2R92G

Elongation complex of rna polymerase ii with artificial rdrp scaffold
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords RNA (5'-R(*UP*GP*CP*AP*UP*AP*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3
publication title Molecular basis of RNA-dependent RNA polymerase II activity.
pubmed doi rcsb
total genus 27
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2007-09-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2r92G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2r92G01
4H02A 1M1KC 3T1HQ 1K9MC 2WB1E 1VQCA 1NMFA 3J7ZC 1YBYA 3RNUA 3GTPH 3KFUA 2ALYB 4C3JH 3I4NH 2UUAQ 1I3QH 3KF6A 1A8VA 4PZ8A 4UP8A 3CCRA 1YJWA 4BA2I 2QEXA 4A3IH 1IBKL 2Z0SA 2VZAA 2UU9L 1N33Q 2PQAA 4KI0A 1VQ8A 4WJ4A 1B70B 1BKBA 1V43A 1VQPA 4FDBA 4HJ5A 2Q2HA 3PF4A 4LFBL 2E2HH 4JI0Q 2K5HA 2UU9Q 1L0WA 3UDGA 4DR3L 4LNQA 4GKKL 3S1RH 3PO3H 2DGYA 2GN5A 2GVAA 2L15A 2KCMA 3S1MH 2XTIA 1GKHA 1SROA 4GOPB 4A3LG 5C3EG 3PUXA 5IY0A 1I5FA 3I4OA 1X65A 2I5LX 4BBRG 1NE3A 4JOIC 1PH8A 3FKIG 1B7YB 1E24A 2IY5B 2OQ0A 4LF6L 2KENA 5M3FH 3BJUA 3HKSA 2UXCL 2AHOB 3GTGH 2A1AA 4LF6Q 1XPUA 1YITA 1YHAA 5IYCH 1XNRL 1PH9A 1EQRA 2H5XA 2UXCQ 2WAQE 4R4OA 5LMNW 4A3FG 1Q81C 4WJ3M 1E22A 2LSSA 3K81C 1SMXA 2HIXA 2N78A 1X56A 5IP7G 1GD7A 4NXNQ 1Z9FA 4UP9A 3S2DH 4DV4L 2K75A 3CC4A 1VQIA 1LTLA 1DGSA 1EIFA 2CWPA 3M3YH 4GOPC 2CQOA 4A3EG 3H15A 4A3FH 4DV4Q 1N36L 4IJHA 1Q82C 2WAQG 1S40A 4QJFA 1YNXA 4HIMA 1JE5A 5LMNL 2HHHL 4A3MG 1XMQL 1OTCA 4TVAB 4A3CG 1JMCA 1VQ9A 1BBWA 1KXLA 4HJ9A 5LMNQ 1D8LA 5C0XG 2LXKA 2I5MX 2NZOA 2CCZA 4UY8C 4Y7NH 4GS3A 1Q7YC 4P71A 4R4IA 2UUCQ 1VQAA 4POGA 3HOVG 4B3RL 2KBNA 5M3MG 5IE8A 1KD1C 4HJ7A 4BBSG 1YHBA 1J5EL 1CSPA 2AKWB 2R92H 5IYBG 1VQ5A 5C4XG 4X65L 1PVOA 4IPHA 1PFSA 3UDXA 1XMOQ 4DV3Q 1VQNA 2E2JH 4XIGS 5FLXc 3CCLA 3KDFB 1E1OA 1IBMQ 3J81c 1EIYB 1Y1VH 5IYDG 2ES2A 1EOVA 4JC0A 4X6AH 2WP8J 2XGTA 1KAWA 3CMEA 1CKMA 1KL9A 5GQOA 5E7NA 3NENA 1KRTA 4X66L 5LMUL 4DV7L 1YIJA 1XPOA 5FJ8G 3HFZB 4DV2L 1X9NA 4LF5L 2E8GA 1X55A 2Q2UA 1AH9A 5LMUQ 3UDFA 1HNXQ 2MNAA 3CPFA 4KHPL 4JI8L 4C3IH 3G4SA 1KQSA 3E0EA 3PUZA 3M4PA 3I55A 4B3SL 1Q1EA 1JJCB 1V9PA 3T1YQ 1V1QA 4LFCL 3W5OA 2AWNA 2R7DA 1C9OA 1LYLA 1CUKA 3H3VH 4ALPA 3KJOA 1VQFA 1VCIA 4TQUS 1VQHA 2AMCB 1PYBA 3SGIA 4JI3Q 2B63G 1P16A 5GAHC 1HH2P 3EIVA 3M4OH 1JB7A 3PO2G 1FVIA 2EIFA 4GN4B 1XNQL 4A93G 3HOZG 1H95A 5IWAL 2B3GA 5FLMH 2R93G 1SE8A 1R9TH 2YTXA 3PV0A 2VQFL 1IBLQ 3ULLA 1XNQQ 1HJPA 1TXYA 3MXNB 4PZ6A 2ASBA 3I4MG 3E9HA 1TWCH 4GKJQ 2DUDA 4NXNL 1PV4A 2VQFQ 3H0GH 4DV0L 1X3GA 3J81i 2NZHA 3CCQA 1L1OA 1PH6A 4JI6Q 4A3DH 1WJJA 3HOYH 2HIVA 5JJIA 1CKNB 2YTVA 2R93H 3BU2A 4DV0Q 4JYAL 1KC8C 4LFAQ 4IFDJ 1FGUA 3AEVA 2K50A 4L5TA 1N8RC 1WCMG 2ID0A 3GDEA 2ZM6L 4LF9Q 4DR2Q 4GLAC 1U5KA 4KLKA 1CKOA 3I7FA 2F4VL 4HIOA 1HZCA 3GO5A 5ELOA 2YU9H 1YEZA 2Z6KC 2VQEL 2ZJQA 1VQBA 1NMGA 2B29A 2ZM6Q 4HIDA 1VQKA 3ZJYC 2OQKA 2JA7G 1OXVA 3GTLH 1SFOH 3PGZA 3CD6A 3AYHB 1K0RA 3UE0A 3J81j 4LWCA 1Q1BA 3RLFA 4DNIA 4QQBX 2IT1A 3F8TA 4OONA 3TS2A 1OXTA 4BA1I 5H1SE 2CWAA 4AQYL 4NXML 5K36G 4IO9A 1VQ4A 2JA7H 1Q86C 2ZJRA 3JC66 3DLLA 2BA0A 2ZTEA 2F52A 1IBKQ 4B3ML 4L5SA 4JOIA 1UE7A 3K7UC 4DV6L 1LM0A 1IZ6A 2N49A 4BY1G 1TWAH 1QZHA 3S16H 4LFBQ 4B3MQ 1HNZL 3HOWG 2OWOA 4DR3Q 3PUWA 1G6PA 1IYJB 5GAGC 4R4CA 4GKKQ 4MTNA 3GTOH 2AWOA 4O0AA 2MQHA 4LF8L 4ME3A 2V1CC 3E9IA 1NBWA 2NN6G 2VW9A 4JBJA 4LF8Q 3M4QA 4JI1L 4L5QA 4UP7A 4DUYL 2E5LL 1WYDA 3IRBA 5C3EH 4DV1L 4A3LH 1VQGA 4LF7L 4GOPA 3WWVA 3PUYA 3S24A 4BBRH 3PSIA 3NBHB 3FKIH 4JI1Q 4DUYQ 2E5LQ 3AFQA 4DV1Q 4EQ5A 1XNRQ 2RHQB 2JA9A 2RHSB 3RN5A 4XTCS 1FJGL 4OO1I 3GTQH 1Y1WG 1AE2A 1UEBA 3CCSA 4O2DA 2D0OA 1TWGH 3EBEA 1K3RA 5IP7H 3RLNA 3LGJA 1N36Q 3ICEA 4YCWA 4P73A 1E3PA 4YHHL 2K4KA 3PUVA 2PI2A 2I5HA 4J15A 4DK3C 4DR5L 1YJ9A 1VQMA 1HNWL 1JT8A 4JG2A 3TQYA 4A3EH 3RZDH 4YHHQ 1XJVA 1PHJA 4DR5Q 2HHHQ 5C0XJ 1SR3A 4YCVA 1XMQQ 1HNWQ 4X64L 1OXSC 5JJLA 3UDIA 2JA8G 1N32Q 2K5NA 4A3MH 1U0LA 4B3RQ 2D0PA 3F2BA 4A3CH 3B6YA 1GO3E 4BY7G 3G6EA 4LW1A 1C7YA 1EYGA 1J5EQ 4P75A 3A0JA 2PI2E 2R6GA 3HOVH 4X65Q 3HOUG 4HJAA 3KOJA 5M5XH 1ASZA 5M3MH 1NJIC 4OX9L 4BBSH 2JA6G 1UE6A 5C4XH 4YWMA 5IYBH 5AJ3L 1NY4A 2BH8A 3FHWA 1EFWA 5C4JH 4LUVA 4QIWE 3F2CA 2A8VA 1EWIA 1KHIA 3CCVA 3S17H 1NTGA 3HOUH 1K8AC 3CMAA 1QVGA 4X66Q 1PH4A 4DV7Q 5IYDH 1K83H 1LUZA 3L7ZC 3ERSX 4YCUA 4DV2Q 4LF5Q 4OWWB 1S3OA 3CPWA 3U4VA 3CP0A 2NVQH 4HJ8A 3CQZH 1SN8A 1MIUA 4LF4L 2JEAI 4KHPQ 1QVFA 4JI8Q 5FJ8H 3GD7A 2JA5G 4LF4Q 4B3SQ 4DKAC 2WFWA 3RN2A 3G71A 4LFCQ 2K52A 2JQOA 1PH5A 5HGQA 1JJ2A 2ATWA 4DR4L 4A3BG 2Y0SG 1N32L 1TWFH 5IP9G 1VQEA 1RL2A 1VQJA 5IT9c 4A3JG 4DR6L 4IFDI 4OWXB 5IWAQ 2B63H 1BVSA 2YYZA 4X62L 1HR0W 3ULJA 4LUZA 5GROA 5JEAJ 3MEFA 3G48A 3PO2H 1I50H 2Z6KA 3OYYA 4YY3L 4IPGA 5IP9H 4JBMA 1PH7A 5HY6A 4JI2L 4C2MH 2IHFA 4KHZA 1ASYA 1VQ7A 4P72A 4A3JH 4YY3Q 1BBUA 3I4MH 1QVCA 4JI2Q 4R1JA 2VNUD 1L1OB 2I0QA 4JYAQ 3PCOB 3UE1A 1Q46A 2RF4A 4MNOA 3S1QH 2EXDA 3BZKA 3KJPA 1QUQB 1X3FA 2OTJA 3HOXG 1D7QA 2F4VQ 1CKNA 3RR5A 3U50C 2VUMG 4B3TL 3S2HH 2VQEQ 1HR0L 2Q2TA 1N9WA 4GNXB 1A63A 5BR8L 1WCMH 3FP9A 2NVXH 4OXPA 2C35B 4DAYB 1W2BA 4YWKA 3HKZE 5BR8Q 2PNHA 2JEBI 1YHQA 3L0OA 2YV5A 1RIPA 1GVPA 2MO0A 4PG3A 3CCJA 4AQYQ 4NXMQ 4IFDG 2ZJPA 4DR7L 3KF6B 3STBD 1A0IA 1S72A 1PH1A 3M7NA 1IXRA 1JJGA 4JBKA 3RZOH 4YWLA 2KCTA 4DR7Q 2PQAB 3RLOA 3K8AA 3GTJH 1G51A 4DV6Q 3VDYA 4A3IG 2UUBL 1HZAA 3CXCA 2UUAL 2N3SA 1HNZQ 3BZCA 3HKZG 1X3EA 4IPDA 3CCUA 2UUBQ 3ER0A 4P74A 3OTOL 1YZ6A 4IOAA 2UXBL 4GNXC 1QZGA 4BY1H 1N33L 3AFPA 5M5WH 3OTOQ 3PO3G 3HOWH 1Z47A 1YI2A 2R7ZG 4JI0L 1VS0A 2UXBQ 2FXQA 1OXXK 3J7A5 2IX0A 2QA4A 4RMFA 4AYBE 1TWHH 3CAMA 2WB1G 4JI5L 1GM5A 1W3SA 3KF8B 5M3FG 4LF7Q 4A76A 4DPGA 4EX5A 4C3HH 2R7ZH 3GTMH 4JI5Q 2KHIA 5IYCG 1MJCA 1WOCA 1MKHA 4APVA 4JI4L 2BA1A 3J80c 4A3KG 1FJGQ 4PMWA 5C0XI 2OCEA 4JI4Q 1IL2A 4Y52H 2D62A 3TEHB 4AYBG 2HT1A 4JI7L 3U4ZA 1KRSA 3U58A 1Y1WH 2VY3A 3S15H 4HIKA 1CSQA 4DV5L 1N34L 4A3KH 4JI7Q 3ULPA 1B8AA 2F3IA 1L2FA 4DAMA 4DV5Q 2JE6I 1YJNA 1N34Q 1VQOA 3S1NH 2MO1A 4AH6A 1UWVA 1I94L 2GVBA 1XTDA 1Q8KA 4X64Q 3K0XA 5J3BA 1KIXA 3PIOA 4IPCA 1I94Q 2CFMA 1HZ9A 2MFIA 2ZTDA 1K73C 2IHEA 3A74A 1EUJA 2A19A 4OO1G 2JA8H 3H3VI 2HQLA 1SRUA 3KLWA 5M5YH 3TS0A 2UUCL 2R92G 4PZ7A 1OXUA 4JBWA 5C44G 4OX9Q 4OWTB 5GADC 3CCEA 4BY7H 1K8GA 1HZBA 4BXXG 1VQLA 4K0KL 2JK8A 1Q12A 3J80i 5AJ3Q 3CC2A 3TREA 3JAMc 1XPRA 4A3GG 5JJKA 1WI5A 2N8NA 1Y1VG 4IOCA 2Y0SE 3KDFA 4DV3L 1XMOL 4K0KQ 2JA6H 2RCNA 3K7AH 4QGUA 3W1GA 3PF5A 4R4TA 5C44H 1IBML 3I56A 5EAYA 2E2IH 4BXXH 3D31A 1E1TA 2K14A 5DLQE 1MJEA 4A3GH 4IJLA 3K80C 4DK6C 1SLJA 3A5UA 1PA6A 5GAEC 3S14H 4QY7A 1T9HA 2LXJA 2R7FA 3W1BA 2KHJA 4A4IA 2VL6A 2CKZB 3TRZA 1X6OA 1EQQA 1HNXL 2JA5H 1UE5A 2NVYH 4DR4Q 2JJQA 1O7IA 1FL0A 2K5VA 3M85A 1WFQA 1C0AA 3T1YL 3PIPA 3CCMA 4R4QA 4JV5L 4DR6Q 4A3BH 5FLMG 4X62Q 4JV5Q 4JI3L 1E7ZA 2BH2A 3STBC 2VS1A 4POFA 2ZTCA 2OTLA 3GTKH 4QL5A 4A93H 1PYSB 4RG1A 2IX1A 2NVTH 1AE3A 3KYHC 2PMZE 3JAMi 1VQDA 3H0GG 4LUOA 4DR1L 1PH3A 4L5RC 1YVCA 4A3DG 1P8LA 3L2PA 1M90C 1IBLL 3HOYG 3NEMA 2UXDL 1J6QA 4GN5A 3CC7A 4DR1Q 4GKJL 3F2DA 1UE1A 1I6HH 3M9BA 2Q2IA 3OW2A 1Y14B 3CW2C 4JI6L 2QGQA 2UXDQ 5ELNA 4GLVB 4NB3A 4UPAA 2EQSA 3F1ZA 5JEAG 3Q8DA 3CF5A 1HR0Q 4B3TQ 4LFAL 1VQ6A 3HOZH 3D0FA 3HOXH 4GN3B 4AIMA 4LF9L 4DR2L 1QUQA 1PH2A 4DUZL 3I2ZA 2VUMH 4NPSA 3EN2A 1A62A 3I4NG 2YTYA 4MZ9A 4A75A 1G291 4GNXA 3NELA 3AQQA 4JCVE 1L1OC 3DM3A 4DUZQ 1X54A 4GLXA 2NN6I 3T1HL 3A5ZB
chains in the Genus database with same CATH superfamily
2DZDA 3Q0AA 4A3KB 2R7LA 1VQCA 3J7ZC 3FVQA 3RNUA 3KFUA 3S1NB 1TQOA 4YHHH 1A8VA 2HCCA 4FBTA 4BA2I 1ENFA 3FDSA 1CQIB 1IBKL 3J7AF 5KFAA 3V6KA 1N34H 2PZTA 2PQAA 3RUZA 1VQ8A 3VPBA 1VQPA 3OWFA 4HJ5A 4X64H 5BN5A 3HS0C 3RB3A 2K6AA 2R8KA 4PV1C 4ZYSA 2B39A 3BVZA 4DR3L 4LNQA 4EQOA 2JA8B 1G6ZA 2PW5A 4RAUC 2DGYA 2B2UC 2L15A 1SYXB 4DXFA 5C3WA 1PFNA 1I5FA 4BBRG 1NE3A 1SYBA 4JOIC 1KJJA 4O4IF 5D1OB 5KYLA 3T5HA 3EFXD 5BMVF 4OX9H 1CZGA 1I4PA 2B2VC 3GTGH 4HYKA 4LF6Q 1QCBD 1EQRA 4Q8FA 2H5XA 1EU4A 1SE4A 2WAQE 5LMNW 5LL6X 2K5WA 4ODGA 2ZXRA 3K81C 5KFCA 4NDXA 2FINB 5K5PA 4ED2A 3TZDA 2ZXPA 3Q6SA 2F0PA 3S14B 3I91A 3S2DH 1K83A 2BQRA 5C4HA 2CWPA 3M3YH 2B2WA 4GOPC 4A3EG 3CQZA 1SYGA 4IQZA 4A3FH 4IJHA 3LWUA 2YZMA 2WAQG 1D1KA 2D2CC 3BDOA 2AQ4A 1M4VA 1SYEA 1YNXA 5KFDA 2WKCA 1I4XA 1XMQL 3J7YW 3V6JA 3MA2B 4QMGA 4CHTB 3LMLA 4FBUA 4XT3B 1JDEA 1VQ9A 1V4YA 1D8LA 5C0XG 3H94A 1TWFA 4DR6H 2QDBA 5CV6A 1Q7YC 2V9WA 3NP8A 4FS1A 5M3MG 2XCAA 4HJ7A 4TRDA 1VQ5A 2L9HA 5FD6A 3J81L 4X65L 4R8UB 1GSOA 1KC7A 1U9RA 3VR2A 5EKLA 1OO9B 2V4RA 3WDNA 1E1OA 1O80A 3H0GB 4J6HA 4A3DB 4GC7A 4F4YA 2UXDH 5CYUA 2WP8J 1EU3A 4X66L 4DV7L 2R3ZA 3HXLA 3TSSA 2E8GA 1RD9D 4QWCA 1F9QA 3OSPA 1AH9A 3I90A 1VMCA 1ILQA 4O42A 4KHPL 2I8CA 2NVXA 2F0EA 4CDEC 3I55A 2F4IA 1SFOB 2WYOA 4K5VA 2EJFC 5D65A 3GTPB 3W5OA 3BDCA 2GLTA 1C9OA 2R7DA 4K6DA 1VQHA 1BCPB 3D4DA 2Z8LA 2WV6D 5CA0F 3PO2G 4GN4B 3HOZG 1H95A 2DIKA 2R93G 5J22A 4KHVA 2E2HB 1N33H 3ULLA 1XNQQ 2ASBA 1M6VA 5JPMC 1PV4A 2VQFQ 4DV0L 3CCQA 1PH6A 3HOYH 2HIVA 1EYAA 5JJIA 2FE3A 1FNVA 2AQ1B 5DNFA 3PR5B 1K0SA 1W6JA 5CC4A 4ZI7F 3AEVA 2ID0A 3Q8RB 2ZM6L 1WTHA 3X3MA 4G7OC 5EBCA 1CKOA 2L11A 3GO5A 2YU9H 1YEZA 2VQEL 3IKJA 5KFRA 3GTQA 2F3VA 3FEWX 4HIDA 2JA7G 1OXVA 3MXGA 3CD6A 1K0RA 3NE5B 3GQCA 3J81j 4LWCA 4DNIA 4QQBX 4OONA 1LTID 3TS2A 2B8GA 2I07B 5K36G 1VQ4A 1QE6A 1Y1WA 1K8OA 2W8LA 4TV8F 2BA0A 5FLXE 4DN4M 1O7YA 2VUGA 1UE7A 1LM0A 4DV4H 4YIJA 1VBGA 3S16H 1DCZA 2F0GA 1JQYD 4CJ1B 2OWOA 3KXYT 1IYJB 4R4CA 1K1SA 4MAMA 3NHHA 2AWOA 4Y7NB 2DLNA 3HG9A 1F2LA 1FR3A 1BNCA 1NR4A 4QWAA 4TV9F 2XRQD 2W9CB 4UP7A 1IW7C 2KCCA 5C3EH 4MV7A 1DONA 2E2JB 4TUYF 3LP8A 5HURA 3NBHB 2XNAC 4JI1Q 3TP5A 4DUYQ 1T3NA 3AFQA 4DV1Q 1XNRQ 2F0MA 1WSCA 5D1OA 2JA9A 1Y1VB 3C3LA 1HQRD 3A55A 1FJGL 4OO1I 3GTQH 3RD4A 1AE2A 1VF7A 5D8DA 1TWGH 2NWGA 5HBRB 2UVWA 3GV5B 3RLNA 1N36Q 1VMPA 4RWSC 4YCWA 4P73A 1E3PA 3ICEA 4IZOA 2K4KA 3PUVA 2PI2A 4DR5L 1YJ9A 2JXMB 3NTHA 1VQMA 4IWYA 4KK7A 1XJVA 1IW7D 2PQEA 1SR3A 4DA2A 1EL0A 3R2IA 4BWSC 3E6ZX 5KNDA 4B9XA 2R84A 1SAPA 1PYWD 3B6YA 3G6EA 4LW1A 1SNCA 1C7YA 3LNNA 3DWQA 2R6GA 3HOVH 2V4DA 4I7ZC 1PLFA 4ECSA 5J2TF 3KHGA 3MC0B 3K57A 2JYOA 4BBSH 4GKJH 1UE6A 5C4XH 1KBLA 2BH8A 5KT3A 2A8VA 4LUVA 5CGKA 2R82A 1KHIA 1G2TA 1TR5A 4R8UA 5JQWA 2RSNA 1HA6A 3KTMA 1O75A 1B2TA 5IYDH 1LUZA 3L7ZC 3Q23A 4LF5Q 4YCUA 4OWWB 4LFAH 1NSNS 3CPWA 3AMUA 5I9PA 2MPMA 2YS7A 4DR2H 1SN8A 3GTLB 4RZQA 5FJ8H 3Q8QB 3K6OA 3SK8A 1RTNA 4LF4Q 1JICA 3T1HH 1PXUA 4ETSA 4Y8VB 5ELBA 5KFQA 1ICFB 2JQOA 5D14A 5IT9L 1PH5A 5HGQA 1JJ2A 3CVZA 2I87A 2XRSD 2Y0SG 1LT3D 3J7AV 1VQJA 1EUCB 3K58A 5NUCA 1W93A 5KG7A 4A3JG 3GTPA 3KHLA 3MVVA 5IWAQ 2B63H 1TWAB 1OWTA 1BVSA 5C5LA 1IBKH 3UI2A 3MEFA 1I50H 2Z1CA 4V0BA 4RUCA 4DL2A 4JI2L 4C2MH 4KHZA 4X3SA 1AZQA 1XDNA 4DR3H 3QR8A 4YY3Q 1WTWA 1BBUA 3I4MH 2E2HA 3RFCA 4R1JA 3GLKA 2VNUD 1L1OB 4L63B 5KG6A 3UE1A 4FYDA 2RF4A 4F50A 4RH6A 3BZKA 1AEXA 2R7ZA 1QUQB 3C2PA 5C3XA 1BJTA 3I70A 2GA4B 4ED3A 4LJZC 4LF8H 4RNNA 2PVPA 2C2RA 3X3NA 1A63A 3VPDA 4IRKA 3ND8A 5CAEB 1S0OA 2W7OA 2R8IA 3R5HA 4YQWA 1BXTA 4DR7L 2KA7A 1A0IA 1CI3M 2R7KA 1PH1A 2MCTA 4OIJA 3MFGA 4JBKA 4DL5A 3GTJH 1Y8PB 3HEJA 1JWSD 1VAJA 4A3EB 2P0AA 3I72A 4ZOLF 1CTMA 3TIGA 