3PO3G

Arrested rna polymerase ii reactivation intermediate
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Structural basis of RNA polymerase II backtracking, arrest and reactivation.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/dna/rna
total genus 30
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2010-11-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3po3G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3po3G01
3TRZA 3I2ZA 2UUBQ 3F1ZA 2NVXH 1WFQA 2VQFQ 3STBD 1N8RC 1L0WA 3S1MH 3K8AA 4YHHL 3AEVA 5JEAG 2CCZA 2E5LQ 2HT1A 2JEAI 1YVCA 4MNOA 1HNXQ 4WJ4A 2WAQE 1Q1BA 3KF8B 3PO3H 3GDEA 4JYAL 3S1NH 1VQNA 3EBEA 2GN5A 4P71A 5IP9H 2MNAA 1GD7A 3KF6A 4R4IA 4DR2L 5LMUQ 4BY1H 2ATWA 2JA6H 2IHFA 1HZ9A 4WJ3M 5IWAQ 4C3JH 4DV2L 3JAMi 1Y1WH 3GTPH 4K0KQ 4BA1I 2N78A 2LXKA 2DUDA 3A0JA 3AFQA 4DR3L 2OTLA 2R7ZG 1PHJA 2GVBA 4GS3A 4GN5A 5IY0A 4A93H 1V43A 5HGQA 4UP8A 1N9WA 2VQEQ 4A3EH 2K5VA 1DGSA 4A76A 2EIFA 1VCIA 3PV0A 2N49A 1E7ZA 4NXMQ 4JV5Q 4DV4L 3K7UC 2OWOA 2UXDQ 4YWLA 3TS2A 1SROA 1YIJA 1Q1EA 1J6QA 4A3DG 3HOVH 1VS0A 2WAQG 2V1CC 2MO1A 4JBJA 5C0XI 1X3FA 4YHHQ 4HIDA 3HOYH 1X3EA 1FJGL 3MXNB 3CW2C 4DV3L 3VDYA 4PZ7A 4A3CG 4UPAA 5JJIA 5C4XH 2UU9Q 3KYHC 4LF8L 4LF5L 4JI6L 3CD6A 2N8NA 3AFPA 4AYBG 1NY4A 2WB1E 3M9BA 1XNQL 4LW1A 2PQAB 4DR2Q 4X6AH 2QEXA 4H02A 4DV2Q 3M3YH 2E8GA 4LF4L 4LF7Q 1EUJA 1KRTA 1NTGA 3GTKH 3T1HL 1I6HH 4GLXA 1AH9A 3ULLA 5J3BA 4AIMA 2AWOA 1VQ9A 2YTYA 2PNHA 2F4VL 1RIPA 1SR3A 4JI0L 1IYJB 5GADC 3G4SA 5FJ8H 5AJ3L 4DV7L 4IOCA 3K7AH 4UY8C 1Q12A 2XTIA 1YJ9A 1Y1WG 4LFAL 4ALPA 4GKJQ 4GOPB 2I0QA 1CSQA 1NE3A 1GO3E 2RCNA 4JI1Q 4BBSH 4BXXG 4IPHA 2K5NA 3KJOA 3U58A 1VQDA 2VZAA 4A3JH 2IX1A 4A93G 1XNRQ 4A3EG 3HKZE 1I94Q 2WB1G 4QIWE 1OXUA 2Z6KA 2NVQH 2DGYA 3UE0A 4B3RL 3CMAA 1JE5A 3KDFB 4GNXC 4GNXA 3TEHB 5LMNL 4R4OA 4JI6Q 4LF5Q 1S3OA 4ME3A 1X9NA 3I4OA 1SFOH 4JI5L 5IP7H 1EQQA 2ES2A 2KCMA 1FVIA 1XNQQ 2Q2IA 1QVFA 2JA9A 1PYSB 1I3QH 4DK6C 3CPWA 2R7FA 4R4QA 4EQ5A 4HJ8A 1VQPA 4B3TQ 1AE3A 3E0EA 1VQFA 2B29A 2ALYB 3H0GG 3JAMc 3CCJA 1NJIC 1HNZQ 2UU9L 4DK3C 1Q8KA 1YI2A 4P72A 3GTLH 3HOUH 4DR4Q 3T1YQ 3RR5A 2UUBL 1N36Q 1X3GA 2HIXA 2VQFL 3GTQH 1EQRA 4P75A 2UUAL 2JEBI 5GAGC 3KOJA 3F8TA 1PH3A 2ZJQA 4NB3A 2E5LL 1HNWQ 2R93H 1VQHA 2BH8A 3PUZA 2VUMG 4JI8L 4LFBQ 1MKHA 3DLLA 2E2HH 2CFMA 2AMCB 3HKZG 3S24A 4QL5A 3PCOB 1HNXL 3J7A5 1FGUA 1OXSC 2K52A 3PF4A 2F52A 1PYBA 1UE7A 1X6OA 1XJVA 1E24A 3KLWA 1VQJA 1IBMQ 5LMUL 1PH6A 3S2DH 1CUKA 5IWAL 3HFZB 1QVCA 4GN4B 4K0KL 2WFWA 1VQOA 2CWAA 4LFAQ 1T9HA 1P16A 2D0PA 2E2JH 3CCSA 2MFIA 2EXDA 1QVGA 2KCTA 1IBKQ 2QGQA 4AQYQ 2OTJA 2JA5G 4LWCA 3TREA 2VQEL 5JJLA 4GN3B 3PO2H 2K5HA 2Q2HA 4KLKA 3K0XA 1UE6A 3PGZA 4HIOA 1YHQA 5FLMG 4X66Q 3RN5A 4NXML 2RHSB 3I56A 1J5EQ 3GTMH 3AYHB 4UP9A 4JV5L 2UUCQ 2AHOB 1IZ6A 2I5MX 4R4TA 5M5WH 1HZCA 5GAHC 2VL6A 2UXDL 5IP7G 3S14H 1TWFH 1LM0A 1XMQQ 2UUAQ 1KHIA 1K83H 3DM3A 3GO5A 5K36G 1E22A 4JI8Q 3H15A 3Q8DA 1UEBA 3MEFA 4A3GH 4DUZQ 2CWPA 1B7YB 1VQ7A 1Z47A 1TWCH 1ASYA 3CF5A 1N34Q 3I4MH 1MIUA 3HOZH 1S72A 2PI2E 4J15A 3J80i 4TVAB 1C9OA 3PUWA 4A3IH 2KBNA 2PQAA 3S16H 2R93G 4OXPA 4IJHA 3J81c 4AYBE 4LF7L 5IYDH 3M85A 1KXLA 1WI5A 3CCUA 3L7ZC 5BR8Q 3CCRA 2R6GA 1A63A 1Z9FA 1VQLA 2FXQA 4DV1L 1A62A 1HR0Q 1Q81C 2GVAA 4B3SQ 1G291 2K14A 1YHBA 2YTVA 1E3PA 4IPGA 1M1KC 2ASBA 1TXYA 2HIVA 5H1SE 4JI2Q 2R92H 3ERSX 4P73A 1QZHA 4B3ML 3F2CA 1HR0W 2A8VA 1CKNB 4DNIA 4YCUA 4QGUA 1JJ2A 4GKJL 3G48A 4GLAC 3GTOH 4DR7Q 2YV5A 4EX5A 4JI1L 4OWXB 4GOPC 4IO9A 3I4NG 4YWMA 1PV4A 4HJ7A 4DAYB 1WYDA 1FL0A 1MJEA 3CC4A 5JEAJ 1XNRL 1XTDA 3RLFA 2VY3A 2A19A 1I94L 2B63H 3A5ZB 1BVSA 4L5SA 4A3BG 4JI7Q 2HQLA 1YITA 2H5XA 1PH8A 1KQSA 1VQ6A 2JA7H 4BA2I 3FP9A 2I5HA 3KDFA 4JC0A 3FHWA 5E7NA 4LUOA 3HOXH 4HIMA 1C7YA 3PUVA 1WCMH 1IBLQ 4QY7A 4B3TL 3H3VI 4A3GG 1HNZL 3BZKA 1VQ4A 3PO3G 3M7NA 3I4MG 4JI3Q 1KRSA 4DR4L 4DV1Q 3T1YL 1N36L 3HOZG 1X54A 3RNUA 1N33Q 5IP9G 4BY1G 2VW9A 4A3KH 1VQ8A 2C35B 4A3IG 2Q2TA 2JA6G 1G6PA 3S2HH 1LTLA 4B3MQ 1HNWL 4LFBL 4AH6A 1JB7A 1Q82C 4JCVE 2JA8H 4OONA 1LUZA 3S1QH 1D8LA 5ELOA 1VQBA 4IPCA 3RN2A 3OW2A 3HOWH 2IHEA 2UXBQ 1MJCA 1VQMA 3W5OA 3TS0A 1L1OB 3J81i 1V1QA 1IBML 1YZ6A 2HHHQ 2R92G 3EIVA 1W2BA 2QA4A 1VQIA 2VNUD 4FDBA 2AKWB 3STBC 4JBKA 1SRUA 3KFUA 3HOVG 1XPUA 2ZTCA 1IBKL 4HJ9A 4AQYL 1OXVA 2LSSA 3J80c 3S1RH 2NZOA 4X64Q 4DUYQ 1BBUA 2ZM6Q 4A3FH 5C4XG 1B8AA 1L2FA 1VQ5A 2D62A 4X66L 3LGJA 1J5EL 2Z0SA 2UUCL 4XTCS 5M3FH 4YCWA 2JA7G 4L5TA 3L2PA 4YCVA 4BY7H 4LNQA 1XMQL 4PMWA 1WOCA 3CCVA 1C0AA 1EOVA 1GM5A 4JBMA 2MO0A 1EIYB 2KHIA 2RF4A 5EAYA 5C3EH 2BH2A 1TWAH 3F2BA 2R7DA 1WCMG 5HY6A 4DR6Q 3UE1A 3NENA 1UE5A 4DUZL 3CCEA 2K75A 4R1JA 1N34L 1NMFA 3TQYA 2AWNA 5IE8A 1D7QA 4C3HH 5FJ8G 2UXCQ 1KL9A 2XGTA 3ULJA 1CSPA 1RL2A 1X55A 2JE6I 2PMZE 3E9HA 2CKZB 2JA8G 5BR8L 3RZOH 4X62Q 3IRBA 4BBSG 3CQZH 2I5LX 4A3JG 4A3BH 3A74A 1YNXA 4QJFA 4DV6L 5C44H 3UDGA 1HR0L 4B3SL 4JI4Q 4OWWB 2Y0SE 2NVYH 2KENA 4L5RC 3CXCA 1X56A 4JI2L 1A0IA 5IT9c 5GAEC 3E9IA 3U4VA 4DR7L 1Y14B 3GTJH 4A3LH 1PH9A 2E2IH 3I7FA 3CP0A 4DR1Q 2Q2UA 4RG1A 1PH2A 1PH4A 3AQQA 4A3FG 3D0FA 2NN6G 5M3MH 4X65Q 3PUYA 4RMFA 5M5YH 3M4PA 3CCQA 1OTCA 4JI7L 2JQOA 4C2MH 3HOUG 4A3DH 1Q86C 4IOAA 3K80C 1K8GA 4BY7G 2VS1A 4POFA 4YY3Q 3J7ZC 2JJQA 1A8VA 4A3CH 1EWIA 3KJPA 4C3IH 1IBLL 1BBWA 2Y0SG 1SMXA 3PSIA 3OYYA 4JI3L 4OO1G 4DV6Q 1TWHH 1Q7YC 1HJPA 2L15A 3BZCA 4IPDA 1YJNA 1N33L 4IJLA 4HIKA 1QUQB 1ASZA 1U0LA 4P74A 2LXJA 3U50C 3A5UA 1H95A 3M4OH 4DAMA 2YU9H 3OTOQ 1PVOA 1E1OA 2ID0A 2K50A 4GOPA 2N3SA 3G71A 5C44G 2UXBL 1EFWA 3B6YA 5FLXc 4LF9Q 2IT1A 3PUXA 4OWTB 4GKKQ 3M4QA 1L1OC 3FKIH 4DR5Q 1L1OA 2OQ0A 1XMOQ 1PH7A 2OCEA 2HHHL 3PO2G 4GLVB 2ZTEA 3CC7A 1XPRA 1VQAA 4BXXH 4IFDG 4NXNL 1KIXA 5DLQE 4MTNA 4LF6Q 4DV0Q 4KHPQ 3CMEA 1P8LA 5IYCH 4L5QA 2ZJPA 4A3LG 1B70B 1NMGA 4YWKA 1Y1VH 4Y52H 1JMCA 3CAMA 4X64L 4JOIC 4BBRH 1GKHA 4JOIA 1SLJA 2ZM6L 3NBHB 4DUYL 1HZBA 1YHAA 5M3MG 2D0OA 1V9PA 4Y7NH 4POGA 3W1BA 4KHZA 4NPSA 2BA0A 1O7IA 2NZHA 2BA1A 3H3VH 4A3MH 5IYBH 1PFSA 3ULPA 2YYZA 3H0GH 2OQKA 4JBWA 4LFCL 3W1GA 4OX9L 1JT8A 5IYDG 4DR6L 4JYAQ 3KF6B 2IY5B 1K73C 1K0RA 4QQBX 4O2DA 1CKOA 3I55A 4HJ5A 3UDIA 2VUMH 4DKAC 5JJKA 2KHJA 2UXCL 1N32L 1SE8A 1U5KA 1FJGQ 1LYLA 4O0AA 1R9TH 2A1AA 4NXNQ 5ELNA 1VQGA 1TWGH 3SGIA 2K4KA 4DV5L 4IFDJ 1S40A 4X62L 3ICEA 1YJWA 3G6EA 4PZ6A 4JI4L 4A75A 1EYGA 4JG2A 2PI2A 2CQOA 1YBYA 3FKIG 1I50H 4DPGA 4DV4Q 4DR3Q 1VQKA 2B63G 3ER0A 3RLOA 5C0XG 1YEZA 3PIOA 3CCMA 3CC2A 3UDFA 1VQCA 2JA5H 1WJJA 2IX0A 2ZTDA 3D31A 5IYCG 1PH5A 4DV3Q 1OXXK 1QZGA 2Z6KC 1PA6A 3K81C 1IL2A 3HOXG 1OXTA 1Y1VG 4PZ8A 4DR1L 3PF5A 5FLMH 2YTXA 4LFCQ 4LF8Q 4OX9Q 3GD7A 4BBRG 5GROA 4HJAA 4X65L 2NVTH 2WP8J 3WWVA 1XPOA 1UE1A 2NN6I 3GTGH 4YY3L 4A3MG 5IYBG 3RZDH 1G51A 4LF4Q 1W3SA 4A3KG 3HOYG 3S15H 1N32Q 3T1HQ 3U4ZA 2F3IA 1NBWA 1UWVA 4DV5Q 1VQEA 2EQSA 1KAWA 1M90C 4JI0Q 2F4VQ 4LUVA 1X65A 5C4JH 5AJ3Q 4DV7Q 3HOWG 5GQOA 4A4IA 4OO1I 4PG3A 1HH2P 1JJCB 1HZAA 3HKSA 1KD1C 3CCLA 3NEMA 1KC8C 1JJGA 1Q46A 4R4CA 1K3RA 5M5XH 2R7ZH 3NELA 1K9MC 1QUQA 1K8AC 3F2DA 1PH1A 5C0XJ 3EN2A 4TQUS 3CPFA 1GVPA 1CKNA 2JK8A 4APVA 3OTOL 2ZJRA 1E1TA 1SN8A 4B3RQ 1I5FA 4GNXB 4LF9L 4LUZA 3J81j 3UDXA 4GKKL 1XMOL 4DR5L 5LMNQ 3L0OA 3ZJYC 2B3GA 3RLNA 4JI5Q 4UP7A 1CKMA 3I4NH 4XIGS 4LF6L 4DV0L 1AE2A 1BKBA 5M3FG 3S17H 4IFDI 4KHPL 5LMNW 4MZ9A 4KI0A 3JC66 3PIPA 3BJUA 2RHQB 1IXRA 2MQHA 1EIFA 5C3EG 3BU2A
chains in the Genus database with same CATH superfamily
4JUZA 1WTVA 1AUXA 3I2ZA 1IBMH 2UUBQ 2FMCA 2MGSA 1CI3M 1N8RC 2GLTA 1L0WA 2R86A 3K8AA 4M7EA 2W9BA 2DPIA 3IKJA 2EYMA 5KX5F 5KFKA 5KT5A 1HA5A 1IBKH 1HNXQ 2MCTA 4IUTA 3GTOB 1ONLA 3PO3H 4WJ4A 5DQGA 1I4QA 1HQRD 5A2QW 4JYAL 3VR5A 1O7ZA 2XRQD 4X66H 2MNAA 4DR2L 1GD7A 3KF6A 1J5EH 1UAPA 3FKIB 2DWCA 1Z2NX 1T3NA 4C3JH 4DV2L 1Y1WH 4TUYF 3T56B 4BA1I 1RODA 2N78A 1TS5A 2R7ZG 3VPDA 2OTLA 4XQJA 3Q8PB 1XWEA 5IY0A 2IMWP 5L37A 1NUCA 3K57A 4UP8A 2EJMA 3PQIA 3VR3A 2VQEQ 2B2YA 2K5VA 1GUOA 2HVSA 2K7VA 1E7ZA 1S0OA 3ORRA 4KV6A 5DG9A 2OWOA 3GTLA 2R7NA 4A3MB 2WAQG 2V1CC 2MO1A 5C0XI 1NNXA 5TSSA 2PMZA 3JRWA 4I7HA 5BR8H 3GTQA 1FJGL 3H91A 3L4JA 2ASDA 3TINA 5JJIA 1EY6A 4A3CG 1BXRA 4MAMA 5C4XH 3G6JB 3OUUA 3S1QB 3Q24A 1ILQA 3HEJA 4JI6L 2N8NA 5KFJA 1NY4A 5KFRA 4LW1A 4DR2Q 4UCVA 4GC6A 4TRDA 3WO1A 2QEXA 4YB8B 4DV2Q 5JQWA 3PN1A 4RB0A 2D9UA 1JE4A 4QIWB 1NTGA 5KG4A 2J6UA 2N55A 5J3BA 2BDOA 4JV1A 4O3SA 2YTYA 2J6SA 2JEJA 3CQZA 3LX0A 5GADC 3G4SA 4HCEA 1AUVA 4RAUC 3K7AH 3VR4A 1I50B 2PW5A 4JW0A 5M3FB 1GYFA 3UQ8A 2EYPA 1VF5C 4QIWE 4FF3A 3BDCA 1S5CD 3PIO3 2NVTB 2B8FA 4GNXC 1WVLA 1ICWA 4JI6Q 2N88A 3TP6A 4LFAL 4WBNF 1TWCA 3KHHA 2K01A 2ES2A 2KCMA 3O13A 2Q2IA 4I50F 2BE5D 4RU9A 4TKOB 4DK6C 3CPWA 1WTXA 1HTLD 3E3XA 4HJ8A 1W6JA 1IL2A 4K2KA 2V58A 3H0GG 2B29A 3GTLH 4MV6A 1E4GT 4P72A 1LT3D 2XGQA 3BVZA 3T13A 3GTQH 1EQRA 2DZDA 4MTDA 2A6HC 2RDGA 2W7OA 1HNWQ 2ZDGA 4LFBQ 3PUZA 2R7ZB 5CA1F 1S0MA 1Q3LA 1TU2B 1OXSC 3PF4A 1M7JA 4DR3H 1GSOA 1N48A 3GTOA 1PYBA 1UE7A 1XJVA 1E24A 5KIXA 4FNFA 5KG3A 2J4XA 3S2DH 5IWAL 1G8ZD 4Q45A 1QVCA 4J9SA 2B63A 1DZ1A 3RB6A 2WAQB 3I3CA 4LFAQ 2D0PA 4A2AA 3CCSA 4DR6H 2KCTA 5EKIA 4AQYQ 1BR9A 5I9OA 5KFWA 2M05A 2ZXOA 3PO2H 3F8NA 3JZIA 5F9NA 2VPSA 1UE6A 3NTIA 1LTRD 3TDQA 4NXML 4JV5L 5EQ0A 5EOYA 1I4GA 5KFZA 1N32H 3S1MB 2UXDL 5M5WH 3V6HA 1ESFA 4MTKA 2M9VA 3J7YW 4RGNA 3LP8A 3H15A 1JR0D 4A2BA 1UEBA 1BCPB 4A3GH 3GIQA 2CWPA 1B7YB 3BG3A 2YU9B 3KHLA 1E2WA 2EYJA 1TWCH 3I4MH 3CF5A 4ZLTF 1DOLA 1C9OA 4XXEA 2KBNA 1VBHA 3J81c 4LF7L 3GIJA 3PW4A 3M85A 1WI5A 2R61A 4CBVA 3CCUA 4YR3A 3CCRA 4HSPA 4MV9A 4R8NA 1Q81C 1HR0Q 4B3SQ 2HJWA 2Z8LA 3W2DA 1M1KC 1TXYA 1I7LA 2IP4A 3LMLA 3DWPA 4KN7C 3D4WA 4P73A 4LMQD 1QZHA 3F2CA 4QCLA 4YY3H 4EFEA 1I50A 1KNEA 1JJ2A 1M8AA 4ZQ3A 1S5ED 3G48A 3GTOH 1C30A 3MFHA 4EX5A 4JI1L 4OWXB 2SNSA 1IOWA 2UVVA 3JAME 3I4NG 4DAYB 3TMEA 2R8GA 3H0GB 1XNRL 1XTCD 2A6HD 2B63H 3A5ZB 4Q43A 1PH8A 3QG1A 5BPFA 3QZ7A 4FYDA 5EGTA 3FP9A 2XIGA 4HNVA 3SEBA 1JQYD 1ZQ7A 1O7YA 4OIJA 5T1GA 1NR2A 3GTKB 3OTOH 3RFCA 1U9RA 1LTID 4QY7A 3H3VI 2XWJB 3BA9A 3M7NA 3D4RA 1KRSA 4DR4L 1XMOH 4YBZB 2KEDA 1SYFA 2K32A 1CTMA 3RNUA 1N33Q 4BY1G 2Q2TA 1JWSD 4IR1A 2PNRC 1GSHA 3J81W 5KFQA 1Q82C 1CQJB 1DOKA 2JA8H 1WR2A 2R7ZA 1LUZA 3S1QH 1D8LA 5ELOA 1VQBA 2FK1A 3DWAA 1VQMA 4UFZA 2IX3A 2R92G 1IKMA 1J8IA 5DM73 1W2BA 1D6EC 3TBIB 4JBKA 2VR1A 4KD4A 4GC7A 5FO7B 3HOVG 3K3PA 3FVQA 2WAQA 2R3ZA 4L8JA 4ME6A 4A3FH 1BBUA 2ZM6Q 3RV3A 1B8AA 1Z6HA 2KEEA 2D62A 4EGQA 1BUVT 2F0DA 4WJWA 2EOTA 3LGJA 4DL7A 4DL2A 2UUCL 5M3FH 3N8DA 1PMRA 4BY7H 3JAML 4LNQA 1H9RA 4PMWA 2R7MA 4J9KA 3CCVA 1EOVA 1K8OA 1PTOB 2Q8TA 2BH2A 3F2BA 1WCMG 5HY6A 1S68A 3NUCA 4RB1A 3G7LA 5BPHA 5DG7A 2K75A 1WTQA 2YU9A 5DLGA 1JIHA 3H4DA 1S5DD 4QWAA 2O4XA 3FDTA 1LABA 1KL9A 4KY6A 3ULJA 1PRTF 1RL2A 1S5FD 4H0LC 5CV4A 4ME5A 3V05A 3BZDB 3I4NB 5KFOA 2NZ1D 4X62Q 4LF8H 4UCTA 4J9LA 1YNXA 4JI4Q 2YZMA 4RGOS 2NTTA 4QUCA 1K1QA 1XNQH 5EPKA 2RSOA 1SMYD 1TVXA 3TZUA 3OW7A 1A0IA 3GP7A 2NVXB 4LF4H 4ECRA 1YNJD 1KJJA 1RJPA 4HCSA 5LOVF 3RIZA 4Q0YA 3CP0A 4DR1Q 1L0YB 1PH2A 4DAYA 3PZPA 2KCNA 4CHTB 4X65Q 3H0GA 2C28A 3PUYA 1D5ZC 4GZYC 3M4PA 4PMBA 4JI7L 3ETJA 2JQOA 1STEA 5T1IA 4BY1B 3M9NB 3K80C 3NK9A 3J7ZC 3FRPB 2JJQA 3RGZA 4A3CH 1CZGA 1SEBD 4ZCKA 1O75A 2RDJA 3KJPA 