2R7ZG

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r7zG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r7zG01
1VQEA 4A3EH 2F52A 3RLFA 3BU2A 2HHHL 1P16A 3KFUA 2ALYB 4JI1L 3PIOA 4X66L 2VW9A 4IJHA 1MJEA 2HHHQ 4A3EG 3F2DA 3AYHB 3CMEA 4X66Q 3B6YA 4A3DG 1C7YA 4LFBL 1OXTA 1EIYB 4A3DH 4A3FG 4KHPQ 5M5WH 3GO5A 3RLNA 4K0KQ 1HZAA 1HR0Q 2AWNA 3OYYA 1Z9FA 4A3FH 1VQOA 1X9NA 2HIVA 4OX9Q 4GOPA 4YCWA 4DV0L 1HNXL 1FGUA 3PF5A 4LF5L 2CQOA 4LF5Q 4NXNQ 1TWFH 4DUZQ 3A5UA 1KL9A 4YCUA 4BY7H 4GKJQ 2KBNA 2E2HH 2R93G 3L7ZC 2UXDQ 3UDGA 1PV4A 1N36L 2R93H 4DR4L 4GN5A 4PG3A 4BA2I 5E7NA 4DR4Q 2UUBL 1NY4A 1TWGH 2RCNA 3LGJA 4X62Q 1IZ6A 3ZJYC 4LF7L 3M3YH 4C3JH 4J15A 1D7QA 3RZOH 3K8AA 1VQ4A 2IX1A 4DV3Q 2MNAA 1Q7YC 4LF8L 1PH4A 1SLJA 3PV0A 1GKHA 5ELOA 3ULPA 5IWAQ 4IOAA 2ID0A 5K36G 4MZ9A 4YWLA 5JJKA 2ZTDA 1HZCA 3PCOB 1IYJB 1OXUA 4R4IA 3BZCA 1NE3A 4DR1L 2UXBQ 3J81c 4QQBX 4JV5Q 3DM3A 4P73A 2VQEL 4JI5Q 4JBKA 1N33L 1T9HA 1X65A 2IT1A 2Z6KC 4YHHL 2Z0SA 3I7FA 2VQEQ 1QUQA 3J7ZC 2K5NA 4YHHQ 4KLKA 4XTCS 1KAWA 4DV2L 1L1OA 2E2JH 4TVAB 1XJVA 1I5FA 3KF8B 5AJ3Q 4GLXA 3STBC 1HNZQ 1ASYA 4A75A 1VS0A 1DGSA 1X56A 1SRUA 3S16H 3AQQA 2VUMG 4WJ3M 3G6EA 2JA6H 4A3MG 1PH7A 2VUMH 3NEMA 5HGQA 1VQPA 1BVSA 1N8RC 2GVBA 4PMWA 4JI4Q 4LF4Q 1BBUA 4DAYB 2Q2UA 1A62A 5JJIA 1L0WA 2E2IH 2E5LL 5M3FG 1B7YB 2WB1E 1YHQA 1YEZA 2GN5A 4IPCA 4P71A 3F2BA 5M3FH 2R7DA 3JAMc 3FKIG 3I4OA 1XPRA 4YY3Q 3I2ZA 5C4XG 2JQOA 3FKIH 2CKZB 5C4XH 3M9BA 4Y52H 4IPHA 1I50H 1SE8A 4X64Q 4Y7NH 1K8GA 3IRBA 2UUAL 1YITA 3UDIA 2VY3A 4DK6C 1TXYA 4JCVE 1BKBA 3CP0A 2DGYA 4DAMA 2ZM6Q 1SROA 4JI6L 2K4KA 4LWCA 1KD1C 1RL2A 1E7ZA 1KC8C 4MTNA 4DV1L 1AH9A 3S2HH 4FDBA 1WI5A 4DV5L 4DR5L 2WFWA 2N3SA 3RN2A 4JI2Q 1OXVA 1NBWA 4OO1G 4DV5Q 4DR7L 2ASBA 4DR6L 1NJIC 2UXDL 4DR7Q 3E9IA 4DR6Q 1J6QA 1LYLA 2JE6I 4R4QA 1A0IA 4LUZA 3HOZG 3GTLH 3CCRA 1RIPA 2Y0SE 4LFCQ 4A3IG 1B70B 1YJNA 2JEBI 1VQKA 3HOZH 1X3GA 2R7ZG 2N49A 4DV7L 4DPGA 1FJGQ 4A3IH 2OWOA 2R7ZH 1PA6A 2CWPA 3S2DH 1E22A 2PMZE 4C2MH 5FJ8G 2EQSA 4EQ5A 2JA5G 3A74A 3GD7A 4X65Q 4JI0Q 2UXCL 4HIKA 5FJ8H 4B3RL 2JA5H 1I94L 4LF6L 3NELA 4BA1I 4P72A 2UXCQ 3PO3G 3KDFB 3S17H 1H95A 1I94Q 2XGTA 4LF6Q 4LFAL 1L2FA 1XMQL 2I5LX 5J3BA 3PO3H 1G6PA 1Q1EA 2RHSB 1XMQQ 4AQYQ 2NZHA 1HNWQ 1GVPA 4EX5A 3RR5A 1Q46A 1VQJA 2EIFA 3KJPA 5GAHC 2N78A 4UP9A 5FLMG 5FLMH 2A19A 4L5SA 1QVGA 4JI1Q 4JOIA 3GTQH 1WCMG 3JC66 1XTDA 4DUYL 1XNQL 2A8VA 1CKNB 2D0PA 1WCMH 2BA0A 2RHQB 3FP9A 3CCJA 3CPWA 5LMNW 3J81j 1VQBA 1YI2A 4JI8L 3I55A 3PF4A 1J5EL 3S1MH 2WB1G 4DV0Q 1HNXQ 1EYGA 2KENA 1J5EQ 3CAMA 3STBD 2QGQA 3G71A 1M1KC 4B3ML 3J81i 1PFSA 4JG2A 1PH1A 2OTLA 3U4ZA 1M90C 1CSQA 3K80C 1N36Q 1K0RA 2YYZA 3PUXA 1KIXA 1HR0W 4GNXA 3L0OA 1YNXA 3NENA 2ZJQA 2CFMA 3S14H 2UUBQ 1V9PA 4B3TL 2I5HA 5JEAG 4OXPA 1EQRA 4LF7Q 4GKKL 1A8VA 2OQKA 3W1BA 4C3IH 3HOVG 1N32L 4JYAL 3S1QH 3K7UC 4HJ7A 3HOVH 1WOCA 4IJLA 4JYAQ 2NZOA 4LF8Q 5GAGC 3CC7A 3PGZA 3AFQA 2A1AA 2KCTA 2KHIA 3HKSA 3CCMA 3MEFA 2AKWB 2ES2A 4GLVB 4QY7A 5GROA 4DV4L 1Z47A 2JK8A 3SGIA 2Y0SG 1JMCA 2UU9L 2OQ0A 4DR1Q 1IBLL 4BXXG 1EIFA 3NBHB 2PQAA 4BXXH 3E9HA 1PH5A 2ZTCA 4DR2L 1N33Q 4A3GG 4DNIA 2IY5B 1NMGA 2KHJA 2MFIA 4L5RC 4A3GH 3TQYA 3JAMi 3H3VI 4ALPA 2NVQH 4DV2Q 1KQSA 4JI3L 2YTXA 2ZTEA 3VDYA 2CCZA 1VQDA 2B29A 2LXKA 2JEAI 3ICEA 4DK3C 2H5XA 2LSSA 4NPSA 4A4IA 5GADC 1QVFA 1LTLA 4LFBQ 4BBRG 4GLAC 2UUCL 1G51A 1HZ9A 2YV5A 3M7NA 3S15H 4BBRH 3EIVA 1IXRA 2HQLA 1VQ9A 4RG1A 2MO1A 1LM0A 2CWAA 1U0LA 1X6OA 3H0GG 3PSIA 4L5TA 4A3MH 4IFDI 4A3CG 4A93G 3K7AH 3KF6A 4A3CH 1S72A 4A93H 2E5LQ 2AWOA 2R6GA 5IT9c 3UDFA 1NTGA 1VQIA 2QA4A 1N34L 3GTJH 3AEVA 2NVYH 1VQAA 4DV6L 1UE5A 1N9WA 2WAQE 2WP8J 1VQNA 1PH3A 2ATWA 1PVOA 1D8LA 4PZ8A 1IBML 1OXSC 2K52A 1JJ2A 3CCVA 1IBMQ 4L5QA 4GOPC 2UUAQ 4UY8C 3EN2A 1UE7A 1CKMA 1E1OA 1PH6A 3MXNB 1ASZA 1VQGA 4JI6Q 4DR3L 5IP7G 3PIPA 1LUZA 2F4VL 1HJPA 1EQQA 1VQLA 5IP7H 4DV1Q 4RMFA 1YHAA 2IHEA 2F4VQ 3WWVA 5IYCG 1UEBA 4HIMA 3TEHB 4LNQA 4DR5Q 4JI7L 2JA6G 3GTKH 5C0XI 4A3KG 5IYCH 4A3LG 2HIXA 5M5XH 4JI7Q 4O0AA 3KOJA 3PUZA 3HKZE 4A3KH 4B3SL 2AMCB 4DKAC 1VQ7A 4A3LH 4R4CA 3RNUA 3TS0A 4PZ6A 1Y1VG 5DLQE 4YWMA 4IFDJ 1JT8A 4BY1G 2K5VA 1Y1VH 2NN6I 1OXXK 3K81C 4DV7Q 1QUQB 3T1HL 4BY1H 4HIDA 1GO3E 3J80i 4AYBE 1L1OB 1JJGA 4A3BG 3U58A 3HOWG 1GD7A 2C35B 4NB3A 2OCEA 4A3BH 2BA1A 2Q2HA 3RLOA 4IO9A 3HOWH 4B3RQ 4X6AH 2K75A 3TREA 3F1ZA 1KXLA 4LFAQ 1KRSA 2Z6KA 2VQFL 1Q81C 1I6HH 4P74A 4WJ4A 4LF9L 5LMUL 1Y14B 3CF5A 1QVCA 1NMFA 1Y1WG 5H1SE 2XTIA 1Y1WH 4PZ7A 1L1OC 2PNHA 4HJ9A 1PH2A 1K8AC 1YVCA 2ZJPA 1FL0A 2R92G 3GTOH 1HH2P 1U5KA 3S24A 2DUDA 1VQCA 1VCIA 3M4QA 5IY0A 1S40A 4OONA 2YU9H 1EUJA 2R92H 3A5ZB 3J80c 2IHFA 2KCMA 4DUYQ 1XNQQ 5C0XJ 1EWIA 1CSPA 1AE2A 4JBMA 3CCUA 1XMOL 4HIOA 4HJAA 5LMNL 1TWAH 4JI8Q 1YHBA 3U50C 3F2CA 4KI0A 1V1QA 1C0AA 1SN8A 3HFZB 1KRTA 1YBYA 4UPAA 1E3PA 2AHOB 2WAQG 4HJ5A 2MO0A 2ZJRA 4POFA 4B3MQ 4AH6A 4QIWE 5HY6A 3W5OA 3BJUA 4NXML 4C3HH 3UE0A 1PH8A 1K9MC 4KHPL 3GTPH 4K0KL 3GTGH 3T1YL 1HR0L 4NXMQ 2NVTH 3CC4A 4OX9L 4LW1A 3CC2A 1VQ6A 3T1YQ 1E24A 3RN5A 4B3TQ 1VQ5A 2BH2A 4GKKQ 1UWVA 2EXDA 1N32Q 4NXNL 3HOYG 4GS3A 3TS2A 4DUZL 4A76A 1X3EA 1SFOH 1Q82C 1TWCH 1XNRL 4BY7G 3HOYH 1Q86C 4GKJL 2HT1A 1MJCA 3CCLA 1XNRQ 1VQ8A 2JJQA 3HKZG 4R4OA 2IX0A 3G48A 4DV4Q 1UE6A 3ULLA 2BH8A 1K3RA 1KHIA 4H02A 1VQMA 1S3OA 4X62L 4UP7A 2UU9Q 2B63G 1MIUA 1CUKA 2FXQA 1IBLQ 5M5YH 2B63H 4DV3L 4AYBG 1FVIA 3FHWA 4DR2Q 1B8AA 3RZDH 3I56A 2I0QA 1IL2A 1E1TA 1QZHA 2Q2IA 5IWAL 3J7A5 4GN3B 3CD6A 4JI3Q 3CQZH 1HZBA 2UXBL 3BZKA 4JV5L 3PUYA 2PI2E 1JE5A 4JI5L 4A3JG 5C44G 2UUCQ 5JEAJ 1W3SA 4A3JH 1SMXA 5IE8A 5C44H 3PUVA 5ELNA 1PYSB 3H0GH 5IP9G 2D62A 3Q8DA 3A0JA 3UDXA 3CCSA 4GOPB 1IBKL 1UE1A 1YZ6A 4GN4B 5IP9H 5IYBG 1IBKQ 1VQHA 3KLWA 3UE1A 2QEXA 1JB7A 5JJLA 2K50A 5IYBH 4IPGA 5IYDG 1GM5A 5AJ3L 1HNZL 1Q1BA 5FLXc 3W1GA 3OW2A 5IYDH 2OTJA 1WFQA 3H3VH 3KDFA 2R7FA 2VS1A 2V1CC 1N34Q 4JOIC 1A63A 2LXJA 1I3QH 4DV6Q 4GNXB 4JI4L 2JA9A 1Q8KA 1SR3A 4AIMA 4APVA 4LF4L 3HOUG 4OWWB 3HOUH 3GTMH 1JJCB 4JBJA 4IFDG 1O7IA 1MKHA 3AFPA 3L2PA 2YTVA 3PO2G 3DLLA 5GQOA 3M4OH 1X54A 1CKNA 1G291 1WYDA 4DR3Q 3PO2H 4IOCA 3KJOA 3S1RH 4YY3L 4OO1I 3I4MG 4JBWA 2JA7G 3ERSX 1X55A 4GNXC 3I4MH 4LUOA 4X64L 4R4TA 1YJ9A 5M3MG 2JA7H 2D0OA 2K5HA 3M85A 4POGA 2PI2A 5M3MH 4B3SQ 3G4SA 4HJ8A 3I4NG 2ZM6L 1YJWA 2PQAB 1K73C 4R1JA 1BBWA 1CKOA 3K0XA 2JA8G 3I4NH 2JA8H 1W2BA 3T1HQ 1YIJA 1V43A 4YWKA 4MNOA 1VQFA 3H15A 3E0EA 2NVXH 4JI2L 2VNUD 4QJFA 2N8NA 3U4VA 3D0FA 1XPOA 4BBSG 1PHJA 4O2DA 1X3FA 5C0XG 2VZAA 3CPFA 5C3EG 1AE3A 4BBSH 4LFCL 3S1NH 1P8LA 2F3IA 4JC0A 3PUWA 5C3EH 2YTYA 2VQFQ 3CCQA 1WJJA 2RF4A 1QZGA 4ME3A 2I5MX 3CMAA 5LMUQ 4LF9Q 1FJGL 5GAEC 1PYBA 4OWXB 3EBEA 1PH9A 1K83H 4XIGS 3GDEA 3KF6B 2E8GA 2L15A 2NN6G 3CXCA 2K14A 4JI0L 4OWTB 3CW2C 4X65L 1R9TH 3F8TA 3ULJA 2GVAA 1C9OA 3HOXG 1EFWA 3TRZA 3KYHC 1XPUA 4TQUS 4P75A 4YCVA 3HOXH 1TWHH 1EOVA 3D31A 3CCEA 1OTCA 5BR8L 4UP8A 3M4PA 2Q2TA 4AQYL 1HNWL 2MQHA 3ER0A 4QL5A 4KHZA 5BR8Q 5EAYA 4QGUA 1XMOQ 3OTOL 5C4JH 1Q12A 2B3GA 2VL6A 4IPDA 4LUVA 5LMNQ 3OTOQ
chains in the Genus database with same CATH superfamily
1VQEA 2JA5B 1GUSA 3BU2A 3L4KA 1GUWA 1P16A 2B63A 4JI1L 5C6AA 2VW9A 5FKAC 1MJEA 2FMCA 4QB4A 4AYBA 2K03A 3B6YA 4A3DG 5KG0A 5L37A 3OWFA 4A3DH 1I4QA 1JORA 1HZAA 1HR0Q 3KK7A 1X9NA 1T94A 1HNXL 2WINB 5EKIA 1MBYA 3PF5A 4RNNA 1O7LA 4LF5L 3GTQB 3RGZA 3M9MB 4JV2A 4LF5Q 2RVLA 4R8UA 4NXNQ 1PRTD 2R3ZA 5CV5A 2E2HH 4F88A 1N36L 1TS5A 4DNRB 4K6LA 2UUBL 1NY4A 2RSOA 4G7OC 3LGJA 1KBLA 4ZKCB 4YJ3F 4X64H 2IMWP 2FPPB 5I2YA 4N8FA 3SE7A 2MNAA 5LL6X 3RGXA 3TIGA 2ASJA 2FK1A 4FF2A 1A2UA 4QWEA 1KLUD 2FMMA 5IWAQ 2F0SA 3MR5A 1KNEA 3NTIA 2BOSA 5K36G 1EHIA 4DV1H 5K36H 4O42A 1I4XA 4DV5H 2E2IA 4DR5H 3DWAA 3I90A 4JI5Q 4OIKA 1SYXB 4DR6H 3V6HA 1BCPF 3T16A 1WTWA 3J7ZC 4QF4A 3FKIA 2E2JH 1L1OA 4TVAB 4DV7H 3H91A 2Y0SB 2KSWA 2MCTA 5KNCA 1ASYA 5CAEB 3STBC 2IJ0A 2TSSA 4JI0H 1VS0A 3QWNA 3X3NA 3PR5B 3FDTA 4ZQIA 2PMZB 2DNCA 2EJMA 3AQQA 3FPUB 3K59A 3EROA 4A3GB 5IIFA 4A3MG 1BVSA 2AQ1B 1WTXA 4PMWA 1S97A 2VXWA 4O4IF 3V05A 3K0YA 3E5NA 2E5LL 5ELBA 5KEEA 3GIKA 5JAVA 4UCUA 2ZJTA 4H0LC 4P71A 3PR4A 4MAMA 3T56B 4LMQD 3M7GA 2Z4IA 3E3XA 5EQ0A 3UI2A 4YY3Q 1XPRA 5KFJA 2MGSA 5KNBA 1B33N 2CKZB 4A93B 4DUYH 3M9BA 1XNQH 4C2MA 1I50H 4XYOA 1K8GA 3IRBA 3SXHA 3UDIA 2JA5A 1HNXH 3GTJB 4FF4A 2DGYA 4DAMA 4F4YA 4N9PA 3P20A 3P75A 5L9XA 1HA6A 1AH9A 5C5LA 1EWHA 1WI5A 1I7NA 2N3SA 4JI2Q 1NBWA 3ONAB 4OL7A 3GTMB 2R7KA 4R7RA 1U4LA 5IGBA 2UXDL 5BN4A 2R7LA 2UUBH 4DL7A 1J6QA 1LYLA 4R4QA 2UXDQ 3IL8A 3GTLH 3GTQA 2Y0SE 1AEXA 4LFCQ 4H13C 1I6UA 1VAJA 3RF2A 2NTTA 1HHVA 3TQ1A 3VMMA 3EA6A 3WO0A 4XQQA 3BYTB 2CWPA 4ZYSA 5EDWA 2F3VA 2J6TA 2PMZE 5K5PA 2EQSA 2PO4A 4X65Q 4HIKA 3NELA 4RNOA 4P72A 4O2BF 3NTHA 3J7AK 4LFAL 5M9OA 1E4FT 2NU9B 2A68C 5J3BA 5HURA 3QFFA 2R93A 4AQYQ 2NZHA 1LT4D 1Q46A 2EIFA 4MV1A 3T53B 4DR2H 3RB4A 2XNAC 4A3BB 3HOWB 5FLMG 1U4PA 3H4BA 2PQEA 3DMUA 3H40A 5FLMH 1QVGA 3NGDA 4JOIA 1TS4A 3JC66 2WIIB 3GILA 2RDFA 4RGMA 3QJYA 2A8VA 2R86A 2RHQB 1RTOA 1EYAA 3RB6A 1F2LA 4XYLB 4EBDA 3J81j 4JI8L 3I55A 1K8OA 5KFHA 1J5EL 1ESRA 1D1KA 3OHBA 1J5EQ 3MWMA 4EEYA 2R92B 2ALZA 4U7CA 2M00A 3BDCA 2OF1A 2E5LH 1SSOA 1PH1A 1M90C 3EVQA 5CV6A 4LK1C 3K80C 1KIXA 1A2TA 2PMZA 1HR0W 1PZJD 2ZJQA 4B3TL 3MWYW 1EEID 2RCFA 3T5HA 2WAQB 3W1BA 5IGEA 5CR3A 4DK0A 3K7UC 4HJ7A 1Z7TA 1GOZA 1WOCA 4IJLA 2G9DA 4C3HB 2NZOA 2XGPA 2MUYA 2A1AA 1M7JA 2AKWB 4DV4L 1Z47A 1CK1A 4HNUA 1F2MA 1JMCA 3A8KE 3FMAA 1SFOB 3N8DA 1EIFA 4JI7H 2PQAA 3N6RA 4MTDA 2CW7A 2IY5B 1B04A 2MFIA 4DNTB 3GV8B 2VB2X 1ZXTA 4DV2Q 3ETJA 2W9BB 1TWGB 2EDGA 4JI3L 1KQSA 3GV5B 2B2VA 2YTXA 2ZTEA 1DONA 2CCZA 1VQDA 1PMRA 2P5ZX 2LXKA 2XIWA 2LSSA 3DWQA 5GADC 4FU0A 1B4OA 1QILA 4F4XA 3S15H 2YV5A 5DG7A 4DAVA 2HQLA 4L5SA 4XYMB 1LM0A 2XSCA 2IL8A 4G7ZC 3R5HA 1JR0D 3Q0AA 5CA1F 3MR2A 1AW7A 5IT9c 2QA4A 3AEVA 4KD4A 4BWGB 4EBEA 1VQAA 1PRTC 5C44B 2FK3A 1SYGA 2I46A 2EY6A 2WAQE 1C8CA 1E4GT 3R2TA 1SYBA 1D8LA 1IBML 2CH4W 3K5HA 1KJJA 1IBMQ 2OEOA 2UUAQ 2CQAA 4UY8C 3BABA 5LMNH 3I3CA 1E1OA 5KFKA 1H9SB 4N8X1 4EVOA 5IP7G 1LUZA 1UAPA 5IP7H 4RB3C 3OMGA 2K7VA 4B9WA 5IYCG 1UEBA 2X69A 3TEHB 4HIMA 3HOUB 2B2WA 3GTKH 1WSCA 2BDOA 5C0XI 5IYCH 4EYHB 4NXMH 4KKTA 1F9QA 1WD0A 1F77A 4QIWB 4K0KH 3T1YH 3TP6A 4B3TH 1ILPA 5KG2A 5CBEE 1O75A 3TS0A 4PZ6A 5DLQE 3PO2B 4MV7A 2R92A 3KBGA 2F0JA 1TIID 3M4IA 1QUQB 4HIDA 1AP0A 2XIGA 2ENBA 3I4MB 3QR8A 4DUZH 3J80i 2F0GA 2JA7B 1A3TA 1VDZA 2C35B 1SJED 2OCEA 1TQOA 4IO9A 4X6AH 1M8AA 2HVQA 5A2QW 3F1ZA 1KXLA 3I4NB 2WAQA 3G8CA 4HNTA 4WJ4A 2QKIC 4LF9L 3BS1A 2PW7A 1Y14B 1W93A 1SMYD 3ORQA 1Y1WG 1Y1WH 4BS9A 2X6GA 1L1OC 1K8AC 2KCCA 4RNMA 5LOVF 1U5KA 1S40A 4ETSA 3S9WA 4JI3H 2W7PA 1SFOA 2B39A 2W6OA 3SK6A 1EWIA 5DGBA 4DK1A 1K83B 4JBMA 2Q8IB 1JDEA 2A69C 1TWAH 1ESFA 3J80E 4EFEA 2F0QA 3MVVA 3SVMA 4FVMA 1SN8A 1JDBB 1VMCA 2AHOB 2ZJRA 3IAYA 4B3MQ 4AH6A 2DJFC 4QIWE 5HY6A 3W5OA 3BJUA 3KHGA 3UE0A 1PH8A 2HJWA 3G6JB 3GTGH 2NVTH 1HCZA 3CC2A 1X3PA 2K6AA 2KJXA 2XGQA 4E6IA 1VQ5A 4IRKA 1KAAA 2BH2A 1SNPA 1UWVA 4LF4H 4I4TF 5KFQA 2F0KA 2BQRA 1DOMA 1X3EA 2OXPA 3TP7A 1TWCH 2F0HA 2RA4A 4NP5A 2BE5D 4ZQ3A 5I6WA 4GKJL 4A3DB 2W6NA 1VQ8A 3HKZG 4R4OA 2IX0A 1EEFD 1LT6D 1G6ZA 3E6ZX 4H02A 