2FK3A

Structure of the alzheimer's amyloid precursor protein (app) copper binding domain in 'large unit cell' form
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
59
structure length
59
Chain Sequence
b'EACKFLHQERMDVCETHLHWHTVAKETCSEKSTNLHDYGMLLPCGIDKFRGVEFVCCPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Amyloid beta A4 protein precursor
publication title Structural Studies of the Alzheimer's Amyloid Precursor Protein Copper-binding Domain Reveal How it Binds Copper Ions
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal binding protein
total genus 12
structure length 59
sequence length 59
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2006-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.140 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Amyloidogenic glycoprotein, copper-binding domain 2fk3A00
3KTMA 2FK1A 2FK3A 2FJZA 2FMAA 2FK2A 4PWQA 2M05A 2FKLA 1OWTA
chains in the Genus database with same CATH superfamily
3L4KA 1W93A 5FPOA 2VUGA 4IAJA 3KHLA 3RAXA 4EBDA 3L4JA 1XDNA 3PR5B 3H4DA 4G3IA 5KT7A 4J9NA 5DG7A 2JA8G 3QFFA 5KG3A 3GTJA 3N40P 3MR5A 2DPIA 4CC5A 3HOZG 2PMZE 2DLNA 3RGXA 5C44G 1RK5A 4JI7H 4O4IF 1Y14B 4EEQA 4U6PA 2Y0SA 4CC6A 4IWYA 4MV1A 2R8KA 4A2AA 1Z2OX 2NU6B 2YW2A 4XYMB 3L2PA 4A3EG 1S0NA 4NLGA 4KHPH 5KT4A 3RB6A 2J6TA 4JV5H 5EZYF 2RGVA 2R7ZG 3KHHA 1GSAA 4JI3H 5HV6A 4GLXA 2HHHH 2V4QA 4B3SH 1CE8A 2UXBH 1WSCA 1EYZA 1V4YA 1RYRA 2R92A 1IOWA 3G6XA 4RNOA 1EUCB 2W9BA 2ASDA 5HBRB 3JZIA 2JA6A 4DR5H 1IOVA 4I4TF 4O3OA 5CA0F 4YJ2F 5CB4F 5IP7G 3OHBA 3GIJA 3M4IA 4QIWA 4ZI7F 2WAQE 5KFYA 4TV9F 1T3NA 2HVQA 1JIHA 3HOWG 4YP3A 4BY7G 2YZGA 4O3QA 1PK8A 3RGZA 1P8LA 1TWHA 3OUZA 4RAZA 2VQFH 3TINA 3HB9A 3RAQA 1TA8A 4QJFA 3GLKA 2ZJTA 4ECRA 3U9SA 4LF6H 3RBDA 2O03A 4B3TH 2HJWA 4DL3A 3QZ7A 3G8CA 1J5EH 4ECXA 2AU0A 5KFXA 4FBUA 4UCRA 2FB9A 5GONF 4EYIB 2RGRA 3T1YH 3U9TA 3GTKA 4ED7A 1TWGA 4RNNA 3V6HA 2FPGB 3CQZA 1V9PA 4J9LA 4DR2H 2JA7A 4FBTA 1XNRH 4EFBA 2VUMG 1XMQH 4A3JG 2W6MA 2FMAA 4QW8A 1VBGA 4FM9A 2R86A 3Q8RB 4NXNH 3TIIA 1B04A 4FU0A 4ED0A 4ECQA 4MV8A 3K3VA 2VQDA 4DV7H 1KJQA 