2AUKA 3GTKA 4B3RH 1SMXA 2A73B 4U7CA 4JI3L 1Y8NB 5LMNH 4PV1C 2R92B 1PFNA 1CQVA 1WSCA 1STYA 5J2TF 2OH2A 1CFMA 4P74A 1SYCA 3QZ8A 3CVZA 2QW7A 3J80E 3HOVB 2YU9H 5DGBA 3I70A 4Q8FA 1CA6A 4YAKB 3G71A 2NU9B 3Q22A 3RB4A 1FKAH 5C44G 1IYUA 5FLXc 2IT1A 2VQFH 4GKKQ 1Y8PB 2HHHL 4QUFA 2OCEA 4RZRA 2ZTEA 1F9RA 1VQAA 5A35A 4LF6Q 2JYOA 2BR0A 5DQHA 4L5QA 4A3LG 3NXWA 5KG5A 1WCMB 4HMIA 2XCAA 1TY2A 4DXFA 3FMCA 1BF4A 4BBRH 2B2WC 4JOIA 1SLJA 4DUYL 4FO2A 1UNSA 5M3MG 2KSWA 2DJFC 2D0OA 2KVMA 5LMUH 2KQ3A 4KHZA 1E0BA 4NPSA 1O7IA 3ETHA 2BA1A 3H3VH 5IYBH 2ZXRA 3H0GH 4JBWA 3W1GA 1DIKA 1DV1A 4JV0A 4YP3A 4IUPA 3KHRA 5EZYF 1O78A 4O2DA 1EYDA 5IT9E 3KBXA 2QYZA 3GV3A 3OMGA 3L9AX 4DK1A 1TS4A 5JJKA 1ZYRD 3NWSA 2XVSA 1ET9A 4O0AA 5FKAC 3E0JA 3LWUA 1SFOB 1SDFA 2A5HA 1RDPD 1YJWA 3OWFA 5FLXW 3MFIA 2I46A 4DU9A 4KHVA 2PI2A 3KLSA 2CQOA 1YBYA 5LA6F 2Z9HA 3J80L 4EEYA 1DJRD 4Q44A 3KUPA 5CV5A 3UDFA 1VQCA 2NVXA 2VQDA 1SSOA 2RDFA 2IX0A 2JXMB 1H9MA 2Z6KC 3K81C 4HMJA 1OXTA 1SE4A 2LY7A 2PCFB 4ZRZA 4QWEA 4HJAA 3Q6SA 1JLLB 3A56A 4XX0B 4GKJH 3G6YA 4C1NK 2XNAC 1G91A 1RK6A 4X3SA 3S15H 1W3SA 3EPIA 1TQOA 2LMCB 3T1HQ 2UXBH 4EQOA 2WE6A 3GTPA 2HCIA 2UVRA 5DEHA 5KFBA 4BS9A 2PBZA 5J22A 1I94H 3D6CA 3RF2A 5C44B 4JI0Q 3WNZA 5JUMA 5F2DA 3MWEA 5C4JH 5AJ3Q 4DV7Q 3HOWG 2PVPA 5GQOA 1ZEQX 1KAAA 4WD3A 3NEMA 1JJGA 2ZDHA 4KTAA 2R92A 1D5XC 3KALA 4ECYA 3V96A 1F9SA 5C0XJ 4APVA 1HNZH 2E2IB 2I8CA 5IT9L 3T4AC 3D6WA 1SN8A 3A55A 3V4ZA 4J8QA 1TR5A 3T1YH 1I5FA 4LF9L 1AFPA 5M3MB 1HRJA 1JORA 1V1PB 1V51A 2B3GA 4V190 2QILA 1MZBA 4JI5Q 1UNNC 3HXLA 1HPCA 4FF2A 4XIGS 3I4NH 4F8MA 1CS0A 1BKBA 5E3FA 2L12A 3S17H 4KHPL 2SCUB 2YCHA 4N8X1 5LMNW 3PIPA 2NUAB 2RHQB 5DM63 1IXRA 5FO8B 4LH6A 2HDLA 3QOJA 3E5SA 4I7AA 1ENAA 2NVXH 1WFQA 3STBD 5CV7A 4YHHL 1GHJA 1IW7D 5JEAG 2AGQA 2CCZA 2E5LQ 2HT1A 4FBTA 1CM9A 4RNOA 2JEAI 1STGA 4MNOA 2P0AA 4CDDC 1Q1BA 4J9NA 4J6HA 1VQNA 4O3QA 1SNPA 4BY1H 1AEXA 1K3BC 4R4IA 4IR9A 2F3WA 2IHFA 3TP8A 3GTPH 1UC9A 2PZTA 4JK1C 3K58A 2W6MA 4K0KQ 4CDCC 1LTAD 1XMQH 4HYKA 2NYZD 2LXKA 3AFQA 2BQUA 1KDAA 1BDOA 1PHJA 3MXGA 4JI8H 4GN5A 4M8AA 4A93H 5HGQA 1SFOA 4DUZH 2HCCA 3PVXA 1N9WA 2B2YC 4A3EH 1HQMC 1N34H 2ASJA 2EIFA 5D65A 1VCIA 2N49A 4E6IA 4Y7NB 1FNUA 4DV4L 2K5QA 2EZVA 2JEIA 3K7UC 5IGEA 2L55A 3TS2A 1YIJA 3HRZC 2FE3A 1Q1EA 5C5MA 3HOVH 4R8UB 3RB3A 1VS0A 3R93A 4YHHQ 2R8JA 5D14A 3U9SA 5DG8A 2AQ2B 1UC8A 2EY2A 3MXNB 4DV3L 1IYVA 4PZ7A 3T5JA 4ED1A 2R93A 4C3IG 2XRSD 1AN7A 4LF5L 2O5JC 2A68C 3CD6A 3AFPA 4AYBG 2EYOA 3HOWB 1KJ9A 4JI2H 2WB1E 3JRXA 3M9BA 4IUNA 4HNTA 2E2HA 1TT2A 4DR7H 3M3YH 2E8GA 2H4OA 4J9OA 1KLUD 1EUJA 1KRTA 1I6HH 1CK1A 3MR3A 4NLGA 2SDFA 3CRKC 5KNCA 1VQ9A 3RV4A 2F4VL 4S3SA 1RIPA 5IGBA 1EY5A 1IYJB 1ZKOA 2CHBD 3RGXA 4UY8C 1EQVA 4I55F 1Q12A 2QEJC 2XTIA 3DEPA 3U9OA 1YJ9A 2FMAA 3AU7A 5M9OA 4QF4A 3WOFA 4G3IA 1GO3E 1H9SA 2DNCA 3VYSA 3FPUB 2WIIB 2K5NA 5IGFA 3U58A 3LWBA 3ND9A 1IBLH 2IX1A 3BABA 1EYAA 1TAEA 4KKUA 1OXUA 2Z6KA 4O4LF 4CKBA 3CMAA 4LF5Q 3GTGB 3NWTA 1C4QA 1EQQA 1SFOH 2YZGA 1R4PB 2TSSA 3RZDB 4ZK9B 4F4WA 4ZHQF 1I3QH 3J7AV 1DM0B 4R4QA 5NUCA 1VQPA 4B3TQ 2O5IC 1AE3A 2G5DA 1VQFA 3E0EA 1NJIC 2FINB 5CBEE 1K8MA 3CCJA 2UU9L 5KG6A 3G6XA 1YI2A 3BQ2A 4FS2A 1UUPA 2KECA 4KY7A 1GUNA 1SNDA 1N36Q 2UUBL 5EDWA 2L11A 1SYEA 3P1HA 4P75A 1QNKA 5GAGC 2ZJQA 3F8TA 2V4DA 1PH3A 2R93H 1VQHA 2BH8A 2FJZA 3SE0A 3DWQA 3DLLA 2E2HH 1HNXL 3J7A5 2V4QA 4X64H 3N43B 2HUGA 5DGAA 3U9TA 1IBMQ 1B3AA 1EZ8A 1CUKA 3HFZB 3HBLA 3Q2OA 4RAYA 3MWDA 2C2RA 3RD4A 4LFCH 1T9HA 1P16A 3HB9A 1IBKQ 2QGQA 2VQEL 2J9GA 4GN3B 4C3IB 2K5HA 2QK4A 3PGZA 4AYBB 4HIOA 5EWEA 2X0SA 4X66Q 3GTMH 1J5EQ 3AYHB 4UP9A 2UXCH 3QR8A 2I5MX 5GAHC 1ICFB 4CJ0B 5IP7G 3S14H 2F0HA 1SXTA 1K83H 5CC4A 1QILA 1QJOA 4U673 1EYZA 5BN5A 2L9HA 2V59A 1SYDA 2I07B 3MXNA 1B3QA 1ASYA 3S9WA 2IBKA 5JVDF 1MIUA 2SOBA 3C46A 3HOZH 5E1FA 1S72A 1AZPA 1LO5D 4TVAB 3PUWA 2GPWA 4EYHB 4EBCA 1CHPD 4AYBE 4F4YA 5IYZF 3L7ZC 5BR8Q 2R6GA 1A63A 1VQLA 2FXQA 4DV1L 1A62A 3VMMA 2YTVA 4IPGA 3V6KA 4EFBA 3ERQA 5H1SE 3R2IA 1K0SA 4O4IF 5KFFA 1EY4A 4KKTA 2A8VA 1CKNB 1R4QB 3KHGA 1C8CA 4YCUA 3MR2A 2YV5A 4ZYSA 4CJ2C 5JAVA 2IWHA 4YWMA 1PV4A 4HJ7A 5KT6A 1I6UA 2PO4A 1MJEA 1XTDA 2VY3A 3ONAB 4DV6H 1HA6A 4LAAA 4L5SA 3N6XA 1E4FT 2HQLA 2H5XA 2H1EA 1KQSA 1X32A 2JA7H 3GTGA 4ED0A 4KY5A 4LUOA 3I12A 2G9DA 2RKSA 1TS3A 3PUVA 2BQ3A 1B53A 1R9TB 4HNUA 3F2UA 1ESRA 2K6AA 2F4IA 3R8BA 4DV1Q 1A6XA 4DR5H 1X54A 1BNCA 5IP9G 4H7BA 1VQ8A 4A3IG 1SE3A 2JA6G 4DV0H 1LTLA 1HNWL 2O2LD 4LFBL 4JCVE 1E4EB 5C5JA 1A2UA 4ECZA 3H4BA 4EBEA 1RK5A 3T5KA 3OW2A 3HOWH 2IHEA 1C3OA 4N9PA 3GIMA 3TS0A 1L1OB 4R9WA 1B04A 3J81i 4CJ1B 3EIVA 2BQRA 4QMGA 2EJGC 2QA4A 3NGDA 2HVRA 5BN3A 4FDBA 1FD7D 2AKWB 1HXYD 3SK8A 1SRUA 2HD3A 3MHBA 4HJ9A 4JYAH 4AQYL 3IFDA 5JVH3 3FEWX 4XYQA 4H13C 4DR2H 5HGTA 3J7AK 1L2FA 1U4MA 1VQ5A 4DV2H 4F4XA 2XGPA 1HFNA 3UI2A 2Z0SA 2L5TA 4L5TA 5ELDA 4YCVA 5J2UF 5KT4A 4RHRA 5EPLA 1JCKB 2OEOA 3R3OA 4JBMA 2XN9C 3T5HA 4EGVA 1JDBB 2R7DA 3A54A 4ULLA 4DR6Q 4OELB 1RJQA 3K5NA 3OHXC 5G3LD 1BCPC 5ELEA 1GSAA 1S03G 1B9MA 3MXUA 1D7QA 5C1OA 4RGMA 1T5EA 2XGTA 2F0JA 1CSPA 1PFBA 4KJNA 2B2UA 3K0YA 3BVGA 1PFMA 1GLVA 3FKIA 1FJGH 5FLXE 2D2CC 3RZOH 4J9QA 3CQZH 4A3JG 4X3KA 3E6ZX 4ID6A 1HR0L 5KG2A 4JI6H 4B3SL 4Q8EA 2Y0SE 3HS0C 3CXCA 1X56A 5I2XA 3DHQA 4EQNA 1SAPA 4L63B 3QFFA 5KFVA 2IA6A 5FD6A 1Y14B 2ICIA 3VYTA 4ED7A 1PH9A 2DY7A 3H3VC 1GGOA 2AQ3B 2Q2UA 3D0FA 2PN1A 2R7LA 3S1NB 1JXLA 2RGRA 5M5YH 2XD4A 4YJ3F 1F2MA 1B1ZA 1Z2PX 1Q86C 2W6QA 4A3IB 1K8GA 2JA6B 1O7LA 2VS1A 4ZAIA 4POFA 2IL8A 4YY3Q 4QW9A 1A8VA 4C3IH 1Y69U 1BBWA 1AN8A 1RHPA 4J9RA 4QIWA 3G6VA 3IL8A 2R7KA 1R9TA 1DOMA 1QG7A 2NUCA 3HG9A 2L15A 5IIFA 1KLGD 4IPDA 4LFAH 1YJNA 1N33L 4IJLA 1BJTA 4RCNA 1QUQB 5LL6S 2MUYA 4HIKA 1ASZA 4C5BA 4LK1C 2LXJA 4CKEA 3A5UA 1H95A 1CZWA 2VB3X 3OTOQ 1PVOA 1E1OA 4RH6A 4ED3A 5IODA 2HQEA 3B6YA 4TSSA 1EFWA 1BXTA 3M4QA 3FKIH 4B9WA 1XMOQ 1L1OA 2OQ0A 1PH7A 3UFXB 1BQQT 2NWGA 1XPRA 3A8KE 5C0XH 3NSWA 2NU6B 1BCPD 1C48A 2Z4IA 2ZJPA 4HR7B 2F03A 2VA3A 1JB3A 2B2VC 1GKHA 4JOIC 5COYA 2ZM6L 3MR5A 5IWAH 1ZETA 4POGA 2ENBA 2F0KA 1LV9A 3W1BA 5I4DA 2M2LA 1G6ZA 3D3RA 4G57A 4A3MH 1M4VA 3VA5A 3QO2A 3NPPA 3ULPA 4OX9L 5IOCA 5IYDG 2I80A 1PTOC 3DM1A 4HN7A 4A3JB 4ZI7F 4DN4M 1PK8A 3D8GA 4JV5H 4NXMH 3I55A 2UXDH 1NCVA 3UDIA 1JOOA 3Q8SB 2KHJA 3KTMA 3EFXD 1U5KA 2EYHA 1LYLA 1QCBD 1R9TH 2A1AA 4MV8A 1K28A 2WKCA 1STNA 4X62L 3ICEA 3CHBD 2YZNA 1MSGA 3RUPA 4JI4L 4HQ6A 1A3UA 4A75A 3PR5B 3AB9A 1KABA 1I50H 2MPMA 3MFYA 2F0LA 1GJXA 4LF7H 4EGJA 3RLOA 1YEZA 2F0NA 2IW3A 3RJ0A 4O2AF 4PWQA 2ZTDA 5IYCG 3EQLC 1TWAB 4B08A 1FNVA 1I4HA 1D5MC 3D4DA 1Y1VG 4OX9Q 4DR1L 1RTNA 2YTXA 3OIQA 4LF8Q 4RNMA 2B2TC 3Q8RB 4EYIB 5GROA 2F0TA 5DLFA 2V9WA 4X65L 2NVTH 1V4YA 4FVMA 1TS2A 3WWVA 1XPOA 2O03A 3R5FA 3RMHA 5HBRB 4HEDA 4JI1H 1MSHA 1H9JA 4LF4Q 1AW7A 4A3KG 4UDUC 2JA6A 2F0EA 4O3PA 1XNRH 1UWVA 4ZUJA 2E2JB 2ZJTA 2E74C 1VQEA 1M90C 2KUMA 2NVYB 3MZ5A 3T5LA 1HZAA 1JJCB 3HKSA 2D5DA 1SE2A 2DPJA 2R7ZH 1IOVA 3NELA 4ZKBB 1QUQA 1K9MC 1K8AC 4TV9F 5C1PA 3BQ0A 2R85A 4TQUS 2JK8A 3BVMA 3VYRA 3PW2A 1E1TA 4DR4H 4B3RQ 4RHSA 1KDCA 3OMCA 4IWYA 4I7ZC 4GKKL 5LMNQ 4C2MB 3R2TA 3RLNA 3K59A 2W6ZA 4UP7A 4RKBA 1CKMA 5A2QE 3CRLC 2W7PA 4LF6L 1FGBD 3S16B 4KI0A 4K6LA 5LL6b 1F2ZA 1GUWA 2MQHA 1JC7A 5L9XA 3TRZA 1KC7A 1FR3A 1X3PA 3N52A 1TWHB 5KFAA 3KAJA 4M1UB 2VQFQ 1DONA 3S1MH 1LTSD 5EBDA 3TQ1A 1SCUB 4OEMB 4C3HG 1LTBD 3OSOA 3PR4A 1YVCA 3M4OB 1F9PA 5EBCA 4N8FA 3KF8B 4ETSA 3GDEA 2CW7A 2W70A 5KKNB 5I47A 3V2TA 5FK9C 3S1NH 4U6PA 2GN5A 4P71A 5IP9H 4MHEA 2K03A 5LMUQ 2JA6H 4TQSA 2UUCH 1HZ9A 4G4KA 4RAZA 4C5AA 3JAMi 5EJWA 4HTHA 4OHJA 1WD1A 4YR0A 3A0JA 2DUDA 5LXTF 1RJRA 2GVBA 4GS3A 5HV6A 1V43A 4EQPA 1Y1VB 4OGQC 5C3XA 1DGSA 5CORA 1WTHA 4A76A 2M00A 3PV0A 1AP0A 2B2VA 2KOLA 1L2ZA 2W6PA 4A3DG 2K5WA 4A3KB 5KFPA 2C22A 1X3FA 2WYOA 3TSSA 3S2HB 2B39A 4HSVA 3CW2C 1JICA 4G7OC 4UPAA 5EWFA 3KYHC 3A8JE 4FXKC 1EIGA 2W57A 2RDHA 3P7JA 4RZQA 4H02A 5K2MA 3MJFA 3K6OA 3GTKH 3T1HL 2AU0A 4GLXA 4AIMA 1I6VC 1YNNC 4JI0L 2JEGA 1SJED 4JI7H 4IUUA 5AJ3L 4DV7L 1HTPA 2QKIC 4C3JG 2NVYA 1Y1WG 5KFCA 4GKJQ 3FDSA 4GOPB 4P2CB 3IG0A 1CSQA 4UCUA 3G8CA 2RCNA 4FF1A 4IPHA 4A3JH 1VQDA 2VZAA 4ED2A 4YQWA 1SNMA 3HKZE 5L1JA 1I94Q 4NP5A 2F0IA 4JI3H 2WB1G 1PX2A 2YS6A 2JSOA 2KHSA 4QB4A 3M4IA 4QWBA 3I73A 4ECUA 3KDFB 3TEHB 2B2TA 4R4OA 5E4WC 1LT5D 2AQ4A 1PRTB 4JI5L 4C2MA 1EQTA 1FVIA 4C3HB 3BDLA 1QVFA 1DXMA 4F7XA 1CE8A 3GIKA 1UEAB 3TP7A 4MV3A 1FNWA 1PZKD 2R7FA 3P20A 4EQ5A 1HNZQ 3JAMc 1U4LA 3RAXA 3T1YQ 3RR5A 1EEFD 2HHHH 1B50A 4F88A 4FF4A 1F2LA 2UUAL 1TWHA 2JEBI 3KOJA 2E5LL 1X3QA 2ALZA 5M5XB 3ITPA 4JI8L 1MKHA 4KJOA 3TQTA 1ILPA 1PTOH 1B33N 2CFMA 5KYLA 3PCOB 4M9UA 1EL0A 1FGUA 2K52A 3GTJB 5ELCA 4DUYH 2F52A 3KF8A 1ENCA 1O80A 4IN3A 3K3VA 4XYMB 4GN4B 4K0KL 1TIID 3I8ZA 4A3DB 4MV4A 2WFWA 2CWAA 2AQ1B 4KKSA 1SNCA 4CDFC 2E2JH 1S0NA 2EXDA 1EY7A 2GPSA 2OTJA 4LWCA 3TREA 4K5XA 2Q2HA 4KLKA 3GIPA 4O2BF 5KG7A 2K04A 2AGOA 4MIUA 5FLMG 3RN5A 4RB3C 1WCMA 4ECTA 1XYIA 3PIP3 1HZCA 2VL6A 1BGWA 1GUGA 2JN4A 2HGSA 1LM0A 1XMQQ 2UUAQ 1A15A 3BS1A 3GO5A 1QE6A 1E22A 4JI8Q 3NTKA 4V0BA 3Q8DA 3MEFA 3JAMW 2CW0C 4DUZQ 1F9QA 1VQ7A 3M9OB 3GV6A 1H9KA 1XX8A 1N34Q 5FPRA 3TP5A 4EVOA 1D1IA 1KJ8A 3J80i 3M9MB 4C3JB 1Y1WB 4CDEC 1A2TA 2PW7A 3S16H 4OXPA 4IJHA 5LYJF 2K05A 5IYDH 3M4YA 1KXLA 3H09A 5CGKA 1Z9FA 5C4HA 1W6KA 2X69A 2WB1B 1G2TA 2R82A 2XCPA 1KNAA 1PYWD 3MR6A 4JI2Q 2R92H 5KRUA 4B3ML 4FP5D 4QGUA 5EWGA 3SI8A 3J7AF 3K5MA 4DR7Q 1M0TA 4J0MA 5C6AA 4F4ZA 2QF7A 3NE5B 1WYDA 4PQXA 2A19A 4RGTA 3DXJC 1BVSA 2F0SA 1EIHA 1U4RA 1YITA 5IGDA 2ATLA 4BA2I 3KDFA 2I5HA 3FHWA 5KFSA 3JSLA 2MP1A 4O1NA 4EBDA 4WRDA 2BOSA 5JVLA 1EZ6A 1WCMH 1IBLQ 4B3TL 2SEBD 4A3GG 1TWGB 4LF9H 3BZKA 2IJ0A 4RKLA 3I4MG 3MXPA 1N36L 1L0XB 1NR4A 4BWGB 5BMVF 1GUTA 2UVUA 3QOLA 2VW9A 4A3KH 1G6PA 3S2HH 2VOBA 4B3MQ 1CQFA 4KHPH 1B4OA 1JB7A 5J39A 2KCCA 3MWYW 4OONA 4K5VA 4J1MA 4IPCA 3RN2A 5CV9A 2UXBQ 4RFBA 1DV2A 5GONF 1WTPA 3GTJA 4ECVA 2R84A 2PZUA 1RF2D 1IBML 2E2IA 4YHHH 4IWXA 1VQIA 2VNUD 5KFXA 1HFGA 5HURA 4RNNA 2B8GA 3KFUA 4J9PA 1V1PA 3EPGA 1XPUA 2F1MA 2ZTCA 1IBKL 1KEEA 3JSNA 2LSSA 3J80c 1KDBA 2NZOA 4X64Q 4X66L 4LJZC 1VF7A 1J5EL 3GTQB 5EKLA 3J81E 1EHIA 4XTCS 5G3LF 4YCWA 1LTTD 5LP6F 3L2PA 4C56C 2OF1A 4NXNH 1WOCA 1C0AA 3RBEA 2MO0A 2CZGA 2KHIA 3SDZA 2RF4A 3W3AA 2CVRA 5EAYA 1STBA 5KNDA 4ILWA 3NENA 3Q23A 3CCEA 4IUVA 3KXYT 3PW5A 1MBYA 2L4NA 4R1JA 1NMFA 4DV4H 4ECWA 1DCZA 2EVBA 3TQYA 3S2DB 3OSNA 5IE8A 1Y8OB 4C3HH 3K5LA 5FJ8G 1IL8A 2UXCQ 4FXGC 3KLRA 1QNUA 2A69C 2B2UC 2C2DA 1Y1WA 2PMZE 3E9HA 2JA8G 4DV3H 5F9LA 5BR8L 5JPNC 1B6RA 4BBSG 3BA8A 2I5LX 2A68D 3P75A 2IPKD 3A74A 4QJFA 4DV6L 5C44H 4LF5H 3MEHA 3PO2B 2FP4B 4OWWB 2FFKB 2KENA 4L5RC 2WB1A 5IT9c 5GAEC 1VBGA 3E9IA 3C1EA 4BWSC 3GTJH 4A3LH 3J80W 3SVMA 4DV5H 1ET6A 2E2IH 3I7FA 2F4VH 4A3GB 4R8UA 4N9TA 1CA5A 1WTRA 1TWCB 3AQQA 3WOEA 4A3FG 3I4MB 4MA0A 2NN6G 5M3MH 5BN4A 5L1KA 1OTCA 5KT3A 3CCQA 4A3DH 4PDBA 3HOUG 4B9XA 4IOAA 3VPCA 4Q5VA 1JWUD 1TA8A 4BY7G 2C9OA 2WKDA 1EUCB 4IURA 4RB2C 3VA7A 2J7ZA 2Y0SG 5IGCA 3AMUA 4NMZA 5KG1A 2DY8A 3X3NA 3J81L 3T16A 4OO1G 4ECSA 1TWGA 4DV6Q 1OO9B 2YW2A 2LFNA 1BOSA 3TN2A 3U50C 5FPOA 4DAMA 2QCPX 2BE5C 2K50A 4K5WA 1F77A 4I65A 2UU9H 1MGSA 1BCPF 2B63B 2UUBH 