3PO3G

Arrested rna polymerase ii reactivation intermediate
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po3G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po3G01
3KF6A 4DV7L 1YBYA 4DNIA 1B70B 4GNXA 3RR5A 4DR2Q 1VQMA 4LF8Q 1Q1EA 3PIOA 1PH3A 2R92G 3DLLA 4JI3L 2R7ZH 1VQOA 2HHHL 4WJ3M 1WJJA 1JB7A 4IFDJ 1PH5A 4IO9A 3CCEA 2CQOA 2IHEA 3PUYA 1FVIA 3M7NA 1JE5A 2UUAQ 1PH4A 3E9HA 1U5KA 2KCTA 1QVFA 4KHPL 4JC0A 4JI8L 4UP7A 1OXVA 1VQDA 4QY7A 1NJIC 5C4JH 3M85A 1K9MC 4JI0L 4DV1Q 3MEFA 3T1YL 3L0OA 1X3FA 2PMZE 2VQFL 5IWAQ 3TS2A 5HGQA 4LFCQ 4HJ5A 2NVQH 1HZ9A 5M3MH 3GDEA 3UDFA 4DK3C 1XNRL 5H1SE 3PO2G 3I7FA 1UE5A 4YHHQ 4A3DG 4IFDG 3G48A 4GKKL 2UXDL 3KDFA 3T1HL 4JI7Q 4OWWB 4IOCA 4DR1Q 2K5VA 4QJFA 4AQYQ 3F1ZA 4B3RL 3CC4A 1WI5A 4A3CH 3HOVH 4BBSG 5JEAG 1VQ6A 4LF5L 4C2MH 2JK8A 3K80C 2UUBQ 1YIJA 5BR8Q 4LUOA 2AWOA 2NN6I 4AH6A 2ES2A 2FXQA 5E7NA 2I5HA 1MJCA 4RG1A 3CCVA 2F4VL 4A3DH 2Z6KA 4LFBL 1PYBA 2EXDA 3A0JA 1KRTA 1K8AC 2A19A 2WB1G 1P8LA 2K52A 2E2HH 3GTQH 3A5ZB 1JJ2A 3TRZA 2IY5B 1NBWA 2PQAA 4DR4Q 3EIVA 1QVGA 3FP9A 4OONA 1E22A 4UP8A 2MQHA 3AQQA 1VQLA 2ASBA 2OQKA 4YWKA 4A3GH 5JEAJ 3BZCA 2B63H 2WB1E 1VQHA 1GM5A 3S1QH 1YVCA 4HIKA 4A3IH 2JA5H 1E7ZA 3S14H 5IY0A 3RLNA 4DKAC 3CMAA 4GKJQ 2YTVA 4DR3L 1Y1WG 1HZAA 1MKHA 1PH9A 3GD7A 3J81j 2IX1A 3ULLA 1JJGA 5LMUQ 4DAYB 1UEBA 4PZ6A 1HH2P 2NZOA 4BXXH 2Q2UA 1FJGQ 2AKWB 1IYJB 4FDBA 2I5MX 1QVCA 1VCIA 1LM0A 1GKHA 1HZCA 5HY6A 1I6HH 3CAMA 4LF6L 5IP9H 2JA9A 2VUMH 4C3JH 4R1JA 4C3IH 5C0XI 1CKOA 1OXXK 1BVSA 2ZM6L 2EIFA 3S2DH 4IPCA 1YJWA 4IJLA 2UXBQ 1TWGH 2JA5G 5C44G 3KYHC 2MO0A 4IPDA 3CCLA 3CF5A 5GAGC 2JA7H 2Z0SA 4IJHA 3SGIA 3M4QA 4PZ7A 4JYAQ 1N8RC 1JJCB 2H5XA 1UE7A 3F2CA 4LFBQ 3FKIH 3RNUA 3W1GA 1E1OA 1BBUA 3H3VH 4YY3L 5FJ8H 2HQLA 2RCNA 5FLMG 1HNXL 1KL9A 1VQ7A 3U4VA 3CPWA 1L1OC 2I5LX 4BY7H 4K0KQ 2ALYB 4DV3L 4A3MH 2K50A 4GN4B 3CCQA 4A76A 4DR1L 4JI7L 5IYCH 4X66Q 1EIYB 2ATWA 3W1BA 4DV0Q 3PUWA 4QGUA 5GQOA 4PMWA 3PIPA 1MIUA 3STBC 3FKIG 2IX0A 4NB3A 4LF9Q 4YWLA 4A3FG 1VQ5A 2DGYA 4JOIC 1KD1C 2JA7G 3HOVG 4BBSH 4DV3Q 4K0KL 4A3CG 4R4QA 1KHIA 1A8VA 1HNXQ 4JI0Q 3HOYG 4Y7NH 3KDFB 2VNUD 4WJ4A 2WAQG 4KHPQ 3H15A 1ASYA 1PH8A 1VQEA 2N3SA 3D31A 3OYYA 4X64L 2UUAL 4X6AH 1PV4A 5C4XH 1N9WA 4BA2I 2K5NA 4DUZL 1XPOA 2E2JH 2OTLA 4LF7Q 5M3FG 1UE1A 1M1KC 2UUCQ 4O0AA 1BBWA 4GOPC 4A3KH 1WYDA 2LSSA 1AE2A 1PH6A 2UXBL 2ZM6Q 1IBML 5M5XH 4OXPA 2RHQB 2HT1A 2A8VA 2NVYH 1WCMG 4LUVA 3G6EA 1YHAA 4JV5L 1V43A 4APVA 4GLVB 4A3IG 2VY3A 2UXCQ 2Y0SE 1N33L 2NZHA 2N8NA 3EN2A 3CQZH 1HR0L 3GTPH 4DR6Q 1SROA 1M90C 1UWVA 4NXNQ 4GNXB 2B63G 3GTMH 4DR3Q 4XTCS 4BBRG 1XMOL 1OXUA 4GNXC 4JI2L 1FJGL 1B7YB 3HOUG 4X62L 4P74A 2NN6G 4AYBG 5IT9c 4GN5A 4DR5Q 4YCWA 1IXRA 4RMFA 1LYLA 4YCUA 2CFMA 4DV5L 4DR7L 1X3GA 2VL6A 1SR3A 1Q1BA 4JI1Q 3ZJYC 3KJOA 1P16A 1LUZA 1E1TA 3MXNB 1EQRA 4IPGA 3BJUA 4R4CA 2IHFA 2CKZB 1C9OA 3GTOH 1G6PA 3I2ZA 4DR4L 1N32Q 4L5SA 3HOXG 3J81i 4GOPB 1N36Q 1Q12A 3H0GH 1X54A 4EX5A 1EYGA 1EQQA 3I56A 1NE3A 5AJ3Q 2DUDA 1PA6A 2WAQE 3CXCA 1YZ6A 3STBD 3I4MG 4B3TL 3PO2H 5IYBG 3NBHB 3GO5A 4X65L 3J80i 1I3QH 1N36L 2HIVA 3PUZA 1N32L 4BY1G 1A63A 4A3MG 3DM3A 5M5YH 1QUQA 2IT1A 1X65A 1K83H 1RL2A 2R7FA 3T1HQ 1N34Q 1VQ8A 2VQEL 2AWNA 5FJ8G 4HJ8A 3HKZE 1XNQL 1SFOH 1VQPA 4B3ML 2ZTDA 2VW9A 2D0OA 3NEMA 3D0FA 4J15A 1PHJA 4NXML 1K73C 1QZHA 1CKNA 2Q2HA 2YTYA 3M4PA 5IWAL 2R7ZG 1EWIA 4X62Q 1OTCA 2ZTEA 2JA8H 2KCMA 4DV1L 3T1YQ 1L0WA 5C3EH 1L1OB 1X55A 2F52A 2KHJA 3PGZA 3HKZG 4JI2Q 3UDXA 4JI8Q 1XMOQ 2R6GA 3U4ZA 4JBWA 1SMXA 2E8GA 4POFA 4B3SQ 2K5HA 3RLFA 5IP9G 3L2PA 4A3KG 1YI2A 1Q7YC 4DR6L 4DV6L 3K7AH 4L5RC 3KFUA 1C0AA 1ASZA 3K81C 1YHBA 2ZTCA 1KRSA 4BXXG 3J80c 4C3HH 4LF8L 4UY8C 5DLQE 5GAEC 4A3BG 4GLXA 4DV7Q 1IBMQ 1L1OA 4HIDA 2GVBA 4ALPA 3J7ZC 3OTOL 1Y1WH 1XPRA 1E24A 4JI4L 3J7A5 2UUCL 4GLAC 5IP7H 4A3JG 1KIXA 2JA8G 5JJLA 2JJQA 4HIMA 4JI5Q 1WCMH 4P73A 3UDIA 5GAHC 2YYZA 5LMNL 4HJ9A 3S17H 1IBKL 1Q8KA 4A3LG 1Q81C 5IYDG 4B3SL 2RF4A 2KBNA 2WFWA 1I94L 1QZGA 3NENA 3K8AA 1GD7A 1A0IA 3E0EA 1J5EL 3PSIA 3GTKH 4L5QA 3G71A 4DPGA 1G51A 5C4XG 1K3RA 1K0RA 4TQUS 1MJEA 3S1NH 4B3MQ 4DV2Q 3CC2A 1XNQQ 1XPUA 4A3EH 1BKBA 2OQ0A 2VQEQ 4HJ7A 1N34L 3HOWG 3I4NH 4QL5A 1GVPA 3RN5A 2UU9Q 1IL2A 1HNWQ 3HOZH 2JA6G 1HJPA 5J3BA 3FHWA 4R4OA 3PF5A 3HOXH 5M5WH 4A3FH 2Q2IA 4LNQA 5ELNA 2ZJRA 1NTGA 4HIOA 1YHQA 4R4TA 3G4SA 3KF8B 3PO3G 3B6YA 1Q86C 3CD6A 1J6QA 3IRBA 3ULJA 4XIGS 5IYCG 1SRUA 5AJ3L 4DV4Q 2E2IH 3TREA 3HOWH 4YWMA 4OX9L 3HOZG 4JYAL 1CKMA 4JBMA 1IBLL 3CCSA 1YEZA 2QEXA 4LF4Q 4A93G 1Y14B 3LGJA 1LTLA 3PCOB 1X56A 3J81c 2D0PA 3K7UC 2QA4A 1VQBA 5IYDH 3KJPA 3CW2C 3CMEA 4LF6Q 2A1AA 1FGUA 2ID0A 2KHIA 1SLJA 1TWCH 3CCMA 1Y1VH 3S24A 1VQ4A 1XMQL 3BU2A 3S2HH 4Y52H 4DK6C 3AFQA 2OCEA 5C44H 4A75A 2NVXH 1PVOA 1WOCA 1A62A 2MFIA 4O2DA 5LMUL 3RZDH 4UPAA 1D7QA 1G291 2MO1A 4L5TA 1KXLA 2WP8J 4OO1G 4GKJL 2ZJPA 4QQBX 3BZKA 1W2BA 3S15H 5LMNW 1N33Q 2PI2E 4LUZA 2UXCL 1H95A 1I5FA 1YNXA 4OWTB 5JJKA 4GN3B 1C7YA 4PG3A 3HOUH 2C35B 2PNHA 1VS0A 5K36G 3RLOA 3ERSX 1U0LA 1NMGA 2EQSA 3S1MH 4POGA 1PFSA 1TWFH 2I0QA 1Y1VG 3CC7A 4LF7L 2JA6H 3H3VI 3U58A 4DUZQ 1IBLQ 3I4OA 4HJAA 1YJ9A 3S16H 3I55A 4JG2A 3PF4A 3M4OH 4OX9Q 4NPSA 4X64Q 4KHZA 1S40A 3ICEA 1CSQA 4IOAA 4DV4L 1TXYA 1XTDA 5C0XJ 1XJVA 4LFAQ 1AE3A 5M3MG 4A3GG 2VS1A 3CP0A 3GTJH 3OW2A 5IE8A 1W3SA 4LF5Q 1DGSA 5EAYA 4DUYQ 3PUXA 2B3GA 1SN8A 1VQIA 5FLMH 1YITA 4MZ9A 3W5OA 3U50C 4AQYL 3VDYA 4LF9L 3I4MH 2LXKA 1X9NA 4P75A 2YTXA 1YJNA 4UP9A 4DV0L 1JT8A 4DV2L 3RZOH 4X66L 2BA1A 4H02A 5ELOA 1VQAA 2K4KA 1S3OA 1Z47A 4LFCL 1B8AA 4ME3A 4LWCA 4DUYL 3WWVA 3A5UA 4MTNA 3UE1A 4BY7G 1JMCA 2D62A 3CCJA 3TEHB 1VQKA 4LFAL 4YY3Q 1CUKA 1Q82C 4A3BH 3PV0A 3GTGH 1NY4A 4OWXB 1IBKQ 1VQNA 1KC8C 2CCZA 5LMNQ 1X3EA 2F3IA 3ER0A 3KLWA 4JI5L 2Q2TA 1PH2A 2HHHQ 3EBEA 4JI3Q 3F2BA 1E3PA 2N78A 2VZAA 1OXSC 1CSPA 1VQ9A 4DR2L 3A74A 2CWPA 1S72A 1VQCA 2GN5A 5FLXc 4A3LH 3CPFA 2Z6KC 1EIFA 3AFPA 2PI2A 4DAMA 4IPHA 1EOVA 2R92H 4DV6Q 3GTLH 2HIXA 3NELA 1V1QA 4QIWE 4A4IA 1HZBA 3F2DA 2V1CC 2OWOA 1HR0W 5GADC 1T9HA 2CWAA 5M3FH 2PQAB 2R93H 2XTIA 3E9IA 3TS0A 2YU9H 1EUJA 2YV5A 3HKSA 3AYHB 2N49A 3Q8DA 5IYBH 5C0XG 4MNOA 1XMQQ 1VQGA 3UDGA 2JQOA 3L7ZC 4NXMQ 3M9BA 1D8LA 2B29A 1Q46A 4GS3A 2E5LL 1O7IA 4A93H 3HOYH 4JBJA 3CCUA 1NMFA 5C3EG 1HNZL 1SE8A 1KQSA 3PUVA 2BH8A 4LF4L 4JI6Q 3RN2A 1K8GA 1I50H 4X65Q 1CKNB 2JEBI 2ZJQA 3HFZB 3TQYA 2QGQA 3I4NG 1AH9A 1KAWA 4B3TQ 3S1RH 1VQFA 2NVTH 2F4VQ 1L2FA 1OXTA 2AMCB 3K0XA 2RHSB 2MNAA 4A3EG 2K14A 3AEVA 4AIMA 5BR8L 1QUQB 4BY1H 2UUBL 2R93G 4JI4Q 2AHOB 4JI6L 1HNWL 4PZ8A 1HNZQ 2UU9L 4P71A 4B3RQ 2JEAI 4KI0A 1PH1A 3JAMi 4BA1I 1UE6A 1EFWA 4YCVA 1FL0A 1X6OA 1RIPA 2L15A 4JI1L 3F8TA 4YHHL 2E5LQ 4GKKQ 4DR7Q 2UXDQ 4DV5Q 3ULPA 1TWHH 1R9TH 1XNRQ 3PO3H 1PH7A 1TWAH 4DR5L 1IZ6A 2LXJA 5JJIA 3H0GG 4GOPA 3UE0A 5IP7G 4P72A 2VQFQ 3KOJA 2BA0A 5GROA 1J5EQ 3M3YH 4JCVE 4AYBE 2OTJA 2Y0SG 4A3JH 1PYSB 2KENA 2R7DA 4LW1A 2JE6I 3JC66 1I94Q 4NXNL 1WFQA 1V9PA 2VUMG 3JAMc 4JBKA 2XGTA 3KF6B 1HR0Q 4OO1I 4TVAB 3CCRA 1Z9FA 4KLKA 2GVAA 1GO3E 2BH2A 4JOIA 4EQ5A 4JV5Q 2K75A 4IFDI 4R4IA 1VQJA 3OTOQ 4BBRH
chains in the Genus database with same CATH superfamily
4DV7L 5KFWA 4GNXA 2FFKB 1KJIA 4DR4H 2R92G 3V4SA 1DOLA 4C1NK 1VQOA 1DM0B 3DXJC 1WJJA 1BXTA 4HNVA 3SXHA 3T13A 2LMCB 1KDCA 1JE5A 2Z4IA 3C2PA 3E9HA 2OT2A 4KHPL 2AUJD 4R7RA 4UP7A 3U9TA 3SI8A 4DV1Q 2OH2A 2XSCA 2PMZE 4HSVA 2RGRA 2JN4A 2A6HD 4XYLB 4JI7H 4LFCQ 4MV9A 3OWFA 1EWHA 2NVQH 1I3QA 5M3MH 3N44B 4YHHQ 1UE5A 3G48A 3KDFA 3T1HL 1Q90A 4DV6H 4Q44A 1GHKA 3P7JA 1WI5A 1T5EA 3HOVH 1VQ6A 4LF5L 2JK8A 3K80C 2R86A 2B2VC 2EYHA 4LUOA 5EZYF 3K3PA 1KNAA 1EIGA 4RG1A 5CV7A 3A8KE 4A3DH 2Z6KA 2UUBH 3OIPA 4N9TA 1K3BC 1KRTA 2E2HH 4B3MH 4A3IB 1AP0A 3GTQH 1B44D 3A5ZB 1IOWA 4EFEA 3KUPA 1S68A 5K2MA 1QVGA 1SE2A 1DV1A 4DNRB 2MQHA 3FKIB 4YWKA 1T3NA 5IT9E 2M2LA 4ULLA 1U4RA 2WB1E 2NVXA 2WE6A 4YAKB 1YVCA 2EPBA 1Y69U 5LL6b 3KTMA 4RKLA 2P5ZX 1AN8A 3RLNA 2XCAA 2YTVA 5A35A 1Y1WG 2HCCA 2HHHH 1S0OA 2KHSA 3LX0A 1UEBA 2F0LA 5FLXE 2NZOA 2X69A 1LO5D 1Z2PX 1QVCA 1VCIA 2W9BB 1GKHA 1UEAB 1Z7TA 4DFAA 3IL8A 3VYRA 5KG7A 3CAMA 2NVTB 3E3XA 4R1JA 4C3IH 3K5OA 4J8QA 1R9TB 4IURA 2EIFA 4IPCA 1F2ZA 2LFNA 4IJLA 4XX0B 2NZ1D 4NKLA 3ND9A 4DF7A 4QWEA 1SCUB 4ED7A 2OLSA 5GAGC 3MJFA 2NYZD 2NVXB 2VB2X 2PBZA 3F2CA 1Y1WA 2K5QA 2K5WA 5C5LA 2PW7A 3PR5B 1E1OA 4DU9A 3HOWB 4DR5H 5FJ8H 3FKIA 2RCNA 4IUNA 1HNXL 5FO9B 1VQ7A 1E4GT 3T1HH 3CQZA 3QB3A 1KAAA 4DV3L 2O03A 4TV9F 2DJFC 2KVMA 3CCQA 2UXBH 4A76A 2FK1A 4KN4C 3W1BA 2DIKA 2XIGA 4PMWA 3BAAA 2HDMA 3FKIG 1BF4A 3RB6A 4YWLA 4A3FG 2DGYA 4JOIC 1KD1C 4PMBA 1WCMA 4JI8H 3HOVG 2ZDQA 1VMCA 1ZXTA 4DV3Q 4QWBA 4CDCC 1KHIA 1JIHA 1HNXQ 3BG3A 3VR6A 3J7AF 2VNUD 3HKZA 4XT3B 1HTPA 4A3BB 2A5HA 1VQEA 4C1NI 3TP6A 1K83A 2IX3A 1N9WA 5J2TF 1YNJD 1II3A 4M1UB 4BWSC 1M1KC 2CW8A 2PO4A 4O0AA 5CGKA 1KDBA 4GC7A 1AE2A 1X32A 3NK9A 3GIMA 2KJXA 5JH7F 3HP3A 1GXDC 2W7OA 5D1OB 4R8IA 5EKLA 2NVYH 2PVPA 3J7AV 2V4RA 2XWJB 3MR6A 1CZGA 3BA8A 5KFSA 5KFOA 2JA5B 5COYA 1HRJA 3T5LA 1HR0L 2BDOA 1B4OA 1OWTA 1XMOL 1D2BA 1W6JA 3A7AB 3MR5A 3S9WA 1B6RA 4H44C 1MSGA 4GN5A 4RCNA 4YCUA 2CFMA 3Q8PB 1LT4D 4KJNA 2RDIA 2R8GA 4DV5L 3KALA 1X3GA 1SJHD 2VL6A 3D8GA 4JI5H 2NB0A 3KF8A 5JJZA 2UVUA 4JI3H 2F0QA 3GTOH 2FJZA 3HOXG 1N36Q 2TMPA 2Y0SA 1W93A 1B33N 1I4PA 3QWNA 4CDEC 1NE3A 3I56A 1DCZA 3I4LA 1RJTA 4OL7A 4PQXA 2FMAA 3PO2H 5IYBG 1LTRD 1A3TA 3OUZA 1N36L 1I3QH 2F0EA 1TAEA 3BDCA 2HJWA 2R87A 1TWAA 1K83H 3T56B 3T1HQ 1JOKA 2DLNA 1N33H 2VQEL 4HJ8A 5FJ8G 4F7XA 2ZTDA 3UQ8A 4ODGA 1NCVA 3D0FA 4RWSC 1PHJA 2CZGA 3RF2A 5JVLA 2QEJC 2ZTEA 4ZKCB 4DV1L 4EEQA 5C3EH 1X55A 3UDXA 4CGYB 1XMOQ 1VKZA 5CV6A 5KFCA 1SMXA 3PO2B 3MXPA 3R5XA 3G6YA 1YI2A 4NXMH 1C0AA 3KFUA 2M05A 4NP5A 3K81C 1YHBA 4C2MA 1Q3LA 4HYKA 4DA2A 5KG2A 1HFNA 3TZDA 4FM9A 4UDUC 3KHLA 2FMCA 4DV7Q 2ATLA 1Y1WH 4HIDA 2E2HB 5JOBA 1NUCA 3JAME 1S5DD 1PYWD 2ZXOA 2JA8B 3NTKA 4TRDA 2A69D 2VPQA 4ED1A 3V6KA 1Q8KA 4A3LG 2RF4A 5DEHA 4PNYA 2M00A 2IW3A 5C1OA 4MTDA 4RU9A 3K8AA 1GD7A 3I8ZA 4R8NA 2YRXA 1J5EL 4U673 1CQVA 3GTKH 4DR7H 4L5QA 1IOVA 3NBHA 1FNVA 2NU7B 1I6VC 5KG6A 5C4XG 3KLSA 1MJEA 4B3MQ 1TIID 1UUPA 3EJIA 3I73A 4RHSA 1N34L 2HVRA 2R8HA 1GVPA 4K14A 1N48A 4JI2H 2C9OA 4MTEA 1M6VA 1HJPA 3PVXA 1SYCA 4YIJA 4A3FH 4YJ2F 4C56C 4HIOA 3MXNA 4IUQA 4TQSA 5DLFA 3KF8B 3M9NB 3W2DA 3PO3G 1Q86C 3CD6A 1J6QA 3IRBA 5AJ3L 4JV1A 3CVZA 1SRUA 3JAMW 4LF7H 4IQZA 4ZRZA 1G91A 1Z2OX 2IP4A 4JBMA 1IBLL 4OIKA 3PIO3 1YEZA 2JA7B 3GTQA 4G3IA 2HD3A 3J81c 1W96A 4C5AA 5IYDH 4CC5A 4RGNA 3GTMB 3VYUA 2AQ2B 3F8NA 1TWCH 5KT4A 2A73B 3S24A 4HCSA 3S2HH 1HTLD 1EL0A 3OOCA 4DK6C 1GHJA 5G3LD 2OCEA 4A75A 5ELCA 3MR2A 4O2DA 4HN7A 4IUTA 5FKAC 1B2TA 2HQEA 1D7QA 1CQFA 2FKLA 5F9LA 5KT5A 2ZJPA 1W2BA 3S15H 1KLUD 3S2DB 1N33Q 2UXCL 4LUZA 3BQ0A 1H95A 4DR1H 4E6IA 1AN7A 2F3WA 2VR1A 4QIWA 5KG0A 2PNHA 1L0YB 1FD7D 1U0LA 5KFNA 3QG1A 4POGA 1PFSA 4JYAH 2I0QA 4OX9H 2FB9A 4KKTA 1Y1VG 2A6ED 2WKDA 4FF3A 2JA6H 4O3RA 1X3QA 3I55A 1UNSA 4RUAA 2I46A 1STAA 1Y8NB 4KY7A 1S40A 4TUYF 5J39A 1B04A 1TXYA 1M7JA 2JA7A 4LF5Q 1W3SA 4FP5D 1UC9A 3JSNA 4K2KA 1XX8A 2B3GA 1VQIA 4BBRH 3FPPA 4MZ9A 2AGPA 1EY8A 2LXKA 3Q2OA 4UP9A 3N40P 2RSOA 4DV2L 4DK1A 1I4HA 2EY5A 2AQ4A 1PRTF 