2FK3A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
b'EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
molecule tags Metal binding protein
source organism Homo sapiens
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk3A00
2M05A 2FJZA 1OWTA 2FMAA 4PWQA 2FK3A 2FK1A 3KTMA 2FK2A 2FKLA
chains in the Genus database with same CATH superfamily
3HXLA 4YP3A 2W70A 3OTOH 1RK5A 4AQYH 4RNOA 5GONF 2V5AA 4ECWA 3MFIA 2PMZA 1ZHQA 4J9SA 3R5HA 5KFNA 5IYDG 3G6YA 1WH2A 3JSNA 5D1OB 4EBCA 1N33H 2JA5A 4A3GG 2W6QA 2CZGA 3ETJA 1M6VA 5DG7A 5KFWA 4ZI7F 5IYCG 1FJGH 3QFFA 2JA7A 5D1PA 4EEQA 2XGQA 5EOYA 2Q2TA 2RGRA 4LMYA 2VPSA 3J7AK 2R7ZA 4RB1A 2UVWA 2C2EA 3GIMA 3BQ0A 2YS6A 4UCOA 5C4XG 2R8GA 5LL6b 4X62H 4RAZA 3GTQA 1GSHA 4DV2H 5KFDA 3JRXA 5LP6F 3OHAA 2YRWA 3PR5B 2JA7G 1AUXA 2IMWP 3V4SA 1RJRA 2R7ZG 4IRCA 2FPPB 4QIWA 4JYAH 2W9BA 4DR3H 5EDWA 3RTXA 2ASLA 2IA6A 4Y8VB 4ED8A 2FB9A 1WSCA 2C28A 2JA8G 1TWHA 2AQ4A 4BWSC 4ECXA 3T5LA 1BGWA 1EUDB 1TWAA 2R85A 2WTFA 4ECYA 3T1HH 1N48A 2R92G 4IHJF 1XNRH 4BBSG 2J9GA 5KG3A 2DPJA 4DR6H 5KT7A 1ULZA 3IN5A 4TQSA 3PN1A 4ECQA 3H20A 1Y1VA 5JVLA 1JLLB 4R7RA 2ZDHA 4FU0A 3VPDA 3RGZA 3LWBA 4B3TH 4O3QA 4DR2H 1Y14B 3T5HA 4FBUA 1TWGA 1EYZA 5LYJF 4J9LA 2GLTA 4ME6A 2ZM6H 2W7OA 3BABA 4C5BA 2YU9A 2R93A 3FMAA 4J9PA 5FD5A 4JV0A 4UCSA 4YBZB 3EPGA 2AGOA 1UC9A 3R23A 2E5LH 2IP4A 1GSOA 3WO0A 4LFCH 4DUZH 3NGDA 4WBNF 5KX5F 4YHHH 4LF6H 3KHGA 4LH6A 4WD3A 4I55F 1S97A 2J6UA 5FLXW 2Q2UA 2VA3A 4Q8FA 2BQUA 5KG6A 4MV6A 3SE7A 4DL4A 3K5IA 4X64H 2FP4B 2V58A 1GSAA 3AYHB 1CQIB 5KFCA 4EBEA 5HBRB 4DLKA 3H4DA 3OUZA 1HNXH 3FDSA 3H0GG 3BG5A 2NUAB 1B6RA 2R7NA 1SFOA 3WO1A 1J5EH 3HKZA 5LOVF 4ED3A 1HNZH 1C3OA 2P0AA 4O2BF 5KT3A 5C8YF 3PR4A 5FJ8G 1DGSA 1SCUB 2RDJA 2VQEH 2X0SA 4DL2A 1B04A 1IBMH 3F8NA 1I3QA 4QWDA 4JI1H 2MCTA 1KJ8A 5KT6A 4YQWA 4G3IA 5IP9G 3RGXA 5J2UF 3GIKA 2C2RA 3R5XA 1I7LA 4RZQA 5J2TF 5L1LA 5LMNH 4QWBA 3IG0A 4TV8F 4ED6A 4EEYA 5KFUA 2QYZA 4DV0H 4F4YA 4J9NA 5KFQA 3RUPA 4A93G 3GIPA 5KFYA 4DV4H 3SI8A 1IBKH 4ECTA 4RZRA 2PVPA 2FE3A 2I8CA 