2R92G

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r92G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r92G01
2Z6KC 4A93H 1I50H 1BKBA 3S1RH 4HIDA 2YTYA 1V9PA 2Q2UA 3HOUH 5IT9c 3RZOH 4OONA 1FGUA 4NPSA 3TREA 3JAMc 3CCVA 1VQBA 1TWHH 5M5XH 4JI6Q 1A63A 3A74A 1PYSB 2Y0SG 4P73A 1XMQQ 5IWAQ 5C4XH 3TRZA 4DR7Q 4LW1A 4B3RL 4JI5L 3TEHB 1P16A 3SGIA 3CCLA 4POGA 5IYBH 3UDXA 3H0GG 1PHJA 1PH8A 1HZCA 2Y0SE 4JG2A 5GAHC 2A8VA 1NTGA 1E1OA 1UE6A 2BA1A 1HR0W 2NN6G 4DKAC 4C3JH 1S40A 2H5XA 3NBHB 1YHAA 4GKKQ 2Q2HA 4IJLA 3STBC 4IOCA 1SFOH 5GADC 4BXXG 3HOYG 2V1CC 2KENA 4LF9L 4P75A 3I56A 4B3ML 2I5HA 4A3FG 2ZTCA 3HOXH 4HJ9A 4DV3Q 4A93G 1HNWL 4LUVA 5IY0A 1V43A 4LUOA 3HOUG 1X3EA 1FVIA 2JA8H 3M9BA 4JI2Q 1NJIC 3CPWA 4DUZL 2K5VA 1PV4A 1N33Q 3I4NH 1OXTA 1LYLA 1VQFA 5C4XG 1UE7A 2NN6I 4DUYQ 2OQKA 3RN5A 2VQEL 3M4OH 2ATWA 3PGZA 4R4CA 4NXML 2N3SA 4X66Q 3KOJA 4JOIA 3K0XA 4OWWB 3ICEA 1RIPA 1BBUA 2UXCQ 4JBJA 3RNUA 1OXVA 1YBYA 2JA5G 4R4IA 3K7AH 5GQOA 2E2IH 1JJGA 2RHQB 4LFCL 4DV5Q 4DV7Q 1N36Q 3EBEA 2R7FA 1A62A 1GKHA 4AQYQ 2ID0A 1Q86C 3RN2A 1CSPA 2HHHL 1MJEA 4LFBQ 1KIXA 3KJPA 4JOIC 1Q8KA 4PZ7A 1NMFA 4DR5Q 2JA9A 2YV5A 1Y1WH 1KD1C 1N32L 3GD7A 5JJKA 1Q1BA 3ULJA 1DGSA 1KXLA 2KCMA 3L2PA 3NENA 3HOXG 1T9HA 1O7IA 2DGYA 3Q8DA 3ULLA 5AJ3Q 4GKKL 2R92H 4IPDA 1N9WA 1N8RC 2JA8G 5LMNW 1AH9A 1V1QA 4HJAA 3CQZH 2CCZA 3I4NG 1CKMA 4QQBX 3S16H 1TWFH 1X56A 4X62L 1KQSA 2K4KA 1VQ7A 1K8GA 2HHHQ 3PF5A 1SMXA 4B3TL 3GTJH 2BH8A 5JJIA 4UY8C 1LTLA 3ERSX 4JV5L 3M4PA 4MTNA 4QIWE 4JI2L 4POFA 3T1HL 3UDGA 2OCEA 4A3GH 5HY6A 1A0IA 3UDFA 1XJVA 4LWCA 3I4MH 3RZDH 2JJQA 1VS0A 1NY4A 3CAMA 3MXNB 2NZHA 2ASBA 2IX1A 4A3EH 3KYHC 3PIPA 4BY7H 4B3RQ 3CCMA 4AH6A 4JI5Q 4X66L 3CCEA 3L0OA 5ELNA 1Y1WG 4BA2I 1BVSA 1E22A 1EIYB 1QUQA 3W5OA 4Y52H 2HQLA 5LMUL 4DV5L 1VQ9A 1QZHA 1VQPA 2WB1G 1K73C 1OXUA 3BZKA 2D0PA 1VQIA 1KRTA 1HNXQ 1NBWA 3K7UC 1WFQA 3D31A 4HJ7A 4DR3Q 3OW2A 2NVTH 4GN3B 4LF9Q 3HKZG 2K52A 1CKOA 1N34L 3H3VI 4UP8A 2WB1E 2UU9Q 3CCSA 1XNRQ 1CKNB 1SE8A 1WJJA 1YVCA 3CW2C 1VQ8A 4BY1H 3HOZG 2AKWB 1EQRA 1E24A 1HNWQ 3HKZE 2GVBA 3J81j 2PQAB 1KRSA 2OQ0A 1EFWA 5C0XI 4WJ3M 4BY7G 2RCNA 1IYJB 1K83H 1VQCA 4GN5A 4DUZQ 1I5FA 1VQEA 2E5LL 2IX0A 3I4MG 3VDYA 1L0WA 1D8LA 1I3QH 1SLJA 5JJLA 4JBMA 1K3RA 1IZ6A 3K80C 5C4JH 4YHHQ 2ZTEA 3HFZB 4A3EG 2OWOA 3OTOQ 3DLLA 2VQEQ 5M3MG 3AFQA 2RHSB 2I5LX 4AYBE 3DM3A 2A19A 3PUYA 1PH2A 4KI0A 3UE1A 2MO0A 1GD7A 1VQHA 4LFAQ 1VQ4A 1JB7A 4NXMQ 4QY7A 3M7NA 1Y1VG 2QA4A 3I4OA 3FKIH 2VNUD 2F52A 3PUZA 3PO2H 2VS1A 4C3HH 2IT1A 4LFCQ 2K5NA 3HOWH 1QZGA 4JI4L 2A1AA 3KF8B 2JA6G 4A3JH 2JE6I 1PH3A 1WOCA 4R4OA 2E8GA 4JI8Q 4Y7NH 2ALYB 2GVAA 4A4IA 5IE8A 1SRUA 1L1OA 4MNOA 4UP7A 4IFDJ 2KHJA 1N32Q 2R7DA 2VQFL 4A3IH 1VQLA 2UXDL 3CC7A 4DR4L 2R93H 4BY1G 4GNXB 1XMOL 3KFUA 2YU9H 4DR6Q 2PI2A 1HNXL 1IBKL 4HIMA 1BBWA 3G71A 3J80c 1UEBA 4QJFA 4DR3L 1Q12A 1L1OC 2BH2A 2ZJQA 2UU9L 3D0FA 4TQUS 1M1KC 1XNRL 3PUVA 4J15A 3RR5A 1Z9FA 4X62Q 4A3KH 5HGQA 1IL2A 3A5UA 3F2BA 2K14A 3F1ZA 1U5KA 4B3TQ 2D0OA 3S15H 4IPCA 4JV5Q 3PCOB 2B29A 2E2HH 1FL0A 4GN4B 4OXPA 3ZJYC 3KF6A 5IP9H 3T1HQ 1FJGL 1HZ9A 4YWMA 2AMCB 3AFPA 1E7ZA 1YITA 2QGQA 1A8VA 4L5TA 2LXKA 1WI5A 4YHHL 3GTOH 3HOWG 1PVOA 1VQDA 2XGTA 5GAEC 3OTOL 4IFDG 2OTJA 4A3JG 3S24A 1WYDA 1NMGA 2VUMH 2HIXA 5IYBG 3CCJA 3UE0A 2ZJRA 1XPOA 4LFAL 4B3SL 3PO3H 2R7ZH 3PUXA 2YYZA 3STBD 4A3IG 4LF8L 2R93G 1I94L 1CUKA 3L7ZC 3E9IA 5LMUQ 1VQ6A 1UE1A 1X6OA 3W1BA 1RL2A 3PSIA 3H15A 2KCTA 3I2ZA 3I7FA 4JI8L 4YCUA 1LUZA 2JQOA 4IOAA 5JEAJ 1YZ6A 1Q7YC 2Q2IA 1N34Q 4DAMA 4A3KG 1S72A 1X54A 4XIGS 1PH9A 4HIKA 2UUCQ 4JI0L 4LF7L 5IP7H 4DR6L 1GVPA 3F8TA 5IYDH 4DNIA 5IP9G 4P72A 4JYAL 3WWVA 1PYBA 3IRBA 1MIUA 2WFWA 2E5LQ 1CSQA 3K8AA 4IO9A 1NE3A 3NEMA 2PMZE 2EIFA 3CXCA 5GAGC 4L5QA 4YWKA 3CMAA 4PG3A 3EIVA 4IJHA 2VUMG 4A3MH 4A3DH 3CF5A 2HT1A 3PO3G 3OYYA 3G48A 4DK3C 1YJ9A 1K9MC 3S14H 2AHOB 3KDFA 5FLXc 5EAYA 2N49A 1MJCA 2UUBQ 1XNQL 4APVA 1HNZL 1IBML 3CPFA 1PH1A 4UP9A 1W2BA 2CQOA 1C9OA 5JEAG 4BBRH 1Q81C 1HR0L 5BR8Q 4JI4Q 4A3LH 1X65A 4O2DA 2E2JH 2VZAA 1PH7A 2IY5B 5FLMH 2YTXA 2ZJPA 5LMNQ 2VQFQ 1XPRA 3RLFA 4HJ8A 2CKZB 3CCRA 3CD6A 1XMOQ 4DR4Q 2UXDQ 5IP7G 5IYCH 4DV0Q 1HJPA 4GOPB 3FHWA 2R92G 4OO1G 1QUQB 5IYDG 2N8NA 4X64L 1IBKQ 5C44H 2WAQG 2B63H 3HOVH 2N78A 4OX9L 4P74A 4DAYB 4LF6L 4KHPL 5H1SE 1Z47A 4GLAC 1WCMH 1E3PA 1GM5A 4IPGA 2UUCL 2WAQE 5M5YH 1SROA 1C0AA 2DUDA 2KBNA 4ALPA 4A3DG 1U0LA 1JJCB 1YHBA 5DLQE 4DV4Q 3CC2A 2UXBL 4A3GG 1X3FA 3KLWA 3W1GA 1FJGQ 1H95A 4RMFA 3RLNA 1TWCH 1KL9A 2C35B 3B6YA 3F2CA 4DR2L 4RG1A 3J81c 1Y14B 4UPAA 4A3LG 4BBRG 2MFIA 1UE5A 2Z0SA 4DV6Q 4OO1I 2JEBI 3S17H 1E1TA 1X55A 3G6EA 2JEAI 5FLMG 1OTCA 4B3SQ 1JE5A 5M3FH 4LF4L 4LF8Q 3AQQA 4YCVA 1I94Q 1C7YA 1D7QA 5IYCG 3J80i 3GTGH 1X3GA 3I55A 2B3GA 5BR8L 5C44G 2PI2E 4YY3L 1XTDA 1JMCA 1VQKA 2UUAL 2B63G 3HOVG 3U4ZA 4K0KL 3PF4A 1ASZA 1QVFA 3J7ZC 4DK6C 4GKJL 4X6AH 1WCMG 5LMNL 1Q82C 1VQ5A 3GTMH 4DR1L 3PIOA 2EXDA 4DV0L 4LF7Q 1L1OB 4OWXB 1TWAH 4JI0Q 1G51A 2I5MX 4NXNQ 2JA7H 2NVXH 1YIJA 4BA1I 5C3EH 4JYAQ 4R4QA 2CWPA 3UDIA 4A3BH 1R9TH 4GLXA 2GN5A 5FJ8H 4JI7L 2MQHA 4GNXA 4TVAB 4JC0A 2L15A 4DV4L 3KJOA 1J5EL 5M3FG 2F3IA 3FKIG 2K5HA 1VQOA 3GDEA 1GO3E 2K50A 2JA5H 4JI3Q 3PO2G 4LF5L 1HZAA 4FDBA 3E0EA 4A3CH 4YWLA 4X65L 5M5WH 4GNXC 1XNQQ 1I6HH 3KF6B 2QEXA 3A0JA 1HNZQ 1IBMQ 1VQNA 3U4VA 4PZ8A 4DV6L 1HR0Q 3S1QH 2ZM6Q 4DV2Q 1Q1EA 4GS3A 3G4SA 2VW9A 1VQMA 3TQYA 2I0QA 3F2DA 3M3YH 3S1NH 4L5RC 2YTVA 4GLVB 4DV1L 3S1MH 3S2DH 1VQAA 4JI1L 2LXJA 3J7A5 1EOVA 5E7NA 2IHFA 2WP8J 2F4VL 3A5ZB 2JA7G 5K36G 1IBLL 4X64Q 1ASYA 1PH4A 1G291 5C3EG 2VL6A 3CMEA 2UUBL 5GROA 2PNHA 4OX9Q 4LF6Q 4KHPQ 4L5SA 4A3BG 3PUWA 3TS0A 2MNAA 4R4TA 5FJ8G 2CFMA 1VQGA 5J3BA 2HIVA 4NXNL 1K0RA 2KHIA 4IFDI 3BU2A 1UWVA 1YEZA 4YCWA 4C3IH 3H3VH 1AE3A 1HZBA 2AWNA 4OWTB 4JI6L 2D62A 2MO1A 1W3SA 1PA6A 3GTKH 2UXBQ 1TWGH 4DR7L 2FXQA 1XMQL 5IWAL 1XPUA 1EWIA 1JJ2A 4A3CG 1Q46A 1SR3A 3FP9A 4DR2Q 2BA0A 3CCQA 4BBSH 3RLOA 1S3OA 1X9NA 3JC66 1KC8C 1PH6A 4ME3A 5C0XJ 3CCUA 2R7ZG 4EX5A 3T1YQ 1EUJA 4JI3L 1G6PA 4LF4Q 3LGJA 1QVGA 3CC4A 1SN8A 3K81C 3M85A 4LUZA 3CP0A 1LM0A 4QL5A 2ZM6L 3M4QA 4IPHA 3KDFB 4DV2L 4YY3Q 2UUAQ 1B8AA 4P71A 1EQQA 2ES2A 2Q2TA 2NVYH 4LNQA 3AEVA 4K0KQ 4NB3A 3GTQH 1PH5A 2NVQH 1JT8A 4DPGA 4GKJQ 1YHQA 4XTCS 4DV3L 3HOZH 1B70B 1J6QA 1M90C 4DR1Q 1QVCA 1VQJA 3MEFA 1OXSC 4H02A 4KLKA 3HKSA 3PV0A 1KAWA 1K8AC 1TXYA 1N33L 2K75A 1YJWA 3AYHB 1L2FA 3E9HA 4JBKA 1YJNA 3J81i 1OXXK 4DUYL 3GO5A 4WJ4A 4R1JA 4JCVE 2XTIA 2RF4A 1HH2P 2ZTDA 2R6GA 5C0XG 5M3MH 4BBSG 4JI7Q 2OTLA 1YNXA 1KHIA 3U50C 3ULPA 4A3MG 4GOPA 2UXCL 3BZCA 2AWOA 3S2HH 1Y1VH 1J5EQ 1P8LA 1PFSA 4PMWA 2IHEA 4MZ9A 3EN2A 4DV7L 1N36L 2LSSA 4AIMA 4AQYL 4LF5Q 4LFBL 4A76A 1IXRA 4KHZA 4O0AA 1B7YB 2JK8A 4X65Q 2JA6H 1CKNA 3ER0A 5ELOA 4EQ5A 4DR5L 4GOPC 4JBWA 3H0GH 4PZ6A 2EQSA 3NELA 4QGUA 1MKHA 4B3MQ 4C2MH 3TS2A 2VY3A 3T1YL 1EIFA 2PQAA 5AJ3L 3GTPH 4HJ5A 2Z6KA 4DV1Q 4BXXH 4JI1Q 1AE2A 2F4VQ 3JAMi 3HOYH 1YI2A 2CWAA 4A75A 1IBLQ 1VCIA 4AYBG 1EYGA 3GTLH 2NZOA 3U58A 3BJUA 4A3FH 4HIOA
chains in the Genus database with same CATH superfamily
2WAQA 3CQZA 2LFNA 1XMQH 2ZT9C 1BKBA 1TWFA 1RYSA 1I4PA 1ZETA 3MFIA 1K8MA 2Q2UA 5IT9c 3RZOH 2F0MA 3GTJA 1M0TA 4ZK9B 3KF8A 3JAMc 2NVQB 1VQBA 5M5XH 2WV6D 3M9MB 1S0MA 5JVG3 4DR7Q 1PYSB 2Y0SG 3TRZA 5KFHA 2BQ3A 3DXJC 3URYA 4EVOA 2JSOA 2R6FA 5J22A 2RSNA 3H0GG 2A8VA 3PW5A 1EUDB 5EZYF 1EQTA 3P7JA 1MHWC 4RFBA 3PMFA 1G6ZA 2H5XA 4DV3H 4BXXG 2HCIA 5GADC 4FXGC 4MV9A 3HOYG 4ECZA 2K5QA 4LF9L 4P75A 5C1OA 3I56A 3S2HB 3K5OA 5J1ZA 1VAJA 3GV6A 4LF6H 3NWTA 2R87A 2Y0SB 1F9QA 2PQEA 4N8X1 2F0WA 3HXLA 3HBLA 1V43A 4O3OA 2W8KA 4QW9A 3HOUG 1X3EA 2JA8H 4JI2Q 1O7ZA 3SHLA 2K5VA 3I4NH 2V5AA 3NWSA 3OHBA 4NDXA 2I8CA 2UXBH 2SDFA 2K7VA 5C4XG 2UVWA 4DUYQ 4DV7H 1KNEA 4R8UA 2ATWA 2AUJD 4MTDA 3NTHA 2C00A 1BXRA 1EL0A 3HOYB 4LSXA 1BOSA 1QG7A 3FVQA 4F88A 1RIPA 3RNUA 3NPPA 1QNUA 5GQOA 1S5ED 2GPSA 2RHQB 4O3QA 2W8LA 1I50B 4DV5Q 4EBEA 1Q86C 1A62A 3FKIA 1MJEA 3KJPA 4MV3A 5FD6A 3HOUB 1NMFA 3SDZA 2JA9A 2YV5A 3VR2A 1KD1C 2NVXB 3ULJA 2KCMA 1KDBA 3L2PA 3NENA 2EJMA 2DGYA 1O7IA 2F0JA 3HOXG 3M9NB 3SK6A 3TZUA 2R92H 3DHQA 4IPDA 5EPJA 4J9LA 1N8RC 1CHPD 3SR1A 1AH9A 2CCZA 2H1EA 5GONF 4HMJA 1CA5A 4JVZA 1HQRD 2FMAA 1K8GA 5KFVA 1SMXA 5JJIA 2BH8A 1SFOB 2EE1A 4KD4A 1Z2NX 4QIWE 2RGVA 4JI2L 4RGMA 4POFA 1LTAD 2OCEA 4RH6A 4RCNA 3VR5A 5C8YF 3UDFA 5J39A 5KFSA 3I4MH 2JJQA 1NY4A 3T56B 1L0XB 3HOXB 4JK1C 4IUNA 2YL2A 4HAEA 3RV3A 4BY7H 4LF5H 2F0EA 4DA2A 5C5MA 4BA2I 2O5JC 1B3AA 1RHPA 4ZUJA 3H4BA 4Y52H 2FFKB 2NU6B 4DV5L 1QZHA 4HNUA 4RZQA 3M4OB 1K73C 3K6OA 1DD2A 3I8ZA 4XXEA 3OW2A 4DR3Q 4GN3B 2DPJA 1CKOA 3OWFA 2Z4IA 1JICA 3CW2C 2AKWB 2SNSA 4TV8F 4IRKA 1PRTF 4UHVA 3N44B 4RAUC 2GVBA 2F0SA 4ECSA 1EFWA 2VUGA 3KLSA 3G7LA 3RV4A 4X3KA 1WD0A 3J81L 2DJFC 1VQCA 1OWTA 4GN5A 4DUZQ 1JOOA 2BE5D 1SCUB 2XIGA 4XZ3B 3L4KA 4N9TA 1D8LA 1SLJA 1EY5A 4YHHQ 2A5HA 3AFQA 2RHSB 3DM3A 1RDPD 1PH2A 3UE1A 1VQ4A 1IL8A 1DOKA 1YNJC 3CQZB 4QY7A 1T94A 3I72A 1TWFB 4U7CA 1FR3A 4C3HH 2IT1A 5I4DA 2SOBA 4EGVA 5HBRB 3GTJB 4JI4L 1IKLA 4EGQA 3KF8B 4A3JH 1GUTA 2EYHA 2E8GA 4JI8Q 3SE7A 4MNOA 4UP7A 4IFDJ 2KHJA 3PQIA 2VQFL 4A3IH 5KFXA 3CC7A 4DR4L 2AU0A 1DOLA 4BY1G 4GNXB 2YU9H 2YZNA 3DWPA 4HIMA 1X3PA 3A7LA 3DEOA 4DR3L 2BH2A 3K5IA 3VR3A 2BR0A 4JI2H 1LO5D 4I50F 4TQUS 2K6AA 3KBGA 1M1KC 3PUVA 4A3KH 5HGQA 3A5UA 3F2BA 2CHBD 1PDQA 1NR2A 2D0OA 4FYDA 4TSSA 1QILA 1IW7D 1E2ZA 4Q0FA 3NBHA 4JV5Q 4I55F 2B29A 1FL0A 1STYA 4OXPA 3Q0AA 4HCEA 3AFPA 1E7ZA 3GTPB 2KECA 2QGQA 1A8VA 2XNAC 4L5TA 1H9SB 4BY1B 4YHHL 3HOWG 1VQDA 4DV5H 3NSWA 2J6UA 2BDOA 1NMGA 5IYBG 1S5BD 3UE0A 5ISRA 4B3SL 3PO3H 4R8UB 1K28A 2W6OA 2XCAA 2W6ZA 5KKNB 3LWEA 1OO9B 2X0SA 3L7ZC 1VQ6A 5LMUQ 4J6HA 5C4JB 1TT2A 3W1BA 3G6XA 3I2ZA 3C1EA 3Q1KA 4JI8L 4IWXA 4MV8A 2CH4W 3GTGA 1LUZA 4IOAA 2AGOA 2UVUA 1YZ6A 4KTAA 3TP8A 5C3XA 1N34Q 5KFUA 2K5DA 3I70A 5ELCA 4XIGS 5CMDA 3HOWB 3M4IA 3GV5B 4IZ8A 4DNIA 1UC9A 3WWVA 3IRBA 3H40A 4FS1A 1I6UA 3K8AA 4H7BA 4WFN3 1SNCA 2O2LD 3CMAA 4IJHA 4JI4H 1R9TA 4A3MH 4DK3C 1YJ9A 5JOBA 5FLXc 3QWNA 3OSNA 4DR4H 1BQQT 2G9HD 1IBML 3N6XA 4WORA 3S15B 5EJWA 4FNFA 2E2JH 1SEIA 3RUPA 4DR3H 5KFOA 5FLMH 1D5ZC 4EBDA 2J7ZA 3RLFA 1U4RA 3BABA 3MWYW 5IYDG 2N8NA 2GLTA 5C44H 4I7ZC 1MI2A 4YAKB 1B44D 2N78A 4OX9L 4UCSA 4DAYB 1EEFD 4DUZH 2JEJA 1WCMH 3MVVA 3K7AB 2P0AA 2E2IB 1WTVA 4IPGA 2NWGA 2QDLA 4YHHH 5M5YH 3Q23A 2X69A 4DV4Q 3NBIA 5ELDA 3CC2A 4A3GG 2AQ3B 3W1GA 3R23A 4B3SH 4RMFA 3RLNA 1TWCH 1KL9A 2C35B 4P2CB 1ZQ7A 2FP4B 1ET6A 4DR2L 4EBCA 1UNNC 4BBRG 4PMCA 4OO1I 2Z0SA 2EOTA 4DV6Q 4JI8H 1E1TA 3P75A 2JEAI 5DG8A 1ESFA 1B04A 5JJZA 3GIPA 1I94Q 1KJ8A 2F0UA 3TZDA 1D7QA 1J8IA 1SJED 2EY5A 3J80i 2K5WA 4CJ1B 1X3GA 3J7YW 3I55A 3OOCA 2PI2E 5KT4A 1XTDA 1BO0A 3PF4A 3J7ZC 2YW2A 4CKEA 4DK6C 4A3GB 3RBEA 1PTOF 3S14B 4RCOA 4FBUA 1Q82C 1U4PA 4DR1L 3R93A 3GTMH 1B6RA 3GTQA 4LF7Q 4BBRB 2UVRA 2JA7H 2NVXH 4L6TB 2L1BA 4TQRA 3E0JA 4BA1I 1JXLA 1BCPD 5LYJF 4DNRB 4A3BH 2D5DA 3GIDA 3CU7A 1ONLA 3RUZA 5FJ8H 2W57A 3UI2A 1RTNA 3TSSA 4TQSA 2G9DA 5CA0F 4DV4L 2I46A 4XYLB 3KJOA 5BN4A 5M3FG 1VQOA 3Q6SA 3GDEA 3PO2G 4JI3Q 4FDBA 5LMUH 4X65L 1TS4A 1XNQQ 2QEXA 3A0JA 1VQNA 4RAZA 4PZ8A 4DV6L 1HR0Q 3R5HA 