4X62L 4NDXA 3W2DA 4C1NK 1MSHA 1OO9B 2UU9Q 1MIUA 5M5YH 2F03A 1NCVA 2E2HB 1FVIA 4MV8A 4Q8FA 4J9RA 1H9SA 4NMZA 2I0QA 4I50F 4ED7A 1LTBD 1JWMD 5F9LA 1AUXA 3J7A5 5D3IB 4ABNA 1CZGA 3CQZH 2UXBL 4MA5A 4I65A 5KFPA 3KLSA 4RKBA 2PI2E 1JE5A 3GIIA 5L1LA 1EIHA 2UUCQ 3GTOA 2ICEC 2W6ZA 3H0GH 4LF9H 3A0JA 5IGDA 1STHA 1OTCA 1UE1A 1YZ6A 2D5DA 1VQHA 3UE1A 1K1SA 5IGCA 2QEXA 2JA7A 2K50A 4DL6A 5AJ3L 1FNVA 2W71A 3H3VH 4JOIC 2LXJA 4DV6Q 4ED1A 4C56C 2E2JB 1R4PB 1LLRD 5BR8H 3GTMH 4XQJA 5DG8A 1TT2A 2XVSA 4JBJA 1GHKA 3IFDA 4RA8A 2NU8B 1MKHA 3C1EA 3Q8PB 1EY7A 1UC8A 5GQOA 3M4OH 5EKKA 5KG4A 4DR3Q 1CKNA 4DGZA 1OWTA 3MZ5A 4A3MB 1ENFA 4JBWA 1RYSA 5FPOA 1K83A 5ELDA 3NE5B 1YJ9A 5M3MG 1B1ZA 1B2TA 1RF2D 2I80A 2X0SA 2PI2A 5M3MH 4B3SQ 1EQVA 2YU9A 2VQDA 1Y69U 4PMBA 4DV0H 1BBWA 2JA8G 3K0XA 4G3IA 4HNVA 2JA8H 1VBGA 4EBCA 4YWKA 4GKJH 5C1OA 4MNOA 1HRJA 2DY7A 1CHQD 1I50B 1VQFA 3H15A 4ECSA 2O4XA 5C4HA 4DR4H 2N55A 4MV9A 4Z9CB 2V59A 4O2DA 1X3FA 2VZAA 3CPFA 1RJRA 4X62H 4ECRA 3HS0C 4JC0A 4CKBA 2K32A 2K01A 2PYKA 1IYUA 4PV1C 5GAEC 1PYBA 2RSNA 3GIMA 2D9UA 3EBEA 1IKMA 2E8GA 1CQJB 2IWHA 4LF8H 1M0TA 3KALA 3KTMA 4OELB 1WD1A 3ULJA 3I91A 2B2VC 1WTHA 1U4RA 3HRZC 3J80L 3HOXG 3GTLB 3NBHA 2AGPA 4C1NI 1BF4A 1XPUA 3MFYA 4M9UA 3HOXH 5D1OB 2UXBH 3CCEA 1II3A 2E2HA 3K5MA 1TY2A 2MQHA 3K5NA 5DQIA 1SNQA 5EAYA 4A3EG 4YHHH 3I72A 1XXGA 1PFNA 4A3EH 2UVRA 2BQ3A 3D4WA 3NQIA 2HHHL 3KFUA 3D8GA 2ALYB 4RUAA 2AU0A 4X66L 3L9AX 2HHHQ 1SAPA 3AYHB 1B9NA 4X66Q 5EJWA 2IBKA 1EIYB 1ONLA 4KHPQ 2F0TA 3GO5A 3RLNA 3Q23A 2E76C 2WACA 3OYYA 4OX9Q 3VYRA 1VQOA 5LL6S 2DN8A 2CZGA 4O3PA 2EY1A 3A5UA 1KL9A 4YCUA 2YL2A 3TBIB 4EGQA 1PV4A 5E3FA 4F50A 4QUFA 4PG3A 4N9TA 1ZHSA 1PYWD 4BA2I 1K8MA 4WBNF 3H20A 3T5KA 4UCRA 1TWGH 2B2WC 4C3JG 3M3YH 5EWFA 4PDBA 4C3JH 4TV9F 1LO5D 3RZOH 3K8AA 3HZXA 1TVXA 1QOHA 1VQ4A 4XDXA 4DV3Q 2IX1A 3MXNA 1Q7YC 4ZLTF 4KKUA 5DM73 3PV0A 5T1IA 2WE6A 2ZT9C 1SMYC 3GQBA 1GSHA 2ID0A 5JJKA 2R84A 4YWLA 4TQRA 4R4IA 1OXUA 3BZCA 1NE3A 1CQIB 4DR1L 1NUCA 5E4WC 4O1NA 3TQTA 2EYPA 1N33L 1TKWB 2IT1A 2RDJA 1ZKOA 2Z0SA 3I7FA 3J81E 2K5NA 2UVUA 1PRTF 4KLKA 4XTCS 4O3SA 4CBVA 3MXPA 3Q6SA 1I50A 2KCNA 1I5FA 1HNZQ 1H9KA 5I9OA 1Z2NX 1X56A 4KK7A 2UXCH 3S16H 4B3RH 4L63B 4WJ3M 4LF6H 4RUCA 4I7ZC 1N8RC 2NVXA 4DAYB 2WKDA 1SE4A 4FYDA 2SCUB 4RGOS 1YEZA 2GN5A 3S15B 4MA0A 3PW0A 3GTLA 4DXGA 2NU6B 5D1OA 4DAPA 5C4XG 4UHVA 4GC6A 1KABA 5C4XH 2Z1CA 4IPHA 1PFBA 4X64Q 3JAME 4Y7NH 5J2UF 4LJZC 3TP5A 2JSOA 4IUQA 4TUYF 1BKBA 2R82A 2ZM6Q 4ECWA 1TWHA 1SROA 5KFDA 1XX8A 2EY5A 3OHAA 4MTNA 4DV1L 2J9GA 1FNUA 1Y8OB 3OIQA 4FDBA 4DV5L 1CE8A 4DR5L 2WFWA 3RN2A 4OO1G 4DV5Q 4DR6L 5KFEA 4OO1H 2H4OA 2YYAA 2HUGA 4DR6Q 2NZ1D 4RAUC 4LUZA 4ZAIA 3HOZG 2J6SA 1B70B 3HOZH 2JEBI 1DV2A 2N49A 4DV7L 1FJGQ 4O4LF 5I6YA 2OWOA 3GTKB 4EGJA 5I2XA 1U4MA 3S2DH 2EYFA 1PZID 1I4RA 4EQ5A 4JI0Q 4IUUA 3WOFA 2DJGC 3KDFB 3PO3G 3IN5A 5BN5A 4DR1H 1L2FA 3PO3H 4DF7A 1V1PA 5KX5F 4U673 3PW4A 1IBLH 5H80A 4HYKA 2JEJA 1HNWQ 5D14A 3OUZA 1N33H 2PBZA 5KFNA 1VQJA 2A6HD 3KJPA 2GPWA 4K8JA 3T5LA 5GAHC 4UP9A 5C5JA 1BO0A 5JVDF 3SHLA 4F4WA 2LS01 2A19A 4JI1Q 1RCVD 4XX0B 3OOCA 3KLSX 1XTDA 4DUYL 3OPOA 1XNQL 2ASDA 4JPBW 2O5IC 5NUCA 3CCJA 4ZRZA 1I6VC 5BMVF 2IA6A 1Y1WB 1I7LA 3S1MH 2WB1G 2NYZD 2W6MA 1HNXQ 5ELEA 1STGA 3V96A 1QNUA 3MR6A 3RB0A 3RAXA 2QGQA 1M1KC 2EYHA 3M9NB 2F0PA 4IR1A 1QJOA 1CSQA 1N36Q 1K0RA 1TWAB 2YYZA 1N34H 3Q22A 4GNXA 3R23A 2WKCA 3S14H 2CFMA 3R3OA 3RFCA 2UUBQ 4J9KA 4OHJA 4GKKL 1W96A 4K14A 4KMUC 2F3WA 3CU7A 3S1QH 2W6QA 3EQLC 3L4JA 4KY7A 1VF5C 3CC7A 3PGZA 3AFQA 2KCTA 3PIP3 2MHVA 3GTGB 4L6TB 2NVTB 3BQ2A 5M5WB 5GROA 2OLSA 2JK8A 4UCVA 3SGIA 3Q2OA 2B8GA 3J81L 1JX4A 1PFMA 2YW2A 1SYEA 4BXXG 2LMCB 5KIXA 1TWCB 4BXXH 3E9HA 5ELCA 1DIKA 4DR2L 5D3DA 4DNIA 2E74C 4X3UA 4L5RC 3HKZB 2FLNA 4ALPA 2FHTA 2NVQH 3T1HH 5EPJA 1HQMC 3Q24A 5M5YB 1CFMA 2DPIA 3ICEA 2V58A 4DK3C 1LTLA 4HN7A 1ZYRD 4U68A 1WTRA 4IZ8A 3I4LA 1IXRA 4RG1A 4A3MH 2CWAA 1SE2A 1X6OA 1D1IA 3PSIA 4L5TA 2F0DA 3GTKA 1S72A 3CQZB 3DUZA 1ICWA 5IT9W 2EY2A 2EJGC 1DJRD 1DZ1A 2E5LQ 2EOTA 4ED0A 3JAML 3A56A 2NVYH 1UE5A 5T14A 3G6VA 3OSNA 1K3BC 3H0GB 2R7ZA 1VQNA 3F2UA 1PVOA 4PZ8A 2EVBA 2EZVA 4L8JA 2C5CA 4RH6A 1MGSA 4XT3B 1SEIA 5CYUA 1S4ZA 3U9SA 3VPDA 1PH6A 2D2CC 5IGGA 1VQGA 1S10A 4Q0FA 4Y8VB 1VQLA 2IHEA 1M4VA 4K2KA 4JI7L 2JA6G 1W6JA 1LT3D 4JI7Q 2JA6H 2V5AA 1R4QB 3HKZE 5KNDA 1RK5A 1BXTA 3BYYB 4R4CA 3VYTA 3M4OB 3HG9A 1ZETA 3CKIB 4GKKH 5FO7B 1Y1VG 4IFDJ 1JT8A 4RFBA 2K5VA 1Y1VH 1O7YA 2NN6I 5A35A 4FBUA 4NXNH 1TWAA 4PNYA 3SEBA 3Q8SB 2L55A 4KJNA 1GD7A 5M3MB 1EY8A 3MTSA 4J6HA 2Q2HA 2K75A 4JK1C 4HMIA 2R61A 4LFAQ 2JA8B 2Z6KA 3MEHA 2DNEA 2VQFL 5A2QL 3KUPA 1DM0B 3PQIA 4PZ7A 3V4ZA 1F2ZA 2PCFB 1BNCA 5KFRA 3BZDB 2ZJPA 5IWAH 1HH2P 3S24A 4DN4M 5IY0A 3M4QA 1RTNA 1B50A 3A5ZB 1LV9A 1SNCA 3J80c 1JKJB 2KCMA 3RMHA 2NU7B 3CCUA 1XMOL 5LMNL 4Q44A 4JI8Q 2GLTA 3HKZA 1C0AA 2Y0SA 1KRTA 1YBYA 4X3SA 1IBKH 5KG6A 1HUNA 3GV7B 4ECQA 3HOXB 4HJ5A 1SYFA 4J9NA 1JICA 1UEAB 3CRKC 2KOLA 4NXML 1BQQT 3VR3A 2W9AA 4K0KL 3T1YL 4NXMQ 3CC4A 4LW1A 1VQ6A 4A3EB 3D4RA 3T1YQ 1E24A 4B3TQ 1ZHQA 1KJ9A 4IHJF 4MV3A 3NXWA 1JE4A 3CQZA 2EXDA 1U9RA 3HOYG 4DUZL 4EGVA 1S5ED 4F8MA 1Q82C 4BY7G 1F9PA 3HOYH 2R6FA 3N43B 1EWCA 2HT1A 2JEFA 4RWSC 3I73A 3BVGA 5L1IA 3OMCA 5DEHA 3G48A 3H0GA 4DV4Q 1RODA 3N41B 4X3KA 4F4ZA 5JH7F 1K3RA 2L1BA 4YY3H 1S3OA 2HD3A 2B63G 4LAAA 1SDFA 3GTJA 2B63H 1HTLD 2WYOA 3M9OB 2HCCA 4AYBG 1JOKA 3FHWA 2IX3A 1WTQA 1IKLA 2PZTA 3BVMA 3RZDH 4WD3A 4EG0A 3LWBA 1E1TA 2L9HA 5KFLA 2A6HC 1TU2B 4HQ6A 4K6DA 1JC7A 3M3YB 3O13A 3OSOA 4O2AF 5FD6A 3GTMA 1EY4A 4C3JB 4JI3Q 3CD6A 3RZOB 1HZBA 2X6LA 5EBCA 5BPHA 1E4EB 4JV5L 3RUPA 1DXMA 3TZUA 3PW7A 4A3JG 1Y8PB 4A3JH 1SMXA 1ZQ7A 3RBDA 2VQFH 4CC6A 3CCSA 2D62A 1VQKA 4GN4B 4ZUJA 4IPGA 3HP3A 4PWQA 4R8NA 2OTJA 5FO9B 1L0XB 3U9TA 3I8ZA 4X65H 2QILA 1I3QH 4HR7B 1EFID 2J7ZA 1MZBA 3K58A 1BUVT 2B2YA 1B3QA 4EQOA 4JI4L 2JA9A 1Q8KA 4Q5VA 4LF4L 1XMOH 4J9OA 2A5HA 4I55F 3OTOH 3SDZA 2YRWA 2IW3A 3AFPA 3PIO3 4FXGC 1C4QA 2YTVA 3L2PA 3S16B 4HSPA 1WYDA 1S03G 3KJOA 1LABA 4KTAA 1AZQA 3RAQA 4Q8EA 5KT2A 2JYOA 4GNXC 4LFBH 4U6PA 2D0OA 3MAQA 3OHXC 4HJ8A 1K73C 5KFTA 1CKOA 2F0OA 2V9WA 2I8CA 4IRCA 3VR4A 1MD2D 1W2BA 2IP4A 4KHVA 1WH2A 1PTOH 5C4XB 1QE6A 4Y7NB 4ZUIA 5I4DA 3M4YA 2FLLA 4QJFA 4UDUC 1MSGA 3G7LA 1PHJA 5C0XG 3MJFA 4IWXA 5C3EG 3PN1A 2A6ED 5I9PA 3MHBA 3S1NH 3PUWA 4OIJA 5C3EH 1HPCA 2RF4A 1QZGA 4LF9Q 1EYZA 2ZXPA 5J1ZA 4OWXB 1RYRA 1JOQA 3KF6B 1EU3A 3BG5A 1J8IA 2K14A 4OWTB 3CW2C 1FKAH 2GVAA 4GZYC 3KYHC 3HOZB 4YCVA 4JV5H 1EOVA 5BR8L 3DEOA 2QDBA 3QG1A 4KHZA 2Z9HA 4JW0A 5BR8Q 3S2DB 2VQEH 5C4JH 2W6PA 1C3OA 1RDPD 3G6EA 3V2TA 2W9BA 1TWGA 3RLFA 1BDOA 5CC4A 3LWEA 2F0UA 4X3TA 3K5IA 4FO2A 4O3RA 3PO3B 4IJHA 1E4EA 3VR6A 5F9NA 1OXTA 5KFZA 4A3FG 5M5WH 1QCBD 4XXEA 4F7XA 3KBXA 4A3FH 1GYFA 5EKLA 2M2LA 4DV0L 4J9PA 2E75C 4JI4H 1BJTA 1UUPA 3UFXB 1EY9A 2CQOA 4XT1B 3R93A 1TWFH 4K5VA 2R93G 4GKJQ 3BA9A 3X3MA 2KBNA 4YR0A 3V6JA 3ND8A 2YZGA 2R93H 1VBHA 5CV8A 4DR4L 4RB0A 3S1MB 1D5XC 1NAPA 5E7NA 4R8IA 4DR4Q 2DWCA 5KFUA 3MR3A 2WB1B 3QOJA 4MN3A 5EGTA 4X62Q 1IZ6A 4LF7L 4UCTA 4J15A 4CJ2C 1D7QA 2F0LA 4LF8L 4LH7A 2YS6A 1GKHA 1ILQA 5ELOA 3ULPA 3S14B 3GTPB 1D2BA 1UC9A 1BGWA 2ZTDA 1IYJB 5LP6F 3RV4A 2FJ2A 4QIWA 3S1QB 2UXBQ 3J81c 4QQBX 1XWEA 5FPRA 4DR7H 2SNSA 3MFHA 2C28A 4JBKA 1RK6A 1T9HA 1ENCA 1X65A 2Z6KC 4YHHL 2NUAB 2FLPA 1QUQA 4YHHQ 3SI8A 2AUKA 4JVZA 3U9OA 2RQXA 5FLXL 2I87A 3P7JA 3KF8B 5AJ3Q 4GLXA 4ECYA 2HVSA 5EWEA 5KFSA 2NB0A 5LXTF 1DGSA 1SRUA 4CKEA 1EZ1A 5DQGA 2VUMG 1F9SA 1I94H 5KG7A 4ILWA 2JEIA 2G5DA 1VQPA 2VUMH 2NVQB 5KT3A 2GVBA 1XMQH 4C5CA 4A2BA 1A62A 4YAJB 5IOCA 2SEBD 5JJIA 1ML0D 1RJPA 1RKNA 5M3FG 1B7YB 2WB1E 2HQEA 2KEDA 4ID6A 4IZOA 3F2BA 4CDCC 5M3FH 3JAMc 3DM1A 3I4OA 3IG0A 4E4TA 4Q43A 4DL5A 5LL6b 1TS3A 4YR2A 1SE8A 3VR5A 1PX2A 5KFMA 4ECXA 1FGBD 1TR5A 3TN2A 2VY3A 5KT7A 1TXYA 4ZHQF 2NVYB 1CA6A 4J0MA 4JI6L 4DL4A 4KD3A 4LWCA 1KD1C 1RL2A 2FP4B 3V4SA 4KN7C 3SR1A 1XDNA 1SNMA 4QWCA 4B3MH 1OXVA 5DG9A 2ASBA 3PZPA 2CHBD 4UAIA 1PLFA 4LF7H 2C2EA 3H3VC 3QIAA 1JCKB 4HTHA 4JYAH 2QCPX 1PA6A 3LMLA 3E0JA 1E22A 3NK9A 2JA6B 2YS7A 5KFIA 5FJ8G 2UXCL 4C5BA 3DXJC 5FJ8H 4B3RL 1SYCA 1WTVA 2FB9A 4LF6L 4R9WA 4BA1I 5T1GA 2UXCQ 3S17H 4NLGA 4LF6Q 3K3PA 1Y1VB 4B9XA 1G6PA 1Q1EA 2R7NA 1PXUA 5KFXA 3RR5A 2RDIA 1E2VA 2QEJC 3NPPA 2ASLA 2N78A 3PW5A 1WCMG 3TDQA 2UVVA 2D0PA 1WCMH 2BA0A 5LA6F 2W7OA 4CDDC 2K05A 1VQBA 4ECUA 2B2YC 1EOTA 1EYCA 4V190 3PF4A 4LH6A 1JLLB 1IOVA 2F0WA 5J22A 3A7LA 4FBTA 3H6MA 2KENA 1R9TB 2FE3A 3JZIA 4QUCA 4MHEA 3FRPB 2RKSA 2RDHA 3CAMA 3KF8A 3STBD 3G71A 3J81i 1H9JA 1PFSA 4JG2A 2OTLA 3U4ZA 1SJHD 1BXRA 3PUXA 2LKVA 4YJ2F 3NENA 5FO8B 2R87A 4IN3A 1AUVA 3NWSA 2R7MA 3RJ0A 2I5HA 1S5DD 3WNZA 3K5LA 4C3IG 5JEAG 5JVG3 1EQRA 1A8VA 2OQKA 4C3IH 4S3SA 5JEAH 3HOVG 1N32L 3GLKA 5CA0F 3H4DA 2A6EC 3P1HA 3HOVH 2FFKB 3CVZA 3F8NA 3LX0A 5KYIA 5GAGC 5E4XA 2KHIA 3CCMA 1JIHA 4JI6H 4GLVB 4QY7A 2OT2A 2VUGA 4RKLA 1KTKA 4DR3H 2F4VH 2AQ2B 2NUCA 2OQ0A 4DR1Q 5KT5A 4HCSA 1IBLL 1C30A 2W9CB 4QW8A 3HOYB 4K5WA 1ULZA 2ZTCA 1N33Q 4BY7B 4B3SH 4QWAA 1NMGA 4V0BA 3DWPA 3ZYYX 3QZ7A 2CVRA 3TQYA 3JAMi 2L5TA 4KY6A 4J9SA 1O7ZA 4K5XA 5TSSA 2K1BA 3BAAA 5BPFA 2B63B 2JEAI 1Z2OX 3A8JE 2H5XA 4A4IA 4AYBB 4LUVA 4BBRG 4GLAC 2JXMB 3RZDB 1G51A 1HZ9A 3M7NA 4RCNA 1AFPA 1ENAA 3CHBD 4BBRH 3EIVA 1VQ9A 4IFDI 4YBZB 3V6KA 5EWGA 3LWUA 3K7AH 4ULLA 4YR3A 1FD7D 2JA6A 1SBBB 4HSVA 2AWOA 3G6XA 1NTGA 1JB3A 2BE5C 1N34L 5KGUA 1M6VA 4ED2A 4A3JB 5GONF 3ETHA 5C3XA 1PZKD 1Y1VA 2A68D 4DXFA 4HMJA 2ATWA 3GIDA 3PW2A 1B44D 4L5QA 1F2YA 4HEDA 1GUNA 3EN2A 4RZQA 4I7AA 4I7HA 1I3QB 4G57A 1CQVA 3QO2A 5CMDA 3PIPA 1STAA 1HJPA 4DV1Q 4RMFA 2YRXA 3WWVA 3GTOH 4DR5Q 4J8QA 1NR4A 4A3KG 1STBA 3KLRA 4A3LG 5M5XH 4O0AA 3KOJA 3PUZA 4A3KH 4F87A 4FXDA 2ZDHA 4DKAC 4A3LH 4KHPH 2VR1A 3NTKA 4C5AA 4BY1G 1N32H 1B6RA 1AN8A 5JPMC 3K81C 4DV7Q 1NNXA 2AQ3B 3QOLA 3T1HL 4BY1H 3PVXA 4AYBE 1XNRH 2O5JC 1L1OB 2PZWA 1KDBA 3U58A 3D4DA 3RLOA 3W3AA 5D1PA 3TREA 1HFGA 3A55A 1SNOA 1I6HH 4P74A 2V4RA 1PTOB 4OGQC 5LMUL 2VA2A 3CF5A 3PMFA 4DV3H 2XRQD 3JRXA 5CV9A 1K28A 5FK9C 2F0VA 5A2QE 1O78A 4HJ9A 2HDMA 3UQ8A 1YVCA 3J80W 1A6XA 4J9MA 4FM9A 3S1NB 2DZDA 2YU9H 1KJIA 1VQCA 1VCIA 2HGSA 5C3EB 2XC9A 4OONA 2W9CA 2CH4A 2XCPA 5IODA 2IHFA 4DUYQ 1XNQQ 5KT6A 5FOBB 4HIOA 4HJAA 1YHBA 4G4KA 4C2MB 3F2CA 2PNRC 4KI0A 1S68A 5KG3A 1C48A 4UPAA 3EJIA 2B2UA 4DFAA 1N56A 2MO0A 4POFA 3L3OC 1HNZH 3OIPA 4EYIB 4CKCA 5C4JB 1ZEQX 1K9MC 3GTPH 4PMCA 1HR0L 4J1MA 4JV0A 1VKZA 2W8LA 4DAYA 4TQSA 2CW0D 4GKKQ 3RUZA 1SCUB 3GV3A 4NXNL 4GS3A 3TS2A 3NBIA 1Q86C 5L1JA 1MJCA 3QB3A 3CCLA 1EY5A 1L0YB 3NSWA 2LY7A 4A3FB 5IYZF 2FPIB 1KEEA 3BDLA 3ULLA 1KHIA 4O3NA 4ED8A 4XYQA 3VYSA 3OWEB 1CUKA 1TWFB 5KFGA 4G7HC 1W6KA 4IALA 1CI3M 2PVPA 5EBDA 4YIJA 2R93B 1I3QA 4DR2Q 1B8AA 3RBEA 4DA2A 3I56A 2R8JA 1IL2A 2ZM6H 1GUTA 1QZHA 1NSNS 2Q2IA 5IWAL 1CHPD 1Y1WA 2BQUA 1BCPB 1TAEA 4GN3B 4HCEA 2B2TA 4JV1A 3BZKA 3ORRA 4JI5L 1O80A 4K8IA 1V51A 3BG3A 3OW7A 5JEAJ 3HEJA 1V4YA 1I4GA 1W3SA 3WO1A 3PUVA 5ELNA 1PYSB 5CGKA 5IP9G 4GOPB 1IBKL 4UCSA 2YZMA 1H9RA 5LMUH 5IP9H 1IBKQ 1FJGH 5IYDG 2DPJA 1QB5D 1CZWA 5FLXc 5IYDH 4J9LA 3KDFA 2R7FA 3EFXD 2VS1A 2V1CC 4RGNA 1A63A 4H7BA 