2R7ZG

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r7zG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r7zG01
2JA8G 3S2DH 4P74A 2VY3A 5C44H 1PH7A 3TRZA 4XTCS 5H1SE 1LM0A 3I4OA 3M4QA 1MIUA 2E2JH 3E9IA 3S1QH 4BBSH 4A75A 2ZJRA 4NXMQ 4B3MQ 4B3RL 3FKIG 2RHSB 1VQFA 3HOWG 2KCMA 4DK3C 3AEVA 3JAMi 1VQEA 5E7NA 1QZGA 1HZAA 1L1OC 3DM3A 2ALYB 4DV6Q 5C44G 4AQYL 3U58A 2AKWB 3CXCA 3RR5A 1X3FA 4BBSG 2VS1A 3GTJH 2OWOA 1I94L 4JG2A 2NVXH 4GN3B 4Y52H 4QL5A 1XNRQ 2E8GA 2WB1G 2ZTCA 5FLXc 3KF8B 4DAMA 4JI0L 1YNXA 1EQRA 2I5MX 3FHWA 2OTJA 5IP9H 1OXXK 2KBNA 1Q86C 5IE8A 2ZTDA 2GVAA 3W1BA 3WWVA 5LMUL 1N32Q 2AHOB 1Q12A 1K83H 3AYHB 4TQUS 5IYCH 4DV5L 1YJWA 3PUZA 2VZAA 3PF5A 1LTLA 3PF4A 2YTVA 4JI8Q 4J15A 2UXCL 2WFWA 4X65L 5IP9G 1EOVA 2C35B 3BZKA 4JC0A 3M9BA 3OW2A 4POFA 4POGA 1SN8A 4JI3Q 4R4TA 3PV0A 2F52A 5IYCG 1WCMG 2CKZB 2PQAB 3RLFA 5GADC 2R7ZH 3GTGH 1YHAA 4AH6A 1OTCA 5AJ3L 3EN2A 3AFQA 4QGUA 4A3KH 2AWOA 2R93G 1A0IA 3CCJA 1N36Q 4YWLA 1NTGA 2I5LX 1VQMA 1XNQQ 4EQ5A 1V9PA 1PHJA 3PUYA 4HJ7A 2H5XA 1HR0Q 2F3IA 4JI3L 4DR1L 2Q2UA 4JI2Q 3W5OA 1N34L 3HOZH 3K80C 1Y14B 3H15A 2VQFQ 3PUVA 4A3KG 4DUZQ 2WAQE 2ATWA 4O2DA 4DR5L 4DPGA 4PZ6A 1GD7A 4C3JH 5IY0A 3GTLH 3UE1A 1N36L 3BZCA 1BVSA 2KHIA 4DR2L 4DV0Q 3G6EA 4K0KL 1EUJA 1NJIC 2IX1A 1X56A 1XMQQ 3HOZG 1WYDA 1YIJA 3SGIA 4JOIA 1SR3A 4NPSA 4DV3Q 1Q1EA 2CFMA 1NMFA 4AYBE 1PH6A 2E5LL 1X54A 4R4QA 5C3EG 2VQFL 2Z6KA 3MEFA 3CAMA 3CW2C 4JI1Q 3B6YA 1NBWA 1IZ6A 4QQBX 4HIMA 2VUMH 1G51A 5FJ8H 4JI6Q 1IXRA 4DR7Q 4P75A 3T1HQ 2PQAA 4BA2I 3T1YQ 5M3FH 4RG1A 5JJKA 5M5XH 4GOPA 4BXXH 2A19A 1VQ7A 4C3HH 4GNXB 1FGUA 3STBC 3CCQA 2ID0A 4JI4L 3NEMA 4A3EH 4LW1A 3HKSA 1LUZA 3E9HA 4IJLA 4JI7L 4X6AH 5JJLA 2VUMG 5FJ8G 1FJGL 4EX5A 2BH2A 3OTOL 1PA6A 4JBKA 1B8AA 2LSSA 2WB1E 3KOJA 3T1HL 3J80c 4LF4L 1IYJB 5M5WH 2NVQH 4RMFA 4X64L 3KDFA 4DV2Q 4A3BH 2UXBQ 2HHHL 1V1QA 2UUAQ 3S17H 2VQEQ 4P72A 3H3VI 4JYAL 3F1ZA 4A3EG 1OXUA 3J81i 4LF8Q 1N33L 1JMCA 1X55A 3GO5A 3CCEA 1VQ8A 1M1KC 3CCLA 4L5TA 4DUYQ 2VQEL 2RHQB 3NENA 2F4VQ 1CUKA 2WAQG 1IBML 1A63A 1CKOA 4R4CA 2YU9H 1VQKA 1E1TA 4LFAQ 2ZM6Q 4A93H 1MJEA 2PI2E 3KJPA 4QIWE 2NVYH 4L5SA 1PH8A 1KRTA 2K4KA 3RLOA 1I50H 1J5EL 1X3EA 3I56A 1Q82C 2UXDL 4IPGA 3PSIA 2K75A 2ZJQA 2F4VL 3M4OH 4DNIA 3NELA 2L15A 3KFUA 4A93G 1QVFA 4GN4B 2XTIA 4A3FG 1JB7A 1P8LA 2JA9A 3CCSA 1XJVA 2K50A 5GROA 4JCVE 5FLMH 1S40A 4LFBL 3PO3H 4GKJQ 2VL6A 2NN6I 3I2ZA 4DV1L 2JA7G 3TS2A 3E0EA 1V43A 4YCWA 1VQLA 2MO0A 1EIFA 1K8AC 3EIVA 3AFPA 3GTPH 5LMNQ 1E22A 1HNXQ 1VQCA 3I4MH 2NN6G 4IOAA 4R4OA 2HIVA 2DGYA 5FLMG 4JBWA 1L1OA 3PO2H 4NXML 4KI0A 2MNAA 2D0OA 5GAHC 1QZHA 4B3ML 2XGTA 4B3SQ 1KQSA 3M7NA 3S2HH 4GKJL 2HIXA 4LUVA 5C0XI 2K5VA 2AMCB 4A3JH 3A5ZB 5IP7H 3HOXH 3CMAA 2UUCQ 2EQSA 4NXNQ 4WJ3M 4DV6L 3I4MG 4AIMA 1XPOA 5JEAJ 1D8LA 1Y1VH 1HNXL 1T9HA 2IT1A 5C0XG 3KYHC 3CCVA 1CKNA 3PO2G 1KXLA 3G4SA 3KJOA 4C3IH 1GO3E 1XNRL 2WP8J 1TXYA 4A3JG 1R9TH 3HOXG 3GTMH 3F2CA 1MKHA 4OXPA 4BY1H 2UUCL 1TWGH 5DLQE 3CC2A 1O7IA 3S1RH 4UPAA 1PH2A 2NVTH 4LFCQ 1YHQA 3U50C 1N32L 4LF6Q 2R92H 4YCUA 5GAEC 1PV4A 4YWMA 4R1JA 2A1AA 3BJUA 4GOPB 4LF5Q 4JI8L 2Y0SG 1VQBA 3L0OA 4YHHQ 4PZ8A 4YY3Q 4P73A 1OXVA 5JEAG 3GD7A 4A3MH 1L0WA 1OXSC 4JV5Q 4MTNA 3TS0A 3CPFA 4MZ9A 3GDEA 1AH9A 3D31A 2EXDA 2R7ZG 3UDFA 2R92G 2MFIA 2IX0A 2JA5H 5IYBH 1XMOQ 5GAGC 2K14A 3S1MH 3KDFB 1Z9FA 1BBWA 1PFSA 4DV4Q 1E1OA 2QA4A 2BA0A 4O0AA 3L2PA 4YHHL 4HIOA 3DLLA 4JI5Q 2CCZA 4A3MG 3CPWA 4L5QA 1VS0A 3PUWA 4DAYB 2I5HA 3BU2A 1XNQL 4DV7Q 1HR0L 2JA5G 1WOCA 5IYBG 1Q8KA 1KL9A 5IYDH 4DR6Q 4JI2L 1HZCA 1YITA 1VQ5A 1YBYA 4OO1I 3S15H 4DUZL 1YJ9A 2GN5A 2B63H 4B3TQ 4A3GH 1DGSA 2YTXA 4DV0L 1PYSB 1A8VA 3H0GH 4OO1G 4NB3A 4APVA 4DK6C 1UE5A 1CSPA 2B3GA 3UDGA 1XMQL 2BA1A 1EIYB 2A8VA 1VQ6A 1G6PA 1A62A 4DV3L 1UWVA 4HJAA 1JJ2A 4A3LH 1TWAH 3STBD 3F2BA 5M5YH 4A3CH 1IBLQ 4QJFA 4GLXA 1Q46A 4JI1L 3RZDH 4A3GG 1QUQA 1KRSA 1X6OA 5M3FG 1EFWA 3M4PA 4JI6L 4DR7L 1YVCA 4IPCA 5K36G 3T1YL 4BXXG 3GTOH 1C9OA 4OX9Q 1K73C 4X62Q 2OCEA 4A3LG 1X65A 1Q81C 1VQJA 4TVAB 1I5FA 1NE3A 5ELNA 3U4VA 3F8TA 2Q2TA 1KD1C 1SROA 3L7ZC 1K0RA 3M3YH 4OONA 3CP0A 1KC8C 3HOUH 4A3BG 3JAMc 4ALPA 2R7DA 2JA6H 1L1OB 4LUOA 2UXBL 4DV2L 4OX9L 3J7A5 5IT9c 2UUAL 3HKZE 1NMGA 2CWAA 1OXTA 4KLKA 4JBJA 2UU9Q 1XPRA 3RLNA 2KENA 1YJNA 2LXKA 3Q8DA 4X66Q 1K9MC 2UUBQ 4LF8L 5JJIA 4LF9Q 1ASYA 1ASZA 2N49A 2PMZE 2JA6G 1CKNB 3H3VH 4IOCA 2Y0SE 3NBHB 3M85A 4JBMA 2YTYA 1JJCB 1VQAA 1X3GA 1Y1WH 5BR8Q 1HZBA 3A5UA 1RIPA 1N8RC 1IBKQ 4LF7Q 1AE3A 3W1GA 3K7UC 4PG3A 3CC7A 4DUYL 1VQHA 2NZHA 3A0JA 1I6HH 4OWTB 1H95A 2K5HA 2RCNA 2OQ0A 2V1CC 3KLWA 4BBRH 4LFAL 2IY5B 2ZM6L 2EIFA 3IRBA 1CSQA 3S14H 1X9NA 2IHFA 5C0XJ 3CMEA 2N3SA 2D0PA 4IFDJ 4UP9A 4GNXC 3K7AH 1WFQA 3S16H 1PH3A 4B3RQ 1KIXA 4BBRG 4BA1I 5J3BA 1KHIA 1L2FA 4OWWB 4KHPQ 1PH1A 2DUDA 3J80i 3A74A 3PO3G 1J6QA 1W3SA 2MQHA 2Z0SA 4PMWA 4AQYQ 3VDYA 1HNZQ 1G291 2PNHA 4GLVB 1AE2A 3PGZA 1I94Q 4IFDI 1EWIA 1UE6A 3UDXA 1EQQA 1QVGA 2E2HH 1FVIA 4GN5A 4PZ7A 1XPUA 3CF5A 5LMNL 2KCTA 4Y7NH 4JI0Q 4KHPL 1Z47A 5GQOA 3MXNB 4IFDG 3RNUA 1JE5A 1TWFH 1WJJA 1JT8A 3PIOA 1SE8A 1YEZA 5ELOA 2E2IH 4B3SL 5IP7G 1HNZL 1HJPA 2JQOA 3D0FA 3KF6B 1VQDA 1SRUA 3LGJA 4YCVA 3J7ZC 2QEXA 5LMUQ 1PH4A 1U0LA 4NXNL 4DV5Q 3HKZG 4R4IA 1K8GA 1HR0W 1Y1VG 2GVBA 2KHJA 1IL2A 3HFZB 5C4XH 1LYLA 2UXCQ 1XTDA 4P71A 4X65Q 3TQYA 1E7ZA 2NZOA 4A76A 2LXJA 2HT1A 3K8AA 4H02A 1S72A 2CWPA 1GKHA 3I4NH 1HNWQ 3CCMA 4BY1G 1Q7YC 2JEAI 2HQLA 5C4XG 3OYYA 3F2DA 2VNUD 1PH5A 4LNQA 1WCMH 5HY6A 4HJ9A 1K3RA 2JK8A 1NY4A 1QUQB 5AJ3Q 3AQQA 1KAWA 2JA8H 4LFCL 2K5NA 1SFOH 2JJQA 4GKKQ 4A3IH 2ASBA 2R93H 4LF6L 1VQGA 3I4NG 1PVOA 2OQKA 4LF5L 1HNWL 3ERSX 3CD6A 4BY7H 4HIDA 1P16A 4YY3L 1VQOA 4DR1Q 2K52A 3CCRA 1VQNA 1N34Q 1PYBA 4JV5L 4LUZA 4GS3A 1Q1BA 3UDIA 1VQIA 1VQ4A 1UE7A 4A3IG 2ZJPA 4DR5Q 1B70B 4DKAC 1GM5A 1XMOL 3ICEA 1M90C 4GKKL 4DR2Q 2JE6I 1CKMA 1W2BA 4DV4L 4BY7G 4K0KQ 3KF6A 4WJ4A 3J81c 3EBEA 4JI5L 1BKBA 1B7YB 1FL0A 3PCOB 1WI5A 1SLJA 3CQZH 3S1NH 2CQOA 4IPDA 1BBUA 2E5LQ 3CC4A 5IYDG 4DV7L 3RN2A 2BH8A 4MNOA 2IHEA 1VQ9A 5C3EH 4DR6L 3TREA 4JOIC 2VW9A 1PH9A 1TWHH 2Z6KC 1E24A 2B63G 3U4ZA 1EYGA 3H0GG 4B3TL 2OTLA 4UP7A 4JI4Q 4IPHA 3G71A 4JI7Q 4GOPC 1VQPA 4IJHA 4OWXB 2YV5A 3ULJA 1FJGQ 1SMXA 1HH2P 4KHZA 3OTOQ 4A3CG 3PIPA 3UE0A 1YI2A 4LF4Q 1IBLL 1UEBA 4X64Q 2ZTEA 2HHHQ 5M3MH 1GVPA 3K0XA 4JYAQ 2YYZA 1U5KA 2MO1A 1HZ9A 1C0AA 2QGQA 5HGQA 4HJ5A 4UY8C 4X62L 1MJCA 1N33Q 2ES2A 3I7FA 1JJGA 5C4JH 1UE1A 5IWAQ 4IO9A 2AWNA 1YHBA 5M3MG 3JC66 3ULPA 4GLAC 2N8NA 4ME3A 3HOUG 3RZOH 1IBMQ 2I0QA 2Q2IA 2PI2A 5EAYA 4A4IA 3I55A 1TWCH 1YZ6A 2Q2HA 2R6GA 3HOVH 1RL2A 3TEHB 4XIGS 5LMNW 1S3OA 3CCUA 2B29A 2RF4A 3ZJYC 2R7FA 5IWAL 4DR3Q 2UU9L 3HOYH 4X66L 2UUBL 1D7QA 1J5EQ 3PUXA 4L5RC 4DR4Q 4A3DH 4LF9L 3J81j 1N9WA 2UXDQ 1C7YA 2FXQA 4HJ8A 1Y1WG 1E3PA 4FDBA 3RN5A 3HOVG 2JEBI 4QY7A 4UP8A 1VCIA 4YWKA 2D62A 1I3QH 3FP9A 4C2MH 3S24A 5BR8L 3G48A 1IBKL 4LF7L 4HIKA 3HOYG 4A3FH 4LFBQ 4A3DG 4DR3L 3K81C 3FKIH 4DV1Q 3HOWH 1QVCA 3ULLA 3ER0A 4GNXA 4DR4L 2JA7H 4LWCA 3GTKH 2N78A 4AYBG 3GTQH
chains in the Genus database with same CATH superfamily
1BF4A 5C44H 3TRZA 4XTCS 4BBSH 1II3A 3MZ5A 4A75A 4B3RL 1ZXTA 3HXLA 3JAMi 1VQEA 3TSSA 1QZGA 1L1OC 4GC7A 4HNVA 3MWEA 2Z6BA 1JIHA 1JDEA 2AKWB 4TUYF 5KFVA 5KT5A 3RFCA 1HTLD 2F1MA 4QL5A 5CV5A 1Z7TA 2K28A 3BDOA 3KF8B 3T5HA 4JI0L 1JX4A 5I2YA 2A6HC 4A2BA 2OTJA 5KFGA 2UXDH 1E4EB 1O7YA 2L4NA 1PTOH 3KAKA 4FF3A 5KFXA 4IUUA 5LMUL 3NQIA 3MEHA 1YJWA 3PF5A 2VZAA 4K2KA 2B2WA 1VMPA 4JK1C 4DV1H 1QG7A 3HRZC 3Q22A 2VOBA 2YRWA 1EOVA 4RNMA 4JC0A 2J9GA 2Z4HA 3J80E 1EQTA 4POGA 1TU2B 1ESRA 3PV0A 2F52A 4G3IA 4ZI7F 2CKZB 4IUQA 3TP7A 4NXMH 2NVXB 3K3VA 4M9UA 4GKJH 1SMYD 1CHPD 2CVRA 3OIQA 3S2HB 1EY9A 2NU7B 4DV6H 2I5LX 4A3JB 4MHEA 1HR0Q 5A35A 4DR1L 4TQSA 3KF8A 2VQFQ 4A3KG 2NUAB 4DUZQ 1STGA 1A3UA 2DJGC 2WV6D 2RDJA 4QWBA 4PZ6A 1GD7A 2AQ1B 4C3JH 1E4EA 2Y0SB 2YYAA 3GTMB 2W57A 1EUJA 2IX1A 4O3OA 1XMQQ 2IX3A 3HOZG 1YIJA 2VR1A 3WO0A 4DV3Q 2NVTB 1PFNA 5FKAC 2CFMA 3E5SA 1NMFA 3VPBA 2XCAA 4O3SA 5C3EG 2B2VC 1WTOA 3G6JB 4KJNA 4QQBX 5IGEA 3ND8A 1G51A 2K5WA 4G7ZC 4JI6Q 3T1HQ 2Q8IB 3Q2OA 4RG1A 3C2PA 5CMDA 2A19A 4DA2A 3STBC 2ID0A 2G9DA 3N52A 3HKSA 1LUZA 3E9HA 4JI7L 1Y69U 2VUMG 2R8HA 3VYTA 1FJGL 1O7LA 2DZDA 1IKLA 3OTOL 1PA6A 4JBKA 3PW7A 1ZYRC 3KOJA 3J80c 2UXBQ 2W71A 4JI2H 1GXDC 3QWNA 1SYEA 1GSAA 3S17H 2W6MA 4ECRA 2FK2A 5DNFA 2CH4A 3GTMA 3NK9A 5IOCA 4A3GB 2ZJTA 5KG3A 1MSHA 2YZGA 2HCCA 3D4DA 1DOLA 3V4ZA 1K8MA 1X32A 3EFXD 2VQEL 2F4VQ 2K1BA 1SYXB 1A15A 4ILWA 2F3VA 3MXUA 4JI1H 1TWAB 3TIGA 2XCPA 3D6CA 1T3NA 2PI2E 1J8IA 1S5FD 3T1YH 1D5XC 3RLOA 1PZID 2DNCA 1IHZA 4A3BB 2W9BA 4G57A 4DNIA 3NELA 3BA9A 3GQBA 4UCSA 4MV8A 2XGPA 1LACA 4GN4B 2K03A 4A3FG 1P8LA 1I7NA 4JVZA 4ID6A 1LLRD 3OWFA 5GROA 1S40A 2F0DA 5KGUA 4J9KA 4F4XA 4RAUC 3FMCA 2F03A 2NN6I 3I2ZA 2JA7G 3TS2A 4YR3A 1KTKA 2MUYA 2JA6B 1EIFA 2AUJD 1K8AC 3EIVA 1Z6HA 3DXJC 3E0JA 2DPJA 4R4OA 5CV6A 3J81E 2GLTA 2MNAA 1WTVA 1QZHA 3M7NA 4IFDH 3S2HH 1KQSA 4LUVA 4A3JH 2A6HD 5IP7H 3M9OB 1Y1WB 4L1KA 4RZQA 1TWAA 5KFJA 2W70A 1HNXL 1D8LA 4K5VA 4ECYA 4DNTB 2IT1A 3CCVA 5C0XG 4UFZA 4LFAH 2ZM6H 3VPCA 2EJGC 1ENCA 4KMUC 3HOXG 3GTMH 2O03A 3RAQA 3R5HA 1MKHA 1PRTC 5DLQE 1GUWA 1FYCA 3S1RH 4ZAIA 1PH2A 1HHVA 4RNNA 2NVTH 1M4VA 2XRSD 3U50C 1EUDB 5E1FA 5EPKA 1B50A 2VQDA 1PV4A 1JC7A 3BJUA 4JI8L 1Y8NB 1VQBA 4HEDA 4FF2A 2JA6A 3MR2A 4P73A 1HFGA 1OXSC 3C3LA 4JV5Q 4ZHQF 1TVXA 2FB9A 5KFRA 4MZ9A 3GDEA 5BN4A 3D31A 2R7ZG 1K0SA 3UDFA 1SYDA 2R92G 3UI2A 1GGOA 4J9QA 1Y1VB 4EQNA 4Y7NB 1Z9FA 1IOWA 3PR4A 3ND9A 1R4PB 2BA0A 4O0AA 4YHHL 4HIOA 3IFDA 5TSSA 4C3IB 3W2DA 5H80A 3M4IA 1Y1WA 2E2IB 1VS0A 1BUVT 1BNZA 4I50F 2JEFA 1G2TA 1XNQL 5CGKA 5CV9A 3JAML 1WOCA 5A2QW 1Q8KA 1KL9A 5C4XB 1RKNA 3J7AK 2XN9C 4EYHB 4J9SA 2RSNA 1Y8PB 1YJ9A 4LSAA 3SK8A 4FBUA 3VR4A 5KG5A 3A8JE 4A3GH 3KBXA 3GLKA 1A8VA 2E74C 3N42B 1U4RA 1EIYB 1UE5A 3BABA 5D1OB 4LFCH 4LF6H 4HQ6A 1UWVA 4HJAA 4LF5H 5T14A 1TWAH 3STBD 3RAXA 2WKDA 1CS0A 4A3CH 1IBLQ 2NTSA 3K6OA 1SJHD 5CAEB 5M3FG 4DR7L 3M4PA 1ZYRD 4BXXG 2F0KA 2CZGA 5I47A 1XMOH 3N43B 4M8AA 1TWFA 1C3OA 5JJZA 1GUGA 1NE3A 2L0CA 2Q2TA 1KD1C 5DM73 3M3YH 1RYRA 3CP0A 2SNMA 3NTHA 4NW2A 4F7XA 4DV7H 4H7BA 2JA6H 2BOSA 4N8X1 3PW4A 3H0GB 5BN5A 3J7A5 1M8AA 4XYQA 5D3IB 1ET9A 4JBJA 3C46A 1G6PA 3GIDA 1YJNA 2C5CA 3Q8DA 2UUBQ 4ED7A 4LF8L 5KFNA 1ASZA 4IR9A 2HCIA 4QMGA 4EGJA 1KEEA 4JBMA 2YTYA 3GIQA 3GIKA 5ELCA 1Y1WH 2AUKA 1N8RC 5D3DA 3W1GA 3CC7A 1VQHA 1H95A 5C6AA 1JICA 3L4KA 4L6TB 2FPIB 3J81W 3S14H 1X9NA 3QO2A 4EYIB 2D0PA 4OX9H 4IFDJ 4GNXC 4Z9CB 3MAQA 4WFN3 3DWPA 1KIXA 1IKMA 1F2ZA 3KUPA 5J3BA 5C4JB 1V1PA 1CZGA 2R8GA 2EPBA 5EPLA 1S9FA 1J6QA 1ENFA 3A8IE 1AE2A 3PGZA 1I94Q 4KKSA 4IFDI 3GTLA 1RODA 3UDXA 1STYA 4F8MA 3HOVB 3CF5A 3MR5A 2RQXA 2KCTA 5F2DA 4Y7NH 1D5MC 3EPIA 4LF9H 1F9RA 1TWFH 1SAPA 1M6VA 3TMEA 5IIFA 1QB5D 3D8GA 2E2IH 3KAJA 5ELOA 5KFCA 1K1QA 2M05A 2W6PA 4YCVA 1SRUA 1KAAA 1EWCA 3DM1A 1PH4A 1HR0W 2ATWA 1KXLA 2ASDA 2KHJA 2M00A 2JA8B 2VUMA 5C4XH 2UXCQ 1XTDA 4A3FB 1E7ZA 1ZEQX 1QWYA 3FKIB 2LXJA 3HOWB 1HNWQ 4J0MA 3H3VC 4K2LA 1Q7YC 1DXMA 3BS1A 1FNVA 4B3RH 4HJ9A 2RDIA 1K3RA 3JRWA 1NY4A 5AJ3Q 1RHPA 1KAWA 4CKEA 4DU9A 1S68A 4IRCA 2ASBA 5KFIA 