3BQ1A 1E4GT 2O03A 5L1JA 4UCUA 4A3MG 3RBDA 1GYFA 4RB2C 2W8LA 5CAEB 4JV1A 1M0WA 5KFZA 5F9NA 4R8UB 2XIGA 4A3IG 2HJWA 4FM9A 2F4VH 3I4MG 4DV7H 4DR7H 1JDBB 1JKJB 2CQYA 2ZDQA 3N8DA 5FPOA 2I80A 4YJ2F 4Q8EA 4RU9A 2DPIA 2R8HA 4MV4A 3N43B 3H40A 5KFRA 3RV3A 1VBGA 2KSWA 3Q8QB 2BQRA 1V4YA 2YW2A 4HQ6A 2YZGA 4X66H 3PZPA 2GPSA 3GLKA 2AU0A 4J9MA 4A3CG 2R7KA 5L1IA 4LF8H 4MV1A 1JXLA 2VUMG 1IOVA 1UC8A 2HVQA 4EFBA 4ETSA 5KFXA 4B3MH 1KJ9A 5KFJA 4B3SH 2ASDA 3BA8A 5KFVA 3M9OB 4LF4H 4TV9F 3Q8RB 2UVRA 1S0MA 1XNQH 3U9SA 3RFCA 5FLMG 5KFAA 4DR5H 3MR6A 3KHLA 5HV6A 3MR5A 4GC6A 2PBZA 4YJ3F 3V6KA 1JIHA 2HVSA 4BY7G 4Q0YA 2YZNA 3L2PA 4QWEA 2AGPA 1FVIA 4A3BG 5KFTA 3CVZA 4GLXA 2R8KA 2I87A 2W6ZA 4JV5H 3N44B 5IYZF 3L4KA 4QIWE 5KFIA 5IWAH 4DL5A 3V4ZA 5I47A 3M9NB 3GV7B 4NLGA 3T5KA 2ZDGA 1R9TA 1TA8A 1W93A 4F4WA 1KJQA 2B63G 4DR4H 5IP7G 5KFSA 4A2AA 4ED7A 2CW7A 4A3DG 4O3OA 3HOUG 5DG8A 3KTMA 5BPHA 2DZDA 2C00A 4NXMH 4TUYF 3RV4A 3EPIA 5A2QW 3RIZA 4FS2A 1KEEA 1S03G 3WNZA 5T14A 2C2DA 4MTEA 4B3RH 3C0FB 4DL6A 4UFZA 3FKIA 3N41B 5KFEA 2UXDH 1T94A 2JA6G 2UVVA 3HOYG 4M7EA 2NU7B 4MV9A 1B6SA 1GGOA 2RF4A 4M9UA 4YB8B 1RYRA 4EFEA 3V6JA 4IAJA 3GTKA 4RB3C 5KFOA 4ECVA 3ORRA 2Y0SA 4LH7A 4ED1A 1S9FA 2ZJTA 3JSLA 3DF7A 2FMAA 4YR3A 3UQ8A 2AGQA 2RGVA 5JQWA 5CA1F 3RB0A 1PK8A 1TAEA 1VBHA 5DGBA 4F4XA 1PX2A 3MR2A 1L2ZA 4UCVA 4JI2H 4DV3H 4LF5H 1I6UA 5D1OA 3U9TA 4E4TA 4AYBE 3K5HA 1JDEA 1KBLA 1I94H 2VA2A 5IYBG 1AN7A 1Y1VG 3RB3A 4EYHB 5LMUH 5C5JA 2QK4A 3HB9A 2NVXA 4EGQA 4A2BA 4LSXA 4O2AF 3JAMW 3J81W 3T1YH 2UXCH 3LP8A 3TQ1A 4RB0A 1IOWA 3PVXA 4U6PA 1N56A 1A9XA 2XCPA 1WCMG 1E4EA 4DL7A 2J6TA 4JI0H 1CS0A 3V6HA 4XYMB 4A3JG 2NVYA 4IRDA 3H3VH 2WB1E 2UUBH 1BNCA 5KFGA 2VUMA 3BA9A 1V51A 3KAJA 4K0KH 4APMA 5FD6A 4PDBA 1W96A 1Z2NX 2V4RA 1SYXB 3BAAA 4XX0B 5C3EG 3RAXA 5BR8H 3ETHA 4EG0A 3QZ7A 2W9CB 3MFHA 4A3KG 4LFBH 2UU9H 3KAKA 1ZETA 4DL3A 2YRXA 4Q43A 4RNMA 3OHBA 4FS1A 4IRKA 2JEIA 4BY1G 4HR7A 4LSAA 2WE6A 1Y1WG 3GTJA 4OX9H 3GIDA 4IWXA 4O4IF 4A3LG 4QWAA 2OH2A 5JUMA 3J80W 2RDIA 3MWMA 5EWGA 4L1KA 1VAJA 