3ER0A 4JK1C 1YZ6A 4GNXC 2F1MA 3UQ8A 1XMQH 3OTOQ 3OWEB 4RB3C 1TA8A 3EPIA 1GUWA 1Q90A 2Z6BA 5CB4F 1OXXK 3J7A5 3BG3A 4RMFA 4KJNA 4BS9A 2YCHA 4JI5L 1W3SA 5M3FG 4LF7Q 4EX5A 2R7ZH 3GTMH 5CV4A 4X65H 2O5IC 2KOLA 1HCZA 1MKHA 3Q1KA 2W9CA 1K8MA 4J9QA 4A3KG 3R2TA 5C0XI 5KNCA 3NBHA 3N44B 3TIIA 2D62A 4EBCA 4ABNA 2YRXA 3K7AB 1Y1VA 4X66H 4DV7H 1I4RA 3U4ZA 3S15H 1AZPA 5HGTA 1N34L 4JI7Q 3RBDA 4MA0A 2YS6A 2ALZA 4KHPH 2JE6I 1VQOA 1EEFD 5FOBB 3R93A 3KHRA 1STNA 1QILA 1Y8NB 4DXGA 2JA5B 3I12A 3PW4A 2MFIA 2FK3A 5F9NA 4R7RA 3P75A 4N9TA 1BBXC 5I47A 3Q8PB 2A19A 2OEOA 3H3VI 4IUPA 1XYIA 3LWBA 3KLWA 5M5YH 5JVH3 4PZ7A 4O1NA 3HOZB 2B8FA 5GADC 4BXXG 1HZBA 5AJ3Q 2VPSA 1S03G 1QWYA 1XPRA 3NSWA 3CRLC 1PTOB 2H4OA 1B53A 5C44H 3KLRA 2E2IH 5DAUA 3M9MB 4WRDA 3AU7A 4A3GH 4IJLA 5CV5A 1PA6A 5GAEC 2VQEH 2LXJA 3W1BA 3F8NA 2KHJA 2VL6A 2E75C 2K5DA 1S10A 5FO8B 3GTLA 5BR8H 3GV3A 1S5BD 1UE5A 5DG9A 4DR4Q 1F2YA 1O7IA 3M85A 2I80A 5KFGA 1MD2D 1LO5D 1D6EC 3PIPA 2KSWA 2DPIA 4M1UB 4A3BH 4QUFA 1STBA 3J80E 2RDJA 3D4RA 4X62Q 4JV5Q 1E7ZA 4G3IA 1GYFA 2VS1A 3GTKH 2VOBA 3VYTA 2F0SA 2JEIA 4DL3A 1AE3A 2PMZE 3SXHA 3H0GG 1WVLA 1TWAA 1HPCA 1LLRD 1MI2A 4A3DG 2V59A 5KG3A 2UXDL 2XCPA 3CC7A 3L4KA 2FLPA 2Q2IA 4ZKBB 5ELNA 2OH2A 2L12A 2L5TA 4H7BA 2LFNA 1HR0Q 1SE2A 1EYZA 3D0FA 3HOXH 2DPJA 4OEMB 1QUQA 2B2TA 4XZ3B 2KUMA 2VUMH 4NPSA 5C5MA 1A62A 2YYAA 1HQMC 1FJGH 1G291 4JCVE 1L1OC 4XYLB 1X54A 1EQQA 4H02A 1PX2A 1A2TA 3NWSA 4RNOA 1NMFA 1R4PB 2XGQA 1V1PA 4C3JH 5BN4A 3JAME 3C0FB 2UUAQ 3CCRA 4UP8A 4PZ8A 4DR5H 2J4XA 2N55A 1YJWA 1PMRA 1DV2A 2Z0SA 4KI0A 3N43B 1B70B 1JX4A 4HQ6A 3PF4A 3FDTA 4JI0Q 4K5XA 2UU9Q 4K6LA 1L0WA 1I94H 1L0XB 4CJ2C 4UCOA 4IAJA 2WAQA 5M9OA 3S1RH 3PO3H 1LTBD 4QWEA 1B6SA 3S1MH 2XTIA 1GKHA 1SROA 4GOPB 4IUTA 1Z2PX 4O3OA 1GHKA 4GZYC 2OQ0A 2E76C 2KENA 3A7AB 3JSLA 1TS5A 2FKLA 2A1AA 1KDBA 1YHAA 5IYCH 1XNRL 3VR4A 5L1JA 3RJ0A 2UXCQ 3VR6A 1LTRD 4R4OA 4WJ3M 4MV4A 1SMXA 2HIXA 5E4WC 5IP7G 4DV4L 2ASJA 4ECRA 4OL7A 1EIFA 1QB5D 2CQOA 1VBHA 4RNMA 3H15A 1N36L 4KY5A 3BVMA 2IW3A 3J81W 4KD4A 3I4LA 1UC9A 4QJFA 3BJYA 3W2DA 4HN7A 1NNXA 2BDNA 2Y0SB 4TVAB 4A3CG 1JMCA 1KXLA 4LK1C 5LMNQ 5KFBA 5EGTA 4UY8C 2I5MX 3W3AA 2CCZA 3N8DA 1I4GA 4HNUA 1SCUB 2F0LA 4POGA 4K2KA 2NVTB 3A8JE 2W6PA 3R23A 1Z6HA 4FXKC 5IYBG 2R92H 1VKZA 4IPHA 1I6HB 3GV8B 3OW7A 3EPGA 4KN4C 4IN3A 4F87A 4DR1H 2NTTA 2O03A 2QYZA 1N48A 3J81c 2RGRA 3RB4A 1BUVT 1EOVA 3HOYB 4TQSA 4FF2A 3MR2A 1KRTA 5E7NA 1EZ1A 5C4ZA 5F9LA 3HFZB 4LF5L 1HTPA 4Q8EA 1O7ZA 1X55A 2WTFA 3FMCA 5LMUQ 1HNXQ 2M2LA 2FB9A 4C3IH 1KQSA 4E6IA 3N6XA 2BE5D 4XQQA 2BR0A 1V9PA 1Z7TA 2WACA 3WO0A 3MFYA 1V1QA 3T1YQ 3I4NB 3NUCA 2YZNA 4DR7H 5JVDF 1LYLA 1CUKA 2DN8A 3H3VH 1I3QB 2MGSA 2EYLA 3OIPA 1PYBA 1LT5D 4JI3Q 5T14A 3A8KE 1P16A 2W6QA 4IWXA 5GAHC 3K0YA 4O3SA 3M4OH 1JB7A 2AU0A 2OT2A 2PZUA 4A2AA 5IWAL 1PZID 5FLMH 1WTOA 3T4AC 4FU0A 1EYCA 3PV0A 5I9OA 3Q2OA 1TXYA 4PZ6A 3E9HA 2QCPX 1XXGA 1TWCH 4XQNA 2DUDA 1C8CA 1RK5A 2EYFA 3J81i 4DNTB 1SYDA 4HTHA 2R93H 1LABA 3E0JA 3BU2A 2X0SA 4C1NI 2MJ8A 5M3FB 5CV9A 1WCMG 4P2CB 4GLAC 2Z4HA 5JEAH 4HIOA 1HZCA 5ELOA 2Z6KC 2ZJQA 4YR0A 1VQBA 2B29A 3OIQA 1SNQA 2OQKA 1JWMD 2OXPA 3ZJYC 4LF6H 2K32A 3ITPA 1SJED 2VPQA 1S0MA 2P5ZX 1OXTA 4BA1I 2CWAA 2KVMA 4IO9A 2B2UA 2JA7H 1TY2A 2ZJRA 4YAJB 3EYYA 4JOIA 3K7UC 2EYHA 1IZ6A 2N49A 4BY1G 5KG2A 1PRTF 2ZT9C 3MEHA 4L6TB 1QZHA 4B3MQ 4LFBQ 2B2VA 1EY0A 4PMCA 1X3PA 2NBFA 1MHWC 5KFXA 2SEBD 2MQHA 4LF8L 3V4SA 4ME3A 2V1CC 5CR3A 4Q0FA 4YP3A 2NN6G 1K3BC 4JBJA 4EGVA 5CBEE 3TINA 3Q22A 3MWDA 4A3LH 1VQGA 4LF7L 3E5SA 4GOPA 3PUYA 1GGOA 3HOVB 1EY6A 3FKIH 2E5LQ 1EEID 1KDAA 4HR7B 2OLSA 4BBSB 1BNZA 2XIGA 3CCSA 4O2DA 1VF5C 4ZQ3A 4R8NA 2TMPA 4LMQD 4DK3C 3OOCA 2I5HA 1MSHA 1HNWL 1A3UA 3TQYA 2PPBC 3RZDH 1IL8A 4YHHQ 1PHJA 3QB3A 2HHHQ 4YCVA 4Q0YA 1H9MA 1OXSC 1BXRA 1JOOA 1YNND 2K7VA 4XYQA 2K5NA 1N32Q 4A3MH 4B3RQ 4FP5D 2J6UA 5EZYF 1R9TB 4KY7A 2Y0SA 4BY7G 2BDOA 1NUCA 1J5EQ 2W9BA 4P75A 3J7AK 1DM0B 2B63B 5KG1A 4YR3A 2W7PA 1HTLD 5LHY1 5M5XH 2NU8B 1NJIC 1XNQH 2JA6G 5AJ3L 3FHWA 5IIFA 2CH4W 4WJWA 5C4JH 2NU6B 2VQFH 3S17H 5IT9W 5D3DA 2IA6A 1Q3LA 1M8AA 3DEPA 4OELB 1HUMA 1U4MA 2F0VA 3DUZA 1K83H 4DV2Q 3BQ2A 3ERSX 2Q8TA 2F0FA 2NVQH 2PMZB 3CQZH 1MIUA 2JEAI 1I4QA 1QVFA 2E74C 4JI8Q 1ML0D 2F0UA 2JA5G 1DIKA 4B3SQ 1QOHA 1SNPA 3BVGA 3CU7A 4Z9CB 1UUPA 4DAVA 4LFCQ 1JC7A 4CDFC 1JCKB 4DR4L 1KLUD 1TWFH 2ZDQA 1VQEA 1CT1D 1B6RA 2MUYA 1RL2A 5IT9c 4IFDI 4OWXB 5CMDA 2JEJA 1AUVA 4X62L 1I3QA 1I6UA 3ULJA 4LUZA 5GROA 4A93H 3OYYA 3GTOB 4IPGA 3H09A 3KBGA 2IHFA 2XWJB 1ASYA 1VQ7A 1LV9A 2PNRC 4A3JH 1GSAA 2W6OA 1QVCA 5CV7A 1TWHA 4JYAQ 1TVXA 5DQHA 3GIKA 4F4ZA 4ECXA 3S1QH 3SE7A 2EXDA 3A56A 3IN5A 3VYRA 5FPRA 2W71A 4DL4A 2ZXOA 1HR0L 2Q2TA 2K03A 4GNXB 1HFGA 4K2LA 5CA1F 5BR8L 4C5AA 2NVXH 3SDZA 4LSAA 1ENAA 4OXPA 4DUYH 1XNRH 5KGUA 1W2BA 4YWKA 1UC8A 2PNHA 2JEBI 1HXYD 1DV1A 1BCPF 2V4QA 2MO0A 3CCJA 4AQYQ 2R7MA 1KNAA 3I8ZA 3GP7A 3STBD 5A2QE 4ZAIA 4EYIB 3RZOH 4YWLA 4UCUA 3VDYA 1G51A 4DV6Q 5FPOA 1N36H 2UUAL 2IP4A 1AUXA 1H9SB 4OHJA 2K1BA 2YW2A 1MBYA 2UUBQ 4IOAA 2HQEA 5JOBA 2UVRA 5M5WH 3HOWH 3D6CA 4JI0L 1VS0A 2UXBQ 1QNKA 5KFEA 2FXQA 3G6XA 4ECVA 1GJXA 1F77A 4KKUA 1ZYRC 2AUJD 1TWHH 2QF7A 2WB1G 3OHXC 3TP7A 3MWYW 2PYKA 4A76A 3G6YA 1WR2A 4DK0A 3C1FA 4X3KA 2BA1A 2J6SA 4H44C 1C30A 3HOUB 1KJIA 3T13A 1TY0A 2OCEA 4JI4Q 1IL2A 4Y52H 5G3LF 3CHBD 4ECUA 4IRCA 1U4RA 3NPPA 2FPIB 2HT1A 4HR7A 5LOVF 3H91A 1B33N 4K8IA 4G4KA 3U58A 1Y1WH 4UCVA 1CSQA 4LF5H 4QW8A 4A3KH 2SDFA 5F2DA 1L2FA 1UAPA 1ZYRD 4DV5Q 3S1NH 5DQGA 3SI8A 2FK1A 4RAZA 2IWHA 4AH6A 1WH2A 1I94L 4LF4H 1N56A 3GIPA 4DLKA 1STHA 3DWPA 1GUGA 5DGBA 2K05A 1FKAH 4IPCA 1LTGD 1HZ9A 4X3UA 2ZTDA 1K73C 4GC6A 2IHEA 4RCOA 1DOLA 4RKLA 1NR2A 2V58A 2JA8H 2HQLA 1D5XC 4RCNA 2JEFA 2R7NA 4A3BB 3TDQA 5IWAH 4J9RA 1CE8A 4QUCA 1R9TA 1G8ZD 1B50A 1VQLA 1Q12A 2JN4A 2CW0D 3V6HA 5JJKA 5FO9B 4WBNF 1WI5A 1GUSA 2N8NA 1PFBA 2Y0SE 1EY7A 2Q8IB 4K0KQ 1Z2NX 4YY3H 3H0GA 3PF5A 3I56A 4BXXH 1HA5A 4ZUIA 1E1TA 5DG8A 3S2HB 1BGWA 4H13C 5DLQE 2X6GA 1MJEA 1WCMB 3RIZA 2FJZA 4X3TA 1BO0A 4DK6C 3VA5A 1RTOA 5IGGA 3S14H 2N88A 1T9HA 2R7FA 4QY7A 4Q44A 2A6ED 3V2TA 1HNXL 2PMZA 5KFTA 5KNBA 1SFOA 2NU9B 4C5CA 4N9PA 1CA5A 1FL0A 2K5VA 3GILA 1WFQA 4HMJA 3QOJA 4O3RA 2Z4IA 4HSVA 3T1YL 3E3XA 2IBKA 4JI3L 2OTLA 3E5NA 4QL5A 4BY1B 1PYSB 4IHJF 4RG1A 3KYHC 4DR1L 3T5KA 1VQDA 3U9TA 3URYA 1YVCA 3L2PA 3HOYG 1CQVA 1J6QA 3OTOH 3HKZB 3GTOA 4JUZA 4GLVB 1DOKA 2JEGA 3S1RB 2QW7A 4C3HB 4CJ0B 5JAVA 4UPAA 3A54A 5JPNC 4B3TQ 4J9OA 3DM1A 4LF7H 3P7JA 2K04A 2FPGB 1UEAB 2C5CA 2C28A 4AIMA 2C00A 5LA6F 4CKEA 3I2ZA 3LWEA 3EN2A 1EWHA 3I4NG 2UVVA 3OSNA 4RAYA 4IR1A 2NU7B 4GNXA 4MV3A 4DUZQ 5IYZF 3DM3A 2NN6I 3A5ZB 3SK4A 4U673 3RB6A 2DNEA 3TQTA 1ZHSA 2XD4A 3T1HQ 1K9MC 5LYJF 1YBYA 4IFDH 5EOYA 4KY6A 3GTPH 4YR2A 2ALYB 1SNDA 2WDTA 4JI7H 1MZBA 2QEXA 1HNWH 2FJ2A 4A3IH 1KJ9A 3VYSA 4EEQA 5JH7F 4O4LF 1AN8A 1BKBA 2K5QA 1O7LA 1V43A 2AQ2B 4FDBA 1TU2B 2Q2HA 5D3IB 5J39A 2XWBB 2E2HH 4LFBL 1H9SA 3V05A 2UVUA 2B2YC 4CGYB 3NBIA 2GN5A 2GVAA 2X6LA 1BCPD 2A5HA 3IFTA 1A3TA 3ND9A 4QCLA 5C3EG 4BY7B 3PUXA 1ESFA 1PH8A 1UNSA 1X65A 2I5LX 3EJIA 1O78A 1E24A 2RCFA 4LF6L 1SEBD 3HKSA 5L9XA 4HCSA 2AHOB 5FKAC 2JA6B 4JV2A 3GIDA 1PH9A 3U9SA 4N8X1 2XN9C 2LSSA 4UFZA 1KEEA 4PNYA 2N78A 1FNUA 4ZK9B 3KAKA 5DQIA 2RVLA 4JV0A 1GUOA 4UP9A 4RKBA 1S5ED 3CC4A 2VR1A 1JR0D 1LTLA 1DGSA 1SYCA 3AB9A 4ED6A 3R3OA 4K14A 5FD5A 4M7EA 3HGBA 1TS3A 3SVMA 5D1PA 2NVYB 2CQYA 4PMBA 1S40A 4DR4H 3TN2A 2HHHL 4ECTA 1SNMA 5FO7B 2W6NA 2RDFA 1PZKD 1N32L 2NZOA 2IL8A 4GS3A 1EZ6A 2L0CA 4R4IA 5G3LD 1VQAA 4Y7NH 3PIO3 2UUCQ 3HOVG 4B3RL 4X62H 4JV5H 4OO1H 2KBNA 4FVMA 5EWEA 3T5JA 4BBSG 1YHBA 3A7LA 5FLXL 1J5EL 5C4XG 1EY5A 5A2QL 1PVOA 2EJMA 1XMOQ 4DV3Q 1EWCA 2E2JH 1VQNA 5EQ0A 2FMMA 3CCLA 3KDFB 1IBMQ 1EIYB 4QW9A 1Y1VH 5IYDG 2ES2A 4X6AH 4EG0A 5EWFA 2R87A 1KAAA 1YIJA 1XPOA 1X9NA 1HR0H 5FJ8G 2SOBA 4DV2L 4EFEA 5DLFA 1C4QA 2Q2UA 1M0WA 3VA7A 2OF1A 5KFIA 5E4XA 1WCMA 4JI8L 3G4SA 2ZDHA 3E0EA 4IUQA 4B3SL 1Q1EA 3HP3A 1JJCB 5H80A 3EROA 2M9VA 4IR9A 4LFCL 1EIGA 2H1EA 4ALPA 1VCIA 1VQFA 3G6JB 4TQUS 2B63G 4CDDC 1S5FD 2J9GA 4HMIA 4EQNA 1HH2P 2UUAH 2EYPA 1KDCA 1Z2OX 5ELFA 1XNQL 5KFLA 5KFKA 3N41B 1A3VA 3KLSA 1PTOF 2F0QA 3OMGA 2VQFL 1IBLQ 3MXNB 2R85A 2KECA 3I4MG 4NMZA 2A74C 1AP0A 3VMMA 4RU9A 2UU9H 5EBDA 3ZYYX 2VA2A 1L1OA 4JI6Q 2AGPA 4MA5A 4IALA 3BABA 3BQ1A 1CA6A 1CKNB 2YTVA 4DU9A 4IUNA 4DV0Q 4JYAL 2HVSA 4UHVA 5I4DA 2WB1B 1FGUA 2K50A 1ZKOA 4L5TA 1N8RC 4ECQA 2PO4A 4LF9Q 2KEDA 5KFZA 4KLKA 4XDXA 3GTGB 1S68A 5KT6A 3I7FA 1C48A 1V51A 1BOSA 2FFKB 5L1LA 2W8KA 3GV6A 1G2SA 2ZM6Q 1WTXA 3GIQA 3MWMA 3GTLH 5J2UF 5DG7A 1W96A 2UXCH 3OHAA 3UE0A 1Q1BA 3QWNA 3RLFA 3Q8SB 3S2DB 5H1SE 1CS0A 4AQYL 3M3YB 3DF7A 2W9AA 4A3FB 3BQ0A 1RODA 3DMUA 4L5SA 1GOZA 3J81E 4DV6L 2RBMA 1JXLA 1E4FT 1IHZA 1TWAH 3I73A 1ZHQA 4KKTA 1JOKA 1XTCD 3PUWA 4K8JA 4GKKQ 1KLGD 3HZXA 2C22A 4L8JA 3TP6A 4MIUA 3R8BA 3E9IA 5KFUA 1TS4A 5KEEA 1RYSA 3M4QA 3HRZC 3GIJA 5HV6A 4JI1L 4L5QA 4DUYL 2VB3X 4CC6A 4EQPA 3EQLC 3IRBA 4KD3A 4DV1L 3RBEA 1TS2A 2A6HC 4FS2A 3WWVA 3S24A 4BBRH 3PSIA 4O3NA 4ZCKA 4EQ5A 1IOWA 3GV7B 2RHQB 1H9JA 4XTCS 2XIWA 2BQ3A 5C4JB 2FP4B 2JA6A 4YBZB 1UEBA 5JVLA 1F2MA 2D0OA 2LY7A 3OSOA 3EBEA 4U68A 1K3RA 3LGJA 1T94A 4I50F 2NUCA 5LMUH 2FPPB 4YJ3F 5E3FA 1HNXH 1JT8A 4JG2A 4IUUA 2BOSA 4A3EH 1ONLA 1G91A 5L1IA 1STGA 4DR5Q 1MGSA 5C0XJ 3MR6A 4J9SA 2A6HD 2JA5A 3ONAB 1E0BA 3SEBA 1B9MA 2NVYA 5JJLA 3T1YH 3UDIA 3HBLA 2BE5C 5LL6b 1U0LA 4HNTA 2D0PA 2W70A 4JI3H 2G9DA 2NB0A 5T1IA 5C0XH 1LTSD 3A0JA 3HOUG 4I65A 5M3MH 3RGXA 3QOLA 4YWMA 1NY4A 2O4XA 5DM63 1J8IA 4QIWE 3F2CA 5KFNA 3JZIA 3CMAA 3KBXA 2IJ0A 1QVGA 3H3VC 1EYDA 4IURA 1II3A 1LT4D 1I6VC 2YU9B 1S3OA 2KQ3A 3CP0A 4HJ8A 1CM9A 4LF4L 4N8FA 3N52A 1WTVA 5IGDA 4ID6A 3H6MA 4F88A 4DF7A 2QDLA 4FM9A 2WFWA 3NWTA 1GSHA 5EPJA 1W6KA 3G71A 3C46A 2K52A 1LTAD 1K28A 4LAAA 2ATWA 4A3BG 1PDQA 4KMUC 5IP9G 3TZUA 3VR3A 4J9MA 1D2BA 2WIIB 1FD7D 4NKLA 5K2MA 2R6FA 3RZOB 3FRPB 3S16B 2YYZA 4FF4A 1B44D 1HR0W 4ZKCB 2XVSA 5JEAJ 3PO2H 1HUNA 5C1PA 1S5DD 1B3QA 2Z6KA 4YY3L 4NXNQ 3HOZH 4B3MH 4LFBH 5HY6A 4HAEA 1CZWA 3OUUA 2PW7A 2RA4A 4JI2Q 3JRWA 3MXNA 1D1IA 1GUNA 2YZGA 2R8JA 1MSGA 4XT1B 2DJFC 2CHBD 1PTOH 4MNOA 4DAPA 3WNZA 5C3EB 1F9SA 1X3FA 2OTJA 3HOXG 5C8YF 3MFIA 1D7QA 2F4VQ 3K5NA 5KFWA 1CKNA 3N42B 2R8GA 3U50C 2VUMG 4B3TL 5KKNB 2G9HD 4KKSA 5L37A 1XX8A 2M00A 4ZLTF 2WB1A 4EVOA 4RA8A 2E5LH 3GTQB 4DAYB 3GTGA 3HKZE 1NAPA 2IPKD 2HDLA 1YHQA 3L0OA 1TWGB 1TT2A 1JOQA 3JSNA 3IAYA 1B9NA 5KFJA 4PG3A 4NXMQ 3KALA 2HDMA 2ZJPA 3KF6B 1S72A 2SNSA 3M7NA 1JJGA 2DWCA 1Y1WB 4U6PA 2KCTA 4DR7Q 4ED1A 1EUDB 3RLOA 5K36H 2ENBA 4J9KA 5KFYA 1J9OA 1S97A 1DXMA 4MV9A 1I7LA 1HNZQ 3BZCA 3HKZG 1X3EA 4IPDA 3CCUA 3QO2A 3OTOL 4V190 3VR5A 2FMAA 1QZGA 5JUMA 2HHHH 4ME6A 5KFOA 2KEEA 3AFPA 1AW7A 3PO3G 4C3HG 1N32H 4ILWA 4RZRA 1ENCA 2GPWA 2IX0A 4B3RH 1F9PA 4AYBE 4DK1A 3EA6A 1YNNC 4ULLA 3KF8B 1GM5A 1EQTA 3J80L 3OUZA 1J5EH 4DPGA 1Q8IA 2HGSA 1I7NA 3H4DA 5C4XB 4JI5Q 3I3CA 5IGBA 5IYCG 3QZ8A 3OHBA 2AGOA 3GQBA 4APVA 5E1FA 5IT9E 5BN3A 4PMWA 1IKLA 2R61A 2VA3A 4FO2A 3TEHB 1JORA 4AYBG 2LKVA 2CW8A 4JI7L 3RF2A 3MXUA 1KRSA 2VY3A 2J0TD 4DV2H 1RF2D 3MJFA 1B8AA 3RAQA 3VYUA 2F3IA 4HEDA 4JI8H 1N34Q 2MO1A 1WTPA 1UWVA 4B3SH 3ETHA 4X64Q 