2R92G

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
molecule tags Transferase/rna
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r92G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r92G01
3KJOA 3H3VH 2UU9Q 2JA8G 4AH6A 3W1BA 2OTJA 4BY1H 2K75A 4LFBL 3CW2C 4DV5Q 4LF9Q 4DR7L 4HIKA 2MO1A 3I4NG 1IYJB 1EWIA 4DV3L 3RR5A 1BBWA 1N36Q 1VQDA 3BZKA 3HOUG 3CXCA 3I2ZA 4GOPB 1K8AC 3PCOB 3CMAA 4OX9L 1HNXL 1MJCA 4PG3A 5GAHC 4DR5Q 4LW1A 1JMCA 4IFDJ 4PMWA 1UE1A 1SLJA 4NPSA 1Q86C 5JJKA 3OTOQ 5M3MG 1GM5A 1P8LA 5IY0A 3HOVG 3HOUH 1LTLA 1XTDA 2OQKA 3ERSX 4LF5L 4UP9A 5M3FG 4XTCS 4IPGA 1N32Q 2RHQB 2ES2A 3HKZG 4R4IA 4UY8C 4A3GG 1QZHA 4JI3L 1A0IA 1HZBA 1NTGA 5M3MH 3HOVH 4NXNQ 4KHPQ 4C3IH 4JI6Q 3MXNB 4GS3A 2AWNA 2LXKA 4A3GH 1C7YA 1CKOA 1E24A 2R7ZG 3HFZB 3K7UC 3U58A 1KRSA 2MQHA 3GDEA 4JI0L 4MNOA 1X56A 2WAQG 1IBKQ 4EX5A 1L1OA 3J80c 1HNWL 1PH6A 1EOVA 1N34L 2CKZB 2Y0SG 1E22A 4JOIA 2R7ZH 2K52A 2WFWA 1TXYA 3UE1A 3M7NA 1SROA 3BJUA 3CAMA 3AFQA 2KENA 1IXRA 4C3JH 2MFIA 4FDBA 2MO0A 2C35B 4JYAL 1NMGA 1MIUA 1L0WA 1XJVA 3I55A 3CCVA 1UE5A 4OONA 4PZ8A 2R92G 5HY6A 4LFCQ 2CCZA 3UDXA 1W3SA 1VQMA 1PH8A 4LF5Q 4DK3C 2ZJPA 1XMOQ 1L1OB 1TWAH 2YTXA 2UUAQ 3PIPA 2N49A 2QEXA 2ZM6Q 1PHJA 3GTKH 3PSIA 2N8NA 5C0XI 4DV2Q 1VQ8A 4LF4Q 1Q12A 1K9MC 3J81i 1FJGL 1VQ7A 4LF6Q 1K3RA 1SN8A 3G4SA 3OW2A 1HR0W 2R92H 3F8TA 3DLLA 5GADC 3RZOH 3S2HH 4WJ4A 4BXXG 5IP7G 4DV4L 4GLXA 2VNUD 1PYBA 3BU2A 3TQYA 3HKZE 4LF7Q 5LMNL 4DV6L 3G71A 4YWLA 1YHAA 1A62A 1D8LA 5M5YH 4DR2Q 4NXML 1OXSC 4GKKL 4BXXH 4GN5A 4C2MH 5IP7H 1K73C 3KYHC 1M1KC 2UUBQ 2UXDL 3KF8B 4YHHQ 5JEAJ 2DUDA 4RMFA 3TS2A 1UE7A 1ASZA 4X64L 3PV0A 3S14H 2OWOA 3EN2A 4DPGA 3A74A 4JC0A 4GOPC 2OCEA 2K5VA 1Y1VG 4P74A 1KAWA 4B3SQ 1PV4A 3NENA 4JI8L 5IYCG 4LWCA 5FLMG 1X9NA 2UU9L 2R6GA 4UP8A 2WAQE 4B3TQ 4OWWB 3JC66 3KOJA 1B7YB 2WB1E 5C44G 4DV5L 4QIWE 4LF9L 4A76A 2Y0SE 3PGZA 1K0RA 4GLAC 5C0XG 3GD7A 1Y1VH 4DV0Q 5IYCH 5AJ3Q 1Y1WG 1LM0A 1N36L 2ZJQA 3CC7A 3M4QA 4GN3B 4DV7Q 3GTOH 4QQBX 1YBYA 1BKBA 3JAMi 4DR5L 5C44H 3RNUA 1Q82C 2A8VA 3S16H 1G291 1YHQA 2AHOB 1JT8A 3OTOL 3GTQH 1X3EA 3K80C 3PF5A 4A75A 1Y1WH 4L5TA 1OTCA 4X65Q 1I94Q 3KFUA 4YCWA 1VQLA 2HIXA 3RLNA 3CQZH 1N32L 1UE6A 3VDYA 3S1NH 2JA5G 2EIFA 4BY7G 1EQQA 3PUZA 2Q2HA 4NXNL 1Q8KA 2EXDA 3STBC 2VQFQ 4EQ5A 4KHPL 1J5EQ 3G6EA 1OXTA 4A3MG 4DKAC 4APVA 2A19A 1QUQA 1K83H 1IZ6A 2GVAA 4X62L 5K36G 1EFWA 4QY7A 3WWVA 1QVCA 4DUYQ 4IPHA 2JA5H 3L2PA 2JJQA 1O7IA 3CCMA 4JI8Q 4L5QA 1P16A 4R4OA 3UDGA 1IBKL 4A3MH 1VQ5A 3T1YL 4DUZQ 3W5OA 4L5SA 3IRBA 2CWAA 3AFPA 1I50H 4AQYQ 2HHHL 2NN6I 1L1OC 2IT1A 3CCQA 4YWMA 3FP9A 5GQOA 3T1HQ 4JOIC 5JJLA 1QUQB 4HIMA 4DR1Q 1LUZA 1X3FA 1VQEA 4A3BH 2K14A 3FHWA 1AE2A 3ULLA 3J81j 3PUVA 3PF4A 2K50A 1Q1BA 4BA1I 1VQ4A 4LFCL 4QGUA 2ATWA 4A3EG 1XMOL 4POFA 2UUAL 1KQSA 3K8AA 4UPAA 3CC4A 2ZM6L 5IT9c 4R4TA 4DV2L 1PH3A 2PMZE 2VS1A 3BZCA 2D62A 2VL6A 5FJ8H 2I5LX 4R1JA 3F2CA 3TS0A 4A3JG 4LF4L 1X54A 5M5XH 4LF6L 2BA1A 1C9OA 4PZ6A 4A4IA 4A3EH 2IHEA 3PIOA 1U5KA 3KDFA 2JEBI 4DAYB 4X62Q 1VQAA 2RCNA 5GROA 1YIJA 3F2BA 4DV1Q 4YCUA 1N33Q 3CCRA 4A3CG 1XPUA 4A3JH 1FL0A 4JBJA 4LF7L 1HZCA 1VCIA 1VQIA 4JBKA 1YITA 4DR2L 2NN6G 2WB1G 4GN4B 3T1YQ 2UUBL 5ELOA 1BBUA 1VQBA 4YHHL 4A3CH 2HHHQ 1DGSA 3TRZA 2RHSB 4HIDA 2AKWB 3K81C 2VW9A 2QA4A 3L0OA 3I4MG 2BH8A 4DR6Q 3CP0A 1G51A 4B3SL 2F4VQ 1A63A 3KDFB 1HNZQ 1TWCH 4PZ7A 4P71A 1NMFA 1UEBA 1W2BA 1SFOH 1MJEA 2VQEQ 4B3TL 3E9IA 2Z6KA 2KCMA 1XNQQ 2AWOA 4Y52H 3F2DA 3GTMH 1WJJA 4JI4Q 2Q2IA 3J7A5 1EYGA 2ZTEA 4DAMA 4DV0L 3I4MH 1TWGH 5AJ3L 1Z47A 4POGA 1S40A 4TVAB 2V1CC 3CCUA 5C4JH 4DV7L 4B3RQ 2KHIA 1HR0Q 4B3RL 4R4QA 1XMQQ 3PUWA 3AYHB 1E1OA 2YTVA 3UDIA 2KBNA 3CD6A 4X65L 1I94L 1WI5A 4MZ9A 5LMUQ 3M4PA 1KL9A 1VQPA 1QVGA 2ZTCA 2RF4A 3I4OA 1VQHA 3RZDH 1I3QH 3B6YA 5IWAQ 2VQFL 1VQGA 1OXUA 1VS0A 3DM3A 4KI0A 4R4CA 3J80i 3CCJA 1YJ9A 1J5EL 4BBSH 2NZHA 3JAMc 4P72A 5BR8Q 1SRUA 4JBMA 3NBHB 5C3EG 2B63G 3K0XA 2XTIA 2LSSA 4DUYL 4ALPA 4IOCA 1IBMQ 1CKNA 4DK6C 1LYLA 2JEAI 1VQFA 1H95A 4MTNA 3H0GG 4LUZA 4YY3Q 2Q2UA 1PH7A 2OQ0A 1E7ZA 2IX0A 4LFAQ 4JG2A 3ULJA 5C3EH 4JBWA 4DUZL 3CF5A 4JI5Q 3U4VA 2MNAA 2B63H 4AQYL 3AEVA 1JJCB 5JEAG 4AIMA 1VQ9A 1FGUA 3H0GH 2VUMG 3T1HL 1ASYA 2K5NA 4DR1L 1OXXK 1YVCA 4JV5L 1CKNB 4A3KH 2JQOA 5IP9G 2KHJA 2IY5B 1J6QA 2VUMH 1RIPA 1T9HA 1WYDA 1N9WA 1IBLQ 3S15H 3KLWA 3M85A 1YJWA 3CCSA 4HJ5A 3U50C 1KD1C 3PO2H 3ER0A 2Z0SA 5M5WH 1XPOA 1XNQL 5IP9H 4JI7Q 1UWVA 4OO1I 1JJ2A 2D0PA 4TQUS 4A3DG 3S24A 5H1SE 1X6OA 1XPRA 3HOWH 1B8AA 4BA2I 4IFDI 2ID0A 4DV1L 1N33L 5GAGC 1TWFH 3HKSA 3HOXG 3ULPA 3S2DH 3D0FA 1AE3A 4A3DH 5C4XG 2Q2TA 4DNIA 1V1QA 1RL2A 3RN5A 4A3BG 3OYYA 4OXPA 4QJFA 1KC8C 4A3LG 4IPDA 4OWXB 3HOXH 1Q1EA 2K5HA 1L2FA 2E2HH 5C4XH 5LMNW 4J15A 4ME3A 1QZGA 4DR6L 3E9HA 2F4VL 1X65A 1GD7A 1HNZL 1K8GA 2F3IA 4Y7NH 2IX1A 2L15A 4JV5Q 2D0OA 4A3LH 2VQEL 4A93G 2DGYA 5FJ8G 3AQQA 1NJIC 1YEZA 2XGTA 4UP7A 3Q8DA 4LUVA 4JI1Q 4B3ML 4JI4L 3PO3G 3G48A 3I56A 1EIYB 1BVSA 4X66L 2JK8A 4OO1G 2Z6KC 3KF6A 1WOCA 1YJNA 3L7ZC 3GTGH 5IYBG 5HGQA 1HR0L 1TWHH 4A93H 5IE8A 1PA6A 3D31A 4KHZA 3GTPH 3A5ZB 3PO3H 4DR4L 1XMQL 4IFDG 1PH5A 1CSPA 1YHBA 2JA6G 4GNXA 4JI2Q 2JA8H 5EAYA 4YCVA 4A3IG 1YI2A 4L5RC 2CQOA 3HOZG 1SR3A 5IYBH 4K0KQ 5LMUL 3CC2A 3I4NH 2UXBQ 5J3BA 4HJ7A 4XIGS 4O2DA 1Y14B 2JA6H 2OTLA 1VQCA 1Q81C 3KF6B 5IWAL 4DR3Q 4A3IH 4LF8Q 3HOZH 3GTLH 2UXCQ 3CMEA 5BR8L 3J81c 1KIXA 1VQOA 3PUYA 2UUCL 1XNRQ 4GKJL 1U0LA 2VZAA 2PNHA 5IYDG 3CCEA 1IBML 1NE3A 2ASBA 2JA7G 2R93G 4WJ3M 4GNXB 2YV5A 2NVYH 2YYZA 2YU9H 5M3FH 2CFMA 1N8RC 4YY3L 1Q46A 1PYSB 3E0EA 3SGIA 4AYBE 4HIOA 1PH1A 1PH4A 3KJPA 3CCLA 4LFAL 1GKHA 3A5UA 4B3MQ 4JI5L 5JJIA 1YNXA 5IYDH 4P73A 2JA7H 2PQAA 3GTJH 2R93H 4JCVE 2NZOA 3I7FA 1FVIA 1V43A 1HJPA 4X66Q 2VY3A 3LGJA 4LFBQ 4LNQA 3TEHB 1VQNA 1VQ6A 3ICEA 4DR7Q 3CPWA 1X3GA 4DR4Q 2NVXH 4DV3Q 3NELA 3UE0A 2E8GA 2FXQA 1HNXQ 4OX9Q 3FKIG 2R7DA 1VQJA 1IBLL 4BBSG 2H5XA 5E7NA 4O0AA 3J7ZC 1PH2A 1SMXA 4HJ9A 1G6PA 2PQAB 2PI2E 2N3SA 4OWTB 5GAEC 1VQKA 4JI7L 2ZJRA 4IO9A 1V9PA 2HIVA 2N78A 3FKIH 1WCMG 3STBD 4JI3Q 2AMCB 4LUOA 3W1GA 1YZ6A 3RLOA 2E2IH 2UUCQ 4GKJQ 3TREA 1PVOA 2B29A 3MEFA 1Q7YC 1CUKA 1S72A 1KXLA 4A3FG 2NVTH 1WCMH 1I6HH 1JB7A 3A0JA 1SE8A 4YWKA 1KHIA 4IOAA 2R7FA 1GO3E 4NB3A 4A3KG 2CWPA 2I0QA 4JI0Q 4IJHA 4RG1A 4BBRG 2B3GA 3M9BA 2E2JH 1KRTA 4A3FH 2KCTA 1HNWQ 1A8VA 1E1TA 1N34Q 2BA0A 2E5LL 5C0XJ 1X55A 3EBEA 3PO2G 4QL5A 2WP8J 1M90C 5DLQE 3K7AH 2JA9A 1Z9FA 3H3VI 1JJGA 1EIFA 4BBRH 4IJLA 1PFSA 4JI1L 3RN2A 2NVQH 3S17H 4JYAQ 4GLVB 3HOWG 1PH9A 3RLFA 1C0AA 4KLKA 1R9TH 4IPCA 1IL2A 2ZTDA 2I5MX 2HQLA 4P75A 5FLMH 1S3OA 4X6AH 4JI2L 1JE5A 1E3PA 3F1ZA 2F52A 2LXJA 3NEMA 4C3HH 4HJAA 1FJGQ 1I5FA 4K0KL 2HT1A 1CSQA 4GNXC 1EUJA 1D7QA 3HOYG 2UXBL 3S1RH 4HJ8A 3EIVA 1OXVA 4AYBG 1NBWA 4DV4Q 3M3YH 3M4OH 4DR3L 2QGQA 4LF8L 1AH9A 3GO5A 1GVPA 2UXCL 4H02A 1HZ9A 2IHFA 2GVBA 2YTYA 5LMNQ 4DV6Q 3H15A 1XNRL 1MKHA 3HOYH 4GKKQ 1NY4A 4NXMQ 2UXDQ 1QVFA 2GN5A 3PUXA 3S1QH 1WFQA 4GOPA 2E5LQ 5FLXc 2JE6I 4BY1G 2ALYB 2I5HA 4JI6L 1CKMA 2A1AA 4X64Q 3S1MH 3U4ZA 1B70B 3UDFA 1HH2P 2BH2A 1HZAA 2EQSA 3CPFA 2K4KA 5ELNA 4BY7H 2PI2A 1EQRA 3ZJYC
chains in the Genus database with same CATH superfamily
1T3NA 4AH6A 3MFIA 3W1BA 2PO4A 4ED2A 2K75A 3CW2C 4HIKA 2MO1A 1IYJB 2PBZA 4DV0H 1N36Q 1VQDA 2I46A 3BZKA 1STGA 4ME6A 3A8JE 3ERQA 3CMAA 2B2TA 1SNCA 1MJCA 5GAHC 4IFDJ 1UE1A 4NPSA 1Z6HA 2X6LA 2XGPA 4G7HC 2R82A 3HKZA 3A56A 4CBVA 3L9AX 1LTLA 2OQKA 4LF5L 1SNOA 4C3IG 5M3FG 3WOEA 4MV3A 5CBEE 3A8IE 4R4IA 1QZHA 4JI3L 4F4YA 1NTGA 1I4RA 2R85A 3FRPB 3HOVH 3VYTA 4XQJA 2M00A 2RDFA 3DXJC 4MA5A 5DLGA 4M8AA 1E24A 4O3RA 2J0TD 3GV6A 4DL4A 3HKZB 1KLUD 3GDEA 2Y0SA 4JI0L 1BNCA 4MNOA 5FO9B 5FPOA 5CAEB 4JI8H 4NLGA 1ESRA 2WAQG 1RD9D 3K5MA 1L1OA 2QKIC 1HNWL 1EOVA 1LTID 5KFCA 4KJNA 3TZUA 2R7ZH 1EL0A 1TWAA 1CZWA 1JOOA 2WFWA 3TP7A 5KG4A 3GTKA 3EFXD 3AFQA 1IXRA 3V96A 1PFBA 1G8ZD 1MIUA 2FLLA 5KIXA 3JSLA 2K03A 1XJVA 3NWTA 2QDBA 4OONA 2R92G 2Y0SB 4RU9A 4J9LA 1W3SA 1VQMA 1XMOQ 2KECA 1L1OB 4LMQD 3SI8A 3SXHA 2L5TA 3I4MB 1TWAB 3PSIA 4DV2Q 4LF4Q 1A63A 1JXLA 1K3RA 1SN8A 2MP1A 3I3CA 3G4SA 3OW2A 3GTKB 4KHPH 1BO0A 5GADC 3DLLA 2W6QA 2H1EA 5IP7G 4X62H 2VB2X 1V1OA 4Q0YA 5CC4A 1STBA 1QJOA 1PYBA 3OOCA 2K7VA 2W6PA 1ZXTA 4LF7Q 3M7GA 5CV8A 3M9NB 2HDMA 4DR2Q 2JEGA 1D8LA 2JEIA 4C2MH 1K73C 2UUBQ 3H3VC 2R8HA 2F0OA 3W3AA 4RZRA 3GIJA 3T1YH 4RMFA 2A74C 3H0GA 2HHHH 3PV0A 2OWOA 3TP8A 3EN2A 4DPGA 3RTXA 4JC0A 2OCEA 3GTOA 3S14B 4JI8L 4QMGA 1X9NA 3J80L 3E5NA 4B3TQ 2WAQE 3JC66 2WB1E 4QIWE 3VR2A 3OIQA 4EFBA 5C0XG 3Q22A 3GD7A 3CQZA 3K0YA 4JPBW 2NBFA 5KFKA 2UUAH 3CC7A 4GN3B 4QQBX 1YBYA 3H0GB 1Q82C 2V58A 1G291 1YHQA 1LTGD 1DOMA 1EY5A 3GTOB 2B2TC 3GIQA 1Y1WH 2JA5A 1BNZA 4FF4A 1OTCA 1EUDB 2NTSA 5KYIA 4LJZC 5LMUH 1KDCA 4ZKBB 3R23A 3M9OB 4KMUC 1GLVA 3FMAA 3GIPA 1TY0A 3CQZB 4OELB 2NTTA 2Q2HA 4KHPL 3OIPA 2MUYA 2VR1A 1XWEA 3ETHA 2YZGA 5L1KA 3G6EA 4ECTA 4DKAC 3TDQA 4X62L 1K83H 1NSNS 2A5HA 4ECUA 2EJFC 2EPBA 4LH6A 4XQNA 3C2PA 2JJQA 4RNMA 2JA5B 5DM63 1AUXA 1LT5D 3MWMA 3TQTA 4M7EA 4A3MH 3T1YL 3KAKA 3W5OA 5K36H 1KJIA 2CWAA 1E4EA 3LWBA 2HHHL 4R8IA 1L1OC 1STNA 2Q8RE 3FP9A 3BABA 5GQOA 3T1HQ 5JJLA 4HIMA 4DR1Q 4DA2A 2E2HB 1VQEA 4A3BH 4B3RH 1FD7D 2K14A 3OWFA 4ED8A 1SSOA 3ULLA 3PUVA 4HMJA 4KY5A 1VQ4A 2NU6B 1D5MC 4C5BA 4LFCL 1SEBD 1UUPA 3OPOA 4X65H 2FE3A 2UUAL 4RB1A 4XT1B 2EJGC 3K8AA 3DMUA 1WSCA 1E4EB 4EBDA 1PH3A 2PMZE 2VS1A 5FJ8H 2I07B 3KHRA 1C3OA 5DQGA 1X54A 3MXPA 4X3TA 1TU2B 3PR4A 3MR6A 5DGAA 3GTPB 2IHEA 5M5XB 1U5KA 3FPPA 3KDFA 4A3EB 1YIJA 4DV1Q 4OIKA 3OHAA 3CCRA 4A3CG 1XPUA 5FD5A 1TWCA 2I87A 4MTDA 3H09A 2K32A 5I6YA 1YITA 2NN6G 3GTMA 1WD0A 5ELOA 1EIGA 2JA6B 2RDGA 2CW0D 1WVLA 4EEQA 2G9DA 1QWYA 2QA4A 2GA4B 4DR6Q 3DWQA 3KDFB 1C4QA 4PZ7A 1SFOH 3AMUA 2VQEQ 4MV4A 3E9IA 4Y52H 1EU3A 2C00A 4HNVA 1W96A 1WJJA 2J6TA 4JI4Q 3J7A5 3VYSA 4RGOS 2ZTEA 1A2UA 3I4MH 2XCAA 1TWGH 1RCVD 3GTMB 2WV6D 1EYDA 2P0AA 4B3RL 2AGPA 4F7XA 5I2YA 3UDIA 2W9AA 3CD6A 3FDTA 5IGGA 3T53B 4X65L 3CU7A 5KG6A 1O7LA 2F3VA 3NPPA 2K5WA 4U7CA 1QVGA 2ZTCA 2RF4A 5LYJF 1SNMA 4C1NK 4V190 3RZDH 3BQ1A 2B63A 1GOZA 2IPKD 3B6YA 3ND8A 2VQFL 4R4CA 1VS0A 4DR3H 3CCJA 4BBSH 4J9OA 4LF8H 4DU9A 4Q8EA 2UXCH 1JQYD 5KNCA 2LSSA 3J81E 4DL5A 1H95A 1VQFA 2EY6A 1SBBB 2F4VH 5KFYA 4YY3Q 2J9GA 2F4IA 3TN2A 3A7AB 1BCPB 2OQ0A 2IX0A 2QCPX 4TUYF 1WCMB 4B3MH 3AEVA 2FPGB 1GUTA 2B63B 3F8NA 1SYDA 2CW0C 3FVQA 3H0GH 2VUMG 4F4XA 1GXDC 2XD4A 1STAA 3RIZA 5FLXW 1YVCA 2RCFA 4ECQA 2NZ1D 2W9CA 5IP9G 2BQRA 2KHJA 3VYRA 2VPSA 1J6QA 1T9HA 2KEDA 3A54A 1O80A 1LO5D 2NUAB 3PO2H 4U6PA 1HTPA 2KA7A 2Z0SA 5KFQA 3MR5A 4QWEA 4JI7Q 3G6XA 4OO1I 1JJ2A 4NMZA 2WACA 5M5WB 4A3DG 1XPRA 4IN3A 1I4XA 1Z7TA 3RAXA 1S0OA 3R5FA 4IFDI 1VMCA 1Y8OB 4ZRZA 3HOWB 2B2UA 4O4HF 3HOXG 1TWFH 2K28A 5NUCA 2W9CB 1IBMH 1WTOA 4JV2A 1CT1D 2Q2TA 3S2DB 4F87A 4IHJF 1E2WA 5CV4A 4A3BG 5K2MA 3OYYA 4A3LG 5KFNA 2K5HA 3NTHA 2E2HH 5LMNW 4J15A 4ME3A 2F0MA 5HV6A 3E9HA 2F4VL 1X65A 1SNPA 1HNZL 1K8GA 5CR3A 2XWBB 4G57A 2CW8A 3LX0A 2DY7A 4BS9A 4A93G 5FJ8G 1OO9B 2FJZA 1YEZA 4B3ML 5CA0F 4XYQA 3KHLA 3I56A 1IL8A 1BF4A 3MR2A 5HGQA 4PMBA 2QK4A 4Q43A 3GTPH 4RCNA 3PO3H 1CSPA 2TSSA 5DNFA 4JI2Q 4GNXA 5KFLA 3GV5B 3WDNA 4A3IG 4L5RC 2CQOA 3CC2A 