3PO2G

Arrested rna polymerase ii elongation complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
molecule tags Transferase/dna/rna
total genus 32
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po2G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po2G01
4JI7Q 3NEMA 2GVBA 1IBLL 5IYBH 1XMQQ 2E2JH 1X9NA 5M3MG 3L0OA 2MO1A 3MXNB 1NBWA 1K8AC 3CF5A 2KHJA 3NBHB 1SN8A 3U4VA 1Q1EA 2I0QA 2HIXA 5K36G 4FDBA 4DV0L 4TQUS 1PFSA 5FLXc 4GNXC 4IO9A 1EIFA 2R6GA 1JMCA 1BKBA 1VQ5A 4EQ5A 1L1OC 2EXDA 2WFWA 4JC0A 1DGSA 5IWAL 4A93H 1E1TA 3CQZH 4NXNL 3TREA 2Y0SE 3CCVA 4JBWA 3KFUA 2OCEA 5ELNA 2UXBQ 2Q2HA 4IJHA 4JV5Q 4P71A 1VQAA 2I5HA 2UUCL 4KHPL 2CKZB 4AQYQ 4LF8Q 2F4VL 2YYZA 5AJ3Q 2NN6G 5IP9G 1YITA 4DV1Q 4ME3A 3G4SA 1Q12A 1RIPA 5GAHC 2VNUD 4DV2Q 2E2IH 2AKWB 5C0XI 1FL0A 1L2FA 3AQQA 4X62Q 2JEBI 1CUKA 5H1SE 3BZKA 3CMAA 4RG1A 4OONA 1S3OA 4GN5A 1N9WA 4YWKA 5FLMG 4GKKL 2N49A 4R4CA 2N78A 3LGJA 4YHHQ 4GNXA 2JA7H 3I2ZA 2UUAQ 3GTLH 3HOYH 2VQEL 3GDEA 1OXSC 1K73C 5IYCG 1N36L 4JI4Q 4R4IA 4A3EG 3CCRA 2GVAA 2RHSB 1E24A 1TWFH 2Z6KC 1XPOA 1KD1C 4IPDA 2R93H 1HH2P 2JK8A 4OX9L 5IP7G 1VS0A 2XGTA 5C4XG 2R7ZG 4DUYQ 1VQ7A 4IFDI 4GOPA 2WB1G 4AIMA 1A62A 3S16H 1Y1VH 2WP8J 4GS3A 3S15H 4DUZL 4YY3Q 1I3QH 1PA6A 2ZJQA 1BVSA 3PSIA 4YCWA 2UXBL 2UXDQ 1TWCH 4A3CH 3RNUA 3G71A 1JE5A 4A3FH 4A3DG 4DR2Q 1AE2A 1Q46A 4NB3A 4DV7Q 1T9HA 4POFA 1L0WA 5AJ3L 4AQYL 1AH9A 5LMUQ 5C44G 4DV1L 1PH9A 3M85A 4UPAA 2K50A 3PO3G 4O0AA 3L7ZC 4IPCA 3OTOQ 4A3IH 3WWVA 1B70B 2JA5H 3F2CA 4B3SQ 4XTCS 4K0KQ 1UE7A 4LW1A 5C3EG 3OW2A 4LUVA 2VZAA 2K4KA 4HIOA 3T1HQ 1S72A 2Q2UA 4B3TL 2ZTCA 2JE6I 3I4NH 1HJPA 3G6EA 4EX5A 4GLAC 1GM5A 1IBLQ 1IXRA 5EAYA 2R92H 1SR3A 3PF5A 1TXYA 4KLKA 2D0OA 3CW2C 5BR8Q 4X64L 3I4OA 3NENA 5HY6A 1X3FA 2CQOA 4ALPA 1VQLA 2UUAL 1XPRA 3HOUH 2YTYA 4DV0Q 4DV3L 2AHOB 1D8LA 1W3SA 4DKAC 2IX1A 4JI4L 3S2DH 4PZ7A 3UE0A 1EQQA 3A5UA 1C9OA 3GTOH 4LFCL 4AYBG 1L1OB 4NXNQ 4P75A 2R7FA 2OWOA 3ZJYC 3CXCA 2VUMH 1SLJA 4BBSH 4QIWE 1EWIA 1I94Q 2QEXA 1SRUA 3AYHB 2UUCQ 3S1RH 2F4VQ 4R1JA 1HZAA 1ASZA 2JA8H 3VDYA 4A3MH 2I5LX 4DR5L 2LXJA 1Q86C 4XIGS 1VQBA 2JA6G 4P73A 4X66Q 2NVXH 1Q81C 4DR2L 4DV7L 1UE5A 2OQKA 3CCUA 3CCLA 1W2BA 4BBRH 1YJNA 4GKKQ 1CSPA 3OTOL 1R9TH 3J7ZC 1JJCB 1IBML 1XPUA 2PQAB 3STBC 1FGUA 2VQEQ 3J80c 4JI0L 3UDGA 4LFBQ 1N36Q 1NY4A 2KBNA 4C3JH 3M4QA 4Y7NH 4LF5L 2VQFL 1ASYA 4PMWA 3K7AH 1BBWA 2K5VA 4JI5Q 2ID0A 1VQOA 3HOXG 2UXCL 5JJKA 1WYDA 2JQOA 1I6HH 5BR8L 1U0LA 4OX9Q 4DR3L 3CC4A 1X65A 3HOZG 2NN6I 3PV0A 3KDFB 1P8LA 2CWAA 2NZHA 3D31A 2NZOA 1K8GA 3CPFA 4GN3B 2ALYB 3U4ZA 2OQ0A 5IYBG 2WB1E 3H0GG 2ZM6L 4DUZQ 1MKHA 3J80i 1X3GA 1I5FA 3PUXA 4JI6L 3KOJA 4O2DA 1VQ8A 1M90C 2QA4A 1PH5A 1I94L 4JYAL 1C0AA 1CKMA 3W5OA 4MNOA 1NE3A 1Y14B 3A5ZB 1QZHA 3PUYA 4JI1L 4A3JG 2WAQG 4DR1L 3FKIH 2YTVA 4R4TA 4A93G 1GD7A 3UDXA 3JC66 4HIMA 1KXLA 4B3MQ 4C3HH 1U5KA 1X56A 4NPSA 4B3TQ 4X66L 4DR6L 2EIFA 2PI2A 4DR7L 4OWTB 1D7QA 1WOCA 3RLNA 5M5YH 1HZ9A 1HR0L 4JBKA 2IHFA 4X64Q 1E22A 1L1OA 3ER0A 1PH4A 5LMNQ 4A3KH 4LF7Q 2IX0A 4LFBL 4DV3Q 5FLMH 2I5MX 3ULJA 1EUJA 2HQLA 5IT9c 2YU9H 4A3GG 3I56A 2ZJRA 2BH8A 1FJGL 1OXUA 4LFCQ 1Q7YC 4JI5L 5GADC 1NMGA 4BXXG 3KF8B 1GVPA 4AYBE 4A3BH 1EOVA 1PVOA 4YWMA 4BA2I 2NVQH 5M3FH 3HOYG 4X6AH 1NMFA 2IT1A 1YZ6A 1Q8KA 5JJLA 1EFWA 2B63G 1WCMG 4JG2A 1I50H 4HJ5A 5C4XH 4DR5Q 3PGZA 1EIYB 1N8RC 4BY7H 2K52A 3FP9A 1PHJA 5C0XJ 4JI2L 1N33Q 2R93G 3M9BA 3A0JA 3M4PA 3TQYA 4JBMA 2PQAA 4BY1H 2VY3A 3CC2A 1KHIA 5GAGC 1QZGA 2D62A 2VS1A 1YVCA 4JI3L 1HNWL 4LFAL 1Y1VG 2MQHA 1UE6A 5JEAJ 1E1OA 1HR0W 4C3IH 1XJVA 2OTLA 2E8GA 1G6PA 1E3PA 1IBMQ 4POGA 4JOIC 3HOWG 4JI0Q 2Q2IA 4JI8L 5JEAG 4DV4L 1CSQA 4Y52H 4YCUA 2IHEA 2Z6KA 3NELA 3PO2H 3KDFA 3SGIA 1RL2A 2VQFQ 4A3FG 2ZTEA 4LF5Q 4OO1G 1VQKA 1KC8C 3GTGH 1SROA 1C7YA 4QQBX 3CAMA 3M4OH 2UXCQ 3ULPA 1YNXA 1HZCA 1XNRL 2KCMA 1AE3A 2MFIA 5FJ8H 4DK3C 1A0IA 4DR3Q 4A3IG 5LMNL 2JA5G 3GD7A 3GTPH 4L5RC 3GTMH 4IFDJ 1YI2A 4H02A 2MNAA 4DV5L 1VQ9A 3I4NG 3PUZA 3GO5A 2ZJPA 2F52A 2VW9A 3AEVA 4WJ3M 1X6OA 1YEZA 2ZM6Q 4IPGA 4BA1I 2R92G 1X3EA 3HOVG 4JI6Q 3HFZB 3CCQA 1YJ9A 4DR4L 3H3VI 3U58A 1PH3A 4DK6C 1VCIA 3AFQA 1XMOL 4JYAQ 3RR5A 4A3LH 3F1ZA 1M1KC 4DPGA 3KJPA 2CCZA 3CMEA 4J15A 4IOAA 2Q2TA 1PH2A 4JI1Q 3ULLA 1LYLA 2JEAI 4DR1Q 1J5EL 2XTIA 4IJLA 3OYYA 3EIVA 2K5HA 4HJ8A 4DV6Q 1B8AA 2WAQE 1HNXL 1N33L 3M7NA 2VUMG 1XNQL 4BBSG 4DR6Q 5IE8A 4DR7Q 1VQGA 4OWXB 2RCNA 4GLXA 1B7YB 4QGUA 1JJ2A 4GN4B 2B29A 1PH1A 2JA8G 4PG3A 5J3BA 1GKHA 4A3MG 1HR0Q 5GQOA 3K8AA 5DLQE 1LUZA 2ASBA 3HKZG 2N3SA 4X65L 5LMNW 5M5WH 5JJIA 4B3RL 5IYDH 1VQDA 3KF6B 3PF4A 1FJGQ 3I55A 1A8VA 4QY7A 2N8NA 2A19A 1G291 4L5SA 1IBKL 1WJJA 3FHWA 2RHQB 2DUDA 1GO3E 3A74A 3KJOA 3I4MG 1LTLA 1X54A 3DM3A 3J7A5 4OWWB 2QGQA 1HNZL 4UP9A 5M3MH 4APVA 1VQEA 1Y1WG 2C35B 2AWOA 2RF4A 3D0FA 1XTDA 3F2DA 3RN5A 3ICEA 2A1AA 3PIPA 4MTNA 1CKOA 1FVIA 1QVFA 2PMZE 2K5NA 5C4JH 4JI2Q 1OTCA 1Q1BA 3T1YQ 3L2PA 1IL2A 5IY0A 4LUOA 4QJFA 3H0GH 1N34L 3CCSA 1VQHA 3PUWA 4P74A 3S1QH 4HIKA 3UE1A 1UWVA 2B3GA 4JI3Q 2LSSA 1HNWQ 4LFAQ 4UY8C 1QUQB 4MZ9A 1CKNB 2KENA 1KRTA 2K14A 2ES2A 1V43A 4DV6L 2LXKA 2Z0SA 3RZDH 3CP0A 4JI8Q 4DV4Q 2AMCB 3E9IA 5IP9H 2E5LL 1HZBA 3S2HH 3J81i 4A3JH 4UP8A 1JJGA 1BBUA 1YBYA 5HGQA 2JA9A 2OTJA 3AFPA 1XNRQ 1K83H 1VQ6A 2A8VA 2CFMA 1KIXA 1O7IA 3FKIG 4A75A 1EYGA 2KHIA 1OXVA 3TEHB 3KYHC 1UE1A 2NVTH 3B6YA 4LF6L 1OXXK 5ELOA 4DV5Q 4LWCA 3K7UC 4NXML 3RLFA 4GOPC 2H5XA 4LF4L 2E2HH 4IPHA 5IYCH 1VQMA 1J6QA 2JA7G 4DR4Q 1V9PA 2ATWA 4A3EH 4A3GH 3I7FA 3CCMA 4A3KG 4KHZA 1S40A 1XMOQ 3S1NH 3Q8DA 2UU9L 2UUBL 1TWAH 3U50C 2YTXA 2CWPA 1OXTA 3GTQH 4L5TA 4BXXH 2NVYH 2IY5B 5IP7H 4LF9L 1J5EQ 2R7ZH 3JAMc 1IZ6A 4QL5A 4GKJL 4OO1I 1TWHH 1HNXQ 3T1YL 4A3BG 1PH8A 1XNQQ 2B63H 1WCMH 4JI7L 5M3FG 1XMQL 5C0XG 1MIUA 5GROA 3BU2A 1YHBA 2BH2A 1VQFA 1VQ4A 3G48A 3J81j 3KF6A 1MJCA 3K81C 2F3IA 3TS0A 1YIJA 4X65Q 4A3DH 4LNQA 3HKSA 4BY7G 4HJ7A 5GAEC 4JCVE 1KQSA 4GLVB 1G51A 4B3RQ 3HKZE 3UDFA 3UDIA 2Y0SG 4R4QA 5C44H 3PO3H 4A3CG 3CCEA 2PI2E 4BY1G 4A4IA 1EQRA 4HJAA 2BA0A 2KCTA 1X55A 2DGYA 4KI0A 3PCOB 3JAMi 3IRBA 3PUVA 3HOWH 1K9MC 5E7NA 5C3EH 3F2BA 2K75A 4HJ9A 1IBKQ 3GTKH 1A63A 3STBD 1NTGA 4JV5L 1QVGA 2JJQA 1Z9FA 4YWLA 1K3RA 4TVAB 1E7ZA 1SFOH 3KLWA 2L15A 2HHHQ 1HNZQ 1H95A 1VQIA 1WFQA 3CC7A 1MJEA 4LF8L 2HT1A 2BA1A 4A76A 4IFDG 3E0EA 3PO2G 2ZTDA 1K0RA 2V1CC 1VQPA 1N32Q 3E9HA 3BZCA 4DV2L 1Q82C 4IOCA 3S14H 4L5QA 2D0PA 1QUQA 4PZ8A 1YJWA 1CKNA 4DAMA 5FJ8G 2R7DA 4X62L 3BJUA 4UP7A 3RZOH 1VQNA 3HOUG 1N34Q 1LM0A 3H15A 4JOIA 3S1MH 3HOVH 4YHHL 3RLOA 3K0XA 3CCJA 1P16A 1KL9A 3GTJH 4OXPA 1SE8A 1PH7A 1WI5A 2E5LQ 4GNXB 1Z47A 3F8TA 3EN2A 5IWAQ 3RN2A 4A3LG 1NJIC 4R4OA 1TWGH 2JA6H 3S17H 4PZ6A 3ERSX 4HIDA 4P72A 1KRSA 4DUYL 3TRZA 4AH6A 3EBEA 4LF6Q 4KHPQ 3CD6A 1KAWA 3H3VH 3K80C 4NXMQ 2FXQA 3W1GA 2EQSA 3TS2A 3CPWA 4LF4Q 4YY3L 1VQJA 3PIOA 1QVCA 3S24A 4BBRG 3M3YH 2GN5A 4GOPB 4LUZA 2UXDL 1IYJB 1V1QA 5M5XH 2HHHL 1YHQA 1PV4A 4WJ4A 1PYSB 1UEBA 1PH6A 4B3ML 2UU9Q 2UUBQ 4YCVA 1PYBA 3HOXH 2AWNA 4JBJA 5IYDG 5LMUL 1JB7A 4DNIA 1VQCA 2YV5A 4DAYB 3DLLA 2HIVA 3HOZH 3J81c 4LF9Q 3MEFA 2MO0A 4B3SL 3I4MH 1N32L 1SMXA 1YHAA 4K0KL 2PNHA 4C2MH 4RMFA 3W1BA 4GKJQ 2VL6A 4LF7L 3T1HL 1JT8A 1Y1WH
chains in the Genus database with same CATH superfamily
4JI7Q 2GVBA 3ORQA 1XMQQ 1I4PA 2E2JH 1V1OA 5IIFA 2EYJA 3R2TA 1E4GT 5BN4A 3L0OA 1BXRA 5D14A 2XC9A 2WKCA 4RKBA 4E4TA 2E2IB 2W7OA 4FDBA 1PFSA 1FJGH 3DWQA 4KD3A 3QZ7A 1O75A 1BKBA 3BVZA 1F77A 5I4DA 4DFAA 4NXNL 2B8FA 4IHJF 2OCEA 5KFMA 5ELNA 2Q2HA 3HOYB 2K1BA 4P71A 1PZKD 3UI2A 1VQAA 2I80A 4AQYQ 2YYZA 2YU9B 1WSCA 1LTGD 3PR5B 1MD2D 2J6SA 1EZ6A 3G4SA 3GILA 5CV8A 1H9JA 2R8JA 2VNUD 4O3RA 5DLFA 2R3ZA 1PX2A 1EY7A 5C0XI 1FL0A 1L2FA 3OSNA 2JEBI 3BZKA 4OONA 1S3OA 1N9WA 1Y1VB 2W57A 5LYJF 4YHHQ 2N78A 3LGJA 2KCCA 5KYLA 2F0NA 1A2TA 4GNXA 4LK1C 1WVLA 2JA7H 3OUZA 4Q8FA 1IOWA 1JOOA 2C22A 1XTCD 1CS0A 3JRXA 3DWPA 5JH7F 2ZDQA 3MC0B 1PYWD 3LX0A 3PIO3 3KLSA 1TWCB 5IYCG 4A3EG 2FK2A 2N55A 1E4FT 4ZRZA 2WE6A 1EQTA 2EYPA 2Z6KC 4JV5H 4OHJA 5A35A 1PDQA 4IZ8A 2XGTA 1SJHD 2V58A 4DUYQ 1VQ7A 4KY5A 4IFDI 3TIIA 4GOPA 2WP8J 1IOVA 4ECTA 4DR4H 3MWDA 2Z9HA 4KJOA 2ZJQA 5JEAH 3A55A 1XMOH 4DAYA 3QO2A 2UXBL 2UXDQ 1W96A 3TQ1A 1SSOA 4HNVA 4A3CH 4IUQA 3OPOA 4A3FH 4DL3A 2J4XA 4RHSA 3N43B 1Q46A 4NB3A 4ED1A 5DNFA 4Z9CB 1AH9A 5C44G 3PO3G 4IPCA 5ISRA 4A3IH 2K32A 4WJWA 3WWVA 2JA5H 4B3SQ 3KTMA 1XNQH 3RBEA 5J2UF 3MXNA 1UE7A 5C3EG 4B3ML 2BE5D 3S2HH 2XWBB 4OEMB 5DM63 4XZ3B 3G6EA 2F0IA 3S1RB 1GM5A 3R2IA 5EAYA 3VA5A 2W9BA 3PF5A 1HCZA 2D0OA 2W6PA 1EY8A 3I4OA 2UUAL 3L3OC 1X3FA 4ALPA 4RUCA 2B2WA 1XPRA 3HOUH 2IX1A 4DV3L 5D1OA 5EKIA 2AQ3B 1IBKH 4LFCL 4AYBG 1L1OB 4K6LA 4NXNQ 4P75A 1V51A 2PMZA 2DJFC 4RUAA 3P75A 1J8IA 1W6JA 1Q8IA 4BBSH 2YYAA 4ZLTF 4EBEA 2F0TA 5FO9B 2JA8H 3VDYA 2ICEC 2PZUA 2SNSA 4IALA 2IPKD 4IAJA 2XVSA 4RAYA 3ND9A 1Q86C 2ASDA 4MV6A 4ECSA 2FPPB 3RF2A 4X66Q 1Q3LA 4UCRA 1Q81C 3FVQA 2OF1A 1GSHA 3CCUA 1AP0A 2Y0SA 1SDFA 1VF5C 4ED6A 1KDBA 4BBRH 1YJNA 1I4GA 1XPUA 3J80c 3PW0A 1S03G 1S9FA 3D8GA 1Q90A 5C8YF 4LF5L 5ELDA 1SE3A 4QIWB 5K2MA 2UXCL 2JQOA 3N42B 3LNNA 4C1NI 5C4ZA 1I6HH 4Q5VA 4LF6H 4KHPH 2Z4HA 2R92A 2NN6I 2DY8A 2A69C 4C3HB 2CWAA 3SK8A 4ECYA 3MXGA 1DJRD 3TDQA 1UAPA 3U4ZA 2XIGA 4CKCA 5FPOA 5A2QL 3BS1A 4APMA 3KOJA 3GTOA 4RB2C 4O2DA 2UUBH 2EDGA 2K7VA 1PH5A 1I94L 4JYAL 2VUMA 1TS3A 5KNDA 4NW2A 1CKMA 2CH4A 4LF9H 3KLRA 1NE3A 4KY7A 3A5ZB 4ZUIA 5CA0F 4JI1L 4A3JG 4GKJH 1I4RA 3VR2A 3K5IA 4R4TA 4A93G 4BS9A 1B04A 4JI7H 4FO2A 4A3BB 1MSGA 4HIMA 4B3MQ 1XMQH 3V05A 4CJ2C 4CGYB 1B3QA 4DNRB 1BF4A 3EA6A 4DR7L 4OWTB 1WOCA 5KT5A 4IUVA 2NVXA 1TIID 4EG0A 1W6KA 1B9MA 3L4KA 2IHFA 4L63B 5KNBA 5E3FA 2WB1B 2IX0A 2KA7A 5FLMH 4DV3Q 2E74C 3P1HA 1M7JA 1EUJA 2HQLA 3I56A 3RJ0A 1OXUA 4LFCQ 1STNA 4AQYH 3NPPA 3NUCA 1NMFA 1STYA 1FYCA 2A74C 1IKLA 1IW7D 2IT1A 3BZDB 4KKUA 4HYKA 2PPBC 5JJLA 1EFWA 1LTSD 4K5VA 3PO2B 4JG2A 4HJ5A 3U9SA 5C4XH 1EIYB 3PGZA 1GUGA 1D5MC 3M4OB 4BY7H 2K52A 3FP9A 1AUVA 4ED7A 3V6JA 2A6EC 5C0XJ 2C2RA 1PXUA 3GTPB 2CVRA 3GTMB 5ELEA 4JBMA 3OSPA 2SDFA 1A3UA 2CW7A 5GAGC 5C1PA 1QG7A 4CDFC 1HNWL 2OTLA 1HUNA 2RDFA 2QILA 4JOIC 3CRLC 1SYEA 2L5TA 3HOWG 2Q2IA 4JI8L 3FKIA 2Z8LA 4NP5A 4YCUA 2IHEA 3RAQA 1BUVT 2ENBA 1LTID 3SGIA 4LF5Q 2ZTEA 1KJIA 1KC8C 3GTGH 1CA5A 3JZIA 4M9UA 4TV8F 5KFNA 2UXCQ 4DUYH 1HZCA 2KCMA 4DGZA 4ZKCB 5FJ8H 4M7EA 3H4DA 4IFDJ 4L5RC 1YI2A 4QWDA 2O2LD 4H02A 3I4NG 1LO5D 4DAVA 3A8IE 4KK7A 2VW9A 4WJ3M 1YEZA 1O7LA 2UXDH 2R92G 1C30A 5KFJA 4YR0A 2B2UA 5KFCA 1YJ9A 1G2TA 4OIKA 4MA0A 3KHGA 4JYAQ 1VCIA 5EDWA 1TT2A 1M1KC 2LFNA 3CMEA 1X32A 5KFOA 1S4ZA 3EPGA 1PZJD 4ZI7F 1U4PA 5E4XA 4JI1Q 2PZWA 2JEAI 2XTIA 4IJLA 4WFN3 1CHQD 1CQFA 3EIVA 5D3IB 4R8IA 4DV6Q 1S5CD 4QB4A 3M7NA 2VUMG 1PRTF 4FBUA 2ASLA 1DOLA 2VPQA 5M3MB 4DR7Q 1VQGA 2RCNA 4GLXA 1JJ2A 4GN4B 2IL8A 1LV9A 2EJMA 4DN4M 1GKHA 4A3MG 3GTPA 5GQOA 5DLQE 1RF2D 1EY4A 1LTBD 5DG8A 3TN2A 3HS0C 5FO7B 4GZYC 1HUMA 2NYZD 1Z2NX 2XGQA 4NXNH 1YNNC 1A8VA 4QY7A 1S5BD 3NP8A 1LT3D 4L5SA 1G291 1WJJA 3NWSA 4CHTB 2ZDHA 3A74A 3KJOA 5KFIA 4ETSA 3J7A5 2X69A 1VQEA 4APVA 5IT9W 4F87A 2WAQB 2O4XA 1ENCA 1FVIA 1QVFA 4X66H 2Z1CA 1G91A 2G5DA 5IYZF 4ED2A 3NHHA 4QJFA 3PW5A 3H0GH 1VQHA 4C5BA 4PV1C 4C56C 1HNWQ 4JV2A 