2FK3A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
molecule keywords Amyloid beta A4 protein precursor
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk3A00
2FK2A 3KTMA 2FJZA 4PWQA 2FK3A 2FK1A 2M05A 2FMAA 2FKLA 1OWTA
chains in the Genus database with same CATH superfamily
1M0WA 5IYDG 3UQ8A 5A2QW 5KT2A 5BPFA 1HNZH 3GTQA 2UU9H 2PN1A 5EZYF 2UXDH 3GTJA 4ZI7F 4AYBA 2GPWA 4XYLB 5KG3A 2W7OA 4RAYA 3K3PA 4HYKA 2FPIB 3MR6A 1VAJA 4RUAA 4ECWA 4J0MA 1UC9A 2R8JA 2XIGA 2DPIA 4DV2H 2FE3A 3T1YH 1N48A 4F4WA 2OWOA 3G8CA 1TWGA 2GLTA 3LP8A 4JV5H 2VPSA 3N42B 2NU8B 2UVWA 4B3MH 1IBKH 4WBNF 4LF4H 4FS1A 4R8UB 2R8KA 4J9SA 5KFLA 3KAKA 3JRXA 4BY1G 4EBEA 1KJJA 2W71A 2HVRA 2V5AA 2VQFH 2XCPA 4J9QA 2W9CB 2XCAA 2PVPA 3BQ0A 1ZQ7A 4QW8A 4JUZA 3U9SA 4U6PA 4OX9H 1N32H 1Z2OX 4ZHQF 4BBRG 3OUZA 1I3QA 3H0GG 2W6QA 5KT4A 4A3MG 2JEFA 2E2IA 1T94A 5LYJF 5EWGA 4DV7H 1T3NA 4DR4H 2NVYA 3V4SA 3J7AK 4ED0A 1VBHA 1XMQH 2UVVA 3OHBA 2J6SA 1IOVA 5BPHA 2C2DA 4A2BA 2R85A 3PVXA 1CQIB 2KSWA 3L4JA 4EYHB 4A3JG 4M9UA 2R7ZG 4C5CA 2HGSA 5CA0F 1O75A 2YZNA 3Q2OA 4ECRA 2DWCA 2OH2A 1BNCA 1E4EB 3MR2A 3IN5A 2PMZA 4QWEA 1M0TA 4FU0A 2BQ3A 2RDJA 4YR0A 4FM9A 4A3IG 2YS7A 2CW7A 5IWAH 5DGAA 4UCVA 5KG6A 4LH6A 1KJ9A 3R23A 2RGVA 3BG5A 5L1JA 1S0NA 1RK6A 5IYZF 2W6ZA 4AYBE 5IT9W 4ME6A 4MA5A 3IG0A 4O2AF 5KFWA 3RB4A 3N40P 4PDBA 1GO3E 1IBMH 3HKZA 3RB0A 4YAJB 4YY3H 2Q2UA 1HNWH 4JI1H 4O3OA 1C3OA 5LL6b 5J2TF 4I50F 2FK1A 4JV0A 5LMNH 3EPGA 3JSLA 4I55F 3HOXG 3JRWA 4RB3C 5KFMA 2VUGA 4QJFA 5KG1A 4HNTA 3BA9A 3HB9A 5KFJA 4J9MA 3FMAA 5KFFA 3R5XA 5KFIA 3MWMA 4RB2C 2FPPB 5LXTF 4DL6A 1S0OA 3M4IA 5EDWA 1ZETA 4EGQA 1HR0H 2WE6A 4MV7A 1ZHQA 5KFCA 1KJIA 4O4IF 4A2AA 4JI3H 4LFAH 2WB1A 1VKZA 4RAZA 3U9TA 1EUCB 5L1LA 1FKAH 2R93A 2B63A 2C28A 4Y8VB 3BAAA 2YRWA 4QIWA 5T14A 3GILA 2YZMA 2R8HA 5C4XG 1TWFA 4LF9H 4YR2A 2PBZA 5KFAA 5C44G 3G6VA 2C35B 4QWDA 2FLPA 5KFUA 3PO2G 3PZPA 3GTGA 3OSNA 5KFZA 3TINA 1KEEA 5KFSA 2FP4B 5EWEA 5FD6A 2WTFA 5JVDF 4TUYF 1N36H 2VQDA 3E5NA 3ORQA 1T36A 2XD4A 4RUCA 3GIJA 4MV6A 