3I4NH 4HJ7A 1F2LA 3BYTB 4O2DA 2UVVA 1JWUD 1BCPC 3TMEA 2JA6H 4TV9F 1VQCA 3QOLA 3OUZA 5FKAC 5IWAL 5D3DA 4Y8VB 2YS7A 4R9WA 2LFNA 3M4IA 1QB5D 1I4GA 4YQWA 3HOZB 1IBML 4ME5A 2R93G 1PTOB 4GNXB 4YR2A 3VYUA 4TV8F 2NVXA 1VBHA 2ZDGA 1ET6A 1PYSB 3CHBD 4HIOA 5JVDF 5M3FB 4TQSA 2C2RA 3KJPA 2D9UA 3G7LA 3A5UA 5IYDH 3IFDA 4P73A 4JI1H 1ZEQX 2FKLA 5ELBA 3BS1A 1T5XD 3I7FA 2CZGA 2GPWA 2KUMA 3PN1A 3RUPA 2DNEA 4V0BA 4FVMA 3TEHB 1VQ6A 1KJ9A 3FDSA 3K5HA 3FKIA 3PR5B 2B2WA 3NELA 1N36H 2NVXB 2B2VA 3T51B 3H4BA 1VQJA 1IHZA 1IBLL 4BBSG 1LT4D 5KT3A 3J7ZC 1PH2A 2JEFA 1IW7C 3V6HA 3ORQA 2PI2E 1ZHSA 3OSPA 2CHBD 1NUCA 2Z4IA 2ZDHA 2HIVA 2N78A 1PK8A 1B4OA 2E74C 3FKIB 3STBD 4GKJQ 1YZ6A 5EOYA 2M2LA 4DL6A 2A6HD 1M0TA 3MEFA 1Q7YC 1EZ6A 1KXLA 3RFCA 2B2UC 1WCMH 2F0FA 2NVTH 1I6HH 3A0JA 1SE8A 4IOAA 1KHIA 4NB3A 4PV1C 2J6UA 1W6JA 3NK9A 4RG1A 5T14A 3M9BA 5TSSA 1SJHD 2KCTA 1T5EA 2BA0A 2K6AA 3EBEA 3PO2G 4ZAIA 3Q24A 1DM0B 3GILA 1KABA 2ALZA 2VA3A 3H3VI 4OX9H 4JI1L 3RN2A 4YJ2F 3PIO3 1HNXH 4JYAQ 5KT7A 1EIHA 1PZID 3J7AF 1MI2A 1DONA 1VMPA 1RODA 2Z4HA 2F0NA 2Z8LA 4B9WA 2NUCA 4P75A 4I7HA 3SK5A 4X6AH 3A8KE 2L12A 1E3PA 3F1ZA 1U4LA 3L4JA 4C3HH 4LF4H 3AU7A 1CSQA 1PTOC 2EYFA 4GNXC 1EUJA 3HOYG 2HDLA 3EA6A 5ELFA 3S1RH 4ECXA 4ETSA 4IZOA 3EIVA 1LTAD 4AYBG 1NBWA 2A6EC 2QEJC 3BA8A 4Q8FA 5DG7A 2H4OA 3M4OB 2IHFA 2YTYA 3MWDA 3H15A 1XNRL 4DL2A 4DR2H 4I7AA 2GN5A 3PUXA 1LTRD 1WFQA 4GOPA 5KFGA 1JX4A 4BY1G 2AUJD 2KVMA 3J7AV 2I5HA 3BYYB 3S1QB 2A1AA 1CS0A 1UNSA 4ECWA 2MGSA 2ZXRA 1HH2P 2BH2A 3S1MB 2K4KA 5ELNA 2FK3A 2FP4B 3ZJYC 2UU9Q 1RJQA 1EU4A 5E4XA 4B3TH 4QW8A 1TS5A 4LFBL 4DV5Q 4DR7L 1K1SA 5J22A 3I4NG 3VR5A 4DV3L 3RR5A 3J81W 1YNNC 3HOUG 1I50B 5EKIA 4GOPB 4OX9L 1HNXL 2B2WC 3QZ7A 4FM9A 2B2YA 3RGXA 2DPJA 4DR5Q 1FJGH 5JJKA 4KN4C 2W70A 2B2VC 3HS0C 1SMYD 4CHTB 1P8LA 5IY0A 1B1ZA 2E75C 4FF3A 1JOKA 4O3OA 4KY7A 1B9MA 4J1MA 4UP9A 3K59A 3EJIA 4XTCS 1N32Q 2ES2A 2BR0A 3N6RA 4A3GG 1GUWA 3L3OC 1HZBA 2V4RA 1KJQA 4K5WA 5LMNH 5JH7F 2M9VA 2DLNA 2A69D 2RBMA 2R7ZA 2NWGA 4C3IH 1FYCA 3HOVB 5KFFA 4JI6Q 5IOCA 2LXKA 2G5DA 3WO0A 3U58A 5EJWA 1KRSA 2MQHA 4UCTA 1FR3A 1X56A 3QG1A 4C3JG 1S68A 4JV0A 5FLXL 1N34L 4LF9H 1AEXA 1MBYA 2K52A 4B08A 4F50A 2K5DA 1TXYA 4EFEA 2V4DA 1SROA 3CAMA 2UVUA 1SXTA 3Q8QB 2JYOA 2EYMA 3T1HH 5EBDA 2C35B 4FO2A 1ILPA 4DR1H 3LP8A 4LSAA 1JDEA 1S5BD 2DY8A 3I55A 3E3XA 1UE5A 4PZ8A 1JB3A 5C5MA 3N42B 2CCZA 4DFAA 1PH8A 3HEJA 4DK3C 2ZJPA 1L2ZA 5KFWA 5LP6F 2QEXA 4RAYA 1R4PB 5CGKA 1PFMA 3KF8A 4N9TA 1VQ8A 4C2MA 1FJGL 2R92H 4LF6Q 2WTFA 5IT9E 1HR0W 1B44D 2K05A 3RZOH 5DG9A 1SMYC 4C5AA 2G9HD 5KKNB 4DV4L 4QWDA 2OH2A 2VNUD 3KBXA 4DV1H 1IOWA 3MVVA 4DL7A 2MPMA 2EDGA 2KQ3A 1JICA 3ETJA 5LMNL 4DV6L 3G71A 4IURA 1YHAA 2DJFC 4YWLA 3N44B 1IBKH 1OXSC 3PZPA 4GN5A 5IP7H 1DD2A 3KYHC 1M1KC 3KF8B 4YHHQ 5JEAJ 3TS2A 3FMCA 2A69C 4IRCA 4C2MB 4X64L 2IJ0A 4KTAA 5EPKA 4GOPC 4CC5A 1KAWA 4B3SQ 1SDFA 4J6HA 4ZLTF 5IYCG 4LWCA 4K8IA 2F03A 4TQRA 2B8GA 4IR1A 1U9RA 2R6GA 4UP8A 1PDQA 3NP8A 1Y1WA 3KOJA 4R8NA 5C44G 4LF9L 4A76A 5JPNC 1GUNA 4JI4H 2ZJQA 5J39A 1LM0A 4L8JA 4TRDA 4DV7Q 2ZM6H 2QF7A 2F0IA 4MN3A 3S16H 3DHQA 2AHOB 3OTOL 5C0XH 3GTQH 1X3EA 3K80C 2B2YC 3N40P 1I94Q 1Y1WB 2PYKA 1VQLA 5KFEA 2HIXA 5KFZA 1UE6A 3VDYA 2X69A 3OSNA 3K5NA 1WD1A 2ZJTA 1EOTA 1Q8KA 4NXNL 2N88A 1IKLA 1Y69U 4APVA 1CQFA 1GUOA 3S9WA 2C2DA 1E0BA 1NR4A 1A3TA 1QG7A 3K5LA 1PRTF 1EFWA 4DL3A 4IPHA 5K5PA 5KYLA 3F2UA 1P16A 3UDGA 1IBKL 4DUZQ 2RDHA 1AN8A 4A3MB 4C1NI 1I50H 3E5SA 5KFBA 4ED0A 2IT1A 2L4NA 1YNJC 1F2ZA 1LUZA 4GZYC 5IGCA 4CJ2C 1AE2A 1JLLB 1Z2NX 3J81j 2IX3A 2K50A 4BA1I 4A3BB 4RKLA 1VBGA 4HN7A 1IYUA 2CVRA 2Q8TA 1N48A 4POFA 4CKEA 3JSNA 2W9BA 1PZKD 4MTKA 1B3QA 2ZM6L 2I80A 1XNQQ 2C28A 2VL6A 1I4HA 4A3JG 2FMAA 2VXWA 4DF7A 4JI7H 1GSHA 4A93B 1J5EH 3PIOA 1PRTD 2QYZA 3KTMA 1N33Q 4DUYH 5ELDA 3V6JA 4UCOA 4IUPA 1UC9A 4JBJA 3MHBA 4QWAA 4IFDH 1VCIA 4ABNA 1SFOA 1H9SB 2F0EA 2R8GA 2WB1G 3T16A 2W9BB 2NYZD 3C1EA 1JCKB 1BBUA 1VQBA 2EVBA 4KY6A 4RHSA 1TWGA 4A3CH 4AQYH 4A3IB 3D6CA 4J9MA 2VW9A 4YAJB 3L0OA 1JIHA 3CP0A 2NN6H 3NSWA 1EY0A 1UEBA 2F0QA 1Q8IA 2KCMA 3LNNA 3F2DA 4MHEA 1SFOB 4IUVA 2Q2IA 1Z2PX 4RAZA 4DAMA 4DV0L 4QUCA 1AP0A 1KDAA 5AJ3L 1HXYD 4TVAB 1K0SA 2V1CC 3CCUA 1JKJB 5C4JH 1TWGB 2FK1A 4HSPA 4EG0A 1E4FT 5BMVF 4H13C 4KKUA 1XMQQ 5J1ZA 5KT4A 3PUWA 1ICWA 4OL7A 1E1OA 1H9RA 4NDXA 3SVMA 3RB4A 2VPQA 5C1PA 2EYOA 5JJZA 2QW7A 5A2QE 2K5QA 3T4AC 3V2TA 4DLKA 3DM3A 1J5EL 3RZDB 1YJ9A 1M4VA 3JAMc 4P72A 5BR8Q 1SRUA 2BQUA 5C3EG 1T36A 4BBSB 1B3AA 2KCNA 4DUYL 4ALPA 1B6RA 4EGJA 5L37A 4LUZA 1ULZA 4I50F 3K6OA 1QILA 3QIAA 2JEJA 4JI5Q 5KT5A 3VR3A 4AQYL 4EYIB 4IQZA 5JEAG 4AIMA 3OW7A 4CDEC 1VQ9A 1JDBB 3GQBA 1JC7A 4O3SA 2E2JB 1HR0H 2KOLA 3SK6A 4A3KH 4H44C 4XYOA 2VUMH 1S97A 1TWFA 3KLWA 3CCSA 1EY7A 4IWYA 2HCCA 3PO2B 5IP9H 1UWVA 2D0PA 3TP5A 1F9QA 3U9TA 2P5ZX 2A68D 4IR9A 3ND9A 5HBRB 2KJXA 1D1KA 4BA2I 2E2HA 2ID0A 5KFUA 3JAME 4AYBA 5BPFA 4GKJH 3ULPA 3D0FA 1TS4A 1AE3A 2M05A 1TWFB 4A3DH 5C4XG 3FPUB 5IODA 4WRDA 4DNIA 2EY2A 4LFAH 2YZMA 4EGVA 3HOXH 3MR3A 4FF2A 5IT9W 1F9PA 1S0NA 2D2CC 4QB4A 3GTPA 4K5XA 1ESFA 4XDXA 2IWHA 4Y7NH 4JV5Q 4AYBB 4A3LH 5F2DA 4FU0A 3AQQA 2W6ZA 2XGTA 4EBCA 2OEOA 4J9SA 5EDWA 3G48A 5CORA 4OO1G 1D1IA 3GTGH 1C48A 3L7ZC 5FK9C 2JA6A 5IYBG 5DQIA 1HR0L 4A93H 3GV7B 1K8MA 2IMWP 4IFDG 4DGZA 1PH5A 4YR0A 3PO3B 2R61A 4KHVA 4UAIA 4YCVA 2XC9A 5KRUA 4LMYA 3HP3A 1AZQA 4K0KQ 2ATLA 5LMUL 1SE2A 2K04A 2UXBQ 4RUCA 5L1JA 4FBUA 5FO7B 3QR8A 4X3KA 3I4NB 3WOFA 4E4TA 2F0VA 4PMCA 1Q81C 2F0HA 3I72A 2R7LA 4A3IH 3VMMA 4QCLA 1VDZA 2QILA 3GTLH 1EWCA 3J81c 2FMCA 2HCIA 1TVXA 1VQOA 2A68C 4RB3C 4GKJL 3Q6SA 5FD6A 2JA7G 2A73B 1NE3A 3A55A 2YV5A 2NVYH 3D6WA 2C2EA 2RVLA 1XDNA 2YU9H 1ZHQA 4FXDA 5KG0A 4XQQA 4A2BA 3E0EA 1PH1A 1PH4A 4LFAL 3EPIA 5JJIA 4EQNA 1YNXA 3PW7A 2KHSA 2PQEA 3GTJH 2R93H 5C1OA 1CK1A 4X66Q 3ITPA 1SYEA 4LNQA 4HSVA 3ICEA 5LHY1 2O4XA 1ZETA 5KG5A 5E4WC 3UE0A 2NU9B 2R7DA 2EOTA 2H5XA 2K01A 3BA9A 3H40A 1HA6A 1SMXA 3RMHA 1WCMA 1ZYRD 1XX8A 4K6LA 3N41B 1V9PA 3KLSA 1L0XB 2KSWA 3NXWA 1RYSA 1A9XA 4JI3Q 2ASLA 4CKBA 2UUCQ 3RLOA 5D8DA 2R3ZA 3KBGA 1PVOA 2F3WA 2FMMA 3ZYYX 2ICIA 4A3FG 4RNNA 1BR9A 4JI6H 2EZVA 1JB7A 2NVTB 1I6HB 1QCBD 4XYMB 4A3KG 4GC7A 2CWPA 4JI0Q 4UCVA 4IJHA 1EYZA 1JWMD 4BBRG 5D3IB 5CYUA 3SE0A 2E2JH 1HNWQ 1A8VA 3SEBA 5M5YB 3J80E 2FPPB 1D5ZC 2AQ1B 3RF2A 5DLQE 2JA9A 5IGFA 2DPIA 1EIFA 1FNUA 1EY9A 4IJLA 1ILQA 2NVQH 1UC8A 1W93A 5BN4A 1C0AA 1QNKA 4F8MA 4ZI7F 1IL2A 3IAYA 2YYAA 2ZTDA 1RJRA 4LH7A 1S3OA 1JE5A 2PZWA 3NEMA 2F52A 2LXJA 3TP6A 5C6AA 2O5IC 4CC6A 4LF6H 2VUGA 1ICFB 4C3HB 2W6OA 5LA6F 1OXVA 4WBNF 3PW5A 3TQ1A 3S1RB 4DR3L 5F9NA 1X3QA 2QGQA 3MFYA 4LF8L 1GVPA 3IL8A 1TIID 4WORA 4UHVA 1HZ9A 2UXCL 2GVBA 3BAAA 5KT2A 5DQHA 3GIMA 3HOYH 4ECRA 1MKHA 1FGBD 2E5LQ 1PLFA 2JE6I 4HTHA 3CVZA 1PZJD 4YHHH 4JI6L 2PNRC 3VPCA 1B70B 5I9OA 3OWEB 1STEA 1HZAA 2RQXA 4BY7H 3BDCA 3URYA 3DEPA 4O42A 4KV6A 4RH6A 4LSXA 2TMPA 5DEHA 1EY8A 4BY1H 2R8KA 2IA6A 1S5FD 3I8ZA 4ILWA 2RSOA 4ZKCB 4HYKA 3I2ZA 1K8AC 3PCOB 4CDCC 1SCUB 3MJFA 1U4PA 4PG3A 4LW1A 3MXNA 1EFID 4PMWA 5IGEA 1Q86C 3RUZA 1EWHA 5M3MG 1UAPA 4FP5D 4ED3A 3HOUH 1HRJA 1WTVA 5ELEA 1XTDA 3ERSX 1AFPA 2VB3X 3KK7A 3RV4A 2RHQB 3HKZG 1A0IA 2I8CA 3H20A 5IYZF 4GKKH 4KHPQ 4NXMH 2UXDH 5FPRA 4EGQA 2V59A 2FINB 1KC7A 1EQTA 3MXNB 4GS3A 2AWNA 4C3IB 4A3GH 1KJJA 2WAQA 1C7YA 3L4KA 4RWSC 2J6SA 1V1PA 3HFZB 3K7UC 2DIKA 2WB1A 4RUAA 4IAJA 1DZ1A 4EBEA 1LTSD 2W8LA 2CKZB 2JXMB 2Y0SG 5EPLA 3SE7A 2AQ2B 1KTKA 3JAMW 3IKJA 2LKVA 3UE1A 5L1LA 3BJUA 2F0WA 2KENA 4UCUA 4C3JH 2B39A 1TR5A 2MFIA 2R92A 2MO0A 1CQIB 3N6XA 2WAQB 1EQVA 1L0WA 1V1PB 2WB1B 1D6EC 1EYCA 3CCVA 4LFCQ 1S5CD 2XN9C 3W2DA 1O7ZA 4EYHB 2YTXA 1C30A 1RKNA 2UUAQ 5KGUA 3PIPA 3C3LA 2N49A 4LAAA 1PHJA 2FFKB 4KN7C 3T13A 1Q12A 4R7RA 3J81i 5EWFA 5KX5F 2AQ4A 4K8JA 3RD4A 4PNYA 3Q8SB 2R92B 1BJTA 1J9OA 3KAJA 4ED7A 3U9OA 3PVXA 4ED6A 4BXXG 5CV5A 5KFMA 3RZOB 4DK1A 1ENCA 1BOSA 5EBCA 5I4DA 3LWUA 5IGBA 3EPGA 3BU2A 1N33H 3TQYA 3HKZE 4QWCA 4Q45A 1NR2A 1BGWA 4GKKL 1A62A 5M5YH 4NXML 2UXDL 4N8FA 3PW2A 1TS3A 1ASZA 4RZQA 4FS1A 5KG7A 1Y1VG 3OHXC 1PV4A 3NENA 3WO1A 3GTQA 2OF1A 3GQCA 4OWWB 4IZ8A 4IUQA 2EXZA 1K28A 2Y0SE 4O2BF 3PGZA 5C8YF 1K0RA 4GLAC 3LMLA 4G3IA 3UFXB 1GJXA 5C3EB 1XMOH 4NKLA 5IYCH 1N36L 1FNVA 1SYGA 2PZUA 2E76C 4MA0A 2R8IA 3QOJA 4DV2H 4UCRA 1BKBA 4K5VA 4B3RQ 5C44H 3PW4A 4YJ3F 2A8VA 4O2AF 3G6VA 1JT8A 3H91A 4O4IF 3JZIA 3S16B 4A75A 3IFTA 4ECYA 3GTQB 4X65Q 5C5LA 1SAPA 3MZ5A 3X3MA 4YCWA 4JV1A 1GUGA 3VR4A 3HRZC 1WTWA 3KALA 2JA5G 2AGOA 2EY5A 2PMZB 4LF7H 4BY7G 4J9QA 2ZT9C 1EQQA 3STBC 2F0UA 2EXDA 2VQFQ 1I50A 2UUBH 1I7LA 4FF1A 2A6HC 1WTRA 1HUNA 5BR8H 3V6KA 2XRSD 2O03A 4QY7A 1QVCA 2F0JA 2F0GA 2Z1CA 3L2PA 4ECSA 1O7IA 2R84A 4R4OA 4DXGA 5EQ0A 4UCSA 2XGQA 3SDZA 3NE5B 1VQ5A 2AUKA 4L5SA 3IRBA 3J7AK 1DXMA 3AFPA 2VA2A 3OSOA 4JW0A 4JI5H 4ECVA 4YWMA 1F2MA 4NW2A 2RDJA 4YAKB 4RA8A 4DAYA 5CV6A 5C4XB 2EY1A 1CFMA 1Z2OX 4Z9CB 3PF4A 1Q1BA 2R7MA 3OUUA 5C4ZA 3C1FA 4QGUA 3Q2OA 1KBLA 4A3EG 1XMOL 3UI2A 2R87A 5T1GA 2ASJA 3CC4A 4UPAA 4JUZA 1QNUA 2AU0A 3J80W 5IT9c 4DV2L 3BZCA 4O3PA 2D62A 4LF4L 3TS0A 4R1JA 1PX2A 3BJYA 5BN5A 4DAYB 2ZXPA 2JEBI 1VQAA 2RCNA 5GROA 4YCUA 3A7LA 2VOBA 4A3JH 4LF7L 1A3VA 1VQIA 3SR1A 4DR2L 1UNNC 5KFTA 2UUBL 1MGSA 3T5LA 2PW7A 2RHSB 2AKWB 3E6ZX 3GIKA 4OIJA 2DJGC 3IG0A 5J2TF 4ZUIA 3WNZA 3I4LA 2F4VQ 4ZQIA 1HNZQ 1SYCA 2L11A 3VPDA 2YRXA 4B3TL 3P7JA 4JV5H 5L1IA 2W8KA 4OGQC 3RB0A 3T56B 4RAUC 1Z47A 1S40A 1CHPD 1MZBA 1IOVA 4ZK9B 1EEID 2PZTA 5C4JB 3NBHA 4R4QA 3TINA 3QWNA 4IUNA 2KEEA 1AUVA 5JUMA 4RFBA 1U4RA 2KBNA 5EZYF 1D2BA 2HVRA 1LABA 1VQPA 5LL6S 4UFZA 3I4OA 1VQHA 1DJRD 1I3QH 2L1BA 3SK4A 5IWAQ 1VQGA 1OXUA 4KI0A 4DNTB 3MXGA 1VF5C 3VA5A 4IWXA 3NBHB 2B63G 5C5JA 2XTIA 2BOSA 2DN8A 4J9PA 1IBMQ 1CQJB 1CKNA 2OLSA 4HR7A 4DK6C 1S5DD 1B9NA 1LYLA 4DR6H 2PW5A 3MFHA 2Q2UA 2J4XA 1PH7A 5KFXA 2CH4W 4FBTA 2VQEH 2VUMA 4JG2A 3ULJA 5C3EH 4JBWA 1AZPA 3CF5A 2YCHA 2MNAA 4I55F 4HAEA 1JJCB 5GONF 4X66H 3LWEA 3T1HL 1CTMA 1B2TA 4O3NA 4DR1L 1OXXK 3TIGA 4ECZA 3N8DA 3NTKA 4JV5L 2SNMA 1CKNB 4HR7B 2JQOA 5JEAH 2WINB 1RIPA 4A3KB 1N9WA 1IBLQ 3X3NA 3GIDA 3BDLA 4BBRB 1YJWA 4HJ5A 3U50C 2VUMB 2AGQA 4OHJA 2BE5D 2N55A 3ER0A 1DOKA 3R93A 1PYWD 5AFWA 1FKAH 1R9TB 4TQUS 4RGNA 4J0MA 2Q8IB 1B8AA 3JRXA 3VPBA 4JI3H 4DV1L 2UUCH 4EQPA 4Q5VA 3HKSA 1RJPA 1WH2A 5M9OA 2WDTA 2HJWA 4B9XA 3T5KA 1G2TA 4O1NA 1F9RA 4YY3H 3C46A 1DYQA 1B50A 1XTCD 1RL2A 4A3DB 4OXPA 4L6TB 4OWXB 4KK7A 3SHLA 4ID6A 1M0WA 3GTGA 1T94A 3HOXB 1PRTB 5C4XH 1QZGA 4DR6L 1HNWH 4I65A 2YW2A 2F3IA 2IX1A 1ET9A 2D0OA 1RF2D 2VQEL 3R2TA 4Y7NB 4QW9A 3P20A 4UP7A 4JI1Q 3QB3A 4JI4L 2WKDA 2UVRA 1BVSA 1H9SA 4J9KA 1Y8PB 2JK8A 4X66L 1KJ8A 1WOCA 2XNAC 1YJNA 3CKIB 1EHIA 5KFDA 1HHVA 1TWHH 5IE8A 2LMCB 3A5ZB 3GTGB 4APMA 3Q8PB 3GTLA 5D1OA 2WYOA 2JA8H 3I91A 2F0TA 5EAYA 4OO1H 4XYLB 1ENAA 5KFVA 3K3VA 3HOZG 1SR3A 5IYBH 2EYHA 1RK6A 2NVYA 1S5ED 2YU9A 2VQDA 5J3BA 4XIGS 5KG3A 1Y14B 2BE5C 1BQQT 5LOVF 3GTJA 2R93A 4H7BA 4G4KA 3DWPA 4IUTA 3PUYA 2UUCL 3AB9A 3BVMA 1XNRQ 2PNHA 3CCEA 3GTLB 4WJ3M 5D1OB 3RB6A 1CQVA 5M3MB 1M8AA 2YYZA 2E5LH 2CFMA 3BZDB 4YY3L 2NVYB 4IRKA 5FLXE 3SGIA 2Z9HA 5JVG3 5G3LF 3CCLA 2C9OA 2YU9B 1GKHA 5DG8A 4K2LA 2JA7H 1ENFA 2F0SA 