2R7ZG

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r7zG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r7zG01
1B70B 4GNXA 2I5MX 1KHIA 2WFWA 1VQ6A 3S1MH 3I4MG 1SN8A 4JI5Q 1YI2A 4JI6L 2R93H 5JJLA 2MO0A 1KXLA 4AQYQ 1QZGA 1SROA 4A3GG 4XIGS 4DV6L 1C7YA 4A3EH 3GTPH 2VZAA 5IP9H 3GTGH 2B63G 2UU9Q 4DR2L 1UE6A 1HNZL 4BY7H 2VS1A 5IY0A 2NVYH 2VNUD 2VL6A 4A3DG 4DV4Q 2H5XA 4BA1I 1AH9A 1SLJA 4JOIA 4Y7NH 3S1QH 3DM3A 4WJ4A 1BBWA 1O7IA 2Q2HA 2YTXA 2HIXA 1FGUA 1WYDA 4RMFA 4AYBG 4X64L 4B3SL 2WB1G 2WAQG 5C4XH 4O2DA 3CCQA 2B29A 1GM5A 3ZJYC 5FJ8H 3KJPA 4DV5L 2E5LQ 2ATWA 1N8RC 5C44G 4DV1L 5HY6A 4NXNQ 4LUOA 1UWVA 4JCVE 4JYAL 3HOZH 2D0PA 4HJAA 1L0WA 3HOUH 1RL2A 2IT1A 5LMNW 4HJ5A 5K36G 4JBJA 2ZJRA 4JI7Q 3GO5A 3K8AA 4DR4L 2R7DA 4AH6A 5ELOA 4B3TL 2ASBA 2JA8G 3FHWA 2JE6I 1VQ5A 4JG2A 4NXMQ 1ASYA 4XTCS 3G6EA 3NENA 2PMZE 2C35B 3PUWA 4QJFA 4A76A 3CD6A 3M4OH 4QY7A 4B3ML 3J81i 4JI0Q 3K0XA 5C3EG 4A3JH 3PIPA 4LFBL 4YWLA 2AHOB 1C9OA 4X65Q 4GOPA 4IFDG 3FKIH 4YCUA 5M5WH 2D0OA 2CCZA 3TRZA 3PO3H 3PF4A 1XPRA 3CMAA 4GKJQ 1C0AA 4GLAC 1N34Q 4BBRH 3ICEA 3E9IA 2UUCL 2UXBL 2F4VL 3HOXG 3CCLA 1TWHH 2GN5A 1KRTA 2Z0SA 3M85A 4X62Q 4LFCQ 1S72A 2JA5H 4BXXH 1UE7A 4A3EG 1YHBA 1PVOA 4LF4L 1YNXA 1LYLA 2WB1E 2WAQE 2Y0SE 3KJOA 4JI2L 4BY7G 2XTIA 1V1QA 4BBSH 1PH2A 4A3KG 1NJIC 3S1RH 1UE5A 4YY3L 1PHJA 1MJEA 4OX9Q 1LUZA 2R6GA 3EIVA 2KCMA 3CCUA 2KCTA 4A3IG 1IBML 2R7ZH 3T1HL 2KBNA 1I5FA 1VQKA 1XNQQ 3MEFA 3RLFA 1UE1A 5FJ8G 3PO2G 4R4QA 1PH4A 2RHSB 4DR3L 3HFZB 4OO1I 2VQFL 3CPFA 3U58A 4HJ9A 3I4MH 1PH5A 1XPUA 2IY5B 2MNAA 1N36Q 4GKKQ 2NN6G 3S2DH 4GOPB 2I5HA 1SFOH 1AE3A 1VQCA 4R4OA 4JI3L 3L7ZC 2F52A 1TWGH 4R4IA 1IXRA 1X3EA 5BR8L 1A62A 4OWWB 2ZM6L 1K3RA 3T1YQ 2B63H 1N32L 4LFAL 3BJUA 3KOJA 3UDIA 1X65A 4YWMA 4HJ7A 4LF7Q 4GNXC 1T9HA 4DV7Q 1VS0A 3HOVG 2RCNA 3DLLA 1H95A 3I55A 1K8AC 4GS3A 4JI4Q 3FKIG 3HOYG 3F2DA 3U4VA 2K75A 5C44H 3F2CA 1QVGA 2PQAB 2E8GA 4YHHL 3I4NG 1ASZA 2Q2IA 4C3JH 4B3RL 3K81C 2MO1A 4IFDJ 4DV3L 1A8VA 2BH8A 3M4QA 3CW2C 1CKOA 1NBWA 3UDXA 1JJGA 4KLKA 4DR5L 3EBEA 3RR5A 1Q86C 4C2MH 4DK6C 4A3LG 4WJ3M 4IPDA 3GTQH 4A3MH 2ZTEA 4PZ7A 2JA8H 4QL5A 1P8LA 2VQEQ 3ULPA 1PH8A 4OONA 4APVA 3G4SA 4X6AH 4PZ8A 1RIPA 2QGQA 4JBMA 3OTOQ 3A5UA 3A74A 5C3EH 5DLQE 1KRSA 4JI6Q 4POGA 1EIYB 2NVTH 1BKBA 1EOVA 1QUQB 1YHAA 2RHQB 4DV6Q 3J7ZC 1J5EL 2HHHL 1E3PA 4HIDA 1IYJB 4DUZQ 1VQBA 1HNZQ 2IX1A 1HNWQ 2OTJA 1E24A 4P75A 4LF5Q 5M3FH 1U5KA 2Z6KA 1VQGA 3HOXH 1B8AA 3RN5A 3S1NH 3HKZE 4ALPA 1QZHA 4DK3C 3AFPA 4BY1G 3CC4A 2RF4A 5HGQA 2JA6G 2UXDQ 2K50A 2KHJA 2E2HH 1IZ6A 1K0RA 4KI0A 1N9WA 2AMCB 2MQHA 4DV5Q 4A3KH 1HJPA 4DV1Q 3KYHC 2CFMA 4PMWA 4A3IH 1OXXK 5JJIA 1Y1WG 1VQDA 3M9BA 1EWIA 1I50H 4TQUS 2B3GA 2Y0SG 1Q46A 1V9PA 1PH6A 1VQJA 2BA0A 3KDFB 3D0FA 4JI8L 1DGSA 1L2FA 2LXJA 5H1SE 4GLXA 1HNXL 3W5OA 1N33Q 1I6HH 5JEAG 2UUBQ 2YYZA 3FP9A 3TEHB 3HOWG 3NBHB 4IPCA 4OO1G 1PV4A 1CSQA 3JAMc 4JV5L 1KL9A 5LMUQ 1EUJA 2YTVA 3H3VI 3AEVA 1XJVA 4A75A 3ER0A 3MXNB 5AJ3L 3CF5A 4NPSA 1K9MC 4LF9L 3S16H 2F3IA 1WCMH 1IBKL 4IJLA 3U4ZA 4AQYL 3VDYA 4A3MG 3TS2A 1JB7A 2DGYA 5LMNL 1XTDA 2UU9L 2N78A 3KF6B 3HOVH 1FVIA 2KHIA 4P71A 1U0LA 1XPOA 4NB3A 4L5SA 3J7A5 1OXTA 4DV4L 4DV0Q 4DR7Q 1CKMA 4KHZA 3A0JA 4DV2Q 3LGJA 1Q8KA 3PCOB 5EAYA 5IE8A 4DR1Q 3HOYH 2CKZB 1MIUA 1TWAH 2JK8A 4C3IH 4LF4Q 3BZCA 3I4NH 1Q81C 2JEBI 2E5LL 1XNRQ 1HR0Q 3ULJA 1VQIA 3I2ZA 5M3FG 1B7YB 1VQ7A 4YY3Q 4MNOA 4LUVA 4K0KQ 5GQOA 3J81j 1YIJA 1VQPA 1CKNB 2QA4A 3T1HQ 1BVSA 4LF6L 4A3LH 1E1TA 3RNUA 3B6YA 4QGUA 4L5TA 1BBUA 1MJCA 1EFWA 3M7NA 4POFA 1YVCA 3AFQA 3K80C 2PQAA 3I4OA 2VQFQ 2YTYA 3UDFA 1G51A 3OYYA 4PZ6A 2FXQA 2ZTCA 1Q1EA 2YV5A 1YITA 3HKSA 1X6OA 4JI3Q 3ULLA 4JBKA 4JI0L 2HIVA 2AKWB 1HR0W 3CXCA 4JI1Q 4X65L 3EN2A 1HZAA 4LFAQ 4DAYB 4LF8L 1IBLQ 5GROA 4BA2I 2UUAL 2VUMG 1SRUA 1SE8A 4ME3A 1XMQL 1P16A 5JEAJ 4BY1H 1FJGQ 2CWPA 2JA6H 3A5ZB 3PIOA 1E7ZA 1WOCA 3M4PA 4A3CG 3TS0A 2JJQA 5M3MG 1WCMG 4X62L 4L5QA 4LFCL 3K7UC 1L1OB 2LXKA 1VQLA 3GTLH 1QUQA 2WP8J 2IHFA 1CSPA 4IOCA 1Q1BA 1GO3E 3HKZG 2ES2A 4LNQA 1Y1WH 2PI2E 4HIMA 3CAMA 4TVAB 3CMEA 4DV3Q 4OX9L 1PH3A 3CCSA 3PUZA 1WI5A 4DUYQ 4DR5Q 4DAMA 1VQHA 3BU2A 4QQBX 2N3SA 1EYGA 1D8LA 1X54A 1X3FA 1XMOQ 4C3HH 1I94L 3J80c 3HOWH 5M5YH 4DR6Q 4LW1A 5FLXc 2I0QA 3H15A 4JOIC 3NELA 2VY3A 1EQRA 5IWAL 2HT1A 1G6PA 3STBD 1N36L 2GVAA 4P72A 1YZ6A 2EIFA 3PV0A 2UXCQ 1HZ9A 1HZCA 3CC2A 4KHPL 3KDFA 4IPHA 1VQAA 3T1YL 2A19A 2OQKA 4L5RC 1I3QH 3RLOA 1EQQA 5IYCG 1K73C 4DV7L 2JEAI 1Z9FA 3CCJA 5J3BA 4OWTB 1OXUA 2Q2UA 1IL2A 1K83H 1KD1C 4UP9A 1VQMA 4X66L 1Q82C 2OTLA 3IRBA 4DR2Q 4JI4L 2K5NA 1KC8C 1SR3A 1SMXA 2AWOA 2CWAA 5ELNA 3KF6A 3KLWA 5GAEC 1PH1A 4R4TA 1PYSB 3RZOH 5JJKA 4R4CA 3S2HH 1S3OA 1X3GA 3UE1A 3PGZA 3CPWA 4JI2Q 4X64Q 5C0XI 4GOPC 1KIXA 4B3SQ 1Q12A 3RZDH 2MFIA 2R92G 4UY8C 1E1OA 2AWNA 4GN3B 4IOAA 5FLMG 3JC66 3S17H 2L15A 4OXPA 4JYAQ 3M3YH 2I5LX 2KENA 4DKAC 2VQEL 3H0GG 4H02A 2JA7H 4GN4B 2NN6I 1PYBA 4A93G 3GD7A 1CKNA 4LWCA 4LUZA 3OTOL 5AJ3Q 3NEMA 2EXDA 2A8VA 4DR4Q 4LF9Q 1VQ9A 2OCEA 1IBKQ 4B3TQ 4HIKA 3I7FA 4EQ5A 1YHQA 1D7QA 1X9NA 2VUMH 5LMNQ 1LM0A 4HJ8A 4DUZL 1HNWL 4JC0A 4JI5L 1PH9A 4B3MQ 4LF5L 1W2BA 1PH7A 3G71A 3L0OA 4A3CH 1JT8A 4LFBQ 2ALYB 5M3MH 1VCIA 1PA6A 1GKHA 2UXDL 3SGIA 4A3BH 4EX5A 4P74A 5IP7G 1TWFH 3J80i 2NZHA 3D31A 2E2IH 2UXBQ 2JA9A 2UUCQ 2F4VQ 3F1ZA 2CQOA 1UEBA 4Y52H 1LTLA 3Q8DA 4LF6Q 3W1GA 1X56A 3I56A 3TREA 3UE0A 2N49A 1L1OA 5IYDH 2OWOA 3TQYA 4NXNL 2R7FA 4A3FH 3GTJH 4GNXB 1N33L 1E22A 2UUBL 1IBMQ 5GAGC 2VW9A 4DNIA 1YEZA 1Z47A 2NZOA 4RG1A 3CCEA 3G48A 5LMUL 3H3VH 1X55A 3PSIA 4JI7L 2IX0A 3L2PA 3PUYA 1NY4A 4DR3Q 1VQ8A 1WFQA 5IYCH 1NE3A 4LF8Q 3S24A 4MZ9A 1VQOA 1S40A 4NXML 4A4IA 2JA7G 3UDGA 2UUAQ 2ZTDA 4IPGA 1QVCA 1XMQQ 3S14H 5E7NA 1Y1VH 1OXVA 5BR8Q 2K5VA 2K14A 4MTNA 2QEXA 4DV0L 4DR7L 3E0EA 1VQEA 2ZM6Q 2R93G 4DPGA 4GN5A 4JBWA 1HH2P 2NVQH 1N32Q 3ERSX 5M5XH 3STBC 1MKHA 4DV2L 1VQ4A 2XGTA 4DR1L 1Q7YC 1YJWA 5IP9G 4AYBE 4GKJL 2OQ0A 1J6QA 3S15H 1N34L 1XNRL 1HR0L 4FDBA 3GTKH 1A0IA 1V43A 3CQZH 3CCMA 3RN2A 3GTOH 1NTGA 2BA1A 2R92H 5IYBH 2ID0A 4K0KL 1GD7A 3AQQA 1A63A 1WJJA 3PUVA 5C0XG 2LSSA 4A3BG 5FLMH 4YHHQ 4B3RQ 5C4XG 2K52A 1QVFA 2Z6KC 3PF5A 1I94Q 1AE2A 3PUXA 3K7AH 3JAMi 2K4KA 1HZBA 3H0GH 1JJ2A 4IJHA 3GDEA 2GVBA 1PFSA 2HQLA 4YCWA 4R1JA 4YCVA 1JMCA 4A93H 3CC7A 2JQOA 5IT9c 5IWAQ 3F2BA 1KAWA 3HOZG 3CCRA 3CCVA 2EQSA 3HOUG 4UP7A 1XNQL 3BZKA 3W1BA 5IYDG 3OW2A 4A3GH 1YJ9A 4KHPQ 2V1CC 3AYHB 4UP8A 4JI1L 4A3FG 3F8TA 1M1KC 1TWCH 3U50C 1IBLL 2Q2TA 4GKKL 1R9TH 2IHEA 4A3DH 2ZJQA 4HIOA 4IO9A 2DUDA 2YU9H 1FJGL 4IFDI 4UPAA 1J5EQ 2N8NA 2HHHQ 4A3JG 5IP7H 1K8GA 4X66Q 2E2JH 1OXSC 1VQFA 3WWVA 4GLVB 4LF7L 4OWXB 2ZJPA 3PO3G 2PI2A 3CP0A 3KF8B 1Y1VG 3PO2H 3GTMH 4J15A 3J81c 4BBRG 2BH2A 2D62A 1CUKA 1NMFA 4DUYL 1G291 4O0AA 1EIFA 4AIMA 2JA5G 1VQNA 4BXXG 2K5HA 1NMGA 5GADC 2A1AA 1M90C 1W3SA 3E9HA 4YWKA 5C4JH 1XMOL 4DR6L 4BBSG 1Y14B 2NVXH 4PG3A 1JJCB 1GVPA 4QIWE 1TXYA 5IYBG 2R7ZG 1OTCA 4JI8Q 1YBYA 1JE5A 1KQSA 1YJNA 1HNXQ 5GAHC 3RLNA 4P73A 1L1OC 2UXCL 3KFUA 1FL0A 2PNHA 4JV5Q 5C0XJ
chains in the Genus database with same CATH superfamily
1B70B 4XZ3B 1DIKA 4LF7H 4J9OA 2BQUA 5KFZA 1K83B 4IHJF 2A73B 5JJLA 4F4XA 2MO0A 3FEWX 4M9UA 1KBLA 1F2ZA 1C7YA 1EIGA 2LY7A 4DUYH 1I4HA 3PIO3 2B63G 1HNZL 2YCHA 2R8IA 3HKZA 2VS1A 1K8MA 1TWFA 2NVYH 2VL6A 1XMOH 2B2TA 4DR6H 3DM3A 4H13C 4WJ4A 3MAQA 5C0XH 2VOBA 1GM5A 3L3OC 3BDLA 3CCQA 3BG3A 1H9SA 2AGQA 4C5CA 5KFGA 3GTJA 3IKJA 2QW7A 3G7LA 3H4BA 3MFIA 3D3RA 3OWEB 4I7HA 1I6HB 2UVUA 4JI7Q 2KHSA 3K8AA 1E4GT 4JW0A 4J0MA 4AH6A 5ELOA 4B3TL 5EPKA 5KT4A 2B2VC 4E6IA 3FHWA 2W9BB 4XTCS 3PUWA 3CD6A 1G2TA 3MFYA 4B3ML 3J81i 1Y8PB 3K0XA 1EZ6A 3NTKA 4I7AA 1TU2B 3I3CA 4OEMB 1DV2A 4ECQA 3AB9A 4X65Q 4GOPA 4K5VA 2Z4IA 3KHRA 2F3WA 3FKIH 3CVZA 2CCZA 3PO3H 2W6PA 1XPRA 1JXLA 2E2IB 4KV6A 5KG7A 1N34Q 2WTFA 3NWSA 2UXBL 3E9IA 1EZ1A 2F4VL 3CCLA 1TWHH 2GN5A 3M85A 4X62Q 5CGKA 3QZ8A 1S72A 1C8CA 3GTLA 1YNXA 2FJZA 2WAQE 2X6GA 3KJOA 3N6XA 4A3FB 2XTIA 1V1QA 3HEJA 4LF9H 1PHJA 2M2LA 4FVMA 3EIVA 4B3TH 1ICFB 3CCUA 2KCTA 4UHVA 2R7ZH 4RUAA 3J81W 1QJOA 5DM73 1VQKA 4LH6A 5EWEA 4B3MH 1XNQQ 3MEFA 3RLFA 3V05A 2FPGB 2BDOA 1EU3A 2PCFB 2L4NA 1NR4A 2OF1A 1ZEQX 4DXFA 4HJ9A 3I4MH 1XPUA 4GKKQ 2B2UA 2CW8A 2I5HA 4JI3L 2UXBH 3L7ZC 4HNTA 4QCLA 4G7OC 1IXRA 4DU9A 5BR8L 2F4VH 2E2HB 1A62A 5EZYF 1W96A 5IGBA 5DEHA 2NTSA 2UVWA 5EBCA 1X65A 3TP6A 4DV7Q 1VS0A 1HFNA 3GTKB 2RCNA 4RGOS 1JKJB 3KXYT 1JLLB 1PTOH 2R92B 4QUFA 4GS3A 1XTCD 4F4WA 4OHJA 1SYGA 3HG9A 3K5OA 4CDEC 1B50A 3FKIG 1S5BD 4RNMA 3HOYG 1ZXTA 4FO2A 3FDSA 2YRXA 4C3IG 2XCPA 1ZETA 4DV3L 4QWEA 4LAAA 4B9WA 3RR5A 5C3WA 3JAML 1Q86C 1EYZA 3MJFA 3GV7B 4TQRA 4DK6C 5BR8H 1EHIA 3M9OB 5ELFA 1K1SA 4O2BF 3M7GA 4PZ7A 4Z9CB 4APVA 1T3NA 4A3DB 3JRWA 2IX3A 3I91A 4PZ8A 2ZDHA 4JBMA 2F0HA 3A74A 5C3EH 3QG1A 4MA5A 2D2CC 4HNUA 4AYBB 4IFDH 1YHAA 4F4YA 4DV6Q 3J7ZC 1E3PA 4LK1C 2K04A 5IGEA 1N56A 3GILA 4EQOA 4P75A 4K6DA 1D2BA 2SDFA 3HOXH 3GTMB 2R7KA 5JQWA 2FP4B 4FNFA 5BPHA 4MV6A 1DV1A 4ODGA 4U6PA 2BE5D 2MP1A 4KI0A 4IWXA 5C4JB 2MQHA 4A3KH 3R5XA 4ED0A 1M4VA 3KYHC 4A3IH 5JJIA 2PW5A 4DL7A 1AP0A 2ZJTA 3T56B 2CZGA 1BNCA 1DYQA 4F87A 2PNRC 3KDFB 4FXGC 4JI8L 4GLXA 1HNXL 1DGSA 3ETHA 2AQ4A 5BN5A 2A74C 4I7ZC 5CBEE 1RTOA 4FM9A 3BJYA 3CF5A 3S16H 3HS0C 2F3IA 4AQYL 3VDYA 2N88A 3A56A 4WRDA 2EZVA 4ZLTF 1JB7A 3TS2A 2DGYA 1B6SA 4TSSA 1OWTA 3RF2A 1XTDA 2N78A 2KHIA 1U0LA 4NB3A 1KLUD 3DEOA 3CKIB 4TKOB 4DV0Q 5IT9E 5LL6S 2EYJA 3OIQA 3R2TA 3W3AA 5C4XB 4HR7B 3ORQA 2BQ3A 4CDCC 4MV1A 2JK8A 4LF4Q 3I4NH 3BZCA 2FK2A 1HNXH 4IRKA 2E5LL 4JI8H 2OH2A 2KCNA 3ULJA 2ENBA 2DLNA 4MNOA 5D3DA 1JR0D 1JC7A 2J4XA 3BVZA 3MHBA 3D6CA 4UAIA 5FLXL 3J81j 3HOUB 1J8IA 1M6VA 3T1HQ 4XYOA 2V4QA 4J9NA 3SVMA 3HB9A 3RNUA 2K1BA 4K8JA 3NQIA 1FKAH 1BBUA 1A15A 1JOQA 3QZ7A 4AQYH 1BCPB 1D1KA 1GUGA 1WD0A 2YZMA 3H0GA 2LFNA 3OYYA 5KFXA 3HKSA 5I6WA 2W6MA 2NBFA 4ZRZA 3OSPA 1KAAA 1G8ZD 1C48A 3EN2A 4MV3A 5H80A 5FOBB 1M0WA 1SE2A 4LFAQ 4DAYB 5HGTA 3V6KA 3SHLA 4BA2I 5GROA 5KFFA 1TWCA 3MWYW 4DK1A 1CQJB 2VUMG 1Y8NB 4BBRB 2E5LH 1FJGQ 1H9RA 4XT3B 4OL7A 5IGGA 2YU9A 3A5ZB 1E4FT 5KFYA 1WOCA 3WDNA 2JA5B 4YAKB 1AFPA 1VQLA 4LFCL 3K7UC 3GTLH 1QUQA 4ZQ3A 1CSPA 4IOCA 1GO3E 2NZ1D 3HKZG 5JAVA 5JPMC 4HIMA 2I8CA 3SI8A 3CMEA 2M9VA 4OX9L 3QJYA 1TS4A 2QYZA 1WI5A 2JYOA 4DR5Q 2VUGA 3PVXA 4QQBX 1SSOA 2N3SA 1R4QB 2NWGA 4O4HF 2F0KA 5JEAH 1X54A 1X3FA 3HOWH 5M5YH 4OO1H 4LW1A 2I0QA 2B2TC 2BE5C 1O80A 3NELA 1TIID 2K32A 3ORRA 3S2DB 4S3SA 5JH7F 2HT1A 1AN7A 1N36L 1TWGB 2GVAA 3TQTA 1S5ED 4P72A 3CC2A 2J6UA 1UNSA 3WNZA 2LMCB 2DNEA 4EBDA 4LFCH 4L5RC 4F7XA 1EQQA 3OUZA 5IYCG 2IL8A 4IZ8A 1GUOA 2EYFA 3JAMW 2DJGC 3UI2A 1EU4A 5EKLA 1CQFA 1VF5C 3H3VC 4OX9H 1OXUA 2R93A 2WAQB 2G9HD 3MXNA 3MWDA 1Q82C 5C44B 2OTLA 3QIAA 2JEJA 3GTGA 3MR2A 4C3JB 5KFSA 1SNDA 2CWAA 3RUZA 5ELNA 5GAEC 3KLWA 2EY1A 1MBYA 1PYSB 2XWBB 3C46A 3S2HH 3MR6A 4JV0A 4GOPC 3EROA 3CPWA 4X64Q 5C0XI 2FMAA 1N36H 1EZ8A 5KG2A 2KEDA 4A3MB 2JA8B 4J9PA 2L9HA 1JB3A 2NVXB 5IYZF 4OXPA 3M3YH 3NHHA 3T5JA 2FJ2A 2VQEL 2OXPA 3Q8RB 3TIGA 5LL6X 4GN4B 3RGXA 2WKDA 1PRTB 1V51A 1ZHSA 4LWCA 3OTOL 4LUZA 5KFWA 5A2QE 5AJ3Q 3L4KA 2B2YA 1B9NA 4EQNA 3EVQA 4HYKA 1I7NA 1VAJA 4LMQD 4EQ5A 3SE0A 5M3FB 