3TIIA 3BJYA 3N42B 1S0NA 4MAMA 2W57A 3ORQA 4YR0A 4QWCA 3TINA 1S10A 1N34H 4KHPH 4Q44A 4RUAA 3GIJA 2R92A 4JI8H 3EYYA 4O3SA 5KFPA 4QJFA 4JI4H 1JX4A 3JRWA 2XCLA 4C5AA 1VS0A 2PN1A 1T36A 3E5NA 1ZQ7A 4RUCA 2XC9A 2WAQE 4JUZA 1P8LA 1B33N 4DV1H 3PO2G 4UCTA 1Z2OX 4AYBA 4F50A 2FJZA 3CQZA 3HOXG 2JEJA 3GQCA 4HNTA 4BXXG 2W9CA 4FBTA 1ZHSA 1Y1WA 1M0TA 2R7LA 4J9KA 5K2MA 4MA5A 2XGPA 4JI7H 3KHRA 4J9OA 2VPQA 5KG1A 4A3FG 3H4BA 2JEGA 3GTMA 3Q2OA 4XYLB 4JV2A 2JA6A 2M05A 3JZIA 3OSNA 2W9AA 3VPCA 2FLLA 3N40P 4ECUA 1EUCB 2FK3A 2Y0SE 3Q1KA 4MTDA 2E2IA 2FK2A 2UUCH 3OSPA 1HR0H 2R6FA 4CC6A 3G8CA 4I7HA 4UCRA 3TIGA 2C35B 3PW4A 4ECSA 4R8UA 4GKKH 1A0IA 1K1SA 1K83A 2SCUB 1SEIA 5KG7A 4O3NA 5LXTF 4J9QA 1HNWH 4O3PA 2R7MA 3VPBA 4JI6H 2VR1A 1AUVA 1VKZA 3KALA 4QW9A 2DLNA 2OWOA 2R93G 1GO3E 2YL2A 3RAQA 3K3PA 2YYAA 5KFBA 3Q8SB 1N36H 3HOZG 4LF7H 5KG0A 2JEFA 4MV3A 3PO3G 5KFLA 4JI3H 1V9PA 3PW7A 1UNNC 3PW5A 4IR1A 4MA0A 1N32H 5BMVF 3HBLA 5EWFA 2BR0A 4TQRA 4C5CA 2W9BB 2W7PA 4GKJH 2YZMA 3H0GA 4HNUA 4C2MA 4O4HF 4PWQA 4ZQIA 2FPIB 5DGAA 3N6XA 3HKZE 4F4ZA 4MV8A 4IR9A 2W6OA 2HHHH 5FPRA 1DV1A 3MJFA 4DR1H 3GTOA 1S0OA 4ED2A 2VUGA 5KFMA 1WCMA 2XD4A 2V59A 2YCHA 3MWEA 3HOWG 3HOVG 2VQFH 2ALZA 1RJQA 4DUYH 3FKIG 4O4LF 2WDTA 2HVRA 5DQIA 5D8DA 5DLFA 1RK6A 1RJPA 5KG5A 1CQJB 2E2HA 4IZOA 3G6XA 4LF9H 2UUAH 4HYKA 2C22A 2UVUA 1BXRA 4CC5A 4RNNA 3K3VA 2W6NA 3UFXB 1CE8A 3R5FA 1EZ1A 1O75A 2W6MA 1XMOH 5L1KA 2R8JA 2XCAA 3TQTA 5KT5A 3GILA 5CB4F 3GTGA 1MZBA 5DG9A 3GTLA 3MR3A 5C44G 1KJJA 1KC7A 1IBLH 1XDNA 2YS7A 2R82A 5C1OA 3L4JA 2FK1A 4RAYA 3Q8PB 5KFKA 4YR2A 5KFFA 3OUUA 3GV8B 4BBRG 3RBEA 3VMMA 1X9NA 2B63A 1S68A 1TWCA 2GPWA 3QZ8A 3G6VA 2ATLA 4I4TF 4J9RA 2VQDA 4J0MA 4I50F 4DV6H 1Z2PX 3GV5B 2FLNA 3T5JA 4ED0A 3RB4A 2OLSA 5LA6F 2W6PA 4ZOLF 2J6SA 4NXNH 3GIQA 2NU9B 1I7NA 2BQ3A 2WB1A 3M9MB 5JVDF 2FLPA 2V9WA 4EGJA 1KJIA 4YAKB 4EYIB 5KKNB 2R8IA 2CKZB 5DQGA 5DQHA 2NU8B 1M7JA 2WYOA 1DV2A 4GC7A 5KG2A 4U7CA 4LFAH 2FKLA 4YAJB 3RF2A 1OWTA 4MV7A 5L9XA 5CA0F 4YY3H 5DLGA 3I12A 3RJ0A 1FKAH 4O3RA 2UXBH 1RYSA 4ECZA 