2R7ZG

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r7zG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r7zG01
3HKZE 2PI2A 2ATWA 1GM5A 3HOUH 1HNZL 5C44H 4POFA 1N36L 4JI4L 3GTQH 2UXBL 2GVAA 2K50A 3DLLA 1IYJB 3ER0A 4DR2L 4GOPC 2AMCB 5EAYA 1U5KA 2ZM6Q 5IP9G 4L5TA 2LSSA 3DM3A 3I4MG 3GDEA 2KCMA 4DV7Q 4K0KQ 3I55A 4HJ8A 3HKSA 1YHQA 3KYHC 4DK6C 1OTCA 2Q2UA 4A3DH 1CSQA 3PCOB 5IYBG 1N33L 1VQEA 3RNUA 1BBWA 2IHEA 1PH4A 4L5QA 4JI5L 3ULPA 1ASZA 3GTOH 5C4XG 4DV4Q 5M3MH 3PF4A 4EQ5A 4BY7H 3WWVA 3CMEA 2HHHL 3G6EA 2VQEQ 1PH9A 4LUOA 2N8NA 3CF5A 5JJKA 2JA7H 2UUCL 4L5SA 4YHHL 4HJ9A 2BA0A 4LF4L 3K0XA 1XMQL 1E1OA 1EUJA 1C7YA 1PVOA 5LMNL 4DV2Q 3M85A 4C2MH 4GNXC 3NEMA 4WJ4A 3GD7A 4AQYL 2VL6A 1YJWA 3RN5A 4AYBG 4X64Q 4JI6L 4OO1I 1Q81C 5C3EG 4A3MG 1WOCA 3CC7A 4GKJQ 4LF7Q 4JI8Q 1IZ6A 2D0PA 2JA9A 5IP9H 4IJLA 3I4MH 2KCTA 3GO5A 5M5WH 2MO0A 4JBJA 3CCEA 2ZJPA 3CCSA 1SE8A 3Q8DA 1TWAH 1I50H 3CW2C 3FHWA 4A3CG 3KF6B 4QGUA 2A1AA 5IYBH 2ZJRA 1Q1BA 5BR8Q 3AEVA 1PH1A 3HOWG 4DV6L 5C4XH 4LF6Q 2F3IA 3B6YA 3KDFA 2I5HA 4DR3L 4LNQA 3F2CA 3NBHB 4IPCA 3D31A 3CAMA 4DR6Q 3T1HQ 2LXJA 4BA2I 2YV5A 3S1QH 1HZAA 4C3IH 2VQFL 4IOAA 4YY3Q 2MFIA 1HNWL 4X66Q 3G4SA 3CC4A 3S2DH 4IFDJ 1VQPA 3S24A 1IBKL 4LFBL 4DV5Q 4OO1G 1Q7YC 4RMFA 3F1ZA 5C3EH 4A3MH 3JAMc 1TWHH 1YBYA 4O2DA 3TS0A 4LF5L 2NN6G 2KBNA 4MNOA 4DUZL 3IRBA 4R1JA 1GO3E 1E24A 1SN8A 2VY3A 1XMOL 1GD7A 3AYHB 4A3CH 1TXYA 4AYBE 1HNZQ 4LUVA 4YCVA 1N36Q 4JI4Q 3HOWH 2UXBQ 3M3YH 1R9TH 2C35B 3ZJYC 4GLVB 1Q12A 4L5RC 3UDIA 4DR2Q 3HOXG 1W2BA 1N8RC 4UY8C 2JK8A 3LGJA 3J81c 3W1GA 2NVYH 2WAQG 4BA1I 3CMAA 1EFWA 1AE3A 3S16H 4A3BG 1N33Q 3S2HH 4APVA 1XPOA 4TQUS 4JI5Q 1KC8C 2PQAB 1HNXL 4HJAA 1UE6A 1YJ9A 2N3SA 2CFMA 2F4VL 4JG2A 2HHHQ 1VQDA 3U4ZA 3F2BA 4DR5L 1UEBA 2PI2E 5GAGC 1H95A 3JC66 1FL0A 4MTNA 3STBD 2RF4A 2PNHA 4YHHQ 2UUCQ 5JJLA 1VQ7A 4LF4Q 1XMQQ 3GTGH 3S14H 5LMNQ 3H3VI 3I7FA 4A4IA 1P16A 2CWAA 4R4CA 2UUAL 1YHAA 4LF9L 1XPUA 4A3GG 3I2ZA 2D62A 5H1SE 4AQYQ 3AFPA 5IP7G 3HOXH 4JI6Q 2N49A 3PIOA 1QUQB 4P71A 3J7ZC 3D0FA 1D7QA 3KOJA 1G51A 3M7NA 3K8AA 4LWCA 3J80i 1L1OB 1V43A 1HR0L 4A3BH 2ALYB 3AQQA 4DV6Q 1QVCA 4MZ9A 4DR3Q 2B63G 3PUWA 5IWAL 1I94L 4KHZA 4P75A 1UE1A 3CCJA 1WI5A 1GVPA 1M90C 1PHJA 3RLOA 3NELA 1WYDA 4ALPA 4A75A 2Q2IA 2VQFQ 2MNAA 1HNWQ 1HJPA 1LUZA 4GOPB 4UPAA 3S17H 2IT1A 3K81C 4X65L 4OONA 2YU9H 3GTKH 3UDGA 3A74A 1EOVA 4R4IA 2CKZB 1KRTA 4IPGA 1IBKQ 3CCLA 3ICEA 1K0RA 1QVFA 4BXXG 4A3GH 4LFBQ 1I6HH 5IP7H 5GAEC 1TWFH 1A8VA 5E7NA 1VQMA 4GKKL 4DR1L 4XTCS 1T9HA 4A76A 4OWWB 1N32L 4LF5Q 1VQIA 1KIXA 1XMOQ 1VQFA 1N9WA 3CCUA 1VQKA 4JI1Q 4POGA 1UE7A 4GS3A 2Q2HA 2DGYA 1KD1C 3PUYA 5ELOA 1Z9FA 5IE8A 2B63H 3GTMH 1XPRA 1Q46A 1JJ2A 2V1CC 2IX1A 3PO3G 2JE6I 3KJOA 3GTLH 1S40A 1K8GA 2BH8A 1WCMG 1KAWA 3RLNA 1MKHA 2OWOA 1TWGH 3CD6A 2YTXA 2UXCL 5DLQE 4LFCL 4YWMA 2HIXA 4JI2L 3H3VH 1X3EA 1KHIA 2E2JH 1KRSA 1HNXQ 3UE0A 3FKIG 1IXRA 4FDBA 4OWXB 4A3EG 4A3KG 1Y1WG 4BXXH 4HIDA 2F4VQ 3A5ZB 2ZTEA 1Q1EA 3W5OA 1VQ5A 4DR5Q 4JI3L 1OXVA 2HIVA 2YTYA 2E5LL 4LF8L 2NVQH 4IOCA 3M9BA 2E2HH 2UUBL 4UP7A 2E8GA 1PYSB 1OXXK 1KQSA 1IL2A 2WP8J 4A3LG 2OTJA 5HY6A 3H15A 2UUAQ 4Y7NH 4C3JH 1PH3A 4LF9Q 2PQAA 2JA8G 1L0WA 2RHSB 3PO3H 2DUDA 1X6OA 4H02A 5J3BA 5JEAJ 1EQQA 4QIWE 1JT8A 1LYLA 4EX5A 4KHPL 4X62L 1WCMH 1WFQA 1EIYB 4AH6A 4IFDI 1HR0Q 4PZ8A 4JI7L 2B29A 4LUZA 4ME3A 1HR0W 2JA5G 3HOYG 1VQHA 2K5HA 1NMGA 3M4PA 4DV3L 4NXML 1SLJA 1ASYA 2NVXH 2YYZA 3FKIH 2ZJQA 4A3EH 4A3JG 4JCVE 1J6QA 5IWAQ 4HIKA 1X3GA 4A3KH 3PUVA 1Y1WH 1Q8KA 2OCEA 1VQ8A 3JAMi 4DR4L 1HZ9A 4BBRG 2PMZE 2YTVA 2N78A 2R93G 2MQHA 3TEHB 2I0QA 2RHQB 3PUZA 3RZOH 5AJ3L 1C9OA 4GN5A 4QJFA 2HQLA 1M1KC 3CPWA 4OXPA 3U58A 1L1OA 4X65Q 1PFSA 4NXNL 2MO1A 2K14A 3PV0A 1VQ9A 3S15H 4A3LH 1DGSA 3BZCA 1Y1VG 2EXDA 1PA6A 2JA8H 1VQNA 5GQOA 2ES2A 5C0XJ 4GKKQ 4DR1Q 4O0AA 3ERSX 3K7UC 4BY1G 1FVIA 1XTDA 3J81i 4IFDG 2VNUD 4GN4B 1IBLL 5JEAG 3T1YL 4A3FG 5C0XI 1E7ZA 4DK3C 2WFWA 1G6PA 1E22A 4GN3B 2JA5H 1A0IA 2CQOA 3CXCA 1CKMA 1E1TA 3I56A 4QY7A 3UDFA 3CCVA 1MIUA 4PZ7A 4DAYB 1YITA 1VQLA 4A3JH 1PH2A 1YI2A 3KDFB 3W1BA 1VQJA 4BBRH 3S1NH 1HH2P 2I5MX 3CQZH 4DV2L 2R93H 1VQGA 3PIPA 4JI0L 4JBKA 1FJGL 1SMXA 5LMNW 3PUXA 4JV5L 1LTLA 2UXCQ 4YWKA 4DKAC 3S1MH 4LFCQ 1EIFA 1X9NA 4JI2Q 3CCQA 2RCNA 1X54A 1NJIC 2OQKA 2Z0SA 2BH2A 2I5LX 1Y1VH 2R7DA 1EWIA 2AWNA 4DV0L 4DV1L 2IHFA 1K8AC 2A8VA 1NY4A 1PH8A 3E9IA 1RIPA 4A3IG 2HT1A 3NENA 4JI3Q 2F52A 4IPHA 2GN5A 1VQ4A 2E5LQ 4BY1H 4LF8Q 3HOZG 1CKNB 2XGTA 5LMUL 3VDYA 4A3FH 2UUBQ 4R4QA 3OTOL 4OX9L 4P72A 2WAQE 4IJHA 3STBC 5ELNA 3J7A5 4JYAL 1PH6A 5FJ8G 3OW2A 2AWOA 2OTLA 2Q2TA 1XNQL 2UXDL 2ZTDA 4DAMA 2A19A 1JE5A 4BBSG 4LW1A 4OWTB 5IYCG 4B3SL 5C4JH 2VS1A 4HIOA 1UE5A 1VQOA 1D8LA 1TWCH 2K4KA 1L1OC 3KF6A 2R6GA 3ULJA 4X62Q 1PV4A 4KHPQ 4Y52H 4YCWA 1QVGA 4JI7Q 4B3TL 5HGQA 4P74A 4R4TA 2R92G 3KFUA 1QZGA 1SRUA 4KI0A 4NXMQ 2Z6KA 2JA7G 4GLXA 1N34L 2K5NA 3K80C 1X55A 1HZCA 3MEFA 4XIGS 4DUZQ 4J15A 4DR4Q 1SR3A 3L2PA 2EIFA 4A3IH 1CSPA 3M4OH 3EBEA 4B3RL 1I3QH 2D0OA 3UE1A 1Q86C 4LFAL 2JA6G 1YNXA 1VQAA 4DUYL 3OYYA 3HOZH 1OXUA 4NB3A 2BA1A 2NZHA 5AJ3Q 3KLWA 1IBML 3I4NG 1VQCA 1VS0A 5IY0A 2IX0A 5FJ8H 2UU9L 1B7YB 2KHJA 3ULLA 3BU2A 4NXNQ 4GNXB 4QL5A 1X3FA 4BBSH 1K9MC 5IYCH 3TS2A 4IPDA 4YWLA 1NE3A 4C3HH 1J5EL 4B3ML 2KHIA 4AIMA 1A62A 1VQBA 3RR5A 1IBLQ 5FLMG 3T1YQ 3CC2A 5GROA 3HOVG 2B3GA 1MJEA 2JEAI 2R92H 1K83H 3TRZA 4DR7L 4JBWA 1XJVA 1KL9A 3TREA 3KF8B 5M3FH 1MJCA 4HIMA 1PYBA 1YJNA 1PH7A 2JJQA 3J81j 4JI0Q 2QGQA 5FLXc 1XNRL 2FXQA 2VZAA 1Z47A 3AFQA 1QZHA 1FJGQ 3BZKA 2JA6H 3S1RH 4JV5Q 1S3OA 2AKWB 2QEXA 3I4NH 3CCRA 1S72A 1JJCB 1W3SA 1NBWA 4WJ3M 2WB1G 3GTPH 2L15A 1K73C 4KLKA 1B8AA 2NN6I 1BKBA 2OQ0A 2Y0SG 4DV0Q 4DV1Q 3A5UA 1CUKA 1GKHA 1EQRA 3E0EA 1RL2A 4HJ7A 1AH9A 2VW9A 2KENA 2GVBA 3PO2G 3EN2A 1FGUA 3PF5A 5FLMH 2Z6KC 5LMUQ 1I94Q 4PG3A 3OTOQ 4OX9Q 3HOVH 4R4OA 4JYAQ 5IYDG 1YEZA 4IO9A 2K75A 2IY5B 2E2IH 1E3PA 1BBUA 1HZBA 2R7ZG 3SGIA 1YVCA 1OXSC 1QUQA 1YHBA 3UDXA 2ID0A 5GADC 1XNQQ 2UXDQ 3M4QA 1JJGA 2ZM6L 4HJ5A 1OXTA 4B3SQ 1CKOA 2AHOB 4QQBX 1BVSA 5M5XH 4YCUA 1AE2A 3G48A 2K52A 4DV7L 4K0KL 3L0OA 3FP9A 1SFOH 1L2FA 4B3TQ 4JOIA 1K3RA 1V9PA 1CKNA 1VCIA 1PH5A 3CP0A 3F8TA 4DNIA 3KJPA 4DV4L 1N32Q 4UP8A 3EIVA 1N34Q 2VQEL 4GLAC 1X65A 4JI1L 2NVTH 3H0GG 2ZTCA 5M5YH 3K7AH 4GOPA 3RZDH 1Q82C 2EQSA 4B3RQ 4LFAQ 3PO2H 2JQOA 2WB1E 1WJJA 3U4VA 4DUYQ 2QA4A 1KXLA 1IBMQ 2Y0SE 5IYDH 4X6AH 5JJIA 4DPGA 3HKZG 3U50C 3L7ZC 4JC0A 3GTJH 2XTIA 1LM0A 1SROA 1JMCA 2NZOA 2UU9Q 2R7ZH 4TVAB 4X64L 4A93G 4GKJL 5GAHC 4LF7L 4JI8L 2JEBI 5M3FG 2K5VA 1P8LA 1J5EQ 4B3MQ 2H5XA 4UP9A 5K36G 1NTGA 1YIJA 3HOUG 5IT9c 3HFZB 2CCZA 2LXKA 5BR8L 5C44G 3F2DA 1B70B 4LF6L 4DR7Q 5C0XG 4DR6L 3T1HL 3PGZA 4PMWA 4GNXA 3RN2A 3CPFA 1EYGA 1C0AA 3H0GH 3PSIA 1YZ6A 1JB7A 4YY3L 4PZ6A 1X56A 1XNRQ 4X66L 2R7FA 4RG1A 3J80c 4JBMA 4A3DG 2CWPA 1UWVA 2ASBA 3MXNB 3I4OA 4NPSA 1A63A 5M3MG 3G71A 4DV5L 1V1QA 2VUMH 3HOYH 3CCMA 4BY7G 1Y14B 4P73A 4A93H 3TQYA 1NMFA 1O7IA 3E9HA 1G291 1VQ6A 2VUMG 3RLFA 1U0LA 3A0JA 4JOIC 3BJUA 4DV3Q 1I5FA
chains in the Genus database with same CATH superfamily
3BA9A 3HKZE 5K2MA 2A6HD 3HOUH 4IUUA 5DEHA 2D9UA 4RAUC 4HYKA 4POFA 2X6GA 2V4RA 3QJYA 4UDUC 3PW2A 1ESRA 2IW3A 5IP9G 4L5TA 3DM3A 4XQNA 4Q0YA 4RH6A 4ECWA 2PCFB 4ZK9B 2W7PA 4MV7A 3I55A 4HJ8A 4DK6C 4XYMB 5KT3A 3M7GA 3E0JA 2W9BA 2OXPA 1BBWA 2AQ1B 4L5QA 2I46A 3T13A 4IUVA 1LT6D 3NTHA 1PH9A 4LUOA 2N8NA 3CF5A 3S15B 2RGVA 1T3NA 2ENBA 2RDHA 3F8NA 4RAYA 2AU0A 2UUCL 1DONA 5KG0A 1FKAH 4DV4H 3K0XA 4N9TA 1XMQL 2W6ZA 2OH2A 3T16A 1PRTC 3NEMA 2MUYA 3GTQA 1PTOD 3RN5A 2W6OA 3C46A 1Q81C 2KOLA 1KNEA 2JA5B 4JI8Q 3JAME 1K28A 2KCTA 2MO0A 5DLGA 2V9WA 2ZJPA 3CCSA 1SE8A 4GZYC 5KG3A 1TWAH 5IYBH 3RGZA 3CQZB 4DV2H 5LL6X 5C4XH 4LF6Q 5CYUA 5IT9W 3QZ8A 2F3IA 3L4KA 4LNQA 4O3PA 3F2CA 1IHZA 4DL4A 4DR6Q 4J9OA 4C5CA 4U673 2XGPA 2VQFL 3QOLA 3J81E 1BJTA 5KFKA 4ECVA 4ZUJA 4Q44A 5CV5A 3VR6A 5KFNA 2L9HA 1PXUA 1IBKL 4LFBL 3RGXA 4A3FB 1JORA 3H40A 1B4OA 1SYXB 4C2MA 4RMFA 5ELBA 4QWBA 3MWMA 2XVSA 4YY3H 4K5WA 4LF5L 3SEBA 3V6HA 1GO3E 3X3MA 3ONAB 1XMOL 5KFAA 5KIXA 3VYSA 1MBYA 4AYBE 4HQ6A 3HOWH 4GLVB 4DR2Q 4HEDA 3HOXG 4U7CA 4UCOA 3IAYA 3NHHA 5KFTA 3RF2A 3U9TA 2F0UA 2ZXRA 4HSPA 1XDNA 2R6FA 3CMAA 1HNZH 3NWSA 4A3BG 1AE3A 4JI4H 4ZAIA 2EPBA 5DM73 3TSSA 1KC8C 4F7XA 4HJAA 1K8OA 4OO1H 4JG2A 3R93A 5KNDA 3TQTA 5JVH3 1ZHSA 4J9MA 2JEIA 1D1KA 4KKTA 1H95A 3JC66 4O4IF 1FNVA 2PNHA 2RF4A 3WDNA 2NU8B 2AGQA 4IR9A 5KFHA 3PW4A 5C8YF 1P16A 2CWAA 2NB0A 4ULLA 3N44B 4ECSA 2HHHH 1GXDC 4A3GG 2D62A 4U6PA 1JICA 4JI6Q 4XYQA 1PMRA 1GSOA 5E4WC 3D0FA 2F0HA 4YHHH 1KJIA 3J80i 2CZGA 2AQ3B 1LTRD 3NTIA 4MV4A 5C6AA 2NVYA 2Z6BA 5LMNH 1WTPA 2LKVA 4DV6Q 3K5HA 4AQYH 2O5JC 1T36A 4C3JB 2ZDGA 1HCZA 1UE1A 2KCCA 3HEJA 1H9RA 3PO3B 1BXRA 4DNRB 3AMUA 4PWQA 2EYHA 1LUZA 5COYA 4GOPB 3S17H 3KHGA 3GIQA 4X65L 3GTKH 2CH4A 3DUZA 5CGKA 3A74A 3CCLA 4RUCA 4IPGA 2SNSA 3ICEA 3C1EA 5IP7H 5GAEC 3HP3A 5E7NA 1HA6A 4YP3A 2BQ3A 1HNWH 4A76A 3JAMW 1N32L 2DJGC 5H80A 4QUFA 4DFAA 4K8IA 2VQDA 3GIJA 5KG6A 4EFBA 5EWEA 2Q2HA 3J7YW 1STNA 2DGYA 3DXJC 5ELOA 2DY8A 2B63H 4G57A 4JV0A 4O3SA 3V4SA 1Q46A 1JJ2A 3KJOA 1CA5A 2WIIB 3OWFA 4HCEA 2WB1B 2FLNA 1U4LA 4RNNA 4JI1H 3J81W 4YR0A 1PYWD 4ZQ3A 5KX5F 4MTKA 1KRSA 2I87A 2R82A 1IXRA 2SEBD 5D3DA 3RTXA 3A5ZB 2YS7A 1DXMA 3VA7A 3W5OA 4DR5Q 2E5LL 4EG0A 2ZDHA 4F8MA 5CMDA 2UUBL 2CVRA 3Q6SA 3CRLC 1IKLA 1LTTD 4B9WA 3WOFA 1KQSA 2EJMA 2RCFA 4A3LG 2B2VA 2F4VH 2OTJA 3H15A 2SDFA 4Y7NH 4C3JH 4LF9Q 5LA6F 4GC7A 3PO3H 1F2ZA 4I50F 4H02A 4ECTA 4TKOB 1TKWB 1JT8A 5I6WA 4KHPL 2G5DA 4I65A 3Q23A 3GTLA 1HR0Q 5K5PA 2EXZA 2B29A 4LUZA 1TS4A 4ME3A 2JA5G 1TWGA 1I4XA 1NMGA 3TP6A 4NXML 3V6JA 4A3EH 4DL7A 1J6QA 1HQMC 5L37A 3EA6A 4HIKA 1Q8KA 4RZRA 4YIJA 4IURA 4I7HA 3GLKA 2YTVA 2R93G 2ALZA 3M4YA 1EEID 3HKZB 2PZWA 4RUAA 1AFPA 2YZGA 3VR4A 5KT2A 3CPWA 4OXPA 1L1OA 5E4XA 1PFSA 3G6JB 4NXNL 3PV0A 1SXTA 5IWAH 3BZCA 5ELCA 4L1KA 5D8DA 1QB5D 1ENAA 4K6DA 4CC6A 4QW8A 1RKNA 5C44B 1HUNA 5CV4A 1KNAA 3ITPA 1ET6A 3ERSX 4O0AA 4BY1G 1FVIA 3SK4A 3M4OB 4A3FG 4F88A 2PN1A 2W6NA 4XDXA 1TS5A 1G6PA 2W9AA 2R84A 4GN3B 1A0IA 2BE5D 4X3KA 2JEFA 4ZYSA 1MIUA 4PZ7A 4A3DB 3N6XA 3SE0A 4DR1H 4IRKA 2NVXA 4BBRH 4C56C 1RODA 4JBKA 1AUVA 5LHY1 5FD5A 4YJ3F 2B2VC 4HN7A 1LTLA 4ZCKA 3VYRA 4DKAC 1WTWA 1JOQA 4LFCQ 1GUSA 2WDTA 5BPFA 4J9LA 3CCQA 2RCNA 1NCVA 1KDAA 2OQKA 5C5LA 3H6MA 4MV1A 1TU2B 5CA1F 2A8VA 1NY4A 3PR5B 1PFBA 2A6EC 4EQPA 4LF8Q 1B9MA 2UXCH 4EYHB 1CKNB 4HTHA 4R4QA 3H3VC 3I4NB 3K3VA 1VMCA 3FDSA 2AWOA 2E75C 2OTLA 2Q2TA 2JA5A 2Z9HA 1XNQL 2F0IA 3J80L 2XN9C 4LW1A 1BNZA 4JV1A 1M6VA 4JI3H 4EBCA 4HIOA 1MHWC 1D8LA 1EY4A 2K4KA 1L1OC 4Y52H 4X62Q 4KN7C 3CQZA 2R93A 4OEMB 5FPRA 4B3TL 2MP1A 2R92G 4CDFC 3S1QB 3PIO3 4K2KA 1WSCA 2JA7G 2R8HA 3M9MB 2K5NA 1HZCA 2C28A 2QW7A 2XRQD 2A6HC 4KMUC 4J6HA 3M4OH 1X32A 4B3RL 2RBMA 4JI7H 3NBIA 3HOZH 1VQAA 4IQZA 4AYBB 4N8X1 5AJ3Q 2BA1A 5C3EB 3ND9A 4A3MB 5FJ8H 5DLFA 4TRDA 2UU9L 3MWYW 3ULLA 1GUWA 2F03A 1X3FA 1Y8OB 5GONF 2RSNA 4QB4A 3TS2A 3N42B 4EGJA 1NE3A 1J5EL 4B3ML 2KHIA 4DL3A 4AIMA 1A62A 2FMAA 3CKIB 4OHJA 3T1YQ 1KEEA 5HGTA 2B3GA 3TRZA 4I4TF 2FKLA 2W9CB 1KL9A 2R7ZB 4ED3A 5EKKA 3S16B 4MAMA 4HIMA 3S2HB 1YJNA 1PH7A 