQKA 5LOVF 3HP3A 3K5HA 1IBKH 3J80c 3H4DA 2RDJA 5IP7G 5LMUQ 2VNUD 1NBWA 3TN2A 1ESRA 1HR0L 2DPIA 1YVCA 4Q43A 2W8KA 4HCEA 4RAUC 3FP9A 3H0GA 1IBMQ 1BNZA 1HRJA 4RUCA 1VQ4A 5BPHA 4DV3H 4QWEA 2W6NA 1LT5D 4O3NA 1KTKA 2E2JB 1WTRA 3J7YW 1FNUA 2FK1A 1D6EC 1PZJD 2Z4IA 5C3XA 1NUCA 1B04A 4RCNA 2KEEA 5KFHA 2F3IA 2K05A 3GIPA 1HFGA 1V8QA 4JI3Q 2FLNA 1PHJA 1PFSA 3A7LA 2N88A 3DMUA 1PTOH 1K83B 4DV7L 1STGA 1G2TA 3R5XA 2KHSA 2NB0A 5GAHC 3CCUA 2M00A 4YHHH 4B3MH 1ZEQX 3VR2A 5M5XB 1KC7A 4QWAA 4JI6Q 3V6KA 1QE6A 4QW9A 3BVZA 4YB8B 1I4GA 2Z6BA 4TKOB 4X62H 1GO3E 3Q1KA 3BA8A 4J9NA 1TIID 3S24A 4H7BA 2K5HA 4Z9CB 3RNUA 1L2ZA 1BVSA 3HFZB 5AJ3Q 4JI1H 1CUKA 4DR1L 1YNJD 2FPPB 2A69C 3Q8DA 4RWSC 4YJ2F 1Q7YC 3D4RA 1G291 2Y0SB 3DM3A 4K0KQ 4JV2A 3K7AB 4Y7NB 5A2QE 1W93A 2DGYA 1BCPF 5DNFA 1TR5A 3GIQA 1IW7D 1N34Q 3S2HB 4BY1H 5DQHA 1GUOA 3KHGA 5FPRA 2NUAB 2D0PA 3V6HA 4EFEA 1Y1VB 5IYCG 2O4XA 4XYQA 2CWAA 3OW7A 3H4BA 4QWCA 1N56A 3WOEA 1E1OA 5KNDA 3NPPA 4JI5H 3PGZA 3E0JA 1EQTA 2VQEH 3W1BA 3OTOL 4O42A 1W6JA 5M3MB 2XIWA 1YJNA 1S68A 1IBLL 3QG1A 2UUBH 4FYDA 4LSXA 4GC7A 1H95A 1LTTD 3PO2B 3TINA 2Z0SA 3NK9A 4O3RA 4RAYA 4O2AF 3G48A 1SR3A 2B63B 1UEBA 2VS1A 3FDTA 3S15B 1Q90A 1JORA 4A3FH 1SAPA 4A3CG 4U6PA 1DJRD 2CW8A 2K04A 1N36L 2B39A 5CA0F 4EYIB 2A8VA 2PNHA 1KEEA 1VS0A 4WORA 1YJ9A 2R84A 1EY4A 4LF9H 1EZ6A 3E9IA 3RN5A 2C28A 3NTKA 5EKIA 2F03A 2WB1A 4KKTA 3HOVG 4J9PA 2I8CA 3HOXH 2JE6I 1C4QA 4F7XA 1FD7D 1Z6HA 4X66L 4DR6H 1S0NA 4DK6C 4KY6A 1R4QB 2R86A 3VMMA 4KV6A 1SNPA 3UI2A 4BBSH 4JV5Q 2R93H 1QWYA 2RA4A 4YY3L 5M9OA 3A54A 1YNJC 4DR7L 1TA8A 1NMFA 5G3LD 1U4MA 3OSNA 5C44H 4X6AH 4LFAQ 1NMGA 1XMQL 3VA7A 1GXDC 1VQ6A 3GIJA 1CI3M 2WE6A 4MTKA 1ET6A 4JUZA 2R93A 5F2DA 4MV8A 2CH4W 5C0XJ 5IP9G 3RIZA 4J9LA 2MJ8A 4PZ8A 4A3GG 2IMWP 4OONA 1J9OA 4GOPA 3URYA 4DV4H 5IYZF 3L4JA 1KBLA 2A68C 4JI0H 3KFUA 3BDCA 1SFOB 1PMRA 2W70A 3HOUB 2M9VA 5I9OA 3MXNA 1M1KC 3SI8A 1XPRA 4BBRG 4KTAA 2YU9H 1B6RA 5LMUL 3STBD 2R85A 1LT3D 3CAMA 5KFXA 3RGXA 1B7YB 4IOCA 4A93B 1ZHSA 1KRSA 4KJOA 2UU9H 1O7YA 2UUAH 5LXTF 2XCAA 2Z6KA 3PF4A 5EPKA 4KI0A 2KCCA 4A3IG 4C5AA 3ITPA 1PH4A 2W6MA 1PH6A 2IX1A 5DEHA 4LFBH 1PTOD 2EYLA 3RB0A 4K8IA 1D2BA 3JSLA 2QDBA 4YCVA 4JI8Q 3E5NA 3CRLC 2JN4A 4ECRA 1ILPA 2R92H 4I55F 1A3UA 2RDHA 3NBHB 4ECUA 2NVYH 4IPHA 5D3IB 5IP7H 4G7OC 3Q0AA 3PUZA 3M85A 2V9WA 2IY5B 4DXFA 2QEXA 1JJ2A 3I72A 4CKEA 2QDLA 1MSHA 2EVBA 2J6SA 1EYAA 2PPBC 1B8AA 3H6MA 3OYYA 1PH3A 1X9NA 3R5FA 2WIIB 1NE3A 1EU3A 5KT7A 2R92A 4YWLA 4IRDA 2I07B 3FDSA 3KF6A 1VAJA 4KHVA 3HRZC 4K6LA 4DR3H 4YWKA 2FLPA 1ONLA 1VQDA 4OL7A 3BVMA 3KDFA 2UXBH 1JWUD 4ED1A 4K0KL 1MBYA 4IUQA 4PZ7A 3M4IA 2W7OA 1MZBA 2UVWA 4ED8A 4GLXA 4GKKQ
chains in the Genus database with same CATH topology
4R4TA 3G6EA 1EYGA 2E2IH 4GKJQ 3J81i 4EX5A 1EQQA 3AFQA 4LF6Q 1N32Q 1SFOH 2LXJA 4GLVB 3HKZG 3HOUH 4JI7Q 4NB3A 2HIVA 4DR5Q 4A3IH 3GTGH 2A19A 3TS0A 2K75A 1T9HA 4LFCQ 5IWAL 3CCEA 1CSPA 3U58A 1K0RA 2EIFA 3CP0A 4A93H 4DV1L 1GD7A 1LUZA 4GKKL 1X55A 4BA1I 3UDXA 3CCRA 4GKJL 4O0AA 2N3SA 4HIMA 4A3JG 4LF6L 1AE3A 1Q8KA 1N32L 4LNQA 1L1OB 3I7FA 4DR5L 4JI7L 4DV3Q 2H5XA 5JEAJ 4DNIA 2AWOA 3UDIA 3I55A 4LFCL 2GVBA 4HJ5A 1M90C 1D8LA 1YJWA 4R4QA 3G71A 3I4MG 3S14H 4HIOA 2PQAA 1WOCA 1IYJB 3B6YA 3KYHC 2E5LQ 3FKIG 3EN2A 1VQOA 3BZCA 3UDGA 2L15A 4DV5L 1YEZA 5IYBH 4IJLA 4DV2Q 2ZJRA 1LYLA 2HIXA 3SGIA 3TEHB 5BR8Q 2YYZA 3E0EA 2R7FA 4LUVA 3L0OA 4AH6A 3KF6B 3M4QA 4B3MQ 4YCUA 5IYCH 3L2PA 4HJ8A 2E5LL 1O7IA 1Z47A 3KDFB 1ASYA 4LF7Q 4X62Q 3UE1A 4DV2L 4KHZA 2UXCQ 4UPAA 1N33Q 3HKZE 2IHEA 3A5UA 3E9HA 5EAYA 1VQPA 5BR8L 2JA9A 4HIKA 2OWOA 4B3ML 2NN6I 4C2MH 4OXPA 1C7YA 4A3MG 4JBKA 1J6QA 1XNQQ 3MEFA 3GTMH 1MJEA 4LF7L 3JAMc 1K73C 4X62L 4DR4Q 1U5KA 4X64Q 3GDEA 1KD1C 1QVCA 3H3VI 2KENA 5C3EG 1HR0Q 2UXCL 2CWPA 1WCMH 3PUWA 4ME3A 1HR0W 1N33L 1X3EA 1YHAA 4OX9Q 4A3CH 3J7ZC 5M3FG 1K9MC 4P72A 1S72A 5JJKA 1B70B 5H1SE 3HOWG 4B3SQ 3CCVA 2RHQB 2JA5H 1XNQL 2YTYA 3PCOB 5GADC 2N78A 3M9BA 2HHHQ 5J3BA 4DR4L 1I6HH 1BBUA 4X64L 2Q2TA 2PQAB 2KCMA 4LF8Q 3RLNA 2IT1A 3A5ZB 1UE1A 2MQHA 5FLMH 1FGUA 1Q1BA 2OTJA 1XNRQ 1JE5A 3HOVH 1S3OA 4OX9L 2ZJQA 4JI5Q 1VQ7A 4POFA 1K8AC 3PUXA 1CKOA 4DAYB 4DKAC 1RIPA 1SROA 3EIVA 2VQEQ 4FDBA 4DUZQ 3F8TA 5GAEC 2E2HH 1CSQA 2CKZB 4UP7A 4DUYQ 2JA6H 2HHHL 2WAQG 2ES2A 1JB7A 2UUBQ 4A3EG 4AIMA 2BH2A 1I5FA 3ICEA 1V9PA 2CFMA 4MNOA 5GQOA 3CCSA 2VL6A 4DAMA 3PSIA 5IYDG 1MIUA 1VQ9A 1WYDA 1ASZA 2HT1A 1I94Q 4BXXH 1AE2A 3S1MH 4A3DH 4JYAQ 3S2DH 2VQEL 3I4NH 4DV0Q 1K8GA 1SRUA 5IP9H 4DUZL 2NZOA 2R7ZH 2QGQA 4A3BG 2B3GA 3U4VA 4DUYL 1XTDA 1KIXA 2JK8A 1PH5A 2UUBL 3GTQH 3H3VH 4OWWB 1U0LA 1OXXK 2JJQA 2XGTA 3AYHB 2AKWB 4JI8L 5C3EH 4GNXC 1KQSA 2Q2UA 2VZAA 3PUVA 3CC2A 4LF9Q 4IPCA 4DV6Q 1I50H 5M3FH 2AWNA 1EIFA 5M5YH 1I94L 1EFWA 4JYAL 2JEAI 2RHSB 4TQUS 4QJFA 1VQGA 4BBRH 5GAGC 4DV0L 1IZ6A 1Q1EA 1GKHA 2CQOA 4UP8A 4PMWA 2ZM6Q 1YITA 2EQSA 1E3PA 2E8GA 2F52A 3HOZH 2WB1G 3H15A 2JA8G 3S16H 4OO1G 3BU2A 1TXYA 2UXDQ 1JT8A 3KJOA 1HH2P 1BBWA 2JEBI 1SE8A 2K50A 4LF9L 3PO3H 1VQJA 2BA1A 4DV6L 4OWTB 1X3GA 3IRBA 1Y1WG 2OTLA 1TWGH 1WJJA 1XMOQ 1G6PA 4LW1A 2WP8J 3ERSX 2VQFQ 1VQ5A 1W2BA 4RMFA 5FJ8G 3BZKA 2ZM6L 1IBKQ 1Q81C 2EXDA 3W1GA 3OW2A 1KXLA 4A3LG 4L5RC 2JQOA 1VQMA 4A3EH 4HIDA 4IPDA 2UXDL 2BH8A 4GLAC 3HOXG 2BA0A 1PA6A 4QGUA 2NVTH 3RN2A 3STBC 4DV4Q 2Y0SG 1XPOA 1EUJA 3TQYA 5IYDH 4BBSG 1XMOL 2R93G 1Q86C 4JI0Q 2VQFL 1X56A 4MTNA 4GKKQ 4QL5A 1XJVA 4AYBE 1IBKL 2JA7H 3H0GG 4GN5A 5IT9c 3GTKH 5LMNQ 3CPWA 5C0XG 5LMNW 2V1CC 4O2DA 1X6OA 3UE0A 1PYBA 4LF5Q 1UWVA 2UU9Q 1NTGA 1VQHA 2HQLA 2I5HA 1Y1VG 3K81C 2UUAQ 4XTCS 3DLLA 4DV3L 1KRTA 3CXCA 4B3TQ 4J15A 1VCIA 1VQNA 1CKMA 3HOYH 4R4IA 1G51A 3TS2A 1K83H 2C35B 4WJ3M 4P74A 5LMNL 4YHHQ 3F2BA 4A75A 3GTLH 2JA8H 1QZHA 3GO5A 1PH2A 4GN3B 1GM5A 2VUMG 2R7DA 1PVOA 1Q12A 4QIWE 1IXRA 4L5SA 5JJIA 5M3MG 4LF4Q 1S40A 4LFBQ 4L5QA 4DR2Q 3A0JA 4QY7A 1PH7A 4R4OA 2UU9L 3CQZH 2UUCQ 4HJ7A 1HZBA 1Y1WH 1QVFA 1WI5A 3LGJA 3AEVA 4B3TL 2D0OA 5M5WH 3PO2G 2ZTCA 4YY3Q 2MNAA 3T1HQ 4R4CA 4A3KG 3AFPA 1PH1A 2B63G 3KOJA 4YHHL 4A3LH 5FLXc 3RZOH 1NJIC 2I0QA 1NY4A 4JI1Q 1VQAA 2LSSA 4JBJA 4JCVE 3CCMA 1XMQQ 5ELOA 4A76A 4LF4L 4KHPQ 4DR2L 3CPFA 3JC66 4A3JH 4LUOA 2UUCL 1TWAH 3K7AH 4EQ5A 3CCQA 2KBNA 4Y7NH 3U50C 2R6GA 3T1HL 2Y0SE 2IHFA 4GNXA 3CC4A 4JI4Q 3M7NA 3M3YH 4BA2I 2LXKA 2WFWA 3CCJA 1A63A 2QA4A 1OXTA 3I4MH 4YWMA 1YNXA 1EIYB 4BY7G 2Q2IA 4JI1L 3W5OA 4DR3Q 3NENA 2UXBQ 2I5MX 1KL9A 2OQKA 3J7A5 4KHPL 3FKIH 3J80c 1Y14B 1VQLA 3HKSA 1L0WA 5IP7G 2OCEA 1QZGA 2N8NA 1TWHH 5LMUQ 4IFDG 1PV4A 2VNUD 1NBWA 1HR0L 1YVCA 2MO1A 2KHIA 1E7ZA 3FP9A 1IBMQ 3EBEA 3S17H 3I2ZA 1VQ4A 1J5EQ 2B29A 4B3SL 2UXBL 4L5TA 4DV7Q 5GROA 4B3RQ 2I5LX 4X65Q 4LF8L 3T1YQ 1OXVA 1C9OA 2DUDA 4KLKA 4XIGS 3ER0A 4BY1G 4AQYQ 3GTOH 4IOAA 1YZ6A 2GVAA 3PUYA 4A4IA 1XNRL 2NVXH 3PO2H 2K14A 1IBML 2F3IA 1W3SA 2YTVA 1DGSA 2VY3A 4JI5L 3PF5A 4JI3Q 1J5EL 1PHJA 1PFSA 1X65A 4R1JA 4C3IH 4A3MH 1YBYA 4PG3A 3U4ZA 4DV7L 4B3RL 3HOUG 3M4OH 1HZ9A 5GAHC 4X65L 3TRZA 1CKNA 3CCUA 3T1YL 4P73A 4DR1Q 4AQYL 4JI6Q 3S1RH 1C0AA 1HZAA 2F4VQ 4NXMQ 1MJCA 3A74A 4NPSA 3RR5A 1YHQA 4A93G 1HNZQ 1IL2A 4JI3L 1GO3E 2RF4A 1OXUA 1YI2A 4BY7H 2YV5A 1V43A 4P75A 3HOWH 4GNXB 3CMEA 1YHBA 3S24A 2GN5A 3TREA 2K5HA 3RNUA 3RZDH 4DR6Q 1P16A 1BVSA 3HFZB 5AJ3Q 3I56A 4OO1I 1CUKA 4DR1L 4A3FG 1JMCA 4JI6L 1FL0A 1PYSB 1E22A 4GOPC 3Q8DA 1PH8A 4NXNQ 4QQBX 1E1TA 1Q7YC 4K0KQ 1G291 3DM3A 1UE7A 4PZ6A 4JOIC 3NELA 3KJPA 1HNZL 1VQ8A 4IFDJ 1HNXQ 2ASBA 2YTXA 2DGYA 3D0FA 3CCLA 4DR6L 5IYBG 5AJ3L 1N34Q 1VQCA 5IWAQ 1AH9A 4BY1H 4NXNL 3OTOQ 1FVIA 2WAQE 2D0PA 3MXNB 3K80C 4JBWA 5HY6A 1D7QA 1IBLQ 3CMAA 5IYCG 2CWAA 4YCWA 1GVPA 2Z6KC 1HNXL 4IO9A 2E2JH 4A3BH 1E1OA 3GTJH 3K7UC 3PGZA 1N34L 4C3JH 4RG1A 5C44G 5ELNA 4APVA 5C0XI 3J81c 1KC8C 3W1BA 5C4JH 3OTOL 1RL2A 1X3FA 1L2FA 4JC0A 1SLJA 4DV4L 1N36Q 1YJNA 1CKNB 1L1OC 1IBLL 3J81j 5C4XG 3UDFA 3CF5A 4JI0L 5DLQE 1H95A 3ULLA 1KAWA 2A1AA 2Z0SA 3L7ZC 