5EWGA 1QNKA 1RF2D 1TR5A 2BCOA 4JI5L 1A6XA 1VDZA 1AZQA 1KJ8A 5M3MH 1PA6A 1GKHA 2J7ZA 2VQDA 2UXDL 4RCOA 3SGIA 4A3BH 3RD4A 1V1PA 4RGNA 2XGQA 3V6JA 2B2UC 4PDBA 2ASJA 2R87A 1UEBA 1EL0A 2VQEH 3ONAB 3OIPA 4KY6A 4R8UA 3L4JA 3I56A 3OTOH 3TREA 2A5HA 4JI6H 1MGSA 2OWOA 2Z1CA 2MGSA 4NXNL 4GNXB 1N33L 2X0SA 3M4YA 1RKNA 1XYIA 2EJFC 5KT2A 1YEZA 2WACA 5KFLA 4FXKC 3TMEA 2KUMA 2RSOA 1EY6A 4JI5H 4DXGA 4XYLB 5KG5A 1MI2A 3ND9A 3KALA 2K03A 4HMIA 4EG0A 2UXDH 4LMYA 1NE3A 3NE5B 4KKSA 1WTPA 1VQOA 4NXML 4DV5H 2ZT9C 1XMQQ 2YS7A 1B6RA 3HRZC 4CJ0B 2K5VA 2SNMA 2PPBC 4I4TF 3PZPA 4WD3A 4EGQA 4JBWA 1ILQA 1PMRA 4UCRA 2R8HA 3ERSX 1Q7YC 2YRWA 3T5LA 2B63A 2XGTA 3RIZA 4P2CB 1EUDB 5KFJA 5I2YA 4GKJL 1J6QA 3S15H 1HR0L 3TIIA 4NXNH 1N33H 3NTHA 3NP8A 1BJTA 2R8GA 2P5ZX 1BQQT 3PW7A 4K0KL 3GTOH 4GC6A 5J39A 2Y0SA 3N6RA 1BGWA 1WJJA 4DL3A 1KABA 2LSSA 4A3BG 2A6HD 4DL4A 1F9SA 4ZCKA 1SMYD 5T1GA 1BOSA 1I94Q 3K7AH 3H0GH 4IJHA 3GDEA 1PFSA 4Q5VA 1SYBA 3HOZG 3CCVA 2OEOA 3T51B 5CV6A 2YS6A 4C2MA 5J2TF 3WO0A 3OW2A 4O4LF 1YJ9A 2V1CC 1B44D 3I70A 2JEGA 3F8TA 3QR8A 1TWCH 2W6ZA 1IBLL 1TS3A 4XT1B 1AW7A 4GKJH 2IHEA 3J7AV 5KT7A 1HR0H 1EYDA 4IO9A 2YU9H 4RB3C 5CR3A 3RB3A 3HGBA 4IFDI 4K0KH 2N8NA 2HHHQ 1HA5A 5IP7H 1K8GA 4X66Q 1RJPA 3VA5A 4DLKA 3BDOA 1VQFA 3WWVA 2HD3A 1HQRD 4OWXB 2ZJPA 1B1ZA 3CP0A 4MTDA 3KF8B 3T4AC 4EGVA 4J9QA 1O78A 3J81c 1UNNC 2HVRA 1CUKA 3NGDA 1I4QA 4XYMB 4O0AA 2R86A 2PQEA 1EY0A 2C00A 3KLSA 4BBSG 2MHVA 3GV6A 1UAPA 4IRDA 1JJCB 1IBLH 1I50A 1HTPA 1IW7C 5KNCA 1YJNA 1L1OC 1CQVA 5KFHA 5CB4F 4F8MA 5KFVA 2EQSA 4JV5Q 3U9TA 2I5MX 4ME6A 1WR2A 1SN8A 2NVTB 2R93H 2HCIA 2YZGA 3E5SA 5CV7A 3KLRA 3VYRA 1WCMA 4A3EH 3GTPH 5L1JA 2HDLA 5C3XA 3GTGH 4DR2L 3GIKA 2ASDA 3C1EA 4BY7H 2F1MA 3UFXB 2QCPX 4RNNA 5EWFA 4DV4Q 1PZID 4BA1I 1AH9A 4ZOLF 3X3NA 1O7IA 2Q2HA 2YTXA 3OMCA 2HIXA 4RMFA 3K57A 4JI2L 4B3SL 1PVOA 2WB1G 4O2DA 5BPFA 1LT4D 2ATWA 1C30A 5KG3A 3S17B 1ONLA 3VR5A 1GJXA 4PV1C 2JA7B 2NB0A 2D0PA 1I6VC 1BXRA 5DG9A 4RB0A 4DR4L 3R93A 4O1NA 3NTIA 3U9SA 2WYOA 1DM0B 1T5XD 5DG8A 5KG1A 2A6HC 1TVXA 2JE6I 4CHTB 1VQ5A 2NU7B 4DR2H 3M4OH 1QOHA 4QJFA 4QY7A 3BA8A 5IT9W 4JI0Q 1O7YA 1F2YA 4A3JH 4LFBL 4YWLA 3GV8B 1QWYA 1JORA 4OELB 2DPJA 5M5WH 2D0OA 4JI2H 1KDBA 4B3SH 3R23A 1SNCA 4RHRA 4C1NI 3VR4A 4O4IF 3J80L 1KRTA 2Z0SA 1DONA 1CM9A 1EY8A 1SYFA 4R9WA 1UE7A 4A3EG 1YHBA 1LTTD 1RHPA 1LYLA 4MV7A 5KYIA 1RODA 4BY7G 4UFZA 3T5HA 2J6TA 4DR4H 4MA0A 3S1RH 1MJEA 1LUZA 1RTNA 2KCMA 3PQIA 1IBML 1K3BC 1I5FA 1E4EB 1B04A 1U4PA 2F0EA 5FPOA 1NAPA 1PZKD 3TP7A 4CDDC 3PO2G 4LFBH 2RHSB 4DR3L 3HFZB 4OO1I 1ILPA 3PW0A 4NW2A 2VQFL 4ABNA 3CPFA 1Z2PX 4LH7A 4V0BA 3S14B 4JVZA 2QILA 1AE3A 1SYEA 1W6JA 1SNMA 4R4OA 1FNUA 2NVQB 2EVBA 4OWWB 4J1MA 1N32L 2B63H 3HP3A 3BJUA 5DQGA 3KOJA 1JOOA 3E5NA 1MSHA 2K5WA 3ZYYX 4DNTB 4RAUC 4LF7Q 4FF3A 1U4RA 3HOVG 1LTRD 3CQZB 1H95A 2B2YC 2SOBA 3QO2A 5JPNC 2AQ3B 1IBMH 1TKWB 4JV1A 3F2DA 3QOLA 3U4VA 2K75A 1L2ZA 3GQCA 1QVGA 2PQAB 1GSOA 1ASZA 2MO1A 4DR3H 1A8VA 3M4QA 3G6XA 4A93B 3CW2C 2VQFH 3RAXA 3EBEA 4C2MH 4XDXA 5L1LA 3T53B 4A3LG 4Q0FA 4IPDA 1NR2A 4X3TA 2ZTEA 4ZKCB 3MWEA 4K14A 1WSCA 5GONF 1N32H 3J7YW 4OONA 2DWCA 2PYKA 3Q8PB 1RIPA 3A5UA 1RYRA 4JV2A 1RJQA 3HZXA 4PQXA 4NP5A 1SDFA 1XWEA 1I3QB 2E2JB 4HIDA 1VQBA 1HNZQ 1HNWQ 2VUMA 5T14A 4LF5Q 1U5KA 4IZOA 1VQGA 3RN5A 3S1NH 5EDWA 3HKZE 3MZ5A 4ALPA 4DK3C 3GIQA 3AFPA 4BY1G 3CC4A 5HGQA 2JA6G 1GLVA 3AMUA 1LABA 1K0RA 1I6UA 2P0AA 2AMCB 5CBAE 2CFMA 1A2UA 2AUKA 3JSLA 4OIJA 4EFEA 1Y1WG 1ZYRC 4Q43A 3M9BA 1I50H 4HSVA 4DL5A 3LWBA 2B3GA 2Y0SG 1S9FA 3RV4A 5A2QW 1V9PA 3D0FA 1L2FA 1QILA 1LACA 5H1SE 1WTQA 1RK5A 2R82A 4U7CA 1I6HH 3FP9A 3TEHB 2F0DA 4C3HG 4IPCA 1PV4A 3JAMc 1EY7A 1KDCA 3DHQA 3T16A 3EJIA 1XJVA 4DF7A 2W71A 1A9XA 4ECSA 1PDQA 1K9MC 4LF9L 3BG5A 1WCMH 1SJHD 4G7HC 3U4ZA 1EY9A 1IBKL 5LMNL 1GUWA 4IR1A 2NVYB 3KF6B 1Q8IA 2XRSD 2A68C 4R8NA 4JK1C 3G6YA 3LGJA 1Z6HA 3HOYH 2CKZB 2Q8RE 5FLXE 4C3IH 2F3VA 1PFMA 1XXGA 5BN4A 5JVG3 1VQIA 3I2ZA 1QNUA 4LUVA 5A35A 2PN1A 2J0TD 1BVSA 4LF6L 3T5KA 1RJTA 1E1TA 2ALZA 4QGUA 4L5TA 1MJCA 5D1OB 3M7NA 3AFQA 1IBKH 1G2SA 2FB9A 4PZ6A 5LMNH 2FXQA 3M9NB 3MWMA 1WD1A 3MA2B 5E3FA 1YITA 3VPCA 4F50A 3K58A 4JI3Q 3ULLA 4JBKA 5DLGA 2HIVA 2AKWB 3IFDA 3CXCA 4X65L 2W7OA 1HZAA 3PO3B 4LF8L 2BOSA 1ZQ7A 1KC7A 4JUZA 1Y1VB 2UUAL 1ENFA 1SE8A 1SRUA 4ME3A 4J9KA 1R9TA 4IAJA 4G4KA 2CWPA 5G3LD 4KY7A 1ML0D 3VR6A 3TS0A 3ETJA 4DL6A 1WCMG 4X62L 5JVDF 4LF6H 4MAMA 5KT3A 1SNQA 4Q0YA 3BAAA 2ZDGA 1TT2A 2M05A 4LNQA 5KT5A 4ED2A 4TVAB 1AUXA 4DV3Q 2FK1A 3DWQA 2R7ZB 4MV9A 3PUZA 4KKTA 4DAMA 5KFQA 2EY5A 4UCUA 4Q45A 4X65H 4ED3A 5FLXc 3WOEA 2F0WA 3I4MB 1RJRA 3ITPA 4ID6A 4U68A 3RB0A 4LF8H 2NVXA 3SK8A 1EQRA 5IWAL 2UUAH 3KHHA 5J22A 4A3GB 4ZI7F 1YZ6A 2KA7A 3PV0A 2UXCQ 1HZ9A 1HZCA 4RH6A 5KG4A 4ZYSA 4G3IA 4FS2A 4X62H 4YR2A 2EJMA 3Q8QB 4GZYC 3VYSA 4ILWA 3NBHA 1BO0A 5EJWA 4DV7L 1QE6A 1PTOB 1GYFA 4DA2A 4OWTB 2Q2UA 3G8CA 3QWNA 1UC9A 3R8BA 5EKIA 5FO8B 1H9JA 5BN3A 2K5NA 3TINA 1SR3A 2F0PA 3OUUA 4N9PA 3RZOH 4KD4A 3UE1A 5IWAH 2MFIA 2R92G 1WVLA 4ECXA 4IOAA 4CKEA 2ZXRA 3BA9A 2L15A 4JYAQ 2KENA 4DKAC 4QIWA 1KJ9A 5C3EB 2V59A 3C3LA 3VMMA 1CKNA 4DV7H 1D6EC 2EXDA 2RDGA 4IRCA 1BCPD 4GC7A 2RQXA 2VXWA 1NUCA 4YIJA 3J7AK 1X9NA 2VUMH 2AGOA 1LM0A 3GIMA 1PRTF 2L12A 2PO4A 3HOXB 4JC0A 5NUCA 1KJIA 3I73A 4K8IA 2NUAB 1W2BA 3L0OA 1KJJA 4O3NA 1VCIA 1TWFH 2CH4W 4A3KB 5CA1F 2EYPA 3V4SA 3D31A 3S1QB 4A3IB 2UUCQ 1KLGD 1EWHA 1PZJD 4Y52H 2Z6BA 4R7RA 3Q8DA 1MZBA 4X3KA 5CV8A 1YNJD 3VYTA 3GIDA 3UE0A 2N49A 1L1OA 3VA7A 4BWSC 4WBNF 3GIPA 5KGUA 4ZUJA 3NK9A 2R7FA 3GTJH 4DK0A 3MVVA 5T1IA 3OW7A 2XSCA 2A69D 5IGDA 5HURA 2NZOA 3CCEA 1Y69U 3H3VH 2KSWA 3S16B 4RCNA 1VBGA 3GQBA 1XX8A 2C22A 1NY4A 1S4ZA 1WFQA 2E75C 4ED6A 5IYCH 4EEYA 2DPIA 5KKNB 3KK7A 2PMZA 4MZ9A 3UDGA 3DXJC 2ZTDA 4IPGA 4UCTA 2I46A 5DM63 1CA6A 1OXVA 3FMCA 4Q44A 1WTRA 1SFOA 4DV0L 3URYA 4B9XA 3E0EA 2ZM6Q 3HBLA 4DPGA 4GN5A 5M5XH 1UEAB 3I4NB 1KNAA 1VQ4A 1H9SB 5IP9G 2VPQA 2OQ0A 5LXTF 4FDBA 3K5LA 1HRJA 1V43A 3A55A 2ID0A 2WB1A 1GD7A 3AQQA 1S0NA 2CQAA 2ZXOA 4YHHQ 4B3RQ 5C4XG 3P75A 2K52A 2J9GA 1AE2A 3JAMi 1JJ2A 4YCWA 2JXMB 2RA4A 2QDLA 1CQIB 3J7AF 4YCVA 2ATLA 2JQOA 5IT9c 3F2BA 2R85A 3HOUG 5ELBA 4CJ2C 4O3PA 4DV0H 1JCKB 2XCAA 3GTQA 5LP6F 1HQMC 1PRTD 2Q2TA 4LF4H 1KEEA 1R9TH 1Z2NX 2N55A 2ZJQA 5IGCA 4HIOA 3H94A 1FJGL 1QG7A 1KNEA 1FR3A 3VR2A 4UPAA 4CBVA 1J5EQ 1S0OA 1A3VA 1KJQA 3T1HH 2WKCA 5C8YF 3RFCA 4GLVB 2R8JA 2WINB 3JRXA 2XNAC 4J15A 4BBRG 4M8AA 2BH2A 3K3VA 4KHVA 1NMFA 5J2UF 4AIMA 2JA5G 4BXXG 3C2PA 1NMGA 3HOWB 5M5YB 3R3OA 3K6OA 1B33N 2IP4A 3D6WA 1TS5A 2NVXH 4LFAH 2L1BA 4ECYA 4IR9A 5DG7A 1ET6A 1FJGH 5GAHC 4P73A 5DQHA 1FL0A 2FK3A 2PNHA 5C0XJ 2F03A 2TSSA 2WFWA 1VQ6A 3S1MH 4JI5Q 1YI2A 4JI6L 2IWHA 2DIKA 1IL8A 4C56C 5L9XA 2A69C 3BVMA 1KXLA 1SROA 3CRKC 4XIGS 1C3OA 1S10A 2VZAA 1ENCA 3PR5B 2F0GA 2UU9Q 3IN5A 2M00A 2RKSA 1DOMA 4YAJB 5IY0A 4HTHA 2Q8TA 2VNUD 2J6SA 3S2HB 4Y7NH 4MHEA 1U4MA 1FGUA 4X64L 4ED8A 5CYUA 5DLFA 4EFBA 3PMFA 1LT3D 2WAQG 4LSAA 2B29A 4U673 5FJ8H 4EVOA 5EPJA 3KJPA 4DV5L 4YP3A 2FLPA 4IN3A 5C44G 4DV1L 1SE4A 4NXNQ 1UWVA 2E74C 4C3JG 4JCVE 3HOZH 5FD5A 3RGZA 4HJAA 2I87A 2NN6H 2QF7A 1L0WA 1RL2A 5K36G 4JBJA 1KDAA 3GO5A 2WE6A 1CTMA 1E4EA 3BQ2A 1B3AA 2DNCA 2PZWA 2ASBA 3NWTA 2JA8G 4TV9F 3IFTA 4NXMQ 4JG2A 1ASYA 3G6EA 2K6AA 3NENA 3PW2A 5M3MB 4KD3A 3Q23A 3BYTB 3PIPA 1C9OA 5KFTA 3M9MB 1PFBA 5CV4A 4X64H 5FLXW 4WFN3 3J80E 3PF4A 4GKJQ 1C0AA 4DV1H 5LYJF 3ICEA 1IOVA 4EGJA 3TSSA 2GPWA 1G91A 2JA6A 5EGTA 1PRTC 1TWAB 2VB2X 2R6FA 4PNYA 1FYCA 1SAPA 2Y0SE 4H0LC 4BBSH 1PH2A 1NJIC 2CQYA 3BZDB 3JZIA 1BUVT 4YY3L 1Y1WA 2R6GA 4R8IA 4TUYF 4JPBW 3MFHA 2B2WA 1RCVD 2KBNA 3MC0B 3T13A 1F9PA 4KJOA 5FJ8G 2W9CB 4R4QA 3LWUA 1FGBD 5D3IB 3U58A 2E76C 4QWBA 1ZKOA 2MNAA 5C6AA 2NN6G 1SFOH 1R4PB 1V8QA 4KMUC 3N41B 2L0CA 4QWCA 1K3RA 3T1YQ 1F9QA 3S15B 1I3QA 1Q90A 4YWMA 3UDIA 4HJ7A 1SNOA 1CT1D 4GNXC 4N8FA 1VF7A 1UUPA 4HEDA 3K0YA 2MPMA 2B8FA 3DLLA 4LSXA 2C2DA 4YY3H 3GTOB 3I55A 2FMMA 1K8AC 5CV5A 1K83A 3EPGA 2AUJD 4JI4Q 2VB3X 1JICA 1VMCA 2DY8A 2BDNA 3K7AB 1JQYD 2Q2IA 3H0GB 4TV8F 4IFDJ 1T94A 2BH8A 1CKOA 1NBWA 1JJGA 3LNNA 4ZAIA 2CW0D 3MEHA 4XXEA 1XMQH 1FD7D 1U4LA 2CVRA 5KRUA 2W8LA 4ZQIA 2W9AA 1AEXA 2TMPA 1BXTA 3GTQH 3BYYB 1TQOA 1TWCB 3U9OA 4QW9A 3ULPA 1PH8A 3G4SA 2JSOA 2YU9B 5E1FA 5M9OA 4L63B 3TBIB 5KFBA 3MXUA 3V6HA 1EIYB 2NVTH 1BKBA 1EOVA 1QUQB 2RHQB 2HHHL 1EUCB 3TN2A 5D14A 4CJ1B 4DUZQ 2OTJA 4H7BA 2IX1A 1B9MA 3ERQA 2Z6KA 3X3MA 1B8AA 2W9BA 4QWAA 5HBRB 2V4DA 2RF4A 1EYCA 2KECA 2KHJA 3Q1KA 2XC9A 1IZ6A 2EY2A 1N9WA 1HJPA 1GUNA 5KT6A 4PMWA 2E2IA 2OT2A 3MTSA 1PLFA 4TRDA 3RZDB 5KFMA 4DGZA 3NUCA 1RD9D 3RJ0A 4TQUS 2RGVA 2B39A 3KBGA 1TA8A 1GHJA 4UCOA 5ELEA 5DAUA 3PO2H 3A8IE 3OHAA 3E3XA 3H4DA 2LXJA 4APMA 1T36A 1TY0A 3A8JE 2UUBQ 2YYZA 2HHHH 3A8KE 4X66H 1SBBB 1CSQA 2B8GA 4JV5L 5DNFA 1KL9A 4ZKBB 5LMUQ 4NKLA 1EUJA 2YTVA 3H3VI 2R93B 3AEVA 4A75A 3MXNB 4NPSA 3GTPB 4IJLA 5KFOA 3GTGB 1SMYC 2EYHA 3HOVH 4O2AF 2K5DA 2K01A 4L5SA 4FF1A 1JE4A 1OXTA 4DV4L 5E4XA 1CKMA 1EYAA 4DR7Q 1Y1VA 2MJ8A 3A0JA 4CKBA 3N8DA 4ZHQF 4DV2Q 4OIKA 5EAYA 4DR1Q 2YL2A 2E2HA 1MIUA 4G57A 1Q81C 4J6HA 3VYUA 1XNRQ 4C5AA 2RDHA 1VQ7A 1V4YA 3GTKA 4RZRA 4FYDA 4JV5H 2QA4A 1M0TA 5LA6F 2R92A 3SDZA 4A3LH 1IKMA 4F4ZA 3KAKA 1B4OA 1EFWA 1Y8OB 4QB4A 2YZNA 1IHZA 4POFA 1YVCA 2R7NA 3K80C 5KFPA 3I4OA 4L1KA 2VQFQ 4NMZA 3M4OB 2GA4B 4RKBA 2ZTCA 1BNZA 3GIJA 1SJED 1SYCA 2YV5A 1E2VA 4A3JB 2QK4A 4YR3A 5FD6A 4DV4H 4JI0L 2KCCA 1HR0W 4JI1Q 5M5WB 1V1PB 1ESRA 2RGRA 3J81L 3K5MA 1I4GA 1BR9A 3H09A 1K8OA 2PZUA 4DAVA 1S68A 5JEAJ 4BY1H 3V2TA 2JA6H 3MFGA 1W93A 1E7ZA 3M4PA 4O42A 5JUMA 4A3CG 5IGFA 4AYBA 1EY5A 5CORA 3FVQA 1C4QA 2IHFA 1EQTA 1Q1BA 4B08A 3S1RB 1Y1WH 1EWCA 2PI2E 3N43B 3CAMA 1DCZA 4NDXA 1CE8A 1PH3A 3GTMA 4ULLA 4CGYB 4DUYQ 1VQHA 2XIWA 2F0SA 1W6KA 4JI0H 3RAQA 4MTKA 1F77A 4KTAA 4C3HH 4F88A 1XMOQ 4DR6Q 3K3PA 3QFFA 3P1HA 3H15A 3FPUB 2D5DA 4HAEA 5KEEA 5BMVF 3STBD 3NSWA 4K5XA 4ME5A 2C9OA 2EIFA 2LKVA 1GGOA 3RBDA 2V58A 2B63B 4KHPL 3SE7A 3KDFA 4YQWA 1VQAA 5F2DA 2A19A 2HCCA 1I3QH 3RLOA 2C2RA 3PIP3 2VPSA 5JVLA 1K73C 2JEAI 2X6LA 1Z9FA 4Q8FA 3CCJA 5J3BA 2RDJA 2PZTA 1IL2A 1SEIA 1IYUA 2Y0SB 1K83H 3TP5A 4XQJA 2EDGA 3IRBA 1F2MA 5D8DA 1KC8C 3MR3A 3R2IA 1SMXA 1PTOF 2AWOA 5G3LF 4R4TA 2I80A 3S9WA 4IQZA 4MIUA 1S3OA 1KIXA 3P20A 4C2MB 3IL8A 1Q12A 2RBMA 3KBXA 1GOZA 1E1OA 2K33A 2AWNA 4HR7A 4GN3B 5FLMG 4HQ6A 3BQ0A 4KHPH 3JSNA 5L1KA 4LJZC 2I5LX 2IPKD 1E0BA 4O3OA 2NN6I 4MV4A 4O3RA 4A93G 3WO1A 3GD7A 4EYIB 2A8VA 4LF9Q 1DOKA 1V1OA 5KYLA 1IBKQ 3GP7A 4B3TQ 3RUPA 4YR0A 3I7FA 5ELDA 4ECWA 3OPOA 5LMNQ 3GLKA 4A2BA 2B2WC 1HNWL 3S1NB 4FXDA 1IOWA 4B3MQ 1PH9A 4KN4C 4LF5L 2F0OA 1PH7A 3G71A 1JT8A 1STNA 2ALYB 4ECTA 2UVRA 1ENAA 1LV9A 2FKLA 1ESFA 3OSOA 4P74A 2PW7A 2EYOA 4DAYA 3RV3A 4IUNA 1F2LA 3J80i 1Z2OX 4C5BA 3GV5B 2E2IH 2UXBQ 2JA9A 4EBCA 2F4VQ 3F1ZA 4J9MA 1I50B 3SK6A 1LTLA 1RDPD 1MHWC 4LF6Q 4MV8A 4ECVA 2JA5A 3I4LA 1B2TA 1X56A 4C1NK 1EEFD 3C0FB 5IYDH 3SK4A 3RTXA 3TQYA 4IUQA 4I55F 2F0JA 3H6MA 4A3FH 1GHKA 3I72A 1WTVA 5GAGC 4RAYA 4DNIA 2L5TA 1Z47A 2O5JC 1HNWH 1HNZH 3G48A 4WJWA 1I7LA 2W6NA 4CKCA 2JEFA 4LF5H 1NNXA 3PSIA 4JI7L 1WCMB 2IX0A 3L2PA 2JP1A 4Y8VB 5LL6b 1VQ8A 3G6JB 1WTXA 