3PO3G

Arrested rna polymerase ii reactivation intermediate
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po3G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po3G01
2Y0SE 5C4XG 4PG3A 1VQHA 1HNZL 4BXXH 1PFSA 2K52A 2D0OA 2JEBI 3RR5A 1YZ6A 3M4QA 5FJ8H 4JI3L 1NJIC 1AH9A 2DUDA 4JG2A 4P72A 2YU9H 2RHQB 3I4MG 3PSIA 4AH6A 3HOXH 3NENA 2Q2UA 1NE3A 4HJ7A 2A19A 1UE6A 1FVIA 5H1SE 2CWPA 3PGZA 1Q7YC 1XNQQ 1VQOA 2K5HA 1HNWQ 2LXKA 2I0QA 2RF4A 1NMFA 3OYYA 1TWHH 4OXPA 4DR5L 4IPGA 1SMXA 5FLMG 3F8TA 3KOJA 1D8LA 3CMAA 2VQFL 5C4XH 1HR0W 1IBML 2ZJQA 3GTGH 3GTMH 4JYAQ 1X6OA 3CMEA 5LMUL 3T1HQ 3I4NG 5IT9c 1N32Q 1YVCA 1V1QA 1VQBA 3W1GA 3I4MH 1EFWA 1PH7A 1SN8A 4JI7Q 4LF9L 4UP8A 2B29A 1HR0L 2OWOA 3H3VH 1HJPA 5C0XI 4QJFA 3F2DA 5JJKA 1YI2A 4LF6L 1UEBA 3FKIG 3ICEA 1PHJA 4ALPA 1HZCA 2YV5A 5FLMH 3H0GG 3CP0A 1A0IA 3E9IA 4ME3A 3CCSA 4QQBX 4BBRH 1I94Q 3I4NH 4GLVB 2UU9L 2OCEA 3KF8B 1VQAA 4YHHL 3L2PA 3KFUA 4A75A 1M90C 4LUZA 4LFAL 1IBLQ 2Z0SA 4UPAA 3RN5A 1Q81C 2XGTA 4GLAC 4MZ9A 4B3RQ 3GTLH 1PH2A 1HNXL 2RHSB 3GTOH 4JBJA 1GD7A 2NZHA 3FKIH 4AYBE 1EIYB 2AHOB 2I5MX 3GD7A 3OW2A 5JEAG 2OQ0A 3H0GH 3S15H 4IPCA 2UUAQ 4NPSA 5JEAJ 1PH1A 2CWAA 1CKOA 1T9HA 2H5XA 2CCZA 3ER0A 4JI1Q 3I55A 1QUQA 2WP8J 2VUMG 4DR4L 1XNQL 1VQDA 1HNWL 2Q2TA 3M9BA 3JC66 1LUZA 2JA5G 3K81C 4OX9L 4LUVA 1VQ7A 1J5EL 4EX5A 4GNXC 4JI0Q 1VS0A 4JYAL 3D0FA 3HOVG 3T1HL 1C9OA 3KJOA 4P71A 1N33Q 4A3FG 1K9MC 2DGYA 1N32L 2I5LX 3RLOA 2MQHA 4QGUA 4A3MG 4JI7L 2VL6A 3W5OA 4DR3Q 1RL2A 5IE8A 5M3MG 2VUMH 3FP9A 4IFDI 2GVBA 1LTLA 4A3EG 2N3SA 1N8RC 4FDBA 1VQLA 3GDEA 2EXDA 3HOZG 1Z9FA 4RMFA 1GM5A 2JA5H 3BZKA 1JB7A 3RLFA 3A5ZB 4Y7NH 3J81j 3GTPH 3BZCA 1MKHA 5E7NA 1VQ8A 3LGJA 3HOVH 1QZGA 1HZAA 4OO1I 3B6YA 2EQSA 5GAHC 2LXJA 2IX0A 1PH6A 4A3FH 4HIDA 1YJWA 3J80c 1Z47A 4A3MH 4QL5A 1IBLL 1A8VA 5M3MH 1E22A 1KL9A 5ELNA 4GKKQ 4X6AH 3DLLA 4A3EH 1WFQA 4B3RL 1VQPA 2UUCQ 2FXQA 3NBHB 1N36Q 3HOZH 3U4VA 1CSQA 4GOPC 1LM0A 2PI2E 3KDFA 4IPHA 3CCMA 3S1RH 4IFDJ 1UE5A 2KHIA 2E5LQ 3NEMA 2UUAL 4Y52H 4C3IH 4DV3Q 4JI1L 4LF6Q 4IJHA 1WI5A 1I6HH 2BA0A 3OTOL 2HQLA 2PNHA 4TVAB 5EAYA 1M1KC 3H3VI 1VQNA 1N9WA 1QUQB 4PMWA 4YCWA 3KYHC 3RNUA 2F3IA 2KCMA 1Q12A 4JI0L 2NVTH 3TRZA 4HIMA 3J81c 3GTQH 1NY4A 3TEHB 1WYDA 4DV0Q 5C4JH 3KF6A 1N33L 5HY6A 2IHEA 3PUZA 4LF4Q 4LUOA 1OXUA 4HJ5A 4A3KG 3HOWG 3PO2G 2UUBL 1XPOA 3AFPA 4DR3L 4A93H 3TS0A 1EQRA 4HIOA 3M7NA 4DR6Q 3STBC 2F52A 3K7UC 4QY7A 5AJ3Q 4A76A 2R93G 3S1QH 4DV7Q 3E9HA 4NXML 2PMZE 3CQZH 3IRBA 1VQ6A 4L5RC 3PO3G 2ZJPA 1L1OC 2Z6KA 3D31A 4KI0A 4MNOA 4DR4Q 4AIMA 3I7FA 1G6PA 2NVXH 1X9NA 1Q1EA 1YIJA 4A3KH 3HOWH 4X62Q 3PO2H 1S40A 1J5EQ 2F4VQ 4GKKL 1NMGA 1P8LA 4JI8Q 2UUCL 1BBWA 2NVQH 1BBUA 1YHAA 1L0WA 4BBRG 1JE5A 3UE0A 1VQ5A 5DLQE 2R93H 4GS3A 1N36L 1WCMG 3U4ZA 1B70B 5LMNQ 4XIGS 4A3DG 3L0OA 1O7IA 1YEZA 3PO3H 1X56A 3EN2A 1VQMA 4C3JH 2E5LL 2V1CC 1SFOH 1JJGA 4DV3L 1YHQA 4GOPA 1B7YB 4LW1A 3KDFB 2YTXA 4OWTB 5M5XH 5IYCH 1XTDA 1PH9A 4JOIC 3M3YH 4DV1Q 3CC7A 2NVYH 1AE2A 3CCUA 4A3IG 1DGSA 5IP9G 2A8VA 1H95A 2IY5B 1RIPA 1PV4A 3UDFA 1WCMH 3GO5A 3AFQA 3E0EA 5IP7G 1L2FA 4UY8C 1C0AA 4A3DH 1Q8KA 4DV0L 1SROA 1Q86C 2MO0A 4DK3C 3S16H 4LF4L 4HJAA 2VS1A 4R4CA 4TQUS 4L5SA 2GN5A 4DR7L 2IT1A 3FHWA 2JE6I 4A3BG 4YCVA 1X65A 5M5YH 3KF6B 4YWKA 4DR6L 1EUJA 4LFBQ 5AJ3L 4LNQA 5GROA 5IY0A 1PVOA 4H02A 3U50C 5IP9H 4DV7L 4A3IH 4DUZL 4NXNQ 1K83H 4DAMA 1NBWA 1WOCA 2K5NA 5IP7H 1KQSA 4JI4L 2MO1A 2JA7G 4B3TQ 2ZTCA 3OTOQ 3CD6A 1L1OA 3S17H 1N34Q 2D0PA 1C7YA 1FL0A 1P16A 5IWAQ 1V9PA 4X62L 1Y1VG 1E1OA 3ULJA 1EIFA 4DV4Q 5GAEC 2F4VL 4A3BH 1J6QA 2OTJA 4JI8L 2MNAA 3CCVA 1XMOQ 1BKBA 1YJNA 1WJJA 1PH8A 4PZ7A 4OONA 2ZTEA 4O2DA 3BJUA 2BH8A 4XTCS 1CKNA 1XPRA 3PIOA 1GVPA 1TXYA 5LMNL 2UUBQ 4DK6C 1A63A 5IYBG 4C3HH 3A74A 1QZHA 3SGIA 1QVGA 2JA7H 1EOVA 3J80i 4K0KQ 1S72A 4GN3B 1TWCH 1SRUA 4RG1A 2ID0A 3A5UA 1Y1VH 2CFMA 4QIWE 4DKAC 4DPGA 4GN5A 4DV1L 1KD1C 3S14H 5JJIA 1TWGH 4R4IA 1CUKA 2B3GA 3G48A 1FJGQ 4JOIA 2E8GA 4WJ3M 1X3EA 3JAMc 2ZJRA 3AQQA 1TWFH 4DR2Q 4A3GG 2UXBQ 1X3FA 5IYBH 3HKZG 4DR1Q 1KIXA 4EQ5A 4GKJQ 2CQOA 2JJQA 2VZAA 4BA2I 2OQKA 1PA6A 3AYHB 4LF5L 4KLKA 3BU2A 2E2HH 4LFBL 3CCJA 3HOYG 3GTJH 2B63G 1XJVA 4NXNL 3J81i 1CSPA 4R4OA 3Q8DA 2JA9A 2YYZA 4A93G 1VQEA 2KCTA 4DUYQ 2NN6G 4B3TL 4A3GH 1Y1WG 1JJ2A 1K0RA 1W3SA 1SLJA 1N34L 3K8AA 5IWAL 3HOUG 3RZOH 2AWOA 4YWLA 4DV4L 5M3FG 3PF5A 1HZBA 3H15A 3I4OA 3T1YL 1XMOL 2YTYA 1Q46A 3A0JA 2ES2A 3TS2A 4A3JG 3HOYH 4LF7Q 2JA8G 4DV2L 4GNXA 2B63H 4HJ9A 2WFWA 4YWMA 4DR7Q 5J3BA 1IBKL 4WJ4A 4YY3L 5M5WH 4B3MQ 4GN4B 5GQOA 1CKNB 1Y1WH 3M4OH 1IYJB 3KJPA 4K0KL 2AMCB 2ZTDA 4L5QA 4BA1I 1Q82C 3CF5A 5IYDG 4DUZQ 1YNXA 3HOUH 3CXCA 5BR8Q 2VNUD 2ALYB 4L5TA 4R4QA 1AE3A 5M3FH 2HIVA 1I5FA 3MEFA 2QEXA 4JI4Q 4JI5Q 2QA4A 4A3JH 1FJGL 2R6GA 1VQJA 1Y14B 4P75A 2JA8H 3RLNA 2BH2A 1MIUA 3PCOB 3G4SA 4DR2L 2L15A 3F2CA 2OTLA 2UXBL 2BA1A 1E24A 2JA6G 4A3LG 4DR1L 3PIPA 1IL2A 4GKJL 3ERSX 4APVA 4KHPQ 3K80C 1YITA 4R1JA 1JJCB 1KRSA 1G291 1U0LA 5IYDH 2JEAI 4BBSG 2R7DA 1OXXK 1IZ6A 4AQYQ 1XMQL 1XNRL 1EQQA 1VQCA 1HZ9A 1VQKA 1Q1BA 4UP9A 4IPDA 3NELA 4DV5Q 1S3OA 4DUYL 1K8AC 3U58A 3CAMA 4A4IA 1X3GA 4IOCA 3W1BA 2C35B 2JA6H 1ASZA 4A3LH 4LF8L 2N49A 3CCQA 2D62A 2UXDQ 2QGQA 4LFCL 4JI6Q 3G71A 2K50A 2K75A 3WWVA 4B3SQ 1OXSC 1V43A 1UE1A 3RN2A 3VDYA 4BBSH 1PH4A 1CKMA 4LF7L 4GLXA 1MJEA 1QVFA 4JV5Q 4X65L 4BY1G 4UP7A 4LF5Q 1PH3A 4JI2Q 1A62A 2ATWA 4IOAA 3PV0A 4JBMA 4GNXB 4B3ML 2EIFA 1VQ9A 1E1TA 3HKZE 4NB3A 1FGUA 2WB1E 2VQEQ 4DV6Q 1X55A 1GO3E 4PZ6A 4C2MH 3ZJYC 5BR8L 5C3EG 3UDIA 2KHJA 3PUVA 3M85A 3CC4A 3CCEA 2JK8A 5GAGC 1XPUA 3PF4A 4BY7G 4JI5L 1K73C 2JQOA 2Q2IA 3AEVA 2IX1A 2K14A 2Y0SG 1EYGA 1SE8A 2ASBA 3S1MH 4MTNA 2GVAA 2YTVA 5LMNW 1VQ4A 4BY1H 4X64L 4KHZA 1VCIA 2HHHQ 2HIXA 3T1YQ 2ZM6L 4KHPL 1OXVA 1TWAH 4P73A 4OWXB 2VW9A 2KBNA 1D7QA 2IHFA 3S2DH 4DV2Q 4IO9A 2RCNA 1EWIA 2I5HA 3MXNB 1B8AA 2Q2HA 1ASYA 5C0XG 5C3EH 1IBKQ 1OTCA 4BY7H 1UWVA 1OXTA 3S24A 4YY3Q 4AQYL 3HKSA 3JAMi 1PH5A 2A1AA 5C0XJ 1IXRA 1KRTA 3ULPA 4DV5L 1HH2P 3L7ZC 1VQFA 5HGQA 2KENA 1X54A 2N8NA 1U5KA 3I2ZA 2AKWB 3CCRA 4JCVE 1YBYA 5C44G 1KC8C 2NN6I 4GOPB 1I50H 4X66Q 2R7ZG 3ULLA 2UXDL 1K3RA 4JI6L 2PQAA 4OWWB 2XTIA 3S1NH 4B3SL 2UXCQ 1W2BA 2N78A 1K8GA 1YHBA 1E7ZA 4OX9Q 2WB1G 2NZOA 4JV5L 1QVCA 4O0AA 1KAWA 4JI2L 1HNZQ 4J15A 2MFIA 3CPFA 3DM3A 3EBEA 2Z6KC 4HIKA 1G51A 1UE7A 4P74A 3F1ZA 5C44H 4JI3Q 2HT1A 4DAYB 2VQEL 1XMQQ 2WAQE 4DV6L 1XNRQ 2R7ZH 4LWCA 3UDXA 3CW2C 2AWNA 4IJLA 3CPWA 1GKHA 4HJ8A 1I94L 4POFA 3UDGA 2VY3A 4AYBG 4LF8Q 3J7A5 1LYLA 1BVSA 1E3PA 4DR5Q 3STBD 2VQFQ 1IBMQ 3CC2A 4LFCQ 3PUXA 2HHHL 3KLWA 5LMUQ 3RZDH 4POGA 3HFZB 1L1OB 4A3CG 5K36G 4YCUA 3J7ZC 4JBKA 1PYSB 4IFDG 5ELOA 3PUYA 5GADC 1PYBA 2K5VA 4LF9Q 2R92G 1KHIA 4X65Q 3GTKH 3I56A 3K0XA 1HR0Q 5FLXc 4DNIA 3CCLA 1MJCA 4JBWA 2R7FA 2E2JH 1I3QH 5IYCG 3UE1A 3TQYA 3PUWA 3F2BA 3G6EA 1VQIA 4JC0A 1SR3A 4BXXG 4R4TA 4OO1G 3EIVA 2PI2A 3TREA 5FJ8G 3S2HH 4A3CH 4X66L 1R9TH 2E2IH 3HOXG 2UU9Q 1KXLA 5JJLA 4YHHQ 4NXMQ 1JMCA 1YJ9A 2CKZB 2K4KA 2UXCL 4LFAQ 2R92H 3M4PA 3K7AH 4X64Q 4PZ8A 1VQGA 1JT8A 2LSSA 2ZM6Q 2PQAB 1NTGA 2WAQG 1HNXQ
chains in the Genus database with same CATH superfamily
5DGAA 5HGTA 2Y0SE 2MUYA 2R92B 4B3RH 3FKIA 3K7AB 1EYZA 1F2LA 1VQHA 2D0OA 2JEBI 3M4QA 1IYUA 1CK1A 4JI3L 1NJIC 4P72A 5KFRA 2RHQB 3OMGA 3MZ5A 1DM0B 2Q2UA 2Z6BA 1HCZA 4PV1C 5ELFA 1D5ZC 2P0AA 4O2AF 4TQSA 5H1SE 1HPCA 2NU8B 3D3RA 3BDCA 2K5HA 2LXKA 4L63B 4OEMB 1KDAA 3HXLA 1TWHH 4IPGA 5KFQA 5FLMG 5JJLA 1D8LA 1BQQT 1NR4A 5D8DA 3GTMH 1X6OA 4F87A 3VYUA 1FD7D 1ET9A 2QDLA 5A2QL 1VQBA 2YS6A 2A69C 1HHVA 2ZXRA 5C4XB 3GTGB 1EFWA 1SN8A 5FKAC 3MTSA 4UP8A 2VUMA 1Q8IA 4X3UA 2OWOA 3H3VH 1D1KA 3PW7A 1HJPA 4ZUJA 1YI2A 4ECZA 5LL6X 5FLMH 1ZKOA 3NE5B 3H0GG 1RK5A 4DL2A 4CHTB 5EBCA 1A0IA 3CCSA 3BABA 3NP8A 1T36A 2UU9L 3KF8B 1BXTA 3L2PA 1M90C 3DMUA 5FOBB 2HGSA 3NBHA 4O3PA 4U7CA 4MV8A 4MZ9A 3QIAA 3G7LA 4EGQA 1JX4A 4YAJB 4GKKH 4JBJA 2FPPB 1QCBD 1W96A 2AHOB 5CV5A 3OW2A 5JEAG 2R82A 1NCVA 3T5KA 4EBCA 3H0GH 3R93A 5FLXW 4G7ZC 5BPHA 4NPSA 1SBBB 1EY6A 3FKIB 4RB3C 3S2DB 1DYQA 2KOLA 2W70A 3I55A 2JEGA 4BY7B 3OWEB 1JDEA 1ESFA 3K58A 4XT1B 5KFWA 4EYIB 3FRPB 3K81C 2AUKA 3UI2A 2JA5G 3RB4A 4LUVA 3HP3A 1J5EL 2HVSA 2B2WC 4EX5A 4JI0Q 1B2TA 3HOVG 2RBMA 2C9OA 5JEAH 1C9OA 3GTQA 4IUQA 4P71A 2UU9H 1VF7A 4A3FG 1JLLB 3LWUA 4QGUA 3SEBA 4DR3Q 1PZID 1LTLA 2G9DA 2GVBA 1G8ZD 3VYTA 4A3EG 5KFMA 4O3RA 2CH4A 4IAJA 4N9TA 1DIKA 2JA5H 3GTPH 5L1IA 1JB7A 4MTEA 1I4QA 4FS2A 4ZQ3A 4DV7H 3ERQA 5E7NA 3HOVH 1K0SA 2RGRA 3B6YA 1PH6A 1KAAA 4K5XA 4C3IG 3GV7B 4A3FH 1F9PA 4PNYA 1A8VA 4DA2A 1E22A 2CHBD 1BBXC 4X6AH 3PQIA 4A3EH 1BGWA 5L1JA 1STBA 1VQPA 2UUCQ 1L0XB 2EY2A 1J5EH 2FXQA 3NBHB 3E0JA 4JI8H 5HV6A 3J7YW 2FHTA 1CSQA 1GUTA 4ULLA 2R7NA 1LM0A 4RNNA 4F4ZA 3N6XA 1UE5A 2E5LQ 4KN4C 1I6VC 4C3IH 1SFOA 1CS0A 1I6HH 3OTOL 2PNHA 5EAYA 1TS5A 4QWBA 3RNUA 4PMWA 4YCWA 3KYHC 2F3IA 5BN3A 4K6LA 1JWUD 4JI0L 2J9GA 2UVUA 1JICA 3TEHB 2YZNA 1SYBA 1FNVA 4S3SA 5C4JH 5IGCA 3GP7A 2ZXOA 3PUZA 1TVXA 3LP8A 3UFXB 2KECA 2EYJA 1A2TA 1CQVA 3PO2G 3GTQB 4DR3L 4HEDA 4A93H 4I7ZC 3TS0A 4ZK9B 4EQOA 4FF4A 3KXYT 2DWCA 4QY7A 1AUVA 1O75A 2WTFA 5DGBA 1W6JA 2R93G 3IKJA 3E9HA 3A55A 4ZRZA 5FO7B 2HCIA 1VQ6A 4YR3A 3S1QB 3BVMA 4DR4Q 3N41B 4HNUA 1G6PA 5CGKA 2NVXH 1S5CD 3OTOH 3URYA 3PO2H 2CZGA 2PMZA 2WE6A 2F4VQ 4JK1C 4C5AA 3ZYYX 3E6ZX 2UUCL 2EJMA 1TWHB 1QG7A 3KLSX 3UE0A 1I4PA 3QWNA 5DLQE 2OT2A 3V05A 3HOWB 1I4GA 3U4ZA 2F03A 3A7AB 4XIGS 4A3DG 2F0SA 2YYAA 1YEZA 2C2DA 1D5MC 2IBKA 2E5LL 1N56A 1CI3M 5A35A 4DR3H 4FXGC 5F2DA 2VQDA 4OWTB 5CA1F 1PH9A 4ZKBB 2YRXA 4JOIC 3M3YH 3BAAA 4DV1Q 1SFOB 3JZIA 1RF2D 1DGSA 2PNRC 4C1NK 1EIHA 1UC9A 5EKIA 1H9SA 3IFDA 2IY5B 5DG8A 1F2MA 3UDFA 1SNPA 2NVYB 2FJ2A 3AFQA 4UY8C 1C0AA 4IWYA 3T5LA 4A3DH 3V6KA 4DK3C 5IGDA 3S16H 4HSVA 4L5SA 4QWDA 4DR2H 4A2BA 3J81E 4YCVA 4GKJH 3JSLA 4YWKA 2UUCH 2PCFB 3K5NA 1EY7A 5GROA 2W71A 4NXNQ 5CB4F 5ELDA 4JI4L 2SNSA 3JRWA 4A3IB 3T4AC 3CD6A 2LS01 2Z8LA 4XXEA 2EZVA 2YL2A 3R2IA 1C7YA 2D0PA 4DL7A 5IWAQ 1V9PA 5DAUA 3HGBA 3A7LA 4DV4Q 5JUMA 2F4VL 1XXGA 4RAZA 2FLNA 3SE7A 1XMOQ 1LTBD 2PMZB 3V4ZA 4A3BB 2LFNA 3PIOA 1GVPA 3T5JA 4FP5D 2UUBQ 1A63A 1H9RA 4F8MA 3J80i 1SSOA 1TWCH 1TQOA 3T13A 4C3HB 4DV1L 2CFMA 1I7LA 3S14H 4XQNA 1GJXA 4R4IA 4ZQIA 2OXPA 2KCNA 2B3GA 1FJGQ 1ZETA 3GTPB 2SOBA 4RGNA 3HB9A 1RCVD 4JI4H 1TWFH 3RV3A 3QZ7A 1X3FA 1H9SB 4EQ5A 1KNEA 2JJQA 1DXMA 1LABA 2VZAA 4BA2I 2I80A 4IR9A 4FXDA 5CMDA 2ICIA 4ID6A 4KHPH 2E2HH 3BDOA 1HA6A 3ITPA 2YU9A 1XJVA 4NXNL 4CDEC 5BN5A 3Q1KA 5IT9L 3Q8DA 2JA9A 5L9XA 1BCPB 3HZXA 1TKWB 4J0MA 3V96A 2NN6G 4B9XA 1Y1WG 1JJ2A 3OSPA 5F9NA 3V4SA 3EJIA 2G9HD 1K0RA 5T1GA 5G3LD 3K8AA 1R4PB 5IWAL 5K2MA 4DV4L 5CV7A 3H15A 3T1YL 1O7YA 3I4OA 1XMOL 2YTYA 4J6HA 1E4EA 2M05A 5JQWA 4A3JG 2NUAB 1D5XC 4HJ9A 4DR7Q 5J3BA 4KJOA 1U4MA 3GV3A 4WJ4A 3HOYB 2NN6H 4B3MQ 5GQOA 1AUXA 1Y1WH 2NYZD 3MXPA 2EYHA 3KJPA 2R8KA 4A93B 4DUZQ 1ICFB 4C2MA 1AE3A 2HIVA 4NXNH 1T3NA 1FJGL 4A3JH 2V4DA 1Y14B 4P75A 5EPLA 2O5IC 1AN8A 2KSWA 3I8ZA 5M3FB 3M4IA 5JVLA 3NHHA 4OELB 2OTLA 3EROA 2JA6G 4A3LG 4NP5A 1B6RA 2NVXB 4APVA 2XD4A 3Q22A 3K5HA 2AQ1B 2NB0A 3S9WA 5DM63 1KRSA 5KGUA 3J80E 3T1YH 1XMOH 1V8QA 3UQ8A 2JEAI 4BBSG 2R7DA 5J2TF 4AQYQ 