5LOVF 2R7LA 3GILA 4E6IA 2RVLA 2K52A 3CCRA 2FK3A 1LTAD 2EJFC 5J2UF 4JV2A 1VQ4A 1E0BA 1MZBA 4A3IG 4QF4A 4ZCKA 4JI0H 3R23A 4DKAC 4R8UB 4HCSA 2JE6I 4BY7G 4DV4L 4UHVA 1B7YB 2W6ZA 4PV1C 4DXGA 3J80L 4UCVA 5LMUH 4CKCA 5I4DA 1JOQA 4X3UA 5LL6b 4MNOA 1NCVA 2FMAA 1WCMB 2IHEA 5DGBA 3FKIA 5C3EH 4DR6L 3F8NA 3BZDB 2JA7A 3E6ZX 1SNOA 3T51B 1E24A 4DL5A 1B3AA 1EYGA 2GA4B 4B3TL 1CM9A 1VDZA 5LA6F 2D9UA 4GOPC 1KNEA 4IJHA 1SYBA 5KFBA 1SMXA 1RTOA 3UE0A 3PIPA 4UCTA 1UAPA 4LF4Q 3RB3A 4DR1H 4Q43A 2HHHQ 2E76C 1LT3D 2L12A 4PMCA 2OH2A 5FO8B 1GSOA 1HZ9A 2QGQA 2ZDQA 1EY5A 2UVVA 5C4JH 5FLXE 4IO9A 2WINB 2AWNA 3DEOA 5EJWA 1YHBA 4ECXA 3JC66 3HOUG 1O80A 2ZDHA 1RJQA 5BPHA 3G8CA 5KG7A 1F2YA 5EAYA 3RBDA 3E5NA 4QIWA 2W9AA 1SEIA 2A74C 3HOVH 2F3WA 4XIGS 2PCFB 3RV4A 4KY6A 3M9MB 1G8ZD 2RF4A 4LAAA 3GV7B 4DR3Q 4X66L 1D7QA 3PUXA 4IQZA 2R7ZA 5M3FB 2UXDQ 3N8DA 2HVSA 1V8QA 5IGFA 1B6SA 3IN5A 1EZ1A 4C5AA 3OSPA 4JI7H 1VCIA 5BR8L 2D62A 2JA8H 3FP9A 1IBKL 1FJGH 2B8GA 2Z4IA 3OTOH 3HOYG 4YB8B 4A3FH 2F0PA 2PZTA 1SNQA 3FKIH 4DV1Q 3HOWH 2L5TA 2CW0D 2JA7H 5M5WB 1EIHA 5KIXA 4LWCA 4ZQIA 1WR2A 1KNAA 5LHY1 2VY3A 5H1SE 3S1QH 3I4OA 3MR6A 3E9IA 2ATLA 1BNCA 4NXMQ 1QNUA 3QG1A 5JPMC 1SCUB 2K01A 5E7NA 1JLLB 1RDPD 2X6LA 3ONAB 1WTHA 2MP1A 1STEA 2ALYB 4DV6Q 4IUNA 3U58A 4ULLA 3CXCA 1SNPA 1S5CD 4MIUA 5EZYF 3W3AA 4Y52H 1I3QB 5C1PA 5FLXc 4DAMA 3K5NA 2YZNA 1YNXA 2NVYB 3A55A 4IURA 5IP9H 4Q5VA 1OXXK 4K5XA 2KBNA 3GIJA 5IE8A 3GTKB 4O3NA 2GVAA 3W1BA 3PW0A 5EWGA 2DPIA 2AHOB 5IYCH 1LTRD 3AB9A 3PUZA 1WVLA 4YJ2F 2OEOA 1A2UA 3OSNA 2FJ2A 2Q8RE 4POFA 1JB3A 3C1EA 1SN8A 4JI3Q 2R7ZH 5JQWA 3RLFA 1A3VA 1YHAA 1OTCA 3RIZA 5K5PA 1UUPA 4OELB 1EEFD 3EN2A 1ICWA 3PO2B 2R93G 3JSNA 3OW7A 1N36Q 4EGVA 2FHTA 4J9NA 2AGPA 2L9HA 5DLFA 4O2AF 2H5XA 1HNXH 2WDTA 4DF7A 1BOSA 5IT9E 2MCTA 1BXRA 1EFID 2RGRA 4JI2Q 3H4BA 3K80C 2RSOA 1Y14B 3H15A 2E2DC 1PTOF 2NVYA 4O2DA 4DPGA 2PMZB 3UE1A 4G7HC 3BZCA 2B2UC 4K0KL 3G6EA 5CV7A 3I91A 1NJIC 5C8YF 2EOTA 1KDBA 1X56A 5CC4A 3L3OC 1C30A 4ZK9B 1SR3A 4BS9A 4TRDA 3KLSX 4UDUC 1PH6A 2VQFL 4JI8H 2Z6KA 4ED3A 4TKOB 4JI1Q 3SXHA 2F0VA 4HIMA 3T5JA 2F0UA 4XQQA 1IXRA 4A3MB 1G6ZA 4ECQA 3T1YQ 5M3FH 3R93A 3AMUA 4BXXH 3MA2B 5LP6F 2ASJA 2IPKD 2JA5B 3TZDA 3C1FA 4JI4L 4YHHH 2I46A 2FPGB 1MBYA 1A9XA 4IJLA 4K5WA 5JJLA 4X6AH 2C22A 2IP4A 5FJ8G 3SK5A 4C3JB 1XNQH 1HPCA 3KXYT 2WB1E 2D5DA 3T1HL 4HR7A 4QWEA 3M4YA 1IYJB 3HGBA 5M5WH 4X64L 4MV1A 5IGGA 1V1QA 3H3VI 4JYAL 3F1ZA 4A3EG 1PDQA 1E2WA 2PMZA 1R9TA 3IKJA 1JKJB 1N33L 2QKIC 1X55A 3VA7A 3GO5A 2J4XA 3WOEA 1Y8OB 4FS1A 4L5TA 2A6EC 1CI3M 2ZXRA 1K3BC 2OXPA 2WAQG 1A63A 3D4WA 1E1TA 4ZUIA 4LFAQ 1L0XB 4MAMA 3KALA 2ZM6Q 4RZRA 4OEMB 4DR7H 3L9AX 2NVYH 4EVOA 1L0YB 1J5EL 2XGQA 1TY2A 1CHQD 4IWYA 4IPGA 2LKVA 2K75A 2F4VL 3CRLC 2L15A 5KFWA 3TINA 4A93G 2XTIA 2K32A 4EBEA 4J8QA 1WTRA 2NN6H 3CCSA 4JCVE 5FLMH 3R8BA 3E0EA 3CKIB 5KKNB 5L1IA 4R8IA 4RUCA 1EWHA 4N9TA 2YW2A 1QE6A 4LF8H 3PW2A 4IOAA 2HIVA 2DGYA 4IALA 1GUOA 4JBWA 2P5ZX 1ZHSA 3ORRA 1L1OA 3PO2H 5DQHA 4B3ML 1Q3LA 4RCOA 4DL3A 3NSWA 3GIPA 2HIXA 5C0XI 4A2AA 4YBZB 1BGWA 1PFMA 2JEGA 1EY7A 2UUCQ 3K58A 1CQJB 4DLKA 3I4MG 4YP3A 5KFTA 3RB6A 1O75A 1EOTA 1CKNA 1AZPA 5L1JA 4BBRB 1EYAA 2A68C 1XNRL 4NMZA 2WE6A 3MTSA 1R9TH 1B53A 3BVGA 1HRJA 5KT7A 4OXPA 3NXWA 3JAMW 2AU0A 1I4RA 3K7AB 3N6XA 4UPAA 1S03G 5IT9W 4LFCQ 3A7AB 1LTSD 2EYMA 1YHQA 1N32L 2VPQA 2G5DA 4LF6Q 1ULZA 4YCUA 5GAEC 2JEIA 4YWMA 4R1JA 4LF5Q 5HV6A 3VYUA 1KLGD 2O5IC 5DG8A 5JEAG 4WORA 4A3MH 1B4OA 4X3TA 4H44C 3TS0A 1U9RA 3CPFA 5LL6X 4XQNA 2MFIA 2IX0A 2NBFA 2JA5H 1G91A 1XMOQ 2XWJB 4N8FA 4IHJF 1FNUA 1LTTD 5EQ0A 1E1OA 1VBHA 3DLLA 1JDBB 4L5QA 1IL8A 4YAKB 4WD3A 3BU2A 4XT1B 4DV7Q 5J2TF 5IYBG 4CJ1B 1QILA 3S1RB 1T94A 3MR3A 1LT6D 5DQIA 3MHBA 2QILA 2FKLA 3OSOA 2PW7A 1HA5A 4XDXA 4IRDA 2GN5A 3I4NB 4IZOA 3K5OA 4ECVA 5F9LA 1DGSA 1JOOA 4DV0L 2OT2A 2B2VA 3V05A 4R8NA 5A2QE 2A8VA 1VQ6A 1A62A 1GUTA 1SNMA 1JJ2A 4J9OA 3RB0A 1W6JA 3F2BA 3V96A 1TR5A 2W9BB 3OHBA 1JE4A 4GLXA 3N41B 4RAYA 4RB2C 1FGBD 5HURA 1PXUA 2NU9B 1QUQA 2E2HA 1KRSA 2QDBA 3VA5A 4K6LA 1JQYD 4OX9Q 4A3LG 2A5HA 4C3HG 4NDXA 1X65A 5I9OA 3TQTA 4DV4H 5I9PA 4TVAB 1I5FA 4Y8VB 1LTGD 1BCPB 4DN4M 1VMCA 3L7ZC 1K0RA 1DYQA 1BCPF 2EYOA 4OONA 3HOUH 4KTAA 4O4LF 2R7DA 2EY6A 2IBKA 4DL7A 1GUNA 4K8JA 2KCNA 4DV2L 3I12A 4I4TF 2BQUA 2A6ED 5KNDA 4DR6H 2UUAL 1E4FT 1TS3A 3HP3A 1XX8A 3V6JA 1STHA 5IGBA 1RJPA 1TWHB 5DEHA 2KENA 2X6GA 3RLNA 4LF9Q 5E4WC 5KG4A 4B3TH 2N49A 4RAZA 4IZ8A 2Y0SE 3Q6SA 5KRUA 1JWMD 1H9SA 1VQAA 1X3GA 3N6RA 4HN7A 3WDNA 2R93A 5FPRA 5BN3A 4DUYL 3BYTB 4PG3A 1XWEA 2NZHA 3A0JA 4OWTB 3PIO3 2K5HA 4V190 2OQ0A 3KLWA 4BBRH 2V59A 4ETSA 1HCZA 4CBVA 1BJTA 3Q8RB 2YL2A 2BCOA 3IRBA 4XYOA 2QK4A 3CMEA 4YR2A 1PRTB 2HDMA 1NSNS 2N3SA 2RDGA 3M3YB 4RFBA 1EU4A 4EGQA 3K7AH 5KG2A 1WTXA 1WFQA 4HCEA 4B3RQ 2RCFA 2IMWP 1KHIA 1LT4D 4KHPQ 3V6HA 1PH1A 2SDFA 3J80i 3PO3G 2B8FA 1FD7D 3I90A 3RZOB 4KN4C 3KHGA 2R7KA 1HNZQ 4FF4A 4YQWA 5ISRA 1EWIA 3NE5B 2E2HH 1XPUA 1EQQA 1TWHA 1FVIA 3DUZA 3GP7A 5LMNL 4X66H 4JI0Q 1QCBD 3L4JA 4ECUA 2K6AA 2ICEC 4A3DB 2A68D 1JT8A 1EIGA 1YEZA 4FXKC 4B3SL 1KJQA 1DM0B 1RJRA 5G3LD 4ZYSA 3D0FA 5CBEE 3S14B 1VQDA 3J7ZC 3EROA 5LMUQ 5BR8H 1IBKH 4AYBB 5HBRB 4NXNL 1IL2A 3UQ8A 2EYHA 3HKZG 2FPPB 1LYLA 2AQ4A 4PMBA 4F4YA 5CORA 1U4PA 2NZOA 3TP5A 2JN4A 1CQVA 5E3FA 3I4NH 2KA7A 5KFEA 2A69C 4BY1G 3R5FA 2JEAI 4QUCA 4ZKBB 3S2DB 1KJ8A 1EU3A 2PW5A 2E2JB 5JOBA 1RK5A 3AQQA 2J6UA 1TT2A 2K5NA 4GKKQ 4DL4A 2R93H 1VQGA 1GSHA 2KEDA 1PVOA 2OQKA 1HNWL 3N44B 4OHJA 3ERSX 3CD6A 3QFFA 4ME5A 1TWFB 4HIDA 1P16A 2OF1A 4YY3L 4DR1Q 1VQOA 1OWTA 2WAQA 2I87A 2W7OA 5K2MA 1PYBA 2ALZA 4LUZA 4GS3A 1Q1BA 2K5QA 3FEWX 1VQIA 1H9MA 1UE7A 1ICFB 4K8IA 3UDIA 2ZJPA 1B70B 2B2YC 2XWBB 3ICEA 4RB0A 3ZYYX 1W2BA 5KT3A 4WJ4A 3J81c 3EBEA 5D14A 1FL0A 4JI5L 4AYBA 2DY8A 2YU9A 4YAJB 2EY2A 4C1NK 1WH2A 2V9WA 4CGYB 1EUCB 2CQOA 1CTMA 1BBUA 1C48A 4HAEA 4O3QA 2YCHA 5FD6A 3Q23A 1I4XA 1LTID 3TREA 4JOIC 2VW9A 3G6YA 1TWHH 3GTQA 4FXGC 2KVMA 1O78A 3KLRA 5EBCA 2B63G 3RMHA 3MFHA 2FMCA 3QR8A 4UP7A 1G2SA 4RKLA 4IPHA 1V51A 4JI7Q 4KD4A 2NU6B 5KFDA 4A3KB 1BDOA 1FJGQ 1HH2P 4KHZA 3OTOQ 5JVDF 1HQMC 2ZTEA 3GTJA 1V1PB 1GVPA 2PZUA 3BQ1A 5BPFA 1B3QA 1U5KA 2CH4W 4LMQD 3HOZB 2O5JC 2FP4B 3Q8PB 2UVUA 4X62L 1MJCA 5C3EB 1ML0D 2BDOA 4K0KH 3GTLB 3NPPA 5LYJF 4MN3A 5M3MG 3ULPA 4ME3A 2N8NA 3RZOH 3M9NB 2P0AA 1WTWA 2VQFH 5JPNC 3OWEB 4A4IA 1YZ6A 2R6GA 3TIIA 3EPGA 1S3OA 2W8KA 4N9PA 4RHSA 3MWYW 3BQ0A 2UU9L 2VUMB 1JORA 4A3DH 1SEBD 4DR4Q 4O2BF 2CW7A 2MJ8A 3OIPA 3SHLA 4O1NA 1RCVD 4QW8A 2FXQA 4JI4H 1E3PA 4FDBA 3NTIA 2JEBI 4QY7A 1NNXA 2DY7A 3KBGA 3G48A 2EYJA 4LF7L 5EPJA 1DV1A 2NTTA 4MV3A 3BJYA 3T1HH 4HSVA 3EQLC 1B9MA 4DR3L 4X64H 5KFZA 4O3PA 3ER0A 3R3OA 2CW0C 4GNXA 1D1IA 4JYAH 3GTQH 1C4QA 3WO1A 4ED1A 4O3RA 3GQCA 3S2DH 1SE4A 1PH7A 3J7AV 1JOKA 2QCPX 3D6WA 1N33H 4KY5A 1MIUA 2I07B 2E2JH 1Z2PX 2AGQA 4ZRZA 5L1KA 5IWAH 2RHSB 1VQFA 4DK3C 3NWTA 3FRPB 3P20A 5FOBB 3AEVA 4KHVA 3OMGA 5C44G 4AQYL 3KLSA 3RR5A 4BBSG 2VS1A 3K3PA 3GTJH 1VF7A 1SXTA 5EKIA 2OWOA 4GN3B 1K8OA 1H9KA 1KBLA 2WB1G 5CR3A 1J5EH 2I5MX 4ECSA 2R8IA 2PNRC 1I50B 3A54A 3K0YA 2JA7B 1WTPA 2A69D 4LH6A 2EE1A 3WWVA 1Q12A 1ONLA 2K5DA 2MHVA 3DHQA 4DV5L 3PF4A 1NR4A 4XT3B 3S1QB 5KFFA 1A2TA 2YTVA 4JI8Q 5KFLA 4EBDA 3JZIA 3R2IA 4X65L 1W96A 1FNWA 4ODGA 3BZKA 1BXTA 3OW2A 3M9BA 3MXPA 4ZOLF 5CA1F 5JEAH 4ECWA 1S0MA 2IL8A 3BDLA 4BWSC 3GTPB 2PQAB 5KFMA 1TIID 2AGOA 2J0TD 4B3MH 4MTEA 4MA0A 4JPBW 4QGUA 3NTKA 4A3KH 4QWAA 2W9CB 1GHKA 4YWLA 1NTGA 3SK6A 3QB3A 1VQMA 4EQ5A 1V9PA 1XXGA 3PUYA 3HOXB 1XNQQ 2IW3A 4HMJA 2FK1A 4JI3L 5C3XA 4CDDC 2Q2UA 4I7AA 1UEAB 3HOZH 1N34L 3BQ2A 2O4XA 1XNRH 3PUVA 3OHAA 4FS2A 3NWSA 2JSOA 2XVSA 4DR5L 1I50A 1W93A 5KX5F 5IY0A 4MV6A 3GTLH 2EYLA 1N36L 4QIWB 4DR2L 1A6XA 1SJED 5KG0A 3VR5A 5KT4A 5D8DA 1WYDA 5KFOA 3SGIA 4J9RA 4IUVA 1N32H 1NR2A 5C1OA 4HSPA 4RH6A 3TDQA 3WOFA 2R7ZB 2E5LL 2RGVA 2C28A 2RDFA 4R4QA 2R92B 1LO5D 4J9PA 3MEFA 3CW2C 3SI8A 3B6YA 4RGNA 5DG7A 2VUMH 4FP5D 4RB1A 4DR7Q 1TY0A 3OUZA 2HDLA 4P75A 2PQAA 4BA2I 3GTPA 3EA6A 3RF2A 3TQ1A 4GOPA 4DGZA 1HA6A 1PZKD 3SR1A 4C3HH 1FGUA 2W9CA 3NEMA 2AQ2B 2PPBC 2FE3A 4IR1A 4HYKA 2BH2A 4F87A 2QW7A 1XTCD 2LSSA 3HKZA 2NVQH 3H3VH 1EYZA 3KDFA 1GUSA 5A2QL 4FVMA 2ZXOA 4B9XA 4CHTB 2XD4A 2SEBD 1OXUA 1ZHQA 4C5CA 4FBTA 4LF8Q 1ILQA 4DV0H 3CCEA 1VQ8A 3GV3A 5KFUA 2R92A 1SNDA 2N55A 4RUAA 1MHWC 1IBML 4R4CA 5EOYA 1VQKA 4XYLB 3AU7A 1MJEA 3RZDB 2LMCB 4QIWE 3Q8QB 4L5SA 2F0OA 4ZKCB 4ABNA 1KRTA 2K4KA 5JAVA 5DLGA 4MTDA 1I50H 3GIIA 3T53B 3GTOB 2HGSA 2DLNA 2KECA 2XIWA 1E2ZA 1PLFA 2O2LD 3KFUA 3FMAA 1QVFA 1NUCA 3VYSA 2JP1A 3MFIA 4JV0A 4LFBL 4RGOS 3QIAA 3PO3H 2KJXA 4GKJQ 4DV2H 1UC9A 1V43A 4YCWA 1VQLA 2MO0A 2UUAH 5E4XA 2VQEH 3GTPH 1KJ9A 5JH7F 3BVMA 3G7LA 2ENBA 2PO4A 4WRDA 3CQZA 2LFNA 3P1HA 2B63A 5C0XH 4KI0A 5FK9C 5GAHC 3BG3A 2XGTA 5KFQA 3BYYB 1I4HA 2AMCB 4EEYA 3HOXH 4DUYH 4UCOA 3H94A 4AIMA 1HUMA 1KJJA 5JEAJ 2V4DA 1I6HB 4XX0B 1T9HA 1K28A 1E4GT 1QJOA 3NBHA 3HBLA 1UNNC 3KJOA 1GO3E 2WP8J 1TXYA 1B1ZA 3J81L 4A3JG 3GTOA 3SVMA 1ET6A 1QOHA 4O42A 4BY1H 3A8KE 4Q0FA 2UUCL 1CK1A 2HD3A 2K05A 2F0QA 1UNSA 4IUPA 2R92H 4NP5A 2FFKB 1MI2A 1JXLA 4HNUA 2Y0SG 4PZ8A 2EVBA 1IW7D 5BMVF 5FO7B 1L0WA 3JAME 4RKBA 5LMNH 1WSCA 4J9LA 4X3KA 2F0WA 4H0LC 4HR7B 4CKBA 4FNFA 4DV4Q 1PFSA 5C5MA 3MXGA 2QA4A 2YS7A 4B3SH 3L2PA 4KJOA 2NUCA 3CPWA 2B2TC 2J6SA 4NXNH 1R9TB 4Q0YA 5JVH3 3M7GA 2F0EA 5I6WA 1AUXA 1HR0L 5FO9B 2CQYA 4DR6Q 2VA3A 1I4PA 1HZCA 1MSGA 2PBZA 1YITA 1F77A 4LSXA 1YBYA 2B2UA 4EG0A 3S15H 4DUZL 4O4IF 1RF2D 2C2RA 4PQXA 2RDHA 2B63H 4C56C 4B3TQ 1GYFA 1PYSB 4OO1G 3T5KA 3TZUA 4CDEC 4APVA 1XMQL 2B3GA 2I80A 3UDGA 2BA1A 3HB9A 5FPOA 1ILPA 2RBMA 4KKTA 4DV3L 2KUMA 1SFOB 4HMIA 4A3IB 1HNWH 5M5YH 3F2UA 4YY3H 1F9SA 4QJFA 4R7RA 3RZDH 4A3GG 4BY7B 5IGCA 2VPSA 2JYOA 2F0HA 2R85A 1X6OA 4G4KA 2M2LA 1SE3A 4JI6L 5K36G 4IPCA 4Q44A 4QWCA 2R7NA 4EEQA 1S5DD 3GTOH 3PVXA 3I70A 1K73C 4MA5A 3QZ7A 3ERQA 1Q81C 1XDNA 1AW7A 4JI5H 4WBNF 4RB3C 1SROA 4RU9A 3I73A 4A3BG 4OGQC 2A73B 3TP8A 3JAMc 1PTOC 4ALPA 1K1SA 1L1OB 2UXBL 1JCKB 4MV9A 4OX9L 1ZQ7A 1OO9B 5IT9c 5CA0F 1N56A 2CWAA 1OXTA 4KLKA 4X66Q 2TSSA 5JJIA 3G6VA 2IJ0A 5J22A 2PMZE 5J1ZA 1CKNB 4EQPA 3K5MA 2JA6G 5JUMA 3M85A 2WTFA 4LH7A 2R7MA 2BDNA 1HUNA 5KG1A 1SFOA 5BR8Q 1HZBA 2EZVA 1RIPA 3ITPA 1IBKQ 1RYSA 1E2VA 1I6HH 3PZPA 4J1MA 2B39A 2QF7A 1STBA 1B04A 3H09A 2HUGA 3P7JA 5T1IA 4FF1A 2IY5B 4BWGB 5KFPA 1TS5A 2UVRA 5C0XJ 3OMCA 5KNCA 3HOUB 4B08A 1LV9A 2ZDGA 4X62H 3QZ8A 3GV6A 4NLGA 2YRXA 2X0SA 2F0MA 4XQJA 1PH3A 1T5XD 1TAEA 1DJRD 4BA1I 2QDLA 1L2FA 1R4QB 5IGDA 3FPUB 2DUDA 1Q90A 2Z9HA 1B33N 2PVPA 2V4RA 4ECTA 1JWSD 2KQ3A 2MQHA 4PMWA 1EYDA 1G291 2PNHA 2IA6A 3NBIA 3J7YW 3HG9A 3KHLA 1QVGA 1TWCB 4PZ7A 2UU9H 2H1EA 1PZJD 4KHPL 2SNSA 3D3RA 1Z47A 3HOYB 5CV8A 1S5BD 4KKUA 1WJJA 1B6RA 3P75A 3PIOA 4ED0A 1EYCA 3I4LA 1HNZL 1HJPA 1S5ED 2JQOA 3LGJA 3X3MA 5DG9A 4LF7H 1K8GA 1Y1VG 2BE5C 4C2MB 4MV4A 1DOKA 4DR3H 3MVVA 3V6KA 2V4QA 2N88A 4C3IG 4PNYA 2HT1A 2B2WC 3K8AA 3O13A 2CWPA 1S72A 3CCMA 3LMLA 3LP8A 4QB4A 2HQLA 3ETJA 5C4XG 2R61A 3F2DA 4J9MA 1QUQB 3A56A 2E2HB 4XZ3B 4DXFA 1SFOH 4EBCA 5AFWA 5KYLA 4A3IH 3QOLA 1IYUA 1CZWA 4I65A 4AQYH 2LS01 4BY7H 3CU7A 5D65A 1TWCA 2K7VA 