5F9LA 1QUQB 4MZ9A 1CKNB 2KENA 1KRTA 4U7CA 2LXKA 3Q8RB 3CP0A 4JI8Q 4A3GB 3AMUA 4K8IA 4KJNA 1HZBA 4X3SA 1E2ZA 3RB3A 1BBUA 5IT9E 1KLUD 1EWCA 1A15A 3KUPA 1VQ6A 2CFMA 2FPIB 2OT2A 3FKIG 3QZ8A 1EYAA 1SMYD 3B6YA 4EEYA 1OXXK 2FB9A 4O3NA 3K7UC 1ENFA 2J0TD 4GOPC 4ECXA 5A2QW 1PRTB 4LSAA 5IYCH 1VQMA 1J6QA 2JSOA 2K5QA 4NMZA 2ATWA 2JA7G 1ZHQA 4A3EH 1JQYD 3V96A 3CCMA 4A3KG 4KHZA 3S1NH 5DQGA 2ZT9C 2SOBA 3U50C 4BXXH 2MP1A 3Q1KA 1BDOA 4B3MH 1H9KA 4YAKB 3IN5A 3KHRA 1PH8A 2NTSA 5BN5A 2B63H 1SFOB 2JEFA 3TQTA 2FINB 5GROA 1YHBA 1B53A 1VQ4A 2NU9B 5EKLA 3K81C 2F3IA 4DV3H 1EFID 5A2QE 4XQJA 3E6ZX 2I8CA 5DLGA 3QJYA 4HJ7A 5GAEC 1CQJB 4LFCH 4R4QA 5C44H 4A3CG 3PO3H 4DL2A 2PI2E 4BY1G 2EE1A 4KI0A 3HOVB 5KG3A 3F2UA 5E7NA 5C3EH 4HJ9A 2K75A 4FXDA 1RJPA 4MAMA 1A3VA 4C3IG 3MR6A 1WH2A 1NTGA 4JV5L 4TVAB 1K83A 1JICA 2L15A 1WTOA 1CFMA 1WFQA 4LF8L 1DYQA 4R8NA 1D5XC 4UCSA 2W9CA 3V6HA 2FMCA 3DM1A 3E9HA 2R7NA 1EQVA 3S14H 3I90A 2F03A 1WTHA 4BBSB 3Q0AA 4DAMA 4X62L 1B6SA 2VOBA 5DQHA 3HOUG 5J2TF 3HP3A 4RAZA 2DZDA 3RLOA 3CCJA 1HTLD 1EU3A 3HKZB 1TWAA 1EYDA 1AEXA 4B3RH 2LMCB 4OXPA 2B2YA 1KDCA 4KKTA 1I7NA 1QNKA 5M5XB 1T94A 3PMFA 1BBXC 2F0VA 2FK3A 2R7ZA 2DWCA 2UXCH 3EN2A 3G7LA 1TWHA 4A3LG 1WCMA 1L0XB 4N9PA 2WACA 4HMJA 3S17H 1L2ZA 4C2MB 4RNMA 4CDCC 1D5ZC 4AH6A 4EEQA 5JOBA 5IGEA 3K80C 3BQ1A 3W1GA 2EQSA 3HG9A 1SXTA 4YY3L 5JVG3 1CZWA 1V4YA 3PIOA 1QVCA 3S24A 4BBRG 3NTIA 4JYAH 2GN5A 5CORA 1DOMA 1WR2A 4NDXA 4J1MA 1BCPC 1PV4A 3GTKA 1PYSB 3P20A 4RGOS 4JI1H 1PFMA 3T13A 1PYBA 1RDPD 2AWNA 5LMUL 4DNIA 2YV5A 4DV6H 4FM9A 3J81c 3I4MH 3T5HA 3RD4A 5LHY1 2C2EA 4DR7H 4XYLB 3T1HL 4MV1A 2XRSD 3D4RA 2BCOA 4QCLA 2MO1A 5CV6A 3T5JA 4O4IF 4RGMA 1RJTA 1UC8A 2KHJA 3HBLA 3H94A 1ONLA 4HN7A 5DAUA 3U4VA 5KEEA 1JMCA 1TVXA 5FLXc 1NAPA 4IO9A 1ICWA 1EIFA 1PTOF 1VQ5A 3GTJA 1EU4A 2WFWA 4O4HF 4A93H 1E1TA 3FDTA 1M6VA 3VYRA 1JORA 2Y0SE 1MSHA 3J7YW 5L1KA 4J9QA 4UCOA 4JBWA 3L9AX 3GTLB 4IJHA 4PMBA 4JV5Q 1TWGA 5DGBA 1E4EB 1SAPA 2F0UA 4QUFA 4KHPL 4MV4A 2W70A 4LF8Q 3L4JA 4H44C 2CH4W 5AJ3Q 2YL2A 3T5KA 3J7AF 2EY5A 4ME3A 1TWFB 3CKIB 2R93B 1JOKA 3KALA 4F4XA 5FD5A 4X62Q 3AB9A 1CUKA 5H1SE 1HNWH 4IN3A 4GN5A 5FLMG 4YWKA 2TSSA 5EGTA 1PRTD 2LKVA 5L1LA 3RUPA 3I2ZA 1GUWA 4YB8B 5KRUA 1I3QB 4JI8H 4X3TA 5KFAA 2V59A 4HR7B 2VQEL 3ETJA 3GDEA 1QCBD 2SEBD 2EZVA 4JI4Q 2XNAC 4WD3A 1K8OA 3CCRA 1WTQA 2GVAA 2A6HC 1Y1WA 2RHSB 1E24A 2EYOA 1PLFA 1XPOA 1MZBA 2O5JC 5JVDF 3LWUA 1U9RA 1KJ9A 4KD4A 1VS0A 3GIKA 5C4XG 2R7ZG 3M4YA 4HCSA 4FF3A 3S16H 1YNJD 4C5AA 3PR4A 3S15H 4ZHQF 5DG9A 4YY3Q 2IW3A 3P7JA 1PA6A 3DWAA 3H4BA 3PSIA 3K57A 3CQZA 5I6YA 3RNUA 1MGSA 3SK6A 1R4QB 1AE2A 5KFDA 2B2UC 4DV7Q 4AQYL 4I4TF 5LMUQ 1EZ8A 5DQIA 4ME5A 4FYDA 1M0TA 2NU7B 1PTOB 1NNXA 2KCNA 2XRQD 4LW1A 3BDCA 1S72A 1CQVA 2VZAA 3T1HQ 2Q2UA 1VKZA 3I4NH 1I4HA 2E2IA 1EY5A 2HDLA 1STEA 1EHIA 3GQBA 2R92H 3H20A 3NENA 5HY6A 4EYHB 1W3SA 4DKAC 3S2DH 1H9MA 3GTOH 1DV2A 2I07B 2HVQA 2QCPX 2R7FA 1CI3M 2YU9A 4NLGA 3ZJYC 1R9TB 2VUMH 4MTDA 1SLJA 2CW8A 2BOSA 3KBXA 4FP5D 3V2TA 1QE6A 4C3JB 3PVXA 1ASZA 2EYMA 3K7AB 2I5LX 4A3MH 1SNQA 1Y1VA 2LS01 2V4DA 1VQBA 4ED3A 2L12A 2NVXH 2R87A 1EY6A 3OWFA 2OQKA 4CBVA 1TWCA 2BQ3A 2ATLA 2K6AA 1B4OA 1CSPA 1JJCB 4N8FA 1IBML 4U68A 3STBC 1D6EC 4LMYA 5COYA 2VQEQ 4LFBQ 2I46A 3CRKC 4PQXA 2KBNA 4Y7NH 2F0OA 4FNFA 2VQFL 1ASYA 1BBWA 1BNCA 1VQOA 1LTAD 1TAEA 2NWGA 3I12A 1U0LA 3HOZG 3CC4A 1MBYA 1X65A 3D31A 1K8GA 3CPFA 2K04A 4GN3B 2D9UA 1JWSD 4M1UB 3H0GG 5F9NA 4O1NA 1I5FA 4J6HA 5JAVA 4EGJA 1WTVA 1ML0D 4Q45A 2VPSA 1C0AA 2WV6D 1TU2B 3D6WA 3SK5A 3W5OA 4QW9A 3PUYA 5LL6S 3G6YA 1ZETA 2IX3A 3FKIH 2YTVA 5C5LA 3V4SA 2MUYA 4O4LF 3JC66 1IYVA 1U5KA 2NVQB 5M3FB 1L0YB 4X66L 4YAJB 3X3MA 2PI2A 3NXWA 1EY9A 2MJ8A 1D7QA 1DOKA 2YRWA 1I50B 4EBCA 5EPKA 5EJWA 4LMQD 5M5YH 2RDHA 1QOHA 4G57A 4CDDC 1PFBA 2JEIA 2AUJD 1L1OA 4A3KH 3GIQA 2DPIA 2BH8A 4L6TB 5IGFA 1Q7YC 2B2TA 3EFXD 3K3PA 2NZ1D 5GADC 3BJYA 1NMGA 4BXXG 2PO4A 4J0MA 2EXZA 5I9OA 1NR4A 4YWMA 4LF8H 4KN7C 4V0BA 3HOYG 4I55F 5KX5F 1Q8KA 2MCTA 2VB3X 2YZNA 2KEEA 2B63G 4Q43A 2FPGB 3FRPB 1FD7D 5IGDA 4G3IA 5FKAC 1RCVD 3BG3A 1N8RC 4X62H 1PHJA 1GSAA 1S0OA 2F0SA 1N33Q 3M9BA 4CKEA 3A0JA 3M4PA 4IWXA 1IYUA 3T53B 4U673 4BY1H 4IUPA 4DK0A 1KHIA 3Q2OA 5I9PA 3RV3A 2VS1A 4JI3L 4XYQA 1Y1VG 2MQHA 1HR0W 4C3IH 2F0JA 2E8GA 2JXMB 4JI4H 3N6RA 1IBMQ 4QIWA 3R3OA 5KT3A 4DV4L 1CSQA 3D3RA 3NTHA 1JWUD 3MR3A 3C1EA 1FR3A 4AYBB 2VQFQ 4OO1G 2B2YC 1JKJB 5KYIA 2PVPA 2YCHA 1PTOD 1FKAH 4JW0A 1LLRD 1G2SA 3DEPA 3GD7A 4O2BF 1RK5A 4WORA 4YY3H 2CQAA 3PUZA 3HGBA 5IGCA 2ZJPA 3AEVA 4EQNA 5JVLA 4IPGA 2HCIA 4BA1I 3WOFA 1X3EA 4H0LC 1PFNA 4DV7H 2AUKA 5M5WB 5LMUH 2RDJA 5IT9L 4A3LH 4MIUA 4FF4A 4J15A 1V1PB 4IOAA 2O03A 1LYLA 2HGSA 4R8UB 1J5EL 1O7YA 3T1HH 2ZXOA 1SJED 1B8AA 4QWAA 3M9NB 5J39A 4DU9A 3J80E 5IE8A 2FFKB 2VR1A 2WB1A 4IWYA 3SEBA 3MWEA 2G9DA 1K8MA 4QGUA 2XCLA 4PG3A 1JXLA 1UEAB 3K8AA 1S5DD 1A3TA 5C4JB 2P0AA 5JJIA 5L9XA 4B3RL 3OWEB 3KF6B 2EY6A 3J7AV 3I55A 3S1QB 3V6KA 3WDNA 1PK8A 2N8NA 2A19A 2L0CA 1E0BA 5KFWA 5EWEA 2EYHA 3FHWA 2RHQB 2DUDA 2HVSA 5BPHA 2BE5C 3T51B 2PBZA 3I4MG 1LTLA 3K5LA 3RZDB 5KT7A 2QGQA 4UP9A 4A3JB 2AWOA 5EKKA 2RF4A 2KSWA 2YZGA 3F2DA 1CM9A 4UCUA 3GIJA 4KTAA 3GTMA 4MTNA 1CKOA 1OTCA 2L55A 2NVTB 3H3VC 5IY0A 1N34L 2NB0A 5M9OA 4FF1A 1H9RA 5CB4F 1C48A 1GUNA 4HIKA 1STGA 2B3GA 4JI3Q 2CQYA 2VQEH 4UY8C 4LFBH 5E4WC 2E2HB 2K14A 1QILA 3BAAA 4CC6A 2A6ED 4DV6L 2Z0SA 2DY7A 4DV4Q 4LH7A 2EJFC 3E9IA 5FK9C 5KFHA 2R7LA 3J81i 5KFKA 3SVMA 2C5CA 3KAJA 3GTQB 3N41B 2NVYB 2RCFA 5EZYF 2UVWA 1K83H 3ND8A 4XXEA 3EROA 4DLKA 1D1IA 2MHVA 1CTMA 1OXVA 4PNYA 1UE1A 2A73B 4LWCA 3OHAA 1I4QA 2W8LA 5LA6F 3RLFA 2FMAA 1T3NA 1W93A 4IPHA 1BNZA 4QWBA 3BQ2A 4A3DB 4KV6A 3FPPA 1S40A 2UU9L 1QB5D 1TWAH 5L1IA 2YTXA 3MR2A 2L9HA 3TZDA 2CWPA 3Q23A 4L5TA 2IY5B 1F2ZA 4DK1A 1J5EQ 1XXGA 1CZGA 2R7ZH 1HQRD 1U4RA 3HOWB 5C3WA 3ZYYX 2HJWA 4XT1B 4YBZB 3RFCA 1TWHH 3R5XA 4A3BG 4F8MA 1WCMH 2HCCA 2EYFA 2AGPA 2BH2A 3BA9A 1VQFA 2D2CC 3TINA 3G48A 3J81j 3RUZA 4ME6A 3TS0A 2A5HA 5LL6b 4DV5H 4LNQA 3HKSA 4JCVE 1AN7A 3Q8PB 4B3RQ 1Z2OX 3QB3A 3UDFA 1S5ED 2Y0SG 3UDIA 3CCEA 3DEOA 4IUUA 4HJAA 2BA0A 2KCTA 3Q8QB 3JAMi 3PCOB 3SE7A 1K9MC 3GTKH 2WAQA 2RDIA 2BDOA 5KG6A 4J9NA 4EYIB 3DMUA 1F2MA 1Z9FA 4YWLA 4R7RA 2IWHA 1E7ZA 4N9TA 3TMEA 3K58A 1MJEA 5EWGA 1Y8NB 5D65A 4A76A 3PO2G 1N33H 2JA6B 1N32Q 3RB4A 4L5QA 2I87A 1QUQA 1DM0B 2XN9C 1CKNA 4PZ8A 4EVOA 4QMGA 4XYOA 3RZOH 1N34Q 5HBRB 4LSXA 3S1MH 1IBMH 4X65H 1O7ZA 3N44B 3FPUB 3A56A 1KL9A 3GTJH 1SE8A 1EIHA 2VQFH 2JP1A 1WI5A 4I7ZC 2DJGC 2ALZA 3R8BA 1STBA 4XDXA 2H1EA 1SYCA 1CQIB 1GUSA 5IWAQ 3HOXB 2X6GA 3R5HA 1TWGH 4ILWA 4PZ6A 1HNZH 3JAML 4K5XA 1KRSA 3ORRA 2E76C 2RSOA 1KAWA 3H3VH 3VPDA 2GPSA 2E2JB 2FXQA 3VMMA 1AZPA 1VQJA 2EPBA 3K59A 3M3YH 3QG1A 3PQIA 5KT4A 4JVZA 1EYCA 3SI8A 5KG1A 2Q8RE 1HXYD 4WJ4A 3MWMA 2UU9Q 3NQIA 3ITPA 3NBIA 4JBJA 3S9WA 1SFOA 3DLLA 3HOZH 2EYLA 2MO0A 3HXLA 1SMXA 4XT3B 4RMFA 2BDNA 4LF7L 1Y1WH 2YZMA 3NEMA 1B33N 2R61A 1IBLL 4MA5A 4ECUA 2PQEA 5M3MG 3SK4A 1Y69U 1X9NA 1SYBA 1NBWA 3W2DA 5IGGA 5FD6A 3NBHB 4PMCA 1Q1EA 2I0QA 2HIXA 4GNXC 2GPWA 4Q0YA 4EQ5A 5D8DA 1L1OC 1DIKA 1ZHSA 2UVUA 1DGSA 2FLLA 3CQZH 2RKSA 1ICFB 2JA7B 4YJ3F 3A8JE 3MAQA 3KFUA 3K5MA 1NSNS 2M05A 2B2TC 2GA4B 2I5HA 3H09A 2CKZB 2F4VL 2NTTA 1DV1A 3C1FA 4DV1Q 2HD3A 2A68C 1STHA 2E2IH 2AKWB 1UNSA 4RFBA 4FS2A 3HKZA 3QR8A 1T5EA 3AQQA 4JI3H 4DXFA 4RZRA 4ZQ3A 4RG1A 1I6VC 2L1BA 3D6CA 4R4CA 4DV4H 2K01A 3HOYH 5KFVA 4GC6A 1OXSC 1K73C 4UHVA 1N36L 4FXGC 4A3FB 4R4IA 4C2MA 1SEBD 3R23A 5BMVF 3KBGA 5KG0A 4IPDA 1HH2P 1RHPA 2JK8A 2EY2A 4A3IB 3ONAB 2JA5B 4ED0A 2F0HA 3S2HB 5C0XH 1ILQA 5I6WA 1Z7TA 1IKMA 1A62A 4B9XA 2IMWP 1Y1VH 5KFSA 2B2WC 2JEGA 4DUZL 3G6JB 1BVSA 5LL6X 4YCWA 1TWCH 5DGAA 3HOUB 2VB2X 1JE5A 4OO1H 4DR2Q 3D4DA 1L0WA 5AJ3L 4UCVA 1O78A 1LT4D 5C5JA 1J5EH 3M85A 4UPAA 2K50A 5D1PA 4O0AA 3OTOQ 4MTKA 3F2CA 2QK4A 3DXJC 4LJZC 1KNEA 2CW0C 4KKSA 4CDEC 3OW2A 4LF7Q 5HV6A 3GV5B 3PW2A 4IFDH 4MTEA 4EX5A 4GLAC 1IBLQ 3CVZA 1IXRA 3IFDA 1CT1D 2JA8B 3U9TA 1FNWA 4FU0A 1TXYA 3LWEA 5KG5A 4X64L 3CW2C 5BR8Q 1GGOA 3J81W 5DEHA 1B44D 4OELB 4JI4L 3GTLA 3HB9A 4PZ7A 1EQQA 1ILPA 1E4EA 3A5UA 2J6TA 1EWHA 4BBRB 2X0SA 2KHSA 1ET9A 3EJIA 3Q6SA 1TWFA 1EZ1A 4CC5A 4QIWE 1EWIA 2R93A 3V4ZA 2K05A 2QEXA 3OSOA 3H6MA 3S1RH 2F4VQ 3TP8A 2IP4A 4IRKA 1HZAA 4F88A 1S0NA 1N32H 3WO0A 3E5NA 2IBKA 4I7HA 1I6HB 3MTSA 2Q8IB 3J81E 1IHZA 4DL5A 2V5AA 1N34H 4P73A 1A6XA 1LT5D 1I3QA 2J9GA 4HR7A 3VPCA 4FXKC 2K5WA 4ZK9B 4DV7L 2KUMA 2BR0A 1W2BA 2J7ZA 3RGZA 5KFFA 3J7ZC 1FNVA 2VXWA 2PQAB 1FGUA 2AQ2B 1LABA 1RYRA 3BYYB 3UDGA 3OIPA 2YRXA 5IWAH 1N36Q 1NY4A 3M9MB 4RB3C 5FLXE 3FEWX 2TMPA 4K5WA 4JI5Q 2ID0A 4C1NK 1WYDA 4X3UA 2FP4B 4DR3L 3JAMW 3PV0A 4DNTB 2ZJTA 3KDFB 4RB0A 1P8LA 3H91A 2NZHA 4ECWA 2NZOA 1XDNA 2ALYB 4YR2A 2LY7A 5L1JA 1B50A 5IYBG 4TQRA 1VBGA 2WB1E 2ZM6L 2OH2A 4DUZQ 1MKHA 3J80i 1ZKOA 1GUOA 3PUXA 3OHBA 1VQ8A 2UU9H 1F9PA 1HFGA 2QA4A 1H9SB 3K5NA 1CA6A 1HTPA 5FPRA 4IZOA 1EY0A 4DR1L 3NQTA 1FNUA 2VA3A 1KXLA 4C3HH 4Q8EA 1AN8A 1EEFD 2NN6H 4ABNA 3JAME 2EIFA 2W6MA 1RODA 2AU0A 3RLNA 3AU7A 3GIDA 1UNNC 1HR0L 5C4XB 4X64Q 4BY7B 4ZQIA 1TS4A 3ER0A 5LMNQ 3Q8SB 3URYA 4LFBL 1M0WA 2NU6B 1R9TA 2UVVA 3ULJA 4PDBA 2ZJRA 3T4AC 4RA8A 5T1GA 2M2LA 5CAEB 2ICIA 3KF8B 4A3BH 1EOVA 4BA2I 3J80L 2YS6A 3OMGA 4X6AH 4XX0B 4DV1H 1S0MA 2QW7A 2DLNA 4HNTA 2F0FA 1WCMG 1EL0A 1BOSA 1ET6A 4RH6A 3U9OA 5BN3A 3GTGB 3JRWA 1ESFA 1E2VA 5KG4A 2QEJC 2W6QA 2QDLA 4JI2L 2R93G 1VDZA 1HRJA 1CE8A 5KFQA 1FGBD 5C5MA 4J9SA 3ERQA 5ELFA 3VPBA 2VY3A 3CC2A 5JQWA 1QZGA 4LFAL 2KQ3A 3MVVA 1UE6A 3KXYT 1JB3A 5JEAJ 3VR6A 2XCPA 1XJVA 1E3PA 3MA2B 4G7OC 1K1SA 1DD2A 2DIKA 1X3PA 2J6UA 5CMDA 1TS2A 2FE3A 1ZYRD 3PO2H 1RL2A 5ELBA 4QQBX 1Z2PX 3M4OH 3ULPA 1XNRL 1C3OA 2MFIA 4DR3Q 1A0IA 3E0JA 3E5SA 3GTPH 3GTMH 2BQUA 2MNAA 2WKDA 5FOBB 4DV5L 4RAUC 1VQ9A 1OWTA 3OIQA 2F52A 2JEJA 2ZM6Q 3TSSA 3VYTA 1JC7A 2F3WA 4DR2H 3GV7B 3HFZB 4CKBA 4MV8A 3H3VI 3U58A 3AFQA 3RR5A 1BXTA 2RGVA 3OTOH 3F1ZA 3MJFA 2CCZA 3OUUA 3W3AA 2Q8TA 4DR1Q 4LF7H 3OYYA 3K0YA 1SCUB 1I50A 3FMAA 1RTNA 1IBLH 2WAQE 1Y8PB 1ZEQX 1HNXL 1N33L 4E6IA 1BQQT 5F2DA 3FDSA 1YNJC 4OWXB 5BR8H 4ECRA 3TP5A 2B29A 1PH1A 4ECVA 2L11A 1HR0Q 3IAYA 4UAIA 4YP3A 4X65L 2N3SA 5LMNW 3NSWA 3I91A 2W7PA 3K5OA 4ULLA 3H0GB 4F7XA 5JPNC 2PW5A 2M9VA 2R8IA 1IL8A 1SYFA 3Q24A 3I3CA 2SNMA 2RBMA 1GO3E 4XQQA 2F4VH 3DM3A 4BWGB 1HNZL 5KFXA 5BPFA 5M3MH 1Y1WG 4J9KA 3D0FA 3ICEA 1XTDA 4C3JG 2M00A 2BQRA 1M8AA 1ZQ7A 4DR6H 2RVLA 2K5NA 3VYUA 4JI2Q 4DAPA 3T1YQ 4LUOA 2X6LA 5IODA 4JV0A 4I65A 3CCSA 1LT6D 1LTTD 2LSSA 4LFAQ 3WNZA 1MHWC 4RGTA 4O2AF 4AYBA 1N36H 1V43A 1F2LA 3KHLA 1PZID 4HSPA 4A3EB 1B6RA 3S1NB 4JI5H 1EIGA 1EOTA 2RGRA 1JJGA 1YBYA 3T5LA 1GYFA 5KFTA 2N88A 3AFPA 5J1ZA 1XNRQ 4FS1A 1EYGA 1O7IA 1HFNA 2KHIA 3TEHB 3DF7A 2RQXA 2XSCA 2B63B 1B1ZA 5ELOA 4DUZH 4ODGA 4DV5Q 1K0SA 2ASJA 4NXML 2FHTA 5CV7A 2CZGA 1JDEA 2F0DA 3BABA 1KJQA 3BDOA 4RCNA 4HSVA 1V1PA 1GLVA 3I70A 1V9PA 4R8UA 1N48A 2B39A 4RHRA 4A3GH 4J9MA 5EBCA 3VYSA 3Q8DA 3VR5A 5KGUA 3O13A 5C44B 4K14A 3PO3B 5KFYA 3G6VA 1AFPA 1OXTA 4Y8VB 4JK1C 4FF2A 5C3EB 4OO1I 1XWEA 1HNXQ 4XQNA 1GHJA 4ZOLF 3OW7A 3UFXB 5G3LF 1JIHA 3MHBA 5M3FG 2V4RA 2E2DC 5C0XG 2NUCA 2W8KA 4X64H 1SNOA 