2H4OA 2J4XA 3PQIA 3J81j 4JI0Q 2QGQA 1XNRL 5FLXL 4FXKC 1SEBD 3S1RH 1NR2A 4LSXA 3I4NH 3DWPA 5EJWA 3H4BA 3VMMA 1PTOC 2M9VA 1EIHA 1BF4A 2WB1G 2VPSA 5KG2A 3N43B 1BKBA 2RQXA 1N48A 3E0EA 1EQRA 3NGDA 5CBEE 1BO0A 1RL2A 4RB1A 3GV8B 4RFBA 4IUQA 4MV9A 1FJGH 3TZUA 3DMUA 3EN2A 4JV5H 3PF5A 1AP0A 1A9XA 5LMUQ 1I94Q 3OTOQ 3I91A 4R4OA 5IYDG 3IFTA 3NPPA 1ULZA 2K75A 2IY5B 1PZID 1Y8PB 2E2IH 3WO0A 5KFBA 2PNRC 4DV1H 4DV0H 1O75A 2R92A 2F0NA 1OXSC 5GADC 2UXDQ 3VR3A 5F9LA 1Q8IA 3QG1A 4B3SQ 2B2YA 1S0OA 2JA7A 1CKOA 1WH2A 3LX0A 4YCUA 3G48A 2K52A 4H44C 4OX9H 1STGA 4JYAH 4ILWA 1KC7A 4QUCA 1KJJA 1LTAD 3GTQB 5KFJA 5J1ZA 1PH5A 1CK1A 3VA5A 4DV4L 4I55F 3GQCA 2LFNA 4UP8A 3EIVA 3QB3A 4GLAC 1A3TA 3E5NA 5EPLA 1CZGA 2ZTCA 5C4ZA 4GOPA 2YS6A 2EQSA 4LFAQ 1RYRA 1WJJA 1TWFB 1EHIA 3A55A 1IBMQ 1O7ZA 2XNAC 5KFMA 2Y0SE 5JJIA 1N32H 1ASZA 3HKZG 1QG7A 2XTIA 2R7ZH 3BG5A 3V6KA 4A93G 2AUKA 4ED2A 1IOWA 3T4AC 1S9FA 5CBAE 4ECZA 4NMZA 1P8LA 2ZJTA 2H5XA 5K36G 5IT9c 3HFZB 3HS0C 2CCZA 3FMCA 5C44G 1B04A 5J2UF 2B8FA 4DR7Q 1SBBB 1EYAA 2ZXOA 3PGZA 2N55A 2LMCB 5M5WB 1JB7A 2VOBA 4M8AA 5CV7A 4YY3L 3I4LA 4PZ6A 1C8CA 2C22A 2R7FA 2QDLA 4A3DG 3OHXC 1ENCA 1KABA 3Q2OA 5FLXW 2EYFA 3MFIA 2B2YC 3MVVA 2E2HB 3E6ZX 1H9KA 4BY7G 1F9QA 4P73A 1GSAA 2G9DA 3I12A 3BJUA 5C3XA 5M3FH 3K5OA 3U58A 3GV7B 2PI2A 1LTGD 4EBEA 1R4QB 4OIJA 2M00A 1HNZL 3RBDA 1N36L 4JI4L 3GTQH 4CDEC 2GVAA 3V2TA 2K50A 3DLLA 4GOPC 2M2LA 2ZM6Q 1ZXTA 2LSSA 4NDXA 4KTAA 3I4MG 4NP5A 5F9NA 3H91A 3GV5B 3BYYB 4IRCA 4A3KB 2Q2UA 3PCOB 2IHEA 3HXLA 3VR5A 3FEWX 3SVMA 1H9SA 3D6CA 5CA0F 2HHHL 3G6EA 3HKZA 1W93A 2GPSA 4DV7H 4K0KH 4C3IG 5JJKA 3RB4A 5M9OA 2JA8B 4L5SA 4YHHL 3AU7A 5IGEA 2BA0A 1JE4A 2FLLA 5LMNL 3M85A 4C2MH 4XQJA 3GD7A 4O4HF 5D1OB 1EWHA 2VL6A 4AQYL 5EOYA 4AYBG 2VQEH 5C3EG 4A3MG 1WOCA 5IP9H 2D0PA 4JUZA 5M5WH 4XT3B 1E4FT 1XXGA 2KHSA 1O78A 1ZQ7A 4YQWA 4A3CG 3VPDA 1Q1BA 5BR8Q 3AEVA 2EJFC 3S14B 3B6YA 3NE5B 2I5HA 4X64H 3G6YA 4GKJH 1PRTF 3I70A 2DPJA 4LF7H 3D31A 3QZ7A 3CAMA 3T1HQ 1EQVA 4LMQD 4NW2A 3T5JA 5G3LD 1HZAA 2RSOA 1B6SA 4QWAA 1HNWL 4G7ZC 1F9RA 2HVQA 4ZOLF 5A2QE 1I7LA 3M4IA 3N41B 1DOMA 3DWQA 3JAMc 4X66H 1SCUB 1LABA 1WD1A 1J8IA 4R1JA 2YW2A 2VY3A 2BDNA 1GD7A 2R7KA 2XGQA 1D5XC 5C4JB 4YCVA 4JPBW 4DV5H 1D5MC 3SXHA 4NLGA 1R9TH 3ZJYC 4ME5A 1TS3A 1S97A 3MXUA 2DPIA 4LH7A 4BS9A 3HZXA 3J81c 2P5ZX 2HUGA 2NVYH 4BA1I 2UXBH 2MCTA 1EUDB 5KFYA 3SK5A 2FP4B 2GPWA 5KT7A 1UE6A 2R3ZA 1WD0A 1B1ZA 2N3SA 2F4VL 2XRSD 1SYCA 3F2BA 4EEQA 1UC9A 1B3AA 4AYBA 3KXYT 1UEBA 2PI2E 1TWHA 2BE5C 2Z1CA 1TWGB 2UUCQ 1VF5C 5E1FA 1N33H 4JI5H 1VQ7A 5LYJF 1XMQQ 4IUNA 2L55A 2XSCA 1EYCA 2ZXPA 3S14H 1RF2D 4K5XA 2E2JB 5KFWA 1XPUA 2SNMA 3I2ZA 5H1SE 5EKLA 3HOXH 3PIOA 5L1JA 2C2EA 4RGOS 5CORA 1G51A 1K8MA 1L1OB 4LF4H 1F9SA 4A3BH 2FHTA 2W9CA 2OT2A 3AQQA 3HB9A 5BN5A 4RGMA 4R9WA 2JA6B 1CQIB 4DXGA 2K04A 3PUWA 5IWAL 3BQ2A 2A68C 1AEXA 4P75A 3CCJA 1M90C 1F2LA 4ALPA 2Q2IA 2VQFQ 1Y69U 2D5DA 5ELFA 1IYVA 1HJPA 3ORQA 2IT1A 2BQUA 2NUCA 3A8JE 4LK1C 2DNEA 4CJ2C 1AUXA 5KFRA 4DR3H 4R4IA 2NVXB 1KRTA 1IBKQ 3MXPA 2RDFA 4BXXG 4LFBQ 2F0SA 3GTGA 4A3GH 3JRWA 1I6HH 5CV9A 1VQMA 1EOTA 4DR1L 4FM9A 2B2UC 3EPGA 1RJQA 2R8JA 4LF5Q 4YJ2F 3T56B 2W6MA 1XMOQ 3CCUA 5I2XA 3GP7A 5DGAA 4O2AF 4JV2A 4TV9F 2OF1A 1DM0B 3LWEA 5JPNC 2IX1A 4DGZA 3GTLH 1EUCB 2XIGA 3I73A 3CVZA 2NU7B 4CKEA 1MKHA 2Y0SB 1TWGH 3CD6A 2UXCL 1JDBB 5C1PA 4RA8A 3H3VH 1X3EA 3RZDB 1KHIA 2E2JH 1PTOB 3UE0A 3O13A 4FDBA 4OWXB 4PDBA 4A3KG 4G7OC 2R7LA 5A2QW 2BR0A 2EYJA 5D1PA 1ICWA 3FDTA 2B39A 2ZTEA 1Q1EA 2R93B 4JI3L 1ICFB 1OXVA 3GTJB 1TWFA 3DF7A 3EJIA 1UNNC 1R4PB 4IZOA 4ZQIA 1I4QA 1PFMA 5JUMA 1HNXH 1Y8NB 1CTMA 1IL2A 1EU4A 2WP8J 5D3IB 2X69A 2FJ2A 2FPIB 4IHJF 2JA8G 3OSNA 2J6SA 2V58A 2KECA 2H1EA 1L0WA 2K05A 2DUDA 2DY7A 4E6IA 4QIWE 5C5JA 4BY1B 4ED6A 2XC9A 1WFQA 5KT6A 1EIYB 3BA8A 5T1IA 4IFDI 4JI7L 4PZ8A 3MWEA 3U9OA 4DV3L 2UUAH 1SLJA 2NVXH 2YCHA 1B2TA 1PX2A 2RDJA 3PUVA 2J6UA 3OPOA 1VQ8A 5L1KA 2E74C 3Q8QB 2MQHA 1M0WA 5BN3A 2L1BA 2RHQB 3A54A 4RHRA 3D4WA 3PUZA 3SR1A 2W6PA 2HQLA 2E2HA 1ILPA 4X65Q 1VBHA 3S15H 4M1UB 2K14A 4A3LH 1DGSA 4HMJA 4ID6A 2QILA 2EXDA 1PA6A 4IAJA 1BCPC 1N36H 5KFUA 2ES2A 5C0XJ 3TZDA 1L2ZA 4KKUA 4GC6A 5JEAG 2WYOA 5KT4A 1H9JA 1JDEA 1KTKA 2JA5H 1K0SA 3CXCA 1PTOH 4DAYB 1PH2A 2CW0D 1SYFA 1TT2A 4GKKH 3KDFB 3RB6A 3W1BA 3CQZH 5C1OA 2O4XA 2R93H 5M3MB 1Z7TA 1KDCA 2F0MA 1FJGL 3EROA 3PUXA 4JV5L 4YWKA 1GGOA 2R92B 1PZKD 2FK1A 1X54A 1GOZA 2Z0SA 2JA7B 3Q24A 1W96A 2R7DA 1EWIA 5CV8A 2EYOA 4DV0L 4DV1L 1QCBD 3DHQA 2K1BA 3NQIA 4J9QA 1PH8A 2VR1A 1RTOA 4A3IG 2W6QA 3OHBA 2F52A 1MI2A 2E5LQ 4BY1H 2SOBA 2XGTA 2UUBQ 4A3FH 1EU3A 3PZPA 4JI2H 4OX9L 3KUPA 3PR4A 4P72A 4JYAL 2VPQA 1PH6A 5D1OA 1HFNA 3D6WA 2RGRA 4OGQC 4OIKA 4MA5A 1I50B 2A19A 4LJZC 2AGPA 2R8KA 2YZMA 4O3RA 2EY2A 4XXEA 1UE5A 4C3HG 1W6JA 4KHPQ 3LWBA 5JH7F 3MFYA 4LSAA 5JVLA 1NAPA 5KFLA 4YCWA 1QVGA 2EVBA 5HGQA 4FYDA 3OW7A 1C3OA 1QZGA 1SRUA 4ZUIA 4NXMQ 2Z6KA 3HBLA 3JRXA 4IWXA 4L6TB 3MEFA 1PFNA 4DUZQ 3OHAA 2K5DA 2E2DC 2B2TA 3L2PA 1CHPD 1EL0A 1CSPA 5FO8B 2D0OA 5KFGA 2JA6G 1S0NA 2WTFA 3BQ0A 1YNXA 4NB3A 1AN8A 4RGTA 2IX0A 2JSOA 4NXNQ 2KHJA 4LMYA 3BU2A 4MV3A 5KG5A 1TY2A 3L9AX 4DR4H 1O80A 3K3PA 4DF7A 1HA5A 3T53B 1B6RA 5LOVF 5DM63 3K7AB 5CV6A 1RK5A 5EKIA 5FLMG 2FMMA 2J9GA 1E2WA 2FLPA 1MJEA 2R92H 3R5HA 4UCRA 2I07B 4RKLA 4IWYA 1LLRD 3KF8B 4IRDA 4XX0B 1MJCA 1V1OA 4DAVA 3TIGA 3FRPB 2JJQA 1IBLH 5FLXc 3M9NB 1Z47A 4HAEA 1I3QA 2AKWB 1F9PA 1UAPA 1S72A 1CHQD 4WJ3M 4RHSA 3R5FA 1B8AA 2OQ0A 1V1PB 4YR3A 2Y0SG 3A5UA 1PLFA 1CFMA 1G8ZD 3W2DA 4ECUA 2VW9A 4QWDA 4K2LA 2GVBA 1LTBD 2CW7A 3I72A 2Z6KC 3IFDA 1LT5D 1H9SB 4HR7B 2B2TC 1E3PA 1PTOF 2K5WA 4XZ3B 4DLKA 1K83A 1XNQQ 5ELDA 2W57A 4J9NA 1YHBA 3UDXA 4A93B 1NUCA 1A15A 1BOSA 1DV1A 1YNJD 1BVSA 4I7AA 1STAA 4DV7L 4K0KL 1MSGA 5FK9C 1TVXA 5HV6A 2JA6A 4B3TQ 5KFOA 2QF7A 2Z4IA 4DNIA 5EBDA 1B44D 2VQEL 4Q8EA 3GTPA 4ME6A 4RGNA 1EZ6A 3K7AH 3QFFA 4HNVA 1X3QA 4B3RQ 1VMPA 5DG7A 2F0KA 3J80E 5AFWA 2QA4A 2CW8A 5IYDH 3C2PA 4DPGA 2L5TA 3U50C 2UU9Q 4R8UA 1N34H 4APMA 1JMCA 4BY7B 3K6OA 4X64L 3WO1A 3GIKA 4GKJL 4LF7L 3RB3A 3JZIA 4ODGA 5JAVA 2K28A 1J5EQ 4B3MQ 4DUYH 2AQ4A 3VYUA 3GTMB 4PV1C 3SI8A 3T5LA 3F2DA 3Q8PB 3R2TA 4LH6A 3NXWA 1DOKA 2A68D 4MV6A 5C0XG 3J7AV 1WTQA 4J9RA 3I4MB 2IPKD 4GNXA 3CPFA 3RN2A 1RJPA 3PSIA 2Y0SA 1SNQA 4NKLA 2KVMA 1XNRQ 4X66L 4RG1A 4JBMA 3NP8A 2BCOA 1G6ZA 4H0LC 1UWVA 3MAQA 2ASBA 5EQ0A 2NZ1D 2NVQB 4UFZA 5M3MG 3G71A 4DV5L 5LP6F 3CCMA 4I7ZC 4A93H 4QCLA 3QO2A 3L4JA 1PZJD 4QIWB 3GTJA 2DIKA 4TSSA 2GA4B 2HCIA 4C3IB 1HTLD 1JQYD 4QMGA 5K36H 3BABA 1GM5A 3OOCA 1G91A 4UCTA 1VAJA 5C44H 2UXBL 1MD2D 5CR3A 1JXLA 4FBUA 1WTVA 1WCMB 5FLXE 4UAIA 2AMCB 1Q90A 2MHVA 1U5KA 3P20A 1PK8A 1TWHB 4DV3H 2K5QA 2I80A 1EY9A 3HKSA 5EBCA 4CBVA 4BWSC 3KYHC 3EPIA 4A3DH 1CSQA 4FVMA 1N33L 1VQEA 2XWBB 3I8ZA 3A8KE 4JI5L 3BVGA 1QWYA 3ULPA 3RV3A 5JQWA 4MTDA 4ED1A 4DV4Q 2LS01 3UFXB 4FS2A 4DA2A 4EQ5A 1WTHA 3CMEA 4BY7H 4Y8VB 4IN3A 4ZKCB 1CQFA 4MIUA 5NUCA 4C1NI 4HJ9A 4CKCA 3OIQA 1AZQA 4YAKB 4LF4L 2CHBD 1EUJA 1C7YA 1HUMA 4DV2Q 4GNXC 4HMIA 4CGYB 1YJWA 5BMVF 4OO1I 2KCNA 2KA7A 2NTTA 3CC7A 3I4MH 4IJLA 2IWHA 4JBJA 3CCEA 1F2MA 1T5EA 1MSHA 3KF6B 2A1AA 3S1NB 2ASJA 4DAYA 3GTGB 1PH1A 3A56A 3F2UA 2K7VA 3KDFA 4DR3L 2FINB 3D4RA 1O7LA 3E5SA 3GTOA 4IPCA 3S1MB 1JC7A 4JI8H 1JOOA 2LXJA 2R7NA 4BA2I 3A7AB 3OMCA 4C3IH 3S1QH 1EY7A 4YY3Q 2MFIA 1Z6HA 3G4SA 2PO4A 4IFDJ 4LF6H 1VQPA 3J80W 1SE2A 4IZ8A 1SE4A 3S24A 5KFEA 1BCPD 3VPCA 5KKNB 4DR6H 1SYGA 1EY8A 3F1ZA 5C3EH 4A3MH 1BCPB 1L0XB 1TWHH 1VBGA 2RDIA 4RWSC 4FXGC 2F3WA 3TS0A 2NN6G 4MNOA 3E3XA 1SN8A 1E24A 4A3CH 1DZ1A 3OIPA 2FFKB 5L1LA 1HNZQ 5DGBA 1N36Q 4JI4Q 3R5XA 1I50A 5KFXA 4L5RC 3MXNA 3KHLA 1GHJA 1W2BA 5DAUA 4UY8C 5KRUA 2JK8A 5LXTF 4KD3A 3LGJA 5KFVA 4EQOA 3W1GA 1RYSA 1C4QA 2WAQG 3MR6A 1B53A 1EFWA 3S16H 1TAEA 1SNPA 3S2HH 2FMCA 1UUPA 4LAAA 4APVA 4CDCC 1XPOA 3NQTA 1HNXL 4DR2H 4FS1A 2UVRA 2AGOA 5EGTA 1QNUA 3TP7A 3I3CA 3TINA 4TQRA 2IMWP 2HHHQ 1VQDA 5KNCA 1A2UA 1O7YA 2PZUA 5KG1A 2PMZA 3KHRA 1EQTA 4BBSB 1E4EB 4F87A 1SNDA 4MTNA 5DNFA 4YHHQ 4ECRA 1F77A 2SCUB 2CW0C 4K5VA 4X3UA 4K6LA 5F2DA 3GTGH 5LMNQ 2RA4A 4A4IA 3RB0A 2UUAL 4WFN3 3TP8A 5JPMC 1BBXC 2EY1A 4AQYQ 3DWAA 4IUPA 4L63B 4O4LF 3R2IA 4X3SA 4A2BA 1QUQB 4P71A 3DM1A 5HURA 4JW0A 3KOJA 3K8AA 3LNNA 3C3LA 2C9OA 2DLNA 4FO2A 3RFCA 3KBXA 4H13C 3QIAA 3KF8A 1DOLA 1LTSD 2L11A 4IALA 2NU9B 1QVCA 4KJNA 4MZ9A 4JI6H 1I94L 1ILQA 4KHZA 1CM9A 2PBZA 4TUYF 1RK6A 1GVPA 3BDCA 3RLOA 3KK7A 1WYDA 2L12A 4EQNA 3R8BA 4HNUA 2MNAA 1HNWQ 2UVUA 2EY5A 4UPAA 1D5ZC 1S5CD 3KBGA 3JSLA 4DV6H 2CQYA 4OONA 1V1PA 4RB0A 4FF4A 3LP8A 3ORRA 2CKZB 2EYLA 2QCPX 3HOVB 1VKZA 1TWFH 1A8VA 1V51A 3HG9A 4K8JA 4GKKL 3RZOB 4HR7A 4Q45A 2WACA 1VQIA 1C48A 1I6VC 1KIXA 1VQFA 1N9WA 2G9HD 1FD7D 4Z9CB 2WAQA 2C2RA 4JI1Q 4POGA 1UE7A 4GS3A 1G2SA 1KD1C 2ICEC 1SFOB 5IE8A 1LO5D 4F4XA 4KN4C 5HBRB 2V1CC 3NWTA 3N8DA 1S40A 5IGBA 2BH8A 1WCMG 1KAWA 2F0TA 2YTXA 4YWMA 3A8IE 2HIXA 4JI2L 5M5YB 1Z2NX 5KGUA 4UCVA 3PO2B 3FKIG 4PMCA 1Y1WG 4BXXH 2YU9A 1KJ8A 4HIDA 2F4VQ 2XD4A 1VQ5A 4MA0A 2HIVA 3PVXA 5I4DA 5IODA 4IOCA 3M9BA 2E2HH 5KG7A 1KLUD 4UP7A 3DEOA 1JLLB 2W8LA 1PYSB 4KHVA 4EGQA 3PW5A 2MGSA 5HY6A 1EY6A 1KLGD 1SE3A 1PH3A 2PQAA 3C1FA 1I6UA 4DR5H 1X6OA 2L4NA 2QKIC 3BZDB 3SK6A 5JEAJ 3GTMA 1LYLA 2NYZD 4EX5A 1TS2A 3P1HA 4B08A 1EY5A 1N56A 1GYFA 1DD2A 3KAJA 1KJ9A 3H0GB 4RKBA 3M4PA 4QWEA 4LF9H 2C2DA 1ZHQA 2A69D 2YYZA 3MEHA 4A3JG 5IWAQ 4A3KH 4DR4L 1S0MA 2L0CA 3JAMi 2K33A 1RJRA 2PMZE 5BN4A 2N78A 2FK2A 3TEHB 2I0QA 3K0YA 1HR0H 3RZOH 4OL7A 3G7LA 1VQ9A 2MO1A 4DU9A 4QIWA 3A7LA 1YNJC 1CQVA 1Y1VG 2UVWA 3J7AK 4RCOA 2JA8H 4ED0A 3HOUB 3PMFA 2Q8TA 2B2UA 2F0DA 4A3IB 4DR1Q 3K7UC 1XTDA 1I3QB 3J81i 4IFDG 2VNUD 1IBLL 3KTMA 4QW9A 1STEA 4V0BA 4WORA 3RUPA 2W8KA 4DK3C 2WFWA 1WCMA 2C5CA 1ONLA 4DK0A 1E1TA 3I56A 1EY0A 3MHBA 3UDFA 3CCVA 1YITA 1VQLA 4S3SA 1BR9A 1E2ZA 5D65A 3FKIA 1VQJA 1Y1WA 1HH2P 2I5MX 1BCPF 4C3HB 2QDBA 1SMXA 5LMNW 2C00A 1D1IA 2UXCQ 2F0JA 2K01A 1K83B 3RIZA 1NJIC 2BH2A 2I5LX 5D14A 1GJXA 2V5AA 2AWNA 1EZ8A 5IT9L 1NNXA 1QJOA 3NENA 4JI3Q 3MFGA 4IPHA 4QWCA 4FF3A 1AW7A 4J9PA 5JEAH 4C1NK 3VDYA 1M0TA 2GLTA 4LFCH 1RD9D 2WAQE 3STBC 5ELNA 3J7A5 3OW2A 4XYLB 1HXYD 1A2TA 3GTPB 3OUUA 4KJOA 3OWEB 4DAMA 4BBSG 1JE5A 4IUTA 3SDZA 4OWTB 5IYCG 4E4TA 1NSNS 4K14A 1XYIA 4LF8H 5C4JH 2VS1A 1JOKA 2NBFA 5C4XB 1HRJA 1CS0A 1VQOA 1RTNA 3KF6A 3ULJA 1PV4A 3IN5A 2R6GA 1AN7A 4JI7Q 2PPBC 4R8UB 1V4YA 4V190 1BQQT 5KFIA 1IOVA 1GSHA 1Q3LA 5FPOA 3OUZA 5E3FA 1LACA 1N34L 3K80C 1X55A 3FVQA 1SR3A 1JKJB 2EIFA 1Y1VA 1RHPA 5M5XB 4A3IH 4L8JA 4X62H 2NUAB 3EBEA 1I3QH 3UE1A 1STBA 1Q86C 2MPMA 5JVDF 4DUYL 1OXUA 5KFFA 1D6EC 2BDOA 3KLWA 1VQCA 1VS0A 5IY0A 5KT5A 2B2WA 4G4KA 4JK1C 3G6VA 1C30A 4GNXB 4QL5A 3TIIA 1SAPA 1K9MC 1DV2A 1TQOA 3RAQA 4IPDA 4YWLA 3HOWB 3IG0A 1S4ZA 4C3HH 3T5KA 4DL2A 2R61A 1JCKB 1VQBA 2Z8LA 3CC2A 5GROA 3HOVG 1TWCA 5KYLA 1U9RA 5CC4A 3RBEA 1K83H 4JBWA 2ZT9C 3X3NA 2A5HA 4RNMA 3GIDA 3TREA 3TDQA 2FK3A 1JR0D 1SYEA 3T1YH 2JA6H 2VZAA 1FJGQ 3U9SA 4B9XA 4JV5Q 2QEXA 4KY7A 4UHVA 3CCRA 3GTPH 3HGBA 1K73C 2F4IA 4KKSA 2XCAA 5IGDA 3G6XA 4DV1Q 4DV0Q 1CUKA 1GKHA 1I4HA 1ZEQX 3RUZA 5DG8A 2PZTA 4HJ7A 1AH9A 1E4EA 4JI0H 2FPGB 4WJWA 