3BYYB 1WTWA 3PMFA 1L1OC 4DR5Q 5IT9W 1HHVA 2VUGA 4IFDG 5CV6A 5DLQE 4MTNA 4DV0Q 1HNXH 3SK5A 1D2BA 1B70B 3C0FB 5KFIA 5KFGA 4Y52H 2HVQA 1JMCA 1EWHA 2A69D 4DR3L 1RJTA 1YHQA 2CW8A 3NBHB 4C5CA 4J9MA 4LMYA 4Y7NH 1MD2D 2BA0A 2K5DA 1PFSA 1ZHQA 2YYZA 2JA8B 2EYFA 2F0QA 1GUSA 4UCRA 3T51B 4BBSB 2VQEH 4DR6L 4JYAQ 2YRWA 3MWMA 3RB0A 2IY5B 2ZXPA 1K0RA 4Q0FA 2WINB 1CKOA 1EWCA 4XYOA 4HJ5A 2NVQB 5KFMA 2FB9A 1N32L 4O42A 1SE8A 3C2PA 4L1KA 2RCFA 1VQGA 1TWGH 4KMUC 5KFUA 2F3VA 5KGUA 1HUNA 4ED6A 3WDNA 3G6EA 2NU7B 4A3FB 1EYGA 1EY0A 5ELFA 4DR3Q 1HCZA 1VQKA 3HOUB 2RGVA 3SK6A 3ER0A 3CCMA 3CC2A 4BY7B 3PIOA 5KT7A 1A3VA 4AYBA 1WJJA 1FJGQ 1PH5A 3D31A 2ICEC 1QZGA 4DV1H 1PA6A 4E4TA 3HOXG 4FU0A 4PZ8A 2Y0SB 3L4KA 3PF5A 5FLMH 2XCLA 3GD7A 3MTSA 4BBRG 4Z9CB 2EY5A 4QWDA 1UE1A 2DN8A 2NN6I 3GTGH 1I7NA 4YR2A 2VA2A 2TMPA 5JEAH 3GIIA 2ZT9C 4YY3L 5IYBG 3RZDH 3HOYG 3RBDA 1S10A 1EOTA 1N32Q 3Q8QB 2SNMA 4NDXA 1T36A 1NBWA 4DNRB 1BO0A 2R8HA 2EQSA 1KAWA 3GLKA 4FM9A 4FS1A 2XWBB 1X65A 1S5BD 4A4IA 4OO1I 4PG3A 1HH2P 2PYKA 3CCLA 1KD1C 2J0TD 5C5LA 2DNEA 2DJGC 1K3RA 3I91A 1PH1A 1TWFB 1PTOF 1GVPA 1CKNA 3OTOL 2FPPB 2RQXA 2W6OA 3IN5A 3NP8A 2FK3A 3C1FA 4GNXB 2ASLA 3T53B 3J81j 3UDXA 1EZ1A 4QW8A 1XMOL 4YJ2F 3ZJYC 3DEOA 1HNWH 4LFBH 4ZUIA 1D1KA 2AGPA 4IFDI 1OWTA 1E2VA 3BJUA 4X3TA 2Z6BA 1EIFA 3V4SA 5C3EG 3BU2A 5KG0A 3F1ZA 3GV5B 2FPIB 3NBHA 2F0GA 3AEVA 2RDIA 1SYGA 3BDOA 1SJHD 4QWCA 5LHY1 4AQYH 3N42B 2WAQE 2GA4B 1RD9D 1PLFA 2NBFA 2VXWA 4TQRA 3EBEA 1Q8IA 1E4EA 1A3TA 2FK2A 2ATWA 4A3BG 1LACA 3WO0A 2W8LA 1MI2A 4WJ3M 5IWAQ 4APMA 3V6JA 4IALA 3MAQA 3H40A 3GQBA 5CBAE 2WDTA 5FLXL 3E5NA 3MVVA 3X3MA 1DD2A 5D3DA 3HOXB 2PZWA 4CC5A 5JPMC 4BBRB 1BBXC 3BAAA 1VMCA 4JV5Q 4NXMQ 5JH7F 1RYRA 4DA2A 2UXDQ 4YWLA 3TIIA 2YRXA 1SROA 2WV6D 5DNFA 1EFID 1J6QA 4NKLA 3HOYB 4HIDA 4MV7A 4JBJA 5I2YA 1RTOA 1X3EA 4UAIA 1T94A 3GQCA 1V1OA 1CQIB 3VDYA 4ECXA 4DL4A 1HR0H 1EU3A 4B3SH 5KFYA 4LF8L 1LTGD 4K8IA 2Y0SA 1CT1D 1SNOA 4DF7A 1XNQL 2PQAB 4X6AH 1SMYC 4LF4L 5FOBB 4G7ZC 4LF7Q 2K28A 3M7GA 3TIGA 1AH9A 3ULLA 3PW0A 2AWOA 1GHKA 1Z7TA 1YNJC 2PNHA 1STAA 1SR3A 1I4RA 3S1RB 5FJ8H 4IOCA 2XIWA 3L3OC 2NTSA 2EE1A 2Z4HA 4IZ8A 4ALPA 2YYAA 5CB4F 1WTOA 2I0QA 1NE3A 5CV8A 4JI1Q 4BBSH 4BXXG 2AUJD 3KJOA 4MV1A 4DAVA 4A93G 5EKKA 1XNRQ 1TWFA 4A3EG 5C3EB 3ZYYX 4B3RL 2NVQH 4RUCA 1EY9A 2DGYA 3UE0A 1JX4A 1JE5A 1N33H 4GNXA 2KJXA 5LMNL 1S3OA 4ME3A 5I6YA 3I4OA 1X9NA 1XNQQ 5IP7H 2RSNA 3S15B 1NSNS 4PMCA 2JA9A 4ODGA 3EYYA 1PYSB 4MA5A 1EU4A 2NN6H 5C4ZA 2ALYB 1DYQA 2FHTA 4MN3A 4DK3C 1Q8KA 3HOUH 4DR4Q 4A3BB 5C4JB 5CA0F 1X3GA 2HIXA 2VQFL 5CYUA 1KBLA 1EEID 4NB3A 2KA7A 1SEIA 2VUMG 2OXPA 3RTXA 4DFAA 5L1IA 5LL6X 5JJZA 4G7HC 3HKZG 2AMCB 3S24A 4QL5A 4OO1H 2ZM6H 4XZ3B 1X6OA 2Q8IB 1Z2OX 3KLWA 1VQJA 4ZKCB 2R8KA 5LMUL 1PH6A 5H80A 2NU8B 3KLSX 1S97A 5D3IB 1VQOA 5KFNA 1XXGA 5D1OB 4OX9H 1PTOD 2VB2X 3S17B 4R7RA 1J9OA 2MFIA 1QVGA 5I9PA 3OHAA 2JA5G 2FKLA 5JJLA 3PW7A 1SNQA 3K0XA 5AFWA 2XC9A 2QDLA 2E2DC 4IFDH 1GXDC 2RHSB 3I56A 4YIJA 4HR7A 3GILA 2UUCQ 2AHOB 1IZ6A 3H20A 4R4TA 1SYBA 3MC0B 3R23A 2R8IA 1TWFH 1KHIA 3DM3A 1ULZA 1ZYRC 5K36G 4X62H 2FLLA 4IRDA 4JI4H 2DLNA 3Q0AA 1Z47A 1FYCA 2P5ZX 1CHQD 1I4XA 2PI2E 3HP3A 4J15A 3RAQA 3BYTB 3TZDA 3GTPB 5KFLA 4A3IH 1HUMA 1ZHSA 3BJYA 2PQAA 2R93G 1B9NA 5D1PA 2EYLA 4FXDA 4A93B 4DR1H 3QWNA 1VKZA 1KJIA 4A3EB 4KN4C 3OHBA 2C00A 1SBBB 2GVAA 4X65H 1G291 2K14A 1YHBA 4O3NA 1E3PA 4CKCA 2ASBA 4UCSA 1S4ZA 2HIVA 3KBGA 3SXHA 5J1ZA 3VR6A 3ERSX 1HR0W 2C2EA 4DNIA 4JV2A 4GKJL 4GLAC 2W71A 4GOPC 4IO9A 1V8QA 4IRCA 3ORQA 4C1NI 1FL0A 3CC4A 5JEAJ 3I72A 3RLFA 1I94L 1TWAA 4JI7Q 1QOHA 2E75C 4ED8A 3Q1KA 1VQ6A 4XQNA 4JC0A 2CH4A 1PZJD 5E7NA 5A2QL 3M3YB 2VUMB 2G9HD 4OIKA 1PRTC 1I6HB 3HOXH 4HIMA 3HKZB 1C7YA 2V4RA 2PQEA 2EPBA 1JOKA 1HNZL 3DF7A 1VQ4A 3PO3G 2FLNA 1PZID 4RCOA 5KEEA 4JI3Q 4GKKH 3T1YL 3HOZG 1RYSA 1E2ZA 2WACA 5CAEB 3HOYH 1IKLA 2C35B 4LF6H 2X6LA 5K5PA 2K1BA 4WFN3 4DL6A 1IHZA 5JOBA 4AH6A 2EY6A 2FMMA 3NBIA 1EYCA 3N41B 3K5IA 2JA5B 2RBMA 1MJCA 3OUZA 3W5OA 1F2YA 4XT1B 3N40P 2HDMA 1V1QA 1YZ6A 1T5XD 2HHHQ 5KT2A 5FD5A 3BG5A 2L0CA 3STBC 5CR3A 3VYUA 1PDQA 1RKNA 5IGGA 5KFEA 1IW7C 2EY1A 5D8DA 1I3QB 1ENFA 3H94A 5D1OA 4K8JA 1OXVA 4DNTB 3S1RH 2EJFC 4DUYQ 3LWEA 2F0UA 5C4XG 1QWYA 1SYXB 3SR1A 4IHJF 4MTEA 1B44D 1RCVD 2JA7G 4F50A 2J6TA 2XSCA 4NW2A 2R93B 1XMQL 4DXGA 1LLRD 3EROA 2L1BA 1GM5A 1EIYB 2E2HB 5C3EH 1TWAH 3N6RA 1STHA 2E76C 4LSAA 3UE1A 1VMPA 1UE5A 2LS01 3A7LA 4DUZL 2WTFA 1N34L 2NB0A 4IQZA 4TV8F 1S9FA 3OWEB 2AWNA 2YS7A 2UVWA 2K33A 1PXUA 3FMAA 4ABNA 4DGZA 4L6TB 3H6MA 4DLKA 1X55A 3QB3A 4EG0A 2JE6I 2CKZB 1XDNA 4U68A 3IRBA 4A3BH 2JEFA 3UDGA 3I4LA 1VDZA 2NVYH 1PRTD 3KK7A 5C8YF 1H9SB 3GTMB 2JP1A 2FJ2A 4JI2L 1Y1VA 4CC6A 2F0PA 3S14B 4K6DA 3T1HH 1K83B 3U4VA 4DR7L 5C3WA 1YNND 4JPBW 5KNBA 2CQYA 4JI0H 2A6EC 4RG1A 3K5OA 3PO3B 2I87A 1PH4A 5T14A 4DV7H 3OIPA 3HOZB 3OPOA 4RMFA 4C2MH 1G2SA 4XDXA 3N44B 5FO9B 4JVZA 2OLSA 2W9CB 4O4HF 4LSXA 2VUMA 1EWIA 4XT3B 3URYA 4DL3A 1TY0A 1IBLL 4DAPA 5CMDA 3HKZA 2OT2A 3PSIA 3SE7A 3IFTA 3NHHA 3OYYA 3R5XA 4IAJA 1Q7YC 1TWHH 3IAYA 3OOCA 3HGBA 1HJPA 4OL7A 3BZCA 3NQIA 4JI5H 2W8KA 3DUZA 4XQQA 1U0LA 2EXZA 1ML0D 5ELBA 3QIAA 3M4OH 2BCOA 2ID0A 1B2TA 4GOPA 1I4PA 2N3SA 2VPQA 2UXBL 3KAKA 5KFDA 4LF9Q 2JA5A 2F0WA 3PUXA 5C4XB 4OWTB 4ECQA 1Q90A 2CQAA 2RA4A 3VR2A 3PO2G 2UUAH 5DAUA 1AZQA 4O3OA 2E5LH 5L1LA 4GLVB 3SHLA 3CC7A 4BXXH 2JA7B 2W9AA 3ND8A 4PNYA 4NXNL 1KIXA 2PPBC 4IZOA 3GV8B 4KHPQ 3CMEA 1P8LA 5IYCH 1NMGA 4YWKA 1W96A 3RUZA 1Y1VH 1I3QA 2F0VA 2RVLA 4IUQA 3CAMA 4X64L 2B2WA 1K1SA 1HZBA 1YHAA 2FLPA 2W9BB 1V9PA 2BDNA 3R5HA 4UHVA 4ZOLF 5EPJA 3HZXA 1JKJB 4K0KH 1TKWB 2NZHA 3EJIA 3K7AB 4CGYB 4I4TF 4LFCL 2OQKA 1JT8A 3GIDA 3C3LA 3KF6B 2F0OA 3A8IE 1K73C 4EEQA 4QQBX 1NAPA 2EDGA 3I90A 5ISRA 2VUMH 1KTKA 4DKAC 1LT6D 2UXCL 2A6ED 3EVQA 3NTHA 2CW0D 4NXNQ 5ELNA 3SK4A 3SGIA 4DV5L 2K4KA 4IFDJ 4ZQIA 1S40A 1EUDB 4K2LA 2V5AA 4PZ6A 4XYLB 2W6NA 1EY8A 4KD3A 3VPBA 4JG2A 4FBUA 2Z1CA 3GTLB 4DK0A 3FKIG 4DPGA 4DV4Q 2B63G 3GV7B 2ZDQA 2PMZB 3CKIB 3GTMA 4RWSC 5C0XG 5DQIA 3DMUA 4R8IA 1B6SA 2CH4W 3MA2B 1JOQA 2JA5H 1QB5D 1M6VA 4DV3Q 1OXXK 4K14A 1K83A 5JVG3 4LFCQ 2R87A 2DIKA 1LT4D 4UCOA 4B3MH 2WP8J 5E4XA 3FPPA 2MJ8A 4H44C 5I6WA 4HAEA 2QDBA 5K36H 4A3MG 1G51A 1N56A 2MHVA 3U4ZA 2F3IA 4O3RA 3K5HA 3RZOB 2W9CA 1MHWC 3CQZB 1WH2A 1KJQA 4IRKA 3A7AB 4DV5Q 2F4VQ 3EA6A 4LH7A 1ZXTA 4LUVA 3MFGA 5KFTA 5KYIA 1A9XA 4WORA 1KC8C 1VAJA 1W93A 1Q46A 2A74C 3LNNA 4R4CA 5M5XH 5M5WB 3OSPA 1U4PA 2X6GA 4F87A 3F2DA 4B3TH 2Q8RE 3EN2A 4Y8VB 3CPFA 2ZJRA 2F0FA 3NQTA 3BQ1A 3CU7A 1N36H 1II3A 4LUZA 5KFHA 2F0MA 4X3UA 4KK7A 2FPGB 5M5YB 1M0WA 4DR5L 3QJYA 3L0OA 4RA8A 2LKVA 1JWMD 2R6FA 4DL5A 1WD0A 1JDEA 2JA7A 4DV0L 1AE2A 1GOZA 2C5CA 5M3FG 1BNZA 2YL2A 4MZ9A 3JC66 4YAJB 4RUAA 2UU9Q
chains in the Genus database with same CATH topology
3TRZA 3I2ZA 2UUBQ 3F1ZA 2NVXH 1WFQA 2VQFQ 3STBD 1N8RC 1L0WA 3S1MH 3K8AA 4YHHL 3AEVA 5JEAG 2CCZA 2E5LQ 2HT1A 2JEAI 1YVCA 4MNOA 1HNXQ 4WJ4A 2WAQE 1Q1BA 3KF8B 3PO3H 3GDEA 4JYAL 3S1NH 1VQNA 3EBEA 2GN5A 4P71A 5IP9H 2MNAA 1GD7A 3KF6A 4R4IA 4DR2L 5LMUQ 4BY1H 2ATWA 2JA6H 2IHFA 1HZ9A 4WJ3M 5IWAQ 4C3JH 4DV2L 3JAMi 1Y1WH 3GTPH 4K0KQ 4BA1I 2N78A 2LXKA 2DUDA 3A0JA 3AFQA 4DR3L 2OTLA 2R7ZG 1PHJA 2GVBA 4GS3A 4GN5A 5IY0A 4A93H 1V43A 5HGQA 4UP8A 1N9WA 2VQEQ 4A3EH 2K5VA 1DGSA 4A76A 2EIFA 1VCIA 3PV0A 2N49A 1E7ZA 4NXMQ 4JV5Q 4DV4L 3K7UC 2OWOA 2UXDQ 4YWLA 3TS2A 1SROA 1YIJA 1Q1EA 1J6QA 4A3DG 3HOVH 1VS0A 2WAQG 2V1CC 2MO1A 4JBJA 5C0XI 1X3FA 4YHHQ 4HIDA 3HOYH 1X3EA 1FJGL 3MXNB 3CW2C 4DV3L 3VDYA 4PZ7A 4A3CG 4UPAA 5JJIA 5C4XH 2UU9Q 3KYHC 4LF8L 4LF5L 4JI6L 3CD6A 2N8NA 3AFPA 4AYBG 1NY4A 2WB1E 3M9BA 1XNQL 4LW1A 2PQAB 4DR2Q 4X6AH 2QEXA 4H02A 4DV2Q 3M3YH 2E8GA 4LF4L 4LF7Q 1EUJA 1KRTA 1NTGA 3GTKH 3T1HL 1I6HH 4GLXA 1AH9A 3ULLA 5J3BA 4AIMA 2AWOA 1VQ9A 2YTYA 2PNHA 2F4VL 1RIPA 1SR3A 4JI0L 1IYJB 5GADC 3G4SA 5FJ8H 5AJ3L 4DV7L 4IOCA 3K7AH 4UY8C 1Q12A 2XTIA 1YJ9A 1Y1WG 4LFAL 4ALPA 4GKJQ 4GOPB 2I0QA 1CSQA 1NE3A 1GO3E 2RCNA 4JI1Q 4BBSH 4BXXG 4IPHA 2K5NA 3KJOA 3U58A 1VQDA 2VZAA 4A3JH 2IX1A 4A93G 1XNRQ 4A3EG 3HKZE 1I94Q 2WB1G 4QIWE 1OXUA 2Z6KA 2NVQH 2DGYA 3UE0A 4B3RL 3CMAA 1JE5A 3KDFB 4GNXC 4GNXA 3TEHB 5LMNL 4R4OA 4JI6Q 4LF5Q 1S3OA 4ME3A 1X9NA 3I4OA 1SFOH 4JI5L 5IP7H 1EQQA 2ES2A 2KCMA 1FVIA 1XNQQ 2Q2IA 1QVFA 2JA9A 1PYSB 1I3QH 4DK6C 3CPWA 2R7FA 4R4QA 4EQ5A 4HJ8A 1VQPA 4B3TQ 1AE3A 3E0EA 1VQFA 2B29A 2ALYB 3H0GG 3JAMc 3CCJA 1NJIC 1HNZQ 2UU9L 4DK3C 1Q8KA 1YI2A 4P72A 3GTLH 3HOUH 4DR4Q 3T1YQ 3RR5A 2UUBL 1N36Q 1X3GA 2HIXA 2VQFL 3GTQH 1EQRA 4P75A 2UUAL 2JEBI 5GAGC 3KOJA 3F8TA 1PH3A 2ZJQA 4NB3A 2E5LL 1HNWQ 2R93H 1VQHA 2BH8A 3PUZA 2VUMG 4JI8L 4LFBQ 1MKHA 3DLLA 2E2HH 2CFMA 2AMCB 3HKZG 3S24A 4QL5A 3PCOB 1HNXL 3J7A5 1FGUA 1OXSC 2K52A 3PF4A 2F52A 1PYBA 1UE7A 1X6OA 1XJVA 1E24A 3KLWA 1VQJA 1IBMQ 5LMUL 1PH6A 3S2DH 1CUKA 5IWAL 3HFZB 1QVCA 4GN4B 4K0KL 2WFWA 1VQOA 2CWAA 4LFAQ 1T9HA 1P16A 2D0PA 2E2JH 3CCSA 2MFIA 2EXDA 1QVGA 2KCTA 1IBKQ 2QGQA 4AQYQ 2OTJA 2JA5G 4LWCA 3TREA 2VQEL 5JJLA 4GN3B 3PO2H 2K5HA 2Q2HA 4KLKA 3K0XA 1UE6A 3PGZA 4HIOA 1YHQA 5FLMG 4X66Q 3RN5A 4NXML 2RHSB 3I56A 1J5EQ 3GTMH 3AYHB 4UP9A 4JV5L 2UUCQ 2AHOB 1IZ6A 2I5MX 4R4TA 5M5WH 1HZCA 5GAHC 2VL6A 2UXDL 5IP7G 3S14H 1TWFH 1LM0A 1XMQQ 2UUAQ 1KHIA 1K83H 3DM3A 3GO5A 5K36G 1E22A 4JI8Q 3H15A 3Q8DA 1UEBA 3MEFA 4A3GH 4DUZQ 2CWPA 1B7YB 1VQ7A 1Z47A 1TWCH 1ASYA 3CF5A 1N34Q 3I4MH 1MIUA 3HOZH 1S72A 2PI2E 4J15A 3J80i 4TVAB 1C9OA 3PUWA 4A3IH 2KBNA 2PQAA 3S16H 2R93G 4OXPA 4IJHA 3J81c 4AYBE 4LF7L 5IYDH 3M85A 1KXLA 1WI5A 3CCUA 3L7ZC 5BR8Q 3CCRA 2R6GA 1A63A 1Z9FA 1VQLA 2FXQA 4DV1L 1A62A 1HR0Q 1Q81C 2GVAA 4B3SQ 1G291 2K14A 1YHBA 2YTVA 1E3PA 4IPGA 1M1KC 2ASBA 1TXYA 2HIVA 5H1SE 4JI2Q 2R92H 3ERSX 4P73A 1QZHA 4B3ML 3F2CA 1HR0W 2A8VA 1CKNB 4DNIA 4YCUA 4QGUA 1JJ2A 4GKJL 3G48A 4GLAC 3GTOH 4DR7Q 2YV5A 4EX5A 4JI1L 4OWXB 4GOPC 4IO9A 3I4NG 4YWMA 1PV4A 4HJ7A 4DAYB 1WYDA 1FL0A 1MJEA 3CC4A 5JEAJ 1XNRL 1XTDA 3RLFA 2VY3A 2A19A 1I94L 2B63H 3A5ZB 1BVSA 4L5SA 4A3BG 4JI7Q 2HQLA 1YITA 2H5XA 1PH8A 1KQSA 1VQ6A 2JA7H 4BA2I 3FP9A 2I5HA 3KDFA 4JC0A 3FHWA 5E7NA 4LUOA 3HOXH 4HIMA 1C7YA 3PUVA 1WCMH 1IBLQ 4QY7A 4B3TL 3H3VI 4A3GG 1HNZL 3BZKA 1VQ4A 3PO3G 3M7NA 3I4MG 4JI3Q 1KRSA 4DR4L 4DV1Q 3T1YL 1N36L 3HOZG 1X54A 3RNUA 1N33Q 5IP9G 4BY1G 2VW9A 4A3KH 1VQ8A 2C35B 4A3IG 2Q2TA 2JA6G 1G6PA 3S2HH 1LTLA 4B3MQ 1HNWL 4LFBL 4AH6A 1JB7A 1Q82C 4JCVE 2JA8H 4OONA 1LUZA 3S1QH 1D8LA 5ELOA 1VQBA 4IPCA 3RN2A 3OW2A 3HOWH 2IHEA 2UXBQ 1MJCA 1VQMA 3W5OA 3TS0A 1L1OB 3J81i 1V1QA 1IBML 1YZ6A 2HHHQ 2R92G 3EIVA 1W2BA 2QA4A 1VQIA 2VNUD 4FDBA 2AKWB 3STBC 4JBKA 1SRUA 3KFUA 3HOVG 1XPUA 2ZTCA 1IBKL 4HJ9A 4AQYL 1OXVA 2LSSA 3J80c 3S1RH 2NZOA 4X64Q 4DUYQ 1BBUA 2ZM6Q 4A3FH 5C4XG 1B8AA 1L2FA 1VQ5A 2D62A 4X66L 3LGJA 1J5EL 2Z0SA 2UUCL 4XTCS 5M3FH 4YCWA 2JA7G 4L5TA 3L2PA 4YCVA 4BY7H 4LNQA 1XMQL 4PMWA 1WOCA 3CCVA 1C0AA 1EOVA 1GM5A 4JBMA 2MO0A 1EIYB 2KHIA 2RF4A 5EAYA 5C3EH 2BH2A 1TWAH 3F2BA 2R7DA 1WCMG 5HY6A 4DR6Q 3UE1A 3NENA 1UE5A 4DUZL 3CCEA 2K75A 4R1JA 1N34L 1NMFA 3TQYA 2AWNA 5IE8A 1D7QA 4C3HH 5FJ8G 2UXCQ 1KL9A 2XGTA 3ULJA 1CSPA 1RL2A 1X55A 2JE6I 2PMZE 3E9HA 2CKZB 2JA8G 5BR8L 3RZOH 4X62Q 3IRBA 4BBSG 3CQZH 2I5LX 4A3JG 4A3BH 3A74A 1YNXA 