1E4FT 1BJTA 4DV5H 4QW8A 4X65H 5EWEA 3RB6A 2R87A 5KT4A 3BQ2A 3KXYT 4Q45A 1K1QA 3GIIA 2W8KA 4JI5H 5IT9W 5KFHA 2WAQA 2R84A 5C1PA 2IBKA 2DWCA 1EHIA 2DIKA 1WR2A 5KG4A 4ZHQF 5JH7F 5KT2A 2W71A 2CW8A 1DIKA 2FPGB 4ECRA 4XZ3B 1I50A 2HGSA 5F9LA 3KHHA 4IWYA 2PMZE 1C30A 5EZYF 3I4NG 2R86A 3M4IA 2V4QA 1GLVA 2VOBA 2ASJA 3PW0A 1E4EB 4HNVA 3MWDA 1T3NA 4A3EG 2JA5G 3GTPA 5H80A 3PW2A 1XMQH 1TWFA 4EBDA 5BPFA 2NU6B 3LMLA
chains in the Genus database with same CATH topology
2M05A 2FJZA 1OWTA 2FMAA 4PWQA 2FK3A 2FK1A 3KTMA 2FK2A 2FKLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M05 A;  2FJZ A;  1OWT A;  2FMA A;  4PWQ A;  2FK3 A;  2FK1 A;  3KTM A;  2FK2 A;  2FKL A; 
#chains in the Genus database with same CATH topology
 3HXL A;  4YP3 A;  2W70 A;  3OTO H;  1RK5 A;  4AQY H;  4RNO A;  5GON F;  2V5A A;  4ECW A;  3MFI A;  2PMZ A;  1ZHQ A;  4J9S A;  3R5H A;  5KFN A;  5IYD G;  3G6Y A;  1WH2 A;  3JSN A;  5D1O B;  4EBC A;  1N33 H;  2JA5 A;  4A3G G;  2W6Q A;  2CZG A;  3ETJ A;  1M6V A;  5DG7 A;  5KFW A;  4ZI7 F;  5IYC G;  1FJG H;  3QFF A;  2JA7 A;  5D1P A;  4EEQ A;  2XGQ A;  5EOY A;  2Q2T A;  2RGR A;  4LMY A;  2VPS A;  3J7A K;  2R7Z A;  4RB1 A;  2UVW A;  2C2E A;  3GIM A;  3BQ0 A;  2YS6 A;  4UCO A;  5C4X G;  2R8G A;  5LL6 b;  4X62 H;  4RAZ A;  3GTQ A;  1GSH A;  4DV2 H;  5KFD A;  3JRX A;  5LP6 F;  3OHA A;  2YRW A;  3PR5 B;  2JA7 G;  1AUX A;  2IMW P;  3V4S A;  1RJR A;  2R7Z G;  4IRC A;  2FPP B;  4QIW A;  4JYA H;  2W9B A;  4DR3 H;  5EDW A;  3RTX A;  2ASL A;  2IA6 A;  4Y8V B;  4ED8 A;  2FB9 A;  1WSC A;  2C28 A;  2JA8 G;  1TWH A;  2AQ4 A;  4BWS C;  4ECX A;  3T5L A;  1BGW A;  1EUD B;  1TWA A;  2R85 A;  2WTF A;  4ECY A;  3T1H H;  1N48 A;  2R92 G;  4IHJ F;  1XNR H;  4BBS G;  2J9G A;  5KG3 A;  2DPJ A;  4DR6 H;  5KT7 A;  1ULZ A;  3IN5 A;  4TQS A;  3PN1 A;  4ECQ A;  3H20 A;  1Y1V A;  5JVL A;  1JLL B;  4R7R A;  2ZDH A;  4FU0 A;  3VPD A;  3RGZ A;  3LWB A;  4B3T H;  4O3Q A;  4DR2 H;  1Y14 B;  3T5H A;  4FBU A;  1TWG A;  1EYZ A;  5LYJ F;  4J9L A;  2GLT A;  