5FD5A 1I4PA 1S0NA 1MHWC 4CGYB 4AIMA 4OWWB 4FS2A 4EQPA 1JJCB 3ND9A 1HNWH 4CC5A 1O7IA 1AN7A 2WTFA 2FPGB 4QMGA 3LNNA 3HGBA 1CM9A 4RHRA 3DLLA 1Q90A 1X54A 1G291 2VUMB 3S1RH 4YY3L 4JI1H 1FNWA 2V4QA 3MWDA 3BDOA 1PTOD 4M7EA 3ERSX 1X55A 2WV6D 2FMAA 3KAJA 5COYA 2A69D 3H94A 4UCOA 1HR0H 4YAKB 3M85A 3N6XA 1IYVA 4ECVA 2GA4B 1YJWA 2PQAB 1BNZA 4FS1A 5M3FB 3D3RA 3SE0A 4NKLA 4LF5H 3C0FB 2AUJD 2A73B 2EYLA 1V43A 2B8FA 5HBRB 1LTTD 5IGFA 2NVXH 4JI2L 4UFZA 4QCLA 3N44B 4K2LA 5JVLA 3C3LA 2VNUD 1N36H 1IHZA 2N8NA 2O2LD 4BBSG 2VPQA 4XQNA 3BA8A 2KQ3A 3HBLA 4BBSH 2K04A 4LFCL 2F3IA 3CCQA 2VQFQ 4H44C 1GSAA 4DL2A 1WJJA 4ME3A 3CMAA 5DAUA 3GTGA 4XIGS 1A9XA 3GDEA 3C46A 3R5FA 4L1KA 2NN6G 1D5ZC 2NBFA 3A54A 4X65L 1R9TH 1JWUD 2NN6H 2PW5A 3F8TA 2VPSA 5C8YF 1EFWA 4CJ0B 1KDAA 3TRZA 2SDFA 1TWCA 4TQUS 4P75A 1TWFA 2AGQA 1TWHH 3D31A 3H09A 2Q2TA 1GGOA 3M4PA 4AQYL 4JI5H 1A3UA 3ER0A 4QL5A 1XMOQ 1A15A 4QGUA 4MV6A 3T4AC 3OTOL 5LMNQ 2B3GA 2VL6A 5EZYF 4RAYA 4ECTA 3OTOQ 1WTPA 2F52A 5D65A 2ZXRA 3S17B 1JWSD 4IUTA 3PIOA 2KVMA 3MFGA 3MXUA 2RGVA 3F2DA 2MPMA 3CMEA 2E2DC 3KXYT 4ZOLF 1N48A 2F1MA 5EPLA 1C7YA 4LFBL 4K0KQ 4LFBQ 2AWNA 1Z9FA 4MTEA 2HIVA 2KECA 4YCWA 4GOPA 1FGUA 5F2DA 3DF7A 3JRWA 1IW7D 1BCPD 1H9MA 3GIQA 1WCMB 4DUZQ 2PPBC 4BY7H 3L7ZC 3TP8A 1QNKA 3UDGA 1VF7A 2HDLA 4GN5A 3URYA 5KFYA 2EXZA 1Z6HA 2RCNA 3MXGA 1SE3A 2Z8LA 3ZJYC 1YNND 3RIZA 3BJYA 3GP7A 3SK8A 5KFAA 1PH4A 1SLJA 2L11A 1XTCD 4IUNA 4TKOB 2VUMA 3LP8A 2BCOA 4IOAA 2L4NA 4Q0YA 1Q8IA 4MZ9A 3PCOB 1HZCA 3J81W 1Y8NB 3RV3A 3T5JA 2M05A 4C3IB 2FINB 3I70A 4JI2H 1KLGD 3HOVB 4JV5Q 2A74C 3DM3A 3T51B 4P73A 1RHPA 2VQEL 1WTOA 1VMPA 5KFWA 2JEGA 2UXDH 4A2AA 2VQEQ 4LFCH 1ET6A 1SNDA 1HA5A 1DV1A 1KAWA 4DV2L 2W70A 3Q1KA 4QWDA 3N40P 1S9FA 1X3QA 1XJVA 2R8KA 1S5FD 2QK4A 4A75A 1GUOA 5KFBA 4BWSC 5FLXE 2DIKA 2XWJB 4RU9A 1PH7A 3NEMA 5HGQA 1DYQA 4LFAH 4JI4Q 4LF4Q 4AQYH 1BBUA 3Q8QB 2Q2UA 2EYMA 1Q3LA 4JUZA 2CW0C 5HGTA 5JJZA 5JOBA 3R2IA 3BVZA 1L0WA 3NHHA 2E2IH 5JUMA 2HVRA 2RGRA 3JAMW 2B2UC 2IPKD 1YHQA 5J39A 4IPCA 4BBRB 2ATLA 4NW2A 5EPKA 2LFNA 2R7DA 2QYZA 3FKIG 3JSNA 4RB1A 3I2ZA 2JQOA 1HXYD 3FKIH 3K7AB 3FVQA 4DLKA 4Y52H 2UUAL 1YITA 1STNA 5I47A 4JI8H 5CORA 4DK6C 1G91A 1G2SA 4JCVE 3CP0A 5BN3A 1KJQA 1J5EH 3RTXA 2K4KA 2J4XA 5G3LF 1E7ZA 1EUDB 1KC8C 4APMA 5KKNB 3S2HH 5DQHA 2BDNA 5L1KA 1ICFB 4DR7L 1LTID 4J9QA 1NJIC 1KC7A 4DR7Q 3E9IA 4YB8B 2F0MA 2JE6I 1A0IA 1ZYRC 3VA7A 3SK4A 5C0XH 1B9MA 1RIPA 1EZ8A 3CCRA 1B53A 4A3IG 5ISRA 1YJNA 3C2PA 1Z2PX 1X3GA 2R7ZG 1WCMA 5K2MA 4DPGA 3MFIA 4A3IH 3GTOB 2CW8A 2SOBA 2R7ZH 4C2MH 5M5XB 4A3KB 2JA5G 2PZUA 1A3VA 3A74A 3GD7A 3KHRA 3KHHA 2JA5H 1E2WA 1I94L 4DV4H 2B2TC 1EZ6A 1H95A 1I94Q 2XGTA 1XMQL 2I5LX 4BY1B 4WJWA 2RHSB 4KY5A 1XMQQ 1GVPA 3GIJA 4EX5A 1E0BA 3NP8A 2V4DA 4FXKC 3K57A 3R5XA 4ECZA 2AQ4A 2Q8RE 4WRDA 4DV2H 1TY0A 1JQYD 3GTQH 1I6HB 3RB3A 4WFN3 2ICIA 1CKNB 3FP9A 2ZDQA 4IQZA 1GXDC 3CPWA 5LMNW 3C1FA 4LMYA 1YI2A 1PTOC 2DLNA 4DV0Q 5KFCA 4RB2C 1QWYA 1EYGA 2YU9B 1DCZA 1G8ZD 4FF3A 4ED3A 4B3ML 3VPCA 2VA3A 2R8GA 2J6UA 4HR7A 3D6CA 2EJFC 3L0OA 1YNXA 5CV7A 1V9PA 4ZI7F 1CQFA 1AZPA 1K0SA 4ZKBB 1KNAA 4OXPA 4LF7Q 1IBMH 4JYAL 1DOLA 3FPPA 1JXLA 2UUAH 1CA5A 1S5BD 4JYAQ 4LF8Q 5JQWA 3HKSA 4XZ3B 3MEFA 2ES2A 3TMEA 4RGTA 3EPIA 1F9RA 2Y0SG 3K6OA 2XCLA 3AU7A 2R8IA 2UU9L 5DNFA 1D5MC 2QW7A 5J2TF 3FDSA 3NBHB 4KN4C 4KV6A 1PH5A 4A3GG 1CS0A 2KHJA 4A3GH 3H3VI 2N88A 1L2ZA 3TSSA 1HTPA 3NUCA 2EPBA 5ELFA 1HFNA 2K5QA 5G3LD 2O03A 3VDYA 2EE1A 3KAKA 2B29A 3BQ1A 2VB3X 2XRSD 4NPSA 1QVFA 2J0TD 1K1QA 2W8KA 5AFWA 2UUCL 2HCIA 2MO1A 1U0LA 3H0GG 4A3CG 4A93G 2XD4A 4DL3A 1T3NA 3KF6A 5CV4A 2XWBB 4A3CH 4CJ1B 4A93H 4LSAA 3R8BA 4RZRA 1B6SA 1IW7C 1BCPC 2R6GA 2W57A 3UDFA 1VQIA 1YNJD 3NQTA 3GTJH 1V8QA 4DV6L 4IR9A 1N9WA 1STYA 2WP8J 4CHTB 1PH3A 1NR2A 5IT9E 2KHSA 3SK5A 2M9VA 1OXSC 4QWBA 2K52A 1JJ2A 3CCVA 3CRLC 3E5SA 1SXTA 3VR2A 4GOPC 2CQYA 1YNNC 4KKSA 4TV8F 5DLFA 1UE7A 1CKMA 2K33A 2K5WA 3MXNB 5LHY1 1V1OA 1ASZA 3HXLA 1BOSA 4JI6Q 4DR3L 1GUGA 1STEA 2F4VL 1EQQA 4ODGA 3IFTA 1YHAA 2FK2A 2F4VQ 1KJ8A 2F0IA 4LNQA 2R8HA 4LSXA 1DD2A 3G6YA 2HIXA 1PK8A 4B3SL 2AMCB 3GV6A 1SYDA 4OEMB 1VQ7A 2XCAA 3RNUA 4MIUA 1UNSA 2C00A 1RJQA 4YWMA 2Q8TA 1S5CD 1M0WA 2OH2A 1EU4A 3S1RB 1FR3A 2P0AA 1OXXK 4RHSA 3TZDA 1EIGA 1GO3E 1CT1D 1JJGA 4A3BG 3VYUA 3HOWG 2WDTA 2WB1A 4NB3A 3WDNA 4A3BH 2BA1A 4B3RQ 3HOWH 3IKJA 2UU9H 5KG1A 1KRSA 1Q81C 3A8IE 4IURA 4DU9A 2AGOA 2H1EA 4M8AA 1QVCA 2NVXB 1NMFA 1T5EA 4ZK9B 2EYOA 5H1SE 3GTPA 4O3OA 2XTIA 1IOWA 3RD4A 4YQWA 1T5XD 2PNHA 1PH2A 4MV4A 2K28A 4BBSB 1FL0A 2R92G 2DUDA 4IUVA 1GHJA 2R92H 1EUJA 2UVWA 2C9OA 5DGAA 1PDQA 3JSLA 5C0XJ 1CSPA 1EYDA 1AE2A 4ME6A 2UUCH 3U50C 2L0CA 1V1QA 4MTKA 3HFZB 5C1PA 1E3PA 2WAQG 5KT4A 4IRDA 2PN1A 2F0EA 3K5OA 4QW9A 1TWHB 3J7AV 4C3HG 3AB9A 1UNNC 1TA8A 3MWEA 1IL8A 1DOKA 4C3HH 3A7AB 2G9HD 2KA7A 4DV6H 4KHPL 2XN9C 4M1UB 5C4ZA 4OX9L 4IWYA 1BR9A 4TSSA 4FF1A 3RN5A 4EFBA 2FJZA 1J9OA 2YCHA 1N32Q 1QG7A 2BR0A 4ME5A 2KUMA 4A76A 1SFOH 2R85A 1XNRL 3OUUA 5D8DA 5JPNC 4O3QA 1S0MA 3VA5A 1XNRQ 5C5MA 2JJQA 2MJ8A 5C3WA 3AMUA 2DY8A 1UE6A 2ZDGA 4YP3A 1EY6A 2BH8A 2ZXOA 1VQMA 2KEEA 3EYYA 1GLVA 4UP7A 1LT5D 1IBLQ 2FXQA 4DV3L 1LTGD 2RDGA 2QF7A 2NVYA 1V1PB 2C2RA 1LACA 2SNMA 2L12A 4FP5D 5JVH3 1JOOA 5DM63 2EYJA 1PRTB 2JN4A 1TS2A 1E2ZA 3PUYA 5KFFA 5C44G 4P2CB 1SEBD 3N52A 5IE8A 5C44H 2YZNA 1LTAD 3GIPA 3Q8DA 3UDXA 5E1FA 1ET9A 5IYBG 3TIIA 5FLXW 3KLWA 1JB7A 3I12A 5JJLA 5IYBH 1GM5A 1HNZL 5IT9L 2F4IA 5KFVA 1Q1BA 4R8UB 1RD9D 3W1GA 3OW2A 1WFQA 1LTRD 4CDFC 1N34Q 3MC0B 3DHQA 3J7YW 1BBXC 1EL0A 3K3VA 5CB4F 4GNXB 3FEWX 3HOUG 1SR3A 4IUPA 4APVA 3QZ8A 3HB9A 3HOUH 2NTSA 2F0NA 4ZCKA 1WR2A 4IFDG 1EUCB 3FMCA 1WVLA 3EPGA 4O4HF 4IFDH 2NWGA 2Z6BA 3WOEA 3PO2G 3N42B 3GQCA 1D6EC 1LTSD 3PO2H 5EOYA 2GPSA 4OO1I 4IOCA 2RBMA 4IAJA 2HHHH 4X66H 1I4HA 3I4MG 5HV6A 1MI2A 2TMPA 2JA7G 2VOBA 3I4MH 2JP1A 4LUOA 4X64L 4R4TA 2JA7H 2E2IB 3TINA 2K5HA 4POGA 1R9TA 1XYIA 4OX9H 5CBAE 3G4SA 4RAZA 3I4NG 2ZM6L 5KG5A 4CDEC 4R1JA 4RCOA 3I4NH 4B08A 2K5DA 3D6WA 1CTMA 5KRUA 3T1HQ 3FKIB 1YIJA 4TRDA 2C22A 3E0EA 1EQTA 3T13A 5KFOA 1B3AA 4PQXA 1S0OA 3U4VA 3D0FA 3MA2B 1XPOA 1T36A 4EEQA 4Q45A 1AE3A 1HUMA 2I07B 1P8LA 4WORA 2YTYA 2Z4HA 3J7AF 3S2HB 1FJGL 1GJXA 3Q8RB 2I5MX 5LMUQ 3DEPA 1PH9A 1K83H 2L15A 1HQRD 3CXCA 5KYLA 4JI0L 3OSPA 2F0FA 2C2DA 5LYJF 1PTOF 2FKLA 3VPBA 4FNFA 4EQNA 1C9OA 1X32A 5DLGA 1YNJC 1G2TA 4HAEA 4ED6A 3NWTA 1EY0A 1GSOA 4A3IB 2QDLA 2MP1A 4UP8A 2R7ZB 3BQ0A 1HNWL 1FYCA 3ITPA 1KDCA 1RJTA 4KJOA 1Q12A 4GC7A 4IPDA 3ERQA 3KHLA
chains in the Genus database with same CATH topology
1VQEA 4A3EH 2F52A 3RLFA 3BU2A 2HHHL 1P16A 3KFUA 2ALYB 4JI1L 3PIOA 4X66L 2VW9A 4IJHA 1MJEA 2HHHQ 4A3EG 3F2DA 3AYHB 3CMEA 4X66Q 3B6YA 4A3DG 1C7YA 4LFBL 1OXTA 1EIYB 4A3DH 4A3FG 4KHPQ 5M5WH 3GO5A 3RLNA 4K0KQ 1HZAA 1HR0Q 2AWNA 3OYYA 1Z9FA 4A3FH 1VQOA 1X9NA 2HIVA 4OX9Q 4GOPA 4YCWA 4DV0L 1HNXL 1FGUA 3PF5A 4LF5L 2CQOA 4LF5Q 4NXNQ 1TWFH 4DUZQ 3A5UA 1KL9A 4YCUA 4BY7H 4GKJQ 2KBNA 2E2HH 2R93G 3L7ZC 2UXDQ 3UDGA 1PV4A 1N36L 2R93H 4DR4L 4GN5A 4PG3A 4BA2I 5E7NA 4DR4Q 2UUBL 1NY4A 1TWGH 2RCNA 3LGJA 4X62Q 1IZ6A 3ZJYC 4LF7L 3M3YH 4C3JH 4J15A 1D7QA 3RZOH 3K8AA 1VQ4A 2IX1A 4DV3Q 2MNAA 1Q7YC 4LF8L 1PH4A 1SLJA 3PV0A 1GKHA 5ELOA 3ULPA 5IWAQ 4IOAA 2ID0A 5K36G 4MZ9A 4YWLA 5JJKA 2ZTDA 1HZCA 3PCOB 1IYJB 1OXUA 4R4IA 3BZCA 1NE3A 4DR1L 2UXBQ 3J81c 4QQBX 4JV5Q 3DM3A 4P73A 2VQEL 4JI5Q 4JBKA 1N33L 1T9HA 1X65A 2IT1A 2Z6KC 4YHHL 2Z0SA 3I7FA 2VQEQ 1QUQA 3J7ZC 2K5NA 4YHHQ 4KLKA 4XTCS 1KAWA 4DV2L 1L1OA 2E2JH 4TVAB 1XJVA 1I5FA 3KF8B 5AJ3Q 4GLXA 3STBC 1HNZQ 1ASYA 4A75A 1VS0A 1DGSA 1X56A 1SRUA 3S16H 3AQQA 2VUMG 4WJ3M 3G6EA 2JA6H 4A3MG 1PH7A 2VUMH 3NEMA 5HGQA 1VQPA 1BVSA 1N8RC 2GVBA 4PMWA 4JI4Q 4LF4Q 1BBUA 4DAYB 2Q2UA 1A62A 5JJIA 1L0WA 2E2IH 2E5LL 5M3FG 1B7YB 2WB1E 1YHQA 1YEZA 2GN5A 4IPCA 4P71A 3F2BA 5M3FH 2R7DA 3JAMc 3FKIG 3I4OA 1XPRA 4YY3Q 3I2ZA 5C4XG 2JQOA 3FKIH 2CKZB 5C4XH 3M9BA 4Y52H 4IPHA 1I50H 1SE8A 4X64Q 4Y7NH 1K8GA 3IRBA 2UUAL 1YITA 3UDIA 2VY3A 4DK6C 1TXYA 4JCVE 1BKBA 3CP0A 2DGYA 4DAMA 2ZM6Q 1SROA 4JI6L 2K4KA 4LWCA 1KD1C 1RL2A 1E7ZA 1KC8C 4MTNA 4DV1L 1AH9A 3S2HH 4FDBA 1WI5A 4DV5L 4DR5L 2WFWA 2N3SA 3RN2A 4JI2Q 1OXVA 1NBWA 4OO1G 4DV5Q 4DR7L 2ASBA 4DR6L 1NJIC 2UXDL 4DR7Q 3E9IA 4DR6Q 1J6QA 1LYLA 2JE6I 4R4QA 1A0IA 4LUZA 3HOZG 3GTLH 3CCRA 1RIPA 2Y0SE 4LFCQ 4A3IG 1B70B 1YJNA 2JEBI 1VQKA 3HOZH 1X3GA 2R7ZG 2N49A 4DV7L 4DPGA 1FJGQ 4A3IH 2OWOA 2R7ZH 1PA6A 2CWPA 3S2DH 1E22A 2PMZE 4C2MH 5FJ8G 2EQSA 4EQ5A 2JA5G 3A74A 3GD7A 4X65Q 4JI0Q 2UXCL 4HIKA 5FJ8H 4B3RL 2JA5H 1I94L 4LF6L 3NELA 4BA1I 4P72A 2UXCQ 3PO3G 3KDFB 3S17H 1H95A 1I94Q 2XGTA 4LF6Q 4LFAL 1L2FA 1XMQL 2I5LX 5J3BA 3PO3H 1G6PA 1Q1EA 2RHSB 1XMQQ 4AQYQ 2NZHA 1HNWQ 1GVPA 4EX5A 3RR5A 1Q46A 1VQJA 2EIFA 3KJPA 5GAHC 2N78A 4UP9A 5FLMG 5FLMH 2A19A 4L5SA 1QVGA 4JI1Q 4JOIA 3GTQH 1WCMG 3JC66 1XTDA 4DUYL 1XNQL 2A8VA 1CKNB 2D0PA 1WCMH 2BA0A 2RHQB 3FP9A 3CCJA 3CPWA 5LMNW 3J81j 1VQBA 1YI2A 4JI8L 3I55A 3PF4A 1J5EL 3S1MH 2WB1G 4DV0Q 1HNXQ 1EYGA 2KENA 1J5EQ 3CAMA 3STBD 2QGQA 3G71A 1M1KC 4B3ML 3J81i 1PFSA 4JG2A 1PH1A 2OTLA 3U4ZA 1M90C 1CSQA 3K80C 1N36Q 1K0RA 2YYZA 3PUXA 1KIXA 1HR0W 4GNXA 3L0OA 1YNXA 3NENA 2ZJQA 2CFMA 3S14H 2UUBQ 1V9PA 4B3TL 2I5HA 5JEAG 4OXPA 1EQRA 4LF7Q 4GKKL 1A8VA 2OQKA 3W1BA 4C3IH 3HOVG 1N32L 4JYAL 3S1QH 3K7UC 4HJ7A 3HOVH 1WOCA 4IJLA 4JYAQ 2NZOA 4LF8Q 5GAGC 3CC7A 3PGZA 3AFQA 2A1AA 2KCTA 2KHIA 3HKSA 3CCMA 3MEFA 2AKWB 2ES2A 4GLVB 4QY7A 5GROA 4DV4L 1Z47A 2JK8A 3SGIA 2Y0SG 1JMCA 2UU9L 2OQ0A 4DR1Q 1IBLL 4BXXG 1EIFA 3NBHB 2PQAA 4BXXH 3E9HA 1PH5A 2ZTCA 4DR2L 1N33Q 4A3GG 4DNIA 2IY5B 1NMGA 2KHJA 2MFIA 4L5RC 4A3GH 3TQYA 3JAMi 3H3VI 4ALPA 2NVQH 4DV2Q 1KQSA 4JI3L 2YTXA 2ZTEA 3VDYA 2CCZA 1VQDA 2B29A 2LXKA 2JEAI 3ICEA 4DK3C 2H5XA 2LSSA 4NPSA 4A4IA 5GADC 1QVFA 1LTLA 4LFBQ 4BBRG 4GLAC 2UUCL 1G51A 1HZ9A 2YV5A 3M7NA 3S15H 4BBRH 3EIVA 1IXRA 2HQLA 1VQ9A 4RG1A 2MO1A 1LM0A 2CWAA 1U0LA 1X6OA 3H0GG 3PSIA 4L5TA 4A3MH 4IFDI 4A3CG 4A93G 3K7AH 3KF6A 4A3CH 1S72A 4A93H 2E5LQ 2AWOA 2R6GA 5IT9c 3UDFA 1NTGA 1VQIA 2QA4A 1N34L 3GTJH 3AEVA 2NVYH 1VQAA 4DV6L 1UE5A 1N9WA 2WAQE 2WP8J 1VQNA 1PH3A 2ATWA 1PVOA 1D8LA 4PZ8A 1IBML 1OXSC 2K52A 1JJ2A 3CCVA 1IBMQ 4L5QA 4GOPC 2UUAQ 4UY8C 3EN2A 1UE7A 1CKMA 1E1OA 1PH6A 3MXNB 1ASZA 1VQGA 4JI6Q 4DR3L 5IP7G 3PIPA 1LUZA 2F4VL 1HJPA 1EQQA 1VQLA 5IP7H 4DV1Q 4RMFA 1YHAA 2IHEA 2F4VQ 3WWVA 5IYCG 1UEBA 4HIMA 3TEHB 4LNQA 4DR5Q 4JI7L 2JA6G 3GTKH 5C0XI 4A3KG 5IYCH 4A3LG 2HIXA 5M5XH 4JI7Q 4O0AA 3KOJA 3PUZA 3HKZE 4A3KH 4B3SL 2AMCB 4DKAC 1VQ7A 4A3LH 4R4CA 3RNUA 3TS0A 4PZ6A 1Y1VG 5DLQE 4YWMA 4IFDJ 1JT8A 4BY1G 2K5VA 1Y1VH 2NN6I 1OXXK 3K81C 4DV7Q 1QUQB 3T1HL 4BY1H 4HIDA 1GO3E 3J80i 4AYBE 1L1OB 1JJGA 4A3BG 3U58A 3HOWG 1GD7A 2C35B 4NB3A 2OCEA 4A3BH 2BA1A 2Q2HA 3RLOA 4IO9A 3HOWH 4B3RQ 4X6AH 2K75A 3TREA 3F1ZA 1KXLA 4LFAQ 1KRSA 2Z6KA 2VQFL 1Q81C 1I6HH 4P74A 4WJ4A 4LF9L 5LMUL 1Y14B 3CF5A 1QVCA 1NMFA 1Y1WG 5H1SE 2XTIA 1Y1WH 4PZ7A 1L1OC 2PNHA 4HJ9A 1PH2A 1K8AC 1YVCA 2ZJPA 1FL0A 2R92G 3GTOH 1HH2P 1U5KA 3S24A 2DUDA 1VQCA 1VCIA 3M4QA 5IY0A 1S40A 4OONA 2YU9H 1EUJA 2R92H 3A5ZB 3J80c 2IHFA 2KCMA 4DUYQ 1XNQQ 5C0XJ 1EWIA 1CSPA 1AE2A 4JBMA 3CCUA 1XMOL 4HIOA 4HJAA 5LMNL 