5LA6F 5LMUH 4DR1H 3TQ1A 2W9BA 4BBSG 3TIGA 3RV3A 2FK3A 2WAQE 3K5IA 4HNVA 2FMAA 4JI0H 3ETHA 1TA8A 2FK2A 5DG7A 5D8DA 3MJFA 3RUPA 3JZIA 3RTXA 3WO0A 1ZHSA 4JYAH 3MWEA 2V4RA 3GTKA 2X0SA 4JI6H 4F50A 3SE7A 3J81W 3H40A 4ECZA 5DQGA 3T5JA 2JEGA 1A0IA 4IRKA 2ASLA 3PW0A 2R92A 1N33H 4DR2H 3GIQA 4DV4H 1Y1WG 2YL2A 2F4VH 4X62H 3R5HA 1V9PA 1Z2PX 2I87A 2ASJA 4XZ3B 4NXNH 4IWXA 4YBZB 2QYZA 3UFXB 5KFHA 4LF8H 4A3FG 3I4MG 1TAEA 4R7RA 3J80W 2NU9B 3QZ7A 4IAJA 1K83A 5IYBG 5KG5A 4F4ZA 3N44B 2AU0A 1KJ8A 5JQWA 2W9AA 1V51A 3T5LA 2UUCH 3N41B 1DV2A 1W93A 4UCOA 5DLFA 1P8LA 2VR1A 1RJQA 3QFFA 5DG9A 4ECYA 1I94H 4GKJH 2I80A 2ZM6H 2NU7B 3RJ0A 1KC7A 1W96A 3KHHA 5KG4A 3HXLA 4FBTA 3MR3A 3Q8PB 3KHGA 2R7MA 1Y14B 4YHHH 5C1PA 1JDEA 3I12A 4JI2H 5IYCG 4EEQA 3F8NA 4DR3H 5KFRA 5KT5A 4DUYH 1Y1WA 1GYFA 1TWCA 3PW2A 4I7HA 3VPDA 4ECQA 2R84A 4JI8H 3M9OB 3HOUG 2VA3A 3K5HA 1TWHA 3H4BA 3RGXA 1SYXB 3KAJA 4ED7A 2RDIA 2XC9A 4TV9F 3K3VA 4F4XA 1C30A 1DGSA 4BXXG 3MFHA 3OTOH 4ZOLF 4ECTA 4LFCH 3JSNA 2W7PA 2M05A 1JKJB 2W8LA 5BMVF 4J9OA 1S10A 1JXLA 1K1SA 4WD3A 3GTMA 2W6PA 4LSXA 1R9TA 2OLSA 1N34H 4ECUA 3RIZA 3GQCA 1I50A 3LMLA 1SEIA 5KFPA 4J9RA 1DIKA 1B6SA 4O2BF 1IBLH 3DF7A 2J6UA 3H4DA 3GV7B 4YB8B 2YYAA 4F4YA 2JA5A 4RNNA 4YQWA 4PWQA 4ED8A 1E4GT 1K1QA 3SI8A 2AGPA 1WSCA 2GPSA 2Y0SA 2WDTA 4Q44A 1I7NA 4GKKH 4IWYA 4B3SH 1I6UA 5L1IA 4TV8F 4LSAA 1Z2NX 3L4KA 2R7NA 2VPQA 5IP9G 4ECSA 2ALZA 2JA7G 1TWAA 3H20A 4IZOA 5BR8H 5EWFA 3PN1A 2CQYA 3RV4A 5FJ8G 2RGRA 2IP4A 5KFNA 4XYMB 3GIIA 1BXRA 1S68A 4QIWE 2AQ4A 2NVXA 2R8IA 4DV3H 3G6YA 1L2ZA 3N6XA 1UNNC 3G6XA 1M6VA 2AGQA 2O03A 2UXCH 1JLLB 4YJ2F 1WH2A 2WB1E 5KG7A 2BQUA 1S9FA 4X64H 4LF5H 3PR5B 3FKIA 4RNOA 2ZJTA 3FDSA 2SCUB 5J2UF 2C2RA 2UUAH 4I4TF 2W8KA 3V6JA 4GLXA 4LH7A 5FPRA 4C5BA 3GTOA 4XX0B 4O4LF 5KFKA 4HR7A 3OHAA 1UC8A 2ZDGA 4EEYA 2UVRA 5C8YF 2CKZB 2R7ZA 4EGJA 2JA7A 1MZBA 2WAQA 4UCRA 2ZDHA 4UFZA 3KHLA 4ED3A 3EPIA 1IOWA 4EG0A 1A9XA 1AUVA 4C2MA 3CVZA 4C5AA 2YZGA 4HQ6A 4R8UA 5KFTA 4CC5A 4NXMH 3BJYA 3HOVG 5DQHA 4DV0H 4JI7H 2ZDQA 1B04A 1FVIA 1CS0A 