2R7ZG

Cisplatin lesion containing rna polymerase ii elongation complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanism of transcriptional stalling at cisplatin-damaged DNA.
pubmed doi rcsb
molecule tags Transcription/dna-rna hybrid
molecule keywords 5'-D(*TP*AP*CP*TP*TP*GUP*CP*CP*CP*TP*CP*CP*TP*CP*AP*T)-3'
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r7zG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r7zG01
2IT1A 4MNOA 1NY4A 3KOJA 4KHZA 3UE1A 4HJ9A 4JI2L 1CKMA 1XNRQ 4LFCQ 1Q1BA 2IHEA 3W5OA 1KD1C 2JQOA 3CC4A 5IP9H 5GAGC 4GLVB 4IFDJ 2ALYB 1A8VA 2K14A 4ALPA 3H3VI 4DR2L 3J81i 4DUYQ 3OTOQ 4A3IG 3ULPA 3GTQH 4DR6Q 3HOUG 4GNXC 3CC7A 4HIMA 3GTMH 4BXXG 3I55A 2PMZE 4GOPB 4BY1H 1WCMH 3F8TA 4OO1G 2PI2A 3E9HA 4NPSA 2UUAQ 4QIWE 3M85A 2ES2A 4NXML 2JE6I 3F2DA 1VQNA 4LUZA 5GADC 2CCZA 2VUMG 2VUMH 1UE1A 1IL2A 4IPDA 5IYCG 3HOYH 3ER0A 3S1QH 1K3RA 3G71A 4BY7G 3T1YQ 1VQMA 1IBKQ 2WB1G 4HIDA 1N33L 2QA4A 1SLJA 2Z6KA 3OYYA 1PH9A 1HNZQ 1PH7A 2JEAI 1AE2A 3S17H 1HR0Q 2A19A 3D31A 2R6GA 3BU2A 4JV5L 4DR7Q 3CPWA 1JB7A 1KQSA 2E5LQ 3HFZB 2WAQE 1PH1A 2CFMA 3KF6B 1I6HH 2EQSA 3DLLA 1OXXK 5M3FH 1NE3A 2K50A 4Y7NH 3S1MH 2F52A 4AIMA 3EIVA 5IYBH 1YITA 1XPOA 3LGJA 3UDFA 4DV7Q 4A3EG 4JI3L 4LF9L 4QY7A 3GTGH 1EFWA 3H3VH 4JYAQ 4HIOA 1VQCA 4BBSH 2A1AA 2I5HA 1KXLA 5LMUL 4YCWA 5IWAL 3GTKH 4A75A 3ULLA 2OTLA 4LF5Q 3HOVH 1VQ8A 1SN8A 1YIJA 4DR1L 4LWCA 2JA8G 2NVXH 1HNXQ 5BR8L 4GKKL 3PO3H 4LFBL 3PO3G 2K5VA 5FLXc 3TRZA 4YWLA 5LMNW 4DK6C 1OXTA 3T1YL 3L0OA 1IBKL 4GLXA 1VQ5A 2UXBL 3D0FA 1VQIA 4DV1L 1R9TH 1VQLA 3HOVG 2RF4A 2XTIA 1LYLA 4B3SQ 1VQ6A 5FJ8G 1LUZA 4AQYQ 2YU9H 5C44G 2IY5B 2UXCQ 2XGTA 1A62A 3A5ZB 3EN2A 1Y1VH 2IX0A 2E5LL 1N32Q 3M4QA 4HJ5A 4IO9A 3H0GH 1Y1VG 1VQ9A 1PA6A 2ATWA 4YHHL 3TEHB 5M5YH 4IFDG 3RZDH 4JI0L 3KF8B 2NN6I 1KRTA 2N3SA 4YWMA 4NB3A 3HOWG 3ERSX 3HKZG 4C3HH 1AE3A 3IRBA 5IWAQ 1HNWL 2MQHA 4NXMQ 2KBNA 4PG3A 1X55A 2LSSA 2VQEQ 1VQOA 1N36L 1NMFA 2RHQB 2EXDA 1NJIC 2ZTDA 3ZJYC 2NVTH 2VZAA 1N33Q 3HKZE 1XPRA 4OX9Q 1Q12A 1UE7A 2H5XA 1VCIA 4DKAC 1WCMG 2NVQH 4BY1G 2CQOA 5JEAJ 1YJ9A 2HIXA 1IBML 1PVOA 1L0WA 1GKHA 4JI2Q 1HZ9A 4RMFA 1XNRL 4A3DH 1AH9A 1N32L 2D0PA 3UDIA 1LTLA 2I5MX 2LXKA 2R7DA 1PFSA 4YHHQ 3CCSA 4DV7L 1KC8C 3HOXH 2Q2TA 4LF9Q 1MJEA 4DUYL 1HZAA 4JYAL 4GNXB 3FP9A 4UP7A 2GVBA 3CMAA 4JI7L 1CSPA 1FJGQ 1G6PA 1Q82C 1WI5A 4GOPA 2L15A 4DV2L 1TWFH 4KLKA 1J6QA 1VQPA 2D62A 3BZCA 1OXSC 5IYCH 4GS3A 4GKKQ 2Q2HA 4DUZL 2PNHA 2OWOA 3MEFA 3S2DH 5ELNA 4A4IA 4KHPL 1DGSA 4JI8L 3J81c 4PZ8A 5JJKA 4WJ4A 1IBLL 1X65A 4IOCA 2RHSB 4KI0A 4GOPC 4FDBA 4J15A 5GAHC 3PUVA 2Q2UA 2MO1A 1C0AA 2K5HA 4B3RQ 1OTCA 2UXCL 3L7ZC 4X66L 2HT1A 4A3KG 3STBD 4GN5A 1YJNA 5EAYA 1M90C 3CF5A 3NEMA 1B70B 4UP9A 3T1HL 4B3TL 2MFIA 1I3QH 3K80C 4A3LH 3W1GA 1UE5A 1IYJB 4OWTB 4JI7Q 1PH4A 4DV4L 2UUBQ 3A5UA 3VDYA 2FXQA 5LMUQ 3FHWA 3S24A 2IX1A 3I56A 2VL6A 1X3FA 3DM3A 3PUWA 3TREA 4A3MH 4PMWA 4JOIA 1K8AC 3I4NG 4L5TA 3GTJH 1I50H 2VNUD 1VQ7A 3GDEA 3KLWA 4LF7Q 4JBJA 1S40A 1L1OA 4LFAL 3CXCA 3PO2G 2GVAA 4KHPQ 5C4JH 2YTVA 1E7ZA 4C3JH 3Q8DA 3UE0A 1XMQL 4IFDI 3CAMA 1E3PA 3JAMi 3G6EA 4A3EH 1X3EA 1JJCB 3AFQA 3NENA 4GLAC 2B29A 1PH5A 1CKOA 2JA5G 3PCOB 5C3EH 3PF5A 1PV4A 3I4OA 1EUJA 4GN3B 1E24A 2AKWB 3BZKA 3PIOA 1HZCA 2UUCQ 4LNQA 5E7NA 3TS0A 3CW2C 2WAQG 4JC0A 4DUZQ 2R92H 3CCLA 3ULJA 1YEZA 2VS1A 2YTXA 4R4QA 4DV0L 1YVCA 3HOYG 4LF7L 4AYBG 4DV5L 2QEXA 2UU9Q 4A93H 1A63A 4TQUS 2B63H 4K0KL 4OX9L 4X6AH 1UEBA 1LM0A 2OQKA 1O7IA 4UPAA 4JI6Q 1E1TA 4DR5L 4B3RL 4P73A 2ID0A 4X64Q 3MXNB 2ASBA 4JCVE 2CWAA 3AYHB 1QUQA 3STBC 4BBRH 2JJQA 3F2CA 2BH2A 4UP8A 2B3GA 3HOWH 3AFPA 1CKNB 1U5KA 3H15A 1X9NA 4ME3A 3KF6A 5C0XI 1M1KC 1YI2A 4P71A 4DPGA 4YY3Q 1UE6A 3OTOL 2QGQA 4DR6L 3H0GG 1PH3A 3K8AA 2LXJA 1XPUA 1WFQA 4JBWA 4GKJL 4L5QA 3NELA 5FJ8H 5GQOA 3RZOH 2E8GA 1FGUA 4JOIC 4APVA 1ASYA 4LFAQ 2F3IA 3K7UC 3S1RH 4DNIA 1VQHA 4JI8Q 1XMOL 1I94Q 1IBLQ 3G48A 4RG1A 2I5LX 5HY6A 4IPHA 4R4TA 3PF4A 4A3GG 4K0KQ 4JBKA 2JA8H 4DAYB 5M3MG 5M5XH 1BBUA 3CCQA 1MJCA 3BJUA 1Q86C 1I5FA 3U58A 4LF8L 5GROA 5IYDG 2E2HH 1L1OC 3U50C 4JI4L 1KHIA 3SGIA 4DV3L 1K8GA 3TQYA 4LF4L 4POGA 3CCEA 1BKBA 3T1HQ 2RCNA 5LMNL 1C9OA 1VQFA 4DK3C 2HHHQ 1PYBA 3CD6A 2CWPA 4Y52H 3RN2A 1MKHA 4IPGA 4P72A 4DV4Q 3J80i 1HR0W 3CCRA 1J5EL 2UUBL 4BA2I 1H95A 4GKJQ 1TWAH 3HOZH 3CCMA 1QVGA 3FKIG 2VQFQ 4OXPA 2N49A 1YBYA 4R4OA 3GTOH 3G4SA 2F4VQ 4DV6L 4R4CA 4A3BH 1VQBA 2UU9L 1SE8A 5J3BA 4PZ6A 1VQDA 3B6YA 4NXNL 4A93G 4DV1Q 2Z0SA 4OONA 4L5SA 3CPFA 4X64L 3KDFB 2ZTCA 1KIXA 1VQGA 1CKNA 1YHAA 1TWGH 4B3SL 1GM5A 4AQYL 4QGUA 1SRUA 1G291 3RN5A 1N8RC 2ZTEA 1JE5A 2JA6G 3I4MG 4A3FG 3HOUH 4DR3L 3S15H 5M3FG 3K0XA 4A3IH 1KRSA 3CQZH 4DV3Q 4JV5Q 4YY3L 2DUDA 1P16A 2A8VA 1EQRA 2KHJA 1E1OA 4JI0Q 4DAMA 1EQQA 2CKZB 2EIFA 1W3SA 2ZM6Q 1JJ2A 4QL5A 1NBWA 1EIFA 3U4VA 5HGQA 3CP0A 2ZJRA 2UUCL 2UXDL 2JA6H 1HNWQ 4X62Q 4A3JH 1Y1WG 2JEBI 4PZ7A 5M5WH 3TS2A 4BY7H 4BA1I 2E2IH 2WFWA 4YCUA 4POFA 4A76A 4LF5L 4DV6Q 1PH8A 1XNQQ 1K0RA 2K4KA 4DV5Q 1IXRA 3JAMc 4DR1Q 1OXVA 4IPCA 4X65L 2OTJA 3CCJA 1EOVA 1WYDA 1SMXA 4LFBQ 1V43A 4A3JG 1Y1WH 1QZHA 4JI1Q 1U0LA 1HH2P 5C0XG 2KENA 3AEVA 3M4OH 1D8LA 4DR4Q 4BXXH 1B8AA 1GD7A 4A3MG 4LUOA 1VQJA 4MTNA 1PYSB 3CMEA 3W1BA 4P75A 4O0AA 4JI5L 1EIYB 2HHHL 1BBWA 2JA5H 4A3LG 1FVIA 2BA0A 3K7AH 1QVCA 2DGYA 3NBHB 2OCEA 3HKSA 3RLOA 5C44H 4C3IH 1C7YA 5JJIA 1D7QA 4O2DA 4R1JA 3GD7A 1YNXA 2R7FA 4YCVA 4A3KH 3L2PA 4L5RC 2JA7G 2F4VL 1Q46A 2MO0A 1VQKA 3GTPH 2ZJPA 3OW2A 1YJWA 1Q1EA 4YWKA 1SR3A 1JJGA 3KDFA 2Y0SE 4A3GH 1XNQL 1VQAA 4NXNQ 1L1OB 4A3BG 1TWHH 4TVAB 2VQEL 1XMOQ 4AH6A 1N36Q 1I94L 1Z9FA 3ICEA 4X65Q 2AWNA 1Q7YC 3M9BA 2PI2E 2OQ0A 2E2JH 3FKIH 2KCMA 3KJPA 4HIKA 4A3CH 4XTCS 2JA7H 5AJ3Q 4DR4L 4X66Q 4LF8Q 4BBSG 3JC66 4QQBX 4EX5A 4IOAA 1CSQA 4AYBE 3UDGA 4GNXA 5IP7G 3F1ZA 1IBMQ 1QZGA 1IZ6A 4QJFA 1YHBA 3PUZA 1E22A 2UXDQ 1V9PA 2ZM6L 3CCVA 3HOXG 1GVPA 1PH2A 3RNUA 3J7A5 1JMCA 2HQLA 4DR7L 4LW1A 1J5EQ 4X62L 2AMCB 1HZBA 4B3ML 2VQFL 1WJJA 1Q81C 1FJGL 2Y0SG 2IHFA 4BBRG 5H1SE 3S1NH 1YZ6A 3M4PA 5IY0A 1N34L 4DV2Q 1GO3E 5FLMH 1MIUA 1KAWA 2UUAL 3AQQA 2KHIA 2Q2IA 2WB1E 2B63G 1JT8A 4C2MH 2R93G 2R93H 3S14H 4JI1L 4OO1I 1S72A 1PHJA 1G51A 1NMGA 1Y14B 2NZHA 2YYZA 3I2ZA 3K81C 3PGZA 1K9MC 1XMQQ 2PQAA 3U4ZA 5C0XJ 2R92G 3RLFA 1EYGA 4LF6L 4OWXB 3PUXA 5AJ3L 1K83H 2JK8A 1XTDA 4DR3Q 4JI5Q 3A0JA 2BA1A 5JJLA 2N8NA 2N78A 4MZ9A 5IP9G 3PSIA 1X56A 1B7YB 5C3EG 4A3DG 3EBEA 1TWCH 1VS0A 3UDXA 5GAEC 4A3FH 1PH6A 4B3TQ 3I4MH 3S2HH 1RL2A 5IP7H 2R7ZG 2C35B 4DR2Q 3PV0A 3KFUA 5C4XH 3PUYA 2Z6KC 4H02A 4WJ3M 1QVFA 4JBMA 1CUKA 5JEAG 3CC2A 2JA9A 4JG2A 2NVYH 3RR5A 1SFOH 4A3CG 1W2BA 3J80c 2NZOA 1HNXL 4UY8C 2D0OA 1P8LA 4HJ8A 3PO2H 3I7FA 5FLMG 4JI6L 2K52A 3PIPA 3I4NH 1RIPA 2UXBQ 4LUVA 1EWIA 3HOZG 4LF6Q 2K5NA 1N9WA 2VW9A 4OWWB 1FL0A 1HR0L 3F2BA 3J81j 4XIGS 4EQ5A 3GO5A 5DLQE 4LFCL 3CCUA 2AWOA 1TXYA 2WP8J 3KYHC 3KJOA 1X3GA 5IE8A 4B3MQ 4P74A 5IYDH 2BH8A 1V1QA 1N34Q 4JI3Q 3M7NA 2HIVA 2YTYA 2KCTA 1UWVA 5M3MH 1X54A 3E9IA 2MNAA 4IJLA 1XJVA 1L2FA 1OXUA 2VY3A 4R4IA 1K73C 4HJAA 1HJPA 3S16H 2PQAB 2GN5A 3E0EA 2NN6G 1YHQA 3A74A 1ASZA 2AHOB 1SROA 3RLNA 2ZJQA 1T9HA 4DV0Q 1Q8KA 1X6OA 5BR8Q 1WOCA 1QUQB 1BVSA 1S3OA 1VQ4A 5K36G 4IJHA 1HNZL 1VQEA 3WWVA 2I0QA 3GTLH 1Z47A 3J7ZC 1A0IA 4DR5Q 1KL9A 1NTGA 2V1CC 2YV5A 2K75A 4GN4B 5IT9c 4JI4Q 4LF4Q 5C4XG 2R7ZH 4HJ7A 5IYBG 5ELOA 5LMNQ 3M3YH
chains in the Genus database with same CATH superfamily
2W6OA 4KHZA 2SNMA 4HYKA 5J22A 2JP1A 4IFDJ 3I72A 4ALPA 3J81i 4DUYQ 3OTOQ 4DR6Q 2CH4W 5IYZF 4BXXG 3GTMH 1EWCA 5A2QE 2PMZE 4L63B 4BY1H 4OO1G 5KT7A 4XT1B 3HBLA 4NPSA 1FGBD 1ILPA 1I4RA 2ES2A 4WD3A 2G9DA 3FVQA 2CCZA 5C5JA 2F0SA 2K5DA 5IYCG 3JAME 1K3RA 5K2MA 2VR1A 3T1YQ 1VQMA 3RAQA 3VA7A 2QA4A 2JEAI 2BE5C 4IWXA 1HNZQ 4QWEA 2J6SA 4J9RA 3D31A 2A69C 2Q8RE 3SE0A 3BU2A 4JV5L 3IL8A 2A6HC 1KQSA 2VQEH 2W8KA 3RBEA 1Y69U 1I6HH 1M4VA 2B2YC 3S1MH 5M3FH 1EQVA 4AIMA 5IYBH 3JSNA 3I73A 1XPOA 5CGKA 1CZWA 4JYAQ 3K5NA 3RGZA 4BBSH 5JVLA 1B9NA 2I5HA 5IWAL 4A75A 2OTLA 4JUZA 5EQ0A 4Q44A 1YNJC 1Z2PX 2A6ED 1CK1A 2L5TA 5BR8L 2NN6H 4YIJA 3MFGA 4L1KA 3PQIA 1BUVT 2K5VA 4B3MH 5CB4F 2X0SA 3R5HA 2UXBL 2J6UA 3D0FA 5CV5A 1VQIA 3C0FB 1ZHQA 2R92A 3FEWX 2RF4A 2NU8B 1HFGA 3NHHA 5FJ8G 1O7YA 5D8DA 4X3SA 1Y1VH 2AGQA 4IO9A 2UUCH 4EYIB 3TN2A 2IW3A 4R8UB 1MSHA 5M5YH 4UFZA 1U4PA 2RDJA 4JI0L 4OEMB 4I65A 1BCPF 1RKNA 4HEDA 4ILWA 1EZ8A 5C1OA 2F0PA 3M9MB 3I90A 1R4QB 4A3MB 4O2BF 1VQOA 1I3QA 2RHQB 4IN3A 2E75C 2W9CB 2VZAA 3S16B 1TWAB 4RGNA 4IUTA 4OX9Q 3H4DA 2PYKA 4FS2A 1VCIA 1WCMG 2NVQH 2A6EC 2P0AA 1B33N 1PVOA 4OIJA 1L0WA 4JI2Q 1Z2NX 4PWQA 2MHVA 2R84A 2MUYA 1GXDC 1KJQA 1GSHA 1LTLA 1CHQD 4MTEA 3MVVA 2Z4HA 2UU9H 3MFIA 4LH7A 2GVBA 2R8IA 3EPIA 5KFZA 2NZ1D 4RFBA 2M9VA 1II3A 5I9OA 2ZXPA 1EUDB 4O3PA 1JWSD 4UCVA 2FK2A 3D6CA 2R7KA 4RNMA 2PNHA 2OWOA 5C1PA 1FKAH 1WH2A 3V6HA 4A4IA 3J81c 5JJKA 1Y1VA 3HKZB 4N8FA 3K5LA 1IBLL 1XMQH 2QK4A 4KI0A 3I70A 1LTRD 1Q90A 4J15A 2DY7A 2K5HA 5D1OB 4B3RQ 2XVSA 1EZ6A 4DXGA 1BF4A 2X6GA 3STBD 3T53B 5EAYA 3KBXA 4C3IG 1YJNA 3RB0A 1B70B 5D3DA 4FF1A 4B3TL 4I7AA 4KKTA 5EPJA 3QJYA 3HRZC 1HQMC 1UE5A 2WV6D 1JWUD 2DLNA 2R86A 2KECA 3K5IA 5J2TF 1PZJD 1X3FA 4A3MH 4RU9A 4QWAA 4UCTA 3OIPA 3G7LA 4Y7NB 1I50H 3GTJH 3GDEA 3KLWA 3D8GA 3M4YA 4JBJA 1S40A 4LF7Q 1GSOA 4M7EA 4DR2H 5KNDA 5IIFA 4KHPQ 4TQSA 1R9TA 3BYTB 5C4JH 5FKAC 2YTVA 5EPKA 4IRDA 1QJOA 4KN7C 2E2IA 1KTKA 1XMQL 3JAMi 1JX4A 3RGXA 3ND8A 5EOYA 1CS0A 1X3EA 4HMIA 5BMVF 4QCLA 1R4PB 4LMQD 4A3EB 2JA5G 3PCOB 2YU9B 3M3YB 4UCUA 4GN3B 1E24A 2F0WA 4PMBA 3OW7A 3MJFA 1UC9A 5E1FA 1PRTC 1HZCA 3DUZA 2L9HA 4JW0A 2UUCQ 4MV7A 4RGTA 4B08A 3CU7A 1DM0B 3E3XA 4JC0A 1N48A 1HA6A 2XRQD 2VS1A 2YTXA 3NP8A 4R4QA 5FO8B 2HDLA 4DV0L 3L3OC 4DV5L 1PZKD 4LF9H 4J0MA 1TS5A 2I46A 4K0KL 4ED2A 4V0BA 3KUPA 4X3TA 3S1MB 4JI6Q 2RDFA 1SYCA 2R93A 2XNAC 5I9PA 4JCVE 1QUQA 1S68A 4DR1H 4N9PA 3IFTA 4UP8A 3Q23A 1TWHA 2VQFH 4CDDC 2B2YA 5DLFA 3TP5A 1FNUA 1TIID 2CW0D 1CKNB 2V58A 3H15A 1X9NA 4ME3A 5C0XI 4YY3Q 1O7ZA 1UE6A 3OTOL 3TP6A 5FLXL 4DR6L 3H0GG 3K8AA 3TIGA 4B9XA 2WAQA 3GIQA 4GKJL 3HEJA 5KEEA 4DLKA 2VB3X 3NELA 1PTOC 3RZOH 4RNOA 4MN3A 4G57A 4CGYB 4EYHB 1SE3A 4OHJA 3K7UC 3HG9A 1XMOL 3MR3A 2E76C 4RG1A 4K0KQ 4IPHA 4A3GG 2FP4B 3DXJC 2JA8H 3ETHA 1O78A 5JH7F 2XWJB 3M4IA 1HNWH 1BBUA 2R92B 4IURA 1XYIA 4MV6A 3BQ1A 2VQDA 2ASDA 3BJUA 3OSNA 1BCPC 5GROA 4LF8L 3U50C 1M7JA 1K8GA 4C2MA 4QW8A 2R8GA 1EWHA 3J7YW 4HCSA 5ELEA 2HGSA 4DK3C 3CD6A 1PYBA 2PZTA 4Y52H 4POGA 2EY5A 3CCRA 5E4WC 5FLXW 5CV4A 1X3PA 4YR2A 2VQFQ 1XNRH 2N49A 3GTOH 5T1IA 3J80W 3G4SA 2IL8A 3NSWA 4IRCA 4XX0B 1GYFA 4ID6A 2QF7A 5J3BA 4PZ6A 1VQDA 3SK6A 3BJYA 2AQ4A 2AQ2B 3EFXD 2N55A 3PW4A 4A93G 2J4XA 4MV1A 1A3TA 3CPFA 4X64L 1KIXA 4L5SA 4G7OC 1YHAA 4ODGA 1KBLA 1SRUA 1KNEA 1IBKH 2JA6G 3H20A 4DR3L 2F3VA 5KG3A 3K0XA 1V8QA 4KKSA 2ALZA 2DUDA 1P16A 2FE3A 2PPBC 1EQQA 1W3SA 5KFTA 2NWGA 4BY1B 3U4VA 1OWTA 5LL6b 5L1LA 2JA6H 4EGJA 4X62Q 5KFKA 4A3JH 1Y1WG 3TS2A 5CA0F 4BA1I 2EYPA 2WFWA 4YCUA 1I94H 3HOYB 4A76A 1PH8A 2B8FA 3VPCA 1HA5A 1EOVA 4IUQA 4WORA 1W96A 4HR7A 1ZHSA 4RB1A 1V43A 1QZHA 4B9WA 1HH2P 5C0XG 1D8LA 4DR4Q 2NYZD 3K5MA 3UQ8A 1JOKA 5D1OA 5KFOA 1EUCB 1G2TA 1VQJA 4MTNA 3KXYT 4LK1C 2XGQA 4HMJA 4J9PA 1EIYB 4JI5L 3PVXA 