1TWAH 4JI8Q 1YHBA 3U50C 3F2CA 4KI0A 1V1QA 1C0AA 1SN8A 3HFZB 1KRTA 1YBYA 4UPAA 1E3PA 2AHOB 2WAQG 4HJ5A 2MO0A 2ZJRA 4POFA 4B3MQ 4AH6A 4QIWE 5HY6A 3W5OA 3BJUA 4NXML 4C3HH 3UE0A 1PH8A 1K9MC 4KHPL 3GTPH 4K0KL 3GTGH 3T1YL 1HR0L 4NXMQ 2NVTH 3CC4A 4OX9L 4LW1A 3CC2A 1VQ6A 3T1YQ 1E24A 3RN5A 4B3TQ 1VQ5A 2BH2A 4GKKQ 1UWVA 2EXDA 1N32Q 4NXNL 3HOYG 4GS3A 3TS2A 4DUZL 4A76A 1X3EA 1SFOH 1Q82C 1TWCH 1XNRL 4BY7G 3HOYH 1Q86C 4GKJL 2HT1A 1MJCA 3CCLA 1XNRQ 1VQ8A 2JJQA 3HKZG 4R4OA 2IX0A 3G48A 4DV4Q 1UE6A 3ULLA 2BH8A 1K3RA 1KHIA 4H02A 1VQMA 1S3OA 4X62L 4UP7A 2UU9Q 2B63G 1MIUA 1CUKA 2FXQA 1IBLQ 5M5YH 2B63H 4DV3L 4AYBG 1FVIA 3FHWA 4DR2Q 1B8AA 3RZDH 3I56A 2I0QA 1IL2A 1E1TA 1QZHA 2Q2IA 5IWAL 3J7A5 4GN3B 3CD6A 4JI3Q 3CQZH 1HZBA 2UXBL 3BZKA 4JV5L 3PUYA 2PI2E 1JE5A 4JI5L 4A3JG 5C44G 2UUCQ 5JEAJ 1W3SA 4A3JH 1SMXA 5IE8A 5C44H 3PUVA 5ELNA 1PYSB 3H0GH 5IP9G 2D62A 3Q8DA 3A0JA 3UDXA 3CCSA 4GOPB 1IBKL 1UE1A 1YZ6A 4GN4B 5IP9H 5IYBG 1IBKQ 1VQHA 3KLWA 3UE1A 2QEXA 1JB7A 5JJLA 2K50A 5IYBH 4IPGA 5IYDG 1GM5A 5AJ3L 1HNZL 1Q1BA 5FLXc 3W1GA 3OW2A 5IYDH 2OTJA 1WFQA 3H3VH 3KDFA 2R7FA 2VS1A 2V1CC 1N34Q 4JOIC 1A63A 2LXJA 1I3QH 4DV6Q 4GNXB 4JI4L 2JA9A 1Q8KA 1SR3A 4AIMA 4APVA 4LF4L 3HOUG 4OWWB 3HOUH 3GTMH 1JJCB 4JBJA 4IFDG 1O7IA 1MKHA 3AFPA 3L2PA 2YTVA 3PO2G 3DLLA 5GQOA 3M4OH 1X54A 1CKNA 1G291 1WYDA 4DR3Q 3PO2H 4IOCA 3KJOA 3S1RH 4YY3L 4OO1I 3I4MG 4JBWA 2JA7G 3ERSX 1X55A 4GNXC 3I4MH 4LUOA 4X64L 4R4TA 1YJ9A 5M3MG 2JA7H 2D0OA 2K5HA 3M85A 4POGA 2PI2A 5M3MH 4B3SQ 3G4SA 4HJ8A 3I4NG 2ZM6L 1YJWA 2PQAB 1K73C 4R1JA 1BBWA 1CKOA 3K0XA 2JA8G 3I4NH 2JA8H 1W2BA 3T1HQ 1YIJA 1V43A 4YWKA 4MNOA 1VQFA 3H15A 3E0EA 2NVXH 4JI2L 2VNUD 4QJFA 2N8NA 3U4VA 3D0FA 1XPOA 4BBSG 1PHJA 4O2DA 1X3FA 5C0XG 2VZAA 3CPFA 5C3EG 1AE3A 4BBSH 4LFCL 3S1NH 1P8LA 2F3IA 4JC0A 3PUWA 5C3EH 2YTYA 2VQFQ 3CCQA 1WJJA 2RF4A 1QZGA 4ME3A 2I5MX 3CMAA 5LMUQ 4LF9Q 1FJGL 5GAEC 1PYBA 4OWXB 3EBEA 1PH9A 1K83H 4XIGS 3GDEA 3KF6B 2E8GA 2L15A 2NN6G 3CXCA 2K14A 4JI0L 4OWTB 3CW2C 4X65L 1R9TH 3F8TA 3ULJA 2GVAA 1C9OA 3HOXG 1EFWA 3TRZA 3KYHC 1XPUA 4TQUS 4P75A 4YCVA 3HOXH 1TWHH 1EOVA 3D31A 3CCEA 1OTCA 5BR8L 4UP8A 3M4PA 2Q2TA 4AQYL 1HNWL 2MQHA 3ER0A 4QL5A 4KHZA 5BR8Q 5EAYA 4QGUA 1XMOQ 3OTOL 5C4JH 1Q12A 2B3GA 2VL6A 4IPDA 4LUVA 5LMNQ 3OTOQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQE A;  4A3E H;  2F52 A;  3RLF A;  3BU2 A;  2HHH L;  1P16 A;  3KFU A;  2ALY B;  4JI1 L;  3PIO A;  4X66 L;  2VW9 A;  4IJH A;  1MJE A;  2HHH Q;  4A3E G;  3F2D A;  3AYH B;  3CME A;  4X66 Q;  3B6Y A;  4A3D G;  1C7Y A;  4LFB L;  1OXT A;  1EIY B;  4A3D H;  4A3F G;  4KHP Q;  5M5W H;  3GO5 A;  3RLN A;  4K0K Q;  1HZA A;  1HR0 Q;  2AWN A;  3OYY A;  1Z9F A;  4A3F H;  1VQO A;  1X9N A;  2HIV A;  4OX9 Q;  4GOP A;  4YCW A;  4DV0 L;  1HNX L;  1FGU A;  3PF5 A;  4LF5 L;  2CQO A;  4LF5 Q;  4NXN Q;  1TWF H;  4DUZ Q;  3A5U A;  1KL9 A;  4YCU A;  4BY7 H;  4GKJ Q;  2KBN A;  2E2H H;  2R93 G;  3L7Z C;  2UXD Q;  3UDG A;  1PV4 A;  1N36 L;  2R93 H;  4DR4 L;  4GN5 A;  4PG3 A;  4BA2 I;  5E7N A;  4DR4 Q;  2UUB L;  1NY4 A;  1TWG H;  2RCN A;  3LGJ A;  4X62 Q;  1IZ6 A;  3ZJY C;  4LF7 L;  3M3Y H;  4C3J H;  4J15 A;  1D7Q A;  3RZO H;  3K8A A;  1VQ4 A;  2IX1 A;  4DV3 Q;  2MNA A;  1Q7Y C;  4LF8 L;  1PH4 A;  1SLJ A;  3PV0 A;  1GKH A;  5ELO A;  3ULP A;  5IWA Q;  4IOA A;  2ID0 A;  5K36 G;  4MZ9 A;  4YWL A;  5JJK A;  2ZTD A;  1HZC A;  3PCO B;  1IYJ B;  1OXU A;  4R4I A;  3BZC A;  1NE3 A;  4DR1 L;  2UXB Q;  3J81 c;  4QQB X;  4JV5 Q;  3DM3 A;  4P73 A;  2VQE L;  4JI5 Q;  4JBK A;  1N33 L;  1T9H A;  1X65 A;  2IT1 A;  2Z6K C;  4YHH L;  2Z0S A;  3I7F A;  2VQE Q;  1QUQ A;  3J7Z C;  2K5N A;  4YHH Q;  4KLK A;  4XTC S;  1KAW A;  4DV2 L;  1L1O A;  2E2J H;  4TVA B;  1XJV A;  1I5F A;  3KF8 B;  5AJ3 Q;  4GLX A;  3STB C;  1HNZ Q;  1ASY A;  4A75 A;  1VS0 A;  1DGS A;  1X56 A;  1SRU A;  3S16 H;  3AQQ A;  2VUM G;  4WJ3 M;  3G6E A;  2JA6 H;  4A3M G;  1PH7 A;  2VUM H;  3NEM A;  5HGQ A;  1VQP A;  1BVS A;  1N8R C;  2GVB A;  4PMW A;  4JI4 Q;  4LF4 Q;  1BBU A;  4DAY B;  2Q2U A;  1A62 A;  5JJI A;  1L0W A;  2E2I H;  2E5L L;  5M3F G;  1B7Y B;  2WB1 E;  1YHQ A;  1YEZ A;  2GN5 A;  4IPC A;  4P71 A;  3F2B A;  5M3F H;  2R7D A;  3JAM c;  3FKI G;  3I4O A;  1XPR A;  4YY3 Q;  3I2Z A;  5C4X G;  2JQO A;  3FKI H;  2CKZ B;  5C4X H;  3M9B A;  4Y52 H;  4IPH A;  1I50 H;  1SE8 A;  4X64 Q;  4Y7N H;  1K8G A;  3IRB A;  2UUA L;  1YIT A;  3UDI A;  2VY3 A;  4DK6 C;  1TXY A;  4JCV E;  1BKB A;  3CP0 A;  2DGY A;  4DAM A;  2ZM6 Q;  1SRO A;  4JI6 L;  2K4K A;  4LWC A;  1KD1 C;  1RL2 A;  1E7Z A;  1KC8 C;  4MTN A;  4DV1 L;  1AH9 A;  3S2H H;  4FDB A;  1WI5 A;  4DV5 L;  4DR5 L;  2WFW A;  2N3S A;  3RN2 A;  4JI2 Q;  1OXV A;  1NBW A;  4OO1 G;  4DV5 Q;  4DR7 L;  2ASB A;  4DR6 L;  1NJI C;  2UXD L;  4DR7 Q;  3E9I A;  4DR6 Q;  1J6Q A;  1LYL A;  2JE6 I;  4R4Q A;  1A0I A;  4LUZ A;  3HOZ G;  3GTL H;  3CCR A;  1RIP A;  2Y0S E;  4LFC Q;  4A3I G;  1B70 B;  1YJN A;  2JEB I;  1VQK A;  3HOZ H;  1X3G A;  2R7Z G;  2N49 A;  4DV7 L;  4DPG A;  1FJG Q;  4A3I H;  2OWO A;  2R7Z H;  1PA6 A;  2CWP A;  3S2D H;  1E22 A;  2PMZ E;  4C2M H;  5FJ8 G;  2EQS A;  4EQ5 A;  2JA5 G;  3A74 A;  3GD7 A;  4X65 Q;  4JI0 Q;  2UXC L;  4HIK A;  5FJ8 H;  4B3R L;  2JA5 H;  1I94 L;  4LF6 L;  3NEL A;  4BA1 I;  4P72 A;  2UXC Q;  3PO3 G;  3KDF B;  3S17 H;  1H95 A;  1I94 Q;  2XGT A;  4LF6 Q;  4LFA L;  1L2F A;  1XMQ L;  2I5L X;  5J3B A;  3PO3 H;  1G6P A;  1Q1E A;  2RHS B;  1XMQ Q;  4AQY Q;  2NZH A;  1HNW Q;  1GVP A;  4EX5 A;  3RR5 A;  1Q46 A;  1VQJ A;  2EIF A;  3KJP A;  5GAH C;  2N78 A;  4UP9 A;  5FLM G;  5FLM H;  2A19 A;  4L5S A;  1QVG A;  4JI1 Q;  4JOI A;  3GTQ H;  1WCM G;  3JC6 6;  1XTD A;  4DUY L;  1XNQ L;  2A8V A;  1CKN B;  2D0P A;  1WCM H;  2BA0 A;  2RHQ B;  3FP9 A;  3CCJ A;  3CPW A;  5LMN W;  3J81 j;  1VQB A;  1YI2 A;  4JI8 L;  3I55 A;  3PF4 A;  1J5E L;  3S1M H;  2WB1 G;  4DV0 Q;  1HNX Q;  1EYG A;  2KEN A;  1J5E Q;  3CAM A;  3STB D;  2QGQ A;  3G71 A;  1M1K C;  4B3M L;  3J81 i;  1PFS A;  4JG2 A;  1PH1 A;  2OTL A;  3U4Z A;  1M90 C;  1CSQ A;  3K80 C;  1N36 Q;  1K0R A;  2YYZ A;  3PUX A;  1KIX A;  1HR0 W;  4GNX A;  3L0O A;  1YNX A;  3NEN A;  2ZJQ A;  2CFM A;  3S14 H;  2UUB Q;  1V9P A;  4B3T L;  2I5H A;  5JEA G;  4OXP A;  1EQR A;  4LF7 Q;  4GKK L;  1A8V A;  2OQK A;  3W1B A;  4C3I H;  3HOV G;  1N32 L;  4JYA L;  3S1Q H;  3K7U C;  4HJ7 A;  3HOV H;  1WOC A;  4IJL A;  4JYA Q;  2NZO A;  4LF8 Q;  5GAG C;  3CC7 A;  3PGZ A;  3AFQ A;  2A1A A;  2KCT A;  2KHI A;  3HKS A;  3CCM A;  3MEF A;  2AKW B;  2ES2 A;  4GLV B;  4QY7 A;  5GRO A;  4DV4 L;  1Z47 A;  2JK8 A;  3SGI A;  2Y0S G;  1JMC A;  2UU9 L;  2OQ0 A;  4DR1 Q;  1IBL L;  4BXX G;  1EIF A;  3NBH B;  2PQA A;  4BXX H;  3E9H A;  1PH5 A;  2ZTC A;  4DR2 L;  1N33 Q;  4A3G G;  4DNI A;  2IY5 B;  1NMG A;  2KHJ A;  2MFI A;  4L5R C;  4A3G H;  3TQY A;  3JAM i;  3H3V I;  4ALP A;  2NVQ H;  4DV2 Q;  1KQS A;  4JI3 L;  2YTX A;  2ZTE A;  3VDY A;  2CCZ A;  1VQD A;  2B29 A;  2LXK A;  2JEA I;  3ICE A;  4DK3 C;  2H5X A;  2LSS A;  4NPS A;  4A4I A;  5GAD C;  1QVF A;  1LTL A;  4LFB Q;  4BBR G;  4GLA C;  2UUC L;  1G51 A;  1HZ9 A;  2YV5 A;  3M7N A;  3S15 H;  4BBR H;  3EIV A;  1IXR A;  2HQL A;  1VQ9 A;  4RG1 A;  2MO1 A;  1LM0 A;  2CWA A;  1U0L A;  1X6O A;  3H0G G;  3PSI A;  4L5T A;  4A3M H;  4IFD I;  4A3C G;  4A93 G;  3K7A H;  3KF6 A;  4A3C H;  1S72 A;  4A93 H;  2E5L Q;  2AWO A;  2R6G A;  5IT9 c;  3UDF A;  1NTG A;  1VQI A;  2QA4 A;  1N34 L;  3GTJ H;  3AEV A;  2NVY H;  1VQA A;  4DV6 L;  1UE5 A;  1N9W A;  2WAQ E;  2WP8 J;  1VQN A;  1PH3 A;  2ATW A;  1PVO A;  1D8L A;  4PZ8 A;  1IBM L;  1OXS C;  2K52 A;  1JJ2 A;  3CCV A;  1IBM Q;  4L5Q A;  4GOP C;  2UUA Q;  4UY8 C;  3EN2 A;  1UE7 A;  1CKM A;  1E1O A;  1PH6 A;  3MXN B;  1ASZ A;  1VQG A;  4JI6 Q;  4DR3 L;  5IP7 G;  3PIP A;  1LUZ A;  2F4V L;  1HJP A;  1EQQ A;  1VQL A;  5IP7 H;  4DV1 Q;  4RMF A;  1YHA A;  2IHE A;  2F4V Q;  3WWV A;  5IYC G;  1UEB A;  4HIM A;  3TEH B;  4LNQ A;  4DR5 Q;  4JI7 L;  2JA6 G;  3GTK H;  5C0X I;  4A3K G;  5IYC H;  4A3L G;  2HIX A;  5M5X H;  4JI7 Q;  4O0A A;  3KOJ A;  3PUZ A;  3HKZ E;  4A3K H;  4B3S L;  2AMC B;  4DKA C;  1VQ7 A;  4A3L H;  4R4C A;  3RNU A;  3TS0 A;  4PZ6 A;  1Y1V G;  5DLQ E;  4YWM A;  4IFD J;  1JT8 A;  4BY1 G;  2K5V A;  1Y1V H;  2NN6 I;  1OXX K;  3K81 C;  4DV7 Q;  1QUQ B;  3T1H L;  4BY1 H;  4HID A;  1GO3 E;  3J80 i;  4AYB E;  1L1O B;  1JJG A;  4A3B G;  3U58 A;  3HOW G;  1GD7 A;  2C35 B;  4NB3 A;  2OCE A;  4A3B H;  2BA1 A;  2Q2H A;  3RLO A;  4IO9 A;  3HOW H;  4B3R Q;  4X6A H;  2K75 A;  3TRE A;  3F1Z A;  1KXL A;  4LFA Q;  1KRS A;  2Z6K A;  2VQF L;  1Q81 C;  1I6H H;  4P74 A;  4WJ4 A;  4LF9 L;  5LMU L;  1Y14 B;  3CF5 A;  1QVC A;  1NMF A;  1Y1W G;  5H1S E;  2XTI A;  1Y1W H;  4PZ7 A;  1L1O C;  2PNH A;  4HJ9 A;  1PH2 A;  1K8A C;  1YVC A;  2ZJP A;  1FL0 A;  2R92 G;  3GTO H;  1HH2 P;  1U5K A;  3S24 A;  2DUD A;  1VQC A;  1VCI A;  3M4Q A;  5IY0 A;  1S40 A;  4OON A;  2YU9 H;  1EUJ A;  2R92 H;  3A5Z B;  3J80 c;  2IHF A;  2KCM A;  4DUY Q;  1XNQ Q;  5C0X J;  1EWI A;  1CSP A;  1AE2 A;  4JBM A;  3CCU A;  1XMO L;  4HIO A;  4HJA A;  5LMN L;  1TWA H;  4JI8 Q;  1YHB A;  3U50 C;  3F2C A;  4KI0 A;  1V1Q A;  1C0A A;  1SN8 A;  3HFZ B;  1KRT A;  1YBY A;  4UPA A;  1E3P A;  2AHO B;  2WAQ G;  4HJ5 A;  2MO0 A;  2ZJR A;  4POF A;  4B3M Q;  4AH6 A;  4QIW E;  5HY6 A;  3W5O A;  3BJU A;  4NXM L;  4C3H H;  3UE0 A;  1PH8 A;  1K9M C;  4KHP L;  3GTP H;  4K0K L;  3GTG H;  3T1Y L;  1HR0 L;  4NXM Q;  2NVT H;  3CC4 A;  4OX9 L;  4LW1 A;  3CC2 A;  1VQ6 A;  3T1Y Q;  1E24 A;  3RN5 A;  4B3T Q;  1VQ5 A;  2BH2 A;  4GKK Q;  1UWV A;  2EXD A;  1N32 Q;  4NXN L;  3HOY G;  4GS3 A;  3TS2 A;  4DUZ L;  4A76 A;  1X3E A;  1SFO H;  1Q82 C;  1TWC H;  1XNR L;  4BY7 G;  3HOY H;  1Q86 C;  4GKJ L;  2HT1 A;  1MJC A;  3CCL A;  1XNR Q;  1VQ8 A;  2JJQ A;  3HKZ G;  4R4O A;  2IX0 A;  3G48 A;  4DV4 Q;  1UE6 A;  3ULL A;  2BH8 A;  1K3R A;  1KHI A;  4H02 A;  1VQM A;  1S3O A;  4X62 L;  4UP7 A;  2UU9 Q;  2B63 G;  1MIU A;  1CUK A;  2FXQ A;  1IBL Q;  5M5Y H;  2B63 H;  4DV3 L;  4AYB G;  1FVI A;  3FHW A;  4DR2 Q;  1B8A A;  3RZD H;  3I56 A;  2I0Q A;  1IL2 A;  1E1T A;  1QZH A;  2Q2I A;  5IWA L;  3J7A 5;  4GN3 B;  3CD6 A;  4JI3 Q;  3CQZ H;  1HZB A;  2UXB L;  3BZK A;  4JV5 L;  3PUY A;  2PI2 E;  1JE5 A;  4JI5 L;  4A3J G;  5C44 G;  2UUC Q;  5JEA J;  1W3S A;  4A3J H;  1SMX A;  5IE8 A;  5C44 H;  3PUV A;  5ELN A;  1PYS B;  3H0G H;  5IP9 G;  2D62 A;  3Q8D A;  3A0J A;  3UDX A;  3CCS A;  4GOP B;  1IBK L;  1UE1 A;  1YZ6 A;  4GN4 B;  5IP9 H;  5IYB G;  1IBK Q;  1VQH A;  3KLW A;  3UE1 A;  2QEX A;  1JB7 A;  5JJL A;  2K50 A;  5IYB H;  4IPG A;  5IYD G;  1GM5 A;  5AJ3 L;  1HNZ L;  1Q1B A;  5FLX c;  3W1G A;  3OW2 A;  5IYD H;  2OTJ A;  1WFQ A;  3H3V H;  3KDF A;  2R7F A;  2VS1 A;  2V1C C;  1N34 Q;  4JOI C;  1A63 A;  2LXJ A;  1I3Q H;  4DV6 Q;  4GNX B;  4JI4 L;  2JA9 A;  1Q8K A;  1SR3 A;  4AIM A;  4APV A;  4LF4 L;  3HOU G;  4OWW B;  3HOU H;  3GTM H;  1JJC B;  4JBJ A;  4IFD G;  1O7I A;  1MKH A;  3AFP A;  3L2P A;  2YTV A;  3PO2 G;  3DLL A;  5GQO A;  3M4O H;  1X54 A;  1CKN A;  1G29 1;  1WYD A;  4DR3 Q;  3PO2 H;  4IOC A;  3KJO A;  3S1R H;  4YY3 L;  4OO1 I;  3I4M G;  4JBW A;  2JA7 G;  3ERS X;  1X55 A;  4GNX C;  3I4M H;  4LUO A;  4X64 L;  4R4T A;  1YJ9 A;  5M3M G;  2JA7 H;  2D0O A;  2K5H A;  3M85 A;  4POG A;  2PI2 A;  5M3M H;  4B3S Q;  3G4S A;  4HJ8 A;  3I4N G;  2ZM6 L;  1YJW A;  2PQA B;  1K73 C;  4R1J A;  1BBW A;  1CKO A;  3K0X A;  2JA8 G;  3I4N H;  2JA8 H;  1W2B A;  3T1H Q;  1YIJ A;  1V43 A;  4YWK A;  4MNO A;  1VQF A;  3H15 A;  3E0E A;  2NVX H;  4JI2 L;  2VNU D;  4QJF A;  2N8N A;  3U4V A;  3D0F A;  1XPO A;  4BBS G;  1PHJ A;  4O2D A;  1X3F A;  5C0X G;  2VZA A;  3CPF A;  5C3E G;  1AE3 A;  4BBS H;  4LFC L;  3S1N H;  1P8L A;  2F3I A;  4JC0 A;  3PUW A;  5C3E H;  2YTY A;  2VQF Q;  3CCQ A;  1WJJ A;  2RF4 A;  1QZG A;  4ME3 A;  2I5M X;  3CMA A;  5LMU Q;  4LF9 Q;  1FJG L;  5GAE C;  1PYB A;  4OWX B;  3EBE A;  1PH9 A;  1K83 H;  4XIG S;  3GDE A;  3KF6 B;  2E8G A;  2L15 A;  2NN6 G;  3CXC A;  2K14 A;  4JI0 L;  4OWT B;  3CW2 C;  4X65 L;  1R9T H;  3F8T A;  3ULJ A;  2GVA A;  1C9O A;  3HOX G;  1EFW A;  3TRZ A;  3KYH C;  1XPU A;  4TQU S;  4P75 A;  4YCV A;  3HOX H;  1TWH H;  1EOV A;  3D31 A;  3CCE A;  1OTC A;  5BR8 L;  4UP8 A;  3M4P A;  2Q2T A;  4AQY L;  1HNW L;  2MQH A;  3ER0 A;  4QL5 A;  4KHZ A;  5BR8 Q;  5EAY A;  4QGU A;  1XMO Q;  3OTO L;  5C4J H;  1Q12 A;  2B3G A;  2VL6 A;  4IPD A;  4LUV A;  5LMN Q;  3OTO Q; 
