2FK3A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk3A00
2FK2A 2FK1A 2FJZA 4PWQA 2M05A 3KTMA 2FK3A 2FKLA 2FMAA 1OWTA
chains in the Genus database with same CATH superfamily
4DL2A 5LA6F 4DR3H 1AN7A 4RAYA 3GTOA 4MTDA 3KHGA 3T5KA 1HR0H 3MR5A 2W71A 1TWHA 3L4KA 3RAXA 1K1SA 5KFGA 4RZRA 3KHLA 1V9PA 3G6YA 2RDIA 3RTXA 2W9BA 1JXLA 2JEFA 2W6QA 3Q8RB 1C3OA 4U7CA 3JRXA 4J9KA 1E4GT 2CKZB 1M6VA 5HBRB 3HOXG 1EYZA 3J81W 2JA6G 5EZYF 1V4YA 4QWCA 4DR1H 4ECUA 4RZQA 4GC7A 5FPOA 4YR3A 3H40A 4JI8H 5L9XA 3GTPA 4O4LF 2CW7A 2NVYA 1PK8A 4A2AA 4EBCA 3RB6A 5KT5A 2WDTA 4GC6A 3Q1KA 4MV4A 1WH2A 3AYHB 4ME6A 5C3EG 2DLNA 2SCUB 4MV1A 3SE7A 2W7OA 5BPFA 4HYKA 4F4WA 2IA6A 4O3NA 2R93A 2DIKA 2FP4B 3IN5A 2CW8A 3K5IA 3GV8B 4UCSA 4OX9H 4BWSC 3R5XA 4DUYH 2FPGB 3H0GG 3OUUA 4Q43A 1C30A 4FU0A 1SCUB 2R8KA 4O3PA 3HOWG 2NU7B 1I3QA 5KT2A 4LSXA 3H4DA 3I4MG 2YYAA 3R5FA 4CC5A 2V4RA 4JI4H 2BR0A 1VBHA 3MFIA 5KFCA 1VKZA 5KT4A 5IYCG 4YR2A 4DV0H 3E5NA 1ZHSA 3ETHA 3LP8A 3MWEA 3RFCA 4GLXA 2AGPA 1S9FA 2DZDA 4YAJB 3JAMW 3MWMA 4QWDA 1S0MA 4LMYA 1ZHQA 5IYBG 5EWGA 5IYZF 4XYMB 4JV5H 1E4EB 2UUAH 1ULZA 4HNTA 2C2DA 1S68A 4R7RA 2O03A 4O4HF 4BY1G 1EUCB 1Y14B 1N32H 4ZQIA 2W57A 2NU9B 2NU6B 2XCPA 4QW8A 5CA0F 2KSWA 2YZMA 3L2PA 3ORQA 4LFCH 2HVQA 3NGDA 1RJQA 4A3KG 2RGRA 1KJ9A 4X65H 4DL6A 5C1PA 5LMUH 3I4NG 4A3JG 3H3VH 4WBNF 3OHAA 2V59A 3BQ1A 4DL3A 4C5BA 4J0MA 1TWAA 2ZDHA 4F4ZA 4ED6A 2IMWP 4UCOA 5KG2A 5FLMG 2R82A 3K3VA 2UXBH 2DWCA 2R7LA 3HOUG 4IRKA 2JEIA 5KT6A 1K1QA 4DV7H 1AUVA 4A3LG 3U9TA 3KXYT 3BG5A 5D1OB 1L2ZA 3T5JA 1N56A 2W6ZA 4C2MA 3JSNA 3TINA 5DQHA 1BXRA 4FM9A 2HHHH 3PW2A 5KT3A 3QFFA 3PZPA 2V9WA 5HV6A 2WB1A 4DR7H 3T1YH 3GV5B 4IZOA 4RNOA 1CQJB 4EGQA 1XDNA 3FKIG 2ASDA 2UUBH 2AGOA 4UCTA 2JA5G 1TWCA 4JI0H 2YL2A 4M9UA 5LL6b 4A3IG 3KAKA 4JUZA 3V4SA 1N36H 4JI1H 2GLTA 1FJGH 2FPIB 4JI5H 1N33H 4DL5A 1GSHA 3M9OB 2J6SA 1I6UA 5DQGA 1J5EH 4E4TA 5KFBA 3GTLA 3ETJA 2PMZE 3RF2A 1DV2A 3GILA 4A3EG 4B3SH 3RB3A 2NVXA 2FK1A 3VMMA 4ECSA 2QK4A 4A3FG 3PW4A 4O4IF 2W9CA 4DR6H 4EFEA 