2HHHL 1FVIA 2BA0A 1HQRD 1QVCA 4QWCA 3NBHB 3HKSA 5JJIA 3RLOA 1C7YA 1SXTA 1I3QB 4R1JA 4DXFA 2LMCB 4A3FB 1Q46A 3CKIB 1FYCA 1EFID 1B04A 5KKNB 3CVZA 2ZJPA 5DM63 1VBHA 4A3GH 2C2RA 1VQAA 2K5QA 4NXNQ 5D14A 1AN7A 1I94L 3FKIB 4X65Q 1A9XA 1WVLA 1SNPA 2E2JH 3FKIH 3NQTA 2EY6A 3BQ2A 2JA7H 2E2JB 1TY0A 1GUGA 5CYUA 3D4DA 2KEDA 4QQBX 4IOAA 2L11A 1CSQA 1PDQA 2B2UA 3F1ZA 1QZGA 4M8AA 4LSXA 1Z7TA 4QJFA 5FOBB 4ED1A 2YU9A 5F9NA 3JZIA 3K6OA 1GVPA 2F0EA 3J7A5 4DR7L 2YCHA 2HQLA 4LW1A 3E0JA 3X3NA 2EXZA 4A93B 2I8CA 1WJJA 3S1NH 2K6AA 1IHZA 5GONF 1YZ6A 3D6WA 5IY0A 4TSSA 4ECTA 5FLMH 3HKZA 1MIUA 2Y0SB 4ECUA 1SNCA 1VMCA 4QW9A 2M00A 4HNVA 1JT8A 3HS0C 3NPPA 3N43B 4JI1L 3MWEA 3K81C 1Y14B 1K9MC 1CQJB 5LMUH 3U4ZA 3SVMA 1EYGA 3PUXA 4DNRB 1ZYRC 4F87A 2XRSD 3DMUA 4EBEA 2FJ2A 1ZKOA 2NU6B 1FR3A 2AGPA 3A0JA 2BA1A 2W9AA 5IP9G 2Z4IA 2EE1A 3PSIA 1X56A 3IAYA 4J9QA 1SNQA 2BQRA 3GTLA 1B7YB 3OUUA 3S2HH 1I4HA 3UDXA 4A3FH 4YBZB 5C4XH 2V4DA 4WJ3M 3EVQA 1R9TB 1QG7A 1MGSA 5KFQA 4NW2A 1SMYD 2I80A 3VPDA 5FLXE 1HNXL 3EA6A 2D0OA 3J81E 3I7FA 4JI6L 3WOFA 4BWGB 3CHBD 5ISRA 2W8LA 3S1QB 2XN9C 2K5WA 1ILQA 5M5YB 4LUVA 2R87A 3Q8PB 4WJWA 4K5WA 1FL0A 1I6UA 1GSAA 4DV2H 1F2LA 4EQ5A 5KYIA 1BNCA 2PO4A 4LFCL 2M05A 4IQZA 2WP8J 3I8ZA 3KJOA 3J81L 2YL2A 1EEFD 2JEGA 1A15A 2B63B 2W6ZA 1EU4A 4U68A 4UAIA 5EPLA 1N34Q 3M7NA 5LL6X 2HIVA 2YTYA 1XJVA 2MNAA 1L2FA 5I4DA 2VY3A 5LOVF 1K73C 4PNYA 2A69D 2F0GA 3BDLA 4ZQ3A 4HJAA 3S16H 1FNVA 5KG4A 5DG8A 4HN7A 4FF3A 2ZJQA 3KALA 4DV0Q 2CH4A 1WOCA 1QUQB 5K36G 3BG5A 1JWMD 1TWHB 4O4LF 2I0QA 1VQEA 3WWVA 3GTLH 2W71A 3KTMA 1DOLA 1Z47A 3QO2A 4G4KA 1C8CA 1PK8A 1LV9A 5L37A 1KL9A 5IT9c 5C4XG 1TA8A 4CDFC 4O3QA 5D65A 3M3YH 2IT1A 1AZPA 1NY4A 3JAML 4LFCQ 1Q1BA 5AFWA 4GKJH 2I87A 3CC4A 5IP9H 5GAGC 4C5CA 2ALYB 2JA7B 4E4TA 4LFCH 3RUZA 4HIMA 3CC7A 1AEXA 3I55A 3C1EA 3A56A 3H3VC 1QE6A 3E9HA 2IJ0A 1A2TA 4QIWE 3M85A 3KAKA 3F2DA 3GIIA 5GADC 2YRXA 2VUMH 4IPDA 3HOYH 3ER0A 3S1QH 4O3RA 4HIDA 3Q0AA 1N33L 2RA4A 2Z6KA 1HR0Q 3PIO3 2R61A 2V9WA 1S5CD 3TP8A 3CPWA 2QDBA 2FPGB 1JKJB 3HFZB 1PH1A 2CFMA 1QB5D 2EQSA 1RDPD 2EY1A 4DL6A 4LJZC 1NE3A 4Y7NH 3GTJB 3SK4A 3VR3A 4JI2H 3DEOA 3BDOA 3GTGH 3UDFA 4DV7Q 4LF9L 1F9QA 4JI3L 5M3FB 1V51A 1EFWA 3HOXB 2DNCA 3HOUB 1EEID 4YCWA 4KV6A 1SN8A 1YIJA 2JA8G 3IG0A 2IX3A 2NVXH 1QNUA 5I6YA 3GIPA 4X62H 5FLXc 5KFXA 4YWLA 1TWFA 1IBKL 1VQ5A 3L0OA 1KLUD 4K6DA 3N42B 3MAQA 1G91A 1FD7D 1R9TH 1DZ1A 3QWNA 1NAPA 1LUZA 2R7LA 4DGZA 1SEBD 2EY2A 1D5ZC 3A5ZB 4HCEA 2UXCQ 1EIGA 3H0GH 1Y1VG 3P7JA 1SYBA 1K3BC 1S5ED 4UHVA 1VQ9A 4S3SA 1S03G 2F1MA 2PQEA 3TEHB 2C2DA 4IFDG 3PR5B 4IWYA 4RA8A 4YAJB 3HKZG 1SBBB 4K6LA 1XXGA 5KFFA 1D1KA 4NXMQ 4HR7B 5JOBA 4PG3A 4K8JA 2VQEQ 2EJMA 1NMFA 3PR4A 4KD3A 2EXDA 2NB0A 1ML0D 2ZTDA 3J7AV 1JC7A 1MHWC 1HHVA 3AMUA 2JEIA 2P5ZX 3HKZE 4H44C 4P2CB 4IRKA 4YQWA 4F4WA 4DKAC 2OH2A 4BY1G 2CQOA 1IBML 4RMFA 1XNRL 4ED7A 1JOQA 1SJED 2DIKA 1ESRA 1RJQA 1CZGA 2I5MX 3L4JA 3GTLB 2Q2TA 4YHHQ 1EYAA 5IT9L 3HOXH 4JYAL 3KLSA 1MJEA 1DONA 4F88A 4JI7L 1EHIA 5KFMA 1SE2A 5CV7A 2JEJA 1LT6D 2F0KA 1Q82C 2FJZA 2DPJA 4IUNA 1TWFH 1E4EB 1VQPA 2W6NA 4LFAH 2CVRA 5IYCH 3S2DB 4GS3A 4GKKQ 4DUZL 3P75A 1KJIA 4DU9A 1SYXB 3TMEA 4DR3H 3S2DH 2A6HD 5ELNA 1C48A 4KHPL 5ELCA 1LACA 4PZ8A 3VYSA 1J5EH 2RHSB 4PDBA 5GAHC 4Q8FA 4FO2A 4Q5VA 1LT3D 4PQXA 3L7ZC 1U4RA 4X66L 3SK8A 1HRJA 1E4FT 3G6YA 2ZDHA 1X3QA 1ENAA 3NEMA 4UP9A 4MA0A 1I3QH 2RKSA 2E74C 5JPMC 4OWTB 4JI7Q 1RJPA 1UNNC 3A5UA 3VDYA 5LMUQ 4JI7H 3I56A 1JXLA 3PUWA 1TWGB 1TWAA 1K8AC 2VNUD 4ZI7F 1EY7A 2QDLA 4LFAL 4H7BA 3CXCA 2WKCA 4O3OA 4CJ0B 2F0NA 5NUCA 2QCPX 4C3JH 3Q8DA 2PNRC 3UE0A 2L4NA 1RK5A 4BS9A 3CAMA 5EGTA 1VAJA 1ULZA 3D3RA 3U9OA 5IWAH 4XQQA 4UCSA 2HJWA 5CV6A 2B29A 1CKOA 1RYRA 3I4OA 1EUJA 5EDWA 2EYOA 3U9TA 3GTMA 3BZKA 4KD4A 1HUNA 3PIOA 2F0MA 4LNQA 3GIJA 1WTXA 3T4AC 2V59A 2FFKB 2R92H 3MXPA 3CCLA 4J9MA 3HP3A 1BR9A 4J9OA 2UU9Q 4TQRA 2W70A 2ZM6H 2XWBB 2ASLA 4UPAA 4XYQA 2HVRA 3H4BA 4JI0H 4TRDA 4B3RL 1KDAA 4P73A 5CORA 4R9WA 4XYOA 2ASBA 3UI2A 1WTVA 2RQXA 4Y8VB 1XNQH 1G2SA 2RGVA 2YYAA 2VUGA 1VMPA 2HQEA 3TQTA 4DPGA 1AN8A 3QFFA 3GTJA 3C1FA 1XPUA 2UVVA 1RHPA 3NE5B 5FJ8H 4DL3A 2QKIC 3A55A 3NXWA 1ZETA 1FGUA 2NTTA 1ASYA 2E2IB 4FF2A 1AW7A 3S1RH 1HNZH 1VQHA 4JI8Q 4LMYA 4R8IA 4ULLA 1I94Q 3CQZB 2PBZA 4U6PA 3G48A 2I5LX 4R4TA 5EBCA 3ZYYX 2AUJD 2EZVA 1IW7D 2F3WA 5M3MG 1T5XD 3Q8RB 1MJCA 2C00A 1ENFA 5TSSA 2J7ZA 1SAPA 5IYDG 1L1OC 2UUAH 1EQTA 2JA7A 3TQYA 3MFYA 1KDCA 3QZ8A 1BKBA 3T1HQ 2RCNA 3V2TA 4KTAA 1VQFA 5FO7B 5KT4A 4YR0A 3Q8QB 2CWPA 3RN2A 4P72A 4DR7Q 1HNXH 1HR0W 2UUBL 4ED6A 2C28A 1H95A 3S14B 4GC6A 1TWAH 1W93A 5LP6F 3CCMA 1YBYA 4R4OA 2O2LD 1DOKA 3DF7A 2F4VQ 3JRXA 3MHBA 5FPOA 4RAZA 4DV7H 1MZBA 4A2AA 3T13A 1TKWB 3SR1A 1SNDA 2F0FA 1UNSA 1XTCD 4CJ2C 1CKNA 3E5NA 1TWGH 4RHRA 3T16A 3WOEA 4B3SL 4AQYL 3MR5A 2HCIA 1G291 1H9RA 4A3IB 4WBNF 2ZTEA 1JE5A 4MTKA 3I4MG 2HHHH 4A3FG 1WTHA 3S15H 2WAQB 4DV3Q 2FK3A 4RGMA 4YY3L 1RODA 2A8VA 3RMHA 4KJOA 1E1OA 4ED0A 5K5PA 5KFUA 2CKZB 3EROA 2EIFA 3RB6A 1PXUA 3MFHA 1NBWA 5BPFA 2B8GA 2K1BA 1HNWQ 2CW7A 4FXKC 1CT1D 3BS1A 4BY7H 4RWSC 1Q8IA 1SYFA 3JAMc 2UXBH 4DR1Q 1JLLB 2OTJA 4X65L 3CRLC 5KNCA 1CA5A 3GIDA 3H91A 1SMXA 3N6RA 4MA5A 4LFBQ 1LLRD 4C2MB 2FKLA 1FNWA 1U0LA 2FLPA 1IL8A 2IWHA 1B8AA 4LSAA 2YZNA 5KFNA 1RCVD 1SJHD 1GD7A 2JN4A 1STAA 3QZ7A 4HAEA 4N9TA 1A6XA 3S1NB 2FINB 4RAUC 5DEHA 3W1BA 2FPPB 4P75A 5EBDA 3RB3A 3IN5A 3DEPA 4K2LA 1DIKA 2QYZA 4FM9A 4O2DA 4L5RC 1YNXA 4A3KH 3L2PA 3BYYB 2JA7G 1S0NA 2MO0A 1CQVA 4WRDA 1S5DD 1TWGA 3L9AX 3OW2A 1YJWA 2EJGC 1SR3A 1AFPA 1JJGA 3H6MA 3H94A 3R2IA 5FO9B 3Q22A 2VXWA 1TWHH 4TVAB 3QOLA 2ICIA 2VQEL 3WO1A 1NNXA 4HNTA 4A3GB 2A74C 2WB1A 3R23A 1I4PA 2KCMA 5E4XA 3OTOH 3KJPA 4HIKA 1V1OA 3VA5A 2F0LA 5AJ3Q 4X66Q 1PFBA 2K01A 2VPQA 4AYBE 3JSLA 1IBMQ 1IZ6A 4CKBA 2KOLA 5EWEA 3Q8SB 1V9PA 1E4EA 4QWDA 1JMCA 1J5EQ 4DL4A 1ONLA 1CQIB 4I4TF 4B3ML 3RJ0A 5G3LF 1Q81C 2ZXRA 1FJGL 2Y0SG 2IHFA 5H1SE 5JUMA 1GLVA 5DG9A 4KHPH 3BVGA 5HGTA 1WTOA 2H1EA 2FPIB 4MAMA 2FMMA 4EQOA 1T3NA 4KY5A 2R93H 3S14H 3VMMA 1K1SA 2NU7B 2D5DA 1S72A 1G51A 1WTRA 3I2ZA 4J6HA 1NSNS 2PQAA 4CJ1B 1M8AA 3GTGB 4OWXB 5A2QL 5AJ3L 1K83H 2JK8A 4C5BA 4C3HG 3QB3A 3V4ZA 1TY2A 4PMCA 3PW0A 3NBHA 4GKKH 1CM9A 2KCNA 5E3FA 5JJLA 3D4RA 3R93A 2KEEA 1KJ9A 3N41B 4R7RA 4LAAA 1SE4A 1BO0A 1HCZA 5JVH3 1TWCH 5GAEC 1PH6A 2W6PA 3I4MH 2R7ZG 5IP7H 1ET6A 2R8JA 5LYJF 3OSOA 3FKIA 4JBMA 2NVXB 1EYZA 5JEAG 1T5EA 2FHTA 4N8X1 3M9NB 1F2MA 1E2WA 3J80c 3RD4A 1LTID 4O3NA 4I7ZC 3FDTA 3CQZA 4EFBA 2W9BA 1BXRA 2K52A 2TSSA 1RIPA 2F03A 2UXBQ 5HBRB 3SK5A 4F8MA 3IKJA 4DV6H 1E2VA 2VW9A 3KHRA 3J81j 1RD9D 3GTMB 5LXTF 3J7AK 4XIGS 2OXPA 3V6JA 4NXNH 2FMCA 1H9MA 2R3ZA 2NBFA 5EKLA 1EL0A 5KYLA 3HGBA 1X3GA 5IE8A 4OIKA 5IYDH 1S4ZA 3LNNA 5FD5A 3DM1A 1V1QA 4QUCA 5C44B 2KCTA 5M3MH 1I7LA 4XQNA 1PMRA 5M9OA 3W2DA 4DL2A 2GN5A 2ZXOA 2HCCA 3OHAA 1S5FD 1N33H 1Q8KA 4IUPA 5BR8Q 2WB1B 1VQ4A 4QUFA 3MXUA 4QIWA 4CBVA 4L8JA 1BGWA 2RBMA 4RNNA 3J7ZC 1A0IA 4CC6A 3X3MA 4GN4B 2K75A 2FB9A 3FMAA 4FP5D 5ELOA 1E4GT 4JI2L 3UE1A 5IGCA 1CKMA 3W5OA 1KD1C 3S15B 2JA8B 4GLVB 1A8VA 3H3VI 5KFWA 4DR2L 2EPBA 3GQBA 2KA7A 3ULPA 5JJZA 3HOUG 4GNXC 2SNSA 1O75A 2PW7A 4GOPB 4ZHQF 4FBTA 1WCMH 3F8TA 4AYBB 1DD2A 3OIQA 1BCPB 3KF8A 2UUAQ 2KCCA 4C3HB 1K8OA 4ED8A 2JE6I 4LUZA 3I91A 1I4GA 1IL2A 1STGA 4BY7G 1IBKQ 2A68D 2OT2A 2DJFC 4LF8H 1SLJA 1PH9A 3S17H 1PH7A 1I4QA 1Z2OX 1ESFA 3MXNA 3FPUB 4JPBW 2L55A 2EYLA 3I3CA 4ME6A 1JB7A 4YHHH 2Z9HA 3KF6B 3BVZA 4L6TB 3G6VA 1OXXK 2XCPA 2F52A 1EU3A 3EIVA 4RUAA 3H3VH 1PFNA 4JK1C 4QY7A 1SNOA 2SDFA 5IGDA 2W57A 3GTKH 2F4IA 3ULLA 4LF5Q 3HOVH 3MXGA 4DR1L 4J9LA 4EGQA 4RB0A 5EKKA 4LFBL 1M6VA 3PO3G 3MR2A 2AQ3B 3HZXA 3TRZA 5LMNW 4DK6C 1OXTA 4GLXA 4ZUJA 1HTLD 5KG0A 2XTIA 1LYLA 4MV3A 4J9SA 4B3SQ 4DK1A 4AQYQ 1KEEA 1QILA 4DK0A 2YU9H 4NP5A 5CV9A 1A62A 3EN2A 1N32Q 2IX0A 3M4QA 4YHHL 1Y1WB 4ZLTF 2PVPA 4IR1A 1F9RA 3N44B 2K7VA 1LTSD 3RZDH 1DV1A 2NN6I 4JI6H 2RDHA 2WINB 4NB3A 4YWMA 5IOCA 3ERSX 1LT5D 3HOWG 3KLRA 4RGOS 1C3OA 4ECZA 4C3HH 1K8MA 1HNWL 5KT3A 1A3UA 3RTXA 2KBNA 1W6KA 4CHTB 3VYTA 2F4VH 4KMUC 1NJIC 1E0BA 2O03A 3ZJYC 2NVTH 1K1QA 4DR6H 2NVTB 1EOTA 1F77A 1XPRA 5FK9C 2K28A 1UE7A 2KVMA 4OO1H 4YJ2F 3GTGA 2JXMB 1GUTA 5JEAJ 5CBAE 5JQWA 1GKHA 1HZ9A 1KDBA 2EYMA 3C2PA 1AH9A 1N32L 1HXYD 2VPSA 5BN3A 3K0YA 3UDIA 1SCUB 2R7DA 1PFSA 3CCSA 1KC8C 1YNND 2E5LH 4DUYL 1HZAA 1STNA 5C3EB 4GNXB 4UP7A 1FJGQ 1CSPA 2F0JA 1KJ8A 3K3PA 4ECVA 1G6PA 4BY7B 1SDFA 1WI5A 4GOPA 1AZQA 1NR4A 3K5OA 4KLKA 1J6QA 3S1RB 2D62A 1OXSC 1TWFB 5LMNH 4J9KA 3OMCA 1STEA 2AGOA 1H9KA 3MEFA 1RJRA 3GTQB 1DGSA 1N36H 3VR4A 5HV6A 4GOPC 4DAYA 1B53A 2Q2UA 2MO1A 1C0AA 1DV2A 3EYYA 2UXCL 3GILA 2F0QA 1MSGA 5JAVA 1IKLA 5M3MB 1M90C 5EZYF 2OF1A 1EY9A 4K8IA 2W6MA 3PW2A 4GC7A 3K80C 3A8JE 4A3LH 3W1GA 2NVQB 5IGBA 1J8IA 1F2YA 5DQGA 1A2UA 1V1PA 3WDNA 4IHJF 4X65H 3GTKA 2FMAA 1STYA 2FXQA 3MEHA 1TS2A 3TREA 4E6IA 4JOIA 1DCZA 1RK6A 4L5TA 2V4RA 2Q8TA 3J81W 1L1OA 4QB4A 5LHY1 2BOSA 2GVAA 2UXDH 3MR6A 4YR3A 2XSCA 3HOVB 3I12A 4HNUA 5DGAA 1BBXC 2ZDQA 1UUPA 3R2TA 2NUCA 1E3PA 2C9OA 5J2UF 3AFQA 3NENA 4GLAC 5A2QW 1GHKA 3EQLC 1NUCA 1PV4A 2C2EA 1Y1WA 1B50A 3R8BA 4EQNA 2AKWB 2JA6B 2NVXA 2DJGC 3H40A 1WCMA 2WTFA 2QILA 4QMGA 5E7NA 3TS0A 3R5FA 3CW2C 3S17B 4KKUA 2MGSA 4DUZQ 3HOZB 3QR8A 4Q0YA 2W9BB 3ULJA 1YEZA 2PN1A 3T5HA 1YVCA 3HOYG 5F2DA 2QEXA 2GA4B 4LH6A 4KN4C 1A63A 5DAUA 4CKCA 2B63H 5KGUA 4X6AH 4RH6A 1LM0A 1O7IA 1S5BD 1D6EC 3Q2OA 3MXNB 3SHLA 4FU0A 1G8ZD 1I7NA 2CWAA 3AYHB 4R8NA 3STBC 4BBRH 4DNTB 3F2CA 4U7CA 5DLGA 5KFPA 4QF4A 3HOWH 2F0IA 3AFPA 2Z8LA 2XD4A 3OPOA 5KFHA 2KQ3A 3T5KA 3KF6A 2L12A 1YI2A 4WFN3 3PW5A 4A3DB 4KJNA 4DV1H 1PH3A 5COYA 1SSOA 2LXJA 2ZJTA 4L5QA 2BR0A 3IFDA 2E8GA 4OGQC 5IGFA 1VBGA 4JOIC 4APVA 3MWYW 4ED3A 4QIWB 4LFAQ 3TSSA 4DNIA 4FXDA 3SEBA 4DF7A 4RB2C 3PF4A 5M5XB 4AQYH 5KFGA 4DAYB 3ETJA 3NTKA 5M5XH 1BDOA 2MCTA 2E2HH 4DR5H 1VDZA 1GUSA 4JI4L 4DV3L 3SGIA 4LF4L 2VUMB 4A3JB 4NDXA 3GV3A 4MTDA 3CCEA 3V05A 3J80L 4JV5H 3ORQA 5C4ZA 4AYBA 4XZ3B 4IPGA 4DV4Q 1XDNA 3J80i 3RF2A 1ICWA 2BDOA 1KC7A 3HOZH 1UAPA 1QVGA 4LF5H 3N40P 4HQ6A 2W6QA 2JA5A 1S9FA 1BOSA 4APMA 4A3BH 1VQBA 4EVOA 2UU9L 5BN5A 5I47A 4NXNL 2EDGA 1UEAB 4J1MA 4KK7A 4OONA 3FRPB 5BR8H 3KDFB 1D2BA 3P20A 3GTPA 4RHSA 3BABA 2NUAB 4QGUA 1N8RC 4HSVA 3T1YH 2YW2A 3K5HA 3FMCA 4A3IH 1KRSA 5FD6A 5KFEA 3I4MB 4JI4H 4LF4H 4DAMA 5KFSA 1NCVA 2X6LA 2ZM6Q 1PYWD 4QL5A 4EGVA 5HGQA 2ZJRA 4RAYA 2BDNA 3I4LA 1TWCA 4HTHA 1L0XB 2EJFC 4PZ7A 3VR6A 5M5WH 2E2IH 3H0GB 5ELDA 4C3JG 4POFA 5KFRA 4LF5L 4DV6Q 4RUCA 4DV5Q 1IXRA 4YJ3F 3V4SA 2NVYA 4QWBA 5BPHA 3BA8A 3CCJA 1WYDA 4DV4H 2F0VA 3AEVA 4C1NK 1UC8A 4MIUA 4X3UA 1PYSB 3CMEA 1AUVA 3QIAA 3K7AB 3CRKC 4MV9A 1PX2A 1QWYA 4O0AA 4TUYF 4A3LG 3N6XA 3K7AH 5LA6F 5KFLA 4DV0H 1JDBB 5A35A 2XCLA 1LTTD 3A7AB 2KHSA 2VB2X 2R8HA 5I6WA 2DGYA 3F8NA 5C44H 4G3IA 1D7QA 3GD7A 3LP8A 5J1ZA 1Q3LA 5KT2A 1S10A 4CDEC 4A3BB 3GTPH 5K36H 1Q1EA 1STBA 4YWKA 4G7HC 2Y0SE 1XNQL 5EKIA 1L1OB 4A3BG 1XMOQ 2ZDGA 4AH6A 1N36Q 1Z9FA 2R8KA 1F9PA 5KT5A 1MI2A 2PI2E 3RV4A 1IBMH 1TAEA 4F7XA 1SFOA 4A3CH 4XTCS 2SEBD 1KABA 1MD2D 2B2VA 4BBSG 3TBIB 5C4XB 4LF7H 4GNXA 4FNFA 2XC9A 2UVWA 4MV8A 3CCVA 3HOXG 1K28A 3E6ZX 1PH2A 3RNUA 1B3AA 3K3VA 5KG6A 3GQCA 3M7GA 3KBGA 