#chains in the Genus database with same CATH topology
 1VQE A;  2JA5 B;  1GUS A;  3BU2 A;  3L4K A;  1GUW A;  1P16 A;  2B63 A;  4JI1 L;  5C6A A;  2VW9 A;  5FKA C;  1MJE A;  2FMC A;  4QB4 A;  4AYB A;  2K03 A;  3B6Y A;  4A3D G;  5KG0 A;  5L37 A;  3OWF A;  4A3D H;  1I4Q A;  1JOR A;  1HZA A;  1HR0 Q;  3KK7 A;  1X9N A;  1T94 A;  1HNX L;  2WIN B;  5EKI A;  1MBY A;  3PF5 A;  4RNN A;  1O7L A;  4LF5 L;  3GTQ B;  3RGZ A;  3M9M B;  4JV2 A;  4LF5 Q;  2RVL A;  4R8U A;  4NXN Q;  1PRT D;  2R3Z A;  5CV5 A;  2E2H H;  4F88 A;  1N36 L;  1TS5 A;  4DNR B;  4K6L A;  2UUB L;  1NY4 A;  2RSO A;  4G7O C;  3LGJ A;  1KBL A;  4ZKC B;  4YJ3 F;  4X64 H;  2IMW P;  2FPP B;  5I2Y A;  4N8F A;  3SE7 A;  2MNA A;  5LL6 X;  3RGX A;  3TIG A;  2ASJ A;  2FK1 A;  4FF2 A;  1A2U A;  4QWE A;  1KLU D;  2FMM A;  5IWA Q;  2F0S A;  3MR5 A;  1KNE A;  3NTI A;  2BOS A;  5K36 G;  1EHI A;  4DV1 H;  5K36 H;  4O42 A;  1I4X A;  4DV5 H;  2E2I A;  4DR5 H;  3DWA A;  3I90 A;  4JI5 Q;  4OIK A;  1SYX B;  4DR6 H;  3V6H A;  1BCP F;  3T16 A;  1WTW A;  3J7Z C;  4QF4 A;  3FKI A;  2E2J H;  1L1O A;  4TVA B;  4DV7 H;  3H91 A;  2Y0S B;  2KSW A;  2MCT A;  5KNC A;  1ASY A;  5CAE B;  3STB C;  2IJ0 A;  2TSS A;  4JI0 H;  1VS0 A;  3QWN A;  3X3N A;  3PR5 B;  3FDT A;  4ZQI A;  2PMZ B;  2DNC A;  2EJM A;  3AQQ A;  3FPU B;  3K59 A;  3ERO A;  4A3G B;  5IIF A;  4A3M G;  1BVS A;  2AQ1 B;  1WTX A;  4PMW A;  1S97 A;  2VXW A;  4O4I F;  3V05 A;  3K0Y A;  3E5N A;  2E5L L;  5ELB A;  5KEE A;  3GIK A;  5JAV A;  4UCU A;  2ZJT A;  4H0L C;  4P71 A;  3PR4 A;  4MAM A;  3T56 B;  4LMQ D;  3M7G A;  2Z4I A;  3E3X A;  5EQ0 A;  3UI2 A;  4YY3 Q;  1XPR A;  5KFJ A;  2MGS A;  5KNB A;  1B33 N;  2CKZ B;  4A93 B;  4DUY H;  3M9B A;  1XNQ H;  4C2M A;  1I50 H;  4XYO A;  1K8G A;  3IRB A;  3SXH A;  3UDI A;  2JA5 A;  1HNX H;  3GTJ B;  4FF4 A;  2DGY A;  4DAM A;  4F4Y A;  4N9P A;  3P20 A;  3P75 A;  5L9X A;  1HA6 A;  1AH9 A;  5C5L A;  1EWH A;  1WI5 A;  1I7N A;  2N3S A;  4JI2 Q;  1NBW A;  3ONA B;  4OL7 A;  3GTM B;  2R7K A;  4R7R A;  1U4L A;  5IGB A;  2UXD L;  5BN4 A;  2R7L A;  2UUB H;  4DL7 A;  1J6Q A;  1LYL A;  4R4Q A;  2UXD Q;  3IL8 A;  3GTL H;  3GTQ A;  2Y0S E;  1AEX A;  4LFC Q;  4H13 C;  1I6U A;  1VAJ A;  3RF2 A;  2NTT A;  1HHV A;  3TQ1 A;  3VMM A;  3EA6 A;  3WO0 A;  4XQQ A;  3BYT B;  2CWP A;  4ZYS A;  5EDW A;  2F3V A;  2J6T A;  2PMZ E;  5K5P A;  2EQS A;  2PO4 A;  4X65 Q;  4HIK A;  3NEL A;  4RNO A;  4P72 A;  4O2B F;  3NTH A;  3J7A K;  4LFA L;  5M9O A;  1E4F T;  2NU9 B;  2A68 C;  5J3B A;  5HUR A;  3QFF A;  2R93 A;  4AQY Q;  2NZH A;  1LT4 D;  1Q46 A;  2EIF A;  4MV1 A;  3T53 B;  4DR2 H;  3RB4 A;  2XNA C;  4A3B B;  3HOW B;  5FLM G;  1U4P A;  3H4B A;  2PQE A;  3DMU A;  3H40 A;  5FLM H;  1QVG A;  3NGD A;  4JOI A;  1TS4 A;  3JC6 6;  2WII B;  3GIL A;  2RDF A;  4RGM A;  3QJY A;  2A8V A;  2R86 A;  2RHQ B;  1RTO A;  1EYA A;  3RB6 A;  1F2L A;  4XYL B;  4EBD A;  3J81 j;  4JI8 L;  3I55 A;  1K8O A;  5KFH A;  1J5E L;  1ESR A;  1D1K A;  3OHB A;  1J5E Q;  3MWM A;  4EEY A;  2R92 B;  2ALZ A;  4U7C A;  2M00 A;  3BDC A;  2OF1 A;  2E5L H;  1SSO A;  1PH1 A;  1M90 C;  3EVQ A;  5CV6 A;  4LK1 C;  3K80 C;  1KIX A;  1A2T A;  2PMZ A;  1HR0 W;  1PZJ D;  2ZJQ A;  4B3T L;  3MWY W;  1EEI D;  2RCF A;  3T5H A;  2WAQ B;  3W1B A;  5IGE A;  5CR3 A;  4DK0 A;  3K7U C;  4HJ7 A;  1Z7T A;  1GOZ A;  1WOC A;  4IJL A;  2G9D A;  4C3H B;  2NZO A;  2XGP A;  2MUY A;  2A1A A;  1M7J A;  2AKW B;  4DV4 L;  1Z47 A;  1CK1 A;  4HNU A;  1F2M A;  1JMC A;  3A8K E;  3FMA A;  1SFO B;  3N8D A;  1EIF A;  4JI7 H;  2PQA A;  3N6R A;  4MTD A;  2CW7 A;  2IY5 B;  1B04 A;  2MFI A;  4DNT B;  3GV8 B;  2VB2 X;  1ZXT A;  4DV2 Q;  3ETJ A;  2W9B B;  1TWG B;  2EDG A;  4JI3 L;  1KQS A;  3GV5 B;  2B2V A;  2YTX A;  2ZTE A;  1DON A;  2CCZ A;  1VQD A;  1PMR A;  2P5Z X;  2LXK A;  2XIW A;  2LSS A;  3DWQ A;  5GAD C;  4FU0 A;  1B4O A;  1QIL A;  4F4X A;  3S15 H;  2YV5 A;  5DG7 A;  4DAV A;  2HQL A;  4L5S A;  4XYM B;  1LM0 A;  2XSC A;  2IL8 A;  4G7Z C;  3R5H A;  1JR0 D;  3Q0A A;  5CA1 F;  3MR2 A;  1AW7 A;  5IT9 c;  2QA4 A;  3AEV A;  4KD4 A;  4BWG B;  4EBE A;  1VQA A;  1PRT C;  5C44 B;  2FK3 A;  1SYG A;  2I46 A;  2EY6 A;  2WAQ E;  1C8C A;  1E4G T;  3R2T A;  1SYB A;  1D8L A;  1IBM L;  2CH4 W;  3K5H A;  1KJJ A;  1IBM Q;  2OEO A;  2UUA Q;  2CQA A;  4UY8 C;  3BAB A;  5LMN H;  3I3C A;  1E1O A;  5KFK A;  1H9S B;  4N8X 1;  4EVO A;  5IP7 G;  1LUZ A;  1UAP A;  5IP7 H;  4RB3 C;  3OMG A;  2K7V A;  4B9W A;  5IYC G;  1UEB A;  2X69 A;  3TEH B;  4HIM A;  3HOU B;  2B2W A;  3GTK H;  1WSC A;  2BDO A;  5C0X I;  5IYC H;  4EYH B;  4NXM H;  4KKT A;  1F9Q A;  1WD0 A;  1F77 A;  4QIW B;  4K0K H;  3T1Y H;  3TP6 A;  4B3T H;  1ILP A;  5KG2 A;  5CBE E;  1O75 A;  3TS0 A;  4PZ6 A;  5DLQ E;  3PO2 B;  4MV7 A;  2R92 A;  3KBG A;  2F0J A;  1TII D;  3M4I A;  1QUQ B;  4HID A;  1AP0 A;  2XIG A;  2ENB A;  3I4M B;  3QR8 A;  4DUZ H;  3J80 i;  2F0G A;  2JA7 B;  1A3T A;  1VDZ A;  2C35 B;  1SJE D;  2OCE A;  1TQO A;  4IO9 A;  4X6A H;  1M8A A;  2HVQ A;  5A2Q W;  3F1Z A;  1KXL A;  3I4N B;  2WAQ A;  3G8C A;  4HNT A;  4WJ4 A;  2QKI C;  4LF9 L;  3BS1 A;  2PW7 A;  1Y14 B;  1W93 A;  1SMY D;  3ORQ A;  1Y1W G;  1Y1W H;  4BS9 A;  2X6G A;  1L1O C;  1K8A C;  2KCC A;  4RNM A;  5LOV F;  1U5K A;  1S40 A;  4ETS A;  3S9W A;  4JI3 H;  2W7P A;  1SFO A;  2B39 A;  2W6O A;  3SK6 A;  1EWI A;  5DGB A;  4DK1 A;  1K83 B;  4JBM A;  2Q8I B;  1JDE A;  2A69 C;  1TWA H;  1ESF A;  3J80 E;  4EFE A;  2F0Q A;  3MVV A;  3SVM A;  4FVM A;  1SN8 A;  1JDB B;  1VMC A;  2AHO B;  2ZJR A;  3IAY A;  4B3M Q;  4AH6 A;  2DJF C;  4QIW E;  5HY6 A;  3W5O A;  3BJU A;  3KHG A;  3UE0 A;  1PH8 A;  2HJW A;  3G6J B;  3GTG H;  2NVT H;  1HCZ A;  3CC2 A;  1X3P A;  2K6A A;  2KJX A;  2XGQ A;  4E6I A;  1VQ5 A;  4IRK A;  1KAA A;  2BH2 A;  1SNP A;  1UWV A;  4LF4 H;  4I4T F;  5KFQ A;  2F0K A;  2BQR A;  1DOM A;  1X3E A;  2OXP A;  3TP7 A;  1TWC H;  2F0H A;  2RA4 A;  4NP5 A;  2BE5 D;  4ZQ3 A;  5I6W A;  4GKJ L;  4A3D B;  2W6N A;  1VQ8 A;  3HKZ G;  4R4O A;  2IX0 A;  1EEF D;  1LT6 D;  1G6Z A;  3E6Z X;  4H02 A;  4X62 L;  4NDX A;  3W2D A;  4C1N K;  1MSH A;  1OO9 B;  2UU9 Q;  1MIU A;  5M5Y H;  2F03 A;  1NCV A;  2E2H B;  1FVI A;  4MV8 A;  4Q8F A;  4J9R A;  1H9S A;  4NMZ A;  2I0Q A;  4I50 F;  4ED7 A;  1LTB D;  1JWM D;  5F9L A;  1AUX A;  3J7A 5;  5D3I B;  4ABN A;  1CZG A;  3CQZ H;  2UXB L;  4MA5 A;  4I65 A;  5KFP A;  3KLS A;  4RKB A;  2PI2 E;  1JE5 A;  3GII A;  5L1L A;  1EIH A;  2UUC Q;  3GTO A;  2ICE C;  2W6Z A;  3H0G H;  4LF9 H;  3A0J A;  5IGD A;  1STH A;  1OTC A;  1UE1 A;  1YZ6 A;  2D5D A;  1VQH A;  3UE1 A;  1K1S A;  5IGC A;  2QEX A;  2JA7 A;  2K50 A;  4DL6 A;  5AJ3 L;  1FNV A;  2W71 A;  3H3V H;  4JOI C;  2LXJ A;  4DV6 Q;  4ED1 A;  4C56 C;  2E2J B;  1R4P B;  1LLR D;  5BR8 H;  3GTM H;  4XQJ A;  5DG8 A;  1TT2 A;  2XVS A;  4JBJ A;  1GHK A;  3IFD A;  4RA8 A;  2NU8 B;  1MKH A;  3C1E A;  3Q8P B;  1EY7 A;  1UC8 A;  5GQO A;  3M4O H;  5EKK A;  5KG4 A;  4DR3 Q;  1CKN A;  4DGZ A;  1OWT A;  3MZ5 A;  4A3M B;  1ENF A;  4JBW A;  1RYS A;  5FPO A;  1K83 A;  5ELD A;  3NE5 B;  1YJ9 A;  5M3M G;  1B1Z A;  1B2T A;  1RF2 D;  2I80 A;  2X0S A;  2PI2 A;  5M3M H;  4B3S Q;  1EQV A;  2YU9 A;  2VQD A;  1Y69 U;  4PMB A;  4DV0 H;  1BBW A;  2JA8 G;  3K0X A;  4G3I A;  4HNV A;  2JA8 H;  1VBG A;  4EBC A;  4YWK A;  4GKJ H;  5C1O A;  4MNO A;  1HRJ A;  2DY7 A;  1CHQ D;  1I50 B;  1VQF A;  3H15 A;  4ECS A;  2O4X A;  5C4H A;  4DR4 H;  2N55 A;  4MV9 A;  4Z9C B;  2V59 A;  4O2D A;  1X3F A;  2VZA A;  3CPF A;  1RJR A;  4X62 H;  4ECR A;  3HS0 C;  4JC0 A;  4CKB A;  2K32 A;  2K01 A;  2PYK A;  1IYU A;  4PV1 C;  5GAE C;  1PYB A;  2RSN A;  3GIM A;  2D9U A;  3EBE A;  1IKM A;  2E8G A;  1CQJ B;  2IWH A;  4LF8 H;  1M0T A;  3KAL A;  3KTM A;  4OEL B;  1WD1 A;  3ULJ A;  3I91 A;  2B2V C;  1WTH A;  1U4R A;  3HRZ C;  3J80 L;  3HOX G;  3GTL B;  3NBH A;  2AGP A;  4C1N I;  1BF4 A;  1XPU A;  3MFY A;  4M9U A;  3HOX H;  5D1O B;  2UXB H;  3CCE A;  1II3 A;  2E2H A;  3K5M A;  1TY2 A;  2MQH A;  3K5N A;  5DQI A;  1SNQ A;  5EAY A;  4A3E G;  4YHH H;  3I72 A;  1XXG A;  1PFN A;  4A3E H;  2UVR A;  2BQ3 A;  3D4W A;  3NQI A;  2HHH L;  3KFU A;  3D8G A;  2ALY B;  4RUA A;  2AU0 A;  4X66 L;  3L9A X;  2HHH Q;  1SAP A;  3AYH B;  1B9N A;  4X66 Q;  5EJW A;  2IBK A;  1EIY B;  1ONL A;  4KHP Q;  2F0T A;  3GO5 A;  3RLN A;  3Q23 A;  2E76 C;  2WAC A;  3OYY A;  4OX9 Q;  3VYR A;  1VQO A;  5LL6 S;  2DN8 A;  2CZG A;  4O3P A;  2EY1 A;  3A5U A;  1KL9 A;  4YCU A;  2YL2 A;  3TBI B;  4EGQ A;  1PV4 A;  5E3F A;  4F50 A;  4QUF A;  4PG3 A;  4N9T A;  1ZHS A;  1PYW D;  4BA2 I;  1K8M A;  4WBN F;  3H20 A;  3T5K A;  4UCR A;  1TWG H;  2B2W C;  4C3J G;  3M3Y H;  5EWF A;  4PDB A;  4C3J H;  4TV9 F;  1LO5 D;  3RZO H;  3K8A A;  3HZX A;  1TVX A;  1QOH A;  1VQ4 A;  4XDX A;  4DV3 Q;  2IX1 A;  3MXN A;  1Q7Y C;  4ZLT F;  4KKU A;  5DM7 3;  3PV0 A;  5T1I A;  2WE6 A;  2ZT9 C;  1SMY C;  3GQB A;  1GSH A;  2ID0 A;  5JJK A;  2R84 A;  4YWL A;  4TQR A;  4R4I A;  1OXU A;  3BZC A;  1NE3 A;  1CQI B;  4DR1 L;  1NUC A;  5E4W C;  4O1N A;  3TQT A;  2EYP A;  1N33 L;  1TKW B;  2IT1 A;  2RDJ A;  1ZKO A;  2Z0S A;  3I7F A;  3J81 E;  2K5N A;  2UVU A;  1PRT F;  4KLK A;  4XTC S;  4O3S A;  4CBV A;  3MXP A;  3Q6S A;  1I50 A;  2KCN A;  1I5F A;  1HNZ Q;  1H9K A;  5I9O A;  1Z2N X;  1X56 A;  4KK7 A;  2UXC H;  3S16 H;  4B3R H;  4L63 B;  4WJ3 M;  4LF6 H;  4RUC A;  4I7Z C;  1N8R C;  2NVX A;  4DAY B;  2WKD A;  1SE4 A;  4FYD A;  2SCU B;  4RGO S;  1YEZ A;  