3PO2G

Arrested rna polymerase ii elongation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
molecule tags Transferase/dna/rna
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po2G01
3W1BA 1A0IA 5IWAL 1A62A 2XTIA 1J6QA 2BA1A 4IFDI 1VQDA 1GD7A 1Y1VH 1M90C 3CW2C 1NTGA 3AQQA 4X62L 3CQZH 4GNXC 2R7ZH 2CWAA 1YNXA 1GVPA 3M7NA 2RF4A 2ZTDA 2E2HH 3HOYH 2E5LL 2JA5G 2ID0A 3KJPA 3W1GA 4OXPA 5LMNW 3G71A 4DV7L 4A3MH 5J3BA 1CKNA 1GM5A 4LWCA 4YWKA 2I5HA 2LXJA 4BA2I 3TREA 2YU9H 4LF7Q 1YI2A 1JJ2A 3FKIH 2JEAI 4PZ8A 5IP9G 3K8AA 4Y52H 3KDFA 1YHBA 3FKIG 4P72A 3TRZA 2PI2E 3HOWH 4DV7Q 3S2HH 5M3MG 1YITA 3HOUH 4KI0A 4QY7A 3T1YL 2EXDA 1FVIA 2I0QA 3S1MH 1XMQL 4OX9L 4DV0Q 4C3HH 2IHFA 4IOAA 4OO1I 1L2FA 4JV5L 2ZM6L 1K73C 1VQGA 4B3MQ 1WYDA 2HHHL 3J7ZC 1B7YB 4IJLA 1HNWL 3KLWA 1PYSB 4GLVB 1YIJA 2ZM6Q 4LFBL 1MIUA 4L5QA 2DUDA 5GAGC 1ASZA 3U4ZA 4LUVA 3T1HQ 5IY0A 4BY1H 3D31A 1WFQA 5JJKA 1X55A 3ERSX 1DGSA 4JI4Q 2BH2A 2UU9L 1VCIA 5IYCH 3ICEA 1P16A 4DV2Q 2OQ0A 2ES2A 1LUZA 4P75A 5BR8L 1N34Q 4HIMA 3M4OH 2NVXH 2WB1G 1SLJA 2I5MX 2AMCB 4FDBA 3TQYA 1YHAA 1WOCA 3GD7A 4K0KQ 4KLKA 4OWXB 2R7DA 1I6HH 1OXXK 1HJPA 3SGIA 4A3JG 1QVGA 4IPHA 1IBMQ 5IYBG 4HJ7A 4JI0Q 4TQUS 3KFUA 4RMFA 1U5KA 4IO9A 1N9WA 2ZTEA 1YJWA 4JYAL 3S1NH 2AKWB 1FGUA 4R4TA 1VQ7A 4X65Q 2VZAA 1MJCA 4HJ9A 2NVQH 1J5EL 1NJIC 4UPAA 1N36L 2IY5B 3I55A 5AJ3L 2ALYB 4DR3Q 3HOVH 3U4VA 1H95A 3OW2A 4A3KH 5HGQA 1IBKL 2R7FA 1XNRL 4GKKQ 1X65A 1UE1A 2KENA 3K80C 3T1HL 4A75A 1R9TH 1XMQQ 1KD1C 4LF8Q 1JE5A 3J80c 1TWFH 5C4JH 1Q86C 2UXBL 1IL2A 3AEVA 3U58A 1SRUA 4DUZL 1VQJA 4R4CA 4DNIA 3UDGA 3RZDH 1OXUA 4DUYL 4X64L 2QA4A 4GN5A 4A3MG 3S2DH 3CAMA 3KOJA 2PQAA 2QEXA 2VUMH 1SMXA 1L0WA 3JAMc 4GN3B 4LF8L 4MZ9A 5LMNQ 3I4MG 3S16H 3S17H 1AE2A 2WAQE 3RLFA 1Y1VG 2WAQG 1Q1EA 1UE5A 1KHIA 1HR0Q 4ME3A 4RG1A 3CCMA 1S3OA 4JI8Q 2JA7G 2CWPA 4KHPL 1YHQA 2UXCL 4A3CH 3D0FA 1HNZQ 2UUCL 3NBHB 1VQ4A 1IYJB 3HKZG 1B8AA 2DGYA 2WB1E 5E7NA 2A8VA 2ZTCA 3CCVA 4A3LH 3PGZA 3H3VH 1PV4A 5ELNA 1SN8A 3A5UA 1VQMA 1WCMG 5BR8Q 1N34L 1K8AC 1WCMH 1Q12A 4LUOA 4XIGS 3F2BA 1I94Q 1HNWQ 1N36Q 4A3BH 1G291 1N32Q 2E2JH 3CCQA 4A4IA 4DR1L 4K0KL 3CCSA 4DR6Q 1NMGA 4BXXG 1NMFA 3S1RH 1PA6A 5IT9c 1VQOA 2PI2A 2IT1A 4HJAA 3IRBA 2RCNA 2Z6KC 4JBKA 1QVFA 2AHOB 1EWIA 1HNXL 2R92G 1EFWA 4NXNQ 1YJ9A 5IYDG 1VQFA 4J15A 1IZ6A 1VQEA 4IOCA 1N8RC 2JA6H 3GTMH 4GNXB 5GADC 3M85A 1VQKA 1FL0A 3KJOA 1VQCA 4DKAC 1XPUA 2E8GA 1JT8A 1YEZA 3CCJA 4NXNL 4DV6Q 3CXCA 1Q1BA 1Z9FA 1XPRA 4DV5Q 1IBLL 4NPSA 1L1OB 1FJGL 4BBRH 2YYZA 5LMUL 3CCEA 4DV4L 1NBWA 4B3RQ 3TEHB 3UDFA 2F4VQ 3GTOH 4B3TQ 2Z6KA 3ULPA 4KHPQ 1SROA 4P74A 2UXCQ 2UUBL 1VQHA 1HZAA 3GTKH 3CF5A 1VQAA 1Q81C 3OTOQ 5DLQE 4DK6C 4HIOA 4DV5L 2OWOA 2ASBA 3UE1A 3KDFB 2OQKA 2Q2HA 1PH8A 3CP0A 4R1JA 2IHEA 3J80i 3U50C 4DV0L 3MXNB 1W2BA 1Q7YC 2JA5H 1TWCH 1UE7A 4A3DH 4OWTB 1MKHA 1IXRA 1UE6A 4L5TA 4ALPA 1QZGA 2UUBQ 3PO2H 3FHWA 5C3EH 1PH5A 4EQ5A 4AQYL 2N3SA 1EIYB 2ZJRA 5IYBH 1YVCA 4JYAQ 4HJ5A 1XNQQ 2LSSA 2JE6I 2Y0SG 1CUKA 2YTVA 3BZKA 4UP9A 5GQOA 4OX9Q 1G51A 2R93H 1VQLA 1E1OA 3M4QA 1HNZL 2UUCQ 2ATWA 4DUYQ 2R6GA 5FJ8H 3I4OA 3RNUA 3KF6B 3S24A 4JI6Q 1VQNA 4YWMA 1I94L 1N32L 1LYLA 3PUYA 4DR4L 2KHIA 3M9BA 3J81c 1C0AA 1E7ZA 1SFOH 2UXDL 1HZCA 4YHHQ 1Y14B 4DR6L 3HOZH 1XMOL 3A5ZB 3KYHC 4A3DG 2MO1A 2PQAB 4R4OA 4DR5Q 5AJ3Q 1J5EQ 2NN6G 1PH6A 3PUXA 2KCTA 3PF4A 3L7ZC 4A3CG 2CCZA 2Q2IA 5FLMG 1HR0L 1HH2P 2PMZE 4YHHL 4JI3L 2F3IA 3F2CA 4DV6L 1Q8KA 4XTCS 1K83H 3K0XA 4GLAC 1KQSA 4X64Q 3PO3H 1Q46A 2FXQA 4A93H 1VQ9A 2K5NA 3W5OA 1BBUA 1JJCB 4IFDJ 3PUZA 3GTPH 1PH2A 1HNXQ 3ULLA 3G48A 1QZHA 2Y0SE 4BBSH 2NZOA 1K9MC 4JI0L 4QQBX 2N49A 4LW1A 1I5FA 1A8VA 4GS3A 4TVAB 1K0RA 3AYHB 4HIKA 1QUQB 3H0GG 4JBJA 1Y1WH 3CC4A 4GLXA 1K3RA 1PFSA 1LTLA 2UXBQ 4YY3L 2E5LQ 4WJ3M 3B6YA 4JOIC 2KBNA 1KAWA 3S14H 3HOYG 1O7IA 4GKKL 4A93G 1UWVA 2RHQB 1TWGH 2H5XA 1E24A 2HQLA 1UEBA 1X54A 1WI5A 1X6OA 3DM3A 3K7AH 4UP7A 3EN2A 2B63H 3I4NH 1HZ9A 1AH9A 2VQFL 3RN5A 3PO3G 4A3FH 2B29A 4JBWA 3JAMi 3GO5A 5LMUQ 3CC7A 2Q2TA 2HIXA 2VQEQ 1GKHA 4YCWA 1X3EA 4DV1Q 2BH8A 4IJHA 4EX5A 1M1KC 1EQQA 3TS2A 4MNOA 1C9OA 3PUVA 2WP8J 4BXXH 1D7QA 1X3GA 3NENA 4LF4Q 5FLXc 2VUMG 2N78A 5IP7G 4LF9Q 3A0JA 4A3BG 5K36G 4JI2Q 3HOXH 3ULJA 1OXSC 1Q82C 1P8LA 2LXKA 1OTCA 3AFQA 1L1OC 2V1CC 2K5HA 1YJNA 4GOPC 1X3FA 2JK8A 2E2IH 4LF5L 4AYBG 3GTGH 4A3LG 4DR7Q 4JOIA 3UDIA 5C0XI 4PZ6A 4P71A 4B3TL 1Y1WG 3J81j 2F4VL 1YZ6A 1X56A 2I5LX 2YTYA 2GVAA 3OYYA 1EYGA 5GROA 4A3KG 3S1QH 1G6PA 4JI4L 1WJJA 5JEAJ 3HKZE 4H02A 4BBSG 4X62Q 4LUZA 3PCOB 4A3IH 3HOVG 4JV5Q 2R93G 5C4XG 3GTLH 1PH1A 2IX1A 5GAEC 2JEBI 1X9NA 3BZCA 1EQRA 1CSQA 3BJUA 4LFCL 4JI7L 1TXYA 2CFMA 4OWWB 4A3JH 4JI3Q 4YCVA 1OXVA 3HOWG 5M3FH 3JC66 2R92H 1IBML 2JJQA 2K50A 1PHJA 2ZJQA 4JG2A 2VS1A 4LFCQ 4JI8L 4Y7NH 3F8TA 4X6AH 1LM0A 2GVBA 4DV4Q 5C0XJ 4O0AA 3CCUA 2RHSB 1I50H 1L1OA 4B3RL 4JI1L 4GOPA 2PNHA 1V43A 3STBC 3L2PA 4DV3Q 4JBMA 1EIFA 3E9HA 3HOXG 2OCEA 5C44H 5IP7H 4DPGA 4LF7L 3PIPA 2R7ZG 1D8LA 3ER0A 4BY1G 1VQPA 3EBEA 3F2DA 1QVCA 4QL5A 1NY4A 4GKJQ 2F52A 2NZHA 1RL2A 1PYBA 4BA1I 4OO1G 2JA6G 1VQ6A 1IBLQ 1FJGQ 2A19A 2L15A 3RN2A 1SE8A 1T9HA 4X66Q 3HKSA 1PH4A 1ASYA 3KF6A 2YV5A 5M5XH 5IWAQ 3CMEA 1MJEA 1V1QA 2B63G 3J81i 5IE8A 2UU9Q 3PO2G 2OTJA 3F1ZA 2BA0A 4JI7Q 1PVOA 3CPFA 4POGA 2AWOA 4DR7L 4A3IG 3KF8B 4AIMA 2HT1A 2VY3A 1A63A 3H15A 2NVYH 3ZJYC 3CMAA 4AYBE 1EOVA 5M5YH 5IP9H 1B70B 4GOPB 4UY8C 1XMOQ 3GDEA 3PV0A 1W3SA 4LNQA 4L5RC 2Z0SA 4BY7H 1KRTA 2CQOA 3UE0A 4DV1L 4APVA 1XTDA 2UUAL 4LFAL 3I4MH 1KRSA 1N33Q 4DV2L 1E1TA 4JI6L 2AWNA 2EIFA 2VL6A 1Z47A 2MO0A 1CKNB 4MTNA 1NE3A 1PH7A 2VQFQ 3VDYA 4PG3A 4BY7G 5C4XH 4NXMQ 4NB3A 2K52A 3G4SA 1N33L 2GN5A 4R4IA 4R4QA 4LFAQ 3I56A 5GAHC 2UUAQ 3J7A5 4IPGA 4PMWA 2VQEL 3NEMA 4WJ4A 5IYDH 1U0LA 1HR0W 1YBYA 2C35B 4IPDA 4JI1Q 2A1AA 4B3SQ 4A3FG 4O2DA 4C3IH 3G6EA 2VW9A 1BBWA 4OONA 4JI5L 1C7YA 3H3VI 2XGTA 2K75A 4X65L 3HOZG 3I4NG 2JA9A 4GKJL 5C0XG 1HZBA 3PUWA 2NVTH 5IYCG 2NN6I 3GTQH 1VS0A 4B3SL 1KIXA 3CCRA 4LF5Q 5LMNL 3DLLA 3CPWA 1SR3A 1V9PA 2YTXA 1IBKQ 1VQIA 4UP8A 2N8NA 4DR2L 3AFPA 2K4KA 3EIVA 5FJ8G 2HHHQ 4JI5Q 4LF6Q 3RZOH 3I7FA 4DR5L 1BVSA 4B3ML 1OXTA 3I2ZA 3A74A 3PIOA 2D0OA 3STBD 5M3FG 2JA7H 4YCUA 2ZJPA 5H1SE 1S72A 3PSIA 4LF9L 3PF5A 1CSPA 4A3EG 1PH9A 3E9IA 4YY3Q 1TWHH 2QGQA 4JCVE 5M5WH 5C3EG 1XPOA 1XNQL 3S15H 5C44G 1PH3A 1CKOA 4GN4B 1VQ8A 3K7UC 5JJIA 1E3PA 2JQOA 5JEAG 3K81C 4DAYB 3MEFA 1CKMA 2JA8G 3LGJA 4JC0A 5M3MH 3HOUG 1GO3E 2MFIA 4A3GG 1JJGA 4X66L 2VNUD 1K8GA 1AE3A 1VQ5A 1KC8C 4JI2L 3FP9A 3M4PA 3RLNA 3RR5A 3UDXA 1EUJA 2OTLA 4DR4Q 4DR3L 4AQYQ 2Q2UA 3H0GH 3Q8DA 4AH6A 1JMCA 1I3QH 5EAYA 4A76A 3TS0A 4GNXA 2B3GA 3NELA 4L5SA 2WFWA 3RLOA 3BU2A 1E22A 4A3GH 5JJLA 2HIVA 2K14A 4QIWE 3WWVA 4BBRG 3CCLA 1KL9A 1VQBA 4P73A 2CKZB 3T1YQ 2MNAA 4IFDG 4PZ7A 1JB7A 2D62A 5ELOA 1S40A 3GTJH 2IX0A 4QGUA 4QJFA 4IPCA 4DK3C 5FLMH 3CD6A 4DAMA 1RIPA 2UXDQ 4HJ8A 4KHZA 4DV3L 4POFA 4LFBQ 3M3YH 2D0PA 4DR1Q 2JA8H 4DUZQ 4HIDA 4LF4L 4DR2Q 4LF6L 1QUQA 1BKBA 3HFZB 5HY6A 4C2MH 4A3EH 1TWAH 4YWLA 1XNRQ 3OTOL 3L0OA 3E0EA 1XJVA 1KXLA 4NXML 4C3JH 3CC2A 2MQHA 2K5VA 2KCMA 2EQSA 2KHJA
chains in the Genus database with same CATH superfamily
1K8MA 2MUYA 1JX4A 4K5WA 2SCUB 2E76C 4C3JG 5CC4A 1OWTA 3JAME 2LKVA 1J6QA 5A2QL 4IFDI 1VQDA 1GD7A 1Y1VH 4PMCA 5J2TF 3GTPA 3DM1A 1KJQA 3BYYB 2CWAA 1JOOA 5IGDA 2ZTDA 5CV6A 2JA5G 4OXPA 2V4DA 3G71A 2F0WA 3R2TA 2XIWA 4A3MH 4LWCA 4YWKA 2I5HA 2LXJA 4CDFC 2AQ1B 3GQBA 1C48A 4MN3A 3KDFA 3SHLA 4QW9A 4DF7A 4GKKH 3BYTB 3RBEA 3TRZA 2CVRA 2PI2E 2NZ1D 3HOWH 1K1SA 2W57A 2F0EA 1NUCA 3HOUH 4Z9CB 4KI0A 3S2HB 2F0LA 3MVVA 5LOVF 5KFAA 2I0QA 4DV0Q 4OO1I 1L2FA 3PW0A 2G9DA 5DAUA 5J22A 2EOTA 2F1MA 1AEXA 2PQEA 3LWEA 1SAPA 1K73C 1DV1A 4B3MQ 1WYDA 5CV4A 5LL6b 2JA8B 1HNWL 1BDOA 4I4TF 1G2TA 1EQTA 2PW5A 3T56B 4LFBL 1ASZA 1A3TA 3I90A 4J9KA 2VQDA 3MTSA 4BY1H 1WFQA 3ERSX 1V4YA 4ECWA 4ECUA 2C5CA 1KEEA 1I50A 4NDXA 1P16A 1IYUA 4PMBA 2LFNA 5FLXL 1LUZA 4RGNA 4HIMA 1EYAA 2YW2A 4DR6H 1TKWB 5LXTF 4XT3B 2I5MX 4QWAA 5IIFA 4FDBA 4RHRA 1F2YA 4QIWB 4MV6A 2ASJA 4CKEA 4KLKA 4OWXB 4CC5A 2R7DA 1ILQA 2L55A 1B9NA 5A2QE 4RKLA 4ZYSA 4EGQA 4JI0Q 3QIAA 3KFUA 2FK1A 4JI6H 5KFSA 1DYQA 1LTAD 1Z7TA 1N9WA 2EXZA 1HHVA 1WR2A 4YQWA 3OMCA 4KKUA 4R4TA 2PBZA 2W6ZA 4X65Q 2VZAA 3FDSA 1J5EL 2IY5B 3RAQA 5AJ3L 2C9OA 2YZMA 1XNRL 2B2YA 4GKKQ 1EL0A 1UE1A 4G4KA 4F4YA 4TRDA 1CHQD 1Q3LA 4A75A 1LACA 1XMQQ 1W93A 2UXBL 3GV6A 4L63B 1RJQA 1CK1A 2KECA 3BJYA 4GN5A 1X3QA 3OHXC 4GN3B 3BDOA 1RKNA 5C1PA 2FKLA 2NBFA 4DFAA 4B3MH 3RLFA 1BNCA 1Y1VG 1Q1EA 3SE0A 3SEBA 1HR0Q 3D8GA 1CT1D 3CCMA 1WSCA 3BQ0A 4JI8Q 1EIHA 2CWPA 5BPFA 2B2WA 5K2MA 4A3CH 3D0FA 3X3MA 2EYLA 1HNZQ 2UUCL 3K5NA 1VQ4A 2OEOA 2WB1E 2DGYA 1SYFA 1WTQA 1JR0D 4Y8VB 3GIMA 2HUGA 2WB1A 3JAMW 3A5UA 1VQMA 3VMMA 1K8AC 4XZ3B 5IGBA 2N55A 3CCQA 1CQJB 4DR6Q 3NQTA 1NMGA 5KNBA 4Q0YA 3TBIB 5CA0F 2IT1A 4HJAA 2WKCA 1VBHA 5IODA 5LMUH 2WE6A 5IYDG 4J15A 4K5XA 5I6WA 3T51B 5KFQA 3GTMH 4DNTB 2K28A 4O4IF 4LSXA 1UNSA 2E8GA 1LTRD 4IUQA 3CCJA 4C1NI 4DV6Q 1SNOA 3T5HA 1Q1BA 3DEPA 3V4ZA 1ZHSA 4H7BA 1XPRA 4DV5Q 2A73B 4NPSA 4LF9H 3QFFA 3RB3A 2EYMA 4MTEA 1HZAA 1CZWA 4QWEA 1QILA 3BS1A 5EBCA 3CF5A 2WB1B 5DLQE 2OWOA 1TWAB 2NU8B 2E5LH 4TSSA 1PH8A 1B2TA 2SNSA 1BCPC 3OSPA 4DV0L 1W2BA 3CU7A 2R7LA 3EA6A 1I4GA 4OWTB 2AGOA 4PNYA 1TA8A 5C3EH 1PH5A 4AQYL 1EIYB 4JYAQ 4TKOB 1J5EH 1QJOA 1CUKA 3BZKA 4LH6A 4MA0A 2R93H 3IN5A 4YBZB 2UXCH 1I3QB 4FBUA 3HZXA 5KFLA 4KY5A 1N56A 1E4EA 4RCNA 4UHVA 5IT9L 5F9NA 1SMYD 4CC6A 4YWMA 1ZYRC 1N32L 4KD4A 1PRTB 3RV4A 4KKSA 2KHIA 5ELCA 1C0AA 4F4ZA 1SFOH 2CH4W 4JW0A 5KFDA 1GUNA 2QW7A 4DV3H 3HOZH 4A3DG 4IR9A 2MO1A 2PQAB 5LL6X 5AJ3Q 2NN6G 1PH6A 1TS4A 2K5DA 1M0TA 1KNEA 1S5FD 4HMJA 2UUCH 2AQ4A 1GXDC 5D1OA 4QUCA 4RZRA 4TQSA 3F2CA 3FPPA 4XX0B 2P5ZX 1JXLA 3K0XA 3IFDA 4X64Q 3PO3H 2R93A 5KG0A 3DWAA 1BBUA 1FNUA 3I70A 4M8AA 3CQZA 1Q8IA 1JC7A 5G3LF 4J9MA 2R7ZA 1SYXB 3M9NB 4DR5H 3PR4A 4TVAB 4LSAA 1SYGA 3RMHA 1S5ED 3CC4A 1Z2OX 2GLTA 4DK1A 4MV9A 2UXBQ 1H9SA 4CKCA 2E5LQ 1SSOA 3NWSA 2B2TA 2VB3X 2NVXB 2KBNA 3MFYA 5BR8H 3HOYG 4DK0A 1O7IA 4GKKL 1EU4A 1UWVA 3K7AH 3DM3A 1UEBA 3R5XA 4YJ2F 2KQ3A 2WDTA 4MAMA 1N33H 2FPGB 3PO3G 3GTLA 1KJJA 3WOEA 1JB3A 3JAMi 3GO5A 4LF8H 1QOHA 3CRKC 2P0AA 5KFZA 3IFTA 5KYIA 2VQEQ 3BAAA 1FYCA 2UUAH 4YCWA 2R6FA 3NWTA 4ZI7F 1PRTF 1D7QA 1E2WA 4LF4Q 4B3SH 3LWBA 3S1MB 2B8FA 3GQCA 4QWBA 4C3HB 4MV1A 2ZT9C 2CZGA 4G3IA 5ELDA 2PZUA 4LF5L 1L1OC 2K5HA 3PR5B 4GOPC 1RJRA 1ZETA 4AYBG 4IRKA 4JOIA 1S03G 3J81j 2XCPA 2I5LX 1D5ZC 5GROA 3RUPA 5JEAJ 1ZYRD 3HKZE 3KK7A 4RFBA 4X62Q 1C4QA 4LUZA 4JV5Q 1BJTA 2NVXA 4O2AF 3HKZA 2IX1A 3NTHA 5GAEC 2JEBI 3TIGA 3RZDB 3PN1A 4UFZA 4LFCL 4JI7L 1A9XA 1C3OA 4OWWB 2D5DA 1A3VA 4UCUA 4RAZA 4BWSC 5KG2A 1OXVA 3HOWG 1PTOB 2K50A 4DL7A 4LFCQ 4TQRA 5C3EB 1MSHA 2GVBA 4B3RL 2ASLA 2JP1A 2QYZA 2RHSB 4JI1L 4GOPA 1V43A 2QF7A 4FVMA 3L2PA 1WVLA 1HRJA 5KG5A 4DPGA 1EQVA 5KYLA 5DG8A 1TVXA 3UQ8A 4IHJF 2IW3A 3EBEA 3CRLC 2F52A 1PZID 1PYBA 3VYRA 4J9RA 5EZYF 1FJGQ 3RN2A 1JICA 3GTPB 3C0FB 4X66Q 1HTLD 3GP7A 3HKSA 3NBHA 2HVRA 4C5BA 2QK4A 5TSSA 1MJEA 1V1QA 3M4IA 3J81i 4ZUJA 4JI7Q 4CGYB 1PVOA 5EOYA 4POGA 2AWOA 4HN7A 3S2DB 4AYBA 1OO9B 2VQFH 3E0JA 3SXHA 3TP5A 1RF2D 1A63A 