3K0XA 1KIXA 4H0LC 4LFCH 4DNRB 3PIOA 4MV6A 4RUAA 2NUAB 2YRWA 3QG1A 4JPBW 4FF3A 1SRUA 3PQIA 3KLSX 1PK8A 3H20A 3TS0A 1A15A 1I50B 2B2WC 2D9UA 4IZ8A 4C1NK 3JAML 2UUCL 2R92G 2EYJA 1B3AA 4C2MB 1RK6A 1RYRA 3G8CA 4OX9Q 4MN3A 2F0IA 1UNNC 2JK8A 3I4MB 4MTKA 3TREA 3K3PA 3O13A 4IOCA 1SJHD 1JLLB 1XMOL 4DV3L 2JSOA 1ZEQX 4QGUA 1VDZA 2F0JA 2K01A 3W1GA 4ZUJA 4JYAH 4R4TA 2IX3A 1U4LA 1IBML 1ILPA 3D31A 1JE4A 2HCIA 2R86A 2K14A 3CRKC 4LMYA 2CQAA 1CHQD 3HB9A 3WOEA 2EOTA 3IG0A 4C3IG 2F0DA 1IOVA 2MP1A 2EXZA 4A4IA 2YU9A 4EBDA 2EPBA 3T51B 2C2EA 4I7AA 1X6OA 3LX0A 2EYOA 1B4OA 1T36A 5EPKA 4UCRA 2JJQA 3MR5A 5IGEA 2JP1A 1K1QA 1QG7A 4AQYH 4RGOS 1C0AA 1HRJA 5IODA 4I55F 3GTJB 4JV5L 1FYCA 3CCMA 4JV1A 4DR6Q 3VPCA 1AFPA 5FLMG 2BCOA 4DV6H 3STBC 4POFA 3G6VA 3S9WA 2NVTH 2RGVA 4A3IB 4L5RC 3ORRA 2PCFB 4LUOA 1PH3A 2UUBH 3KUPA 1P8LA 4S3SA 1IBLL 3NEMA 1EY9A 3PIP3 4GN5A 3F2DA 1I6HH 2LMCB 4TKOB 3RV4A 2UXBH 3CW2C 1X32A 2QGQA 4JI6L 2UXDQ 3R5XA 4Q5VA 2F03A 5KIXA 3GTMB 2R7ZB 2J7ZA 4JI1H 3F1ZA 5JEAG 3Q8DA 3CF5A 3M9OB 4DV1H 4L1KA 1A6XA 3NTIA 4LF9L 2F0TA 5KFVA 4I4TF 5CORA 1LACA 2M05A 2EE1A 4U7CA 4A75A 3NELA 3AQQA 1CQFA 3S15B 3M9BA 4IUVA 1C3OA 4JI4H 4DAYA 1M1KC 2WB1E 1RDPD 1TWGA 1PRTC 2RSOA 3I4NH 2CZGA 1M7JA 2QEJC 5J1ZA 3MHBA 3DXJC 4XXEA 1DD2A 5C1OA 1I3QH 3KF6A 1LTTD 1H9KA 5EWGA 4M8AA 4DV5H 2VZAA 1BF4A 2UU9L 1N33Q 5KFMA 3PW0A 4WJ4A 2WE6A 4UCSA 4CBVA 3K59A 2K5HA 1GXDC 3UDGA 3ORQA 2CVRA 4DGZA 4GKKL 1E2WA 5M5YB 3PR4A 2KCMA 1E4GT 2EY2A 1DJRD 1L0YB 3N6RA 3IFDA 4A3LG 2C9OA 3DHQA 3NQTA 2QKIC 5IGCA 3I4OA 5IY0A 3GIIA 3FKIG 1B7YB 2IY5B 5M3FH 5A35A 1PRTD 4KN7C 3BJUA 3H40A 2HVRA 2UXCL 3BYYB 3KF8A 2TSSA 4ED8A 1XPUA 1YITA 5C44B 3DWAA 2E2IB 4K0KH 1TIID 3OPOA 1DZ1A 4A3FG 1Q81C 1E22A 2CW0C 3SHLA 4A3GB 1X56A 1GD7A 1Z9FA 2BQUA 2LS01 2ICIA 3K5OA 5AFWA 2K75A 1VQIA 4I7HA 3V4ZA 1FGBD 1GLVA 2W6MA 4Q45A 4DV4Q 5FLXW 3NQIA 4QIWB 5DGAA 1Q82C 5A2QW 3PW7A 2RDIA 4RB1A 2FLLA 4M9UA 3TQ1A 3G7LA 1XWEA 3FMAA 4HIMA 1KJQA 3NXWA 1JE5A 5LMNL 5I6WA 2A6EC 4A3MG 1OTCA 2FK2A 2F0WA 3RV3A 4PDBA 1BBWA 4HJ9A 2XC9A 1KNEA 2EZVA 2LXKA 3GTKB 1IKMA 4P71A 1SYFA 3MTSA 4O3PA 5DLGA 4RGTA 2B63A 5IE8A 1KD1C 2HVQA 1CSPA 1WD1A 2AKWB 1I50A 1PFSA 1RKNA 3UDXA 2SCUB 3K5HA 4C2MA 1S9FA 4XIGS 5FLXc 1U4PA 2I46A 4G7ZC 4YAKB 5I2YA 4JC0A 4K5WA 2XGTA 1KAWA 3CMEA 1QNUA 1CKMA 1KL9A 5GQOA 3HOXB 3NENA 1V8QA 5LMUL 4CDCC 2BH2A 1CK1A 4B3TH 2VUMB 2EY5A 4FXDA 2DY8A 4UAIA 3UDFA 2MNAA 3CPFA 3RUPA 2IMWP 3T16A 4EFBA 2KCNA 2PBZA 3PUZA 2A73B 3C1EA 2O2LD 1LT6D 3M4PA 4OGQC 4DUZH 1KABA 3N40P 2W6ZA 4C3JB 2AWNA 3KJOA 1H9RA 3SGIA 2AMCB 5IGFA 2ZJTA 4KV6A 1EY8A 3EIVA 1RCVD 4LSXA 3GTJA 1FVIA 2EIFA 4A93G 1A9XA 3BS1A 5CBAE 2B3GA 4Q43A 1SE8A 1R9TH 1V1OA 2NYZD 2YTXA 2PN1A 4O3QA 1HJPA 4GKJQ 2L1BA 4NXNL 2D5DA 1WTQA 3PO3B 3F2UA 3H0GH 1X3GA 3L4JA 2NZHA 4J9LA 4A3DH 4F7XA 3S1MB 1WJJA 2AQ3B 5KFSA 4XX0B 2K33A 2KJXA 2DNCA 4WORA 2FHTA 2HD3A 1KC8C 4LFAQ 4IFDJ 4YJ2F 3MXPA 3GDEA 2XGPA 4DR2Q 1STYA 1U5KA 1WD0A 1BCPC 2F4VL 3P20A 4J9PA 3SK5A 4DL6A 5KFHA 1ZETA 3GTMA 1NMGA 4BBRB 1VQKA 1SXTA 2X69A 3IL8A 1SFOH 3Q24A 3PGZA 3RTXA 4DL7A 4HNVA 3AYHB 3JRXA 4MV8A 3PZPA 3D8GA 5IOCA 2EY1A 4AYBB 3MAQA 2IT1A 3F8TA 2B2YA 4O2BF 5KYIA 2RQXA 4NXML 2VB2X 4FF1A 4ZRZA 1CQJB 1Q86C 1V1PB 3KK7A 3JC66 2L4NA 3DLLA 1S0NA 2ZTEA 5L1KA 2F52A 1IBKQ 1EOTA 4B3ML 1SSOA 2EYMA 5DEHA 3KHHA 4F8MA 4FXGC 4J0MA 3UFXB 4JVZA 1HNZL 3HOWG 4B9WA 3L3OC 4DR3Q 1G6PA 4RHRA 5GAGC 4NP5A 4MTNA 3GTOH 3RB0A 2ASDA 5FK9C 4O0AA 2WAQB 4EYHB 1NBWA 5LL6S 1ZQ7A 2VW9A 4LF8Q 2UUCH 1DYQA 2R92B 4MTEA 2F0NA 3PVXA 2E5LL 4QWDA 1SNOA 1WYDA 4WFN3 4ECYA 4ECWA 5M3MB 4ED7A 2RHSB 5I2XA 5JJZA 3PN1A 4DV3H 1STAA 3RN5A 1XMOH 2WINB 1SE3A 5BPFA 1HFNA 1IBMH 1Y1WG 2CW7A 2K28A 3R5FA 1BQQT 2QILA 5KRUA 3SE0A 1PFMA 2AUKA 2E2IA 1NCVA 2VXWA 4EEYA 5IP7H 5KG0A 1QJOA 4C3IB 2SNMA 1Y8OB 4HCEA 4YHHL 5ELDA 5CV8A 4J15A 2ATLA 5JVG3 3P1HA 4MHEA 4LH6A 1EIHA 5KT2A 1XMQQ 4JI0H 1HNWQ 4X64L 4QIWA 1E2ZA 1JB3A 2JA8G 4HSPA 4RGMA 4G57A 3M4OB 4XYOA 1ESRA 1ICWA 3F2BA 4A3CH 3M4YA 4PQXA 1E2VA 1GO3E 1EYGA 1KJ8A 3U9OA 1ULZA 1GHJA 2PI2E 1IYVA 3T5LA 1TWCB 4X65Q 4HJAA 3KOJA 3BA9A 3GTKA 1IYUA 1ASZA 3BYTB 4ME5A 3QJYA 4OX9L 3GIMA 1IBLH 5C5JA 3PO2B 1EZ8A 4ED0A 1I4HA 5KFPA 1EFWA 5IYBH 2R93B 4TSSA 1EWIA 3CCVA 4LH7A 4JI6H 1NTGA 4RHSA 4XQJA 4YB8B 5KG5A 1E4EB 3HOUH 1K8AC 5LP6F 4X66Q 4DV0H 1PH4A 4DV7Q 4KTAA 4E4TA 3U4VA 1T5XD 4LF9H 1X3QA 1ZXTA 3TP8A 4ZHQF 4KHPQ 3GD7A 2ZM6H 2VUMA 2F0HA 4DKAC 3RN2A 5EKIA 2J6TA 5KG4A 4ECZA 3CKIB 1B1ZA 1JDBB 2JA7B 2DY7A 2A68C 5LXTF 4CKCA 1GUTA 4DR6L 1EFID 3L9AX 1HHVA 3QIAA 1ET6A 2PZWA 3DEOA 1RJTA 4IRDA 1PZJD 3G48A 3OMCA 4JBMA 5IP9H 1L2ZA 3T56B 1PH7A 1FNWA 4J8QA 1RJQA 4P72A 4XYMB 3HKZA 5EPLA 4GKKH 3K3VA 2I0QA 5GONF 3PCOB 2QK4A 1Q46A 4F4WA 4F4XA 2GPSA 3KAJA 2F3WA 3KJPA 3FKIB 3D6WA 2A68D 3RR5A 1BR9A 3S2HH 2VQEQ 1N9WA 3D3RA 1WCMH 3FP9A 1S4ZA 2C35B 5EDWA 1AN7A 1TAEA 2W57A 5BR8Q 2YV5A 1RIPA 1GVPA 3PW2A 2F0KA 4QF4A 4R9WA 2ICEC 4IFDG 1JIHA 5ELEA 4RFBA 2EJGC 3SR1A 1IXRA 1DOMA 4AYBA 3MZ5A 2PQAB 5KT5A 3K8AA 4A3IG 2UUBL 1HZAA 5EKKA 3CXCA 3RZDB 3J80W 3M9NB 2N3SA 2B2TC 1T5EA 5ELCA 1EQVA 3QFFA 3K5LA 4P74A 3MFHA 4KJOA 2CH4A 2UXBL 4BY1H 1N33L 2R8HA 5LMNH 1STEA 3NTKA 4A3MB 1Z47A 1YI2A 2R7ZG 3ETJA 4TQRA 1RJRA 4UCTA 3PW5A 4OIKA 4RGNA 4JW0A 2ASLA 2QA4A 4BWGB 2NZ1D 3WOFA 3CAMA 1S5CD 5M5XB 2NN6H 2XSCA 3BG5A 4C3HH 4APMA 4C56C 2EDGA 2Z9HA 2KHIA 2RDGA 1MJCA 1M0TA 1WOCA 4EGJA 2R92A 4JI4L 3S17B 3J80c 2O5JC 3H4BA 1FJGQ 3WO1A 2L55A 3RAXA 3K5IA 4DFAA 1K83B 4CC5A 2FLNA 4EGQA 2A69C 2NVQB 3BDLA 3CQZB 5TSSA 4HIKA 4NLGA 4J9NA 4DV5L 3NGDA 1YNJC 3ULPA 3BAAA 3JAMW 5KT7A 3TBIB 4DAMA 1YJNA 1JWUD 1XTDA 2GVBA 1Q8KA 3MR3A 5J3BA 2V5AA 1SMYC 1RHPA 1TWFB 3A8IE 1I94Q 2E2DC 3M4IA 2CFMA 4NW2A 1B04A 1SDFA 4QWBA 2EVBA 3A74A 3TMEA 1EUJA 4OO1G 3BA8A 2RKSA 4A93B 2W9BB 1OXUA 2A69D 4JBWA 1WTRA 5C44G 2Q8RE 4EBEA 4OWTB 3CCEA 4BY7H 4A3JB 1K8GA 1ET9A 3J80i 3CC2A 4K0KL 4NXNH 1YNJD 3JAMc 4A3GG 4MV1A 1R4QB 1Y1VG 1TWCA 3KDFA 4CKBA 3S1QB 3M7GA 2RCNA 2JA6H 4JI2H 3K7AH 5DM73 3SK6A 5EAYA 4B08A 5EJWA 2R93A 1SMYD 1EHIA 4C5BA 2DJGC 4QB4A 5KX5F 2NVXB 1E4EA 3K80C 2F4VH 3ERQA 4PWQA 1SLJA 2MHVA 3A5UA 2F0OA 2C2DA 5I6YA 3EVQA 2YL2A 1F9RA 2CKZB 3TRZA 1CFMA 2EY6A 2ZDGA 4J1MA 2JA5H 3RGZA 2NVYH 3RMHA 4NXMH 3PMFA 1JKJB 2HJWA 1BDOA 4R4QA 4O2AF 1PTOC 4MTDA 4G7HC 1SBBB 2HUGA 2JA7A 4R8IA 2ZTCA 3QZ7A 3V96A 5ISRA 1HNZH 1EY4A 5T1GA 3BZDB 4FNFA 5M5WB 3JAMi 1Y69U 2IX1A 3HOWB 1RJPA 3NK9A 4A2BA 5KT4A 2NTSA 2WKDA 1SEIA 2XCLA 1M90C 2VQDA 2RDHA 2FMCA 4DR1Q 1KTKA 4GKJL 1UE1A 4UDUC 1PRTB 1TWHB 3OW2A 1Y14B 1F2ZA 4NB3A 3D4WA 2EQSA 4LFAL 1D5MC 1VQ6A 2AGQA 5BPHA 4RB2C 1PTOD 1TKWB 1CHPD 4GN3B 3K5MA 4DR2L 1PH2A 4O4HF 4JI5H 4DUZL 5KFFA 3FPPA 4RB0A 4WD3A 3FKIA 2YTYA 3FPUB 2G5DA 4C3JG 5COYA 4MZ9A 2KHSA 3T53B 4GLXA 3T1HL 3MWEA 4ZQIA 1D5ZC 1A2UA 5C6AA
chains in the Genus database with same CATH topology
4H02A 1M1KC 3T1HQ 1K9MC 2WB1E 1VQCA 1NMFA 3J7ZC 1YBYA 3RNUA 3GTPH 3KFUA 2ALYB 4C3JH 3I4NH 2UUAQ 1I3QH 3KF6A 1A8VA 4PZ8A 4UP8A 3CCRA 1YJWA 4BA2I 2QEXA 4A3IH 1IBKL 2Z0SA 2VZAA 2UU9L 1N33Q 2PQAA 4KI0A 1VQ8A 4WJ4A 1B70B 1BKBA 1V43A 1VQPA 4FDBA 4HJ5A 2Q2HA 3PF4A 4LFBL 2E2HH 4JI0Q 2K5HA 2UU9Q 1L0WA 3UDGA 4DR3L 4LNQA 4GKKL 3S1RH 3PO3H 2DGYA 2GN5A 2GVAA 2L15A 2KCMA 3S1MH 2XTIA 1GKHA 1SROA 4GOPB 4A3LG 5C3EG 3PUXA 5IY0A 1I5FA 3I4OA 1X65A 2I5LX 4BBRG 1NE3A 4JOIC 1PH8A 3FKIG 1B7YB 1E24A 2IY5B 2OQ0A 4LF6L 2KENA 5M3FH 3BJUA 3HKSA 2UXCL 2AHOB 3GTGH 2A1AA 4LF6Q 1XPUA 1YITA 1YHAA 5IYCH 1XNRL 1PH9A 1EQRA 2H5XA 2UXCQ 2WAQE 4R4OA 5LMNW 4A3FG 1Q81C 4WJ3M 1E22A 2LSSA 3K81C 1SMXA 2HIXA 2N78A 1X56A 5IP7G 1GD7A 4NXNQ 1Z9FA 4UP9A 3S2DH 4DV4L 2K75A 3CC4A 1VQIA 1LTLA 1DGSA 1EIFA 2CWPA 3M3YH 4GOPC 2CQOA 4A3EG 3H15A 4A3FH 4DV4Q 1N36L 4IJHA 1Q82C 2WAQG 1S40A 4QJFA 1YNXA 4HIMA 1JE5A 5LMNL 2HHHL 4A3MG 1XMQL 1OTCA 4TVAB 4A3CG 1JMCA 1VQ9A 1BBWA 1KXLA 4HJ9A 5LMNQ 1D8LA 5C0XG 2LXKA 2I5MX 2NZOA 2CCZA 4UY8C 4Y7NH 4GS3A 1Q7YC 4P71A 4R4IA 2UUCQ 1VQAA 4POGA 3HOVG 4B3RL 2KBNA 5M3MG 5IE8A 1KD1C 4HJ7A 4BBSG 1YHBA 1J5EL 1CSPA 2AKWB 2R92H 5IYBG 1VQ5A 5C4XG 4X65L 1PVOA 4IPHA 1PFSA 3UDXA 1XMOQ 4DV3Q 1VQNA 2E2JH 4XIGS 5FLXc 3CCLA 3KDFB 1E1OA 1IBMQ 3J81c 1EIYB 1Y1VH 5IYDG 2ES2A 1EOVA 4JC0A 4X6AH 2WP8J 2XGTA 1KAWA 3CMEA 1CKMA 1KL9A 5GQOA 5E7NA 3NENA 1KRTA 4X66L 5LMUL 4DV7L 1YIJA 1XPOA 5FJ8G 3HFZB 4DV2L 1X9NA 4LF5L 2E8GA 1X55A 2Q2UA 1AH9A 5LMUQ 3UDFA 1HNXQ 2MNAA 3CPFA 4KHPL 4JI8L 4C3IH 3G4SA 1KQSA 3E0EA 3PUZA 3M4PA 3I55A 4B3SL 1Q1EA 1JJCB 1V9PA 3T1YQ 1V1QA 4LFCL 3W5OA 2AWNA 2R7DA 1C9OA 1LYLA 1CUKA 3H3VH 4ALPA 3KJOA 1VQFA 1VCIA 4TQUS 1VQHA 2AMCB 1PYBA 3SGIA 4JI3Q 2B63G 1P16A 5GAHC 1HH2P 3EIVA 3M4OH 1JB7A 3PO2G 1FVIA 2EIFA 4GN4B 1XNQL 4A93G 3HOZG 1H95A 5IWAL 2B3GA 5FLMH 2R93G 1SE8A 1R9TH 2YTXA 3PV0A 2VQFL 1IBLQ 3ULLA 1XNQQ 1HJPA 1TXYA 3MXNB 4PZ6A 2ASBA 3I4MG 3E9HA 1TWCH 4GKJQ 2DUDA 4NXNL 1PV4A 2VQFQ 3H0GH 4DV0L 1X3GA 3J81i 2NZHA 3CCQA 1L1OA 1PH6A 4JI6Q 4A3DH 1WJJA 3HOYH 2HIVA 5JJIA 1CKNB 2YTVA 2R93H 3BU2A 4DV0Q 4JYAL 1KC8C 4LFAQ 4IFDJ 1FGUA 3AEVA 2K50A 4L5TA 1N8RC 1WCMG 2ID0A 3GDEA 2ZM6L 4LF9Q 4DR2Q 4GLAC 1U5KA 4KLKA 1CKOA 3I7FA 2F4VL 4HIOA 1HZCA 3GO5A 5ELOA 2YU9H 1YEZA 2Z6KC 2VQEL 2ZJQA 1VQBA 1NMGA 2B29A 2ZM6Q 4HIDA 1VQKA 3ZJYC 2OQKA 2JA7G 1OXVA 3GTLH 1SFOH 3PGZA 3CD6A 3AYHB 1K0RA 3UE0A 3J81j 4LWCA 1Q1BA 3RLFA 4DNIA 4QQBX 2IT1A 3F8TA 4OONA 3TS2A 1OXTA 4BA1I 5H1SE 2CWAA 4AQYL 4NXML 5K36G 4IO9A 1VQ4A 2JA7H 1Q86C 2ZJRA 3JC66 3DLLA 2BA0A 2ZTEA 2F52A 1IBKQ 4B3ML 4L5SA 4JOIA 1UE7A 3K7UC 4DV6L 1LM0A 1IZ6A 2N49A 4BY1G 1TWAH 1QZHA 3S16H 4LFBQ 4B3MQ 1HNZL 3HOWG 2OWOA 4DR3Q 3PUWA 1G6PA 1IYJB 5GAGC 4R4CA 4GKKQ 4MTNA 3GTOH 2AWOA 4O0AA 2MQHA 4LF8L 4ME3A 2V1CC 3E9IA 1NBWA 2NN6G 2VW9A 4JBJA 4LF8Q 3M4QA 4JI1L 4L5QA 4UP7A 4DUYL 2E5LL 1WYDA 3IRBA 5C3EH 4DV1L 4A3LH 1VQGA 4LF7L 4GOPA 3WWVA 3PUYA 3S24A 4BBRH 3PSIA 3NBHB 3FKIH 4JI1Q 4DUYQ 2E5LQ 3AFQA 4DV1Q 4EQ5A 1XNRQ 2RHQB 2JA9A 2RHSB 3RN5A 4XTCS 1FJGL 4OO1I 3GTQH 1Y1WG 1AE2A 1UEBA 3CCSA 4O2DA 2D0OA 1TWGH 3EBEA 1K3RA 5IP7H 3RLNA 3LGJA 1N36Q 3ICEA 4YCWA 4P73A 1E3PA 4YHHL 2K4KA 3PUVA 2PI2A 2I5HA 4J15A 4DK3C 4DR5L 1YJ9A 1VQMA 1HNWL 1JT8A 4JG2A 3TQYA 4A3EH 3RZDH 4YHHQ 1XJVA 1PHJA 4DR5Q 2HHHQ 5C0XJ 1SR3A 4YCVA 1XMQQ 1HNWQ 4X64L 1OXSC 5JJLA 3UDIA 2JA8G 1N32Q 2K5NA 4A3MH 1U0LA 4B3RQ 2D0PA 3F2BA 4A3CH 3B6YA 1GO3E 4BY7G 3G6EA 4LW1A 1C7YA 1EYGA 1J5EQ 4P75A 3A0JA 2PI2E 2R6GA 3HOVH 4X65Q 3HOUG 4HJAA 3KOJA 5M5XH 1ASZA 5M3MH 1NJIC 4OX9L 4BBSH 2JA6G 1UE6A 5C4XH 4YWMA 5IYBH 5AJ3L 1NY4A 2BH8A 3FHWA 1EFWA 5C4JH 4LUVA 4QIWE 3F2CA 2A8VA 1EWIA 1KHIA 3CCVA 3S17H 1NTGA 3HOUH 1K8AC 3CMAA 1QVGA 4X66Q 1PH4A 4DV7Q 5IYDH 1K83H 1LUZA 3L7ZC 3ERSX 4YCUA 4DV2Q 4LF5Q 4OWWB 1S3OA 3CPWA 3U4VA 3CP0A 2NVQH 4HJ8A 3CQZH 1SN8A 1MIUA 4LF4L 2JEAI 4KHPQ 1QVFA 4JI8Q 5FJ8H 3GD7A 2JA5G 4LF4Q 4B3SQ 4DKAC 2WFWA 3RN2A 3G71A 4LFCQ 2K52A 2JQOA 1PH5A 5HGQA 1JJ2A 2ATWA 4DR4L 4A3BG 2Y0SG 1N32L 1TWFH 5IP9G 1VQEA 1RL2A 1VQJA 5IT9c 4A3JG 4DR6L 4IFDI 4OWXB 5IWAQ 2B63H 1BVSA 2YYZA 4X62L 1HR0W 3ULJA 4LUZA 5GROA 5JEAJ 3MEFA 3G48A 3PO2H 1I50H 2Z6KA 3OYYA 4YY3L 4IPGA 5IP9H 4JBMA 1PH7A 5HY6A 4JI2L 4C2MH 2IHFA 4KHZA 1ASYA 1VQ7A 4P72A 4A3JH 4YY3Q 1BBUA 3I4MH 1QVCA 4JI2Q 4R1JA 2VNUD 1L1OB 