3J80W 2R3ZA 4LF8Q 1HUMA 2SNSA 5FO9B 2C28A 4A4IA 2E2DC 2UUAQ 1SCUB 4V190 1MSGA 4TQSA 4J9RA 1Y1VH 1GXDC 2EPBA 5EQ0A 1DXMA 5BR8Q 1BCPF 2K14A 3FKIB 2QEXA 3HOYB 1K1QA 1VQEA 1VBHA 1TWGA 3KAJA 2E2HH 4CDFC 3STBC 1MKHA 4C3IB 3Q0AA 2F0NA 1II3A 3CU7A 1JOKA 2VA2A 1PFNA 1PTOD 1N34L 1TWHB 2HVSA 3GTKH 5DQIA 5C4ZA 2HVQA 3RN2A 1NTGA 2BA1A 2R92H 1CHQD 2WAQA 3Q22A 1A63A 5C0XG 3H40A 3GV3A 1A3TA 4JI7H 5KNDA 1QVFA 2Z6KC 3PF5A 2IA6A 1LTSD 2K4KA 3K59A 1IYVA 1JMCA 2GVBA 2HQLA 1CI3M 1PX2A 2W70A 3VPBA 5IWAQ 1KAWA 3CCRA 3UQ8A 5KFAA 4QMGA 1XNQL 3BZKA 2FINB 3W1BA 5IYDG 4A3GH 1JIHA 1ET9A 2EXZA 1O75A 2I07B 4A3FG 2EYLA 3WOFA 3I90A 4RGTA 2A6ED 3TZDA 4GKKL 1H9KA 4A3DH 1N34H 2YW2A 2DUDA 1S5DD 5C1OA 2ZDQA 3R5HA 3F8NA 3HXLA 4UCVA 3GIIA 3EYYA 3PO3G 1Y1VG 1PXUA 2R7LA 3GTMH 2QDBA 4XQNA 2MCTA 1BDOA 4DFAA 1XNQH 5GADC 2A1AA 4JI3H 3E9HA 2FE3A 5C4JH 4QWDA 3KHGA 2R8KA 2WIIB 2JEIA 2F0VA 3MR5A 2XVSA 4PG3A 4J9SA 1GVPA 5FPRA 4GKKH 4QIWE 2R7ZG 3P7JA 1OTCA 4JI8Q 1YBYA 1JE5A 1KQSA 1HNXQ 2EYMA 2UXCL 5I47A 3DWPA 4K2LA 4YJ2F 1ICWA 4GNXA 1KHIA 3V96A 2W7PA 1NCVA 3F2UA 1WTWA 3I4MG 3VPDA 1CS0A 3PW5A 4DV3H 4FBUA 4AQYQ 1QZGA 4A3GG 4O3QA 4DV6L 3RB6A 1S03G 5IP9H 3OSNA 3QB3A 4PWQA 1UE6A 1STYA 4E4TA 3DF7A 4A3DG 3RZOB 5C4HA 2H5XA 4ED1A 1SLJA 4JOIA 3S1QH 4UCSA 4QW8A 5KFUA 2K05A 1BBWA 4A2AA 5CV9A 3OHBA 1AZPA 4AYBG 1WYDA 2HQEA 4DAPA 5C4XH 3M4IA 1TWAA 3ZJYC 2SCUB 2E5LQ 1N8RC 1JDBB 5HY6A 2UXCH 3OOCA 4IALA 5C1PA 2O4XA 4LUOA 1F9RA 4JYAL 4M1UB 3VR3A 1PTOC 3HOUH 2IT1A 5LMNW 4HJ5A 4X3SA 1DJRD 2ZJRA 1DOLA 2NYZD 5DGAA 4RFBA 2BQRA 2R7DA 1M7JA 2FMCA 3FPPA 4FF2A 3N44B 4DV6H 2VUMB 2NUCA 3O13A 5IODA 2QKIC 5ISRA 1G6PA 5I2XA 5L1IA 2W57A 2PMZE 2C35B 4A76A 1SE3A 4RHSA 2OLSA 5C3EG 3TZUA 2GLTA 2AHOB 3DWAA 2XN9C 5KFDA 5JJZA 3HKZB 4YCUA 1TWFB 3NQTA 3LX0A 4IFDG 3SEBA 2XCLA 2W8KA 3TRZA 3NBIA 3CMAA 3A7AB 4GLAC 4BBRH 2UUCL 5KFEA 3HOXG 4JYAH 2A6EC 4LFCQ 2JA5H 4BXXH 3GTOA 5D65A 4LF4L 2WB1E 3GTJB 4FP5D 4A3KG 4OX9Q 1SXTA 1UE5A 5K2MA 4ZUIA 5J1ZA 3C1FA 3KF8A 4A3IG 3T1HL 1GUSA 5I9PA 2O5IC 2VA3A 1UE1A 5KFKA 5LOVF 1PH4A 3SXHA 3BDCA 2XRQD 1CZWA 2EE1A 1PH5A 2IY5B 1O7LA 4G7ZC 1N36Q 4RU9A 1CHPD 4GOPB 3S2DH 1VQCA 3N52A 2UUCH 2F52A 1TWGH 4R4IA 1X3EA 3D4WA 5M5XB 2ZM6L 4FU0A 4LFAL 2C2EA 2DY7A 2NU9B 5ELCA 4ETSA 3H91A 1T9HA 2HJWA 2BR0A 1IKLA 2F4IA 5F9LA 4YB8B 3K5IA 3DUZA 3NXWA 3GTLB 1GSHA 2RVLA 3KTMA 2H1EA 3W2DA 5I4DA 3F2CA 5IIFA 5C44H 1BCPC 4O3SA 2E8GA 2EOTA 4YHHL 1HTLD 4C3JH 1CK1A 4ZK9B 3I4NG 4B3RL 1MD2D 1D5MC 3K81C 4M7EA 4ED7A 1E2WA 3Q6SA 3UDXA 4KLKA 5K36H 4KKUA 4DR5L 1LT6D 1OO9B 1QCBD 1VKZA 2Q8IB 4IUPA 4WJ3M 3PN1A 4A3MH 2ZM6H 2JA8H 5CAEB 3PR4A 4QL5A 1P8LA 3OMGA 2VQEQ 1D5ZC 1R9TB 3G6VA 2ICEC 4X6AH 2JA7A 2QGQA 4CC6A 1D5XC 3OTOQ 2GPSA 5DLQE 1KRSA 4JI6Q 4POGA 1EOTA 3KHLA 1J5EL 1YNJC 5CA0F 5KIXA 1IYJB 2H4OA 3DM1A 3GTPA 1DZ1A 1HFGA 1E24A 5M3FH 4YHHH 2IMWP 4B3RH 3V4ZA 1QZHA 2RSNA 1J9OA 2SEBD 1G6ZA 1SYXB 2UXDQ 2K50A 2V4RA 4DR5H 2DZDA 5FKAC 2G9DA 2ZXPA 1LT5D 4DV5Q 1FNVA 1X32A 1ZHQA 4DV1Q 3IG0A 2F0QA 1OXXK 3I12A 1VQDA 4ECZA 1EWIA 4EQPA 3ND8A 5CMDA 1Q46A 1K0SA 1O7ZA 1RK6A 1Q3LA 1PH6A 1VQJA 2BA0A 4RB2C 4HCSA 3M3YB 3N42B 3W5OA 1N33Q 5JEAG 3OHXC 3RBEA 4PMBA 5KG6A 1J5EH 3HOWG 1TY2A 1STGA 3NBHB 2R61A 4OO1G 3S1MB 5KG0A 2Z4HA 1S5CD 2NTTA 3ER0A 5AJ3L 2G5DA 3KUPA 1LLRD 3EQLC 3OWFA 1EIHA 4A3MG 1UC8A 3EPIA 2AQ2B 3RMHA 1I4PA 2UU9L 1FVIA 1LTGD 4P71A 2K7VA 4Y7NB 1XPOA 3A54A 3J7A5 1IW7D 4KHZA 2ASLA 4A3BB 5EPLA 1Q8KA 3PCOB 1M8AA 4HSPA 5IE8A 2R7MA 3Q2OA 4FS1A 1TWAH 4ECRA 3CHBD 5IT9L 2FFKB 2K28A 2L11A 5L37A 2JEBI 1HR0Q 5M3FG 4QIWB 4MTEA 1B7YB 4YY3Q 4I50F 3HOZB 4K0KQ 5GQOA 1YIJA 1VQPA 5COYA 1CKNB 3IAYA 3CQZA 3EFXD 2HUGA 3BQ1A 3I8ZA 3K5NA 1S97A 4XYQA 3B6YA 1STHA 4EEQA 2PQAA 5E4WC 2YTYA 2JN4A 3UDFA 1PK8A 1G51A 1EEID 3D4RA 2AU0A 1I4RA 2FLNA 2UU9H 1EQVA 2FHTA 4KJNA 3J81E 1Q1EA 1X6OA 1X3QA 5CC4A 2F0UA 1NSNS 2W6OA 1IBLQ 2XD4A 1DD2A 4BS9A 2KVMA 1XMQL 1P16A 4RA8A 3PIOA 4HMJA 2JJQA 5M3MG 1CFMA 4L5QA 1L1OB 2LXKA 3BS1A 2AQ1B 2WP8J 4QUCA 5I6YA 1HHVA 4BBSB 2ES2A 1WTHA 4IUTA 2F0MA 1QB5D 1WTOA 5JOBA 4RZQA 3H20A 3CCSA 2B2VA 2ICIA 3L9AX 4NXMH 3BU2A 5FK9C 1STEA 1EYGA 1D8LA 2W9CA 1I94L 2PMZB 3J80c 4J8QA 4JOIC 1A3UA 5EKKA 1H9MA 3D4DA 2VY3A 1B3QA 1CZGA 2CW7A 1SFOB 2KEEA 4RGMA 2NU8B 4NLGA 4YJ3F 4FF4A 4L6TB 4IPHA 1JDEA 1EFID 3T1YL 2OQKA 2V5AA 4Q8EA 2IBKA 1K28A 3EA6A 2RDFA 2WB1B 4I65A 1ULZA 1KD1C 3K5HA 4EYHB 4UP9A 1VQMA 1LTAD 4X66L 4DR2Q 4JI4L 3LMLA 4WORA 2PVPA 1EY4A 4QF4A 4XQQA 2NVYA 3KF6A 1I94H 1PH1A 1YNND 3E6ZX 5JJKA 4R4CA 5TSSA 1X3GA 3PGZA 4JI2Q 4B3SQ 3DEPA 2L55A 1PYWD 3RZDH 5C5LA 2F0TA 2HDMA 2K5QA 2YYAA 4UY8C 2Z9HA 2VR1A 5KX5F 3GTQB 2F0FA 3JC66 2HGSA 4RB1A 3S17H 5HV6A 3T1YH 4N8X1 2JA7H 3H0GG 1SEBD 4H02A 5C5JA 5KFIA 4ECUA 4EBEA 1N48A 1PYBA 3NEMA 4DR4Q 4KY5A 3R5FA 2IW3A 5LHY1 1VQ9A 2OCEA 4HNVA 3CRLC 1I4XA 5D1OA 4HIKA 1YHQA 2V9WA 1D7QA 5KFRA 4JI4H 1BF4A 5A2QL 4HJ8A 4DUZL 1HXYD 5KFNA 4IURA 4RAZA 1SYDA 4A3CH 4LFBQ 4A3EB 4L8JA 2O2LD 1S5FD 3BVGA 4BY7B 3FKIA 4EX5A 1HPCA 5IP7G 2RCFA 4N9TA 2NZHA 4BWGB 2D9UA 2F0LA 2FPPB 2CQOA 5AFWA 4XX0B 3LP8A 1B53A 2EY6A 1TWHA 4RUCA 2CH4A 3W1GA 3PO2B 1CA5A 2C5CA 1X3PA 1KTKA 5EBDA 2LS01 3BABA 2UVVA 2PBZA 5D1PA 1E22A 2UUBL 3PW4A 1IBMQ 2VW9A 4DUZH 4RG1A 5LMUL 2R7ZA 1X55A 1BBXC 2QEJC 2DJFC 1L0YB 3PUYA 3QOJA 1HA6A 1T5EA 4DR3Q 2RDIA 1AUVA 5KFCA 2IJ0A 5DGBA 1A2TA 2KOLA 1TAEA 3HOVB 3S24A 3Q24A 1STAA 3FRPB 1ZYRD 4IUUA 1S40A 2JA7G 3AU7A 3SR1A 2MUYA 5F9NA 1QVCA 3TP8A 3S14H 5E7NA 3NPPA 3MXGA 4HN7A 2DN8A 3FDTA 3E0JA 4MTNA 1STBA 4DR7L 4K5WA 2R93G 4IUVA 2CW0C 2NVQH 1N32Q 1HH2P 4DV2L 2NU6B 4DR1L 4RWSC 1L0XB 1YJWA 1HUNA 4AYBE 4DL2A 2F0IA 1XNRL 3FMAA 4R8UB 2UUBH 1A0IA 3CQZH 3CCMA 1SNPA 4DN4M 5IYBH 2XGPA 3N40P 4PMCA 5LMUH 3PUVA 2FPIB 5FLMH 5C5MA 5EOYA 4UDUC 1U9RA 2AGPA 2KJXA 4KN7C 1WH2A 3PUXA 4FBTA 1HZBA 3TQ1A 1Z7TA 2A68D 4R1JA 2WDTA 1GUTA 3CC7A 4K6LA 4A93H 1AN8A 1E2ZA 5KNBA 5K5PA 2W6QA 2XIGA 1YNNC 4UP7A 5I9OA 1JWUD 4X3UA 2O03A 3LWEA 3Q8SB 1GSAA 3TDQA 4DR7H 4KHPQ 2WV6D 2CHBD 4HCEA 1JWMD 3AYHB 4UP8A 4JI1L 4DV2H 1D1IA 4DR1H 1M1KC 2Z8LA 3DMUA 3U50C 4BY1B 3RB4A 2JA6B 1XNRH 4DNRB 3D8GA 2X69A 3KLSX 4A3JG 1JWSD 4RKLA 5JVH3 2R84A 2E2JH 1RYSA 4OGQC 1OXSC 4LF7L 1Y1WB 2PI2A 2XWJB 3JAME 1S0MA 1LTID 2D62A 4H44C 4J9LA 4K2KA 1XDNA 4DUYL 1G291 1VQNA 1EIFA 5IOCA 2K5HA 1FNWA 4KK7A 4C3HB 1M90C 4YBZB 1W3SA 1LTBD 4YWKA 5FO7B 3SK5A 1XMOL 1VMPA 4JI1H 3MXPA 4IWYA 4DR6L 2FLLA 1Y14B 2EJGC 2KQ3A 5IYBG 1TXYA 1TS2A 3A7LA 4MN3A 4CC5A 3RLNA 1LO5D 3KFUA 1HCZA 4RNOA 1JX4A
chains in the Genus database with same CATH topology
1B70B 4GNXA 2I5MX 1KHIA 2WFWA 1VQ6A 3S1MH 3I4MG 1SN8A 4JI5Q 1YI2A 4JI6L 2R93H 5JJLA 2MO0A 1KXLA 4AQYQ 1QZGA 1SROA 4A3GG 4XIGS 4DV6L 1C7YA 4A3EH 3GTPH 2VZAA 5IP9H 3GTGH 2B63G 2UU9Q 4DR2L 1UE6A 1HNZL 4BY7H 2VS1A 5IY0A 2NVYH 2VNUD 2VL6A 4A3DG 4DV4Q 2H5XA 4BA1I 1AH9A 1SLJA 4JOIA 4Y7NH 3S1QH 3DM3A 4WJ4A 1BBWA 1O7IA 2Q2HA 2YTXA 2HIXA 1FGUA 1WYDA 4RMFA 4AYBG 4X64L 4B3SL 2WB1G 2WAQG 5C4XH 4O2DA 3CCQA 2B29A 1GM5A 3ZJYC 5FJ8H 3KJPA 4DV5L 2E5LQ 2ATWA 1N8RC 5C44G 4DV1L 5HY6A 4NXNQ 4LUOA 1UWVA 4JCVE 4JYAL 3HOZH 2D0PA 4HJAA 1L0WA 3HOUH 1RL2A 2IT1A 5LMNW 4HJ5A 5K36G 4JBJA 2ZJRA 4JI7Q 3GO5A 3K8AA 4DR4L 2R7DA 4AH6A 5ELOA 4B3TL 2ASBA 2JA8G 3FHWA 2JE6I 1VQ5A 4JG2A 4NXMQ 1ASYA 4XTCS 3G6EA 3NENA 2PMZE 2C35B 3PUWA 4QJFA 4A76A 3CD6A 3M4OH 4QY7A 4B3ML 3J81i 4JI0Q 3K0XA 5C3EG 4A3JH 3PIPA 4LFBL 4YWLA 2AHOB 1C9OA 4X65Q 4GOPA 4IFDG 3FKIH 4YCUA 5M5WH 2D0OA 2CCZA 3TRZA 3PO3H 3PF4A 1XPRA 3CMAA 4GKJQ 1C0AA 4GLAC 1N34Q 4BBRH 3ICEA 3E9IA 2UUCL 2UXBL 2F4VL 3HOXG 3CCLA 1TWHH 2GN5A 1KRTA 2Z0SA 3M85A 4X62Q 4LFCQ 1S72A 2JA5H 4BXXH 1UE7A 4A3EG 1YHBA 1PVOA 4LF4L 1YNXA 1LYLA 2WB1E 2WAQE 2Y0SE 3KJOA 4JI2L 4BY7G 2XTIA 1V1QA 4BBSH 1PH2A 4A3KG 1NJIC 3S1RH 1UE5A 4YY3L 1PHJA 1MJEA 4OX9Q 1LUZA 2R6GA 3EIVA 2KCMA 3CCUA 2KCTA 4A3IG 1IBML 2R7ZH 3T1HL 2KBNA 1I5FA 1VQKA 1XNQQ 3MEFA 3RLFA 1UE1A 5FJ8G 3PO2G 4R4QA 1PH4A 2RHSB 4DR3L 3HFZB 4OO1I 2VQFL 3CPFA 3U58A 4HJ9A 3I4MH 1PH5A 1XPUA 2IY5B 2MNAA 1N36Q 4GKKQ 2NN6G 3S2DH 4GOPB 2I5HA 1SFOH 1AE3A 1VQCA 4R4OA 4JI3L 3L7ZC 2F52A 1TWGH 4R4IA 1IXRA 1X3EA 5BR8L 1A62A 4OWWB 2ZM6L 1K3RA 3T1YQ 2B63H 1N32L 4LFAL 3BJUA 3KOJA 3UDIA 1X65A 4YWMA 4HJ7A 4LF7Q 4GNXC 1T9HA 4DV7Q 1VS0A 3HOVG 2RCNA 3DLLA 1H95A 3I55A 1K8AC 4GS3A 4JI4Q 3FKIG 3HOYG 3F2DA 3U4VA 2K75A 5C44H 3F2CA 1QVGA 2PQAB 2E8GA 4YHHL 3I4NG 1ASZA 2Q2IA 4C3JH 4B3RL 3K81C 2MO1A 4IFDJ 4DV3L 1A8VA 2BH8A 3M4QA 3CW2C 1CKOA 1NBWA 3UDXA 1JJGA 4KLKA 4DR5L 3EBEA 3RR5A 1Q86C 4C2MH 4DK6C 4A3LG 4WJ3M 4IPDA 3GTQH 4A3MH 2ZTEA 4PZ7A 2JA8H 4QL5A 1P8LA 2VQEQ 3ULPA 1PH8A 4OONA 4APVA 3G4SA 4X6AH 4PZ8A 1RIPA 2QGQA 4JBMA 3OTOQ 3A5UA 3A74A 5C3EH 5DLQE 1KRSA 4JI6Q 4POGA 1EIYB 2NVTH 1BKBA 1EOVA 1QUQB 1YHAA 2RHQB 4DV6Q 3J7ZC 1J5EL 2HHHL 1E3PA 4HIDA 1IYJB 4DUZQ 1VQBA 1HNZQ 2IX1A 1HNWQ 2OTJA 1E24A 4P75A 4LF5Q 5M3FH 1U5KA 2Z6KA 1VQGA 3HOXH 1B8AA 3RN5A 3S1NH 3HKZE 4ALPA 1QZHA 4DK3C 3AFPA 4BY1G 3CC4A 2RF4A 5HGQA 2JA6G 2UXDQ 2K50A 2KHJA 2E2HH 1IZ6A 1K0RA 4KI0A 1N9WA 2AMCB 2MQHA 4DV5Q 4A3KH 1HJPA 4DV1Q 3KYHC 2CFMA 4PMWA 4A3IH 1OXXK 5JJIA 1Y1WG 1VQDA 3M9BA 1EWIA 1I50H 4TQUS 2B3GA 2Y0SG 1Q46A 1V9PA 1PH6A 1VQJA 2BA0A 3KDFB 3D0FA 4JI8L 1DGSA 1L2FA 2LXJA 5H1SE 4GLXA 1HNXL 3W5OA 1N33Q 1I6HH 5JEAG 2UUBQ 2YYZA 3FP9A 3TEHB 3HOWG 3NBHB 4IPCA 4OO1G 1PV4A 1CSQA 3JAMc 4JV5L 1KL9A 5LMUQ 1EUJA 2YTVA 3H3VI 3AEVA 1XJVA 4A75A 3ER0A 3MXNB 5AJ3L 3CF5A 4NPSA 1K9MC 4LF9L 3S16H 2F3IA 1WCMH 1IBKL 4IJLA 3U4ZA 4AQYL 3VDYA 4A3MG 3TS2A 1JB7A 2DGYA 5LMNL 1XTDA 2UU9L 2N78A 3KF6B 3HOVH 1FVIA 2KHIA 4P71A 1U0LA 1XPOA 4NB3A 4L5SA 3J7A5 1OXTA 4DV4L 4DV0Q 4DR7Q 1CKMA 4KHZA 3A0JA 4DV2Q 3LGJA 1Q8KA 3PCOB 5EAYA 5IE8A 4DR1Q 3HOYH 2CKZB 1MIUA 1TWAH 2JK8A 4C3IH 4LF4Q 3BZCA 3I4NH 1Q81C 2JEBI 2E5LL 1XNRQ 1HR0Q 3ULJA 1VQIA 3I2ZA 5M3FG 1B7YB 1VQ7A 4YY3Q 4MNOA 4LUVA 4K0KQ 5GQOA 3J81j 1YIJA 1VQPA 1CKNB 2QA4A 3T1HQ 1BVSA 4LF6L 4A3LH 1E1TA 3RNUA 3B6YA 4QGUA 4L5TA 1BBUA 1MJCA 1EFWA 3M7NA 4POFA 1YVCA 3AFQA 3K80C 2PQAA 3I4OA 2VQFQ 2YTYA 3UDFA 1G51A 3OYYA 4PZ6A 2FXQA 2ZTCA 1Q1EA 2YV5A 1YITA 3HKSA 1X6OA 4JI3Q 3ULLA 4JBKA 4JI0L 2HIVA 2AKWB 1HR0W 3CXCA 4JI1Q 4X65L 3EN2A 1HZAA 4LFAQ 4DAYB 4LF8L 1IBLQ 5GROA 4BA2I 2UUAL 2VUMG 1SRUA 1SE8A 4ME3A 1XMQL 1P16A 5JEAJ 4BY1H 1FJGQ 2CWPA 2JA6H 3A5ZB 3PIOA 1E7ZA 1WOCA 3M4PA 4A3CG 3TS0A 2JJQA 5M3MG 1WCMG 4X62L 4L5QA 4LFCL 3K7UC 1L1OB 2LXKA 1VQLA 3GTLH 1QUQA 2WP8J 2IHFA 1CSPA 4IOCA 1Q1BA 1GO3E 3HKZG 2ES2A 4LNQA 1Y1WH 2PI2E 4HIMA 3CAMA 4TVAB 3CMEA 4DV3Q 4OX9L 1PH3A 3CCSA 3PUZA 1WI5A 4DUYQ 4DR5Q 4DAMA 1VQHA 3BU2A 4QQBX 2N3SA 1EYGA 1D8LA 1X54A 1X3FA 1XMOQ 4C3HH 1I94L 3J80c 3HOWH 5M5YH 4DR6Q 4LW1A 5FLXc 2I0QA 3H15A 4JOIC 3NELA 2VY3A 1EQRA 5IWAL 2HT1A 1G6PA 3STBD 1N36L 2GVAA 4P72A 1YZ6A 2EIFA 3PV0A 2UXCQ 1HZ9A 1HZCA 3CC2A 4KHPL 3KDFA 4IPHA 1VQAA 3T1YL 2A19A 2OQKA 4L5RC 1I3QH 3RLOA 1EQQA 5IYCG 1K73C 4DV7L 2JEAI 1Z9FA 3CCJA 5J3BA 4OWTB 1OXUA 2Q2UA 1IL2A 1K83H 1KD1C 4UP9A 1VQMA 4X66L 1Q82C 2OTLA 3IRBA 4DR2Q 4JI4L 2K5NA 1KC8C 1SR3A 1SMXA 2AWOA 2CWAA 5ELNA 3KF6A 3KLWA 5GAEC 1PH1A 4R4TA 1PYSB 3RZOH 5JJKA 4R4CA 3S2HH 1S3OA 1X3GA 3UE1A 3PGZA 3CPWA 4JI2Q 4X64Q 5C0XI 4GOPC 