3R23A 1B04A 1ZETA 2XGQA 1I7LA 1BJTA 5KFUA 4YAKB 4IRCA 5LXTF 3SI8A 2JA6A 4ECQA 3V6KA 2YRXA 5KKNB 2WAQA 5KFMA 1HNWH 3PW7A 1OWTA 3VPBA 1XMOH 3T1HH 2R86A 1Z2OX 4JI2H 1GO3E 1ZQ7A 5H80A 4YP3A 3BQ2A 1RK5A 5IWAH 5FD6A 4ED8A 2UU9H 5KG0A 5KFFA 3M4IA 3QZ8A 4X62H 2VQFH 1M7JA 4HNVA 4JI6H 4EFBA 3KTMA 2R7ZG 4DR5H 2MCTA 3RGZA 3GIIA 4TQRA 2JA8G 3N8DA 1TWFA 4GKJH 2IBKA 3Q8PB 4IRDA 2R85A 4M7EA 4LFBH 5FPRA 2W9AA 4QWEA 5KG4A 2ZJTA 4B3MH 2J9GA 4ED1A 1M0TA 3PVXA 2B63G 5IT9W 4JV0A 5EWFA 1S10A 2WB1E 3TIGA 2AQ4A 3L4JA 2RDJA 5FLXW 4YBZB 2YS6A 1AUXA 3C0FB 4J9QA 3RV4A 2R7MA 4EG0A 4A3GG 3N42B 2YCHA 4J9OA 3ORRA 2V58A 3N41B 1FVIA 2W6PA 1I50A 3HKZE 4UCUA 5KFQA 1RJRA 1TA8A 4BBSG 4HNUA 1BNCA 2GPWA 1T36A 4AQYH 1RJPA 4ZOLF 2JEJA 4APMA 5L1LA 4MV3A 4ED2A 3RB0A 1GYFA 5KFOA 3BA9A 2AU0A 1IOWA 4JI3H 1Y1WG 1RYSA 4ZHQF 4J9NA 3K5HA 3LMLA 5KFVA 4ED7A 5DLGA 2WAQE 2C22A 2CQYA 1S0NA 3RGXA 4JV1A 5C5JA 1IBLH 5CB4F 4MV7A 2NU8B 1S97A 4TV8F 4LF6H 2FK2A 4MA5A 4U6PA 2R7KA 4ECRA 5BR8H 3GIPA 5EDWA 4LF8H 2R8HA 4ED0A 4MTEA 3M9MB 3GIKA 4QJFA 2AGQA 1SFOA 4LF4H 5LOVF 1VS0A 1KJQA 5D1PA 4R8UB 4LF9H 5BPHA 2HJWA 4UFZA 4HR7A 2FMAA 2PN1A 5D8DA 3V6HA 3PO3G 4FS1A 4X66H 3OHBA 2FJZA 4B3TH 1GGOA 2R6FA 3HB9A 4ECZA 2FLLA 5KFDA 4BXXG 5C44G 3FKIA 4Q0YA 3TQTA 4J9PA 1V51A 4DL7A 4YY3H 2WE6A 2CZGA 1E4FT 4RB1A 2IP4A 2E2HA 3N40P 5C4XG 2WTFA 1E4EA 3EPIA 2UVRA 3BA8A 3PR5B 1P8LA 1O75A 2FLPA 3GTQA 1K83A 1TWGA 1EZ1A 4LSAA 2R92G 1KBLA 3BABA 5KFRA 4AYBA 4YHHH 2YZNA 3FMAA 3VPDA 5IYDG 3GQCA 2I87A 2QYZA 1JX4A 1SEIA 5A2QW 5DGBA 3T5HA 1JDBB 4YQWA 1GSAA 4UCRA 4XX0B 4DV3H 4QWAA 1WSCA 5JVDF 3TQ1A 2R8GA 4MA0A 3PO2G 2W8KA 5DG7A 2XD4A 3TIIA 3WNZA 2VA3A 4FBTA 4EEYA 4EBEA 3U9SA 4I55F 4FS2A 5DG8A 4LH6A 2J6UA 4O3RA 3Q2OA 2JEGA 2Q2UA 1KC7A 3HOYG 3I12A 4EGJA 2W7PA 4IWYA 5KG1A 4ECYA 5KT7A 5D1OA 2UVUA 3OSPA 5KFZA 2V5AA 1WCMG 2W8LA 3KHHA 1EHIA 4LF7H 5C1OA 2B63A 3V4ZA 2C28A 1N34H 4Q8EA 1A0IA 4QWBA 4A3BG 1RK6A 2I8CA 2C2RA 1EUDB 3GTKA 5C8YF 4RAZA 5LYJF 4LFAH 5KFXA 1HNZH 2YS7A 4O3QA 1MZBA 5KX5F 3DF7A 