3RLOA 3G48A 1SR3A 3AQQA 4DV5Q 1UEBA 4IPGA 3D31A 2VS1A 4P71A 1QUQA 1WCMG 5M5XH 4A3FH 4IJHA 4A3CG 2ZJPA 2WB1E 3NEMA 1EQRA 1N36L 4X66Q 4LF5L 1PH9A 1KHIA 3FHWA 2UUAL 4DPGA 2A8VA 2PNHA 3S1QH 2JA5G 1VS0A 1YJ9A 2NZHA 5FJ8H 3K8AA 5IY0A 1JJCB 2MO0A 1HJPA 3E9IA 4OWXB 4DR7Q 3RN5A 4C3HH 2XTIA 2ALYB 3CW2C 2IX0A 5FLMG 3JAMi 3ULPA 3HOVG 1A0IA 3HOXH 2JE6I 1JJGA 1WFQA 2AMCB 4LFBL 4X66L 1UE5A 4DK6C 3PV0A 4BBSH 2R93H 1QVGA 4JV5Q 1VQFA 2PI2E 4YY3L 2JA6G 2RCNA 4DR7L 2ZTEA 1NMFA 3H0GH 1OTCA 3J80i 3I4OA 2ID0A 3GD7A 5C44H 4X6AH 4LFAQ 1NMGA 3S2HH 1XMQL 1MKHA 3RLFA 1VQ6A 2K4KA 2PI2A 2R92G 4BXXG 1HZCA 2NN6G 4A3DG 1TWFH 3WWVA 1Y1VH 5C4XH 5C0XJ 4HJ9A 5IP9G 3I4NG 4IFDI 4PZ8A 2R7ZG 4JV5L 4A3GG 4JI4L 4MZ9A 4OONA 4GOPA 2K5VA 4JG2A 1Q82C 4JOIA 4GN4B 4DR3L 4LFAL 1VQKA 4TVAB 2VUMH 3KFUA 3KF8B 4HJAA 3PIPA 2NVQH 5M3MH 1M1KC 1K3RA 2KHJA 4ALPA 1XPRA 5IE8A 1FJGQ 1QUQB 4BBRG 3F1ZA 4H02A 5LMUL 3STBD 2YU9H 3S1NH 1A8VA 3CAMA 1P8LA 3HOZG 3CC7A 2KCTA 1B7YB 4IOCA 3F2DA 1KRSA 1SN8A 1VQEA 4A3KH 2B63H 1EWIA 2D62A 2PMZE 3S15H 2Z6KA 3PF4A 3PO3G 5K36G 3ZJYC 4JI2Q 3CD6A 4KI0A 4POGA 5HGQA 3VDYA 1SMXA 1EOVA 2AHOB 1FJGL 4A3IG 4UP9A 1Z9FA 3ULJA 4DK3C 1N8RC 1PH4A 4LUZA 1LM0A 2N49A 3BJUA 2VW9A 1TWCH 1PH6A 2IX1A 3GTPH 4Y52H 1E24A 1L1OA 1V1QA 5JEAG 3G4SA 4YCVA 1HNWQ 4JI8Q 4JI2L 4GS3A 4AYBG 1XPUA 2R92H 3NBHB 2NVYH 4IPHA 5IP7H 3PUZA 3M85A 2JA7G 4A3GH 2CCZA 2F4VL 4NXML 3M4PA 2QEXA 2IY5B 4LWCA 1JJ2A 2K5NA 3K0XA 4UY8C 1I3QH 1VQIA 3PIOA 1VQBA 1Q46A 2FXQA 2ZTDA 1HNWL 2K52A 2Q2HA 1B8AA 3F2CA 3OYYA 4GOPB 1X9NA 1PH3A 1BKBA 1NE3A 5E7NA 1UE6A 4YWLA 3KF6A 1N9WA 3KLWA 3HOYG 4YWKA 2ATWA 5JJLA 1VQDA 2MFIA 1OXSC 3KDFA 1YIJA 1A62A 4JBMA 2OQ0A 4K0KL 1LTLA 4PZ7A 4WJ4A 4DV1Q 4GLXA 1X54A 1R9TH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R4T A;  3G6E A;  1EYG A;  2E2I H;  4GKJ Q;  3J81 i;  4EX5 A;  1EQQ A;  3AFQ A;  4LF6 Q;  1N32 Q;  1SFO H;  2LXJ A;  4GLV B;  3HKZ G;  3HOU H;  4JI7 Q;  4NB3 A;  2HIV A;  4DR5 Q;  4A3I H;  3GTG H;  2A19 A;  3TS0 A;  2K75 A;  1T9H A;  4LFC Q;  5IWA L;  3CCE A;  1CSP A;  3U58 A;  1K0R A;  2EIF A;  3CP0 A;  4A93 H;  4DV1 L;  1GD7 A;  1LUZ A;  4GKK L;  1X55 A;  4BA1 I;  3UDX A;  3CCR A;  4GKJ L;  4O0A A;  2N3S A;  4HIM A;  4A3J G;  4LF6 L;  1AE3 A;  1Q8K A;  1N32 L;  4LNQ A;  1L1O B;  3I7F A;  4DR5 L;  4JI7 L;  4DV3 Q;  2H5X A;  5JEA J;  4DNI A;  2AWO A;  3UDI A;  3I55 A;  4LFC L;  2GVB A;  4HJ5 A;  1M90 C;  1D8L A;  1YJW A;  4R4Q A;  3G71 A;  3I4M G;  3S14 H;  4HIO A;  2PQA A;  1WOC A;  1IYJ B;  3B6Y A;  3KYH C;  2E5L Q;  3FKI G;  3EN2 A;  1VQO A;  3BZC A;  3UDG A;  2L15 A;  4DV5 L;  1YEZ A;  5IYB H;  4IJL A;  4DV2 Q;  2ZJR A;  1LYL A;  2HIX A;  3SGI A;  3TEH B;  5BR8 Q;  2YYZ A;  3E0E A;  2R7F A;  4LUV A;  3L0O A;  4AH6 A;  3KF6 B;  3M4Q A;  4B3M Q;  4YCU A;  5IYC H;  3L2P A;  4HJ8 A;  2E5L L;  1O7I A;  1Z47 A;  3KDF B;  1ASY A;  4LF7 Q;  4X62 Q;  3UE1 A;  4DV2 L;  4KHZ A;  2UXC Q;  4UPA A;  1N33 Q;  3HKZ E;  2IHE A;  3A5U A;  3E9H A;  5EAY A;  1VQP A;  5BR8 L;  2JA9 A;  4HIK A;  2OWO A;  4B3M L;  2NN6 I;  4C2M H;  4OXP A;  1C7Y A;  4A3M G;  4JBK A;  1J6Q A;  1XNQ Q;  3MEF A;  3GTM H;  1MJE A;  4LF7 L;  3JAM c;  1K73 C;  4X62 L;  4DR4 Q;  1U5K A;  4X64 Q;  3GDE A;  1KD1 C;  1QVC A;  3H3V I;  2KEN A;  5C3E G;  1HR0 Q;  2UXC L;  2CWP A;  1WCM H;  3PUW A;  4ME3 A;  1HR0 W;  1N33 L;  1X3E A;  1YHA A;  4OX9 Q;  4A3C H;  3J7Z C;  5M3F G;  1K9M C;  4P72 A;  1S72 A;  5JJK A;  1B70 B;  5H1S E;  3HOW G;  4B3S Q;  3CCV A;  2RHQ B;  2JA5 H;  1XNQ L;  2YTY A;  3PCO B;  5GAD C;  2N78 A;  3M9B A;  2HHH Q;  5J3B A;  4DR4 L;  1I6H H;  1BBU A;  4X64 L;  2Q2T A;  2PQA B;  2KCM A;  4LF8 Q;  3RLN A;  2IT1 A;  3A5Z B;  1UE1 A;  2MQH A;  5FLM H;  1FGU A;  1Q1B A;  2OTJ A;  1XNR Q;  1JE5 A;  3HOV H;  1S3O A;  4OX9 L;  2ZJQ A;  4JI5 Q;  1VQ7 A;  4POF A;  1K8A C;  3PUX A;  1CKO A;  4DAY B;  4DKA C;  1RIP A;  1SRO A;  3EIV A;  2VQE Q;  4FDB A;  4DUZ Q;  3F8T A;  5GAE C;  2E2H H;  1CSQ A;  2CKZ B;  4UP7 A;  4DUY Q;  2JA6 H;  2HHH L;  2WAQ G;  2ES2 A;  1JB7 A;  2UUB Q;  4A3E G;  4AIM A;  2BH2 A;  1I5F A;  3ICE A;  1V9P A;  2CFM A;  4MNO A;  5GQO A;  3CCS A;  2VL6 A;  4DAM A;  3PSI A;  5IYD G;  1MIU A;  1VQ9 A;  1WYD A;  1ASZ A;  2HT1 A;  1I94 Q;  4BXX H;  1AE2 A;  3S1M H;  4A3D H;  4JYA Q;  3S2D H;  2VQE L;  3I4N H;  4DV0 Q;  1K8G A;  1SRU A;  5IP9 H;  4DUZ L;  2NZO A;  2R7Z H;  2QGQ A;  4A3B G;  2B3G A;  3U4V A;  4DUY L;  1XTD A;  1KIX A;  2JK8 A;  1PH5 A;  2UUB L;  3GTQ H;  3H3V H;  4OWW B;  1U0L A;  1OXX K;  2JJQ A;  2XGT A;  3AYH B;  2AKW B;  4JI8 L;  5C3E H;  4GNX C;  1KQS A;  2Q2U A;  2VZA A;  3PUV A;  3CC2 A;  4LF9 Q;  4IPC A;  4DV6 Q;  1I50 H;  5M3F H;  2AWN A;  1EIF A;  5M5Y H;  1I94 L;  1EFW A;  4JYA L;  2JEA I;  2RHS B;  4TQU S;  4QJF A;  1VQG A;  4BBR H;  5GAG C;  4DV0 L;  1IZ6 A;  1Q1E A;  1GKH A;  2CQO A;  4UP8 A;  4PMW A;  2ZM6 Q;  1YIT A;  2EQS A;  1E3P A;  2E8G A;  2F52 A;  3HOZ H;  2WB1 G;  3H15 A;  2JA8 G;  3S16 H;  4OO1 G;  3BU2 A;  1TXY A;  2UXD Q;  1JT8 A;  3KJO A;  1HH2 P;  1BBW A;  2JEB I;  1SE8 A;  2K50 A;  4LF9 L;  3PO3 H;  1VQJ A;  2BA1 A;  4DV6 L;  4OWT B;  1X3G A;  3IRB A;  1Y1W G;  2OTL A;  1TWG H;  1WJJ A;  1XMO Q;  1G6P A;  4LW1 A;  2WP8 J;  3ERS X;  2VQF Q;  1VQ5 A;  1W2B A;  4RMF A;  5FJ8 G;  3BZK A;  2ZM6 L;  1IBK Q;  1Q81 C;  2EXD A;  3W1G A;  3OW2 A;  1KXL A;  4A3L G;  4L5R C;  2JQO A;  1VQM A;  4A3E H;  4HID A;  4IPD A;  2UXD L;  2BH8 A;  4GLA C;  3HOX G;  2BA0 A;  1PA6 A;  4QGU A;  2NVT H;  3RN2 A;  3STB C;  4DV4 Q;  2Y0S G;  1XPO A;  1EUJ A;  3TQY A;  5IYD H;  4BBS G;  1XMO L;  2R93 G;  1Q86 C;  4JI0 Q;  2VQF L;  1X56 A;  4MTN A;  4GKK Q;  4QL5 A;  1XJV A;  4AYB E;  1IBK L;  2JA7 H;  3H0G G;  4GN5 A;  5IT9 c;  3GTK H;  5LMN Q;  3CPW A;  5C0X G;  5LMN W;  2V1C C;  4O2D A;  1X6O A;  3UE0 A;  1PYB A;  4LF5 Q;  1UWV A;  2UU9 Q;  1NTG A;  1VQH A;  2HQL A;  2I5H A;  1Y1V G;  3K81 C;  2UUA Q;  4XTC S;  3DLL A;  4DV3 L;  1KRT A;  3CXC A;  4B3T Q;  4J15 A;  1VCI A;  1VQN A;  1CKM A;  3HOY H;  4R4I A;  1G51 A;  3TS2 A;  1K83 H;  2C35 B;  4WJ3 M;  4P74 A;  5LMN L;  4YHH Q;  3F2B A;  4A75 A;  3GTL H;  2JA8 H;  1QZH A;  3GO5 A;  1PH2 A;  4GN3 B;  1GM5 A;  2VUM G;  2R7D A;  1PVO A;  1Q12 A;  4QIW E;  1IXR A;  4L5S A;  5JJI A;  5M3M G;  4LF4 Q;  1S40 A;  4LFB Q;  4L5Q A;  4DR2 Q;  3A0J A;  4QY7 A;  1PH7 A;  4R4O A;  2UU9 L;  3CQZ H;  2UUC Q;  4HJ7 A;  1HZB A;  1Y1W H;  1QVF A;  1WI5 A;  3LGJ A;  3AEV A;  4B3T L;  2D0O A;  5M5W H;  3PO2 G;  2ZTC A;  4YY3 Q;  2MNA A;  3T1H Q;  4R4C A;  4A3K G;  3AFP A;  1PH1 A;  2B63 G;  3KOJ A;  4YHH L;  4A3L H;  5FLX c;  3RZO H;  1NJI C;  2I0Q A;  1NY4 A;  4JI1 Q;  1VQA A;  2LSS A;  4JBJ A;  4JCV E;  3CCM A;  1XMQ Q;  5ELO A;  4A76 A;  4LF4 L;  4KHP Q;  4DR2 L;  3CPF A;  3JC6 6;  4A3J H;  4LUO A;  2UUC L;  1TWA H;  3K7A H;  4EQ5 A;  3CCQ A;  2KBN A;  4Y7N H;  3U50 C;  2R6G A;  3T1H L;  2Y0S E;  2IHF A;  4GNX A;  3CC4 A;  4JI4 Q;  3M7N A;  3M3Y H;  4BA2 I;  2LXK A;  2WFW A;  3CCJ A;  1A63 A;  2QA4 A;  1OXT A;  3I4M H;  4YWM A;  1YNX A;  1EIY B;  4BY7 G;  2Q2I A;  4JI1 L;  3W5O A;  4DR3 Q;  3NEN A;  2UXB Q;  2I5M X;  1KL9 A;  2OQK A;  3J7A 5;  4KHP L;  3FKI H;  3J80 c;  1Y14 B;  1VQL A;  3HKS A;  1L0W A;  5IP7 G;  2OCE A;  1QZG A;  2N8N A;  1TWH H;  5LMU Q;  4IFD G;  1PV4 A;  2VNU D;  1NBW A;  1HR0 L;  1YVC A;  2MO1 A;  2KHI A;  1E7Z A;  3FP9 A;  1IBM Q;  3EBE A;  3S17 H;  3I2Z A;  1VQ4 A;  1J5E Q;  2B29 A;  4B3S L;  2UXB L;  4L5T A;  4DV7 Q;  5GRO A;  4B3R Q;  2I5L X;  4X65 Q;  4LF8 L;  3T1Y Q;  1OXV A;  1C9O A;  2DUD A;  4KLK A;  4XIG S;  3ER0 A;  4BY1 G;  4AQY Q;  3GTO H;  4IOA A;  1YZ6 A;  2GVA A;  3PUY A;  4A4I A;  1XNR L;  2NVX H;  3PO2 H;  2K14 A;  1IBM L;  2F3I A;  1W3S A;  2YTV