4QJFA 4DV6L 5C44H 3UDGA 1HR0L 4B3SL 4JI4Q 4OWWB 2Y0SE 2NVYH 2KENA 4L5RC 3CXCA 1X56A 4JI2L 1A0IA 5IT9c 5GAEC 3E9IA 3U4VA 4DR7L 1Y14B 3GTJH 4A3LH 1PH9A 2E2IH 3I7FA 3CP0A 4DR1Q 2Q2UA 4RG1A 1PH2A 1PH4A 3AQQA 4A3FG 3D0FA 2NN6G 5M3MH 4X65Q 3PUYA 4RMFA 5M5YH 3M4PA 3CCQA 1OTCA 4JI7L 2JQOA 4C2MH 3HOUG 4A3DH 1Q86C 4IOAA 3K80C 1K8GA 4BY7G 2VS1A 4POFA 4YY3Q 3J7ZC 2JJQA 1A8VA 4A3CH 1EWIA 3KJPA 4C3IH 1IBLL 1BBWA 2Y0SG 1SMXA 3PSIA 3OYYA 4JI3L 4OO1G 4DV6Q 1TWHH 1Q7YC 1HJPA 2L15A 3BZCA 4IPDA 1YJNA 1N33L 4IJLA 4HIKA 1QUQB 1ASZA 1U0LA 4P74A 2LXJA 3U50C 3A5UA 1H95A 3M4OH 4DAMA 2YU9H 3OTOQ 1PVOA 1E1OA 2ID0A 2K50A 4GOPA 2N3SA 3G71A 5C44G 2UXBL 1EFWA 3B6YA 5FLXc 4LF9Q 2IT1A 3PUXA 4OWTB 4GKKQ 3M4QA 1L1OC 3FKIH 4DR5Q 1L1OA 2OQ0A 1XMOQ 1PH7A 2OCEA 2HHHL 3PO2G 4GLVB 2ZTEA 3CC7A 1XPRA 1VQAA 4BXXH 4IFDG 4NXNL 1KIXA 5DLQE 4MTNA 4LF6Q 4DV0Q 4KHPQ 3CMEA 1P8LA 5IYCH 4L5QA 2ZJPA 4A3LG 1B70B 1NMGA 4YWKA 1Y1VH 4Y52H 1JMCA 3CAMA 4X64L 4JOIC 4BBRH 1GKHA 4JOIA 1SLJA 2ZM6L 3NBHB 4DUYL 1HZBA 1YHAA 5M3MG 2D0OA 1V9PA 4Y7NH 4POGA 3W1BA 4KHZA 4NPSA 2BA0A 1O7IA 2NZHA 2BA1A 3H3VH 4A3MH 5IYBH 1PFSA 3ULPA 2YYZA 3H0GH 2OQKA 4JBWA 4LFCL 3W1GA 4OX9L 1JT8A 5IYDG 4DR6L 4JYAQ 3KF6B 2IY5B 1K73C 1K0RA 4QQBX 4O2DA 1CKOA 3I55A 4HJ5A 3UDIA 2VUMH 4DKAC 5JJKA 2KHJA 2UXCL 1N32L 1SE8A 1U5KA 1FJGQ 1LYLA 4O0AA 1R9TH 2A1AA 4NXNQ 5ELNA 1VQGA 1TWGH 3SGIA 2K4KA 4DV5L 4IFDJ 1S40A 4X62L 3ICEA 1YJWA 3G6EA 4PZ6A 4JI4L 4A75A 1EYGA 4JG2A 2PI2A 2CQOA 1YBYA 3FKIG 1I50H 4DPGA 4DV4Q 4DR3Q 1VQKA 2B63G 3ER0A 3RLOA 5C0XG 1YEZA 3PIOA 3CCMA 3CC2A 3UDFA 1VQCA 2JA5H 1WJJA 2IX0A 2ZTDA 3D31A 5IYCG 1PH5A 4DV3Q 1OXXK 1QZGA 2Z6KC 1PA6A 3K81C 1IL2A 3HOXG 1OXTA 1Y1VG 4PZ8A 4DR1L 3PF5A 5FLMH 2YTXA 4LFCQ 4LF8Q 4OX9Q 3GD7A 4BBRG 5GROA 4HJAA 4X65L 2NVTH 2WP8J 3WWVA 1XPOA 1UE1A 2NN6I 3GTGH 4YY3L 4A3MG 5IYBG 3RZDH 1G51A 4LF4Q 1W3SA 4A3KG 3HOYG 3S15H 1N32Q 3T1HQ 3U4ZA 2F3IA 1NBWA 1UWVA 4DV5Q 1VQEA 2EQSA 1KAWA 1M90C 4JI0Q 2F4VQ 4LUVA 1X65A 5C4JH 5AJ3Q 4DV7Q 3HOWG 5GQOA 4A4IA 4OO1I 4PG3A 1HH2P 1JJCB 1HZAA 3HKSA 1KD1C 3CCLA 3NEMA 1KC8C 1JJGA 1Q46A 4R4CA 1K3RA 5M5XH 2R7ZH 3NELA 1K9MC 1QUQA 1K8AC 3F2DA 1PH1A 5C0XJ 3EN2A 4TQUS 3CPFA 1GVPA 1CKNA 2JK8A 4APVA 3OTOL 2ZJRA 1E1TA 1SN8A 4B3RQ 1I5FA 4GNXB 4LF9L 4LUZA 3J81j 3UDXA 4GKKL 1XMOL 4DR5L 5LMNQ 3L0OA 3ZJYC 2B3GA 3RLNA 4JI5Q 4UP7A 1CKMA 3I4NH 4XIGS 4LF6L 4DV0L 1AE2A 1BKBA 5M3FG 3S17H 4IFDI 4KHPL 5LMNW 4MZ9A 4KI0A 3JC66 3PIPA 3BJUA 2RHQB 1IXRA 2MQHA 1EIFA 5C3EG 3BU2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TRZ A;  3I2Z A;  2UUB Q;  3F1Z A;  2NVX H;  1WFQ A;  2VQF Q;  3STB D;  1N8R C;  1L0W A;  3S1M H;  3K8A A;  4YHH L;  3AEV A;  5JEA G;  2CCZ A;  2E5L Q;  2HT1 A;  2JEA I;  1YVC A;  4MNO A;  1HNX Q;  4WJ4 A;  2WAQ E;  1Q1B A;  3KF8 B;  3PO3 H;  3GDE A;  4JYA L;  3S1N H;  1VQN A;  3EBE A;  2GN5 A;  4P71 A;  5IP9 H;  2MNA A;  1GD7 A;  3KF6 A;  4R4I A;  4DR2 L;  5LMU Q;  4BY1 H;  2ATW A;  2JA6 H;  2IHF A;  1HZ9 A;  4WJ3 M;  5IWA Q;  4C3J H;  4DV2 L;  3JAM i;  1Y1W H;  3GTP H;  4K0K Q;  4BA1 I;  2N78 A;  2LXK A;  2DUD A;  3A0J A;  3AFQ A;  4DR3 L;  2OTL A;  2R7Z G;  1PHJ A;  2GVB A;  4GS3 A;  4GN5 A;  5IY0 A;  4A93 H;  1V43 A;  5HGQ A;  4UP8 A;  1N9W A;  2VQE Q;  4A3E H;  2K5V A;  1DGS A;  4A76 A;  2EIF A;  1VCI A;  3PV0 A;  2N49 A;  1E7Z A;  4NXM Q;  4JV5 Q;  4DV4 L;  3K7U C;  2OWO A;  2UXD Q;  4YWL A;  3TS2 A;  1SRO A;  1YIJ A;  1Q1E A;  1J6Q A;  4A3D G;  3HOV H;  1VS0 A;  2WAQ G;  2V1C C;  2MO1 A;  4JBJ A;  5C0X I;  1X3F A;  4YHH Q;  4HID A;  3HOY H;  1X3E A;  1FJG L;  3MXN B;  3CW2 C;  4DV3 L;  3VDY A;  4PZ7 A;  4A3C G;  4UPA A;  5JJI A;  5C4X H;  2UU9 Q;  3KYH C;  4LF8 L;  4LF5 L;  4JI6 L;  3CD6 A;  2N8N A;  3AFP A;  4AYB G;  1NY4 A;  2WB1 E;  3M9B A;  1XNQ L;  4LW1 A;  2PQA B;  4DR2 Q;  4X6A H;  2QEX A;  4H02 A;  4DV2 Q;  3M3Y H;  2E8G A;  4LF4 L;  4LF7 Q;  1EUJ A;  1KRT A;  1NTG A;  3GTK H;  3T1H L;  1I6H H;  4GLX A;  1AH9 A;  3ULL A;  5J3B A;  4AIM A;  2AWO A;  1VQ9 A;  2YTY A;  2PNH A;  2F4V L;  1RIP A;  1SR3 A;  4JI0 L;  1IYJ B;  5GAD C;  3G4S A;  5FJ8 H;  5AJ3 L;  4DV7 L;  4IOC A;  3K7A H;  4UY8 C;  1Q12 A;  2XTI A;  1YJ9 A;  1Y1W G;  4LFA L;  4ALP A;  4GKJ Q;  4GOP B;  2I0Q A;  1CSQ A;  1NE3 A;  1GO3 E;  2RCN A;  4JI1 Q;  4BBS H;  4BXX G;  4IPH A;  2K5N A;  3KJO A;  3U58 A;  1VQD A;  2VZA A;  4A3J H;  2IX1 A;  4A93 G;  1XNR Q;  4A3E G;  3HKZ E;  1I94 Q;  2WB1 G;  4QIW E;  1OXU A;  2Z6K A;  2NVQ H;  2DGY A;  3UE0 A;  4B3R L;  3CMA A;  1JE5 A;  3KDF B;  4GNX C;  4GNX A;  3TEH B;  5LMN L;  4R4O A;  4JI6 Q;  4LF5 Q;  1S3O A;  4ME3 A;  1X9N A;  3I4O A;  1SFO H;  4JI5 L;  5IP7 H;  1EQQ A;  2ES2 A;  2KCM A;  1FVI A;  1XNQ Q;  2Q2I A;  1QVF A;  2JA9 A;  1PYS B;  1I3Q H;  4DK6 C;  3CPW A;  2R7F A;  4R4Q A;  4EQ5 A;  4HJ8 A;  1VQP A;  4B3T Q;  1AE3 A;  3E0E A;  1VQF A;  2B29 A;  2ALY B;  3H0G G;  3JAM c;  3CCJ A;  1NJI C;  1HNZ Q;  2UU9 L;  4DK3 C;  1Q8K A;  1YI2 A;  4P72 A;  3GTL H;  3HOU H;  4DR4 Q;  3T1Y Q;  3RR5 A;  2UUB L;  1N36 Q;  1X3G A;  2HIX A;  2VQF L;  3GTQ H;  1EQR A;  4P75 A;  2UUA L;  2JEB I;  5GAG C;  3KOJ A;  3F8T A;  1PH3 A;  2ZJQ A;  4NB3 A;  2E5L L;  1HNW Q;  2R93 H;  1VQH A;  2BH8 A;  3PUZ A;  2VUM G;  4JI8 L;  4LFB Q;  1MKH A;  3DLL A;  2E2H H;  2CFM A;  2AMC B;  3HKZ G;  3S24 A;  4QL5 A;  3PCO B;  1HNX L;  3J7A 5;  1FGU A;  1OXS C;  2K52 A;  3PF4 A;  2F52 A;  1PYB A;  1UE7 A;  1X6O A;  1XJV A;  1E24 A;  3KLW A;  1VQJ A;  1IBM Q;  5LMU L;  1PH6 A;  3S2D H;  1CUK A;  5IWA L;  3HFZ B;  1QVC A;  4GN4 B;  4K0K L;  2WFW A;  1VQO A;  2CWA A;  4LFA Q;  1T9H A;  1P16 A;  2D0P A;  2E2J H;  3CCS A;  2MFI A;  2EXD A;  1QVG A;  2KCT A;  1IBK Q;  2QGQ A;  4AQY Q;  2OTJ A;  2JA5 G;  4LWC A;  3TRE A;  2VQE L;  5JJL A;  4GN3 B;  3PO2 H;  2K5H A;  2Q2H A;  4KLK A;  3K0X A;  1UE6 A;  3PGZ A;  4HIO A;  1YHQ A;  5FLM G;  4X66 Q;  3RN5 A;  4NXM L;  2RHS B;  3I56 A;  1J5E Q;  3GTM H;  3AYH B;  4UP9 A;  4JV5 L;  2UUC Q;  2AHO B;  1IZ6 A;  2I5M X;  4R4T A;  5M5W H;  1HZC A;  5GAH C;  2VL6 A;  2UXD L;  5IP7 G;  3S14 H;  1TWF H;  1LM0 A;  1XMQ Q;  2UUA Q;  1KHI A;  1K83 H;  3DM3 A;  3GO5 A;  5K36 G;  1E22 A;  4JI8 Q;  3H15 A;  3Q8D A;  1UEB A;  3MEF A;  4A3G H;  4DUZ Q;  2CWP A;  1B7Y B;  1VQ7 A;  1Z47 A;  1TWC H;  1ASY A;  3CF5 A;  1N34 Q;  3I4M H;  1MIU A;  3HOZ H;  1S72 A;  2PI2 E;  4J15 A;  3J80 i;  4TVA B;  1C9O A;  3PUW A;  4A3I H;  2KBN A;  2PQA A;  3S16 H;  2R93 G;  4OXP A;  4IJH A;  3J81 c;  4AYB E;  4LF7 L;  5IYD H;  3M85 A;  1KXL A;  1WI5 A;  3CCU A;  3L7Z C;  5BR8 Q;  3CCR A;  2R6G A;  1A63 A;  1Z9F A;  1VQL A;  2FXQ A;  4DV1 L;  1A62 A;  1HR0 Q;  1Q81 C;  2GVA A;  4B3S Q;  1G29 1;  2K14 A;  1YHB A;  2YTV A;  1E3P A;  4IPG A;  1M1K C;  2ASB A;  1TXY A;  2HIV A;  5H1S E;  4JI2 Q;  2R92 H;  3ERS X;  4P73 A;  1QZH A;  4B3M L;  3F2C A;  1HR0 W;  2A8V A;  1CKN B;  4DNI A;  4YCU A;  4QGU A;  1JJ2 A;  4GKJ L;  3G48 A;  4GLA C;  3GTO H;  4DR7 Q;  2YV5 A;  4EX5 A;  4JI1 L;  4OWX B;  4GOP C;  4IO9 A;  3I4N G;  4YWM A;  1PV4 A;  4HJ7 A;  4DAY B;  1WYD A;  1FL0 A;  1MJE A;  3CC4 A;  5JEA J;  1XNR L;  1XTD A;  3RLF A;  2VY3 A;  2A19 A;  1I94 L;  2B63 H;  3A5Z B;  1BVS A;  4L5S A;  4A3B G;  4JI7 Q;  2HQL A;  1YIT A;  2H5X A;  1PH8 A;  1KQS A;  1VQ6 A;  2JA7 H;  4BA2 I;  3FP9 A;  2I5H A;  3KDF A;  4JC0 A;  3FHW A;  5E7N A;  4LUO A;  3HOX H;  4HIM A;  1C7Y A;  3PUV A;  1WCM H;  1IBL Q;  4QY7 A;  4B3T L;  3H3V I;  4A3G G;  1HNZ L;  3BZK A;  1VQ4 A;  3PO3 G;  3M7N A;  3I4M G;  4JI3 Q;  1KRS A;  4DR4 L;  4DV1 Q;  3T1Y L;  1N36 L;  3HOZ G;  1X54 A;  3RNU A;  1N33 Q;  5IP9 G;  4BY1 G;  2VW9 A;  4A3K H;  1VQ8 A;  2C35 B;  4A3I G;  2Q2T A;  2JA6 G;  1G6P A;  3S2H H;  1LTL A;  4B3M Q;  1HNW L;  4LFB L;  4AH6 A;  1JB7 A;  1Q82 C;  4JCV E;  2JA8 H;  4OON A;  1LUZ A;  3S1Q H;  1D8L A;  5ELO A;  1VQB A;  4IPC A;  3RN2 A;  3OW2 A;  3HOW H;  2IHE A;  2UXB Q;  1MJC A;  1VQM A;  3W5O A;  3TS0 A;  1L1O B;  3J81 i;  1V1Q A;  1IBM L;  1YZ6 A;  2HHH Q;  2R92 G;  3EIV A;  1W2B A;  2QA4 A;  1VQI A;  2VNU D;  4FDB A;  2AKW B;  3STB C;  4JBK A;  1SRU A;  3KFU A;  3HOV G;  1XPU A;  2ZTC A;  1IBK L;  4HJ9 A;  4AQY L;  1OXV A;  2LSS A;  3J80 c;  3S1R H;  2NZO A;  4X64 Q;  4DUY Q;  1BBU A;  2ZM6 Q;  4A3F H;  5C4X G;  1B8A A;  1L2F A;  1VQ5 A;  2D62 A;  4X66 L;  3LGJ A;  1J5E L;  2Z0S A;  2UUC L;  4XTC S;  5M3F H;  4YCW A;  2JA7 G;  4L5T A;  3L2P A;  4YCV A;  4BY7 H;  4LNQ A;  1XMQ L;  4PMW A;  1WOC A;  3CCV A;  1C0A A;  1EOV A;  1GM5 A;  4JBM A;  2MO0 A;  1EIY B;  2KHI A;  2RF4 A;  5EAY A;  5C3E H;  2BH2 A;  1TWA H;  3F2B A;  2R7D A;  1WCM G;  5HY6 A;  4DR6 Q;  3UE1 A;  3NEN A;  1UE5 A;  4DUZ L;  3CCE A;  2K75 A;  4R1J A;  1N34 L;  1NMF A;  3TQY A;  2AWN A;  5IE8 A;  1D7Q A;  4C3H H;  5FJ8 G;  2UXC Q;  1KL9 A;  2XGT A;  3ULJ A;  1CSP A;  1RL2 A;  1X55 A;  2JE6 I;  2PMZ E;  3E9H A;  2CKZ B;  2JA8 G;  5BR8 L;  3RZO H;  4X62 Q;  3IRB A;  4BBS G;  3CQZ H;  2I5L X;  4A3J G;  4A3B H;  3A74 A;  1YNX A;  4QJF A;  4DV6 L;  5C44 H;  3UDG A;  1HR0 L;  4B3S L;  4JI4 Q;  4OWW B;  2Y0S E;  2NVY H;  2KEN A;  4L5R C;  3CXC A;  1X56 A;  4JI2 L;  1A0I A;  5IT9 c;  5GAE C;  3E9I A;  3U4V A;  4DR7 L;  1Y14 B;  3GTJ H;  4A3L H;  1PH9 A;  2E2I H;  3I7F A;  3CP0 A;  4DR1 Q;  2Q2U A;  4RG1 A;  1PH2 A;  1PH4 A;  3AQQ A;  4A3F G;  3D0F A;  2NN6 G;  5M3M H;  4X65 Q;  3PUY A;  4RMF A;  5M5Y H;  3M4P A;  3CCQ A;  1OTC A;  4JI7 L;  2JQO A;  4C2M H;  3HOU G;  4A3D H;  1Q86 C;  4IOA A;  3K80 C;  1K8G A;  4BY7 G;  2VS1 A;  4POF A;  4YY3 Q;  3J7Z C;  2JJQ A;  1A8V A;  4A3C H;  1EWI A;  3KJP A;  4C3I H;  1IBL L;  1BBW A;  2Y0S G;  1SMX A;  3PSI A;  3OYY A;  4JI3 L;  4OO1 G;  4DV6 Q;  1TWH H;  1Q7Y C;  1HJP A;  2L15 A;  3BZC A;  4IPD A;  1YJN A;  1N33 L;  4IJL A;  4HIK A;  1QUQ B;  1ASZ A;  1U0L A;  4P74 A;  2LXJ A;  3U50 C;  3A5U A;  1H95 A;  3M4O H;  4DAM A;  2YU9 H;  3OTO Q;  1PVO A;  1E1O A;  2ID0 A;  2K50 A;  4GOP A;  2N3S A;  3G71 A;  5C44 G;  2UXB L;  1EFW A;  3B6Y A;  5FLX c;  4LF9 Q;  2IT1 A;  3PUX A;  4OWT B;  4GKK Q;  3M4Q A;  1L1O C;  3FKI H;  4DR5 Q;  1L1O A;  2OQ0 A;  1XMO Q;  1PH7 A;  2OCE A;  2HHH L;  3PO2 G;  4GLV B;  2ZTE A;  3CC7 A;  1XPR A;  1VQA A;  4BXX H;  4IFD G;  4NXN L;  1KIX A;  5DLQ E;  4MTN A;  4LF6 Q;  4DV0 Q;  4KHP Q;  3CME A;  1P8L A;  5IYC H;  4L5Q A;  2ZJP A;  4A3L G;  1B70 B;  1NMG A;  4YWK A;  1Y1V H;  4Y52 H;  1JMC A;  3CAM A;  4X64 L;  4JOI C;  4BBR H;  1GKH A;  4JOI A;  1SLJ A;  2ZM6 L;  3NBH B;  4DUY L;  1HZB A;  1YHA A;  5M3M G;  2D0O A;  1V9P A;  4Y7N H;  4POG A;  3W1B A;  4KHZ A;  4NPS A;  2BA0 A;  1O7I A;  2NZH A;  2BA1 A;  3H3V H;  4A3M H;  5IYB H;  1PFS A;  3ULP A;  2YYZ A;  3H0G H;  2OQK A;  4JBW A;  4LFC L;  3W1G A;  4OX9 L;  1JT8 A;  5IYD G;  4DR6 L;  4JYA Q;  3KF6 B;  2IY5 B;  1K73 C;  1K0R A;  4QQB X;  4O2D A;  1CKO A;  3I55 A;  4HJ5 A;  3UDI A;  2VUM H;  4DKA C;  5JJK A;  2KHJ A;  2UXC L;  1N32 L;  1SE8 A;  1U5K A;  1FJG Q;  1LYL A;  4O0A A;  1R9T H;  2A1A A;  4NXN Q;  5ELN A;  1VQG