4LFCL 5KG5A 1B8AA 4B9XA 3WWVA 5DG7A 3A5UA 5JQWA 2QDBA 1JMCA 3GTPB 1VQKA 3E0JA 1R9TA 3KBGA 3KK7A 1LTAD 4FO2A 5LL6X 3GTGH 1IBKQ 1PRTC 4ABNA 4FU0A 5KT2A 2W9BA 1SYXB 1PH2A 3WO0A 3BABA 2NN6H 1VF5C 4CDDC 2B2UA 1F2LA 4DAYA 1SEIA 1S72A 1GYFA 4A3LH 3RB3A 1STHA 1SMYD 5C8YF 1ESRA 1WR2A 1ULZA 3AFPA 3PR4A 2WTFA 1N34H 5IODA 1TWGA 4DAMA 4IPHA 1EOVA 5T1IA 3M4YA 2R92H 3R23A 5D1PA 1V1QA 3J81W 2K05A 3DM1A 1SFOA 1EHIA 5E3FA 1HR0W 1DV2A 5GADC 4EGQA 2CWAA 2W6MA 3F2UA 3GTJB 2YU9H 3J7A5 2WDTA 3HKSA 2OXPA 5I4DA 3L7ZC 5KFIA 3PZPA 1Q46A 3CRKC 4GS3A 4K0KH 3OHXC 2E5LL 1O7IA 2F0TA 2Q8RE 4HNUA 1HCZA 2HVQA 1HNZL 1I4GA 1CA6A 3I4NB 2PMZA 5BPHA 5G3LF 5KFEA 4JI6Q 4IAJA 4EBCA 4O1NA 2ENBA 3K58A 4ED2A 3GV6A 3VA5A 3HFZB 5KFKA 4FNFA 1PLFA 5C3EB 3M4OB 1KAWA 4B3TQ 1VQFA 5DGBA 1AEXA 1OXTA 2AMCB 3K0XA 3OSNA 1QUQB 4BY1H 2UUBL 3NPPA 2F4VH 1A3UA 2AHOB 1PFNA 1HPCA 1R4QB 2PCFB 3VR5A 4KI0A 4C3HB 1UE6A 1EFWA 1I4XA 1BOSA 3K0YA 2N88A 5KRUA 3JRWA 3F8TA 3PO3H 1VBGA 1PH7A 4X3SA 1FJGH 1TWAH 1DXMA 3GTKB 2LXJA 1U4PA 5CC4A 4GOPA 1UAPA 5IP7G 2VQFQ 1JB3A 3KOJA 2BA0A 3M3YH 4APMA 1STEA 5C6AA 4DLKA 4A3JH 4X3TA 2W70A 2B2VA 1PYSB 2KENA 2MP1A 2V4DA 1WTWA 1QB5D 3JC66 3K5LA 2XC9A 4NXNL 1N32H 1WFQA 1V9PA 2Z6BA 3ETHA 1S97A 2XGTA 3KF6B 3K7AB 3PMFA 2JEFA 4DL4A 4O42A 5LHY1 4F4XA 3CCRA 4KLKA 4JI1H 4JOIA 4JV5Q 4MV4A 1LLRD 2G5DA 2NU8B 1TWCA 4OO1H 1BUVT 1YBYA 3TP5A 1TR5A 2PW5A 4MV6A 1B70B 3TINA 3D4WA 4DR2Q 1LT6D 1PH3A 4Z9CB 3DLLA 4JI3L 4BY1B 2R7ZH 3PQIA 1JB7A 1PH5A 4I50F 4YQWA 3J7AK 1FVIA 5M5YB 2SEBD 2UUAQ 1KJ9A 4CC6A 1YNND 2ZJTA 4FBUA 2F4IA 4JC0A 1A6XA 3CKIB 1VQDA 4JI0L 5C4JH 3M85A 1K9MC 4OGQC 3L0OA 3WDNA 2HDLA 1ZQ7A 2QCPX 2WKCA 5H1SE 3PO2G 4RUCA 4F4WA 3I7FA 2KEEA 4A3DG 2UXDL 1PK8A 1HUNA 2RDJA 4RZRA 4OWWB 2M9VA 3NHHA 4AQYQ 3VPDA 3JSLA 4ZHQF 4K6LA 2EJMA 5BR8Q 4MTKA 3Q24A 4C3IG 2NN6I 4KKUA 4ECQA 5NUCA 2FXQA 4LSAA 1MJCA 2VQFH 2F4VL 4ZOLF 4LFBL 4I7ZC 2EXDA 2B8FA 2K52A 1STBA 4LJZC 2IY5B 1NBWA 3A56A 3N42B 1E22A 4UP8A 4EYIB 3AQQA 3RV4A 5KFAA 3X3NA 4CJ2C 3NXWA 3BZCA 3Q8RB 1Y1WB 4UCUA 4QCLA 2C00A 4LMQD 1WTXA 1VQHA 4L63B 1TWGB 4HIKA 1HFGA 2PZUA 4I55F 1E7ZA 3S14H 5IY0A 3K5HA 3EFXD 3CMAA 4G7ZC 4DR3L 2FP4B 2YS7A 1PH9A 1JJGA 5LMUQ 4BXXH 2Q2UA 2FLNA 2QK4A 2K33A 3I70A 2L5TA 4FDBA 2I5MX 4NXNH 1JQYD 1LM0A 5FO7B 4IZOA 5L37A 5CMDA 1I6HH 2XCPA 5IP9H 2JA9A 3SDZA 3SK4A 4C3JH 2I8CA 5C0XI 1CKOA 1OXXK 1BVSA 2DJGC 4LK1C 5L1JA 4JVZA 2UXBQ 1YJWA 4ETSA 3GTPA 2JA5G 1K8OA 1B3AA 5A2QL 1G8ZD 2PPBC 2MO0A 4HTHA 4IPDA 5KFUA 4HAEA 4DL3A 1G2SA 4DR2H 4JYAQ 1N8RC 3VR3A 1UE7A 4LFBQ 4WFN3 1B50A 3W1GA 4XQNA 2E2IB 4IUVA 5DG9A 2HQLA 2RQXA 5FLMG 1MSHA 1SE4A 2WV6D 2I5LX 1D5MC 3A8IE 4A3MH 1K8MA 4RAUC 4DNTB 2K50A 4GN4B 3MWYW 2W9CA 4Y8VB 5IYCH 4X66Q 1EIYB 1FR3A 2ATWA 2WAQA 3PUWA 1B9NA 5GQOA 4QGUA 4DUZH 2OEOA 3N41B 3STBC 5BR8H 3U9SA 1VQ5A 4I4TF 4GKJH 5F9NA 3S15B 1QWYA 2RDHA 3HS0C 3TQTA 2XGPA 1HXYD 3V05A 2UVRA 1A8VA 4AQYH 4JI0Q 4X3KA 1M0WA 2WAQG 4UHVA 2UUAL 3D31A 2N3SA 5C3XA 4X64L 2K1BA 2FJ2A 4BA2I 4DUZL 1XPOA 2OTLA 3M3YB 4O4IF 1LV9A 1SNCA 4BBSB 2UUCQ 5IIFA 4GOPC 2LSSA 1LTBD 2B2UC 1IBML 5M5XH 3BVGA 3OHAA 1V1OA 1WCMG 5BN3A 4JV5L 2A68D 3M7GA 4GLVB 2QILA 2VY3A 4ZUJA 4RKBA 4Y7NB 4MA5A 5J1ZA 3GTPH 1SROA 3JAML 3KHRA 1UWVA 4NXNQ 3GTMH 1XDNA 4QWAA 1OXUA 1PX2A 3M9OB 2YZMA 2A6EC 3RJ0A 3RTXA 1IXRA 2EYJA 4RMFA 2E2DC 5BN5A 3VPCA 4ZAIA 1GOZA 3S1MB 1SR3A 5KFDA 2DNEA 2L55A 1LUZA 1E1TA 3MXNB 1EQRA 1PTOH 1Y8PB 4DR4L 2YU9B 5IT9L 3GIDA 1Q12A 2ZDHA 1RF2D 4EX5A 1WSCA 3C1EA 2RVLA 4KD4A 2SDFA 5DNFA 3OUUA 1IBLH 4B3TL 1UNNC 1U9RA 4X66H 2C22A 1N32L 4BY1G 3DM3A 5M5YH 3QOLA 1QUQA 2NVYA 5DGAA 4HMIA 1X65A 4XQQA 1VQ8A 1W6KA 2AWNA 3H3VC 3DF7A 3RIZA 3BDLA 5ELFA 1WTQA 1SFOH 1PDQA 3R2IA 2D0OA 2VW9A 4ECUA 1K73C 1IW7D 1MI2A 4NW2A 1EWIA 4X62Q 2R93B 1PZKD 1C8CA 2JA8H 2KCMA 2PMZB 3T1YQ 4UCRA 4L8JA 1L1OB 2CVRA 4JI2Q 4WD3A 1S0NA 3ITPA 4A2AA 4JI8Q 1JC7A 1L0XB 2R6GA 3U4ZA 4JBWA 4JI6H 3OSPA 5IP9G 2MHVA 4RGOS 1CZWA 4A3KG 2FHTA 4DR6L 5BPFA 1TS3A 3K7AH 4L5RC 5C1PA 4C2MB 2UXDH 1Y8OB 3K5IA 1KRSA 4BXXG 2J0TD 1ZYRC 1T5XD 2EXZA 4LF8L 1M0TA 5GAEC 3G8CA 2B2TA 2RDFA 2L1BA 4GLXA 1AZPA 4BY7H 1HNZH 1E24A 1KIXA 2EYLA 4KMUC 5D3IB 4ZUIA 3S17H 2R7NA 1IBKL 5IYDG 1HQRD 5C5MA 4CJ0B 4O3NA 1I94L 1QZGA 2ZXRA 1KABA 3D4RA 4EGJA 2W6QA 1A0IA 3SVMA 2XGQA 1VBHA 1K3RA 1B1ZA 4TQUS 3S1NH 4FF1A 4A2BA 4DV2Q 2G9DA 4A3EH 2OQ0A 2R8JA 3I4NH 4QL5A 5FPRA 2Y0SB 4RNOA 2UU9Q 3RB0A 2E74C 1HNWQ 3RFCA 4ED3A 2R7ZB 2PN1A 3C46A 3FHWA 5KIXA 3PF5A 4UFZA 5ELNA 2ZDGA 3G4SA 5JVG3 3N8DA 2FK2A 3KLSX 4G4KA 3ULJA 4J9SA 4XIGS 1LTTD 1TKWB 2I07B 4X65H 4FBTA 4YWMA 3HOZG 2B2YC 1F9RA 1CA5A 3C3LA 2QEXA 4LF4Q 4EG0A 5CB4F 1LTLA 1BO0A 3H20A 2J7ZA 2D0PA 1GSOA 3K7UC 1VQBA 1H9MA 3CMEA 2A1AA 1FGUA 1A2TA 3GIJA 2UUAH 3CCMA 2ASJA 1Y1VH 1XMQL 4Y52H 2XRSD 3BU2A 5LL6S 3PW4A 4G57A 4LF8H 2KA7A 5C44H 1WOCA 1A62A 1KXLA 3FMAA 2K32A 3RZDH 4UPAA 5K36H 1G291 1JE4A 4L5TA 5L1KA 2WP8J 1XMQH 4X62H 2XD4A 3BZKA 3VR4A 3EPGA 1PTOC 2PI2E 5CV4A 5BMVF 4K6DA 5C0XH 5JJKA 4KV6A 1I4QA 5E4XA 1D5ZC 3WOEA 1I6HB 2F0IA 4EBEA 1K83B 3MHBA 4X3UA 2C35B 3Q8SB 4GZYC 5K36G 3RLOA 3PW5A 4A93B 3S1MH 1I7NA 4ZQ3A 2BQ3A 3MWEA 5LOVF 3H3VI 4DUZQ 1IBLQ 3I4OA 4HJAA 3PF4A 4X64Q 4KHZA 3GQCA 1F2YA 4IOAA 2FMMA 2W9AA 4IR1A 2W8KA 1AE3A 2X6LA 2W9CB 4MAMA 2ZM6H 3GTJH 3GTQB 1H9JA 1SN8A 3U50C 5LXTF 3OHBA 3MFYA 1H9SA 4P75A 1CFMA 3URYA 4OIJA 4X66L 4XT1B 2G9HD 1VQAA 1EUCB 1IKMA 4UCVA 2CQYA 4ME3A 1KEEA 1RHPA 4DUYL 1JORA 4LFAH 2SNMA 2R7ZA 1MBYA 1I7LA 3CCJA 4B08A 4LFAL 4UCTA 4DUYH 3PV0A 5F2DA 3V6JA 2F0JA 4C3IB 4YR0A 1X3EA 1Z6HA 3Q1KA 2F3IA 3GIQA 3ER0A 3KLWA 2Q2TA 1LT3D 1D5XC 3D3RA 3F2BA 1E2VA 2VZAA 3MA2B 2W6ZA 3A74A 2VUMB 4EYHB 4PMCA 2F0WA 1S5FD 3NTIA 4RH6A 4DGZA 5EWFA 3H0GB 5JPMC 1QNKA 2I80A 3PW7A 1M8AA 1ZYRD 4QIWE 5IWAH 4A4IA 4NLGA 1BCPD 2B2TC 2OWOA 1EZ6A 5D3DA 5HGTA 5M3FH 4X64H 2PQAB 4DK0A 3FEWX 1ET9A 2XTIA 2XWBB 3TS0A 2YV5A 3NWSA 5C0XG 2N49A 4XYMB 3M9BA 3V96A 2ICEC 4JBJA 1NMFA 1K28A 1SE8A 3BVZA 1KQSA 3PUVA 2R93A 4Q8EA 1M4VA 3RN2A 3R8BA 1XXGA 1I50H 2ZJQA 5HURA 1AH9A 2F0PA 2F4VQ 5KFLA 1L2FA 5H80A 1CE8A 3BG5A 4F50A 4ECVA 2J9GA 4UAIA 1TWAB 5BR8L 1EZ1A 1TWFB 1CK1A 3D6CA 3OSOA 5IOCA 1QOHA 2RDGA 2VA2A 2B2WA 4P71A 2FPGB 1PH1A 1FYCA 4BA1I 4BBRB 3JRXA 1KJ8A 1X6OA 2FPIB 1EU4A 2UXDQ 2Z8LA 4B9WA 1C4QA 4KD3A 4NMZA 1TWHH 4DV5Q 3ULPA 1NSNS 1WTOA 1G2TA 1JDBB 1LACA 1QE6A 2WYOA 5KNBA 4B3RH 5FD5A 1IZ6A 1PTOB 3H0GG 3UE0A 4GKKH 4P72A 2JEJA 2OTJA 1E0BA 4AYBE 1XNRH 1AFPA 1BCPB 4NDXA 5HBRB 4JV5H 2GPWA 4WJWA 4JBKA 2LS01 2VUMG 1HR0Q 2EYFA 3T1YH 4TVAB 1EYDA 1NR4A 4MV7A 5IT9W 2R8KA 4EQ5A 4G7OC 2BQUA 3MFIA 3P1HA 4R4IA 1VQJA 1RDPD 3OTOQ 2PNRC 4JI4Q 3T5KA 2EYMA 2F0KA 3RR5A 4IUUA 4CDFC 1Q1EA 3PIOA 3HOYB 1JOOA 1GSAA 2BE5D 3E5NA 2EJGC 2HHHL 2F0FA 2L12A 1IBKH 3HOUB 2L9HA 3GILA 5FPOA 1U4MA 5D1OA 1IYVA 1PH4A 4I7AA 3MR3A 1U5KA 2ALZA 3TDQA 5DG8A 4J9RA 2C2RA 4IR9A 4QY7A 5KGUA 4IRCA 2VQFL 1WD1A 3Q6SA 5IWAQ 3TQ1A 3TS2A 5HGQA 4HJ5A 1E4FT 5M5WB 2V59A 5KFYA 5IGBA 1HZ9A 5KT3A 4JV2A 1GUGA 4DK3C 2NTTA 2FK3A 3JZIA 2FPPB 3HKZB 2YRWA 4QJFA 3GIPA 3F1ZA 4IZ8A 3NUCA 1EOTA 4CHTB 4DR6H 4A3CH 4ECZA 1EY5A 2UUBQ 1BR9A 2AWOA 4AH6A 2ES2A 3VMMA 4ED8A 2I5HA 3CCVA 1EIHA 2DN8A 1PYBA 3V6HA 3A0JA 3MC0B 4A3MB 1K8AC 4QUFA 2RCFA 2EY1A 3FP9A 4OONA 3S1NB 2ASBA 2OQKA 1N36H 4PV1C 2E2IA 2V9WA 3K57A 5CV9A 4JI0H 1GM5A 4I65A 2ZT9C 5EWEA 4A3IH 4WORA 1SNQA 1CS0A 4DV7H 3N6XA 4O3SA 3GTOA 4DKAC 4GKJQ 3GV5B 1CTMA 3H09A 1MKHA 1HZAA 3DWAA 4C3JG 5KT6A 2IX1A 2W6OA 1E4EA 2NUAB 3ULLA 2W57A 4LFCH 2VUGA 4DAYB 3G6JB 1HH2P 3ONAB 5JAVA 2AKWB 3HOVB 5DM73 1STYA 1R4PB 1HZCA 4ILWA 5HY6A 1V1PB 1SNDA 4LF6L 1E4EB 2B63B 4J9PA 2VUMH 4MIUA 3T16A 4ECSA 1TWHB 3MZ5A 2ZM6L 1BBXC 2YL2A 2R92A 2Q8IB 3S2DH 2O2LD 2WB1A 5CBEE 1TWGH 4U7CA 1XMOH 3KYHC 3CCLA 3CF5A 2K7VA 5DLGA 2A6HC 4IJHA 3SGIA 1JXLA 4QMGA 3H40A 4RNNA 1BDOA 5HV6A 3N6RA 4QW8A 2K03A 1BBUA 2YZNA 1AUXA 3U4VA 3CPWA 1L1OC 4K0KQ 2KUMA 5J22A 5EKKA 5M3FB 4LAAA 3SK6A 4FF2A 2HCIA 1RTOA 3HOZH 3TIIA 4TSSA 3PIPA 2IX0A 4NB3A 4KTAA 5IGGA 1PFMA 1MGSA 4RAYA 2JA7G 1KJQA 5E1FA 2WACA 5KG3A 4K0KL 2DY8A 3NP8A 4R4QA 2FE3A 1ENAA 1AW7A 4ME5A 4KHPQ 3H15A 1LABA 2PZTA 4X6AH 2RA4A 5C4XH 4ED0A 3H6MA 3KBXA 4G7HC 2E2JH 1Y1VA 5DQGA 3I3CA 3QJYA 1UE1A 3MFHA 1KLGD 3RD4A 5ELBA 5D8DA 1EYAA 1WYDA 4A3KH 1PH6A 2ZM6Q 4OXPA 2RHQB 1TY2A 4V0BA 1ZHSA 3EYYA 2F0VA 1AUVA 2A8VA 1SXTA 2HGSA 4LUVA 1YHAA 1IL8A 4A3IG 1WTHA 2UXCQ 2Y0SE 1N33L 2NZHA 1PTOF 2R6FA 3Q22A 3K6OA 1CT1D 5L1IA 1MD2D 3GTMA 4ZI7F 4GNXB 2GLTA 1XTCD 4XTCS 1FJGL 4J0MA 3HOUG 4RB2C 3S1QB 4K8JA 2JA6B 4RB3C 2MPMA 2A69C 2RSNA 3BDOA 2YS6A 1LYLA 5M5XB 1WTVA 4DR7L 1T94A 3OIQA 3CRLC 3KJOA 1RK5A 4Q45A 1G6PA 4IPGA 2NU6B 2CKZB 3I2ZA 2R8IA 1UC8A 5I9OA 3ND8A 4GOPB 4IUPA 5DAUA 1X54A 2AQ3B 4FXGC 3QFFA 2UVWA 1E2WA 5EPKA 1EYGA 2HUGA 1EYCA 5AJ3Q 3ETJA 2WAQE 4EQPA 3CXCA 1YZ6A 5L9XA 1IYUA 3AU7A 3MTSA 3STBD 3I4MG 1AZQA 3GO5A 2E5LH 1S5CD 2HIVA 3PUZA 1HQMC 2KSWA 2IT1A 4M8AA 4CKCA 1RL2A 3RAQA 5KT7A 1N34Q 5KFFA 1Q8IA 5CORA 1VQPA 4B3ML 4K5VA 4J15A 4NXML 3UI2A 3H91A 2YTYA 3KAJA 5FD6A 5IWAL 1YNJC 2R7ZG 2QF7A 1OTCA 2P0AA 4EGVA 3PW0A 1GUWA 1L0WA 4KY6A 2F52A 3PGZA 2KHJA 5CYUA 4EQOA 1FJGQ 4L1KA 2E8GA 2DWCA 5LP6F 2C28A 3EVQA 3J7YW 3L2PA 4S3SA 4O3PA 3EA6A 4DV6L 2SOBA 1GUNA 2ZTCA 3CHBD 1EUDB 3GIKA 1RJPA 5DLQE 4ID6A 5C5JA 4J9LA 1BCPC 3KLRA 1L1OA 3OTOL 4JI4L 4B3TH 1TU2B 4A3JG 1MZBA 4HIMA 1WCMH 3UDIA 5GAHC 2YYZA 5LMNL 2DZDA 4A3EB 1Q81C 2L4NA 1H9KA 2WFWA 1BCPF 3RGXA 2VUMA 3J81L 5DM63 4J9OA 2R7MA 2NVYB 3RGZA 2BDNA 3RMHA 1K0RA 3CC2A 1BKBA 1PZJD 2VQEQ 5IGDA 2SCUB 3E5SA 2IL8A 3FPUB 2F0GA 3RN5A 1RKNA 2JA6G 4ECXA 3MWDA 4R4OA 1C3OA 2YU9A 3HOXH 3HXLA 2Q2IA 2IJ0A 4RGTA 5EJWA 4LNQA 1NTGA 1YHQA 4Q43A 3B6YA 1E2ZA 2E2IH 4RGMA 3HEJA 3CCSA 2MJ8A 1Z2NX 4LH7A 3PCOB 4A3FB 5KG1A 5EPLA 5KNDA 2QA4A 1K1QA 4Q0YA 4KHVA 1J8IA 3HG9A 3KJPA 3V2TA 1EQVA 3DUZA 4EVOA 2KCCA 4LF6Q 1KJJA 2KHIA 2O5IC 3NE5B 1VQ4A 4DV0H 3FVQA 4H13C 2KEDA 2LY7A 2NVXH 1EYZA 4YBZB 5I6WA 5DQIA 4K5XA 2MFIA 3GTGA 3ZYYX 2MO1A 4IRDA 2ZXPA 3MXGA 2L0CA 2X0SA 1BQQT 5I2XA 4GKJL 2LKVA 4QQBX 4R8UB 1HA5A 3IFTA 1VDZA 2BE5C 5LMNW 4TV8F 1I5FA 3HZXA 2Z4HA 4DXGA 5EWGA 2C2DA 2FINB 2XIWA 1QCBD 4GN3B 1C7YA 3HOUH 5J2UF 4IHJF 3R2TA 2K01A 2AGQA 3X3MA 3ERSX 4DV3H 1NMGA 3GTGB 5C4HA 1BXRA 5KFBA 4RA8A 2CW0D 1TWFH 1HNXH 1BNCA 3S2HB 1SYDA 1DIKA 1HUMA 3CC7A 5KFGA 1WCMB 4CKBA 4EQNA 3RBEA 4OX9Q 4NPSA 1PMRA 3ICEA 1CSQA 1SSOA 4DV4L 2JYOA 3T4AC 5KYLA 1XJVA 4LFAQ 5M3MG 4A3GG 2VS1A 3CP0A 3KHHA 3FDTA 1DGSA 5EAYA 4DUYQ 3PUXA 3KXYT 2ASDA 5FLMH 2AQ1B 3TN2A 2JEIA 3A54A 3GQBA 2PYKA 2YTXA 3RZOH 2BA1A 4H02A 2F0DA 5ELOA 5KKNB 3RUZA 2F0SA 2K4KA 2GA4B 5DQHA 3A8JE 1Z47A 1KDAA 5I47A 1JKJB 2AUKA 2W8LA 4LWCA 1I94H 3I91A 3FDSA 1O7ZA 1ET6A 3UE1A 2X6GA 3D4DA 1TWHA 3QZ7A 4DAPA 2WIIB 5GONF 4A3BH 1SYBA 4J9NA 4RNMA 3A55A 3H94A 2IBKA 1ICFB 3N43B 4OWXB 1VQNA 1KC8C 2CCZA 4RB0A 1IHZA 3Q23A 3BQ2A 4JI5L 2HHHQ 2R7LA 5EQ0A 3VYTA 2N78A 4A3GB 5M3MB 2W71A 3T5JA 3IKJA 2YCHA 2CWPA 1VQCA 2GN5A 5FLXc 5A2QE 3CPFA 3GTOB 4LFBH 1NAPA 1EIFA 1PTOD 4F88A 5E4WC 5C4ZA 1CHQD 2CH4A 2EY6A 2PI2A 1PRTB 1HR0H 2HIXA 1XWEA 3NELA 3J80E 3BS1A 4HNTA 5JUMA 2B39A 4MN3A 3F2DA 4QB4A 4C3HG 4GC6A 1FGBD 2R85A 1I50B 2VQEH 