4A3GG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3gG01
3IRBA 4QL5A 3NEMA 4O0AA 4YWKA 1UEBA 2K5NA 1HZ9A 1E1TA 1OXUA 2ZTEA 1UWVA 1GVPA 4LFCL 5IP9G 5M3MH 4YCWA 5M5XH 5GADC 5FLXc 4TQUS 3G71A 1PH4A 1N34Q 4JV5Q 4QY7A 4DR6Q 2JA7G 4YY3Q 4A3KG 2VW9A 3UDIA 2KCTA 4DV6L 3CC2A 4B3SL 3GTQH 1B7YB 2E5LL 3ERSX 4AYBE 3GTKH 3HKZG 1J5EQ 4LUZA 3U50C 2ATWA 3RNUA 3AFQA 4DKAC 3S1RH 1I94L 4K0KL 1B8AA 1Q1EA 2UXBL 4DAMA 1PFSA 4DK6C 4DR4Q 1OXVA 2UUBL 4JI0Q 3ER0A 1FJGQ 4A3BH 2YYZA 5IP7H 5IYCH 1PVOA 3MEFA 1PH2A 3NBHB 2UXDQ 4JI8Q 4DNIA 2JJQA 2VQEQ 1XTDA 1PH5A 2ZTCA 3S2HH 2XGTA 4PG3A 1K0RA 5C0XJ 4GKJL 1TXYA 4DV7Q 4TVAB 2NZHA 1JJCB 4P71A 4YWMA 1E3PA 4B3ML 3M4OH 4JI1Q 2V1CC 1ASZA 3U58A 4J15A 3U4ZA 2OCEA 1EQRA 3CCLA 1IBML 2ZJQA 2UUCL 4LF6L 1VQBA 5GAGC 4LFCQ 2I5LX 3RZDH 3F2BA 2N78A 4A3EG 3CCUA 2BH8A 3DM3A 4IJLA 2VQFL 2K5HA 3JC66 4NPSA 1L1OB 4X65L 3H15A 2IHEA 4DV6Q 4B3SQ 3G48A 4MTNA 2E5LQ 5GROA 1UE5A 3I55A 1S40A 4LF8L 3RN2A 3HOUH 4IJHA 1WCMH 3ULPA 3M3YH 4APVA 5IP7G 1EOVA 1WI5A 2JA8H 2MQHA 5IYCG 1GD7A 1I94Q 4K0KQ 2UXBQ 4DR1L 3CC4A 3KLWA 5H1SE 2AMCB 4DK3C 2PI2E 4JBJA 1XMQL 3PIPA 1QZGA 4LUVA 1Y1VG 2MFIA 2JE6I 3PCOB 2JA6H 2RF4A 4A93H 2NN6G 2AKWB 1IBKQ 3GTLH 4XIGS 4X6AH 4LF4L 4A3IG 1VQOA 1KC8C 3A74A 1E7ZA 3CMAA 2VL6A 2HIVA 4GKJQ 1HNXL 1N32L 2D62A 5J3BA 4X64L 4DR3L 4A3JH 4B3MQ 1QVFA 1KXLA 4OX9L 5IYDG 1YJWA 1XNQL 1IXRA 1W2BA 1IBMQ 2KBNA 2UUCQ 4LF6Q 4LFAL 2QEXA 4LF5L 1AE3A 2MO0A 1Y1WG 3J80i 1GM5A 2QGQA 1Q8KA 1YBYA 4X65Q 2VQFQ 4BBSH 2ZJRA 2JA8G 1EIYB 3RN5A 3D0FA 1PH1A 4BXXH 2YU9H 4GLVB 1V43A 3ULLA 4LF8Q 3KJPA 3L2PA 1IYJB 3HFZB 4OXPA 4GNXA 3K80C 4A93G 1OTCA 4DR1Q 4O2DA 