A;  1TWG H;  3SGI A;  2K4K A;  4DV5 L;  4IFD J;  1S40 A;  4X62 L;  3ICE A;  1YJW A;  3G6E A;  4PZ6 A;  4JI4 L;  4A75 A;  1EYG A;  4JG2 A;  2PI2 A;  2CQO A;  1YBY A;  3FKI G;  1I50 H;  4DPG A;  4DV4 Q;  4DR3 Q;  1VQK A;  2B63 G;  3ER0 A;  3RLO A;  5C0X G;  1YEZ A;  3PIO A;  3CCM A;  3CC2 A;  3UDF A;  1VQC A;  2JA5 H;  1WJJ A;  2IX0 A;  2ZTD A;  3D31 A;  5IYC G;  1PH5 A;  4DV3 Q;  1OXX K;  1QZG A;  2Z6K C;  1PA6 A;  3K81 C;  1IL2 A;  3HOX G;  1OXT A;  1Y1V G;  4PZ8 A;  4DR1 L;  3PF5 A;  5FLM H;  2YTX A;  4LFC Q;  4LF8 Q;  4OX9 Q;  3GD7 A;  4BBR G;  5GRO A;  4HJA A;  4X65 L;  2NVT H;  2WP8 J;  3WWV A;  1XPO A;  1UE1 A;  2NN6 I;  3GTG H;  4YY3 L;  4A3M G;  5IYB G;  3RZD H;  1G51 A;  4LF4 Q;  1W3S A;  4A3K G;  3HOY G;  3S15 H;  1N32 Q;  3T1H Q;  3U4Z A;  2F3I A;  1NBW A;  1UWV A;  4DV5 Q;  1VQE A;  2EQS A;  1KAW A;  1M90 C;  4JI0 Q;  2F4V Q;  4LUV A;  1X65 A;  5C4J H;  5AJ3 Q;  4DV7 Q;  3HOW G;  5GQO A;  4A4I A;  4OO1 I;  4PG3 A;  1HH2 P;  1JJC B;  1HZA A;  3HKS A;  1KD1 C;  3CCL A;  3NEM A;  1KC8 C;  1JJG A;  1Q46 A;  4R4C A;  1K3R A;  5M5X H;  2R7Z H;  3NEL A;  1K9M C;  1QUQ A;  1K8A C;  3F2D A;  1PH1 A;  5C0X J;  3EN2 A;  4TQU S;  3CPF A;  1GVP A;  1CKN A;  2JK8 A;  4APV A;  3OTO L;  2ZJR A;  1E1T A;  1SN8 A;  4B3R Q;  1I5F A;  4GNX B;  4LF9 L;  4LUZ A;  3J81 j;  3UDX A;  4GKK L;  1XMO L;  4DR5 L;  5LMN Q;  3L0O A;  3ZJY C;  2B3G A;  3RLN A;  4JI5 Q;  4UP7 A;  1CKM A;  3I4N H;  4XIG S;  4LF6 L;  4DV0 L;  1AE2 A;  1BKB A;  5M3F G;  3S17 H;  4IFD I;  4KHP L;  5LMN W;  4MZ9 A;  4KI0 A;  3JC6 6;  3PIP A;  3BJU A;  2RHQ B;  1IXR A;  2MQH A;  1EIF A;  5C3E G;  3BU2 A; 
#chains in the Genus database with same CATH topology
 4JUZ A;  1WTV A;  1AUX A;  3I2Z A;  1IBM H;  2UUB Q;  2FMC A;  2MGS A;  1CI3 M;  1N8R C;  2GLT A;  1L0W A;  2R86 A;  3K8A A;  4M7E A;  2W9B A;  2DPI A;  3IKJ A;  2EYM A;  5KX5 F;  5KFK A;  5KT5 A;  1HA5 A;  1IBK H;  1HNX Q;  2MCT A;  4IUT A;  3GTO B;  1ONL A;  3PO3 H;  4WJ4 A;  5DQG A;  1I4Q A;  1HQR D;  5A2Q W;  4JYA L;  3VR5 A;  1O7Z A;  2XRQ D;  4X66 H;  2MNA A;  4DR2 L;  1GD7 A;  3KF6 A;  1J5E H;  1UAP A;  3FKI B;  2DWC A;  1Z2N X;  1T3N A;  4C3J H;  4DV2 L;  1Y1W H;  4TUY F;  3T56 B;  4BA1 I;  1ROD A;  2N78 A;  1TS5 A;  2R7Z G;  3VPD A;  2OTL A;  4XQJ A;  3Q8P B;  1XWE A;  5IY0 A;  2IMW P;  5L37 A;  1NUC A;  3K57 A;  4UP8 A;  2EJM A;  3PQI A;  3VR3 A;  2VQE Q;  2B2Y A;  2K5V A;  1GUO A;  2HVS A;  2K7V A;  1E7Z A;  1S0O A;  3ORR A;  4KV6 A;  5DG9 A;  2OWO A;  3GTL A;  2R7N A;  4A3M B;  2WAQ G;  2V1C C;  2MO1 A;  5C0X I;  1NNX A;  5TSS A;  2PMZ A;  3JRW A;  4I7H A;  5BR8 H;  3GTQ A;  1FJG L;  3H91 A;  3L4J A;  2ASD A;  3TIN A;  5JJI A;  1EY6 A;  4A3C G;  1BXR A;  4MAM A;  5C4X H;  3G6J B;  3OUU A;  3S1Q B;  3Q24 A;  1ILQ A;  3HEJ A;  4JI6 L;  2N8N A;  5KFJ A;  1NY4 A;  5KFR A;  4LW1 A;  4DR2 Q;  4UCV A;  4GC6 A;  4TRD A;  3WO1 A;  2QEX A;  4YB8 B;  4DV2 Q;  5JQW A;  3PN1 A;  4RB0 A;  2D9U A;  1JE4 A;  4QIW B;  1NTG A;  5KG4 A;  2J6U A;  2N55 A;  5J3B A;  2BDO A;  4JV1 A;  4O3S A;  2YTY A;  2J6S A;  2JEJ A;  3CQZ A;  3LX0 A;  5GAD C;  3G4S A;  4HCE A;  1AUV A;  4RAU C;  3K7A H;  3VR4 A;  1I50 B;  2PW5 A;  4JW0 A;  5M3F B;  1GYF A;  3UQ8 A;  2EYP A;  1VF5 C;  4QIW E;  4FF3 A;  3BDC A;  1S5C D;  3PIO 3;  2NVT B;  2B8F A;  4GNX C;  1WVL A;  1ICW A;  4JI6 Q;  2N88 A;  3TP6 A;  4LFA L;  4WBN F;  1TWC A;  3KHH A;  2K01 A;  2ES2 A;  2KCM A;  3O13 A;  2Q2I A;  4I50 F;  2BE5 D;  4RU9 A;  4TKO B;  4DK6 C;  3CPW A;  1WTX A;  1HTL D;  3E3X A;  4HJ8 A;  1W6J A;  1IL2 A;  4K2K A;  2V58 A;  3H0G G;  2B29 A;  3GTL H;  4MV6 A;  1E4G T;  4P72 A;  1LT3 D;  2XGQ A;  3BVZ A;  3T13 A;  3GTQ H;  1EQR A;  2DZD A;  4MTD A;  2A6H C;  2RDG A;  2W7O A;  1HNW Q;  2ZDG A;  4LFB Q;  3PUZ A;  2R7Z B;  5CA1 F;  1S0M A;  1Q3L A;  1TU2 B;  1OXS C;  3PF4 A;  1M7J A;  4DR3 H;  1GSO A;  1N48 A;  3GTO A;  1PYB A;  1UE7 A;  1XJV A;  1E24 A;  5KIX A;  4FNF A;  5KG3 A;  2J4X A;  3S2D H;  5IWA L;  1G8Z D;  4Q45 A;  1QVC A;  4J9S A;  2B63 A;  1DZ1 A;  3RB6 A;  2WAQ B;  3I3C A;  4LFA Q;  2D0P A;  4A2A A;  3CCS A;  4DR6 H;  2KCT A;  5EKI A;  4AQY Q;  1BR9 A;  5I9O A;  5KFW A;  2M05 A;  2ZXO A;  3PO2 H;  3F8N A;  3JZI A;  5F9N A;  2VPS A;  1UE6 A;  3NTI A;  1LTR D;  3TDQ A;  4NXM L;  4JV5 L;  5EQ0 A;  5EOY A;  1I4G A;  5KFZ A;  1N32 H;  3S1M B;  2UXD L;  5M5W H;  3V6H A;  1ESF A;  4MTK A;  2M9V A;  3J7Y W;  4RGN A;  3LP8 A;  3H15 A;  1JR0 D;  4A2B A;  1UEB A;  1BCP B;  4A3G H;  3GIQ A;  2CWP A;  1B7Y B;  3BG3 A;  2YU9 B;  3KHL A;  1E2W A;  2EYJ A;  1TWC H;  3I4M H;  3CF5 A;  4ZLT F;  1DOL A;  1C9O A;  4XXE A;  2KBN A;  1VBH A;  3J81 c;  4LF7 L;  3GIJ A;  3PW4 A;  3M85 A;  1WI5 A;  2R61 A;  4CBV A;  3CCU A;  4YR3 A;  3CCR A;  4HSP A;  4MV9 A;  4R8N A;  1Q81 C;  1HR0 Q;  4B3S Q;  2HJW A;  2Z8L A;  3W2D A;  1M1K C;  1TXY A;  1I7L A;  2IP4 A;  3LML A;  3DWP A;  4KN7 C;  3D4W A;  4P73 A;  4LMQ D;  1QZH A;  3F2C A;  4QCL A;  4YY3 H;  4EFE A;  1I50 A;  1KNE A;  1JJ2 A;  1M8A A;  4ZQ3 A;  1S5E D;  3G48 A;  3GTO H;  1C30 A;  3MFH A;  4EX5 A;  4JI1 L;  4OWX B;  2SNS A;  1IOW A;  2UVV A;  3JAM E;  3I4N G;  4DAY B;  3TME A;  2R8G A;  3H0G B;  1XNR L;  1XTC D;  2A6H D;  2B63 H;  3A5Z B;  4Q43 A;  1PH8 A;  3QG1 A;  5BPF A;  3QZ7 A;  4FYD A;  5EGT A;  3FP9 A;  2XIG A;  4HNV A;  3SEB A;  1JQY D;  1ZQ7 A;  1O7Y A;  4OIJ A;  5T1G A;  1NR2 A;  3GTK B;  3OTO H;  3RFC A;  1U9R A;  1LTI D;  4QY7 A;  3H3V I;  2XWJ B;  3BA9 A;  3M7N A;  3D4R A;  1KRS A;  4DR4 L;  1XMO H;  4YBZ B;  2KED A;  1SYF A;  2K32 A;  1CTM A;  3RNU A;  1N33 Q;  4BY1 G;  2Q2T A;  1JWS D;  4IR1 A;  2PNR C;  1GSH A;  3J81 W;  5KFQ A;  1Q82 C;  1CQJ B;  1DOK A;  2JA8 H;  1WR2 A;  2R7Z A;  1LUZ A;  3S1Q H;  1D8L A;  5ELO A;  1VQB A;  2FK1 A;  3DWA A;  1VQM A;  4UFZ A;  2IX3 A;  2R92 G;  1IKM A;  1J8I A;  5DM7 3;  1W2B A;  1D6E C;  3TBI B;  4JBK A;  2VR1 A;  4KD4 A;  4GC7 A;  5FO7 B;  3HOV G;  3K3P A;  3FVQ A;  2WAQ A;  2R3Z A;  4L8J A;  4ME6 A;  4A3F H;  1BBU A;  2ZM6 Q;  3RV3 A;  1B8A A;  1Z6H A;  2KEE A;  2D62 A;  4EGQ A;  1BUV T;  2F0D A;  4WJW A;  2EOT A;  3LGJ A;  4DL7 A;  4DL2 A;  2UUC L;  5M3F H;  3N8D A;  1PMR A;  4BY7 H;  3JAM L;  4LNQ A;  1H9R A;  4PMW A;  2R7M A;  4J9K A;  3CCV A;  1EOV A;  1K8O A;  1PTO B;  2Q8T A;  2BH2 A;  3F2B A;  1WCM G;  5HY6 A;  1S68 A;  3NUC A;  4RB1 A;  3G7L A;  5BPH A;  5DG7 A;  2K75 A;  1WTQ A;  2YU9 A;  5DLG A;  1JIH A;  3H4D A;  1S5D D;  4QWA A;  2O4X A;  3FDT A;  1LAB A;  1KL9 A;  4KY6 A;  3ULJ A;  1PRT F;  1RL2 A;  1S5F D;  4H0L C;  5CV4 A;  4ME5 A;  3V05 A;  3BZD B;  3I4N B;  5KFO A;  2NZ1 D;  4X62 Q;  4LF8 H;  4UCT A;  4J9L A;  1YNX A;  4JI4 Q;  2YZM A;  4RGO S;  2NTT A;  4QUC A;  1K1Q A;  1XNQ H;  5EPK A;  2RSO A;  1SMY D;  1TVX A;  3TZU A;  3OW7 A;  1A0I A;  3GP7 A;  2NVX B;  4LF4 H;  4ECR A;  1YNJ D;  1KJJ A;  1RJP A;  4HCS A;  5LOV F;  3RIZ A;  4Q0Y A;  3CP0 A;  4DR1 Q;  1L0Y B;  1PH2 A;  4DAY A;  3PZP A;  2KCN A;  4CHT B;  4X65 Q;  3H0G A;  2C28 A;  3PUY A;  1D5Z C;  4GZY C;  3M4P A;  4PMB A;  4JI7 L;  3ETJ A;  2JQO A;  1STE A;  5T1I A;  4BY1 B;  3M9N B;  3K80 C;  3NK9 A;  3J7Z C;  3FRP B;  2JJQ A;  3RGZ A;  4A3C H;  1CZG A;  1SEB D;  4ZCK A;  1O75 A;  2RDJ A;  3KJP A;  2AUK A;  3GTK A;  4B3R H;  1SMX A;  2A73 B;  4U7C A;  4JI3 L;  1Y8N B;  5LMN H;  4PV1 C;  2R92 B;  1PFN A;  1CQV A;  1WSC A;  1STY A;  5J2T F;  2OH2 A;  1CFM A;  4P74 A;  1SYC A;  3QZ8 A;  3CVZ A;  2QW7 A;  3J80 E;  3HOV B;  2YU9 H;  5DGB A;  3I70 A;  4Q8F A;  1CA6 A;  4YAK B;  3G71 A;  2NU9 B;  3Q22 A;  3RB4 A;  1FKA H;  5C44 G;  1IYU A;  5FLX c;  2IT1 A;  2VQF H;  4GKK Q;  1Y8P B;  2HHH L;  4QUF A;  2OCE A;  4RZR A;  2ZTE A;  1F9R A;  1VQA A;  5A35 A;  4LF6 Q;  2JYO A;  2BR0 A;  5DQH A;  4L5Q A;  4A3L G;  3NXW A;  5KG5 A;  1WCM B;  4HMI A;  2XCA A;  1TY2 A;  4DXF A;  3FMC A;  1BF4 A;  4BBR H;  2B2W C;  4JOI A;  1SLJ A;  4DUY L;  4FO2 A;  1UNS A;  5M3M G;  2KSW A;  2DJF C;  2D0O A;  2KVM A;  5LMU H;  2KQ3 A;  4KHZ A;  1E0B A;  4NPS A;  1O7I A;  3ETH A;  2BA1 A;  3H3V H;  5IYB H;  2ZXR A;  3H0G H;  4JBW A;  3W1G A;  1DIK A;  1DV1 A;  4JV0 A;  4YP3 A;  4IUP A;  3KHR A;  5EZY F;  1O78 A;  4O2D A;  1EYD A;  5IT9 E;  3KBX A;  2QYZ A;  3GV3 A;  3OMG A;  3L9A X;  4DK1 A;  1TS4 A;  5JJK A;  1ZYR D;  3NWS A;  2XVS A;  1ET9 A;  4O0A A;  5FKA C;  3E0J A;  3LWU A;  1SFO B;  1SDF A;  2A5H A;  1RDP D;  1YJW A;  3OWF A;  5FLX W;  3MFI A;  2I46 A;  4DU9 A;  4KHV A;  2PI2 A;  3KLS A;  2CQO A;  1YBY A;  5LA6 F;  2Z9H A;  3J80 L;  4EEY A;  1DJR D;  4Q44 A;  3KUP A;  5CV5 A;  3UDF A;  1VQC A;  2NVX A;  2VQD A;  1SSO A;  2RDF A;  2IX0 A;  2JXM B;  1H9M A;  2Z6K C;  3K81 C;  4HMJ A;  1OXT A;  1SE4 A;  2LY7 A;  2PCF B;  4ZRZ A;  4QWE A;  4HJA A;  3Q6S A;  1JLL B;  3A56 A;  4XX0 B;  4GKJ H;  3G6Y A;  4C1N K;  2XNA C;  1G91 A;  1RK6 A;  4X3S A;  3S15 H;  1W3S A;  3EPI A;  1TQO A;  2LMC B;  3T1H Q;  2UXB H;  4EQO A;  2WE6 A;  3GTP A;  2HCI A;  2UVR A;  5DEH A;  5KFB A;  4BS9 A;  2PBZ A;  5J22 A;  1I94 H;  3D6C A;  3RF2 A;  5C44 B;  4JI0 Q;  3WNZ A;  5JUM A;  5F2D A;  3MWE A;  5C4J H;  5AJ3 Q;  4DV7 Q;  3HOW G;  2PVP A;  5GQO A;  1ZEQ X;  1KAA A;  4WD3 A;  3NEM A;  1JJG A;  2ZDH A;  4KTA A;  2R92 A;  1D5X C;  3KAL A;  4ECY A;  3V96 A;  1F9S A;  5C0X J;  4APV A;  1HNZ H;  2E2I B;  2I8C A;  5IT9 L;  3T4A C;  3D6W A;  1SN8 A;  3A55 A;  3V4Z A;  4J8Q A;  1TR5 A;  3T1Y H;  1I5F A;  4LF9 L;  1AFP A;  5M3M B;  1HRJ A;  1JOR A;  1V1P B;  1V51 A;  2B3G A;  4V19 0;  2QIL A;  1MZB A;  4JI5 Q;  1UNN C;  3HXL A;  1HPC A;  4FF2 A;  4XIG S;  3I4N H;  4F8M A;  1CS0 A;  1BKB A;  5E3F A;  2L12 A;  3S17 H;  4KHP L;  2SCU B;  2YCH A;  4N8X 1;  5LMN W;  3PIP A;  2NUA B;  2RHQ B;  5DM6 3;  1IXR A;  5FO8 B;  4LH6 A;  2HDL A;  3QOJ A;  3E5S A;  4I7A A;  1ENA A;  2NVX H;  1WFQ A;  3STB D;  5CV7 A;  4YHH L;  1GHJ A;  1IW7 D;  5JEA G;  2AGQ A;  2CCZ A;  2E5L Q;  2HT1 A;  4FBT A;  1CM9 A;  4RNO A;  2JEA I;  1STG A;  4MNO A;  2P0A A;  4CDD C;  1Q1B A;  4J9N A;  4J6H A;  1VQN A;  4O3Q A;  1SNP A;  4BY1 H;  1AEX A;  1K3B C;  4R4I A;  4IR9 A;  2F3W A;  2IHF A;  3TP8 A;  3GTP H;  1UC9 A;  2PZT A;  4JK1 C;  3K58 A;  2W6M A;  4K0K Q;  4CDC C;  1LTA D;  1XMQ H;  4HYK A;  2NYZ D;  2LXK A;  3AFQ A;  2BQU A;  1KDA A;  1BDO A;  1PHJ A;  3MXG A;  4JI8 H;  4GN5 A;  4M8A A;  4A93 H;  5HGQ A;  1SFO A;  4DUZ H;  2HCC A;  3PVX A;  1N9W A;  2B2Y C;  4A3E H;  1HQM C;  1N34 H;  2ASJ A;  2EIF A;  5D65 A;  1VCI A;  2N49 A;  4E6I A;  4Y7N B;  1FNU A;  4DV4 L;  2K5Q A;  2EZV A;  2JEI A;  3K7U C;  5IGE A;  2L55 A;  3TS2 A;  1YIJ A;  3HRZ C;  2FE3 A;  1Q1E A;  5C5M A;  3HOV H;  4R8U B;  3RB3 A;  1VS0 A;  3R93 A;  4YHH Q;  2R8J A;  5D14 A;  3U9S A;  5DG8 A;  2AQ2 B;  1UC8 A;  2EY2 A;  3MXN B;  4DV3 L;  1IYV A;  4PZ7 A;  3T5J A;  4ED1 A;  2R93 A;  4C3I G;  2XRS D;  1AN7 A;  4LF5 L;  2O5J C;  2A68 C;  3CD6 A;  3AFP A;  4AYB G;  2EYO A;  3HOW B;  1KJ9 A;  4JI2 H;  2WB1 