1KIXA 4B3SQ 1Q12A 3RZDH 2MFIA 2R92G 4UY8C 1E1OA 2AWNA 4GN3B 4IOAA 5FLMG 3JC66 3S17H 2L15A 4OXPA 4JYAQ 3M3YH 2I5LX 2KENA 4DKAC 2VQEL 3H0GG 4H02A 2JA7H 4GN4B 2NN6I 1PYBA 4A93G 3GD7A 1CKNA 4LWCA 4LUZA 3OTOL 5AJ3Q 3NEMA 2EXDA 2A8VA 4DR4Q 4LF9Q 1VQ9A 2OCEA 1IBKQ 4B3TQ 4HIKA 3I7FA 4EQ5A 1YHQA 1D7QA 1X9NA 2VUMH 5LMNQ 1LM0A 4HJ8A 4DUZL 1HNWL 4JC0A 4JI5L 1PH9A 4B3MQ 4LF5L 1W2BA 1PH7A 3G71A 3L0OA 4A3CH 1JT8A 4LFBQ 2ALYB 5M3MH 1VCIA 1PA6A 1GKHA 2UXDL 3SGIA 4A3BH 4EX5A 4P74A 5IP7G 1TWFH 3J80i 2NZHA 3D31A 2E2IH 2UXBQ 2JA9A 2UUCQ 2F4VQ 3F1ZA 2CQOA 1UEBA 4Y52H 1LTLA 3Q8DA 4LF6Q 3W1GA 1X56A 3I56A 3TREA 3UE0A 2N49A 1L1OA 5IYDH 2OWOA 3TQYA 4NXNL 2R7FA 4A3FH 3GTJH 4GNXB 1N33L 1E22A 2UUBL 1IBMQ 5GAGC 2VW9A 4DNIA 1YEZA 1Z47A 2NZOA 4RG1A 3CCEA 3G48A 5LMUL 3H3VH 1X55A 3PSIA 4JI7L 2IX0A 3L2PA 3PUYA 1NY4A 4DR3Q 1VQ8A 1WFQA 5IYCH 1NE3A 4LF8Q 3S24A 4MZ9A 1VQOA 1S40A 4NXML 4A4IA 2JA7G 3UDGA 2UUAQ 2ZTDA 4IPGA 1QVCA 1XMQQ 3S14H 5E7NA 1Y1VH 1OXVA 5BR8Q 2K5VA 2K14A 4MTNA 2QEXA 4DV0L 4DR7L 3E0EA 1VQEA 2ZM6Q 2R93G 4DPGA 4GN5A 4JBWA 1HH2P 2NVQH 1N32Q 3ERSX 5M5XH 3STBC 1MKHA 4DV2L 1VQ4A 2XGTA 4DR1L 1Q7YC 1YJWA 5IP9G 4AYBE 4GKJL 2OQ0A 1J6QA 3S15H 1N34L 1XNRL 1HR0L 4FDBA 3GTKH 1A0IA 1V43A 3CQZH 3CCMA 3RN2A 3GTOH 1NTGA 2BA1A 2R92H 5IYBH 2ID0A 4K0KL 1GD7A 3AQQA 1A63A 1WJJA 3PUVA 5C0XG 2LSSA 4A3BG 5FLMH 4YHHQ 4B3RQ 5C4XG 2K52A 1QVFA 2Z6KC 3PF5A 1I94Q 1AE2A 3PUXA 3K7AH 3JAMi 2K4KA 1HZBA 3H0GH 1JJ2A 4IJHA 3GDEA 2GVBA 1PFSA 2HQLA 4YCWA 4R1JA 4YCVA 1JMCA 4A93H 3CC7A 2JQOA 5IT9c 5IWAQ 3F2BA 1KAWA 3HOZG 3CCRA 3CCVA 2EQSA 3HOUG 4UP7A 1XNQL 3BZKA 3W1BA 5IYDG 3OW2A 4A3GH 1YJ9A 4KHPQ 2V1CC 3AYHB 4UP8A 4JI1L 4A3FG 3F8TA 1M1KC 1TWCH 3U50C 1IBLL 2Q2TA 4GKKL 1R9TH 2IHEA 4A3DH 2ZJQA 4HIOA 4IO9A 2DUDA 2YU9H 1FJGL 4IFDI 4UPAA 1J5EQ 2N8NA 2HHHQ 4A3JG 5IP7H 1K8GA 4X66Q 2E2JH 1OXSC 1VQFA 3WWVA 4GLVB 4LF7L 4OWXB 2ZJPA 3PO3G 2PI2A 3CP0A 3KF8B 1Y1VG 3PO2H 3GTMH 4J15A 3J81c 4BBRG 2BH2A 2D62A 1CUKA 1NMFA 4DUYL 1G291 4O0AA 1EIFA 4AIMA 2JA5G 1VQNA 4BXXG 2K5HA 1NMGA 5GADC 2A1AA 1M90C 1W3SA 3E9HA 4YWKA 5C4JH 1XMOL 4DR6L 4BBSG 1Y14B 2NVXH 4PG3A 1JJCB 1GVPA 4QIWE 1TXYA 5IYBG 2R7ZG 1OTCA 4JI8Q 1YBYA 1JE5A 1KQSA 1YJNA 1HNXQ 5GAHC 3RLNA 4P73A 1L1OC 2UXCL 3KFUA 1FL0A 2PNHA 4JV5Q 5C0XJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B70 B;  4GNX A;  2I5M X;  1KHI A;  2WFW A;  1VQ6 A;  3S1M H;  3I4M G;  1SN8 A;  4JI5 Q;  1YI2 A;  4JI6 L;  2R93 H;  5JJL A;  2MO0 A;  1KXL A;  4AQY Q;  1QZG A;  1SRO A;  4A3G G;  4XIG S;  4DV6 L;  1C7Y A;  4A3E H;  3GTP H;  2VZA A;  5IP9 H;  3GTG H;  2B63 G;  2UU9 Q;  4DR2 L;  1UE6 A;  1HNZ L;  4BY7 H;  2VS1 A;  5IY0 A;  2NVY H;  2VNU D;  2VL6 A;  4A3D G;  4DV4 Q;  2H5X A;  4BA1 I;  1AH9 A;  1SLJ A;  4JOI A;  4Y7N H;  3S1Q H;  3DM3 A;  4WJ4 A;  1BBW A;  1O7I A;  2Q2H A;  2YTX A;  2HIX A;  1FGU A;  1WYD A;  4RMF A;  4AYB G;  4X64 L;  4B3S L;  2WB1 G;  2WAQ G;  5C4X H;  4O2D A;  3CCQ A;  2B29 A;  1GM5 A;  3ZJY C;  5FJ8 H;  3KJP A;  4DV5 L;  2E5L Q;  2ATW A;  1N8R C;  5C44 G;  4DV1 L;  5HY6 A;  4NXN Q;  4LUO A;  1UWV A;  4JCV E;  4JYA L;  3HOZ H;  2D0P A;  4HJA A;  1L0W A;  3HOU H;  1RL2 A;  2IT1 A;  5LMN W;  4HJ5 A;  5K36 G;  4JBJ A;  2ZJR A;  4JI7 Q;  3GO5 A;  3K8A A;  4DR4 L;  2R7D A;  4AH6 A;  5ELO A;  4B3T L;  2ASB A;  2JA8 G;  3FHW A;  2JE6 I;  1VQ5 A;  4JG2 A;  4NXM Q;  1ASY A;  4XTC S;  3G6E A;  3NEN A;  2PMZ E;  2C35 B;  3PUW A;  4QJF A;  4A76 A;  3CD6 A;  3M4O H;  4QY7 A;  4B3M L;  3J81 i;  4JI0 Q;  3K0X A;  5C3E G;  4A3J H;  3PIP A;  4LFB L;  4YWL A;  2AHO B;  1C9O A;  4X65 Q;  4GOP A;  4IFD G;  3FKI H;  4YCU A;  5M5W H;  2D0O A;  2CCZ A;  3TRZ A;  3PO3 H;  3PF4 A;  1XPR A;  3CMA A;  4GKJ Q;  1C0A A;  4GLA C;  1N34 Q;  4BBR H;  3ICE A;  3E9I A;  2UUC L;  2UXB L;  2F4V L;  3HOX G;  3CCL A;  1TWH H;  2GN5 A;  1KRT A;  2Z0S A;  3M85 A;  4X62 Q;  4LFC Q;  1S72 A;  2JA5 H;  4BXX H;  1UE7 A;  4A3E G;  1YHB A;  1PVO A;  4LF4 L;  1YNX A;  1LYL A;  2WB1 E;  2WAQ E;  2Y0S E;  3KJO A;  4JI2 L;  4BY7 G;  2XTI A;  1V1Q A;  4BBS H;  1PH2 A;  4A3K G;  1NJI C;  3S1R H;  1UE5 A;  4YY3 L;  1PHJ A;  1MJE A;  4OX9 Q;  1LUZ A;  2R6G A;  3EIV A;  2KCM A;  3CCU A;  2KCT A;  4A3I G;  1IBM L;  2R7Z H;  3T1H L;  2KBN A;  1I5F A;  1VQK A;  1XNQ Q;  3MEF A;  3RLF A;  1UE1 A;  5FJ8 G;  3PO2 G;  4R4Q A;  1PH4 A;  2RHS B;  4DR3 L;  3HFZ B;  4OO1 I;  2VQF L;  3CPF A;  3U58 A;  4HJ9 A;  3I4M H;  1PH5 A;  1XPU A;  2IY5 B;  2MNA A;  1N36 Q;  4GKK Q;  2NN6 G;  3S2D H;  4GOP B;  2I5H A;  1SFO H;  1AE3 A;  1VQC A;  4R4O A;  4JI3 L;  3L7Z C;  2F52 A;  1TWG H;  4R4I A;  1IXR A;  1X3E A;  5BR8 L;  1A62 A;  4OWW B;  2ZM6 L;  1K3R A;  3T1Y Q;  2B63 H;  1N32 L;  4LFA L;  3BJU A;  3KOJ A;  3UDI A;  1X65 A;  4YWM A;  4HJ7 A;  4LF7 Q;  4GNX C;  1T9H A;  4DV7 Q;  1VS0 A;  3HOV G;  2RCN A;  3DLL A;  1H95 A;  3I55 A;  1K8A C;  4GS3 A;  4JI4 Q;  3FKI G;  3HOY G;  3F2D A;  3U4V A;  2K75 A;  5C44 H;  3F2C A;  1QVG A;  2PQA B;  2E8G A;  4YHH L;  3I4N G;  1ASZ A;  2Q2I A;  4C3J H;  4B3R L;  3K81 C;  2MO1 A;  4IFD J;  4DV3 L;  1A8V A;  2BH8 A;  3M4Q A;  3CW2 C;  1CKO A;  1NBW A;  3UDX A;  1JJG A;  4KLK A;  4DR5 L;  3EBE A;  3RR5 A;  1Q86 C;  4C2M H;  4DK6 C;  4A3L G;  4WJ3 M;  4IPD A;  3GTQ H;  4A3M H;  2ZTE A;  4PZ7 A;  2JA8 H;  4QL5 A;  1P8L A;  2VQE Q;  3ULP A;  1PH8 A;  4OON A;  4APV A;  3G4S A;  4X6A H;  4PZ8 A;  1RIP A;  2QGQ A;  4JBM A;  3OTO Q;  3A5U A;  3A74 A;  5C3E H;  5DLQ E;  1KRS A;  4JI6 Q;  4POG A;  1EIY B;  2NVT H;  1BKB A;  1EOV A;  1QUQ B;  1YHA A;  2RHQ B;  4DV6 Q;  3J7Z C;  1J5E L;  2HHH L;  1E3P A;  4HID A;  1IYJ B;  4DUZ Q;  1VQB A;  1HNZ Q;  2IX1 A;  1HNW Q;  2OTJ A;  1E24 A;  4P75 A;  4LF5 Q;  5M3F H;  1U5K A;  2Z6K A;  1VQG A;  3HOX H;  1B8A A;  3RN5 A;  3S1N H;  3HKZ E;  4ALP A;  1QZH A;  4DK3 C;  3AFP A;  4BY1 G;  3CC4 A;  2RF4 A;  5HGQ A;  2JA6 G;  2UXD Q;  2K50 A;  2KHJ A;  2E2H H;  1IZ6 A;  1K0R A;  4KI0 A;  1N9W A;  2AMC B;  2MQH A;  4DV5 Q;  4A3K H;  1HJP A;  4DV1 Q;  3KYH C;  2CFM A;  4PMW A;  4A3I H;  1OXX K;  5JJI A;  1Y1W G;  1VQD A;  3M9B A;  1EWI A;  1I50 H;  4TQU S;  2B3G A;  2Y0S G;  1Q46 A;  1V9P A;  1PH6 A;  1VQJ A;  2BA0 A;  3KDF B;  3D0F A;  4JI8 L;  1DGS A;  1L2F A;  2LXJ A;  5H1S E;  4GLX A;  1HNX L;  3W5O A;  1N33 Q;  1I6H H;  5JEA G;  2UUB Q;  2YYZ A;  3FP9 A;  3TEH B;  3HOW G;  3NBH B;  4IPC A;  4OO1 G;  1PV4 A;  1CSQ A;  3JAM c;  4JV5 L;  1KL9 A;  5LMU Q;  1EUJ A;  2YTV A;  3H3V I;  3AEV A;  1XJV A;  4A75 A;  3ER0 A;  3MXN B;  5AJ3 L;  3CF5 A;  4NPS A;  1K9M C;  4LF9 L;  3S16 H;  2F3I A;  1WCM H;  1IBK L;  4IJL A;  3U4Z A;  4AQY L;  3VDY A;  4A3M G;  3TS2 A;  1JB7 A;  2DGY A;  5LMN L;  1XTD A;  2UU9 L;  2N78 A;  3KF6 B;  3HOV H;  1FVI A;  2KHI A;  4P71 A;  1U0L A;  1XPO A;  4NB3 A;  4L5S A;  3J7A 5;  1OXT A;  4DV4 L;  4DV0 Q;  4DR7 Q;  1CKM A;  4KHZ A;  3A0J A;  4DV2 Q;  3LGJ A;  1Q8K A;  3PCO B;  5EAY A;  5IE8 A;  4DR1 Q;  3HOY H;  2CKZ B;  1MIU A;  1TWA H;  2JK8 A;  4C3I H;  4LF4 Q;  3BZC A;  3I4N H;  1Q81 C;  2JEB I;  2E5L L;  1XNR Q;  1HR0 Q;  3ULJ A;  1VQI A;  3I2Z A;  5M3F G;  1B7Y B;  1VQ7 A;  4YY3 Q;  4MNO A;  4LUV A;  4K0K Q;  5GQO A;  3J81 j;  1YIJ A;  1VQP A;  1CKN B;  2QA4 A;  3T1H Q;  1BVS A;  4LF6 L;  4A3L H;  1E1T A;  3RNU A;  3B6Y A;  4QGU A;  4L5T A;  1BBU A;  1MJC A;  1EFW A;  3M7N A;  4POF A;  1YVC A;  3AFQ A;  3K80 C;  2PQA A;  3I4O A;  2VQF Q;  2YTY A;  3UDF A;  1G51 A;  3OYY A;  4PZ6 A;  2FXQ A;  2ZTC A;  1Q1E A;  2YV5 A;  1YIT A;  3HKS A;  1X6O A;  4JI3 Q;  3ULL A;  4JBK A;  4JI0 L;  2HIV A;  2AKW B;  1HR0 W;  3CXC A;  4JI1 Q;  4X65 L;  3EN2 A;  1HZA A;  4LFA Q;  4DAY B;  4LF8 L;  1IBL Q;  5GRO A;  4BA2 I;  2UUA L;  2VUM G;  1SRU A;  1SE8 A;  4ME3 A;  1XMQ L;  1P16 A;  5JEA J;  4BY1 H;  1FJG Q;  2CWP A;  2JA6 H;  3A5Z B;  3PIO A;  1E7Z A;  1WOC A;  3M4P A;  4A3C G;  3TS0 A;  2JJQ A;  5M3M G;  1WCM G;  4X62 L;  4L5Q A;  4LFC L;  3K7U C;  1L1O B;  2LXK A;  1VQL A;  3GTL H;  1QUQ A;  2WP8 J;  2IHF A;  1CSP A;  4IOC A;  1Q1B A;  1GO3 E;  3HKZ G;  2ES2 A;  4LNQ A;  1Y1W H;  2PI2 E;  4HIM A;  3CAM A;  4TVA B;  3CME A;  4DV3 Q;  4OX9 L;  1PH3 A;  3CCS A;  3PUZ A;  1WI5 A;  4DUY Q;  4DR5 Q;  4DAM A;  1VQH A;  3BU2 A;  4QQB X;  2N3S A;  1EYG A;  1D8L A;  1X54 A;  1X3F A;  1XMO Q;  4C3H H;  1I94 L;  3J80 c;  3HOW H;  5M5Y H;  4DR6 Q;  4LW1 A;  5FLX c;  2I0Q A;  3H15 A;  4JOI C;  3NEL A;  2VY3 A;  1EQR A;  5IWA L;  2HT1 A;  1G6P A;  3STB D;  1N36 L;  2GVA A;  4P72 A;  1YZ6 A;  2EIF A;  3PV0 A;  2UXC Q;  1HZ9 A;  1HZC A;  3CC2 A;  4KHP L;  3KDF A;  4IPH A;  1VQA A;  3T1Y L;  2A19 A;  2OQK A;  4L5R C;  1I3Q H;  3RLO A;  1EQQ A;  5IYC G;  1K73 C;  4DV7 L;  2JEA I;  1Z9F A;  3CCJ A;  5J3B A;  4OWT B;  1OXU A;  2Q2U A;  1IL2 A;  1K83 H;  1KD1 C;  4UP9 A;  1VQM A;  4X66 L;  1Q82 C;  2OTL A;  3IRB A;  4DR2 Q;  4JI4 L;  2K5N A;  1KC8 C;  1SR3 A;  1SMX A;  2AWO A;  2CWA A;  5ELN A;  3KF6 A;  3KLW A;  5GAE C;  1PH1 A;  4R4T A;  1PYS B;  3RZO H;  5JJK A;  4R4C A;  3S2H H;  1S3O A;  1X3G A;  3UE1 A;  3PGZ A;  3CPW A;  4JI2 Q;  4X64 Q;  5C0X I;  4GOP C;  1KIX A;  4B3S Q;  1Q12 A;  3RZD H;  2MFI A;  2R92 G;  4UY8 C;  1E1O A;  2AWN A;  4GN3 B;  4IOA A;  5FLM G;  3JC6 6;  3S17 H;  2L15 A;  4OXP A;  4JYA Q;  3M3Y H;  2I5L X;  2KEN A;  4DKA C;  2VQE L;  3H0G G;  4H02 A;  2JA7 H;  4GN4 B;  2NN6 I;  1PYB A;  4A93 G;  3GD7 A;  1CKN A;  4LWC A;  4LUZ A;  3OTO L;  5AJ3 Q;  3NEM A;  2EXD A;  2A8V A;  4DR4 Q;  4LF9 Q;  1VQ9 A;  2OCE A;  1IBK Q;  4B3T Q;  4HIK A;  3I7F A;  4EQ5 A;  1YHQ A;  1D7Q A;  1X9N A;  2VUM H;  5LMN Q;  1LM0 A;  4HJ8 A;  4DUZ L;  1HNW L;  4JC0 A;  4JI5 L;  1PH9 A;  4B3M Q;  4LF5 L;  1W2B A;  1PH7 A;  3G71 A;  3L0O A;  4A3C H;  1JT8 A;  4LFB Q;  2ALY B;  5M3M H;  1VCI A;  1PA6 A;  1GKH A;  2UXD L;  3SGI A;  4A3B H;  4EX5 A;  4P74 A;  5IP7 G;  1TWF H;  3J80 i;  2NZH A;  3D31 A;  2E2I H;  2UXB Q;  2JA9 A;  2UUC Q;  2F4V Q;  3F1Z A;  2CQO A;  1UEB A;  4Y52 H;  1LTL A;  3Q8D A;  4LF6 Q;  3W1G A;  1X56 A;  3I56 A;  3TRE A;  3UE0 A;  2N49 A;  1L1O A;  5IYD H;  2OWO A;  3TQY A;  4NXN L;  2R7F A;  4A3F H;  3GTJ H;  4GNX B;  1N33 L;  1E22 A;  2UUB L;  1IBM Q;  5GAG C;  2VW9 A;  4DNI A;  1YEZ A;  1Z47 A;  2NZO A;  4RG1 A;  3CCE A;  3G48 A;  5LMU L;  3H3V H;  1X55 A;  3PSI A;  4JI7 L;  2IX0 A;  3L2P A;  3PUY A;  1NY4 A;  4DR3 Q;  1VQ8 A;  1WFQ A;  5IYC H;  1NE3 A;  4LF8 Q;  3S24 A;  4MZ9 A;  1VQO A;  1S40 A;  4NXM L;  4A4I A;  2JA7 G;  3UDG A;  2UUA Q;  2ZTD A;  4IPG A;  1QVC A;  1XMQ Q;  3S14 H;  5E7N A;  1Y1V H;  1OXV A;  5BR8 Q;  2K5V A;  2K14 A;  4MTN A;  2QEX A;  4DV0 L;  4DR7 L;  3E0E A;  1VQE A;  2ZM6 Q;  2R93 G;  4DPG A;  4GN5 A;  4JBW A;  1HH2 P;  2NVQ H;  1N32 Q;  3ERS X;  5M5X H;  3STB C;  1MKH A;  4DV2 L;  1VQ4 A;  2XGT A;  4DR1 L;  1Q7Y C;  1YJW A;  5IP9 G;  4AYB E;  4GKJ L;  2OQ0 A;  1J6Q A;  3S15 H;  1N34 L;  1XNR L;  1HR0 L;  4FDB A;  3GTK H;  1A0I A;  1V43 A;  3CQZ H;  3CCM A;  3RN2 A;  3GTO H;  1NTG A;  2BA1 A;  2R92 H;  5IYB H;  2ID0 A;  4K0K L;  1GD7 A;  3AQQ A;  1A63 A;  1WJJ A;  3PUV A;  5C0X G;  2LSS A;  4A3B G;  5FLM H;  4YHH Q;  4B3R Q;  5C4X G;  2K52 A;  1QVF A;  2Z6K C;  3PF5 A;  1I94 Q;  1AE2 A;  3PUX A;  3K7A H;  3JAM i;  2K4K A;  1HZB A;  3H0G H;  1JJ2 A;  4IJH A;  3GDE A;  2GVB A;  1PFS A;  2HQL A;  4YCW A;  4R1J A;  4YCV A;  1JMC A;  4A93 H;  3CC7 A;  2JQO A;  5IT9 c;  5IWA Q;  3F2B A;  1KAW A;  3HOZ G;  3CCR A;  3CCV A;  2EQS A;  3HOU G;  4UP7 A;  1XNQ L;  3BZK A;  3W1B A;  5IYD G;  3OW2 A;  4A3G H;  1YJ9 A;  4KHP Q;  2V1C C;  3AYH B;  4UP8 A;  4JI1 L;  4A3F G;  3F8T A;  1M1K C;  1TWC H;  3U50 C;  1IBL L;  2Q2T A;  4GKK L;  1R9T H;  2IHE A;  4A3D H;  2ZJQ A;  4HIO A;  4IO9 A;  2DUD A;  2YU9 H;  1FJG L;  4IFD I;  4UPA A;  1J5E Q;  2N8N A;  2HHH Q;  4A3J G;  5IP7 H;  1K8G A;  4X66 Q;  2E2J H;  1OXS C;  1VQF A;  3WWV A;  4GLV B;  4LF7 L;  4OWX B;  2ZJP A;  3PO3 G;  2PI2 A;  3CP0 A;  3KF8 B;  1Y1V G;  3PO2 H;  3GTM H;  4J15 A;  3J81 c;  4BBR G;  2BH2 A;  2D62 A;  1CUK A;  1NMF A;  4DUY L;  1G29 1;  4O0A A;  1EIF A;  4AIM A;  2JA5 G;  1VQN A;  4BXX G;  2K5H A;  1NMG A;  5GAD C;  2A1A A;  1M90 C;  1W3S A;  3E9H A;  4YWK A;  5C4J H;  1XMO L;  4DR6 L;  4BBS G;  1Y14 B;  2NVX H;  4PG3 A;  1JJC B;  1GVP A;  4QIW E;  1TXY A;  5IYB G;  2R7Z G;  1OTC A;  4JI8 Q;  1YBY A;  1JE5 A;  1KQS A;  1YJN A;  1HNX Q;  5GAH C;  3RLN A;  4P73 A;  1L1O C;  2UXC L;  3KFU A;  1FL0 A;  2PNH A;  4JV5 Q;  5C0X J; 
