3PO3G

Arrested rna polymerase ii reactivation intermediate
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po3G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po3G01
2LXJA 2ZTDA 1PA6A 1SRUA 1PH3A 3DM3A 4YHHL 1LTLA 4EX5A 1HNWL 3KLWA 3CMEA 4DV1Q 1MKHA 3SGIA 2WAQG 4OWTB 1N36L 1L1OA 2XTIA 3L2PA 4A3GG 2JA8G 5AJ3Q 3HKZE 3UDIA 2NVTH 1HH2P 1NMGA 2E5LQ 3F8TA 4X64Q 5FJ8H 5C0XJ 4DR7L 3HOVG 1PH4A 1EUJA 3U4ZA 4DR1Q 1HR0W 3RLNA 2UXBL 1T9HA 1N32L 2NVYH 4R4TA 1GO3E 4LF6L 3ERSX 3GTMH 3I55A 3AQQA 3JAMc 2HHHL 1YHBA 2JEAI 1WCMH 4K0KQ 4P74A 3STBC 4HJ9A 3PO2H 4L5QA 1Q7YC 1X65A 1U0LA 5JEAG 4GOPA 2UUBQ 4L5RC 4NXNL 1Y1VG 4QGUA 2K5NA 3A0JA 4YWLA 2NZOA 4DR2Q 1CKNA 3F1ZA 2N78A 4LUZA 3GTJH 5M3FG 2VUMH 5FLMG 3W5OA 2WP8J 2RHSB 1DGSA 1PH5A 3K80C 4B3SQ 2K14A 1NE3A 1TWGH 3NELA 4XIGS 1I94L 5C0XG 1Y14B 4LUOA 1YIJA 4JI3Q 1G51A 1I5FA 2NVXH 4JI7L 1NTGA 2BH2A 4XTCS 5IYDH 3S16H 1HZCA 1TWFH 4JBJA 2MO1A 4QIWE 4GNXC 1XNRL 1B8AA 5C44H 3AYHB 5IYCH 3GTPH 3F2BA 2A19A 1YI2A 5LMNW 1VQ5A 1VQ7A 1YZ6A 2Z6KA 5C4XG 1Q8KA 2UU9Q 1BBUA 3CF5A 4JBMA 4A3JG 2KBNA 4JI4L 1TWHH 1N9WA 1IXRA 1SMXA 1UEBA 2BH8A 3UDFA 4DPGA 3F2CA 1XJVA 2E2JH 3K0XA 4KHPL 4LF9L 3M4OH 2I5MX 4QQBX 4DV6Q 1YITA 1N33L 1C7YA 2CQOA 3M9BA 3CCLA 1X3FA 5IE8A 1PYSB 2VQEL 1A62A 4HJ5A 1H95A 4NXMQ 4GN5A 1IBMQ 1KRSA 4NPSA 1P16A 3PUYA 1XNQL 2K52A 2EIFA 4IFDJ 1A8VA 4IPCA 1Q12A 2NN6G 5GAHC 3J7A5 4BY7G 4IOCA 4GS3A 4R4OA 3KJOA 3BU2A 3K81C 3KDFB 1Q46A 4A3EG 4LWCA 1CSQA 1E22A 1PH7A 3PO3G 1K83H 3ER0A 4JYAL 2Q2HA 2NVQH 1VQDA 4YWMA 1MIUA 5J3BA 4JOIA 5M5XH 2VNUD 2CFMA 3M85A 3AFPA 2FXQA 1K0RA 2R6GA 2RF4A 4DV4L 1HNXL 1QUQB 1L2FA 4DV2Q 1B7YB 4MTNA 2OTJA 1Q82C 1GD7A 4A3IG 1PH2A 3I2ZA 4LF8Q 3PUVA 4L5TA 1QZHA 1E1OA 4LFBQ 3KFUA 4KHZA 5JJKA 3L7ZC 4DKAC 2MQHA 3RLFA 1BVSA 3G4SA 1YJWA 4IFDG 1N34L 1BKBA 4GLVB 1VQHA 1YVCA 2MNAA 4GKKL 4EQ5A 2HQLA 2VL6A 1VQCA 4X62L 1YHAA 1XMQL 1EOVA 2F52A 1EWIA 2IHEA 5IP7G 1FJGQ 3EIVA 1J5EL 2KHIA 4JI5L 3E9IA 2GVAA 3G6EA 4JC0A 2PQAB 4OX9Q 3NEMA 4JI8L 4A93H 4JV5Q 3PIOA 1S40A 2JK8A 4BY1G 3HOXG 4LF4L 1QZGA 2B63H 3KF6A 4AYBG 3GTLH 4A3BH 2DGYA 4A3LH 3PUXA 3A5UA 1IL2A 4B3RL 5GQOA 5LMNL 5M5WH 5LMUQ 2ID0A 2WB1G 2YV5A 3DLLA 2WAQE 5GAGC 4JI0L 1K3RA 1KQSA 3HOZG 4LFCQ 3B6YA 3S1QH 2KCMA 5JEAJ 4DV3Q 4A75A 3RN5A 1OXSC 1S72A 2HIVA 4DV0Q 2IX1A 2I5HA 4A3FG 3I4MH 1VQIA 3PF4A 1VQFA 4OXPA 1YJNA 1L1OB 4OWXB 5GAEC 4LNQA 3I4OA 2ZM6L 1YJ9A 2UUCQ 4A4IA 1E1TA 4DUYL 5AJ3L 3HOWH 3CPFA 4A3KH 2OCEA 3J7ZC 1XMOQ 2GN5A 1WYDA 4X64L 1IBLQ 4GLXA 4A3MG 1VQ6A 1OXTA 1RIPA 1V43A 4R4QA 3TS0A 4A3CG 1UWVA 4DR1L 2IHFA 2Q2IA 4BBRG 1IBKL 2JA5H 5IYBH 3I4NH 1JJGA 1HZ9A 1Y1WH 4L5SA 3CP0A 2KCTA 5C3EH 2QEXA 2NZHA 2Y0SE 3GTOH 1AE3A 1VQ8A 4JI1Q 1ASZA 4GOPB 2R93G 1L0WA 4ALPA 1MJCA 5IP9G 3HOYH 2HIXA 4DV7L 4DR6Q 2UUBL 1C0AA 1CKNB 3T1HQ 1E7ZA 2E2IH 4DR4Q 4BXXG 3F2DA 4A3DG 2ASBA 1PFSA 3H0GG 4B3MQ 1RL2A 4C3JH 1EQRA 3CQZH 2ZJPA 3H15A 4HIDA 1R9TH 3RZDH 3W1GA 4B3SL 2AMCB 2ZJQA 2OWOA 2AHOB 3D0FA 5HY6A 2CWPA 3GD7A 3CCEA 1B70B 2E2HH 1N32Q 2UUAQ 3ULPA 4LF6Q 1K8AC 1XTDA 3RZOH 3GDEA 2BA1A 3TQYA 1NJIC 2HHHQ 2R92G 4IPGA 1C9OA 2YTXA 4O0AA 2K5HA 4JCVE 3G71A 2JA7H 4P72A 1LUZA 4DV5Q 1Y1WG 3STBD 3HOUG 1I6HH 4JI2L 1XPOA 2KENA 3E0EA 5C0XI 5E7NA 2UU9L 3S1NH 1KL9A 4IJHA 4PZ8A 3OTOQ 2ZTCA 2EXDA 5EAYA 3T1YL 1SFOH 2R7ZH 2F3IA 1HNZQ 3PCOB 1JT8A 4DUZQ 4MNOA 2WFWA 3CCQA 2H5XA 2N3SA 1VS0A 3E9HA 2K75A 1LM0A 2MFIA 3S14H 4DV6L 1I50H 1EIFA 4JG2A 5FJ8G 3S15H 2N49A 4GKJL 2IY5B 4JI7Q 1CSPA 2A1AA 2C35B 3KOJA 4TQUS 2VQFQ 1VQOA 2A8VA 1L1OC 4DAMA 3LGJA 1Q1BA 2YTVA 4PZ7A 4HJ8A 3GTKH 2ALYB 4UP7A 2AWOA 1WCMG 2CKZB 3H3VI 2AKWB 1VQ9A 1GVPA 3PO2G 2YTYA 2B29A 2Q2UA 4R1JA 1KRTA 3WWVA 1YBYA 2K5VA 2LXKA 1Q1EA 4UP8A 2JA6H 1BBWA 1UE1A 5GROA 1FVIA 3CXCA 1HR0L 1E24A 1PH6A 2NN6I 4DAYB 2UXCQ 4KI0A 4GOPC 4OWWB 3M4QA 3PIPA 1QVGA 2CCZA 4DV2L 2F4VL 3UE1A 4WJ3M 3CCJA 4LF8L 2IX0A 1EFWA 3FP9A 2VZAA 1XNQQ 5M3MH 3JC66 3UDXA 5IYDG 5IWAL 3A5ZB 2D62A 3VDYA 1M90C 4YY3Q 2Q2TA 4BBSH 1KHIA 4B3TQ 4LF5Q 5C44G 1W3SA 5IYCG 2OTLA 5JJLA 1E3PA 4BA2I 4X65Q 1PV4A 1JMCA 2D0PA 4AYBE 4C3IH 4A3GH 4TVAB 2JA8H 4O2DA 3ULLA 3CCUA 1QVFA 1PH9A 3AFQA 2WB1E 4UPAA 4OX9L 2DUDA 1X3EA 4DV4Q 1HNXQ 4QL5A 4PZ6A 2BA0A 2ZJRA 1Q81C 1JJ2A 2HT1A 3HOVH 4IFDI 4J15A 3K7AH 4OO1G 2I0QA 1QUQA 3M7NA 3I7FA 1PYBA 3PV0A 1HJPA 1UE6A 4DNIA 5LMUL 1HZAA 4LF7L 3CD6A 1SE8A 5BR8L 4LFAL 1VQKA 4LFCL 4PMWA 3S17H 4HIOA 4GKKQ 2E8GA 4X66Q 5H1SE 4IO9A 4AQYQ 5ELNA 1K8GA 3BZKA 1Y1VH 1VQJA 2JQOA 1KAWA 5DLQE 4AIMA 3J81j 3GTQH 2XGTA 4LW1A 3S1MH 1V1QA 5M3FH 1G291 4DR3Q 3CMAA 4JI5Q 5FLMH 4DV1L 3PUWA 1WJJA 3HFZB 1GM5A 1TWCH 3PF5A 2EQSA 4JI6Q 3J81i 3RLOA 4IOAA 1M1KC 3CCVA 5IY0A 3FKIG 3M3YH 4GNXA 2E5LL 1XMOL 2IT1A 1UE5A 4A76A 4DR5Q 2PI2E 2VS1A 2D0OA 2UXDQ 3CAMA 1CKMA 5JJIA 1JJCB 1X3GA 2MO0A 4ME3A 4R4IA 3CC2A 3BJUA 4JOIC 3RR5A 2ATWA 4DK6C 1S3OA 1VQBA 1OTCA 5IT9c 4Y7NH 4JI0Q 1OXXK 2QGQA 2B3GA 1X54A 1K9MC 1KIXA 4KLKA 4LFAQ 4JI1L 3NENA 4JBKA 1N8RC 4K0KL 4HIKA 5C4XH 4YHHQ 2ZTEA 4A3JH 4DR6L 2V1CC 1HNWQ 1ASYA 4WJ4A 1CUKA 3T1HL 3AEVA 2ZM6Q 3UDGA 3TREA 4DR4L 1CKOA 4B3ML 4PG3A 2RHQB 3W1BA 4DUYQ 1N36Q 1JB7A 4DR2L 1AH9A 2R7DA 2ES2A 3H3VH 5K36G 3S2HH 3EN2A 3J81c 1EIYB 4UP9A 3TS2A 4A93G 4Y52H 1D7QA 4DR7Q 3CCRA 3IRBA 1WI5A 1FGUA 1PH1A 1IBKQ 2Z0SA 2UXBQ 2B63G 1SLJA 2UUAL 4A3BG 4C3HH 4A3LG 4HIMA 3U4VA 3CW2C 4JI3L 3HKZG 3PUZA 4LUVA 4BA1I 4BY7H 1OXVA 3K7UC 1Q86C 1I3QH 1TXYA 2JA9A 1P8LA 4DV7Q 4IPDA 4AH6A 4A3EH 4DV5L 3CPWA 3CC4A 3PO3H 1SROA 4NXNQ 4OONA 1YHQA 2K50A 1VQEA 2Y0SG 3I4MG 1X55A 1A0IA 5M5YH 3OTOL 1VQAA 2JEBI 1PVOA 1UE7A 1HNZL 1O7IA 3PSIA 3K8AA 4DUZL 4RG1A 1NBWA 2GVBA 2QA4A 3HOWG 1VQLA 2JE6I 4IPHA 4A3KG 4A3IH 1I94Q 1OXUA 3FHWA 3EBEA 3MXNB 4POGA 1NY4A 1X9NA 2N8NA 2VY3A 2VQFL 3I4NG 3RNUA 5IYBG 2JA5G 4NXML 1IBML 2VW9A 1VQGA 2R7FA 2RCNA 1G6PA 1EQQA 5C3EG 3GO5A 1VCIA 1XNRQ 3A74A 4JI2Q 4JBWA 3HKSA 5IP7H 3HOYG 1KXLA 1EYGA 1GKHA 1Z47A 3RN2A 4RMFA 1LYLA 1K73C 4YWKA 3T1YQ 2K4KA 4JI4Q 4GLAC 1VQMA 5HGQA 4KHPQ 4LF9Q 1SN8A 2JJQA 4BY1H 1YNXA 3HOXH 3J80i 2VUMG 3CCSA 2UXCL 1IYJB 1N33Q 3PGZA 3S24A 5GADC 3GTGH 4GKJQ 2VQEQ 4YCWA 4X6AH 4GN3B 3TRZA 1A63A 1WOCA 1X56A 4UY8C 3M4PA 1HZBA 3HOZH 4FDBA 4QY7A 3TEHB 4R4CA 4LFBL 2AWNA 1V9PA 3ULJA 1VQNA 5ELOA 4IJLA 1J6QA 4YY3L 3BZCA 2JA7G 1IZ6A 4QJFA 4B3TL 2L15A 4LF5L 3OW2A 3D31A 4A3FH 2YU9H 4X65L 3L0OA 3KDFA 3S1RH 4JYAQ 1AE2A 3OYYA 1FJGL 3HOUH 4P73A 1HR0Q 3FKIH 5C4JH 2R7ZG 2OQ0A 4A3MH 1D8LA 4A3CH 1YEZA 3J80c 4JV5L 3KF6B 4P75A 2F4VQ 2Z6KC 4BBRH 1KD1C 1PHJA 4P71A 1SR3A 2PNHA 4GN4B 2PMZE 3CC7A 1JE5A 3G48A 5IWAQ 3U50C 3NBHB 2R93H 4YCUA 5IP9H 1N34Q 2KHJA 1VQPA 1XPRA 4C2MH 4H02A 4X66L 4AQYL 4OO1I 4BXXH 4POFA 2I5LX 4X62Q 1XMQQ 4A3DH 2CWAA 4DV3L 3H0GH 2OQKA 4DV0L 2PI2A 1TWAH 4APVA 1J5EQ 2YYZA 1NMFA 3MEFA 4DR3L 1VQ4A 1QVCA 3KYHC 5FLXc 3KF8B 2JA6G 4JI8Q 4DK3C 4GNXB 2UUCL 4JI6L 3I56A 1FL0A 1WFQA 3U58A 1KC8C 2PQAA 4LF4Q 4NB3A 3CCMA 4HJ7A 1Z9FA 3Q8DA 1PH8A 1XPUA 3ICEA 4DR5L 1IBLL 2UXDL 1W2BA 3UE0A 4B3RQ 4HJAA 5LMNQ 4MZ9A 2LSSA 1U5KA 4YCVA 4LF7Q 2R92H 3S2DH 5BR8Q 3JAMi 5M3MG 3KJPA 3ZJYC 1X6OA 1MJEA 4BBSG
chains in the Genus database with same CATH superfamily
2LXJA 2ZTDA 1SRUA 1F2ZA 1M4VA 5FO8B 3QOLA 4UCUA 1WD1A 1DOKA 1EEID 3L2PA 4X62H 3PR5B 2NVTH 1CS0A 4IRCA 1HH2P 1I4QA 5KFEA 4MV1A 3QG1A 3L4JA 3ETHA 2F3VA 1EYAA 3S2HB 1M7JA 4XX0B 1PH4A 3RLNA 2NVYH 4FF4A 1S5FD 4LF4H 4LF6L 2B2VA 3ERSX 3JRWA 3GTMH 3I55A 3EROA 2B2UC 3AQQA 3RB0A 4NP5A 2HHHL 4S3SA 2JEAI 2W7OA 5LMNH 2BQ3A 3STBC 2NZ1D 1SMYC 5BR8H 1Q7YC 4YP3A 5KFJA 2UUBQ 1I3QB 4HQ6A 4MIUA 1SYEA 5I2YA 2EJMA 4QGUA 2FLNA 1AEXA 1SYBA 5KFLA 1NR2A 2I46A 2N78A 5I6WA 3GTJH 5M3FG 2DZDA 5FLMG 2J6UA 1EZ6A 2RHSB 1PH5A 4U7CA 1H9JA 1B3AA 4DF7A 3NELA 3T51B 2F0DA 2EYMA 3CRKC 3TINA 1N48A 2F1MA 2SNMA 2XN9C 4LUOA 5LYJF 1I5FA 3PQIA 1NTGA 3RD4A 2CZGA 4X3UA 1HZCA 4FXGC 3RTXA 3P20A 4RUCA 2GPSA 3FMAA 2Q8RE 2ASDA 1IW7C 5C44H 5IYCH 3F2BA 3OIPA 3OSOA 5IT9E 1YI2A 1M6VA 1HFGA 1JDBB 2Z6KA 4TQSA 5C4XG 5KT2A 2FPPB 1V8QA 1TWHH 3GQCA 1DV2A 5D1OA 5JPMC 1XJVA 3K0XA 1XX8A 3M4OH 3MHBA 5AFWA 4ED3A 4QQBX 3GIQA 4LH6A 1C48A 1YITA 5K5PA 5I9PA 2KA7A 1N33L 5EQ0A 2CQOA 3V6KA 5IGDA 3U9SA 2OEOA 4HJ5A 4ZUJA 1H95A 1AN7A 1SYFA 1UNNC 4Q8EA 2DY7A 3PUYA 2EIFA 4KN7C 1A8VA 1Q12A 3J7A5 4EQOA 4ZLTF 4R4OA 1Q3LA 1Q46A 2FFKB 4H44C 3PO3G 1CSQA 1E22A 3IFDA 1K83H 1YNJC 5C1PA 3RGXA 1VQDA 2YU9B 4J9RA 3OPOA 4F87A 1TA8A 2F0PA 1RYSA 1F9PA 2O5JC 1Z2NX 3V2TA 2JA8B 1A9XA 5KFPA 4DV4L 1HNZH 1QUQB 3GLKA 1L2FA 2HCCA 4XQJA 1B7YB 4DUZH 3I70A 1Q82C 1GD7A 1VMCA 4A3MB 1PH2A 1BCPB 3T56B 3FKIA 5FLXL 3PUVA 5JVG3 4L5TA 4ZK9B 3KFUA 4YBZB 2K6AA 1SE2A 4DKAC 2F0TA 1YJWA 1BKBA 2F0VA 1Q90A 2VL6A 2F0GA 1EOVA 2F52A 1FJGQ 5C1OA 2F0UA 2CQYA 1RHPA 3O13A 3HBLA 2C2EA 3E6ZX 2LFNA 4OX9Q 3S1MB 4JI8L 1R4QB 2F0QA 2X0SA 1RKNA 4HSVA 1Z6HA 1TWCB 1QZGA 4AYBG 4A3LH 4MA5A 4QUFA 2BQRA 5KFGA 2FKLA 5M5WH 1GSHA 3JSNA 2YV5A 1K28A 4DAPA 4JI0L 3HOZG 4DA2A 2B63A 2FJ2A 2R92B 3D4WA 3HKZA 1KAAA 2KVMA 2NTTA 2NWGA 5KFZA 4A75A 3UFXB 2IX1A 2HIVA 3RAXA 2I5HA 1L1OB 5COYA 3JAML 5GAEC 5ELDA 3I4OA 1JIHA 4X65H 2A5HA 3HOWH 4ECRA 2Y0SA 1FJGH 2OCEA 1AP0A 4GZYC 2F0WA 4GLXA 1VQ6A 1V43A 2Z9HA 4OX9H 2IHFA 2Q2IA 2JA5H 1ZYRD 3EQLC 1JJGA 1HZ9A 1RTOA 1I7LA 5L1JA 3CP0A 1BCPF 2V59A 2C22A 5C3EH 1TVXA 2NZHA 4LK1C 2QILA 2X6GA 3DHQA 3VR4A 2WTFA 4C3HB 3VMMA 3LP8A 4ALPA 4ED1A 3ERQA 3OOCA 5FO7B 2HIXA 4DR6Q 2IMWP 5EPKA 2BCOA 1CKNB 2E2IH 4A3DG 2MGSA 4L8JA 4RA8A 2PZWA 5CV5A 4J9KA 2IW3A 2W71A 4XYOA 2ZJPA 1RCVD 2EYPA 4HIDA 3RZDH 5CMDA 4B3SL 2OWOA 1QJOA 2AHOB 3D0FA 3CQZA 5HY6A 1BDOA 2CWPA 3CCEA 4XQQA 3N41B 2UUAQ 4DU9A 2K5QA 1K8AC 4DR5H 3GDEA 3PIO3 4FU0A 2ZDQA 1QCBD 1HTPA 3HGBA 2F0NA 1EWCA 4JCVE 1C30A 1F2MA 1TWFB 4DV5Q 3STBD 4C56C 2LKVA 1SMYD 5C6AA 2KENA 5L1IA 4O4LF 5E7NA 2JA7A 1SNPA 4IJHA 5I9OA 4PZ8A 1XYIA 5EAYA 2R7ZH 3T1YL 2F3IA 4F8MA 3C1FA 2YZGA 3SVMA 1B6RA 3CCQA 1H9SA 3E9HA 2MFIA 2NYZD 3S14H 1I50H 2HJWA 1EIFA 5DEHA 5FJ8G 2W6MA 3S15H 2N49A 4GKJL 3KHHA 5DG8A 2BQUA 1FNWA 2C35B 3KOJA 1JWUD 2VQFQ 1Q1BA 1HRJA 2SDFA 1HHVA 2W57A 2HCIA 2SNSA 2UUAH 3QB3A 2ALYB 4DL6A 3TIIA 1EIGA 1WCMG 3J7YW 1B50A 2AKWB 2HGSA 3JAME 1H9KA 4FF1A 3GTKA 1KEEA 3WWVA 4R8UB 2PMZB 3V6HA 4DV5H 4TQRA 1BBWA 1FVIA 2W9BB 1F2LA 3S1RB 4DXFA 5C4ZA 1B2TA 5LXTF 3SE7A 4DAYB 3QZ8A 4KI0A 4N9PA 5DAUA 4MTEA 2JA6A 5JVH3 5C4JB 2OF1A 2F4VL 1A6XA 3CCJA 4LF8L 1ENAA 1Q8IA 1EFWA 1XNQQ 1I94H 5M3MH 2F0KA 5IYDG 2WKDA 5EKIA 2VQFH 1PK8A 5JVLA 1V1PB 1W3SA 1F9RA 5JJLA 5CAEB 1MHWC 3G6JB 4BA2I 3RJ0A 1TQOA 2D0PA 3JSLA 4RKBA 4TVAB 4X3SA 4K6LA 4O2DA 3ULLA 1QVFA 1RK6A 3IKJA 2WB1E 4RGOS 5IGGA 3HOVH 2R7MA 1NCVA 2FHTA 5KG3A 4KHPH 5D14A 3S9WA 2YW2A 2RDHA 3KLSX 3PV0A 2B8GA 4MTDA 2Z6BA 1VF5C 2VQEH 5LMUL 4CBVA 1GUTA 1Z2PX 2RQXA 3CHBD 3GTLA 3NBHA 4LFCL 2NU6B 4O2AF 3S17H 5I47A 5E1FA 1XNQH 1L0XB 2RDGA 5H1SE 4RB0A 4RGNA 1KAWA 2XD4A 5T14A 4F50A 1Y1WB 2J0TD 2HDMA 1CHQD 3CMAA 1EZ1A 3PUWA 2M05A 1M1KC 3M3YH 5C0XH 4C5CA 2VS1A 1DD2A 3CAMA 1CKMA 3A8KE 4KN4C 3J81L 3RR5A 3OW7A 4ECVA 1OTCA 1S3OA 1VQBA 2ZXOA 3NPPA 1JE4A 4FNFA 4Y7NH 4B9XA 1B3QA 4JI1L 3TQTA 3NENA 1LLRD 4YHHQ 5I6YA 3QZ7A 2EVBA 2V1CC 3J80W 2NUAB 1EEFD 3DWQA 3UDGA 3QJYA 3TREA 3HOYB 3OIQA 4DL3A 3GP7A 4U673 