4A3GG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3gG01
3TS0A 4JI2Q 1T9HA 3HOVH 2JA5G 1A63A 1OXTA 2AWOA 1HNZL 3AQQA 1J6QA 4A3JH 1VQPA 4IFDG 2Y0SE 1D8LA 5C0XI 4A3EG 3I4MG 1SN8A 1KRTA 4GLAC 3J81i 1HZCA 1K0RA 2R6GA 3CC7A 2KHJA 3J81j 4PG3A 1P16A 3HOXG 3PSIA 4YY3Q 3CP0A 1VQMA 2WFWA 1EFWA 2IY5B 1TWGH 2KHIA 1PYSB 2ID0A 3K8AA 2Z6KA 5GQOA 3LGJA 3S24A 5C3EH 1OXXK 2KCMA 5M3MG 1XPOA 1EQQA 2DGYA 1KD1C 4LUVA 5JEAG 3HOYG 2JEAI 1V43A 3VDYA 1R9TH 1PH7A 2A8VA 1CKMA 2CFMA 2UU9L 4KHPQ 4PZ7A 2I5HA 5HY6A 2JQOA 3UDGA 5HGQA 4NB3A 1JJ2A 3F1ZA 3PO2H 3UDIA 5IYBG 4GN4B 3F2DA 4R1JA 1XPRA 4JG2A 4OO1G 3CCSA 3PF5A 4JI4L 1H95A 5IE8A 4DV2L 4LF6L 2JA8G 2K50A 5LMUQ 5IWAQ 4GKKL 3G6EA 3CXCA 4X6AH 3CF5A 3E9HA 5C0XJ 1VQOA 3MEFA 3D0FA 4C3HH 3ULPA 1NTGA 2NVYH 3RN5A 2UUAL 4BBSG 2PI2E 5IYDG 5LMNL 5M5XH 4AQYQ 1J5EQ 1WCMH 1B7YB 1O7IA 1UE5A 4PZ6A 4DR2Q 2UXCL 3HOVG 4QL5A 4HJ7A 4HJAA 3L7ZC 3JAMc 4A3JG 1Z9FA 3CPFA 1VQEA 2KENA 3BJUA 4IJHA 3S17H 5JJKA 1YHAA 4BBRH 2ZM6L 4IFDJ 2JA6H 1E7ZA 1N33Q 4NXMQ 2YTXA 2B63H 1SR3A 4JBJA 4UPAA 4AYBG 4YWKA 4H02A 2ES2A 2IX1A 3DLLA 4B3ML 4X62L 4B3RQ 4NPSA 1L1OC 1Q1EA 3OTOL 1I5FA 2HIVA 5IP9H 4A3BH 2RHSB 1Q12A 5C3EG 5C4JH 2VW9A 2B63G 1E1TA 3W5OA 2UXDQ 1PH5A 3S16H 1BKBA 3NEMA 1PH4A 1NMFA 4JI1Q 5JEAJ 1L1OB 2JA5H 1FGUA 1U0LA 2GVAA 3CAMA 4IO9A 1JT8A 3PIPA 1QZHA 4DV5L 1Q1BA 1I50H 4JI8Q 4C2MH 3PO2G 4DR4Q 2NZHA 3ULLA 2QA4A 4DR6L 1RL2A 3STBC 1XTDA 3UE0A 3A5ZB 1CSPA 3CPWA 1KAWA 2VL6A 1SLJA 1NY4A 2Z0SA 1KIXA 3CCLA 2GVBA 2VUMH 3NENA 3GTLH 1VQ8A 3HFZB 1I94L 2PQAB 3W1BA 3G71A 2BH8A 3T1HQ 2D0OA 1YJ9A 2CQOA 2E2HH 1NE3A 4JI6Q 3CCMA 4YHHL 1XNRL 3GTMH 3PF4A 1QUQA 4OONA 2Q2HA 4RMFA 4JI3Q 1SROA 1HR0L 3GD7A 1Z47A 4LFCQ 1E24A 3NELA 2WP8J 1B70B 4JV5L 4X64L 2E8GA 4LFBL 1WCMG 1VQ5A 2E2JH 4LF7L 3CCEA 4P71A 1EWIA 2C35B 1VQ4A 1JE5A 3KF6B 2ZTCA 1FVIA 3CMAA 4DR1Q 4DR5L 2A19A 3CMEA 2D62A 3I4NH 4A3CH 4IPGA 3U50C 1IXRA 4BBRG 3F8TA 4JC0A 4A75A 1PH2A 2HIXA 2UUBQ 4L5SA 4HJ5A 4P73A 5K36G 1LM0A 2PNHA 4DKAC 4LF9Q 2LSSA 3AFPA 5IWAL 1N36Q 4MTNA 2N8NA 4JCVE 4GN3B 4PMWA 4A3IH 4DR3Q 1XMOQ 3FP9A 4JBWA 5IP9G 4APVA 3JAMi 4A3BG 1V9PA 3I2ZA 4R4IA 4DV4Q 1NMGA 1I3QH 3KJOA 4BBSH 4KLKA 4KI0A 2IHEA 4QJFA 4WJ4A 2VQEL 1DGSA 1RIPA 2GN5A 2WAQG 4DAMA 2MFIA 2D0PA 2N78A 3I4OA 1K8AC 3PUXA 1U5KA 2NZOA 4DUYQ 1HZ9A 2NN6I 1X3FA 5GAHC 2XTIA 3TREA 1PH6A 3K7UC 1Q81C 4POGA 4DV0L 3GTKH 1QVCA 4GNXC 2F4VL 1HNWL 2K5VA 2PI2A 3CCRA 4NXML 2ATWA 3UDFA 4P74A 2VUMG 2N49A 2AHOB 2VY3A 3AYHB 4BY7H 3H3VI 3TS2A 1PHJA 2E5LQ 2HQLA 2K5NA 4ALPA 1WYDA 1IYJB 4GNXB 1HNXL 4DV6L 3KOJA 5BR8L 3GTPH 2LXKA 1Y1WH 1IBKL 1OXVA 1S72A 1YEZA 4IPDA 4HJ9A 2UXBQ 1HZAA 3M4PA 2HHHL 4LF8Q 3J7A5 1CSQA 4HIDA 4O2DA 3RLOA 3GTOH 5IYCH 4DUZQ 3EBEA 1YHQA 1XNQQ 3S1RH 4GKJL 3PCOB 3GO5A 1YITA 2EIFA 3EIVA 4DR7Q 3I4NG 4A3CG 3FHWA 4IPHA 3HOWG 1K8GA 4NXNQ 2RHQB 4B3SQ 4OX9Q 3CCVA 3S1MH 1K83H 3B6YA 2VQFL 1S40A 4GOPC 4JI0Q 2Q2UA 4X65L 1Q82C 1IL2A 3G48A 4R4OA 3S1QH 4A3IG 1N9WA 4RG1A 3PUZA 1X55A 3E9IA 1PH3A 2ALYB 1FJGQ 2RF4A 2WB1G 1UWVA 4GOPB 4LFCL 4JYAL 1OXUA 1L1OA 1PA6A 3CW2C 4JI7L 3CC2A 1K73C 3A0JA 4YWMA 2R92G 5AJ3L 1GM5A 1SRUA 4DV3Q 4J15A 3RN2A 4QY7A 5E7NA 4DK6C 2YU9H 4QIWE 2CKZB 1KXLA 2R7FA 3K0XA 5ELOA 1VQGA 1VQHA 2KBNA 2UUCL 3M9BA 1UEBA 4DK3C 4L5QA 3H15A 4JI5Q 1KRSA 3E0EA 4HIOA 1VQFA 2PQAA 1N34Q 2I5LX 4BY7G 2AKWB 2BA0A 4GLVB 3ULJA 3U4VA 3T1YL 3I56A 4LF4L 2ZTDA 4P75A 2MNAA 1IBML 3GDEA 1D7QA 4JOIC 4P72A 1YIJA 4GN5A 1E1OA 2V1CC 3MXNB 3UDXA 1Y1WG 4DV1Q 2ZTEA 1NJIC 1L2FA 4LF5L 4LFAL 2NVTH 2R93H 3H3VH 4DV7L 1GKHA 1QZGA 1XMQL 2F52A 4OWWB 2BH2A 3AFQA 3KF6A 1M1KC 5IYCG 1HNZQ 1CKNB 2VZAA 5GAEC 1SMXA 4JI2L 4A76A 2RCNA 4PZ8A 2N3SA 1VCIA 3Q8DA 1BVSA 5H1SE 4HIKA 1WOCA 4IJLA 4OWXB 4DNIA 1C0AA 2JE6I 3CCJA 5GROA 4YCWA 1AE2A 3FKIH 3KF8B 1SE8A 2K52A 2OTLA 4R4CA 2Y0SG 4YY3L 1PVOA 1V1QA 3KLWA 1HNXQ 1A62A 1PFSA 4EQ5A 3U58A 3RR5A 1K3RA 1VQAA 2JEBI 1QVGA 4POFA 3A74A 4IOCA 4LNQA 1AH9A 5J3BA 2NVQH 2UU9Q 1KQSA 1VQCA 2YYZA 1Q86C 2IX0A 4KHPL 2A1AA 1XNQL 1VQ9A 1CUKA 4LUZA 4BA2I 4X66Q 1JB7A 1JJCB 4O0AA 5C4XH 1WFQA 2R7DA 3CQZH 2OWOA 1LYLA 4C3IH 4JI4Q 3HOWH 4B3TQ 2E2IH 1E3PA 4DV2Q 1PH9A 2K75A 1NBWA 2WB1E 4LF6Q 3ICEA 3DM3A 5GADC 4DPGA 4A3DH 4GKKQ 4GNXA 3TRZA 2NN6G 2ASBA 5LMUL 1KL9A 3BZKA 3OYYA 1VQDA 2UUAQ 2VNUD 1X3GA 5LMNQ 1KC8C 4A93H 1LUZA 5EAYA 1QVFA 4R4TA 2YTVA 1VQIA 3S14H 4A3FH 4TVAB 4K0KQ 1N32Q 2JA7H 1EOVA 4AQYL 2UXCQ 2R93G 1J5EL 2R92H 4XIGS 4MZ9A 4DR2L 4AYBE 2R7ZG 1EYGA 4A3KH 4YHHQ 1IBLQ 5ELNA 1JMCA 4UY8C 1IZ6A 2H5XA 4AH6A 1WJJA 3HOZH 1VQJA 4JI5L 2JK8A 1TWFH 1WI5A 2I5MX 5C44H 1N33L 5LMNW 3FKIG 4A4IA 1GD7A 5M5YH 4B3MQ 1Q8KA 1B8AA 4X62Q 3L2PA 3CC4A 4BY1H 1VQNA 4IPCA 1GO3E 4LUOA 3OTOQ 4B3RL 5FLMH 4GOPA 4OXPA 1EIFA 1YNXA 1KHIA 1VQBA 4DV1L 2UXDL 2ZJQA 3GTJH 2MO0A 5IY0A 4JI1L 3W1GA 1BBUA 4DV5Q 1XJVA 3BZCA 4YWLA 1MIUA 3M3YH 3HOUH 5C4XG 4DR6Q 3TQYA 4JI8L 2CWAA 4DR4L 4L5TA 3CD6A 2PMZE 2B3GA 4JBMA 3S1NH 1UE7A 5M3FG 1UE1A 1W3SA 2AMCB 1I94Q 2NVXH 1OTCA 3OW2A 3PUWA 1YI2A 3ERSX 4A3DG 1XNRQ 4R4QA 3M7NA 3M4QA 3T1HL 3CCQA 3PV0A 4JI6L 4IFDI 1HR0Q 3JC66 4JV5Q 1TXYA 1X65A 4JI3L 4A3GG 4A93G 2JA9A 4X64Q 1S3OA 4JOIA 3S2DH 3D31A 4LFBQ 4A3FG 1CKNA 2ZJPA 4LF7Q 2JA7G 4A3LH 2XGTA 1TWHH 3H0GH 2K4KA 4EX5A 4DR5Q 4X66L 4QGUA 2KCTA 1YVCA 3SGIA 4A3KG 1E22A 2Q2IA 4DR1L 3I7FA 4GS3A 1X9NA 3J7ZC 1Y1VH 3KJPA 4WJ3M 1BBWA 1YJWA 4B3TL 2IT1A 3KYHC 3RZDH 4DAYB 3AEVA 3HOZG 1HR0W 1X54A 3RLFA 5C44G 2UUBL 1ASZA 3U4ZA 3S2HH 1G51A 2Z6KC 3GTGH 1PV4A 3J80c 2K5HA 1OXSC 4LF9L 4BY1G 1AE3A 2WAQE 4A3MH 5GAGC 4L5RC 3S15H 1LTLA 1N36L 4OWTB 4DR3L 3K81C 4UP8A 5FLMG 1XMOL 1SFOH 4IOAA 2OCEA 2EXDA 4YCUA 1L0WA 4DV4L 4K0KL 2VQEQ 3PO3H 4OO1I 2L15A 1N32L 2CCZA 2OQKA 5FJ8H 3PIOA 2QGQA 3HKZG 1MJCA 1Y14B 3K80C 3STBD 2R7ZH 2B29A 4GLXA 4TQUS 2ZJRA 3I55A 3CCUA 4DUYL 1IBLL 3HOUG 1XPUA 4DV0Q 2F4VQ 1HNWQ 5IP7H 3KDFA 3NBHB 4AIMA 1HJPA 3F2CA 4FDBA 1C9OA 1EUJA 1EQRA 1X56A 2YV5A 4MNOA 1EIYB 3PGZA 1CKOA 2LXJA 4YCVA 5JJIA 1Q46A 1UE6A 3EN2A 1YJNA 4DV6Q 1M90C 1TWAH 5BR8Q 2E5LL 3J81c 2HT1A 2QEXA 1VS0A 1IBKQ 4BXXH 4C3JH 1A0IA 2HHHQ 3GTQH 2UXBL 1I6HH 5IT9c 1TWCH 3UE1A 4LF8L 5M5WH 4A3LG 3IRBA 4GKJQ 3ZJYC 4DUZL 1YHBA 3H0GG 2BA1A 3M4OH 4A3EH 1YBYA 2FXQA 3TEHB 3RLNA 1PH8A 1G291 3I4MH 3F2BA 1ASYA 4Y7NH 2Q2TA 1VQ6A 1Y1VG 4DR7L 5M3FH 3ER0A 1PH1A 3G4SA 1FL0A 4NXNL 2JJQA 4LWCA 2CWPA 3HOXH 2VQFQ 3KDFB 3RNUA 4B3SL 4X65Q 4OX9L 5FLXc 1JJGA 2AWNA 4JI0L 1X3EA 3HKSA 1VQKA 2OQ0A 1W2BA 4A3MG 4HJ8A 5M3MH 3HOYH 4JYAQ 4QQBX 2F3IA 4JI7Q 1FJGL 4A3GH 1X6OA 3A5UA 2VS1A 5AJ3Q 1K9MC 1PYBA 1VQLA 3PO3G 4UP7A 2EQSA 3L0OA 5FJ8G 1HH2P 4DV3L 2K14A 1VQ7A 2DUDA 2UUCQ 1MJEA 3J80i 5IYBH 1C7YA 4UP9A 3RZOH 1YZ6A 3KFUA 4LW1A 2MQHA 4BA1I 2ZM6Q 4JBKA 3K7AH 5IP7G 2JA6G 2OTJA 5JJLA 1MKHA 1Q7YC 1P8LA 2JA8H 2IHFA 3PUVA 4KHZA 1GVPA 4XTCS 3WWVA 3T1YQ 1N8RC 1G6PA 1N34L 4LF4Q 4ME3A 3PUYA 5C0XG 1IBMQ 1HZBA 3HKZE 2MO1A 1A8VA 2I0QA 4Y52H 4BXXG 4LF5Q 4LFAQ 3BU2A 5IYDH 2YTYA 1QUQB 5DLQE 4DV7Q 4HIMA 1XMQQ 3M85A
chains in the Genus database with same CATH superfamily
5CV6A 4J1MA 1HNZH 4QUFA 4Y8VB 1BGWA 4MV9A 1H9SA 1OXTA 2M05A 3AQQA 4ILWA 1VQPA 4ECRA 2ZDHA 3C46A 2G9HD 5L1LA 1SN8A 1A2UA 3H0GB 2R6FA 5KG6A 1W93A 1PFNA 4PMBA 1P16A 1A3VA 4YY3Q 4ZUIA 2KQ3A 2XCAA 3CP0A 3TMEA 1F2ZA 1EFWA 2IY5B 5KT7A 4IRDA 4ZOLF 2KHIA 4N9PA 1HNXL 3LGJA 2KCMA 3HOYG 3I12A 1ZYRC 4RA8A 5JEAG 3V4SA 3HB9A 1SYFA 1N48A 2F0QA 2UU9L 1RJPA 1C3OA 4QMGA 2JYOA 3NSWA 4NB3A 5HGQA 1SFOB 1JJ2A 3F1ZA 2R61A 1J8IA 1AN8A 1B50A 4IHJF 4UCRA 3PO3B 1TS4A 2NU9B 4ECXA 1K28A 5IYBG 1GSOA 4F8MA 4U7CA 4DV2H 1VF7A 4JG2A 1UAPA 3CQZA 4FF2A 2D9UA 1ET6A 2HGSA 4IWYA 4LF6L 2E2IA 1TKWB 1G91A 2OXPA 1L0YB 1D5MC 2FMMA 3CXCA 1EU3A 1S5BD 4UCUA 1VQOA 3MEFA 3D0FA 5KRUA 1DONA 2NVYH 3H20A 1N56A 2FPGB 4IRKA 4O3OA 3H6MA 3VYUA 3LWEA 5IYDG 4TQSA 4CDDC 1J5EQ 3G6VA 1LO5D 4KD3A 4QL5A 4MA0A 3K5MA 5IGFA 3NQTA 3CHBD 3DEPA 2ZM6H 3OSOA 5I47A 2XN9C 3CPFA 4B9XA 2KENA 5M5WB 1Y69U 5CORA 2LS01 2JA6H 1S0NA 4JBJA 4UPAA 4AYBG 4X62H 1Q3LA 3TIGA 3J80W 3EFXD 3DLLA 4B3RQ 5L1IA 4NPSA 4LF5H 4YR0A 1Q1EA 3SEBA 5C3EG 2B63G 2VW9A 1XMQH 2K32A 2PO4A 1BKBA 5KFVA 1EY4A 4JI1Q 1SNMA 4O2BF 3DXJC 5JVG3 3O13A 2JA5H 4ECSA 4IO9A 2P0AA 2A69C 4DV5L 4JI8Q 4C2MH 4J6HA 4FBUA 2QA4A 4YJ3F 4MTDA 1BBXC 1CSPA 3BG5A 4ECYA 4R9WA 3K6OA 1C8CA 1QNKA 3A8IE 3MFYA 4TKOB 2N55A 2SDFA 1BUVT 2BH8A 2D0OA 4EGVA 1XNRL 3ETHA 3CCMA 4YHHL 3PF4A 1XYIA 1QUQA 4FF4A 3K3PA 4C56C 4OONA 2Q2HA 4RMFA 5C5JA 2F0SA 1HR0L 3ETJA 1Z47A 5KG5A 1EEFD 4X64L 4PDBA 3GIPA 1MGSA 3RV4A 1A15A 4LF7L 1OWTA 4P71A 5KFNA 2C35B 4XQNA 1JE5A 4Q8EA 1GUSA 3SR1A 3TZDA 2A19A 2GPSA 3H0GA 2K04A 1WTQA 3I4NH 4IPGA 1SYDA 3SXHA 5LP6F 3RV3A 4YJ2F 3MR3A 2UUBQ 4A3JB 2DZDA 5IWAH 3VA7A 1LM0A 2PNHA 4DKAC 5E3FA 1VBGA 2G9DA 2LSSA 1ZEQX 2NYZD 2HDLA 4PMWA 2N8NA 3KUPA 5C1PA 4JBWA 4A3BG 1V9PA 3I2ZA 1BOSA 4BBSH 1NMGA 3KJOA 1XXGA 2DIKA 1TWGB 1JQYD 1SFOA 4QJFA 3KLRA 2DJGC 2VQEL 2GN5A 2WAQG 4XYMB 2HCCA 2MFIA 1U5KA 2EPBA 1X3FA 2XTIA 3TREA 2F4VH 1PH6A 1TQOA 2DJFC 1LV9A 3U9SA 4ECWA 1N33H 3K7UC 1Q81C 3MXUA 4DV0L 1TWHB 1QVCA 4POGA 4OIKA 3M4YA 4J9NA 1PZJD 5I2YA 2ATWA 2A74C 2JN4A 5DGBA 4IRCA 4FF3A 2K5NA 4MA5A 3TP6A 1IYJB 2XIWA 2G5DA 2LXKA 1Y1WH 1IBKL 1CQJB 1OXVA 1YEZA 1HZAA 4FVMA 1E4EA 2DPIA 2V5AA 4HYKA 3G6YA 1GUGA 1WTRA 1CSQA 3S15B 3EA6A 3EROA 4HCEA 4O2DA 4GKJH 4DUZQ 1LACA 3QO2A 4X3KA 4C3HB 4FF1A 2NU6B 3HGBA 2H4OA 3MFIA 3C1EA 1YITA 4FP5D 2K1BA 3MEHA 3FHWA 3HOWG 1K8GA 1B9NA 3UI2A 2JEJA 5KFBA 4X65H 1FYCA 2BR0A 3S1MH 1K83H 5TSSA 3S17B 2Q2UA 3GTLA 1Q82C 1IL2A 1BQQT 3QZ7A 5DEHA 2WE6A 2WB1G 5CV9A 3SK4A 4LFCL 5FLXL 4JYAL 4IUTA 4F7XA 2FMAA 3CW2C 1W96A 4HMIA 4J9SA 3OWEB 1JLLB 5EKKA 2EYPA 1HFNA 5KFLA 2YU9H 4J8QA 4MV3A 2R7FA 1S5CD 2PCFB 5ELOA 5KGUA 4EFBA 5D14A 4DK3C 3H15A 2HDMA 1KRSA 3I73A 3N40P 4H44C 4HIOA 1VQFA 2RGVA 1SE2A 5FKAC 2XIGA 2PNRC 2NN6H 2RKSA 5KFOA 1EY5A 4LF4L 3HBLA 1IYUA 3RB4A 2VUMB 1IBML 4IR1A 2MPMA 2R7LA 4LFAH 5J39A 1ZXTA 2KEEA 3MXNB 2ZTEA 1L2FA 2F0TA 3H3VH 2E2HB 3R93A 1QZGA 3M9OB 4OWWB 2L0CA 1RK5A 1CQIB 2B2UC 2Z9HA 1D5XC 3HOYB 1IOWA 3K3VA 2FJ2A 4A76A 4LAAA 1F9PA 4WD3A 2AGQA 2DNEA 1BVSA 2J6TA 1NCVA 3K57A 3K58A 1WOCA 1EQTA 2JE6I 5IGGA 5GROA 5F9LA 3FKIH 1CS0A 3BDOA 3KF8B 3MWMA 1KLGD 3T16A 4KN4C 2OTLA 4YY3L 1QOHA 3WOEA 2FMCA 4O4IF 4ABNA 5KIXA 5C3WA 5KFKA 3U58A 1I7NA 4J9RA 3A74A 3GV6A 1TWGA 3OSNA 3GTPA 2F0PA 1KQSA 2HJWA 4XZ3B 2EYJA 2ASLA 4KHPH 4DAPA 4QF4A 1DOLA 1W6KA 4LH6A 1QNUA 1VMPA 2A1AA 1XNQL 4EVOA 1CUKA 1JB7A 2RDFA 1LTAD 5JPMC 1WFQA 2OWOA 3WO0A 4C3IH 1I4PA 2MHVA 5EZYF 1NBWA 1SE4A 4MTKA 3ICEA 2MGSA 3V6KA 1D1KA 1GHJA 2SOBA 3BZKA 3OYYA 1VQDA 4BY7B 4AYBB 1MD2D 2UUAQ 4HNUA 1NAPA 5LMNQ 4A93H 1KJJA 5EPLA 4AQYH 4O42A 4CJ1B 1VQIA 4K0KQ 3J80L 2K33A 5EPJA 1B33N 2JA7H 1DZ1A 3RAXA 1J5EL 4XIGS 1KJ9A 2R3ZA 1JDBB 5DG8A 2SNSA 4AYBE 5E1FA 2IP4A 4XYLB 1RYSA 2HQEA 2H5XA 5JAVA 3QJYA 1BCPC 4MV6A 3QOLA 3TINA 5LMNW 4B3MQ 3L2PA 1VQNA 1GO3E 4BWGB 1BCPB 4LUOA 1I7LA 1Z7TA 4B3RL 4O3NA 3LP8A 4TQRA 4DV1H 4IR9A 1SYCA 4CKCA 1VQBA 2Z8LA 3J7YW 3RFCA 4X3UA 2MO0A 2PMZB 4N8FA 3A8JE 4JW0A 2RSOA 4JI1L 4U6PA 3W1GA 1IW7C 4I7ZC 3H09A 4JVZA 5C4XG 4DR6Q 1O80A 4JI8L 2ZXOA 2PMZE 4JBMA 1UE7A 5FLXE 1W3SA 2SNMA 1WTHA 4C1NI 