2I0QA 4JYAQ 3PCOB 3UE1A 1Q46A 2RF4A 4MNOA 3S1QH 2EXDA 3BZKA 3KJPA 1QUQB 1X3FA 2OTJA 3HOXG 1D7QA 2F4VQ 1CKNA 3RR5A 3U50C 2VUMG 4B3TL 3S2HH 2VQEQ 1HR0L 2Q2TA 1N9WA 4GNXB 1A63A 5BR8L 1WCMH 3FP9A 2NVXH 4OXPA 2C35B 4DAYB 1W2BA 4YWKA 3HKZE 5BR8Q 2PNHA 2JEBI 1YHQA 3L0OA 2YV5A 1RIPA 1GVPA 2MO0A 4PG3A 3CCJA 4AQYQ 4NXMQ 4IFDG 2ZJPA 4DR7L 3KF6B 3STBD 1A0IA 1S72A 1PH1A 3M7NA 1IXRA 1JJGA 4JBKA 3RZOH 4YWLA 2KCTA 4DR7Q 2PQAB 3RLOA 3K8AA 3GTJH 1G51A 4DV6Q 3VDYA 4A3IG 2UUBL 1HZAA 3CXCA 2UUAL 2N3SA 1HNZQ 3BZCA 3HKZG 1X3EA 4IPDA 3CCUA 2UUBQ 3ER0A 4P74A 3OTOL 1YZ6A 4IOAA 2UXBL 4GNXC 1QZGA 4BY1H 1N33L 3AFPA 5M5WH 3OTOQ 3PO3G 3HOWH 1Z47A 1YI2A 2R7ZG 4JI0L 1VS0A 2UXBQ 2FXQA 1OXXK 3J7A5 2IX0A 2QA4A 4RMFA 4AYBE 1TWHH 3CAMA 2WB1G 4JI5L 1GM5A 1W3SA 3KF8B 5M3FG 4LF7Q 4A76A 4DPGA 4EX5A 4C3HH 2R7ZH 3GTMH 4JI5Q 2KHIA 5IYCG 1MJCA 1WOCA 1MKHA 4APVA 4JI4L 2BA1A 3J80c 4A3KG 1FJGQ 4PMWA 5C0XI 2OCEA 4JI4Q 1IL2A 4Y52H 2D62A 3TEHB 4AYBG 2HT1A 4JI7L 3U4ZA 1KRSA 3U58A 1Y1WH 2VY3A 3S15H 4HIKA 1CSQA 4DV5L 1N34L 4A3KH 4JI7Q 3ULPA 1B8AA 2F3IA 1L2FA 4DAMA 4DV5Q 2JE6I 1YJNA 1N34Q 1VQOA 3S1NH 2MO1A 4AH6A 1UWVA 1I94L 2GVBA 1XTDA 1Q8KA 4X64Q 3K0XA 5J3BA 1KIXA 3PIOA 4IPCA 1I94Q 2CFMA 1HZ9A 2MFIA 2ZTDA 1K73C 2IHEA 3A74A 1EUJA 2A19A 4OO1G 2JA8H 3H3VI 2HQLA 1SRUA 3KLWA 5M5YH 3TS0A 2UUCL 2R92G 4PZ7A 1OXUA 4JBWA 5C44G 4OX9Q 4OWTB 5GADC 3CCEA 4BY7H 1K8GA 1HZBA 4BXXG 1VQLA 4K0KL 2JK8A 1Q12A 3J80i 5AJ3Q 3CC2A 3TREA 3JAMc 1XPRA 4A3GG 5JJKA 1WI5A 2N8NA 1Y1VG 4IOCA 2Y0SE 3KDFA 4DV3L 1XMOL 4K0KQ 2JA6H 2RCNA 3K7AH 4QGUA 3W1GA 3PF5A 4R4TA 5C44H 1IBML 3I56A 5EAYA 2E2IH 4BXXH 3D31A 1E1TA 2K14A 5DLQE 1MJEA 4A3GH 4IJLA 3K80C 4DK6C 1SLJA 3A5UA 1PA6A 5GAEC 3S14H 4QY7A 1T9HA 2LXJA 2R7FA 3W1BA 2KHJA 4A4IA 2VL6A 2CKZB 3TRZA 1X6OA 1EQQA 1HNXL 2JA5H 1UE5A 2NVYH 4DR4Q 2JJQA 1O7IA 1FL0A 2K5VA 3M85A 1WFQA 1C0AA 3T1YL 3PIPA 3CCMA 4R4QA 4JV5L 4DR6Q 4A3BH 5FLMG 4X62Q 4JV5Q 4JI3L 1E7ZA 2BH2A 3STBC 2VS1A 4POFA 2ZTCA 2OTLA 3GTKH 4QL5A 4A93H 1PYSB 4RG1A 2IX1A 2NVTH 1AE3A 3KYHC 2PMZE 3JAMi 1VQDA 3H0GG 4LUOA 4DR1L 1PH3A 4L5RC 1YVCA 4A3DG 1P8LA 3L2PA 1M90C 1IBLL 3HOYG 3NEMA 2UXDL 1J6QA 4GN5A 3CC7A 4DR1Q 4GKJL 3F2DA 1UE1A 1I6HH 3M9BA 2Q2IA 3OW2A 1Y14B 3CW2C 4JI6L 2QGQA 2UXDQ 5ELNA 4GLVB 4NB3A 4UPAA 2EQSA 3F1ZA 5JEAG 3Q8DA 3CF5A 1HR0Q 4B3TQ 4LFAL 1VQ6A 3HOZH 3D0FA 3HOXH 4GN3B 4AIMA 4LF9L 4DR2L 1QUQA 1PH2A 4DUZL 3I2ZA 2VUMH 4NPSA 3EN2A 1A62A 3I4NG 2YTYA 4MZ9A 4A75A 1G291 4GNXA 3NELA 3AQQA 4JCVE 1L1OC 3DM3A 4DUZQ 1X54A 4GLXA 2NN6I 3T1HL 3A5ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  1M1K C;  3T1H Q;  1K9M C;  2WB1 E;  1VQC A;  1NMF A;  3J7Z C;  1YBY A;  3RNU A;  3GTP H;  3KFU A;  2ALY B;  4C3J H;  3I4N H;  2UUA Q;  1I3Q H;  3KF6 A;  1A8V A;  4PZ8 A;  4UP8 A;  3CCR A;  1YJW A;  4BA2 I;  2QEX A;  4A3I H;  1IBK L;  2Z0S A;  2VZA A;  2UU9 L;  1N33 Q;  2PQA A;  4KI0 A;  1VQ8 A;  4WJ4 A;  1B70 B;  1BKB A;  1V43 A;  1VQP A;  4FDB A;  4HJ5 A;  2Q2H A;  3PF4 A;  4LFB L;  2E2H H;  4JI0 Q;  2K5H A;  2UU9 Q;  1L0W A;  3UDG A;  4DR3 L;  4LNQ A;  4GKK L;  3S1R H;  3PO3 H;  2DGY A;  2GN5 A;  2GVA A;  2L15 A;  2KCM A;  3S1M H;  2XTI A;  1GKH A;  1SRO A;  4GOP B;  4A3L G;  5C3E G;  3PUX A;  5IY0 A;  1I5F A;  3I4O A;  1X65 A;  2I5L X;  4BBR G;  1NE3 A;  4JOI C;  1PH8 A;  3FKI G;  1B7Y B;  1E24 A;  2IY5 B;  2OQ0 A;  4LF6 L;  2KEN A;  5M3F H;  3BJU A;  3HKS A;  2UXC L;  2AHO B;  3GTG H;  2A1A A;  4LF6 Q;  1XPU A;  1YIT A;  1YHA A;  5IYC H;  1XNR L;  1PH9 A;  1EQR A;  2H5X A;  2UXC Q;  2WAQ E;  4R4O A;  5LMN W;  4A3F G;  1Q81 C;  4WJ3 M;  1E22 A;  2LSS A;  3K81 C;  1SMX A;  2HIX A;  2N78 A;  1X56 A;  5IP7 G;  1GD7 A;  4NXN Q;  1Z9F A;  4UP9 A;  3S2D H;  4DV4 L;  2K75 A;  3CC4 A;  1VQI A;  1LTL A;  1DGS A;  1EIF A;  2CWP A;  3M3Y H;  4GOP C;  2CQO A;  4A3E G;  3H15 A;  4A3F H;  4DV4 Q;  1N36 L;  4IJH A;  1Q82 C;  2WAQ G;  1S40 A;  4QJF A;  1YNX A;  4HIM A;  1JE5 A;  5LMN L;  2HHH L;  4A3M G;  1XMQ L;  1OTC A;  4TVA B;  4A3C G;  1JMC A;  1VQ9 A;  1BBW A;  1KXL A;  4HJ9 A;  5LMN Q;  1D8L A;  5C0X G;  2LXK A;  2I5M X;  2NZO A;  2CCZ A;  4UY8 C;  4Y7N H;  4GS3 A;  1Q7Y C;  4P71 A;  4R4I A;  2UUC Q;  1VQA A;  4POG A;  3HOV G;  4B3R L;  2KBN A;  5M3M G;  5IE8 A;  1KD1 C;  4HJ7 A;  4BBS G;  1YHB A;  1J5E L;  1CSP A;  2AKW B;  2R92 H;  5IYB G;  1VQ5 A;  5C4X G;  4X65 L;  1PVO A;  4IPH A;  1PFS A;  3UDX A;  1XMO Q;  4DV3 Q;  1VQN A;  2E2J H;  4XIG S;  5FLX c;  3CCL A;  3KDF B;  1E1O A;  1IBM Q;  3J81 c;  1EIY B;  1Y1V H;  5IYD G;  2ES2 A;  1EOV A;  4JC0 A;  4X6A H;  2WP8 J;  2XGT A;  1KAW A;  3CME A;  1CKM A;  1KL9 A;  5GQO A;  5E7N A;  3NEN A;  1KRT A;  4X66 L;  5LMU L;  4DV7 L;  1YIJ A;  1XPO A;  5FJ8 G;  3HFZ B;  4DV2 L;  1X9N A;  4LF5 L;  2E8G A;  1X55 A;  2Q2U A;  1AH9 A;  5LMU Q;  3UDF A;  1HNX Q;  2MNA A;  3CPF A;  4KHP L;  4JI8 L;  4C3I H;  3G4S A;  1KQS A;  3E0E A;  3PUZ A;  3M4P A;  3I55 A;  4B3S L;  1Q1E A;  1JJC B;  1V9P A;  3T1Y Q;  1V1Q A;  4LFC L;  3W5O A;  2AWN A;  2R7D A;  1C9O A;  1LYL A;  1CUK A;  3H3V H;  4ALP A;  3KJO A;  1VQF A;  1VCI A;  4TQU S;  1VQH A;  2AMC B;  1PYB A;  3SGI A;  4JI3 Q;  2B63 G;  1P16 A;  5GAH C;  1HH2 P;  3EIV A;  3M4O H;  1JB7 A;  3PO2 G;  1FVI A;  2EIF A;  4GN4 B;  1XNQ L;  4A93 G;  3HOZ G;  1H95 A;  5IWA L;  2B3G A;  5FLM H;  2R93 G;  1SE8 A;  1R9T H;  2YTX A;  3PV0 A;  2VQF L;  1IBL Q;  3ULL A;  1XNQ Q;  1HJP A;  1TXY A;  3MXN B;  4PZ6 A;  2ASB A;  3I4M G;  3E9H A;  1TWC H;  4GKJ Q;  2DUD A;  4NXN L;  1PV4 A;  2VQF Q;  3H0G H;  4DV0 L;  1X3G A;  3J81 i;  2NZH A;  3CCQ A;  1L1O A;  1PH6 A;  4JI6 Q;  4A3D H;  1WJJ A;  3HOY H;  2HIV A;  5JJI A;  1CKN B;  2YTV A;  2R93 H;  3BU2 A;  4DV0 Q;  4JYA L;  1KC8 C;  4LFA Q;  4IFD J;  1FGU A;  3AEV A;  2K50 A;  4L5T A;  1N8R C;  1WCM G;  2ID0 A;  3GDE A;  2ZM6 L;  4LF9 Q;  4DR2 Q;  4GLA C;  1U5K A;  4KLK A;  1CKO A;  3I7F A;  2F4V L;  4HIO A;  1HZC A;  3GO5 A;  5ELO A;  2YU9 H;  1YEZ A;  2Z6K C;  2VQE L;  2ZJQ A;  1VQB A;  1NMG A;  2B29 A;  2ZM6 Q;  4HID A;  1VQK A;  3ZJY C;  2OQK A;  2JA7 G;  1OXV A;  3GTL H;  1SFO H;  3PGZ A;  3CD6 A;  3AYH B;  1K0R A;  3UE0 A;  3J81 j;  4LWC A;  1Q1B A;  3RLF A;  4DNI A;  4QQB X;  2IT1 A;  3F8T A;  4OON A;  3TS2 A;  1OXT A;  4BA1 I;  5H1S E;  2CWA A;  4AQY L;  4NXM L;  5K36 G;  4IO9 A;  1VQ4 A;  2JA7 H;  1Q86 C;  2ZJR A;  3JC6 6;  3DLL A;  2BA0 A;  2ZTE A;  2F52 A;  1IBK Q;  4B3M L;  4L5S A;  4JOI A;  1UE7 A;  3K7U C;  4DV6 L;  1LM0 A;  1IZ6 A;  2N49 A;  4BY1 G;  1TWA H;  1QZH A;  3S16 H;  4LFB Q;  4B3M Q;  1HNZ L;  3HOW G;  2OWO A;  4DR3 Q;  3PUW A;  1G6P A;  1IYJ B;  5GAG C;  4R4C A;  4GKK Q;  4MTN A;  3GTO H;  2AWO A;  4O0A A;  2MQH A;  4LF8 L;  4ME3 A;  2V1C C;  3E9I A;  1NBW A;  2NN6 G;  2VW9 A;  4JBJ A;  4LF8 Q;  3M4Q A;  4JI1 L;  4L5Q A;  4UP7 A;  4DUY L;  2E5L L;  1WYD A;  3IRB A;  5C3E H;  4DV1 L;  4A3L H;  1VQG A;  4LF7 L;  4GOP A;  3WWV A;  3PUY A;  3S24 A;  4BBR H;  3PSI A;  3NBH B;  3FKI H;  4JI1 Q;  4DUY Q;  2E5L Q;  3AFQ A;  4DV1 Q;  4EQ5 A;  1XNR Q;  2RHQ B;  2JA9 A;  2RHS B;  3RN5 A;  4XTC S;  1FJG L;  4OO1 I;  3GTQ H;  1Y1W G;  1AE2 A;  1UEB A;  3CCS A;  4O2D A;  2D0O A;  1TWG H;  3EBE A;  1K3R A;  5IP7 H;  3RLN A;  3LGJ A;  1N36 Q;  3ICE A;  4YCW A;  4P73 A;  1E3P A;  4YHH L;  2K4K A;  3PUV A;  2PI2 A;  2I5H A;  4J15 A;  4DK3 C;  4DR5 L;  1YJ9 A;  1VQM A;  1HNW L;  1JT8 A;  4JG2 A;  3TQY A;  4A3E H;  3RZD H;  4YHH Q;  1XJV A;  1PHJ A;  4DR5 Q;  2HHH Q;  5C0X J;  1SR3 A;  4YCV A;  1XMQ Q;  1HNW Q;  4X64 L;  1OXS C;  5JJL A;  3UDI A;  2JA8 G;  1N32 Q;  2K5N A;  4A3M H;  1U0L A;  4B3R Q;  2D0P A;  3F2B A;  4A3C H;  3B6Y A;  1GO3 E;  4BY7 G;  3G6E A;  4LW1 A;  1C7Y A;  1EYG A;  1J5E Q;  4P75 A;  3A0J A;  2PI2 E;  2R6G A;  3HOV H;  4X65 Q;  3HOU G;  4HJA A;  3KOJ A;  5M5X H;  1ASZ A;  5M3M H;  1NJI C;  4OX9 L;  4BBS H;  2JA6 G;  1UE6 A;  5C4X H;  4YWM A;  5IYB H;  5AJ3 L;  1NY4 A;  2BH8 A;  3FHW A;  1EFW A;  5C4J H;  4LUV A;  4QIW E;  3F2C A;  2A8V A;  1EWI A;  1KHI A;  3CCV A;  3S17 H;  1NTG A;  3HOU H;  1K8A C;  3CMA A;  1QVG A;  4X66 Q;  1PH4 A;  4DV7 Q;  5IYD H;  1K83 H;  1LUZ A;  3L7Z C;  3ERS X;  4YCU A;  4DV2 Q;  4LF5 Q;  4OWW B;  1S3O A;  3CPW A;  3U4V A;  3CP0 A;  2NVQ H;  4HJ8 A;  3CQZ H;  1SN8 A;  1MIU A;  4LF4 L;  2JEA I;  4KHP Q;  1QVF A;  4JI8 Q;  5FJ8 H;  3GD7 A;  2JA5 G;  4LF4 Q;  4B3S Q;  4DKA C;  2WFW A;  3RN2 A;  3G71 A;  4LFC Q;  2K52 A;  2JQO A;  1PH5 A;  5HGQ A;  1JJ2 A;  2ATW A;  4DR4 L;  4A3B G;  2Y0S G;  1N32 L;  1TWF H;  5IP9 G;  1VQE A;  1RL2 A;  1VQJ A;  5IT9 c;  4A3J G;  4DR6 L;  4IFD I;  4OWX B;  5IWA Q;  2B63 H;  1BVS A;  2YYZ A;  4X62 L;  1HR0 W;  3ULJ A;  4LUZ A;  5GRO A;  5JEA J;  3MEF A;  3G48 A;  3PO2 H;  1I50 H;  2Z6K A;  3OYY A;  4YY3 L;  4IPG A;  5IP9 H;  4JBM A;  1PH7 A;  5HY6 A;  4JI2 L;  4C2M H;  2IHF A;  4KHZ A;  1ASY A;  1VQ7 A;  4P72 A;  4A3J H;  4YY3 Q;  1BBU A;  3I4M H;  1QVC A;  4JI2 Q;  4R1J A;  2VNU D;  1L1O B;  2I0Q A;  4JYA Q;  3PCO B;  3UE1 A;  1Q46 A;  2RF4 A;  4MNO A;  3S1Q H;  2EXD A;  3BZK A;  3KJP A;  1QUQ B;  1X3F A;  2OTJ A;  3HOX G;  1D7Q A;  2F4V Q;  1CKN A;  3RR5 A;  3U50 C;  2VUM G;  4B3T L;  3S2H H;  2VQE Q;  1HR0 L;  2Q2T A;  1N9W A;  4GNX B;  1A63 A;  5BR8 L;  1WCM H;  3FP9 A;  2NVX H;  4OXP A;  2C35 B;  4DAY B;  1W2B A;  4YWK A;  3HKZ E;  5BR8 Q;  2PNH A;  2JEB I;  1YHQ A;  3L0O A;  2YV5 A;  1RIP A;  1GVP A;  2MO0 A;  4PG3 A;  3CCJ A;  4AQY Q;  4NXM Q;  4IFD G;  2ZJP A;  4DR7 L;  3KF6 B;  3STB D;  1A0I A;  1S72 A;  1PH1 A;  3M7N A;  1IXR A;  1JJG A;  4JBK A;  3RZO H;  4YWL A;  2KCT A;  4DR7 Q;  2PQA B;  3RLO A;  3K8A A;  3GTJ H;  1G51 A;  4DV6 Q;  3VDY A;  4A3I G;  2UUB L;  1HZA A;  3CXC A;  2UUA L;  2N3S A;  1HNZ Q;  3BZC A;  3HKZ G;  1X3E A;  4IPD A;  3CCU A;  2UUB Q;  3ER0 A;  4P74 A;  3OTO L;  1YZ6 A;  4IOA A;  2UXB L;  4GNX C;  1QZG A;  4BY1 H;  1N33 L;  3AFP A;  5M5W H;  3OTO Q;  3PO3 G;  3HOW H;  1Z47 A;  1YI2 A;  2R7Z G;  4JI0 L;  1VS0 A;  2UXB Q;  2FXQ A;  1OXX K;  3J7A 5;  2IX0 A;  2QA4 A;  4RMF A;  4AYB E;  1TWH H;  3CAM A;  2WB1 G;  4JI5 L;  1GM5 A;  1W3S A;  3KF8 B;  5M3F G;  4LF7 Q;  4A76 A;  4DPG A;  4EX5 A;  4C3H H;  2R7Z H;  3GTM H;  4JI5 Q;  2KHI A;  5IYC G;  1MJC A;  1WOC A;  1MKH A;  4APV A;  4JI4 L;  2BA1 A;  3J80 c;  4A3K G;  1FJG Q;  4PMW A;  5C0X I;  2OCE A;  4JI4 Q;  1IL2 A;  4Y52 H;  2D62 A;  3TEH B;  4AYB G;  2HT1 A;  4JI7 L;  3U4Z A;  1KRS A;  3U58 A;  1Y1W H;  2VY3 A;  3S15 H;  4HIK A;  1CSQ A;  4DV5 L;  1N34 L;  4A3K H;  4JI7 Q;  3ULP A;  1B8A A;  2F3I A;  1L2F A;  4DAM A;  4DV5 Q;  2JE6 I;  1YJN A;  1N34 Q;  1VQO A;  3S1N H;  2MO1 A;  4AH6 A;  1UWV A;  1I94 L;  2GVB A;  1XTD A;  1Q8K A;  4X64 Q;  3K0X A;  5J3B A;  1KIX A;  3PIO A;  4IPC A;  1I94 Q;  2CFM A;  1HZ9 A;  2MFI A;  2ZTD A;  1K73 C;  2IHE A;  3A74 A;  1EUJ A;  2A19 A;  4OO1 G;  2JA8 H;  3H3V I;  2HQL A;  1SRU A;  3KLW A;  5M5Y H;  3TS0 A;  2UUC L;  2R92 G;  4PZ7 A;  1OXU A;  4JBW A;  5C44 G;  4OX9 Q;  4OWT B;  5GAD C;  3CCE A;  4BY7 H;  1K8G