4X62L 1OO9B 1Z6HA 3GV6A 1QOHA 4M1UB 5L1KA 4DA2A 2J6TA 1N34L 3GTQA 1GO3E 3LX0A 2UVUA 1KAWA 4BBRB 3AQQA 1WTQA 2UUAL 4F4YA 2KHIA 3Q6SA 2B63G 3TZUA 4C2MH 4C3IB 5C5LA 4JI3H 4OO1I 1PHJA 1NMGA 5KG2A 2K03A 3PGZA 4Z9CB 1ZXTA 3RLFA 3WNZA 2BQUA 1EY6A 1XTDA 4DR3Q 2NU9B 4JI5Q 1B3QA 4EBDA 1V1PB 3LWEA 3MA2B 3S9WA 2YRWA 2N78A 5G3LD 3KHHA 3HOWB 2WKDA 1LABA 2WE6A 5C3EG 1ENCA 3EBEA 1V4YA 1TT2A 2UXDQ 2J9GA 5CA1F 2D2CC 1LT4D 3PV0A 1TWCB 3KFUA 2Z6KC 4ABNA 1QVFA 3J7AF 3CC2A 2VA2A 1SFOH 2NVYH 3RR5A 4A3CG 4KY6A 4UCOA 3M9OB 4YAKB 3NGDA 2NVYB 2B2TA 2EYHA 2NZOA 4UY8C 3PO2H 2CW8A 1P8LA 4HJ8A 2YZMA 4IUUA 1AP0A 2VA3A 3MZ5A 2L1BA 4FXGC 1PTOF 2RCFA 3OMGA 1H9SA 3T56B 3I4NH 4U673 2K5NA 1N9WA 3PN1A 4C5AA 1HR0L 1N56A 2JA6A 3G6JB 4IFDH 3SXHA 3GO5A 5DLQE 1HUMA 3CCUA 2AWOA 4ZAIA 1TXYA 2K05A 3KYHC 1LO5D 2F0OA 4B3MQ 1PTOD 2DNEA 4P74A 3MC0B 3DHQA 4Q43A 1S0MA 5KFAA 1SYDA 2BH8A 4JI3Q 1TVXA 3O13A 4V190 1UWVA 1B6SA 4IJLA 1OXUA 1HJPA 5EJWA 3NBIA 2PQAB 1YHQA 3E0EA 4X66H 1SYEA 3A74A 2BCOA 3F2UA 3VR2A 3K58A 3RLNA 4JI5H 3OWEB 1BQQT 1S3OA 1CQFA 2MPMA 4FBUA 5CV8A 1RF2D 3T51B 1GJXA 1WR2A 1XMOH 2HUGA 4DR5Q 1NTGA 2KJXA 2V1CC 2YV5A 4JI4Q 4LF4Q 2DPIA 4HJ7A 5IYBG 4ETSA 1S97A 3RZOB 2JSOA 4MNOA 3KOJA 1XNRQ 4HJ9A 5KG7A 1HR0H 2IHEA 2X69A 4JV0A 4K14A 2JQOA 1IBLH 5T1GA 3KHGA 5L1IA 1EYCA 2K14A 2RVLA 3OOCA 2UVRA 4A3IG 3QG1A 5JVG3 3U9SA 2B39A 3GTQH 1ET9A 2K32A 3ERQA 2RDGA 2R7NA 1PTOB 2EYJA 2PI2A 3KAJA 5C5MA 1E2ZA 4ZUIA 4F50A 2QEJC 5HURA 4NXML 1VQNA 4DL7A 4OL7A 3ONAB 2VUMG 1UE1A 1H9JA 2LFNA 2LS01 3G71A 2ICEC 2WB1G 2WDTA 1GUOA 4ZQIA 3KHLA 3OYYA 5CR3A 1O7LA 2PW5A 1AE2A 2A19A 3BQ0A 2R6GA 1SYGA 2N88A 3RBDA 4EEQA 2E5LQ 4ZRZA 1SNMA 2PCFB 2WAQE 4G7ZC 3RAXA 3DLLA 2K50A 1YITA 3LGJA 4A3EG 2JA5B 4JI1H 4HIOA 1VQCA 2A1AA 3URYA 3NK9A 1KXLA 5LMUL 4ECRA 5L1JA 1VQ8A 1EY8A 4LWCA 3QOJA 3BVMA 4KY7A 1HNXQ 3GTPB 4GKKL 3PO3H 4DR7H 5LL6S 5IGGA 3OSPA 5ELFA 3LWUA 2HD3A 4NXMH 4C1NI 2CQYA 3NWTA 5CC4A 3T1YL 1H9SB 2XIWA 4DV1L 1VQLA 3HOVG 3PMFA 4YY3H 2D9UA 3N52A 1VQ6A 1Y1VB 3SDZA 2LKVA 5C44G 2IY5B 2XGTA 2E5LL 4DUYH 4HJ5A 4ECXA 1WD1A 5H80A 1PA6A 4K0KH 2ATWA 5IGEA 4TV9F 4PV1C 3KF8B 3OHXC 1KRTA 2N3SA 1PTOH 4K2KA 1Y8NB 2A5HA 1B1ZA 1ICFB 4DFAA 2YZGA 2LY7A 4ZOLF 1AE3A 3IRBA 5IWAQ 2MQHA 2HVQA 1X55A 2LSSA 1DOMA 1JCKB 2Z6BA 1N36L 2ASJA 4EBCA 4DV3H 3EPGA 4JV2A 1EIHA 4IALA 1N33Q 3UFXB 5KFBA 1JIHA 1B2TA 1VF5C 1K83A 1Q12A 4FF4A 4DL5A 4J8QA 2H5XA 4DN4M 1I50A 5I2YA 1YJ9A 2HIXA 4A3KB 3A8IE 4A3DH 2D0PA 2IPKD 4KHVA 4O42A 1WTWA 2FLLA 2LXKA 1U9RA 3TZDA 4DV7L 4LF9Q 3VR5A 1A3VA 3L4KA 3GIMA 3FP9A 3CMAA 3R3OA 1BJTA 3OHBA 1IOVA 2L15A 2TMPA 2RSOA 4DV2L 1STHA 5D1PA 3I4NB 1F2ZA 4CDCC 2JYOA 3BZCA 2HVSA 1LTBD 4YP3A 5KFDA 3GV8B 1PZID 2Q2HA 2O5IC 1HTPA 1SFOB 5I2XA 2CZGA 2XIGA 1GOZA 3NTHA 4JI8L 1I6VC 4WJ4A 2B2VC 1RTOA 1X65A 3FPPA 1JICA 4IOCA 4I7HA 1GUNA 1KJJA 4FDBA 5KX5F 1C4QA 3PUVA 1OTCA 2G9HD 1BNZA 2HT1A 4A3KG 1IYVA 3GV5B 4GN5A 4LF6H 2K04A 3EJIA 2R93B 3CF5A 3HB9A 4JVZA 1JR0D 1J9OA 2F0TA 3T1HL 2MFIA 4O4HF 1FJGH 4X64H 3RB4A 3ND9A 1IYJB 1XWEA 1QCBD 3KK7A 4DV4L 1PH4A 2UUBQ 3OWFA 3T5JA 5JPNC 3K57A 3FHWA 3S24A 2IX1A 4ZCKA 5DM73 3Q24A 2F0DA 2VL6A 3DM3A 3Q1KA 3VYRA 4XYMB 4PMWA 3I4NG 2ATLA 4ZKCB 2A73B 1VQ7A 4XYLB 5T14A 5C3XA 5C4JB 4TKOB 2SCUB 3PO2G 1CTMA 1IYUA 5C6AA 1X32A 2J0TD 1E7ZA 2MP1A 5D3IB 5ELBA 1DJRD 4IFDI 5CAEB 3G6EA 4A3EH 4IZ8A 2G5DA 3G8CA 1IOWA 3HXLA 1JJCB 1TU2B 1C30A 1PH5A 4FYDA 5C3EH 2O5JC 3PF5A 4RZRA 1HPCA 4IR9A 3TP7A 4LFBH 2VOBA 4B3TH 4ZYSA 2XGPA 1RYSA 3N8DA 2WAQG 4OELB 2V4QA 4ECQA 2Z1CA 4UDUC 2C5CA 2PZUA 4LF7L 4AYBG 3V6KA 1I4XA 4A93H 4TQUS 3RUPA 5JEAH 4EEYA 4OX9L 2JEFA 1UEBA 2OQKA 1WSCA 4TV8F 4Q8EA 3GTOA 1E1TA 4DR5L 3DWAA 4DAPA 1EY4A 2B2TC 2ID0A 4X64Q 4XT3B 5KFVA 2JJQA 2BH2A 2IA6A 5DQHA 5CMDA 2B3GA 1EY5A 3GTKB 1EZ1A 2CHBD 1U5KA 2KUMA 1M1KC 1CE8A 4P71A 1K0SA 2IP4A 5DG7A 2QGQA 2C22A 1WFQA 1XX8A 4JBWA 4X3KA 4GZYC 3BDCA 1BCPD 5DGBA 1G6ZA 1CFMA 3TDQA 3KLSX 1JQYD 2HDMA 5GQOA 2WIIB 2R6FA 4O2AF 5C8YF 2XCAA 2SOBA 1NR2A 2F3IA 1U4LA 2A68C 4RCNA 4ZKBB 1N32H 1LTGD 1IBLQ 3OUZA 5HY6A 5KG1A 3RIZA 4DV5H 4JBKA 4MV4A 2RGRA 4JYAH 2Q8IB 4ME5A 3TQ1A 2L0CA 3CCQA 1Q86C 1L2ZA 3W3AA 1I5FA 3U58A 2PMZA 4O4IF 4H13C 1KHIA 1PRTF 1WCMB 4RKBA 1HFNA 2GPWA 1B6RA 3GIKA 5LMNL 1C9OA 2KSWA 2HHHQ 4K5XA 5DNFA 1MKHA 3NQIA 4BA2I 1J5EL 3SE7A 4GKJQ 4EQPA 3FKIG 4OXPA 3MWMA 2DN8A 2OLSA 1GGOA 1EY0A 4DV6L 4R4CA 1SEIA 2AQ1B 2OEOA 3MTSA 1BXTA 1SE8A 1F9SA 1U4MA 1W6JA 3B6YA 2RSNA 4CKEA 4DV1Q 3JAMW 2Z0SA 1TQOA 2ZTCA 5KIXA 1VQGA 4RZQA 3PZPA 1MBYA 2O4XA 1GM5A 1GHJA 1CHPD 1RTNA 3RN5A 3R5XA 3LMLA 1B4OA 2CW0C 2QW7A 3V96A 1DXMA 3D4WA 3HOUH 2BQ3A 5M3FG 3CQZH 4DAVA 4JV5Q 1EQRA 2KHJA 1CA6A 4C56C 4JI0Q 4FS1A 2NTSA 1JJ2A 1WTPA 2UXDL 1EIFA 2UUCL 1GUWA 3CP0A 5F9LA 1T94A 2R7ZB 5C0XH 4R8UA 3VYUA 2JEBI 1VKZA 3PO2B 4CC5A 2W7OA 3GP7A 5M5WB 2R7MA 1XNQQ 1K0RA 2K4KA 1QNKA 1YNJD 1OXVA 4IPCA 4H0LC 4O1NA 4EG0A 4Q45A 4A3JG 5IT9E 1Y1WH 3M4OH 2F0UA 4JI1Q 4XQJA 2Y0SA 2KENA 4F4ZA 2VUMA 2E2HB 3RZDB 4BXXH 4HSPA 5J39A 5JVDF 4A3MG 4LUOA 4RCOA 3H09A 3JRWA 1JE4A 1YNNC 1EYDA 1KNAA 1BBWA 2JA5H 4BWSC 4Q0FA 4IUVA 2OCEA 4F4XA 4C3IH 1N34H 3BG3A 2R7FA 4YCVA 2E2DC 5C4HA 3DWPA 2F4VL 1IW7C 2R85A 4M9UA 5KT6A 1VQKA 3GV7B 4B3RH 3A54A 1WD0A 3PO3B 1I6HB 4I50F 4EFEA 1O80A 3KDFA 1K83B 1AUXA 3ICEA 1ZEQX 3J80E 2FK1A 4A2BA 1SMYC 4JV1A 1I50B 2AWNA 1Q7YC 3M9BA 3K59A 4DUZH 2OQ0A 2MJ8A 2V5AA 3ITPA 5KRUA 1M0WA 4DR4L 4I55F 4K5VA 4LF8Q 1M0TA 3JC66 3P1HA 4EX5A 3UDGA 1D1IA 5IP7G 2R82A 2DZDA 3AU7A 3C3LA 1S0OA 1YHBA 3PUZA 2B2UC 1E22A 3NUCA 2ZM6L 4NMZA 4YB8B 5IODA 3TINA 3H0GA 1KAAA 3T5LA 1ZYRD 4NKLA 2AMCB 1HZBA 1JDEA 3TIIA 2VQFL 3LWBA 2W7PA 4BBRG 2YS7A 1PFMA 2DY8A 3M4PA 2GLTA 1TR5A 4DV2Q 3FDSA 4O3SA 5KNBA 5KFCA 4JI8H 5IT9W 2B63A 2RDIA 2Q2IA 2WB1E 2EOTA 3SI8A 2PZWA 3PIP3 2R93G 3M4OB 2IBKA 3GLKA 5KFIA 2NZHA 4NLGA 2FLNA 2YYZA 3GTOB 2ZT9C 1XMQQ 2R92G 5C0XJ 3C46A 2UUBH 4LF6L 5DQIA 1ZQ7A 4UCRA 1B44D 3MWDA 2EVBA 3RV3A 3DWQA 4BBSB 4DR4H 1TS4A 5EWFA 4XDXA 2N8NA 5EWGA 3BAAA 4MZ9A 2F0HA 4XXEA 3S2HB 1VF7A 5C3WA 4FVMA 4A3DG 1VS0A 1IKMA 1PRTB 4B3TQ 1RL2A 3BZDB 1D5MC 2C35B 2M2LA 4DR2Q 2R7ZA 5FPRA 3G6XA 1TS3A 1Y8OB 3PUYA 4H02A 4IAJA 4B3SH 2AUKA 1CUKA 1Y8PB 4C3JB 2JA9A 4JG2A 3WO0A 4ECYA 3BA9A 4J9NA 1W2BA 3AB9A 3VPBA 1L0YB 5FLMG 4ZK9B 2GPSA 2CQAA 4RKLA 5BN4A 2ENBA 3PIPA 1D5XC 2E2HA 3RFCA 4IZOA 1EWIA 3HOZG 4LF6Q 4OWWB 1PLFA 2PMZB 3F2BA 1JB3A 1DYQA 3PW7A 2H4OA 3A8KE 3NTIA 2WACA 2IMWP 2AU0A 3NWSA 1CI3M 4ECWA 2YS6A 2B2WC 2EYFA 3A7LA 5KFYA 1B9MA 5L9XA 3ORRA 1JOOA 1PRTD 1X54A 2BE5D 3E9IA 1JORA 4RB3C 4ECSA 2I07B 1RJTA 4R4IA 4MHEA 2UXCH 4OX9H 2DWCA 2NN6G 1ASZA 2AHOB 5KG5A 1SROA 2W9CA 1T9HA 1KLGD 1LTAD 1X6OA 1BVSA 2K33A 3E5SA 3T1HH 5KFJA 4IJHA 1HNZL 5CBEE 2WYOA 2B2WA 2R7ZH 5LMNQ 1T36A
chains in the Genus database with same CATH topology
2IT1A 4MNOA 1NY4A 3KOJA 4KHZA 3UE1A 4HJ9A 4JI2L 1CKMA 1XNRQ 4LFCQ 1Q1BA 2IHEA 3W5OA 1KD1C 2JQOA 3CC4A 5IP9H 5GAGC 4GLVB 4IFDJ 2ALYB 1A8VA 2K14A 4ALPA 3H3VI 4DR2L 3J81i 4DUYQ 3OTOQ 4A3IG 3ULPA 3GTQH 4DR6Q 3HOUG 4GNXC 3CC7A 4HIMA 3GTMH 4BXXG 3I55A 2PMZE 4GOPB 4BY1H 1WCMH 3F8TA 4OO1G 2PI2A 3E9HA 4NPSA 2UUAQ 4QIWE 3M85A 2ES2A 4NXML 2JE6I 3F2DA 1VQNA 4LUZA 5GADC 2CCZA 2VUMG 2VUMH 1UE1A 1IL2A 4IPDA 5IYCG 3HOYH 3ER0A 3S1QH 1K3RA 3G71A 4BY7G 3T1YQ 1VQMA 1IBKQ 2WB1G 4HIDA 1N33L 2QA4A 1SLJA 2Z6KA 3OYYA 1PH9A 1HNZQ 1PH7A 2JEAI 1AE2A 3S17H 1HR0Q 2A19A 3D31A 2R6GA 3BU2A 4JV5L 4DR7Q 3CPWA 1JB7A 1KQSA 2E5LQ 3HFZB 2WAQE 1PH1A 2CFMA 3KF6B 1I6HH 2EQSA 3DLLA 1OXXK 5M3FH 1NE3A 2K50A 4Y7NH 3S1MH 2F52A 4AIMA 3EIVA 5IYBH 1YITA 1XPOA 3LGJA 3UDFA 4DV7Q 4A3EG 4JI3L 4LF9L 4QY7A 3GTGH 1EFWA 3H3VH 4JYAQ 4HIOA 1VQCA 4BBSH 2A1AA 2I5HA 1KXLA 5LMUL 4YCWA 5IWAL 3GTKH 4A75A 3ULLA 2OTLA 4LF5Q 3HOVH 1VQ8A 1SN8A 1YIJA 4DR1L 4LWCA 2JA8G 2NVXH 1HNXQ 5BR8L 4GKKL 3PO3H 4LFBL 3PO3G 2K5VA 5FLXc 3TRZA 4YWLA 5LMNW 4DK6C 1OXTA 3T1YL 3L0OA 1IBKL 4GLXA 1VQ5A 2UXBL 3D0FA 1VQIA 4DV1L 1R9TH 1VQLA 3HOVG 2RF4A 2XTIA 1LYLA 4B3SQ 1VQ6A 5FJ8G 1LUZA 4AQYQ 2YU9H 5C44G 2IY5B 2UXCQ 2XGTA 1A62A 3A5ZB 3EN2A 1Y1VH 2IX0A 2E5LL 1N32Q 3M4QA 4HJ5A 4IO9A 3H0GH 1Y1VG 1VQ9A 1PA6A 2ATWA 4YHHL 3TEHB 5M5YH 4IFDG 3RZDH 4JI0L 3KF8B 2NN6I 1KRTA 2N3SA 4YWMA 4NB3A 3HOWG 3ERSX 3HKZG 4C3HH 1AE3A 3IRBA 5IWAQ 1HNWL 2MQHA 4NXMQ 2KBNA 4PG3A 1X55A 2LSSA 2VQEQ 1VQOA 1N36L 1NMFA 2RHQB 2EXDA 1NJIC 2ZTDA 3ZJYC 2NVTH 2VZAA 1N33Q 3HKZE 1XPRA 4OX9Q 1Q12A 1UE7A 2H5XA 1VCIA 4DKAC 1WCMG 2NVQH 4BY1G 2CQOA 5JEAJ 1YJ9A 2HIXA 1IBML 1PVOA 1L0WA 1GKHA 4JI2Q 1HZ9A 4RMFA 1XNRL 4A3DH 1AH9A 1N32L 2D0PA 3UDIA 1LTLA 2I5MX 2LXKA 2R7DA 1PFSA 4YHHQ 3CCSA 4DV7L 1KC8C 3HOXH 2Q2TA 4LF9Q 1MJEA 4DUYL 1HZAA 4JYAL 4GNXB 3FP9A 4UP7A 2GVBA 3CMAA 4JI7L 1CSPA 1FJGQ 1G6PA 1Q82C 1WI5A 4GOPA 2L15A 4DV2L 1TWFH 4KLKA 1J6QA 1VQPA 2D62A 3BZCA 1OXSC 5IYCH 4GS3A 4GKKQ 2Q2HA 4DUZL 2PNHA 2OWOA 3MEFA 3S2DH 5ELNA 4A4IA 4KHPL 1DGSA 4JI8L 3J81c 4PZ8A 5JJKA 4WJ4A 1IBLL 1X65A 4IOCA 2RHSB 4KI0A 4GOPC 4FDBA 4J15A 5GAHC 3PUVA 2Q2UA 2MO1A 1C0AA 2K5HA 4B3RQ 1OTCA 2UXCL 3L7ZC 4X66L 2HT1A 4A3KG 3STBD 4GN5A 1YJNA 5EAYA 1M90C 3CF5A 3NEMA 1B70B 4UP9A 3T1HL 4B3TL 2MFIA 1I3QH 3K80C 4A3LH 3W1GA 1UE5A 1IYJB 4OWTB 4JI7Q 1PH4A 4DV4L 2UUBQ 3A5UA 3VDYA 2FXQA 5LMUQ 3FHWA 3S24A 2IX1A 3I56A 2VL6A 1X3FA 3DM3A 3PUWA 3TREA 4A3MH 4PMWA 4JOIA 1K8AC 3I4NG 4L5TA 3GTJH 1I50H 2VNUD 1VQ7A 3GDEA 3KLWA 4LF7Q 4JBJA 1S40A 1L1OA 4LFAL 3CXCA 3PO2G 2GVAA 4KHPQ 5C4JH 2YTVA 1E7ZA 4C3JH 3Q8DA 3UE0A 1XMQL 4IFDI 3CAMA 1E3PA 3JAMi 3G6EA 4A3EH 1X3EA 1JJCB 3AFQA 3NENA 4GLAC 2B29A 1PH5A 1CKOA 2JA5G 3PCOB 5C3EH 3PF5A 1PV4A 3I4OA 1EUJA 4GN3B 1E24A 2AKWB 3BZKA 3PIOA 1HZCA 2UUCQ 4LNQA 5E7NA 3TS0A 3CW2C 2WAQG 4JC0A 4DUZQ 2R92H 3CCLA 3ULJA 1YEZA 2VS1A 2YTXA 4R4QA 4DV0L 1YVCA 3HOYG 4LF7L 4AYBG 4DV5L 2QEXA 2UU9Q 4A93H 1A63A 4TQUS 2B63H 4K0KL 4OX9L 4X6AH 1UEBA 1LM0A 2OQKA 1O7IA 4UPAA 4JI6Q 1E1TA 4DR5L 4B3RL 4P73A 2ID0A 4X64Q 3MXNB 2ASBA 4JCVE 2CWAA 3AYHB 1QUQA 3STBC 4BBRH 2JJQA 3F2CA 2BH2A 4UP8A 2B3GA 3HOWH 3AFPA 1CKNB 1U5KA 3H15A 1X9NA 4ME3A 3KF6A 5C0XI 1M1KC 1YI2A 4P71A 4DPGA 4YY3Q 1UE6A 3OTOL 2QGQA 4DR6L 3H0GG 1PH3A 3K8AA 2LXJA 1XPUA 1WFQA 4JBWA 4GKJL 4L5QA 3NELA 5FJ8H 5GQOA 3RZOH 2E8GA 1FGUA 4JOIC 4APVA 1ASYA 4LFAQ 2F3IA 3K7UC 3S1RH 4DNIA 1VQHA 4JI8Q 1XMOL 1I94Q 1IBLQ 3G48A 4RG1A 2I5LX 5HY6A 4IPHA 4R4TA 3PF4A 4A3GG 4K0KQ 4JBKA 2JA8H 4DAYB 5M3MG 5M5XH 1BBUA 3CCQA 1MJCA 3BJUA 1Q86C 1I5FA 3U58A 4LF8L 5GROA 5IYDG 2E2HH 1L1OC 3U50C 4JI4L 1KHIA 3SGIA 4DV3L 1K8GA 3TQYA 4LF4L 4POGA 3CCEA 1BKBA 3T1HQ 2RCNA 5LMNL 1C9OA 1VQFA 4DK3C 2HHHQ 1PYBA 3CD6A 2CWPA 4Y52H 3RN2A 1MKHA 4IPGA 4P72A 4DV4Q 3J80i 1HR0W 3CCRA 1J5EL 2UUBL 4BA2I 1H95A 4GKJQ 1TWAH 3HOZH 3CCMA 1QVGA 3FKIG 2VQFQ 4OXPA 2N49A 1YBYA 4R4OA 3GTOH 3G4SA 2F4VQ 4DV6L 4R4CA 4A3BH 1VQBA 2UU9L 1SE8A 5J3BA 4PZ6A 1VQDA 3B6YA 4NXNL 4A93G 4DV1Q 2Z0SA 4OONA 4L5SA 3CPFA 4X64L 3KDFB 2ZTCA 1KIXA 1VQGA 1CKNA 1YHAA 1TWGH 4B3SL 1GM5A 4AQYL 4QGUA 1SRUA 1G291 3RN5A 1N8RC 2ZTEA 1JE5A 2JA6G 3I4MG 4A3FG 3HOUH 4DR3L 3S15H 5M3FG 3K0XA 4A3IH 1KRSA 3CQZH 4DV3Q 4JV5Q 4YY3L 2DUDA 1P16A 2A8VA 1EQRA 2KHJA 1E1OA 4JI0Q 4DAMA 1EQQA 2CKZB 2EIFA 1W3SA 2ZM6Q 1JJ2A 4QL5A 1NBWA 1EIFA 3U4VA 5HGQA 3CP0A 2ZJRA 2UUCL 2UXDL 2JA6H 