4CJ1B 1HJPA 3E0JA 2VY3A 3GTJB 2R93B 4LFBQ 1VQNA 4DR7Q 3CPWA 5CV9A 1TA8A 1X3GA 4DR4Q 4DV3Q 1KNEA 1RTNA 2HQEA 1VAJA 1RYRA 4OX9Q 1HNXQ 5EWEA 4JI2H 3FKIG 1KNAA 3MAQA 1D5XC 4O0AA 2HUGA 5E7NA 4HJ9A 1G6PA 2N3SA 4PWQA 5GAEC 1VQKA 4JI7L 4IO9A 4N9PA 3RJ0A 4LUOA 3W1GA 2E2IH 2RA4A 3DM1A 2J7ZA 1JR0D 1PRTC 1SNDA 3TREA 4DK0A 2YS6A 2B29A 1S03G 3S1NB 1CUKA 1S72A 3QO2A 5G3LD 3DWAA 5KNBA 3S2HB 2FJ2A 4YWKA 3K58A 3J81L 1CI3M 4BWSC 4MV1A 1V8QA 1KAAA 5C3XA 3V05A 1KRTA 4A3FH 1HTLD 4MIUA 5BN3A 3D4WA 3R8BA 4RKBA 1N34Q 1X55A 2E5LL 1Y1VA 4C5CA 3RBDA 1LV9A 4YP3A 5JVH3 3K7AH 5KT6A 1Z9FA 4BBRH 3HXLA 2FB9A 3S17H 1JE4A 4FS2A 4H0LC 3RLFA 3PW0A 2W57A 2NVQB 4KLKA 1R9TH 2IL8A 1BXRA 4LFCH 5L9XA 2I5MX 2HQLA 3O13A 2AQ3B 1ZQ7A 5FLMH 1F2YA 1Y1VB 4C56C 4JI2L 5BPHA 5KG2A 4HJAA 5E1FA 1H9JA 1I5FA 2O2LD 1FJGQ 5HURA 2HT1A 1VF7A 4S3SA 3Q23A 5DLFA 4HJ8A 3D4RA 3K57A 1GSAA 1WTHA 4DV4Q 3H6MA 3M3YH 3BG5A 1BBXC 1AW7A 1SE4A 3EVQA 2RKSA 4H02A 3NHHA 5LMNQ 4DV6Q 4YBZB 2W6NA 1H9KA 1QVFA 3PIP3 3HOYB 1ONLA 3KUPA 2ALYB 1CKMA 4X64Q 2ASDA 3U4ZA 4CGYB 1UEAB 2EQSA 4MV8A 1CE8A 1EZ8A 1V51A 3KJOA 1EY4A 3H3VH 4BY7B 2JA8G 4WFN3 1E4GT 2OTJA 4JYAH 2RGRA 2EJMA 2SNSA 4QWBA 4ZUJA 4LF9Q 4RNOA 4BY1B 2FHTA 1WR2A 1EWIA 4IUUA 1S10A 5KFJA 1BBWA 1M7JA 1GSOA 3CXCA 1TT2A 4RB0A 1NNXA 1WTQA 2GLTA 1RDPD 1JMCA 1HUMA 5KFHA 1SLJA 2R8JA 3OTOQ 1GM5A 4ED1A 3HOVG 4HCSA 2DNCA 2X6GA 1K1QA 2HGSA 4G7OC 1TKWB 3HOUB 4IPGA 4YR3A 1SYXB 4UY8C 4KJOA 4PQXA 1GUSA 5M3MH 1R4QB 4UDUC 1GGOA 4NXNQ 3HB9A 3GV8B 2VQFH 2MHVA 2V5AA 1SYBA 3GV3A 5EWGA 2SDFA 5CV7A 5KFSA 2JP1A 1CKOA 2R7ZG 4X3UA 2K1BA 3S15B 3D3RA 3MEHA 4A3GB 2YL2A 1SYFA 2QDLA 2FK2A 2NU8B 1B04A 1IBKQ 2UU9H 1QOHA 4EX5A 2IP4A 1E2VA 1K3BC 3J80c 1PH6A 2OT2A 3H4DA 4N8X1 4DV5H 1E22A 4JOIA 5KFIA 4I7ZC 4EQOA 3M7NA 3JRWA 4RGTA 2W7PA 3QJYA 4FDBA 1I7NA 1QE6A 4JYAL 1NMGA 1X3PA 4DR5H 4C3JB 3D8GA 4RHRA 4ZCKA 4U673 1TWCB 3TIIA 5HY6A 4TSSA 3UDXA 4LF5Q 1Q3LA 1TWAH 4KKSA 1J8IA 3P75A 1JORA 5J2UF 1BDOA 4O3QA 1N32H 2ZM6Q 3GTKH 2MJ8A 2N8NA 5C0XI 3NUCA 1K9MC 4IALA 3S1NH 1VQ7A 4ODGA 3TBIB 1A6XA 3F8TA 4WJ4A 2XIWA 3S2HH 1HCZA 1I6VC 3GP7A 2LY7A 3TSSA 5IGDA 2YRWA 4GLXA 1DV1A 2EYJA 4J9NA 4ZHQF 1A2TA 4R8UA 1BCPF 4KKTA 1F9SA 1I4QA 1XXGA 5F9LA 2GPSA 4XXEA 4BXXH 1XYIA 2KCCA 2DUDA 1UE7A 2HD3A 5IIFA 5D1PA 1E2ZA 1NCVA 3S14H 3A74A 3FEWX 1B6SA 2K5VA 3NQTA 4P74A 3BQ2A 5FLMG 1TQOA 1HNZH 3DUZA 2UU9L 1B7YB 4U68A 4DV5L 3R3OA 1SE3A 4ZQ3A 4R8UB 4A2AA 5KFOA 5JQWA 4DV0Q 5I9PA 1Y1VH 4HCEA 5AJ3Q 1Y1WG 1STYA 5KFRA 2R7NA 2JN4A 3MA2B 3M4QA 1HQMC 3GTOH 3GIIA 2LS01 3JAMi 4FYDA 4EVOA 4CJ0B 4DR5L 3RNUA 3K3PA 4GC6A 4CDDC 1STHA 1MSGA 2K33A 4L63B 5C44B 1BUVT 3I70A 3PF5A 3T5JA 1CHQD 4WD3A 4L5TA 4KD3A 3KFUA 1ZYRC 3RLNA 3CQZH 1N32L 1BCPD 3BVZA 2JSOA 2PN1A 2EIFA 5C4HA 3PUZA 1IYVA 1HQRD 4ZYSA 4EQ5A 5IWAH 1J5EQ 2CW7A 1OXTA 4A3MG 2A19A 1QUQA 5KFAA 1IZ6A 2GVAA 5K36G 2JA5H 3WWVA 4DUYQ 3CCMA 4JI8Q 5A2QW 4L5QA 4B3SH 1HPCA 2F0LA 1LACA 1DOLA 1H9MA 3K5IA 5EKKA 4YIJA 1JWSD 4AQYQ 1C8CA 2NN6I 3EQLC 1A3UA 3CCQA 3BDOA 3GLKA 3M9MB 3KHHA 4MV7A 1CA6A 3BVGA 3RV3A 1G2SA 4JOIC 4DV7H 4EEYA 1QUQB 2F1MA 1X3FA 4FXGC 3FHWA 3VA7A 2XRQD 3N52A 1I6UA 1TAEA 3KHGA 2ATWA 3R2IA 1I94H 1IBLH 1IW7D 1KQSA 3C0FB 2ICEC 4F88A 1MSHA 4R4TA 1X32A 3F2CA 2I5LX 4LF6L 1S4ZA 5M5XH 2BA1A 1C9OA 4PZ6A 4A4IA 1EYAA 4A3EH 1KEEA 1I4PA 3CRLC 2SEBD 2Z6BA 4X62Q 3S15H 1LT3D 2D5DA 3F2BA 1PTOF 4M9UA 3EYYA 2EE1A 4QIWA 1U4MA 5ELCA 5CB4F 1FL0A 1HZCA 2WE6A 1EUCB 5JVLA 4JBKA 4A3JB 2B8FA 4GN4B 3T1YQ 4K2KA 1WTXA 2UVWA 3SK8A 4DUZH 3BQ0A 4YHHL 1LTTD 2HHHQ 1DGSA 3TRZA 4HIDA 3NWSA 3K81C 5EGTA 3I4MG 2BH8A 5D65A 1G51A 4B3SL 3DF7A 3RBEA 1TWCH 1EEFD 4P71A 1NMFA 1MJEA 1W2BA 4PDBA 4HNTA 1PMRA 4QIWB 2Z6KA 4QUFA 3Q1KA 2AWOA 3M4YA 3GTMH 2WIIB 2R7KA 1CA5A 1EYGA 1EY6A 4POGA 2BDOA 4DV7L 2KHIA 4MV6A 1I3QA 3MTSA 3PMFA 1HR0Q 1XNQH 3V4ZA 3MC0B 4HEDA 5LL6b 1GHJA 2XCLA 3AYHB 2YTVA 4FNFA 1B53A 1PTOD 1I94L 3IN5A 3DEOA 1IKMA 1WI5A 4MZ9A 5LMUQ 3M4PA 5IT9L 1KL9A 2A6ED 1FNWA 3ORRA 5KEEA 2V9WA 2PCFB 4K6DA 1PXUA 3OMCA 3KLSX 3KXYT 3J80i 1I3QB 3CRKC 2NZHA 1GHKA 4JBMA 2C5CA 3K0XA 1XNRH 2MCTA 4IOCA 4HNUA 3NBIA 2JEAI 5I2XA 4MTNA 3H0GG 3P1HA 1Q90A 3QFFA 1E7ZA 4LK1C 4LFAQ 2NU7B 4DUZL 2NB0A 5HGTA 2B63H 4NP5A 3Q8RB 3U4VA 2PMZA 5A35A 3G6YA 2OXPA 4I4TF 1FGUA 1RTOA 2F0DA 5ISRA 4LFBH 1O75A 1YNND 1ASYA 1LLRD 2K5NA 4JVZA 4DR7H 1A15A 1CZGA 4DR4H 1N56A 4DV3H 1XMQH 4ZOLF 3HZXA 5DGBA 4DAPA 3OMGA 4TKOB 2IY5B 1WYDA 3OHBA 4DAVA 2EYLA 3G6JB 3M85A 1KD1C 3HBLA 1ZKOA 5M5WH 1XPOA 1XNQL 3N43B 1TS2A 2RSNA 3S24A 5H1SE 1X6OA 3HOWH 4L1KA 4KD4A 2W7OA 1N33L 4X3SA 5JOBA 5GAGC 1KLGD 3S2DH 5LXTF 1CM9A 4F4ZA 5E3FA 4MV9A 3ONAB 1V1QA 3RN5A 4QJFA 1KC8C 5KG1A 5H80A 4IPDA 5LL6X 1Q1EA 3NGDA 1L2FA 2F0PA 4K14A 1L0YB 5COYA 4CKCA 1TWHA 3MWEA 4IRDA 1WTPA 1BXTA 2IBKA 1GD7A 1N34H 1HFNA 3U9SA 2L15A 1SJED 2DGYA 2W6MA 2YZNA 1NJIC 3RGZA 3V4SA 3PO3G 3Q8DA 4LUVA 1S9FA 4XZ3B 1LT6D 4WJWA 1EIYB 2Z6KC 3KF6A 5C3WA 3TZDA 3G8CA 4DXFA 4DN4M 1PA6A 1O7YA 3D31A 4KHZA 4DR4L 2XIGA 1XMQL 2O5JC 2V4QA 4BWGB 1TWHB 1YHBA 2JA6G 3NQIA 4F4WA 4YB8B 3KLRA 3K5OA 1YI2A 3H94A 1VKZA 3MWYW 2JA8B 1OWTA 4G7ZC 4DNRB 3D4DA 5KNDA 2OTLA 1RHPA 2DWCA 2L55A 3KF6B 4DR3Q 4J9RA 4DV4H 2JA7A 4LF8Q 1KDBA 1V4YA 2XCPA 3HOZH 2L9HA 5DAUA 2UXCQ 3CMEA 5BR8L 3T5HA 1O78A 1PTOH 5DM73 1KIXA 1U0LA 2VZAA 5IYDG 3I73A 2ASBA 4DV6H 1HFGA 3EROA 2ZXOA 2R86A 3HGBA 5M3FH 1N8RC 4Q0FA 1Q46A 4RGMA 4AYBE 4X64H 4B3MQ 4JI5L 1SNQA 2PQAA 4JCVE 2NZOA 1FVIA 1V43A 2JA7B 3LGJA 1F77A 2XWJB 2NVXH 4RCOA 5CA1F 2PPBC 2R7ZB 1GYFA 2E8GA 2FXQA 2E2IA 5I6WA 4ULLA 3Q0AA 1B33N 2EYPA 4J8QA 4K0KH 1RJTA 2FLPA 2W71A 3OTOH 4FXKC 2UXBH 2PQAB 2IW3A 2CQAA 4OWTB 4HQ6A 2ZJRA 2FLNA 3FKIH 2ENBA 2BCOA 4HMIA 1WCMG 2AMCB 1S0MA 2ZDQA 3I12A 5T1IA 5A2QL 1DCZA 4NXNH 1DIKA 2E2IB 2BQ3A 2X0SA 2RDIA 1RK5A 3MXUA 2E2DC 1EZ1A 4Q44A 2R7FA 1GO3E 4P2CB 5EKLA 3RB3A 2I0QA 3J7YW 2HVSA 4E6IA 2B3GA 4OEMB 1R9TA 2WKCA 4QF4A 2HVQA 2R6FA 1E1TA 5C0XJ 1II3A 4JK1C 4M1UB 4QL5A 4A3FB 2WP8J 1SEIA 1M90C 2DZDA 1YNJD 1K8OA 1JJGA 1PFSA 3I90A 3K7AB 3UQ8A 4GLVB 3HOWG 1PH9A 2L0CA 1TY2A 3HG9A 3R5XA 2BDNA 3S17B 2CH4A 4C3HG 4IPCA 5D14A 2C22A 1JOQA 1DV2A 4LF5H 4XT3B 2XSCA 1HA5A 1ML0D 1MHWC 3QZ8A 4CDFC 1M6VA 4MTEA 4K0KL 1AN7A 4MAMA 1MD2D 5JAVA 1D7QA 5CBAE 2UXBL 3VR6A 2FPIB 3R5HA 1K83A 3PQIA 5FOBB 2SCUB 5I47A 3NTIA 3M4OH 4RB2C 1LTBD 1PFNA 3JAML 1AH9A 2SOBA 3GO5A 5JPMC 5EPJA 3M3YB 1NAPA 4JI0H 3RAQA 4GKKQ 2XVSA 2RGVA 1NY4A 3BG3A 1Y8NB 3MFGA 2F0KA 4NXMQ 2UXDQ 3S1QH 5KFPA 1G91A 5FLXc 1W6KA 5CMDA 3S1MH 4XX0B 1G6ZA 3UDFA 3CPFA 5FO8B 1K83B 2CQYA 4O4LF 2PI2A 2PVPA 1EQRA
chains in the Genus database with same CATH topology
3KJOA 3H3VH 2UU9Q 2JA8G 4AH6A 3W1BA 2OTJA 4BY1H 2K75A 4LFBL 3CW2C 4DV5Q 4LF9Q 4DR7L 4HIKA 2MO1A 3I4NG 1IYJB 1EWIA 4DV3L 3RR5A 1BBWA 1N36Q 1VQDA 3BZKA 3HOUG 3CXCA 3I2ZA 4GOPB 1K8AC 3PCOB 3CMAA 4OX9L 1HNXL 1MJCA 4PG3A 5GAHC 4DR5Q 4LW1A 1JMCA 4IFDJ 4PMWA 1UE1A 1SLJA 4NPSA 1Q86C 5JJKA 3OTOQ 5M3MG 1GM5A 1P8LA 5IY0A 3HOVG 3HOUH 1LTLA 1XTDA 2OQKA 3ERSX 4LF5L 4UP9A 5M3FG 4XTCS 4IPGA 1N32Q 2RHQB 2ES2A 3HKZG 4R4IA 4UY8C 4A3GG 1QZHA 4JI3L 1A0IA 1HZBA 1NTGA 5M3MH 3HOVH 4NXNQ 4KHPQ 4C3IH 4JI6Q 3MXNB 4GS3A 2AWNA 2LXKA 4A3GH 1C7YA 1CKOA 1E24A 2R7ZG 3HFZB 3K7UC 3U58A 1KRSA 2MQHA 3GDEA 4JI0L 4MNOA 1X56A 2WAQG 1IBKQ 4EX5A 1L1OA 3J80c 1HNWL 1PH6A 1EOVA 1N34L 2CKZB 2Y0SG 1E22A 4JOIA 2R7ZH 2K52A 2WFWA 1TXYA 3UE1A 3M7NA 1SROA 3BJUA 3CAMA 3AFQA 2KENA 1IXRA 4C3JH 2MFIA 4FDBA 2MO0A 2C35B 4JYAL 1NMGA 1MIUA 1L0WA 1XJVA 3I55A 3CCVA 1UE5A 4OONA 4PZ8A 2R92G 5HY6A 4LFCQ 2CCZA 3UDXA 1W3SA 1VQMA 1PH8A 4LF5Q 4DK3C 2ZJPA 1XMOQ 1L1OB 1TWAH 2YTXA 2UUAQ 3PIPA 2N49A 2QEXA 2ZM6Q 1PHJA 3GTKH 3PSIA 2N8NA 5C0XI 4DV2Q 1VQ8A 4LF4Q 1Q12A 1K9MC 3J81i 1FJGL 1VQ7A 4LF6Q 1K3RA 1SN8A 3G4SA 3OW2A 1HR0W 2R92H 3F8TA 3DLLA 5GADC 3RZOH 3S2HH 4WJ4A 4BXXG 5IP7G 4DV4L 4GLXA 2VNUD 1PYBA 3BU2A 3TQYA 3HKZE 4LF7Q 5LMNL 4DV6L 3G71A 4YWLA 1YHAA 1A62A 1D8LA 5M5YH 4DR2Q 4NXML 1OXSC 4GKKL 4BXXH 4GN5A 4C2MH 5IP7H 1K73C 3KYHC 1M1KC 2UUBQ 2UXDL 3KF8B 4YHHQ 5JEAJ 2DUDA 4RMFA 3TS2A 1UE7A 1ASZA 4X64L 3PV0A 3S14H 2OWOA 3EN2A 4DPGA 3A74A 4JC0A 4GOPC 2OCEA 2K5VA 1Y1VG 4P74A 1KAWA 4B3SQ 1PV4A 3NENA 4JI8L 5IYCG 4LWCA 5FLMG 1X9NA 2UU9L 2R6GA 4UP8A 2WAQE 4B3TQ 4OWWB 3JC66 3KOJA 1B7YB 2WB1E 5C44G 4DV5L 4QIWE 4LF9L 4A76A 2Y0SE 3PGZA 1K0RA 4GLAC 5C0XG 3GD7A 1Y1VH 4DV0Q 5IYCH 5AJ3Q 1Y1WG 1LM0A 1N36L 2ZJQA 3CC7A 3M4QA 4GN3B 4DV7Q 3GTOH 4QQBX 1YBYA 1BKBA 3JAMi 4DR5L 5C44H 3RNUA 1Q82C 2A8VA 3S16H 1G291 1YHQA 2AHOB 1JT8A 3OTOL 3GTQH 1X3EA 3K80C 3PF5A 4A75A 1Y1WH 4L5TA 1OTCA 4X65Q 1I94Q 3KFUA 4YCWA 1VQLA 2HIXA 3RLNA 3CQZH 1N32L 1UE6A 3VDYA 3S1NH 2JA5G 2EIFA 4BY7G 1EQQA 3PUZA 2Q2HA 4NXNL 1Q8KA 2EXDA 3STBC 2VQFQ 4EQ5A 4KHPL 1J5EQ 3G6EA 1OXTA 4A3MG 4DKAC 4APVA 2A19A 1QUQA 1K83H 1IZ6A 2GVAA 4X62L 5K36G 1EFWA 4QY7A 3WWVA 1QVCA 4DUYQ 4IPHA 2JA5H 3L2PA 2JJQA 1O7IA 3CCMA 4JI8Q 4L5QA 1P16A 4R4OA 3UDGA 1IBKL 4A3MH 1VQ5A 3T1YL 4DUZQ 3W5OA 4L5SA 3IRBA 2CWAA 3AFPA 1I50H 4AQYQ 2HHHL 2NN6I 1L1OC 2IT1A 3CCQA 4YWMA 3FP9A 5GQOA 3T1HQ 4JOIC 5JJLA 1QUQB 4HIMA 4DR1Q 1LUZA 1X3FA 1VQEA 4A3BH 2K14A 3FHWA 1AE2A 3ULLA 3J81j 3PUVA 3PF4A 2K50A 1Q1BA 4BA1I 1VQ4A 4LFCL 4QGUA 2ATWA 4A3EG 1XMOL 4POFA 2UUAL 1KQSA 3K8AA 4UPAA 3CC4A 2ZM6L 5IT9c 4R4TA 4DV2L 1PH3A 2PMZE 2VS1A 3BZCA 2D62A 2VL6A 5FJ8H 2I5LX 4R1JA 3F2CA 3TS0A 4A3JG 4LF4L 1X54A 5M5XH 4LF6L 2BA1A 1C9OA 4PZ6A 4A4IA 4A3EH 2IHEA 3PIOA 1U5KA 3KDFA 2JEBI 4DAYB 4X62Q 1VQAA 2RCNA 5GROA 1YIJA 3F2BA 4DV1Q 4YCUA 1N33Q 3CCRA 4A3CG 1XPUA 4A3JH 1FL0A 4JBJA 4LF7L 1HZCA 1VCIA 1VQIA 4JBKA 1YITA 4DR2L 2NN6G 2WB1G 4GN4B 3T1YQ 2UUBL 5ELOA 1BBUA 1VQBA 4YHHL 4A3CH 2HHHQ 1DGSA 3TRZA 2RHSB 4HIDA 2AKWB 3K81C 2VW9A 2QA4A 3L0OA 3I4MG 2BH8A 4DR6Q 3CP0A 1G51A 4B3SL 2F4VQ 1A63A 3KDFB 1HNZQ 1TWCH 4PZ7A 4P71A 1NMFA 1UEBA 1W2BA 1SFOH 1MJEA 2VQEQ 4B3TL 3E9IA 2Z6KA 2KCMA 1XNQQ 2AWOA 4Y52H 3F2DA 3GTMH 1WJJA 4JI4Q 2Q2IA 3J7A5 1EYGA 2ZTEA 4DAMA 4DV0L 3I4MH 1TWGH 5AJ3L 1Z47A 4POGA 1S40A 4TVAB 2V1CC 3CCUA 5C4JH 4DV7L 4B3RQ 2KHIA 1HR0Q 4B3RL 4R4QA 1XMQQ 3PUWA 3AYHB 1E1OA 2YTVA 3UDIA 2KBNA 3CD6A 4X65L 1I94L 1WI5A 4MZ9A 5LMUQ 3M4PA 1KL9A 1VQPA 1QVGA 2ZTCA 2RF4A 3I4OA 1VQHA 3RZDH 1I3QH 3B6YA 5IWAQ 2VQFL 1VQGA 1OXUA 1VS0A 3DM3A 4KI0A 4R4CA 3J80i 3CCJA 1YJ9A 1J5EL 4BBSH 2NZHA 3JAMc 4P72A 5BR8Q 1SRUA 4JBMA 3NBHB 5C3EG 2B63G 3K0XA 2XTIA 2LSSA 4DUYL 4ALPA 4IOCA 1IBMQ 1CKNA 4DK6C 1LYLA 2JEAI 1VQFA 1H95A 4MTNA 3H0GG 4LUZA 4YY3Q 2Q2UA 1PH7A 2OQ0A 1E7ZA 2IX0A 4LFAQ 4JG2A 3ULJA 5C3EH 4JBWA 4DUZL 3CF5A 4JI5Q 3U4VA 2MNAA 2B63H 4AQYL 3AEVA 1JJCB 5JEAG 4AIMA 1VQ9A 1FGUA 3H0GH 2VUMG 3T1HL 1ASYA 2K5NA 4DR1L 1OXXK 1YVCA 4JV5L 1CKNB 4A3KH 2JQOA 5IP9G 2KHJA 2IY5B 1J6QA 2VUMH 1RIPA 1T9HA 1WYDA 1N9WA 1IBLQ 3S15H 3KLWA 3M85A 1YJWA 3CCSA 4HJ5A 3U50C 1KD1C 3PO2H 3ER0A 2Z0SA 5M5WH 1XPOA 1XNQL 5IP9H 4JI7Q 1UWVA 4OO1I 1JJ2A 2D0PA 4TQUS 4A3DG 3S24A 5H1SE 1X6OA 1XPRA 3HOWH 1B8AA 4BA2I 4IFDI 2ID0A 4DV1L 1N33L 5GAGC 1TWFH 3HKSA 3HOXG 3ULPA 3S2DH 3D0FA 1AE3A 4A3DH 5C4XG 2Q2TA 4DNIA 1V1QA 1RL2A 3RN5A 4A3BG 3OYYA 4OXPA 4QJFA 1KC8C 4A3LG 4IPDA 4OWXB 3HOXH 1Q1EA 2K5HA 1L2FA 2E2HH 5C4XH 5LMNW 4J15A 4ME3A 1QZGA 4DR6L 3E9HA 2F4VL 