2R93B 1M0WA 4M7EA 2GLTA 2K5DA 2XVSA 1X3GA 2JA6H 4A3LH 1STAA 2K6AA 1BDOA 2D62A 2XWBB 5KYIA 1CQIB 1GSOA 4XZ3B 2K75A 4QW9A 2VR1A 4BBSH 1OWTA 1CKMA 1PRTB 1QVFA 4O4HF 1HUNA 2W6QA 1E4EB 5C8YF 2BQ3A 3T5HA 3HS0C 3R2TA 4OX9H 2ATWA 4HCSA 3Q24A 3S16B 4B3ML 4IOAA 2EIFA 2E2DC 1HRJA 5KFHA 1FGUA 3G8CA 1HNZH 1SXTA 2Q8IB 1X55A 1PMRA 1EZ8A 4PZ6A 1MSHA 3UDIA 1V1PA 2KHJA 1SAPA 1GGOA 3TZDA 1K73C 1H9JA 1F2YA 2XSCA 3PW2A 2Y0SG 3W2DA 3S1MH 4UCTA 1LT4D 1TS2A 4BWSC 2F0NA 2PQEA 4QCLA 3KHLA 5KFTA 2VPSA 1LO5D 3HBLA 1O7LA 2VW9A 1AP0A 2IHFA 3V2TA 3NSWA 2RCNA 4H13C 2Z4IA 3RGXA 5CAEB 1OTCA 4RU9A 1UWVA 1OXTA 4AQYL 1E0BA 1PH5A 3RV4A 3RUPA 5C0XJ 2HVRA 3ULPA 2F0MA 1WTPA 1BNCA 1HH2P 2KVMA 3GIIA 1VQFA 1X54A 1U5KA 1T5EA 2AKWB 2RGVA 4JCVE 3L9AX 2P5ZX 4XX0B 1I50H 4N8FA 2KJXA 2R7ZG 2R86A 2E2IA 4ILWA 3D4RA 2PQAA 1UUPA 2UXCQ 3OHAA 3MWDA 1VBHA 5J39A 2JP1A 1YHBA 3KTMA 1RTOA 2B2VA 2WB1G 1IOWA 1GOZA 1QVCA 4H44C 4KY5A 4O0AA 3SHLA 2ZJTA 4MV9A 1DD2A 4J15A 4O4LF 2MFIA 3CPFA 3DM3A 3EBEA 4OL7A 4UDUC 3K5IA 1TIID 1RJRA 1YNJD 2R7ZH 5IYZF 4ODGA 3UDXA 3CW2C 3NXWA 4IJLA 1MBYA 1I94L 4M8AA 4POFA 3CHBD 3MC0B 3UDGA 1F77A 4LAAA 1BCPD 4TV9F 1ZEQX 2R8IA 1V1PB 3M9MB 1E3PA 5ELBA 4IUNA 2WAQA 2VQFQ 3CC2A 4CC6A 3KLWA 4POGA 2L9HA 2D9UA 1L1OB 2EY6A 4A3CG 4DL4A 3TP7A 2MGSA 4YCUA 1U4LA 3I73A 5CV8A 3MWMA 4IFDG 3SK5A 1HUMA 5GADC 3KHHA 1PYBA 2K5VA 2R92G 3Q8RB 4X65Q 1F9QA 1N32H 3NWTA 3K0XA 1HR0Q 5EWGA 3QJYA 4EFBA 4JBWA 2R7FA 1A3VA 5IYCG 3UE1A 1S5ED 2F3WA 4RGMA 4JC0A 4BXXG 3VR4A 5C6AA 4OO1G 3U9OA 2PI2A 3D8GA 2E2JB 1LTRD 4HN7A 1R9TH 4A3CH 2EJGC 1AZQA 1HXYD 4IFDH 3KBXA 3MA2B 1B3QA 2K4KA 4FXKC 4X3KA 2UXCL 4LFAQ 2R92H 1I94H 4Q8EA 3K7AH 4X64Q 3S2HB 1KBLA 2E2IB 4ZOLF 3AU7A 2EYMA 1BCPC 1CHQD 1VMPA 4A3JB 4KY7A 2PQAB 4EYHB 5IYCH 1HNXQ 3TQ1A 1IBLH 3GTLA 1DV2A 5C4XG 4YP3A 3LX0A 3EQLC 5D3IB 4BXXH 1OO9B 1PFSA 4OO1H 1YZ6A 2NU9B 2DUDA 1EOTA 3I4LA 3NENA 1EY5A 1NE3A 3JRXA 2A19A 1B1ZA 3J7AF 1FVIA 3PGZA 4ABNA 1XNQQ 4KV6A 3H91A 1HNWQ 4FO2A 4JI1H 3KLRA 3GLKA 2NWGA 1SMXA 2KQ3A 2VQFL 5C4XH 3GTGH 3T1HQ 2K7VA 1JWMD 2WAQB 3BDLA 1V1QA 3LWEA 1B4OA 2TSSA 4IURA 2DPIA 4DFAA 1PH7A 1CA6A 2L55A 2CVRA 1BJTA 1HR0L 1PRTD 3F2DA 3I4MB 2O4XA 4O3OA 1LACA 1S9FA 3FKIG 5KKNB 4ALPA 2BE5C 5TSSA 3TBIB 2YV5A 4O4IF 5FLXE 2R85A 3C1EA 1PFBA 4NXMH 3E9IA 5FK9C 5JAVA 4QQBX 2RKSA 1M6VA 1PDQA 5C3XA 3U9TA 4GC6A 3E3XA 1VQAA 4A2AA 1KDCA 4A75A 5DQGA 1S5DD 4KMUC 3RMHA 3TP6A 4LFAL 4UPAA 3RN5A 2OLSA 4B3RQ 1W93A 1HNXL 3S1MB 2RHSB 3FKIH 5LYJF 4KTAA 4EG0A 2IL8A 4UCRA 3GTLB 1N36H 1UNNC 2BOSA 1PFMA 5JEAJ 2PBZA 4HR7A 4IZOA 4YBZB 1RYSA 2CWAA 1WD0A 4R9WA 1CKOA 1T9HA 2VUMG 1B50A 2W9AA 1QUQA 3S15B 2F0PA 1XNQL 1PRTC 1QJOA 3SR1A 1HNWL 3GQCA 2V9WA 3M9BA 1Z2NX 3BYTB 4UFZA 1GSHA 1VS0A 5EWEA 3T1HL 1UAPA 1I50B 1SJED 1E2VA 2DGYA 3FVQA 4DV0H 5EBDA 2LY7A 3W5OA 4LF4H 4JV1A 5DG7A 3OSOA 2VUMH 3BA9A 2N3SA 4FDBA 4OHJA 3MWYW 3OUUA 1SNQA 1HNXH 2EXDA 1PX2A 1Z9FA 4RHSA 2FLPA 4DK0A 3RLFA 2ICEC 3A5ZB 1Y69U 5FO9B 4ED2A 1MKHA 2L11A 1PLFA 1B33N 3LGJA 3H09A 1HZAA 4C56C 2EQSA 4N9PA 2IX0A 2R7ZB 2ZXPA 3J80c 2AU0A 4GKKQ 3N6RA 1WFQA 4B3RL 4FU0A 1I7NA 3L4KA 1ZHSA 1KJ9A 1KJ8A 2PI2E 1PK8A 4DL3A 2W7PA 2C2RA 3GIDA 4Y52H 2B2YA 4IUPA 4ZI7F 1SYCA 2BA0A 3S1RB 4HR7B 1G91A 1M1KC 1VQNA 1Y8NB 1QUQB 1EY4A 1KTKA 3TRZA 1WCMA 3GTQH 3K5LA 4IALA 2VOBA 2ZDHA 3I90A 1EY9A 3OHBA 5IGEA 5KG7A 3EPIA 3HOWG 4L8JA 3TIGA 3OIQA 3AFPA 4DXFA 4QW8A 1EQRA 3A8KE 4O3QA 5C5JA 3STBC 4CGYB 3K7UC 2EE1A 3S1QH 2IP4A 4F88A 4DV7Q 4ZYSA 4LFBH 3IRBA 4KY6A 2ZJPA 1L1OC 4OIJA 1ZHQA 4DF7A 4C3JG 2DY8A 5KFLA 2K05A 4CJ0B 2FLLA 5DQHA 2YZMA 3QOLA 5G3LF 3HOWH 4B3TH 2CW0D 1TT2A 1S40A 1J5EQ 4GKKL 2I87A 1P8LA 4EBEA 4JI8Q 4UCUA 4QMGA 1YHAA 2R93H 1ML0D 3GV8B 4X3SA 4GS3A 5LMNQ 2R7KA 2R8JA 3L0OA 1O7IA 4H0LC 1RJPA 1EFID 4I65A 2WKCA 4C3JH 2V1CC 4J8QA 5JPMC 2JA7A 1SFOH 1JJGA 1YHQA 4GOPA 4LW1A 1S0OA 1ONLA 2WINB 1TU2B 3CC7A 1Y1VA 2NVYH 4HMIA 3L3OC 3ONAB 1QNKA 4CBVA 4A3IG 5IP9G 2A8VA 5M5XB 1SYGA 4IHJF 1KLUD 1RIPA 2B2VC 1PV4A 2TMPA 1K8OA 2BQRA 1FKAH 5EGTA 1MD2D 5KFOA 3NQIA 3Q2OA 3P75A 4P2CB 2VS1A 5KFSA 3KUPA 4TQUS 5FO8B 1WCMB 4CDDC 2SCUB 4YR2A 4ED8A 4A3BG 5M5YH 1X65A 3J80L 4HYKA 2F0GA 1EUJA 2IMWP 3N8DA 2OH2A 2H1EA 5IY0A 4H02A 4DV7L 1K8MA 5IP9H 4A3IH 3GTJA 4PDBA 1HTLD 3F2UA 2ZT9C 2EY5A 2EYFA 4DAMA 4HNTA 2EY1A 1WOCA 2K5NA 4C3HG 5LA6F 3OTOQ 5I9PA 4J9QA 3HKZA 3BVGA 1FL0A 4MA5A 4A3BH 4NLGA 1A3UA 4JI8L 2MNAA 1SYXB 2WIIB 3Q0AA 3S17B 1YJNA 4ETSA 4OONA 5D65A 3BJUA 2BH8A 4XTCS 5JVH3 5I6YA 3GILA 2B63A 3PW5A 2ASJA 5LMNL 1SE3A 2FFKB 3HRZC 4C3HH 2NTSA 3A74A 1QZHA 1QVGA 4I50F 1EOVA 3DWQA 5IGBA 4K0KQ 4GN3B 3GIJA 1SRUA 5E1FA 4FF3A 3DXJC 2VUMB 2JA7B 4QIWE 1PTOB 2R6FA 4GN5A 3NPPA 5LOVF 5KFDA 3K57A 1CUKA 5BR8H 4ED0A 3ND9A 4WJ3M 1X3EA 1Y1VB 3Q6SA 5KEEA 4DR2Q 5C1PA 3MXGA 2CW7A 1KIXA 4GKJQ 1RK6A 5IT9W 3QG1A 4LF5L 4F4XA 2K04A 4TSSA 1ULZA 2XIWA 1Z6HA 1STHA 4C1NI 4QUCA 3HOYG 1CFMA 3QR8A 5LMNH 3J81i 4Y8VB 1CSPA 4A93G 1VQEA 4DUYQ 5HBRB 2AQ4A 5EKLA 2B2TC 2OEOA 1SLJA 2DN8A 2AWOA 5M3FG 3T16A 4A3GB 2K01A 2KA7A 3PF5A 4DU9A 1Q46A 2ES2A 2IJ0A 3OHXC 3HOYH 1AN7A 3VPBA 2WFWA 4YWMA 2FK2A 3KAJA 5LL6S 4YY3L 3RTXA 4ECVA 1S68A 2B63B 4K0KL 4LF5H 4NDXA 2ZTDA 4Q0YA 5CBEE 5L1LA 5IYDG 1YNXA 5M5WB 5CV4A 2ALYB 3BVZA 5M3FH 3M4OB 1I5FA 1ZXTA 2QEXA 4JI4Q 3TIIA 3WNZA 3H4BA 2QA4A 1BCPF 2R6GA 3FDTA 4FS1A 4IN3A 4DR2L 1QOHA 3F2CA 2BA1A 4Q8FA 2SNMA 3HEJA 1IL2A 4GKJL 3RGZA 2JA8B 1F9SA 4KHPQ 1S97A 3K80C 1SNOA 3JAME 3VR6A 2VA2A 1G291 2HHHH 5CYUA 1U0LA 5IYDH 4U68A 4IZ8A 4DN4M 3C1FA 3I72A 1CM9A 1V51A 2X6GA 2R84A 3PZPA 3NELA 4YY3H 4EGJA 4DUYL 1K8AC 3W1BA 4C3JB 1UNSA 1WTHA 4K0KH 2EVBA 4LF8L 2QGQA 3MVVA 4LFCL 3T51B 4CKBA 2K50A 1SNMA 2OF1A 3K6OA 3WWVA 4E6IA 4B3SQ 3RN2A 2PZTA 1LT6D 1PH4A 4K6DA 4G7OC 2R8GA 3TMEA 4GC7A 3RB3A 4JV5Q 3QFFA 1EYAA 2ASDA 4ED7A 3MR2A 4JBMA 2K5WA 4RUAA 3IN5A 3HKZE 4NB3A 2DIKA 4DV6Q 5M5YB 1GO3E 4C2MH 3SDZA 4MV1A 4IQZA 3PF4A 4G7HC 4XYOA 3RBDA 2Q8RE 1WR2A 1SE8A 4DUYH 1UEAB 2GVAA 2YTVA 1VCIA 4LF8H 3T1YQ 4DR5H 4KHPL 1XYIA 4P73A 1IBMH 4LFCH 4RZRA 4BY1B 5LMUH 4K2KA 4IO9A 1ILPA 2I5HA 4QWCA 3GTKA 2B2YC 2Z9HA 1DCZA 1J8IA 5JVDF 1PRTF 5C3EB 5CR3A 5EWFA 4RA8A 3BZDB 1ILQA 2WACA 1U9RA 1WD1A 4J9MA 1PTOD 4KKSA 4RKBA 5COYA 3X3MA 1E4FT 4OWWB 1EQTA 2QF7A 4B3SL 1K8GA 3RB0A 1E7ZA 4OX9Q 4XYLB 1F2ZA 2KHSA 4JV5L 2UVVA 1LT3D 2JXMB 4FYDA 2C28A 3TZUA 1SJHD 2QYZA 1HNZQ 2NTTA 1SYFA 4HIKA 1O78A 1UE7A 1EWCA 2RA4A 4DV6L 4LSXA 2DNCA 5DG9A 4PMBA 2W9CA 1G2SA 1K3BC 1EU4A 4UHVA 3J7A5 4N8X1 2XNAC 1LYLA 1MZBA 4IUVA 2RCFA 4YJ3F 2DNEA 4RB0A 3HFZB 2GPWA 4RCOA 4DXGA 4JYAH 2HUGA 5KFVA 5BN4A 1PTOC 3PUYA 2R8HA 4B3SH 4LJZC 5C4ZA 4LF9Q 1KHIA 4QF4A 3MR3A 3H4DA 1Z2OX 3V6HA 3K5OA 4DNIA 3K0YA 3MFGA 2L4NA 4FF1A 3CCLA 1MJCA 4JI7H 1U4RA 2E2JH 2DLNA 4JV5H 2RDJA 4XYQA 2A6ED 1JQYD 3G6EA 1VQIA 1I4XA 3TN2A 3TREA 3ETJA 1RTNA 2CW8A 4DV6H 3S2HH 5HURA 2E2IH 4YHHQ 3VMMA 1YJ9A 2UVRA 3J7AK 2EYLA 2EDGA 5A2QE 2FKLA 2JSOA 3IFTA 4RAUC 4K14A 4OX9L 2IWHA 3TSSA 1NTGA 2WAQG 1X3PA 3SE0A 3WO1A 3GTOA 5CA0F 5L37A 2K28A 3EA6A 2PO4A 4LSAA 4PG3A 4FNFA 1HNZL 1SEIA 4Q45A 2K03A 1AH9A 2F0WA 3PIP3 4JG2A 1K28A 3I4MG 4C5BA 4OGQC 2F4IA 2NU6B 4HJ7A 2EYPA 1UE6A 1QE6A 1N48A 2C2EA 1O80A 3D4WA 3WOEA 2YU9B 5KG3A 1U4PA 2I0QA 3OWFA 3OYYA 2QW7A 2XWJB 2LKVA 3HOXB 2CQYA 2W9BA 2A6EC 3KOJA 3JAMW 1HR0W 2W9CB 1WTXA 3CMEA 2K32A 1N32Q 3W1GA 4DAPA 3I4MH 4APMA 1N33H 4LF9L 1DOKA 1S4ZA 4HMJA 2B29A 2JEJA 3EFXD 1FGBD 5C0XI 2AQ3B 5JJKA 1EY8A 4LF6L 3ND8A 4EEQA 4MV4A 2J4XA 5D1PA 3OIPA 4DNRB 4BBRH 1I94Q 4GLVB 4YHHL 4YJ2F 1HFNA 3KFUA 1ZQ7A 4C2MB 2W6MA 3U9SA 5I6WA 2JYOA 1IBLQ 4G4KA 2Z0SA 1Q81C 2XGTA 3BYYB 1D6EC 1Q3LA 2IW3A 2B8FA 4GLAC 4JW0A 5EPKA 3GTLH 5LXTF 4J9NA 5DLFA 2F0KA 1EYDA 1GD7A 1EIYB 2PZWA 2C00A 3GD7A 2I5MX 4MV3A 5IGGA 3VA5A 2OQ0A 1HFGA 5LHY1 3S15H 2PPBC 4IPCA 2VB3X 3GTOB 2UUAQ 1JOQA 1PH1A 3VR2A 4LF9H 2YCHA 4JI1Q 4ECUA 2WP8J 2MPMA 2Q2TA 3SXHA 4LF6H 2A5HA 4L6TB 1WH2A 2HVQA 4RH6A 3GV6A 2RDIA 2O5JC 1X3QA 3D0FA 3KJOA 1TS3A 1LV9A 2YZGA 4YHHH 2QDBA 2AGQA 1K9MC 1N32L 2XIGA 2I5LX 3PMFA 3QB3A 2MQHA 4EQNA 1JCKB 2VL6A 1RL2A 5IE8A 2N55A 1N8RC 5BMVF 4BWGB 2XRQD 3GDEA 4YAKB 4FBTA 4NXMQ 3RFCA 3BZKA 3CQZA 3J81j 4TUYF 1NNXA 4ECYA 1A15A 3R3OA 1VQ8A 1JB3A 1QZGA 4O42A 1WTOA 5GAHC 2LXJA 3N43B 4Y7NB 4HIDA 2L1BA 4LK1C 4R8NA 1Z47A 4QL5A 1IBLL 3NK9A 4KK7A 1SMYD 4A3MB 1N36Q 4JV0A 5M3MB 2SDFA 4E4TA 2PW5A 3VYRA 4IPHA 3S1RH 5KG0A 2KHIA 2UUAL 3NEMA 3HOZB 4J9OA 3MEHA 5CORA 4DV3Q 2V4RA 4CJ1B 2R61A 3R5XA 4JI1L 2ZDQA 4TVAB 1AZPA 1MGSA 4RNOA 1SYEA 2UVWA 3H3VI 3K5MA 2VUGA 1N9WA 3K3VA 4JUZA 1YNJC 2KCMA 1FR3A 1Q12A 3SI8A 4DK1A 3J81c 2KUMA 2NU7B 4DV0Q 2RDFA 5IOCA 1YNND 5HY6A 2IHEA 3BS1A 4LF4Q 3X3NA 5KFJA 3I91A 1OXUA 4HJ5A 4H7BA 4A3KG 1B44D 4C5CA 3MFIA 1RJTA 3FMCA 4DR6Q 2F52A 4UAIA 1EEFD 2F0HA 5AJ3Q 4A76A 5KFGA 1GYFA 3MXUA 1ENFA 3P1HA 5NUCA 4NXML 2V5AA 1K83A 2Z6KA 3D31A 4KI0A 4EFEA 3CRLC 4MNOA 2F0QA 4NW2A 3TDQA 2UUAH 5A2QW 3CQZB 3I7FA 2RQXA 4AIMA 4ME5A 5ISRA 1IYVA 5KFAA 4A3KH 4RB1A 1VF5C 4X62Q 2QCPX 2XRSD 3E5NA 4IRDA 4EVOA 4WBNF 1BBUA 3FDSA 1VQ5A 1JE5A 1L2ZA 4EGVA 1N36L 1WCMG 2L5TA 1ENAA 3RUZA 2B2UA 1B70B 1GUWA 2NVQB 1X56A 3EN2A 1M8AA 3KHRA 2I07B 2J6UA 3SK8A 3Q8QB 4CDCC 4DV3L 5L1KA 4ZKCB 5M5XH 3PO3B 3FPPA 3CCUA 1TWGA 4IUUA 1H95A 2KEEA 1EHIA 1WCMH 3GO5A 3E0EA 4KKUA 5IP7G 4I7HA 1I4HA 1Q8KA 4DV0L 1SROA 1DV1A 1Q86C 2MO0A 2FPGB 5KFEA 4LF4L 3TP5A 4BBRB 4R4CA 1B04A 5E3FA 2IT1A 2R7MA 2UXBH 2MP1A 4DR1H 1STGA 4DR6L 3D6WA 4LFBQ 1TS4A 5AJ3L 3U50C 4YIJA 2NZ1D 3VYSA 5AFWA 1WSCA 5IP7H 3I12A 1G6ZA 2JA7G 3R5FA 3RB6A 2HQEA 4B3TQ 4DV3H 4WORA 3RF2A 1K83B 2F1MA 3S17H 1N34Q 3K3PA 2IX3A 1P16A 1BOSA 3T56B 1S03G 4X62L 1Y1VG 1ICWA 1EIFA 1AFPA 2HJWA 1J6QA 3CCVA 2WV6D 1BKBA 1PH8A 4PZ7A 2ZTEA 2VB2X 4LMQD 4O2DA 1M0TA 2LMCB 1XPRA 2X69A 4DK6C 3J81L 3K59A 2JA7H 1PTOH 1GUNA 5IT9E 2HCCA 2AGPA 1JWSD 4OIKA 4HNVA 5I9OA 4RG1A 2DJFC 1PFNA 4DR6H 3H6MA 3DM1A 3A5UA 1Y1VH 4DKAC 4FF2A 4DPGA 1KD1C 3KHGA 1SYDA 3PVXA 4LH7A 4JOIA 1XWEA 3AQQA 2ZJRA 4JI5H 4A3GG 4QIWA 3HKZG 4RCNA 4ME6A 2F0EA 4QWAA 4X62H 1SEBD 1PA6A 1C3OA 1EU3A 3AYHB 1S10A 2D2CC 1D1IA 3BU2A 1EY0A 4LFBL 5EZYF 1LTAD 3GTJH 2BDNA 2B63G 1SDFA 4BS9A 4R4OA 1GLVA 5KIXA 5DNFA 2KCTA 3FMAA 4B3TL 4A3GH 1RD9D 1ET6A 1EZ1A 2A6HD 3LMLA 1O7ZA 4DV5H 1W3SA 1N34L 3NBIA 1PTOF 4YWLA 4KN7C 1HZBA 3A0JA 5KFYA 1GHJA 1Z2PX 4LF7Q 2JA8G 3RZOB 4DV2L 4GNXA 2B63H 4MAMA 5EDWA 4J9LA 1IBKL 3MJFA 2ATLA 1STNA 5M5WH 5FD6A 2DZDA 1KEEA 3GV5B 1T94A 3M4OH 1IYJB 1G2TA 1CZWA 4L5QA 1Q82C 4BA1I 5J2UF 1JDBB 3KF8A 5KNDA 3CXCA 5BR8Q 4R4QA 2AGOA 1SE2A 3M9OB 2VQEH 3G6JB 3M4YA 3MEFA 4WFN3 2CQAA 1VQJA 3HOUB 2NBFA 2JA8H 4ED6A 5ELEA 3RLNA 5C3WA 1MIUA 3PCOB 3G4SA 1K1QA 2I8CA 2L15A 3DEOA 3TQTA 1E24A 5KFKA 1VAJA 3PIPA 1N34H 2F3VA 2A6HC 4KD3A 4LH6A 4PQXA 1IW7D 2KCCA 4R1JA 1TWAA 1JJCB 4A3KB 2ZDGA 3N44B 2W6PA 5KFFA 4QIWB 3MWEA 1DZ1A 1XMQL 5C1OA 4PMCA 1XNRL 4DV2H 1EQQA 1VQCA 1VQKA 1IBKH 4UP9A 1S3OA 4MIUA 2C22A 4FBUA 2C35B 4U6PA 2N49A 3CCQA 2E75C 3L4JA 1ESRA 3GQBA 2K33A 4RKLA 1MI2A 2IPKD 5JH7F 3IAYA 4LF7L 4GLXA 1MJEA 4BY1G 1PZJD 4DAYA 4LF5Q 5KT7A 2CW0C 1PH3A 3NWSA 4K5WA 3PV0A 4GNXB 2K5QA 5KFXA 1IW7C 2WB1E 2EOTA 4DAVA 5EPJA 3ZJYC 5BR8L 2BR0A 5EQ0A 5C3EG 1E2WA 1RKNA 4JI3H 