2EYHA 1HNXH 2VUMA 2OLSA 1Y8OB 4R4QA 2XRQD 4IQZA 3M4QA 3MXNA 1IHZA 3R2IA 2UU9H 2QDLA 1PZKD 3D4DA 1SJHD 2E2HA 3EQLC 4CHTB 2XWJB 2JA9A 3G6JB 5KYIA 4H7BA 2K6AA 4LFBQ 1KDCA 2R8HA 2CQYA 4TSSA 1B6SA 4X66H 3V96A 5FO9B 2XGTA 4HMJA 1TWHH 1VDZA 4A3BB 2K4KA 2FK3A 4K5XA 4ZYSA 2B2UA 4G57A 2ZJTA 4GS3A 2WAQB 1Y1VH 3I70A 3GIQA 5BPFA 4G7HC 4O3PA 1YJWA 4B3TL 3PMFA 4IAJA 4LF6H 3KF8A 4DAYB 4J9QA 1X54A 2UUBL 3S2HH 1ASZA 1G51A 2Z6KC 1M0TA 1KAAA 1OXSC 2K5HA 1AFPA 4DR3H 2WAQE 4L5RC 5GAGC 1XMOH 3S15H 4DF7A 3IL8A 2E74C 5FO7B 5D1PA 3DWAA 3L9AX 4IOAA 2ZXPA 2XGQA 1JICA 1G8ZD 3GIKA 4J9LA 3GIDA 3PW5A 5FJ8H 4CGYB 1LTRD 2R92A 1V51A 1IBLH 2R7ZH 1RHPA 1EY8A 4TQUS 4KHVA 4O4HF 4KJNA 3PZPA 1ZETA 3NBHB 1HJPA 4DL5A 5E4XA 3CRKC 1X56A 4QWAA 2YV5A 5DM73 3I91A 4I50F 3BZDB 3HOWB 2LXJA 4YCVA 5JJIA 3NHHA 4DV6Q 1M90C 3FMAA 5BR8Q 2QEXA 1VS0A 3Q2OA 4C3JH 1A6XA 1E2ZA 1MHWC 3GTQH 2DY7A 2LKVA 3UE1A 1PRTF 2HD3A 1XDNA 4NMZA 3E6ZX 4RGOS 4QW8A 2WINB 4DUZL 3N42B 3H0GG 3AU7A 3M9MB 3M4OH 1YBYA 2FXQA 2YZGA 3MR5A 4JV2A 1ASYA 1SYBA 4NXNH 4B3SH 3G4SA 1FL0A 4X3SA 3J80E 4Q8FA 1ULZA 3KDFB 2F4IA 3HEJA 5FLXc 3EJIA 1M0WA 5D3IB 1X3EA 3W3AA 3HOZB 5EDWA 1TWFB 4B08A 4RGTA 2Y0SA 3HOYH 1FJGH 2FK2A 4RAUC 5JEAH 1M8AA 1WH2A 4QQBX 2F3IA 4BY1B 4JI7Q 4A3GH 2PMZA 1NR2A 4XT3B 5I9OA 2VS1A 1WTVA 1K9MC 4A2AA 4RNNA 1VQLA 3I4LA 3PO3G 2VPSA 2KA7A 1VQ7A 1XX8A 3GTJB 2UUCQ 2I07B 1LT4D 5IYBH 4UP9A 4MAMA 4JBKA 1F9RA 3K7AH 4ED2A 3S1RB 3M3YB 1Q8IA 2IHFA 4KHZA 1G6PA 2CW0D 3T1YQ 2F0VA 5K5PA 2UVVA 4J9OA 2DPJA 3CRLC 4MN3A 5C0XG 5ELEA 2MO1A 2I0QA 1PYWD 2NVXB 4BXXG 5IYDH 2F0FA 2VQEH 5DLQE 2IPKD 1HXYD 3A7LA 3M85A 3TS0A 4JI2Q 3S1QB 1KEEA 1EWHA 3RMHA 2AGPA 3T5JA 3K5LA 4DNRB 4EQNA 1J6QA 5KFCA 4DV0H 1D6EC 4J0MA 1D8LA 1STEA 4DAYA 1JWMD 4GLAC 1K0RA 2R6GA 2C22A 1PK8A 2KHJA 5A35A 1Q90A 2CVRA 2EOTA 1VQMA 5EJWA 2RDGA 5BMVF 4YR2A 3RZDB 1AUXA 2VB3X 1IBKH 3K8AA 1PYSB 5GQOA 4YHHQ 2Z6KA 5C3EH 1EQQA 2B63H 1TWAA 4Q43A 4WFN3 3GTGB 5KFFA 2X6LA 4LUVA 4DL3A 1QJOA 1R9TH 1GLVA 3NQIA 1RDPD 2ENBA 2F1MA 3GV5B 5D3DA 2NVTB 4KY6A 1G6ZA 2XCLA 1IKMA 5KT3A 2W9AA 5D65A 1V1OA 3NBHA 1ONLA 4R1JA 2EY2A 3KALA 1TY0A 3CCSA 4JV1A 5IE8A 5HV6A 1G2TA 1WD1A 4K6DA 1FNVA 2VA2A 4JYAH 2F0GA 1SCUB 1NTGA 3TN2A 2UUAL 2AU0A 5LMNL 1K8OA 3RGXA 4BS9A 1B7YB 4DR2Q 4PZ6A 4NW2A 3NE5B 3T4AC 1S0OA 2A6HC 4RNMA 4MV8A 3JAMc 1TWCB 3C1FA 4FNFA 1Z9FA 5C4ZA 4A3JG 3PR5B 4IJHA 2F0IA 1LTID 1YHAA 2FLNA 4IFDJ 2EVBA 3W2DA 4Q0FA 2YYAA 1PTOF 2YTXA 3SE0A 2D2CC 4A3EB 1SR3A 2W8KA 4LF4H 4YWKA 1IBMH 4Y7NB 2AUJD 5FPRA 1TWFA 2YS6A 5CV8A 3NGDA 2F0OA 4B3ML 3HOXB 4A3BH 1B44D 5C4JH 2UXDQ 4RKLA 1E1TA 1X3PA 3W5OA 4H13C 2WV6D 1STAA 3NP8A 5M3MB 1EYZA 1PMRA 5C5MA 1U0LA 3GTJA 1T3NA 3VPCA 2CW8A 2R7NA 1Q1BA 4DR4Q 3PO2G 4DR6L 1RL2A 3RIZA 3STBC 1CFMA 2A5HA 1TAEA 3PR4A 3A5ZB 3CCLA 1KAWA 2Z0SA 1SLJA 2WDTA 4I7AA 3RZOB 1EWCA 5JVLA 3HFZB 5EGTA 3T1HQ 3MFGA 3I3CA 1GGOA 4JI6Q 3VPBA 2JEGA 2NVXA 2IMWP 2F0LA 5T1IA 2B39A 1DIKA 4JI3Q 4C3HG 3ERQA 4LFCQ 5G3LD 3NELA 2WP8J 4YQWA 4LFBL 5IGDA 4U673 1II3A 2E2JH 2W6QA 3T13A 4KV6A 3ZYYX 3BQ0A 3H94A 3KF6B 5KG4A 4A2BA 4DL2A 5KFDA 3HOVB 3F8NA 1IXRA 4JC0A 2LY7A 4C1NK 5K36G 4QWBA 1K8MA 4LF9Q 2HUGA 3AFPA 4JCVE 3GIJA 3GTGA 1I4GA 1STNA 3FP9A 5ELCA 3JAMi 4QWDA 3LMLA 3OHXC 4DV4Q 4KLKA 4EBCA 1QE6A 3GIIA 3ORRA 4KI0A 2IHEA 3S1NB 4LSAA 4RB1A 1MI2A 1K8AC 2D0PA 1CA5A 1JWSD 4DUYQ 4MIUA 4QWCA 3PW0A 2YRXA 2K5DA 3BABA 1HNWH 1V1PA 4GNXC 2K5VA 4NXML 2JA6A 5I9PA 2VUMG 1XWEA 2N49A 1JC7A 2ZXRA 1GUOA 2E5LQ 2HQLA 4ALPA 4GNXB 1EY9A 1GUTA 2IJ0A 4DV6L 2V58A 5BR8L 3OUZA 4JI1H 3Q1KA 3DF7A 1WSCA 4LF8Q 1VF5C 3J7A5 3HP3A 1U4RA 5JVH3 3WNZA 2Q8TA 1TWCA 4APMA 1YHQA 2XRSD 1XNQQ 3S1RH 2FINB 2JA5A 5M5XB 1VBHA 3QR8A 2EJGC 3PCOB 5C3XA 5GONF 1NNXA 1SYGA 1B53A 3EIVA 4DR7Q 5F2DA 1DV1A 4RUCA 1E2WA 4ME5A 1S40A 3B6YA 4JI0Q 3RAQA 4BBRB 4UCOA 2UVUA 3G48A 1HQMC 3S1QH 2F0UA 1L0XB 1JB3A 3VYTA 1LTSD 3E9IA 1PH3A 2ALYB 5A2QW 1UWVA 3T56B 4IUPA 1JCKB 2WTFA 4JI7L 2AQ4A 3CC2A 1K73C 2R92G 4CBVA 1E4EB 5L1JA 1GM5A 3CU7A 5KG1A 4QY7A 1JORA 3NK9A 2CKZB 2FE3A 4RWSC 2PN1A 1EIGA 2W6PA 2UUCL 4RAYA 1UEBA 1PX2A 2OEOA 4L5QA 3MR6A 2B8FA 3TP5A 1RTOA 1I50B 3VR6A 1N34Q 4BY7G 4YP3A 4B9WA 2DY8A 2F0WA 4GLVB 2A6EC 2BA0A 3A54A 1U4MA 3T1YL 2FPIB 4IZ8A 2MNAA 3UQ8A 3GDEA 3E3XA 3GTLB 4P72A 2L55A 1YIJA 1K1SA 1E1OA 3UDXA 4F87A 3MAQA 3GLKA 2NVTH 4CKEA 3GTMB 4K8IA 1OO9B 5J1ZA 1BNZA 2R84A 3KF6A 1M1KC 1HNZQ 4JI2L 3KLSX 1SMXA 3JAMW 1Y8NB 4ZKCB 1O7ZA 3OIPA 4DNIA 3PW7A 1SNQA 2K52A 4RH6A 2CH4W 4R4CA 2Y0SG 1M4VA 4CDCC 2V9WA 1V1QA 3KLWA 1I6UA 1DXMA 2OT2A 2F0KA 4EQ5A 4CC6A 4UCVA 2JEBI 4LNQA 4OELB 5J3BA 2NVQH 2DN8A 2Q8RE 4A3IB 1WTPA 1Q86C 4DUZH 1W6JA 1E4FT 2IX3A 1VQ9A 4BA2I 1I3QB 5C4XH 3CQZH 4JI4Q 2L5TA 4B3TQ 2E2IH 1E3PA 4DV2Q 2B8GA 1PH9A 2KCCA 1B2TA 4RU9A 1XTCD 1UEAB 3DM3A 3BG3A 1S10A 1PFBA 5LMUH 4GNXA 3GTKB 2ASBA 1KL9A 4WRDA 4FBTA 5J22A 3QOJA 3LX0A 1FD7D 1F9SA 1QVFA 4R4TA 3V05A 2R86A 3S14H 4RHRA 3JSLA 5DQGA 3N41B 3GTPB 4MZ9A 4DR2L 5KFEA 4IUVA 1WCMA 4F4ZA 3QFFA 1GHKA 2VB2X 4RGNA 5ELNA 5KNDA 1JMCA 3GTOB 3HG9A 4DFAA 5KT2A 1WJJA 4RZQA 3R23A 4JI5L 1HCZA 3PO2B 1O78A 4OIJA 3MTSA 1GD7A 5M5YH 1CZGA 5IGEA 1B8AA 4X62Q 4IPCA 1NR4A 4EBDA 3OTOQ 2O4XA 3JRWA 2X6GA 3Q8QB 1EIFA 1HUNA 2UXDL 3BVGA 3G8CA 4F4WA 2Z4HA 2F0DA 4R8IA 3DWPA 3BZCA 1RD9D 2H1EA 4DR4L 3T5HA 1PRTC 2B3GA 1I50A 2EY1A 4QWEA 5M3FG 1UE1A 2EY5A 2C2RA 1B9MA 2JEFA 1I94Q 1PRTB 3ERSX 1SNDA 3VR4A 5KT5A 3T1HL 3CCQA 4JI6L 2PPBC 1L2ZA 4RUAA 1SMYC 3GTMA 2A68D 4JV5Q 1X65A 4JI3L 3SI8A 3BAAA 1S3OA 2ALZA 1BXRA 4JUZA 2F0MA 2ZJPA 1EZ1A 3T5KA 3PN1A 3KHRA 4DXGA 2FK1A 1JX4A 3EVQA 3H0GH 2SCUB 1F9QA 4EX5A 4DR5Q 4DR1H 2R93B 3S16B 1YVCA 3SGIA 2YL2A 2Q2IA 3IFTA 2V59A 1T36A 3I7FA 4RCNA 1X9NA 3KJPA 3KYHC 1LTTD 3HOZG 4WORA 5DLGA 3U4ZA 4ZRZA 1CA6A 2X0SA 5KFGA 1JXLA 4LF9L 4BY1G 3P1HA 5AFWA 5KNCA 2UUAH 1LTLA 2QK4A 4OWTB 4RHSA 2QEJC 1CQVA 3Q8RB 4K0KH 1SFOH 2OCEA 1UC8A 4RAZA 3LWUA 5LL6b 4DV4L 2BE5C 4V0BA 1N32L 3PO3H 3IN5A 5EWGA 3BDCA 1I3QA 4IUNA 3PIOA 2CCZA 4UHVA 4K6LA 1LT5D 3OHAA 3NXWA 2W9BB 4GLXA 4DUYL 2ZJRA 3HOUG 2X69A 1I4HA 2F4VQ 3GV3A 3FMCA 5KFYA 3QIAA 3VYRA 1RK6A 4DLKA 1EUJA 4MNOA 3GTKA 3KAKA 4ED6A 4FXKC 1F2YA 5C0XH 1CKOA 1UE6A 1YNJC 3EN2A 1YJNA 1SEBD 1ET9A 2E5LL 1Z2PX 2HT1A 5KFMA 4BXXH 2UXBH 4A3DB 2HHHQ 4ECQA 2ASJA 1HRJA 5DG7A 2RDIA 2I46A 1RCVD 4HAEA 3BQ1A 4LF8L 5M5WH 3TP7A 2MUYA 3IRBA 4GKJQ 1UC9A 4DR6H 4L1KA 3GTOA 4A3FB 3TEHB 2RSNA 2KECA 2R92B 1VQ6A 4DR7L 2N88A 2J6UA 4A3KB 1GSHA 2CWPA 5CBAE 2VQFQ 5FPOA 3NUCA 4X65Q 2WKDA 1JJGA 4DNTB 3X3NA 4JI0L 3HKSA 3J81W 2GPWA 5KFPA 3MVVA 5C44B 3MFHA 4DK1A 4LFBH 3MJFA 4HNVA 1PYBA 3RF2A 4UP7A 3L0OA 4EGQA 1E4GT 5KT4A 2K14A 3KBGA 1BCPD 4MV1A 5C1OA 1MJEA 5BN4A 1C7YA 3RUPA 1V8QA 3KFUA 2JA6G 1SNCA 2B2WC 5IP7G 1SBBB 1MKHA 1Q7YC 5KYLA 2IW3A 2C00A 1GVPA 3JAML 3DHQA 1N34L 2O5IC 3PUYA 5HURA 4DA2A 1A8VA 3TQ1A 3GV8B 4Y52H 2DNCA 1PTOC 4PQXA 4LFAQ 3BU2A 2VUGA 2YTYA 1IW7D 2Y0SB 4DV7Q 4YAJB 1CM9A 4YIJA 2EYMA 2JA5G 2R93A 4EQPA 1A63A 1PTOB 3KHLA 1BNCA 1HNZL 1S4ZA 2Z6BA 4A3JH 3S2DB 2Y0SE 4A3EG 5C0XI 2R7ZA 3R8BA 2AGOA 1S9FA 4PG3A 5JJZA 3D3RA 3HOXG 3PSIA 1E0BA 2WFWA 1TWGH 2ID0A 1W2BA 3FPUB 1LT3D 1XPOA 1H9MA 4ZKBB 5M3MG 1KD1C 2DGYA 1VKZA 2EJFC 3L3OC 2JEAI 1QCBD 5JPNC 2XVSA 5COYA 4HTHA 5ELFA 3G7LA 4A3MB 3GTQA 4KHPQ 2V4QA 1STBA 3BDLA 1SJED 5HY6A 2EYLA 2JQOA 4RFBA 2W9BA 2WKCA 3PO2H 3UDIA 1EL0A 4RZRA 3VPDA 3MXGA 1XPRA 1EYCA 4JI4L 4FYDA 4DV2L 4O3QA 1TS3A 4M1UB 2R82A 2K50A 2QILA 2FPPB 3NTKA 4JI7H 4IALA 5IODA 4C3HH 3ULPA 1S5FD 2B2YA 5BN5A 2WACA 4BBSG 1SEIA 3ITPA 1TWAB 4AQYQ 2M2LA 1O7IA 1UE5A 1JKJB 3NWTA 3HOVG 5KKNB 1EOTA 2UUCH 4HJAA 1I6HB 1VQEA 2KEDA 3S17H 2W7OA 2ZM6L 4EYIB 1E7ZA 2ZT9C 1AZQA 4NXMQ 4WBNF 3T1YH 5K36H 5LXTF 4X3TA 2EZVA 3I4MB 3R3OA 3DUZA 2IWHA 2IX1A 5M3FB 4X62L 5I4DA 5A2QE 2W6NA 3D6WA 3OTOL 1I5FA 2V4DA 4CDFC 1IOVA 2RHSB 1Q12A 5CBEE 4HQ6A 4C5BA 5DLFA 1S03G 4G7OC 2F0HA 1A3UA 3SK5A 3S16H 3K0YA 3SE7A 3DMUA 1RJTA 2R8JA 5JEAJ 3GQCA 4LMYA 5KFXA 4DV5H 2GVAA 3CAMA 1JT8A 4KJOA 3PIPA 3JZIA 3GV7B 3GILA 4NKLA 3SDZA 3OSPA 1EQVA 5K2MA 4K14A 4G4KA 2CQAA 1AW7A 2RQXA 1XTDA 5FO8B 3UE0A 5I6WA 3K5HA 2HVRA 1EY6A 2VL6A 2L4NA 2VUMH 5JOBA 1RJQA 3NENA 4K8JA 1VQ8A 1XNRH 2B2WA 3Q0AA 1I94L 4YHHH 2PQAB 3W1BA 2CQOA 2E2HH 1EYAA 2FHTA 2JA8B 1HR0H 4K2LA 3T53B 4OHJA 4X64H 1E24A 4JV5L 1B70B 1PDQA 4LF7H 2E8GA 4ZUJA 3KTMA 5KFTA 1LABA 1WCMG 3JAME 3WO1A 2BDOA 3HZXA 3FVQA 2JEIA 3KXYT 2FFKB 4DL4A 1EWIA 3ONAB 2ZTCA 4DR5L 1DOKA 4GZYC 1AZPA 2D62A 3U50C 4FU0A 4BBRG 2D5DA 2FB9A 3RBDA 2HIXA 3S9WA 1O75A 3HOUB 1FKAH 4R7RA 5IWAL 4NP5A 1N36Q 4MTNA 5KFRA 3BYYB 2EDGA 4DR3Q 1XMOQ 5IP9G 1KC7A 2XWBB 4KMUC 5JVDF 3Q8PB 1A3TA 1B3AA 4I7HA 4DGZA 1TY2A 4WJ4A 1DGSA 4DAMA 1H9JA 4O3RA 4EYHB 1ICWA 1HZ9A 5GAHC 2PW5A 2I80A 4ED1A 4EBEA 2AUKA 3KK7A 2F4VL 2KJXA 4BY7H 2VY3A 2AHOB 3RGZA 1PHJA 2GA4B 2CW0C 4YBZB 5M9OA 2R8IA 3KOJA 1WD0A 1B1ZA 4IPDA 3M4PA 4MTEA 1JDEA 2HHHL 3AMUA 2C5CA 1M7JA 4HIDA 2HCIA 3RLOA 3RD4A 1AUVA 2XC9A 3EBEA 2MJ8A 4HN7A 2RA4A 2R8KA 4DU9A 4DAVA 4GKJL 3G6XA 1KABA 3GO5A 2C9OA 3MWDA 4A3CG 4IPHA 2FJZA 4NXNQ 2RHQB 4B3SQ 1K3BC 4OX9Q 1S0MA 1V1PB 3CCVA 3T1HH 2VQFL 4JI6H 4GOPC 4X65L 1KTKA 2JA6B 1PLFA 1T94A 4N9TA 1K1QA 4R4OA 4L63B 4JI3H 1I4QA 4A3IG 4RG1A 1IKLA 4QIWB 4ME6A 5IOCA 1JE4A 1X55A 1FJGQ 4LFCH 2YCHA 3OOCA 4GOPB 1PA6A 1HHVA 3QG1A 1FGBD 1IL8A 4YWMA 3C3LA 4EFEA 1SRUA 2O2LD 4DV3Q 5E7NA 1S5DD 2RBMA 1M6VA 4QIWE 1SAPA 3K0XA 1VQGA 4OEMB 5EKIA 2JA5B 3M9BA 3OWFA 3V6HA 3D6CA 4JI5Q 3E0EA 4C2MB 4ECUA 1O7YA 2PQAA 4KKUA 1DV2A 1SNPA 2I5LX 2AKWB 3ULJA 3LWBA 2VQDA 3I56A 1SXTA 2W6MA 2QW7A 2ZTDA 5LHY1 5DAUA 1D7QA 4DV4H 2V1CC 5KX5F 4LFAL 2E2DC 3T51B 5BN3A 4DV7L 3SVMA 1SYEA 2CH4A 2F52A 4R8NA 4IZOA 2BH2A 4Q5VA 3AFQA 5IYCG 1Y8PB 4OL7A 1ENFA 2RCNA 4ECTA 2NZ1D 5H1SE 5KFQA 2NWGA 1HUMA 4IJLA 1C0AA 3CCJA 4HR7A 4WJWA 4YY3H 3I4NB 1SE8A 2NTTA 5KFAA 4DL7A 4HCSA 1C4QA 1A62A 3QWNA 4ZQIA 2PBZA 4BWSC 4POFA 4IOCA 1AH9A 3R5FA 2PZUA 3F2UA 3GP7A 1XNQH 5L9XA 2QF7A 3RUZA 4KHPL 3DWQA 4BBSB 4DR7H 4K2KA 1YNND 4TV9F 1T5XD 1LYLA 2ATLA 3HOWH 1CE8A 1BDOA 4TRDA 2NBFA 1Z6HA 5GADC 1QILA 4IURA 3WDNA 2I8CA 4GKKQ 2KSWA 3PVXA 1EHIA 4F88A 1ZQ7A 3NTIA 1DCZA 2I87A 1K0SA 3K59A 1KC8C 5CV4A 5EAYA 1J5EH 1AEXA 4ZAIA 5JH7F 1S5ED 1N32Q 4TVAB 4HEDA 2UXCQ 2R93G 5EKLA 4AQYL 1EUDB 2W71A 2NVYA 1Y1WB 2Z1CA 1MBYA 4KTAA 2R7ZG 1EYGA 4TUYF 5FK9C 5EWFA 4UY8C 5LYJF 1IZ6A 3C2PA 1HQRD 4AH6A 3HOZH 1JWUD 1N34H 1VQJA 2JK8A 1TWFH 2I5MX 4OGQC 1BJTA 4LH7A 4EEYA 4A4IA 3J81E 2VXWA 2EXZA 2VR1A 3E0JA 4GC6A 4B3RH 4BY1H 1FNUA 1ZYRD 1LT6D 1V4YA 3BA9A 4QIWA 4GOPA 4G7ZC 3S1MB 1K83B 1YNXA 2YZMA 2WYOA 4DV1L 2CW7A 2J6SA 2ZJQA 3GTJH 5IY0A 3UFXB 3HS0C 2NU8B 5C8YF 2Z4IA 3MC0B 4ECZA 4YWLA 1TA8A 2XSCA 4Q0YA 4JI8H 3EYYA 3JSNA 3M3YH 3HOUH 3SHLA 2HVSA 2K5WA 1WCMB 4L5TA 2YU9B 4C5CA 3U9TA 4C2MA 5E4WC 5DGAA 4XDXA 2AMCB 2NVXH 1OTCA 3M4IA 1YI2A 4A3DG 3P7JA 2F0EA 1G2SA 4XYQA 4IFDI 5I6YA 3TSSA 4XXEA 2EYOA 1U4PA 3JC66 4A3GG 3H3VC 3OUUA 2J0TD 3FEWX 4A3FG 5I2XA 4RCOA 2YS7A 5KNBA 4X66L 2LFNA 2QKIC 4QGUA 2FLLA 2IA6A 4A3KG 4JI4H 4B3TH 2C28A 1BBWA 2UUBH 2A6ED 3RZDH 1MSGA 3AEVA 4ED3A 5C44G 4MV7A 2PW7A 1PV4A 3GTGH 1X32A 1ILPA 1AE3A 2NB0A 1N36L 3FKIB 1IYVA 2J7ZA 4DR3L 