1M7JA 2AGPA 5DQGA 4HNUA 3KALA 3ORQA 4DL4A 1AUVA 2C00A 3GQCA 2FJZA 4DR7H 5IYDG 5KT6A 3FKIA 4DLKA 4JUZA 1DIKA 1E4EB 5D1OB 4ED1A 1Z2NX 3T5LA 2VPSA 4AYBE 1AUXA 3GIIA 2UVRA 3T1HH 3N44B 4A93G 4X64H 2J9GA 3M9OB 1SFOA 1S0MA 4LF4H 5IT9W 2CKZB 3PO3G 3RUPA 2RDJA 4EGQA 4I50F 5LMUH 1HR0H 2C2DA 5KFJA 2XGPA 2FPPB 3MFHA 2W9CA 4LF5H 1M0WA 3MR2A 2NVXA 5KFDA 5LL6b 3MJFA 3PN1A 4O3NA 3PW5A 4YQWA 4O3SA 2UXCH 4L1KA 5A2QW 2YS7A 3N43B 2YU9A 1HNZH 3GTLA 3KHGA 4F50A 2KSWA 1KJJA 2R93G 4UCUA 2BQRA 4TQRA 3T5JA 5KFUA 1ZETA 1JXLA 4YR2A 1ZHQA 2IP4A 3AYHB 1RJPA 4HNTA 5KFKA 3BQ1A 4OX9H 1Y1WG 3I4NG 1UC8A 4ETSA 4ED6A 4J9MA 3T5HA 2CZGA 1SCUB 2HGSA 4Q8FA 4ECYA 4O3RA 3VMMA 1Y1VA 5DQIA 3PW4A 2XCLA 1BGWA 4MA5A 5KFQA 4O4LF 1Z2PX 4ED8A 5KKNB 3JSLA 4PWQA 2UU9H 1GYFA 3V4ZA 1BNCA 4Q43A 1GGOA 4AQYH 2R7NA 1V51A 4F4XA 2IMWP 4DV5H 4Q0YA 1BJTA 3Q8SB 1E4EA 4O2AF 5D1OA 3J80W 3NGDA 1TWAA 1RK6A 2B63G 3OHAA 1S9FA 4RUAA 1UC9A 3HOXG 3GTPA 3OTOH 2V4RA 3EYYA 3EPIA 2R7MA 1KBLA 2C35B 4O4HF 4J9RA 4J9PA 3MR3A 3BQ0A 4B3RH 3K5HA 2ZM6H 4MTEA 4DL5A 4J0MA 1WR2A 2R87A 1N32H 4ED3A 3BA8A 2XCPA 5I47A 3GIKA 2V59A 3PVXA 2VA2A 2PVPA 4C5CA 3RB0A 4YB8B 4GC7A 4JV2A 1WCMA 2PMZA 5K2MA 3R5HA 2JA5G 3MR6A 3GV7B 1K1SA 3GTGA 2W7OA 3LP8A 5DG8A 2JA7G 1TAEA 3HOVG 1VS0A 5EOYA 2CW8A 2YS6A 4PDBA 4IR1A 1B6SA 3BA9A 5BR8H 3PW0A 4DR6H 4UCTA 3VPBA 4YHHH 3SI8A 1S97A 3Q1KA 1GLVA 1SYXB 3MWMA 2GLTA 3RV3A 1I3QA 2OLSA 5BPHA 4RB3C 2BQ3A 5F9NA 2W9CB 3PW2A 1IBMH 5T14A 1EHIA 1O75A 4DR4H 2WB1E 4JI0H 4XYLB 4ECZA 3N41B 2UVUA 3BABA 5KFTA 5KG5A 4A3CG 4LMYA 4A3IG 1N33H 5KFIA 1VBHA 3JSNA 1FVIA 2I87A 2WAQA 3JRXA 4TQSA 2R8GA 4F4WA 1JDEA 3KXYT 2ASJA 2GPWA 4LFCH 5IYZF 5F9LA 1KC7A 4U7CA 3E5NA 3R23A 3CVZA 3JAMW 4LFBH 3WO1A 3H3VH 2W57A 4A2BA 4UFZA 4GC6A 2FLPA 3EPGA 3GV8B 3OSPA 1E4FT 1ZHSA 1N48A 3TQTA 1KJ9A 2YZMA 2P0AA 4B3MH 3ETHA 5DLFA 4JI5H 2V5AA 2UXDH 4X65H 1GSHA 2NVYA 3ETJA 4RU9A 3H0GG 2WTFA 2NU8B 5EWGA 2WDTA 1KJ8A 4RUCA 5FJ8G 1JDBB 1T94A 1FKAH 2WYOA 3V6KA 1S10A 2VQEH 1K1QA 3IN5A 4LSXA 1OWTA 1JLLB 2F4VH 2WE6A 5IP9G 4R7RA 5DG9A 3N42B 1TWFA 5FPRA 2FK2A 4RAYA 5DGBA 2R8HA 2OWOA 1B33N 2R8IA 4DV0H 5C1PA 2BQUA 