2KENA 5LL6b 3PO2G 4FP5D 1FGUA 5FLMH 1HHVA 1ZYRD 5KNBA 4OX9Q 4J9KA 1YNNC 5KEEA 4JYAQ 4IO9A 1QNKA 4PQXA 2JYOA 1JWUD 1BBUA 1EFID 1QUQA 2ID0A 5I9OA 3M4QA 1HTPA 1OXTA 2EE1A 4QQBX 1M8AA 5M5XH 5JVG3 1AE2A 5KYIA 2B2WC 5LMUH 3L0OA 3FP9A 3OTOH 1I94H 3MZ5A 3KHHA 1BUVT 5KFPA 3QOJA 4JOIA 1ESFA 2FE3A 1V9PA 3JAML 4ZI7F 1VCIA 1S5DD 2OEOA 4ECYA 3CP0A 3F8TA 2VB2X 3KJPA 2UXDH 1OO9B 4WRDA 1N32Q 4B3SH 4FBTA 3S17B 5G3LF 3GTKB 1VF7A 5DQIA 3H0GG 3RZDH 3P75A 1Q82C 2ICIA 2JQOA 3QWNA 2XCLA 2ASDA 2KJXA 2O2LD 4YBZB 4X6AH 1K1SA 3LWUA 3GTOB 3UQ8A 3GTJH 2VUMG 4JC0A 3HOYG 3J81L 1LM0A 1SROA 4FU0A 2NZOA 1A3VA 3CRKC 5JJZA 4JI8L 3D8GA 1S5FD 4LFAH 2JEBI 5KG4A 2K5VA 2EZVA 2B63B 4XQQA 1IBMH 1NTGA 1YIJA 3N6RA 4IR1A 2VUGA 3SHLA 3HOUG 2LXKA 4CC5A 1SFOA 4F4ZA 1B70B 4LF6L 5C3WA 3BVMA 2JN4A 4Q8FA 2JEJA 1A3UA 4DR6L 1FGBD 1EYGA 3MTSA 5J2TF 4ABNA 3MR3A 3R23A 2A74C 5T1GA 3J80c 2F0GA 1R9TA 3NUCA 1QILA 4DR7H 5IGFA 3MXNB 4NPSA 4O1NA 1A63A 1B3QA 4O42A 3PIP3 1Y14B 3K59A 1FYCA 4DL6A 1NMFA 1O7IA 3MR2A 2HD3A 3E9HA 5EPKA 1VQ6A 5J22A 4ECXA 1CI3M 1U0LA 4JOIC 4LUVA 3RLFA 1I5FA 4Y7NB 4MTEA 2F0VA 5T14A 3OSPA 3D4DA 2ATWA 3S2DB 3OSOA 1J9OA 4HSVA 1IYJB 3ER0A 4DR2L 1RDPD 5C0XH 3MFHA 5EAYA 2PMZB 3WNZA 2F0EA 1MZBA 4ETSA 5IIFA 1CE8A 3GDEA 2KCMA 4C5AA 2HVSA 4DV7Q 4K0KQ 4A3EB 1YHQA 1SMYD 1OTCA 3H0GA 2ASLA 3W3AA 5IYBG 1K1QA 3RNUA 1PH4A 3GTOH 3M3YB 5C4XG 4M9UA 3BDLA 5M3MH 1WTXA 3PF4A 4RB3C 1EEFD 3SK8A 2ZM6H 4OELB 3WWVA 2VQEQ 2VUMA 2K6AA 3J7AF 1EYDA 3HRZC 1S5BD 3KLSA 1SDFA 4CJ1B 2JA7H 2F0QA 1WR2A 3KLRA 1XTCD 2F0FA 1TA8A 1E1OA 1PVOA 4UCSA 4WJ4A 1U4PA 5FO9B 2N88A 4ZHQF 1UNSA 2RVLA 4X64Q 4JI6L 4GKJQ 5FOBB 3P7JA 4LF7Q 1IZ6A 2JA9A 2I8CA 3TQ1A 5FKAC 3GO5A 3C0FB 1BNCA 4DAPA 3Q8DA 1I50H 2PQEA 3CW2C 3FHWA 4QGUA 3S9WA 4BBRB 2ZJRA 3HOWG 3PW0A 4DV6L 3FMAA 1FR3A 3NBHB 5KFZA 1GUGA 1D2BA 5IGGA 2YV5A 4IOAA 3MC0B 2WAQB 4X66Q 3PN1A 3ERQA 3CC4A 3S2DH 5BR8H 3GIIA 4TV8F 3ND8A 1B9NA 4DV5Q 1KDBA 4OO1G 1Q7YC 1M7JA 3T1HH 2P0AA 3VYTA 2UVVA 3ETHA 1YBYA 3TMEA 4O2DA 2KBNA 4DUZL 3IRBA 3WOEA 3Q0AA 3BS1A 2A69C 3AYHB 1TXYA 4EEYA 4DN4M 1TWAA 2YU9B 2UXBQ 3K57A 1S03G 1T5XD 4P2CB 3M3YH 2C35B 2EDGA 3K58A 4KK7A 1Q12A 4Q43A 3UDIA 1SSOA 1N8RC 3MWDA 2YL2A 3L3OC 4O2BF 3RV4A 3DEPA 3MXGA 2M05A 5ISRA 1N33Q 2YRXA 5EWGA 4TQUS 4JI5Q 2PQAB 4YB8B 1JWMD 3HOZB 1YJ9A 2CFMA 4FXDA 3U4ZA 4DR5L 3D3RA 1KJQA 1TY0A 1WVLA 4EYIB 3BDOA 2NN6H 1I4RA 1FNUA 5GAGC 1FL0A 3STBD 1EYZA 5JJLA 3MR5A 4LF4Q 3H3VI 2OLSA 3TN2A 3I7FA 4R4CA 1YHAA 4KY5A 4LF9L 5EWFA 3AFPA 5IP7G 2N49A 2HDLA 2YZNA 1H9MA 1I4PA 2HJWA 1K3BC 3J7ZC 5CAEB 5FD6A 3BAAA 2UUCH 1D7QA 3M7NA 4LWCA 2WE6A 1V43A 1HR0L 1SEIA 5A35A 1XMQH 1IW7D 1ZETA 2ALYB 1TR5A 2D2CC 2KEDA 3EFXD 4DR3Q 2B63G 3S1RB 4R7RA 1XX8A 2QK4A 1WI5A 5L1IA 3Q8RB 2F0OA 4XT1B 5TSSA 1PHJA 4DL5A 1JX4A 3NELA 2HCCA 5IOCA 4A75A 2NWGA 1EIGA 1RJTA 3N52A 1BGWA 4PMBA 2KEEA 3K81C 1LT3D 2YU9H 3UDGA 5JOBA 1EOVA 2K32A 3FKIB 1SJHD 1Z2PX 3T5HA 1Y1WB 1K0RA 1QVFA 1PDQA 4J1MA 5EPJA 4O3NA 1IYUA 3BYTB 1Z2OX 1NR4A 2VXWA 4XTCS 2E2IB 2VQFH 2ZDQA 2IA6A 1T9HA 2QEJC 4OWWB 2F0WA 5BPHA 3KAKA 1VQKA 1IBKH 4LFBH 4EGVA 4N9PA 3EVQA 5EZYF 3PUYA 4BWGB 4C3JG 1Z9FA 2NTSA 3GTMH 1U4MA 1XPRA 3PO3G 2DNCA 2JE6I 1PRTD 1S68A 1JIHA 4LF5H 1DCZA 4FF2A 1K8GA 2XWJB 1CA6A 1A6XA 2FPPB 3GILA 1XMOH 1PRTB 3RLNA 3RJ0A 2OWOA 1GLVA 5DLQE 4LFCL 2AUJD 2KSWA 3TP5A 1HNXQ 3IL8A 4A3EG 3GTKA 4A3JB 2O5IC 3KALA 2TMPA 3SE7A 2KUMA 5KFSA 4KY6A 2B8GA 2IJ0A 2F0LA 2YTYA 4LF8L 2NVQH 4O3QA 4RAZA 2XIWA 5KFQA 1F2YA 1YNND 2MJ8A 2E8GA 2IP4A 4G7HC 1GUOA 1OXXK 1BXTA 2R8GA 1I7NA 3BG3A 4M7EA 1Y1VB 2UUAQ 2HDMA 2RHSB 1HPCA 4PNYA 2B63A 2JXMB 5J3BA 1EQQA 2WKCA 2YRWA 1RCVD 4X62L 1WCMH 3URYA 4RB2C 4AH6A 2F0PA 4CDDC 3BQ1A 3IKJA 2HVRA 1GUTA 4WD3A 1LT4D 1KBLA 1HR0W 5KFCA 3RD4A 4RU9A 2VA3A 1VQHA 2K5HA 3EQLC 2W9BB 1ASYA 2ZJQA 2IBKA 3FKIH 1Y1WH 4JCVE 4KD4A 1X3GA 2OCEA 2NU6B 1HZ9A 2WKDA 4BBRG 1ZYRC 4ZKBB 1GHKA 1TWCB 4F4YA 1ENFA 5AJ3L 1C9OA 4GN5A 4QJFA 1ML0D 1M1KC 5M3FB 1GUNA 4DXFA 3VPBA 2W7OA 1M4VA 1VQNA 5GQOA 1IL8A 1FNWA 1DIKA 4J9SA 5I2YA 4GKKQ 3BVZA 4RNOA 2CH4W 1JB3A 1HFGA 1SNCA 5I9PA 4GN4B 1B50A 3Q8SB 4C5BA 3T1YL 5EDWA 1XWEA 2J7ZA 1E7ZA 3V96A 5C0XI 1G2TA 1T94A 4X65H 1E22A 3KLSX 2R85A 1BDOA 2CQOA 1CKMA 2Q8RE 4QY7A 4CKBA 5I47A 4A3JH 2WINB 1YI2A 5CB4F 3S1NH 4DV2L 3RAXA 1VQGA 3OMGA 3PIPA 4JI0L 3S1MH 1EIFA 1X9NA 4JI2Q 2DZDA 2QYZA 2KQ3A 4MN3A 1Y1VH 4H7BA 1K8AC 4EVOA 2IHFA 2V4QA 3ZYYX 3UI2A 2PVPA 4EBDA 4WBNF 1UC8A 3E9IA 1RIPA 2HT1A 4C2MB 2R87A 1VQ4A 2GN5A 3GV3A 4IFDH 3MA2B 3HOZG 5LMUL 2WB1A 1U4RA 4ED7A 3OTOL 3I90A 4IJHA 4ZRZA 5FJ8G 3JSNA 4R8NA 2FJZA 2UXDL 2ZTDA 3ETJA 2IX3A 2W70A 4YR2A 1S10A 1QE6A 4B3SL 2X0SA 1HQRD 3CU7A 5ELEA 1CQJB 2E5LH 1X3PA 4G3IA 4QF4A 1TWCH 2UUBH 1V8QA 3Q1KA 1L0YB 4CHTB 1LV9A 2DJFC 4P74A 3AB9A 4R4TA 3KFUA 3GIPA 3GIMA 3NBHA 4KI0A 5DQGA 1SJED 1QOHA 4GLXA 4XIGS 4J15A 4DR4Q 2R8IA 2HQEA 4FNFA 4KHPH 3R3OA 1SNOA 4LFAL 4CJ0B 4TQSA 1MGSA 2R86A 1UEAB 3OYYA 3K5LA 1KAAA 2NZHA 3I4NG 1IBML 4ZLTF 1AZPA 2EJGC 4NXMH 1I4GA 3K5MA 3K5IA 4YAJB 1B7YB 4DUZH 5J39A 4BBSH 5IYCH 5L9XA 1SMYC 2RDGA 1DYQA 2NVTB 1R9TB 2EYMA 4N8FA 2CQAA 3RR5A 1IBLQ 2O03A 3V4ZA 3H94A 2JEAI 5KFDA 4NXNH 3NK9A 2ATLA 4DR7L 1XJVA 3RMHA 3M9OB 2NVYB 4J8QA 3H09A 3FPPA 5C4HA 3LMLA 3N40P 3G8CA 1PYBA 2F3VA 2FB9A 2JP1A 3FPUB 4R8IA 1SYDA 4X3TA 2FXQA 2PW7A 3AFQA 2EY6A 3GQBA 3VR2A 3BZKA 1QZHA 4MV8A 1E2VA 1ET9A 2DWCA 1S3OA 1WTRA 2XCPA 1JJCB 1W3SA 1NBWA 2WV6D 4F50A 2L15A 3K5NA 2JEGA 4KLKA 2NN6I 1STYA 4HNTA 4UCUA 4ECQA 2K03A 5DQHA 1OWTA 2IL8A 5I6YA 3HOXB 2YYAA 4PG3A 3HOVH 4DNTB 3T51B 1YEZA 1CZWA 2DN8A 1CT1D 3HOYB 2VUMB 1HZBA 1ZKOA 2R7ZG 3Q22A 3SGIA 1S5ED 1YVCA 2Q8IB 2EOTA 4A3BB 1JJGA 2ZM6L 4HJ5A 4F4WA 2AHOB 4JVZA 1SYBA 1B33N 1EZ1A 2BQRA 2EYPA 2V4DA 1SFOH 1WTOA 4Q0FA 1L2FA 5IT9E 1K3RA 1CKNA 5LL6S 2AQ2B 5DG9A 1XNQH 4MHEA 1N34Q 2F1MA 4U68A 4J0MA 1X65A 4JI1L 5C5MA 2NVTH 1DJRD 5M5YH 5FO7B 3PO2H 4RCNA 2WB1E 3U4VA 4A3GB 1I6HB 4DUYQ 4FF1A 4B3TH 4DK1A 1KXLA 3H20A 4RZQA 2PW5A 2VB3X 1EWCA 3L7ZC 2A73B 2BOSA 4TVAB 2VA2A 2E2IA 2Z4HA 5GAHC 4B3RH 4O3OA 4KV6A 5A2QL 5M3FG 2R7MA 1E4GT 1VDZA 4UP9A 3V05A 1SNMA 3NSWA 4Q5VA 2A6ED 3CHBD 5BR8L 3GTLB 2UU9H 5IGCA 3EYYA 2TSSA 3BJYA 5IYZF 3MJFA 2RKSA 1JWSD 3QR8A 3T1HL 4A2AA 2E76C 4XYOA 4PMWA 2X6LA 1C0AA 1IKMA 1J5EH 3H0GH 4B3MH 1YZ6A 1E0BA 3H4DA 1X56A 1TWAB 4EFEA 2J0TD 2CWPA 3PW7A 3I4OA 2V59A 2PYKA 1W6KA 2VUMH 1V1QA 3HOYH 2W71A 2J6TA 2HGSA 1II3A 3NTKA 3TQYA 2R7ZA 4ED8A 1G291 4HCSA 1TIID 1LTID 3GV6A 1IW7C 3A0JA 2LY7A 1STHA 3TBIB 1XNRH 4DV3Q
chains in the Genus database with same CATH topology
3HKZE 2PI2A 2ATWA 1GM5A 3HOUH 1HNZL 5C44H 4POFA 1N36L 4JI4L 3GTQH 2UXBL 2GVAA 2K50A 3DLLA 1IYJB 3ER0A 4DR2L 4GOPC 2AMCB 5EAYA 1U5KA 2ZM6Q 5IP9G 4L5TA 2LSSA 3DM3A 3I4MG 3GDEA 2KCMA 4DV7Q 4K0KQ 3I55A 4HJ8A 3HKSA 1YHQA 3KYHC 4DK6C 1OTCA 2Q2UA 4A3DH 1CSQA 3PCOB 5IYBG 1N33L 1VQEA 3RNUA 1BBWA 2IHEA 1PH4A 4L5QA 4JI5L 3ULPA 1ASZA 3GTOH 5C4XG 4DV4Q 5M3MH 3PF4A 4EQ5A 4BY7H 3WWVA 3CMEA 2HHHL 3G6EA 2VQEQ 1PH9A 4LUOA 2N8NA 3CF5A 5JJKA 2JA7H 2UUCL 4L5SA 4YHHL 4HJ9A 2BA0A 4LF4L 3K0XA 1XMQL 1E1OA 1EUJA 1C7YA 1PVOA 5LMNL 4DV2Q 3M85A 4C2MH 4GNXC 3NEMA 4WJ4A 3GD7A 4AQYL 2VL6A 1YJWA 3RN5A 4AYBG 4X64Q 4JI6L 4OO1I 1Q81C 5C3EG 4A3MG 1WOCA 3CC7A 4GKJQ 4LF7Q 4JI8Q 1IZ6A 2D0PA 2JA9A 5IP9H 4IJLA 3I4MH 2KCTA 3GO5A 5M5WH 2MO0A 4JBJA 3CCEA 2ZJPA 3CCSA 1SE8A 3Q8DA 1TWAH 1I50H 3CW2C 3FHWA 4A3CG 3KF6B 4QGUA 2A1AA 5IYBH 2ZJRA 1Q1BA 5BR8Q 3AEVA 1PH1A 3HOWG 4DV6L 5C4XH 4LF6Q 2F3IA 3B6YA 3KDFA 2I5HA 4DR3L 4LNQA 3F2CA 3NBHB 4IPCA 3D31A 3CAMA 4DR6Q 3T1HQ 2LXJA 4BA2I 2YV5A 3S1QH 1HZAA 4C3IH 2VQFL 4IOAA 4YY3Q 2MFIA 1HNWL 4X66Q 3G4SA 3CC4A 3S2DH 4IFDJ 1VQPA 3S24A 1IBKL 4LFBL 4DV5Q 4OO1G 1Q7YC 4RMFA 3F1ZA 5C3EH 4A3MH 3JAMc 1TWHH 1YBYA 4O2DA 3TS0A 4LF5L 2NN6G 2KBNA 4MNOA 4DUZL 3IRBA 4R1JA 1GO3E 1E24A 1SN8A 2VY3A 1XMOL 1GD7A 3AYHB 4A3CH 1TXYA 4AYBE 1HNZQ 4LUVA 4YCVA 1N36Q 4JI4Q 3HOWH 2UXBQ 3M3YH 1R9TH 2C35B 3ZJYC 4GLVB 1Q12A 4L5RC 3UDIA 4DR2Q 3HOXG 1W2BA 1N8RC 4UY8C 2JK8A 3LGJA 3J81c 3W1GA 2NVYH 2WAQG 4BA1I 3CMAA 1EFWA 1AE3A 3S16H 4A3BG 1N33Q 3S2HH 4APVA 1XPOA 4TQUS 4JI5Q 1KC8C 2PQAB 1HNXL 4HJAA 1UE6A 1YJ9A 2N3SA 2CFMA 2F4VL 4JG2A 2HHHQ 1VQDA 3U4ZA 3F2BA 4DR5L 1UEBA 2PI2E 5GAGC 1H95A 3JC66 1FL0A 4MTNA 3STBD 2RF4A 2PNHA 4YHHQ 2UUCQ 5JJLA 1VQ7A 4LF4Q 1XMQQ 3GTGH 3S14H 5LMNQ 3H3VI 3I7FA 4A4IA 1P16A 2CWAA 4R4CA 2UUAL 1YHAA 4LF9L 1XPUA 4A3GG 3I2ZA 2D62A 5H1SE 4AQYQ 3AFPA 5IP7G 3HOXH 4JI6Q 2N49A 3PIOA 1QUQB 4P71A 3J7ZC 3D0FA 1D7QA 3KOJA 1G51A 3M7NA 3K8AA 4LWCA 3J80i 1L1OB 1V43A 1HR0L 4A3BH 2ALYB 3AQQA 4DV6Q 1QVCA 4MZ9A 4DR3Q 2B63G 3PUWA 5IWAL 1I94L 4KHZA 4P75A 1UE1A 3CCJA 1WI5A 1GVPA 1M90C 1PHJA 3RLOA 3NELA 1WYDA 4ALPA 4A75A 2Q2IA 2VQFQ 2MNAA 1HNWQ 1HJPA 1LUZA 4GOPB 4UPAA 3S17H 2IT1A 3K81C 4X65L 4OONA 2YU9H 3GTKH 3UDGA 3A74A 1EOVA 4R4IA 2CKZB 1KRTA 4IPGA 1IBKQ 3CCLA 3ICEA 1K0RA 1QVFA 4BXXG 4A3GH 4LFBQ 1I6HH 5IP7H 5GAEC 1TWFH 1A8VA 5E7NA 1VQMA 4GKKL 4DR1L 4XTCS 1T9HA 4A76A 4OWWB 1N32L 4LF5Q 1VQIA 1KIXA 1XMOQ 1VQFA 1N9WA 3CCUA 1VQKA 4JI1Q 4POGA 1UE7A 4GS3A 2Q2HA 2DGYA 1KD1C 3PUYA 5ELOA 1Z9FA 5IE8A 2B63H 3GTMH 1XPRA 1Q46A 1JJ2A 2V1CC 2IX1A 3PO3G 2JE6I 3KJOA 3GTLH 1S40A 1K8GA 2BH8A 1WCMG 1KAWA 3RLNA 1MKHA 2OWOA 1TWGH 3CD6A 2YTXA 2UXCL 5DLQE 4LFCL 4YWMA 2HIXA 4JI2L 3H3VH 1X3EA 1KHIA 2E2JH 1KRSA 1HNXQ 3UE0A 3FKIG 1IXRA 4FDBA 4OWXB 4A3EG 4A3KG 1Y1WG 4BXXH 4HIDA 2F4VQ 3A5ZB 2ZTEA 1Q1EA 3W5OA 1VQ5A 4DR5Q 4JI3L 1OXVA 2HIVA 2YTYA 2E5LL 4LF8L 2NVQH 4IOCA 3M9BA 2E2HH 2UUBL 4UP7A 2E8GA 1PYSB 1OXXK 1KQSA 1IL2A 2WP8J 4A3LG 2OTJA 5HY6A 3H15A 2UUAQ 4Y7NH 4C3JH 1PH3A 4LF9Q 2PQAA 2JA8G 1L0WA 2RHSB 3PO3H 2DUDA 1X6OA 4H02A 5J3BA 5JEAJ 1EQQA 4QIWE 1JT8A 1LYLA 4EX5A 4KHPL 4X62L 1WCMH 1WFQA 1EIYB 4AH6A 4IFDI 1HR0Q 4PZ8A 4JI7L 2B29A 4LUZA 4ME3A 1HR0W 2JA5G 3HOYG 1VQHA 2K5HA 1NMGA 3M4PA 4DV3L 4NXML 1SLJA 1ASYA 2NVXH 2YYZA 3FKIH 2ZJQA 4A3EH 4A3JG 4JCVE 1J6QA 5IWAQ 4HIKA 1X3GA 4A3KH 3PUVA 1Y1WH 1Q8KA 2OCEA 1VQ8A 3JAMi 4DR4L 1HZ9A 4BBRG 2PMZE 2YTVA 2N78A 2R93G 2MQHA 3TEHB 2I0QA 2RHQB 3PUZA 3RZOH 5AJ3L 1C9OA 4GN5A 4QJFA 2HQLA 1M1KC 3CPWA 4OXPA 3U58A 1L1OA 4X65Q 1PFSA 4NXNL 2MO1A 2K14A 3PV0A 1VQ9A 3S15H 4A3LH 1DGSA 3BZCA 1Y1VG 2EXDA 1PA6A 2JA8H 1VQNA 5GQOA 2ES2A 5C0XJ 4GKKQ 4DR1Q 4O0AA 3ERSX 3K7UC 4BY1G 1FVIA 1XTDA 3J81i 4IFDG 2VNUD 4GN4B 1IBLL 5JEAG 3T1YL 4A3FG 5C0XI 1E7ZA 4DK3C 2WFWA 1G6PA 1E22A 4GN3B 2JA5H 1A0IA 2CQOA 3CXCA 1CKMA 1E1TA 3I56A 4QY7A 3UDFA 3CCVA 1MIUA 4PZ7A 4DAYB 1YITA 1VQLA 4A3JH 1PH2A 1YI2A 3KDFB 3W1BA 1VQJA 4BBRH 3S1NH 1HH2P 2I5MX 3CQZH 4DV2L 2R93H 1VQGA 3PIPA 4JI0L 4JBKA 1FJGL 1SMXA 5LMNW 3PUXA 4JV5L 1LTLA 2UXCQ 4YWKA 4DKAC 3S1MH 4LFCQ 1EIFA 1X9NA 4JI2Q 3CCQA 2RCNA 1X54A 1NJIC 2OQKA 2Z0SA 2BH2A 2I5LX 1Y1VH 2R7DA 1EWIA 2AWNA 4DV0L 4DV1L 2IHFA 1K8AC 2A8VA 1NY4A 1PH8A 3E9IA 1RIPA 4A3IG 2HT1A 3NENA 4JI3Q 2F52A 4IPHA 2GN5A 1VQ4A 2E5LQ 4BY1H 4LF8Q 3HOZG 1CKNB 2XGTA 5LMUL 3VDYA 4A3FH 2UUBQ 4R4QA 3OTOL 4OX9L 4P72A 2WAQE 4IJHA 3STBC 5ELNA 3J7A5 4JYAL 1PH6A 5FJ8G 3OW2A 2AWOA 2OTLA 2Q2TA 1XNQL 2UXDL 2ZTDA 4DAMA 2A19A 1JE5A 4BBSG 4LW1A 4OWTB 5IYCG 4B3SL 5C4JH 2VS1A 4HIOA 1UE5A 1VQOA 1D8LA 1TWCH 2K4KA 1L1OC 