A;  1DGS A;  2VY3 A;  4JI5 L;  3PF5 A;  4JI3 Q;  1J5E L;  1PHJ A;  1PFS A;  1X65 A;  4R1J A;  4C3I H;  4A3M H;  1YBY A;  4PG3 A;  3U4Z A;  4DV7 L;  4B3R L;  3HOU G;  3M4O H;  1HZ9 A;  5GAH C;  4X65 L;  3TRZ A;  1CKN A;  3CCU A;  3T1Y L;  4P73 A;  4DR1 Q;  4AQY L;  4JI6 Q;  3S1R H;  1C0A A;  1HZA A;  2F4V Q;  4NXM Q;  1MJC A;  3A74 A;  4NPS A;  3RR5 A;  1YHQ A;  4A93 G;  1HNZ Q;  1IL2 A;  4JI3 L;  1GO3 E;  2RF4 A;  1OXU A;  1YI2 A;  4BY7 H;  2YV5 A;  1V43 A;  4P75 A;  3HOW H;  4GNX B;  3CME A;  1YHB A;  3S24 A;  2GN5 A;  3TRE A;  2K5H A;  3RNU A;  3RZD H;  4DR6 Q;  1P16 A;  1BVS A;  3HFZ B;  5AJ3 Q;  3I56 A;  4OO1 I;  1CUK A;  4DR1 L;  4A3F G;  1JMC A;  4JI6 L;  1FL0 A;  1PYS B;  1E22 A;  4GOP C;  3Q8D A;  1PH8 A;  4NXN Q;  4QQB X;  1E1T A;  1Q7Y C;  4K0K Q;  1G29 1;  3DM3 A;  1UE7 A;  4PZ6 A;  4JOI C;  3NEL A;  3KJP A;  1HNZ L;  1VQ8 A;  4IFD J;  1HNX Q;  2ASB A;  2YTX A;  2DGY A;  3D0F A;  3CCL A;  4DR6 L;  5IYB G;  5AJ3 L;  1N34 Q;  1VQC A;  5IWA Q;  1AH9 A;  4BY1 H;  4NXN L;  3OTO Q;  1FVI A;  2WAQ E;  2D0P A;  3MXN B;  3K80 C;  4JBW A;  5HY6 A;  1D7Q A;  1IBL Q;  3CMA A;  5IYC G;  2CWA A;  4YCW A;  1GVP A;  2Z6K C;  1HNX L;  4IO9 A;  2E2J H;  4A3B H;  1E1O A;  3GTJ H;  3K7U C;  3PGZ A;  1N34 L;  4C3J H;  4RG1 A;  5C44 G;  5ELN A;  4APV A;  5C0X I;  3J81 c;  1KC8 C;  3W1B A;  5C4J H;  3OTO L;  1RL2 A;  1X3F A;  1L2F A;  4JC0 A;  1SLJ A;  4DV4 L;  1N36 Q;  1YJN A;  1CKN B;  1L1O C;  1IBL L;  3J81 j;  5C4X G;  3UDF A;  3CF5 A;  4JI0 L;  5DLQ E;  1H95 A;  3ULL A;  1KAW A;  2A1A A;  2Z0S A;  3L7Z C;  3RLO A;  3G48 A;  1SR3 A;  3AQQ A;  4DV5 Q;  1UEB A;  4IPG A;  3D31 A;  2VS1 A;  4P71 A;  1QUQ A;  1WCM G;  5M5X H;  4A3F H;  4IJH A;  4A3C G;  2ZJP A;  2WB1 E;  3NEM A;  1EQR A;  1N36 L;  4X66 Q;  4LF5 L;  1PH9 A;  1KHI A;  3FHW A;  2UUA L;  4DPG A;  2A8V A;  2PNH A;  3S1Q H;  2JA5 G;  1VS0 A;  1YJ9 A;  2NZH A;  5FJ8 H;  3K8A A;  5IY0 A;  1JJC B;  2MO0 A;  1HJP A;  3E9I A;  4OWX B;  4DR7 Q;  3RN5 A;  4C3H H;  2XTI A;  2ALY B;  3CW2 C;  2IX0 A;  5FLM G;  3JAM i;  3ULP A;  3HOV G;  1A0I A;  3HOX H;  2JE6 I;  1JJG A;  1WFQ A;  2AMC B;  4LFB L;  4X66 L;  1UE5 A;  4DK6 C;  3PV0 A;  4BBS H;  2R93 H;  1QVG A;  4JV5 Q;  1VQF A;  2PI2 E;  4YY3 L;  2JA6 G;  2RCN A;  4DR7 L;  2ZTE A;  1NMF A;  3H0G H;  1OTC A;  3J80 i;  3I4O A;  2ID0 A;  3GD7 A;  5C44 H;  4X6A H;  4LFA Q;  1NMG A;  3S2H H;  1XMQ L;  1MKH A;  3RLF A;  1VQ6 A;  2K4K A;  2PI2 A;  2R92 G;  4BXX G;  1HZC A;  2NN6 G;  4A3D G;  1TWF H;  3WWV A;  1Y1V H;  5C4X H;  5C0X J;  4HJ9 A;  5IP9 G;  3I4N G;  4IFD I;  4PZ8 A;  2R7Z G;  4JV5 L;  4A3G G;  4JI4 L;  4MZ9 A;  4OON A;  4GOP A;  2K5V A;  4JG2 A;  1Q82 C;  4JOI A;  4GN4 B;  4DR3 L;  4LFA L;  1VQK A;  4TVA B;  2VUM H;  3KFU A;  3KF8 B;  4HJA A;  3PIP A;  2NVQ H;  5M3M H;  1M1K C;  1K3R A;  2KHJ A;  4ALP A;  1XPR A;  5IE8 A;  1FJG Q;  1QUQ B;  4BBR G;  3F1Z A;  4H02 A;  5LMU L;  3STB D;  2YU9 H;  3S1N H;  1A8V A;  3CAM A;  1P8L A;  3HOZ G;  3CC7 A;  2KCT A;  1B7Y B;  4IOC A;  3F2D A;  1KRS A;  1SN8 A;  1VQE A;  4A3K H;  2B63 H;  1EWI A;  2D62 A;  2PMZ E;  3S15 H;  2Z6K A;  3PF4 A;  3PO3 G;  5K36 G;  3ZJY C;  4JI2 Q;  3CD6 A;  4KI0 A;  4POG A;  5HGQ A;  3VDY A;  1SMX A;  1EOV A;  2AHO B;  1FJG L;  4A3I G;  4UP9 A;  1Z9F A;  3ULJ A;  4DK3 C;  1N8R C;  1PH4 A;  4LUZ A;  1LM0 A;  2N49 A;  3BJU A;  2VW9 A;  1TWC H;  1PH6 A;  2IX1 A;  3GTP H;  4Y52 H;  1E24 A;  1L1O A;  1V1Q A;  5JEA G;  3G4S A;  4YCV A;  1HNW Q;  4JI8 Q;  4JI2 L;  4GS3 A;  4AYB G;  1XPU A;  2R92 H;  3NBH B;  2NVY H;  4IPH A;  5IP7 H;  3PUZ A;  3M85 A;  2JA7 G;  4A3G H;  2CCZ A;  2F4V L;  4NXM L;  3M4P A;  2QEX A;  2IY5 B;  4LWC A;  1JJ2 A;  2K5N A;  3K0X A;  4UY8 C;  1I3Q H;  1VQI A;  3PIO A;  1VQB A;  1Q46 A;  2FXQ A;  2ZTD A;  1HNW L;  2K52 A;  2Q2H A;  1B8A A;  3F2C A;  3OYY A;  4GOP B;  1X9N A;  1PH3 A;  1BKB A;  1NE3 A;  5E7N A;  1UE6 A;  4YWL A;  3KF6 A;  1N9W A;  3KLW A;  3HOY G;  4YWK A;  2ATW A;  5JJL A;  1VQD A;  2MFI A;  1OXS C;  3KDF A;  1YIJ A;  1A62 A;  4JBM A;  2OQ0 A;  4K0K L;  1LTL A;  4PZ7 A;  4WJ4 A;  4DV1 Q;  4GLX A;  1X54 A;  1R9T H; 
#chains in the Genus database with same CATH topology
 4R4T A;  2VR1 A;  2NYZ D;  1EYG A;  2MP1 A;  3J81 i;  5E1F A;  3GTM B;  1B9N A;  4GKJ Q;  3AFQ A;  1I50 A;  1M4V A;  2E2D C;  3HKZ G;  3GTG H;  4KK7 A;  1KJI A;  2R6F A;  1WCM B;  3P75 A;  1K28 A;  3DM1 A;  4I7A A;  3T13 A;  4DK1 A;  4IWX A;  3I3C A;  4ED6 A;  3Q24 A;  5EQ0 A;  3T1Y H;  3R2T A;  1LUZ A;  1IOW A;  2JA5 B;  3UDX A;  1BXT A;  4A3J G;  4LF6 L;  1AE3 A;  1N32 L;  3J7A V;  2FPI B;  4EBE A;  3N6X A;  3I7F A;  4ZI7 F;  4GZY C;  3GTG A;  4DNI A;  3I55 A;  2AWO A;  5CC4 A;  1I4P A;  1KAA A;  2DIK A;  2B2U A;  2A6H C;  3QOJ A;  1E0B A;  1EZ8 A;  4R4Q A;  3VYU A;  2AQ3 B;  4DXG A;  2ATL A;  3S14 H;  4NP5 A;  1E4E B;  3B6Y A;  3DEO A;  4K2K A;  4CKB A;  2E5L Q;  2E2H B;  2XRS D;  3NQI A;  1VQO A;  4NXM H;  3R93 A;  2RDI A;  5L1K A;  2FP4 B;  1HNZ H;  2EOT A;  4DV2 Q;  2HDM A;  4JK1 C;  4RB3 C;  3U9T A;  4EBD A;  4RKL A;  5BR8 Q;  3E0E A;  3P1H A;  2Z9H A;  2WYO A;  5C3W A;  3L2P A;  5IYC H;  1AP0 A;  3BS1 A;  2R7Z B;  1LAC A;  1U4P A;  1K1Q A;  4NXN H;  1ASY A;  1DV1 A;  2DJF C;  4RGN A;  3S9W A;  4LF7 Q;  3F2U A;  4CC6 A;  3GTQ B;  2UVR A;  3R2I A;  5JOB A;  2KSW A;  4G7H C;  3H91 A;  2UXC Q;  3TP5 A;  3A56 A;  5EBC A;  2IHE A;  5KEE A;  5M5Y B;  4J1M A;  1SE2 A;  4B3M L;  3NWS A;  1FNV A;  4C3I G;  1C7Y A;  4L6T B;  4DF7 A;  2QEJ C;  2R61 A;  1J6Q A;  5IT9 L;  1WD1 A;  3HOZ B;  3MEF A;  5JQW A;  3I70 A;  1I7N A;  1RJR A;  4X62 L;  2J9G A;  5A2Q W;  4X64 Q;  3GDE A;  1QVC A;  1V51 A;  4F88 A;  3PO3 B;  4ILW A;  3ORQ A;  1X3E A;  1JOO A;  4A3C H;  2B2T A;  3NSW A;  1VBH A;  3RTX A;  1TWG B;  4P72 A;  4XQJ A;  4DR5 H;  1LT6 D;  4B3S Q;  3PIP 3;  3SR1 A;  2VPS A;  2YTY A;  3D4D A;  4HSP A;  3M9B A;  4DR4 L;  1BBU A;  2PQA B;  4KD4 A;  3RLN A;  2DNE A;  1F9P A;  1UE1 A;  1Q1B A;  2X6G A;  3MEH A;  2G9H D;  3HOV H;  4NLG A;  2EYJ A;  2ZDQ A;  1X3P A;  1D5M C;  5KX5 F;  2XSC A;  3OIQ A;  3T5J A;  3A55 A;  4FM9 A;  2JA7 B;  5CBA E;  3GP7 A;  4DUY Q;  1XYI A;  2HHH L;  1UAP A;  1HTP A;  4RFB A;  4KMU C;  3E5S A;  4A3E G;  2PW5 A;  1V9P A;  4ULL A;  4OEL B;  1HA6 A;  1XXG A;  4CDC C;  1ZKO A;  5DLF A;  1EY6 A;  4TSS A;  5IYD G;  3S1M H;  3JSN A;  1ICF B;  2VQE L;  2EJG C;  3HOY B;  3MHB A;  5IP9 H;  4XT3 B;  2NZO A;  1W6K A;  3MWE A;  4QIW B;  1WTV A;  5G3L F;  1KIX A;  3GTL B;  1PH5 A;  3ZYY X;  2UUB L;  4L8J A;  5HBR B;  3HXL A;  5C3E H;  2AKW B;  4JI8 L;  4A2A A;  4FF2 A;  4DV6 Q;  4IN3 A;  4HSV A;  5M3F H;  3M9N B;  4N9P A;  1I94 L;  2JEA I;  4BBR H;  4DV0 L;  1KDC A;  4PDB A;  1IZ6 A;  2E75 C;  2E8G A;  2F52 A;  5I6Y A;  2X0S A;  3H15 A;  4OO1 G;  4KKU A;  4FF1 A;  3N8D A;  4LF9 L;  2BA1 A;  2F0F A;  1XMO Q;  2VQF Q;  2EYH A;  1S5C D;  4RMF A;  5FJ8 G;  3MWD A;  2EXD A;  1KXL A;  3V05 A;  2R7M A;  1VQM A;  2F0I A;  3QZ8 A;  1TT2 A;  4IPD A;  4GLA C;  4C56 C;  1G8Z D;  2BA0 A;  1H9S A;  2I87 A;  1XPO A;  1PDQ A;  4I50 F;  5ELB A;  2F0U A;  5C4H A;  4QL5 A;  1F2Y A;  2DY7 A;  1XJV A;  2H1E A;  4XX0 B;  2PNR C;  4AYB E;  3D4W A;  4K5W A;  3H0G G;  1PTO F;  1B6S A;  5D1O B;  3JAM E;  5LMN Q;  2NU6 B;  1LTB D;  3BQ1 A;  1X6O A;  5JUM A;  2FHT A;  5EKK A;  2IPK D;  1PYB A;  5ELE A;  4G57 A;  2HQL A;  2I5H A;  2A74 C;  1HNW H;  4R4I A;  3LWB A;  1ZYR D;  3TQ1 A;  3ERO A;  1EUD B;  4JYA H;  1QZH A;  2VUM G;  1PVO A;  1RYR A;  5JJI A;  3KTM A;  3LP8 A;  3BVG A;  2J0T D;  3BYT B;  2UU9 L;  4R4O A;  2UUC Q;  2YZM A;  3J81 W;  1Y1W H;  3A8J E;  2MCT A;  4R8U B;  5E3F A;  2D0O A;  4I7H A;  2K01 A;  2QCP X;  2MNA A;  2M2L A;  