4V0BA 1E2ZA 4WRDA 3M85A 2JK8A 5GAGC 3CCEA 3QZ8A 3OPOA 1XMQH 1XNRH 3AEVA 2Q2IA 5CBAE 2IX1A 1HQRD 2K14A 1I6UA 3GIMA 4MTNA 4DGZA 1E4GT 1VQ4A 4BY1H 4KHZA 3FPUB 2PZUA 2FINB 2HHHQ 2XC9A 2ZM6L 4LMYA 2RSOA 1OXVA 1D7QA 2HDLA 1ASYA 2Q2HA 2C5CA 5C3EH 4MV6A 1M4VA 4LF7H 1TWAB 2ENBA 3S24A 4YY3Q 3JAMi 1CQJB 1I3QA 1S5BD 4AYBA 1GHKA 3I2ZA 2KENA 2N8NA 1CTMA 3CCRA 1KC8C 5M9OA 2NN6I 4GOPB 4F4YA 4X66Q 1RDPD 1UC8A 2D5DA 1B6SA 2XTIA 1STYA 1W2BA 2N78A 1EUCB 3F8NA 1IKMA 1WVLA 1TY2A 5KYLA 5D1OA 5KT3A 4K8IA 5EJWA 4WD3A 2MCTA 2NZOA 5E4WC 3S1NB 4ECSA 3MR6A 4PWQA 2ZM6H 3KK7A 1K1SA 2I46A 2Z6KC 3F1ZA 4DLKA 4UCSA 3M9NB 1HTPA 4DAYB 3AB9A 1BUVT 4LWCA 1R4QB 4RNMA 3A8IE 3ETHA 2AWNA 3CPWA 1JC7A 2HD3A 4O1NA 4F7XA 5C44B 3GTJB 2VY3A 4RAYA 1IL8A 4LF8Q 1TWHA 2A73B 2L12A 3SK6A 1BVSA 4DR5Q 1DONA 3PN1A 1IBMQ 4RGOS 4LFCQ 2PN1A 2B2UC 2HHHL 1RYRA 5LMUQ 3GTMA 5K36G 4FM9A 3HKZB 2XCPA 3J7ZC 1CZGA 3ORQA 4JBKA 2F0VA 4O3SA 5KG5A 1JKJB 3RZDB 3GTKH 5FLXc 2F0DA 2Z4HA 3PUWA 3SK4A 3F2BA 1DOMA 1ENCA 5KG2A 4KJNA 5KFCA 3GIQA 4R4TA 3ORRA 1XTCD 3EIVA 2NVYA 4ECXA 1I3QB 4B08A 5FJ8G 4MHEA 5K36H 4AYBB 1V4YA 4X66L 1JE4A 3LNNA 3HOXG 1KXLA 5T14A 4NKLA 3D6CA 1FNWA 2FMCA 4CKCA 4PZ8A 2FPIB 4B9WA 5J22A 1JT8A 4NMZA 4Q0FA 1KNAA 5KG6A 2BQUA 2MHVA 1F9RA 3VR3A 2FK1A 5D1OB 2X6LA 2K52A 4HCEA 4ECRA 3RR5A 3H0GA 5FJ8H 2YU9H 3PSIA 4AH6A 3HOXH 1H9KA 1A3TA 1FNUA 5F9LA 2CWPA 1Q7YC 1VQOA 3I3CA 1KJQA 2RF4A 1NMFA 1GUGA 1LTTD 4OXPA 4DR5L 4EBDA 3CMAA 3MFYA 3F8TA 2ZJQA 1IBML 4JYAQ 3Q8PB 4J9RA 5LMUL 4X66H 3I4NG 2E76C 5IT9c 4JI0H 1YVCA 1W6KA 4IRCA 1L0YB 2A68D 3H20A 4JI7Q 3GTMB 5KRUA 1CHPD 2O03A 3G6YA 1I4RA 5DM73 4QJFA 1UEBA 3ICEA 1MSGA 1PHJA 2E74C 2JA5A 3GTPA 2J6TA 1HZCA 4TV8F 2XN9C 2YRWA 3CP0A 4ME3A 4Q44A 3VPDA 5H80A 3J7AV 4IRKA 3I4NH 2F0OA 5E4XA 2OCEA 4M1UB 4JV2A 5C4HA 3WOFA 4LUZA 2L0CA 4CJ2C 1RHPA 1MHWC 4DL5A 1RJQA 1PH2A 3GTOH 1JORA 2XCLA 2NZHA 4AYBE 2BCOA 3LWBA 4RGTA 5GONF 1KJJA 5C5LA 1C30A 4Z9CB 1EUDB 3I70A 2A68C 2H5XA 2CCZA 3ER0A 5KFZA 3H0GB 2E5LH 4DR4L 3VPCA 3O13A 1VQDA 2W6NA 4ZCKA 3JC66 5FLXL 4ZAIA 1LUZA 3RJ0A 1VQ7A 1GUOA 3NTIA 2EYOA 4MTKA 4GNXC 4JYAL 1JXLA 2FJZA 1A2UA 3TP8A 1IKLA 5CC4A 1N33Q 4MN3A 3RLOA 4A3MG 4JI7L 1AW7A 5M3MG 1BR9A 3FP9A 4K8JA 4IFDI 1A9XA 2DPJA 2YS7A 1VQLA 5DLGA 3HOZG 1GM5A 4RMFA 5CV9A 4Y7NH 4KHVA 3BZCA 4J9KA 2Q8TA 1PYWD 1B9MA 3P20A 4OO1I 2JA5B 2RVLA 5C5MA 2NVXA 1YJWA 4DR4H 4A3MH 3HOVB 3GIPA 5BPFA 5KT2A 5M3MH 1KL9A 1VMCA 5ELNA 1BF4A 4RFBA 3DLLA 1KDBA 1QNUA 4A3FB 4DL6A 5KNBA 2F4VH 2R93A 3HOZH 3PR5B 3U4VA 1NR2A 3MHBA 2G5DA 1EIGA 1JOOA 4A3EB 4GOPC 3KDFA 3CCMA 3BQ2A 3MAQA 4IFDJ 5EKKA 5KG4A 5JOBA 4ED3A 1NAPA 4XQQA 4R8UA 4LF6Q 3PW4A 4IJHA 3NTHA 1WI5A 1XX8A 3C2PA 3GTKB 2HQLA 4RHRA 4C3IB 2K1BA 2F0UA 1EWHA 4DV1H 1CT1D 4R8IA 3Q8SB 1I6HB 2NVTH 4HIMA 4G3IA 1J9OA 1NY4A 3CRKC 1WYDA 5EOYA 3KF6A 1N33L 4UCVA 2R3ZA 4LUOA 3MFHA 3M7GA 3EPGA 4IR1A 2UUBL 1XPOA 2IA6A 1GUSA 1D2BA 5C4JB 4HIOA 3M7NA 2KEDA 3H94A 3D4DA 1QWYA 2J0TD 2PMZE 3CQZH 4QB4A 2PVPA 5JJZA 3OMCA 4L5RC 3PO3G 1JIHA 1NSNS 4RB2C 1IOVA 3V6JA 1X9NA 1Q1EA 1YIJA 2RDHA 1ZYRD 1NMGA 1AEXA 5IWAH 2NVQH 1BBWA 3H40A 2JEFA 4BBRG 1L0WA 4DV4H 1S0NA 1VDZA 3PO2B 2V58A 4MA0A 3BJYA 2VXWA 4JVZA 2WYOA 4TKOB 3PO3H 2XGQA 1VQMA 2UUBH 4RUCA 1WTVA 1B7YB 1TWCA 3KDFB 2YTXA 1XTDA 4GZYC 4V190 2VPQA 3OOCA 4MV7A 3KALA 1IHZA 4TQRA 1AE2A 2FP4B 4M9UA 4R8UB 3G6VA 4QUFA 1RODA 3M3YB 1T5XD 1L2FA 1TWFA 4YR0A 1FJGH 4RZQA 2F0FA 2DY7A 4HJAA 3I4NB 1B3AA 1BNZA 1EYCA 2GN5A 4DR7L 3FHWA 2JE6I 4A3DB 3KF6B 4J1MA 2R87A 3NTKA 1ZYRC 1XDNA 3R5HA 2E2HA 2V4QA 2XGPA 4LNQA 5I47A 5I2YA 1PVOA 4DUZL 1K83H 1NBWA 2RSNA 5D3DA 1KQSA 2HDMA 2MO1A 3OSNA 1C48A 2ZTCA 2FK3A 4YB8B 3BA8A 1KABA 1L1OA 1Q90A 3C3LA 1WTRA 2EPBA 3C46A 4UCOA 2QILA 1E1OA 3ULJA 3J81W 5GAEC 1EEID 5DQIA 2OTJA 4K5VA 2B8GA 5J1ZA 1WJJA 2W9BB 1SE4A 2ALZA 1DJRD 4ECQA 2PW7A 3H3VC 1PXUA 3N52A 1CKNA 2J7ZA 5IGFA 1TXYA 5ELCA 3DWPA 5IYBG 3CVZA 3SGIA 5FPRA 5KG1A 4DR7H 1Y1WA 2JEIA 1S72A 1VKZA 4B3MH 2FB9A 2R7LA 2ID0A 5JJIA 3DF7A 1TWGH 1TWCB 4DUZH 2CH4W 2FE3A 3G48A 1TR5A 3WDNA 4HQ6A 2E8GA 3JAMc 3S14B 4TRDA 2Z1CA 2UXBQ 3JSNA 2W8LA 5IYBH 4DR1Q 4F4WA 2CQOA 1EL0A 2OQKA 4I4TF 1WTQA 1TWFB 2FMAA 4HAEA 4KLKA 5LP6F 3MR5A 1WTWA 2DJGC 4EEYA 3CCJA 2WKDA 3KLSA 5KFIA 5KX5F 3BQ1A 2E2HB 2YYZA 3DHQA 4AQYH 2MJ8A 2VA3A 1S0MA 2JA6A 2A74C 3E5SA 3EVQA 4CC5A 3HOUG 1X32A 3SVMA 3RZOH 4R7RA 3CU7A 3BQ0A 3T53B 1H9MA 4ZHQF 1B9NA 4O3NA 3TS2A 4XYMB 1BO0A 2W8KA 4ECTA 2GPSA 2B2WA 2NVTB 1JOKA 3BG3A 1NUCA 2J6SA 4GN4B 1CKNB 1GXDC 4U673 1KLGD 2AMCB 1SMYC 1C8CA 1QILA 2QEJC 3CF5A 3HOUH 2M9VA 2VNUD 4KKTA 4L5TA 1Y1WB 2M2LA 5KNCA 4JI5Q 1CE8A 1HA5A 2B39A 2BH2A 2UXBL 2X0SA 3NQTA 4DR1L 5T1IA 3MXNA 3ERSX 1LTID 1YITA 2BE5D 2BDOA 3IG0A 3WO0A 3DUZA 4Q43A 4K2LA 2ASLA 3RBEA 5KT5A 1OXXK 3QOJA 5DEHA 3C0FB 1CA5A 1IZ6A 2AQ2B 3RD4A 1YNNC 4XT3B 5KT4A 1HZ9A 1Q1BA 2SEBD 4IPDA 4JPBW 4RWSC 2Y0SA 4DV5Q 2W6OA 1SNCA 3U58A 3CAMA 3W3AA 4A4IA 1TY0A 2W6ZA 1S5FD 1LT5D 5CV6A 5D14A 5JPNC 1QB5D 4IOCA 1BXRA 1ASZA 2F0JA 2XCAA 1I50A 1Z7TA 2UXDQ 4JI6Q 3J80W 3R8BA 3G71A 4F50A 2B2TA 2JA6B 3QO2A 4FVMA 3R23A 1OXSC 1V43A 1UE1A 3VDYA 2V59A 3KAKA 2NUCA 2UXCH 1LTGD 4X65L 3CKIB 2H4OA 4UP7A 3JAML 4BBSB 4JI2Q 1KJIA 4YQWA 1A62A 1SNDA 1VQ9A 1E1TA 4Q5VA 1M7JA 2VQEQ 2O2LD 1DOLA 2GA4B 4O2BF 3BG5A 2R7ZA 3VR5A 1FYCA 4ZLTF 4ECWA 2F0LA 3PUVA 3CC4A 1XPUA 3A56A 4BY7G 5LL6b 4JI5L 2JQOA 4IUTA 2QKIC 3A54A 1EYGA 2ASBA 1TAEA 2RDGA 5LMNW 1GSAA 2WB1A 4X64L 2HIXA 1TWAH 2VQFH 4OWXB 2KBNA 3A8JE 3S2DH 4DV2Q 2F0IA 1PZKD 1EQVA 1EWIA 1HQMC 1B8AA 3MXNB 5C0XG 1IBKQ 5KFBA 3NGDA 4BY7H 3N40P 4QWEA 3HKSA 4L1KA 1STEA 2A1AA 4X65H 1IXRA 1HR0H 1KRTA 4XDXA 1KC7A 4DV5L 3L7ZC 3RIZA 2YW2A 5HGQA 3PIO3 3TINA 3DEPA 1CQFA 4DNTB 5C44G 1YBYA 2Y0SB 3ULLA 1R9TA 3OUZA 5KFPA 5IODA 2UXDL 1K3RA 4JI6L 4ED1A 2EJFC 3S1NH 4X3TA 3IL8A 1C4QA 1B53A 1TWGB 5C0XH 4I55F 2R92A 2AUJD 4LFAH 4X64H 4KD4A 2N88A 1KAWA 4JI2L 1G51A 3NUCA 4P74A 5IIFA 5C44H 4JI3Q 2HT1A 2W57A 2VQEL 1XMQQ 2WAQE 1XNRQ 3EYYA 4G57A 3HG9A 3RAXA 1GKHA 4MTDA 4HJ8A 4HSPA 4J9PA 2EXZA 4IWXA 5FD5A 4AYBG 2W7OA 1XNQH 3OW7A 1HNWH 1Y8OB 3GIKA 3STBD 2WDTA 3GTGA 3PUXA 5I4DA 1VBGA 2JN4A 3RZDH 3Q23A 4EQPA 3PW0A 2M00A 2WB1B 2UXDH 4JI6H 3G6XA 1PYSB 1SCUB 5ELOA 1V1OA 5I2XA 3T1HH 5FPOA 2F0TA 1EZ6A 3FEWX 3AMUA 3N42B 3I56A 1TA8A 1LTSD 4CDFC 4HTHA 1I3QH 4CKEA 5K5PA 4XQJA 5KT6A 4ZUIA 3TQYA 4JI2H 3PR4A 1JR0D 1SR3A 1Y8PB 3KBGA 4J9SA 5JVG3 2QK4A 3RAQA 3P7JA 2A69D 2UU9Q 1JMCA 3DWAA 1LLRD 2FMMA 2CKZB 5KFNA 4I7AA 4WJWA 1II3A 3M4PA 1A6XA 2PYKA 1R9TB 5KFUA 1VQGA 3VA7A 2LSSA 2ZM6Q
chains in the Genus database with same CATH topology
2Y0SE 5C4XG 4PG3A 1VQHA 1HNZL 4BXXH 1PFSA 2K52A 2D0OA 2JEBI 3RR5A 1YZ6A 3M4QA 5FJ8H 4JI3L 1NJIC 1AH9A 2DUDA 4JG2A 4P72A 2YU9H 2RHQB 3I4MG 3PSIA 4AH6A 3HOXH 3NENA 2Q2UA 1NE3A 4HJ7A 2A19A 1UE6A 1FVIA 5H1SE 2CWPA 3PGZA 1Q7YC 1XNQQ 1VQOA 2K5HA 1HNWQ 2LXKA 2I0QA 2RF4A 1NMFA 3OYYA 1TWHH 4OXPA 4DR5L 4IPGA 1SMXA 5FLMG 3F8TA 3KOJA 1D8LA 3CMAA 2VQFL 5C4XH 1HR0W 1IBML 2ZJQA 3GTGH 3GTMH 4JYAQ 1X6OA 3CMEA 5LMUL 3T1HQ 3I4NG 5IT9c 1N32Q 1YVCA 1V1QA 1VQBA 3W1GA 3I4MH 1EFWA 1PH7A 1SN8A 4JI7Q 4LF9L 4UP8A 2B29A 1HR0L 2OWOA 3H3VH 1HJPA 5C0XI 4QJFA 3F2DA 5JJKA 1YI2A 4LF6L 1UEBA 3FKIG 3ICEA 1PHJA 4ALPA 1HZCA 2YV5A 5FLMH 3H0GG 3CP0A 1A0IA 3E9IA 4ME3A 3CCSA 4QQBX 4BBRH 1I94Q 3I4NH 4GLVB 2UU9L 2OCEA 3KF8B 1VQAA 4YHHL 3L2PA 3KFUA 4A75A 1M90C 4LUZA 4LFAL 1IBLQ 2Z0SA 4UPAA 3RN5A 1Q81C 2XGTA 4GLAC 4MZ9A 4B3RQ 3GTLH 1PH2A 1HNXL 2RHSB 3GTOH 4JBJA 1GD7A 2NZHA 3FKIH 4AYBE 1EIYB 2AHOB 2I5MX 3GD7A 3OW2A 5JEAG 2OQ0A 3H0GH 3S15H 4IPCA 2UUAQ 4NPSA 5JEAJ 1PH1A 2CWAA 1CKOA 1T9HA 2H5XA 2CCZA 3ER0A 4JI1Q 3I55A 1QUQA 2WP8J 2VUMG 4DR4L 1XNQL 1VQDA 1HNWL 2Q2TA 3M9BA 3JC66 1LUZA 2JA5G 3K81C 4OX9L 4LUVA 1VQ7A 1J5EL 4EX5A 4GNXC 4JI0Q 1VS0A 4JYAL 3D0FA 3HOVG 3T1HL 1C9OA 3KJOA 4P71A 1N33Q 4A3FG 1K9MC 2DGYA 1N32L 2I5LX 3RLOA 2MQHA 4QGUA 4A3MG 4JI7L 2VL6A 3W5OA 4DR3Q 1RL2A 5IE8A 5M3MG 2VUMH 3FP9A 4IFDI 2GVBA 1LTLA 4A3EG 2N3SA 1N8RC 4FDBA 1VQLA 3GDEA 2EXDA 3HOZG 1Z9FA 4RMFA 1GM5A 2JA5H 3BZKA 1JB7A 3RLFA 3A5ZB 4Y7NH 3J81j 3GTPH 3BZCA 1MKHA 5E7NA 1VQ8A 3LGJA 3HOVH 1QZGA 1HZAA 4OO1I 3B6YA 2EQSA 5GAHC 2LXJA 2IX0A 1PH6A 4A3FH 4HIDA 1YJWA 3J80c 1Z47A 4A3MH 4QL5A 1IBLL 1A8VA 5M3MH 1E22A 1KL9A 5ELNA 4GKKQ 4X6AH 3DLLA 4A3EH 1WFQA 4B3RL 1VQPA 2UUCQ 2FXQA 3NBHB 1N36Q 3HOZH 3U4VA 1CSQA 4GOPC 1LM0A 2PI2E 3KDFA 4IPHA 3CCMA 3S1RH 4IFDJ 1UE5A 2KHIA 2E5LQ 3NEMA 2UUAL 4Y52H 4C3IH 4DV3Q 4JI1L 4LF6Q 4IJHA 1WI5A 1I6HH 2BA0A 3OTOL 2HQLA 2PNHA 4TVAB 5EAYA 1M1KC 3H3VI 1VQNA 1N9WA 1QUQB 4PMWA 4YCWA 3KYHC 3RNUA 2F3IA 2KCMA 1Q12A 4JI0L 2NVTH 3TRZA 4HIMA 3J81c 3GTQH 1NY4A 3TEHB 1WYDA 4DV0Q 5C4JH 3KF6A 1N33L 5HY6A 2IHEA 3PUZA 4LF4Q 4LUOA 1OXUA 4HJ5A 4A3KG 3HOWG 3PO2G 2UUBL 1XPOA 3AFPA 4DR3L 4A93H 3TS0A 1EQRA 4HIOA 3M7NA 4DR6Q 3STBC 2F52A 3K7UC 4QY7A 5AJ3Q 4A76A 2R93G 3S1QH 4DV7Q 3E9HA 4NXML 2PMZE 3CQZH 3IRBA 1VQ6A 4L5RC 3PO3G 2ZJPA 1L1OC 2Z6KA 3D31A 4KI0A 4MNOA 4DR4Q 4AIMA 3I7FA 1G6PA 2NVXH 1X9NA 1Q1EA 1YIJA 4A3KH 3HOWH 4X62Q 3PO2H 1S40A 1J5EQ 2F4VQ 4GKKL 1NMGA 1P8LA 4JI8Q 2UUCL 1BBWA 2NVQH 1BBUA 1YHAA 1L0WA 4BBRG 1JE5A 3UE0A 1VQ5A 5DLQE 2R93H 4GS3A 1N36L 1WCMG 3U4ZA 1B70B 5LMNQ 4XIGS 4A3DG 3L0OA 1O7IA 1YEZA 3PO3H 1X56A 3EN2A 1VQMA 4C3JH 2E5LL 2V1CC 1SFOH 1JJGA 4DV3L 1YHQA 4GOPA 1B7YB 4LW1A 3KDFB 2YTXA 4OWTB 5M5XH 5IYCH 1XTDA 1PH9A 4JOIC 3M3YH 4DV1Q 3CC7A 2NVYH 1AE2A 3CCUA 4A3IG 1DGSA 5IP9G 2A8VA 1H95A 2IY5B 1RIPA 1PV4A 3UDFA 1WCMH 3GO5A 3AFQA 3E0EA 5IP7G 1L2FA 4UY8C 1C0AA 4A3DH 1Q8KA 4DV0L 1SROA 1Q86C 2MO0A 4DK3C 3S16H 4LF4L 4HJAA 2VS1A 4R4CA 4TQUS 4L5SA 2GN5A 4DR7L 2IT1A 3FHWA 2JE6I 4A3BG 4YCVA 1X65A 5M5YH 3KF6B 4YWKA 4DR6L 1EUJA 4LFBQ 5AJ3L 4LNQA 5GROA 5IY0A 1PVOA 4H02A 3U50C 5IP9H 4DV7L 4A3IH 4DUZL 4NXNQ 1K83H 4DAMA 1NBWA 1WOCA 2K5NA 5IP7H 1KQSA 4JI4L 2MO1A 2JA7G 4B3TQ 2ZTCA 3OTOQ 3CD6A 1L1OA 3S17H 1N34Q 2D0PA 1C7YA 1FL0A 1P16A 5IWAQ 1V9PA 4X62L 1Y1VG 1E1OA 3ULJA 1EIFA 4DV4Q 5GAEC 2F4VL 4A3BH 1J6QA 2OTJA 4JI8L 2MNAA 3CCVA 1XMOQ 1BKBA 1YJNA 1WJJA 1PH8A 4PZ7A 4OONA 2ZTEA 4O2DA 3BJUA 2BH8A 4XTCS 1CKNA 1XPRA 3PIOA 1GVPA 1TXYA 5LMNL 2UUBQ 4DK6C 1A63A 5IYBG 4C3HH 3A74A 1QZHA 3SGIA 1QVGA 2JA7H 1EOVA 3J80i 4K0KQ 1S72A 4GN3B 1TWCH 1SRUA 4RG1A 2ID0A 3A5UA 1Y1VH 2CFMA 4QIWE 4DKAC 4DPGA 4GN5A 4DV1L 1KD1C 3S14H 5JJIA 1TWGH 4R4IA 1CUKA 2B3GA 3G48A 1FJGQ 4JOIA 2E8GA 4WJ3M 1X3EA 3JAMc 2ZJRA 3AQQA 1TWFH 4DR2Q 4A3GG 2UXBQ 1X3FA 5IYBH 3HKZG 4DR1Q 1KIXA 4EQ5A 4GKJQ 2CQOA 2JJQA 2VZAA 4BA2I 2OQKA 1PA6A 3AYHB 4LF5L 4KLKA 3BU2A 2E2HH 4LFBL 3CCJA 3HOYG 3GTJH 2B63G 1XJVA 4NXNL 3J81i 1CSPA 4R4OA 3Q8DA 2JA9A 2YYZA 4A93G 1VQEA 2KCTA 4DUYQ 2NN6G 4B3TL 4A3GH 1Y1WG 1JJ2A 1K0RA 1W3SA 1SLJA 1N34L 3K8AA 5IWAL 3HOUG 3RZOH 2AWOA 4YWLA 4DV4L 5M3FG 3PF5A 1HZBA 3H15A 3I4OA 3T1YL 1XMOL 2YTYA 1Q46A 3A0JA 2ES2A 3TS2A 4A3JG 3HOYH 4LF7Q 2JA8G 4DV2L 4GNXA 2B63H 4HJ9A 2WFWA 4YWMA 4DR7Q 5J3BA 1IBKL 4WJ4A 4YY3L 5M5WH 4B3MQ 4GN4B 5GQOA 1CKNB 1Y1WH 3M4OH 1IYJB 3KJPA 4K0KL 2AMCB 2ZTDA 4L5QA 4BA1I 1Q82C 3CF5A 5IYDG 4DUZQ 1YNXA 3HOUH 3CXCA 5BR8Q 2VNUD 2ALYB 4L5TA 4R4QA 1AE3A 5M3FH 2HIVA 1I5FA 3MEFA 2QEXA 4JI4Q 4JI5Q 2QA4A 4A3JH 1FJGL 