3T4AC 1Z2NX 4UCRA 2R87A 4JV5L 5COYA 5KG6A 2KEEA 3EVQA 2NB0A 4KK7A 4GKKL 1YNNC 1EEID 4K0KQ 1BQQT 2HJWA 1DD2A 3PCOB 4C1NI 1SLJA 2FINB 2R8JA 4C2MA 4DV5H 4IPDA 3CC4A 5IYDG 1K83B 1PFBA 1HTPA 3RN2A 4X65H 1RTNA 1PH9A 3R2TA 1H9SB 4B9WA 2R93B 2F0IA 3U4ZA 3H0GG 3C0FB 4JUZA 3GTGB 1M0TA 4JI4Q 3FPPA 3ETHA 2EJMA 2NYZD 1Z2OX 1CA6A 4RWSC 4OWXB 1WD1A 4OIKA 4I7ZC 1D1KA 3OUUA 2BR0A 3EYYA 3DEPA 1IBLL 4JI3H 4X64Q 1N34H 3GV5B 2NVXA 1SDFA 4JYAQ 5FD5A 1VBGA 3SE7A 1PTOD 2GPWA 2MO1A 4ME6A 3LWUA 5HGQA 4UY8C 4HJ5A 3G6XA 1N33Q 4DR5H 1S97A 2ES2A 1N36H 4DR2H 3I7FA 4ZUJA 1JJGA 1UE1A 5GONF 1H9RA 5KFSA 5IYZF 1FR3A 1JWUD 2MPMA 5IWAQ 4Q8FA 2HVRA 4UCUA 4GLAC 5T1GA 1K83A 2E5LH 4DAPA 3PQIA 4XYMB 2PI2A 5EGTA 3I55A 1TWCH 2Y0SA 1HFNA 1D6EC 3CVZA 4DL2A 2B29A 2J6TA 3ZJYC 2R7FA 3HOYH 5FLXL 1EY6A 1EY8A 1J5EQ 2UUBL 4L5RC 3GTGA 3J81j 3DWQA 1HQRD 5M5XB 3NHHA 1AP0A 4HJ8A 3HOVG 5CB4F 1I6VC 1PRTF 4C2MH 4A3EB 3IFTA 4HIKA 1LTBD 3RB4A 2R82A 5LL6S 3K81C 3Q1KA 2FLNA 1QVCA 1X3QA 3MFYA 4DR4L 4M7EA 1AZQA 1M0WA 1S0NA 4JW0A 4EFBA 3I8ZA 2WACA 2JA8G 1BO0A 4P74A 1LM0A 3M4QA 4J6HA 2W6QA 5KFKA 2WAQB 3RV3A 2ZJRA 1BCPC 4B3MQ 3FKIG 5ELBA 3HOWG 4ED2A 2KCMA 2EYPA 2W6OA 1HZAA 3DM3A 1U4MA 1IBMH 4FO2A 1I4GA 2QYZA 1X3FA 2DIKA 4KY7A 1I94L 4JG2A 2NVXH 2YU9B 3GIMA 1KLUD 1EZ8A 1XNRQ 2EY1A 2BE5D 5ELDA 2E8GA 4U7CA 4A93B 2ZTCA 1EQRA 4APMA 3FHWA 2PN1A 3J80W 1Q86C 2ZTDA 3NUCA 3RD4A 3GTQB 1VAJA 3M4OB 1N32Q 1K83H 3AYHB 4TQUS 1ZKOA 3K5IA 4LFBH 1LTLA 3K59A 2WYOA 4DL6A 4J15A 2UXCL 2WFWA 5C4HA 1VF5C 5IP9G 4QUFA 1TA8A 2C35B 1S10A 1GLVA 2RKSA 4KV6A 4R4TA 5IYCG 1WCMG 5EBDA 5GADC 3GTGH 3I4MB 3HEJA 3GTJB 3K5HA 2K04A 4AH6A 1V4YA 5AJ3L 2D2CC 3AFQA 2AWOA 3U9SA 1A0IA 4R9WA 3CCJA 1YNND 5CV4A 2W7PA 1PHJA 4HJ7A 2X69A 1EY0A 5DAUA 2F3IA 2B2YA 3URYA 1YNJC 3W5OA 2WAQE 1WD0A 1C8CA 4DFAA 1I7LA 1JR0D 2UUCH 1BVSA 2KHIA 4MTKA 3OPOA 3VR2A 5CBAE 4DV0Q 5HGTA 1TWGB 2UVWA 3VR3A 4OO1H 4JOIA 4NPSA 4CJ2C 1Q1EA 1Q8IA 5IT9L 4AYBE 1X54A 4ZQ3A 2F0NA 3V2TA 3CAMA 3K57A 1NBWA 1IZ6A 2GPSA 2NZ1D 5FJ8H 4QCLA 3KHHA 3LWBA 5K36H 5JJKA 1M7JA 1AUVA 5M5XH 3RGZA 4HNTA 3CHBD 1DIKA 1VQ7A 4GNXB 3CCQA 4I55F 3KK7A 3S1MB 4A3EH 4LW1A 2PQEA 1ENAA 4EX5A 5KFAA 1HR0H 1B8AA 4LF4L 4A3BH 1Y1VA 1CFMA 4RMFA 4DV2Q 1IOVA 5KFYA 4OL7A 2HHHL 1F2MA 2UUAQ 3IAYA 3S17B 2VQEQ 4P72A 3V4SA 5EKKA 3H20A 4DUZH 4CJ0B 2E2IA 5I6YA 1GHJA 1EZ6A 3J81i 1JMCA 4FM9A 2C2EA 2XSCA 1TWGA 3BG5A 1M1KC 2QEJC 1XMQH 1AFPA 2JXMB 4C5BA 3CCLA 2XC9A 4DV3H 2VB2X 4DUYQ 2RHQB 3NENA 2VA2A 1CUKA 5J39A 4FYDA 1CKOA 2YU9H 4C3HB 1IYVA 5C5LA 3T56B 4A93H 1ZETA 3KJPA 2CHBD 2TMPA 5D1OA 4JI6H 2L55A 2F0SA 1PH8A 1BR9A 4OIJA 4CDCC 3RJ0A 1X3EA 3I56A 1Q82C 2NVQB 4F4WA 2UXDL 5EDWA 3PSIA 2ZJQA 1KC7A 3M4OH 4LK1C 4XXEA 1DV2A 4M1UB 1JB7A 2JA9A 1XJVA 2K50A 2CQAA 1BCPD 3CRKC 1PMRA 1UC8A 2UXBH 2VL6A 4DV1L 1DZ1A 2ZXPA 1DOMA 3Q0AA 1DCZA 4IRKA 3AFPA 2NU8B 5LMNQ 1E22A 1HNXQ 2ASLA 1VQCA 5ELEA 3I4MH 3E3XA 2DJFC 2NN6G 3FDTA 4Q8EA 2R3ZA 4H13C 5FLMG 3SK4A 4I7HA 4NXML 3HZXA 2D0OA 3A7LA 3QJYA 1QNKA 4B3SQ 1PK8A 3H0GA 5L37A 2DNEA 4GKJL 4LMYA 4IN3A 4EFEA 2K5VA 3A5ZB 3CMAA 4NXNQ 2V58A 2EQSA 4WJ3M 4DV6L 2F4VH 1L2ZA 2EDGA 1XPOA 1Y1VH 1RJTA 3MWDA 4ED6A 3KYHC 3I72A 1KABA 1MD2D 3PO2G 2C2DA 3G4SA 4C3IH 2MGSA 4QW9A 2HQEA 3X3NA 3PO3B 4RCNA 1F9PA 3F2CA 1PRTD 1TWGH 2K33A 2NWGA 3CC2A 1O7IA 2KOLA 4U68A 5JVLA 1SNCA 4LJZC 3S16B 3R5XA 2VB3X 2F0LA 4DK0A 2A1AA 4GOPB 4PWQA 1T5EA 3L0OA 4YHHQ 4YY3Q 1OXVA 2XRQD 2EY5A 1IW7C 3GD7A 1U4LA 4E4TA 3JRXA 4MTNA 2Z8LA 3DMUA 1AH9A 3H4DA 2EXDA 4KHPH 3KHRA 3HKZB 5IYBH 5GAGC 1LT5D 1YNJD 2K14A 2R6FA 3N40P 3S1MH 3KDFB 4CC6A 1BBWA 2ICIA 4PDBA 4JI5Q 2J7ZA 3RUPA 1HNZH 2R8KA 1TS2A 4A3MG 2CCZA 3QOJA 1CT1D 3PUWA 4DAYB 2I5HA 2I8CA 4BY1B 2JA5G 3MC0B 3VMMA 5IYDH 1CQIB 1S4ZA 1SBBB 4JI2L 5DQGA 4RGMA 3VYRA 2CW8A 2FMMA 1VQ5A 4RHRA 1LABA 4OO1I 3NQTA 4C3JG 4GZYC 3WNZA 3RUZA 2YTXA 4CC5A 3H0GH 5DM63 3H40A 4NB3A 1STNA 4DK6C 1CSPA 3U9OA 1F9QA 3Q24A 2AQ3B 2W6NA 4X3SA 4QWDA 3KTMA 4A3LH 1RD9D 4TV9F 4S3SA 4KN7C 3NP8A 3H6MA 1Q46A 4JI1L 4JV5H 5I2XA 2DWCA 1EFWA 1YVCA 1B9NA 3T13A 5JVG3 3T1YL 1C9OA 4K14A 4FXDA 2WIIB 4GKKH 2F4IA 4X62Q 2VXWA 2OCEA 3J7AF 2FLLA 3IL8A 1VQJA 3U9TA 1N48A 5ELNA 3U4VA 1VKZA 2KHSA 2YZMA 3S15B 3F8TA 2R84A 4DAYA 1B44D 4L8JA 1KC8C 3JSLA 3CQZB 2B63B 3S1NB 4LUOA 4R8UA 1T36A 1V1OA 4U673 3HKZE 1NMGA 3DWAA 1RK6A 2VUGA 4IWXA 1X3PA 2UU9Q 3BDCA 1XPRA 2LXKA 4DK1A 5M5YB 3SDZA 1ESFA 1ASYA 1PYWD 3T16A 2V5AA 1KJIA 3PN1A 1WCMA 3OHXC 4IOCA 3NBHB 1JJCB 1EL0A 1D2BA 2HVQA 2YS6A 3RBEA 3A5UA 1CE8A 4F88A 4LF7Q 1AE3A 3K7UC 4YJ3F 4RA8A 2IWHA 3ORQA 1IBLH 2RCNA 1WTQA 4UAIA 2V1CC 1CA5A 4LFAL 1W6KA 2ZM6L 1BBXC 2EIFA 2JEJA 5KYIA 3LWEA 4TV8F 1CSQA 3EJIA 4DAVA 1I4QA 2IHFA 5M3MB 4NKLA 4UP9A 3I3CA 3LX0A 4EQOA 5EWEA 3S16H 5EWFA 3RTXA 2F0FA 5L9XA 4BBRG 1GJXA 4F4ZA 3GV8B 4OWWB 4ZLTF 3IG0A 3MFGA 3A74A 1W3SA 2Z0SA 4AQYQ 2KSWA 5C3WA 3VDYA 3SE0A 4GLVB 4ECZA 1DONA 2OLSA 1SE2A 5C5JA 1UE6A 4GN5A 2UUBH 3BA8A 1NAPA 5GQOA 5F9NA 2RA4A 3MXNB 4IFDG 3RNUA 1JE5A 3UFXB 4JV1A 1SE8A 4HTHA 2XIGA 5NUCA 5IP7G 3KF6B 5LXTF 2PZWA 2QEXA 4TQRA 4ED8A 1U0LA 4DV5Q 4R4IA 3MJFA 2FLPA 2GVBA 1GOZA 3HFZB 3LNNA 4P71A 4F50A 4X65Q 2L11A 3TQYA 1XYIA 3T5LA 5KFHA 4DR4H 4A76A 1CQFA 4H02A 2C00A 1GKHA 1AN7A 5KT6A 2EXZA 3K5LA 3BAAA 2C9OA 3RGXA 3OYYA 1SSOA 5C44B 1PH5A 4LNQA 1J9OA 1WCMH 2M9VA 5HY6A 2JK8A 2VNUD 4BBSB 3HS0C 1B2TA 5KT2A 2BQRA 4LFCL 2JJQA 4LF6L 3I4NG 1I6UA 2WB1B 4LF5L 4Q45A 4RNOA 3BVZA 5ELFA 4L63B 3VR6A 4YR0A 1I94H 2F0TA 1VQNA 1N34Q 3VPDA 4GC6A 4P2CB 3PIP3 2SCUB 3MXNA 1AEXA 1SMYC 4DR5Q 2B2TA 3FVQA 2SOBA 1XMOL 1M90C 1GM5A 4DR2Q 1CKMA 5D1PA 4TSSA 4V0BA 3KF6A 4KD3A 1BKBA 1KDAA 1WI5A 4WJWA 1SYFA 3CQZH 1I3QA 1PTOB 1A3TA 2ZT9C 3S1NH 2F0JA 2E5LQ 4YIJA 5C4ZA 4DV7L 2UXCH 2BH8A 1VQ9A 3PW5A 2EYFA 4G7OC 1D5ZC 1O7ZA 2F0GA 4DNRB 3GTKA 4MV7A 2Z6KC 4K6DA 1TQOA 3SEBA 2E75C 1KDCA 2G9HD 4FU0A 2H4OA 2OTLA 1EQVA 1S0OA 3G71A 3PMFA 1FKAH 1VQPA 2WB1A 2R86A 2BQ3A 1STAA 5KEEA 4O4HF 2YV5A 1H9JA 3ULJA 4A3CG 5FLXW 1YI2A 1UEBA 4U6PA 5M3MH 3Q8SB 5M9OA 3K0XA 5DGAA 2YYZA 2FJZA 3DF7A 1SYCA 3H91A 1C0AA 2DN8A 1EY4A 5L1LA 1SYGA 1TS4A 3OOCA 3S9WA 5KNBA 3TP6A 1HXYD 1IBMQ 2I0QA 2Q2IA 2WKCA 2Z1CA 5CYUA 1EHIA 2L1BA 2XNAC 2LY7A 3TBIB 2Q2HA 3FDSA 1RL2A 3TEHB 5LMNW 3MWMA 3CCUA 1AN8A 4RGTA 5IWAL 2KCCA 5IODA 3TN2A 3NGDA 4LF9L 1F2LA 1N9WA 1PX2A 1C7YA 3PR5B 1Y1WG 5G3LF 3RN5A 4CDFC 1K9MC 5EKLA 4UP8A 1TKWB 2PYKA 4YWKA 1I3QH 2XCLA 3S24A 2W8LA 4LFBQ 1MGSA 3D4RA 4A3DG 4LF4H 2Q8TA 2JA5A 3ULLA 2HHHH 4IAJA 3GTKH 2N78A 4AYBG 4IUTA
chains in the Genus database with same CATH topology
2JA8G 3S2DH 4P74A 2VY3A 5C44H 1PH7A 3TRZA 4XTCS 5H1SE 1LM0A 3I4OA 3M4QA 1MIUA 2E2JH 3E9IA 3S1QH 4BBSH 4A75A 2ZJRA 4NXMQ 4B3MQ 4B3RL 3FKIG 2RHSB 1VQFA 3HOWG 2KCMA 4DK3C 3AEVA 3JAMi 1VQEA 5E7NA 1QZGA 1HZAA 1L1OC 3DM3A 2ALYB 4DV6Q 5C44G 4AQYL 3U58A 2AKWB 3CXCA 3RR5A 1X3FA 4BBSG 2VS1A 3GTJH 2OWOA 1I94L 4JG2A 2NVXH 4GN3B 4Y52H 4QL5A 1XNRQ 2E8GA 2WB1G 2ZTCA 5FLXc 3KF8B 4DAMA 4JI0L 1YNXA 1EQRA 2I5MX 3FHWA 2OTJA 5IP9H 1OXXK 2KBNA 1Q86C 5IE8A 2ZTDA 2GVAA 3W1BA 3WWVA 5LMUL 1N32Q 2AHOB 1Q12A 1K83H 3AYHB 4TQUS 5IYCH 4DV5L 1YJWA 3PUZA 2VZAA 3PF5A 1LTLA 3PF4A 2YTVA 4JI8Q 4J15A 2UXCL 2WFWA 4X65L 5IP9G 1EOVA 2C35B 3BZKA 4JC0A 3M9BA 3OW2A 4POFA 4POGA 1SN8A 4JI3Q 4R4TA 3PV0A 2F52A 5IYCG 1WCMG 2CKZB 2PQAB 3RLFA 5GADC 2R7ZH 3GTGH 1YHAA 4AH6A 1OTCA 5AJ3L 3EN2A 3AFQA 4QGUA 4A3KH 2AWOA 2R93G 1A0IA 3CCJA 1N36Q 4YWLA 1NTGA 2I5LX 1VQMA 1XNQQ 4EQ5A 1V9PA 1PHJA 3PUYA 4HJ7A 2H5XA 1HR0Q 2F3IA 4JI3L 4DR1L 2Q2UA 4JI2Q 3W5OA 1N34L 3HOZH 3K80C 1Y14B 3H15A 2VQFQ 3PUVA 4A3KG 4DUZQ 2WAQE 2ATWA 4O2DA 4DR5L 4DPGA 4PZ6A 1GD7A 4C3JH 5IY0A 3GTLH 3UE1A 1N36L 3BZCA 1BVSA 2KHIA 4DR2L 4DV0Q 3G6EA 4K0KL 1EUJA 1NJIC 2IX1A 1X56A 1XMQQ 3HOZG 1WYDA 1YIJA 3SGIA 4JOIA 1SR3A 4NPSA 4DV3Q 1Q1EA 2CFMA 1NMFA 4AYBE 1PH6A 2E5LL 1X54A 4R4QA 5C3EG 2VQFL 2Z6KA 3MEFA 3CAMA 3CW2C 4JI1Q 3B6YA 1NBWA 1IZ6A 4QQBX 4HIMA 2VUMH 1G51A 5FJ8H 4JI6Q 1IXRA 4DR7Q 4P75A 3T1HQ 2PQAA 4BA2I 3T1YQ 5M3FH 4RG1A 5JJKA 5M5XH 4GOPA 4BXXH 2A19A 1VQ7A 4C3HH 4GNXB 1FGUA 3STBC 3CCQA 2ID0A 4JI4L 3NEMA 4A3EH 4LW1A 3HKSA 1LUZA 3E9HA 4IJLA 4JI7L 4X6AH 5JJLA 2VUMG 5FJ8G 1FJGL 4EX5A 2BH2A 3OTOL 1PA6A 4JBKA 1B8AA 2LSSA 2WB1E 3KOJA 3T1HL 3J80c 4LF4L 1IYJB 5M5WH 2NVQH 4RMFA 4X64L 3KDFA 4DV2Q 4A3BH 2UXBQ 2HHHL 1V1QA 2UUAQ 3S17H 2VQEQ 4P72A 3H3VI 4JYAL 3F1ZA 4A3EG 1OXUA 3J81i 4LF8Q 1N33L 1JMCA 1X55A 3GO5A 3CCEA 1VQ8A 1M1KC 3CCLA 4L5TA 4DUYQ 2VQEL 2RHQB 3NENA 2F4VQ 1CUKA 2WAQG 1IBML 1A63A 1CKOA 4R4CA 2YU9H 1VQKA 1E1TA 4LFAQ 2ZM6Q 4A93H 1MJEA 2PI2E 3KJPA 4QIWE 2NVYH 4L5SA 1PH8A 1KRTA 2K4KA 3RLOA 1I50H 1J5EL 1X3EA 3I56A 1Q82C 2UXDL 4IPGA 3PSIA 2K75A 2ZJQA 2F4VL 3M4OH 4DNIA 3NELA 2L15A 3KFUA 4A93G 1QVFA 4GN4B 2XTIA 4A3FG 1JB7A 1P8LA 2JA9A 3CCSA 1XJVA 2K50A 5GROA 4JCVE 5FLMH 1S40A 4LFBL 3PO3H 4GKJQ 2VL6A 2NN6I 3I2ZA 4DV1L 2JA7G 3TS2A 3E0EA 1V43A 4YCWA 1VQLA 2MO0A 1EIFA 1K8AC 3EIVA 3AFPA 3GTPH 5LMNQ 1E22A 1HNXQ 1VQCA 3I4MH 2NN6G 4IOAA 4R4OA 2HIVA 2DGYA 5FLMG 4JBWA 1L1OA 3PO2H 4NXML 4KI0A 2MNAA 2D0OA 5GAHC 1QZHA 4B3ML 2XGTA 4B3SQ 1KQSA 3M7NA 3S2HH 4GKJL 2HIXA 4LUVA 5C0XI 2K5VA 2AMCB 4A3JH 3A5ZB 5IP7H 3HOXH 3CMAA 2UUCQ 2EQSA 4NXNQ 4WJ3M 4DV6L 3I4MG 4AIMA 1XPOA 5JEAJ 1D8LA 1Y1VH 1HNXL 1T9HA 2IT1A 5C0XG 3KYHC 3CCVA 1CKNA 3PO2G 1KXLA 3G4SA 3KJOA 4C3IH 1GO3E 1XNRL 2WP8J 1TXYA 4A3JG 1R9TH 3HOXG 3GTMH 3F2CA 1MKHA 4OXPA 4BY1H 2UUCL 1TWGH 5DLQE 3CC2A 1O7IA 3S1RH 4UPAA 1PH2A 2NVTH 4LFCQ 1YHQA 3U50C 1N32L 4LF6Q 2R92H 4YCUA 5GAEC 1PV4A 4YWMA 4R1JA 2A1AA 3BJUA 4GOPB 4LF5Q 4JI8L 2Y0SG 1VQBA 3L0OA 4YHHQ 4PZ8A 4YY3Q 4P73A 1OXVA 5JEAG 3GD7A 4A3MH 1L0WA 1OXSC 4JV5Q 4MTNA 3TS0A 3CPFA 4MZ9A 3GDEA 1AH9A 3D31A 2EXDA 2R7ZG 3UDFA 2R92G 2MFIA 2IX0A 2JA5H 5IYBH 1XMOQ 5GAGC 2K14A 3S1MH 3KDFB 1Z9FA 1BBWA 1PFSA 4DV4Q 1E1OA 2QA4A 2BA0A 4O0AA 3L2PA 4YHHL 4HIOA 3DLLA 4JI5Q 2CCZA 4A3MG 3CPWA 4L5QA 1VS0A 3PUWA 4DAYB 2I5HA 3BU2A 1XNQL 4DV7Q 1HR0L 2JA5G 1WOCA 5IYBG 1Q8KA 1KL9A 5IYDH 4DR6Q 4JI2L 1HZCA 1YITA 1VQ5A 1YBYA 4OO1I 3S15H 4DUZL 1YJ9A 2GN5A 2B63H 4B3TQ 4A3GH 1DGSA 2YTXA 4DV0L 1PYSB 1A8VA 3H0GH 4OO1G 4NB3A 4APVA 4DK6C 1UE5A 1CSPA 2B3GA 3UDGA 1XMQL 2BA1A 1EIYB 2A8VA 1VQ6A 1G6PA 1A62A 4DV3L 1UWVA 4HJAA 1JJ2A 4A3LH 1TWAH 3STBD 3F2BA 5M5YH 4A3CH 1IBLQ 4QJFA 4GLXA 1Q46A 4JI1L 3RZDH 4A3GG 1QUQA 1KRSA 1X6OA 5M3FG 1EFWA 3M4PA 4JI6L 4DR7L 1YVCA 4IPCA 5K36G 3T1YL 4BXXG 3GTOH 1C9OA 4OX9Q 1K73C 4X62Q 2OCEA 4A3LG 1X65A 1Q81C 1VQJA 4TVAB 1I5FA 1NE3A 5ELNA 3U4VA 3F8TA 2Q2TA 1KD1C 1SROA 3L7ZC 1K0RA 3M3YH 4OONA 3CP0A 1KC8C 3HOUH 4A3BG 3JAMc 4ALPA 2R7DA 2JA6H 1L1OB 4LUOA 2UXBL 4DV2L 4OX9L 3J7A5 5IT9c 2UUAL 3HKZE 1NMGA 2CWAA 1OXTA 4KLKA 4JBJA 2UU9Q 1XPRA 3RLNA 2KENA 1YJNA 2LXKA 3Q8DA 4X66Q 1K9MC 2UUBQ 4LF8L 5JJIA 4LF9Q 1ASYA 1ASZA 2N49A 2PMZE 2JA6G 1CKNB 3H3VH 4IOCA 2Y0SE 3NBHB 3M85A 4JBMA 2YTYA 1JJCB 1VQAA 1X3GA 1Y1WH 5BR8Q 1HZBA 3A5UA 1RIPA 1N8RC 1IBKQ 4LF7Q 1AE3A 3W1GA 3K7UC 4PG3A 3CC7A 4DUYL 1VQHA 2NZHA 3A0JA 1I6HH 4OWTB 1H95A 2K5HA 2RCNA 2OQ0A 2V1CC 3KLWA 4BBRH 4LFAL 2IY5B 2ZM6L 2EIFA 3IRBA 1CSQA 3S14H 1X9NA 2IHFA 5C0XJ 3CMEA 2N3SA 2D0PA 4IFDJ 4UP9A 4GNXC 3K7AH 1WFQA 3S16H 1PH3A 4B3RQ 1KIXA 