1XMOL 5FLMG 3TP8A 5KG7A 4O1NA 3E5NA 3NTHA 4OO1I 2A69D 2L15A 1KLUD 3N6XA 2BQRA 1MJCA 1Y14B 2B2TC 2L1BA 3K80C 2O03A 4XQJA 1TS5A 3I55A 3CCUA 5LL6X 1IBLL 1HPCA 1XPUA 5IYZF 1HNWQ 5IP7H 4AIMA 4PNYA 5CV7A 5DNFA 1C9OA 4EQOA 1EIHA 2TSSA 3PGZA 5T14A 4C3IB 3OTOH 1RJRA 4V190 1GUNA 2K03A 3I8ZA 4XT1B 1Z2OX 4JK1C 3J81c 1WR2A 3E5SA 3N43B 3D8GA 4U68A 3AB9A 1ENCA 5IT9c 1TWCH 1Y1WA 1ENAA 2RDHA 1EFID 1B3QA 4A3LG 1JOQA 1I4XA 4A93B 3ZJYC 1YHBA 3N44B 3RJ0A 2BA1A 4A3EH 4DXFA 2JA7B 1PH8A 3RLNA 4I55F 1G291 4Q45A 1ESRA 4QUCA 4Y7NH 4N8X1 2Q2TA 4QW9A 3NBIA 1PH1A 3ER0A 2XGPA 1I94H 1LTGD 4NXNL 3MR2A 1CTMA 3HOXH 1D5ZC 4B3SL 3RNUA 4OX9L 1CHPD 2LMCB 1GJXA 1QG7A 1SYXB 4O2AF 2AWNA 4DK0A 1VQKA 3N8DA 2RDJA 3A55A 2OQ0A 2BQUA 1K83A 4A3MG 3RB0A 3N52A 4XQQA 5M3MH 4JV5H 2EY6A 3R2TA 4M9UA 1T5EA 4ID6A 3VA5A 2NUAB 1FJGL 4HNTA 3PW2A 5FD6A 5AJ3Q 4DR5H 1WTOA 2F3VA 3MXPA 2EQSA 2F3WA 4NDXA 5C6AA 4DV3L 2DUDA 2UVRA 3OPOA 2YU9A 3RZOH 4LMQD 4ED0A 3HKZB 4LW1A 2MQHA 3TZUA 2ZM6Q 2OTJA 2FP4B 3TBIB 3RBEA 3GIMA 3VYSA 3PUVA 1QB5D 4KN7C 2BDNA 4ME3A 4ZLTF 1KDBA 3K5OA 3HKZE 1BF4A 4Z9CB 4LF5Q 2NTSA 3FDTA 1WVLA 2R85A 3D4RA 1XMQQ 3K5IA 4FO2A 5LOVF 3H40A 1T9HA 3HOVH 1EUCB 1PRTD 2AWOA 2BQ3A 2BCOA 1WTWA 1EY7A 1UUPA 2KHSA 4IFDG 4ULLA 3I4MG 1KRTA 1H9RA 3J81i 1HZCA 3CC7A 4LJZC 1FR3A 3J81j 1D1IA 4KY5A 5ELBA 2PYKA 1Y1VB 2J4XA 1SMYD 3FKIA 5T1GA 1B4OA 1E2VA 3S24A 2AQ2B 4FS1A 3S1NH 3S2HB 2HHHH 1A2TA 1OXXK 3A8KE 1AP0A 4QCLA 1V43A 3VDYA 1PH7A 2A8VA 1CKMA 2CFMA 1ZHSA 4PZ7A 3RTXA 2I5HA 3UDGA 1TIID 4GC7A 1D2BA 4UCSA 1EYDA 1HA6A 4GN4B 3F2DA 2B2TA 2VQFH 4KD4A 3PF5A 4OO1G 2R7ZB 1H95A 3RB3A 1STYA 2ASDA 2K5QA 3FRPB 2JA8G 2AQ1B 3I90A 5LMUQ 5IWAQ 4GKKL 3G6EA 5FD5A 1NSNS 4X6AH 2K01A 3E9HA 5FOBB 5G3LF 3K5NA 2BE5D 5C0XJ 3CF5A 4RB3C 5LMNH 2W57A 3MHBA 4RB2C 2W9CB 3RN5A 3BYTB 2PI2E 4EGJA 5M5XH 1GUWA 4IWXA 2QDBA 1WCMH 4RKBA 3Q24A 2A68C 1EZ6A 2WIIB 2UXCL 1UNSA 4C3JB 4HJ7A 5CA1F 5KG3A 3GTQB 5L37A 3L7ZC 2NU7B 2JA7A 4HSPA 4UAIA 4YB8B 3PIO3 4P2CB 1ESFA 3BJUA 5JJKA 1STGA 1SNOA 3M9NB 4PMCA 4BBRH 3H4DA 5KG0A 2W7PA 1WTXA 1N33Q 1YNJD 3M4OB 4KY7A 4B3MH 3BS1A 1JR0D 3HRZC 4H02A 4E4TA 2ES2A 4FM9A 3CVZA 2B2YC 1S68A 1L1OC 1KNEA 2HIVA 5IP9H 2J9GA 3KHHA 4DV7H 5BPHA 3H4BA 1CI3M 1PH5A 3NEMA 1PH4A 1EU4A 1NMFA 3QB3A 5L1KA 1L1OB 1GOZA 1FGUA 3PQIA 2W8LA 3BVMA 4A3GB 1QZHA 1I50H 1AN7A 3HKZA 4I65A 2NZHA 3ULLA 5A2QL 4KKSA 4F4YA 3ND8A 3CPWA 1KIXA 1NY4A 4ED8A 2GVBA 3VR2A 5DM63 3GTLH 1R4QB 4DN4M 3ORQA 5LA6F 4ZI7F 3G71A 3K7AB 4CJ0B 1YJ9A 3GTMH 1A9XA 1NE3A 4EEQA 1CHQD 1VAJA 5CC4A 5H80A 4PV1C 1SROA 5IT9W 3GD7A 4RGMA 3KAJA 3J7AK 2EYFA 1VQ5A 1SSOA 5DG9A 3CCEA 1VQ4A 1GSAA 3QZ8A 1FVIA 3LNNA 3CMAA 3KBXA 3CMEA 4DR1Q 1TWHA 3R5XA 4A3CH 1GXDC 3F8TA 4ETSA 3VR3A 4A75A 1PH2A 4L5SA 4HJ5A 4P73A 1Y1VA 4M7EA 4ZHQF 5ISRA 1PTOD 1X3QA 3VR5A 4GN3B 4A3IH 5KFJA 2L9HA 5CGKA 4APVA 2R87A 4R4IA 1I3QH 1CZWA 1TT2A 3MA2B 5C3EB 2B63B 1RIPA 1I4RA 3I4OA 2N78A 5F9NA 2CZGA 3PUXA 4RNOA 2NZOA 2PZWA 1R9TB 1GYFA 2NN6I 2RCFA 1CQFA 4NXMH 5CB4F 3GTKH 1O7LA 4HSVA 4H0LC 1HNWL 2K28A 2PI2A 3CCRA 3UDFA 4P74A 3IAYA 3AYHB 4O3SA 3H3VI 2KCNA 1FNWA 3TS2A 4DV6H 5BR8H 1WYDA 2M00A 4M8AA 2W9CA 4NLGA 3GTPH 1S72A 2UXBQ 4HJ9A 2XNAC 3KLSA 2CHBD 5CA0F 2ZDQA 4F50A 2QCPX 2EJMA 3U9OA 3GTOH 2E75C 3URYA 5IYCH 1JIHA 2L11A 1SDFA 1MSHA 2EIFA 5KEEA 3I4NG 2O5JC 3BVZA 1CT1D 2XCPA 3DEOA 3NPPA 5C5LA 2EE1A 1DYQA 5NUCA 4R8UB 5IGBA 2OH2A 3NWSA 2PVPA 1N9WA 3Q22A 1TR5A 3PUZA 2B2VC 5EWEA 2RF4A 4TV8F 1OXUA 1L1OA 5HGTA 1QWYA 3A0JA 3H91A 5AJ3L 4UCTA 2ICIA 1PZID 5C4JB 4J15A 3RN2A 2AQ3B 4DK6C 2HVQA 1KXLA 3TDQA 2R7MA 1VQHA 3D4WA 2KBNA 4ZK9B 2KVMA 3OMGA 5CV5A 1N36H 3R5HA 2YZNA 1KDAA 2JXMB 1TVXA 1TU2B 1NUCA 2NUCA 3CKIB 2TMPA 3U4VA 2F0NA 4P75A 1HTLD 1C30A 3MWYW 4LK1C 4UFZA 3ND9A 3IG0A 4JOIC 4GN5A 1Y1WG 4DV1Q 1NJIC 4LF5L 1J9OA 1EZ8A 2R93H 2OF1A 4JI2H 3FPPA 1GKHA 1DOMA 2KOLA 1XMQL 3JRXA 2K7VA 5JQWA 1CKNB 2VZAA 5GAEC 2M9VA 4CKBA 2MP1A 4PZ8A 1F77A 2N3SA 4C5AA 1VCIA 3Q8DA 3PIP3 2E2JB 4J9MA 4HIKA 1RODA 4OWXB 4XX0B 3A56A 3Q8SB 4IUUA 4K5VA 4YCWA 1AE2A 3SK8A 1F2LA 3A7AB 3P20A 1PVOA 2XD4A 4AYBA 4IN3A 1HNXQ 3TIIA 1BR9A 1PFSA 3L4JA 4MHEA 3RR5A 1K3RA 1VQAA 1ML0D 1QVGA 1HFGA 2VPQA 2UVWA 2UU9Q 1STHA 1VQCA 2YYZA 2B63A 2SEBD 2IX0A 1LTBD 5D1OB 2WB1B 1R9TA 5CAEB 4LUZA 4X66Q 1JJCB 4O0AA 1B6RA 2R7DA 2IBKA 3RB6A 4OX9H 5CMDA 3M7GA 4L8JA 2K75A 2WB1E 4LF6Q 4FXDA 4IUQA 5JUMA 4DPGA 5IIFA 4A3DH 3TRZA 1LLRD 2ICEC 4HR7B 4DL6A 2NN6G 5LMUL 1H9KA 1R4PB 2VNUD 4Q44A 1X3GA 3PW4A 1LUZA 4FS2A 4ZQ3A 1C48A 1ZHQA 4KKTA 3MZ5A 2YTVA 4EG0A 4DR2H 4A3FH 4DV3H 2RGRA 1EOVA 2KUMA 2R92H 4PWQA 5D8DA 3MWEA 4JPBW 4KK7A 4QB4A 4A3KH 1S97A 3T5LA 1IBLQ 4J9KA 4ZCKA 4JI5H 4ECVA 2PZTA 1JOKA 1RTNA 1WI5A 5C44H 2A73B 1RF2D 4ODGA 3GQBA 1EEID 1RKNA 3FKIG 2RVLA 1N33L 4RB0A 4R8UA 1Q8KA 3CC4A 5EOYA 5KFUA 4CC5A 5FLMH 2UXDH 4OXPA 1KHIA 1ICFB 2JP1A 2B2VA 3C0FB 1BBUA 3J81L 4UDUC 3OMCA 4DV5Q 1XJVA 2NVYB 2QYZA 5KG2A 2WAQA 4YR3A 3EPIA 1MIUA 4DR4H 3TQYA 3OW7A 2CWAA 5DQIA 5IT9L 3CD6A 4C3IG 3TQTA 3V6JA 1DJRD 1DM0B 3N6RA 4MV4A 3OW2A 3PUWA 1UNNC 1XNRQ 5KFIA 3M7NA 1EY0A 3IFDA 3PV0A 3BQ2A 5ELDA 3BJYA 1HR0Q 1PTOH 4XYOA 1TXYA 3X3MA 4E6IA 4A93G 4X64Q 2A6HD 4JOIA 3S2DH 3D31A 1Z2NX 3OHBA 3KHGA 1CKNA 4LF7Q 2JA7G 4A3LH 1RYRA 4JV0A 1BO0A 2L12A 2KCTA 1H9SB 1E22A 4DR1L 1CK1A 4WJ3M 2VOBA 3J7ZC 2IT1A 1U9RA 2W6OA 4GKKH 1HR0W 3RLFA 4LF9H 3J80c 3J7AV 1KJ8A 2YRWA 4S3SA 4A3MH 2W6ZA 5LL6S 3K81C 4UP8A 1KNAA 4CJ2C 1N32H 1HTPA 3WOFA 2VA3A 4L6TB 2UXCH 2EXDA 4YCUA 1KJIA 1L0WA 4K0KL 2K05A 2VQEQ 2WB1A 5D1OA 1BCPF 2C2EA 2OQKA 1HA5A 1VMCA 2NVQB 2QGQA 3HKZG 3FDSA 4DUYH 2BOSA 3STBD 2B29A 3Q23A 1B04A 4ED7A 4DV0Q 1TS2A 2F0JA 3KDFA 5EBCA 3F2CA 4FDBA 5C4XB 1EQRA 3CQZB 1EIYB 3V2TA 2W70A 1SE3A 3P75A 2E5LH 5EBDA 4YAKB 2E2IB 1ILQA 1Q46A 5KFHA 1TWAH 1JOOA 2ZDGA 1U4LA 1IBKQ 2FKLA 2E76C 4O4LF 1A0IA 2DWCA 3OIQA 4LF8H 2UXBL 2PQEA 1I6HH 2MCTA 3VMMA 5J2TF 3DM1A 4LSXA 5KFSA 1KJQA 3S14B 4IFDH 3BA8A 3I4MH 2IL8A 3F2BA 5KFWA 1Y1VG 5HBRB 5M3FH 2R7KA 1F2MA 2JJQA 4LWCA 4I4TF 4JI0H 2F03A 4G3IA 1BXTA 2V4RA 2DLNA 5DQHA 4HJ8A 4K5WA 5IGCA 5EPKA 2GLTA 5M5YB 4JYAQ 3V4ZA 2C2DA 1X6OA 3SK6A 4J9PA 3J7AF 3A5UA 1PXUA 3I72A 2JSOA 2P5ZX 5KT6A 5CR3A 5C4HA 3HXLA 5CYUA 4CDEC 5FJ8G 4F4XA 1HH2P 2Q8IB 3J80i 1MZBA 1ZKOA 1I6VC 1YZ6A 4BA1I 1PFMA 4OO1H 1YNNC 5EQ0A 1KBLA 5JJLA 3EPGA 5FLXW 1P8LA 2JA8H 4XTCS 1N8RC 3WWVA 4LF4Q 5J2UF 1IBMQ 2YW2A 1HZBA 5KFZA 2FLPA 2R8GA 3IKJA 5IT9E 4C3JG 1QUQB 4FXGC 1DD2A 4HIMA 3Q6SA 3L4KA
chains in the Genus database with same CATH topology
3TS0A 4JI2Q 1T9HA 3HOVH 2JA5G 1A63A 1OXTA 2AWOA 1HNZL 3AQQA 1J6QA 4A3JH 1VQPA 4IFDG 2Y0SE 1D8LA 5C0XI 4A3EG 3I4MG 1SN8A 1KRTA 4GLAC 3J81i 1HZCA 1K0RA 2R6GA 3CC7A 2KHJA 3J81j 4PG3A 1P16A 3HOXG 3PSIA 4YY3Q 3CP0A 1VQMA 2WFWA 1EFWA 2IY5B 1TWGH 2KHIA 1PYSB 2ID0A 3K8AA 2Z6KA 5GQOA 3LGJA 3S24A 5C3EH 1OXXK 2KCMA 5M3MG 1XPOA 1EQQA 2DGYA 1KD1C 4LUVA 5JEAG 3HOYG 2JEAI 1V43A 3VDYA 1R9TH 1PH7A 2A8VA 1CKMA 2CFMA 2UU9L 4KHPQ 4PZ7A 2I5HA 5HY6A 2JQOA 3UDGA 5HGQA 4NB3A 1JJ2A 3F1ZA 3PO2H 3UDIA 5IYBG 4GN4B 3F2DA 4R1JA 1XPRA 4JG2A 4OO1G 3CCSA 3PF5A 4JI4L 1H95A 5IE8A 4DV2L 4LF6L 2JA8G 2K50A 5LMUQ 5IWAQ 4GKKL 3G6EA 3CXCA 4X6AH 3CF5A 3E9HA 5C0XJ 1VQOA 3MEFA 3D0FA 4C3HH 3ULPA 1NTGA 2NVYH 3RN5A 2UUAL 4BBSG 2PI2E 5IYDG 5LMNL 5M5XH 4AQYQ 1J5EQ 1WCMH 1B7YB 1O7IA 1UE5A 4PZ6A 4DR2Q 2UXCL 3HOVG 4QL5A 4HJ7A 4HJAA 3L7ZC 3JAMc 4A3JG 1Z9FA 3CPFA 1VQEA 2KENA 3BJUA 4IJHA 3S17H 5JJKA 1YHAA 4BBRH 2ZM6L 4IFDJ 2JA6H 1E7ZA 1N33Q 4NXMQ 2YTXA 2B63H 1SR3A 4JBJA 4UPAA 4AYBG 4YWKA 4H02A 2ES2A 2IX1A 3DLLA 4B3ML 4X62L 4B3RQ 4NPSA 1L1OC 1Q1EA 3OTOL 1I5FA 2HIVA 5IP9H 4A3BH 2RHSB 1Q12A 5C3EG 5C4JH 2VW9A 2B63G 1E1TA 3W5OA 2UXDQ 1PH5A 3S16H 1BKBA 3NEMA 1PH4A 1NMFA 4JI1Q 5JEAJ 1L1OB 2JA5H 1FGUA 1U0LA 2GVAA 3CAMA 4IO9A 1JT8A 3PIPA 1QZHA 4DV5L 1Q1BA 1I50H 4JI8Q 4C2MH 3PO2G 4DR4Q 2NZHA 3ULLA 2QA4A 4DR6L 1RL2A 3STBC 1XTDA 3UE0A 3A5ZB 1CSPA 3CPWA 1KAWA 2VL6A 1SLJA 1NY4A 2Z0SA 1KIXA 3CCLA 2GVBA 2VUMH 3NENA 3GTLH 1VQ8A 3HFZB 1I94L 2PQAB 3W1BA 3G71A 2BH8A 3T1HQ 2D0OA 1YJ9A 2CQOA 2E2HH 1NE3A 4JI6Q 3CCMA 4YHHL 1XNRL 3GTMH 3PF4A 1QUQA 4OONA 2Q2HA 4RMFA 4JI3Q 1SROA 1HR0L 3GD7A 1Z47A 4LFCQ 1E24A 3NELA 2WP8J 1B70B 4JV5L 4X64L 2E8GA 4LFBL 1WCMG 1VQ5A 2E2JH 4LF7L 3CCEA 4P71A 1EWIA 2C35B 1VQ4A 1JE5A 3KF6B 2ZTCA 1FVIA 3CMAA 4DR1Q 4DR5L 2A19A 3CMEA 2D62A 3I4NH 4A3CH 4IPGA 3U50C 1IXRA 4BBRG 3F8TA 4JC0A 4A75A 1PH2A 2HIXA 2UUBQ 4L5SA 4HJ5A 4P73A 5K36G 1LM0A 2PNHA 4DKAC 4LF9Q 2LSSA 3AFPA 5IWAL 1N36Q 4MTNA 2N8NA 4JCVE 4GN3B 4PMWA 4A3IH 4DR3Q 1XMOQ 3FP9A 4JBWA 5IP9G 4APVA 3JAMi 4A3BG 1V9PA 3I2ZA 4R4IA 4DV4Q 1NMGA 1I3QH 3KJOA 4BBSH 4KLKA 4KI0A 2IHEA 4QJFA 4WJ4A 2VQEL 1DGSA 1RIPA 2GN5A 2WAQG 4DAMA 2MFIA 2D0PA 2N78A 3I4OA 1K8AC 3PUXA 1U5KA 2NZOA 4DUYQ 1HZ9A 2NN6I 1X3FA 5GAHC 2XTIA 3TREA 1PH6A 3K7UC 1Q81C 4POGA 4DV0L 3GTKH 1QVCA 4GNXC 2F4VL 1HNWL 2K5VA 2PI2A 3CCRA 4NXML 2ATWA 3UDFA 4P74A 2VUMG 2N49A 2AHOB 2VY3A 3AYHB 4BY7H 3H3VI 3TS2A 1PHJA 2E5LQ 2HQLA 2K5NA 4ALPA 1WYDA 1IYJB 4GNXB 1HNXL 4DV6L 3KOJA 5BR8L 3GTPH 2LXKA 1Y1WH 1IBKL 1OXVA 1S72A 1YEZA 4IPDA 4HJ9A 2UXBQ 1HZAA 3M4PA 2HHHL 4LF8Q 3J7A5 1CSQA 4HIDA 4O2DA 3RLOA 3GTOH 5IYCH 4DUZQ 3EBEA 1YHQA 1XNQQ 3S1RH 4GKJL 3PCOB 3GO5A 1YITA 2EIFA 3EIVA 4DR7Q 3I4NG 4A3CG 3FHWA 4IPHA 3HOWG 1K8GA 4NXNQ 2RHQB 4B3SQ 4OX9Q 3CCVA 3S1MH 1K83H 3B6YA 2VQFL 1S40A 4GOPC 4JI0Q 2Q2UA 4X65L 1Q82C 1IL2A 3G48A 4R4OA 3S1QH 4A3IG 1N9WA 4RG1A 3PUZA 1X55A 3E9IA 1PH3A 2ALYB 1FJGQ 2RF4A 2WB1G 1UWVA 4GOPB 4LFCL 4JYAL 1OXUA 1L1OA 1PA6A 3CW2C 4JI7L 3CC2A 1K73C 3A0JA 4YWMA 2R92G 5AJ3L 1GM5A 1SRUA 4DV3Q 4J15A 3RN2A 4QY7A 5E7NA 4DK6C 2YU9H 4QIWE 2CKZB 1KXLA 2R7FA 3K0XA 5ELOA 1VQGA 1VQHA 2KBNA 2UUCL 3M9BA 1UEBA 4DK3C 4L5QA 3H15A 4JI5Q 1KRSA 3E0EA 4HIOA 1VQFA 2PQAA 1N34Q 2I5LX 4BY7G 2AKWB 2BA0A 4GLVB 3ULJA 3U4VA 3T1YL 3I56A 4LF4L 2ZTDA 4P75A 2MNAA 1IBML 3GDEA 1D7QA 4JOIC 4P72A 1YIJA 4GN5A 1E1OA 2V1CC 3MXNB 3UDXA 1Y1WG 4DV1Q 2ZTEA 1NJIC 1L2FA 4LF5L 4LFAL 2NVTH 2R93H 3H3VH 4DV7L 1GKHA 1QZGA 1XMQL 2F52A 4OWWB 2BH2A 3AFQA 3KF6A 1M1KC 5IYCG 1HNZQ 1CKNB 2VZAA 5GAEC 1SMXA 4JI2L 4A76A 2RCNA 4PZ8A 2N3SA 1VCIA 3Q8DA 1BVSA 5H1SE 4HIKA 1WOCA 4IJLA 4OWXB 4DNIA 1C0AA 2JE6I 3CCJA 5GROA 4YCWA 1AE2A 3FKIH 3KF8B 1SE8A 2K52A 2OTLA 4R4CA 2Y0SG 4YY3L 1PVOA 1V1QA 3KLWA 1HNXQ 1A62A 1PFSA 4EQ5A 3U58A 3RR5A 1K3RA 1VQAA 2JEBI 1QVGA 4POFA 3A74A 4IOCA 4LNQA 1AH9A 5J3BA 2NVQH 2UU9Q 1KQSA 1VQCA 2YYZA 1Q86C 2IX0A 4KHPL 2A1AA 1XNQL 1VQ9A 1CUKA 4LUZA 4BA2I 4X66Q 1JB7A 1JJCB 4O0AA 5C4XH 1WFQA 2R7DA 3CQZH 2OWOA 1LYLA 4C3IH 4JI4Q 3HOWH 4B3TQ 2E2IH 1E3PA 4DV2Q 1PH9A 2K75A 1NBWA 2WB1E 4LF6Q 3ICEA 3DM3A 5GADC 4DPGA 4A3DH 4GKKQ 4GNXA 3TRZA 2NN6G 2ASBA 5LMUL 1KL9A 3BZKA 3OYYA 1VQDA 2UUAQ 2VNUD 1X3GA 5LMNQ 1KC8C 4A93H 1LUZA 5EAYA 1QVFA 4R4TA 2YTVA 1VQIA 3S14H 4A3FH 4TVAB 4K0KQ 1N32Q 2JA7H 1EOVA 4AQYL 2UXCQ 2R93G 1J5EL 2R92H 4XIGS 4MZ9A 4DR2L 4AYBE 2R7ZG 1EYGA 4A3KH 4YHHQ 1IBLQ 5ELNA 1JMCA 4UY8C 1IZ6A 2H5XA 4AH6A 1WJJA 3HOZH 1VQJA 4JI5L 2JK8A 1TWFH 1WI5A 2I5MX 5C44H 1N33L 5LMNW 3FKIG 4A4IA 1GD7A 5M5YH 4B3MQ 1Q8KA 1B8AA 4X62Q 3L2PA 3CC4A 4BY1H 1VQNA 4IPCA 1GO3E 4LUOA 3OTOQ 4B3RL 5FLMH 4GOPA 