1DOLA 4QW8A 3GTQA 1EOVA 5M5YH 2NU7B 1DD2A 4FO2A 4MV8A 1XMOQ 3LX0A 1ZQ7A 4LNQA 4L5RC 2RSOA 1BNZA 4BY7H 3NSWA 1KABA 2K1BA 1JKJB 4LFAL 4Q8EA 1N48A 1KRSA 5M5WB 5DQHA 4EBCA 2AWNA 2EIFA 2YRWA 1Z47A 1HFGA 5DM63 4BY7G 5I47A 2IWHA 1S5BD 1PTOF 3G4SA 2GN5A 3LMLA 3PW7A 1JLLB 4ETSA 2VQEL 3KF8A 2LY7A 1U0LA 2HD3A 4OL7A 4O2DA 3G6EA 4OONA 2B2UA 4RAUC 2WINB 3I4NG 2JA9A 3T16A 4J0MA 5KFPA 2BQUA 5IYCG 2NN6I 3GTQH 1VS0A 4TV9F 2ASDA 3RF2A 1BQQT 3GIIA 5LMNL 5E3FA 2YTXA 5CB4F 1IBKQ 2N8NA 3DHQA 4QB4A 1E2VA 1RK5A 1BVSA 2HGSA 5FO9B 3A55A 1OXTA 3PVXA 1LT6D 3A74A 2D0OA 2WYOA 1LT4D 3PF5A 1B6SA 3M4YA 3KAJA 2X6LA 1BGWA 3S15H 4YY3Q 1XNQL 2V4QA 4IFDH 2X69A 1PH3A 4GN4B 5CV8A 2F0JA 3K7UC 1E3PA 2JQOA 3K81C 4IAJA 4I7ZC 4DAYB 4LMYA 5E4WC 5JVLA 5M3MH 2MFIA 1SNPA 3S14B 2R7ZB 1RJTA 1KC8C 1VQ5A 2C2EA 3M4PA 1H9KA 3RR5A 4MV7A 4DR4Q 2Q2UA 4AQYQ 1XMOH 1GSHA 3RFCA 4A76A 2JA6B 3V96A 4LFBH 4RU9A 2WFWA 1BOSA 5JJLA 4ED6A 1KL9A 1I4PA 1VQBA 4P73A 2CKZB 5JAVA 4FF1A 2CQAA 1SNCA 3GILA 5J1ZA 1TWFB 4IFDG 4OELB 5KFKA 3K5HA 1A6XA 1JB7A 2X6GA 2A6ED 2XSCA 1A15A 3GTOB 2FMCA 5JOBA 1K28A 5AFWA 5CBEE 5KG6A 2CQYA 1IKLA 1Z2NX 4LH7A 2NYZD 4DAMA 1F9RA 3SVMA 4IRDA 3D3RA 4LMQD 1TS5A 3RAXA 1DZ1A 3M3YH 3L4JA 2R8HA 2GPSA 4DR1Q 4DR2Q 5EWEA 1CI3M 1BKBA 4RNNA 2QDLA 1PRTD 3BDLA 3E5SA 5DQIA 4A3EH 1D1IA 1TWAH 4YWLA 4K14A 4ZKBB 1N34H 2MP1A 4PWQA 4DV4H 3V4SA 3FDTA 1I4QA 4IQZA 4MA5A 4C3JH 5J39A 2HDLA 3CC2A 2MQHA 2PNRC 5F9LA 4OO1H 4RAYA 5KFMA 1A0IA 1A62A 1EEFD 1FD7D 4O3RA 3S1RB 3CW2C 1NTGA 3ETJA 5KG7A 3CQZH 1S9FA 4E6IA 1M8AA 1ZXTA 5FPOA 4J9QA 5DNFA 2E5LL 3HOZB 3W1GA 1GM5A 1CKNA 5I6YA 5FLXE 1JOQA 3Q2OA 2UUBH 2W6MA 4ULLA 1KJIA 4I7HA 4EFEA 3N42B 4PZ8A 5IP9G 3K8AA 2XWJB 1LTGD 2NN6H 4P72A 2WKDA 2F4IA 1YITA 2I46A 4QY7A 4LF5H 1A2UA 3D6WA 3T1YL 2EXDA 3HOXB 4OX9L 2NU6B 2ZM6L 3C2PA 5DGBA 1MBYA 4V0BA 4FS2A 4IJLA 4N8X1 5EPLA 4CBVA 4EG0A 3LP8A 1H9RA 3ORQA 2ZM6Q 3RTXA 4L5QA 4Q43A 2FINB 1M6VA 4ME6A 2R92A 1HQRD 3UI2A 1GGOA 4UCTA 3QG1A 1X55A 3F8NA 2R8IA 1DGSA 3K7AB 4GC7A 3RB0A 3RB6A 2BH2A 2UU9L 5IYCH 2JN4A 2W9AA 4L1KA 3ICEA 1TS2A 2Q8TA 3R8BA 4XXEA 1N34Q 1TQOA 1G8ZD 1J8IA 3JSLA 1ENFA 2NVXH 1IOVA 2AGQA 4JYAH 5CORA 2CW8A 2NUCA 2M05A 4IWYA 3GD7A 3RB4A 3DUZA 3TSSA 1OXXK 4OGQC 4RH6A 3JAML 5IYBG 4J8QA 4C3HG 1XTCD 4JV2A 1FGUA 1SDFA 4KKTA 1VQ7A 4HJ9A 5JQWA 1BBXC 1RJPA 2SDFA 5E4XA 3WDNA 2NVTB 5D14A 2PMZB 2K01A 2ZXPA 3SK4A 2B2WC 5C3XA 4EGJA 1Q86C 1TWFH 3OWEB 3J7YW 1NR4A 1PTOD 3AEVA 3TQTA 1SRUA 2F0OA 3GIJA 1VQJA 4DNIA 3UDGA 4C3JB 3I12A 1OXUA 2A6HD 4DUYL 1B9MA 1HNWH 2PQAA 2PYKA 5EQ0A 3K59A 2VUMH 4QIWA 3PMFA 1ESRA 1WH2A 3H4DA 5C4HA 2EYOA 3P7JA 4MZ9A 3S17H 4DGZA 1AE2A 1TIID 2KVMA 2H1EA 1UE5A 2JA5B 2HVSA 2AU0A 2XRQD 5FPRA 3ND9A 3D4RA 2JA7G 2ZM6H 3IKJA 4KHPL 2F0DA 4B9XA 1QNUA 3WOFA 1IOWA 1JIHA 4QWDA 2F0KA 3CCVA 4IN3A 3PGZA 3FRPB 3DXJC 1ZEQX 5DLFA 5C44B 1SN8A 2IPKD 3SK6A 3JZIA 1WCMG 5BR8Q 5FLXW 1WCMH 1I94Q 2G5DA 4A3BH 2ICIA 1G291 2DPIA 4UAIA 3HOUB 2F0HA 1KJ8A 4DR1L 4K0KL 1MZBA 2JA5A 1NMFA 3S1RH 5IT9c 2B8GA 2L4NA 3H6MA 5COYA 1V51A 3G8CA 1S10A 4WRDA 2FMMA 1QVFA 3JRWA 4JI8H 4NXNQ 1YJ9A 1VQFA 1IZ6A 1VQEA 1VDZA 4GNXB 1VQKA 2W9BA 1FL0A 1VQCA 2VB2X 5ELBA 4DKAC 1JT8A 2EYHA 4NXNL 4R8UB 1AZPA 1FJGL 1K83B 1HNXH 3GTLB 1LTBD 4DV4L 3TEHB 3UDFA 2F4VQ 1I6UA 1IHZA 4B3TQ 4KHPQ 1SROA 4P74A 4Q45A 1VQHA 4DUYH 1B4OA 3K0YA 3OTOQ 2XD4A 4HIOA 4DV5L 2ASBA 3UE1A 1H9SB 2Q2HA 3QJYA 3U50C 4LF9L 5CV5A 4A3DH 2C00A 2K7VA 4DAVA 1UE7A 1FNWA 1MKHA 4ALPA 3URYA 3PO2H 4TUYF 3FHWA 3KBXA 4EQ5A 5KG1A 3EPGA 3VR3A 4BY7B 1XNQQ 3CQZB 5KT5A 3IAYA 2Y0SG 3MFGA 4QMGA 2KSWA 3M4QA 2R93B 2ATWA 3GLKA 4UCSA 3WO1A 2F0IA 4ED0A 3FEWX 5FJ8H 2FK2A 2I80A 1VQNA 3BQ2A 4ED2A 3G6JB 2HCIA 2R86A 5DM73 4DL6A 3NK9A 2UXDL 1HZCA 2O03A 2V5AA 4YHHQ 1Y14B 3A5ZB 5KFFA 3HEJA 1J5EQ 4ED8A 2KCTA 3L7ZC 2F0MA 3QOLA 2YU9B 4XYLB 2CCZA 5EDWA 2Q2IA 2B63A 4ILWA 5FLMG 1HR0L 2EY2A 5KT7A 2PMZE 1RCVD 2LMCB 2VA2A 1KBLA 2F3IA 1HA5A 1S5DD 4XTCS 3VA5A 4GLAC 5DG9A 3I8ZA 3NXWA 1KQSA 2KCNA 1VQ9A 1RYSA 1BXRA 2EJMA 4IFDJ 1Y1VA 3A7LA 1LT5D 3PUZA 5KFUA 1HNXQ 1NCVA 3G48A 3ULLA 2Y0SE 1HTPA 2NZOA 1QZHA 4JI0L 4QQBX 2F4VH 4K0KH 4JI3H 4GS3A 1K0RA 4HIKA 1QUQB 4JV0A 1Y1WH 3T5LA 1LTTD 4YY3L 4WJ3M 4MTDA 4EQPA 5KIXA 2K6AA 1KAWA 5A35A 3S14H 4ECQA 4FF3A 4UCRA 5L1JA 1N36H 3MWEA 2H5XA 1E24A 2BE5C 2HQLA 5J3BA 4UP7A 2B63H 2KJXA 4C3IB 1SEBD 1I50B 1XNQH 4WJWA 4A3FH 4ZCKA 1MI2A 2B29A 1LLRD 3R23A 4ZHQF 5JPNC 2EY1A 5KGUA 2HIXA 2L5TA 3BDCA 2F0SA 4ECVA 3R2IA 3FVQA 2FHTA 3I4LA 4MNOA 4OIJA 1C9OA 3PUVA 4YAKB 3T5KA 1X3GA 1K8OA 1EHIA 5KFJA 2QCPX 1CA5A 3H94A 4YHHH 3RJ0A 3ULJA 1OXSC 4RB3C 3MZ5A 1W96A 3M9MB 1F9PA 1SNQA 1SYCA 2JK8A 3NHHA 3GTGH 2ZDGA 4A3LG 5KFCA 1ET9A 5C0XI 1A3UA 2OF1A 1QE6A 4B3TL 1VKZA 3T53B 3EYYA 3MJFA 2NWGA 1X56A 2YTYA 4RGMA 2IJ0A 1G6PA 4JI4L 3N52A 4RB0A 4BBSG 3HOVG 3HRZC 2ZDQA 1QB5D 4KY7A 3K6OA 1N32H 1PTOC 2EVBA 4G7OC 4UDUC 1TWGB 5EGTA 2Y0SA 1EQRA 5D3DA 4RGOS 1D2BA 2AQ2B 2DN8A 4OX9H 4A3JH 4JI3Q 2V59A 4YCVA 5M3FB 4JUZA 5KFOA 2R92H 1IBML 4A3DB 4UCOA 1MD2D 1Y8OB 2EJFC 4Y7NH 5C5JA 3C1FA 5C0XJ 4E4TA 3GTGA 3UFXB 4HSVA 1RK6A 1EIFA 3E9HA 3QB3A 3HOXG 3J7AF 3MFIA 2QEJC 3HS0C 3DWPA 2ICEC 1QVCA 4QL5A 4GKJQ 2RQXA 1RL2A 4BA1I 1VQ6A 1E4GT 4K5VA 2R8GA 2A19A 2Z8LA 2I87A 1SE8A 2L12A 1O7LA 1T9HA 4ODGA 5CR3A 4O4LF 2YV5A 3AB9A 5IWAQ 5BN4A 1I4RA 2G9HD 4KJOA 5IE8A 4MV3A 2BA0A 3BQ1A 4LK1C 2RCFA 4DR1H 4DR7L 1YNJC 2EJGC 4DR2H 4A3IG 3KF8B 2HT1A 2VY3A 4K8IA 3H15A 5A2QW 3ZJYC 5CAEB 3P20A 3PIP3 3MXGA 2BDOA 2YZGA 2B2TC 5IP9H 3PO3B 4GOPB 4R7RA 1FJGH 3OPOA 1W3SA 2Z0SA 5G3LD 5KFHA 4DV1L 4X66H 3T13A 2XC9A 4JI7H 2I8CA 4O3PA 4IUUA 2EZVA 2BQRA 1CKNB 3FPUB 2FPIB 2XIGA 4O1NA 2FLPA 3K5OA 1PH7A 2VQFQ 3VDYA 4PG3A 4WFN3 5C4XH 5CA1F 4I50F 1B53A 1LTSD 1HXYD 3J7A5 4LFAQ 2E2DC 1ICWA 3SE7A 2XN9C 1U4PA 1F9SA 1HR0W 1YBYA 4DLKA 4C3IH 4CKBA 4R8IA 1WCMA 4JI5L 1C7YA 3H3VI 2NVYA 2O5IC 1DJRD 1HZBA 2NVTH 3H0GA 2HDMA 3KALA 4HQ6A 5JPMC 3CCRA 4LF5Q 4GKJH 1V9PA 4JI0H 4KN7C 4UP8A 2EE1A 4LF6Q 3AFPA 2K4KA 3I72A 4JI5Q 2HHHQ 3I7FA 4DR5L 2DY7A 4HNVA 1ENCA 1PRTC 3I2ZA 1B6RA 2JA7B 3OSOA 2JA7H 4YCUA 4K2KA 4RHSA 1CSPA 2DWCA 1PH9A 2XWBB 2NVYB 1TWHH 5C3EG 4A93G 5HGTA 3GIDA 5JJIA 5C44G 1XMQH 1WCMB 3GTOA 3T1YH 2C2RA 5LP6F 2V4RA 4RB2C 2YL2A 1STAA 2DJFC 4JC0A 1GO3E 3EVQA 3HOUG 4Q44A 1IBKH 4X66L 4IUVA 4IZOA 4QWCA 2A6EC 1AE3A 4OIKA 2HVQA 4DV1H 1GUSA 3UDXA 2UXDH 4RB1A 4AH6A 4HR7A 1I3QH 1STNA 1JWMD 3VA7A 4FU0A 3NELA 2BDNA 2MJ8A 3BU2A 3OW7A 1F9QA 1Z6HA 4JPBW 2C28A 1X32A 1HNZH 1M4VA 1MSGA 2VA3A 1S5CD 3GTJH 2O4XA 2IX0A 3KLSX 1G2SA 4QJFA 5FLMH 4AQYH 1RIPA 2ZJTA 1TR5A 4WORA 1MHWC 1B1ZA 2UU9H 3K5MA 5KFXA 4IR1A 4LFBQ 3VYUA 2OH2A 1CQVA 4HIDA 2RSNA 4IWXA 2QKIC 5LL6S 3J81L 3L3OC 1QUQA 4KV6A 4XYOA 2KUMA 3HFZB 4LF6H 1CM9A 3OSNA 2HHHH 1XNRQ 3RUZA 3OTOL 5L9XA 1II3A 1SYBA 4O3OA 3S1NH 4NMZA 4RWSC 3ERQA 3HGBA 1XX8A 3W1BA 5IWAL 2XTIA 2RVLA 1C30A 1GSOA 3S16B 3AQQA 4L6TB 4TV8F 3N41B 1YNXA 1GVPA 5HV6A 2E2HH 3KTMA 5I2YA 3KJPA 4V190 3I4NB 4NXMH 5EKIA 4DV7L 5T1IA 2CHBD 4F50A 3NTKA 3SI8A 3VYSA 5I4DA 3TREA 2YU9H 4JI1H 1JJ2A 1WTOA 1KJ9A 4ECZA 1KNAA 4C1NK 3N6RA 2JEFA 1W6JA 1YHBA 2L9HA 3FKIG 4O3SA 4HSPA 4CDEC 2RA4A 2K5WA 3T1HH 3DEOA 4NXNH 3PW4A 2M9VA 3S1MH 3N40P 3MR5A 2IHFA 2R61A 4FM9A 4RNOA 2L1BA 1VAJA 5M5XB 2R84A 2X0SA 3RD4A 1I4XA 1NAPA 1T5XD 1B7YB 3NGDA 1PYSB 4GLVB 1JWUD 1PFBA 1CQIB 3HB9A 1MIUA 4B3TH 2DUDA 4CJ2C 3U4ZA 2K04A 4LUVA 5IY0A 5JH7F 3D31A 4NW2A 4F87A 5JJKA 2OT2A 4MIUA 4JI4Q 2XCLA 2YU9A 1WD0A 3CHBD 4DV2Q 2OQ0A 2ES2A 4P75A 1XNRH 5BN5A 5J2UF 4H13C 5DQGA 1SLJA 4ECRA 2AMCB 3TQYA 4R8UA 1JORA 3D4DA 1WOCA 1BCPD 1PTOH 4YB8B 2D2CC 2L11A 1LO5D 5KFRA 3SGIA 3DWQA 4A3JG 4IPHA 1IBMQ 1U5KA 4IO9A 4XQNA 2RBMA 1YJWA 3J7AV 4JYAL 2AKWB 4WBNF 3TP7A 2IX3A 1MJCA 5K5PA 2NVQH 5KFWA 5LMNH 3HBLA 3NTIA 3I55A 4FP5D 5I2XA 3HOVH 3VPCA 1IL8A 1H95A 1U4LA 5HGQA 4A3KH 2C2DA 1BCPF 2QILA 2KENA 3K80C 1DV2A 3A56A 1LABA 3T1HL 2RKSA 3EFXD 1R9TH 1EOTA 1KD1C 4LF8Q 4BBSB 2FMAA 1IL2A 4QCLA 3U58A 3U9SA 1E2ZA 2VQEH 4MHEA 4KMUC 1GUOA 3K5IA 3RZDH 4A3MG 1SE3A 2HCCA 4ECYA 1WTWA 3CAMA 3KOJA 2QEXA 1SMXA 3TP8A 4EYHB 2B2UC 4LF8L 3T4AC 4FXKC 3A8KE 1ICFB 2WAQE 3OHAA 3V2TA 3MR6A 5KX5F 4XT1B 4RG1A 1S3OA 1SJED 4CDDC 3KBGA 1S0OA 1GUTA 1IYJB 3HKZG 1B8AA 2A8VA 5E7NA 1FNVA 2ZTCA 4A3EB 4A3LH 1JCKB 2K03A 1PV4A 1S0MA 1CA6A 3E6ZX 4ZOLF 3GTKA 4U673 3M9OB 3RGXA 4PDBA 3F2BA 2B2YC 2ZXOA 4LUOA 4XIGS 1HNWQ 5CV7A 1N36Q 4LF7H 4HYKA 5C5LA 5FD6A 4A3GB 1VF5C 5IGEA 3CCSA 1R9TA 4B3RH 4BXXG 5EKKA 1VQOA 3IRBA 2RCNA 2Z6KC 4K6LA 4JBKA 3IG0A 2AHOB 1EWIA 2R92G 3DF7A 1N8RC 2RDIA 3ORRA 4IOCA 4RZQA 3MWMA 1IBMH 3DMUA 5GADC 4LFCH 1XPUA 4YIJA 5D3IB 3R3OA 3BVZA 4XYMB 4A3IB 3L4KA 4IURA 4YR2A 4BBRH 5LMUL 3CCEA 1S68A 1DXMA 1ML0D 1BCPB 2F3VA 3VYTA 5HBRB 3ULPA 2UUBL 2NU9B 4R8NA 3GTKH 5KFEA 2VUMB 3GTKB 2EY5A 1J9OA 4MTKA 3KDFB 4XQQA 2EYJA 2NUAB 3CP0A 2IHEA 3S17B 5JEAH 3MXPA 5L1KA 1TWCH 2IA6A 1QZGA 1UE6A 1IXRA 4L5TA 3V6JA 3I3CA 4FNFA 4U7CA 4I65A 4NLGA 4EEYA 2N3SA 3R5HA 2ZJRA 1YVCA 2BR0A 4HJ5A 4ED1A 2LSSA 2K5QA 3GV5B 2JE6I 5GQOA 2YTVA 4OX9Q 1G51A 4HCSA 1VQLA 1B44D 3NBIA 1UC9A 2YRXA 4KHPH 4O4HF 4S3SA 4DUYQ 1ONLA 2FB9A 3FMAA 1PK8A 2NTSA 1ET6A 3RNUA 2XCAA 2MGSA 3KF6B 5CMDA 1HUNA 3OTOH 2A69C 1I94L 1SCUB 2FE3A 4U68A 4DR4L 3J81c 5T1GA 1IKMA 4DA2A 2VPQA 4F7XA 4DR6L 3J80E 5CGKA 4DR3H 4R4OA 4EBEA 5KFGA 3PUXA 2JXMB 2PVPA 3EJIA 4A3CG 4LJZC 1GJXA 3X3NA 3MHBA 2ZDHA 4RUCA 1HH2P 4YHHL 3HG9A 1TWAA 2R8JA 4DV6L 1TWHB 1KTKA 4A93B 3TIIA 3Q8RB 1Q46A 1U4RA 4QF4A 1BF4A 4A93H 2K5NA 3PW5A 1JJCB 2WAQA 3LNNA 5D1OB 3KHGA 1HQMC 1PH2A 4KD3A 1EY0A 2K32A 2FJZA 1IW7D 2N49A 4ZUIA 1I5FA 1STYA 4KHVA 2PZWA 5KEEA 3AYHB 1PLFA 1SJHD 1RTOA 2J6TA 4DXFA 1CHPD 1K3RA 1LTLA 3PO2B 4DL4A 2HQEA 5DEHA 3B6YA 4JOIC 1U9RA 3TP6A 1PX2A 3FKIA 5BPHA 1ULZA 4IUTA 1SNDA 3HXLA 4X65H 4C2MA 1QNKA 5E1FA 1TWGH 1X54A 1WI5A 1X6OA 4XQJA 1ZHQA 1IW7C 1HZ9A 5C1OA 1I6HB 1AH9A 3RN5A 1YNNC 4DR7H 2J9GA 1M0WA 3A8IE 2Q2TA 2NB0A 3VPBA 1GKHA 2RDJA 3VR2A 4LFAH 2XNAC 1X3EA 4IJHA 4EX5A 4FXGC 1EQQA 2O2LD 2IBKA 1EWHA 2KCCA 5FLXc 2VR1A 2N78A 3A7AB 1SE2A 4CJ1B 4A3BG 2GA4B 5EWGA 4J9OA 3HOXH 5KFVA 3J81W 1HR0H 3AFQA 1YJNA 1HA6A 2F03A 2KEDA 2KHSA 3BVMA 1D6EC 3BG5A 1YZ6A 1EYGA 4A3KG 5M9OA 3S1QH 1WJJA 1KC7A 3S1QB 2Y0SB 1TWGA 3GIQA 2A69D 3PCOB 5KNDA 4A3IH 2R93G 5BMVF 4K8JA 4YR0A 4ZK9B 2ATLA 3GTLH 1PH1A 5NUCA 1AUXA 3RZOB 3OMGA 3R5FA 2CH4A 3BG3A 3H09A 1CFMA 5FD5A 2W6NA 4RA8A 5D1PA 2CFMA 1CS0A 3I73A 1E4FT 3I4MB 2C22A 2PN1A 1C8CA 2WAQB 4HTHA 5M3FH 1FKAH 4IRCA 3JC66 1F2LA 4F4XA 2JJQA 3Q24A 4XYQA 1PHJA 3BVGA 4J9NA 2W7OA 4PV1C 3SDZA 1PZKD 1W6KA 3TZDA 4IUPA 4JI8L 1V1PA 2L0CA 1STBA 3F8TA 1LTID 4DV4Q 1L1OA 1I50H 2IP4A 3H40A 1X3PA 2PNHA 5KFYA 3STBC 1EY7A 1XYIA 5KFBA 5KT4A 4DV5H 2EYFA 2OCEA 5IP7H 2N88A 5K36H 4A2BA 2EPBA 4EFBA 1BO0A 2DJGC 4BY1G 1VQPA 2V9WA 1RODA 5EJWA 4DAYA 3PIO3 5IGGA 1Q90A 2Q8IB 4KJNA 1IBLQ 2L15A 2I07B 5L1LA 4UCVA 4BBRB 1PH4A 1HPCA 1KLGD 3K5LA 3KF6A 5M5XH 2B63G 2UU9Q 3W3AA 3F1ZA 1V1PB 1KAAA 1GLVA 2O5JC 2F3WA 3EROA 3SR1A 3OIPA 5JJZA 3BA8A 3J80L 5EPJA 5EKLA 4C3IG 2JEJA 3JRXA 4ZQ3A 3GDEA 1KRTA 4KN4C 4EQOA 3UE0A 4FF2A 1TAEA 4A3JB 5ELFA 4APVA 1XTDA 2UUAL 1QCBD 3M4OB 1WTHA 4DV2L 4JI6L 1O80A 4FBTA 2B2VC 