3BU2A 2O5IC 5LMNH 2RA4A 3KF6A 4IURA 3RIZA 3PIP3 1YIJA 2MGSA 2F3VA 4X65Q 3S14B 1XYIA 4F50A 4GLVB 3HKZE 2QF7A 4A4IA 3OOCA 1EQRA 3PN1A 1CK1A 1X55A 2DGYA 1KTKA 2F0KA 2VUGA 3IRBA 1A63A 1DONA 1HHVA 4KN4C 3MFIA 4OL7A 1S97A 4IR9A 2JJQA 2HHHQ 3J80W 1SFOH 1I6UA 4WRDA 1HNZQ 4NKLA 5LOVF 2HT1A 3WO1A 1TY0A 4IFDG 3E0EA 4MV9A 4RNNA 2ZTDA 4TKOB 3OHXC 3S17B 1TKWB 3RTXA 3BZCA 4DV2L 1WTRA 4IOCA 1Q82C 4ED8A 2D0PA 1YJWA 2E2HA 2R7DA 2A69D 3GIMA 1VQNA 4ECZA 1LM0A 1T36A 3H15A 4CJ1B 3HOVH 1KDAA 2HDMA 5KFRA 1GXDC 2DPJA 3K0XA 1P16A 1EUCB 2IJ0A 3C2PA 3GTQA 4OIJA 4IR1A 2NVYA 1VBHA 1PH7A 3RAXA 5LP6F 2R8HA 2PN1A 3Q22A 3QOLA 4GNXB 1II3A 1VF7A 5EBDA 2WTFA 3GQCA 3N40P 1DCZA 4DR3H 1KLGD 3NWTA 1QNUA 1TY2A 3ERSX 3I4MB 4P72A 4LAAA 2WIIB 2FLNA 4V190 3EBEA 4QF4A 3IG0A 3CD6A 3E3XA 2ZM6H 4TSSA 4YQWA 1WTPA 2KJXA 4NXMQ 3MWYW 2KECA 4GOPB 3MXPA 4LUZA 5IOCA 5KFUA 4O3OA 5CYUA 5M5XH 5KG2A 4MHEA 4FVMA 4DR1H 2PYKA 5IYDG 1PTOC 5KFEA 1VQCA 4A93B 3A7AB 4DAYB 3MEFA 5E1FA 1RJQA 2E5LH 1N32L 4K0KL 1KEEA 2PNHA 4C2MH 1JT8A 2VL6A 5EPJA 3F8NA 4RWSC 2ZDGA 5IYBH 4FBTA 2EY1A 5HGTA 1HR0H 3TP7A 4M8AA 3T16A 3MXNB 3LMLA 1K8AC 3C0FB 4UDUC 1BCPF 3CF5A 1WD0A 2V9WA 1SN8A 4L1KA 2QDBA 4ZUJA 5K36G 2EOTA 4DV0L 4EFBA 2F0EA 4TQUS 2R6GA 4LF4H 2W9BB 4DL7A 2HVRA 2EXDA 3MFGA 5DM73 4JC0A 5IWAL 3TREA 1WTXA 3CCVA 4DL6A 2HQEA 5D1OB 3C3LA 2UXBQ 3A54A 1A9XA 5KG7A 3RBDA 4RNOA 5FO8B 2JA6A 1GUTA 2UUCL 3GIIA 4C3HG 2PMZB 4G7ZC 2NN6G 5IP9G 1AUXA 4F4ZA 1YITA 2NUAB 4JI2H 1Q12A 1RK6A 2W6OA 1RIPA 3EPIA 3T1YH 5GAHC 3OMCA 4DV2Q 2FMMA 1AW7A 4IQZA 4G7HC 1S68A 4J9PA 4LFAH 3CMAA 3S16B 2SCUB 5I2YA 4GKKL 2N49A 3S15B 3CHBD 4R9WA 2UUAQ 3GTLH 3A8KE 5H80A 1RTOA 2Y0SB 1WD1A 1GJXA 1EUDB 4IRCA 1XNRH 4HTHA 3RB6A 2R85A 1T5XD 1TWFH 4H13C 1G6ZA 1KD1C 2R93H 3J81L 1SE4A 4OX9L 1BO0A 1TQOA 2P5ZX 5IP7G 4IUTA 5C4HA 5KT6A 1STAA 1C4QA 4L8JA 3I4NB 5C3XA 3M9OB 2WB1G 4AIMA 4HMIA 5I47A 4ZKBB 4GS3A 2EJGC 2F0PA 4B9WA 4QWCA 2F1MA 4X3KA 2R92B 1I3QH 2F0LA 1A2UA 4TRDA 3IKJA 3IFTA 1RKNA 5FLXL 3TZUA 3G71A 4YHHH 4N8X1 4A3DG 1SYDA 1I4XA 3S2DB 1F9QA 1VMPA 1BCPB 1T9HA 5ELCA 2KEDA 1YNND 4POFA 3D4WA 4DV1L 1PH9A 3GTOB 4QWEA 1VAJA 3L7ZC 1HQMC 5K5PA 1TR5A 1HNXH 1B70B 3K5HA 4XTCS 4K0KQ 2VUMB 1BGWA 2W6ZA 4XYMB 4LUVA 4HIOA 2K4KA 4B3TL 2FJZA 3R5FA 3NBHA 2ZTCA 1E2WA 2JE6I 1B3AA 1K3BC 1HJPA 2YW2A 2B8GA 4RCOA 1LTRD 1SR3A 4A3MB 4KLKA 4DA2A 3J7AK 1CHPD 4EBDA 1HPCA 1RD9D 2CQOA 3I8ZA 1VQLA 2R86A 2JA7A 2YTYA 4DV0Q 2AHOB 1D8LA 4KY6A 2NVXB 1IW7C 3UE0A 1OO9B 4YIJA 3WOEA 1WTWA 5KT2A 1C9OA 2PCFB 4Q0FA 4O3SA 3EYYA 1PTOH 2OWOA 2HHHH 3CXCA 5KNCA 2DN8A 5EQ0A 3KHHA 5TSSA 1I94Q 1SRUA 3AYHB 1PMRA 2UUCQ 4F4YA 4R1JA 4Y7NB 4B3SH 2MPMA 1S5FD 5CV5A 2OEOA 2JN4A 2LXJA 4DR5L 1S10A 3LWBA 4XIGS 2JA6G 4K2LA 4J9OA 3KAKA 3HEJA 2B2VA 4K8JA 4ECQA 4DR2L 1SNCA 1UE5A 5C1OA 3CCLA 3MXUA 4GKKQ 2OXPA 5G3LD 1K28A 2C00A 2A68D 3OTOL 1R9TH 1HA6A 2AQ1B 2WINB 3RV4A 4JI0L 5JJZA 2JA5A 1B9NA 3M4QA 4C3JH 4PMWA 3K7AH 4TQSA 2K5VA 2FK1A 5JJKA 3HOXG 1DXMA 3FKIB 5BR8L 4OX9Q 1ZXTA 3EQLC 4TUYF 2K33A 2VQDA 4NXMH 3DUZA 5IGBA 4EFEA 5EWFA 2OQ0A 2OLSA 1SE2A 1JE4A 1Z6HA 5M5YB 1K1QA 4IRDA 1X3GA 4JI6L 5EOYA 4RU9A 3SE0A 4RKLA 4A3KB 2RDGA 1M90C 4KHVA 5LXTF 4UFZA 2D5DA 2ZXRA 1JX4A 4MNOA 1Y14B 1QZHA 3BYTB 3HRZC 1KNAA 2WAQG 1GD7A 3UDXA 2WYOA 2G9HD 2EVBA 1X56A 4NPSA 4B3TQ 4ID6A 4DR6L 1ENAA 3QOJA 4J9RA 5CV4A 2UVRA 3TBIB 5NUCA 3PZPA 1HZ9A 4JBKA 2XIWA 1E22A 2DNCA 1PH4A 1GHKA 2FLPA 2CW0D 4H7BA 2Z4IA 2I5MX 5C6AA 4BY1B 5IT9c 2F0QA 2KVMA 2YU9H 1FJGL 4A3GG 3KLSX 2UXBH 5KKNB 4JI5L 3BQ0A 1SNDA 4C3IB 2K03A 2V4QA 1GVPA 2K5DA 4JPBW 4AYBE 3IL8A 1PVOA 3TIGA 3RB0A 2RSNA 2NVQH 5M3FH 1YZ6A 4LH6A 1KBLA 4MN3A 2F4IA 5JPMC 1I50H 1Y8OB 4DV2H 1F9SA 4DR5Q 4HQ6A 2XWJB 3MEHA 2Z6BA 2WDTA 4O3PA 3TQYA 2PQAA 4J8QA 5CA1F 3QIAA 3GLKA 2D62A 1HA5A 1YVCA 2UUAH 3SDZA 5KFZA 2C9OA 4ZAIA 2F0MA 4I7AA 4B08A 1E1OA 3UQ8A 1U4LA 4J9LA 1G6PA 4POGA 2CHBD 1I7LA 3JSNA 3QWNA 4JI0Q 4A2AA 5JEAG 4Y52H 4IUNA 1SMYC 1BCPD 3NTKA 2Z6KA 2R84A 5CC4A 3NELA 1GOZA 3KDFA 4A3FG 1N56A 1VQKA 1SROA 1C7YA 3CAMA 1YNXA 1AE3A 4DK3C 4A3IG 5LMNL 2JA5G 1J9OA 3MZ5A 3GO5A 5EPLA 5J22A 1H9SA 4WBNF 1X6OA 2L4NA 3MR5A 3HOVG 2JYOA 4JI6Q 2NU8B 5KFBA 4DR4L 3CCQA 1GSOA 5KFGA 3FMCA 1PH3A 5FLXW 4DK6C 1XMOL 1DZ1A 2W9AA 1TS5A 4DPGA 3KJPA 4K0KH 2Q2TA 1PH2A 3ULLA 2KOLA 5KIXA 4CJ0B 2K5HA 4HJ8A 4MV3A 3PW4A 4LF5H 1XNQL 1JR0D 4BBSG 4DR6Q 3I72A 4MV7A 1EYZA 4DL4A 3GP7A 1D1KA 5T1IA 1B7YB 1V8QA 1NR2A 2JA8G 3I73A 5J3BA 3BG5A 4O3QA 4DV0H 3QFFA 3SR1A 1LUZA 2ASBA 3HKZG 5M5WH 3ETHA 4A2BA 1ULZA 4HNUA 1SYXB 3KF8A 2GLTA 4GC7A 5IYDH 1TA8A 1VQDA 1XX8A 3PF4A 1FJGQ 1SEIA 1SNPA 2ZXPA 1SNMA 3CU7A 3DHQA 1C8CA 2PNRC 1IBKL 4I50F 1I94H 3MFHA 2R8KA 2UUCH 3GTGA 3RMHA 1RYSA 5D3DA 1X54A 3GV8B 4OWWB 1M4VA 3SXHA 2AGQA 3NE5B 2C35B 3JSLA 3N6XA 2XCAA 3RN5A 2A6HD 2A1AA 3PIPA 3G6XA 1KAAA 4P2CB 5K36H 1ESRA 2PMZE 1K83B 5C4JH 2R7KA 2K28A 1Q1BA 3L2PA 1IL2A 4RZQA 4GKKH 1UUPA 3VR3A 2E75C 3PUWA 1NCVA 4P74A 3S1QH 3UE1A 1UWVA 2QYZA 2YS7A 2W9CB 2XGPA 2C28A 2ES2A 2W71A 5CV9A 1O80A 1JOQA 1BR9A 3R93A 3K3VA 3RZDH 1LACA 2AMCB 2E5LL 5IP9H 3PW7A 4A3JH 2NBFA 2HUGA 1TWAB 4UP8A 1AZQA 5HGQA 4OX9H 2JA9A 1QWYA 3K6OA 2OTJA 4YJ2F 3T56B 2R7ZB 2A8VA 1KIXA 4A75A 5GONF 2NVTH 1JLLB 3KYHC 3GV3A 5KFLA 1TWHB 4F4WA 2R8GA 4LF6L 1QJOA 1WCMB 3BVMA 1R4PB 1KC7A 4S3SA 5KFPA 3I4LA 4QUCA 4LF4L 2H5XA 2E2HH 4DR4Q 3BA8A 3I7FA 4ZCKA 1XMOQ 3G8CA 2UUBL 4KMUC 4UCTA 1BJTA 3GTQH 4EQOA 2NVYH 5IP7H 4LF9L 4B3TH 3GTKB 3JAMc 1IZ6A 4QL5A 4GKJL 1SBBB 2F0GA 3T1YL 1XNQQ 4HAEA 4JI7L 1XMQL 1MIUA 2PW7A 5CBEE 1RJRA 3H0GA 1JWMD 1MJCA 3GV6A 2AQ4A 2FJ2A 4BY7G 4A3DH 1X3QA 4PWQA 1KQSA 5CBAE 1G51A 5CGKA 1JCKB 3RZOB 3GIPA 2AGOA 4EGVA 3LP8A 3A7LA 2R82A 3S1MB 3PUVA 3HOWH 4JUZA 3RGXA 3F2BA 2VA2A 1IBKQ 2R6FA 3GTJB 3STBD 1B2TA 3N52A 1F9RA 2W6NA 1QVGA 1K3RA 3KLWA 1H95A 1VQIA 2DNEA 4HCEA 3CC7A 1KJJA 4DR5H 2BA1A 2FKLA 4Q44A 1PRTC 3H40A 5T14A 1K0RA 2V1CC 1VQPA 1TWGB 2R7MA 5FJ8G 4RB1A 5DG7A 3BJUA 4UP7A 4EGQA 4G4KA 4OGQC 4C5CA 1SYGA 1U4MA 4JOIA 3MFYA 4O42A 3BDLA 3VA7A 4YHHL 2C2DA 2B2VC 4JI0H 3M4IA 4DF7A 3M3YB 1VMCA 1F2YA 2PZTA 2E5LQ 5JUMA 4U6PA 5CR3A 1Z47A 3F8TA 3X3NA 3EVQA 3RN2A 2B63A 1NJIC 4R4OA 1KJ8A 3SHLA 2JA6H 3HOZB 1JDBB 4HIDA 3NK9A 2H4OA 3BVGA 4ZYSA 4DUYL 5L37A 3TRZA 3HZXA 1Y1WB 4LF6Q 5AFWA 4KHPQ 4K6DA 2XD4A 4K2KA 3C46A 1D2BA 4JI6H 3TS2A 3CPWA 4LF4Q 4EQPA 2F0WA 5JVH3 3VR4A 3TP6A 2UXDL 4RGNA 1IYJB 5I2XA 1V1QA 4DXGA 2HHHL 1YHQA 3N8DA 1EEID 1UEBA 1PH6A 1ZYRC 4JV1A 2UUBQ 4YCVA 4TV9F 1G8ZD 3HOXH 4BWSC 1JB7A 1NUCA 2IA6A 3CQZB 2HIVA 3KK7A 1KABA 4YR3A 4LF9Q 4B3SL 3NGDA 1UC9A 1YHAA 4HEDA 3W1BA 2QKIC 4GKJQ 5HURA 4QW8A 1MI2A 3M7GA
chains in the Genus database with same CATH topology
4JI7Q 3NEMA 2GVBA 1IBLL 5IYBH 1XMQQ 2E2JH 1X9NA 5M3MG 3L0OA 2MO1A 3MXNB 1NBWA 1K8AC 3CF5A 2KHJA 3NBHB 1SN8A 3U4VA 1Q1EA 2I0QA 2HIXA 5K36G 4FDBA 4DV0L 4TQUS 1PFSA 5FLXc 4GNXC 4IO9A 1EIFA 2R6GA 1JMCA 1BKBA 1VQ5A 4EQ5A 1L1OC 2EXDA 2WFWA 4JC0A 1DGSA 5IWAL 4A93H 1E1TA 3CQZH 4NXNL 3TREA 2Y0SE 3CCVA 4JBWA 3KFUA 2OCEA 5ELNA 2UXBQ 2Q2HA 4IJHA 4JV5Q 4P71A 1VQAA 2I5HA 2UUCL 4KHPL 2CKZB 4AQYQ 4LF8Q 2F4VL 2YYZA 5AJ3Q 2NN6G 5IP9G 1YITA 4DV1Q 4ME3A 3G4SA 1Q12A 1RIPA 5GAHC 2VNUD 4DV2Q 2E2IH 2AKWB 5C0XI 1FL0A 1L2FA 3AQQA 4X62Q 2JEBI 1CUKA 5H1SE 3BZKA 3CMAA 4RG1A 4OONA 1S3OA 4GN5A 1N9WA 4YWKA 5FLMG 4GKKL 2N49A 4R4CA 2N78A 3LGJA 4YHHQ 4GNXA 2JA7H 3I2ZA 2UUAQ 3GTLH 3HOYH 2VQEL 3GDEA 1OXSC 1K73C 5IYCG 1N36L 4JI4Q 4R4IA 4A3EG 3CCRA 2GVAA 2RHSB 1E24A 1TWFH 2Z6KC 1XPOA 1KD1C 4IPDA 2R93H 1HH2P 2JK8A 4OX9L 5IP7G 1VS0A 2XGTA 5C4XG 2R7ZG 4DUYQ 1VQ7A 4IFDI 4GOPA 2WB1G 4AIMA 1A62A 3S16H 1Y1VH 2WP8J 4GS3A 3S15H 4DUZL 4YY3Q 1I3QH 1PA6A 2ZJQA 1BVSA 3PSIA 4YCWA 2UXBL 2UXDQ 1TWCH 4A3CH 3RNUA 3G71A 1JE5A 4A3FH 4A3DG 4DR2Q 1AE2A 1Q46A 4NB3A 4DV7Q 1T9HA 4POFA 1L0WA 5AJ3L 4AQYL 1AH9A 5LMUQ 5C44G 4DV1L 1PH9A 3M85A 4UPAA 2K50A 3PO3G 4O0AA 3L7ZC 4IPCA 3OTOQ 4A3IH 3WWVA 1B70B 2JA5H 3F2CA 4B3SQ 4XTCS 4K0KQ 1UE7A 4LW1A 5C3EG 3OW2A 4LUVA 2VZAA 2K4KA 4HIOA 3T1HQ 1S72A 2Q2UA 4B3TL 2ZTCA 2JE6I 3I4NH 1HJPA 3G6EA 4EX5A 4GLAC 1GM5A 1IBLQ 1IXRA 5EAYA 2R92H 1SR3A 3PF5A 1TXYA 4KLKA 2D0OA 3CW2C 5BR8Q 4X64L 3I4OA 3NENA 5HY6A 1X3FA 2CQOA 4ALPA 1VQLA 2UUAL 1XPRA 3HOUH 2YTYA 4DV0Q 4DV3L 2AHOB 1D8LA 1W3SA 4DKAC 2IX1A 4JI4L 3S2DH 4PZ7A 3UE0A 1EQQA 3A5UA 1C9OA 3GTOH 4LFCL 4AYBG 1L1OB 4NXNQ 4P75A 2R7FA 2OWOA 3ZJYC 3CXCA 2VUMH 1SLJA 4BBSH 4QIWE 1EWIA 1I94Q 2QEXA 1SRUA 3AYHB 2UUCQ 3S1RH 2F4VQ 4R1JA 1HZAA 1ASZA 2JA8H 3VDYA 4A3MH 2I5LX 4DR5L 2LXJA 1Q86C 4XIGS 1VQBA 2JA6G 4P73A 4X66Q 2NVXH 1Q81C 4DR2L 4DV7L 1UE5A 2OQKA 3CCUA 3CCLA 1W2BA 4BBRH 1YJNA 4GKKQ 1CSPA 3OTOL 1R9TH 3J7ZC 1JJCB 1IBML 1XPUA 2PQAB 3STBC 1FGUA 2VQEQ 3J80c 4JI0L 3UDGA 4LFBQ 1N36Q 1NY4A 2KBNA 4C3JH 3M4QA 4Y7NH 4LF5L 2VQFL 1ASYA 4PMWA 3K7AH 1BBWA 2K5VA 4JI5Q 2ID0A 1VQOA 3HOXG 2UXCL 5JJKA 1WYDA 2JQOA 1I6HH 5BR8L 1U0LA 4OX9Q 4DR3L 3CC4A 1X65A 3HOZG 2NN6I 3PV0A 3KDFB 1P8LA 2CWAA 2NZHA 3D31A 2NZOA 1K8GA 3CPFA 4GN3B 2ALYB 3U4ZA 2OQ0A 5IYBG 2WB1E 3H0GG 2ZM6L 4DUZQ 1MKHA 3J80i 1X3GA 1I5FA 3PUXA 4JI6L 3KOJA 4O2DA 1VQ8A 1M90C 2QA4A 1PH5A 1I94L 4JYAL 1C0AA 1CKMA 3W5OA 4MNOA 1NE3A 1Y14B 3A5ZB 1QZHA 3PUYA 4JI1L 4A3JG 2WAQG 4DR1L 3FKIH 2YTVA 4R4TA 4A93G 1GD7A 3UDXA 3JC66 4HIMA 1KXLA 4B3MQ 4C3HH 1U5KA 1X56A 4NPSA 4B3TQ 4X66L 4DR6L 2EIFA 2PI2A 4DR7L 4OWTB 1D7QA 1WOCA 3RLNA 5M5YH 1HZ9A 1HR0L 4JBKA 2IHFA 4X64Q 1E22A 1L1OA 3ER0A 1PH4A 5LMNQ 4A3KH 4LF7Q 2IX0A 4LFBL 4DV3Q 5FLMH 2I5MX 3ULJA 1EUJA 2HQLA 5IT9c 2YU9H 4A3GG 3I56A 2ZJRA 2BH8A 1FJGL 1OXUA 4LFCQ 1Q7YC 4JI5L 5GADC 1NMGA 4BXXG 3KF8B 1GVPA 4AYBE 4A3BH 1EOVA 1PVOA 4YWMA 4BA2I 2NVQH 5M3FH 3HOYG 4X6AH 1NMFA 2IT1A 1YZ6A 1Q8KA 5JJLA 1EFWA 2B63G 1WCMG 4JG2A 1I50H 4HJ5A 5C4XH 4DR5Q 3PGZA 1EIYB 1N8RC 4BY7H 2K52A 3FP9A 1PHJA 5C0XJ 4JI2L 1N33Q 2R93G 3M9BA 3A0JA 3M4PA 3TQYA 4JBMA 2PQAA 4BY1H 2VY3A 3CC2A 1KHIA 5GAGC 1QZGA 2D62A 2VS1A 1YVCA 4JI3L 1HNWL 4LFAL 1Y1VG 2MQHA 1UE6A 5JEAJ 1E1OA 1HR0W 4C3IH 1XJVA 2OTLA 2E8GA 1G6PA 1E3PA 1IBMQ 4POGA 4JOIC 3HOWG 4JI0Q 2Q2IA 4JI8L 5JEAG 4DV4L 1CSQA 4Y52H 4YCUA 2IHEA 2Z6KA 3NELA 3PO2H 3KDFA 3SGIA 1RL2A 2VQFQ 4A3FG 2ZTEA 4LF5Q 4OO1G 1VQKA 1KC8C 3GTGH 1SROA 1C7YA 4QQBX 3CAMA 3M4OH 2UXCQ 3ULPA 1YNXA 1HZCA 1XNRL 2KCMA 1AE3A 2MFIA 5FJ8H 4DK3C 1A0IA 4DR3Q 4A3IG 5LMNL 2JA5G 3GD7A 3GTPH 4L5RC 3GTMH 4IFDJ 1YI2A 4H02A 2MNAA 4DV5L 1VQ9A 3I4NG 3PUZA 3GO5A 2ZJPA 2F52A 2VW9A 3AEVA 4WJ3M 1X6OA 1YEZA 2ZM6Q 4IPGA 4BA1I 2R92G 1X3EA 3HOVG 4JI6Q 3HFZB 3CCQA 1YJ9A 4DR4L 3H3VI 3U58A 1PH3A 4DK6C 1VCIA 3AFQA 1XMOL 4JYAQ 3RR5A 4A3LH 3F1ZA 1M1KC 4DPGA 3KJPA 2CCZA 3CMEA 4J15A 4IOAA 2Q2TA 1PH2A 4JI1Q 3ULLA 1LYLA 2JEAI 4DR1Q 1J5EL 2XTIA 4IJLA 3OYYA 3EIVA 2K5HA 4HJ8A 4DV6Q 1B8AA 2WAQE 1HNXL 1N33L 3M7NA 2VUMG 1XNQL 4BBSG 4DR6Q 5IE8A 4DR7Q 1VQGA 4OWXB 2RCNA 4GLXA 1B7YB 4QGUA 1JJ2A 4GN4B 2B29A 1PH1A 2JA8G 4PG3A 5J3BA 1GKHA 4A3MG 1HR0Q 5GQOA 3K8AA 5DLQE 1LUZA 2ASBA 3HKZG 2N3SA 4X65L 5LMNW 5M5WH 5JJIA 4B3RL 5IYDH 1VQDA 3KF6B 3PF4A 1FJGQ 3I55A 1A8VA 4QY7A 2N8NA 2A19A 1G291 4L5SA 1IBKL 1WJJA 3FHWA 2RHQB 2DUDA 1GO3E 3A74A 3KJOA 3I4MG 1LTLA 1X54A 3DM3A 3J7A5 4OWWB 2QGQA 1HNZL 4UP9A 5M3MH 4APVA 1VQEA 1Y1WG 2C35B 2AWOA 2RF4A 3D0FA 