2NWGA 3Q8DA 1XMQQ 5ELDA 3I12A 5IYBH 4IN3A 1DONA 3L4JA 3GIIA 3WO1A 2Z1CA 3UDGA 4HEDA 4HQ6A 5LMNH 2WINB 1YNNC 4A93H 3HOYH 1JOQA 1S0MA 3TBIB 1TA8A 2UUCH 3RZOB 4ME6A 2E2JB 5C3EG 2BH8A 3VYSA 5IGFA 4LF4L 4MV3A 2EYPA 3QR8A 1O78A 4OHJA 5JEAH 4X65Q 1CKNB 3PW2A 4Q8FA 5JPNC 3TQYA 2EDGA 2QGQA 1RJRA 3I4NG 5FLXL 5KFRA 2J6TA 1PXUA 2RHSB 4HR7A 1EFID 3AEVA 4AIMA 4M9UA 4PDBA 1I3QB 1RJQA 1CI3M 1U4LA 2R93G 2QYZA 5KFVA 4MV8A 3MXUA 1HNWL 1EU3A 4PZ8A 2UU9L 1GSHA 2JEAI 4YCVA 1FL0A 1O75A 1RIPA 2DY7A 4JI1L 4YHHL 1PRTD 1EZ8A 4DR5L 1SYGA 1RYRA 1GUTA 3OWEB 3S1RB 2R7DA 1I94Q 4A3DB 3HB9A 3DWQA 3JAMc 1SMYC 4OO1I 1JLLB 3Q8QB 1Z9FA 3DWPA 1GUOA 2JA6A 4FF4A 1DD2A 4F4YA 1IBMH 4HSPA 1DOKA 4IFDI 2XN9C 4EEYA 4XQJA 3GP7A 3KF6A 4DNIA 2IPKD 2F03A 1J5EH 1F9SA 1VQMA 4LF8Q 1SNMA 1BGWA 3D6WA 1MHWC 5KFPA 4RCOA 4WJ3M 4IFDJ 2O5JC 4IO9A 2NU9B 4RHRA 4B3SH 3GTKA 4O3OA 3CCEA 2CQOA 2IHEA 4LMYA 3PUYA 3LWBA 5D14A 2D2CC 3M7NA 4O3QA 3ORQA 3VR2A 4LH6A 1QVFA 2KCTA 4JI8L 1KNEA 1LT5D 1OXVA 1NJIC 5FLXW 1VMPA 3T1YL 1ENCA 3MEFA 2C2EA 5CBAE 4RAZA 1X3FA 1CQJB 2TSSA 4ZCKA 4RB1A 4M7EA 1F9PA 1JICA 1TWFA 2MUYA 3GDEA 3UDFA 1XNRL 2PQEA 2J4XA 5FK9C 1HA6A 4HR7B 1XYIA 4IFDG 4GKKL 2XNAC 5JJIA 4JI7Q 1TT2A 4IOCA 2K5VA 4DR1Q 3VA7A 4B3RL 4DL2A 1BNZA 3CC4A 3IN5A 1JWMD 3FMCA 4BBSG 4AYBB 5JEAG 4C2MH 4UCOA 2DNCA 4IWXA 1YIJA 1LTSD 5EBDA 1HNWH 5E7NA 2WAQB 5C4JB 3TMEA 2KQ3A 3SK5A 3M9MB 2R82A 2A19A 2H4OA 1P8LA 2WB1G 4BY7B 4J9MA 1JJ2A 3TRZA 4F8MA 3GTJA 2PQAA 4DR4Q 3EIVA 1A2UA 3CQZB 3RBDA 2BQRA 3I4MB 1X3PA 1I6UA 4RFBA 1VQLA 4A3GH 4Q0FA 1SFOB 5JEAJ 2B63H 5T14A 2HVSA 1PZID 5I6YA 1B9MA 5I9PA 2PZWA 4J9QA 1CM9A 2K04A 2VOBA 3S1QH 5KFTA 2F0UA 3H0GA 4KHPH 1O7YA 2VQDA 4DR3H 2JA5H 4K5WA 2NVQB 1D1KA 5CA1F 3GD7A 3J81j 2IMWP 3MFGA 2B63A 1QJOA 1K1SA 5K5PA 3HGBA 2Z9HA 4MA0A 2BOSA 4PZ6A 4H0LC 3GV7B 1SJED 3NBIA 3OW7A 2MGSA 1IYJB 4RZQA 1S9FA 4L6TB 4DV5H 4DXFA 5KFHA 1ICWA 3S17B 1G6ZA 3M4IA 1KC7A 3NQIA 5EKIA 3I72A 3T53B 3PO3B 3GLKA 5C44G 4ECYA 2JA7H 2Z0SA 4FYDA 3M4QA 4JV0A 4PZ7A 4FXDA 1JJCB 2H5XA 2F1MA 3FKIH 1RD9D 3RNUA 3MAQA 3H3VH 4YY3L 4YR2A 4JPBW 5T1GA 1KL9A 1SAPA 2EYOA 4KKSA 2ALYB 3R93A 1TS5A 4PWQA 4FS1A 5C44B 3NQTA 4H7BA 2W6NA 1QILA 1VF7A 1J9OA 1S5BD 4DR1L 4YAJB 4JI7L 4DV0Q 4CJ1B 5IYZF 2UXCH 1MIUA 3ERQA 5JVH3 1EEID 4EFBA 5KYIA 4LF9Q 2A74C 4DAVA 4FVMA 1F77A 4BBSH 3G6VA 3G7LA 1SBBB 3QIAA 4A3CG 3HOYG 4Y7NH 2FLPA 3KDFB 4IFDH 4WJ4A 3NWTA 4C5BA 3H4DA 1B3QA 1ASYA 2W6PA 1PH8A 3OYYA 1GLVA 4OEMB 1PV4A 2VPSA 1IW7C 1KBLA 3PIP3 2K5NA 2CHBD 3SHLA 5M3FG 4LF7Q 2KOLA 2I87A 4UCSA 1BBWA 2F0OA 3SE0A 2UXBL 4R8UA 4BWGB 3AB9A 3TIGA 4YR3A 2AGOA 2K6AA 2R3ZA 2HT1A 1FNWA 3H4BA 1K0SA 5D65A 4O4HF 3G6EA 5KEEA 1V43A 1JWSD 4APVA 1GGOA 4ZKBB 2N8NA 2EVBA 3EN2A 3CQZH 4HCEA 4DR6Q 3HBLA 2XCLA 1M90C 2B63G 2V5AA 5EPJA 1RK6A 1PFBA 4DR3Q 2L11A 2CW0C 4BBRG 4GNXC 4JI2L 1B7YB 3O13A 4X62L 4P74A 2NN6G 4AYBG 1SE3A 5IT9c 4DR5Q 4YCWA 4U6PA 1WD0A 3GTLB 2GPSA 5CV5A 1JR0D 4BS9A 3K3VA 2NTSA 3SR1A 3R5HA 2Q8TA 4JI1Q 3ZJYC 1Q1BA 3SEBA 4C3JB 2DPIA 1P16A 1GJXA 2F0NA 4R4CA 3BJUA 2IHFA 3RUPA 1C9OA 4XDXA 1N32Q 5KFMA 4L5SA 1S10A 3J81i 3HOXB 3OMCA 3H0GH 3GV3A 2MCTA 1F9QA 4QW9A 1EQQA 2KECA 2DUDA 1EY4A 1PA6A 5M9OA 4I7HA 3RV3A 3J80L 3TP8A 4EBDA 3LP8A 3BA9A 3NBHB 3EQLC 2EE1A 4X65L 3J80i 4V190 3L9AX 4J1MA 4A3MG 1A63A 1S03G 2B2WC 1GUSA 2R7FA 5LA6F 4R9WA 3HKZE 1XNQL 2K5DA 2CW7A 1B6SA 3WNZA 2C5CA 4K2LA 1DJRD 3NEMA 3GV8B 2DPJA 1QZHA 1CKNA 2Q2HA 3M4PA 3TZUA 4IRKA 5EDWA 3DMUA 2E2HA 1ZKOA 2H1EA 3BYTB 3HKZG 4LF5H 4POFA 4B3SQ 2K5HA 3RLFA 1Q7YC 4IWYA 1VAJA 1ASZA 4N8FA 2A68C 5BN4A 3ORRA 1I50A 3W3AA 5LMUH 4YJ3F 2B8GA 1A15A 1D6EC 3J80c 4C3HH 4UY8C 2RBMA 4A3BG 3HRZC 2QKIC 5ELEA 4F87A 4TQRA 3T5HA 3IAYA 1IBMQ 4LF4H 3MWMA 4ALPA 2GVBA 1XPRA 3J7ZC 3SE7A 2UUCL 4GLAC 5IP7H 5JJLA 2JA8G 2F3VA 1F2MA 2JJQA 4JI5Q 4P73A 5AFWA 2E76C 1JCKB 4HJ9A 2BCOA 3RZDB 2YYAA 4B3SL 3PN1A 1L2ZA 2KBNA 3K59A 3LMLA 3RB4A 5KFZA 5CA0F 3NENA 5EOYA 4DV2H 3MEHA 3E0EA 3PSIA 1RCVD 5JVDF 1CQIB 3G71A 1TS2A 3S14B 5KNCA 1TS4A 4DPGA 1G51A 1WTRA 3IG0A 4LF9H 3BQ1A 1XNQQ 1XPUA 3Q0AA 4HJ7A 3HOWG 2VXWA 1ILQA 1LTGD 4TKOB 3C0FB 1IL2A 3P20A 1EY9A 1CHPD 4F4ZA 2J6UA 2D9UA 4OELB 5J3BA 5M5WH 4LF6H 1SNPA 4FXKC 4WBNF 4FS2A 2ZJRA 2KCNA 1EY6A 4R4TA 1EQTA 3V4ZA 4ED6A 1STGA 3LWEA 4XYQA 3CU7A 5IYCG 4DV4Q 3HOWH 1H9SB 1I4RA 4A93G 3TREA 4ZQIA 4OX9L 1KTKA 1NNXA 2YW2A 4JYAL 1CKMA 3GTLA 5EBCA 5CV8A 1WH2A 5KG4A 1FKAH 5C3WA 1V51A 1Y14B 3LGJA 1SDFA 1X56A 3DEPA 2F0HA 3I90A 4K8IA 2ASLA 3CW2C 1JDEA 2ID0A 4LSXA 5ISRA 2NUCA 3BYYB 3N52A 4J9KA 1SLJA 1JWUD 1ILPA 2JA5A 1O80A 2K28A 3AFQA 5FOBB 1PVOA 1EWCA 5LMUL 2V58A 1EEFD 5IGCA 4YP3A 1TQOA 1QG7A 4O4LF 1SNOA 4OO1G 3OPOA 1HHVA 5EGTA 2EZVA 4JUZA 3VPBA 4QIWB 5L1LA 3KAKA 1C48A 2ICIA 1YNXA 3KHGA 1Y1VB 4OWTB 4DL5A 4KN7C 1T36A 4PG3A 3AMUA 3HOZB 1ESFA 1VS0A 5CAEB 4DL6A 1BJTA 2EQSA 4KJOA 2UVVA 4E4TA 4LF7L 1XNQH 3U58A 3K5MA 3NSWA 1RTNA 1YJ9A 1DYQA 1B53A 4U68A 4JG2A 3S16H 3M4OH 1A9XA 1O7LA 2FLLA 3R5FA 2OF1A 1XTDA 5C0XJ 4ECWA 1DZ1A 2D5DA 4O2AF 2B2YA 3QZ8A 5KX5F 2J6SA 2XVSA 2SNSA 3OW2A 5IE8A 2IWHA 1A3VA 1ZHQA 4ZLTF 3BZDB 2N55A 2R61A 1YITA 3W5OA 3VDYA 4AQYL 4LF9L 3I4MH 3LWUA 5KFJA 1X9NA 1YJNA 4DV0L 1V8QA 1JT8A 2O4XA 3UFXB 2W7PA 1RYSA 4DN4M 5KFXA 3TP7A 3IFDA 1S3OA 5TSSA 2XRQD 5IGEA 1SYFA 2EOTA 3S16B 4C5CA 3P75A 1N56A 1FNUA 2WB1B 4MTNA 3OMGA 4BY7G 4ECRA 2D62A 4MHEA 3TEHB 4QUCA 2R92B 2QW7A 1CUKA 2EY2A 3NTHA 5FO8B 4YY3Q 1Q82C 5LYJF 4ECTA 1NY4A 1V1PA 1SYEA 5LMNQ 4QF4A 1QNUA 3EBEA 3QO2A 4JI3Q 3EPIA 1E3PA 4JW0A 4ZYSA 1OXSC 4A3KB 1CSPA 2JXMB 1VQ9A 4DR2L 2VB3X 1WTPA 1C30A 2F0MA 1S4ZA 5C4XB 3L4KA 3DHQA 5KFQA 2Z6KC 4DV4H 4YHHH 1V4YA 4JK1C 4Q5VA 1D1IA 3C1FA 4DV6Q 3GTLH 4DV1H 1H9RA 2UU9H 4KK7A 2R84A 1JX4A 3WOFA 1OO9B 1HZBA 1ZEQX 2V1CC 4N9PA 3MVVA 1T9HA 4XYOA 1EY0A 2R93H 3E9IA 3E6ZX 4YB8B 1EUJA 2RKSA 3AYHB 2NBFA 3L3OC 4MNOA 1VQGA 4P2CB 2JQOA 4NXMQ 1ML0D 2V4QA 1D8LA 2B29A 4DL7A 1LTID 3LNNA 3CCUA 3BJYA 2BR0A 1STNA 3OTOH 1WVLA 1ZETA 4JI4H 3T51B 1K8GA 2JEGA 4AYBA 4ZK9B 2JEBI 3EROA 3NGDA 2CQAA 4MV1A 1EY7A 1S5ED 3TSSA 2AU0A 3S1RH 3QOJA 2NVTH 2RGVA 4CBVA 2E75C 2CH4W 2MNAA 4A3EG 2K14A 1IKLA 2JP1A 4XZ3B 2JSOA 3U9OA 4XXEA 4JI6L 4A3JB 3R3OA 1HNZQ 1NR2A 4B3RQ 5I2YA 4QWDA 3JAMi 4J6HA 2VA3A 3FRPB 2L15A 2E5LQ 4GKKQ 2YZGA 4QWCA 4N8X1 3K5NA 4DR7Q 1SEBD 1R9TH 1XNRQ 1ONLA 4KY5A 1TY0A 1DOMA 4YY3H 5GROA 1J5EQ 4JCVE 1RODA 2Y0SG 3SK8A 4O2BF 4HMJA 3J81E 4LW1A 1ENFA 3J80W 3DEOA 3G6XA 2JE6I 1TVXA 4IALA 2R7KA 3RAXA 3BVMA 1TWCB 2IA6A 2GVAA 1GO3E 2BH2A 4WRDA 4CKEA 5CR3A 5A2QW 2K75A 2QDLA 3A7LA 2EJFC
chains in the Genus database with same CATH topology
3KF6A 4DV7L 1YBYA 4DNIA 1B70B 4GNXA 3RR5A 4DR2Q 1VQMA 4LF8Q 1Q1EA 3PIOA 1PH3A 2R92G 3DLLA 4JI3L 2R7ZH 1VQOA 2HHHL 4WJ3M 1WJJA 1JB7A 4IFDJ 1PH5A 4IO9A 3CCEA 2CQOA 2IHEA 3PUYA 1FVIA 3M7NA 1JE5A 2UUAQ 1PH4A 3E9HA 1U5KA 2KCTA 1QVFA 4KHPL 4JC0A 4JI8L 4UP7A 1OXVA 1VQDA 4QY7A 1NJIC 5C4JH 3M85A 1K9MC 4JI0L 4DV1Q 3MEFA 3T1YL 3L0OA 1X3FA 2PMZE 2VQFL 5IWAQ 3TS2A 5HGQA 4LFCQ 4HJ5A 2NVQH 1HZ9A 5M3MH 3GDEA 3UDFA 4DK3C 1XNRL 5H1SE 3PO2G 3I7FA 1UE5A 4YHHQ 4A3DG 4IFDG 3G48A 4GKKL 2UXDL 3KDFA 3T1HL 4JI7Q 4OWWB 4IOCA 4DR1Q 2K5VA 4QJFA 4AQYQ 3F1ZA 4B3RL 3CC4A 1WI5A 4A3CH 3HOVH 4BBSG 5JEAG 1VQ6A 4LF5L 4C2MH 2JK8A 3K80C 2UUBQ 1YIJA 5BR8Q 4LUOA 2AWOA 2NN6I 4AH6A 2ES2A 2FXQA 5E7NA 2I5HA 1MJCA 4RG1A 3CCVA 2F4VL 4A3DH 2Z6KA 4LFBL 1PYBA 2EXDA 3A0JA 1KRTA 1K8AC 2A19A 2WB1G 1P8LA 2K52A 2E2HH 3GTQH 3A5ZB 1JJ2A 3TRZA 2IY5B 1NBWA 2PQAA 4DR4Q 3EIVA 1QVGA 3FP9A 4OONA 1E22A 4UP8A 2MQHA 3AQQA 1VQLA 2ASBA 2OQKA 4YWKA 4A3GH 5JEAJ 3BZCA 2B63H 2WB1E 1VQHA 1GM5A 3S1QH 1YVCA 4HIKA 4A3IH 2JA5H 1E7ZA 3S14H 5IY0A 3RLNA 4DKAC 3CMAA 4GKJQ 2YTVA 4DR3L 1Y1WG 1HZAA 1MKHA 1PH9A 3GD7A 3J81j 2IX1A 3ULLA 1JJGA 5LMUQ 4DAYB 1UEBA 4PZ6A 1HH2P 2NZOA 4BXXH 2Q2UA 1FJGQ 2AKWB 1IYJB 4FDBA 2I5MX 1QVCA 1VCIA 1LM0A 1GKHA 1HZCA 5HY6A 1I6HH 3CAMA 4LF6L 5IP9H 2JA9A 2VUMH 4C3JH 4R1JA 4C3IH 5C0XI 1CKOA 1OXXK 1BVSA 2ZM6L 2EIFA 3S2DH 4IPCA 1YJWA 4IJLA 2UXBQ 1TWGH 2JA5G 5C44G 3KYHC 2MO0A 4IPDA 3CCLA 3CF5A 5GAGC 2JA7H 2Z0SA 4IJHA 3SGIA 3M4QA 4PZ7A 4JYAQ 1N8RC 1JJCB 2H5XA 1UE7A 3F2CA 4LFBQ 3FKIH 3RNUA 3W1GA 1E1OA 1BBUA 3H3VH 4YY3L 5FJ8H 2HQLA 2RCNA 5FLMG 1HNXL 1KL9A 1VQ7A 3U4VA 3CPWA 1L1OC 2I5LX 4BY7H 4K0KQ 2ALYB 4DV3L 4A3MH 2K50A 4GN4B 3CCQA 4A76A 4DR1L 4JI7L 5IYCH 4X66Q 1EIYB 2ATWA 3W1BA 4DV0Q 3PUWA 4QGUA 5GQOA 4PMWA 3PIPA 1MIUA 3STBC 3FKIG 2IX0A 4NB3A 4LF9Q 4YWLA 4A3FG 1VQ5A 2DGYA 4JOIC 1KD1C 2JA7G 3HOVG 4BBSH 4DV3Q 4K0KL 4A3CG 4R4QA 1KHIA 1A8VA 1HNXQ 4JI0Q 3HOYG 4Y7NH 3KDFB 2VNUD 4WJ4A 2WAQG 4KHPQ 3H15A 1ASYA 1PH8A 1VQEA 2N3SA 3D31A 3OYYA 4X64L 2UUAL 4X6AH 1PV4A 5C4XH 1N9WA 4BA2I 2K5NA 4DUZL 1XPOA 2E2JH 2OTLA 4LF7Q 5M3FG 1UE1A 1M1KC 2UUCQ 4O0AA 1BBWA 4GOPC 4A3KH 1WYDA 2LSSA 1AE2A 1PH6A 2UXBL 2ZM6Q 1IBML 5M5XH 4OXPA 2RHQB 2HT1A 2A8VA 2NVYH 1WCMG 4LUVA 3G6EA 1YHAA 4JV5L 1V43A 4APVA 4GLVB 4A3IG 2VY3A 2UXCQ 2Y0SE 1N33L 2NZHA 2N8NA 3EN2A 3CQZH 1HR0L 3GTPH 4DR6Q 1SROA 1M90C 1UWVA 4NXNQ 4GNXB 2B63G 3GTMH 4DR3Q 4XTCS 4BBRG 1XMOL 1OXUA 4GNXC 4JI2L 1FJGL 1B7YB 3HOUG 4X62L 4P74A 2NN6G 4AYBG 5IT9c 4GN5A 4DR5Q 4YCWA 1IXRA 4RMFA 1LYLA 4YCUA 2CFMA 4DV5L 4DR7L 1X3GA 2VL6A 1SR3A 1Q1BA 4JI1Q 3ZJYC 3KJOA 1P16A 1LUZA 1E1TA 3MXNB 1EQRA 4IPGA 3BJUA 4R4CA 2IHFA 2CKZB 1C9OA 3GTOH 1G6PA 3I2ZA 4DR4L 1N32Q 4L5SA 3HOXG 3J81i 4GOPB 1N36Q 1Q12A 3H0GH 1X54A 4EX5A 1EYGA 1EQQA 3I56A 1NE3A 5AJ3Q 2DUDA 1PA6A 2WAQE 3CXCA 1YZ6A 3STBD 3I4MG 4B3TL 3PO2H 5IYBG 3NBHB 3GO5A 4X65L 3J80i 1I3QH 1N36L 2HIVA 3PUZA 1N32L 4BY1G 1A63A 4A3MG 3DM3A 5M5YH 1QUQA 2IT1A 1X65A 1K83H 1RL2A 2R7FA 3T1HQ 1N34Q 1VQ8A 2VQEL 2AWNA 5FJ8G 4HJ8A 3HKZE 1XNQL 1SFOH 1VQPA 4B3ML 2ZTDA 2VW9A 2D0OA 3NEMA 3D0FA 4J15A 1PHJA 4NXML 1K73C 1QZHA 1CKNA 2Q2HA 2YTYA 3M4PA 5IWAL 2R7ZG 1EWIA 4X62Q 1OTCA 2ZTEA 2JA8H 2KCMA 4DV1L 3T1YQ 1L0WA 5C3EH 1L1OB 1X55A 2F52A 2KHJA 3PGZA 3HKZG 4JI2Q 3UDXA 4JI8Q 1XMOQ 2R6GA 3U4ZA 4JBWA 1SMXA 2E8GA 4POFA 4B3SQ 2K5HA 3RLFA 5IP9G 3L2PA 4A3KG 1YI2A 1Q7YC 4DR6L 4DV6L 3K7AH 4L5RC 3KFUA 1C0AA 1ASZA 3K81C 1YHBA 2ZTCA 1KRSA 4BXXG 3J80c 4C3HH 4LF8L 4UY8C 5DLQE 5GAEC 4A3BG 4GLXA 4DV7Q 1IBMQ 1L1OA 4HIDA 2GVBA 4ALPA 3J7ZC 3OTOL 1Y1WH 1XPRA 1E24A 4JI4L 3J7A5 2UUCL 4GLAC 5IP7H 4A3JG 1KIXA 2JA8G 5JJLA 2JJQA 4HIMA 4JI5Q 1WCMH 4P73A 3UDIA 5GAHC 2YYZA 5LMNL 4HJ9A 3S17H 1IBKL 1Q8KA 4A3LG 1Q81C 5IYDG 4B3SL 2RF4A 2KBNA 2WFWA 1I94L 1QZGA 3NENA 3K8AA 1GD7A 1A0IA 3E0EA 1J5EL 3PSIA 3GTKH 4L5QA 3G71A 4DPGA 1G51A 5C4XG 1K3RA 1K0RA 4TQUS 1MJEA 3S1NH 4B3MQ 4DV2Q 3CC2A 1XNQQ 1XPUA 4A3EH 1BKBA 2OQ0A 2VQEQ 4HJ7A 1N34L 3HOWG 3I4NH 4QL5A 1GVPA 3RN5A 2UU9Q 1IL2A 1HNWQ 3HOZH 2JA6G 1HJPA 5J3BA 3FHWA 4R4OA 3PF5A 3HOXH 5M5WH 4A3FH 2Q2IA 4LNQA 5ELNA 2ZJRA 1NTGA 4HIOA 1YHQA 4R4TA 3G4SA 3KF8B 3PO3G 3B6YA 1Q86C 3CD6A 1J6QA 3IRBA 3ULJA 4XIGS 5IYCG 1SRUA 5AJ3L 4DV4Q 2E2IH 3TREA 3HOWH 4YWMA 4OX9L 3HOZG 4JYAL 1CKMA 4JBMA 1IBLL 3CCSA 1YEZA 2QEXA 4LF4Q 4A93G 1Y14B 3LGJA 1LTLA 3PCOB 1X56A 3J81c 2D0PA 3K7UC 2QA4A 1VQBA 5IYDH 3KJPA 3CW2C 3CMEA 4LF6Q 2A1AA 1FGUA 2ID0A 2KHIA 1SLJA 1TWCH 3CCMA 1Y1VH 3S24A 1VQ4A 1XMQL 3BU2A 3S2HH 4Y52H 4DK6C 3AFQA 2OCEA 5C44H 4A75A 2NVXH 1PVOA 