3BG3A 4DV2Q 2ZDQA 5KFDA 2JA6A 1H9RA 4KKTA 4YJ2F 1N34H 4XDXA 1VQAA 2GPWA 2IHFA 4MTEA 3A5ZB 5BN3A 5K36G 4MV6A 4R9WA 3U9OA 4X64Q 1ASYA 1CS0A 3EYYA 3G8CA 1WTRA 5LL6S 2UUBL 2NTTA 2QW7A 5M3FB 4FF1A 4KHPQ 3PO2B 2FK1A 3TS0A 3GTLA 4R4TA 1KJIA 3GTGB 4DR2H 2ZXRA 1LT4D 1BJTA 1K0RA 2IPKD 4B9WA 4EFEA 4HQ6A 3BU2A 4YCWA 1AE3A 4ED6A 1ET9A 3KHRA 2MO1A 1T5XD 3I73A 3IFDA 1EWIA 2LY7A 4F7XA 1DYQA 2XD4A 2EYMA 2KHSA 3NP8A 2BA0A 3T16A 5C0XH 4KHVA 4HR7A 3RLOA 1X9NA 3T13A 4DK0A 5C0XJ 3NXWA 4DU9A 3BQ0A 4JI3L 3LGJA 1R9TB 5HV6A 1HA5A 3CP0A 2WACA 1PZKD 1H9MA 1JDBB 4DV2L 3M4QA 4IPHA 3C3LA 3J80W 4LNQA 1B8AA 2FJ2A 1PH5A 4J1MA 4GKJQ 4XTCS 1AFPA 5KX5F 1B70B 5DGBA 1J6QA 1M90C 2F0LA 1RD9D 4C56C 1PRTB 1I6HB 3ORRA 1V8QA 1VQJA 2F0KA 2R3ZA 3HKSA 1KAWA 3J81E 2EJGC 2L11A 3J7AF 2VUMB 3GQCA 4DV4H 4NLGA 3OWEB 3S1NB 4F4YA 3AYHB 3E9HA 4JBKA 4IRCA 3D4WA 4MV4A 4R1JA 2B2VA 5DM73 2BE5C 1E4FT 2R6GA 1TA8A 4JI7Q 1Z6HA 1JDEA 1WTPA 5CC4A 4DV6H 3N41B 1JWUD 1EWCA 4PMWA 4ME6A 4MZ9A 4HSPA 2B2VC 4DXFA 4LFBL 4KHZA 2V9WA 2JK8A 1CKNA 1QCBD 4O4LF 1QNKA 4PZ6A 3NELA 2VY3A 3BDCA 3GTPH 2PQAA 4Z9CB 4F8MA 5AJ3L 4RUCA 2UUBH 2E2DC 4HJ5A 2A6HD 1B33N 2B2UA 1VF5C 4R8IA 2Z6KA 1I7LA 5KIXA 1M4VA 1Y8PB 2BCOA 2HJWA 4H0LC 3OSPA 4LF7H 2RBMA 4JI1Q 3IFTA 1AE2A 2O03A 2F4VQ 3JAMi 1SNDA 1I4HA 1IBLQ 4DL7A 5KFJA 2WB1A 5C4ZA 4EGJA 2XVSA 4A3FH 4HIOA 2HHHL 2B2UC 2F0DA 2Z6KC 4A93H 1JR0D 1JOKA 3S1RH 3HKZA 4HIDA 2MJ8A 4G7HC 1RJQA 1BNZA 2AGPA 2L9HA 1A3TA 1IOWA 4O3RA 4NPSA 3WO1A 3TREA 3A7AB 3CCVA 2F3WA 3TQTA 1D6EC 1IW7C 2M9VA 3SE0A 5F9LA 4P73A 3WOFA 1XMQQ 4QCLA 5G3LD 4JI3H 4LW1A 1MGSA 4O1NA 3TEHB 2VA2A 3KUPA 1P16A 3A54A 4I65A 3SGIA 4IR1A 4KY7A 4POGA 1XNQH 5IYBH 1HR0H 3UDXA 4DLKA 1SAPA 3U9SA 1HCZA 2Y0SE 4JG2A 5KFTA 4DV2H 3M4YA 1UE6A 5EQ0A 3J80L 3DF7A 1SNOA 2NN6G 5I47A 3R5XA 3A56A 1S40A 1SE2A 2Q2HA 3NK9A 1KTKA 2A6ED 4X64H 1NCVA 4LH7A 2WYOA 4NMZA 1LTBD 2W6QA 2FLLA 1B53A 2ZTCA 4HJ9A 5EWEA 4DV3Q 3FMAA 1F77A 4ZOLF 4TV9F 4KHPH 5EOYA 4FS2A 3WNZA 4LSAA 3JZIA 3PZPA 4WJWA 4WD3A 3M9BA 1PV4A 1N33Q 3GILA 1VQFA 3SK4A 3OHAA 2R7MA 5DQIA 1K83A 3RN5A 3PGZA 4R4CA 2YS7A 1PZJD 1SXTA 3H91A 2HVQA 2JYOA 2N3SA 4X66Q 5E4WC 4RGTA 4DL6A 3GTLB 1JORA 2F0GA 1LLRD 1CQFA 4OEMB 2JA5G 3GIQA 3K7AH 2PPBC 4C3JG 2E2IH 1JJGA 5KG4A 4DV7Q 1ICFB 2RVLA 2ID0A 1CSPA 4ED8A 2F0NA 3KAKA 4PZ7A 1Y1WH 3Q24A 5LP6F 1N32L 2KEEA 3GD7A 5KFEA 5DM63 5DGAA 4HR7B 1QOHA 1T9HA 1B9NA 3E5SA 3ULLA 2FKLA 2HHHH 4HNTA 4ZCKA 3ITPA 5DG9A 2BQRA 1V1QA 5KFRA 5IT9W 3CVZA 2M05A 3JAMW 5KFZA 1KQSA 1TQOA 2JA5B 4FXDA 1VBGA 4C3JB 4ZI7F 3BDOA 3PF5A 3G6VA 3C46A 1D5MC 3ERSX 3V6KA 1N56A 4A2AA 1JC7A 3T1HL 3HEJA 5CA1F 4A3GH 2QYZA 1XJVA 4EEYA 4LWCA 3Q8SB 3RZDH 1A2UA 1LTGD 5I6WA 2ASBA 2YCHA 5EKLA 2E2HA 1UAPA 4A3EH 3PIPA 3S2DB 3C2PA 4OIKA 4X66L 3S9WA 2WKCA 5ELNA 3GTOA 1EIYB 1PFMA 1QUQA 2VXWA 4RHRA 2V59A 5KFQA 3K57A 5A2QW 3MR3A 1TVXA 4PNYA 4G7OC 3JSNA 3LP8A 2AUKA 2VOBA 2WB1G 3QJYA 2D0PA 3H4DA 1KRTA 1ENAA 1NBWA 4QWAA 2RDJA 4JI1H 1ILQA 1FNUA 2NVTH 2HVRA 2F4VH 2F0HA 2VB3X 4LF9Q 1IBLH 3HKZG 1PTOB 2CH4A 3BS1A 3HOZG 1CKNB 1WJJA 3V05A 4ZYSA 4C5CA 4RB2C 5COYA 2W6PA 2ALZA 2PQAB 4RZRA 4WJ3M 3HRZC 3T5JA 1VQEA 3VDYA 2WKDA 2ZDHA 5KT5A 1ZYRD 3K59A 3L4JA 1AEXA 1IZ6A 2OWOA 1BCPC 2WB1B 5CGKA 3DLLA 1KC7A 2A19A 4Q0YA 4KI0A 1GD7A 1VQHA 1RF2D 3C0FB 1ICWA 3M7NA 2C9OA 3HKZB 3I4OA 4FF4A 2R8GA 2VNUD 1N32H 1O7LA 2F52A 3IKJA 3PUZA 3PO2H 2VS1A 3HOZB 1HXYD 4U673 1Z7TA 2K5NA 3D3RA 4NP5A 2A1AA 2FJZA 4YR3A 1PH3A 2H4OA 4HN7A 1WOCA 4Y7NH 2ALYB 5JH7F 5IE8A 1SRUA 1L1OA 1G8ZD 5T1GA 4AYBB 1G2SA 2UXDL 1Q90A 2R93H 1XMOL 4J9QA 4ZKBB 2WIIB 1SYXB 3G71A 1UEBA 5K36H 1Q12A 1L1OC 1PK8A 3QG1A 1N33H 2XWJB 2B63A 4EQPA 3RR5A 3ETHA 1IL2A 1SNQA 4XQQA 2CW8A 5KT6A 1G91A 4IPCA 3L9AX 4S3SA 4X66H 3DM1A 3H0GB 4GN4B 1FJGL 4MV1A 4YWMA 1YITA 1D1IA 1X32A 1PVOA 2RCFA 3D4RA 5ELFA 2VUMH 2HIXA 3RF2A 5ELEA 1DJRD 1K83B 2SEBD 2YYZA 1DZ1A 3STBD 4LF8L 3E9IA 1GSHA 3PSIA 1A3VA 4U68A 3E5NA 4UCOA 2IMWP 1FNWA 5HGTA 1TWHB 3O13A 3OPOA 5C4XB 1TKWB 2J0TD 1GVPA 1WTXA 3F8TA 1IKMA 1A6XA 3BG5A 2PVPA 2W6MA 2F0TA 4P72A 5IP9G 2ASJA 4JYAL 5EBDA 5KFIA 2MUYA 1PYBA 1MIUA 2MP1A 4IO9A 1CM9A 3ORQA 3CXCA 5GAGC 1EHIA 1ML0D 1LABA 3L3OC 3EIVA 4YR0A 3RB0A 4A3DH 2W6NA 3G48A 1K9MC 2F0VA 2IWHA 3EA6A 3HG9A 2MPMA 1EZ1A 2N49A 2UXDH 5C6AA 4IN3A 1KAAA 4ZRZA 4UP9A 1F9SA 1W2BA 1ZHSA 5JEAG 4JI4Q 4J9MA 4MV7A 3H20A 2PMZB 1EY0A 4CKCA 2E2HB 2VZAA 1PH7A 5FPOA 4LF9H 3W2DA 2ZJPA 2IA6A 1FD7D 2VQFQ 4R7RA 2CKZB 2QF7A 4KY5A 4DR4Q 3GTOB 3RAQA 5IP7G 4EYHB 1EU3A 1HJPA 1O80A 3ZYYX 1QUQB 2A6HC 4EYIB 2WAQG 3UQ8A 3MR2A 4L63B 5NUCA 3G6JB 1FJGH 3FDSA 2JEFA 2V4DA 5CV8A 1GM5A 3PIO3 2DLNA 2XSCA 2O5IC 2F03A 3K58A 4QMGA 3KK7A 3MHBA 5DLQE 2K33A 3FDTA 3GIKA 1B1ZA 3DWQA 5DG7A 2W71A 1SDFA 3F2CA 1CQIB 3J81c 3MXUA 1LT3D 4A3LG 2MFIA 3T5KA 2RDGA 4M1UB 3S17H 2WAQB 1HFNA 4K2LA 3G6EA 1X55A 3J80E 5J2UF 3ND9A 5KYIA 5KG3A 4B3SQ 4RB3C 3PW2A 3S16B 2NN6H 4LF4L 1AP0A 1U9RA 4O3PA 3AQQA 4YCVA 1TU2B 1C7YA 1ESRA 5IYCG 2IW3A 2B3GA 2KEDA 4YY3L 2UUAL 2B63G 3HOVG 1EU4A 2HGSA 4IUQA 3U4ZA 4DXGA 1QVFA 3OMCA 4K0KL 1CTMA 4X6AH 1K0SA 1Z2OX 4ZKCB 1VQ5A 2A6EC 2E74C 3PW0A 4JV0A 2NVYA 3PIOA 3LX0A 1O7YA 1L1OB 1UEAB 1TWAH 1G51A 3Q8RB 2EYJA 1F2LA 1JCKB 2A74C 3SK5A 5IGGA 5FLXW 3TP6A 3MWDA 4FXKC 1L0YB 1HTLD 1VMCA 1D5XC 1AZPA 3BYYB 2B63B 5CV4A 3HOVB 1J5EL 4DL2A 3MC0B 2F3IA 3FKIG 2K5HA 2JA5H 1DV1A 1GO3E 2K50A 1GSAA 2R7NA 4O4HF 1F9RA 2ASDA 1PFNA 4O2AF 1TS5A 4YWLA 4CDFC 5M5WH 1Y1VA 5EPKA 2J9GA 4OELB 1IBMQ 2JXMB 1VQMA 1TS3A 2EYLA 3TQYA 2C22A 2I0QA 3WDNA 4LMQD 2YTVA 4XT1B 4DV1L 2DJGC 3S1MH 3S2DH 1UC8A 4C2MA 2LXJA 2OH2A 2ZXPA 1EOVA 2WP8J 3R2TA 1HQMC 1BDOA 1WTOA 1V4YA 4QUCA 5C3EG 1J9OA 5GROA 2PNHA 4OX9Q 2PZWA 3FKIB 4L5SA 4DL4A 1NUCA 2MNAA 5KFAA 1WD1A 3P20A 1X3QA 4NW2A 2KHIA 2EYPA 4IFDI 3RTXA 2MGSA 1UWVA 1YEZA 3H3VH 1PTOH 4ZLTF 3CKIB 4PV1C 4JI6L 5D1OA 1WTHA 2D62A 4LJZC 4YQWA 1RJPA 1TWGH 5DQGA 2FXQA 3R2IA 5IWAL 1TIID 4R8NA 1B50A 4LF4H 2C5CA 4A3CG 4XYMB 1SR3A 4DR2Q 5JAVA 3CCQA 4BBSH 1S3OA 1SE3A 3RAXA 3VA5A 2UUAH 3E6ZX 5C3EB 2K28A 2KJXA 3T1YQ 5KG1A 2IJ0A 2EPBA 3CC4A 1QVGA 2VQFH 3VPBA 3M85A 2D2CC 4QL5A 3T51B 2NU8B 1EQQA 2Q2TA 2YS6A 4M8AA 1MSGA 4DK1A 2NVQH 1YHQA 3HOZH 4IALA 2ATLA 4DR1Q 4Q5VA 4IURA 3MXNA 2HDLA 3PV0A 4K8IA 4RB1A 4HMIA 4C3IG 4CDDC 5KNDA 2Z6BA 5D3IB 3M3YB 1J5EH 1JWMD 1EZ6A 1OXXK 3GO5A 4WJ4A 2VA3A 1CE8A 2NB0A 1HH2P 5D65A 2OTLA 4H44C 1LTRD 1ZYRC 4GOPA 2UXCL 2L12A 4KN4C 3S2HH 1WVLA 1B2TA 2FB9A 2F4IA 2IHEA 4ZAIA 1N36L 2LSSA 4AQYL 2DWCA 4DV1H 1V51A 4X65Q 3GTKA 3GV8B 3ER0A 1YNND 4O3SA 4DR5L 1XX8A 4GOPC 2XN9C 3H0GH 4C3IB 4M9UA 1MKHA 1V1PA 4CJ2C 3T1YL 1NR4A 4PMBA 4RWSC 3JAME 3FPUB 4BWSC 4BXXH 1EY7A 4C5AA 3BDLA 1LACA 5CBEE 3HOYH 2CWAA 4O3NA 4G3IA 1XWEA 2R92A 5FOBB 2UUBQ 4JI6H 5JVLA 1LV9A 1I50H 2OT2A 5IWAH 1KLGD 4DNTB 1CI3M 1W93A 1E2WA 3HOUH 5H80A 1CQVA 2XRSD 1S9FA 5CAEB 3BVGA 4OONA 1FGUA 2NVYB 2F1MA 2JN4A 1TWHH 1G2TA 2A69D 3A74A 2C2DA 5C4XH 4ODGA 4B3RL 4GC7A 3QO2A 4JI5L 2OEOA 4ZQIA 2TMPA 4CKBA 3CCLA 1IBMH 2KSWA 4B08A 1H9JA 1PHJA 1PH8A 1L2ZA 5GAHC 1GGOA 3OUUA 1NTGA 1E1OA 2BA1A 5KNCA 1HR0W 4DKAC 4RU9A 3VMMA 3NBHB 1YHAA 4GKKQ 4U6PA 2PYKA 3STBC 4IOCA 1SFOH 4ETSA 3OIPA 5I2YA 1B9MA 2TSSA 2AQ2B 5D3DA 5JUMA 1CZGA 2B2YA 3PN1A 2V58A 4OX9H 3HOXH 5A35A 5L1KA 1HNWL 3JRXA 5IY0A 1SBBB 4LUOA 2G5DA 3MTSA 2QKIC 1FVIA 5EKIA 4I7HA 4RNOA 2B2YC 3HS0C 3CPWA 2A73B 4C2MB 4ECQA 3Q2OA 2I07B 2BQUA 2OQKA 2SNMA 2VQEL 3M4OH 3K0YA 4C1NK 4AQYH 2IX3A 1ULZA 4NXML 2K05A 4JOIA 3K0XA 4DL3A 4OWWB 1DIKA 1BBUA 4JBJA 1KBLA 1SYDA 4F4WA 3T1YH 5KNBA 4LFCL 3V2TA 1M7JA 4EEQA 2R7FA 1GKHA 4LFBQ 3RN2A 1CT1D 5D14A 2CVRA 1KIXA 4JOIC 1Q8KA 2CW7A 4ECTA 5IOCA 2DN8A 2Z9HA 2R7LA 4I4TF 1Q1BA 5M5XB 5AJ3Q 3Q8DA 5KG6A 1TS2A 1RJTA 1EY4A 4GKKL 1AN7A 3RGZA 3BAAA 4DR1H 1N9WA 2JA8G 5LMNW 3OIQA 3CQZH 2YU9A 3I4NG 1CKMA 4QQBX 3S16H 1TWFH 2KVMA 1X56A 4X62L 5KFYA 1IYVA 2HHHQ 3MFGA 4JPBW 4B3TL 3GTJH 3SVMA 5J2TF 4B3RH 4UY8C 4JI5H 5DEHA 5BPFA 3EJIA 4YJ3F 3M4PA 3S1QB 1PX2A 2Q8TA 1UNSA 5HY6A 1A0IA 2YZMA 3PIP3 1EZ8A 3CAMA 3MXNB 4CC6A 5JQWA 3N52A 3VPDA 1IYUA 5BN5A 3L0OA 4X65H 1H9KA 4MHEA 1BVSA 1E22A 1JE4A 5IGBA 2W9CA 3HGBA 4JUZA 3EROA 1I4QA 3QOLA 1OXUA 5CV9A 4LAAA 1WTWA 1HNXQ 1HNWH 1Y69U 3K7UC 2IL8A 1JQYD 2AQ1B 2F3VA 2WB1E 2XWBB 4UP8A 3GTKB 1SE8A 4GZYC 3QZ8A 3FEWX 2L0CA 4BY1H 2UVVA 1EQRA 1II3A 4QWDA 1E24A 2VQEH 2R7KA 3HKZE 1T5EA 5C0XI 3RGXA 4NXMH 1IYJB 3DMUA 3OHXC 1I5FA 3EQLC 2E5LL 3I4MG 1GXDC 2PO4A 2M2LA 1DOMA 4JBMA 1K3RA 3K80C 5C4JH 5KFGA 4BY7G 4QB4A 3HFZB 1D2BA 4J0MA 4LFCH 5M3MG 2NUCA 4AYBE 3PUYA 1MZBA 1JB7A 1XTCD 5C5LA 2QA4A 3FKIH 3GTQB 1F2MA 4ABNA 2WDTA 2QILA 1BCPF 3HOWH 2VPSA 1QZGA 3BQ2A 4GKKH 4K5XA 2JA6G 5CYUA 4R4OA 2FK2A 2GVAA 3NTIA 1XDNA 1N32Q 4ED3A 2EYOA 2JP1A 3KFUA 1F9PA 4X62H 1FGBD 4BY7B 2ZXOA 1IBKL 1DXMA 1BBWA 3TDQA 1HNXL 5M3MB 3J80c 4X3TA 3N6RA 4IR9A 2ZJQA 4Q8EA 3D0FA 3GLKA 1F2ZA 4J15A 5CB4F 4CBVA 1STHA 1U5KA 3S15H 1WCMA 5JVDF 2JA6B 1FKAH 4FU0A 3T5LA 3PCOB 3E3XA 5IGFA 3MR5A 3ZJYC 3W3AA 3T1HQ 1C30A 4HYKA 2AMCB 5L1IA 4C3HG 3KXYT 2LXKA 1EY9A 2XGTA 2PCFB 4TKOB 4IFDG 2OTJA 4A3JG 3S24A 1MD2D 4LFBH 2NZ1D 1TWCA 1I3QA 3CCJA 3QR8A 4DAVA 1O78A 2ZJRA 1XPOA 1M0WA 4XX0B 5KFCA 1NAPA 3TINA 3GV7B 3N8DA 2RDIA 4A3IG 1S68A 5KRUA 4YR2A 4KD3A 1UE1A 4ECXA 1X6OA 4ED2A 3GQBA 3H15A 3FRPB 3I7FA 5K2MA 3R3OA 4YCUA 4RNMA 3D6WA 1CQJB 2R85A 1JLLB 1Q7YC 4K6DA 4XYOA 2F0OA 4DAMA 4A3KG 1STGA 4C3HB 5FO8B 1S72A 1X54A 2UUCQ 1ZXTA 4JI0L 2FINB 5IYDH 3GTMA 3BVMA 3GIMA 2WFWA 4A3IB 3H6MA 2JA7A 2J6SA 2NVXA 1A15A 2B2TA 2PMZE 3NEMA 4IWYA 2EZVA 2YU9B 3OSOA 4KV6A 2VQDA 4YWKA 5KFFA 4PG3A 5BPHA 5KG7A 1RKNA 3SEBA 4G7ZC 3DWAA 2R8JA 3CF5A 2HT1A 3PO3G 3RFCA 3OYYA 3S14H 5KEEA 2AHOB 3MAQA 2B2TC 2DIKA 5EAYA 4A3KB 5FD5A 1HNZL 4RNNA 1HUMA 3X3NA 1E2VA 4BBRH 3V4ZA 2XGQA 1IBKH 4IQZA 1HNXH 1X65A 1GHKA 2IY5B 2XC9A 1YNNC 2YTXA 4K14A 5ELBA 1EWHA 1LT5D 1XPRA 3CD6A 2UXDQ 3ERQA 5F2DA 3CCRA 1XMOQ 2R7ZA 4DV0Q 4OO1G 1EY6A 3D6CA 2DNCA 1HHVA 2W9CB 4B9XA 4RAYA 3PO3B 4LF6L 4EFBA 1D1KA 1V1OA 1TY0A 1C4QA 2XGPA 2UUCL 2WAQE 2EVBA 5L1JA 2EDGA 4ECRA 1C0AA 5C1PA 2KBNA 3MR6A 5EPLA 2UXBL 3KLWA 3KHLA 1FJGQ 3R5FA 1H95A 1HFGA 1PYWD 2DY7A 4BWGB 1DONA 5C5JA 4XT3B 4V0BA 1Y14B 4UPAA 3V6JA 2A69C 3OUZA 1UE5A 2D9UA 4ECVA 5FLMG 1EYZA 5M3FH 5L37A 2KA7A 4LF8Q 5KFKA 1PRTD 1GJXA 1QB5D 4OIJA 3RB3A 1GLVA 2EJFC 3GTGH 3GIIA 5KFBA 4JI0H 5G3LF 1JMCA 5C44G 1VQKA 1C8CA 1VKZA 1KLUD 1ASZA 4XYQA 1HUNA 4KN7C 1WCMG 2F0PA 2EY1A 5IT9L 4FM9A 4JV2A 4QF4A 4DV0L 3JAML 4OWXB 1N48A 4NXNQ 1IOVA 1SYGA 2E2JB 4C5BA 2L5TA 4LMYA 3T1HH 2KOLA 4R4QA 4JYAQ 4L8JA 5LOVF 3UDIA 1R9TH 2ICIA 4GLXA 4CC5A 4O4IF 2GN5A 3DUZA 1HTPA 1SE4A 4GNXA 1E4GT 2MCTA 1HNZH 2L15A 3MEHA 5C44B 1CZWA 4RA8A 1EIGA 5FPRA 4N8FA 3A8IE 1Y8NB 1WCMB 2O4XA 2XCPA 4LF5L 3H94A 1I6HH 1SYCA 4GNXC 4TUYF 4XQNA 5A2QL 3S1QH 5M5YB 4RGNA 3U4VA 2ZM6Q 3G4SA 2VW9A 2ZJTA 1RCVD 3K5MA 3F2DA 3S1NH 1E0BA 1MBYA 4CHTB 1Z2PX 2QK4A 1TWCB 1I3QB 4N9PA 2FE3A 3J7A5 1BGWA 2UUCH 5KFMA 3GTPA 5E7NA 4QUFA 1H9SA 3QZ7A 2JA7G 1CK1A 4FO2A 1WSCA 2N55A 3NQIA 5T1IA 3AMUA 2PZUA 2FPPB 1RK5A 1GYFA 1K3BC 3K3PA 4A3BG 3PUWA 2NBFA 2JEIA 5FJ8G 3J81W 2HIVA 5LL6X 4NXNL 2YRXA 4IHJF 2W9AA 2FHTA 1I4GA 4DFAA 4UCVA 2XCLA 1PA6A 