1X65A 1GD7A 1HNZL 1K8GA 2F3IA 4Y7NH 2IX1A 2L15A 4JV5Q 2D0OA 4A3LH 2VQEL 4A93G 2DGYA 5FJ8G 3AQQA 1NJIC 1YEZA 2XGTA 4UP7A 3Q8DA 4LUVA 4JI1Q 4B3ML 4JI4L 3PO3G 3G48A 3I56A 1EIYB 1BVSA 4X66L 2JK8A 4OO1G 2Z6KC 3KF6A 1WOCA 1YJNA 3L7ZC 3GTGH 5IYBG 5HGQA 1HR0L 1TWHH 4A93H 5IE8A 1PA6A 3D31A 4KHZA 3GTPH 3A5ZB 3PO3H 4DR4L 1XMQL 4IFDG 1PH5A 1CSPA 1YHBA 2JA6G 4GNXA 4JI2Q 2JA8H 5EAYA 4YCVA 4A3IG 1YI2A 4L5RC 2CQOA 3HOZG 1SR3A 5IYBH 4K0KQ 5LMUL 3CC2A 3I4NH 2UXBQ 5J3BA 4HJ7A 4XIGS 4O2DA 1Y14B 2JA6H 2OTLA 1VQCA 1Q81C 3KF6B 5IWAL 4DR3Q 4A3IH 4LF8Q 3HOZH 3GTLH 2UXCQ 3CMEA 5BR8L 3J81c 1KIXA 1VQOA 3PUYA 2UUCL 1XNRQ 4GKJL 1U0LA 2VZAA 2PNHA 5IYDG 3CCEA 1IBML 1NE3A 2ASBA 2JA7G 2R93G 4WJ3M 4GNXB 2YV5A 2NVYH 2YYZA 2YU9H 5M3FH 2CFMA 1N8RC 4YY3L 1Q46A 1PYSB 3E0EA 3SGIA 4AYBE 4HIOA 1PH1A 1PH4A 3KJPA 3CCLA 4LFAL 1GKHA 3A5UA 4B3MQ 4JI5L 5JJIA 1YNXA 5IYDH 4P73A 2JA7H 2PQAA 3GTJH 2R93H 4JCVE 2NZOA 3I7FA 1FVIA 1V43A 1HJPA 4X66Q 2VY3A 3LGJA 4LFBQ 4LNQA 3TEHB 1VQNA 1VQ6A 3ICEA 4DR7Q 3CPWA 1X3GA 4DR4Q 2NVXH 4DV3Q 3NELA 3UE0A 2E8GA 2FXQA 1HNXQ 4OX9Q 3FKIG 2R7DA 1VQJA 1IBLL 4BBSG 2H5XA 5E7NA 4O0AA 3J7ZC 1PH2A 1SMXA 4HJ9A 1G6PA 2PQAB 2PI2E 2N3SA 4OWTB 5GAEC 1VQKA 4JI7L 2ZJRA 4IO9A 1V9PA 2HIVA 2N78A 3FKIH 1WCMG 3STBD 4JI3Q 2AMCB 4LUOA 3W1GA 1YZ6A 3RLOA 2E2IH 2UUCQ 4GKJQ 3TREA 1PVOA 2B29A 3MEFA 1Q7YC 1CUKA 1S72A 1KXLA 4A3FG 2NVTH 1WCMH 1I6HH 1JB7A 3A0JA 1SE8A 4YWKA 1KHIA 4IOAA 2R7FA 1GO3E 4NB3A 4A3KG 2CWPA 2I0QA 4JI0Q 4IJHA 4RG1A 4BBRG 2B3GA 3M9BA 2E2JH 1KRTA 4A3FH 2KCTA 1HNWQ 1A8VA 1E1TA 1N34Q 2BA0A 2E5LL 5C0XJ 1X55A 3EBEA 3PO2G 4QL5A 2WP8J 1M90C 5DLQE 3K7AH 2JA9A 1Z9FA 3H3VI 1JJGA 1EIFA 4BBRH 4IJLA 1PFSA 4JI1L 3RN2A 2NVQH 3S17H 4JYAQ 4GLVB 3HOWG 1PH9A 3RLFA 1C0AA 4KLKA 1R9TH 4IPCA 1IL2A 2ZTDA 2I5MX 2HQLA 4P75A 5FLMH 1S3OA 4X6AH 4JI2L 1JE5A 1E3PA 3F1ZA 2F52A 2LXJA 3NEMA 4C3HH 4HJAA 1FJGQ 1I5FA 4K0KL 2HT1A 1CSQA 4GNXC 1EUJA 1D7QA 3HOYG 2UXBL 3S1RH 4HJ8A 3EIVA 1OXVA 4AYBG 1NBWA 4DV4Q 3M3YH 3M4OH 4DR3L 2QGQA 4LF8L 1AH9A 3GO5A 1GVPA 2UXCL 4H02A 1HZ9A 2IHFA 2GVBA 2YTYA 5LMNQ 4DV6Q 3H15A 1XNRL 1MKHA 3HOYH 4GKKQ 1NY4A 4NXMQ 2UXDQ 1QVFA 2GN5A 3PUXA 3S1QH 1WFQA 4GOPA 2E5LQ 5FLXc 2JE6I 4BY1G 2ALYB 2I5HA 4JI6L 1CKMA 2A1AA 4X64Q 3S1MH 3U4ZA 1B70B 3UDFA 1HH2P 2BH2A 1HZAA 2EQSA 3CPFA 2K4KA 5ELNA 4BY7H 2PI2A 1EQRA 3ZJYC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KJO A;  3H3V H;  2UU9 Q;  2JA8 G;  4AH6 A;  3W1B A;  2OTJ A;  4BY1 H;  2K75 A;  4LFB L;  3CW2 C;  4DV5 Q;  4LF9 Q;  4DR7 L;  4HIK A;  2MO1 A;  3I4N G;  1IYJ B;  1EWI A;  4DV3 L;  3RR5 A;  1BBW A;  1N36 Q;  1VQD A;  3BZK A;  3HOU G;  3CXC A;  3I2Z A;  4GOP B;  1K8A C;  3PCO B;  3CMA A;  4OX9 L;  1HNX L;  1MJC A;  4PG3 A;  5GAH C;  4DR5 Q;  4LW1 A;  1JMC A;  4IFD J;  4PMW A;  1UE1 A;  1SLJ A;  4NPS A;  1Q86 C;  5JJK A;  3OTO Q;  5M3M G;  1GM5 A;  1P8L A;  5IY0 A;  3HOV G;  3HOU H;  1LTL A;  1XTD A;  2OQK A;  3ERS X;  4LF5 L;  4UP9 A;  5M3F G;  4XTC S;  4IPG A;  1N32 Q;  2RHQ B;  2ES2 A;  3HKZ G;  4R4I A;  4UY8 C;  4A3G G;  1QZH A;  4JI3 L;  1A0I A;  1HZB A;  1NTG A;  5M3M H;  3HOV H;  4NXN Q;  4KHP Q;  4C3I H;  4JI6 Q;  3MXN B;  4GS3 A;  2AWN A;  2LXK A;  4A3G H;  1C7Y A;  1CKO A;  1E24 A;  2R7Z G;  3HFZ B;  3K7U C;  3U58 A;  1KRS A;  2MQH A;  3GDE A;  4JI0 L;  4MNO A;  1X56 A;  2WAQ G;  1IBK Q;  4EX5 A;  1L1O A;  3J80 c;  1HNW L;  1PH6 A;  1EOV A;  1N34 L;  2CKZ B;  2Y0S G;  1E22 A;  4JOI A;  2R7Z H;  2K52 A;  2WFW A;  1TXY A;  3UE1 A;  3M7N A;  1SRO A;  3BJU A;  3CAM A;  3AFQ A;  2KEN A;  1IXR A;  4C3J H;  2MFI A;  4FDB A;  2MO0 A;  2C35 B;  4JYA L;  1NMG A;  1MIU A;  1L0W A;  1XJV A;  3I55 A;  3CCV A;  1UE5 A;  4OON A;  4PZ8 A;  2R92 G;  5HY6 A;  4LFC Q;  2CCZ A;  3UDX A;  1W3S A;  1VQM A;  1PH8 A;  4LF5 Q;  4DK3 C;  2ZJP A;  1XMO Q;  1L1O B;  1TWA H;  2YTX A;  2UUA Q;  3PIP A;  2N49 A;  2QEX A;  2ZM6 Q;  1PHJ A;  3GTK H;  3PSI A;  2N8N A;  5C0X I;  4DV2 Q;  1VQ8 A;  4LF4 Q;  1Q12 A;  1K9M C;  3J81 i;  1FJG L;  1VQ7 A;  4LF6 Q;  1K3R A;  1SN8 A;  3G4S A;  3OW2 A;  1HR0 W;  2R92 H;  3F8T A;  3DLL A;  5GAD C;  3RZO H;  3S2H H;  4WJ4 A;  4BXX G;  5IP7 G;  4DV4 L;  4GLX A;  2VNU D;  1PYB A;  3BU2 A;  3TQY A;  3HKZ E;  4LF7 Q;  5LMN L;  4DV6 L;  3G71 A;  4YWL A;  1YHA A;  1A62 A;  1D8L A;  5M5Y H;  4DR2 Q;  4NXM L;  1OXS C;  4GKK L;  4BXX H;  4GN5 A;  4C2M H;  5IP7 H;  1K73 C;  3KYH C;  1M1K C;  2UUB Q;  2UXD L;  3KF8 B;  4YHH Q;  5JEA J;  2DUD A;  4RMF A;  3TS2 A;  1UE7 A;  1ASZ A;  4X64 L;  3PV0 A;  3S14 H;  2OWO A;  3EN2 A;  4DPG A;  3A74 A;  4JC0 A;  4GOP C;  2OCE A;  2K5V A;  1Y1V G;  4P74 A;  1KAW A;  4B3S Q;  1PV4 A;  3NEN A;  4JI8 L;  5IYC G;  4LWC A;  5FLM G;  1X9N A;  2UU9 L;  2R6G A;  4UP8 A;  2WAQ E;  4B3T Q;  4OWW B;  3JC6 6;  3KOJ A;  1B7Y B;  2WB1 E;  5C44 G;  4DV5 L;  4QIW E;  4LF9 L;  4A76 A;  2Y0S E;  3PGZ A;  1K0R A;  4GLA C;  5C0X G;  3GD7 A;  1Y1V H;  4DV0 Q;  5IYC H;  5AJ3 Q;  1Y1W G;  1LM0 A;  1N36 L;  2ZJQ A;  3CC7 A;  3M4Q A;  4GN3 B;  4DV7 Q;  3GTO H;  4QQB X;  1YBY A;  1BKB A;  3JAM i;  4DR5 L;  5C44 H;  3RNU A;  1Q82 C;  2A8V A;  3S16 H;  1G29 1;  1YHQ A;  2AHO B;  1JT8 A;  3OTO L;  3GTQ H;  1X3E A;  3K80 C;  3PF5 A;  4A75 A;  1Y1W H;  4L5T A;  1OTC A;  4X65 Q;  1I94 Q;  3KFU A;  4YCW A;  1VQL A;  2HIX A;  3RLN A;  3CQZ H;  1N32 L;  1UE6 A;  3VDY A;  3S1N H;  2JA5 G;  2EIF A;  4BY7 G;  1EQQ A;  3PUZ A;  2Q2H A;  4NXN L;  1Q8K A;  2EXD A;  3STB C;  2VQF Q;  4EQ5 A;  4KHP L;  1J5E Q;  3G6E A;  1OXT A;  4A3M G;  4DKA C;  4APV A;  2A19 A;  1QUQ A;  1K83 H;  1IZ6 A;  2GVA A;  4X62 L;  5K36 G;  1EFW A;  4QY7 A;  3WWV A;  1QVC A;  4DUY Q;  4IPH A;  2JA5 H;  3L2P A;  2JJQ A;  1O7I A;  3CCM A;  4JI8 Q;  4L5Q A;  1P16 A;  4R4O A;  3UDG A;  1IBK L;  4A3M H;  1VQ5 A;  3T1Y L;  4DUZ Q;  3W5O A;  4L5S A;  3IRB A;  2CWA A;  3AFP A;  1I50 H;  4AQY Q;  2HHH L;  2NN6 I;  1L1O C;  2IT1 A;  3CCQ A;  4YWM A;  3FP9 A;  5GQO A;  3T1H Q;  4JOI C;  5JJL A;  1QUQ B;  4HIM A;  4DR1 Q;  1LUZ A;  1X3F A;  1VQE A;  4A3B H;  2K14 A;  3FHW A;  1AE2 A;  3ULL A;  3J81 j;  3PUV A;  3PF4 A;  2K50 A;  1Q1B A;  4BA1 I;  1VQ4 A;  4LFC L;  4QGU A;  2ATW A;  4A3E G;  1XMO L;  4POF A;  2UUA L;  1KQS A;  3K8A A;  4UPA A;  3CC4 A;  2ZM6 L;  5IT9 c;  4R4T A;  4DV2 L;  1PH3 A;  2PMZ E;  2VS1 A;  3BZC A;  2D62 A;  2VL6 A;  5FJ8 H;  2I5L X;  4R1J A;  3F2C A;  3TS0 A;  4A3J G;  4LF4 L;  1X54 A;  5M5X H;  4LF6 L;  2BA1 A;  1C9O A;  4PZ6 A;  4A4I A;  4A3E H;  2IHE A;  3PIO A;  1U5K A;  3KDF A;  2JEB I;  4DAY B;  4X62 Q;  1VQA A;  2RCN A;  5GRO A;  1YIJ A;  3F2B A;  4DV1 Q;  4YCU A;  1N33 Q;  3CCR A;  4A3C G;  1XPU A;  4A3J H;  1FL0 A;  4JBJ A;  4LF7 L;  1HZC A;  1VCI A;  1VQI A;  4JBK A;  1YIT A;  4DR2 L;  2NN6 G;  2WB1 G;  4GN4 B;  3T1Y Q;  2UUB L;  5ELO A;  1BBU A;  1VQB A;  4YHH L;  4A3C H;  2HHH Q;  1DGS A;  3TRZ A;  2RHS B;  4HID A;  2AKW B;  3K81 C;  2VW9 A;  2QA4 A;  3L0O A;  3I4M G;  2BH8 A;  4DR6 Q;  3CP0 A;  1G51 A;  4B3S L;  2F4V Q;  1A63 A;  3KDF B;  1HNZ Q;  1TWC H;  4PZ7 A;  4P71 A;  1NMF A;  1UEB A;  1W2B A;  1SFO H;  1MJE A;  2VQE Q;  4B3T L;  3E9I A;  2Z6K A;  2KCM A;  1XNQ Q;  2AWO A;  4Y52 H;  3F2D A;  3GTM H;  1WJJ A;  4JI4 Q;  2Q2I A;  3J7A 5;  1EYG A;  2ZTE A;  4DAM A;  4DV0 L;  3I4M H;  1TWG H;  5AJ3 L;  1Z47 A;  4POG A;  1S40 A;  4TVA B;  2V1C C;  3CCU A;  5C4J H;  4DV7 L;  4B3R Q;  2KHI A;  1HR0 Q;  4B3R L;  4R4Q A;  1XMQ Q;  3PUW A;  3AYH B;  1E1O A;  2YTV A;  3UDI A;  2KBN A;  3CD6 A;  4X65 L;  1I94 L;  1WI5 A;  4MZ9 A;  5LMU Q;  3M4P A;  1KL9 A;  1VQP A;  1QVG A;  2ZTC A;  2RF4 A;  3I4O A;  1VQH A;  3RZD H;  1I3Q H;  3B6Y A;  5IWA Q;  2VQF L;  1VQG A;  1OXU A;  1VS0 A;  3DM3 A;  4KI0 A;  4R4C A;  3J80 i;  3CCJ A;  1YJ9 A;  1J5E L;  4BBS H;  2NZH A;  3JAM c;  4P72 A;  5BR8 Q;  1SRU A;  4JBM A;  3NBH B;  5C3E G;  2B63 G;  3K0X A;  2XTI A;  2LSS A;  4DUY L;  4ALP A;  4IOC A;  1IBM Q;  1CKN A;  4DK6 C;  1LYL A;  2JEA I;  1VQF A;  1H95 A;  4MTN A;  3H0G G;  4LUZ A;  4YY3 Q;  2Q2U A;  1PH7 A;  2OQ0 A;  1E7Z A;  2IX0 A;  4LFA Q;  4JG2 A;  3ULJ A;  5C3E H;  4JBW A;  4DUZ L;  3CF5 A;  4JI5 Q;  3U4V A;  2MNA A;  2B63 H;  4AQY L;  3AEV A;  1JJC B;  5JEA G;  4AIM A;  1VQ9 A;  1FGU A;  3H0G H;  2VUM G;  3T1H L;  1ASY A;  2K5N A;  4DR1 L;  1OXX K;  1YVC A;  4JV5 L;  1CKN B;  4A3K H;  2JQO A;  5IP9 G;  2KHJ A;  2IY5 B;  1J6Q A;  2VUM H;  1RIP A;  1T9H A;  1WYD A;  1N9W A;  1IBL Q;  3S15 H;  3KLW A;  3M85 A;  1YJW A;  3CCS A;  4HJ5 A;  3U50 C;  1KD1 C;  3PO2 H;  3ER0 A;  2Z0S A;  5M5W H;  1XPO A;  1XNQ L;  5IP9 H;  4JI7 Q;  1UWV A;  4OO1 I;  1JJ2 A;  2D0P A;  4TQU S;  4A3D G;  3S24 A;  5H1S E;  1X6O A;  1XPR A;  3HOW H;  1B8A A;  4BA2 I;  4IFD I;  2ID0 A;  4DV1 L;  1N33 L;  5GAG C;  1TWF H;  3HKS A;  3HOX G;  3ULP A;  3S2D H;  3D0F A;  1AE3 A;  4A3D H;  5C4X G;  2Q2T A;  4DNI A;  1V1Q A;  1RL2 A;  3RN5 A;  4A3B G;  3OYY A;  4OXP A;  4QJF A;  1KC8 C;  4A3L G;  4IPD A;  4OWX B;  3HOX H;  1Q1E A;  2K5H A;  1L2F A;  2E2H H;  5C4X H;  5LMN W;  4J15 A;  4ME3 A;  1QZG A;  4DR6 L;  3E9H A;  2F4V L;  1X65 A;  1GD7 A;  1HNZ L;  1K8G A;  2F3I A;  4Y7N H;  2IX1 A;  2L15 A;  4JV5 Q;  2D0O A;  4A3L H;  2VQE L;  4A93 G;  2DGY A;  5FJ8 G;  3AQQ A;  1NJI C;  1YEZ A;  2XGT A;  4UP7 A;  3Q8D A;  4LUV A;  4JI1 Q;  4B3M L;  4JI4 L;  3PO3 G;  3G48 A;  3I56 A;  1EIY B;  1BVS A;  4X66 L;  2JK8 A;  4OO1 G;  2Z6K C;  3KF6 A;  1WOC A;  1YJN A;  3L7Z C;  3GTG H;  5IYB G;  5HGQ A;  1HR0 L;  1TWH H;  4A93 H;  5IE8 A;  1PA6 A;  3D31 A;  4KHZ A;  3GTP H;  3A5Z B;  3PO3 H;  4DR4 L;  1XMQ L;  4IFD G;  1PH5 A;  1CSP A;  1YHB A;  2JA6 G;  4GNX A;  4JI2 Q;  2JA8 H;  5EAY A;  4YCV A;  4A3I G;  1YI2 A;  4L5R C;  2CQO A;  3HOZ G;  1SR3 A;  5IYB H;  4K0K Q;  5LMU L;  3CC2 A;  3I4N H;  2UXB Q;  5J3B A;  4HJ7 A;  4XIG S;  4O2D A;  1Y14 B;  2JA6 H;  2OTL A;  1VQC A;  1Q81 C;  3KF6 B;  5IWA L;  4DR3 Q;  4A3I H;  4LF8 Q;  3HOZ H;  3GTL H;  2UXC Q;  3CME A;  5BR8 L;  3J81 c;  1KIX A;  1VQO A;  3PUY A;  2UUC L;  1XNR Q;  4GKJ L;  1U0L A;  2VZA A;  2PNH A;  5IYD G;  3CCE A;  1IBM L;  1NE3 A;  2ASB A;  2JA7 G;  2R93 G;  4WJ3 M;  4GNX B;  2YV5 A;  2NVY H;  2YYZ A;  2YU9 H;  5M3F H;  2CFM A;  1N8R C;  4YY3 L;  1Q46 A;  1PYS B;  3E0E A;  3SGI A;  4AYB E;  4HIO A;  1PH1 A;  1PH4 A;  3KJP A;  3CCL A;  4LFA L;  1GKH A;  3A5U A;  4B3M Q;  4JI5 L;  5JJI A;  1YNX A;  5IYD H;  4P73 A;  2JA7 H;  2PQA A;  3GTJ H;  2R93 H;  4JCV E;  2NZO A;  3I7F A;  1FVI A;  1V43 A;  1HJP A;  4X66 Q;  2VY3 A;  3LGJ A;  4LFB Q;  4LNQ A;  3TEH B;  1VQN A;  1VQ6 A;  3ICE A;  4DR7 Q;  3CPW A;  1X3G A;  4DR4 Q;  2NVX H;  4DV3 Q;  3NEL A;  3UE0 A;  2E8G A;  2FXQ A;  1HNX Q;  4OX9 Q;  3FKI G;  2R7D A;  1VQJ A;  1IBL L;  4BBS G;  2H5X A;  5E7N A;  4O0A A;  3J7Z C;  1PH2 A;  1SMX A;  4HJ9 A;  1G6P A;  2PQA B;  2PI2 E;  2N3S A;  4OWT B;  5GAE C;  1VQK A;  4JI7 L;  2ZJR A;  4IO9 A;  1V9P A;  2HIV A;  2N78 A;  3FKI H;  1WCM G;  3STB D;  4JI3 Q;  2AMC B;  4LUO A;  3W1G A;  1YZ6 A;  3RLO A;  2E2I H;  2UUC Q;  4GKJ Q;  3TRE A;  1PVO A;  2B29 A;  3MEF A;  1Q7Y C;  1CUK A;  1S72 A;  1KXL A;  4A3F G;  2NVT H;  1WCM H;  1I6H H;  1JB7 A;  3A0J A;  1SE8 A;  4YWK A;  1KHI A;  4IOA A;  2R7F A;  1GO3 E;  4NB3 A;  4A3K G;  2CWP A;  2I0Q A;  4JI0 Q;  4IJH A;  4RG1 A;  4BBR G;  2B3G A;  3M9B A;  2E2J H;  1KRT A;  4A3F H;  2KCT A;  1HNW Q;  1A8V A;  1E1T A;  1N34 Q;  2BA0 A;  2E5L L;  5C0X J;  1X55 A;  3EBE A;  3PO2 G;  4QL5 A;  2WP8 J;  1M90 C;  5DLQ E;  3K7A H;  2JA9 A;  1Z9F A;  3H3V I;  1JJG A;  1EIF A;  4BBR H;  4IJL A;  1PFS A;  4JI1 L;  3RN2 A;  2NVQ H;  3S17 H;  4JYA Q;  4GLV B;  3HOW G;  1PH9 A;  3RLF A;  1C0A A;  4KLK A;  1R9T H;  4IPC A;  1IL2 A;  2ZTD A;  2I5M X;  2HQL A;  4P75 A;  5FLM H;  1S3O A;  4X6A H;  4JI2 L;  1JE5 A;  1E3P A;  3F1Z A;  2F52 A;  2LXJ A;  3NEM A;  4C3H H;  4HJA A;  1FJG Q;  1I5F A;  4K0K L;  2HT1 A;  1CSQ A;  4GNX C;  1EUJ A;  1D7Q A;  3HOY G;  2UXB L;  3S1R H;  4HJ8 A;  3EIV A;  1OXV A;  4AYB G;  1NBW A;  4DV4 Q;  3M3Y H;  3M4O H;  4DR3 L;  2QGQ A;  4LF8 L;  1AH9 A;  3GO5 A;  1GVP A;  2UXC L;  4H02 A;  1HZ9 A;  2IHF A;  2GVB A;  2YTY A;  5LMN Q;  4DV6 Q;  3H15 A;  1XNR L;  1MKH A;  3HOY H;  4GKK Q;  1NY4 A;  4NXM Q;  2UXD Q;  1QVF A;  2GN5 A;  3PUX A;  3S1Q H;  1WFQ A;  4GOP A;  2E5L Q;  5FLX c;  2JE6 I;  4BY1 G;  2ALY B;  2I5H A;  4JI6 L;  1CKM A;  2A1A A;  4X64 Q;  3S1M H;  3U4Z A;  1B70 B;  3UDF A;  1HH2 P;  2BH2 A;  1HZA A;  2EQS A;  3CPF A;  2K4K A;  5ELN A;  4BY7 H;  2PI2 A;  1EQR A;  3ZJY C; 