1OWTA 3VR6A 1SYXB 1XMQH 1AH9A 3N43B 4J9NA 2IL8A 2ES2A 3H3VH 2W70A 3S2HH 1J5EH 5EBCA 4UP9A 4A93G 3GTJB 4CKBA 2VB3X 4DR7Q 4Z9CB 3IRBA 4ZRZA 1IBKQ 3DMUA 2Z0SA 1TS2A 2UXBQ 1TY2A 4TSSA 4A3BG 2RGRA 4HIMA 3U4VA 1EUCB 1PFMA 3R5XA 3NBIA 2HVSA 4LUVA 3SK6A 4BY7H 3K7UC 1Q86C 1I3QH 4PQXA 1ET6A 3A55A 1P8LA 4DV7Q 2NB0A 2F0IA 3CPWA 4NXNQ 5C44B 2K50A 5KT6A 2JYOA 5EKLA 3AMUA 4YHHH 1T5EA 1WTQA 1SJED 3K8AA 1JOOA 4RG1A 3R5FA 5KNDA 2E74C 1TWHB 2JE6I 4A3KG 4F4ZA 2JSOA 2R8IA 1F2YA 1SEIA 2O03A 5KT5A 2I8CA 4DR7H 2AUKA 4IRDA 4NXML 3MTSA 2VW9A 2R7FA 4IFDH 2RCNA 1IBKH 1XNRQ 1D1IA 1WTOA 3MXGA 1TY0A 3A74A 1XWEA 4JBWA 3SEBA 5IGBA 1AFPA 2PYKA 4KKTA 1EYGA 3RN2A 3VR3A 3V05A 3Q1KA 1GLVA 2BDNA 1YNND 2N55A 4QWCA 4DV7H 4RNNA 5HGQA 5KFCA 3RIZA 1SN8A 2JJQA 4NXNH 1K83B 3J80i 2VUMG 3CCSA 3R93A 2ICEC 2PZUA 1RTNA 4MV4A 2XGQA 1UC9A 3A56A 3DWAA 2N88A 4GN3B 2RSNA 4AYBA 1IL8A 3GTGA 4LFBL 1K1QA 2C9OA 1G2SA 3CRLC 4KK7A 4FF2A 4YY3L 3MWMA 3J7AK 1LT6D 1KBLA 2MUYA 3N6RA 4A3FH 5E3FA 2YU9H 5KYIA 3PMFA 2A6HD 1FKAH 1XNRH 1LO5D 4K14A 3LWEA 5DNFA 3Q8QB 2JEJA 3FKIH 4C3IB 3K58A 4RHSA 4LMQD 1HPCA 1EYDA 4A3MH 3X3MA 4A3CH 1T94A 4RZQA 2FLPA 1KD1C 1RJRA 4H7BA 3RB6A 1LT4D 3FMCA 2PNHA 1DCZA 2QEJC 3SXHA 1Z2OX 5IWAQ 2J7ZA 1A2TA 2I87A 2K03A 4KJOA 2R93H 5FD5A 1W96A 1N34Q 5FD6A 1SNDA 1XPRA 4AQYL 4BXXH 4HR7B 4J6HA 1VDZA 4M1UB 4DV3L 4ZKCB 1EOTA 1VQ4A 1NMFA 3GIPA 1QVCA 4GNXB 4DNRB 5IGFA 3A8JE 5E4XA 3WNZA 1TWAA 1BNZA 1BR9A 2R8GA 3GTQA 4HJ7A 2ZXRA 2PW5A 3Q8DA 1GJXA 1JKJB 1U9RA 4OEMB 3UE0A 1GHKA 2R92H 2PQEA 4LF7Q 4DV2H 4IWYA 2W8LA 4KHVA 2JA5B 2D2CC 3PIP3 4FXDA 3HOUH 2J6TA 4BBSG 5NUCA 5IWAH 1AW7A 5C3EB 3OUZA 2IWHA 3G8CA 2IJ0A 5CC4A 5I4DA 4DV1Q 4XYLB 3SGIA 1F77A 3I3CA 4OWTB 2K04A 3TZDA 2FE3A 5FPRA 2XTIA 4A3GG 2JA8G 5AJ3Q 3HKZE 3UDIA 5LHY1 2E5LQ 4G57A 4CDFC 4X64Q 5LL6b 1LTID 5C0XJ 3J7AF 2VPQA 5DLGA 4KD4A 2IBKA 2A74C 3TP6A 4DR1Q 3RZDB 5J2TF 1HR0W 1PDQA 1N32L 3C2PA 3G7LA 5KFVA 1XXGA 2A69D 3GV3A 1CQVA 1YHBA 4K0KQ 3PZPA 1E4EA 5FLXW 4LF7H 3PO2H 4L5QA 4CKEA 2G9DA 3ITPA 1U0LA 5JEAG 4GOPA 1CQIB 1Y1VG 2L55A 2K5NA 5KFRA 1WCMA 2NZOA 4HCEA 2FJZA 3F1ZA 3HRZC 2F0EA 3W5OA 3T5HA 4DV1H 1GSOA 4XIGS 3DF7A 4OIKA 4IALA 5D3IB 1Y14B 2E5LH 3CKIB 4A3IB 2F0HA 4X64H 1CT1D 1I50B 4XTCS 5CV7A 1TWFH 3S15B 1STNA 4DR1H 1EFID 1B8AA 1WD0A 2A19A 1VQ5A 1VQ7A 2NTSA 3PVXA 2UU9Q 1RODA 4A3JG 1K1SA 4K0KH 2RSOA 4K5WA 3GTPA 1QG7A 5CGKA 1SEBD 1IXRA 1HCZA 1SMXA 2BH8A 3UDFA 3F2CA 4WRDA 4NKLA 1PTOF 2DPIA 2WV6D 2I5MX 4B3MH 4OO1H 4YR0A 1KDAA 2XCLA 4BY1B 2YZMA 3D4DA 3M9BA 3HOXB 1O7ZA 1UNSA 1PYSB 1X3FA 3NUCA 5IE8A 1WH2A 1KABA 4HTHA 3OMGA 1P16A 4C3HG 2WDTA 4WFN3 4IFDJ 2WB1B 5GAHC 2E2DC 2JEGA 5M3MB 4IOCA 4GS3A 2XSCA 3K81C 1ZKOA 3KDFB 4EFEA 3H3VC 4FP5D 4YAJB 4A3EG 1PH7A 2EY2A 4ZAIA 2DNCA 2MCTA 2I07B 3ER0A 2Q2HA 4YWMA 1MIUA 4N9TA 4JOIA 2VNUD 2EOTA 1IKMA 3M85A 2R6GA 3OTOH 3KTMA 3RF2A 1HNXL 3VPCA 2CW0C 3LMLA 3BZDB 1EY4A 2RDFA 3HOVB 4QWAA 4QMGA 1E1OA 4BBRB 3GIIA 4RB1A 2RA4A 4XXEA 1O7YA 3L7ZC 2F4IA 2ICIA 3G4SA 5KFBA 3LWBA 2WE6A 1CTMA 1VQHA 4EQ5A 3H4BA 4X62L 2YYAA 3S17B 1AUXA 1TS3A 2DJFC 2IA6A 4JI5L 5K36H 2W7PA 3E9IA 2GVAA 3OUUA 4NMZA 4JV5Q 2OT2A 4LF4L 3GTLH 1B9MA 3QFFA 5DGAA 5KFDA 2UXCH 2FMAA 3M3YB 5LMNL 2H4OA 2C28A 4I65A 2KCCA 2F0MA 5A2QL 1K3RA 2WKCA 5FO9B 3DM1A 5BN4A 5HV6A 2XWBB 2M2LA 1MGSA 2JXMB 3B6YA 4YAKB 4Y7NB 2B2TA 4IN3A 5JEAJ 3RN5A 2O2LD 4DL2A 3PF4A 4OXPA 1YJNA 4B3TH 1IHZA 1TU2B 3QR8A 3LWUA 4KKSA 2UUCQ 2W6NA 1E1TA 2KJXA 4CDDC 3AU7A 2R61A 3CPFA 2K7VA 3DUZA 1BOSA 2GN5A 1IBLQ 5JH7F 1OXTA 2R3ZA 3TS0A 5KG4A 3T13A 1UWVA 1DYQA 2JP1A 1IKLA 4JV5H 3J80E 1WSCA 1Y1WH 2VOBA 2UVVA 2FINB 5CB4F 4FBUA 2K32A 3V6JA 4PMCA 1C3OA 3PW7A 2L11A 1MJCA 1LTGD 5IP9G 3HOYH 4JV1A 1B9NA 3NXWA 4BY7B 2UUBL 4DR4Q 1BCPC 5EBDA 3F2DA 4X66H 3H0GG 1RL2A 4C3JH 4O3RA 1FR3A 5JPNC 4CDEC 3H15A 2QW7A 3VYTA 1RDPD 3G6XA 3W1GA 2AMCB 2ZJQA 2P0AA 1PX2A 2V4RA 3PW2A 2UUCH 4I7ZC 1EZ8A 2V4DA 5BMVF 3PR4A 2VUMA 1R9TA 4LF6Q 1WVLA 1IBLH 2HHHQ 1G6ZA 4RAYA 4IPGA 1C9OA 3G71A 5KFOA 3S16B 3PW5A 4P72A 5J22A 1Y1WG 1I6HH 1KLGD 4JI2L 2V9WA 4LFAH 3S1NH 1EY7A 3BDOA 2C2DA 2ZTCA 2EXDA 3A7LA 1SFOH 1HNZQ 4DUZQ 2WFWA 2CVRA 3IAYA 2H5XA 4DR4H 5KFFA 1LM0A 4XYQA 1S5ED 1O80A 4JG2A 1WTVA 2IY5B 2A1AA 2A8VA 4TQUS 1KC7A 1L1OC 3RB3A 3LGJA 2YTVA 3F8NA 4CGYB 2DWCA 2K01A 4BS9A 4UFZA 4LF6H 1KLUD 3M9NB 4O3OA 1GVPA 3J81W 2HHHH 4J9QA 3MAQA 1KRTA 1PRTD 4A3FB 4X3KA 3CXCA 1HR0L 3P1HA 4OIJA 5M5XB 5CV6A 3FKIB 3PIPA 1NR4A 2FMCA 1B4OA 3HG9A 4ECXA 4QW8A 3FP9A 2VZAA 4N8X1 5F9NA 1AZPA 1K8OA 3KUPA 5G3LD 3A5ZB 1ZXTA 2D62A 3VDYA 1KHIA 3ND9A 2R87A 4LF5Q 2ZXPA 5C44G 1GHJA 5IYCG 5KFAA 4ECYA 1I7NA 4YR2A 1KDBA 2AUJD 4X65Q 1F9QA 2R93B 3M9MB 4AYBE 4C3IH 2WIIB 5EOYA 3WOEA 2EDGA 2B2UA 4OX9L 4DV4Q 3IL8A 2BE5D 1Q81C 3K7AH 1QE6A 4ZQ3A 2I0QA 1QUQA 2CW0D 4K8JA 5KG1A 1UE6A 4KTAA 2B63B 3V96A 1CM9A 3HKZB 4LFAL 2A68C 1VQKA 1BBXC 4DN4M 2E8GA 1JC7A 2C2RA 5KGUA 2DY8A 2JQOA 3LX0A 1D1KA 3GTQH 3HOUB 1CFMA 1RJTA 4DR3Q 4C1NK 4LF5H 3T5KA 1WJJA 3HFZB 1Y1VA 2EQSA 3J81i 5DQGA 1STGA 2OXPA 3H40A 3CCVA 5IY0A 5JAVA 4EG0A 1PFNA 2IT1A 1UE5A 4A76A 4DR5Q 3GIMA 2D0OA 4YB8B 1JOQA 1TWCA 2MO0A 4DV4H 5L9XA 1K8MA 2ATWA 4JI0Q 5IT9c 4J9SA 1OXXK 4HMJA 4RWSC 4TV9F 2JEIA 4ZKBB 2ZTEA 1V1OA 4J0MA 1PTOH 4DR6L 1HNWQ 4WJ4A 1CUKA 4DFAA 3BQ1A 3GTOA 4HSPA 3PO2B 1N36Q 1JLLB 5KT4A 1XTCD 4DR2L 1A15A 5DM63 3CQZB 2K05A 5IOCA 1D7QA 4DR3H 3CCRA 5DG7A 5FLXE 1FGUA 4JPBW 1H9RA 2KECA 5KG6A 1SLJA 2UUAL 1ZHSA 4E6IA 4A3LG 3GV6A 4JI3L 5IYZF 5C8YF 4PV1C 5DM73 3TP7A 5M9OA 2NN6H 2EY5A 2F0JA 5JVDF 1FNUA 4BA1I 2E2HA 3RZOB 1GUGA 3SE0A 3WOFA 2AQ4A 1JOKA 1VMPA 3CC4A 4JI0H 4DV5L 2SEBD 4OONA 1YHQA 1X55A 1A0IA 5ELCA 1H9SB 1C4QA 4Q0FA 1PVOA 1UE7A 2NBFA 1EL0A 2QF7A 1HNWH 1NBWA 2KQ3A 3HOWG 2IP4A 2IPKD 1VQLA 5KG2A 4IPHA 1N36H 4ED2A 4A3IH 1I94Q 1AZQA 1I4PA 4O3SA 5CORA 2N8NA 2VQFL 2VUGA 3NWSA 2JA5G 5EWGA 1IBML 3NTIA 4L6TB 1K3BC 1EQQA 4XT3B 3GQBA 3EJIA 4WJWA 5C3EG 1CI3M 3OMCA 4RFBA 3GTKB 1IW7D 1QNKA 5IP7H 2HUGA 3E0JA 1DZ1A 4MV9A 4RMFA 2G9HD 1K73C 3T1YQ 4JI4Q 5EWFA 4KHPQ 3C46A 5DQIA 4LF9Q 4BY1H 2KOLA 2B2WC 3HOXH 2JA6B 1QNUA 3RGZA 3TQ1A 4GKJQ 1LTSD 3L4KA 4FBTA 2VQEQ 1TIID 1X3QA 4X6AH 2YRXA 4JV0A 1WOCA 1X56A 3FPUB 2W9AA 3M4PA 1HZBA 3R5HA 4FDBA 3EVQA 1DM0B 4QY7A 4CJ0B 3GV5B 3MR3A 4IJLA 1J6QA 1LACA 3BZCA 3ORRA 4QJFA 2FP4B 1E2VA 3D31A 4CHTB 2V4QA 4JYAQ 2W9CA 2WACA 4R8UA 3HS0C 1YNJD 3E3XA 2R7ZG 3Q23A 2UVUA 2J9GA 4EGQA 3SHLA 1ONLA 3T1YH 4JI4H 1YEZA 4DAYA 3KF6B 4P75A 3Q0AA 2F4VQ 4UCOA 3C3LA 4BBRH 4LF9H 1G8ZD 1Z7TA 4R7RA 3X3NA 1SXTA 3MEHA 4ID6A 1JCKB 3T5JA 2LMCB 4G3IA 1JE5A 1S5DD 1VBHA 4GKJH 3GTLB 3NBHB 3UI2A 2X69A 4DAVA 5KFTA 2XWJB 4YCUA 5HURA 2KHJA 4EVOA 3ND8A 4POFA 1U4PA 1XMQQ 5DQHA 4DV0L 2PI2A 1J5EQ 3KBXA 2YYZA 1F9SA 4C2MA 5FLXc 4J1MA 4TRDA 3KXYT 3HZXA 3I56A 3H0GA 2HVRA 2PBZA 4JYAH 5DGBA 4IUPA 2PQAA 1KC8C 3CCMA 1Z9FA 1PH8A 4IHJF 2E75C 3T53B 4B3RQ 4HJAA 4MZ9A 1U5KA 4Q5VA 1SYDA 3ZYYX 4XQNA 3S2DH 2F4VH 3TP8A 5M3MG 4UHVA 2EXZA 4G7HC 3KJPA 5EZYF 2L4NA 4FO2A 4IUNA 1QILA 3CC2A 5KNCA 3K3VA 1PH3A 1STBA 2XC9A 3DM3A 4YHHL 1LTLA 4EX5A 1ZHQA 2HVQA 1CQJB 2ASJA 3KLWA 5IIFA 3E5SA 4Q8FA 1MKHA 4QW9A 2C5CA 4J9LA 2UVRA 1EU4A 2WAQG 1Y1WA 5KG5A 4DLKA 3TDQA 3MWEA 3VPDA 2A73B 1NMGA 4ZCKA 4C3JB 2MP1A 3BQ0A 2PN1A 4DR7L 1TS4A 3HOVG 1EUJA 1I4GA 2UXBL 3KHLA 1T9HA 5IGCA 4R4TA 1GO3E 2L12A 2R7NA 1E4FT 3JAMc 4B3RH 3DWPA 2XRSD 2K28A 4JUZA 4P74A 3TN2A 2NVYA 5LMUH 4YJ3F 4IRKA 3GTMA 1X65A 4FXKC 4NXNL 1C8CA 4YWLA 3A0JA 3PO3B 4UCTA 1I6HB 2A6EC 2VUMH 1QOHA 4MV7A 4M8AA 3K5LA 1DGSA 3S1NB 1Y8PB 2ATLA 2K14A 2J6SA 3M4YA 4R8NA 3NWTA 5JUMA 1SFOB 3GTJA 1NSNS 2K5DA 5C0XG 4MHEA 1JWMD 3DEOA 4LSXA 2R8HA 1YIJA 4JI7L 4L63B 2J4XA 4UAIA 3S16H 2MO1A 3BQ2A 4GNXC 1XNRL 3AYHB 5ELBA 3NK9A 5LMNW 1I4XA 5KFSA 4I50F 1YZ6A 3I90A 3AB9A 4JBMA 5A2QW 3VR5A 2KBNA 1N9WA 1RF2D 4RAUC 1BJTA 4DPGA 3RMHA 5D8DA 2QYZA 4ED8A 4OGQC 4DV6Q 2XNAC 1TWHA 2EJGC 3J81E 3EA6A 4AYBB 1A62A 1NAPA 3NTHA 4NXMQ 4MAMA 2K33A 4IQZA 3H09A 5KFIA 5KG7A 4IUTA 3U9TA 3GV7B 4ED7A 4IPCA 3HOZB 3TIGA 4BY7G 2YCHA 4KV6A 2D5DA 2SOBA 1DONA 3N42B 2FK1A 1KJJA 4MV8A 5IGEA 3MR5A 4LWCA 2AGPA 1N56A 3D6WA 4MV6A 4R8IA 2YS6A 5JQWA 2YS7A 4QWEA 5M5XH 2CFMA 3Q8RB 2L5TA 4EQPA 4V190 1K83A 5KG0A 1EYCA 4DV2Q 4FS1A 2MHVA 2OTJA 4EBCA 4J9MA 4LMYA 1QZHA 3K7AB 5HGTA 4LFBQ 4DV6H 4L1KA 4MN3A 2MQHA 3GIKA 1STAA 4IFDG 1N34L 4GLVB 4NXMH 4GKKL 5KIXA 2PW7A 1T3NA 1VQCA 1YHAA 1EWIA 2R85A 3QOJA 1CE8A 2F3WA 2XCAA 4A3DB 2KHIA 2QCPX 4H0LC 1TWAB 3G6EA 3GTQB 5EDWA 3NEMA 3MA2B 3PIOA 4JK1C 1S40A 2JK8A 3VYRA 2YZNA 5C3XA 2R84A 4HYKA 4BWGB 2B63H 5KFQA 2DGYA 5L37A 2V5AA 1IL2A 1LT5D 1S10A 4IAJA 2ID0A 3DLLA 1M8AA 1ML0D 5GAGC 4DK1A 2X6LA 1J9OA 4WBNF 1GUWA 2KCMA 3NP8A 4LFBH 1S72A 4DV3Q 2CW8A 4QWBA 3N8DA 4HR7A 4A3FG 4ME5A 3I4MH 4YY3H 4MV3A 5KEEA 3K57A 1D5MC 2KCNA 4OWXB 2ZM6L 1PTOB 4DUYL 3KK7A 5AJ3L 5KYLA 1XMOQ 4X64L 4A3MG 1RIPA 4A3CG 2Z4HA 1VKZA 4DR1L 3I4NH 4HNUA 5IYBH 4OHJA 2EY6A 5LA6F 5C5MA 2KCTA 2QEXA 2AQ2B 2Y0SE 3GTOH 1E4EB 1HFNA 1AE3A 2NUCA 3FDSA 1VQ8A 5LP6F 3UQ8A 5KT3A 4GOPB 2R93G 2JA5A 1FYCA 1WCMB 1C0AA 3T1HQ 4BXXG 1G2TA 2KSWA 2ASBA 4B3MQ 4O3QA 3LNNA 1EQRA 3CQZH 3Q8PB 4DV3H 2E2IA 4I7HA 1A3TA 2JN4A 4QIWA 3TZUA 2E2HH 3GD7A 1N32Q 1KDCA 2O4XA 5KFKA 2XVSA 3RZOH 1XMOH 1TWGA 3TQYA 1NJIC 2R92G 4ZI7F 4EYIB 4O0AA 2JA7H 4R9WA 4KKUA 1LUZA 3RUZA 3BA9A 3HOUG 4IUVA 2NVXA 4HNTA 3GTPB 3E0EA 5CBEE 5C0XI 2UU9L 3KBGA 3WO1A 3OTOQ 2OH2A 1JT8A 2A6ED 1KJIA 1B1ZA 3T1HH 4RZRA 2N3SA 1I4HA 5L1KA 2R7ZA 3I72A 3IFTA 4MTKA 2QK4A 2EZVA 1VQOA 1E2WA 1DJRD 3MXNA 4ZOLF 1EYZA 4ILWA 1TAEA 1MD2D 3W2DA 3MFGA 4HJ8A 3GTKH 4EQNA 4O2BF 1HQRD 1N32H 3BYYB 5T1GA 2AWOA 4QF4A 2VA2A 3H3VI 5JOBA 1VQ9A 3PO2G 3MFYA 1HUMA 2B29A 5KFWA 2B2VC 1YBYA 2K5VA 1EY9A 1SNCA 3FRPB 3M7GA 4UP8A 2JA6H 1I6UA 1UE1A 5GROA 4FF3A 1GYFA 2M9VA 2NVQB 1BO0A 1E24A 2F03A 2UXCQ 4ZUIA 4F4WA 2V58A 4OWWB 1QVGA 1A3VA 4LAAA 4WJ3M 1TT2A 3VYSA 2IX0A 1T5XD 2G5DA 4Q44A 2FMMA 1M0TA 1B53A 1BXRA 1VAJA 3I4LA 1M90C 2Q2TA 2TSSA 4B3TQ 1O78A 5EJWA 1E3PA 3MXUA 3H91A 4G4KA 4CC5A 4ME6A 1SAPA 3CCUA 1GUSA 4YIJA 3RBEA 1PH9A 4DK0A 1EY6A 3AFQA 1SNOA 2DUDA 2DNEA 2HT1A 1HNXQ 2WAQA 1KNAA 1JR0D 1Y8OB 2ZJRA 4IFDI 2JEFA 4OO1G 4J15A 2NU7B 1SCUB 3QWNA 1HJPA 4NW2A 2BDOA 4DNIA 3L3OC 4U68A 4A3BB 1HZAA 5EKKA 1BQQT 1STHA 1SE8A 3CD6A 5BR8L 4GC7A 4ECSA 4PMWA 3BG3A 2CQAA 4HIOA 1WTHA 4GC6A 3S2DB 4X66Q 4IO9A 1K8GA 1O7LA 1GXDC 1GUOA 1SNQA 3BZKA 5ELNA 3G6YA 5IT9L 1VQJA 5DLQE 1ET9A 5M3FH 3D8GA 1G291 4KY6A 4JI5Q 1DIKA 5FLMH 4UCRA 5J2UF 4IWXA 1GM5A 3PF5A 3FPPA 1DXMA 4JI6Q 2W6ZA 2CW7A 4IOAA 3DXJC 1B04A 3BG5A 3KF8A 2W8KA 2FK2A 3FEWX 3EYYA 2PI2E 2UXDQ 3EPGA 1ZYRC 2W6PA 5JJIA 1PRTB 1JJCB 3MXPA 1X3GA 1HNXH 1MZBA 2EY1A 2I80A 4DK6C 4QB4A 2OLSA 2QGQA 2B3GA 5KFUA 1X54A 5EPLA 1J8IA 4LFAQ 2F0FA 1SSOA 1N8RC 2HDLA 5C4XH 4HIKA 5D1PA 1ASYA 1JQYD 3AEVA 1JORA 4DR4L 4RGMA 4K5XA 1DOLA 1II3A 1A3UA 2CHBD 2RHQB 4O1NA 4PG3A 3W1BA 4B08A 1JB7A 2O5IC 4TV8F 5LL6X 5K36G 1S68A 1HA5A 3EN2A 3BDLA 1UUPA 3MC0B 1EIYB 3C0FB 3TS2A 4Y52H 4JI5H 2VUMB 3SK5A 1R9TB 1WI5A 2ZDHA 4JI6H 2H1EA 4DL5A 3TBIB 5CV9A 4B9WA 1LV9A 3CW2C 4F88A 3PUZA 5CA0F 2UXDH 1W93A 2SCUB 2JA9A 4IPDA 4AH6A 3PO3H 3CVZA 4UCVA 3RV4A 4KMUC 1SROA 1UEAB 2QDBA 3C1EA 