2R6GA 1VQJA 1Y14B 4P75A 2JA8H 3RLNA 2BH2A 1MIUA 3PCOB 3G4SA 4DR2L 2L15A 3F2CA 2OTLA 2UXBL 2BA1A 1E24A 2JA6G 4A3LG 4DR1L 3PIPA 1IL2A 4GKJL 3ERSX 4APVA 4KHPQ 3K80C 1YITA 4R1JA 1JJCB 1KRSA 1G291 1U0LA 5IYDH 2JEAI 4BBSG 2R7DA 1OXXK 1IZ6A 4AQYQ 1XMQL 1XNRL 1EQQA 1VQCA 1HZ9A 1VQKA 1Q1BA 4UP9A 4IPDA 3NELA 4DV5Q 1S3OA 4DUYL 1K8AC 3U58A 3CAMA 4A4IA 1X3GA 4IOCA 3W1BA 2C35B 2JA6H 1ASZA 4A3LH 4LF8L 2N49A 3CCQA 2D62A 2UXDQ 2QGQA 4LFCL 4JI6Q 3G71A 2K50A 2K75A 3WWVA 4B3SQ 1OXSC 1V43A 1UE1A 3RN2A 3VDYA 4BBSH 1PH4A 1CKMA 4LF7L 4GLXA 1MJEA 1QVFA 4JV5Q 4X65L 4BY1G 4UP7A 4LF5Q 1PH3A 4JI2Q 1A62A 2ATWA 4IOAA 3PV0A 4JBMA 4GNXB 4B3ML 2EIFA 1VQ9A 1E1TA 3HKZE 4NB3A 1FGUA 2WB1E 2VQEQ 4DV6Q 1X55A 1GO3E 4PZ6A 4C2MH 3ZJYC 5BR8L 5C3EG 3UDIA 2KHJA 3PUVA 3M85A 3CC4A 3CCEA 2JK8A 5GAGC 1XPUA 3PF4A 4BY7G 4JI5L 1K73C 2JQOA 2Q2IA 3AEVA 2IX1A 2K14A 2Y0SG 1EYGA 1SE8A 2ASBA 3S1MH 4MTNA 2GVAA 2YTVA 5LMNW 1VQ4A 4BY1H 4X64L 4KHZA 1VCIA 2HHHQ 2HIXA 3T1YQ 2ZM6L 4KHPL 1OXVA 1TWAH 4P73A 4OWXB 2VW9A 2KBNA 1D7QA 2IHFA 3S2DH 4DV2Q 4IO9A 2RCNA 1EWIA 2I5HA 3MXNB 1B8AA 2Q2HA 1ASYA 5C0XG 5C3EH 1IBKQ 1OTCA 4BY7H 1UWVA 1OXTA 3S24A 4YY3Q 4AQYL 3HKSA 3JAMi 1PH5A 2A1AA 5C0XJ 1IXRA 1KRTA 3ULPA 4DV5L 1HH2P 3L7ZC 1VQFA 5HGQA 2KENA 1X54A 2N8NA 1U5KA 3I2ZA 2AKWB 3CCRA 4JCVE 1YBYA 5C44G 1KC8C 2NN6I 4GOPB 1I50H 4X66Q 2R7ZG 3ULLA 2UXDL 1K3RA 4JI6L 2PQAA 4OWWB 2XTIA 3S1NH 4B3SL 2UXCQ 1W2BA 2N78A 1K8GA 1YHBA 1E7ZA 4OX9Q 2WB1G 2NZOA 4JV5L 1QVCA 4O0AA 1KAWA 4JI2L 1HNZQ 4J15A 2MFIA 3CPFA 3DM3A 3EBEA 2Z6KC 4HIKA 1G51A 1UE7A 4P74A 3F1ZA 5C44H 4JI3Q 2HT1A 4DAYB 2VQEL 1XMQQ 2WAQE 4DV6L 1XNRQ 2R7ZH 4LWCA 3UDXA 3CW2C 2AWNA 4IJLA 3CPWA 1GKHA 4HJ8A 1I94L 4POFA 3UDGA 2VY3A 4AYBG 4LF8Q 3J7A5 1LYLA 1BVSA 1E3PA 4DR5Q 3STBD 2VQFQ 1IBMQ 3CC2A 4LFCQ 3PUXA 2HHHL 3KLWA 5LMUQ 3RZDH 4POGA 3HFZB 1L1OB 4A3CG 5K36G 4YCUA 3J7ZC 4JBKA 1PYSB 4IFDG 5ELOA 3PUYA 5GADC 1PYBA 2K5VA 4LF9Q 2R92G 1KHIA 4X65Q 3GTKH 3I56A 3K0XA 1HR0Q 5FLXc 4DNIA 3CCLA 1MJCA 4JBWA 2R7FA 2E2JH 1I3QH 5IYCG 3UE1A 3TQYA 3PUWA 3F2BA 3G6EA 1VQIA 4JC0A 1SR3A 4BXXG 4R4TA 4OO1G 3EIVA 2PI2A 3TREA 5FJ8G 3S2HH 4A3CH 4X66L 1R9TH 2E2IH 3HOXG 2UU9Q 1KXLA 5JJLA 4YHHQ 4NXMQ 1JMCA 1YJ9A 2CKZB 2K4KA 2UXCL 4LFAQ 2R92H 3M4PA 3K7AH 4X64Q 4PZ8A 1VQGA 1JT8A 2LSSA 2ZM6Q 2PQAB 1NTGA 2WAQG 1HNXQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Y0S E;  5C4X G;  4PG3 A;  1VQH A;  1HNZ L;  4BXX H;  1PFS A;  2K52 A;  2D0O A;  2JEB I;  3RR5 A;  1YZ6 A;  3M4Q A;  5FJ8 H;  4JI3 L;  1NJI C;  1AH9 A;  2DUD A;  4JG2 A;  4P72 A;  2YU9 H;  2RHQ B;  3I4M G;  3PSI A;  4AH6 A;  3HOX H;  3NEN A;  2Q2U A;  1NE3 A;  4HJ7 A;  2A19 A;  1UE6 A;  1FVI A;  5H1S E;  2CWP A;  3PGZ A;  1Q7Y C;  1XNQ Q;  1VQO A;  2K5H A;  1HNW Q;  2LXK A;  2I0Q A;  2RF4 A;  1NMF A;  3OYY A;  1TWH H;  4OXP A;  4DR5 L;  4IPG A;  1SMX A;  5FLM G;  3F8T A;  3KOJ A;  1D8L A;  3CMA A;  2VQF L;  5C4X H;  1HR0 W;  1IBM L;  2ZJQ A;  3GTG H;  3GTM H;  4JYA Q;  1X6O A;  3CME A;  5LMU L;  3T1H Q;  3I4N G;  5IT9 c;  1N32 Q;  1YVC A;  1V1Q A;  1VQB A;  3W1G A;  3I4M H;  1EFW A;  1PH7 A;  1SN8 A;  4JI7 Q;  4LF9 L;  4UP8 A;  2B29 A;  1HR0 L;  2OWO A;  3H3V H;  1HJP A;  5C0X I;  4QJF A;  3F2D A;  5JJK A;  1YI2 A;  4LF6 L;  1UEB A;  3FKI G;  3ICE A;  1PHJ A;  4ALP A;  1HZC A;  2YV5 A;  5FLM H;  3H0G G;  3CP0 A;  1A0I A;  3E9I A;  4ME3 A;  3CCS A;  4QQB X;  4BBR H;  1I94 Q;  3I4N H;  4GLV B;  2UU9 L;  2OCE A;  3KF8 B;  1VQA A;  4YHH L;  3L2P A;  3KFU A;  4A75 A;  1M90 C;  4LUZ A;  4LFA L;  1IBL Q;  2Z0S A;  4UPA A;  3RN5 A;  1Q81 C;  2XGT A;  4GLA C;  4MZ9 A;  4B3R Q;  3GTL H;  1PH2 A;  1HNX L;  2RHS B;  3GTO H;  4JBJ A;  1GD7 A;  2NZH A;  3FKI H;  4AYB E;  1EIY B;  2AHO B;  2I5M X;  3GD7 A;  3OW2 A;  5JEA G;  2OQ0 A;  3H0G H;  3S15 H;  4IPC A;  2UUA Q;  4NPS A;  5JEA J;  1PH1 A;  2CWA A;  1CKO A;  1T9H A;  2H5X A;  2CCZ A;  3ER0 A;  4JI1 Q;  3I55 A;  1QUQ A;  2WP8 J;  2VUM G;  4DR4 L;  1XNQ L;  1VQD A;  1HNW L;  2Q2T A;  3M9B A;  3JC6 6;  1LUZ A;  2JA5 G;  3K81 C;  4OX9 L;  4LUV A;  1VQ7 A;  1J5E L;  4EX5 A;  4GNX C;  4JI0 Q;  1VS0 A;  4JYA L;  3D0F A;  3HOV G;  3T1H L;  1C9O A;  3KJO A;  4P71 A;  1N33 Q;  4A3F G;  1K9M C;  2DGY A;  1N32 L;  2I5L X;  3RLO A;  2MQH A;  4QGU A;  4A3M G;  4JI7 L;  2VL6 A;  3W5O A;  4DR3 Q;  1RL2 A;  5IE8 A;  5M3M G;  2VUM H;  3FP9 A;  4IFD I;  2GVB A;  1LTL A;  4A3E G;  2N3S A;  1N8R C;  4FDB A;  1VQL A;  3GDE A;  2EXD A;  3HOZ G;  1Z9F A;  4RMF A;  1GM5 A;  2JA5 H;  3BZK A;  1JB7 A;  3RLF A;  3A5Z B;  4Y7N H;  3J81 j;  3GTP H;  3BZC A;  1MKH A;  5E7N A;  1VQ8 A;  3LGJ A;  3HOV H;  1QZG A;  1HZA A;  4OO1 I;  3B6Y A;  2EQS A;  5GAH C;  2LXJ A;  2IX0 A;  1PH6 A;  4A3F H;  4HID A;  1YJW A;  3J80 c;  1Z47 A;  4A3M H;  4QL5 A;  1IBL L;  1A8V A;  5M3M H;  1E22 A;  1KL9 A;  5ELN A;  4GKK Q;  4X6A H;  3DLL A;  4A3E H;  1WFQ A;  4B3R L;  1VQP A;  2UUC Q;  2FXQ A;  3NBH B;  1N36 Q;  3HOZ H;  3U4V A;  1CSQ A;  4GOP C;  1LM0 A;  2PI2 E;  3KDF A;  4IPH A;  3CCM A;  3S1R H;  4IFD J;  1UE5 A;  2KHI A;  2E5L Q;  3NEM A;  2UUA L;  4Y52 H;  4C3I H;  4DV3 Q;  4JI1 L;  4LF6 Q;  4IJH A;  1WI5 A;  1I6H H;  2BA0 A;  3OTO L;  2HQL A;  2PNH A;  4TVA B;  5EAY A;  1M1K C;  3H3V I;  1VQN A;  1N9W A;  1QUQ B;  4PMW A;  4YCW A;  3KYH C;  3RNU A;  2F3I A;  2KCM A;  1Q12 A;  4JI0 L;  2NVT H;  3TRZ A;  4HIM A;  3J81 c;  3GTQ H;  1NY4 A;  3TEH B;  1WYD A;  4DV0 Q;  5C4J H;  3KF6 A;  1N33 L;  5HY6 A;  2IHE A;  3PUZ A;  4LF4 Q;  4LUO A;  1OXU A;  4HJ5 A;  4A3K G;  3HOW G;  3PO2 G;  2UUB L;  1XPO A;  3AFP A;  4DR3 L;  4A93 H;  3TS0 A;  1EQR A;  4HIO A;  3M7N A;  4DR6 Q;  3STB C;  2F52 A;  3K7U C;  4QY7 A;  5AJ3 Q;  4A76 A;  2R93 G;  3S1Q H;  4DV7 Q;  3E9H A;  4NXM L;  2PMZ E;  3CQZ H;  3IRB A;  1VQ6 A;  4L5R C;  3PO3 G;  2ZJP A;  1L1O C;  2Z6K A;  3D31 A;  4KI0 A;  4MNO A;  4DR4 Q;  4AIM A;  3I7F A;  1G6P A;  2NVX H;  1X9N A;  1Q1E A;  1YIJ A;  4A3K H;  3HOW H;  4X62 Q;  3PO2 H;  1S40 A;  1J5E Q;  2F4V Q;  4GKK L;  1NMG A;  1P8L A;  4JI8 Q;  2UUC L;  1BBW A;  2NVQ H;  1BBU A;  1YHA A;  1L0W A;  4BBR G;  1JE5 A;  3UE0 A;  1VQ5 A;  5DLQ E;  2R93 H;  4GS3 A;  1N36 L;  1WCM G;  3U4Z A;  1B70 B;  5LMN Q;  4XIG S;  4A3D G;  3L0O A;  1O7I A;  1YEZ A;  3PO3 H;  1X56 A;  3EN2 A;  1VQM A;  4C3J H;  2E5L L;  2V1C C;  1SFO H;  1JJG A;  4DV3 L;  1YHQ A;  4GOP A;  1B7Y B;  4LW1 A;  3KDF B;  2YTX A;  4OWT B;  5M5X H;  5IYC H;  1XTD A;  1PH9 A;  4JOI C;  3M3Y H;  4DV1 Q;  3CC7 A;  2NVY H;  1AE2 A;  3CCU A;  4A3I G;  1DGS A;  5IP9 G;  2A8V A;  1H95 A;  2IY5 B;  1RIP A;  1PV4 A;  3UDF A;  1WCM H;  3GO5 A;  3AFQ A;  3E0E A;  5IP7 G;  1L2F A;  4UY8 C;  1C0A A;  4A3D H;  1Q8K A;  4DV0 L;  1SRO A;  1Q86 C;  2MO0 A;  4DK3 C;  3S16 H;  4LF4 L;  4HJA A;  2VS1 A;  4R4C A;  4TQU S;  4L5S A;  2GN5 A;  4DR7 L;  2IT1 A;  3FHW A;  2JE6 I;  4A3B G;  4YCV A;  1X65 A;  5M5Y H;  3KF6 B;  4YWK A;  4DR6 L;  1EUJ A;  4LFB Q;  5AJ3 L;  4LNQ A;  5GRO A;  5IY0 A;  1PVO A;  4H02 A;  3U50 C;  5IP9 H;  4DV7 L;  4A3I H;  4DUZ L;  4NXN Q;  1K83 H;  4DAM A;  1NBW A;  1WOC A;  2K5N A;  5IP7 H;  1KQS A;  4JI4 L;  2MO1 A;  2JA7 G;  4B3T Q;  2ZTC A;  3OTO Q;  3CD6 A;  1L1O A;  3S17 H;  1N34 Q;  2D0P A;  1C7Y A;  1FL0 A;  1P16 A;  5IWA Q;  1V9P A;  4X62 L;  1Y1V G;  1E1O A;  3ULJ A;  1EIF A;  4DV4 Q;  5GAE C;  2F4V L;  4A3B H;  1J6Q A;  2OTJ A;  4JI8 L;  2MNA A;  3CCV A;  1XMO Q;  1BKB A;  1YJN A;  1WJJ A;  1PH8 A;  4PZ7 A;  4OON A;  2ZTE A;  4O2D A;  3BJU A;  2BH8 A;  4XTC S;  1CKN A;  1XPR A;  3PIO A;  1GVP A;  1TXY A;  5LMN L;  2UUB Q;  4DK6 C;  1A63 A;  5IYB G;  4C3H H;  3A74 A;  1QZH A;  3SGI A;  1QVG A;  2JA7 H;  1EOV A;  3J80 i;  4K0K Q;  1S72 A;  4GN3 B;  1TWC H;  1SRU A;  4RG1 A;  2ID0 A;  3A5U A;  1Y1V H;  2CFM A;  4QIW E;  4DKA C;  4DPG A;  4GN5 A;  4DV1 L;  1KD1 C;  3S14 H;  5JJI A;  1TWG H;  4R4I A;  1CUK A;  2B3G A;  3G48 A;  1FJG Q;  4JOI A;  2E8G A;  4WJ3 M;  1X3E A;  3JAM c;  2ZJR A;  3AQQ A;  1TWF H;  4DR2 Q;  4A3G G;  2UXB Q;  1X3F A;  5IYB H;  3HKZ G;  4DR1 Q;  1KIX A;  4EQ5 A;  4GKJ Q;  2CQO A;  2JJQ A;  2VZA A;  4BA2 I;  2OQK A;  1PA6 A;  3AYH B;  4LF5 L;  4KLK A;  3BU2 A;  2E2H H;  4LFB L;  3CCJ A;  3HOY G;  3GTJ H;  2B63 G;  1XJV A;  4NXN L;  3J81 i;  1CSP A;  4R4O A;  3Q8D A;  2JA9 A;  2YYZ A;  4A93 G;  1VQE A;  2KCT A;  4DUY Q;  2NN6 G;  4B3T L;  4A3G H;  1Y1W G;  1JJ2 A;  1K0R A;  1W3S A;  1SLJ A;  1N34 L;  3K8A A;  5IWA L;  3HOU G;  3RZO H;  2AWO A;  4YWL A;  4DV4 L;  5M3F G;  3PF5 A;  1HZB A;  3H15 A;  3I4O A;  3T1Y L;  1XMO L;  2YTY A;  1Q46 A;  3A0J A;  2ES2 A;  3TS2 A;  4A3J G;  3HOY H;  4LF7 Q;  2JA8 G;  4DV2 L;  4GNX A;  2B63 H;  4HJ9 A;  2WFW A;  4YWM A;  4DR7 Q;  5J3B A;  1IBK L;  4WJ4 A;  4YY3 L;  5M5W H;  4B3M Q;  4GN4 B;  5GQO A;  1CKN B;  1Y1W H;  3M4O H;  1IYJ B;  3KJP A;  4K0K L;  2AMC B;  2ZTD A;  4L5Q A;  4BA1 I;  1Q82 C;  3CF5 A;  5IYD G;  4DUZ Q;  1YNX A;  3HOU H;  3CXC A;  5BR8 Q;  2VNU D;  2ALY B;  4L5T A;  4R4Q A;  1AE3 A;  5M3F H;  2HIV A;  1I5F A;  3MEF A;  2QEX A;  4JI4 Q;  4JI5 Q;  2QA4 A;  4A3J H;  1FJG L;  2R6G A;  1VQJ A;  1Y14 B;  4P75 A;  2JA8 H;  3RLN A;  2BH2 A;  1MIU A;  3PCO B;  3G4S A;  4DR2 L;  2L15 A;  3F2C A;  2OTL A;  2UXB L;  2BA1 A;  1E24 A;  2JA6 G;  4A3L G;  4DR1 L;  3PIP A;  1IL2 A;  4GKJ L;  3ERS X;  4APV A;  4KHP Q;  3K80 C;  1YIT A;  4R1J A;  1JJC B;  1KRS A;  1G29 1;  1U0L A;  5IYD H;  2JEA I;  4BBS G;  2R7D A;  1OXX K;  1IZ6 A;  4AQY Q;  1XMQ L;  1XNR L;  1EQQ A;  1VQC A;  1HZ9 A;  1VQK A;  1Q1B A;  4UP9 A;  4IPD A;  3NEL A;  4DV5 Q;  1S3O A;  4DUY L;  1K8A C;  3U58 A;  3CAM A;  4A4I A;  1X3G A;  4IOC A;  3W1B A;  2C35 B;  2JA6 H;  1ASZ A;  4A3L H;  4LF8 L;  2N49 A;  3CCQ A;  2D62 A;  2UXD Q;  2QGQ A;  4LFC L;  4JI6 Q;  3G71 A;  2K50 A;  2K75 A;  3WWV A;  4B3S Q;  1OXS C;  1V43 A;  1UE1 A;  3RN2 A;  3VDY A;  4BBS H;  1PH4 A;  1CKM A;  4LF7 L;  4GLX A;  1MJE A;  1QVF A;  4JV5 Q;  4X65 L;  4BY1 G;  4UP7 A;  4LF5 Q;  1PH3 A;  4JI2 Q;  1A62 A;  2ATW A;  4IOA A;  3PV0 A;  4JBM A;  4GNX B;  4B3M L;  2EIF A;  1VQ9 A;  1E1T A;  3HKZ E;  4NB3 A;  1FGU A;  2WB1 E;  2VQE Q;  4DV6 Q;  1X55 A;  1GO3 E;  4PZ6 A;  4C2M H;  3ZJY C;  5BR8 L;  5C3E G;  3UDI A;  2KHJ A;  3PUV A;  3M85 A;  3CC4 A;  3CCE A;  2JK8 A;  5GAG C;  1XPU A;  3PF4 A;  4BY7 G;  4JI5 L;  1K73 C;  2JQO A;  2Q2I A;  3AEV A;  2IX1 A;  2K14 A;  2Y0S G;  1EYG A;  1SE8 A;  2ASB A;  3S1M H;  4MTN A;  2GVA A;  2YTV A;  5LMN W;  1VQ4 A;  4BY1 H;  4X64 L;  4KHZ A;  1VCI A;  2HHH Q;  2HIX A;  3T1Y Q;  2ZM6 L;  4KHP L;  1OXV A;  1TWA H;  4P73 A;  4OWX B;  2VW9 A;  2KBN A;  1D7Q A;  2IHF A;  3S2D H;  4DV2 Q;  4IO9 A;  2RCN A;  1EWI A;  2I5H A;  3MXN B;  1B8A A;  2Q2H A;  1ASY A;  5C0X G;  5C3E H;  1IBK Q;  1OTC A;  4BY7 H;  1UWV A;  1OXT A;  3S24 A;  4YY3 Q;  4AQY L;  3HKS A;  3JAM i;  1PH5 A;  2A1A A;  5C0X J;  1IXR A;  1KRT A;  3ULP A;  4DV5 L;  1HH2 P;  3L7Z C;  1VQF A;  5HGQ A;  2KEN A;  1X54 A;  2N8N A;  1U5K A;  3I2Z A;  2AKW B;  3CCR A;  4JCV E;  1YBY A;  5C44 G;  1KC8 C;  2NN6 I;  4GOP B;  1I50 H;  4X66 Q;  2R7Z G;  3ULL A;  2UXD L;  1K3R A;  4JI6 L;  2PQA A;  4OWW B;  2XTI A;  3S1N H;  4B3S L;  2UXC Q;  1W2B A;  2N78 A;  1K8G A;  1YHB A;  1E7Z A;  4OX9 Q;  2WB1 G;  2NZO A;  4JV5 L;  1QVC A;  4O0A A;  1KAW A;  4JI2 L;  1HNZ Q;  4J15 A;  2MFI A;  3CPF A;  3DM3 A;  3EBE A;  2Z6K C;  4HIK A;  1G51 A;  1UE7 A;  4P74 A;  3F1Z A;  5C44 H;  4JI3 Q;  2HT1 A;  4DAY B;  2VQE L;  1XMQ Q;  2WAQ E;  4DV6 L;  1XNR Q;  2R7Z H;  4LWC A;  3UDX A;  3CW2 C;  2AWN A;  4IJL A;  3CPW A;  1GKH A;  4HJ8 A;  1I94 L;  4POF A;  3UDG A;  2VY3 A;  4AYB G;  4LF8 Q;  3J7A 5;  1LYL A;  1BVS A;  1E3P A;  4DR5 Q;  3STB D;  2VQF Q;  1IBM Q;  3CC2 A;  4LFC Q;  3PUX A;  2HHH L;  3KLW A;  5LMU Q;  3RZD H;  4POG A;  3HFZ B;  1L1O B;  4A3C G;  5K36 G;  4YCU A;  3J7Z C;  4JBK A;  1PYS B;  4IFD G;  5ELO A;  3PUY A;  5GAD C;  1PYB A;  2K5V A;  4LF9 Q;  2R92 G;  1KHI A;  4X65 Q;  3GTK H;  3I56 A;  3K0X A;  1HR0 Q;  5FLX c;  4DNI A;  3CCL A;  1MJC A;  4JBW A;  2R7F A;  2E2J H;  1I3Q H;  5IYC G;  3UE1 A;  3TQY A;  3PUW A;  3F2B A;  3G6E A;  1VQI A;  4JC0 A;  1SR3 A;  4BXX G;  4R4T A;  4OO1 G;  3EIV A;  2PI2 A;  3TRE A;  5FJ8 G;  3S2H H;  4A3C H;  4X66 L;  1R9T H;  2E2I H;  3HOX G;  2UU9 Q;  1KXL A;  5JJL A;  4YHH Q;  4NXM Q;  1JMC A;  1YJ9 A;  2CKZ B;  2K4K A;  2UXC L;  4LFA Q;  2R92 H;  3M4P A;  3K7A H;  4X64 Q;  4PZ8 A;  1VQG A;  1JT8 A;  2LSS A;  2ZM6 Q;  2PQA B;  1NTG A;  2WAQ G;  1HNX Q; 