#chains in the Genus database with same CATH topology
 1T3N A;  4AH6 A;  3MFI A;  3W1B A;  2PO4 A;  4ED2 A;  2K75 A;  3CW2 C;  4HIK A;  2MO1 A;  1IYJ B;  2PBZ A;  4DV0 H;  1N36 Q;  1VQD A;  2I46 A;  3BZK A;  1STG A;  4ME6 A;  3A8J E;  3ERQ A;  3CMA A;  2B2T A;  1SNC A;  1MJC A;  5GAH C;  4IFD J;  1UE1 A;  4NPS A;  1Z6H A;  2X6L A;  2XGP A;  4G7H C;  2R82 A;  3HKZ A;  3A56 A;  4CBV A;  3L9A X;  1LTL A;  2OQK A;  4LF5 L;  1SNO A;  4C3I G;  5M3F G;  3WOE A;  4MV3 A;  5CBE E;  3A8I E;  4R4I A;  1QZH A;  4JI3 L;  4F4Y A;  1NTG A;  1I4R A;  2R85 A;  3FRP B;  3HOV H;  3VYT A;  4XQJ A;  2M00 A;  2RDF A;  3DXJ C;  4MA5 A;  5DLG A;  4M8A A;  1E24 A;  4O3R A;  2J0T D;  3GV6 A;  4DL4 A;  3HKZ B;  1KLU D;  3GDE A;  2Y0S A;  4JI0 L;  1BNC A;  4MNO A;  5FO9 B;  5FPO A;  5CAE B;  4JI8 H;  4NLG A;  1ESR A;  2WAQ G;  1RD9 D;  3K5M A;  1L1O A;  2QKI C;  1HNW L;  1EOV A;  1LTI D;  5KFC A;  4KJN A;  3TZU A;  2R7Z H;  1EL0 A;  1TWA A;  1CZW A;  1JOO A;  2WFW A;  3TP7 A;  5KG4 A;  3GTK A;  3EFX D;  3AFQ A;  1IXR A;  3V96 A;  1PFB A;  1G8Z D;  1MIU A;  2FLL A;  5KIX A;  3JSL A;  2K03 A;  1XJV A;  3NWT A;  2QDB A;  4OON A;  2R92 G;  2Y0S B;  4RU9 A;  4J9L A;  1W3S A;  1VQM A;  1XMO Q;  2KEC A;  1L1O B;  4LMQ D;  3SI8 A;  3SXH A;  2L5T A;  3I4M B;  1TWA B;  3PSI A;  4DV2 Q;  4LF4 Q;  1A63 A;  1JXL A;  1K3R A;  1SN8 A;  2MP1 A;  3I3C A;  3G4S A;  3OW2 A;  3GTK B;  4KHP H;  1BO0 A;  5GAD C;  3DLL A;  2W6Q A;  2H1E A;  5IP7 G;  4X62 H;  2VB2 X;  1V1O A;  4Q0Y A;  5CC4 A;  1STB A;  1QJO A;  1PYB A;  3OOC A;  2K7V A;  2W6P A;  1ZXT A;  4LF7 Q;  3M7G A;  5CV8 A;  3M9N B;  2HDM A;  4DR2 Q;  2JEG A;  1D8L A;  2JEI A;  4C2M H;  1K73 C;  2UUB Q;  3H3V C;  2R8H A;  2F0O A;  3W3A A;  4RZR A;  3GIJ A;  3T1Y H;  4RMF A;  2A74 C;  3H0G A;  2HHH H;  3PV0 A;  2OWO A;  3TP8 A;  3EN2 A;  4DPG A;  3RTX A;  4JC0 A;  2OCE A;  3GTO A;  3S14 B;  4JI8 L;  4QMG A;  1X9N A;  3J80 L;  3E5N A;  4B3T Q;  2WAQ E;  3JC6 6;  2WB1 E;  4QIW E;  3VR2 A;  3OIQ A;  4EFB A;  5C0X G;  3Q22 A;  3GD7 A;  3CQZ A;  3K0Y A;  4JPB W;  2NBF A;  5KFK A;  2UUA H;  3CC7 A;  4GN3 B;  4QQB X;  1YBY A;  3H0G B;  1Q82 C;  2V58 A;  1G29 1;  1YHQ A;  1LTG D;  1DOM A;  1EY5 A;  3GTO B;  2B2T C;  3GIQ A;  1Y1W H;  2JA5 A;  1BNZ A;  4FF4 A;  1OTC A;  1EUD B;  2NTS A;  5KYI A;  4LJZ C;  5LMU H;  1KDC A;  4ZKB B;  3R23 A;  3M9O B;  4KMU C;  1GLV A;  3FMA A;  3GIP A;  1TY0 A;  3CQZ B;  4OEL B;  2NTT A;  2Q2H A;  4KHP L;  3OIP A;  2MUY A;  2VR1 A;  1XWE A;  3ETH A;  2YZG A;  5L1K A;  3G6E A;  4ECT A;  4DKA C;  3TDQ A;  4X62 L;  1K83 H;  1NSN S;  2A5H A;  4ECU A;  2EJF C;  2EPB A;  4LH6 A;  4XQN A;  3C2P A;  2JJQ A;  4RNM A;  2JA5 B;  5DM6 3;  1AUX A;  1LT5 D;  3MWM A;  3TQT A;  4M7E A;  4A3M H;  3T1Y L;  3KAK A;  3W5O A;  5K36 H;  1KJI A;  2CWA A;  1E4E A;  3LWB A;  2HHH L;  4R8I A;  1L1O C;  1STN A;  2Q8R E;  3FP9 A;  3BAB A;  5GQO A;  3T1H Q;  5JJL A;  4HIM A;  4DR1 Q;  4DA2 A;  2E2H B;  1VQE A;  4A3B H;  4B3R H;  1FD7 D;  2K14 A;  3OWF A;  4ED8 A;  1SSO A;  3ULL A;  3PUV A;  4HMJ A;  4KY5 A;  1VQ4 A;  2NU6 B;  1D5M C;  4C5B A;  4LFC L;  1SEB D;  1UUP A;  3OPO A;  4X65 H;  2FE3 A;  2UUA L;  4RB1 A;  4XT1 B;  2EJG C;  3K8A A;  3DMU A;  1WSC A;  1E4E B;  4EBD A;  1PH3 A;  2PMZ E;  2VS1 A;  5FJ8 H;  2I07 B;  3KHR A;  1C3O A;  5DQG A;  1X54 A;  3MXP A;  4X3T A;  1TU2 B;  3PR4 A;  3MR6 A;  5DGA A;  3GTP B;  2IHE A;  5M5X B;  1U5K A;  3FPP A;  3KDF A;  4A3E B;  1YIJ A;  4DV1 Q;  4OIK A;  3OHA A;  3CCR A;  4A3C G;  1XPU A;  5FD5 A;  1TWC A;  2I87 A;  4MTD A;  3H09 A;  2K32 A;  5I6Y A;  1YIT A;  2NN6 G;  3GTM A;  1WD0 A;  5ELO A;  1EIG A;  2JA6 B;  2RDG A;  2CW0 D;  1WVL A;  4EEQ A;  2G9D A;  1QWY A;  2QA4 A;  2GA4 B;  4DR6 Q;  3DWQ A;  3KDF B;  1C4Q A;  4PZ7 A;  1SFO H;  3AMU A;  2VQE Q;  4MV4 A;  3E9I A;  4Y52 H;  1EU3 A;  2C00 A;  4HNV A;  1W96 A;  1WJJ A;  2J6T A;  4JI4 Q;  3J7A 5;  3VYS A;  4RGO S;  2ZTE A;  1A2U A;  3I4M H;  2XCA A;  1TWG H;  1RCV D;  3GTM B;  2WV6 D;  1EYD A;  2P0A A;  4B3R L;  2AGP A;  4F7X A;  5I2Y A;  3UDI A;  2W9A A;  3CD6 A;  3FDT A;  5IGG A;  3T53 B;  4X65 L;  3CU7 A;  5KG6 A;  1O7L A;  2F3V A;  3NPP A;  2K5W A;  4U7C A;  1QVG A;  2ZTC A;  2RF4 A;  5LYJ F;  1SNM A;  4C1N K;  4V19 0;  3RZD H;  3BQ1 A;  2B63 A;  1GOZ A;  2IPK D;  3B6Y A;  3ND8 A;  2VQF L;  4R4C A;  1VS0 A;  4DR3 H;  3CCJ A;  4BBS H;  4J9O A;  4LF8 H;  4DU9 A;  4Q8E A;  2UXC H;  1JQY D;  5KNC A;  2LSS A;  3J81 E;  4DL5 A;  1H95 A;  1VQF A;  2EY6 A;  1SBB B;  2F4V H;  5KFY A;  4YY3 Q;  2J9G A;  2F4I A;  3TN2 A;  3A7A B;  1BCP B;  2OQ0 A;  2IX0 A;  2QCP X;  4TUY F;  1WCM B;  4B3M H;  3AEV A;  2FPG B;  1GUT A;  2B63 B;  3F8N A;  1SYD A;  2CW0 C;  3FVQ A;  3H0G H;  2VUM G;  4F4X A;  1GXD C;  2XD4 A;  1STA A;  3RIZ A;  5FLX W;  1YVC A;  2RCF A;  4ECQ A;  2NZ1 D;  2W9C A;  5IP9 G;  2BQR A;  2KHJ A;  3VYR A;  2VPS A;  1J6Q A;  1T9H A;  2KED A;  3A54 A;  1O80 A;  1LO5 D;  2NUA B;  3PO2 H;  4U6P A;  1HTP A;  2KA7 A;  2Z0S A;  5KFQ A;  3MR5 A;  4QWE A;  4JI7 Q;  3G6X A;  4OO1 I;  1JJ2 A;  4NMZ A;  2WAC A;  5M5W B;  4A3D G;  1XPR A;  4IN3 A;  1I4X A;  1Z7T A;  3RAX A;  1S0O A;  3R5F A;  4IFD I;  1VMC A;  1Y8O B;  4ZRZ A;  3HOW B;  2B2U A;  4O4H F;  3HOX G;  1TWF H;  2K28 A;  5NUC A;  2W9C B;  1IBM H;  1WTO A;  4JV2 A;  1CT1 D;  2Q2T A;  3S2D B;  4F87 A;  4IHJ F;  1E2W A;  5CV4 A;  4A3B G;  5K2M A;  3OYY A;  4A3L G;  5KFN A;  2K5H A;  3NTH A;  2E2H H;  5LMN W;  4J15 A;  4ME3 A;  2F0M A;  5HV6 A;  3E9H A;  2F4V L;  1X65 A;  1SNP A;  1HNZ L;  1K8G A;  5CR3 A;  2XWB B;  4G57 A;  2CW8 A;  3LX0 A;  2DY7 A;  4BS9 A;  4A93 G;  5FJ8 G;  1OO9 B;  2FJZ A;  1YEZ A;  4B3M L;  5CA0 F;  4XYQ A;  3KHL A;  3I56 A;  1IL8 A;  1BF4 A;  3MR2 A;  5HGQ A;  4PMB A;  2QK4 A;  4Q43 A;  3GTP H;  4RCN A;  3PO3 H;  1CSP A;  2TSS A;  5DNF A;  4JI2 Q;  4GNX A;  5KFL A;  3GV5 B;  3WDN A;  4A3I G;  4L5R C;  2CQO A;  3CC2 A;  3I4N H;  4HJ7 A;  1F2L A;  3BYT B;  4O2D A;  2UVV A;  1JWU D;  1BCP C;  3TME A;  2JA6 H;  4TV9 F;  1VQC A;  3QOL A;  3OUZ A;  5FKA C;  5IWA L;  5D3D A;  4Y8V B;  2YS7 A;  4R9W A;  2LFN A;  3M4I A;  1QB5 D;  1I4G A;  4YQW A;  3HOZ B;  1IBM L;  4ME5 A;  2R93 G;  1PTO B;  4GNX B;  4YR2 A;  3VYU A;  4TV8 F;  2NVX A;  1VBH A;  2ZDG A;  1ET6 A;  1PYS B;  3CHB D;  4HIO A;  5JVD F;  5M3F B;  4TQS A;  2C2R A;  3KJP A;  2D9U A;  3G7L A;  3A5U A;  5IYD H;  3IFD A;  4P73 A;  4JI1 H;  1ZEQ X;  2FKL A;  5ELB A;  3BS1 A;  1T5X D;  3I7F A;  2CZG A;  2GPW A;  2KUM A;  3PN1 A;  3RUP A;  2DNE A;  4V0B A;  4FVM A;  3TEH B;  1VQ6 A;  1KJ9 A;  3FDS A;  3K5H A;  3FKI A;  3PR5 B;  2B2W A;  3NEL A;  1N36 H;  2NVX B;  2B2V A;  3T51 B;  3H4B A;  1VQJ A;  1IHZ A;  1IBL L;  4BBS G;  1LT4 D;  5KT3 A;  3J7Z C;  1PH2 A;  2JEF A;  1IW7 C;  3V6H A;  3ORQ A;  2PI2 E;  1ZHS A;  3OSP A;  2CHB D;  1NUC A;  2Z4I A;  2ZDH A;  2HIV A;  2N78 A;  1PK8 A;  1B4O A;  2E74 C;  3FKI B;  3STB D;  4GKJ Q;  1YZ6 A;  5EOY A;  2M2L A;  4DL6 A;  2A6H D;  1M0T A;  3MEF A;  1Q7Y C;  1EZ6 A;  1KXL A;  3RFC A;  2B2U C;  1WCM H;  2F0F A;  2NVT H;  1I6H H;  3A0J A;  1SE8 A;  4IOA A;  1KHI A;  4NB3 A;  4PV1 C;  2J6U A;  1W6J A;  3NK9 A;  4RG1 A;  5T14 A;  3M9B A;  5TSS A;  1SJH D;  2KCT A;  1T5E A;  2BA0 A;  2K6A A;  3EBE A;  3PO2 G;  4ZAI A;  3Q24 A;  1DM0 B;  3GIL A;  1KAB A;  2ALZ A;  2VA3 A;  3H3V I;  4OX9 H;  4JI1 L;  3RN2 A;  4YJ2 F;  3PIO 3;  1HNX H;  4JYA Q;  5KT7 A;  1EIH A;  1PZI D;  3J7A F;  1MI2 A;  1DON A;  1VMP A;  1ROD A;  2Z4H A;  2F0N A;  2Z8L A;  4B9W A;  2NUC A;  4P75 A;  4I7H A;  3SK5 A;  4X6A H;  3A8K E;  2L12 A;  1E3P A;  3F1Z A;  1U4L A;  3L4J A;  4C3H H;  4LF4 H;  3AU7 A;  1CSQ A;  1PTO C;  2EYF A;  4GNX C;  1EUJ A;  3HOY G;  2HDL A;  3EA6 A;  5ELF A;  3S1R H;  4ECX A;  4ETS A;  4IZO A;  3EIV A;  1LTA D;  4AYB G;  1NBW A;  2A6E C;  2QEJ C;  3BA8 A;  4Q8F A;  5DG7 A;  2H4O A;  3M4O B;  2IHF A;  2YTY A;  3MWD A;  3H15 A;  1XNR L;  4DL2 A;  4DR2 H;  4I7A A;  2GN5 A;  3PUX A;  1LTR D;  1WFQ A;  4GOP A;  5KFG A;  1JX4 A;  4BY1 G;  2AUJ D;  2KVM A;  3J7A V;  2I5H A;  3BYY B;  3S1Q B;  2A1A A;  1CS0 A;  1UNS A;  4ECW A;  2MGS A;  2ZXR A;  1HH2 P;  2BH2 A;  3S1M B;  2K4K A;  5ELN A;  2FK3 A;  2FP4 B;  3ZJY C;  2UU9 Q;  1RJQ A;  1EU4 A;  5E4X A;  4B3T H;  4QW8 A;  1TS5 A;  4LFB L;  4DV5 Q;  4DR7 L;  1K1S A;  5J22 A;  3I4N G;  3VR5 A;  4DV3 L;  3RR5 A;  3J81 W;  1YNN C;  3HOU G;  1I50 B;  5EKI A;  4GOP B;  4OX9 L;  1HNX L;  2B2W C;  3QZ7 A;  4FM9 A;  2B2Y A;  3RGX A;  2DPJ A;  4DR5 Q;  1FJG H;  5JJK A;  4KN4 C;  2W70 A;  2B2V C;  3HS0 C;  1SMY D;  4CHT B;  1P8L A;  5IY0 A;  1B1Z A;  2E75 C;  4FF3 A;  1JOK A;  4O3O A;  4KY7 A;  1B9M A;  4J1M A;  4UP9 A;  3K59 A;  3EJI A;  4XTC S;  1N32 Q;  2ES2 A;  2BR0 A;  3N6R A;  4A3G G;  1GUW A;  3L3O C;  1HZB A;  2V4R A;  1KJQ A;  4K5W A;  5LMN H;  5JH7 F;  2M9V A;  2DLN A;  2A69 D;  2RBM A;  2R7Z A;  2NWG A;  4C3I H;  1FYC A;  3HOV B;  5KFF A;  4JI6 Q;  5IOC A;  2LXK A;  2G5D A;  3WO0 A;  3U58 A;  5EJW A;  1KRS A;  2MQH A;  4UCT A;  1FR3 A;  1X56 A;  3QG1 A;  4C3J G;  1S68 A;  4JV0 A;  5FLX L;  1N34 L;  4LF9 H;  1AEX A;  1MBY A;  2K52 A;  4B08 A;  4F50 A;  2K5D A;  1TXY A;  4EFE A;  2V4D A;  1SRO A;  3CAM A;  2UVU A;  1SXT A;  3Q8Q B;  2JYO A;  2EYM A;  3T1H H;  5EBD A;  2C35 B;  4FO2 A;  1ILP A;  4DR1 H;  3LP8 A;  4LSA A;  1JDE A;  1S5B D;  2DY8 A;  3I55 A;  3E3X A;  1UE5 