3KF6A 2R6GA 3ULJA 4X62Q 1PV4A 4KHPQ 4Y52H 4YCWA 1QVGA 4JI7Q 4B3TL 5HGQA 4P74A 4R4TA 2R92G 3KFUA 1QZGA 1SRUA 4KI0A 4NXMQ 2Z6KA 2JA7G 4GLXA 1N34L 2K5NA 3K80C 1X55A 1HZCA 3MEFA 4XIGS 4DUZQ 4J15A 4DR4Q 1SR3A 3L2PA 2EIFA 4A3IH 1CSPA 3M4OH 3EBEA 4B3RL 1I3QH 2D0OA 3UE1A 1Q86C 4LFAL 2JA6G 1YNXA 1VQAA 4DUYL 3OYYA 3HOZH 1OXUA 4NB3A 2BA1A 2NZHA 5AJ3Q 3KLWA 1IBML 3I4NG 1VQCA 1VS0A 5IY0A 2IX0A 5FJ8H 2UU9L 1B7YB 2KHJA 3ULLA 3BU2A 4NXNQ 4GNXB 4QL5A 1X3FA 4BBSH 1K9MC 5IYCH 3TS2A 4IPDA 4YWLA 1NE3A 4C3HH 1J5EL 4B3ML 2KHIA 4AIMA 1A62A 1VQBA 3RR5A 1IBLQ 5FLMG 3T1YQ 3CC2A 5GROA 3HOVG 2B3GA 1MJEA 2JEAI 2R92H 1K83H 3TRZA 4DR7L 4JBWA 1XJVA 1KL9A 3TREA 3KF8B 5M3FH 1MJCA 4HIMA 1PYBA 1YJNA 1PH7A 2JJQA 3J81j 4JI0Q 2QGQA 5FLXc 1XNRL 2FXQA 2VZAA 1Z47A 3AFQA 1QZHA 1FJGQ 3BZKA 2JA6H 3S1RH 4JV5Q 1S3OA 2AKWB 2QEXA 3I4NH 3CCRA 1S72A 1JJCB 1W3SA 1NBWA 4WJ3M 2WB1G 3GTPH 2L15A 1K73C 4KLKA 1B8AA 2NN6I 1BKBA 2OQ0A 2Y0SG 4DV0Q 4DV1Q 3A5UA 1CUKA 1GKHA 1EQRA 3E0EA 1RL2A 4HJ7A 1AH9A 2VW9A 2KENA 2GVBA 3PO2G 3EN2A 1FGUA 3PF5A 5FLMH 2Z6KC 5LMUQ 1I94Q 4PG3A 3OTOQ 4OX9Q 3HOVH 4R4OA 4JYAQ 5IYDG 1YEZA 4IO9A 2K75A 2IY5B 2E2IH 1E3PA 1BBUA 1HZBA 2R7ZG 3SGIA 1YVCA 1OXSC 1QUQA 1YHBA 3UDXA 2ID0A 5GADC 1XNQQ 2UXDQ 3M4QA 1JJGA 2ZM6L 4HJ5A 1OXTA 4B3SQ 1CKOA 2AHOB 4QQBX 1BVSA 5M5XH 4YCUA 1AE2A 3G48A 2K52A 4DV7L 4K0KL 3L0OA 3FP9A 1SFOH 1L2FA 4B3TQ 4JOIA 1K3RA 1V9PA 1CKNA 1VCIA 1PH5A 3CP0A 3F8TA 4DNIA 3KJPA 4DV4L 1N32Q 4UP8A 3EIVA 1N34Q 2VQEL 4GLAC 1X65A 4JI1L 2NVTH 3H0GG 2ZTCA 5M5YH 3K7AH 4GOPA 3RZDH 1Q82C 2EQSA 4B3RQ 4LFAQ 3PO2H 2JQOA 2WB1E 1WJJA 3U4VA 4DUYQ 2QA4A 1KXLA 1IBMQ 2Y0SE 5IYDH 4X6AH 5JJIA 4DPGA 3HKZG 3U50C 3L7ZC 4JC0A 3GTJH 2XTIA 1LM0A 1SROA 1JMCA 2NZOA 2UU9Q 2R7ZH 4TVAB 4X64L 4A93G 4GKJL 5GAHC 4LF7L 4JI8L 2JEBI 5M3FG 2K5VA 1P8LA 1J5EQ 4B3MQ 2H5XA 4UP9A 5K36G 1NTGA 1YIJA 3HOUG 5IT9c 3HFZB 2CCZA 2LXKA 5BR8L 5C44G 3F2DA 1B70B 4LF6L 4DR7Q 5C0XG 4DR6L 3T1HL 3PGZA 4PMWA 4GNXA 3RN2A 3CPFA 1EYGA 1C0AA 3H0GH 3PSIA 1YZ6A 1JB7A 4YY3L 4PZ6A 1X56A 1XNRQ 4X66L 2R7FA 4RG1A 3J80c 4JBMA 4A3DG 2CWPA 1UWVA 2ASBA 3MXNB 3I4OA 4NPSA 1A63A 5M3MG 3G71A 4DV5L 1V1QA 2VUMH 3HOYH 3CCMA 4BY7G 1Y14B 4P73A 4A93H 3TQYA 1NMFA 1O7IA 3E9HA 1G291 1VQ6A 2VUMG 3RLFA 1U0LA 3A0JA 4JOIC 3BJUA 4DV3Q 1I5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  2PI2 A;  2ATW A;  1GM5 A;  3HOU H;  1HNZ L;  5C44 H;  4POF A;  1N36 L;  4JI4 L;  3GTQ H;  2UXB L;  2GVA A;  2K50 A;  3DLL A;  1IYJ B;  3ER0 A;  4DR2 L;  4GOP C;  2AMC B;  5EAY A;  1U5K A;  2ZM6 Q;  5IP9 G;  4L5T A;  2LSS A;  3DM3 A;  3I4M G;  3GDE A;  2KCM A;  4DV7 Q;  4K0K Q;  3I55 A;  4HJ8 A;  3HKS A;  1YHQ A;  3KYH C;  4DK6 C;  1OTC A;  2Q2U A;  4A3D H;  1CSQ A;  3PCO B;  5IYB G;  1N33 L;  1VQE A;  3RNU A;  1BBW A;  2IHE A;  1PH4 A;  4L5Q A;  4JI5 L;  3ULP A;  1ASZ A;  3GTO H;  5C4X G;  4DV4 Q;  5M3M H;  3PF4 A;  4EQ5 A;  4BY7 H;  3WWV A;  3CME A;  2HHH L;  3G6E A;  2VQE Q;  1PH9 A;  4LUO A;  2N8N A;  3CF5 A;  5JJK A;  2JA7 H;  2UUC L;  4L5S A;  4YHH L;  4HJ9 A;  2BA0 A;  4LF4 L;  3K0X A;  1XMQ L;  1E1O A;  1EUJ A;  1C7Y A;  1PVO A;  5LMN L;  4DV2 Q;  3M85 A;  4C2M H;  4GNX C;  3NEM A;  4WJ4 A;  3GD7 A;  4AQY L;  2VL6 A;  1YJW A;  3RN5 A;  4AYB G;  4X64 Q;  4JI6 L;  4OO1 I;  1Q81 C;  5C3E G;  4A3M G;  1WOC A;  3CC7 A;  4GKJ Q;  4LF7 Q;  4JI8 Q;  1IZ6 A;  2D0P A;  2JA9 A;  5IP9 H;  4IJL A;  3I4M H;  2KCT A;  3GO5 A;  5M5W H;  2MO0 A;  4JBJ A;  3CCE A;  2ZJP A;  3CCS A;  1SE8 A;  3Q8D A;  1TWA H;  1I50 H;  3CW2 C;  3FHW A;  4A3C G;  3KF6 B;  4QGU A;  2A1A A;  5IYB H;  2ZJR A;  1Q1B A;  5BR8 Q;  3AEV A;  1PH1 A;  3HOW G;  4DV6 L;  5C4X H;  4LF6 Q;  2F3I A;  3B6Y A;  3KDF A;  2I5H A;  4DR3 L;  4LNQ A;  3F2C A;  3NBH B;  4IPC A;  3D31 A;  3CAM A;  4DR6 Q;  3T1H Q;  2LXJ A;  4BA2 I;  2YV5 A;  3S1Q H;  1HZA A;  4C3I H;  2VQF L;  4IOA A;  4YY3 Q;  2MFI A;  1HNW L;  4X66 Q;  3G4S A;  3CC4 A;  3S2D H;  4IFD J;  1VQP A;  3S24 A;  1IBK L;  4LFB L;  4DV5 Q;  4OO1 G;  1Q7Y C;  4RMF A;  3F1Z A;  5C3E H;  4A3M H;  3JAM c;  1TWH H;  1YBY A;  4O2D A;  3TS0 A;  4LF5 L;  2NN6 G;  2KBN A;  4MNO A;  4DUZ L;  3IRB A;  4R1J A;  1GO3 E;  1E24 A;  1SN8 A;  2VY3 A;  1XMO L;  1GD7 A;  3AYH B;  4A3C H;  1TXY A;  4AYB E;  1HNZ Q;  4LUV A;  4YCV A;  1N36 Q;  4JI4 Q;  3HOW H;  2UXB Q;  3M3Y H;  1R9T H;  2C35 B;  3ZJY C;  4GLV B;  1Q12 A;  4L5R C;  3UDI A;  4DR2 Q;  3HOX G;  1W2B A;  1N8R C;  4UY8 C;  2JK8 A;  3LGJ A;  3J81 c;  3W1G A;  2NVY H;  2WAQ G;  4BA1 I;  3CMA A;  1EFW A;  1AE3 A;  3S16 H;  4A3B G;  1N33 Q;  3S2H H;  4APV A;  1XPO A;  4TQU S;  4JI5 Q;  1KC8 C;  2PQA B;  1HNX L;  4HJA A;  1UE6 A;  1YJ9 A;  2N3S A;  2CFM A;  2F4V L;  4JG2 A;  2HHH Q;  1VQD A;  3U4Z A;  3F2B A;  4DR5 L;  1UEB A;  2PI2 E;  5GAG C;  1H95 A;  3JC6 6;  1FL0 A;  4MTN A;  3STB D;  2RF4 A;  2PNH A;  4YHH Q;  2UUC Q;  5JJL A;  1VQ7 A;  4LF4 Q;  1XMQ Q;  3GTG H;  3S14 H;  5LMN Q;  3H3V I;  3I7F A;  4A4I A;  1P16 A;  2CWA A;  4R4C A;  2UUA L;  1YHA A;  4LF9 L;  1XPU A;  4A3G G;  3I2Z A;  2D62 A;  5H1S E;  4AQY Q;  3AFP A;  5IP7 G;  3HOX H;  4JI6 Q;  2N49 A;  3PIO A;  1QUQ B;  4P71 A;  3J7Z C;  3D0F A;  1D7Q A;  3KOJ A;  1G51 A;  3M7N A;  3K8A A;  4LWC A;  3J80 i;  1L1O B;  1V43 A;  1HR0 L;  4A3B H;  2ALY B;  3AQQ A;  4DV6 Q;  1QVC A;  4MZ9 A;  4DR3 Q;  2B63 G;  3PUW A;  5IWA L;  1I94 L;  4KHZ A;  4P75 A;  1UE1 A;  3CCJ A;  1WI5 A;  1GVP A;  1M90 C;  1PHJ A;  3RLO A;  3NEL A;  1WYD A;  4ALP A;  4A75 A;  2Q2I A;  2VQF Q;  2MNA A;  1HNW Q;  1HJP A;  1LUZ A;  4GOP B;  4UPA A;  3S17 H;  2IT1 A;  3K81 C;  4X65 L;  4OON A;  2YU9 H;  3GTK H;  3UDG A;  3A74 A;  1EOV A;  4R4I A;  2CKZ B;  1KRT A;  4IPG A;  1IBK Q;  3CCL A;  3ICE A;  1K0R A;  1QVF A;  4BXX G;  4A3G H;  4LFB Q;  1I6H H;  5IP7 H;  5GAE C;  1TWF H;  1A8V A;  5E7N A;  1VQM A;  4GKK L;  4DR1 L;  4XTC S;  1T9H A;  4A76 A;  4OWW B;  1N32 L;  4LF5 Q;  1VQI A;  1KIX A;  1XMO Q;  1VQF A;  1N9W A;  3CCU A;  1VQK A;  4JI1 Q;  4POG A;  1UE7 A;  4GS3 A;  2Q2H A;  2DGY A;  1KD1 C;  3PUY A;  5ELO A;  1Z9F A;  5IE8 A;  2B63 H;  3GTM H;  1XPR A;  1Q46 A;  1JJ2 A;  2V1C C;  2IX1 A;  3PO3 G;  2JE6 I;  3KJO A;  3GTL H;  1S40 A;  1K8G A;  2BH8 A;  1WCM G;  1KAW A;  3RLN A;  1MKH A;  2OWO A;  1TWG H;  3CD6 A;  2YTX A;  2UXC L;  5DLQ E;  4LFC L;  4YWM A;  2HIX A;  4JI2 L;  3H3V H;  1X3E A;  1KHI A;  2E2J H;  1KRS A;  1HNX Q;  3UE0 A;  3FKI G;  1IXR A;  4FDB A;  4OWX B;  4A3E G;  4A3K G;  1Y1W G;  4BXX H;  4HID A;  2F4V Q;  3A5Z B;  2ZTE A;  1Q1E A;  3W5O A;  1VQ5 A;  4DR5 Q;  4JI3 L;  1OXV A;  2HIV A;  2YTY A;  2E5L L;  4LF8 L;  2NVQ H;  4IOC A;  3M9B A;  2E2H H;  2UUB L;  4UP7 A;  2E8G A;  1PYS B;  1OXX K;  1KQS A;  1IL2 A;  2WP8 J;  4A3L G;  2OTJ A;  5HY6 A;  3H15 A;  2UUA Q;  4Y7N H;  4C3J H;  1PH3 A;  4LF9 Q;  2PQA A;  2JA8 G;  1L0W A;  2RHS B;  3PO3 H;  2DUD A;  1X6O A;  4H02 A;  5J3B A;  5JEA J;  1EQQ A;  4QIW E;  1JT8 A;  1LYL A;  4EX5 A;  4KHP L;  4X62 L;  1WCM H;  1WFQ A;  1EIY B;  4AH6 A;  4IFD I;  1HR0 Q;  4PZ8 A;  4JI7 L;  2B29 A;  4LUZ A;  4ME3 A;  1HR0 W;  2JA5 G;  3HOY G;  1VQH A;  2K5H A;  1NMG A;  3M4P A;  4DV3 L;  4NXM L;  1SLJ A;  1ASY A;  2NVX H;  2YYZ A;  3FKI H;  2ZJQ A;  4A3E H;  4A3J G;  4JCV E;  1J6Q A;  5IWA Q;  4HIK A;  1X3G A;  4A3K H;  3PUV A;  1Y1W H;  1Q8K A;  2OCE A;  1VQ8 A;  3JAM i;  4DR4 L;  1HZ9 A;  4BBR G;  2PMZ E;  2YTV A;  2N78 A;  2R93 G;  2MQH A;  3TEH B;  2I0Q A;  2RHQ B;  3PUZ A;  3RZO H;  5AJ3 L;  1C9O A;  4GN5 A;  4QJF A;  2HQL A;  1M1K C;  3CPW A;  4OXP A;  3U58 A;  1L1O A;  4X65 Q;  1PFS A;  4NXN L;  2MO1 A;  2K14 A;  3PV0 A;  1VQ9 A;  3S15 H;  4A3L H;  1DGS A;  3BZC A;  1Y1V G;  2EXD A;  1PA6 A;  2JA8 H;  1VQN A;  5GQO A;  2ES2 A;  5C0X J;  4GKK Q;  4DR1 Q;  4O0A A;  3ERS X;  3K7U C;  4BY1 G;  1FVI A;  1XTD A;  3J81 i;  4IFD G;  2VNU D;  4GN4 B;  1IBL L;  5JEA G;  3T1Y L;  4A3F G;  5C0X I;  1E7Z A;  4DK3 C;  2WFW A;  1G6P A;  1E22 A;  4GN3 B;  2JA5 H;  1A0I A;  2CQO A;  3CXC A;  1CKM A;  1E1T A;  3I56 A;  4QY7 A;  3UDF A;  3CCV A;  1MIU A;  4PZ7 A;  4DAY B;  1YIT A;  1VQL A;  4A3J H;  1PH2 A;  1YI2 A;  3KDF B;  3W1B A;  1VQJ A;  4BBR H;  3S1N H;  1HH2 P;  2I5M X;  3CQZ H;  4DV2 L;  2R93 H;  1VQG A;  3PIP A;  4JI0 L;  4JBK A;  1FJG L;  1SMX A;  5LMN W;  3PUX A;  4JV5 L;  1LTL A;  2UXC Q;  4YWK A;  4DKA C;  3S1M H;  4LFC Q;  1EIF A;  1X9N A;  4JI2 Q;  3CCQ A;  2RCN A;  1X54 A;  1NJI C;  2OQK A;  2Z0S A;  2BH2 A;  2I5L X;  1Y1V H;  2R7D A;  1EWI A;  2AWN A;  4DV0 L;  4DV1 L;  2IHF A;  1K8A C;  2A8V A;  1NY4 A;  1PH8 A;  3E9I A;  1RIP A;  4A3I G;  2HT1 A;  3NEN A;  4JI3 Q;  2F52 A;  4IPH A;  2GN5 A;  1VQ4 A;  2E5L Q;  4BY1 H;  4LF8 Q;  3HOZ G;  1CKN B;  2XGT A;  5LMU L;  3VDY A;  4A3F H;  2UUB Q;  4R4Q A;  3OTO L;  4OX9 L;  4P72 A;  2WAQ E;  4IJH A;  3STB C;  5ELN A;  3J7A 5;  4JYA L;  1PH6 A;  5FJ8 G;  3OW2 A;  2AWO A;  2OTL A;  2Q2T A;  1XNQ L;  2UXD L;  2ZTD A;  4DAM A;  2A19 A;  1JE5 A;  4BBS G;  4LW1 A;  4OWT B;  5IYC G;  4B3S L;  5C4J H;  2VS1 A;  4HIO A;  1UE5 A;  1VQO A;  1D8L A;  1TWC H;  2K4K A;  1L1O C;  3KF6 A;  2R6G A;  3ULJ A;  4X62 Q;  1PV4 A;  4KHP Q;  4Y52 H;  4YCW A;  1QVG A;  4JI7 Q;  4B3T L;  5HGQ A;  4P74 A;  4R4T A;  2R92 G;  3KFU A;  1QZG A;  1SRU A;  4KI0 A;  4NXM Q;  2Z6K A;  2JA7 G;  4GLX A;  1N34 L;  2K5N A;  3K80 C;  1X55 A;  1HZC A;  3MEF A;  4XIG S;  4DUZ Q;  4J15 A;  4DR4 Q;  1SR3 A;  3L2P A;  2EIF A;  4A3I H;  1CSP A;  3M4O H;  3EBE A;  4B3R L;  1I3Q H;  2D0O A;  3UE1 A;  1Q86 C;  4LFA L;  2JA6 G;  1YNX A;  1VQA A;  4DUY L;  3OYY A;  3HOZ H;  1OXU A;  4NB3 A;  2BA1 A;  2NZH A;  5AJ3 Q;  3KLW A;  1IBM L;  3I4N G;  1VQC A;  1VS0 A;  5IY0 A;  2IX0 A;  5FJ8 H;  2UU9 L;  1B7Y B;  2KHJ A;  3ULL A;  3BU2 A;  4NXN Q;  4GNX B;  4QL5 A;  1X3F A;  4BBS H;  1K9M C;  5IYC H;  3TS2 A;  4IPD A;  4YWL A;  1NE3 A;  4C3H H;  1J5E L;  4B3M L;  2KHI A;  4AIM A;  1A62 A;  1VQB A;  3RR5 A;  1IBL Q;  5FLM G;  3T1Y Q;  3CC2 A;  5GRO A;  3HOV G;  2B3G A;  1MJE A;  2JEA I;  2R92 H;  1K83 H;  3TRZ A;  4DR7 L;  4JBW A;  1XJV A;  1KL9 A;  3TRE A;  3KF8 B;  5M3F H;  1MJC A;  4HIM A;  1PYB A;  1YJN A;  1PH7 A;  2JJQ A;  3J81 j;  4JI0 Q;  2QGQ A;  5FLX c;  1XNR L;  2FXQ A;  2VZA A;  1Z47 A;  3AFQ A;  1QZH A;  1FJG Q;  3BZK A;  2JA6 H;  3S1R H;  4JV5 Q;  1S3O A;  2AKW B;  2QEX A;  3I4N H;  3CCR A;  1S72 A;  1JJC B;  1W3S A;  1NBW A;  4WJ3 M;  2WB1 G;  3GTP H;  2L15 A;  1K73 C;  4KLK A;  1B8A A;  2NN6 I;  1BKB A;  2OQ0 A;  2Y0S G;  4DV0 Q;  4DV1 Q;  3A5U A;  1CUK A;  1GKH A;  1EQR A;  3E0E A;  1RL2 A;  4HJ7 A;  1AH9 A;  2VW9 A;  2KEN A;  2GVB A;  3PO2 G;  3EN2 A;  1FGU A;  3PF5 A;  5FLM H;  2Z6K C;  5LMU Q;  1I94 Q;  4PG3 A;  3OTO Q;  4OX9 Q;  3HOV H;  4R4O A;  4JYA Q;  5IYD G;  1YEZ A;  4IO9 A;  2K75 A;  2IY5 B;  2E2I H;  1E3P A;  1BBU A;  1HZB A;  2R7Z G;  3SGI A;  1YVC A;  1OXS C;  1QUQ A;  1YHB A;  3UDX A;  2ID0 A;  5GAD C;  1XNQ Q;  2UXD Q;  3M4Q A;  1JJG A;  2ZM6 L;  4HJ5 A;  1OXT A;  4B3S Q;  1CKO A;  2AHO B;  4QQB X;  1BVS A;  5M5X H;  4YCU A;  1AE2 A;  3G48 A;  2K52 A;  4DV7 L;  4K0K L;  3L0O A;  3FP9 A;  1SFO H;  1L2F A;  4B3T Q;  4JOI A;  1K3R A;  1V9P A;  1CKN A;  1VCI A;  1PH5 A;  3CP0 A;  3F8T A;  4DNI A;  3KJP A;  4DV4 L;  1N32 Q;  4UP8 A;  3EIV A;  1N34 Q;  2VQE L;  4GLA C;  1X65 A;  4JI1 L;  2NVT H;  3H0G G;  2ZTC A;  5M5Y H;  3K7A H;  4GOP A;  3RZD H;  1Q82 C;  2EQS A;  4B3R Q;  4LFA Q;  3PO2 H;  2JQO A;  2WB1 E;  1WJJ A;  3U4V A;  4DUY Q;  2QA4 A;  1KXL A;  1IBM Q;  2Y0S E;  5IYD H;  4X6A H;  5JJI A;  4DPG A;  3HKZ G;  3U50 C;  3L7Z C;  4JC0 A;  3GTJ H;  2XTI A;  1LM0 A;  1SRO A;  1JMC A;  2NZO A;  2UU9 Q;  2R7Z H;  4TVA B;  4X64 L;  4A93 G;  4GKJ L;  5GAH C;  4LF7 L;  4JI8 L;  2JEB I;  5M3F G;  2K5V A;  1P8L A;  1J5E Q;  4B3M Q;  2H5X A;  4UP9 A;  5K36 G;  1NTG A;  1YIJ A;  3HOU G;  5IT9 c;  3HFZ B;  2CCZ A;  2LXK A;  5BR8 L;  5C44 G;  3F2D A;  1B70 B;  4LF6 L;  4DR7 Q;  5C0X G;  4DR6 L;  3T1H L;  3PGZ A;  4PMW A;  4GNX A;  3RN2 A;  3CPF A;  1EYG A;  1C0A A;  3H0G H;  3PSI A;  1YZ6 A;  1JB7 A;  4YY3 L;  4PZ6 A;  1X56 A;  1XNR Q;  4X66 L;  2R7F A;  4RG1 A;  3J80 c;  4JBM A;  4A3D G;  2CWP A;  1UWV A;  2ASB A;  3MXN B;  3I4O A;  4NPS A;  1A63 A;  5M3M G;  3G71 A;  4DV5 L;  1V1Q A;  2VUM H;  3HOY H;  3CCM A;  4BY7 G;  1Y14 B;  4P73 A;  4A93 H;  3TQY A;  1NMF A;  1O7I A;  3E9H A;  1G29 1;  1VQ6 A;  2VUM G;  3RLF A;  1U0L A;  3A0J A;  4JOI C;  3BJU A;  4DV3 Q;  1I5F A; 