2VB3 X;  2SEB D;  4R4C A;  2W6Z A;  1JE4 A;  2VB2 X;  1PH1 A;  1TQO A;  4A3L H;  5FLX c;  2AQ4 A;  4G4K A;  4CDF C;  1NJI C;  2I0Q A;  3OSO A;  2FJ2 A;  4JCV E;  3IAY A;  2ZM6 H;  5ELO A;  4LF4 L;  3CPF A;  3TSS A;  4A3J H;  4MTD A;  3VYR A;  1Y1W A;  2A6E D;  4A2B A;  5D3D A;  2Y0S E;  1ENA A;  4GNX A;  3CC4 A;  3M3Y H;  3CVZ A;  3KLS A;  4WD3 A;  2WFW A;  3N40 P;  2QA4 A;  4JI7 H;  4YWM A;  1V4Y A;  2Q2I A;  4DL7 A;  3NEN A;  3RAX A;  2I5M X;  2HD3 A;  4R9W A;  5F9L A;  1UC8 A;  2WAQ B;  1TY2 A;  1LAB A;  3HKS A;  4QB4 A;  5KFY A;  3MTS A;  2F0K A;  4P2C B;  1JDB B;  4NDX A;  1SCU B;  2RKS A;  3GII A;  2MO1 A;  5KFB A;  4IRK A;  4IUU A;  3S17 H;  5TSS A;  2Q8R E;  3I2Z A;  4ZYS A;  1KDA A;  5J1Z A;  4B3S L;  2B2U C;  4TV8 F;  2UXB L;  3RB3 A;  5KFC A;  1F9R A;  4DV7 Q;  5GRO A;  2PCF B;  1C9O A;  2DUD A;  2IL8 A;  2SOB A;  3D3R A;  3ER0 A;  4BY1 G;  4IOA A;  3T5L A;  1CTM A;  1YZ6 A;  3MXP A;  3PUY A;  4A4I A;  2ZJT A;  1GSO A;  3GV8 B;  2YTV A;  3PF5 A;  1J5E L;  3BDL A;  3MWY W;  1X65 A;  4PMB A;  4C3I H;  3G6X A;  1YBY A;  4PG3 A;  4B3R L;  2WB1 B;  2E74 C;  4IQZ A;  3T1Y L;  1DZ1 A;  1PFB A;  2JA8 B;  4H0L C;  2M05 A;  4FS1 A;  1ZYR C;  4P73 A;  4DR1 Q;  4AQY L;  2RVL A;  3S1R H;  3T56 B;  2DN8 A;  4DL2 A;  2F4V Q;  4DR2 H;  1HQM C;  4P75 A;  3TZU A;  1BF4 A;  1PZI D;  3CME A;  5K5P A;  3RZD H;  1P16 A;  4OO1 I;  3RV3 A;  4A3F G;  1DV2 A;  3HOX B;  1M8A A;  4Q8E A;  1GUW A;  4I7Z C;  4NW2 A;  1WR2 A;  1E1T A;  2OF1 A;  3Q22 A;  1SEB D;  1EZ1 A;  4KHP H;  1SE3 A;  1UE7 A;  4PZ6 A;  4JOI C;  4S3S A;  3KJP A;  1HNZ L;  4BBS B;  2ZXO A;  2C5C A;  2R93 B;  3HZX A;  3RV4 A;  4HCS A;  1GUS A;  2ASB A;  2A6E C;  3D0F A;  5IYB G;  2ALZ A;  3QB3 A;  1VQC A;  4KY5 A;  4NXN L;  3OTO Q;  2JXM B;  5KFJ A;  3MXN B;  4RGO S;  3K80 C;  2Q8I B;  1PRT D;  5KFO A;  1LO5 D;  1IBL Q;  4LF8 H;  3TME A;  2BQ3 A;  1BCP C;  4YCW A;  1GVP A;  3EQL C;  5I47 A;  1XNR H;  5KFQ A;  3GTJ H;  3K7U C;  5EPL A;  1I4R A;  2RSN A;  3HS0 C;  4RG1 A;  5ELN A;  4APV A;  5C44 G;  2RBM A;  4DUZ H;  1RL2 A;  4JC0 A;  2SDF A;  1QNK A;  1SLJ A;  1L0Y B;  5ELF A;  1N36 Q;  1CKN B;  1L1O C;  5AFW A;  2YU9 B;  3J81 j;  1IYV A;  3UDF A;  3HG9 A;  4XYL B;  5DLQ E;  3DHQ A;  3T5H A;  5DGB A;  4ZQI A;  3DWA A;  4JPB W;  1WVL A;  3AQQ A;  4FF4 A;  4DV5 Q;  3GTJ A;  3D31 A;  1BJT A;  4JI3 H;  4OO1 H;  5JVD F;  1SYG A;  2ZJP A;  4CJ2 C;  2F0H A;  1SYE A;  3FMA A;  2EYO A;  4X66 Q;  1PH9 A;  4DPG A;  2KQ3 A;  4JI6 H;  3S1Q H;  5JVH 3;  2NZH A;  3C2P A;  5FJ8 H;  4CDD C;  3HEJ A;  5IY0 A;  1JJC B;  2PZW A;  3DF7 A;  2ICI A;  3QIA A;  4DR7 Q;  2SCU B;  2V4Q A;  3W2D A;  3BAB A;  1YNN C;  2ALY B;  4BY7 B;  2IX0 A;  1EOT A;  3TP7 A;  1JJG A;  2AMC B;  1BDO A;  2XN9 C;  2NVY B;  3PV0 A;  4RB1 A;  1QVG A;  3KAL A;  2PI2 E;  1FGB D;  3H0G H;  4FVM A;  3J80 i;  3I4O A;  3VYT A;  2JP1 A;  1EFI D;  4FU0 A;  4IZO A;  4OHJ A;  2R87 A;  1LTR D;  2R92 G;  2DWC A;  1HZC A;  4A3D G;  1N34 H;  3WWV A;  5C4X H;  1SMY C;  3I12 A;  4MZ9 A;  5KNC A;  1EL0 A;  2R82 A;  5IGF A;  2YW2 A;  2HUG A;  4EGQ A;  4ED2 A;  1JOK A;  3CKI B;  1TS3 A;  1Q82 C;  4GN4 B;  2C00 A;  1B50 A;  2XD4 A;  2VUM H;  3OIP A;  4FBU A;  4KKS A;  5D8D A;  3PIP A;  3BQ2 A;  2NVQ H;  1MSG A;  1QUQ B;  4H02 A;  5KFW A;  4K14 A;  1A8V A;  5KFG A;  2PQE A;  5EZY F;  1P8L A;  4ZKC B;  2AQ1 B;  4MIU A;  4ZCK A;  4LF5 H;  1SN8 A;  5EWG A;  2EYM A;  2L4N A;  1WTW A;  1CFM A;  3T5K A;  2PMZ E;  1CQI B;  4B3T H;  4M9U A;  3BDO A;  2QKI C;  2MHV A;  2DPJ A;  5K36 G;  3JAM W;  2VUM A;  1XX8 A;  5HGQ A;  3Q6S A;  5LHY 1;  2AHO B;  3JZI A;  4UP9 A;  1T36 A;  3MFG A;  1PFM A;  4N8X 1;  1N8R C;  2NU9 B;  1LM0 A;  2LKV A;  2VW9 A;  1TWC H;  1HCZ A;  3GTP H;  5FO9 B;  1E24 A;  5CYU A;  3T1H H;  1BOS A;  4GS3 A;  4AYB G;  5FD5 A;  1TY0 A;  4O3Q A;  2B2V C;  2CCZ A;  2F4V L;  1TWC A;  2UVV A;  4LWC A;  1X3Q A;  2K5N A;  3T4A C;  3GTP A;  3OOC A;  1AEX A;  3RD4 A;  3ND8 A;  2B2W A;  4MV6 A;  1HNW L;  3F2C A;  5CGK A;  4UCU A;  4JI4 H;  1F77 A;  1D5X C;  3SK5 A;  1BKB A;  3VA5 A;  1HUN A;  3LX0 A;  5LA6 F;  2W9B B;  1N9W A;  4LFA H;  2ATW A;  1YIJ A;  1OXS C;  4FXK C;  2WDT A;  3HB9 A;  5KG3 A;  2ASJ A;  1FNW A;  1D5Z C;  4EX5 A;  3DEP A;  1EQQ A;  3QWN A;  1PXU A;  4LF6 Q;  1N32 Q;  4ECY A;  2LXJ A;  3L3O C;  1V1P B;  1EWC A;  3FRP B;  2A19 A;  2WTF A;  1BCP B;  4IZ8 A;  4C5B A;  4RB2 C;  4EBC A;  4ECS A;  1O7Z A;  2SNM A;  4YIJ A;  3G7L A;  4X65 H;  1AW7 A;  1GD7 A;  2X69 A;  1VBG A;  3MFY A;  4BA1 I;  1UNS A;  3CCR A;  2WAC A;  2N3S A;  4HIM A;  3MFI A;  2VQD A;  5HGT A;  4LNQ A;  1L1O B;  4JI7 L;  4DV3 Q;  1EQV A;  2KVM A;  4LFC L;  1NNX A;  3HOV B;  1D8L A;  1YJW A;  3MR5 A;  3NUC A;  3BG3 A;  1A3T A;  1VF7 A;  4KN4 C;  3I4M G;  4HIO A;  1B4O A;  4K5V A;  3FKI G;  3KHL A;  3EN2 A;  1LTA D;  2AGQ A;  2EYF A;  4DV5 L;  5IYB H;  4IJL A;  2L55 A;  5EJW A;  1VMC A;  4HED A;  1NR2 A;  3OUZ A;  5CAE B;  3TEH B;  4IWY A;  3GTK A;  3G6J B;  2HVR A;  3L0O A;  3SXH A;  4AH6 A;  4B3M Q;  3H3V C;  3H20 A;  1Z47 A;  3OPO A;  2G5D A;  4A3G B;  5KFS A;  3V4S A;  4M7E A;  1I3Q B;  4X62 Q;  3UE1 A;  3A7A B;  2K1B A;  1AN7 A;  1SND A;  2BQU A;  2CQY A;  1HNX H;  1PLF A;  5CV7 A;  3KLR A;  5EAY A;  1VQP A;  1PRT F;  5CA1 F;  4HIK A;  4BBR B;  3SDZ A;  4ABN A;  5IWA H;  5C5J A;  1IW7 C;  4U68 A;  1S03 G;  4DR4 Q;  4IHJ F;  3V2T A;  1KD1 C;  4LSA A;  5C3E G;  2VPQ A;  1VKZ A;  1H9S B;  4GKJ H;  3L4K A;  1HR0 W;  3J7Z C;  5M3F G;  4FS2 A;  2XC9 A;  1S72 A;  4RB0 A;  4A3I B;  3VR3 A;  5F9N A;  2IBK A;  3BG5 A;  3CCV A;  1PRT B;  3MR6 A;  3NE5 B;  2NZ1 D;  1EYD A;  4H44 C;  3GV5 B;  2PZU A;  5KT6 A;  2YRW A;  5GAD C;  5A2Q L;  1I6H H;  2OT2 A;  5J3B A;  2HHH Q;  2Q2T A;  2KCM A;  4MA5 A;  3MZ5 A;  1EYZ A;  1DOK A;  1LLR D;  1JE5 A;  1GGO A;  4OX9 L;  5JPN C;  4XT1 B;  1J8I A;  4JI5 Q;  2ENB A;  1VQ7 A;  3IG0 A;  4MAM A;  1CKO A;  4DKA C;  1L0X B;  1RIP A;  1SRO A;  2VQE Q;  4J0M A;  4I65 A;  3TZD A;  2QK4 A;  3IFT A;  1IL8 A;  1I4X A;  2VUG A;  2W6O A;  2UUB Q;  1TWH A;  4AIM A;  3MXG A;  3PVX A;  4DNR B;  2E5L H;  3J80 W;  5GQO A;  1EIG A;  1KJ9 A;  3PSI A;  2HT1 A;  2IP4 A;  4B08 A;  1I94 Q;  4IAJ A;  1AE2 A;  4A3D H;  1E4G T;  4DV2 H;  4DV0 Q;  4DUZ L;  5IGC A;  1HTL D;  4A3B G;  2B3G A;  1D1K A;  3ETJ A;  1B44 D;  4C3J G;  1E4F T;  2JK8 A;  1I7L A;  1SSO A;  2EXZ A;  2E76 C;  4HMI A;  4ZLT F;  2IX3 A;  3CC2 A;  2DY8 A;  4LF9 Q;  3PIO 3;  2Z4H A;  2O03 A;  4LF7 H;  1I50 H;  3HKZ B;  3IKJ A;  1EIF A;  3RGZ A;  5IT9 E;  4TQU S;  4QJF A;  1VQG A;  1TVX A;  5GAG C;  2EY6 A;  3RUZ A;  2UXC H;  3X3M A;  5JPM C;  3TQT A;  2A5H A;  1RJT A;  5KFA A;  4RA8 A;  3S16 H;  1M0W A;  3BU2 A;  5GON F;  2JEB I;  2EYP A;  1T3N A;  4FP5 D;  4A3J B;  5K36 H;  1Y1W G;  1KLG D;  2JEJ A;  1B53 A;  2WP8 J;  4LW1 A;  1VQ5 A;  3M3Y B;  2ZDG A;  3BZK A;  3TIG A;  4C3H G;  4A3L G;  1FJG H;  2JQO A;  4HID A;  5K2M A;  1HQR D;  1SNQ A;  4QGU A;  1C3O A;  1U4R A;  3STB C;  4DV4 Q;  2KED A;  1EUJ A;  2IJ0 A;  1T94 A;  4JI0 Q;  5KFL A;  3MXU A;  1X56 A;  3KUP A;  5E4X A;  1EEI D;  3RAQ A;  1TKW B;  1IBK L;  4QW8 A;  4JI2 H;  5LP6 F;  2K5W A;  5IT9 c;  4HQ6 A;  3P20 A;  3CPW A;  2B2Y A;  4EGJ A;  1SYB A;  2V1C C;  2RCF A;  2ZXP A;  4DA2 A;  4DUY H;  5I6W A;  5KG7 A;  1O75 A;  1DM0 B;  2UU9 Q;  1NTG A;  4AYB A;  2WKC A;  2UUA Q;  4DV3 L;  4DAY A;  1Z2O X;  2DZD A;  1KRT A;  1PTO C;  4J15 A;  1VQN A;  1CKM A;  3TS2 A;  4UFZ A;  1K83 H;  4K8J A;  4ETS A;  5KFN A;  5KRU A;  2L0C A;  4C3I B;  1B9M A;  3GO5 A;  5LL6 b;  4GN3 B;  2CW0 D;  1MI2 A;  2TSS A;  4LF4 Q;  4LFB Q;  4L5Q A;  5D1P A;  3A0J A;  2PVP A;  1EY9 A;  4BS9 A;  4HJ7 A;  4HNT A;  