2FK3A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk3A00
2FK1A 4PWQA 2FK3A 3KTMA 2FKLA 1OWTA 2M05A 2FK2A 2FJZA 2FMAA
chains in the Genus database with same CATH superfamily
1N56A 2R7LA 3M4IA 3I4MG 5FD5A 4EYHB 5KFUA 4FM9A 3MWDA 5C3EG 1BGWA 5BPHA 4C2MA 4DUYH 4FS2A 1S97A 1CQIB 5C1OA 4JUZA 3H3VH 1T36A 2F4VH 3BQ1A 1XDNA 3H40A 3V6HA 5FPOA 3T1HH 2VUGA 3VPBA 4TV8F 1CS0A 4I4TF 4R8UB 3OSNA 1RK5A 1V4YA 2XCLA 3BABA 3UQ8A 2VQDA 4IZOA 4ECSA 2SCUB 5KG7A 2ATLA 4HNVA 3T5JA 2JA8G 4RB0A 5KFRA 2JA7A 2X0SA 5LOVF 4J9SA 3GILA 1AN7A 4O2AF 5FD6A 4UCUA 4ZI7F 5KFLA 1TWCA 1M7JA 3L4KA 3N6XA 1KJ8A 2CW8A 3KAJA 3TQ1A 5KT6A 5KT4A 1I7NA 3VMMA 2YZMA 5DG9A 4U6PA 3OHAA 3HOXG 1KJJA 4Q8EA 3GIMA 1V51A 1FVIA 3RUPA 1N48A 4ECVA 2Y0SE 2C00A 3GV7B 4J9KA 2XGPA 1DIKA 2W9CA 4M7EA 3L4JA 1J5EH 2JEGA 3G8CA 1BNCA 2PMZE 2E5LH 4YJ3F 2WDTA 4MV9A 2XCPA 2GPWA 4YR3A 2CZGA 3V6JA 1K1QA 5JUMA 4B3MH 4XYLB 5BR8H 1C30A 4KHPH 2W57A 4DL5A 1JX4A 1GLVA 4A3LG 1Y1WA 2YZNA 2NVYA 3JRWA 2YL2A 3TINA 3RAQA 1CE8A 3SI8A 2CKZB 3CQZA 1VBGA 4HNTA 1A9XA 5LP6F 4HNUA 5T14A 5F9LA 4EGJA 4JV2A 1IBLH 4YJ2F 4JI2H 5EWEA 2AGOA 4GLXA 3ORQA 4EYIB 4AYBA 3QFFA 2DIKA 5CA0F 4XYMB 4DR5H 2B63A 4IR1A 3IN5A 2Q2TA 4RAZA 4A3GG 3FKIA 3N43B 5KX5F 2VQFH 1TWHA 1X9NA 2FPPB 4GKJH 2E2HA 2YS7A 3G6VA 5H80A 2UUCH 3N41B 4G3IA 1T94A 5KFZA 4HYKA 2IMWP 3RGXA 2UVVA 4I55F 5L9XA 3KALA 4ED8A 2BQUA 1B04A 5KFOA 1W93A 2JA5A 2RF4A 4QWDA 1RJQA 4EBCA 4IWYA 4LFAH 3H0GG 5F9NA 4YHHH 4QW9A 2I8CA 4DR2H 3PN1A 5FPRA 2DLNA 2WAQA 4Y8VB 5BMVF 4C5CA 4DL2A 4FBUA 1Y1WG 2JEFA 4BBSG 1XMQH 2JA6A 2AQ4A 5HBRB 4U7CA 2I80A 2V58A 1EUDB 5KFVA 1GYFA 5DG7A 5K2MA 4UCVA 3BQ0A 1HNZH 3PW2A 1S68A 3ETJA 3KTMA 4JI5H 2JEIA 4F4ZA 4OX9H 2VPQA 4L1KA 2VA3A 1S0OA 1S0NA 1VBHA 3BA9A 4QIWA 1RYSA 2NU7B 2FLLA 5IYDG 4ED7A 4NXMH 5KFQA 3EYYA 5EWGA 3OUZA 1S9FA 3HOYG 2C35B 4MV7A 3F8NA 4I7HA 5GONF 2W8KA 1KBLA 1A0IA 3N44B 4NLGA 2DZDA 3H4BA 4A3EG 3HXLA 3OUUA 5DG8A 2V4RA 3LMLA 5KG5A 1S10A 4I50F 4Q45A 4EGQA 4LF5H 2W71A 5KG0A 2W8LA 4C5AA 5KFPA 3GLKA 4EBEA 