1XTDA 3F2DA 3RN5A 3ICEA 2A1AA 3PIPA 4MTNA 1CKOA 1FVIA 1QVFA 2PMZE 2K5NA 5C4JH 4JI2Q 1OTCA 1Q1BA 3T1YQ 3L2PA 1IL2A 5IY0A 4LUOA 4QJFA 3H0GH 1N34L 3CCSA 1VQHA 3PUWA 4P74A 3S1QH 4HIKA 3UE1A 1UWVA 2B3GA 4JI3Q 2LSSA 1HNWQ 4LFAQ 4UY8C 1QUQB 4MZ9A 1CKNB 2KENA 1KRTA 2K14A 2ES2A 1V43A 4DV6L 2LXKA 2Z0SA 3RZDH 3CP0A 4JI8Q 4DV4Q 2AMCB 3E9IA 5IP9H 2E5LL 1HZBA 3S2HH 3J81i 4A3JH 4UP8A 1JJGA 1BBUA 1YBYA 5HGQA 2JA9A 2OTJA 3AFPA 1XNRQ 1K83H 1VQ6A 2A8VA 2CFMA 1KIXA 1O7IA 3FKIG 4A75A 1EYGA 2KHIA 1OXVA 3TEHB 3KYHC 1UE1A 2NVTH 3B6YA 4LF6L 1OXXK 5ELOA 4DV5Q 4LWCA 3K7UC 4NXML 3RLFA 4GOPC 2H5XA 4LF4L 2E2HH 4IPHA 5IYCH 1VQMA 1J6QA 2JA7G 4DR4Q 1V9PA 2ATWA 4A3EH 4A3GH 3I7FA 3CCMA 4A3KG 4KHZA 1S40A 1XMOQ 3S1NH 3Q8DA 2UU9L 2UUBL 1TWAH 3U50C 2YTXA 2CWPA 1OXTA 3GTQH 4L5TA 4BXXH 2NVYH 2IY5B 5IP7H 4LF9L 1J5EQ 2R7ZH 3JAMc 1IZ6A 4QL5A 4GKJL 4OO1I 1TWHH 1HNXQ 3T1YL 4A3BG 1PH8A 1XNQQ 2B63H 1WCMH 4JI7L 5M3FG 1XMQL 5C0XG 1MIUA 5GROA 3BU2A 1YHBA 2BH2A 1VQFA 1VQ4A 3G48A 3J81j 3KF6A 1MJCA 3K81C 2F3IA 3TS0A 1YIJA 4X65Q 4A3DH 4LNQA 3HKSA 4BY7G 4HJ7A 5GAEC 4JCVE 1KQSA 4GLVB 1G51A 4B3RQ 3HKZE 3UDFA 3UDIA 2Y0SG 4R4QA 5C44H 3PO3H 4A3CG 3CCEA 2PI2E 4BY1G 4A4IA 1EQRA 4HJAA 2BA0A 2KCTA 1X55A 2DGYA 4KI0A 3PCOB 3JAMi 3IRBA 3PUVA 3HOWH 1K9MC 5E7NA 5C3EH 3F2BA 2K75A 4HJ9A 1IBKQ 3GTKH 1A63A 3STBD 1NTGA 4JV5L 1QVGA 2JJQA 1Z9FA 4YWLA 1K3RA 4TVAB 1E7ZA 1SFOH 3KLWA 2L15A 2HHHQ 1HNZQ 1H95A 1VQIA 1WFQA 3CC7A 1MJEA 4LF8L 2HT1A 2BA1A 4A76A 4IFDG 3E0EA 3PO2G 2ZTDA 1K0RA 2V1CC 1VQPA 1N32Q 3E9HA 3BZCA 4DV2L 1Q82C 4IOCA 3S14H 4L5QA 2D0PA 1QUQA 4PZ8A 1YJWA 1CKNA 4DAMA 5FJ8G 2R7DA 4X62L 3BJUA 4UP7A 3RZOH 1VQNA 3HOUG 1N34Q 1LM0A 3H15A 4JOIA 3S1MH 3HOVH 4YHHL 3RLOA 3K0XA 3CCJA 1P16A 1KL9A 3GTJH 4OXPA 1SE8A 1PH7A 1WI5A 2E5LQ 4GNXB 1Z47A 3F8TA 3EN2A 5IWAQ 3RN2A 4A3LG 1NJIC 4R4OA 1TWGH 2JA6H 3S17H 4PZ6A 3ERSX 4HIDA 4P72A 1KRSA 4DUYL 3TRZA 4AH6A 3EBEA 4LF6Q 4KHPQ 3CD6A 1KAWA 3H3VH 3K80C 4NXMQ 2FXQA 3W1GA 2EQSA 3TS2A 3CPWA 4LF4Q 4YY3L 1VQJA 3PIOA 1QVCA 3S24A 4BBRG 3M3YH 2GN5A 4GOPB 4LUZA 2UXDL 1IYJB 1V1QA 5M5XH 2HHHL 1YHQA 1PV4A 4WJ4A 1PYSB 1UEBA 1PH6A 4B3ML 2UU9Q 2UUBQ 4YCVA 1PYBA 3HOXH 2AWNA 4JBJA 5IYDG 5LMUL 1JB7A 4DNIA 1VQCA 2YV5A 4DAYB 3DLLA 2HIVA 3HOZH 3J81c 4LF9Q 3MEFA 2MO0A 4B3SL 3I4MH 1N32L 1SMXA 1YHAA 4K0KL 2PNHA 4C2MH 4RMFA 3W1BA 4GKJQ 2VL6A 4LF7L 3T1HL 1JT8A 1Y1WH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI7 Q;  3NEM A;  2GVB A;  1IBL L;  5IYB H;  1XMQ Q;  2E2J H;  1X9N A;  5M3M G;  3L0O A;  2MO1 A;  3MXN B;  1NBW A;  1K8A C;  3CF5 A;  2KHJ A;  3NBH B;  1SN8 A;  3U4V A;  1Q1E A;  2I0Q A;  2HIX A;  5K36 G;  4FDB A;  4DV0 L;  4TQU S;  1PFS A;  5FLX c;  4GNX C;  4IO9 A;  1EIF A;  2R6G A;  1JMC A;  1BKB A;  1VQ5 A;  4EQ5 A;  1L1O C;  2EXD A;  2WFW A;  4JC0 A;  1DGS A;  5IWA L;  4A93 H;  1E1T A;  3CQZ H;  4NXN L;  3TRE A;  2Y0S E;  3CCV A;  4JBW A;  3KFU A;  2OCE A;  5ELN A;  2UXB Q;  2Q2H A;  4IJH A;  4JV5 Q;  4P71 A;  1VQA A;  2I5H A;  2UUC L;  4KHP L;  2CKZ B;  4AQY Q;  4LF8 Q;  2F4V L;  2YYZ A;  5AJ3 Q;  2NN6 G;  5IP9 G;  1YIT A;  4DV1 Q;  4ME3 A;  3G4S A;  1Q12 A;  1RIP A;  5GAH C;  2VNU D;  4DV2 Q;  2E2I H;  2AKW B;  5C0X I;  1FL0 A;  1L2F A;  3AQQ A;  4X62 Q;  2JEB I;  1CUK A;  5H1S E;  3BZK A;  3CMA A;  4RG1 A;  4OON A;  1S3O A;  4GN5 A;  1N9W A;  4YWK A;  5FLM G;  4GKK L;  2N49 A;  4R4C A;  2N78 A;  3LGJ A;  4YHH Q;  4GNX A;  2JA7 H;  3I2Z A;  2UUA Q;  3GTL H;  3HOY H;  2VQE L;  3GDE A;  1OXS C;  1K73 C;  5IYC G;  1N36 L;  4JI4 Q;  4R4I A;  4A3E G;  3CCR A;  2GVA A;  2RHS B;  1E24 A;  1TWF H;  2Z6K C;  1XPO A;  1KD1 C;  4IPD A;  2R93 H;  1HH2 P;  2JK8 A;  4OX9 L;  5IP7 G;  1VS0 A;  2XGT A;  5C4X G;  2R7Z G;  4DUY Q;  1VQ7 A;  4IFD I;  4GOP A;  2WB1 G;  4AIM A;  1A62 A;  3S16 H;  1Y1V H;  2WP8 J;  4GS3 A;  3S15 H;  4DUZ L;  4YY3 Q;  1I3Q H;  1PA6 A;  2ZJQ A;  1BVS A;  3PSI A;  4YCW A;  2UXB L;  2UXD Q;  1TWC H;  4A3C H;  3RNU A;  3G71 A;  1JE5 A;  4A3F H;  4A3D G;  4DR2 Q;  1AE2 A;  1Q46 A;  4NB3 A;  4DV7 Q;  1T9H A;  4POF A;  1L0W A;  5AJ3 L;  4AQY L;  1AH9 A;  5LMU Q;  5C44 G;  4DV1 L;  1PH9 A;  3M85 A;  4UPA A;  2K50 A;  3PO3 G;  4O0A A;  3L7Z C;  4IPC A;  3OTO Q;  4A3I H;  3WWV A;  1B70 B;  2JA5 H;  3F2C A;  4B3S Q;  4XTC S;  4K0K Q;  1UE7 A;  4LW1 A;  5C3E G;  3OW2 A;  4LUV A;  2VZA A;  2K4K A;  4HIO A;  3T1H Q;  1S72 A;  2Q2U A;  4B3T L;  2ZTC A;  2JE6 I;  3I4N H;  1HJP A;  3G6E A;  4EX5 A;  4GLA C;  1GM5 A;  1IBL Q;  1IXR A;  5EAY A;  2R92 H;  1SR3 A;  3PF5 A;  1TXY A;  4KLK A;  2D0O A;  3CW2 C;  5BR8 Q;  4X64 L;  3I4O A;  3NEN A;  5HY6 A;  1X3F A;  2CQO A;  4ALP A;  1VQL A;  2UUA L;  1XPR A;  3HOU H;  2YTY A;  4DV0 Q;  4DV3 L;  2AHO B;  1D8L A;  1W3S A;  4DKA C;  2IX1 A;  4JI4 L;  3S2D H;  4PZ7 A;  3UE0 A;  1EQQ A;  3A5U A;  1C9O A;  3GTO H;  4LFC L;  4AYB G;  1L1O B;  4NXN Q;  4P75 A;  2R7F A;  2OWO A;  3ZJY C;  3CXC A;  2VUM H;  1SLJ A;  4BBS H;  4QIW E;  1EWI A;  1I94 Q;  2QEX A;  1SRU A;  3AYH B;  2UUC Q;  3S1R H;  2F4V Q;  4R1J A;  1HZA A;  1ASZ A;  2JA8 H;  3VDY A;  4A3M H;  2I5L X;  4DR5 L;  2LXJ A;  1Q86 C;  4XIG S;  1VQB A;  2JA6 G;  4P73 A;  4X66 Q;  2NVX H;  1Q81 C;  4DR2 L;  4DV7 L;  1UE5 A;  2OQK A;  3CCU A;  3CCL A;  1W2B A;  4BBR H;  1YJN A;  4GKK Q;  1CSP A;  3OTO L;  1R9T H;  3J7Z C;  1JJC B;  1IBM L;  1XPU A;  2PQA B;  3STB C;  1FGU A;  2VQE Q;  3J80 c;  4JI0 L;  3UDG A;  4LFB Q;  1N36 Q;  1NY4 A;  2KBN A;  4C3J H;  3M4Q A;  4Y7N H;  4LF5 L;  2VQF L;  1ASY A;  4PMW A;  3K7A H;  1BBW A;  2K5V A;  4JI5 Q;  2ID0 A;  1VQO A;  3HOX G;  2UXC L;  5JJK A;  1WYD A;  2JQO A;  1I6H H;  5BR8 L;  1U0L A;  4OX9 Q;  4DR3 L;  3CC4 A;  1X65 A;  3HOZ G;  2NN6 I;  3PV0 A;  3KDF B;  1P8L A;  2CWA A;  2NZH A;  3D31 A;  2NZO A;  1K8G A;  3CPF A;  4GN3 B;  2ALY B;  3U4Z A;  2OQ0 A;  5IYB G;  2WB1 E;  3H0G G;  2ZM6 L;  4DUZ Q;  1MKH A;  3J80 i;  1X3G A;  1I5F A;  3PUX A;  4JI6 L;  3KOJ A;  4O2D A;  1VQ8 A;  1M90 C;  2QA4 A;  1PH5 A;  1I94 L;  4JYA L;  1C0A A;  1CKM A;  3W5O A;  4MNO A;  1NE3 A;  1Y14 B;  3A5Z B;  1QZH A;  3PUY A;  4JI1 L;  4A3J G;  2WAQ G;  4DR1 L;  3FKI H;  2YTV A;  4R4T A;  4A93 G;  1GD7 A;  3UDX A;  3JC6 6;  4HIM A;  1KXL A;  4B3M Q;  4C3H H;  1U5K A;  1X56 A;  4NPS A;  4B3T Q;  4X66 L;  4DR6 L;  2EIF A;  2PI2 A;  4DR7 L;  4OWT B;  1D7Q A;  1WOC A;  3RLN A;  5M5Y H;  1HZ9 A;  1HR0 L;  4JBK A;  2IHF A;  4X64 Q;  1E22 A;  1L1O A;  3ER0 A;  1PH4 A;  5LMN Q;  4A3K H;  4LF7 Q;  2IX0 A;  4LFB L;  4DV3 Q;  5FLM H;  2I5M X;  3ULJ A;  1EUJ A;  2HQL A;  5IT9 c;  2YU9 H;  4A3G G;  3I56 A;  2ZJR A;  2BH8 A;  1FJG L;  1OXU A;  4LFC Q;  1Q7Y C;  4JI5 L;  5GAD C;  1NMG A;  4BXX G;  3KF8 B;  1GVP A;  4AYB E;  4A3B H;  1EOV A;  1PVO A;  4YWM A;  4BA2 I;  2NVQ H;  5M3F H;  3HOY G;  4X6A H;  1NMF A;  2IT1 A;  1YZ6 A;  1Q8K A;  5JJL A;  1EFW A;  2B63 G;  1WCM G;  4JG2 A;  1I50 H;  4HJ5 A;  5C4X H;  4DR5 Q;  3PGZ A;  1EIY B;  1N8R C;  4BY7 H;  2K52 A;  3FP9 A;  1PHJ A;  5C0X J;  4JI2 L;  1N33 Q;  2R93 G;  3M9B A;  3A0J A;  3M4P A;  3TQY A;  4JBM A;  2PQA A;  4BY1 H;  2VY3 A;  3CC2 A;  1KHI A;  5GAG C;  1QZG A;  2D62 A;  2VS1 A;  1YVC A;  4JI3 L;  1HNW L;  4LFA L;  1Y1V G;  2MQH A;  1UE6 A;  5JEA J;  1E1O A;  1HR0 W;  4C3I H;  1XJV A;  2OTL A;  2E8G A;  1G6P A;  1E3P A;  1IBM Q;  4POG A;  4JOI C;  3HOW G;  4JI0 Q;  2Q2I A;  4JI8 L;  5JEA G;  4DV4 L;  1CSQ A;  4Y52 H;  4YCU A;  2IHE A;  2Z6K A;  3NEL A;  3PO2 H;  3KDF A;  3SGI A;  1RL2 A;  2VQF Q;  4A3F G;  2ZTE A;  4LF5 Q;  4OO1 G;  1VQK A;  1KC8 C;  3GTG H;  1SRO A;  1C7Y A;  4QQB X;  3CAM A;  3M4O H;  2UXC Q;  3ULP A;  1YNX A;  1HZC A;  1XNR L;  2KCM A;  1AE3 A;  2MFI A;  5FJ8 H;  4DK3 C;  1A0I A;  4DR3 Q;  4A3I G;  5LMN L;  2JA5 G;  3GD7 A;  3GTP H;  4L5R C;  3GTM H;  4IFD J;  1YI2 A;  4H02 A;  2MNA A;  4DV5 L;  1VQ9 A;  3I4N G;  3PUZ A;  3GO5 A;  2ZJP A;  2F52 A;  2VW9 A;  3AEV A;  4WJ3 M;  1X6O A;  1YEZ A;  2ZM6 Q;  4IPG A;  4BA1 I;  2R92 G;  1X3E A;  3HOV G;  4JI6 Q;  3HFZ B;  3CCQ A;  1YJ9 A;  4DR4 L;  3H3V I;  3U58 A;  1PH3 A;  4DK6 C;  1VCI A;  3AFQ A;  1XMO L;  4JYA Q;  3RR5 A;  4A3L H;  3F1Z A;  1M1K C;  4DPG A;  3KJP A;  2CCZ A;  3CME A;  4J15 A;  4IOA A;  2Q2T A;  1PH2 A;  4JI1 Q;  3ULL A;  1LYL A;  2JEA I;  4DR1 Q;  1J5E L;  2XTI A;  4IJL A;  3OYY A;  3EIV A;  2K5H A;  4HJ8 A;  4DV6 Q;  1B8A A;  2WAQ E;  1HNX L;  1N33 L;  3M7N A;  2VUM G;  1XNQ L;  4BBS G;  4DR6 Q;  5IE8 A;  4DR7 Q;  1VQG A;  4OWX B;  2RCN A;  4GLX A;  1B7Y B;  4QGU A;  1JJ2 A;  4GN4 B;  2B29 A;  1PH1 A;  2JA8 G;  4PG3 A;  5J3B A;  1GKH A;  4A3M G;  1HR0 Q;  5GQO A;  3K8A A;  5DLQ E;  1LUZ A;  2ASB A;  3HKZ G;  2N3S A;  4X65 L;  5LMN W;  5M5W H;  5JJI A;  4B3R L;  5IYD H;  1VQD A;  3KF6 B;  3PF4 A;  1FJG Q;  3I55 A;  1A8V A;  4QY7 A;  2N8N A;  2A19 A;  1G29 1;  4L5S A;  1IBK L;  1WJJ A;  3FHW A;  2RHQ B;  2DUD A;  1GO3 E;  3A74 A;  3KJO A;  3I4M G;  1LTL A;  1X54 A;  3DM3 A;  3J7A 5;  4OWW B;  2QGQ A;  1HNZ L;  4UP9 A;  5M3M H;  4APV A;  1VQE A;  1Y1W G;  2C35 B;  2AWO A;  2RF4 A;  3D0F A;  1XTD A;  3F2D A;  3RN5 A;  3ICE A;  2A1A A;  3PIP A;  4MTN A;  1CKO A;  1FVI A;  1QVF A;  2PMZ E;  2K5N A;  5C4J H;  4JI2 Q;  1OTC A;  1Q1B A;  3T1Y Q;  3L2P A;  1IL2 A;  5IY0 A;  4LUO A;  4QJF A;  3H0G H;  1N34 L;  3CCS A;  1VQH A;  3PUW A;  4P74 A;  3S1Q H;  4HIK A;  3UE1 A;  1UWV A;  2B3G A;  4JI3 Q;  2LSS A;  1HNW Q;  4LFA Q;  4UY8 C;  1QUQ B;  4MZ9 A;  1CKN B;  2KEN A;  1KRT A;  2K14 A;  2ES2 A;  1V43 A;  4DV6 L;  2LXK A;  2Z0S A;  3RZD H;  3CP0 A;  4JI8 Q;  4DV4 Q;  2AMC B;  3E9I A;  5IP9 H;  2E5L L;  1HZB A;  3S2H H;  3J81 i;  4A3J H;  4UP8 A;  1JJG A;  1BBU A;  1YBY A;  5HGQ A;  2JA9 A;  2OTJ A;  3AFP A;  1XNR Q;  1K83 H;  1VQ6 A;  2A8V A;  2CFM A;  1KIX A;  1O7I A;  3FKI G;  4A75 A;  1EYG A;  2KHI A;  1OXV A;  3TEH B;  3KYH C;  1UE1 A;  2NVT H;  3B6Y A;  4LF6 L;  1OXX K;  5ELO A;  4DV5 Q;  4LWC A;  3K7U C;  4NXM L;  3RLF A;  4GOP C;  2H5X A;  4LF4 L;  2E2H H;  4IPH A;  5IYC H;  1VQM A;  1J6Q A;  2JA7 G;  4DR4 Q;  1V9P A;  2ATW A;  4A3E H;  4A3G H;  3I7F A;  3CCM A;  4A3K G;  4KHZ A;  1S40 A;  1XMO Q;  3S1N H;  3Q8D A;  2UU9 L;  2UUB L;  1TWA H;  3U50 C;  2YTX A;  2CWP A;  1OXT A;  3GTQ H;  4L5T A;  4BXX H;  2NVY H;  2IY5 B;  5IP7 H;  4LF9 L;  1J5E Q;  2R7Z H;  3JAM c;  1IZ6 A;  4QL5 A;  4GKJ L;  4OO1 I;  1TWH H;  1HNX Q;  3T1Y L;  4A3B G;  1PH8 A;  1XNQ Q;  2B63 H;  1WCM H;  4JI7 L;  5M3F G;  1XMQ L;  5C0X G;  1MIU A;  5GRO A;  3BU2 A;  1YHB A;  2BH2 A;  1VQF A;  1VQ4 A;  3G48 A;  3J81 j;  3KF6 A;  1MJC A;  3K81 C;  2F3I A;  3TS0 A;  1YIJ A;  4X65 Q;  4A3D H;  4LNQ A;  3HKS A;  4BY7 G;  4HJ7 A;  5GAE C;  4JCV E;  1KQS A;  4GLV B;  1G51 A;  4B3R Q;  3HKZ E;  3UDF A;  3UDI A;  2Y0S G;  4R4Q A;  5C44 H;  3PO3 H;  4A3C G;  3CCE A;  2PI2 E;  4BY1 G;  4A4I A;  1EQR A;  4HJA A;  2BA0 A;  2KCT A;  1X55 A;  2DGY A;  4KI0 A;  3PCO B;  3JAM i;  3IRB A;  3PUV A;  3HOW H;  1K9M C;  5E7N A;  5C3E H;  3F2B A;  2K75 A;  4HJ9 A;  1IBK Q;  3GTK H;  1A63 A;  3STB D;  1NTG A;  4JV5 L;  1QVG A;  2JJQ A;  1Z9F A;  4YWL A;  1K3R A;  4TVA B;  1E7Z A;  1SFO H;  3KLW A;  2L15 A;  2HHH Q;  1HNZ Q;  1H95 A;  1VQI A;  1WFQ A;  3CC7 A;  1MJE A;  4LF8 L;  2HT1 A;  2BA1 A;  4A76 A;  4IFD G;  3E0E A;  3PO2 G;  2ZTD A;  1K0R A;  2V1C C;  1VQP A;  1N32 Q;  3E9H A;  3BZC A;  4DV2 L;  1Q82 C;  4IOC A;  3S14 H;  4L5Q A;  2D0P A;  1QUQ A;  4PZ8 A;  1YJW A;  1CKN A;  4DAM A;  5FJ8 G;  2R7D A;  4X62 L;  3BJU A;  4UP7 A;  3RZO H;  1VQN A;  3HOU G;  1N34 Q;  1LM0 A;  3H15 A;  4JOI A;  3S1M H;  3HOV H;  4YHH L;  3RLO A;  3K0X A;  3CCJ A;  1P16 A;  1KL9 A;  3GTJ H;  4OXP A;  1SE8 A;  1PH7 A;  1WI5 A;  2E5L Q;  4GNX B;  1Z47 A;  3F8T A;  3EN2 A;  5IWA Q;  3RN2 A;  4A3L G;  1NJI C;  4R4O A;  1TWG H;  2JA6 H;  3S17 H;  4PZ6 A;  3ERS X;  4HID A;  4P72 A;  1KRS A;  4DUY L;  3TRZ A;  4AH6 A;  3EBE A;  4LF6 Q;  4KHP Q;  3CD6 A;  1KAW A;  3H3V H;  3K80 C;  4NXM Q;  2FXQ A;  3W1G A;  2EQS A;  3TS2 A;  3CPW A;  4LF4 Q;  4YY3 L;  1VQJ A;  3PIO A;  1QVC A;  3S24 A;  4BBR G;  3M3Y H;  2GN5 A;  4GOP B;  4LUZ A;  2UXD L;  1IYJ B;  1V1Q A;  5M5X H;  2HHH L;  1YHQ A;  1PV4 A;  4WJ4 A;  1PYS B;  1UEB A;  1PH6 A;  4B3M L;  2UU9 Q;  2UUB Q;  4YCV A;  1PYB A;  3HOX H;  2AWN A;  4JBJ A;  5IYD G;  5LMU L;  1JB7 A;  4DNI A;  1VQC A;  2YV5 A;  4DAY B;  3DLL A;  2HIV A;  3HOZ H;  3J81 c;  4LF9 Q;  3MEF A;  2MO0 A;  4B3S L;  3I4M H;  1N32 L;  1SMX A;  1YHA A;  4K0K L;  2PNH A;  4C2M H;  4RMF A;  3W1B A;  4GKJ Q;  2VL6 A;  4LF7 L;  3T1H L;  1JT8 A;  1Y1W H; 