1HNWQ 4X62Q 4A3JH 1Y1WG 2JEBI 4PZ7A 5M5WH 3TS2A 4BY7H 4BA1I 2E2IH 2WFWA 4YCUA 4POFA 4A76A 4LF5L 4DV6Q 1PH8A 1XNQQ 1K0RA 2K4KA 4DV5Q 1IXRA 3JAMc 4DR1Q 1OXVA 4IPCA 4X65L 2OTJA 3CCJA 1EOVA 1WYDA 1SMXA 4LFBQ 1V43A 4A3JG 1Y1WH 1QZHA 4JI1Q 1U0LA 1HH2P 5C0XG 2KENA 3AEVA 3M4OH 1D8LA 4DR4Q 4BXXH 1B8AA 1GD7A 4A3MG 4LUOA 1VQJA 4MTNA 1PYSB 3CMEA 3W1BA 4P75A 4O0AA 4JI5L 1EIYB 2HHHL 1BBWA 2JA5H 4A3LG 1FVIA 2BA0A 3K7AH 1QVCA 2DGYA 3NBHB 2OCEA 3HKSA 3RLOA 5C44H 4C3IH 1C7YA 5JJIA 1D7QA 4O2DA 4R1JA 3GD7A 1YNXA 2R7FA 4YCVA 4A3KH 3L2PA 4L5RC 2JA7G 2F4VL 1Q46A 2MO0A 1VQKA 3GTPH 2ZJPA 3OW2A 1YJWA 1Q1EA 4YWKA 1SR3A 1JJGA 3KDFA 2Y0SE 4A3GH 1XNQL 1VQAA 4NXNQ 1L1OB 4A3BG 1TWHH 4TVAB 2VQEL 1XMOQ 4AH6A 1N36Q 1I94L 1Z9FA 3ICEA 4X65Q 2AWNA 1Q7YC 3M9BA 2PI2E 2OQ0A 2E2JH 3FKIH 2KCMA 3KJPA 4HIKA 4A3CH 4XTCS 2JA7H 5AJ3Q 4DR4L 4X66Q 4LF8Q 4BBSG 3JC66 4QQBX 4EX5A 4IOAA 1CSQA 4AYBE 3UDGA 4GNXA 5IP7G 3F1ZA 1IBMQ 1QZGA 1IZ6A 4QJFA 1YHBA 3PUZA 1E22A 2UXDQ 1V9PA 2ZM6L 3CCVA 3HOXG 1GVPA 1PH2A 3RNUA 3J7A5 1JMCA 2HQLA 4DR7L 4LW1A 1J5EQ 4X62L 2AMCB 1HZBA 4B3ML 2VQFL 1WJJA 1Q81C 1FJGL 2Y0SG 2IHFA 4BBRG 5H1SE 3S1NH 1YZ6A 3M4PA 5IY0A 1N34L 4DV2Q 1GO3E 5FLMH 1MIUA 1KAWA 2UUAL 3AQQA 2KHIA 2Q2IA 2WB1E 2B63G 1JT8A 4C2MH 2R93G 2R93H 3S14H 4JI1L 4OO1I 1S72A 1PHJA 1G51A 1NMGA 1Y14B 2NZHA 2YYZA 3I2ZA 3K81C 3PGZA 1K9MC 1XMQQ 2PQAA 3U4ZA 5C0XJ 2R92G 3RLFA 1EYGA 4LF6L 4OWXB 3PUXA 5AJ3L 1K83H 2JK8A 1XTDA 4DR3Q 4JI5Q 3A0JA 2BA1A 5JJLA 2N8NA 2N78A 4MZ9A 5IP9G 3PSIA 1X56A 1B7YB 5C3EG 4A3DG 3EBEA 1TWCH 1VS0A 3UDXA 5GAEC 4A3FH 1PH6A 4B3TQ 3I4MH 3S2HH 1RL2A 5IP7H 2R7ZG 2C35B 4DR2Q 3PV0A 3KFUA 5C4XH 3PUYA 2Z6KC 4H02A 4WJ3M 1QVFA 4JBMA 1CUKA 5JEAG 3CC2A 2JA9A 4JG2A 2NVYH 3RR5A 1SFOH 4A3CG 1W2BA 3J80c 2NZOA 1HNXL 4UY8C 2D0OA 1P8LA 4HJ8A 3PO2H 3I7FA 5FLMG 4JI6L 2K52A 3PIPA 3I4NH 1RIPA 2UXBQ 4LUVA 1EWIA 3HOZG 4LF6Q 2K5NA 1N9WA 2VW9A 4OWWB 1FL0A 1HR0L 3F2BA 3J81j 4XIGS 4EQ5A 3GO5A 5DLQE 4LFCL 3CCUA 2AWOA 1TXYA 2WP8J 3KYHC 3KJOA 1X3GA 5IE8A 4B3MQ 4P74A 5IYDH 2BH8A 1V1QA 1N34Q 4JI3Q 3M7NA 2HIVA 2YTYA 2KCTA 1UWVA 5M3MH 1X54A 3E9IA 2MNAA 4IJLA 1XJVA 1L2FA 1OXUA 2VY3A 4R4IA 1K73C 4HJAA 1HJPA 3S16H 2PQAB 2GN5A 3E0EA 2NN6G 1YHQA 3A74A 1ASZA 2AHOB 1SROA 3RLNA 2ZJQA 1T9HA 4DV0Q 1Q8KA 1X6OA 5BR8Q 1WOCA 1QUQB 1BVSA 1S3OA 1VQ4A 5K36G 4IJHA 1HNZL 1VQEA 3WWVA 2I0QA 3GTLH 1Z47A 3J7ZC 1A0IA 4DR5Q 1KL9A 1NTGA 2V1CC 2YV5A 2K75A 4GN4B 5IT9c 4JI4Q 4LF4Q 5C4XG 2R7ZH 4HJ7A 5IYBG 5ELOA 5LMNQ 3M3YH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IT1 A;  4MNO A;  1NY4 A;  3KOJ A;  4KHZ A;  3UE1 A;  4HJ9 A;  4JI2 L;  1CKM A;  1XNR Q;  4LFC Q;  1Q1B A;  2IHE A;  3W5O A;  1KD1 C;  2JQO A;  3CC4 A;  5IP9 H;  5GAG C;  4GLV B;  4IFD J;  2ALY B;  1A8V A;  2K14 A;  4ALP A;  3H3V I;  4DR2 L;  3J81 i;  4DUY Q;  3OTO Q;  4A3I G;  3ULP A;  3GTQ H;  4DR6 Q;  3HOU G;  4GNX C;  3CC7 A;  4HIM A;  3GTM H;  4BXX G;  3I55 A;  2PMZ E;  4GOP B;  4BY1 H;  1WCM H;  3F8T A;  4OO1 G;  2PI2 A;  3E9H A;  4NPS A;  2UUA Q;  4QIW E;  3M85 A;  2ES2 A;  4NXM L;  2JE6 I;  3F2D A;  1VQN A;  4LUZ A;  5GAD C;  2CCZ A;  2VUM G;  2VUM H;  1UE1 A;  1IL2 A;  4IPD A;  5IYC G;  3HOY H;  3ER0 A;  3S1Q H;  1K3R A;  3G71 A;  4BY7 G;  3T1Y Q;  1VQM A;  1IBK Q;  2WB1 G;  4HID A;  1N33 L;  2QA4 A;  1SLJ A;  2Z6K A;  3OYY A;  1PH9 A;  1HNZ Q;  1PH7 A;  2JEA I;  1AE2 A;  3S17 H;  1HR0 Q;  2A19 A;  3D31 A;  2R6G A;  3BU2 A;  4JV5 L;  4DR7 Q;  3CPW A;  1JB7 A;  1KQS A;  2E5L Q;  3HFZ B;  2WAQ E;  1PH1 A;  2CFM A;  3KF6 B;  1I6H H;  2EQS A;  3DLL A;  1OXX K;  5M3F H;  1NE3 A;  2K50 A;  4Y7N H;  3S1M H;  2F52 A;  4AIM A;  3EIV A;  5IYB H;  1YIT A;  1XPO A;  3LGJ A;  3UDF A;  4DV7 Q;  4A3E G;  4JI3 L;  4LF9 L;  4QY7 A;  3GTG H;  1EFW A;  3H3V H;  4JYA Q;  4HIO A;  1VQC A;  4BBS H;  2A1A A;  2I5H A;  1KXL A;  5LMU L;  4YCW A;  5IWA L;  3GTK H;  4A75 A;  3ULL A;  2OTL A;  4LF5 Q;  3HOV H;  1VQ8 A;  1SN8 A;  1YIJ A;  4DR1 L;  4LWC A;  2JA8 G;  2NVX H;  1HNX Q;  5BR8 L;  4GKK L;  3PO3 H;  4LFB L;  3PO3 G;  2K5V A;  5FLX c;  3TRZ A;  4YWL A;  5LMN W;  4DK6 C;  1OXT A;  3T1Y L;  3L0O A;  1IBK L;  4GLX A;  1VQ5 A;  2UXB L;  3D0F A;  1VQI A;  4DV1 L;  1R9T H;  1VQL A;  3HOV G;  2RF4 A;  2XTI A;  1LYL A;  4B3S Q;  1VQ6 A;  5FJ8 G;  1LUZ A;  4AQY Q;  2YU9 H;  5C44 G;  2IY5 B;  2UXC Q;  2XGT A;  1A62 A;  3A5Z B;  3EN2 A;  1Y1V H;  2IX0 A;  2E5L L;  1N32 Q;  3M4Q A;  4HJ5 A;  4IO9 A;  3H0G H;  1Y1V G;  1VQ9 A;  1PA6 A;  2ATW A;  4YHH L;  3TEH B;  5M5Y H;  4IFD G;  3RZD H;  4JI0 L;  3KF8 B;  2NN6 I;  1KRT A;  2N3S A;  4YWM A;  4NB3 A;  3HOW G;  3ERS X;  3HKZ G;  4C3H H;  1AE3 A;  3IRB A;  5IWA Q;  1HNW L;  2MQH A;  4NXM Q;  2KBN A;  4PG3 A;  1X55 A;  2LSS A;  2VQE Q;  1VQO A;  1N36 L;  1NMF A;  2RHQ B;  2EXD A;  1NJI C;  2ZTD A;  3ZJY C;  2NVT H;  2VZA A;  1N33 Q;  3HKZ E;  1XPR A;  4OX9 Q;  1Q12 A;  1UE7 A;  2H5X A;  1VCI A;  4DKA C;  1WCM G;  2NVQ H;  4BY1 G;  2CQO A;  5JEA J;  1YJ9 A;  2HIX A;  1IBM L;  1PVO A;  1L0W A;  1GKH A;  4JI2 Q;  1HZ9 A;  4RMF A;  1XNR L;  4A3D H;  1AH9 A;  1N32 L;  2D0P A;  3UDI A;  1LTL A;  2I5M X;  2LXK A;  2R7D A;  1PFS A;  4YHH Q;  3CCS A;  4DV7 L;  1KC8 C;  3HOX H;  2Q2T A;  4LF9 Q;  1MJE A;  4DUY L;  1HZA A;  4JYA L;  4GNX B;  3FP9 A;  4UP7 A;  2GVB A;  3CMA A;  4JI7 L;  1CSP A;  1FJG Q;  1G6P A;  1Q82 C;  1WI5 A;  4GOP A;  2L15 A;  4DV2 L;  1TWF H;  4KLK A;  1J6Q A;  1VQP A;  2D62 A;  3BZC A;  1OXS C;  5IYC H;  4GS3 A;  4GKK Q;  2Q2H A;  4DUZ L;  2PNH A;  2OWO A;  3MEF A;  3S2D H;  5ELN A;  4A4I A;  4KHP L;  1DGS A;  4JI8 L;  3J81 c;  4PZ8 A;  5JJK A;  4WJ4 A;  1IBL L;  1X65 A;  4IOC A;  2RHS B;  4KI0 A;  4GOP C;  4FDB A;  4J15 A;  5GAH C;  3PUV A;  2Q2U A;  2MO1 A;  1C0A A;  2K5H A;  4B3R Q;  1OTC A;  2UXC L;  3L7Z C;  4X66 L;  2HT1 A;  4A3K G;  3STB D;  4GN5 A;  1YJN A;  5EAY A;  1M90 C;  3CF5 A;  3NEM A;  1B70 B;  4UP9 A;  3T1H L;  4B3T L;  2MFI A;  1I3Q H;  3K80 C;  4A3L H;  3W1G A;  1UE5 A;  1IYJ B;  4OWT B;  4JI7 Q;  1PH4 A;  4DV4 L;  2UUB Q;  3A5U A;  3VDY A;  2FXQ A;  5LMU Q;  3FHW A;  3S24 A;  2IX1 A;  3I56 A;  2VL6 A;  1X3F A;  3DM3 A;  3PUW A;  3TRE A;  4A3M H;  4PMW A;  4JOI A;  1K8A C;  3I4N G;  4L5T A;  3GTJ H;  1I50 H;  2VNU D;  1VQ7 A;  3GDE A;  3KLW A;  4LF7 Q;  4JBJ A;  1S40 A;  1L1O A;  4LFA L;  3CXC A;  3PO2 G;  2GVA A;  4KHP Q;  5C4J H;  2YTV A;  1E7Z A;  4C3J H;  3Q8D A;  3UE0 A;  1XMQ L;  4IFD I;  3CAM A;  1E3P A;  3JAM i;  3G6E A;  4A3E H;  1X3E A;  1JJC B;  3AFQ A;  3NEN A;  4GLA C;  2B29 A;  1PH5 A;  1CKO A;  2JA5 G;  3PCO B;  5C3E H;  3PF5 A;  1PV4 A;  3I4O A;  1EUJ A;  4GN3 B;  1E24 A;  2AKW B;  3BZK A;  3PIO A;  1HZC A;  2UUC Q;  4LNQ A;  5E7N A;  3TS0 A;  3CW2 C;  2WAQ G;  4JC0 A;  4DUZ Q;  2R92 H;  3CCL A;  3ULJ A;  1YEZ A;  2VS1 A;  2YTX A;  4R4Q A;  4DV0 L;  1YVC A;  3HOY G;  4LF7 L;  4AYB G;  4DV5 L;  2QEX A;  2UU9 Q;  4A93 H;  1A63 A;  4TQU S;  2B63 H;  4K0K L;  4OX9 L;  4X6A H;  1UEB A;  1LM0 A;  2OQK A;  1O7I A;  4UPA A;  4JI6 Q;  1E1T A;  4DR5 L;  4B3R L;  4P73 A;  2ID0 A;  4X64 Q;  3MXN B;  2ASB A;  4JCV E;  2CWA A;  3AYH B;  1QUQ A;  3STB C;  4BBR H;  2JJQ A;  3F2C A;  2BH2 A;  4UP8 A;  2B3G A;  3HOW H;  3AFP A;  1CKN B;  1U5K A;  3H15 A;  1X9N A;  4ME3 A;  3KF6 A;  5C0X I;  1M1K C;  1YI2 A;  4P71 A;  4DPG A;  4YY3 Q;  1UE6 A;  3OTO L;  2QGQ A;  4DR6 L;  3H0G G;  1PH3 A;  3K8A A;  2LXJ A;  1XPU A;  1WFQ A;  4JBW A;  4GKJ L;  4L5Q A;  3NEL A;  5FJ8 H;  5GQO A;  3RZO H;  2E8G A;  1FGU A;  4JOI C;  4APV A;  1ASY A;  4LFA Q;  2F3I A;  3K7U C;  3S1R H;  4DNI A;  1VQH A;  4JI8 Q;  1XMO L;  1I94 Q;  1IBL Q;  3G48 A;  4RG1 A;  2I5L X;  5HY6 A;  4IPH A;  4R4T A;  3PF4 A;  4A3G G;  4K0K Q;  4JBK A;  2JA8 H;  4DAY B;  5M3M G;  5M5X H;  1BBU A;  3CCQ A;  1MJC A;  3BJU A;  1Q86 C;  1I5F A;  3U58 A;  4LF8 L;  5GRO A;  5IYD G;  2E2H H;  1L1O C;  3U50 C;  4JI4 L;  1KHI A;  3SGI A;  4DV3 L;  1K8G A;  3TQY A;  4LF4 L;  4POG A;  3CCE A;  1BKB A;  3T1H Q;  2RCN A;  5LMN L;  1C9O A;  1VQF A;  4DK3 C;  2HHH Q;  1PYB A;  3CD6 A;  2CWP A;  4Y52 H;  3RN2 A;  1MKH A;  4IPG A;  4P72 A;  4DV4 Q;  3J80 i;  1HR0 W;  3CCR A;  1J5E L;  2UUB L;  4BA2 I;  1H95 A;  4GKJ Q;  1TWA H;  3HOZ H;  3CCM A;  1QVG A;  3FKI G;  2VQF Q;  4OXP A;  2N49 A;  1YBY A;  4R4O A;  3GTO H;  3G4S A;  2F4V Q;  4DV6 L;  4R4C A;  4A3B H;  1VQB A;  2UU9 L;  1SE8 A;  5J3B A;  4PZ6 A;  1VQD A;  3B6Y A;  4NXN L;  4A93 G;  4DV1 Q;  2Z0S A;  4OON A;  4L5S A;  3CPF A;  4X64 L;  3KDF B;  2ZTC A;  1KIX A;  1VQG A;  1CKN A;  1YHA A;  1TWG H;  4B3S L;  1GM5 A;  4AQY L;  4QGU A;  1SRU A;  1G29 1;  3RN5 A;  1N8R C;  2ZTE A;  1JE5 A;  2JA6 G;  3I4M G;  4A3F G;  3HOU H;  4DR3 L;  3S15 H;  5M3F G;  3K0X A;  4A3I H;  1KRS A;  3CQZ H;  4DV3 Q;  4JV5 Q;  4YY3 L;  2DUD A;  1P16 A;  2A8V A;  1EQR A;  2KHJ A;  1E1O A;  4JI0 Q;  4DAM A;  1EQQ A;  2CKZ B;  2EIF A;  1W3S A;  2ZM6 Q;  1JJ2 A;  4QL5 A;  1NBW A;  1EIF A;  3U4V A;  5HGQ A;  3CP0 A;  2ZJR A;  2UUC L;  2UXD L;  2JA6 H;  1HNW Q;  4X62 Q;  4A3J H;  1Y1W G;  2JEB I;  4PZ7 A;  5M5W H;  3TS2 A;  4BY7 H;  4BA1 I;  2E2I H;  2WFW A;  4YCU A;  4POF A;  4A76 A;  4LF5 L;  4DV6 Q;  1PH8 A;  1XNQ Q;  1K0R A;  2K4K A;  4DV5 Q;  1IXR A;  3JAM c;  4DR1 Q;  1OXV A;  4IPC A;  4X65 L;  2OTJ A;  3CCJ A;  1EOV A;  1WYD A;  1SMX A;  4LFB Q;  1V43 A;  4A3J G;  1Y1W H;  1QZH A;  4JI1 Q;  1U0L A;  1HH2 P;  5C0X G;  2KEN A;  3AEV A;  3M4O H;  1D8L A;  4DR4 Q;  4BXX H;  1B8A A;  1GD7 A;  4A3M G;  4LUO A;  1VQJ A;  4MTN A;  1PYS B;  3CME A;  3W1B A;  4P75 A;  4O0A A;  4JI5 L;  1EIY B;  2HHH L;  1BBW A;  2JA5 H;  4A3L G;  1FVI A;  2BA0 A;  3K7A H;  1QVC A;  2DGY A;  3NBH B;  2OCE A;  3HKS A;  3RLO A;  5C44 H;  4C3I H;  1C7Y A;  5JJI A;  1D7Q A;  4O2D A;  4R1J A;  3GD7 A;  1YNX A;  2R7F A;  4YCV A;  4A3K H;  3L2P A;  4L5R C;  2JA7 G;  2F4V L;  1Q46 A;  2MO0 A;  1VQK A;  3GTP H;  2ZJP A;  3OW2 A;  1YJW A;  1Q1E A;  4YWK A;  1SR3 A;  1JJG A;  3KDF A;  2Y0S E;  4A3G H;  1XNQ L;  1VQA A;  4NXN Q;  1L1O B;  4A3B G;  1TWH H;  4TVA B;  2VQE L;  1XMO Q;  4AH6 A;  1N36 Q;  1I94 L;  1Z9F A;  3ICE A;  4X65 Q;  2AWN A;  1Q7Y C;  3M9B A;  2PI2 E;  2OQ0 A;  2E2J H;  3FKI H;  2KCM A;  3KJP A;  4HIK A;  4A3C H;  4XTC S;  2JA7 H;  5AJ3 Q;  4DR4 L;  4X66 Q;  4LF8 Q;  4BBS G;  3JC6 6;  4QQB X;  4EX5 A;  4IOA A;  1CSQ A;  4AYB E;  3UDG A;  4GNX A;  5IP7 G;  3F1Z A;  1IBM Q;  1QZG A;  1IZ6 A;  4QJF A;  1YHB A;  3PUZ A;  1E22 A;  2UXD Q;  1V9P A;  2ZM6 L;  3CCV A;  3HOX G;  1GVP A;  1PH2 A;  3RNU A;  3J7A 5;  1JMC A;  2HQL A;  4DR7 L;  4LW1 A;  1J5E Q;  4X62 L;  2AMC B;  1HZB A;  4B3M L;  2VQF L;  1WJJ A;  1Q81 C;  1FJG L;  2Y0S G;  2IHF A;  4BBR G;  5H1S E;  3S1N H;  1YZ6 A;  3M4P A;  5IY0 A;  1N34 L;  4DV2 Q;  1GO3 E;  5FLM H;  1MIU A;  1KAW A;  2UUA L;  3AQQ A;  2KHI A;  2Q2I A;  2WB1 E;  2B63 G;  1JT8 A;  4C2M H;  2R93 G;  2R93 H;  3S14 H;  4JI1 L;  4OO1 I;  1S72 A;  1PHJ A;  1G51 A;  1NMG A;  1Y14 B;  2NZH A;  2YYZ A;  3I2Z A;  3K81 C;  3PGZ A;  1K9M C;  1XMQ Q;  