3S1R B;  4B3T L;  1KJ8 A;  5JVG 3;  2ZTC A;  2FB9 A;  2FK3 A;  1K83 A;  2HJW A;  4DV6 H;  4A3K G;  5T14 A;  3KOJ A;  5IGB A;  4YHH L;  4IUP A;  1NY4 A;  2MUY A;  2KUM A;  3CCM A;  3SK4 A;  3J81 L;  3JC6 6;  4LUO A;  3RJ0 A;  5DAU A;  1G6Z A;  4RUA A;  4DV1 H;  1TWA H;  3K7A H;  2SNS A;  3CCQ A;  3NHH A;  4Y7N H;  3U50 C;  2R6G A;  3T1H L;  2IHF A;  1HFN A;  2F0Q A;  3M7N A;  3CCJ A;  3LWU A;  3I4M H;  3HBL A;  2BE5 D;  1YNX A;  1SYD A;  4JI1 L;  2IWH A;  3W5O A;  5FOB B;  2F0S A;  4DR3 Q;  3JRW A;  4ME5 A;  4ODG A;  2UXB Q;  2GLT A;  1FKA H;  3FKI H;  1Y14 B;  2Y0S A;  1GHJ A;  1L0W A;  4A3E B;  2OCE A;  1QZG A;  2N8N A;  4RCO A;  3PQI A;  1TWA A;  3KBG A;  3IFD A;  1NCV A;  2L9H A;  3EJI A;  1K3B C;  1H9M A;  4HN7 A;  4C1N K;  2NVT B;  2KHI A;  4ECW A;  1E7Z A;  3T53 B;  1ROD A;  4ZQ3 A;  4UCS A;  2YRX A;  1J5E Q;  2B29 A;  4L5T A;  3TDQ A;  1JWS D;  4QUF A;  3GTJ B;  4B3R Q;  3FKI A;  3LWE A;  4F4Y A;  5LMN H;  4MV9 A;  3T1Y Q;  1I6V C;  1ZXT A;  4XIG S;  4AQY Q;  5IIF A;  1II3 A;  3PO2 H;  2KOL A;  4ZUI A;  2B8F A;  4DFA A;  1JOQ A;  3OWE B;  1QJO A;  1HA5 A;  4C1N I;  1W3S A;  2AUJ D;  4JI5 L;  2VY3 A;  3MR2 A;  3SE0 A;  2K33 A;  3EPI A;  3HGB A;  1PX2 A;  3U4Z A;  4QF4 A;  4WBN F;  3FMC A;  1HZ9 A;  3CU7 A;  1S5E D;  4X65 L;  4R8I A;  2BQR A;  5I4D A;  2Z1C A;  3SK8 A;  2WIN B;  4YP3 A;  1H9K A;  1HZA A;  4YR3 A;  4NXM Q;  2KA7 A;  3GQB A;  2XGQ A;  3CQZ B;  2CW0 C;  4NPS A;  2UUC H;  1HNZ Q;  4UCT A;  4ZAI A;  1IL2 A;  1S4Z A;  3S1Q B;  2R7K A;  1OXU A;  2PZT A;  3LML A;  1N33 H;  2GN5 A;  3TRE A;  3RBE A;  1STB A;  3N44 B;  4X3S A;  3CHB D;  1QG7 A;  2MGS A;  5CV4 A;  1UNN C;  1WSC A;  3OWF A;  1FL0 A;  2DJG C;  1E22 A;  4GOP C;  5DM6 3;  4NXN Q;  1XNQ H;  1F2Z A;  3QOL A;  4QQB X;  3NEL A;  1JX4 A;  1VQ8 A;  1ML0 D;  4RH6 A;  2XIG A;  1Y8O B;  1WTQ A;  2YTX A;  1HR0 H;  1HPC A;  4DL3 A;  3H0G B;  3NTH A;  2CHB D;  4YR2 A;  3CCL A;  4DR6 L;  5EWE A;  2W8L A;  4DNT B;  3GV7 B;  4Q0F A;  3VR4 A;  3ETH A;  2R7N A;  3K5I A;  2EE1 A;  3G6Y A;  1GUN A;  4FBT A;  1JIH A;  2BE5 C;  2VA2 A;  1FVI A;  1JQY D;  2I80 A;  5C4X B;  1RYS A;  1S5F D;  2W71 A;  5FLX E;  2Z6K C;  1HNX L;  1Y8N B;  2F0L A;  3GV3 A;  2GPS A;  1GSA A;  4L63 B;  4A3B H;  1KJJ A;  3MVV A;  4XXE A;  4C3J H;  2VUM B;  3OHB A;  4MV1 A;  3NTI A;  3T51 B;  5C4J H;  2FK2 A;  4LMQ D;  4DV7 H;  4ED7 A;  1L2F A;  4DV4 L;  2F0N A;  2K6A A;  5C4X G;  4JI0 L;  1S5D D;  3P7J A;  5KG5 A;  1KAW A;  4TUY F;  4E6I A;  3F8N A;  4LH6 A;  3VPB A;  5KFE A;  1PTO B;  1OO9 B;  4IJH A;  4FXD A;  4DL6 A;  1KHI A;  4CJ0 B;  3FHW A;  2UUA L;  4DR1 H;  4TQS A;  2O5J C;  1TWC B;  3K8A A;  3Q8S B;  3PR4 A;  3H40 A;  4O4L F;  2O5I C;  1HJP A;  4OWX B;  3D8G A;  4PNY A;  4C3H H;  3JAM i;  3CW2 C;  3ULP A;  3QJY A;  1A0I A;  4DN4 M;  5KFI A;  1MGS A;  4LFB L;  1H9R A;  1IHZ A;  2H4O A;  2FE3 A;  2R8I A;  5D14 A;  2J7Z A;  3A8I E;  4K2L A;  2BR0 A;  1VQF A;  2UXD H;  1LTI D;  2JA6 G;  2RCN A;  2KCN A;  3TBI B;  1A9X A;  4HTH A;  1T5X D;  1OTC A;  2OEO A;  3MR3 A;  3QZ7 A;  3SVM A;  1MKH A;  2LFN A;  2K4K A;  2PI2 A;  4CHT B;  4DLK A;  1TWF H;  3I4N G;  1SNC A;  3K57 A;  4BY1 B;  1STY A;  3OTO H;  4O3S A;  1O80 A;  3RB6 A;  4JG2 A;  2IW3 A;  1IBL H;  3OMC A;  4ZHQ F;  4DR3 L;  3RB4 A;  1VQK A;  4TVA B;  3M4Y A;  3NP8 A;  2FPG B;  1EUC B;  1PFN A;  4CKC A;  4LK1 C;  1X32 A;  3AMU A;  5JH7 F;  4ALP A;  4N9T A;  3KK7 A;  2B2Y C;  5IE8 A;  1SXT A;  1TWF A;  5H80 A;  3S1N H;  3BAA A;  3O13 A;  1N36 H;  4A3K H;  1VQE A;  1EWI A;  5KIX A;  2D62 A;  5NUC A;  1SE4 A;  3ZJY C;  2FMC A;  3VDY A;  1SMX A;  1EOV A;  2FMM A;  2UVU A;  3N43 B;  1FJG L;  1STA A;  4ID6 A;  4A3F B;  5COY A;  5KFZ A;  4RHS A;  2XVS A;  2N49 A;  2PMZ A;  4XQN A;  4X66 H;  1CK1 A;  1MHW C;  2F0V A;  1M6V A;  1V1Q A;  1RCV D;  1HNW Q;  4YY3 H;  4JI2 L;  2F0M A;  2F0D A;  4DGZ A;  3NGD A;  1DON A;  4OIJ A;  1IKM A;  1BGW A;  1E4E A;  1E2W A;  3MAQ A;  1RJP A;  1ENF A;  4RAZ A;  1XMQ H;  3OHX C;  1CQJ B;  1GYF A;  4NXM L;  3M4P A;  2IA6 A;  3PIO A;  1VQB A;  1Q46 A;  2ZTD A;  2K52 A;  3Q23 A;  2K32 A;  1G2S A;  2B2T C;  4GOP B;  1AZP A;  2W7P A;  1Q3L A;  3VYS A;  2YS7 A;  1XWE A;  1UE6 A;  5C44 B;  3KLW A;  1B3Q A;  2MFI A;  1AUX A;  4WJ4 A;  2W9C A;  4X3U A;  5LMU H;  1X54 A;  1R9T H;  2E2I H;  3DWQ A;  4RNO A;  1JIC A;  3SHL A;  5FO8 B;  1IBM H;  4JI7 Q;  5LL6 X;  3TS0 A;  2K75 A;  4LFC Q;  4ZOL F;  3CCE A;  3NWT A;  3U58 A;  1K0R A;  5CBE E;  2EIF A;  3CP0 A;  4DAP A;  4DV1 L;  2F0J A;  1R9T A;  1X55 A;  1I4Q A;  4HAE A;  2E2I A;  4Q44 A;  4O0A A;  1I6H B;  3KF8 A;  3K5O A;  1A2U A;  1Q8K A;  4ZKB B;  5HV6 A;  1TWG A;  4DR5 L;  1EY5 A;  2YCH A;  2OTL A;  4KD3 A;  4HJ5 A;  2GVB A;  3KHH A;  4O3O A;  2BCO A;  2F0E A;  2RSO A;  4RZR A;  2PQA A;  1WOC A;  1IYJ B;  1EWH A;  4FNF A;  3KYH C;  3DWP A;  3M9M B;  1S10 A;  2NU7 B;  4EYH B;  3BZC A;  3UDG A;  2L15 A;  3KBX A;  2FLL A;  1YEZ A;  5KFT A;  3K5M A;  1PYW D;  4OEM B;  2XRQ D;  1LYL A;  3EYY A;  4F4W A;  4CC5 A;  5C8Y F;  3K59 A;  5KT2 A;  2R92 B;  2D2C C;  4A3D B;  4LUV A;  2C2E A;  2RDG A;  4KY7 A;  1PZK D;  3KF6 B;  4YCU A;  4HJ8 A;  1RTN A;  3H09 A;  3KDF B;  4EQP A;  4X3T A;  4K0K H;  1AZQ A;  3MFH A;  2XCL A;  4UPA A;  1TS5 A;  3HKZ E;  3A5U A;  1I50 B;  3E9H A;  5DG9 A;  2HCI A;  5ISR A;  2MPM A;  2JA9 A;  4IUT A;  2XWB B;  4J8Q A;  2V4D A;  2OWO A;  3DXJ C;  1K8M A;  4C2M H;  4ECV A;  2LY7 A;  4A3M G;  3U9S A;  4UDU C;  1QOH A;  1GOZ A;  1MJE A;  2F0W A;  1SYC A;  1K73 C;  1CHQ D;  1K1S A;  3S16 B;  4JV0 A;  4Y8V B;  2PYK A;  2KEN A;  1PRT C;  2PW7 A;  3PUW A;  1N33 L;  3Q8R B;  2AGP A;  1YHA A;  4DAV A;  4OX9 Q;  1RJQ A;  2EPB A;  1K9M C;  3GTG B;  5JJK A;  4C2M A;  3HOW G;  3NXW A;  1XNQ L;  1B3A A;  2F3W A;  5FLX W;  4MN3 A;  4LF8 Q;  3BZD B;  2IT1 A;  3A5Z B;  2MQH A;  3VPD A;  1FGU A;  4G3I A;  1XNR Q;  5IGD A;  2V59 A;  4YQW A;  2ZJQ A;  4AYB B;  3C1F A;  4YBZ B;  1WTO A;  4MV4 A;  3WO1 A;  1DD2 A;  4ED0 A;  4DAY B;  3EIV A;  3PN1 A;  4FDB A;  4IAL A;  4DUZ Q;  1CSQ A;  4UP7 A;  2JA6 H;  1EY0 A;  3S14 B;  1E2Z A;  1O7L A;  3E6Z X;  4LAA A;  2BH2 A;  3ICE A;  1JWM D;  3CCS A;  2J6U A;  4DAM A;  3NBI A;  5D1O A;  1ASZ A;  5C6A A;  4K5X A;  5FPO A;  3S2D H;  3I4N H;  4CJ1 B;  1M0T A;  4M1U B;  3U4V A;  4Q0Y A;  2JA6 A;  1XTD A;  4PQX A;  4OWW B;  2F3V A;  4JV5 H;  3AYH B;  2XGT A;  3J80 L;  1DYQ A;  4GNX C;  1RHP A;  2VZA A;  3PUV A;  5BMV F;  4IPC A;  1ESF A;  1EFW A;  2ASD A;  4JYA L;  2RHS B;  4Q45 A;  3KLS X;  1Q1E A;  1GKH A;  4PMW A;  2FMA A;  4BWS C;  3GIM A;  2L5T A;  2OH2 A;  1SBB B;  4R8U A;  4JW0 A;  3VR6 A;  1JT8 A;  3OUU A;  1BBW A;  3R8B A;  1SE8 A;  3GIK A;  1VQJ A;  4OWT B;  4DR4 H;  1CQF A;  1X3G A;  4RNN A;  1TWA B;  1W96 A;  1WJJ A;  3LNN A;  4IUV A;  1G6P A;  4DL5 A;  1VDZ A;  1DXM A;  1W2B A;  1WD0 A;  3FEW X;  2ZM6 L;  4G7Z C;  3QFF A;  5DQG A;  1IBK Q;  1Q81 C;  3I4M B;  3W1G A;  4L5R C;  5LYJ F;  1SJH D;  2L12 A;  2XGP A;  4F50 A;  1JB3 A;  2UXD L;  3FKI B;  2A68 D;  3RN2 A;  2JEF A;  2HHH H;  2Y0S G;  4O4H F;  2AUK A;  3K5L A;  2C2D A;  2J6T A;  2F0G A;  4LH7 A;  1FYC A;  1EYC A;  2WKD A;  2F1M A;  2Z8L A;  4GN5 A;  1WTH A;  3GTK H;  2WAQ A;  4YAK B;  3RUP A;  5C0X G;  5LMN W;  4F4Z A;  4M8A A;  1XDN A;  4O2B F;  4PMC A;  3UE0 A;  3V96 A;  2RDF A;  1UWV A;  4LF5 Q;  4QWB A;  3K81 C;  1Y1V G;  2DNC A;  2R8K A;  1JR0 D;  4XTC S;  1NR4 A;  4B3T Q;  4JI8 H;  1B2T A;  1JCK B;  5KFR A;  3S1M B;  1I94 H;  2ZT9 C;  4YHH Q;  3F2B A;  3PW2 A;  3PW0 A;  2JA8 H;  4DV0 H;  2R7D A;  4QIW E;  4L5S A;  5M3M G;  5DGA A;  5I9P A;  3W3A A;  5CV8 A;  4YJ3 F;  4QY7 A;  3J7A K;  2W6Q A;  3K3V A;  1WI5 A;  3LGJ A;  5C3E B;  1LV9 A;  3BJY A;  5M5W H;  3PO2 G;  3T1H Q;  4XQQ A;  1NAP A;  5M3F B;  2JEG A;  3EFX D;  3AFP A;  2B63 G;  2EJF C;  1MD2 D;  3MJF A;  5KFP A;  3C46 A;  1S9F A;  3RZO H;  3L9A X;  2G9D A;  4JI1 Q;  1VQA A;  3WDN A;  4ME6 A;  1AN8 A;  2AU0 A;  1STE A;  1IOV A;  4A76 A;  4DR2 L;  2QF7 A;  1CT1 D;  3RMH A;  1BNC A;  4XYO A;  2EY5 A;  5KFK A;  4GKK H;  3K0Y A;  3MC0 B;  4JI4 Q;  4EVO A;  4BA2 I;  2R3Z A;  1A63 A;  1OXT A;  1B1Z A;  2JYO A;  4LJZ C;  2FFK B;  3N42 B;  1U4L A;  3J7A 5;  4KHP L;  4EEY A;  3TII A;  1VQL A;  3TP8 A;  1SDF A;  3SK6 A;  1A6X A;  3DUZ A;  1TWH H;  5I2X A;  4IFD G;  1PV4 A;  5C1P A;  2C22 A;  1LT4 D;  2LMC B;  4IUN A;  4UCV A;  1RTO A;  3EBE A;  4DK0 A;  4UHV A;  1Z2N X;  4HNU A;  4HR7 A;  4A3B B;  4MV3 A;  1NSN S;  3K6O A;  2K5D A;  5C5L A;  4C3J B;  2I5L X;  4X65 Q;  4LF8 L;  2FKL A;  2HGS A;  1OXV A;  1EIH A;  3KAJ A;  4KLK A;  5C4J B;  3GTO H;  1RK6 A;  5D65 A;  1QIL A;  2GVA A;  1RF2 D;  3NQT A;  5IOC A;  2NVX H;  1XNR L;  5COR A;  1KJQ A;  2D5D A;  3OMG A;  2K14 A;  3V4Z A;  1IBM L;  4I4T F;  1DGS A;  2A6H D;  4J6H A;  4F87 A;  2Q8T A;  4R1J A;  4A3M H;  2PBZ A;  1R4P B;  1ULZ A;  3HOU G;  3M4O H;  5BR8 H;  5EBD A;  3TRZ A;  1CKN A;  4EEQ A;  2YU9 A;  2KJX A;  2YYA A;  2QW7 A;  5KT3 A;  3GTO A;  1C0A A;  4B9X A;  1LTG D;  4LF4 H;  2NVX A;  3GQC A;  5KG6 A;  1MJC A;  3A74 A;  5CV6 A;  3RR5 A;  1YHQ A;  1Y1W B;  4A93 G;  1K8O A;  3C0F B;  4JI3 L;  4Q5V A;  2RF4 A;  1YI2 A;  4BY7 H;  3N52 A;  3J81 E;  2YV5 A;  1V43 A;  3HOW H;  4GNX B;  4U67 3;  1YHB A;  3BA9 A;  1BBX C;  4ED3 A;  4CGY B;  4C3H B;  4DR6 Q;  2VXW A;  4EQN A;  3I56 A;  4JI6 L;  1JMC A;  1PYS B;  1PH8 A;  2CVR A;  2F0T A;  4QUC A;  3KAK A;  4GC6 A;  5CV5 A;  5FD6 A;  4X64 H;  4FF3 A;  1BR9 A;  3I90 A;  4IFD J;  1HNX Q;  3UFX B;  4YAJ B;  2C2R A;  1QNU A;  3M7G A;  3E3X A;  2NVY A;  5AJ3 L;  5I2Y A;  1SNO A;  4B3S H;  5IWA Q;  4RNM A;  1SYF A;  4K6D A;  3QO2 A;  3A8K E;  3PR5 B;  4JBW A;  2WAQ E;  1BQQ T;  5HY6 A;  5DG8 A;  1TWF B;  1D7Q A;  3CMA A;  1JDE A;  2VA3 A;  4J9M A;  1CZG A;  1ENC A;  4IO9 A;  2E2J H;  3S17 B;  3SEB A;  1E2V A;  1S5B D;  1N34 L;  3UQ8 A;  1J5E H;  5C0X I;  3J81 c;  2EDG A;  2QYZ A;  1EY7 A;  1JC7 A;  1KC8 C;  1X3F A;  4B3R H;  2EY1 A;  3ERQ A;  5KYI A;  5L1J A;  1TAE A;  4V19 0;  3S1N B;  3CF5 A;  4ZK9 B;  3Q8Q B;  5KNB A;  1C8C A;  2JSO A;  3ULL A;  1G91 A;  2A1A A;  1ZHQ A;  3L7Z C;  4EFB A;  2PMZ B;  3G8C A;  3RLO A;  4OIK A;  4A3K B;  4IPG A;  4Q8F A;  5J2U F;  4P71 A;  1QUQ A;  4DU9 A;  1WCM G;  5M5X H;  3I8Z A;  2B8G A;  1DOM A;  1F9S A;  2NTS A;  4KN7 C;  4PV1 C;  1KNA A;  3R3O A;  2WB1 E;  3NEM A;  1EQR A;  1VF5 C;  1JKJ B;  4LF5 L;  1B33 N;  3WNZ A;  5BN4 A;  1CZW A;  3ONA B;  3Q2O A;  2B2W C;  1ICW A;  3GID A;  2JA5 G;  1ET9 A;  5CMD A;  2MO0 A;  2A73 B;  1Z2P X;  5BN5 A;  2XTI A;  2NU8 B;  5KFF A;  5FLM G;  4O3P A;  5HUR A;  1PK8 A;  3EA6 A;  5KFD A;  2K03 A;  1WFQ A;  3JRX A;  5FKA C;  1WTX A;  1UE5 A;  3RZD B;  1KNE A;  1QCB D;  2I46 A;  2W57 A;  5IGG A;  1WTP A;  2L1B A;  4PWQ A;  3EVQ A;  2ZTE A;  3M9O B;  2W9C B;  1XMO H;  2ID0 A;  3GD7 A;  5C0X H;  2VQF H;  5EOY A;  3S2H H;  1V1O A;  1CA5 A;  3RLF A;  1O78 A;  2F4I A;  4IUR A;  4V0B A;  4HYK A;  4BXX G;  2NN6 G;  5ELC A;  4HJ9 A;  1Y1V H;  4JV5 L;  3CRK C;  3GV6 A;  2C9O A;  3K5N A;  2R7Z G;  4IFD I;  4J9S A;  1GSH A;  4JI4 L;  3ORR A;  3G6V A;  2K5V A;  4XZ3 B;  4TRD A;  4JOI A;  1R9T B;  2W9B A;  2E2I B;  4LFA L;  1ZQ7 A;  4H13 C;  3KF8 B;  4HJA A;  3KHR A;  5M3M H;  1U9R A;  1K3R A;  2HQE A;  2KHJ A;  3ND9 A;  5FK9 C;  3D6W A;  1FJG Q;  1Y1V A;  3F1Z A;  2L11 A;  3X3N A;  4BWG B;  2R8H A;  5CV9 A;  4R7R A;  1F2M A;  3CC7 A;  3HOZ G;  2KCT A;  3F2D A;  2OLS A;  2DLN A;  2B63 H;  2W9A A;  1V1P A;  5T1I A;  3RFC A;  4J9K A;  3S15 H;  3PO3 G;  4ECZ A;  4ECT A;  4JI2 Q;  3CD6 A;  4MTE A;  3RF2 A;  4ECQ A;  3C1E A;  4POG A;  5DG7 A;  4MHE A;  1GUG A;  1CHP D;  1SNM A;  2D9U A;  1Z9F A;  3ULJ A;  4DK3 C;  4LUZ A;  2EY2 A;  2ZXR A;  3BJU A;  3FVQ A;  4RGM A;  2B63 A;  2FIN B;  1L1O A;  3G4S A;  5JEA G;  4Y52 H;  2RGV A;  4ECX A;  1VMP A;  5BN3 A;  5J39 A;  5KKN B;  1XPU A;  1C30 A;  4U7C A;  1QB5 D;  2EJM A;  4NMZ A;  5KT4 A;  4IFD H;  2JA7 G;  4A3G H;  2GPW A;  5L9X A;  3BQ0 A;  1H9J A;  5IGE A;  3K0X A;  4UY8 C;  1I3Q H;  4LMY A;  1VQI A;  2FXQ A;  3I4L A;  1FR3 A;  2Q2H A;  1IKL A;  1RK5 A;  1F9Q A;  5E7N A;  1BXR A;  1LTS D;  1EEF D;  1GLV A;  2TMP A;  1KDB A;  2HDL A;  3HOY G;  3H94 A;  5JJL A;  3WO0 A;  4JBM A;  1A62 A;  3N6R A;  2OQ0 A;  1BO0 A;  1AUV A;  5DLG A;  5KGU A;  1I3Q A;  1LTL A;  4C2M B;  4DV1 Q;  1K0S A;  4RGT A;  4RHR A;  3G6E A;  3I73 A;  1A3V A;  4F4X A;  1SFO H;  4GLV B;  3HOU H;  4RU9 A;  4NB3 A;  2HIV A;  4DR5 Q;  4A3I H;  4IR1 A;  1T9H A;  5IWA L;  5EKL A;  1CSP A;  2PO4 A;  2NVQ B;  5KFV A;  2BDO A;  2CH4 A;  5LL6 S;  4A93 H;  1F2L A;  3VPC A;  4OGQ C;  4GKK L;  1CE8 A;  4XDX A;  4GKJ L;  1Q8I A;  1CS0 A;  1CM9 A;  1SFO A;  1N48 A;  1KAB A;  4CBV A;  4QWD A;  2H5X A;  5JEA J;  4N8F A;  3UDI A;  1M90 C;  5DQI A;  2CZG A;  3OHA A;  4JVZ A;  1XTC D;  5CB4 F;  3IN5 A;  1STH A;  3G71 A;  1RD9 D;  5C1O A;  4F8M A;  3QR8 A;  4AQY H;  2JA6 B;  1SYX B;  1Y69 U;  2F4V H;  1RKN A;  2J4X A;  4FXG C;  3GTP B;  2W6P A;  1S0M A;  2V4R A;  5CR3 A;  2ZJR A;  2YL2 A;  4X3K A;  1D1I A;  2HIX A;  3MA2 B;  4IRC A;  3SGI A;  3MWM A;  2YYZ A;  2R7F A;  3S2D B;  3M4Q A;  3I4N B;  2E5L L;  1GHK A;  1O7I A;  5JVL A;  5IT9 W;  1TS2 A;  2HVS A;  5KYL A;  1OWT A;  4E4T A;  1UUP A;  3NBH A;  4DV2 L;  5JAV A;  2LS0 1;  4KHZ A;  5J22 A;  3R5H A;  1STN A;  3U9O A;  1N33 Q;  2PN1 A;  5BR8 L;  2F0P A;  2NN6 I;  4OXP A;  4UAI A;  4JBK A;  2B2V A;  3IL8 A;  1XNQ Q;  3GTM H;  1S0O A;  4LF7 L;  3JAM c;  1U5K A;  3HKZ A;  1TU2 B;  3H3V I;  4WRD A;  1HR0 Q;  2UXC L;  2CWP A;  1WCM H;  3AU7 A;  4ME3 A;  2YZG A;  3N41 B;  4IR9 A;  4TV9 F;  2XNA C;  1HXY D;  2R7L A;  4YR0 A;  3FPP A;  5L1I A;  1AFP A;  1B70 B;  5H1S E;  1M7J A;  4LFC H;  2RHQ B;  2JA5 H;  5KT5 A;  1HUM A;  4RZQ A;  3PCO B;  1BCP D;  2R8J A;  2N78 A;  3GTM A;  4J9O A;  4X64 L;  4QCL A;  5J2T F;  5FLM H;  1SJE D;  5A35 A;  2OTJ A;  1WCM A;  2OXP A;  2ASL A;  4NKL A;  4RKB A;  1S3O A;  2GA4 B;  1T5E A;  4APM A;  4DV5 H;  5T1G A;  4POF A;  3PUX A;  1K8A C;  3GLK A;  1JXL A;  2JA5 A;  3F8T A;  1Y8P B;  5GAE C;  2E2H H;  5FLX L;  2CKZ B;  3GTK B;  4C5C A;  4XYM B;  2WAQ G;  2ES2 A;  1JB7 A;  5EWF A;  5KFU A;  2NTT A;  2WV6 D;  1I5F A;  2HCC A;  2CFM A;  2NWG A;  2XWJ B;  4MNO A;  3JAM L;  1EHI A;  2VL6 A;  1UC9 A;  4DR7 H;  1MIU A;  1VQ9 A;  1WYD A;  2K28 A;  4BXX H;  4JV1 A;  2HVQ A;  2NN6 H;  4JYA Q;  1BUV T;  1EY8 A;  1K8G A;  1SRU A;  1GJX A;  2E2H A;  2R7Z H;  2QGQ A;  4DUY L;  5KFM A;  5KG2 A;  2V58 A;  1RDP D;  3AB9 A;  3GTQ H;  3H3V H;  3C3L A;  1U0L A;  1IYU A;  1KLU D;  1OXX K;  2JJQ A;  4ZRZ A;  2Q2U A;  1KQS A;  1HHV A;  1YNN D;  4UCO A;  3PW7 A;  5L37 A;  4WJW A;  2AWN A;  5M5Y H;  2VOB A;  4EQO A;  5M5W B;  5EDW A;  3K3P A;  1YIT A;  2CQO A;  2F0O A;  4UP8 A;  2ZM6 Q;  2R7Z A;  2EQS A;  1E3P A;  5EGT A;  3HOZ H;  3RZO B;  2KEC A;  2WB1 G;  3EPG A;  4O4I F;  1ZET A;  3GTQ A;  2JA8 G;  2ZDH A;  1TXY A;  2NUC A;  2UXD Q;  1SEI A;  3KJO A;  1HH2 P;  2K50 A;  3PO3 H;  4DV6 L;  3IRB A;  1UEA B;  2CQA A;  3PW5 A;  1TWG H;  2CW7 A;  2R8G A;  1ILQ A;  3TP6 A;  4HNV A;  3ERS X;  2QIL A;  2P5Z X;  2K5Q A;  3Q8P B;  1CQV A;  2AQ2 B;  4CDE C;  4OX9 H;  4EGV A;  1SMY D;  2YS6 A;  3OW2 A;  4EG0 A;  4O1N A;  4A3E H;  5JEA H;  1TS4 A;  2BH8 A;  4HR7 B;  3PZP A;  3HOX G;  1PA6 A;  1A2T A;  2BOS A;  2NVT H;  1CA6 A;  3T16 A;  1DIK A;  5KG1 