3GTKH 4DR7L 3K5HA 3CHBD 3T5HA 3BVZA 1JJ2A 3GTMB 3FP9A 1QWYA 1ZHQA 3PW4A 2A68D 3N42B 3GIJA 1U4MA 1KC8C 3JC66 3KLSX 4DN4M 2JA7B 1PH6A 3MWMA 3A8KE 3M9OB 4ME3A 2F0IA 2R7ZG 2VPQA 1EYAA 2CQAA 1EUJA 5E4XA 4CDEC 4A3BB 4LF4Q 4CDCC 1TAEA 2ENBA 2PBZA 1XMOH 3CRLC 1HA6A 3RB4A 4DV0H 3QIAA 4J9OA 3MXPA 2GA4B 4HEDA 2ZM6L 4YY3Q 2UUAQ 1B6SA 4K0KQ 1A9XA 4NB3A 3GTQH 1BXTA 1JT8A 4ZHQF 4DPGA 2CQYA 4EQOA 1EOTA 1I4RA 2XIWA 1QVCA 3MEFA 4H02A 1WH2A 4KLKA 1RK6A 1AN8A 1IHZA 2J4XA 1CFMA 3IG0A 2RA4A 3D8GA 4L1KA 2R7ZB 1SYFA 1L2FA 1EFID 3RBDA 1KNAA 1YJNA 4DUYL 2K32A 2OF1A 4JCVE 2RF4A 5FKAC 2ZTDA 5C0XG 4QIWA 5M3MH 3RD4A 2HDMA 4UCRA 1KHIA 3U50C 3ULPA 2Q8IB 2AWOA 2BDNA 2K01A 4ECUA 1A3UA 1J5EQ 3VR6A 1GSOA 1PFSA 2L4NA 4RUAA 3NHHA 2X6LA 3CRKC 1U4LA 1BCPB 4LF8H 4DAYA 1GUOA 4A76A 4O0AA 4ECWA 4QWEA 3QFFA 5CV6A 2JA6H 2E2IA 5FO9B 1R4QB 4JBWA 4F50A 2BOSA 1CHQD 4B3MQ 3TS2A 2AQ4A 1EIFA 5IGDA 3TIGA 1JWSD 1Y1WA 3TIIA 1KJJA 4DV1Q 4J9RA 2KCNA 1Y8OB 3OMGA 3BZDB 1E4EA 3KALA 4NXNH 1YI2A 4RGOS 1VCIA 1PFBA 3GTLH 1EYGA 3MWEA 3U58A 1A63A 5I9OA 3TN2A 4JYAH 1JB3A 4QWCA 2K1BA 4OL7A 1I6VC 4DR7H 1XYIA 1JX4A 2YTYA 1V9PA 4CGYB 3KHHA 5KYLA 5EWGA 3FMCA 3MXGA 2EYFA 4JI6Q 4MA5A 5IWAQ 4ME5A 4IFDH 4FP5D 5KFPA 2V4QA 4IAJA 3BA8A 5EBCA 1PTOD 4FVMA 1STBA 1HZCA 3NGDA 2ZM6H 4CJ0B 3PR5B 3MFHA 2NYZD 5D1PA 2PZTA 4C3JH 2X6GA 4RHSA 3MFYA 2HQEA 5CR3A 2F0QA 4IJLA 4K5VA 1BF4A 3JSLA 4E4TA 2V1CC 2KENA 3N40P 1RODA 5L1LA 1HRJA 4B3ML 4IUPA 3N43B 2I5HA 2VR1A 2LKVA 1LTID 4A3FG 3WOEA 1LT6D 1ENFA 1Q3LA 2YYAA 4A93G 4KMUC 3LMLA 4DUYH 2FPIB 3QOJA 3A55A 3NE5B 4LUVA 4KK7A 3H09A 1NJIC 4DUZL 1K8OA 1DM0B 3VYUA 1OXTA 4UDUC 1LYLA 4X3UA 2SCUB 3X3MA 3SK8A 1UE7A 2QDBA 2NN6I 3K3VA 3I12A 5KFNA 3HB9A 4RKBA 4I7AA 2R61A 1K1QA 3KOJA 5AFWA 1BUVT 3VPCA 3ICEA 2UXCQ 1OXVA 1YBYA 4R4IA 4A3FB 5CV7A 1N36Q 3I90A 4A93B 2EY6A 3EBEA 4G57A 4AQYQ 3VR4A 3S1RB 4J9KA 4JW0A 5KG0A 5KG5A 1F2YA 3V6HA 2NU9B 4YIJA 2I87A 4DR5Q 4YY3H 5JJKA 5IODA 2CZGA 1DGSA 3V96A 1KXLA 5LA6F 3U9TA 4K0KH 1W6JA 1JKJB 4ED1A 2HCCA 5LHY1 3BA9A 2L55A 4OO1H 2R93A 2CW0D 1TR5A 4HJAA 1KJQA 1SMYD 2OXPA 5LL6b 2K4KA 1VQ7A 3P1HA 4Q45A 2OLSA 4PDBA 3KLRA 5D8DA 4OGQC 1SNMA 1LTLA 2B8GA 4JV5L 1WR2A 4MTNA 5FLXL 3EPIA 2PW7A 5IIFA 2R8KA 3TMEA 3UDGA 4IUVA 1S0NA 1GOZA 1VS0A 2IX1A 2NZHA 4QW8A 2DNEA 5DNFA 2W9BA 2M00A 5FK9C 3KYHC 4B3RQ 3CCMA 4AH6A 4JI5Q 3CCEA 1DV2A 1Y1WG 4UAIA 5M9OA 3NUCA 2LMCB 2MHVA 3T53B 2VB2X 2QCPX 3W5OA 4B3MH 4QIWB 2VUMA 2HQLA 5LMUL 1VQ9A 1BR9A 2NTSA 4XQJA 1VQPA 2PN1A 3I3CA 3BZKA 5IGEA 1AW7A 2W7PA 1VQIA 1PRTC 1C48A 1WFQA 3D31A 4HJ7A 1PZID 2XRQD 4WBNF 2K52A 3G6YA 5IT9E 1N34L 3H3VI 2UU9Q 3CCSA 1XNRQ 1YVCA 4DF7A 1VQ8A 1HPCA 2E75C 1EUCB 5T14A 1HNWQ 3J81j 1C3OA 1KRSA 2OQ0A 3LWBA 1Y1WB 4JV1A 2RCNA 1K83H 4KKUA 4FBTA 1EEID 1TY2A 1PMRA 3R8BA 2IX0A 3IL8A 1S97A 3ND8A 2R8IA 4UFZA 1L0WA 2DZDA 1I3QH 2RQXA 1E4EB 5JJLA 5KGUA 2ASLA 4A3EG 1S5FD 2ZTEA 4FF3A 3OTOQ 2VQEQ 4KJNA 1GHJA 4APMA 1B4OA 2I5LX 3NQTA 2RSOA 3TBIB 4NXMQ 2MO0A 4LFAQ 4EQNA 1Y1VG 1CA6A 3J7AK 3MJFA 4MAMA 4Q8FA 5TSSA 5DQHA 5A2QE 4LFCQ 1I7NA 1JOQA 2JE6I 4RB0A 4YBZB 4J9SA 4A4IA 5IGCA 4ECYA 2R7DA 3KHGA 1VQLA 3RZDB 3V4SA 1S5DD 2B2WA 4A3EB 4DR6Q 2PI2A 4GC6A 3EFXD 1I4XA 4QJFA 1T36A 5KG2A 4JV5H 3IN5A 4ID6A 2RDHA 2UU9L 1Y1VB 1XNRL 1XXGA 4FF2A 1JIHA 1Z9FA 4X62Q 3KBXA 1STNA 2B2WC 4MTKA 2K14A 3Q8QB 3F1ZA 1O75A 4B3TQ 1M6VA 2NVTB 2E2HH 4MN3A 5IP9H 4ED0A 3KF6A 4HCSA 3BYTB 1HZ9A 2UXCH 2W7OA 3Q8PB 4ZQ3A 1ENCA 3OW7A 4RKLA 3GV3A 3VYRA 1WI5A 3GTOH 1N36H 5GAEC 3OTOL 3PW7A 1STEA 4KY6A 2R86A 2Q8RE 1WYDA 3ONAB 2FLNA 4DGZA 2ZDGA 1FNVA 4LFAL 4M7EA 4DR5H 2A68C 3PUXA 2R7ZH 2JEGA 2R93G 1I94L 2B39A 1CUKA 1WTQA 5CORA 1RL2A 2KCTA 4BS9A 5D1OB 4ULLA 1VDZA 4F4ZA 5JEAH 2RDFA 1T3NA 2HVSA 1VMPA 4K5WA 1EYDA 3RZOB 2JQOA 5JEAJ 2Q2IA 5JVH3 4LF7L 1PH9A 4HIKA 4DR6L 5IP7H 3VYTA 2EXZA 1KEEA 4Y7NB 3I91A 4Y8VB 3MZ5A 1TWAA 1MSHA 1GUGA 1B3QA 5E3FA 3AB9A 3M7GA 3FPPA 3NTKA 4K2KA 2E5LQ 2R93B 1CSQA 1SSOA 1NSNS 1NE3A 3RJ0A 2EIFA 4IUTA 2W70A 4L5QA 2VUMG 1M8AA 3LWUA 2F0FA 4MIUA 3HZXA 2PNRC 4KKSA 3KDFA 1MJCA 1XNQL 4APVA 3CPFA 1PH1A 1HR0L 2JA5A 2CQOA 1C9OA 4A3LH 1ZKOA 1Q81C 1ZEQX 3D4DA 5BR8Q 1RJRA 4O2DA 1RTOA 2JA8B 2W9BB 3I4NB 2IBKA 2Z8LA 5LMNQ 2UU9H 4HJ8A 1XNRH 3SXHA 5IYCH 4GOPB 2R92G 3FHWA 2FMCA 2QEJC 4KJOA 4X64L 1IBKQ 1Q8IA 2B63H 3HOVH 3JRWA 3EPGA 4P74A 4KHPL 5H1SE 1Z47A 3BJYA 4GLAC 2J6TA 4YP3A 1E3PA 4C1NI 1V1PB 1SROA 1KDAA 4X3SA 3K5LA 3OTOH 2DUDA 4ALPA 4A3DG 1U0LA 1JJCB 1YHBA 4IUUA 3KAJA 4K8JA 1X3FA 5BMVF 4LFAH 3B6YA 1I94H 4RG1A 4PQXA 5I9PA 1EIHA 3HP3A 1TWGA 2R92B 4A2BA 2KQ3A 1EY8A 1QJOA 1GUNA 2JEBI 2R84A 2PW5A 2DY8A 1OTCA 1JE5A 3H3VC 1PTOC 5JPNC 4IZOA 4HTHA 4J9NA 5KT2A 4Q43A 5C3WA 2RKSA 1VF7A 4DR6H 5BR8L 2FPGB 1GUSA 4A3DB 3RB6A 5CV5A 4EG0A 4GKJL 5KT3A 5CBAE 5LMNL 3I4MB 1EYCA 1S5CD 2WE6A 2K04A 2EXDA 2K03A 4JI0Q 1S03G 1EQVA 4B3TH 2I5MX 4F4XA 3RMHA 2DPIA 2KCCA 1YIJA 1W96A 5C3EH 5KFWA 4V190 2CWPA 4K6LA 5I2XA 4AYBA 1YNJD 2HD3A 4JI7L 1KJ9A 1UUPA 2MQHA 4TVAB 2FK3A 4JC0A 2YZGA 1FYCA 5EWFA 4HNVA 1LTSD 1R4PB 3KTMA 1HZAA 1RYRA 3E0EA 1S0OA 4A3CH 4DL5A 3KF6B 1HNZQ 4DAPA 2Y0SA 3EVQA 1Q1EA 4GS3A 3I4LA 1STAA 4J9PA 3M3YH 2B8FA 4H13C 5K5PA 3QB3A 4YB8B 4L5RC 3PR4A 3VYSA 3H0GA 4GLVB 3K5NA 4JI1L 4IRDA 3WO0A 5DAUA 2F4VL 4UCUA 1KABA 3VA7A 1IBLL 2R82A 3SI8A 1PH4A 3S17B 4NKLA 1G291 4Q44A 2VL6A 3CMEA 5F9NA 2NUAB 2CW0C 3ETJA 2P5ZX 5HURA 4LF6Q 5DLGA 2E5LH 1DCZA 1GUWA 1SYBA 5DLFA 1SMYC 2HUGA 2V4RA 2C2EA 5FLXE 2CFMA 1VQGA 5J3BA 1SYEA 4A3JB 1I50A 4C3IH 1HZBA 2AWNA 4OWTB 1W3SA 2UXBQ 1XMQL 1XPUA 1LTTD 3DEPA 2N88A 1SJHD 2WINB 1A2TA 4WRDA 2FLPA 1Q46A 5JPMC 3C1FA 1TWHA 4ZUIA 1TWAB 3BQ1A 2YRWA 5BR8H 2Z1CA 3Q22A 2KUMA 3CCUA 4G4KA 4UCTA 4EX5A 4LK1C 2R8HA 4GKJH 1G6PA 5EKKA 5LMNH 1S10A 1SN8A 3K81C 4LUZA 4MA0A 5FO7B 1LM0A 2FMMA 3KDFB 2ES2A 4P71A 3AEVA 2NVYH 1SFOA 2C28A 4PWQA 3TQ1A 4DV3L 2LS01 5I6YA 4E6IA 4OHJA 4QWBA 5M5WB 5LXTF 1AUXA 3RIZA 3TP7A 4J8QA 1OXSC 4O2BF 4JI7H 2I80A 3F2UA 2ICEC 1K8AC 4YAJB 1TXYA 1PXUA 4TRDA 2K75A 5EGTA 1YJWA 1N33L 3MA2B 3PVXA 4ILWA 1PLFA 2PMZA 4LH6A 2WTFA 3J81i 1KDCA 3A8JE 2AGQA 3T4AC 2XTIA 3S1MB 5KFLA 4BBSG 1NNXA 1YNXA 4A3MG 2IP4A 3BZCA 1S4ZA 3AU7A 1Y1VH 1P8LA 1BBXC 3EN2A 1QE6A 4DV7L 3IAYA 3J7AV 4AIMA 1BNCA 5KT7A 4LF5Q 1IXRA 2Z4HA 1B7YB 5ELOA 3TP5A 4EQ5A 2RGRA 2EQSA 4QGUA 1AUVA 5C4HA 2EY2A 4C2MH 1TWGB 2E76C 3GP7A 5EDWA 2C2RA 2NU7B 4ED7A 5IYZF 4HSVA 1VBHA 1W6KA 4F87A 4BBSB 5E1FA 1ILPA 4A75A 3LNNA 4A3MB 3F8NA 4AYBG 3UFXB 1AZQA 2NZOA 4O42A 1K1SA 1SEBD 3BJUA 1SNPA 5L9XA
chains in the Genus database with same CATH topology
2Z6KC 4A93H 1I50H 1BKBA 3S1RH 4HIDA 2YTYA 1V9PA 2Q2UA 3HOUH 5IT9c 3RZOH 4OONA 1FGUA 4NPSA 3TREA 3JAMc 3CCVA 1VQBA 1TWHH 5M5XH 4JI6Q 1A63A 3A74A 1PYSB 2Y0SG 4P73A 1XMQQ 5IWAQ 5C4XH 3TRZA 4DR7Q 4LW1A 4B3RL 4JI5L 3TEHB 1P16A 3SGIA 3CCLA 4POGA 5IYBH 3UDXA 3H0GG 1PHJA 1PH8A 1HZCA 2Y0SE 4JG2A 5GAHC 2A8VA 1NTGA 1E1OA 1UE6A 2BA1A 1HR0W 2NN6G 4DKAC 4C3JH 1S40A 2H5XA 3NBHB 1YHAA 4GKKQ 2Q2HA 4IJLA 3STBC 4IOCA 1SFOH 5GADC 4BXXG 3HOYG 2V1CC 2KENA 4LF9L 4P75A 3I56A 4B3ML 2I5HA 4A3FG 2ZTCA 3HOXH 4HJ9A 4DV3Q 4A93G 1HNWL 4LUVA 5IY0A 1V43A 4LUOA 3HOUG 1X3EA 1FVIA 2JA8H 3M9BA 4JI2Q 1NJIC 3CPWA 4DUZL 2K5VA 1PV4A 1N33Q 3I4NH 1OXTA 1LYLA 1VQFA 5C4XG 1UE7A 2NN6I 4DUYQ 2OQKA 3RN5A 2VQEL 3M4OH 2ATWA 3PGZA 4R4CA 4NXML 2N3SA 4X66Q 3KOJA 4JOIA 3K0XA 4OWWB 3ICEA 1RIPA 1BBUA 2UXCQ 4JBJA 3RNUA 1OXVA 1YBYA 2JA5G 4R4IA 3K7AH 5GQOA 2E2IH 1JJGA 2RHQB 4LFCL 4DV5Q 4DV7Q 1N36Q 3EBEA 2R7FA 1A62A 1GKHA 4AQYQ 2ID0A 1Q86C 3RN2A 1CSPA 2HHHL 1MJEA 4LFBQ 1KIXA 3KJPA 4JOIC 1Q8KA 4PZ7A 1NMFA 4DR5Q 2JA9A 2YV5A 1Y1WH 1KD1C 1N32L 3GD7A 5JJKA 1Q1BA 3ULJA 1DGSA 1KXLA 2KCMA 3L2PA 3NENA 3HOXG 1T9HA 1O7IA 2DGYA 3Q8DA 3ULLA 5AJ3Q 4GKKL 2R92H 4IPDA 1N9WA 1N8RC 2JA8G 5LMNW 1AH9A 1V1QA 4HJAA 3CQZH 2CCZA 3I4NG 1CKMA 4QQBX 3S16H 1TWFH 1X56A 4X62L 1KQSA 2K4KA 1VQ7A 1K8GA 2HHHQ 3PF5A 1SMXA 4B3TL 3GTJH 2BH8A 5JJIA 4UY8C 1LTLA 3ERSX 4JV5L 3M4PA 4MTNA 4QIWE 4JI2L 4POFA 3T1HL 3UDGA 2OCEA 4A3GH 5HY6A 1A0IA 3UDFA 1XJVA 4LWCA 3I4MH 3RZDH 2JJQA 1VS0A 1NY4A 3CAMA 3MXNB 2NZHA 2ASBA 2IX1A 4A3EH 3KYHC 3PIPA 4BY7H 4B3RQ 3CCMA 4AH6A 4JI5Q 4X66L 3CCEA 3L0OA 5ELNA 1Y1WG 4BA2I 1BVSA 1E22A 1EIYB 1QUQA 3W5OA 4Y52H 2HQLA 5LMUL 4DV5L 1VQ9A 1QZHA 1VQPA 2WB1G 1K73C 1OXUA 3BZKA 2D0PA 1VQIA 1KRTA 1HNXQ 1NBWA 3K7UC 1WFQA 3D31A 4HJ7A 4DR3Q 3OW2A 2NVTH 4GN3B 4LF9Q 3HKZG 2K52A 1CKOA 1N34L 3H3VI 4UP8A 2WB1E 2UU9Q 3CCSA 1XNRQ 1CKNB 1SE8A 1WJJA 1YVCA 3CW2C 1VQ8A 4BY1H 3HOZG 2AKWB 1EQRA 1E24A 1HNWQ 3HKZE 2GVBA 3J81j 2PQAB 1KRSA 2OQ0A 1EFWA 5C0XI 4WJ3M 4BY7G 2RCNA 1IYJB 1K83H 1VQCA 4GN5A 4DUZQ 1I5FA 1VQEA 2E5LL 2IX0A 3I4MG 3VDYA 1L0WA 1D8LA 1I3QH 1SLJA 5JJLA 4JBMA 1K3RA 1IZ6A 3K80C 5C4JH 4YHHQ 2ZTEA 3HFZB 4A3EG 2OWOA 3OTOQ 3DLLA 2VQEQ 5M3MG 3AFQA 2RHSB 2I5LX 4AYBE 3DM3A 2A19A 3PUYA 1PH2A 4KI0A 3UE1A 2MO0A 1GD7A 1VQHA 4LFAQ 1VQ4A 1JB7A 4NXMQ 4QY7A 3M7NA 1Y1VG 2QA4A 3I4OA 3FKIH 2VNUD 2F52A 3PUZA 3PO2H 2VS1A 4C3HH 2IT1A 4LFCQ 2K5NA 3HOWH 1QZGA 4JI4L 2A1AA 3KF8B 2JA6G 4A3JH 2JE6I 1PH3A 1WOCA 4R4OA 2E8GA 4JI8Q 4Y7NH 2ALYB 2GVAA 4A4IA 5IE8A 1SRUA 1L1OA 4MNOA 4UP7A 4IFDJ 2KHJA 1N32Q 2R7DA 2VQFL 4A3IH 1VQLA 2UXDL 3CC7A 4DR4L 2R93H 4BY1G 4GNXB 1XMOL 3KFUA 2YU9H 4DR6Q 2PI2A 1HNXL 1IBKL 4HIMA 1BBWA 3G71A 3J80c 1UEBA 4QJFA 4DR3L 1Q12A 1L1OC 2BH2A 2ZJQA 2UU9L 3D0FA 4TQUS 1M1KC 1XNRL 3PUVA 4J15A 3RR5A 1Z9FA 4X62Q 4A3KH 5HGQA 1IL2A 3A5UA 3F2BA 2K14A 3F1ZA 1U5KA 4B3TQ 2D0OA 3S15H 4IPCA 4JV5Q 3PCOB 2B29A 2E2HH 1FL0A 4GN4B 4OXPA 3ZJYC 3KF6A 5IP9H 3T1HQ 1FJGL 1HZ9A 4YWMA 2AMCB 3AFPA 1E7ZA 1YITA 2QGQA 1A8VA 4L5TA 2LXKA 1WI5A 4YHHL 3GTOH 3HOWG 1PVOA 1VQDA 2XGTA 5GAEC 3OTOL 4IFDG 2OTJA 4A3JG 3S24A 1WYDA 1NMGA 2VUMH 2HIXA 5IYBG 3CCJA 3UE0A 2ZJRA 1XPOA 4LFAL 4B3SL 3PO3H 2R7ZH 3PUXA 2YYZA 3STBD 4A3IG 4LF8L 2R93G 1I94L 1CUKA 3L7ZC 3E9IA 5LMUQ 1VQ6A 1UE1A 1X6OA 3W1BA 1RL2A 3PSIA 3H15A 2KCTA 3I2ZA 3I7FA 4JI8L 4YCUA 1LUZA 2JQOA 4IOAA 5JEAJ 1YZ6A 1Q7YC 2Q2IA 1N34Q 4DAMA 4A3KG 1S72A 1X54A 4XIGS 1PH9A 4HIKA 2UUCQ 4JI0L 4LF7L 5IP7H 4DR6L 1GVPA 3F8TA 5IYDH 4DNIA 5IP9G 4P72A 4JYAL 3WWVA 1PYBA 3IRBA 1MIUA 2WFWA 2E5LQ 1CSQA 3K8AA 4IO9A 1NE3A 3NEMA 2PMZE 2EIFA 3CXCA 5GAGC 4L5QA 4YWKA 3CMAA 4PG3A 3EIVA 4IJHA 2VUMG 4A3MH 4A3DH 3CF5A 2HT1A 3PO3G 3OYYA 3G48A 4DK3C 1YJ9A 1K9MC 3S14H 2AHOB 3KDFA 5FLXc 5EAYA 2N49A 1MJCA 2UUBQ 1XNQL 4APVA 1HNZL 1IBML 3CPFA 1PH1A 4UP9A 1W2BA 2CQOA 1C9OA 5JEAG 4BBRH 1Q81C 1HR0L 5BR8Q 4JI4Q 4A3LH 1X65A 4O2DA 2E2JH 2VZAA 1PH7A 2IY5B 5FLMH 2YTXA 2ZJPA 5LMNQ 2VQFQ 1XPRA 3RLFA 4HJ8A 2CKZB 3CCRA 3CD6A 1XMOQ 4DR4Q 2UXDQ 5IP7G 5IYCH 4DV0Q 1HJPA 4GOPB 3FHWA 2R92G 4OO1G 1QUQB 5IYDG 2N8NA 4X64L 1IBKQ 5C44H 2WAQG 2B63H 3HOVH 2N78A 4OX9L 4P74A 4DAYB 4LF6L 4KHPL 5H1SE 1Z47A 4GLAC 1WCMH 1E3PA 1GM5A 4IPGA 2UUCL 2WAQE 5M5YH 1SROA 1C0AA 2DUDA 2KBNA 4ALPA 4A3DG 1U0LA 1JJCB 1YHBA 5DLQE 4DV4Q 3CC2A 2UXBL 4A3GG 1X3FA 3KLWA 3W1GA 1FJGQ 1H95A 4RMFA 3RLNA 1TWCH 1KL9A 2C35B 3B6YA 3F2CA 4DR2L 4RG1A 3J81c 1Y14B 4UPAA 4A3LG 4BBRG 2MFIA 1UE5A 2Z0SA 4DV6Q 4OO1I 2JEBI 3S17H 1E1TA 1X55A 3G6EA 2JEAI 5FLMG 1OTCA 4B3SQ 1JE5A 5M3FH 4LF4L 4LF8Q 3AQQA 4YCVA 1I94Q 1C7YA 1D7QA 5IYCG 3J80i 3GTGH 1X3GA 3I55A 2B3GA 5BR8L 5C44G 2PI2E 4YY3L 1XTDA 1JMCA 1VQKA 2UUAL 2B63G 3HOVG 3U4ZA 4K0KL 3PF4A 1ASZA 1QVFA 3J7ZC 4DK6C 4GKJL 4X6AH 1WCMG 5LMNL 1Q82C 1VQ5A 3GTMH 4DR1L 3PIOA 2EXDA 4DV0L 4LF7Q 1L1OB 4OWXB 1TWAH 4JI0Q 1G51A 2I5MX 4NXNQ 2JA7H 2NVXH 1YIJA 4BA1I 5C3EH 4JYAQ 4R4QA 2CWPA 3UDIA 4A3BH 1R9TH 4GLXA 2GN5A 5FJ8H 4JI7L 2MQHA 4GNXA 4TVAB 4JC0A 2L15A 4DV4L 3KJOA 1J5EL 5M3FG 2F3IA 3FKIG 2K5HA 1VQOA 3GDEA 1GO3E 2K50A 2JA5H 4JI3Q 3PO2G 4LF5L 1HZAA 4FDBA 3E0EA 4A3CH 4YWLA 4X65L 5M5WH 4GNXC 1XNQQ 1I6HH 3KF6B 2QEXA 3A0JA 1HNZQ 1IBMQ 1VQNA 3U4VA 4PZ8A 4DV6L 1HR0Q 3S1QH 2ZM6Q 4DV2Q 1Q1EA 4GS3A 3G4SA 2VW9A 1VQMA 3TQYA 2I0QA 3F2DA 3M3YH 3S1NH 4L5RC 2YTVA 4GLVB 4DV1L 3S1MH 3S2DH 1VQAA 4JI1L 2LXJA 3J7A5 1EOVA 5E7NA 2IHFA 2WP8J 2F4VL 3A5ZB 2JA7G 5K36G 1IBLL 4X64Q 1ASYA 1PH4A 1G291 5C3EG 2VL6A 3CMEA 2UUBL 5GROA 2PNHA 4OX9Q 4LF6Q 4KHPQ 4L5SA 4A3BG 3PUWA 3TS0A 2MNAA 4R4TA 5FJ8G 2CFMA 1VQGA 5J3BA 2HIVA 4NXNL 1K0RA 2KHIA 4IFDI 3BU2A 1UWVA 1YEZA 4YCWA 4C3IH 3H3VH 1AE3A 1HZBA 2AWNA 4OWTB 4JI6L 2D62A 2MO1A 1W3SA 1PA6A 3GTKH 2UXBQ 1TWGH 4DR7L 2FXQA 1XMQL 5IWAL 1XPUA 1EWIA 1JJ2A 4A3CG 1Q46A 1SR3A 3FP9A 4DR2Q 2BA0A 3CCQA 4BBSH 3RLOA 1S3OA 1X9NA 3JC66 1KC8C 1PH6A 4ME3A 5C0XJ 3CCUA 2R7ZG 4EX5A 3T1YQ 1EUJA 4JI3L 1G6PA 4LF4Q 3LGJA 1QVGA 3CC4A 1SN8A 3K81C 3M85A 4LUZA 3CP0A 1LM0A 4QL5A 2ZM6L 3M4QA 4IPHA 3KDFB 4DV2L 4YY3Q 2UUAQ 1B8AA 4P71A 1EQQA 2ES2A 2Q2TA 2NVYH 4LNQA 3AEVA 4K0KQ 4NB3A 3GTQH 1PH5A 2NVQH 1JT8A 4DPGA 4GKJQ 1YHQA 4XTCS 4DV3L 3HOZH 1B70B 1J6QA 1M90C 4DR1Q 1QVCA 1VQJA 3MEFA 1OXSC 4H02A 4KLKA 3HKSA 3PV0A 1KAWA 1K8AC 1TXYA 1N33L 2K75A 1YJWA 3AYHB 1L2FA 3E9HA 4JBKA 1YJNA 3J81i 1OXXK 4DUYL 3GO5A 4WJ4A 4R1JA 4JCVE 2XTIA 2RF4A 1HH2P 2ZTDA 2R6GA 5C0XG 5M3MH 4BBSG 4JI7Q 2OTLA 1YNXA 1KHIA 3U50C 3ULPA 4A3MG 4GOPA 2UXCL 3BZCA 2AWOA 3S2HH 1Y1VH 1J5EQ 1P8LA 1PFSA 4PMWA 2IHEA 4MZ9A 3EN2A 4DV7L 1N36L 2LSSA 4AIMA 4AQYL 4LF5Q 4LFBL 4A76A 1IXRA 4KHZA 4O0AA 1B7YB 2JK8A 4X65Q 2JA6H 1CKNA 3ER0A 5ELOA 4EQ5A 4DR5L 4GOPC 4JBWA 3H0GH 4PZ6A 2EQSA 3NELA 4QGUA 1MKHA 4B3MQ 4C2MH 3TS2A 2VY3A 3T1YL 1EIFA 2PQAA 5AJ3L 3GTPH 4HJ5A 2Z6KA 4DV1Q 4BXXH 4JI1Q 1AE2A 2F4VQ 3JAMi 3HOYH 1YI2A 2CWAA 4A75A 1IBLQ 1VCIA 4AYBG 1EYGA 3GTLH 2NZOA 3U58A 3BJUA 4A3FH 4HIOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z6K C;  4A93 H;  1I50 H;  1BKB A;  3S1R H;  4HID A;  2YTY A;  1V9P A;  2Q2U A;  3HOU H;  5IT9 c;  3RZO H;  4OON A;  1FGU A;  4NPS A;  3TRE A;  3JAM c;  3CCV A;  1VQB A;  1TWH H;  5M5X H;  4JI6 Q;  1A63 A;  3A74 A;  1PYS B;  2Y0S G;  4P73 A;  1XMQ Q;  5IWA Q;  5C4X H;  3TRZ A;  4DR7 Q;  4LW1 A;  4B3R L;  4JI5 L;  3TEH B;  1P16 A;  3SGI A;  3CCL A;  4POG A;  5IYB H;  3UDX A;  3H0G G;  1PHJ A;  1PH8 A;  1HZC A;  2Y0S E;  4JG2 A;  5GAH C;  2A8V A;  1NTG A;  1E1O A;  1UE6 A;  2BA1 A;  1HR0 W;  2NN6 G;  4DKA C;  4C3J H;  1S40 A;  2H5X A;  3NBH B;  1YHA A;  4GKK Q;  2Q2H A;  4IJL A;  3STB C;  4IOC A;  1SFO H;  5GAD C;  4BXX G;  3HOY G;  2V1C C;  2KEN A;  4LF9 L;  4P75 A;  3I56 A;  4B3M L;  2I5H A;  4A3F G;  2ZTC A;  3HOX H;  4HJ9 A;  4DV3 Q;  4A93 G;  1HNW L;  4LUV A;  5IY0 A;  1V43 A;  4LUO A;  3HOU G;  1X3E A;  1FVI A;  2JA8 H;  3M9B A;  4JI2 Q;  1NJI C;  3CPW A;  4DUZ L;  2K5V A;  1PV4 A;  1N33 Q;  3I4N H;  1OXT A;  1LYL A;  1VQF A;  5C4X G;  1UE7 A;  2NN6 I;  4DUY Q;  2OQK A;  3RN5 A;  2VQE L;  3M4O H;  2ATW A;  3PGZ A;  4R4C A;  4NXM L;  2N3S A;  4X66 Q;  3KOJ A;  4JOI A;  3K0X A;  4OWW B;  3ICE A;  1RIP A;  1BBU A;  2UXC Q;  4JBJ A;  3RNU A;  1OXV A;  1YBY A;  2JA5 G;  4R4I A;  3K7A H;  5GQO A;  2E2I H;  1JJG A;  2RHQ B;  4LFC L;  4DV5 Q;  4DV7 Q;  1N36 Q;  3EBE A;  2R7F A;  1A62 A;  1GKH A;  4AQY Q;  2ID0 A;  1Q86 C;  3RN2 A;  1CSP A;  2HHH L;  1MJE A;  4LFB Q;  1KIX A;  3KJP A;  4JOI C;  1Q8K A;  4PZ7 A;  1NMF A;  4DR5 Q;  2JA9 A;  2YV5 A;  1Y1W H;  1KD1 C;  1N32 L;  3GD7 A;  5JJK A;  1Q1B A;  3ULJ A;  1DGS A;  1KXL A;  2KCM A;  3L2P A;  3NEN A;  3HOX G;  1T9H A;  1O7I A;  2DGY A;  3Q8D A;  3ULL A;  5AJ3 Q;  4GKK L;  2R92 H;  4IPD A;  1N9W A;  1N8R C;  2JA8 G;  5LMN W;  1AH9 A;  1V1Q A;  4HJA A;  3CQZ H;  2CCZ A;  3I4N G;  1CKM A;  4QQB X;  3S16 H;  1TWF H;  1X56 A;  4X62 L;  1KQS A;  2K4K A;  1VQ7 A;  1K8G A;  2HHH Q;  3PF5 A;  1SMX A;  4B3T L;  3GTJ H;  2BH8 A;  5JJI A;  4UY8 C;  1LTL A;  3ERS X;  4JV5 L;  3M4P A;  4MTN A;  4QIW E;  4JI2 L;  4POF A;  3T1H L;  3UDG A;  2OCE A;  4A3G H;  5HY6 A;  1A0I A;  3UDF A;  1XJV A;  4LWC A;  3I4M H;  3RZD H;  2JJQ A;  1VS0 A;  1NY4 A;  3CAM A;  3MXN B;  2NZH A;  2ASB A;  2IX1 A;  4A3E H;  3KYH C;  3PIP A;  4BY7 H;  4B3R Q;  3CCM A;  4AH6 A;  4JI5 Q;  4X66 L;  3CCE A;  3L0O A;  5ELN A;  1Y1W G;  4BA2 I;  1BVS A;  1E22 A;  1EIY B;  1QUQ A;  3W5O A;  4Y52 H;  2HQL A;  5LMU L;  4DV5 L;  1VQ9 A;  1QZH A;  1VQP A;  2WB1 G;  1K73 C;  1OXU A;  3BZK A;  2D0P A;  1VQI A;  1KRT A;  1HNX Q;  1NBW A;  3K7U C;  1WFQ A;  3D31 A;  4HJ7 A;  4DR3 Q;  3OW2 A;  2NVT H;  4GN3 B;  4LF9 Q;  3HKZ G;  2K52 A;  1CKO A;  1N34 L;  3H3V I;  4UP8 A;  2WB1 E;  2UU9 Q;  3CCS A;  1XNR Q;  1CKN B;  1SE8 A;  1WJJ A;  1YVC A;  3CW2 C;  1VQ8 A;  4BY1 H;  3HOZ G;  2AKW B;  1EQR A;  1E24 A;  1HNW Q;  3HKZ E;  2GVB A;  3J81 j;  2PQA B;  1KRS A;  2OQ0 A;  1EFW A;  5C0X I;  4WJ3 M;  4BY7 G;  2RCN A;  1IYJ B;  1K83 H;  1VQC A;  4GN5 A;  4DUZ Q;  1I5F A;  1VQE A;  2E5L L;  2IX0 A;  3I4M G;  3VDY A;  1L0W A;  1D8L A;  1I3Q H;  1SLJ A;  5JJL A;  4JBM A;  1K3R A;  1IZ6 A;  3K80 C;  5C4J H;  4YHH Q;  2ZTE A;  3HFZ B;  4A3E G;  2OWO A;  3OTO Q;  3DLL A;  2VQE Q;  5M3M G;  3AFQ A;  2RHS B;  2I5L X;  4AYB E;  3DM3 A;  2A19 A;  3PUY A;  1PH2 A;  4KI0 A;  3UE1 A;  2MO0 A;  1GD7 A;  1VQH A;  4LFA Q;  1VQ4 A;  1JB7 A;  4NXM Q;  4QY7 A;  3M7N A;  1Y1V G;  2QA4 A;  3I4O A;  3FKI H;  2VNU D;  2F52 A;  3PUZ A;  3PO2 H;  2VS1 A;  4C3H H;  2IT1 A;  4LFC Q;  2K5N A;  3HOW H;  1QZG A;  4JI4 L;  2A1A A;  3KF8 B;  2JA6 G;  4A3J H;  2JE6 I;  1PH3 A;  1WOC A;  4R4O A;  2E8G A;  4JI8 Q;  4Y7N H;  2ALY B;  2GVA A;  4A4I A;  5IE8 A;  1SRU A;  1L1O A;  4MNO A;  4UP7 A;  4IFD J;  2KHJ A;  1N32 Q;  2R7D A;  2VQF L;  4A3I H;  1VQL A;  2UXD L;  3CC7 A;  4DR4 L;  2R93 H;  4BY1 G;  4GNX B;  1XMO L;  3KFU A;  2YU9 H;  4DR6 Q;  2PI2 A;  1HNX L;  1IBK L;  4HIM A;  1BBW A;  3G71 A;  3J80 c;  1UEB A;  4QJF A;  4DR3 L;  1Q12 A;  1L1O C;  2BH2 A;  2ZJQ A;  2UU9 L;  3D0F A;  4TQU S;  1M1K C;  1XNR L;  3PUV A;  4J15 A;  3RR5 A;  1Z9F A;  4X62 Q;  4A3K H;  5HGQ A;  1IL2 A;  3A5U A;  3F2B A;  2K14 A;  3F1Z A;  1U5K A;  4B3T Q;  2D0O A;  3S15 H;  4IPC A;  4JV5 Q;  3PCO B;  2B29 A;  2E2H H;  1FL0 A;  4GN4 B;  4OXP A;  3ZJY C;  3KF6 A;  5IP9 H;  3T1H Q;  1FJG L;  1HZ9 A;  4YWM A;  2AMC B;  3AFP A;  1E7Z A;  1YIT A;  2QGQ A;  1A8V A;  4L5T A;  2LXK A;  1WI5 A;  4YHH L;  3GTO H;  3HOW G;  1PVO A;  1VQD A;  2XGT A;  5GAE C;  3OTO L;  4IFD G;  2OTJ A;  4A3J G;  3S24 A;  1WYD A;  1NMG A;  2VUM H;  2HIX A;  5IYB G;  3CCJ A;  3UE0 A;  2ZJR A;  1XPO A;  4LFA L;  4B3S L;  3PO3 H;  2R7Z H;  3PUX A;  2YYZ A;  3STB D;  4A3I G;  4LF8 L;  2R93 G;  1I94 L;  1CUK A;  3L7Z C;  3E9I A;  5LMU Q;  1VQ6 A;  1UE1 A;  1X6O A;  3W1B A;  1RL2 A;  3PSI A;  3H15 A;  2KCT A;  3I2Z A;  3I7F A;  4JI8 L;  4YCU A;  1LUZ A;  2JQO A;  4IOA A;  5JEA J;  1YZ6 A;  1Q7Y C;  2Q2I A;  1N34 Q;  4DAM A;  4A3K G;  1S72 A;  1X54 A;  4XIG S;  1PH9 A;  4HIK A;  2UUC Q;  4JI0 L;  4LF7 L;  5IP7 H;  4DR6 L;  1GVP A;  3F8T A;  5IYD H;  4DNI A;  5IP9 G;  4P72 A;  4JYA L;  3WWV A;  1PYB A;  3IRB A;  1MIU A;  2WFW A;  2E5L Q;  1CSQ A;  3K8A A;  4IO9 A;  1NE3 A;  3NEM A;  2PMZ E;  2EIF A;  3CXC A;  5GAG C;  4L5Q A;  4YWK A;  3CMA A;  4PG3 A;  3EIV A;  4IJH A;  2VUM G;  4A3M H;  4A3D H;  3CF5 A;  2HT1 A;  3PO3 G;  3OYY A;  3G48 A;  4DK3 C;  1YJ9 A;  1K9M C;  3S14 H;  2AHO B;  3KDF A;  5FLX c;  5EAY A;  2N49 A;  1MJC A;  2UUB Q;  1XNQ L;  4APV A;  1HNZ L;  1IBM L;  3CPF A;  1PH1 A;  4UP9 A;  1W2B A;  2CQO A;  1C9O A;  5JEA G;  4BBR H;  1Q81 C;  1HR0 L;  5BR8 Q;  4JI4 Q;  4A3L H;  1X65 A;  4O2D A;  2E2J H;  2VZA A;  1PH7 A;  2IY5 B;  5FLM H;  2YTX A;  2ZJP A;  5LMN Q;  2VQF Q;  1XPR A;  3RLF A;  4HJ8 A;  2CKZ B;  3CCR A;  3CD6 A;  1XMO Q;  4DR4 Q;  2UXD Q;  5IP7 G;  5IYC H;  4DV0 Q;  1HJP A;  4GOP B;  3FHW A;  2R92 G;  4OO1 G;  1QUQ B;  5IYD G;  2N8N A;  4X64 L;  1IBK Q;  5C44 H;  2WAQ G;  2B63 H;  3HOV H;  2N78 A;  4OX9 L;  4P74 A;  4DAY B;  4LF6 L;  4KHP L;  5H1S E;  1Z47 A;  4GLA C;  1WCM H;  1E3P A;  1GM5 A;  4IPG A;  2UUC L;  2WAQ E;  5M5Y H;  1SRO A;  1C0A A;  2DUD A;  2KBN A;  4ALP A;  4A3D G;  1U0L A;  1JJC B;  1YHB A;  5DLQ E;  4DV4 Q;  3CC2 A;  2UXB L;  4A3G G;  1X3F A;  3KLW A;  3W1G A;  1FJG Q;  1H95 A;  4RMF A;  3RLN A;  1TWC H;  1KL9 A;  2C35 B;  3B6Y A;  3F2C A;  4DR2 L;  4RG1 A;  3J81 c;  1Y14 B;  4UPA A;  4A3L G;  4BBR G;  2MFI A;  1UE5 A;  2Z0S A;  4DV6 Q;  4OO1 I;  2JEB I;  3S17 H;  1E1T A;  1X55 A;  3G6E A;  2JEA I;  5FLM G;  1OTC A;  4B3S Q;  1JE5 A;  5M3F H;  4LF4 L;  4LF8 Q;  3AQQ A;  4YCV A;  1I94 Q;  1C7Y A;  1D7Q A;  5IYC G;  3J80 i;  3GTG H;  1X3G A;  3I55 A;  2B3G A;  5BR8 L;  5C44 G;  2PI2 E;  4YY3 L;  1XTD A;  1JMC A;  1VQK A;  2UUA L;  2B63 G;  3HOV G;  3U4Z A;  4K0K L;  3PF4 A;  1ASZ A;  1QVF A;  3J7Z C;  4DK6 C;  4GKJ L;  4X6A H;  1WCM G;  5LMN L;  1Q82 C;  1VQ5 A;  3GTM H;  4DR1 L;  3PIO A;  2EXD A;  4DV0 L;  4LF7 Q;  1L1O B;  4OWX B;  1TWA H;  4JI0 Q;  1G51 A;  2I5M X;  4NXN Q;  2JA7 H;  2NVX H;  1YIJ A;  4BA1 I;  5C3E H;  4JYA Q;  4R4Q A;  2CWP A;  3UDI A;  4A3B H;  1R9T H;  4GLX A;  2GN5 A;  5FJ8 H;  4JI7 L;  2MQH A;  4GNX A;  4TVA B;  4JC0 A;  2L15 A;  4DV4 L;  3KJO A;  1J5E L;  5M3F G;  2F3I A;  3FKI G;  2K5H A;  1VQO A;  3GDE A;  1GO3 E;  2K50 A;  2JA5 H;  4JI3 Q;  3PO2 G;  4LF5 L;  1HZA A;  4FDB A;  3E0E A;  4A3C H;  4YWL A;  4X65 L;  5M5W H;  4GNX C;  1XNQ Q;  1I6H H;  3KF6 B;  2QEX A;  3A0J A;  1HNZ Q;  1IBM Q;  1VQN A;  3U4V A;  4PZ8 A;  4DV6 L;  1HR0 Q;  3S1Q H;  2ZM6 Q;  4DV2 Q;  1Q1E A;  4GS3 A;  3G4S A;  2VW9 A;  1VQM A;  3TQY A;  2I0Q A;  3F2D A;  3M3Y H;  3S1N H;  4L5R C;  2YTV A;  4GLV B;  4DV1 L;  3S1M H;  3S2D H;  1VQA A;  4JI1 L;  2LXJ A;  3J7A 5;  1EOV A;  5E7N A;  2IHF A;  2WP8 J;  2F4V L;  3A5Z B;  2JA7 G;  5K36 G;  1IBL L;  4X64 Q;  1ASY A;  1PH4 A;  1G29 1;  5C3E G;  2VL6 A;  3CME A;  2UUB L;  5GRO A;  2PNH A;  4OX9 Q;  4LF6 Q;  4KHP Q;  4L5S A;  4A3B G;  3PUW A;  3TS0 A;  2MNA A;  4R4T A;  5FJ8 G;  2CFM A;  1VQG A;  5J3B A;  2HIV A;  4NXN L;  1K0R A;  2KHI A;  4IFD I;  3BU2 A;  1UWV A;  1YEZ A;  4YCW A;  4C3I H;  3H3V H;  1AE3 A;  1HZB A;  2AWN A;  4OWT B;  4JI6 L;  2D62 A;  2MO1 A;  1W3S A;  1PA6 A;  3GTK H;  2UXB Q;  1TWG H;  4DR7 L;  2FXQ A;  1XMQ L;  5IWA L;  1XPU A;  1EWI A;  1JJ2 A;  4A3C G;  1Q46 A;  1SR3 A;  3FP9 A;  4DR2 Q;  2BA0 A;  3CCQ A;  4BBS H;  3RLO A;  1S3O A;  1X9N A;  3JC6 6;  1KC8 C;  1PH6 A;  4ME3 A;  5C0X J;  3CCU A;  2R7Z G;  4EX5 A;  3T1Y Q;  1EUJ A;  4JI3 L;  1G6P A;  4LF4 Q;  3LGJ A;  1QVG A;  3CC4 A;  1SN8 A;  3K81 C;  3M85 A;  4LUZ A;  3CP0 A;  1LM0 A;  4QL5 A;  2ZM6 L;  3M4Q A;  4IPH A;  3KDF B;  4DV2 L;  4YY3 Q;  2UUA Q;  1B8A A;  4P71 A;  1EQQ A;  2ES2 A;  2Q2T A;  2NVY H;  4LNQ A;  3AEV A;  4K0K Q;  4NB3 A;  3GTQ H;  1PH5 A;  2NVQ H;  1JT8 A;  4DPG A;  4GKJ Q;  1YHQ A;  4XTC S;  4DV3 L;  3HOZ H;  1B70 B;  1J6Q A;  1M90 C;  4DR1 Q;  1QVC A;  1VQJ A;  3MEF A;  1OXS C;  4H02 A;  4KLK A;  3HKS A;  3PV0 A;  1KAW A;  1K8A C;  1TXY A;  1N33 L;  2K75 A;  1YJW A;  3AYH B;  1L2F A;  3E9H A;  4JBK A;  1YJN A;  3J81 i;  1OXX K;  4DUY L;  3GO5 A;  4WJ4 A;  4R1J A;  4JCV E;  2XTI A;  2RF4 A;  1HH2 P;  2ZTD A;  2R6G A;  5C0X G;  5M3M H;  4BBS G;  4JI7 Q;  2OTL A;  1YNX A;  1KHI A;  3U50 C;  3ULP A;  4A3M G;  4GOP A;  2UXC L;  3BZC A;  2AWO A;  3S2H H;  1Y1V H;  1J5E Q;  1P8L A;  1PFS A;  4PMW A;  2IHE A;  4MZ9 A;  3EN2 A;  4DV7 L;  1N36 L;  2LSS A;  4AIM A;  4AQY L;  4LF5 Q;  4LFB L;  4A76 A;  1IXR A;  4KHZ A;  4O0A A;  1B7Y B;  2JK8 A;  4X65 Q;  2JA6 H;  1CKN A;  3ER0 A;  5ELO A;  4EQ5 A;  4DR5 L;  4GOP C;  4JBW A;  3H0G H;  4PZ6 A;  2EQS A;  3NEL A;  4QGU A;  1MKH A;  4B3M Q;  4C2M H;  3TS2 A;  2VY3 A;  3T1Y L;  1EIF A;  2PQA A;  5AJ3 L;  3GTP H;  4HJ5 A;  2Z6K A;  4DV1 Q;  4BXX H;  4JI1 Q;  1AE2 A;  2F4V Q;  3JAM i;  3HOY H;  1YI2 A;  2CWA A;  4A75 A;  1IBL Q;  1VCI A;  4AYB G;  1EYG A;  3GTL H;  2NZO A;  3U58 A;  3BJU A;  4A3F H;  4HIO A; 