A;  4PZ8 A;  1JB3 A;  5C5M A;  3N42 B;  2CCZ A;  4DFA A;  1PH8 A;  3HEJ A;  4DK3 C;  2ZJP A;  1L2Z A;  5KFW A;  5LP6 F;  2QEX A;  4RAY A;  1R4P B;  5CGK A;  1PFM A;  3KF8 A;  4N9T A;  1VQ8 A;  4C2M A;  1FJG L;  2R92 H;  4LF6 Q;  2WTF A;  5IT9 E;  1HR0 W;  1B44 D;  2K05 A;  3RZO H;  5DG9 A;  1SMY C;  4C5A A;  2G9H D;  5KKN B;  4DV4 L;  4QWD A;  2OH2 A;  2VNU D;  3KBX A;  4DV1 H;  1IOW A;  3MVV A;  4DL7 A;  2MPM A;  2EDG A;  2KQ3 A;  1JIC A;  3ETJ A;  5LMN L;  4DV6 L;  3G71 A;  4IUR A;  1YHA A;  2DJF C;  4YWL A;  3N44 B;  1IBK H;  1OXS C;  3PZP A;  4GN5 A;  5IP7 H;  1DD2 A;  3KYH C;  1M1K C;  3KF8 B;  4YHH Q;  5JEA J;  3TS2 A;  3FMC A;  2A69 C;  4IRC A;  4C2M B;  4X64 L;  2IJ0 A;  4KTA A;  5EPK A;  4GOP C;  4CC5 A;  1KAW A;  4B3S Q;  1SDF A;  4J6H A;  4ZLT F;  5IYC G;  4LWC A;  4K8I A;  2F03 A;  4TQR A;  2B8G A;  4IR1 A;  1U9R A;  2R6G A;  4UP8 A;  1PDQ A;  3NP8 A;  1Y1W A;  3KOJ A;  4R8N A;  5C44 G;  4LF9 L;  4A76 A;  5JPN C;  1GUN A;  4JI4 H;  2ZJQ A;  5J39 A;  1LM0 A;  4L8J A;  4TRD A;  4DV7 Q;  2ZM6 H;  2QF7 A;  2F0I A;  4MN3 A;  3S16 H;  3DHQ A;  2AHO B;  3OTO L;  5C0X H;  3GTQ H;  1X3E A;  3K80 C;  2B2Y C;  3N40 P;  1I94 Q;  1Y1W B;  2PYK A;  1VQL A;  5KFE A;  2HIX A;  5KFZ A;  1UE6 A;  3VDY A;  2X69 A;  3OSN A;  3K5N A;  1WD1 A;  2ZJT A;  1EOT A;  1Q8K A;  4NXN L;  2N88 A;  1IKL A;  1Y69 U;  4APV A;  1CQF A;  1GUO A;  3S9W A;  2C2D A;  1E0B A;  1NR4 A;  1A3T A;  1QG7 A;  3K5L A;  1PRT F;  1EFW A;  4DL3 A;  4IPH A;  5K5P A;  5KYL A;  3F2U A;  1P16 A;  3UDG A;  1IBK L;  4DUZ Q;  2RDH A;  1AN8 A;  4A3M B;  4C1N I;  1I50 H;  3E5S A;  5KFB A;  4ED0 A;  2IT1 A;  2L4N A;  1YNJ C;  1F2Z A;  1LUZ A;  4GZY C;  5IGC A;  4CJ2 C;  1AE2 A;  1JLL B;  1Z2N X;  3J81 j;  2IX3 A;  2K50 A;  4BA1 I;  4A3B B;  4RKL A;  1VBG A;  4HN7 A;  1IYU A;  2CVR A;  2Q8T A;  1N48 A;  4POF A;  4CKE A;  3JSN A;  2W9B A;  1PZK D;  4MTK A;  1B3Q A;  2ZM6 L;  2I80 A;  1XNQ Q;  2C28 A;  2VL6 A;  1I4H A;  4A3J G;  2FMA A;  2VXW A;  4DF7 A;  4JI7 H;  1GSH A;  4A93 B;  1J5E H;  3PIO A;  1PRT D;  2QYZ A;  3KTM A;  1N33 Q;  4DUY H;  5ELD A;  3V6J A;  4UCO A;  4IUP A;  1UC9 A;  4JBJ A;  3MHB A;  4QWA A;  4IFD H;  1VCI A;  4ABN A;  1SFO A;  1H9S B;  2F0E A;  2R8G A;  2WB1 G;  3T16 A;  2W9B B;  2NYZ D;  3C1E A;  1JCK B;  1BBU A;  1VQB A;  2EVB A;  4KY6 A;  4RHS A;  1TWG A;  4A3C H;  4AQY H;  4A3I B;  3D6C A;  4J9M A;  2VW9 A;  4YAJ B;  3L0O A;  1JIH A;  3CP0 A;  2NN6 H;  3NSW A;  1EY0 A;  1UEB A;  2F0Q A;  1Q8I A;  2KCM A;  3LNN A;  3F2D A;  4MHE A;  1SFO B;  4IUV A;  2Q2I A;  1Z2P X;  4RAZ A;  4DAM A;  4DV0 L;  4QUC A;  1AP0 A;  1KDA A;  5AJ3 L;  1HXY D;  4TVA B;  1K0S A;  2V1C C;  3CCU A;  1JKJ B;  5C4J H;  1TWG B;  2FK1 A;  4HSP A;  4EG0 A;  1E4F T;  5BMV F;  4H13 C;  4KKU A;  1XMQ Q;  5J1Z A;  5KT4 A;  3PUW A;  1ICW A;  4OL7 A;  1E1O A;  1H9R A;  4NDX A;  3SVM A;  3RB4 A;  2VPQ A;  5C1P A;  2EYO A;  5JJZ A;  2QW7 A;  5A2Q E;  2K5Q A;  3T4A C;  3V2T A;  4DLK A;  3DM3 A;  1J5E L;  3RZD B;  1YJ9 A;  1M4V A;  3JAM c;  4P72 A;  5BR8 Q;  1SRU A;  2BQU A;  5C3E G;  1T36 A;  4BBS B;  1B3A A;  2KCN A;  4DUY L;  4ALP A;  1B6R A;  4EGJ A;  5L37 A;  4LUZ A;  1ULZ A;  4I50 F;  3K6O A;  1QIL A;  3QIA A;  2JEJ A;  4JI5 Q;  5KT5 A;  3VR3 A;  4AQY L;  4EYI B;  4IQZ A;  5JEA G;  4AIM A;  3OW7 A;  4CDE C;  1VQ9 A;  1JDB B;  3GQB A;  1JC7 A;  4O3S A;  2E2J B;  1HR0 H;  2KOL A;  3SK6 A;  4A3K H;  4H44 C;  4XYO A;  2VUM H;  1S97 A;  1TWF A;  3KLW A;  3CCS A;  1EY7 A;  4IWY A;  2HCC A;  3PO2 B;  5IP9 H;  1UWV A;  2D0P A;  3TP5 A;  1F9Q A;  3U9T A;  2P5Z X;  2A68 D;  4IR9 A;  3ND9 A;  5HBR B;  2KJX A;  1D1K A;  4BA2 I;  2E2H A;  2ID0 A;  5KFU A;  3JAM E;  4AYB A;  5BPF A;  4GKJ H;  3ULP A;  3D0F A;  1TS4 A;  1AE3 A;  2M05 A;  1TWF B;  4A3D H;  5C4X G;  3FPU B;  5IOD A;  4WRD A;  4DNI A;  2EY2 A;  4LFA H;  2YZM A;  4EGV A;  3HOX H;  3MR3 A;  4FF2 A;  5IT9 W;  1F9P A;  1S0N A;  2D2C C;  4QB4 A;  3GTP A;  4K5X A;  1ESF A;  4XDX A;  2IWH A;  4Y7N H;  4JV5 Q;  4AYB B;  4A3L H;  5F2D A;  4FU0 A;  3AQQ A;  2W6Z A;  2XGT A;  4EBC A;  2OEO A;  4J9S A;  5EDW A;  3G48 A;  5COR A;  4OO1 G;  1D1I A;  3GTG H;  1C48 A;  3L7Z C;  5FK9 C;  2JA6 A;  5IYB G;  5DQI A;  1HR0 L;  4A93 H;  3GV7 B;  1K8M A;  2IMW P;  4IFD G;  4DGZ A;  1PH5 A;  4YR0 A;  3PO3 B;  2R61 A;  4KHV A;  4UAI A;  4YCV A;  2XC9 A;  5KRU A;  4LMY A;  3HP3 A;  1AZQ A;  4K0K Q;  2ATL A;  5LMU L;  1SE2 A;  2K04 A;  2UXB Q;  4RUC A;  5L1J A;  4FBU A;  5FO7 B;  3QR8 A;  4X3K A;  3I4N B;  3WOF A;  4E4T A;  2F0V A;  4PMC A;  1Q81 C;  2F0H A;  3I72 A;  2R7L A;  4A3I H;  3VMM A;  4QCL A;  1VDZ A;  2QIL A;  3GTL H;  1EWC A;  3J81 c;  2FMC A;  2HCI A;  1TVX A;  1VQO A;  2A68 C;  4RB3 C;  4GKJ L;  3Q6S A;  5FD6 A;  2JA7 G;  2A73 B;  1NE3 A;  3A55 A;  2YV5 A;  2NVY H;  3D6W A;  2C2E A;  2RVL A;  1XDN A;  2YU9 H;  1ZHQ A;  4FXD A;  5KG0 A;  4XQQ A;  4A2B A;  3E0E A;  1PH1 A;  1PH4 A;  4LFA L;  3EPI A;  5JJI A;  4EQN A;  1YNX A;  3PW7 A;  2KHS A;  2PQE A;  3GTJ H;  2R93 H;  5C1O A;  1CK1 A;  4X66 Q;  3ITP A;  1SYE A;  4LNQ A;  4HSV A;  3ICE A;  5LHY 1;  2O4X A;  1ZET A;  5KG5 A;  5E4W C;  3UE0 A;  2NU9 B;  2R7D A;  2EOT A;  2H5X A;  2K01 A;  3BA9 A;  3H40 A;  1HA6 A;  1SMX A;  3RMH A;  1WCM A;  1ZYR D;  1XX8 A;  4K6L A;  3N41 B;  1V9P A;  3KLS A;  1L0X B;  2KSW A;  3NXW A;  1RYS A;  1A9X A;  4JI3 Q;  2ASL A;  4CKB A;  2UUC Q;  3RLO A;  5D8D A;  2R3Z A;  3KBG A;  1PVO A;  2F3W A;  2FMM A;  3ZYY X;  2ICI A;  4A3F G;  4RNN A;  1BR9 A;  4JI6 H;  2EZV A;  1JB7 A;  2NVT B;  1I6H B;  1QCB D;  4XYM B;  4A3K G;  4GC7 A;  2CWP A;  4JI0 Q;  4UCV A;  4IJH A;  1EYZ A;  1JWM D;  4BBR G;  5D3I B;  5CYU A;  3SE0 A;  2E2J H;  1HNW Q;  1A8V A;  3SEB A;  5M5Y B;  3J80 E;  2FPP B;  1D5Z C;  2AQ1 B;  3RF2 A;  5DLQ E;  2JA9 A;  5IGF A;  2DPI A;  1EIF A;  1FNU A;  1EY9 A;  4IJL A;  1ILQ A;  2NVQ H;  1UC8 A;  1W93 A;  5BN4 A;  1C0A A;  1QNK A;  4F8M A;  4ZI7 F;  1IL2 A;  3IAY A;  2YYA A;  2ZTD A;  1RJR A;  4LH7 A;  1S3O A;  1JE5 A;  2PZW A;  3NEM A;  2F52 A;  2LXJ A;  3TP6 A;  5C6A A;  2O5I C;  4CC6 A;  4LF6 H;  2VUG A;  1ICF B;  4C3H B;  2W6O A;  5LA6 F;  1OXV A;  4WBN F;  3PW5 A;  3TQ1 A;  3S1R B;  4DR3 L;  5F9N A;  1X3Q A;  2QGQ A;  3MFY A;  4LF8 L;  1GVP A;  3IL8 A;  1TII D;  4WOR A;  4UHV A;  1HZ9 A;  2UXC L;  2GVB A;  3BAA A;  5KT2 A;  5DQH A;  3GIM A;  3HOY H;  4ECR A;  1MKH A;  1FGB D;  2E5L Q;  1PLF A;  2JE6 I;  4HTH A;  3CVZ A;  1PZJ D;  4YHH H;  4JI6 L;  2PNR C;  3VPC A;  1B70 B;  5I9O A;  3OWE B;  1STE A;  1HZA A;  2RQX A;  4BY7 H;  3BDC A;  3URY A;  3DEP A;  4O42 A;  4KV6 A;  4RH6 A;  4LSX A;  2TMP A;  5DEH A;  1EY8 A;  4BY1 H;  2R8K A;  2IA6 A;  1S5F D;  3I8Z A;  4ILW A;  2RSO A;  4ZKC B;  4HYK A;  3I2Z A;  1K8A C;  3PCO B;  4CDC C;  1SCU B;  3MJF A;  1U4P A;  4PG3 A;  4LW1 A;  3MXN A;  1EFI D;  4PMW A;  5IGE A;  1Q86 C;  3RUZ A;  1EWH A;  5M3M G;  1UAP A;  4FP5 D;  4ED3 A;  3HOU H;  1HRJ A;  1WTV A;  5ELE A;  1XTD A;  3ERS X;  1AFP A;  2VB3 X;  3KK7 A;  3RV4 A;  2RHQ B;  3HKZ G;  1A0I A;  2I8C A;  3H20 A;  5IYZ F;  4GKK H;  4KHP Q;  4NXM H;  2UXD H;  5FPR A;  4EGQ A;  2V59 A;  2FIN B;  1KC7 A;  1EQT A;  3MXN B;  4GS3 A;  2AWN A;  4C3I B;  4A3G H;  1KJJ A;  2WAQ A;  1C7Y A;  3L4K A;  4RWS C;  2J6S A;  1V1P A;  3HFZ B;  3K7U C;  2DIK A;  2WB1 A;  4RUA A;  4IAJ A;  1DZ1 A;  4EBE A;  1LTS D;  2W8L A;  2CKZ B;  2JXM B;  2Y0S G;  5EPL A;  3SE7 A;  2AQ2 B;  1KTK A;  3JAM W;  3IKJ A;  2LKV A;  3UE1 A;  5L1L A;  3BJU A;  2F0W A;  2KEN A;  4UCU A;  4C3J H;  2B39 A;  1TR5 A;  2MFI A;  2R92 A;  2MO0 A;  1CQI B;  3N6X A;  2WAQ B;  1EQV A;  1L0W A;  1V1P B;  2WB1 B;  1D6E C;  1EYC A;  3CCV A;  4LFC Q;  1S5C D;  2XN9 C;  3W2D A;  1O7Z A;  4EYH B;  2YTX A;  1C30 A;  1RKN A;  2UUA Q;  5KGU A;  3PIP A;  3C3L A;  2N49 A;  4LAA A;  1PHJ A;  2FFK B;  4KN7 C;  3T13 A;  1Q12 A;  4R7R A;  3J81 i;  5EWF A;  5KX5 F;  2AQ4 A;  4K8J A;  3RD4 A;  4PNY A;  3Q8S B;  2R92 B;  1BJT A;  1J9O A;  3KAJ A;  4ED7 A;  3U9O A;  3PVX A;  4ED6 A;  4BXX G;  5CV5 A;  5KFM A;  3RZO B;  4DK1 A;  1ENC A;  1BOS A;  5EBC A;  5I4D A;  3LWU A;  5IGB A;  3EPG A;  3BU2 A;  1N33 H;  3TQY A;  3HKZ E;  4QWC A;  4Q45 A;  1NR2 A;  1BGW A;  4GKK L;  1A62 A;  5M5Y H;  4NXM L;  2UXD L;  4N8F A;  3PW2 A;  1TS3 A;  1ASZ A;  4RZQ A;  4FS1 A;  5KG7 A;  1Y1V G;  3OHX C;  1PV4 A;  3NEN A;  3WO1 A;  3GTQ A;  2OF1 A;  3GQC A;  4OWW B;  4IZ8 A;  4IUQ A;  2EXZ A;  1K28 A;  2Y0S E;  4O2B F;  3PGZ A;  5C8Y F;  1K0R A;  4GLA C;  3LML A;  4G3I A;  3UFX B;  1GJX A;  5C3E B;  1XMO H;  4NKL A;  5IYC H;  1N36 L;  1FNV A;  1SYG A;  2PZU A;  2E76 C;  4MA0 A;  2R8I A;  3QOJ A;  4DV2 H;  4UCR A;  1BKB A;  4K5V A;  4B3R Q;  5C44 H;  3PW4 A;  4YJ3 F;  2A8V A;  4O2A F;  3G6V A;  1JT8 A;  3H91 A;  4O4I F;  3JZI A;  3S16 B;  4A75 A;  3IFT A;  4ECY A;  3GTQ B;  4X65 Q;  5C5L A;  1SAP A;  3MZ5 A;  3X3M A;  4YCW A;  4JV1 A;  1GUG A;  3VR4 A;  3HRZ C;  1WTW A;  3KAL A;  2JA5 G;  2AGO A;  2EY5 A;  2PMZ B;  4LF7 H;  4BY7 G;  4J9Q A;  2ZT9 C;  1EQQ A;  3STB C;  2F0U A;  2EXD A;  2VQF Q;  1I50 A;  2UUB H;  1I7L A;  4FF1 A;  2A6H C;  1WTR A;  1HUN A;  5BR8 H;  3V6K A;  2XRS D;  2O03 A;  4QY7 A;  1QVC A;  2F0J A;  2F0G A;  2Z1C A;  3L2P A;  4ECS A;  1O7I A;  2R84 A;  4R4O A;  4DXG A;  5EQ0 A;  4UCS A;  2XGQ A;  3SDZ A;  3NE5 B;  1VQ5 A;  2AUK A;  4L5S A;  3IRB A;  3J7A K;  1DXM A;  3AFP A;  2VA2 A;  3OSO A;  4JW0 A;  4JI5 H;  4ECV A;  4YWM A;  1F2M A;  4NW2 A;  2RDJ A;  4YAK B;  4RA8 A;  4DAY A;  5CV6 A;  5C4X B;  2EY1 A;  1CFM A;  1Z2O X;  4Z9C B;  3PF4 A;  1Q1B A;  2R7M A;  3OUU A;  5C4Z A;  3C1F A;  4QGU A;  3Q2O A;  1KBL A;  4A3E G;  1XMO L;  3UI2 A;  2R87 A;  5T1G A;  2ASJ A;  3CC4 A;  4UPA A;  4JUZ A;  1QNU A;  2AU0 A;  3J80 W;  5IT9 c;  4DV2 L;  3BZC A;  4O3P A;  2D62 A;  4LF4 L;  3TS0 A;  4R1J A;  1PX2 A;  3BJY A;  5BN5 A;  4DAY B;  2ZXP A;  2JEB I;  1VQA A;  2RCN A;  5GRO A;  4YCU A;  3A7L A;  2VOB A;  4A3J H;  4LF7 L;  1A3V A;  1VQI A;  3SR1 A;  4DR2 L;  1UNN C;  5KFT A;  2UUB L;  1MGS A;  3T5L A;  2PW7 A;  2RHS B;  2AKW B;  3E6Z X;  3GIK A;  4OIJ A;  2DJG C;  3IG0 A;  5J2T F;  4ZUI A;  3WNZ A;  3I4L A;  2F4V Q;  4ZQI A;  1HNZ Q;  1SYC A;  2L11 A;  3VPD A;  2YRX A;  4B3T L;  3P7J A;  4JV5 H;  5L1I A;  2W8K A;  4OGQ C;  3RB0 A;  3T56 B;  4RAU C;  1Z47 A;  1S40 A;  1CHP D;  1MZB A;  1IOV A;  4ZK9 B;  1EEI D;  2PZT A;  5C4J B;  3NBH A;  4R4Q A;  3TIN A;  3QWN A;  4IUN A;  2KEE A;  1AUV A;  5JUM A;  4RFB A;  1U4R A;  2KBN A;  5EZY F;  1D2B A;  2HVR A;  1LAB A;  1VQP A;  5LL6 S;  4UFZ A;  3I4O A;  1VQH A;  1DJR D;  1I3Q H;  2L1B A;  3SK4 A;  5IWA Q;  1VQG A;  1OXU A;  4KI0 A;  4DNT B;  3MXG A;  1VF5 C;  3VA5 A;  4IWX A;  3NBH B;  2B63 G;  5C5J A;  2XTI A;  2BOS A;  2DN8 A;  4J9P A;  1IBM Q;  1CQJ B;  1CKN A;  2OLS A;  4HR7 A;  4DK6 C;  1S5D D;  1B9N A;  1LYL A;  4DR6 H;  2PW5 A;  3MFH A;  2Q2U A;  2J4X A;  1PH7 A;  