2R8GA 5FPOA 2JEIA 4G3IA 2IBKA 2J6TA 4QWBA 5KFGA 2W57A 2JA6G 4Q0YA 5DQIA 3RBEA 3H3VH 2UVUA 5KFVA 3I4NG 3FKIG 3HKZE 5KFXA 2VQEH 5EOYA 2C22A 1GLVA 2C2EA 4JV1A 3RB6A 2JA6A 5HV6A 4M7EA 4UCUA 1BGWA 4O3RA 4MV8A 4O3PA 5FLXW 4YR3A 3OSPA 1ULZA 5DLGA 1I7LA 4RNMA 3Q8RB 1RK5A 4CC6A 2HHHH 2FPGB 5KT7A 1RYSA 1WCMG 2FLLA 3H0GA 4EFEA 1BJTA 3NGDA 5KG2A 3MFIA 4E4TA 2BQRA 2V9WA 4KHPH 3N8DA 3RFCA 4DV6H 3JAMW 2AGOA 2DPJA 4B3RH 3ETJA 1E4FT 5H80A 4DL2A 2YRXA 4DV5H 4DL5A 2DZDA 4Q45A 5GONF 2MCTA 3PR4A 3T5KA 2FKLA 4BY7G 2W6MA 3T1HH 2ASDA 2FJZA 5DGBA 4U7CA 3EYYA 5F9LA 4GC6A 3RF2A 3Q8SB 4J9PA 4ECXA 1HNXH 3PO3G 4UCTA 4L1KA 2ATLA 2UXBH 3HBLA 3TQTA 4RZQA 1J5EH 1AUXA 1V4YA 4A3CG 3GIDA 4IHJF 5KG0A 4IR1A 2XGPA 1GSAA 3BABA 4BWSC 4MA0A 2UUBH 4YJ3F 3VPBA 3Q8QB 1JX4A 1PK8A 1RJRA 5KFQA 4Q43A 4EYIB 5KT3A 1CE8A 4AQYH 5KFDA 2VUMA 5JUMA 2YW2A 5LP6F 4B3TH 1XMOH 4A3DG 2R7KA 5IP7G 2NUAB 4MV1A 2W9CA 3PW4A 4MAMA 1E4EA 1WCMA 4RB0A 5CAEB 5KX5F 4DL3A 3GTLA 4A3BG 5KFYA 5L9XA 2R7LA 4YAKB 2XGQA 2RF4A 5JH7F 5L1KA 4RB1A 3LWBA 3V6KA 2Q2TA 4JV2A 3V6HA 2DIKA 4MV4A 5DG8A 3GIMA 2FLNA 3OUUA 4LF6H 4DV1H 1B33N 4APMA 1VBGA 5K2MA 2B63G 4A3EG 5FLMG 1RJPA 5F9NA 5KFEA 4DL4A 5HBRB 4ED6A 1N56A 4DR7H 5LOVF 3KALA 4DUZH 4TQSA 4GC7A 4TQRA 3GIPA 2Y0SE 2R86A 4J9KA 4J9LA 4YP3A 5FD5A 3PW7A 2R6FA 3RAQA 3VMMA 4EBCA 2YS6A 4A3GG 3TIIA 1Y1VG 4NLGA 1FJGH 5I47A 4UCSA 4DR6H 4K0KH 2VA2A 2BR0A 1JDBB 3M9MB 3WNZA 3MR5A 1B6RA 1M7JA 4FBUA 1EZ1A 2HJWA 2QK4A 4IRCA 2R87A 5CA1F 4X66H 3RAXA 1XDNA 4JI4H 2P0AA 1GSOA 2PMZE 2W70A 2JEJA 3PW5A 4HNUA 4ED1A 5D1OB 3RGZA 3AYHB 1SFOA 2HVQA 5KT6A 3KHRA 2J9GA 1KJQA 1OWTA 1SCUB 4QWCA 2FB9A 3KTMA 2V4QA 4EBDA 3VPCA 1AN7A 3CQZA 3KXYT 4X65H 4EFBA 3GV8B 3GIKA 2JA8G 3GV5B 4ECVA 3BA8A 4QW9A 3RBDA 2NU6B 1S03G 4LFBH 4Q8FA 1PX2A 4A93G 3HOZG 2YU9A 2R92G 4A3LG 1DV1A 4LF7H 4RZRA 2HVSA 4MV9A 3Q1KA 3RB3A 1GGOA 1Y1VA 2JA5G 1GSHA 2IMWP 3MWDA 5C3EG 2E5LH 3C0FB 2C00A 1EHIA 5D1OA 4ETSA 2DLNA 5JVLA 4LMYA 3GTPA 2V58A 4DL7A 1S0MA 4JI5H 1CQJB 5C5JA 2R93G 1S97A 3BQ2A 4DR5H 5KFOA 3WO1A 