#chains in the Genus database with same CATH topology
 2WAQ A;  3CQZ A;  2LFN A;  1XMQ H;  2ZT9 C;  1BKB A;  1TWF A;  1RYS A;  1I4P A;  1ZET A;  3MFI A;  1K8M A;  2Q2U A;  5IT9 c;  3RZO H;  2F0M A;  3GTJ A;  1M0T A;  4ZK9 B;  3KF8 A;  3JAM c;  2NVQ B;  1VQB A;  5M5X H;  2WV6 D;  3M9M B;  1S0M A;  5JVG 3;  4DR7 Q;  1PYS B;  2Y0S G;  3TRZ A;  5KFH A;  2BQ3 A;  3DXJ C;  3URY A;  4EVO A;  2JSO A;  2R6F A;  5J22 A;  2RSN A;  3H0G G;  2A8V A;  3PW5 A;  1EUD B;  5EZY F;  1EQT A;  3P7J A;  1MHW C;  4RFB A;  3PMF A;  1G6Z A;  2H5X A;  4DV3 H;  4BXX G;  2HCI A;  5GAD C;  4FXG C;  4MV9 A;  3HOY G;  4ECZ A;  2K5Q A;  4LF9 L;  4P75 A;  5C1O A;  3I56 A;  3S2H B;  3K5O A;  5J1Z A;  1VAJ A;  3GV6 A;  4LF6 H;  3NWT A;  2R87 A;  2Y0S B;  1F9Q A;  2PQE A;  4N8X 1;  2F0W A;  3HXL A;  3HBL A;  1V43 A;  4O3O A;  2W8K A;  4QW9 A;  3HOU G;  1X3E A;  2JA8 H;  4JI2 Q;  1O7Z A;  3SHL A;  2K5V A;  3I4N H;  2V5A A;  3NWS A;  3OHB A;  4NDX A;  2I8C A;  2UXB H;  2SDF A;  2K7V A;  5C4X G;  2UVW A;  4DUY Q;  4DV7 H;  1KNE A;  4R8U A;  2ATW A;  2AUJ D;  4MTD A;  3NTH A;  2C00 A;  1BXR A;  1EL0 A;  3HOY B;  4LSX A;  1BOS A;  1QG7 A;  3FVQ A;  4F88 A;  1RIP A;  3RNU A;  3NPP A;  1QNU A;  5GQO A;  1S5E D;  2GPS A;  2RHQ B;  4O3Q A;  2W8L A;  1I50 B;  4DV5 Q;  4EBE A;  1Q86 C;  1A62 A;  3FKI A;  1MJE A;  3KJP A;  4MV3 A;  5FD6 A;  3HOU B;  1NMF A;  3SDZ A;  2JA9 A;  2YV5 A;  3VR2 A;  1KD1 C;  2NVX B;  3ULJ A;  2KCM A;  1KDB A;  3L2P A;  3NEN A;  2EJM A;  2DGY A;  1O7I A;  2F0J A;  3HOX G;  3M9N B;  3SK6 A;  3TZU A;  2R92 H;  3DHQ A;  4IPD A;  5EPJ A;  4J9L A;  1N8R C;  1CHP D;  3SR1 A;  1AH9 A;  2CCZ A;  2H1E A;  5GON F;  4HMJ A;  1CA5 A;  4JVZ A;  1HQR D;  2FMA A;  1K8G A;  5KFV A;  1SMX A;  5JJI A;  2BH8 A;  1SFO B;  2EE1 A;  4KD4 A;  1Z2N X;  4QIW E;  2RGV A;  4JI2 L;  4RGM A;  4POF A;  1LTA D;  2OCE A;  4RH6 A;  4RCN A;  3VR5 A;  5C8Y F;  3UDF A;  5J39 A;  5KFS A;  3I4M H;  2JJQ A;  1NY4 A;  3T56 B;  1L0X B;  3HOX B;  4JK1 C;  4IUN A;  2YL2 A;  4HAE A;  3RV3 A;  4BY7 H;  4LF5 H;  2F0E A;  4DA2 A;  5C5M A;  4BA2 I;  2O5J C;  1B3A A;  1RHP A;  4ZUJ A;  3H4B A;  4Y52 H;  2FFK B;  2NU6 B;  4DV5 L;  1QZH A;  4HNU A;  4RZQ A;  3M4O B;  1K73 C;  3K6O A;  1DD2 A;  3I8Z A;  4XXE A;  3OW2 A;  4DR3 Q;  4GN3 B;  2DPJ A;  1CKO A;  3OWF A;  2Z4I A;  1JIC A;  3CW2 C;  2AKW B;  2SNS A;  4TV8 F;  4IRK A;  1PRT F;  4UHV A;  3N44 B;  4RAU C;  2GVB A;  2F0S A;  4ECS A;  1EFW A;  2VUG A;  3KLS A;  3G7L A;  3RV4 A;  4X3K A;  1WD0 A;  3J81 L;  2DJF C;  1VQC A;  1OWT A;  4GN5 A;  4DUZ Q;  1JOO A;  2BE5 D;  1SCU B;  2XIG A;  4XZ3 B;  3L4K A;  4N9T A;  1D8L A;  1SLJ A;  1EY5 A;  4YHH Q;  2A5H A;  3AFQ A;  2RHS B;  3DM3 A;  1RDP D;  1PH2 A;  3UE1 A;  1VQ4 A;  1IL8 A;  1DOK A;  1YNJ C;  3CQZ B;  4QY7 A;  1T94 A;  3I72 A;  1TWF B;  4U7C A;  1FR3 A;  4C3H H;  2IT1 A;  5I4D A;  2SOB A;  4EGV A;  5HBR B;  3GTJ B;  4JI4 L;  1IKL A;  4EGQ A;  3KF8 B;  4A3J H;  1GUT A;  2EYH A;  2E8G A;  4JI8 Q;  3SE7 A;  4MNO A;  4UP7 A;  4IFD J;  2KHJ A;  3PQI A;  2VQF L;  4A3I H;  5KFX A;  3CC7 A;  4DR4 L;  2AU0 A;  1DOL A;  4BY1 G;  4GNX B;  2YU9 H;  2YZN A;  3DWP A;  4HIM A;  1X3P A;  3A7L A;  3DEO A;  4DR3 L;  2BH2 A;  3K5I A;  3VR3 A;  2BR0 A;  4JI2 H;  1LO5 D;  4I50 F;  4TQU S;  2K6A A;  3KBG A;  1M1K C;  3PUV A;  4A3K H;  5HGQ A;  3A5U A;  3F2B A;  2CHB D;  1PDQ A;  1NR2 A;  2D0O A;  4FYD A;  4TSS A;  1QIL A;  1IW7 D;  1E2Z A;  4Q0F A;  3NBH A;  4JV5 Q;  4I55 F;  2B29 A;  1FL0 A;  1STY A;  4OXP A;  3Q0A A;  4HCE A;  3AFP A;  1E7Z A;  3GTP B;  2KEC A;  2QGQ A;  1A8V A;  2XNA C;  4L5T A;  1H9S B;  4BY1 B;  4YHH L;  3HOW G;  1VQD A;  4DV5 H;  3NSW A;  2J6U A;  2BDO A;  1NMG A;  5IYB G;  1S5B D;  3UE0 A;  5ISR A;  4B3S L;  3PO3 H;  4R8U B;  1K28 A;  2W6O A;  2XCA A;  2W6Z A;  5KKN B;  3LWE A;  1OO9 B;  2X0S A;  3L7Z C;  1VQ6 A;  5LMU Q;  4J6H A;  5C4J B;  1TT2 A;  3W1B A;  3G6X A;  3I2Z A;  3C1E A;  3Q1K A;  4JI8 L;  4IWX A;  4MV8 A;  2CH4 W;  3GTG A;  1LUZ A;  4IOA A;  2AGO A;  2UVU A;  1YZ6 A;  4KTA A;  3TP8 A;  5C3X A;  1N34 Q;  5KFU A;  2K5D A;  3I70 A;  5ELC A;  4XIG S;  5CMD A;  3HOW B;  3M4I A;  3GV5 B;  4IZ8 A;  4DNI A;  1UC9 A;  3WWV A;  3IRB A;  3H40 A;  4FS1 A;  1I6U A;  3K8A A;  4H7B A;  4WFN 3;  1SNC A;  2O2L D;  3CMA A;  4IJH A;  4JI4 H;  1R9T A;  4A3M H;  4DK3 C;  1YJ9 A;  5JOB A;  5FLX c;  3QWN A;  3OSN A;  4DR4 H;  1BQQ T;  2G9H D;  1IBM L;  3N6X A;  4WOR A;  3S15 B;  5EJW A;  4FNF A;  2E2J H;  1SEI A;  3RUP A;  4DR3 H;  5KFO A;  5FLM H;  1D5Z C;  4EBD A;  2J7Z A;  3RLF A;  1U4R A;  3BAB A;  3MWY W;  5IYD G;  2N8N A;  2GLT A;  5C44 H;  4I7Z C;  1MI2 A;  4YAK B;  1B44 D;  2N78 A;  4OX9 L;  4UCS A;  4DAY B;  1EEF D;  4DUZ H;  2JEJ A;  1WCM H;  3MVV A;  3K7A B;  2P0A A;  2E2I B;  1WTV A;  4IPG A;  2NWG A;  2QDL A;  4YHH H;  5M5Y H;  3Q23 A;  2X69 A;  4DV4 Q;  3NBI A;  5ELD A;  3CC2 A;  4A3G G;  2AQ3 B;  3W1G A;  3R23 A;  4B3S H;  4RMF A;  3RLN A;  1TWC H;  1KL9 A;  2C35 B;  4P2C B;  1ZQ7 A;  2FP4 B;  1ET6 A;  4DR2 L;  4EBC A;  1UNN C;  4BBR G;  4PMC A;  4OO1 I;  2Z0S A;  2EOT A;  4DV6 Q;  4JI8 H;  1E1T A;  3P75 A;  2JEA I;  5DG8 A;  1ESF A;  1B04 A;  5JJZ A;  3GIP A;  1I94 Q;  1KJ8 A;  2F0U A;  3TZD A;  1D7Q A;  1J8I A;  1SJE D;  2EY5 A;  3J80 i;  2K5W A;  4CJ1 B;  1X3G A;  3J7Y W;  3I55 A;  3OOC A;  2PI2 E;  5KT4 A;  1XTD A;  1BO0 A;  3PF4 A;  3J7Z C;  2YW2 A;  4CKE A;  4DK6 C;  4A3G B;  3RBE A;  1PTO F;  3S14 B;  4RCO A;  4FBU A;  1Q82 C;  1U4P A;  4DR1 L;  3R93 A;  3GTM H;  1B6R A;  3GTQ A;  4LF7 Q;  4BBR B;  2UVR A;  2JA7 H;  2NVX H;  4L6T B;  2L1B A;  4TQR A;  3E0J A;  4BA1 I;  1JXL A;  1BCP D;  5LYJ F;  4DNR B;  4A3B H;  2D5D A;  3GID A;  3CU7 A;  1ONL A;  3RUZ A;  5FJ8 H;  2W57 A;  3UI2 A;  1RTN A;  3TSS A;  4TQS A;  2G9D A;  5CA0 F;  4DV4 L;  2I46 A;  4XYL B;  3KJO A;  5BN4 A;  5M3F G;  1VQO A;  3Q6S A;  3GDE A;  3PO2 G;  4JI3 Q;  4FDB A;  5LMU H;  4X65 L;  1TS4 A;  1XNQ Q;  2QEX A;  3A0J A;  1VQN A;  4RAZ A;  4PZ8 A;  4DV6 L;  1HR0 Q;  3R5H A;  3BG3 A;  4DV2 Q;  2ZDQ A;  5KFD A;  2JA6 A;  1H9R A;  4KKT A;  4YJ2 F;  1N34 H;  4XDX A;  1VQA A;  2GPW A;  2IHF A;  4MTE A;  3A5Z B;  5BN3 A;  5K36 G;  4MV6 A;  4R9W A;  3U9O A;  4X64 Q;  1ASY A;  1CS0 A;  3EYY A;  3G8C A;  1WTR A;  5LL6 S;  2UUB L;  2NTT A;  2QW7 A;  5M3F B;  4FF1 A;  4KHP Q;  3PO2 B;  2FK1 A;  3TS0 A;  3GTL A;  4R4T A;  1KJI A;  3GTG B;  4DR2 H;  2ZXR A;  1LT4 D;  1BJT A;  1K0R A;  2IPK D;  4B9W A;  4EFE A;  4HQ6 A;  3BU2 A;  4YCW A;  1AE3 A;  4ED6 A;  1ET9 A;  3KHR A;  2MO1 A;  1T5X D;  3I73 A;  3IFD A;  1EWI A;  2LY7 A;  4F7X A;  1DYQ A;  2XD4 A;  2EYM A;  2KHS A;  3NP8 A;  2BA0 A;  3T16 A;  5C0X H;  4KHV A;  4HR7 A;  3RLO A;  1X9N A;  3T13 A;  4DK0 A;  5C0X J;  3NXW A;  4DU9 A;  3BQ0 A;  4JI3 L;  3LGJ A;  1R9T B;  5HV6 A;  1HA5 A;  3CP0 A;  2WAC A;  1PZK D;  1H9M A;  1JDB B;  4DV2 L;  3M4Q A;  4IPH A;  3C3L A;  3J80 W;  4LNQ A;  1B8A A;  2FJ2 A;  1PH5 A;  4J1M A;  4GKJ Q;  4XTC S;  1AFP A;  5KX5 F;  1B70 B;  5DGB A;  1J6Q A;  1M90 C;  2F0L A;  1RD9 D;  4C56 C;  1PRT B;  1I6H B;  3ORR A;  1V8Q A;  1VQJ A;  2F0K A;  2R3Z A;  3HKS A;  1KAW A;  3J81 E;  2EJG C;  2L11 A;  3J7A F;  2VUM B;  3GQC A;  4DV4 H;  4NLG A;  3OWE B;  3S1N B;  4F4Y A;  3AYH B;  3E9H A;  4JBK A;  4IRC A;  3D4W A;  4MV4 A;  4R1J A;  2B2V A;  5DM7 3;  2BE5 C;  1E4F T;  2R6G A;  1TA8 A;  4JI7 Q;  1Z6H A;  1JDE A;  1WTP A;  5CC4 A;  4DV6 H;  3N41 B;  1JWU D;  1EWC A;  4PMW A;  4ME6 A;  4MZ9 A;  4HSP A;  2B2V C;  4DXF A;  4LFB L;  4KHZ A;  2V9W A;  2JK8 A;  1CKN A;  1QCB D;  4O4L F;  1QNK A;  4PZ6 A;  3NEL A;  2VY3 A;  3BDC A;  3GTP H;  2PQA A;  4Z9C B;  4F8M A;  5AJ3 L;  4RUC A;  2UUB H;  2E2D C;  4HJ5 A;  2A6H D;  1B33 N;  2B2U A;  1VF5 C;  4R8I A;  2Z6K A;  1I7L A;  5KIX A;  1M4V A;  1Y8P B;  2BCO A;  2HJW A;  4H0L C;  3OSP A;  4LF7 H;  2RBM A;  4JI1 Q;  3IFT A;  1AE2 A;  2O03 A;  2F4V Q;  3JAM i;  1SND A;  1I4H A;  1IBL Q;  4DL7 A;  5KFJ A;  2WB1 A;  5C4Z A;  4EGJ A;  2XVS A;  4A3F H;  4HIO A;  2HHH L;  2B2U C;  2F0D A;  2Z6K C;  4A93 H;  1JR0 D;  1JOK A;  3S1R H;  3HKZ A;  4HID A;  2MJ8 A;  4G7H C;  1RJQ A;  1BNZ A;  2AGP A;  2L9H A;  1A3T A;  1IOW A;  4O3R A;  4NPS A;  3WO1 A;  3TRE A;  3A7A B;  3CCV A;  2F3W A;  3TQT A;  1D6E C;  1IW7 C;  2M9V A;  3SE0 A;  5F9L A;  4P73 A;  3WOF A;  1XMQ Q;  4QCL A;  5G3L D;  4JI3 H;  4LW1 A;  1MGS A;  4O1N A;  3TEH B;  2VA2 A;  3KUP A;  1P16 A;  3A54 A;  4I65 A;  3SGI A;  4IR1 A;  4KY7 A;  4POG A;  1XNQ H;  5IYB H;  1HR0 H;  3UDX A;  4DLK A;  1SAP A;  3U9S A;  1HCZ A;  2Y0S E;  4JG2 A;  5KFT A;  4DV2 H;  3M4Y A;  1UE6 A;  5EQ0 A;  3J80 L;  3DF7 A;  1SNO A;  2NN6 G;  5I47 A;  3R5X A;  3A56 A;  1S40 A;  1SE2 A;  2Q2H A;  3NK9 A;  1KTK A;  2A6E D;  4X64 H;  1NCV A;  4LH7 A;  2WYO A;  4NMZ A;  1LTB D;  2W6Q A;  2FLL A;  1B53 A;  2ZTC A;  4HJ9 A;  5EWE A;  4DV3 Q;  3FMA A;  1F77 A;  4ZOL F;  4TV9 F;  4KHP H;  5EOY A;  4FS2 A;  3WNZ A;  4LSA A;  3JZI A;  3PZP A;  4WJW A;  4WD3 A;  3M9B A;  1PV4 A;  1N33 Q;  3GIL A;  1VQF A;  3SK4 A;  3OHA A;  2R7M A;  5DQI A;  1K83 A;  3RN5 A;  3PGZ A;  4R4C A;  2YS7 A;  1PZJ D;  1SXT A;  3H91 A;  2HVQ A;  2JYO A;  2N3S A;  4X66 Q;  5E4W C;  4RGT A;  4DL6 A;  3GTL B;  1JOR A;  2F0G A;  1LLR D;  1CQF A;  4OEM B;  2JA5 G;  3GIQ A;  3K7A H;  2PPB C;  4C3J G;  2E2I H;  1JJG A;  5KG4 A;  4DV7 Q;  1ICF B;  2RVL A;  2ID0 A;  1CSP A;  4ED8 A;  