4EEYA 1VQEA 4K8IA 1I3QA 5D1OB 5M5YH 1SYGA 1VQAA 2JEBI 4EBEA 1B44D 4RB3C 1HNZL 1O7IA 4DUZL 2QA4A 2DLNA 2QKIC 1SE4A 1W6KA 1OXUA 4HCSA 4RCOA 4HMIA 2PCFB 1V4YA 1EQTA 1X32A 4FYDA 5C5JA 5ELFA 1X9NA 5A2QE 5CR3A 3RNUA 1PRTF 2MPMA 2B39A 2XGPA 1VQGA 4DXGA 3VPBA 1G6PA 4QCLA 1VCIA 3OHXC 4LH7A 4JI2Q 4C1NI 3URYA 1TR5A 3HKSA 3P75A 3HOYG 1GKHA 4FVMA 3RUPA 4YWKA 5J39A 1ENFA 1VQMA 2UUBH 4C3JG 2R86A 5G3LF 1M0WA 1N33Q 3IN5A 3H94A 3N6XA 3GTGH 4WORA 5GADC 1ICWA 5T1IA 3VR2A 2YRWA 1UAPA 1PFBA 3TRZA 1A63A 4UY8C 3HOZH 4NLGA 2Z1CA 4R4CA 2AWNA 1V9PA 3ULJA 5ELOA 4F7XA 4DL4A 4H13C 1IZ6A 4LF5L 2L15A 3OW2A 5KNBA 4BBSB 4ETSA 4X65L 3L0OA 4Q43A 1W6JA 2IX3A 1LTRD 1SJHD 3OYYA 1FJGL 4JI2H 3I8ZA 2Z4IA 1KJQA 1HR0Q 3RFCA 2YU9A 4A3GB 1SYCA 1RD9D 2VPSA 1GUNA 3J80c 2EYLA 1B6SA 4EBDA 1Y69U 2R6FA 5C5LA 5KT7A 2BOSA 5CV4A 4HAEA 2CH4A 4HN7A 3G48A 4ZHQF 1BNCA 5K2MA 3U50C 1N33H 1S0NA 4KD3A 1HA6A 3PN1A 2C00A 2R8JA 1ZEQX 1KJ9A 4IR9A 1VQPA 3NTKA 1EY8A 4OO1I 2TMPA 1SBBB 1MI2A 1EY5A 2CWAA 3N52A 4A3DH 2R93A 1TWAH 1NUCA 3MVVA 1Y1VB 1HTLD 3MEFA 4DR3L 3KYHC 4XDXA 2VR1A 2Y0SB 3I4MB 4JI8Q 4DK3C 3NQTA 1FL0A 1WFQA 3U58A 2F0OA 4NB3A 4IUQA 3ICEA 1HR0H 1KNEA 2CH4W 3SR1A 4DR5L 3K5IA 3T4AC 4YCVA 4J8QA 4K5VA 3I4NB 1X6OA 2R92A 1PA6A 3KAKA 4IZOA 2L1BA 3GTOB 1X3PA 4YJ2F 1HNWL 3CMEA 3KLSA 4C3IG 4A3JB 1N36L 4ULLA 1L1OA 3R23A 1A2UA 1RJQA 5H80A 3F8TA 5FJ8H 1D6EC 2XRQD 3GIDA 3U4ZA 4JI8H 3CU7A 1ILQA 3V4ZA 1HUNA 4EYHB 2E2HB 2AQ3B 1JXLA 2PZTA 1GOZA 3SDZA 5KX5F 3SK4A 1WCMH 2FK3A 2LY7A 2GPWA 4HJ9A 1WTRA 4EFBA 3M4IA 2GA4B 4PDBA 4L5RC 2JA7B 1CZWA 4A3EB 4DR2Q 1CKNA 4N8FA 1BCPD 4LUZA 4RGTA 2B8FA 3TSSA 3OHAA 2WP8J 3K80C 2KUMA 4B3SQ 5CA1F 1NE3A 1TWGH 2M00A 4RCNA 5CV8A 3OWEB 4U6PA 3H6MA 1I94L 4ED6A 1H9MA 2NU8B 1GSAA 4JI3Q 1G51A 2NVXH 5IYDH 2BH2A 1RJPA 4WD3A 2W6OA 3L9AX 4JBJA 4QIWE 4V0BA 2K5WA 1IYVA 3GTPH 1V51A 3K3PA 2ENBA 4ODGA 3NHHA 5EGTA 1TWFA 4YQWA 1Q8KA 1YNNC 2EYOA 1BBUA 3CF5A 1E4GT 3MWDA 3K5OA 4JI4L 3BAAA 4DR6H 3R3OA 1UEBA 3HP3A 2E2JH 5KFHA 4KHPL 4LF9L 1S5CD 3BVZA 4DGZA 3Q2OA 4O3PA 5CBAE 4DR2H 3KLRA 4IR1A 1C7YA 5KFXA 3CCLA 2VQEL 3RB4A 3ETJA 4B3SH 4GN5A 1IBMQ 3Q22A 1KRSA 4NPSA 4E4TA 3R2IA 1XNQL 2K52A 2NN6G 4JI3H 3OHBA 3KJOA 3BU2A 2A6HC 2W9CB 1DOMA 1Y8NB 1D2BA 3P7JA 4JYAL 2NVQH 2DN8A 5J3BA 1BUVT 2PMZA 3K0YA 1VBGA 1WR2A 1LABA 3AFPA 2W6QA 2FXQA 1K0RA 2W9BA 2RVLA 2RF4A 2WINB 4CJ2C 4G7ZC 4RNOA 3EFXD 4MTNA 4J9PA 4ECZA 4A3IG 3I2ZA 4LF8Q 1BXTA 3G6VA 4IURA 1JDEA 4KHZA 1L2ZA 2DIKA 2RDJA 1HXYD 1EIHA 3RLFA 4A2BA 1BVSA 3MR2A 3J7AV 3H20A 1S97A 1IBMH 3Q6SA 1RK5A 1YVCA 2PNRC 2MNAA 4O3NA 2HQLA 1ZQ7A 5I2XA 4PNYA 1XMQL 1V1PA 1UC8A 4A2AA 2AGOA 5ISRA 2IHEA 4C2MB 5IP7G 3EIVA 1J5EL 5LOVF 3H0GB 2KHSA 2L0CA 4IUUA 4JC0A 1U4MA 2PQAB 3Q24A 4A93H 2Q8TA 1I4RA 5M3FB 4BY1G 1CHPD 1O75A 3HOXG 2DPJA 4CC6A 3KF6A 4A3BH 1B33N 4F4YA 3PUXA 3A5UA 4B3RL 4Y8VB 3DEPA 5GQOA 3KAJA 4C5BA 2RBMA 3A8IE 5LMUQ 2WB1G 4DNTB 2WAQE 5CYUA 1ESFA 2AQ1B 1KQSA 2RDIA 4LFCQ 3MZ5A 4LF8H 5F2DA 5BPFA 3S1QH 2A68D 4K2KA 1TS5A 1OXSC 4DV0Q 1EHIA 3N44B 3D4RA 1VQIA 1VQFA 1S9FA 4RHRA 5C3WA 3BS1A 1IYUA 4LNQA 5C4XB 1YJ9A 2UVWA 1U4LA 4NDXA 4A4IA 3K5HA 3TP5A 2YL2A 2P5ZX 4A3KH 4O4IF 3J7ZC 1KTKA 1LT3D 1WYDA 2NVTB 4R4QA 4ECQA 2A69C 4M9UA 4BBRG 1IBKL 1SE3A 2FLLA 4L5SA 4O42A 5JJZA 2NVYB 1CK1A 4JI1Q 3FDTA 1ASZA 3GTMB 2B2WA 1EY0A 1TKWB 1L0WA 3R8BA 1WTPA 1S03G 4DV7L 4HEDA 1KJ8A 1E7ZA 4LFCH 1PZKD 1MSHA 1PFSA 1LTAD 3BVMA 4DV0H 1QWYA 4KY5A 1R9TH 1EQVA 4JW0A 5M5YB 2FB9A 2RGVA 3RAQA 1B70B 1PYWD 4RKLA 3BVGA 2XCPA 3ONAB 3ULPA 1SDFA 2EYHA 3WO0A 2NU9B 1XTDA 5C4HA 2BA1A 2XIGA 4P2CB 4ECWA 3BDCA 3MFIA 2YTXA 2K5HA 1S4ZA 2PO4A 3NSWA 1U4RA 1XPOA 1RYRA 4RU9A 3D6CA 3T16A 1S5BD 1D5XC 2R7LA 3BA8A 4JI1H 1KL9A 5FPOA 3PCOB 4MNOA 5IT9W 4EEQA 1VS0A 3IG0A 2K75A 2PPBC 4DV6L 3JZIA 3M4OB 2FPIB 5BPHA 1SFOA 1IOWA 4JI7Q 1CSPA 5HBRB 4YR3A 4DAMA 4PZ7A 3GTGB 2VA3A 1PTOC 2UXBH 2Z8LA 3NE5B 3A7AB 4UP7A 2CKZB 4O4HF 2DJGC 5L1LA 2YTYA 4CDCC 2Q2UA 1EUDB 4R1JA 4XZ3B 1PXUA 2LXKA 1Q1EA 2KEDA 4CJ1B 3VA5A 3RV3A 4ED0A 2D9UA 1AUVA 4EGJA 1PH6A 2NN6I 1S0OA 1STYA 4GOPC 2B2YC 3M4QA 2CCZA 4DV2L 3UE1A 4CKCA 2HD3A 5FKAC 5ELEA 4EGVA 3JC66 3UDXA 5IWAL 4RNMA 4JI7H 3SK8A 4BBSH 2EYFA 4YY3Q 2F0LA 5J1ZA 3PW4A 3W3AA 2OTLA 4Q0YA 1PV4A 1D5ZC 1JMCA 3V4SA 3F2UA 1NNXA 3OSNA 5DLFA 3K6OA 3R2TA 4A3GH 2JA8H 3I73A 1SNMA 4UPAA 3FVQA 1X3EA 4QL5A 4PZ6A 2BA0A 1JJ2A 1JB3A 3U9OA 5FOBB 3MFHA 1PMRA 3M7NA 3I7FA 1PYBA 1JX4A 1PZID 5KFYA 5BN5A 3M9OB 1ESRA 1JICA 5D3DA 2ZJTA 1ZETA 4LF7L 1LTTD 2HQEA 2KEEA 1S0MA 1OO9B 2R8KA 5M5WB 2VQDA 4GKKQ 5KFNA 5JEAH 4AQYQ 1Y1VH 3K5MA 2ASLA 4AIMA 1FGBD 4I4TF 3RBDA 4I7AA 3J81j 4F4XA 2XGTA 4LW1A 3S1MH 4ZQIA 5GONF 1V1QA 3Q8SB 4DV1L 4ECUA 1TWCH 3NGDA 5KRUA 3RLOA 5F9LA 3FKIG 3QO2A 3WDNA 2LS01 4GNXA 1XMOL 2E5LL 3HOWB 4QWDA 1CA5A 3GIJA 5KKNB 4ME3A 4R4IA 3BJUA 4JOIC 1FNVA 3GV8B 1ULZA 1K9MC 1KIXA 4KLKA 2BR0A 4JBKA 4K0KL 4Q45A 1I6VC 2F0SA 4PWQA 1FD7D 4A3JH 2AGQA 1N34H 4RUAA 3T1HL 4UDUC 2ZDGA 2ZM6Q 4HNVA 4GKKH 1CKOA 4B3ML 5EWEA 4AQYH 4DUYQ 1HQMC 2E2IB 1JWSD 3KALA 2R7DA 4QIWB 4OELB 3D3RA 3J81c 5D65A 3I12A 4X3TA 4JVZA 2EJFC 4C5AA 1PH1A 2ZT9C 2E76C 2B63G 3BABA 1TWGB 1E2ZA 4C3HH 2K1BA 4MA0A 4APMA 3HKZG 2QDLA 4RB2C 2ALZA 1OXVA 4ZYSA 2NVXB 4XYMB 1TXYA 5JJKA 2RCFA 4FM9A 4A3EH 4G7OC 2B2YA 1L0YB 2Q8IB 1G91A 1VF7A 4KJNA 3OWFA 2GLTA 1XDNA 2Y0SG 3I4MG 1BGWA 3OTOL 3NQIA 3PSIA 1QB5D 1MBYA 2MJ8A 4IZ8A 2GVBA 5FK9C 2R7ZB 1CA6A 2B2TC 2ZM6H 1GGOA 3TMEA 2E2JB 4DUYH 3FHWA 3EBEA 3MJFA 3MXNB 1ICFB 4POGA 4UCSA 1NY4A 3S14B 2VY3A 4OL7A 3I4NG 5IYBG 1I50A 3GO5A 1AN8A 3E5NA 5DG9A 3MR6A 3T5LA 1KXLA 1STEA 1Z47A 1PRTC 1LYLA 2K4KA 3MWYW 2RKSA 3VA7A 4GLAC 1BF4A 2VXWA 4RAZA 4ABNA 1YNXA 2PVPA 1MSGA 2UXCL 3H4DA 4TKOB 1IYJB 3JAMW 1IOVA 3PGZA 3S24A 3SI8A 2XIWA 4YCWA 1DV1A 3OSPA 1PLFA 1WTWA 4DL7A 3J80L 1LTBD 3TEHB 3N40P 4ECTA 1PTOD 4J9OA 5IODA 1VQNA 3HB9A 4BWSC 4K2LA 2JA7G 4FS2A 2WB1A 5KFMA 4B3TL 3KHRA 2VB2X 2AU0A 4LJZC 2EYJA 3KDFA 3S1RH 2FPGB 1AE2A 4XT1B 4P73A 2WYOA 3PW0A 2WAQB 5C4JH 2UU9H 2BE5C 3BYTB 3QIAA 2OQ0A 2L9HA 1D8LA 4TUYF 1EU3A 4JV5L 3A54A 2R82A 2Z6KC 3KHGA 3K5NA 4A93B 1PHJA 4P71A 1E0BA 1SR3A 1EWHA 4GN4B 2PMZE 3CC7A 4JV2A 4QUCA 1T36A 3I91A 5IP9H 4I55F 4KY7A 4RH6A 4C2MH 4H02A 4X66L 3JRXA 4LSAA 3ORQA 2I5LX 4X62Q 5EPJA 3H0GH 2OQKA 4APVA 5BN3A 3S1QB 1WTXA 3KF8B 1ENCA 2JA6G 2UUCL 4JI6L 3VYUA 3K59A 4K6DA 4LF4Q 1R4PB 1XPUA 4M7EA 1IBLL 2UXDL 2R7KA 5A35A 1W2BA 5LMNQ 4A3KB 5E4WC 4PMBA 2LSSA 1PZJD 3BJYA 3GILA 5BR8Q 5LL6S 2EE1A 2EPBA 3JAMi 1K0SA 1ILPA 1CZGA 5TSSA 1CQFA 3EPIA 3ZJYC 3HXLA 3HEJA 1MJEA
chains in the Genus database with same CATH topology
2LXJA 2ZTDA 1PA6A 1SRUA 1PH3A 3DM3A 4YHHL 1LTLA 4EX5A 1HNWL 3KLWA 3CMEA 4DV1Q 1MKHA 3SGIA 2WAQG 4OWTB 1N36L 1L1OA 2XTIA 3L2PA 4A3GG 2JA8G 5AJ3Q 3HKZE 3UDIA 2NVTH 1HH2P 1NMGA 2E5LQ 3F8TA 4X64Q 5FJ8H 5C0XJ 4DR7L 3HOVG 1PH4A 1EUJA 3U4ZA 4DR1Q 1HR0W 3RLNA 2UXBL 1T9HA 1N32L 2NVYH 4R4TA 1GO3E 4LF6L 3ERSX 3GTMH 3I55A 3AQQA 3JAMc 2HHHL 1YHBA 2JEAI 1WCMH 4K0KQ 4P74A 3STBC 4HJ9A 3PO2H 4L5QA 1Q7YC 1X65A 1U0LA 5JEAG 4GOPA 2UUBQ 4L5RC 4NXNL 1Y1VG 4QGUA 2K5NA 3A0JA 4YWLA 2NZOA 4DR2Q 1CKNA 3F1ZA 2N78A 4LUZA 3GTJH 5M3FG 2VUMH 5FLMG 3W5OA 2WP8J 2RHSB 1DGSA 1PH5A 3K80C 4B3SQ 2K14A 1NE3A 1TWGH 3NELA 4XIGS 1I94L 5C0XG 1Y14B 4LUOA 1YIJA 4JI3Q 1G51A 1I5FA 2NVXH 4JI7L 1NTGA 2BH2A 4XTCS 5IYDH 3S16H 1HZCA 1TWFH 4JBJA 2MO1A 4QIWE 4GNXC 1XNRL 1B8AA 5C44H 3AYHB 5IYCH 3GTPH 3F2BA 2A19A 1YI2A 5LMNW 1VQ5A 1VQ7A 1YZ6A 2Z6KA 5C4XG 1Q8KA 2UU9Q 1BBUA 3CF5A 4JBMA 4A3JG 2KBNA 4JI4L 1TWHH 1N9WA 1IXRA 1SMXA 1UEBA 2BH8A 3UDFA 4DPGA 3F2CA 1XJVA 2E2JH 3K0XA 4KHPL 4LF9L 3M4OH 2I5MX 4QQBX 4DV6Q 1YITA 1N33L 1C7YA 2CQOA 3M9BA 3CCLA 1X3FA 5IE8A 1PYSB 2VQEL 1A62A 4HJ5A 1H95A 4NXMQ 4GN5A 1IBMQ 1KRSA 4NPSA 1P16A 3PUYA 1XNQL 2K52A 2EIFA 4IFDJ 1A8VA 4IPCA 1Q12A 2NN6G 5GAHC 3J7A5 4BY7G 4IOCA 4GS3A 4R4OA 3KJOA 3BU2A 3K81C 3KDFB 1Q46A 4A3EG 4LWCA 1CSQA 1E22A 1PH7A 3PO3G 1K83H 3ER0A 4JYAL 2Q2HA 2NVQH 1VQDA 4YWMA 1MIUA 5J3BA 4JOIA 5M5XH 2VNUD 2CFMA 3M85A 3AFPA 2FXQA 1K0RA 2R6GA 2RF4A 4DV4L 1HNXL 1QUQB 1L2FA 4DV2Q 1B7YB 4MTNA 2OTJA 1Q82C 1GD7A 4A3IG 1PH2A 3I2ZA 4LF8Q 3PUVA 4L5TA 1QZHA 1E1OA 4LFBQ 3KFUA 4KHZA 5JJKA 3L7ZC 4DKAC 2MQHA 3RLFA 1BVSA 3G4SA 1YJWA 4IFDG 1N34L 1BKBA 4GLVB 1VQHA 1YVCA 2MNAA 4GKKL 4EQ5A 2HQLA 2VL6A 1VQCA 4X62L 1YHAA 1XMQL 1EOVA 2F52A 1EWIA 2IHEA 5IP7G 1FJGQ 3EIVA 1J5EL 2KHIA 4JI5L 3E9IA 2GVAA 3G6EA 4JC0A 2PQAB 4OX9Q 3NEMA 4JI8L 4A93H 4JV5Q 3PIOA 1S40A 2JK8A 4BY1G 3HOXG 4LF4L 1QZGA 2B63H 3KF6A 4AYBG 3GTLH 4A3BH 2DGYA 4A3LH 3PUXA 3A5UA 1IL2A 4B3RL 5GQOA 5LMNL 5M5WH 5LMUQ 2ID0A 2WB1G 2YV5A 3DLLA 2WAQE 5GAGC 4JI0L 1K3RA 1KQSA 3HOZG 4LFCQ 3B6YA 3S1QH 2KCMA 5JEAJ 4DV3Q 4A75A 3RN5A 1OXSC 1S72A 2HIVA 4DV0Q 2IX1A 2I5HA 4A3FG 3I4MH 1VQIA 3PF4A 1VQFA 4OXPA 1YJNA 1L1OB 4OWXB 5GAEC 4LNQA 3I4OA 2ZM6L 1YJ9A 2UUCQ 4A4IA 1E1TA 4DUYL 5AJ3L 3HOWH 3CPFA 4A3KH 2OCEA 3J7ZC 1XMOQ 2GN5A 1WYDA 4X64L 1IBLQ 4GLXA 4A3MG 1VQ6A 1OXTA 1RIPA 1V43A 4R4QA 3TS0A 4A3CG 1UWVA 4DR1L 2IHFA 2Q2IA 4BBRG 1IBKL 2JA5H 5IYBH 3I4NH 1JJGA 1HZ9A 1Y1WH 4L5SA 3CP0A 2KCTA 5C3EH 2QEXA 2NZHA 2Y0SE 3GTOH 1AE3A 1VQ8A 4JI1Q 1ASZA 4GOPB 2R93G 1L0WA 4ALPA 1MJCA 5IP9G 3HOYH 2HIXA 4DV7L 4DR6Q 2UUBL 1C0AA 1CKNB 3T1HQ 1E7ZA 2E2IH 4DR4Q 4BXXG 3F2DA 4A3DG 2ASBA 1PFSA 3H0GG 4B3MQ 1RL2A 4C3JH 1EQRA 3CQZH 2ZJPA 3H15A 4HIDA 1R9TH 3RZDH 3W1GA 4B3SL 2AMCB 2ZJQA 2OWOA 2AHOB 3D0FA 5HY6A 2CWPA 3GD7A 3CCEA 1B70B 2E2HH 1N32Q 2UUAQ 3ULPA 4LF6Q 1K8AC 1XTDA 3RZOH 3GDEA 2BA1A 3TQYA 1NJIC 2HHHQ 2R92G 4IPGA 1C9OA 2YTXA 4O0AA 2K5HA 4JCVE 3G71A 2JA7H 4P72A 1LUZA 4DV5Q 1Y1WG 3STBD 3HOUG 1I6HH 4JI2L 1XPOA 2KENA 3E0EA 5C0XI 5E7NA 2UU9L 3S1NH 1KL9A 4IJHA 4PZ8A 3OTOQ 2ZTCA 2EXDA 5EAYA 3T1YL 1SFOH 2R7ZH 2F3IA 1HNZQ 3PCOB 1JT8A 4DUZQ 4MNOA 2WFWA 3CCQA 2H5XA 2N3SA 1VS0A 3E9HA 2K75A 1LM0A 2MFIA 3S14H 4DV6L 1I50H 1EIFA 4JG2A 5FJ8G 3S15H 2N49A 4GKJL 2IY5B 4JI7Q 1CSPA 2A1AA 2C35B 3KOJA 4TQUS 2VQFQ 1VQOA 2A8VA 1L1OC 4DAMA 3LGJA 1Q1BA 2YTVA 4PZ7A 4HJ8A 3GTKH 2ALYB 4UP7A 2AWOA 1WCMG 2CKZB 3H3VI 2AKWB 1VQ9A 1GVPA 3PO2G 2YTYA 2B29A 2Q2UA 4R1JA 1KRTA 3WWVA 1YBYA 2K5VA 2LXKA 1Q1EA 4UP8A 2JA6H 1BBWA 1UE1A 5GROA 1FVIA 3CXCA 1HR0L 1E24A 1PH6A 2NN6I 4DAYB 2UXCQ 4KI0A 4GOPC 4OWWB 3M4QA 3PIPA 1QVGA 2CCZA 4DV2L 2F4VL 3UE1A 4WJ3M 3CCJA 4LF8L 2IX0A 1EFWA 3FP9A 2VZAA 1XNQQ 5M3MH 3JC66 3UDXA 5IYDG 5IWAL 3A5ZB 2D62A 3VDYA 1M90C 4YY3Q 2Q2TA 4BBSH 1KHIA 4B3TQ 4LF5Q 5C44G 1W3SA 5IYCG 2OTLA 5JJLA 1E3PA 4BA2I 4X65Q 1PV4A 1JMCA 2D0PA 4AYBE 4C3IH 4A3GH 4TVAB 2JA8H 4O2DA 3ULLA 3CCUA 1QVFA 1PH9A 3AFQA 2WB1E 4UPAA 4OX9L 2DUDA 1X3EA 4DV4Q 1HNXQ 4QL5A 4PZ6A 2BA0A 2ZJRA 1Q81C 1JJ2A 2HT1A 3HOVH 4IFDI 4J15A 3K7AH 4OO1G 2I0QA 1QUQA 3M7NA 3I7FA 1PYBA 3PV0A 1HJPA 1UE6A 4DNIA 5LMUL 1HZAA 4LF7L 3CD6A 1SE8A 5BR8L 4LFAL 1VQKA 4LFCL 4PMWA 3S17H 4HIOA 4GKKQ 2E8GA 4X66Q 5H1SE 4IO9A 4AQYQ 5ELNA 1K8GA 3BZKA 1Y1VH 1VQJA 2JQOA 1KAWA 5DLQE 4AIMA 3J81j 3GTQH 2XGTA 4LW1A 3S1MH 1V1QA 5M3FH 1G291 4DR3Q 3CMAA 4JI5Q 5FLMH 4DV1L 3PUWA 1WJJA 3HFZB 1GM5A 1TWCH 3PF5A 2EQSA 4JI6Q 3J81i 3RLOA 4IOAA 1M1KC 3CCVA 5IY0A 3FKIG 3M3YH 4GNXA 2E5LL 1XMOL 2IT1A 1UE5A 4A76A 4DR5Q 2PI2E 2VS1A 2D0OA 2UXDQ 