5D8DA 3RB6A 4WBNF 2FPIB 3RBEA 3I4NG 2YYAA 5IP7G 5KFJA 4TV9F 2FK3A 4ZQIA 2RDJA 2AGPA 1GSAA 3GIDA 1WCMA 2HVQA 4UFZA 2R7KA 1RJRA 4HQ6A 3JSLA 5KT7A 3PW5A 2W6MA 2R92A 2BQRA 2V9WA 1BXRA 1SEIA 2O03A 3OTOH 4DV3H 2IA6A 2UUBH 3GTOA 1L2ZA 2DWCA 4AQYH 2Q2UA 1KJQA 3BA8A 3MR5A 5KT3A 2PBZA 3KAKA 4XZ3B 1ZETA 4DV1H 1VS0A 3RB4A 4JV0A 4GC7A 2FKLA 4DLKA 1EZ1A 4X66H 4ED6A 3JSNA 3T5HA 4ED0A 3HKZA 3UFXB 5C5JA 1KJ9A 4RUCA 4LFCH 3GTMA 3JAMW 4AYBE 3MWMA 4R7RA 3KXYT 2R8IA 2R93A 2YZGA 2FJZA 4NXNH 3N40P 4HR7A 4O4LF 2XCAA 2FPGB 3J80W 1SFOA 1ZHSA 4ECTA 4PDBA 1IBKH 4A2AA 4J9PA 1N32H 4J9QA 4YR2A 3K5IA 1B6RA 1Z2OX 3H20A 1IBMH 4X65H 1B33N 2V5AA 4MV6A 2FLNA 2UVWA 1GGOA 2R85A 1JXLA 1E4EB 1R9TA 4A3MG 4JI8H 3R5XA 5DGBA 4CC5A 3RV4A 1AUVA 1E4FT 4A2BA 4YAKB 1XNRH 2CQYA 2UXCH 1M6VA 4O4HF 4JI3H 4YR0A 1WH2A 5KFAA 2WAQE 4TUYF 1O75A 1W96A 2ZDQA 5L1LA 2VUMA 3GQCA 4EFBA 2W6PA 3GV8B 3AYHB 5IYZF 4X64H 5KG2A 3M9MB 2JA7G 4JV5H 2R8JA 1GO3E 4A3KG 3PVXA 4RNOA 5FLXW 4DL7A 5KFNA 1WR2A 2YU9A 2W6ZA 3MJFA 5DQGA 5BPFA 4BBRG 4EG0A 2HVRA 4LH6A 2VPSA 1EUCB 3HBLA 3RB0A 4Q44A 4GKKH 4QWBA 2XGQA 3GTQA 1K83A 3GIIA 4MTEA 1I50A 5LMNH 2W9CB 3G6XA 3G6YA 1P8LA 3RV3A 2XD4A 5KFFA 4F4YA 3R23A 5LA6F 2HJWA 3RJ0A 5DQIA 5IYCG 2C28A 5JQWA 4BY1G 2WB1A 1JDEA 1PK8A 2R6FA 2W70A 1HR0H 2J6TA 3WNZA 3QZ8A 1SYXB 3RB3A 2IBKA 3GIQA 4ECXA 4RB1A 1C3OA 5EWFA 3KHRA 1HNXH 2W7OA 4LF6H 2V59A 1TWFA 4ED3A 1E4GT 4UCOA 5C4XG 5KFKA 1UNNC 4ZOLF 4DL6A 5J2UF 2Y0SA 4A3IG 3RAXA 4ECZA 4IRKA 2FB9A 3EPIA 5L1KA 1ZHQA 5LXTF 5LMUH 2VQEH 4DR1H 2HHHH 4BXXG 1I94H 4ECYA 5D1PA 5KKNB 1FJGH 2C2DA 4A3FG 3WO0A 2W9AA 4FS1A 5IYBG 4JYAH 3Q8RB 1Y1VA 3Q8SB 4YP3A 2WTFA 2W9BB 4F4WA 1IOVA 5DGAA 3PR5B 1RYRA 2B63G 3RF2A 3HOVG 2PVPA 3FKIG 4LH7A 4JI0H 5KFWA 2NU8B 3OSPA 1N34H 4IRCA 5JVDF 4B3RH 3RBDA 5IP9G 4FU0A 3Q8PB 2I87A 4B3SH 4LF8H 4DR6H 4DL3A 3J7AK 4DV0H 4UCRA 2MCTA 2RGVA 4MA0A 2R84A 5KFHA 1K1SA 2JA5G 3GIJA 5KG3A 3LWBA 1I7LA 3PR4A 2GLTA 2HGSA 4R8UA 2FLPA 2R82A 2RGRA 3MR3A 3QZ7A 2JA6G 2ASLA 3PW7A 2W6NA 4DL4A 1FKAH 1GSHA 