2F0N A;  3KAK A;  4PZ7 A;  1Y1W H;  3Q24 A;  5LP6 F;  1N32 L;  2KEE A;  3GD7 A;  5KFE A;  5DM6 3;  5DGA A;  4HR7 B;  1QOH A;  1T9H A;  1B9N A;  3E5S A;  3ULL A;  2FKL A;  2HHH H;  4HNT A;  4ZCK A;  3ITP A;  5DG9 A;  2BQR A;  1V1Q A;  5KFR A;  5IT9 W;  3CVZ A;  2M05 A;  3JAM W;  5KFZ A;  1KQS A;  1TQO A;  2JA5 B;  4FXD A;  1VBG A;  4C3J B;  4ZI7 F;  3BDO A;  3PF5 A;  3G6V A;  3C46 A;  1D5M C;  3ERS X;  3V6K A;  1N56 A;  4A2A A;  1JC7 A;  3T1H L;  3HEJ A;  5CA1 F;  4A3G H;  2QYZ A;  1XJV A;  4EEY A;  4LWC A;  3Q8S B;  3RZD H;  1A2U A;  1LTG D;  5I6W A;  2ASB A;  2YCH A;  5EKL A;  2E2H A;  1UAP A;  4A3E H;  3PIP A;  3S2D B;  3C2P A;  4OIK A;  4X66 L;  3S9W A;  2WKC A;  5ELN A;  3GTO A;  1EIY B;  1PFM A;  1QUQ A;  2VXW A;  4RHR A;  2V59 A;  5KFQ A;  3K57 A;  5A2Q W;  3MR3 A;  1TVX A;  4PNY A;  4G7O C;  3JSN A;  3LP8 A;  2AUK A;  2VOB A;  2WB1 G;  3QJY A;  2D0P A;  3H4D A;  1KRT A;  1ENA A;  1NBW A;  4QWA A;  2RDJ A;  4JI1 H;  1ILQ A;  1FNU A;  2NVT H;  2HVR A;  2F4V H;  2F0H A;  2VB3 X;  4LF9 Q;  1IBL H;  3HKZ G;  1PTO B;  2CH4 A;  3BS1 A;  3HOZ G;  1CKN B;  1WJJ A;  3V05 A;  4ZYS A;  4C5C A;  4RB2 C;  5COY A;  2W6P A;  2ALZ A;  2PQA B;  4RZR A;  4WJ3 M;  3HRZ C;  3T5J A;  1VQE A;  3VDY A;  2WKD A;  2ZDH A;  5KT5 A;  1ZYR D;  3K59 A;  3L4J A;  1AEX A;  1IZ6 A;  2OWO A;  1BCP C;  2WB1 B;  5CGK A;  3DLL A;  1KC7 A;  2A19 A;  4Q0Y A;  4KI0 A;  1GD7 A;  1VQH A;  1RF2 D;  3C0F B;  1ICW A;  3M7N A;  2C9O A;  3HKZ B;  3I4O A;  4FF4 A;  2R8G A;  2VNU D;  1N32 H;  1O7L A;  2F52 A;  3IKJ A;  3PUZ A;  3PO2 H;  2VS1 A;  3HOZ B;  1HXY D;  4U67 3;  1Z7T A;  2K5N A;  3D3R A;  4NP5 A;  2A1A A;  2FJZ A;  4YR3 A;  1PH3 A;  2H4O A;  4HN7 A;  1WOC A;  4Y7N H;  2ALY B;  5JH7 F;  5IE8 A;  1SRU A;  1L1O A;  1G8Z D;  5T1G A;  4AYB B;  1G2S A;  2UXD L;  1Q90 A;  2R93 H;  1XMO L;  4J9Q A;  4ZKB B;  2WII B;  1SYX B;  3G71 A;  1UEB A;  5K36 H;  1Q12 A;  1L1O C;  1PK8 A;  3QG1 A;  1N33 H;  2XWJ B;  2B63 A;  4EQP A;  3RR5 A;  3ETH A;  1IL2 A;  1SNQ A;  4XQQ A;  2CW8 A;  5KT6 A;  1G91 A;  4IPC A;  3L9A X;  4S3S A;  4X66 H;  3DM1 A;  3H0G B;  4GN4 B;  1FJG L;  4MV1 A;  4YWM A;  1YIT A;  1D1I A;  1X32 A;  1PVO A;  2RCF A;  3D4R A;  5ELF A;  2VUM H;  2HIX A;  3RF2 A;  5ELE A;  1DJR D;  1K83 B;  2SEB D;  2YYZ A;  1DZ1 A;  3STB D;  4LF8 L;  3E9I A;  1GSH A;  3PSI A;  1A3V A;  4U68 A;  3E5N A;  4UCO A;  2IMW P;  1FNW A;  5HGT A;  1TWH B;  3O13 A;  3OPO A;  5C4X B;  1TKW B;  2J0T D;  1GVP A;  1WTX A;  3F8T A;  1IKM A;  1A6X A;  3BG5 A;  2PVP A;  2W6M A;  2F0T A;  4P72 A;  5IP9 G;  2ASJ A;  4JYA L;  5EBD A;  5KFI A;  2MUY A;  1PYB A;  1MIU A;  2MP1 A;  4IO9 A;  1CM9 A;  3ORQ A;  3CXC A;  5GAG C;  1EHI A;  1ML0 D;  1LAB A;  3L3O C;  3EIV A;  4YR0 A;  3RB0 A;  4A3D H;  2W6N A;  3G48 A;  1K9M C;  2F0V A;  2IWH A;  3EA6 A;  3HG9 A;  2MPM A;  1EZ1 A;  2N49 A;  2UXD H;  5C6A A;  4IN3 A;  1KAA A;  4ZRZ A;  4UP9 A;  1F9S A;  1W2B A;  1ZHS A;  5JEA G;  4JI4 Q;  4J9M A;  4MV7 A;  3H20 A;  2PMZ B;  1EY0 A;  4CKC A;  2E2H B;  2VZA A;  1PH7 A;  5FPO A;  4LF9 H;  3W2D A;  2ZJP A;  2IA6 A;  1FD7 D;  2VQF Q;  4R7R A;  2CKZ B;  2QF7 A;  4KY5 A;  4DR4 Q;  3GTO B;  3RAQ A;  5IP7 G;  4EYH B;  1EU3 A;  1HJP A;  1O80 A;  3ZYY X;  1QUQ B;  2A6H C;  4EYI B;  2WAQ G;  3UQ8 A;  3MR2 A;  4L63 B;  5NUC A;  3G6J B;  1FJG H;  3FDS A;  2JEF A;  2V4D A;  5CV8 A;  1GM5 A;  3PIO 3;  2DLN A;  2XSC A;  2O5I C;  2F03 A;  3K58 A;  4QMG A;  3KK7 A;  3MHB A;  5DLQ E;  2K33 A;  3FDT A;  3GIK A;  1B1Z A;  3DWQ A;  5DG7 A;  2W71 A;  1SDF A;  3F2C A;  1CQI B;  3J81 c;  3MXU A;  1LT3 D;  4A3L G;  2MFI A;  3T5K A;  2RDG A;  4M1U B;  3S17 H;  2WAQ B;  1HFN A;  4K2L A;  3G6E A;  1X55 A;  3J80 E;  5J2U F;  3ND9 A;  5KYI A;  5KG3 A;  4B3S Q;  4RB3 C;  3PW2 A;  3S16 B;  2NN6 H;  4LF4 L;  1AP0 A;  1U9R A;  4O3P A;  3AQQ A;  4YCV A;  1TU2 B;  1C7Y A;  1ESR A;  5IYC G;  2IW3 A;  2B3G A;  2KED A;  4YY3 L;  2UUA L;  2B63 G;  3HOV G;  1EU4 A;  2HGS A;  4IUQ A;  3U4Z A;  4DXG A;  1QVF A;  3OMC A;  4K0K L;  1CTM A;  4X6A H;  1K0S A;  1Z2O X;  4ZKC B;  1VQ5 A;  2A6E C;  2E74 C;  3PW0 A;  4JV0 A;  2NVY A;  3PIO A;  3LX0 A;  1O7Y A;  1L1O B;  1UEA B;  1TWA H;  1G51 A;  3Q8R B;  2EYJ A;  1F2L A;  1JCK B;  2A74 C;  3SK5 A;  5IGG A;  5FLX W;  3TP6 A;  3MWD A;  4FXK C;  1L0Y B;  1HTL D;  1VMC A;  1D5X C;  1AZP A;  3BYY B;  2B63 B;  5CV4 A;  3HOV B;  1J5E L;  4DL2 A;  3MC0 B;  2F3I A;  3FKI G;  2K5H A;  2JA5 H;  1DV1 A;  1GO3 E;  2K50 A;  1GSA A;  2R7N A;  4O4H F;  1F9R A;  2ASD A;  1PFN A;  4O2A F;  1TS5 A;  4YWL A;  4CDF C;  5M5W H;  1Y1V A;  5EPK A;  2J9G A;  4OEL B;  1IBM Q;  2JXM B;  1VQM A;  1TS3 A;  2EYL A;  3TQY A;  2C22 A;  2I0Q A;  3WDN A;  4LMQ D;  2YTV A;  4XT1 B;  4DV1 L;  2DJG C;  3S1M H;  3S2D H;  1UC8 A;  4C2M A;  2LXJ A;  2OH2 A;  2ZXP A;  1EOV A;  2WP8 J;  3R2T A;  1HQM C;  1BDO A;  1WTO A;  1V4Y A;  4QUC A;  5C3E G;  1J9O A;  5GRO A;  2PNH A;  4OX9 Q;  2PZW A;  3FKI B;  4L5S A;  4DL4 A;  1NUC A;  2MNA A;  5KFA A;  1WD1 A;  3P20 A;  1X3Q A;  4NW2 A;  2KHI A;  2EYP A;  4IFD I;  3RTX A;  2MGS A;  1UWV A;  1YEZ A;  3H3V H;  1PTO H;  4ZLT F;  3CKI B;  4PV1 C;  4JI6 L;  5D1O A;  1WTH A;  2D62 A;  4LJZ C;  4YQW A;  1RJP A;  1TWG H;  5DQG A;  2FXQ A;  3R2I A;  5IWA L;  1TII D;  4R8N A;  1B50 A;  4LF4 H;  2C5C A;  4A3C G;  4XYM B;  1SR3 A;  4DR2 Q;  5JAV A;  3CCQ A;  4BBS H;  1S3O A;  1SE3 A;  3RAX A;  3VA5 A;  2UUA H;  3E6Z X;  5C3E B;  2K28 A;  2KJX A;  3T1Y Q;  5KG1 A;  2IJ0 A;  2EPB A;  3CC4 A;  1QVG A;  2VQF H;  3VPB A;  3M85 A;  2D2C C;  4QL5 A;  3T51 B;  2NU8 B;  1EQQ A;  2Q2T A;  2YS6 A;  4M8A A;  1MSG A;  4DK1 A;  2NVQ H;  1YHQ A;  3HOZ H;  4IAL A;  2ATL A;  4DR1 Q;  4Q5V A;  4IUR A;  3MXN A;  2HDL A;  3PV0 A;  4K8I A;  4RB1 A;  4HMI A;  4C3I G;  4CDD C;  5KND A;  2Z6B A;  5D3I B;  3M3Y B;  1J5E H;  1JWM D;  1EZ6 A;  1OXX K;  3GO5 A;  4WJ4 A;  2VA3 A;  1CE8 A;  2NB0 A;  1HH2 P;  5D65 A;  2OTL A;  4H44 C;  1LTR D;  1ZYR C;  4GOP A;  2UXC L;  2L12 A;  4KN4 C;  3S2H H;  1WVL A;  1B2T A;  2FB9 A;  2F4I A;  2IHE A;  4ZAI A;  1N36 L;  2LSS A;  4AQY L;  2DWC A;  4DV1 H;  1V51 A;  4X65 Q;  3GTK A;  3GV8 B;  3ER0 A;  1YNN D;  4O3S A;  4DR5 L;  1XX8 A;  4GOP C;  2XN9 C;  3H0G H;  4C3I B;  4M9U A;  1MKH A;  1V1P A;  4CJ2 C;  3T1Y L;  1NR4 A;  4PMB A;  4RWS C;  3JAM E;  3FPU B;  4BWS C;  4BXX H;  1EY7 A;  4C5A A;  3BDL A;  1LAC A;  5CBE E;  3HOY H;  2CWA A;  4O3N A;  4G3I A;  1XWE A;  2R92 A;  5FOB B;  2UUB Q;  4JI6 H;  5JVL A;  1LV9 A;  1I50 H;  2OT2 A;  5IWA H;  1KLG D;  4DNT B;  1CI3 M;  1W93 A;  1E2W A;  3HOU H;  5H80 A;  1CQV A;  2XRS D;  1S9F A;  5CAE B;  3BVG A;  4OON A;  1FGU A;  2NVY B;  2F1M A;  2JN4 A;  1TWH H;  1G2T A;  2A69 D;  3A74 A;  2C2D A;  5C4X H;  4ODG A;  4B3R L;  4GC7 A;  3QO2 A;  4JI5 L;  2OEO A;  4ZQI A;  2TMP A;  4CKB A;  3CCL A;  1IBM H;  2KSW A;  4B08 A;  1H9J A;  1PHJ A;  1PH8 A;  1L2Z A;  5GAH C;  1GGO A;  3OUU A;  1NTG A;  1E1O A;  2BA1 A;  5KNC A;  1HR0 W;  4DKA C;  4RU9 A;  3VMM A;  3NBH B;  1YHA A;  4GKK Q;  4U6P A;  2PYK A;  3STB C;  4IOC A;  1SFO H;  4ETS A;  3OIP A;  5I2Y A;  1B9M A;  2TSS A;  2AQ2 B;  5D3D A;  5JUM A;  1CZG A;  2B2Y A;  3PN1 A;  2V58 A;  4OX9 H;  3HOX H;  5A35 A;  5L1K A;  1HNW L;  3JRX A;  5IY0 A;  1SBB B;  4LUO A;  2G5D A;  3MTS A;  2QKI C;  1FVI A;  5EKI A;  4I7H A;  4RNO A;  2B2Y C;  3HS0 C;  3CPW A;  2A73 B;  4C2M B;  4ECQ A;  3Q2O A;  2I07 B;  2BQU A;  2OQK A;  2SNM A;  2VQE L;  3M4O H;  3K0Y A;  4C1N K;  4AQY H;  2IX3 A;  1ULZ A;  4NXM L;  2K05 A;  4JOI A;  3K0X A;  4DL3 A;  4OWW B;  1DIK A;  1BBU A;  4JBJ A;  1KBL A;  1SYD A;  4F4W A;  3T1Y H;  5KNB A;  4LFC L;  3V2T A;  1M7J A;  4EEQ A;  2R7F A;  1GKH A;  4LFB Q;  3RN2 A;  1CT1 D;  5D14 A;  2CVR A;  1KIX A;  4JOI C;  1Q8K A;  2CW7 A;  4ECT A;  5IOC A;  2DN8 A;  2Z9H A;  2R7L A;  4I4T F;  1Q1B A;  5M5X B;  5AJ3 Q;  3Q8D A;  5KG6 A;  1TS2 A;  1RJT A;  1EY4 A;  4GKK L;  1AN7 A;  3RGZ A;  3BAA A;  4DR1 H;  1N9W A;  2JA8 G;  5LMN W;  3OIQ A;  3CQZ H;  2YU9 A;  3I4N G;  1CKM A;  4QQB X;  3S16 H;  1TWF H;  2KVM A;  1X56 A;  4X62 L;  5KFY A;  1IYV A;  2HHH Q;  3MFG A;  4JPB W;  4B3T L;  3GTJ H;  3SVM A;  5J2T F;  4B3R H;  4UY8 C;  4JI5 H;  5DEH A;  5BPF A;  3EJI A;  4YJ3 F;  3M4P A;  3S1Q B;  1PX2 A;  2Q8T A;  1UNS A;  5HY6 A;  1A0I A;  2YZM A;  3PIP 3;  1EZ8 A;  3CAM A;  3MXN B;  4CC6 A;  5JQW A;  3N52 A;  3VPD A;  1IYU A;  5BN5 A;  3L0O A;  4X65 H;  1H9K A;  4MHE A;  1BVS A;  1E22 A;  1JE4 A;  5IGB A;  2W9C A;  3HGB A;  4JUZ A;  3ERO A;  1I4Q A;  3QOL A;  1OXU A;  5CV9 A;  4LAA A;  1WTW A;  1HNX Q;  1HNW H;  1Y69 U;  3K7U C;  2IL8 A;  1JQY D;  2AQ1 B;  2F3V A;  2WB1 E;  2XWB B;  4UP8 A;  3GTK B;  1SE8 A;  4GZY C;  3QZ8 A;  3FEW X;  2L0C A;  4BY1 H;  2UVV A;  1EQR A;  1II3 A;  4QWD A;  1E24 A;  2VQE H;  2R7K A;  3HKZ E;  1T5E A;  5C0X I;  3RGX A;  4NXM H;  1IYJ B;  3DMU A;  3OHX C;  1I5F A;  3EQL C;  2E5L L;  3I4M G;  1GXD C;  2PO4 A;  2M2L A;  1DOM A;  4JBM A;  1K3R A;  3K80 C;  5C4J H;  5KFG A;  4BY7 G;  4QB4 A;  3HFZ B;  1D2B A;  4J0M A;  4LFC H;  5M3M G;  2NUC A;  4AYB E;  3PUY A;  1MZB A;  1JB7 A;  1XTC D;  5C5L A;  2QA4 A;  3FKI H;  3GTQ B;  1F2M A;  4ABN A;  2WDT A;  2QIL A;  1BCP F;  3HOW H;  2VPS A;  1QZG A;  3BQ2 A;  4GKK H;  4K5X A;  2JA6 G;  5CYU A;  4R4O A;  2FK2 A;  2GVA A;  3NTI A;  1XDN A;  1N32 Q;  4ED3 A;  2EYO A;  2JP1 A;  3KFU A;  1F9P A;  4X62 H;  1FGB D;  4BY7 B;  2ZXO A;  1IBK L;  1DXM A;  1BBW A;  3TDQ A;  1HNX L;  5M3M B;  3J80 c;  4X3T A;  3N6R A;  4IR9 A;  2ZJQ A;  4Q8E A;  3D0F A;  3GLK A;  1F2Z A;  4J15 A;  5CB4 F;  4CBV A;  1STH A;  1U5K A;  3S15 H;  1WCM A;  5JVD F;  2JA6 B;  1FKA H;  4FU0 A;  3T5L A;  3PCO B;  3E3X A;  5IGF A;  3MR5 A;  3ZJY C;  3W3A A;  3T1H Q;  1C30 A;  4HYK A;  2AMC B;  5L1I A;  4C3H G;  3KXY T;  2LXK A;  1EY9 A;  2XGT A;  2PCF B;  4TKO B;  4IFD G;  2OTJ A;  4A3J G;  3S24 A;  1MD2 D;  4LFB H;  2NZ1 D;  1TWC A;  1I3Q A;  3CCJ A;  3QR8 A;  4DAV A;  1O78 A;  2ZJR A;  1XPO A;  1M0W A;  4XX0 B;  5KFC A;  1NAP A;  3TIN A;  3GV7 B;  3N8D A;  2RDI A;  4A3I G;  1S68 A;  5KRU A;  4YR2 A;  4KD3 A;  1UE1 A;  4ECX A;  1X6O A;  4ED2 A;  3GQB A;  3H15 A;  3FRP B;  3I7F A;  5K2M A;  3R3O A;  4YCU A;  4RNM A;  3D6W A;  1CQJ B;  2R85 A;  1JLL B;  1Q7Y C;  4K6D A;  4XYO A;  2F0O A;  4DAM A;  4A3K G;  1STG A;  4C3H B;  5FO8 B;  1S72 A;  1X54 A;  2UUC Q;  1ZXT A;  4JI0 L;  2FIN B;  5IYD H;  3GTM A;  3BVM A;  3GIM A;  2WFW A;  4A3I B;  3H6M A;  2JA7 A;  2J6S A;  2NVX A;  1A15 A;  2B2T A;  2PMZ E;  3NEM A;  4IWY A;  2EZV A;  2YU9 B;  3OSO A;  4KV6 A;  2VQD A;  4YWK A;  5KFF A;  4PG3 A;  5BPH A;  5KG7 A;  1RKN A;  3SEB A;  4G7Z C;  3DWA A;  2R8J A;  3CF5 A;  2HT1 A;  3PO3 G;  3RFC A;  3OYY A;  3S14 H;  5KEE A;  2AHO B;  3MAQ A;  2B2T C;  2DIK A;  5EAY A;  4A3K B;  5FD5 A;  1HNZ L;  4RNN A;  1HUM A;  3X3N A;  1E2V A;  4BBR H;  3V4Z A;  2XGQ A;  