4BBRG 4BA1I 5J3BA 1KHIA 1L2FA 4OWWB 4KHPQ 1PH1A 2DUDA 3J80i 3A74A 3PO3G 1J6QA 1W3SA 2MQHA 2Z0SA 4PMWA 4AQYQ 3VDYA 1HNZQ 1G291 2PNHA 4GLVB 1AE2A 3PGZA 1I94Q 4IFDI 1EWIA 1UE6A 3UDXA 1EQQA 1QVGA 2E2HH 1FVIA 4GN5A 4PZ7A 1XPUA 3CF5A 5LMNL 2KCTA 4Y7NH 4JI0Q 4KHPL 1Z47A 5GQOA 3MXNB 4IFDG 3RNUA 1JE5A 1TWFH 1WJJA 1JT8A 3PIOA 1SE8A 1YEZA 5ELOA 2E2IH 4B3SL 5IP7G 1HNZL 1HJPA 2JQOA 3D0FA 3KF6B 1VQDA 1SRUA 3LGJA 4YCVA 3J7ZC 2QEXA 5LMUQ 1PH4A 1U0LA 4NXNL 4DV5Q 3HKZG 4R4IA 1K8GA 1HR0W 1Y1VG 2GVBA 2KHJA 1IL2A 3HFZB 5C4XH 1LYLA 2UXCQ 1XTDA 4P71A 4X65Q 3TQYA 1E7ZA 2NZOA 4A76A 2LXJA 2HT1A 3K8AA 4H02A 1S72A 2CWPA 1GKHA 3I4NH 1HNWQ 3CCMA 4BY1G 1Q7YC 2JEAI 2HQLA 5C4XG 3OYYA 3F2DA 2VNUD 1PH5A 4LNQA 1WCMH 5HY6A 4HJ9A 1K3RA 2JK8A 1NY4A 1QUQB 5AJ3Q 3AQQA 1KAWA 2JA8H 4LFCL 2K5NA 1SFOH 2JJQA 4GKKQ 4A3IH 2ASBA 2R93H 4LF6L 1VQGA 3I4NG 1PVOA 2OQKA 4LF5L 1HNWL 3ERSX 3CD6A 4BY7H 4HIDA 1P16A 4YY3L 1VQOA 4DR1Q 2K52A 3CCRA 1VQNA 1N34Q 1PYBA 4JV5L 4LUZA 4GS3A 1Q1BA 3UDIA 1VQIA 1VQ4A 1UE7A 4A3IG 2ZJPA 4DR5Q 1B70B 4DKAC 1GM5A 1XMOL 3ICEA 1M90C 4GKKL 4DR2Q 2JE6I 1CKMA 1W2BA 4DV4L 4BY7G 4K0KQ 3KF6A 4WJ4A 3J81c 3EBEA 4JI5L 1BKBA 1B7YB 1FL0A 3PCOB 1WI5A 1SLJA 3CQZH 3S1NH 2CQOA 4IPDA 1BBUA 2E5LQ 3CC4A 5IYDG 4DV7L 3RN2A 2BH8A 4MNOA 2IHEA 1VQ9A 5C3EH 4DR6L 3TREA 4JOIC 2VW9A 1PH9A 1TWHH 2Z6KC 1E24A 2B63G 3U4ZA 1EYGA 3H0GG 4B3TL 2OTLA 4UP7A 4JI4Q 4IPHA 3G71A 4JI7Q 4GOPC 1VQPA 4IJHA 4OWXB 2YV5A 3ULJA 1FJGQ 1SMXA 1HH2P 4KHZA 3OTOQ 4A3CG 3PIPA 3UE0A 1YI2A 4LF4Q 1IBLL 1UEBA 4X64Q 2ZTEA 2HHHQ 5M3MH 1GVPA 3K0XA 4JYAQ 2YYZA 1U5KA 2MO1A 1HZ9A 1C0AA 2QGQA 5HGQA 4HJ5A 4UY8C 4X62L 1MJCA 1N33Q 2ES2A 3I7FA 1JJGA 5C4JH 1UE1A 5IWAQ 4IO9A 2AWNA 1YHBA 5M3MG 3JC66 3ULPA 4GLAC 2N8NA 4ME3A 3HOUG 3RZOH 1IBMQ 2I0QA 2Q2IA 2PI2A 5EAYA 4A4IA 3I55A 1TWCH 1YZ6A 2Q2HA 2R6GA 3HOVH 1RL2A 3TEHB 4XIGS 5LMNW 1S3OA 3CCUA 2B29A 2RF4A 3ZJYC 2R7FA 5IWAL 4DR3Q 2UU9L 3HOYH 4X66L 2UUBL 1D7QA 1J5EQ 3PUXA 4L5RC 4DR4Q 4A3DH 4LF9L 3J81j 1N9WA 2UXDQ 1C7YA 2FXQA 4HJ8A 1Y1WG 1E3PA 4FDBA 3RN5A 3HOVG 2JEBI 4QY7A 4UP8A 1VCIA 4YWKA 2D62A 1I3QH 3FP9A 4C2MH 3S24A 5BR8L 3G48A 1IBKL 4LF7L 4HIKA 3HOYG 4A3FH 4LFBQ 4A3DG 4DR3L 3K81C 3FKIH 4DV1Q 3HOWH 1QVCA 3ULLA 3ER0A 4GNXA 4DR4L 2JA7H 4LWCA 3GTKH 2N78A 4AYBG 3GTQH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JA8 G;  3S2D H;  4P74 A;  2VY3 A;  5C44 H;  1PH7 A;  3TRZ A;  4XTC S;  5H1S E;  1LM0 A;  3I4O A;  3M4Q A;  1MIU A;  2E2J H;  3E9I A;  3S1Q H;  4BBS H;  4A75 A;  2ZJR A;  4NXM Q;  4B3M Q;  4B3R L;  3FKI G;  2RHS B;  1VQF A;  3HOW G;  2KCM A;  4DK3 C;  3AEV A;  3JAM i;  1VQE A;  5E7N A;  1QZG A;  1HZA A;  1L1O C;  3DM3 A;  2ALY B;  4DV6 Q;  5C44 G;  4AQY L;  3U58 A;  2AKW B;  3CXC A;  3RR5 A;  1X3F A;  4BBS G;  2VS1 A;  3GTJ H;  2OWO A;  1I94 L;  4JG2 A;  2NVX H;  4GN3 B;  4Y52 H;  4QL5 A;  1XNR Q;  2E8G A;  2WB1 G;  2ZTC A;  5FLX c;  3KF8 B;  4DAM A;  4JI0 L;  1YNX A;  1EQR A;  2I5M X;  3FHW A;  2OTJ A;  5IP9 H;  1OXX K;  2KBN A;  1Q86 C;  5IE8 A;  2ZTD A;  2GVA A;  3W1B A;  3WWV A;  5LMU L;  1N32 Q;  2AHO B;  1Q12 A;  1K83 H;  3AYH B;  4TQU S;  5IYC H;  4DV5 L;  1YJW A;  3PUZ A;  2VZA A;  3PF5 A;  1LTL A;  3PF4 A;  2YTV A;  4JI8 Q;  4J15 A;  2UXC L;  2WFW A;  4X65 L;  5IP9 G;  1EOV A;  2C35 B;  3BZK A;  4JC0 A;  3M9B A;  3OW2 A;  4POF A;  4POG A;  1SN8 A;  4JI3 Q;  4R4T A;  3PV0 A;  2F52 A;  5IYC G;  1WCM G;  2CKZ B;  2PQA B;  3RLF A;  5GAD C;  2R7Z H;  3GTG H;  1YHA A;  4AH6 A;  1OTC A;  5AJ3 L;  3EN2 A;  3AFQ A;  4QGU A;  4A3K H;  2AWO A;  2R93 G;  1A0I A;  3CCJ A;  1N36 Q;  4YWL A;  1NTG A;  2I5L X;  1VQM A;  1XNQ Q;  4EQ5 A;  1V9P A;  1PHJ A;  3PUY A;  4HJ7 A;  2H5X A;  1HR0 Q;  2F3I A;  4JI3 L;  4DR1 L;  2Q2U A;  4JI2 Q;  3W5O A;  1N34 L;  3HOZ H;  3K80 C;  1Y14 B;  3H15 A;  2VQF Q;  3PUV A;  4A3K G;  4DUZ Q;  2WAQ E;  2ATW A;  4O2D A;  4DR5 L;  4DPG A;  4PZ6 A;  1GD7 A;  4C3J H;  5IY0 A;  3GTL H;  3UE1 A;  1N36 L;  3BZC A;  1BVS A;  2KHI A;  4DR2 L;  4DV0 Q;  3G6E A;  4K0K L;  1EUJ A;  1NJI C;  2IX1 A;  1X56 A;  1XMQ Q;  3HOZ G;  1WYD A;  1YIJ A;  3SGI A;  4JOI A;  1SR3 A;  4NPS A;  4DV3 Q;  1Q1E A;  2CFM A;  1NMF A;  4AYB E;  1PH6 A;  2E5L L;  1X54 A;  4R4Q A;  5C3E G;  2VQF L;  2Z6K A;  3MEF A;  3CAM A;  3CW2 C;  4JI1 Q;  3B6Y A;  1NBW A;  1IZ6 A;  4QQB X;  4HIM A;  2VUM H;  1G51 A;  5FJ8 H;  4JI6 Q;  1IXR A;  4DR7 Q;  4P75 A;  3T1H Q;  2PQA A;  4BA2 I;  3T1Y Q;  5M3F H;  4RG1 A;  5JJK A;  5M5X H;  4GOP A;  4BXX H;  2A19 A;  1VQ7 A;  4C3H H;  4GNX B;  1FGU A;  3STB C;  3CCQ A;  2ID0 A;  4JI4 L;  3NEM A;  4A3E H;  4LW1 A;  3HKS A;  1LUZ A;  3E9H A;  4IJL A;  4JI7 L;  4X6A H;  5JJL A;  2VUM G;  5FJ8 G;  1FJG L;  4EX5 A;  2BH2 A;  3OTO L;  1PA6 A;  4JBK A;  1B8A A;  2LSS A;  2WB1 E;  3KOJ A;  3T1H L;  3J80 c;  4LF4 L;  1IYJ B;  5M5W H;  2NVQ H;  4RMF A;  4X64 L;  3KDF A;  4DV2 Q;  4A3B H;  2UXB Q;  2HHH L;  1V1Q A;  2UUA Q;  3S17 H;  2VQE Q;  4P72 A;  3H3V I;  4JYA L;  3F1Z A;  4A3E G;  1OXU A;  3J81 i;  4LF8 Q;  1N33 L;  1JMC A;  1X55 A;  3GO5 A;  3CCE A;  1VQ8 A;  1M1K C;  3CCL A;  4L5T A;  4DUY Q;  2VQE L;  2RHQ B;  3NEN A;  2F4V Q;  1CUK A;  2WAQ G;  1IBM L;  1A63 A;  1CKO A;  4R4C A;  2YU9 H;  1VQK A;  1E1T A;  4LFA Q;  2ZM6 Q;  4A93 H;  1MJE A;  2PI2 E;  3KJP A;  4QIW E;  2NVY H;  4L5S A;  1PH8 A;  1KRT A;  2K4K A;  3RLO A;  1I50 H;  1J5E L;  1X3E A;  3I56 A;  1Q82 C;  2UXD L;  4IPG A;  3PSI A;  2K75 A;  2ZJQ A;  2F4V L;  3M4O H;  4DNI A;  3NEL A;  2L15 A;  3KFU A;  4A93 G;  1QVF A;  4GN4 B;  2XTI A;  4A3F G;  1JB7 A;  1P8L A;  2JA9 A;  3CCS A;  1XJV A;  2K50 A;  5GRO A;  4JCV E;  5FLM H;  1S40 A;  4LFB L;  3PO3 H;  4GKJ Q;  2VL6 A;  2NN6 I;  3I2Z A;  4DV1 L;  2JA7 G;  3TS2 A;  3E0E A;  1V43 A;  4YCW A;  1VQL A;  2MO0 A;  1EIF A;  1K8A C;  3EIV A;  3AFP A;  3GTP H;  5LMN Q;  1E22 A;  1HNX Q;  1VQC A;  3I4M H;  2NN6 G;  4IOA A;  4R4O A;  2HIV A;  2DGY A;  5FLM G;  4JBW A;  1L1O A;  3PO2 H;  4NXM L;  4KI0 A;  2MNA A;  2D0O A;  5GAH C;  1QZH A;  4B3M L;  2XGT A;  4B3S Q;  1KQS A;  3M7N A;  3S2H H;  4GKJ L;  2HIX A;  4LUV A;  5C0X I;  2K5V A;  2AMC B;  4A3J H;  3A5Z B;  5IP7 H;  3HOX H;  3CMA A;  2UUC Q;  2EQS A;  4NXN Q;  4WJ3 M;  4DV6 L;  3I4M G;  4AIM A;  1XPO A;  5JEA J;  1D8L A;  1Y1V H;  1HNX L;  1T9H A;  2IT1 A;  5C0X G;  3KYH C;  3CCV A;  1CKN A;  3PO2 G;  1KXL A;  3G4S A;  3KJO A;  4C3I H;  1GO3 E;  1XNR L;  2WP8 J;  1TXY A;  4A3J G;  1R9T H;  3HOX G;  3GTM H;  3F2C A;  1MKH A;  4OXP A;  4BY1 H;  2UUC L;  1TWG H;  5DLQ E;  3CC2 A;  1O7I A;  3S1R H;  4UPA A;  1PH2 A;  2NVT H;  4LFC Q;  1YHQ A;  3U50 C;  1N32 L;  4LF6 Q;  2R92 H;  4YCU A;  5GAE C;  1PV4 A;  4YWM A;  4R1J A;  2A1A A;  3BJU A;  4GOP B;  4LF5 Q;  4JI8 L;  2Y0S G;  1VQB A;  3L0O A;  4YHH Q;  4PZ8 A;  4YY3 Q;  4P73 A;  1OXV A;  5JEA G;  3GD7 A;  4A3M H;  1L0W A;  1OXS C;  4JV5 Q;  4MTN A;  3TS0 A;  3CPF A;  4MZ9 A;  3GDE A;  1AH9 A;  3D31 A;  2EXD A;  2R7Z G;  3UDF A;  2R92 G;  2MFI A;  2IX0 A;  2JA5 H;  5IYB H;  1XMO Q;  5GAG C;  2K14 A;  3S1M H;  3KDF B;  1Z9F A;  1BBW A;  1PFS A;  4DV4 Q;  1E1O A;  2QA4 A;  2BA0 A;  4O0A A;  3L2P A;  4YHH L;  4HIO A;  3DLL A;  4JI5 Q;  2CCZ A;  4A3M G;  3CPW A;  4L5Q A;  1VS0 A;  3PUW A;  4DAY B;  2I5H A;  3BU2 A;  1XNQ L;  4DV7 Q;  1HR0 L;  2JA5 G;  1WOC A;  5IYB G;  1Q8K A;  1KL9 A;  5IYD H;  4DR6 Q;  4JI2 L;  1HZC A;  1YIT A;  1VQ5 A;  1YBY A;  4OO1 I;  3S15 H;  4DUZ L;  1YJ9 A;  2GN5 A;  2B63 H;  4B3T Q;  4A3G H;  1DGS A;  2YTX A;  4DV0 L;  1PYS B;  1A8V A;  3H0G H;  4OO1 G;  4NB3 A;  4APV A;  4DK6 C;  1UE5 A;  1CSP A;  2B3G A;  3UDG A;  1XMQ L;  2BA1 A;  1EIY B;  2A8V A;  1VQ6 A;  1G6P A;  1A62 A;  4DV3 L;  1UWV A;  4HJA A;  1JJ2 A;  4A3L H;  1TWA H;  3STB D;  3F2B A;  5M5Y H;  4A3C H;  1IBL Q;  4QJF A;  4GLX A;  1Q46 A;  4JI1 L;  3RZD H;  4A3G G;  1QUQ A;  1KRS A;  1X6O A;  5M3F G;  1EFW A;  3M4P A;  4JI6 L;  4DR7 L;  1YVC A;  4IPC A;  5K36 G;  3T1Y L;  4BXX G;  3GTO H;  1C9O A;  4OX9 Q;  1K73 C;  4X62 Q;  2OCE A;  4A3L G;  1X65 A;  1Q81 C;  1VQJ A;  4TVA B;  1I5F A;  1NE3 A;  5ELN A;  3U4V A;  3F8T A;  2Q2T A;  1KD1 C;  1SRO A;  3L7Z C;  1K0R A;  3M3Y H;  4OON A;  3CP0 A;  1KC8 C;  3HOU H;  4A3B G;  3JAM c;  4ALP A;  2R7D A;  2JA6 H;  1L1O B;  4LUO A;  2UXB L;  4DV2 L;  4OX9 L;  3J7A 5;  5IT9 c;  2UUA L;  3HKZ E;  1NMG A;  2CWA A;  1OXT A;  4KLK A;  4JBJ A;  2UU9 Q;  1XPR A;  3RLN A;  2KEN A;  1YJN A;  2LXK A;  3Q8D A;  4X66 Q;  1K9M C;  2UUB Q;  4LF8 L;  5JJI A;  4LF9 Q;  1ASY A;  1ASZ A;  2N49 A;  2PMZ E;  2JA6 G;  1CKN B;  3H3V H;  4IOC A;  2Y0S E;  3NBH B;  3M85 A;  4JBM A;  2YTY A;  1JJC B;  1VQA A;  1X3G A;  1Y1W H;  5BR8 Q;  1HZB A;  3A5U A;  1RIP A;  1N8R C;  1IBK Q;  4LF7 Q;  1AE3 A;  3W1G A;  3K7U C;  4PG3 A;  3CC7 A;  4DUY L;  1VQH A;  2NZH A;  3A0J A;  1I6H H;  4OWT B;  1H95 A;  2K5H A;  2RCN A;  2OQ0 A;  2V1C C;  3KLW A;  4BBR H;  4LFA L;  2IY5 B;  2ZM6 L;  2EIF A;  3IRB A;  1CSQ A;  3S14 H;  1X9N A;  2IHF A;  5C0X J;  3CME A;  2N3S A;  2D0P A;  4IFD J;  4UP9 A;  4GNX C;  3K7A H;  1WFQ A;  3S16 H;  1PH3 A;  4B3R Q;  1KIX A;  4BBR G;  4BA1 I;  5J3B A;  1KHI A;  1L2F A;  4OWW B;  4KHP Q;  1PH1 A;  2DUD A;  3J80 i;  3A74 A;  3PO3 G;  1J6Q A;  1W3S A;  2MQH A;  2Z0S A;  4PMW A;  4AQY Q;  3VDY A;  1HNZ Q;  1G29 1;  2PNH A;  4GLV B;  1AE2 A;  3PGZ A;  1I94 Q;  4IFD I;  1EWI A;  1UE6 A;  3UDX A;  1EQQ A;  1QVG A;  2E2H H;  1FVI A;  4GN5 A;  4PZ7 A;  1XPU A;  3CF5 A;  5LMN L;  2KCT A;  4Y7N H;  4JI0 Q;  4KHP L;  1Z47 A;  5GQO A;  3MXN B;  4IFD G;  3RNU A;  1JE5 A;  1TWF H;  1WJJ A;  1JT8 A;  3PIO A;  1SE8 A;  1YEZ A;  5ELO A;  2E2I H;  4B3S L;  5IP7 G;  1HNZ L;  1HJP A;  2JQO A;  3D0F A;  3KF6 B;  1VQD A;  1SRU A;  3LGJ A;  4YCV A;  3J7Z C;  2QEX A;  5LMU Q;  1PH4 A;  1U0L A;  4NXN L;  4DV5 Q;  3HKZ G;  4R4I A;  1K8G A;  1HR0 W;  1Y1V G;  2GVB A;  2KHJ A;  1IL2 A;  3HFZ B;  5C4X H;  1LYL A;  2UXC Q;  1XTD A;  4P71 A;  4X65 Q;  3TQY A;  1E7Z A;  2NZO A;  4A76 A;  2LXJ A;  2HT1 A;  3K8A A;  4H02 A;  1S72 A;  2CWP A;  1GKH A;  3I4N H;  1HNW Q;  3CCM A;  4BY1 G;  1Q7Y C;  2JEA I;  2HQL A;  5C4X G;  3OYY A;  3F2D A;  2VNU D;  1PH5 A;  4LNQ A;  1WCM H;  5HY6 A;  4HJ9 A;  1K3R A;  2JK8 A;  1NY4 A;  1QUQ B;  5AJ3 Q;  3AQQ A;  1KAW A;  2JA8 H;  4LFC L;  2K5N A;  1SFO H;  2JJQ A;  4GKK Q;  4A3I H;  2ASB A;  2R93 H;  4LF6 L;  1VQG A;  3I4N G;  1PVO A;  2OQK A;  4LF5 L;  1HNW L;  3ERS X;  3CD6 A;  4BY7 H;  4HID A;  1P16 A;  4YY3 L;  1VQO A;  4DR1 Q;  2K52 A;  3CCR A;  1VQN A;  1N34 Q;  1PYB A;  4JV5 L;  4LUZ A;  4GS3 A;  1Q1B A;  3UDI A;  1VQI A;  1VQ4 A;  1UE7 A;  4A3I G;  2ZJP A;  4DR5 Q;  1B70 B;  4DKA C;  1GM5 A;  1XMO L;  3ICE A;  1M90 C;  4GKK L;  4DR2 Q;  2JE6 I;  1CKM A;  1W2B A;  4DV4 L;  4BY7 G;  4K0K Q;  3KF6 A;  4WJ4 A;  3J81 c;  3EBE A;  4JI5 L;  1BKB A;  1B7Y B;  1FL0 A;  3PCO B;  1WI5 A;  1SLJ A;  3CQZ H;  3S1N H;  2CQO A;  4IPD A;  1BBU A;  2E5L Q;  3CC4 A;  5IYD G;  4DV7 L;  3RN2 A;  2BH8 A;  4MNO A;  2IHE A;  1VQ9 A;  5C3E H;  4DR6 L;  3TRE A;  4JOI C;  2VW9 A;  1PH9 A;  1TWH H;  2Z6K C;  1E24 A;  2B63 G;  3U4Z A;  1EYG A;  3H0G G;  4B3T L;  2OTL A;  4UP7 A;  4JI4 Q;  4IPH A;  3G71 A;  4JI7 Q;  4GOP C;  1VQP A;  4IJH A;  4OWX B;  2YV5 A;  3ULJ A;  1FJG Q;  1SMX A;  1HH2 P;  4KHZ A;  3OTO Q;  4A3C G;  3PIP A;  3UE0 A;  1YI2 A;  4LF4 Q;  1IBL L;  1UEB A;  4X64 Q;  2ZTE A;  2HHH Q;  5M3M H;  1GVP A;  3K0X A;  4JYA Q;  2YYZ A;  1U5K A;  2MO1 A;  1HZ9 A;  1C0A A;  2QGQ A;  5HGQ A;  4HJ5 A;  4UY8 C;  4X62 L;  1MJC A;  1N33 Q;  2ES2 A;  3I7F A;  1JJG A;  5C4J H;  1UE1 A;  5IWA Q;  4IO9 A;  2AWN A;  1YHB A;  5M3M G;  3JC6 6;  3ULP A;  4GLA C;  2N8N A;  4ME3 A;  3HOU G;  3RZO H;  1IBM Q;  2I0Q A;  2Q2I A;  2PI2 A;  5EAY A;  4A4I A;  3I55 A;  1TWC H;  1YZ6 A;  2Q2H A;  2R6G A;  3HOV H;  1RL2 A;  3TEH B;  4XIG S;  5LMN W;  1S3O A;  3CCU A;  2B29 A;  2RF4 A;  3ZJY C;  2R7F A;  5IWA L;  4DR3 Q;  2UU9 L;  3HOY H;  4X66 L;  2UUB L;  1D7Q A;  1J5E Q;  3PUX A;  4L5R C;  4DR4 Q;  4A3D H;  4LF9 L;  3J81 j;  1N9W A;  2UXD Q;  1C7Y A;  2FXQ A;  4HJ8 A;  1Y1W G;  1E3P A;  4FDB A;  3RN5 A;  3HOV G;  2JEB I;  4QY7 A;  4UP8 A;  1VCI A;  4YWK A;  2D62 A;  1I3Q H;  3FP9 A;  4C2M H;  3S24 A;  5BR8 L;  3G48 A;  1IBK L;  4LF7 L;  4HIK A;  3HOY G;  4A3F H;  4LFB Q;  4A3D G;  4DR3 L;  3K81 C;  3FKI H;  4DV1 Q;  3HOW H;  1QVC A;  3ULL A;  3ER0 A;  4GNX A;  4DR4 L;  2JA7 H;  4LWC A;  3GTK H;  2N78 A;  4AYB G;  3GTQ H; 