2PQA A;  3U4Z A;  5C0X J;  2R92 G;  3RLF A;  1EYG A;  4LF6 L;  4OWX B;  3PUX A;  5AJ3 L;  1K83 H;  2JK8 A;  1XTD A;  4DR3 Q;  4JI5 Q;  3A0J A;  2BA1 A;  5JJL A;  2N8N A;  2N78 A;  4MZ9 A;  5IP9 G;  3PSI A;  1X56 A;  1B7Y B;  5C3E G;  4A3D G;  3EBE A;  1TWC H;  1VS0 A;  3UDX A;  5GAE C;  4A3F H;  1PH6 A;  4B3T Q;  3I4M H;  3S2H H;  1RL2 A;  5IP7 H;  2R7Z G;  2C35 B;  4DR2 Q;  3PV0 A;  3KFU A;  5C4X H;  3PUY A;  2Z6K C;  4H02 A;  4WJ3 M;  1QVF A;  4JBM A;  1CUK A;  5JEA G;  3CC2 A;  2JA9 A;  4JG2 A;  2NVY H;  3RR5 A;  1SFO H;  4A3C G;  1W2B A;  3J80 c;  2NZO A;  1HNX L;  4UY8 C;  2D0O A;  1P8L A;  4HJ8 A;  3PO2 H;  3I7F A;  5FLM G;  4JI6 L;  2K52 A;  3PIP A;  3I4N H;  1RIP A;  2UXB Q;  4LUV A;  1EWI A;  3HOZ G;  4LF6 Q;  2K5N A;  1N9W A;  2VW9 A;  4OWW B;  1FL0 A;  1HR0 L;  3F2B A;  3J81 j;  4XIG S;  4EQ5 A;  3GO5 A;  5DLQ E;  4LFC L;  3CCU A;  2AWO A;  1TXY A;  2WP8 J;  3KYH C;  3KJO A;  1X3G A;  5IE8 A;  4B3M Q;  4P74 A;  5IYD H;  2BH8 A;  1V1Q A;  1N34 Q;  4JI3 Q;  3M7N A;  2HIV A;  2YTY A;  2KCT A;  1UWV A;  5M3M H;  1X54 A;  3E9I A;  2MNA A;  4IJL A;  1XJV A;  1L2F A;  1OXU A;  2VY3 A;  4R4I A;  1K73 C;  4HJA A;  1HJP A;  3S16 H;  2PQA B;  2GN5 A;  3E0E A;  2NN6 G;  1YHQ A;  3A74 A;  1ASZ A;  2AHO B;  1SRO A;  3RLN A;  2ZJQ A;  1T9H A;  4DV0 Q;  1Q8K A;  1X6O A;  5BR8 Q;  1WOC A;  1QUQ B;  1BVS A;  1S3O A;  1VQ4 A;  5K36 G;  4IJH A;  1HNZ L;  1VQE A;  3WWV A;  2I0Q A;  3GTL H;  1Z47 A;  3J7Z C;  1A0I A;  4DR5 Q;  1KL9 A;  1NTG A;  2V1C C;  2YV5 A;  2K75 A;  4GN4 B;  5IT9 c;  4JI4 Q;  4LF4 Q;  5C4X G;  2R7Z H;  4HJ7 A;  5IYB G;  5ELO A;  5LMN Q;  3M3Y H; 
#chains in the Genus database with same CATH topology
 2W6O A;  4KHZ A;  2SNM A;  4HYK A;  5J22 A;  2JP1 A;  4IFD J;  3I72 A;  4ALP A;  3J81 i;  4DUY Q;  3OTO Q;  4DR6 Q;  2CH4 W;  5IYZ F;  4BXX G;  3GTM H;  1EWC A;  5A2Q E;  2PMZ E;  4L63 B;  4BY1 H;  4OO1 G;  5KT7 A;  4XT1 B;  3HBL A;  4NPS A;  1FGB D;  1ILP A;  1I4R A;  2ES2 A;  4WD3 A;  2G9D A;  3FVQ A;  2CCZ A;  5C5J A;  2F0S A;  2K5D A;  5IYC G;  3JAM E;  1K3R A;  5K2M A;  2VR1 A;  3T1Y Q;  1VQM A;  3RAQ A;  3VA7 A;  2QA4 A;  2JEA I;  2BE5 C;  4IWX A;  1HNZ Q;  4QWE A;  2J6S A;  4J9R A;  3D31 A;  2A69 C;  2Q8R E;  3SE0 A;  3BU2 A;  4JV5 L;  3IL8 A;  2A6H C;  1KQS A;  2VQE H;  2W8K A;  3RBE A;  1Y69 U;  1I6H H;  1M4V A;  2B2Y C;  3S1M H;  5M3F H;  1EQV A;  4AIM A;  5IYB H;  3JSN A;  3I73 A;  1XPO A;  5CGK A;  1CZW A;  4JYA Q;  3K5N A;  3RGZ A;  4BBS H;  5JVL A;  1B9N A;  2I5H A;  5IWA L;  4A75 A;  2OTL A;  4JUZ A;  5EQ0 A;  4Q44 A;  1YNJ C;  1Z2P X;  2A6E D;  1CK1 A;  2L5T A;  5BR8 L;  2NN6 H;  4YIJ A;  3MFG A;  4L1K A;  3PQI A;  1BUV T;  2K5V A;  4B3M H;  5CB4 F;  2X0S A;  3R5H A;  2UXB L;  2J6U A;  3D0F A;  5CV5 A;  1VQI A;  3C0F B;  1ZHQ A;  2R92 A;  3FEW X;  2RF4 A;  2NU8 B;  1HFG A;  3NHH A;  5FJ8 G;  1O7Y A;  5D8D A;  4X3S A;  1Y1V H;  2AGQ A;  4IO9 A;  2UUC H;  4EYI B;  3TN2 A;  2IW3 A;  4R8U B;  1MSH A;  5M5Y H;  4UFZ A;  1U4P A;  2RDJ A;  4JI0 L;  4OEM B;  4I65 A;  1BCP F;  1RKN A;  4HED A;  4ILW A;  1EZ8 A;  5C1O A;  2F0P A;  3M9M B;  3I90 A;  1R4Q B;  4A3M B;  4O2B F;  1VQO A;  1I3Q A;  2RHQ B;  4IN3 A;  2E75 C;  2W9C B;  2VZA A;  3S16 B;  1TWA B;  4RGN A;  4IUT A;  4OX9 Q;  3H4D A;  2PYK A;  4FS2 A;  1VCI A;  1WCM G;  2NVQ H;  2A6E C;  2P0A A;  1B33 N;  1PVO A;  4OIJ A;  1L0W A;  4JI2 Q;  1Z2N X;  4PWQ A;  2MHV A;  2R84 A;  2MUY A;  1GXD C;  1KJQ A;  1GSH A;  1LTL A;  1CHQ D;  4MTE A;  3MVV A;  2Z4H A;  2UU9 H;  3MFI A;  4LH7 A;  2GVB A;  2R8I A;  3EPI A;  5KFZ A;  2NZ1 D;  4RFB A;  2M9V A;  1II3 A;  5I9O A;  2ZXP A;  1EUD B;  4O3P A;  1JWS D;  4UCV A;  2FK2 A;  3D6C A;  2R7K A;  4RNM A;  2PNH A;  2OWO A;  5C1P A;  1FKA H;  1WH2 A;  3V6H A;  4A4I A;  3J81 c;  5JJK A;  1Y1V A;  3HKZ B;  4N8F A;  3K5L A;  1IBL L;  1XMQ H;  2QK4 A;  4KI0 A;  3I70 A;  1LTR D;  1Q90 A;  4J15 A;  2DY7 A;  2K5H A;  5D1O B;  4B3R Q;  2XVS A;  1EZ6 A;  4DXG A;  1BF4 A;  2X6G A;  3STB D;  3T53 B;  5EAY A;  3KBX A;  4C3I G;  1YJN A;  3RB0 A;  1B70 B;  5D3D A;  4FF1 A;  4B3T L;  4I7A A;  4KKT A;  5EPJ A;  3QJY A;  3HRZ C;  1HQM C;  1UE5 A;  2WV6 D;  1JWU D;  2DLN A;  2R86 A;  2KEC A;  3K5I A;  5J2T F;  1PZJ D;  1X3F A;  4A3M H;  4RU9 A;  4QWA A;  4UCT A;  3OIP A;  3G7L A;  4Y7N B;  1I50 H;  3GTJ H;  3GDE A;  3KLW A;  3D8G A;  3M4Y A;  4JBJ A;  1S40 A;  4LF7 Q;  1GSO A;  4M7E A;  4DR2 H;  5KND A;  5IIF A;  4KHP Q;  4TQS A;  1R9T A;  3BYT B;  5C4J H;  5FKA C;  2YTV A;  5EPK A;  4IRD A;  1QJO A;  4KN7 C;  2E2I A;  1KTK A;  1XMQ L;  3JAM i;  1JX4 A;  3RGX A;  3ND8 A;  5EOY A;  1CS0 A;  1X3E A;  4HMI A;  5BMV F;  4QCL A;  1R4P B;  4LMQ D;  4A3E B;  2JA5 G;  3PCO B;  2YU9 B;  3M3Y B;  4UCU A;  4GN3 B;  1E24 A;  2F0W A;  4PMB A;  3OW7 A;  3MJF A;  1UC9 A;  5E1F A;  1PRT C;  1HZC A;  3DUZ A;  2L9H A;  4JW0 A;  2UUC Q;  4MV7 A;  4RGT A;  4B08 A;  3CU7 A;  1DM0 B;  3E3X A;  4JC0 A;  1N48 A;  1HA6 A;  2XRQ D;  2VS1 A;  2YTX A;  3NP8 A;  4R4Q A;  5FO8 B;  2HDL A;  4DV0 L;  3L3O C;  4DV5 L;  1PZK D;  4LF9 H;  4J0M A;  1TS5 A;  2I46 A;  4K0K L;  4ED2 A;  4V0B A;  3KUP A;  4X3T A;  3S1M B;  4JI6 Q;  2RDF A;  1SYC A;  2R93 A;  2XNA C;  5I9P A;  4JCV E;  1QUQ A;  1S68 A;  4DR1 H;  4N9P A;  3IFT A;  4UP8 A;  3Q23 A;  1TWH A;  2VQF H;  4CDD C;  2B2Y A;  5DLF A;  3TP5 A;  1FNU A;  1TII D;  2CW0 D;  1CKN B;  2V58 A;  3H15 A;  1X9N A;  4ME3 A;  5C0X I;  4YY3 Q;  1O7Z A;  1UE6 A;  3OTO L;  3TP6 A;  5FLX L;  4DR6 L;  3H0G G;  3K8A A;  3TIG A;  4B9X A;  2WAQ A;  3GIQ A;  4GKJ L;  3HEJ A;  5KEE A;  4DLK A;  2VB3 X;  3NEL A;  1PTO C;  3RZO H;  4RNO A;  4MN3 A;  4G57 A;  4CGY B;  4EYH B;  1SE3 A;  4OHJ A;  3K7U C;  3HG9 A;  1XMO L;  3MR3 A;  2E76 C;  4RG1 A;  4K0K Q;  4IPH A;  4A3G G;  2FP4 B;  3DXJ C;  2JA8 H;  3ETH A;  1O78 A;  5JH7 F;  2XWJ B;  3M4I A;  1HNW H;  1BBU A;  2R92 B;  4IUR A;  1XYI A;  4MV6 A;  3BQ1 A;  2VQD A;  2ASD A;  3BJU A;  3OSN A;  1BCP C;  5GRO A;  4LF8 L;  3U50 C;  1M7J A;  1K8G A;  4C2M A;  4QW8 A;  2R8G A;  1EWH A;  3J7Y W;  4HCS A;  5ELE A;  2HGS A;  4DK3 C;  3CD6 A;  1PYB A;  2PZT A;  4Y52 H;  4POG A;  2EY5 A;  3CCR A;  5E4W C;  5FLX W;  5CV4 A;  1X3P A;  4YR2 A;  2VQF Q;  1XNR H;  2N49 A;  3GTO H;  5T1I A;  3J80 W;  3G4S A;  2IL8 A;  3NSW A;  4IRC A;  4XX0 B;  1GYF A;  4ID6 A;  2QF7 A;  5J3B A;  4PZ6 A;  1VQD A;  3SK6 A;  3BJY A;  2AQ4 A;  2AQ2 B;  3EFX D;  2N55 A;  3PW4 A;  4A93 G;  2J4X A;  4MV1 A;  1A3T A;  3CPF A;  4X64 L;  1KIX A;  4L5S A;  4G7O C;  1YHA A;  4ODG A;  1KBL A;  1SRU A;  1KNE A;  1IBK H;  2JA6 G;  3H20 A;  4DR3 L;  2F3V A;  5KG3 A;  3K0X A;  1V8Q A;  4KKS A;  2ALZ A;  2DUD A;  1P16 A;  2FE3 A;  2PPB C;  1EQQ A;  1W3S A;  5KFT A;  2NWG A;  4BY1 B;  3U4V A;  1OWT A;  5LL6 b;  5L1L A;  2JA6 H;  4EGJ A;  4X62 Q;  5KFK A;  4A3J H;  1Y1W G;  3TS2 A;  5CA0 F;  4BA1 I;  2EYP A;  2WFW A;  4YCU A;  1I94 H;  3HOY B;  4A76 A;  1PH8 A;  2B8F A;  3VPC A;  1HA5 A;  1EOV A;  4IUQ A;  4WOR A;  1W96 A;  4HR7 A;  1ZHS A;  4RB1 A;  1V43 A;  1QZH A;  4B9W A;  1HH2 P;  5C0X G;  1D8L A;  4DR4 Q;  2NYZ D;  3K5M A;  3UQ8 A;  1JOK A;  5D1O A;  5KFO A;  1EUC B;  1G2T A;  1VQJ A;  4MTN A;  3KXY T;  4LK1 C;  2XGQ A;  4HMJ A;  4J9P A;  1EIY B;  4JI5 L;  3PVX A;  2HHH L;  1FVI A;  2BA0 A;  1HQR D;  1QVC A;  4QWC A;  3NBH B;  3HKS A;  5JJI A;  3RLO A;  1C7Y A;  1SXT A;  1I3Q B;  4R1J A;  4DXF A;  2LMC B;  4A3F B;  1Q46 A;  3CKI B;  1FYC A;  1EFI D;  1B04 A;  5KKN B;  3CVZ A;  2ZJP A;  5DM6 3;  1VBH A;  4A3G H;  2C2R A;  1VQA A;  2K5Q A;  4NXN Q;  5D14 A;  1AN7 A;  1I94 L;  3FKI B;  4X65 Q;  1A9X A;  1WVL A;  1SNP A;  2E2J H;  3FKI H;  3NQT A;  2EY6 A;  3BQ2 A;  2JA7 H;  2E2J B;  1TY0 A;  1GUG A;  5CYU A;  3D4D A;  2KED A;  4QQB X;  4IOA A;  2L11 A;  1CSQ A;  1PDQ A;  2B2U A;  3F1Z A;  1QZG A;  4M8A A;  4LSX A;  1Z7T A;  4QJF A;  5FOB B;  4ED1 A;  2YU9 A;  5F9N A;  3JZI A;  3K6O A;  1GVP A;  2F0E A;  3J7A 5;  4DR7 L;  2YCH A;  2HQL A;  4LW1 A;  3E0J A;  3X3N A;  2EXZ A;  4A93 B;  2I8C A;  1WJJ A;  3S1N H;  2K6A A;  1IHZ A;  5GON F;  1YZ6 A;  3D6W A;  5IY0 A;  4TSS A;  4ECT A;  5FLM H;  3HKZ A;  1MIU A;  2Y0S B;  4ECU A;  1SNC A;  1VMC A;  4QW9 A;  2M00 A;  4HNV A;  1JT8 A;  3HS0 C;  3NPP A;  3N43 B;  4JI1 L;  3MWE A;  3K81 C;  1Y14 B;  1K9M C;  1CQJ B;  5LMU H;  3U4Z A;  3SVM A;  1EYG A;  3PUX A;  4DNR B;  1ZYR C;  4F87 A;  2XRS D;  3DMU A;  4EBE A;  2FJ2 A;  1ZKO A;  2NU6 B;  1FR3 A;  2AGP A;  3A0J A;  2BA1 A;  2W9A A;  5IP9 G;  2Z4I A;  2EE1 A;  3PSI A;  1X56 A;  3IAY A;  4J9Q A;  1SNQ A;  2BQR A;  3GTL A;  1B7Y B;  3OUU A;  3S2H H;  1I4H A;  3UDX A;  4A3F H;  4YBZ B;  5C4X H;  2V4D A;  4WJ3 M;  3EVQ A;  1R9T B;  1QG7 A;  1MGS A;  5KFQ A;  4NW2 A;  1SMY D;  2I80 A;  3VPD A;  5FLX E;  1HNX L;  3EA6 A;  2D0O A;  3J81 E;  3I7F A;  4JI6 L;  3WOF A;  4BWG B;  3CHB D;  5ISR A;  2W8L A;  3S1Q B;  2XN9 C;  2K5W A;  1ILQ A;  5M5Y B;  4LUV A;  2R87 A;  3Q8P B;  4WJW A;  4K5W A;  1FL0 A;  1I6U A;  1GSA A;  4DV2 H;  1F2L A;  4EQ5 A;  5KYI A;  1BNC A;  2PO4 A;  4LFC L;  2M05 A;  4IQZ A;  2WP8 J;  3I8Z A;  3KJO A;  3J81 L;  2YL2 A;  1EEF D;  2JEG A;  1A15 A;  2B63 B;  2W6Z A;  1EU4 A;  4U68 A;  4UAI A;  5EPL A;  1N34 Q;  3M7N A;  5LL6 X;  2HIV A;  2YTY A;  1XJV A;  2MNA A;  1L2F A;  5I4D A;  2VY3 A;  5LOV F;  1K73 C;  4PNY A;  2A69 D;  2F0G A;  3BDL A;  4ZQ3 A;  4HJA A;  3S16 H;  1FNV A;  5KG4 A;  5DG8 A;  4HN7 A;  4FF3 A;  2ZJQ A;  3KAL A;  4DV0 Q;  2CH4 A;  1WOC A;  1QUQ B;  5K36 G;  3BG5 A;  1JWM D;  1TWH B;  4O4L F;  2I0Q A;  1VQE A;  3WWV A;  3GTL H;  2W71 A;  3KTM A;  1DOL A;  1Z47 A;  3QO2 A;  4G4K A;  1C8C A;  1PK8 A;  1LV9 A;  5L37 A;  1KL9 A;  5IT9 c;  5C4X G;  1TA8 A;  4CDF C;  4O3Q A;  5D65 A;  3M3Y H;  2IT1 A;  1AZP A;  1NY4 A;  3JAM L;  4LFC Q;  1Q1B A;  5AFW A;  4GKJ H;  2I87 A;  3CC4 A;  5IP9 H;  5GAG C;  4C5C A;  2ALY B;  2JA7 B;  4E4T A;  4LFC H;  3RUZ A;  4HIM A;  3CC7 A;  1AEX A;  3I55 A;  3C1E A;  3A56 A;  3H3V C;  1QE6 A;  3E9H A;  2IJ0 A;  1A2T A;  4QIW E;  3M85 A;  3KAK A;  3F2D A;  3GII A;  5GAD C;  2YRX A;  2VUM H;  4IPD A;  3HOY H;  3ER0 A;  3S1Q H;  4O3R A;  4HID A;  3Q0A A;  1N33 L;  2RA4 A;  2Z6K A;  1HR0 Q;  3PIO 3;  2R61 A;  2V9W A;  1S5C D;  3TP8 A;  3CPW A;  2QDB A;  2FPG B;  1JKJ B;  3HFZ B;  1PH1 A;  2CFM A;  1QB5 D;  2EQS A;  1RDP D;  2EY1 A;  4DL6 A;  4LJZ C;  1NE3 A;  4Y7N H;  3GTJ B;  3SK4 A;  3VR3 A;  4JI2 H;  3DEO A;  3BDO A;  3GTG H;  3UDF A;  4DV7 Q;  4LF9 L;  1F9Q A;  4JI3 L;  5M3F B;  1V51 A;  1EFW A;  3HOX B;  2DNC A;  3HOU B;  1EEI D;  4YCW A;  4KV6 A;  1SN8 A;  1YIJ A;  2JA8 G;  3IG0 A;  2IX3 A;  2NVX H;  1QNU A;  5I6Y A;  3GIP A;  4X62 H;  5FLX c;  5KFX A;  4YWL A;  1TWF A;  1IBK L;  1VQ5 A;  3L0O A;  1KLU D;  4K6D A;  3N42 B;  3MAQ A;  1G91 A;  1FD7 D;  1R9T H;  1DZ1 A;  3QWN A;  1NAP A;  1LUZ A;  2R7L A;  4DGZ A;  1SEB D;  2EY2 A;  1D5Z C;  3A5Z B;  4HCE A;  2UXC Q;  1EIG A;  3H0G H;  1Y1V G;  3P7J