5H80A 2EYPA 2JA6A 4MTNA 1L2ZA 4BS9A 1NE3A 4YAJB 5FKAC 3O13A 4NXMQ 2YYAA 2K52A 1N33L 4ZKCB 1CQFA 1EZ8A 4Q0FA 2CW7A 4WJ4A 1VMCA 5IYDH 3HP3A 3NEMA 2W6OA 5JVDF 4X64H 4JI1Q 5LYJF 2BE5D 1EEID 4DL2A 4A3FG 2VW9A 2PCFB 3D6CA 1S97A 2XGTA 2K75A 4ZLTF 3MXUA 2W9CA 1CE8A 5C0XG 5IGFA 5HURA 3HOVB 3TDQA 4F4WA 4B3SL 1SFOB 5EWFA 4O3QA 1XDNA 3KLRA 3KLSA 3DLLA 1SR3A 2BQ3A 1R9TB 1XXGA 2XGQA 4DR2L 1BXTA 3EIVA 5FJ8G 1WTXA 3RZOH 2J0TD 1SYEA 4B3ML 3MFHA 3GTMA 5GONF 1K1QA 3NPPA 5M3FG 3RGZA 2UVVA 4LAAA 1S72A 3SK5A 1SNMA 2LS01 4C56C 2B2VA 4C2MB 1T36A 3HKZB 3Q22A 1AZQA 1RYRA 4KTAA 4A3EG 4JCVE 1XPOA 3G6XA 4K2LA 3Q6SA 3BZDB 2DIKA 1ILPA 2UVUA 1CKMA 2JA8G 3LGJA 4A3GG 3MWDA 2W70A 1JJGA 4JK1C 2DPJA 3M7GA 1WTPA 1K8GA 2AUJD 4J9PA 1WTRA 3RLNA 1EUJA 3H0GB 4BWGB 3Q8DA 1JMCA 1TWCA 5EAYA 3KHLA 4HEDA 1EY8A 3NP8A 3TS0A 1EUDB 4GNXA 4L5SA 2F0QA 3RLOA 1F2MA 2VPSA 4DV7H 1E22A 4A3GH 2FLLA 3CCLA 3WWVA 2Z6BA 3I91A 3T1YQ 2QDBA 4Y7NB 1QWYA 1STEA 5C4JB 3Q1KA 3U9OA 2D62A 4X62H 3E5NA 4HNUA 1EY9A 1VBGA 2M2LA 4QGUA 3GTJB 2UXDQ 4IPCA 3CD6A 4ME5A 1NNXA 1SFOA 3K57A 2R3ZA 4HJ8A 4KHZA 5L37A 4DV3L 1PMRA 2JA8H 1TWCB 3GV3A 4EBDA 4DUZQ 3OWFA 4LF4L 2M00A 1B3AA 1UC8A 5T14A 1WD1A 1ENAA 4O2BF 2R8KA 4JVZA 1EIGA 1TY2A 5HY6A 3TMEA 3L0OA 1PFMA 5L1IA 1Y1WB 2J4XA 3S15B 1KXLA 4X3TA 2YS6A 1TT2A 1L1OB 2KCMA 1OTCA 2EQSA 4OHJA 4DU9A 3J80W 2RDHA 3AMUA 2BA1A 5C4XB 3F2UA 1M90C 4X62L 1D1KA 5D8DA 4GNXC 4G7HC 2R7ZH 3M7NA 2F0FA 1G91A 4DV0H 2RF4A 3HOYH 2ID0A 2FK3A 5EBDA 5LA6F 5LMNW 3EPIA 4EVOA 3KXYT 1NR2A 4BA2I 3WO0A 3V6HA 2R7NA 4LF7Q 4H44C 3N8DA 3WNZA 1YI2A 3FKIH 2CW0C 1O7YA 4Y52H 2F0VA 2JEGA 1I7LA 2D9UA 4DV7Q 3C3LA 3S2HH 5M3MG 5KT2A 4EEQA 3TN2A 3BABA 1R4PB 2EY6A 1FVIA 2YZNA 1XMQL 4QUFA 4C3HH 4IOAA 2JYOA 4JV5L 2JSOA 4M7EA 1VQGA 1UUPA 1MGSA 2HHHL 3J7ZC 3KLWA 1YIJA 2AQ3B 5FK9C 5GAGC 1L0XB 4I55F 2RDFA 3GV7B 3T1HQ 1AFPA 1SBBB 2R82A 2R85A 4B9WA 4HMIA 1VCIA 4RUAA 5CV9A 3S1NB 2FLNA 2J7ZA 2E74C 5BR8L 2Z1CA 3M4OH 2WB1G 4CJ0B 1SE4A 1L0YB 1YHAA 5KG3A 2B39A 4K0KQ 5C6AA 4DNRB 4WD3A 2PZTA 1I6HH 1E4EB 4EQNA 2XRSD 1HJPA 2F0NA 1UEAB 4NP5A 3P75A 5FO7B 4HJ7A 1QVGA 3GIPA 4TQUS 2WTFA 4RMFA 3TINA 2H4OA 1EWCA 2K05A 4JI4H 2ZTEA 4N9TA 5KG4A 5DLGA 4RNMA 1NJIC 3RV3A 4UPAA 1N36L 1FR3A 1K0SA 2ALYB 4DR3Q 3MC0B 3U4VA 3NUCA 3OW2A 1IBKL 2R7FA 3J81E 1X65A 4A3KB 5FOBB 2RGRA 1AW7A 2A68D 3BA9A 2VOBA 1JE5A 3J80c 4F88A 5C4JH 4ED3A 5F2DA 2V58A 4DUZL 1KDBA 3QOJA 4R4CA 3VR6A 3KUPA 4X64L 2QA4A 3S2DH 3GTQB 1L0WA 5C3WA 3JAMc 3CKIB 2XVSA 4H0LC 3H4BA 1G6ZA 5LMNQ 5D65A 3I4MG 3S16H 1IYVA 3Q8PB 2WAQG 1WTVA 5KFTA 1KHIA 4ME3A 5KFNA 2UXCL 3QO2A 1YHQA 5KKNB 3NBHB 2Q8RE 2MHVA 5LHY1 3LWUA 2W71A 4C5AA 1FGBD 1SEIA 3H3VH 3FKIB 5ELNA 3A54A 2R7MA 3Q8SB 1N34L 4DXGA 1Q12A 1N32Q 1EZ1A 1EY6A 1Y8PB 2W7PA 1S0NA 2E2JH 4A4IA 1YNJD 4FF4A 2EDGA 2JEIA 1TWFA 1PA6A 3G6YA 3IL8A 3QWNA 3U9TA 2PI2A 2TMPA 1PXUA 1HNXL 1EFWA 3HOYB 2F0UA 4A2AA 2VUMA 2JA6H 3M85A 5KT6A 3KJOA 2SEBD 2FFKB 1YEZA 3CXCA 4L8JA 2AUKA 1Z9FA 1R4QB 1IBLL 3OUUA 5KFIA 2YYZA 3NE5B 3PW2A 4B3RQ 1NBWA 1T94A 3GTOH 4ZQIA 2E75C 2Z6KA 4N9PA 2UXCQ 1B50A 1AN8A 4YJ3F 1B04A 1VQAA 1Q81C 4DK6C 1GHKA 1BR9A 1HCZA 3C46A 2OQKA 1PYWD 3J80i 4R1JA 1PZJD 1Q7YC 2JEAI 3QZ8A 3MXNB 1JWSD 5I9PA 2JA5H 3OHBA 3VPDA 1I4HA 2UUBQ 4G57A 1GYFA 5IWAH 2F0TA 5IYBH 1K83A 3W2DA 3MR2A 2KOLA 1STHA 2DY8A 4IALA 2A5HA 4UP9A 2K33A 3MEHA 3VR4A 3KHRA 1JDEA 1E1OA 1HNZL 2UUCQ 4O42A 4ECXA 2W9BB 1XWEA 2R6GA 3I4OA 1EYZA 4A3FB 1Y8NB 4I7AA 4CDCC 2FP4B 3PQIA 4JI6Q 3S24A 3SK8A 1DOMA 1JOKA 3ZYYX 1LYLA 3PUYA 2SNMA 2VUGA 1Y1WA 3M9BA 1E7ZA 5C0XH 3MR3A 4JI2H 3N44B 3HOWB 1SYDA 1LT3D 2WV6D 1XMOL 3KYHC 3VR5A 4A3MB 1UAPA 4DR5Q 4ED7A 5DGAA 5FO8B 3PF4A 3OIQA 1M7JA 4ECSA 3MWYW 4X3UA 5IGCA 3CVZA 1KLUD 4EGVA 4JI3L 3S9WA 5IT9W 4HNTA 2Z4HA 1Q8KA 2Z9HA 2NVQB 1K83H 5DG7A 3D4WA 2J6SA 2FXQA 3L9AX 2MPMA 3W5OA 1EYDA 5IOCA 2TSSA 3GTPH 4BBSH 2OLSA 4DAPA 1EY4A 1K9MC 3K3VA 4LW1A 1A8VA 3GV8B 1AN7A 3H0GG 4JBJA 1UNNC 4GLXA 4Q8FA 1PFSA 4HCEA 2ENBA 1EFID 4JI5H 4RGTA 4FYDA 1GHJA 2R92B 1JDBB 4KK7A 3AU7A 3ITPA 2PMZA 2RHQB 4XDXA 3I4NH 3EN2A 2E2HB 1E0BA 5C5MA 2VQFL 4OEMB 1F77A 4JBWA 3J7AK 3Q8QB 1O75A 5LMUQ 1EU3A 3CC7A 3FMCA 1RD9D 5ELEA 4DV1Q 3TS2A 2BH8A 2RDGA 2WACA 1A2TA 3NQIA 1M1KC 4JV5H 1BUVT 2WP8J 4BXXH 2E2JB 3NENA 1DONA 3KAKA 3MXNA 4DV6H 3PZPA 4CHTB 2VUMG 5JUMA 3KHHA 2IL8A 5IP7G 3A0JA 4LF9Q 5K36G 1JE4A 4JI2Q 1Q82C 4X3KA 1P8LA 2LXKA 2V1CC 2SOBA 1X3FA 3EQLC 2E2IH 4DR7Q 3UDIA 4PZ6A 4P71A 1Y1WG 2F4VL 2F0GA 3OYYA 2GVAA 4N8FA 1KDAA 3MAQA 3N6XA 3QR8A 4H02A 5C4XG 2VXWA 5C8YF 3V6KA 1I94H 4ZRZA 1DM0B 2W8LA 1X9NA 3BZCA 1SXTA 2A68C 1CSQA 3BJUA 5ISRA 2ALZA 1TXYA 5KRUA 2HJWA 2UVRA 4ECTA 5BN3A 1TS3A 1Y1VB 4O3NA 5CBAE 1GOZA 4FS1A 2ZJQA 4JG2A 2VS1A 1EYCA 5KT3A 3ND8A 3G6VA 1LM0A 2W6PA 3CCUA 4O0AA 1S4ZA 4X6AH 2RGVA 5M3MB 1RHPA 2DNEA 4M9UA 1K3BC 1O78A 2E2IA 3TZUA 4DV3Q 2FJ2A 4JBMA 4RCOA 2Z4IA 3R93A 5C44H 2A74C 5JVH3 4LF7L 3PIPA 3ONAB 2R7ZG 1U4MA 1D8LA 3ER0A 4J9LA 3F2DA 3GTMB 1NY4A 1PDQA 1STGA 2NZHA 1TU2B 4ZAIA 4OO1G 1V1OA 2JA6G 4MV4A 1I7NA 4IZ8A 4KY6A 3ETHA 1QG7A 1ASYA 1I6VC 4F8MA 3Q0AA 3GTGB 3CMEA 2J6UA 3PO2G 2OTJA 1JQYD 3P1HA 5EPKA 1T3NA 3CPFA 1PFNA 1V8QA 1AUVA 4P2CB 4DUZH 2BCOA 2R87A 3TQ1A 1H9JA 4AIMA 5CYUA 4GZYC 4M1UB 2NVYH 5IYZF 4PQXA 2DNCA 1RDPD 4AYBE 3CMAA 2UXBH 1B70B 1ZKOA 4UY8C 3K3PA 4R9WA 2PW7A 1IBLH 3H20A 4Q5VA 3PV0A 2CQOA 3V05A 5IT9E 3I4MH 1N33Q 2DLNA 4EYIB 3RBDA 1E1TA 2VL6A 2MO0A 5I9OA 2CW0D 4A3BB 4NB3A 1D5MC 4K6DA 4R4IA 4R4QA 2UUAQ 3I56A 2A6HC 5GAHC 4IPGA 4PMWA 1Z2PX 4DV2H 1ESFA 3C1EA 2C35B 1DCZA 3OOCA 4IPDA 1GUWA 2A1AA 4B3SQ 4LF4H 3RIZA 4GC6A 2E2IB 3E3XA 1BBWA 2UVWA 4YY3H 3MA2B 3HOZG 1GSAA 4X65L 1HUMA 4X3SA 4GKJL 4J6HA 3PUWA 1I3QA 2XGPA 1KIXA 2W8KA 1CZGA 5KNCA 2GPWA 3CPWA 2DZDA 1B3QA 4B08A 1VQIA 3M3YB 2R7KA 5M5YB 1Y69U 4J1MA 4DR4H 2W6QA 3PIOA 5JVG3 3STBD 4U6PA 2ZJPA 5H1SE 1DIKA 3PSIA 4YP3A 3K58A 1AP0A 4J9SA 1HFNA 3GTJA 3E9IA 3A8JE 4YR3A 1EZ6A 2QGQA 5M5WH 3JSNA 1CKOA 2KEEA 4ABNA 2NTTA 1VQ8A 5JEAG 2F0PA 2FPPB 3MEFA 4APMA 2BOSA 4JV1A 2VNUD 4BY1B 4JI2L 2KA7A 3FP9A 3Q23A 2YS7A 2OTLA 1EUCB 2YCHA 4DR3L 3H0GH 4DL5A 1D5XC 2PPBC 4HAEA 2B3GA 2ZXRA 1EY5A 1DOKA 1O7ZA 2HIVA 2K14A 1SMYC 4IUNA 4QIWE 4BBRG 4C5CA 5C4ZA 4ID6A 1F2ZA 3OUZA 1TY0A 3QZ7A 2AGPA 2B63B 2JA7A 2MNAA 4G7ZC 4DL3A 4PZ7A 3H91A 3N43B 3T5JA 5ELOA 1S40A 2E2HA 1TWHA 2OXPA 4DK3C 1LV9A 1KDCA 3GIKA 1NSNS 4POFA 1GUGA 1B33N 1CTMA 1H9MA 2D0PA 2WIIB 3H3VC 2IMWP 4HR7B 4DN4M 1VF7A 4LF6L 1RTNA 2PO4A 4FXDA 4NKLA 1VMPA 4RKBA 1YNND 3G7LA 4C2MH 4AYBB 3E0EA 1XJVA 4NXML 2W9CB 2MCTA 2K5VA 1T5EA 2KHJA
chains in the Genus database with same CATH topology
3W1BA 1A0IA 5IWAL 1A62A 2XTIA 1J6QA 2BA1A 4IFDI 1VQDA 1GD7A 1Y1VH 1M90C 3CW2C 1NTGA 3AQQA 4X62L 3CQZH 4GNXC 2R7ZH 2CWAA 1YNXA 1GVPA 3M7NA 2RF4A 2ZTDA 2E2HH 3HOYH 2E5LL 2JA5G 2ID0A 3KJPA 3W1GA 4OXPA 5LMNW 3G71A 4DV7L 4A3MH 5J3BA 1CKNA 1GM5A 4LWCA 4YWKA 2I5HA 2LXJA 4BA2I 3TREA 2YU9H 4LF7Q 1YI2A 1JJ2A 3FKIH 2JEAI 4PZ8A 5IP9G 3K8AA 4Y52H 3KDFA 1YHBA 3FKIG 4P72A 3TRZA 2PI2E 3HOWH 4DV7Q 3S2HH 5M3MG 1YITA 3HOUH 4KI0A 4QY7A 3T1YL 2EXDA 1FVIA 2I0QA 3S1MH 1XMQL 4OX9L 4DV0Q 4C3HH 2IHFA 4IOAA 4OO1I 1L2FA 4JV5L 2ZM6L 1K73C 1VQGA 4B3MQ 1WYDA 2HHHL 3J7ZC 1B7YB 4IJLA 1HNWL 3KLWA 1PYSB 4GLVB 1YIJA 2ZM6Q 4LFBL 1MIUA 4L5QA 2DUDA 5GAGC 1ASZA 3U4ZA 4LUVA 3T1HQ 5IY0A 4BY1H 3D31A 1WFQA 5JJKA 1X55A 3ERSX 1DGSA 4JI4Q 2BH2A 2UU9L 1VCIA 5IYCH 3ICEA 1P16A 4DV2Q 2OQ0A 2ES2A 1LUZA 4P75A 5BR8L 1N34Q 4HIMA 3M4OH 2NVXH 2WB1G 1SLJA 2I5MX 2AMCB 4FDBA 3TQYA 1YHAA 1WOCA 3GD7A 4K0KQ 4KLKA 4OWXB 2R7DA 1I6HH 1OXXK 1HJPA 3SGIA 4A3JG 1QVGA 4IPHA 1IBMQ 5IYBG 4HJ7A 4JI0Q 4TQUS 3KFUA 4RMFA 1U5KA 4IO9A 1N9WA 2ZTEA 1YJWA 4JYAL 3S1NH 2AKWB 1FGUA 4R4TA 1VQ7A 4X65Q 2VZAA 1MJCA 4HJ9A 2NVQH 1J5EL 1NJIC 4UPAA 1N36L 2IY5B 3I55A 5AJ3L 2ALYB 4DR3Q 3HOVH 3U4VA 1H95A 3OW2A 4A3KH 5HGQA 1IBKL 2R7FA 1XNRL 4GKKQ 1X65A 1UE1A 2KENA 3K80C 3T1HL 4A75A 1R9TH 1XMQQ 1KD1C 4LF8Q 1JE5A 3J80c 1TWFH 5C4JH 1Q86C 2UXBL 1IL2A 3AEVA 3U58A 1SRUA 4DUZL 1VQJA 4R4CA 4DNIA 3UDGA 3RZDH 1OXUA 4DUYL 4X64L 2QA4A 4GN5A 4A3MG 3S2DH 3CAMA 3KOJA 2PQAA 2QEXA 2VUMH 1SMXA 1L0WA 3JAMc 4GN3B 4LF8L 4MZ9A 5LMNQ 3I4MG 3S16H 3S17H 1AE2A 2WAQE 3RLFA 1Y1VG 2WAQG 1Q1EA 1UE5A 1KHIA 1HR0Q 4ME3A 4RG1A 3CCMA 1S3OA 4JI8Q 2JA7G 2CWPA 4KHPL 1YHQA 2UXCL 4A3CH 3D0FA 1HNZQ 2UUCL 3NBHB 1VQ4A 1IYJB 3HKZG 1B8AA 2DGYA 2WB1E 5E7NA 2A8VA 2ZTCA 3CCVA 4A3LH 3PGZA 3H3VH 1PV4A 5ELNA 1SN8A 3A5UA 1VQMA 1WCMG 5BR8Q 1N34L 1K8AC 1WCMH 1Q12A 4LUOA 4XIGS 3F2BA 1I94Q 1HNWQ 1N36Q 4A3BH 1G291 1N32Q 2E2JH 3CCQA 4A4IA 4DR1L 4K0KL 3CCSA 4DR6Q 1NMGA 4BXXG 1NMFA 3S1RH 1PA6A 5IT9c 1VQOA 2PI2A 2IT1A 4HJAA 3IRBA 2RCNA 2Z6KC 4JBKA 1QVFA 2AHOB 1EWIA 1HNXL 2R92G 1EFWA 4NXNQ 1YJ9A 5IYDG 1VQFA 4J15A 1IZ6A 1VQEA 4IOCA 1N8RC 2JA6H 3GTMH 4GNXB 5GADC 3M85A 1VQKA 1FL0A 3KJOA 1VQCA 4DKAC 1XPUA 2E8GA 1JT8A 1YEZA 3CCJA 4NXNL 4DV6Q 3CXCA 1Q1BA 1Z9FA 1XPRA 4DV5Q 1IBLL 4NPSA 1L1OB 1FJGL 4BBRH 2YYZA 5LMUL 3CCEA 4DV4L 1NBWA 4B3RQ 3TEHB 3UDFA 2F4VQ 3GTOH 4B3TQ 2Z6KA 3ULPA 4KHPQ 1SROA 4P74A 2UXCQ 2UUBL 1VQHA 1HZAA 3GTKH 3CF5A 1VQAA 1Q81C 3OTOQ 5DLQE 4DK6C 4HIOA 4DV5L 2OWOA 2ASBA 3UE1A 3KDFB 2OQKA 2Q2HA 1PH8A 3CP0A 4R1JA 2IHEA 3J80i 3U50C 4DV0L 3MXNB 1W2BA 1Q7YC 2JA5H 1TWCH 1UE7A 4A3DH 4OWTB 1MKHA 1IXRA 1UE6A 4L5TA 4ALPA 1QZGA 2UUBQ 3PO2H 3FHWA 5C3EH 1PH5A 4EQ5A 4AQYL 2N3SA 1EIYB 2ZJRA 5IYBH 1YVCA 4JYAQ 4HJ5A 1XNQQ 2LSSA 2JE6I 2Y0SG 1CUKA 2YTVA 3BZKA 4UP9A 5GQOA 4OX9Q 1G51A 2R93H 1VQLA 1E1OA 3M4QA 1HNZL 2UUCQ 2ATWA 4DUYQ 2R6GA 5FJ8H 3I4OA 3RNUA 3KF6B 3S24A 4JI6Q 1VQNA 4YWMA 1I94L 1N32L 1LYLA 3PUYA 4DR4L 2KHIA 3M9BA 3J81c 1C0AA 1E7ZA 1SFOH 2UXDL 1HZCA 4YHHQ 1Y14B 4DR6L 3HOZH 1XMOL 3A5ZB 3KYHC 4A3DG 2MO1A 2PQAB 4R4OA 4DR5Q 5AJ3Q 1J5EQ 2NN6G 1PH6A 3PUXA 2KCTA 3PF4A 3L7ZC 4A3CG 2CCZA 2Q2IA 5FLMG 1HR0L 1HH2P 2PMZE 4YHHL 4JI3L 2F3IA 3F2CA 4DV6L 1Q8KA 4XTCS 1K83H 3K0XA 4GLAC 1KQSA 4X64Q 3PO3H 1Q46A 2FXQA 4A93H 1VQ9A 2K5NA 3W5OA 1BBUA 1JJCB 4IFDJ 3PUZA 3GTPH 1PH2A 1HNXQ 3ULLA 3G48A 1QZHA 2Y0SE 4BBSH 2NZOA 1K9MC 4JI0L 4QQBX 2N49A 4LW1A 1I5FA 1A8VA 4GS3A 4TVAB 1K0RA 3AYHB 4HIKA 1QUQB 3H0GG 4JBJA 1Y1WH 3CC4A 4GLXA 1K3RA 1PFSA 1LTLA 2UXBQ 4YY3L 2E5LQ 4WJ3M 3B6YA 4JOIC 2KBNA 1KAWA 3S14H 3HOYG 1O7IA 4GKKL 4A93G 1UWVA 2RHQB 1TWGH 2H5XA 1E24A 2HQLA 1UEBA 1X54A 1WI5A 1X6OA 3DM3A 3K7AH 4UP7A 3EN2A 2B63H 3I4NH 1HZ9A 1AH9A 2VQFL 3RN5A 3PO3G 4A3FH 2B29A 4JBWA 3JAMi 3GO5A 5LMUQ 3CC7A 2Q2TA 2HIXA 2VQEQ 1GKHA 4YCWA 1X3EA 4DV1Q 2BH8A 4IJHA 4EX5A 1M1KC 1EQQA 3TS2A 4MNOA 1C9OA 3PUVA 2WP8J 4BXXH 1D7QA 1X3GA 3NENA 4LF4Q 5FLXc 2VUMG 2N78A 5IP7G 4LF9Q 3A0JA 4A3BG 5K36G 4JI2Q 3HOXH 3ULJA 1OXSC 1Q82C 1P8LA 2LXKA 1OTCA 3AFQA 1L1OC 2V1CC 2K5HA 1YJNA 4GOPC 1X3FA 2JK8A 2E2IH 4LF5L 4AYBG 3GTGH 4A3LG 4DR7Q 4JOIA 3UDIA 5C0XI 4PZ6A 4P71A 4B3TL 1Y1WG 3J81j 2F4VL 1YZ6A 1X56A 2I5LX 2YTYA 2GVAA 3OYYA 1EYGA 5GROA 4A3KG 3S1QH 1G6PA 4JI4L 1WJJA 5JEAJ 3HKZE 4H02A 4BBSG 4X62Q 4LUZA 3PCOB 4A3IH 3HOVG 4JV5Q 2R93G 5C4XG 3GTLH 1PH1A 2IX1A 5GAEC 2JEBI 1X9NA 3BZCA 1EQRA 1CSQA 3BJUA 4LFCL 4JI7L 1TXYA 2CFMA 4OWWB 4A3JH 4JI3Q 4YCVA 1OXVA 3HOWG 5M3FH 3JC66 2R92H 1IBML 2JJQA 2K50A 1PHJA 2ZJQA 4JG2A 2VS1A 4LFCQ 4JI8L 