#chains in the Genus database with same CATH topology
 1B70 B;  4XZ3 B;  1DIK A;  4LF7 H;  4J9O A;  2BQU A;  5KFZ A;  1K83 B;  4IHJ F;  2A73 B;  5JJL A;  4F4X A;  2MO0 A;  3FEW X;  4M9U A;  1KBL A;  1F2Z A;  1C7Y A;  1EIG A;  2LY7 A;  4DUY H;  1I4H A;  3PIO 3;  2B63 G;  1HNZ L;  2YCH A;  2R8I A;  3HKZ A;  2VS1 A;  1K8M A;  1TWF A;  2NVY H;  2VL6 A;  1XMO H;  2B2T A;  4DR6 H;  3DM3 A;  4H13 C;  4WJ4 A;  3MAQ A;  5C0X H;  2VOB A;  1GM5 A;  3L3O C;  3BDL A;  3CCQ A;  3BG3 A;  1H9S A;  2AGQ A;  4C5C A;  5KFG A;  3GTJ A;  3IKJ A;  2QW7 A;  3G7L A;  3H4B A;  3MFI A;  3D3R A;  3OWE B;  4I7H A;  1I6H B;  2UVU A;  4JI7 Q;  2KHS A;  3K8A A;  1E4G T;  4JW0 A;  4J0M A;  4AH6 A;  5ELO A;  4B3T L;  5EPK A;  5KT4 A;  2B2V C;  4E6I A;  3FHW A;  2W9B B;  4XTC S;  3PUW A;  3CD6 A;  1G2T A;  3MFY A;  4B3M L;  3J81 i;  1Y8P B;  3K0X A;  1EZ6 A;  3NTK A;  4I7A A;  1TU2 B;  3I3C A;  4OEM B;  1DV2 A;  4ECQ A;  3AB9 A;  4X65 Q;  4GOP A;  4K5V A;  2Z4I A;  3KHR A;  2F3W A;  3FKI H;  3CVZ A;  2CCZ A;  3PO3 H;  2W6P A;  1XPR A;  1JXL A;  2E2I B;  4KV6 A;  5KG7 A;  1N34 Q;  2WTF A;  3NWS A;  2UXB L;  3E9I A;  1EZ1 A;  2F4V L;  3CCL A;  1TWH H;  2GN5 A;  3M85 A;  4X62 Q;  5CGK A;  3QZ8 A;  1S72 A;  1C8C A;  3GTL A;  1YNX A;  2FJZ A;  2WAQ E;  2X6G A;  3KJO A;  3N6X A;  4A3F B;  2XTI A;  1V1Q A;  3HEJ A;  4LF9 H;  1PHJ A;  2M2L A;  4FVM A;  3EIV A;  4B3T H;  1ICF B;  3CCU A;  2KCT A;  4UHV A;  2R7Z H;  4RUA A;  3J81 W;  1QJO A;  5DM7 3;  1VQK A;  4LH6 A;  5EWE A;  4B3M H;  1XNQ Q;  3MEF A;  3RLF A;  3V05 A;  2FPG B;  2BDO A;  1EU3 A;  2PCF B;  2L4N A;  1NR4 A;  2OF1 A;  1ZEQ X;  4DXF A;  4HJ9 A;  3I4M H;  1XPU A;  4GKK Q;  2B2U A;  2CW8 A;  2I5H A;  4JI3 L;  2UXB H;  3L7Z C;  4HNT A;  4QCL A;  4G7O C;  1IXR A;  4DU9 A;  5BR8 L;  2F4V H;  2E2H B;  1A62 A;  5EZY F;  1W96 A;  5IGB A;  5DEH A;  2NTS A;  2UVW A;  5EBC A;  1X65 A;  3TP6 A;  4DV7 Q;  1VS0 A;  1HFN A;  3GTK B;  2RCN A;  4RGO S;  1JKJ B;  3KXY T;  1JLL B;  1PTO H;  2R92 B;  4QUF A;  4GS3 A;  1XTC D;  4F4W A;  4OHJ A;  1SYG A;  3HG9 A;  3K5O A;  4CDE C;  1B50 A;  3FKI G;  1S5B D;  4RNM A;  3HOY G;  1ZXT A;  4FO2 A;  3FDS A;  2YRX A;  4C3I G;  2XCP A;  1ZET A;  4DV3 L;  4QWE A;  4LAA A;  4B9W A;  3RR5 A;  5C3W A;  3JAM L;  1Q86 C;  1EYZ A;  3MJF A;  3GV7 B;  4TQR A;  4DK6 C;  5BR8 H;  1EHI A;  3M9O B;  5ELF A;  1K1S A;  4O2B F;  3M7G A;  4PZ7 A;  4Z9C B;  4APV A;  1T3N A;  4A3D B;  3JRW A;  2IX3 A;  3I91 A;  4PZ8 A;  2ZDH A;  4JBM A;  2F0H A;  3A74 A;  5C3E H;  3QG1 A;  4MA5 A;  2D2C C;  4HNU A;  4AYB B;  4IFD H;  1YHA A;  4F4Y A;  4DV6 Q;  3J7Z C;  1E3P A;  4LK1 C;  2K04 A;  5IGE A;  1N56 A;  3GIL A;  4EQO A;  4P75 A;  4K6D A;  1D2B A;  2SDF A;  3HOX H;  3GTM B;  2R7K A;  5JQW A;  2FP4 B;  4FNF A;  5BPH A;  4MV6 A;  1DV1 A;  4ODG A;  4U6P A;  2BE5 D;  2MP1 A;  4KI0 A;  4IWX A;  5C4J B;  2MQH A;  4A3K H;  3R5X A;  4ED0 A;  1M4V A;  3KYH C;  4A3I H;  5JJI A;  2PW5 A;  4DL7 A;  1AP0 A;  2ZJT A;  3T56 B;  2CZG A;  1BNC A;  1DYQ A;  4F87 A;  2PNR C;  3KDF B;  4FXG C;  4JI8 L;  4GLX A;  1HNX L;  1DGS A;  3ETH A;  2AQ4 A;  5BN5 A;  2A74 C;  4I7Z C;  5CBE E;  1RTO A;  4FM9 A;  3BJY A;  3CF5 A;  3S16 H;  3HS0 C;  2F3I A;  4AQY L;  3VDY A;  2N88 A;  3A56 A;  4WRD A;  2EZV A;  4ZLT F;  1JB7 A;  3TS2 A;  2DGY A;  1B6S A;  4TSS A;  1OWT A;  3RF2 A;  1XTD A;  2N78 A;  2KHI A;  1U0L A;  4NB3 A;  1KLU D;  3DEO A;  3CKI B;  4TKO B;  4DV0 Q;  5IT9 E;  5LL6 S;  2EYJ A;  3OIQ A;  3R2T A;  3W3A A;  5C4X B;  4HR7 B;  3ORQ A;  2BQ3 A;  4CDC C;  4MV1 A;  2JK8 A;  4LF4 Q;  3I4N H;  3BZC A;  2FK2 A;  1HNX H;  4IRK A;  2E5L L;  4JI8 H;  2OH2 A;  2KCN A;  3ULJ A;  2ENB A;  2DLN A;  4MNO A;  5D3D A;  1JR0 D;  1JC7 A;  2J4X A;  3BVZ A;  3MHB A;  3D6C A;  4UAI A;  5FLX L;  3J81 j;  3HOU B;  1J8I A;  1M6V A;  3T1H Q;  4XYO A;  2V4Q A;  4J9N A;  3SVM A;  3HB9 A;  3RNU A;  2K1B A;  4K8J A;  3NQI A;  1FKA H;  1BBU A;  1A15 A;  1JOQ A;  3QZ7 A;  4AQY H;  1BCP B;  1D1K A;  1GUG A;  1WD0 A;  2YZM A;  3H0G A;  2LFN A;  3OYY A;  5KFX A;  3HKS A;  5I6W A;  2W6M A;  2NBF A;  4ZRZ A;  3OSP A;  1KAA A;  1G8Z D;  1C48 A;  3EN2 A;  4MV3 A;  5H80 A;  5FOB B;  1M0W A;  1SE2 A;  4LFA Q;  4DAY B;  5HGT A;  3V6K A;  3SHL A;  4BA2 I;  5GRO A;  5KFF A;  1TWC A;  3MWY W;  4DK1 A;  1CQJ B;  2VUM G;  1Y8N B;  4BBR B;  2E5L H;  1FJG Q;  1H9R A;  4XT3 B;  4OL7 A;  5IGG A;  2YU9 A;  3A5Z B;  1E4F T;  5KFY A;  1WOC A;  3WDN A;  2JA5 B;  4YAK B;  1AFP A;  1VQL A;  4LFC L;  3K7U C;  3GTL H;  1QUQ A;  4ZQ3 A;  1CSP A;  4IOC A;  1GO3 E;  2NZ1 D;  3HKZ G;  5JAV A;  5JPM C;  4HIM A;  2I8C A;  3SI8 A;  3CME A;  2M9V A;  4OX9 L;  3QJY A;  1TS4 A;  2QYZ A;  1WI5 A;  2JYO A;  4DR5 Q;  2VUG A;  3PVX A;  4QQB X;  1SSO A;  2N3S A;  1R4Q B;  2NWG A;  4O4H F;  2F0K A;  5JEA H;  1X54 A;  1X3F A;  3HOW H;  5M5Y H;  4OO1 H;  4LW1 A;  2I0Q A;  2B2T C;  2BE5 C;  1O80 A;  3NEL A;  1TII D;  2K32 A;  3ORR A;  3S2D B;  4S3S A;  5JH7 F;  2HT1 A;  1AN7 A;  1N36 L;  1TWG B;  2GVA A;  3TQT A;  1S5E D;  4P72 A;  3CC2 A;  2J6U A;  1UNS A;  3WNZ A;  2LMC B;  2DNE A;  4EBD A;  4LFC H;  4L5R C;  4F7X A;  1EQQ A;  3OUZ A;  5IYC G;  2IL8 A;  4IZ8 A;  1GUO A;  2EYF A;  3JAM W;  2DJG C;  3UI2 A;  1EU4 A;  5EKL A;  1CQF A;  1VF5 C;  3H3V C;  4OX9 H;  1OXU A;  2R93 A;  2WAQ B;  2G9H D;  3MXN A;  3MWD A;  1Q82 C;  5C44 B;  2OTL A;  3QIA A;  2JEJ A;  3GTG A;  3MR2 A;  4C3J B;  5KFS A;  1SND A;  2CWA A;  3RUZ A;  5ELN A;  5GAE C;  3KLW A;  2EY1 A;  1MBY A;  1PYS B;  2XWB B;  3C46 A;  3S2H H;  3MR6 A;  4JV0 A;  4GOP C;  3ERO A;  3CPW A;  4X64 Q;  5C0X I;  2FMA A;  1N36 H;  1EZ8 A;  5KG2 A;  2KED A;  4A3M B;  2JA8 B;  4J9P A;  2L9H A;  1JB3 A;  2NVX B;  5IYZ F;  4OXP A;  3M3Y H;  3NHH A;  3T5J A;  2FJ2 A;  2VQE L;  2OXP A;  3Q8R B;  3TIG A;  5LL6 X;  4GN4 B;  3RGX A;  2WKD A;  1PRT B;  1V51 A;  1ZHS A;  4LWC A;  3OTO L;  4LUZ A;  5KFW A;  5A2Q E;  5AJ3 Q;  3L4K A;  2B2Y A;  1B9N A;  4EQN A;  3EVQ A;  4HYK A;  1I7N A;  1VAJ A;  4LMQ D;  4EQ5 A;  3SE0 A;  5M3F B;  5EWG A;  1QNK A;  1RF2 D;  1TR5 A;  2BCO A;  4JI5 L;  1A6X A;  1VDZ A;  1AZQ A;  1KJ8 A;  5M3M H;  1PA6 A;  1GKH A;  2J7Z A;  2VQD A;  2UXD L;  4RCO A;  3SGI A;  4A3B H;  3RD4 A;  1V1P A;  4RGN A;  2XGQ A;  3V6J A;  2B2U C;  4PDB A;  2ASJ A;  2R87 A;  1UEB A;  1EL0 A;  2VQE H;  3ONA B;  3OIP A;  4KY6 A;  4R8U A;  3L4J A;  3I56 A;  3OTO H;  3TRE A;  2A5H A;  4JI6 H;  1MGS A;  2OWO A;  2Z1C A;  2MGS A;  4NXN L;  4GNX B;  1N33 L;  2X0S A;  3M4Y A;  1RKN A;  1XYI A;  2EJF C;  5KT2 A;  1YEZ A;  2WAC A;  5KFL A;  4FXK C;  3TME A;  2KUM A;  2RSO A;  1EY6 A;  4JI5 H;  4DXG A;  4XYL B;  5KG5 A;  1MI2 A;  3ND9 A;  3KAL A;  2K03 A;  4HMI A;  4EG0 A;  2UXD H;  4LMY A;  1NE3 A;  3NE5 B;  4KKS A;  1WTP A;  1VQO A;  4NXM L;  4DV5 H;  2ZT9 C;  1XMQ Q;  2YS7 A;  1B6R A;  3HRZ C;  4CJ0 B;  2K5V A;  2SNM A;  2PPB C;  4I4T F;  3PZP A;  4WD3 A;  4EGQ A;  4JBW A;  1ILQ A;  1PMR A;  4UCR A;  2R8H A;  3ERS X;  1Q7Y C;  2YRW A;  3T5L A;  2B63 A;  2XGT A;  3RIZ A;  4P2C B;  1EUD B;  5KFJ A;  5I2Y A;  4GKJ L;  1J6Q A;  3S15 H;  1HR0 L;  3TII A;  4NXN H;  1N33 H;  3NTH A;  3NP8 A;  1BJT A;  2R8G A;  2P5Z X;  1BQQ T;  3PW7 A;  4K0K L;  3GTO H;  4GC6 A;  5J39 A;  2Y0S A;  3N6R A;  1BGW A;  1WJJ A;  4DL3 A;  1KAB A;  2LSS A;  4A3B G;  2A6H D;  4DL4 A;  1F9S A;  4ZCK A;  1SMY D;  5T1G A;  1BOS A;  1I94 Q;  3K7A H;  3H0G H;  4IJH A;  3GDE A;  1PFS A;  4Q5V A;  1SYB A;  3HOZ G;  3CCV A;  2OEO A;  3T51 B;  5CV6 A;  2YS6 A;  4C2M A;  5J2T F;  3WO0 A;  3OW2 A;  4O4L F;  1YJ9 A;  2V1C C;  1B44 D;  3I70 A;  2JEG A;  3F8T A;  3QR8 A;  1TWC H;  2W6Z A;  1IBL L;  1TS3 A;  4XT1 B;  1AW7 A;  4GKJ H;  2IHE A;  3J7A V;  5KT7 A;  1HR0 H;  1EYD A;  4IO9 A;  2YU9 H;  4RB3 C;  5CR3 A;  3RB3 A;  3HGB A;  4IFD I;  4K0K H;  2N8N A;  2HHH Q;  1HA5 A;  5IP7 H;  1K8G A;  4X66 Q;  1RJP A;  3VA5 A;  4DLK A;  3BDO A;  1VQF A;  3WWV A;  2HD3 A;  1HQR D;  4OWX B;  2ZJP A;  1B1Z A;  3CP0 A;  4MTD A;  3KF8 B;  3T4A C;  4EGV A;  4J9Q A;  1O78 A;  3J81 c;  1UNN C;  2HVR A;  1CUK A;  3NGD A;  1I4Q A;  4XYM B;  4O0A A;  2R86 A;  2PQE A;  1EY0 A;  2C00 A;  3KLS A;  4BBS G;  2MHV A;  3GV6 A;  1UAP A;  4IRD A;  1JJC B;  1IBL H;  1I50 A;  1HTP A;  1IW7 C;  5KNC A;  1YJN A;  1L1O C;  1CQV A;  5KFH A;  5CB4 F;  4F8M A;  5KFV A;  2EQS A;  4JV5 Q;  3U9T A;  2I5M X;  4ME6 A;  1WR2 A;  1SN8 A;  2NVT B;  2R93 H;  2HCI A;  2YZG A;  3E5S A;  5CV7 A;  3KLR A;  3VYR A;  1WCM A;  4A3E H;  3GTP H;  5L1J A;  2HDL A;  5C3X A;  3GTG H;  4DR2 L;  3GIK A;  2ASD A;  3C1E A;  4BY7 H;  2F1M A;  3UFX B;  2QCP X;  4RNN A;  5EWF A;  4DV4 Q;  1PZI D;  4BA1 I;  1AH9 A;  4ZOL F;  3X3N A;  1O7I A;  2Q2H A;  2YTX A;  3OMC A;  2HIX A;  4RMF A;  3K57 A;  4JI2 L;  4B3S L;  1PVO A;  2WB1 G;  4O2D A;  5BPF A;  1LT4 D;  2ATW A;  1C30 A;  5KG3 A;  3S17 B;  1ONL A;  3VR5 A;  1GJX A;  4PV1 C;  2JA7 B;  2NB0 A;  2D0P A;  1I6V C;  1BXR A;  5DG9 A;  4RB0 A;  4DR4 L;  3R93 A;  4O1N A;  3NTI A;  3U9S A;  2WYO A;  1DM0 B;  1T5X D;  5DG8 A;  5KG1 A;  2A6H C;  1TVX A;  2JE6 I;  4CHT B;  1VQ5 A;  2NU7 B;  4DR2 H;  3M4O H;  1QOH A;  4QJF A;  4QY7 A;  3BA8 A;  5IT9 W;  4JI0 Q;  1O7Y A;  1F2Y A;  4A3J H;  4LFB L;  4YWL A;  3GV8 B;  1QWY A;  1JOR A;  4OEL B;  2DPJ A;  5M5W H;  2D0O A;  4JI2 H;  1KDB A;  4B3S H;  3R23 A;  1SNC A;  4RHR A;  4C1N I;  3VR4 A;  4O4I F;  3J80 L;  1KRT A;  2Z0S A;  1DON A;  1CM9 A;  