4ME6 A;  2ZM6 H;  2W7O A;  3BAB A;  4C5B A;  2YU9 A;  2R93 A;  3FMA A;  4J9P A;  5FD5 A;  4JV0 A;  4UCS A;  4YBZ B;  3EPG A;  2AGO A;  1UC9 A;  3R23 A;  2E5L H;  2IP4 A;  1GSO A;  3WO0 A;  4LFC H;  4DUZ H;  3NGD A;  4WBN F;  5KX5 F;  4YHH H;  4LF6 H;  3KHG A;  4LH6 A;  4WD3 A;  4I55 F;  1S97 A;  2J6U A;  5FLX W;  2Q2U A;  2VA3 A;  4Q8F A;  2BQU A;  5KG6 A;  4MV6 A;  3SE7 A;  4DL4 A;  3K5I A;  4X64 H;  2FP4 B;  2V58 A;  1GSA A;  3AYH B;  1CQI B;  5KFC A;  4EBE A;  5HBR B;  4DLK A;  3H4D A;  3OUZ A;  1HNX H;  3FDS A;  3H0G G;  3BG5 A;  2NUA B;  1B6R A;  2R7N A;  1SFO A;  3WO1 A;  1J5E H;  3HKZ A;  5LOV F;  4ED3 A;  1HNZ H;  1C3O A;  2P0A A;  4O2B F;  5KT3 A;  5C8Y F;  3PR4 A;  5FJ8 G;  1DGS A;  1SCU B;  2RDJ A;  2VQE H;  2X0S A;  4DL2 A;  1B04 A;  1IBM H;  3F8N A;  1I3Q A;  4QWD A;  4JI1 H;  2MCT A;  1KJ8 A;  5KT6 A;  4YQW A;  4G3I A;  5IP9 G;  3RGX A;  5J2U F;  3GIK A;  2C2R A;  3R5X A;  1I7L A;  4RZQ A;  5J2T F;  5L1L A;  5LMN H;  4QWB A;  3IG0 A;  4TV8 F;  4ED6 A;  4EEY A;  5KFU A;  2QYZ A;  4DV0 H;  4F4Y A;  4J9N A;  5KFQ A;  3RUP A;  4A93 G;  3GIP A;  5KFY A;  4DV4 H;  3SI8 A;  1IBK H;  4ECT A;  4RZR A;  2PVP A;  2FE3 A;  2I8C A;  3BQ1 A;  1E4G T;  2O03 A;  5L1J A;  4UCU A;  4A3M G;  3RBD A;  1GYF A;  4RB2 C;  2W8L A;  5CAE B;  4JV1 A;  1M0W A;  5KFZ A;  5F9N A;  4R8U B;  2XIG A;  4A3I G;  2HJW A;  4FM9 A;  2F4V H;  3I4M G;  4DV7 H;  4DR7 H;  1JDB B;  1JKJ B;  2CQY A;  2ZDQ A;  3N8D A;  5FPO A;  2I80 A;  4YJ2 F;  4Q8E A;  4RU9 A;  2DPI A;  2R8H A;  4MV4 A;  3N43 B;  3H40 A;  5KFR A;  3RV3 A;  1VBG A;  2KSW A;  3Q8Q B;  2BQR A;  1V4Y A;  2YW2 A;  4HQ6 A;  2YZG A;  4X66 H;  3PZP A;  2GPS A;  3GLK A;  2AU0 A;  4J9M A;  4A3C G;  2R7K A;  5L1I A;  4LF8 H;  4MV1 A;  1JXL A;  2VUM G;  1IOV A;  1UC8 A;  2HVQ A;  4EFB A;  4ETS A;  5KFX A;  4B3M H;  1KJ9 A;  5KFJ A;  4B3S H;  2ASD A;  3BA8 A;  5KFV A;  3M9O B;  4LF4 H;  4TV9 F;  3Q8R B;  2UVR A;  1S0M A;  1XNQ H;  3U9S A;  3RFC A;  5FLM G;  5KFA A;  4DR5 H;  3MR6 A;  