1WOCA 1A62A 2MFIA 4O2DA 5LMUL 3RZDH 4UPAA 1D7QA 1G291 2MO1A 4L5TA 1KXLA 2WP8J 4OO1G 4GKJL 2ZJPA 4QQBX 3BZKA 1W2BA 3S15H 5LMNW 1N33Q 2PI2E 4LUZA 2UXCL 1H95A 1I5FA 1YNXA 4OWTB 5JJKA 4GN3B 1C7YA 4PG3A 3HOUH 2C35B 2PNHA 1VS0A 5K36G 3RLOA 3ERSX 1U0LA 1NMGA 2EQSA 3S1MH 4POGA 1PFSA 1TWFH 2I0QA 1Y1VG 3CC7A 4LF7L 2JA6H 3H3VI 3U58A 4DUZQ 1IBLQ 3I4OA 4HJAA 1YJ9A 3S16H 3I55A 4JG2A 3PF4A 3M4OH 4OX9Q 4NPSA 4X64Q 4KHZA 1S40A 3ICEA 1CSQA 4IOAA 4DV4L 1TXYA 1XTDA 5C0XJ 1XJVA 4LFAQ 1AE3A 5M3MG 4A3GG 2VS1A 3CP0A 3GTJH 3OW2A 5IE8A 1W3SA 4LF5Q 1DGSA 5EAYA 4DUYQ 3PUXA 2B3GA 1SN8A 1VQIA 5FLMH 1YITA 4MZ9A 3W5OA 3U50C 4AQYL 3VDYA 4LF9L 3I4MH 2LXKA 1X9NA 4P75A 2YTXA 1YJNA 4UP9A 4DV0L 1JT8A 4DV2L 3RZOH 4X66L 2BA1A 4H02A 5ELOA 1VQAA 2K4KA 1S3OA 1Z47A 4LFCL 1B8AA 4ME3A 4LWCA 4DUYL 3WWVA 3A5UA 4MTNA 3UE1A 4BY7G 1JMCA 2D62A 3CCJA 3TEHB 1VQKA 4LFAL 4YY3Q 1CUKA 1Q82C 4A3BH 3PV0A 3GTGH 1NY4A 4OWXB 1IBKQ 1VQNA 1KC8C 2CCZA 5LMNQ 1X3EA 2F3IA 3ER0A 3KLWA 4JI5L 2Q2TA 1PH2A 2HHHQ 3EBEA 4JI3Q 3F2BA 1E3PA 2N78A 2VZAA 1OXSC 1CSPA 1VQ9A 4DR2L 3A74A 2CWPA 1S72A 1VQCA 2GN5A 5FLXc 4A3LH 3CPFA 2Z6KC 1EIFA 3AFPA 2PI2A 4DAMA 4IPHA 1EOVA 2R92H 4DV6Q 3GTLH 2HIXA 3NELA 1V1QA 4QIWE 4A4IA 1HZBA 3F2DA 2V1CC 2OWOA 1HR0W 5GADC 1T9HA 2CWAA 5M3FH 2PQAB 2R93H 2XTIA 3E9IA 3TS0A 2YU9H 1EUJA 2YV5A 3HKSA 3AYHB 2N49A 3Q8DA 5IYBH 5C0XG 4MNOA 1XMQQ 1VQGA 3UDGA 2JQOA 3L7ZC 4NXMQ 3M9BA 1D8LA 2B29A 1Q46A 4GS3A 2E5LL 1O7IA 4A93H 3HOYH 4JBJA 3CCUA 1NMFA 5C3EG 1HNZL 1SE8A 1KQSA 3PUVA 2BH8A 4LF4L 4JI6Q 3RN2A 1K8GA 1I50H 4X65Q 1CKNB 2JEBI 2ZJQA 3HFZB 3TQYA 2QGQA 3I4NG 1AH9A 1KAWA 4B3TQ 3S1RH 1VQFA 2NVTH 2F4VQ 1L2FA 1OXTA 2AMCB 3K0XA 2RHSB 2MNAA 4A3EG 2K14A 3AEVA 4AIMA 5BR8L 1QUQB 4BY1H 2UUBL 2R93G 4JI4Q 2AHOB 4JI6L 1HNWL 4PZ8A 1HNZQ 2UU9L 4P71A 4B3RQ 2JEAI 4KI0A 1PH1A 3JAMi 4BA1I 1UE6A 1EFWA 4YCVA 1FL0A 1X6OA 1RIPA 2L15A 4JI1L 3F8TA 4YHHL 2E5LQ 4GKKQ 4DR7Q 2UXDQ 4DV5Q 3ULPA 1TWHH 1R9TH 1XNRQ 3PO3H 1PH7A 1TWAH 4DR5L 1IZ6A 2LXJA 5JJIA 3H0GG 4GOPA 3UE0A 5IP7G 4P72A 2VQFQ 3KOJA 2BA0A 5GROA 1J5EQ 3M3YH 4JCVE 4AYBE 2OTJA 2Y0SG 4A3JH 1PYSB 2KENA 2R7DA 4LW1A 2JE6I 3JC66 1I94Q 4NXNL 1WFQA 1V9PA 2VUMG 3JAMc 4JBKA 2XGTA 3KF6B 1HR0Q 4OO1I 4TVAB 3CCRA 1Z9FA 4KLKA 2GVAA 1GO3E 2BH2A 4JOIA 4EQ5A 4JV5Q 2K75A 4IFDI 4R4IA 1VQJA 3OTOQ 4BBRH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KF6 A;  4DV7 L;  1YBY A;  4DNI A;  1B70 B;  4GNX A;  3RR5 A;  4DR2 Q;  1VQM A;  4LF8 Q;  1Q1E A;  3PIO A;  1PH3 A;  2R92 G;  3DLL A;  4JI3 L;  2R7Z H;  1VQO A;  2HHH L;  4WJ3 M;  1WJJ A;  1JB7 A;  4IFD J;  1PH5 A;  4IO9 A;  3CCE A;  2CQO A;  2IHE A;  3PUY A;  1FVI A;  3M7N A;  1JE5 A;  2UUA Q;  1PH4 A;  3E9H A;  1U5K A;  2KCT A;  1QVF A;  4KHP L;  4JC0 A;  4JI8 L;  4UP7 A;  1OXV A;  1VQD A;  4QY7 A;  1NJI C;  5C4J H;  3M85 A;  1K9M C;  4JI0 L;  4DV1 Q;  3MEF A;  3T1Y L;  3L0O A;  1X3F A;  2PMZ E;  2VQF L;  5IWA Q;  3TS2 A;  5HGQ A;  4LFC Q;  4HJ5 A;  2NVQ H;  1HZ9 A;  5M3M H;  3GDE A;  3UDF A;  4DK3 C;  1XNR L;  5H1S E;  3PO2 G;  3I7F A;  1UE5 A;  4YHH Q;  4A3D G;  4IFD G;  3G48 A;  4GKK L;  2UXD L;  3KDF A;  3T1H L;  4JI7 Q;  4OWW B;  4IOC A;  4DR1 Q;  2K5V A;  4QJF A;  4AQY Q;  3F1Z A;  4B3R L;  3CC4 A;  1WI5 A;  4A3C H;  3HOV H;  4BBS G;  5JEA G;  1VQ6 A;  4LF5 L;  4C2M H;  2JK8 A;  3K80 C;  2UUB Q;  1YIJ A;  5BR8 Q;  4LUO A;  2AWO A;  2NN6 I;  4AH6 A;  2ES2 A;  2FXQ A;  5E7N A;  2I5H A;  1MJC A;  4RG1 A;  3CCV A;  2F4V L;  4A3D H;  2Z6K A;  4LFB L;  1PYB A;  2EXD A;  3A0J A;  1KRT A;  1K8A C;  2A19 A;  2WB1 G;  1P8L A;  2K52 A;  2E2H H;  3GTQ H;  3A5Z B;  1JJ2 A;  3TRZ A;  2IY5 B;  1NBW A;  2PQA A;  4DR4 Q;  3EIV A;  1QVG A;  3FP9 A;  4OON A;  1E22 A;  4UP8 A;  2MQH A;  3AQQ A;  1VQL A;  2ASB A;  2OQK A;  4YWK A;  4A3G H;  5JEA J;  3BZC A;  2B63 H;  2WB1 E;  1VQH A;  1GM5 A;  3S1Q H;  1YVC A;  4HIK A;  4A3I H;  2JA5 H;  1E7Z A;  3S14 H;  5IY0 A;  3RLN A;  4DKA C;  3CMA A;  4GKJ Q;  2YTV A;  4DR3 L;  1Y1W G;  1HZA A;  1MKH A;  1PH9 A;  3GD7 A;  3J81 j;  2IX1 A;  3ULL A;  1JJG A;  5LMU Q;  4DAY B;  1UEB A;  4PZ6 A;  1HH2 P;  2NZO A;  4BXX H;  2Q2U A;  1FJG Q;  2AKW B;  1IYJ B;  4FDB A;  2I5M X;  1QVC A;  1VCI A;  1LM0 A;  1GKH A;  1HZC A;  5HY6 A;  1I6H H;  3CAM A;  4LF6 L;  5IP9 H;  2JA9 A;  2VUM H;  4C3J H;  4R1J A;  4C3I H;  5C0X I;  1CKO A;  1OXX K;  1BVS A;  2ZM6 L;  2EIF A;  3S2D H;  4IPC A;  1YJW A;  4IJL A;  2UXB Q;  1TWG H;  2JA5 G;  5C44 G;  3KYH C;  2MO0 A;  4IPD A;  3CCL A;  3CF5 A;  5GAG C;  2JA7 H;  2Z0S A;  4IJH A;  3SGI A;  3M4Q A;  4PZ7 A;  4JYA Q;  1N8R C;  1JJC B;  2H5X A;  1UE7 A;  3F2C A;  4LFB Q;  3FKI H;  3RNU A;  3W1G A;  1E1O A;  1BBU A;  3H3V H;  4YY3 L;  5FJ8 H;  2HQL A;  2RCN A;  5FLM G;  1HNX L;  1KL9 A;  1VQ7 A;  3U4V A;  3CPW A;  1L1O C;  2I5L X;  4BY7 H;  4K0K Q;  2ALY B;  4DV3 L;  4A3M H;  2K50 A;  4GN4 B;  3CCQ A;  4A76 A;  4DR1 L;  4JI7 L;  5IYC H;  4X66 Q;  1EIY B;  2ATW A;  3W1B A;  4DV0 Q;  3PUW A;  4QGU A;  5GQO A;  4PMW A;  3PIP A;  1MIU A;  3STB C;  3FKI G;  2IX0 A;  4NB3 A;  4LF9 Q;  4YWL A;  4A3F G;  1VQ5 A;  2DGY A;  4JOI C;  1KD1 C;  2JA7 G;  3HOV G;  4BBS H;  4DV3 Q;  4K0K L;  4A3C G;  4R4Q A;  1KHI A;  1A8V A;  1HNX Q;  4JI0 Q;  3HOY G;  4Y7N H;  3KDF B;  2VNU D;  4WJ4 A;  2WAQ G;  4KHP Q;  3H15 A;  1ASY A;  1PH8 A;  1VQE A;  2N3S A;  3D31 A;  3OYY A;  4X64 L;  2UUA L;  4X6A H;  1PV4 A;  5C4X H;  1N9W A;  4BA2 I;  2K5N A;  4DUZ L;  1XPO A;  2E2J H;  2OTL A;  4LF7 Q;  5M3F G;  1UE1 A;  1M1K C;  2UUC Q;  4O0A A;  1BBW A;  4GOP C;  4A3K H;  1WYD A;  2LSS A;  1AE2 A;  1PH6 A;  2UXB L;  2ZM6 Q;  1IBM L;  5M5X H;  4OXP A;  2RHQ B;  2HT1 A;  2A8V A;  2NVY H;  1WCM G;  4LUV A;  3G6E A;  1YHA A;  4JV5 L;  1V43 A;  4APV A;  4GLV B;  4A3I G;  2VY3 A;  2UXC Q;  2Y0S E;  1N33 L;  2NZH A;  2N8N A;  3EN2 A;  3CQZ H;  1HR0 L;  3GTP H;  4DR6 Q;  1SRO A;  1M90 C;  1UWV A;  4NXN Q;  4GNX B;  2B63 G;  3GTM H;  4DR3 Q;  4XTC S;  4BBR G;  1XMO L;  1OXU A;  4GNX C;  4JI2 L;  1FJG L;  1B7Y B;  3HOU G;  4X62 L;  4P74 A;  2NN6 G;  4AYB G;  5IT9 c;  4GN5 A;  4DR5 Q;  4YCW A;  1IXR A;  4RMF A;  1LYL A;  4YCU A;  2CFM A;  4DV5 L;  4DR7 L;  1X3G A;  2VL6 A;  1SR3 A;  1Q1B A;  4JI1 Q;  3ZJY C;  3KJO A;  1P16 A;  1LUZ A;  1E1T A;  3MXN B;  1EQR A;  4IPG A;  3BJU A;  4R4C A;  2IHF A;  2CKZ B;  1C9O A;  3GTO H;  1G6P A;  3I2Z A;  4DR4 L;  1N32 Q;  4L5S A;  3HOX G;  3J81 i;  4GOP B;  1N36 Q;  1Q12 A;  3H0G H;  1X54 A;  4EX5 A;  1EYG A;  1EQQ A;  3I56 A;  1NE3 A;  5AJ3 Q;  2DUD A;  1PA6 A;  2WAQ E;  3CXC A;  1YZ6 A;  3STB D;  3I4M G;  4B3T L;  3PO2 H;  5IYB G;  3NBH B;  3GO5 A;  4X65 L;  3J80 i;  1I3Q H;  1N36 L;  2HIV A;  3PUZ A;  1N32 L;  4BY1 G;  1A63 A;  4A3M G;  3DM3 A;  5M5Y H;  1QUQ A;  2IT1 A;  1X65 A;  1K83 H;  1RL2 A;  2R7F A;  3T1H Q;  1N34 Q;  1VQ8 A;  2VQE L;  2AWN A;  5FJ8 G;  4HJ8 A;  3HKZ E;  1XNQ L;  1SFO H;  1VQP A;  4B3M L;  2ZTD A;  2VW9 A;  2D0O A;  3NEM A;  3D0F A;  4J15 A;  1PHJ A;  4NXM L;  1K73 C;  1QZH A;  1CKN A;  2Q2H A;  2YTY A;  3M4P A;  5IWA L;  2R7Z G;  1EWI A;  4X62 Q;  1OTC A;  2ZTE A;  2JA8 H;  2KCM A;  4DV1 L;  3T1Y Q;  1L0W A;  5C3E H;  1L1O B;  1X55 A;  2F52 A;  2KHJ A;  3PGZ A;  3HKZ G;  4JI2 Q;  3UDX A;  4JI8 Q;  1XMO Q;  2R6G A;  3U4Z A;  4JBW A;  1SMX A;  2E8G A;  4POF A;  4B3S Q;  2K5H A;  3RLF A;  5IP9 G;  3L2P A;  4A3K G;  1YI2 A;  1Q7Y C;  4DR6 L;  4DV6 L;  3K7A H;  4L5R C;  3KFU A;  1C0A A;  1ASZ A;  3K81 C;  1YHB A;  2ZTC A;  1KRS A;  4BXX G;  3J80 c;  4C3H H;  4LF8 L;  4UY8 C;  5DLQ E;  5GAE C;  4A3B G;  4GLX A;  4DV7 Q;  1IBM Q;  1L1O A;  4HID A;  2GVB A;  4ALP A;  3J7Z C;  3OTO L;  1Y1W H;  1XPR A;  1E24 A;  4JI4 L;  3J7A 5;  2UUC L;  4GLA C;  5IP7 H;  4A3J G;  1KIX A;  2JA8 G;  5JJL A;  2JJQ A;  4HIM A;  4JI5 Q;  1WCM H;  4P73 A;  3UDI A;  5GAH C;  2YYZ A;  5LMN L;  4HJ9 A;  3S17 H;  1IBK L;  1Q8K A;  4A3L G;  1Q81 C;  5IYD G;  4B3S L;  2RF4 A;  2KBN A;  2WFW A;  1I94 L;  1QZG A;  3NEN A;  3K8A A;  1GD7 A;  1A0I A;  3E0E A;  1J5E L;  3PSI A;  3GTK H;  4L5Q A;  3G71 A;  4DPG A;  1G51 A;  5C4X G;  1K3R A;  1K0R A;  4TQU S;  1MJE A;  3S1N H;  4B3M Q;  4DV2 Q;  3CC2 A;  1XNQ Q;  1XPU A;  4A3E H;  1BKB A;  2OQ0 A;  2VQE Q;  4HJ7 A;  1N34 L;  3HOW G;  3I4N H;  4QL5 A;  1GVP A;  3RN5 A;  2UU9 Q;  1IL2 A;  1HNW Q;  3HOZ H;  2JA6 G;  1HJP A;  5J3B A;  3FHW A;  4R4O A;  3PF5 A;  3HOX H;  5M5W H;  4A3F H;  2Q2I A;  4LNQ A;  5ELN A;  2ZJR A;  1NTG A;  4HIO A;  1YHQ A;  4R4T A;  3G4S A;  3KF8 B;  3PO3 G;  3B6Y A;  1Q86 C;  3CD6 A;  1J6Q A;  3IRB A;  3ULJ A;  4XIG S;  5IYC G;  1SRU A;  5AJ3 L;  4DV4 Q;  2E2I H;  3TRE A;  3HOW H;  4YWM A;  4OX9 L;  3HOZ G;  4JYA L;  1CKM A;  4JBM A;  1IBL L;  3CCS A;  1YEZ A;  2QEX A;  4LF4 Q;  4A93 G;  1Y14 B;  3LGJ A;  1LTL A;  3PCO B;  1X56 A;  3J81 c;  2D0P A;  3K7U C;  2QA4 A;  1VQB A;  5IYD H;  3KJP A;  3CW2 C;  3CME A;  4LF6 Q;  2A1A A;  1FGU A;  2ID0 A;  2KHI A;  1SLJ A;  1TWC H;  3CCM A;  1Y1V H;  3S24 A;  1VQ4 A;  1XMQ L;  3BU2 A;  3S2H H;  4Y52 H;  4DK6 C;  3AFQ A;  2OCE A;  5C44 H;  4A75 A;  2NVX H;  1PVO A;  1WOC A;  1A62 A;  2MFI A;  4O2D A;  5LMU L;  3RZD H;  4UPA A;  1D7Q A;  1G29 1;  2MO1 A;  4L5T A;  1KXL A;  2WP8 J;  4OO1 G;  4GKJ L;  2ZJP A;  4QQB X;  3BZK A;  1W2B A;  3S15 H;  5LMN W;  1N33 Q;  2PI2 E;  4LUZ A;  2UXC L;  1H95 A;  1I5F A;  1YNX A;  4OWT B;  5JJK A;  4GN3 B;  1C7Y A;  4PG3 A;  3HOU H;  2C35 B;  2PNH A;  1VS0 A;  5K36 G;  3RLO A;  3ERS X;  1U0L A;  1NMG A;  2EQS A;  3S1M H;  4POG A;  1PFS A;  1TWF H;  2I0Q A;  1Y1V G;  3CC7 A;  4LF7 L;  2JA6 H;  3H3V I;  3U58 A;  4DUZ Q;  1IBL Q;  3I4O A;  4HJA A;  1YJ9 A;  3S16 H;  3I55 A;  4JG2 A;  3PF4 A;  3M4O H;  4OX9 Q;  4NPS A;  4X64 Q;  4KHZ A;  1S40 A;  3ICE A;  1CSQ A;  4IOA A;  4DV4 L;  1TXY A;  1XTD A;  5C0X J;  1XJV A;  4LFA Q;  1AE3 A;  5M3M G;  4A3G G;  2VS1 A;  3CP0 A;  3GTJ H;  3OW2 A;  5IE8 A;  1W3S A;  4LF5 Q;  1DGS A;  5EAY A;  4DUY Q;  3PUX A;  2B3G A;  1SN8 A;  1VQI A;  5FLM H;  1YIT A;  4MZ9 A;  3W5O A;  3U50 C;  4AQY L;  3VDY A;  4LF9 L;  3I4M H;  2LXK A;  1X9N A;  4P75 A;  2YTX A;  1YJN A;  4UP9 A;  4DV0 L;  1JT8 A;  4DV2 L;  3RZO H;  4X66 L;  2BA1 A;  4H02 A;  5ELO A;  1VQA A;  2K4K A;  1S3O A;  1Z47 A;  4LFC L;  1B8A A;  4ME3 A;  4LWC A;  4DUY L;  3WWV A;  3A5U A;  4MTN A;  3UE1 A;  4BY7 G;  1JMC A;  2D62 A;  3CCJ A;  3TEH B;  1VQK A;  4LFA L;  4YY3 Q;  1CUK A;  1Q82 C;  4A3B H;  3PV0 A;  3GTG H;  1NY4 A;  4OWX B;  1IBK Q;  1VQN A;  1KC8 C;  2CCZ A;  5LMN Q;  1X3E A;  2F3I A;  3ER0 A;  3KLW A;  4JI5 L;  2Q2T A;  1PH2 A;  2HHH Q;  3EBE A;  4JI3 Q;  3F2B A;  1E3P A;  2N78 A;  2VZA A;  1OXS C;  1CSP A;  1VQ9 A;  4DR2 L;  3A74 A;  2CWP A;  1S72 A;  1VQC A;  2GN5 A;  5FLX c;  4A3L H;  3CPF A;  2Z6K C;  1EIF A;  3AFP A;  2PI2 A;  4DAM A;  4IPH A;  1EOV A;  2R92 H;  4DV6 Q;  3GTL H;  2HIX A;  3NEL A;  1V1Q A;  4QIW E;  4A4I A;  1HZB A;  3F2D A;  2V1C C;  2OWO A;  1HR0 W;  5GAD C;  1T9H A;  2CWA A;  5M3F H;  2PQA B;  2R93 H;  2XTI A;  3E9I A;  3TS0 A;  2YU9 H;  1EUJ A;  2YV5 A;  3HKS A;  3AYH B;  2N49 A;  3Q8D A;  5IYB H;  5C0X G;  4MNO A;  1XMQ Q;  1VQG A;  3UDG A;  2JQO A;  3L7Z C;  4NXM Q;  3M9B A;  1D8L A;  2B29 A;  1Q46 A;  4GS3 A;  2E5L L;  1O7I A;  4A93 H;  3HOY H;  4JBJ A;  3CCU A;  1NMF A;  5C3E G;  1HNZ L;  1SE8 A;  1KQS A;  3PUV A;  2BH8 A;  4LF4 L;  4JI6 Q;  3RN2 A;  1K8G A;  1I50 H;  4X65 Q;  1CKN B;  2JEB I;  2ZJQ A;  3HFZ B;  3TQY A;  2QGQ A;  3I4N G;  1AH9 A;  1KAW A;  4B3T Q;  3S1R H;  1VQF A;  2NVT H;  2F4V Q;  1L2F A;  1OXT A;  2AMC B;  3K0X A;  2RHS B;  2MNA A;  4A3E G;  2K14 A;  3AEV A;  4AIM A;  5BR8 L;  1QUQ B;  4BY1 H;  2UUB L;  2R93 G;  4JI4 Q;  2AHO B;  4JI6 L;  1HNW L;  4PZ8 A;  1HNZ Q;  2UU9 L;  4P71 A;  4B3R Q;  2JEA I;  4KI0 A;  1PH1 A;  3JAM i;  4BA1 I;  1UE6 A;  1EFW A;  4YCV A;  1FL0 A;  1X6O A;  1RIP A;  2L15 A;  4JI1 L;  3F8T A;  4YHH L;  2E5L Q;  4GKK Q;  4DR7 Q;  2UXD Q;  4DV5 Q;  3ULP A;  1TWH H;  1R9T H;  1XNR Q;  3PO3 H;  1PH7 A;  1TWA H;  4DR5 L;  1IZ6 A;  2LXJ A;  5JJI A;  3H0G G;  4GOP A;  3UE0 A;  5IP7 G;  4P72 A;  2VQF Q;  3KOJ A;  2BA0 A;  5GRO A;  1J5E Q;  3M3Y H;  4JCV E;  4AYB E;  2OTJ A;  2Y0S G;  4A3J H;  1PYS B;  2KEN A;  2R7D A;  4LW1 A;  2JE6 I;  3JC6 6;  1I94 Q;  4NXN L;  1WFQ A;  1V9P A;  2VUM G;  3JAM c;  4JBK A;  2XGT A;  3KF6 B;  1HR0 Q;  4OO1 I;  4TVA B;  3CCR A;  1Z9F A;  4KLK A;  2GVA A;  1GO3 E;  2BH2 A;  4JOI A;  4EQ5 A;  4JV5 Q;  2K75 A;  4IFD I;  4R4I A;  1VQJ A;  3OTO Q;  4BBR H; 