#chains in the Genus database with same CATH topology
 5DGA A;  5HGT A;  2Y0S E;  2MUY A;  2R92 B;  4B3R H;  3FKI A;  3K7A B;  1EYZ A;  1F2L A;  1VQH A;  2D0O A;  2JEB I;  3M4Q A;  1IYU A;  1CK1 A;  4JI3 L;  1NJI C;  4P72 A;  5KFR A;  2RHQ B;  3OMG A;  3MZ5 A;  1DM0 B;  2Q2U A;  2Z6B A;  1HCZ A;  4PV1 C;  5ELF A;  1D5Z C;  2P0A A;  4O2A F;  4TQS A;  5H1S E;  1HPC A;  2NU8 B;  3D3R A;  3BDC A;  2K5H A;  2LXK A;  4L63 B;  4OEM B;  1KDA A;  3HXL A;  1TWH H;  4IPG A;  5KFQ A;  5FLM G;  5JJL A;  1D8L A;  1BQQ T;  1NR4 A;  5D8D A;  3GTM H;  1X6O A;  4F87 A;  3VYU A;  1FD7 D;  1ET9 A;  2QDL A;  5A2Q L;  1VQB A;  2YS6 A;  2A69 C;  1HHV A;  2ZXR A;  5C4X B;  3GTG B;  1EFW A;  1SN8 A;  5FKA C;  3MTS A;  4UP8 A;  2VUM A;  1Q8I A;  4X3U A;  2OWO A;  3H3V H;  1D1K A;  3PW7 A;  1HJP A;  4ZUJ A;  1YI2 A;  4ECZ A;  5LL6 X;  5FLM H;  1ZKO A;  3NE5 B;  3H0G G;  1RK5 A;  4DL2 A;  4CHT B;  5EBC A;  1A0I A;  3CCS A;  3BAB A;  3NP8 A;  1T36 A;  2UU9 L;  3KF8 B;  1BXT A;  3L2P A;  1M90 C;  3DMU A;  5FOB B;  2HGS A;  3NBH A;  4O3P A;  4U7C A;  4MV8 A;  4MZ9 A;  3QIA A;  3G7L A;  4EGQ A;  1JX4 A;  4YAJ B;  4GKK H;  4JBJ A;  2FPP B;  1QCB D;  1W96 A;  2AHO B;  5CV5 A;  3OW2 A;  5JEA G;  2R82 A;  1NCV A;  3T5K A;  4EBC A;  3H0G H;  3R93 A;  5FLX W;  4G7Z C;  5BPH A;  4NPS A;  1SBB B;  1EY6 A;  3FKI B;  4RB3 C;  3S2D B;  1DYQ A;  2KOL A;  2W70 A;  3I55 A;  2JEG A;  4BY7 B;  3OWE B;  1JDE A;  1ESF A;  3K58 A;  4XT1 B;  5KFW A;  4EYI B;  3FRP B;  3K81 C;  2AUK A;  3UI2 A;  2JA5 G;  3RB4 A;  4LUV A;  3HP3 A;  1J5E L;  2HVS A;  2B2W C;  4EX5 A;  4JI0 Q;  1B2T A;  3HOV G;  2RBM A;  2C9O A;  5JEA H;  1C9O A;  3GTQ A;  4IUQ A;  4P71 A;  2UU9 H;  1VF7 A;  4A3F G;  1JLL B;  3LWU A;  4QGU A;  3SEB A;  4DR3 Q;  1PZI D;  1LTL A;  2G9D A;  2GVB A;  1G8Z D;  3VYT A;  4A3E G;  5KFM A;  4O3R A;  2CH4 A;  4IAJ A;  4N9T A;  1DIK A;  2JA5 H;  3GTP H;  5L1I A;  1JB7 A;  4MTE A;  1I4Q A;  4FS2 A;  4ZQ3 A;  4DV7 H;  3ERQ A;  5E7N A;  3HOV H;  1K0S A;  2RGR A;  3B6Y A;  1PH6 A;  1KAA A;  4K5X A;  4C3I G;  3GV7 B;  4A3F H;  1F9P A;  4PNY A;  1A8V A;  4DA2 A;  1E22 A;  2CHB D;  1BBX C;  4X6A H;  3PQI A;  4A3E H;  1BGW A;  5L1J A;  1STB A;  1VQP A;  2UUC Q;  1L0X B;  2EY2 A;  1J5E H;  2FXQ A;  3NBH B;  3E0J A;  4JI8 H;  5HV6 A;  3J7Y W;  2FHT A;  1CSQ A;  1GUT A;  4ULL A;  2R7N A;  1LM0 A;  4RNN A;  4F4Z A;  3N6X A;  1UE5 A;  2E5L Q;  4KN4 C;  1I6V C;  4C3I H;  1SFO A;  1CS0 A;  1I6H H;  3OTO L;  2PNH A;  5EAY A;  1TS5 A;  4QWB A;  3RNU A;  4PMW A;  4YCW A;  3KYH C;  2F3I A;  5BN3 A;  4K6L A;  1JWU D;  4JI0 L;  2J9G A;  2UVU A;  1JIC A;  3TEH B;  2YZN A;  1SYB A;  1FNV A;  4S3S A;  5C4J H;  5IGC A;  3GP7 A;  2ZXO A;  3PUZ A;  1TVX A;  3LP8 A;  3UFX B;  2KEC A;  2EYJ A;  1A2T A;  1CQV A;  3PO2 G;  3GTQ B;  4DR3 L;  4HED A;  4A93 H;  4I7Z C;  3TS0 A;  4ZK9 B;  4EQO A;  4FF4 A;  3KXY T;  2DWC A;  4QY7 A;  1AUV A;  1O75 A;  2WTF A;  5DGB A;  1W6J A;  2R93 G;  3IKJ A;  3E9H A;  3A55 A;  4ZRZ A;  5FO7 B;  2HCI A;  1VQ6 A;  4YR3 A;  3S1Q B;  3BVM A;  4DR4 Q;  3N41 B;  4HNU A;  1G6P A;  5CGK A;  2NVX H;  1S5C D;  3OTO H;  3URY A;  3PO2 H;  2CZG A;  2PMZ A;  2WE6 A;  2F4V Q;  4JK1 C;  4C5A A;  3ZYY X;  3E6Z X;  2UUC L;  2EJM A;  1TWH B;  1QG7 A;  3KLS X;  3UE0 A;  1I4P A;  3QWN A;  5DLQ E;  2OT2 A;  3V05 A;  3HOW B;  1I4G A;  3U4Z A;  2F03 A;  3A7A B;  4XIG S;  4A3D G;  2F0S A;  2YYA A;  1YEZ A;  2C2D A;  1D5M C;  2IBK A;  2E5L L;  1N56 A;  1CI3 M;  5A35 A;  4DR3 H;  4FXG C;  5F2D A;  2VQD A;  4OWT B;  5CA1 F;  1PH9 A;  4ZKB B;  2YRX A;  4JOI C;  3M3Y H;  3BAA A;  4DV1 Q;  1SFO B;  3JZI A;  1RF2 D;  1DGS A;  2PNR C;  4C1N K;  1EIH A;  1UC9 A;  5EKI A;  1H9S A;  3IFD A;  2IY5 B;  5DG8 A;  1F2M A;  3UDF A;  1SNP A;  2NVY B;  2FJ2 A;  3AFQ A;  4UY8 C;  1C0A A;  4IWY A;  3T5L A;  4A3D H;  3V6K A;  4DK3 C;  5IGD A;  3S16 H;  4HSV A;  4L5S A;  4QWD A;  4DR2 H;  4A2B A;  3J81 E;  4YCV A;  4GKJ H;  3JSL A;  4YWK A;  2UUC H;  2PCF B;  3K5N A;  1EY7 A;  5GRO A;  2W71 A;  4NXN Q;  5CB4 F;  5ELD A;  4JI4 L;  2SNS A;  3JRW A;  4A3I B;  3T4A C;  3CD6 A;  2LS0 1;  2Z8L A;  4XXE A;  2EZV A;  2YL2 A;  3R2I A;  1C7Y A;  2D0P A;  4DL7 A;  5IWA Q;  1V9P A;  5DAU A;  3HGB A;  3A7L A;  4DV4 Q;  5JUM A;  2F4V L;  1XXG A;  4RAZ A;  2FLN A;  3SE7 A;  1XMO Q;  1LTB D;  2PMZ B;  3V4Z A;  4A3B B;  2LFN A;  3PIO A;  1GVP A;  3T5J A;  4FP5 D;  2UUB Q;  1A63 A;  1H9R A;  4F8M A;  3J80 i;  1SSO A;  1TWC H;  1TQO A;  3T13 A;  4C3H B;  4DV1 L;  2CFM A;  1I7L A;  3S14 H;  4XQN A;  1GJX A;  4R4I A;  4ZQI A;  2OXP A;  2KCN A;  2B3G A;  1FJG Q;  1ZET A;  3GTP B;  2SOB A;  4RGN A;  3HB9 A;  1RCV D;  4JI4 H;  1TWF H;  3RV3 A;  3QZ7 A;  1X3F A;  1H9S B;  4EQ5 A;  1KNE A;  2JJQ A;  1DXM A;  1LAB A;  2VZA A;  4BA2 I;  2I80 A;  4IR9 A;  4FXD A;  5CMD A;  2ICI A;  4ID6 A;  4KHP H;  2E2H H;  3BDO A;  1HA6 A;  3ITP A;  2YU9 A;  1XJV A;  4NXN L;  4CDE C;  5BN5 A;  3Q1K A;  5IT9 L;  3Q8D A;  2JA9 A;  5L9X A;  1BCP B;  3HZX A;  1TKW B;  4J0M A;  3V96 A;  2NN6 G;  4B9X A;  1Y1W G;  1JJ2 A;  3OSP A;  5F9N A;  3V4S A;  3EJI A;  2G9H D;  1K0R A;  5T1G A;  5G3L D;  3K8A A;  1R4P B;  5IWA L;  5K2M A;  4DV4 L;  5CV7 A;  3H15 A;  3T1Y L;  1O7Y A;  3I4O A;  1XMO L;  2YTY A;  4J6H A;  1E4E A;  2M05 A;  5JQW A;  4A3J G;  2NUA B;  1D5X C;  4HJ9 A;  4DR7 Q;  5J3B A;  4KJO A;  1U4M A;  3GV3 A;  4WJ4 A;  3HOY B;  2NN6 H;  4B3M Q;  5GQO A;  1AUX A;  1Y1W H;  2NYZ D;  3MXP A;  2EYH A;  3KJP A;  2R8K A;  4A93 B;  4DUZ Q;  1ICF B;  4C2M A;  1AE3 A;  2HIV A;  4NXN H;  1T3N A;  1FJG L;  4A3J H;  2V4D A;  1Y14 B;  4P75 A;  5EPL A;  2O5I C;  1AN8 A;  2KSW A;  3I8Z A;  5M3F B;  3M4I A;  5JVL A;  3NHH A;  4OEL B;  2OTL A;  3ERO A;  2JA6 G;  4A3L G;  4NP5 A;  1B6R A;  2NVX B;  4APV A;  2XD4 A;  3Q22 A;  3K5H A;  2AQ1 B;  2NB0 A;  3S9W A;  5DM6 3;  1KRS A;  5KGU A;  3J80 E;  3T1Y H;  1XMO H;  1V8Q A;  3UQ8 A;  2JEA I;  4BBS G;  2R7D A;  5J2T F;  4AQY Q;  2R93 B;  1M0W A;  4M7E A;  2GLT A;  2K5D A;  2XVS A;  1X3G A;  2JA6 H;  4A3L H;  1STA A;  2K6A A;  1BDO A;  2D62 A;  2XWB B;  5KYI A;  1CQI B;  1GSO A;  4XZ3 B;  2K75 A;  4QW9 A;  2VR1 A;  4BBS H;  1OWT A;  1CKM A;  1PRT B;  1QVF A;  4O4H F;  1HUN A;  2W6Q A;  1E4E B;  5C8Y F;  2BQ3 A;  3T5H A;  3HS0 C;  3R2T A;  4OX9 H;  2ATW A;  4HCS A;  3Q24 A;  3S16 B;  4B3M L;  4IOA A;  2EIF A;  2E2D C;  1HRJ A;  5KFH A;  1FGU A;  3G8C A;  1HNZ H;  1SXT A;  2Q8I B;  1X55 A;  1PMR A;  1EZ8 A;  4PZ6 A;  1MSH A;  3UDI A;  1V1P A;  2KHJ A;  1SAP A;  1GGO A;  3TZD A;  1K73 C;  1H9J A;  1F2Y A;  2XSC A;  3PW2 A;  2Y0S G;  3W2D A;  3S1M H;  4UCT A;  1LT4 D;  1TS2 A;  4BWS C;  2F0N A;  2PQE A;  4QCL A;  3KHL A;  5KFT A;  2VPS A;  1LO5 D;  3HBL A;  1O7L A;  2VW9 A;  1AP0 A;  2IHF A;  3V2T A;  3NSW A;  2RCN A;  4H13 C;  2Z4I A;  3RGX A;  5CAE B;  1OTC A;  4RU9 A;  1UWV A;  1OXT A;  4AQY L;  1E0B A;  1PH5 A;  3RV4 A;  3RUP A;  5C0X J;  2HVR A;  3ULP A;  2F0M A;  1WTP A;  1BNC A;  1HH2 P;  2KVM A;  3GII A;  1VQF A;  1X54 A;  1U5K A;  1T5E A;  2AKW B;  2RGV A;  4JCV E;  3L9A X;  2P5Z X;  4XX0 B;  1I50 H;  4N8F A;  2KJX A;  2R7Z G;  2R86 A;  2E2I A;  4ILW A;  3D4R A;  2PQA A;  1UUP A;  2UXC Q;  3OHA A;  3MWD A;  1VBH A;  5J39 A;  2JP1 A;  1YHB A;  3KTM A;  1RTO A;  2B2V A;  2WB1 G;  1IOW A;  1GOZ A;  1QVC A;  4H44 C;  4KY5 A;  4O0A A;  3SHL A;  2ZJT A;  4MV9 A;  1DD2 A;  4J15 A;  4O4L F;  2MFI A;  3CPF A;  3DM3 A;  3EBE A;  4OL7 A;  4UDU C;  3K5I A;  1TII D;  1RJR A;  1YNJ D;  2R7Z H;  5IYZ F;  4ODG A;  3UDX A;  3CW2 C;  3NXW A;  4IJL A;  1MBY A;  1I94 L;  4M8A A;  4POF A;  3CHB D;  3MC0 B;  3UDG A;  1F77 A;  4LAA A;  1BCP D;  4TV9 F;  1ZEQ X;  2R8I A;  1V1P B;  3M9M B;  1E3P A;  5ELB A;  4IUN A;  2WAQ A;  2VQF Q;  3CC2 A;  4CC6 A;  3KLW A;  4POG A;  2L9H A;  2D9U A;  1L1O B;  2EY6 A;  4A3C G;  4DL4 A;  3TP7 A;  2MGS A;  4YCU A;  1U4L A;  3I73 A;  5CV8 A;  3MWM A;  4IFD G;  3SK5 A;  1HUM A;  5GAD C;  3KHH A;  1PYB A;  2K5V A;  2R92 G;  3Q8R B;  4X65 Q;  1F9Q A;  1N32 H;  3NWT A;  3K0X A;  1HR0 Q;  5EWG A;  3QJY A;  4EFB A;  4JBW A;  2R7F A;  1A3V A;  5IYC G;  3UE1 A;  1S5E D;  2F3W A;  4RGM A;  4JC0 A;  4BXX G;  3VR4 A;  5C6A A;  4OO1 G;  3U9O A;  2PI2 A;  3D8G A;  2E2J B;  1LTR D;  4HN7 A;  1R9T H;  4A3C H;  2EJG C;  1AZQ A;  1HXY D;  4IFD H;  3KBX A;  3MA2 B;  1B3Q A;  2K4K A;  4FXK C;  4X3K A;  2UXC L;  4LFA Q;  2R92 H;  1I94 H;  4Q8E A;  3K7A H;  4X64 Q;  3S2H B;  1KBL A;  2E2I B;  4ZOL F;  3AU7 A;  2EYM A;  1BCP C;  1CHQ D;  1VMP A;  4A3J B;  4KY7 A;  2PQA B;  4EYH B;  5IYC H;  1HNX Q;  3TQ1 A;  1IBL H;  3GTL A;  1DV2 A;  5C4X G;  4YP3 A;  3LX0 A;  3EQL C;  5D3I B;  4BXX H;  1OO9 B;  1PFS A;  4OO1 H;  1YZ6 A;  2NU9 B;  2DUD A;  1EOT A;  3I4L A;  3NEN A;  1EY5 A;  1NE3 A;  3JRX A;  2A19 A;  1B1Z A;  3J7A F;  1FVI A;  3PGZ A;  4ABN A;  1XNQ Q;  4KV6 A;  3H91 A;  1HNW Q;  4FO2 A;  4JI1 H;  3KLR A;  3GLK A;  2NWG A;  1SMX A;  2KQ3 A;  2VQF L;  5C4X H;  3GTG H;  3T1H Q;  2K7V A;  1JWM D;  2WAQ B;  3BDL A;  1V1Q A;  3LWE A;  1B4O A;  2TSS A;  4IUR A;  2DPI A;  4DFA A;  1PH7 A;  1CA6 A;  2L55 A;  2CVR A;  1BJT A;  1HR0 L;  1PRT D;  3F2D A;  3I4M B;  2O4X A;  4O3O A;  1LAC A;  1S9F A;  3FKI G;  5KKN B;  4ALP A;  2BE5 C;  5TSS A;  3TBI B;  2YV5 A;  4O4I F;  5FLX E;  2R85 A;  3C1E A;  1PFB A;  4NXM H;  3E9I A;  5FK9 C;  5JAV A;  4QQB X;  2RKS A;  1M6V A;  1PDQ A;  5C3X A;  