4OXPA 1EIFA 1YNXA 1KHIA 1VQBA 4DV1L 2UXDL 2ZJQA 3GTJH 2MO0A 5IY0A 4JI1L 3W1GA 1BBUA 4DV5Q 1XJVA 3BZCA 4YWLA 1MIUA 3M3YH 3HOUH 5C4XG 4DR6Q 3TQYA 4JI8L 2CWAA 4DR4L 4L5TA 3CD6A 2PMZE 2B3GA 4JBMA 3S1NH 1UE7A 5M3FG 1UE1A 1W3SA 2AMCB 1I94Q 2NVXH 1OTCA 3OW2A 3PUWA 1YI2A 3ERSX 4A3DG 1XNRQ 4R4QA 3M7NA 3M4QA 3T1HL 3CCQA 3PV0A 4JI6L 4IFDI 1HR0Q 3JC66 4JV5Q 1TXYA 1X65A 4JI3L 4A3GG 4A93G 2JA9A 4X64Q 1S3OA 4JOIA 3S2DH 3D31A 4LFBQ 4A3FG 1CKNA 2ZJPA 4LF7Q 2JA7G 4A3LH 2XGTA 1TWHH 3H0GH 2K4KA 4EX5A 4DR5Q 4X66L 4QGUA 2KCTA 1YVCA 3SGIA 4A3KG 1E22A 2Q2IA 4DR1L 3I7FA 4GS3A 1X9NA 3J7ZC 1Y1VH 3KJPA 4WJ3M 1BBWA 1YJWA 4B3TL 2IT1A 3KYHC 3RZDH 4DAYB 3AEVA 3HOZG 1HR0W 1X54A 3RLFA 5C44G 2UUBL 1ASZA 3U4ZA 3S2HH 1G51A 2Z6KC 3GTGH 1PV4A 3J80c 2K5HA 1OXSC 4LF9L 4BY1G 1AE3A 2WAQE 4A3MH 5GAGC 4L5RC 3S15H 1LTLA 1N36L 4OWTB 4DR3L 3K81C 4UP8A 5FLMG 1XMOL 1SFOH 4IOAA 2OCEA 2EXDA 4YCUA 1L0WA 4DV4L 4K0KL 2VQEQ 3PO3H 4OO1I 2L15A 1N32L 2CCZA 2OQKA 5FJ8H 3PIOA 2QGQA 3HKZG 1MJCA 1Y14B 3K80C 3STBD 2R7ZH 2B29A 4GLXA 4TQUS 2ZJRA 3I55A 3CCUA 4DUYL 1IBLL 3HOUG 1XPUA 4DV0Q 2F4VQ 1HNWQ 5IP7H 3KDFA 3NBHB 4AIMA 1HJPA 3F2CA 4FDBA 1C9OA 1EUJA 1EQRA 1X56A 2YV5A 4MNOA 1EIYB 3PGZA 1CKOA 2LXJA 4YCVA 5JJIA 1Q46A 1UE6A 3EN2A 1YJNA 4DV6Q 1M90C 1TWAH 5BR8Q 2E5LL 3J81c 2HT1A 2QEXA 1VS0A 1IBKQ 4BXXH 4C3JH 1A0IA 2HHHQ 3GTQH 2UXBL 1I6HH 5IT9c 1TWCH 3UE1A 4LF8L 5M5WH 4A3LG 3IRBA 4GKJQ 3ZJYC 4DUZL 1YHBA 3H0GG 2BA1A 3M4OH 4A3EH 1YBYA 2FXQA 3TEHB 3RLNA 1PH8A 1G291 3I4MH 3F2BA 1ASYA 4Y7NH 2Q2TA 1VQ6A 1Y1VG 4DR7L 5M3FH 3ER0A 1PH1A 3G4SA 1FL0A 4NXNL 2JJQA 4LWCA 2CWPA 3HOXH 2VQFQ 3KDFB 3RNUA 4B3SL 4X65Q 4OX9L 5FLXc 1JJGA 2AWNA 4JI0L 1X3EA 3HKSA 1VQKA 2OQ0A 1W2BA 4A3MG 4HJ8A 5M3MH 3HOYH 4JYAQ 4QQBX 2F3IA 4JI7Q 1FJGL 4A3GH 1X6OA 3A5UA 2VS1A 5AJ3Q 1K9MC 1PYBA 1VQLA 3PO3G 4UP7A 2EQSA 3L0OA 5FJ8G 1HH2P 4DV3L 2K14A 1VQ7A 2DUDA 2UUCQ 1MJEA 3J80i 5IYBH 1C7YA 4UP9A 3RZOH 1YZ6A 3KFUA 4LW1A 2MQHA 4BA1I 2ZM6Q 4JBKA 3K7AH 5IP7G 2JA6G 2OTJA 5JJLA 1MKHA 1Q7YC 1P8LA 2JA8H 2IHFA 3PUVA 4KHZA 1GVPA 4XTCS 3WWVA 3T1YQ 1N8RC 1G6PA 1N34L 4LF4Q 4ME3A 3PUYA 5C0XG 1IBMQ 1HZBA 3HKZE 2MO1A 1A8VA 2I0QA 4Y52H 4BXXG 4LF5Q 4LFAQ 3BU2A 5IYDH 2YTYA 1QUQB 5DLQE 4DV7Q 4HIMA 1XMQQ 3M85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TS0 A;  4JI2 Q;  1T9H A;  3HOV H;  2JA5 G;  1A63 A;  1OXT A;  2AWO A;  1HNZ L;  3AQQ A;  1J6Q A;  4A3J H;  1VQP A;  4IFD G;  2Y0S E;  1D8L A;  5C0X I;  4A3E G;  3I4M G;  1SN8 A;  1KRT A;  4GLA C;  3J81 i;  1HZC A;  1K0R A;  2R6G A;  3CC7 A;  2KHJ A;  3J81 j;  4PG3 A;  1P16 A;  3HOX G;  3PSI A;  4YY3 Q;  3CP0 A;  1VQM A;  2WFW A;  1EFW A;  2IY5 B;  1TWG H;  2KHI A;  1PYS B;  2ID0 A;  3K8A A;  2Z6K A;  5GQO A;  3LGJ A;  3S24 A;  5C3E H;  1OXX K;  2KCM A;  5M3M G;  1XPO A;  1EQQ A;  2DGY A;  1KD1 C;  4LUV A;  5JEA G;  3HOY G;  2JEA I;  1V43 A;  3VDY A;  1R9T H;  1PH7 A;  2A8V A;  1CKM A;  2CFM A;  2UU9 L;  4KHP Q;  4PZ7 A;  2I5H A;  5HY6 A;  2JQO A;  3UDG A;  5HGQ A;  4NB3 A;  1JJ2 A;  3F1Z A;  3PO2 H;  3UDI A;  5IYB G;  4GN4 B;  3F2D A;  4R1J A;  1XPR A;  4JG2 A;  4OO1 G;  3CCS A;  3PF5 A;  4JI4 L;  1H95 A;  5IE8 A;  4DV2 L;  4LF6 L;  2JA8 G;  2K50 A;  5LMU Q;  5IWA Q;  4GKK L;  3G6E A;  3CXC A;  4X6A H;  3CF5 A;  3E9H A;  5C0X J;  1VQO A;  3MEF A;  3D0F A;  4C3H H;  3ULP A;  1NTG A;  2NVY H;  3RN5 A;  2UUA L;  4BBS G;  2PI2 E;  5IYD G;  5LMN L;  5M5X H;  4AQY Q;  1J5E Q;  1WCM H;  1B7Y B;  1O7I A;  1UE5 A;  4PZ6 A;  4DR2 Q;  2UXC L;  3HOV G;  4QL5 A;  4HJ7 A;  4HJA A;  3L7Z C;  3JAM c;  4A3J G;  1Z9F A;  3CPF A;  1VQE A;  2KEN A;  3BJU A;  4IJH A;  3S17 H;  5JJK A;  1YHA A;  4BBR H;  2ZM6 L;  4IFD J;  2JA6 H;  1E7Z A;  1N33 Q;  4NXM Q;  2YTX A;  2B63 H;  1SR3 A;  4JBJ A;  4UPA A;  4AYB G;  4YWK A;  4H02 A;  2ES2 A;  2IX1 A;  3DLL A;  4B3M L;  4X62 L;  4B3R Q;  4NPS A;  1L1O C;  1Q1E A;  3OTO L;  1I5F A;  2HIV A;  5IP9 H;  4A3B H;  2RHS B;  1Q12 A;  5C3E G;  5C4J H;  2VW9 A;  2B63 G;  1E1T A;  3W5O A;  2UXD Q;  1PH5 A;  3S16 H;  1BKB A;  3NEM A;  1PH4 A;  1NMF A;  4JI1 Q;  5JEA J;  1L1O B;  2JA5 H;  1FGU A;  1U0L A;  2GVA A;  3CAM A;  4IO9 A;  1JT8 A;  3PIP A;  1QZH A;  4DV5 L;  1Q1B A;  1I50 H;  4JI8 Q;  4C2M H;  3PO2 G;  4DR4 Q;  2NZH A;  3ULL A;  2QA4 A;  4DR6 L;  1RL2 A;  3STB C;  1XTD A;  3UE0 A;  3A5Z B;  1CSP A;  3CPW A;  1KAW A;  2VL6 A;  1SLJ A;  1NY4 A;  2Z0S A;  1KIX A;  3CCL A;  2GVB A;  2VUM H;  3NEN A;  3GTL H;  1VQ8 A;  3HFZ B;  1I94 L;  2PQA B;  3W1B A;  3G71 A;  2BH8 A;  3T1H Q;  2D0O A;  1YJ9 A;  2CQO A;  2E2H H;  1NE3 A;  4JI6 Q;  3CCM A;  4YHH L;  1XNR L;  3GTM H;  3PF4 A;  1QUQ A;  4OON A;  2Q2H A;  4RMF A;  4JI3 Q;  1SRO A;  1HR0 L;  3GD7 A;  1Z47 A;  4LFC Q;  1E24 A;  3NEL A;  2WP8 J;  1B70 B;  4JV5 L;  4X64 L;  2E8G A;  4LFB L;  1WCM G;  1VQ5 A;  2E2J H;  4LF7 L;  3CCE A;  4P71 A;  1EWI A;  2C35 B;  1VQ4 A;  1JE5 A;  3KF6 B;  2ZTC A;  1FVI A;  3CMA A;  4DR1 Q;  4DR5 L;  2A19 A;  3CME A;  2D62 A;  3I4N H;  4A3C H;  4IPG A;  3U50 C;  1IXR A;  4BBR G;  3F8T A;  4JC0 A;  4A75 A;  1PH2 A;  2HIX A;  2UUB Q;  4L5S A;  4HJ5 A;  4P73 A;  5K36 G;  1LM0 A;  2PNH A;  4DKA C;  4LF9 Q;  2LSS A;  3AFP A;  5IWA L;  1N36 Q;  4MTN A;  2N8N A;  4JCV E;  4GN3 B;  4PMW A;  4A3I H;  4DR3 Q;  1XMO Q;  3FP9 A;  4JBW A;  5IP9 G;  4APV A;  3JAM i;  4A3B G;  1V9P A;  3I2Z A;  4R4I A;  4DV4 Q;  1NMG A;  1I3Q H;  3KJO A;  4BBS H;  4KLK A;  4KI0 A;  2IHE A;  4QJF A;  4WJ4 A;  2VQE L;  1DGS A;  1RIP A;  2GN5 A;  2WAQ G;  4DAM A;  2MFI A;  2D0P A;  2N78 A;  3I4O A;  1K8A C;  3PUX A;  1U5K A;  2NZO A;  4DUY Q;  1HZ9 A;  2NN6 I;  1X3F A;  5GAH C;  2XTI A;  3TRE A;  1PH6 A;  3K7U C;  1Q81 C;  4POG A;  4DV0 L;  3GTK H;  1QVC A;  4GNX C;  2F4V L;  1HNW L;  2K5V A;  2PI2 A;  3CCR A;  4NXM L;  2ATW A;  3UDF A;  4P74 A;  2VUM G;  2N49 A;  2AHO B;  2VY3 A;  3AYH B;  4BY7 H;  3H3V I;  3TS2 A;  1PHJ A;  2E5L Q;  2HQL A;  2K5N A;  4ALP A;  1WYD A;  1IYJ B;  4GNX B;  1HNX L;  4DV6 L;  3KOJ A;  5BR8 L;  3GTP H;  2LXK A;  1Y1W H;  1IBK L;  1OXV A;  1S72 A;  1YEZ A;  4IPD A;  4HJ9 A;  2UXB Q;  1HZA A;  3M4P A;  2HHH L;  4LF8 Q;  3J7A 5;  1CSQ A;  4HID A;  4O2D A;  3RLO A;  3GTO H;  5IYC H;  4DUZ Q;  3EBE A;  1YHQ A;  1XNQ Q;  3S1R H;  4GKJ L;  3PCO B;  3GO5 A;  1YIT A;  2EIF A;  3EIV A;  4DR7 Q;  3I4N G;  4A3C G;  3FHW A;  4IPH A;  3HOW G;  1K8G A;  4NXN Q;  2RHQ B;  4B3S Q;  4OX9 Q;  3CCV A;  3S1M H;  1K83 H;  3B6Y A;  2VQF L;  1S40 A;  4GOP C;  4JI0 Q;  2Q2U A;  4X65 L;  1Q82 C;  1IL2 A;  3G48 A;  4R4O A;  3S1Q H;  4A3I G;  1N9W A;  4RG1 A;  3PUZ A;  1X55 A;  3E9I A;  1PH3 A;  2ALY B;  1FJG Q;  2RF4 A;  2WB1 G;  1UWV A;  4GOP B;  4LFC L;  4JYA L;  1OXU A;  1L1O A;  1PA6 A;  3CW2 C;  4JI7 L;  3CC2 A;  1K73 C;  3A0J A;  4YWM A;  2R92 G;  5AJ3 L;  1GM5 A;  1SRU A;  4DV3 Q;  4J15 A;  3RN2 A;  4QY7 A;  5E7N A;  4DK6 C;  2YU9 H;  4QIW E;  2CKZ B;  1KXL A;  2R7F A;  3K0X A;  5ELO A;  1VQG A;  1VQH A;  2KBN A;  2UUC L;  3M9B A;  1UEB A;  4DK3 C;  4L5Q A;  3H15 A;  4JI5 Q;  1KRS A;  3E0E A;  4HIO A;  1VQF A;  2PQA A;  1N34 Q;  2I5L X;  4BY7 G;  2AKW B;  2BA0 A;  4GLV B;  3ULJ A;  3U4V A;  3T1Y L;  3I56 A;  4LF4 L;  2ZTD A;  4P75 A;  2MNA A;  1IBM L;  3GDE A;  1D7Q A;  4JOI C;  4P72 A;  1YIJ A;  4GN5 A;  1E1O A;  2V1C C;  3MXN B;  3UDX A;  1Y1W G;  4DV1 Q;  2ZTE A;  1NJI C;  1L2F A;  4LF5 L;  4LFA L;  2NVT H;  2R93 H;  3H3V H;  4DV7 L;  1GKH A;  1QZG A;  1XMQ L;  2F52 A;  4OWW B;  2BH2 A;  3AFQ A;  3KF6 A;  1M1K C;  5IYC G;  1HNZ Q;  1CKN B;  2VZA A;  5GAE C;  1SMX A;  4JI2 L;  4A76 A;  2RCN A;  4PZ8 A;  2N3S A;  1VCI A;  3Q8D A;  1BVS A;  5H1S E;  4HIK A;  1WOC A;  4IJL A;  4OWX B;  4DNI A;  1C0A A;  2JE6 I;  3CCJ A;  5GRO A;  4YCW A;  1AE2 A;  3FKI H;  3KF8 B;  1SE8 A;  2K52 A;  2OTL A;  4R4C A;  2Y0S G;  4YY3 L;  1PVO A;  1V1Q A;  3KLW A;  1HNX Q;  1A62 A;  1PFS A;  4EQ5 A;  3U58 A;  3RR5 A;  1K3R A;  1VQA A;  2JEB I;  1QVG A;  4POF A;  3A74 A;  4IOC A;  4LNQ A;  1AH9 A;  5J3B A;  2NVQ H;  2UU9 Q;  1KQS A;  1VQC A;  2YYZ A;  1Q86 C;  2IX0 A;  4KHP L;  2A1A A;  1XNQ L;  1VQ9 A;  1CUK A;  4LUZ A;  4BA2 I;  4X66 Q;  1JB7 A;  1JJC B;  4O0A A;  5C4X H;  1WFQ A;  2R7D A;  3CQZ H;  2OWO A;  1LYL A;  4C3I H;  4JI4 Q;  3HOW H;  4B3T Q;  2E2I H;  1E3P A;  4DV2 Q;  1PH9 A;  2K75 A;  1NBW A;  2WB1 E;  4LF6 Q;  3ICE A;  3DM3 A;  5GAD C;  4DPG A;  4A3D H;  4GKK Q;  4GNX A;  3TRZ A;  2NN6 G;  2ASB A;  5LMU L;  1KL9 A;  3BZK A;  3OYY A;  1VQD A;  2UUA Q;  2VNU D;  1X3G A;  5LMN Q;  1KC8 C;  4A93 H;  1LUZ A;  5EAY A;  1QVF A;  4R4T A;  2YTV A;  1VQI A;  3S14 H;  4A3F H;  4TVA B;  4K0K Q;  1N32 Q;  2JA7 H;  1EOV A;  4AQY L;  2UXC Q;  2R93 G;  1J5E L;  2R92 H;  4XIG S;  4MZ9 A;  4DR2 L;  4AYB E;  2R7Z G;  1EYG A;  4A3K H;  4YHH Q;  1IBL Q;  5ELN A;  1JMC A;  4UY8 C;  1IZ6 A;  2H5X A;  4AH6 A;  1WJJ A;  3HOZ H;  1VQJ A;  4JI5 L;  2JK8 A;  1TWF H;  1WI5 A;  2I5M X;  5C44 H;  1N33 L;  5LMN W;  3FKI G;  4A4I A;  1GD7 A;  5M5Y H;  4B3M Q;  1Q8K A;  1B8A A;  4X62 Q;  3L2P A;  3CC4 A;  4BY1 H;  1VQN A;  4IPC A;  1GO3 E;  4LUO A;  3OTO Q;  4B3R L;  5FLM H;  4GOP A;  4OXP A;  1EIF A;  1YNX A;  1KHI A;  1VQB A;  4DV1 L;  2UXD L;  2ZJQ A;  3GTJ H;  2MO0 A;  5IY0 A;  4JI1 L;  3W1G A;  1BBU A;  4DV5 Q;  1XJV A;  3BZC A;  4YWL A;  1MIU A;  3M3Y H;  3HOU H;  5C4X G;  4DR6 Q;  3TQY A;  4JI8 L;  2CWA A;  4DR4 L;  4L5T A;  3CD6 A;  2PMZ E;  2B3G A;  4JBM A;  3S1N H;  1UE7 A;  5M3F G;  1UE1 A;  1W3S A;  2AMC B;  1I94 Q;  2NVX H;  1OTC A;  3OW2 A;  3PUW A;  1YI2 A;  3ERS X;  4A3D G;  1XNR Q;  4R4Q A;  3M7N A;  3M4Q A;  3T1H L;  3CCQ A;  3PV0 A;  4JI6 L;  4IFD I;  1HR0 Q;  3JC6 6;  4JV5 Q;  1TXY A;  1X65 A;  4JI3 L;  4A3G G;  4A93 G;  2JA9 A;  4X64 Q;  1S3O A;  4JOI A;  3S2D H;  3D31 A;  4LFB Q;  4A3F G;  1CKN A;  2ZJP A;  4LF7 Q;  2JA7 G;  4A3L H;  2XGT A;  1TWH H;  3H0G H;  2K4K A;  4EX5 A;  4DR5 Q;  4X66 L;  4QGU A;  2KCT A;  1YVC A;  3SGI A;  4A3K G;  1E22 A;  2Q2I A;  4DR1 L;  3I7F A;  4GS3 A;  1X9N A;  3J7Z C;  1Y1V H;  3KJP A;  4WJ3 M;  1BBW A;  1YJW A;  4B3T L;  2IT1 A;  3KYH C;  3RZD H;  4DAY B;  3AEV A;  3HOZ G;  1HR0 W;  1X54 A;  3RLF A;  5C44 G;  2UUB L;  1ASZ A;  3U4Z A;  3S2H H;  1G51 A;  2Z6K C;  3GTG H;  1PV4 A;  3J80 c;  2K5H A;  1OXS C;  4LF9 L;  4BY1 G;  1AE3 A;  2WAQ E;  4A3M H;  5GAG C;  4L5R C;  3S15 H;  1LTL A;  1N36 L;  4OWT B;  4DR3 L;  3K81 C;  4UP8 A;  5FLM G;  1XMO L;  1SFO H;  4IOA A;  2OCE A;  2EXD A;  4YCU A;  1L0W A;  4DV4 L;  4K0K L;  2VQE Q;  3PO3 H;  4OO1 I;  2L15 A;  1N32 L;  2CCZ A;  2OQK A;  5FJ8 H;  3PIO A;  2QGQ A;  3HKZ G;  1MJC A;  1Y14 B;  3K80 C;  3STB D;  2R7Z H;  2B29 A;  4GLX A;  4TQU S;  2ZJR A;  3I55 A;  3CCU A;  4DUY L;  1IBL L;  3HOU G;  1XPU A;  4DV0 Q;  2F4V Q;  1HNW Q;  5IP7 H;  3KDF A;  3NBH B;  4AIM A;  1HJP A;  3F2C A;  4FDB A;  1C9O A;  1EUJ A;  1EQR A;  1X56 A;  2YV5 A;  4MNO A;  1EIY B;  3PGZ A;  1CKO A;  2LXJ A;  4YCV A;  5JJI A;  1Q46 A;  1UE6 A;  3EN2 A;  1YJN A;  4DV6 Q;  1M90 C;  1TWA H;  5BR8 Q;  2E5L L;  3J81 c;  2HT1 A;  2QEX A;  1VS0 A;  1IBK Q;  4BXX H;  4C3J H;  1A0I A;  2HHH Q;  3GTQ H;  2UXB L;  1I6H H;  5IT9 c;  1TWC H;  3UE1 A;  4LF8 L;  5M5W H;  4A3L G;  3IRB A;  4GKJ Q;  3ZJY C;  4DUZ L;  1YHB A;  3H0G G;  2BA1 A;  3M4O H;  4A3E H;  1YBY A;  2FXQ A;  3TEH B;  3RLN A;  1PH8 A;  1G29 1;  3I4M H;  3F2B A;  1ASY A;  4Y7N H;  2Q2T A;  1VQ6 A;  1Y1V G;  4DR7 L;  5M3F H;  3ER0 A;  1PH1 A;  3G4S A;  1FL0 A;  4NXN L;  2JJQ A;  4LWC A;  2CWP A;  3HOX H;  2VQF Q;  3KDF B;  3RNU A;  4B3S L;  4X65 Q;  4OX9 L;  5FLX c;  1JJG A;  2AWN A;  4JI0 L;  1X3E A;  3HKS A;  1VQK A;  2OQ0 A;  1W2B A;  4A3M G;  4HJ8 A;  5M3M H;  3HOY H;  4JYA Q;  4QQB X;  2F3I A;  4JI7 Q;  1FJG L;  4A3G H;  1X6O A;  3A5U A;  2VS1 A;  5AJ3 Q;  1K9M C;  1PYB A;  1VQL A;  3PO3 G;  4UP7 A;  2EQS A;  3L0O A;  5FJ8 G;  1HH2 P;  4DV3 L;  2K14 A;  1VQ7 A;  2DUD A;  2UUC Q;  1MJE A;  3J80 i;  5IYB H;  1C7Y A;  4UP9 A;  3RZO H;  1YZ6 A;  3KFU A;  4LW1 A;  2MQH A;  4BA1 I;  2ZM6 Q;  4JBK A;  3K7A H;  5IP7 G;  2JA6 G;  2OTJ A;  5JJL A;  1MKH A;  1Q7Y C;  1P8L A;  2JA8 H;  2IHF A;  3PUV A;  4KHZ A;  1GVP A;  4XTC S;  3WWV A;  3T1Y Q;  1N8R C;  1G6P A;  1N34 L;  4LF4 Q;  4ME3 A;  3PUY A;  5C0X G;  1IBM Q;  1HZB A;  3HKZ E;  2MO1 A;  1A8V A;  2I0Q A;  4Y52 H;  4BXX G;  4LF5 Q;  4LFA Q;  3BU2 A;  5IYD H;  2YTY A;  1QUQ B;  5DLQ E;  4DV7 Q;  4HIM A;  1XMQ Q;  3M85 A; 