4DV5H 2W9BB 2X0SA 1BGWA 2VA2A 2Y0SA 1I7NA 4IHJF 1X9NA 4WD3A 3RJ0A 3BAAA 3RB4A 4O2AF 2ATLA 4RNNA 2E2IA 3BQ0A 4ECXA 2E5LH 2NUAB 4AYBE 5BMVF 4Y8VB 5T14A 5F9NA 4UCVA 3GV7B 2ZM6H 1CQIB 3G6VA 1KJJA 3H0GA 3WO0A 4J9MA 2ALZA 4DV1H 3KALA 2GPSA 3EYYA 4TUYF 5KFIA 1Y1WA 3JSLA 4YR0A 2FK3A 2YZGA 3N43B 2XC9A 2FLNA 1R9TA 2J6TA 2XGPA 3MR2A 5LMNH 3MWDA 5KFNA 4EYHB 1XNRH 1VBGA 4A93G 1KJIA 3PN1A 4RUAA 5LP6F 1UNNC 3OSNA 4MAMA 3RBDA 5KFHA 2UUCH 5KFLA 1CE8A 5GONF 1KEEA 5IP7G 4YB8B 3H20A 2ASJA 1Y1VG 4JI7H 3J7AK 2JA7G 3RV3A 1GSOA 3GLKA 5L1KA 2DPJA 2VUMG 2ZDQA 4ED3A 2VUGA 5KG7A 3GTMA 4LH7A 1T3NA 2XCAA 3RUPA 4HQ6A 3N44B 3UQ8A 1Z2PX 5EWEA 3RBEA 2FE3A 1S03G 2VQDA 1IOVA 3GIQA 3J80W 5DLFA 4F4YA 1JLLB 2ASLA 1HNXH 4IAJA 4XZ3B 4F4XA 4IWXA 2C00A 5DG9A 4GKKH 2HGSA 5IP9G 1I94H 4YJ2F 1DGSA 4RB2C 2UVWA 2YW2A 4I7HA 5KG3A 2VOBA 4DLKA 4QW9A 3PR4A 5K2MA 4EBDA 3GTJA 4NLGA 4CC6A 2UXDH 4L1KA 4EEQA 2W6NA 2XCLA 2WYOA 2Y0SE 3T5LA 5DQIA 4X64H 1IBMH 4QIWA 3PW5A 1KJ8A 5KG5A 1Z2NX 3OTOH 3HXLA 2RGVA 1VAJA 2VPQA 1A9XA 2UXCH 4O2BF 1IBKH 2UVVA 1B33N 5DGAA 1PX2A 2R92A 5FD5A 4MV6A 1B6SA 2W6OA 2YRWA 4NXNH 4BY7G 2BQ3A 5CA1F 2FPPB 2DPIA 4BBRG 3FDSA 2OWOA 3CQZA 3KAJA 2BQRA 5I47A 1XNQH 3M9NB 5L1IA 4A3DG 1B6RA 3RIZA 4PWQA 2ZDGA 4DV2H 2W6MA 4YJ3F 2JA5A 2R7NA 2FB9A 5F9LA 5KFKA 1M0WA 4XYLB 3IG0A 3K3PA 3QZ7A 3Q8QB 2VR1A 2R93G 4ECWA 1DIKA 4JV2A 4I4TF 2PMZA 3JRWA 4A3MG 2OLSA 5JUMA 5J2UF 1JIHA 5KFSA 3R5HA 5EOYA 4FBUA 3UFXB 1GLVA 3N6XA 4R8UA 4TQSA 4IR9A 1S0OA 2F4VH 1WCMA 3H4BA 4NXMH 1UC8A 3GTGA 3PW0A 1JDEA 3MR3A 3VPCA 1RYRA 1TAEA 3MJFA 1T94A 4RB0A 5KFWA 5KG6A 4DV4H 3G8CA 4A3CG 3Q8SB 3V6JA 3CVZA 4DV6H 4O3SA 4I50F 5FJ8G 2XIGA 3GIMA 4J9RA 4F50A 3RAQA 2PVPA 1XMQH 4B3RH 2C2EA 1WR2A 4Q45A 5JQWA 5CAEB 4QIWE 1UC9A 2R8JA 5JH7F 3MFHA 2HVSA 2W9CB 5KFTA 4TV9F 2HVRA 2R7ZA 4ZI7F 2YU9A 1W96A 1SYXB 2W70A 4MV9A 3LWBA 2Q2TA 3WO1A 5KFYA 4ETSA 2R84A 4RUCA 5L1JA 4RB3C 2VQEH 4ECTA 3OUZA 3KHRA 4J9SA 2RF4A 4DR2H 1N48A 4DR4H 5J2TF 5KFEA 3MR6A 4RNMA 4KHPH 3JZIA 4JYAH 1FKAH 1W93A 2I80A 