4Y7NH 3F8TA 4X6AH 1LM0A 2GVBA 4DV4Q 5C0XJ 4O0AA 3CCUA 2RHSB 1I50H 1L1OA 4B3RL 4JI1L 4GOPA 2PNHA 1V43A 3STBC 3L2PA 4DV3Q 4JBMA 1EIFA 3E9HA 3HOXG 2OCEA 5C44H 5IP7H 4DPGA 4LF7L 3PIPA 2R7ZG 1D8LA 3ER0A 4BY1G 1VQPA 3EBEA 3F2DA 1QVCA 4QL5A 1NY4A 4GKJQ 2F52A 2NZHA 1RL2A 1PYBA 4BA1I 4OO1G 2JA6G 1VQ6A 1IBLQ 1FJGQ 2A19A 2L15A 3RN2A 1SE8A 1T9HA 4X66Q 3HKSA 1PH4A 1ASYA 3KF6A 2YV5A 5M5XH 5IWAQ 3CMEA 1MJEA 1V1QA 2B63G 3J81i 5IE8A 2UU9Q 3PO2G 2OTJA 3F1ZA 2BA0A 4JI7Q 1PVOA 3CPFA 4POGA 2AWOA 4DR7L 4A3IG 3KF8B 4AIMA 2HT1A 2VY3A 1A63A 3H15A 2NVYH 3ZJYC 3CMAA 4AYBE 1EOVA 5M5YH 5IP9H 1B70B 4GOPB 4UY8C 1XMOQ 3GDEA 3PV0A 1W3SA 4LNQA 4L5RC 2Z0SA 4BY7H 1KRTA 2CQOA 3UE0A 4DV1L 4APVA 1XTDA 2UUAL 4LFAL 3I4MH 1KRSA 1N33Q 4DV2L 1E1TA 4JI6L 2AWNA 2EIFA 2VL6A 1Z47A 2MO0A 1CKNB 4MTNA 1NE3A 1PH7A 2VQFQ 3VDYA 4PG3A 4BY7G 5C4XH 4NXMQ 4NB3A 2K52A 3G4SA 1N33L 2GN5A 4R4IA 4R4QA 4LFAQ 3I56A 5GAHC 2UUAQ 3J7A5 4IPGA 4PMWA 2VQEL 3NEMA 4WJ4A 5IYDH 1U0LA 1HR0W 1YBYA 2C35B 4IPDA 4JI1Q 2A1AA 4B3SQ 4A3FG 4O2DA 4C3IH 3G6EA 2VW9A 1BBWA 4OONA 4JI5L 1C7YA 3H3VI 2XGTA 2K75A 4X65L 3HOZG 3I4NG 2JA9A 4GKJL 5C0XG 1HZBA 3PUWA 2NVTH 5IYCG 2NN6I 3GTQH 1VS0A 4B3SL 1KIXA 3CCRA 4LF5Q 5LMNL 3DLLA 3CPWA 1SR3A 1V9PA 2YTXA 1IBKQ 1VQIA 4UP8A 2N8NA 4DR2L 3AFPA 2K4KA 3EIVA 5FJ8G 2HHHQ 4JI5Q 4LF6Q 3RZOH 3I7FA 4DR5L 1BVSA 4B3ML 1OXTA 3I2ZA 3A74A 3PIOA 2D0OA 3STBD 5M3FG 2JA7H 4YCUA 2ZJPA 5H1SE 1S72A 3PSIA 4LF9L 3PF5A 1CSPA 4A3EG 1PH9A 3E9IA 4YY3Q 1TWHH 2QGQA 4JCVE 5M5WH 5C3EG 1XPOA 1XNQL 3S15H 5C44G 1PH3A 1CKOA 4GN4B 1VQ8A 3K7UC 5JJIA 1E3PA 2JQOA 5JEAG 3K81C 4DAYB 3MEFA 1CKMA 2JA8G 3LGJA 4JC0A 5M3MH 3HOUG 1GO3E 2MFIA 4A3GG 1JJGA 4X66L 2VNUD 1K8GA 1AE3A 1VQ5A 1KC8C 4JI2L 3FP9A 3M4PA 3RLNA 3RR5A 3UDXA 1EUJA 2OTLA 4DR4Q 4DR3L 4AQYQ 2Q2UA 3H0GH 3Q8DA 4AH6A 1JMCA 1I3QH 5EAYA 4A76A 3TS0A 4GNXA 2B3GA 3NELA 4L5SA 2WFWA 3RLOA 3BU2A 1E22A 4A3GH 5JJLA 2HIVA 2K14A 4QIWE 3WWVA 4BBRG 3CCLA 1KL9A 1VQBA 4P73A 2CKZB 3T1YQ 2MNAA 4IFDG 4PZ7A 1JB7A 2D62A 5ELOA 1S40A 3GTJH 2IX0A 4QGUA 4QJFA 4IPCA 4DK3C 5FLMH 3CD6A 4DAMA 1RIPA 2UXDQ 4HJ8A 4KHZA 4DV3L 4POFA 4LFBQ 3M3YH 2D0PA 4DR1Q 2JA8H 4DUZQ 4HIDA 4LF4L 4DR2Q 4LF6L 1QUQA 1BKBA 3HFZB 5HY6A 4C2MH 4A3EH 1TWAH 4YWLA 1XNRQ 3OTOL 3L0OA 3E0EA 1XJVA 1KXLA 4NXML 4C3JH 3CC2A 2MQHA 2K5VA 2KCMA 2EQSA 2KHJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3W1B A;  1A0I A;  5IWA L;  1A62 A;  2XTI A;  1J6Q A;  2BA1 A;  4IFD I;  1VQD A;  1GD7 A;  1Y1V H;  1M90 C;  3CW2 C;  1NTG A;  3AQQ A;  4X62 L;  3CQZ H;  4GNX C;  2R7Z H;  2CWA A;  1YNX A;  1GVP A;  3M7N A;  2RF4 A;  2ZTD A;  2E2H H;  3HOY H;  2E5L L;  2JA5 G;  2ID0 A;  3KJP A;  3W1G A;  4OXP A;  5LMN W;  3G71 A;  4DV7 L;  4A3M H;  5J3B A;  1CKN A;  1GM5 A;  4LWC A;  4YWK A;  2I5H A;  2LXJ A;  4BA2 I;  3TRE A;  2YU9 H;  4LF7 Q;  1YI2 A;  1JJ2 A;  3FKI H;  2JEA I;  4PZ8 A;  5IP9 G;  3K8A A;  4Y52 H;  3KDF A;  1YHB A;  3FKI G;  4P72 A;  3TRZ A;  2PI2 E;  3HOW H;  4DV7 Q;  3S2H H;  5M3M G;  1YIT A;  3HOU H;  4KI0 A;  4QY7 A;  3T1Y L;  2EXD A;  1FVI A;  2I0Q A;  3S1M H;  1XMQ L;  4OX9 L;  4DV0 Q;  4C3H H;  2IHF A;  4IOA A;  4OO1 I;  1L2F A;  4JV5 L;  2ZM6 L;  1K73 C;  1VQG A;  4B3M Q;  1WYD A;  2HHH L;  3J7Z C;  1B7Y B;  4IJL A;  1HNW L;  3KLW A;  1PYS B;  4GLV B;  1YIJ A;  2ZM6 Q;  4LFB L;  1MIU A;  4L5Q A;  2DUD A;  5GAG C;  1ASZ A;  3U4Z A;  4LUV A;  3T1H Q;  5IY0 A;  4BY1 H;  3D31 A;  1WFQ A;  5JJK A;  1X55 A;  3ERS X;  1DGS A;  4JI4 Q;  2BH2 A;  2UU9 L;  1VCI A;  5IYC H;  3ICE A;  1P16 A;  4DV2 Q;  2OQ0 A;  2ES2 A;  1LUZ A;  4P75 A;  5BR8 L;  1N34 Q;  4HIM A;  3M4O H;  2NVX H;  2WB1 G;  1SLJ A;  2I5M X;  2AMC B;  4FDB A;  3TQY A;  1YHA A;  1WOC A;  3GD7 A;  4K0K Q;  4KLK A;  4OWX B;  2R7D A;  1I6H H;  1OXX K;  1HJP A;  3SGI A;  4A3J G;  1QVG A;  4IPH A;  1IBM Q;  5IYB G;  4HJ7 A;  4JI0 Q;  4TQU S;  3KFU A;  4RMF A;  1U5K A;  4IO9 A;  1N9W A;  2ZTE A;  1YJW A;  4JYA L;  3S1N H;  2AKW B;  1FGU A;  4R4T A;  1VQ7 A;  4X65 Q;  2VZA A;  1MJC A;  4HJ9 A;  2NVQ H;  1J5E L;  1NJI C;  4UPA A;  1N36 L;  2IY5 B;  3I55 A;  5AJ3 L;  2ALY B;  4DR3 Q;  3HOV H;  3U4V A;  1H95 A;  3OW2 A;  4A3K H;  5HGQ A;  1IBK L;  2R7F A;  1XNR L;  4GKK Q;  1X65 A;  1UE1 A;  2KEN A;  3K80 C;  3T1H L;  4A75 A;  1R9T H;  1XMQ Q;  1KD1 C;  4LF8 Q;  1JE5 A;  3J80 c;  1TWF H;  5C4J H;  1Q86 C;  2UXB L;  1IL2 A;  3AEV A;  3U58 A;  1SRU A;  4DUZ L;  1VQJ A;  4R4C A;  4DNI A;  3UDG A;  3RZD H;  1OXU A;  4DUY L;  4X64 L;  2QA4 A;  4GN5 A;  4A3M G;  3S2D H;  3CAM A;  3KOJ A;  2PQA A;  2QEX A;  2VUM H;  1SMX A;  1L0W A;  3JAM c;  4GN3 B;  4LF8 L;  4MZ9 A;  5LMN Q;  3I4M G;  3S16 H;  3S17 H;  1AE2 A;  2WAQ E;  3RLF A;  1Y1V G;  2WAQ G;  1Q1E A;  1UE5 A;  1KHI A;  1HR0 Q;  4ME3 A;  4RG1 A;  3CCM A;  1S3O A;  4JI8 Q;  2JA7 G;  2CWP A;  4KHP L;  1YHQ A;  2UXC L;  4A3C H;  3D0F A;  1HNZ Q;  2UUC L;  3NBH B;  1VQ4 A;  1IYJ B;  3HKZ G;  1B8A A;  2DGY A;  2WB1 E;  5E7N A;  2A8V A;  2ZTC A;  3CCV A;  4A3L H;  3PGZ A;  3H3V H;  1PV4 A;  5ELN A;  1SN8 A;  3A5U A;  1VQM A;  1WCM G;  5BR8 Q;  1N34 L;  1K8A C;  1WCM H;  1Q12 A;  4LUO A;  4XIG S;  3F2B A;  1I94 Q;  1HNW Q;  1N36 Q;  4A3B H;  1G29 1;  1N32 Q;  2E2J H;  3CCQ A;  4A4I A;  4DR1 L;  4K0K L;  3CCS A;  4DR6 Q;  1NMG A;  4BXX G;  1NMF A;  3S1R H;  1PA6 A;  5IT9 c;  1VQO A;  2PI2 A;  2IT1 A;  4HJA A;  3IRB A;  2RCN A;  2Z6K C;  4JBK A;  1QVF A;  2AHO B;  1EWI A;  1HNX L;  2R92 G;  1EFW A;  4NXN Q;  1YJ9 A;  5IYD G;  1VQF A;  4J15 A;  1IZ6 A;  1VQE A;  4IOC A;  1N8R C;  2JA6 H;  3GTM H;  4GNX B;  5GAD C;  3M85 A;  1VQK A;  1FL0 A;  3KJO A;  1VQC A;  4DKA C;  1XPU A;  2E8G A;  1JT8 A;  1YEZ A;  3CCJ A;  4NXN L;  4DV6 Q;  3CXC A;  1Q1B A;  1Z9F A;  1XPR A;  4DV5 Q;  1IBL L;  4NPS A;  1L1O B;  1FJG L;  4BBR H;  2YYZ A;  5LMU L;  3CCE A;  4DV4 L;  1NBW A;  4B3R Q;  3TEH B;  3UDF A;  2F4V Q;  3GTO H;  4B3T Q;  2Z6K A;  3ULP A;  4KHP Q;  1SRO A;  4P74 A;  2UXC Q;  2UUB L;  1VQH A;  1HZA A;  3GTK H;  3CF5 A;  1VQA A;  1Q81 C;  3OTO Q;  5DLQ E;  4DK6 C;  4HIO A;  4DV5 L;  2OWO A;  2ASB A;  3UE1 A;  3KDF B;  2OQK A;  2Q2H A;  1PH8 A;  3CP0 A;  4R1J A;  2IHE A;  3J80 i;  3U50 C;  4DV0 L;  3MXN B;  1W2B A;  1Q7Y C;  2JA5 H;  1TWC H;  1UE7 A;  4A3D H;  4OWT B;  1MKH A;  1IXR A;  1UE6 A;  4L5T A;  4ALP A;  1QZG A;  2UUB Q;  3PO2 H;  3FHW A;  5C3E H;  1PH5 A;  4EQ5 A;  4AQY L;  2N3S A;  1EIY B;  2ZJR A;  5IYB H;  1YVC A;  4JYA Q;  4HJ5 A;  1XNQ Q;  2LSS A;  2JE6 I;  2Y0S G;  1CUK A;  2YTV A;  3BZK A;  4UP9 A;  5GQO A;  4OX9 Q;  1G51 A;  2R93 H;  1VQL A;  1E1O A;  3M4Q A;  1HNZ L;  2UUC Q;  2ATW A;  4DUY Q;  2R6G A;  5FJ8 H;  3I4O A;  3RNU A;  3KF6 B;  3S24 A;  4JI6 Q;  1VQN A;  4YWM A;  1I94 L;  1N32 L;  1LYL A;  3PUY A;  4DR4 L;  2KHI A;  3M9B A;  3J81 c;  1C0A A;  1E7Z A;  1SFO H;  2UXD L;  1HZC A;  4YHH Q;  1Y14 B;  4DR6 L;  3HOZ H;  1XMO L;  3A5Z B;  3KYH C;  4A3D G;  2MO1 A;  2PQA B;  4R4O A;  4DR5 Q;  5AJ3 Q;  1J5E Q;  2NN6 G;  1PH6 A;  3PUX A;  2KCT A;  3PF4 A;  3L7Z C;  4A3C G;  2CCZ A;  2Q2I A;  5FLM G;  1HR0 L;  1HH2 P;  2PMZ E;  4YHH L;  4JI3 L;  2F3I A;  3F2C A;  4DV6 L;  1Q8K A;  4XTC S;  1K83 H;  3K0X A;  4GLA C;  1KQS A;  4X64 Q;  3PO3 H;  1Q46 A;  2FXQ A;  4A93 H;  1VQ9 A;  2K5N A;  3W5O A;  1BBU A;  1JJC B;  4IFD J;  3PUZ A;  3GTP H;  1PH2 A;  1HNX Q;  3ULL A;  3G48 A;  1QZH A;  2Y0S E;  4BBS H;  2NZO A;  1K9M C;  4JI0 L;  4QQB X;  2N49 A;  4LW1 A;  1I5F A;  1A8V A;  4GS3 A;  4TVA B;  1K0R A;  3AYH B;  4HIK A;  1QUQ B;  3H0G G;  4JBJ A;  1Y1W H;  3CC4 A;  4GLX A;  1K3R A;  1PFS A;  1LTL A;  2UXB Q;  4YY3 L;  2E5L Q;  4WJ3 M;  3B6Y A;  4JOI C;  2KBN A;  1KAW A;  3S14 H;  3HOY G;  1O7I A;  4GKK L;  4A93 G;  1UWV A;  2RHQ B;  1TWG H;  2H5X A;  1E24 A;  2HQL A;  1UEB A;  1X54 A;  1WI5 A;  1X6O A;  3DM3 A;  3K7A H;  4UP7 A;  3EN2 A;  2B63 H;  3I4N H;  1HZ9 A;  1AH9 A;  2VQF L;  3RN5 A;  3PO3 G;  4A3F H;  2B29 A;  4JBW A;  3JAM i;  3GO5 A;  5LMU Q;  3CC7 A;  2Q2T A;  2HIX A;  2VQE Q;  1GKH A;  4YCW A;  1X3E A;  4DV1 Q;  2BH8 A;  4IJH A;  4EX5 A;  1M1K C;  1EQQ A;  3TS2 A;  4MNO A;  1C9O A;  3PUV A;  2WP8 J;  4BXX H;  1D7Q A;  1X3G A;  3NEN A;  4LF4 Q;  5FLX c;  2VUM G;  2N78 A;  5IP7 G;  4LF9 Q;  3A0J A;  4A3B G;  5K36 G;  4JI2 Q;  3HOX H;  3ULJ A;  1OXS C;  1Q82 C;  1P8L A;  2LXK A;  1OTC A;  3AFQ A;  1L1O C;  2V1C C;  2K5H A;  1YJN A;  4GOP C;  1X3F A;  2JK8 A;  2E2I H;  4LF5 L;  4AYB G;  3GTG H;  4A3L G;  4DR7 Q;  4JOI A;  3UDI A;  5C0X I;  4PZ6 A;  4P71 A;  4B3T L;  1Y1W G;  3J81 j;  2F4V L;  1YZ6 A;  1X56 A;  2I5L X;  2YTY A;  2GVA A;  3OYY A;  1EYG A;  5GRO A;  4A3K G;  3S1Q H;  1G6P A;  4JI4 L;  1WJJ A;  5JEA J;  3HKZ E;  4H02 A;  4BBS G;  4X62 Q;  4LUZ A;  3PCO B;  4A3I H;  3HOV G;  4JV5 Q;  2R93 G;  5C4X G;  3GTL H;  1PH1 A;  2IX1 A;  5GAE C;  2JEB I;  1X9N A;  3BZC A;  1EQR A;  1CSQ A;  3BJU A;  4LFC L;  4JI7 L;  1TXY A;  2CFM A;  4OWW B;  4A3J H;  4JI3 Q;  4YCV A;  1OXV A;  3HOW G;  5M3F H;  3JC6 6;  2R92 H;  1IBM L;  2JJQ A;  2K50 A;  1PHJ A;  2ZJQ A;  4JG2 A;  2VS1 A;  4LFC Q;  4JI8 L;  4Y7N H;  3F8T A;  4X6A H;  1LM0 A;  2GVB A;  4DV4 Q;  5C0X J;  4O0A A;  3CCU A;  2RHS B;  1I50 H;  1L1O A;  4B3R L;  4JI1 L;  4GOP A;  2PNH A;  1V43 A;  3STB C;  3L2P A;  4DV3 Q;  4JBM A;  1EIF A;  3E9H A;  3HOX G;  2OCE A;  5C44 H;  5IP7 H;  4DPG A;  4LF7 L;  3PIP A;  2R7Z G;  1D8L A;  3ER0 A;  4BY1 G;  1VQP A;  3EBE A;  3F2D A;  1QVC A;  4QL5 A;  1NY4 A;  4GKJ Q;  2F52 A;  2NZH A;  1RL2 A;  1PYB A;  4BA1 I;  4OO1 G;  2JA6 G;  1VQ6 A;  1IBL Q;  1FJG Q;  2A19 A;  2L15 A;  3RN2 A;  1SE8 A;  1T9H A;  4X66 Q;  3HKS A;  1PH4 A;  1ASY A;  3KF6 A;  2YV5 A;  5M5X H;  5IWA Q;  3CME A;  1MJE A;  1V1Q A;  2B63 G;  3J81 i;  5IE8 A;  2UU9 Q;  3PO2 G;  2OTJ A;  3F1Z A;  2BA0 A;  4JI7 Q;  1PVO A;  3CPF A;  4POG A;  2AWO A;  4DR7 L;  4A3I G;  3KF8 B;  4AIM A;  2HT1 A;  2VY3 A;  1A63 A;  3H15 A;  2NVY H;  3ZJY C;  3CMA A;  4AYB E;  1EOV A;  5M5Y H;  5IP9 H;  1B70 B;  4GOP B;  4UY8 C;  1XMO Q;  3GDE A;  3PV0 A;  1W3S A;  4LNQ A;  4L5R C;  2Z0S A;  4BY7 H;  1KRT A;  2CQO A;  3UE0 A;  4DV1 L;  4APV A;  1XTD A;  2UUA L;  4LFA L;  3I4M H;  1KRS A;  1N33 Q;  4DV2 L;  1E1T A;  4JI6 L;  2AWN A;  2EIF A;  2VL6 A;  1Z47 A;  2MO0 A;  1CKN B;  4MTN A;  1NE3 A;  1PH7 A;  2VQF Q;  3VDY A;  4PG3 A;  4BY7 G;  5C4X H;  4NXM Q;  4NB3 A;  2K52 A;  3G4S A;  1N33 L;  2GN5 A;  4R4I A;  4R4Q A;  4LFA Q;  3I56 A;  5GAH C;  2UUA Q;  3J7A 5;  4IPG A;  4PMW A;  2VQE L;  3NEM A;  4WJ4 A;  5IYD H;  1U0L A;  1HR0 W;  1YBY A;  2C35 B;  4IPD A;  4JI1 Q;  2A1A A;  4B3S Q;  4A3F G;  4O2D A;  4C3I H;  3G6E A;  2VW9 A;  1BBW A;  4OON A;  4JI5 L;  1C7Y A;  3H3V I;  2XGT A;  2K75 A;  4X65 L;  3HOZ G;  3I4N G;  2JA9 A;  4GKJ L;  5C0X G;  1HZB A;  3PUW A;  2NVT H;  5IYC G;  2NN6 I;  3GTQ H;  1VS0 A;  4B3S L;  1KIX A;  3CCR A;  4LF5 Q;  5LMN L;  3DLL A;  3CPW A;  1SR3 A;  1V9P A;  2YTX A;  1IBK Q;  1VQI A;  4UP8 A;  2N8N A;  4DR2 L;  3AFP A;  2K4K A;  3EIV A;  5FJ8 G;  2HHH Q;  4JI5 Q;  4LF6 Q;  3RZO H;  3I7F A;  4DR5 L;  1BVS A;  4B3M L;  1OXT A;  3I2Z A;  3A74 A;  3PIO A;  2D0O A;  3STB D;  5M3F G;  2JA7 H;  4YCU A;  2ZJP A;  5H1S E;  1S72 A;  3PSI A;  4LF9 L;  3PF5 A;  1CSP A;  4A3E G;  1PH9 A;  3E9I A;  4YY3 Q;  1TWH H;  2QGQ A;  4JCV E;  5M5W H;  5C3E G;  1XPO A;  1XNQ L;  3S15 H;  5C44 G;  1PH3 A;  1CKO A;  4GN4 B;  1VQ8 A;  3K7U C;  5JJI A;  1E3P A;  2JQO A;  5JEA G;  3K81 C;  4DAY B;  3MEF A;  1CKM A;  2JA8 G;  3LGJ A;  4JC0 A;  5M3M H;  3HOU G;  1GO3 E;  2MFI A;  4A3G G;  1JJG A;  4X66 L;  2VNU D;  1K8G A;  1AE3 A;  1VQ5 A;  1KC8 C;  4JI2 L;  3FP9 A;  3M4P A;  3RLN A;  3RR5 A;  3UDX A;  1EUJ A;  2OTL A;  4DR4 Q;  4DR3 L;  4AQY Q;  2Q2U A;  3H0G H;  3Q8D A;  4AH6 A;  1JMC A;  1I3Q H;  5EAY A;  4A76 A;  3TS0 A;  4GNX A;  2B3G A;  3NEL A;  4L5S A;  2WFW A;  3RLO A;  3BU2 A;  1E22 A;  4A3G H;  5JJL A;  2HIV A;  2K14 A;  4QIW E;  3WWV A;  4BBR G;  3CCL A;  1KL9 A;  1VQB A;  4P73 A;  2CKZ B;  3T1Y Q;  2MNA A;  4IFD G;  4PZ7 A;  1JB7 A;  2D62 A;  5ELO A;  1S40 A;  3GTJ H;  2IX0 A;  4QGU A;  4QJF A;  4IPC A;  4DK3 C;  5FLM H;  3CD6 A;  4DAM A;  1RIP A;  2UXD Q;  4HJ8 A;  4KHZ A;  4DV3 L;  4POF A;  4LFB Q;  3M3Y H;  2D0P A;  4DR1 Q;  2JA8 H;  4DUZ Q;  4HID A;  4LF4 L;  4DR2 Q;  4LF6 L;  1QUQ A;  1BKB A;  3HFZ B;  5HY6 A;  4C2M H;  4A3E H;  1TWA H;  4YWL A;  1XNR Q;  3OTO L;  3L0O A;  3E0E A;  1XJV A;  1KXL A;  4NXM L;  4C3J H;  3CC2 A;  2MQH A;  2K5V A;  2KCM A;  2EQS A;  2KHJ A; 