3KHL A;  5HV6 A;  3MR5 A;  4GC6 A;  2PBZ A;  4YJ3 F;  3V6K A;  1JIH A;  2HVS A;  4BY7 G;  4Q0Y A;  2YZN A;  3L2P A;  4QWE A;  2AGP A;  1FVI A;  4A3B G;  5KFT A;  3CVZ A;  4GLX A;  2R8K A;  2I87 A;  2W6Z A;  4JV5 H;  3N44 B;  5IYZ F;  3L4K A;  4QIW E;  5KFI A;  5IWA H;  4DL5 A;  3V4Z A;  5I47 A;  3M9N B;  3GV7 B;  4NLG A;  3T5K A;  2ZDG A;  1R9T A;  1TA8 A;  1W93 A;  4F4W A;  1KJQ A;  2B63 G;  4DR4 H;  5IP7 G;  5KFS A;  4A2A A;  4ED7 A;  2CW7 A;  4A3D G;  4O3O A;  3HOU G;  5DG8 A;  3KTM A;  5BPH A;  2DZD A;  2C00 A;  4NXM H;  4TUY F;  3RV4 A;  3EPI A;  5A2Q W;  3RIZ A;  4FS2 A;  1KEE A;  1S03 G;  3WNZ A;  5T14 A;  2C2D A;  4MTE A;  4B3R H;  3C0F B;  4DL6 A;  4UFZ A;  3FKI A;  3N41 B;  5KFE A;  2UXD H;  1T94 A;  2JA6 G;  2UVV A;  3HOY G;  4M7E A;  2NU7 B;  4MV9 A;  1B6S A;  1GGO A;  2RF4 A;  4M9U A;  4YB8 B;  1RYR A;  4EFE A;  3V6J A;  4IAJ A;  3GTK A;  4RB3 C;  5KFO A;  4ECV A;  3ORR A;  2Y0S A;  4LH7 A;  4ED1 A;  1S9F A;  2ZJT A;  3JSL A;  3DF7 A;  2FMA A;  4YR3 A;  3UQ8 A;  2AGQ A;  2RGV A;  5JQW A;  5CA1 F;  3RB0 A;  1PK8 A;  1TAE A;  1VBH A;  5DGB A;  4F4X A;  1PX2 A;  3MR2 A;  1L2Z A;  4UCV A;  4JI2 H;  4DV3 H;  4LF5 H;  1I6U A;  5D1O A;  3U9T A;  4E4T A;  4AYB E;  3K5H A;  1JDE A;  1KBL A;  1I94 H;  2VA2 A;  5IYB G;  1AN7 A;  1Y1V G;  3RB3 A;  4EYH B;  5LMU H;  5C5J A;  2QK4 A;  3HB9 A;  2NVX A;  4EGQ A;  4A2B A;  4LSX A;  4O2A F;  3JAM W;  3J81 W;  3T1Y H;  2UXC H;  3LP8 A;  3TQ1 A;  4RB0 A;  1IOW A;  3PVX A;  4U6P A;  1N56 A;  1A9X A;  2XCP A;  1WCM G;  1E4E A;  4DL7 A;  2J6T A;  4JI0 H;  1CS0 A;  3V6H A;  4XYM B;  4A3J G;  2NVY A;  4IRD A;  3H3V H;  2WB1 E;  2UUB H;  1BNC A;  5KFG A;  2VUM A;  3BA9 A;  1V51 A;  3KAJ A;  4K0K H;  4APM A;  5FD6 A;  4PDB A;  1W96 A;  1Z2N X;  2V4R A;  1SYX B;  3BAA A;  4XX0 B;  5C3E G;  3RAX A;  5BR8 H;  3ETH A;  4EG0 A;  3QZ7 A;  2W9C B;  3MFH A;  4A3K G;  4LFB H;  2UU9 H;  3KAK A;  1ZET A;  4DL3 A;  2YRX A;  4Q43 A;  4RNM A;  3OHB A;  4FS1 A;  4IRK A;  2JEI A;  4BY1 G;  