#chains in the Genus database with same CATH topology
 4DV7 L;  5KFW A;  4GNX A;  2FFK B;  1KJI A;  4DR4 H;  2R92 G;  3V4S A;  1DOL A;  4C1N K;  1VQO A;  1DM0 B;  3DXJ C;  1WJJ A;  1BXT A;  4HNV A;  3SXH A;  3T13 A;  2LMC B;  1KDC A;  1JE5 A;  2Z4I A;  3C2P A;  3E9H A;  2OT2 A;  4KHP L;  2AUJ D;  4R7R A;  4UP7 A;  3U9T A;  3SI8 A;  4DV1 Q;  2OH2 A;  2XSC A;  2PMZ E;  4HSV A;  2RGR A;  2JN4 A;  2A6H D;  4XYL B;  4JI7 H;  4LFC Q;  4MV9 A;  3OWF A;  1EWH A;  2NVQ H;  1I3Q A;  5M3M H;  3N44 B;  4YHH Q;  1UE5 A;  3G48 A;  3KDF A;  3T1H L;  1Q90 A;  4DV6 H;  4Q44 A;  1GHK A;  3P7J A;  1WI5 A;  1T5E A;  3HOV H;  1VQ6 A;  4LF5 L;  2JK8 A;  3K80 C;  2R86 A;  2B2V C;  2EYH A;  4LUO A;  5EZY F;  3K3P A;  1KNA A;  1EIG A;  4RG1 A;  5CV7 A;  3A8K E;  4A3D H;  2Z6K A;  2UUB H;  3OIP A;  4N9T A;  1K3B C;  1KRT A;  2E2H H;  4B3M H;  4A3I B;  1AP0 A;  3GTQ H;  1B44 D;  3A5Z B;  1IOW A;  4EFE A;  3KUP A;  1S68 A;  5K2M A;  1QVG A;  1SE2 A;  1DV1 A;  4DNR B;  2MQH A;  3FKI B;  4YWK A;  1T3N A;  5IT9 E;  2M2L A;  4ULL A;  1U4R A;  2WB1 E;  2NVX A;  2WE6 A;  4YAK B;  1YVC A;  2EPB A;  1Y69 U;  5LL6 b;  3KTM A;  4RKL A;  2P5Z X;  1AN8 A;  3RLN A;  2XCA A;  2YTV A;  5A35 A;  1Y1W G;  2HCC A;  2HHH H;  1S0O A;  2KHS A;  3LX0 A;  1UEB A;  2F0L A;  5FLX E;  2NZO A;  2X69 A;  1LO5 D;  1Z2P X;  1QVC A;  1VCI A;  2W9B B;  1GKH A;  1UEA B;  1Z7T A;  4DFA A;  3IL8 A;  3VYR A;  5KG7 A;  3CAM A;  2NVT B;  3E3X A;  4R1J A;  4C3I H;  3K5O A;  4J8Q A;  1R9T B;  4IUR A;  2EIF A;  4IPC A;  1F2Z A;  2LFN A;  4IJL A;  4XX0 B;  2NZ1 D;  4NKL A;  3ND9 A;  4DF7 A;  4QWE A;  1SCU B;  4ED7 A;  2OLS A;  5GAG C;  3MJF A;  2NYZ D;  2NVX B;  2VB2 X;  2PBZ A;  3F2C A;  1Y1W A;  2K5Q A;  2K5W A;  5C5L A;  2PW7 A;  3PR5 B;  1E1O A;  4DU9 A;  3HOW B;  4DR5 H;  5FJ8 H;  3FKI A;  2RCN A;  4IUN A;  1HNX L;  5FO9 B;  1VQ7 A;  1E4G T;  3T1H H;  3CQZ A;  3QB3 A;  1KAA A;  4DV3 L;  2O03 A;  4TV9 F;  2DJF C;  2KVM A;  3CCQ A;  2UXB H;  4A76 A;  2FK1 A;  4KN4 C;  3W1B A;  2DIK A;  2XIG A;  4PMW A;  3BAA A;  2HDM A;  3FKI G;  1BF4 A;  3RB6 A;  4YWL A;  4A3F G;  2DGY A;  4JOI C;  1KD1 C;  4PMB A;  1WCM A;  4JI8 H;  3HOV G;  2ZDQ A;  1VMC A;  1ZXT A;  4DV3 Q;  4QWB A;  4CDC C;  1KHI A;  1JIH A;  1HNX Q;  3BG3 A;  3VR6 A;  3J7A F;  2VNU D;  3HKZ A;  4XT3 B;  1HTP A;  4A3B B;  2A5H A;  1VQE A;  4C1N I;  3TP6 A;  1K83 A;  2IX3 A;  1N9W A;  5J2T F;  1YNJ D;  1II3 A;  4M1U B;  4BWS C;  1M1K C;  2CW8 A;  2PO4 A;  4O0A A;  5CGK A;  1KDB A;  4GC7 A;  1AE2 A;  1X32 A;  3NK9 A;  3GIM A;  2KJX A;  5JH7 F;  3HP3 A;  1GXD C;  2W7O A;  5D1O B;  4R8I A;  5EKL A;  2NVY H;  2PVP A;  3J7A V;  2V4R A;  2XWJ B;  3MR6 A;  1CZG A;  3BA8 A;  5KFS A;  5KFO A;  2JA5 B;  5COY A;  1HRJ A;  3T5L A;  1HR0 L;  2BDO A;  1B4O A;  1OWT A;  1XMO L;  1D2B A;  1W6J A;  3A7A B;  3MR5 A;  3S9W A;  1B6R A;  4H44 C;  1MSG A;  4GN5 A;  4RCN A;  4YCU A;  2CFM A;  3Q8P B;  1LT4 D;  4KJN A;  2RDI A;  2R8G A;  4DV5 L;  3KAL A;  1X3G A;  1SJH D;  2VL6 A;  3D8G A;  4JI5 H;  2NB0 A;  3KF8 A;  5JJZ A;  2UVU A;  4JI3 H;  2F0Q A;  3GTO H;  2FJZ A;  3HOX G;  1N36 Q;  2TMP A;  2Y0S A;  1W93 A;  1B33 N;  1I4P A;  3QWN A;  4CDE C;  1NE3 A;  3I56 A;  1DCZ A;  3I4L A;  1RJT A;  4OL7 A;  4PQX A;  2FMA A;  3PO2 H;  5IYB G;  1LTR D;  1A3T A;  3OUZ A;  1N36 L;  1I3Q H;  2F0E A;  1TAE A;  3BDC A;  2HJW A;  2R87 A;  1TWA A;  1K83 H;  3T56 B;  3T1H Q;  1JOK A;  2DLN A;  1N33 H;  2VQE L;  4HJ8 A;  5FJ8 G;  4F7X A;  2ZTD A;  3UQ8 A;  4ODG A;  1NCV A;  3D0F A;  4RWS C;  1PHJ A;  2CZG A;  3RF2 A;  5JVL A;  2QEJ C;  2ZTE A;  4ZKC B;  4DV1 L;  4EEQ A;  5C3E H;  1X55 A;  3UDX A;  4CGY B;  1XMO Q;  1VKZ A;  5CV6 A;  5KFC A;  1SMX A;  3PO2 B;  3MXP A;  3R5X A;  3G6Y A;  1YI2 A;  4NXM H;  1C0A A;  3KFU A;  2M05 A;  4NP5 A;  3K81 C;  1YHB A;  4C2M A;  1Q3L A;  4HYK A;  4DA2 A;  5KG2 A;  1HFN A;  3TZD A;  4FM9 A;  4UDU C;  3KHL A;  2FMC A;  4DV7 Q;  2ATL A;  1Y1W H;  4HID A;  2E2H B;  5JOB A;  1NUC A;  3JAM E;  1S5D D;  1PYW D;  2ZXO A;  2JA8 B;  3NTK A;  4TRD A;  2A69 D;  2VPQ A;  4ED1 A;  3V6K A;  1Q8K A;  4A3L G;  2RF4 A;  5DEH A;  4PNY A;  2M00 A;  2IW3 A;  5C1O A;  4MTD A;  4RU9 A;  3K8A A;  1GD7 A;  3I8Z A;  4R8N A;  2YRX A;  1J5E L;  4U67 3;  1CQV A;  3GTK H;  4DR7 H;  4L5Q A;  1IOV A;  3NBH A;  1FNV A;  2NU7 B;  1I6V C;  5KG6 A;  5C4X G;  3KLS A;  1MJE A;  4B3M Q;  1TII D;  1UUP A;  3EJI A;  3I73 A;  4RHS A;  1N34 L;  2HVR A;  2R8H A;  1GVP A;  4K14 A;  1N48 A;  4JI2 H;  2C9O A;  4MTE A;  1M6V A;  1HJP A;  3PVX A;  1SYC A;  4YIJ A;  4A3F H;  4YJ2 F;  4C56 C;  4HIO A;  3MXN A;  4IUQ A;  4TQS A;  5DLF A;  3KF8 B;  3M9N B;  3W2D A;  3PO3 G;  1Q86 C;  3CD6 A;  1J6Q A;  3IRB A;  5AJ3 L;  4JV1 A;  3CVZ A;  1SRU A;  3JAM W;  4LF7 H;  4IQZ A;  4ZRZ A;  1G91 A;  1Z2O X;  2IP4 A;  4JBM A;  1IBL L;  4OIK A;  3PIO 3;  1YEZ A;  2JA7 B;  3GTQ A;  4G3I A;  2HD3 A;  3J81 c;  1W96 A;  4C5A A;  5IYD H;  4CC5 A;  4RGN A;  3GTM B;  3VYU A;  2AQ2 B;  3F8N A;  1TWC H;  5KT4 A;  2A73 B;  3S24 A;  4HCS A;  3S2H H;  1HTL D;  1EL0 A;  3OOC A;  4DK6 C;  1GHJ A;  5G3L D;  2OCE A;  4A75 A;  5ELC A;  3MR2 A;  4O2D A;  4HN7 A;  4IUT A;  5FKA C;  1B2T A;  2HQE A;  1D7Q A;  1CQF A;  2FKL A;  5F9L A;  5KT5 A;  2ZJP A;  1W2B A;  3S15 H;  1KLU D;  3S2D B;  1N33 Q;  2UXC L;  4LUZ A;  3BQ0 A;  1H95 A;  4DR1 H;  4E6I A;  1AN7 A;  2F3W A;  2VR1 A;  4QIW A;  5KG0 A;  2PNH A;  1L0Y B;  1FD7 D;  1U0L A;  5KFN A;  3QG1 A;  4POG A;  1PFS A;  4JYA H;  2I0Q A;  4OX9 H;  2FB9 A;  4KKT A;  1Y1V G;  2A6E D;  2WKD A;  4FF3 A;  2JA6 H;  4O3R A;  1X3Q A;  3I55 A;  1UNS A;  4RUA A;  2I46 A;  1STA A;  1Y8N B;  4KY7 A;  1S40 A;  4TUY F;  5J39 A;  1B04 A;  1TXY A;  1M7J A;  2JA7 A;  4LF5 Q;  1W3S A;  4FP5 D;  1UC9 A;  3JSN A;  4K2K A;  1XX8 A;  2B3G A;  1VQI A;  4BBR H;  3FPP A;  4MZ9 A;  2AGP A;  1EY8 A;  2LXK A;  3Q2O A;  4UP9 A;  3N40 P;  2RSO A;  4DV2 L;  4DK1 A;  1I4H A;  2EY5 A;  2AQ4 A;  1PRT F;  4LFC L;  5KG5 A;  1B8A A;  4B9X A;  3WWV A;  5DG7 A;  3A5U A;  5JQW A;  2QDB A;  1JMC A;  3GTP B;  1VQK A;  3E0J A;  1R9T A;  3KBG A;  3KK7 A;  1LTA D;  4FO2 A;  5LL6 X;  3GTG H;  1IBK Q;  1PRT C;  4ABN A;  4FU0 A;  5KT2 A;  2W9B A;  1SYX B;  1PH2 A;  3WO0 A;  3BAB A;  2NN6 H;  1VF5 C;  4CDD C;  2B2U A;  1F2L A;  4DAY A;  1SEI A;  1S72 A;  1GYF A;  4A3L H;  3RB3 A;  1STH A;  1SMY D;  5C8Y F;  1ESR A;  1WR2 A;  1ULZ A;  3AFP A;  3PR4 A;  2WTF A;  1N34 H;  5IOD A;  1TWG A;  4DAM A;  4IPH A;  1EOV A;  5T1I A;  3M4Y A;  2R92 H;  3R23 A;  5D1P A;  1V1Q A;  3J81 W;  2K05 A;  3DM1 A;  1SFO A;  1EHI A;  5E3F A;  1HR0 W;  1DV2 A;  5GAD C;  4EGQ A;  2CWA A;  2W6M A;  3F2U A;  3GTJ B;  2YU9 H;  3J7A 5;  2WDT A;  3HKS A;  2OXP A;  5I4D A;  3L7Z C;  5KFI A;  3PZP A;  1Q46 A;  3CRK C;  4GS3 A;  4K0K H;  3OHX C;  2E5L L;  1O7I A;  2F0T A;  2Q8R E;  4HNU A;  1HCZ A;  2HVQ A;  1HNZ L;  1I4G A;  1CA6 A;  3I4N B;  2PMZ A;  5BPH A;  5G3L F;  5KFE A;  4JI6 Q;  4IAJ A;  4EBC A;  4O1N A;  2ENB A;  3K58 A;  4ED2 A;  3GV6 A;  3VA5 A;  3HFZ B;  5KFK A;  4FNF A;  1PLF A;  5C3E B;  3M4O B;  1KAW A;  4B3T Q;  1VQF A;  5DGB A;  1AEX A;  1OXT A;  2AMC B;  3K0X A;  3OSN A;  1QUQ B;  4BY1 H;  2UUB L;  3NPP A;  2F4V H;  1A3U A;  2AHO B;  1PFN A;  1HPC A;  1R4Q B;  2PCF B;  3VR5 A;  4KI0 A;  4C3H B;  1UE6 A;  1EFW A;  1I4X A;  1BOS A;  3K0Y A;  2N88 A;  5KRU A;  3JRW A;  3F8T A;  3PO3 H;  1VBG A;  1PH7 A;  4X3S A;  1FJG H;  1TWA H;  1DXM A;  3GTK B;  2LXJ A;  1U4P A;  5CC4 A;  4GOP A;  1UAP A;  5IP7 G;  2VQF Q;  1JB3 A;  3KOJ A;  2BA0 A;  3M3Y H;  4APM A;  1STE A;  5C6A A;  4DLK A;  4A3J H;  4X3T A;  2W70 A;  2B2V A;  1PYS B;  2KEN A;  2MP1 A;  2V4D A;  1WTW A;  1QB5 D;  3JC6 6;  3K5L A;  2XC9 A;  4NXN L;  1N32 H;  1WFQ A;  1V9P A;  2Z6B A;  3ETH A;  1S97 A;  2XGT A;  3KF6 B;  3K7A B;  3PMF A;  2JEF A;  4DL4 A;  4O42 A;  5LHY 1;  4F4X A;  3CCR A;  4KLK A;  4JI1 H;  4JOI A;  4JV5 Q;  4MV4 A;  1LLR D;  2G5D A;  2NU8 B;  1TWC A;  4OO1 H;  1BUV T;  1YBY A;  3TP5 A;  1TR5 A;  2PW5 A;  4MV6 A;  1B70 B;  3TIN A;  3D4W A;  4DR2 Q;  1LT6 D;  1PH3 A;  4Z9C B;  3DLL A;  4JI3 L;  4BY1 B;  2R7Z H;  3PQI A;  1JB7 A;  1PH5 A;  4I50 F;  4YQW A;  3J7A K;  1FVI A;  5M5Y B;  2SEB D;  2UUA Q;  1KJ9 A;  4CC6 A;  1YNN D;  2ZJT A;  4FBU A;  2F4I A;  4JC0 A;  1A6X A;  3CKI B;  1VQD A;  4JI0 L;  5C4J H;  3M85 A;  1K9M C;  4OGQ C;  3L0O A;  3WDN A;  2HDL A;  1ZQ7 A;  2QCP X;  2WKC A;  5H1S E;  3PO2 G;  4RUC A;  4F4W A;  3I7F A;  2KEE A;  4A3D G;  2UXD L;  1PK8 A;  1HUN A;  2RDJ A;  4RZR A;  4OWW B;  2M9V A;  3NHH A;  4AQY Q;  3VPD A;  3JSL A;  4ZHQ F;  4K6L A;  2EJM A;  5BR8 Q;  4MTK A;  3Q24 A;  4C3I G;  2NN6 I;  4KKU A;  4ECQ A;  5NUC A;  2FXQ A;  4LSA A;  1MJC A;  2VQF H;  2F4V L;  4ZOL F;  4LFB L;  4I7Z C;  2EXD A;  2B8F A;  2K52 A;  1STB A;  4LJZ C;  2IY5 B;  1NBW A;  3A56 A;  3N42 B;  1E22 A;  4UP8 A;  4EYI B;  3AQQ A;  3RV4 A;  5KFA A;  3X3N A;  4CJ2 C;  3NXW A;  3BZC A;  3Q8R B;  1Y1W B;  4UCU A;  4QCL A;  2C00 A;  4LMQ D;  1WTX A;  1VQH A;  4L63 B;  1TWG B;  4HIK A;  1HFG A;  2PZU A;  4I55 F;  1E7Z A;  3S14 H;  5IY0 A;  3K5H A;  3EFX D;  3CMA A;  4G7Z C;  4DR3 L;  2FP4 B;  2YS7 A;  1PH9 A;  1JJG A;  5LMU Q;  4BXX H;  2Q2U A;  2FLN A;  2QK4 A;  2K33 A;  3I70 A;  2L5T A;  4FDB A;  2I5M X;  4NXN H;  1JQY D;  1LM0 A;  5FO7 B;  4IZO A;  5L37 A;  5CMD A;  1I6H H;  2XCP A;  5IP9 H;  2JA9 A;  3SDZ A;  