3GLKA 5KKNB 5C1OA 4MTDA 3QZ8A 1EYZA 3V4ZA 4Q8EA 3M9NB 4ED2A 4J9NA 2W6NA 4O3SA 4O3QA 2XCLA 2CW8A 2V59A 2W6OA 2WYOA 1JIHA 1RYRA 4O3NA 1KBLA 5KFBA 3ORRA 4IRDA 1WR2A 3R5FA 4IR9A 2VUMG 4FS2A 1XNQH 1X9NA 5D1PA 2I8CA 1XNRH 4QWAA 3T5HA 2YCHA 4RU9A 4ZQIA 5CB4F 4O4HF 3L2PA 2W9BB 3HOWG 1EUDB 2R82A 2VOBA 3BQ1A 2IA6A 4MTEA 2CZGA 1VS0A 4A3KG 3HOYG 4DLKA 4MV3A 2E2HA 3N43B
chains in the Genus database with same CATH topology
2FK2A 3KTMA 2FJZA 4PWQA 2FK3A 2FK1A 2M05A 2FMAA 2FKLA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FK2 A;  3KTM A;  2FJZ A;  4PWQ A;  2FK3 A;  2FK1 A;  2M05 A;  2FMA A;  2FKL A;  1OWT A; 
#chains in the Genus database with same CATH topology
 1M0W A;  5IYD G;  3UQ8 A;  5A2Q W;  5KT2 A;  5BPF A;  1HNZ H;  3GTQ A;  2UU9 H;  2PN1 A;  5EZY F;  2UXD H;  3GTJ A;  4ZI7 F;  4AYB A;  2GPW A;  4XYL B;  5KG3 A;  2W7O A;  4RAY A;  3K3P A;  4HYK A;  2FPI B;  3MR6 A;  1VAJ A;  4RUA A;  4ECW A;  4J0M A;  1UC9 A;  2R8J A;  2XIG A;  2DPI A;  4DV2 H;  2FE3 A;  3T1Y H;  1N48 A;  4F4W A;  2OWO A;  3G8C A;  1TWG A;  2GLT A;  3LP8 A;  4JV5 H;  2VPS A;  3N42 B;  2NU8 B;  2UVW A;  4B3M H;  1IBK H;  4WBN F;  4LF4 H;  4FS1 A;  4R8U B;  2R8K A;  4J9S A;  5KFL A;  3KAK A;  3JRX A;  4BY1 G;  4EBE A;  1KJJ A;  2W71 A;  2HVR A;  2V5A A;  2VQF H;  2XCP A;  4J9Q A;  2W9C B;  2XCA A;  2PVP A;  3BQ0 A;  1ZQ7 A;  4QW8 A;  4JUZ A;  3U9S A;  4U6P A;  4OX9 H;  1N32 H;  1Z2O X;  4ZHQ F;  4BBR G;  3OUZ A;  1I3Q A;  3H0G G;  2W6Q A;  5KT4 A;  4A3M G;  2JEF A;  2E2I A;  1T94 A;  5LYJ F;  5EWG A;  4DV7 H;  1T3N A;  4DR4 H;  2NVY A;  3V4S A;  3J7A K;  4ED0 A;  1VBH A;  1XMQ H;  2UVV A;  3OHB A;  2J6S A;  1IOV A;  5BPH A;  2C2D A;  4A2B A;  2R85 A;  3PVX A;  1CQI B;  2KSW A;  3L4J A;  4EYH B;  4A3J G;  4M9U A;  2R7Z G;  4C5C A;  2HGS A;  5CA0 F;  1O75 A;  2YZN A;  3Q2O A;  4ECR A;  2DWC A;  2OH2 A;  1BNC A;  1E4E B;  3MR2 A;  3IN5 A;  2PMZ A;  4QWE A;  1M0T A;  4FU0 A;  2BQ3 A;  2RDJ A;  4YR0 A;  4FM9 A;  4A3I G;  2YS7 A;  2CW7 A;  