A;  1HZB A;  4BXX G;  1VQL A;  4K0K L;  2JK8 A;  1Q12 A;  3J80 i;  5AJ3 Q;  3CC2 A;  3TRE A;  3JAM c;  1XPR A;  4A3G G;  5JJK A;  1WI5 A;  2N8N A;  1Y1V G;  4IOC A;  2Y0S E;  3KDF A;  4DV3 L;  1XMO L;  4K0K Q;  2JA6 H;  2RCN A;  3K7A H;  4QGU A;  3W1G A;  3PF5 A;  4R4T A;  5C44 H;  1IBM L;  3I56 A;  5EAY A;  2E2I H;  4BXX H;  3D31 A;  1E1T A;  2K14 A;  5DLQ E;  1MJE A;  4A3G H;  4IJL A;  3K80 C;  4DK6 C;  1SLJ A;  3A5U A;  1PA6 A;  5GAE C;  3S14 H;  4QY7 A;  1T9H A;  2LXJ A;  2R7F A;  3W1B A;  2KHJ A;  4A4I A;  2VL6 A;  2CKZ B;  3TRZ A;  1X6O A;  1EQQ A;  1HNX L;  2JA5 H;  1UE5 A;  2NVY H;  4DR4 Q;  2JJQ A;  1O7I A;  1FL0 A;  2K5V A;  3M85 A;  1WFQ A;  1C0A A;  3T1Y L;  3PIP A;  3CCM A;  4R4Q A;  4JV5 L;  4DR6 Q;  4A3B H;  5FLM G;  4X62 Q;  4JV5 Q;  4JI3 L;  1E7Z A;  2BH2 A;  3STB C;  2VS1 A;  4POF A;  2ZTC A;  2OTL A;  3GTK H;  4QL5 A;  4A93 H;  1PYS B;  4RG1 A;  2IX1 A;  2NVT H;  1AE3 A;  3KYH C;  2PMZ E;  3JAM i;  1VQD A;  3H0G G;  4LUO A;  4DR1 L;  1PH3 A;  4L5R C;  1YVC A;  4A3D G;  1P8L A;  3L2P A;  1M90 C;  1IBL L;  3HOY G;  3NEM A;  2UXD L;  1J6Q A;  4GN5 A;  3CC7 A;  4DR1 Q;  4GKJ L;  3F2D A;  1UE1 A;  1I6H H;  3M9B A;  2Q2I A;  3OW2 A;  1Y14 B;  3CW2 C;  4JI6 L;  2QGQ A;  2UXD Q;  5ELN A;  4GLV B;  4NB3 A;  4UPA A;  2EQS A;  3F1Z A;  5JEA G;  3Q8D A;  3CF5 A;  1HR0 Q;  4B3T Q;  4LFA L;  1VQ6 A;  3HOZ H;  3D0F A;  3HOX H;  4GN3 B;  4AIM A;  4LF9 L;  4DR2 L;  1QUQ A;  1PH2 A;  4DUZ L;  3I2Z A;  2VUM H;  4NPS A;  3EN2 A;  1A62 A;  3I4N G;  2YTY A;  4MZ9 A;  4A75 A;  1G29 1;  4GNX A;  3NEL A;  3AQQ A;  4JCV E;  1L1O C;  3DM3 A;  4DUZ Q;  1X54 A;  4GLX A;  2NN6 I;  3T1H L;  3A5Z B; 
#chains in the Genus database with same CATH topology
 2DZD A;  3Q0A A;  4A3K B;  2R7L A;  1VQC A;  3J7Z C;  3FVQ A;  3RNU A;  3KFU A;  3S1N B;  1TQO A;  4YHH H;  1A8V A;  2HCC A;  4FBT A;  4BA2 I;  1ENF A;  3FDS A;  1CQI B;  1IBK L;  3J7A F;  5KFA A;  3V6K A;  1N34 H;  2PZT A;  2PQA A;  3RUZ A;  1VQ8 A;  3VPB A;  1VQP A;  3OWF A;  4HJ5 A;  4X64 H;  5BN5 A;  3HS0 C;  3RB3 A;  2K6A A;  2R8K A;  4PV1 C;  4ZYS A;  2B39 A;  3BVZ A;  4DR3 L;  4LNQ A;  4EQO A;  2JA8 B;  1G6Z A;  2PW5 A;  4RAU C;  2DGY A;  2B2U C;  2L15 A;  1SYX B;  4DXF A;  5C3W A;  1PFN A;  1I5F A;  4BBR G;  1NE3 A;  1SYB A;  4JOI C;  1KJJ A;  4O4I F;  5D1O B;  5KYL A;  3T5H A;  3EFX D;  5BMV F;  4OX9 H;  1CZG A;  1I4P A;  2B2V C;  3GTG H;  4HYK A;  4LF6 Q;  1QCB D;  1EQR A;  4Q8F A;  2H5X A;  1EU4 A;  1SE4 A;  2WAQ E;  5LMN W;  5LL6 X;  2K5W A;  4ODG A;  2ZXR A;  3K81 C;  5KFC A;  4NDX A;  2FIN B;  5K5P A;  4ED2 A;  3TZD A;  2ZXP A;  3Q6S A;  2F0P A;  3S14 B;  3I91 A;  3S2D H;  1K83 A;  2BQR A;  5C4H A;  2CWP A;  3M3Y H;  2B2W A;  4GOP C;  4A3E G;  3CQZ A;  1SYG A;  4IQZ A;  4A3F H;  4IJH A;  3LWU A;  2YZM A;  2WAQ G;  1D1K A;  2D2C C;  3BDO A;  2AQ4 A;  1M4V A;  1SYE A;  1YNX A;  5KFD A;  2WKC A;  1I4X A;  1XMQ L;  3J7Y W;  3V6J A;  3MA2 B;  4QMG A;  4CHT B;  3LML A;  4FBU A;  4XT3 B;  1JDE A;  1VQ9 A;  1V4Y A;  1D8L A;  5C0X G;  3H94 A;  1TWF A;  4DR6 H;  2QDB A;  5CV6 A;  1Q7Y C;  2V9W A;  3NP8 A;  4FS1 A;  5M3M G;  2XCA A;  4HJ7 A;  4TRD A;  1VQ5 A;  2L9H A;  5FD6 A;  3J81 L;  4X65 L;  4R8U B;  1GSO A;  1KC7 A;  1U9R A;  3VR2 A;  5EKL A;  1OO9 B;  2V4R A;  3WDN A;  1E1O A;  1O80 A;  3H0G B;  4J6H A;  4A3D B;  4GC7 A;  4F4Y A;  2UXD H;  5CYU A;  2WP8 J;  1EU3 A;  4X66 L;  4DV7 L;  2R3Z A;  3HXL A;  3TSS A;  2E8G A;  1RD9 D;  4QWC A;  1F9Q A;  3OSP A;  1AH9 A;  3I90 A;  1VMC A;  1ILQ A;  4O42 A;  4KHP L;  2I8C A;  2NVX A;  2F0E A;  4CDE C;  3I55 A;  2F4I A;  1SFO B;  2WYO A;  4K5V A;  2EJF C;  5D65 A;  3GTP B;  3W5O A;  3BDC A;  2GLT A;  1C9O A;  2R7D A;  4K6D A;  1VQH A;  1BCP B;  3D4D A;  2Z8L A;  2WV6 D;  5CA0 F;  3PO2 G;  4GN4 B;  3HOZ G;  1H95 A;  2DIK A;  2R93 G;  5J22 A;  4KHV A;  2E2H B;  1N33 H;  3ULL A;  1XNQ Q;  2ASB A;  1M6V A;  5JPM C;  1PV4 A;  2VQF Q;  4DV0 L;  3CCQ A;  1PH6 A;  3HOY H;  2HIV A;  1EYA A;  5JJI A;  2FE3 A;  1FNV A;  2AQ1 B;  5DNF A;  3PR5 B;  1K0S A;  1W6J A;  5CC4 A;  4ZI7 F;  3AEV A;  2ID0 A;  3Q8R B;  2ZM6 L;  1WTH A;  3X3M A;  4G7O C;  5EBC A;  1CKO A;  2L11 A;  3GO5 A;  2YU9 H;  1YEZ A;  2VQE L;  3IKJ A;  5KFR A;  3GTQ A;  2F3V A;  3FEW X;  4HID A;  2JA7 G;  1OXV A;  3MXG A;  3CD6 A;  1K0R A;  3NE5 B;  3GQC A;  3J81 j;  4LWC A;  4DNI A;  4QQB X;  4OON A;  1LTI D;  3TS2 A;  2B8G A;  2I07 B;  5K36 G;  1VQ4 A;  1QE6 A;  1Y1W A;  1K8O A;  2W8L A;  4TV8 F;  2BA0 A;  5FLX E;  4DN4 M;  1O7Y A;  2VUG A;  1UE7 A;  1LM0 A;  4DV4 H;  4YIJ A;  1VBG A;  3S16 H;  1DCZ A;  2F0G A;  1JQY D;  4CJ1 B;  2OWO A;  3KXY T;  1IYJ B;  4R4C A;  1K1S A;  4MAM A;  3NHH A;  2AWO A;  4Y7N B;  2DLN A;  3HG9 A;  1F2L A;  1FR3 A;  1BNC A;  1NR4 A;  4QWA A;  4TV9 F;  2XRQ D;  2W9C B;  4UP7 A;  1IW7 C;  2KCC A;  5C3E H;  4MV7 A;  1DON A;  2E2J B;  4TUY F;  3LP8 A;  5HUR A;  3NBH B;  2XNA C;  4JI1 Q;  3TP5 A;  4DUY Q;  1T3N A;  3AFQ A;  4DV1 Q;  1XNR Q;  2F0M A;  1WSC A;  5D1O A;  2JA9 A;  1Y1V B;  3C3L A;  1HQR D;  3A55 A;  1FJG L;  4OO1 I;  3GTQ H;  3RD4 A;  1AE2 A;  1VF7 A;  5D8D A;  1TWG H;  2NWG A;  5HBR B;  2UVW A;  3GV5 B;  3RLN A;  1N36 Q;  1VMP A;  4RWS C;  4YCW A;  4P73 A;  1E3P A;  3ICE A;  4IZO A;  2K4K A;  3PUV A;  2PI2 A;  4DR5 L;  1YJ9 A;  2JXM B;  3NTH A;  1VQM A;  4IWY A;  4KK7 A;  1XJV A;  1IW7 D;  2PQE A;  1SR3 A;  4DA2 A;  1EL0 A;  3R2I A;  4BWS C;  3E6Z X;  5KND A;  4B9X A;  2R84 A;  1SAP A;  1PYW D;  3B6Y A;  3G6E A;  4LW1 A;  1SNC A;  1C7Y A;  3LNN A;  3DWQ A;  2R6G A;  3HOV H;  2V4D A;  4I7Z C;  1PLF A;  4ECS A;  5J2T F;  3KHG A;  3MC0 B;  3K57 A;  2JYO A;  4BBS H;  4GKJ H;  1UE6 A;  5C4X H;  1KBL A;  2BH8 A;  5KT3 A;  2A8V A;  4LUV A;  5CGK A;  2R82 A;  1KHI A;  1G2T A;  1TR5 A;  4R8U A;  5JQW A;  2RSN A;  1HA6 A;  3KTM A;  1O75 A;  1B2T A;  5IYD H;  1LUZ A;  3L7Z C;  3Q23 A;  4LF5 Q;  4YCU A;  4OWW B;  4LFA H;  1NSN S;  3CPW A;  3AMU A;  5I9P A;  2MPM A;  2YS7 A;  4DR2 H;  1SN8 A;  3GTL B;  4RZQ A;  5FJ8 H;  3Q8Q B;  3K6O A;  3SK8 A;  1RTN A;  4LF4 Q;  1JIC A;  3T1H H;  1PXU A;  4ETS A;  4Y8V B;  5ELB A;  5KFQ A;  1ICF B;  2JQO A;  5D14 A;  5IT9 L;  1PH5 A;  5HGQ A;  1JJ2 A;  3CVZ A;  2I87 A;  2XRS D;  2Y0S G;  1LT3 D;  3J7A V;  1VQJ A;  1EUC B;  3K58 A;  5NUC A;  1W93 A;  5KG7 A;  4A3J G;  3GTP A;  3KHL A;  3MVV A;  5IWA Q;  2B63 H;  1TWA B;  1OWT A;  1BVS A;  5C5L A;  1IBK H;  3UI2 A;  3MEF A;  1I50 H;  2Z1C A;  4V0B A;  4RUC A;  4DL2 A;  4JI2 L;  4C2M H;  4KHZ A;  4X3S A;  1AZQ A;  1XDN A;  4DR3 H;  3QR8 A;  4YY3 Q;  1WTW A;  1BBU A;  3I4M H;  2E2H A;  3RFC A;  4R1J A;  3GLK A;  2VNU D;  1L1O B;  4L63 B;  5KG6 A;  3UE1 A;  4FYD A;  2RF4 A;  4F50 A;  4RH6 A;  3BZK A;  1AEX A;  2R7Z A;  1QUQ B;  3C2P A;  5C3X A;  1BJT A;  3I70 A;  2GA4 B;  4ED3 A;  4LJZ C;  4LF8 H;  4RNN A;  2PVP A;  2C2R A;  3X3N A;  1A63 A;  3VPD A;  4IRK A;  3ND8 A;  5CAE B;  1S0O A;  2W7O A;  2R8I A;  3R5H A;  4YQW A;  1BXT A;  4DR7 L;  2KA7 A;  1A0I A;  1CI3 M;  2R7K A;  1PH1 A;  2MCT A;  4OIJ A;  3MFG A;  4JBK A;  4DL5 A;  3GTJ H;  1Y8P B;  3HEJ A;  1JWS D;  1VAJ A;  4A3E B;  2P0A A;  3I72 A;  4ZOL F;  1CTM A;  3TIG A;  3ER0 A;  4JK1 C;  1YZ6 A;  4GNX C;  2F1M A;  3UQ8 A;  1XMQ H;  3OTO Q;  3OWE B;  4RB3 C;  1TA8 A;  3EPI A;  1GUW A;  1Q90 A;  2Z6B A;  5CB4 F;  1OXX K;  3J7A 5;  3BG3 A;  4RMF A;  4KJN A;  4BS9 A;  2YCH A;  4JI5 L;  1W3S A;  5M3F G;  4LF7 Q;  4EX5 A;  2R7Z H;  3GTM H;  5CV4 A;  4X65 H;  2O5I C;  2KOL A;  1HCZ A;  1MKH A;  3Q1K A;  2W9C A;  1K8M A;  4J9Q A;  4A3K G;  3R2T A;  5C0X I;  5KNC A;  3NBH A;  3N44 B;  3TII A;  2D62 A;  4EBC A;  4ABN A;  2YRX A;  3K7A B;  1Y1V A;  4X66 H;  4DV7 H;  1I4R A;  3U4Z A;  3S15 H;  1AZP A;  5HGT A;  1N34 L;  4JI7 Q;  3RBD A;  4MA0 A;  2YS6 A;  2ALZ A;  4KHP H;  2JE6 I;  1VQO A;  1EEF D;  5FOB B;  3R93 A;  3KHR A;  1STN A;  1QIL A;  1Y8N B;  4DXG A;  2JA5 B;  3I12 A;  3PW4 A;  2MFI A;  2FK3 A;  5F9N A;  4R7R A;  3P75 A;  4N9T A;  1BBX C;  5I47 A;  3Q8P B;  2A19 A;  2OEO A;  3H3V I;  4IUP A;  1XYI A;  3LWB A;  3KLW A;  5M5Y H;  5JVH 3;  4PZ7 A;  4O1N A;  3HOZ B;  2B8F A;  5GAD C;  4BXX G;  1HZB A;  5AJ3 Q;  2VPS A;  1S03 G;  1QWY A;  1XPR A;  3NSW A;  3CRL C;  1PTO B;  2H4O A;  1B53 A;  5C44 H;  3KLR A;  2E2I H;  5DAU A;  3M9M B;  4WRD A;  3AU7 A;  4A3G H;  4IJL A;  5CV5 A;  1PA6 A;  5GAE C;  2VQE H;  2LXJ A;  3W1B A;  3F8N A;  2KHJ A;  2VL6 A;  2E75 C;  2K5D A;  1S10 A;  5FO8 B;  3GTL A;  5BR8 H;  3GV3 A;  1S5B D;  1UE5 A;  5DG9 A;  4DR4 Q;  1F2Y A;  1O7I A;  3M85 A;  2I80 A;  5KFG A;  1MD2 D;  1LO5 D;  1D6E C;  3PIP A;  2KSW A;  2DPI A;  4M1U B;  4A3B H;  4QUF A;  1STB A;  3J80 E;  2RDJ A;  3D4R A;  4X62 Q;  4JV5 Q;  1E7Z A;  4G3I A;  1GYF A;  2VS1 A;  3GTK H;  2VOB A;  3VYT A;  2F0S A;  2JEI A;  4DL3 A;  1AE3 A;  2PMZ E;  3SXH A;  3H0G G;  1WVL A;  1TWA A;  1HPC A;  1LLR D;  1MI2 A;  4A3D G;  2V59 A;  5KG3 A;  2UXD L;  2XCP A;  3CC7 A;  3L4K A;  2FLP A;  2Q2I A;  4ZKB B;  5ELN A;  2OH2 A;  2L12 A;  2L5T A;  4H7B A;  2LFN A;  1HR0 Q;  1SE2 A;  1EYZ A;  3D0F A;  3HOX H;  2DPJ A;  4OEM B;  1QUQ A;  2B2T A;  4XZ3 B;  2KUM A;  2VUM H;  4NPS A;  5C5M A;  1A62 A;  2YYA A;  1HQM C;  1FJG H;  1G29 1;  4JCV E;  1L1O C;  4XYL B;  1X54 A;  1EQQ A;  4H02 A;  1PX2 A;  1A2T A;  3NWS A;  4RNO A;  1NMF A;  1R4P B;  2XGQ A;  1V1P A;  4C3J H;  5BN4 A;  3JAM E;  3C0F B;  2UUA Q;  3CCR A;  4UP8 A;  4PZ8 A;  4DR5 H;  2J4X A;  2N55 A;  1YJW A;  1PMR A;  1DV2 A;  2Z0S A;  4KI0 A;  3N43 B;  1B70 B;  1JX4 A;  4HQ6 A;  3PF4 A;  3FDT A;  4JI0 Q;  4K5X A;  2UU9 Q;  4K6L A;  1L0W A;  1I94 H;  1L0X B;  4CJ2 C;  4UCO A;  4IAJ A;  2WAQ A;  5M9O A;  3S1R H;  3PO3 H;  1LTB D;  4QWE A;  1B6S A;  3S1M H;  2XTI A;  1GKH A;  1SRO A;  4GOP B;  4IUT A;  1Z2P X;  4O3O A;  1GHK A;  4GZY C;  2OQ0 A;  2E76 C;  2KEN A;  3A7A B;  3JSL A;  1TS5 A;  2FKL A;  2A1A A;  1KDB A;  1YHA A;  5IYC H;  1XNR L;  3VR4 A;  5L1J A;  3RJ0 A;  2UXC Q;  3VR6 A;  1LTR D;  4R4O A;  4WJ3 M;  4MV4 A;  1SMX A;  2HIX A;  5E4W C;  5IP7 G;  4DV4 L;  2ASJ A;  4ECR A;  4OL7 A;  1EIF A;  1QB5 D;  2CQO A;  1VBH A;  4RNM A;  3H15 A;  1N36 L;  4KY5 A;  3BVM A;  2IW3 A;  3J81 W;  4KD4 A;  3I4L A;  1UC9 A;  4QJF A;  3BJY A;  3W2D A;  4HN7 A;  1NNX A;  2BDN A;  2Y0S B;  4TVA B;  4A3C G;  1JMC A;  1KXL A;  4LK1 C;  5LMN Q;  5KFB A;  5EGT A;  4UY8 C;  2I5M X;  3W3A A;  2CCZ A;  3N8D A;  1I4G A;  4HNU A;  1SCU B;  2F0L A;  4POG A;  4K2K A;  2NVT B;  3A8J E;  2W6P A;  3R23 A;  1Z6H A;  4FXK C;  5IYB G;  2R92 H;  1VKZ A;  4IPH A;  1I6H B;  3GV8 B;  3OW7 A;  3EPG A;  4KN4 C;  4IN3 A;  4F87 A;  4DR1 H;  2NTT A;  2O03 A;  2QYZ A;  1N48 A;  3J81 c;  2RGR A;  3RB4 A;  1BUV T;  1EOV A;  3HOY B;  4TQS A;  4FF2 A;  3MR2 A;  1KRT A;  5E7N A;  1EZ1 A;  5C4Z A;  5F9L A;  3HFZ B;  4LF5 L;  1HTP A;  4Q8E A;  1O7Z A;  1X55 A;  2WTF A;  3FMC A;  5LMU Q;  1HNX Q;  2M2L A;  2FB9 A;  4C3I H;  1KQS A;  4E6I A;  3N6X A;  2BE5 