5KFX A;  2CH4 W;  4FBT A;  2VQE H;  2VUM A;  4JG2 A;  3ULJ A;  5C3E H;  4JBW A;  1AZP A;  3CF5 A;  2YCH A;  2MNA A;  4I55 F;  4HAE A;  1JJC B;  5GON F;  4X66 H;  3LWE A;  3T1H L;  1CTM A;  1B2T A;  4O3N A;  4DR1 L;  1OXX K;  3TIG A;  4ECZ A;  3N8D A;  3NTK A;  4JV5 L;  2SNM A;  1CKN B;  4HR7 B;  2JQO A;  5JEA H;  2WIN B;  1RIP A;  4A3K B;  1N9W A;  1IBL Q;  3X3N A;  3GID A;  3BDL A;  4BBR B;  1YJW A;  4HJ5 A;  3U50 C;  2VUM B;  2AGQ A;  4OHJ A;  2BE5 D;  2N55 A;  3ER0 A;  1DOK A;  3R93 A;  1PYW D;  5AFW A;  1FKA H;  1R9T B;  4TQU S;  4RGN A;  4J0M A;  2Q8I B;  1B8A A;  3JRX A;  3VPB A;  4JI3 H;  4DV1 L;  2UUC H;  4EQP A;  4Q5V A;  3HKS A;  1RJP A;  1WH2 A;  5M9O A;  2WDT A;  2HJW A;  4B9X A;  3T5K A;  1G2T A;  4O1N A;  1F9R A;  4YY3 H;  3C46 A;  1DYQ A;  1B50 A;  1XTC D;  1RL2 A;  4A3D B;  4OXP A;  4L6T B;  4OWX B;  4KK7 A;  3SHL A;  4ID6 A;  1M0W A;  3GTG A;  1T94 A;  3HOX B;  1PRT B;  5C4X H;  1QZG A;  4DR6 L;  1HNW H;  4I65 A;  2YW2 A;  2F3I A;  2IX1 A;  1ET9 A;  2D0O A;  1RF2 D;  2VQE L;  3R2T A;  4Y7N B;  4QW9 A;  3P20 A;  4UP7 A;  4JI1 Q;  3QB3 A;  4JI4 L;  2WKD A;  2UVR A;  1BVS A;  1H9S A;  4J9K A;  1Y8P B;  2JK8 A;  4X66 L;  1KJ8 A;  1WOC A;  2XNA C;  1YJN A;  3CKI B;  1EHI A;  5KFD A;  1HHV A;  1TWH H;  5IE8 A;  2LMC B;  3A5Z B;  3GTG B;  4APM A;  3Q8P B;  3GTL A;  5D1O A;  2WYO A;  2JA8 H;  3I91 A;  2F0T A;  5EAY A;  4OO1 H;  4XYL B;  1ENA A;  5KFV A;  3K3V A;  3HOZ G;  1SR3 A;  5IYB H;  2EYH A;  1RK6 A;  2NVY A;  1S5E D;  2YU9 A;  2VQD A;  5J3B A;  4XIG S;  5KG3 A;  1Y14 B;  2BE5 C;  1BQQ T;  5LOV F;  3GTJ A;  2R93 A;  4H7B A;  4G4K A;  3DWP A;  4IUT A;  3PUY A;  2UUC L;  3AB9 A;  3BVM A;  1XNR Q;  2PNH A;  3CCE A;  3GTL B;  4WJ3 M;  5D1O B;  3RB6 A;  1CQV A;  5M3M B;  1M8A A;  2YYZ A;  2E5L H;  2CFM A;  3BZD B;  4YY3 L;  2NVY B;  4IRK A;  5FLX E;  3SGI A;  2Z9H A;  5JVG 3;  5G3L F;  3CCL A;  2C9O A;  2YU9 B;  1GKH A;  5DG8 A;  4K2L A;  2JA7 H;  1ENF A;  2F0S A;  4CJ1 B;  1HJP A;  3E0J A;  2VY3 A;  3GTJ B;  2R93 B;  4LFB Q;  1VQN A;  4DR7 Q;  3CPW A;  5CV9 A;  1TA8 A;  1X3G A;  4DR4 Q;  4DV3 Q;  1KNE A;  1RTN A;  2HQE A;  1VAJ A;  1RYR A;  4OX9 Q;  1HNX Q;  5EWE A;  4JI2 H;  3FKI G;  1KNA A;  3MAQ A;  1D5X C;  4O0A A;  2HUG A;  5E7N A;  4HJ9 A;  1G6P A;  2N3S A;  4PWQ A;  5GAE C;  1VQK A;  4JI7 L;  4IO9 A;  4N9P A;  3RJ0 A;  4LUO A;  3W1G A;  2E2I H;  2RA4 A;  3DM1 A;  2J7Z A;  1JR0 D;  1PRT C;  1SND A;  3TRE A;  4DK0 A;  2YS6 A;  2B29 A;  1S03 G;  3S1N B;  1CUK A;  1S72 A;  3QO2 A;  5G3L D;  3DWA A;  5KNB A;  3S2H B;  2FJ2 A;  4YWK A;  3K58 A;  3J81 L;  1CI3 M;  4BWS C;  4MV1 A;  1V8Q A;  1KAA A;  5C3X A;  3V05 A;  1KRT A;  4A3F H;  1HTL D;  4MIU A;  5BN3 A;  3D4W A;  3R8B A;  4RKB A;  1N34 Q;  1X55 A;  2E5L L;  1Y1V A;  4C5C A;  3RBD A;  1LV9 A;  4YP3 A;  5JVH 3;  3K7A H;  5KT6 A;  1Z9F A;  4BBR H;  3HXL A;  2FB9 A;  3S17 H;  1JE4 A;  4FS2 A;  4H0L C;  3RLF A;  3PW0 A;  2W57 A;  2NVQ B;  4KLK A;  1R9T H;  2IL8 A;  1BXR A;  4LFC H;  5L9X A;  2I5M X;  2HQL A;  3O13 A;  2AQ3 B;  1ZQ7 A;  5FLM H;  1F2Y A;  1Y1V B;  4C56 C;  4JI2 L;  5BPH A;  5KG2 A;  4HJA A;  5E1F A;  1H9J A;  1I5F A;  2O2L D;  1FJG Q;  5HUR A;  2HT1 A;  1VF7 A;  4S3S A;  3Q23 A;  5DLF A;  4HJ8 A;  3D4R A;  3K57 A;  1GSA A;  1WTH A;  4DV4 Q;  3H6M A;  3M3Y H;  3BG5 A;  1BBX C;  1AW7 A;  1SE4 A;  3EVQ A;  2RKS A;  4H02 A;  3NHH A;  5LMN Q;  4DV6 Q;  4YBZ B;  2W6N A;  1H9K A;  1QVF A;  3PIP 3;  3HOY B;  1ONL A;  3KUP A;  2ALY B;  1CKM A;  4X64 Q;  2ASD A;  3U4Z A;  4CGY B;  1UEA B;  2EQS A;  4MV8 A;  1CE8 A;  1EZ8 A;  1V51 A;  3KJO A;  1EY4 A;  3H3V H;  4BY7 B;  2JA8 G;  4WFN 3;  1E4G T;  2OTJ A;  4JYA H;  2RGR A;  2EJM A;  2SNS A;  4QWB A;  4ZUJ A;  4LF9 Q;  4RNO A;  4BY1 B;  2FHT A;  1WR2 A;  1EWI A;  4IUU A;  1S10 A;  5KFJ A;  1BBW A;  1M7J A;  1GSO A;  3CXC A;  1TT2 A;  4RB0 A;  1NNX A;  1WTQ A;  2GLT A;  1RDP D;  1JMC A;  1HUM A;  5KFH A;  1SLJ A;  2R8J A;  3OTO Q;  1GM5 A;  4ED1 A;  3HOV G;  4HCS A;  2DNC A;  2X6G A;  1K1Q A;  2HGS A;  4G7O C;  1TKW B;  3HOU B;  4IPG A;  4YR3 A;  1SYX B;  4UY8 C;  4KJO A;  4PQX A;  1GUS A;  5M3M H;  1R4Q B;  4UDU C;  1GGO A;  4NXN Q;  3HB9 A;  3GV8 B;  2VQF H;  2MHV A;  2V5A A;  1SYB A;  3GV3 A;  5EWG A;  2SDF A;  5CV7 A;  5KFS A;  2JP1 A;  1CKO A;  2R7Z G;  4X3U A;  2K1B A;  3S15 B;  3D3R A;  3MEH A;  4A3G B;  2YL2 A;  1SYF A;  2QDL A;  2FK2 A;  2NU8 B;  1B04 A;  1IBK Q;  2UU9 H;  1QOH A;  4EX5 A;  2IP4 A;  1E2V A;  1K3B C;  3J80 c;  1PH6 A;  2OT2 A;  3H4D A;  4N8X 1;  4DV5 H;  1E22 A;  4JOI A;  5KFI A;  4I7Z C;  4EQO A;  3M7N A;  3JRW A;  4RGT A;  2W7P A;  3QJY A;  4FDB A;  1I7N A;  1QE6 A;  4JYA L;  1NMG A;  1X3P A;  4DR5 H;  4C3J B;  3D8G A;  4RHR A;  4ZCK A;  4U67 3;  1TWC B;  3TII A;  5HY6 A;  4TSS A;  3UDX A;  4LF5 Q;  1Q3L A;  1TWA H;  4KKS A;  1J8I A;  3P75 A;  1JOR A;  5J2U F;  1BDO A;  4O3Q A;  1N32 H;  2ZM6 Q;  3GTK H;  2MJ8 A;  2N8N A;  5C0X I;  3NUC A;  1K9M C;  4IAL A;  3S1N H;  1VQ7 A;  4ODG A;  3TBI B;  1A6X A;  3F8T A;  4WJ4 A;  2XIW A;  3S2H H;  1HCZ A;  1I6V C;  3GP7 A;  2LY7 A;  3TSS A;  5IGD A;  2YRW A;  4GLX A;  1DV1 A;  2EYJ A;  4J9N A;  4ZHQ F;  1A2T A;  4R8U A;  1BCP F;  4KKT A;  1F9S A;  1I4Q A;  1XXG A;  5F9L A;  2GPS A;  4XXE A;  4BXX H;  1XYI A;  2KCC A;  2DUD A;  1UE7 A;  2HD3 A;  5IIF A;  5D1P A;  1E2Z A;  1NCV A;  3S14 H;  3A74 A;  3FEW X;  1B6S A;  2K5V A;  3NQT A;  4P74 A;  3BQ2 A;  5FLM G;  1TQO A;  1HNZ H;  3DUZ A;  2UU9 L;  1B7Y B;  4U68 A;  4DV5 L;  3R3O A;  1SE3 A;  4ZQ3 A;  4R8U B;  4A2A A;  5KFO A;  5JQW A;  4DV0 Q;  5I9P A;  1Y1V H;  4HCE A;  5AJ3 Q;  1Y1W G;  1STY A;  5KFR A;  2R7N A;  2JN4 A;  3MA2 B;  3M4Q A;  1HQM C;  3GTO H;  3GII A;  2LS0 1;  3JAM i;  4FYD A;  4EVO A;  4CJ0 B;  4DR5 L;  3RNU A;  3K3P A;  4GC6 A;  4CDD C;  1STH A;  1MSG A;  2K33 A;  4L63 B;  5C44 B;  1BUV T;  3I70 A;  3PF5 A;  3T5J A;  1CHQ D;  4WD3 A;  4L5T A;  4KD3 A;  3KFU A;  1ZYR C;  3RLN A;  3CQZ H;  1N32 L;  1BCP D;  3BVZ A;  2JSO A;  2PN1 A;  2EIF A;  5C4H A;  3PUZ A;  1IYV A;  1HQR D;  4ZYS A;  4EQ5 A;  5IWA H;  1J5E Q;  2CW7 A;  1OXT A;  4A3M G;  2A19 A;  1QUQ A;  5KFA A;  1IZ6 A;  2GVA A;  5K36 G;  2JA5 H;  3WWV A;  4DUY Q;  3CCM A;  4JI8 Q;  5A2Q W;  4L5Q A;  4B3S H;  1HPC A;  2F0L A;  1LAC A;  1DOL A;  1H9M A;  3K5I A;  5EKK A;  4YIJ A;  1JWS D;  4AQY Q;  1C8C A;  2NN6 I;  3EQL C;  1A3U A;  3CCQ A;  3BDO A;  3GLK A;  3M9M B;  3KHH A;  4MV7 A;  1CA6 A;  3BVG A;  3RV3 A;  1G2S A;  4JOI C;  4DV7 H;  4EEY A;  1QUQ B;  2F1M A;  1X3F A;  4FXG C;  3FHW A;  3VA7 A;  2XRQ D;  3N52 A;  1I6U A;  1TAE A;  3KHG A;  2ATW A;  3R2I A;  1I94 H;  1IBL H;  1IW7 D;  1KQS A;  3C0F B;  2ICE C;  4F88 A;  1MSH A;  4R4T A;  1X32 A;  3F2C A;  2I5L X;  4LF6 L;  1S4Z A;  5M5X H;  2BA1 A;  1C9O A;  4PZ6 A;  4A4I A;  1EYA A;  4A3E H;  1KEE A;  1I4P A;  3CRL C;  2SEB D;  2Z6B A;  4X62 Q;  3S15 H;  1LT3 D;  2D5D A;  3F2B A;  1PTO F;  4M9U A;  3EYY A;  2EE1 A;  4QIW A;  1U4M A;  5ELC A;  5CB4 F;  1FL0 A;  1HZC A;  2WE6 A;  1EUC B;  5JVL A;  4JBK A;  4A3J B;  2B8F A;  4GN4 B;  3T1Y Q;  4K2K A;  1WTX A;  2UVW A;  3SK8 A;  4DUZ H;  3BQ0 A;  4YHH L;  1LTT D;  2HHH Q;  1DGS A;  3TRZ A;  4HID A;  3NWS A;  3K81 C;  5EGT A;  3I4M G;  2BH8 A;  5D65 A;  1G51 A;  4B3S L;  3DF7 A;  3RBE A;  1TWC H;  1EEF D;  4P71 A;  1NMF A;  1MJE A;  1W2B A;  4PDB A;  4HNT A;  1PMR A;  4QIW B;  2Z6K A;  4QUF A;  3Q1K A;  2AWO A;  3M4Y A;  3GTM H;  2WII B;  2R7K A;  1CA5 A;  1EYG A;  1EY6 A;  4POG A;  2BDO A;  4DV7 L;  2KHI A;  4MV6 A;  1I3Q A;  3MTS A;  3PMF A;  1HR0 Q;  1XNQ H;  3V4Z A;  3MC0 B;  4HED A;  5LL6 b;  1GHJ A;  2XCL A;  3AYH B;  2YTV A;  4FNF A;  1B53 A;  1PTO D;  1I94 L;  3IN5 A;  3DEO A;  1IKM A;  1WI5 A;  4MZ9 A;  5LMU Q;  3M4P A;  5IT9 L;  1KL9 A;  2A6E D;  1FNW A;  3ORR A;  5KEE A;  2V9W A;  2PCF B;  4K6D A;  1PXU A;  3OMC A;  3KLS X;  3KXY T;  3J80 i;  1I3Q B;  3CRK C;  2NZH A;  1GHK A;  4JBM A;  2C5C A;  3K0X A;  1XNR H;  2MCT A;  4IOC A;  4HNU A;  3NBI A;  2JEA I;  5I2X A;  4MTN A;  3H0G G;  3P1H A;  1Q90 A;  3QFF A;  1E7Z A;  4LK1 C;  4LFA Q;  2NU7 B;  4DUZ L;  2NB0 A;  5HGT A;  2B63 H;  4NP5 A;  3Q8R B;  3U4V A;  2PMZ A;  5A35 A;  3G6Y A;  2OXP A;  4I4T F;  1FGU A;  1RTO A;  2F0D A;  5ISR A;  4LFB H;  1O75 A;  1YNN D;  1ASY A;  1LLR D;  2K5N A;  4JVZ A;  4DR7 H;  1A15 A;  1CZG A;  4DR4 H;  1N56 A;  4DV3 H;  1XMQ H;  4ZOL F;  3HZX A;  5DGB A;  4DAP A;  3OMG A;  4TKO B;  2IY5 B;  1WYD A;  3OHB A;  4DAV A;  2EYL A;  3G6J B;  3M85 A;  1KD1 C;  3HBL A;  1ZKO A;  5M5W H;  1XPO A;  1XNQ L;  3N43 B;  1TS2 A;  2RSN A;  3S24 A;  5H1S E;  1X6O A;  3HOW H;  4L1K A;  4KD4 A;  2W7O A;  1N33 L;  4X3S A;  5JOB A;  5GAG C;  1KLG D;  3S2D H;  5LXT F;  1CM9 A;  4F4Z A;  5E3F A;  4MV9 A;  3ONA B;  1V1Q A;  3RN5 A;  4QJF A;  1KC8 C;  5KG1 A;  5H80 A;  4IPD A;  5LL6 X;  1Q1E A;  3NGD A;  1L2F A;  2F0P A;  4K14 A;  1L0Y B;  5COY A;  4CKC A;  1TWH A;  3MWE A;  4IRD A;  1WTP A;  1BXT A;  2IBK A;  1GD7 A;  1N34 H;  1HFN A;  3U9S A;  2L15 A;  1SJE D;  2DGY A;  2W6M A;  2YZN A;  1NJI C;  3RGZ A;  3V4S A;  3PO3 G;  3Q8D A;  4LUV A;  1S9F A;  4XZ3 B;  1LT6 D;  4WJW A;  1EIY B;  2Z6K C;  3KF6 A;  5C3W A;  3TZD A;  3G8C A;  4DXF A;  4DN4 M;  1PA6 A;  1O7Y A;  3D31 A;  4KHZ A;  4DR4 L;  2XIG A;  1XMQ L;  2O5J C;  2V4Q A;  4BWG B;  1TWH B;  1YHB A;  2JA6 G;  3NQI A;  4F4W A;  4YB8 B;  3KLR A;  3K5O A;  1YI2 A;  3H94 A;  1VKZ A;  3MWY W;  2JA8 B;  1OWT A;  4G7Z C;  4DNR B;  3D4D A;  5KND A;  2OTL A;  1RHP A;  2DWC A;  2L55 A;  3KF6 B;  4DR3 Q;  4J9R A;  4DV4 H;  2JA7 A;  4LF8 Q;  1KDB A;  1V4Y A;  2XCP A;  3HOZ H;  2L9H A;  5DAU A;  2UXC Q;  3CME A;  5BR8 L;  3T5H A;  1O78 A;  1PTO H;  5DM7 3;  1KIX A;  1U0L A;  2VZA A;  5IYD G;  3I73 A;  2ASB A;  4DV6 H;  1HFG A;  3ERO A;  2ZXO A;  2R86 A;  3HGB A;  5M3F H;  1N8R C;  4Q0F A;  1Q46 A;  4RGM A;  4AYB E;  4X64 H;  4B3M Q;  4JI5 L;  1SNQ A;  2PQA A;  4JCV E;  2NZO A;  1FVI A;  1V43 A;  2JA7 B;  3LGJ A;  1F77 A;  2XWJ B;  2NVX H;  4RCO A;  5CA1 F;  2PPB C;  2R7Z B;  1GYF A;  2E8G A;  2FXQ A;  2E2I A;  5I6W A;  4ULL A;  3Q0A A;  1B33 N;  2EYP A;  4J8Q A;  4K0K H;  1RJT A;  2FLP A;  2W71 A;  3OTO H;  4FXK C;  2UXB H;  2PQA B;  2IW3 A;  2CQA A;  4OWT B;  4HQ6 A;  2ZJR A;  2FLN A;  3FKI H;  2ENB A;  2BCO A;  4HMI A;  1WCM G;  2AMC B;  1S0M A;  2ZDQ A;  3I12 A;  5T1I A;  5A2Q L;  1DCZ A;  4NXN H;  1DIK A;  2E2I B;  2BQ3 A;  2X0S A;  2RDI A;  1RK5 A;  3MXU A;  2E2D C;  1EZ1 A;  4Q44 A;  2R7F A;  1GO3 E;  4P2C B;  5EKL A;  3RB3 A;  2I0Q A;  3J7Y W;  2HVS A;  4E6I A;  2B3G A;  4OEM B;  1R9T A;  2WKC A;  4QF4 A;  2HVQ A;  2R6F A;  1E1T A;  5C0X J;  1II3 A;  4JK1 C;  4M1U B;  4QL5 A;  4A3F B;  2WP8 J;  1SEI A;  1M90 C;  2DZD A;  1YNJ D;  1K8O A;  1JJG A;  1PFS A;  3I90 A;  3K7A B;  3UQ8 A;  4GLV B;  3HOW G;  1PH9 A;  2L0C A;  1TY2 A;  3HG9 A;  3R5X A;  2BDN A;  3S17 B;  2CH4 A;  4C3H G;  4IPC A;  5D14 A;  2C22 A;  1JOQ A;  1DV2 A;  4LF5 H;  4XT3 B;  2XSC A;  1HA5 A;  1ML0 D;  1MHW C;  3QZ8 A;  4CDF C;  1M6V A;  4MTE A;  4K0K L;  1AN7 A;  4MAM A;  1MD2 D;  5JAV A;  1D7Q A;  5CBA E;  2UXB L;  3VR6 A;  2FPI B;  3R5H A;  1K83 A;  3PQI A;  5FOB B;  2SCU B;  5I47 A;  3NTI A;  3M4O H;  4RB2 C;  1LTB D;  1PFN A;  3JAM L;  1AH9 A;  2SOB A;  3GO5 A;  5JPM C;  5EPJ A;  3M3Y B;  1NAP A;  4JI0 H;  3RAQ A;  4GKK Q;  2XVS A;  2RGV A;  1NY4 A;  3BG3 A;  1Y8N B;  3MFG A;  2F0K A;  4NXM Q;  2UXD Q;  3S1Q H;  5KFP A;  1G91 A;  5FLX c;  1W6K A;  5CMD A;  3S1M H;  4XX0 B;  1G6Z A;  3UDF A;  3CPF A;  5FO8 B;  1K83 B;  2CQY A;  4O4L F;  2PI2 A;  2PVP A;  1EQR A; 