3MFIA 5BPFA 3HKZE 2C28A 1FJGH 4FS2A 4MV9A 4EBCA 3RTXA 5EWFA 4Q44A 4HQ6A 3H40A 4YY3H 4MV6A 1RYSA 4BBRG 5CAEB 2C2EA 2RF4A 4DV1H 3G6YA 1N34H 2JEFA 1I7NA 5KFZA 4UCSA 4DUZH 3LWBA 4QWBA 2FP4B 4ME6A 5KG0A 4AYBA 4LSAA 1T36A 3PR4A 2UVVA 5KFFA 4RB0A 4C2MA 3J7AK 3HBLA 2VUMA 1S03G 2YYAA 4DR1H 2W6QA 3OSNA 2CW7A 4IRKA 3HKZA 4APMA 1A9XA 3Q8QB 5C8YF 4J9QA 4LFAH 3F8NA 5KFSA 3OUUA 5KG6A 3Q8PB 4ECWA 1HNWH 2W8KA 2XGQA 5DQHA 5LMNH 2J6SA 1VKZA 4UCVA 5KG4A 2XCAA 4BBSG 2R8JA 2PBZA 2SCUB 5KFVA 2J6UA 5FLMG 5LA6F 3ORRA 2W71A 3VPDA 5JH7F 4J9KA 4ECVA 3WNZA 4MTDA 3H20A 4M9UA 5CA1F 3I12A 2V58A 3DF7A 2CQYA 2QYZA 2FE3A 2R92G 3R5FA 2R7KA 4X62H 4DV3H 2Q2UA 4RZRA 2FKLA 4DL6A 4Y8VB 4YAKB 1X9NA 1MZBA 4WD3A 1C3OA 4I7HA 2JA6G 4A3GG 3SE7A 4ZHQF 1DGSA 4A3BG 1I6UA 2W6ZA 2Y0SE 2W6OA 4O3PA 5LP6F 1ZQ7A 1E4GT 2UUCH 1DV2A 3GTOA 2UUAH 3RFCA 5KG7A 1M6VA 4C5BA 1R9TA 4LH6A 4RNMA 4MV7A 4A3MG 3FDSA 3JRWA 3KHRA 4LF8H 5KT3A 2UVWA 2R93A 1L2ZA 3GV5B 1I50A 4QW9A 3HOUG 4XX0B 2ATLA 1C30A 4DR3H 3RV4A 2GPSA 4J9SA 2IA6A 2FPIB 4E4TA 2M05A 5KG1A 1S0OA 1Y1WA 4TV8F 2W8LA 1A0IA 1PX2A 4WBNF 5JUMA 1M0TA 5KFWA 3K5IA 1IBLH 1W96A 4YJ3F 1UNNC 3GIQA 5KFRA 3PZPA 2YRWA 5KFHA 4QIWE 2UUBH 1ULZA 2FK3A 2R6FA 3K3PA 3QZ8A 5FLXW 2DWCA 4R8UB 2YCHA 5KFGA 5KFMA 4RB1A 4YR0A 3TQ1A 4EYHB 2E2HA 4MAMA 4MV4A 4O2BF 1N36H 2DPJA 5KFAA 4BY1G 2DZDA 2W7PA 3KTMA 2ASLA 2W6PA 2RDIA 4QWCA 4A3FG 4MV3A 3T5KA 5FD6A 4MA0A 5EWEA 4K0KH 5KT5A 3GILA 4BWSC 5DLGA 3V4SA 3BJYA 2B63A 3KAKA 1HNXH 4HNVA 2YL2A 3M9MB 2HVRA 5L1IA 4JI6H 2NU9B 3RB4A 4DL7A 3V6JA 3BAAA 3GTMA 1B6RA 4A3DG 4HYKA 4Q45A 5IYBG 5C3EG 4Q8EA 2E2IA 3I4MG 1CQJB 3FKIG 3RJ0A 4A3KG 3FMAA 5LYJF 2XC9A 4BXXG 3RBEA 3MWEA 1N56A 2E5LH 1XNQH 2R7ZA 2DIKA 4J9OA 2R84A 3RF2A 2W6NA 1CQIB 2W9AA 5C4XG 4IHJF 2WB1A 4DV4H 1EZ1A 3J81W 1JX4A 5KX5F 5KT2A 4DV2H 2I80A 2OH2A 2PN1A 4ZQIA 5JQWA 4LF7H 2JA5A 5KFNA 4QWAA 4ED2A 3HOYG 2VOBA 4JI2H 2R85A 4ECSA 4IRDA 2V9WA 1IBKH 4IR9A 1BXRA 3IG0A 4GKJH 3VPCA 4ZOLF 5C1OA 2ZDGA 2QK4A 4C5AA 3BG5A 2XIGA 4F4YA 2AGOA 5IWAH 5FD5A 1GO3E 2X0SA 4JV0A 2I8CA 3GIPA 4RZQA 1KEEA 4EBEA 3C0FB 1DV1A 2YZNA 3LMLA 3TIGA 5EDWA 2R82A 4R8UA 