3CAMA 1CKMA 5JJIA 1JJCB 1X3GA 2MO0A 4ME3A 4R4IA 3CC2A 3BJUA 4JOIC 3RR5A 2ATWA 4DK6C 1S3OA 1VQBA 1OTCA 5IT9c 4Y7NH 4JI0Q 1OXXK 2QGQA 2B3GA 1X54A 1K9MC 1KIXA 4KLKA 4LFAQ 4JI1L 3NENA 4JBKA 1N8RC 4K0KL 4HIKA 5C4XH 4YHHQ 2ZTEA 4A3JH 4DR6L 2V1CC 1HNWQ 1ASYA 4WJ4A 1CUKA 3T1HL 3AEVA 2ZM6Q 3UDGA 3TREA 4DR4L 1CKOA 4B3ML 4PG3A 2RHQB 3W1BA 4DUYQ 1N36Q 1JB7A 4DR2L 1AH9A 2R7DA 2ES2A 3H3VH 5K36G 3S2HH 3EN2A 3J81c 1EIYB 4UP9A 3TS2A 4A93G 4Y52H 1D7QA 4DR7Q 3CCRA 3IRBA 1WI5A 1FGUA 1PH1A 1IBKQ 2Z0SA 2UXBQ 2B63G 1SLJA 2UUAL 4A3BG 4C3HH 4A3LG 4HIMA 3U4VA 3CW2C 4JI3L 3HKZG 3PUZA 4LUVA 4BA1I 4BY7H 1OXVA 3K7UC 1Q86C 1I3QH 1TXYA 2JA9A 1P8LA 4DV7Q 4IPDA 4AH6A 4A3EH 4DV5L 3CPWA 3CC4A 3PO3H 1SROA 4NXNQ 4OONA 1YHQA 2K50A 1VQEA 2Y0SG 3I4MG 1X55A 1A0IA 5M5YH 3OTOL 1VQAA 2JEBI 1PVOA 1UE7A 1HNZL 1O7IA 3PSIA 3K8AA 4DUZL 4RG1A 1NBWA 2GVBA 2QA4A 3HOWG 1VQLA 2JE6I 4IPHA 4A3KG 4A3IH 1I94Q 1OXUA 3FHWA 3EBEA 3MXNB 4POGA 1NY4A 1X9NA 2N8NA 2VY3A 2VQFL 3I4NG 3RNUA 5IYBG 2JA5G 4NXML 1IBML 2VW9A 1VQGA 2R7FA 2RCNA 1G6PA 1EQQA 5C3EG 3GO5A 1VCIA 1XNRQ 3A74A 4JI2Q 4JBWA 3HKSA 5IP7H 3HOYG 1KXLA 1EYGA 1GKHA 1Z47A 3RN2A 4RMFA 1LYLA 1K73C 4YWKA 3T1YQ 2K4KA 4JI4Q 4GLAC 1VQMA 5HGQA 4KHPQ 4LF9Q 1SN8A 2JJQA 4BY1H 1YNXA 3HOXH 3J80i 2VUMG 3CCSA 2UXCL 1IYJB 1N33Q 3PGZA 3S24A 5GADC 3GTGH 4GKJQ 2VQEQ 4YCWA 4X6AH 4GN3B 3TRZA 1A63A 1WOCA 1X56A 4UY8C 3M4PA 1HZBA 3HOZH 4FDBA 4QY7A 3TEHB 4R4CA 4LFBL 2AWNA 1V9PA 3ULJA 1VQNA 5ELOA 4IJLA 1J6QA 4YY3L 3BZCA 2JA7G 1IZ6A 4QJFA 4B3TL 2L15A 4LF5L 3OW2A 3D31A 4A3FH 2YU9H 4X65L 3L0OA 3KDFA 3S1RH 4JYAQ 1AE2A 3OYYA 1FJGL 3HOUH 4P73A 1HR0Q 3FKIH 5C4JH 2R7ZG 2OQ0A 4A3MH 1D8LA 4A3CH 1YEZA 3J80c 4JV5L 3KF6B 4P75A 2F4VQ 2Z6KC 4BBRH 1KD1C 1PHJA 4P71A 1SR3A 2PNHA 4GN4B 2PMZE 3CC7A 1JE5A 3G48A 5IWAQ 3U50C 3NBHB 2R93H 4YCUA 5IP9H 1N34Q 2KHJA 1VQPA 1XPRA 4C2MH 4H02A 4X66L 4AQYL 4OO1I 4BXXH 4POFA 2I5LX 4X62Q 1XMQQ 4A3DH 2CWAA 4DV3L 3H0GH 2OQKA 4DV0L 2PI2A 1TWAH 4APVA 1J5EQ 2YYZA 1NMFA 3MEFA 4DR3L 1VQ4A 1QVCA 3KYHC 5FLXc 3KF8B 2JA6G 4JI8Q 4DK3C 4GNXB 2UUCL 4JI6L 3I56A 1FL0A 1WFQA 3U58A 1KC8C 2PQAA 4LF4Q 4NB3A 3CCMA 4HJ7A 1Z9FA 3Q8DA 1PH8A 1XPUA 3ICEA 4DR5L 1IBLL 2UXDL 1W2BA 3UE0A 4B3RQ 4HJAA 5LMNQ 4MZ9A 2LSSA 1U5KA 4YCVA 4LF7Q 2R92H 3S2DH 5BR8Q 3JAMi 5M3MG 3KJPA 3ZJYC 1X6OA 1MJEA 4BBSG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LXJ A;  2ZTD A;  1PA6 A;  1SRU A;  1PH3 A;  3DM3 A;  4YHH L;  1LTL A;  4EX5 A;  1HNW L;  3KLW A;  3CME A;  4DV1 Q;  1MKH A;  3SGI A;  2WAQ G;  4OWT B;  1N36 L;  1L1O A;  2XTI A;  3L2P A;  4A3G G;  2JA8 G;  5AJ3 Q;  3HKZ E;  3UDI A;  2NVT H;  1HH2 P;  1NMG A;  2E5L Q;  3F8T A;  4X64 Q;  5FJ8 H;  5C0X J;  4DR7 L;  3HOV G;  1PH4 A;  1EUJ A;  3U4Z A;  4DR1 Q;  1HR0 W;  3RLN A;  2UXB L;  1T9H A;  1N32 L;  2NVY H;  4R4T A;  1GO3 E;  4LF6 L;  3ERS X;  3GTM H;  3I55 A;  3AQQ A;  3JAM c;  2HHH L;  1YHB A;  2JEA I;  1WCM H;  4K0K Q;  4P74 A;  3STB C;  4HJ9 A;  3PO2 H;  4L5Q A;  1Q7Y C;  1X65 A;  1U0L A;  5JEA G;  4GOP A;  2UUB Q;  4L5R C;  4NXN L;  1Y1V G;  4QGU A;  2K5N A;  3A0J A;  4YWL A;  2NZO A;  4DR2 Q;  1CKN A;  3F1Z A;  2N78 A;  4LUZ A;  3GTJ H;  5M3F G;  2VUM H;  5FLM G;  3W5O A;  2WP8 J;  2RHS B;  1DGS A;  1PH5 A;  3K80 C;  4B3S Q;  2K14 A;  1NE3 A;  1TWG H;  3NEL A;  4XIG S;  1I94 L;  5C0X G;  1Y14 B;  4LUO A;  1YIJ A;  4JI3 Q;  1G51 A;  1I5F A;  2NVX H;  4JI7 L;  1NTG A;  2BH2 A;  4XTC S;  5IYD H;  3S16 H;  1HZC A;  1TWF H;  4JBJ A;  2MO1 A;  4QIW E;  4GNX C;  1XNR L;  1B8A A;  5C44 H;  3AYH B;  5IYC H;  3GTP H;  3F2B A;  2A19 A;  1YI2 A;  5LMN W;  1VQ5 A;  1VQ7 A;  1YZ6 A;  2Z6K A;  5C4X G;  1Q8K A;  2UU9 Q;  1BBU A;  3CF5 A;  4JBM A;  4A3J G;  2KBN A;  4JI4 L;  1TWH H;  1N9W A;  1IXR A;  1SMX A;  1UEB A;  2BH8 A;  3UDF A;  4DPG A;  3F2C A;  1XJV A;  2E2J H;  3K0X A;  4KHP L;  4LF9 L;  3M4O H;  2I5M X;  4QQB X;  4DV6 Q;  1YIT A;  1N33 L;  1C7Y A;  2CQO A;  3M9B A;  3CCL A;  1X3F A;  5IE8 A;  1PYS B;  2VQE L;  1A62 A;  4HJ5 A;  1H95 A;  4NXM Q;  4GN5 A;  1IBM Q;  1KRS A;  4NPS A;  1P16 A;  3PUY A;  1XNQ L;  2K52 A;  2EIF A;  4IFD J;  1A8V A;  4IPC A;  1Q12 A;  2NN6 G;  5GAH C;  3J7A 5;  4BY7 G;  4IOC A;  4GS3 A;  4R4O A;  3KJO A;  3BU2 A;  3K81 C;  3KDF B;  1Q46 A;  4A3E G;  4LWC A;  1CSQ A;  1E22 A;  1PH7 A;  3PO3 G;  1K83 H;  3ER0 A;  4JYA L;  2Q2H A;  2NVQ H;  1VQD A;  4YWM A;  1MIU A;  5J3B A;  4JOI A;  5M5X H;  2VNU D;  2CFM A;  3M85 A;  3AFP A;  2FXQ A;  1K0R A;  2R6G A;  2RF4 A;  4DV4 L;  1HNX L;  1QUQ B;  1L2F A;  4DV2 Q;  1B7Y B;  4MTN A;  2OTJ A;  1Q82 C;  1GD7 A;  4A3I G;  1PH2 A;  3I2Z A;  4LF8 Q;  3PUV A;  4L5T A;  1QZH A;  1E1O A;  4LFB Q;  3KFU A;  4KHZ A;  5JJK A;  3L7Z C;  4DKA C;  2MQH A;  3RLF A;  1BVS A;  3G4S A;  1YJW A;  4IFD G;  1N34 L;  1BKB A;  4GLV B;  1VQH A;  1YVC A;  2MNA A;  4GKK L;  4EQ5 A;  2HQL A;  2VL6 A;  1VQC A;  4X62 L;  1YHA A;  1XMQ L;  1EOV A;  2F52 A;  1EWI A;  2IHE A;  5IP7 G;  1FJG Q;  3EIV A;  1J5E L;  2KHI A;  4JI5 L;  3E9I A;  2GVA A;  3G6E A;  4JC0 A;  2PQA B;  4OX9 Q;  3NEM A;  4JI8 L;  4A93 H;  4JV5 Q;  3PIO A;  1S40 A;  2JK8 A;  4BY1 G;  3HOX G;  4LF4 L;  1QZG A;  2B63 H;  3KF6 A;  4AYB G;  3GTL H;  4A3B H;  2DGY A;  4A3L H;  3PUX A;  3A5U A;  1IL2 A;  4B3R L;  5GQO A;  5LMN L;  5M5W H;  5LMU Q;  2ID0 A;  2WB1 G;  2YV5 A;  3DLL A;  2WAQ E;  5GAG C;  4JI0 L;  1K3R A;  1KQS A;  3HOZ G;  4LFC Q;  3B6Y A;  3S1Q H;  2KCM A;  5JEA J;  4DV3 Q;  4A75 A;  3RN5 A;  1OXS C;  1S72 A;  2HIV A;  4DV0 Q;  2IX1 A;  2I5H A;  4A3F G;  3I4M H;  1VQI A;  3PF4 A;  1VQF A;  4OXP A;  1YJN A;  1L1O B;  4OWX B;  5GAE C;  4LNQ A;  3I4O A;  2ZM6 L;  1YJ9 A;  2UUC Q;  4A4I A;  1E1T A;  4DUY L;  5AJ3 L;  3HOW H;  3CPF A;  4A3K H;  2OCE A;  3J7Z C;  1XMO Q;  2GN5 A;  1WYD A;  4X64 L;  1IBL Q;  4GLX A;  4A3M G;  1VQ6 A;  1OXT A;  1RIP A;  1V43 A;  4R4Q A;  3TS0 A;  4A3C G;  1UWV A;  4DR1 L;  2IHF A;  2Q2I A;  4BBR G;  1IBK L;  2JA5 H;  5IYB H;  3I4N H;  1JJG A;  1HZ9 A;  1Y1W H;  4L5S A;  3CP0 A;  2KCT A;  5C3E H;  2QEX A;  2NZH A;  2Y0S E;  3GTO H;  1AE3 A;  1VQ8 A;  4JI1 Q;  1ASZ A;  4GOP B;  2R93 G;  1L0W A;  4ALP A;  1MJC A;  5IP9 G;  3HOY H;  2HIX A;  4DV7 L;  4DR6 Q;  2UUB L;  1C0A A;  1CKN B;  3T1H Q;  1E7Z A;  2E2I H;  4DR4 Q;  4BXX G;  3F2D A;  4A3D G;  2ASB A;  1PFS A;  3H0G G;  4B3M Q;  1RL2 A;  4C3J H;  1EQR A;  3CQZ H;  2ZJP A;  3H15 A;  4HID A;  1R9T H;  3RZD H;  3W1G A;  4B3S L;  2AMC B;  2ZJQ A;  2OWO A;  2AHO B;  3D0F A;  5HY6 A;  2CWP A;  3GD7 A;  3CCE A;  1B70 B;  2E2H H;  1N32 Q;  2UUA Q;  3ULP A;  4LF6 Q;  1K8A C;  1XTD A;  3RZO H;  3GDE A;  2BA1 A;  3TQY A;  1NJI C;  2HHH Q;  2R92 G;  4IPG A;  1C9O A;  2YTX A;  4O0A A;  2K5H A;  4JCV E;  3G71 A;  2JA7 H;  4P72 A;  1LUZ A;  4DV5 Q;  1Y1W G;  3STB D;  3HOU G;  1I6H H;  4JI2 L;  1XPO A;  2KEN A;  3E0E A;  5C0X I;  5E7N A;  2UU9 L;  3S1N H;  1KL9 A;  4IJH A;  4PZ8 A;  3OTO Q;  2ZTC A;  2EXD A;  5EAY A;  3T1Y L;  1SFO H;  2R7Z H;  2F3I A;  1HNZ Q;  3PCO B;  1JT8 A;  4DUZ Q;  4MNO A;  2WFW A;  3CCQ A;  2H5X A;  2N3S A;  1VS0 A;  3E9H A;  2K75 A;  1LM0 A;  2MFI A;  3S14 H;  4DV6 L;  1I50 H;  1EIF A;  4JG2 A;  5FJ8 G;  3S15 H;  2N49 A;  4GKJ L;  2IY5 B;  4JI7 Q;  1CSP A;  2A1A A;  2C35 B;  3KOJ A;  4TQU S;  2VQF Q;  1VQO A;  2A8V A;  1L1O C;  4DAM A;  3LGJ A;  1Q1B A;  2YTV A;  4PZ7 A;  4HJ8 A;  3GTK H;  2ALY B;  4UP7 A;  2AWO A;  1WCM G;  2CKZ B;  3H3V I;  2AKW B;  1VQ9 A;  1GVP A;  3PO2 G;  2YTY A;  2B29 A;  2Q2U A;  4R1J A;  1KRT A;  3WWV A;  1YBY A;  2K5V A;  2LXK A;  1Q1E A;  4UP8 A;  2JA6 H;  1BBW A;  1UE1 A;  5GRO A;  1FVI A;  3CXC A;  1HR0 L;  1E24 A;  1PH6 A;  2NN6 I;  4DAY B;  2UXC Q;  4KI0 A;  4GOP C;  4OWW B;  3M4Q A;  3PIP A;  1QVG A;  2CCZ A;  4DV2 L;  2F4V L;  3UE1 A;  4WJ3 M;  3CCJ A;  4LF8 L;  2IX0 A;  1EFW A;  3FP9 A;  2VZA A;  1XNQ Q;  5M3M H;  3JC6 6;  3UDX A;  5IYD G;  5IWA L;  3A5Z B;  2D62 A;  3VDY A;  1M90 C;  4YY3 Q;  2Q2T A;  4BBS H;  1KHI A;  4B3T Q;  4LF5 Q;  5C44 G;  1W3S A;  5IYC G;  2OTL A;  5JJL A;  1E3P A;  4BA2 I;  4X65 Q;  1PV4 A;  1JMC A;  2D0P A;  4AYB E;  4C3I H;  4A3G H;  4TVA B;  2JA8 H;  4O2D A;  3ULL A;  3CCU A;  1QVF A;  1PH9 A;  3AFQ A;  2WB1 E;  4UPA A;  4OX9 L;  2DUD A;  1X3E A;  4DV4 Q;  1HNX Q;  4QL5 A;  4PZ6 A;  2BA0 A;  2ZJR A;  1Q81 C;  1JJ2 A;  2HT1 A;  3HOV H;  4IFD I;  4J15 A;  3K7A H;  4OO1 G;  2I0Q A;  1QUQ A;  3M7N A;  3I7F A;  1PYB A;  3PV0 A;  1HJP A;  1UE6 A;  4DNI A;  5LMU L;  1HZA A;  4LF7 L;  3CD6 A;  1SE8 A;  5BR8 L;  4LFA L;  1VQK A;  4LFC L;  4PMW A;  3S17 H;  4HIO A;  4GKK Q;  2E8G A;  4X66 Q;  5H1S E;  4IO9 A;  4AQY Q;  5ELN A;  1K8G A;  3BZK A;  1Y1V H;  1VQJ A;  2JQO A;  1KAW A;  5DLQ E;  4AIM A;  3J81 j;  3GTQ H;  2XGT A;  4LW1 A;  3S1M H;  1V1Q A;  5M3F H;  1G29 1;  4DR3 Q;  3CMA A;  4JI5 Q;  5FLM H;  4DV1 L;  3PUW A;  1WJJ A;  3HFZ B;  1GM5 A;  1TWC H;  3PF5 A;  2EQS A;  4JI6 Q;  3J81 i;  3RLO A;  4IOA A;  1M1K C;  3CCV A;  5IY0 A;  3FKI G;  3M3Y H;  4GNX A;  2E5L L;  1XMO L;  2IT1 A;  1UE5 A;  4A76 A;  4DR5 Q;  2PI2 E;  2VS1 A;  2D0O A;  2UXD Q;  3CAM A;  1CKM A;  5JJI A;  1JJC B;  1X3G A;  2MO0 A;  4ME3 A;  4R4I A;  3CC2 A;  3BJU A;  4JOI C;  3RR5 A;  2ATW A;  4DK6 C;  1S3O A;  1VQB A;  1OTC A;  5IT9 c;  4Y7N H;  4JI0 Q;  1OXX K;  2QGQ A;  2B3G A;  1X54 A;  1K9M C;  1KIX A;  4KLK A;  4LFA Q;  4JI1 L;  3NEN A;  4JBK A;  1N8R C;  4K0K L;  4HIK A;  5C4X H;  4YHH Q;  2ZTE A;  4A3J H;  4DR6 L;  2V1C C;  1HNW Q;  1ASY A;  4WJ4 A;  1CUK A;  3T1H L;  3AEV A;  2ZM6 Q;  3UDG A;  3TRE A;  4DR4 L;  1CKO A;  4B3M L;  4PG3 A;  2RHQ B;  3W1B A;  4DUY Q;  1N36 Q;  1JB7 A;  4DR2 L;  1AH9 A;  2R7D A;  2ES2 A;  3H3V H;  5K36 G;  3S2H H;  3EN2 A;  3J81 c;  1EIY B;  4UP9 A;  3TS2 A;  4A93 G;  4Y52 H;  1D7Q A;  4DR7 Q;  3CCR A;  3IRB A;  1WI5 A;  1FGU A;  1PH1 A;  1IBK Q;  2Z0S A;  2UXB Q;  2B63 G;  1SLJ A;  2UUA L;  4A3B G;  4C3H H;  4A3L G;  4HIM A;  3U4V A;  3CW2 C;  4JI3 L;  3HKZ G;  3PUZ A;  4LUV A;  4BA1 I;  4BY7 H;  1OXV A;  3K7U C;  1Q86 C;  1I3Q H;  1TXY A;  2JA9 A;  1P8L A;  4DV7 Q;  4IPD A;  4AH6 A;  4A3E H;  4DV5 L;  3CPW A;  3CC4 A;  3PO3 H;  1SRO A;  4NXN Q;  4OON A;  1YHQ A;  2K50 A;  1VQE A;  2Y0S G;  3I4M G;  1X55 A;  1A0I A;  5M5Y H;  3OTO L;  1VQA A;  2JEB I;  1PVO A;  1UE7 A;  1HNZ L;  1O7I A;  3PSI A;  3K8A A;  4DUZ L;  4RG1 A;  1NBW A;  2GVB A;  2QA4 A;  3HOW G;  1VQL A;  2JE6 I;  4IPH A;  4A3K G;  4A3I H;  1I94 Q;  1OXU A;  3FHW A;  3EBE A;  3MXN B;  4POG A;  1NY4 A;  1X9N A;  2N8N A;  2VY3 A;  2VQF L;  3I4N G;  3RNU A;  5IYB G;  2JA5 G;  4NXM L;  1IBM L;  2VW9 A;  1VQG A;  2R7F A;  2RCN A;  1G6P A;  1EQQ A;  5C3E G;  3GO5 A;  1VCI A;  1XNR Q;  3A74 A;  4JI2 Q;  4JBW A;  3HKS A;  5IP7 H;  3HOY G;  1KXL A;  1EYG A;  1GKH A;  1Z47 A;  3RN2 A;  4RMF A;  1LYL A;  1K73 C;  4YWK A;  3T1Y Q;  2K4K A;  4JI4 Q;  4GLA C;  1VQM A;  5HGQ A;  4KHP Q;  4LF9 Q;  1SN8 A;  2JJQ A;  4BY1 H;  1YNX A;  3HOX H;  3J80 i;  2VUM G;  3CCS A;  2UXC L;  1IYJ B;  1N33 Q;  3PGZ A;  3S24 A;  5GAD C;  3GTG H;  4GKJ Q;  2VQE Q;  4YCW A;  4X6A H;  4GN3 B;  3TRZ A;  1A63 A;  1WOC A;  1X56 A;  4UY8 C;  3M4P A;  1HZB A;  3HOZ H;  4FDB A;  4QY7 A;  3TEH B;  4R4C A;  4LFB L;  2AWN A;  1V9P A;  3ULJ A;  1VQN A;  5ELO A;  4IJL A;  1J6Q A;  4YY3 L;  3BZC A;  2JA7 G;  1IZ6 A;  4QJF A;  4B3T L;  2L15 A;  4LF5 L;  3OW2 A;  3D31 A;  4A3F H;  2YU9 H;  4X65 L;  3L0O A;  3KDF A;  3S1R H;  4JYA Q;  1AE2 A;  3OYY A;  1FJG L;  3HOU H;  4P73 A;  1HR0 Q;  3FKI H;  5C4J H;  2R7Z G;  2OQ0 A;  4A3M H;  1D8L A;  4A3C H;  1YEZ A;  3J80 c;  4JV5 L;  3KF6 B;  4P75 A;  2F4V Q;  2Z6K C;  4BBR H;  1KD1 C;  1PHJ A;  4P71 A;  1SR3 A;  2PNH A;  4GN4 B;  2PMZ E;  3CC7 A;  1JE5 A;  3G48 A;  5IWA Q;  3U50 C;  3NBH B;  2R93 H;  4YCU A;  5IP9 H;  1N34 Q;  2KHJ A;  1VQP A;  1XPR A;  4C2M H;  4H02 A;  4X66 L;  4AQY L;  4OO1 I;  4BXX H;  4POF A;  2I5L X;  4X62 Q;  1XMQ Q;  4A3D H;  2CWA A;  4DV3 L;  3H0G H;  2OQK A;  4DV0 L;  2PI2 A;  1TWA H;  4APV A;  1J5E Q;  2YYZ A;  1NMF A;  3MEF A;  4DR3 L;  1VQ4 A;  1QVC A;  3KYH C;  5FLX c;  3KF8 B;  2JA6 G;  4JI8 Q;  4DK3 C;  4GNX B;  2UUC L;  4JI6 L;  3I56 A;  1FL0 A;  1WFQ A;  3U58 A;  1KC8 C;  2PQA A;  4LF4 Q;  4NB3 A;  3CCM A;  4HJ7 A;  1Z9F A;  3Q8D A;  1PH8 A;  1XPU A;  3ICE A;  4DR5 L;  1IBL L;  2UXD L;  1W2B A;  3UE0 A;  4B3R Q;  4HJA A;  5LMN Q;  4MZ9 A;  2LSS A;  1U5K A;  4YCV A;  4LF7 Q;  2R92 H;  3S2D H;  5BR8 Q;  3JAM i;  5M3M G;  3KJP A;  3ZJY C;  1X6O A;  1MJE A;  4BBS G; 