D;  4XQQ A;  2BR0 A;  1V9P A;  1Z7T A;  2WAC A;  3WO0 A;  3MFY A;  1V1Q A;  3T1Y Q;  3I4N B;  3NUC A;  2YZN A;  4DR7 H;  5JVD F;  1LYL A;  1CUK A;  2DN8 A;  3H3V H;  1I3Q B;  2MGS A;  2EYL A;  3OIP A;  1PYB A;  1LT5 D;  4JI3 Q;  5T14 A;  3A8K E;  1P16 A;  2W6Q A;  4IWX A;  5GAH C;  3K0Y A;  4O3S A;  3M4O H;  1JB7 A;  2AU0 A;  2OT2 A;  2PZU A;  4A2A A;  5IWA L;  1PZI D;  5FLM H;  1WTO A;  3T4A C;  4FU0 A;  1EYC A;  3PV0 A;  5I9O A;  3Q2O A;  1TXY A;  4PZ6 A;  3E9H A;  2QCP X;  1XXG A;  1TWC H;  4XQN A;  2DUD A;  1C8C A;  1RK5 A;  2EYF A;  3J81 i;  4DNT B;  1SYD A;  4HTH A;  2R93 H;  1LAB A;  3E0J A;  3BU2 A;  2X0S A;  4C1N I;  2MJ8 A;  5M3F B;  5CV9 A;  1WCM G;  4P2C B;  4GLA C;  2Z4H A;  5JEA H;  4HIO A;  1HZC A;  5ELO A;  2Z6K C;  2ZJQ A;  4YR0 A;  1VQB A;  2B29 A;  3OIQ A;  1SNQ A;  2OQK A;  1JWM D;  2OXP A;  3ZJY C;  4LF6 H;  2K32 A;  3ITP A;  1SJE D;  2VPQ A;  1S0M A;  2P5Z X;  1OXT A;  4BA1 I;  2CWA A;  2KVM A;  4IO9 A;  2B2U A;  2JA7 H;  1TY2 A;  2ZJR A;  4YAJ B;  3EYY A;  4JOI A;  3K7U C;  2EYH A;  1IZ6 A;  2N49 A;  4BY1 G;  5KG2 A;  1PRT F;  2ZT9 C;  3MEH A;  4L6T B;  1QZH A;  4B3M Q;  4LFB Q;  2B2V A;  1EY0 A;  4PMC A;  1X3P A;  2NBF A;  1MHW C;  5KFX A;  2SEB D;  2MQH A;  4LF8 L;  3V4S A;  4ME3 A;  2V1C C;  5CR3 A;  4Q0F A;  4YP3 A;  2NN6 G;  1K3B C;  4JBJ A;  4EGV A;  5CBE E;  3TIN A;  3Q22 A;  3MWD A;  4A3L H;  1VQG A;  4LF7 L;  3E5S A;  4GOP A;  3PUY A;  1GGO A;  3HOV B;  1EY6 A;  3FKI H;  2E5L Q;  1EEI D;  1KDA A;  4HR7 B;  2OLS A;  4BBS B;  1BNZ A;  2XIG A;  3CCS A;  4O2D A;  1VF5 C;  4ZQ3 A;  4R8N A;  2TMP A;  4LMQ D;  4DK3 C;  3OOC A;  2I5H A;  1MSH A;  1HNW L;  1A3U A;  3TQY A;  2PPB C;  3RZD H;  1IL8 A;  4YHH Q;  1PHJ A;  3QB3 A;  2HHH Q;  4YCV A;  4Q0Y A;  1H9M A;  1OXS C;  1BXR A;  1JOO A;  1YNN D;  2K7V A;  4XYQ A;  2K5N A;  1N32 Q;  4A3M H;  4B3R Q;  4FP5 D;  2J6U A;  5EZY F;  1R9T B;  4KY7 A;  2Y0S A;  4BY7 G;  2BDO A;  1NUC A;  1J5E Q;  2W9B A;  4P75 A;  3J7A K;  1DM0 B;  2B63 B;  5KG1 A;  4YR3 A;  2W7P A;  1HTL D;  5LHY 1;  5M5X H;  2NU8 B;  1NJI C;  1XNQ H;  2JA6 G;  5AJ3 L;  3FHW A;  5IIF A;  2CH4 W;  4WJW A;  5C4J H;  2NU6 B;  2VQF H;  3S17 H;  5IT9 W;  5D3D A;  2IA6 A;  1Q3L A;  1M8A A;  3DEP A;  4OEL B;  1HUM A;  1U4M A;  2F0V A;  3DUZ A;  1K83 H;  4DV2 Q;  3BQ2 A;  3ERS X;  2Q8T A;  2F0F A;  2NVQ H;  2PMZ B;  3CQZ H;  1MIU A;  2JEA I;  1I4Q A;  1QVF A;  2E74 C;  4JI8 Q;  1ML0 D;  2F0U A;  2JA5 G;  1DIK A;  4B3S Q;  1QOH A;  1SNP A;  3BVG A;  3CU7 A;  4Z9C B;  1UUP A;  4DAV A;  4LFC Q;  1JC7 A;  4CDF C;  1JCK B;  4DR4 L;  1KLU D;  1TWF H;  2ZDQ A;  1VQE A;  1CT1 D;  1B6R A;  2MUY A;  1RL2 A;  5IT9 c;  4IFD I;  4OWX B;  5CMD A;  2JEJ A;  1AUV A;  4X62 L;  1I3Q A;  1I6U A;  3ULJ A;  4LUZ A;  5GRO A;  4A93 H;  3OYY A;  3GTO B;  4IPG A;  3H09 A;  3KBG A;  2IHF A;  2XWJ B;  1ASY A;  1VQ7 A;  1LV9 A;  2PNR C;  4A3J H;  1GSA A;  2W6O A;  1QVC A;  5CV7 A;  1TWH A;  4JYA Q;  1TVX A;  5DQH A;  3GIK A;  4F4Z A;  4ECX A;  3S1Q H;  3SE7 A;  2EXD A;  3A56 A;  3IN5 A;  3VYR A;  5FPR A;  2W71 A;  4DL4 A;  2ZXO A;  1HR0 L;  2Q2T A;  2K03 A;  4GNX B;  1HFG A;  4K2L A;  5CA1 F;  5BR8 L;  4C5A A;  2NVX H;  3SDZ A;  4LSA A;  1ENA A;  4OXP A;  4DUY H;  1XNR H;  5KGU A;  1W2B A;  4YWK A;  1UC8 A;  2PNH A;  2JEB I;  1HXY D;  1DV1 A;  1BCP F;  2V4Q A;  2MO0 A;  3CCJ A;  4AQY Q;  2R7M A;  1KNA A;  3I8Z A;  3GP7 A;  3STB D;  5A2Q E;  4ZAI A;  4EYI B;  3RZO H;  4YWL A;  4UCU A;  3VDY A;  1G51 A;  4DV6 Q;  5FPO A;  1N36 H;  2UUA L;  2IP4 A;  1AUX A;  1H9S B;  4OHJ A;  2K1B A;  2YW2 A;  1MBY A;  2UUB Q;  4IOA A;  2HQE A;  5JOB A;  2UVR A;  5M5W H;  3HOW H;  3D6C A;  4JI0 L;  1VS0 A;  2UXB Q;  1QNK A;  5KFE A;  2FXQ A;  3G6X A;  4ECV A;  1GJX A;  1F77 A;  4KKU A;  1ZYR C;  2AUJ D;  1TWH H;  2QF7 A;  2WB1 G;  3OHX C;  3TP7 A;  3MWY W;  2PYK A;  4A76 A;  3G6Y A;  1WR2 A;  4DK0 A;  3C1F A;  4X3K A;  2BA1 A;  2J6S A;  4H44 C;  1C30 A;  3HOU B;  1KJI A;  3T13 A;  1TY0 A;  2OCE A;  4JI4 Q;  1IL2 A;  4Y52 H;  5G3L F;  3CHB D;  4ECU A;  4IRC A;  1U4R A;  3NPP A;  2FPI B;  2HT1 A;  4HR7 A;  5LOV F;  3H91 A;  1B33 N;  4K8I A;  4G4K A;  3U58 A;  1Y1W H;  4UCV A;  1CSQ A;  4LF5 H;  4QW8 A;  4A3K H;  2SDF A;  5F2D A;  1L2F A;  1UAP A;  1ZYR D;  4DV5 Q;  3S1N H;  5DQG A;  3SI8 A;  2FK1 A;  4RAZ A;  2IWH A;  4AH6 A;  1WH2 A;  1I94 L;  4LF4 H;  1N56 A;  3GIP A;  4DLK A;  1STH A;  3DWP A;  1GUG A;  5DGB A;  2K05 A;  1FKA H;  4IPC A;  1LTG D;  1HZ9 A;  4X3U A;  2ZTD A;  1K73 C;  4GC6 A;  2IHE A;  4RCO A;  1DOL A;  4RKL A;  1NR2 A;  2V58 A;  2JA8 H;  2HQL A;  1D5X C;  4RCN A;  2JEF A;  2R7N A;  4A3B B;  3TDQ A;  5IWA H;  4J9R A;  1CE8 A;  4QUC A;  1R9T A;  1G8Z D;  1B50 A;  1VQL A;  1Q12 A;  2JN4 A;  2CW0 D;  3V6H A;  5JJK A;  5FO9 B;  4WBN F;  1WI5 A;  1GUS A;  2N8N A;  1PFB A;  2Y0S E;  1EY7 A;  2Q8I B;  4K0K Q;  1Z2N X;  4YY3 H;  3H0G A;  3PF5 A;  3I56 A;  4BXX H;  1HA5 A;  4ZUI A;  1E1T A;  5DG8 A;  3S2H B;  1BGW A;  4H13 C;  5DLQ E;  2X6G A;  1MJE A;  1WCM B;  3RIZ A;  2FJZ A;  4X3T A;  1BO0 A;  4DK6 C;  3VA5 A;  1RTO A;  5IGG A;  3S14 H;  2N88 A;  1T9H A;  2R7F A;  4QY7 A;  4Q44 A;  2A6E D;  3V2T A;  1HNX L;  2PMZ A;  5KFT A;  5KNB A;  1SFO A;  2NU9 B;  4C5C A;  4N9P A;  1CA5 A;  1FL0 A;  2K5V A;  3GIL A;  1WFQ A;  4HMJ A;  3QOJ A;  4O3R A;  2Z4I A;  4HSV A;  3T1Y L;  3E3X A;  2IBK A;  4JI3 L;  2OTL A;  3E5N A;  4QL5 A;  4BY1 B;  1PYS B;  4IHJ F;  4RG1 A;  3KYH C;  4DR1 L;  3T5K A;  1VQD A;  3U9T A;  3URY A;  1YVC A;  3L2P A;  3HOY G;  1CQV A;  1J6Q A;  3OTO H;  3HKZ B;  3GTO A;  4JUZ A;  4GLV B;  1DOK A;  2JEG A;  3S1R B;  2QW7 A;  4C3H B;  4CJ0 B;  5JAV A;  4UPA A;  3A54 A;  5JPN C;  4B3T Q;  4J9O A;  3DM1 A;  4LF7 H;  3P7J A;  2K04 A;  2FPG B;  1UEA B;  2C5C A;  2C28 A;  4AIM A;  2C00 A;  5LA6 F;  4CKE A;  3I2Z A;  3LWE A;  3EN2 A;  1EWH A;  3I4N G;  2UVV A;  3OSN A;  4RAY A;  4IR1 A;  2NU7 B;  4GNX A;  4MV3 A;  4DUZ Q;  5IYZ F;  3DM3 A;  2NN6 I;  3A5Z B;  3SK4 A;  4U67 3;  3RB6 A;  2DNE A;  3TQT A;  1ZHS A;  2XD4 A;  3T1H Q;  1K9M C;  5LYJ F;  1YBY A;  4IFD H;  5EOY A;  4KY6 A;  3GTP H;  4YR2 A;  2ALY B;  1SND A;  2WDT A;  4JI7 H;  1MZB A;  2QEX A;  1HNW H;  2FJ2 A;  4A3I H;  1KJ9 A;  3VYS A;  4EEQ A;  5JH7 F;  4O4L F;  1AN8 A;  1BKB A;  2K5Q A;  1O7L A;  1V43 A;  2AQ2 B;  4FDB A;  1TU2 B;  2Q2H A;  5D3I B;  5J39 A;  2XWB B;  2E2H H;  4LFB L;  1H9S A;  3V05 A;  2UVU A;  2B2Y C;  4CGY B;  3NBI A;  2GN5 A;  2GVA A;  2X6L A;  1BCP D;  2A5H A;  3IFT A;  1A3T A;  3ND9 A;  4QCL A;  5C3E G;  4BY7 B;  3PUX A;  1ESF A;  1PH8 A;  1UNS A;  1X65 A;  2I5L X;  3EJI A;  1O78 A;  1E24 A;  2RCF A;  4LF6 L;  1SEB D;  3HKS A;  5L9X A;  4HCS A;  2AHO B;  5FKA C;  2JA6 B;  4JV2 A;  3GID A;  1PH9 A;  3U9S A;  4N8X 1;  2XN9 C;  2LSS A;  4UFZ A;  1KEE A;  4PNY A;  2N78 A;  1FNU A;  4ZK9 B;  3KAK A;  5DQI A;  2RVL A;  4JV0 A;  1GUO A;  4UP9 A;  4RKB A;  1S5E D;  3CC4 A;  2VR1 A;  1JR0 D;  1LTL A;  1DGS A;  1SYC A;  3AB9 A;  4ED6 A;  3R3O A;  4K14 A;  5FD5 A;  4M7E A;  3HGB A;  1TS3 A;  3SVM A;  5D1P A;  2NVY B;  2CQY A;  4PMB A;  1S40 A;  4DR4 H;  3TN2 A;  2HHH L;  4ECT A;  1SNM A;  5FO7 B;  2W6N A;  2RDF A;  1PZK D;  1N32 L;  2NZO A;  2IL8 A;  4GS3 A;  1EZ6 A;  2L0C A;  4R4I A;  5G3L D;  1VQA A;  4Y7N H;  3PIO 3;  2UUC Q;  3HOV G;  4B3R L;  4X62 H;  4JV5 H;  4OO1 H;  2KBN A;  4FVM A;  5EWE A;  3T5J A;  4BBS G;  1YHB A;  3A7L A;  5FLX L;  1J5E L;  5C4X G;  1EY5 A;  5A2Q L;  1PVO A;  2EJM A;  1XMO Q;  4DV3 Q;  1EWC A;  2E2J H;  1VQN A;  5EQ0 A;  2FMM A;  3CCL A;  3KDF B;  1IBM Q;  1EIY B;  4QW9 A;  1Y1V H;  5IYD G;  2ES2 A;  4X6A H;  4EG0 A;  5EWF A;  2R87 A;  1KAA A;  1YIJ A;  1XPO A;  1X9N A;  1HR0 H;  5FJ8 G;  2SOB A;  4DV2 L;  4EFE A;  5DLF A;  1C4Q A;  2Q2U A;  1M0W A;  3VA7 A;  2OF1 A;  5KFI A;  5E4X A;  1WCM A;  4JI8 L;  3G4S A;  2ZDH A;  3E0E A;  4IUQ A;  4B3S L;  1Q1E A;  3HP3 A;  1JJC B;  5H80 A;  3ERO A;  2M9V A;  4IR9 A;  4LFC L;  1EIG A;  2H1E A;  4ALP A;  1VCI A;  1VQF A;  3G6J B;  4TQU S;  2B63 G;  4CDD C;  1S5F D;  2J9G A;  4HMI A;  4EQN A;  1HH2 P;  2UUA H;  2EYP A;  1KDC A;  1Z2O X;  5ELF A;  1XNQ L;  5KFL A;  5KFK A;  3N41 B;  1A3V A;  3KLS A;  1PTO F;  2F0Q A;  3OMG A;  2VQF L;  1IBL Q;  3MXN B;  2R85 A;  2KEC A;  3I4M G;  4NMZ A;  2A74 C;  1AP0 A;  3VMM A;  4RU9 A;  2UU9 H;  5EBD A;  3ZYY X;  2VA2 A;  1L1O A;  4JI6 Q;  2AGP A;  4MA5 A;  4IAL A;  3BAB A;  3BQ1 A;  1CA6 A;  1CKN B;  2YTV A;  4DU9 A;  4IUN A;  4DV0 Q;  4JYA L;  2HVS A;  4UHV A;  5I4D A;  2WB1 B;  1FGU A;  2K50 A;  1ZKO A;  4L5T A;  1N8R C;  4ECQ A;  2PO4 A;  4LF9 Q;  2KED A;  5KFZ A;  4KLK A;  4XDX A;  3GTG B;  1S68 A;  5KT6 A;  3I7F A;  1C48 A;  1V51 A;  1BOS A;  2FFK B;  5L1L A;  2W8K A;  3GV6 A;  1G2S A;  2ZM6 Q;  1WTX A;  3GIQ A;  3MWM A;  3GTL H;  5J2U F;  5DG7 A;  1W96 A;  2UXC H;  3OHA A;  3UE0 A;  1Q1B A;  3QWN A;  3RLF A;  3Q8S B;  3S2D B;  5H1S E;  1CS0 A;  4AQY L;  3M3Y B;  3DF7 A;  2W9A A;  4A3F B;  3BQ0 A;  1ROD A;  3DMU A;  4L5S A;  1GOZ A;  3J81 E;  4DV6 L;  2RBM A;  1JXL A;  1E4F T;  1IHZ A;  1TWA H;  3I73 A;  1ZHQ A;  4KKT A;  1JOK A;  1XTC D;  3PUW A;  4K8J A;  4GKK Q;  1KLG D;  3HZX A;  2C22 A;  4L8J A;  3TP6 A;  4MIU A;  3R8B A;  3E9I A;  5KFU A;  1TS4 A;  5KEE A;  1RYS A;  3M4Q A;  3HRZ C;  3GIJ A;  5HV6 A;  4JI1 L;  4L5Q A;  4DUY L;  2VB3 X;  4CC6 A;  4EQP A;  3EQL C;  3IRB A;  4KD3 A;  4DV1 L;  3RBE A;  1TS2 A;  2A6H C;  4FS2 A;  3WWV A;  3S24 A;  4BBR H;  3PSI A;  4O3N A;  4ZCK A;  4EQ5 A;  1IOW A;  3GV7 B;  2RHQ B;  1H9J A;  4XTC S;  2XIW A;  2BQ3 A;  5C4J B;  2FP4 B;  2JA6 A;  4YBZ B;  1UEB A;  5JVL A;  1F2M A;  2D0O A;  2LY7 A;  3OSO A;  3EBE A;  4U68 A;  1K3R A;  3LGJ A;  1T94 A;  4I50 F;  2NUC A;  5LMU H;  2FPP B;  4YJ3 F;  5E3F A;  1HNX H;  1JT8 A;  4JG2 A;  4IUU A;  2BOS A;  4A3E H;  1ONL A;  1G91 A;  5L1I A;  1STG A;  4DR5 Q;  1MGS A;  5C0X J;  3MR6 A;  4J9S A;  2A6H D;  2JA5 A;  3ONA B;  1E0B A;  3SEB A;  1B9M A;  2NVY A;  5JJL A;  3T1Y H;  3UDI A;  3HBL A;  2BE5 C;  5LL6 b;  1U0L A;  4HNT A;  2D0P A;  2W70 A;  4JI3 H;  2G9D A;  2NB0 A;  5T1I A;  5C0X H;  1LTS D;  3A0J A;  3HOU G;  4I65 A;  5M3M H;  3RGX A;  3QOL A;  4YWM A;  1NY4 A;  2O4X A;  5DM6 3;  1J8I A;  4QIW E;  3F2C A;  5KFN A;  3JZI A;  3CMA A;  3KBX A;  2IJ0 A;  1QVG A;  3H3V C;  1EYD A;  4IUR A;  1II3 A;  1LT4 D;  1I6V C;  2YU9 B;  1S3O A;  2KQ3 A;  3CP0 A;  4HJ8 A;  1CM9 A;  4LF4 L;  4N8F A;  3N52 A;  1WTV A;  5IGD A;  4ID6 A;  3H6M A;  4F88 A;  4DF7 A;  2QDL A;  4FM9 A;  2WFW A;  3NWT A;  1GSH A;  5EPJ A;  1W6K A;  3G71 A;  3C46 A;  2K52 A;  1LTA D;  1K28 A;  4LAA A;  2ATW A;  4A3B G;  1PDQ A;  4KMU C;  5IP9 G;  3TZU A;  3VR3 A;  4J9M A;  1D2B A;  2WII B;  1FD7 D;  4NKL A;  5K2M A;  2R6F A;  3RZO B;  3FRP B;  3S16 B;  2YYZ A;  4FF4 A;  1B44 D;  1HR0 W;  4ZKC B;  2XVS A;  5JEA J;  3PO2 H;  1HUN A;  5C1P A;  1S5D D;  1B3Q A;  2Z6K A;  4YY3 L;  4NXN Q;  3HOZ H;  4B3M H;  4LFB