1K83A 2VR1A 3R5XA 5KFOA 3M9NB 4EEYA 5H80A 2C22A 2W70A 2C2RA 4NXMH 3UFXB 3GIMA 2AGQA 5LXTF 1Y1VG 1I94H 2FLNA 2JEJA 4X66H 5LOVF 3GIDA 4FS1A 1TWCA 3UQ8A 3PO2G 2YRXA 2FLLA 4LH7A 4IZOA 3N8DA 5IYCG 2ZDQA 2BR0A 2MCTA 1SEIA 2AQ4A 5KFEA 1RJRA 4EFEA 5L1JA 3H4BA 5DGAA 2ALZA 5JVLA 1EUDB 5D1PA 5BMVF 1AN7A 1CS0A 4RB2C 3GTQA 1I7LA 2Q2TA 2ZDHA 2VPQA 5JVDF 3Q2OA 2IBKA 4GKKH 5J2UF 1GSOA 4TUYF 5KFLA 3MWDA 4JYAH 3H0GA 5J2TF 5KFCA 3G6VA 4HR7A 2VA3A 3KAJA 4DV6H 3BQ2A 5L1LA 2HVSA 4QWDA 4JI8H 4YR3A 1RJQA 4UCOA 3WO0A 4YBZB 4XZ3B 2NU7B 4I55F 4DUYH 4ECTA 4ECUA 3RIZA 2R7LA 3RB3A 2W9BB 4F4ZA 5C5JA 5L1KA 5KFPA 4EG0A 4DL2A 1JKJB 1WCMG 5KG2A 4JV1A 5L9XA 1XMOH 2JEGA 4QWEA 3PW7A 4M7EA 4LF9H 4IWXA 2XD4A 4JI4H 4A3LG 1WH2A 2FK1A 2JEIA 1KJIA 5D8DA 4IRCA 3HXLA 3N6XA 2NUAB 4EGJA 5KFBA 4YAJB 1VAJA 1S68A 4JI1H
chains in the Genus database with same CATH topology
3KTMA 2FK1A 2FK3A 2FJZA 2FMAA 2FK2A 4PWQA 2M05A 2FKLA 1OWTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KTM A;  2FK1 A;  2FK3 A;  2FJZ A;  2FMA A;  2FK2 A;  4PWQ A;  2M05 A;  2FKL A;  1OWT A; 
#chains in the Genus database with same CATH topology
 3L4K A;  1W93 A;  5FPO A;  2VUG A;  4IAJ A;  3KHL A;  3RAX A;  4EBD A;  3L4J A;  1XDN A;  3PR5 B;  3H4D A;  4G3I A;  5KT7 A;  4J9N A;  5DG7 A;  2JA8 G;  3QFF A;  5KG3 A;  3GTJ A;  3N40 P;  3MR5 A;  2DPI A;  4CC5 A;  3HOZ G;  2PMZ E;  2DLN A;  3RGX A;  5C44 G;  1RK5 A;  4JI7 H;  4O4I F;  1Y14 B;  4EEQ A;  4U6P A;  2Y0S A;  4CC6 A;  4IWY A;  4MV1 A;  2R8K A;  4A2A A;  1Z2O X;  2NU6 B;  2YW2 A;  4XYM B;  3L2P A;  4A3E G;  1S0N A;  4NLG A;  4KHP H;  5KT4 A;  3RB6 A;  2J6T A;  4JV5 H;  5EZY F;  2RGV A;  2R7Z G;  3KHH A;  1GSA A;  4JI3 H;  5HV6 A;  4GLX A;  2HHH H;  2V4Q A;  4B3S H;  1CE8 A;  2UXB H;  1WSC A;  1EYZ A;  1V4Y A;  1RYR A;  2R92 A;  1IOW A;  3G6X A;  4RNO A;  1EUC B;  2W9B A;  2ASD A;  5HBR B;  3JZI A;  2JA6 A;  4DR5 H;  1IOV A;  4I4T F;  4O3O A;  5CA0 F;  4YJ2 F;  5CB4 F;  5IP7 G;  3OHB A;  3GIJ A;  3M4I A;  4QIW A;  4ZI7 F;  2WAQ E;  5KFY A;  4TV9 F;  1T3N A;  2HVQ A;  1JIH A;  3HOW G;  4YP3 A;  4BY7 G;  2YZG