4HR7 A;  4LSA A;  2WE6 A;  1Y1W G;  3GTJ A;  4OX9 H;  3GID A;  4IWX A;  4O4I F;  4A3L G;  4QWA A;  2OH2 A;  5JUM A;  3J80 W;  2RDI A;  3MWM A;  5EWG A;  4L1K A;  1VAJ A;  3TII A;  3BJY A;  3N42 B;  1S0N A;  4MAM A;  2W57 A;  3ORQ A;  4YR0 A;  4QWC A;  3TIN A;  1S10 A;  1N34 H;  4KHP H;  4Q44 A;  4RUA A;  3GIJ A;  2R92 A;  4JI8 H;  3EYY A;  4O3S A;  5KFP A;  4QJF A;  4JI4 H;  1JX4 A;  3JRW A;  2XCL A;  4C5A A;  1VS0 A;  2PN1 A;  1T36 A;  3E5N A;  1ZQ7 A;  4RUC A;  2XC9 A;  2WAQ E;  4JUZ A;  1P8L A;  1B33 N;  4DV1 H;  3PO2 G;  4UCT A;  1Z2O X;  4AYB A;  4F50 A;  2FJZ A;  3CQZ A;  3HOX G;  2JEJ A;  3GQC A;  4HNT A;  4BXX G;  2W9C A;  4FBT A;  1ZHS A;  1Y1W A;  1M0T A;  2R7L A;  4J9K A;  5K2M A;  4MA5 A;  2XGP A;  4JI7 H;  3KHR A;  4J9O A;  2VPQ A;  5KG1 A;  4A3F G;  3H4B A;  2JEG A;  3GTM A;  3Q2O A;  4XYL B;  4JV2 A;  2JA6 A;  2M05 A;  3JZI A;  3OSN A;  2W9A A;  3VPC A;  2FLL A;  3N40 P;  4ECU A;  1EUC B;  2FK3 A;  2Y0S E;  3Q1K A;  4MTD A;  2E2I A;  2FK2 A;  2UUC H;  3OSP A;  1HR0 H;  2R6F A;  4CC6 A;  3G8C A;  4I7H A;  4UCR A;  3TIG A;  2C35 B;  3PW4 A;  4ECS A;  4R8U A;  4GKK H;  1A0I A;  1K1S A;  1K83 A;  2SCU B;  1SEI A;  5KG7 A;  4O3N A;  5LXT F;  4J9Q A;  1HNW H;  4O3P A;  2R7M A;  3VPB A;  4JI6 H;  2VR1 A;  1AUV A;  1VKZ A;  3KAL A;  4QW9 A;  2DLN A;  2OWO A;  2R93 G;  1GO3 E;  2YL2 A;  3RAQ A;  3K3P A;  2YYA A;  5KFB A;  3Q8S B;  1N36 H;  3HOZ G;  4LF7 H;  5KG0 A;  2JEF A;  4MV3 A;  3PO3 G;  5KFL A;  4JI3 H;  1V9P A;  3PW7 A;  1UNN C;  3PW5 A;  4IR1 A;  4MA0 A;  1N32 H;  5BMV F;  3HBL A;  5EWF A;  2BR0 A;  4TQR A;  4C5C A;  2W9B B;  2W7P A;  4GKJ H;  2YZM A;  3H0G A;  4HNU A;  4C2M A;  4O4H F;  4PWQ A;  4ZQI A;  2FPI B;  5DGA A;  3N6X A;  3HKZ E;  4F4Z A;  4MV8 A;  4IR9 A;  2W6O A;  2HHH H;  5FPR A;  1DV1 A;  3MJF A;  4DR1 H;  3GTO A;  1S0O A;  4ED2 A;  2VUG A;  5KFM A;  1WCM A;  2XD4 A;  2V59 A;  2YCH A;  3MWE A;  3HOW G;  3HOV G;  2VQF H;  2ALZ A;  1RJQ A;  4DUY H;  3FKI G;  4O4L F;  2WDT A;  2HVR A;  