#chains in the Genus database with same CATH topology
 1BF4 A;  5C44 H;  3TRZ A;  4XTC S;  4BBS H;  1II3 A;  3MZ5 A;  4A75 A;  4B3R L;  1ZXT A;  3HXL A;  3JAM i;  1VQE A;  3TSS A;  1QZG A;  1L1O C;  4GC7 A;  4HNV A;  3MWE A;  2Z6B A;  1JIH A;  1JDE A;  2AKW B;  4TUY F;  5KFV A;  5KT5 A;  3RFC A;  1HTL D;  2F1M A;  4QL5 A;  5CV5 A;  1Z7T A;  2K28 A;  3BDO A;  3KF8 B;  3T5H A;  4JI0 L;  1JX4 A;  5I2Y A;  2A6H C;  4A2B A;  2OTJ A;  5KFG A;  2UXD H;  1E4E B;  1O7Y A;  2L4N A;  1PTO H;  3KAK A;  4FF3 A;  5KFX A;  4IUU A;  5LMU L;  3NQI A;  3MEH A;  1YJW A;  3PF5 A;  2VZA A;  4K2K A;  2B2W A;  1VMP A;  4JK1 C;  4DV1 H;  1QG7 A;  3HRZ C;  3Q22 A;  2VOB A;  2YRW A;  1EOV A;  4RNM A;  4JC0 A;  2J9G A;  2Z4H A;  3J80 E;  1EQT A;  4POG A;  1TU2 B;  1ESR A;  3PV0 A;  2F52 A;  4G3I A;  4ZI7 F;  2CKZ B;  4IUQ A;  3TP7 A;  4NXM H;  2NVX B;  3K3V A;  4M9U A;  4GKJ H;  1SMY D;  1CHP D;  2CVR A;  3OIQ A;  3S2H B;  1EY9 A;  2NU7 B;  4DV6 H;  2I5L X;  4A3J B;  4MHE A;  1HR0 Q;  5A35 A;  4DR1 L;  4TQS A;  3KF8 A;  2VQF Q;  4A3K G;  2NUA B;  4DUZ Q;  1STG A;  1A3U A;  2DJG C;  2WV6 D;  2RDJ A;  4QWB A;  4PZ6 A;  1GD7 A;  2AQ1 B;  4C3J H;  1E4E A;  2Y0S B;  2YYA A;  3GTM B;  2W57 A;  1EUJ A;  2IX1 A;  4O3O A;  1XMQ Q;  2IX3 A;  3HOZ G;  1YIJ A;  2VR1 A;  3WO0 A;  4DV3 Q;  2NVT B;  1PFN A;  5FKA C;  2CFM A;  3E5S A;  1NMF A;  3VPB A;  2XCA A;  4O3S A;  5C3E G;  2B2V C;  1WTO A;  3G6J B;  4KJN A;  4QQB X;  5IGE A;  3ND8 A;  1G51 A;  2K5W A;  4G7Z C;  4JI6 Q;  3T1H Q;  2Q8I B;  3Q2O A;  4RG1 A;  3C2P A;  5CMD A;  2A19 A;  4DA2 A;  3STB C;  2ID0 A;  2G9D A;  3N52 A;  3HKS A;  1LUZ A;  3E9H A;  4JI7 L;  1Y69 U;  2VUM G;  2R8H A;  3VYT A;  1FJG L;  1O7L A;  2DZD A;  1IKL A;  3OTO L;  1PA6 A;  4JBK A;  3PW7 A;  1ZYR C;  3KOJ A;  3J80 c;  2UXB Q;  2W71 A;  4JI2 H;  1GXD C;  3QWN A;  1SYE A;  1GSA A;  3S17 H;  2W6M A;  4ECR A;  2FK2 A;  5DNF A;  2CH4 A;  3GTM A;  3NK9 A;  5IOC A;  4A3G B;  2ZJT A;  5KG3 A;  1MSH A;  2YZG A;  2HCC A;  3D4D A;  1DOL A;  3V4Z A;  1K8M A;  1X32 A;  3EFX D;  2VQE L;  2F4V Q;  2K1B A;  1SYX B;  1A15 A;  4ILW A;  2F3V A;  3MXU A;  4JI1 H;  1TWA B;  3TIG A;  2XCP A;  3D6C A;  1T3N A;  2PI2 E;  1J8I A;  1S5F D;  3T1Y H;  1D5X C;  3RLO A;  1PZI D;  2DNC A;  1IHZ A;  4A3B B;  2W9B A;  4G57 A;  4DNI A;  3NEL A;  3BA9 A;  3GQB A;  4UCS A;  4MV8 A;  2XGP A;  1LAC A;  4GN4 B;  2K03 A;  4A3F G;  1P8L A;  1I7N A;  4JVZ A;  4ID6 A;  1LLR D;  3OWF A;  5GRO A;  1S40 A;  2F0D A;  5KGU A;  4J9K A;  4F4X A;  4RAU C;  3FMC A;  2F03 A;  2NN6 I;  3I2Z A;  2JA7 G;  3TS2 A;  4YR3 A;  1KTK A;  2MUY A;  2JA6 B;  1EIF A;  2AUJ D;  1K8A C;  3EIV A;  1Z6H A;  3DXJ C;  3E0J A;  2DPJ A;  4R4O A;  5CV6 A;  3J81 E;  2GLT A;  2MNA A;  1WTV A;  1QZH A;  3M7N A;  4IFD H;  3S2H H;  1KQS A;  4LUV A;  4A3J H;  2A6H D;  5IP7 H;  3M9O B;  1Y1W B;  4L1K A;  4RZQ A;  1TWA A;  5KFJ A;  2W70 A;  1HNX L;  1D8L A;  4K5V A;  4ECY A;  4DNT B;  2IT1 A;  3CCV A;  5C0X G;  4UFZ A;  4LFA H;  2ZM6 H;  3VPC A;  2EJG C;  1ENC A;  4KMU C;  3HOX G;  3GTM H;  2O03 A;  3RAQ A;  3R5H A;  1MKH A;  1PRT C;  5DLQ E;  1GUW A;  1FYC A;  3S1R H;  4ZAI A;  1PH2 A;  1HHV A;  4RNN A;  2NVT H;  1M4V A;  2XRS D;  3U50 C;  1EUD B;  5E1F A;  5EPK A;  1B50 A;  2VQD A;  1PV4 A;  1JC7 A;  3BJU A;  4JI8 L;  1Y8N B;  1VQB A;  4HED A;  4FF2 A;  2JA6 A;  3MR2 A;  4P73 A;  1HFG A;  1OXS C;  3C3L A;  4JV5 Q;  4ZHQ F;  1TVX A;  2FB9 A;  5KFR A;  4MZ9 A;  3GDE A;  5BN4 A;  3D31 A;  2R7Z G;  1K0S A;  3UDF A;  1SYD A;  2R92 G;  3UI2 A;  1GGO A;  4J9Q A;  1Y1V B;  4EQN A;  4Y7N B;  1Z9F A;  1IOW A;  3PR4 A;  3ND9 A;  1R4P B;  2BA0 A;  4O0A A;  4YHH L;  4HIO A;  3IFD A;  5TSS A;  4C3I B;  3W2D A;  5H80 A;  3M4I A;  1Y1W A;  2E2I B;  1VS0 A;  1BUV T;  1BNZ A;  4I50 F;  2JEF A;  1G2T A;  1XNQ L;  5CGK A;  5CV9 A;  3JAM L;  1WOC A;  5A2Q W;  1Q8K A;  1KL9 A;  5C4X B;  1RKN A;  3J7A K;  2XN9 C;  4EYH B;  4J9S A;  2RSN A;  1Y8P B;  1YJ9 A;  4LSA A;  3SK8 A;  4FBU A;  3VR4 A;  5KG5 A;  3A8J E;  4A3G H;  3KBX A;  3GLK A;  1A8V A;  2E74 C;  3N42 B;  1U4R A;  1EIY B;  1UE5 A;  3BAB A;  5D1O B;  4LFC H;  4LF6 H;  4HQ6 A;  1UWV A;  4HJA A;  4LF5 H;  5T14 A;  1TWA H;  3STB D;  3RAX A;  2WKD A;  1CS0 A;  4A3C H;  1IBL Q;  2NTS A;  3K6O A;  1SJH D;  5CAE B;  5M3F G;  4DR7 L;  3M4P A;  1ZYR D;  4BXX G;  2F0K A;  2CZG A;  5I47 A;  1XMO H;  3N43 B;  4M8A A;  1TWF A;  1C3O A;  5JJZ A;  1GUG A;  1NE3 A;  2L0C A;  2Q2T A;  1KD1 C;  5DM7 3;  3M3Y H;  1RYR A;  3CP0 A;  2SNM A;  3NTH A;  4NW2 A;  4F7X A;  4DV7 H;  4H7B A;  2JA6 H;  2BOS A;  4N8X 1;  3PW4 A;  3H0G B;  5BN5 A;  3J7A 5;  1M8A A;  4XYQ A;  5D3I B;  1ET9 A;  4JBJ A;  3C46 A;  1G6P A;  3GID A;  1YJN A;  2C5C A;  3Q8D A;  2UUB Q;  4ED7 A;  4LF8 L;  5KFN A;  1ASZ A;  4IR9 A;  2HCI A;  4QMG A;  4EGJ A;  1KEE A;  4JBM A;  2YTY A;  3GIQ A;  3GIK A;  5ELC A;  1Y1W H;  2AUK A;  1N8R C;  5D3D A;  3W1G A;  3CC7 A;  1VQH A;  1H95 A;  5C6A A;  1JIC A;  3L4K A;  4L6T B;  2FPI B;  3J81 W;  3S14 H;  1X9N A;  3QO2 A;  4EYI B;  2D0P A;  4OX9 H;  4IFD J;  4GNX C;  4Z9C B;  3MAQ A;  4WFN 3;  3DWP A;  1KIX A;  1IKM A;  1F2Z A;  3KUP A;  5J3B A;  5C4J B;  1V1P A;  1CZG A;  2R8G A;  2EPB A;  5EPL A;  1S9F A;  1J6Q A;  1ENF A;  3A8I E;  1AE2 A;  3PGZ A;  1I94 Q;  4KKS A;  4IFD I;  3GTL A;  1ROD A;  3UDX A;  1STY A;  4F8M A;  3HOV B;  3CF5 A;  3MR5 A;  2RQX A;  2KCT A;  5F2D A;  4Y7N H;  1D5M C;  3EPI A;  4LF9 H;  1F9R A;  1TWF H;  1SAP A;  1M6V A;  3TME A;  5IIF A;  1QB5 D;  3D8G A;  2E2I H;  3KAJ A;  5ELO A;  5KFC A;  1K1Q A;  2M05 A;  2W6P A;  4YCV A;  1SRU A;  1KAA A;  1EWC A;  3DM1 A;  1PH4 A;  1HR0 W;  2ATW A;  1KXL A;  2ASD A;  2KHJ A;  2M00 A;  2JA8 B;  2VUM A;  5C4X H;  2UXC Q;  1XTD A;  4A3F B;  1E7Z A;  1ZEQ X;  1QWY A;  3FKI B;  2LXJ A;  3HOW B;  1HNW Q;  4J0M A;  3H3V C;  4K2L A;  1Q7Y C;  1DXM A;  3BS1 A;  1FNV A;  4B3R H;  4HJ9 A;  2RDI A;  1K3R A;  3JRW A;  1NY4 A;  5AJ3 Q;  1RHP A;  1KAW A;  4CKE A;  4DU9 A;  1S68 A;  4IRC A;  2ASB A;  5KFI A;  5LOV F;  2R7L A;  3GIL A;  4E6I A;  2RVL A;  2K52 A;  3CCR A;  2FK3 A;  1LTA D;  2EJF C;  5J2U F;  4JV2 A;  1VQ4 A;  1E0B A;  1MZB A;  4A3I G;  4QF4 A;  4ZCK A;  4JI0 H;  3R23 A;  4DKA C;  4R8U B;  4HCS A;  2JE6 I;  4BY7 G;  4DV4 L;  4UHV A;  1B7Y B;  2W6Z A;  4PV1 C;  4DXG A;  3J80 L;  4UCV A;  5LMU H;  4CKC A;  5I4D A;  1JOQ A;  4X3U A;  5LL6 b;  4MNO A;  1NCV A;  2FMA A;  1WCM B;  2IHE A;  5DGB A;  3FKI A;  5C3E H;  4DR6 L;  3F8N A;  3BZD B;  2JA7 A;  3E6Z X;  1SNO A;  3T51 B;  1E24 A;  4DL5 A;  1B3A A;  1EYG A;  2GA4 B;  4B3T L;  1CM9 A;  1VDZ A;  5LA6 F;  2D9U A;  4GOP C;  1KNE A;  4IJH A;  1SYB A;  5KFB A;  1SMX A;  1RTO A;  3UE0 A;  3PIP A;  4UCT A;  1UAP A;  4LF4 Q;  3RB3 A;  4DR1 H;  4Q43 A;  2HHH Q;  2E76 C;  1LT3 D;  2L12 A;  4PMC A;  2OH2 A;  5FO8 B;  1GSO A;  1HZ9 A;  2QGQ A;  2ZDQ A;  1EY5 A;  2UVV A;  5C4J H;  5FLX E;  4IO9 A;  2WIN B;  2AWN A;  3DEO A;  5EJW A;  1YHB A;  4ECX A;  3JC6 6;  3HOU G;  1O80 A;  2ZDH A;  1RJQ A;  5BPH A;  3G8C A;  5KG7 A;  1F2Y A;  5EAY A;  3RBD A;  3E5N A;  4QIW A;  2W9A A;  1SEI A;  2A74 C;  3HOV H;  2F3W A;  4XIG S;  2PCF B;  3RV4 A;  4KY6 A;  3M9M B;  1G8Z D;  2RF4 A;  4LAA A;  3GV7 B;  4DR3 Q;  4X66 L;  1D7Q A;  3PUX A;  4IQZ A;  2R7Z A;  5M3F B;  2UXD Q;  3N8D A;  2HVS A;  1V8Q A;  5IGF A;  1B6S A;  3IN5 A;  1EZ1 A;  4C5A A;  3OSP A;  4JI7 H;  1VCI A;  5BR8 L;  2D62 A;  2JA8 H;  3FP9 A;  1IBK L;  1FJG H;  2B8G A;  2Z4I A;  3OTO H;  3HOY G;  4YB8 B;  4A3F H;  2F0P A;  2PZT A;  1SNQ A;  3FKI H;  4DV1 Q;  3HOW H;  2L5T A;  2CW0 D;  2JA7 H;  5M5W B;  1EIH A;  5KIX A;  4LWC A;  4ZQI A;  1WR2 A;  1KNA A;  5LHY 1;  2VY3 A;  5H1S E;  3S1Q H;  3I4O A;  3MR6 A;  3E9I A;  2ATL A;  1BNC A;  4NXM Q;  1QNU A;  3QG1 A;  5JPM C;  1SCU B;  2K01 A;  5E7N A;  1JLL B;  1RDP D;  2X6L A;  3ONA B;  1WTH A;  2MP1 A;  1STE A;  2ALY B;  4DV6 Q;  4IUN A;  3U58 A;  4ULL A;  3CXC A;  1SNP A;  1S5C D;  4MIU A;  5EZY F;  3W3A A;  4Y52 H;  1I3Q B;  5C1P A;  5FLX c;  4DAM A;  3K5N A;  2YZN A;  1YNX A;  2NVY B;  3A55 A;  4IUR A;  5IP9 H;  4Q5V A;  1OXX K;  4K5X A;  2KBN A;  3GIJ A;  5IE8 A;  3GTK B;  4O3N A;  2GVA A;  3W1B A;  3PW0 A;  5EWG A;  2DPI A;  2AHO B;  5IYC H;  1LTR D;  3AB9 A;  3PUZ A;  1WVL A;  4YJ2 F;  2OEO A;  1A2U A;  3OSN A;  2FJ2 A;  2Q8R E;  4POF A;  1JB3 A;  3C1E A;  1SN8 A;  4JI3 Q;  2R7Z H;  5JQW A;  3RLF A;  1A3V A;  1YHA A;  1OTC A;  3RIZ A;  5K5P A;  1UUP A;  4OEL B;  1EEF D;  3EN2 A;  1ICW A;  3PO2 B;  2R93 G;  3JSN A;  3OW7 A;  1N36 Q;  4EGV A;  2FHT A;  4J9N A;  2AGP A;  2L9H A;  5DLF A;  4O2A F;  2H5X A;  1HNX H;  2WDT A;  4DF7 A;  1BOS A;  5IT9 E;  2MCT A;  1BXR A;  1EFI D;  2RGR A;  4JI2 Q;  3H4B A;  3K80 C;  2RSO A;  1Y14 B;  3H15 A;  2E2D C;  1PTO F;  2NVY A;  4O2D A;  4DPG A;  2PMZ B;  3UE1 A;  4G7H C;  3BZC A;  2B2U C;  4K0K L;  3G6E A;  5CV7 A;  3I91 A;  1NJI C;  5C8Y F;  2EOT A;  1KDB A;  1X56 A;  5CC4 A;  3L3O C;  1C30 A;  4ZK9 B;  1SR3 A;  4BS9 A;  4TRD A;  3KLS X;  4UDU C;  1PH6 A;  2VQF L;  4JI8 H;  2Z6K A;  4ED3 A;  4TKO B;  4JI1 Q;  3SXH A;  2F0V A;  4HIM A;  3T5J A;  2F0U A;  4XQQ A;  1IXR A;  4A3M B;  1G6Z A;  4ECQ A;  3T1Y Q;  5M3F H;  3R93 A;  3AMU A;  4BXX H;  3MA2 B;  5LP6 F;  2ASJ A;  2IPK D;  2JA5 B;  3TZD A;  3C1F A;  4JI4 L;  4YHH H;  2I46 A;  2FPG B;  1MBY A;  1A9X A;  4IJL A;  4K5W A;  5JJL A;  4X6A H;  2C22 A;  2IP4 A;  