#chains in the Genus database with same CATH topology
 4JI7 Q;  2GVB A;  3ORQ A;  1XMQ Q;  1I4P A;  2E2J H;  1V1O A;  5IIF A;  2EYJ A;  3R2T A;  1E4G T;  5BN4 A;  3L0O A;  1BXR A;  5D14 A;  2XC9 A;  2WKC A;  4RKB A;  4E4T A;  2E2I B;  2W7O A;  4FDB A;  1PFS A;  1FJG H;  3DWQ A;  4KD3 A;  3QZ7 A;  1O75 A;  1BKB A;  3BVZ A;  1F77 A;  5I4D A;  4DFA A;  4NXN L;  2B8F A;  4IHJ F;  2OCE A;  5KFM A;  5ELN A;  2Q2H A;  3HOY B;  2K1B A;  4P71 A;  1PZK D;  3UI2 A;  1VQA A;  2I80 A;  4AQY Q;  2YYZ A;  2YU9 B;  1WSC A;  1LTG D;  3PR5 B;  1MD2 D;  2J6S A;  1EZ6 A;  3G4S A;  3GIL A;  5CV8 A;  1H9J A;  2R8J A;  2VNU D;  4O3R A;  5DLF A;  2R3Z A;  1PX2 A;  1EY7 A;  5C0X I;  1FL0 A;  1L2F A;  3OSN A;  2JEB I;  3BZK A;  4OON A;  1S3O A;  1N9W A;  1Y1V B;  2W57 A;  5LYJ F;  4YHH Q;  2N78 A;  3LGJ A;  2KCC A;  5KYL A;  2F0N A;  1A2T A;  4GNX A;  4LK1 C;  1WVL A;  2JA7 H;  3OUZ A;  4Q8F A;  1IOW A;  1JOO A;  2C22 A;  1XTC D;  1CS0 A;  3JRX A;  3DWP A;  5JH7 F;  2ZDQ A;  3MC0 B;  1PYW D;  3LX0 A;  3PIO 3;  3KLS A;  1TWC B;  5IYC G;  4A3E G;  2FK2 A;  2N55 A;  1E4F T;  4ZRZ A;  2WE6 A;  1EQT A;  2EYP A;  2Z6K C;  4JV5 H;  4OHJ A;  5A35 A;  1PDQ A;  4IZ8 A;  2XGT A;  1SJH D;  2V58 A;  4DUY Q;  1VQ7 A;  4KY5 A;  4IFD I;  3TII A;  4GOP A;  2WP8 J;  1IOV A;  4ECT A;  4DR4 H;  3MWD A;  2Z9H A;  4KJO A;  2ZJQ A;  5JEA H;  3A55 A;  1XMO H;  4DAY A;  3QO2 A;  2UXB L;  2UXD Q;  1W96 A;  3TQ1 A;  1SSO A;  4HNV A;  4A3C H;  4IUQ A;  3OPO A;  4A3F H;  4DL3 A;  2J4X A;  4RHS A;  3N43 B;  1Q46 A;  4NB3 A;  4ED1 A;  5DNF A;  4Z9C B;  1AH9 A;  5C44 G;  3PO3 G;  4IPC A;  5ISR A;  4A3I H;  2K32 A;  4WJW A;  3WWV A;  2JA5 H;  4B3S Q;  3KTM A;  1XNQ H;  3RBE A;  5J2U F;  3MXN A;  1UE7 A;  5C3E G;  4B3M L;  2BE5 D;  3S2H H;  2XWB B;  4OEM B;  5DM6 3;  4XZ3 B;  3G6E A;  2F0I A;  3S1R B;  1GM5 A;  3R2I A;  5EAY A;  3VA5 A;  2W9B A;  3PF5 A;  1HCZ A;  2D0O A;  2W6P A;  1EY8 A;  3I4O A;  2UUA L;  3L3O C;  1X3F A;  4ALP A;  4RUC A;  2B2W A;  1XPR A;  3HOU H;  2IX1 A;  4DV3 L;  5D1O A;  5EKI A;  2AQ3 B;  1IBK H;  4LFC L;  4AYB G;  1L1O B;  4K6L A;  4NXN Q;  4P75 A;  1V51 A;  2PMZ A;  2DJF C;  4RUA A;  3P75 A;  1J8I A;  1W6J A;  1Q8I A;  4BBS H;  2YYA A;  4ZLT F;  4EBE A;  2F0T A;  5FO9 B;  2JA8 H;  3VDY A;  2ICE C;  2PZU A;  2SNS A;  4IAL A;  2IPK D;  4IAJ A;  2XVS A;  4RAY A;  3ND9 A;  1Q86 C;  2ASD A;  4MV6 A;  4ECS A;  2FPP B;  3RF2 A;  4X66 Q;  1Q3L A;  4UCR A;  1Q81 C;  3FVQ A;  2OF1 A;  1GSH A;  3CCU A;  1AP0 A;  2Y0S A;  1SDF A;  1VF5 C;  4ED6 A;  1KDB A;  4BBR H;  1YJN A;  1I4G A;  1XPU A;  3J80 c;  3PW0 A;  1S03 G;  1S9F A;  3D8G A;  1Q90 A;  5C8Y F;  4LF5 L;  5ELD A;  1SE3 A;  4QIW B;  5K2M A;  2UXC L;  2JQO A;  3N42 B;  3LNN A;  4C1N I;  5C4Z A;  1I6H H;  4Q5V A;  4LF6 H;  4KHP H;  2Z4H A;  2R92 A;  2NN6 I;  2DY8 A;  2A69 C;  4C3H B;  2CWA A;  3SK8 A;  4ECY A;  3MXG A;  1DJR D;  3TDQ A;  1UAP A;  3U4Z A;  2XIG A;  4CKC A;  5FPO A;  5A2Q L;  3BS1 A;  4APM A;  3KOJ A;  3GTO A;  4RB2 C;  4O2D A;  2UUB H;  2EDG A;  2K7V A;  1PH5 A;  1I94 L;  4JYA L;  2VUM A;  1TS3 A;  5KND A;  4NW2 A;  1CKM A;  2CH4 A;  4LF9 H;  3KLR A;  1NE3 A;  4KY7 A;  3A5Z B;  4ZUI A;  5CA0 F;  4JI1 L;  4A3J G;  4GKJ H;  1I4R A;  3VR2 A;  3K5I A;  4R4T A;  4A93 G;  4BS9 A;  1B04 A;  4JI7 H;  4FO2 A;  4A3B B;  1MSG A;  4HIM A;  4B3M Q;  1XMQ H;  3V05 A;  4CJ2 C;  4CGY B;  1B3Q A;  4DNR B;  1BF4 A;  3EA6 A;  4DR7 L;  4OWT B;  1WOC A;  5KT5 A;  4IUV A;  2NVX A;  1TII D;  4EG0 A;  1W6K A;  1B9M A;  3L4K A;  2IHF A;  4L63 B;  5KNB A;  5E3F A;  2WB1 B;  2IX0 A;  2KA7 A;  5FLM H;  4DV3 Q;  2E74 C;  3P1H A;  1M7J A;  1EUJ A;  2HQL A;  3I56 A;  3RJ0 A;  1OXU A;  4LFC Q;  1STN A;  4AQY H;  3NPP A;  3NUC A;  1NMF A;  1STY A;  1FYC A;  2A74 C;  1IKL A;  1IW7 D;  2IT1 A;  3BZD B;  4KKU A;  4HYK A;  2PPB C;  5JJL A;  1EFW A;  1LTS D;  4K5V A;  3PO2 B;  4JG2 A;  4HJ5 A;  3U9S A;  5C4X H;  1EIY B;  3PGZ A;  1GUG A;  1D5M C;  3M4O B;  4BY7 H;  2K52 A;  3FP9 A;  1AUV A;  4ED7 A;  3V6J A;  2A6E C;  5C0X J;  2C2R A;  1PXU A;  3GTP B;  2CVR A;  3GTM B;  5ELE A;  4JBM A;  3OSP A;  2SDF A;  1A3U A;  2CW7 A;  5GAG C;  5C1P A;  1QG7 A;  4CDF C;  1HNW L;  2OTL A;  1HUN A;  2RDF A;  2QIL A;  4JOI C;  3CRL C;  1SYE A;  2L5T A;  3HOW G;  2Q2I A;  4JI8 L;  3FKI A;  2Z8L A;  4NP5 A;  4YCU A;  2IHE A;  3RAQ A;  1BUV T;  2ENB A;  1LTI D;  3SGI A;  4LF5 Q;  2ZTE A;  1KJI A;  1KC8 C;  3GTG H;  1CA5 A;  3JZI A;  4M9U A;  4TV8 F;  5KFN A;  2UXC Q;  4DUY H;  1HZC A;  2KCM A;  4DGZ A;  4ZKC B;  5FJ8 H;  4M7E A;  3H4D A;  4IFD J;  4L5R C;  1YI2 A;  4QWD A;  2O2L D;  4H02 A;  3I4N G;  1LO5 D;  4DAV A;  3A8I E;  4KK7 A;  2VW9 A;  4WJ3 M;  1YEZ A;  1O7L A;  2UXD H;  2R92 G;  1C30 A;  5KFJ A;  4YR0 A;  2B2U A;  5KFC A;  1YJ9 A;  1G2T A;  4OIK A;  4MA0 A;  3KHG A;  4JYA Q;  1VCI A;  5EDW A;  1TT2 A;  1M1K C;  2LFN A;  3CME A;  1X32 A;  5KFO A;  1S4Z A;  3EPG A;  1PZJ D;  4ZI7 F;  1U4P A;  5E4X A;  4JI1 Q;  2PZW A;  2JEA I;  2XTI A;  4IJL A;  4WFN 3;  1CHQ D;  1CQF A;  3EIV A;  5D3I B;  4R8I A;  4DV6 Q;  1S5C D;  4QB4 A;  3M7N A;  2VUM G;  1PRT F;  4FBU A;  2ASL A;  1DOL A;  2VPQ A;  5M3M B;  4DR7 Q;  1VQG A;  2RCN A;  4GLX A;  1JJ2 A;  4GN4 B;  2IL8 A;  1LV9 A;  2EJM A;  4DN4 M;  1GKH A;  4A3M G;  3GTP A;  5GQO A;  5DLQ E;  1RF2 D;  1EY4 A;  1LTB D;  5DG8 A;  3TN2 A;  3HS0 C;  5FO7 B;  4GZY C;  1HUM A;  2NYZ D;  1Z2N X;  2XGQ A;  4NXN H;  1YNN C;  1A8V A;  4QY7 A;  1S5B D;  3NP8 A;  1LT3 D;  4L5S A;  1G29 1;  1WJJ A;  3NWS A;  4CHT B;  2ZDH A;  3A74 A;  3KJO A;  5KFI A;  4ETS A;  3J7A 5;  2X69 A;  1VQE A;  4APV A;  5IT9 W;  4F87 A;  2WAQ B;  2O4X A;  1ENC A;  1FVI A;  1QVF A;  4X66 H;  2Z1C A;  1G91 A;  2G5D A;  5IYZ F;  4ED2 A;  3NHH A;  4QJF A;  3PW5 A;  3H0G H;  1VQH A;  4C5B A;  4PV1 C;  4C56 C;  1HNW Q;  4JV2 A;  5F9L A;  1QUQ B;  4MZ9 A;  1CKN B;  2KEN A;  1KRT A;  4U7C A;  2LXK A;  3Q8R B;  3CP0 A;  4JI8 Q;  4A3G B;  3AMU A;  4K8I A;  4KJN A;  1HZB A;  4X3S A;  1E2Z A;  3RB3 A;  1BBU A;  5IT9 E;  1KLU D;  1EWC A;  1A15 A;  3KUP A;  1VQ6 A;  2CFM A;  2FPI B;  2OT2 A;  3FKI G;  3QZ8 A;  1EYA A;  1SMY D;  3B6Y A;  4EEY A;  1OXX K;  2FB9 A;  4O3N A;  3K7U C;  1ENF A;  2J0T D;  4GOP C;  4ECX A;  5A2Q W;  1PRT B;  4LSA A;  5IYC H;  1VQM A;  1J6Q A;  2JSO A;  2K5Q A;  4NMZ A;  2ATW A;  2JA7 G;  1ZHQ A;  4A3E H;  1JQY D;  3V96 A;  3CCM A;  4A3K G;  4KHZ A;  3S1N H;  5DQG A;  2ZT9 C;  2SOB A;  3U50 C;  4BXX H;  2MP1 A;  3Q1K A;  1BDO A;  4B3M H;  1H9K A;  4YAK B;  3IN5 A;  3KHR A;  1PH8 A;  2NTS A;  5BN5 A;  2B63 H;  1SFO B;  2JEF A;  3TQT A;  2FIN B;  5GRO A;  1YHB A;  1B53 A;  1VQ4 A;  2NU9 B;  5EKL A;  3K81 C;  2F3I A;  4DV3 H;  1EFI D;  5A2Q E;  4XQJ A;  3E6Z X;  2I8C A;  5DLG A;  3QJY A;  4HJ7 A;  5GAE C;  1CQJ B;  4LFC H;  4R4Q A;  5C44 H;  4A3C G;  3PO3 H;  4DL2 A;  2PI2 E;  4BY1 G;  2EE1 A;  4KI0 A;  3HOV B;  5KG3 A;  3F2U A;  5E7N A;  5C3E H;  4HJ9 A;  2K75 A;  4FXD A;  1RJP A;  4MAM A;  1A3V A;  4C3I G;  3MR6 A;  1WH2 A;  1NTG A;  4JV5 L;  4TVA B;  1K83 A;  1JIC A;  2L15 A;  1WTO A;  1CFM A;  1WFQ A;  4LF8 L;  1DYQ A;  4R8N A;  1D5X C;  4UCS A;  2W9C A;  3V6H A;  2FMC A;  3DM1 A;  3E9H A;  2R7N A;  1EQV A;  3S14 H;  3I90 A;  2F03 A;  1WTH A;  4BBS B;  3Q0A A;  4DAM A;  4X62 L;  1B6S A;  2VOB A;  5DQH A;  3HOU G;  5J2T F;  3HP3 A;  4RAZ A;  2DZD A;  3RLO A;  3CCJ A;  1HTL D;  1EU3 A;  3HKZ B;  1TWA A;  1EYD A;  1AEX A;  4B3R H;  2LMC B;  4OXP A;  2B2Y A;  1KDC A;  4KKT A;  1I7N A;  1QNK A;  5M5X B;  1T94 A;  3PMF A;  1BBX C;  2F0V A;  2FK3 A;  2R7Z A;  2DWC A;  2UXC H;  3EN2 A;  3G7L A;  1TWH A;  4A3L G;  1WCM A;  1L0X B;  4N9P A;  2WAC A;  4HMJ A;  3S17 H;  1L2Z A;  4C2M B;  4RNM A;  4CDC C;  1D5Z C;  4AH6 A;  4EEQ A;  5JOB A;  5IGE A;  3K80 C;  3BQ1 A;  3W1G A;  2EQS A;  3HG9 A;  1SXT A;  4YY3 L;  5JVG 3;  1CZW A;  1V4Y A;  3PIO A;  1QVC A;  3S24 A;  4BBR G;  3NTI A;  4JYA H;  2GN5 A;  5COR A;  1DOM A;  1WR2 A;  4NDX A;  4J1M A;  1BCP C;  1PV4 A;  3GTK A;  1PYS B;  3P20 A;  4RGO S;  4JI1 H;  1PFM A;  3T13 A;  1PYB A;  1RDP D;  2AWN A;  5LMU L;  4DNI A;  2YV5 A;  4DV6 H;  4FM9 A;  3J81 c;  3I4M H;  3T5H A;  3RD4 A;  5LHY 1;  2C2E A;  4DR7 H;  4XYL B;  3T1H L;  4MV1 A;  2XRS D;  3D4R A;  2BCO A;  4QCL A;  2MO1 A;  5CV6 A;  3T5J A;  4O4I F;  4RGM A;  1RJT A;  1UC8 A;  2KHJ A;  3HBL A;  3H94 A;  1ONL A;  4HN7 A;  5DAU A;  3U4V A;  5KEE A;  1JMC A;  1TVX A;  5FLX c;  1NAP A;  4IO9 A;  1ICW A;  1EIF A;  1PTO F;  1VQ5 A;  3GTJ A;  1EU4 A;  2WFW A;  4O4H F;  4A93 H;  1E1T A;  3FDT A;  1M6V A;  3VYR A;  1JOR A;  2Y0S E;  1MSH A;  3J7Y W;  5L1K A;  4J9Q A;  4UCO A;  4JBW A;  3L9A X;  3GTL B;  4IJH A;  4PMB A;  4JV5 Q;  1TWG A;  5DGB A;  1E4E B;  1SAP A;  2F0U A;  4QUF A;  4KHP L;  4MV4 A;  2W70 A;  4LF8 Q;  3L4J A;  4H44 C;  2CH4 W;  5AJ3 Q;  2YL2 A;  3T5K A;  3J7A F;  2EY5 A;  4ME3 A;  1TWF B;  3CKI B;  2R93 B;  1JOK A;  3KAL A;  4F4X A;  5FD5 A;  4X62 Q;  3AB9 A;  1CUK A;  5H1S E;  1HNW H;  4IN3 A;  4GN5 A;  5FLM G;  4YWK A;  2TSS A;  5EGT A;  1PRT D;  2LKV A;  5L1L A;  3RUP A;  3I2Z A;  1GUW A;  4YB8 B;  5KRU A;  1I3Q B;  4JI8 H;  4X3T A;  5KFA A;  2V59 A;  4HR7 B;  2VQE L;  3ETJ A;  3GDE A;  1QCB D;  2SEB D;  2EZV A;  4JI4 Q;  2XNA C;  4WD3 A;  1K8O A;  3CCR A;  1WTQ A;  2GVA A;  2A6H C;  1Y1W A;  2RHS B;  1E24 A;  2EYO A;  1PLF A;  