#chains in the Genus database with same CATH topology
 5CV6 A;  4J1M A;  1HNZ H;  4QUF A;  4Y8V B;  1BGW A;  4MV9 A;  1H9S A;  1OXT A;  2M05 A;  3AQQ A;  4ILW A;  1VQP A;  4ECR A;  2ZDH A;  3C46 A;  2G9H D;  5L1L A;  1SN8 A;  1A2U A;  3H0G B;  2R6F A;  5KG6 A;  1W93 A;  1PFN A;  4PMB A;  1P16 A;  1A3V A;  4YY3 Q;  4ZUI A;  2KQ3 A;  2XCA A;  3CP0 A;  3TME A;  1F2Z A;  1EFW A;  2IY5 B;  5KT7 A;  4IRD A;  4ZOL F;  2KHI A;  4N9P A;  1HNX L;  3LGJ A;  2KCM A;  3HOY G;  3I12 A;  1ZYR C;  4RA8 A;  5JEA G;  3V4S A;  3HB9 A;  1SYF A;  1N48 A;  2F0Q A;  2UU9 L;  1RJP A;  1C3O A;  4QMG A;  2JYO A;  3NSW A;  4NB3 A;  5HGQ A;  1SFO B;  1JJ2 A;  3F1Z A;  2R61 A;  1J8I A;  1AN8 A;  1B50 A;  4IHJ F;  4UCR A;  3PO3 B;  1TS4 A;  2NU9 B;  4ECX A;  1K28 A;  5IYB G;  1GSO A;  4F8M A;  4U7C A;  4DV2 H;  1VF7 A;  4JG2 A;  1UAP A;  3CQZ A;  4FF2 A;  2D9U A;  1ET6 A;  2HGS A;  4IWY A;  4LF6 L;  2E2I A;  1TKW B;  1G91 A;  2OXP A;  1L0Y B;  1D5M C;  2FMM A;  3CXC A;  1EU3 A;  1S5B D;  4UCU A;  1VQO A;  3MEF A;  3D0F A;  5KRU A;  1DON A;  2NVY H;  3H20 A;  1N56 A;  2FPG B;  4IRK A;  4O3O A;  3H6M A;  3VYU A;  3LWE A;  5IYD G;  4TQS A;  4CDD C;  1J5E Q;  3G6V A;  1LO5 D;  4KD3 A;  4QL5 A;  4MA0 A;  3K5M A;  5IGF A;  3NQT A;  3CHB D;  3DEP A;  2ZM6 H;  3OSO A;  5I47 A;  2XN9 C;  3CPF A;  4B9X A;  2KEN A;  5M5W B;  1Y69 U;  5COR A;  2LS0 1;  2JA6 H;  1S0N A;  4JBJ A;  4UPA A;  4AYB G;  4X62 H;  1Q3L A;  3TIG A;  3J80 W;  3EFX D;  3DLL A;  4B3R Q;  5L1I A;  4NPS A;  4LF5 H;  4YR0 A;  1Q1E A;  3SEB A;  5C3E G;  2B63 G;  2VW9 A;  1XMQ H;  2K32 A;  2PO4 A;  1BKB A;  5KFV A;  1EY4 A;  4JI1 Q;  1SNM A;  4O2B F;  3DXJ C;  5JVG 3;  3O13 A;  2JA5 H;  4ECS A;  4IO9 A;  2P0A A;  2A69 C;  4DV5 L;  4JI8 Q;  4C2M H;  4J6H A;  4FBU A;  2QA4 A;  4YJ3 F;  4MTD A;  1BBX C;  1CSP A;  3BG5 A;  4ECY A;  4R9W A;  3K6O A;  1C8C A;  1QNK A;  3A8I E;  3MFY A;  4TKO B;  2N55 A;  2SDF A;  1BUV T;  2BH8 A;  2D0O A;  4EGV A;  1XNR L;  3ETH A;  3CCM A;  4YHH L;  3PF4 A;  1XYI A;  1QUQ A;  4FF4 A;  3K3P A;  4C56 C;  4OON A;  2Q2H A;  4RMF A;  5C5J A;  2F0S A;  1HR0 L;  3ETJ A;  1Z47 A;  5KG5 A;  1EEF D;  4X64 L;  4PDB A;  3GIP A;  1MGS A;  3RV4 A;  1A15 A;  4LF7 L;  1OWT A;  4P71 A;  5KFN A;  2C35 B;  4XQN A;  1JE5 A;  4Q8E A;  1GUS A;  3SR1 A;  3TZD A;  2A19 A;  2GPS A;  3H0G A;  2K04 A;  1WTQ A;  3I4N H;  4IPG A;  1SYD A;  3SXH A;  5LP6 F;  3RV3 A;  4YJ2 F;  3MR3 A;  2UUB Q;  4A3J B;  2DZD A;  5IWA H;  3VA7 A;  1LM0 A;  2PNH A;  4DKA C;  5E3F A;  1VBG A;  2G9D A;  2LSS A;  1ZEQ X;  2NYZ D;  2HDL A;  4PMW A;  2N8N A;  3KUP A;  5C1P A;  4JBW A;  4A3B G;  1V9P A;  3I2Z A;  1BOS A;  4BBS H;  1NMG A;  3KJO A;  1XXG A;  2DIK A;  1TWG B;  1JQY D;  1SFO A;  4QJF A;  3KLR A;  2DJG C;  2VQE L;  2GN5 A;  2WAQ G;  4XYM B;  2HCC A;  2MFI A;  1U5K A;  2EPB A;  1X3F A;  2XTI A;  3TRE A;  2F4V H;  1PH6 A;  1TQO A;  2DJF C;  1LV9 A;  3U9S A;  4ECW A;  1N33 H;  3K7U C;  1Q81 C;  3MXU A;  4DV0 L;  1TWH B;  1QVC A;  4POG A;  4OIK A;  3M4Y A;  4J9N A;  1PZJ D;  5I2Y A;  2ATW A;  2A74 C;  2JN4 A;  5DGB A;  4IRC A;  4FF3 A;  2K5N A;  4MA5 A;  3TP6 A;  1IYJ B;  2XIW A;  2G5D A;  2LXK A;  1Y1W H;  1IBK L;  1CQJ B;  1OXV A;  1YEZ A;  1HZA A;  4FVM A;  1E4E A;  2DPI A;  2V5A A;  4HYK A;  3G6Y A;  1GUG A;  1WTR A;  1CSQ A;  3S15 B;  3EA6 A;  3ERO A;  4HCE A;  4O2D A;  4GKJ H;  4DUZ Q;  1LAC A;  3QO2 A;  4X3K A;  4C3H B;  4FF1 A;  2NU6 B;  3HGB A;  2H4O A;  3MFI A;  3C1E A;  1YIT A;  4FP5 D;  2K1B A;  3MEH A;  3FHW A;  3HOW G;  1K8G A;  1B9N A;  3UI2 A;  2JEJ A;  5KFB A;  4X65 H;  1FYC A;  2BR0 A;  3S1M H;  1K83 H;  5TSS A;  3S17 B;  2Q2U A;  3GTL A;  1Q82 C;  1IL2 A;  1BQQ T;  3QZ7 A;  5DEH A;  2WE6 A;  2WB1 G;  5CV9 A;  3SK4 A;  4LFC L;  5FLX L;  4JYA L;  4IUT A;  4F7X A;  2FMA A;  3CW2 C;  1W96 A;  4HMI A;  4J9S A;  3OWE B;  1JLL B;  5EKK A;  2EYP A;  1HFN A;  5KFL A;  2YU9 H;  4J8Q A;  4MV3 A;  2R7F A;  1S5C D;  2PCF B;  5ELO A;  5KGU A;  4EFB A;  5D14 A;  4DK3 C;  3H15 A;  2HDM A;  1KRS A;  3I73 A;  3N40 P;  4H44 C;  4HIO A;  1VQF A;  2RGV A;  1SE2 A;  5FKA C;  2XIG A;  2PNR C;  2NN6 H;  2RKS A;  5KFO A;  1EY5 A;  4LF4 L;  3HBL A;  1IYU A;  3RB4 A;  2VUM B;  1IBM L;  4IR1 A;  2MPM A;  2R7L A;  4LFA H;  5J39 A;  1ZXT A;  2KEE A;  3MXN B;  2ZTE A;  1L2F A;  2F0T A;  3H3V H;  2E2H B;  3R93 A;  1QZG A;  3M9O B;  4OWW B;  2L0C A;  1RK5 A;  1CQI B;  2B2U C;  2Z9H A;  1D5X C;  3HOY B;  1IOW A;  3K3V A;  2FJ2 A;  4A76 A;  4LAA A;  1F9P A;  4WD3 A;  2AGQ A;  2DNE A;  1BVS A;  2J6T A;  1NCV A;  3K57 A;  3K58 A;  1WOC A;  1EQT A;  2JE6 I;  5IGG A;  5GRO A;  5F9L A;  3FKI H;  1CS0 A;  3BDO A;  3KF8 B;  3MWM A;  1KLG D;  3T16 A;  4KN4 C;  2OTL A;  4YY3 L;  1QOH A;  3WOE A;  2FMC A;  4O4I F;  4ABN A;  5KIX A;  5C3W A;  5KFK A;  3U58 A;  1I7N A;  4J9R A;  3A74 A;  3GV6 A;  1TWG A;  3OSN A;  3GTP A;  2F0P A;  1KQS A;  2HJW A;  4XZ3 B;  2EYJ A;  2ASL A;  4KHP H;  4DAP A;  4QF4 A;  1DOL A;  1W6K A;  4LH6 A;  1QNU A;  1VMP A;  2A1A A;  1XNQ L;  4EVO A;  1CUK A;  1JB7 A;  2RDF A;  1LTA D;  5JPM C;  1WFQ A;  2OWO A;  3WO0 A;  4C3I H;  1I4P A;  2MHV A;  5EZY F;  1NBW A;  1SE4 A;  4MTK A;  3ICE A;  2MGS A;  3V6K A;  1D1K A;  1GHJ A;  2SOB A;  3BZK A;  3OYY A;  1VQD A;  4BY7 B;  4AYB B;  1MD2 D;  2UUA Q;  4HNU A;  1NAP A;  5LMN Q;  4A93 H;  1KJJ A;  5EPL A;  4AQY H;  4O42 A;  4CJ1 B;  1VQI A;  4K0K Q;  3J80 L;  2K33 A;  5EPJ A;  1B33 N;  2JA7 H;  1DZ1 A;  3RAX A;  1J5E L;  4XIG S;  1KJ9 A;  2R3Z A;  1JDB B;  5DG8 A;  2SNS A;  4AYB E;  5E1F A;  2IP4 A;  4XYL B;  1RYS A;  2HQE A;  2H5X A;  5JAV A;  3QJY A;  1BCP C;  4MV6 A;  3QOL A;  3TIN A;  5LMN W;  4B3M Q;  3L2P A;  1VQN A;  1GO3 E;  4BWG B;  1BCP B;  4LUO A;  1I7L A;  1Z7T A;  4B3R L;  4O3N A;  3LP8 A;  4TQR A;  4DV1 H;  4IR9 A;  1SYC A;  4CKC A;  1VQB A;  2Z8L A;  3J7Y W;  3RFC A;  4X3U A;  2MO0 A;  2PMZ B;  4N8F A;  3A8J E;  4JW0 A;  2RSO A;  4JI1 L;  4U6P A;  3W1G A;  1IW7 C;  4I7Z C;  3H09 A;  4JVZ A;  5C4X G;  4DR6 Q;  1O80 A;  4JI8 L;  2ZXO A;  2PMZ E;  4JBM A;  1UE7 A;  5FLX E;  1W3S A;  2SNM A;  1WTH A;  4C1N I;  2EYH A;  1HNX H;  2VUM A;  2OLS A;  1Y8O B;  4R4Q A;  2XRQ D;  4IQZ A;  3M4Q A;  3MXN A;  1IHZ A;  3R2I A;  2UU9 H;  2QDL A;  1PZK D;  3D4D A;  1SJH D;  2E2H A;  3EQL C;  4CHT B;  2XWJ B;  2JA9 A;  3G6J B;  5KYI A;  4H7B A;  2K6A A;  4LFB Q;  1KDC A;  2R8H A;  2CQY A;  4TSS A;  1B6S A;  4X66 H;  3V96 A;  5FO9 B;  2XGT A;  4HMJ A;  1TWH H;  1VDZ A;  4A3B B;  2K4K A;  2FK3 A;  4K5X A;  4ZYS A;  2B2U A;  4G57 A;  2ZJT A;  4GS3 A;  2WAQ B;  1Y1V H;  3I70 A;  3GIQ A;  5BPF A;  4G7H C;  4O3P A;  1YJW A;  4B3T L;  3PMF A;  4IAJ A;  4LF6 H;  3KF8 A;  4DAY B;  4J9Q A;  1X54 A;  2UUB L;  3S2H H;  1ASZ A;  1G51 A;  2Z6K C;  1M0T A;  1KAA A;  1OXS C;  2K5H A;  1AFP A;  4DR3 H;  2WAQ E;  4L5R C;  5GAG C;  1XMO H;  3S15 H;  4DF7 A;  3IL8 A;  2E74 C;  5FO7 B;  5D1P A;  3DWA A;  3L9A X;  4IOA A;  2ZXP A;  2XGQ A;  1JIC A;  1G8Z D;  3GIK A;  4J9L A;  3GID A;  3PW5 A;  5FJ8 H;  4CGY B;  1LTR D;  2R92 A;  1V51 A;  1IBL H;  2R7Z H;  1RHP A;  1EY8 A;  4TQU S;  4KHV A;  4O4H F;  4KJN A;  3PZP A;  1ZET A;  3NBH B;  1HJP A;  4DL5 A;  5E4X A;  3CRK C;  1X56 A;  4QWA A;  2YV5 A;  5DM7 3;  3I91 A;  4I50 F;  3BZD B;  3HOW B;  2LXJ A;  4YCV A;  5JJI A;  3NHH A;  4DV6 Q;  1M90 C;  3FMA A;  5BR8 Q;  2QEX A;  1VS0 A;  3Q2O A;  4C3J H;  1A6X A;  1E2Z A;  1MHW C;  3GTQ H;  2DY7 A;  2LKV A;  3UE1 A;  1PRT F;  2HD3 A;  1XDN A;  4NMZ A;  3E6Z X;  4RGO S;  4QW8 A;  2WIN B;  4DUZ L;  3N42 B;  3H0G G;  3AU7 A;  3M9M B;  3M4O H;  1YBY A;  2FXQ A;  2YZG A;  3MR5 A;  4JV2 A;  1ASY A;  1SYB A;  4NXN H;  4B3S H;  3G4S A;  1FL0 A;  4X3S A;  3J80 E;  4Q8F A;  1ULZ A;  3KDF B;  2F4I A;  3HEJ A;  5FLX c;  3EJI A;  1M0W A;  5D3I B;  1X3E A;  3W3A A;  3HOZ B;  5EDW A;  1TWF B;  4B08 A;  4RGT A;  2Y0S A;  3HOY H;  1FJG H;  2FK2 A;  4RAU C;  5JEA H;  1M8A A;  1WH2 A;  4QQB X;  2F3I A;  4BY1 B;  4JI7 Q;  4A3G H;  2PMZ A;  1NR2 A;  4XT3 B;  5I9O A;  2VS1 A;  1WTV A;  1K9M C;  4A2A A;  4RNN A;  1VQL A;  3I4L A;  3PO3 G;  2VPS A;  2KA7 A;  1VQ7 A;  1XX8 A;  3GTJ B;  2UUC Q;  2I07 B;  1LT4 D;  5IYB H;  4UP9 A;  4MAM A;  4JBK A;  1F9R A;  3K7A H;  4ED2 A;  3S1R B;  3M3Y B;  1Q8I A;  2IHF A;  4KHZ A;  1G6P A;  2CW0 D;  3T1Y Q;  2F0V A;  5K5P A;  2UVV A;  4J9O A;  2DPJ A;  3CRL C;  4MN3 A;  5C0X G;  5ELE A;  2MO1 A;  2I0Q A;  1PYW D;  2NVX B;  4BXX G;  5IYD H;  2F0F A;  2VQE H;  5DLQ E;  2IPK D;  1HXY D;  3A7L A;  3M85 A;  3TS0 A;  4JI2 Q;  3S1Q B;  1KEE A;  1EWH A;  3RMH A;  2AGP A;  3T5J A;  3K5L A;  4DNR B;  4EQN A;  1J6Q A;  5KFC A;  4DV0 H;  1D6E C;  4J0M A;  1D8L A;  1STE A;  4DAY A;  1JWM D;  4GLA C;  1K0R A;  2R6G A;  2C22 A;  1PK8 A;  2KHJ A;  5A35 A;  1Q90 A;  2CVR A;  2EOT A;  1VQM A;  5EJW A;  2RDG A;  5BMV F;  4YR2 A;  3RZD B;  1AUX A;  2VB3 X;  1IBK H;  3K8A A;  1PYS B;  5GQO A;  4YHH Q;  2Z6K A;  5C3E H;  1EQQ A;  2B63 H;  1TWA A;  4Q43 A;  4WFN 3;  3GTG B;  5KFF A;  2X6L A;  4LUV A;  4DL3 A;  1QJO A;  1R9T H;  1GLV A;  3NQI A;  1RDP D;  2ENB A;  2F1M A;  3GV5 B;  5D3D A;  2NVT B;  4KY6 A;  1G6Z A;  2XCL A;  1IKM A;  5KT3 A;  2W9A A;  5D65 A;  1V1O A;  3NBH A;  1ONL A;  4R1J A;  2EY2 A;  3KAL A;  1TY0 A;  3CCS A;  4JV1 A;  5IE8 A;  5HV6 A;  1G2T A;  1WD1 A;  4K6D A;  1FNV A;  2VA2 A;  4JYA H;  2F0G A;  1SCU B;  1NTG A;  3TN2 A;  2UUA L;  2AU0 A;  5LMN L;  1K8O A;  3RGX A;  4BS9 