3SK4 A;  4C3J H;  2I8C A;  5C0X I;  1CKO A;  1OXX K;  1BVS A;  2DJG C;  4LK1 C;  5L1J A;  4JVZ A;  2UXB Q;  1YJW A;  4ETS A;  3GTP A;  2JA5 G;  1K8O A;  1B3A A;  5A2Q L;  1G8Z D;  2PPB C;  2MO0 A;  4HTH A;  4IPD A;  5KFU A;  4HAE A;  4DL3 A;  1G2S A;  4DR2 H;  4JYA Q;  1N8R C;  3VR3 A;  1UE7 A;  4LFB Q;  4WFN 3;  1B50 A;  3W1G A;  4XQN A;  2E2I B;  4IUV A;  5DG9 A;  2HQL A;  2RQX A;  5FLM G;  1MSH A;  1SE4 A;  2WV6 D;  2I5L X;  1D5M C;  3A8I E;  4A3M H;  1K8M A;  4RAU C;  4DNT B;  2K50 A;  4GN4 B;  3MWY W;  2W9C A;  4Y8V B;  5IYC H;  4X66 Q;  1EIY B;  1FR3 A;  2ATW A;  2WAQ A;  3PUW A;  1B9N A;  5GQO A;  4QGU A;  4DUZ H;  2OEO A;  3N41 B;  3STB C;  5BR8 H;  3U9S A;  1VQ5 A;  4I4T F;  4GKJ H;  5F9N A;  3S15 B;  1QWY A;  2RDH A;  3HS0 C;  3TQT A;  2XGP A;  1HXY D;  3V05 A;  2UVR A;  1A8V A;  4AQY H;  4JI0 Q;  4X3K A;  1M0W A;  2WAQ G;  4UHV A;  2UUA L;  3D31 A;  2N3S A;  5C3X A;  4X64 L;  2K1B A;  2FJ2 A;  4BA2 I;  4DUZ L;  1XPO A;  2OTL A;  3M3Y B;  4O4I F;  1LV9 A;  1SNC A;  4BBS B;  2UUC Q;  5IIF A;  4GOP C;  2LSS A;  1LTB D;  2B2U C;  1IBM L;  5M5X H;  3BVG A;  3OHA A;  1V1O A;  1WCM G;  5BN3 A;  4JV5 L;  2A68 D;  3M7G A;  4GLV B;  2QIL A;  2VY3 A;  4ZUJ A;  4RKB A;  4Y7N B;  4MA5 A;  5J1Z A;  3GTP H;  1SRO A;  3JAM L;  3KHR A;  1UWV A;  4NXN Q;  3GTM H;  1XDN A;  4QWA A;  1OXU A;  1PX2 A;  3M9O B;  2YZM A;  2A6E C;  3RJ0 A;  3RTX A;  1IXR A;  2EYJ A;  4RMF A;  2E2D C;  5BN5 A;  3VPC A;  4ZAI A;  1GOZ A;  3S1M B;  1SR3 A;  5KFD A;  2DNE A;  2L55 A;  1LUZ A;  1E1T A;  3MXN B;  1EQR A;  1PTO H;  1Y8P B;  4DR4 L;  2YU9 B;  5IT9 L;  3GID A;  1Q12 A;  2ZDH A;  1RF2 D;  4EX5 A;  1WSC A;  3C1E A;  2RVL A;  4KD4 A;  2SDF A;  5DNF A;  3OUU A;  1IBL H;  4B3T L;  1UNN C;  1U9R A;  4X66 H;  2C22 A;  1N32 L;  4BY1 G;  3DM3 A;  5M5Y H;  3QOL A;  1QUQ A;  2NVY A;  5DGA A;  4HMI A;  1X65 A;  4XQQ A;  1VQ8 A;  1W6K A;  2AWN A;  3H3V C;  3DF7 A;  3RIZ A;  3BDL A;  5ELF A;  1WTQ A;  1SFO H;  1PDQ A;  3R2I A;  2D0O A;  2VW9 A;  4ECU A;  1K73 C;  1IW7 D;  1MI2 A;  4NW2 A;  1EWI A;  4X62 Q;  2R93 B;  1PZK D;  1C8C A;  2JA8 H;  2KCM A;  2PMZ B;  3T1Y Q;  4UCR A;  4L8J A;  1L1O B;  2CVR A;  4JI2 Q;  4WD3 A;  1S0N A;  3ITP A;  4A2A A;  4JI8 Q;  1JC7 A;  1L0X B;  2R6G A;  3U4Z A;  4JBW A;  4JI6 H;  3OSP A;  5IP9 G;  2MHV A;  4RGO S;  1CZW A;  4A3K G;  2FHT A;  4DR6 L;  5BPF A;  1TS3 A;  3K7A H;  4L5R C;  5C1P A;  4C2M B;  2UXD H;  1Y8O B;  3K5I A;  1KRS A;  4BXX G;  2J0T D;  1ZYR C;  1T5X D;  2EXZ A;  4LF8 L;  1M0T A;  5GAE C;  3G8C A;  2B2T A;  2RDF A;  2L1B A;  4GLX A;  1AZP A;  4BY7 H;  1HNZ H;  1E24 A;  1KIX A;  2EYL A;  4KMU C;  5D3I B;  4ZUI A;  3S17 H;  2R7N A;  1IBK L;  5IYD G;  1HQR D;  5C5M A;  4CJ0 B;  4O3N A;  1I94 L;  1QZG A;  2ZXR A;  1KAB A;  3D4R A;  4EGJ A;  2W6Q A;  1A0I A;  3SVM A;  2XGQ A;  1VBH A;  1K3R A;  1B1Z A;  4TQU S;  3S1N H;  4FF1 A;  4A2B A;  4DV2 Q;  2G9D A;  4A3E H;  2OQ0 A;  2R8J A;  3I4N H;  4QL5 A;  5FPR A;  2Y0S B;  4RNO A;  2UU9 Q;  3RB0 A;  2E74 C;  1HNW Q;  3RFC A;  4ED3 A;  2R7Z B;  2PN1 A;  3C46 A;  3FHW A;  5KIX A;  3PF5 A;  4UFZ A;  5ELN A;  2ZDG A;  3G4S A;  5JVG 3;  3N8D A;  2FK2 A;  3KLS X;  4G4K A;  3ULJ A;  4J9S A;  4XIG S;  1LTT D;  1TKW B;  2I07 B;  4X65 H;  4FBT A;  4YWM A;  3HOZ G;  2B2Y C;  1F9R A;  1CA5 A;  3C3L A;  2QEX A;  4LF4 Q;  4EG0 A;  5CB4 F;  1LTL A;  1BO0 A;  3H20 A;  2J7Z A;  2D0P A;  1GSO A;  3K7U C;  1VQB A;  1H9M A;  3CME A;  2A1A A;  1FGU A;  1A2T A;  3GIJ A;  2UUA H;  3CCM A;  2ASJ A;  1Y1V H;  1XMQ L;  4Y52 H;  2XRS D;  3BU2 A;  5LL6 S;  3PW4 A;  4G57 A;  4LF8 H;  2KA7 A;  5C44 H;  1WOC A;  1A62 A;  1KXL A;  3FMA A;  2K32 A;  3RZD H;  4UPA A;  5K36 H;  1G29 1;  1JE4 A;  4L5T A;  5L1K A;  2WP8 J;  1XMQ H;  4X62 H;  2XD4 A;  3BZK A;  3VR4 A;  3EPG A;  1PTO C;  2PI2 E;  5CV4 A;  5BMV F;  4K6D A;  5C0X H;  5JJK A;  4KV6 A;  1I4Q A;  5E4X A;  1D5Z C;  3WOE A;  1I6H B;  2F0I A;  4EBE A;  1K83 B;  3MHB A;  4X3U A;  2C35 B;  3Q8S B;  4GZY C;  5K36 G;  3RLO A;  3PW5 A;  4A93 B;  3S1M H;  1I7N A;  4ZQ3 A;  2BQ3 A;  3MWE A;  5LOV F;  3H3V I;  4DUZ Q;  1IBL Q;  3I4O A;  4HJA A;  3PF4 A;  4X64 Q;  4KHZ A;  3GQC A;  1F2Y A;  4IOA A;  2FMM A;  2W9A A;  4IR1 A;  2W8K A;  1AE3 A;  2X6L A;  2W9C B;  4MAM A;  2ZM6 H;  3GTJ H;  3GTQ B;  1H9J A;  1SN8 A;  3U50 C;  5LXT F;  3OHB A;  3MFY A;  1H9S A;  4P75 A;  1CFM A;  3URY A;  4OIJ A;  4X66 L;  4XT1 B;  2G9H D;  1VQA A;  1EUC B;  1IKM A;  4UCV A;  2CQY A;  4ME3 A;  1KEE A;  1RHP A;  4DUY L;  1JOR A;  4LFA H;  2SNM A;  2R7Z A;  1MBY A;  1I7L A;  3CCJ A;  4B08 A;  4LFA L;  4UCT A;  4DUY H;  3PV0 A;  5F2D A;  3V6J A;  2F0J A;  4C3I B;  4YR0 A;  1X3E A;  1Z6H A;  3Q1K A;  2F3I A;  3GIQ A;  3ER0 A;  3KLW A;  2Q2T A;  1LT3 D;  1D5X C;  3D3R A;  3F2B A;  1E2V A;  2VZA A;  3MA2 B;  2W6Z A;  3A74 A;  2VUM B;  4EYH B;  4PMC A;  2F0W A;  1S5F D;  3NTI A;  4RH6 A;  4DGZ A;  5EWF A;  3H0G B;  5JPM C;  1QNK A;  2I80 A;  3PW7 A;  1M8A A;  1ZYR D;  4QIW E;  5IWA H;  4A4I A;  4NLG A;  1BCP D;  2B2T C;  2OWO A;  1EZ6 A;  5D3D A;  5HGT A;  5M3F H;  4X64 H;  2PQA B;  4DK0 A;  3FEW X;  1ET9 A;  2XTI A;  2XWB B;  3TS0 A;  2YV5 A;  3NWS A;  5C0X G;  2N49 A;  4XYM B;  3M9B A;  3V96 A;  2ICE C;  4JBJ A;  1NMF A;  1K28 A;  1SE8 A;  3BVZ A;  1KQS A;  3PUV A;  2R93 A;  4Q8E A;  1M4V A;  3RN2 A;  3R8B A;  1XXG A;  1I50 H;  2ZJQ A;  5HUR A;  1AH9 A;  2F0P A;  2F4V Q;  5KFL A;  1L2F A;  5H80 A;  1CE8 A;  3BG5 A;  4F50 A;  4ECV A;  2J9G A;  4UAI A;  1TWA B;  5BR8 L;  1EZ1 A;  1TWF B;  1CK1 A;  3D6C A;  3OSO A;  5IOC A;  1QOH A;  2RDG A;  2VA2 A;  2B2W A;  4P71 A;  2FPG B;  1PH1 A;  1FYC A;  4BA1 I;  4BBR B;  3JRX A;  1KJ8 A;  1X6O A;  2FPI B;  1EU4 A;  2UXD Q;  2Z8L A;  4B9W A;  1C4Q A;  4KD3 A;  4NMZ A;  1TWH H;  4DV5 Q;  3ULP A;  1NSN S;  1WTO A;  1G2T A;  1JDB B;  1LAC A;  1QE6 A;  2WYO A;  5KNB A;  4B3R H;  5FD5 A;  1IZ6 A;  1PTO B;  3H0G G;  3UE0 A;  4GKK H;  4P72 A;  2JEJ A;  2OTJ A;  1E0B A;  4AYB E;  1XNR H;  1AFP A;  1BCP B;  4NDX A;  5HBR B;  4JV5 H;  2GPW A;  4WJW A;  4JBK A;  2LS0 1;  2VUM G;  1HR0 Q;  2EYF A;  3T1Y H;  4TVA B;  1EYD A;  1NR4 A;  4MV7 A;  5IT9 W;  2R8K A;  4EQ5 A;  4G7O C;  2BQU A;  3MFI A;  3P1H A;  4R4I A;  1VQJ A;  1RDP D;  3OTO Q;  2PNR C;  4JI4 Q;  3T5K A;  2EYM A;  2F0K A;  3RR5 A;  4IUU A;  4CDF C;  1Q1E A;  3PIO A;  3HOY B;  1JOO A;  1GSA A;  2BE5 D;  3E5N A;  2EJG C;  2HHH L;  2F0F A;  2L12 A;  1IBK H;  3HOU B;  2L9H A;  3GIL A;  5FPO A;  1U4M A;  5D1O A;  1IYV A;  1PH4 A;  4I7A A;  3MR3 A;  1U5K A;  2ALZ A;  3TDQ A;  5DG8 A;  4J9R A;  2C2R A;  4IR9 A;  4QY7 A;  5KGU A;  4IRC A;  2VQF L;  1WD1 A;  3Q6S A;  5IWA Q;  3TQ1 A;  3TS2 A;  5HGQ A;  4HJ5 A;  1E4F T;  5M5W B;  2V59 A;  5KFY A;  5IGB A;  1HZ9 A;  5KT3 A;  4JV2 A;  1GUG A;  4DK3 C;  2NTT A;  2FK3 A;  3JZI A;  2FPP B;  3HKZ B;  2YRW A;  4QJF A;  3GIP A;  3F1Z A;  4IZ8 A;  3NUC A;  1EOT A;  4CHT B;  4DR6 H;  4A3C H;  4ECZ A;  1EY5 A;  2UUB Q;  1BR9 A;  2AWO A;  4AH6 A;  2ES2 A;  3VMM A;  4ED8 A;  2I5H A;  3CCV A;  1EIH A;  2DN8 A;  1PYB A;  3V6H A;  3A0J A;  3MC0 B;  4A3M B;  1K8A C;  4QUF A;  2RCF A;  2EY1 A;  3FP9 A;  4OON A;  3S1N B;  2ASB A;  2OQK A;  1N36 H;  4PV1 C;  2E2I A;  2V9W A;  3K57 A;  5CV9 A;  4JI0 H;  1GM5 A;  4I65 A;  2ZT9 C;  5EWE A;  4A3I H;  4WOR A;  1SNQ A;  1CS0 A;  4DV7 H;  3N6X A;  4O3S A;  3GTO A;  4DKA C;  4GKJ Q;  3GV5 B;  1CTM A;  3H09 A;  1MKH A;  1HZA A;  3DWA A;  4C3J G;  5KT6 A;  2IX1 A;  2W6O A;  1E4E A;  2NUA B;  3ULL A;  2W57 A;  4LFC H;  2VUG A;  4DAY B;  3G6J B;  1HH2 P;  3ONA B;  5JAV A;  2AKW B;  3HOV B;  5DM7 3;  1STY A;  1R4P B;  1HZC A;  4ILW A;  5HY6 A;  1V1P B;  1SND A;  4LF6 L;  1E4E B;  2B63 B;  4J9P A;  2VUM H;  4MIU A;  3T16 A;  4ECS A;  1TWH B;  3MZ5 A;  2ZM6 L;  1BBX C;  2YL2 A;  2R92 A;  2Q8I B;  3S2D H;  2O2L D;  2WB1 A;  5CBE E;  1TWG H;  4U7C A;  1XMO H;  3KYH C;  3CCL A;  3CF5 A;  2K7V A;  5DLG A;  2A6H C;  4IJH A;  3SGI A;  1JXL A;  4QMG A;  3H40 A;  4RNN A;  1BDO A;  5HV6 A;  3N6R A;  4QW8 A;  2K03 A;  1BBU A;  2YZN A;  1AUX A;  3U4V A;  3CPW A;  1L1O C;  4K0K Q;  2KUM A;  5J22 A;  5EKK A;  5M3F B;  4LAA A;  3SK6 A;  4FF2 A;  2HCI A;  1RTO A;  3HOZ H;  3TII A;  4TSS A;  3PIP A;  2IX0 A;  4NB3 A;  4KTA A;  5IGG A;  1PFM A;  1MGS A;  4RAY A;  2JA7 G;  1KJQ A;  5E1F A;  2WAC A;  5KG3 A;  4K0K L;  2DY8 A;  3NP8 A;  4R4Q A;  2FE3 A;  1ENA A;  1AW7 A;  4ME5 A;  4KHP Q;  3H15 A;  1LAB A;  2PZT A;  4X6A H;  2RA4 A;  5C4X H;  4ED0 A;  3H6M A;  3KBX A;  4G7H C;  2E2J H;  1Y1V A;  5DQG A;  3I3C A;  3QJY A;  1UE1 A;  3MFH A;  1KLG D;  3RD4 A;  5ELB A;  5D8D A;  1EYA A;  1WYD A;  4A3K H;  1PH6 A;  2ZM6 Q;  4OXP A;  2RHQ B;  1TY2 A;  4V0B A;  1ZHS A;  3EYY A;  2F0V A;  1AUV A;  2A8V A;  1SXT A;  2HGS A;  4LUV A;  1YHA A;  1IL8 A;  4A3I G;  1WTH A;  2UXC Q;  2Y0S E;  1N33 L;  2NZH A;  1PTO F;  2R6F A;  3Q22 A;  3K6O A;  1CT1 D;  5L1I A;  1MD2 D;  3GTM A;  4ZI7 F;  4GNX B;  2GLT A;  1XTC D;  4XTC S;  1FJG L;  4J0M A;  3HOU G;  4RB2 C;  3S1Q B;  4K8J A;  2JA6 B;  4RB3 C;  2MPM A;  2A69 C;  2RSN A;  3BDO A;  2YS6 A;  1LYL A;  5M5X B;  1WTV A;  4DR7 L;  1T94 A;  3OIQ A;  3CRL C;  3KJO A;  1RK5 A;  4Q45 A;  1G6P A;  4IPG A;  2NU6 B;  2CKZ B;  3I2Z A;  2R8I A;  1UC8 A;  5I9O A;  3ND8 A;  4GOP B;  4IUP A;  5DAU A;  1X54 A;  2AQ3 B;  4FXG C;  3QFF A;  2UVW A;  1E2W A;  5EPK A;  1EYG A;  2HUG A;  1EYC A;  5AJ3 Q;  3ETJ A;  2WAQ E;  4EQP A;  3CXC A;  1YZ6 A;  5L9X A;  1IYU A;  3AU7 A;  3MTS A;  3STB D;  3I4M G;  1AZQ A;  3GO5 A;  2E5L H;  1S5C D;  2HIV A;  3PUZ A;  1HQM C;  2KSW A;  2IT1 A;  4M8A A;  4CKC A;  1RL2 A;  3RAQ A;  5KT7 A;  1N34 Q;  5KFF A;  1Q8I A;  5COR A;  1VQP A;  4B3M L;  4K5V A;  4J15 A;  4NXM L;  3UI2 A;  3H91 A;  2YTY A;  3KAJ A;  5FD6 A;  5IWA L;  1YNJ C;  2R7Z G;  2QF7 A;  1OTC A;  2P0A A;  4EGV A;  3PW0 A;  1GUW A;  1L0W A;  4KY6 A;  2F52 A;  3PGZ A;  2KHJ A;  5CYU A;  4EQO A;  1FJG Q;  4L1K A;  2E8G A;  2DWC A;  5LP6 F;  2C28 A;  3EVQ A;  3J7Y W;  3L2P A;  4S3S A;  4O3P A;  3EA6 A;  4DV6 L;  2SOB A;  1GUN A;  2ZTC A;  3CHB D;  1EUD B;  3GIK A;  1RJP A;  5DLQ E;  4ID6 A;  5C5J A;  4J9L A;  1BCP C;  3KLR A;  1L1O A;  3OTO L;  4JI4 L;  4B3T H;  1TU2 B;  4A3J G;  1MZB A;  4HIM A;  1WCM H;  3UDI A;  5GAH C;  2YYZ A;  5LMN L;  2DZD A;  4A3E B;  1Q81 C;  2L4N A;  1H9K A;  2WFW A;  1BCP F;  3RGX A;  2VUM A;  3J81 L;  5DM6 3;  4J9O A;  2R7M A;  2NVY B;  3RGZ A;  2BDN A;  3RMH A;  1K0R A;  3CC2 A;  1BKB A;  1PZJ D;  2VQE Q;  5IGD A;  2SCU B;  3E5S A;  2IL8 A;  3FPU B;  2F0G A;  3RN5 A;  1RKN A;  2JA6 G;  4ECX A;  3MWD A;  4R4O A;  1C3O A;  2YU9 A;  3HOX H;  3HXL A;  2Q2I A;  2IJ0 A;  4RGT A;  5EJW A;  4LNQ A;  1NTG A;  1YHQ A;  4Q43 A;  3B6Y A;  1E2Z A;  2E2I H;  4RGM A;  3HEJ A;  3CCS A;  2MJ8 A;  1Z2N X;  4LH7 A;  3PCO B;  4A3F B;  5KG1 A;  5EPL A;  5KND A;  2QA4 A;  1K1Q A;  4Q0Y A;  4KHV A;  1J8I