1EY8 A;  1SYF A;  4R9W A;  1UE7 A;  4A3E G;  1YHB A;  1LTT D;  1RHP A;  1LYL A;  4MV7 A;  5KYI A;  1ROD A;  4BY7 G;  4UFZ A;  3T5H A;  2J6T A;  4DR4 H;  4MA0 A;  3S1R H;  1MJE A;  1LUZ A;  1RTN A;  2KCM A;  3PQI A;  1IBM L;  1K3B C;  1I5F A;  1E4E B;  1B04 A;  1U4P A;  2F0E A;  5FPO A;  1NAP A;  1PZK D;  3TP7 A;  4CDD C;  3PO2 G;  4LFB H;  2RHS B;  4DR3 L;  3HFZ B;  4OO1 I;  1ILP A;  3PW0 A;  4NW2 A;  2VQF L;  4ABN A;  3CPF A;  1Z2P X;  4LH7 A;  4V0B A;  3S14 B;  4JVZ A;  2QIL A;  1AE3 A;  1SYE A;  1W6J A;  1SNM A;  4R4O A;  1FNU A;  2NVQ B;  2EVB A;  4OWW B;  4J1M A;  1N32 L;  2B63 H;  3HP3 A;  3BJU A;  5DQG A;  3KOJ A;  1JOO A;  3E5N A;  1MSH A;  2K5W A;  3ZYY X;  4DNT B;  4RAU C;  4LF7 Q;  4FF3 A;  1U4R A;  3HOV G;  1LTR D;  3CQZ B;  1H95 A;  2B2Y C;  2SOB A;  3QO2 A;  5JPN C;  2AQ3 B;  1IBM H;  1TKW B;  4JV1 A;  3F2D A;  3QOL A;  3U4V A;  2K75 A;  1L2Z A;  3GQC A;  1QVG A;  2PQA B;  1GSO A;  1ASZ A;  2MO1 A;  4DR3 H;  1A8V A;  3M4Q A;  3G6X A;  4A93 B;  3CW2 C;  2VQF H;  3RAX A;  3EBE A;  4C2M H;  4XDX A;  5L1L A;  3T53 B;  4A3L G;  4Q0F A;  4IPD A;  1NR2 A;  4X3T A;  2ZTE A;  4ZKC B;  3MWE A;  4K14 A;  1WSC A;  5GON F;  1N32 H;  3J7Y W;  4OON A;  2DWC A;  2PYK A;  3Q8P B;  1RIP A;  3A5U A;  1RYR A;  4JV2 A;  1RJQ A;  3HZX A;  4PQX A;  4NP5 A;  1SDF A;  1XWE A;  1I3Q B;  2E2J B;  4HID A;  1VQB A;  1HNZ Q;  1HNW Q;  2VUM A;  5T14 A;  4LF5 Q;  1U5K A;  4IZO A;  1VQG A;  3RN5 A;  3S1N H;  5EDW A;  3HKZ E;  3MZ5 A;  4ALP A;  4DK3 C;  3GIQ A;  3AFP A;  4BY1 G;  3CC4 A;  5HGQ A;  2JA6 G;  1GLV A;  3AMU A;  1LAB A;  1K0R A;  1I6U A;  2P0A A;  2AMC B;  5CBA E;  2CFM A;  1A2U A;  2AUK A;  3JSL A;  4OIJ A;  4EFE A;  1Y1W G;  1ZYR C;  4Q43 A;  3M9B A;  1I50 H;  4HSV A;  4DL5 A;  3LWB A;  2B3G A;  2Y0S G;  1S9F A;  3RV4 A;  5A2Q W;  1V9P A;  3D0F A;  1L2F A;  1QIL A;  1LAC A;  5H1S E;  1WTQ A;  1RK5 A;  2R82 A;  4U7C A;  1I6H H;  3FP9 A;  3TEH B;  2F0D A;  4C3H G;  4IPC A;  1PV4 A;  3JAM c;  1EY7 A;  1KDC A;  3DHQ A;  3T16 A;  3EJI A;  1XJV A;  4DF7 A;  2W71 A;  1A9X A;  4ECS A;  1PDQ A;  1K9M C;  4LF9 L;  3BG5 A;  1WCM H;  1SJH D;  4G7H C;  3U4Z A;  1EY9 A;  1IBK L;  5LMN L;  1GUW A;  4IR1 A;  2NVY B;  3KF6 B;  1Q8I A;  2XRS D;  2A68 C;  4R8N A;  4JK1 C;  3G6Y A;  3LGJ A;  1Z6H A;  3HOY H;  2CKZ B;  2Q8R E;  5FLX E;  4C3I H;  2F3V A;  1PFM A;  1XXG A;  5BN4 A;  5JVG 3;  1VQI A;  3I2Z A;  1QNU A;  4LUV A;  5A35 A;  2PN1 A;  2J0T D;  1BVS A;  4LF6 L;  3T5K A;  1RJT A;  1E1T A;  2ALZ A;  4QGU A;  4L5T A;  1MJC A;  5D1O B;  3M7N A;  3AFQ A;  1IBK H;  1G2S A;  2FB9 A;  4PZ6 A;  5LMN H;  2FXQ A;  3M9N B;  3MWM A;  1WD1 A;  3MA2 B;  5E3F A;  1YIT A;  3VPC A;  4F50 A;  3K58 A;  4JI3 Q;  3ULL A;  4JBK A;  5DLG A;  2HIV A;  2AKW B;  3IFD A;  3CXC A;  4X65 L;  2W7O A;  1HZA A;  3PO3 B;  4LF8 L;  2BOS A;  1ZQ7 A;  1KC7 A;  4JUZ A;  1Y1V B;  2UUA L;  1ENF A;  1SE8 A;  1SRU A;  4ME3 A;  4J9K A;  1R9T A;  4IAJ A;  4G4K A;  2CWP A;  5G3L D;  4KY7 A;  1ML0 D;  3VR6 A;  3TS0 A;  3ETJ A;  4DL6 A;  1WCM G;  4X62 L;  5JVD F;  4LF6 H;  4MAM A;  5KT3 A;  1SNQ A;  4Q0Y A;  3BAA A;  2ZDG A;  1TT2 A;  2M05 A;  4LNQ A;  5KT5 A;  4ED2 A;  4TVA B;  1AUX A;  4DV3 Q;  2FK1 A;  3DWQ A;  2R7Z B;  4MV9 A;  3PUZ A;  4KKT A;  4DAM A;  5KFQ A;  2EY5 A;  4UCU A;  4Q45 A;  4X65 H;  4ED3 A;  5FLX c;  3WOE A;  2F0W A;  3I4M B;  1RJR A;  3ITP A;  4ID6 A;  4U68 A;  3RB0 A;  4LF8 H;  2NVX A;  3SK8 A;  1EQR A;  5IWA L;  2UUA H;  3KHH A;  5J22 A;  4A3G B;  4ZI7 F;  1YZ6 A;  2KA7 A;  3PV0 A;  2UXC Q;  1HZ9 A;  1HZC A;  4RH6 A;  5KG4 A;  4ZYS A;  4G3I A;  4FS2 A;  4X62 H;  4YR2 A;  2EJM A;  3Q8Q B;  4GZY C;  3VYS A;  4ILW A;  3NBH A;  1BO0 A;  5EJW A;  4DV7 L;  1QE6 A;  1PTO B;  1GYF A;  4DA2 A;  4OWT B;  2Q2U A;  3G8C A;  3QWN A;  1UC9 A;  3R8B A;  5EKI A;  5FO8 B;  1H9J A;  5BN3 A;  2K5N A;  3TIN A;  1SR3 A;  2F0P A;  3OUU A;  4N9P A;  3RZO H;  4KD4 A;  3UE1 A;  5IWA H;  2MFI A;  2R92 G;  1WVL A;  4ECX A;  4IOA A;  4CKE A;  2ZXR A;  3BA9 A;  2L15 A;  4JYA Q;  2KEN A;  4DKA C;  4QIW A;  1KJ9 A;  5C3E B;  2V59 A;  3C3L A;  3VMM A;  1CKN A;  4DV7 H;  1D6E C;  2EXD A;  2RDG A;  4IRC A;  1BCP D;  4GC7 A;  2RQX A;  2VXW A;  1NUC A;  4YIJ A;  3J7A K;  1X9N A;  2VUM H;  2AGO A;  1LM0 A;  3GIM A;  1PRT F;  2L12 A;  2PO4 A;  3HOX B;  4JC0 A;  5NUC A;  1KJI A;  3I73 A;  4K8I A;  2NUA B;  1W2B A;  3L0O A;  1KJJ A;  4O3N A;  1VCI A;  1TWF H;  2CH4 W;  4A3K B;  5CA1 F;  2EYP A;  3V4S A;  3D31 A;  3S1Q B;  4A3I B;  2UUC Q;  1KLG D;  1EWH A;  1PZJ D;  4Y52 H;  2Z6B A;  4R7R A;  3Q8D A;  1MZB A;  4X3K A;  5CV8 A;  1YNJ D;  3VYT A;  3GID A;  3UE0 A;  2N49 A;  1L1O A;  3VA7 A;  4BWS C;  4WBN F;  3GIP A;  5KGU A;  4ZUJ A;  3NK9 A;  2R7F A;  3GTJ H;  4DK0 A;  3MVV A;  5T1I A;  3OW7 A;  2XSC A;  2A69 D;  5IGD A;  5HUR A;  2NZO A;  3CCE A;  1Y69 U;  3H3V H;  2KSW A;  3S16 B;  4RCN A;  1VBG A;  3GQB A;  1XX8 A;  2C22 A;  1NY4 A;  1S4Z A;  1WFQ A;  2E75 C;  4ED6 A;  5IYC H;  4EEY A;  2DPI A;  5KKN B;  3KK7 A;  2PMZ A;  4MZ9 A;  3UDG A;  3DXJ C;  2ZTD A;  4IPG A;  4UCT A;  2I46 A;  5DM6 3;  1CA6 A;  1OXV A;  3FMC A;  4Q44 A;  1WTR A;  1SFO A;  4DV0 L;  3URY A;  4B9X A;  3E0E A;  2ZM6 Q;  3HBL A;  4DPG A;  4GN5 A;  5M5X H;  1UEA B;  3I4N B;  1KNA A;  1VQ4 A;  1H9S B;  5IP9 G;  2VPQ A;  2OQ0 A;  5LXT F;  4FDB A;  3K5L A;  1HRJ A;  1V43 A;  3A55 A;  2ID0 A;  2WB1 A;  1GD7 A;  3AQQ A;  1S0N A;  2CQA A;  2ZXO A;  4YHH Q;  4B3R Q;  5C4X G;  3P75 A;  2K52 A;  2J9G A;  1AE2 A;  3JAM i;  1JJ2 A;  4YCW A;  2JXM B;  2RA4 A;  2QDL A;  1CQI B;  3J7A F;  4YCV A;  2ATL A;  2JQO A;  5IT9 c;  3F2B A;  2R85 A;  3HOU G;  5ELB A;  4CJ2 C;  4O3P A;  4DV0 H;  1JCK B;  2XCA A;  3GTQ A;  5LP6 F;  1HQM C;  1PRT D;  2Q2T A;  4LF4 H;  1KEE A;  1R9T H;  1Z2N X;  2N55 A;  2ZJQ A;  5IGC A;  4HIO A;  3H94 A;  1FJG L;  1QG7 A;  1KNE A;  1FR3 A;  3VR2 A;  4UPA A;  4CBV A;  1J5E Q;  1S0O A;  1A3V A;  1KJQ A;  3T1H H;  2WKC A;  5C8Y F;  3RFC A;  4GLV B;  2R8J A;  2WIN B;  3JRX A;  2XNA C;  4J15 A;  4BBR G;  4M8A A;  2BH2 A;  3K3V A;  4KHV A;  1NMF A;  5J2U F;  4AIM A;  2JA5 G;  4BXX G;  3C2P A;  1NMG A;  3HOW B;  5M5Y B;  3R3O A;  3K6O A;  1B33 N;  2IP4 A;  3D6W A;  1TS5 A;  2NVX H;  4LFA H;  2L1B A;  4ECY A;  4IR9 A;  5DG7 A;  1ET6 A;  1FJG H;  5GAH C;  4P73 A;  5DQH A;  1FL0 A;  2FK3 A;  2PNH A;  5C0X J;  2F03 A;  2TSS A;  2WFW A;  1VQ6 A;  3S1M H;  4JI5 Q;  1YI2 A;  4JI6 L;  2IWH A;  2DIK A;  1IL8 A;  4C56 C;  5L9X A;  2A69 C;  3BVM A;  1KXL A;  1SRO A;  3CRK C;  4XIG S;  1C3O A;  1S10 A;  2VZA A;  1ENC A;  3PR5 B;  2F0G A;  2UU9 Q;  3IN5 A;  2M00 A;  2RKS A;  1DOM A;  4YAJ B;  5IY0 A;  4HTH A;  2Q8T A;  2VNU D;  2J6S A;  3S2H B;  4Y7N H;  4MHE A;  1U4M A;  1FGU A;  4X64 L;  4ED8 A;  5CYU A;  5DLF A;  4EFB A;  3PMF A;  1LT3 D;  2WAQ G;  4LSA A;  2B29 A;  4U67 3;  5FJ8 H;  4EVO A;  5EPJ A;  3KJP A;  4DV5 L;  4YP3 A;  2FLP A;  4IN3 A;  5C44 G;  4DV1 L;  1SE4 A;  4NXN Q;  1UWV A;  2E74 C;  4C3J G;  4JCV E;  3HOZ H;  5FD5 A;  3RGZ A;  4HJA A;  2I87 A;  2NN6 H;  2QF7 A;  1L0W A;  1RL2 A;  5K36 G;  4JBJ A;  1KDA A;  3GO5 A;  2WE6 A;  1CTM A;  1E4E A;  3BQ2 A;  1B3A A;  2DNC A;  2PZW A;  2ASB A;  3NWT A;  2JA8 G;  4TV9 F;  3IFT A;  4NXM Q;  4JG2 A;  1ASY A;  3G6E A;  2K6A A;  3NEN A;  3PW2 A;  5M3M B;  4KD3 A;  3Q23 A;  3BYT B;  3PIP A;  1C9O A;  5KFT A;  3M9M B;  1PFB A;  5CV4 A;  4X64 H;  5FLX W;  4WFN 3;  3J80 E;  3PF4 A;  4GKJ Q;  1C0A A;  4DV1 H;  5LYJ F;  3ICE A;  1IOV A;  4EGJ A;  3TSS A;  2GPW A;  1G91 A;  2JA6 A;  5EGT A;  1PRT C;  1TWA B;  2VB2 X;  2R6F A;  4PNY A;  1FYC A;  1SAP A;  2Y0S E;  4H0L C;  4BBS H;  1PH2 A;  1NJI C;  2CQY A;  3BZD B;  3JZI A;  1BUV T;  4YY3 L;  1Y1W A;  2R6G A;  4R8I A;  4TUY F;  4JPB W;  3MFH A;  2B2W A;  1RCV D;  2KBN A;  3MC0 B;  3T13 A;  1F9P A;  4KJO A;  5FJ8 G;  2W9C B;  4R4Q A;  3LWU A;  1FGB D;  5D3I B;  3U58 A;  2E76 C;  4QWB A;  1ZKO A;  2MNA A;  5C6A A;  2NN6 G;  1SFO H;  1R4P B;  1V8Q A;  4KMU C;  3N41 B;  2L0C A;  4QWC A;  1K3R A;  3T1Y Q;  1F9Q A;  3S15 B;  1I3Q A;  1Q90 A;  4YWM A;  3UDI A;  4HJ7 A;  1SNO A;  1CT1 D;  4GNX C;  4N8F A;  1VF7 A;  1UUP A;  4HED A;  3K0Y A;  2MPM A;  2B8F A;  3DLL A;  4LSX A;  2C2D A;  4YY3 H;  3GTO B;  3I55 A;  2FMM A;  1K8A C;  5CV5 A;  1K83 A;  3EPG A;  2AUJ D;  4JI4 Q;  2VB3 X;  1JIC A;  1VMC A;  2DY8 A;  2BDN A;  3K7A B;  1JQY D;  2Q2I A;  3H0G B;  4TV8 F;  4IFD J;  1T94 A;  2BH8 A;  1CKO A;  1NBW A;  1JJG A;  3LNN A;  4ZAI A;  2CW0 D;  3MEH A;  4XXE A;  1XMQ H;  1FD7 D;  1U4L A;  2CVR A;  5KRU A;  2W8L A;  4ZQI A;  2W9A A;  1AEX A;  2TMP A;  1BXT A;  3GTQ H;  3BYY B;  1TQO A;  1TWC B;  3U9O A;  4QW9 A;  3ULP A;  1PH8 A;  3G4S A;  2JSO A;  2YU9 B;  5E1F A;  5M9O A;  4L63 B;  3TBI B;  5KFB A;  3MXU A;  3V6H A;  1EIY B;  2NVT H;  1BKB A;  1EOV A;  1QUQ B;  2RHQ B;  2HHH L;  1EUC B;  3TN2 A;  5D14 A;  4CJ1 B;  4DUZ Q;  2OTJ A;  4H7B A;  2IX1 A;  1B9M A;  3ERQ A;  2Z6K A;  3X3M A;  1B8A A;  2W9B A;  4QWA A;  5HBR B;  2V4D A;  2RF4 A;  1EYC A;  2KEC A;  2KHJ A;  3Q1K A;  2XC9 A;  1IZ6 A;  2EY2 A;  1N9W A;  1HJP A;  1GUN A;  5KT6 A;  4PMW A;  2E2I A;  2OT2 A;  3MTS A;  1PLF A;  4TRD A;  3RZD B;  5KFM A;  4DGZ A;  3NUC A;  1RD9 D;  3RJ0 A;  4TQU S;  2RGV A;  2B39 A;  3KBG A;  1TA8 A;  1GHJ A;  4UCO A;  5ELE A;  5DAU A;  3PO2 H;  3A8I E;  3OHA A;  3E3X A;  3H4D A;  2LXJ A;  4APM A;  1T36 A;  1TY0 A;  3A8J E;  2UUB Q;  2YYZ A;  2HHH H;  3A8K E;  4X66 H;  1SBB B;  1CSQ A;  2B8G A;  4JV5 L;  5DNF A;  1KL9 A;  4ZKB B;  5LMU Q;  4NKL A;  1EUJ A;  2YTV A;  3H3V I;  2R93 B;  3AEV A;  4A75 A;  3MXN B;  4NPS A;  3GTP B;  4IJL A;  5KFO A;  3GTG B;  1SMY C;  2EYH A;  3HOV H;  4O2A F;  2K5D A;  2K01 A;  4L5S A;  4FF1 A;  1JE4 A;  1OXT A;  4DV4 L;  5E4X A;  1CKM A;  1EYA A;  4DR7 Q;  1Y1V A;  2MJ8 A;  3A0J A;  4CKB A;  3N8D A;  4ZHQ F;  4DV2 Q;  4OIK A;  5EAY A;  4DR1 Q;  2YL2 A;  2E2H A;  1MIU A;  4G57 A;  1Q81 C;  4J6H A;  3VYU A;  1XNR Q;  4C5A A;  2RDH A;  1VQ7 A;  1V4Y A;  3GTK A;  4RZR A;  4FYD A;  4JV5 H;  2QA4 A;  1M0T A;  5LA6 F;  2R92 A;  3SDZ A;  4A3L H;  1IKM A;  4F4Z A;  3KAK A;  1B4O A;  1EFW A;  1Y8O B;  4QB4 A;  2YZN A;  1IHZ A;  4POF A;  1YVC A;  2R7N A;  3K80 C;  5KFP A;  3I4O A;  4L1K A;  2VQF Q;  4NMZ A;  3M4O B;  2GA4 B;  4RKB A;  2ZTC A;  1BNZ A;  3GIJ A;  1SJE D;  1SYC A;  2YV5 A;  1E2V A;  4A3J B;  2QK4 A;  4YR3 A;  5FD6 A;  4DV4 H;  4JI0 L;  2KCC A;  1HR0 W;  4JI1 Q;  5M5W B;  1V1P B;  1ESR A;  2RGR A;  3J81 L;  3K5M A;  1I4G A;  1BR9 A;  3H09 A;  1K8O A;  2PZU A;  4DAV A;  1S68 A;  5JEA J;  4BY1 H;  3V2T A;  2JA6 H;  3MFG A;  1W93 A;  1E7Z A;  3M4P A;  4O42 A;  5JUM A;  4A3C G;  5IGF A;  4AYB A;  1EY5 A;  5COR A;  3FVQ A;  1C4Q A;  2IHF A;  1EQT A;  1Q1B A;  4B08 A;  3S1R B;  1Y1W H;  1EWC A;  2PI2 E;  3N43 B;  3CAM A;  1DCZ A;  4NDX A;  1CE8 A;  1PH3 A;  3GTM A;  4ULL A;  4CGY B;  4DUY Q;  1VQH A;  