A;  1B7Y B;  4DR2 Q;  4PZ6 A;  4NW2 A;  3NE5 B;  3T4A C;  1S0O A;  2A6H C;  4RNM A;  4MV8 A;  3JAM c;  1TWC B;  3C1F A;  4FNF A;  1Z9F A;  5C4Z A;  4A3J G;  3PR5 B;  4IJH A;  2F0I A;  1LTI D;  1YHA A;  2FLN A;  4IFD J;  2EVB A;  3W2D A;  4Q0F A;  2YYA A;  1PTO F;  2YTX A;  3SE0 A;  2D2C C;  4A3E B;  1SR3 A;  2W8K A;  4LF4 H;  4YWK A;  1IBM H;  4Y7N B;  2AUJ D;  5FPR A;  1TWF A;  2YS6 A;  5CV8 A;  3NGD A;  2F0O A;  4B3M L;  3HOX B;  4A3B H;  1B44 D;  5C4J H;  2UXD Q;  4RKL A;  1E1T A;  1X3P A;  3W5O A;  4H13 C;  2WV6 D;  1STA A;  3NP8 A;  5M3M B;  1EYZ A;  1PMR A;  5C5M A;  1U0L A;  3GTJ A;  1T3N A;  3VPC A;  2CW8 A;  2R7N A;  1Q1B A;  4DR4 Q;  3PO2 G;  4DR6 L;  1RL2 A;  3RIZ A;  3STB C;  1CFM A;  2A5H A;  1TAE A;  3PR4 A;  3A5Z B;  3CCL A;  1KAW A;  2Z0S A;  1SLJ A;  2WDT A;  4I7A A;  3RZO B;  1EWC A;  5JVL A;  3HFZ B;  5EGT A;  3T1H Q;  3MFG A;  3I3C A;  1GGO A;  4JI6 Q;  3VPB A;  2JEG A;  2NVX A;  2IMW P;  2F0L A;  5T1I A;  2B39 A;  1DIK A;  4JI3 Q;  4C3H G;  3ERQ A;  4LFC Q;  5G3L D;  3NEL A;  2WP8 J;  4YQW A;  4LFB L;  5IGD A;  4U67 3;  1II3 A;  2E2J H;  2W6Q A;  3T13 A;  4KV6 A;  3ZYY X;  3BQ0 A;  3H94 A;  3KF6 B;  5KG4 A;  4A2B A;  4DL2 A;  5KFD A;  3HOV B;  3F8N A;  1IXR A;  4JC0 A;  2LY7 A;  4C1N K;  5K36 G;  4QWB A;  1K8M A;  4LF9 Q;  2HUG A;  3AFP A;  4JCV E;  3GIJ A;  3GTG A;  1I4G A;  1STN A;  3FP9 A;  5ELC A;  3JAM i;  4QWD A;  3LML A;  3OHX C;  4DV4 Q;  4KLK A;  4EBC A;  1QE6 A;  3GII A;  3ORR A;  4KI0 A;  2IHE A;  3S1N B;  4LSA A;  4RB1 A;  1MI2 A;  1K8A C;  2D0P A;  1CA5 A;  1JWS D;  4DUY Q;  4MIU A;  4QWC A;  3PW0 A;  2YRX A;  2K5D A;  3BAB A;  1HNW H;  1V1P A;  4GNX C;  2K5V A;  4NXM L;  2JA6 A;  5I9P A;  2VUM G;  1XWE A;  2N49 A;  1JC7 A;  2ZXR A;  1GUO A;  2E5L Q;  2HQL A;  4ALP A;  4GNX B;  1EY9 A;  1GUT A;  2IJ0 A;  4DV6 L;  2V58 A;  5BR8 L;  3OUZ A;  4JI1 H;  3Q1K A;  3DF7 A;  1WSC A;  4LF8 Q;  1VF5 C;  3J7A 5;  3HP3 A;  1U4R A;  5JVH 3;  3WNZ A;  2Q8T A;  1TWC A;  4APM A;  1YHQ A;  2XRS D;  1XNQ Q;  3S1R H;  2FIN B;  2JA5 A;  5M5X B;  1VBH A;  3QR8 A;  2EJG C;  3PCO B;  5C3X A;  5GON F;  1NNX A;  1SYG A;  1B53 A;  3EIV A;  4DR7 Q;  5F2D A;  1DV1 A;  4RUC A;  1E2W A;  4ME5 A;  1S40 A;  3B6Y A;  4JI0 Q;  3RAQ A;  4BBR B;  4UCO A;  2UVU A;  3G48 A;  1HQM C;  3S1Q H;  2F0U A;  1L0X B;  1JB3 A;  3VYT A;  1LTS D;  3E9I A;  1PH3 A;  2ALY B;  5A2Q W;  1UWV A;  3T56 B;  4IUP A;  1JCK B;  2WTF A;  4JI7 L;  2AQ4 A;  3CC2 A;  1K73 C;  2R92 G;  4CBV A;  1E4E B;  5L1J A;  1GM5 A;  3CU7 A;  5KG1 A;  4QY7 A;  1JOR A;  3NK9 A;  2CKZ B;  2FE3 A;  4RWS C;  2PN1 A;  1EIG A;  2W6P A;  2UUC L;  4RAY A;  1UEB A;  1PX2 A;  2OEO A;  4L5Q A;  3MR6 A;  2B8F A;  3TP5 A;  1RTO A;  1I50 B;  3VR6 A;  1N34 Q;  4BY7 G;  4YP3 A;  4B9W A;  2DY8 A;  2F0W A;  4GLV B;  2A6E C;  2BA0 A;  3A54 A;  1U4M A;  3T1Y L;  2FPI B;  4IZ8 A;  2MNA A;  3UQ8 A;  3GDE A;  3E3X A;  3GTL B;  4P72 A;  2L55 A;  1YIJ A;  1K1S A;  1E1O A;  3UDX A;  4F87 A;  3MAQ A;  3GLK A;  2NVT H;  4CKE A;  3GTM B;  4K8I A;  1OO9 B;  5J1Z A;  1BNZ A;  2R84 A;  3KF6 A;  1M1K C;  1HNZ Q;  4JI2 L;  3KLS X;  1SMX A;  3JAM W;  1Y8N B;  4ZKC B;  1O7Z A;  3OIP A;  4DNI A;  3PW7 A;  1SNQ A;  2K52 A;  4RH6 A;  2CH4 W;  4R4C A;  2Y0S G;  1M4V A;  4CDC C;  2V9W A;  1V1Q A;  3KLW A;  1I6U A;  1DXM A;  2OT2 A;  2F0K A;  4EQ5 A;  4CC6 A;  4UCV A;  2JEB I;  4LNQ A;  4OEL B;  5J3B A;  2NVQ H;  2DN8 A;  2Q8R E;  4A3I B;  1WTP A;  1Q86 C;  4DUZ H;  1W6J A;  1E4F T;  2IX3 A;  1VQ9 A;  4BA2 I;  1I3Q B;  5C4X H;  3CQZ H;  4JI4 Q;  2L5T A;  4B3T Q;  2E2I H;  1E3P A;  4DV2 Q;  2B8G A;  1PH9 A;  2KCC A;  1B2T A;  4RU9 A;  1XTC D;  1UEA B;  3DM3 A;  3BG3 A;  1S10 A;  1PFB A;  5LMU H;  4GNX A;  3GTK B;  2ASB A;  1KL9 A;  4WRD A;  4FBT A;  5J22 A;  3QOJ A;  3LX0 A;  1FD7 D;  1F9S A;  1QVF A;  4R4T A;  3V05 A;  2R86 A;  3S14 H;  4RHR A;  3JSL A;  5DQG A;  3N41 B;  3GTP B;  4MZ9 A;  4DR2 L;  5KFE A;  4IUV A;  1WCM A;  4F4Z A;  3QFF A;  1GHK A;  2VB2 X;  4RGN A;  5ELN A;  5KND A;  1JMC A;  3GTO B;  3HG9 A;  4DFA A;  5KT2 A;  1WJJ A;  4RZQ A;  3R23 A;  4JI5 L;  1HCZ A;  3PO2 B;  1O78 A;  4OIJ A;  3MTS A;  1GD7 A;  5M5Y H;  1CZG A;  5IGE A;  1B8A A;  4X62 Q;  4IPC A;  1NR4 A;  4EBD A;  3OTO Q;  2O4X A;  3JRW A;  2X6G A;  3Q8Q B;  1EIF A;  1HUN A;  2UXD L;  3BVG A;  3G8C A;  4F4W A;  2Z4H A;  2F0D A;  4R8I A;  3DWP A;  3BZC A;  1RD9 D;  2H1E A;  4DR4 L;  3T5H A;  1PRT C;  2B3G A;  1I50 A;  2EY1 A;  4QWE A;  5M3F G;  1UE1 A;  2EY5 A;  2C2R A;  1B9M A;  2JEF A;  1I94 Q;  1PRT B;  3ERS X;  1SND A;  3VR4 A;  5KT5 A;  3T1H L;  3CCQ A;  4JI6 L;  2PPB C;  1L2Z A;  4RUA A;  1SMY C;  3GTM A;  2A68 D;  4JV5 Q;  1X65 A;  4JI3 L;  3SI8 A;  3BAA A;  1S3O A;  2ALZ A;  1BXR A;  4JUZ A;  2F0M A;  2ZJP A;  1EZ1 A;  3T5K A;  3PN1 A;  3KHR A;  4DXG A;  2FK1 A;  1JX4 A;  3EVQ A;  3H0G H;  2SCU B;  1F9Q A;  4EX5 A;  4DR5 Q;  4DR1 H;  2R93 B;  3S16 B;  1YVC A;  3SGI A;  2YL2 A;  2Q2I A;  3IFT A;  2V59 A;  1T36 A;  3I7F A;  4RCN A;  1X9N A;  3KJP A;  3KYH C;  1LTT D;  3HOZ G;  4WOR A;  5DLG A;  3U4Z A;  4ZRZ A;  1CA6 A;  2X0S A;  5KFG A;  1JXL A;  4LF9 L;  4BY1 G;  3P1H A;  5AFW A;  5KNC A;  2UUA H;  1LTL A;  2QK4 A;  4OWT B;  4RHS A;  2QEJ C;  1CQV A;  3Q8R B;  4K0K H;  1SFO H;  2OCE A;  1UC8 A;  4RAZ A;  3LWU A;  5LL6 b;  4DV4 L;  2BE5 C;  4V0B A;  1N32 L;  3PO3 H;  3IN5 A;  5EWG A;  3BDC A;  1I3Q A;  4IUN A;  3PIO A;  2CCZ A;  4UHV A;  4K6L A;  1LT5 D;  3OHA A;  3NXW A;  2W9B B;  4GLX A;  4DUY L;  2ZJR A;  3HOU G;  2X69 A;  1I4H A;  2F4V Q;  3GV3 A;  3FMC A;  5KFY A;  3QIA A;  3VYR A;  1RK6 A;  4DLK A;  1EUJ A;  4MNO A;  3GTK A;  3KAK A;  4ED6 A;  4FXK C;  1F2Y A;  5C0X H;  1CKO A;  1UE6 A;  1YNJ C;  3EN2 A;  1YJN A;  1SEB D;  1ET9 A;  2E5L L;  1Z2P X;  2HT1 A;  5KFM A;  4BXX H;  2UXB H;  4A3D B;  2HHH Q;  4ECQ A;  2ASJ A;  1HRJ A;  5DG7 A;  2RDI A;  2I46 A;  1RCV D;  4HAE A;  3BQ1 A;  4LF8 L;  5M5W H;  3TP7 A;  2MUY A;  3IRB A;  4GKJ Q;  1UC9 A;  4DR6 H;  4L1K A;  3GTO A;  4A3F B;  3TEH B;  2RSN A;  2KEC A;  2R92 B;  1VQ6 A;  4DR7 L;  2N88 A;  2J6U A;  4A3K B;  1GSH A;  2CWP A;  5CBA E;  2VQF Q;  5FPO A;  3NUC A;  4X65 Q;  2WKD A;  1JJG A;  4DNT B;  3X3N A;  4JI0 L;  3HKS A;  3J81 W;  2GPW A;  5KFP A;  3MVV A;  5C44 B;  3MFH A;  4DK1 A;  4LFB H;  3MJF A;  4HNV A;  1PYB A;  3RF2 A;  4UP7 A;  3L0O A;  4EGQ A;  1E4G T;  5KT4 A;  2K14 A;  3KBG A;  1BCP D;  4MV1 A;  5C1O A;  1MJE A;  5BN4 A;  1C7Y A;  3RUP A;  1V8Q A;  3KFU A;  2JA6 G;  1SNC A;  2B2W C;  5IP7 G;  1SBB B;  1MKH A;  1Q7Y C;  5KYL A;  2IW3 A;  2C00 A;  1GVP A;  3JAM L;  3DHQ A;  1N34 L;  2O5I C;  3PUY A;  5HUR A;  4DA2 A;  1A8V A;  3TQ1 A;  3GV8 B;  4Y52 H;  2DNC A;  1PTO C;  4PQX A;  4LFA Q;  3BU2 A;  2VUG A;  2YTY A;  1IW7 D;  2Y0S B;  4DV7 Q;  4YAJ B;  1CM9 A;  4YIJ A;  2EYM A;  2JA5 G;  2R93 A;  4EQP A;  1A63 A;  1PTO B;  3KHL A;  1BNC A;  1HNZ L;  1S4Z A;  2Z6B A;  4A3J H;  3S2D B;  2Y0S E;  4A3E G;  5C0X I;  2R7Z A;  3R8B A;  2AGO A;  1S9F A;  4PG3 A;  5JJZ A;  3D3R A;  3HOX G;  3PSI A;  1E0B A;  2WFW A;  1TWG H;  2ID0 A;  1W2B A;  3FPU B;  1LT3 D;  1XPO A;  1H9M A;  4ZKB B;  5M3M G;  1KD1 C;  2DGY A;  1VKZ A;  2EJF C;  3L3O C;  2JEA I;  1QCB D;  5JPN C;  2XVS A;  5COY A;  4HTH A;  5ELF A;  3G7L A;  4A3M B;  3GTQ A;  4KHP Q;  2V4Q A;  1STB A;  3BDL A;  1SJE D;  5HY6 A;  2EYL A;  2JQO A;  4RFB A;  2W9B A;  2WKC A;  3PO2 H;  3UDI A;  1EL0 A;  4RZR A;  3VPD A;  3MXG A;  1XPR A;  1EYC A;  4JI4 L;  4FYD A;  4DV2 L;  4O3Q A;  1TS3 A;  4M1U B;  2R82 A;  2K50 A;  2QIL A;  2FPP B;  3NTK A;  4JI7 H;  4IAL A;  5IOD A;  4C3H H;  3ULP A;  1S5F D;  2B2Y A;  5BN5 A;  2WAC A;  4BBS G;  1SEI A;  3ITP A;  1TWA B;  4AQY Q;  2M2L A;  1O7I A;  1UE5 A;  1JKJ B;  3NWT A;  3HOV G;  5KKN B;  1EOT A;  2UUC H;  4HJA A;  1I6H B;  1VQE A;  2KED A;  3S17 H;  2W7O A;  2ZM6 L;  4EYI B;  1E7Z A;  2ZT9 C;  1AZQ A;  4NXM Q;  4WBN F;  3T1Y H;  5K36 H;  5LXT F;  4X3T A;  2EZV A;  3I4M B;  3R3O A;  3DUZ A;  2IWH A;  2IX1 A;  5M3F B;  4X62 L;  5I4D A;  5A2Q E;  2W6N A;  3D6W A;  3OTO L;  1I5F A;  2V4D A;  4CDF C;  1IOV A;  2RHS B;  1Q12 A;  5CBE E;  4HQ6 A;  4C5B A;  5DLF A;  1S03 G;  4G7O C;  2F0H A;  1A3U A;  3SK5 A;  3S16 H;  3K0Y A;  3SE7 A;  3DMU A;  1RJT A;  2R8J A;  5JEA J;  3GQC A;  4LMY A;  5KFX A;  4DV5 H;  2GVA A;  3CAM A;  1JT8 A;  4KJO A;  3PIP A;  3JZI A;  3GV7 B;  3GIL A;  4NKL A;  3SDZ A;  3OSP A;  1EQV A;  5K2M A;  4K14 A;  4G4K A;  2CQA A;  1AW7 A;  2RQX A;  1XTD A;  5FO8 B;  3UE0 A;  5I6W A;  3K5H A;  2HVR A;  1EY6 A;  2VL6 A;  2L4N A;  2VUM H;  5JOB A;  1RJQ A;  3NEN A;  4K8J A;  1VQ8 A;  1XNR H;  2B2W A;  3Q0A A;  1I94 L;  4YHH H;  2PQA B;  3W1B A;  2CQO A;  2E2H H;  1EYA A;  2FHT A;  2JA8 B;  1HR0 H;  4K2L A;  3T53 B;  4OHJ A;  4X64 H;  1E24 A;  4JV5 L;  1B70 B;  1PDQ A;  4LF7 H;  2E8G A;  4ZUJ A;  3KTM A;  5KFT A;  1LAB A;  1WCM G;  3JAM E;  3WO1 A;  2BDO A;  3HZX A;  3FVQ A;  2JEI A;  3KXY T;  2FFK B;  4DL4 A;  1EWI A;  3ONA B;  2ZTC A;  4DR5 L;  1DOK A;  4GZY C;  1AZP A;  2D62 A;  3U50 C;  4FU0 A;  4BBR G;  2D5D A;  2FB9 A;  3RBD A;  2HIX A;  3S9W A;  1O75 A;  3HOU B;  1FKA H;  4R7R A;  5IWA L;  4NP5 A;  1N36 Q;  4MTN A;  5KFR A;  3BYY B;  2EDG A;  4DR3 Q;  1XMO Q;  5IP9 G;  1KC7 A;  2XWB B;  4KMU C;  5JVD F;  3Q8P B;  1A3T A;  1B3A A;  4I7H A;  4DGZ A;  1TY2 A;  4WJ4 A;  1DGS A;  4DAM A;  1H9J A;  4O3R A;  4EYH B;  1ICW A;  1HZ9 A;  5GAH C;  2PW5 A;  2I80 A;  4ED1 A;  4EBE A;  2AUK A;  3KK7 A;  2F4V L;  2KJX A;  4BY7 H;  2VY3 A;  2AHO B;  3RGZ A;  1PHJ A;  2GA4 B;  2CW0 C;  4YBZ B;  5M9O A;  2R8I A;  3KOJ A;  1WD0 A;  1B1Z A;  4IPD A;  3M4P A;  4MTE A;  1JDE A;  2HHH L;  3AMU A;  2C5C A;  1M7J A;  4HID A;  2HCI A;  3RLO A;  3RD4 A;  1AUV A;  2XC9 A;  3EBE A;  2MJ8 A;  4HN7 A;  2RA4 A;  2R8K A;  4DU9 A;  4DAV A;  4GKJ L;  3G6X A;  1KAB A;  3GO5 A;  2C9O A;  3MWD A;  4A3C G;  4IPH A;  2FJZ A;  4NXN Q;  2RHQ B;  4B3S Q;  1K3B C;  4OX9 Q;  1S0M A;  1V1P B;  3CCV A;  3T1H H;  2VQF L;  4JI6 H;  4GOP C;  4X65 L;  1KTK A;  2JA6 B;  1PLF A;  1T94 A;  4N9T A;  1K1Q A;  4R4O A;  4L63 B;  4JI3 H;  1I4Q A;  4A3I G;  4RG1 A;  1IKL A;  4QIW B;  4ME6 A;  5IOC A;  1JE4 A;  1X55 A;  1FJG Q;  4LFC H;  2YCH A;  3OOC A;  4GOP B;  1PA6 A;  1HHV A;  3QG1 A;  1FGB D;  1IL8 A;  4YWM A;  3C3L A;  4EFE A;  1SRU A;  2O2L D;  4DV3 Q;  5E7N A;  1S5D D;  2RBM A;  1M6V A;  4QIW E;  1SAP A;  3K0X A;  1VQG A;  4OEM B;  5EKI A;  2JA5 B;  3M9B A;  3OWF A;  3V6H A;  3D6C A;  4JI5 Q;  3E0E A;  4C2M B;  4ECU A;  1O7Y A;  2PQA A;  4KKU A;  1DV2 A;  1SNP A;  2I5L X;  2AKW B;  3ULJ A;  3LWB A;  2VQD A;  3I56 A;  1SXT A;  2W6M A;  2QW7 A;  2ZTD A;  5LHY 1;  5DAU A;  1D7Q A;  4DV4 H;  2V1C C;  5KX5 F;  4LFA L;  2E2D C;  3T51 B;  5BN3 A;  4DV7 L;  3SVM A;  1SYE A;  2CH4 A;  2F52 A;  4R8N A;  4IZO A;  2BH2 A;  4Q5V A;  3AFQ A;  5IYC G;  1Y8P B;  4OL7 A;  1ENF