A;  1SYB A;  1K3B C;  1S5E D;  4UHV A;  1VQ9 A;  4S3S A;  1S03 G;  2F1M A;  2PQE A;  3TEH B;  2C2D A;  4IFD G;  3PR5 B;  4IWY A;  4RA8 A;  4YAJ B;  3HKZ G;  1SBB B;  4K6L A;  1XXG A;  5KFF A;  1D1K A;  4NXM Q;  4HR7 B;  5JOB A;  4PG3 A;  4K8J A;  2VQE Q;  2EJM A;  1NMF A;  3PR4 A;  4KD3 A;  2EXD A;  2NB0 A;  1ML0 D;  2ZTD A;  3J7A V;  1JC7 A;  1MHW C;  1HHV A;  3AMU A;  2JEI A;  2P5Z X;  3HKZ E;  4H44 C;  4P2C B;  4IRK A;  4YQW A;  4F4W A;  4DKA C;  2OH2 A;  4BY1 G;  2CQO A;  1IBM L;  4RMF A;  1XNR L;  4ED7 A;  1JOQ A;  1SJE D;  2DIK A;  1ESR A;  1RJQ A;  1CZG A;  2I5M X;  3L4J A;  3GTL B;  2Q2T A;  4YHH Q;  1EYA A;  5IT9 L;  3HOX H;  4JYA L;  3KLS A;  1MJE A;  1DON A;  4F88 A;  4JI7 L;  1EHI A;  5KFM A;  1SE2 A;  5CV7 A;  2JEJ A;  1LT6 D;  2F0K A;  1Q82 C;  2FJZ A;  2DPJ A;  4IUN A;  1TWF H;  1E4E B;  1VQP A;  2W6N A;  4LFA H;  2CVR A;  5IYC H;  3S2D B;  4GS3 A;  4GKK Q;  4DUZ L;  3P75 A;  1KJI A;  4DU9 A;  1SYX B;  3TME A;  4DR3 H;  3S2D H;  2A6H D;  5ELN A;  1C48 A;  4KHP L;  5ELC A;  1LAC A;  4PZ8 A;  3VYS A;  1J5E H;  2RHS B;  4PDB A;  5GAH C;  4Q8F A;  4FO2 A;  4Q5V A;  1LT3 D;  4PQX A;  3L7Z C;  1U4R A;  4X66 L;  3SK8 A;  1HRJ A;  1E4F T;  3G6Y A;  2ZDH A;  1X3Q A;  1ENA A;  3NEM A;  4UP9 A;  4MA0 A;  1I3Q H;  2RKS A;  2E74 C;  5JPM C;  4OWT B;  4JI7 Q;  1RJP A;  1UNN C;  3A5U A;  3VDY A;  5LMU Q;  4JI7 H;  3I56 A;  1JXL A;  3PUW A;  1TWG B;  1TWA A;  1K8A C;  2VNU D;  4ZI7 F;  1EY7 A;  2QDL A;  4LFA L;  4H7B A;  3CXC A;  2WKC A;  4O3O A;  4CJ0 B;  2F0N A;  5NUC A;  2QCP X;  4C3J H;  3Q8D A;  2PNR C;  3UE0 A;  2L4N A;  1RK5 A;  4BS9 A;  3CAM A;  5EGT A;  1VAJ A;  1ULZ A;  3D3R A;  3U9O A;  5IWA H;  4XQQ A;  4UCS A;  2HJW A;  5CV6 A;  2B29 A;  1CKO A;  1RYR A;  3I4O A;  1EUJ A;  5EDW A;  2EYO A;  3U9T A;  3GTM A;  3BZK A;  4KD4 A;  1HUN A;  3PIO A;  2F0M A;  4LNQ A;  3GIJ A;  1WTX A;  3T4A C;  2V59 A;  2FFK B;  2R92 H;  3MXP A;  3CCL A;  4J9M A;  3HP3 A;  1BR9 A;  4J9O A;  2UU9 Q;  4TQR A;  2W70 A;  2ZM6 H;  2XWB B;  2ASL A;  4UPA A;  4XYQ A;  2HVR A;  3H4B A;  4JI0 H;  4TRD A;  4B3R L;  1KDA A;  4P73 A;  5COR A;  4R9W A;  4XYO A;  2ASB A;  3UI2 A;  1WTV A;  2RQX A;  4Y8V B;  1XNQ H;  1G2S A;  2RGV A;  2YYA A;  2VUG A;  1VMP A;  2HQE A;  3TQT A;  4DPG A;  1AN8 A;  3QFF A;  3GTJ A;  3C1F A;  1XPU A;  2UVV A;  1RHP A;  3NE5 B;  5FJ8 H;  4DL3 A;  2QKI C;  3A55 A;  3NXW A;  1ZET A;  1FGU A;  2NTT A;  1ASY A;  2E2I B;  4FF2 A;  1AW7 A;  3S1R H;  1HNZ H;  1VQH A;  4JI8 Q;  4LMY A;  4R8I A;  4ULL A;  1I94 Q;  3CQZ B;  2PBZ A;  4U6P A;  3G48 A;  2I5L X;  4R4T A;  5EBC A;  3ZYY X;  2AUJ D;  2EZV A;  1IW7 D;  2F3W A;  5M3M G;  1T5X D;  3Q8R B;  1MJC A;  2C00 A;  1ENF A;  5TSS A;  2J7Z A;  1SAP A;  5IYD G;  1L1O C;  2UUA H;  1EQT A;  2JA7 A;  3TQY A;  3MFY A;  1KDC A;  3QZ8 A;  1BKB A;  3T1H Q;  2RCN A;  3V2T A;  4KTA A;  1VQF A;  5FO7 B;  5KT4 A;  4YR0 A;  3Q8Q B;  2CWP A;  3RN2 A;  4P72 A;  4DR7 Q;  1HNX H;  1HR0 W;  2UUB L;  4ED6 A;  2C28 A;  1H95 A;  3S14 B;  4GC6 A;  1TWA H;  1W93 A;  5LP6 F;  3CCM A;  1YBY A;  4R4O A;  2O2L D;  1DOK A;  3DF7 A;  2F4V Q;  3JRX A;  3MHB A;  5FPO A;  4RAZ A;  4DV7 H;  1MZB A;  4A2A A;  3T13 A;  1TKW B;  3SR1 A;  1SND A;  2F0F A;  1UNS A;  1XTC D;  4CJ2 C;  1CKN A;  3E5N A;  1TWG H;  4RHR A;  3T16 A;  3WOE A;  4B3S L;  4AQY L;  3MR5 A;  2HCI A;  1G29 1;  1H9R A;  4A3I B;  4WBN F;  2ZTE A;  1JE5 A;  4MTK A;  3I4M G;  2HHH H;  4A3F G;  1WTH A;  3S15 H;  2WAQ B;  4DV3 Q;  2FK3 A;  4RGM A;  4YY3 L;  1ROD A;  2A8V A;  3RMH A;  4KJO A;  1E1O A;  4ED0 A;  5K5P A;  5KFU A;  2CKZ B;  3ERO A;  2EIF A;  3RB6 A;  1PXU A;  3MFH A;  1NBW A;  5BPF A;  2B8G A;  2K1B A;  1HNW Q;  2CW7 A;  4FXK C;  1CT1 D;  3BS1 A;  4BY7 H;  4RWS C;  1Q8I A;  1SYF A;  3JAM c;  2UXB H;  4DR1 Q;  1JLL B;  2OTJ A;  4X65 L;  3CRL C;  5KNC A;  1CA5 A;  3GID A;  3H91 A;  1SMX A;  3N6R A;  4MA5 A;  4LFB Q;  1LLR D;  4C2M B;  2FKL A;  1FNW A;  1U0L A;  2FLP A;  1IL8 A;  2IWH A;  1B8A A;  4LSA A;  2YZN A;  5KFN A;  1RCV D;  1SJH D;  1GD7 A;  2JN4 A;  1STA A;  3QZ7 A;  4HAE A;  4N9T A;  1A6X A;  3S1N B;  2FIN B;  4RAU C;  5DEH A;  3W1B A;  2FPP B;  4P75 A;  5EBD A;  3RB3 A;  3IN5 A;  3DEP A;  4K2L A;  1DIK A;  2QYZ A;  4FM9 A;  4O2D A;  4L5R C;  1YNX A;  4A3K H;  3L2P A;  3BYY B;  2JA7 G;  1S0N A;  2MO0 A;  1CQV A;  4WRD A;  1S5D D;  1TWG A;  3L9A X;  3OW2 A;  1YJW A;  2EJG C;  1SR3 A;  1AFP A;  1JJG A;  3H6M A;  3H94 A;  3R2I A;  5FO9 B;  3Q22 A;  2VXW A;  1TWH H;  4TVA B;  3QOL A;  2ICI A;  2VQE L;  3WO1 A;  1NNX A;  4HNT A;  4A3G B;  2A74 C;  2WB1 A;  3R23 A;  1I4P A;  2KCM A;  5E4X A;  3OTO H;  3KJP A;  4HIK A;  1V1O A;  3VA5 A;  2F0L A;  5AJ3 Q;  4X66 Q;  1PFB A;  2K01 A;  2VPQ A;  4AYB E;  3JSL A;  1IBM Q;  1IZ6 A;  4CKB A;  2KOL A;  5EWE A;  3Q8S B;  1V9P A;  1E4E A;  4QWD A;  1JMC A;  1J5E Q;  4DL4 A;  1ONL A;  1CQI B;  4I4T F;  4B3M L;  3RJ0 A;  5G3L F;  1Q81 C;  2ZXR A;  1FJG L;  2Y0S G;  2IHF A;  5H1S E;  5JUM A;  1GLV A;  5DG9 A;  4KHP H;  3BVG A;  5HGT A;  1WTO A;  2H1E A;  2FPI B;  4MAM A;  2FMM A;  4EQO A;  1T3N A;  4KY5 A;  2R93 H;  3S14 H;  3VMM A;  1K1S A;  2NU7 B;  2D5D A;  1S72 A;  1G51 A;  1WTR A;  3I2Z A;  4J6H A;  1NSN S;  2PQA A;  4CJ1 B;  1M8A A;  3GTG B;  4OWX B;  5A2Q L;  5AJ3 L;  1K83 H;  2JK8 A;  4C5B A;  4C3H G;  3QB3 A;  3V4Z A;  1TY2 A;  4PMC A;  3PW0 A;  3NBH A;  4GKK H;  1CM9 A;  2KCN A;  5E3F A;  5JJL A;  3D4R A;  3R93 A;  2KEE A;  1KJ9 A;  3N41 B;  4R7R A;  4LAA A;  1SE4 A;  1BO0 A;  1HCZ A;  5JVH 3;  1TWC H;  5GAE C;  1PH6 A;  2W6P A;  3I4M H;  2R7Z G;  5IP7 H;  1ET6 A;  2R8J A;  5LYJ F;  3OSO A;  3FKI A;  4JBM A;  2NVX B;  1EYZ A;  5JEA G;  1T5E A;  2FHT A;  4N8X 1;  3M9N B;  1F2M A;  1E2W A;  3J80 c;  3RD4 A;  1LTI D;  4O3N A;  4I7Z C;  3FDT A;  3CQZ A;  4EFB A;  2W9B A;  1BXR A;  2K52 A;  2TSS A;  1RIP A;  2F03 A;  2UXB Q;  5HBR B;  3SK5 A;  4F8M A;  3IKJ A;  4DV6 H;  1E2V A;  2VW9 A;  3KHR A;  3J81 j;  1RD9 D;  3GTM B;  5LXT F;  3J7A K;  4XIG S;  2OXP A;  3V6J A;  4NXN H;  2FMC A;  1H9M A;  2R3Z A;  2NBF A;  5EKL A;  1EL0 A;  5KYL A;  3HGB A;  1X3G A;  5IE8 A;  4OIK A;  5IYD H;  1S4Z A;  3LNN A;  5FD5 A;  3DM1 A;  1V1Q A;  4QUC A;  5C44 B;  2KCT A;  5M3M H;  1I7L A;  4XQN A;  1PMR A;  5M9O A;  3W2D A;  4DL2 A;  2GN5 A;  2ZXO A;  2HCC A;  3OHA A;  1S5F D;  1N33 H;  1Q8K A;  4IUP A;  5BR8 Q;  2WB1 B;  1VQ4 A;  4QUF A;  3MXU A;  4QIW A;  4CBV A;  4L8J A;  1BGW A;  2RBM A;  4RNN A;  3J7Z C;  1A0I A;  4CC6 A;  3X3M A;  4GN4 B;  2K75 A;  2FB9 A;  3FMA A;  4FP5 D;  5ELO A;  1E4G T;  4JI2 L;  3UE1 A;  5IGC A;  1CKM A;  3W5O A;  1KD1 C;  3S15 B;  2JA8 B;  4GLV B;  1A8V A;  3H3V I;  5KFW A;  4DR2 L;  2EPB A;  3GQB A;  2KA7 A;  3ULP A;  5JJZ A;  3HOU G;  4GNX C;  2SNS A;  1O75 A;  2PW7 A;  4GOP B;  4ZHQ F;  4FBT A;  1WCM H;  3F8T A;  4AYB B;  1DD2 A;  3OIQ A;  1BCP B;  3KF8 A;  2UUA Q;  2KCC A;  4C3H B;  1K8O A;  4ED8 A;  2JE6 I;  4LUZ A;  3I91 A;  1I4G A;  1IL2 A;  1STG A;  4BY7 G;  1IBK Q;  2A68 D;  2OT2 A;  2DJF C;  4LF8 H;  1SLJ A;  1PH9 A;  3S17 H;  1PH7 A;  1I4Q A;  1Z2O X;  1ESF A;  3MXN A;  3FPU B;  4JPB W;  2L55 A;  2EYL A;  3I3C A;  4ME6 A;  1JB7 A;  4YHH H;  2Z9H A;  3KF6 B;  3BVZ A;  4L6T B;  3G6V A;  1OXX K;  2XCP A;  2F52 A;  1EU3 A;  3EIV A;  4RUA A;  3H3V H;  1PFN A;  4JK1 C;  4QY7 A;  1SNO A;  2SDF A;  5IGD A;  2W57 A;  3GTK H;  2F4I A;  3ULL A;  4LF5 Q;  3HOV H;  3MXG A;  4DR1 L;  4J9L A;  4EGQ A;  4RB0 A;  5EKK A;  4LFB L;  1M6V A;  3PO3 G;  3MR2 A;  2AQ3 B;  3HZX A;  3TRZ A;  5LMN W;  4DK6 C;  1OXT A;  4GLX A;  4ZUJ A;  1HTL D;  5KG0 A;  2XTI A;  1LYL A;  4MV3 A;  4J9S A;  4B3S Q;  4DK1 A;  4AQY Q;  1KEE A;  1QIL A;  4DK0 A;  2YU9 H;  4NP5 A;  5CV9 A;  1A62 A;  3EN2 A;  1N32 Q;  2IX0 A;  3M4Q A;  4YHH L;  1Y1W B;  4ZLT F;  2PVP A;  4IR1 A;  1F9R A;  3N44 B;  2K7V A;  1LTS D;  3RZD H;  1DV1 A;  2NN6 I;  4JI6 H;  2RDH A;  2WIN B;  4NB3 A;  4YWM A;  5IOC A;  3ERS X;  1LT5 D;  3HOW G;  3KLR A;  4RGO S;  1C3O A;  4ECZ A;  4C3H H;  1K8M A;  1HNW L;  5KT3 A;  1A3U A;  3RTX A;  2KBN A;  1W6K A;  4CHT B;  3VYT A;  2F4V H;  4KMU C;  1NJI C;  1E0B A;  2O03 A;  3ZJY C;  2NVT H;  1K1Q A;  4DR6 H;  2NVT B;  1EOT A;  1F77 A;  1XPR A;  5FK9 C;  2K28 A;  1UE7 A;  2KVM A;  4OO1 H;  4YJ2 F;  3GTG A;  2JXM B;  1GUT A;  5JEA J;  5CBA E;  5JQW A;  1GKH A;  1HZ9 A;  1KDB A;  2EYM A;  3C2P A;  1AH9 A;  1N32 L;  1HXY D;  2VPS A;  5BN3 A;  3K0Y A;  3UDI A;  1SCU B;  2R7D A;  1PFS A;  3CCS A;  1KC8 C;  1YNN D;  2E5L H;  4DUY L;  1HZA A;  1STN A;  5C3E B;  4GNX B;  4UP7 A;  1FJG Q;  1CSP A;  2F0J A;  1KJ8 A;  3K3P A;  4ECV A;  1G6P A;  4BY7 B;  1SDF A;  1WI5 A;  4GOP A;  1AZQ A;  1NR4 A;  3K5O A;  4KLK A;  1J6Q A;  3S1R B;  2D62 A;  1OXS C;  1TWF B;  5LMN H;  4J9K A;  3OMC A;  1STE A;  2AGO A;  1H9K A;  3MEF A;  1RJR A;  3GTQ B;  1DGS A;  1N36 H;  3VR4 A;  5HV6 A;  4GOP C;  4DAY A;  1B53 A;  2Q2U A;  2MO1 A;  1C0A A;  1DV2 A;  3EYY A;  2UXC L;  3GIL A;  2F0Q A;  1MSG A;  5JAV A;  1IKL A;  5M3M B;  1M90 C;  5EZY F;  2OF1 A;  1EY9 A;  4K8I A;  2W6M A;  3PW2 A;  4GC7 A;  3K80 C;  3A8J E;  4A3L H;  3W1G A;  2NVQ B;  5IGB A;  1J8I A;  1F2Y A;  5DQG A;  1A2U A;  1V1P A;  3WDN A;  4IHJ F;  4X65 H;  3GTK A;  2FMA A;  1STY A;  2FXQ A;  3MEH A;  1TS2 A;  3TRE A;  4E6I A;  4JOI A;  1DCZ A;  1RK6 A;  4L5T A;  2V4R A;  2Q8T A;  3J81 W;  1L1O A;  4QB4 A;  5LHY 1;  2BOS A;  2GVA A;  2UXD H;  3MR6 A;  4YR3 A;  2XSC A;  3HOV B;  3I12 A;  4HNU A;  5DGA A;  1BBX C;  2ZDQ A;  1UUP A;  3R2T A;  2NUC A;  1E3P A;  2C9O A;  5J2U F;  3AFQ A;  3NEN A;  4GLA C;  5A2Q W;  1GHK A;  3EQL C;  1NUC A;  1PV4 A;  2C2E A;  1Y1W A;  1B50 A;  3R8B A;  4EQN A;  2AKW B;  2JA6 B;  2NVX A;  2DJG C;  3H40 A;  1WCM A;  2WTF A;  2QIL A;  4QMG A;  5E7N A;  3TS0 A;  3R5F A;  3CW2 C;  3S17 B;  4KKU A;  2MGS A;  4DUZ Q;  3HOZ B;  3QR8 A;  4Q0Y A;  2W9B B;  3ULJ A;  1YEZ A;  2PN1 A;  3T5H A;  1YVC A;  3HOY G;  5F2D A;  2QEX A;  2GA4 B;  4LH6 A;  4KN4 C;  1A63 A;  5DAU A;  4CKC A;  2B63 H;  5KGU A;  4X6A H;  4RH6 A;  1LM0 A;  1O7I A;  1S5B D;  1D6E C;  3Q2O A;  3MXN B;  3SHL A;  4FU0 A;  1G8Z D;  1I7N A;  2CWA A;  3AYH B;  4R8N A;  3STB C;  4BBR H;  4DNT B;  3F2C A;  4U7C A;  5DLG A;  5KFP A;  4QF4 A;  3HOW H;  2F0I A;  3AFP A;  2Z8L A;  2XD4 A;  3OPO A;  5KFH A;  2KQ3 A;  3T5K A;  3KF6 A;  2L12 A;  1YI2 A;  4WFN 3;  3PW5 A;  4A3D B;  4KJN A;  4DV1 H;  1PH3 A;  5COY A;  1SSO A;  2LXJ A;  2ZJT A;  4L5Q A;  2BR0 A;  3IFD A;  2E8G A;  4OGQ C;  5IGF A;  1VBG A;  4JOI C;  4APV A;  3MWY W;  4ED3 A;  4QIW B;  4LFA Q;  3TSS A;  4DNI A;  4FXD A;  3SEB A;  4DF7 A;  4RB2 C;  3PF4 A;  5M5X B;  4AQY H;  5KFG A;  4DAY B;  3ETJ A;  3NTK A;  5M5X H;  1BDO A;  2MCT A;  2E2H H;  4DR5 H;  1VDZ A;  1GUS A;  4JI4 L;  4DV3 L;  3SGI A;  4LF4 L;  2VUM B;  4A3J B;  4NDX A;  3GV3 A;  4MTD A;  3CCE A;  3V05 A;  3J80 L;  4JV5 H;  3ORQ A;  5C4Z A;  4AYB A;  4XZ3 B;  4IPG A;  4DV4 