#chains in the Genus database with same CATH topology
 2LXJ A;  2ZTD A;  1SRU A;  1F2Z A;  1M4V A;  5FO8 B;  3QOL A;  4UCU A;  1WD1 A;  1DOK A;  1EEI D;  3L2P A;  4X62 H;  3PR5 B;  2NVT H;  1CS0 A;  4IRC A;  1HH2 P;  1I4Q A;  5KFE A;  4MV1 A;  3QG1 A;  3L4J A;  3ETH A;  2F3V A;  1EYA A;  3S2H B;  1M7J A;  4XX0 B;  1PH4 A;  3RLN A;  2NVY H;  4FF4 A;  1S5F D;  4LF4 H;  4LF6 L;  2B2V A;  3ERS X;  3JRW A;  3GTM H;  3I55 A;  3ERO A;  2B2U C;  3AQQ A;  3RB0 A;  4NP5 A;  2HHH L;  4S3S A;  2JEA I;  2W7O A;  5LMN H;  2BQ3 A;  3STB C;  2NZ1 D;  1SMY C;  5BR8 H;  1Q7Y C;  4YP3 A;  5KFJ A;  2UUB Q;  1I3Q B;  4HQ6 A;  4MIU A;  1SYE A;  5I2Y A;  2EJM A;  4QGU A;  2FLN A;  1AEX A;  1SYB A;  5KFL A;  1NR2 A;  2I46 A;  2N78 A;  5I6W A;  3GTJ H;  5M3F G;  2DZD A;  5FLM G;  2J6U A;  1EZ6 A;  2RHS B;  1PH5 A;  4U7C A;  1H9J A;  1B3A A;  4DF7 A;  3NEL A;  3T51 B;  2F0D A;  2EYM A;  3CRK C;  3TIN A;  1N48 A;  2F1M A;  2SNM A;  2XN9 C;  4LUO A;  5LYJ F;  1I5F A;  3PQI A;  1NTG A;  3RD4 A;  2CZG A;  4X3U A;  1HZC A;  4FXG C;  3RTX A;  3P20 A;  4RUC A;  2GPS A;  3FMA A;  2Q8R E;  2ASD A;  1IW7 C;  5C44 H;  5IYC H;  3F2B A;  3OIP A;  3OSO A;  5IT9 E;  1YI2 A;  1M6V A;  1HFG A;  1JDB B;  2Z6K A;  4TQS A;  5C4X G;  5KT2 A;  2FPP B;  1V8Q A;  1TWH H;  3GQC A;  1DV2 A;  5D1O A;  5JPM C;  1XJV A;  3K0X A;  1XX8 A;  3M4O H;  3MHB A;  5AFW A;  4ED3 A;  4QQB X;  3GIQ A;  4LH6 A;  1C48 A;  1YIT A;  5K5P A;  5I9P A;  2KA7 A;  1N33 L;  5EQ0 A;  2CQO A;  3V6K A;  5IGD A;  3U9S A;  2OEO A;  4HJ5 A;  4ZUJ A;  1H95 A;  1AN7 A;  1SYF A;  1UNN C;  4Q8E A;  2DY7 A;  3PUY A;  2EIF A;  4KN7 C;  1A8V A;  1Q12 A;  3J7A 5;  4EQO A;  4ZLT F;  4R4O A;  1Q3L A;  1Q46 A;  2FFK B;  4H44 C;  3PO3 G;  1CSQ A;  1E22 A;  3IFD A;  1K83 H;  1YNJ C;  5C1P A;  3RGX A;  1VQD A;  2YU9 B;  4J9R A;  3OPO A;  4F87 A;  1TA8 A;  2F0P A;  1RYS A;  1F9P A;  2O5J C;  1Z2N X;  3V2T A;  2JA8 B;  1A9X A;  5KFP A;  4DV4 L;  1HNZ H;  1QUQ B;  3GLK A;  1L2F A;  2HCC A;  4XQJ A;  1B7Y B;  4DUZ H;  3I70 A;  1Q82 C;  1GD7 A;  1VMC A;  4A3M B;  1PH2 A;  1BCP B;  3T56 B;  3FKI A;  5FLX L;  3PUV A;  5JVG 3;  4L5T A;  4ZK9 B;  3KFU A;  4YBZ B;  2K6A A;  1SE2 A;  4DKA C;  2F0T A;  1YJW A;  1BKB A;  2F0V A;  1Q90 A;  2VL6 A;  2F0G A;  1EOV A;  2F52 A;  1FJG Q;  5C1O A;  2F0U A;  2CQY A;  1RHP A;  3O13 A;  3HBL A;  2C2E A;  3E6Z X;  2LFN A;  4OX9 Q;  3S1M B;  4JI8 L;  1R4Q B;  2F0Q A;  2X0S A;  1RKN A;  4HSV A;  1Z6H A;  1TWC B;  1QZG A;  4AYB G;  4A3L H;  4MA5 A;  4QUF A;  2BQR A;  5KFG A;  2FKL A;  5M5W H;  1GSH A;  3JSN A;  2YV5 A;  1K28 A;  4DAP A;  4JI0 L;  3HOZ G;  4DA2 A;  2B63 A;  2FJ2 A;  2R92 B;  3D4W A;  3HKZ A;  1KAA A;  2KVM A;  2NTT A;  2NWG A;  5KFZ A;  4A75 A;  3UFX B;  2IX1 A;  2HIV A;  3RAX A;  2I5H A;  1L1O B;  5COY A;  3JAM L;  5GAE C;  5ELD A;  3I4O A;  1JIH A;  4X65 H;  2A5H A;  3HOW H;  4ECR A;  2Y0S A;  1FJG H;  2OCE A;  1AP0 A;  4GZY C;  2F0W A;  4GLX A;  1VQ6 A;  1V43 A;  2Z9H A;  4OX9 H;  2IHF A;  2Q2I A;  2JA5 H;  1ZYR D;  3EQL C;  1JJG A;  1HZ9 A;  1RTO A;  1I7L A;  5L1J A;  3CP0 A;  1BCP F;  2V59 A;  2C22 A;  5C3E H;  1TVX A;  2NZH A;  4LK1 C;  2QIL A;  2X6G A;  3DHQ A;  3VR4 A;  2WTF A;  4C3H B;  3VMM A;  3LP8 A;  4ALP A;  4ED1 A;  3ERQ A;  3OOC A;  5FO7 B;  2HIX A;  4DR6 Q;  2IMW P;  5EPK A;  2BCO A;  1CKN B;  2E2I H;  4A3D G;  2MGS A;  4L8J A;  4RA8 A;  2PZW A;  5CV5 A;  4J9K A;  2IW3 A;  2W71 A;  4XYO A;  2ZJP A;  1RCV D;  2EYP A;  4HID A;  3RZD H;  5CMD A;  4B3S L;  2OWO A;  1QJO A;  2AHO B;  3D0F A;  3CQZ A;  5HY6 A;  1BDO A;  2CWP A;  3CCE A;  4XQQ A;  3N41 B;  2UUA Q;  4DU9 A;  2K5Q A;  1K8A C;  4DR5 H;  3GDE A;  3PIO 3;  4FU0 A;  2ZDQ A;  1QCB D;  1HTP A;  3HGB A;  2F0N A;  1EWC A;  4JCV E;  1C30 A;  1F2M A;  1TWF B;  4DV5 Q;  3STB D;  4C56 C;  2LKV A;  1SMY D;  5C6A A;  2KEN A;  5L1I A;  4O4L F;  5E7N A;  2JA7 A;  1SNP A;  4IJH A;  5I9O A;  4PZ8 A;  1XYI A;  5EAY A;  2R7Z H;  3T1Y L;  2F3I A;  4F8M A;  3C1F A;  2YZG A;  3SVM A;  1B6R A;  3CCQ A;  1H9S A;  3E9H A;  2MFI A;  2NYZ D;  3S14 H;  1I50 H;  2HJW A;  1EIF A;  5DEH A;  5FJ8 G;  2W6M A;  3S15 H;  2N49 A;  4GKJ L;  3KHH A;  5DG8 A;  2BQU A;  1FNW A;  2C35 B;  3KOJ A;  1JWU D;  2VQF Q;  1Q1B A;  1HRJ A;  2SDF A;  1HHV A;  2W57 A;  2HCI A;  2SNS A;  2UUA H;  3QB3 A;  2ALY B;  4DL6 A;  3TII A;  1EIG A;  1WCM G;  3J7Y W;  1B50 A;  2AKW B;  2HGS A;  3JAM E;  1H9K A;  4FF1 A;  3GTK A;  1KEE A;  3WWV A;  4R8U B;  2PMZ B;  3V6H A;  4DV5 H;  4TQR A;  1BBW A;  1FVI A;  2W9B B;  1F2L A;  3S1R B;  4DXF A;  5C4Z A;  1B2T A;  5LXT F;  3SE7 A;  4DAY B;  3QZ8 A;  4KI0 A;  4N9P A;  5DAU A;  4MTE A;  2JA6 A;  5JVH 3;  5C4J B;  2OF1 A;  2F4V L;  1A6X A;  3CCJ A;  4LF8 L;  1ENA A;  1Q8I A;  1EFW A;  1XNQ Q;  1I94 H;  5M3M H;  2F0K A;  5IYD G;  2WKD A;  5EKI A;  2VQF H;  1PK8 A;  5JVL A;  1V1P B;  1W3S A;  1F9R A;  5JJL A;  5CAE B;  1MHW C;  3G6J B;  4BA2 I;  3RJ0 A;  1TQO A;  2D0P A;  3JSL A;  4RKB A;  4TVA B;  4X3S A;  4K6L A;  4O2D A;  3ULL A;  1QVF A;  1RK6 A;  3IKJ A;  2WB1 E;  4RGO S;  5IGG A;  3HOV H;  2R7M A;  1NCV A;  2FHT A;  5KG3 A;  4KHP H;  5D14 A;  3S9W A;  2YW2 A;  2RDH A;  3KLS X;  3PV0 A;  2B8G A;  4MTD A;  2Z6B A;  1VF5 C;  2VQE H;  5LMU L;  4CBV A;  1GUT A;  1Z2P X;  2RQX A;  3CHB D;  3GTL A;  3NBH A;  4LFC L;  2NU6 B;  4O2A F;  3S17 H;  5I47 A;  5E1F A;  1XNQ H;  1L0X B;  2RDG A;  5H1S E;  4RB0 A;  4RGN A;  1KAW A;  2XD4 A;  5T14 A;  4F50 A;  1Y1W B;  2J0T D;  2HDM A;  1CHQ D;  3CMA A;  1EZ1 A;  3PUW A;  2M05 A;  1M1K C;  3M3Y H;  5C0X H;  4C5C A;  2VS1 A;  1DD2 A;  3CAM A;  1CKM A;  3A8K E;  4KN4 C;  3J81 L;  3RR5 A;  3OW7 A;  4ECV A;  1OTC A;  1S3O A;  1VQB A;  2ZXO A;  3NPP A;  1JE4 A;  4FNF A;  4Y7N H;  4B9X A;  1B3Q A;  4JI1 L;  3TQT A;  3NEN A;  1LLR D;  4YHH Q;  5I6Y A;  3QZ7 A;  2EVB A;  2V1C C;  3J80 W;  2NUA B;  1EEF D;  3DWQ A;  3UDG A;  3QJY A;  3TRE A;  3HOY B;  3OIQ A;  4DL3 A;  3GP7 A;  4U67 3;  1OWT A;  3VR6 A;  1SYX B;  1XMQ H;  1AH9 A;  3N43 B;  4J9N A;  2IL8 A;  2ES2 A;  3H3V H;  2W70 A;  3S2H H;  1J5E H;  5EBC A;  4UP9 A;  4A93 G;  3GTJ B;  4CKB A;  2VB3 X;  4DR7 Q;  4Z9C B;  3IRB A;  4ZRZ A;  1IBK Q;  3DMU A;  2Z0S A;  1TS2 A;  2UXB Q;  1TY2 A;  4TSS A;  4A3B G;  2RGR A;  4HIM A;  3U4V A;  1EUC B;  1PFM A;  3R5X A;  3NBI A;  2HVS A;  4LUV A;  3SK6 A;  4BY7 H;  3K7U C;  1Q86 C;  1I3Q H;  4PQX A;  1ET6 A;  3A55 A;  1P8L A;  4DV7 Q;  2NB0 A;  2F0I A;  3CPW A;  4NXN Q;  5C44 B;  2K50 A;  5KT6 A;  2JYO A;  5EKL A;  3AMU A;  4YHH H;  1T5E A;  1WTQ A;  1SJE D;  3K8A A;  1JOO A;  4RG1 A;  3R5F A;  5KND A;  2E74 C;  1TWH B;  2JE6 I;  4A3K G;  4F4Z A;  2JSO A;  2R8I A;  1F2Y A;  1SEI A;  2O03 A;  5KT5 A;  2I8C A;  4DR7 H;  2AUK A;  4IRD A;  4NXM L;  3MTS A;  2VW9 A;  2R7F A;  4IFD H;  2RCN A;  1IBK H;  1XNR Q;  1D1I A;  1WTO A;  3MXG A;  1TY0 A;  3A74 A;  1XWE A;  4JBW A;  3SEB A;  5IGB A;  1AFP A;  2PYK A;  4KKT A;  1EYG A;  3RN2 A;  3VR3 A;  3V05 A;  3Q1K A;  1GLV A;  2BDN A;  1YNN D;  2N55 A;  4QWC A;  4DV7 H;  4RNN A;  5HGQ A;  5KFC A;  3RIZ A;  1SN8 A;  2JJQ A;  4NXN H;  1K83 B;  3J80 i;  2VUM G;  3CCS A;  3R93 A;  2ICE C;  2PZU A;  1RTN A;  4MV4 A;  2XGQ A;  1UC9 A;  3A56 A;  3DWA A;  2N88 A;  4GN3 B;  2RSN A;  4AYB A;  1IL8 A;  3GTG A;  4LFB L;  1K1Q A;  2C9O A;  1G2S A;  3CRL C;  4KK7 A;  4FF2 A;  4YY3 L;  3MWM A;  3J7A K;  1LT6 D;  1KBL A;  2MUY A;  3N6R A;  4A3F H;  5E3F A;  2YU9 H;  5KYI A;  3PMF A;  2A6H D;  1FKA H;  1XNR H;  1LO5 D;  4K14 A;  3LWE A;  5DNF A;  3Q8Q B;  2JEJ A;  3FKI H;  4C3I B;  3K58 A;  4RHS A;  4LMQ D;  1HPC A;  1EYD A;  4A3M H;  3X3M A;  4A3C H;  1T94 A;  4RZQ A;  2FLP A;  1KD1 C;  1RJR A;  4H7B A;  3RB6 A;  1LT4 D;  3FMC A;  2PNH A;  1DCZ A;  2QEJ C;  3SXH A;  1Z2O X;  5IWA Q;  2J7Z A;  1A2T A;  2I87 A;  2K03 A;  4KJO A;  2R93 H;  5FD5 A;  1W96 A;  1N34 Q;  5FD6 A;  1SND A;  1XPR A;  4AQY L;  4BXX H;  4HR7 B;  4J6H A;  1VDZ A;  4M1U B;  4DV3 L;  4ZKC B;  1EOT A;  1VQ4 A;  1NMF A;  3GIP A;  1QVC A;  4GNX B;  4DNR B;  5IGF A;  3A8J E;  5E4X A;  3WNZ A;  1TWA A;  1BNZ A;  1BR9 A;  2R8G A;  3GTQ A;  4HJ7 A;  2ZXR A;  2PW5 A;  3Q8D A;  1GJX A;  1JKJ B;  1U9R A;  4OEM B;  3UE0 A;  1GHK A;  2R92 H;  2PQE A;  4LF7 Q;  4DV2 H;  4IWY A;  2W8L A;  4KHV A;  2JA5 B;  2D2C C;  3PIP 3;  4FXD A;  3HOU H;  2J6T A;  4BBS G;  5NUC A;  5IWA H;  1AW7 A;  5C3E B;  3OUZ A;  2IWH A;  3G8C A;  2IJ0 A;  5CC4 A;  5I4D A;  4DV1 Q;  4XYL B;  3SGI A;  1F77 A;  3I3C A;  4OWT B;  2K04 A;  3TZD A;  2FE3 A;  5FPR A;  2XTI A;  4A3G G;  2JA8 G;  5AJ3 Q;  3HKZ E;  3UDI A;  5LHY 1;  2E5L Q;  4G57 A;  4CDF C;  4X64 Q;  5LL6 b;  1LTI D;  5C0X J;  3J7A F;  2VPQ A;  5DLG A;  4KD4 A;  2IBK A;  2A74 C;  3TP6 A;  4DR1 Q;  3RZD B;  5J2T F;  1HR0 W;  1PDQ A;  1N32 L;  3C2P A;  3G7L A;  5KFV A;  1XXG A;  2A69 D;  3GV3 A;  1CQV A;  1YHB A;  4K0K Q;  3PZP A;  1E4E A;  5FLX W;  4LF7 H;  3PO2 H;  4L5Q A;  4CKE A;  2G9D A;  3ITP A;  1U0L A;  5JEA G;  4GOP A;  1CQI B;  1Y1V G;  2L55 A;  2K5N A;  5KFR A;  1WCM A;  2NZO A;  4HCE A;  2FJZ A;  3F1Z A;  3HRZ C;  2F0E A;  3W5O A;  3T5H A;  4DV1 H;  1GSO A;  4XIG S;  3DF7 A;  4OIK A;  4IAL A;  5D3I B;  1Y14 B;  2E5L H;  3CKI B;  4A3I B;  2F0H A;  4X64 H;  1CT1 D;  1I50 B;  4XTC S;  5CV7 A;  1TWF H;  3S15 B;  1STN A;  4DR1 H;  1EFI D;  1B8A A;  1WD0 A;  2A19 A;  1VQ5 A;  1VQ7 A;  2NTS A;  3PVX A;  2UU9 Q;  1ROD A;  