1XPO A;  1MZB A;  2O5J C;  5JVD F;  3LWU A;  1U9R A;  1KJ9 A;  4KD4 A;  1VS0 A;  3GIK A;  5C4X G;  2R7Z G;  3M4Y A;  4HCS A;  4FF3 A;  3S16 H;  1YNJ D;  4C5A A;  3PR4 A;  3S15 H;  4ZHQ F;  5DG9 A;  4YY3 Q;  2IW3 A;  3P7J A;  1PA6 A;  3DWA A;  3H4B A;  3PSI A;  3K57 A;  3CQZ A;  5I6Y A;  3RNU A;  1MGS A;  3SK6 A;  1R4Q B;  1AE2 A;  5KFD A;  2B2U C;  4DV7 Q;  4AQY L;  4I4T F;  5LMU Q;  1EZ8 A;  5DQI A;  4ME5 A;  4FYD A;  1M0T A;  2NU7 B;  1PTO B;  1NNX A;  2KCN A;  2XRQ D;  4LW1 A;  3BDC A;  1S72 A;  1CQV A;  2VZA A;  3T1H Q;  2Q2U A;  1VKZ A;  3I4N H;  1I4H A;  2E2I A;  1EY5 A;  2HDL A;  1STE A;  1EHI A;  3GQB A;  2R92 H;  3H20 A;  3NEN A;  5HY6 A;  4EYH B;  1W3S A;  4DKA C;  3S2D H;  1H9M A;  3GTO H;  1DV2 A;  2I07 B;  2HVQ A;  2QCP X;  2R7F A;  1CI3 M;  2YU9 A;  4NLG A;  3ZJY C;  1R9T B;  2VUM H;  4MTD A;  1SLJ A;  2CW8 A;  2BOS A;  3KBX A;  4FP5 D;  3V2T A;  1QE6 A;  4C3J B;  3PVX A;  1ASZ A;  2EYM A;  3K7A B;  2I5L X;  4A3M H;  1SNQ A;  1Y1V A;  2LS0 1;  2V4D A;  1VQB A;  4ED3 A;  2L12 A;  2NVX H;  2R87 A;  1EY6 A;  3OWF A;  2OQK A;  4CBV A;  1TWC A;  2BQ3 A;  2ATL A;  2K6A A;  1B4O A;  1CSP A;  1JJC B;  4N8F A;  1IBM L;  4U68 A;  3STB C;  1D6E C;  4LMY A;  5COY A;  2VQE Q;  4LFB Q;  2I46 A;  3CRK C;  4PQX A;  2KBN A;  4Y7N H;  2F0O A;  4FNF A;  2VQF L;  1ASY A;  1BBW A;  1BNC A;  1VQO A;  1LTA D;  1TAE A;  2NWG A;  3I12 A;  1U0L A;  3HOZ G;  3CC4 A;  1MBY A;  1X65 A;  3D31 A;  1K8G A;  3CPF A;  2K04 A;  4GN3 B;  2D9U A;  1JWS D;  4M1U B;  3H0G G;  5F9N A;  4O1N A;  1I5F A;  4J6H A;  5JAV A;  4EGJ A;  1WTV A;  1ML0 D;  4Q45 A;  2VPS A;  1C0A A;  2WV6 D;  1TU2 B;  3D6W A;  3SK5 A;  3W5O A;  4QW9 A;  3PUY A;  5LL6 S;  3G6Y A;  1ZET A;  2IX3 A;  3FKI H;  2YTV A;  5C5L A;  3V4S A;  2MUY A;  4O4L F;  3JC6 6;  1IYV A;  1U5K A;  2NVQ B;  5M3F B;  1L0Y B;  4X66 L;  4YAJ B;  3X3M A;  2PI2 A;  3NXW A;  1EY9 A;  2MJ8 A;  1D7Q A;  1DOK A;  2YRW A;  1I50 B;  4EBC A;  5EPK A;  5EJW A;  4LMQ D;  5M5Y H;  2RDH A;  1QOH A;  4G57 A;  4CDD C;  1PFB A;  2JEI A;  2AUJ D;  1L1O A;  4A3K H;  3GIQ A;  2DPI A;  2BH8 A;  4L6T B;  5IGF A;  1Q7Y C;  2B2T A;  3EFX D;  3K3P A;  2NZ1 D;  5GAD C;  3BJY A;  1NMG A;  4BXX G;  2PO4 A;  4J0M A;  2EXZ A;  5I9O A;  1NR4 A;  4YWM A;  4LF8 H;  4KN7 C;  4V0B A;  3HOY G;  4I55 F;  5KX5 F;  1Q8K A;  2MCT A;  2VB3 X;  2YZN A;  2KEE A;  2B63 G;  4Q43 A;  2FPG B;  3FRP B;  1FD7 D;  5IGD A;  4G3I A;  5FKA C;  1RCV D;  3BG3 A;  1N8R C;  4X62 H;  1PHJ A;  1GSA A;  1S0O A;  2F0S A;  1N33 Q;  3M9B A;  4CKE A;  3A0J A;  3M4P A;  4IWX A;  1IYU A;  3T53 B;  4U67 3;  4BY1 H;  4IUP A;  4DK0 A;  1KHI A;  3Q2O A;  5I9P A;  3RV3 A;  2VS1 A;  4JI3 L;  4XYQ A;  1Y1V G;  2MQH A;  1HR0 W;  4C3I H;  2F0J A;  2E8G A;  2JXM B;  4JI4 H;  3N6R A;  1IBM Q;  4QIW A;  3R3O A;  5KT3 A;  4DV4 L;  1CSQ A;  3D3R A;  3NTH A;  1JWU D;  3MR3 A;  3C1E A;  1FR3 A;  4AYB B;  2VQF Q;  4OO1 G;  2B2Y C;  1JKJ B;  5KYI A;  2PVP A;  2YCH A;  1PTO D;  1FKA H;  4JW0 A;  1LLR D;  1G2S A;  3DEP A;  3GD7 A;  4O2B F;  1RK5 A;  4WOR A;  4YY3 H;  2CQA A;  3PUZ A;  3HGB A;  5IGC A;  2ZJP A;  3AEV A;  4EQN A;  5JVL A;  4IPG A;  2HCI A;  4BA1 I;  3WOF A;  1X3E A;  4H0L C;  1PFN A;  4DV7 H;  2AUK A;  5M5W B;  5LMU H;  2RDJ A;  5IT9 L;  4A3L H;  4MIU A;  4FF4 A;  4J15 A;  1V1P B;  4IOA A;  2O03 A;  1LYL A;  2HGS A;  4R8U B;  1J5E L;  1O7Y A;  3T1H H;  2ZXO A;  1SJE D;  1B8A A;  4QWA A;  3M9N B;  5J39 A;  4DU9 A;  3J80 E;  5IE8 A;  2FFK B;  2VR1 A;  2WB1 A;  4IWY A;  3SEB A;  3MWE A;  2G9D A;  1K8M A;  4QGU A;  2XCL A;  4PG3 A;  1JXL A;  1UEA B;  3K8A A;  1S5D D;  1A3T A;  5C4J B;  2P0A A;  5JJI A;  5L9X A;  4B3R L;  3OWE B;  3KF6 B;  2EY6 A;  3J7A V;  3I55 A;  3S1Q B;  3V6K A;  3WDN A;  1PK8 A;  2N8N A;  2A19 A;  2L0C A;  1E0B A;  5KFW A;  5EWE A;  2EYH A;  3FHW A;  2RHQ B;  2DUD A;  2HVS A;  5BPH A;  2BE5 C;  3T51 B;  2PBZ A;  3I4M G;  1LTL A;  3K5L A;  3RZD B;  5KT7 A;  2QGQ A;  4UP9 A;  4A3J B;  2AWO A;  5EKK A;  2RF4 A;  2KSW A;  2YZG A;  3F2D A;  1CM9 A;  4UCU A;  3GIJ A;  4KTA A;  3GTM A;  4MTN A;  1CKO A;  1OTC A;  2L55 A;  2NVT B;  3H3V C;  5IY0 A;  1N34 L;  2NB0 A;  5M9O A;  4FF1 A;  1H9R A;  5CB4 F;  1C48 A;  1GUN A;  4HIK A;  1STG A;  2B3G A;  4JI3 Q;  2CQY A;  2VQE H;  4UY8 C;  4LFB H;  5E4W C;  2E2H B;  2K14 A;  1QIL A;  3BAA A;  4CC6 A;  2A6E D;  4DV6 L;  2Z0S A;  2DY7 A;  4DV4 Q;  4LH7 A;  2EJF C;  3E9I A;  5FK9 C;  5KFH A;  2R7L A;  3J81 i;  5KFK A;  3SVM A;  2C5C A;  3KAJ A;  3GTQ B;  3N41 B;  2NVY B;  2RCF A;  5EZY F;  2UVW A;  1K83 H;  3ND8 A;  4XXE A;  3ERO A;  4DLK A;  1D1I A;  2MHV A;  1CTM A;  1OXV A;  4PNY A;  1UE1 A;  2A73 B;  4LWC A;  3OHA A;  1I4Q A;  2W8L A;  5LA6 F;  3RLF A;  2FMA A;  1T3N A;  1W93 A;  4IPH A;  1BNZ A;  4QWB A;  3BQ2 A;  4A3D B;  4KV6 A;  3FPP A;  1S40 A;  2UU9 L;  1QB5 D;  1TWA H;  5L1I A;  2YTX A;  3MR2 A;  2L9H A;  3TZD A;  2CWP A;  3Q23 A;  4L5T A;  2IY5 B;  1F2Z A;  4DK1 A;  1J5E Q;  1XXG A;  1CZG A;  2R7Z H;  1HQR D;  1U4R A;  3HOW B;  5C3W A;  3ZYY X;  2HJW A;  4XT1 B;  4YBZ B;  3RFC A;  1TWH H;  3R5X A;  4A3B G;  4F8M A;  1WCM H;  2HCC A;  2EYF A;  2AGP A;  2BH2 A;  3BA9 A;  1VQF A;  2D2C C;  3TIN A;  3G48 A;  3J81 j;  3RUZ A;  4ME6 A;  3TS0 A;  2A5H A;  5LL6 b;  4DV5 H;  4LNQ A;  3HKS A;  4JCV E;  1AN7 A;  3Q8P B;  4B3R Q;  1Z2O X;  3QB3 A;  3UDF A;  1S5E D;  2Y0S G;  3UDI A;  3CCE A;  3DEO A;  4IUU A;  4HJA A;  2BA0 A;  2KCT A;  3Q8Q B;  3JAM i;  3PCO B;  3SE7 A;  1K9M C;  3GTK H;  2WAQ A;  2RDI A;  2BDO A;  5KG6 A;  4J9N A;  4EYI B;  3DMU A;  1F2M A;  1Z9F A;  4YWL A;  4R7R A;  2IWH A;  1E7Z A;  4N9T A;  3TME A;  3K58 A;  1MJE A;  5EWG A;  1Y8N B;  5D65 A;  4A76 A;  3PO2 G;  1N33 H;  2JA6 B;  1N32 Q;  3RB4 A;  4L5Q A;  2I87 A;  1QUQ A;  1DM0 B;  2XN9 C;  1CKN A;  4PZ8 A;  4EVO A;  4QMG A;  4XYO A;  3RZO H;  1N34 Q;  5HBR B;  4LSX A;  3S1M H;  1IBM H;  4X65 H;  1O7Z A;  3N44 B;  3FPU B;  3A56 A;  1KL9 A;  3GTJ H;  1SE8 A;  1EIH A;  2VQF H;  2JP1 A;  1WI5 A;  4I7Z C;  2DJG C;  2ALZ A;  3R8B A;  1STB A;  4XDX A;  2H1E A;  1SYC A;  1CQI B;  1GUS A;  5IWA Q;  3HOX B;  2X6G A;  3R5H A;  1TWG H;  4ILW A;  4PZ6 A;  1HNZ H;  3JAM L;  4K5X A;  1KRS A;  3ORR A;  2E76 C;  2RSO A;  1KAW A;  3H3V H;  3VPD A;  2GPS A;  2E2J B;  2FXQ A;  3VMM A;  1AZP A;  1VQJ A;  2EPB A;  3K59 A;  3M3Y H;  3QG1 A;  3PQI A;  5KT4 A;  4JVZ A;  1EYC A;  3SI8 A;  5KG1 A;  2Q8R E;  1HXY D;  4WJ4 A;  3MWM A;  2UU9 Q;  3NQI A;  3ITP A;  3NBI A;  4JBJ A;  3S9W A;  1SFO A;  3DLL A;  3HOZ H;  2EYL A;  2MO0 A;  3HXL A;  1SMX A;  4XT3 B;  4RMF A;  2BDN A;  4LF7 L;  1Y1W H;  2YZM A;  3NEM A;  1B33 N;  2R61 A;  1IBL L;  4MA5 A;  4ECU A;  2PQE A;  5M3M G;  3SK4 A;  1Y69 U;  1X9N A;  1SYB A;  1NBW A;  3W2D A;  5IGG A;  5FD6 A;  3NBH B;  4PMC A;  1Q1E A;  2I0Q A;  2HIX A;  4GNX C;  2GPW A;  4Q0Y A;  4EQ5 A;  5D8D A;  1L1O C;  1DIK A;  1ZHS A;  2UVU A;  1DGS A;  2FLL A;  3CQZ H;  2RKS A;  1ICF B;  2JA7 B;  4YJ3 F;  3A8J E;  3MAQ A;  3KFU A;  3K5M A;  1NSN S;  2M05 A;  2B2T C;  2GA4 B;  2I5H A;  3H09 A;  2CKZ B;  2F4V L;  2NTT A;  1DV1 A;  3C1F A;  4DV1 Q;  2HD3 A;  2A68 C;  1STH A;  2E2I H;  2AKW B;  1UNS A;  4RFB A;  4FS2 A;  3HKZ A;  3QR8 A;  1T5E A;  3AQQ A;  4JI3 H;  4DXF A;  4RZR A;  4ZQ3 A;  4RG1 A;  1I6V C;  2L1B A;  3D6C A;  4R4C A;  4DV4 H;  2K01 A;  3HOY H;  5KFV A;  4GC6 A;  1OXS C;  1K73 C;  4UHV A;  1N36 L;  4FXG C;  4A3F B;  4R4I A;  4C2M A;  1SEB D;  3R23 A;  5BMV F;  3KBG A;  5KG0 A;  4IPD A;  1HH2 P;  1RHP A;  2JK8 A;  2EY2 A;  4A3I B;  3ONA B;  2JA5 B;  4ED0 A;  2F0H A;  3S2H B;  5C0X H;  1ILQ A;  5I6W A;  1Z7T A;  1IKM A;  1A62 A;  4B9X A;  2IMW P;  1Y1V H;  5KFS A;  2B2W C;  2JEG A;  4DUZ L;  3G6J B;  1BVS A;  5LL6 X;  4YCW A;  1TWC H;  5DGA A;  3HOU B;  2VB2 X;  1JE5 A;  4OO1 H;  4DR2 Q;  3D4D A;  1L0W A;  5AJ3 L;  4UCV A;  1O78 A;  1LT4 D;  5C5J A;  1J5E H;  3M85 A;  4UPA A;  2K50 A;  5D1P A;  4O0A A;  3OTO Q;  4MTK A;  3F2C A;  2QK4 A;  3DXJ C;  4LJZ C;  1KNE A;  2CW0 C;  4KKS A;  4CDE C;  3OW2 A;  4LF7 Q;  5HV6 A;  3GV5 B;  3PW2 A;  4IFD H;  4MTE A;  4EX5 A;  4GLA C;  1IBL Q;  3CVZ A;  1IXR A;  3IFD A;  1CT1 D;  2JA8 B;  3U9T A;  1FNW A;  4FU0 A;  1TXY A;  3LWE A;  5KG5 A;  4X64 L;  3CW2 C;  5BR8 Q;  1GGO A;  3J81 W;  5DEH A;  1B44 D;  4OEL B;  4JI4 L;  3GTL A;  3HB9 A;  4PZ7 A;  1EQQ A;  1ILP A;  1E4E A;  3A5U A;  2J6T A;  1EWH A;  4BBR B;  2X0S A;  2KHS A;  1ET9 A;  3EJI A;  3Q6S A;  1TWF A;  1EZ1 A;  4CC5 A;  4QIW E;  1EWI A;  2R93 A;  3V4Z A;  2K05 A;  2QEX A;  3OSO A;  3H6M A;  3S1R H;  2F4V Q;  3TP8 A;  2IP4 A;  4IRK A;  1HZA A;  4F88 A;  1S0N A;  1N32 H;  3WO0 A;  3E5N A;  2IBK A;  4I7H A;  1I6H B;  3MTS A;  2Q8I B;  3J81 E;  1IHZ A;  4DL5 A;  2V5A A;  1N34 H;  4P73 A;  1A6X A;  1LT5 D;  1I3Q A;  2J9G A;  4HR7 A;  3VPC A;  4FXK C;  2K5W A;  4ZK9 B;  4DV7 L;  2KUM A;  2BR0 A;  1W2B A;  2J7Z A;  3RGZ A;  5KFF A;  3J7Z C;  1FNV A;  2VXW A;  2PQA B;  1FGU A;  2AQ2 B;  1LAB A;  1RYR A;  3BYY B;  3UDG A;  3OIP A;  2YRX A;  5IWA H;  1N36 Q;  1NY4 A;  3M9M B;  4RB3 C;  5FLX E;  3FEW X;  2TMP A;  4K5W A;  4JI5 Q;  2ID0 A;  4C1N K;  1WYD A;  4X3U A;  2FP4 B;  4DR3 L;  3JAM W;  3PV0 A;  4DNT B;  2ZJT A;  3KDF B;  4RB0 A;  1P8L A;  3H91 A;  2NZH A;  4ECW A;  2NZO A;  1XDN A;  2ALY B;  4YR2 A;  2LY7 A;  5L1J A;  1B50 A;  5IYB G;  4TQR A;  1VBG A;  2WB1 E;  2ZM6 L;  2OH2 A;  4DUZ Q;  1MKH A;  3J80 i;  1ZKO A;  1GUO A;  3PUX A;  3OHB A;  1VQ8 A;  2UU9 H;  1F9P A;  1HFG A;  2QA4 A;  1H9S B;  3K5N A;  1CA6 A;  1HTP A;  5FPR A;  4IZO A;  1EY0 A;  4DR1 L;  3NQT A;  1FNU A;  2VA3 A;  1KXL A;  4C3H H;  4Q8E A;  1AN8 A;  1EEF D;  2NN6 H;  4ABN A;  3JAM E;  2EIF A;  2W6M A;  1ROD A;  2AU0 A;  3RLN A;  3AU7 A;  3GID A;  1UNN C;  1HR0 L;  5C4X B;  4X64 Q;  4BY7 B;  4ZQI A;  1TS4 A;  3ER0 A;  5LMN Q;  3Q8S B;  3URY A;  4LFB L;  1M0W A;  2NU6 B;  1R9T A;  2UVV A;  3ULJ A;  4PDB A;  2ZJR A;  3T4A C;  4RA8 A;  5T1G A;  2M2L A;  5CAE B;  2ICI A;  3KF8 B;  4A3B H;  1EOV A;  4BA2 I;  3J80 L;  2YS6 A;  3OMG A;  4X6A H;  4XX0 B;  4DV1 H;  1S0M A;  2QW7 A;  2DLN A;  4HNT A;  2F0F A;  1WCM G;  1EL0 A;  1BOS A;  1ET6 A;  4RH6 A;  3U9O A;  5BN3 A;  3GTG B;  3JRW A;  1ESF A;  1E2V A;  5KG4 A;  2QEJ C;  2W6Q A;  2QDL A;  4JI2 L;  2R93 G;  1VDZ A;  1HRJ A;  1CE8 A;  5KFQ A;  1FGB D;  5C5M A;  4J9S A;  3ERQ A;  5ELF A;  3VPB A;  2VY3 A;  3CC2 A;  5JQW A;  1QZG A;  4LFA L;  2KQ3 A;  3MVV A;  1UE6 A;  3KXY T;  1JB3 A;  5JEA J;  3VR6 A;  2XCP A;  1XJV A;  1E3P A;  3MA2 B;  4G7O C;  1K1S A;  1DD2 A;  2DIK A;  1X3P A;  2J6U A;  5CMD A;  1TS2 A;  2FE3 A;  1ZYR D;  3PO2 H;  1RL2 A;  5ELB A;  4QQB X;  1Z2P X;  3M4O H;  3ULP A;  1XNR L;  1C3O A;  2MFI A;  4DR3 Q;  1A0I A;  3E0J A;  3E5S A;  3GTP H;  3GTM H;  2BQU A;  2MNA A;  2WKD A;  5FOB B;  4DV5 L;  4RAU C;  1VQ9 A;  1OWT A;  3OIQ A;  2F52 A;  2JEJ A;  2ZM6 Q;  3TSS A;  3VYT A;  1JC7 A;  2F3W A;  