5KFJA 4C5CA 3BJYA 4EYIB 4Q44A 2V4QA 2OH2A 2C35B 5KFAA 4G3IA 2P0AA 3HOVG 4A2BA 2VPSA 3G6XA 2R8IA 3HKZA 2BQUA 3GIDA 5JVLA 3F8NA 4DUZH 1DV1A 2R87A 4ECVA 4DL4A 4LF5H 1CS0A 4J9LA 4PDBA 1Y1VA 4RU9A 4MV8A 4K0KH 2JA7A 3GIJA 2FKLA 2VUMA 3HBLA 5KFPA 4IR1A 2M05A 1JKJB 3EPGA 3HOZG 2PBZA 4Q8FA 4C5AA 4O3OA
chains in the Genus database with same CATH topology
2FK2A 2FK1A 2FJZA 4PWQA 2M05A 3KTMA 2FK3A 2FKLA 2FMAA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK2 A;  2FK1 A;  2FJZ A;  4PWQ A;  2M05 A;  3KTM A;  2FK3 A;  2FKL A;  2FMA A;  1OWT A; 
#chains in the Genus database with same CATH topology
 4DL2 A;  5LA6 F;  4DR3 H;  1AN7 A;  4RAY A;  3GTO A;  4MTD A;  3KHG A;  3T5K A;  1HR0 H;  3MR5 A;  2W71 A;  1TWH A;  3L4K A;  3RAX A;  1K1S A;  5KFG A;  4RZR A;  3KHL A;  1V9P A;  3G6Y A;  2RDI A;  3RTX A;  2W9B A;  1JXL A;  2JEF A;  2W6Q A;  3Q8R B;  1C3O A;  4U7C A;  3JRX A;  4J9K A;  1E4G T;  2CKZ B;  1M6V A;  5HBR B;  3HOX G;  1EYZ A;  3J81 W;  2JA6 G;  5EZY F;  1V4Y A;  4QWC A;  4DR1 H;  4ECU A;  4RZQ A;  4GC7 A;  5FPO A;  4YR3 A;  3H40 A;  4JI8 H;  5L9X A;  3GTP A;  4O4L F;  2CW7 A;  2NVY A;  1PK8 A;  4A2A A;  4EBC A;  3RB6 A;  5KT5 A;  2WDT A;  4GC6 A;  3Q1K A;  4MV4 A;  1WH2 A;  3AYH B;  4ME6 A;  5C3E G;  2DLN A;  2SCU B;  4MV1 A;  3SE7 A;  2W7O A;  5BPF A;  4HYK A;  4F4W A;  2IA6 A;  4O3N A;  2R93 A;  2DIK A;  2FP4 B;  3IN5 A;  2CW8 A;  3K5I A;  3GV8 B;  4UCS A;  4OX9 H;  4BWS C;  3R5X A;  4DUY H;  2FPG B;  3H0G G;  3OUU A;  4Q43 A;  1C30 A;  4FU0 A;  1SCU B;  2R8K A;  4O3P A;  3HOW G;  2NU7 B;  1I3Q A;  5KT2 A;  4LSX A;  3H4D A;  3I4M G;  2YYA A;  3R5F A;  4CC5 A;  2V4R A;  4JI4 H;  2BR0 A;  1VBH A;  3MFI A;  5KFC A;  1VKZ A;  5KT4 A;  5IYC G;  4YR2 A;  4DV0 H;  3E5N A;  1ZHS A;  3ETH A;  3LP8 A;  3MWE A;  3RFC A;  4GLX A;  2AGP A;  1S9F A;  2DZD A;  4YAJ B;  3JAM W;  3MWM A;  4QWD A;  1S0M A;  4LMY A;  1ZHQ A;  5IYB G;  5EWG A;  5IYZ F;  4XYM B;  4JV5 H;  1E4E B;  2UUA H;  1ULZ A;  4HNT A;  