#chains in the Genus database with same CATH topology
 3BA9 A;  3HKZ E;  5K2M A;  2A6H D;  3HOU H;  4IUU A;  5DEH A;  2D9U A;  4RAU C;  4HYK A;  4POF A;  2X6G A;  2V4R A;  3QJY A;  4UDU C;  3PW2 A;  1ESR A;  2IW3 A;  5IP9 G;  4L5T A;  3DM3 A;  4XQN A;  4Q0Y A;  4RH6 A;  4ECW A;  2PCF B;  4ZK9 B;  2W7P A;  4MV7 A;  3I55 A;  4HJ8 A;  4DK6 C;  4XYM B;  5KT3 A;  3M7G A;  3E0J A;  2W9B A;  2OXP A;  1BBW A;  2AQ1 B;  4L5Q A;  2I46 A;  3T13 A;  4IUV A;  1LT6 D;  3NTH A;  1PH9 A;  4LUO A;  2N8N A;  3CF5 A;  3S15 B;  2RGV A;  1T3N A;  2ENB A;  2RDH A;  3F8N A;  4RAY A;  2AU0 A;  2UUC L;  1DON A;  5KG0 A;  1FKA H;  4DV4 H;  3K0X A;  4N9T A;  1XMQ L;  2W6Z A;  2OH2 A;  3T16 A;  1PRT C;  3NEM A;  2MUY A;  3GTQ A;  1PTO D;  3RN5 A;  2W6O A;  3C46 A;  1Q81 C;  2KOL A;  1KNE A;  2JA5 B;  4JI8 Q;  3JAM E;  1K28 A;  2KCT A;  2MO0 A;  5DLG A;  2V9W A;  2ZJP A;  3CCS A;  1SE8 A;  4GZY C;  5KG3 A;  1TWA H;  5IYB H;  3RGZ A;  3CQZ B;  4DV2 H;  5LL6 X;  5C4X H;  4LF6 Q;  5CYU A;  5IT9 W;  3QZ8 A;  2F3I A;  3L4K A;  4LNQ A;  4O3P A;  3F2C A;  1IHZ A;  4DL4 A;  4DR6 Q;  4J9O A;  4C5C A;  4U67 3;  2XGP A;  2VQF L;  3QOL A;  3J81 E;  1BJT A;  5KFK A;  4ECV A;  4ZUJ A;  4Q44 A;  5CV5 A;  3VR6 A;  5KFN A;  2L9H A;  1PXU A;  1IBK L;  4LFB L;  3RGX A;  4A3F B;  1JOR A;  3H40 A;  1B4O A;  1SYX B;  4C2M A;  4RMF A;  5ELB A;  4QWB A;  3MWM A;  2XVS A;  4YY3 H;  4K5W A;  4LF5 L;  3SEB A;  3V6H A;  1GO3 E;  3X3M A;  3ONA B;  1XMO L;  5KFA A;  5KIX A;  3VYS A;  1MBY A;  4AYB E;  4HQ6 A;  3HOW H;  4GLV B;  4DR2 Q;  4HED A;  3HOX G;  4U7C A;  4UCO A;  3IAY A;  3NHH A;  5KFT A;  3RF2 A;  3U9T A;  2F0U A;  2ZXR A;  4HSP A;  1XDN A;  2R6F A;  3CMA A;  1HNZ H;  3NWS A;  4A3B G;  1AE3 A;  4JI4 H;  4ZAI A;  2EPB A;  5DM7 3;  3TSS A;  1KC8 C;  4F7X A;  4HJA A;  1K8O A;  4OO1 H;  4JG2 A;  3R93 A;  5KND A;  3TQT A;  5JVH 3;  1ZHS A;  4J9M A;  2JEI A;  1D1K A;  4KKT A;  1H95 A;  3JC6 6;  4O4I F;  1FNV A;  2PNH A;  2RF4 A;  3WDN A;  2NU8 B;  2AGQ A;  4IR9 A;  5KFH A;  3PW4 A;  5C8Y F;  1P16 A;  2CWA A;  2NB0 A;  4ULL A;  3N44 B;  4ECS A;  2HHH H;  1GXD C;  4A3G G;  2D62 A;  4U6P A;  1JIC A;  4JI6 Q;  4XYQ A;  1PMR A;  1GSO A;  5E4W C;  3D0F A;  2F0H A;  4YHH H;  1KJI A;  3J80 i;  2CZG A;  2AQ3 B;  1LTR D;  3NTI A;  4MV4 A;  5C6A A;  2NVY A;  2Z6B A;  5LMN H;  1WTP A;  2LKV A;  4DV6 Q;  3K5H A;  4AQY H;  2O5J C;  1T36 A;  4C3J B;  2ZDG A;  1HCZ A;  1UE1 A;  2KCC A;  3HEJ A;  1H9R A;  3PO3 B;  1BXR A;  4DNR B;  3AMU A;  4PWQ A;  2EYH A;  1LUZ A;  5COY A;  4GOP B;  3S17 H;  3KHG A;  3GIQ A;  4X65 L;  3GTK H;  2CH4 A;  3DUZ A;  5CGK A;  3A74 A;  3CCL A;  4RUC A;  4IPG A;  2SNS A;  3ICE A;  3C1E A;  5IP7 H;  5GAE C;  3HP3 A;  5E7N A;  1HA6 A;  4YP3 A;  2BQ3 A;  1HNW H;  4A76 A;  3JAM W;  1N32 L;  2DJG C;  5H80 A;  4QUF A;  4DFA A;  4K8I A;  2VQD A;  3GIJ A;  5KG6 A;  4EFB A;  5EWE A;  2Q2H A;  3J7Y W;  1STN A;  2DGY A;  3DXJ C;  5ELO A;  2DY8 A;  2B63 H;  4G57 A;  4JV0 A;  4O3S A;  3V4S A;  1Q46 A;  1JJ2 A;  3KJO A;  1CA5 A;  2WII B;  3OWF A;  4HCE A;  2WB1 B;  2FLN A;  1U4L A;  4RNN A;  4JI1 H;  3J81 W;  4YR0 A;  1PYW D;  4ZQ3 A;  5KX5 F;  4MTK A;  1KRS A;  2I87 A;  2R82 A;  1IXR A;  2SEB D;  5D3D A;  3RTX A;  3A5Z B;  2YS7 A;  1DXM A;  3VA7 A;  3W5O A;  4DR5 Q;  2E5L L;  4EG0 A;  2ZDH A;  4F8M A;  5CMD A;  2UUB L;  2CVR A;  3Q6S A;  3CRL C;  1IKL A;  1LTT D;  4B9W A;  3WOF A;  1KQS A;  2EJM A;  2RCF A;  4A3L G;  2B2V A;  2F4V H;  2OTJ A;  3H15 A;  2SDF A;  4Y7N H;  4C3J H;  4LF9 Q;  5LA6 F;  4GC7 A;  3PO3 H;  1F2Z A;  4I50 F;  4H02 A;  4ECT A;  4TKO B;  1TKW B;  1JT8 A;  5I6W A;  4KHP L;  2G5D A;  4I65 A;  3Q23 A;  3GTL A;  1HR0 Q;  5K5P A;  2EXZ A;  2B29 A;  4LUZ A;  1TS4 A;  4ME3 A;  2JA5 G;  1TWG A;  1I4X A;  1NMG A;  3TP6 A;  4NXM L;  3V6J A;  4A3E H;  4DL7 A;  1J6Q A;  1HQM C;  5L37 A;  3EA6 A;  4HIK A;  1Q8K A;  4RZR A;  4YIJ A;  4IUR A;  4I7H A;  3GLK A;  2YTV A;  2R93 G;  2ALZ A;  3M4Y A;  1EEI D;  3HKZ B;  2PZW A;  4RUA A;  1AFP A;  2YZG A;  3VR4 A;  5KT2 A;  3CPW A;  4OXP A;  1L1O A;  5E4X A;  1PFS A;  3G6J B;  4NXN L;  3PV0 A;  1SXT A;  5IWA H;  3BZC A;  5ELC A;  4L1K A;  5D8D A;  1QB5 D;  1ENA A;  4K6D A;  4CC6 A;  4QW8 A;  1RKN A;  5C44 B;  1HUN A;  5CV4 A;  1KNA A;  3ITP A;  1ET6 A;  3ERS X;  4O0A A;  4BY1 G;  1FVI A;  3SK4 A;  3M4O B;  4A3F G;  4F88 A;  2PN1 A;  2W6N A;  4XDX A;  1TS5 A;  1G6P A;  2W9A A;  2R84 A;  4GN3 B;  1A0I A;  2BE5 D;  4X3K A;  2JEF A;  4ZYS A;  1MIU A;  4PZ7 A;  4A3D B;  3N6X A;  3SE0 A;  4DR1 H;  4IRK A;  2NVX A;  4BBR H;  4C56 C;  1ROD A;  4JBK A;  1AUV A;  5LHY 1;  5FD5 A;  4YJ3 F;  2B2V C;  4HN7 A;  1LTL A;  4ZCK A;  3VYR A;  4DKA C;  1WTW A;  1JOQ A;  4LFC Q;  1GUS A;  2WDT A;  5BPF A;  4J9L A;  3CCQ A;  2RCN A;  1NCV A;  1KDA A;  2OQK A;  5C5L A;  3H6M A;  4MV1 A;  1TU2 B;  5CA1 F;  2A8V A;  1NY4 A;  3PR5 B;  1PFB A;  2A6E C;  4EQP A;  4LF8 Q;  1B9M A;  2UXC H;  4EYH B;  1CKN B;  4HTH A;  4R4Q A;  3H3V C;  3I4N B;  3K3V A;  1VMC A;  3FDS A;  2AWO A;  2E75 C;  2OTL A;  2Q2T A;  2JA5 A;  2Z9H A;  1XNQ L;  2F0I A;  3J80 L;  2XN9 C;  4LW1 A;  1BNZ A;  4JV1 A;  1M6V A;  4JI3 H;  4EBC A;  4HIO A;  1MHW C;  1D8L A;  1EY4 A;  2K4K A;  1L1O C;  4Y52 H;  4X62 Q;  4KN7 C;  3CQZ A;  2R93 A;  4OEM B;  5FPR A;  4B3T L;  2MP1 A;  2R92 G;  4CDF C;  3S1Q B;  3PIO 3;  4K2K A;  1WSC A;  2JA7 G;  2R8H A;  3M9M B;  2K5N A;  1HZC A;  2C28 A;  2QW7 A;  2XRQ D;  2A6H C;  4KMU C;  4J6H A;  3M4O H;  1X32 A;  4B3R L;  2RBM A;  4JI7 H;  3NBI A;  3HOZ H;  1VQA A;  4IQZ A;  4AYB B;  4N8X 1;  5AJ3 Q;  2BA1 A;  5C3E B;  3ND9 A;  4A3M B;  5FJ8 H;  5DLF A;  4TRD A;  2UU9 L;  3MWY W;  3ULL A;  1GUW A;  2F03 A;  1X3F A;  1Y8O B;  5GON F;  2RSN A;  4QB4 A;  3TS2 A;  3N42 B;  4EGJ A;  1NE3 A;  1J5E L;  4B3M L;  2KHI A;  4DL3 A;  4AIM A;  1A62 A;  2FMA A;  3CKI B;  4OHJ A;  3T1Y Q;  1KEE A;  5HGT A;  2B3G A;  3TRZ A;  4I4T F;  2FKL A;  2W9C B;  1KL9 A;  2R7Z B;  4ED3 A;  5EKK A;  3S16 B;  4MAM A;  4HIM A;  3S2H B;  1YJN A;  1PH7 A;  2H4O A;  2J4X A;  3PQI A;  3J81 j;  4JI0 Q;  2QGQ A;  1XNR L;  5FLX L;  4FXK C;  1SEB D;  3S1R H;  1NR2 A;  4LSX A;  3I4N H;  3DWP A;  5EJW A;  3H4B A;  3VMM A;  1PTO C;  2M9V A;  1EIH A;  1BF4 A;  2WB1 G;  2VPS A;  5KG2 A;  3N43 B;  1BKB A;  2RQX A;  1N48 A;  3E0E A;  1EQR A;  3NGD A;  5CBE E;  1BO0 A;  1RL2 A;  4RB1 A;  3GV8 B;  4RFB A;  4IUQ A;  4MV9 A;  1FJG H;  3TZU A;  3DMU A;  3EN2 A;  4JV5 H;  3PF5 A;  1AP0 A;  1A9X A;  5LMU Q;  1I94 Q;  3OTO Q;  3I91 A;  4R4O A;  5IYD G;  3IFT A;  3NPP A;  1ULZ A;  2K75 A;  2IY5 B;  1PZI D;  1Y8P B;  2E2I H;  3WO0 A;  5KFB A;  2PNR C;  4DV1 H;  4DV0 H;  1O75 A;  2R92 A;  2F0N A;  1OXS C;  5GAD C;  2UXD Q;  3VR3 A;  5F9L A;  1Q8I A;  3QG1 A;  4B3S Q;  2B2Y A;  1S0O A;  2JA7 A;  1CKO A;  1WH2 A;  3LX0 A;  4YCU A;  3G48 A;  2K52 A;  4H44 C;  4OX9 H;  1STG A;  4JYA H;  4ILW A;  1KC7 A;  4QUC A;  1KJJ A;  1LTA D;  3GTQ B;  5KFJ A;  5J1Z A;  1PH5 A;  1CK1 A;  3VA5 A;  4DV4 L;  4I55 F;  3GQC A;  2LFN A;  4UP8 A;  3EIV A;  3QB3 A;  4GLA C;  1A3T A;  3E5N A;  5EPL A;  1CZG A;  2ZTC A;  5C4Z A;  4GOP A;  2YS6 A;  2EQS A;  4LFA Q;  1RYR A;  1WJJ A;  1TWF B;  1EHI A;  3A55 A;  1IBM Q;  1O7Z A;  2XNA C;  5KFM A;  2Y0S E;  5JJI A;  1N32 H;  1ASZ A;  3HKZ G;  1QG7 A;  2XTI A;  2R7Z H;  3BG5 A;  3V6K A;  4A93 G;  2AUK A;  4ED2 A;  1IOW A;  3T4A C;  1S9F A;  5CBA E;  4ECZ A;  4NMZ A;  1P8L A;  2ZJT A;  2H5X A;  5K36 G;  5IT9 c;  3HFZ B;  3HS0 C;  2CCZ A;  3FMC A;  5C44 G;  1B04 A;  5J2U F;  2B8F A;  4DR7 Q;  1SBB B;  1EYA A;  2ZXO A;  3PGZ A;  2N55 A;  2LMC B;  5M5W B;  1JB7 A;  2VOB A;  4M8A A;  5CV7 A;  4YY3 L;  3I4L A;  4PZ6 A;  1C8C A;  2C22 A;  2R7F A;  2QDL A;  4A3D G;  3OHX C;  1ENC A;  1KAB A;  3Q2O A;  5FLX W;  2EYF A;  3MFI A;  2B2Y C;  3MVV A;  2E2H B;  3E6Z X;  1H9K A;  4BY7 G;  1F9Q A;  4P73 A;  1GSA A;  2G9D A;  3I12 A;  3BJU A;  5C3X A;  5M3F H;  3K5O A;  3U58 A;  3GV7 B;  2PI2 A;  1LTG D;  4EBE A;  1R4Q B;  4OIJ A;  2M00 A;  1HNZ L;  3RBD A;  1N36 L;  4JI4 L;  3GTQ H;  4CDE C;  2GVA A;  3V2T A;  2K50 A;  3DLL A;  4GOP C;  2M2L A;  2ZM6 Q;  1ZXT A;  2LSS A;  4NDX A;  4KTA A;  3I4M G;  4NP5 A;  5F9N A;  3H91 A;  3GV5 B;  3BYY B;  4IRC A;  4A3K B;  2Q2U A;  3PCO B;  2IHE A;  3HXL A;  3VR5 A;  3FEW X;  3SVM A;  1H9S A;  3D6C A;  5CA0 F;  2HHH L;  3G6E A;  3HKZ A;  1W93 A;  2GPS A;  4DV7 H;  4K0K H;  4C3I G;  5JJK A;  3RB4 A;  5M9O A;  2JA8 B;  4L5S A;  4YHH L;  3AU7 A;  5IGE A;  2BA0 A;  1JE4 A;  2FLL A;  5LMN L;  3M85 A;  4C2M H;  4XQJ A;  3GD7 A;  4O4H F;  5D1O B;  1EWH A;  2VL6 A;  4AQY L;  5EOY A;  4AYB G;  2VQE H;  5C3E G;  4A3M G;  1WOC A;  5IP9 H;  2D0P A;  4JUZ A;  5M5W H;  4XT3 B;  1E4F T;  1XXG A;  2KHS A;  1O78 A;  1ZQ7 A;  4YQW A;  4A3C G;  3VPD A;  1Q1B A;  5BR8 Q;  3AEV A;  2EJF C;  3S14 B;  3B6Y A;  3NE5 B;  2I5H A;  4X64 H;  3G6Y A;  4GKJ H;  1PRT F;  3I70 A;  2DPJ A;  4LF7 H;  3D31 A;  3QZ7 A;  3CAM A;  3T1H Q;  1EQV A;  4LMQ D;  4NW2 A;  3T5J A;  5G3L D;  1HZA A;  2RSO A;  1B6S A;  4QWA A;  1HNW L;  4G7Z C;  1F9R A;  2HVQ A;  4ZOL F;  5A2Q E;  1I7L A;  3M4I A;  3N41 B;  1DOM A;  3DWQ A;  3JAM c;  4X66 H;  1SCU B;  1LAB A;  1WD1 A;  1J8I A;  4R1J A;  2YW2 A;  2VY3 A;  2BDN A;  1GD7 A;  2R7K A;  2XGQ A;  1D5X C;  5C4J B;  4YCV A;  4JPB W;  4DV5 H;  1D5M C;  3SXH A;  4NLG A;  1R9T H;  3ZJY C;  4ME5 A;  1TS3 A;  1S97 A;  3MXU A;  2DPI A;  4LH7 