A;  2RCN A;  4ECT A;  2NZ1 D;  5H1S E;  5KFQ A;  2NWG A;  1HUM A;  4IJL A;  1C0A A;  3CCJ A;  4HR7 A;  4WJW A;  4YY3 H;  3I4N B;  1SE8 A;  2NTT A;  5KFA A;  4DL7 A;  4HCS A;  1C4Q A;  1A62 A;  3QWN A;  4ZQI A;  2PBZ A;  4BWS C;  4POF A;  4IOC A;  1AH9 A;  3R5F A;  2PZU A;  3F2U A;  3GP7 A;  1XNQ H;  5L9X A;  2QF7 A;  3RUZ A;  4KHP L;  3DWQ A;  4BBS B;  4DR7 H;  4K2K A;  1YNN D;  4TV9 F;  1T5X D;  1LYL A;  2ATL A;  3HOW H;  1CE8 A;  1BDO A;  4TRD A;  2NBF A;  1Z6H A;  5GAD C;  1QIL A;  4IUR A;  3WDN A;  2I8C A;  4GKK Q;  2KSW A;  3PVX A;  1EHI A;  4F88 A;  1ZQ7 A;  3NTI A;  1DCZ A;  2I87 A;  1K0S A;  3K59 A;  1KC8 C;  5CV4 A;  5EAY A;  1J5E H;  1AEX A;  4ZAI A;  5JH7 F;  1S5E D;  1N32 Q;  4TVA B;  4HED A;  2UXC Q;  2R93 G;  5EKL A;  4AQY L;  1EUD B;  2W71 A;  2NVY A;  1Y1W B;  2Z1C A;  1MBY A;  4KTA A;  2R7Z G;  1EYG A;  4TUY F;  5FK9 C;  5EWF A;  4UY8 C;  5LYJ F;  1IZ6 A;  3C2P A;  1HQR D;  4AH6 A;  3HOZ H;  1JWU D;  1N34 H;  1VQJ A;  2JK8 A;  1TWF H;  2I5M X;  4OGQ C;  1BJT A;  4LH7 A;  4EEY A;  4A4I A;  3J81 E;  2VXW A;  2EXZ A;  2VR1 A;  3E0J A;  4GC6 A;  4B3R H;  4BY1 H;  1FNU A;  1ZYR D;  1LT6 D;  1V4Y A;  3BA9 A;  4QIW A;  4GOP A;  4G7Z C;  3S1M B;  1K83 B;  1YNX A;  2YZM A;  2WYO A;  4DV1 L;  2CW7 A;  2J6S A;  2ZJQ A;  3GTJ H;  5IY0 A;  3UFX B;  3HS0 C;  2NU8 B;  5C8Y F;  2Z4I A;  3MC0 B;  4ECZ A;  4YWL A;  1TA8 A;  2XSC A;  4Q0Y A;  4JI8 H;  3EYY A;  3JSN A;  3M3Y H;  3HOU H;  3SHL A;  2HVS A;  2K5W A;  1WCM B;  4L5T A;  2YU9 B;  4C5C A;  3U9T A;  4C2M A;  5E4W C;  5DGA A;  4XDX A;  2AMC B;  2NVX H;  1OTC A;  3M4I A;  1YI2 A;  4A3D G;  3P7J A;  2F0E A;  1G2S A;  4XYQ A;  4IFD I;  5I6Y A;  3TSS A;  4XXE A;  2EYO A;  1U4P A;  3JC6 6;  4A3G G;  3H3V C;  3OUU A;  2J0T D;  3FEW X;  4A3F G;  5I2X A;  4RCO A;  2YS7 A;  5KNB A;  4X66 L;  2LFN A;  2QKI C;  4QGU A;  2FLL A;  2IA6 A;  4A3K G;  4JI4 H;  4B3T H;  2C28 A;  1BBW A;  2UUB H;  2A6E D;  3RZD H;  1MSG A;  3AEV A;  4ED3 A;  5C44 G;  4MV7 A;  2PW7 A;  1PV4 A;  3GTG H;  1X32 A;  1ILP A;  1AE3 A;  2NB0 A;  1N36 L;  3FKI B;  1IYV A;  2J7Z A;  4DR3 L;  1XMO L;  5FLM G;  3TP8 A;  5KG7 A;  4O1N A;  3E5N A;  3NTH A;  4OO1 I;  2A69 D;  2L15 A;  1KLU D;  3N6X A;  2BQR A;  1MJC A;  1Y14 B;  2B2T C;  2L1B A;  3K80 C;  2O03 A;  4XQJ A;  1TS5 A;  3I55 A;  3CCU A;  5LL6 X;  1IBL L;  1HPC A;  1XPU A;  5IYZ F;  1HNW Q;  5IP7 H;  4AIM A;  4PNY A;  5CV7 A;  5DNF A;  1C9O A;  4EQO A;  1EIH A;  2TSS A;  3PGZ A;  5T14 A;  4C3I B;  3OTO H;  1RJR A;  4V19 0;  1GUN A;  2K03 A;  3I8Z A;  4XT1 B;  1Z2O X;  4JK1 C;  3J81 c;  1WR2 A;  3E5S A;  3N43 B;  3D8G A;  4U68 A;  3AB9 A;  1ENC A;  5IT9 c;  1TWC H;  1Y1W A;  1ENA A;  2RDH A;  1EFI D;  1B3Q A;  4A3L G;  1JOQ A;  1I4X A;  4A93 B;  3ZJY C;  1YHB A;  3N44 B;  3RJ0 A;  2BA1 A;  4A3E H;  4DXF A;  2JA7 B;  1PH8 A;  3RLN A;  4I55 F;  1G29 1;  4Q45 A;  1ESR A;  4QUC A;  4Y7N H;  4N8X 1;  2Q2T A;  4QW9 A;  3NBI A;  1PH1 A;  3ER0 A;  2XGP A;  1I94 H;  1LTG D;  4NXN L;  3MR2 A;  1CTM A;  3HOX H;  1D5Z C;  4B3S L;  3RNU A;  4OX9 L;  1CHP D;  2LMC B;  1GJX A;  1QG7 A;  1SYX B;  4O2A F;  2AWN A;  4DK0 A;  1VQK A;  3N8D A;  2RDJ A;  3A55 A;  2OQ0 A;  2BQU A;  1K83 A;  4A3M G;  3RB0 A;  3N52 A;  4XQQ A;  5M3M H;  4JV5 H;  2EY6 A;  3R2T A;  4M9U A;  1T5E A;  4ID6 A;  3VA5 A;  2NUA B;  1FJG L;  4HNT A;  3PW2 A;  5FD6 A;  5AJ3 Q;  4DR5 H;  1WTO A;  2F3V A;  3MXP A;  2EQS A;  2F3W A;  4NDX A;  5C6A A;  4DV3 L;  2DUD A;  2UVR A;  3OPO A;  2YU9 A;  3RZO H;  4LMQ D;  4ED0 A;  3HKZ B;  4LW1 A;  2MQH A;  3TZU A;  2ZM6 Q;  2OTJ A;  2FP4 B;  3TBI B;  3RBE A;  3GIM A;  3VYS A;  3PUV A;  1QB5 D;  4KN7 C;  2BDN A;  4ME3 A;  4ZLT F;  1KDB A;  3K5O A;  3HKZ E;  1BF4 A;  4Z9C B;  4LF5 Q;  2NTS A;  3FDT A;  1WVL A;  2R85 A;  3D4R A;  1XMQ Q;  3K5I A;  4FO2 A;  5LOV F;  3H40 A;  1T9H A;  3HOV H;  1EUC B;  1PRT D;  2AWO A;  2BQ3 A;  2BCO A;  1WTW A;  1EY7 A;  1UUP A;  2KHS A;  4IFD G;  4ULL A;  3I4M G;  1KRT A;  1H9R A;  3J81 i;  1HZC A;  3CC7 A;  4LJZ C;  1FR3 A;  3J81 j;  1D1I A;  4KY5 A;  5ELB A;  2PYK A;  1Y1V B;  2J4X A;  1SMY D;  3FKI A;  5T1G A;  1B4O A;  1E2V A;  3S24 A;  2AQ2 B;  4FS1 A;  3S1N H;  3S2H B;  2HHH H;  1A2T A;  1OXX K;  3A8K E;  1AP0 A;  4QCL A;  1V43 A;  3VDY A;  1PH7 A;  2A8V A;  1CKM A;  2CFM A;  1ZHS A;  4PZ7 A;  3RTX A;  2I5H A;  3UDG A;  1TII D;  4GC7 A;  1D2B A;  4UCS A;  1EYD A;  1HA6 A;  4GN4 B;  3F2D A;  2B2T A;  2VQF H;  4KD4 A;  3PF5 A;  4OO1 G;  2R7Z B;  1H95 A;  3RB3 A;  1STY A;  2ASD A;  2K5Q A;  3FRP B;  2JA8 G;  2AQ1 B;  3I90 A;  5LMU Q;  5IWA Q;  4GKK L;  3G6E A;  5FD5 A;  1NSN S;  4X6A H;  2K01 A;  3E9H A;  5FOB B;  5G3L F;  3K5N A;  2BE5 D;  5C0X J;  3CF5 A;  4RB3 C;  5LMN H;  2W57 A;  3MHB A;  4RB2 C;  2W9C B;  3RN5 A;  3BYT B;  2PI2 E;  4EGJ A;  5M5X H;  1GUW A;  4IWX A;  2QDB A;  1WCM H;  4RKB A;  3Q24 A;  2A68 C;  1EZ6 A;  2WII B;  2UXC L;  1UNS A;  4C3J B;  4HJ7 A;  5CA1 F;  5KG3 A;  3GTQ B;  5L37 A;  3L7Z C;  2NU7 B;  2JA7 A;  4HSP A;  4UAI A;  4YB8 B;  3PIO 3;  4P2C B;  1ESF A;  3BJU A;  5JJK A;  1STG A;  1SNO A;  3M9N B;  4PMC A;  4BBR H;  3H4D A;  5KG0 A;  2W7P A;  1WTX A;  1N33 Q;  1YNJ D;  3M4O B;  4KY7 A;  4B3M H;  3BS1 A;  1JR0 D;  3HRZ C;  4H02 A;  4E4T A;  2ES2 A;  4FM9 A;  3CVZ A;  2B2Y C;  1S68 A;  1L1O C;  1KNE A;  2HIV A;  5IP9 H;  2J9G A;  3KHH A;  4DV7 H;  5BPH A;  3H4B A;  1CI3 M;  1PH5 A;  3NEM A;  1PH4 A;  1EU4 A;  1NMF A;  3QB3 A;  5L1K A;  1L1O B;  1GOZ A;  1FGU A;  3PQI A;  2W8L A;  3BVM A;  4A3G B;  1QZH A;  1I50 H;  1AN7 A;  3HKZ A;  4I65 A;  2NZH A;  3ULL A;  5A2Q L;  4KKS A;  4F4Y A;  3ND8 A;  3CPW A;  1KIX A;  1NY4 A;  4ED8 A;  2GVB A;  3VR2 A;  5DM6 3;  3GTL H;  1R4Q B;  4DN4 M;  3ORQ A;  5LA6 F;  4ZI7 F;  3G71 A;  3K7A B;  4CJ0 B;  1YJ9 A;  3GTM H;  1A9X A;  1NE3 A;  4EEQ A;  1CHQ D;  1VAJ A;  5CC4 A;  5H80 A;  4PV1 C;  1SRO A;  5IT9 W;  3GD7 A;  4RGM A;  3KAJ A;  3J7A K;  2EYF A;  1VQ5 A;  1SSO A;  5DG9 A;  3CCE A;  1VQ4 A;  1GSA A;  3QZ8 A;  1FVI A;  3LNN A;  3CMA A;  3KBX A;  3CME A;  4DR1 Q;  1TWH A;  3R5X A;  4A3C H;  1GXD C;  3F8T A;  4ETS A;  3VR3 A;  4A75 A;  1PH2 A;  4L5S A;  4HJ5 A;  4P73 A;  1Y1V A;  4M7E A;  4ZHQ F;  5ISR A;  1PTO D;  1X3Q A;  3VR5 A;  4GN3 B;  4A3I H;  5KFJ A;  2L9H A;  5CGK A;  4APV A;  2R87 A;  4R4I A;  1I3Q H;  1CZW A;  1TT2 A;  3MA2 B;  5C3E B;  2B63 B;  1RIP A;  1I4R A;  3I4O A;  2N78 A;  5F9N A;  2CZG A;  3PUX A;  4RNO A;  2NZO A;  2PZW A;  1R9T B;  1GYF A;  2NN6 I;  2RCF A;  1CQF A;  4NXM H;  5CB4 F;  3GTK H;  1O7L A;  4HSV A;  4H0L C;  1HNW L;  2K28 A;  2PI2 A;  3CCR A;  3UDF A;  4P74 A;  3IAY A;  3AYH B;  4O3S A;  3H3V I;  2KCN A;  1FNW A;  3TS2 A;  4DV6 H;  5BR8 H;  1WYD A;  2M00 A;  4M8A A;  2W9C A;  4NLG A;  3GTP H;  1S72 A;  2UXB Q;  4HJ9 A;  2XNA C;  3KLS A;  2CHB D;  5CA0 F;  2ZDQ A;  4F50 A;  2QCP X;  2EJM A;  3U9O A;  3GTO H;  2E75 C;  3URY A;  5IYC H;  1JIH A;  2L11 A;  1SDF A;  1MSH A;  2EIF A;  5KEE A;  3I4N G;  2O5J C;  3BVZ A;  1CT1 D;  2XCP A;  3DEO A;  3NPP A;  5C5L A;  2EE1 A;  1DYQ A;  5NUC A;  4R8U B;  5IGB A;  2OH2 A;  3NWS A;  2PVP A;  1N9W A;  3Q22 A;  1TR5 A;  3PUZ A;  2B2V C;  5EWE A;  2RF4 A;  4TV8 F;  1OXU A;  1L1O A;  5HGT A;  1QWY A;  3A0J A;  3H91 A;  5AJ3 L;  4UCT A;  2ICI A;  1PZI D;  5C4J B;  4J15 A;  3RN2 A;  2AQ3 B;  4DK6 C;  2HVQ A;  1KXL A;  3TDQ A;  2R7M A;  1VQH A;  3D4W A;  2KBN A;  4ZK9 B;  2KVM A;  3OMG A;  5CV5 A;  1N36 H;  3R5H A;  2YZN A;  1KDA A;  2JXM B;  1TVX A;  1TU2 B;  1NUC A;  2NUC A;  3CKI B;  2TMP A;  3U4V A;  2F0N A;  4P75 A;  1HTL D;  1C30 A;  3MWY W;  4LK1 C;  4UFZ A;  3ND9 A;  3IG0 A;  4JOI C;  4GN5 A;  1Y1W G;  4DV1 Q;  1NJI C;  4LF5 L;  1J9O A;  1EZ8 A;  2R93 H;  2OF1 A;  4JI2 H;  3FPP A;  1GKH A;  1DOM A;  2KOL A;  1XMQ L;  3JRX A;  2K7V A;  5JQW A;  1CKN B;  2VZA A;  5GAE C;  2M9V A;  4CKB A;  2MP1 A;  4PZ8 A;  1F77 A;  2N3S A;  4C5A A;  1VCI A;  3Q8D A;  3PIP 3;  2E2J B;  4J9M A;  4HIK A;  1ROD A;  4OWX B;  4XX0 B;  3A56 A;  3Q8S B;  4IUU A;  4K5V A;  4YCW A;  1AE2 A;  3SK8 A;  1F2L A;  3A7A B;  3P20 A;  1PVO A;  2XD4 A;  4AYB A;  4IN3 A;  1HNX Q;  3TII A;  1BR9 A;  1PFS A;  3L4J A;  4MHE A;  3RR5 A;  1K3R A;  1VQA A;  1ML0 D;  1QVG A;  1HFG A;  2VPQ A;  2UVW A;  2UU9 Q;  1STH A;  1VQC A;  2YYZ A;  2B63 A;  2SEB D;  2IX0 A;  1LTB D;  5D1O B;  2WB1 B;  1R9T A;  5CAE B;  4LUZ A;  4X66 Q;  1JJC B;  4O0A A;  1B6R A;  2R7D A;  2IBK A;  3RB6 A;  4OX9 H;  5CMD A;  3M7G A;  4L8J A;  2K75 A;  2WB1 E;  4LF6 Q;  4FXD A;  4IUQ A;  5JUM A;  4DPG A;  5IIF A;  4A3D H;  3TRZ A;  1LLR D;  2ICE C;  4HR7 B;  4DL6 A;  2NN6 G;  5LMU L;  1H9K A;  1R4P B;  2VNU D;  4Q44 A;  1X3G A;  3PW4 A;  1LUZ A;  4FS2 A;  4ZQ3 A;  1C48 A;  1ZHQ A;  4KKT A;  3MZ5 A;  2YTV A;  4EG0 A;  4DR2 H;  4A3F H;  4DV3 H;  2RGR A;  1EOV A;  2KUM A;  2R92 H;  4PWQ A;  5D8D A;  3MWE A;  4JPB W;  4KK7 A;  4QB4 A;  4A3K H;  1S97 A;  3T5L A;  1IBL Q;  4J9K A;  4ZCK A;  4JI5 H;  4ECV A;  2PZT A;  1JOK A;  1RTN A;  1WI5 A;  5C44 H;  2A73 B;  1RF2 D;  4ODG A;  3GQB A;  1EEI D;  1RKN A;  3FKI G;  2RVL A;  1N33 L;  4RB0 A;  4R8U A;  1Q8K A;  3CC4 A;  5EOY A;  5KFU A;  4CC5 A;  5FLM H;  2UXD H;  4OXP A;  1KHI A;  1ICF B;  2JP1 A;  2B2V A;  3C0F B;  1BBU A;  3J81 L;  4UDU C;  3OMC A;  4DV5 Q;  1XJV A;  2NVY B;  2QYZ A;  5KG2 A;  2WAQ A;  4YR3 A;  3EPI A;  1MIU A;  4DR4 H;  3TQY A;  3OW7 A;  2CWA A;  5DQI A;  5IT9 L;  3CD6 A;  4C3I G;  3TQT A;  3V6J A;  1DJR D;  1DM0 B;  3N6R A;  4MV4 A;  3OW2 A;  3PUW A;  1UNN C;  1XNR Q;  5KFI A;  3M7N A;  1EY0 A;  3IFD A;  3PV0 A;  3BQ2 A;  5ELD A;  3BJY A;  1HR0 Q;  1PTO H;  4XYO A;  1TXY A;  3X3M A;  4E6I A;  4A93 G;  4X64 Q;  2A6H D;  4JOI A;  3S2D H;  3D31 A;  1Z2N X;  3OHB A;  3KHG A;  1CKN A;  4LF7 Q;  2JA7 G;  4A3L H;  1RYR A;  4JV0 A;  1BO0 A;  2L12 A;  2KCT A;  1H9S B;  1E22 A;  4DR1 L;  1CK1 A;  4WJ3 M;  2VOB A;  3J7Z C;  2IT1 A;  1U9R A;  2W6O A;  4GKK H;  1HR0 W;  3RLF A;  4LF9 H;  3J80 c;  3J7A V;  1KJ8 A;  2YRW A;  4S3S A;  4A3M H;  2W6Z A;  5LL6 S;  3K81 C;  4UP8 A;  1KNA A;  4CJ2 C;  1N32 H;  1HTP A;  3WOF A;  2VA3 A;  4L6T B;  2UXC H;  2EXD A;  4YCU A;  1KJI A;  1L0W A;  4K0K L;  2K05 A;  2VQE Q;  2WB1 A;  5D1O A;  1BCP F;  2C2E A;  2OQK A;  1HA5 A;  1VMC A;  2NVQ B;  2QGQ A;  3HKZ G;  3FDS A;  4DUY H;  2BOS A;  3STB D;  2B29 A;  3Q23 A;  1B04 A;  4ED7 A;  4DV0 Q;  1TS2 A;  2F0J A;  3KDF A;  5EBC A;  3F2C A;  4FDB A;  5C4X B;  1EQR A;  3CQZ B;  1EIY B;  3V2T A;  2W70 A;  1SE3 A;  3P75 A;  2E5L H;  5EBD A;  4YAK B;  2E2I B;  1ILQ A;  1Q46 A;  5KFH A;  1TWA H;  1JOO A;  2ZDG A;  1U4L A;  1IBK Q;  2FKL A;  2E76 C;  4O4L F;  1A0I A;  2DWC A;  3OIQ A;  4LF8 H;  2UXB L;  2PQE A;  1I6H H;  2MCT A;  3VMM A;  5J2T F;  3DM1 A;  4LSX A;  5KFS A;  1KJQ A;  3S14 B;  4IFD H;  3BA8 A;  3I4M H;  2IL8 A;  3F2B A;  5KFW A;  1Y1V G;  5HBR B;  5M3F H;  2R7K A;  1F2M A;  2JJQ A;  4LWC A;  4I4T F;  4JI0 H;  2F03 A;  4G3I A;  1BXT A;  2V4R A;  2DLN A;  5DQH A;  4HJ8 A;  4K5W A;  5IGC A;  5EPK A;  2GLT A;  5M5Y B;  4JYA Q;  3V4Z A;  2C2D A;  1X6O A;  3SK6 A;  4J9P A;  3J7A F;  3A5U A;  1PXU A;  3I72 A;  2JSO A;  2P5Z X;  5KT6 A;  5CR3 A;  5C4H A;  3HXL A;  5CYU A;  4CDE C;  5FJ8 G;  4F4X A;  1HH2 P;  2Q8I B;  3J80 i;  1MZB A;  1ZKO A;  1I6V C;  1YZ6 A;  4BA1 I;  1PFM A;  4OO1 H;  1YNN C;  5EQ0 A;  1KBL A;  5JJL A;  3EPG A;  5FLX W;  1P8L A;  2JA8 H;  4XTC S;  1N8R C;  3WWV A;  4LF4 Q;  5J2U F;  1IBM Q;  2YW2 A;  1HZB A;  5KFZ A;  2FLP A;  2R8G A;  3IKJ A;  5IT9 E;  4C3J G;  1QUQ B;  4FXG C;  1DD2 A;  4HIM A;  3Q6S A;  3L4K A; 