3LP8A 4Q8FA 4DR7H 4ECWA 1TWAA 5KFMA 4LF4H 1M0TA 2UU9H 3PO2G 4RAYA 2R7NA 3TIGA 4ZHQF 5IWAH 3K3VA 1IOWA 2XIGA 1KEEA 3MFIA 3KHHA 3JZIA 1KC7A 1TAEA 1VKZA 5KFCA 2UVUA 3V6KA 4LFBH 3RIZA 2FMAA 4DR4H 4MV3A 1UC8A 1WSCA 2QK4A 3Q8QB 3T5KA 1PX2A 4DR3H 2C22A 4O3SA 1T3NA 3K3PA 5D1OB 3WO1A 4RUAA 2NU6B 4QWAA 4ECRA 4JI6H 2RDIA 1B6SA 4EFEA 3MR6A 4IHJF 4UCSA 2W7PA 4ED1A 4DV6H 4APMA 1OWTA 4RZQA 2WE6A 4MV1A 4QW8A 5KFEA 5KFYA 1Y14B 1S03G 5I47A 2DPJA 1E4EA 4XX0B 5C8YF 5L1JA 2AU0A 5KG1A 3CVZA 4PWQA 3E5NA 1SCUB 4RNMA 5CA1F 4A3DG 1Z2PX 2VR1A 1JLLB 3GTJA 4JI4H 3KHGA 4YBZB 5EZYF 1WCMG 4MTDA 2WB1E 3C0FB 2ZJTA 3BJYA 2R92G 5HV6A 2V4QA 5KFIA 2NU9B 1MZBA 3L2PA 2ZM6H 4EBDA 2AGQA 1XNQH 5C1PA 2R7MA 1HNWH 3JRXA 4ETSA 4K0KH 1CQJB 3ORRA 4J9LA 3Q2OA 3EPGA 4IR9A 4EEYA 5KFXA 3I12A 5JVLA 5LL6b 3TQTA 1N36H 4RB2C 2FE3A 4F50A 4QWCA 4M9UA 5LYJF 2C2RA 4B3TH 4Q0YA 5JH7F 1I3QA 4A93G 4MV8A 5EOYA 3M9OB 4BY7G 1ZQ7A 3BAAA 4QIWE 2R93G 4F4XA 5FLMG 4IWXA 4ECQA 3GTGA 2R7ZA 3H0GA 1EYZA 2P0AA 1I6UA 3V4ZA 2M05A 4YQWA 1DV1A 3N8DA 4FBTA 4QJFA 1XMOH 4RU9A 2FK1A 3PW0A 5KFSA 2HVSA 4MAMA 4TQSA 4DUZH 4YY3H 4J9OA 2FK2A 2R8HA 3DF7A 4O2BF 4IRDA 5L1IA 4JI1H 1V9PA 2BQ3A 2PN1A 1TWGA 3GIPA 4LSAA 3R5FA 2QYZA 4O3NA 4MA5A 3RTXA 3BG5A 3K5HA 1N33H 4J9NA 1UC9A 1JKJB 4RZRA 4J0MA 1JDBB 4GC6A 2DPIA 2JEJA 5KFDA 1EHIA 5C44G 2VUMG 2R86A 5KG4A 3VPDA 4LMYA 4LSXA 5J2TF 3J81W 2W9BA 4JV1A 3Q1KA 4RB3C 1KJIA 2UUAH 3BQ2A 3GTLA 4E4TA 2YRWA 3IG0A 4YB8B 4Q43A 2NVXA 2XC9A 2UVRA 3FMAA 5A2QW 3T5LA 3GTKA 4CC6A 3HOZG 2R8GA 3ETHA 1VAJA 5KFTA 2R87A 4A3BG 4O3OA 4DV7H 2PMZA 5CB4F 4QWEA 4YAJB 4DV2H 4LF9H 5FJ8G 3HOUG 4O3QA 2R7ZG 3MR2A 4ED2A 4C5BA 3GV5B 3MWEA 4JI7H 3SE7A 4ECUA 1TA8A 2YS6A 4RNNA 3HKZE 4UCTA 3T1YH 1RJPA 4TQRA 3M9NB 4DV5H 1S0MA 1DV2A 4IAJA 3R5HA 1DGSA 4J9RA 4J9MA 2UXBH 1BJTA 3HOWG 2ASDA 4A3CG 2ALZA 2VOBA 2YCHA 2J6SA 5IT9W 1AUXA 3TIIA 2E2IA 2OLSA 2W6OA 3RFCA 3PW4A 2OWOA 4A3JG 3GIKA 5DLGA 5KT2A 1GSOA 2VA2A 3MFHA 2J9GA 3VPCA 5DLFA 2J6UA 4ME6A 5KG6A 2CW7A 3KHLA 4DV4H 3HB9A 1Z2NX 3RGZA 