5FJ8 G;  3SK5 A;  4C3J B;  1XNQ H;  1HPC A;  3KXY T;  2WB1 E;  2D5D A;  3T1H L;  4HR7 A;  4QWE A;  3M4Y A;  1IYJ B;  3HGB A;  5M5W H;  4X64 L;  4MV1 A;  5IGG A;  1V1Q A;  3H3V I;  4JYA L;  3F1Z A;  4A3E G;  1PDQ A;  1E2W A;  2PMZ A;  1R9T A;  3IKJ A;  1JKJ B;  1N33 L;  2QKI C;  1X55 A;  3VA7 A;  3GO5 A;  2J4X A;  3WOE A;  1Y8O B;  4FS1 A;  4L5T A;  2A6E C;  1CI3 M;  2ZXR A;  1K3B C;  2OXP A;  2WAQ G;  1A63 A;  3D4W A;  1E1T A;  4ZUI A;  4LFA Q;  1L0X B;  4MAM A;  3KAL A;  2ZM6 Q;  4RZR A;  4OEM B;  4DR7 H;  3L9A X;  2NVY H;  4EVO A;  1L0Y B;  1J5E L;  2XGQ A;  1TY2 A;  1CHQ D;  4IWY A;  4IPG A;  2LKV A;  2K75 A;  2F4V L;  3CRL C;  2L15 A;  5KFW A;  3TIN A;  4A93 G;  2XTI A;  2K32 A;  4EBE A;  4J8Q A;  1WTR A;  2NN6 H;  3CCS A;  4JCV E;  5FLM H;  3R8B A;  3E0E A;  3CKI B;  5KKN B;  5L1I A;  4R8I A;  4RUC A;  1EWH A;  4N9T A;  2YW2 A;  1QE6 A;  4LF8 H;  3PW2 A;  4IOA A;  2HIV A;  2DGY A;  4IAL A;  1GUO A;  4JBW A;  2P5Z X;  1ZHS A;  3ORR A;  1L1O A;  3PO2 H;  5DQH A;  4B3M L;  1Q3L A;  4RCO A;  4DL3 A;  3NSW A;  3GIP A;  2HIX A;  5C0X I;  4A2A A;  4YBZ B;  1BGW A;  1PFM A;  2JEG A;  1EY7 A;  2UUC Q;  3K58 A;  1CQJ B;  4DLK A;  3I4M G;  4YP3 A;  5KFT A;  3RB6 A;  1O75 A;  1EOT A;  1CKN A;  1AZP A;  5L1J A;  4BBR B;  1EYA A;  2A68 C;  1XNR L;  4NMZ A;  2WE6 A;  3MTS A;  1R9T H;  1B53 A;  3BVG A;  1HRJ A;  5KT7 A;  4OXP A;  3NXW A;  3JAM W;  2AU0 A;  1I4R A;  3K7A B;  3N6X A;  4UPA A;  1S03 G;  5IT9 W;  4LFC Q;  3A7A B;  1LTS D;  2EYM A;  1YHQ A;  1N32 L;  2VPQ A;  2G5D A;  4LF6 Q;  1ULZ A;  4YCU A;  5GAE C;  2JEI A;  4YWM A;  4R1J A;  4LF5 Q;  5HV6 A;  3VYU A;  1KLG D;  2O5I C;  5DG8 A;  5JEA G;  4WOR A;  4A3M H;  1B4O A;  4X3T A;  4H44 C;  3TS0 A;  1U9R A;  3CPF A;  5LL6 X;  4XQN A;  2MFI A;  2IX0 A;  2NBF A;  2JA5 H;  1G91 A;  1XMO Q;  2XWJ B;  4N8F A;  4IHJ F;  1FNU A;  1LTT D;  5EQ0 A;  1E1O A;  1VBH A;  3DLL A;  1JDB B;  4L5Q A;  1IL8 A;  4YAK B;  4WD3 A;  3BU2 A;  4XT1 B;  4DV7 Q;  5J2T F;  5IYB G;  4CJ1 B;  1QIL A;  3S1R B;  1T94 A;  3MR3 A;  1LT6 D;  5DQI A;  3MHB A;  2QIL A;  2FKL A;  3OSO A;  2PW7 A;  1HA5 A;  4XDX A;  4IRD A;  2GN5 A;  3I4N B;  4IZO A;  3K5O A;  4ECV A;  5F9L A;  1DGS A;  1JOO A;  4DV0 L;  2OT2 A;  2B2V A;  3V05 A;  4R8N A;  5A2Q E;  2A8V A;  1VQ6 A;  1A62 A;  1GUT A;  1SNM A;  1JJ2 A;  4J9O A;  3RB0 A;  1W6J A;  3F2B A;  3V96 A;  1TR5 A;  2W9B B;  3OHB A;  1JE4 A;  4GLX A;  3N41 B;  4RAY A;  4RB2 C;  1FGB D;  5HUR A;  1PXU A;  2NU9 B;  1QUQ A;  2E2H A;  1KRS A;  2QDB A;  3VA5 A;  4K6L A;  1JQY D;  4OX9 Q;  4A3L G;  2A5H A;  4C3H G;  4NDX A;  1X65 A;  5I9O A;  3TQT A;  4DV4 H;  5I9P A;  4TVA B;  1I5F A;  4Y8V B;  1LTG D;  1BCP B;  4DN4 M;  1VMC A;  3L7Z C;  1K0R A;  1DYQ A;  1BCP F;  2EYO A;  4OON A;  3HOU H;  4KTA A;  4O4L F;  2R7D A;  2EY6 A;  2IBK A;  4DL7 A;  1GUN A;  4K8J A;  2KCN A;  4DV2 L;  3I12 A;  4I4T F;  2BQU A;  2A6E D;  5KND A;  4DR6 H;  2UUA L;  1E4F T;  1TS3 A;  3HP3 A;  1XX8 A;  3V6J A;  1STH A;  5IGB A;  1RJP A;  1TWH B;  5DEH A;  2KEN A;  2X6G A;  3RLN A;  4LF9 Q;  5E4W C;  5KG4 A;  4B3T H;  2N49 A;  4RAZ A;  4IZ8 A;  2Y0S E;  3Q6S A;  5KRU A;  1JWM D;  1H9S A;  1VQA A;  1X3G A;  3N6R A;  4HN7 A;  3WDN A;  2R93 A;  5FPR A;  5BN3 A;  4DUY L;  3BYT B;  4PG3 A;  1XWE A;  2NZH A;  3A0J A;  4OWT B;  3PIO 3;  2K5H A;  4V19 0;  2OQ0 A;  3KLW A;  4BBR H;  2V59 A;  4ETS A;  1HCZ A;  4CBV A;  1BJT A;  3Q8R B;  2YL2 A;  2BCO A;  3IRB A;  4XYO A;  2QK4 A;  3CME A;  4YR2 A;  1PRT B;  2HDM A;  1NSN S;  2N3S A;  2RDG A;  3M3Y B;  4RFB A;  1EU4 A;  4EGQ A;  3K7A H;  5KG2 A;  1WTX A;  1WFQ A;  4HCE A;  4B3R Q;  2RCF A;  2IMW P;  1KHI A;  1LT4 D;  4KHP Q;  3V6H A;  1PH1 A;  2SDF A;  3J80 i;  3PO3 G;  2B8F A;  1FD7 D;  3I90 A;  3RZO B;  4KN4 C;  3KHG A;  2R7K A;  1HNZ Q;  4FF4 A;  4YQW A;  5ISR A;  1EWI A;  3NE5 B;  2E2H H;  1XPU A;  1EQQ A;  1TWH A;  1FVI A;  3DUZ A;  3GP7 A;  5LMN L;  4X66 H;  4JI0 Q;  1QCB D;  3L4J A;  4ECU A;  2K6A A;  2ICE C;  4A3D B;  2A68 D;  1JT8 A;  1EIG A;  1YEZ A;  4FXK C;  4B3S L;  1KJQ A;  1DM0 B;  1RJR A;  5G3L D;  4ZYS A;  3D0F A;  5CBE E;  3S14 B;  1VQD A;  3J7Z C;  3ERO A;  5LMU Q;  5BR8 H;  1IBK H;  4AYB B;  5HBR B;  4NXN L;  1IL2 A;  3UQ8 A;  2EYH A;  3HKZ G;  2FPP B;  1LYL A;  2AQ4 A;  4PMB A;  4F4Y A;  5COR A;  1U4P A;  2NZO A;  3TP5 A;  2JN4 A;  1CQV A;  5E3F A;  3I4N H;  2KA7 A;  5KFE A;  2A69 C;  4BY1 G;  3R5F A;  2JEA I;  4QUC A;  4ZKB B;  3S2D B;  1KJ8 A;  1EU3 A;  2PW5 A;  2E2J B;  5JOB A;  1RK5 A;  3AQQ A;  2J6U A;  1TT2 A;  2K5N A;  4GKK Q;  4DL4 A;  2R93 H;  1VQG A;  1GSH A;  2KED A;  1PVO A;  2OQK A;  1HNW L;  3N44 B;  4OHJ A;  3ERS X;  3CD6 A;  3QFF A;  4ME5 A;  1TWF B;  4HID A;  1P16 A;  2OF1 A;  4YY3 L;  4DR1 Q;  1VQO A;  1OWT A;  2WAQ A;  2I87 A;  2W7O A;  5K2M A;  1PYB A;  2ALZ A;  4LUZ A;  4GS3 A;  1Q1B A;  2K5Q A;  3FEW X;  1VQI A;  1H9M A;  1UE7 A;  1ICF B;  4K8I A;  3UDI A;  2ZJP A;  1B70 B;  2B2Y C;  2XWB B;  3ICE A;  4RB0 A;  3ZYY X;  1W2B A;  5KT3 A;  4WJ4 A;  3J81 c;  3EBE A;  5D14 A;  1FL0 A;  4JI5 L;  4AYB A;  2DY8 A;  2YU9 A;  4YAJ B;  2EY2 A;  4C1N K;  1WH2 A;  2V9W A;  4CGY B;  1EUC B;  2CQO A;  1CTM A;  1BBU A;  1C48 A;  4HAE A;  4O3Q A;  2YCH A;  5FD6 A;  3Q23 A;  1I4X A;  1LTI D;  3TRE A;  4JOI C;  2VW9 A;  3G6Y A;  1TWH H;  3GTQ A;  4FXG C;  2KVM A;  1O78 A;  3KLR A;  5EBC A;  2B63 G;  3RMH A;  3MFH A;  2FMC A;  3QR8 A;  4UP7 A;  1G2S A;  4RKL A;  4IPH A;  1V51 A;  4JI7 Q;  4KD4 A;  2NU6 B;  5KFD A;  4A3K B;  1BDO A;  1FJG Q;  1HH2 P;  4KHZ A;  3OTO Q;  5JVD F;  1HQM C;  2ZTE A;  3GTJ A;  1V1P B;  1GVP A;  2PZU A;  3BQ1 A;  5BPF A;  1B3Q A;  1U5K A;  2CH4 W;  4LMQ D;  3HOZ B;  2O5J C;  2FP4 B;  3Q8P B;  2UVU A;  4X62 L;  1MJC A;  5C3E B;  1ML0 D;  2BDO A;  4K0K H;  3GTL B;  3NPP A;  5LYJ F;  4MN3 A;  5M3M G;  3ULP A;  4ME3 A;  2N8N A;  3RZO H;  3M9N B;  2P0A A;  1WTW A;  2VQF H;  5JPN C;  3OWE B;  4A4I A;  1YZ6 A;  2R6G A;  3TII A;  3EPG A;  1S3O A;  2W8K A;  4N9P A;  4RHS A;  3MWY W;  3BQ0 A;  2UU9 L;  2VUM B;  1JOR A;  4A3D H;  1SEB D;  4DR4 Q;  4O2B F;  2CW7 A;  2MJ8 A;  3OIP A;  3SHL A;  4O1N A;  1RCV D;  4QW8 A;  2FXQ A;  4JI4 H;  1E3P A;  4FDB A;  3NTI A;  2JEB I;  4QY7 A;  1NNX A;  2DY7 A;  3KBG A;  3G48 A;  2EYJ A;  4LF7 L;  5EPJ A;  1DV1 A;  2NTT A;  4MV3 A;  3BJY A;  3T1H H;  4HSV A;  3EQL C;  1B9M A;  4DR3 L;  4X64 H;  5KFZ A;  4O3P A;  3ER0 A;  3R3O A;  2CW0 C;  4GNX A;  1D1I A;  4JYA H;  3GTQ H;  1C4Q A;  3WO1 A;  4ED1 A;  4O3R A;  3GQC A;  3S2D H;  1SE4 A;  1PH7 A;  3J7A V;  1JOK A;  2QCP X;  3D6W A;  1N33 H;  4KY5 A;  1MIU A;  2I07 B;  2E2J H;  1Z2P X;  2AGQ A;  4ZRZ A;  5L1K A;  5IWA H;  2RHS B;  1VQF A;  4DK3 C;  3NWT A;  3FRP B;  3P20 A;  5FOB B;  3AEV A;  4KHV A;  3OMG A;  5C44 G;  4AQY L;  3KLS A;  3RR5 A;  4BBS G;  2VS1 A;  3K3P A;  3GTJ H;  1VF7 A;  1SXT A;  5EKI A;  2OWO A;  4GN3 B;  1K8O A;  1H9K A;  1KBL A;  2WB1 G;  5CR3 A;  1J5E H;  2I5M X;  4ECS A;  2R8I A;  2PNR C;  1I50 B;  3A54 A;  3K0Y A;  2JA7 B;  1WTP A;  2A69 D;  4LH6 A;  2EE1 A;  3WWV A;  1Q12 A;  1ONL A;  2K5D A;  2MHV A;  3DHQ A;  4DV5 L;  3PF4 A;  1NR4 A;  4XT3 B;  3S1Q B;  5KFF A;  1A2T A;  2YTV A;  4JI8 Q;  5KFL A;  4EBD A;  3JZI A;  3R2I A;  4X65 L;  1W96 A;  1FNW A;  4ODG A;  3BZK A;  1BXT A;  3OW2 A;  3M9B A;  3MXP A;  4ZOL F;  5CA1 F;  5JEA H;  4ECW A;  1S0M A;  2IL8 A;  3BDL A;  4BWS C;  3GTP B;  2PQA B;  5KFM A;  1TII D;  2AGO A;  2J0T D;  4B3M H;  4MTE A;  4MA0 A;  4JPB W;  4QGU A;  3NTK A;  4A3K H;  4QWA A;  2W9C B;  1GHK A;  4YWL A;  1NTG A;  3SK6 A;  3QB3 A;  1VQM A;  4EQ5 A;  1V9P A;  1XXG A;  3PUY A;  3HOX B;  1XNQ Q;  2IW3 A;  4HMJ A;  2FK1 A;  4JI3 L;  5C3X A;  4CDD C;  2Q2U A;  4I7A A;  1UEA B;  3HOZ H;  1N34 L;  3BQ2 A;  2O4X A;  1XNR H;  3PUV A;  3OHA A;  4FS2 A;  3NWS A;  2JSO A;  2XVS A;  4DR5 L;  1I50 A;  1W93 A;  5KX5 F;  5IY0 A;  4MV6 A;  3GTL H;  2EYL A;  1N36 L;  4QIW B;  4DR2 L;  1A6X A;  1SJE D;  5KG0 A;  3VR5 A;  5KT4 A;  5D8D A;  1WYD A;  5KFO A;  3SGI A;  4J9R A;  4IUV A;  1N32 H;  1NR2 A;  5C1O A;  4HSP A;  4RH6 A;  3TDQ A;  3WOF A;  2R7Z B;  2E5L L;  2RGV A;  2C28 A;  2RDF A;  4R4Q A;  2R92 B;  1LO5 D;  4J9P A;  3MEF A;  3CW2 C;  3SI8 A;  3B6Y A;  4RGN A;  5DG7 A;  2VUM H;  4FP5 D;  4RB1 A;  4DR7 Q;  1TY0 A;  3OUZ A;  2HDL A;  4P75 A;  2PQA A;  4BA2 I;  3GTP A;  3EA6 A;  3RF2 A;  3TQ1 A;  4GOP A;  4DGZ A;  1HA6 A;  1PZK D;  3SR1 A;  4C3H H;  1FGU A;  2W9C A;  3NEM A;  2AQ2 B;  2PPB C;  2FE3 A;  4IR1 A;  4HYK A;  2BH2 A;  4F87 A;  2QW7 A;  1XTC D;  2LSS A;  3HKZ A;  2NVQ H;  3H3V H;  1EYZ A;  3KDF A;  1GUS A;  5A2Q L;  4FVM A;  2ZXO A;  4B9X A;  4CHT B;  2XD4 A;  2SEB D;  1OXU A;  1ZHQ A;  4C5C A;  4FBT A;  4LF8 Q;  1ILQ A;  4DV0 H;  3CCE A;  1VQ8 A;  3GV3 A;  5KFU A;  2R92 A;  1SND A;  2N55 A;  4RUA A;  1MHW C;  1IBM L;  4R4C A;  5EOY A;  1VQK A;  4XYL B;  3AU7 A;  1MJE A;  3RZD B;  2LMC B;  4QIW E;  3Q8Q B;  4L5S A;  2F0O A;  4ZKC B;  4ABN A;  1KRT A;  2K4K A;  5JAV A;  5DLG A;  4MTD A;  1I50 H;  3GII A;  3T53 B;  3GTO B;  2HGS A;  2DLN A;  2KEC A;  2XIW A;  1E2Z A;  1PLF A;  2O2L D;  3KFU A;  3FMA A;  1QVF A;  1NUC A;  3VYS A;  2JP1 A;  3MFI A;  4JV0 A;  4LFB L;  4RGO S;  3QIA A;  3PO3 H;  2KJX A;  4GKJ Q;  4DV2 H;  1UC9 A;  1V43 A;  4YCW A;  1VQL A;  2MO0 A;  2UUA H;  5E4X A;  2VQE H;  3GTP H;  1KJ9 A;  5JH7 F;  3BVM A;  3G7L A;  2ENB A;  2PO4 A;  4WRD A;  3CQZ A;  2LFN A;  3P1H A;  2B63 A;  5C0X H;  4KI0 A;  5FK9 C;  5GAH C;  3BG3 A;  2XGT A;  5KFQ A;  3BYY B;  1I4H A;  2AMC B;  4EEY A;  3HOX H;  4DUY H;  4UCO A;  3H94 A;  4AIM A;  1HUM A;  1KJJ A;  5JEA J;  2V4D A;  1I6H B;  4XX0 B;  1T9H A;  1K28 A;  1E4G T;  1QJO A;  3NBH A;  3HBL A;  1UNN C;  3KJO A;  1GO3 E;  2WP8 J;  1TXY A;  1B1Z A;  3J81 L;  4A3J G;  3GTO A;  3SVM A;  1ET6 A;  1QOH A;  4O42 A;  4BY1 H;  3A8K E;  4Q0F A;  2UUC L;  1CK1 A;  2HD3 A;  2K05 A;  2F0Q A;  1UNS A;  4IUP A;  2R92 H;  4NP5 A;  2FFK B;  1MI2 A;  1JXL A;  4HNU A;  2Y0S G;  4PZ8 A;  2EVB A;  1IW7 D;  5BMV F;  5FO7 B;  1L0W A;  3JAM E;  4RKB A;  5LMN H;  1WSC A;  4J9L A;  4X3K A;  2F0W A;  4H0L C;  4HR7 B;  4CKB A;  4FNF A;  4DV4 Q;  1PFS A;  5C5M A;  3MXG A;  2QA4 A;  2YS7 A;  4B3S H;  3L2P A;  4KJO A;  2NUC A;  3CPW A;  2B2T C;  2J6S A;  4NXN H;  1R9T B;  4Q0Y A;  5JVH 3;  3M7G A;  2F0E A;  5I6W A;  1AUX A;  1HR0 L;  5FO9 B;  2CQY A;  4DR6 Q;  2VA3 A;  1I4P A;  1HZC A;  1MSG A;  2PBZ A;  1YIT A;  1F77 A;  4LSX A;  1YBY A;  2B2U A;  4EG0 A;  3S15 H;  4DUZ L;  4O4I F;  1RF2 D;  2C2R A;  4PQX A;  2RDH A;  2B63 H;  4C56 C;  4B3T Q;  1GYF A;  1PYS B;  4OO1 G;  3T5K A;  3TZU A;  4CDE C;  4APV A;  1XMQ L;  2B3G A;  2I80 A;  3UDG A;  2BA1 A;  3HB9 A;  5FPO A;  1ILP A;  2RBM A;  4KKT A;  4DV3 L;  2KUM A;  1SFO B;  4HMI A;  4A3I B;  1HNW H;  5M5Y H;  3F2U A;  4YY3 H;  1F9S A;  4QJF A;  4R7R A;  3RZD H;  4A3G G;  4BY7 B;  5IGC A;  2VPS A;  