2XIW A;  2F0S A;  1W6K A;  4JI0 H;  3RAQ A;  4MTK A;  1F77 A;  4KTA A;  4C3H H;  4F88 A;  1XMO Q;  4DR6 Q;  3K3P A;  3QFF A;  3P1H A;  3H15 A;  3FPU B;  2D5D A;  4HAE A;  5KEE A;  5BMV F;  3STB D;  3NSW A;  4K5X A;  4ME5 A;  2C9O A;  2EIF A;  2LKV A;  1GGO A;  3RBD A;  2V58 A;  2B63 B;  4KHP L;  3SE7 A;  3KDF A;  4YQW A;  1VQA A;  5F2D A;  2A19 A;  2HCC A;  1I3Q H;  3RLO A;  2C2R A;  3PIP 3;  2VPS A;  5JVL A;  1K73 C;  2JEA I;  2X6L A;  1Z9F A;  4Q8F A;  3CCJ A;  5J3B A;  2RDJ A;  2PZT A;  1IL2 A;  1SEI A;  1IYU A;  2Y0S B;  1K83 H;  3TP5 A;  4XQJ A;  2EDG A;  3IRB A;  1F2M A;  5D8D A;  1KC8 C;  3MR3 A;  3R2I A;  1SMX A;  1PTO F;  2AWO A;  5G3L F;  4R4T A;  2I80 A;  3S9W A;  4IQZ A;  4MIU A;  1S3O A;  1KIX A;  3P20 A;  4C2M B;  3IL8 A;  1Q12 A;  2RBM A;  3KBX A;  1GOZ A;  1E1O A;  2K33 A;  2AWN A;  4HR7 A;  4GN3 B;  5FLM G;  4HQ6 A;  3BQ0 A;  4KHP H;  3JSN A;  5L1K A;  4LJZ C;  2I5L X;  2IPK D;  1E0B A;  4O3O A;  2NN6 I;  4MV4 A;  4O3R A;  4A93 G;  3WO1 A;  3GD7 A;  4EYI B;  2A8V A;  4LF9 Q;  1DOK A;  1V1O A;  5KYL A;  1IBK Q;  3GP7 A;  4B3T Q;  3RUP A;  4YR0 A;  3I7F A;  5ELD A;  4ECW A;  3OPO A;  5LMN Q;  3GLK A;  4A2B A;  2B2W C;  1HNW L;  3S1N B;  4FXD A;  1IOW A;  4B3M Q;  1PH9 A;  4KN4 C;  4LF5 L;  2F0O A;  1PH7 A;  3G71 A;  1JT8 A;  1STN A;  2ALY B;  4ECT A;  2UVR A;  1ENA A;  1LV9 A;  2FKL A;  1ESF A;  3OSO A;  4P74 A;  2PW7 A;  2EYO A;  4DAY A;  3RV3 A;  4IUN A;  1F2L A;  3J80 i;  1Z2O X;  4C5B A;  3GV5 B;  2E2I H;  2UXB Q;  2JA9 A;  4EBC A;  2F4V Q;  3F1Z A;  4J9M A;  1I50 B;  3SK6 A;  1LTL A;  1RDP D;  1MHW C;  4LF6 Q;  4MV8 A;  4ECV A;  2JA5 A;  3I4L A;  1B2T A;  1X56 A;  4C1N K;  1EEF D;  3C0F B;  5IYD H;  3SK4 A;  3RTX A;  3TQY A;  4IUQ A;  4I55 F;  2F0J A;  3H6M A;  4A3F H;  1GHK A;  3I72 A;  1WTV A;  5GAG C;  4RAY A;  4DNI A;  2L5T A;  1Z47 A;  2O5J C;  1HNW H;  1HNZ H;  3G48 A;  4WJW A;  1I7L A;  2W6N A;  4CKC A;  2JEF A;  4LF5 H;  1NNX A;  3PSI A;  4JI7 L;  1WCM B;  2IX0 A;  3L2P A;  2JP1 A;  4Y8V B;  5LL6 b;  1VQ8 A;  3G6J B;  1WTX A;  3J80 W;  2R3Z A;  4LF8 Q;  1HUM A;  2SNS A;  5FO9 B;  2C28 A;  4A4I A;  2E2D C;  2UUA Q;  1SCU B;  4V19 0;  1MSG A;  4TQS A;  4J9R A;  1Y1V H;  1GXD C;  2EPB A;  5EQ0 A;  1DXM A;  5BR8 Q;  1BCP F;  2K14 A;  3FKI B;  2QEX A;  3HOY B;  1K1Q A;  1VQE A;  1VBH A;  1TWG A;  3KAJ A;  2E2H H;  4CDF C;  3STB C;  1MKH A;  4C3I B;  3Q0A A;  2F0N A;  1II3 A;  3CU7 A;  1JOK A;  2VA2 A;  1PFN A;  1PTO D;  1N34 L;  1TWH B;  2HVS A;  3GTK H;  5DQI A;  5C4Z A;  2HVQ A;  3RN2 A;  1NTG A;  2BA1 A;  2R92 H;  1CHQ D;  2WAQ A;  3Q22 A;  1A63 A;  5C0X G;  3H40 A;  3GV3 A;  1A3T A;  4JI7 H;  5KND A;  1QVF A;  2Z6K C;  3PF5 A;  2IA6 A;  1LTS D;  2K4K A;  3K59 A;  1IYV A;  1JMC A;  2GVB A;  2HQL A;  1CI3 M;  1PX2 A;  2W70 A;  3VPB A;  5IWA Q;  1KAW A;  3CCR A;  3UQ8 A;  5KFA A;  4QMG A;  1XNQ L;  3BZK A;  2FIN B;  3W1B A;  5IYD G;  4A3G H;  1JIH A;  1ET9 A;  2EXZ A;  1O75 A;  2I07 B;  4A3F G;  2EYL A;  3WOF A;  3I90 A;  4RGT A;  2A6E D;  3TZD A;  4GKK L;  1H9K A;  4A3D H;  1N34 H;  2YW2 A;  2DUD A;  1S5D D;  5C1O A;  2ZDQ A;  3R5H A;  3F8N A;  3HXL A;  4UCV A;  3GII A;  3EYY A;  3PO3 G;  1Y1V G;  1PXU A;  2R7L A;  3GTM H;  2QDB A;  4XQN A;  2MCT A;  1BDO A;  4DFA A;  1XNQ H;  5GAD C;  2A1A A;  4JI3 H;  3E9H A;  2FE3 A;  5C4J H;  4QWD A;  3KHG A;  2R8K A;  2WII B;  2JEI A;  2F0V A;  3MR5 A;  2XVS A;  4PG3 A;  4J9S A;  1GVP A;  5FPR A;  4GKK H;  4QIW E;  2R7Z G;  3P7J A;  1OTC A;  4JI8 Q;  1YBY A;  1JE5 A;  1KQS A;  1HNX Q;  2EYM A;  2UXC L;  5I47 A;  3DWP A;  4K2L A;  4YJ2 F;  1ICW A;  4GNX A;  1KHI A;  3V96 A;  2W7P A;  1NCV A;  3F2U A;  1WTW A;  3I4M G;  3VPD A;  1CS0 A;  3PW5 A;  4DV3 H;  4FBU A;  4AQY Q;  1QZG A;  4A3G G;  4O3Q A;  4DV6 L;  3RB6 A;  1S03 G;  5IP9 H;  3OSN A;  3QB3 A;  4PWQ A;  1UE6 A;  1STY A;  4E4T A;  3DF7 A;  4A3D G;  3RZO B;  5C4H A;  2H5X A;  4ED1 A;  1SLJ A;  4JOI A;  3S1Q H;  4UCS A;  4QW8 A;  5KFU A;  2K05 A;  1BBW A;  4A2A A;  5CV9 A;  3OHB A;  1AZP A;  4AYB G;  1WYD A;  2HQE A;  4DAP A;  5C4X H;  3M4I A;  1TWA A;  3ZJY C;  2SCU B;  2E5L Q;  1N8R C;  1JDB B;  5HY6 A;  2UXC H;  3OOC A;  4IAL A;  5C1P A;  2O4X A;  4LUO A;  1F9R A;  4JYA L;  4M1U B;  3VR3 A;  1PTO C;  3HOU H;  2IT1 A;  5LMN W;  4HJ5 A;  4X3S A;  1DJR D;  2ZJR A;  1DOL A;  2NYZ D;  5DGA A;  4RFB A;  2BQR A;  2R7D A;  1M7J A;  2FMC A;  3FPP A;  4FF2 A;  3N44 B;  4DV6 H;  2VUM B;  2NUC A;  3O13 A;  5IOD A;  2QKI C;  5ISR A;  1G6P A;  5I2X A;  5L1I A;  2W57 A;  2PMZ E;  2C35 B;  4A76 A;  1SE3 A;  4RHS A;  2OLS A;  5C3E G;  3TZU A;  2GLT A;  2AHO B;  3DWA A;  2XN9 C;  5KFD A;  5JJZ A;  3HKZ B;  4YCU A;  1TWF B;  3NQT A;  3LX0 A;  4IFD G;  3SEB A;  2XCL A;  2W8K A;  3TRZ A;  3NBI A;  3CMA A;  3A7A B;  4GLA C;  4BBR H;  2UUC L;  5KFE A;  3HOX G;  4JYA H;  2A6E C;  4LFC Q;  2JA5 H;  4BXX H;  3GTO A;  5D65 A;  4LF4 L;  2WB1 E;  3GTJ B;  4FP5 D;  4A3K G;  4OX9 Q;  1SXT A;  1UE5 A;  5K2M A;  4ZUI A;  5J1Z A;  3C1F A;  3KF8 A;  4A3I G;  3T1H L;  1GUS A;  5I9P A;  2O5I C;  2VA3 A;  1UE1 A;  5KFK A;  5LOV F;  1PH4 A;  3SXH A;  3BDC A;  2XRQ D;  1CZW A;  2EE1 A;  1PH5 A;  2IY5 B;  1O7L A;  4G7Z C;  1N36 Q;  4RU9 A;  1CHP D;  4GOP B;  3S2D H;  1VQC A;  3N52 A;  2UUC H;  2F52 A;  1TWG H;  4R4I A;  1X3E A;  3D4W A;  5M5X B;  2ZM6 L;  4FU0 A;  4LFA L;  2C2E A;  2DY7 A;  2NU9 B;  5ELC A;  4ETS A;  3H91 A;  1T9H A;  2HJW A;  2BR0 A;  1IKL A;  2F4I A;  5F9L A;  4YB8 B;  3K5I A;  3DUZ A;  3NXW A;  3GTL B;  1GSH A;  2RVL A;  3KTM A;  2H1E A;  3W2D A;  5I4D A;  3F2C A;  5IIF A;  5C44 H;  1BCP C;  4O3S A;  2E8G A;  2EOT A;  4YHH L;  1HTL D;  4C3J H;  1CK1 A;  4ZK9 B;  3I4N G;  4B3R L;  1MD2 D;  1D5M C;  3K81 C;  4M7E A;  4ED7 A;  1E2W A;  3Q6S A;  3UDX A;  4KLK A;  5K36 H;  4KKU A;  4DR5 L;  1LT6 D;  1OO9 B;  1QCB D;  1VKZ A;  2Q8I B;  4IUP A;  4WJ3 M;  3PN1 A;  4A3M H;  2ZM6 H;  2JA8 H;  5CAE B;  3PR4 A;  4QL5 A;  1P8L A;  3OMG A;  2VQE Q;  1D5Z C;  1R9T B;  3G6V A;  2ICE C;  4X6A H;  2JA7 A;  2QGQ A;  4CC6 A;  1D5X C;  3OTO Q;  2GPS A;  5DLQ E;  1KRS A;  4JI6 Q;  4POG A;  1EOT A;  3KHL A;  1J5E L;  1YNJ C;  5CA0 F;  5KIX A;  1IYJ B;  2H4O A;  3DM1 A;  3GTP A;  1DZ1 A;  1HFG A;  1E24 A;  5M3F H;  4YHH H;  2IMW P;  4B3R H;  3V4Z A;  1QZH A;  2RSN A;  1J9O A;  2SEB D;  1G6Z A;  1SYX B;  2UXD Q;  2K50 A;  2V4R A;  4DR5 H;  2DZD A;  5FKA C;  2G9D A;  2ZXP A;  1LT5 D;  4DV5 Q;  1FNV A;  1X32 A;  1ZHQ A;  4DV1 Q;  3IG0 A;  2F0Q A;  1OXX K;  3I12 A;  1VQD A;  4ECZ A;  1EWI A;  4EQP A;  3ND8 A;  5CMD A;  1Q46 A;  1K0S A;  1O7Z A;  1RK6 A;  1Q3L A;  1PH6 A;  1VQJ A;  2BA0 A;  4RB2 C;  4HCS A;  3M3Y B;  3N42 B;  3W5O A;  1N33 Q;  5JEA G;  3OHX C;  3RBE A;  4PMB A;  5KG6 A;  1J5E H;  3HOW G;  1TY2 A;  1STG A;  3NBH B;  2R61 A;  4OO1 G;  3S1M B;  5KG0 A;  2Z4H A;  1S5C D;  2NTT A;  3ER0 A;  5AJ3 L;  2G5D A;  3KUP A;  1LLR D;  3EQL C;  3OWF A;  1EIH A;  4A3M G;  1UC8 A;  3EPI A;  2AQ2 B;  3RMH A;  1I4P A;  2UU9 L;  1FVI A;  1LTG D;  4P71 A;  2K7V A;  4Y7N B;  1XPO A;  3A54 A;  3J7A 5;  1IW7 D;  4KHZ A;  2ASL A;  4A3B B;  5EPL A;  1Q8K A;  3PCO B;  1M8A A;  4HSP A;  5IE8 A;  2R7M A;  3Q2O A;  4FS1 A;  1TWA H;  4ECR A;  3CHB D;  5IT9 L;  2FFK B;  2K28 A;  2L11 A;  5L37 A;  2JEB I;  1HR0 Q;  5M3F G;  4QIW B;  4MTE A;  1B7Y B;  4YY3 Q;  4I50 F;  3HOZ B;  4K0K Q;  5GQO A;  1YIJ A;  1VQP A;  5COY A;  1CKN B;  3IAY A;  3CQZ A;  3EFX D;  2HUG A;  3BQ1 A;  3I8Z A;  3K5N A;  1S97 A;  4XYQ A;  3B6Y A;  1STH A;  4EEQ A;  2PQA A;  5E4W C;  2YTY A;  2JN4 A;  3UDF A;  1PK8 A;  1G51 A;  1EEI D;  3D4R A;  2AU0 A;  1I4R A;  2FLN A;  2UU9 H;  1EQV A;  2FHT A;  4KJN A;  3J81 E;  1Q1E A;  1X6O A;  1X3Q A;  5CC4 A;  2F0U A;  1NSN S;  2W6O A;  1IBL Q;  2XD4 A;  1DD2 A;  4BS9 A;  2KVM A;  1XMQ L;  1P16 A;  4RA8 A;  3PIO A;  4HMJ A;  2JJQ A;  5M3M G;  1CFM A;  4L5Q A;  1L1O B;  2LXK A;  3BS1 A;  2AQ1 B;  2WP8 J;  4QUC A;  5I6Y A;  1HHV A;  4BBS B;  2ES2 A;  1WTH A;  4IUT A;  2F0M A;  1QB5 D;  1WTO A;  5JOB A;  4RZQ A;  3H20 A;  3CCS A;  2B2V A;  2ICI A;  3L9A X;  4NXM H;  3BU2 A;  5FK9 C;  1STE A;  1EYG A;  1D8L A;  2W9C A;  1I94 L;  2PMZ B;  3J80 c;  4J8Q A;  4JOI C;  1A3U A;  5EKK A;  1H9M A;  3D4D A;  2VY3 A;  1B3Q A;  1CZG A;  2CW7 A;  1SFO B;  2KEE A;  4RGM A;  2NU8 B;  4NLG A;  4YJ3 F;  4FF4 A;  4L6T B;  4IPH A;  1JDE A;  1EFI D;  3T1Y L;  2OQK A;  2V5A A;  4Q8E A;  2IBK A;  1K28 A;  3EA6 A;  2RDF A;  2WB1 B;  4I65 A;  1ULZ A;  1KD1 C;  3K5H A;  4EYH B;  4UP9 A;  1VQM A;  1LTA D;  4X66 L;  4DR2 Q;  4JI4 L;  3LML A;  4WOR A;  2PVP A;  1EY4 A;  4QF4 A;  4XQQ A;  2NVY A;  3KF6 A;  1I94 H;  1PH1 A;  1YNN D;  3E6Z X;  5JJK A;  4R4C A;  5TSS A;  1X3G A;  3PGZ A;  4JI2 Q;  4B3S Q;  3DEP A;  2L55 A;  1PYW D;  3RZD H;  5C5L A;  2F0T A;  2HDM A;  2K5Q A;  2YYA A;  4UY8 C;  2Z9H A;  2VR1 A;  5KX5 F;  3GTQ B;  2F0F A;  3JC6 6;  2HGS A;  4RB1 A;  3S17 H;  5HV6 A;  3T1Y H;  4N8X 1;  2JA7 H;  3H0G G;  1SEB D;  4H02 A;  5C5J A;  5KFI A;  4ECU A;  4EBE A;  1N48 A;  1PYB A;  3NEM A;  4DR4 Q;  4KY5 A;  3R5F A;  2IW3 A;  5LHY 1;  1VQ9 A;  2OCE A;  4HNV A;  3CRL C;  1I4X A;  5D1O A;  4HIK A;  1YHQ A;  2V9W A;  1D7Q A;  5KFR A;  4JI4 H;  1BF4 A;  5A2Q L;  4HJ8 A;  4DUZ L;  1HXY D;  5KFN A;  4IUR A;  4RAZ A;  1SYD A;  4A3C H;  4LFB Q;  4A3E B;  4L8J A;  2O2L D;  1S5F D;  3BVG A;  4BY7 B;  3FKI A;  4EX5 A;  1HPC A;  5IP7 G;  2RCF A;  4N9T A;  2NZH A;  4BWG B;  2D9U A;  2F0L A;  2FPP B;  2CQO A;  5AFW A;  4XX0 B;  3LP8 A;  1B53 A;  2EY6 A;  1TWH A;  4RUC A;  2CH4 A;  3W1G A;  3PO2 B;  1CA5 A;  2C5C A;  1X3P A;  1KTK A;  5EBD A;  2LS0 1;  3BAB A;  2UVV A;  2PBZ A;  5D1P A;  1E22 A;  2UUB L;  3PW4 A;  1IBM Q;  2VW9 A;  4DUZ H;  4RG1 A;  5LMU L;  2R7Z A;  1X55 A;  1BBX C;  2QEJ C;  2DJF C;  1L0Y B;  3PUY A;  3QOJ A;  1HA6 A;  1T5E A;  4DR3 Q;  2RDI A;  1AUV A;  5KFC A;  2IJ0 A;  5DGB A;  1A2T A;  2KOL A;  1TAE A;  3HOV B;  3S24 A;  3Q24 A;  1STA A;  3FRP B;  1ZYR D;  4IUU A;  1S40 A;  2JA7 G;  3AU7 A;  3SR1 A;  2MUY A;  5F9N A;  1QVC A;  3TP8 A;  3S14 H;  5E7N A;  3NPP A;  3MXG A;  4HN7 A;  2DN8 A;  3FDT A;  3E0J A;  4MTN A;  1STB A;  4DR7 L;  4K5W A;  2R93 G;  4IUV A;  2CW0 C;  2NVQ H;  1N32 Q;  1HH2 P;  4DV2 L;  2NU6 B;  4DR1 L;  4RWS C;  1L0X B;  1YJW A;  1HUN A;  4AYB E;  4DL2 A;  2F0I A;  1XNR L;  3FMA A;  4R8U B;  2UUB H;  1A0I A;  3CQZ H;  3CCM A;  1SNP A;  4DN4 M;  5IYB H;  2XGP A;  3N40 P;  4PMC A;  5LMU H;  3PUV A;  2FPI B;  5FLM H;  5C5M A;  5EOY A;  4UDU C;  1U9R A;  2AGP A;  2KJX A;  4KN7 C;  1WH2 A;  3PUX A;  4FBT A;  1HZB A;  3TQ1 A;  1Z7T A;  2A68 D;  4R1J A;  2WDT A;  1GUT A;  3CC7 A;  4K6L A;  4A93 H;  1AN8 A;  1E2Z A;  5KNB A;  5K5P A;  2W6Q A;  2XIG A;  1YNN C;  4UP7 A;  5I9O A;  1JWU D;  4X3U A;  2O03 A;  3LWE A;  3Q8S B;  1GSA A;  3TDQ A;  4DR7 H;  4KHP Q;  2WV6 D;  2CHB D;  4HCE A;  1JWM D;  3AYH B;  4UP8 A;  4JI1 L;  4DV2 H;  1D1I A;  4DR1 H;  1M1K C;  2Z8L A;  3DMU A;  3U50 C;  4BY1 B;  3RB4 A;  2JA6 B;  1XNR H;  4DNR B;  3D8G A;  2X69 A;  3KLS X;  4A3J G;  1JWS D;  4RKL A;  5JVH 3;  2R84 A;  2E2J H;  1RYS A;  4OGQ C;  1OXS C;  4LF7 L;  1Y1W B;  2PI2 A;  2XWJ B;  3JAM E;  1S0M A;  1LTI D;  2D62 A;  4H44 C;  4J9L A;  4K2K A;  1XDN A;  4DUY L;  1G29 1;  1VQN A;  1EIF A;  5IOC A;  2K5H A;  1FNW A;  4KK7 A;  4C3H B;  1M90 C;  4YBZ B;  1W3S A;  1LTB D;  4YWK A;  5FO7 B;  3SK5 A;  1XMO L;  1VMP A;  4JI1 H;  3MXP A;  4IWY A;  4DR6 L;  2FLL A;  1Y14 B;  2EJG C;  2KQ3 A;  5IYB G;  1TXY A;  1TS2 A;  3A7L A;  4MN3 A;  4CC5 A;  3RLN A;  1LO5 D;  3KFU A;  1HCZ A;  4RNO A;  1JX4 A; 