3GTPA 4O3RA 3N42B 2YRXA 1ULZA 4MV4A 1RK6A 3NGDA 3U9TA 2YW2A 5KT5A 2ZDGA 4X62H 3U9SA 3H4DA 1JIHA 4WD3A 5KFGA 5D1OA 2ASJA 2GPSA 3V4SA 4O4IF 5DQHA 3OHBA 2BR0A 2KSWA 5EDWA 2IP4A 5KFBA 2R8KA 4LF7H 3PO3G 1Y1VG 4EEQA 3FDSA 2W6QA 2NUAB 4BWSC 2UXDH 2OH2A 2C2EA 2WYOA 5CAEB 2FP4B 2ZDHA 1M0WA 4O3PA 3PZPA
chains in the Genus database with same CATH topology
2FK1A 4PWQA 2FK3A 3KTMA 2FKLA 1OWTA 2M05A 2FK2A 2FJZA 2FMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK1 A;  4PWQ A;  2FK3 A;  3KTM A;  2FKL A;  1OWT A;  2M05 A;  2FK2 A;  2FJZ A;  2FMA A; 
#chains in the Genus database with same CATH topology
 1N56 A;  2R7L A;  3M4I A;  3I4M G;  5FD5 A;  4EYH B;  5KFU A;  4FM9 A;  3MWD A;  5C3E G;  1BGW A;  5BPH A;  4C2M A;  4DUY H;  4FS2 A;  1S97 A;  1CQI B;  5C1O A;  4JUZ A;  3H3V H;  1T36 A;  2F4V H;  3BQ1 A;  1XDN A;  3H40 A;  3V6H A;  5FPO A;  3T1H H;  2VUG A;  3VPB A;  4TV8 F;  1CS0 A;  4I4T F;  4R8U B;  3OSN A;  1RK5 A;  1V4Y A;  2XCL A;  3BAB A;  3UQ8 A;  2VQD A;  4IZO A;  4ECS A;  2SCU B;  5KG7 A;  2ATL A;  4HNV A;  3T5J A;  2JA8 G;  4RB0 A;  5KFR A;  2JA7 A;  2X0S A;  5LOV F;  4J9S A;  3GIL A;  1AN7 A;  4O2A F;  5FD6 A;  4UCU A;  4ZI7 F;  5KFL A;  1TWC A;  1M7J A;  3L4K A;  3N6X A;  1KJ8 A;  2CW8 A;  3KAJ A;  3TQ1 A;  5KT6 A;  5KT4 A;  1I7N A;  3VMM A;  2YZM A;  5DG9 A;  4U6P A;  3OHA A;  3HOX G;  1KJJ A;  4Q8E A;  3GIM A;  1V51 A;  1FVI A;  3RUP A;  1N48 A;  4ECV A;  2Y0S E;  2C00 A;  3GV7 B;  4J9K A;  2XGP A;  1DIK A;  2W9C A;  4M7E A;  3L4J A;  1J5E H;  2JEG A;  3G8C A;  1BNC A;  2PMZ E;  2E5L H;  4YJ3 F;  2WDT A;  4MV9 A;  2XCP A;  2GPW A;  4YR3 A;  2CZG A;  3V6J A;  1K1Q A;  5JUM A;  4B3M H;  4XYL B;  5BR8 H;  1C30 A;  4KHP H;  2W57 A;  4DL5 A;  1JX4 A;  1GLV A;  4A3L G;  1Y1W A;  2YZN A;  2NVY A;  3JRW A;  2YL2 A;  3TIN A;  3RAQ A;  1CE8 A;  3SI8 A;  2CKZ B;  3CQZ A;  1VBG A;  4HNT A;  1A9X A;  5LP6 F;  4HNU A;  5T14 A;  5F9L A;  4EGJ A;  4JV2 A;  1IBL H;  4YJ2 F;  4JI2 H;  5EWE A;  2AGO A;  