4A3J G;  1K1S A;  4K0K H;  2RSO A;  4K5W A;  3GTP A;  1QG7 A;  5CGK A;  1SEB D;  1IXR A;  1HCZ A;  1SMX A;  2BH8 A;  3UDF A;  3F2C A;  4WRD A;  4NKL A;  1PTO F;  2DPI A;  2WV6 D;  2I5M X;  4B3M H;  4OO1 H;  4YR0 A;  1KDA A;  2XCL A;  4BY1 B;  2YZM A;  3D4D A;  3M9B A;  3HOX B;  1O7Z A;  1UNS A;  1PYS B;  1X3F A;  3NUC A;  5IE8 A;  1WH2 A;  1KAB A;  4HTH A;  3OMG A;  1P16 A;  4C3H G;  2WDT A;  4WFN 3;  4IFD J;  2WB1 B;  5GAH C;  2E2D C;  2JEG A;  5M3M B;  4IOC A;  4GS3 A;  2XSC A;  3K81 C;  1ZKO A;  3KDF B;  4EFE A;  3H3V C;  4FP5 D;  4YAJ B;  4A3E G;  1PH7 A;  2EY2 A;  4ZAI A;  2DNC A;  2MCT A;  2I07 B;  3ER0 A;  2Q2H A;  4YWM A;  1MIU A;  4N9T A;  4JOI A;  2VNU D;  2EOT A;  1IKM A;  3M85 A;  2R6G A;  3OTO H;  3KTM A;  3RF2 A;  1HNX L;  3VPC A;  2CW0 C;  3LML A;  3BZD B;  1EY4 A;  2RDF A;  3HOV B;  4QWA A;  4QMG A;  1E1O A;  4BBR B;  3GII A;  4RB1 A;  2RA4 A;  4XXE A;  1O7Y A;  3L7Z C;  2F4I A;  2ICI A;  3G4S A;  5KFB A;  3LWB A;  2WE6 A;  1CTM A;  1VQH A;  4EQ5 A;  3H4B A;  4X62 L;  2YYA A;  3S17 B;  1AUX A;  1TS3 A;  2DJF C;  2IA6 A;  4JI5 L;  5K36 H;  2W7P A;  3E9I A;  2GVA A;  3OUU A;  4NMZ A;  4JV5 Q;  2OT2 A;  4LF4 L;  3GTL H;  1B9M A;  3QFF A;  5DGA A;  5KFD A;  2UXC H;  2FMA A;  3M3Y B;  5LMN L;  2H4O A;  2C28 A;  4I65 A;  2KCC A;  2F0M A;  5A2Q L;  1K3R A;  2WKC A;  5FO9 B;  3DM1 A;  5BN4 A;  5HV6 A;  2XWB B;  2M2L A;  1MGS A;  2JXM B;  3B6Y A;  4YAK B;  4Y7N B;  2B2T A;  4IN3 A;  5JEA J;  3RN5 A;  2O2L D;  4DL2 A;  3PF4 A;  4OXP A;  1YJN A;  4B3T H;  1IHZ A;  1TU2 B;  3QR8 A;  3LWU A;  4KKS A;  2UUC Q;  2W6N A;  1E1T A;  2KJX A;  4CDD C;  3AU7 A;  2R61 A;  3CPF A;  2K7V A;  3DUZ A;  1BOS A;  2GN5 A;  1IBL Q;  5JH7 F;  1OXT A;  2R3Z A;  3TS0 A;  5KG4 A;  3T13 A;  1UWV A;  1DYQ A;  2JP1 A;  1IKL A;  4JV5 H;  3J80 E;  1WSC A;  1Y1W H;  2VOB A;  2UVV A;  2FIN B;  5CB4 F;  4FBU A;  2K32 A;  3V6J A;  4PMC A;  1C3O A;  3PW7 A;  2L11 A;  1MJC A;  1LTG D;  5IP9 G;  3HOY H;  4JV1 A;  1B9N A;  3NXW A;  4BY7 B;  2UUB L;  4DR4 Q;  1BCP C;  5EBD A;  3F2D A;  4X66 H;  3H0G G;  1RL2 A;  4C3J H;  4O3R A;  1FR3 A;  5JPN C;  4CDE C;  3H15 A;  2QW7 A;  3VYT A;  1RDP D;  3G6X A;  3W1G A;  2AMC B;  2ZJQ A;  2P0A A;  1PX2 A;  2V4R A;  3PW2 A;  2UUC H;  4I7Z C;  1EZ8 A;  2V4D A;  5BMV F;  3PR4 A;  2VUM A;  1R9T A;  4LF6 Q;  1WVL A;  1IBL H;  2HHH Q;  1G6Z A;  4RAY A;  4IPG A;  1C9O A;  3G71 A;  5KFO A;  3S16 B;  3PW5 A;  4P72 A;  5J22 A;  1Y1W G;  1I6H H;  1KLG D;  4JI2 L;  2V9W A;  4LFA H;  3S1N H;  1EY7 A;  3BDO A;  2C2D A;  2ZTC A;  2EXD A;  3A7L A;  1SFO H;  1HNZ Q;  4DUZ Q;  2WFW A;  2CVR A;  3IAY A;  2H5X A;  4DR4 H;  5KFF A;  1LM0 A;  4XYQ A;  1S5E D;  1O80 A;  4JG2 A;  1WTV A;  2IY5 B;  2A1A A;  2A8V A;  4TQU S;  1KC7 A;  1L1O C;  3RB3 A;  3LGJ A;  2YTV A;  3F8N A;  4CGY B;  2DWC A;  2K01 A;  4BS9 A;  4UFZ A;  4LF6 H;  1KLU D;  3M9N B;  4O3O A;  1GVP A;  3J81 W;  2HHH H;  4J9Q A;  3MAQ A;  1KRT A;  1PRT D;  4A3F B;  4X3K A;  3CXC A;  1HR0 L;  3P1H A;  4OIJ A;  5M5X B;  5CV6 A;  3FKI B;  3PIP A;  1NR4 A;  2FMC A;  1B4O A;  3HG9 A;  4ECX A;  4QW8 A;  3FP9 A;  2VZA A;  4N8X 1;  5F9N A;  1AZP A;  1K8O A;  3KUP A;  5G3L D;  3A5Z B;  1ZXT A;  2D62 A;  3VDY A;  1KHI A;  3ND9 A;  2R87 A;  4LF5 Q;  2ZXP A;  5C44 G;  1GHJ A;  5IYC G;  5KFA A;  4ECY A;  1I7N A;  4YR2 A;  1KDB A;  2AUJ D;  4X65 Q;  1F9Q A;  2R93 B;  3M9M B;  4AYB E;  4C3I H;  2WII B;  5EOY A;  3WOE A;  2EDG A;  2B2U A;  4OX9 L;  4DV4 Q;  3IL8 A;  2BE5 D;  1Q81 C;  3K7A H;  1QE6 A;  4ZQ3 A;  2I0Q A;  1QUQ A;  2CW0 D;  4K8J A;  5KG1 A;  1UE6 A;  4KTA A;  2B63 B;  3V96 A;  1CM9 A;  3HKZ B;  4LFA L;  2A68 C;  1VQK A;  1BBX C;  4DN4 M;  2E8G A;  1JC7 A;  2C2R A;  5KGU A;  2DY8 A;  2JQO A;  3LX0 A;  1D1K A;  3GTQ H;  3HOU B;  1CFM A;  1RJT A;  4DR3 Q;  4C1N K;  4LF5 H;  3T5K A;  1WJJ A;  3HFZ B;  1Y1V A;  2EQS A;  3J81 i;  5DQG A;  1STG A;  2OXP A;  3H40 A;  3CCV A;  5IY0 A;  5JAV A;  4EG0 A;  1PFN A;  2IT1 A;  1UE5 A;  4A76 A;  4DR5 Q;  3GIM A;  2D0O A;  4YB8 B;  1JOQ A;  1TWC A;  2MO0 A;  4DV4 H;  5L9X A;  1K8M A;  2ATW A;  4JI0 Q;  5IT9 c;  4J9S A;  1OXX K;  4HMJ A;  4RWS C;  4TV9 F;  2JEI A;  4ZKB B;  2ZTE A;  1V1O A;  4J0M A;  1PTO H;  4DR6 L;  1HNW Q;  4WJ4 A;  1CUK A;  4DFA A;  3BQ1 A;  3GTO A;  4HSP A;  3PO2 B;  1N36 Q;  1JLL B;  5KT4 A;  1XTC D;  4DR2 L;  1A15 A;  5DM6 3;  3CQZ B;  2K05 A;  5IOC A;  1D7Q A;  4DR3 H;  3CCR A;  5DG7 A;  5FLX E;  1FGU A;  4JPB W;  1H9R A;  2KEC A;  5KG6 A;  1SLJ A;  2UUA L;  1ZHS A;  4E6I A;  4A3L G;  3GV6 A;  4JI3 L;  5IYZ F;  5C8Y F;  4PV1 C;  5DM7 3;  3TP7 A;  5M9O A;  2NN6 H;  2EY5 A;  2F0J A;  5JVD F;  1FNU A;  4BA1 I;  2E2H A;  3RZO B;  1GUG A;  3SE0 A;  3WOF A;  2AQ4 A;  1JOK A;  1VMP A;  3CC4 A;  4JI0 H;  4DV5 L;  2SEB D;  4OON A;  1YHQ A;  1X55 A;  1A0I A;  5ELC A;  1H9S B;  1C4Q A;  4Q0F A;  1PVO A;  1UE7 A;  2NBF A;  1EL0 A;  2QF7 A;  1HNW H;  1NBW A;  2KQ3 A;  3HOW G;  2IP4 A;  2IPK D;  1VQL A;  5KG2 A;  4IPH A;  1N36 H;  4ED2 A;  4A3I H;  1I94 Q;  1AZQ A;  1I4P A;  4O3S A;  5COR A;  2N8N A;  2VQF L;  2VUG A;  3NWS A;  2JA5 G;  5EWG A;  1IBM L;  3NTI A;  4L6T B;  1K3B C;  1EQQ A;  4XT3 B;  3GQB A;  3EJI A;  4WJW A;  5C3E G;  1CI3 M;  3OMC A;  4RFB A;  3GTK B;  1IW7 D;  1QNK A;  5IP7 H;  2HUG A;  3E0J A;  1DZ1 A;  4MV9 A;  4RMF A;  2G9H D;  1K73 C;  3T1Y Q;  4JI4 Q;  5EWF A;  4KHP Q;  3C46 A;  5DQI A;  4LF9 Q;  4BY1 H;  2KOL A;  2B2W C;  3HOX H;  2JA6 B;  1QNU A;  3RGZ A;  3TQ1 A;  4GKJ Q;  1LTS D;  3L4K A;  4FBT A;  2VQE Q;  1TII D;  1X3Q A;  4X6A H;  2YRX A;  4JV0 A;  1WOC A;  1X56 A;  3FPU B;  2W9A A;  3M4P A;  1HZB A;  3R5H A;  4FDB A;  3EVQ A;  1DM0 B;  4QY7 A;  4CJ0 B;  3GV5 B;  3MR3 A;  4IJL A;  1J6Q A;  1LAC A;  3BZC A;  3ORR A;  4QJF A;  2FP4 B;  1E2V A;  3D31 A;  4CHT B;  2V4Q A;  4JYA Q;  2W9C A;  2WAC A;  4R8U A;  3HS0 C;  1YNJ D;  3E3X A;  2R7Z G;  3Q23 A;  2UVU A;  2J9G A;  4EGQ A;  3SHL A;  1ONL A;  3T1Y H;  4JI4 H;  1YEZ A;  4DAY A;  3KF6 B;  4P75 A;  3Q0A A;  2F4V Q;  4UCO A;  3C3L A;  4BBR H;  4LF9 H;  1G8Z D;  1Z7T A;  4R7R A;  3X3N A;  1SXT A;  3MEH A;  4ID6 A;  1JCK B;  3T5J A;  2LMC B;  4G3I A;  1JE5 A;  1S5D D;  1VBH A;  4GKJ H;  3GTL B;  3NBH B;  3UI2 A;  2X69 A;  4DAV A;  5KFT A;  2XWJ B;  4YCU A;  5HUR A;  2KHJ A;  4EVO A;  3ND8 A;  4POF A;  1U4P A;  1XMQ Q;  5DQH A;  4DV0 L;  2PI2 A;  1J5E Q;  3KBX A;  2YYZ A;  1F9S A;  4C2M A;  5FLX c;  4J1M A;  4TRD A;  3KXY T;  3HZX A;  3I56 A;  3H0G A;  2HVR A;  2PBZ A;  4JYA H;  5DGB A;  4IUP A;  2PQA A;  1KC8 C;  3CCM A;  1Z9F A;  1PH8 A;  4IHJ F;  2E75 C;  3T53 B;  4B3R Q;  4HJA A;  4MZ9 A;  1U5K A;  4Q5V A;  1SYD A;  3ZYY X;  4XQN A;  3S2D H;  2F4V H;  3TP8 A;  5M3M G;  4UHV A;  2EXZ A;  4G7H C;  3KJP A;  5EZY F;  2L4N A;  4FO2 A;  4IUN A;  1QIL A;  3CC2 A;  5KNC A;  3K3V A;  1PH3 A;  1STB A;  2XC9 A;  3DM3 A;  4YHH L;  1LTL A;  4EX5 A;  1ZHQ A;  2HVQ A;  1CQJ B;  2ASJ A;  3KLW A;  5IIF A;  3E5S A;  4Q8F A;  1MKH A;  4QW9 A;  2C5C A;  4J9L A;  2UVR A;  1EU4 A;  2WAQ G;  1Y1W A;  5KG5 A;  4DLK A;  3TDQ A;  3MWE A;  3VPD A;  2A73 B;  1NMG A;  4ZCK A;  4C3J B;  2MP1 A;  3BQ0 A;  2PN1 A;  4DR7 L;  1TS4 A;  3HOV G;  1EUJ A;  1I4G A;  2UXB L;  3KHL A;  1T9H A;  5IGC A;  4R4T A;  1GO3 E;  2L12 A;  2R7N A;  1E4F T;  3JAM c;  4B3R H;  3DWP A;  2XRS D;  2K28 A;  4JUZ A;  4P74 A;  3TN2 A;  2NVY A;  5LMU H;  4YJ3 F;  4IRK A;  3GTM A;  1X65 A;  4FXK C;  4NXN L;  1C8C A;  4YWL A;  3A0J A;  3PO3 B;  4UCT A;  1I6H B;  2A6E C;  2VUM H;  1QOH A;  4MV7 A;  4M8A A;  3K5L A;  1DGS A;  3S1N B;  1Y8P B;  2ATL A;  2K14 A;  2J6S A;  3M4Y A;  4R8N A;  3NWT A;  5JUM A;  1SFO B;  3GTJ A;  1NSN S;  2K5D A;  5C0X G;  4MHE A;  1JWM D;  3DEO A;  4LSX A;  2R8H A;  1YIJ A;  4JI7 L;  4L63 B;  2J4X A;  4UAI A;  3S16 H;  2MO1 A;  3BQ2 A;  4GNX C;  1XNR L;  3AYH B;  5ELB A;  3NK9 A;  5LMN W;  1I4X A;  5KFS A;  4I50 F;  1YZ6 A;  3I90 A;  3AB9 A;  4JBM A;  5A2Q W;  3VR5 A;  2KBN A;  1N9W A;  1RF2 D;  4RAU C;  1BJT A;  4DPG A;  3RMH A;  5D8D A;  2QYZ A;  4ED8 A;  4OGQ C;  4DV6 Q;  2XNA C;  1TWH A;  2EJG C;  3J81 E;  3EA6 A;  4AYB B;  1A62 A;  1NAP A;  3NTH A;  4NXM Q;  4MAM A;  2K33 A;  4IQZ A;  3H09 A;  5KFI A;  5KG7 A;  4IUT A;  3U9T A;  3GV7 B;  4ED7 A;  4IPC A;  3HOZ B;  3TIG A;  4BY7 G;  2YCH A;  4KV6 A;  2D5D A;  2SOB A;  1DON A;  3N42 B;  2FK1 A;  1KJJ A;  4MV8 A;  5IGE A;  3MR5 A;  4LWC A;  2AGP A;  1N56 A;  3D6W A;  4MV6 A;  4R8I A;  2YS6 A;  5JQW A;  2YS7 A;  4QWE A;  5M5X H;  2CFM A;  3Q8R B;  2L5T A;  4EQP A;  4V19 0;  1K83 A;  5KG0 A;  1EYC A;  4DV2 Q;  4FS1 A;  2MHV A;  2OTJ A;  4EBC A;  4J9M A;  4LMY A;  1QZH A;  3K7A B;  5HGT A;  4LFB Q;  4DV6 H;  4L1K A;  4MN3 A;  2MQH A;  3GIK A;  1STA A;  4IFD G;  1N34 L;  4GLV B;  4NXM H;  4GKK L;  5KIX A;  2PW7 A;  1T3N A;  1VQC A;  1YHA A;  1EWI A;  2R85 A;  3QOJ A;  1CE8 A;  2F3W A;  2XCA A;  4A3D B;  2KHI A;  2QCP X;  4H0L C;  1TWA B;  3G6E A;  3GTQ B;  5EDW A;  3NEM A;  3MA2 B;  3PIO A;  4JK1 C;  1S40 A;  2JK8 A;  3VYR A;  2YZN A;  5C3X A;  2R84 A;  4HYK A;  4BWG B;  2B63 H;  5KFQ A;  2DGY A;  5L37 A;  2V5A A;  1IL2 A;  1LT5 D;  1S10 A;  4IAJ A;  2ID0 A;  3DLL A;  1M8A A;  1ML0 D;  5GAG C;  4DK1 A;  2X6L A;  1J9O A;  4WBN F;  1GUW A;  2KCM A;  3NP8 A;  4LFB H;  1S72 A;  4DV3 Q;  2CW8 A;  4QWB A;  3N8D A;  4HR7 A;  4A3F G;  4ME5 A;  3I4M H;  4YY3 H;  4MV3 A;  5KEE A;  3K57 A;  1D5M C;  2KCN A;  4OWX B;  2ZM6 L;  1PTO B;  4DUY L;  3KK7 A;  5AJ3 L;  5KYL A;  1XMO Q;  4X64 L;  4A3M G;  1RIP A;  4A3C G;  2Z4H A;  1VKZ A;  4DR1 L;  3I4N H;  4HNU A;  5IYB H;  4OHJ A;  2EY6 A;  5LA6 F;  5C5M A;  2KCT A;  2QEX A;  2AQ2 B;  2Y0S E;  3GTO H;  1E4E B;  1HFN A;  1AE3 A;  2NUC A;  3FDS A;  1VQ8 A;  5LP6 F;  3UQ8 A;  5KT3 A;  4GOP B;  2R93 G;  2JA5 A;  1FYC A;  1WCM B;  1C0A A;  3T1H Q;  4BXX G;  1G2T A;  2KSW A;  2ASB A;  4B3M Q;  4O3Q A;  3LNN A;  1EQR A;  3CQZ H;  3Q8P B;  4DV3 H;  2E2I A;  4I7H A;  1A3T A;  2JN4 A;  4QIW A;  3TZU A;  2E2H H;  3GD7 A;  1N32 Q;  1KDC A;  2O4X A;  5KFK A;  2XVS A;  3RZO H;  1XMO H;  1TWG A;  3TQY A;  1NJI C;  2R92 G;  4ZI7 F;  4EYI B;  4O0A A;  2JA7 H;  4R9W A;  4KKU A;  1LUZ A;  3RUZ A;  3BA9 A;  3HOU G;  4IUV A;  2NVX A;  4HNT A;  3GTP B;  3E0E A;  5CBE E;  5C0X I;  2UU9 L;  3KBG A;  3WO1 A;  3OTO Q;  2OH2 A;  1JT8 A;  2A6E D;  1KJI A;  1B1Z A;  3T1H H;  4RZR A;  2N3S A;  1I4H A;  5L1K A;  2R7Z A;  3I72 A;  3IFT A;  4MTK A;  2QK4 A;  2EZV A;  1VQO A;  1E2W A;  1DJR D;  3MXN A;  4ZOL F;  1EYZ A;  4ILW A;  1TAE A;  1MD2 D;  3W2D A;  3MFG A;  4HJ8 A;  3GTK H;  4EQN A;  4O2B F;  1HQR D;  1N32 H;  3BYY B;  5T1G A;  2AWO A;  4QF4 A;  2VA2 A;  3H3V I;  5JOB A;  1VQ9 A;  3PO2 G;  3MFY A;  1HUM A;  2B29 A;  5KFW A;  2B2V C;  1YBY A;  2K5V A;  1EY9 A;  1SNC A;  3FRP B;  3M7G A;  4UP8 A;  2JA6 H;  1I6U A;  1UE1 A;  5GRO A;  4FF3 A;  1GYF A;  2M9V A;  2NVQ B;  1BO0 A;  1E24 A;  2F03 A;  2UXC