Q;  1XDN A;  3J80 i;  3RF2 A;  1ICW A;  2BDO A;  1KC7 A;  3HOZ H;  1UAP A;  1QVG A;  4LF5 H;  3N40 P;  4HQ6 A;  2W6Q A;  2JA5 A;  1S9F A;  1BOS A;  4APM A;  4A3B H;  1VQB A;  4EVO A;  2UU9 L;  5BN5 A;  5I47 A;  4NXN L;  2EDG A;  1UEA B;  4J1M A;  4KK7 A;  4OON A;  3FRP B;  5BR8 H;  3KDF B;  1D2B A;  3P20 A;  3GTP A;  4RHS A;  3BAB A;  2NUA B;  4QGU A;  1N8R C;  4HSV A;  3T1Y H;  2YW2 A;  3K5H A;  3FMC A;  4A3I H;  1KRS A;  5FD6 A;  5KFE A;  3I4M B;  4JI4 H;  4LF4 H;  4DAM A;  5KFS A;  1NCV A;  2X6L A;  2ZM6 Q;  1PYW D;  4QL5 A;  4EGV A;  5HGQ A;  2ZJR A;  4RAY A;  2BDN A;  3I4L A;  1TWC A;  4HTH A;  1L0X B;  2EJF C;  4PZ7 A;  3VR6 A;  5M5W H;  2E2I H;  3H0G B;  5ELD A;  4C3J G;  4POF A;  5KFR A;  4LF5 L;  4DV6 Q;  4RUC A;  4DV5 Q;  1IXR A;  4YJ3 F;  3V4S A;  2NVY A;  4QWB A;  5BPH A;  3BA8 A;  3CCJ A;  1WYD A;  4DV4 H;  2F0V A;  3AEV A;  4C1N K;  1UC8 A;  4MIU A;  4X3U A;  1PYS B;  3CME A;  1AUV A;  3QIA A;  3K7A B;  3CRK C;  4MV9 A;  1PX2 A;  1QWY A;  4O0A A;  4TUY F;  4A3L G;  3N6X A;  3K7A H;  5LA6 F;  5KFL A;  4DV0 H;  1JDB B;  5A35 A;  2XCL A;  1LTT D;  3A7A B;  2KHS A;  2VB2 X;  2R8H A;  5I6W A;  2DGY A;  3F8N A;  5C44 H;  4G3I A;  1D7Q A;  3GD7 A;  3LP8 A;  5J1Z A;  1Q3L A;  5KT2 A;  1S10 A;  4CDE C;  4A3B B;  3GTP H;  5K36 H;  1Q1E A;  1STB A;  4YWK A;  4G7H C;  2Y0S E;  1XNQ L;  5EKI A;  1L1O B;  4A3B G;  1XMO Q;  2ZDG A;  4AH6 A;  1N36 Q;  1Z9F A;  2R8K A;  1F9P A;  5KT5 A;  1MI2 A;  2PI2 E;  3RV4 A;  1IBM H;  1TAE A;  4F7X A;  1SFO A;  4A3C H;  4XTC S;  2SEB D;  1KAB A;  1MD2 D;  2B2V A;  4BBS G;  3TBI B;  5C4X B;  4LF7 H;  4GNX A;  4FNF A;  2XC9 A;  2UVW A;  4MV8 A;  3CCV A;  3HOX G;  1K28 A;  3E6Z X;  1PH2 A;  3RNU A;  1B3A A;  3K3V A;  5KG6 A;  3GQC A;  3M7G A;  3KBG A;  4X62 L;  1OO9 B;  1Z6H A;  3GV6 A;  1QOH A;  4M1U B;  5L1K A;  4DA2 A;  2J6T A;  1N34 L;  3GTQ A;  1GO3 E;  3LX0 A;  2UVU A;  1KAW A;  4BBR B;  3AQQ A;  1WTQ A;  2UUA L;  4F4Y A;  2KHI A;  3Q6S A;  2B63 G;  3TZU A;  4C2M H;  4C3I B;  5C5L A;  4JI3 H;  4OO1 I;  1PHJ A;  1NMG A;  5KG2 A;  2K03 A;  3PGZ A;  4Z9C B;  1ZXT A;  3RLF A;  3WNZ A;  2BQU A;  1EY6 A;  1XTD A;  4DR3 Q;  2NU9 B;  4JI5 Q;  1B3Q A;  4EBD A;  1V1P B;  3LWE A;  3MA2 B;  3S9W A;  2YRW A;  2N78 A;  5G3L D;  3KHH A;  3HOW B;  2WKD A;  1LAB A;  2WE6 A;  5C3E G;  1ENC A;  3EBE A;  1V4Y A;  1TT2 A;  2UXD Q;  2J9G A;  5CA1 F;  2D2C C;  1LT4 D;  3PV0 A;  1TWC B;  3KFU A;  2Z6K C;  4ABN A;  1QVF A;  3J7A F;  3CC2 A;  2VA2 A;  1SFO H;  2NVY H;  3RR5 A;  4A3C G;  4KY6 A;  4UCO A;  3M9O B;  4YAK B;  3NGD A;  2NVY B;  2B2T A;  2EYH A;  2NZO A;  4UY8 C;  3PO2 H;  2CW8 A;  1P8L A;  4HJ8 A;  2YZM A;  4IUU A;  1AP0 A;  2VA3 A;  3MZ5 A;  2L1B A;  4FXG C;  1PTO F;  2RCF A;  3OMG A;  1H9S A;  3T56 B;  3I4N H;  4U67 3;  2K5N A;  1N9W A;  3PN1 A;  4C5A A;  1HR0 L;  1N56 A;  2JA6 A;  3G6J B;  4IFD H;  3SXH A;  3GO5 A;  5DLQ E;  1HUM A;  3CCU A;  2AWO A;  4ZAI A;  1TXY A;  2K05 A;  3KYH C;  1LO5 D;  2F0O A;  4B3M Q;  1PTO D;  2DNE A;  4P74 A;  3MC0 B;  3DHQ A;  4Q43 A;  1S0M A;  5KFA A;  1SYD A;  2BH8 A;  4JI3 Q;  1TVX A;  3O13 A;  4V19 0;  1UWV A;  1B6S A;  4IJL A;  1OXU A;  1HJP A;  5EJW A;  3NBI A;  2PQA B;  1YHQ A;  3E0E A;  4X66 H;  1SYE A;  3A74 A;  2BCO A;  3F2U A;  3VR2 A;  3K58 A;  3RLN A;  4JI5 H;  3OWE B;  1BQQ T;  1S3O A;  1CQF A;  2MPM A;  4FBU A;  5CV8 A;  1RF2 D;  3T51 B;  1GJX A;  1WR2 A;  1XMO H;  2HUG A;  4DR5 Q;  1NTG A;  2KJX A;  2V1C C;  2YV5 A;  4JI4 Q;  4LF4 Q;  2DPI A;  4HJ7 A;  5IYB G;  4ETS A;  1S97 A;  3RZO B;  2JSO A;  4MNO A;  3KOJ A;  1XNR Q;  4HJ9 A;  5KG7 A;  1HR0 H;  2IHE A;  2X69 A;  4JV0 A;  4K14 A;  2JQO A;  1IBL H;  5T1G A;  3KHG A;  5L1I A;  1EYC A;  2K14 A;  2RVL A;  3OOC A;  2UVR A;  4A3I G;  3QG1 A;  5JVG 3;  3U9S A;  2B39 A;  3GTQ H;  1ET9 A;  2K32 A;  3ERQ A;  2RDG A;  2R7N A;  1PTO B;  2EYJ A;  2PI2 A;  3KAJ A;  5C5M A;  1E2Z A;  4ZUI A;  4F50 A;  2QEJ C;  5HUR A;  4NXM L;  1VQN A;  4DL7 A;  4OL7 A;  3ONA B;  2VUM G;  1UE1 A;  1H9J A;  2LFN A;  2LS0 1;  3G71 A;  2ICE C;  2WB1 G;  2WDT A;  1GUO A;  4ZQI A;  3KHL A;  3OYY A;  5CR3 A;  1O7L A;  2PW5 A;  1AE2 A;  2A19 A;  3BQ0 A;  2R6G A;  1SYG A;  2N88 A;  3RBD A;  4EEQ A;  2E5L Q;  4ZRZ A;  1SNM A;  2PCF B;  2WAQ E;  4G7Z C;  3RAX A;  3DLL A;  2K50 A;  1YIT A;  3LGJ A;  4A3E G;  2JA5 B;  4JI1 H;  4HIO A;  1VQC A;  2A1A A;  3URY A;  3NK9 A;  1KXL A;  5LMU L;  4ECR A;  5L1J A;  1VQ8 A;  1EY8 A;  4LWC A;  3QOJ A;  3BVM A;  4KY7 A;  1HNX Q;  3GTP B;  4GKK L;  3PO3 H;  4DR7 H;  5LL6 S;  5IGG A;  3OSP A;  5ELF A;  3LWU A;  2HD3 A;  4NXM H;  4C1N I;  2CQY A;  3NWT A;  5CC4 A;  3T1Y L;  1H9S B;  2XIW A;  4DV1 L;  1VQL A;  3HOV G;  3PMF A;  4YY3 H;  2D9U A;  3N52 A;  1VQ6 A;  1Y1V B;  3SDZ A;  2LKV A;  5C44 G;  2IY5 B;  2XGT A;  2E5L L;  4DUY H;  4HJ5 A;  4ECX A;  1WD1 A;  5H80 A;  1PA6 A;  4K0K H;  2ATW A;  5IGE A;  4TV9 F;  4PV1 C;  3KF8 B;  3OHX C;  1KRT A;  2N3S A;  1PTO H;  4K2K A;  1Y8N B;  2A5H A;  1B1Z A;  1ICF B;  4DFA A;  2YZG A;  2LY7 A;  4ZOL F;  1AE3 A;  3IRB A;  5IWA Q;  2MQH A;  2HVQ A;  1X55 A;  2LSS A;  1DOM A;  1JCK B;  2Z6B A;  1N36 L;  2ASJ A;  4EBC A;  4DV3 H;  3EPG A;  4JV2 A;  1EIH A;  4IAL A;  1N33 Q;  3UFX B;  5KFB A;  1JIH A;  1B2T A;  1VF5 C;  1K83 A;  1Q12 A;  4FF4 A;  4DL5 A;  4J8Q A;  2H5X A;  4DN4 M;  1I50 A;  5I2Y A;  1YJ9 A;  2HIX A;  4A3K B;  3A8I E;  4A3D H;  2D0P A;  2IPK D;  4KHV A;  4O42 A;  1WTW A;  2FLL A;  2LXK A;  1U9R A;  3TZD A;  4DV7 L;  4LF9 Q;  3VR5 A;  1A3V A;  3L4K A;  3GIM A;  3FP9 A;  3CMA A;  3R3O A;  1BJT A;  3OHB A;  1IOV A;  2L15 A;  2TMP A;  2RSO A;  4DV2 L;  1STH A;  5D1P A;  3I4N B;  1F2Z A;  4CDC C;  2JYO A;  3BZC A;  2HVS A;  1LTB D;  4YP3 A;  5KFD A;  3GV8 B;  1PZI D;  2Q2H A;  2O5I C;  1HTP A;  1SFO B;  5I2X A;  2CZG A;  2XIG A;  1GOZ A;  3NTH A;  4JI8 L;  1I6V C;  4WJ4 A;  2B2V C;  1RTO A;  1X65 A;  3FPP A;  1JIC A;  4IOC A;  4I7H A;  1GUN A;  1KJJ A;  4FDB A;  5KX5 F;  1C4Q A;  3PUV A;  1OTC A;  2G9H D;  1BNZ A;  2HT1 A;  4A3K G;  1IYV A;  3GV5 B;  4GN5 A;  4LF6 H;  2K04 A;  3EJI A;  2R93 B;  3CF5 A;  3HB9 A;  4JVZ A;  1JR0 D;  1J9O A;  2F0T A;  3T1H L;  2MFI A;  4O4H F;  1FJG H;  4X64 H;  3RB4 A;  3ND9 A;  1IYJ B;  1XWE A;  1QCB D;  3KK7 A;  4DV4 L;  1PH4 A;  2UUB Q;  3OWF A;  3T5J A;  5JPN C;  3K57 A;  3FHW A;  3S24 A;  2IX1 A;  4ZCK A;  5DM7 3;  3Q24 A;  2F0D A;  2VL6 A;  3DM3 A;  3Q1K A;  3VYR A;  4XYM B;  4PMW A;  3I4N G;  2ATL A;  4ZKC B;  2A73 B;  1VQ7 A;  4XYL B;  5T14 A;  5C3X A;  5C4J B;  4TKO B;  2SCU B;  3PO2 G;  1CTM A;  1IYU A;  5C6A A;  1X32 A;  2J0T D;  1E7Z A;  2MP1 A;  5D3I B;  5ELB A;  1DJR D;  4IFD I;  5CAE B;  3G6E A;  4A3E H;  4IZ8 A;  2G5D A;  3G8C A;  1IOW A;  3HXL A;  1JJC B;  1TU2 B;  1C30 A;  1PH5 A;  4FYD A;  5C3E H;  2O5J C;  3PF5 A;  4RZR A;  1HPC A;  4IR9 A;  3TP7 A;  4LFB H;  2VOB A;  4B3T H;  4ZYS A;  2XGP A;  1RYS A;  3N8D A;  2WAQ G;  4OEL B;  2V4Q A;  4ECQ A;  2Z1C A;  4UDU C;  2C5C A;  2PZU A;  4LF7 L;  4AYB G;  3V6K A;  1I4X A;  4A93 H;  4TQU S;  3RUP A;  5JEA H;  4EEY A;  4OX9 L;  2JEF A;  1UEB A;  2OQK A;  1WSC A;  4TV8 F;  4Q8E A;  3GTO A;  1E1T A;  4DR5 L;  3DWA A;  4DAP A;  1EY4 A;  2B2T C;  2ID0 A;  4X64 Q;  4XT3 B;  5KFV A;  2JJQ A;  2BH2 A;  2IA6 A;  5DQH A;  5CMD A;  2B3G A;  1EY5 A;  3GTK B;  1EZ1 A;  2CHB D;  1U5K A;  2KUM A;  1M1K C;  1CE8 A;  4P71 A;  1K0S A;  2IP4 A;  5DG7 A;  2QGQ A;  2C22 A;  1WFQ A;  1XX8 A;  4JBW A;  4X3K A;  4GZY C;  3BDC A;  1BCP D;  5DGB A;  1G6Z A;  1CFM A;  3TDQ A;  3KLS X;  1JQY D;  2HDM A;  5GQO A;  2WII B;  2R6F A;  4O2A F;  5C8Y F;  2XCA A;  2SOB A;  1NR2 A;  2F3I A;  1U4L A;  2A68 C;  4RCN A;  4ZKB B;  1N32 H;  1LTG D;  1IBL Q;  3OUZ A;  5HY6 A;  5KG1 A;  3RIZ A;  4DV5 H;  4JBK A;  4MV4 A;  2RGR A;  4JYA H;  2Q8I B;  4ME5 A;  3TQ1 A;  2L0C A;  3CCQ A;  1Q86 C;  1L2Z A;  3W3A A;  1I5F A;  3U58 A;  2PMZ A;  4O4I F;  4H13 C;  1KHI A;  1PRT F;  1WCM B;  4RKB A;  1HFN A;  2GPW A;  1B6R A;  3GIK A;  5LMN L;  1C9O A;  2KSW A;  2HHH Q;  4K5X A;  5DNF A;  1MKH A;  3NQI A;  4BA2 I;  1J5E L;  3SE7 A;  4GKJ Q;  4EQP A;  3FKI G;  4OXP A;  3MWM A;  2DN8 A;  2OLS A;  1GGO A;  1EY0 A;  4DV6 L;  4R4C A;  1SEI A;  2AQ1 B;  2OEO A;  3MTS A;  1BXT A;  1SE8 A;  1F9S A;  1U4M A;  1W6J A;  3B6Y A;  2RSN A;  4CKE A;  4DV1 Q;  3JAM W;  2Z0S A;  1TQO A;  2ZTC A;  5KIX A;  1VQG A;  4RZQ A;  3PZP A;  1MBY A;  2O4X A;  1GM5 A;  1GHJ A;  1CHP D;  1RTN A;  3RN5 A;  3R5X A;  3LML A;  1B4O A;  2CW0 C;  2QW7 A;  3V96 A;  1DXM A;  3D4W A;  3HOU H;  2BQ3 A;  5M3F G;  3CQZ H;  4DAV A;  4JV5 Q;  1EQR A;  2KHJ A;  1CA6 A;  4C56 C;  4JI0 Q;  4FS1 A;  2NTS A;  1JJ2 A;  1WTP A;  2UXD L;  1EIF A;  2UUC L;  1GUW A;  3CP0 A;  5F9L A;  1T94 A;  2R7Z B;  5C0X H;  4R8U A;  3VYU A;  2JEB I;  1VKZ A;  3PO2 B;  4CC5 A;  2W7O A;  3GP7 A;  5M5W B;  2R7M A;  1XNQ Q;  1K0R A;  2K4K A;  1QNK A;  1YNJ D;  1OXV A;  4IPC A;  4H0L C;  4O1N A;  4EG0 A;  4Q45 A;  4A3J G;  5IT9 E;  1Y1W H;  3M4O H;  2F0U A;  4JI1 Q;  4XQJ A;  2Y0S A;  2KEN A;  4F4Z A;  2VUM A;  2E2H B;  3RZD B;  4BXX H;  4HSP A;  5J39 A;  5JVD F;  4A3M G;  4LUO A;  4RCO A;  3H09 A;  3JRW A;  1JE4 A;  1YNN C;  1EYD A;  1KNA A;  1BBW A;  2JA5 H;  4BWS C;  4Q0F A;  4IUV A;  2OCE A;  4F4X A;  4C3I H;  1N34 H;  3BG3 A;  2R7F A;  4YCV A;  2E2D C;  5C4H A;  3DWP A;  2F4V L;  1IW7 C;  2R85 A;  4M9U A;  5KT6 A;  1VQK A;  3GV7 B;  4B3R H;  3A54 A;  1WD0 A;  3PO3 B;  1I6H B;  4I50 F;  4EFE A;  1O80 A;  3KDF A;  1K83 B;  1AUX A;  3ICE A;  1ZEQ X;  3J80 E;  2FK1 A;  4A2B A;  1SMY C;  4JV1 A;  1I50 B;  2AWN A;  1Q7Y C;  3M9B A;  3K59 A;  4DUZ H;  2OQ0 A;  2MJ8 A;  2V5A A;  3ITP A;  5KRU A;  1M0W A;  4DR4 L;  4I55 F;  4K5V A;  4LF8 Q;  1M0T A;  3JC6 6;  3P1H A;  4EX5 A;  3UDG A;  1D1I A;  5IP7 G;  2R82 A;  2DZD A;  3AU7 A;  3C3L A;  1S0O A;  1YHB A;  3PUZ A;  2B2U C;  1E22 A;  3NUC A;  2ZM6 L;  4NMZ A;  4YB8 B;  5IOD A;  3TIN A;  3H0G A;  1KAA A;  3T5L A;  1ZYR D;  4NKL A;  2AMC B;  1HZB A;  1JDE A;  3TII A;  2VQF L;  3LWB A;  2W7P A;  4BBR G;  2YS7 A;  1PFM A;  2DY8 A;  3M4P A;  2GLT A;  1TR5 A;  4DV2 Q;  3FDS A;  4O3S A;  5KNB A;  5KFC A;  4JI8 H;  5IT9 W;  2B63 A;  2RDI A;  2Q2I A;  2WB1 E;  2EOT A;  3SI8 A;  2PZW A;  3PIP 3;  2R93 G;  3M4O B;  2IBK A;  3GLK A;  5KFI A;  2NZH A;  4NLG A;  2FLN A;  2YYZ A;  3GTO B;  2ZT9 C;  1XMQ Q;  2R92 G;  5C0X J;  3C46 A;  2UUB H;  4LF6 L;  5DQI A;  1ZQ7 A;  4UCR A;  1B44 D;  3MWD A;  2EVB A;  3RV3 A;  3DWQ A;  4BBS B;  4DR4 H;  1TS4 A;  5EWF A;  4XDX A;  2N8N A;  5EWG A;  3BAA A;  4MZ9 A;  2F0H A;  4XXE A;  3S2H B;  1VF7 A;  5C3W A;  4FVM A;  4A3D G;  1VS0 A;  1IKM A;  1PRT B;  4B3T Q;  1RL2 A;  3BZD B;  1D5M C;  2C35 B;  2M2L A;  4DR2 Q;  2R7Z A;  5FPR A;  3G6X A;  1TS3 A;  1Y8O B;  3PUY A;  4H02 A;  4IAJ A;  4B3S H;  2AUK A;  1CUK A;  1Y8P B;  4C3J B;  2JA9 A;  4JG2 A;  3WO0 A;  4ECY A;  3BA9 A;  4J9N A;  1W2B A;  3AB9 A;  3VPB A;  1L0Y B;  5FLM G;  4ZK9 B;  2GPS A;  2CQA A;  4RKL A;  5BN4 A;  2ENB A;  3PIP A;  1D5X C;  2E2H A;  3RFC A;  4IZO A;  1EWI A;  3HOZ G;  4LF6 Q;  4OWW B;  1PLF A;  2PMZ B;  3F2B A;  1JB3 A;  1DYQ A;  3PW7 A;  2H4O A;  3A8K E;  3NTI A;  2WAC A;  2IMW P;  2AU0 A;  3NWS A;  1CI3 M;  4ECW A;  2YS6 A;  2B2W C;  2EYF A;  3A7L A;  5KFY A;  1B9M A;  5L9X A;  3ORR A;  1JOO A;  1PRT D;  1X54 A;  2BE5 D;  3E9I A;  1JOR A;  4RB3 C;  4ECS A;  2I07 B;  1RJT A;  4R4I A;  4MHE A;  2UXC H;  4OX9 H;  2DWC A;  2NN6 G;  1ASZ A;  2AHO B;  5KG5 A;  1SRO A;  2W9C A;  1T9H A;  1KLG D;  1LTA D;  1X6O A;  1BVS A;  2K33 A;  3E5S A;  3T1H H;  5KFJ A;  4IJH A;  1HNZ L;  5CBE E;  2WYO A;  2B2W A;  2R7Z H;  5LMN Q;  1T36 A; 