2GN5 A;  3S15 B;  4MA0 A;  3PW0 A;  3GTL A;  4DXG A;  2NU6 B;  5D1O A;  4DAP A;  5C4X G;  4UHV A;  4GC6 A;  1KAB A;  5C4X H;  2Z1C A;  4IPH A;  1PFB A;  4X64 Q;  3JAM E;  4Y7N H;  5J2U F;  4LJZ C;  3TP5 A;  2JSO A;  4IUQ A;  4TUY F;  1BKB A;  2R82 A;  2ZM6 Q;  4ECW A;  1TWH A;  1SRO A;  5KFD A;  1XX8 A;  2EY5 A;  3OHA A;  4MTN A;  4DV1 L;  2J9G A;  1FNU A;  1Y8O B;  3OIQ A;  4FDB A;  4DV5 L;  1CE8 A;  4DR5 L;  2WFW A;  3RN2 A;  4OO1 G;  4DV5 Q;  4DR6 L;  5KFE A;  4OO1 H;  2H4O A;  2YYA A;  2HUG A;  4DR6 Q;  2NZ1 D;  4RAU C;  4LUZ A;  4ZAI A;  3HOZ G;  2J6S A;  1B70 B;  3HOZ H;  2JEB I;  1DV2 A;  2N49 A;  4DV7 L;  1FJG Q;  4O4L F;  5I6Y A;  2OWO A;  3GTK B;  4EGJ A;  5I2X A;  1U4M A;  3S2D H;  2EYF A;  1PZI D;  1I4R A;  4EQ5 A;  4JI0 Q;  4IUU A;  3WOF A;  2DJG C;  3KDF B;  3PO3 G;  3IN5 A;  5BN5 A;  4DR1 H;  1L2F A;  3PO3 H;  4DF7 A;  1V1P A;  5KX5 F;  4U67 3;  3PW4 A;  1IBL H;  5H80 A;  4HYK A;  2JEJ A;  1HNW Q;  5D14 A;  3OUZ A;  1N33 H;  2PBZ A;  5KFN A;  1VQJ A;  2A6H D;  3KJP A;  2GPW A;  4K8J A;  3T5L A;  5GAH C;  4UP9 A;  5C5J A;  1BO0 A;  5JVD F;  3SHL A;  4F4W A;  2LS0 1;  2A19 A;  4JI1 Q;  1RCV D;  4XX0 B;  3OOC A;  3KLS X;  1XTD A;  4DUY L;  3OPO A;  1XNQ L;  2ASD A;  4JPB W;  2O5I C;  5NUC A;  3CCJ A;  4ZRZ A;  1I6V C;  5BMV F;  2IA6 A;  1Y1W B;  1I7L A;  3S1M H;  2WB1 G;  2NYZ D;  2W6M A;  1HNX Q;  5ELE A;  1STG A;  3V96 A;  1QNU A;  3MR6 A;  3RB0 A;  3RAX A;  2QGQ A;  1M1K C;  2EYH A;  3M9N B;  2F0P A;  4IR1 A;  1QJO A;  1CSQ A;  1N36 Q;  1K0R A;  1TWA B;  2YYZ A;  1N34 H;  3Q22 A;  4GNX A;  3R23 A;  2WKC A;  3S14 H;  2CFM A;  3R3O A;  3RFC A;  2UUB Q;  4J9K A;  4OHJ A;  4GKK L;  1W96 A;  4K14 A;  4KMU C;  2F3W A;  3CU7 A;  3S1Q H;  2W6Q A;  3EQL C;  3L4J A;  4KY7 A;  1VF5 C;  3CC7 A;  3PGZ A;  3AFQ A;  2KCT A;  3PIP 3;  2MHV A;  3GTG B;  4L6T B;  2NVT B;  3BQ2 A;  5M5W B;  5GRO A;  2OLS A;  2JK8 A;  4UCV A;  3SGI A;  3Q2O A;  2B8G A;  3J81 L;  1JX4 A;  1PFM A;  2YW2 A;  1SYE A;  4BXX G;  2LMC B;  5KIX A;  1TWC B;  4BXX H;  3E9H A;  5ELC A;  1DIK A;  4DR2 L;  5D3D A;  4DNI A;  2E74 C;  4X3U A;  4L5R C;  3HKZ B;  2FLN A;  4ALP A;  2FHT A;  2NVQ H;  3T1H H;  5EPJ A;  1HQM C;  3Q24 A;  5M5Y B;  1CFM A;  2DPI A;  3ICE A;  2V58 A;  4DK3 C;  1LTL A;  4HN7 A;  1ZYR D;  4U68 A;  1WTR A;  4IZ8 A;  3I4L A;  1IXR A;  4RG1 A;  4A3M H;  2CWA A;  1SE2 A;  1X6O A;  1D1I A;  3PSI A;  4L5T A;  2F0D A;  3GTK A;  1S72 A;  3CQZ B;  3DUZ A;  1ICW A;  5IT9 W;  2EY2 A;  2EJG C;  1DJR D;  1DZ1 A;  2E5L Q;  2EOT A;  4ED0 A;  3JAM L;  3A56 A;  2NVY H;  1UE5 A;  5T14 A;  3G6V A;  3OSN A;  1K3B C;  3H0G B;  2R7Z A;  1VQN A;  3F2U A;  1PVO A;  4PZ8 A;  2EVB A;  2EZV A;  4L8J A;  2C5C A;  4RH6 A;  1MGS A;  4XT3 B;  1SEI A;  5CYU A;  1S4Z A;  3U9S A;  3VPD A;  1PH6 A;  2D2C C;  5IGG A;  1VQG A;  1S10 A;  4Q0F A;  4Y8V B;  1VQL A;  2IHE A;  1M4V A;  4K2K A;  4JI7 L;  2JA6 G;  1W6J A;  1LT3 D;  4JI7 Q;  2JA6 H;  2V5A A;  1R4Q B;  3HKZ E;  5KND A;  1RK5 A;  1BXT A;  3BYY B;  4R4C A;  3VYT A;  3M4O B;  3HG9 A;  1ZET A;  3CKI B;  4GKK H;  5FO7 B;  1Y1V G;  4IFD J;  1JT8 A;  4RFB A;  2K5V A;  1Y1V H;  1O7Y A;  2NN6 I;  5A35 A;  4FBU A;  4NXN H;  1TWA A;  4PNY A;  3SEB A;  3Q8S B;  2L55 A;  4KJN A;  1GD7 A;  5M3M B;  1EY8 A;  3MTS A;  4J6H A;  2Q2H A;  2K75 A;  4JK1 C;  4HMI A;  2R61 A;  4LFA Q;  2JA8 B;  2Z6K A;  3MEH A;  2DNE A;  2VQF L;  5A2Q L;  3KUP A;  1DM0 B;  3PQI A;  4PZ7 A;  3V4Z A;  1F2Z A;  2PCF B;  1BNC A;  5KFR A;  3BZD B;  2ZJP A;  5IWA H;  1HH2 P;  3S24 A;  4DN4 M;  5IY0 A;  3M4Q A;  1RTN A;  1B50 A;  3A5Z B;  1LV9 A;  1SNC A;  3J80 c;  1JKJ B;  2KCM A;  3RMH A;  2NU7 B;  3CCU A;  1XMO L;  5LMN L;  4Q44 A;  4JI8 Q;  2GLT A;  3HKZ A;  1C0A A;  2Y0S A;  1KRT A;  1YBY A;  4X3S A;  1IBK H;  5KG6 A;  1HUN A;  3GV7 B;  4ECQ A;  3HOX B;  4HJ5 A;  1SYF A;  4J9N A;  1JIC A;  1UEA B;  3CRK C;  2KOL A;  4NXM L;  1BQQ T;  3VR3 A;  2W9A A;  4K0K L;  3T1Y L;  4NXM Q;  3CC4 A;  4LW1 A;  1VQ6 A;  4A3E B;  3D4R A;  3T1Y Q;  1E24 A;  4B3T Q;  1ZHQ A;  1KJ9 A;  4IHJ F;  4MV3 A;  3NXW A;  1JE4 A;  3CQZ A;  2EXD A;  1U9R A;  3HOY G;  4DUZ L;  4EGV A;  1S5E D;  4F8M A;  1Q82 C;  4BY7 G;  1F9P A;  3HOY H;  2R6F A;  3N43 B;  1EWC A;  2HT1 A;  2JEF A;  4RWS C;  3I73 A;  3BVG A;  5L1I A;  3OMC A;  5DEH A;  3G48 A;  3H0G A;  4DV4 Q;  1ROD A;  3N41 B;  4X3K A;  4F4Z A;  5JH7 F;  1K3R A;  2L1B A;  4YY3 H;  1S3O A;  2HD3 A;  2B63 G;  4LAA A;  1SDF A;  3GTJ A;  2B63 H;  1HTL D;  2WYO A;  3M9O B;  2HCC A;  4AYB G;  1JOK A;  3FHW A;  2IX3 A;  1WTQ A;  1IKL A;  2PZT A;  3BVM A;  3RZD H;  4WD3 A;  4EG0 A;  3LWB A;  1E1T A;  2L9H A;  5KFL A;  2A6H C;  1TU2 B;  4HQ6 A;  4K6D A;  1JC7 A;  3M3Y B;  3O13 A;  3OSO A;  4O2A F;  5FD6 A;  3GTM A;  1EY4 A;  4C3J B;  4JI3 Q;  3CD6 A;  3RZO B;  1HZB A;  2X6L A;  5EBC A;  5BPH A;  1E4E B;  4JV5 L;  3RUP A;  1DXM A;  3TZU A;  3PW7 A;  4A3J G;  1Y8P B;  4A3J H;  1SMX A;  1ZQ7 A;  3RBD A;  2VQF H;  4CC6 A;  3CCS A;  2D62 A;  1VQK A;  4GN4 B;  4ZUJ A;  4IPG A;  3HP3 A;  4PWQ A;  4R8N A;  2OTJ A;  5FO9 B;  1L0X B;  3U9T A;  3I8Z A;  4X65 H;  2QIL A;  1I3Q H;  4HR7 B;  1EFI D;  2J7Z A;  1MZB A;  3K58 A;  1BUV T;  2B2Y A;  1B3Q A;  4EQO A;  4JI4 L;  2JA9 A;  1Q8K A;  4Q5V A;  4LF4 L;  1XMO H;  4J9O A;  2A5H A;  4I55 F;  3OTO H;  3SDZ A;  2YRW A;  2IW3 A;  3AFP A;  3PIO 3;  4FXG C;  1C4Q A;  2YTV A;  3L2P A;  3S16 B;  4HSP A;  1WYD A;  1S03 G;  3KJO A;  1LAB A;  4KTA A;  1AZQ A;  3RAQ A;  4Q8E A;  5KT2 A;  2JYO A;  4GNX C;  4LFB H;  4U6P A;  2D0O A;  3MAQ A;  3OHX C;  4HJ8 A;  1K73 C;  5KFT A;  1CKO A;  2F0O A;  2V9W A;  2I8C A;  4IRC A;  3VR4 A;  1MD2 D;  1W2B A;  2IP4 A;  4KHV A;  1WH2 A;  1PTO H;  5C4X B;  1QE6 A;  4Y7N B;  4ZUI A;  5I4D A;  3M4Y A;  2FLL A;  4QJF A;  4UDU C;  1MSG A;  3G7L A;  1PHJ A;  5C0X G;  3MJF A;  4IWX A;  5C3E G;  3PN1 A;  2A6E D;  5I9P A;  3MHB A;  3S1N H;  3PUW A;  4OIJ A;  5C3E H;  1HPC A;  2RF4 A;  1QZG A;  4LF9 Q;  1EYZ A;  2ZXP A;  5J1Z A;  4OWX B;  1RYR A;  1JOQ A;  3KF6 B;  1EU3 A;  3BG5 A;  1J8I A;  2K14 A;  4OWT B;  3CW2 C;  1FKA H;  2GVA A;  4GZY C;  3KYH C;  3HOZ B;  4YCV A;  4JV5 H;  1EOV A;  5BR8 L;  3DEO A;  2QDB A;  3QG1 A;  4KHZ A;  2Z9H A;  4JW0 A;  5BR8 Q;  3S2D B;  2VQE H;  5C4J H;  2W6P A;  1C3O A;  1RDP D;  3G6E A;  3V2T A;  2W9B A;  1TWG A;  3RLF A;  1BDO A;  5CC4 A;  3LWE A;  2F0U A;  4X3T A;  3K5I A;  4FO2 A;  4O3R A;  3PO3 B;  4IJH A;  1E4E A;  3VR6 A;  5F9N A;  1OXT A;  5KFZ A;  4A3F G;  5M5W H;  1QCB D;  4XXE A;  4F7X A;  3KBX A;  4A3F H;  1GYF A;  5EKL A;  2M2L A;  4DV0 L;  4J9P A;  2E75 C;  4JI4 H;  1BJT A;  1UUP A;  3UFX B;  1EY9 A;  2CQO A;  4XT1 B;  3R93 A;  1TWF H;  4K5V A;  2R93 G;  4GKJ Q;  3BA9 A;  3X3M A;  2KBN A;  4YR0 A;  3V6J A;  3ND8 A;  2YZG A;  2R93 H;  1VBH A;  5CV8 A;  4DR4 L;  4RB0 A;  3S1M B;  1D5X C;  1NAP A;  5E7N A;  4R8I A;  4DR4 Q;  2DWC A;  5KFU A;  3MR3 A;  2WB1 B;  3QOJ A;  4MN3 A;  5EGT A;  4X62 Q;  1IZ6 A;  4LF7 L;  4UCT A;  4J15 A;  4CJ2 C;  1D7Q A;  2F0L A;  4LF8 L;  4LH7 A;  2YS6 A;  1GKH A;  1ILQ A;  5ELO A;  3ULP A;  3S14 B;  3GTP B;  1D2B A;  1UC9 A;  1BGW A;  2ZTD A;  1IYJ B;  5LP6 F;  3RV4 A;  2FJ2 A;  4QIW A;  3S1Q B;  2UXB Q;  3J81 c;  4QQB X;  1XWE A;  5FPR A;  4DR7 H;  2SNS A;  3MFH A;  2C28 A;  4JBK A;  1RK6 A;  1T9H A;  1ENC A;  1X65 A;  2Z6K C;  4YHH L;  2NUA B;  2FLP A;  1QUQ A;  4YHH Q;  3SI8 A;  2AUK A;  4JVZ A;  3U9O A;  2RQX A;  5FLX L;  2I87 A;  3P7J A;  3KF8 B;  5AJ3 Q;  4GLX A;  4ECY A;  2HVS A;  5EWE A;  5KFS A;  2NB0 A;  5LXT F;  1DGS A;  1SRU A;  4CKE A;  1EZ1 A;  5DQG A;  2VUM G;  1F9S A;  1I94 H;  5KG7 A;  4ILW A;  2JEI A;  2G5D A;  1VQP A;  2VUM H;  2NVQ B;  5KT3 A;  2GVB A;  1XMQ H;  4C5C A;  4A2B A;  1A62 A;  4YAJ B;  5IOC A;  2SEB D;  5JJI A;  1ML0 D;  1RJP A;  1RKN A;  5M3F G;  1B7Y B;  2WB1 E;  2HQE A;  2KED A;  4ID6 A;  4IZO A;  3F2B A;  4CDC C;  5M3F H;  3JAM c;  3DM1 A;  3I4O A;  3IG0 A;  4E4T A;  4Q43 A;  4DL5 A;  5LL6 b;  1TS3 A;  4YR2 A;  1SE8 A;  3VR5 A;  1PX2 A;  5KFM A;  4ECX A;  1FGB D;  1TR5 A;  3TN2 A;  2VY3 A;  5KT7 A;  1TXY A;  4ZHQ F;  2NVY B;  1CA6 A;  4J0M A;  4JI6 L;  4DL4 A;  4KD3 A;  4LWC A;  1KD1 C;  1RL2 A;  2FP4 B;  3V4S A;  4KN7 C;  3SR1 A;  1XDN A;  1SNM A;  4QWC A;  4B3M H;  1OXV A;  5DG9 A;  2ASB A;  3PZP A;  2CHB D;  4UAI A;  1PLF A;  4LF7 H;  2C2E A;  3H3V C;  3QIA A;  1JCK B;  4HTH A;  4JYA H;  2QCP X;  1PA6 A;  3LML A;  3E0J A;  1E22 A;  3NK9 A;  2JA6 B;  2YS7 A;  5KFI A;  5FJ8 G;  2UXC L;  4C5B A;  3DXJ C;  5FJ8 H;  4B3R L;  1SYC A;  1WTV A;  2FB9 A;  4LF6 L;  4R9W A;  4BA1 I;  5T1G A;  2UXC Q;  3S17 H;  4NLG A;  4LF6 Q;  3K3P A;  1Y1V B;  4B9X A;  1G6P A;  1Q1E A;  2R7N A;  1PXU A;  5KFX A;  3RR5 A;  2RDI A;  1E2V A;  2QEJ C;  3NPP A;  2ASL A;  2N78 A;  3PW5 A;  1WCM G;  3TDQ A;  2UVV A;  2D0P A;  1WCM H;  2BA0 A;  5LA6 F;  2W7O A;  4CDD C;  2K05 A;  1VQB A;  4ECU A;  2B2Y C;  1EOT A;  1EYC A;  4V19 0;  3PF4 A;  4LH6 A;  1JLL B;  1IOV A;  2F0W A;  5J22 A;  3A7L A;  4FBT A;  3H6M A;  2KEN A;  1R9T B;  2FE3 A;  3JZI A;  4QUC A;  4MHE A;  3FRP B;  2RKS A;  2RDH A;  3CAM A;  3KF8 A;  3STB D;  3G71 A;  3J81 i;  1H9J A;  1PFS A;  4JG2 A;  2OTL A;  3U4Z A;  1SJH D;  1BXR A;  3PUX A;  2LKV A;  4YJ2 F;  3NEN A;  5FO8 B;  2R87 A;  4IN3 A;  1AUV A;  3NWS A;  2R7M A;  3RJ0 A;  2I5H A;  1S5D D;  3WNZ A;  3K5L A;  4C3I G;  5JEA G;  5JVG 3;  1EQR A;  1A8V A;  2OQK A;  4C3I H;  4S3S A;  5JEA H;  3HOV G;  1N32 L;  3GLK A;  5CA0 F;  3H4D A;  2A6E C;  3P1H A;  3HOV H;  2FFK B;  3CVZ A;  3F8N A;  3LX0 A;  5KYI A;  5GAG C;  5E4X A;  2KHI A;  3CCM A;  1JIH A;  4JI6 H;  4GLV B;  4QY7 A;  2OT2 A;  2VUG A;  4RKL A;  1KTK A;  4DR3 H;  2F4V H;  2AQ2 B;  2NUC A;  2OQ0 A;  4DR1 Q;  5KT5 A;  4HCS A;  1IBL L;  1C30 A;  2W9C B;  4QW8 A;  3HOY B;  4K5W A;  1ULZ A;  2ZTC A;  1N33 Q;  4BY7 B;  4B3S H;  4QWA A;  1NMG A;  4V0B A;  3DWP A;  3ZYY X;  3QZ7 A;  2CVR A;  3TQY A;  3JAM i;  2L5T A;  4KY6 A;  4J9S A;  1O7Z A;  4K5X A;  5TSS A;  2K1B A;  3BAA A;  5BPF A;  2B63 B;  2JEA I;  1Z2O X;  3A8J E;  2H5X A;  4A4I A;  4AYB B;  4LUV A;  4BBR G;  4GLA C;  2JXM B;  3RZD B;  1G51 A;  1HZ9 A;  3M7N A;  4RCN A;  1AFP A;  1ENA A;  3CHB D;  4BBR H;  3EIV A;  1VQ9 A;  4IFD I;  4YBZ B;  3V6K A;  5EWG A;  3LWU A;  3K7A H;  4ULL A;  4YR3 A;  1FD7 D;  2JA6 A;  1SBB B;  4HSV A;  2AWO A;  3G6X A;  1NTG A;  1JB3 A;  2BE5 C;  1N34 L;  5KGU A;  1M6V A;  4ED2 A;  4A3J B;  5GON F;  3ETH A;  5C3X A;  1PZK D;  1Y1V A;  2A68 D;  4DXF A;  4HMJ A;  2ATW A;  3GID A;  3PW2 A;  1B44 D;  4L5Q A;  1F2Y A;  4HED A;  1GUN A;  3EN2 A;  4RZQ A;  4I7A A;  4I7H A;  1I3Q B;  4G57 A;  1CQV A;  3QO2 A;  5CMD A;  3PIP A;  1STA A;  1HJP A;  4DV1 Q;  4RMF A;  2YRX A;  3WWV A;  3GTO H;  4DR5 Q;  4J8Q A;  1NR4 A;  4A3K G;  1STB A;  3KLR A;  4A3L G;  5M5X H;  4O0A A;  3KOJ A;  3PUZ A;  4A3K H;  4F87 A;  4FXD A;  2ZDH A;  