A;  4BS9 A;  3HZX A;  3J81 c;  2P5Z X;  2HUG A;  2NVY H;  4BA1 I;  2UXB H;  2MCT A;  1EUD B;  5KFY A;  3SK5 A;  2FP4 B;  2GPW A;  5KT7 A;  1UE6 A;  2R3Z A;  1WD0 A;  1B1Z A;  2N3S A;  2F4V L;  2XRS D;  1SYC A;  3F2B A;  4EEQ A;  1UC9 A;  1B3A A;  4AYB A;  3KXY T;  1UEB A;  2PI2 E;  1TWH A;  2BE5 C;  2Z1C A;  1TWG B;  2UUC Q;  1VF5 C;  5E1F A;  1N33 H;  4JI5 H;  1VQ7 A;  5LYJ F;  1XMQ Q;  4IUN A;  2L55 A;  2XSC A;  1EYC A;  2ZXP A;  3S14 H;  1RF2 D;  4K5X A;  2E2J B;  5KFW A;  1XPU A;  2SNM A;  3I2Z A;  5H1S E;  5EKL A;  3HOX H;  3PIO A;  5L1J A;  2C2E A;  4RGO S;  5COR A;  1G51 A;  1K8M A;  1L1O B;  4LF4 H;  1F9S A;  4A3B H;  2FHT A;  2W9C A;  2OT2 A;  3AQQ A;  3HB9 A;  5BN5 A;  4RGM A;  4R9W A;  2JA6 B;  1CQI B;  4DXG A;  2K04 A;  3PUW A;  5IWA L;  3BQ2 A;  2A68 C;  1AEX A;  4P75 A;  3CCJ A;  1M90 C;  1F2L A;  4ALP A;  2Q2I A;  2VQF Q;  1Y69 U;  2D5D A;  5ELF A;  1IYV A;  1HJP A;  3ORQ A;  2IT1 A;  2BQU A;  2NUC A;  3A8J E;  4LK1 C;  2DNE A;  4CJ2 C;  1AUX A;  5KFR A;  4DR3 H;  4R4I A;  2NVX B;  1KRT A;  1IBK Q;  3MXP A;  2RDF A;  4BXX G;  4LFB Q;  2F0S A;  3GTG A;  4A3G H;  3JRW A;  1I6H H;  5CV9 A;  1VQM A;  1EOT A;  4DR1 L;  4FM9 A;  2B2U C;  3EPG A;  1RJQ A;  2R8J A;  4LF5 Q;  4YJ2 F;  3T56 B;  2W6M A;  1XMO Q;  3CCU A;  5I2X A;  3GP7 A;  5DGA A;  4O2A F;  4JV2 A;  4TV9 F;  2OF1 A;  1DM0 B;  3LWE A;  5JPN C;  2IX1 A;  4DGZ A;  3GTL H;  1EUC B;  2XIG A;  3I73 A;  3CVZ A;  2NU7 B;  4CKE A;  1MKH A;  2Y0S B;  1TWG H;  3CD6 A;  2UXC L;  1JDB B;  5C1P A;  4RA8 A;  3H3V H;  1X3E A;  3RZD B;  1KHI A;  2E2J H;  1PTO B;  3UE0 A;  3O13 A;  4FDB A;  4OWX B;  4PDB A;  4A3K G;  4G7O C;  2R7L A;  5A2Q W;  2BR0 A;  2EYJ A;  5D1P A;  1ICW A;  3FDT A;  2B39 A;  2ZTE A;  1Q1E A;  2R93 B;  4JI3 L;  1ICF B;  1OXV A;  3GTJ B;  1TWF A;  3DF7 A;  3EJI A;  1UNN C;  1R4P B;  4IZO A;  4ZQI A;  1I4Q A;  1PFM A;  5JUM A;  1HNX H;  1Y8N B;  1CTM A;  1IL2 A;  1EU4 A;  2WP8 J;  5D3I B;  2X69 A;  2FJ2 A;  2FPI B;  4IHJ F;  2JA8 G;  3OSN A;  2J6S A;  2V58 A;  2KEC A;  2H1E A;  1L0W A;  2K05 A;  2DUD A;  2DY7 A;  4E6I A;  4QIW E;  5C5J A;  4BY1 B;  4ED6 A;  2XC9 A;  1WFQ A;  5KT6 A;  1EIY B;  3BA8 A;  5T1I A;  4IFD I;  4JI7 L;  4PZ8 A;  3MWE A;  3U9O A;  4DV3 L;  2UUA H;  1SLJ A;  2NVX H;  2YCH A;  1B2T A;  1PX2 A;  2RDJ A;  3PUV A;  2J6U A;  3OPO A;  1VQ8 A;  5L1K A;  2E74 C;  3Q8Q B;  2MQH A;  1M0W A;  5BN3 A;  2L1B A;  2RHQ B;  3A54 A;  4RHR A;  3D4W A;  3PUZ A;  3SR1 A;  2W6P A;  2HQL A;  2E2H A;  1ILP A;  4X65 Q;  1VBH A;  3S15 H;  4M1U B;  2K14 A;  4A3L H;  1DGS A;  4HMJ A;  4ID6 A;  2QIL A;  2EXD A;  1PA6 A;  4IAJ A;  1BCP C;  1N36 H;  5KFU A;  2ES2 A;  5C0X J;  3TZD A;  1L2Z A;  4KKU A;  4GC6 A;  5JEA G;  2WYO A;  5KT4 A;  1H9J A;  1JDE A;  1KTK A;  2JA5 H;  1K0S A;  3CXC A;  1PTO H;  4DAY B;  1PH2 A;  2CW0 D;  1SYF A;  1TT2 A;  4GKK H;  3KDF B;  3RB6 A;  3W1B A;  3CQZ H;  5C1O A;  2O4X A;  2R93 H;  5M3M B;  1Z7T A;  1KDC A;  2F0M A;  1FJG L;  3ERO A;  3PUX A;  4JV5 L;  4YWK A;  1GGO A;  2R92 B;  1PZK D;  2FK1 A;  1X54 A;  1GOZ A;  2Z0S A;  2JA7 B;  3Q24 A;  1W96 A;  2R7D A;  1EWI A;  5CV8 A;  2EYO A;  4DV0 L;  4DV1 L;  1QCB D;  3DHQ A;  2K1B A;  3NQI A;  4J9Q A;  1PH8 A;  2VR1 A;  1RTO A;  4A3I G;  2W6Q A;  3OHB A;  2F52 A;  1MI2 A;  2E5L Q;  4BY1 H;  2SOB A;  2XGT A;  2UUB Q;  4A3F H;  1EU3 A;  3PZP A;  4JI2 H;  4OX9 L;  3KUP A;  3PR4 A;  4P72 A;  4JYA L;  2VPQ A;  1PH6 A;  5D1O A;  1HFN A;  3D6W A;  2RGR A;  4OGQ C;  4OIK A;  4MA5 A;  1I50 B;  2A19 A;  4LJZ C;  2AGP A;  2R8K A;  2YZM A;  4O3R A;  2EY2 A;  4XXE A;  1UE5 A;  4C3H G;  1W6J A;  4KHP Q;  3LWB A;  5JH7 F;  3MFY A;  4LSA A;  5JVL A;  1NAP A;  5KFL A;  4YCW A;  1QVG A;  2EVB A;  5HGQ A;  4FYD A;  3OW7 A;  1C3O A;  1QZG A;  1SRU A;  4ZUI A;  4NXM Q;  2Z6K A;  3HBL A;  3JRX A;  4IWX A;  4L6T B;  3MEF A;  1PFN A;  4DUZ Q;  3OHA A;  2K5D A;  2E2D C;  2B2T A;  3L2P A;  1CHP D;  1EL0 A;  1CSP A;  5FO8 B;  2D0O A;  5KFG A;  2JA6 G;  1S0N A;  2WTF A;  3BQ0 A;  1YNX A;  4NB3 A;  1AN8 A;  4RGT A;  2IX0 A;  2JSO A;  4NXN Q;  2KHJ A;  4LMY A;  3BU2 A;  4MV3 A;  5KG5 A;  1TY2 A;  3L9A X;  4DR4 H;  1O80 A;  3K3P A;  4DF7 A;  1HA5 A;  3T53 B;  1B6R A;  5LOV F;  5DM6 3;  3K7A B;  5CV6 A;  1RK5 A;  5EKI A;  5FLM G;  2FMM A;  2J9G A;  1E2W A;  2FLP A;  1MJE A;  2R92 H;  3R5H A;  4UCR A;  2I07 B;  4RKL A;  4IWY A;  1LLR D;  3KF8 B;  4IRD A;  4XX0 B;  1MJC A;  1V1O A;  4DAV A;  3TIG A;  3FRP B;  2JJQ A;  1IBL H;  5FLX c;  3M9N B;  1Z47 A;  4HAE A;  1I3Q A;  2AKW B;  1F9P A;  1UAP A;  1S72 A;  1CHQ D;  4WJ3 M;  4RHS A;  3R5F A;  1B8A A;  2OQ0 A;  1V1P B;  4YR3 A;  2Y0S G;  3A5U A;  1PLF A;  1CFM A;  1G8Z D;  3W2D A;  4ECU A;  2VW9 A;  4QWD A;  4K2L A;  2GVB A;  1LTB D;  2CW7 A;  3I72 A;  2Z6K C;  3IFD A;  1LT5 D;  1H9S B;  4HR7 B;  2B2T C;  1E3P A;  1PTO F;  2K5W A;  4XZ3 B;  4DLK A;  1K83 A;  1XNQ Q;  5ELD A;  2W57 A;  4J9N A;  1YHB A;  3UDX A;  4A93 B;  1NUC A;  1A15 A;  1BOS A;  1DV1 A;  1YNJ D;  1BVS A;  4I7A A;  1STA A;  4DV7 L;  4K0K L;  1MSG A;  5FK9 C;  1TVX A;  5HV6 A;  2JA6 A;  4B3T Q;  5KFO A;  2QF7 A;  2Z4I A;  4DNI A;  5EBD A;  1B44 D;  2VQE L;  4Q8E A;  3GTP A;  4ME6 A;  4RGN A;  1EZ6 A;  3K7A H;  3QFF A;  4HNV A;  1X3Q A;  4B3R Q;  1VMP A;  5DG7 A;  2F0K A;  3J80 E;  5AFW A;  2QA4 A;  2CW8 A;  5IYD H;  3C2P A;  4DPG A;  2L5T A;  3U50 C;  2UU9 Q;  4R8U A;  1N34 H;  4APM A;  1JMC A;  4BY7 B;  3K6O A;  4X64 L;  3WO1 A;  3GIK A;  4GKJ L;  4LF7 L;  3RB3 A;  3JZI A;  4ODG A;  5JAV A;  2K28 A;  1J5E Q;  4B3M Q;  4DUY H;  2AQ4 A;  3VYU A;  3GTM B;  4PV1 C;  3SI8 A;  3T5L A;  3F2D A;  3Q8P B;  3R2T A;  4LH6 A;  3NXW A;  1DOK A;  2A68 D;  4MV6 A;  5C0X G;  3J7A V;  1WTQ A;  4J9R A;  3I4M B;  2IPK D;  4GNX A;  3CPF A;  3RN2 A;  1RJP A;  3PSI A;  2Y0S A;  1SNQ A;  4NKL A;  2KVM A;  1XNR Q;  4X66 L;  4RG1 A;  4JBM A;  3NP8 A;  2BCO A;  1G6Z A;  4H0L C;  1UWV A;  3MAQ A;  2ASB A;  5EQ0 A;  2NZ1 D;  2NVQ B;  4UFZ A;  5M3M G;  3G71 A;  4DV5 L;  5LP6 F;  3CCM A;  4I7Z C;  4A93 H;  4QCL A;  3QO2 A;  3L4J A;  1PZJ D;  4QIW B;  3GTJ A;  2DIK A;  4TSS A;  2GA4 B;  2HCI A;  4C3I B;  1HTL D;  1JQY D;  4QMG A;  5K36 H;  3BAB A;  1GM5 A;  3OOC A;  1G91 A;  4UCT A;  1VAJ A;  5C44 H;  2UXB L;  1MD2 D;  5CR3 A;  1JXL A;  4FBU A;  1WTV A;  1WCM B;  5FLX E;  4UAI A;  2AMC B;  1Q90 A;  2MHV A;  1U5K A;  3P20 A;  1PK8 A;  1TWH B;  4DV3 H;  2K5Q A;  2I80 A;  1EY9 A;  3HKS A;  5EBC A;  4CBV A;  4BWS C;  3KYH C;  3EPI A;  4A3D H;  1CSQ A;  4FVM A;  1N33 L;  1VQE A;  2XWB B;  3I8Z A;  3A8K E;  4JI5 L;  3BVG A;  1QWY A;  3ULP A;  3RV3 A;  5JQW A;  4MTD A;  4ED1 A;  4DV4 Q;  2LS0 1;  3UFX B;  4FS2 A;  4DA2 A;  4EQ5 A;  1WTH A;  3CME A;  4BY7 H;  4Y8V B;  4IN3 A;  4ZKC B;  1CQF A;  4MIU A;  5NUC A;  4C1N I;  4HJ9 A;  4CKC A;  3OIQ A;  1AZQ A;  4YAK B;  4LF4 L;  2CHB D;  1EUJ A;  1C7Y A;  1HUM A;  4DV2 Q;  4GNX C;  4HMI A;  4CGY B;  1YJW A;  5BMV F;  4OO1 I;  2KCN A;  2KA7 A;  2NTT A;  3CC7 A;  3I4M H;  4IJL A;  2IWH A;  4JBJ A;  3CCE A;  1F2M A;  1T5E A;  1MSH A;  3KF6 B;  2A1A A;  3S1N B;  2ASJ A;  4DAY A;  3GTG B;  1PH1 A;  3A56 A;  3F2U A;  2K7V A;  3KDF A;  4DR3 L;  2FIN B;  3D4R A;  1O7L A;  3E5S A;  3GTO A;  4IPC A;  3S1M B;  1JC7 A;  4JI8 H;  1JOO A;  2LXJ A;  2R7N A;  4BA2 I;  3A7A B;  3OMC A;  4C3I H;  3S1Q H;  1EY7 A;  4YY3 Q;  2MFI A;  1Z6H A;  3G4S A;  2PO4 A;  4IFD J;  4LF6 H;  1VQP A;  3J80 W;  1SE2 A;  4IZ8 A;  1SE4 A;  3S24 A;  5KFE A;  1BCP D;  3VPC A;  5KKN B;  4DR6 H;  1SYG A;  1EY8 A;  3F1Z A;  5C3E H;  4A3M H;  1BCP B;  1L0X B;  1TWH H;  1VBG A;  2RDI A;  4RWS C;  4FXG C;  2F3W A;  3TS0 A;  2NN6 G;  4MNO A;  3E3X A;  1SN8 A;  1E24 A;  4A3C H;  1DZ1 A;  3OIP A;  2FFK B;  5L1L A;  1HNZ Q;  5DGB A;  1N36 Q;  4JI4 Q;  3R5X A;  1I50 A;  5KFX A;  4L5R C;  3MXN A;  3KHL A;  1GHJ A;  1W2B A;  5DAU A;  4UY8 C;  5KRU A;  2JK8 A;  5LXT F;  4KD3 A;  3LGJ A;  5KFV A;  4EQO A;  3W1G A;  1RYS A;  1C4Q A;  2WAQ G;  3MR6 A;  1B53 A;  1EFW A;  3S16 H;  1TAE A;  1SNP A;  3S2H H;  2FMC A;  1UUP A;  4LAA A;  4APV A;  4CDC C;  1XPO A;  3NQT A;  1HNX L;  4DR2 H;  4FS1 A;  2UVR A;  2AGO A;  5EGT A;  1QNU A;  3TP7 A;  3I3C A;  3TIN A;  4TQR A;  2IMW P;  2HHH Q;  1VQD A;  5KNC A;  1A2U A;  1O7Y A;  2PZU A;  5KG1 A;  2PMZ A;  3KHR A;  1EQT A;  4BBS B;  1E4E B;  4F87 A;  1SND A;  4MTN A;  5DNF A;  4YHH Q;  4ECR A;  1F77 A;  2SCU B;  2CW0 C;  4K5V A;  4X3U A;  4K6L A;  5F2D A;  3GTG H;  5LMN Q;  2RA4 A;  4A4I A;  3RB0 A;  2UUA L;  4WFN 3;  3TP8 A;  5JPM C;  1BBX C;  2EY1 A;  4AQY Q;  3DWA A;  4IUP A;  4L63 B;  4O4L F;  3R2I A;  4X3S A;  4A2B A;  1QUQ B;  4P71 A;  3DM1 A;  5HUR A;  4JW0 A;  3KOJ A;  3K8A A;  3LNN A;  3C3L A;  2C9O A;  2DLN A;  4FO2 A;  3RFC A;  3KBX A;  4H13 C;  3QIA A;  3KF8 A;  1DOL A;  1LTS D;  2L11 A;  4IAL A;  2NU9 B;  1QVC A;  4KJN A;  4MZ9 A;  4JI6 H;  1I94 L;  1ILQ A;  4KHZ A;  1CM9 A;  2PBZ A;  4TUY F;  1RK6 A;  1GVP A;  3BDC A;  3RLO A;  3KK7 A;  1WYD A;  2L12 A;  4EQN A;  3R8B A;  4HNU A;  2MNA A;  1HNW Q;  2UVU A;  2EY5 A;  4UPA A;  1D5Z C;  1S5C D;  3KBG A;  3JSL A;  4DV6 H;  2CQY A;  4OON A;  1V1P A;  4RB0 A;  4FF4 A;  3LP8 A;  3ORR A;  2CKZ B;  2EYL A;  2QCP X;  3HOV B;  1VKZ A;  1TWF H;  1A8V A;  1V51 A;  3HG9 A;  4K8J A;  4GKK L;  3RZO B;  4HR7 A;  4Q45 A;  2WAC A;  1VQI A;  1C48 A;  1I6V C;  1KIX A;  1VQF A;  1N9W A;  2G9H D;  1FD7 D;  4Z9C B;  2WAQ A;  2C2R A;  4JI1 Q;  4POG A;  1UE7 A;  4GS3 A;  1G2S A;  1KD1 C;  2ICE C;  1SFO B;  5IE8 A;  1LO5 D;  4F4X A;  4KN4 C;  5HBR B;  2V1C C;  3NWT A;  3N8D A;  1S40 A;  5IGB A;  2BH8 A;  1WCM G;  1KAW A;  2F0T A;  2YTX A;  4YWM A;  3A8I E;  2HIX A;  4JI2 L;  5M5Y B;  1Z2N X;  5KGU A;  4UCV A;  3PO2 B;  3FKI G;  4PMC A;  1Y1W G;  4BXX H;  2YU9 A;  1KJ8 A;  4HID A;  2F4V Q;  2XD4 A;  1VQ5 A;  4MA0 A;  2HIV A;  3PVX A;  5I4D A;  5IOD A;  4IOC A;  3M9B A;  2E2H H;  5KG7 A;  1KLU D;  4UP7 A;  3DEO A;  1JLL B;  2W8L A;  1PYS B;  4KHV A;  4EGQ A;  3PW5 A;  2MGS A;  5HY6 A;  1EY6 A;  1KLG D;  1SE3 A;  1PH3 A;  2PQA A;  3C1F A;  1I6U A;  4DR5 H;  1X6O A;  2L4N A;  2QKI C;  3BZD B;  3SK6 A;  5JEA J;  3GTM A;  1LYL A;  2NYZ D;  4EX5 A;  1TS2 A;  3P1H A;  4B08 A;  1EY5 A;  1N56 A;  1GYF A;  1DD2 A;  3KAJ A;  1KJ9 A;  3H0G B;  4RKB A;  3M4P A;  4QWE A;  4LF9 H;  2C2D A;  1ZHQ A;  2A69 D;  2YYZ A;  3MEH A;  4A3J G;  5IWA Q;  4A3K H;  4DR4 L;  1S0M A;  2L0C A;  3JAM i;  2K33 A;  1RJR A;  2PMZ E;  5BN4 A;  2N78 A;  2FK2 A;  3TEH B;  2I0Q A;  3K0Y A;  1HR0 H;  3RZO H;  4OL7 A;  3G7L A;  1VQ9 A;  2MO1 A;  4DU9 A;  4QIW A;  3A7L A;  1YNJ C;  1CQV A;  1Y1V G;  2UVW A;  3J7A K;  4RCO A;  2JA8 H;  4ED0 A;  3HOU B;  3PMF A;  2Q8T A;  2B2U A;  2F0D A;  4A3I B;  4DR1 Q;  3K7U C;  1XTD A;  1I3Q B;  3J81 i;  4IFD G;  2VNU D;  1IBL L;  3KTM A;  4QW9 A;  1STE A;  4V0B A;  4WOR A;  3RUP A;  2W8K A;  4DK3 C;  2WFW A;  1WCM A;  2C5C A;  