#chains in the Genus database with same CATH topology
 1K8M A;  2MUY A;  1JX4 A;  4K5W A;  2SCU B;  2E76 C;  4C3J G;  5CC4 A;  1OWT A;  3JAM E;  2LKV A;  1J6Q A;  5A2Q L;  4IFD I;  1VQD A;  1GD7 A;  1Y1V H;  4PMC A;  5J2T F;  3GTP A;  3DM1 A;  1KJQ A;  3BYY B;  2CWA A;  1JOO A;  5IGD A;  2ZTD A;  5CV6 A;  2JA5 G;  4OXP A;  2V4D A;  3G71 A;  2F0W A;  3R2T A;  2XIW A;  4A3M H;  4LWC A;  4YWK A;  2I5H A;  2LXJ A;  4CDF C;  2AQ1 B;  3GQB A;  1C48 A;  4MN3 A;  3KDF A;  3SHL A;  4QW9 A;  4DF7 A;  4GKK H;  3BYT B;  3RBE A;  3TRZ A;  2CVR A;  2PI2 E;  2NZ1 D;  3HOW H;  1K1S A;  2W57 A;  2F0E A;  1NUC A;  3HOU H;  4Z9C B;  4KI0 A;  3S2H B;  2F0L A;  3MVV A;  5LOV F;  5KFA A;  2I0Q A;  4DV0 Q;  4OO1 I;  1L2F A;  3PW0 A;  2G9D A;  5DAU A;  5J22 A;  2EOT A;  2F1M A;  1AEX A;  2PQE A;  3LWE A;  1SAP A;  1K73 C;  1DV1 A;  4B3M Q;  1WYD A;  5CV4 A;  5LL6 b;  2JA8 B;  1HNW L;  1BDO A;  4I4T F;  1G2T A;  1EQT A;  2PW5 A;  3T56 B;  4LFB L;  1ASZ A;  1A3T A;  3I90 A;  4J9K A;  2VQD A;  3MTS A;  4BY1 H;  1WFQ A;  3ERS X;  1V4Y A;  4ECW A;  4ECU A;  2C5C A;  1KEE A;  1I50 A;  4NDX A;  1P16 A;  1IYU A;  4PMB A;  2LFN A;  5FLX L;  1LUZ A;  4RGN A;  4HIM A;  1EYA A;  2YW2 A;  4DR6 H;  1TKW B;  5LXT F;  4XT3 B;  2I5M X;  4QWA A;  5IIF A;  4FDB A;  4RHR A;  1F2Y A;  4QIW B;  4MV6 A;  2ASJ A;  4CKE A;  4KLK A;  4OWX B;  4CC5 A;  2R7D A;  1ILQ A;  2L55 A;  1B9N A;  5A2Q E;  4RKL A;  4ZYS A;  4EGQ A;  4JI0 Q;  3QIA A;  3KFU A;  2FK1 A;  4JI6 H;  5KFS A;  1DYQ A;  1LTA D;  1Z7T A;  1N9W A;  2EXZ A;  1HHV A;  1WR2 A;  4YQW A;  3OMC A;  4KKU A;  4R4T A;  2PBZ A;  2W6Z A;  4X65 Q;  2VZA A;  3FDS A;  1J5E L;  2IY5 B;  3RAQ A;  5AJ3 L;  2C9O A;  2YZM A;  1XNR L;  2B2Y A;  4GKK Q;  1EL0 A;  1UE1 A;  4G4K A;  4F4Y A;  4TRD A;  1CHQ D;  1Q3L A;  4A75 A;  1LAC A;  1XMQ Q;  1W93 A;  2UXB L;  3GV6 A;  4L63 B;  1RJQ A;  1CK1 A;  2KEC A;  3BJY A;  4GN5 A;  1X3Q A;  3OHX C;  4GN3 B;  3BDO A;  1RKN A;  5C1P A;  2FKL A;  2NBF A;  4DFA A;  4B3M H;  3RLF A;  1BNC A;  1Y1V G;  1Q1E A;  3SE0 A;  3SEB A;  1HR0 Q;  3D8G A;  1CT1 D;  3CCM A;  1WSC A;  3BQ0 A;  4JI8 Q;  1EIH A;  2CWP A;  5BPF A;  2B2W A;  5K2M A;  4A3C H;  3D0F A;  3X3M A;  2EYL A;  1HNZ Q;  2UUC L;  3K5N A;  1VQ4 A;  2OEO A;  2WB1 E;  2DGY A;  1SYF A;  1WTQ A;  1JR0 D;  4Y8V B;  3GIM A;  2HUG A;  2WB1 A;  3JAM W;  3A5U A;  1VQM A;  3VMM A;  1K8A C;  4XZ3 B;  5IGB A;  2N55 A;  3CCQ A;  1CQJ B;  4DR6 Q;  3NQT A;  1NMG A;  5KNB A;  4Q0Y A;  3TBI B;  5CA0 F;  2IT1 A;  4HJA A;  2WKC A;  1VBH A;  5IOD A;  5LMU H;  2WE6 A;  5IYD G;  4J15 A;  4K5X A;  5I6W A;  3T51 B;  5KFQ A;  3GTM H;  4DNT B;  2K28 A;  4O4I F;  4LSX A;  1UNS A;  2E8G A;  1LTR D;  4IUQ A;  3CCJ A;  4C1N I;  4DV6 Q;  1SNO A;  3T5H A;  1Q1B A;  3DEP A;  3V4Z A;  1ZHS A;  4H7B A;  1XPR A;  4DV5 Q;  2A73 B;  4NPS A;  4LF9 H;  3QFF A;  3RB3 A;  2EYM A;  4MTE A;  1HZA A;  1CZW A;  4QWE A;  1QIL A;  3BS1 A;  5EBC A;  3CF5 A;  2WB1 B;  5DLQ E;  2OWO A;  1TWA B;  2NU8 B;  2E5L H;  4TSS A;  1PH8 A;  1B2T A;  2SNS A;  1BCP C;  3OSP A;  4DV0 L;  1W2B A;  3CU7 A;  2R7L A;  3EA6 A;  1I4G A;  4OWT B;  2AGO A;  4PNY A;  1TA8 A;  5C3E H;  1PH5 A;  4AQY L;  1EIY B;  4JYA Q;  4TKO B;  1J5E H;  1QJO A;  1CUK A;  3BZK A;  4LH6 A;  4MA0 A;  2R93 H;  3IN5 A;  4YBZ B;  2UXC H;  1I3Q B;  4FBU A;  3HZX A;  5KFL A;  4KY5 A;  1N56 A;  1E4E A;  4RCN A;  4UHV A;  5IT9 L;  5F9N A;  1SMY D;  4CC6 A;  4YWM A;  1ZYR C;  1N32 L;  4KD4 A;  1PRT B;  3RV4 A;  4KKS A;  2KHI A;  5ELC A;  1C0A A;  4F4Z A;  1SFO H;  2CH4 W;  4JW0 A;  5KFD A;  1GUN A;  2QW7 A;  4DV3 H;  3HOZ H;  4A3D G;  4IR9 A;  2MO1 A;  2PQA B;  5LL6 X;  5AJ3 Q;  2NN6 G;  1PH6 A;  1TS4 A;  2K5D A;  1M0T A;  1KNE A;  1S5F D;  4HMJ A;  2UUC H;  2AQ4 A;  1GXD C;  5D1O A;  4QUC A;  4RZR A;  4TQS A;  3F2C A;  3FPP A;  4XX0 B;  2P5Z X;  1JXL A;  3K0X A;  3IFD A;  4X64 Q;  3PO3 H;  2R93 A;  5KG0 A;  3DWA A;  1BBU A;  1FNU A;  3I70 A;  4M8A A;  3CQZ A;  1Q8I A;  1JC7 A;  5G3L F;  4J9M A;  2R7Z A;  1SYX B;  3M9N B;  4DR5 H;  3PR4 A;  4TVA B;  4LSA A;  1SYG A;  3RMH A;  1S5E D;  3CC4 A;  1Z2O X;  2GLT A;  4DK1 A;  4MV9 A;  2UXB Q;  1H9S A;  4CKC A;  2E5L Q;  1SSO A;  3NWS A;  2B2T A;  2VB3 X;  2NVX B;  2KBN A;  3MFY A;  5BR8 H;  3HOY G;  4DK0 A;  1O7I A;  4GKK L;  1EU4 A;  1UWV A;  3K7A H;  3DM3 A;  1UEB A;  3R5X A;  4YJ2 F;  2KQ3 A;  2WDT A;  4MAM A;  1N33 H;  2FPG B;  3PO3 G;  3GTL A;  1KJJ A;  3WOE A;  1JB3 A;  3JAM i;  3GO5 A;  4LF8 H;  1QOH A;  3CRK C;  2P0A A;  5KFZ A;  3IFT A;  5KYI A;  2VQE Q;  3BAA A;  1FYC A;  2UUA H;  4YCW A;  2R6F A;  3NWT A;  4ZI7 F;  1PRT F;  1D7Q A;  1E2W A;  4LF4 Q;  4B3S H;  3LWB A;  3S1M B;  2B8F A;  3GQC A;  4QWB A;  4C3H B;  4MV1 A;  2ZT9 C;  2CZG A;  4G3I A;  5ELD A;  2PZU A;  4LF5 L;  1L1O C;  2K5H A;  3PR5 B;  4GOP C;  1RJR A;  1ZET A;  4AYB G;  4IRK A;  4JOI A;  1S03 G;  3J81 j;  2XCP A;  2I5L X;  1D5Z C;  5GRO A;  3RUP A;  5JEA J;  1ZYR D;  3HKZ E;  3KK7 A;  4RFB A;  4X62 Q;  1C4Q A;  4LUZ A;  4JV5 Q;  1BJT A;  2NVX A;  4O2A F;  3HKZ A;  2IX1 A;  3NTH A;  5GAE C;  2JEB I;  3TIG A;  3RZD B;  3PN1 A;  4UFZ A;  4LFC L;  4JI7 L;  1A9X A;  1C3O A;  4OWW B;  2D5D A;  1A3V A;  4UCU A;  4RAZ A;  4BWS C;  5KG2 A;  1OXV A;  3HOW G;  1PTO B;  2K50 A;  4DL7 A;  4LFC Q;  4TQR A;  5C3E B;  1MSH A;  2GVB A;  4B3R L;  2ASL A;  2JP1 A;  2QYZ A;  2RHS B;  4JI1 L;  4GOP A;  1V43 A;  2QF7 A;  4FVM A;  3L2P A;  1WVL A;  1HRJ A;  5KG5 A;  4DPG A;  1EQV A;  5KYL A;  5DG8 A;  1TVX A;  3UQ8 A;  4IHJ F;  2IW3 A;  3EBE A;  3CRL C;  2F52 A;  1PZI D;  1PYB A;  3VYR A;  4J9R A;  5EZY F;  1FJG Q;  3RN2 A;  1JIC A;  3GTP B;  3C0F B;  4X66 Q;  1HTL D;  3GP7 A;  3HKS A;  3NBH A;  2HVR A;  4C5B A;  2QK4 A;  5TSS A;  1MJE A;  1V1Q A;  3M4I A;  3J81 i;  4ZUJ A;  4JI7 Q;  4CGY B;  1PVO A;  5EOY A;  4POG A;  2AWO A;  4HN7 A;  3S2D B;  4AYB A;  1OO9 B;  2VQF H;  3E0J A;  3SXH A;  3TP5 A;  1RF2 D;  1A63 A;  1DOL A;  4QW8 A;  3GTQ A;  1EOV A;  5M5Y H;  2NU7 B;  1DD2 A;  4FO2 A;  4MV8 A;  1XMO Q;  3LX0 A;  1ZQ7 A;  4LNQ A;  4L5R C;  2RSO A;  1BNZ A;  4BY7 H;  3NSW A;  1KAB A;  2K1B A;  1JKJ B;  4LFA L;  4Q8E A;  1N48 A;  1KRS A;  5M5W B;  5DQH A;  4EBC A;  2AWN A;  2EIF A;  2YRW A;  1Z47 A;  1HFG A;  5DM6 3;  4BY7 G;  5I47 A;  2IWH A;  1S5B D;  1PTO F;  3G4S A;  2GN5 A;  3LML A;  3PW7 A;  1JLL B;  4ETS A;  2VQE L;  3KF8 A;  2LY7 A;  1U0L A;  2HD3 A;  4OL7 A;  4O2D A;  3G6E A;  4OON A;  2B2U A;  4RAU C;  2WIN B;  3I4N G;  2JA9 A;  3T16 A;  4J0M A;  5KFP A;  2BQU A;  5IYC G;  2NN6 I;  3GTQ H;  1VS0 A;  4TV9 F;  2ASD A;  3RF2 A;  1BQQ T;  3GII A;  5LMN L;  5E3F A;  2YTX A;  5CB4 F;  1IBK Q;  2N8N A;  3DHQ A;  4QB4 A;  1E2V A;  1RK5 A;  1BVS A;  2HGS A;  5FO9 B;  3A55 A;  1OXT A;  3PVX A;  1LT6 D;  3A74 A;  2D0O A;  2WYO A;  1LT4 D;  3PF5 A;  1B6S A;  3M4Y A;  3KAJ A;  2X6L A;  1BGW A;  3S15 H;  4YY3 Q;  1XNQ L;  2V4Q A;  4IFD H;  2X69 A;  1PH3 A;  4GN4 B;  5CV8 A;  2F0J A;  3K7U C;  1E3P A;  2JQO A;  3K81 C;  4IAJ A;  4I7Z C;  4DAY B;  4LMY A;  5E4W C;  5JVL A;  5M3M H;  2MFI A;  1SNP A;  3S14 B;  2R7Z B;  1RJT A;  1KC8 C;  1VQ5 A;  2C2E A;  3M4P A;  1H9K A;  3RR5 A;  4MV7 A;  4DR4 Q;  2Q2U A;  4AQY Q;  1XMO H;  1GSH A;  3RFC A;  4A76 A;  2JA6 B;  3V96 A;  4LFB H;  4RU9 A;  2WFW A;  1BOS A;  5JJL A;  4ED6 A;  1KL9 A;  1I4P A;  1VQB A;  4P73 A;  2CKZ B;  5JAV A;  4FF1 A;  2CQA A;  1SNC A;  3GIL A;  5J1Z A;  1TWF B;  4IFD G;  4OEL B;  5KFK A;  3K5H A;  1A6X A;  1JB7 A;  2X6G A;  2A6E D;  2XSC A;  1A15 A;  3GTO B;  2FMC A;  5JOB A;  1K28 A;  5AFW A;  5CBE E;  5KG6 A;  2CQY A;  1IKL A;  1Z2N X;  4LH7 A;  2NYZ D;  4DAM A;  1F9R A;  3SVM A;  4IRD A;  3D3R A;  4LMQ D;  1TS5 A;  3RAX A;  1DZ1 A;  3M3Y H;  3L4J A;  2R8H A;  2GPS A;  4DR1 Q;  4DR2 Q;  5EWE A;  1CI3 M;  1BKB A;  4RNN A;  2QDL A;  1PRT D;  3BDL A;  3E5S A;  5DQI A;  4A3E H;  1D1I A;  1TWA H;  4YWL A;  4K14 A;  4ZKB B;  1N34 H;  2MP1 A;  4PWQ A;  4DV4 H;  3V4S A;  3FDT A;  1I4Q A;  4IQZ A;  4MA5 A;  4C3J H;  5J39 A;  2HDL A;  3CC2 A;  2MQH A;  2PNR C;  5F9L A;  4OO1 H;  4RAY A;  5KFM A;  1A0I A;  1A62 A;  1EEF D;  1FD7 D;  4O3R A;  3S1R B;  3CW2 C;  1NTG A;  3ETJ A;  5KG7 A;  3CQZ H;  1S9F A;  4E6I A;  1M8A A;  1ZXT A;  5FPO A;  4J9Q A;  5DNF A;  2E5L L;  3HOZ B;  3W1G A;  1GM5 A;  1CKN A;  5I6Y A;  5FLX E;  1JOQ A;  3Q2O A;  2UUB H;  2W6M A;  4ULL A;  1KJI A;  4I7H A;  4EFE A;  3N42 B;  4PZ8 A;  5IP9 G;  3K8A A;  2XWJ B;  1LTG D;  2NN6 H;  4P72 A;  2WKD A;  2F4I A;  1YIT A;  2I46 A;  4QY7 A;  4LF5 H;  1A2U A;  3D6W A;  3T1Y L;  2EXD A;  3HOX B;  4OX9 L;  2NU6 B;  2ZM6 L;  3C2P A;  5DGB A;  1MBY A;  4V0B A;  4FS2 A;  4IJL A;  4N8X 1;  5EPL A;  4CBV A;  4EG0 A;  3LP8 A;  1H9R A;  3ORQ A;  2ZM6 Q;  3RTX A;  4L5Q A;  4Q43 A;  2FIN B;  1M6V A;  4ME6 A;  2R92 A;  1HQR D;  3UI2 A;  1GGO A;  4UCT A;  3QG1 A;  1X55 A;  3F8N A;  2R8I A;  1DGS A;  3K7A B;  4GC7 A;  3RB0 A;  3RB6 A;  2BH2 A;  2UU9 L;  5IYC H;  2JN4 A;  2W9A A;  4L1K A;  3ICE A;  1TS2 A;  2Q8T A;  3R8B A;  4XXE A;  1N34 Q;  1TQO A;  1G8Z D;  1J8I A;  3JSL A;  1ENF A;  2NVX H;  1IOV A;  2AGQ A;  4JYA H;  5COR A;  2CW8 A;  2NUC A;  2M05 A;  4IWY A;  3GD7 A;  3RB4 A;  3DUZ A;  3TSS A;  1OXX K;  4OGQ C;  4RH6 A;  3JAM L;  5IYB G;  4J8Q A;  4C3H G;  1XTC D;  4JV2 A;  1FGU A;  1SDF A;  4KKT A;  1VQ7 A;  4HJ9 A;  5JQW A;  1BBX C;  1RJP A;  2SDF A;  5E4X A;  