#chains in the Genus database with same CATH homology
 3KJO A;  3H3V H;  2UU9 Q;  2JA8 G;  4AH6 A;  3W1B A;  2OTJ A;  4BY1 H;  2K75 A;  4LFB L;  3CW2 C;  4DV5 Q;  4LF9 Q;  4DR7 L;  4HIK A;  2MO1 A;  3I4N G;  1IYJ B;  1EWI A;  4DV3 L;  3RR5 A;  1BBW A;  1N36 Q;  1VQD A;  3BZK A;  3HOU G;  3CXC A;  3I2Z A;  4GOP B;  1K8A C;  3PCO B;  3CMA A;  4OX9 L;  1HNX L;  1MJC A;  4PG3 A;  5GAH C;  4DR5 Q;  4LW1 A;  1JMC A;  4IFD J;  4PMW A;  1UE1 A;  1SLJ A;  4NPS A;  1Q86 C;  5JJK A;  3OTO Q;  5M3M G;  1GM5 A;  1P8L A;  5IY0 A;  3HOV G;  3HOU H;  1LTL A;  1XTD A;  2OQK A;  3ERS X;  4LF5 L;  4UP9 A;  5M3F G;  4XTC S;  4IPG A;  1N32 Q;  2RHQ B;  2ES2 A;  3HKZ G;  4R4I A;  4UY8 C;  4A3G G;  1QZH A;  4JI3 L;  1A0I A;  1HZB A;  1NTG A;  5M3M H;  3HOV H;  4NXN Q;  4KHP Q;  4C3I H;  4JI6 Q;  3MXN B;  4GS3 A;  2AWN A;  2LXK A;  4A3G H;  1C7Y A;  1CKO A;  1E24 A;  2R7Z G;  3HFZ B;  3K7U C;  3U58 A;  1KRS A;  2MQH A;  3GDE A;  4JI0 L;  4MNO A;  1X56 A;  2WAQ G;  1IBK Q;  4EX5 A;  1L1O A;  3J80 c;  1HNW L;  1PH6 A;  1EOV A;  1N34 L;  2CKZ B;  2Y0S G;  1E22 A;  4JOI A;  2R7Z H;  2K52 A;  2WFW A;  1TXY A;  3UE1 A;  3M7N A;  1SRO A;  3BJU A;  3CAM A;  3AFQ A;  2KEN A;  1IXR A;  4C3J H;  2MFI A;  4FDB A;  2MO0 A;  2C35 B;  4JYA L;  1NMG A;  1MIU A;  1L0W A;  1XJV A;  3I55 A;  3CCV A;  1UE5 A;  4OON A;  4PZ8 A;  2R92 G;  5HY6 A;  4LFC Q;  2CCZ A;  3UDX A;  1W3S A;  1VQM A;  1PH8 A;  4LF5 Q;  4DK3 C;  2ZJP A;  1XMO Q;  1L1O B;  1TWA H;  2YTX A;  2UUA Q;  3PIP A;  2N49 A;  2QEX A;  2ZM6 Q;  1PHJ A;  3GTK H;  3PSI A;  2N8N A;  5C0X I;  4DV2 Q;  1VQ8 A;  4LF4 Q;  1Q12 A;  1K9M C;  3J81 i;  1FJG L;  1VQ7 A;  4LF6 Q;  1K3R A;  1SN8 A;  3G4S A;  3OW2 A;  1HR0 W;  2R92 H;  3F8T A;  3DLL A;  5GAD C;  3RZO H;  3S2H H;  4WJ4 A;  4BXX G;  5IP7 G;  4DV4 L;  4GLX A;  2VNU D;  1PYB A;  3BU2 A;  3TQY A;  3HKZ E;  4LF7 Q;  5LMN L;  4DV6 L;  3G71 A;  4YWL A;  1YHA A;  1A62 A;  1D8L A;  5M5Y H;  4DR2 Q;  4NXM L;  1OXS C;  4GKK L;  4BXX H;  4GN5 A;  4C2M H;  5IP7 H;  1K73 C;  3KYH C;  1M1K C;  2UUB Q;  2UXD L;  3KF8 B;  4YHH Q;  5JEA J;  2DUD A;  4RMF A;  3TS2 A;  1UE7 A;  1ASZ A;  4X64 L;  3PV0 A;  3S14 H;  2OWO A;  3EN2 A;  4DPG A;  3A74 A;  4JC0 A;  4GOP C;  2OCE A;  2K5V A;  1Y1V G;  4P74 A;  1KAW A;  4B3S Q;  1PV4 A;  3NEN A;  4JI8 L;  5IYC G;  4LWC A;  5FLM G;  1X9N A;  2UU9 L;  2R6G A;  4UP8 A;  2WAQ E;  4B3T Q;  4OWW B;  3JC6 6;  3KOJ A;  1B7Y B;  2WB1 E;  5C44 G;  4DV5 L;  4QIW E;  4LF9 L;  4A76 A;  2Y0S E;  3PGZ A;  1K0R A;  4GLA C;  5C0X G;  3GD7 A;  1Y1V H;  4DV0 Q;  5IYC H;  5AJ3 Q;  1Y1W G;  1LM0 A;  1N36 L;  2ZJQ A;  3CC7 A;  3M4Q A;  4GN3 B;  4DV7 Q;  3GTO H;  4QQB X;  1YBY A;  1BKB A;  3JAM i;  4DR5 L;  5C44 H;  3RNU A;  1Q82 C;  2A8V A;  3S16 H;  1G29 1;  1YHQ A;  2AHO B;  1JT8 A;  3OTO L;  3GTQ H;  1X3E A;  3K80 C;  3PF5 A;  4A75 A;  1Y1W H;  4L5T A;  1OTC A;  4X65 Q;  1I94 Q;  3KFU A;  4YCW A;  1VQL A;  2HIX A;  3RLN A;  3CQZ H;  1N32 L;  1UE6 A;  3VDY A;  3S1N H;  2JA5 G;  2EIF A;  4BY7 G;  1EQQ A;  3PUZ A;  2Q2H A;  4NXN L;  1Q8K A;  2EXD A;  3STB C;  2VQF Q;  4EQ5 A;  4KHP L;  1J5E Q;  3G6E A;  1OXT A;  4A3M G;  4DKA C;  4APV A;  2A19 A;  1QUQ A;  1K83 H;  1IZ6 A;  2GVA A;  4X62 L;  5K36 G;  1EFW A;  4QY7 A;  3WWV A;  1QVC A;  4DUY Q;  4IPH A;  2JA5 H;  3L2P A;  2JJQ A;  1O7I A;  3CCM A;  4JI8 Q;  4L5Q A;  1P16 A;  4R4O A;  3UDG A;  1IBK L;  4A3M H;  1VQ5 A;  3T1Y L;  4DUZ Q;  3W5O A;  4L5S A;  3IRB A;  2CWA A;  3AFP A;  1I50 H;  4AQY Q;  2HHH L;  2NN6 I;  1L1O C;  2IT1 A;  3CCQ A;  4YWM A;  3FP9 A;  5GQO A;  3T1H Q;  4JOI C;  5JJL A;  1QUQ B;  4HIM A;  4DR1 Q;  1LUZ A;  1X3F A;  1VQE A;  4A3B H;  2K14 A;  3FHW A;  1AE2 A;  3ULL A;  3J81 j;  3PUV A;  3PF4 A;  2K50 A;  1Q1B A;  4BA1 I;  1VQ4 A;  4LFC L;  4QGU A;  2ATW A;  4A3E G;  1XMO L;  4POF A;  2UUA L;  1KQS A;  3K8A A;  4UPA A;  3CC4 A;  2ZM6 L;  5IT9 c;  4R4T A;  4DV2 L;  1PH3 A;  2PMZ E;  2VS1 A;  3BZC A;  2D62 A;  2VL6 A;  5FJ8 H;  2I5L X;  4R1J A;  3F2C A;  3TS0 A;  4A3J G;  4LF4 L;  1X54 A;  5M5X H;  4LF6 L;  2BA1 A;  1C9O A;  4PZ6 A;  4A4I A;  4A3E H;  2IHE A;  3PIO A;  1U5K A;  3KDF A;  2JEB I;  4DAY B;  4X62 Q;  1VQA A;  2RCN A;  5GRO A;  1YIJ A;  3F2B A;  4DV1 Q;  4YCU A;  1N33 Q;  3CCR A;  4A3C G;  1XPU A;  4A3J H;  1FL0 A;  4JBJ A;  4LF7 L;  1HZC A;  1VCI A;  1VQI A;  4JBK A;  1YIT A;  4DR2 L;  2NN6 G;  2WB1 G;  4GN4 B;  3T1Y Q;  2UUB L;  5ELO A;  1BBU A;  1VQB A;  4YHH L;  4A3C H;  2HHH Q;  1DGS A;  3TRZ A;  2RHS B;  4HID A;  2AKW B;  3K81 C;  2VW9 A;  2QA4 A;  3L0O A;  3I4M G;  2BH8 A;  4DR6 Q;  3CP0 A;  1G51 A;  4B3S L;  2F4V Q;  1A63 A;  3KDF B;  1HNZ Q;  1TWC H;  4PZ7 A;  4P71 A;  1NMF A;  1UEB A;  1W2B A;  1SFO H;  1MJE A;  2VQE Q;  4B3T L;  3E9I A;  2Z6K A;  2KCM A;  1XNQ Q;  2AWO A;  4Y52 H;  3F2D A;  3GTM H;  1WJJ A;  4JI4 Q;  2Q2I A;  3J7A 5;  1EYG A;  2ZTE A;  4DAM A;  4DV0 L;  3I4M H;  1TWG H;  5AJ3 L;  1Z47 A;  4POG A;  1S40 A;  4TVA B;  2V1C C;  3CCU A;  5C4J H;  4DV7 L;  4B3R Q;  2KHI A;  1HR0 Q;  4B3R L;  4R4Q A;  1XMQ Q;  3PUW A;  3AYH B;  1E1O A;  2YTV A;  3UDI A;  2KBN A;  3CD6 A;  4X65 L;  1I94 L;  1WI5 A;  4MZ9 A;  5LMU Q;  3M4P A;  1KL9 A;  1VQP A;  1QVG A;  2ZTC A;  2RF4 A;  3I4O A;  1VQH A;  3RZD H;  1I3Q H;  3B6Y A;  5IWA Q;  2VQF L;  1VQG A;  1OXU A;  1VS0 A;  3DM3 A;  4KI0 A;  4R4C A;  3J80 i;  3CCJ A;  1YJ9 A;  1J5E L;  4BBS H;  2NZH A;  3JAM c;  4P72 A;  5BR8 Q;  1SRU A;  4JBM A;  3NBH B;  5C3E G;  2B63 G;  3K0X A;  2XTI A;  2LSS A;  4DUY L;  4ALP A;  4IOC A;  1IBM Q;  1CKN A;  4DK6 C;  1LYL A;  2JEA I;  1VQF A;  1H95 A;  4MTN A;  3H0G G;  4LUZ A;  4YY3 Q;  2Q2U A;  1PH7 A;  2OQ0 A;  1E7Z A;  2IX0 A;  4LFA Q;  4JG2 A;  3ULJ A;  5C3E H;  4JBW A;  4DUZ L;  3CF5 A;  4JI5 Q;  3U4V A;  2MNA A;  2B63 H;  4AQY L;  3AEV A;  1JJC B;  5JEA G;  4AIM A;  1VQ9 A;  1FGU A;  3H0G H;  2VUM G;  3T1H L;  1ASY A;  2K5N A;  4DR1 L;  1OXX K;  1YVC A;  4JV5 L;  1CKN B;  4A3K H;  2JQO A;  5IP9 G;  2KHJ A;  2IY5 B;  1J6Q A;  2VUM H;  1RIP A;  1T9H A;  1WYD A;  1N9W A;  1IBL Q;  3S15 H;  3KLW A;  3M85 A;  1YJW A;  3CCS A;  4HJ5 A;  3U50 C;  1KD1 C;  3PO2 H;  3ER0 A;  2Z0S A;  5M5W H;  1XPO A;  1XNQ L;  5IP9 H;  4JI7 Q;  1UWV A;  4OO1 I;  1JJ2 A;  2D0P A;  4TQU S;  4A3D G;  3S24 A;  5H1S E;  1X6O A;  1XPR A;  3HOW H;  1B8A A;  4BA2 I;  4IFD I;  2ID0 A;  4DV1 L;  1N33 L;  5GAG C;  1TWF H;  3HKS A;  3HOX G;  3ULP A;  3S2D H;  3D0F A;  1AE3 A;  4A3D H;  5C4X G;  2Q2T A;  4DNI A;  1V1Q A;  1RL2 A;  3RN5 A;  4A3B G;  3OYY A;  4OXP A;  4QJF A;  1KC8 C;  4A3L G;  4IPD A;  4OWX B;  3HOX H;  1Q1E A;  2K5H A;  1L2F A;  2E2H H;  5C4X H;  5LMN W;  4J15 A;  4ME3 A;  1QZG A;  4DR6 L;  3E9H A;  2F4V L;  1X65 A;  1GD7 A;  1HNZ L;  1K8G A;  2F3I A;  4Y7N H;  2IX1 A;  2L15 A;  4JV5 Q;  2D0O A;  4A3L H;  2VQE L;  4A93 G;  2DGY A;  5FJ8 G;  3AQQ A;  1NJI C;  1YEZ A;  2XGT A;  4UP7 A;  3Q8D A;  4LUV A;  4JI1 Q;  4B3M L;  4JI4 L;  3PO3 G;  3G48 A;  3I56 A;  1EIY B;  1BVS A;  4X66 L;  2JK8 A;  4OO1 G;  2Z6K C;  3KF6 A;  1WOC A;  1YJN A;  3L7Z C;  3GTG H;  5IYB G;  5HGQ A;  1HR0 L;  1TWH H;  4A93 H;  5IE8 A;  1PA6 A;  3D31 A;  4KHZ A;  3GTP H;  3A5Z B;  3PO3 H;  4DR4 L;  1XMQ L;  4IFD G;  1PH5 A;  1CSP A;  1YHB A;  2JA6 G;  4GNX A;  4JI2 Q;  2JA8 H;  5EAY A;  4YCV A;  4A3I G;  1YI2 A;  4L5R C;  2CQO A;  3HOZ G;  1SR3 A;  5IYB H;  4K0K Q;  5LMU L;  3CC2 A;  3I4N H;  2UXB Q;  5J3B A;  4HJ7 A;  4XIG S;  4O2D A;  1Y14 B;  2JA6 H;  2OTL A;  1VQC A;  1Q81 C;  3KF6 B;  5IWA L;  4DR3 Q;  4A3I H;  4LF8 Q;  3HOZ H;  3GTL H;  2UXC Q;  3CME A;  5BR8 L;  3J81 c;  1KIX A;  1VQO A;  3PUY A;  2UUC L;  1XNR Q;  4GKJ L;  1U0L A;  2VZA A;  2PNH A;  5IYD G;  3CCE A;  1IBM L;  1NE3 A;  2ASB A;  2JA7 G;  2R93 G;  4WJ3 M;  4GNX B;  2YV5 A;  2NVY H;  2YYZ A;  2YU9 H;  5M3F H;  2CFM A;  1N8R C;  4YY3 L;  1Q46 A;  1PYS B;  3E0E A;  3SGI A;  4AYB E;  4HIO A;  1PH1 A;  1PH4 A;  3KJP A;  3CCL A;  4LFA L;  1GKH A;  3A5U A;  4B3M Q;  4JI5 L;  5JJI A;  1YNX A;  5IYD H;  4P73 A;  2JA7 H;  2PQA A;  3GTJ H;  2R93 H;  4JCV E;  2NZO A;  3I7F A;  1FVI A;  1V43 A;  1HJP A;  4X66 Q;  2VY3 A;  3LGJ A;  4LFB Q;  4LNQ A;  3TEH B;  1VQN A;  1VQ6 A;  3ICE A;  4DR7 Q;  3CPW A;  1X3G A;  4DR4 Q;  2NVX H;  4DV3 Q;  3NEL A;  3UE0 A;  2E8G A;  2FXQ A;  1HNX Q;  4OX9 Q;  3FKI G;  2R7D A;  1VQJ A;  1IBL L;  4BBS G;  2H5X A;  5E7N A;  4O0A A;  3J7Z C;  1PH2 A;  1SMX A;  4HJ9 A;  1G6P A;  2PQA B;  2PI2 E;  2N3S A;  4OWT B;  5GAE C;  1VQK A;  4JI7 L;  2ZJR A;  4IO9 A;  1V9P A;  2HIV A;  2N78 A;  3FKI H;  1WCM G;  3STB D;  4JI3 Q;  2AMC B;  4LUO A;  3W1G A;  1YZ6 A;  3RLO A;  2E2I H;  2UUC Q;  4GKJ Q;  3TRE A;  1PVO A;  2B29 A;  3MEF A;  1Q7Y C;  1CUK A;  1S72 A;  1KXL A;  4A3F G;  2NVT H;  1WCM H;  1I6H H;  1JB7 A;  3A0J A;  1SE8 A;  4YWK A;  1KHI A;  4IOA A;  2R7F A;  1GO3 E;  4NB3 A;  4A3K G;  2CWP A;  2I0Q A;  4JI0 Q;  4IJH A;  4RG1 A;  4BBR G;  2B3G A;  3M9B A;  2E2J H;  1KRT A;  4A3F H;  2KCT A;  1HNW Q;  1A8V A;  1E1T A;  1N34 Q;  2BA0 A;  2E5L L;  5C0X J;  1X55 A;  3EBE A;  3PO2 G;  4QL5 A;  2WP8 J;  1M90 C;  5DLQ E;  3K7A H;  2JA9 A;  1Z9F A;  3H3V I;  1JJG A;  1EIF A;  4BBR H;  4IJL A;  1PFS A;  4JI1 L;  3RN2 A;  2NVQ H;  3S17 H;  4JYA Q;  4GLV B;  3HOW G;  1PH9 A;  3RLF A;  1C0A A;  4KLK A;  1R9T H;  4IPC A;  1IL2 A;  2ZTD A;  2I5M X;  2HQL A;  4P75 A;  5FLM H;  1S3O A;  4X6A H;  4JI2 L;  1JE5 A;  1E3P A;  3F1Z A;  2F52 A;  2LXJ A;  3NEM A;  4C3H H;  4HJA A;  1FJG Q;  1I5F A;  4K0K L;  2HT1 A;  1CSQ A;  4GNX C;  1EUJ A;  1D7Q A;  3HOY G;  2UXB L;  3S1R H;  4HJ8 A;  3EIV A;  1OXV A;  4AYB G;  1NBW A;  4DV4 Q;  3M3Y H;  3M4O H;  4DR3 L;  2QGQ A;  4LF8 L;  1AH9 A;  3GO5 A;  1GVP A;  2UXC L;  4H02 A;  1HZ9 A;  2IHF A;  2GVB A;  2YTY A;  5LMN Q;  4DV6 Q;  3H15 A;  1XNR L;  1MKH A;  3HOY H;  4GKK Q;  1NY4 A;  4NXM Q;  2UXD Q;  1QVF A;  2GN5 A;  3PUX A;  3S1Q H;  1WFQ A;  4GOP A;  2E5L Q;  5FLX c;  2JE6 I;  4BY1 G;  2ALY B;  2I5H A;  4JI6 L;  1CKM A;  2A1A A;  4X64 Q;  3S1M H;  3U4Z A;  1B70 B;  3UDF A;  1HH2 P;  2BH2 A;  1HZA A;  2EQS A;  3CPF A;  2K4K A;  5ELN A;  4BY7 H;  2PI2 A;  1EQR A;  3ZJY C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...