3U9T A;  4GC6 A;  3E3X A;  1VQA A;  4A2A A;  1KDC A;  4A75 A;  5DQG A;  1S5D D;  4KMU C;  3RMH A;  3TP6 A;  4LFA L;  4UPA A;  3RN5 A;  2OLS A;  4B3R Q;  1W93 A;  1HNX L;  3S1M B;  2RHS B;  3FKI H;  5LYJ F;  4KTA A;  4EG0 A;  2IL8 A;  4UCR A;  3GTL B;  1N36 H;  1UNN C;  2BOS A;  1PFM A;  5JEA J;  2PBZ A;  4HR7 A;  4IZO A;  4YBZ B;  1RYS A;  2CWA A;  1WD0 A;  4R9W A;  1CKO A;  1T9H A;  2VUM G;  1B50 A;  2W9A A;  1QUQ A;  3S15 B;  2F0P A;  1XNQ L;  1PRT C;  1QJO A;  3SR1 A;  1HNW L;  3GQC A;  2V9W A;  3M9B A;  1Z2N X;  3BYT B;  4UFZ A;  1GSH A;  1VS0 A;  5EWE A;  3T1H L;  1UAP A;  1I50 B;  1SJE D;  1E2V A;  2DGY A;  3FVQ A;  4DV0 H;  5EBD A;  2LY7 A;  3W5O A;  4LF4 H;  4JV1 A;  5DG7 A;  3OSO A;  2VUM H;  3BA9 A;  2N3S A;  4FDB A;  4OHJ A;  3MWY W;  3OUU A;  1SNQ A;  1HNX H;  2EXD A;  1PX2 A;  1Z9F A;  4RHS A;  2FLP A;  4DK0 A;  3RLF A;  2ICE C;  3A5Z B;  1Y69 U;  5FO9 B;  4ED2 A;  1MKH A;  2L11 A;  1PLF A;  1B33 N;  3LGJ A;  3H09 A;  1HZA A;  4C56 C;  2EQS A;  4N9P A;  2IX0 A;  2R7Z B;  2ZXP A;  3J80 c;  2AU0 A;  4GKK Q;  3N6R A;  1WFQ A;  4B3R L;  4FU0 A;  1I7N A;  3L4K A;  1ZHS A;  1KJ9 A;  1KJ8 A;  2PI2 E;  1PK8 A;  4DL3 A;  2W7P A;  2C2R A;  3GID A;  4Y52 H;  2B2Y A;  4IUP A;  4ZI7 F;  1SYC A;  2BA0 A;  3S1R B;  4HR7 B;  1G91 A;  1M1K C;  1VQN A;  1Y8N B;  1QUQ B;  1EY4 A;  1KTK A;  3TRZ A;  1WCM A;  3GTQ H;  3K5L A;  4IAL A;  2VOB A;  2ZDH A;  3I90 A;  1EY9 A;  3OHB A;  5IGE A;  5KG7 A;  3EPI A;  3HOW G;  4L8J A;  3TIG A;  3OIQ A;  3AFP A;  4DXF A;  4QW8 A;  1EQR A;  3A8K E;  4O3Q A;  5C5J A;  3STB C;  4CGY B;  3K7U C;  2EE1 A;  3S1Q H;  2IP4 A;  4F88 A;  4DV7 Q;  4ZYS A;  4LFB H;  3IRB A;  4KY6 A;  2ZJP A;  1L1O C;  4OIJ A;  1ZHQ A;  4DF7 A;  4C3J G;  2DY8 A;  5KFL A;  2K05 A;  4CJ0 B;  2FLL A;  5DQH A;  2YZM A;  3QOL A;  5G3L F;  3HOW H;  4B3T H;  2CW0 D;  1TT2 A;  1S40 A;  1J5E Q;  4GKK L;  2I87 A;  1P8L A;  4EBE A;  4JI8 Q;  4UCU A;  4QMG A;  1YHA A;  2R93 H;  1ML0 D;  3GV8 B;  4X3S A;  4GS3 A;  5LMN Q;  2R7K A;  2R8J A;  3L0O A;  1O7I A;  4H0L C;  1RJP A;  1EFI D;  4I65 A;  2WKC A;  4C3J H;  2V1C C;  4J8Q A;  5JPM C;  2JA7 A;  1SFO H;  1JJG A;  1YHQ A;  4GOP A;  4LW1 A;  1S0O A;  1ONL A;  2WIN B;  1TU2 B;  3CC7 A;  1Y1V A;  2NVY H;  4HMI A;  3L3O C;  3ONA B;  1QNK A;  4CBV A;  4A3I G;  5IP9 G;  2A8V A;  5M5X B;  1SYG A;  4IHJ F;  1KLU D;  1RIP A;  2B2V C;  1PV4 A;  2TMP A;  1K8O A;  2BQR A;  1FKA H;  5EGT A;  1MD2 D;  5KFO A;  3NQI A;  3Q2O A;  3P75 A;  4P2C B;  2VS1 A;  5KFS A;  3KUP A;  4TQU S;  5FO8 B;  1WCM B;  4CDD C;  2SCU B;  4YR2 A;  4ED8 A;  4A3B G;  5M5Y H;  1X65 A;  3J80 L;  4HYK A;  2F0G A;  1EUJ A;  2IMW P;  3N8D A;  2OH2 A;  2H1E A;  5IY0 A;  4H02 A;  4DV7 L;  1K8M A;  5IP9 H;  4A3I H;  3GTJ A;  4PDB A;  1HTL D;  3F2U A;  2ZT9 C;  2EY5 A;  2EYF A;  4DAM A;  4HNT A;  2EY1 A;  1WOC A;  2K5N A;  4C3H G;  5LA6 F;  3OTO Q;  5I9P A;  4J9Q A;  3HKZ A;  3BVG A;  1FL0 A;  4MA5 A;  4A3B H;  4NLG A;  1A3U A;  4JI8 L;  2MNA A;  1SYX B;  2WII B;  3Q0A A;  3S17 B;  1YJN A;  4ETS A;  4OON A;  5D65 A;  3BJU A;  2BH8 A;  4XTC S;  5JVH 3;  5I6Y A;  3GIL A;  2B63 A;  3PW5 A;  2ASJ A;  5LMN L;  1SE3 A;  2FFK B;  3HRZ C;  4C3H H;  2NTS A;  3A74 A;  1QZH A;  1QVG A;  4I50 F;  1EOV A;  3DWQ A;  5IGB A;  4K0K Q;  4GN3 B;  3GIJ A;  1SRU A;  5E1F A;  4FF3 A;  3DXJ C;  2VUM B;  2JA7 B;  4QIW E;  1PTO B;  2R6F A;  4GN5 A;  3NPP A;  5LOV F;  5KFD A;  3K57 A;  1CUK A;  5BR8 H;  4ED0 A;  3ND9 A;  4WJ3 M;  1X3E A;  1Y1V B;  3Q6S A;  5KEE A;  4DR2 Q;  5C1P A;  3MXG A;  2CW7 A;  1KIX A;  4GKJ Q;  1RK6 A;  5IT9 W;  3QG1 A;  4LF5 L;  4F4X A;  2K04 A;  4TSS A;  1ULZ A;  2XIW A;  1Z6H A;  1STH A;  4C1N I;  4QUC A;  3HOY G;  1CFM A;  3QR8 A;  5LMN H;  3J81 i;  4Y8V B;  1CSP A;  4A93 G;  1VQE A;  4DUY Q;  5HBR B;  2AQ4 A;  5EKL A;  2B2T C;  2OEO A;  1SLJ A;  2DN8 A;  2AWO A;  5M3F G;  3T16 A;  4A3G B;  2K01 A;  2KA7 A;  3PF5 A;  4DU9 A;  1Q46 A;  2ES2 A;  2IJ0 A;  3OHX C;  3HOY H;  1AN7 A;  3VPB A;  2WFW A;  4YWM A;  2FK2 A;  3KAJ A;  5LL6 S;  4YY3 L;  3RTX A;  4ECV A;  1S68 A;  2B63 B;  4K0K L;  4LF5 H;  4NDX A;  2ZTD A;  4Q0Y A;  5CBE E;  5L1L A;  5IYD G;  1YNX A;  5M5W B;  5CV4 A;  2ALY B;  3BVZ A;  5M3F H;  3M4O B;  1I5F A;  1ZXT A;  2QEX A;  4JI4 Q;  3TII A;  3WNZ A;  3H4B A;  2QA4 A;  1BCP F;  2R6G A;  3FDT A;  4FS1 A;  4IN3 A;  4DR2 L;  1QOH A;  3F2C A;  2BA1 A;  4Q8F A;  2SNM A;  3HEJ A;  1IL2 A;  4GKJ L;  3RGZ A;  2JA8 B;  1F9S A;  4KHP Q;  1S97 A;  3K80 C;  1SNO A;  3JAM E;  3VR6 A;  2VA2 A;  1G29 1;  2HHH H;  5CYU A;  1U0L A;  5IYD H;  4U68 A;  4IZ8 A;  4DN4 M;  3C1F A;  3I72 A;  1CM9 A;  1V51 A;  2X6G A;  2R84 A;  3PZP A;  3NEL A;  4YY3 H;  4EGJ A;  4DUY L;  1K8A C;  3W1B A;  4C3J B;  1UNS A;  1WTH A;  4K0K H;  2EVB A;  4LF8 L;  2QGQ A;  3MVV A;  4LFC L;  3T51 B;  4CKB A;  2K50 A;  1SNM A;  2OF1 A;  3K6O A;  3WWV A;  4E6I A;  4B3S Q;  3RN2 A;  2PZT A;  1LT6 D;  1PH4 A;  4K6D A;  4G7O C;  2R8G A;  3TME A;  4GC7 A;  3RB3 A;  4JV5 Q;  3QFF A;  1EYA A;  2ASD A;  4ED7 A;  3MR2 A;  4JBM A;  2K5W A;  4RUA A;  3IN5 A;  3HKZ E;  4NB3 A;  2DIK A;  4DV6 Q;  5M5Y B;  1GO3 E;  4C2M H;  3SDZ A;  4MV1 A;  4IQZ A;  3PF4 A;  4G7H C;  4XYO A;  3RBD A;  2Q8R E;  1WR2 A;  1SE8 A;  4DUY H;  1UEA B;  2GVA A;  2YTV A;  1VCI A;  4LF8 H;  3T1Y Q;  4DR5 H;  4KHP L;  1XYI A;  4P73 A;  1IBM H;  4LFC H;  4RZR A;  4BY1 B;  5LMU H;  4K2K A;  4IO9 A;  1ILP A;  2I5H A;  4QWC A;  3GTK A;  2B2Y C;  2Z9H A;  1DCZ A;  1J8I A;  5JVD F;  1PRT F;  5C3E B;  5CR3 A;  5EWF A;  4RA8 A;  3BZD B;  1ILQ A;  2WAC A;  1U9R A;  1WD1 A;  4J9M A;  1PTO D;  4KKS A;  4RKB A;  5COY A;  3X3M A;  1E4F T;  4OWW B;  1EQT A;  2QF7 A;  4B3S L;  1K8G A;  3RB0 A;  1E7Z A;  4OX9 Q;  4XYL B;  1F2Z A;  2KHS A;  4JV5 L;  2UVV A;  1LT3 D;  2JXM B;  4FYD A;  2C28 A;  3TZU A;  1SJH D;  2QYZ A;  1HNZ Q;  2NTT A;  1SYF A;  4HIK A;  1O78 A;  1UE7 A;  1EWC A;  2RA4 A;  4DV6 L;  4LSX A;  2DNC A;  5DG9 A;  4PMB A;  2W9C A;  1G2S A;  1K3B C;  1EU4 A;  4UHV A;  3J7A 5;  4N8X 1;  2XNA C;  1LYL A;  1MZB A;  4IUV A;  2RCF A;  4YJ3 F;  2DNE A;  4RB0 A;  3HFZ B;  2GPW A;  4RCO A;  4DXG A;  4JYA H;  2HUG A;  5KFV A;  5BN4 A;  1PTO C;  3PUY A;  2R8H A;  4B3S H;  4LJZ C;  5C4Z A;  4LF9 Q;  1KHI A;  4QF4 A;  3MR3 A;  3H4D A;  1Z2O X;  3V6H A;  3K5O A;  4DNI A;  3K0Y A;  3MFG A;  2L4N A;  4FF1 A;  3CCL A;  1MJC A;  4JI7 H;  1U4R A;  2E2J H;  2DLN A;  4JV5 H;  2RDJ A;  4XYQ A;  2A6E D;  1JQY D;  3G6E A;  1VQI A;  1I4X A;  3TN2 A;  3TRE A;  3ETJ A;  1RTN A;  2CW8 A;  4DV6 H;  3S2H H;  5HUR A;  2E2I H;  4YHH Q;  3VMM A;  1YJ9 A;  2UVR A;  3J7A K;  2EYL A;  2EDG A;  5A2Q E;  2FKL A;  2JSO A;  3IFT A;  4RAU C;  4K14 A;  4OX9 L;  2IWH A;  3TSS A;  1NTG A;  2WAQ G;  1X3P A;  3SE0 A;  3WO1 A;  3GTO A;  5CA0 F;  5L37 A;  2K28 A;  3EA6 A;  2PO4 A;  4LSA A;  4PG3 A;  4FNF A;  1HNZ L;  1SEI A;  4Q45 A;  2K03 A;  1AH9 A;  2F0W A;  3PIP 3;  4JG2 A;  1K28 A;  3I4M G;  4C5B A;  4OGQ C;  2F4I A;  2NU6 B;  4HJ7 A;  2EYP A;  1UE6 A;  1QE6 A;  1N48 A;  2C2E A;  1O80 A;  3D4W A;  3WOE A;  2YU9 B;  5KG3 A;  1U4P A;  2I0Q A;  3OWF A;  3OYY A;  2QW7 A;  2XWJ B;  2LKV A;  3HOX B;  2CQY A;  2W9B A;  2A6E C;  3KOJ A;  3JAM W;  1HR0 W;  2W9C B;  1WTX A;  3CME A;  2K32 A;  1N32 Q;  3W1G A;  4DAP A;  3I4M H;  4APM A;  1N33 H;  4LF9 L;  1DOK A;  1S4Z A;  4HMJ A;  2B29 A;  2JEJ A;  3EFX D;  1FGB D;  5C0X I;  2AQ3 B;  5JJK A;  1EY8 A;  4LF6 L;  3ND8 A;  4EEQ A;  4MV4 A;  2J4X A;  5D1P A;  3OIP A;  4DNR B;  4BBR H;  1I94 Q;  4GLV B;  4YHH L;  4YJ2 F;  1HFN A;  3KFU A;  1ZQ7 A;  4C2M B;  2W6M A;  3U9S A;  5I6W A;  2JYO A;  1IBL Q;  4G4K A;  2Z0S A;  1Q81 C;  2XGT A;  3BYY B;  1D6E C;  1Q3L A;  2IW3 A;  2B8F A;  4GLA C;  4JW0 A;  5EPK A;  3GTL H;  5LXT F;  4J9N A;  5DLF A;  2F0K A;  1EYD A;  1GD7 A;  1EIY B;  2PZW A;  2C00 A;  3GD7 A;  2I5M X;  4MV3 A;  5IGG A;  3VA5 A;  2OQ0 A;  1HFG A;  5LHY 1;  3S15 H;  2PPB C;  4IPC A;  2VB3 X;  3GTO B;  2UUA Q;  1JOQ A;  1PH1 A;  3VR2 A;  4LF9 H;  2YCH A;  4JI1 Q;  4ECU A;  2WP8 J;  2MPM A;  2Q2T A;  3SXH A;  4LF6 H;  2A5H A;  4L6T B;  1WH2 A;  2HVQ A;  4RH6 A;  3GV6 A;  2RDI A;  2O5J C;  1X3Q A;  3D0F A;  3KJO A;  1TS3 A;  1LV9 A;  2YZG A;  4YHH H;  2QDB A;  2AGQ A;  1K9M C;  1N32 L;  2XIG A;  2I5L X;  3PMF A;  3QB3 A;  2MQH A;  4EQN A;  1JCK B;  2VL6 A;  1RL2 A;  5IE8 A;  2N55 A;  1N8R C;  5BMV F;  4BWG B;  2XRQ D;  3GDE A;  4YAK B;  4FBT A;  4NXM Q;  3RFC A;  3BZK A;  3CQZ A;  3J81 j;  4TUY F;  1NNX A;  4ECY A;  1A15 A;  3R3O A;  1VQ8 A;  1JB3 A;  1QZG A;  4O42 A;  1WTO A;  5GAH C;  2LXJ A;  3N43 B;  4Y7N B;  4HID A;  2L1B A;  4LK1 C;  4R8N A;  1Z47 A;  4QL5 A;  1IBL L;  3NK9 A;  4KK7 A;  1SMY D;  4A3M B;  1N36 Q;  4JV0 A;  5M3M B;  2SDF A;  4E4T A;  2PW5 A;  3VYR A;  4IPH A;  3S1R H;  5KG0 A;  2KHI A;  2UUA L;  3NEM A;  3HOZ B;  4J9O A;  3MEH A;  5COR A;  4DV3 Q;  2V4R A;  4CJ1 B;  2R61 A;  3R5X A;  4JI1 L;  2ZDQ A;  4TVA B;  1AZP A;  1MGS A;  4RNO A;  1SYE A;  2UVW A;  3H3V I;  3K5M A;  2VUG A;  1N9W A;  3K3V A;  4JUZ A;  1YNJ C;  2KCM A;  1FR3 A;  1Q12 A;  3SI8 A;  4DK1 A;  3J81 c;  2KUM A;  2NU7 B;  4DV0 Q;  2RDF A;  5IOC A;  1YNN D;  5HY6 A;  2IHE A;  3BS1 A;  4LF4 Q;  3X3N A;  5KFJ A;  3I91 A;  1OXU A;  4HJ5 A;  4H7B A;  4A3K G;  1B44 D;  4C5C A;  3MFI A;  1RJT A;  3FMC A;  4DR6 Q;  2F52 A;  4UAI A;  1EEF D;  2F0H A;  5AJ3 Q;  4A76 A;  5KFG A;  1GYF A;  3MXU A;  1ENF A;  3P1H A;  5NUC A;  4NXM L;  2V5A A;  1K83 A;  2Z6K A;  3D31 A;  4KI0 A;  4EFE A;  3CRL C;  4MNO A;  2F0Q A;  4NW2 A;  3TDQ A;  2UUA H;  5A2Q W;  3CQZ B;  3I7F A;  2RQX A;  4AIM A;  4ME5 A;  5ISR A;  1IYV A;  5KFA A;  4A3K H;  4RB1 A;  1VF5 C;  4X62 Q;  2QCP X;  2XRS D;  3E5N A;  4IRD A;  4EVO A;  4WBN F;  1BBU A;  3FDS A;  1VQ5 A;  1JE5 A;  1L2Z A;  4EGV A;  1N36 L;  1WCM G;  2L5T A;  1ENA A;  3RUZ A;  2B2U A;  1B70 B;  1GUW A;  2NVQ B;  1X56 A;  3EN2 A;  1M8A A;  3KHR A;  2I07 B;  2J6U A;  3SK8 A;  3Q8Q B;  4CDC C;  4DV3 L;  5L1K A;  4ZKC B;  5M5X H;  3PO3 B;  3FPP A;  3CCU A;  1TWG A;  4IUU A;  1H95 A;  2KEE A;  1EHI A;  1WCM H;  3GO5 A;  3E0E A;  4KKU A;  5IP7 G;  4I7H A;  1I4H A;  1Q8K A;  4DV0 L;  1SRO A;  1DV1 A;  1Q86 C;  2MO0 A;  2FPG B;  5KFE A;  4LF4 L;  3TP5 A;  4BBR B;  4R4C A;  1B04 A;  5E3F A;  2IT1 A;  2R7M A;  2UXB H;  2MP1 A;  4DR1 H;  1STG A;  4DR6 L;  3D6W A;  4LFB Q;  1TS4 A;  5AJ3 L;  3U50 C;  4YIJ A;  2NZ1 D;  3VYS A;  5AFW A;  1WSC A;  5IP7 H;  3I12 A;  1G6Z A;  2JA7 G;  3R5F A;  3RB6 A;  2HQE A;  4B3T Q;  4DV3 H;  4WOR A;  3RF2 A;  1K83 B;  2F1M A;  3S17 H;  1N34 Q;  3K3P A;  2IX3 A;  1P16 A;  1BOS A;  3T56 B;  1S03 G;  4X62 L;  1Y1V G;  1ICW A;  1EIF A;  1AFP A;  2HJW A;  1J6Q A;  3CCV A;  2WV6 D;  1BKB A;  1PH8 A;  4PZ7 A;  2ZTE A;  2VB2 X;  4LMQ D;  4O2D A;  1M0T A;  2LMC B;  1XPR A;  2X69 A;  4DK6 C;  3J81 L;  3K59 A;  2JA7 H;  1PTO H;  1GUN A;  5IT9 E;  2HCC A;  2AGP