1ONL A;  4DK0 A;  1E1T A;  3I56 A;  1EY0 A;  3MHB A;  3UDF A;  3CCV A;  1YIT A;  1VQL A;  4S3S A;  1BR9 A;  1E2Z A;  5D65 A;  3FKI A;  1VQJ A;  1Y1W A;  1HH2 P;  2I5M X;  1BCP F;  4C3H B;  2QDB A;  1SMX A;  5LMN W;  2C00 A;  1D1I A;  2UXC Q;  2F0J A;  2K01 A;  1K83 B;  3RIZ A;  1NJI C;  2BH2 A;  2I5L X;  5D14 A;  1GJX A;  2V5A A;  2AWN A;  1EZ8 A;  5IT9 L;  1NNX A;  1QJO A;  3NEN A;  4JI3 Q;  3MFG A;  4IPH A;  4QWC A;  4FF3 A;  1AW7 A;  4J9P A;  5JEA H;  4C1N K;  3VDY A;  1M0T A;  2GLT A;  4LFC H;  1RD9 D;  2WAQ E;  3STB C;  5ELN A;  3J7A 5;  3OW2 A;  4XYL B;  1HXY D;  1A2T A;  3GTP B;  3OUU A;  4KJO A;  3OWE B;  4DAM A;  4BBS G;  1JE5 A;  4IUT A;  3SDZ A;  4OWT B;  5IYC G;  4E4T A;  1NSN S;  4K14 A;  1XYI A;  4LF8 H;  5C4J H;  2VS1 A;  1JOK A;  2NBF A;  5C4X B;  1HRJ A;  1CS0 A;  1VQO A;  1RTN A;  3KF6 A;  3ULJ A;  1PV4 A;  3IN5 A;  2R6G A;  1AN7 A;  4JI7 Q;  2PPB C;  4R8U B;  1V4Y A;  4V19 0;  1BQQ T;  5KFI A;  1IOV A;  1GSH A;  1Q3L A;  5FPO A;  3OUZ A;  5E3F A;  1LAC A;  1N34 L;  3K80 C;  1X55 A;  3FVQ A;  1SR3 A;  1JKJ B;  2EIF A;  1Y1V A;  1RHP A;  5M5X B;  4A3I H;  4L8J A;  4X62 H;  2NUA B;  3EBE A;  1I3Q H;  3UE1 A;  1STB A;  1Q86 C;  2MPM A;  5JVD F;  4DUY L;  1OXU A;  5KFF A;  1D6E C;  2BDO A;  3KLW A;  1VQC A;  1VS0 A;  5IY0 A;  5KT5 A;  2B2W A;  4G4K A;  4JK1 C;  3G6V A;  1C30 A;  4GNX B;  4QL5 A;  3TII A;  1SAP A;  1K9M C;  1DV2 A;  1TQO A;  3RAQ A;  4IPD A;  4YWL A;  3HOW B;  3IG0 A;  1S4Z A;  4C3H H;  3T5K A;  4DL2 A;  2R61 A;  1JCK B;  1VQB A;  2Z8L A;  3CC2 A;  5GRO A;  3HOV G;  1TWC A;  5KYL A;  1U9R A;  5CC4 A;  3RBE A;  1K83 H;  4JBW A;  2ZT9 C;  3X3N A;  2A5H A;  4RNM A;  3GID A;  3TRE A;  3TDQ A;  2FK3 A;  1JR0 D;  1SYE A;  3T1Y H;  2JA6 H;  2VZA A;  1FJG Q;  3U9S A;  4B9X A;  4JV5 Q;  2QEX A;  4KY7 A;  4UHV A;  3CCR A;  3GTP H;  3HGB A;  1K73 C;  2F4I A;  4KKS A;  2XCA A;  5IGD A;  3G6X A;  4DV1 Q;  4DV0 Q;  1CUK A;  1GKH A;  1I4H A;  1ZEQ X;  3RUZ A;  5DG8 A;  2PZT A;  4HJ7 A;  1AH9 A;  1E4E A;  4JI0 H;  2FPG B;  4WJW A;  2KEN A;  5LL6 b;  3PO2 G;  4FP5 D;  1FGU A;  5FLM H;  1HHV A;  1ZYR D;  5KNB A;  4OX9 Q;  4J9K A;  1YNN C;  5KEE A;  4JYA Q;  4IO9 A;  1QNK A;  4PQX A;  2JYO A;  1JWU D;  1BBU A;  1EFI D;  1QUQ A;  2ID0 A;  5I9O A;  3M4Q A;  1HTP A;  1OXT A;  2EE1 A;  4QQB X;  1M8A A;  5M5X H;  5JVG 3;  1AE2 A;  5KYI A;  2B2W C;  5LMU H;  3L0O A;  3FP9 A;  3OTO H;  1I94 H;  3MZ5 A;  3KHH A;  1BUV T;  5KFP A;  3QOJ A;  4JOI A;  1ESF A;  2FE3 A;  1V9P A;  3JAM L;  4ZI7 F;  1VCI A;  1S5D D;  2OEO A;  4ECY A;  3CP0 A;  3F8T A;  2VB2 X;  3KJP A;  2UXD H;  1OO9 B;  4WRD A;  1N32 Q;  4B3S H;  4FBT A;  3S17 B;  5G3L F;  3GTK B;  1VF7 A;  5DQI A;  3H0G G;  3RZD H;  3P75 A;  1Q82 C;  2ICI A;  2JQO A;  3QWN A;  2XCL A;  2ASD A;  2KJX A;  2O2L D;  4YBZ B;  4X6A H;  1K1S A;  3LWU A;  3GTO B;  3UQ8 A;  3GTJ H;  2VUM G;  4JC0 A;  3HOY G;  3J81 L;  1LM0 A;  1SRO A;  4FU0 A;  2NZO A;  1A3V A;  3CRK C;  5JJZ A;  4JI8 L;  3D8G A;  1S5F D;  4LFA H;  2JEB I;  5KG4 A;  2K5V A;  2EZV A;  2B63 B;  4XQQ A;  1IBM H;  1NTG A;  1YIJ A;  3N6R A;  4IR1 A;  2VUG A;  3SHL A;  3HOU G;  2LXK A;  4CC5 A;  1SFO A;  4F4Z A;  1B70 B;  4LF6 L;  5C3W A;  3BVM A;  2JN4 A;  4Q8F A;  2JEJ A;  1A3U A;  4DR6 L;  1FGB D;  1EYG A;  3MTS A;  5J2T F;  4ABN A;  3MR3 A;  3R23 A;  2A74 C;  5T1G A;  3J80 c;  2F0G A;  1R9T A;  3NUC A;  1QIL A;  4DR7 H;  5IGF A;  3MXN B;  4NPS A;  4O1N A;  1A63 A;  1B3Q A;  4O42 A;  3PIP 3;  1Y14 B;  3K59 A;  1FYC A;  4DL6 A;  1NMF A;  1O7I A;  3MR2 A;  2HD3 A;  3E9H A;  5EPK A;  1VQ6 A;  5J22 A;  4ECX A;  1CI3 M;  1U0L A;  4JOI C;  4LUV A;  3RLF A;  1I5F A;  4Y7N B;  4MTE A;  2F0V A;  5T14 A;  3OSP A;  3D4D A;  2ATW A;  3S2D B;  3OSO A;  1J9O A;  4HSV A;  1IYJ B;  3ER0 A;  4DR2 L;  1RDP D;  5C0X H;  3MFH A;  5EAY A;  2PMZ B;  3WNZ A;  2F0E A;  1MZB A;  4ETS A;  5IIF A;  1CE8 A;  3GDE A;  2KCM A;  4C5A A;  2HVS A;  4DV7 Q;  4K0K Q;  4A3E B;  1YHQ A;  1SMY D;  1OTC A;  3H0G A;  2ASL A;  3W3A A;  5IYB G;  1K1Q A;  3RNU A;  1PH4 A;  3GTO H;  3M3Y B;  5C4X G;  4M9U A;  3BDL A;  5M3M H;  1WTX A;  3PF4 A;  4RB3 C;  1EEF D;  3SK8 A;  2ZM6 H;  4OEL B;  3WWV A;  2VQE Q;  2VUM A;  2K6A A;  3J7A F;  1EYD A;  3HRZ C;  1S5B D;  3KLS A;  1SDF A;  4CJ1 B;  2JA7 H;  2F0Q A;  1WR2 A;  3KLR A;  1XTC D;  2F0F A;  1TA8 A;  1E1O A;  1PVO A;  4UCS A;  4WJ4 A;  1U4P A;  5FO9 B;  2N88 A;  4ZHQ F;  1UNS A;  2RVL A;  4X64 Q;  4JI6 L;  4GKJ Q;  5FOB B;  3P7J A;  4LF7 Q;  1IZ6 A;  2JA9 A;  2I8C A;  3TQ1 A;  5FKA C;  3GO5 A;  3C0F B;  1BNC A;  4DAP A;  3Q8D A;  1I50 H;  2PQE A;  3CW2 C;  3FHW A;  4QGU A;  3S9W A;  4BBR B;  2ZJR A;  3HOW G;  3PW0 A;  4DV6 L;  3FMA A;  1FR3 A;  3NBH B;  5KFZ A;  1GUG A;  1D2B A;  5IGG A;  2YV5 A;  4IOA A;  3MC0 B;  2WAQ B;  4X66 Q;  3PN1 A;  3ERQ A;  3CC4 A;  3S2D H;  5BR8 H;  3GII A;  4TV8 F;  3ND8 A;  1B9N A;  4DV5 Q;  1KDB A;  4OO1 G;  1Q7Y C;  1M7J A;  3T1H H;  2P0A A;  3VYT A;  2UVV A;  3ETH A;  1YBY A;  3TME A;  4O2D A;  2KBN A;  4DUZ L;  3IRB A;  3WOE A;  3Q0A A;  3BS1 A;  2A69 C;  3AYH B;  1TXY A;  4EEY A;  4DN4 M;  1TWA A;  2YU9 B;  2UXB Q;  3K57 A;  1S03 G;  1T5X D;  4P2C B;  3M3Y H;  2C35 B;  2EDG A;  3K58 A;  4KK7 A;  1Q12 A;  4Q43 A;  3UDI A;  1SSO A;  1N8R C;  3MWD A;  2YL2 A;  3L3O C;  4O2B F;  3RV4 A;  3DEP A;  3MXG A;  2M05 A;  5ISR A;  1N33 Q;  2YRX A;  5EWG A;  4TQU S;  4JI5 Q;  2PQA B;  4YB8 B;  1JWM D;  3HOZ B;  1YJ9 A;  2CFM A;  4FXD A;  3U4Z A;  4DR5 L;  3D3R A;  1KJQ A;  1TY0 A;  1WVL A;  4EYI B;  3BDO A;  2NN6 H;  1I4R A;  1FNU A;  5GAG C;  1FL0 A;  3STB D;  1EYZ A;  5JJL A;  3MR5 A;  4LF4 Q;  3H3V I;  2OLS A;  3TN2 A;  3I7F A;  4R4C A;  1YHA A;  4KY5 A;  4LF9 L;  5EWF A;  3AFP A;  5IP7 G;  2N49 A;  2HDL A;  2YZN A;  1H9M A;  1I4P A;  2HJW A;  1K3B C;  3J7Z C;  5CAE B;  5FD6 A;  3BAA A;  2UUC H;  1D7Q A;  3M7N A;  4LWC A;  2WE6 A;  1V43 A;  1HR0 L;  1SEI A;  5A35 A;  1XMQ H;  1IW7 D;  1ZET A;  2ALY B;  1TR5 A;  2D2C C;  2KED A;  3EFX D;  4DR3 Q;  2B63 G;  3S1R B;  4R7R A;  1XX8 A;  2QK4 A;  1WI5 A;  5L1I A;  3Q8R B;  2F0O A;  4XT1 B;  5TSS A;  1PHJ A;  4DL5 A;  1JX4 A;  3NEL A;  2HCC A;  5IOC A;  4A75 A;  2NWG A;  1EIG A;  1RJT A;  3N52 A;  1BGW A;  4PMB A;  2KEE A;  3K81 C;  1LT3 D;  2YU9 H;  3UDG A;  5JOB A;  1EOV A;  2K32 A;  3FKI B;  1SJH D;  1Z2P X;  3T5H A;  1Y1W B;  1K0R A;  1QVF A;  1PDQ A;  4J1M A;  5EPJ A;  4O3N A;  1IYU A;  3BYT B;  1Z2O X;  1NR4 A;  2VXW A;  4XTC S;  2E2I B;  2VQF H;  2ZDQ A;  2IA6 A;  1T9H A;  2QEJ C;  4OWW B;  2F0W A;  5BPH A;  3KAK A;  1VQK A;  1IBK H;  4LFB H;  4EGV A;  4N9P A;  3EVQ A;  5EZY F;  3PUY A;  4BWG B;  4C3J G;  1Z9F A;  2NTS A;  3GTM H;  1U4M A;  1XPR A;  3PO3 G;  2DNC A;  2JE6 I;  1PRT D;  1S68 A;  1JIH A;  4LF5 H;  1DCZ A;  4FF2 A;  1K8G A;  2XWJ B;  1CA6 A;  1A6X A;  2FPP B;  3GIL A;  1XMO H;  1PRT B;  3RLN A;  3RJ0 A;  2OWO A;  1GLV A;  5DLQ E;  4LFC L;  2AUJ D;  2KSW A;  3TP5 A;  1HNX Q;  3IL8 A;  4A3E G;  3GTK A;  4A3J B;  2O5I C;  3KAL A;  2TMP A;  3SE7 A;  2KUM A;  5KFS A;  4KY6 A;  2B8G A;  2IJ0 A;  2F0L A;  2YTY A;  4LF8 L;  2NVQ H;  4O3Q A;  4RAZ A;  2XIW A;  5KFQ A;  1F2Y A;  1YNN D;  2MJ8 A;  2E8G A;  2IP4 A;  4G7H C;  1GUO A;  1OXX K;  1BXT A;  2R8G A;  1I7N A;  3BG3 A;  4M7E A;  1Y1V B;  2UUA Q;  2HDM A;  2RHS B;  1HPC A;  4PNY A;  2B63 A;  2JXM B;  5J3B A;  1EQQ A;  2WKC A;  2YRW A;  1RCV D;  4X62 L;  1WCM H;  3URY A;  4RB2 C;  4AH6 A;  2F0P A;  4CDD C;  3BQ1 A;  3IKJ A;  2HVR A;  1GUT A;  4WD3 A;  1LT4 D;  1KBL A;  1HR0 W;  5KFC A;  3RD4 A;  4RU9 A;  2VA3 A;  1VQH A;  2K5H A;  3EQL C;  2W9B B;  1ASY A;  2ZJQ A;  2IBK A;  3FKI H;  1Y1W H;  4JCV E;  4KD4 A;  1X3G A;  2OCE A;  2NU6 B;  1HZ9 A;  2WKD A;  4BBR G;  1ZYR C;  4ZKB B;  1GHK A;  1TWC B;  4F4Y A;  1ENF A;  5AJ3 L;  1C9O A;  4GN5 A;  4QJF A;  1ML0 D;  1M1K C;  5M3F B;  1GUN A;  4DXF A;  3VPB A;  2W7O A;  1M4V A;  1VQN A;  5GQO A;  1IL8 A;  1FNW A;  1DIK A;  4J9S A;  5I2Y A;  4GKK Q;  3BVZ A;  4RNO A;  2CH4 W;  1JB3 A;  1HFG A;  1SNC A;  5I9P A;  4GN4 B;  1B50 A;  3Q8S B;  4C5B A;  3T1Y L;  5EDW A;  1XWE A;  2J7Z A;  1E7Z A;  3V96 A;  5C0X I;  1G2T A;  1T94 A;  4X65 H;  1E22 A;  3KLS X;  2R85 A;  1BDO A;  2CQO A;  1CKM A;  2Q8R E;  4QY7 A;  4CKB A;  5I47 A;  4A3J H;  2WIN B;  1YI2 A;  5CB4 F;  3S1N H;  4DV2 L;  3RAX A;  1VQG A;  3OMG A;  3PIP A;  4JI0 L;  3S1M H;  1EIF A;  1X9N A;  4JI2 Q;  2DZD A;  2QYZ A;  2KQ3 A;  4MN3 A;  1Y1V H;  4H7B A;  1K8A C;  4EVO A;  2IHF A;  2V4Q A;  3ZYY X;  3UI2 A;  2PVP A;  4EBD A;  4WBN F;  1UC8 A;  3E9I A;  1RIP A;  2HT1 A;  4C2M B;  2R87 A;  1VQ4 A;  2GN5 A;  3GV3 A;  4IFD H;  3MA2 B;  3HOZ G;  5LMU L;  2WB1 A;  1U4R A;  4ED7 A;  3OTO L;  3I90 A;  4IJH A;  4ZRZ A;  5FJ8 G;  3JSN A;  4R8N A;  2FJZ A;  2UXD L;  2ZTD A;  3ETJ A;  2IX3 A;  2W70 A;  4YR2 A;  1S10 A;  1QE6 A;  4B3S L;  2X0S A;  1HQR D;  3CU7 A;  5ELE A;  1CQJ B;  2E5L H;  1X3P A;  4G3I A;  4QF4 A;  1TWC H;  2UUB H;  1V8Q A;  3Q1K A;  1L0Y B;  4CHT B;  1LV9 A;  2DJF C;  4P74 A;  3AB9 A;  4R4T A;  3KFU A;  3GIP A;  3GIM A;  3NBH A;  4KI0 A;  5DQG A;  1SJE D;  1QOH A;  4GLX A;  4XIG S;  4J15 A;  4DR4 Q;  2R8I A;  2HQE A;  4FNF A;  4KHP H;  3R3O A;  1SNO A;  4LFA L;  4CJ0 B;  4TQS A;  1MGS A;  2R86 A;  1UEA B;  3OYY A;  3K5L A;  1KAA A;  2NZH A;  3I4N G;  1IBM L;  4ZLT F;  1AZP A;  2EJG C;  4NXM H;  1I4G A;  3K5M A;  3K5I A;  4YAJ B;  1B7Y B;  4DUZ H;  5J39 A;  4BBS H;  5IYC H;  5L9X A;  1SMY C;  2RDG A;  1DYQ A;  2NVT B;  1R9T B;  2EYM A;  4N8F A;  2CQA A;  3RR5 A;  1IBL Q;  2O03 A;  3V4Z A;  3H94 A;  2JEA I;  5KFD A;  4NXN H;  3NK9 A;  2ATL A;  4DR7 L;  1XJV A;  3RMH A;  3M9O B;  2NVY B;  4J8Q A;  3H09 A;  3FPP A;  5C4H A;  3LML A;  3N40 P;  3G8C A;  1PYB A;  2F3V A;  2FB9 A;  2JP1 A;  3FPU B;  4R8I A;  1SYD A;  4X3T A;  2FXQ A;  2PW7 A;  3AFQ A;  2EY6 A;  3GQB A;  3VR2 A;  3BZK A;  1QZH A;  4MV8 A;  1E2V A;  1ET9 A;  2DWC A;  1S3O A;  1WTR A;  2XCP A;  1JJC B;  1W3S A;  1NBW A;  2WV6 D;  4F50 A;  2L15 A;  3K5N A;  2JEG A;  4KLK A;  2NN6 I;  1STY A;  4HNT A;  4UCU A;  4ECQ A;  2K03 A;  5DQH A;  1OWT A;  2IL8 A;  5I6Y A;  3HOX B;  2YYA A;  4PG3 A;  3HOV H;  4DNT B;  3T51 B;  1YEZ A;  1CZW A;  2DN8 A;  1CT1 D;  3HOY B;  2VUM B;  1HZB A;  1ZKO A;  2R7Z G;  3Q22 A;  3SGI A;  1S5E D;  1YVC A;  2Q8I B;  2EOT A;  4A3B B;  1JJG A;  2ZM6 L;  4HJ5 A;  4F4W A;  2AHO B;  4JVZ A;  1SYB A;  1B33 N;  1EZ1 A;  2BQR A;  2EYP A;  2V4D A;  1SFO H;  1WTO A;  4Q0F A;  1L2F A;  5IT9 E;  1K3R A;  1CKN A;  5LL6 S;  2AQ2 B;  5DG9 A;  1XNQ H;  4MHE A;  1N34 Q;  2F1M A;  4U68 A;  4J0M A;  1X65 A;  4JI1 L;  5C5M A;  2NVT H;  1DJR D;  5M5Y H;  5FO7 B;  3PO2 H;  4RCN A;  2WB1 E;  3U4V A;  4A3G B;  1I6H B;  4DUY Q;  4FF1 A;  4B3T H;  4DK1 A;  1KXL A;  3H20 A;  4RZQ A;  2PW5 A;  2VB3 X;  1EWC A;  3L7Z C;  2A73 B;  2BOS A;  4TVA B;  2VA2 A;  2E2I A;  2Z4H A;  5GAH C;  4B3R H;  4O3O A;  4KV6 A;  5A2Q L;  5M3F G;  2R7M A;  1E4G T;  1VDZ A;  4UP9 A;  3V05 A;  1SNM A;  3NSW A;  4Q5V A;  2A6E D;  3CHB D;  5BR8 L;  3GTL B;  2UU9 H;  5IGC A;  3EYY A;  2TSS A;  3BJY A;  5IYZ F;  3MJF A;  2RKS A;  1JWS D;  3QR8 A;  3T1H L;  4A2A A;  2E76 C;  4XYO A;  4PMW A;  2X6L A;  1C0A A;  1IKM A;  1J5E H;  3H0G H;  4B3M H;  1YZ6 A;  1E0B A;  3H4D A;  1X56 A;  1TWA B;  4EFE A;  2J0T D;  2CWP A;  3PW7 A;  3I4O A;  2V59 A;  2PYK A;  1W6K A;  2VUM H;  1V1Q A;  3HOY H;  2W71 A;  2J6T A;  2HGS A;  1II3 A;  3NTK A;  3TQY A;  2R7Z A;  4ED8 A;  1G29 1;  4HCS A;  1TII D;  1LTI D;  3GV6 A;  1IW7 C;  3A0J A;  2LY7 A;  1STH A;  3TBI B;  1XNR H;  4DV3 Q; 