4GLX A;  3ORQ A;  4EYI B;  4AYB A;  3QFF A;  2DIK A;  5CA0 F;  4XYM B;  4DR5 H;  2B63 A;  4IR1 A;  3IN5 A;  2Q2T A;  4RAZ A;  4A3G G;  3FKI A;  3N43 B;  5KX5 F;  2VQF H;  1TWH A;  1X9N A;  2FPP B;  4GKJ H;  2E2H A;  2YS7 A;  3G6V A;  5H80 A;  2UUC H;  3N41 B;  4G3I A;  1T94 A;  5KFZ A;  4HYK A;  2IMW P;  3RGX A;  2UVV A;  4I55 F;  5L9X A;  3KAL A;  4ED8 A;  2BQU A;  1B04 A;  5KFO A;  1W93 A;  2JA5 A;  2RF4 A;  4QWD A;  1RJQ A;  4EBC A;  4IWY A;  4LFA H;  3H0G G;  5F9N A;  4YHH H;  4QW9 A;  2I8C A;  4DR2 H;  3PN1 A;  5FPR A;  2DLN A;  2WAQ A;  4Y8V B;  5BMV F;  4C5C A;  4DL2 A;  4FBU A;  1Y1W G;  2JEF A;  4BBS G;  1XMQ H;  2JA6 A;  2AQ4 A;  5HBR B;  4U7C A;  2I80 A;  2V58 A;  1EUD B;  5KFV A;  1GYF A;  5DG7 A;  5K2M A;  4UCV A;  3BQ0 A;  1HNZ H;  3PW2 A;  1S68 A;  3ETJ A;  3KTM A;  4JI5 H;  2JEI A;  4F4Z A;  4OX9 H;  2VPQ A;  4L1K A;  2VA3 A;  1S0O A;  1S0N A;  1VBH A;  3BA9 A;  4QIW A;  1RYS A;  2NU7 B;  2FLL A;  5IYD G;  4ED7 A;  4NXM H;  5KFQ A;  3EYY A;  5EWG A;  3OUZ A;  1S9F A;  3HOY G;  2C35 B;  4MV7 A;  3F8N A;  4I7H A;  5GON F;  2W8K A;  1KBL A;  1A0I A;  3N44 B;  4NLG A;  2DZD A;  3H4B A;  4A3E G;  3HXL A;  3OUU A;  5DG8 A;  2V4R A;  3LML A;  5KG5 A;  1S10 A;  4I50 F;  4Q45 A;  4EGQ A;  4LF5 H;  2W71 A;  5KG0 A;  2W8L A;  4C5A A;  5KFP A;  3GLK A;  4EBE A;  5D8D A;  3RB6 A;  4WBN F;  2FPI B;  3RBE A;  3I4N G;  2YYA A;  5IP7 G;  5KFJ A;  4TV9 F;  2FK3 A;  4ZQI A;  2RDJ A;  2AGP A;  1GSA A;  3GID A;  1WCM A;  2HVQ A;  4UFZ A;  2R7K A;  1RJR A;  4HQ6 A;  3JSL A;  5KT7 A;  3PW5 A;  2W6M A;  2R92 A;  2BQR A;  2V9W A;  1BXR A;  1SEI A;  2O03 A;  3OTO H;  4DV3 H;  2IA6 A;  2UUB H;  3GTO A;  1L2Z A;  2DWC A;  4AQY H;  2Q2U A;  1KJQ A;  3BA8 A;  3MR5 A;  5KT3 A;  2PBZ A;  3KAK A;  4XZ3 B;  1ZET A;  4DV1 H;  1VS0 A;  3RB4 A;  4JV0 A;  4GC7 A;  2FKL A;  4DLK A;  1EZ1 A;  4X66 H;  4ED6 A;  3JSN A;  3T5H A;  4ED0 A;  3HKZ A;  3UFX B;  5C5J A;  1KJ9 A;  4RUC A;  4LFC H;  3GTM A;  3JAM W;  4AYB