A;  1JWS D;  4OIK A;  4HNV A;  5I9O A;  4RG1 A;  2DJF C;  1PFN A;  4DR6 H;  3H6M A;  3DM1 A;  3A5U A;  1Y1V H;  4DKA C;  4FF2 A;  4DPG A;  1KD1 C;  3KHG A;  1SYD A;  3PVX A;  4LH7 A;  4JOI A;  1XWE A;  3AQQ A;  2ZJR A;  4JI5 H;  4A3G G;  4QIW A;  3HKZ G;  4RCN A;  4ME6 A;  2F0E A;  4QWA A;  4X62 H;  1SEB D;  1PA6 A;  1C3O A;  1EU3 A;  3AYH B;  1S10 A;  2D2C C;  1D1I A;  3BU2 A;  1EY0 A;  4LFB L;  5EZY F;  1LTA D;  3GTJ H;  2BDN A;  2B63 G;  1SDF A;  4BS9 A;  4R4O A;  1GLV A;  5KIX A;  5DNF A;  2KCT A;  3FMA A;  4B3T L;  4A3G H;  1RD9 D;  1ET6 A;  1EZ1 A;  2A6H D;  3LML A;  1O7Z A;  4DV5 H;  1W3S A;  1N34 L;  3NBI A;  1PTO F;  4YWL A;  4KN7 C;  1HZB A;  3A0J A;  5KFY A;  1GHJ A;  1Z2P X;  4LF7 Q;  2JA8 G;  3RZO B;  4DV2 L;  4GNX A;  2B63 H;  4MAM A;  5EDW A;  4J9L A;  1IBK L;  3MJF A;  2ATL A;  1STN A;  5M5W H;  5FD6 A;  2DZD A;  1KEE A;  3GV5 B;  1T94 A;  3M4O H;  1IYJ B;  1G2T A;  1CZW A;  4L5Q A;  1Q82 C;  4BA1 I;  5J2U F;  1JDB B;  3KF8 A;  5KND A;  3CXC A;  5BR8 Q;  4R4Q A;  2AGO A;  1SE2 A;  3M9O B;  2VQE H;  3G6J B;  3M4Y A;  3MEF A;  4WFN 3;  2CQA A;  1VQJ A;  3HOU B;  2NBF A;  2JA8 H;  4ED6 A;  5ELE A;  3RLN A;  5C3W A;  1MIU A;  3PCO B;  3G4S A;  1K1Q A;  2I8C A;  2L15 A;  3DEO A;  3TQT A;  1E24 A;  5KFK A;  1VAJ A;  3PIP A;  1N34 H;  2F3V A;  2A6H C;  4KD3 A;  4LH6 A;  4PQX A;  1IW7 D;  2KCC A;  4R1J A;  1TWA A;  1JJC B;  4A3K B;  2ZDG A;  3N44 B;  2W6P A;  5KFF A;  4QIW B;  3MWE A;  1DZ1 A;  1XMQ L;  5C1O A;  4PMC A;  1XNR L;  4DV2 H;  1EQQ A;  1VQC A;  1VQK A;  1IBK H;  4UP9 A;  1S3O A;  4MIU A;  2C22 A;  4FBU A;  2C35 B;  4U6P A;  2N49 A;  3CCQ A;  2E75 C;  3L4J A;  1ESR A;  3GQB A;  2K33 A;  4RKL A;  1MI2 A;  2IPK D;  5JH7 F;  3IAY A;  4LF7 L;  4GLX A;  1MJE A;  4BY1 G;  1PZJ D;  4DAY A;  4LF5 Q;  5KT7 A;  2CW0 C;  1PH3 A;  3NWS A;  4K5W A;  3PV0 A;  4GNX B;  2K5Q A;  5KFX A;  1IW7 C;  2WB1 E;  2EOT A;  4DAV A;  5EPJ A;  3ZJY C;  5BR8 L;  2BR0 A;  5EQ0 A;  5C3E G;  1E2W A;  1RKN A;  4JI3 H;  4V0B A;  1E2Z A;  4WRD A;  3M85 A;  2JK8 A;  5GAG C;  3CCE A;  3QZ8 A;  3OPO A;  1XMQ H;  1XNR H;  3AEV A;  2Q2I A;  5CBA E;  2IX1 A;  1HQR D;  2K14 A;  1I6U A;  3GIM A;  4MTN A;  4DGZ A;  1E4G T;  1VQ4 A;  4BY1 H;  4KHZ A;  3FPU B;  2PZU A;  2FIN B;  2HHH Q;  2XC9 A;  2ZM6 L;  4LMY A;  2RSO A;  1OXV A;  1D7Q A;  2HDL A;  1ASY A;  2Q2H A;  2C5C A;  5C3E H;  4MV6 A;  1M4V A;  4LF7 H;  1TWA B;  2ENB A;  3S24 A;  4YY3 Q;  3JAM i;  1CQJ B;  1I3Q A;  1S5B D;  4AYB A;  1GHK A;  3I2Z A;  2KEN A;  2N8N A;  1CTM A;  3CCR A;  1KC8 C;  5M9O A;  2NN6 I;  4GOP B;  4F4Y A;  4X66 Q;  1RDP D;  1UC8 A;  2D5D A;  1B6S A;  2XTI A;  1STY A;  1W2B A;  2N78 A;  1EUC B;  3F8N A;  1IKM A;  1WVL A;  1TY2 A;  5KYL A;  5D1O A;  5KT3 A;  4K8I A;  5EJW A;  4WD3 A;  2MCT A;  2NZO A;  5E4W C;  3S1N B;  4ECS A;  3MR6 A;  4PWQ A;  2ZM6 H;  3KK7 A;  1K1S A;  2I46 A;  2Z6K C;  3F1Z A;  4DLK A;  4UCS A;  3M9N B;  1HTP A;  4DAY B;  3AB9 A;  1BUV T;  4LWC A;  1R4Q B;  4RNM A;  3A8I E;  3ETH A;  2AWN A;  3CPW A;  1JC7 A;  2HD3 A;  4O1N A;  4F7X A;  5C44 B;  3GTJ B;  2VY3 A;  4RAY A;  1IL8 A;  4LF8 Q;  1TWH A;  2A73 B;  2L12 A;  3SK6 A;  1BVS A;  4DR5 Q;  1DON A;  3PN1 A;  1IBM Q;  4RGO S;  4LFC Q;  2PN1 A;  2B2U C;  2HHH L;  1RYR A;  5LMU Q;  3GTM A;  5K36 G;  4FM9 A;  3HKZ B;  2XCP A;  3J7Z C;  1CZG A;  3ORQ A;  4JBK A;  2F0V A;  4O3S A;  5KG5 A;  1JKJ B;  3RZD B;  3GTK H;  5FLX c;  2F0D A;  2Z4H A;  3PUW A;  3SK4 A;  3F2B A;  1DOM A;  1ENC A;  5KG2 A;  4KJN A;  5KFC A;  3GIQ A;  4R4T A;  3ORR A;  1XTC D;  3EIV A;  2NVY A;  4ECX A;  1I3Q B;  4B08 A;  5FJ8 G;  4MHE A;  5K36 H;  4AYB B;  1V4Y A;  4X66 L;  1JE4 A;  3LNN A;  3HOX G;  1KXL A;  5T14 A;  4NKL A;  3D6C A;  1FNW A;  2FMC A;  4CKC A;  4PZ8 A;  2FPI B;  4B9W A;  5J22 A;  1JT8 A;  4NMZ A;  4Q0F A;  1KNA A;  5KG6 A;  2BQU A;  2MHV A;  1F9R A;  3VR3 A;  2FK1 A;  5D1O B;  2X6L A;  2K52 A;  4HCE A;  4ECR A;  3RR5 A;  3H0G A;  5FJ8 H;  2YU9 H;  3PSI A;  4AH6 A;  3HOX H;  1H9K A;  1A3T A;  1FNU A;  5F9L A;  2CWP A;  1Q7Y C;  1VQO A;  3I3C A;  1KJQ A;  2RF4 A;  1NMF A;  1GUG A;  1LTT D;  4OXP A;  4DR5 L;  4EBD A;  3CMA A;  3MFY A;  3F8T A;  2ZJQ A;  1IBM L;  4JYA Q;  3Q8P B;  4J9R A;  5LMU L;  4X66 H;  3I4N G;  2E76 C;  5IT9 c;  4JI0 H;  1YVC A;  1W6K A;  4IRC A;  1L0Y B;  2A68 D;  3H20 A;  4JI7 Q;  3GTM B;  5KRU A;  1CHP D;  2O03 A;  3G6Y A;  1I4R A;  5DM7 3;  4QJF A;  1UEB A;  3ICE A;  1MSG A;  1PHJ A;  2E74 C;  2JA5 A;  3GTP A;  2J6T A;  1HZC A;  4TV8 F;  2XN9 C;  2YRW A;  3CP0 A;  4ME3 A;  4Q44 A;  3VPD A;  5H80 A;  3J7A V;  4IRK A;  3I4N H;  2F0O A;  5E4X A;  2OCE A;  4M1U B;  4JV2 A;  5C4H A;  3WOF A;  4LUZ A;  2L0C A;  4CJ2 C;  1RHP A;  1MHW C;  4DL5 A;  1RJQ A;  1PH2 A;  3GTO H;  1JOR A;  2XCL A;  2NZH A;  4AYB E;  2BCO A;  3LWB A;  4RGT A;  5GON F;  1KJJ A;  5C5L A;  1C30 A;  4Z9C B;  1EUD B;  3I70 A;  2A68 C;  2H5X A;  2CCZ A;  3ER0 A;  5KFZ A;  3H0G B;  2E5L H;  4DR4 L;  3VPC A;  3O13 A;  1VQD A;  2W6N A;  4ZCK A;  3JC6 6;  5FLX L;  4ZAI A;  1LUZ A;  3RJ0 A;  1VQ7 A;  1GUO A;  3NTI A;  2EYO A;  4MTK A;  4GNX C;  4JYA L;  1JXL A;  2FJZ A;  1A2U A;  3TP8 A;  1IKL A;  5CC4 A;  1N33 Q;  4MN3 A;  3RLO A;  4A3M G;  4JI7 L;  1AW7 A;  5M3M G;  1BR9 A;  3FP9 A;  4K8J A;  4IFD I;  1A9X A;  2DPJ A;  2YS7 A;  1VQL A;  5DLG A;  3HOZ G;  1GM5 A;  4RMF A;  5CV9 A;  4Y7N H;  4KHV A;  3BZC A;  4J9K A;  2Q8T A;  1PYW D;  1B9M A;  3P20 A;  4OO1 I;  2JA5 B;  2RVL A;  5C5M A;  2NVX A;  1YJW A;  4DR4 H;  4A3M H;  3HOV B;  3GIP A;  5BPF A;  5KT2 A;  5M3M H;  1KL9 A;  1VMC A;  5ELN A;  1BF4 A;  4RFB A;  3DLL A;  1KDB A;  1QNU A;  4A3F B;  4DL6 A;  5KNB A;  2F4V H;  2R93 A;  3HOZ H;  3PR5 B;  3U4V A;  1NR2 A;  3MHB A;  2G5D A;  1EIG A;  1JOO A;  4A3E B;  4GOP C;  3KDF A;  3CCM A;  3BQ2 A;  3MAQ A;  4IFD J;  5EKK A;  5KG4 A;  5JOB A;  4ED3 A;  1NAP A;  4XQQ A;  4R8U A;  4LF6 Q;  3PW4 A;  4IJH A;  3NTH A;  1WI5 A;  1XX8 A;  3C2P A;  3GTK B;  2HQL A;  4RHR A;  4C3I B;  2K1B A;  2F0U A;  1EWH A;  4DV1 H;  1CT1 D;  4R8I A;  3Q8S B;  1I6H B;  2NVT H;  4HIM A;  4G3I A;  1J9O A;  1NY4 A;  3CRK C;  1WYD A;  5EOY A;  3KF6 A;  1N33 L;  4UCV A;  2R3Z A;  4LUO A;  3MFH A;  3M7G A;  3EPG A;  4IR1 A;  2UUB L;  1XPO A;  2IA6 A;  1GUS A;  1D2B A;  5C4J B;  4HIO A;  3M7N A;  2KED A;  3H94 A;  3D4D A;  1QWY A;  2J0T D;  2PMZ E;  3CQZ H;  4QB4 A;  2PVP A;  5JJZ A;  3OMC A;  4L5R C;  3PO3 G;  1JIH A;  1NSN S;  4RB2 C;  1IOV A;  3V6J A;  1X9N A;  1Q1E A;  1YIJ A;  2RDH A;  1ZYR D;  1NMG A;  1AEX A;  5IWA H;  2NVQ H;  1BBW A;  3H40 A;  2JEF A;  4BBR G;  1L0W A;  4DV4 H;  1S0N A;  1VDZ A;  3PO2 B;  2V58 A;  4MA0 A;  3BJY A;  2VXW A;  4JVZ A;  2WYO A;  4TKO B;  3PO3 H;  2XGQ A;  1VQM A;  2UUB H;  4RUC A;  1WTV A;  1B7Y B;  1TWC A;  3KDF B;  2YTX A;  1XTD A;  4GZY C;  4V19 0;  2VPQ A;  3OOC A;  4MV7 A;  3KAL A;  1IHZ A;  4TQR A;  1AE2 A;  2FP4 B;  4M9U A;  4R8U B;  3G6V A;  4QUF A;  1ROD A;  3M3Y B;  1T5X D;  1L2F A;  1TWF A;  4YR0 A;  1FJG H;  4RZQ A;  2F0F A;  2DY7 A;  4HJA A;  3I4N B;  1B3A A;  1BNZ A;  1EYC A;  2GN5 A;  4DR7 L;  3FHW A;  2JE6 I;  4A3D B;  3KF6 B;  4J1M A;  2R87 A;  3NTK A;  1ZYR C;  1XDN A;  3R5H A;  2E2H A;  2V4Q A;  2XGP A;  4LNQ A;  5I47 A;  5I2Y A;  1PVO A;  4DUZ L;  1K83 H;  1NBW A;  2RSN A;  5D3D A;  1KQS A;  2HDM A;  2MO1 A;  3OSN A;  1C48 A;  2ZTC A;  2FK3 A;  4YB8 B;  3BA8 A;  1KAB A;  1L1O A;  1Q90 A;  3C3L A;  1WTR A;  2EPB A;  3C46 A;  4UCO A;  2QIL A;  1E1O A;  3ULJ A;  3J81 W;  5GAE C;  1EEI D;  5DQI A;  2OTJ A;  4K5V A;  2B8G A;  5J1Z A;  1WJJ A;  2W9B B;  1SE4 A;  2ALZ A;  1DJR D;  4ECQ A;  2PW7 A;  3H3V C;  1PXU A;  3N52 A;  1CKN A;  2J7Z A;  5IGF A;  1TXY A;  5ELC A;  3DWP A;  5IYB G;  3CVZ A;  3SGI A;  5FPR A;  5KG1 A;  4DR7 H;  1Y1W A;  2JEI A;  1S72 A;  1VKZ A;  4B3M H;  2FB9 A;  2R7L A;  2ID0 A;  5JJI A;  3DF7 A;  1TWG H;  1TWC B;  4DUZ H;  2CH4 W;  2FE3 A;  3G48 A;  1TR5 A;  3WDN A;  4HQ6 A;  2E8G A;  3JAM c;  3S14 B;  4TRD A;  2Z1C A;  2UXB Q;  3JSN A;  2W8L A;  5IYB H;  4DR1 Q;  4F4W A;  2CQO A;  1EL0 A;  2OQK A;  4I4T F;  1WTQ A;  1TWF B;  2FMA A;  4HAE A;  4KLK A;  5LP6 F;  3MR5 A;  1WTW A;  2DJG C;  4EEY A;  3CCJ A;  2WKD A;  3KLS A;  5KFI A;  5KX5 F;  3BQ1 A;  2E2H B;  2YYZ A;  3DHQ A;  4AQY H;  2MJ8 A;  2VA3 A;  1S0M A;  2JA6 A;  2A74 C;  3E5S A;  3EVQ A;  4CC5 A;  3HOU G;  1X32 A;  3SVM A;  3RZO H;  4R7R A;  3CU7 A;  3BQ0 A;  3T53 B;  1H9M A;  4ZHQ F;  1B9N A;  4O3N A;  3TS2 A;  4XYM B;  1BO0 A;  2W8K A;  4ECT A;  2GPS A;  2B2W A;  2NVT B;  1JOK A;  3BG3 A;  1NUC A;  2J6S A;  4GN4 B;  1CKN B;  1GXD C;  4U67 3;  1KLG D;  2AMC B;  1SMY C;  1C8C A;  1QIL A;  2QEJ C;  3CF5 A;  3HOU H;  2M9V A;  2VNU D;  4KKT A;  4L5T A;  1Y1W B;  2M2L A;  5KNC A;  4JI5 Q;  1CE8 A;  1HA5 A;  2B39 A;  2BH2 A;  2UXB L;  2X0S A;  3NQT A;  4DR1 L;  5T1I A;  3MXN A;  3ERS X;  1LTI D;  1YIT A;  2BE5 D;  2BDO A;  3IG0 A;  3WO0 A;  3DUZ A;  4Q43 A;  4K2L A;  2ASL A;  3RBE A;  5KT5 A;  1OXX K;  3QOJ A;  5DEH A;  3C0F B;  1CA5 A;  1IZ6 A;  2AQ2 B;  3RD4 A;  1YNN C;  4XT3 B;  5KT4 A;  1HZ9 A;  1Q1B A;  2SEB D;  4IPD A;  4JPB W;  4RWS C;  2Y0S A;  4DV5 Q;  2W6O A;  1SNC A;  3U58 A;  3CAM A;  3W3A A;  4A4I A;  1TY0 A;  2W6Z A;  1S5F D;  1LT5 D;  5CV6 A;  5D14 A;  5JPN C;  1QB5 D;  4IOC A;  1BXR A;  1ASZ A;  2F0J A;  2XCA A;  1I50 A;  1Z7T A;  2UXD Q;  4JI6 Q;  3J80 W;  3R8B A;  3G71 A;  4F50 A;  2B2T A;  2JA6 B;  3QO2 A;  4FVM A;  3R23 A;  1OXS C;  1V43 A;  1UE1 A;  3VDY A;  2V59 A;  3KAK A;  2NUC A;  2UXC H;  1LTG D;  4X65 L;  3CKI B;  2H4O A;  4UP7 A;  3JAM L;  4BBS B;  4JI2 Q;  1KJI A;  4YQW A;  1A62 A;  1SND A;  1VQ9 A;  1E1T A;  4Q5V A;  1M7J A;  2VQE Q;  2O2L D;  1DOL A;  2GA4 B;  4O2B F;  3BG5 A;  2R7Z A;  3VR5 A;  1FYC A;  4ZLT F;  4ECW A;  2F0L A;  3PUV A;  3CC4 A;  1XPU A;  3A56 A;  4BY7 G;  5LL6 b;  4JI5 L;  2JQO A;  4IUT A;  2QKI C;  3A54 A;  1EYG A;  2ASB A;  1TAE A;  2RDG A;  5LMN W;  1GSA A;  2WB1 A;  4X64 L;  2HIX A;  1TWA H;  2VQF H;  4OWX B;  2KBN A;  3A8J E;  3S2D H;  4DV2 Q;  2F0I A;  1PZK D;  1EQV A;  1EWI A;  1HQM C;  1B8A A;  3MXN B;  5C0X G;  1IBK Q;  5KFB A;  3NGD A;  4BY7 H;  3N40 P;  4QWE A;  3HKS A;  4L1K A;  1STE A;  2A1A A;  4X65 H;  1IXR A;  1HR0 H;  1KRT A;  4XDX A;  1KC7 A;  4DV5 L;  3L7Z C;  3RIZ A;  2YW2 A;  5HGQ A;  3PIO 3;  3TIN A;  3DEP A;  1CQF A;  4DNT B;  5C44 G;  1YBY A;  2Y0S B;  3ULL A;  1R9T A;  3OUZ A;  5KFP A;  5IOD A;  2UXD L;  1K3R A;  4JI6 L;  4ED1 A;  2EJF C;  3S1N H;  4X3T A;  3IL8 A;  1C4Q A;  1B53 A;  1TWG B;  5C0X H;  4I55 F;  2R92 A;  2AUJ D;  4LFA H;  4X64 H;  4KD4 A;  2N88 A;  1KAW A;  4JI2 L;  1G51 A;  3NUC A;  4P74 A;  5IIF A;  5C44 H;  4JI3 Q;  2HT1 A;  2W57 A;  2VQE L;  1XMQ Q;  2WAQ E;  1XNR Q;  3EYY A;  4G57 A;  3HG9 A;  3RAX A;  1GKH A;  4MTD A;  4HJ8 A;  4HSP A;  4J9P A;  2EXZ A;  4IWX A;  5FD5 A;  4AYB G;  2W7O A;  1XNQ H;  3OW7 A;  1HNW H;  1Y8O B;  3GIK A;  3STB D;  2WDT A;  3GTG A;  3PUX A;  5I4D A;  1VBG A;  2JN4 A;  3RZD H;  3Q23 A;  4EQP A;  3PW0 A;  2M00 A;  2WB1 B;  2UXD H;  4JI6 H;  3G6X A;  1PYS B;  1SCU B;  5ELO A;  1V1O A;  5I2X A;  3T1H H;  5FPO A;  2F0T A;  1EZ6 A;  3FEW X;  3AMU A;  3N42 B;  3I56 A;  1TA8 A;  1LTS D;  4CDF C;  4HTH A;  1I3Q H;  4CKE A;  5K5P A;  4XQJ A;  5KT6 A;  4ZUI A;  3TQY A;  4JI2 H;  3PR4 A;  1JR0 D;  1SR3 A;  1Y8P B;  3KBG A;  4J9S A;  5JVG 3;  2QK4 A;  3RAQ A;  3P7J A;  2A69 D;  2UU9 Q;  1JMC A;  3DWA A;  1LLR D;  2FMM A;  2CKZ B;  5KFN A;  4I7A A;  4WJW A;  1II3 A;  3M4P A;  1A6X A;  2PYK A;  1R9T B;  5KFU A;  1VQG A;  3VA7 A;  2LSS A;  2ZM6 Q; 