#chains in the Genus database with same CATH homology
 2IT1 A;  4MNO A;  1NY4 A;  3KOJ A;  4KHZ A;  3UE1 A;  4HJ9 A;  4JI2 L;  1CKM A;  1XNR Q;  4LFC Q;  1Q1B A;  2IHE A;  3W5O A;  1KD1 C;  2JQO A;  3CC4 A;  5IP9 H;  5GAG C;  4GLV B;  4IFD J;  2ALY B;  1A8V A;  2K14 A;  4ALP A;  3H3V I;  4DR2 L;  3J81 i;  4DUY Q;  3OTO Q;  4A3I G;  3ULP A;  3GTQ H;  4DR6 Q;  3HOU G;  4GNX C;  3CC7 A;  4HIM A;  3GTM H;  4BXX G;  3I55 A;  2PMZ E;  4GOP B;  4BY1 H;  1WCM H;  3F8T A;  4OO1 G;  2PI2 A;  3E9H A;  4NPS A;  2UUA Q;  4QIW E;  3M85 A;  2ES2 A;  4NXM L;  2JE6 I;  3F2D A;  1VQN A;  4LUZ A;  5GAD C;  2CCZ A;  2VUM G;  2VUM H;  1UE1 A;  1IL2 A;  4IPD A;  5IYC G;  3HOY H;  3ER0 A;  3S1Q H;  1K3R A;  3G71 A;  4BY7 G;  3T1Y Q;  1VQM A;  1IBK Q;  2WB1 G;  4HID A;  1N33 L;  2QA4 A;  1SLJ A;  2Z6K A;  3OYY A;  1PH9 A;  1HNZ Q;  1PH7 A;  2JEA I;  1AE2 A;  3S17 H;  1HR0 Q;  2A19 A;  3D31 A;  2R6G A;  3BU2 A;  4JV5 L;  4DR7 Q;  3CPW A;  1JB7 A;  1KQS A;  2E5L Q;  3HFZ B;  2WAQ E;  1PH1 A;  2CFM A;  3KF6 B;  1I6H H;  2EQS A;  3DLL A;  1OXX K;  5M3F H;  1NE3 A;  2K50 A;  4Y7N H;  3S1M H;  2F52 A;  4AIM A;  3EIV A;  5IYB H;  1YIT A;  1XPO A;  3LGJ A;  3UDF A;  4DV7 Q;  4A3E G;  4JI3 L;  4LF9 L;  4QY7 A;  3GTG H;  1EFW A;  3H3V H;  4JYA Q;  4HIO A;  1VQC A;  4BBS H;  2A1A A;  2I5H A;  1KXL A;  5LMU L;  4YCW A;  5IWA L;  3GTK H;  4A75 A;  3ULL A;  2OTL A;  4LF5 Q;  3HOV H;  1VQ8 A;  1SN8 A;  1YIJ A;  4DR1 L;  4LWC A;  2JA8 G;  2NVX H;  1HNX Q;  5BR8 L;  4GKK L;  3PO3 H;  4LFB L;  3PO3 G;  2K5V A;  5FLX c;  3TRZ A;  4YWL A;  5LMN W;  4DK6 C;  1OXT A;  3T1Y L;  3L0O A;  1IBK L;  4GLX A;  1VQ5 A;  2UXB L;  3D0F A;  1VQI A;  4DV1 L;  1R9T H;  1VQL A;  3HOV G;  2RF4 A;  2XTI A;  1LYL A;  4B3S Q;  1VQ6 A;  5FJ8 G;  1LUZ A;  4AQY Q;  2YU9 H;  5C44 G;  2IY5 B;  2UXC Q;  2XGT A;  1A62 A;  3A5Z B;  3EN2 A;  1Y1V H;  2IX0 A;  2E5L L;  1N32 Q;  3M4Q A;  4HJ5 A;  4IO9 A;  3H0G H;  1Y1V G;  1VQ9 A;  1PA6 A;  2ATW A;  4YHH L;  3TEH B;  5M5Y H;  4IFD G;  3RZD H;  4JI0 L;  3KF8 B;  2NN6 I;  1KRT A;  2N3S A;  4YWM A;  4NB3 A;  3HOW G;  3ERS X;  3HKZ G;  4C3H H;  1AE3 A;  3IRB A;  5IWA Q;  1HNW L;  2MQH A;  4NXM Q;  2KBN A;  4PG3 A;  1X55 A;  2LSS A;  2VQE Q;  1VQO A;  1N36 L;  1NMF A;  2RHQ B;  2EXD A;  1NJI C;  2ZTD A;  3ZJY C;  2NVT H;  2VZA A;  1N33 Q;  3HKZ E;  1XPR A;  4OX9 Q;  1Q12 A;  1UE7 A;  2H5X A;  1VCI A;  4DKA C;  1WCM G;  2NVQ H;  4BY1 G;  2CQO A;  5JEA J;  1YJ9 A;  2HIX A;  1IBM L;  1PVO A;  1L0W A;  1GKH A;  4JI2 Q;  1HZ9 A;  4RMF A;  1XNR L;  4A3D H;  1AH9 A;  1N32 L;  2D0P A;  3UDI A;  1LTL A;  2I5M X;  2LXK A;  2R7D A;  1PFS A;  4YHH Q;  3CCS A;  4DV7 L;  1KC8 C;  3HOX H;  2Q2T A;  4LF9 Q;  1MJE A;  4DUY L;  1HZA A;  4JYA L;  4GNX B;  3FP9 A;  4UP7 A;  2GVB A;  3CMA A;  4JI7 L;  1CSP A;  1FJG Q;  1G6P A;  1Q82 C;  1WI5 A;  4GOP A;  2L15 A;  4DV2 L;  1TWF H;  4KLK A;  1J6Q A;  1VQP A;  2D62 A;  3BZC A;  1OXS C;  5IYC H;  4GS3 A;  4GKK Q;  2Q2H A;  4DUZ L;  2PNH A;  2OWO A;  3MEF A;  3S2D H;  5ELN A;  4A4I A;  4KHP L;  1DGS A;  4JI8 L;  3J81 c;  4PZ8 A;  5JJK A;  4WJ4 A;  1IBL L;  1X65 A;  4IOC A;  2RHS B;  4KI0 A;  4GOP C;  4FDB A;  4J15 A;  5GAH C;  3PUV A;  2Q2U A;  2MO1 A;  1C0A A;  2K5H A;  4B3R Q;  1OTC A;  2UXC L;  3L7Z C;  4X66 L;  2HT1 A;  4A3K G;  3STB D;  4GN5 A;  1YJN A;  5EAY A;  1M90 C;  3CF5 A;  3NEM A;  1B70 B;  4UP9 A;  3T1H L;  4B3T L;  2MFI A;  1I3Q H;  3K80 C;  4A3L H;  3W1G A;  1UE5 A;  1IYJ B;  4OWT B;  4JI7 Q;  1PH4 A;  4DV4 L;  2UUB Q;  3A5U A;  3VDY A;  2FXQ A;  5LMU Q;  3FHW A;  3S24 A;  2IX1 A;  3I56 A;  2VL6 A;  1X3F A;  3DM3 A;  3PUW A;  3TRE A;  4A3M H;  4PMW A;  4JOI A;  1K8A C;  3I4N G;  4L5T A;  3GTJ H;  1I50 H;  2VNU D;  1VQ7 A;  3GDE A;  3KLW A;  4LF7 Q;  4JBJ A;  1S40 A;  1L1O A;  4LFA L;  3CXC A;  3PO2 G;  2GVA A;  4KHP Q;  5C4J H;  2YTV A;  1E7Z A;  4C3J H;  3Q8D A;  3UE0 A;  1XMQ L;  4IFD I;  3CAM A;  1E3P A;  3JAM i;  3G6E A;  4A3E H;  1X3E A;  1JJC B;  3AFQ A;  3NEN A;  4GLA C;  2B29 A;  1PH5 A;  1CKO A;  2JA5 G;  3PCO B;  5C3E H;  3PF5 A;  1PV4 A;  3I4O A;  1EUJ A;  4GN3 B;  1E24 A;  2AKW B;  3BZK A;  3PIO A;  1HZC A;  2UUC Q;  4LNQ A;  5E7N A;  3TS0 A;  3CW2 C;  2WAQ G;  4JC0 A;  4DUZ Q;  2R92 H;  3CCL A;  3ULJ A;  1YEZ A;  2VS1 A;  2YTX A;  4R4Q A;  4DV0 L;  1YVC A;  3HOY G;  4LF7 L;  4AYB G;  4DV5 L;  2QEX A;  2UU9 Q;  4A93 H;  1A63 A;  4TQU S;  2B63 H;  4K0K L;  4OX9 L;  4X6A H;  1UEB A;  1LM0 A;  2OQK A;  1O7I A;  4UPA A;  4JI6 Q;  1E1T A;  4DR5 L;  4B3R L;  4P73 A;  2ID0 A;  4X64 Q;  3MXN B;  2ASB A;  4JCV E;  2CWA A;  3AYH B;  1QUQ A;  3STB C;  4BBR H;  2JJQ A;  3F2C A;  2BH2 A;  4UP8 A;  2B3G A;  3HOW H;  3AFP A;  1CKN B;  1U5K A;  3H15 A;  1X9N A;  4ME3 A;  3KF6 A;  5C0X I;  1M1K C;  1YI2 A;  4P71 A;  4DPG A;  4YY3 Q;  1UE6 A;  3OTO L;  2QGQ A;  4DR6 L;  3H0G G;  1PH3 A;  3K8A A;  2LXJ A;  1XPU A;  1WFQ A;  4JBW A;  4GKJ L;  4L5Q A;  3NEL A;  5FJ8 H;  5GQO A;  3RZO H;  2E8G A;  1FGU A;  4JOI C;  4APV A;  1ASY A;  4LFA Q;  2F3I A;  3K7U C;  3S1R H;  4DNI A;  1VQH A;  4JI8 Q;  1XMO L;  1I94 Q;  1IBL Q;  3G48 A;  4RG1 A;  2I5L X;  5HY6 A;  4IPH A;  4R4T A;  3PF4 A;  4A3G G;  4K0K Q;  4JBK A;  2JA8 H;  4DAY B;  5M3M G;  5M5X H;  1BBU A;  3CCQ A;  1MJC A;  3BJU A;  1Q86 C;  1I5F A;  3U58 A;  4LF8 L;  5GRO A;  5IYD G;  2E2H H;  1L1O C;  3U50 C;  4JI4 L;  1KHI A;  3SGI A;  4DV3 L;  1K8G A;  3TQY A;  4LF4 L;  4POG A;  3CCE A;  1BKB A;  3T1H Q;  2RCN A;  5LMN L;  1C9O A;  1VQF A;  4DK3 C;  2HHH Q;  1PYB A;  3CD6 A;  2CWP A;  4Y52 H;  3RN2 A;  1MKH A;  4IPG A;  4P72 A;  4DV4 Q;  3J80 i;  1HR0 W;  3CCR A;  1J5E L;  2UUB L;  4BA2 I;  1H95 A;  4GKJ Q;  1TWA H;  3HOZ H;  3CCM A;  1QVG A;  3FKI G;  2VQF Q;  4OXP A;  2N49 A;  1YBY A;  4R4O A;  3GTO H;  3G4S A;  2F4V Q;  4DV6 L;  4R4C A;  4A3B H;  1VQB A;  2UU9 L;  1SE8 A;  5J3B A;  4PZ6 A;  1VQD A;  3B6Y A;  4NXN L;  4A93 G;  4DV1 Q;  2Z0S A;  4OON A;  4L5S A;  3CPF A;  4X64 L;  3KDF B;  2ZTC A;  1KIX A;  1VQG A;  1CKN A;  1YHA A;  1TWG H;  4B3S L;  1GM5 A;  4AQY L;  4QGU A;  1SRU A;  1G29 1;  3RN5 A;  1N8R C;  2ZTE A;  1JE5 A;  2JA6 G;  3I4M G;  4A3F G;  3HOU H;  4DR3 L;  3S15 H;  5M3F G;  3K0X A;  4A3I H;  1KRS A;  3CQZ H;  4DV3 Q;  4JV5 Q;  4YY3 L;  2DUD A;  1P16 A;  2A8V A;  1EQR A;  2KHJ A;  1E1O A;  4JI0 Q;  4DAM A;  1EQQ A;  2CKZ B;  2EIF A;  1W3S A;  2ZM6 Q;  1JJ2 A;  4QL5 A;  1NBW A;  1EIF A;  3U4V A;  5HGQ A;  3CP0 A;  2ZJR A;  2UUC L;  2UXD L;  2JA6 H;  1HNW Q;  4X62 Q;  4A3J H;  1Y1W G;  2JEB I;  4PZ7 A;  5M5W H;  3TS2 A;  4BY7 H;  4BA1 I;  2E2I H;  2WFW A;  4YCU A;  4POF A;  4A76 A;  4LF5 L;  4DV6 Q;  1PH8 A;  1XNQ Q;  1K0R A;  2K4K A;  4DV5 Q;  1IXR A;  3JAM c;  4DR1 Q;  1OXV A;  4IPC A;  4X65 L;  2OTJ A;  3CCJ A;  1EOV A;  1WYD A;  1SMX A;  4LFB Q;  1V43 A;  4A3J G;  1Y1W H;  1QZH A;  4JI1 Q;  1U0L A;  1HH2 P;  5C0X G;  2KEN A;  3AEV A;  3M4O H;  1D8L A;  4DR4 Q;  4BXX H;  1B8A A;  1GD7 A;  4A3M G;  4LUO A;  1VQJ A;  4MTN A;  1PYS B;  3CME A;  3W1B A;  4P75 A;  4O0A A;  4JI5 L;  1EIY B;  2HHH L;  1BBW A;  2JA5 H;  4A3L G;  1FVI A;  2BA0 A;  3K7A H;  1QVC A;  2DGY A;  3NBH B;  2OCE A;  3HKS A;  3RLO A;  5C44 H;  4C3I H;  1C7Y A;  5JJI A;  1D7Q A;  4O2D A;  4R1J A;  3GD7 A;  1YNX A;  2R7F A;  4YCV A;  4A3K H;  3L2P A;  4L5R C;  2JA7 G;  2F4V L;  1Q46 A;  2MO0 A;  1VQK A;  3GTP H;  2ZJP A;  3OW2 A;  1YJW A;  1Q1E A;  4YWK A;  1SR3 A;  1JJG A;  3KDF A;  2Y0S E;  4A3G H;  1XNQ L;  1VQA A;  4NXN Q;  1L1O B;  4A3B G;  1TWH H;  4TVA B;  2VQE L;  1XMO Q;  4AH6 A;  1N36 Q;  1I94 L;  1Z9F A;  3ICE A;  4X65 Q;  2AWN A;  1Q7Y C;  3M9B A;  2PI2 E;  2OQ0 A;  2E2J H;  3FKI H;  2KCM A;  3KJP A;  4HIK A;  4A3C H;  4XTC S;  2JA7 H;  5AJ3 Q;  4DR4 L;  4X66 Q;  4LF8 Q;  4BBS G;  3JC6 6;  4QQB X;  4EX5 A;  4IOA A;  1CSQ A;  4AYB E;  3UDG A;  4GNX A;  5IP7 G;  3F1Z A;  1IBM Q;  1QZG A;  1IZ6 A;  4QJF A;  1YHB A;  3PUZ A;  1E22 A;  2UXD Q;  1V9P A;  2ZM6 L;  3CCV A;  3HOX G;  1GVP A;  1PH2 A;  3RNU A;  3J7A 5;  1JMC A;  2HQL A;  4DR7 L;  4LW1 A;  1J5E Q;  4X62 L;  2AMC B;  1HZB A;  4B3M L;  2VQF L;  1WJJ A;  1Q81 C;  1FJG L;  2Y0S G;  2IHF A;  4BBR G;  5H1S E;  3S1N H;  1YZ6 A;  3M4P A;  5IY0 A;  1N34 L;  4DV2 Q;  1GO3 E;  5FLM H;  1MIU A;  1KAW A;  2UUA L;  3AQQ A;  2KHI A;  2Q2I A;  2WB1 E;  2B63 G;  1JT8 A;  4C2M H;  2R93 G;  2R93 H;  3S14 H;  4JI1 L;  4OO1 I;  1S72 A;  1PHJ A;  1G51 A;  1NMG A;  1Y14 B;  2NZH A;  2YYZ A;  3I2Z A;  3K81 C;  3PGZ A;  1K9M C;  1XMQ Q;  2PQA A;  3U4Z A;  5C0X J;  2R92 G;  3RLF A;  1EYG A;  4LF6 L;  4OWX B;  3PUX A;  5AJ3 L;  1K83 H;  2JK8 A;  1XTD A;  4DR3 Q;  4JI5 Q;  3A0J A;  2BA1 A;  5JJL A;  2N8N A;  2N78 A;  4MZ9 A;  5IP9 G;  3PSI A;  1X56 A;  1B7Y B;  5C3E G;  4A3D G;  3EBE A;  1TWC H;  1VS0 A;  3UDX A;  5GAE C;  4A3F H;  1PH6 A;  4B3T Q;  3I4M H;  3S2H H;  1RL2 A;  5IP7 H;  2R7Z G;  2C35 B;  4DR2 Q;  3PV0 A;  3KFU A;  5C4X H;  3PUY A;  2Z6K C;  4H02 A;  4WJ3 M;  1QVF A;  4JBM A;  1CUK A;  5JEA G;  3CC2 A;  2JA9 A;  4JG2 A;  2NVY H;  3RR5 A;  1SFO H;  4A3C G;  1W2B A;  3J80 c;  2NZO A;  1HNX L;  4UY8 C;  2D0O A;  1P8L A;  4HJ8 A;  3PO2 H;  3I7F A;  5FLM G;  4JI6 L;  2K52 A;  3PIP A;  3I4N H;  1RIP A;  2UXB Q;  4LUV A;  1EWI A;  3HOZ G;  4LF6 Q;  2K5N A;  1N9W A;  2VW9 A;  4OWW B;  1FL0 A;  1HR0 L;  3F2B A;  3J81 j;  4XIG S;  4EQ5 A;  3GO5 A;  5DLQ E;  4LFC L;  3CCU A;  2AWO A;  1TXY A;  2WP8 J;  3KYH C;  3KJO A;  1X3G A;  5IE8 A;  4B3M Q;  4P74 A;  5IYD H;  2BH8 A;  1V1Q A;  1N34 Q;  4JI3 Q;  3M7N A;  2HIV A;  2YTY A;  2KCT A;  1UWV A;  5M3M H;  1X54 A;  3E9I A;  2MNA A;  4IJL A;  1XJV A;  1L2F A;  1OXU A;  2VY3 A;  4R4I A;  1K73 C;  4HJA A;  1HJP A;  3S16 H;  2PQA B;  2GN5 A;  3E0E A;  2NN6 G;  1YHQ A;  3A74 A;  1ASZ A;  2AHO B;  1SRO A;  3RLN A;  2ZJQ A;  1T9H A;  4DV0 Q;  1Q8K A;  1X6O A;  5BR8 Q;  1WOC A;  1QUQ B;  1BVS A;  1S3O A;  1VQ4 A;  5K36 G;  4IJH A;  1HNZ L;  1VQE A;  3WWV A;  2I0Q A;  3GTL H;  1Z47 A;  3J7Z C;  1A0I A;  4DR5 Q;  1KL9 A;  1NTG A;  2V1C C;  2YV5 A;  2K75 A;  4GN4 B;  5IT9 c;  4JI4 Q;  4LF4 Q;  5C4X G;  2R7Z H;  4HJ7 A;  5IYB G;  5ELO A;  5LMN Q;  3M3Y H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...