A;  3HG9 A;  3KJP A;  3V2T A;  1EQV A;  3DUZ A;  4EVO A;  2KCC A;  4LF6 Q;  1KJJ A;  2KHI A;  2O5I C;  3NE5 B;  1VQ4 A;  4DV0 H;  3FVQ A;  4H13 C;  2KED A;  2LY7 A;  2NVX H;  1EYZ A;  4YBZ B;  5I6W A;  5DQI A;  4K5X A;  2MFI A;  3GTG A;  3ZYY X;  2MO1 A;  4IRD A;  2ZXP A;  3MXG A;  2L0C A;  2X0S A;  1BQQ T;  5I2X A;  4GKJ L;  2LKV A;  4QQB X;  4R8U B;  1HA5 A;  3IFT A;  1VDZ A;  2BE5 C;  5LMN W;  4TV8 F;  1I5F A;  3HZX A;  2Z4H A;  4DXG A;  5EWG A;  2C2D A;  2FIN B;  2XIW A;  1QCB D;  4GN3 B;  1C7Y A;  3HOU H;  5J2U F;  4IHJ F;  3R2T A;  2K01 A;  2AGQ A;  3X3M A;  3ERS X;  4DV3 H;  1NMG A;  3GTG B;  5C4H A;  1BXR A;  5KFB A;  4RA8 A;  2CW0 D;  1TWF H;  1HNX H;  1BNC A;  3S2H B;  1SYD A;  1DIK A;  1HUM A;  3CC7 A;  5KFG A;  1WCM B;  4CKB A;  4EQN A;  3RBE A;  4OX9 Q;  4NPS A;  1PMR A;  3ICE A;  1CSQ A;  1SSO A;  4DV4 L;  2JYO A;  3T4A C;  5KYL A;  1XJV A;  4LFA Q;  5M3M G;  4A3G G;  2VS1 A;  3CP0 A;  3KHH A;  3FDT A;  1DGS A;  5EAY A;  4DUY Q;  3PUX A;  3KXY T;  2ASD A;  5FLM H;  2AQ1 B;  3TN2 A;  2JEI A;  3A54 A;  3GQB A;  2PYK A;  2YTX A;  3RZO H;  2BA1 A;  4H02 A;  2F0D A;  5ELO A;  5KKN B;  3RUZ A;  2F0S A;  2K4K A;  2GA4 B;  5DQH A;  3A8J E;  1Z47 A;  1KDA A;  5I47 A;  1JKJ B;  2AUK A;  2W8L A;  4LWC A;  1I94 H;  3I91 A;  3FDS A;  1O7Z A;  1ET6 A;  3UE1 A;  2X6G A;  3D4D A;  1TWH A;  3QZ7 A;  4DAP A;  2WII B;  5GON F;  4A3B H;  1SYB A;  4J9N A;  4RNM A;  3A55 A;  3H94 A;  2IBK A;  1ICF B;  3N43 B;  4OWX B;  1VQN A;  1KC8 C;  2CCZ A;  4RB0 A;  1IHZ A;  3Q23 A;  3BQ2 A;  4JI5 L;  2HHH Q;  2R7L A;  5EQ0 A;  3VYT A;  2N78 A;  4A3G B;  5M3M B;  2W71 A;  3T5J A;  3IKJ A;  2YCH A;  2CWP A;  1VQC A;  2GN5 A;  5FLX c;  5A2Q E;  3CPF A;  3GTO B;  4LFB H;  1NAP A;  1EIF A;  1PTO D;  4F88 A;  5E4W C;  5C4Z A;  1CHQ D;  2CH4 A;  2EY6 A;  2PI2 A;  1PRT B;  1HR0 H;  2HIX A;  1XWE A;  3NEL A;  3J80 E;  3BS1 A;  4HNT A;  5JUM A;  2B39 A;  4MN3 A;  3F2D A;  4QB4 A;  4C3H G;  4GC6 A;  1FGB D;  2R85 A;  1I50 B;  2VQE H;  2NWG A;  3Q8D A;  1XMQ Q;  5ELD A;  3I12 A;  5IYB H;  4IN3 A;  1DON A;  3L4J A;  3GII A;  3WO1 A;  2Z1C A;  3UDG A;  4HED A;  4HQ6 A;  5LMN H;  2WIN B;  1YNN C;  4A93 H;  3HOY H;  1JOQ A;  1S0M A;  3TBI B;  1TA8 A;  2UUC H;  3RZO B;  4ME6 A;  2E2J B;  5C3E G;  2BH8 A;  3VYS A;  5IGF A;  4LF4 L;  4MV3 A;  2EYP A;  3QR8 A;  1O78 A;  4OHJ A;  5JEA H;  4X65 Q;  1CKN B;  3PW2 A;  4Q8F A;  5JPN C;  3TQY A;  2EDG A;  2QGQ A;  1RJR A;  3I4N G;  5FLX L;  5KFR A;  2J6T A;  1PXU A;  2RHS B;  4HR7 A;  1EFI D;  3AEV A;  4AIM A;  4M9U A;  4PDB A;  1I3Q B;  1RJQ A;  1CI3 M;  1U4L A;  2R93 G;  2QYZ A;  5KFV A;  4MV8 A;  3MXU A;  1HNW L;  1EU3 A;  4PZ8 A;  2UU9 L;  1GSH A;  2JEA I;  4YCV A;  1FL0 A;  1O75 A;  1RIP A;  2DY7 A;  4JI1 L;  4YHH L;  1PRT D;  1EZ8 A;  4DR5 L;  1SYG A;  1RYR A;  1GUT A;  3OWE B;  3S1R B;  2R7D A;  1I94 Q;  4A3D B;  3HB9 A;  3DWQ A;  3JAM c;  1SMY C;  4OO1 I;  1JLL B;  3Q8Q B;  1Z9F A;  3DWP A;  1GUO A;  2JA6 A;  4FF4 A;  1DD2 A;  4F4Y A;  1IBM H;  4HSP A;  1DOK A;  4IFD I;  2XN9 C;  4EEY A;  4XQJ A;  3GP7 A;  3KF6 A;  4DNI A;  2IPK D;  2F03 A;  1J5E H;  1F9S A;  1VQM A;  4LF8 Q;  1SNM A;  1BGW A;  3D6W A;  1MHW C;  5KFP A;  4RCO A;  4WJ3 M;  4IFD J;  2O5J C;  4IO9 A;  2NU9 B;  4RHR A;  4B3S H;  3GTK A;  4O3O A;  3CCE A;  2CQO A;  2IHE A;  4LMY A;  3PUY A;  3LWB A;  5D14 A;  2D2C C;  3M7N A;  4O3Q A;  3ORQ A;  3VR2 A;  4LH6 A;  1QVF A;  2KCT A;  4JI8 L;  1KNE A;  1LT5 D;  1OXV A;  1NJI C;  5FLX W;  1VMP A;  3T1Y L;  1ENC A;  3MEF A;  2C2E A;  5CBA E;  4RAZ A;  1X3F A;  1CQJ B;  2TSS A;  4ZCK A;  4RB1 A;  4M7E A;  1F9P A;  1JIC A;  1TWF A;  2MUY A;  3GDE A;  3UDF A;  1XNR L;  2PQE A;  2J4X A;  5FK9 C;  1HA6 A;  4HR7 B;  1XYI A;  4IFD G;  4GKK L;  2XNA C;  5JJI A;  4JI7 Q;  1TT2 A;  4IOC A;  2K5V A;  4DR1 Q;  3VA7 A;  4B3R L;  4DL2 A;  1BNZ A;  3CC4 A;  3IN5 A;  1JWM D;  3FMC A;  4BBS G;  4AYB B;  5JEA G;  4C2M H;  4UCO A;  2DNC A;  4IWX A;  1YIJ A;  1LTS D;  5EBD A;  1HNW H;  5E7N A;  2WAQ B;  5C4J B;  3TME A;  2KQ3 A;  3SK5 A;  3M9M B;  2R82 A;  2A19 A;  2H4O A;  1P8L A;  2WB1 G;  4BY7 B;  4J9M A;  1JJ2 A;  3TRZ A;  4F8M A;  3GTJ A;  2PQA A;  4DR4 Q;  3EIV A;  1A2U A;  3CQZ B;  3RBD A;  2BQR A;  3I4M B;  1X3P A;  1I6U A;  4RFB A;  1VQL A;  4A3G H;  4Q0F A;  1SFO B;  5JEA J;  2B63 H;  5T14 A;  2HVS A;  1PZI D;  5I6Y A;  1B9M A;  5I9P A;  2PZW A;  4J9Q A;  1CM9 A;  2K04 A;  2VOB A;  3S1Q H;  5KFT A;  2F0U A;  3H0G A;  4KHP H;  1O7Y A;  2VQD A;  4DR3 H;  2JA5 H;  4K5W A;  2NVQ B;  1D1K A;  5CA1 F;  3GD7 A;  3J81 j;  2IMW P;  3MFG A;  2B63 A;  1QJO A;  1K1S A;  5K5P A;  3HGB A;  2Z9H A;  4MA0 A;  2BOS A;  4PZ6 A;  4H0L C;  3GV7 B;  1SJE D;  3NBI A;  3OW7 A;  2MGS A;  1IYJ B;  4RZQ A;  1S9F A;  4L6T B;  4DV5 H;  4DXF A;  5KFH A;  1ICW A;  3S17 B;  1G6Z A;  3M4I A;  1KC7 A;  3NQI A;  5EKI A;  3I72 A;  3T53 B;  3PO3 B;  3GLK A;  5C44 G;  4ECY A;  2JA7 H;  2Z0S A;  4FYD A;  3M4Q A;  4JV0 A;  4PZ7 A;  4FXD A;  1JJC B;  2H5X A;  2F1M A;  3FKI H;  1RD9 D;  3RNU A;  3MAQ A;  3H3V H;  4YY3 L;  4YR2 A;  4JPB W;  5T1G A;  1KL9 A;  1SAP A;  2EYO A;  4KKS A;  2ALY B;  3R93 A;  1TS5 A;  4PWQ A;  4FS1 A;  5C44 B;  3NQT A;  4H7B A;  2W6N A;  1QIL A;  1VF7 A;  1J9O A;  1S5B D;  4DR1 L;  4YAJ B;  4JI7 L;  4DV0 Q;  4CJ1 B;  5IYZ F;  2UXC H;  1MIU A;  3ERQ A;  5JVH 3;  1EEI D;  4EFB A;  5KYI A;  4LF9 Q;  2A74 C;  4DAV A;  4FVM A;  1F77 A;  4BBS H;  3G6V A;  3G7L A;  1SBB B;  3QIA A;  4A3C G;  3HOY G;  4Y7N H;  2FLP A;  3KDF B;  4IFD H;  4WJ4 A;  3NWT A;  4C5B A;  3H4D A;  1B3Q A;  1ASY A;  2W6P A;  1PH8 A;  3OYY A;  1GLV A;  4OEM B;  1PV4 A;  2VPS A;  1IW7 C;  1KBL A;  3PIP 3;  2K5N A;  2CHB D;  3SHL A;  5M3F G;  4LF7 Q;  2KOL A;  2I87 A;  4UCS A;  1BBW A;  2F0O A;  3SE0 A;  2UXB L;  4R8U A;  4BWG B;  3AB9 A;  3TIG A;  4YR3 A;  2AGO A;  2K6A A;  2R3Z A;  2HT1 A;  1FNW A;  3H4B A;  1K0S A;  5D65 A;  4O4H F;  3G6E A;  5KEE A;  1V43 A;  1JWS D;  4APV A;  1GGO A;  4ZKB B;  2N8N A;  2EVB A;  3EN2 A;  3CQZ H;  4HCE A;  4DR6 Q;  3HBL A;  2XCL A;  1M90 C;  2B63 G;  2V5A A;  5EPJ A;  1RK6 A;  1PFB A;  4DR3 Q;  2L11 A;  2CW0 C;  4BBR G;  4GNX C;  4JI2 L;  1B7Y B;  3O13 A;  4X62 L;  4P74 A;  2NN6 G;  4AYB G;  1SE3 A;  5IT9 c;  4DR5 Q;  4YCW A;  4U6P A;  1WD0 A;  3GTL B;  2GPS A;  5CV5 A;  1JR0 D;  4BS9 A;  3K3V A;  2NTS A;  3SR1 A;  3R5H A;  2Q8T A;  4JI1 Q;  3ZJY C;  1Q1B A;  3SEB A;  4C3J B;  2DPI A;  1P16 A;  1GJX A;  2F0N A;  4R4C A;  3BJU A;  2IHF A;  3RUP A;  1C9O A;  4XDX A;  1N32 Q;  5KFM A;  4L5S A;  1S10 A;  3J81 i;  3HOX B;  3OMC A;  3H0G H;  3GV3 A;  2MCT A;  1F9Q A;  4QW9 A;  1EQQ A;  2KEC A;  2DUD A;  1EY4 A;  1PA6 A;  5M9O A;  4I7H A;  3RV3 A;  3J80 L;  3TP8 A;  4EBD A;  3LP8 A;  3BA9 A;  3NBH B;  3EQL C;  2EE1 A;  4X65 L;  3J80 i;  4V19 0;  3L9A X;  4J1M A;  4A3M G;  1A63 A;  1S03 G;  2B2W C;  1GUS A;  2R7F A;  5LA6 F;  4R9W A;  3HKZ E;  1XNQ L;  2K5D A;  2CW7 A;  1B6S A;  3WNZ A;  2C5C A;  4K2L A;  1DJR D;  3NEM A;  3GV8 B;  2DPJ A;  1QZH A;  1CKN A;  2Q2H A;  3M4P A;  3TZU A;  4IRK A;  5EDW A;  3DMU A;  2E2H A;  1ZKO A;  2H1E A;  3BYT B;  3HKZ G;  4LF5 H;  4POF A;  4B3S Q;  2K5H A;  3RLF A;  1Q7Y C;  4IWY A;  1VAJ A;  1ASZ A;  4N8F A;  2A68 C;  5BN4 A;  3ORR A;  1I50 A;  3W3A A;  5LMU H;  4YJ3 F;  2B8G A;  1A15 A;  1D6E C;  3J80 c;  4C3H H;  4UY8 C;  2RBM A;  4A3B G;  3HRZ C;  2QKI C;  5ELE A;  4F87 A;  4TQR A;  3T5H A;  3IAY A;  1IBM Q;  4LF4 H;  3MWM A;  4ALP A;  2GVB A;  1XPR A;  3J7Z C;  3SE7 A;  2UUC L;  4GLA C;  5IP7 H;  5JJL A;  2JA8 G;  2F3V A;  1F2M A;  2JJQ A;  4JI5 Q;  4P73 A;  5AFW A;  2E76 C;  1JCK B;  4HJ9 A;  2BCO A;  3RZD B;  2YYA A;  4B3S L;  3PN1 A;  1L2Z A;  2KBN A;  3K59 A;  3LML A;  3RB4 A;  5KFZ A;  5CA0 F;  3NEN A;  5EOY A;  4DV2 H;  3MEH A;  3E0E A;  3PSI A;  1RCV D;  5JVD F;  1CQI B;  3G71 A;  1TS2 A;  3S14 B;  5KNC A;  1TS4 A;  4DPG A;  1G51 A;  1WTR A;  3IG0 A;  4LF9 H;  3BQ1 A;  1XNQ Q;  1XPU A;  3Q0A A;  4HJ7 A;  3HOW G;  2VXW A;  1ILQ A;  1LTG D;  4TKO B;  3C0F B;  1IL2 A;  3P20 A;  1EY9 A;  1CHP D;  4F4Z A;  2J6U A;  2D9U A;  4OEL B;  5J3B A;  5M5W H;  4LF6 H;  1SNP A;  4FXK C;  4WBN F;  4FS2 A;  2ZJR A;  2KCN A;  1EY6 A;  4R4T A;  1EQT A;  3V4Z A;  4ED6 A;  1STG A;  3LWE A;  4XYQ A;  3CU7 A;  5IYC G;  4DV4 Q;  3HOW H;  1H9S B;  1I4R A;  4A93 G;  3TRE A;  4ZQI A;  4OX9 L;  1KTK A;  1NNX A;  2YW2 A;  4JYA L;  1CKM A;  3GTL A;  5EBC A;  5CV8 A;  1WH2 A;  5KG4 A;  1FKA H;  5C3W A;  1V51 A;  1Y14 B;  3LGJ A;  1SDF A;  1X56 A;  3DEP A;  2F0H A;  3I90 A;  4K8I A;  2ASL A;  3CW2 C;  1JDE A;  2ID0 A;  4LSX A;  5ISR A;  2NUC A;  3BYY B;  3N52 A;  4J9K A;  1SLJ A;  1JWU D;  1ILP A;  2JA5 A;  1O80 A;  2K28 A;  3AFQ A;  5FOB B;  1PVO A;  1EWC A;  5LMU L;  2V58 A;  1EEF D;  5IGC A;  4YP3 A;  1TQO A;  1QG7 A;  4O4L F;  1SNO A;  4OO1 G;  3OPO A;  1HHV A;  5EGT A;  2EZV A;  4JUZ A;  3VPB A;  4QIW B;  5L1L A;  3KAK A;  1C48 A;  2ICI A;  1YNX A;  3KHG A;  1Y1V B;  4OWT B;  4DL5 A;  4KN7 C;  1T36 A;  4PG3 A;  3AMU A;  3HOZ B;  1ESF A;  1VS0 A;  5CAE B;  4DL6 A;  1BJT A;  2EQS A;  4KJO A;  2UVV A;  4E4T A;  4LF7 L;  1XNQ H;  3U58 A;  3K5M A;  3NSW A;  1RTN A;  1YJ9 A;  1DYQ A;  1B53 A;  4U68 A;  4JG2 A;  3S16 H;  3M4O H;  1A9X A;  1O7L A;  2FLL A;  3R5F A;  2OF1 A;  1XTD A;  5C0X J;  4ECW A;  1DZ1 A;  2D5D A;  4O2A F;  2B2Y A;  3QZ8 A;  5KX5 F;  2J6S A;  2XVS A;  2SNS A;  3OW2 A;  5IE8 A;  2IWH A;  1A3V A;  1ZHQ A;  4ZLT F;  3BZD B;  2N55 A;  2R61 A;  1YIT A;  3W5O A;  3VDY A;  4AQY L;  4LF9 L;  3I4M H;  3LWU A;  5KFJ A;  1X9N A;  1YJN A;  4DV0 L;  1V8Q A;  1JT8 A;  2O4X A;  3UFX B;  2W7P A;  1RYS A;  4DN4 M;  5KFX A;  3TP7 A;  3IFD A;  1S3O A;  5TSS A;  2XRQ D;  5IGE A;  1SYF A;  2EOT A;  3S16 B;  4C5C A;  3P75 A;  1N56 A;  1FNU A;  2WB1 B;  4MTN A;  3OMG A;  4BY7 G;  4ECR A;  2D62 A;  4MHE A;  3TEH B;  4QUC A;  2R92 B;  2QW7 A;  1CUK A;  2EY2 A;  3NTH A;  5FO8 B;  4YY3 Q;  1Q82 C;  5LYJ F;  4ECT A;  1NY4 A;  1V1P A;  1SYE A;  5LMN Q;  4QF4 A;  1QNU A;  3EBE A;  3QO2 A;  4JI3 Q;  3EPI A;  1E3P A;  4JW0 A;  4ZYS A;  1OXS C;  4A3K B;  1CSP A;  2JXM B;  1VQ9 A;  4DR2 L;  2VB3 X;  1WTP A;  1C30 A;  2F0M A;  1S4Z A;  5C4X B;  3L4K A;  3DHQ A;  5KFQ A;  2Z6K C;  4DV4 H;  4YHH H;  1V4Y A;  4JK1 C;  4Q5V A;  1D1I A;  3C1F A;  4DV6 Q;  3GTL H;  4DV1 H;  1H9R A;  2UU9 H;  4KK7 A;  2R84 A;  1JX4 A;  3WOF A;  1OO9 B;  1HZB A;  1ZEQ X;  2V1C C;  4N9P A;  3MVV A;  1T9H A;  4XYO A;  1EY0 A;  2R93 H;  3E9I A;  3E6Z X;  4YB8 B;  1EUJ A;  2RKS A;  3AYH B;  2NBF A;  3L3O C;  4MNO A;  1VQG A;  4P2C B;  2JQO A;  4NXM Q;  1ML0 D;  2V4Q A;  1D8L A;  2B29 A;  4DL7 A;  1LTI D;  3LNN A;  3CCU A;  3BJY A;  2BR0 A;  1STN A;  3OTO H;  1WVL A;  1ZET A;  4JI4 H;  3T51 B;  1K8G A;  2JEG A;  4AYB A;  4ZK9 B;  2JEB I;  3ERO A;  3NGD A;  2CQA A;  4MV1 A;  1EY7 A;  1S5E D;  3TSS A;  2AU0 A;  3S1R H;  3QOJ A;  2NVT H;  2RGV A;  4CBV A;  2E75 C;  2CH4 W;  2MNA A;  4A3E G;  2K14 A;  1IKL A;  2JP1 A;  4XZ3 B;  2JSO A;  3U9O A;  4XXE A;  4JI6 L;  4A3J B;  3R3O A;  1HNZ Q;  1NR2 A;  4B3R Q;  5I2Y A;  4QWD A;  3JAM i;  4J6H A;  2VA3 A;  3FRP B;  2L15 A;  2E5L Q;  4GKK Q;  2YZG A;  4QWC A;  4N8X 1;  3K5N A;  4DR7 Q;  1SEB D;  1R9T H;  1XNR Q;  1ONL A;  4KY5 A;  1TY0 A;  1DOM A;  4YY3 H;  5GRO A;  1J5E Q;  4JCV E;  1ROD A;  2Y0S G;  3SK8 A;  4O2B F;  4HMJ A;  3J81 E;  4LW1 A;  1ENF A;  3J80 W;  3DEO A;  3G6X A;  2JE6 I;  1TVX A;  4IAL A;  2R7K A;  3RAX A;  3BVM A;  1TWC B;  2IA6 A;  2GVA A;  1GO3 E;  2BH2 A;  4WRD A;  4CKE A;  5CR3 A;  5A2Q W;  2K75 A;  2QDL A;  3A7L A;  2EJF C; 