5DQI A;  5D8D A;  5DLF A;  1RK6 A;  1RJP A;  5KG5 A;  1CQJ B;  2E2H A;  4IZO A;  3G6X A;  4LF9 H;  2UUA H;  4HYK A;  2C22 A;  2UVU A;  1BXR A;  4CC5 A;  4RNN A;  3K3V A;  2W6N A;  3UFX B;  1CE8 A;  3R5F A;  1EZ1 A;  1O75 A;  2W6M A;  1XMO H;  5L1K A;  2R8J A;  2XCA A;  3TQT A;  5KT5 A;  3GIL A;  5CB4 F;  3GTG A;  1MZB A;  5DG9 A;  3GTL A;  3MR3 A;  5C44 G;  1KJJ A;  1KC7 A;  1IBL H;  1XDN A;  2YS7 A;  2R82 A;  5C1O A;  3L4J A;  2FK1 A;  4RAY A;  3Q8P B;  5KFK A;  4YR2 A;  5KFF A;  3OUU A;  3GV8 B;  4BBR G;  3RBE A;  3VMM A;  1X9N A;  2B63 A;  1S68 A;  1TWC A;  2GPW A;  3QZ8 A;  3G6V A;  2ATL A;  4I4T F;  4J9R A;  2VQD A;  4J0M A;  4I50 F;  4DV6 H;  1Z2P X;  3GV5 B;  2FLN A;  3T5J A;  4ED0 A;  3RB4 A;  2OLS A;  5LA6 F;  2W6P A;  4ZOL F;  2J6S A;  4NXN H;  3GIQ A;  2NU9 B;  1I7N A;  2BQ3 A;  2WB1 A;  3M9M B;  5JVD F;  2FLP A;  2V9W A;  4EGJ A;  1KJI A;  4YAK B;  4EYI B;  5KKN B;  2R8I A;  2CKZ B;  5DQG A;  5DQH A;  2NU8 B;  1M7J A;  2WYO A;  1DV2 A;  4GC7 A;  5KG2 A;  4U7C A;  4LFA H;  2FKL A;  4YAJ B;  3RF2 A;  1OWT A;  4MV7 A;  5L9X A;  5CA0 F;  4YY3 H;  5DLG A;  3I12 A;  3RJ0 A;  1FKA H;  4O3R A;  2UXB H;  1RYS A;  4ECZ A;  1E4F T;  1BJT A;  4DV5 H;  4QW8 A;  4X65 H;  5EWE A;  3RB6 A;  2R87 A;  5KT4 A;  3BQ2 A;  3KXY T;  4Q45 A;  1K1Q A;  3GII A;  2W8K A;  4JI5 H;  5IT9 W;  5KFH A;  2WAQ A;  2R84 A;  5C1P A;  2IBK A;  2DWC A;  1EHI A;  2DIK A;  1WR2 A;  5KG4 A;  4ZHQ F;  5JH7 F;  5KT2 A;  2W71 A;  2CW8 A;  1DIK A;  2FPG B;  4ECR A;  4XZ3 B;  1I50 A;  2HGS A;  5F9L A;  3KHH A;  4IWY A;  2PMZ E;  1C30 A;  5EZY F;  3I4N G;  2R86 A;  3M4I A;  2V4Q A;  1GLV A;  2VOB A;  2ASJ A;  3PW0 A;  1E4E B;  4HNV A;  3MWD A;  1T3N A;  4A3E G;  2JA5 G;  3GTP A;  5H80 A;  3PW2 A;  1XMQ H;  1TWF A;  4EBD A;  5BPF A;  2NU6 B;  3LML A; 
#chains in the Genus database with same CATH homology
 2M05 A;  2FJZ A;  1OWT A;  2FMA A;  4PWQ A;  2FK3 A;  2FK1 A;  3KTM A;  2FK2 A;  2FKL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...