4DKA C;  4A3L H;  4KHP H;  2VR1 A;  3NTK A;  4C5A A;  4BY1 G;  1N32 H;  1B6R A;  1AN8 A;  5JPM C;  3K81 C;  4DV7 Q;  1NNX A;  2AQ3 B;  3QOL A;  3T1H L;  4BY1 H;  3PVX A;  4AYB E;  1XNR H;  2O5J C;  1L1O B;  2PZW A;  1KDB A;  3U58 A;  3D4D A;  3RLO A;  3W3A A;  5D1P A;  3TRE A;  1HFG A;  3A55 A;  1SNO A;  1I6H H;  4P74 A;  2V4R A;  1PTO B;  4OGQ C;  5LMU L;  2VA2 A;  3CF5 A;  3PMF A;  4DV3 H;  2XRQ D;  3JRX A;  5CV9 A;  1K28 A;  5FK9 C;  2F0V A;  5A2Q E;  1O78 A;  4HJ9 A;  2HDM A;  3UQ8 A;  1YVC A;  3J80 W;  1A6X A;  4J9M A;  4FM9 A;  3S1N B;  2DZD A;  2YU9 H;  1KJI A;  1VQC A;  1VCI A;  2HGS A;  5C3E B;  2XC9 A;  4OON A;  2W9C A;  2CH4 A;  2XCP A;  5IOD A;  2IHF A;  4DUY Q;  1XNQ Q;  5KT6 A;  5FOB B;  4HIO A;  4HJA A;  1YHB A;  4G4K A;  4C2M B;  3F2C A;  2PNR C;  4KI0 A;  1S68 A;  5KG3 A;  1C48 A;  4UPA A;  3EJI A;  2B2U A;  4DFA A;  1N56 A;  2MO0 A;  4POF A;  3L3O C;  1HNZ H;  3OIP A;  4EYI B;  4CKC A;  5C4J B;  1ZEQ X;  1K9M C;  3GTP H;  4PMC A;  1HR0 L;  4J1M A;  4JV0 A;  1VKZ A;  2W8L A;  4DAY A;  4TQS A;  2CW0 D;  4GKK Q;  3RUZ A;  1SCU B;  3GV3 A;  4NXN L;  4GS3 A;  3TS2 A;  3NBI A;  1Q86 C;  5L1J A;  1MJC A;  3QB3 A;  3CCL A;  1EY5 A;  1L0Y B;  3NSW A;  2LY7 A;  4A3F B;  5IYZ F;  2FPI B;  1KEE A;  3BDL A;  3ULL A;  1KHI A;  4O3N A;  4ED8 A;  4XYQ A;  3VYS A;  3OWE B;  1CUK A;  1TWF B;  5KFG A;  4G7H C;  1W6K A;  4IAL A;  1CI3 M;  2PVP A;  5EBD A;  4YIJ A;  2R93 B;  1I3Q A;  4DR2 Q;  1B8A A;  3RBE A;  4DA2 A;  3I56 A;  2R8J A;  1IL2 A;  2ZM6 H;  1GUT A;  1QZH A;  1NSN S;  2Q2I A;  5IWA L;  1CHP D;  1Y1W A;  2BQU A;  1BCP B;  1TAE A;  4GN3 B;  4HCE A;  2B2T A;  4JV1 A;  3BZK A;  3ORR A;  4JI5 L;  1O80 A;  4K8I A;  1V51 A;  3BG3 A;  3OW7 A;  5JEA J;  3HEJ A;  1V4Y A;  1I4G A;  1W3S A;  3WO1 A;  3PUV A;  5ELN A;  1PYS B;  5CGK A;  5IP9 G;  4GOP B;  1IBK L;  4UCS A;  2YZM A;  1H9R A;  5LMU H;  5IP9 H;  1IBK Q;  1FJG H;  5IYD G;  2DPJ A;  1QB5 D;  1CZW A;  5FLX c;  5IYD H;  4J9L A;  3KDF A;  2R7F A;  3EFX D;  2VS1 A;  2V1C C;  4RGN A;  1A63 A;  4H7B A;  5FD5 A;  1I4P A;  1S0N A;  1MHW C;  4CGY B;  4AIM A;  4OWW B;  4FS2 A;  4EQP A;  1JJC B;  3ND9 A;  1HNW H;  4CC5 A;  1O7I A;  1AN7 A;  2WTF A;  2FPG B;  4QMG A;  3LNN A;  3HGB A;  1CM9 A;  4RHR A;  3DLL A;  1Q90 A;  1X54 A;  1G29 1;  2VUM B;  3S1R H;  4YY3 L;  4JI1 H;  1FNW A;  2V4Q A;  3MWD A;  3BDO A;  1PTO D;  4M7E A;  3ERS X;  1X55 A;  2WV6 D;  2FMA A;  3KAJ A;  5COY A;  2A69 D;  3H94 A;  4UCO A;  1HR0 H;  4YAK B;  3M85 A;  3N6X A;  1IYV A;  4ECV A;  2GA4 B;  1YJW A;  2PQA B;  1BNZ A;  4FS1 A;  5M3F B;  3D3R A;  3SE0 A;  4NKL A;  4LF5 H;  3C0F B;  2AUJ D;  2A73 B;  2EYL A;  1V43 A;  2B8F A;  5HBR B;  1LTT D;  5IGF A;  2NVX H;  4JI2 L;  4UFZ A;  4QCL A;  3N44 B;  4K2L A;  5JVL A;  3C3L A;  2VNU D;  1N36 H;  1IHZ A;  2N8N A;  2O2L D;  4BBS G;  2VPQ A;  4XQN A;  3BA8 A;  2KQ3 A;  3HBL A;  4BBS H;  2K04 A;  4LFC L;  2F3I A;  3CCQ A;  2VQF Q;  4H44 C;  1GSA A;  4DL2 A;  1WJJ A;  4ME3 A;  3CMA A;  5DAU A;  3GTG A;  4XIG S;  1A9X A;  3GDE A;  3C46 A;  3R5F A;  4L1K A;  2NN6 G;  1D5Z C;  2NBF A;  3A54 A;  4X65 L;  1R9T H;  1JWU D;  2NN6 H;  2PW5 A;  3F8T A;  2VPS A;  5C8Y F;  1EFW A;  4CJ0 B;  1KDA A;  3TRZ A;  2SDF A;  1TWC A;  4TQU S;  4P75 A;  1TWF A;  2AGQ A;  1TWH H;  3D31 A;  3H09 A;  2Q2T A;  1GGO A;  3M4P A;  4AQY L;  4JI5 H;  1A3U A;  3ER0 A;  4QL5 A;  1XMO Q;  1A15 A;  4QGU A;  4MV6 A;  3T4A C;  3OTO L;  5LMN Q;  2B3G A;  2VL6 A;  5EZY F;  4RAY A;  4ECT A;  3OTO Q;  1WTP A;  2F52 A;  5D65 A;  2ZXR A;  3S17 B;  1JWS D;  4IUT A;  3PIO A;  2KVM A;  3MFG A;  3MXU A;  2RGV A;  3F2D A;  2MPM A;  3CME A;  2E2D C;  3KXY T;  4ZOL F;  1N48 A;  2F1M A;  5EPL A;  1C7Y A;  4LFB L;  4K0K Q;  4LFB Q;  2AWN A;  1Z9F A;  4MTE A;  2HIV A;  2KEC A;  4YCW A;  4GOP A;  1FGU A;  5F2D A;  3DF7 A;  3JRW A;  1IW7 D;  1BCP D;  1H9M A;  3GIQ A;  1WCM B;  4DUZ Q;  2PPB C;  4BY7 H;  3L7Z C;  3TP8 A;  1QNK A;  3UDG A;  1VF7 A;  2HDL A;  4GN5 A;  3URY A;  5KFY A;  2EXZ A;  1Z6H A;  2RCN A;  3MXG A;  1SE3 A;  2Z8L A;  3ZJY C;  1YNN D;  3RIZ A;  3BJY A;  3GP7 A;  3SK8 A;  5KFA A;  1PH4 A;  1SLJ A;  2L11 A;  1XTC D;  4IUN A;  4TKO B;  2VUM A;  3LP8 A;  2BCO A;  4IOA A;  2L4N A;  4Q0Y A;  1Q8I A;  4MZ9 A;  3PCO B;  1HZC A;  3J81 W;  1Y8N B;  3RV3 A;  3T5J A;  2M05 A;  4C3I B;  2FIN B;  3I70 A;  4JI2 H;  1KLG D;  3HOV B;  4JV5 Q;  2A74 C;  3DM3 A;  3T51 B;  4P73 A;  1RHP A;  2VQE L;  1WTO A;  1VMP A;  5KFW A;  2JEG A;  2UXD H;  4A2A A;  2VQE Q;  4LFC H;  1ET6 A;  1SND A;  1HA5 A;  1DV1 A;  1KAW A;  4DV2 L;  2W70 A;  3Q1K A;  4QWD A;  3N40 P;  1S9F A;  1X3Q A;  1XJV A;  2R8K A;  1S5F D;  2QK4 A;  4A75 A;  1GUO A;  5KFB A;  4BWS C;  5FLX E;  2DIK A;  2XWJ B;  4RU9 A;  1PH7 A;  3NEM A;  5HGQ A;  1DYQ A;  4LFA H;  4JI4 Q;  4LF4 Q;  4AQY H;  1BBU A;  3Q8Q B;  2Q2U A;  2EYM A;  1Q3L A;  4JUZ A;  2CW0 C;  5HGT A;  5JJZ A;  5JOB A;  3R2I A;  3BVZ A;  1L0W A;  3NHH A;  2E2I H;  5JUM A;  2HVR A;  2RGR A;  3JAM W;  2B2U C;  2IPK D;  1YHQ A;  5J39 A;  4IPC A;  4BBR B;  2ATL A;  4NW2 A;  5EPK A;  2LFN A;  2R7D A;  2QYZ A;  3FKI G;  3JSN A;  4RB1 A;  3I2Z A;  2JQO A;  1HXY D;  3FKI H;  3K7A B;  3FVQ A;  4DLK A;  4Y52 H;  2UUA L;  1YIT A;  1STN A;  5I47 A;  4JI8 H;  5COR A;  4DK6 C;  1G91 A;  1G2S A;  4JCV E;  3CP0 A;  5BN3 A;  1KJQ A;  1J5E H;  3RTX A;  2K4K A;  2J4X A;  5G3L F;  1E7Z A;  1EUD B;  1KC8 C;  4APM A;  5KKN B;  3S2H H;  5DQH A;  2BDN A;  5L1K A;  1ICF B;  4DR7 L;  1LTI D;  4J9Q A;  1NJI C;  1KC7 A;  4DR7 Q;  3E9I A;  4YB8 B;  2F0M A;  2JE6 I;  1A0I A;  1ZYR C;  3VA7 A;  3SK4 A;  5C0X H;  1B9M A;  1RIP A;  1EZ8 A;  3CCR A;  1B53 A;  4A3I G;  5ISR A;  1YJN A;  3C2P A;  1Z2P X;  1X3G A;  2R7Z G;  1WCM A;  5K2M A;  4DPG A;  3MFI A;  4A3I H;  3GTO B;  2CW8 A;  2SOB A;  2R7Z H;  4C2M H;  5M5X B;  4A3K B;  2JA5 G;  2PZU A;  1A3V A;  3A74 A;  3GD7 A;  3KHR A;  3KHH A;  2JA5 H;  1E2W A;  1I94 L;  4DV4 H;  2B2T C;  1EZ6 A;  1H95 A;  1I94 Q;  2XGT A;  1XMQ L;  2I5L X;  4BY1 B;  4WJW A;  2RHS B;  4KY5 A;  1XMQ Q;  1GVP A;  3GIJ A;  4EX5 A;  1E0B A;  3NP8 A;  2V4D A;  4FXK C;  3K57 A;  3R5X A;  4ECZ A;  2AQ4 A;  2Q8R E;  4WRD A;  4DV2 H;  1TY0 A;  1JQY D;  3GTQ H;  1I6H B;  3RB3 A;  4WFN 3;  2ICI A;  1CKN B;  3FP9 A;  2ZDQ A;  4IQZ A;  1GXD C;  3CPW A;  5LMN W;  3C1F A;  4LMY A;  1YI2 A;  1PTO C;  2DLN A;  4DV0 Q;  5KFC A;  4RB2 C;  1QWY A;  1EYG A;  2YU9 B;  1DCZ A;  1G8Z D;  4FF3 A;  4ED3 A;  4B3M L;  3VPC A;  2VA3 A;  2R8G A;  2J6U A;  4HR7 A;  3D6C A;  2EJF C;  3L0O A;  1YNX A;  5CV7 A;  1V9P A;  4ZI7 F;  1CQF A;  1AZP A;  1K0S A;  4ZKB B;  1KNA A;  4OXP A;  4LF7 Q;  1IBM H;  4JYA L;  1DOL A;  3FPP A;  1JXL A;  2UUA H;  1CA5 A;  1S5B D;  4JYA Q;  4LF8 Q;  5JQW A;  3HKS A;  4XZ3 B;  3MEF A;  2ES2 A;  3TME A;  4RGT A;  3EPI A;  1F9R A;  2Y0S G;  3K6O A;  2XCL A;  3AU7 A;  2R8I A;  2UU9 L;  5DNF A;  1D5M C;  2QW7 A;  5J2T F;  3FDS A;  3NBH B;  4KN4 C;  4KV6 A;  1PH5 A;  4A3G G;  1CS0 A;  2KHJ A;  4A3G H;  3H3V I;  2N88 A;  1L2Z A;  3TSS A;  1HTP A;  3NUC A;  2EPB A;  5ELF A;  1HFN A;  2K5Q A;  5G3L D;  2O03 A;  3VDY A;  2EE1 A;  3KAK A;  2B29 A;  3BQ1 A;  2VB3 X;  2XRS D;  4NPS A;  1QVF A;  2J0T D;  1K1Q A;  2W8K A;  5AFW A;  2UUC L;  2HCI A;  2MO1 A;  1U0L A;  3H0G G;  4A3C G;  4A93 G;  2XD4 A;  4DL3 A;  1T3N A;  3KF6 A;  5CV4 A;  2XWB B;  4A3C H;  4CJ1 B;  4A93 H;  4LSA A;  3R8B A;  4RZR A;  1B6S A;  1IW7 C;  1BCP C;  2R6G A;  2W57 A;  3UDF A;  1VQI A;  1YNJ D;  3NQT A;  3GTJ H;  1V8Q A;  4DV6 L;  4IR9 A;  1N9W A;  1STY A;  2WP8 J;  4CHT B;  1PH3 A;  1NR2 A;  5IT9 E;  2KHS A;  3SK5 A;  2M9V A;  1OXS C;  4QWB A;  2K52 A;  1JJ2 A;  3CCV A;  3CRL C;  3E5S A;  1SXT A;  3VR2 A;  4GOP C;  2CQY A;  1YNN C;  4KKS A;  4TV8 F;  5DLF A;  1UE7 A;  1CKM A;  2K33 A;  2K5W A;  3MXN B;  5LHY 1;  1V1O A;  1ASZ A;  3HXL A;  1BOS A;  4JI6 Q;  4DR3 L;  1GUG A;  1STE A;  2F4V L;  1EQQ A;  4ODG A;  3IFT A;  1YHA A;  2FK2 A;  2F4V Q;  1KJ8 A;  2F0I A;  4LNQ A;  2R8H A;  4LSX A;  1DD2 A;  3G6Y A;  2HIX A;  1PK8 A;  4B3S L;  2AMC B;  3GV6 A;  1SYD A;  4OEM B;  1VQ7 A;  2XCA A;  3RNU A;  4MIU A;  1UNS A;  2C00 A;  1RJQ A;  4YWM A;  2Q8T A;  1S5C D;  1M0W A;  2OH2 A;  1EU4 A;  3S1R B;  1FR3 A;  2P0A A;  1OXX K;  4RHS A;  3TZD A;  1EIG A;  1GO3 E;  1CT1 D;  1JJG A;  4A3B G;  3VYU A;  3HOW G;  2WDT A;  2WB1 A;  4NB3 A;  3WDN A;  4A3B H;  2BA1 A;  4B3R Q;  3HOW H;  3IKJ A;  2UU9 H;  5KG1 A;  1KRS A;  1Q81 C;  3A8I E;  4IUR A;  4DU9 A;  2AGO A;  2H1E A;  4M8A A;  1QVC A;  2NVX B;  1NMF A;  1T5E A;  4ZK9 B;  2EYO A;  5H1S E;  3GTP A;  4O3O A;  2XTI A;  1IOW A;  3RD4 A;  4YQW A;  1T5X D;  2PNH A;  1PH2 A;  4MV4 A;  2K28 A;  4BBS B;  1FL0 A;  2R92 G;  2DUD A;  4IUV A;  1GHJ A;  2R92 H;  1EUJ A;  2UVW A;  2C9O A;  5DGA A;  1PDQ A;  3JSL A;  5C0X J;  1CSP A;  1EYD A;  1AE2 A;  4ME6 A;  2UUC H;  3U50 C;  2L0C A;  1V1Q A;  4MTK A;  3HFZ B;  5C1P A;  1E3P A;  2WAQ G;  5KT4 A;  4IRD A;  2PN1 A;  2F0E A;  3K5O A;  4QW9 A;  1TWH B;  3J7A V;  4C3H G;  3AB9 A;  1UNN C;  1TA8 A;  3MWE A;  1IL8 A;  1DOK A;  4C3H H;  3A7A B;  2G9H D;  2KA7 A;  4DV6 H;  4KHP L;  2XN9 C;  4M1U B;  5C4Z A;  4OX9 L;  4IWY A;  1BR9 A;  4TSS A;  4FF1 A;  3RN5 A;  4EFB A;  2FJZ A;  1J9O A;  2YCH A;  1N32 Q;  1QG7 A;  2BR0 A;  4ME5 A;  2KUM A;  4A76 A;  1SFO H;  2R85 A;  1XNR L;  3OUU A;  5D8D A;  5JPN C;  4O3Q A;  1S0M A;  3VA5 A;  1XNR Q;  5C5M A;  2JJQ A;  2MJ8 A;  5C3W A;  3AMU A;  2DY8 A;  1UE6 A;  2ZDG A;  4YP3 A;  1EY6 A;  2BH8 A;  2ZXO A;  1VQM A;  2KEE A;  3EYY A;  1GLV A;  4UP7 A;  1LT5 D;  1IBL Q;  2FXQ A;  4DV3 L;  1LTG D;  2RDG A;  2QF7 A;  2NVY A;  1V1P B;  2C2R A;  1LAC A;  2SNM A;  2L12 A;  4FP5 D;  5JVH 3;  1JOO A;  5DM6 3;  2EYJ A;  1PRT B;  2JN4 A;  1TS2 A;  1E2Z A;  3PUY A;  5KFF A;  5C44 G;  4P2C B;  1SEB D;  3N52 A;  5IE8 A;  5C44 H;  2YZN A;  1LTA D;  3GIP A;  3Q8D A;  3UDX A;  5E1F A;  1ET9 A;  5IYB G;  3TII A;  5FLX W;  3KLW A;  1JB7 A;  3I12 A;  5JJL A;  5IYB H;  1GM5 A;  1HNZ L;  5IT9 L;  2F4I A;  5KFV A;  1Q1B A;  4R8U B;  1RD9 D;  3W1G A;  3OW2 A;  1WFQ A;  1LTR D;  4CDF C;  1N34 Q;  3MC0 B;  3DHQ A;  3J7Y W;  1BBX C;  1EL0 A;  3K3V A;  5CB4 F;  4GNX B;  3FEW X;  3HOU G;  1SR3 A;  4IUP A;  4APV A;  3QZ8 A;  3HB9 A;  3HOU H;  2NTS A;  2F0N A;  4ZCK A;  1WR2 A;  4IFD G;  1EUC B;  3FMC A;  1WVL A;  3EPG A;  4O4H F;  4IFD H;  2NWG A;  2Z6B A;  3WOE A;  3PO2 G;  3N42 B;  3GQC A;  1D6E C;  1LTS D;  3PO2 H;  5EOY A;  2GPS A;  4OO1 I;  4IOC A;  2RBM A;  4IAJ A;  2HHH H;  4X66 H;  1I4H A;  3I4M G;  5HV6 A;  1MI2 A;  2TMP A;  2JA7 G;  2VOB A;  3I4M H;  2JP1 A;  4LUO A;  4X64 L;  4R4T A;  2JA7 H;  2E2I B;  3TIN A;  2K5H A;  4POG A;  1R9T A;  1XYI A;  4OX9 H;  5CBA E;  3G4S A;  4RAZ A;  3I4N G;  2ZM6 L;  5KG5 A;  4CDE C;  4R1J A;  4RCO A;  3I4N H;  4B08 A;  2K5D A;  3D6W A;  1CTM A;  5KRU A;  3T1H Q;  3FKI B;  1YIJ A;  4TRD A;  2C22 A;  3E0E A;  1EQT A;  3T13 A;  5KFO A;  1B3A A;  4PQX A;  1S0O A;  3U4V A;  3D0F A;  3MA2 B;  1XPO A;  1T36 A;  4EEQ A;  4Q45 A;  1AE3 A;  1HUM A;  2I07 B;  1P8L A;  4WOR A;  2YTY A;  2Z4H A;  3J7A F;  3S2H B;  1FJG L;  1GJX A;  3Q8R B;  2I5M X;  5LMU Q;  3DEP A;  1PH9 A;  1K83 H;  2L15 A;  1HQR D;  3CXC A;  5KYL A;  4JI0 L;  3OSP A;  2F0F A;  2C2D A;  5LYJ F;  1PTO F;  2FKL A;  3VPB A;  4FNF A;  4EQN A;  1C9O A;  1X32 A;  5DLG A;  1YNJ C;  1G2T A;  4HAE A;  4ED6 A;  3NWT A;  1EY0 A;  1GSO A;  4A3I B;  2QDL A;  2MP1 A;  4UP8 A;  2R7Z B;  3BQ0 A;  1HNW L;  1FYC A;  3ITP A;  1KDC A;  1RJT A;  4KJO A;  1Q12 A;  4GC7 A;  4IPD A;  3ERQ A;  3KHL A; 