#chains in the Genus database with same CATH homology
 3KF6 A;  4DV7 L;  1YBY A;  4DNI A;  1B70 B;  4GNX A;  3RR5 A;  4DR2 Q;  1VQM A;  4LF8 Q;  1Q1E A;  3PIO A;  1PH3 A;  2R92 G;  3DLL A;  4JI3 L;  2R7Z H;  1VQO A;  2HHH L;  4WJ3 M;  1WJJ A;  1JB7 A;  4IFD J;  1PH5 A;  4IO9 A;  3CCE A;  2CQO A;  2IHE A;  3PUY A;  1FVI A;  3M7N A;  1JE5 A;  2UUA Q;  1PH4 A;  3E9H A;  1U5K A;  2KCT A;  1QVF A;  4KHP L;  4JC0 A;  4JI8 L;  4UP7 A;  1OXV A;  1VQD A;  4QY7 A;  1NJI C;  5C4J H;  3M85 A;  1K9M C;  4JI0 L;  4DV1 Q;  3MEF A;  3T1Y L;  3L0O A;  1X3F A;  2PMZ E;  2VQF L;  5IWA Q;  3TS2 A;  5HGQ A;  4LFC Q;  4HJ5 A;  2NVQ H;  1HZ9 A;  5M3M H;  3GDE A;  3UDF A;  4DK3 C;  1XNR L;  5H1S E;  3PO2 G;  3I7F A;  1UE5 A;  4YHH Q;  4A3D G;  4IFD G;  3G48 A;  4GKK L;  2UXD L;  3KDF A;  3T1H L;  4JI7 Q;  4OWW B;  4IOC A;  4DR1 Q;  2K5V A;  4QJF A;  4AQY Q;  3F1Z A;  4B3R L;  3CC4 A;  1WI5 A;  4A3C H;  3HOV H;  4BBS G;  5JEA G;  1VQ6 A;  4LF5 L;  4C2M H;  2JK8 A;  3K80 C;  2UUB Q;  1YIJ A;  5BR8 Q;  4LUO A;  2AWO A;  2NN6 I;  4AH6 A;  2ES2 A;  2FXQ A;  5E7N A;  2I5H A;  1MJC A;  4RG1 A;  3CCV A;  2F4V L;  4A3D H;  2Z6K A;  4LFB L;  1PYB A;  2EXD A;  3A0J A;  1KRT A;  1K8A C;  2A19 A;  2WB1 G;  1P8L A;  2K52 A;  2E2H H;  3GTQ H;  3A5Z B;  1JJ2 A;  3TRZ A;  2IY5 B;  1NBW A;  2PQA A;  4DR4 Q;  3EIV A;  1QVG A;  3FP9 A;  4OON A;  1E22 A;  4UP8 A;  2MQH A;  3AQQ A;  1VQL A;  2ASB A;  2OQK A;  4YWK A;  4A3G H;  5JEA J;  3BZC A;  2B63 H;  2WB1 E;  1VQH A;  1GM5 A;  3S1Q H;  1YVC A;  4HIK A;  4A3I H;  2JA5 H;  1E7Z A;  3S14 H;  5IY0 A;  3RLN A;  4DKA C;  3CMA A;  4GKJ Q;  2YTV A;  4DR3 L;  1Y1W G;  1HZA A;  1MKH A;  1PH9 A;  3GD7 A;  3J81 j;  2IX1 A;  3ULL A;  1JJG A;  5LMU Q;  4DAY B;  1UEB A;  4PZ6 A;  1HH2 P;  2NZO A;  4BXX H;  2Q2U A;  1FJG Q;  2AKW B;  1IYJ B;  4FDB A;  2I5M X;  1QVC A;  1VCI A;  1LM0 A;  1GKH A;  1HZC A;  5HY6 A;  1I6H H;  3CAM A;  4LF6 L;  5IP9 H;  2JA9 A;  2VUM H;  4C3J H;  4R1J A;  4C3I H;  5C0X I;  1CKO A;  1OXX K;  1BVS A;  2ZM6 L;  2EIF A;  3S2D H;  4IPC A;  1YJW A;  4IJL A;  2UXB Q;  1TWG H;  2JA5 G;  5C44 G;  3KYH C;  2MO0 A;  4IPD A;  3CCL A;  3CF5 A;  5GAG C;  2JA7 H;  2Z0S A;  4IJH A;  3SGI A;  3M4Q A;  4PZ7 A;  4JYA Q;  1N8R C;  1JJC B;  2H5X A;  1UE7 A;  3F2C A;  4LFB Q;  3FKI H;  3RNU A;  3W1G A;  1E1O A;  1BBU A;  3H3V H;  4YY3 L;  5FJ8 H;  2HQL A;  2RCN A;  5FLM G;  1HNX L;  1KL9 A;  1VQ7 A;  3U4V A;  3CPW A;  1L1O C;  2I5L X;  4BY7 H;  4K0K Q;  2ALY B;  4DV3 L;  4A3M H;  2K50 A;  4GN4 B;  3CCQ A;  4A76 A;  4DR1 L;  4JI7 L;  5IYC H;  4X66 Q;  1EIY B;  2ATW A;  3W1B A;  4DV0 Q;  3PUW A;  4QGU A;  5GQO A;  4PMW A;  3PIP A;  1MIU A;  3STB C;  3FKI G;  2IX0 A;  4NB3 A;  4LF9 Q;  4YWL A;  4A3F G;  1VQ5 A;  2DGY A;  4JOI C;  1KD1 C;  2JA7 G;  3HOV G;  4BBS H;  4DV3 Q;  4K0K L;  4A3C G;  4R4Q A;  1KHI A;  1A8V A;  1HNX Q;  4JI0 Q;  3HOY G;  4Y7N H;  3KDF B;  2VNU D;  4WJ4 A;  2WAQ G;  4KHP Q;  3H15 A;  1ASY A;  1PH8 A;  1VQE A;  2N3S A;  3D31 A;  3OYY A;  4X64 L;  2UUA L;  4X6A H;  1PV4 A;  5C4X H;  1N9W A;  4BA2 I;  2K5N A;  4DUZ L;  1XPO A;  2E2J H;  2OTL A;  4LF7 Q;  5M3F G;  1UE1 A;  1M1K C;  2UUC Q;  4O0A A;  1BBW A;  4GOP C;  4A3K H;  1WYD A;  2LSS A;  1AE2 A;  1PH6 A;  2UXB L;  2ZM6 Q;  1IBM L;  5M5X H;  4OXP A;  2RHQ B;  2HT1 A;  2A8V A;  2NVY H;  1WCM G;  4LUV A;  3G6E A;  1YHA A;  4JV5 L;  1V43 A;  4APV A;  4GLV B;  4A3I G;  2VY3 A;  2UXC Q;  2Y0S E;  1N33 L;  2NZH A;  2N8N A;  3EN2 A;  3CQZ H;  1HR0 L;  3GTP H;  4DR6 Q;  1SRO A;  1M90 C;  1UWV A;  4NXN Q;  4GNX B;  2B63 G;  3GTM H;  4DR3 Q;  4XTC S;  4BBR G;  1XMO L;  1OXU A;  4GNX C;  4JI2 L;  1FJG L;  1B7Y B;  3HOU G;  4X62 L;  4P74 A;  2NN6 G;  4AYB G;  5IT9 c;  4GN5 A;  4DR5 Q;  4YCW A;  1IXR A;  4RMF A;  1LYL A;  4YCU A;  2CFM A;  4DV5 L;  4DR7 L;  1X3G A;  2VL6 A;  1SR3 A;  1Q1B A;  4JI1 Q;  3ZJY C;  3KJO A;  1P16 A;  1LUZ A;  1E1T A;  3MXN B;  1EQR A;  4IPG A;  3BJU A;  4R4C A;  2IHF A;  2CKZ B;  1C9O A;  3GTO H;  1G6P A;  3I2Z A;  4DR4 L;  1N32 Q;  4L5S A;  3HOX G;  3J81 i;  4GOP B;  1N36 Q;  1Q12 A;  3H0G H;  1X54 A;  4EX5 A;  1EYG A;  1EQQ A;  3I56 A;  1NE3 A;  5AJ3 Q;  2DUD A;  1PA6 A;  2WAQ E;  3CXC A;  1YZ6 A;  3STB D;  3I4M G;  4B3T L;  3PO2 H;  5IYB G;  3NBH B;  3GO5 A;  4X65 L;  3J80 i;  1I3Q H;  1N36 L;  2HIV A;  3PUZ A;  1N32 L;  4BY1 G;  1A63 A;  4A3M G;  3DM3 A;  5M5Y H;  1QUQ A;  2IT1 A;  1X65 A;  1K83 H;  1RL2 A;  2R7F A;  3T1H Q;  1N34 Q;  1VQ8 A;  2VQE L;  2AWN A;  5FJ8 G;  4HJ8 A;  3HKZ E;  1XNQ L;  1SFO H;  1VQP A;  4B3M L;  2ZTD A;  2VW9 A;  2D0O A;  3NEM A;  3D0F A;  4J15 A;  1PHJ A;  4NXM L;  1K73 C;  1QZH A;  1CKN A;  2Q2H A;  2YTY A;  3M4P A;  5IWA L;  2R7Z G;  1EWI A;  4X62 Q;  1OTC A;  2ZTE A;  2JA8 H;  2KCM A;  4DV1 L;  3T1Y Q;  1L0W A;  5C3E H;  1L1O B;  1X55 A;  2F52 A;  2KHJ A;  3PGZ A;  3HKZ G;  4JI2 Q;  3UDX A;  4JI8 Q;  1XMO Q;  2R6G A;  3U4Z A;  4JBW A;  1SMX A;  2E8G A;  4POF A;  4B3S Q;  2K5H A;  3RLF A;  5IP9 G;  3L2P A;  4A3K G;  1YI2 A;  1Q7Y C;  4DR6 L;  4DV6 L;  3K7A H;  4L5R C;  3KFU A;  1C0A A;  1ASZ A;  3K81 C;  1YHB A;  2ZTC A;  1KRS A;  4BXX G;  3J80 c;  4C3H H;  4LF8 L;  4UY8 C;  5DLQ E;  5GAE C;  4A3B G;  4GLX A;  4DV7 Q;  1IBM Q;  1L1O A;  4HID A;  2GVB A;  4ALP A;  3J7Z C;  3OTO L;  1Y1W H;  1XPR A;  1E24 A;  4JI4 L;  3J7A 5;  2UUC L;  4GLA C;  5IP7 H;  4A3J G;  1KIX A;  2JA8 G;  5JJL A;  2JJQ A;  4HIM A;  4JI5 Q;  1WCM H;  4P73 A;  3UDI A;  5GAH C;  2YYZ A;  5LMN L;  4HJ9 A;  3S17 H;  1IBK L;  1Q8K A;  4A3L G;  1Q81 C;  5IYD G;  4B3S L;  2RF4 A;  2KBN A;  2WFW A;  1I94 L;  1QZG A;  3NEN A;  3K8A A;  1GD7 A;  1A0I A;  3E0E A;  1J5E L;  3PSI A;  3GTK H;  4L5Q A;  3G71 A;  4DPG A;  1G51 A;  5C4X G;  1K3R A;  1K0R A;  4TQU S;  1MJE A;  3S1N H;  4B3M Q;  4DV2 Q;  3CC2 A;  1XNQ Q;  1XPU A;  4A3E H;  1BKB A;  2OQ0 A;  2VQE Q;  4HJ7 A;  1N34 L;  3HOW G;  3I4N H;  4QL5 A;  1GVP A;  3RN5 A;  2UU9 Q;  1IL2 A;  1HNW Q;  3HOZ H;  2JA6 G;  1HJP A;  5J3B A;  3FHW A;  4R4O A;  3PF5 A;  3HOX H;  5M5W H;  4A3F H;  2Q2I A;  4LNQ A;  5ELN A;  2ZJR A;  1NTG A;  4HIO A;  1YHQ A;  4R4T A;  3G4S A;  3KF8 B;  3PO3 G;  3B6Y A;  1Q86 C;  3CD6 A;  1J6Q A;  3IRB A;  3ULJ A;  4XIG S;  5IYC G;  1SRU A;  5AJ3 L;  4DV4 Q;  2E2I H;  3TRE A;  3HOW H;  4YWM A;  4OX9 L;  3HOZ G;  4JYA L;  1CKM A;  4JBM A;  1IBL L;  3CCS A;  1YEZ A;  2QEX A;  4LF4 Q;  4A93 G;  1Y14 B;  3LGJ A;  1LTL A;  3PCO B;  1X56 A;  3J81 c;  2D0P A;  3K7U C;  2QA4 A;  1VQB A;  5IYD H;  3KJP A;  3CW2 C;  3CME A;  4LF6 Q;  2A1A A;  1FGU A;  2ID0 A;  2KHI A;  1SLJ A;  1TWC H;  3CCM A;  1Y1V H;  3S24 A;  1VQ4 A;  1XMQ L;  3BU2 A;  3S2H H;  4Y52 H;  4DK6 C;  3AFQ A;  2OCE A;  5C44 H;  4A75 A;  2NVX H;  1PVO A;  1WOC A;  1A62 A;  2MFI A;  4O2D A;  5LMU L;  3RZD H;  4UPA A;  1D7Q A;  1G29 1;  2MO1 A;  4L5T A;  1KXL A;  2WP8 J;  4OO1 G;  4GKJ L;  2ZJP A;  4QQB X;  3BZK A;  1W2B A;  3S15 H;  5LMN W;  1N33 Q;  2PI2 E;  4LUZ A;  2UXC L;  1H95 A;  1I5F A;  1YNX A;  4OWT B;  5JJK A;  4GN3 B;  1C7Y A;  4PG3 A;  3HOU H;  2C35 B;  2PNH A;  1VS0 A;  5K36 G;  3RLO A;  3ERS X;  1U0L A;  1NMG A;  2EQS A;  3S1M H;  4POG A;  1PFS A;  1TWF H;  2I0Q A;  1Y1V G;  3CC7 A;  4LF7 L;  2JA6 H;  3H3V I;  3U58 A;  4DUZ Q;  1IBL Q;  3I4O A;  4HJA A;  1YJ9 A;  3S16 H;  3I55 A;  4JG2 A;  3PF4 A;  3M4O H;  4OX9 Q;  4NPS A;  4X64 Q;  4KHZ A;  1S40 A;  3ICE A;  1CSQ A;  4IOA A;  4DV4 L;  1TXY A;  1XTD A;  5C0X J;  1XJV A;  4LFA Q;  1AE3 A;  5M3M G;  4A3G G;  2VS1 A;  3CP0 A;  3GTJ H;  3OW2 A;  5IE8 A;  1W3S A;  4LF5 Q;  1DGS A;  5EAY A;  4DUY Q;  3PUX A;  2B3G A;  1SN8 A;  1VQI A;  5FLM H;  1YIT A;  4MZ9 A;  3W5O A;  3U50 C;  4AQY L;  3VDY A;  4LF9 L;  3I4M H;  2LXK A;  1X9N A;  4P75 A;  2YTX A;  1YJN A;  4UP9 A;  4DV0 L;  1JT8 A;  4DV2 L;  3RZO H;  4X66 L;  2BA1 A;  4H02 A;  5ELO A;  1VQA A;  2K4K A;  1S3O A;  1Z47 A;  4LFC L;  1B8A A;  4ME3 A;  4LWC A;  4DUY L;  3WWV A;  3A5U A;  4MTN A;  3UE1 A;  4BY7 G;  1JMC A;  2D62 A;  3CCJ A;  3TEH B;  1VQK A;  4LFA L;  4YY3 Q;  1CUK A;  1Q82 C;  4A3B H;  3PV0 A;  3GTG H;  1NY4 A;  4OWX B;  1IBK Q;  1VQN A;  1KC8 C;  2CCZ A;  5LMN Q;  1X3E A;  2F3I A;  3ER0 A;  3KLW A;  4JI5 L;  2Q2T A;  1PH2 A;  2HHH Q;  3EBE A;  4JI3 Q;  3F2B A;  1E3P A;  2N78 A;  2VZA A;  1OXS C;  1CSP A;  1VQ9 A;  4DR2 L;  3A74 A;  2CWP A;  1S72 A;  1VQC A;  2GN5 A;  5FLX c;  4A3L H;  3CPF A;  2Z6K C;  1EIF A;  3AFP A;  2PI2 A;  4DAM A;  4IPH A;  1EOV A;  2R92 H;  4DV6 Q;  3GTL H;  2HIX A;  3NEL A;  1V1Q A;  4QIW E;  4A4I A;  1HZB A;  3F2D A;  2V1C C;  2OWO A;  1HR0 W;  5GAD C;  1T9H A;  2CWA A;  5M3F H;  2PQA B;  2R93 H;  2XTI A;  3E9I A;  3TS0 A;  2YU9 H;  1EUJ A;  2YV5 A;  3HKS A;  3AYH B;  2N49 A;  3Q8D A;  5IYB H;  5C0X G;  4MNO A;  1XMQ Q;  1VQG A;  3UDG A;  2JQO A;  3L7Z C;  4NXM Q;  3M9B A;  1D8L A;  2B29 A;  1Q46 A;  4GS3 A;  2E5L L;  1O7I A;  4A93 H;  3HOY H;  4JBJ A;  3CCU A;  1NMF A;  5C3E G;  1HNZ L;  1SE8 A;  1KQS A;  3PUV A;  2BH8 A;  4LF4 L;  4JI6 Q;  3RN2 A;  1K8G A;  1I50 H;  4X65 Q;  1CKN B;  2JEB I;  2ZJQ A;  3HFZ B;  3TQY A;  2QGQ A;  3I4N G;  1AH9 A;  1KAW A;  4B3T Q;  3S1R H;  1VQF A;  2NVT H;  2F4V Q;  1L2F A;  1OXT A;  2AMC B;  3K0X A;  2RHS B;  2MNA A;  4A3E G;  2K14 A;  3AEV A;  4AIM A;  5BR8 L;  1QUQ B;  4BY1 H;  2UUB L;  2R93 G;  4JI4 Q;  2AHO B;  4JI6 L;  1HNW L;  4PZ8 A;  1HNZ Q;  2UU9 L;  4P71 A;  4B3R Q;  2JEA I;  4KI0 A;  1PH1 A;  3JAM i;  4BA1 I;  1UE6 A;  1EFW A;  4YCV A;  1FL0 A;  1X6O A;  1RIP A;  2L15 A;  4JI1 L;  3F8T A;  4YHH L;  2E5L Q;  4GKK Q;  4DR7 Q;  2UXD Q;  4DV5 Q;  3ULP A;  1TWH H;  1R9T H;  1XNR Q;  3PO3 H;  1PH7 A;  1TWA H;  4DR5 L;  1IZ6 A;  2LXJ A;  5JJI A;  3H0G G;  4GOP A;  3UE0 A;  5IP7 G;  4P72 A;  2VQF Q;  3KOJ A;  2BA0 A;  5GRO A;  1J5E Q;  3M3Y H;  4JCV E;  4AYB E;  2OTJ A;  2Y0S G;  4A3J H;  1PYS B;  2KEN A;  2R7D A;  4LW1 A;  2JE6 I;  3JC6 6;  1I94 Q;  4NXN L;  1WFQ A;  1V9P A;  2VUM G;  3JAM c;  4JBK A;  2XGT A;  3KF6 B;  1HR0 Q;  4OO1 I;  4TVA B;  3CCR A;  1Z9F A;  4KLK A;  2GVA A;  1GO3 E;  2BH2 A;  4JOI A;  4EQ5 A;  4JV5 Q;  2K75 A;  4IFD I;  4R4I A;  1VQJ A;  3OTO Q;  4BBR H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...