#chains in the Genus database with same CATH homology
 3TS0 A;  4JI2 Q;  1T9H A;  3HOV H;  2JA5 G;  1A63 A;  1OXT A;  2AWO A;  1HNZ L;  3AQQ A;  1J6Q A;  4A3J H;  1VQP A;  4IFD G;  2Y0S E;  1D8L A;  5C0X I;  4A3E G;  3I4M G;  1SN8 A;  1KRT A;  4GLA C;  3J81 i;  1HZC A;  1K0R A;  2R6G A;  3CC7 A;  2KHJ A;  3J81 j;  4PG3 A;  1P16 A;  3HOX G;  3PSI A;  4YY3 Q;  3CP0 A;  1VQM A;  2WFW A;  1EFW A;  2IY5 B;  1TWG H;  2KHI A;  1PYS B;  2ID0 A;  3K8A A;  2Z6K A;  5GQO A;  3LGJ A;  3S24 A;  5C3E H;  1OXX K;  2KCM A;  5M3M G;  1XPO A;  1EQQ A;  2DGY A;  1KD1 C;  4LUV A;  5JEA G;  3HOY G;  2JEA I;  1V43 A;  3VDY A;  1R9T H;  1PH7 A;  2A8V A;  1CKM A;  2CFM A;  2UU9 L;  4KHP Q;  4PZ7 A;  2I5H A;  5HY6 A;  2JQO A;  3UDG A;  5HGQ A;  4NB3 A;  1JJ2 A;  3F1Z A;  3PO2 H;  3UDI A;  5IYB G;  4GN4 B;  3F2D A;  4R1J A;  1XPR A;  4JG2 A;  4OO1 G;  3CCS A;  3PF5 A;  4JI4 L;  1H95 A;  5IE8 A;  4DV2 L;  4LF6 L;  2JA8 G;  2K50 A;  5LMU Q;  5IWA Q;  4GKK L;  3G6E A;  3CXC A;  4X6A H;  3CF5 A;  3E9H A;  5C0X J;  1VQO A;  3MEF A;  3D0F A;  4C3H H;  3ULP A;  1NTG A;  2NVY H;  3RN5 A;  2UUA L;  4BBS G;  2PI2 E;  5IYD G;  5LMN L;  5M5X H;  4AQY Q;  1J5E Q;  1WCM H;  1B7Y B;  1O7I A;  1UE5 A;  4PZ6 A;  4DR2 Q;  2UXC L;  3HOV G;  4QL5 A;  4HJ7 A;  4HJA A;  3L7Z C;  3JAM c;  4A3J G;  1Z9F A;  3CPF A;  1VQE A;  2KEN A;  3BJU A;  4IJH A;  3S17 H;  5JJK A;  1YHA A;  4BBR H;  2ZM6 L;  4IFD J;  2JA6 H;  1E7Z A;  1N33 Q;  4NXM Q;  2YTX A;  2B63 H;  1SR3 A;  4JBJ A;  4UPA A;  4AYB G;  4YWK A;  4H02 A;  2ES2 A;  2IX1 A;  3DLL A;  4B3M L;  4X62 L;  4B3R Q;  4NPS A;  1L1O C;  1Q1E A;  3OTO L;  1I5F A;  2HIV A;  5IP9 H;  4A3B H;  2RHS B;  1Q12 A;  5C3E G;  5C4J H;  2VW9 A;  2B63 G;  1E1T A;  3W5O A;  2UXD Q;  1PH5 A;  3S16 H;  1BKB A;  3NEM A;  1PH4 A;  1NMF A;  4JI1 Q;  5JEA J;  1L1O B;  2JA5 H;  1FGU A;  1U0L A;  2GVA A;  3CAM A;  4IO9 A;  1JT8 A;  3PIP A;  1QZH A;  4DV5 L;  1Q1B A;  1I50 H;  4JI8 Q;  4C2M H;  3PO2 G;  4DR4 Q;  2NZH A;  3ULL A;  2QA4 A;  4DR6 L;  1RL2 A;  3STB C;  1XTD A;  3UE0 A;  3A5Z B;  1CSP A;  3CPW A;  1KAW A;  2VL6 A;  1SLJ A;  1NY4 A;  2Z0S A;  1KIX A;  3CCL A;  2GVB A;  2VUM H;  3NEN A;  3GTL H;  1VQ8 A;  3HFZ B;  1I94 L;  2PQA B;  3W1B A;  3G71 A;  2BH8 A;  3T1H Q;  2D0O A;  1YJ9 A;  2CQO A;  2E2H H;  1NE3 A;  4JI6 Q;  3CCM A;  4YHH L;  1XNR L;  3GTM H;  3PF4 A;  1QUQ A;  4OON A;  2Q2H A;  4RMF A;  4JI3 Q;  1SRO A;  1HR0 L;  3GD7 A;  1Z47 A;  4LFC Q;  1E24 A;  3NEL A;  2WP8 J;  1B70 B;  4JV5 L;  4X64 L;  2E8G A;  4LFB L;  1WCM G;  1VQ5 A;  2E2J H;  4LF7 L;  3CCE A;  4P71 A;  1EWI A;  2C35 B;  1VQ4 A;  1JE5 A;  3KF6 B;  2ZTC A;  1FVI A;  3CMA A;  4DR1 Q;  4DR5 L;  2A19 A;  3CME A;  2D62 A;  3I4N H;  4A3C H;  4IPG A;  3U50 C;  1IXR A;  4BBR G;  3F8T A;  4JC0 A;  4A75 A;  1PH2 A;  2HIX A;  2UUB Q;  4L5S A;  4HJ5 A;  4P73 A;  5K36 G;  1LM0 A;  2PNH A;  4DKA C;  4LF9 Q;  2LSS A;  3AFP A;  5IWA L;  1N36 Q;  4MTN A;  2N8N A;  4JCV E;  4GN3 B;  4PMW A;  4A3I H;  4DR3 Q;  1XMO Q;  3FP9 A;  4JBW A;  5IP9 G;  4APV A;  3JAM i;  4A3B G;  1V9P A;  3I2Z A;  4R4I A;  4DV4 Q;  1NMG A;  1I3Q H;  3KJO A;  4BBS H;  4KLK A;  4KI0 A;  2IHE A;  4QJF A;  4WJ4 A;  2VQE L;  1DGS A;  1RIP A;  2GN5 A;  2WAQ G;  4DAM A;  2MFI A;  2D0P A;  2N78 A;  3I4O A;  1K8A C;  3PUX A;  1U5K A;  2NZO A;  4DUY Q;  1HZ9 A;  2NN6 I;  1X3F A;  5GAH C;  2XTI A;  3TRE A;  1PH6 A;  3K7U C;  1Q81 C;  4POG A;  4DV0 L;  3GTK H;  1QVC A;  4GNX C;  2F4V L;  1HNW L;  2K5V A;  2PI2 A;  3CCR A;  4NXM L;  2ATW A;  3UDF A;  4P74 A;  2VUM G;  2N49 A;  2AHO B;  2VY3 A;  3AYH B;  4BY7 H;  3H3V I;  3TS2 A;  1PHJ A;  2E5L Q;  2HQL A;  2K5N A;  4ALP A;  1WYD A;  1IYJ B;  4GNX B;  1HNX L;  4DV6 L;  3KOJ A;  5BR8 L;  3GTP H;  2LXK A;  1Y1W H;  1IBK L;  1OXV A;  1S72 A;  1YEZ A;  4IPD A;  4HJ9 A;  2UXB Q;  1HZA A;  3M4P A;  2HHH L;  4LF8 Q;  3J7A 5;  1CSQ A;  4HID A;  4O2D A;  3RLO A;  3GTO H;  5IYC H;  4DUZ Q;  3EBE A;  1YHQ A;  1XNQ Q;  3S1R H;  4GKJ L;  3PCO B;  3GO5 A;  1YIT A;  2EIF A;  3EIV A;  4DR7 Q;  3I4N G;  4A3C G;  3FHW A;  4IPH A;  3HOW G;  1K8G A;  4NXN Q;  2RHQ B;  4B3S Q;  4OX9 Q;  3CCV A;  3S1M H;  1K83 H;  3B6Y A;  2VQF L;  1S40 A;  4GOP C;  4JI0 Q;  2Q2U A;  4X65 L;  1Q82 C;  1IL2 A;  3G48 A;  4R4O A;  3S1Q H;  4A3I G;  1N9W A;  4RG1 A;  3PUZ A;  1X55 A;  3E9I A;  1PH3 A;  2ALY B;  1FJG Q;  2RF4 A;  2WB1 G;  1UWV A;  4GOP B;  4LFC L;  4JYA L;  1OXU A;  1L1O A;  1PA6 A;  3CW2 C;  4JI7 L;  3CC2 A;  1K73 C;  3A0J A;  4YWM A;  2R92 G;  5AJ3 L;  1GM5 A;  1SRU A;  4DV3 Q;  4J15 A;  3RN2 A;  4QY7 A;  5E7N A;  4DK6 C;  2YU9 H;  4QIW E;  2CKZ B;  1KXL A;  2R7F A;  3K0X A;  5ELO A;  1VQG A;  1VQH A;  2KBN A;  2UUC L;  3M9B A;  1UEB A;  4DK3 C;  4L5Q A;  3H15 A;  4JI5 Q;  1KRS A;  3E0E A;  4HIO A;  1VQF A;  2PQA A;  1N34 Q;  2I5L X;  4BY7 G;  2AKW B;  2BA0 A;  4GLV B;  3ULJ A;  3U4V A;  3T1Y L;  3I56 A;  4LF4 L;  2ZTD A;  4P75 A;  2MNA A;  1IBM L;  3GDE A;  1D7Q A;  4JOI C;  4P72 A;  1YIJ A;  4GN5 A;  1E1O A;  2V1C C;  3MXN B;  3UDX A;  1Y1W G;  4DV1 Q;  2ZTE A;  1NJI C;  1L2F A;  4LF5 L;  4LFA L;  2NVT H;  2R93 H;  3H3V H;  4DV7 L;  1GKH A;  1QZG A;  1XMQ L;  2F52 A;  4OWW B;  2BH2 A;  3AFQ A;  3KF6 A;  1M1K C;  5IYC G;  1HNZ Q;  1CKN B;  2VZA A;  5GAE C;  1SMX A;  4JI2 L;  4A76 A;  2RCN A;  4PZ8 A;  2N3S A;  1VCI A;  3Q8D A;  1BVS A;  5H1S E;  4HIK A;  1WOC A;  4IJL A;  4OWX B;  4DNI A;  1C0A A;  2JE6 I;  3CCJ A;  5GRO A;  4YCW A;  1AE2 A;  3FKI H;  3KF8 B;  1SE8 A;  2K52 A;  2OTL A;  4R4C A;  2Y0S G;  4YY3 L;  1PVO A;  1V1Q A;  3KLW A;  1HNX Q;  1A62 A;  1PFS A;  4EQ5 A;  3U58 A;  3RR5 A;  1K3R A;  1VQA A;  2JEB I;  1QVG A;  4POF A;  3A74 A;  4IOC A;  4LNQ A;  1AH9 A;  5J3B A;  2NVQ H;  2UU9 Q;  1KQS A;  1VQC A;  2YYZ A;  1Q86 C;  2IX0 A;  4KHP L;  2A1A A;  1XNQ L;  1VQ9 A;  1CUK A;  4LUZ A;  4BA2 I;  4X66 Q;  1JB7 A;  1JJC B;  4O0A A;  5C4X H;  1WFQ A;  2R7D A;  3CQZ H;  2OWO A;  1LYL A;  4C3I H;  4JI4 Q;  3HOW H;  4B3T Q;  2E2I H;  1E3P A;  4DV2 Q;  1PH9 A;  2K75 A;  1NBW A;  2WB1 E;  4LF6 Q;  3ICE A;  3DM3 A;  5GAD C;  4DPG A;  4A3D H;  4GKK Q;  4GNX A;  3TRZ A;  2NN6 G;  2ASB A;  5LMU L;  1KL9 A;  3BZK A;  3OYY A;  1VQD A;  2UUA Q;  2VNU D;  1X3G A;  5LMN Q;  1KC8 C;  4A93 H;  1LUZ A;  5EAY A;  1QVF A;  4R4T A;  2YTV A;  1VQI A;  3S14 H;  4A3F H;  4TVA B;  4K0K Q;  1N32 Q;  2JA7 H;  1EOV A;  4AQY L;  2UXC Q;  2R93 G;  1J5E L;  2R92 H;  4XIG S;  4MZ9 A;  4DR2 L;  4AYB E;  2R7Z G;  1EYG A;  4A3K H;  4YHH Q;  1IBL Q;  5ELN A;  1JMC A;  4UY8 C;  1IZ6 A;  2H5X A;  4AH6 A;  1WJJ A;  3HOZ H;  1VQJ A;  4JI5 L;  2JK8 A;  1TWF H;  1WI5 A;  2I5M X;  5C44 H;  1N33 L;  5LMN W;  3FKI G;  4A4I A;  1GD7 A;  5M5Y H;  4B3M Q;  1Q8K A;  1B8A A;  4X62 Q;  3L2P A;  3CC4 A;  4BY1 H;  1VQN A;  4IPC A;  1GO3 E;  4LUO A;  3OTO Q;  4B3R L;  5FLM H;  4GOP A;  4OXP A;  1EIF A;  1YNX A;  1KHI A;  1VQB A;  4DV1 L;  2UXD L;  2ZJQ A;  3GTJ H;  2MO0 A;  5IY0 A;  4JI1 L;  3W1G A;  1BBU A;  4DV5 Q;  1XJV A;  3BZC A;  4YWL A;  1MIU A;  3M3Y H;  3HOU H;  5C4X G;  4DR6 Q;  3TQY A;  4JI8 L;  2CWA A;  4DR4 L;  4L5T A;  3CD6 A;  2PMZ E;  2B3G A;  4JBM A;  3S1N H;  1UE7 A;  5M3F G;  1UE1 A;  1W3S A;  2AMC B;  1I94 Q;  2NVX H;  1OTC A;  3OW2 A;  3PUW A;  1YI2 A;  3ERS X;  4A3D G;  1XNR Q;  4R4Q A;  3M7N A;  3M4Q A;  3T1H L;  3CCQ A;  3PV0 A;  4JI6 L;  4IFD I;  1HR0 Q;  3JC6 6;  4JV5 Q;  1TXY A;  1X65 A;  4JI3 L;  4A3G G;  4A93 G;  2JA9 A;  4X64 Q;  1S3O A;  4JOI A;  3S2D H;  3D31 A;  4LFB Q;  4A3F G;  1CKN A;  2ZJP A;  4LF7 Q;  2JA7 G;  4A3L H;  2XGT A;  1TWH H;  3H0G H;  2K4K A;  4EX5 A;  4DR5 Q;  4X66 L;  4QGU A;  2KCT A;  1YVC A;  3SGI A;  4A3K G;  1E22 A;  2Q2I A;  4DR1 L;  3I7F A;  4GS3 A;  1X9N A;  3J7Z C;  1Y1V H;  3KJP A;  4WJ3 M;  1BBW A;  1YJW A;  4B3T L;  2IT1 A;  3KYH C;  3RZD H;  4DAY B;  3AEV A;  3HOZ G;  1HR0 W;  1X54 A;  3RLF A;  5C44 G;  2UUB L;  1ASZ A;  3U4Z A;  3S2H H;  1G51 A;  2Z6K C;  3GTG H;  1PV4 A;  3J80 c;  2K5H A;  1OXS C;  4LF9 L;  4BY1 G;  1AE3 A;  2WAQ E;  4A3M H;  5GAG C;  4L5R C;  3S15 H;  1LTL A;  1N36 L;  4OWT B;  4DR3 L;  3K81 C;  4UP8 A;  5FLM G;  1XMO L;  1SFO H;  4IOA A;  2OCE A;  2EXD A;  4YCU A;  1L0W A;  4DV4 L;  4K0K L;  2VQE Q;  3PO3 H;  4OO1 I;  2L15 A;  1N32 L;  2CCZ A;  2OQK A;  5FJ8 H;  3PIO A;  2QGQ A;  3HKZ G;  1MJC A;  1Y14 B;  3K80 C;  3STB D;  2R7Z H;  2B29 A;  4GLX A;  4TQU S;  2ZJR A;  3I55 A;  3CCU A;  4DUY L;  1IBL L;  3HOU G;  1XPU A;  4DV0 Q;  2F4V Q;  1HNW Q;  5IP7 H;  3KDF A;  3NBH B;  4AIM A;  1HJP A;  3F2C A;  4FDB A;  1C9O A;  1EUJ A;  1EQR A;  1X56 A;  2YV5 A;  4MNO A;  1EIY B;  3PGZ A;  1CKO A;  2LXJ A;  4YCV A;  5JJI A;  1Q46 A;  1UE6 A;  3EN2 A;  1YJN A;  4DV6 Q;  1M90 C;  1TWA H;  5BR8 Q;  2E5L L;  3J81 c;  2HT1 A;  2QEX A;  1VS0 A;  1IBK Q;  4BXX H;  4C3J H;  1A0I A;  2HHH Q;  3GTQ H;  2UXB L;  1I6H H;  5IT9 c;  1TWC H;  3UE1 A;  4LF8 L;  5M5W H;  4A3L G;  3IRB A;  4GKJ Q;  3ZJY C;  4DUZ L;  1YHB A;  3H0G G;  2BA1 A;  3M4O H;  4A3E H;  1YBY A;  2FXQ A;  3TEH B;  3RLN A;  1PH8 A;  1G29 1;  3I4M H;  3F2B A;  1ASY A;  4Y7N H;  2Q2T A;  1VQ6 A;  1Y1V G;  4DR7 L;  5M3F H;  3ER0 A;  1PH1 A;  3G4S A;  1FL0 A;  4NXN L;  2JJQ A;  4LWC A;  2CWP A;  3HOX H;  2VQF Q;  3KDF B;  3RNU A;  4B3S L;  4X65 Q;  4OX9 L;  5FLX c;  1JJG A;  2AWN A;  4JI0 L;  1X3E A;  3HKS A;  1VQK A;  2OQ0 A;  1W2B A;  4A3M G;  4HJ8 A;  5M3M H;  3HOY H;  4JYA Q;  4QQB X;  2F3I A;  4JI7 Q;  1FJG L;  4A3G H;  1X6O A;  3A5U A;  2VS1 A;  5AJ3 Q;  1K9M C;  1PYB A;  1VQL A;  3PO3 G;  4UP7 A;  2EQS A;  3L0O A;  5FJ8 G;  1HH2 P;  4DV3 L;  2K14 A;  1VQ7 A;  2DUD A;  2UUC Q;  1MJE A;  3J80 i;  5IYB H;  1C7Y A;  4UP9 A;  3RZO H;  1YZ6 A;  3KFU A;  4LW1 A;  2MQH A;  4BA1 I;  2ZM6 Q;  4JBK A;  3K7A H;  5IP7 G;  2JA6 G;  2OTJ A;  5JJL A;  1MKH A;  1Q7Y C;  1P8L A;  2JA8 H;  2IHF A;  3PUV A;  4KHZ A;  1GVP A;  4XTC S;  3WWV A;  3T1Y Q;  1N8R C;  1G6P A;  1N34 L;  4LF4 Q;  4ME3 A;  3PUY A;  5C0X G;  1IBM Q;  1HZB A;  3HKZ E;  2MO1 A;  1A8V A;  2I0Q A;  4Y52 H;  4BXX G;  4LF5 Q;  4LFA Q;  3BU2 A;  5IYD H;  2YTY A;  1QUQ B;  5DLQ E;  4DV7 Q;  4HIM A;  1XMQ Q;  3M85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...