A;  4O3Q A;  1PK8 A;  3RGZ A;  1P8L A;  1TWH A;  3OUZ A;  4RAZ A;  2VQF H;  3TIN A;  3HB9 A;  3RAQ A;  1TA8 A;  4QJF A;  3GLK A;  2ZJT A;  4ECR A;  3U9S A;  4LF6 H;  3RBD A;  2O03 A;  4B3T H;  2HJW A;  4DL3 A;  3QZ7 A;  3G8C A;  1J5E H;  4ECX A;  2AU0 A;  5KFX A;  4FBU A;  4UCR A;  2FB9 A;  5GON F;  4EYI B;  2RGR A;  3T1Y H;  3U9T A;  3GTK A;  4ED7 A;  1TWG A;  4RNN A;  3V6H A;  2FPG B;  3CQZ A;  1V9P A;  4J9L A;  4DR2 H;  2JA7 A;  4FBT A;  1XNR H;  4EFB A;  2VUM G;  1XMQ H;  4A3J G;  2W6M A;  2FMA A;  4QW8 A;  1VBG A;  4FM9 A;  2R86 A;  3Q8R B;  4NXN H;  3TII A;  1B04 A;  4FU0 A;  4ED0 A;  4ECQ A;  4MV8 A;  3K3V A;  2VQD A;  4DV7 H;  1KJQ A;  1M7J A;  2AGP A;  5DQG A;  4HNU A;  3KAL A;  3ORQ A;  4DL4 A;  1AUV A;  2C00 A;  3GQC A;  2FJZ A;  4DR7 H;  5IYD G;  5KT6 A;  3FKI A;  4DLK A;  4JUZ A;  1DIK A;  1E4E B;  5D1O B;  4ED1 A;  1Z2N X;  3T5L A;  2VPS A;  4AYB E;  1AUX A;  3GII A;  2UVR A;  3T1H H;  3N44 B;  4A93 G;  4X64 H;  2J9G A;  3M9O B;  1SFO A;  1S0M A;  4LF4 H;  5IT9 W;  2CKZ B;  3PO3 G;  3RUP A;  2RDJ A;  4EGQ A;  4I50 F;  5LMU H;  1HR0 H;  2C2D A;  5KFJ A;  2XGP A;  2FPP B;  3MFH A;  2W9C A;  4LF5 H;  1M0W A;  3MR2 A;  2NVX A;  5KFD A;  5LL6 b;  3MJF A;  3PN1 A;  4O3N A;  3PW5 A;  4YQW A;  4O3S A;  2UXC H;  4L1K A;  5A2Q W;  2YS7 A;  3N43 B;  2YU9 A;  1HNZ H;  3GTL A;  3KHG A;  4F50 A;  2KSW A;  1KJJ A;  2R93 G;  4UCU A;  2BQR A;  4TQR A;  3T5J A;  5KFU A;  1ZET A;  1JXL A;  4YR2 A;  1ZHQ A;  2IP4 A;  3AYH B;  1RJP A;  4HNT A;  5KFK A;  3BQ1 A;  4OX9 H;  1Y1W G;  3I4N G;  1UC8 A;  4ETS A;  4ED6 A;  4J9M A;  3T5H A;  2CZG A;  1SCU B;  2HGS A;  4Q8F A;  4ECY A;  4O3R A;  3VMM A;  1Y1V A;  5DQI A;  3PW4 A;  2XCL A;  1BGW A;  4MA5 A;  5KFQ A;  4O4L F;  1Z2P X;  4ED8 A;  5KKN B;  3JSL A;  4PWQ A;  2UU9 H;  1GYF A;  3V4Z A;  1BNC A;  4Q43 A;  1GGO A;  4AQY H;  2R7N A;  1V51 A;  4F4X A;  2IMW P;  4DV5 H;  4Q0Y A;  1BJT A;  3Q8S B;  1E4E A;  4O2A F;  5D1O A;  3J80 W;  3NGD A;  1TWA A;  1RK6 A;  2B63 G;  3OHA A;  1S9F A;  4RUA A;  1UC9 A;  3HOX G;  3GTP A;  3OTO H;  2V4R A;  3EYY A;  