1IBK H;  4IQZ A;  1HNX H;  1X65 A;  1GHK A;  2IY5 B;  2XC9 A;  1YNN C;  2YTX A;  4K14 A;  5ELB A;  1EWH A;  1LT5 D;  1XPR A;  3CD6 A;  2UXD Q;  3ERQ A;  5F2D A;  3CCR A;  1XMO Q;  2R7Z A;  4DV0 Q;  4OO1 G;  1EY6 A;  3D6C A;  2DNC A;  1HHV A;  2W9C B;  4B9X A;  4RAY A;  3PO3 B;  4LF6 L;  4EFB A;  1D1K A;  1V1O A;  1TY0 A;  1C4Q A;  2XGP A;  2UUC L;  2WAQ E;  2EVB A;  5L1J A;  2EDG A;  4ECR A;  1C0A A;  5C1P A;  2KBN A;  3MR6 A;  5EPL A;  2UXB L;  3KLW A;  3KHL A;  1FJG Q;  3R5F A;  1H95 A;  1HFG A;  1PYW D;  2DY7 A;  4BWG B;  1DON A;  5C5J A;  4XT3 B;  4V0B A;  1Y14 B;  4UPA A;  3V6J A;  2A69 C;  3OUZ A;  1UE5 A;  2D9U A;  4ECV A;  5FLM G;  1EYZ A;  5M3F H;  5L37 A;  2KA7 A;  4LF8 Q;  5KFK A;  1PRT D;  1GJX A;  1QB5 D;  4OIJ A;  3RB3 A;  1GLV A;  2EJF C;  3GTG H;  3GII A;  5KFB A;  4JI0 H;  5G3L F;  1JMC A;  5C44 G;  1VQK A;  1C8C A;  1VKZ A;  1KLU D;  1ASZ A;  4XYQ A;  1HUN A;  4KN7 C;  1WCM G;  2F0P A;  2EY1 A;  5IT9 L;  4FM9 A;  4JV2 A;  4QF4 A;  4DV0 L;  3JAM L;  4OWX B;  1N48 A;  4NXN Q;  1IOV A;  1SYG A;  2E2J B;  4C5B A;  2L5T A;  4LMY A;  3T1H H;  2KOL A;  4R4Q A;  4JYA Q;  4L8J A;  5LOV F;  3UDI A;  1R9T H;  2ICI A;  4GLX A;  4CC5 A;  4O4I F;  2GN5 A;  3DUZ A;  1HTP A;  1SE4 A;  4GNX A;  1E4G T;  2MCT A;  1HNZ H;  2L15 A;  3MEH A;  5C44 B;  1CZW A;  4RA8 A;  1EIG A;  5FPR A;  4N8F A;  3A8I E;  1Y8N B;  1WCM B;  2O4X A;  2XCP A;  4LF5 L;  3H94 A;  1I6H H;  1SYC A;  4GNX C;  4TUY F;  4XQN A;  5A2Q L;  3S1Q H;  5M5Y B;  4RGN A;  3U4V A;  2ZM6 Q;  3G4S A;  2VW9 A;  2ZJT A;  1RCV D;  3K5M A;  3F2D A;  3S1N H;  1E0B A;  1MBY A;  4CHT B;  1Z2P X;  2QK4 A;  1TWC B;  1I3Q B;  4N9P A;  2FE3 A;  3J7A 5;  1BGW A;  2UUC H;  5KFM A;  3GTP A;  5E7N A;  4QUF A;  1H9S A;  3QZ7 A;  2JA7 G;  1CK1 A;  4FO2 A;  1WSC A;  2N55 A;  3NQI A;  5T1I A;  3AMU A;  2PZU A;  2FPP B;  1RK5 A;  1GYF A;  1K3B C;  3K3P A;  4A3B G;  3PUW A;  2NBF A;  2JEI A;  5FJ8 G;  3J81 W;  2HIV A;  5LL6 X;  4NXN L;  2YRX A;  4IHJ F;  2W9A A;  2FHT A;  1I4G A;  4DFA A;  4UCV A;  2XCL A;  1PA6 A;  3GTK H;  4DR7 L;  3K5H A;  3CHB D;  3T5H A;  3BVZ A;  1JJ2 A;  3GTM B;  3FP9 A;  1QWY A;  1ZHQ A;  3PW4 A;  2A68 D;  3N42 B;  3GIJ A;  1U4M A;  1KC8 C;  3JC6 6;  3KLS X;  4DN4 M;  2JA7 B;  1PH6 A;  3MWM A;  3A8K E;  3M9O B;  4ME3 A;  2F0I A;  2R7Z G;  2VPQ A;  1EYA A;  2CQA A;  1EUJ A;  5E4X A;  4CDE C;  4A3B B;  4LF4 Q;  4CDC C;  1TAE A;  2ENB A;  2PBZ A;  1XMO H;  3CRL C;  1HA6 A;  3RB4 A;  4DV0 H;  3QIA A;  4J9O A;  3MXP A;  2GA4 B;  4HED A;  2ZM6 L;  4YY3 Q;  2UUA Q;  1B6S A;  4K0K Q;  1A9X A;  4NB3 A;  3GTQ H;  1BXT A;  1JT8 A;  4ZHQ F;  4DPG A;  2CQY A;  4EQO A;  1EOT A;  1I4R A;  2XIW A;  1QVC A;  3MEF A;  4H02 A;  1WH2 A;  4KLK A;  1RK6 A;  1AN8 A;  1IHZ A;  2J4X A;  1CFM A;  3IG0 A;  2RA4 A;  3D8G A;  4L1K A;  2R7Z B;  1SYF A;  1L2F A;  1EFI D;  3RBD A;  1KNA A;  1YJN A;  4DUY L;  2K32 A;  2OF1 A;  4JCV E;  2RF4 A;  5FKA C;  2ZTD A;  5C0X G;  4QIW A;  5M3M H;  3RD4 A;  2HDM A;  4UCR A;  1KHI A;  3U50 C;  3ULP A;  2Q8I B;  2AWO A;  2BDN A;  2K01 A;  4ECU A;  1A3U A;  1J5E Q;  3VR6 A;  1GSO A;  1PFS A;  2L4N A;  4RUA A;  3NHH A;  2X6L A;  3CRK C;  1U4L A;  1BCP B;  4LF8 H;  4DAY A;  1GUO A;  4A76 A;  4O0A A;  4ECW A;  4QWE A;  3QFF A;  5CV6 A;  2JA6 H;  2E2I A;  5FO9 B;  1R4Q B;  4JBW A;  4F50 A;  2BOS A;  1CHQ D;  4B3M Q;  3TS2 A;  2AQ4 A;  1EIF A;  5IGD A;  3TIG A;  1JWS D;  1Y1W A;  3TII A;  1KJJ A;  4DV1 Q;  4J9R A;  2KCN A;  1Y8O B;  3OMG A;  3BZD B;  1E4E A;  3KAL A;  4NXN H;  1YI2 A;  4RGO S;  1VCI A;  1PFB A;  3GTL H;  1EYG A;  3MWE A;  3U58 A;  1A63 A;  5I9O A;  3TN2 A;  4JYA H;  1JB3 A;  4QWC A;  2K1B A;  4OL7 A;  1I6V C;  4DR7 H;  1XYI A;  1JX4 A;  2YTY A;  1V9P A;  4CGY B;  3KHH A;  5KYL A;  5EWG A;  3FMC A;  3MXG A;  2EYF A;  4JI6 Q;  4MA5 A;  5IWA Q;  4ME5 A;  4IFD H;  4FP5 D;  5KFP A;  2V4Q A;  4IAJ A;  3BA8 A;  5EBC A;  1PTO D;  4FVM A;  1STB A;  1HZC A;  3NGD A;  2ZM6 H;  4CJ0 B;  3PR5 B;  3MFH A;  2NYZ D;  5D1P A;  2PZT A;  4C3J H;  2X6G A;  4RHS A;  3MFY A;  2HQE A;  5CR3 A;  2F0Q A;  4IJL A;  4K5V A;  1BF4 A;  3JSL A;  4E4T A;  2V1C C;  2KEN A;  3N40 P;  1ROD A;  5L1L A;  1HRJ A;  4B3M L;  4IUP A;  3N43 B;  2I5H A;  2VR1 A;  2LKV A;  1LTI D;  4A3F G;  3WOE A;  1LT6 D;  1ENF A;  1Q3L A;  2YYA A;  4A93 G;  4KMU C;  3LML A;  4DUY H;  2FPI B;  3QOJ A;  3A55 A;  3NE5 B;  4LUV A;  4KK7 A;  3H09 A;  1NJI C;  4DUZ L;  1K8O A;  1DM0 B;  3VYU A;  1OXT A;  4UDU C;  1LYL A;  4X3U A;  2SCU B;  3X3M A;  3SK8 A;  1UE7 A;  2QDB A;  2NN6 I;  3K3V A;  3I12 A;  5KFN A;  3HB9 A;  4RKB A;  4I7A A;  2R61 A;  1K1Q A;  3KOJ A;  5AFW A;  1BUV T;  3VPC A;  3ICE A;  2UXC Q;  1OXV A;  1YBY A;  4R4I A;  4A3F B;  5CV7 A;  1N36 Q;  3I90 A;  4A93 B;  2EY6 A;  3EBE A;  4G57 A;  4AQY Q;  3VR4 A;  3S1R B;  4J9K A;  4JW0 A;  5KG0 A;  5KG5 A;  1F2Y A;  3V6H A;  2NU9 B;  4YIJ A;  2I87 A;  4DR5 Q;  4YY3 H;  5JJK A;  5IOD A;  2CZG A;  1DGS A;  3V96 A;  1KXL A;  5LA6 F;  3U9T A;  4K0K H;  1W6J A;  1JKJ B;  4ED1 A;  2HCC A;  5LHY 1;  3BA9 A;  2L55 A;  4OO1 H;  2R93 A;  2CW0 D;  1TR5 A;  4HJA A;  1KJQ A;  1SMY D;  2OXP A;  5LL6 b;  2K4K A;  1VQ7 A;  3P1H A;  4Q45 A;  2OLS A;  4PDB A;  3KLR A;  5D8D A;  4OGQ C;  1SNM A;  1LTL A;  2B8G A;  4JV5 L;  1WR2 A;  4MTN A;  5FLX L;  3EPI A;  2PW7 A;  5IIF A;  2R8K A;  3TME A;  3UDG A;  4IUV A;  1S0N A;  1GOZ A;  1VS0 A;  2IX1 A;  2NZH A;  4QW8 A;  2DNE A;  5DNF A;  2W9B A;  2M00 A;  5FK9 C;  3KYH C;  4B3R Q;  3CCM A;  4AH6 A;  4JI5 Q;  3CCE A;  1DV2 A;  1Y1W G;  4UAI A;  5M9O A;  3NUC A;  2LMC B;  2MHV A;  3T53 B;  2VB2 X;  2QCP X;  3W5O A;  4B3M H;  4QIW B;  2VUM A;  2HQL A;  5LMU L;  1VQ9 A;  1BR9 A;  2NTS A;  4XQJ A;  1VQP A;  2PN1 A;  3I3C A;  3BZK A;  5IGE A;  1AW7 A;  2W7P A;  1VQI A;  1PRT C;  1C48 A;  1WFQ A;  3D31 A;  4HJ7 A;  1PZI D;  2XRQ D;  4WBN F;  2K52 A;  3G6Y A;  5IT9 E;  1N34 L;  3H3V I;  2UU9 Q;  3CCS A;  1XNR Q;  1YVC A;  4DF7 A;  1VQ8 A;  1HPC A;  2E75 C;  1EUC B;  5T14 A;  1HNW Q;  3J81 j;  1C3O A;  1KRS A;  2OQ0 A;  3LWB A;  1Y1W B;  4JV1 A;  2RCN A;  1K83 H;  4KKU A;  4FBT A;  1EEI D;  1TY2 A;  1PMR A;  3R8B A;  2IX0 A;  3IL8 A;  1S97 A;  3ND8 A;  2R8I A;  4UFZ A;  1L0W A;  2DZD A;  1I3Q H;  2RQX A;  1E4E B;  5JJL A;  5KGU A;  2ASL A;  4A3E G;  1S5F D;  2ZTE A;  4FF3 A;  3OTO Q;  2VQE Q;  4KJN A;  1GHJ A;  4APM A;  1B4O A;  2I5L X;  3NQT A;  2RSO A;  3TBI B;  4NXM Q;  2MO0 A;  4LFA Q;  4EQN A;  1Y1V G;  1CA6 A;  3J7A K;  3MJF A;  4MAM A;  4Q8F A;  5TSS A;  5DQH A;  5A2Q E;  4LFC Q;  1I7N A;  1JOQ A;  2JE6 I;  4RB0 A;  4YBZ B;  4J9S A;  4A4I A;  5IGC A;  4ECY A;  2R7D A;  3KHG A;  1VQL A;  3RZD B;  3V4S A;  1S5D D;  2B2W A;  4A3E B;  4DR6 Q;  2PI2 A;  4GC6 A;  3EFX D;  1I4X A;  4QJF A;  1T36 A;  5KG2 A;  4JV5 H;  3IN5 A;  4ID6 A;  2RDH A;  2UU9 L;  1Y1V B;  1XNR L;  1XXG A;  4FF2 A;  1JIH A;  1Z9F A;  4X62 Q;  3KBX A;  1STN A;  2B2W C;  4MTK A;  2K14 A;  3Q8Q B;  3F1Z A;  1O75 A;  4B3T Q;  1M6V A;  2NVT B;  2E2H H;  4MN3 A;  5IP9 H;  4ED0 A;  3KF6 A;  4HCS A;  3BYT B;  1HZ9 A;  2UXC H;  2W7O A;  3Q8P B;  4ZQ3 A;  1ENC A;  3OW7 A;  4RKL A;  3GV3 A;  3VYR A;  1WI5 A;  3GTO H;  1N36 H;  5GAE C;  3OTO L;  3PW7 A;  1STE A;  4KY6 A;  2R86 A;  2Q8R E;  1WYD A;  3ONA B;  2FLN A;  4DGZ A;  2ZDG A;  1FNV A;  4LFA L;  4M7E A;  4DR5 H;  2A68 C;  3PUX A;  2R7Z H;  2JEG A;  2R93 G;  1I94 L;  2B39 A;  1CUK A;  1WTQ A;  5COR A;  1RL2 A;  2KCT A;  4BS9 A;  5D1O B;  4ULL A;  1VDZ A;  4F4Z A;  5JEA H;  2RDF A;  1T3N A;  2HVS A;  1VMP A;  4K5W A;  1EYD A;  3RZO B;  2JQO A;  5JEA J;  2Q2I A;  5JVH 3;  4LF7 L;  1PH9 A;  4HIK A;  4DR6 L;  5IP7 H;  3VYT A;  2EXZ A;  1KEE A;  4Y7N B;  3I91 A;  4Y8V B;  3MZ5 A;  1TWA A;  1MSH A;  1GUG A;  1B3Q A;  5E3F A;  3AB9 A;  3M7G A;  3FPP A;  3NTK A;  4K2K A;  2E5L Q;  2R93 B;  1CSQ A;  1SSO A;  1NSN S;  1NE3 A;  3RJ0 A;  2EIF A;  4IUT A;  2W70 A;  4L5Q A;  2VUM G;  1M8A A;  3LWU A;  2F0F A;  4MIU A;  3HZX A;  2PNR C;  4KKS A;  3KDF A;  1MJC A;  1XNQ L;  4APV A;  3CPF A;  1PH1 A;  1HR0 L;  2JA5 A;  2CQO A;  1C9O A;  4A3L H;  1ZKO A;  1Q81 C;  1ZEQ X;  3D4D A;  5BR8 Q;  1RJR A;  4O2D A;  1RTO A;  2JA8 B;  2W9B B;  3I4N B;  2IBK A;  2Z8L A;  5LMN Q;  2UU9 H;  4HJ8 A;  1XNR H;  3SXH A;  5IYC H;  4GOP B;  2R92 G;  3FHW A;  2FMC A;  2QEJ C;  4KJO A;  4X64 L;  1IBK Q;  1Q8I A;  2B63 H;  3HOV H;  3JRW A;  3EPG A;  4P74 A;  4KHP L;  5H1S E;  1Z47 A;  3BJY A;  4GLA C;  2J6T A;  4YP3 A;  1E3P A;  4C1N I;  1V1P B;  1SRO A;  1KDA A;  4X3S A;  3K5L A;  3OTO H;  2DUD A;  4ALP A;  4A3D G;  1U0L A;  1JJC B;  1YHB A;  4IUU A;  3KAJ A;  4K8J A;  1X3F A;  5BMV F;  4LFA H;  3B6Y A;  1I94 H;  4RG1 A;  4PQX A;  5I9P A;  1EIH A;  3HP3 A;  1TWG A;  2R92 B;  4A2B A;  2KQ3 A;  1EY8 A;  1QJO A;  1GUN A;  2JEB I;  2R84 A;  2PW5 A;  2DY8 A;  1OTC A;  1JE5 A;  3H3V C;  1PTO C;  5JPN C;  4IZO A;  4HTH A;  4J9N A;  5KT2 A;  4Q43 A;  5C3W A;  2RKS A;  1VF7 A;  4DR6 H;  5BR8 L;  2FPG B;  1GUS A;  4A3D B;  3RB6 A;  5CV5 A;  4EG0 A;  4GKJ L;  5KT3 A;  5CBA E;  5LMN L;  3I4M B;  1EYC A;  1S5C D;  2WE6 A;  2K04 A;  2EXD A;  2K03 A;  4JI0 Q;  1S03 G;  1EQV A;  4B3T H;  2I5M X;  4F4X A;  3RMH A;  2DPI A;  2KCC A;  1YIJ A;  1W96 A;  5C3E H;  5KFW A;  4V19 0;  2CWP A;  4K6L A;  5I2X A;  4AYB A;  1YNJ D;  2HD3 A;  4JI7 L;  1KJ9 A;  1UUP A;  2MQH A;  4TVA B;  2FK3 A;  4JC0 A;  2YZG A;  1FYC A;  5EWF A;  4HNV A;  1LTS D;  1R4P B;  3KTM A;  1HZA A;  1RYR A;  3E0E A;  1S0O A;  4A3C H;  4DL5 A;  3KF6 B;  1HNZ Q;  4DAP A;  2Y0S A;  3EVQ A;  1Q1E A;  4GS3 A;  3I4L A;  1STA A;  4J9P A;  3M3Y H;  2B8F A;  4H13 C;  5K5P A;  3QB3 A;  4YB8 B;  4L5R C;  3PR4 A;  3VYS A;  3H0G A;  4GLV B;  3K5N A;  4JI1 L;  4IRD A;  3WO0 A;  5DAU A;  2F4V L;  4UCU A;  1KAB A;  3VA7 A;  1IBL L;  2R82 A;  3SI8 A;  1PH4 A;  3S17 B;  4NKL A;  1G29 1;  4Q44 A;  2VL6 A;  3CME A;  5F9N A;  2NUA B;  2CW0 C;  3ETJ A;  2P5Z X;  5HUR A;  4LF6 Q;  5DLG A;  2E5L H;  1DCZ A;  1GUW A;  1SYB A;  5DLF A;  1SMY C;  2HUG A;  2V4R A;  2C2E A;  5FLX E;  2CFM A;  1VQG A;  5J3B A;  1SYE A;  4A3J B;  1I50 A;  4C3I H;  1HZB A;  2AWN A;  4OWT B;  1W3S A;  2UXB Q;  1XMQ L;  1XPU A;  1LTT D;  3DEP A;  2N88 A;  1SJH D;  2WIN B;  1A2T A;  4WRD A;  2FLP A;  1Q46 A;  5JPM C;  3C1F A;  1TWH A;  4ZUI A;  1TWA B;  3BQ1 A;  2YRW A;  5BR8 H;  2Z1C A;  3Q22 A;  2KUM A;  3CCU A;  4G4K A;  4UCT A;  4EX5 A;  4LK1 C;  2R8H A;  4GKJ H;  1G6P A;  5EKK A;  5LMN H;  1S10 A;  1SN8 A;  3K81 C;  4LUZ A;  4MA0 A;  5FO7 B;  1LM0 A;  2FMM A;  3KDF B;  2ES2 A;  4P71 A;  3AEV A;  2NVY H;  1SFO A;  2C28 A;  4PWQ A;  3TQ1 A;  4DV3 L;  2LS0 1;  5I6Y A;  4E6I A;  4OHJ A;  4QWB A;  5M5W B;  5LXT F;  1AUX A;  3RIZ A;  3TP7 A;  4J8Q A;  1OXS C;  4O2B F;  4JI7 H;  2I80 A;  3F2U A;  2ICE C;  1K8A C;  4YAJ B;  1TXY A;  1PXU A;  4TRD A;  2K75 A;  5EGT A;  1YJW A;  1N33 L;  3MA2 B;  3PVX A;  4ILW A;  1PLF A;  2PMZ A;  4LH6 A;  2WTF A;  3J81 i;  1KDC A;  3A8J E;  2AGQ A;  3T4A C;  2XTI A;  3S1M B;  5KFL A;  4BBS G;  1NNX A;  1YNX A;  4A3M G;  2IP4 A;  3BZC A;  1S4Z A;  3AU7 A;  1Y1V H;  1P8L A;  1BBX C;  3EN2 A;  1QE6 A;  4DV7 L;  3IAY A;  3J7A V;  4AIM A;  1BNC A;  5KT7 A;  4LF5 Q;  1IXR A;  2Z4H A;  1B7Y B;  5ELO A;  3TP5 A;  4EQ5 A;  2RGR A;  2EQS A;  4QGU A;  1AUV A;  5C4H A;  2EY2 A;  4C2M H;  1TWG B;  2E76 C;  3GP7 A;  5EDW A;  2C2R A;  2NU7 B;  4ED7 A;  5IYZ F;  4HSV A;  1VBH A;  1W6K A;  4F87 A;  4BBS B;  5E1F A;  1ILP A;  4A75 A;  3LNN A;  4A3M B;  3F8N A;  4AYB G;  3UFX B;  1AZQ A;  2NZO A;  4O42 A;  1K1S A;  1SEB D;  3BJU A;  1SNP A;  5L9X A; 