3WDN A;  2NVT B;  5D14 A;  2PMZ B;  2K01 A;  2ZXP A;  3SK4 A;  2B2W C;  5C3X A;  4EGJ A;  1Q86 C;  1TWF H;  3OWE B;  3J7Y W;  1NR4 A;  1PTO D;  3AEV A;  3TQT A;  1SRU A;  2F0O A;  3GIJ A;  1VQJ A;  4DNI A;  3UDG A;  4C3J B;  3I12 A;  1OXU A;  2A6H D;  4DUY L;  1B9M A;  1HNW H;  2PQA A;  2PYK A;  5EQ0 A;  3K59 A;  2VUM H;  4QIW A;  3PMF A;  1ESR A;  1WH2 A;  3H4D A;  5C4H A;  2EYO A;  3P7J A;  4MZ9 A;  3S17 H;  4DGZ A;  1AE2 A;  1TII D;  2KVM A;  2H1E A;  1UE5 A;  2JA5 B;  2HVS A;  2AU0 A;  2XRQ D;  5FPR A;  3ND9 A;  3D4R A;  2JA7 G;  2ZM6 H;  3IKJ A;  4KHP L;  2F0D A;  4B9X A;  1QNU A;  3WOF A;  1IOW A;  1JIH A;  4QWD A;  2F0K A;  3CCV A;  4IN3 A;  3PGZ A;  3FRP B;  3DXJ C;  1ZEQ X;  5DLF A;  5C44 B;  1SN8 A;  2IPK D;  3SK6 A;  3JZI A;  1WCM G;  5BR8 Q;  5FLX W;  1WCM H;  1I94 Q;  2G5D A;  4A3B H;  2ICI A;  1G29 1;  2DPI A;  4UAI A;  3HOU B;  2F0H A;  1KJ8 A;  4DR1 L;  4K0K L;  1MZB A;  2JA5 A;  1NMF A;  3S1R H;  5IT9 c;  2B8G A;  2L4N A;  3H6M A;  5COY A;  1V51 A;  3G8C A;  1S10 A;  4WRD A;  2FMM A;  1QVF A;  3JRW A;  4JI8 H;  4NXN Q;  1YJ9 A;  1VQF A;  1IZ6 A;  1VQE A;  1VDZ A;  4GNX B;  1VQK A;  2W9B A;  1FL0 A;  1VQC A;  2VB2 X;  5ELB A;  4DKA C;  1JT8 A;  2EYH A;  4NXN L;  4R8U B;  1AZP A;  1FJG L;  1K83 B;  1HNX H;  3GTL B;  1LTB D;  4DV4 L;  3TEH B;  3UDF A;  2F4V Q;  1I6U A;  1IHZ A;  4B3T Q;  4KHP Q;  1SRO A;  4P74 A;  4Q45 A;  1VQH A;  4DUY H;  1B4O A;  3K0Y A;  3OTO Q;  2XD4 A;  4HIO A;  4DV5 L;  2ASB A;  3UE1 A;  1H9S B;  2Q2H A;  3QJY A;  3U50 C;  4LF9 L;  5CV5 A;  4A3D H;  2C00 A;  2K7V A;  4DAV A;  1UE7 A;  1FNW A;  1MKH A;  4ALP A;  3URY A;  3PO2 H;  4TUY F;  3FHW A;  3KBX A;  4EQ5 A;  5KG1 A;  3EPG A;  3VR3 A;  4BY7 B;  1XNQ Q;  3CQZ B;  5KT5 A;  3IAY A;  2Y0S G;  3MFG A;  4QMG A;  2KSW A;  3M4Q A;  2R93 B;  2ATW A;  3GLK A;  4UCS A;  3WO1 A;  2F0I A;  4ED0 A;  3FEW X;  5FJ8 H;  2FK2 A;  2I80 A;  1VQN A;  3BQ2 A;  4ED2 A;  3G6J B;  2HCI A;  2R86 A;  5DM7 3;  4DL6 A;  3NK9 A;  2UXD L;  1HZC A;  2O03 A;  2V5A A;  4YHH Q;  1Y14 B;  3A5Z B;  5KFF A;  3HEJ A;  1J5E Q;  4ED8 A;  2KCT A;  3L7Z C;  2F0M A;  3QOL A;  2YU9 B;  4XYL B;  2CCZ A;  5EDW A;  2Q2I A;  2B63 A;  4ILW A;  5FLM G;  1HR0 L;  2EY2 A;  5KT7 A;  2PMZ E;  1RCV D;  2LMC B;  2VA2 A;  1KBL A;  2F3I A;  1HA5 A;  1S5D D;  4XTC S;  3VA5 A;  4GLA C;  5DG9 A;  3I8Z A;  3NXW A;  1KQS A;  2KCN A;  1VQ9 A;  1RYS A;  1BXR A;  2EJM A;  4IFD J;  1Y1V A;  3A7L A;  1LT5 D;  3PUZ A;  5KFU A;  1HNX Q;  1NCV A;  3G48 A;  3ULL A;  2Y0S E;  1HTP A;  2NZO A;  1QZH A;  4JI0 L;  4QQB X;  2F4V H;  4K0K H;  4JI3 H;  4GS3 A;  1K0R A;  4HIK A;  1QUQ B;  4JV0 A;  1Y1W H;  3T5L A;  1LTT D;  4YY3 L;  4WJ3 M;  4MTD A;  4EQP A;  5KIX A;  2K6A A;  1KAW A;  5A35 A;  3S14 H;  4ECQ A;  4FF3 A;  4UCR A;  5L1J A;  1N36 H;  3MWE A;  2H5X A;  1E24 A;  2BE5 C;  2HQL A;  5J3B A;  4UP7 A;  2B63 H;  2KJX A;  4C3I B;  1SEB D;  1I50 B;  1XNQ H;  4WJW A;  4A3F H;  4ZCK A;  1MI2 A;  2B29 A;  1LLR D;  3R23 A;  4ZHQ F;  5JPN C;  2EY1 A;  5KGU A;  2HIX A;  2L5T A;  3BDC A;  2F0S A;  4ECV A;  3R2I A;  3FVQ A;  2FHT A;  3I4L A;  4MNO A;  4OIJ A;  1C9O A;  3PUV A;  4YAK B;  3T5K A;  1X3G A;  1K8O A;  1EHI A;  5KFJ A;  2QCP X;  1CA5 A;  3H94 A;  4YHH H;  3RJ0 A;  3ULJ A;  1OXS C;  4RB3 C;  3MZ5 A;  1W96 A;  3M9M B;  1F9P A;  1SNQ A;  1SYC A;  2JK8 A;  3NHH A;  3GTG H;  2ZDG A;  4A3L G;  5KFC A;  1ET9 A;  5C0X I;  1A3U A;  2OF1 A;  1QE6 A;  4B3T L;  1VKZ A;  3T53 B;  3EYY A;  3MJF A;  2NWG A;  1X56 A;  2YTY A;  4RGM A;  2IJ0 A;  1G6P A;  4JI4 L;  3N52 A;  4RB0 A;  4BBS G;  3HOV G;  3HRZ C;  2ZDQ A;  1QB5 D;  4KY7 A;  3K6O A;  1N32 H;  1PTO C;  2EVB A;  4G7O C;  4UDU C;  1TWG B;  5EGT A;  2Y0S A;  1EQR A;  5D3D A;  4RGO S;  1D2B A;  2AQ2 B;  2DN8 A;  4OX9 H;  4A3J H;  4JI3 Q;  2V59 A;  4YCV A;  5M3F B;  4JUZ A;  5KFO A;  2R92 H;  1IBM L;  4A3D B;  4UCO A;  1MD2 D;  1Y8O B;  2EJF C;  4Y7N H;  5C5J A;  3C1F A;  5C0X J;  4E4T A;  3GTG A;  3UFX B;  4HSV A;  1RK6 A;  1EIF A;  3E9H A;  3QB3 A;  3HOX G;  3J7A F;  3MFI A;  2QEJ C;  3HS0 C;  3DWP A;  2ICE C;  1QVC A;  4QL5 A;  4GKJ Q;  2RQX A;  1RL2 A;  4BA1 I;  1VQ6 A;  1E4G T;  4K5V A;  2R8G A;  2A19 A;  2Z8L A;  2I87 A;  1SE8 A;  2L12 A;  1O7L A;  1T9H A;  4ODG A;  5CR3 A;  4O4L F;  2YV5 A;  3AB9 A;  5IWA Q;  5BN4 A;  1I4R A;  2G9H D;  4KJO A;  5IE8 A;  4MV3 A;  2BA0 A;  3BQ1 A;  4LK1 C;  2RCF A;  4DR1 H;  4DR7 L;  1YNJ C;  2EJG C;  4DR2 H;  4A3I G;  3KF8 B;  2HT1 A;  2VY3 A;  4K8I A;  3H15 A;  5A2Q W;  3ZJY C;  5CAE B;  3P20 A;  3PIP 3;  3MXG A;  2BDO A;  2YZG A;  2B2T C;  5IP9 H;  3PO3 B;  4GOP B;  4R7R A;  1FJG H;  3OPO A;  1W3S A;  2Z0S A;  5G3L D;  5KFH A;  4DV1 L;  4X66 H;  3T13 A;  2XC9 A;  4JI7 H;  2I8C A;  4O3P A;  4IUU A;  2EZV A;  2BQR A;  1CKN B;  3FPU B;  2FPI B;  2XIG A;  4O1N A;  2FLP A;  3K5O A;  1PH7 A;  2VQF Q;  3VDY A;  4PG3 A;  4WFN 3;  5C4X H;  5CA1 F;  4I50 F;  1B53 A;  1LTS D;  1HXY D;  3J7A 5;  4LFA Q;  2E2D C;  1ICW A;  3SE7 A;  2XN9 C;  1U4P A;  1F9S A;  1HR0 W;  1YBY A;  4DLK A;  4C3I H;  4CKB A;  4R8I A;  1WCM A;  4JI5 L;  1C7Y A;  3H3V I;  2NVY A;  2O5I C;  1DJR D;  1HZB A;  2NVT H;  3H0G A;  2HDM A;  3KAL A;  4HQ6 A;  5JPM C;  3CCR A;  4LF5 Q;  4GKJ H;  1V9P A;  4JI0 H;  4KN7 C;  4UP8 A;  2EE1 A;  4LF6 Q;  3AFP A;  2K4K A;  3I72 A;  4JI5 Q;  2HHH Q;  3I7F A;  4DR5 L;  2DY7 A;  4HNV A;  1ENC A;  1PRT C;  3I2Z A;  1B6R A;  2JA7 B;  3OSO A;  2JA7 H;  4YCU A;  4K2K A;  4RHS A;  1CSP A;  2DWC A;  1PH9 A;  2XWB B;  2NVY B;  1TWH H;  5C3E G;  4A93 G;  5HGT A;  3GID A;  5JJI A;  5C44 G;  1XMQ H;  1WCM B;  3GTO A;  3T1Y H;  2C2R A;  5LP6 F;  2V4R A;  4RB2 C;  2YL2 A;  1STA A;  2DJF C;  4JC0 A;  1GO3 E;  3EVQ A;  3HOU G;  4Q44 A;  1IBK H;  4X66 L;  4IUV A;  4IZO A;  4QWC A;  2A6E C;  1AE3 A;  4OIK A;  2HVQ A;  4DV1 H;  1GUS A;  3UDX A;  2UXD H;  4RB1 A;  4AH6 A;  4HR7 A;  1I3Q H;  1STN A;  1JWM D;  3VA7 A;  4FU0 A;  3NEL A;  2BDN A;  2MJ8 A;  3BU2 A;  3OW7 A;  1F9Q A;  1Z6H A;  4JPB W;  2C28 A;  1X32 A;  1HNZ H;  1M4V A;  1MSG A;  2VA3 A;  1S5C D;  3GTJ H;  2O4X A;  2IX0 A;  3KLS X;  1G2S A;  4QJF A;  5FLM H;  4AQY H;  1RIP A;  2ZJT A;  1TR5 A;  4WOR A;  1MHW C;  1B1Z A;  2UU9 H;  3K5M A;  5KFX A;  4IR1 A;  4LFB Q;  3VYU A;  2OH2 A;  1CQV A;  4HID A;  2RSN A;  4IWX A;  2QKI C;  5LL6 S;  3J81 L;  3L3O C;  1QUQ A;  4KV6 A;  4XYO A;  2KUM A;  3HFZ B;  4LF6 H;  1CM9 A;  3OSN A;  2HHH H;  1XNR Q;  3RUZ A;  3OTO L;  5L9X A;  1II3 A;  1SYB A;  4O3O A;  3S1N H;  4NMZ A;  4RWS C;  3ERQ A;  3HGB A;  1XX8 A;  3W1B A;  5IWA L;  2XTI A;  2RVL A;  1C30 A;  1GSO A;  3S16 B;  3AQQ A;  4L6T B;  4TV8 F;  3N41 B;  1YNX A;  1GVP A;  5HV6 A;  2E2H H;  3KTM A;  5I2Y A;  3KJP A;  4V19 0;  3I4N B;  4NXM H;  5EKI A;  4DV7 L;  5T1I A;  2CHB D;  4F50 A;  3NTK A;  3SI8 A;  3VYS A;  5I4D A;  3TRE A;  2YU9 H;  4JI1 H;  1JJ2 A;  1WTO A;  1KJ9 A;  4ECZ A;  1KNA A;  4C1N K;  3N6R A;  2JEF A;  1W6J A;  1YHB A;  2L9H A;  3FKI G;  4O3S A;  4HSP A;  4CDE C;  2RA4 A;  2K5W A;  3T1H H;  3DEO A;  4NXN H;  3PW4 A;  2M9V A;  3S1M H;  3N40 P;  3MR5 A;  2IHF A;  2R61 A;  4FM9 A;  4RNO A;  2L1B A;  1VAJ A;  5M5X B;  2R84 A;  2X0S A;  3RD4 A;  1I4X A;  1NAP A;  1T5X D;  1B7Y B;  3NGD A;  1PYS B;  4GLV B;  1JWU D;  1PFB A;  1CQI B;  3HB9 A;  1MIU A;  4B3T H;  2DUD A;  4CJ2 C;  3U4Z A;  2K04 A;  4LUV A;  5IY0 A;  5JH7 F;  3D31 A;  4NW2 A;  4F87 A;  5JJK A;  2OT2 A;  4MIU A;  4JI4 Q;  2XCL A;  2YU9 A;  1WD0 A;  3CHB D;  4DV2 Q;  2OQ0 A;  2ES2 A;  4P75 A;  1XNR H;  5BN5 A;  5J2U F;  4H13 C;  5DQG A;  1SLJ A;  4ECR A;  2AMC B;  3TQY A;  4R8U A;  1JOR A;  3D4D A;  1WOC A;  1BCP D;  1PTO H;  4YB8 B;  2D2C C;  2L11 A;  1LO5 D;  5KFR A;  3SGI A;  3DWQ A;  4A3J G;  4IPH A;  1IBM Q;  1U5K A;  4IO9 A;  4XQN A;  2RBM A;  1YJW A;  3J7A V;  4JYA L;  2AKW B;  4WBN F;  3TP7 A;  2IX3 A;  1MJC A;  5K5P A;  2NVQ H;  5KFW A;  5LMN H;  3HBL A;  3NTI A;  3I55 A;  4FP5 D;  5I2X A;  3HOV H;  3VPC A;  1IL8 A;  1H95 A;  1U4L A;  5HGQ A;  4A3K H;  2C2D A;  1BCP F;  2QIL A;  2KEN A;  3K80 C;  1DV2 A;  3A56 A;  1LAB A;  3T1H L;  2RKS A;  3EFX D;  1R9T H;  1EOT A;  1KD1 C;  4LF8 Q;  4BBS B;  2FMA A;  1IL2 A;  4QCL A;  3U58 A;  3U9S A;  1E2Z A;  2VQE H;  4MHE A;  4KMU C;  1GUO A;  3K5I A;  3RZD H;  4A3M G;  1SE3 A;  2HCC A;  4ECY A;  1WTW A;  3CAM A;  3KOJ A;  2QEX A;  1SMX A;  3TP8 A;  4EYH B;  2B2U C;  4LF8 L;  3T4A C;  4FXK C;  3A8K E;  1ICF B;  2WAQ E;  3OHA A;  3V2T A;  3MR6 A;  5KX5 F;  4XT1 B;  4RG1 A;  1S3O A;  1SJE D;  4CDD C;  3KBG A;  1S0O A;  1GUT A;  1IYJ B;  3HKZ G;  1B8A A;  2A8V A;  5E7N A;  1FNV A;  2ZTC A;  4A3E B;  4A3L H;  1JCK B;  2K03 A;  1PV4 A;  1S0M A;  1CA6 A;  3E6Z X;  4ZOL F;  3GTK A;  4U67 3;  3M9O B;  3RGX A;  4PDB A;  3F2B A;  2B2Y C;  2ZXO A;  4LUO A;  4XIG S;  1HNW Q;  5CV7 A;  1N36 Q;  4LF7 H;  4HYK A;  5C5L A;  5FD6 A;  4A3G B;  1VF5 C;  5IGE A;  3CCS A;  1R9T A;  4B3R H;  4BXX G;  5EKK A;  1VQO A;  3IRB A;  2RCN A;  2Z6K C;  4K6L A;  4JBK A;  3IG0 A;  2AHO B;  1EWI A;  2R92 G;  3DF7 A;  1N8R C;  2RDI A;  3ORR A;  4IOC A;  4RZQ A;  3MWM A;  1IBM H;  3DMU A;  5GAD C;  4LFC H;  1XPU A;  4YIJ A;  5D3I B;  3R3O A;  3BVZ A;  4XYM B;  4A3I B;  3L4K A;  4IUR A;  4YR2 A;  4BBR H;  5LMU L;  3CCE A;  1S68 A;  1DXM A;  1ML0 D;  1BCP B;  2F3V A;  3VYT A;  5HBR B;  3ULP A;  2UUB L;  2NU9 B;  4R8N A;  3GTK H;  5KFE A;  2VUM B;  3GTK B;  2EY5 A;  1J9O A;  4MTK A;  3KDF B;  4XQQ A;  2EYJ A;  2NUA B;  3CP0 A;  2IHE A;  3S17 B;  5JEA H;  3MXP A;  5L1K A;  1TWC H;  2IA6 A;  1QZG A;  1UE6 A;  1IXR A;  4L5T A;  3V6J A;  3I3C A;  4FNF A;  4U7C A;  4I65 A;  4NLG A;  4EEY A;  2N3S A;  3R5H A;  2ZJR A;  1YVC A;  2BR0 A;  4HJ5 A;  4ED1 A;  2LSS A;  2K5Q A;  3GV5 B;  2JE6 I;  5GQO A;  2YTV A;  4OX9 Q;  1G51 A;  4HCS A;  1VQL A;  1B44 D;  3NBI A;  1UC9 A;  2YRX A;  4KHP H;  4O4H F;  4S3S A;  4DUY Q;  1ONL A;  2FB9 A;  3FMA A;  1PK8 A;  2NTS A;  1ET6 A;  3RNU A;  2XCA A;  2MGS A;  3KF6 B;  5CMD A;  1HUN A;  3OTO H;  2A69 C;  1I94 L;  1SCU B;  2FE3 A;  4U68 A;  4DR4 L;  3J81 c;  5T1G A;  1IKM A;  4DA2 A;  2VPQ A;  4F7X A;  4DR6 L;  3J80 E;  5CGK A;  4DR3 H;  4R4O A;  4EBE A;  5KFG A;  3PUX A;  2JXM B;  2PVP A;  3EJI A;  4A3C G;  4LJZ C;  1GJX A;  3X3N A;  3MHB A;  2ZDH A;  4RUC A;  1HH2 P;  4YHH L;  3HG9 A;  1TWA A;  2R8J A;  4DV6 L;  1TWH B;  1KTK A;  4A93 B;  3TII A;  3Q8R B;  1Q46 A;  1U4R A;  4QF4 A;  1BF4 A;  4A93 H;  2K5N A;  3PW5 A;  1JJC B;  2WAQ A;  3LNN A;  5D1O B;  3KHG A;  1HQM C;  1PH2 A;  4KD3 A;  1EY0 A;  2K32 A;  2FJZ A;  1IW7 D;  2N49 A;  4ZUI A;  1I5F A;  1STY A;  4KHV A;  2PZW A;  5KEE A;  3AYH B;  1PLF A;  1SJH D;  1RTO A;  2J6T A;  4DXF A;  1CHP D;  1K3R A;  1LTL A;  3PO2 B;  4DL4 A;  2HQE A;  5DEH A;  3B6Y A;  4JOI C;  1U9R A;  3TP6 A;  1PX2 A;  3FKI A;  5BPH A;  1ULZ A;  4IUT A;  1SND A;  3HXL A;  4X65 H;  4C2M A;  1QNK A;  5E1F A;  1TWG H;  1X54 A;  