5IWA H;  5DGA A;  4UCV A;  5KG6 A;  4LH6 A;  1KJ9 A;  3R23 A;  2RGV A;  3BG5 A;  5L1J A;  1S0N A;  1RK6 A;  5IYZ F;  2W6Z A;  4AYB E;  5IT9 W;  4ME6 A;  4MA5 A;  3IG0 A;  4O2A F;  5KFW A;  3RB4 A;  3N40 P;  4PDB A;  1GO3 E;  1IBM H;  3HKZ A;  3RB0 A;  4YAJ B;  4YY3 H;  2Q2U A;  1HNW H;  4JI1 H;  4O3O A;  1C3O A;  5LL6 b;  5J2T F;  4I50 F;  2FK1 A;  4JV0 A;  5LMN H;  3EPG A;  3JSL A;  4I55 F;  3HOX G;  3JRW A;  4RB3 C;  5KFM A;  2VUG A;  4QJF A;  5KG1 A;  4HNT A;  3BA9 A;  3HB9 A;  5KFJ A;  4J9M A;  3FMA A;  5KFF A;  3R5X A;  5KFI A;  3MWM A;  4RB2 C;  2FPP B;  5LXT F;  4DL6 A;  1S0O A;  3M4I A;  5EDW A;  1ZET A;  4EGQ A;  1HR0 H;  2WE6 A;  4MV7 A;  1ZHQ A;  5KFC A;  1KJI A;  4O4I F;  4A2A A;  4JI3 H;  4LFA H;  2WB1 A;  1VKZ A;  4RAZ A;  3U9T A;  1EUC B;  5L1L A;  1FKA H;  2R93 A;  2B63 A;  2C28 A;  4Y8V B;  3BAA A;  2YRW A;  4QIW A;  5T14 A;  3GIL A;  2YZM A;  2R8H A;  5C4X G;  1TWF A;  4LF9 H;  4YR2 A;  2PBZ A;  5KFA A;  5C44 G;  3G6V A;  2C35 B;  4QWD A;  2FLP A;  5KFU A;  3PO2 G;  3PZP A;  3GTG A;  3OSN A;  5KFZ A;  3TIN A;  1KEE A;  5KFS A;  2FP4 B;  5EWE A;  5FD6 A;  2WTF A;  5JVD F;  4TUY F;  1N36 H;  2VQD A;  3E5N A;  3ORQ A;  1T36 A;  2XD4 A;  4RUC A;  3GIJ A;  4MV6 A;  5LA6 F;  5LMU H;  4DR1 H;  3TQ1 A;  2W9B A;  4BBS G;  3TIG A;  3RV3 A;  2FK3 A;  2WAQ E;  3K5I A;  4HNV A;  2FMA A;  4JI0 H;  3ETH A;  1TA8 A;  2FK2 A;  5DG7 A;  5D8D A;  3MJF A;  3RUP A;  3JZI A;  3RTX A;  3WO0 A;  1ZHS A;  4JYA H;  3MWE A;  2V4R A;  3GTK A;  2X0S A;  4JI6 H;  4F50 A;  3SE7 A;  3J81 W;  3H40 A;  4ECZ A;  5DQG A;  3T5J A;  2JEG A;  1A0I A;  4IRK A;  2ASL A;  3PW0 A;  2R92 A;  1N33 H;  4DR2 H;  3GIQ A;  4DV4 H;  1Y1W G;  2YL2 A;  2F4V H;  4X62 H;  3R5H A;  1V9P A;  1Z2P X;  2I87 A;  2ASJ A;  4XZ3 B;  4NXN H;  4IWX A;  4YBZ B;  2QYZ A;  3UFX B;  5KFH A;  4LF8 H;  4A3F G;  3I4M G;  1TAE A;  4R7R A;  3J80 W;  2NU9 B;  3QZ7 A;  4IAJ A;  1K83 A;  5IYB G;  5KG5 A;  4F4Z A;  3N44 B;  2AU0 A;  1KJ8 A;  5JQW A;  2W9A