E;  3MWM A;  4R7R A;  3KXY T;  2R8I A;  2R93 A;  2YZG A;  2FJZ A;  4NXN H;  3N40 P;  4HR7 A;  4O4L F;  2XCA A;  2FPG B;  3J80 W;  1SFO A;  1ZHS A;  4ECT A;  4PDB A;  1IBK H;  4A2A A;  4J9P A;  1N32 H;  4J9Q A;  4YR2 A;  3K5I A;  1B6R A;  1Z2O X;  3H20 A;  1IBM H;  4X65 H;  1B33 N;  2V5A A;  4MV6 A;  2FLN A;  2UVW A;  1GGO A;  2R85 A;  1JXL A;  1E4E B;  1R9T A;  4A3M G;  4JI8 H;  3R5X A;  5DGB A;  4CC5 A;  3RV4 A;  1AUV A;  1E4F T;  4A2B A;  4YAK B;  1XNR H;  2CQY A;  2UXC H;  1M6V A;  4O4H F;  4JI3 H;  4YR0 A;  1WH2 A;  5KFA A;  2WAQ E;  4TUY F;  1O75 A;  1W96 A;  2ZDQ A;  5L1L A;  2VUM A;  3GQC A;  4EFB A;  2W6P A;  3GV8 B;  3AYH B;  5IYZ F;  4X64 H;  5KG2 A;  3M9M B;  2JA7 G;  4JV5 H;  2R8J A;  1GO3 E;  4A3K G;  3PVX A;  4RNO A;  5FLX W;  4DL7 A;  5KFN A;  1WR2 A;  2YU9 A;  2W6Z A;  3MJF A;  5DQG A;  5BPF A;  4BBR G;  4EG0 A;  2HVR A;  4LH6 A;  2VPS A;  1EUC B;  3HBL A;  3RB0 A;  4Q44 A;  4GKK H;  4QWB A;  2XGQ A;  3GTQ A;  1K83 A;  3GII A;  4MTE A;  1I50 A;  5LMN H;  2W9C B;  3G6X A;  3G6Y A;  1P8L A;  3RV3 A;  2XD4 A;  5KFF A;  4F4Y A;  3R23 A;  5LA6 F;  2HJW A;  3RJ0 A;  5DQI A;  5IYC G;  2C28 A;  5JQW A;  4BY1 G;  2WB1 A;  1JDE A;  1PK8 A;  2R6F A;  2W70 A;  1HR0 H;  2J6T A;  3WNZ A;  3QZ8 A;  1SYX B;  3RB3 A;  2IBK A;  3GIQ A;  4ECX A;  4RB1 A;  1C3O A;  5EWF A;  3KHR A;  1HNX H;  2W7O A;  4LF6 H;  2V59 A;  1TWF A;  4ED3 A;  1E4G T;  4UCO A;  5C4X G;  5KFK A;  1UNN C;  4ZOL F;  4DL6 A;  5J2U F;  2Y0S A;  4A3I G;  3RAX A;  4ECZ A;  4IRK A;  2FB9 A;  3EPI A;  5L1K A;  1ZHQ A;  5LXT F;  5LMU H;  2VQE H;  4DR1 H;  2HHH H;  4BXX G;  1I94 H;  4ECY A;  5D1P A;  5KKN B;  1FJG H;  2C2D A;  4A3F G;  3WO0 A;  2W9A A;  4FS1 A;  5IYB G;  4JYA H;  3Q8R B;  1Y1V A;  3Q8S B;  4YP3 A;  2WTF A;  2W9B B;  4F4W A;  1IOV A;  5DGA A;  3PR5 B;  1RYR A;  2B63 G;  3RF2 A;  3HOV G;  2PVP A;  3FKI G;  4LH7 A;  4JI0 H;  5KFW A;  2NU8 B;  3OSP A;  1N34 H;  4IRC A;  5JVD F;  4B3R H;  3RBD A;  5IP9 G;  4FU0 A;  