2JYO A;  2F0H A;  2R85 A;  1X6O A;  4G4K A;  2M2L A;  1SE3 A;  4JI6 L;  5K36 G;  4IPC A;  4Q44 A;  4QWC A;  2R7N A;  4EEQ A;  1S5D D;  3GTO H;  3PVX A;  3I70 A;  1K73 C;  4MA5 A;  3QZ7 A;  3ERQ A;  1Q81 C;  1XDN A;  1AW7 A;  4JI5 H;  4WBN F;  4RB3 C;  1SRO A;  4RU9 A;  3I73 A;  4A3B G;  4OGQ C;  2A73 B;  3TP8 A;  3JAM c;  1PTO C;  4ALP A;  1K1S A;  1L1O B;  2UXB L;  1JCK B;  4MV9 A;  4OX9 L;  1ZQ7 A;  1OO9 B;  5IT9 c;  5CA0 F;  1N56 A;  2CWA A;  1OXT A;  4KLK A;  4X66 Q;  2TSS A;  5JJI A;  3G6V A;  2IJ0 A;  5J22 A;  2PMZ E;  5J1Z A;  1CKN B;  4EQP A;  3K5M A;  2JA6 G;  5JUM A;  3M85 A;  2WTF A;  4LH7 A;  2R7M A;  2BDN A;  1HUN A;  5KG1 A;  1SFO A;  5BR8 Q;  1HZB A;  2EZV A;  1RIP A;  3ITP A;  1IBK Q;  1RYS A;  1E2V A;  1I6H H;  3PZP A;  4J1M A;  2B39 A;  2QF7 A;  1STB A;  1B04 A;  3H09 A;  2HUG A;  3P7J A;  5T1I A;  4FF1 A;  2IY5 B;  4BWG B;  5KFP A;  1TS5 A;  2UVR A;  5C0X J;  3OMC A;  5KNC A;  3HOU B;  4B08 A;  1LV9 A;  2ZDG A;  4X62 H;  3QZ8 A;  3GV6 A;  4NLG A;  2YRX A;  2X0S A;  2F0M A;  4XQJ A;  1PH3 A;  1T5X D;  1TAE A;  1DJR D;  4BA1 I;  2QDL A;  1L2F A;  1R4Q B;  5IGD A;  3FPU B;  2DUD A;  1Q90 A;  2Z9H A;  1B33 N;  2PVP A;  2V4R A;  4ECT A;  1JWS D;  2KQ3 A;  2MQH A;  4PMW A;  1EYD A;  1G29 1;  2PNH A;  2IA6 A;  3NBI A;  3J7Y W;  3HG9 A;  3KHL A;  1QVG A;  1TWC B;  4PZ7 A;  2UU9 H;  2H1E A;  1PZJ D;  4KHP L;  2SNS A;  3D3R A;  1Z47 A;  3HOY B;  5CV8 A;  1S5B D;  4KKU A;  1WJJ A;  1B6R A;  3P75 A;  3PIO A;  4ED0 A;  1EYC A;  3I4L A;  1HNZ L;  1HJP A;  1S5E D;  2JQO A;  3LGJ A;  3X3M A;  5DG9 A;  4LF7 H;  1K8G A;  1Y1V G;  2BE5 C;  4C2M B;  4MV4 A;  1DOK A;  4DR3 H;  3MVV A;  3V6K A;  2V4Q A;  2N88 A;  4C3I G;  4PNY A;  2HT1 A;  2B2W C;  3K8A A;  3O13 A;  2CWP A;  1S72 A;  3CCM A;  3LML A;  3LP8 A;  4QB4 A;  2HQL A;  3ETJ A;  5C4X G;  2R61 A;  3F2D A;  4J9M A;  1QUQ B;  3A56 A;  2E2H B;  4XZ3 B;  4DXF A;  1SFO H;  4EBC A;  5AFW A;  5KYL A;  4A3I H;  3QOL A;  1IYU A;  1CZW A;  4I65 A;  4AQY H;  2LS0 1;  4BY7 H;  3CU7 A;  5D65 A;  1TWC A;  2K7V A;  3T4A C;  1Z2N X;  4UCR A;  2R87 A;  4JV5 L;  5COY A;  5KG6 A;  2KEE A;  3EVQ A;  2NB0 A;  4KK7 A;  4GKK L;  1YNN C;  1EEI D;  4K0K Q;  1BQQ T;  2HJW A;  1DD2 A;  3PCO B;  4C1N I;  1SLJ A;  2FIN B;  2R8J A;  4C2M A;  4DV5 H;  4IPD A;  3CC4 A;  5IYD G;  1K83 B;  1PFB A;  1HTP A;  3RN2 A;  4X65 H;  1RTN A;  1PH9 A;  3R2T A;  1H9S B;  4B9W A;  2R93 B;  2F0I A;  3U4Z A;  3H0G G;  3C0F B;  4JUZ A;  3GTG B;  1M0T A;  4JI4 Q;  3FPP A;  3ETH A;  2EJM A;  2NYZ D;  1Z2O X;  1CA6 A;  4RWS C;  4OWX B;  1WD1 A;  4OIK A;  4I7Z C;  1D1K A;  3OUU A;  2BR0 A;  3EYY A;  3DEP A;  1IBL L;  4JI3 H;  4X64 Q;  1N34 H;  3GV5 B;  2NVX A;  1SDF A;  4JYA Q;  5FD5 A;  1VBG A;  3SE7 A;  1PTO D;  2GPW A;  2MO1 A;  4ME6 A;  3LWU A;  5HGQ A;  4UY8 C;  4HJ5 A;  3G6X A;  1N33 Q;  4DR5 H;  1S97 A;  2ES2 A;  1N36 H;  4DR2 H;  3I7F A;  4ZUJ A;  1JJG A;  1UE1 A;  5GON F;  1H9R A;  5KFS A;  5IYZ F;  1FR3 A;  1JWU D;  2MPM A;  5IWA Q;  4Q8F A;  2HVR A;  4UCU A;  4GLA C;  5T1G A;  1K83 A;  2E5L H;  4DAP A;  3PQI A;  4XYM B;  2PI2 A;  5EGT A;  3I55 A;  1TWC H;  2Y0S A;  1HFN A;  1D6E C;  3CVZ A;  4DL2 A;  2B29 A;  2J6T A;  3ZJY C;  2R7F A;  3HOY H;  5FLX L;  1EY6 A;  1EY8 A;  1J5E Q;  2UUB L;  4L5R C;  3GTG A;  3J81 j;  3DWQ A;  1HQR D;  5M5X B;  3NHH A;  1AP0 A;  4HJ8 A;  3HOV G;  5CB4 F;  1I6V C;  1PRT F;  4C2M H;  4A3E B;  3IFT A;  4HIK A;  1LTB D;  3RB4 A;  2R82 A;  5LL6 S;  3K81 C;  3Q1K A;  2FLN A;  1QVC A;  1X3Q A;  3MFY A;  4DR4 L;  4M7E A;  1AZQ A;  1M0W A;  1S0N A;  4JW0 A;  4EFB A;  3I8Z A;  2WAC A;  2JA8 G;  1BO0 A;  4P74 A;  1LM0 A;  3M4Q A;  4J6H A;  2W6Q A;  5KFK A;  2WAQ B;  3RV3 A;  2ZJR A;  1BCP C;  4B3M Q;  3FKI G;  5ELB A;  3HOW G;  4ED2 A;  2KCM A;  2EYP A;  2W6O A;  1HZA A;  3DM3 A;  1U4M A;  1IBM H;  4FO2 A;  1I4G A;  2QYZ A;  1X3F A;  2DIK A;  4KY7 A;  1I94 L;  4JG2 A;  2NVX H;  2YU9 B;  3GIM A;  1KLU D;  1EZ8 A;  1XNR Q;  2EY1 A;  2BE5 D;  5ELD A;  2E8G A;  4U7C A;  4A93 B;  2ZTC A;  1EQR A;  4APM A;  3FHW A;  2PN1 A;  3J80 W;  1Q86 C;  2ZTD A;  3NUC A;  3RD4 A;  3GTQ B;  1VAJ A;  3M4O B;  1N32 Q;  1K83 H;  3AYH B;  4TQU S;  1ZKO A;  3K5I A;  4LFB H;  1LTL A;  3K59 A;  2WYO A;  4DL6 A;  4J15 A;  2UXC L;  2WFW A;  5C4H A;  1VF5 C;  5IP9 G;  4QUF A;  1TA8 A;  2C35 B;  1S10 A;  1GLV A;  2RKS A;  4KV6 A;  4R4T A;  5IYC G;  1WCM G;  5EBD A;  5GAD C;  3GTG H;  3I4M B;  3HEJ A;  3GTJ B;  3K5H A;  2K04 A;  4AH6 A;  1V4Y A;  5AJ3 L;  2D2C C;  3AFQ A;  2AWO A;  3U9S A;  1A0I A;  4R9W A;  3CCJ A;  1YNN D;  5CV4 A;  2W7P A;  1PHJ A;  4HJ7 A;  2X69 A;  1EY0 A;  5DAU A;  2F3I A;  2B2Y A;  3URY A;  1YNJ C;  3W5O A;  2WAQ E;  1WD0 A;  1C8C A;  4DFA A;  1I7L A;  1JR0 D;  2UUC H;  1BVS A;  2KHI A;  4MTK A;  3OPO A;  3VR2 A;  5CBA E;  4DV0 Q;  5HGT A;  1TWG B;  2UVW A;  3VR3 A;  4OO1 H;  4JOI A;  4NPS A;  4CJ2 C;  1Q1E A;  1Q8I A;  5IT9 L;  4AYB E;  1X54 A;  4ZQ3 A;  2F0N A;  3V2T A;  3CAM A;  3K57 A;  1NBW A;  1IZ6 A;  2GPS A;  2NZ1 D;  5FJ8 H;  4QCL A;  3KHH A;  3LWB A;  5K36 H;  5JJK A;  1M7J A;  1AUV A;  5M5X H;  3RGZ A;  4HNT A;  3CHB D;  1DIK A;  1VQ7 A;  4GNX B;  3CCQ A;  4I55 F;  3KK7 A;  3S1M B;  4A3E H;  4LW1 A;  2PQE A;  1ENA A;  4EX5 A;  5KFA A;  1HR0 H;  1B8A A;  4LF4 L;  4A3B H;  1Y1V A;  1CFM A;  4RMF A;  4DV2 Q;  1IOV A;  5KFY A;  4OL7 A;  2HHH L;  1F2M A;  2UUA Q;  3IAY A;  3S17 B;  2VQE Q;  4P72 A;  3V4S A;  5EKK A;  3H20 A;  4DUZ H;  4CJ0 B;  2E2I A;  5I6Y A;  1GHJ A;  1EZ6 A;  3J81 i;  1JMC A;  4FM9 A;  2C2E A;  2XSC A;  1TWG A;  3BG5 A;  1M1K C;  2QEJ C;  1XMQ H;  1AFP A;  2JXM B;  4C5B A;  3CCL A;  2XC9 A;  4DV3 H;  2VB2 X;  4DUY Q;  2RHQ B;  3NEN A;  2VA2 A;  1CUK A;  5J39 A;  4FYD A;  1CKO A;  2YU9 H;  4C3H B;  1IYV A;  5C5L A;  3T56 B;  4A93 H;  1ZET A;  3KJP A;  2CHB D;  2TMP A;  5D1O A;  4JI6 H;  2L55 A;  2F0S A;  1PH8 A;  1BR9 A;  4OIJ A;  4CDC C;  3RJ0 A;  1X3E A;  3I56 A;  1Q82 C;  2NVQ B;  4F4W A;  2UXD L;  5EDW A;  3PSI A;  2ZJQ A;  1KC7 A;  3M4O H;  4LK1 C;  4XXE A;  1DV2 A;  4M1U B;  1JB7 A;  2JA9 A;  1XJV A;  2K50 A;  2CQA A;  1BCP D;  3CRK C;  1PMR A;  1UC8 A;  2UXB H;  2VL6 A;  4DV1 L;  1DZ1 A;  2ZXP A;  1DOM A;  3Q0A A;  1DCZ A;  4IRK A;  3AFP A;  2NU8 B;  5LMN Q;  1E22 A;  1HNX Q;  2ASL A;  1VQC A;  5ELE A;  3I4M H;  3E3X A;  2DJF C;  2NN6 G;  3FDT A;  4Q8E A;  2R3Z A;  4H13 C;  5FLM G;  3SK4 A;  4I7H A;  4NXM L;  3HZX A;  2D0O A;  3A7L A;  3QJY A;  1QNK A;  4B3S Q;  1PK8 A;  3H0G A;  5L37 A;  2DNE A;  4GKJ L;  4LMY A;  4IN3 A;  4EFE A;  2K5V A;  3A5Z B;  3CMA A;  4NXN Q;  2V58 A;  2EQS A;  4WJ3 M;  4DV6 L;  2F4V H;  1L2Z A;  2EDG A;  1XPO A;  1Y1V H;  1RJT A;  3MWD A;  4ED6 A;  3KYH C;  3I72 A;  1KAB A;  1MD2 D;  3PO2 G;  2C2D A;  3G4S A;  4C3I H;  2MGS A;  4QW9 A;  2HQE A;  3X3N A;  3PO3 B;  4RCN A;  1F9P A;  3F2C A;  1PRT D;  1TWG H;  2K33 A;  2NWG A;  3CC2 A;  1O7I A;  2KOL A;  4U68 A;  5JVL A;  1SNC A;  4LJZ C;  3S16 B;  3R5X A;  2VB3 X;  2F0L A;  4DK0 A;  2A1A A;  4GOP B;  4PWQ A;  1T5E A;  3L0O A;  4YHH Q;  4YY3 Q;  1OXV A;  2XRQ D;  2EY5 A;  1IW7 C;  3GD7 A;  1U4L A;  4E4T A;  3JRX A;  4MTN A;  2Z8L A;  3DMU A;  1AH9 A;  3H4D A;  2EXD A;  4KHP H;  3KHR A;  3HKZ B;  5IYB H;  5GAG C;  1LT5 D;  1YNJ D;  2K14 A;  2R6F A;  3N40 P;  3S1M H;  3KDF B;  4CC6 A;  1BBW A;  2ICI A;  4PDB A;  4JI5 Q;  2J7Z A;  3RUP A;  1HNZ H;  2R8K A;  1TS2 A;  4A3M G;  2CCZ A;  3QOJ A;  1CT1 D;  3PUW A;  4DAY B;  2I5H A;  2I8C A;  4BY1 B;  2JA5 G;  3MC0 B;  3VMM A;  5IYD H;  1CQI B;  1S4Z A;  1SBB B;  4JI2 L;  5DQG A;  4RGM A;  3VYR A;  2CW8 A;  2FMM A;  1VQ5 A;  4RHR A;  1LAB A;  4OO1 I;  3NQT A;  4C3J G;  4GZY C;  3WNZ A;  3RUZ A;  2YTX A;  4CC5 A;  3H0G H;  5DM6 3;  3H40 A;  4NB3 A;  1STN A;  4DK6 C;  1CSP A;  3U9O A;  1F9Q A;  3Q24 A;  2AQ3 B;  2W6N A;  4X3S A;  4QWD A;  3KTM A;  4A3L H;  1RD9 D;  4TV9 F;  4S3S A;  4KN7 C;  3NP8 A;  3H6M A;  1Q46 A;  4JI1 L;  4JV5 H;  5I2X A;  2DWC A;  1EFW A;  1YVC A;  1B9N A;  3T13 A;  5JVG 3;  3T1Y L;  1C9O A;  4K14 A;  4FXD A;  2WII B;  4GKK H;  2F4I A;  4X62 Q;  2VXW A;  2OCE A;  3J7A F;  2FLL A;  3IL8 A;  1VQJ A;  3U9T A;  1N48 A;  5ELN A;  3U4V A;  1VKZ A;  2KHS A;  2YZM A;  3S15 B;  3F8T A;  2R84 A;  4DAY A;  1B44 D;  4L8J A;  1KC8 C;  3JSL A;  3CQZ B;  2B63 B;  3S1N B;  4LUO A;  4R8U A;  1T36 A;  1V1O A;  4U67 3;  3HKZ E;  1NMG A;  3DWA A;  1RK6 A;  2VUG A;  4IWX A;  1X3P A;  2UU9 Q;  3BDC A;  1XPR A;  2LXK A;  4DK1 A;  5M5Y B;  3SDZ A;  1ESF A;  1ASY A;  1PYW D;  3T16 A;  2V5A A;  1KJI A;  3PN1 A;  1WCM A;  3OHX C;  4IOC A;  3NBH B;  1JJC B;  1EL0 A;  1D2B A;  2HVQ A;  2YS6 A;  3RBE A;  3A5U A;  1CE8 A;  4F88 A;  4LF7 Q;  1AE3 A;  3K7U C;  4YJ3 F;  4RA8 A;  2IWH A;  3ORQ A;  1IBL H;  2RCN A;  1WTQ A;  4UAI A;  2V1C C;  1CA5 A;  4LFA L;  1W6K A;  2ZM6 L;  1BBX C;  2EIF A;  2JEJ A;  5KYI A;  3LWE A;  4TV8 F;  1CSQ A;  3EJI A;  4DAV A;  1I4Q A;  2IHF A;  5M3M B;  4NKL A;  4UP9 A;  3I3C A;  3LX0 A;  4EQO A;  5EWE A;  3S16 H;  5EWF A;  3RTX A;  2F0F A;  5L9X A;  4BBR G;  1GJX A;  4F4Z A;  3GV8 B;  4OWW B;  4ZLT F;  3IG0 A;  3MFG A;  3A74 A;  1W3S A;  2Z0S A;  4AQY Q;  2KSW A;  5C3W A;  3VDY A;  3SE0 A;  4GLV B;  4ECZ A;  1DON A;  2OLS A;  1SE2 A;  5C5J A;  1UE6 A;  4GN5 A;  2UUB H;  3BA8 A;  1NAP A;  5GQO A;  5F9N A;  2RA4 A;  3MXN B;  4IFD G;  3RNU A;  1JE5 A;  3UFX B;  4JV1 A;  1SE8 A;  4HTH A;  2XIG A;  5NUC A;  5IP7 G;  3KF6 B;  5LXT F;  2PZW A;  2QEX A;  4TQR A;  4ED8 A;  1U0L A;  4DV5 Q;  4R4I A;  3MJF A;  2FLP A;  2GVB A;  1GOZ A;  3HFZ B;  3LNN A;  4P71 A;  4F50 A;  4X65 Q;  2L11 A;  3TQY A;  1XYI A;  3T5L A;  5KFH A;  4DR4 H;  4A76 A;  1CQF A;  4H02 A;  2C00 A;  1GKH A;  1AN7 A;  5KT6 A;  2EXZ A;  3K5L A;  3BAA A;  2C9O A;  3RGX A;  3OYY A;  1SSO A;  5C44 B;  1PH5 A;  4LNQ A;  1J9O A;  1WCM H;  2M9V A;  5HY6 A;  2JK8 A;  2VNU D;  4BBS B;  3HS0 C;  1B2T A;  5KT2 A;  2BQR A;  4LFC L;  2JJQ A;  4LF6 L;  3I4N G;  1I6U A;  2WB1 B;  4LF5 L;  4Q45 A;  4RNO A;  3BVZ A;  5ELF A;  4L63 B;  3VR6 A;  4YR0 A;  1I94 H;  2F0T A;  1VQN A;  1N34 Q;  3VPD A;  4GC6 A;  4P2C B;  3PIP 3;  2SCU B;  3MXN A;  1AEX A;  1SMY C;  4DR5 Q;  2B2T A;  3FVQ A;  2SOB A;  1XMO L;  1M90 C;  1GM5 A;  4DR2 Q;  1CKM A;  5D1P A;  4TSS A;  4V0B A;  3KF6 A;  4KD3 A;  1BKB A;  1KDA A;  1WI5 A;  4WJW A;  1SYF A;  3CQZ H;  1I3Q A;  1PTO B;  1A3T A;  2ZT9 C;  3S1N H;  2F0J A;  2E5L Q;  4YIJ A;  5C4Z A;  4DV7 L;  2UXC H;  2BH8 A;  1VQ9 A;  3PW5 A;  2EYF A;  4G7O C;  1D5Z C;  1O7Z A;  2F0G A;  4DNR B;  3GTK A;  4MV7 A;  2Z6K C;  4K6D A;  1TQO A;  3SEB A;  2E75 C;  1KDC A;  2G9H D;  4FU0 A;  2H4O A;  2OTL A;  1EQV A;  1S0O A;  3G71 A;  3PMF A;  1FKA H;  1VQP A;  2WB1 A;  2R86 A;  2BQ3 A;  1STA A;  5KEE A;  4O4H F;  2YV5 A;  1H9J A;  3ULJ A;  4A3C G;  5FLX W;  1YI2 A;  1UEB A;  4U6P A;  5M3M H;  3Q8S B;  5M9O A;  3K0X A;  5DGA A;  2YYZ A;  2FJZ A;  3DF7 A;  1SYC A;  3H91 A;  1C0A A;  2DN8 A;  1EY4 A;  5L1L A;  1SYG A;  1TS4 A;  3OOC A;  3S9W A;  5KNB A;  3TP6 A;  1HXY D;  1IBM Q;  2I0Q A;  2Q2I A;  2WKC A;  2Z1C A;  5CYU A;  1EHI A;  2L1B A;  2XNA C;  2LY7 A;  3TBI B;  2Q2H A;  3FDS A;  1RL2 A;  3TEH B;  5LMN W;  3MWM A;  3CCU A;  1AN8 A;  4RGT A;  5IWA L;  2KCC A;  5IOD A;  3TN2 A;  3NGD A;  4LF9 L;  1F2L A;  1N9W A;  1PX2 A;  1C7Y A;  3PR5 B;  1Y1W G;  5G3L F;  3RN5 A;  4CDF C;  1K9M C;  5EKL A;  4UP8 A;  1TKW B;  2PYK A;  4YWK A;  1I3Q H;  2XCL A;  3S24 A;  2W8L A;  4LFB Q;  1MGS A;  3D4R A;  4A3D G;  4LF4 H;  2Q8T A;  2JA5 A;  3ULL A;  2HHH H;  4IAJ A;  3GTK H;  2N78 A;  4AYB G;  4IUT A; 