H;  5HY6 A;  4HAE A;  1CZW A;  3OUU A;  2PW7 A;  2RA4 A;  4JI2 Q;  3JRW A;  3MXN A;  1D1I A;  1GUN A;  2YZG A;  2R8J A;  1MSG A;  4XT1 B;  2DJF C;  2CHB D;  1PTO H;  4MNO A;  4DAP A;  3WNZ A;  5C3E B;  1F9S A;  1X3F A;  2OTJ A;  3HOX G;  5C8Y F;  3MFI A;  1D7Q A;  2F4V Q;  3K5N A;  5KFW A;  1CKN A;  3N42 B;  2R8G A;  3U50 C;  2VUM G;  4B3T L;  5KKN B;  2G9H D;  4KKS A;  5L37 A;  1XX8 A;  2M00 A;  4ZLT F;  2WB1 A;  4EVO A;  4RA8 A;  2E5L H;  3GTQ B;  4DAY B;  3GTG A;  3HKZ E;  1NAP A;  2IPK D;  2HDL A;  1YHQ A;  3L0O A;  1TWG B;  1TT2 A;  1JOQ A;  3JSN A;  3IAY A;  1B9N A;  5KFJ A;  4PG3 A;  4NXM Q;  3KAL A;  2HDM A;  2ZJP A;  3KF6 B;  1S72 A;  2SNS A;  3M7N A;  1JJG A;  2DWC A;  1Y1W B;  4U6P A;  2KCT A;  4DR7 Q;  4ED1 A;  1EUD B;  3RLO A;  5K36 H;  2ENB A;  4J9K A;  5KFY A;  1J9O A;  1S97 A;  1DXM A;  4MV9 A;  1I7L A;  1HNZ Q;  3BZC A;  3HKZ G;  1X3E A;  4IPD A;  3CCU A;  3QO2 A;  3OTO L;  4V19 0;  3VR5 A;  2FMA A;  1QZG A;  5JUM A;  2HHH H;  4ME6 A;  5KFO A;  2KEE A;  3AFP A;  1AW7 A;  3PO3 G;  4C3H G;  1N32 H;  4ILW A;  4RZR A;  1ENC A;  2GPW A;  2IX0 A;  4B3R H;  1F9P A;  4AYB E;  4DK1 A;  3EA6 A;  1YNN C;  4ULL A;  3KF8 B;  1GM5 A;  1EQT A;  3J80 L;  3OUZ A;  1J5E H;  4DPG A;  1Q8I A;  2HGS A;  1I7N A;  3H4D A;  5C4X B;  4JI5 Q;  3I3C A;  5IGB A;  5IYC G;  3QZ8 A;  3OHB A;  2AGO A;  3GQB A;  4APV A;  5E1F A;  5IT9 E;  5BN3 A;  4PMW A;  1IKL A;  2R61 A;  2VA3 A;  4FO2 A;  3TEH B;  1JOR A;  4AYB G;  2LKV A;  2CW8 A;  4JI7 L;  3RF2 A;  3MXU A;  1KRS A;  2VY3 A;  2J0T D;  4DV2 H;  1RF2 D;  3MJF A;  1B8A A;  3RAQ A;  3VYU A;  2F3I A;  4HED A;  4JI8 H;  1N34 Q;  2MO1 A;  1WTP A;  1UWV A;  4B3S H;  3ETH A;  4X64 Q;  3K0X A;  1KIX A;  4H0L C;  4LFC H;  4DNR B;  3PIO A;  4MV6 A;  4RUA A;  2NUA B;  2YRW A;  3QG1 A;  4JPB W;  4FF3 A;  1SRU A;  3PQI A;  3KLS X;  1PK8 A;  3H20 A;  3TS0 A;  1A15 A;  1I50 B;  2B2W C;  2D9U A;  4IZ8 A;  4C1N K;  3JAM L;  2UUC L;  2R92 G;  2EYJ A;  1B3A A;  4C2M B;  1RK6 A;  1RYR A;  3G8C A;  4OX9 Q;  4MN3 A;  2F0I A;  1UNN C;  2JK8 A;  3I4M B;  4MTK A;  3TRE A;  3K3P A;  3O13 A;  4IOC A;  1SJH D;  1JLL B;  1XMO L;  4DV3 L;  2JSO A;  1ZEQ X;  4QGU A;  1VDZ A;  2F0J A;  2K01 A;  3W1G A;  4ZUJ A;  4JYA H;  4R4T A;  2IX3 A;  1U4L A;  1IBM L;  1ILP A;  3D31 A;  1JE4 A;  2HCI A;  2R86 A;  2K14 A;  3CRK C;  4LMY A;  2CQA A;  1CHQ D;  3HB9 A;  3WOE A;  2EOT A;  3IG0 A;  4C3I G;  2F0D A;  1IOV A;  2MP1 A;  2EXZ A;  4A4I A;  2YU9 A;  4EBD A;  2EPB A;  3T51 B;  2C2E A;  4I7A A;  1X6O A;  3LX0 A;  2EYO A;  1B4O A;  1T36 A;  5EPK A;  4UCR A;  2JJQ A;  3MR5 A;  5IGE A;  2JP1 A;  1K1Q A;  1QG7 A;  4AQY H;  4RGO S;  1C0A A;  1HRJ A;  5IOD A;  4I55 F;  3GTJ B;  4JV5 L;  1FYC A;  3CCM A;  4JV1 A;  4DR6 Q;  3VPC A;  1AFP A;  5FLM G;  2BCO A;  4DV6 H;  3STB C;  4POF A;  3G6V A;  3S9W A;  2NVT H;  2RGV A;  4A3I B;  4L5R C;  3ORR A;  2PCF B;  4LUO A;  1PH3 A;  2UUB H;  3KUP A;  1P8L A;  4S3S A;  1IBL L;  3NEM A;  1EY9 A;  3PIP 3;  4GN5 A;  3F2D A;  1I6H H;  2LMC B;  4TKO B;  3RV4 A;  2UXB H;  3CW2 C;  1X32 A;  2QGQ A;  4JI6 L;  2UXD Q;  3R5X A;  4Q5V A;  2F03 A;  5KIX A;  3GTM B;  2R7Z B;  2J7Z A;  4JI1 H;  3F1Z A;  5JEA G;  3Q8D A;  3CF5 A;  3M9O B;  4DV1 H;  4L1K A;  1A6X A;  3NTI A;  4LF9 L;  2F0T A;  5KFV A;  4I4T F;  5COR A;  1LAC A;  2M05 A;  2EE1 A;  4U7C A;  4A75 A;  3NEL A;  3AQQ A;  1CQF A;  3S15 B;  3M9B A;  4IUV A;  1C3O A;  4JI4 H;  4DAY A;  1M1K C;  2WB1 E;  1RDP D;  1TWG A;  1PRT C;  2RSO A;  3I4N H;  2CZG A;  1M7J A;  2QEJ C;  5J1Z A;  3MHB A;  3DXJ C;  4XXE A;  1DD2 A;  5C1O A;  1I3Q H;  3KF6 A;  1LTT D;  1H9K A;  5EWG A;  4M8A A;  4DV5 H;  2VZA A;  1BF4 A;  2UU9 L;  1N33 Q;  5KFM A;  3PW0 A;  4WJ4 A;  2WE6 A;  4UCS A;  4CBV A;  3K59 A;  2K5H A;  1GXD C;  3UDG A;  3ORQ A;  2CVR A;  4DGZ A;  4GKK L;  1E2W A;  5M5Y B;  3PR4 A;  2KCM A;  1E4G T;  2EY2 A;  1DJR D;  1L0Y B;  3N6R A;  3IFD A;  4A3L G;  2C9O A;  3DHQ A;  3NQT A;  2QKI C;  5IGC A;  3I4O A;  5IY0 A;  3GII A;  3FKI G;  1B7Y B;  2IY5 B;  5M3F H;  5A35 A;  1PRT D;  4KN7 C;  3BJU A;  3H40 A;  2HVR A;  2UXC L;  3BYY B;  3KF8 A;  2TSS A;  4ED8 A;  1XPU A;  1YIT A;  5C44 B;  3DWA A;  2E2I B;  4K0K H;  1TII D;  3OPO A;  1DZ1 A;  4A3F G;  1Q81 C;  1E22 A;  2CW0 C;  3SHL A;  4A3G B;  1X56 A;  1GD7 A;  1Z9F A;  2BQU A;  2LS0 1;  2ICI A;  3K5O A;  5AFW A;  2K75 A;  1VQI A;  4I7H A;  3V4Z A;  1FGB D;  1GLV A;  2W6M A;  4Q45 A;  4DV4 Q;  5FLX W;  3NQI A;  4QIW B;  5DGA A;  1Q82 C;  5A2Q W;  3PW7 A;  2RDI A;  4RB1 A;  2FLL A;  4M9U A;  3TQ1 A;  3G7L A;  1XWE A;  3FMA A;  4HIM A;  1KJQ A;  3NXW A;  1JE5 A;  5LMN L;  5I6W A;  2A6E C;  4A3M G;  1OTC A;  2FK2 A;  2F0W A;  3RV3 A;  4PDB A;  1BBW A;  4HJ9 A;  2XC9 A;  1KNE A;  2EZV A;  2LXK A;  3GTK B;  1IKM A;  4P71 A;  1SYF A;  3MTS A;  4O3P A;  5DLG A;  4RGT A;  2B63 A;  5IE8 A;  1KD1 C;  2HVQ A;  1CSP A;  1WD1 A;  2AKW B;  1I50 A;  1PFS A;  1RKN A;  3UDX A;  2SCU B;  3K5H A;  4C2M A;  1S9F A;  4XIG S;  5FLX c;  1U4P A;  2I46 A;  4G7Z C;  4YAK B;  5I2Y A;  4JC0 A;  4K5W A;  2XGT A;  1KAW A;  3CME A;  1QNU A;  1CKM A;  1KL9 A;  5GQO A;  3HOX B;  3NEN A;  1V8Q A;  5LMU L;  4CDC C;  2BH2 A;  1CK1 A;  4B3T H;  2VUM B;  2EY5 A;  4FXD A;  2DY8 A;  4UAI A;  3UDF A;  2MNA A;  3CPF A;  3RUP A;  2IMW P;  3T16 A;  4EFB A;  2KCN A;  2PBZ A;  3PUZ A;  2A73 B;  3C1E A;  2O2L D;  1LT6 D;  3M4P A;  4OGQ C;  4DUZ H;  1KAB A;  3N40 P;  2W6Z A;  4C3J B;  2AWN A;  3KJO A;  1H9R A;  3SGI A;  2AMC B;  5IGF A;  2ZJT A;  4KV6 A;  1EY8 A;  3EIV A;  1RCV D;  4LSX A;  3GTJ A;  1FVI A;  2EIF A;  4A93 G;  1A9X A;  3BS1 A;  5CBA E;  2B3G A;  4Q43 A;  1SE8 A;  1R9T H;  1V1O A;  2NYZ D;  2YTX A;  2PN1 A;  4O3Q A;  1HJP A;  4GKJ Q;  2L1B A;  4NXN L;  2D5D A;  1WTQ A;  3PO3 B;  3F2U A;  3H0G H;  1X3G A;  3L4J A;  2NZH A;  4J9L A;  4A3D H;  4F7X A;  3S1M B;  1WJJ A;  2AQ3 B;  5KFS A;  4XX0 B;  2K33 A;  2KJX A;  2DNC A;  4WOR A;  2FHT A;  2HD3 A;  1KC8 C;  4LFA Q;  4IFD J;  4YJ2 F;  3MXP A;  3GDE A;  2XGP A;  4DR2 Q;  1STY A;  1U5K A;  1WD0 A;  1BCP C;  2F4V L;  3P20 A;  4J9P A;  3SK5 A;  4DL6 A;  5KFH A;  1ZET A;  3GTM A;  1NMG A;  4BBR B;  1VQK A;  1SXT A;  2X69 A;  3IL8 A;  1SFO H;  3Q24 A;  3PGZ A;  3RTX A;  4DL7 A;  4HNV A;  3AYH B;  3JRX A;  4MV8 A;  3PZP A;  3D8G A;  5IOC A;  2EY1 A;  4AYB B;  3MAQ A;  2IT1 A;  3F8T A;  2B2Y A;  4O2B F;  5KYI A;  2RQX A;  4NXM L;  2VB2 X;  4FF1 A;  4ZRZ A;  1CQJ B;  1Q86 C;  1V1P B;  3KK7 A;  3JC6 6;  2L4N A;  3DLL A;  1S0N A;  2ZTE A;  5L1K A;  2F52 A;  1IBK Q;  1EOT A;  4B3M L;  1SSO A;  2EYM A;  5DEH A;  3KHH A;  4F8M A;  4FXG C;  4J0M A;  3UFX B;  4JVZ A;  1HNZ L;  3HOW G;  4B9W A;  3L3O C;  4DR3 Q;  1G6P A;  4RHR A;  5GAG C;  4NP5 A;  4MTN A;  3GTO H;  3RB0 A;  2ASD A;  5FK9 C;  4O0A A;  2WAQ B;  4EYH B;  1NBW A;  5LL6 S;  1ZQ7 A;  2VW9 A;  4LF8 Q;  2UUC H;  1DYQ A;  2R92 B;  4MTE A;  2F0N A;  3PVX A;  2E5L L;  4QWD A;  1SNO A;  1WYD A;  4WFN 3;  4ECY A;  4ECW A;  5M3M B;  4ED7 A;  2RHS B;  5I2X A;  5JJZ A;  3PN1 A;  4DV3 H;  1STA A;  3RN5 A;  1XMO H;  2WIN B;  1SE3 A;  5BPF A;  1HFN A;  1IBM H;  1Y1W G;  2CW7 A;  2K28 A;  3R5F A;  1BQQ T;  2QIL A;  5KRU A;  3SE0 A;  1PFM A;  2AUK A;  2E2I A;  1NCV A;  2VXW A;  4EEY A;  5IP7 H;  5KG0 A;  1QJO A;  4C3I B;  2SNM A;  1Y8O B;  4HCE A;  4YHH L;  5ELD A;  5CV8 A;  4J15 A;  2ATL A;  5JVG 3;  3P1H A;  4MHE A;  4LH6 A;  1EIH A;  5KT2 A;  1XMQ Q;  4JI0 H;  1HNW Q;  4X64 L;  4QIW A;  1E2Z A;  1JB3 A;  2JA8 G;  4HSP A;  4RGM A;  4G57 A;  3M4O B;  4XYO A;  1ESR A;  1ICW A;  3F2B A;  4A3C H;  3M4Y A;  4PQX A;  1E2V A;  1GO3 E;  1EYG A;  1KJ8 A;  3U9O A;  1ULZ A;  1GHJ A;  2PI2 E;  1IYV A;  3T5L A;  1TWC B;  4X65 Q;  4HJA A;  3KOJ A;  3BA9 A;  3GTK A;  1IYU A;  1ASZ A;  3BYT B;  4ME5 A;  3QJY A;  4OX9 L;  3GIM A;  1IBL H;  5C5J A;  3PO2 B;  1EZ8 A;  4ED0 A;  1I4H A;  5KFP A;  1EFW A;  5IYB H;  2R93 B;  4TSS A;  1EWI A;  3CCV A;  4LH7 A;  4JI6 H;  1NTG A;  4RHS A;  4XQJ A;  4YB8 B;  5KG5 A;  1E4E B;  3HOU H;  1K8A C;  5LP6 F;  4X66 Q;  4DV0 H;  1PH4 A;  4DV7 Q;  4KTA A;  4E4T A;  3U4V A;  1T5X D;  4LF9 H;  1X3Q A;  1ZXT A;  3TP8 A;  4ZHQ F;  4KHP Q;  3GD7 A;  2ZM6 H;  2VUM A;  2F0H A;  4DKA C;  3RN2 A;  5EKI A;  2J6T A;  5KG4 A;  4ECZ A;  3CKI B;  1B1Z A;  1JDB B;  2JA7 B;  2DY7 A;  2A68 C;  5LXT F;  4CKC A;  1GUT A;  4DR6 L;  1EFI D;  3L9A X;  1HHV A;  3QIA A;  1ET6 A;  2PZW A;  3DEO A;  1RJT A;  4IRD A;  1PZJ D;  3G48 A;  3OMC A;  4JBM A;  5IP9 H;  1L2Z A;  3T56 B;  1PH7 A;  1FNW A;  4J8Q A;  1RJQ A;  4P72 A;  4XYM B;  3HKZ A;  5EPL A;  4GKK H;  3K3V A;  2I0Q A;  5GON F;  3PCO B;  2QK4 A;  1Q46 A;  4F4W A;  4F4X A;  2GPS A;  3KAJ A;  2F3W A;  3KJP A;  3FKI B;  3D6W A;  2A68 D;  3RR5 A;  1BR9 A;  3S2H H;  2VQE Q;  1N9W A;  3D3R A;  1WCM H;  3FP9 A;  1S4Z A;  2C35 B;  5EDW A;  1AN7 A;  1TAE A;  2W57 A;  5BR8 Q;  2YV5 A;  1RIP A;  1GVP A;  3PW2 A;  2F0K A;  4QF4 A;  4R9W A;  2ICE C;  4IFD G;  1JIH A;  5ELE A;  4RFB A;  2EJG C;  3SR1 A;  1IXR A;  1DOM A;  4AYB A;  3MZ5 A;  2PQA B;  5KT5 A;  3K8A A;  4A3I G;  2UUB L;  1HZA A;  5EKK A;  3CXC A;  3RZD B;  3J80 W;  3M9N B;  2N3S A;  2B2T C;  1T5E A;  5ELC A;  1EQV A;  3QFF A;  3K5L A;  4P74 A;  3MFH A;  4KJO A;  2CH4 A;  2UXB L;  4BY1 H;  1N33 L;  2R8H A;  5LMN H;  1STE A;  3NTK A;  4A3M B;  1Z47 A;  1YI2 A;  2R7Z G;  3ETJ A;  4TQR A;  1RJR A;  4UCT A;  3PW5 A;  4OIK A;  4RGN A;  4JW0 A;  2ASL A;  2QA4 A;  4BWG B;  2NZ1 D;  3WOF A;  3CAM A;  1S5C D;  5M5X B;  2NN6 H;  2XSC A;  3BG5 A;  4C3H H;  4APM A;  4C56 C;  2EDG A;  2Z9H A;  2KHI A;  2RDG A;  1MJC A;  1M0T A;  1WOC A;  4EGJ A;  2R92 A;  4JI4 L;  3S17 B;  3J80 c;  2O5J C;  3H4B A;  1FJG Q;  3WO1 A;  2L55 A;  3RAX A;  3K5I A;  4DFA A;  1K83 B;  4CC5 A;  2FLN A;  4EGQ A;  2A69 C;  2NVQ B;  3BDL A;  3CQZ B;  5TSS A;  4HIK A;  4NLG A;  4J9N A;  4DV5 L;  3NGD A;  1YNJ C;  3ULP A;  3BAA A;  3JAM W;  5KT7 A;  3TBI B;  4DAM A;  1YJN A;  1JWU D;  1XTD A;  2GVB A;  1Q8K A;  3MR3 A;  5J3B A;  2V5A A;  1SMY C;  1RHP A;  1TWF B;  3A8I E;  1I94 Q;  2E2D C;  3M4I A;  2CFM A;  4NW2 A;  1B04 A;  1SDF A;  4QWB A;  2EVB A;  3A74 A;  3TME A;  1EUJ A;  4OO1 G;  3BA8 A;  2RKS A;  4A93 B;  2W9B B;  1OXU A;  2A69 D;  4JBW A;  1WTR A;  5C44 G;  2Q8R E;  4EBE A;  4OWT B;  3CCE A;  4BY7 H;  4A3J B;  1K8G A;  1ET9 A;  3J80 i;  3CC2 A;  4K0K L;  4NXN H;  1YNJ D;  3JAM c;  4A3G G;  4MV1 A;  1R4Q B;  1Y1V G;  1TWC A;  3KDF A;  4CKB A;  3S1Q B;  3M7G A;  2RCN A;  2JA6 H;  4JI2 H;  3K7A H;  5DM7 3;  3SK6 A;  5EAY A;  4B08 A;  5EJW A;  2R93 A;  1SMY D;  1EHI A;  4C5B A;  2DJG C;  4QB4 A;  5KX5 F;  2NVX B;  1E4E A;  3K80 C;  2F4V H;  3ERQ A;  4PWQ A;  1SLJ A;  2MHV A;  3A5U A;  2F0O A;  2C2D A;  5I6Y A;  3EVQ A;  2YL2 A;  1F9R A;  2CKZ B;  3TRZ A;  1CFM A;  2EY6 A;  2ZDG A;  4J1M A;  2JA5 H;  3RGZ A;  2NVY H;  3RMH A;  4NXM H;  3PMF A;  1JKJ B;  2HJW A;  1BDO A;  4R4Q A;  4O2A F;  1PTO C;  4MTD A;  4G7H C;  1SBB B;  2HUG A;  2JA7 A;  4R8I A;  2ZTC A;  3QZ7 A;  3V96 A;  5ISR A;  1HNZ H;  1EY4 A;  5T1G A;  3BZD B;  4FNF A;  5M5W B;  3JAM i;  1Y69 U;  2IX1 A;  3HOW B;  1RJP A;  3NK9 A;  4A2B A;  5KT4 A;  2NTS A;  2WKD A;  1SEI A;  2XCL A;  1M90 C;  2VQD A;  2RDH A;  2FMC A;  4DR1 Q;  1KTK A;  4GKJ L;  1UE1 A;  4UDU C;  1PRT B;  1TWH B;  3OW2 A;  1Y14 B;  1F2Z A;  4NB3 A;  3D4W A;  2EQS A;  4LFA L;  1D5M C;  1VQ6 A;  2AGQ A;  5BPH A;  4RB2 C;  1PTO D;  1TKW B;  1CHP D;  4GN3 B;  3K5M A;  4DR2 L;  1PH2 A;  4O4H F;  4JI5 H;  4DUZ L;  5KFF A;  3FPP A;  4RB0 A;  4WD3 A;  3FKI A;  2YTY A;  3FPU B;  2G5D A;  4C3J G;  5COY A;  4MZ9 A;  2KHS A;  3T53 B;  4GLX A;  3T1H L;  3MWE A;  4ZQI A;  1D5Z C;  1A2U A;  5C6A A; 