1WI5 A;  1X6O A;  4XQJ A;  1ZHQ A;  1IW7 C;  1HZ9 A;  5C1O A;  1I6H B;  1AH9 A;  3RN5 A;  1YNN C;  4DR7 H;  2J9G A;  1M0W A;  3A8I E;  2Q2T A;  2NB0 A;  3VPB A;  1GKH A;  2RDJ A;  3VR2 A;  4LFA H;  2XNA C;  1X3E A;  4IJH A;  4EX5 A;  4FXG C;  1EQQ A;  2O2L D;  2IBK A;  1EWH A;  2KCC A;  5FLX c;  2VR1 A;  2N78 A;  3A7A B;  1SE2 A;  4CJ1 B;  4A3B G;  2GA4 B;  5EWG A;  4J9O A;  3HOX H;  5KFV A;  3J81 W;  1HR0 H;  3AFQ A;  1YJN A;  1HA6 A;  2F03 A;  2KED A;  2KHS A;  3BVM A;  1D6E C;  3BG5 A;  1YZ6 A;  1EYG A;  4A3K G;  5M9O A;  3S1Q H;  1WJJ A;  1KC7 A;  3S1Q B;  2Y0S B;  1TWG A;  3GIQ A;  2A69 D;  3PCO B;  5KND A;  4A3I H;  2R93 G;  5BMV F;  4K8J A;  4YR0 A;  4ZK9 B;  2ATL A;  3GTL H;  1PH1 A;  5NUC A;  1AUX A;  3RZO B;  3OMG A;  3R5F A;  2CH4 A;  3BG3 A;  3H09 A;  1CFM A;  5FD5 A;  2W6N A;  4RA8 A;  5D1P A;  2CFM A;  1CS0 A;  3I73 A;  1E4F T;  3I4M B;  2C22 A;  2PN1 A;  1C8C A;  2WAQ B;  4HTH A;  5M3F H;  1FKA H;  4IRC A;  3JC6 6;  1F2L A;  4F4X A;  2JJQ A;  3Q24 A;  4XYQ A;  1PHJ A;  3BVG A;  4J9N A;  2W7O A;  4PV1 C;  3SDZ A;  1PZK D;  1W6K A;  3TZD A;  4IUP A;  4JI8 L;  1V1P A;  2L0C A;  1STB A;  3F8T A;  1LTI D;  4DV4 Q;  1L1O A;  1I50 H;  2IP4 A;  3H40 A;  1X3P A;  2PNH A;  5KFY A;  3STB C;  1EY7 A;  1XYI A;  5KFB A;  5KT4 A;  4DV5 H;  2EYF A;  2OCE A;  5IP7 H;  2N88 A;  5K36 H;  4A2B A;  2EPB A;  4EFB A;  1BO0 A;  2DJG C;  4BY1 G;  1VQP A;  2V9W A;  1ROD A;  5EJW A;  4DAY A;  3PIO 3;  5IGG A;  1Q90 A;  2Q8I B;  4KJN A;  1IBL Q;  2L15 A;  2I07 B;  5L1L A;  4UCV A;  4BBR B;  1PH4 A;  1HPC A;  1KLG D;  3K5L A;  3KF6 A;  5M5X H;  2B63 G;  2UU9 Q;  3W3A A;  3F1Z A;  1V1P B;  1KAA A;  1GLV A;  2O5J C;  2F3W A;  3ERO A;  3SR1 A;  3OIP A;  5JJZ A;  3BA8 A;  3J80 L;  5EPJ A;  5EKL A;  4C3I G;  2JEJ A;  3JRX A;  4ZQ3 A;  3GDE A;  1KRT A;  4KN4 C;  4EQO A;  3UE0 A;  4FF2 A;  1TAE A;  4A3J B;  5ELF A;  4APV A;  1XTD A;  2UUA L;  1QCB D;  3M4O B;  1WTH A;  4DV2 L;  4JI6 L;  1O80 A;  4FBT A;  2B2V C;  5H80 A;  2EYP A;  2JA6 A;  4MTN A;  1L2Z A;  4BS9 A;  1NE3 A;  4YAJ B;  5FKA C;  3O13 A;  4NXM Q;  2YYA A;  2K52 A;  1N33 L;  4ZKC B;  1CQF A;  1EZ8 A;  4Q0F A;  2CW7 A;  4WJ4 A;  1VMC A;  5IYD H;  3HP3 A;  3NEM A;  2W6O A;  5JVD F;  4X64 H;  4JI1 Q;  5LYJ F;  2BE5 D;  1EEI D;  4DL2 A;  4A3F G;  2VW9 A;  2PCF B;  3D6C A;  1S97 A;  2XGT A;  2K75 A;  4ZLT F;  3MXU A;  2W9C A;  1CE8 A;  5C0X G;  5IGF A;  5HUR A;  3HOV B;  3TDQ A;  4F4W A;  4B3S L;  1SFO B;  5EWF A;  4O3Q A;  1XDN A;  3KLR A;  3KLS A;  3DLL A;  1SR3 A;  2BQ3 A;  1R9T B;  1XXG A;  2XGQ A;  4DR2 L;  1BXT A;  3EIV A;  5FJ8 G;  1WTX A;  3RZO H;  2J0T D;  1SYE A;  4B3M L;  3MFH A;  3GTM A;  5GON F;  1K1Q A;  3NPP A;  5M3F G;  3RGZ A;  2UVV A;  4LAA A;  1S72 A;  3SK5 A;  1SNM A;  2LS0 1;  4C56 C;  2B2V A;  4C2M B;  1T36 A;  3HKZ B;  3Q22 A;  1AZQ A;  1RYR A;  4KTA A;  4A3E G;  4JCV E;  1XPO A;  3G6X A;  4K2L A;  3Q6S A;  3BZD B;  2DIK A;  1ILP A;  2UVU A;  1CKM A;  2JA8 G;  3LGJ A;  4A3G G;  3MWD A;  2W70 A;  1JJG A;  4JK1 C;  2DPJ A;  3M7G A;  1WTP A;  1K8G A;  2AUJ D;  4J9P A;  1WTR A;  3RLN A;  1EUJ A;  3H0G B;  4BWG B;  3Q8D A;  1JMC A;  1TWC A;  5EAY A;  3KHL A;  4HED A;  1EY8 A;  3NP8 A;  3TS0 A;  1EUD B;  4GNX A;  4L5S A;  2F0Q A;  3RLO A;  1F2M A;  2VPS A;  4DV7 H;  1E22 A;  4A3G H;  2FLL A;  3CCL A;  3WWV A;  2Z6B A;  3I91 A;  3T1Y Q;  2QDB A;  4Y7N B;  1QWY A;  1STE A;  5C4J B;  3Q1K A;  3U9O A;  2D62 A;  4X62 H;  3E5N A;  4HNU A;  1EY9 A;  1VBG A;  2M2L A;  4QGU A;  3GTJ B;  2UXD Q;  4IPC A;  3CD6 A;  4ME5 A;  1NNX A;  1SFO A;  3K57 A;  2R3Z A;  4HJ8 A;  4KHZ A;  5L37 A;  4DV3 L;  1PMR A;  2JA8 H;  1TWC B;  3GV3 A;  4EBD A;  4DUZ Q;  3OWF A;  4LF4 L;  2M00 A;  1B3A A;  1UC8 A;  5T14 A;  1WD1 A;  1ENA A;  4O2B F;  2R8K A;  4JVZ A;  1EIG A;  1TY2 A;  5HY6 A;  3TME A;  3L0O A;  1PFM A;  5L1I A;  1Y1W B;  2J4X A;  3S15 B;  1KXL A;  4X3T A;  2YS6 A;  1TT2 A;  1L1O B;  2KCM A;  1OTC A;  2EQS A;  4OHJ A;  4DU9 A;  3J80 W;  2RDH A;  3AMU A;  2BA1 A;  5C4X B;  3F2U A;  1M90 C;  4X62 L;  1D1K A;  5D8D A;  4GNX C;  4G7H C;  2R7Z H;  3M7N A;  2F0F A;  1G91 A;  4DV0 H;  2RF4 A;  3HOY H;  2ID0 A;  2FK3 A;  5EBD A;  5LA6 F;  5LMN W;  3EPI A;  4EVO A;  3KXY T;  1NR2 A;  4BA2 I;  3WO0 A;  3V6H A;  2R7N A;  4LF7 Q;  4H44 C;  3N8D A;  3WNZ A;  1YI2 A;  3FKI H;  2CW0 C;  1O7Y A;  4Y52 H;  2F0V A;  2JEG A;  1I7L A;  2D9U A;  4DV7 Q;  3C3L A;  3S2H H;  5M3M G;  5KT2 A;  4EEQ A;  3TN2 A;  3BAB A;  1R4P B;  2EY6 A;  1FVI A;  2YZN A;  1XMQ L;  4QUF A;  4C3H H;  4IOA A;  2JYO A;  4JV5 L;  2JSO A;  4M7E A;  1VQG A;  1UUP A;  1MGS A;  2HHH L;  3J7Z C;  3KLW A;  1YIJ A;  2AQ3 B;  5FK9 C;  5GAG C;  1L0X B;  4I55 F;  2RDF A;  3GV7 B;  3T1H Q;  1AFP A;  1SBB B;  2R82 A;  2R85 A;  4B9W A;  4HMI A;  1VCI A;  4RUA A;  5CV9 A;  3S1N B;  2FLN A;  2J7Z A;  2E74 C;  5BR8 L;  2Z1C A;  3M4O H;  2WB1 G;  4CJ0 B;  1SE4 A;  1L0Y B;  1YHA A;  5KG3 A;  2B39 A;  4K0K Q;  5C6A A;  4DNR B;  4WD3 A;  2PZT A;  1I6H H;  1E4E B;  4EQN A;  2XRS D;  1HJP A;  2F0N A;  1UEA B;  4NP5 A;  3P75 A;  5FO7 B;  4HJ7 A;  1QVG A;  3GIP A;  4TQU S;  2WTF A;  4RMF A;  3TIN A;  2H4O A;  1EWC A;  2K05 A;  4JI4 H;  2ZTE A;  4N9T A;  5KG4 A;  5DLG A;  4RNM A;  1NJI C;  3RV3 A;  4UPA A;  1N36 L;  1FR3 A;  1K0S A;  2ALY B;  4DR3 Q;  3MC0 B;  3U4V A;  3NUC A;  3OW2 A;  1IBK L;  2R7F A;  3J81 E;  1X65 A;  4A3K B;  5FOB B;  2RGR A;  1AW7 A;  2A68 D;  3BA9 A;  2VOB A;  1JE5 A;  3J80 c;  4F88 A;  5C4J H;  4ED3 A;  5F2D A;  2V58 A;  4DUZ L;  1KDB A;  3QOJ A;  4R4C A;  3VR6 A;  3KUP A;  4X64 L;  2QA4 A;  3S2D H;  3GTQ B;  1L0W A;  5C3W A;  3JAM c;  3CKI B;  2XVS A;  4H0L C;  3H4B A;  1G6Z A;  5LMN Q;  5D65 A;  3I4M G;  3S16 H;  1IYV A;  3Q8P B;  2WAQ G;  1WTV A;  5KFT A;  1KHI A;  4ME3 A;  5KFN A;  2UXC L;  3QO2 A;  1YHQ A;  5KKN B;  3NBH B;  2Q8R E;  2MHV A;  5LHY 1;  3LWU A;  2W71 A;  4C5A A;  1FGB D;  1SEI A;  3H3V H;  3FKI B;  5ELN A;  3A54 A;  2R7M A;  3Q8S B;  1N34 L;  4DXG A;  1Q12 A;  1N32 Q;  1EZ1 A;  1EY6 A;  1Y8P B;  2W7P A;  1S0N A;  2E2J H;  4A4I A;  1YNJ D;  4FF4 A;  2EDG A;  2JEI A;  1TWF A;  1PA6 A;  3G6Y A;  3IL8 A;  3QWN A;  3U9T A;  2PI2 A;  2TMP A;  1PXU A;  1HNX L;  1EFW A;  3HOY B;  2F0U A;  4A2A A;  2VUM A;  2JA6 H;  3M85 A;  5KT6 A;  3KJO A;  2SEB D;  2FFK B;  1YEZ A;  3CXC A;  4L8J A;  2AUK A;  1Z9F A;  1R4Q B;  1IBL L;  3OUU A;  5KFI A;  2YYZ A;  3NE5 B;  3PW2 A;  4B3R Q;  1NBW A;  1T94 A;  3GTO H;  4ZQI A;  2E75 C;  2Z6K A;  4N9P A;  2UXC Q;  1B50 A;  1AN8 A;  4YJ3 F;  1B04 A;  1VQA A;  1Q81 C;  4DK6 C;  1GHK A;  1BR9 A;  1HCZ A;  3C46 A;  2OQK A;  1PYW D;  3J80 i;  4R1J A;  1PZJ D;  1Q7Y C;  2JEA I;  3QZ8 A;  3MXN B;  1JWS D;  5I9P A;  2JA5 H;  3OHB A;  3VPD A;  1I4H A;  2UUB Q;  4G57 A;  1GYF A;  5IWA H;  2F0T A;  5IYB H;  1K83 A;  3W2D A;  3MR2 A;  2KOL A;  1STH A;  2DY8 A;  4IAL A;  2A5H A;  4UP9 A;  2K33 A;  3MEH A;  3VR4 A;  3KHR A;  1JDE A;  1E1O A;  1HNZ L;  2UUC Q;  4O42 A;  4ECX A;  2W9B B;  1XWE A;  2R6G A;  3I4O A;  1EYZ A;  4A3F B;  1Y8N B;  4I7A A;  4CDC C;  2FP4 B;  3PQI A;  4JI6 Q;  3S24 A;  3SK8 A;  1DOM A;  1JOK A;  3ZYY X;  1LYL A;  3PUY A;  2SNM A;  2VUG A;  1Y1W A;  3M9B A;  1E7Z A;  5C0X H;  3MR3 A;  4JI2 H;  3N44 B;  3HOW B;  1SYD A;  1LT3 D;  2WV6 D;  1XMO L;  3KYH C;  3VR5 A;  4A3M B;  1UAP A;  4DR5 Q;  4ED7 A;  5DGA A;  5FO8 B;  3PF4 A;  3OIQ A;  1M7J A;  4ECS A;  3MWY W;  4X3U A;  5IGC A;  3CVZ A;  1KLU D;  4EGV A;  4JI3 L;  3S9W A;  5IT9 W;  4HNT A;  2Z4H A;  1Q8K A;  2Z9H A;  2NVQ B;  1K83 H;  5DG7 A;  3D4W A;  2J6S A;  2FXQ A;  3L9A X;  2MPM A;  3W5O A;  1EYD A;  5IOC A;  2TSS A;  3GTP H;  4BBS H;  2OLS A;  4DAP A;  1EY4 A;  1K9M C;  3K3V A;  4LW1 A;  1A8V A;  3GV8 B;  1AN7 A;  3H0G G;  4JBJ A;  1UNN C;  4GLX A;  4Q8F A;  1PFS A;  4HCE A;  2ENB A;  1EFI D;  4JI5 H;  4RGT A;  4FYD A;  1GHJ A;  2R92 B;  1JDB B;  4KK7 A;  3AU7 A;  3ITP A;  2PMZ A;  2RHQ B;  4XDX A;  3I4N H;  3EN2 A;  2E2H B;  1E0B A;  5C5M A;  2VQF L;  4OEM B;  1F77 A;  4JBW A;  3J7A K;  3Q8Q B;  1O75 A;  5LMU Q;  1EU3 A;  3CC7 A;  3FMC A;  1RD9 D;  5ELE A;  4DV1 Q;  3TS2 A;  2BH8 A;  2RDG A;  2WAC A;  1A2T A;  3NQI A;  1M1K C;  4JV5 H;  1BUV T;  2WP8 J;  4BXX H;  2E2J B;  3NEN A;  1DON A;  3KAK A;  3MXN A;  4DV6 H;  3PZP A;  4CHT B;  2VUM G;  5JUM A;  3KHH A;  2IL8 A;  5IP7 G;  3A0J A;  4LF9 Q;  5K36 G;  1JE4 A;  4JI2 Q;  1Q82 C;  4X3K A;  1P8L A;  2LXK A;  2V1C C;  2SOB A;  1X3F A;  3EQL C;  2E2I H;  4DR7 Q;  3UDI A;  4PZ6 A;  4P71 A;  1Y1W G;  2F4V L;  2F0G A;  3OYY A;  2GVA A;  4N8F A;  1KDA A;  3MAQ A;  3N6X A;  3QR8 A;  4H02 A;  5C4X G;  2VXW A;  5C8Y F;  3V6K A;  1I94 H;  4ZRZ A;  1DM0 B;  2W8L A;  1X9N A;  3BZC A;  1SXT A;  2A68 C;  1CSQ A;  3BJU A;  5ISR A;  2ALZ A;  1TXY A;  5KRU A;  2HJW A;  2UVR A;  4ECT A;  5BN3 A;  1TS3 A;  1Y1V B;  4O3N A;  5CBA E;  1GOZ A;  4FS1 A;  2ZJQ A;  4JG2 A;  2VS1 A;  1EYC A;  5KT3 A;  3ND8 A;  3G6V A;  1LM0 A;  2W6P A;  3CCU A;  4O0A A;  1S4Z A;  4X6A H;  2RGV A;  5M3M B;  1RHP A;  2DNE A;  4M9U A;  1K3B C;  1O78 A;  2E2I A;  3TZU A;  4DV3 Q;  2FJ2 A;  4JBM A;  4RCO A;  2Z4I A;  3R93 A;  5C44 H;  2A74 C;  5JVH 3;  4LF7 L;  3PIP A;  3ONA B;  2R7Z G;  1U4M A;  1D8L A;  3ER0 A;  4J9L A;  3F2D A;  3GTM B;  1NY4 A;  1PDQ A;  1STG A;  2NZH A;  1TU2 B;  4ZAI A;  4OO1 G;  1V1O A;  2JA6 G;  4MV4 A;  1I7N A;  4IZ8 A;  4KY6 A;  3ETH A;  1QG7 A;  1ASY A;  1I6V C;  4F8M A;  3Q0A A;  3GTG B;  3CME A;  2J6U A;  3PO2 G;  2OTJ A;  1JQY D;  3P1H A;  5EPK A;  1T3N A;  3CPF A;  1PFN A;  1V8Q A;  1AUV A;  4P2C B;  4DUZ H;  2BCO A;  2R87 A;  3TQ1 A;  1H9J A;  4AIM A;  5CYU A;  4GZY C;  4M1U B;  2NVY H;  5IYZ F;  4PQX A;  2DNC A;  1RDP D;  4AYB E;  3CMA A;  2UXB H;  1B70 B;  1ZKO A;  4UY8 C;  3K3P A;  4R9W A;  2PW7 A;  1IBL H;  3H20 A;  4Q5V A;  3PV0 A;  2CQO A;  3V05 A;  5IT9 E;  3I4M H;  1N33 Q;  2DLN A;  4EYI B;  3RBD A;  1E1T A;  2VL6 A;  2MO0 A;  5I9O A;  2CW0 D;  4A3B B;  4NB3 A;  1D5M C;  4K6D A;  4R4I A;  4R4Q A;  2UUA Q;  3I56 A;  2A6H C;  5GAH C;  4IPG A;  4PMW A;  1Z2P X;  4DV2 H;  1ESF A;  3C1E A;  2C35 B;  1DCZ A;  3OOC A;  4IPD A;  1GUW A;  2A1A A;  4B3S Q;  4LF4 H;  3RIZ A;  4GC6 A;  2E2I B;  3E3X A;  1BBW A;  2UVW A;  4YY3 H;  3MA2 B;  3HOZ G;  1GSA A;  4X65 L;  1HUM A;  4X3S A;  4GKJ L;  4J6H A;  3PUW A;  1I3Q A;  2XGP A;  1KIX A;  2W8K A;  1CZG A;  5KNC A;  2GPW A;  3CPW A;  2DZD A;  1B3Q A;  4B08 A;  1VQI A;  3M3Y B;  2R7K A;  5M5Y B;  1Y69 U;  4J1M A;  4DR4 H;  2W6Q A;  3PIO A;  5JVG 3;  3STB D;  4U6P A;  2ZJP A;  5H1S E;  1DIK A;  3PSI A;  4YP3 A;  3K58 A;  1AP0 A;  4J9S A;  1HFN A;  3GTJ A;  3E9I A;  3A8J E;  4YR3 A;  1EZ6 A;  2QGQ A;  5M5W H;  3JSN A;  1CKO A;  2KEE A;  4ABN A;  2NTT A;  1VQ8 A;  5JEA G;  2F0P A;  2FPP B;  3MEF A;  4APM A;  2BOS A;  4JV1 A;  2VNU D;  4BY1 B;  4JI2 L;  2KA7 A;  3FP9 A;  3Q23 A;  2YS7 A;  2OTL A;  1EUC B;  2YCH A;  4DR3 L;  3H0G H;  4DL5 A;  1D5X C;  2PPB C;  4HAE A;  2B3G A;  2ZXR A;  1EY5 A;  1DOK A;  1O7Z A;  2HIV A;  2K14 A;  1SMY C;  4IUN A;  4QIW E;  4BBR G;  4C5C A;  5C4Z A;  4ID6 A;  1F2Z A;  3OUZ A;  1TY0 A;  3QZ7 A;  2AGP A;  2B63 B;  2JA7 A;  2MNA A;  4G7Z C;  4DL3 A;  4PZ7 A;  3H91 A;  3N43 B;  3T5J A;  5ELO A;  1S40 A;  2E2H A;  1TWH A;  2OXP A;  4DK3 C;  1LV9 A;  1KDC A;  3GIK A;  1NSN S;  4POF A;  1GUG A;  1B33 N;  1CTM A;  1H9M A;  2D0P A;  2WII B;  3H3V C;  2IMW P;  4HR7 B;  4DN4 M;  1VF7 A;  4LF6 L;  1RTN A;  2PO4 A;  4FXD A;  4NKL A;  1VMP A;  4RKB A;  1YNN D;  3G7L A;  4C2M H;  4AYB B;  3E0E A;  1XJV A;  4NXM L;  2W9C B;  2MCT A;  2K5V A;  1T5E A;  2KHJ A; 