#chains in the Genus database with same CATH homology
 2JA8 G;  3S2D H;  4P74 A;  2VY3 A;  5C44 H;  1PH7 A;  3TRZ A;  4XTC S;  5H1S E;  1LM0 A;  3I4O A;  3M4Q A;  1MIU A;  2E2J H;  3E9I A;  3S1Q H;  4BBS H;  4A75 A;  2ZJR A;  4NXM Q;  4B3M Q;  4B3R L;  3FKI G;  2RHS B;  1VQF A;  3HOW G;  2KCM A;  4DK3 C;  3AEV A;  3JAM i;  1VQE A;  5E7N A;  1QZG A;  1HZA A;  1L1O C;  3DM3 A;  2ALY B;  4DV6 Q;  5C44 G;  4AQY L;  3U58 A;  2AKW B;  3CXC A;  3RR5 A;  1X3F A;  4BBS G;  2VS1 A;  3GTJ H;  2OWO A;  1I94 L;  4JG2 A;  2NVX H;  4GN3 B;  4Y52 H;  4QL5 A;  1XNR Q;  2E8G A;  2WB1 G;  2ZTC A;  5FLX c;  3KF8 B;  4DAM A;  4JI0 L;  1YNX A;  1EQR A;  2I5M X;  3FHW A;  2OTJ A;  5IP9 H;  1OXX K;  2KBN A;  1Q86 C;  5IE8 A;  2ZTD A;  2GVA A;  3W1B A;  3WWV A;  5LMU L;  1N32 Q;  2AHO B;  1Q12 A;  1K83 H;  3AYH B;  4TQU S;  5IYC H;  4DV5 L;  1YJW A;  3PUZ A;  2VZA A;  3PF5 A;  1LTL A;  3PF4 A;  2YTV A;  4JI8 Q;  4J15 A;  2UXC L;  2WFW A;  4X65 L;  5IP9 G;  1EOV A;  2C35 B;  3BZK A;  4JC0 A;  3M9B A;  3OW2 A;  4POF A;  4POG A;  1SN8 A;  4JI3 Q;  4R4T A;  3PV0 A;  2F52 A;  5IYC G;  1WCM G;  2CKZ B;  2PQA B;  3RLF A;  5GAD C;  2R7Z H;  3GTG H;  1YHA A;  4AH6 A;  1OTC A;  5AJ3 L;  3EN2 A;  3AFQ A;  4QGU A;  4A3K H;  2AWO A;  2R93 G;  1A0I A;  3CCJ A;  1N36 Q;  4YWL A;  1NTG A;  2I5L X;  1VQM A;  1XNQ Q;  4EQ5 A;  1V9P A;  1PHJ A;  3PUY A;  4HJ7 A;  2H5X A;  1HR0 Q;  2F3I A;  4JI3 L;  4DR1 L;  2Q2U A;  4JI2 Q;  3W5O A;  1N34 L;  3HOZ H;  3K80 C;  1Y14 B;  3H15 A;  2VQF Q;  3PUV A;  4A3K G;  4DUZ Q;  2WAQ E;  2ATW A;  4O2D A;  4DR5 L;  4DPG A;  4PZ6 A;  1GD7 A;  4C3J H;  5IY0 A;  3GTL H;  3UE1 A;  1N36 L;  3BZC A;  1BVS A;  2KHI A;  4DR2 L;  4DV0 Q;  3G6E A;  4K0K L;  1EUJ A;  1NJI C;  2IX1 A;  1X56 A;  1XMQ Q;  3HOZ G;  1WYD A;  1YIJ A;  3SGI A;  4JOI A;  1SR3 A;  4NPS A;  4DV3 Q;  1Q1E A;  2CFM A;  1NMF A;  4AYB E;  1PH6 A;  2E5L L;  1X54 A;  4R4Q A;  5C3E G;  2VQF L;  2Z6K A;  3MEF A;  3CAM A;  3CW2 C;  4JI1 Q;  3B6Y A;  1NBW A;  1IZ6 A;  4QQB X;  4HIM A;  2VUM H;  1G51 A;  5FJ8 H;  4JI6 Q;  1IXR A;  4DR7 Q;  4P75 A;  3T1H Q;  2PQA A;  4BA2 I;  3T1Y Q;  5M3F H;  4RG1 A;  5JJK A;  5M5X H;  4GOP A;  4BXX H;  2A19 A;  1VQ7 A;  4C3H H;  4GNX B;  1FGU A;  3STB C;  3CCQ A;  2ID0 A;  4JI4 L;  3NEM A;  4A3E H;  4LW1 A;  3HKS A;  1LUZ A;  3E9H A;  4IJL A;  4JI7 L;  4X6A H;  5JJL A;  2VUM G;  5FJ8 G;  1FJG L;  4EX5 A;  2BH2 A;  3OTO L;  1PA6 A;  4JBK A;  1B8A A;  2LSS A;  2WB1 E;  3KOJ A;  3T1H L;  3J80 c;  4LF4 L;  1IYJ B;  5M5W H;  2NVQ H;  4RMF A;  4X64 L;  3KDF A;  4DV2 Q;  4A3B H;  2UXB Q;  2HHH L;  1V1Q A;  2UUA Q;  3S17 H;  2VQE Q;  4P72 A;  3H3V I;  4JYA L;  3F1Z A;  4A3E G;  1OXU A;  3J81 i;  4LF8 Q;  1N33 L;  1JMC A;  1X55 A;  3GO5 A;  3CCE A;  1VQ8 A;  1M1K C;  3CCL A;  4L5T A;  4DUY Q;  2VQE L;  2RHQ B;  3NEN A;  2F4V Q;  1CUK A;  2WAQ G;  1IBM L;  1A63 A;  1CKO A;  4R4C A;  2YU9 H;  1VQK A;  1E1T A;  4LFA Q;  2ZM6 Q;  4A93 H;  1MJE A;  2PI2 E;  3KJP A;  4QIW E;  2NVY H;  4L5S A;  1PH8 A;  1KRT A;  2K4K A;  3RLO A;  1I50 H;  1J5E L;  1X3E A;  3I56 A;  1Q82 C;  2UXD L;  4IPG A;  3PSI A;  2K75 A;  2ZJQ A;  2F4V L;  3M4O H;  4DNI A;  3NEL A;  2L15 A;  3KFU A;  4A93 G;  1QVF A;  4GN4 B;  2XTI A;  4A3F G;  1JB7 A;  1P8L A;  2JA9 A;  3CCS A;  1XJV A;  2K50 A;  5GRO A;  4JCV E;  5FLM H;  1S40 A;  4LFB L;  3PO3 H;  4GKJ Q;  2VL6 A;  2NN6 I;  3I2Z A;  4DV1 L;  2JA7 G;  3TS2 A;  3E0E A;  1V43 A;  4YCW A;  1VQL A;  2MO0 A;  1EIF A;  1K8A C;  3EIV A;  3AFP A;  3GTP H;  5LMN Q;  1E22 A;  1HNX Q;  1VQC A;  3I4M H;  2NN6 G;  4IOA A;  4R4O A;  2HIV A;  2DGY A;  5FLM G;  4JBW A;  1L1O A;  3PO2 H;  4NXM L;  4KI0 A;  2MNA A;  2D0O A;  5GAH C;  1QZH A;  4B3M L;  2XGT A;  4B3S Q;  1KQS A;  3M7N A;  3S2H H;  4GKJ L;  2HIX A;  4LUV A;  5C0X I;  2K5V A;  2AMC B;  4A3J H;  3A5Z B;  5IP7 H;  3HOX H;  3CMA A;  2UUC Q;  2EQS A;  4NXN Q;  4WJ3 M;  4DV6 L;  3I4M G;  4AIM A;  1XPO A;  5JEA J;  1D8L A;  1Y1V H;  1HNX L;  1T9H A;  2IT1 A;  5C0X G;  3KYH C;  3CCV A;  1CKN A;  3PO2 G;  1KXL A;  3G4S A;  3KJO A;  4C3I H;  1GO3 E;  1XNR L;  2WP8 J;  1TXY A;  4A3J G;  1R9T H;  3HOX G;  3GTM H;  3F2C A;  1MKH A;  4OXP A;  4BY1 H;  2UUC L;  1TWG H;  5DLQ E;  3CC2 A;  1O7I A;  3S1R H;  4UPA A;  1PH2 A;  2NVT H;  4LFC Q;  1YHQ A;  3U50 C;  1N32 L;  4LF6 Q;  2R92 H;  4YCU A;  5GAE C;  1PV4 A;  4YWM A;  4R1J A;  2A1A A;  3BJU A;  4GOP B;  4LF5 Q;  4JI8 L;  2Y0S G;  1VQB A;  3L0O A;  4YHH Q;  4PZ8 A;  4YY3 Q;  4P73 A;  1OXV A;  5JEA G;  3GD7 A;  4A3M H;  1L0W A;  1OXS C;  4JV5 Q;  4MTN A;  3TS0 A;  3CPF A;  4MZ9 A;  3GDE A;  1AH9 A;  3D31 A;  2EXD A;  2R7Z G;  3UDF A;  2R92 G;  2MFI A;  2IX0 A;  2JA5 H;  5IYB H;  1XMO Q;  5GAG C;  2K14 A;  3S1M H;  3KDF B;  1Z9F A;  1BBW A;  1PFS A;  4DV4 Q;  1E1O A;  2QA4 A;  2BA0 A;  4O0A A;  3L2P A;  4YHH L;  4HIO A;  3DLL A;  4JI5 Q;  2CCZ A;  4A3M G;  3CPW A;  4L5Q A;  1VS0 A;  3PUW A;  4DAY B;  2I5H A;  3BU2 A;  1XNQ L;  4DV7 Q;  1HR0 L;  2JA5 G;  1WOC A;  5IYB G;  1Q8K A;  1KL9 A;  5IYD H;  4DR6 Q;  4JI2 L;  1HZC A;  1YIT A;  1VQ5 A;  1YBY A;  4OO1 I;  3S15 H;  4DUZ L;  1YJ9 A;  2GN5 A;  2B63 H;  4B3T Q;  4A3G H;  1DGS A;  2YTX A;  4DV0 L;  1PYS B;  1A8V A;  3H0G H;  4OO1 G;  4NB3 A;  4APV A;  4DK6 C;  1UE5 A;  1CSP A;  2B3G A;  3UDG A;  1XMQ L;  2BA1 A;  1EIY B;  2A8V A;  1VQ6 A;  1G6P A;  1A62 A;  4DV3 L;  1UWV A;  4HJA A;  1JJ2 A;  4A3L H;  1TWA H;  3STB D;  3F2B A;  5M5Y H;  4A3C H;  1IBL Q;  4QJF A;  4GLX A;  1Q46 A;  4JI1 L;  3RZD H;  4A3G G;  1QUQ A;  1KRS A;  1X6O A;  5M3F G;  1EFW A;  3M4P A;  4JI6 L;  4DR7 L;  1YVC A;  4IPC A;  5K36 G;  3T1Y L;  4BXX G;  3GTO H;  1C9O A;  4OX9 Q;  1K73 C;  4X62 Q;  2OCE A;  4A3L G;  1X65 A;  1Q81 C;  1VQJ A;  4TVA B;  1I5F A;  1NE3 A;  5ELN A;  3U4V A;  3F8T A;  2Q2T A;  1KD1 C;  1SRO A;  3L7Z C;  1K0R A;  3M3Y H;  4OON A;  3CP0 A;  1KC8 C;  3HOU H;  4A3B G;  3JAM c;  4ALP A;  2R7D A;  2JA6 H;  1L1O B;  4LUO A;  2UXB L;  4DV2 L;  4OX9 L;  3J7A 5;  5IT9 c;  2UUA L;  3HKZ E;  1NMG A;  2CWA A;  1OXT A;  4KLK A;  4JBJ A;  2UU9 Q;  1XPR A;  3RLN A;  2KEN A;  1YJN A;  2LXK A;  3Q8D A;  4X66 Q;  1K9M C;  2UUB Q;  4LF8 L;  5JJI A;  4LF9 Q;  1ASY A;  1ASZ A;  2N49 A;  2PMZ E;  2JA6 G;  1CKN B;  3H3V H;  4IOC A;  2Y0S E;  3NBH B;  3M85 A;  4JBM A;  2YTY A;  1JJC B;  1VQA A;  1X3G A;  1Y1W H;  5BR8 Q;  1HZB A;  3A5U A;  1RIP A;  1N8R C;  1IBK Q;  4LF7 Q;  1AE3 A;  3W1G A;  3K7U C;  4PG3 A;  3CC7 A;  4DUY L;  1VQH A;  2NZH A;  3A0J A;  1I6H H;  4OWT B;  1H95 A;  2K5H A;  2RCN A;  2OQ0 A;  2V1C C;  3KLW A;  4BBR H;  4LFA L;  2IY5 B;  2ZM6 L;  2EIF A;  3IRB A;  1CSQ A;  3S14 H;  1X9N A;  2IHF A;  5C0X J;  3CME A;  2N3S A;  2D0P A;  4IFD J;  4UP9 A;  4GNX C;  3K7A H;  1WFQ A;  3S16 H;  1PH3 A;  4B3R Q;  1KIX A;  4BBR G;  4BA1 I;  5J3B A;  1KHI A;  1L2F A;  4OWW B;  4KHP Q;  1PH1 A;  2DUD A;  3J80 i;  3A74 A;  3PO3 G;  1J6Q A;  1W3S A;  2MQH A;  2Z0S A;  4PMW A;  4AQY Q;  3VDY A;  1HNZ Q;  1G29 1;  2PNH A;  4GLV B;  1AE2 A;  3PGZ A;  1I94 Q;  4IFD I;  1EWI A;  1UE6 A;  3UDX A;  1EQQ A;  1QVG A;  2E2H H;  1FVI A;  4GN5 A;  4PZ7 A;  1XPU A;  3CF5 A;  5LMN L;  2KCT A;  4Y7N H;  4JI0 Q;  4KHP L;  1Z47 A;  5GQO A;  3MXN B;  4IFD G;  3RNU A;  1JE5 A;  1TWF H;  1WJJ A;  1JT8 A;  3PIO A;  1SE8 A;  1YEZ A;  5ELO A;  2E2I H;  4B3S L;  5IP7 G;  1HNZ L;  1HJP A;  2JQO A;  3D0F A;  3KF6 B;  1VQD A;  1SRU A;  3LGJ A;  4YCV A;  3J7Z C;  2QEX A;  5LMU Q;  1PH4 A;  1U0L A;  4NXN L;  4DV5 Q;  3HKZ G;  4R4I A;  1K8G A;  1HR0 W;  1Y1V G;  2GVB A;  2KHJ A;  1IL2 A;  3HFZ B;  5C4X H;  1LYL A;  2UXC Q;  1XTD A;  4P71 A;  4X65 Q;  3TQY A;  1E7Z A;  2NZO A;  4A76 A;  2LXJ A;  2HT1 A;  3K8A A;  4H02 A;  1S72 A;  2CWP A;  1GKH A;  3I4N H;  1HNW Q;  3CCM A;  4BY1 G;  1Q7Y C;  2JEA I;  2HQL A;  5C4X G;  3OYY A;  3F2D A;  2VNU D;  1PH5 A;  4LNQ A;  1WCM H;  5HY6 A;  4HJ9 A;  1K3R A;  2JK8 A;  1NY4 A;  1QUQ B;  5AJ3 Q;  3AQQ A;  1KAW A;  2JA8 H;  4LFC L;  2K5N A;  1SFO H;  2JJQ A;  4GKK Q;  4A3I H;  2ASB A;  2R93 H;  4LF6 L;  1VQG A;  3I4N G;  1PVO A;  2OQK A;  4LF5 L;  1HNW L;  3ERS X;  3CD6 A;  4BY7 H;  4HID A;  1P16 A;  4YY3 L;  1VQO A;  4DR1 Q;  2K52 A;  3CCR A;  1VQN A;  1N34 Q;  1PYB A;  4JV5 L;  4LUZ A;  4GS3 A;  1Q1B A;  3UDI A;  1VQI A;  1VQ4 A;  1UE7 A;  4A3I G;  2ZJP A;  4DR5 Q;  1B70 B;  4DKA C;  1GM5 A;  1XMO L;  3ICE A;  1M90 C;  4GKK L;  4DR2 Q;  2JE6 I;  1CKM A;  1W2B A;  4DV4 L;  4BY7 G;  4K0K Q;  3KF6 A;  4WJ4 A;  3J81 c;  3EBE A;  4JI5 L;  1BKB A;  1B7Y B;  1FL0 A;  3PCO B;  1WI5 A;  1SLJ A;  3CQZ H;  3S1N H;  2CQO A;  4IPD A;  1BBU A;  2E5L Q;  3CC4 A;  5IYD G;  4DV7 L;  3RN2 A;  2BH8 A;  4MNO A;  2IHE A;  1VQ9 A;  5C3E H;  4DR6 L;  3TRE A;  4JOI C;  2VW9 A;  1PH9 A;  1TWH H;  2Z6K C;  1E24 A;  2B63 G;  3U4Z A;  1EYG A;  3H0G G;  4B3T L;  2OTL A;  4UP7 A;  4JI4 Q;  4IPH A;  3G71 A;  4JI7 Q;  4GOP C;  1VQP A;  4IJH A;  4OWX B;  2YV5 A;  3ULJ A;  1FJG Q;  1SMX A;  1HH2 P;  4KHZ A;  3OTO Q;  4A3C G;  3PIP A;  3UE0 A;  1YI2 A;  4LF4 Q;  1IBL L;  1UEB A;  4X64 Q;  2ZTE A;  2HHH Q;  5M3M H;  1GVP A;  3K0X A;  4JYA Q;  2YYZ A;  1U5K A;  2MO1 A;  1HZ9 A;  1C0A A;  2QGQ A;  5HGQ A;  4HJ5 A;  4UY8 C;  4X62 L;  1MJC A;  1N33 Q;  2ES2 A;  3I7F A;  1JJG A;  5C4J H;  1UE1 A;  5IWA Q;  4IO9 A;  2AWN A;  1YHB A;  5M3M G;  3JC6 6;  3ULP A;  4GLA C;  2N8N A;  4ME3 A;  3HOU G;  3RZO H;  1IBM Q;  2I0Q A;  2Q2I A;  2PI2 A;  5EAY A;  4A4I A;  3I55 A;  1TWC H;  1YZ6 A;  2Q2H A;  2R6G A;  3HOV H;  1RL2 A;  3TEH B;  4XIG S;  5LMN W;  1S3O A;  3CCU A;  2B29 A;  2RF4 A;  3ZJY C;  2R7F A;  5IWA L;  4DR3 Q;  2UU9 L;  3HOY H;  4X66 L;  2UUB L;  1D7Q A;  1J5E Q;  3PUX A;  4L5R C;  4DR4 Q;  4A3D H;  4LF9 L;  3J81 j;  1N9W A;  2UXD Q;  1C7Y A;  2FXQ A;  4HJ8 A;  1Y1W G;  1E3P A;  4FDB A;  3RN5 A;  3HOV G;  2JEB I;  4QY7 A;  4UP8 A;  1VCI A;  4YWK A;  2D62 A;  1I3Q H;  3FP9 A;  4C2M H;  3S24 A;  5BR8 L;  3G48 A;  1IBK L;  4LF7 L;  4HIK A;  3HOY G;  4A3F H;  4LFB Q;  4A3D G;  4DR3 L;  3K81 C;  3FKI H;  4DV1 Q;  3HOW H;  1QVC A;  3ULL A;  3ER0 A;  4GNX A;  4DR4 L;  2JA7 H;  4LWC A;  3GTK H;  2N78 A;  4AYB G;  3GTQ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...