3Q8P B;  2I87 A;  4B3S H;  4LF8 H;  4DR6 H;  4DL3 A;  3J7A K;  4DV0 H;  4UCR A;  2MCT A;  2RGV A;  4MA0 A;  2R84 A;  5KFH A;  1K1S A;  2JA5 G;  3GIJ A;  5KG3 A;  3LWB A;  1I7L A;  3PR4 A;  2GLT A;  2HGS A;  4R8U A;  2FLP A;  2R82 A;  2RGR A;  3MR3 A;  3QZ7 A;  2JA6 G;  2ASL A;  3PW7 A;  2W6N A;  4DL4 A;  1FKA H;  1GSH A;  3LP8 A;  4Q8F A;  4DR7 H;  4ECW A;  1TWA A;  5KFM A;  4LF4 H;  1M0T A;  2UU9 H;  3PO2 G;  4RAY A;  2R7N A;  3TIG A;  4ZHQ F;  5IWA H;  3K3V A;  1IOW A;  2XIG A;  1KEE A;  3MFI A;  3KHH A;  3JZI A;  1KC7 A;  1TAE A;  1VKZ A;  5KFC A;  2UVU A;  3V6K A;  4LFB H;  3RIZ A;  2FMA A;  4DR4 H;  4MV3 A;  1UC8 A;  1WSC A;  2QK4 A;  3Q8Q B;  3T5K A;  1PX2 A;  4DR3 H;  2C22 A;  4O3S A;  1T3N A;  3K3P A;  5D1O B;  3WO1 A;  4RUA A;  2NU6 B;  4QWA A;  4ECR A;  4JI6 H;  2RDI A;  1B6S A;  4EFE A;  3MR6 A;  4IHJ F;  4UCS A;  2W7P A;  4ED1 A;  4DV6 H;  4APM A;  1OWT A;  4RZQ A;  2WE6 A;  4MV1 A;  4QW8 A;  5KFE A;  5KFY A;  1Y14 B;  1S03 G;  5I47 A;  2DPJ A;  1E4E A;  4XX0 B;  5C8Y F;  5L1J A;  2AU0 A;  5KG1 A;  3CVZ A;  4PWQ A;  3E5N A;  1SCU B;  4RNM A;  5CA1 F;  4A3D G;  1Z2P X;  2VR1 A;  1JLL B;  3GTJ A;  4JI4 H;  3KHG A;  4YBZ B;  5EZY F;  1WCM G;  4MTD A;  2WB1 E;  3C0F B;  2ZJT A;  3BJY A;  2R92 G;  5HV6 A;  2V4Q A;  5KFI A;  2NU9 B;  1MZB A;  3L2P A;  2ZM6 H;  4EBD A;  2AGQ A;  1XNQ H;  5C1P A;  2R7M A;  1HNW H;  3JRX A;  4ETS A;  4K0K H;  1CQJ B;  3ORR A;  4J9L A;  3Q2O A;  3EPG A;  4IR9 A;  4EEY A;  5KFX A;  3I12 A;  5JVL A;  5LL6 b;  3TQT A;  1N36 H;  4RB2 C;  2FE3 A;  4F50 A;  4QWC A;  4M9U A;  5LYJ F;  2C2R A;  4B3T H;  4Q0Y A;  5JH7 F;  1I3Q A;  4A93 G;  4MV8 A;  5EOY A;  3M9O B;  4BY7 G;  1ZQ7 A;  3BAA A;  4QIW E;  2R93 G;  4F4X A;  5FLM G;  4IWX A;  4ECQ A;  3GTG A;  2R7Z A;  3H0G A;  1EYZ A;  2P0A A;  1I6U A;  3V4Z A;  2M05 A;  4YQW A;  1DV1 A;  3N8D A;  4FBT A;  4QJF A;  1XMO H;  4RU9 A;  2FK1 A;  3PW0 A;  5KFS A;  2HVS A;  4MAM A;  4TQS A;  4DUZ H;  4YY3 H;  4J9O A;  