#chains in the Genus database with same CATH homology
 2Y0S E;  5C4X G;  4PG3 A;  1VQH A;  1HNZ L;  4BXX H;  1PFS A;  2K52 A;  2D0O A;  2JEB I;  3RR5 A;  1YZ6 A;  3M4Q A;  5FJ8 H;  4JI3 L;  1NJI C;  1AH9 A;  2DUD A;  4JG2 A;  4P72 A;  2YU9 H;  2RHQ B;  3I4M G;  3PSI A;  4AH6 A;  3HOX H;  3NEN A;  2Q2U A;  1NE3 A;  4HJ7 A;  2A19 A;  1UE6 A;  1FVI A;  5H1S E;  2CWP A;  3PGZ A;  1Q7Y C;  1XNQ Q;  1VQO A;  2K5H A;  1HNW Q;  2LXK A;  2I0Q A;  2RF4 A;  1NMF A;  3OYY A;  1TWH H;  4OXP A;  4DR5 L;  4IPG A;  1SMX A;  5FLM G;  3F8T A;  3KOJ A;  1D8L A;  3CMA A;  2VQF L;  5C4X H;  1HR0 W;  1IBM L;  2ZJQ A;  3GTG H;  3GTM H;  4JYA Q;  1X6O A;  3CME A;  5LMU L;  3T1H Q;  3I4N G;  5IT9 c;  1N32 Q;  1YVC A;  1V1Q A;  1VQB A;  3W1G A;  3I4M H;  1EFW A;  1PH7 A;  1SN8 A;  4JI7 Q;  4LF9 L;  4UP8 A;  2B29 A;  1HR0 L;  2OWO A;  3H3V H;  1HJP A;  5C0X I;  4QJF A;  3F2D A;  5JJK A;  1YI2 A;  4LF6 L;  1UEB A;  3FKI G;  3ICE A;  1PHJ A;  4ALP A;  1HZC A;  2YV5 A;  5FLM H;  3H0G G;  3CP0 A;  1A0I A;  3E9I A;  4ME3 A;  3CCS A;  4QQB X;  4BBR H;  1I94 Q;  3I4N H;  4GLV B;  2UU9 L;  2OCE A;  3KF8 B;  1VQA A;  4YHH L;  3L2P A;  3KFU A;  4A75 A;  1M90 C;  4LUZ A;  4LFA L;  1IBL Q;  2Z0S A;  4UPA A;  3RN5 A;  1Q81 C;  2XGT A;  4GLA C;  4MZ9 A;  4B3R Q;  3GTL H;  1PH2 A;  1HNX L;  2RHS B;  3GTO H;  4JBJ A;  1GD7 A;  2NZH A;  3FKI H;  4AYB E;  1EIY B;  2AHO B;  2I5M X;  3GD7 A;  3OW2 A;  5JEA G;  2OQ0 A;  3H0G H;  3S15 H;  4IPC A;  2UUA Q;  4NPS A;  5JEA J;  1PH1 A;  2CWA A;  1CKO A;  1T9H A;  2H5X A;  2CCZ A;  3ER0 A;  4JI1 Q;  3I55 A;  1QUQ A;  2WP8 J;  2VUM G;  4DR4 L;  1XNQ L;  1VQD A;  1HNW L;  2Q2T A;  3M9B A;  3JC6 6;  1LUZ A;  2JA5 G;  3K81 C;  4OX9 L;  4LUV A;  1VQ7 A;  1J5E L;  4EX5 A;  4GNX C;  4JI0 Q;  1VS0 A;  4JYA L;  3D0F A;  3HOV G;  3T1H L;  1C9O A;  3KJO A;  4P71 A;  1N33 Q;  4A3F G;  1K9M C;  2DGY A;  1N32 L;  2I5L X;  3RLO A;  2MQH A;  4QGU A;  4A3M G;  4JI7 L;  2VL6 A;  3W5O A;  4DR3 Q;  1RL2 A;  5IE8 A;  5M3M G;  2VUM H;  3FP9 A;  4IFD I;  2GVB A;  1LTL A;  4A3E G;  2N3S A;  1N8R C;  4FDB A;  1VQL A;  3GDE A;  2EXD A;  3HOZ G;  1Z9F A;  4RMF A;  1GM5 A;  2JA5 H;  3BZK A;  1JB7 A;  3RLF A;  3A5Z B;  4Y7N H;  3J81 j;  3GTP H;  3BZC A;  1MKH A;  5E7N A;  1VQ8 A;  3LGJ A;  3HOV H;  1QZG A;  1HZA A;  4OO1 I;  3B6Y A;  2EQS A;  5GAH C;  2LXJ A;  2IX0 A;  1PH6 A;  4A3F H;  4HID A;  1YJW A;  3J80 c;  1Z47 A;  4A3M H;  4QL5 A;  1IBL L;  1A8V A;  5M3M H;  1E22 A;  1KL9 A;  5ELN A;  4GKK Q;  4X6A H;  3DLL A;  4A3E H;  1WFQ A;  4B3R L;  1VQP A;  2UUC Q;  2FXQ A;  3NBH B;  1N36 Q;  3HOZ H;  3U4V A;  1CSQ A;  4GOP C;  1LM0 A;  2PI2 E;  3KDF A;  4IPH A;  3CCM A;  3S1R H;  4IFD J;  1UE5 A;  2KHI A;  2E5L Q;  3NEM A;  2UUA L;  4Y52 H;  4C3I H;  4DV3 Q;  4JI1 L;  4LF6 Q;  4IJH A;  1WI5 A;  1I6H H;  2BA0 A;  3OTO L;  2HQL A;  2PNH A;  4TVA B;  5EAY A;  1M1K C;  3H3V I;  1VQN A;  1N9W A;  1QUQ B;  4PMW A;  4YCW A;  3KYH C;  3RNU A;  2F3I A;  2KCM A;  1Q12 A;  4JI0 L;  2NVT H;  3TRZ A;  4HIM A;  3J81 c;  3GTQ H;  1NY4 A;  3TEH B;  1WYD A;  4DV0 Q;  5C4J H;  3KF6 A;  1N33 L;  5HY6 A;  2IHE A;  3PUZ A;  4LF4 Q;  4LUO A;  1OXU A;  4HJ5 A;  4A3K G;  3HOW G;  3PO2 G;  2UUB L;  1XPO A;  3AFP A;  4DR3 L;  4A93 H;  3TS0 A;  1EQR A;  4HIO A;  3M7N A;  4DR6 Q;  3STB C;  2F52 A;  3K7U C;  4QY7 A;  5AJ3 Q;  4A76 A;  2R93 G;  3S1Q H;  4DV7 Q;  3E9H A;  4NXM L;  2PMZ E;  3CQZ H;  3IRB A;  1VQ6 A;  4L5R C;  3PO3 G;  2ZJP A;  1L1O C;  2Z6K A;  3D31 A;  4KI0 A;  4MNO A;  4DR4 Q;  4AIM A;  3I7F A;  1G6P A;  2NVX H;  1X9N A;  1Q1E A;  1YIJ A;  4A3K H;  3HOW H;  4X62 Q;  3PO2 H;  1S40 A;  1J5E Q;  2F4V Q;  4GKK L;  1NMG A;  1P8L A;  4JI8 Q;  2UUC L;  1BBW A;  2NVQ H;  1BBU A;  1YHA A;  1L0W A;  4BBR G;  1JE5 A;  3UE0 A;  1VQ5 A;  5DLQ E;  2R93 H;  4GS3 A;  1N36 L;  1WCM G;  3U4Z A;  1B70 B;  5LMN Q;  4XIG S;  4A3D G;  3L0O A;  1O7I A;  1YEZ A;  3PO3 H;  1X56 A;  3EN2 A;  1VQM A;  4C3J H;  2E5L L;  2V1C C;  1SFO H;  1JJG A;  4DV3 L;  1YHQ A;  4GOP A;  1B7Y B;  4LW1 A;  3KDF B;  2YTX A;  4OWT B;  5M5X H;  5IYC H;  1XTD A;  1PH9 A;  4JOI C;  3M3Y H;  4DV1 Q;  3CC7 A;  2NVY H;  1AE2 A;  3CCU A;  4A3I G;  1DGS A;  5IP9 G;  2A8V A;  1H95 A;  2IY5 B;  1RIP A;  1PV4 A;  3UDF A;  1WCM H;  3GO5 A;  3AFQ A;  3E0E A;  5IP7 G;  1L2F A;  4UY8 C;  1C0A A;  4A3D H;  1Q8K A;  4DV0 L;  1SRO A;  1Q86 C;  2MO0 A;  4DK3 C;  3S16 H;  4LF4 L;  4HJA A;  2VS1 A;  4R4C A;  4TQU S;  4L5S A;  2GN5 A;  4DR7 L;  2IT1 A;  3FHW A;  2JE6 I;  4A3B G;  4YCV A;  1X65 A;  5M5Y H;  3KF6 B;  4YWK A;  4DR6 L;  1EUJ A;  4LFB Q;  5AJ3 L;  4LNQ A;  5GRO A;  5IY0 A;  1PVO A;  4H02 A;  3U50 C;  5IP9 H;  4DV7 L;  4A3I H;  4DUZ L;  4NXN Q;  1K83 H;  4DAM A;  1NBW A;  1WOC A;  2K5N A;  5IP7 H;  1KQS A;  4JI4 L;  2MO1 A;  2JA7 G;  4B3T Q;  2ZTC A;  3OTO Q;  3CD6 A;  1L1O A;  3S17 H;  1N34 Q;  2D0P A;  1C7Y A;  1FL0 A;  1P16 A;  5IWA Q;  1V9P A;  4X62 L;  1Y1V G;  1E1O A;  3ULJ A;  1EIF A;  4DV4 Q;  5GAE C;  2F4V L;  4A3B H;  1J6Q A;  2OTJ A;  4JI8 L;  2MNA A;  3CCV A;  1XMO Q;  1BKB A;  1YJN A;  1WJJ A;  1PH8 A;  4PZ7 A;  4OON A;  2ZTE A;  4O2D A;  3BJU A;  2BH8 A;  4XTC S;  1CKN A;  1XPR A;  3PIO A;  1GVP A;  1TXY A;  5LMN L;  2UUB Q;  4DK6 C;  1A63 A;  5IYB G;  4C3H H;  3A74 A;  1QZH A;  3SGI A;  1QVG A;  2JA7 H;  1EOV A;  3J80 i;  4K0K Q;  1S72 A;  4GN3 B;  1TWC H;  1SRU A;  4RG1 A;  2ID0 A;  3A5U A;  1Y1V H;  2CFM A;  4QIW E;  4DKA C;  4DPG A;  4GN5 A;  4DV1 L;  1KD1 C;  3S14 H;  5JJI A;  1TWG H;  4R4I A;  1CUK A;  2B3G A;  3G48 A;  1FJG Q;  4JOI A;  2E8G A;  4WJ3 M;  1X3E A;  3JAM c;  2ZJR A;  3AQQ A;  1TWF H;  4DR2 Q;  4A3G G;  2UXB Q;  1X3F A;  5IYB H;  3HKZ G;  4DR1 Q;  1KIX A;  4EQ5 A;  4GKJ Q;  2CQO A;  2JJQ A;  2VZA A;  4BA2 I;  2OQK A;  1PA6 A;  3AYH B;  4LF5 L;  4KLK A;  3BU2 A;  2E2H H;  4LFB L;  3CCJ A;  3HOY G;  3GTJ H;  2B63 G;  1XJV A;  4NXN L;  3J81 i;  1CSP A;  4R4O A;  3Q8D A;  2JA9 A;  2YYZ A;  4A93 G;  1VQE A;  2KCT A;  4DUY Q;  2NN6 G;  4B3T L;  4A3G H;  1Y1W G;  1JJ2 A;  1K0R A;  1W3S A;  1SLJ A;  1N34 L;  3K8A A;  5IWA L;  3HOU G;  3RZO H;  2AWO A;  4YWL A;  4DV4 L;  5M3F G;  3PF5 A;  1HZB A;  3H15 A;  3I4O A;  3T1Y L;  1XMO L;  2YTY A;  1Q46 A;  3A0J A;  2ES2 A;  3TS2 A;  4A3J G;  3HOY H;  4LF7 Q;  2JA8 G;  4DV2 L;  4GNX A;  2B63 H;  4HJ9 A;  2WFW A;  4YWM A;  4DR7 Q;  5J3B A;  1IBK L;  4WJ4 A;  4YY3 L;  5M5W H;  4B3M Q;  4GN4 B;  5GQO A;  1CKN B;  1Y1W H;  3M4O H;  1IYJ B;  3KJP A;  4K0K L;  2AMC B;  2ZTD A;  4L5Q A;  4BA1 I;  1Q82 C;  3CF5 A;  5IYD G;  4DUZ Q;  1YNX A;  3HOU H;  3CXC A;  5BR8 Q;  2VNU D;  2ALY B;  4L5T A;  4R4Q A;  1AE3 A;  5M3F H;  2HIV A;  1I5F A;  3MEF A;  2QEX A;  4JI4 Q;  4JI5 Q;  2QA4 A;  4A3J H;  1FJG L;  2R6G A;  1VQJ A;  1Y14 B;  4P75 A;  2JA8 H;  3RLN A;  2BH2 A;  1MIU A;  3PCO B;  3G4S A;  4DR2 L;  2L15 A;  3F2C A;  2OTL A;  2UXB L;  2BA1 A;  1E24 A;  2JA6 G;  4A3L G;  4DR1 L;  3PIP A;  1IL2 A;  4GKJ L;  3ERS X;  4APV A;  4KHP Q;  3K80 C;  1YIT A;  4R1J A;  1JJC B;  1KRS A;  1G29 1;  1U0L A;  5IYD H;  2JEA I;  4BBS G;  2R7D A;  1OXX K;  1IZ6 A;  4AQY Q;  1XMQ L;  1XNR L;  1EQQ A;  1VQC A;  1HZ9 A;  1VQK A;  1Q1B A;  4UP9 A;  4IPD A;  3NEL A;  4DV5 Q;  1S3O A;  4DUY L;  1K8A C;  3U58 A;  3CAM A;  4A4I A;  1X3G A;  4IOC A;  3W1B A;  2C35 B;  2JA6 H;  1ASZ A;  4A3L H;  4LF8 L;  2N49 A;  3CCQ A;  2D62 A;  2UXD Q;  2QGQ A;  4LFC L;  4JI6 Q;  3G71 A;  2K50 A;  2K75 A;  3WWV A;  4B3S Q;  1OXS C;  1V43 A;  1UE1 A;  3RN2 A;  3VDY A;  4BBS H;  1PH4 A;  1CKM A;  4LF7 L;  4GLX A;  1MJE A;  1QVF A;  4JV5 Q;  4X65 L;  4BY1 G;  4UP7 A;  4LF5 Q;  1PH3 A;  4JI2 Q;  1A62 A;  2ATW A;  4IOA A;  3PV0 A;  4JBM A;  4GNX B;  4B3M L;  2EIF A;  1VQ9 A;  1E1T A;  3HKZ E;  4NB3 A;  1FGU A;  2WB1 E;  2VQE Q;  4DV6 Q;  1X55 A;  1GO3 E;  4PZ6 A;  4C2M H;  3ZJY C;  5BR8 L;  5C3E G;  3UDI A;  2KHJ A;  3PUV A;  3M85 A;  3CC4 A;  3CCE A;  2JK8 A;  5GAG C;  1XPU A;  3PF4 A;  4BY7 G;  4JI5 L;  1K73 C;  2JQO A;  2Q2I A;  3AEV A;  2IX1 A;  2K14 A;  2Y0S G;  1EYG A;  1SE8 A;  2ASB A;  3S1M H;  4MTN A;  2GVA A;  2YTV A;  5LMN W;  1VQ4 A;  4BY1 H;  4X64 L;  4KHZ A;  1VCI A;  2HHH Q;  2HIX A;  3T1Y Q;  2ZM6 L;  4KHP L;  1OXV A;  1TWA H;  4P73 A;  4OWX B;  2VW9 A;  2KBN A;  1D7Q A;  2IHF A;  3S2D H;  4DV2 Q;  4IO9 A;  2RCN A;  1EWI A;  2I5H A;  3MXN B;  1B8A A;  2Q2H A;  1ASY A;  5C0X G;  5C3E H;  1IBK Q;  1OTC A;  4BY7 H;  1UWV A;  1OXT A;  3S24 A;  4YY3 Q;  4AQY L;  3HKS A;  3JAM i;  1PH5 A;  2A1A A;  5C0X J;  1IXR A;  1KRT A;  3ULP A;  4DV5 L;  1HH2 P;  3L7Z C;  1VQF A;  5HGQ A;  2KEN A;  1X54 A;  2N8N A;  1U5K A;  3I2Z A;  2AKW B;  3CCR A;  4JCV E;  1YBY A;  5C44 G;  1KC8 C;  2NN6 I;  4GOP B;  1I50 H;  4X66 Q;  2R7Z G;  3ULL A;  2UXD L;  1K3R A;  4JI6 L;  2PQA A;  4OWW B;  2XTI A;  3S1N H;  4B3S L;  2UXC Q;  1W2B A;  2N78 A;  1K8G A;  1YHB A;  1E7Z A;  4OX9 Q;  2WB1 G;  2NZO A;  4JV5 L;  1QVC A;  4O0A A;  1KAW A;  4JI2 L;  1HNZ Q;  4J15 A;  2MFI A;  3CPF A;  3DM3 A;  3EBE A;  2Z6K C;  4HIK A;  1G51 A;  1UE7 A;  4P74 A;  3F1Z A;  5C44 H;  4JI3 Q;  2HT1 A;  4DAY B;  2VQE L;  1XMQ Q;  2WAQ E;  4DV6 L;  1XNR Q;  2R7Z H;  4LWC A;  3UDX A;  3CW2 C;  2AWN A;  4IJL A;  3CPW A;  1GKH A;  4HJ8 A;  1I94 L;  4POF A;  3UDG A;  2VY3 A;  4AYB G;  4LF8 Q;  3J7A 5;  1LYL A;  1BVS A;  1E3P A;  4DR5 Q;  3STB D;  2VQF Q;  1IBM Q;  3CC2 A;  4LFC Q;  3PUX A;  2HHH L;  3KLW A;  5LMU Q;  3RZD H;  4POG A;  3HFZ B;  1L1O B;  4A3C G;  5K36 G;  4YCU A;  3J7Z C;  4JBK A;  1PYS B;  4IFD G;  5ELO A;  3PUY A;  5GAD C;  1PYB A;  2K5V A;  4LF9 Q;  2R92 G;  1KHI A;  4X65 Q;  3GTK H;  3I56 A;  3K0X A;  1HR0 Q;  5FLX c;  4DNI A;  3CCL A;  1MJC A;  4JBW A;  2R7F A;  2E2J H;  1I3Q H;  5IYC G;  3UE1 A;  3TQY A;  3PUW A;  3F2B A;  3G6E A;  1VQI A;  4JC0 A;  1SR3 A;  4BXX G;  4R4T A;  4OO1 G;  3EIV A;  2PI2 A;  3TRE A;  5FJ8 G;  3S2H H;  4A3C H;  4X66 L;  1R9T H;  2E2I H;  3HOX G;  2UU9 Q;  1KXL A;  5JJL A;  4YHH Q;  4NXM Q;  1JMC A;  1YJ9 A;  2CKZ B;  2K4K A;  2UXC L;  4LFA Q;  2R92 H;  3M4P A;  3K7A H;  4X64 Q;  4PZ8 A;  1VQG A;  1JT8 A;  2LSS A;  2ZM6 Q;  2PQA B;  1NTG A;  2WAQ G;  1HNX Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...