2C2D A;  1S68 A;  4R7R A;  2O03 A;  4O4H F;  4BY1 G;  1EUC B;  1Y14 B;  1N32 H;  4ZQI A;  2W57 A;  2NU9 B;  2NU6 B;  2XCP A;  4QW8 A;  5CA0 F;  2KSW A;  2YZM A;  3L2P A;  3ORQ A;  4LFC H;  2HVQ A;  3NGD A;  1RJQ A;  4A3K G;  2RGR A;  1KJ9 A;  4X65 H;  4DL6 A;  5C1P A;  5LMU H;  3I4N G;  4A3J G;  3H3V H;  4WBN F;  3OHA A;  2V59 A;  3BQ1 A;  4DL3 A;  4C5B A;  4J0M A;  1TWA A;  2ZDH A;  4F4Z A;  4ED6 A;  2IMW P;  4UCO A;  5KG2 A;  5FLM G;  2R82 A;  3K3V A;  2UXB H;  2DWC A;  2R7L A;  3HOU G;  4IRK A;  2JEI A;  5KT6 A;  1K1Q A;  4DV7 H;  1AUV A;  4A3L G;  3U9T A;  3KXY T;  3BG5 A;  5D1O B;  1L2Z A;  3T5J A;  1N56 A;  2W6Z A;  4C2M A;  3JSN A;  3TIN A;  5DQH A;  1BXR A;  4FM9 A;  2HHH H;  3PW2 A;  5KT3 A;  3QFF A;  3PZP A;  2V9W A;  5HV6 A;  2WB1 A;  4DR7 H;  3T1Y H;  3GV5 B;  4IZO A;  4RNO A;  1CQJ B;  4EGQ A;  1XDN A;  3FKI G;  2ASD A;  2UUB H;  2AGO A;  4UCT A;  2JA5 G;  1TWC A;  4JI0 H;  2YL2 A;  4M9U A;  5LL6 b;  4A3I G;  3KAK A;  4JUZ A;  3V4S A;  1N36 H;  4JI1 H;  2GLT A;  1FJG H;  2FPI B;  4JI5 H;  1N33 H;  4DL5 A;  1GSH A;  3M9O B;  2J6S A;  1I6U A;  5DQG A;  1J5E H;  4E4T A;  5KFB A;  3GTL A;  3ETJ A;  2PMZ E;  3RF2 A;  1DV2 A;  3GIL A;  4A3E G;  4B3S H;  3RB3 A;  2NVX A;  2FK1 A;  3VMM A;  4ECS A;  2QK4 A;  4A3F G;  3PW4 A;  4O4I F;  2W9C A;  4DR6 H;  4EFE A;  3R23 A;  1B04 A;  1ZET A;  2XGQ A;  1I7L A;  1BJT A;  5KFU A;  4YAK B;  4IRC A;  5LXT F;  3SI8 A;  2JA6 A;  4ECQ A;  3V6K A;  2YRX A;  5KKN B;  2WAQ A;  5KFM A;  1HNW H;  3PW7 A;  1OWT A;  3VPB A;  1XMO H;  3T1H H;  2R86 A;  1Z2O X;  4JI2 H;  1GO3 E;  1ZQ7 A;  5H80 A;  4YP3 A;  3BQ2 A;  1RK5 A;  5IWA H;  5FD6 A;  4ED8 A;  2UU9 H;  5KG0 A;  5KFF A;  3M4I A;  3QZ8 A;  4X62 H;  2VQF H;  1M7J A;  4HNV A;  4JI6 H;  4EFB A;  3KTM A;  2R7Z G;  4DR5 H;  2MCT A;  3RGZ A;  3GII A;  4TQR A;  2JA8 G;  3N8D A;  1TWF A;  4GKJ H;  2IBK A;  3Q8P B;  4IRD A;  2R85 A;  4M7E A;  4LFB H;  5FPR A;  2W9A A;  4QWE A;  5KG4 A;  2ZJT A;  4B3M H;  