#chains in the Genus database with same CATH homology
 2Z6K C;  4A93 H;  1I50 H;  1BKB A;  3S1R H;  4HID A;  2YTY A;  1V9P A;  2Q2U A;  3HOU H;  5IT9 c;  3RZO H;  4OON A;  1FGU A;  4NPS A;  3TRE A;  3JAM c;  3CCV A;  1VQB A;  1TWH H;  5M5X H;  4JI6 Q;  1A63 A;  3A74 A;  1PYS B;  2Y0S G;  4P73 A;  1XMQ Q;  5IWA Q;  5C4X H;  3TRZ A;  4DR7 Q;  4LW1 A;  4B3R L;  4JI5 L;  3TEH B;  1P16 A;  3SGI A;  3CCL A;  4POG A;  5IYB H;  3UDX A;  3H0G G;  1PHJ A;  1PH8 A;  1HZC A;  2Y0S E;  4JG2 A;  5GAH C;  2A8V A;  1NTG A;  1E1O A;  1UE6 A;  2BA1 A;  1HR0 W;  2NN6 G;  4DKA C;  4C3J H;  1S40 A;  2H5X A;  3NBH B;  1YHA A;  4GKK Q;  2Q2H A;  4IJL A;  3STB C;  4IOC A;  1SFO H;  5GAD C;  4BXX G;  3HOY G;  2V1C C;  2KEN A;  4LF9 L;  4P75 A;  3I56 A;  4B3M L;  2I5H A;  4A3F G;  2ZTC A;  3HOX H;  4HJ9 A;  4DV3 Q;  4A93 G;  1HNW L;  4LUV A;  5IY0 A;  1V43 A;  4LUO A;  3HOU G;  1X3E A;  1FVI A;  2JA8 H;  3M9B A;  4JI2 Q;  1NJI C;  3CPW A;  4DUZ L;  2K5V A;  1PV4 A;  1N33 Q;  3I4N H;  1OXT A;  1LYL A;  1VQF A;  5C4X G;  1UE7 A;  2NN6 I;  4DUY Q;  2OQK A;  3RN5 A;  2VQE L;  3M4O H;  2ATW A;  3PGZ A;  4R4C A;  4NXM L;  2N3S A;  4X66 Q;  3KOJ A;  4JOI A;  3K0X A;  4OWW B;  3ICE A;  1RIP A;  1BBU A;  2UXC Q;  4JBJ A;  3RNU A;  1OXV A;  1YBY A;  2JA5 G;  4R4I A;  3K7A H;  5GQO A;  2E2I H;  1JJG A;  2RHQ B;  4LFC L;  4DV5 Q;  4DV7 Q;  1N36 Q;  3EBE A;  2R7F A;  1A62 A;  1GKH A;  4AQY Q;  2ID0 A;  1Q86 C;  3RN2 A;  1CSP A;  2HHH L;  1MJE A;  4LFB Q;  1KIX A;  3KJP A;  4JOI C;  1Q8K A;  4PZ7 A;  1NMF A;  4DR5 Q;  2JA9 A;  2YV5 A;  1Y1W H;  1KD1 C;  1N32 L;  3GD7 A;  5JJK A;  1Q1B A;  3ULJ A;  1DGS A;  1KXL A;  2KCM A;  3L2P A;  3NEN A;  3HOX G;  1T9H A;  1O7I A;  2DGY A;  3Q8D A;  3ULL A;  5AJ3 Q;  4GKK L;  2R92 H;  4IPD A;  1N9W A;  1N8R C;  2JA8 G;  5LMN W;  1AH9 A;  1V1Q A;  4HJA A;  3CQZ H;  2CCZ A;  3I4N G;  1CKM A;  4QQB X;  3S16 H;  1TWF H;  1X56 A;  4X62 L;  1KQS A;  2K4K A;  1VQ7 A;  1K8G A;  2HHH Q;  3PF5 A;  1SMX A;  4B3T L;  3GTJ H;  2BH8 A;  5JJI A;  4UY8 C;  1LTL A;  3ERS X;  4JV5 L;  3M4P A;  4MTN A;  4QIW E;  4JI2 L;  4POF A;  3T1H L;  3UDG A;  2OCE A;  4A3G H;  5HY6 A;  1A0I A;  3UDF A;  1XJV A;  4LWC A;  3I4M H;  3RZD H;  2JJQ A;  1VS0 A;  1NY4 A;  3CAM A;  3MXN B;  2NZH A;  2ASB A;  2IX1 A;  4A3E H;  3KYH C;  3PIP A;  4BY7 H;  4B3R Q;  3CCM A;  4AH6 A;  4JI5 Q;  4X66 L;  3CCE A;  3L0O A;  5ELN A;  1Y1W G;  4BA2 I;  1BVS A;  1E22 A;  1EIY B;  1QUQ A;  3W5O A;  4Y52 H;  2HQL A;  5LMU L;  4DV5 L;  1VQ9 A;  1QZH A;  1VQP A;  2WB1 G;  1K73 C;  1OXU A;  3BZK A;  2D0P A;  1VQI A;  1KRT A;  1HNX Q;  1NBW A;  3K7U C;  1WFQ A;  3D31 A;  4HJ7 A;  4DR3 Q;  3OW2 A;  2NVT H;  4GN3 B;  4LF9 Q;  3HKZ G;  2K52 A;  1CKO A;  1N34 L;  3H3V I;  4UP8 A;  2WB1 E;  2UU9 Q;  3CCS A;  1XNR Q;  1CKN B;  1SE8 A;  1WJJ A;  1YVC A;  3CW2 C;  1VQ8 A;  4BY1 H;  3HOZ G;  2AKW B;  1EQR A;  1E24 A;  1HNW Q;  3HKZ E;  2GVB A;  3J81 j;  2PQA B;  1KRS A;  2OQ0 A;  1EFW A;  5C0X I;  4WJ3 M;  4BY7 G;  2RCN A;  1IYJ B;  1K83 H;  1VQC A;  4GN5 A;  4DUZ Q;  1I5F A;  1VQE A;  2E5L L;  2IX0 A;  3I4M G;  3VDY A;  1L0W A;  1D8L A;  1I3Q H;  1SLJ A;  5JJL A;  4JBM A;  1K3R A;  1IZ6 A;  3K80 C;  5C4J H;  4YHH Q;  2ZTE A;  3HFZ B;  4A3E G;  2OWO A;  3OTO Q;  3DLL A;  2VQE Q;  5M3M G;  3AFQ A;  2RHS B;  2I5L X;  4AYB E;  3DM3 A;  2A19 A;  3PUY A;  1PH2 A;  4KI0 A;  3UE1 A;  2MO0 A;  1GD7 A;  1VQH A;  4LFA Q;  1VQ4 A;  1JB7 A;  4NXM Q;  4QY7 A;  3M7N A;  1Y1V G;  2QA4 A;  3I4O A;  3FKI H;  2VNU D;  2F52 A;  3PUZ A;  3PO2 H;  2VS1 A;  4C3H H;  2IT1 A;  4LFC Q;  2K5N A;  3HOW H;  1QZG A;  4JI4 L;  2A1A A;  3KF8 B;  2JA6 G;  4A3J H;  2JE6 I;  1PH3 A;  1WOC A;  4R4O A;  2E8G A;  4JI8 Q;  4Y7N H;  2ALY B;  2GVA A;  4A4I A;  5IE8 A;  1SRU A;  1L1O A;  4MNO A;  4UP7 A;  4IFD J;  2KHJ A;  1N32 Q;  2R7D A;  2VQF L;  4A3I H;  1VQL A;  2UXD L;  3CC7 A;  4DR4 L;  2R93 H;  4BY1 G;  4GNX B;  1XMO L;  3KFU A;  2YU9 H;  4DR6 Q;  2PI2 A;  1HNX L;  1IBK L;  4HIM A;  1BBW A;  3G71 A;  3J80 c;  1UEB A;  4QJF A;  4DR3 L;  1Q12 A;  1L1O C;  2BH2 A;  2ZJQ A;  2UU9 L;  3D0F A;  4TQU S;  1M1K C;  1XNR L;  3PUV A;  4J15 A;  3RR5 A;  1Z9F A;  4X62 Q;  4A3K H;  5HGQ A;  1IL2 A;  3A5U A;  3F2B A;  2K14 A;  3F1Z A;  1U5K A;  4B3T Q;  2D0O A;  3S15 H;  4IPC A;  4JV5 Q;  3PCO B;  2B29 A;  2E2H H;  1FL0 A;  4GN4 B;  4OXP A;  3ZJY C;  3KF6 A;  5IP9 H;  3T1H Q;  1FJG L;  1HZ9 A;  4YWM A;  2AMC B;  3AFP A;  1E7Z A;  1YIT A;  2QGQ A;  1A8V A;  4L5T A;  2LXK A;  1WI5 A;  4YHH L;  3GTO H;  3HOW G;  1PVO A;  1VQD A;  2XGT A;  5GAE C;  3OTO L;  4IFD G;  2OTJ A;  4A3J G;  3S24 A;  1WYD A;  1NMG A;  2VUM H;  2HIX A;  5IYB G;  3CCJ A;  3UE0 A;  2ZJR A;  1XPO A;  4LFA L;  4B3S L;  3PO3 H;  2R7Z H;  3PUX A;  2YYZ A;  3STB D;  4A3I G;  4LF8 L;  2R93 G;  1I94 L;  1CUK A;  3L7Z C;  3E9I A;  5LMU Q;  1VQ6 A;  1UE1 A;  1X6O A;  3W1B A;  1RL2 A;  3PSI A;  3H15 A;  2KCT A;  3I2Z A;  3I7F A;  4JI8 L;  4YCU A;  1LUZ A;  2JQO A;  4IOA A;  5JEA J;  1YZ6 A;  1Q7Y C;  2Q2I A;  1N34 Q;  4DAM A;  4A3K G;  1S72 A;  1X54 A;  4XIG S;  1PH9 A;  4HIK A;  2UUC Q;  4JI0 L;  4LF7 L;  5IP7 H;  4DR6 L;  1GVP A;  3F8T A;  5IYD H;  4DNI A;  5IP9 G;  4P72 A;  4JYA L;  3WWV A;  1PYB A;  3IRB A;  1MIU A;  2WFW A;  2E5L Q;  1CSQ A;  3K8A A;  4IO9 A;  1NE3 A;  3NEM A;  2PMZ E;  2EIF A;  3CXC A;  5GAG C;  4L5Q A;  4YWK A;  3CMA A;  4PG3 A;  3EIV A;  4IJH A;  2VUM G;  4A3M H;  4A3D H;  3CF5 A;  2HT1 A;  3PO3 G;  3OYY A;  3G48 A;  4DK3 C;  1YJ9 A;  1K9M C;  3S14 H;  2AHO B;  3KDF A;  5FLX c;  5EAY A;  2N49 A;  1MJC A;  2UUB Q;  1XNQ L;  4APV A;  1HNZ L;  1IBM L;  3CPF A;  1PH1 A;  4UP9 A;  1W2B A;  2CQO A;  1C9O A;  5JEA G;  4BBR H;  1Q81 C;  1HR0 L;  5BR8 Q;  4JI4 Q;  4A3L H;  1X65 A;  4O2D A;  2E2J H;  2VZA A;  1PH7 A;  2IY5 B;  5FLM H;  2YTX A;  2ZJP A;  5LMN Q;  2VQF Q;  1XPR A;  3RLF A;  4HJ8 A;  2CKZ B;  3CCR A;  3CD6 A;  1XMO Q;  4DR4 Q;  2UXD Q;  5IP7 G;  5IYC H;  4DV0 Q;  1HJP A;  4GOP B;  3FHW A;  2R92 G;  4OO1 G;  1QUQ B;  5IYD G;  2N8N A;  4X64 L;  1IBK Q;  5C44 H;  2WAQ G;  2B63 H;  3HOV H;  2N78 A;  4OX9 L;  4P74 A;  4DAY B;  4LF6 L;  4KHP L;  5H1S E;  1Z47 A;  4GLA C;  1WCM H;  1E3P A;  1GM5 A;  4IPG A;  2UUC L;  2WAQ E;  5M5Y H;  1SRO A;  1C0A A;  2DUD A;  2KBN A;  4ALP A;  4A3D G;  1U0L A;  1JJC B;  1YHB A;  5DLQ E;  4DV4 Q;  3CC2 A;  2UXB L;  4A3G G;  1X3F A;  3KLW A;  3W1G A;  1FJG Q;  1H95 A;  4RMF A;  3RLN A;  1TWC H;  1KL9 A;  2C35 B;  3B6Y A;  3F2C A;  4DR2 L;  4RG1 A;  3J81 c;  1Y14 B;  4UPA A;  4A3L G;  4BBR G;  2MFI A;  1UE5 A;  2Z0S A;  4DV6 Q;  4OO1 I;  2JEB I;  3S17 H;  1E1T A;  1X55 A;  3G6E A;  2JEA I;  5FLM G;  1OTC A;  4B3S Q;  1JE5 A;  5M3F H;  4LF4 L;  4LF8 Q;  3AQQ A;  4YCV A;  1I94 Q;  1C7Y A;  1D7Q A;  5IYC G;  3J80 i;  3GTG H;  1X3G A;  3I55 A;  2B3G A;  5BR8 L;  5C44 G;  2PI2 E;  4YY3 L;  1XTD A;  1JMC A;  1VQK A;  2UUA L;  2B63 G;  3HOV G;  3U4Z A;  4K0K L;  3PF4 A;  1ASZ A;  1QVF A;  3J7Z C;  4DK6 C;  4GKJ L;  4X6A H;  1WCM G;  5LMN L;  1Q82 C;  1VQ5 A;  3GTM H;  4DR1 L;  3PIO A;  2EXD A;  4DV0 L;  4LF7 Q;  1L1O B;  4OWX B;  1TWA H;  4JI0 Q;  1G51 A;  2I5M X;  4NXN Q;  2JA7 H;  2NVX H;  1YIJ A;  4BA1 I;  5C3E H;  4JYA Q;  4R4Q A;  2CWP A;  3UDI A;  4A3B H;  1R9T H;  4GLX A;  2GN5 A;  5FJ8 H;  4JI7 L;  2MQH A;  4GNX A;  4TVA B;  4JC0 A;  2L15 A;  4DV4 L;  3KJO A;  1J5E L;  5M3F G;  2F3I A;  3FKI G;  2K5H A;  1VQO A;  3GDE A;  1GO3 E;  2K50 A;  2JA5 H;  4JI3 Q;  3PO2 G;  4LF5 L;  1HZA A;  4FDB A;  3E0E A;  4A3C H;  4YWL A;  4X65 L;  5M5W H;  4GNX C;  1XNQ Q;  1I6H H;  3KF6 B;  2QEX A;  3A0J A;  1HNZ Q;  1IBM Q;  1VQN A;  3U4V A;  4PZ8 A;  4DV6 L;  1HR0 Q;  3S1Q H;  2ZM6 Q;  4DV2 Q;  1Q1E A;  4GS3 A;  3G4S A;  2VW9 A;  1VQM A;  3TQY A;  2I0Q A;  3F2D A;  3M3Y H;  3S1N H;  4L5R C;  2YTV A;  4GLV B;  4DV1 L;  3S1M H;  3S2D H;  1VQA A;  4JI1 L;  2LXJ A;  3J7A 5;  1EOV A;  5E7N A;  2IHF A;  2WP8 J;  2F4V L;  3A5Z B;  2JA7 G;  5K36 G;  1IBL L;  4X64 Q;  1ASY A;  1PH4 A;  1G29 1;  5C3E G;  2VL6 A;  3CME A;  2UUB L;  5GRO A;  2PNH A;  4OX9 Q;  4LF6 Q;  4KHP Q;  4L5S A;  4A3B G;  3PUW A;  3TS0 A;  2MNA A;  4R4T A;  5FJ8 G;  2CFM A;  1VQG A;  5J3B A;  2HIV A;  4NXN L;  1K0R A;  2KHI A;  4IFD I;  3BU2 A;  1UWV A;  1YEZ A;  4YCW A;  4C3I H;  3H3V H;  1AE3 A;  1HZB A;  2AWN A;  4OWT B;  4JI6 L;  2D62 A;  2MO1 A;  1W3S A;  1PA6 A;  3GTK H;  2UXB Q;  1TWG H;  4DR7 L;  2FXQ A;  1XMQ L;  5IWA L;  1XPU A;  1EWI A;  1JJ2 A;  4A3C G;  1Q46 A;  1SR3 A;  3FP9 A;  4DR2 Q;  2BA0 A;  3CCQ A;  4BBS H;  3RLO A;  1S3O A;  1X9N A;  3JC6 6;  1KC8 C;  1PH6 A;  4ME3 A;  5C0X J;  3CCU A;  2R7Z G;  4EX5 A;  3T1Y Q;  1EUJ A;  4JI3 L;  1G6P A;  4LF4 Q;  3LGJ A;  1QVG A;  3CC4 A;  1SN8 A;  3K81 C;  3M85 A;  4LUZ A;  3CP0 A;  1LM0 A;  4QL5 A;  2ZM6 L;  3M4Q A;  4IPH A;  3KDF B;  4DV2 L;  4YY3 Q;  2UUA Q;  1B8A A;  4P71 A;  1EQQ A;  2ES2 A;  2Q2T A;  2NVY H;  4LNQ A;  3AEV A;  4K0K Q;  4NB3 A;  3GTQ H;  1PH5 A;  2NVQ H;  1JT8 A;  4DPG A;  4GKJ Q;  1YHQ A;  4XTC S;  4DV3 L;  3HOZ H;  1B70 B;  1J6Q A;  1M90 C;  4DR1 Q;  1QVC A;  1VQJ A;  3MEF A;  1OXS C;  4H02 A;  4KLK A;  3HKS A;  3PV0 A;  1KAW A;  1K8A C;  1TXY A;  1N33 L;  2K75 A;  1YJW A;  3AYH B;  1L2F A;  3E9H A;  4JBK A;  1YJN A;  3J81 i;  1OXX K;  4DUY L;  3GO5 A;  4WJ4 A;  4R1J A;  4JCV E;  2XTI A;  2RF4 A;  1HH2 P;  2ZTD A;  2R6G A;  5C0X G;  5M3M H;  4BBS G;  4JI7 Q;  2OTL A;  1YNX A;  1KHI A;  3U50 C;  3ULP A;  4A3M G;  4GOP A;  2UXC L;  3BZC A;  2AWO A;  3S2H H;  1Y1V H;  1J5E Q;  1P8L A;  1PFS A;  4PMW A;  2IHE A;  4MZ9 A;  3EN2 A;  4DV7 L;  1N36 L;  2LSS A;  4AIM A;  4AQY L;  4LF5 Q;  4LFB L;  4A76 A;  1IXR A;  4KHZ A;  4O0A A;  1B7Y B;  2JK8 A;  4X65 Q;  2JA6 H;  1CKN A;  3ER0 A;  5ELO A;  4EQ5 A;  4DR5 L;  4GOP C;  4JBW A;  3H0G H;  4PZ6 A;  2EQS A;  3NEL A;  4QGU A;  1MKH A;  4B3M Q;  4C2M H;  3TS2 A;  2VY3 A;  3T1Y L;  1EIF A;  2PQA A;  5AJ3 L;  3GTP H;  4HJ5 A;  2Z6K A;  4DV1 Q;  4BXX H;  4JI1 Q;  1AE2 A;  2F4V Q;  3JAM i;  3HOY H;  1YI2 A;  2CWA A;  4A75 A;  1IBL Q;  1VCI A;  4AYB G;  1EYG A;  3GTL H;  2NZO A;  3U58 A;  3BJU A;  4A3F H;  4HIO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...