3EPI A;  2R7M A;  1KBL A;  2C35 B;  4O4H F;  4J9R A;  4J9P A;  3MR3 A;  3BQ0 A;  4B3R H;  3K5H A;  2ZM6 H;  4MTE A;  4DL5 A;  4J0M A;  1WR2 A;  2R87 A;  1N32 H;  4ED3 A;  3BA8 A;  2XCP A;  5I47 A;  3GIK A;  2V59 A;  3PVX A;  2VA2 A;  2PVP A;  4C5C A;  3RB0 A;  4YB8 B;  4GC7 A;  4JV2 A;  1WCM A;  2PMZ A;  5K2M A;  3R5H A;  2JA5 G;  3MR6 A;  3GV7 B;  1K1S A;  3GTG A;  2W7O A;  3LP8 A;  5DG8 A;  2JA7 G;  1TAE A;  3HOV G;  1VS0 A;  5EOY A;  2CW8 A;  2YS6 A;  4PDB A;  4IR1 A;  1B6S A;  3BA9 A;  5BR8 H;  3PW0 A;  4DR6 H;  4UCT A;  3VPB A;  4YHH H;  3SI8 A;  1S97 A;  3Q1K A;  1GLV A;  1SYX B;  3MWM A;  2GLT A;  3RV3 A;  1I3Q A;  2OLS A;  5BPH A;  4RB3 C;  2BQ3 A;  5F9N A;  2W9C B;  3PW2 A;  1IBM H;  5T14 A;  1EHI A;  1O75 A;  4DR4 H;  2WB1 E;  4JI0 H;  4XYL B;  4ECZ A;  3N41 B;  2UVU A;  3BAB A;  5KFT A;  5KG5 A;  4A3C G;  4LMY A;  4A3I G;  1N33 H;  5KFI A;  1VBH A;  3JSN A;  1FVI A;  2I87 A;  2WAQ A;  3JRX A;  4TQS A;  2R8G A;  4F4W A;  1JDE A;  3KXY T;  2ASJ A;  2GPW A;  4LFC H;  5IYZ F;  5F9L A;  1KC7 A;  4U7C A;  3E5N A;  3R23 A;  3CVZ A;  3JAM W;  4LFB H;  3WO1 A;  3H3V H;  2W57 A;  4A2B A;  4UFZ A;  4GC6 A;  2FLP A;  3EPG A;  3GV8 B;  3OSP A;  1E4F T;  1ZHS A;  1N48 A;  3TQT A;  1KJ9 A;  2YZM A;  2P0A A;  4B3M H;  3ETH A;  5DLF A;  4JI5 H;  2V5A A;  2UXD H;  4X65 H;  1GSH A;  2NVY A;  3ETJ A;  4RU9 A;  3H0G G;  2WTF A;  2NU8 B;  5EWG A;  2WDT A;  1KJ8 A;  4RUC A;  5FJ8 G;  1JDB B;  1T94 A;  1FKA H;  2WYO A;  3V6K A;  1S10 A;  2VQE H;  1K1Q A;  3IN5 A;  4LSX A;  1OWT A;  1JLL B;  2F4V H;  2WE6 A;  5IP9 G;  4R7R A;  5DG9 A;  3N42 B;  1TWF A;  5FPR A;  2FK2 A;  4RAY A;  5DGB A;  2R8H A;  2OWO A;  1B33 N;  2R8I A;  4DV0 H;  5C1P A;  2BQU A;  3MFI A;  5BPF A;  3HKZ E;  2C28 A;  1FJG H;  4FS2 A;  4MV9 A;  4EBC A;  3RTX A;  5EWF A;  4Q44 A;  4HQ6 A;  3H40 A;  4YY3 H;  4MV6 A;  1RYS A;  4BBR G;  5CAE B;  2C2E A;  2RF4 A;  4DV1 H;  3G6Y A;  1N34 H;  2JEF A;  1I7N A;  5KFZ A;  4UCS A;  4DUZ H;  3LWB A;  4QWB A;  2FP4 B;  4ME6 A;  5KG0 A;  4AYB A;  4LSA A;  1T36 A;  3PR4 A;  2UVV A;  5KFF A;  