2J9G A;  4ED1 A;  1M0T A;  3PVX A;  2B63 G;  5IT9 W;  4JV0 A;  5EWF A;  1S10 A;  2WB1 E;  3TIG A;  2AQ4 A;  3L4J A;  2RDJ A;  5FLX W;  4YBZ B;  2YS6 A;  1AUX A;  3C0F B;  4J9Q A;  3RV4 A;  2R7M A;  4EG0 A;  4A3G G;  3N42 B;  2YCH A;  4J9O A;  3ORR A;  2V58 A;  3N41 B;  1FVI A;  2W6P A;  1I50 A;  3HKZ E;  4UCU A;  5KFQ A;  1RJR A;  1TA8 A;  4BBS G;  4HNU A;  1BNC A;  2GPW A;  1T36 A;  4AQY H;  1RJP A;  4ZOL F;  2JEJ A;  4APM A;  5L1L A;  4MV3 A;  4ED2 A;  3RB0 A;  1GYF A;  5KFO A;  3BA9 A;  2AU0 A;  1IOW A;  4JI3 H;  1Y1W G;  1RYS A;  4ZHQ F;  4J9N A;  3K5H A;  3LML A;  5KFV A;  4ED7 A;  5DLG A;  2WAQ E;  2C22 A;  2CQY A;  1S0N A;  3RGX A;  4JV1 A;  5C5J A;  1IBL H;  5CB4 F;  4MV7 A;  2NU8 B;  1S97 A;  4TV8 F;  4LF6 H;  2FK2 A;  4MA5 A;  4U6P A;  2R7K A;  4ECR A;  5BR8 H;  3GIP A;  5EDW A;  4LF8 H;  2R8H A;  4ED0 A;  4MTE A;  3M9M B;  3GIK A;  4QJF A;  2AGQ A;  1SFO A;  4LF4 H;  5LOV F;  1VS0 A;  1KJQ A;  5D1P A;  4R8U B;  4LF9 H;  5BPH A;  2HJW A;  4UFZ A;  4HR7 A;  2FMA A;  2PN1 A;  5D8D A;  3V6H A;  3PO3 G;  4FS1 A;  4X66 H;  3OHB A;  2FJZ A;  4B3T H;  1GGO A;  2R6F A;  3HB9 A;  4ECZ A;  2FLL A;  5KFD A;  4BXX G;  5C44 G;  3FKI A;  4Q0Y A;  3TQT A;  4J9P A;  1V51 A;  4DL7 A;  4YY3 H;  2WE6 A;  2CZG A;  1E4F T;  4RB1 A;  2IP4 A;  2E2H A;  3N40 P;  5C4X G;  2WTF A;  1E4E A;  3EPI A;  2UVR A;  3BA8 A;  3PR5 B;  1P8L A;  1O75 A;  2FLP A;  3GTQ A;  1K83 A;  1TWG A;  1EZ1 A;  4LSA A;  2R92 G;  1KBL A;  3BAB A;  5KFR A;  4AYB A;  4YHH H;  2YZN A;  3FMA A;  3VPD A;  5IYD G;  3GQC A;  2I87 A;  2QYZ A;  1JX4 A;  1SEI A;  5A2Q W;  5DGB A;  3T5H A;  1JDB B;  4YQW A;  1GSA A;  4UCR A;  4XX0 B;  4DV3 H;  4QWA A;  1WSC A;  5JVD F;  3TQ1 A;  2R8G A;  4MA0 A;  3PO2 G;  2W8K A;  5DG7 A;  2XD4 A;  3TII A;  3WNZ A;  2VA3 A;  4FBT A;  4EEY A;  4EBE A;  3U9S A;  4I55 F;  4FS2 A;  5DG8 A;  4LH6 A;  2J6U A;  4O3R A;  3Q2O A;  2JEG A;  2Q2U A;  1KC7 A;  3HOY G;  3I12 A;  4EGJ A;  2W7P A;  4IWY A;  5KG1 A;  4ECY