#chains in the Genus database with same CATH homology
 3W1B A;  1A0I A;  5IWA L;  1A62 A;  2XTI A;  1J6Q A;  2BA1 A;  4IFD I;  1VQD A;  1GD7 A;  1Y1V H;  1M90 C;  3CW2 C;  1NTG A;  3AQQ A;  4X62 L;  3CQZ H;  4GNX C;  2R7Z H;  2CWA A;  1YNX A;  1GVP A;  3M7N A;  2RF4 A;  2ZTD A;  2E2H H;  3HOY H;  2E5L L;  2JA5 G;  2ID0 A;  3KJP A;  3W1G A;  4OXP A;  5LMN W;  3G71 A;  4DV7 L;  4A3M H;  5J3B A;  1CKN A;  1GM5 A;  4LWC A;  4YWK A;  2I5H A;  2LXJ A;  4BA2 I;  3TRE A;  2YU9 H;  4LF7 Q;  1YI2 A;  1JJ2 A;  3FKI H;  2JEA I;  4PZ8 A;  5IP9 G;  3K8A A;  4Y52 H;  3KDF A;  1YHB A;  3FKI G;  4P72 A;  3TRZ A;  2PI2 E;  3HOW H;  4DV7 Q;  3S2H H;  5M3M G;  1YIT A;  3HOU H;  4KI0 A;  4QY7 A;  3T1Y L;  2EXD A;  1FVI A;  2I0Q A;  3S1M H;  1XMQ L;  4OX9 L;  4DV0 Q;  4C3H H;  2IHF A;  4IOA A;  4OO1 I;  1L2F A;  4JV5 L;  2ZM6 L;  1K73 C;  1VQG A;  4B3M Q;  1WYD A;  2HHH L;  3J7Z C;  1B7Y B;  4IJL A;  1HNW L;  3KLW A;  1PYS B;  4GLV B;  1YIJ A;  2ZM6 Q;  4LFB L;  1MIU A;  4L5Q A;  2DUD A;  5GAG C;  1ASZ A;  3U4Z A;  4LUV A;  3T1H Q;  5IY0 A;  4BY1 H;  3D31 A;  1WFQ A;  5JJK A;  1X55 A;  3ERS X;  1DGS A;  4JI4 Q;  2BH2 A;  2UU9 L;  1VCI A;  5IYC H;  3ICE A;  1P16 A;  4DV2 Q;  2OQ0 A;  2ES2 A;  1LUZ A;  4P75 A;  5BR8 L;  1N34 Q;  4HIM A;  3M4O H;  2NVX H;  2WB1 G;  1SLJ A;  2I5M X;  2AMC B;  4FDB A;  3TQY A;  1YHA A;  1WOC A;  3GD7 A;  4K0K Q;  4KLK A;  4OWX B;  2R7D A;  1I6H H;  1OXX K;  1HJP A;  3SGI A;  4A3J G;  1QVG A;  4IPH A;  1IBM Q;  5IYB G;  4HJ7 A;  4JI0 Q;  4TQU S;  3KFU A;  4RMF A;  1U5K A;  4IO9 A;  1N9W A;  2ZTE A;  1YJW A;  4JYA L;  3S1N H;  2AKW B;  1FGU A;  4R4T A;  1VQ7 A;  4X65 Q;  2VZA A;  1MJC A;  4HJ9 A;  2NVQ H;  1J5E L;  1NJI C;  4UPA A;  1N36 L;  2IY5 B;  3I55 A;  5AJ3 L;  2ALY B;  4DR3 Q;  3HOV H;  3U4V A;  1H95 A;  3OW2 A;  4A3K H;  5HGQ A;  1IBK L;  2R7F A;  1XNR L;  4GKK Q;  1X65 A;  1UE1 A;  2KEN A;  3K80 C;  3T1H L;  4A75 A;  1R9T H;  1XMQ Q;  1KD1 C;  4LF8 Q;  1JE5 A;  3J80 c;  1TWF H;  5C4J H;  1Q86 C;  2UXB L;  1IL2 A;  3AEV A;  3U58 A;  1SRU A;  4DUZ L;  1VQJ A;  4R4C A;  4DNI A;  3UDG A;  3RZD H;  1OXU A;  4DUY L;  4X64 L;  2QA4 A;  4GN5 A;  4A3M G;  3S2D H;  3CAM A;  3KOJ A;  2PQA A;  2QEX A;  2VUM H;  1SMX A;  1L0W A;  3JAM c;  4GN3 B;  4LF8 L;  4MZ9 A;  5LMN Q;  3I4M G;  3S16 H;  3S17 H;  1AE2 A;  2WAQ E;  3RLF A;  1Y1V G;  2WAQ G;  1Q1E A;  1UE5 A;  1KHI A;  1HR0 Q;  4ME3 A;  4RG1 A;  3CCM A;  1S3O A;  4JI8 Q;  2JA7 G;  2CWP A;  4KHP L;  1YHQ A;  2UXC L;  4A3C H;  3D0F A;  1HNZ Q;  2UUC L;  3NBH B;  1VQ4 A;  1IYJ B;  3HKZ G;  1B8A A;  2DGY A;  2WB1 E;  5E7N A;  2A8V A;  2ZTC A;  3CCV A;  4A3L H;  3PGZ A;  3H3V H;  1PV4 A;  5ELN A;  1SN8 A;  3A5U A;  1VQM A;  1WCM G;  5BR8 Q;  1N34 L;  1K8A C;  1WCM H;  1Q12 A;  4LUO A;  4XIG S;  3F2B A;  1I94 Q;  1HNW Q;  1N36 Q;  4A3B H;  1G29 1;  1N32 Q;  2E2J H;  3CCQ A;  4A4I A;  4DR1 L;  4K0K L;  3CCS A;  4DR6 Q;  1NMG A;  4BXX G;  1NMF A;  3S1R H;  1PA6 A;  5IT9 c;  1VQO A;  2PI2 A;  2IT1 A;  4HJA A;  3IRB A;  2RCN A;  2Z6K C;  4JBK A;  1QVF A;  2AHO B;  1EWI A;  1HNX L;  2R92 G;  1EFW A;  4NXN Q;  1YJ9 A;  5IYD G;  1VQF A;  4J15 A;  1IZ6 A;  1VQE A;  4IOC A;  1N8R C;  2JA6 H;  3GTM H;  4GNX B;  5GAD C;  3M85 A;  1VQK A;  1FL0 A;  3KJO A;  1VQC A;  4DKA C;  1XPU A;  2E8G A;  1JT8 A;  1YEZ A;  3CCJ A;  4NXN L;  4DV6 Q;  3CXC A;  1Q1B A;  1Z9F A;  1XPR A;  4DV5 Q;  1IBL L;  4NPS A;  1L1O B;  1FJG L;  4BBR H;  2YYZ A;  5LMU L;  3CCE A;  4DV4 L;  1NBW A;  4B3R Q;  3TEH B;  3UDF A;  2F4V Q;  3GTO H;  4B3T Q;  2Z6K A;  3ULP A;  4KHP Q;  1SRO A;  4P74 A;  2UXC Q;  2UUB L;  1VQH A;  1HZA A;  3GTK H;  3CF5 A;  1VQA A;  1Q81 C;  3OTO Q;  5DLQ E;  4DK6 C;  4HIO A;  4DV5 L;  2OWO A;  2ASB A;  3UE1 A;  3KDF B;  2OQK A;  2Q2H A;  1PH8 A;  3CP0 A;  4R1J A;  2IHE A;  3J80 i;  3U50 C;  4DV0 L;  3MXN B;  1W2B A;  1Q7Y C;  2JA5 H;  1TWC H;  1UE7 A;  4A3D H;  4OWT B;  1MKH A;  1IXR A;  1UE6 A;  4L5T A;  4ALP A;  1QZG A;  2UUB Q;  3PO2 H;  3FHW A;  5C3E H;  1PH5 A;  4EQ5 A;  4AQY L;  2N3S A;  1EIY B;  2ZJR A;  5IYB H;  1YVC A;  4JYA Q;  4HJ5 A;  1XNQ Q;  2LSS A;  2JE6 I;  2Y0S G;  1CUK A;  2YTV A;  3BZK A;  4UP9 A;  5GQO A;  4OX9 Q;  1G51 A;  2R93 H;  1VQL A;  1E1O A;  3M4Q A;  1HNZ L;  2UUC Q;  2ATW A;  4DUY Q;  2R6G A;  5FJ8 H;  3I4O A;  3RNU A;  3KF6 B;  3S24 A;  4JI6 Q;  1VQN A;  4YWM A;  1I94 L;  1N32 L;  1LYL A;  3PUY A;  4DR4 L;  2KHI A;  3M9B A;  3J81 c;  1C0A A;  1E7Z A;  1SFO H;  2UXD L;  1HZC A;  4YHH Q;  1Y14 B;  4DR6 L;  3HOZ H;  1XMO L;  3A5Z B;  3KYH C;  4A3D G;  2MO1 A;  2PQA B;  4R4O A;  4DR5 Q;  5AJ3 Q;  1J5E Q;  2NN6 G;  1PH6 A;  3PUX A;  2KCT A;  3PF4 A;  3L7Z C;  4A3C G;  2CCZ A;  2Q2I A;  5FLM G;  1HR0 L;  1HH2 P;  2PMZ E;  4YHH L;  4JI3 L;  2F3I A;  3F2C A;  4DV6 L;  1Q8K A;  4XTC S;  1K83 H;  3K0X A;  4GLA C;  1KQS A;  4X64 Q;  3PO3 H;  1Q46 A;  2FXQ A;  4A93 H;  1VQ9 A;  2K5N A;  3W5O A;  1BBU A;  1JJC B;  4IFD J;  3PUZ A;  3GTP H;  1PH2 A;  1HNX Q;  3ULL A;  3G48 A;  1QZH A;  2Y0S E;  4BBS H;  2NZO A;  1K9M C;  4JI0 L;  4QQB X;  2N49 A;  4LW1 A;  1I5F A;  1A8V A;  4GS3 A;  4TVA B;  1K0R A;  3AYH B;  4HIK A;  1QUQ B;  3H0G G;  4JBJ A;  1Y1W H;  3CC4 A;  4GLX A;  1K3R A;  1PFS A;  1LTL A;  2UXB Q;  4YY3 L;  2E5L Q;  4WJ3 M;  3B6Y A;  4JOI C;  2KBN A;  1KAW A;  3S14 H;  3HOY G;  1O7I A;  4GKK L;  4A93 G;  1UWV A;  2RHQ B;  1TWG H;  2H5X A;  1E24 A;  2HQL A;  1UEB A;  1X54 A;  1WI5 A;  1X6O A;  3DM3 A;  3K7A H;  4UP7 A;  3EN2 A;  2B63 H;  3I4N H;  1HZ9 A;  1AH9 A;  2VQF L;  3RN5 A;  3PO3 G;  4A3F H;  2B29 A;  4JBW A;  3JAM i;  3GO5 A;  5LMU Q;  3CC7 A;  2Q2T A;  2HIX A;  2VQE Q;  1GKH A;  4YCW A;  1X3E A;  4DV1 Q;  2BH8 A;  4IJH A;  4EX5 A;  1M1K C;  1EQQ A;  3TS2 A;  4MNO A;  1C9O A;  3PUV A;  2WP8 J;  4BXX H;  1D7Q A;  1X3G A;  3NEN A;  4LF4 Q;  5FLX c;  2VUM G;  2N78 A;  5IP7 G;  4LF9 Q;  3A0J A;  4A3B G;  5K36 G;  4JI2 Q;  3HOX H;  3ULJ A;  1OXS C;  1Q82 C;  1P8L A;  2LXK A;  1OTC A;  3AFQ A;  1L1O C;  2V1C C;  2K5H A;  1YJN A;  4GOP C;  1X3F A;  2JK8 A;  2E2I H;  4LF5 L;  4AYB G;  3GTG H;  4A3L G;  4DR7 Q;  4JOI A;  3UDI A;  5C0X I;  4PZ6 A;  4P71 A;  4B3T L;  1Y1W G;  3J81 j;  2F4V L;  1YZ6 A;  1X56 A;  2I5L X;  2YTY A;  2GVA A;  3OYY A;  1EYG A;  5GRO A;  4A3K G;  3S1Q H;  1G6P A;  4JI4 L;  1WJJ A;  5JEA J;  3HKZ E;  4H02 A;  4BBS G;  4X62 Q;  4LUZ A;  3PCO B;  4A3I H;  3HOV G;  4JV5 Q;  2R93 G;  5C4X G;  3GTL H;  1PH1 A;  2IX1 A;  5GAE C;  2JEB I;  1X9N A;  3BZC A;  1EQR A;  1CSQ A;  3BJU A;  4LFC L;  4JI7 L;  1TXY A;  2CFM A;  4OWW B;  4A3J H;  4JI3 Q;  4YCV A;  1OXV A;  3HOW G;  5M3F H;  3JC6 6;  2R92 H;  1IBM L;  2JJQ A;  2K50 A;  1PHJ A;  2ZJQ A;  4JG2 A;  2VS1 A;  4LFC Q;  4JI8 L;  4Y7N H;  3F8T A;  4X6A H;  1LM0 A;  2GVB A;  4DV4 Q;  5C0X J;  4O0A A;  3CCU A;  2RHS B;  1I50 H;  1L1O A;  4B3R L;  4JI1 L;  4GOP A;  2PNH A;  1V43 A;  3STB C;  3L2P A;  4DV3 Q;  4JBM A;  1EIF A;  3E9H A;  3HOX G;  2OCE A;  5C44 H;  5IP7 H;  4DPG A;  4LF7 L;  3PIP A;  2R7Z G;  1D8L A;  3ER0 A;  4BY1 G;  1VQP A;  3EBE A;  3F2D A;  1QVC A;  4QL5 A;  1NY4 A;  4GKJ Q;  2F52 A;  2NZH A;  1RL2 A;  1PYB A;  4BA1 I;  4OO1 G;  2JA6 G;  1VQ6 A;  1IBL Q;  1FJG Q;  2A19 A;  2L15 A;  3RN2 A;  1SE8 A;  1T9H A;  4X66 Q;  3HKS A;  1PH4 A;  1ASY A;  3KF6 A;  2YV5 A;  5M5X H;  5IWA Q;  3CME A;  1MJE A;  1V1Q A;  2B63 G;  3J81 i;  5IE8 A;  2UU9 Q;  3PO2 G;  2OTJ A;  3F1Z A;  2BA0 A;  4JI7 Q;  1PVO A;  3CPF A;  4POG A;  2AWO A;  4DR7 L;  4A3I G;  3KF8 B;  4AIM A;  2HT1 A;  2VY3 A;  1A63 A;  3H15 A;  2NVY H;  3ZJY C;  3CMA A;  4AYB E;  1EOV A;  5M5Y H;  5IP9 H;  1B70 B;  4GOP B;  4UY8 C;  1XMO Q;  3GDE A;  3PV0 A;  1W3S A;  4LNQ A;  4L5R C;  2Z0S A;  4BY7 H;  1KRT A;  2CQO A;  3UE0 A;  4DV1 L;  4APV A;  1XTD A;  2UUA L;  4LFA L;  3I4M H;  1KRS A;  1N33 Q;  4DV2 L;  1E1T A;  4JI6 L;  2AWN A;  2EIF A;  2VL6 A;  1Z47 A;  2MO0 A;  1CKN B;  4MTN A;  1NE3 A;  1PH7 A;  2VQF Q;  3VDY A;  4PG3 A;  4BY7 G;  5C4X H;  4NXM Q;  4NB3 A;  2K52 A;  3G4S A;  1N33 L;  2GN5 A;  4R4I A;  4R4Q A;  4LFA Q;  3I56 A;  5GAH C;  2UUA Q;  3J7A 5;  4IPG A;  4PMW A;  2VQE L;  3NEM A;  4WJ4 A;  5IYD H;  1U0L A;  1HR0 W;  1YBY A;  2C35 B;  4IPD A;  4JI1 Q;  2A1A A;  4B3S Q;  4A3F G;  4O2D A;  4C3I H;  3G6E A;  2VW9 A;  1BBW A;  4OON A;  4JI5 L;  1C7Y A;  3H3V I;  2XGT A;  2K75 A;  4X65 L;  3HOZ G;  3I4N G;  2JA9 A;  4GKJ L;  5C0X G;  1HZB A;  3PUW A;  2NVT H;  5IYC G;  2NN6 I;  3GTQ H;  1VS0 A;  4B3S L;  1KIX A;  3CCR A;  4LF5 Q;  5LMN L;  3DLL A;  3CPW A;  1SR3 A;  1V9P A;  2YTX A;  1IBK Q;  1VQI A;  4UP8 A;  2N8N A;  4DR2 L;  3AFP A;  2K4K A;  3EIV A;  5FJ8 G;  2HHH Q;  4JI5 Q;  4LF6 Q;  3RZO H;  3I7F A;  4DR5 L;  1BVS A;  4B3M L;  1OXT A;  3I2Z A;  3A74 A;  3PIO A;  2D0O A;  3STB D;  5M3F G;  2JA7 H;  4YCU A;  2ZJP A;  5H1S E;  1S72 A;  3PSI A;  4LF9 L;  3PF5 A;  1CSP A;  4A3E G;  1PH9 A;  3E9I A;  4YY3 Q;  1TWH H;  2QGQ A;  4JCV E;  5M5W H;  5C3E G;  1XPO A;  1XNQ L;  3S15 H;  5C44 G;  1PH3 A;  1CKO A;  4GN4 B;  1VQ8 A;  3K7U C;  5JJI A;  1E3P A;  2JQO A;  5JEA G;  3K81 C;  4DAY B;  3MEF A;  1CKM A;  2JA8 G;  3LGJ A;  4JC0 A;  5M3M H;  3HOU G;  1GO3 E;  2MFI A;  4A3G G;  1JJG A;  4X66 L;  2VNU D;  1K8G A;  1AE3 A;  1VQ5 A;  1KC8 C;  4JI2 L;  3FP9 A;  3M4P A;  3RLN A;  3RR5 A;  3UDX A;  1EUJ A;  2OTL A;  4DR4 Q;  4DR3 L;  4AQY Q;  2Q2U A;  3H0G H;  3Q8D A;  4AH6 A;  1JMC A;  1I3Q H;  5EAY A;  4A76 A;  3TS0 A;  4GNX A;  2B3G A;  3NEL A;  4L5S A;  2WFW A;  3RLO A;  3BU2 A;  1E22 A;  4A3G H;  5JJL A;  2HIV A;  2K14 A;  4QIW E;  3WWV A;  4BBR G;  3CCL A;  1KL9 A;  1VQB A;  4P73 A;  2CKZ B;  3T1Y Q;  2MNA A;  4IFD G;  4PZ7 A;  1JB7 A;  2D62 A;  5ELO A;  1S40 A;  3GTJ H;  2IX0 A;  4QGU A;  4QJF A;  4IPC A;  4DK3 C;  5FLM H;  3CD6 A;  4DAM A;  1RIP A;  2UXD Q;  4HJ8 A;  4KHZ A;  4DV3 L;  4POF A;  4LFB Q;  3M3Y H;  2D0P A;  4DR1 Q;  2JA8 H;  4DUZ Q;  4HID A;  4LF4 L;  4DR2 Q;  4LF6 L;  1QUQ A;  1BKB A;  3HFZ B;  5HY6 A;  4C2M H;  4A3E H;  1TWA H;  4YWL A;  1XNR Q;  3OTO L;  3L0O A;  3E0E A;  1XJV A;  1KXL A;  4NXM L;  4C3J H;  3CC2 A;  2MQH A;  2K5V A;  2KCM A;  2EQS A;  2KHJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...