#chains in the Genus database with same CATH homology
 1VQE A;  4A3E H;  2F52 A;  3RLF A;  3BU2 A;  2HHH L;  1P16 A;  3KFU A;  2ALY B;  4JI1 L;  3PIO A;  4X66 L;  2VW9 A;  4IJH A;  1MJE A;  2HHH Q;  4A3E G;  3F2D A;  3AYH B;  3CME A;  4X66 Q;  3B6Y A;  4A3D G;  1C7Y A;  4LFB L;  1OXT A;  1EIY B;  4A3D H;  4A3F G;  4KHP Q;  5M5W H;  3GO5 A;  3RLN A;  4K0K Q;  1HZA A;  1HR0 Q;  2AWN A;  3OYY A;  1Z9F A;  4A3F H;  1VQO A;  1X9N A;  2HIV A;  4OX9 Q;  4GOP A;  4YCW A;  4DV0 L;  1HNX L;  1FGU A;  3PF5 A;  4LF5 L;  2CQO A;  4LF5 Q;  4NXN Q;  1TWF H;  4DUZ Q;  3A5U A;  1KL9 A;  4YCU A;  4BY7 H;  4GKJ Q;  2KBN A;  2E2H H;  2R93 G;  3L7Z C;  2UXD Q;  3UDG A;  1PV4 A;  1N36 L;  2R93 H;  4DR4 L;  4GN5 A;  4PG3 A;  4BA2 I;  5E7N A;  4DR4 Q;  2UUB L;  1NY4 A;  1TWG H;  2RCN A;  3LGJ A;  4X62 Q;  1IZ6 A;  3ZJY C;  4LF7 L;  3M3Y H;  4C3J H;  4J15 A;  1D7Q A;  3RZO H;  3K8A A;  1VQ4 A;  2IX1 A;  4DV3 Q;  2MNA A;  1Q7Y C;  4LF8 L;  1PH4 A;  1SLJ A;  3PV0 A;  1GKH A;  5ELO A;  3ULP A;  5IWA Q;  4IOA A;  2ID0 A;  5K36 G;  4MZ9 A;  4YWL A;  5JJK A;  2ZTD A;  1HZC A;  3PCO B;  1IYJ B;  1OXU A;  4R4I A;  3BZC A;  1NE3 A;  4DR1 L;  2UXB Q;  3J81 c;  4QQB X;  4JV5 Q;  3DM3 A;  4P73 A;  2VQE L;  4JI5 Q;  4JBK A;  1N33 L;  1T9H A;  1X65 A;  2IT1 A;  2Z6K C;  4YHH L;  2Z0S A;  3I7F A;  2VQE Q;  1QUQ A;  3J7Z C;  2K5N A;  4YHH Q;  4KLK A;  4XTC S;  1KAW A;  4DV2 L;  1L1O A;  2E2J H;  4TVA B;  1XJV A;  1I5F A;  3KF8 B;  5AJ3 Q;  4GLX A;  3STB C;  1HNZ Q;  1ASY A;  4A75 A;  1VS0 A;  1DGS A;  1X56 A;  1SRU A;  3S16 H;  3AQQ A;  2VUM G;  4WJ3 M;  3G6E A;  2JA6 H;  4A3M G;  1PH7 A;  2VUM H;  3NEM A;  5HGQ A;  1VQP A;  1BVS A;  1N8R C;  2GVB A;  4PMW A;  4JI4 Q;  4LF4 Q;  1BBU A;  4DAY B;  2Q2U A;  1A62 A;  5JJI A;  1L0W A;  2E2I H;  2E5L L;  5M3F G;  1B7Y B;  2WB1 E;  1YHQ A;  1YEZ A;  2GN5 A;  4IPC A;  4P71 A;  3F2B A;  5M3F H;  2R7D A;  3JAM c;  3FKI G;  3I4O A;  1XPR A;  4YY3 Q;  3I2Z A;  5C4X G;  2JQO A;  3FKI H;  2CKZ B;  5C4X H;  3M9B A;  4Y52 H;  4IPH A;  1I50 H;  1SE8 A;  4X64 Q;  4Y7N H;  1K8G A;  3IRB A;  2UUA L;  1YIT A;  3UDI A;  2VY3 A;  4DK6 C;  1TXY A;  4JCV E;  1BKB A;  3CP0 A;  2DGY A;  4DAM A;  2ZM6 Q;  1SRO A;  4JI6 L;  2K4K A;  4LWC A;  1KD1 C;  1RL2 A;  1E7Z A;  1KC8 C;  4MTN A;  4DV1 L;  1AH9 A;  3S2H H;  4FDB A;  1WI5 A;  4DV5 L;  4DR5 L;  2WFW A;  2N3S A;  3RN2 A;  4JI2 Q;  1OXV A;  1NBW A;  4OO1 G;  4DV5 Q;  4DR7 L;  2ASB A;  4DR6 L;  1NJI C;  2UXD L;  4DR7 Q;  3E9I A;  4DR6 Q;  1J6Q A;  1LYL A;  2JE6 I;  4R4Q A;  1A0I A;  4LUZ A;  3HOZ G;  3GTL H;  3CCR A;  1RIP A;  2Y0S E;  4LFC Q;  4A3I G;  1B70 B;  1YJN A;  2JEB I;  1VQK A;  3HOZ H;  1X3G A;  2R7Z G;  2N49 A;  4DV7 L;  4DPG A;  1FJG Q;  4A3I H;  2OWO A;  2R7Z H;  1PA6 A;  2CWP A;  3S2D H;  1E22 A;  2PMZ E;  4C2M H;  5FJ8 G;  2EQS A;  4EQ5 A;  2JA5 G;  3A74 A;  3GD7 A;  4X65 Q;  4JI0 Q;  2UXC L;  4HIK A;  5FJ8 H;  4B3R L;  2JA5 H;  1I94 L;  4LF6 L;  3NEL A;  4BA1 I;  4P72 A;  2UXC Q;  3PO3 G;  3KDF B;  3S17 H;  1H95 A;  1I94 Q;  2XGT A;  4LF6 Q;  4LFA L;  1L2F A;  1XMQ L;  2I5L X;  5J3B A;  3PO3 H;  1G6P A;  1Q1E A;  2RHS B;  1XMQ Q;  4AQY Q;  2NZH A;  1HNW Q;  1GVP A;  4EX5 A;  3RR5 A;  1Q46 A;  1VQJ A;  2EIF A;  3KJP A;  5GAH C;  2N78 A;  4UP9 A;  5FLM G;  5FLM H;  2A19 A;  4L5S A;  1QVG A;  4JI1 Q;  4JOI A;  3GTQ H;  1WCM G;  3JC6 6;  1XTD A;  4DUY L;  1XNQ L;  2A8V A;  1CKN B;  2D0P A;  1WCM H;  2BA0 A;  2RHQ B;  3FP9 A;  3CCJ A;  3CPW A;  5LMN W;  3J81 j;  1VQB A;  1YI2 A;  4JI8 L;  3I55 A;  3PF4 A;  1J5E L;  3S1M H;  2WB1 G;  4DV0 Q;  1HNX Q;  1EYG A;  2KEN A;  1J5E Q;  3CAM A;  3STB D;  2QGQ A;  3G71 A;  1M1K C;  4B3M L;  3J81 i;  1PFS A;  4JG2 A;  1PH1 A;  2OTL A;  3U4Z A;  1M90 C;  1CSQ A;  3K80 C;  1N36 Q;  1K0R A;  2YYZ A;  3PUX A;  1KIX A;  1HR0 W;  4GNX A;  3L0O A;  1YNX A;  3NEN A;  2ZJQ A;  2CFM A;  3S14 H;  2UUB Q;  1V9P A;  4B3T L;  2I5H A;  5JEA G;  4OXP A;  1EQR A;  4LF7 Q;  4GKK L;  1A8V A;  2OQK A;  3W1B A;  4C3I H;  3HOV G;  1N32 L;  4JYA L;  3S1Q H;  3K7U C;  4HJ7 A;  3HOV H;  1WOC A;  4IJL A;  4JYA Q;  2NZO A;  4LF8 Q;  5GAG C;  3CC7 A;  3PGZ A;  3AFQ A;  2A1A A;  2KCT A;  2KHI A;  3HKS A;  3CCM A;  3MEF A;  2AKW B;  2ES2 A;  4GLV B;  4QY7 A;  5GRO A;  4DV4 L;  1Z47 A;  2JK8 A;  3SGI A;  2Y0S G;  1JMC A;  2UU9 L;  2OQ0 A;  4DR1 Q;  1IBL L;  4BXX G;  1EIF A;  3NBH B;  2PQA A;  4BXX H;  3E9H A;  1PH5 A;  2ZTC A;  4DR2 L;  1N33 Q;  4A3G G;  4DNI A;  2IY5 B;  1NMG A;  2KHJ A;  2MFI A;  4L5R C;  4A3G H;  3TQY A;  3JAM i;  3H3V I;  4ALP A;  2NVQ H;  4DV2 Q;  1KQS A;  4JI3 L;  2YTX A;  2ZTE A;  3VDY A;  2CCZ A;  1VQD A;  2B29 A;  2LXK A;  2JEA I;  3ICE A;  4DK3 C;  2H5X A;  2LSS A;  4NPS A;  4A4I A;  5GAD C;  1QVF A;  1LTL A;  4LFB Q;  4BBR G;  4GLA C;  2UUC L;  1G51 A;  1HZ9 A;  2YV5 A;  3M7N A;  3S15 H;  4BBR H;  3EIV A;  1IXR A;  2HQL A;  1VQ9 A;  4RG1 A;  2MO1 A;  1LM0 A;  2CWA A;  1U0L A;  1X6O A;  3H0G G;  3PSI A;  4L5T A;  4A3M H;  4IFD I;  4A3C G;  4A93 G;  3K7A H;  3KF6 A;  4A3C H;  1S72 A;  4A93 H;  2E5L Q;  2AWO A;  2R6G A;  5IT9 c;  3UDF A;  1NTG A;  1VQI A;  2QA4 A;  1N34 L;  3GTJ H;  3AEV A;  2NVY H;  1VQA A;  4DV6 L;  1UE5 A;  1N9W A;  2WAQ E;  2WP8 J;  1VQN A;  1PH3 A;  2ATW A;  1PVO A;  1D8L A;  4PZ8 A;  1IBM L;  1OXS C;  2K52 A;  1JJ2 A;  3CCV A;  1IBM Q;  4L5Q A;  4GOP C;  2UUA Q;  4UY8 C;  3EN2 A;  1UE7 A;  1CKM A;  1E1O A;  1PH6 A;  3MXN B;  1ASZ A;  1VQG A;  4JI6 Q;  4DR3 L;  5IP7 G;  3PIP A;  1LUZ A;  2F4V L;  1HJP A;  1EQQ A;  1VQL A;  5IP7 H;  4DV1 Q;  4RMF A;  1YHA A;  2IHE A;  2F4V Q;  3WWV A;  5IYC G;  1UEB A;  4HIM A;  3TEH B;  4LNQ A;  4DR5 Q;  4JI7 L;  2JA6 G;  3GTK H;  5C0X I;  4A3K G;  5IYC H;  4A3L G;  2HIX A;  5M5X H;  4JI7 Q;  4O0A A;  3KOJ A;  3PUZ A;  3HKZ E;  4A3K H;  4B3S L;  2AMC B;  4DKA C;  1VQ7 A;  4A3L H;  4R4C A;  3RNU A;  3TS0 A;  4PZ6 A;  1Y1V G;  5DLQ E;  4YWM A;  4IFD J;  1JT8 A;  4BY1 G;  2K5V A;  1Y1V H;  2NN6 I;  1OXX K;  3K81 C;  4DV7 Q;  1QUQ B;  3T1H L;  4BY1 H;  4HID A;  1GO3 E;  3J80 i;  4AYB E;  1L1O B;  1JJG A;  4A3B G;  3U58 A;  3HOW G;  1GD7 A;  2C35 B;  4NB3 A;  2OCE A;  4A3B H;  2BA1 A;  2Q2H A;  3RLO A;  4IO9 A;  3HOW H;  4B3R Q;  4X6A H;  2K75 A;  3TRE A;  3F1Z A;  1KXL A;  4LFA Q;  1KRS A;  2Z6K A;  2VQF L;  1Q81 C;  1I6H H;  4P74 A;  4WJ4 A;  4LF9 L;  5LMU L;  1Y14 B;  3CF5 A;  1QVC A;  1NMF A;  1Y1W G;  5H1S E;  2XTI A;  1Y1W H;  4PZ7 A;  1L1O C;  2PNH A;  4HJ9 A;  1PH2 A;  1K8A C;  1YVC A;  2ZJP A;  1FL0 A;  2R92 G;  3GTO H;  1HH2 P;  1U5K A;  3S24 A;  2DUD A;  1VQC A;  1VCI A;  3M4Q A;  5IY0 A;  1S40 A;  4OON A;  2YU9 H;  1EUJ A;  2R92 H;  3A5Z B;  3J80 c;  2IHF A;  2KCM A;  4DUY Q;  1XNQ Q;  5C0X J;  1EWI A;  1CSP A;  1AE2 A;  4JBM A;  3CCU A;  1XMO L;  4HIO A;  4HJA A;  5LMN L;  1TWA H;  4JI8 Q;  1YHB A;  3U50 C;  3F2C A;  4KI0 A;  1V1Q A;  1C0A A;  1SN8 A;  3HFZ B;  1KRT A;  1YBY A;  4UPA A;  1E3P A;  2AHO B;  2WAQ G;  4HJ5 A;  2MO0 A;  2ZJR A;  4POF A;  4B3M Q;  4AH6 A;  4QIW E;  5HY6 A;  3W5O A;  3BJU A;  4NXM L;  4C3H H;  3UE0 A;  1PH8 A;  1K9M C;  4KHP L;  3GTP H;  4K0K L;  3GTG H;  3T1Y L;  1HR0 L;  4NXM Q;  2NVT H;  3CC4 A;  4OX9 L;  4LW1 A;  3CC2 A;  1VQ6 A;  3T1Y Q;  1E24 A;  3RN5 A;  4B3T Q;  1VQ5 A;  2BH2 A;  4GKK Q;  1UWV A;  2EXD A;  1N32 Q;  4NXN L;  3HOY G;  4GS3 A;  3TS2 A;  4DUZ L;  4A76 A;  1X3E A;  1SFO H;  1Q82 C;  1TWC H;  1XNR L;  4BY7 G;  3HOY H;  1Q86 C;  4GKJ L;  2HT1 A;  1MJC A;  3CCL A;  1XNR Q;  1VQ8 A;  2JJQ A;  3HKZ G;  4R4O A;  2IX0 A;  3G48 A;  4DV4 Q;  1UE6 A;  3ULL A;  2BH8 A;  1K3R A;  1KHI A;  4H02 A;  1VQM A;  1S3O A;  4X62 L;  4UP7 A;  2UU9 Q;  2B63 G;  1MIU A;  1CUK A;  2FXQ A;  1IBL Q;  5M5Y H;  2B63 H;  4DV3 L;  4AYB G;  1FVI A;  3FHW A;  4DR2 Q;  1B8A A;  3RZD H;  3I56 A;  2I0Q A;  1IL2 A;  1E1T A;  1QZH A;  2Q2I A;  5IWA L;  3J7A 5;  4GN3 B;  3CD6 A;  4JI3 Q;  3CQZ H;  1HZB A;  2UXB L;  3BZK A;  4JV5 L;  3PUY A;  2PI2 E;  1JE5 A;  4JI5 L;  4A3J G;  5C44 G;  2UUC Q;  5JEA J;  1W3S A;  4A3J H;  1SMX A;  5IE8 A;  5C44 H;  3PUV A;  5ELN A;  1PYS B;  3H0G H;  5IP9 G;  2D62 A;  3Q8D A;  3A0J A;  3UDX A;  3CCS A;  4GOP B;  1IBK L;  1UE1 A;  1YZ6 A;  4GN4 B;  5IP9 H;  5IYB G;  1IBK Q;  1VQH A;  3KLW A;  3UE1 A;  2QEX A;  1JB7 A;  5JJL A;  2K50 A;  5IYB H;  4IPG A;  5IYD G;  1GM5 A;  5AJ3 L;  1HNZ L;  1Q1B A;  5FLX c;  3W1G A;  3OW2 A;  5IYD H;  2OTJ A;  1WFQ A;  3H3V H;  3KDF A;  2R7F A;  2VS1 A;  2V1C C;  1N34 Q;  4JOI C;  1A63 A;  2LXJ A;  1I3Q H;  4DV6 Q;  4GNX B;  4JI4 L;  2JA9 A;  1Q8K A;  1SR3 A;  4AIM A;  4APV A;  4LF4 L;  3HOU G;  4OWW B;  3HOU H;  3GTM H;  1JJC B;  4JBJ A;  4IFD G;  1O7I A;  1MKH A;  3AFP A;  3L2P A;  2YTV A;  3PO2 G;  3DLL A;  5GQO A;  3M4O H;  1X54 A;  1CKN A;  1G29 1;  1WYD A;  4DR3 Q;  3PO2 H;  4IOC A;  3KJO A;  3S1R H;  4YY3 L;  4OO1 I;  3I4M G;  4JBW A;  2JA7 G;  3ERS X;  1X55 A;  4GNX C;  3I4M H;  4LUO A;  4X64 L;  4R4T A;  1YJ9 A;  5M3M G;  2JA7 H;  2D0O A;  2K5H A;  3M85 A;  4POG A;  2PI2 A;  5M3M H;  4B3S Q;  3G4S A;  4HJ8 A;  3I4N G;  2ZM6 L;  1YJW A;  2PQA B;  1K73 C;  4R1J A;  1BBW A;  1CKO A;  3K0X A;  2JA8 G;  3I4N H;  2JA8 H;  1W2B A;  3T1H Q;  1YIJ A;  1V43 A;  4YWK A;  4MNO A;  1VQF A;  3H15 A;  3E0E A;  2NVX H;  4JI2 L;  2VNU D;  4QJF A;  2N8N A;  3U4V A;  3D0F A;  1XPO A;  4BBS G;  1PHJ A;  4O2D A;  1X3F A;  5C0X G;  2VZA A;  3CPF A;  5C3E G;  1AE3 A;  4BBS H;  4LFC L;  3S1N H;  1P8L A;  2F3I A;  4JC0 A;  3PUW A;  5C3E H;  2YTY A;  2VQF Q;  3CCQ A;  1WJJ A;  2RF4 A;  1QZG A;  4ME3 A;  2I5M X;  3CMA A;  5LMU Q;  4LF9 Q;  1FJG L;  5GAE C;  1PYB A;  4OWX B;  3EBE A;  1PH9 A;  1K83 H;  4XIG S;  3GDE A;  3KF6 B;  2E8G A;  2L15 A;  2NN6 G;  3CXC A;  2K14 A;  4JI0 L;  4OWT B;  3CW2 C;  4X65 L;  1R9T H;  3F8T A;  3ULJ A;  2GVA A;  1C9O A;  3HOX G;  1EFW A;  3TRZ A;  3KYH C;  1XPU A;  4TQU S;  4P75 A;  4YCV A;  3HOX H;  1TWH H;  1EOV A;  3D31 A;  3CCE A;  1OTC A;  5BR8 L;  4UP8 A;  3M4P A;  2Q2T A;  4AQY L;  1HNW L;  2MQH A;  3ER0 A;  4QL5 A;  4KHZ A;  5BR8 Q;  5EAY A;  4QGU A;  1XMO Q;  3OTO L;  5C4J H;  1Q12 A;  2B3G A;  2VL6 A;  4IPD A;  4LUV A;  5LMN Q;  3OTO Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...