A;  5KT7 A;  5D1O A;  2UVU A;  3OSP A;  5KFZ A;  2V5A A;  1WCM G;  2W8L A;  3KHH A;  1EHI A;  4LF7 H;  5C1O A;  2B63 A;  3V4Z A;  2C28 A;  1N34 H;  4Q8E A;  1A0I A;  4QWB A;  4A3B G;  1RK6 A;  2I8C A;  2C2R A;  1EUD B;  3GTK A;  5C8Y F;  4RAZ A;  5LYJ F;  4LFA H;  5KFX A;  1HNZ H;  2YS7 A;  4O3Q A;  1MZB A;  5KX5 F;  3DF7 A;  4DV5 H;  2W9B B;  2X0S A;  1BGW A;  2VA2 A;  2Y0S A;  1I7N A;  4IHJ F;  1X9N A;  4WD3 A;  3RJ0 A;  3BAA A;  3RB4 A;  4O2A F;  2ATL A;  4RNN A;  2E2I A;  3BQ0 A;  4ECX A;  2E5L H;  2NUA B;  4AYB E;  5BMV F;  4Y8V B;  5T14 A;  5F9N A;  4UCV A;  3GV7 B;  2ZM6 H;  1CQI B;  3G6V A;  1KJJ A;  3H0G A;  3WO0 A;  4J9M A;  2ALZ A;  4DV1 H;  3KAL A;  2GPS A;  3EYY A;  4TUY F;  5KFI A;  1Y1W A;  3JSL A;  4YR0 A;  2FK3 A;  2YZG A;  3N43 B;  2XC9 A;  2FLN A;  1R9T A;  2J6T A;  2XGP A;  3MR2 A;  5LMN H;  3MWD A;  5KFN A;  4EYH B;  1XNR H;  1VBG A;  4A93 G;  1KJI A;  3PN1 A;  4RUA A;  5LP6 F;  1UNN C;  3OSN A;  4MAM A;  3RBD A;  5KFH A;  2UUC H;  5KFL A;  1CE8 A;  5GON F;  1KEE A;  5IP7 G;  4YB8 B;  3H20 A;  2ASJ A;  1Y1V G;  4JI7 H;  3J7A K;  2JA7 G;  3RV3 A;  1GSO A;  3GLK A;  5L1K A;  2DPJ A;  2VUM G;  2ZDQ A;  4ED3 A;  2VUG A;  5KG7 A;  3GTM A;  4LH7 A;  1T3N A;  2XCA A;  3RUP A;  4HQ6 A;  3N44 B;  3UQ8 A;  1Z2P X;  5EWE A;  3RBE A;  2FE3 A;  1S03 G;  2VQD A;  1IOV A;  3GIQ A;  3J80 W;  5DLF A;  4F4Y A;  1JLL B;  2ASL A;  1HNX H;  4IAJ A;  4XZ3 B;  4F4X A;  4IWX A;  2C00 A;  5DG9 A;  4GKK H;  2HGS A;  5IP9 G;  1I94 H;  4YJ2 F;  1DGS A;  4RB2 C;  2UVW A;  2YW2 A;  4I7H A;  5KG3 A;  2VOB A;  4DLK A;  4QW9 A;  3PR4 A;  5K2M A;  4EBD A;  3GTJ A;  4NLG A;  4CC6 A;  2UXD H;  4L1K A;  4EEQ A;  2W6N A;  2XCL A;  2WYO A;  2Y0S E;  3T5L A;  5DQI A;  4X64 H;  1IBM H;  4QIW A;  3PW5 A;  1KJ8 A;  5KG5 A;  1Z2N X;  3OTO H;  3HXL A;  2RGV A;  1VAJ A;  2VPQ A;  1A9X A;  2UXC H;  4O2B F;  1IBK H;  2UVV A;  1B33 N;  5DGA A;  1PX2 A;  2R92 A;  5FD5 A;  4MV6 A;  1B6S A;  2W6O A;  2YRW A;  4NXN