A;  5IYD H;  3TQY A;  1TWH B;  4BBS G;  1XMO L;  2R93 G;  1Q86 C;  2VQF L;  4UCR A;  4MTN A;  2FJZ A;  4HMJ A;  2JEI A;  1WH2 A;  3BYY B;  2JA7 H;  4J9Q A;  4MV7 A;  4TQR A;  5E4W C;  4WFN 3;  1Z7T A;  2ICE C;  2V5A A;  3WOF A;  4O2D A;  3VR5 A;  2RGR A;  2K7V A;  3J7A F;  3RBD A;  4KJN A;  3FPU B;  1VQH A;  2P0A A;  3GTO B;  3DLL A;  3CXC A;  1GUT A;  1VCI A;  5C4Z A;  3K58 A;  2NVX B;  5KG0 A;  5C5M A;  3HOY H;  1G51 A;  2JA7 A;  1JLL B;  2C35 B;  2EZV A;  3KXY T;  2X6L A;  3J80 E;  4WJ3 M;  4P74 A;  5LMN L;  2AGO A;  4A75 A;  3GTL H;  2O2L D;  4A3M B;  1PH2 A;  1GM5 A;  1DOL A;  3PMF A;  4MA0 A;  1I4H A;  1Q12 A;  1IXR A;  3M4O B;  4R8N A;  2YZN A;  1S40 A;  4DR2 Q;  1PH7 A;  4ZUJ A;  3CQZ H;  1HZB A;  1QVF A;  3AEV A;  1A15 A;  3PW4 A;  4YY3 Q;  1I6U A;  4QIW A;  5DM7 3;  2BDN A;  2A69 D;  3R23 A;  3V6J A;  3GTL A;  3HOW B;  3I91 A;  5ELD A;  2LSS A;  4JBJ A;  1XMQ Q;  5L1L A;  3GIL A;  4J9R A;  4KHP Q;  4L1K A;  5KG4 A;  2UUC L;  3CQZ A;  5EPJ A;  4EQ5 A;  5BPF A;  5IOD A;  2KBN A;  4B9W A;  2NBF A;  4FO2 A;  4QMG A;  1AH9 A;  2LXK A;  2N55 A;  4LF6 H;  1N32 H;  5JJZ A;  2RQX A;  1C48 A;  5FO7 B;  1EIY B;  3SE7 A;  2XCP A;  4BY7 G;  3OSP A;  1DCZ A;  1S97 A;  4DL4 A;  1KL9 A;  1EU4 A;  3D6C A;  2OQK A;  5LOV F;  3HP3 A;  3K5H A;  1IBK H;  3J80 c;  3H4D A;  2RDJ A;  5IP7 G;  5LMU Q;  2VNU D;  1NBW A;  3TN2 A;  1ESR A;  1HR0 L;  2DPI A;  1YVC A;  4Q43 A;  2W8K A;  4HCE A;  4RAU C;  3FP9 A;  3H0G A;  1IBM Q;  1BNZ A;  1HRJ A;  4RUC A;  1VQ4 A;  5BPH A;  4DV3 H;  4QWE A;  2W6N A;  1LT5 D;  4O3N A;  1KTK A;  2E2J B;  1WTR A;  3J7Y W;  1FNU A;  2FK1 A;  1D6E C;  1PZJ D;  2Z4I A;  5C3X A;  1NUC A;  1B04 A;  4RCN A;  2KEE A;  5KFH A;  2F3I A;  2K05 A;  3GIP A;  1HFG A;  1V8Q A;  4JI3 Q;  2FLN A;  1PHJ A;  1PFS A;  3A7L A;  2N88 A;  3DMU A;  1PTO H;  1K83 B;  4DV7 L;  1STG A;  1G2T A;  3R5X A;  2KHS A;  2NB0 A;  5GAH C;  3CCU A;  2M00 A;  4YHH H;  4B3M H;  1ZEQ X;  3VR2 A;  5M5X B;  1KC7 A;  4QWA A;  4JI6 Q;  3V6K A;  1QE6 A;  4QW9 A;  3BVZ A;  4YB8 B;  1I4G A;  2Z6B A;  4TKO B;  4X62 H;  1GO3 E;  3Q1K A;  3BA8 A;  4J9N A;  1TII D;  3S24 A;  4H7B A;  2K5H A;  4Z9C B;  3RNU A;  1L2Z A;  1BVS A;  3HFZ B;  5AJ3 Q;  4JI1 H;  1CUK A;  4DR1 L;  1YNJ D;  2FPP B;  2A69 C;  3Q8D A;  4RWS C;  4YJ2 F;  1Q7Y C;  3D4R A;  1G29 1;  2Y0S B;  3DM3 A;  4K0K Q;  4JV2 A;  3K7A B;  4Y7N B;  5A2Q E;  1W93 A;  2DGY A;  1BCP F;  5DNF A;  1TR5 A;  3GIQ A;  1IW7 D;  1N34 Q;  3S2H B;  4BY1 H;  5DQH A;  1GUO A;  3KHG A;  5FPR A;  2NUA B;  2D0P A;  3V6H A;  4EFE A;  1Y1V B;  5IYC G;  2O4X A;  4XYQ A;  2CWA A;  3OW7 A;  3H4B A;  4QWC A;  1N56 A;  3WOE A;  1E1O A;  5KND A;  3NPP A;  4JI5 H;  3PGZ A;  3E0J A;  1EQT A;  2VQE H;  3W1B A;  3OTO L;  4O42 A;  1W6J A;  5M3M B;  2XIW A;  1YJN A;  1S68 A;  1IBL L;  3QG1 A;  2UUB H;  4FYD A;  4LSX A;  4GC7 A;  1H95 A;  1LTT D;  3PO2 B;  3TIN A;  2Z0S A;  3NK9 A;  4O3R A;  4RAY A;  4O2A F;  3G48 A;  1SR3 A;  2B63 B;  1UEB A;  2VS1 A;  3FDT A;  3S15 B;  1Q90 A;  1JOR A;  4A3F H;  1SAP A;  4A3C G;  4U6P A;  1DJR D;  2CW8 A;  2K04 A;  1N36 L;  2B39 A;  5CA0 F;  4EYI B;  2A8V A;  2PNH A;  1KEE A;  1VS0 A;  4WOR A;  1YJ9 A;  2R84 A;  1EY4 A;  4LF9 H;  1EZ6 A;  3E9I A;  3RN5 A;  2C28 A;  3NTK A;  5EKI A;  2F03 A;  2WB1 A;  4KKT A;  3HOV G;  4J9P A;  2I8C A;  3HOX H;  2JE6 I;  1C4Q A;  4F7X A;  1FD7 D;  1Z6H A;  4X66 L;  4DR6 H;  1S0N A;  4DK6 C;  4KY6 A;  1R4Q B;  2R86 A;  3VMM A;  4KV6 A;  1SNP A;  3UI2 A;  4BBS H;  4JV5 Q;  2R93 H;  1QWY A;  2RA4 A;  4YY3 L;  5M9O A;  3A54 A;  1YNJ C;  4DR7 L;  1TA8 A;  1NMF A;  5G3L D;  1U4M A;  3OSN A;  5C44 H;  4X6A H;  4LFA Q;  1NMG A;  1XMQ L;  3VA7 A;  1GXD C;  1VQ6 A;  3GIJ A;  1CI3 M;  2WE6 A;  4MTK A;  1ET6 A;  4JUZ A;  2R93 A;  5F2D A;  4MV8 A;  2CH4 W;  5C0X J;  5IP9 G;  3RIZ A;  4J9L A;  2MJ8 A;  4PZ8 A;  4A3G G;  2IMW P;  4OON A;  1J9O A;  4GOP A;  3URY A;  4DV4 H;  5IYZ F;  3L4J A;  1KBL A;  2A68 C;  4JI0 H;  3KFU A;  3BDC A;  1SFO B;  1PMR A;  2W70 A;  3HOU B;  2M9V A;  5I9O A;  3MXN A;  1M1K C;  3SI8 A;  1XPR A;  4BBR G;  4KTA A;  2YU9 H;  1B6R A;  5LMU L;  3STB D;  2R85 A;  1LT3 D;  3CAM A;  5KFX A;  3RGX A;  1B7Y B;  4IOC A;  4A93 B;  1ZHS A;  1KRS A;  4KJO A;  2UU9 H;  1O7Y A;  2UUA H;  5LXT F;  2XCA A;  2Z6K A;  3PF4 A;  5EPK A;  4KI0 A;  2KCC A;  4A3I G;  4C5A A;  3ITP A;  1PH4 A;  2W6M A;  1PH6 A;  2IX1 A;  5DEH A;  4LFB H;  1PTO D;  2EYL A;  3RB0 A;  4K8I A;  1D2B A;  3JSL A;  2QDB A;  4YCV A;  4JI8 Q;  3E5N A;  3CRL C;  2JN4 A;  4ECR A;  1ILP A;  2R92 H;  4I55 F;  1A3U A;  2RDH A;  3NBH B;  4ECU A;  2NVY H;  4IPH A;  5D3I B;  5IP7 H;  4G7O C;  3Q0A A;  3PUZ A;  3M85 A;  2V9W A;  2IY5 B;  4DXF A;  2QEX A;  1JJ2 A;  3I72 A;  4CKE A;  2QDL A;  1MSH A;  2EVB A;  2J6S A;  1EYA A;  2PPB C;  1B8A A;  3H6M A;  3OYY A;  1PH3 A;  1X9N A;  3R5F A;  2WII B;  1NE3 A;  1EU3 A;  5KT7 A;  2R92 A;  4YWL A;  4IRD A;  2I07 B;  3FDS A;  3KF6 A;  1VAJ A;  4KHV A;  3HRZ C;  4K6L A;  4DR3 H;  4YWK A;  2FLP A;  1ONL A;  1VQD A;  4OL7 A;  3BVM A;  3KDF A;  2UXB H;  1JWU D;  4ED1 A;  4K0K L;  1MBY A;  4IUQ A;  4PZ7 A;  3M4I A;  2W7O A;  1MZB A;  2UVW A;  4ED8 A;  4GLX A;  4GKK Q; 
#chains in the Genus database with same CATH homology
 4R4T A;  3G6E A;  1EYG A;  2E2I H;  4GKJ Q;  3J81 i;  4EX5 A;  1EQQ A;  3AFQ A;  4LF6 Q;  1N32 Q;  1SFO H;  2LXJ A;  4GLV B;  3HKZ G;  3HOU H;  4JI7 Q;  4NB3 A;  2HIV A;  4DR5 Q;  4A3I H;  3GTG H;  2A19 A;  3TS0 A;  2K75 A;  1T9H A;  4LFC Q;  5IWA L;  3CCE A;  1CSP A;  3U58 A;  1K0R A;  2EIF A;  3CP0 A;  4A93 H;  4DV1 L;  1GD7 A;  1LUZ A;  4GKK L;  1X55 A;  4BA1 I;  3UDX A;  3CCR A;  4GKJ L;  4O0A A;  2N3S A;  4HIM A;  4A3J G;  4LF6 L;  1AE3 A;  1Q8K A;  1N32 L;  4LNQ A;  1L1O B;  3I7F A;  4DR5 L;  4JI7 L;  4DV3 Q;  2H5X A;  5JEA J;  4DNI A;  2AWO A;  3UDI A;  3I55 A;  4LFC L;  2GVB A;  4HJ5 A;  1M90 C;  1D8L A;  1YJW A;  4R4Q A;  3G71 A;  3I4M G;  3S14 H;  4HIO A;  2PQA A;  1WOC A;  1IYJ B;  3B6Y A;  3KYH C;  2E5L Q;  3FKI G;  3EN2 A;  1VQO A;  3BZC A;  3UDG A;  2L15 A;  4DV5 L;  1YEZ A;  5IYB H;  4IJL A;  4DV2 Q;  2ZJR A;  1LYL A;  2HIX A;  3SGI A;  3TEH B;  5BR8 Q;  2YYZ A;  3E0E A;  2R7F A;  4LUV A;  3L0O A;  4AH6 A;  3KF6 B;  3M4Q A;  4B3M Q;  4YCU A;  5IYC H;  3L2P A;  4HJ8 A;  2E5L L;  1O7I A;  1Z47 A;  3KDF B;  1ASY A;  4LF7 Q;  4X62 Q;  3UE1 A;  4DV2 L;  4KHZ A;  2UXC Q;  4UPA A;  1N33 Q;  3HKZ E;  2IHE A;  3A5U A;  3E9H A;  5EAY A;  1VQP A;  5BR8 L;  2JA9 A;  4HIK A;  2OWO A;  4B3M L;  2NN6 I;  4C2M H;  4OXP A;  1C7Y A;  4A3M G;  4JBK A;  1J6Q A;  1XNQ Q;  3MEF A;  3GTM H;  1MJE A;  4LF7 L;  3JAM c;  1K73 C;  4X62 L;  4DR4 Q;  1U5K A;  4X64 Q;  3GDE A;  1KD1 C;  1QVC A;  3H3V I;  2KEN A;  5C3E G;  1HR0 Q;  2UXC L;  2CWP A;  1WCM H;  3PUW A;  4ME3 A;  1HR0 W;  1N33 L;  1X3E A;  1YHA A;  4OX9 Q;  4A3C H;  3J7Z C;  5M3F G;  1K9M C;  4P72 A;  1S72 A;  5JJK A;  1B70 B;  5H1S E;  3HOW G;  4B3S Q;  3CCV A;  2RHQ B;  2JA5 H;  1XNQ L;  2YTY A;  3PCO B;  5GAD C;  2N78 A;  3M9B A;  2HHH Q;  5J3B A;  4DR4 L;  1I6H H;  1BBU A;  4X64 L;  2Q2T A;  2PQA B;  2KCM A;  4LF8 Q;  3RLN A;  2IT1 A;  3A5Z B;  1UE1 A;  2MQH A;  5FLM H;  1FGU A;  1Q1B A;  2OTJ A;  1XNR Q;  1JE5 A;  3HOV H;  1S3O A;  4OX9 L;  2ZJQ A;  4JI5 Q;  1VQ7 A;  4POF A;  1K8A C;  3PUX A;  1CKO A;  4DAY B;  4DKA C;  1RIP A;  1SRO A;  3EIV A;  2VQE Q;  4FDB A;  4DUZ Q;  3F8T A;  5GAE C;  2E2H H;  1CSQ A;  2CKZ B;  4UP7 A;  4DUY Q;  2JA6 H;  2HHH L;  2WAQ G;  2ES2 A;  1JB7 A;  2UUB Q;  4A3E G;  4AIM A;  2BH2 A;  1I5F A;  3ICE A;  1V9P A;  2CFM A;  4MNO A;  5GQO A;  3CCS A;  2VL6 A;  4DAM A;  3PSI A;  5IYD G;  1MIU A;  1VQ9 A;  1WYD A;  1ASZ A;  2HT1 