4RB0 A;  4C2M A;  3J7A K;  3HBL A;  2VUM A;  1S03 G;  2YYA A;  4DR1 H;  2W6Q A;  3OSN A;  2CW7 A;  4IRK A;  3HKZ A;  4APM A;  1A9X A;  3Q8Q B;  5C8Y F;  4J9Q A;  4LFA H;  3F8N A;  5KFS A;  3OUU A;  5KG6 A;  3Q8P B;  4ECW A;  1HNW H;  2W8K A;  2XGQ A;  5DQH A;  5LMN H;  2J6S A;  1VKZ A;  4UCV A;  5KG4 A;  2XCA A;  4BBS G;  2R8J A;  2PBZ A;  2SCU B;  5KFV A;  2J6U A;  5FLM G;  5LA6 F;  3ORR A;  2W71 A;  3VPD A;  5JH7 F;  4J9K A;  4ECV A;  3WNZ A;  4MTD A;  3H20 A;  4M9U A;  5CA1 F;  3I12 A;  2V58 A;  3DF7 A;  2CQY A;  2QYZ A;  2FE3 A;  2R92 G;  3R5F A;  2R7K A;  4X62 H;  4DV3 H;  2Q2U A;  4RZR A;  2FKL A;  4DL6 A;  4Y8V B;  4YAK B;  1X9N A;  1MZB A;  4WD3 A;  1C3O A;  4I7H A;  2JA6 G;  4A3G G;  3SE7 A;  4ZHQ F;  1DGS A;  4A3B G;  1I6U A;  2W6Z A;  2Y0S E;  2W6O A;  4O3P A;  5LP6 F;  1ZQ7 A;  1E4G T;  2UUC H;  1DV2 A;  3GTO A;  2UUA H;  3RFC A;  5KG7 A;  1M6V A;  4C5B A;  1R9T A;  4LH6 A;  4RNM A;  4MV7 A;  4A3M G;  3FDS A;  3JRW A;  3KHR A;  4LF8 H;  5KT3 A;  2UVW A;  2R93 A;  1L2Z A;  3GV5 B;  1I50 A;  4QW9 A;  3HOU G;  4XX0 B;  2ATL A;  1C30 A;  4DR3 H;  3RV4 A;  2GPS A;  4J9S A;  2IA6 A;  2FPI B;  4E4T A;  2M05 A;  5KG1 A;  1S0O A;  1Y1W A;  4TV8 F;  2W8L A;  1A0I A;  1PX2 A;  4WBN F;  5JUM A;  1M0T A;  5KFW A;  3K5I A;  1IBL H;  1W96 A;  4YJ3 F;  1UNN C;  3GIQ A;  5KFR A;  3PZP A;  2YRW A;  5KFH A;  4QIW E;  2UUB H;  1ULZ A;  2FK3 A;  2R6F A;  3K3P A;  3QZ8 A;  5FLX W;  2DWC A;  4R8U B;  2YCH A;  5KFG A;  5KFM A;  4RB1 A;  4YR0 A;  3TQ1 A;  4EYH B;  2E2H A;  4MAM A;  4MV4 A;  4O2B F;  1N36 H;  2DPJ A;  5KFA A;  4BY1 G;  2DZD A;  2W7P A;  3KTM A;  2ASL A;  2W6P A;  2RDI A;  4QWC A;  4A3F G;  4MV3 A;  3T5K A;  5FD6 A;  4MA0 A;  5EWE A;  4K0K H;  5KT5 A;  3GIL A;  4BWS C;  5DLG A;  3V4S A;  3BJY A;  2B63 A;  3KAK A;  1HNX H;  4HNV A;  2YL2 A;  3M9M B;  2HVR A;  5L1I A;  4JI6 H;  2NU9 B;  3RB4 A;  4DL7 A;  3V6J A;  3BAA A;  3GTM A;  1B6R A;  4A3D G;  4HYK A;  4Q45 A;  5IYB G;  5C3E G;  4Q8E A;  2E2I A;  3I4M G;  1CQJ B;  3FKI G;  3RJ0 A;  4A3K G;  3FMA A;  5LYJ F;  2XC9 A;  4BXX G;  3RBE