A;  1V51 A;  3T5L A;  2UUC H;  3N41 B;  1DV2 A;  1W93 A;  4UCO A;  5DLF A;  1P8L A;  2VR1 A;  1RJQ A;  3QFF A;  5DG9 A;  4ECY A;  1I94 H;  4GKJ H;  2I80 A;  2ZM6 H;  2NU7 B;  3RJ0 A;  1KC7 A;  1W96 A;  3KHH A;  5KG4 A;  3HXL A;  4FBT A;  3MR3 A;  3Q8P B;  3KHG A;  2R7M A;  1Y14 B;  4YHH H;  5C1P A;  1JDE A;  3I12 A;  4JI2 H;  5IYC G;  4EEQ A;  3F8N A;  4DR3 H;  5KFR A;  5KT5 A;  4DUY H;  1Y1W A;  1GYF A;  1TWC A;  3PW2 A;  4I7H A;  3VPD A;  4ECQ A;  2R84 A;  4JI8 H;  3M9O B;  3HOU G;  2VA3 A;  3K5H A;  1TWH A;  3H4B A;  3RGX A;  1SYX B;  3KAJ A;  4ED7 A;  2RDI A;  2XC9 A;  4TV9 F;  3K3V A;  4F4X A;  1C30 A;  1DGS A;  4BXX G;  3MFH A;  3OTO H;  4ZOL F;  4ECT A;  4LFC H;  3JSN A;  2W7P A;  2M05 A;  1JKJ B;  2W8L A;  5BMV F;  4J9O A;  1S10 A;  1JXL A;  1K1S A;  4WD3 A;  3GTM A;  2W6P A;  4LSX A;  1R9T A;  2OLS A;  1N34 H;  4ECU A;  3RIZ A;  3GQC A;  1I50 A;  3LML A;  1SEI A;  5KFP A;  4J9R A;  1DIK A;  1B6S A;  4O2B F;  1IBL H;  3DF7 A;  2J6U A;  3H4D A;  3GV7 B;  4YB8 B;  2YYA A;  4F4Y A;  2JA5 A;  4RNN A;  4YQW A;  4PWQ A;  4ED8 A;  1E4G T;  1K1Q A;  3SI8 A;  2AGP A;  1WSC A;  2GPS A;  2Y0S A;  2WDT A;  4Q44 A;  1I7N A;  4GKK H;  4IWY A;  4B3S H;  1I6U A;  5L1I A;  4TV8 F;  4LSA A;  1Z2N X;  3L4K A;  2R7N A;  2VPQ A;  5IP9 G;  4ECS A;  2ALZ A;  2JA7 G;  1TWA A;  3H20 A;  4IZO A;  5BR8 H;  5EWF A;  3PN1 A;  2CQY A;  3RV4 A;  5FJ8 G;  2RGR A;  2IP4 A;  5KFN A;  4XYM B;  3GII A;  1BXR A;  1S68 A;  4QIW E;  2AQ4 A;  2NVX A;  2R8I A;  4DV3 H;  3G6Y A;  1L2Z A;  3N6X A;  1UNN C;  3G6X A;  1M6V A;  2AGQ A;  2O03 A;  2UXC H;  1JLL B;  4YJ2 F;  1WH2 A;  2WB1 E;  5KG7 A;  2BQU A;  1S9F A;  4X64 H;  4LF5 H;  3PR5 B;  3FKI A;  4RNO A;  2ZJT A;  3FDS A;  2SCU B;  5J2U F;  2C2R A;  2UUA H;  4I4T F;  2W8K A;  3V6J A;  4GLX A;  4LH7 A;  5FPR A;  4C5B A;  3GTO A;  4XX0 B;  4O4L F;  5KFK A;  4HR7 A;  3OHA A;  1UC8 A;  2ZDG A;  4EEY A;  2UVR A;  5C8Y F;  2CKZ B;  2R7Z A;  4EGJ A;  2JA7 A;  1MZB A;  2WAQ A;  4UCR A;  2ZDH