E;  3JRX A;  3M9B A;  4IUN A;  4HNT A;  2E2H A;  1TT2 A;  4DR7 H;  3M3Y H;  2E8G A;  2H4O A;  4J9O A;  1KLU D;  1EUJ A;  1KRT A;  1I6H H;  1CK1 A;  3MR3 A;  4NLG A;  2SDF A;  3CRK C;  5KNC A;  1VQ9 A;  3RV4 A;  2F4V L;  4S3S A;  1RIP A;  5IGB A;  1EY5 A;  1IYJ B;  1ZKO A;  2CHB D;  3RGX A;  4UY8 C;  1EQV A;  4I55 F;  1Q12 A;  2QEJ C;  2XTI A;  3DEP A;  3U9O A;  1YJ9 A;  2FMA A;  3AU7 A;  5M9O A;  4QF4 A;  3WOF A;  4G3I A;  1GO3 E;  1H9S A;  2DNC A;  3VYS A;  3FPU B;  2WII B;  2K5N A;  5IGF A;  3U58 A;  3LWB A;  3ND9 A;  1IBL H;  2IX1 A;  3BAB A;  1EYA A;  1TAE A;  4KKU A;  1OXU A;  2Z6K A;  4O4L F;  4CKB A;  3CMA A;  4LF5 Q;  3GTG B;  3NWT A;  1C4Q A;  1EQQ A;  1SFO H;  2YZG A;  1R4P B;  2TSS A;  3RZD B;  4ZK9 B;  4F4W A;  4ZHQ F;  1I3Q H;  3J7A V;  1DM0 B;  4R4Q A;  5NUC A;  1VQP A;  4B3T Q;  2O5I C;  1AE3 A;  2G5D A;  1VQF A;  3E0E A;  1NJI C;  2FIN B;  5CBE E;  1K8M A;  3CCJ A;  2UU9 L;  5KG6 A;  3G6X A;  1YI2 A;  3BQ2 A;  4FS2 A;  1UUP A;  2KEC A;  4KY7 A;  1GUN A;  1SND A;  1N36 Q;  2UUB L;  5EDW A;  2L11 A;  1SYE A;  3P1H A;  4P75 A;  1QNK A;  5GAG C;  2ZJQ A;  3F8T A;  2V4D A;  1PH3 A;  2R93 H;  1VQH A;  2BH8 A;  2FJZ A;  3SE0 A;  3DWQ A;  3DLL A;  2E2H H;  1HNX L;  3J7A 5;  2V4Q A;  4X64 H;  3N43 B;  2HUG A;  5DGA A;  3U9T A;  1IBM Q;  1B3A A;  1EZ8 A;  1CUK A;  3HFZ B;  3HBL A;  3Q2O A;  4RAY A;  3MWD A;  2C2R A;  3RD4 A;  4LFC H;  1T9H A;  1P16 A;  3HB9 A;  1IBK Q;  2QGQ A;  2VQE L;  2J9G A;  4GN3 B;  4C3I B;  2K5H A;  2QK4 A;  3PGZ A;  4AYB B;  4HIO A;  5EWE A;  2X0S A;  4X66 Q;  3GTM H;  1J5E Q;  3AYH B;  4UP9 A;  2UXC H;  3QR8 A;  2I5M X;  5GAH C;  1ICF B;  4CJ0 B;  5IP7 G;  3S14 H;  2F0H A;  1SXT A;  1K83 H;  5CC4 A;  1QIL A;  1QJO A;  4U67 3;  1EYZ A;  5BN5 A;  2L9H A;  2V59 A;  1SYD A;  2I07 B;  3MXN A;  1B3Q A;  1ASY A;  3S9W A;  2IBK A;  5JVD F;  1MIU A;  2SOB A;  3C46 A;  3HOZ H;  5E1F A;  1S72 A;  1AZP A;  1LO5 D;  4TVA B;  3PUW A;  2GPW A;  4EYH B;  4EBC A;  1CHP D;  4AYB E;  4F4Y A;  5IYZ F;  3L7Z C;  5BR8 Q;  2R6G A;  1A63 A;  1VQL A;  2FXQ A;  4DV1 L;  1A62 A;  3VMM A;  2YTV A;  4IPG A;  3V6K A;  4EFB A;  3ERQ A;  5H1S E;  3R2I A;  1K0S A;  4O4I F;  5KFF A;  1EY4 A;  4KKT A;  2A8V A;  1CKN B;  1R4Q B;  3KHG A;  1C8C A;  4YCU A;  3MR2 A;  2YV5 A;  4ZYS A;  4CJ2 C;  5JAV A;  2IWH A;  4YWM A;  1PV4 A;  4HJ7 A;  5KT6 A;  1I6U A;  2PO4 A;  1MJE A;  1XTD A;  2VY3 A;  3ONA B;  4DV6 H;  1HA6 A;  4LAA A;  4L5S A;  3N6X A;  1E4F T;  2HQL A;  2H5X A;  2H1E A;  1KQS A;  1X32 A;  2JA7 H;  3GTG A;  4ED0 A;  4KY5 A;  4LUO A;  3I12 A;  2G9D A;  2RKS A;  1TS3 A;  3PUV A;  2BQ3 A;  1B53 A;  1R9T B;  4HNU A;  3F2U A;  1ESR A;  2K6A A;  2F4I A;  3R8B A;  4DV1 Q;  1A6X A;  4DR5 H;  1X54 A;  1BNC A;  5IP9 G;  4H7B A;  1VQ8 A;  4A3I G;  1SE3 A;  2JA6 G;  4DV0 H;  1LTL A;  1HNW L;  2O2L D;  4LFB L;  4JCV E;  1E4E B;  5C5J A;  1A2U A;  4ECZ A;  3H4B A;  4EBE A;  1RK5 A;  3T5K A;  3OW2 A;  3HOW H;  2IHE A;  1C3O A;  4N9P A;  3GIM A;  3TS0 A;  1L1O B;  4R9W A;  1B04 A;  3J81 i;  4CJ1 B;  3EIV A;  2BQR A;  4QMG A;  2EJG C;  2QA4 A;  3NGD A;  2HVR A;  5BN3 A;  4FDB A;  1FD7 D;  2AKW B;  1HXY D;  3SK8 A;  1SRU A;  2HD3 A;  3MHB A;  4HJ9 A;  4JYA H;  4AQY L;  3IFD A;  5JVH 3;  3FEW X;  4XYQ A;  4H13 C;  4DR2 H;  5HGT A;  3J7A K;  1L2F A;  1U4M A;  1VQ5 A;  4DV2 H;  4F4X A;  2XGP A;  1HFN A;  3UI2 A;  2Z0S A;  2L5T A;  4L5T A;  5ELD A;  4YCV A;  5J2U F;  5KT4 A;  4RHR A;  5EPL A;  1JCK B;  2OEO A;  3R3O A;  4JBM A;  2XN9 C;  3T5H A;  4EGV A;  1JDB B;  2R7D A;  3A54 A;  4ULL A;  4DR6 Q;  4OEL B;  1RJQ A;  3K5N A;  3OHX C;  5G3L D;  1BCP C;  5ELE A;  1GSA A;  1S03 G;  1B9M A;  3MXU A;  1D7Q A;  5C1O A;  4RGM A;  1T5E A;  2XGT A;  2F0J A;  1CSP A;  1PFB A;  4KJN A;  2B2U A;  3K0Y A;  3BVG A;  1PFM A;  1GLV A;  3FKI A;  1FJG H;  5FLX E;  2D2C C;  3RZO H;  4J9Q A;  3CQZ H;  4A3J G;  4X3K A;  3E6Z X;  4ID6 A;  1HR0 L;  5KG2 A;  4JI6 H;  4B3S L;  4Q8E A;  2Y0S E;  3HS0 C;  3CXC A;  1X56 A;  5I2X A;  3DHQ A;  4EQN A;  1SAP A;  4L63 B;  3QFF A;  5KFV A;  2IA6 A;  5FD6 A;  1Y14 B;  2ICI A;  3VYT A;  4ED7 A;  1PH9 A;  2DY7 A;  3H3V C;  1GGO A;  2AQ3 B;  2Q2U A;  3D0F A;  2PN1 A;  2R7L A;  3S1N B;  1JXL A;  2RGR A;  5M5Y H;  2XD4 A;  4YJ3 F;  1F2M A;  1B1Z A;  1Z2P X;  1Q86 C;  2W6Q A;  4A3I B;  1K8G A;  2JA6 B;  1O7L A;  2VS1 A;  4ZAI A;  4POF A;  2IL8 A;  4YY3 Q;  4QW9 A;  1A8V A;  4C3I H;  1Y69 U;  1BBW A;  1AN8 A;  1RHP A;  4J9R A;  4QIW A;  3G6V A;  3IL8 A;  2R7K A;  1R9T A;  1DOM A;  1QG7 A;  2NUC A;  3HG9 A;  2L15 A;  5IIF A;  1KLG D;  4IPD A;  4LFA H;  1YJN A;  1N33 L;  4IJL A;  1BJT A;  4RCN A;  1QUQ B;  5LL6 S;  2MUY A;  4HIK A;  1ASZ A;  4C5B A;  4LK1 C;  2LXJ A;  4CKE A;  3A5U A;  1H95 A;  1CZW A;  2VB3 X;  3OTO Q;  1PVO A;  1E1O A;  4RH6 A;  4ED3 A;  5IOD A;  2HQE A;  3B6Y A;  4TSS A;  1EFW A;  1BXT A;  3M4Q A;  3FKI H;  4B9W A;  1XMO Q;  1L1O A;  2OQ0 A;  1PH7 A;  3UFX B;  1BQQ T;  2NWG A;  1XPR A;  3A8K E;  5C0X H;  3NSW A;  2NU6 B;  1BCP D;  1C48 A;  2Z4I A;  2ZJP A;  4HR7 B;  2F03 A;  2VA3 A;  1JB3 A;  2B2V C;  1GKH A;  4JOI C;  5COY A;  2ZM6 L;  3MR5 A;  5IWA H;  1ZET A;  4POG A;  2ENB A;  2F0K A;  1LV9 A;  3W1B A;  5I4D A;  2M2L A;  1G6Z A;  3D3R A;  4G57 A;  4A3M H;  1M4V A;  3VA5 A;  3QO2 A;  3NPP A;  3ULP A;  4OX9 L;  5IOC A;  5IYD G;  2I80 A;  1PTO C;  3DM1 A;  4HN7 A;  4A3J B;  4ZI7 F;  4DN4 M;  1PK8 A;  3D8G A;  4JV5 H;  4NXM H;  3I55 A;  2UXD H;  1NCV A;  3UDI A;  1JOO A;  3Q8S B;  2KHJ A;  3KTM A;  3EFX D;  1U5K A;  2EYH A;  1LYL A;  1QCB D;  1R9T H;  2A1A A;  4MV8 A;  1K28 A;  2WKC A;  1STN A;  4X62 L;  3ICE A;  3CHB D;  2YZN A;  1MSG A;  3RUP A;  4JI4 L;  4HQ6 A;  1A3U A;  4A75 A;  3PR5 B;  3AB9 A;  1KAB A;  1I50 H;  2MPM A;  3MFY A;  2F0L A;  1GJX A;  4LF7 H;  4EGJ A;  3RLO A;  1YEZ A;  2F0N A;  2IW3 A;  3RJ0 A;  4O2A F;  4PWQ A;  2ZTD A;  5IYC G;  3EQL C;  1TWA B;  4B08 A;  1FNV A;  1I4H A;  1D5M C;  3D4D A;  1Y1V G;  4OX9 Q;  4DR1 L;  1RTN A;  2YTX A;  3OIQ A;  4LF8 Q;  4RNM A;  2B2T C;  3Q8R B;  4EYI B;  5GRO A;  2F0T A;  5DLF A;  2V9W A;  4X65 L;  2NVT H;  1V4Y A;  4FVM A;  1TS2 A;  3WWV A;  1XPO A;  2O03 A;  3R5F A;  3RMH A;  5HBR B;  4HED A;  4JI1 H;  1MSH A;  1H9J A;  4LF4 Q;  1AW7 A;  4A3K G;  4UDU C;  2JA6 A;  2F0E A;  4O3P A;  1XNR H;  1UWV A;  4ZUJ A;  2E2J B;  2ZJT A;  2E74 C;  1VQE A;  1M90 C;  2KUM A;  2NVY B;  3MZ5 A;  3T5L A;  1HZA A;  1JJC B;  3HKS A;  2D5D A;  1SE2 A;  2DPJ A;  2R7Z H;  1IOV A;  3NEL A;  4ZKB B;  1QUQ A;  1K9M C;  1K8A C;  4TV9 F;  5C1P A;  3BQ0 A;  2R85 A;  4TQU S;  2JK8 A;  3BVM A;  3VYR A;  3PW2 A;  1E1T A;  4DR4 H;  4B3R Q;  4RHS A;  1KDC A;  3OMC A;  4IWY A;  4I7Z C;  4GKK L;  5LMN Q;  4C2M B;  3R2T A;  3RLN A;  3K59 A;  2W6Z A;  4UP7 A;  4RKB A;  1CKM A;  5A2Q E;  3CRL C;  2W7P A;  4LF6 L;  1FGB D;  3S16 B;  4KI0 A;  4K6L A;  5LL6 b;  1F2Z A;  1GUW A;  2MQH A;  1JC7 A;  5L9X A;  3TRZ A;  1KC7 A;  1FR3 A;  1X3P A;  3N52 A;  1TWH B;  5KFA A;  3KAJ A;  4M1U B;  2VQF Q;  1DON A;  3S1M H;  1LTS D;  5EBD A;  3TQ1 A;  1SCU B;  4OEM B;  4C3H G;  1LTB D;  3OSO A;  3PR4 A;  1YVC A;  3M4O B;  1F9P A;  5EBC A;  4N8F A;  3KF8 B;  4ETS A;  3GDE A;  2CW7 A;  2W70 A;  5KKN B;  5I47 A;  3V2T A;  5FK9 C;  3S1N H;  4U6P A;  2GN5 A;  4P71 A;  5IP9 H;  4MHE A;  2K03 A;  5LMU Q;  2JA6 H;  4TQS A;  2UUC H;  1HZ9 A;  4G4K A;  4RAZ A;  4C5A A;  3JAM i;  5EJW A;  4HTH A;  4OHJ A;  1WD1 A;  4YR0 A;  3A0J A;  2DUD A;  5LXT F;  1RJR A;  2GVB A;  4GS3 A;  5HV6 A;  1V43 A;  4EQP A;  1Y1V B;  4OGQ C;  5C3X A;  1DGS A;  5COR A;  1WTH A;  4A76 A;  2M00 A;  3PV0 A;  1AP0 A;  2B2V A;  2KOL A;  1L2Z A;  2W6P A;  4A3D G;  2K5W A;  4A3K B;  5KFP A;  2C22 A;  1X3F A;  2WYO A;  3TSS A;  3S2H B;  2B39 A;  4HSV A;  3CW2 C;  1JIC A;  4G7O C;  4UPA A;  5EWF A;  3KYH C;  3A8J E;  4FXK C;  1EIG A;  2W57 A;  2RDH A;  3P7J A;  4RZQ A;  4H02 A;  5K2M A;  3MJF A;  3K6O A;  3GTK H;  3T1H L;  2AU0 A;  4GLX A;  4AIM A;  1I6V C;  1YNN C;  4JI0 L;  2JEG A;  1SJE D;  4JI7 H;  4IUU A;  5AJ3 L;  4DV7 L;  1HTP A;  2QKI C;  4C3J G;  2NVY A;  1Y1W G;  5KFC A;  4GKJ Q;  3FDS A;  4GOP B;  4P2C B;  3IG0 A;  1CSQ A;  4UCU A;  3G8C A;  2RCN A;  4FF1 A;  4IPH A;  4A3J H;  1VQD A;  2VZA A;  4ED2 A;  4YQW A;  1SNM A;  3HKZ E;  5L1J A;  1I94 Q;  4NP5 A;  2F0I A;  4JI3 H;  2WB1 G;  1PX2 A;  2YS6 A;  2JSO A;  2KHS A;  4QB4 A;  3M4I A;  4QWB A;  3I73 A;  4ECU A;  3KDF B;  3TEH B;  2B2T A;  4R4O A;  5E4W C;  1LT5 D;  2AQ4 A;  1PRT B;  4JI5 L;  4C2M A;  1EQT A;  1FVI A;  4C3H B;  3BDL A;  1QVF A;  1DXM A;  4F7X A;  1CE8 A;  3GIK A;  1UEA B;  3TP7 A;  4MV3 A;  1FNW A;  1PZK D;  2R7F A;  3P20 A;  4EQ5 A;  1HNZ Q;  3JAM c;  1U4L A;  3RAX A;  3T1Y Q;  3RR5 A;  1EEF D;  2HHH H;  1B50 A;  4F88 A;  4FF4 A;  1F2L A;  2UUA L;  1TWH A;  2JEB I;  3KOJ A;  2E5L L;  1X3Q A;  2ALZ A;  5M5X B;  3ITP A;  4JI8 L;  1MKH A;  4KJO A;  3TQT A;  1ILP A;  1PTO H;  1B33 N;  2CFM A;  5KYL A;  3PCO B;  4M9U A;  1EL0 A;  1FGU A;  2K52 A;  3GTJ B;  5ELC A;  4DUY H;  2F52 A;  3KF8 A;  1ENC A;  1O80 A;  4IN3 A;  3K3V A;  4XYM B;  4GN4 B;  4K0K L;  1TII D;  3I8Z A;  4A3D B;  4MV4 A;  2WFW A;  2CWA A;  2AQ1 B;  4KKS A;  1SNC A;  4CDF C;  2E2J H;  1S0N A;  2EXD A;  1EY7 A;  2GPS A;  2OTJ A;  4LWC A;  3TRE A;  4K5X A;  2Q2H A;  4KLK A;  3GIP A;  4O2B F;  5KG7 A;  2K04 A;  2AGO A;  4MIU A;  5FLM G;  3RN5 A;  4RB3 C;  1WCM A;  4ECT A;  1XYI A;  3PIP 3;  1HZC A;  2VL6 A;  1BGW A;  1GUG A;  2JN4 A;  2HGS A;  1LM0 A;  1XMQ Q;  2UUA Q;  1A15 A;  3BS1 A;  3GO5 A;  1QE6 A;  1E22 A;  4JI8 Q;  3NTK A;  4V0B A;  3Q8D A;  3MEF A;  3JAM W;  2CW0 C;  4DUZ Q;  1F9Q A;  1VQ7 A;  3M9O B;  3GV6 A;  1H9K A;  1XX8 A;  1N34 Q;  5FPR A;  3TP5 A;  4EVO A;  1D1I A;  1KJ8 A;  3J80 i;  3M9M B;  4C3J B;  1Y1W B;  4CDE C;  1A2T A;  2PW7 A;  3S16 H;  4OXP A;  4IJH A;  5LYJ F;  2K05 A;  5IYD H;  3M4Y A;  1KXL A;  3H09 A;  5CGK A;  1Z9F A;  5C4H A;  1W6K A;  2X69 A;  2WB1 B;  1G2T A;  2R82 A;  2XCP A;  1KNA A;  1PYW D;  3MR6 A;  4JI2 Q;  2R92 H;  5KRU A;  4B3M L;  4FP5 D;  4QGU A;  5EWG A;  3SI8 A;  3J7A F;  3K5M A;  4DR7 Q;  1M0T A;  4J0M A;  5C6A A;  4F4Z A;  2QF7 A;  3NE5 B;  1WYD A;  4PQX A;  2A19 A;  4RGT A;  3DXJ C;  1BVS A;  2F0S A;  1EIH A;  1U4R A;  1YIT A;  5IGD A;  2ATL A;  4BA2 I;  3KDF A;  2I5H A;  3FHW A;  5KFS A;  3JSL A;  2MP1 A;  4O1N A;  4EBD A;  4WRD A;  2BOS A;  5JVL A;  1EZ6 A;  1WCM H;  1IBL Q;  4B3T L;  2SEB D;  4A3G G;  1TWG B;  4LF9 H;  3BZK A;  2IJ0 A;  4RKL A;  3I4M G;  3MXP A;  1N36 L;  1L0X B;  1NR4 A;  4BWG B;  5BMV F;  1GUT A;  2UVU A;  3QOL A;  2VW9 A;  4A3K H;  1G6P A;  3S2H H;  2VOB A;  4B3M Q;  1CQF A;  4KHP H;  1B4O A;  1JB7 A;  5J39 A;  2KCC A;  3MWY W;  4OON A;  4K5V A;  4J1M A;  4IPC A;  3RN2 A;  5CV9 A;  2UXB Q;  4RFB A;  1DV2 A;  5GON F;  1WTP A;  3GTJ A;  4ECV A;  2R84 A;  2PZU A;  1RF2 D;  1IBM L;  2E2I A;  4YHH H;  4IWX A;  1VQI A;  2VNU D;  5KFX A;  1HFG A;  