Q;  4ZUI A;  4F4W A;  2V58 A;  4OWW B;  1QVG A;  1A3V A;  4LAA A;  4WJ3 M;  1TT2 A;  3VYS A;  2IX0 A;  1T5X D;  2G5D A;  4Q44 A;  2FMM A;  1M0T A;  1B53 A;  1BXR A;  1VAJ A;  3I4L A;  1M90 C;  2Q2T A;  2TSS A;  4B3T Q;  1O78 A;  5EJW A;  1E3P A;  3MXU A;  3H91 A;  4G4K A;  4CC5 A;  4ME6 A;  1SAP A;  3CCU A;  1GUS A;  4YIJ A;  3RBE A;  1PH9 A;  4DK0 A;  1EY6 A;  3AFQ A;  1SNO A;  2DUD A;  2DNE A;  2HT1 A;  1HNX Q;  2WAQ A;  1KNA A;  1JR0 D;  1Y8O B;  2ZJR A;  4IFD I;  2JEF A;  4OO1 G;  4J15 A;  2NU7 B;  1SCU B;  3QWN A;  1HJP A;  4NW2 A;  2BDO A;  4DNI A;  3L3O C;  4U68 A;  4A3B B;  1HZA A;  5EKK A;  1BQQ T;  1STH A;  1SE8 A;  3CD6 A;  5BR8 L;  4GC7 A;  4ECS A;  4PMW A;  3BG3 A;  2CQA A;  4HIO A;  1WTH A;  4GC6 A;  3S2D B;  4X66 Q;  4IO9 A;  1K8G A;  1O7L A;  1GXD C;  1GUO A;  1SNQ A;  3BZK A;  5ELN A;  3G6Y A;  5IT9 L;  1VQJ A;  5DLQ E;  1ET9 A;  5M3F H;  3D8G A;  1G29 1;  4KY6 A;  4JI5 Q;  1DIK A;  5FLM H;  4UCR A;  5J2U F;  4IWX A;  1GM5 A;  3PF5 A;  3FPP A;  1DXM A;  4JI6 Q;  2W6Z A;  2CW7 A;  4IOA A;  3DXJ C;  1B04 A;  3BG5 A;  3KF8 A;  2W8K A;  2FK2 A;  3FEW X;  3EYY A;  2PI2 E;  2UXD Q;  3EPG A;  1ZYR C;  2W6P A;  5JJI A;  1PRT B;  1JJC B;  3MXP A;  1X3G A;  1HNX H;  1MZB A;  2EY1 A;  2I80 A;  4DK6 C;  4QB4 A;  2OLS A;  2QGQ A;  2B3G A;  5KFU A;  1X54 A;  5EPL A;  1J8I A;  4LFA Q;  2F0F A;  1SSO A;  1N8R C;  2HDL A;  5C4X H;  4HIK A;  5D1P A;  1ASY A;  1JQY D;  3AEV A;  1JOR A;  4DR4 L;  4RGM A;  4K5X A;  1DOL A;  1II3 A;  1A3U A;  2CHB D;  2RHQ B;  4O1N A;  4PG3 A;  3W1B A;  4B08 A;  1JB7 A;  2O5I C;  4TV8 F;  5LL6 X;  5K36 G;  1S68 A;  1HA5 A;  3EN2 A;  3BDL A;  1UUP A;  3MC0 B;  1EIY B;  3C0F B;  3TS2 A;  4Y52 H;  4JI5 H;  2VUM B;  3SK5 A;  1R9T B;  1WI5 A;  2ZDH A;  4JI6 H;  2H1E A;  4DL5 A;  3TBI B;  5CV9 A;  4B9W A;  1LV9 A;  3CW2 C;  4F88 A;  3PUZ A;  5CA0 F;  2UXD H;  1W93 A;  2SCU B;  2JA9 A;  4IPD A;  4AH6 A;  3PO3 H;  3CVZ A;  4UCV A;  3RV4 A;  4KMU C;  1SRO A;  1UEA B;  2QDB A;  3C1E A;  4EEY A;  1VQE A;  4K8I A;  1I3Q A;  5D1O B;  5M5Y H;  1SYG A;  1VQA A;  2JEB I;  4EBE A;  1B44 D;  4RB3 C;  1HNZ L;  1O7I A;  4DUZ L;  2QA4 A;  2DLN A;  2QKI C;  1SE4 A;  1W6K A;  1OXU A;  4HCS A;  4RCO A;  4HMI A;  2PCF B;  1V4Y A;  1EQT A;  1X32 A;  4FYD A;  5C5J A;  5ELF A;  1X9N A;  5A2Q E;  5CR3 A;  3RNU A;  1PRT F;  2MPM A;  2B39 A;  2XGP A;  1VQG A;  4DXG A;  3VPB A;  1G6P A;  4QCL A;  1VCI A;  3OHX C;  4LH7 A;  4JI2 Q;  4C1N I;  3URY A;  1TR5 A;  3HKS A;  3P75 A;  3HOY G;  1GKH A;  4FVM A;  3RUP A;  4YWK A;  5J39 A;  1ENF A;  1VQM A;  2UUB H;  4C3J G;  2R86 A;  5G3L F;  1M0W A;  1N33 Q;  3IN5 A;  3H94 A;  3N6X A;  3GTG H;  4WOR A;  5GAD C;  1ICW A;  5T1I A;  3VR2 A;  2YRW A;  1UAP A;  1PFB A;  3TRZ A;  1A63 A;  4UY8 C;  3HOZ H;  4NLG A;  2Z1C A;  4R4C A;  2AWN A;  1V9P A;  3ULJ A;  5ELO A;  4F7X A;  4DL4 A;  4H13 C;  1IZ6 A;  4LF5 L;  2L15 A;  3OW2 A;  5KNB A;  4BBS B;  4ETS A;  4X65 L;  3L0O A;  4Q43 A;  1W6J A;  2IX3 A;  1LTR D;  1SJH D;  3OYY A;  1FJG L;  4JI2 H;  3I8Z A;  2Z4I A;  1KJQ A;  1HR0 Q;  3RFC A;  2YU9 A;  4A3G B;  1SYC A;  1RD9 D;  2VPS A;  1GUN A;  3J80 c;  2EYL A;  1B6S A;  4EBD A;  1Y69 U;  2R6F A;  5C5L A;  5KT7 A;  2BOS A;  5CV4 A;  4HAE A;  2CH4 A;  4HN7 A;  3G48 A;  4ZHQ F;  1BNC A;  5K2M A;  3U50 C;  1N33 H;  1S0N A;  4KD3 A;  1HA6 A;  3PN1 A;  2C00 A;  2R8J A;  1ZEQ X;  1KJ9 A;  4IR9 A;  1VQP A;  3NTK A;  1EY8 A;  4OO1 I;  2TMP A;  1SBB B;  1MI2 A;  1EY5 A;  2CWA A;  3N52 A;  4A3D H;  2R93 A;  1TWA H;  1NUC A;  3MVV A;  1Y1V B;  1HTL D;  3MEF A;  4DR3 L;  3KYH C;  4XDX A;  2VR1 A;  2Y0S B;  3I4M B;  4JI8 Q;  4DK3 C;  3NQT A;  1FL0 A;  1WFQ A;  3U58 A;  2F0O A;  4NB3 A;  4IUQ A;  3ICE A;  1HR0 H;  1KNE A;  2CH4 W;  3SR1 A;  4DR5 L;  3K5I A;  3T4A C;  4YCV A;  4J8Q A;  4K5V A;  3I4N B;  1X6O A;  2R92 A;  1PA6 A;  3KAK A;  4IZO A;  2L1B A;  3GTO B;  1X3P A;  4YJ2 F;  1HNW L;  3CME A;  3KLS A;  4C3I G;  4A3J B;  1N36 L;  4ULL A;  1L1O A;  3R23 A;  1A2U A;  1RJQ A;  5H80 A;  3F8T A;  5FJ8 H;  1D6E C;  2XRQ D;  3GID A;  3U4Z A;  4JI8 H;  3CU7 A;  1ILQ A;  3V4Z A;  1HUN A;  4EYH B;  2E2H B;  2AQ3 B;  1JXL A;  2PZT A;  1GOZ A;  3SDZ A;  5KX5 F;  3SK4 A;  1WCM H;  2FK3 A;  2LY7 A;  2GPW A;  4HJ9 A;  1WTR A;  4EFB A;  3M4I A;  2GA4 B;  4PDB A;  4L5R C;  2JA7 B;  1CZW A;  4A3E B;  4DR2 Q;  1CKN A;  4N8F A;  1BCP D;  4LUZ A;  4RGT A;  2B8F A;  3TSS A;  3OHA A;  2WP8 J;  3K80 C;  2KUM A;  4B3S Q;  5CA1 F;  1NE3 A;  1TWG H;  2M00 A;  4RCN A;  5CV8 A;  3OWE B;  4U6P A;  3H6M A;  1I94 L;  4ED6 A;  1H9M A;  2NU8 B;  1GSA A;  4JI3 Q;  1G51 A;  2NVX H;  5IYD H;  2BH2 A;  1RJP A;  4WD3 A;  2W6O A;  3L9A X;  4JBJ A;  4QIW E;  4V0B A;  2K5W A;  1IYV A;  3GTP H;  1V51 A;  3K3P A;  2ENB A;  4ODG A;  3NHH A;  5EGT A;  1TWF A;  4YQW A;  1Q8K A;  1YNN C;  2EYO A;  1BBU A;  3CF5 A;  1E4G T;  3MWD A;  3K5O A;  4JI4 L;  3BAA A;  4DR6 H;  3R3O A;  1UEB A;  3HP3 A;  2E2J H;  5KFH A;  4KHP L;  4LF9 L;  1S5C D;  3BVZ A;  4DGZ A;  3Q2O A;  4O3P A;  5CBA E;  4DR2 H;  3KLR A;  4IR1 A;  1C7Y A;  5KFX A;  3CCL A;  2VQE L;  3RB4 A;  3ETJ A;  4B3S H;  4GN5 A;  1IBM Q;  3Q22 A;  1KRS A;  4NPS A;  4E4T A;  3R2I A;  1XNQ L;  2K52 A;  2NN6 G;  4JI3 H;  3OHB A;  3KJO A;  3BU2 A;  2A6H C;  2W9C B;  1DOM A;  1Y8N B;  1D2B A;  3P7J A;  4JYA L;  2NVQ H;  2DN8 A;  5J3B A;  1BUV T;  2PMZ A;  3K0Y A;  1VBG A;  1WR2 A;  1LAB A;  3AFP A;  2W6Q A;  2FXQ A;  1K0R A;  2W9B A;  2RVL A;  2RF4 A;  2WIN B;  4CJ2 C;  4G7Z C;  4RNO A;  3EFX D;  4MTN A;  4J9P A;  4ECZ A;  4A3I G;  3I2Z A;  4LF8 Q;  1BXT A;  3G6V A;  4IUR A;  1JDE A;  4KHZ A;  1L2Z A;  2DIK A;  2RDJ A;  1HXY D;  1EIH A;  3RLF A;  4A2B A;  1BVS A;  3MR2 A;  3J7A V;  3H20 A;  1S97 A;  1IBM H;  3Q6S A;  1RK5 A;  1YVC A;  2PNR C;  2MNA A;  4O3N A;  2HQL A;  1ZQ7 A;  5I2X A;  4PNY A;  1XMQ L;  1V1P A;  1UC8 A;  4A2A A;  2AGO A;  5ISR A;  2IHE A;  4C2M B;  5IP7 G;  3EIV A;  1J5E L;  5LOV F;  3H0G B;  2KHS A;  2L0C A;  4IUU A;  4JC0 A;  1U4M A;  2PQA B;  3Q24 A;  4A93 H;  2Q8T A;  1I4R A;  5M3F B;  4BY1 G;  1CHP D;  1O75 A;  3HOX G;  2DPJ A;  4CC6 A;  3KF6 A;  4A3B H;  1B33 N;  4F4Y A;  3PUX A;  3A5U A;  4B3R L;  4Y8V B;  3DEP A;  5GQO A;  3KAJ A;  4C5B A;  2RBM A;  3A8I E;  5LMU Q;  2WB1 G;  4DNT B;  2WAQ E;  5CYU A;  1ESF A;  2AQ1 B;  1KQS A;  2RDI A;  4LFC Q;  3MZ5 A;  4LF8 H;  5F2D A;  5BPF A;  3S1Q H;  2A68 D;  4K2K A;  1TS5 A;  1OXS C;  4DV0 Q;  1EHI A;  3N44 B;  3D4R A;  1VQI A;  1VQF A;  1S9F A;  4RHR A;  5C3W A;  3BS1 A;  1IYU A;  4LNQ A;  5C4X B;  1YJ9 A;  2UVW A;  1U4L A;  4NDX A;  4A4I A;  3K5H A;  3TP5 A;  2YL2 A;  2P5Z X;  4A3K H;  4O4I F;  3J7Z C;  1KTK A;  1LT3 D;  1WYD A;  2NVT B;  4R4Q A;  4ECQ A;  2A69 C;  4M9U A;  4BBR G;  1IBK L;  1SE3 A;  2FLL A;  4L5S A;  4O42 A;  5JJZ A;  2NVY B;  1CK1 A;  4JI1 Q;  3FDT A;  1ASZ A;  3GTM B;  2B2W A;  1EY0 A;  1TKW B;  1L0W A;  3R8B A;  1WTP A;  1S03 G;  4DV7 L;  4HED A;  1KJ8 A;  1E7Z A;  4LFC H;  1PZK D;  1MSH A;  1PFS A;  1LTA D;  3BVM A;  4DV0 H;  1QWY A;  4KY5 A;  1R9T H;  1EQV A;  4JW0 A;  5M5Y B;  2FB9 A;  2RGV A;  3RAQ A;  1B70 B;  1PYW D;  4RKL A;  3BVG A;  2XCP A;  3ONA B;  3ULP A;  1SDF A;  2EYH A;  3WO0 A;  2NU9 B;  1XTD A;  5C4H A;  2BA1 A;  2XIG A;  4P2C B;  4ECW A;  3BDC A;  3MFI A;  2YTX A;  2K5H A;  1S4Z A;  2PO4 A;  3NSW A;  1U4R A;  1XPO A;  1RYR A;  4RU9 A;  3D6C A;  3T16 A;  1S5B D;  1D5X C;  2R7L A;  3BA8 A;  4JI1 H;  1KL9 A;  5FPO A;  3PCO B;  4MNO A;  5IT9 W;  4EEQ A;  1VS0 A;  3IG0 A;  2K75 A;  2PPB C;  4DV6 L;  3JZI A;  3M4O B;  2FPI B;  5BPH A;  1SFO A;  1IOW A;  4JI7 Q;  1CSP A;  5HBR B;  4YR3 A;  4DAM A;  4PZ7 A;  3GTG B;  2VA3 A;  1PTO C;  2UXB H;  2Z8L A;  3NE5 B;  3A7A B;  4UP7 A;  2CKZ B;  4O4H F;  2DJG C;  5L1L A;  2YTY A;  4CDC C;  2Q2U A;  1EUD B;  4R1J A;  4XZ3 B;  1PXU A;  2LXK A;  1Q1E A;  2KED A;  4CJ1 B;  3VA5 A;  3RV3 A;  4ED0 A;  2D9U A;  1AUV A;  4EGJ A;  1PH6 A;  2NN6 I;  1S0O A;  1STY A;  4GOP C;  2B2Y C;  3M4Q A;  2CCZ A;  4DV2 L;  3UE1 A;  4CKC A;  2HD3 A;  5FKA C;  5ELE A;  4EGV A;  3JC6 6;  3UDX A;  5IWA L;  4RNM A;  4JI7 H;  3SK8 A;  4BBS H;  2EYF A;  4YY3 Q;  2F0L A;  5J1Z A;  3PW4 A;  3W3A A;  2OTL A;  4Q0Y A;  1PV4 A;  1D5Z C;  1JMC A;  3V4S A;  3F2U A;  1NNX A;  3OSN A;  5DLF A;  3K6O A;  3R2T A;  4A3G H;  2JA8 H;  3I73 A;  1SNM A;  4UPA A;  3FVQ A;  1X3E A;  4QL5 A;  4PZ6 A;  2BA0 A;  1JJ2 A;  1JB3 A;  3U9O A;  5FOB B;  3MFH A;  1PMR A;  3M7N A;  3I7F A;  1PYB A;  1JX4 A;  1PZI D;  5KFY A;  5BN5 A;  3M9O B;  1ESR A;  1JIC A;  5D3D A;  2ZJT A;  1ZET A;  4LF7 L;  1LTT D;  2HQE A;  2KEE A;  1S0M A;  1OO9 B;  2R8K A;  5M5W B;  2VQD A;  4GKK Q;  5KFN A;  5JEA H;  4AQY Q;  1Y1V H;  3K5M A;  2ASL A;  4AIM A;  1FGB D;  4I4T F;  3RBD A;  4I7A A;  3J81 j;  4F4X A;  2XGT A;  4LW1 A;  3S1M H;  4ZQI A;  5GON F;  1V1Q A;  3Q8S B;  4DV1 L;  4ECU A;  1TWC H;  3NGD A;  5KRU A;  3RLO A;  5F9L A;  3FKI G;  3QO2 A;  3WDN A;  2LS0 1;  4GNX A;  1XMO L;  2E5L L;  3HOW B;  4QWD A;  1CA5 A;  3GIJ A;  5KKN B;  4ME3 A;  4R4I A;  3BJU A;  4JOI C;  1FNV A;  3GV8 B;  1ULZ A;  1K9M C;  1KIX A;  4KLK A;  2BR0 A;  4JBK A;  4K0K L;  4Q45 A;  1I6V C;  2F0S A;  4PWQ A;  1FD7 D;  4A3J H;  2AGQ A;  1N34 H;  4RUA A;  3T1H L;  4UDU C;  2ZDG A;  2ZM6 Q;  4HNV A;  4GKK H;  1CKO A;  4B3M L;  5EWE A;  4AQY H;  4DUY Q;  1HQM C;  2E2I B;  1JWS D;  3KAL A;  2R7D A;  4QIW B;  4OEL B;  3D3R A;  3J81 c;  5D65 A;  3I12 A;  4X3T A;  4JVZ A;  2EJF C;  4C5A A;  1PH1 A;  2ZT9 C;  2E76 C;  2B63 G;  3BAB A;  1TWG B;  1E2Z A;  4C3H H;  2K1B A;  4MA0 A;  4APM A;  3HKZ G;  2QDL A;  4RB2 C;  2ALZ A;  1OXV A;  4ZYS A;  2NVX B;  4XYM B;  1TXY A;  5JJK A;  2RCF A;  4FM9 A;  4A3E H;  4G7O C;  2B2Y A;  1L0Y B;  2Q8I B;  1G91 A;  1VF7 A;  4KJN A;  3OWF A;  2GLT A;  1XDN A;  2Y0S G;  3I4M G;  1BGW A;  3OTO L;  3NQI A;  3PSI A;  1QB5 D;  1MBY A;  2MJ8 A;  4IZ8 A;  2GVB A;  5FK9 C;  2R7Z B;  1CA6 A;  2B2T C;  2ZM6 H;  1GGO A;  3TME A;  2E2J B;  4DUY H;  3FHW A;  3EBE A;  3MJF A;  3MXN B;  1ICF B;  4POG A;  4UCS A;  1NY4 A;  3S14 B;  2VY3 A;  4OL7 A;  3I4N G;  5IYB G;  1I50 A;  3GO5 A;  1AN8 A;  3E5N A;  5DG9 A;  3MR6 A;  3T5L A;  1KXL A;  1STE A;  1Z47 A;  1PRT C;  1LYL A;  2K4K A;  3MWY W;  2RKS A;  3VA7 A;  4GLA C;  1BF4 A;  2VXW A;  4RAZ A;  4ABN A;  1YNX A;  2PVP A;  1MSG A;  2UXC L;  3H4D A;  4TKO B;  1IYJ B;  3JAM W;  1IOV A;  3PGZ A;  3S24 A;  3SI8 A;  2XIW A;  4YCW A;  1DV1 A;  3OSP A;  1PLF A;  1WTW A;  4DL7 A;  3J80 L;  1LTB D;  3TEH B;  3N40 P;  4ECT A;  1PTO D;  4J9O A;  5IOD A;  1VQN A;  3HB9 A;  4BWS C;  4K2L A;  2JA7 G;  4FS2 A;  2WB1 A;  5KFM A;  4B3T L;  3KHR A;  2VB2 X;  2AU0 A;  4LJZ C;  2EYJ A;  3KDF A;  3S1R H;  2FPG B;  1AE2 A;  4XT1 B;  4P73 A;  2WYO A;  3PW0 A;  2WAQ B;  5C4J H;  2UU9 H;  2BE5 C;  3BYT B;  3QIA A;  2OQ0 A;  2L9H A;  1D8L A;  4TUY F;  1EU3 A;  4JV5 L;  3A54 A;  2R82 A;  2Z6K C;  3KHG A;  3K5N A;  4A93 B;  1PHJ A;  4P71 A;  1E0B A;  1SR3 A;  1EWH A;  4GN4 B;  2PMZ E;  3CC7 A;  4JV2 A;  4QUC A;  1T36 A;  3I91 A;  5IP9 H;  4I55 F;  4KY7 A;  4RH6 A;  4C2M H;  4H02 A;  4X66 L;  3JRX A;  4LSA A;  3ORQ A;  2I5L X;  4X62 Q;  5EPJ A;  3H0G H;  2OQK A;  4APV A;  5BN3 A;  3S1Q B;  1WTX A;  3KF8 B;  1ENC A;  2JA6 G;  2UUC L;  4JI6 L;  3VYU A;  3K59 A;  4K6D A;  4LF4 Q;  1R4P B;  1XPU A;  4M7E A;  1IBL L;  2UXD L;  2R7K A;  5A35 A;  1W2B A;  5LMN Q;  4A3K B;  5E4W C;  4PMB A;  2LSS A;  1PZJ D;  3BJY A;  3GIL A;  5BR8 Q;  5LL6 S;  2EE1 A;  2EPB A;  3JAM i;  1K0S A;  1ILP A;  1CZG A;  5TSS A;  1CQF A;  3EPI A;  3ZJY C;  3HXL A;  3HEJ A;  1MJE A; 