#chains in the Genus database with same CATH homology
 3HKZ E;  2PI2 A;  2ATW A;  1GM5 A;  3HOU H;  1HNZ L;  5C44 H;  4POF A;  1N36 L;  4JI4 L;  3GTQ H;  2UXB L;  2GVA A;  2K50 A;  3DLL A;  1IYJ B;  3ER0 A;  4DR2 L;  4GOP C;  2AMC B;  5EAY A;  1U5K A;  2ZM6 Q;  5IP9 G;  4L5T A;  2LSS A;  3DM3 A;  3I4M G;  3GDE A;  2KCM A;  4DV7 Q;  4K0K Q;  3I55 A;  4HJ8 A;  3HKS A;  1YHQ A;  3KYH C;  4DK6 C;  1OTC A;  2Q2U A;  4A3D H;  1CSQ A;  3PCO B;  5IYB G;  1N33 L;  1VQE A;  3RNU A;  1BBW A;  2IHE A;  1PH4 A;  4L5Q A;  4JI5 L;  3ULP A;  1ASZ A;  3GTO H;  5C4X G;  4DV4 Q;  5M3M H;  3PF4 A;  4EQ5 A;  4BY7 H;  3WWV A;  3CME A;  2HHH L;  3G6E A;  2VQE Q;  1PH9 A;  4LUO A;  2N8N A;  3CF5 A;  5JJK A;  2JA7 H;  2UUC L;  4L5S A;  4YHH L;  4HJ9 A;  2BA0 A;  4LF4 L;  3K0X A;  1XMQ L;  1E1O A;  1EUJ A;  1C7Y A;  1PVO A;  5LMN L;  4DV2 Q;  3M85 A;  4C2M H;  4GNX C;  3NEM A;  4WJ4 A;  3GD7 A;  4AQY L;  2VL6 A;  1YJW A;  3RN5 A;  4AYB G;  4X64 Q;  4JI6 L;  4OO1 I;  1Q81 C;  5C3E G;  4A3M G;  1WOC A;  3CC7 A;  4GKJ Q;  4LF7 Q;  4JI8 Q;  1IZ6 A;  2D0P A;  2JA9 A;  5IP9 H;  4IJL A;  3I4M H;  2KCT A;  3GO5 A;  5M5W H;  2MO0 A;  4JBJ A;  3CCE A;  2ZJP A;  3CCS A;  1SE8 A;  3Q8D A;  1TWA H;  1I50 H;  3CW2 C;  3FHW A;  4A3C G;  3KF6 B;  4QGU A;  2A1A A;  5IYB H;  2ZJR A;  1Q1B A;  5BR8 Q;  3AEV A;  1PH1 A;  3HOW G;  4DV6 L;  5C4X H;  4LF6 Q;  2F3I A;  3B6Y A;  3KDF A;  2I5H A;  4DR3 L;  4LNQ A;  3F2C A;  3NBH B;  4IPC A;  3D31 A;  3CAM A;  4DR6 Q;  3T1H Q;  2LXJ A;  4BA2 I;  2YV5 A;  3S1Q H;  1HZA A;  4C3I H;  2VQF L;  4IOA A;  4YY3 Q;  2MFI A;  1HNW L;  4X66 Q;  3G4S A;  3CC4 A;  3S2D H;  4IFD J;  1VQP A;  3S24 A;  1IBK L;  4LFB L;  4DV5 Q;  4OO1 G;  1Q7Y C;  4RMF A;  3F1Z A;  5C3E H;  4A3M H;  3JAM c;  1TWH H;  1YBY A;  4O2D A;  3TS0 A;  4LF5 L;  2NN6 G;  2KBN A;  4MNO A;  4DUZ L;  3IRB A;  4R1J A;  1GO3 E;  1E24 A;  1SN8 A;  2VY3 A;  1XMO L;  1GD7 A;  3AYH B;  4A3C H;  1TXY A;  4AYB E;  1HNZ Q;  4LUV A;  4YCV A;  1N36 Q;  4JI4 Q;  3HOW H;  2UXB Q;  3M3Y H;  1R9T H;  2C35 B;  3ZJY C;  4GLV B;  1Q12 A;  4L5R C;  3UDI A;  4DR2 Q;  3HOX G;  1W2B A;  1N8R C;  4UY8 C;  2JK8 A;  3LGJ A;  3J81 c;  3W1G A;  2NVY H;  2WAQ G;  4BA1 I;  3CMA A;  1EFW A;  1AE3 A;  3S16 H;  4A3B G;  1N33 Q;  3S2H H;  4APV A;  1XPO A;  4TQU S;  4JI5 Q;  1KC8 C;  2PQA B;  1HNX L;  4HJA A;  1UE6 A;  1YJ9 A;  2N3S A;  2CFM A;  2F4V L;  4JG2 A;  2HHH Q;  1VQD A;  3U4Z A;  3F2B A;  4DR5 L;  1UEB A;  2PI2 E;  5GAG C;  1H95 A;  3JC6 6;  1FL0 A;  4MTN A;  3STB D;  2RF4 A;  2PNH A;  4YHH Q;  2UUC Q;  5JJL A;  1VQ7 A;  4LF4 Q;  1XMQ Q;  3GTG H;  3S14 H;  5LMN Q;  3H3V I;  3I7F A;  4A4I A;  1P16 A;  2CWA A;  4R4C A;  2UUA L;  1YHA A;  4LF9 L;  1XPU A;  4A3G G;  3I2Z A;  2D62 A;  5H1S E;  4AQY Q;  3AFP A;  5IP7 G;  3HOX H;  4JI6 Q;  2N49 A;  3PIO A;  1QUQ B;  4P71 A;  3J7Z C;  3D0F A;  1D7Q A;  3KOJ A;  1G51 A;  3M7N A;  3K8A A;  4LWC A;  3J80 i;  1L1O B;  1V43 A;  1HR0 L;  4A3B H;  2ALY B;  3AQQ A;  4DV6 Q;  1QVC A;  4MZ9 A;  4DR3 Q;  2B63 G;  3PUW A;  5IWA L;  1I94 L;  4KHZ A;  4P75 A;  1UE1 A;  3CCJ A;  1WI5 A;  1GVP A;  1M90 C;  1PHJ A;  3RLO A;  3NEL A;  1WYD A;  4ALP A;  4A75 A;  2Q2I A;  2VQF Q;  2MNA A;  1HNW Q;  1HJP A;  1LUZ A;  4GOP B;  4UPA A;  3S17 H;  2IT1 A;  3K81 C;  4X65 L;  4OON A;  2YU9 H;  3GTK H;  3UDG A;  3A74 A;  1EOV A;  4R4I A;  2CKZ B;  1KRT A;  4IPG A;  1IBK Q;  3CCL A;  3ICE A;  1K0R A;  1QVF A;  4BXX G;  4A3G H;  4LFB Q;  1I6H H;  5IP7 H;  5GAE C;  1TWF H;  1A8V A;  5E7N A;  1VQM A;  4GKK L;  4DR1 L;  4XTC S;  1T9H A;  4A76 A;  4OWW B;  1N32 L;  4LF5 Q;  1VQI A;  1KIX A;  1XMO Q;  1VQF A;  1N9W A;  3CCU A;  1VQK A;  4JI1 Q;  4POG A;  1UE7 A;  4GS3 A;  2Q2H A;  2DGY A;  1KD1 C;  3PUY A;  5ELO A;  1Z9F A;  5IE8 A;  2B63 H;  3GTM H;  1XPR A;  1Q46 A;  1JJ2 A;  2V1C C;  2IX1 A;  3PO3 G;  2JE6 I;  3KJO A;  3GTL H;  1S40 A;  1K8G A;  2BH8 A;  1WCM G;  1KAW A;  3RLN A;  1MKH A;  2OWO A;  1TWG H;  3CD6 A;  2YTX A;  2UXC L;  5DLQ E;  4LFC L;  4YWM A;  2HIX A;  4JI2 L;  3H3V H;  1X3E A;  1KHI A;  2E2J H;  1KRS A;  1HNX Q;  3UE0 A;  3FKI G;  1IXR A;  4FDB A;  4OWX B;  4A3E G;  4A3K G;  1Y1W G;  4BXX H;  4HID A;  2F4V Q;  3A5Z B;  2ZTE A;  1Q1E A;  3W5O A;  1VQ5 A;  4DR5 Q;  4JI3 L;  1OXV A;  2HIV A;  2YTY A;  2E5L L;  4LF8 L;  2NVQ H;  4IOC A;  3M9B A;  2E2H H;  2UUB L;  4UP7 A;  2E8G A;  1PYS B;  1OXX K;  1KQS A;  1IL2 A;  2WP8 J;  4A3L G;  2OTJ A;  5HY6 A;  3H15 A;  2UUA Q;  4Y7N H;  4C3J H;  1PH3 A;  4LF9 Q;  2PQA A;  2JA8 G;  1L0W A;  2RHS B;  3PO3 H;  2DUD A;  1X6O A;  4H02 A;  5J3B A;  5JEA J;  1EQQ A;  4QIW E;  1JT8 A;  1LYL A;  4EX5 A;  4KHP L;  4X62 L;  1WCM H;  1WFQ A;  1EIY B;  4AH6 A;  4IFD I;  1HR0 Q;  4PZ8 A;  4JI7 L;  2B29 A;  4LUZ A;  4ME3 A;  1HR0 W;  2JA5 G;  3HOY G;  1VQH A;  2K5H A;  1NMG A;  3M4P A;  4DV3 L;  4NXM L;  1SLJ A;  1ASY A;  2NVX H;  2YYZ A;  3FKI H;  2ZJQ A;  4A3E H;  4A3J G;  4JCV E;  1J6Q A;  5IWA Q;  4HIK A;  1X3G A;  4A3K H;  3PUV A;  1Y1W H;  1Q8K A;  2OCE A;  1VQ8 A;  3JAM i;  4DR4 L;  1HZ9 A;  4BBR G;  2PMZ E;  2YTV A;  2N78 A;  2R93 G;  2MQH A;  3TEH B;  2I0Q A;  2RHQ B;  3PUZ A;  3RZO H;  5AJ3 L;  1C9O A;  4GN5 A;  4QJF A;  2HQL A;  1M1K C;  3CPW A;  4OXP A;  3U58 A;  1L1O A;  4X65 Q;  1PFS A;  4NXN L;  2MO1 A;  2K14 A;  3PV0 A;  1VQ9 A;  3S15 H;  4A3L H;  1DGS A;  3BZC A;  1Y1V G;  2EXD A;  1PA6 A;  2JA8 H;  1VQN A;  5GQO A;  2ES2 A;  5C0X J;  4GKK Q;  4DR1 Q;  4O0A A;  3ERS X;  3K7U C;  4BY1 G;  1FVI A;  1XTD A;  3J81 i;  4IFD G;  2VNU D;  4GN4 B;  1IBL L;  5JEA G;  3T1Y L;  4A3F G;  5C0X I;  1E7Z A;  4DK3 C;  2WFW A;  1G6P A;  1E22 A;  4GN3 B;  2JA5 H;  1A0I A;  2CQO A;  3CXC A;  1CKM A;  1E1T A;  3I56 A;  4QY7 A;  3UDF A;  3CCV A;  1MIU A;  4PZ7 A;  4DAY B;  1YIT A;  1VQL A;  4A3J H;  1PH2 A;  1YI2 A;  3KDF B;  3W1B A;  1VQJ A;  4BBR H;  3S1N H;  1HH2 P;  2I5M X;  3CQZ H;  4DV2 L;  2R93 H;  1VQG A;  3PIP A;  4JI0 L;  4JBK A;  1FJG L;  1SMX A;  5LMN W;  3PUX A;  4JV5 L;  1LTL A;  2UXC Q;  4YWK A;  4DKA C;  3S1M H;  4LFC Q;  1EIF A;  1X9N A;  4JI2 Q;  3CCQ A;  2RCN A;  1X54 A;  1NJI C;  2OQK A;  2Z0S A;  2BH2 A;  2I5L X;  1Y1V H;  2R7D A;  1EWI A;  2AWN A;  4DV0 L;  4DV1 L;  2IHF A;  1K8A C;  2A8V A;  1NY4 A;  1PH8 A;  3E9I A;  1RIP A;  4A3I G;  2HT1 A;  3NEN A;  4JI3 Q;  2F52 A;  4IPH A;  2GN5 A;  1VQ4 A;  2E5L Q;  4BY1 H;  4LF8 Q;  3HOZ G;  1CKN B;  2XGT A;  5LMU L;  3VDY A;  4A3F H;  2UUB Q;  4R4Q A;  3OTO L;  4OX9 L;  4P72 A;  2WAQ E;  4IJH A;  3STB C;  5ELN A;  3J7A 5;  4JYA L;  1PH6 A;  5FJ8 G;  3OW2 A;  2AWO A;  2OTL A;  2Q2T A;  1XNQ L;  2UXD L;  2ZTD A;  4DAM A;  2A19 A;  1JE5 A;  4BBS G;  4LW1 A;  4OWT B;  5IYC G;  4B3S L;  5C4J H;  2VS1 A;  4HIO A;  1UE5 A;  1VQO A;  1D8L A;  1TWC H;  2K4K A;  1L1O C;  3KF6 A;  2R6G A;  3ULJ A;  4X62 Q;  1PV4 A;  4KHP Q;  4Y52 H;  4YCW A;  1QVG A;  4JI7 Q;  4B3T L;  5HGQ A;  4P74 A;  4R4T A;  2R92 G;  3KFU A;  1QZG A;  1SRU A;  4KI0 A;  4NXM Q;  2Z6K A;  2JA7 G;  4GLX A;  1N34 L;  2K5N A;  3K80 C;  1X55 A;  1HZC A;  3MEF A;  4XIG S;  4DUZ Q;  4J15 A;  4DR4 Q;  1SR3 A;  3L2P A;  2EIF A;  4A3I H;  1CSP A;  3M4O H;  3EBE A;  4B3R L;  1I3Q H;  2D0O A;  3UE1 A;  1Q86 C;  4LFA L;  2JA6 G;  1YNX A;  1VQA A;  4DUY L;  3OYY A;  3HOZ H;  1OXU A;  4NB3 A;  2BA1 A;  2NZH A;  5AJ3 Q;  3KLW A;  1IBM L;  3I4N G;  1VQC A;  1VS0 A;  5IY0 A;  2IX0 A;  5FJ8 H;  2UU9 L;  1B7Y B;  2KHJ A;  3ULL A;  3BU2 A;  4NXN Q;  4GNX B;  4QL5 A;  1X3F A;  4BBS H;  1K9M C;  5IYC H;  3TS2 A;  4IPD A;  4YWL A;  1NE3 A;  4C3H H;  1J5E L;  4B3M L;  2KHI A;  4AIM A;  1A62 A;  1VQB A;  3RR5 A;  1IBL Q;  5FLM G;  3T1Y Q;  3CC2 A;  5GRO A;  3HOV G;  2B3G A;  1MJE A;  2JEA I;  2R92 H;  1K83 H;  3TRZ A;  4DR7 L;  4JBW A;  1XJV A;  1KL9 A;  3TRE A;  3KF8 B;  5M3F H;  1MJC A;  4HIM A;  1PYB A;  1YJN A;  1PH7 A;  2JJQ A;  3J81 j;  4JI0 Q;  2QGQ A;  5FLX c;  1XNR L;  2FXQ A;  2VZA A;  1Z47 A;  3AFQ A;  1QZH A;  1FJG Q;  3BZK A;  2JA6 H;  3S1R H;  4JV5 Q;  1S3O A;  2AKW B;  2QEX A;  3I4N H;  3CCR A;  1S72 A;  1JJC B;  1W3S A;  1NBW A;  4WJ3 M;  2WB1 G;  3GTP H;  2L15 A;  1K73 C;  4KLK A;  1B8A A;  2NN6 I;  1BKB A;  2OQ0 A;  2Y0S G;  4DV0 Q;  4DV1 Q;  3A5U A;  1CUK A;  1GKH A;  1EQR A;  3E0E A;  1RL2 A;  4HJ7 A;  1AH9 A;  2VW9 A;  2KEN A;  2GVB A;  3PO2 G;  3EN2 A;  1FGU A;  3PF5 A;  5FLM H;  2Z6K C;  5LMU Q;  1I94 Q;  4PG3 A;  3OTO Q;  4OX9 Q;  3HOV H;  4R4O A;  4JYA Q;  5IYD G;  1YEZ A;  4IO9 A;  2K75 A;  2IY5 B;  2E2I H;  1E3P A;  1BBU A;  1HZB A;  2R7Z G;  3SGI A;  1YVC A;  1OXS C;  1QUQ A;  1YHB A;  3UDX A;  2ID0 A;  5GAD C;  1XNQ Q;  2UXD Q;  3M4Q A;  1JJG A;  2ZM6 L;  4HJ5 A;  1OXT A;  4B3S Q;  1CKO A;  2AHO B;  4QQB X;  1BVS A;  5M5X H;  4YCU A;  1AE2 A;  3G48 A;  2K52 A;  4DV7 L;  4K0K L;  3L0O A;  3FP9 A;  1SFO H;  1L2F A;  4B3T Q;  4JOI A;  1K3R A;  1V9P A;  1CKN A;  1VCI A;  1PH5 A;  3CP0 A;  3F8T A;  4DNI A;  3KJP A;  4DV4 L;  1N32 Q;  4UP8 A;  3EIV A;  1N34 Q;  2VQE L;  4GLA C;  1X65 A;  4JI1 L;  2NVT H;  3H0G G;  2ZTC A;  5M5Y H;  3K7A H;  4GOP A;  3RZD H;  1Q82 C;  2EQS A;  4B3R Q;  4LFA Q;  3PO2 H;  2JQO A;  2WB1 E;  1WJJ A;  3U4V A;  4DUY Q;  2QA4 A;  1KXL A;  1IBM Q;  2Y0S E;  5IYD H;  4X6A H;  5JJI A;  4DPG A;  3HKZ G;  3U50 C;  3L7Z C;  4JC0 A;  3GTJ H;  2XTI A;  1LM0 A;  1SRO A;  1JMC A;  2NZO A;  2UU9 Q;  2R7Z H;  4TVA B;  4X64 L;  4A93 G;  4GKJ L;  5GAH C;  4LF7 L;  4JI8 L;  2JEB I;  5M3F G;  2K5V A;  1P8L A;  1J5E Q;  4B3M Q;  2H5X A;  4UP9 A;  5K36 G;  1NTG A;  1YIJ A;  3HOU G;  5IT9 c;  3HFZ B;  2CCZ A;  2LXK A;  5BR8 L;  5C44 G;  3F2D A;  1B70 B;  4LF6 L;  4DR7 Q;  5C0X G;  4DR6 L;  3T1H L;  3PGZ A;  4PMW A;  4GNX A;  3RN2 A;  3CPF A;  1EYG A;  1C0A A;  3H0G H;  3PSI A;  1YZ6 A;  1JB7 A;  4YY3 L;  4PZ6 A;  1X56 A;  1XNR Q;  4X66 L;  2R7F A;  4RG1 A;  3J80 c;  4JBM A;  4A3D G;  2CWP A;  1UWV A;  2ASB A;  3MXN B;  3I4O A;  4NPS A;  1A63 A;  5M3M G;  3G71 A;  4DV5 L;  1V1Q A;  2VUM H;  3HOY H;  3CCM A;  4BY7 G;  1Y14 B;  4P73 A;  4A93 H;  3TQY A;  1NMF A;  1O7I A;  3E9H A;  1G29 1;  1VQ6 A;  2VUM G;  3RLF A;  1U0L A;  3A0J A;  4JOI C;  3BJU A;  4DV3 Q;  1I5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...