5HUR A;  4RNN A;  2B8G A;  3KFU A;  4J9P A;  1V1P A;  3EPG A;  1XPU A;  2F1M A;  2ZTC A;  1IBK L;  1KEE A;  3JSN A;  2LSS A;  3J80 c;  1KDB A;  2NZO A;  4X64 Q;  4X66 L;  4LJZ C;  1VF7 A;  1J5E L;  3GTQ B;  5EKL A;  3J81 E;  1EHI A;  4XTC S;  5G3L F;  4YCW A;  1LTT D;  5LP6 F;  3L2P A;  4C56 C;  2OF1 A;  4NXN H;  1WOC A;  1C0A A;  3RBE A;  2MO0 A;  2CZG A;  2KHI A;  3SDZ A;  2RF4 A;  3W3A A;  2CVR A;  5EAY A;  1STB A;  5KND A;  4ILW A;  3NEN A;  3Q23 A;  3CCE A;  4IUV A;  3KXY T;  3PW5 A;  1MBY A;  2L4N A;  4R1J A;  1NMF A;  4DV4 H;  4ECW A;  1DCZ A;  2EVB A;  3TQY A;  3S2D B;  3OSN A;  5IE8 A;  1Y8O B;  4C3H H;  3K5L A;  5FJ8 G;  1IL8 A;  2UXC Q;  4FXG C;  3KLR A;  1QNU A;  2A69 C;  2B2U C;  2C2D A;  1Y1W A;  2PMZ E;  3E9H A;  2JA8 G;  4DV3 H;  5F9L A;  5BR8 L;  5JPN C;  1B6R A;  4BBS G;  3BA8 A;  2I5L X;  2A68 D;  3P75 A;  2IPK D;  3A74 A;  4QJF A;  4DV6 L;  5C44 H;  4LF5 H;  3MEH A;  3PO2 B;  2FP4 B;  4OWW B;  2FFK B;  2KEN A;  4L5R C;  2WB1 A;  5IT9 c;  5GAE C;  1VBG A;  3E9I A;  3C1E A;  4BWS C;  3GTJ H;  4A3L H;  3J80 W;  3SVM A;  4DV5 H;  1ET6 A;  2E2I H;  3I7F A;  2F4V H;  4A3G B;  4R8U A;  4N9T A;  1CA5 A;  1WTR A;  1TWC B;  3AQQ A;  3WOE A;  4A3F G;  3I4M B;  4MA0 A;  2NN6 G;  5M3M H;  5BN4 A;  5L1K A;  1OTC A;  5KT3 A;  3CCQ A;  4A3D H;  4PDB A;  3HOU G;  4B9X A;  4IOA A;  3VPC A;  4Q5V A;  1JWU D;  1TA8 A;  4BY7 G;  2C9O A;  2WKD A;  1EUC B;  4IUR A;  4RB2 C;  3VA7 A;  2J7Z A;  2Y0S G;  5IGC A;  3AMU A;  4NMZ A;  5KG1 A;  2DY8 A;  3X3N A;  3J81 L;  3T16 A;  4OO1 G;  4ECS A;  1TWG A;  4DV6 Q;  1OO9 B;  2YW2 A;  2LFN A;  1BOS A;  3TN2 A;  3U50 C;  5FPO A;  4DAM A;  2QCP X;  2BE5 C;  2K50 A;  4K5W A;  1F77 A;  4I65 A;  2UU9 H;  1MGS A;  1BCP F;  2B63 B;  2UUB H;  3BYY B;  1WTW A;  3PMF A;  1L1O C;  4DR5 Q;  5IT9 W;  1HHV A;  2VUG A;  4IFD G;  5CV6 A;  5DLQ E;  4MTN A;  4DV0 Q;  1HNX H;  3SK5 A;  1D2B A;  1B70 B;  3C0F B;  5KFI A;  5KFG A;  4Y52 H;  2HVQ A;  1JMC A;  1EWH A;  2A69 D;  4DR3 L;  1RJT A;  1YHQ A;  2CW8 A;  3NBH B;  4C5C A;  4J9M A;  4LMY A;  4Y7N H;  1MD2 D;  2BA0 A;  2K5D A;  1PFS A;  1ZHQ A;  2YYZ A;  2JA8 B;  2EYF A;  2F0Q A;  1GUS A;  4UCR A;  3T51 B;  4BBS B;  2VQE H;  4DR6 L;  4JYA Q;  2YRW A;  3MWM A;  3RB0 A;  2IY5 B;  2ZXP A;  1K0R A;  4Q0F A;  2WIN B;  1CKO A;  1EWC A;  4XYO A;  4HJ5 A;  2NVQ B;  5KFM A;  2FB9 A;  1N32 L;  4O42 A;  1SE8 A;  3C2P A;  4L1K A;  2RCF A;  1VQG A;  1TWG H;  4KMU C;  5KFU A;  2F3V A;  5KGU A;  1HUN A;  4ED6 A;  3WDN A;  3G6E A;  2NU7 B;  4A3F B;  1EYG A;  1EY0 A;  5ELF A;  4DR3 Q;  1HCZ A;  1VQK A;  3HOU B;  2RGV A;  3SK6 A;  3ER0 A;  3CCM A;  3CC2 A;  4BY7 B;  3PIO A;  5KT7 A;  1A3V A;  4AYB A;  1WJJ A;  1FJG Q;  1PH5 A;  3D31 A;  2ICE C;  1QZG A;  4DV1 H;  1PA6 A;  4E4T A;  3HOX G;  4FU0 A;  4PZ8 A;  2Y0S B;  3L4K A;  3PF5 A;  5FLM H;  2XCL A;  3GD7 A;  3MTS A;  4BBR G;  4Z9C B;  2EY5 A;  4QWD A;  1UE1 A;  2DN8 A;  2NN6 I;  3GTG H;  1I7N A;  4YR2 A;  2VA2 A;  2TMP A;  5JEA H;  3GII A;  2ZT9 C;  4YY3 L;  5IYB G;  3RZD H;  3HOY G;  3RBD A;  1S10 A;  1EOT A;  1N32 Q;  3Q8Q B;  2SNM A;  4NDX A;  1T36 A;  1NBW A;  4DNR B;  1BO0 A;  2R8H A;  2EQS A;  1KAW A;  3GLK A;  4FM9 A;  4FS1 A;  2XWB B;  1X65 A;  1S5B D;  4A4I A;  4OO1 I;  4PG3 A;  1HH2 P;  2PYK A;  3CCL A;  1KD1 C;  2J0T D;  5C5L A;  2DNE A;  2DJG C;  1K3R A;  3I91 A;  1PH1 A;  1TWF B;  1PTO F;  1GVP A;  1CKN A;  3OTO L;  2FPP B;  2RQX A;  2W6O A;  3IN5 A;  3NP8 A;  2FK3 A;  3C1F A;  4GNX B;  2ASL A;  3T53 B;  3J81 j;  3UDX A;  1EZ1 A;  4QW8 A;  1XMO L;  4YJ2 F;  3ZJY C;  3DEO A;  1HNW H;  4LFB H;  4ZUI A;  1D1K A;  2AGP A;  4IFD I;  1OWT A;  1E2V A;  3BJU A;  4X3T A;  2Z6B A;  1EIF A;  3V4S A;  5C3E G;  3BU2 A;  5KG0 A;  3F1Z A;  3GV5 B;  2FPI B;  3NBH A;  2F0G A;  3AEV A;  2RDI A;  1SYG A;  3BDO A;  1SJH D;  4QWC A;  5LHY 1;  4AQY H;  3N42 B;  2WAQ E;  2GA4 B;  1RD9 D;  1PLF A;  2NBF A;  2VXW A;  4TQR A;  3EBE A;  1Q8I A;  1E4E A;  1A3T A;  2FK2 A;  2ATW A;  4A3B G;  1LAC A;  3WO0 A;  2W8L A;  1MI2 A;  4WJ3 M;  5IWA Q;  4APM A;  3V6J A;  4IAL A;  3MAQ A;  3H40 A;  3GQB A;  5CBA E;  2WDT A;  5FLX L;  3E5N A;  3MVV A;  3X3M A;  1DD2 A;  5D3D A;  3HOX B;  2PZW A;  4CC5 A;  5JPM C;  4BBR B;  1BBX C;  3BAA A;  1VMC A;  4JV5 Q;  4NXM Q;  5JH7 F;  1RYR A;  4DA2 A;  2UXD Q;  4YWL A;  3TII A;  2YRX A;  1SRO A;  2WV6 D;  5DNF A;  1EFI D;  1J6Q A;  4NKL A;  3HOY B;  4HID A;  4MV7 A;  4JBJ A;  5I2Y A;  1RTO A;  1X3E A;  4UAI A;  1T94 A;  3GQC A;  1V1O A;  1CQI B;  3VDY A;  4ECX A;  4DL4 A;  1HR0 H;  1EU3 A;  4B3S H;  5KFY A;  4LF8 L;  1LTG D;  4K8I A;  2Y0S A;  1CT1 D;  1SNO A;  4DF7 A;  1XNQ L;  2PQA B;  4X6A H;  1SMY C;  4LF4 L;  5FOB B;  4G7Z C;  4LF7 Q;  2K28 A;  3M7G A;  3TIG A;  1AH9 A;  3ULL A;  3PW0 A;  2AWO A;  1GHK A;  1Z7T A;  1YNJ C;  2PNH A;  1STA A;  1SR3 A;  1I4R A;  3S1R B;  5FJ8 H;  4IOC A;  2XIW A;  3L3O C;  2NTS A;  2EE1 A;  2Z4H A;  4IZ8 A;  4ALP A;  2YYA A;  5CB4 F;  1WTO A;  2I0Q A;  1NE3 A;  5CV8 A;  4JI1 Q;  4BBS H;  4BXX G;  2AUJ D;  3KJO A;  4MV1 A;  4DAV A;  4A93 G;  5EKK A;  1XNR Q;  1TWF A;  4A3E G;  5C3E B;  3ZYY X;  4B3R L;  2NVQ H;  4RUC A;  1EY9 A;  2DGY A;  3UE0 A;  1JX4 A;  1JE5 A;  1N33 H;  4GNX A;  2KJX A;  5LMN L;  1S3O A;  4ME3 A;  5I6Y A;  3I4O A;  1X9N A;  1XNQ Q;  5IP7 H;  2RSN A;  3S15 B;  1NSN S;  4PMC A;  2JA9 A;  4ODG A;  3EYY A;  1PYS B;  4MA5 A;  1EU4 A;  2NN6 H;  5C4Z A;  2ALY B;  1DYQ A;  2FHT A;  4MN3 A;  4DK3 C;  1Q8K A;  3HOU H;  4DR4 Q;  4A3B B;  5C4J B;  5CA0 F;  1X3G A;  2HIX A;  2VQF L;  5CYU A;  1KBL A;  1EEI D;  4NB3 A;  2KA7 A;  1SEI A;  2VUM G;  2OXP A;  3RTX A;  4DFA A;  5L1I A;  5LL6 X;  5JJZ A;  4G7H C;  3HKZ G;  2AMC B;  3S24 A;  4QL5 A;  4OO1 H;  2ZM6 H;  4XZ3 B;  1X6O A;  2Q8I B;  1Z2O X;  3KLW A;  1VQJ A;  4ZKC B;  2R8K A;  5LMU L;  1PH6 A;  5H80 A;  2NU8 B;  3KLS X;  1S97 A;  5D3I B;  1VQO A;  5KFN A;  1XXG A;  5D1O B;  4OX9 H;  1PTO D;  2VB2 X;  3S17 B;  4R7R A;  1J9O A;  2MFI A;  1QVG A;  5I9P A;  3OHA A;  2JA5 G;  2FKL A;  5JJL A;  3PW7 A;  1SNQ A;  3K0X A;  5AFW A;  2XC9 A;  2QDL A;  2E2D C;  4IFD H;  1GXD C;  2RHS B;  3I56 A;  4YIJ A;  4HR7 A;  3GIL A;  2UUC Q;  2AHO B;  1IZ6 A;  3H20 A;  4R4T A;  1SYB A;  3MC0 B;  3R23 A;  2R8I A;  1TWF H;  1KHI A;  3DM3 A;  1ULZ A;  1ZYR C;  5K36 G;  4X62 H;  2FLL A;  4IRD A;  4JI4 H;  2DLN A;  3Q0A A;  1Z47 A;  1FYC A;  2P5Z X;  1CHQ D;  1I4X A;  2PI2 E;  3HP3 A;  4J15 A;  3RAQ A;  3BYT B;  3TZD A;  3GTP B;  5KFL A;  4A3I H;  1HUM A;  1ZHS A;  3BJY A;  2PQA A;  2R93 G;  1B9N A;  5D1P A;  2EYL A;  4FXD A;  4A93 B;  4DR1 H;  3QWN A;  1VKZ A;  1KJI A;  4A3E B;  4KN4 C;  3OHB A;  2C00 A;  1SBB B;  2GVA A;  4X65 H;  1G29 1;  2K14 A;  1YHB A;  4O3N A;  1E3P A;  4CKC A;  2ASB A;  4UCS A;  1S4Z A;  2HIV A;  3KBG A;  3SXH A;  5J1Z A;  3VR6 A;  3ERS X;  1HR0 W;  2C2E A;  4DNI A;  4JV2 A;  4GKJ L;  4GLA C;  2W71 A;  4GOP C;  4IO9 A;  1V8Q A;  4IRC A;  3ORQ A;  4C1N I;  1FL0 A;  3CC4 A;  5JEA J;  3I72 A;  3RLF A;  1I94 L;  1TWA A;  4JI7 Q;  1QOH A;  2E75 C;  4ED8 A;  3Q1K A;  1VQ6 A;  4XQN A;  4JC0 A;  2CH4 A;  1PZJ D;  5E7N A;  5A2Q L;  3M3Y B;  2VUM B;  2G9H D;  4OIK A;  1PRT C;  1I6H B;  3HOX H;  4HIM A;  3HKZ B;  1C7Y A;  2V4R A;  2PQE A;  2EPB A;  1JOK A;  1HNZ L;  3DF7 A;  1VQ4 A;  3PO3 G;  2FLN A;  1PZI D;  4RCO A;  5KEE A;  4JI3 Q;  4GKK H;  3T1Y L;  3HOZ G;  1RYS A;  1E2Z A;  2WAC A;  5CAE B;  3HOY H;  1IKL A;  2C35 B;  4LF6 H;  2X6L A;  5K5P A;  2K1B A;  4WFN 3;  4DL6 A;  1IHZ A;  5JOB A;  4AH6 A;  2EY6 A;  2FMM A;  3NBI A;  1EYC A;  3N41 B;  3K5I A;  2JA5 B;  2RBM A;  1MJC A;  3OUZ A;  3W5O A;  1F2Y A;  4XT1 B;  3N40 P;  2HDM A;  1V1Q A;  1YZ6 A;  1T5X D;  2HHH Q;  5KT2 A;  5FD5 A;  3BG5 A;  2L0C A;  3STB C;  5CR3 A;  3VYU A;  1PDQ A;  1RKN A;  5IGG A;  5KFE A;  1IW7 C;  2EY1 A;  5D8D A;  1I3Q B;  1ENF A;  3H94 A;  5D1O A;  4K8J A;  1OXV A;  4DNT B;  3S1R H;  2EJF C;  4DUY Q;  3LWE A;  2F0U A;  5C4X G;  1QWY A;  1SYX B;  3SR1 A;  4IHJ F;  4MTE A;  1B44 D;  1RCV D;  2JA7 G;  4F50 A;  2J6T A;  2XSC A;  4NW2 A;  2R93 B;  1XMQ L;  4DXG A;  1LLR D;  3ERO A;  2L1B A;  1GM5 A;  1EIY B;  2E2H B;  5C3E H;  1TWA H;  3N6R A;  1STH A;  2E76 C;  4LSA A;  3UE1 A;  1VMP A;  1UE5 A;  2LS0 1;  3A7L A;  4DUZ L;  2WTF A;  1N34 L;  2NB0 A;  4IQZ A;  4TV8 F;  1S9F A;  3OWE B;  2AWN A;  2YS7 A;  2UVW A;  2K33 A;  1PXU A;  3FMA A;  4ABN A;  4DGZ A;  4L6T B;  3H6M A;  4DLK A;  1X55 A;  3QB3 A;  4EG0 A;  2JE6 I;  2CKZ B;  1XDN A;  4U68 A;  3IRB A;  4A3B H;  2JEF A;  3UDG A;  3I4L A;  1VDZ A;  2NVY H;  1PRT D;  3KK7 A;  5C8Y F;  1H9S B;  3GTM B;  2JP1 A;  2FJ2 A;  4JI2 L;  1Y1V A;  4CC6 A;  2F0P A;  3S14 B;  4K6D A;  3T1H H;  1K83 B;  3U4V A;  4DR7 L;  5C3W A;  1YNN D;  4JPB W;  5KNB A;  2CQY A;  4JI0 H;  2A6E C;  4RG1 A;  3K5O A;  3PO3 B;  2I87 A;  1PH4 A;  5T14 A;  4DV7 H;  3OIP A;  3HOZ B;  3OPO A;  4RMF A;  4C2M H;  1G2S A;  4XDX A;  3N44 B;  5FO9 B;  4JVZ A;  2OLS A;  2W9C B;  4O4H F;  4LSX A;  2VUM A;  1EWI A;  4XT3 B;  3URY A;  4DL3 A;  1TY0 A;  1IBL L;  4DAP A;  5CMD A;  3HKZ A;  2OT2 A;  3PSI A;  3SE7 A;  3IFT A;  3NHH A;  3OYY A;  3R5X A;  4IAJ A;  1Q7Y C;  1TWH H;  3IAY A;  3OOC A;  3HGB A;  1HJP A;  4OL7 A;  3BZC A;  3NQI A;  4JI5 H;  2W8K A;  3DUZ A;  4XQQ A;  1U0L A;  2EXZ A;  1ML0 D;  5ELB A;  3QIA A;  3M4O H;  2BCO A;  2ID0 A;  1B2T A;  4GOP A;  1I4P A;  2N3S A;  2VPQ A;  2UXB L;  3KAK A;  5KFD A;  4LF9 Q;  2JA5 A;  2F0W A;  3PUX A;  5C4X B;  4OWT B;  4ECQ A;  1Q90 A;  2CQA A;  2RA4 A;  3VR2 A;  3PO2 G;  2UUA H;  5DAU A;  1AZQ A;  4O3O A;  2E5L H;  5L1L A;  4GLV B;  3SHL A;  3CC7 A;  4BXX H;  2JA7 B;  2W9A A;  3ND8 A;  4PNY A;  4NXN L;  1KIX A;  2PPB C;  4IZO A;  3GV8 B;  4KHP Q;  3CME A;  1P8L A;  5IYC H;  1NMG A;  4YWK A;  1W96 A;  3RUZ A;  1Y1V H;  1I3Q A;  2F0V A;  2RVL A;  4IUQ A;  3CAM A;  4X64 L;  2B2W A;  1K1S A;  1HZB A;  1YHA A;  2FLP A;  2W9B B;  1V9P A;  2BDN A;  3R5H A;  4UHV A;  4ZOL F;  5EPJ A;  3HZX A;  1JKJ B;  4K0K H;  1TKW B;  2NZH A;  3EJI A;  3K7A B;  4CGY B;  4I4T F;  4LFC L;  2OQK A;  1JT8 A;  3GID A;  3C3L A;  3KF6 B;  2F0O A;  3A8I E;  1K73 C;  4EEQ A;  4QQB X;  1NAP A;  2EDG A;  3I90 A;  5ISR A;  2VUM H;  1KTK A;  4DKA C;  1LT6 D;  2UXC L;  2A6E D;  3EVQ A;  3NTH A;  2CW0 D;  4NXN Q;  5ELN A;  3SK4 A;  3SGI A;  4DV5 L;  2K4K A;  4IFD J;  4ZQI A;  1S40 A;  1EUD B;  4K2L A;  2V5A A;  4PZ6 A;  4XYL B;  2W6N A;  1EY8 A;  4KD3 A;  3VPB A;  4JG2 A;  4FBU A;  2Z1C A;  3GTL B;  4DK0 A;  3FKI G;  4DPG A;  4DV4 Q;  2B63 G;  3GV7 B;  2ZDQ A;  2PMZ B;  3CKI B;  3GTM A;  4RWS C;  5C0X G;  5DQI A;  3DMU A;  4R8I A;  1B6S A;  2CH4 W;  3MA2 B;  1JOQ A;  2JA5 H;  1QB5 D;  1M6V A;  4DV3 Q;  1OXX K;  4K14 A;  1K83 A;  5JVG 3;  4LFC Q;  2R87 A;  2DIK A;  1LT4 D;  4UCO A;  4B3M H;  2WP8 J;  5E4X A;  3FPP A;  2MJ8 A;  4H44 C;  5I6W A;  4HAE A;  2QDB A;  5K36 H;  4A3M G;  1G51 A;  1N56 A;  2MHV A;  3U4Z A;  2F3I A;  4O3R A;  3K5H A;  3RZO B;  2W9C A;  1MHW C;  3CQZ B;  1WH2 A;  1KJQ A;  4IRK A;  3A7A B;  4DV5 Q;  2F4V Q;  3EA6 A;  4LH7 A;  1ZXT A;  4LUV A;  3MFG A;  5KFT A;  5KYI A;  1A9X A;  4WOR A;  1KC8 C;  1VAJ A;  1W93 A;  1Q46 A;  2A74 C;  3LNN A;  4R4C A;  5M5X H;  5M5W B;  3OSP A;  1U4P A;  2X6G A;  4F87 A;  3F2D A;  4B3T H;  2Q8R E;  3EN2 A;  4Y8V B;  3CPF A;  2ZJR A;  2F0F A;  3NQT A;  3BQ1 A;  3CU7 A;  1N36 H;  1II3 A;  4LUZ A;  5KFH A;  2F0M A;  4X3U A;  4KK7 A;  2FPG B;  5M5Y B;  1M0W A;  4DR5 L;  3QJY A;  3L0O A;  4RA8 A;  2LKV A;  1JWM D;  2R6F A;  4DL5 A;  1WD0 A;  1JDE A;  2JA7 A;  4DV0 L;  1AE2 A;  1GOZ A;  2C5C A;  5M3F G;  1BNZ A;  2YL2 A;  4MZ9 A;  3JC6 6;  4YAJ B;  4RUA A;  2UU9 Q; 