A;  3MWE A;  1N56 A;  2E5L H;  1XNQ H;  2R7Z A;  2DIK A;  4J9O A;  2R84 A;  3RF2 A;  2W6N A;  1CQI B;  2W9A A;  5C4X G;  4IHJ F;  2WB1 A;  4DV4 H;  1EZ1 A;  3J81 W;  1JX4 A;  5KX5 F;  5KT2 A;  4DV2 H;  2I80 A;  2OH2 A;  2PN1 A;  4ZQI A;  5JQW A;  4LF7 H;  2JA5 A;  5KFN A;  4QWA A;  4ED2 A;  3HOY G;  2VOB A;  4JI2 H;  2R85 A;  4ECS A;  4IRD A;  2V9W A;  1IBK H;  4IR9 A;  1BXR A;  3IG0 A;  4GKJ H;  3VPC A;  4ZOL F;  5C1O A;  2ZDG A;  2QK4 A;  4C5A A;  3BG5 A;  2XIG A;  4F4Y A;  2AGO A;  5IWA H;  5FD5 A;  1GO3 E;  2X0S A;  4JV0 A;  2I8C A;  3GIP A;  4RZQ A;  1KEE A;  4EBE A;  3C0F B;  1DV1 A;  2YZN A;  3LML A;  3TIG A;  5EDW A;  2R82 A;  4R8U A;  1K83 A;  2VR1 A;  3R5X A;  5KFO A;  3M9N B;  4EEY A;  5H80 A;  2C22 A;  2W70 A;  2C2R A;  4NXM H;  3UFX B;  3GIM A;  2AGQ A;  5LXT F;  1Y1V G;  1I94 H;  2FLN A;  2JEJ A;  4X66 H;  5LOV F;  3GID A;  4FS1 A;  1TWC A;  3UQ8 A;  3PO2 G;  2YRX A;  2FLL A;  4LH7 A;  4IZO A;  3N8D A;  5IYC G;  2ZDQ A;  2BR0 A;  2MCT A;  1SEI A;  2AQ4 A;  5KFE A;  1RJR A;  4EFE A;  5L1J A;  3H4B A;  5DGA A;  2ALZ A;  5JVL A;  1EUD B;  5D1P A;  5BMV F;  1AN7 A;  1CS0 A;  4RB2 C;  3GTQ A;  1I7L A;  2Q2T A;  2ZDH A;  2VPQ A;  5JVD F;  3Q2O A;  2IBK A;  4GKK H;  5J2U F;  1GSO A;  4TUY F;  5KFL A;  3MWD A;  4JYA H;  3H0G A;  5J2T F;  5KFC A;  3G6V A;  4HR7 A;  2VA3 A;  3KAJ A;  4DV6 H;  3BQ2 A;  5L1L A;  2HVS A;  4QWD A;  4JI8 H;  4YR3 A;  1RJQ A;  4UCO A;  3WO0 A;  4YBZ B;  4XZ3 B;  2NU7 B;  4I55 F;  4DUY H;  4ECT A;  4ECU A;  3RIZ A;  2R7L A;  3RB3 A;  2W9B B;  4F4Z A;  5C5J A;  5L1K A;  5KFP A;  4EG0 A;  4DL2 A;  1JKJ B;  1WCM G;  5KG2 A;  4JV1 A;  5L9X A;  1XMO H;  2JEG A;  4QWE A;  3PW7 A;  4M7E A;  4LF9 H;  4IWX A;  2XD4 A;  4JI4 H;  4A3L G;  1WH2 A;  2FK1 A;  2JEI A;  1KJI A;  5D8D A;  4IRC A;  3HXL A;  3N6X A;  2NUA B;  4EGJ A;  5KFB A;  4YAJ B;  1VAJ A;  1S68 A;  4JI1 H; 
#chains in the Genus database with same CATH homology
 3KTM A;  2FK1 A;  2FK3 A;  2FJZ A;  2FMA A;  2FK2 A;  4PWQ A;  2M05 A;  2FKL A;  1OWT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...