4DR2 H;  3GV7 B;  3HFZ B;  4CKB A;  4MV8 A;  3H3V I;  3U58 A;  3AFQ A;  3RR5 A;  1BXT A;  2RGV A;  3OTO H;  3F1Z A;  3MJF A;  2CCZ A;  3OUU A;  3W3A A;  2Q8T A;  4DR1 Q;  4LF7 H;  3OYY A;  3K0Y A;  1SCU B;  1I50 A;  3FMA A;  1RTN A;  1IBL H;  2WAQ E;  1Y8P B;  1ZEQ X;  1HNX L;  1N33 L;  4E6I A;  1BQQ T;  5F2D A;  3FDS A;  1YNJ C;  4OWX B;  5BR8 H;  4ECR A;  3TP5 A;  2B29 A;  1PH1 A;  4ECV A;  2L11 A;  1HR0 Q;  3IAY A;  4UAI A;  4YP3 A;  4X65 L;  2N3S A;  5LMN W;  3NSW A;  3I91 A;  2W7P A;  3K5O A;  4ULL A;  3H0G B;  4F7X A;  5JPN C;  2PW5 A;  2M9V A;  2R8I A;  1IL8 A;  1SYF A;  3Q24 A;  3I3C A;  2SNM A;  2RBM A;  1GO3 E;  4XQQ A;  2F4V H;  3DM3 A;  4BWG B;  1HNZ L;  5KFX A;  5BPF A;  5M3M H;  1Y1W G;  4J9K A;  3D0F A;  3ICE A;  1XTD A;  4C3J G;  2M00 A;  2BQR A;  1M8A A;  1ZQ7 A;  4DR6 H;  2RVL A;  2K5N A;  3VYU A;  4JI2 Q;  4DAP A;  3T1Y Q;  4LUO A;  2X6L A;  5IOD A;  4JV0 A;  4I65 A;  3CCS A;  1LT6 D;  1LTT D;  2LSS A;  4LFA Q;  3WNZ A;  1MHW C;  4RGT A;  4O2A F;  4AYB A;  1N36 H;  1V43 A;  1F2L A;  3KHL A;  1PZI D;  4HSP A;  4A3E B;  1B6R A;  3S1N B;  4JI5 H;  1EIG A;  1EOT A;  2RGR A;  1JJG A;  1YBY A;  3T5L A;  1GYF A;  5KFT A;  2N88 A;  3AFP A;  5J1Z A;  1XNR Q;  4FS1 A;  1EYG A;  1O7I A;  1HFN A;  2KHI A;  3TEH B;  3DF7 A;  2RQX A;  2XSC A;  2B63 B;  1B1Z A;  5ELO A;  4DUZ H;  4ODG A;  4DV5 Q;  1K0S A;  2ASJ A;  4NXM L;  2FHT A;  5CV7 A;  2CZG A;  1JDE A;  2F0D A;  3BAB A;  1KJQ A;  3BDO A;  4RCN A;  4HSV A;  1V1P A;  1GLV A;  3I70 A;  1V9P A;  4R8U A;  1N48 A;  2B39 A;  4RHR A;  4A3G H;  4J9M A;  5EBC A;  3VYS A;  3Q8D A;  3VR5 A;  5KGU A;  3O13 A;  5C44 B;  4K14 A;  3PO3 B;  5KFY A;  3G6V A;  1AFP A;  1OXT A;  4Y8V B;  4JK1 C;  4FF2 A;  5C3E B;  4OO1 I;  1XWE A;  1HNX Q;  4XQN A;  1GHJ A;  4ZOL F;  3OW7 A;  3UFX B;  5G3L F;  1JIH A;  3MHB A;  5M3F G;  2V4R A;  2E2D C;  5C0X G;  2NUC A;  2W8K A;  4X64 H;  1SNO A;  3BU2 A;  2O5I C;  5LMN H;  2RA4 A;  3KF6 A;  4IUR A;  3RIZ A;  3PIP 3;  1YIJ A;  2MGS A;  2F3V A;  4X65 Q;  3S14 B;  1XYI A;  4F50 A;  4GLV B;  3HKZ E;  2QF7 A;  4A4I A;  3OOC A;  1EQR A;  3PN1 A;  1CK1 A;  1X55 A;  2DGY A;  1KTK A;  2F0K A;  2VUG A;  3IRB A;  1A63 A;  1DON A;  1HHV A;  4KN4 C;  3MFI A;  4OL7 A;  1S97 A;  4IR9 A;  2JJQ A;  2HHH Q;  3J80 W;  1SFO H;  1I6U A;  4WRD A;  1HNZ Q;  4NKL A;  5LOV F;  2HT1 A;  3WO1 A;  1TY0 A;  4IFD G;  3E0E A;  4MV9 A;  4RNN A;  2ZTD A;  4TKO B;  3OHX C;  3S17 B;  1TKW B;  3RTX A;  3BZC A;  4DV2 L;  1WTR A;  4IOC A;  1Q82 C;  4ED8 A;  2D0P A;  1YJW A;  2E2H A;  2R7D A;  2A69 D;  3GIM A;  1VQN A;  4ECZ A;  1LM0 A;  1T36 A;  3H15 A;  4CJ1 B;  3HOV H;  1KDA A;  2HDM A;  5KFR A;  1GXD C;  2DPJ A;  3K0X A;  1P16 A;  1EUC B;  2IJ0 A;  3C2P A;  3GTQ A;  4OIJ A;  4IR1 A;  2NVY A;  1VBH A;  1PH7 A;  3RAX A;  5LP6 F;  2R8H A;  2PN1 A;  3Q22 A;  3QOL A;  4GNX B;  1II3 A;  1VF7 A;  5EBD A;  2WTF A;  3GQC A;  3N40 P;  1DCZ A;  4DR3 H;  1KLG D;  3NWT A;  1QNU A;  1TY2 A;  3ERS X;  3I4M B;  4P72 A;  4LAA A;  2WII B;  2FLN A;  4V19 0;  3EBE A;  4QF4 A;  3IG0 A;  3CD6 A;  3E3X A;  2ZM6 H;  4TSS A;  4YQW A;  1WTP A;  2KJX A;  4NXM Q;  3MWY W;  2KEC A;  4GOP B;  3MXP A;  4LUZ A;  5IOC A;  5KFU A;  4O3O A;  5CYU A;  5M5X H;  5KG2 A;  4MHE A;  4FVM A;  4DR1 H;  2PYK A;  5IYD G;  1PTO C;  5KFE A;  1VQC A;  4A93 B;  3A7A B;  4DAY B;  3MEF A;  5E1F A;  1RJQ A;  2E5L H;  1N32 L;  4K0K L;  1KEE A;  2PNH A;  4C2M H;  1JT8 A;  2VL6 A;  5EPJ A;  3F8N A;  4RWS C;  2ZDG A;  5IYB H;  4FBT A;  2EY1 A;  5HGT A;  1HR0 H;  3TP7 A;  4M8A A;  3T16 A;  3MXN B;  3LML A;  1K8A C;  3C0F B;  4UDU C;  1BCP F;  3CF5 A;  1WD0 A;  2V9W A;  1SN8 A;  4L1K A;  2QDB A;  4ZUJ A;  5K36 G;  2EOT A;  4DV0 L;  4EFB A;  2F0E A;  4TQU S;  2R6G A;  4LF4 H;  2W9B B;  4DL7 A;  2HVR A;  2EXD A;  3MFG A;  5DM7 3;  4JC0 A;  5IWA L;  3TRE A;  1WTX A;  3CCV A;  4DL6 A;  2HQE A;  5D1O B;  3C3L A;  2UXB Q;  3A54 A;  1A9X A;  5KG7 A;  3RBD A;  4RNO A;  5FO8 B;  2JA6 A;  1GUT A;  2UUC L;  3GII A;  4C3H G;  2PMZ B;  4G7Z C;  2NN6 G;  5IP9 G;  1AUX A;  4F4Z A;  1YIT A;  2NUA B;  4JI2 H;  1Q12 A;  1RK6 A;  2W6O A;  1RIP A;  3EPI A;  3T1Y H;  5GAH C;  3OMC A;  4DV2 Q;  2FMM A;  1AW7 A;  4IQZ A;  4G7H C;  1S68 A;  4J9P A;  4LFA H;  3CMA A;  3S16 B;  2SCU B;  5I2Y A;  4GKK L;  2N49 A;  3S15 B;  3CHB D;  4R9W A;  2UUA Q;  3GTL H;  3A8K E;  5H80 A;  1RTO A;  2Y0S B;  1WD1 A;  1GJX A;  1EUD B;  4IRC A;  1XNR H;  4HTH A;  3RB6 A;  2R85 A;  1T5X D;  1TWF H;  4H13 C;  1G6Z A;  1KD1 C;  2R93 H;  3J81 L;  1SE4 A;  4OX9 L;  1BO0 A;  1TQO A;  2P5Z X;  5IP7 G;  4IUT A;  5C4H A;  5KT6 A;  1STA A;  1C4Q A;  4L8J A;  3I4N B;  5C3X A;  3M9O B;  2WB1 G;  4AIM A;  4HMI A;  5I47 A;  4ZKB B;  4GS3 A;  2EJG C;  2F0P A;  4B9W A;  4QWC A;  2F1M A;  4X3K A;  2R92 B;  1I3Q H;  2F0L A;  1A2U A;  4TRD A;  3IKJ A;  3IFT A;  1RKN A;  5FLX L;  3TZU A;  3G71 A;  4YHH H;  4N8X 1;  4A3D G;  1SYD A;  1I4X A;  3S2D B;  1F9Q A;  1VMP A;  1BCP B;  1T9H A;  5ELC A;  2KED A;  1YNN D;  4POF A;  3D4W A;  4DV1 L;  1PH9 A;  3GTO B;  4QWE A;  1VAJ A;  3L7Z C;  1HQM C;  5K5P A;  1TR5 A;  1HNX H;  1B70 B;  3K5H A;  4XTC S;  4K0K Q;  2VUM B;  1BGW A;  2W6Z A;  4XYM B;  4LUV A;  4HIO A;  2K4K A;  4B3T L;  2FJZ A;  3R5F A;  3NBH A;  2ZTC A;  1E2W A;  2JE6 I;  1B3A A;  1K3B C;  1HJP A;  2YW2 A;  2B8G A;  4RCO A;  1LTR D;  1SR3 A;  4A3M B;  4KLK A;  4DA2 A;  3J7A K;  1CHP D;  4EBD A;  1HPC A;  1RD9 D;  2CQO A;  3I8Z A;  1VQL A;  2R86 A;  2JA7 A;  2YTY A;  4DV0 Q;  2AHO B;  1D8L A;  4KY6 A;  2NVX B;  1IW7 C;  3UE0 A;  1OO9 B;  4YIJ A;  3WOE A;  1WTW A;  5KT2 A;  1C9O A;  2PCF B;  4Q0F A;  4O3S A;  3EYY A;  1PTO H;  2OWO A;  2HHH H;  3CXC A;  5KNC A;  2DN8 A;  5EQ0 A;  3KHH A;  5TSS A;  1I94 Q;  1SRU A;  3AYH B;  1PMR A;  2UUC Q;  4F4Y A;  4R1J A;  4Y7N B;  4B3S H;  2MPM A;  1S5F D;  5CV5 A;  2OEO A;  2JN4 A;  2LXJ A;  4DR5 L;  1S10 A;  3LWB A;  4XIG S;  2JA6 G;  4K2L A;  4J9O A;  3KAK A;  3HEJ A;  2B2V A;  4K8J A;  4ECQ A;  4DR2 L;  1SNC A;  1UE5 A;  5C1O A;  3CCL A;  3MXU A;  4GKK Q;  2OXP A;  5G3L D;  1K28 A;  2C00 A;  2A68 D;  3OTO L;  1R9T H;  1HA6 A;  2AQ1 B;  2WIN B;  3RV4 A;  4JI0 L;  5JJZ A;  2JA5 A;  1B9N A;  3M4Q A;  4C3J H;  4PMW A;  3K7A H;  4TQS A;  2K5V A;  2FK1 A;  5JJK A;  3HOX G;  1DXM A;  3FKI B;  5BR8 L;  4OX9 Q;  1ZXT A;  3EQL C;  4TUY F;  2K33 A;  2VQD A;  4NXM H;  3DUZ A;  5IGB A;  4EFE A;  5EWF A;  2OQ0 A;  2OLS A;  1SE2 A;  1JE4 A;  1Z6H A;  5M5Y B;  1K1Q A;  4IRD A;  1X3G A;  4JI6 L;  5EOY A;  4RU9 A;  3SE0 A;  4RKL A;  4A3K B;  2RDG A;  1M90 C;  4KHV A;  5LXT F;  4UFZ A;  2D5D A;  2ZXR A;  1JX4 A;  4MNO A;  1Y14 B;  1QZH A;  3BYT B;  3HRZ C;  1KNA A;  2WAQ G;  1GD7 A;  3UDX A;  2WYO A;  2G9H D;  2EVB A;  1X56 A;  4NPS A;  4B3T Q;  4ID6 A;  4DR6 L;  1ENA A;  3QOJ A;  4J9R A;  5CV4 A;  2UVR A;  3TBI B;  5NUC A;  3PZP A;  1HZ9 A;  4JBK A;  2XIW A;  1E22 A;  2DNC A;  1PH4 A;  1GHK A;  2FLP A;  2CW0 D;  4H7B A;  2Z4I A;  2I5M X;  5C6A A;  4BY1 B;  5IT9 c;  2F0Q A;  2KVM A;  2YU9 H;  1FJG L;  4A3G G;  3KLS X;  2UXB H;  5KKN B;  4JI5 L;  3BQ0 A;  1SND A;  4C3I B;  2K03 A;  2V4Q A;  1GVP A;  2K5D A;  4JPB W;  4AYB E;  3IL8 A;  1PVO A;  3TIG A;  3RB0 A;  2RSN A;  2NVQ H;  5M3F H;  1YZ6 A;  4LH6 A;  1KBL A;  4MN3 A;  2F4I A;  5JPM C;  1I50 H;  1Y8O B;  4DV2 H;  1F9S A;  4DR5 Q;  4HQ6 A;  2XWJ B;  3MEH A;  2Z6B A;  2WDT A;  4O3P A;  3TQY A;  2PQA A;  4J8Q A;  5CA1 F;  3QIA A;  3GLK A;  2D62 A;  1HA5 A;  1YVC A;  2UUA H;  3SDZ A;  5KFZ A;  2C9O A;  4ZAI A;  2F0M A;  4I7A A;  4B08 A;  1E1O A;  3UQ8 A;  1U4L A;  4J9L A;  1G6P A;  4POG A;  2CHB D;  1I7L A;  3JSN A;  3QWN A;  4JI0 Q;  4A2A A;  5JEA G;  4Y52 H;  4IUN A;  1SMY C;  1BCP D;  3NTK A;  2Z6K A;  2R84 A;  5CC4 A;  3NEL A;  1GOZ A;  3KDF A;  4A3F G;  1N56 A;  1VQK A;  1SRO A;  1C7Y A;  3CAM A;  1YNX A;  1AE3 A;  4DK3 C;  4A3I G;  5LMN L;  2JA5 G;  1J9O A;  3MZ5 A;  3GO5 A;  5EPL A;  5J22 A;  1H9S A;  4WBN F;  1X6O A;  2L4N A;  3MR5 A;  3HOV G;  2JYO A;  4JI6 Q;  2NU8 B;  5KFB A;  4DR4 L;  3CCQ A;  1GSO A;  5KFG A;  3FMC A;  1PH3 A;  5FLX W;  4DK6 C;  1XMO L;  1DZ1 A;  2W9A A;  1TS5 A;  4DPG A;  3KJP A;  4K0K H;  2Q2T A;  1PH2 A;  3ULL A;  2KOL A;  5KIX A;  4CJ0 B;  2K5H A;  4HJ8 A;  4MV3 A;  3PW4 A;  4LF5 H;  1XNQ L;  1JR0 D;  4BBS G;  4DR6 Q;  3I72 A;  4MV7 A;  1EYZ A;  4DL4 A;  3GP7 A;  1D1K A;  5T1I A;  1B7Y B;  1V8Q A;  1NR2 A;  2JA8 G;  3I73 A;  5J3B A;  3BG5 A;  4O3Q A;  4DV0 H;  3QFF A;  3SR1 A;  1LUZ A;  2ASB A;  3HKZ G;  5M5W H;  3ETH A;  4A2B A;  1ULZ A;  4HNU A;  1SYX B;  3KF8 A;  2GLT A;  4GC7 A;  5IYD H;  1TA8 A;  1VQD A;  1XX8 A;  3PF4 A;  1FJG Q;  1SEI A;  1SNP A;  2ZXP A;  1SNM A;  3CU7 A;  3DHQ A;  1C8C A;  2PNR C;  1IBK L;  4I50 F;  1I94 H;  3MFH A;  2R8K A;  2UUC H;  3GTG A;  3RMH A;  1RYS A;  5D3D A;  1X54 A;  3GV8 B;  4OWW B;  1M4V A;  3SXH A;  2AGQ A;  3NE5 B;  2C35 B;  3JSL A;  3N6X A;  2XCA A;  3RN5 A;  2A6H D;  2A1A A;  3PIP A;  3G6X A;  1KAA A;  4P2C B;  5K36 H;  1ESR A;  2PMZ E;  1K83 B;  5C4J H;  2R7K A;  2K28 A;  1Q1B A;  3L2P A;  1IL2 A;  4RZQ A;  4GKK H;  1UUP A;  3VR3 A;  2E75 C;  3PUW A;  1NCV A;  4P74 A;  3S1Q H;  3UE1 A;  1UWV A;  2QYZ A;  2YS7 A;  2W9C B;  2XGP A;  2C28 A;  2ES2 A;  2W71 A;  5CV9 A;  1O80 A;  1JOQ A;  1BR9 A;  3R93 A;  3K3V A;  3RZD H;  1LAC A;  2AMC B;  2E5L L;  5IP9 H;  3PW7 A;  4A3J H;  2NBF A;  2HUG A;  1TWA B;  4UP8 A;  1AZQ A;  5HGQ A;  4OX9 H;  2JA9 A;  1QWY A;  3K6O A;  2OTJ A;  4YJ2 F;  3T56 B;  2R7Z B;  2A8V A;  1KIX A;  4A75 A;  5GON F;  2NVT H;  1JLL B;  3KYH C;  3GV3 A;  5KFL A;  1TWH B;  4F4W A;  2R8G A;  4LF6 L;  1QJO A;  1WCM B;  3BVM A;  1R4P B;  1KC7 A;  4S3S A;  5KFP A;  3I4L A;  4QUC A;  4LF4 L;  2H5X A;  2E2H H;  4DR4 Q;  3BA8 A;  3I7F A;  4ZCK A;  1XMO Q;  3G8C A;  2UUB L;  4KMU C;  4UCT A;  1BJT A;  3GTQ H;  4EQO A;  2NVY H;  5IP7 H;  4LF9 L;  4B3T H;  3GTK B;  3JAM c;  1IZ6 A;  4QL5 A;  4GKJ L;  1SBB B;  2F0G A;  3T1Y L;  1XNQ Q;  4HAE A;  4JI7 L;  1XMQ L;  1MIU A;  2PW7 A;  5CBE E;  1RJR A;  3H0G A;  1JWM D;  1MJC A;  3GV6 A;  2AQ4 A;  2FJ2 A;  4BY7 G;  4A3D H;  1X3Q A;  4PWQ A;  1KQS A;  5CBA E;  1G51 A;  5CGK A;  1JCK B;  3RZO B;  3GIP A;  2AGO A;  4EGV A;  3LP8 A;  3A7L A;  2R82 A;  3S1M B;  3PUV A;  3HOW H;  4JUZ A;  3RGX A;  3F2B A;  2VA2 A;  1IBK Q;  2R6F A;  3GTJ B;  3STB D;  1B2T A;  3N52 A;  1F9R A;  2W6N A;  1QVG A;  1K3R A;  3KLW A;  1H95 A;  1VQI A;  2DNE A;  4HCE A;  3CC7 A;  1KJJ A;  4DR5 H;  2BA1 A;  2FKL A;  4Q44 A;  1PRT C;  3H40 A;  5T14 A;  1K0R A;  2V1C C;  1VQP A;  1TWG B;  2R7M A;  5FJ8 G;  4RB1 A;  5DG7 A;  3BJU A;  4UP7 A;  4EGQ A;  4G4K A;  4OGQ C;  4C5C A;  1SYG A;  1U4M A;  4JOI A;  3MFY A;  4O42 A;  3BDL A;  3VA7 A;  4YHH L;  2C2D A;  2B2V C;  4JI0 H;  3M4I A;  4DF7 A;  3M3Y B;  1VMC A;  1F2Y A;  2PZT A;  2E5L Q;  5JUM A;  4U6P A;  5CR3 A;  1Z47 A;  3F8T A;  3X3N A;  3EVQ A;  3RN2 A;  2B63 A;  1NJI C;  4R4O A;  1KJ8 A;  3SHL A;  2JA6 H;  3HOZ B;  1JDB B;  4HID A;  3NK9 A;  2H4O A;  3BVG A;  4ZYS A;  4DUY L;  5L37 A;  3TRZ A;  3HZX A;  1Y1W B;  4LF6 Q;  5AFW A;  4KHP Q;  4K6D A;  2XD4 A;  4K2K A;  3C46 A;  1D2B A;  4JI6 H;  3TS2 A;  3CPW A;  4LF4 Q;  4EQP A;  2F0W A;  5JVH 3;  3VR4 A;  3TP6 A;  2UXD L;  4RGN A;  1IYJ B;  5I2X A;  1V1Q A;  4DXG A;  2HHH L;  1YHQ A;  3N8D A;  1EEI D;  1UEB A;  1PH6 A;  1ZYR C;  4JV1 A;  2UUB Q;  4YCV A;  4TV9 F;  1G8Z D;  3HOX H;  4BWS C;  1JB7 A;  1NUC A;  2IA6 A;  3CQZ B;  2HIV A;  3KK7 A;  1KAB A;  4YR3 A;  4LF9 Q;  4B3S L;  3NGD A;  1UC9 A;  1YHA A;  4HED A;  3W1B A;  2QKI C;  4GKJ Q;  5HUR A;  4QW8 A;  1MI2 A;  3M7G A; 