2FK2 A;  2R8H A;  3DF7 A;  4O2B F;  4IRD A;  5L1I A;  4JI1 H;  1V9P A;  2BQ3 A;  2PN1 A;  1TWG A;  3GIP A;  4LSA A;  3R5F A;  2QYZ A;  4O3N A;  4MA5 A;  3RTX A;  3BG5 A;  3K5H A;  1N33 H;  4J9N A;  1UC9 A;  1JKJ B;  4RZR A;  4J0M A;  1JDB B;  4GC6 A;  2DPI A;  2JEJ A;  5KFD A;  1EHI A;  5C44 G;  2VUM G;  2R86 A;  5KG4 A;  3VPD A;  4LMY A;  4LSX A;  5J2T F;  3J81 W;  2W9B A;  4JV1 A;  3Q1K A;  4RB3 C;  1KJI A;  2UUA H;  3BQ2 A;  3GTL A;  4E4T A;  2YRW A;  3IG0 A;  4YB8 B;  4Q43 A;  2NVX A;  2XC9 A;  2UVR A;  3FMA A;  5A2Q W;  3T5L A;  3GTK A;  4CC6 A;  3HOZ G;  2R8G A;  3ETH A;  1VAJ A;  5KFT A;  2R87 A;  4A3B G;  4O3O A;  4DV7 H;  2PMZ A;  5CB4 F;  4QWE A;  4YAJ B;  4DV2 H;  4LF9 H;  5FJ8 G;  3HOU G;  4O3Q A;  2R7Z G;  3MR2 A;  4ED2 A;  4C5B A;  3GV5 B;  3MWE A;  4JI7 H;  3SE7 A;  4ECU A;  1TA8 A;  2YS6 A;  4RNN A;  3HKZ E;  4UCT A;  3T1Y H;  1RJP A;  4TQR A;  3M9N B;  4DV5 H;  1S0M A;  1DV2 A;  4IAJ A;  3R5H A;  1DGS A;  4J9R A;  4J9M A;  2UXB H;  1BJT A;  3HOW G;  2ASD A;  4A3C G;  2ALZ A;  2VOB A;  2YCH A;  2J6S A;  5IT9 W;  1AUX A;  3TII A;  2E2I A;  2OLS A;  2W6O A;  3RFC A;  3PW4 A;  2OWO A;  4A3J G;  3GIK A;  5DLG A;  5KT2 A;  1GSO A;  2VA2 A;  3MFH A;  2J9G A;  3VPC A;  5DLF A;  2J6U A;  4ME6 A;  5KG6 A;  2CW7 A;  3KHL A;  4DV4 H;  3HB9 A;  1Z2N X;  3RGZ A;  3GTP A;  4O3R A;  3N42 B;  2YRX A;  1ULZ A;  4MV4 A;  1RK6 A;  3NGD A;  3U9T A;  2YW2 A;  5KT5 A;  2ZDG A;  4X62 H;  3U9S A;  3H4D A;  1JIH A;  4WD3 A;  5KFG A;  5D1O A;  2ASJ A;  2GPS A;  3V4S A;  4O4I F;  5DQH A;  3OHB A;  2BR0 A;  2KSW A;  5EDW A;  2IP4 A;  5KFB A;  2R8K A;  4LF7 H;  3PO3 G;  1Y1V G;  4EEQ A;  3FDS A;  2W6Q A;  2NUA B;  4BWS C;  2UXD H;  2OH2 A;  2C2E A;  2WYO A;  5CAE B;  2FP4 B;  2ZDH A;  1M0W A;  4O3P A;  3PZP A; 
#chains in the Genus database with same CATH homology
 2FK1 A;  4PWQ A;  2FK3 A;  3KTM A;  2FKL A;  1OWT A;  2M05 A;  2FK2 A;  2FJZ A;  2FMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...