A;  4UFZ A;  3KHL A;  4ED3 A;  3EPI A;  1IOW A;  4EG0 A;  1A9X A;  1AUV A;  4C2M A;  3CVZ A;  4C5A A;  2YZG A;  4HQ6 A;  4R8U A;  5KFT A;  4CC5 A;  4NXM H;  3BJY A;  3HOV G;  5DQH A;  4DV0 H;  4JI7 H;  2ZDQ A;  1B04 A;  1FVI A;  1CS0 A;  2R8G A;  5FPO A;  2JEI A;  4G3I A;  2IBK A;  2J6T A;  4QWB A;  5KFG A;  2W57 A;  2JA6 G;  4Q0Y A;  5DQI A;  3RBE A;  3H3V H;  2UVU A;  5KFV A;  3I4N G;  3FKI G;  3HKZ E;  5KFX A;  2VQE H;  5EOY A;  2C22 A;  1GLV A;  2C2E A;  4JV1 A;  3RB6 A;  2JA6 A;  5HV6 A;  4M7E A;  4UCU A;  1BGW A;  4O3R A;  4MV8 A;  4O3P A;  5FLX W;  4YR3 A;  3OSP A;  1ULZ A;  5DLG A;  1I7L A;  4RNM A;  3Q8R B;  1RK5 A;  4CC6 A;  2HHH H;  2FPG B;  5KT7 A;  1RYS A;  1WCM G;  2FLL A;  3H0G A;  4EFE A;  1BJT A;  3NGD A;  5KG2 A;  3MFI A;  4E4T A;  2BQR A;  2V9W A;  4KHP H;  3N8D A;  3RFC A;  4DV6 H;  3JAM W;  2AGO A;  2DPJ A;  4B3R H;  3ETJ A;  1E4F T;  5H80 A;  4DL2 A;  2YRX A;  4DV5 H;  4DL5 A;  2DZD A;  4Q45 A;  5GON F;  2MCT A;  3PR4 A;  3T5K A;  2FKL A;  4BY7 G;  2W6M A;  3T1H H;  2ASD A;  2FJZ A;  5DGB A;  4U7C A;  3EYY A;  5F9L A;  4GC6 A;  3RF2 A;  3Q8S B;  4J9P A;  4ECX A;  1HNX H;  3PO3 G;  4UCT A;  4L1K A;  2ATL A;  2UXB H;  3HBL A;  3TQT A;  4RZQ A;  1J5E H;  1AUX A;  1V4Y A;  4A3C G;  3GID A;  4IHJ F;  5KG0 A;  4IR1 A;  2XGP A;  1GSA A;  3BAB A;  4BWS C;  4MA0 A;  2UUB H;  4YJ3 F;  3VPB A;  3Q8Q B;  1JX4 A;  1PK8 A;  1RJR A;  5KFQ A;  4Q43 A;  4EYI B;  5KT3 A;  1CE8 A;  4AQY H;  5KFD A;  2VUM A;  5JUM A;  2YW2 A;  5LP6 F;  4B3T H;  1XMO H;  4A3D G;  2R7K A;  5IP7 G;  2NUA B;  4MV1 A;  2W9C A;  3PW4 A;  4MAM A;  1E4E A;  1WCM A;  4RB0 A;  5CAE B;  5KX5 F;  4DL3 A;  3GTL A;  4A3B G;  5KFY A;  5L9X A;  2R7L A;  4YAK B;  2XGQ A;  2RF4 A;  5JH7 F;  5L1K A;  4RB1 A;  3LWB A;  3V6K A;  2Q2T A;  4JV2 A;  3V6H A;  2DIK A;  4MV4 A;  5DG8 A;  3GIM A;  2FLN A;  3OUU A;  4LF6 H;  4DV1 H;  1B33 N;  4APM A;  1VBG A;  5K2M A;  2B63 G;  4A3E G;  5FLM G;  1RJP A;  5F9N A;  5KFE A;  4DL4 A;  5HBR B;  