H;  4BY7 G;  2BQ3 A;  5CA1 F;  2FPP B;  2DPI A;  4BBR G;  3FDS A;  2OWO A;  3CQZ A;  3KAJ A;  2BQR A;  5I47 A;  1XNQ H;  3M9N B;  5L1I A;  4A3D G;  1B6R A;  3RIZ A;  4PWQ A;  2ZDG A;  4DV2 H;  2W6M A;  4YJ3 F;  2JA5 A;  2R7N A;  2FB9 A;  5F9L A;  5KFK A;  1M0W A;  4XYL B;  3IG0 A;  3K3P A;  3QZ7 A;  3Q8Q B;  2VR1 A;  2R93 G;  4ECW A;  1DIK A;  4JV2 A;  4I4T F;  2PMZ A;  3JRW A;  4A3M G;  2OLS A;  5JUM A;  5J2U F;  1JIH A;  5KFS A;  3R5H A;  5EOY A;  4FBU A;  3UFX B;  1GLV A;  3N6X A;  4R8U A;  4TQS A;  4IR9 A;  1S0O A;  2F4V H;  1WCM A;  3H4B A;  4NXM H;  1UC8 A;  3GTG A;  3PW0 A;  1JDE A;  3MR3 A;  3VPC A;  1RYR A;  1TAE A;  3MJF A;  1T94 A;  4RB0 A;  5KFW A;  5KG6 A;  4DV4 H;  3G8C A;  4A3C G;  3Q8S B;  3V6J A;  3CVZ A;  4DV6 H;  4O3S A;  4I50 F;  5FJ8 G;  2XIG A;  3GIM A;  4J9R A;  4F50 A;  3RAQ A;  2PVP A;  1XMQ H;  4B3R H;  2C2E A;  1WR2 A;  4Q45 A;  5JQW A;  5CAE B;  4QIW E;  1UC9 A;  2R8J A;  5JH7 F;  3MFH A;  2HVS A;  2W9C B;  5KFT A;  4TV9 F;  2HVR A;  2R7Z A;  4ZI7 F;  2YU9 A;  1W96 A;  1SYX B;  2W70 A;  4MV9 A;  3LWB A;  2Q2T A;  3WO1 A;  5KFY A;  4ETS A;  2R84 A;  4RUC A;  5L1J A;  4RB3 C;  2VQE H;  4ECT A;  3OUZ A;  3KHR A;  4J9S A;  2RF4 A;  4DR2 H;  1N48 A;  4DR4 H;  5J2T F;  5KFE A;  3MR6 A;  4RNM A;  4KHP H;  3JZI A;  4JYA H;  1FKA H;  1W93 A;  2I80 A;  5KFJ A;  4C5C A;  3BJY A;  4EYI B;  4Q44 A;  2V4Q A;  2OH2 A;  2C35 B;  5KFA A;  4G3I A;  2P0A A;  3HOV G;  4A2B A;  2VPS A;  3G6X A;  2R8I A;  3HKZ A;  2BQU A;  3GID A;  5JVL A;  3F8N A;  4DUZ H;  1DV1 A;  2R87 A;  4ECV A;  4DL4 A;  4LF5 H;  1CS0 A;  4J9L A;  4PDB A;  1Y1V A;  4RU9 A;  4MV8 A;  4K0K H;  2JA7 A;  3GIJ A;  2FKL A;  2VUM A;  3HBL A;  5KFP A;  4IR1 A;  2M05 A;  1JKJ B;  3EPG A;  3HOZ G;  2PBZ A;  4Q8F A;  4C5A A;  4O3O A; 
#chains in the Genus database with same CATH homology
 2FK2 A;  2FK1 A;  2FJZ A;  4PWQ A;  2M05 A;  3KTM A;  2FK3 A;  2FKL A;  2FMA A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...