A;  1I94 Q;  4BXX H;  1AE2 A;  3S1M H;  4A3D H;  4JYA Q;  3S2D H;  2VQE L;  3I4N H;  4DV0 Q;  1K8G A;  1SRU A;  5IP9 H;  4DUZ L;  2NZO A;  2R7Z H;  2QGQ A;  4A3B G;  2B3G A;  3U4V A;  4DUY L;  1XTD A;  1KIX A;  2JK8 A;  1PH5 A;  2UUB L;  3GTQ H;  3H3V H;  4OWW B;  1U0L A;  1OXX K;  2JJQ A;  2XGT A;  3AYH B;  2AKW B;  4JI8 L;  5C3E H;  4GNX C;  1KQS A;  2Q2U A;  2VZA A;  3PUV A;  3CC2 A;  4LF9 Q;  4IPC A;  4DV6 Q;  1I50 H;  5M3F H;  2AWN A;  1EIF A;  5M5Y H;  1I94 L;  1EFW A;  4JYA L;  2JEA I;  2RHS B;  4TQU S;  4QJF A;  1VQG A;  4BBR H;  5GAG C;  4DV0 L;  1IZ6 A;  1Q1E A;  1GKH A;  2CQO A;  4UP8 A;  4PMW A;  2ZM6 Q;  1YIT A;  2EQS A;  1E3P A;  2E8G A;  2F52 A;  3HOZ H;  2WB1 G;  3H15 A;  2JA8 G;  3S16 H;  4OO1 G;  3BU2 A;  1TXY A;  2UXD Q;  1JT8 A;  3KJO A;  1HH2 P;  1BBW A;  2JEB I;  1SE8 A;  2K50 A;  4LF9 L;  3PO3 H;  1VQJ A;  2BA1 A;  4DV6 L;  4OWT B;  1X3G A;  3IRB A;  1Y1W G;  2OTL A;  1TWG H;  1WJJ A;  1XMO Q;  1G6P A;  4LW1 A;  2WP8 J;  3ERS X;  2VQF Q;  1VQ5 A;  1W2B A;  4RMF A;  5FJ8 G;  3BZK A;  2ZM6 L;  1IBK Q;  1Q81 C;  2EXD A;  3W1G A;  3OW2 A;  1KXL A;  4A3L G;  4L5R C;  2JQO A;  1VQM A;  4A3E H;  4HID A;  4IPD A;  2UXD L;  2BH8 A;  4GLA C;  3HOX G;  2BA0 A;  1PA6 A;  4QGU A;  2NVT H;  3RN2 A;  3STB C;  4DV4 Q;  2Y0S G;  1XPO A;  1EUJ A;  3TQY A;  5IYD H;  4BBS G;  1XMO L;  2R93 G;  1Q86 C;  4JI0 Q;  2VQF L;  1X56 A;  4MTN A;  4GKK Q;  4QL5 A;  1XJV A;  4AYB E;  1IBK L;  2JA7 H;  3H0G G;  4GN5 A;  5IT9 c;  3GTK H;  5LMN Q;  3CPW A;  5C0X G;  5LMN W;  2V1C C;  4O2D A;  1X6O A;  3UE0 A;  1PYB A;  4LF5 Q;  1UWV A;  2UU9 Q;  1NTG A;  1VQH A;  2HQL A;  2I5H A;  1Y1V G;  3K81 C;  2UUA Q;  4XTC S;  3DLL A;  4DV3 L;  1KRT A;  3CXC A;  4B3T Q;  4J15 A;  1VCI A;  1VQN A;  1CKM A;  3HOY H;  4R4I A;  1G51 A;  3TS2 A;  1K83 H;  2C35 B;  4WJ3 M;  4P74 A;  5LMN L;  4YHH Q;  3F2B A;  4A75 A;  3GTL H;  2JA8 H;  1QZH A;  3GO5 A;  1PH2 A;  4GN3 B;  1GM5 A;  2VUM G;  2R7D A;  1PVO A;  1Q12 A;  4QIW E;  1IXR A;  4L5S A;  5JJI A;  5M3M G;  4LF4 Q;  1S40 A;  4LFB Q;  4L5Q A;  4DR2 Q;  3A0J A;  4QY7 A;  1PH7 A;  4R4O A;  2UU9 L;  3CQZ H;  2UUC Q;  4HJ7 A;  1HZB A;  1Y1W H;  1QVF A;  1WI5 A;  3LGJ A;  3AEV A;  4B3T L;  2D0O A;  5M5W H;  3PO2 G;  2ZTC A;  4YY3 Q;  2MNA A;  3T1H Q;  4R4C A;  4A3K G;  3AFP A;  1PH1 A;  2B63 G;  3KOJ A;  4YHH L;  4A3L H;  5FLX c;  3RZO H;  1NJI C;  2I0Q A;  1NY4 A;  4JI1 Q;  1VQA A;  2LSS A;  4JBJ A;  4JCV E;  3CCM A;  1XMQ Q;  5ELO A;  4A76 A;  4LF4 L;  4KHP Q;  4DR2 L;  3CPF A;  3JC6 6;  4A3J H;  4LUO A;  2UUC L;  1TWA H;  3K7A H;  4EQ5 A;  3CCQ A;  2KBN A;  4Y7N H;  3U50 C;  2R6G A;  3T1H L;  2Y0S E;  2IHF A;  4GNX A;  3CC4 A;  4JI4 Q;  3M7N A;  3M3Y H;  4BA2 I;  2LXK A;  2WFW A;  3CCJ A;  1A63 A;  2QA4 A;  1OXT A;  3I4M H;  4YWM A;  1YNX A;  1EIY B;  4BY7 G;  2Q2I A;  4JI1 L;  3W5O A;  4DR3 Q;  3NEN A;  2UXB Q;  2I5M X;  1KL9 A;  2OQK A;  3J7A 5;  4KHP L;  3FKI H;  3J80 c;  1Y14 B;  1VQL A;  3HKS A;  1L0W A;  5IP7 G;  2OCE A;  1QZG A;  2N8N A;  1TWH H;  5LMU Q;  4IFD G;  1PV4 A;  2VNU D;  1NBW A;  1HR0 L;  1YVC A;  2MO1 A;  2KHI A;  1E7Z A;  3FP9 A;  1IBM Q;  3EBE A;  3S17 H;  3I2Z A;  1VQ4 A;  1J5E Q;  2B29 A;  4B3S L;  2UXB L;  4L5T A;  4DV7 Q;  5GRO A;  4B3R Q;  2I5L X;  4X65 Q;  4LF8 L;  3T1Y Q;  1OXV A;  1C9O A;  2DUD A;  4KLK A;  4XIG S;  3ER0 A;  4BY1 G;  4AQY Q;  3GTO H;  4IOA A;  1YZ6 A;  2GVA A;  3PUY A;  4A4I A;  1XNR L;  2NVX H;  3PO2 H;  2K14 A;  1IBM L;  2F3I A;  1W3S A;  2YTV A;  1DGS A;  2VY3 A;  4JI5 L;  3PF5 A;  4JI3 Q;  1J5E L;  1PHJ A;  1PFS A;  1X65 A;  4R1J A;  4C3I H;  4A3M H;  1YBY A;  4PG3 A;  3U4Z A;  4DV7 L;  4B3R L;  3HOU G;  3M4O H;  1HZ9 A;  5GAH C;  4X65 L;  3TRZ A;  1CKN A;  3CCU A;  3T1Y L;  4P73 A;  4DR1 Q;  4AQY L;  4JI6 Q;  3S1R H;  1C0A A;  1HZA A;  2F4V Q;  4NXM Q;  1MJC A;  3A74 A;  4NPS A;  3RR5 A;  1YHQ A;  4A93 G;  1HNZ Q;  1IL2 A;  4JI3 L;  1GO3 E;  2RF4 A;  1OXU A;  1YI2 A;  4BY7 H;  2YV5 A;  1V43 A;  4P75 A;  3HOW H;  4GNX B;  3CME A;  1YHB A;  3S24 A;  2GN5 A;  3TRE A;  2K5H A;  3RNU A;  3RZD H;  4DR6 Q;  1P16 A;  1BVS A;  3HFZ B;  5AJ3 Q;  3I56 A;  4OO1 I;  1CUK A;  4DR1 L;  4A3F G;  1JMC A;  4JI6 L;  1FL0 A;  1PYS B;  1E22 A;  4GOP C;  3Q8D A;  1PH8 A;  4NXN Q;  4QQB X;  1E1T A;  1Q7Y C;  4K0K Q;  1G29 1;  3DM3 A;  1UE7 A;  4PZ6 A;  4JOI C;  3NEL A;  3KJP A;  1HNZ L;  1VQ8 A;  4IFD J;  1HNX Q;  2ASB A;  2YTX A;  2DGY A;  3D0F A;  3CCL A;  4DR6 L;  5IYB G;  5AJ3 L;  1N34 Q;  1VQC A;  5IWA Q;  1AH9 A;  4BY1 H;  4NXN L;  3OTO Q;  1FVI A;  2WAQ E;  2D0P A;  3MXN B;  3K80 C;  4JBW A;  5HY6 A;  1D7Q A;  1IBL Q;  3CMA A;  5IYC G;  2CWA A;  4YCW A;  1GVP A;  2Z6K C;  1HNX L;  4IO9 A;  2E2J H;  4A3B H;  1E1O A;  3GTJ H;  3K7U C;  3PGZ A;  1N34 L;  4C3J H;  4RG1 A;  5C44 G;  5ELN A;  4APV A;  5C0X I;  3J81 c;  1KC8 C;  3W1B A;  5C4J H;  3OTO L;  1RL2 A;  1X3F A;  1L2F A;  4JC0 A;  1SLJ A;  4DV4 L;  1N36 Q;  1YJN A;  1CKN B;  1L1O C;  1IBL L;  3J81 j;  5C4X G;  3UDF A;  3CF5 A;  4JI0 L;  5DLQ E;  1H95 A;  3ULL A;  1KAW A;  2A1A A;  2Z0S A;  3L7Z C;  3RLO A;  3G48 A;  1SR3 A;  3AQQ A;  4DV5 Q;  1UEB A;  4IPG A;  3D31 A;  2VS1 A;  4P71 A;  1QUQ A;  1WCM G;  5M5X H;  4A3F H;  4IJH A;  4A3C G;  2ZJP A;  2WB1 E;  3NEM A;  1EQR A;  1N36 L;  4X66 Q;  4LF5 L;  1PH9 A;  1KHI A;  3FHW A;  2UUA L;  4DPG A;  2A8V A;  2PNH A;  3S1Q H;  2JA5 G;  1VS0 A;  1YJ9 A;  2NZH A;  5FJ8 H;  3K8A A;  5IY0 A;  1JJC B;  2MO0 A;  1HJP A;  3E9I A;  4OWX B;  4DR7 Q;  3RN5 A;  4C3H H;  2XTI A;  2ALY B;  3CW2 C;  2IX0 A;  5FLM G;  3JAM i;  3ULP A;  3HOV G;  1A0I A;  3HOX H;  2JE6 I;  1JJG A;  1WFQ A;  2AMC B;  4LFB L;  4X66 L;  1UE5 A;  4DK6 C;  3PV0 A;  4BBS H;  2R93 H;  1QVG A;  4JV5 Q;  1VQF A;  2PI2 E;  4YY3 L;  2JA6 G;  2RCN A;  4DR7 L;  2ZTE A;  1NMF A;  3H0G H;  1OTC A;  3J80 i;  3I4O A;  2ID0 A;  3GD7 A;  5C44 H;  4X6A H;  4LFA Q;  1NMG A;  3S2H H;  1XMQ L;  1MKH A;  3RLF A;  1VQ6 A;  2K4K A;  2PI2 A;  2R92 G;  4BXX G;  1HZC A;  2NN6 G;  4A3D G;  1TWF H;  3WWV A;  1Y1V H;  5C4X H;  5C0X J;  4HJ9 A;  5IP9 G;  3I4N G;  4IFD I;  4PZ8 A;  2R7Z G;  4JV5 L;  4A3G G;  4JI4 L;  4MZ9 A;  4OON A;  4GOP A;  2K5V A;  4JG2 A;  1Q82 C;  4JOI A;  4GN4 B;  4DR3 L;  4LFA L;  1VQK A;  4TVA B;  2VUM H;  3KFU A;  3KF8 B;  4HJA A;  3PIP A;  2NVQ H;  5M3M H;  1M1K C;  1K3R A;  2KHJ A;  4ALP A;  1XPR A;  5IE8 A;  1FJG Q;  1QUQ B;  4BBR G;  3F1Z A;  4H02 A;  5LMU L;  3STB D;  2YU9 H;  3S1N H;  1A8V A;  3CAM A;  1P8L A;  3HOZ G;  3CC7 A;  2KCT A;  1B7Y B;  4IOC A;  3F2D A;  1KRS A;  1SN8 A;  1VQE A;  4A3K H;  2B63 H;  1EWI A;  2D62 A;  2PMZ E;  3S15 H;  2Z6K A;  3PF4 A;  3PO3 G;  5K36 G;  3ZJY C;  4JI2 Q;  3CD6 A;  4KI0 A;  4POG A;  5HGQ A;  3VDY A;  1SMX A;  1EOV A;  2AHO B;  1FJG L;  4A3I G;  4UP9 A;  1Z9F A;  3ULJ A;  4DK3 C;  1N8R C;  1PH4 A;  4LUZ A;  1LM0 A;  2N49 A;  3BJU A;  2VW9 A;  1TWC H;  1PH6 A;  2IX1 A;  3GTP H;  4Y52 H;  1E24 A;  1L1O A;  1V1Q A;  5JEA G;  3G4S A;  4YCV A;  1HNW Q;  4JI8 Q;  4JI2 L;  4GS3 A;  4AYB G;  1XPU A;  2R92 H;  3NBH B;  2NVY H;  4IPH A;  5IP7 H;  3PUZ A;  3M85 A;  2JA7 G;  4A3G H;  2CCZ A;  2F4V L;  4NXM L;  3M4P A;  2QEX A;  2IY5 B;  4LWC A;  1JJ2 A;  2K5N A;  3K0X A;  4UY8 C;  1I3Q H;  1VQI A;  3PIO A;  1VQB A;  1Q46 A;  2FXQ A;  2ZTD A;  1HNW L;  2K52 A;  2Q2H A;  1B8A A;  3F2C A;  3OYY A;  4GOP B;  1X9N A;  1PH3 A;  1BKB A;  1NE3 A;  5E7N A;  1UE6 A;  4YWL A;  3KF6 A;  1N9W A;  3KLW A;  3HOY G;  4YWK A;  2ATW A;  5JJL A;  1VQD A;  2MFI A;  1OXS C;  3KDF A;  1YIJ A;  1A62 A;  4JBM A;  2OQ0 A;  4K0K L;  1LTL A;  4PZ7 A;  4WJ4 A;  4DV1 Q;  4GLX A;  1X54 A;  1R9T H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...