#chains in the Genus database with same CATH homology
 1B70 B;  4GNX A;  2I5M X;  1KHI A;  2WFW A;  1VQ6 A;  3S1M H;  3I4M G;  1SN8 A;  4JI5 Q;  1YI2 A;  4JI6 L;  2R93 H;  5JJL A;  2MO0 A;  1KXL A;  4AQY Q;  1QZG A;  1SRO A;  4A3G G;  4XIG S;  4DV6 L;  1C7Y A;  4A3E H;  3GTP H;  2VZA A;  5IP9 H;  3GTG H;  2B63 G;  2UU9 Q;  4DR2 L;  1UE6 A;  1HNZ L;  4BY7 H;  2VS1 A;  5IY0 A;  2NVY H;  2VNU D;  2VL6 A;  4A3D G;  4DV4 Q;  2H5X A;  4BA1 I;  1AH9 A;  1SLJ A;  4JOI A;  4Y7N H;  3S1Q H;  3DM3 A;  4WJ4 A;  1BBW A;  1O7I A;  2Q2H A;  2YTX A;  2HIX A;  1FGU A;  1WYD A;  4RMF A;  4AYB G;  4X64 L;  4B3S L;  2WB1 G;  2WAQ G;  5C4X H;  4O2D A;  3CCQ A;  2B29 A;  1GM5 A;  3ZJY C;  5FJ8 H;  3KJP A;  4DV5 L;  2E5L Q;  2ATW A;  1N8R C;  5C44 G;  4DV1 L;  5HY6 A;  4NXN Q;  4LUO A;  1UWV A;  4JCV E;  4JYA L;  3HOZ H;  2D0P A;  4HJA A;  1L0W A;  3HOU H;  1RL2 A;  2IT1 A;  5LMN W;  4HJ5 A;  5K36 G;  4JBJ A;  2ZJR A;  4JI7 Q;  3GO5 A;  3K8A A;  4DR4 L;  2R7D A;  4AH6 A;  5ELO A;  4B3T L;  2ASB A;  2JA8 G;  3FHW A;  2JE6 I;  1VQ5 A;  4JG2 A;  4NXM Q;  1ASY A;  4XTC S;  3G6E A;  3NEN A;  2PMZ E;  2C35 B;  3PUW A;  4QJF A;  4A76 A;  3CD6 A;  3M4O H;  4QY7 A;  4B3M L;  3J81 i;  4JI0 Q;  3K0X A;  5C3E G;  4A3J H;  3PIP A;  4LFB L;  4YWL A;  2AHO B;  1C9O A;  4X65 Q;  4GOP A;  4IFD G;  3FKI H;  4YCU A;  5M5W H;  2D0O A;  2CCZ A;  3TRZ A;  3PO3 H;  3PF4 A;  1XPR A;  3CMA A;  4GKJ Q;  1C0A A;  4GLA C;  1N34 Q;  4BBR H;  3ICE A;  3E9I A;  2UUC L;  2UXB L;  2F4V L;  3HOX G;  3CCL A;  1TWH H;  2GN5 A;  1KRT A;  2Z0S A;  3M85 A;  4X62 Q;  4LFC Q;  1S72 A;  2JA5 H;  4BXX H;  1UE7 A;  4A3E G;  1YHB A;  1PVO A;  4LF4 L;  1YNX A;  1LYL A;  2WB1 E;  2WAQ E;  2Y0S E;  3KJO A;  4JI2 L;  4BY7 G;  2XTI A;  1V1Q A;  4BBS H;  1PH2 A;  4A3K G;  1NJI C;  3S1R H;  1UE5 A;  4YY3 L;  1PHJ A;  1MJE A;  4OX9 Q;  1LUZ A;  2R6G A;  3EIV A;  2KCM A;  3CCU A;  2KCT A;  4A3I G;  1IBM L;  2R7Z H;  3T1H L;  2KBN A;  1I5F A;  1VQK A;  1XNQ Q;  3MEF A;  3RLF A;  1UE1 A;  5FJ8 G;  3PO2 G;  4R4Q A;  1PH4 A;  2RHS B;  4DR3 L;  3HFZ B;  4OO1 I;  2VQF L;  3CPF A;  3U58 A;  4HJ9 A;  3I4M H;  1PH5 A;  1XPU A;  2IY5 B;  2MNA A;  1N36 Q;  4GKK Q;  2NN6 G;  3S2D H;  4GOP B;  2I5H A;  1SFO H;  1AE3 A;  1VQC A;  4R4O A;  4JI3 L;  3L7Z C;  2F52 A;  1TWG H;  4R4I A;  1IXR A;  1X3E A;  5BR8 L;  1A62 A;  4OWW B;  2ZM6 L;  1K3R A;  3T1Y Q;  2B63 H;  1N32 L;  4LFA L;  3BJU A;  3KOJ A;  3UDI A;  1X65 A;  4YWM A;  4HJ7 A;  4LF7 Q;  4GNX C;  1T9H A;  4DV7 Q;  1VS0 A;  3HOV G;  2RCN A;  3DLL A;  1H95 A;  3I55 A;  1K8A C;  4GS3 A;  4JI4 Q;  3FKI G;  3HOY G;  3F2D A;  3U4V A;  2K75 A;  5C44 H;  3F2C A;  1QVG A;  2PQA B;  2E8G A;  4YHH L;  3I4N G;  1ASZ A;  2Q2I A;  4C3J H;  4B3R L;  3K81 C;  2MO1 A;  4IFD J;  4DV3 L;  1A8V A;  2BH8 A;  3M4Q A;  3CW2 C;  1CKO A;  1NBW A;  3UDX A;  1JJG A;  4KLK A;  4DR5 L;  3EBE A;  3RR5 A;  1Q86 C;  4C2M H;  4DK6 C;  4A3L G;  4WJ3 M;  4IPD A;  3GTQ H;  4A3M H;  2ZTE A;  4PZ7 A;  2JA8 H;  4QL5 A;  1P8L A;  2VQE Q;  3ULP A;  1PH8 A;  4OON A;  4APV A;  3G4S A;  4X6A H;  4PZ8 A;  1RIP A;  2QGQ A;  4JBM A;  3OTO Q;  3A5U A;  3A74 A;  5C3E H;  5DLQ E;  1KRS A;  4JI6 Q;  4POG A;  1EIY B;  2NVT H;  1BKB A;  1EOV A;  1QUQ B;  1YHA A;  2RHQ B;  4DV6 Q;  3J7Z C;  1J5E L;  2HHH L;  1E3P A;  4HID A;  1IYJ B;  4DUZ Q;  1VQB A;  1HNZ Q;  2IX1 A;  1HNW Q;  2OTJ A;  1E24 A;  4P75 A;  4LF5 Q;  5M3F H;  1U5K A;  2Z6K A;  1VQG A;  3HOX H;  1B8A A;  3RN5 A;  3S1N H;  3HKZ E;  4ALP A;  1QZH A;  4DK3 C;  3AFP A;  4BY1 G;  3CC4 A;  2RF4 A;  5HGQ A;  2JA6 G;  2UXD Q;  2K50 A;  2KHJ A;  2E2H H;  1IZ6 A;  1K0R A;  4KI0 A;  1N9W A;  2AMC B;  2MQH A;  4DV5 Q;  4A3K H;  1HJP A;  4DV1 Q;  3KYH C;  2CFM A;  4PMW A;  4A3I H;  1OXX K;  5JJI A;  1Y1W G;  1VQD A;  3M9B A;  1EWI A;  1I50 H;  4TQU S;  2B3G A;  2Y0S G;  1Q46 A;  1V9P A;  1PH6 A;  1VQJ A;  2BA0 A;  3KDF B;  3D0F A;  4JI8 L;  1DGS A;  1L2F A;  2LXJ A;  5H1S E;  4GLX A;  1HNX L;  3W5O A;  1N33 Q;  1I6H H;  5JEA G;  2UUB Q;  2YYZ A;  3FP9 A;  3TEH B;  3HOW G;  3NBH B;  4IPC A;  4OO1 G;  1PV4 A;  1CSQ A;  3JAM c;  4JV5 L;  1KL9 A;  5LMU Q;  1EUJ A;  2YTV A;  3H3V I;  3AEV A;  1XJV A;  4A75 A;  3ER0 A;  3MXN B;  5AJ3 L;  3CF5 A;  4NPS A;  1K9M C;  4LF9 L;  3S16 H;  2F3I A;  1WCM H;  1IBK L;  4IJL A;  3U4Z A;  4AQY L;  3VDY A;  4A3M G;  3TS2 A;  1JB7 A;  2DGY A;  5LMN L;  1XTD A;  2UU9 L;  2N78 A;  3KF6 B;  3HOV H;  1FVI A;  2KHI A;  4P71 A;  1U0L A;  1XPO A;  4NB3 A;  4L5S A;  3J7A 5;  1OXT A;  4DV4 L;  4DV0 Q;  4DR7 Q;  1CKM A;  4KHZ A;  3A0J A;  4DV2 Q;  3LGJ A;  1Q8K A;  3PCO B;  5EAY A;  5IE8 A;  4DR1 Q;  3HOY H;  2CKZ B;  1MIU A;  1TWA H;  2JK8 A;  4C3I H;  4LF4 Q;  3BZC A;  3I4N H;  1Q81 C;  2JEB I;  2E5L L;  1XNR Q;  1HR0 Q;  3ULJ A;  1VQI A;  3I2Z A;  5M3F G;  1B7Y B;  1VQ7 A;  4YY3 Q;  4MNO A;  4LUV A;  4K0K Q;  5GQO A;  3J81 j;  1YIJ A;  1VQP A;  1CKN B;  2QA4 A;  3T1H Q;  1BVS A;  4LF6 L;  4A3L H;  1E1T A;  3RNU A;  3B6Y A;  4QGU A;  4L5T A;  1BBU A;  1MJC A;  1EFW A;  3M7N A;  4POF A;  1YVC A;  3AFQ A;  3K80 C;  2PQA A;  3I4O A;  2VQF Q;  2YTY A;  3UDF A;  1G51 A;  3OYY A;  4PZ6 A;  2FXQ A;  2ZTC A;  1Q1E A;  2YV5 A;  1YIT A;  3HKS A;  1X6O A;  4JI3 Q;  3ULL A;  4JBK A;  4JI0 L;  2HIV A;  2AKW B;  1HR0 W;  3CXC A;  4JI1 Q;  4X65 L;  3EN2 A;  1HZA A;  4LFA Q;  4DAY B;  4LF8 L;  1IBL Q;  5GRO A;  4BA2 I;  2UUA L;  2VUM G;  1SRU A;  1SE8 A;  4ME3 A;  1XMQ L;  1P16 A;  5JEA J;  4BY1 H;  1FJG Q;  2CWP A;  2JA6 H;  3A5Z B;  3PIO A;  1E7Z A;  1WOC A;  3M4P A;  4A3C G;  3TS0 A;  2JJQ A;  5M3M G;  1WCM G;  4X62 L;  4L5Q A;  4LFC L;  3K7U C;  1L1O B;  2LXK A;  1VQL A;  3GTL H;  1QUQ A;  2WP8 J;  2IHF A;  1CSP A;  4IOC A;  1Q1B A;  1GO3 E;  3HKZ G;  2ES2 A;  4LNQ A;  1Y1W H;  2PI2 E;  4HIM A;  3CAM A;  4TVA B;  3CME A;  4DV3 Q;  4OX9 L;  1PH3 A;  3CCS A;  3PUZ A;  1WI5 A;  4DUY Q;  4DR5 Q;  4DAM A;  1VQH A;  3BU2 A;  4QQB X;  2N3S A;  1EYG A;  1D8L A;  1X54 A;  1X3F A;  1XMO Q;  4C3H H;  1I94 L;  3J80 c;  3HOW H;  5M5Y H;  4DR6 Q;  4LW1 A;  5FLX c;  2I0Q A;  3H15 A;  4JOI C;  3NEL A;  2VY3 A;  1EQR A;  5IWA L;  2HT1 A;  1G6P A;  3STB D;  1N36 L;  2GVA A;  4P72 A;  1YZ6 A;  2EIF A;  3PV0 A;  2UXC Q;  1HZ9 A;  1HZC A;  3CC2 A;  4KHP L;  3KDF A;  4IPH A;  1VQA A;  3T1Y L;  2A19 A;  2OQK A;  4L5R C;  1I3Q H;  3RLO A;  1EQQ A;  5IYC G;  1K73 C;  4DV7 L;  2JEA I;  1Z9F A;  3CCJ A;  5J3B A;  4OWT B;  1OXU A;  2Q2U A;  1IL2 A;  1K83 H;  1KD1 C;  4UP9 A;  1VQM A;  4X66 L;  1Q82 C;  2OTL A;  3IRB A;  4DR2 Q;  4JI4 L;  2K5N A;  1KC8 C;  1SR3 A;  1SMX A;  2AWO A;  2CWA A;  5ELN A;  3KF6 A;  3KLW A;  5GAE C;  1PH1 A;  4R4T A;  1PYS B;  3RZO H;  5JJK A;  4R4C A;  3S2H H;  1S3O A;  1X3G A;  3UE1 A;  3PGZ A;  3CPW A;  4JI2 Q;  4X64 Q;  5C0X I;  4GOP C;  1KIX A;  4B3S Q;  1Q12 A;  3RZD H;  2MFI A;  2R92 G;  4UY8 C;  1E1O A;  2AWN A;  4GN3 B;  4IOA A;  5FLM G;  3JC6 6;  3S17 H;  2L15 A;  4OXP A;  4JYA Q;  3M3Y H;  2I5L X;  2KEN A;  4DKA C;  2VQE L;  3H0G G;  4H02 A;  2JA7 H;  4GN4 B;  2NN6 I;  1PYB A;  4A93 G;  3GD7 A;  1CKN A;  4LWC A;  4LUZ A;  3OTO L;  5AJ3 Q;  3NEM A;  2EXD A;  2A8V A;  4DR4 Q;  4LF9 Q;  1VQ9 A;  2OCE A;  1IBK Q;  4B3T Q;  4HIK A;  3I7F A;  4EQ5 A;  1YHQ A;  1D7Q A;  1X9N A;  2VUM H;  5LMN Q;  1LM0 A;  4HJ8 A;  4DUZ L;  1HNW L;  4JC0 A;  4JI5 L;  1PH9 A;  4B3M Q;  4LF5 L;  1W2B A;  1PH7 A;  3G71 A;  3L0O A;  4A3C H;  1JT8 A;  4LFB Q;  2ALY B;  5M3M H;  1VCI A;  1PA6 A;  1GKH A;  2UXD L;  3SGI A;  4A3B H;  4EX5 A;  4P74 A;  5IP7 G;  1TWF H;  3J80 i;  2NZH A;  3D31 A;  2E2I H;  2UXB Q;  2JA9 A;  2UUC Q;  2F4V Q;  3F1Z A;  2CQO A;  1UEB A;  4Y52 H;  1LTL A;  3Q8D A;  4LF6 Q;  3W1G A;  1X56 A;  3I56 A;  3TRE A;  3UE0 A;  2N49 A;  1L1O A;  5IYD H;  2OWO A;  3TQY A;  4NXN L;  2R7F A;  4A3F H;  3GTJ H;  4GNX B;  1N33 L;  1E22 A;  2UUB L;  1IBM Q;  5GAG C;  2VW9 A;  4DNI A;  1YEZ A;  1Z47 A;  2NZO A;  4RG1 A;  3CCE A;  3G48 A;  5LMU L;  3H3V H;  1X55 A;  3PSI A;  4JI7 L;  2IX0 A;  3L2P A;  3PUY A;  1NY4 A;  4DR3 Q;  1VQ8 A;  1WFQ A;  5IYC H;  1NE3 A;  4LF8 Q;  3S24 A;  4MZ9 A;  1VQO A;  1S40 A;  4NXM L;  4A4I A;  2JA7 G;  3UDG A;  2UUA Q;  2ZTD A;  4IPG A;  1QVC A;  1XMQ Q;  3S14 H;  5E7N A;  1Y1V H;  1OXV A;  5BR8 Q;  2K5V A;  2K14 A;  4MTN A;  2QEX A;  4DV0 L;  4DR7 L;  3E0E A;  1VQE A;  2ZM6 Q;  2R93 G;  4DPG A;  4GN5 A;  4JBW A;  1HH2 P;  2NVQ H;  1N32 Q;  3ERS X;  5M5X H;  3STB C;  1MKH A;  4DV2 L;  1VQ4 A;  2XGT A;  4DR1 L;  1Q7Y C;  1YJW A;  5IP9 G;  4AYB E;  4GKJ L;  2OQ0 A;  1J6Q A;  3S15 H;  1N34 L;  1XNR L;  1HR0 L;  4FDB A;  3GTK H;  1A0I A;  1V43 A;  3CQZ H;  3CCM A;  3RN2 A;  3GTO H;  1NTG A;  2BA1 A;  2R92 H;  5IYB H;  2ID0 A;  4K0K L;  1GD7 A;  3AQQ A;  1A63 A;  1WJJ A;  3PUV A;  5C0X G;  2LSS A;  4A3B G;  5FLM H;  4YHH Q;  4B3R Q;  5C4X G;  2K52 A;  1QVF A;  2Z6K C;  3PF5 A;  1I94 Q;  1AE2 A;  3PUX A;  3K7A H;  3JAM i;  2K4K A;  1HZB A;  3H0G H;  1JJ2 A;  4IJH A;  3GDE A;  2GVB A;  1PFS A;  2HQL A;  4YCW A;  4R1J A;  4YCV A;  1JMC A;  4A93 H;  3CC7 A;  2JQO A;  5IT9 c;  5IWA Q;  3F2B A;  1KAW A;  3HOZ G;  3CCR A;  3CCV A;  2EQS A;  3HOU G;  4UP7 A;  1XNQ L;  3BZK A;  3W1B A;  5IYD G;  3OW2 A;  4A3G H;  1YJ9 A;  4KHP Q;  2V1C C;  3AYH B;  4UP8 A;  4JI1 L;  4A3F G;  3F8T A;  1M1K C;  1TWC H;  3U50 C;  1IBL L;  2Q2T A;  4GKK L;  1R9T H;  2IHE A;  4A3D H;  2ZJQ A;  4HIO A;  4IO9 A;  2DUD A;  2YU9 H;  1FJG L;  4IFD I;  4UPA A;  1J5E Q;  2N8N A;  2HHH Q;  4A3J G;  5IP7 H;  1K8G A;  4X66 Q;  2E2J H;  1OXS C;  1VQF A;  3WWV A;  4GLV B;  4LF7 L;  4OWX B;  2ZJP A;  3PO3 G;  2PI2 A;  3CP0 A;  3KF8 B;  1Y1V G;  3PO2 H;  3GTM H;  4J15 A;  3J81 c;  4BBR G;  2BH2 A;  2D62 A;  1CUK A;  1NMF A;  4DUY L;  1G29 1;  4O0A A;  1EIF A;  4AIM A;  2JA5 G;  1VQN A;  4BXX G;  2K5H A;  1NMG A;  5GAD C;  2A1A A;  1M90 C;  1W3S A;  3E9H A;  4YWK A;  5C4J H;  1XMO L;  4DR6 L;  4BBS G;  1Y14 B;  2NVX H;  4PG3 A;  1JJC B;  1GVP A;  4QIW E;  1TXY A;  5IYB G;  2R7Z G;  1OTC A;  4JI8 Q;  1YBY A;  1JE5 A;  1KQS A;  1YJN A;  1HNX Q;  5GAH C;  3RLN A;  4P73 A;  1L1O C;  2UXC L;  3KFU A;  1FL0 A;  2PNH A;  4JV5 Q;  5C0X J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...