#chains in the Genus database with same CATH homology
 4H02 A;  1M1K C;  3T1H Q;  1K9M C;  2WB1 E;  1VQC A;  1NMF A;  3J7Z C;  1YBY A;  3RNU A;  3GTP H;  3KFU A;  2ALY B;  4C3J H;  3I4N H;  2UUA Q;  1I3Q H;  3KF6 A;  1A8V A;  4PZ8 A;  4UP8 A;  3CCR A;  1YJW A;  4BA2 I;  2QEX A;  4A3I H;  1IBK L;  2Z0S A;  2VZA A;  2UU9 L;  1N33 Q;  2PQA A;  4KI0 A;  1VQ8 A;  4WJ4 A;  1B70 B;  1BKB A;  1V43 A;  1VQP A;  4FDB A;  4HJ5 A;  2Q2H A;  3PF4 A;  4LFB L;  2E2H H;  4JI0 Q;  2K5H A;  2UU9 Q;  1L0W A;  3UDG A;  4DR3 L;  4LNQ A;  4GKK L;  3S1R H;  3PO3 H;  2DGY A;  2GN5 A;  2GVA A;  2L15 A;  2KCM A;  3S1M H;  2XTI A;  1GKH A;  1SRO A;  4GOP B;  4A3L G;  5C3E G;  3PUX A;  5IY0 A;  1I5F A;  3I4O A;  1X65 A;  2I5L X;  4BBR G;  1NE3 A;  4JOI C;  1PH8 A;  3FKI G;  1B7Y B;  1E24 A;  2IY5 B;  2OQ0 A;  4LF6 L;  2KEN A;  5M3F H;  3BJU A;  3HKS A;  2UXC L;  2AHO B;  3GTG H;  2A1A A;  4LF6 Q;  1XPU A;  1YIT A;  1YHA A;  5IYC H;  1XNR L;  1PH9 A;  1EQR A;  2H5X A;  2UXC Q;  2WAQ E;  4R4O A;  5LMN W;  4A3F G;  1Q81 C;  4WJ3 M;  1E22 A;  2LSS A;  3K81 C;  1SMX A;  2HIX A;  2N78 A;  1X56 A;  5IP7 G;  1GD7 A;  4NXN Q;  1Z9F A;  4UP9 A;  3S2D H;  4DV4 L;  2K75 A;  3CC4 A;  1VQI A;  1LTL A;  1DGS A;  1EIF A;  2CWP A;  3M3Y H;  4GOP C;  2CQO A;  4A3E G;  3H15 A;  4A3F H;  4DV4 Q;  1N36 L;  4IJH A;  1Q82 C;  2WAQ G;  1S40 A;  4QJF A;  1YNX A;  4HIM A;  1JE5 A;  5LMN L;  2HHH L;  4A3M G;  1XMQ L;  1OTC A;  4TVA B;  4A3C G;  1JMC A;  1VQ9 A;  1BBW A;  1KXL A;  4HJ9 A;  5LMN Q;  1D8L A;  5C0X G;  2LXK A;  2I5M X;  2NZO A;  2CCZ A;  4UY8 C;  4Y7N H;  4GS3 A;  1Q7Y C;  4P71 A;  4R4I A;  2UUC Q;  1VQA A;  4POG A;  3HOV G;  4B3R L;  2KBN A;  5M3M G;  5IE8 A;  1KD1 C;  4HJ7 A;  4BBS G;  1YHB A;  1J5E L;  1CSP A;  2AKW B;  2R92 H;  5IYB G;  1VQ5 A;  5C4X G;  4X65 L;  1PVO A;  4IPH A;  1PFS A;  3UDX A;  1XMO Q;  4DV3 Q;  1VQN A;  2E2J H;  4XIG S;  5FLX c;  3CCL A;  3KDF B;  1E1O A;  1IBM Q;  3J81 c;  1EIY B;  1Y1V H;  5IYD G;  2ES2 A;  1EOV A;  4JC0 A;  4X6A H;  2WP8 J;  2XGT A;  1KAW A;  3CME A;  1CKM A;  1KL9 A;  5GQO A;  5E7N A;  3NEN A;  1KRT A;  4X66 L;  5LMU L;  4DV7 L;  1YIJ A;  1XPO A;  5FJ8 G;  3HFZ B;  4DV2 L;  1X9N A;  4LF5 L;  2E8G A;  1X55 A;  2Q2U A;  1AH9 A;  5LMU Q;  3UDF A;  1HNX Q;  2MNA A;  3CPF A;  4KHP L;  4JI8 L;  4C3I H;  3G4S A;  1KQS A;  3E0E A;  3PUZ A;  3M4P A;  3I55 A;  4B3S L;  1Q1E A;  1JJC B;  1V9P A;  3T1Y Q;  1V1Q A;  4LFC L;  3W5O A;  2AWN A;  2R7D A;  1C9O A;  1LYL A;  1CUK A;  3H3V H;  4ALP A;  3KJO A;  1VQF A;  1VCI A;  4TQU S;  1VQH A;  2AMC B;  1PYB A;  3SGI A;  4JI3 Q;  2B63 G;  1P16 A;  5GAH C;  1HH2 P;  3EIV A;  3M4O H;  1JB7 A;  3PO2 G;  1FVI A;  2EIF A;  4GN4 B;  1XNQ L;  4A93 G;  3HOZ G;  1H95 A;  5IWA L;  2B3G A;  5FLM H;  2R93 G;  1SE8 A;  1R9T H;  2YTX A;  3PV0 A;  2VQF L;  1IBL Q;  3ULL A;  1XNQ Q;  1HJP A;  1TXY A;  3MXN B;  4PZ6 A;  2ASB A;  3I4M G;  3E9H A;  1TWC H;  4GKJ Q;  2DUD A;  4NXN L;  1PV4 A;  2VQF Q;  3H0G H;  4DV0 L;  1X3G A;  3J81 i;  2NZH A;  3CCQ A;  1L1O A;  1PH6 A;  4JI6 Q;  4A3D H;  1WJJ A;  3HOY H;  2HIV A;  5JJI A;  1CKN B;  2YTV A;  2R93 H;  3BU2 A;  4DV0 Q;  4JYA L;  1KC8 C;  4LFA Q;  4IFD J;  1FGU A;  3AEV A;  2K50 A;  4L5T A;  1N8R C;  1WCM G;  2ID0 A;  3GDE A;  2ZM6 L;  4LF9 Q;  4DR2 Q;  4GLA C;  1U5K A;  4KLK A;  1CKO A;  3I7F A;  2F4V L;  4HIO A;  1HZC A;  3GO5 A;  5ELO A;  2YU9 H;  1YEZ A;  2Z6K C;  2VQE L;  2ZJQ A;  1VQB A;  1NMG A;  2B29 A;  2ZM6 Q;  4HID A;  1VQK A;  3ZJY C;  2OQK A;  2JA7 G;  1OXV A;  3GTL H;  1SFO H;  3PGZ A;  3CD6 A;  3AYH B;  1K0R A;  3UE0 A;  3J81 j;  4LWC A;  1Q1B A;  3RLF A;  4DNI A;  4QQB X;  2IT1 A;  3F8T A;  4OON A;  3TS2 A;  1OXT A;  4BA1 I;  5H1S E;  2CWA A;  4AQY L;  4NXM L;  5K36 G;  4IO9 A;  1VQ4 A;  2JA7 H;  1Q86 C;  2ZJR A;  3JC6 6;  3DLL A;  2BA0 A;  2ZTE A;  2F52 A;  1IBK Q;  4B3M L;  4L5S A;  4JOI A;  1UE7 A;  3K7U C;  4DV6 L;  1LM0 A;  1IZ6 A;  2N49 A;  4BY1 G;  1TWA H;  1QZH A;  3S16 H;  4LFB Q;  4B3M Q;  1HNZ L;  3HOW G;  2OWO A;  4DR3 Q;  3PUW A;  1G6P A;  1IYJ B;  5GAG C;  4R4C A;  4GKK Q;  4MTN A;  3GTO H;  2AWO A;  4O0A A;  2MQH A;  4LF8 L;  4ME3 A;  2V1C C;  3E9I A;  1NBW A;  2NN6 G;  2VW9 A;  4JBJ A;  4LF8 Q;  3M4Q A;  4JI1 L;  4L5Q A;  4UP7 A;  4DUY L;  2E5L L;  1WYD A;  3IRB A;  5C3E H;  4DV1 L;  4A3L H;  1VQG A;  4LF7 L;  4GOP A;  3WWV A;  3PUY A;  3S24 A;  4BBR H;  3PSI A;  3NBH B;  3FKI H;  4JI1 Q;  4DUY Q;  2E5L Q;  3AFQ A;  4DV1 Q;  4EQ5 A;  1XNR Q;  2RHQ B;  2JA9 A;  2RHS B;  3RN5 A;  4XTC S;  1FJG L;  4OO1 I;  3GTQ H;  1Y1W G;  1AE2 A;  1UEB A;  3CCS A;  4O2D A;  2D0O A;  1TWG H;  3EBE A;  1K3R A;  5IP7 H;  3RLN A;  3LGJ A;  1N36 Q;  3ICE A;  4YCW A;  4P73 A;  1E3P A;  4YHH L;  2K4K A;  3PUV A;  2PI2 A;  2I5H A;  4J15 A;  4DK3 C;  4DR5 L;  1YJ9 A;  1VQM A;  1HNW L;  1JT8 A;  4JG2 A;  3TQY A;  4A3E H;  3RZD H;  4YHH Q;  1XJV A;  1PHJ A;  4DR5 Q;  2HHH Q;  5C0X J;  1SR3 A;  4YCV A;  1XMQ Q;  1HNW Q;  4X64 L;  1OXS C;  5JJL A;  3UDI A;  2JA8 G;  1N32 Q;  2K5N A;  4A3M H;  1U0L A;  4B3R Q;  2D0P A;  3F2B A;  4A3C H;  3B6Y A;  1GO3 E;  4BY7 G;  3G6E A;  4LW1 A;  1C7Y A;  1EYG A;  1J5E Q;  4P75 A;  3A0J A;  2PI2 E;  2R6G A;  3HOV H;  4X65 Q;  3HOU G;  4HJA A;  3KOJ A;  5M5X H;  1ASZ A;  5M3M H;  1NJI C;  4OX9 L;  4BBS H;  2JA6 G;  1UE6 A;  5C4X H;  4YWM A;  5IYB H;  5AJ3 L;  1NY4 A;  2BH8 A;  3FHW A;  1EFW A;  5C4J H;  4LUV A;  4QIW E;  3F2C A;  2A8V A;  1EWI A;  1KHI A;  3CCV A;  3S17 H;  1NTG A;  3HOU H;  1K8A C;  3CMA A;  1QVG A;  4X66 Q;  1PH4 A;  4DV7 Q;  5IYD H;  1K83 H;  1LUZ A;  3L7Z C;  3ERS X;  4YCU A;  4DV2 Q;  4LF5 Q;  4OWW B;  1S3O A;  3CPW A;  3U4V A;  3CP0 A;  2NVQ H;  4HJ8 A;  3CQZ H;  1SN8 A;  1MIU A;  4LF4 L;  2JEA I;  4KHP Q;  1QVF A;  4JI8 Q;  5FJ8 H;  3GD7 A;  2JA5 G;  4LF4 Q;  4B3S Q;  4DKA C;  2WFW A;  3RN2 A;  3G71 A;  4LFC Q;  2K52 A;  2JQO A;  1PH5 A;  5HGQ A;  1JJ2 A;  2ATW A;  4DR4 L;  4A3B G;  2Y0S G;  1N32 L;  1TWF H;  5IP9 G;  1VQE A;  1RL2 A;  1VQJ A;  5IT9 c;  4A3J G;  4DR6 L;  4IFD I;  4OWX B;  5IWA Q;  2B63 H;  1BVS A;  2YYZ A;  4X62 L;  1HR0 W;  3ULJ A;  4LUZ A;  5GRO A;  5JEA J;  3MEF A;  3G48 A;  3PO2 H;  1I50 H;  2Z6K A;  3OYY A;  4YY3 L;  4IPG A;  5IP9 H;  4JBM A;  1PH7 A;  5HY6 A;  4JI2 L;  4C2M H;  2IHF A;  4KHZ A;  1ASY A;  1VQ7 A;  4P72 A;  4A3J H;  4YY3 Q;  1BBU A;  3I4M H;  1QVC A;  4JI2 Q;  4R1J A;  2VNU D;  1L1O B;  2I0Q A;  4JYA Q;  3PCO B;  3UE1 A;  1Q46 A;  2RF4 A;  4MNO A;  3S1Q H;  2EXD A;  3BZK A;  3KJP A;  1QUQ B;  1X3F A;  2OTJ A;  3HOX G;  1D7Q A;  2F4V Q;  1CKN A;  3RR5 A;  3U50 C;  2VUM G;  4B3T L;  3S2H H;  2VQE Q;  1HR0 L;  2Q2T A;  1N9W A;  4GNX B;  1A63 A;  5BR8 L;  1WCM H;  3FP9 A;  2NVX H;  4OXP A;  2C35 B;  4DAY B;  1W2B A;  4YWK A;  3HKZ E;  5BR8 Q;  2PNH A;  2JEB I;  1YHQ A;  3L0O A;  2YV5 A;  1RIP A;  1GVP A;  2MO0 A;  4PG3 A;  3CCJ A;  4AQY Q;  4NXM Q;  4IFD G;  2ZJP A;  4DR7 L;  3KF6 B;  3STB D;  1A0I A;  1S72 A;  1PH1 A;  3M7N A;  1IXR A;  1JJG A;  4JBK A;  3RZO H;  4YWL A;  2KCT A;  4DR7 Q;  2PQA B;  3RLO A;  3K8A A;  3GTJ H;  1G51 A;  4DV6 Q;  3VDY A;  4A3I G;  2UUB L;  1HZA A;  3CXC A;  2UUA L;  2N3S A;  1HNZ Q;  3BZC A;  3HKZ G;  1X3E A;  4IPD A;  3CCU A;  2UUB Q;  3ER0 A;  4P74 A;  3OTO L;  1YZ6 A;  4IOA A;  2UXB L;  4GNX C;  1QZG A;  4BY1 H;  1N33 L;  3AFP A;  5M5W H;  3OTO Q;  3PO3 G;  3HOW H;  1Z47 A;  1YI2 A;  2R7Z G;  4JI0 L;  1VS0 A;  2UXB Q;  2FXQ A;  1OXX K;  3J7A 5;  2IX0 A;  2QA4 A;  4RMF A;  4AYB E;  1TWH H;  3CAM A;  2WB1 G;  4JI5 L;  1GM5 A;  1W3S A;  3KF8 B;  5M3F G;  4LF7 Q;  4A76 A;  4DPG A;  4EX5 A;  4C3H H;  2R7Z H;  3GTM H;  4JI5 Q;  2KHI A;  5IYC G;  1MJC A;  1WOC A;  1MKH A;  4APV A;  4JI4 L;  2BA1 A;  3J80 c;  4A3K G;  1FJG Q;  4PMW A;  5C0X I;  2OCE A;  4JI4 Q;  1IL2 A;  4Y52 H;  2D62 A;  3TEH B;  4AYB G;  2HT1 A;  4JI7 L;  3U4Z A;  1KRS A;  3U58 A;  1Y1W H;  2VY3 A;  3S15 H;  4HIK A;  1CSQ A;  4DV5 L;  1N34 L;  4A3K H;  4JI7 Q;  3ULP A;  1B8A A;  2F3I A;  1L2F A;  4DAM A;  4DV5 Q;  2JE6 I;  1YJN A;  1N34 Q;  1VQO A;  3S1N H;  2MO1 A;  4AH6 A;  1UWV A;  1I94 L;  2GVB A;  1XTD A;  1Q8K A;  4X64 Q;  3K0X A;  5J3B A;  1KIX A;  3PIO A;  4IPC A;  1I94 Q;  2CFM A;  1HZ9 A;  2MFI A;  2ZTD A;  1K73 C;  2IHE A;  3A74 A;  1EUJ A;  2A19 A;  4OO1 G;  2JA8 H;  3H3V I;  2HQL A;  1SRU A;  3KLW A;  5M5Y H;  3TS0 A;  2UUC L;  2R92 G;  4PZ7 A;  1OXU A;  4JBW A;  5C44 G;  4OX9 Q;  4OWT B;  5GAD C;  3CCE A;  4BY7 H;  1K8G A;  1HZB A;  4BXX G;  1VQL A;  4K0K L;  2JK8 A;  1Q12 A;  3J80 i;  5AJ3 Q;  3CC2 A;  3TRE A;  3JAM c;  1XPR A;  4A3G G;  5JJK A;  1WI5 A;  2N8N A;  1Y1V G;  4IOC A;  2Y0S E;  3KDF A;  4DV3 L;  1XMO L;  4K0K Q;  2JA6 H;  2RCN A;  3K7A H;  4QGU A;  3W1G A;  3PF5 A;  4R4T A;  5C44 H;  1IBM L;  3I56 A;  5EAY A;  2E2I H;  4BXX H;  3D31 A;  1E1T A;  2K14 A;  5DLQ E;  1MJE A;  4A3G H;  4IJL A;  3K80 C;  4DK6 C;  1SLJ A;  3A5U A;  1PA6 A;  5GAE C;  3S14 H;  4QY7 A;  1T9H A;  2LXJ A;  2R7F A;  3W1B A;  2KHJ A;  4A4I A;  2VL6 A;  2CKZ B;  3TRZ A;  1X6O A;  1EQQ A;  1HNX L;  2JA5 H;  1UE5 A;  2NVY H;  4DR4 Q;  2JJQ A;  1O7I A;  1FL0 A;  2K5V A;  3M85 A;  1WFQ A;  1C0A A;  3T1Y L;  3PIP A;  3CCM A;  4R4Q A;  4JV5 L;  4DR6 Q;  4A3B H;  5FLM G;  4X62 Q;  4JV5 Q;  4JI3 L;  1E7Z A;  2BH2 A;  3STB C;  2VS1 A;  4POF A;  2ZTC A;  2OTL A;  3GTK H;  4QL5 A;  4A93 H;  1PYS B;  4RG1 A;  2IX1 A;  2NVT H;  1AE3 A;  3KYH C;  2PMZ E;  3JAM i;  1VQD A;  3H0G G;  4LUO A;  4DR1 L;  1PH3 A;  4L5R C;  1YVC A;  4A3D G;  1P8L A;  3L2P A;  1M90 C;  1IBL L;  3HOY G;  3NEM A;  2UXD L;  1J6Q A;  4GN5 A;  3CC7 A;  4DR1 Q;  4GKJ L;  3F2D A;  1UE1 A;  1I6H H;  3M9B A;  2Q2I A;  3OW2 A;  1Y14 B;  3CW2 C;  4JI6 L;  2QGQ A;  2UXD Q;  5ELN A;  4GLV B;  4NB3 A;  4UPA A;  2EQS A;  3F1Z A;  5JEA G;  3Q8D A;  3CF5 A;  1HR0 Q;  4B3T Q;  4LFA L;  1VQ6 A;  3HOZ H;  3D0F A;  3HOX H;  4GN3 B;  4AIM A;  4LF9 L;  4DR2 L;  1QUQ A;  1PH2 A;  4DUZ L;  3I2Z A;  2VUM H;  4NPS A;  3EN2 A;  1A62 A;  3I4N G;  2YTY A;  4MZ9 A;  4A75 A;  1G29 1;  4GNX A;  3NEL A;  3AQQ A;  4JCV E;  1L1O C;  3DM3 A;  4DUZ Q;  1X54 A;  4GLX A;  2NN6 I;  3T1H L;  3A5Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...