#chains in the Genus database with same CATH homology
 3TRZ A;  3I2Z A;  2UUB Q;  3F1Z A;  2NVX H;  1WFQ A;  2VQF Q;  3STB D;  1N8R C;  1L0W A;  3S1M H;  3K8A A;  4YHH L;  3AEV A;  5JEA G;  2CCZ A;  2E5L Q;  2HT1 A;  2JEA I;  1YVC A;  4MNO A;  1HNX Q;  4WJ4 A;  2WAQ E;  1Q1B A;  3KF8 B;  3PO3 H;  3GDE A;  4JYA L;  3S1N H;  1VQN A;  3EBE A;  2GN5 A;  4P71 A;  5IP9 H;  2MNA A;  1GD7 A;  3KF6 A;  4R4I A;  4DR2 L;  5LMU Q;  4BY1 H;  2ATW A;  2JA6 H;  2IHF A;  1HZ9 A;  4WJ3 M;  5IWA Q;  4C3J H;  4DV2 L;  3JAM i;  1Y1W H;  3GTP H;  4K0K Q;  4BA1 I;  2N78 A;  2LXK A;  2DUD A;  3A0J A;  3AFQ A;  4DR3 L;  2OTL A;  2R7Z G;  1PHJ A;  2GVB A;  4GS3 A;  4GN5 A;  5IY0 A;  4A93 H;  1V43 A;  5HGQ A;  4UP8 A;  1N9W A;  2VQE Q;  4A3E H;  2K5V A;  1DGS A;  4A76 A;  2EIF A;  1VCI A;  3PV0 A;  2N49 A;  1E7Z A;  4NXM Q;  4JV5 Q;  4DV4 L;  3K7U C;  2OWO A;  2UXD Q;  4YWL A;  3TS2 A;  1SRO A;  1YIJ A;  1Q1E A;  1J6Q A;  4A3D G;  3HOV H;  1VS0 A;  2WAQ G;  2V1C C;  2MO1 A;  4JBJ A;  5C0X I;  1X3F A;  4YHH Q;  4HID A;  3HOY H;  1X3E A;  1FJG L;  3MXN B;  3CW2 C;  4DV3 L;  3VDY A;  4PZ7 A;  4A3C G;  4UPA A;  5JJI A;  5C4X H;  2UU9 Q;  3KYH C;  4LF8 L;  4LF5 L;  4JI6 L;  3CD6 A;  2N8N A;  3AFP A;  4AYB G;  1NY4 A;  2WB1 E;  3M9B A;  1XNQ L;  4LW1 A;  2PQA B;  4DR2 Q;  4X6A H;  2QEX A;  4H02 A;  4DV2 Q;  3M3Y H;  2E8G A;  4LF4 L;  4LF7 Q;  1EUJ A;  1KRT A;  1NTG A;  3GTK H;  3T1H L;  1I6H H;  4GLX A;  1AH9 A;  3ULL A;  5J3B A;  4AIM A;  2AWO A;  1VQ9 A;  2YTY A;  2PNH A;  2F4V L;  1RIP A;  1SR3 A;  4JI0 L;  1IYJ B;  5GAD C;  3G4S A;  5FJ8 H;  5AJ3 L;  4DV7 L;  4IOC A;  3K7A H;  4UY8 C;  1Q12 A;  2XTI A;  1YJ9 A;  1Y1W G;  4LFA L;  4ALP A;  4GKJ Q;  4GOP B;  2I0Q A;  1CSQ A;  1NE3 A;  1GO3 E;  2RCN A;  4JI1 Q;  4BBS H;  4BXX G;  4IPH A;  2K5N A;  3KJO A;  3U58 A;  1VQD A;  2VZA A;  4A3J H;  2IX1 A;  4A93 G;  1XNR Q;  4A3E G;  3HKZ E;  1I94 Q;  2WB1 G;  4QIW E;  1OXU A;  2Z6K A;  2NVQ H;  2DGY A;  3UE0 A;  4B3R L;  3CMA A;  1JE5 A;  3KDF B;  4GNX C;  4GNX A;  3TEH B;  5LMN L;  4R4O A;  4JI6 Q;  4LF5 Q;  1S3O A;  4ME3 A;  1X9N A;  3I4O A;  1SFO H;  4JI5 L;  5IP7 H;  1EQQ A;  2ES2 A;  2KCM A;  1FVI A;  1XNQ Q;  2Q2I A;  1QVF A;  2JA9 A;  1PYS B;  1I3Q H;  4DK6 C;  3CPW A;  2R7F A;  4R4Q A;  4EQ5 A;  4HJ8 A;  1VQP A;  4B3T Q;  1AE3 A;  3E0E A;  1VQF A;  2B29 A;  2ALY B;  3H0G G;  3JAM c;  3CCJ A;  1NJI C;  1HNZ Q;  2UU9 L;  4DK3 C;  1Q8K A;  1YI2 A;  4P72 A;  3GTL H;  3HOU H;  4DR4 Q;  3T1Y Q;  3RR5 A;  2UUB L;  1N36 Q;  1X3G A;  2HIX A;  2VQF L;  3GTQ H;  1EQR A;  4P75 A;  2UUA L;  2JEB I;  5GAG C;  3KOJ A;  3F8T A;  1PH3 A;  2ZJQ A;  4NB3 A;  2E5L L;  1HNW Q;  2R93 H;  1VQH A;  2BH8 A;  3PUZ A;  2VUM G;  4JI8 L;  4LFB Q;  1MKH A;  3DLL A;  2E2H H;  2CFM A;  2AMC B;  3HKZ G;  3S24 A;  4QL5 A;  3PCO B;  1HNX L;  3J7A 5;  1FGU A;  1OXS C;  2K52 A;  3PF4 A;  2F52 A;  1PYB A;  1UE7 A;  1X6O A;  1XJV A;  1E24 A;  3KLW A;  1VQJ A;  1IBM Q;  5LMU L;  1PH6 A;  3S2D H;  1CUK A;  5IWA L;  3HFZ B;  1QVC A;  4GN4 B;  4K0K L;  2WFW A;  1VQO A;  2CWA A;  4LFA Q;  1T9H A;  1P16 A;  2D0P A;  2E2J H;  3CCS A;  2MFI A;  2EXD A;  1QVG A;  2KCT A;  1IBK Q;  2QGQ A;  4AQY Q;  2OTJ A;  2JA5 G;  4LWC A;  3TRE A;  2VQE L;  5JJL A;  4GN3 B;  3PO2 H;  2K5H A;  2Q2H A;  4KLK A;  3K0X A;  1UE6 A;  3PGZ A;  4HIO A;  1YHQ A;  5FLM G;  4X66 Q;  3RN5 A;  4NXM L;  2RHS B;  3I56 A;  1J5E Q;  3GTM H;  3AYH B;  4UP9 A;  4JV5 L;  2UUC Q;  2AHO B;  1IZ6 A;  2I5M X;  4R4T A;  5M5W H;  1HZC A;  5GAH C;  2VL6 A;  2UXD L;  5IP7 G;  3S14 H;  1TWF H;  1LM0 A;  1XMQ Q;  2UUA Q;  1KHI A;  1K83 H;  3DM3 A;  3GO5 A;  5K36 G;  1E22 A;  4JI8 Q;  3H15 A;  3Q8D A;  1UEB A;  3MEF A;  4A3G H;  4DUZ Q;  2CWP A;  1B7Y B;  1VQ7 A;  1Z47 A;  1TWC H;  1ASY A;  3CF5 A;  1N34 Q;  3I4M H;  1MIU A;  3HOZ H;  1S72 A;  2PI2 E;  4J15 A;  3J80 i;  4TVA B;  1C9O A;  3PUW A;  4A3I H;  2KBN A;  2PQA A;  3S16 H;  2R93 G;  4OXP A;  4IJH A;  3J81 c;  4AYB E;  4LF7 L;  5IYD H;  3M85 A;  1KXL A;  1WI5 A;  3CCU A;  3L7Z C;  5BR8 Q;  3CCR A;  2R6G A;  1A63 A;  1Z9F A;  1VQL A;  2FXQ A;  4DV1 L;  1A62 A;  1HR0 Q;  1Q81 C;  2GVA A;  4B3S Q;  1G29 1;  2K14 A;  1YHB A;  2YTV A;  1E3P A;  4IPG A;  1M1K C;  2ASB A;  1TXY A;  2HIV A;  5H1S E;  4JI2 Q;  2R92 H;  3ERS X;  4P73 A;  1QZH A;  4B3M L;  3F2C A;  1HR0 W;  2A8V A;  1CKN B;  4DNI A;  4YCU A;  4QGU A;  1JJ2 A;  4GKJ L;  3G48 A;  4GLA C;  3GTO H;  4DR7 Q;  2YV5 A;  4EX5 A;  4JI1 L;  4OWX B;  4GOP C;  4IO9 A;  3I4N G;  4YWM A;  1PV4 A;  4HJ7 A;  4DAY B;  1WYD A;  1FL0 A;  1MJE A;  3CC4 A;  5JEA J;  1XNR L;  1XTD A;  3RLF A;  2VY3 A;  2A19 A;  1I94 L;  2B63 H;  3A5Z B;  1BVS A;  4L5S A;  4A3B G;  4JI7 Q;  2HQL A;  1YIT A;  2H5X A;  1PH8 A;  1KQS A;  1VQ6 A;  2JA7 H;  4BA2 I;  3FP9 A;  2I5H A;  3KDF A;  4JC0 A;  3FHW A;  5E7N A;  4LUO A;  3HOX H;  4HIM A;  1C7Y A;  3PUV A;  1WCM H;  1IBL Q;  4QY7 A;  4B3T L;  3H3V I;  4A3G G;  1HNZ L;  3BZK A;  1VQ4 A;  3PO3 G;  3M7N A;  3I4M G;  4JI3 Q;  1KRS A;  4DR4 L;  4DV1 Q;  3T1Y L;  1N36 L;  3HOZ G;  1X54 A;  3RNU A;  1N33 Q;  5IP9 G;  4BY1 G;  2VW9 A;  4A3K H;  1VQ8 A;  2C35 B;  4A3I G;  2Q2T A;  2JA6 G;  1G6P A;  3S2H H;  1LTL A;  4B3M Q;  1HNW L;  4LFB L;  4AH6 A;  1JB7 A;  1Q82 C;  4JCV E;  2JA8 H;  4OON A;  1LUZ A;  3S1Q H;  1D8L A;  5ELO A;  1VQB A;  4IPC A;  3RN2 A;  3OW2 A;  3HOW H;  2IHE A;  2UXB Q;  1MJC A;  1VQM A;  3W5O A;  3TS0 A;  1L1O B;  3J81 i;  1V1Q A;  1IBM L;  1YZ6 A;  2HHH Q;  2R92 G;  3EIV A;  1W2B A;  2QA4 A;  1VQI A;  2VNU D;  4FDB A;  2AKW B;  3STB C;  4JBK A;  1SRU A;  3KFU A;  3HOV G;  1XPU A;  2ZTC A;  1IBK L;  4HJ9 A;  4AQY L;  1OXV A;  2LSS A;  3J80 c;  3S1R H;  2NZO A;  4X64 Q;  4DUY Q;  1BBU A;  2ZM6 Q;  4A3F H;  5C4X G;  1B8A A;  1L2F A;  1VQ5 A;  2D62 A;  4X66 L;  3LGJ A;  1J5E L;  2Z0S A;  2UUC L;  4XTC S;  5M3F H;  4YCW A;  2JA7 G;  4L5T A;  3L2P A;  4YCV A;  4BY7 H;  4LNQ A;  1XMQ L;  4PMW A;  1WOC A;  3CCV A;  1C0A A;  1EOV A;  1GM5 A;  4JBM A;  2MO0 A;  1EIY B;  2KHI A;  2RF4 A;  5EAY A;  5C3E H;  2BH2 A;  1TWA H;  3F2B A;  2R7D A;  1WCM G;  5HY6 A;  4DR6 Q;  3UE1 A;  3NEN A;  1UE5 A;  4DUZ L;  3CCE A;  2K75 A;  4R1J A;  1N34 L;  1NMF A;  3TQY A;  2AWN A;  5IE8 A;  1D7Q A;  4C3H H;  5FJ8 G;  2UXC Q;  1KL9 A;  2XGT A;  3ULJ A;  1CSP A;  1RL2 A;  1X55 A;  2JE6 I;  2PMZ E;  3E9H A;  2CKZ B;  2JA8 G;  5BR8 L;  3RZO H;  4X62 Q;  3IRB A;  4BBS G;  3CQZ H;  2I5L X;  4A3J G;  4A3B H;  3A74 A;  1YNX A;  4QJF A;  4DV6 L;  5C44 H;  3UDG A;  1HR0 L;  4B3S L;  4JI4 Q;  4OWW B;  2Y0S E;  2NVY H;  2KEN A;  4L5R C;  3CXC A;  1X56 A;  4JI2 L;  1A0I A;  5IT9 c;  5GAE C;  3E9I A;  3U4V A;  4DR7 L;  1Y14 B;  3GTJ H;  4A3L H;  1PH9 A;  2E2I H;  3I7F A;  3CP0 A;  4DR1 Q;  2Q2U A;  4RG1 A;  1PH2 A;  1PH4 A;  3AQQ A;  4A3F G;  3D0F A;  2NN6 G;  5M3M H;  4X65 Q;  3PUY A;  4RMF A;  5M5Y H;  3M4P A;  3CCQ A;  1OTC A;  4JI7 L;  2JQO A;  4C2M H;  3HOU G;  4A3D H;  1Q86 C;  4IOA A;  3K80 C;  1K8G A;  4BY7 G;  2VS1 A;  4POF A;  4YY3 Q;  3J7Z C;  2JJQ A;  1A8V A;  4A3C H;  1EWI A;  3KJP A;  4C3I H;  1IBL L;  1BBW A;  2Y0S G;  1SMX A;  3PSI A;  3OYY A;  4JI3 L;  4OO1 G;  4DV6 Q;  1TWH H;  1Q7Y C;  1HJP A;  2L15 A;  3BZC A;  4IPD A;  1YJN A;  1N33 L;  4IJL A;  4HIK A;  1QUQ B;  1ASZ A;  1U0L A;  4P74 A;  2LXJ A;  3U50 C;  3A5U A;  1H95 A;  3M4O H;  4DAM A;  2YU9 H;  3OTO Q;  1PVO A;  1E1O A;  2ID0 A;  2K50 A;  4GOP A;  2N3S A;  3G71 A;  5C44 G;  2UXB L;  1EFW A;  3B6Y A;  5FLX c;  4LF9 Q;  2IT1 A;  3PUX A;  4OWT B;  4GKK Q;  3M4Q A;  1L1O C;  3FKI H;  4DR5 Q;  1L1O A;  2OQ0 A;  1XMO Q;  1PH7 A;  2OCE A;  2HHH L;  3PO2 G;  4GLV B;  2ZTE A;  3CC7 A;  1XPR A;  1VQA A;  4BXX H;  4IFD G;  4NXN L;  1KIX A;  5DLQ E;  4MTN A;  4LF6 Q;  4DV0 Q;  4KHP Q;  3CME A;  1P8L A;  5IYC H;  4L5Q A;  2ZJP A;  4A3L G;  1B70 B;  1NMG A;  4YWK A;  1Y1V H;  4Y52 H;  1JMC A;  3CAM A;  4X64 L;  4JOI C;  4BBR H;  1GKH A;  4JOI A;  1SLJ A;  2ZM6 L;  3NBH B;  4DUY L;  1HZB A;  1YHA A;  5M3M G;  2D0O A;  1V9P A;  4Y7N H;  4POG A;  3W1B A;  4KHZ A;  4NPS A;  2BA0 A;  1O7I A;  2NZH A;  2BA1 A;  3H3V H;  4A3M H;  5IYB H;  1PFS A;  3ULP A;  2YYZ A;  3H0G H;  2OQK A;  4JBW A;  4LFC L;  3W1G A;  4OX9 L;  1JT8 A;  5IYD G;  4DR6 L;  4JYA Q;  3KF6 B;  2IY5 B;  1K73 C;  1K0R A;  4QQB X;  4O2D A;  1CKO A;  3I55 A;  4HJ5 A;  3UDI A;  2VUM H;  4DKA C;  5JJK A;  2KHJ A;  2UXC L;  1N32 L;  1SE8 A;  1U5K A;  1FJG Q;  1LYL A;  4O0A A;  1R9T H;  2A1A A;  4NXN Q;  5ELN A;  1VQG A;  1TWG H;  3SGI A;  2K4K A;  4DV5 L;  4IFD J;  1S40 A;  4X62 L;  3ICE A;  1YJW A;  3G6E A;  4PZ6 A;  4JI4 L;  4A75 A;  1EYG A;  4JG2 A;  2PI2 A;  2CQO A;  1YBY A;  3FKI G;  1I50 H;  4DPG A;  4DV4 Q;  4DR3 Q;  1VQK A;  2B63 G;  3ER0 A;  3RLO A;  5C0X G;  1YEZ A;  3PIO A;  3CCM A;  3CC2 A;  3UDF A;  1VQC A;  2JA5 H;  1WJJ A;  2IX0 A;  2ZTD A;  3D31 A;  5IYC G;  1PH5 A;  4DV3 Q;  1OXX K;  1QZG A;  2Z6K C;  1PA6 A;  3K81 C;  1IL2 A;  3HOX G;  1OXT A;  1Y1V G;  4PZ8 A;  4DR1 L;  3PF5 A;  5FLM H;  2YTX A;  4LFC Q;  4LF8 Q;  4OX9 Q;  3GD7 A;  4BBR G;  5GRO A;  4HJA A;  4X65 L;  2NVT H;  2WP8 J;  3WWV A;  1XPO A;  1UE1 A;  2NN6 I;  3GTG H;  4YY3 L;  4A3M G;  5IYB G;  3RZD H;  1G51 A;  4LF4 Q;  1W3S A;  4A3K G;  3HOY G;  3S15 H;  1N32 Q;  3T1H Q;  3U4Z A;  2F3I A;  1NBW A;  1UWV A;  4DV5 Q;  1VQE A;  2EQS A;  1KAW A;  1M90 C;  4JI0 Q;  2F4V Q;  4LUV A;  1X65 A;  5C4J H;  5AJ3 Q;  4DV7 Q;  3HOW G;  5GQO A;  4A4I A;  4OO1 I;  4PG3 A;  1HH2 P;  1JJC B;  1HZA A;  3HKS A;  1KD1 C;  3CCL A;  3NEM A;  1KC8 C;  1JJG A;  1Q46 A;  4R4C A;  1K3R A;  5M5X H;  2R7Z H;  3NEL A;  1K9M C;  1QUQ A;  1K8A C;  3F2D A;  1PH1 A;  5C0X J;  3EN2 A;  4TQU S;  3CPF A;  1GVP A;  1CKN A;  2JK8 A;  4APV A;  3OTO L;  2ZJR A;  1E1T A;  1SN8 A;  4B3R Q;  1I5F A;  4GNX B;  4LF9 L;  4LUZ A;  3J81 j;  3UDX A;  4GKK L;  1XMO L;  4DR5 L;  5LMN Q;  3L0O A;  3ZJY C;  2B3G A;  3RLN A;  4JI5 Q;  4UP7 A;  1CKM A;  3I4N H;  4XIG S;  4LF6 L;  4DV0 L;  1AE2 A;  1BKB A;  5M3F G;  3S17 H;  4IFD I;  4KHP L;  5LMN W;  4MZ9 A;  4KI0 A;  3JC6 6;  3PIP A;  3BJU A;  2RHQ B;  1IXR A;  2MQH A;  1EIF A;  5C3E G;  3BU2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...