#chains in the Genus database with same CATH homology
 2LXJ A;  2ZTD A;  1PA6 A;  1SRU A;  1PH3 A;  3DM3 A;  4YHH L;  1LTL A;  4EX5 A;  1HNW L;  3KLW A;  3CME A;  4DV1 Q;  1MKH A;  3SGI A;  2WAQ G;  4OWT B;  1N36 L;  1L1O A;  2XTI A;  3L2P A;  4A3G G;  2JA8 G;  5AJ3 Q;  3HKZ E;  3UDI A;  2NVT H;  1HH2 P;  1NMG A;  2E5L Q;  3F8T A;  4X64 Q;  5FJ8 H;  5C0X J;  4DR7 L;  3HOV G;  1PH4 A;  1EUJ A;  3U4Z A;  4DR1 Q;  1HR0 W;  3RLN A;  2UXB L;  1T9H A;  1N32 L;  2NVY H;  4R4T A;  1GO3 E;  4LF6 L;  3ERS X;  3GTM H;  3I55 A;  3AQQ A;  3JAM c;  2HHH L;  1YHB A;  2JEA I;  1WCM H;  4K0K Q;  4P74 A;  3STB C;  4HJ9 A;  3PO2 H;  4L5Q A;  1Q7Y C;  1X65 A;  1U0L A;  5JEA G;  4GOP A;  2UUB Q;  4L5R C;  4NXN L;  1Y1V G;  4QGU A;  2K5N A;  3A0J A;  4YWL A;  2NZO A;  4DR2 Q;  1CKN A;  3F1Z A;  2N78 A;  4LUZ A;  3GTJ H;  5M3F G;  2VUM H;  5FLM G;  3W5O A;  2WP8 J;  2RHS B;  1DGS A;  1PH5 A;  3K80 C;  4B3S Q;  2K14 A;  1NE3 A;  1TWG H;  3NEL A;  4XIG S;  1I94 L;  5C0X G;  1Y14 B;  4LUO A;  1YIJ A;  4JI3 Q;  1G51 A;  1I5F A;  2NVX H;  4JI7 L;  1NTG A;  2BH2 A;  4XTC S;  5IYD H;  3S16 H;  1HZC A;  1TWF H;  4JBJ A;  2MO1 A;  4QIW E;  4GNX C;  1XNR L;  1B8A A;  5C44 H;  3AYH B;  5IYC H;  3GTP H;  3F2B A;  2A19 A;  1YI2 A;  5LMN W;  1VQ5 A;  1VQ7 A;  1YZ6 A;  2Z6K A;  5C4X G;  1Q8K A;  2UU9 Q;  1BBU A;  3CF5 A;  4JBM A;  4A3J G;  2KBN A;  4JI4 L;  1TWH H;  1N9W A;  1IXR A;  1SMX A;  1UEB A;  2BH8 A;  3UDF A;  4DPG A;  3F2C A;  1XJV A;  2E2J H;  3K0X A;  4KHP L;  4LF9 L;  3M4O H;  2I5M X;  4QQB X;  4DV6 Q;  1YIT A;  1N33 L;  1C7Y A;  2CQO A;  3M9B A;  3CCL A;  1X3F A;  5IE8 A;  1PYS B;  2VQE L;  1A62 A;  4HJ5 A;  1H95 A;  4NXM Q;  4GN5 A;  1IBM Q;  1KRS A;  4NPS A;  1P16 A;  3PUY A;  1XNQ L;  2K52 A;  2EIF A;  4IFD J;  1A8V A;  4IPC A;  1Q12 A;  2NN6 G;  5GAH C;  3J7A 5;  4BY7 G;  4IOC A;  4GS3 A;  4R4O A;  3KJO A;  3BU2 A;  3K81 C;  3KDF B;  1Q46 A;  4A3E G;  4LWC A;  1CSQ A;  1E22 A;  1PH7 A;  3PO3 G;  1K83 H;  3ER0 A;  4JYA L;  2Q2H A;  2NVQ H;  1VQD A;  4YWM A;  1MIU A;  5J3B A;  4JOI A;  5M5X H;  2VNU D;  2CFM A;  3M85 A;  3AFP A;  2FXQ A;  1K0R A;  2R6G A;  2RF4 A;  4DV4 L;  1HNX L;  1QUQ B;  1L2F A;  4DV2 Q;  1B7Y B;  4MTN A;  2OTJ A;  1Q82 C;  1GD7 A;  4A3I G;  1PH2 A;  3I2Z A;  4LF8 Q;  3PUV A;  4L5T A;  1QZH A;  1E1O A;  4LFB Q;  3KFU A;  4KHZ A;  5JJK A;  3L7Z C;  4DKA C;  2MQH A;  3RLF A;  1BVS A;  3G4S A;  1YJW A;  4IFD G;  1N34 L;  1BKB A;  4GLV B;  1VQH A;  1YVC A;  2MNA A;  4GKK L;  4EQ5 A;  2HQL A;  2VL6 A;  1VQC A;  4X62 L;  1YHA A;  1XMQ L;  1EOV A;  2F52 A;  1EWI A;  2IHE A;  5IP7 G;  1FJG Q;  3EIV A;  1J5E L;  2KHI A;  4JI5 L;  3E9I A;  2GVA A;  3G6E A;  4JC0 A;  2PQA B;  4OX9 Q;  3NEM A;  4JI8 L;  4A93 H;  4JV5 Q;  3PIO A;  1S40 A;  2JK8 A;  4BY1 G;  3HOX G;  4LF4 L;  1QZG A;  2B63 H;  3KF6 A;  4AYB G;  3GTL H;  4A3B H;  2DGY A;  4A3L H;  3PUX A;  3A5U A;  1IL2 A;  4B3R L;  5GQO A;  5LMN L;  5M5W H;  5LMU Q;  2ID0 A;  2WB1 G;  2YV5 A;  3DLL A;  2WAQ E;  5GAG C;  4JI0 L;  1K3R A;  1KQS A;  3HOZ G;  4LFC Q;  3B6Y A;  3S1Q H;  2KCM A;  5JEA J;  4DV3 Q;  4A75 A;  3RN5 A;  1OXS C;  1S72 A;  2HIV A;  4DV0 Q;  2IX1 A;  2I5H A;  4A3F G;  3I4M H;  1VQI A;  3PF4 A;  1VQF A;  4OXP A;  1YJN A;  1L1O B;  4OWX B;  5GAE C;  4LNQ A;  3I4O A;  2ZM6 L;  1YJ9 A;  2UUC Q;  4A4I A;  1E1T A;  4DUY L;  5AJ3 L;  3HOW H;  3CPF A;  4A3K H;  2OCE A;  3J7Z C;  1XMO Q;  2GN5 A;  1WYD A;  4X64 L;  1IBL Q;  4GLX A;  4A3M G;  1VQ6 A;  1OXT A;  1RIP A;  1V43 A;  4R4Q A;  3TS0 A;  4A3C G;  1UWV A;  4DR1 L;  2IHF A;  2Q2I A;  4BBR G;  1IBK L;  2JA5 H;  5IYB H;  3I4N H;  1JJG A;  1HZ9 A;  1Y1W H;  4L5S A;  3CP0 A;  2KCT A;  5C3E H;  2QEX A;  2NZH A;  2Y0S E;  3GTO H;  1AE3 A;  1VQ8 A;  4JI1 Q;  1ASZ A;  4GOP B;  2R93 G;  1L0W A;  4ALP A;  1MJC A;  5IP9 G;  3HOY H;  2HIX A;  4DV7 L;  4DR6 Q;  2UUB L;  1C0A A;  1CKN B;  3T1H Q;  1E7Z A;  2E2I H;  4DR4 Q;  4BXX G;  3F2D A;  4A3D G;  2ASB A;  1PFS A;  3H0G G;  4B3M Q;  1RL2 A;  4C3J H;  1EQR A;  3CQZ H;  2ZJP A;  3H15 A;  4HID A;  1R9T H;  3RZD H;  3W1G A;  4B3S L;  2AMC B;  2ZJQ A;  2OWO A;  2AHO B;  3D0F A;  5HY6 A;  2CWP A;  3GD7 A;  3CCE A;  1B70 B;  2E2H H;  1N32 Q;  2UUA Q;  3ULP A;  4LF6 Q;  1K8A C;  1XTD A;  3RZO H;  3GDE A;  2BA1 A;  3TQY A;  1NJI C;  2HHH Q;  2R92 G;  4IPG A;  1C9O A;  2YTX A;  4O0A A;  2K5H A;  4JCV E;  3G71 A;  2JA7 H;  4P72 A;  1LUZ A;  4DV5 Q;  1Y1W G;  3STB D;  3HOU G;  1I6H H;  4JI2 L;  1XPO A;  2KEN A;  3E0E A;  5C0X I;  5E7N A;  2UU9 L;  3S1N H;  1KL9 A;  4IJH A;  4PZ8 A;  3OTO Q;  2ZTC A;  2EXD A;  5EAY A;  3T1Y L;  1SFO H;  2R7Z H;  2F3I A;  1HNZ Q;  3PCO B;  1JT8 A;  4DUZ Q;  4MNO A;  2WFW A;  3CCQ A;  2H5X A;  2N3S A;  1VS0 A;  3E9H A;  2K75 A;  1LM0 A;  2MFI A;  3S14 H;  4DV6 L;  1I50 H;  1EIF A;  4JG2 A;  5FJ8 G;  3S15 H;  2N49 A;  4GKJ L;  2IY5 B;  4JI7 Q;  1CSP A;  2A1A A;  2C35 B;  3KOJ A;  4TQU S;  2VQF Q;  1VQO A;  2A8V A;  1L1O C;  4DAM A;  3LGJ A;  1Q1B A;  2YTV A;  4PZ7 A;  4HJ8 A;  3GTK H;  2ALY B;  4UP7 A;  2AWO A;  1WCM G;  2CKZ B;  3H3V I;  2AKW B;  1VQ9 A;  1GVP A;  3PO2 G;  2YTY A;  2B29 A;  2Q2U A;  4R1J A;  1KRT A;  3WWV A;  1YBY A;  2K5V A;  2LXK A;  1Q1E A;  4UP8 A;  2JA6 H;  1BBW A;  1UE1 A;  5GRO A;  1FVI A;  3CXC A;  1HR0 L;  1E24 A;  1PH6 A;  2NN6 I;  4DAY B;  2UXC Q;  4KI0 A;  4GOP C;  4OWW B;  3M4Q A;  3PIP A;  1QVG A;  2CCZ A;  4DV2 L;  2F4V L;  3UE1 A;  4WJ3 M;  3CCJ A;  4LF8 L;  2IX0 A;  1EFW A;  3FP9 A;  2VZA A;  1XNQ Q;  5M3M H;  3JC6 6;  3UDX A;  5IYD G;  5IWA L;  3A5Z B;  2D62 A;  3VDY A;  1M90 C;  4YY3 Q;  2Q2T A;  4BBS H;  1KHI A;  4B3T Q;  4LF5 Q;  5C44 G;  1W3S A;  5IYC G;  2OTL A;  5JJL A;  1E3P A;  4BA2 I;  4X65 Q;  1PV4 A;  1JMC A;  2D0P A;  4AYB E;  4C3I H;  4A3G H;  4TVA B;  2JA8 H;  4O2D A;  3ULL A;  3CCU A;  1QVF A;  1PH9 A;  3AFQ A;  2WB1 E;  4UPA A;  4OX9 L;  2DUD A;  1X3E A;  4DV4 Q;  1HNX Q;  4QL5 A;  4PZ6 A;  2BA0 A;  2ZJR A;  1Q81 C;  1JJ2 A;  2HT1 A;  3HOV H;  4IFD I;  4J15 A;  3K7A H;  4OO1 G;  2I0Q A;  1QUQ A;  3M7N A;  3I7F A;  1PYB A;  3PV0 A;  1HJP A;  1UE6 A;  4DNI A;  5LMU L;  1HZA A;  4LF7 L;  3CD6 A;  1SE8 A;  5BR8 L;  4LFA L;  1VQK A;  4LFC L;  4PMW A;  3S17 H;  4HIO A;  4GKK Q;  2E8G A;  4X66 Q;  5H1S E;  4IO9 A;  4AQY Q;  5ELN A;  1K8G A;  3BZK A;  1Y1V H;  1VQJ A;  2JQO A;  1KAW A;  5DLQ E;  4AIM A;  3J81 j;  3GTQ H;  2XGT A;  4LW1 A;  3S1M H;  1V1Q A;  5M3F H;  1G29 1;  4DR3 Q;  3CMA A;  4JI5 Q;  5FLM H;  4DV1 L;  3PUW A;  1WJJ A;  3HFZ B;  1GM5 A;  1TWC H;  3PF5 A;  2EQS A;  4JI6 Q;  3J81 i;  3RLO A;  4IOA A;  1M1K C;  3CCV A;  5IY0 A;  3FKI G;  3M3Y H;  4GNX A;  2E5L L;  1XMO L;  2IT1 A;  1UE5 A;  4A76 A;  4DR5 Q;  2PI2 E;  2VS1 A;  2D0O A;  2UXD Q;  3CAM A;  1CKM A;  5JJI A;  1JJC B;  1X3G A;  2MO0 A;  4ME3 A;  4R4I A;  3CC2 A;  3BJU A;  4JOI C;  3RR5 A;  2ATW A;  4DK6 C;  1S3O A;  1VQB A;  1OTC A;  5IT9 c;  4Y7N H;  4JI0 Q;  1OXX K;  2QGQ A;  2B3G A;  1X54 A;  1K9M C;  1KIX A;  4KLK A;  4LFA Q;  4JI1 L;  3NEN A;  4JBK A;  1N8R C;  4K0K L;  4HIK A;  5C4X H;  4YHH Q;  2ZTE A;  4A3J H;  4DR6 L;  2V1C C;  1HNW Q;  1ASY A;  4WJ4 A;  1CUK A;  3T1H L;  3AEV A;  2ZM6 Q;  3UDG A;  3TRE A;  4DR4 L;  1CKO A;  4B3M L;  4PG3 A;  2RHQ B;  3W1B A;  4DUY Q;  1N36 Q;  1JB7 A;  4DR2 L;  1AH9 A;  2R7D A;  2ES2 A;  3H3V H;  5K36 G;  3S2H H;  3EN2 A;  3J81 c;  1EIY B;  4UP9 A;  3TS2 A;  4A93 G;  4Y52 H;  1D7Q A;  4DR7 Q;  3CCR A;  3IRB A;  1WI5 A;  1FGU A;  1PH1 A;  1IBK Q;  2Z0S A;  2UXB Q;  2B63 G;  1SLJ A;  2UUA L;  4A3B G;  4C3H H;  4A3L G;  4HIM A;  3U4V A;  3CW2 C;  4JI3 L;  3HKZ G;  3PUZ A;  4LUV A;  4BA1 I;  4BY7 H;  1OXV A;  3K7U C;  1Q86 C;  1I3Q H;  1TXY A;  2JA9 A;  1P8L A;  4DV7 Q;  4IPD A;  4AH6 A;  4A3E H;  4DV5 L;  3CPW A;  3CC4 A;  3PO3 H;  1SRO A;  4NXN Q;  4OON A;  1YHQ A;  2K50 A;  1VQE A;  2Y0S G;  3I4M G;  1X55 A;  1A0I A;  5M5Y H;  3OTO L;  1VQA A;  2JEB I;  1PVO A;  1UE7 A;  1HNZ L;  1O7I A;  3PSI A;  3K8A A;  4DUZ L;  4RG1 A;  1NBW A;  2GVB A;  2QA4 A;  3HOW G;  1VQL A;  2JE6 I;  4IPH A;  4A3K G;  4A3I H;  1I94 Q;  1OXU A;  3FHW A;  3EBE A;  3MXN B;  4POG A;  1NY4 A;  1X9N A;  2N8N A;  2VY3 A;  2VQF L;  3I4N G;  3RNU A;  5IYB G;  2JA5 G;  4NXM L;  1IBM L;  2VW9 A;  1VQG A;  2R7F A;  2RCN A;  1G6P A;  1EQQ A;  5C3E G;  3GO5 A;  1VCI A;  1XNR Q;  3A74 A;  4JI2 Q;  4JBW A;  3HKS A;  5IP7 H;  3HOY G;  1KXL A;  1EYG A;  1GKH A;  1Z47 A;  3RN2 A;  4RMF A;  1LYL A;  1K73 C;  4YWK A;  3T1Y Q;  2K4K A;  4JI4 Q;  4GLA C;  1VQM A;  5HGQ A;  4KHP Q;  4LF9 Q;  1SN8 A;  2JJQ A;  4BY1 H;  1YNX A;  3HOX H;  3J80 i;  2VUM G;  3CCS A;  2UXC L;  1IYJ B;  1N33 Q;  3PGZ A;  3S24 A;  5GAD C;  3GTG H;  4GKJ Q;  2VQE Q;  4YCW A;  4X6A H;  4GN3 B;  3TRZ A;  1A63 A;  1WOC A;  1X56 A;  4UY8 C;  3M4P A;  1HZB A;  3HOZ H;  4FDB A;  4QY7 A;  3TEH B;  4R4C A;  4LFB L;  2AWN A;  1V9P A;  3ULJ A;  1VQN A;  5ELO A;  4IJL A;  1J6Q A;  4YY3 L;  3BZC A;  2JA7 G;  1IZ6 A;  4QJF A;  4B3T L;  2L15 A;  4LF5 L;  3OW2 A;  3D31 A;  4A3F H;  2YU9 H;  4X65 L;  3L0O A;  3KDF A;  3S1R H;  4JYA Q;  1AE2 A;  3OYY A;  1FJG L;  3HOU H;  4P73 A;  1HR0 Q;  3FKI H;  5C4J H;  2R7Z G;  2OQ0 A;  4A3M H;  1D8L A;  4A3C H;  1YEZ A;  3J80 c;  4JV5 L;  3KF6 B;  4P75 A;  2F4V Q;  2Z6K C;  4BBR H;  1KD1 C;  1PHJ A;  4P71 A;  1SR3 A;  2PNH A;  4GN4 B;  2PMZ E;  3CC7 A;  1JE5 A;  3G48 A;  5IWA Q;  3U50 C;  3NBH B;  2R93 H;  4YCU A;  5IP9 H;  1N34 Q;  2KHJ A;  1VQP A;  1XPR A;  4C2M H;  4H02 A;  4X66 L;  4AQY L;  4OO1 I;  4BXX H;  4POF A;  2I5L X;  4X62 Q;  1XMQ Q;  4A3D H;  2CWA A;  4DV3 L;  3H0G H;  2OQK A;  4DV0 L;  2PI2 A;  1TWA H;  4APV A;  1J5E Q;  2YYZ A;  1NMF A;  3MEF A;  4DR3 L;  1VQ4 A;  1QVC A;  3KYH C;  5FLX c;  3KF8 B;  2JA6 G;  4JI8 Q;  4DK3 C;  4GNX B;  2UUC L;  4JI6 L;  3I56 A;  1FL0 A;  1WFQ A;  3U58 A;  1KC8 C;  2PQA A;  4LF4 Q;  4NB3 A;  3CCM A;  4HJ7 A;  1Z9F A;  3Q8D A;  1PH8 A;  1XPU A;  3ICE A;  4DR5 L;  1IBL L;  2UXD L;  1W2B A;  3UE0 A;  4B3R Q;  4HJA A;  5LMN Q;  4MZ9 A;  2LSS A;  1U5K A;  4YCV A;  4LF7 Q;  2R92 H;  3S2D H;  5BR8 Q;  3JAM i;  5M3M G;  3KJP A;  3ZJY C;  1X6O A;  1MJE A;  4BBS G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...