4ED6 A;  1N56 A;  4DR7 H;  5LOV F;  3KAL A;  4DUZ H;  4TQS A;  4GC7 A;  4TQR A;  3GIP A;  2Y0S E;  2R86 A;  4J9K A;  4J9L A;  4YP3 A;  5FD5 A;  3PW7 A;  2R6F A;  3RAQ A;  3VMM A;  4EBC A;  2YS6 A;  4A3G G;  3TII A;  1Y1V G;  4NLG A;  1FJG H;  5I47 A;  4UCS A;  4DR6 H;  4K0K H;  2VA2 A;  2BR0 A;  1JDB B;  3M9M B;  3WNZ A;  3MR5 A;  1B6R A;  1M7J A;  4FBU A;  1EZ1 A;  2HJW A;  2QK4 A;  4IRC A;  2R87 A;  5CA1 F;  4X66 H;  3RAX A;  1XDN A;  4JI4 H;  2P0A A;  1GSO A;  2PMZ E;  2W70 A;  2JEJ A;  3PW5 A;  4HNU A;  4ED1 A;  5D1O B;  3RGZ A;  3AYH B;  1SFO A;  2HVQ A;  5KT6 A;  3KHR A;  2J9G A;  1KJQ A;  1OWT A;  1SCU B;  4QWC A;  2FB9 A;  3KTM A;  2V4Q A;  4EBD A;  3VPC A;  1AN7 A;  3CQZ A;  3KXY T;  4X65 H;  4EFB A;  3GV8 B;  3GIK A;  2JA8 G;  3GV5 B;  4ECV A;  3BA8 A;  4QW9 A;  3RBD A;  2NU6 B;  1S03 G;  4LFB H;  4Q8F A;  1PX2 A;  4A93 G;  3HOZ G;  2YU9 A;  2R92 G;  4A3L G;  1DV1 A;  4LF7 H;  4RZR A;  2HVS A;  4MV9 A;  3Q1K A;  3RB3 A;  1GGO A;  1Y1V A;  2JA5 G;  1GSH A;  2IMW P;  3MWD A;  5C3E G;  2E5L H;  3C0F B;  2C00 A;  1EHI A;  5D1O A;  4ETS A;  2DLN A;  5JVL A;  4LMY A;  3GTP A;  2V58 A;  4DL7 A;  1S0M A;  4JI5 H;  1CQJ B;  5C5J A;  2R93 G;  1S97 A;  3BQ2 A;  4DR5 H;  5KFO A;  3WO1 A;  3GLK A;  5KKN B;  5C1O A;  4MTD A;  3QZ8 A;  1EYZ A;  3V4Z A;  4Q8E A;  3M9N B;  4ED2 A;  4J9N A;  2W6N A;  4O3S A;  4O3Q A;  2XCL A;  2CW8 A;  2V59 A;  2W6O A;  2WYO A;  1JIH A;  1RYR A;  4O3N A;  1KBL A;  5KFB A;  3ORR A;  4IRD A;  1WR2 A;  3R5F A;  4IR9 A;  2VUM G;  4FS2 A;  1XNQ H;  1X9N A;  5D1P A;  2I8C A;  1XNR H;  4QWA A;  3T5H A;  2YCH A;  4RU9 A;  4ZQI A;  5CB4 F;  4O4H F;  3L2P A;  2W9B B;  3HOW G;  1EUD B;  2R82 A;  2VOB A;  3BQ1 A;  2IA6 A;  4MTE A;  2CZG A;  1VS0 A;  4A3K G;  3HOY G;  4DLK A;  4MV3 A;  2E2H A;  3N43 B; 
#chains in the Genus database with same CATH homology
 2FK2 A;  3KTM A;  2FJZ A;  4PWQ A;  2FK3 A;  2FK1 A;  2M05 A;  2FMA A;  2FKL A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...