#chains in the Genus database with same CATH homology
 4JI7 Q;  3NEM A;  2GVB A;  1IBL L;  5IYB H;  1XMQ Q;  2E2J H;  1X9N A;  5M3M G;  3L0O A;  2MO1 A;  3MXN B;  1NBW A;  1K8A C;  3CF5 A;  2KHJ A;  3NBH B;  1SN8 A;  3U4V A;  1Q1E A;  2I0Q A;  2HIX A;  5K36 G;  4FDB A;  4DV0 L;  4TQU S;  1PFS A;  5FLX c;  4GNX C;  4IO9 A;  1EIF A;  2R6G A;  1JMC A;  1BKB A;  1VQ5 A;  4EQ5 A;  1L1O C;  2EXD A;  2WFW A;  4JC0 A;  1DGS A;  5IWA L;  4A93 H;  1E1T A;  3CQZ H;  4NXN L;  3TRE A;  2Y0S E;  3CCV A;  4JBW A;  3KFU A;  2OCE A;  5ELN A;  2UXB Q;  2Q2H A;  4IJH A;  4JV5 Q;  4P71 A;  1VQA A;  2I5H A;  2UUC L;  4KHP L;  2CKZ B;  4AQY Q;  4LF8 Q;  2F4V L;  2YYZ A;  5AJ3 Q;  2NN6 G;  5IP9 G;  1YIT A;  4DV1 Q;  4ME3 A;  3G4S A;  1Q12 A;  1RIP A;  5GAH C;  2VNU D;  4DV2 Q;  2E2I H;  2AKW B;  5C0X I;  1FL0 A;  1L2F A;  3AQQ A;  4X62 Q;  2JEB I;  1CUK A;  5H1S E;  3BZK A;  3CMA A;  4RG1 A;  4OON A;  1S3O A;  4GN5 A;  1N9W A;  4YWK A;  5FLM G;  4GKK L;  2N49 A;  4R4C A;  2N78 A;  3LGJ A;  4YHH Q;  4GNX A;  2JA7 H;  3I2Z A;  2UUA Q;  3GTL H;  3HOY H;  2VQE L;  3GDE A;  1OXS C;  1K73 C;  5IYC G;  1N36 L;  4JI4 Q;  4R4I A;  4A3E G;  3CCR A;  2GVA A;  2RHS B;  1E24 A;  1TWF H;  2Z6K C;  1XPO A;  1KD1 C;  4IPD A;  2R93 H;  1HH2 P;  2JK8 A;  4OX9 L;  5IP7 G;  1VS0 A;  2XGT A;  5C4X G;  2R7Z G;  4DUY Q;  1VQ7 A;  4IFD I;  4GOP A;  2WB1 G;  4AIM A;  1A62 A;  3S16 H;  1Y1V H;  2WP8 J;  4GS3 A;  3S15 H;  4DUZ L;  4YY3 Q;  1I3Q H;  1PA6 A;  2ZJQ A;  1BVS A;  3PSI A;  4YCW A;  2UXB L;  2UXD Q;  1TWC H;  4A3C H;  3RNU A;  3G71 A;  1JE5 A;  4A3F H;  4A3D G;  4DR2 Q;  1AE2 A;  1Q46 A;  4NB3 A;  4DV7 Q;  1T9H A;  4POF A;  1L0W A;  5AJ3 L;  4AQY L;  1AH9 A;  5LMU Q;  5C44 G;  4DV1 L;  1PH9 A;  3M85 A;  4UPA A;  2K50 A;  3PO3 G;  4O0A A;  3L7Z C;  4IPC A;  3OTO Q;  4A3I H;  3WWV A;  1B70 B;  2JA5 H;  3F2C A;  4B3S Q;  4XTC S;  4K0K Q;  1UE7 A;  4LW1 A;  5C3E G;  3OW2 A;  4LUV A;  2VZA A;  2K4K A;  4HIO A;  3T1H Q;  1S72 A;  2Q2U A;  4B3T L;  2ZTC A;  2JE6 I;  3I4N H;  1HJP A;  3G6E A;  4EX5 A;  4GLA C;  1GM5 A;  1IBL Q;  1IXR A;  5EAY A;  2R92 H;  1SR3 A;  3PF5 A;  1TXY A;  4KLK A;  2D0O A;  3CW2 C;  5BR8 Q;  4X64 L;  3I4O A;  3NEN A;  5HY6 A;  1X3F A;  2CQO A;  4ALP A;  1VQL A;  2UUA L;  1XPR A;  3HOU H;  2YTY A;  4DV0 Q;  4DV3 L;  2AHO B;  1D8L A;  1W3S A;  4DKA C;  2IX1 A;  4JI4 L;  3S2D H;  4PZ7 A;  3UE0 A;  1EQQ A;  3A5U A;  1C9O A;  3GTO H;  4LFC L;  4AYB G;  1L1O B;  4NXN Q;  4P75 A;  2R7F A;  2OWO A;  3ZJY C;  3CXC A;  2VUM H;  1SLJ A;  4BBS H;  4QIW E;  1EWI A;  1I94 Q;  2QEX A;  1SRU A;  3AYH B;  2UUC Q;  3S1R H;  2F4V Q;  4R1J A;  1HZA A;  1ASZ A;  2JA8 H;  3VDY A;  4A3M H;  2I5L X;  4DR5 L;  2LXJ A;  1Q86 C;  4XIG S;  1VQB A;  2JA6 G;  4P73 A;  4X66 Q;  2NVX H;  1Q81 C;  4DR2 L;  4DV7 L;  1UE5 A;  2OQK A;  3CCU A;  3CCL A;  1W2B A;  4BBR H;  1YJN A;  4GKK Q;  1CSP A;  3OTO L;  1R9T H;  3J7Z C;  1JJC B;  1IBM L;  1XPU A;  2PQA B;  3STB C;  1FGU A;  2VQE Q;  3J80 c;  4JI0 L;  3UDG A;  4LFB Q;  1N36 Q;  1NY4 A;  2KBN A;  4C3J H;  3M4Q A;  4Y7N H;  4LF5 L;  2VQF L;  1ASY A;  4PMW A;  3K7A H;  1BBW A;  2K5V A;  4JI5 Q;  2ID0 A;  1VQO A;  3HOX G;  2UXC L;  5JJK A;  1WYD A;  2JQO A;  1I6H H;  5BR8 L;  1U0L A;  4OX9 Q;  4DR3 L;  3CC4 A;  1X65 A;  3HOZ G;  2NN6 I;  3PV0 A;  3KDF B;  1P8L A;  2CWA A;  2NZH A;  3D31 A;  2NZO A;  1K8G A;  3CPF A;  4GN3 B;  2ALY B;  3U4Z A;  2OQ0 A;  5IYB G;  2WB1 E;  3H0G G;  2ZM6 L;  4DUZ Q;  1MKH A;  3J80 i;  1X3G A;  1I5F A;  3PUX A;  4JI6 L;  3KOJ A;  4O2D A;  1VQ8 A;  1M90 C;  2QA4 A;  1PH5 A;  1I94 L;  4JYA L;  1C0A A;  1CKM A;  3W5O A;  4MNO A;  1NE3 A;  1Y14 B;  3A5Z B;  1QZH A;  3PUY A;  4JI1 L;  4A3J G;  2WAQ G;  4DR1 L;  3FKI H;  2YTV A;  4R4T A;  4A93 G;  1GD7 A;  3UDX A;  3JC6 6;  4HIM A;  1KXL A;  4B3M Q;  4C3H H;  1U5K A;  1X56 A;  4NPS A;  4B3T Q;  4X66 L;  4DR6 L;  2EIF A;  2PI2 A;  4DR7 L;  4OWT B;  1D7Q A;  1WOC A;  3RLN A;  5M5Y H;  1HZ9 A;  1HR0 L;  4JBK A;  2IHF A;  4X64 Q;  1E22 A;  1L1O A;  3ER0 A;  1PH4 A;  5LMN Q;  4A3K H;  4LF7 Q;  2IX0 A;  4LFB L;  4DV3 Q;  5FLM H;  2I5M X;  3ULJ A;  1EUJ A;  2HQL A;  5IT9 c;  2YU9 H;  4A3G G;  3I56 A;  2ZJR A;  2BH8 A;  1FJG L;  1OXU A;  4LFC Q;  1Q7Y C;  4JI5 L;  5GAD C;  1NMG A;  4BXX G;  3KF8 B;  1GVP A;  4AYB E;  4A3B H;  1EOV A;  1PVO A;  4YWM A;  4BA2 I;  2NVQ H;  5M3F H;  3HOY G;  4X6A H;  1NMF A;  2IT1 A;  1YZ6 A;  1Q8K A;  5JJL A;  1EFW A;  2B63 G;  1WCM G;  4JG2 A;  1I50 H;  4HJ5 A;  5C4X H;  4DR5 Q;  3PGZ A;  1EIY B;  1N8R C;  4BY7 H;  2K52 A;  3FP9 A;  1PHJ A;  5C0X J;  4JI2 L;  1N33 Q;  2R93 G;  3M9B A;  3A0J A;  3M4P A;  3TQY A;  4JBM A;  2PQA A;  4BY1 H;  2VY3 A;  3CC2 A;  1KHI A;  5GAG C;  1QZG A;  2D62 A;  2VS1 A;  1YVC A;  4JI3 L;  1HNW L;  4LFA L;  1Y1V G;  2MQH A;  1UE6 A;  5JEA J;  1E1O A;  1HR0 W;  4C3I H;  1XJV A;  2OTL A;  2E8G A;  1G6P A;  1E3P A;  1IBM Q;  4POG A;  4JOI C;  3HOW G;  4JI0 Q;  2Q2I A;  4JI8 L;  5JEA G;  4DV4 L;  1CSQ A;  4Y52 H;  4YCU A;  2IHE A;  2Z6K A;  3NEL A;  3PO2 H;  3KDF A;  3SGI A;  1RL2 A;  2VQF Q;  4A3F G;  2ZTE A;  4LF5 Q;  4OO1 G;  1VQK A;  1KC8 C;  3GTG H;  1SRO A;  1C7Y A;  4QQB X;  3CAM A;  3M4O H;  2UXC Q;  3ULP A;  1YNX A;  1HZC A;  1XNR L;  2KCM A;  1AE3 A;  2MFI A;  5FJ8 H;  4DK3 C;  1A0I A;  4DR3 Q;  4A3I G;  5LMN L;  2JA5 G;  3GD7 A;  3GTP H;  4L5R C;  3GTM H;  4IFD J;  1YI2 A;  4H02 A;  2MNA A;  4DV5 L;  1VQ9 A;  3I4N G;  3PUZ A;  3GO5 A;  2ZJP A;  2F52 A;  2VW9 A;  3AEV A;  4WJ3 M;  1X6O A;  1YEZ A;  2ZM6 Q;  4IPG A;  4BA1 I;  2R92 G;  1X3E A;  3HOV G;  4JI6 Q;  3HFZ B;  3CCQ A;  1YJ9 A;  4DR4 L;  3H3V I;  3U58 A;  1PH3 A;  4DK6 C;  1VCI A;  3AFQ A;  1XMO L;  4JYA Q;  3RR5 A;  4A3L H;  3F1Z A;  1M1K C;  4DPG A;  3KJP A;  2CCZ A;  3CME A;  4J15 A;  4IOA A;  2Q2T A;  1PH2 A;  4JI1 Q;  3ULL A;  1LYL A;  2JEA I;  4DR1 Q;  1J5E L;  2XTI A;  4IJL A;  3OYY A;  3EIV A;  2K5H A;  4HJ8 A;  4DV6 Q;  1B8A A;  2WAQ E;  1HNX L;  1N33 L;  3M7N A;  2VUM G;  1XNQ L;  4BBS G;  4DR6 Q;  5IE8 A;  4DR7 Q;  1VQG A;  4OWX B;  2RCN A;  4GLX A;  1B7Y B;  4QGU A;  1JJ2 A;  4GN4 B;  2B29 A;  1PH1 A;  2JA8 G;  4PG3 A;  5J3B A;  1GKH A;  4A3M G;  1HR0 Q;  5GQO A;  3K8A A;  5DLQ E;  1LUZ A;  2ASB A;  3HKZ G;  2N3S A;  4X65 L;  5LMN W;  5M5W H;  5JJI A;  4B3R L;  5IYD H;  1VQD A;  3KF6 B;  3PF4 A;  1FJG Q;  3I55 A;  1A8V A;  4QY7 A;  2N8N A;  2A19 A;  1G29 1;  4L5S A;  1IBK L;  1WJJ A;  3FHW A;  2RHQ B;  2DUD A;  1GO3 E;  3A74 A;  3KJO A;  3I4M G;  1LTL A;  1X54 A;  3DM3 A;  3J7A 5;  4OWW B;  2QGQ A;  1HNZ L;  4UP9 A;  5M3M H;  4APV A;  1VQE A;  1Y1W G;  2C35 B;  2AWO A;  2RF4 A;  3D0F A;  1XTD A;  3F2D A;  3RN5 A;  3ICE A;  2A1A A;  3PIP A;  4MTN A;  1CKO A;  1FVI A;  1QVF A;  2PMZ E;  2K5N A;  5C4J H;  4JI2 Q;  1OTC A;  1Q1B A;  3T1Y Q;  3L2P A;  1IL2 A;  5IY0 A;  4LUO A;  4QJF A;  3H0G H;  1N34 L;  3CCS A;  1VQH A;  3PUW A;  4P74 A;  3S1Q H;  4HIK A;  3UE1 A;  1UWV A;  2B3G A;  4JI3 Q;  2LSS A;  1HNW Q;  4LFA Q;  4UY8 C;  1QUQ B;  4MZ9 A;  1CKN B;  2KEN A;  1KRT A;  2K14 A;  2ES2 A;  1V43 A;  4DV6 L;  2LXK A;  2Z0S A;  3RZD H;  3CP0 A;  4JI8 Q;  4DV4 Q;  2AMC B;  3E9I A;  5IP9 H;  2E5L L;  1HZB A;  3S2H H;  3J81 i;  4A3J H;  4UP8 A;  1JJG A;  1BBU A;  1YBY A;  5HGQ A;  2JA9 A;  2OTJ A;  3AFP A;  1XNR Q;  1K83 H;  1VQ6 A;  2A8V A;  2CFM A;  1KIX A;  1O7I A;  3FKI G;  4A75 A;  1EYG A;  2KHI A;  1OXV A;  3TEH B;  3KYH C;  1UE1 A;  2NVT H;  3B6Y A;  4LF6 L;  1OXX K;  5ELO A;  4DV5 Q;  4LWC A;  3K7U C;  4NXM L;  3RLF A;  4GOP C;  2H5X A;  4LF4 L;  2E2H H;  4IPH A;  5IYC H;  1VQM A;  1J6Q A;  2JA7 G;  4DR4 Q;  1V9P A;  2ATW A;  4A3E H;  4A3G H;  3I7F A;  3CCM A;  4A3K G;  4KHZ A;  1S40 A;  1XMO Q;  3S1N H;  3Q8D A;  2UU9 L;  2UUB L;  1TWA H;  3U50 C;  2YTX A;  2CWP A;  1OXT A;  3GTQ H;  4L5T A;  4BXX H;  2NVY H;  2IY5 B;  5IP7 H;  4LF9 L;  1J5E Q;  2R7Z H;  3JAM c;  1IZ6 A;  4QL5 A;  4GKJ L;  4OO1 I;  1TWH H;  1HNX Q;  3T1Y L;  4A3B G;  1PH8 A;  1XNQ Q;  2B63 H;  1WCM H;  4JI7 L;  5M3F G;  1XMQ L;  5C0X G;  1MIU A;  5GRO A;  3BU2 A;  1YHB A;  2BH2 A;  1VQF A;  1VQ4 A;  3G48 A;  3J81 j;  3KF6 A;  1MJC A;  3K81 C;  2F3I A;  3TS0 A;  1YIJ A;  4X65 Q;  4A3D H;  4LNQ A;  3HKS A;  4BY7 G;  4HJ7 A;  5GAE C;  4JCV E;  1KQS A;  4GLV B;  1G51 A;  4B3R Q;  3HKZ E;  3UDF A;  3UDI A;  2Y0S G;  4R4Q A;  5C44 H;  3PO3 H;  4A3C G;  3CCE A;  2PI2 E;  4BY1 G;  4A4I A;  1EQR A;  4HJA A;  2BA0 A;  2KCT A;  1X55 A;  2DGY A;  4KI0 A;  3PCO B;  3JAM i;  3IRB A;  3PUV A;  3HOW H;  1K9M C;  5E7N A;  5C3E H;  3F2B A;  2K75 A;  4HJ9 A;  1IBK Q;  3GTK H;  1A63 A;  3STB D;  1NTG A;  4JV5 L;  1QVG A;  2JJQ A;  1Z9F A;  4YWL A;  1K3R A;  4TVA B;  1E7Z A;  1SFO H;  3KLW A;  2L15 A;  2HHH Q;  1HNZ Q;  1H95 A;  1VQI A;  1WFQ A;  3CC7 A;  1MJE A;  4LF8 L;  2HT1 A;  2BA1 A;  4A76 A;  4IFD G;  3E0E A;  3PO2 G;  2ZTD A;  1K0R A;  2V1C C;  1VQP A;  1N32 Q;  3E9H A;  3BZC A;  4DV2 L;  1Q82 C;  4IOC A;  3S14 H;  4L5Q A;  2D0P A;  1QUQ A;  4PZ8 A;  1YJW A;  1CKN A;  4DAM A;  5FJ8 G;  2R7D A;  4X62 L;  3BJU A;  4UP7 A;  3RZO H;  1VQN A;  3HOU G;  1N34 Q;  1LM0 A;  3H15 A;  4JOI A;  3S1M H;  3HOV H;  4YHH L;  3RLO A;  3K0X A;  3CCJ A;  1P16 A;  1KL9 A;  3GTJ H;  4OXP A;  1SE8 A;  1PH7 A;  1WI5 A;  2E5L Q;  4GNX B;  1Z47 A;  3F8T A;  3EN2 A;  5IWA Q;  3RN2 A;  4A3L G;  1NJI C;  4R4O A;  1TWG H;  2JA6 H;  3S17 H;  4PZ6 A;  3ERS X;  4HID A;  4P72 A;  1KRS A;  4DUY L;  3TRZ A;  4AH6 A;  3EBE A;  4LF6 Q;  4KHP Q;  3CD6 A;  1KAW A;  3H3V H;  3K80 C;  4NXM Q;  2FXQ A;  3W1G A;  2EQS A;  3TS2 A;  3CPW A;  4LF4 Q;  4YY3 L;  1VQJ A;  3PIO A;  1QVC A;  3S24 A;  4BBR G;  3M3Y H;  2GN5 A;  4GOP B;  4LUZ A;  2UXD L;  1IYJ B;  1V1Q A;  5M5X H;  2HHH L;  1YHQ A;  1PV4 A;  4WJ4 A;  1PYS B;  1UEB A;  1PH6 A;  4B3M L;  2UU9 Q;  2UUB Q;  4YCV A;  1PYB A;  3HOX H;  2AWN A;  4JBJ A;  5IYD G;  5LMU L;  1JB7 A;  4DNI A;  1VQC A;  2YV5 A;  4DAY B;  3DLL A;  2HIV A;  3HOZ H;  3J81 c;  4LF9 Q;  3MEF A;  2MO0 A;  4B3S L;  3I4M H;  1N32 L;  1SMX A;  1YHA A;  4K0K L;  2PNH A;  4C2M H;  4RMF A;  3W1B A;  4GKJ Q;  2VL6 A;  4LF7 L;  3T1H L;  1JT8 A;  1Y1W H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...