1OXSC 2DUDA 2Z6KC 1I6HH 2ES2A 2HT1A 2UXCL 3CCEA 3GD7A 1XMQQ 3H3VH 1SLJA 1X65A 2AHOB 3TS2A 5LMNW 1YVCA 5K36G 1RIPA 3S2DH 1VS0A 1S3OA 3GDEA 4R4TA 2JA5H 1H95A 2WAQG 1QZHA 4LF4Q 2R93G 2CWPA 1Z9FA 1JJ2A 1C0AA 5IP9H 4WJ4A 1HH2P 2DGYA 4NB3A 3A5ZB 2LXKA 4YHHL 3CMEA 4DR3Q 5LMUL 4AIMA 1AH9A 3OW2A 4IFDJ 4OX9Q 3M85A 2JA7H 4A3KH 1XNQQ 4HIOA 3U4VA 1G6PA 4R4CA 3I56A 4LFAQ 2NVQH 3SGIA 4LF9L 3K81C 4LF5Q 4DR4L 3AQQA 3ULJA 1VQNA 5GQOA 1K9MC 2ZM6L 4OO1I 1FVIA 1WJJA 1V1QA 1Q12A 2H5XA 3CPWA 3GTMH 3KDFB 1VCIA 3J80c 1P16A 1NE3A 3NENA 4DUYQ 1XMOQ 1G51A 2R92H 4DV0L 1CKOA 1Z47A 2C35B 4DV3L 3HOWG 4JBKA 1QUQB 3CCJA 2E2HH 2JA5G 4OO1G 3PGZA 4P75A 3DLLA 2UXCQ 3PV0A 5DLQE 4XTCS 4IFDI 3CXCA 4IOAA 2ASBA 2I5MX 1CKMA 3CAMA 4P72A 3UDGA 1YJ9A 1GKHA 4A3GG 1JMCA 4A3CG 1E22A 1SMXA 3HOXG 3PUYA 4A3DG 1VQJA 4KHPQ 4IFDG 1L1OA 2GN5A 3F8TA 4A3EH 2HIXA 2YTYA 3W1GA 4KLKA 4YHHQ 5LMUQ 2N8NA 2ALYB 1RL2A 2LXJA 4L5SA 5IE8A 3PSIA 3ICEA 1YNXA 2JEAI 1MKHA 5C4JH 2N49A 2UUAL 4LF9Q 1X3EA 1R9TH 3KYHC 4P74A 3STBD 1VQ8A 1VQKA 4HJ8A 4B3RL 1SROA 2ZM6Q 3K0XA 4HJ5A 1PYSB 2R92G 4R1JA 3CC7A 1UE1A 3FHWA 4QQBX 4IPHA 3UE1A 1IBKL 1X3FA 3CD6A 4KHZA 1X55A 1LUZA 4DPGA 1LTLA 1Y1VH 5C3EH 1D8LA 4RG1A 5M5WH 4DV2Q 3CF5A 4DV0Q 4DV3Q 1XNRL 2EXDA 3E9IA 1OXTA 2WAQE 4A3IH 1Q1BA 1CUKA 4JG2A 2OWOA 1X3GA 2CFMA 3CCRA 1CKNB 1A0IA 2R7DA 1LYLA 3I4OA 3PIOA 1SR3A 1EWIA 5IYDH 3PUVA 4A75A 3T1YL 2N3SA 2K5VA 2JQOA 2Q2IA 4UP9A 3NELA 2Q2TA 4IPGA 1PA6A 1PH7A 3K8AA 2KCMA 5AJ3Q 3AEVA 5JEAG 3KF6B 1Y1WH 4C3HH 3PO2G 1X6OA 1PYBA 1N33L 2BH2A 1VQPA 2B63G 1VQLA 1IZ6A 3RLFA 5M3FG 4DUZL 2R7ZG 1JT8A 2UUAQ 5IWAQ 3G4SA 1G291 1VQFA 2Q2HA 3JAMc 2VNUD 3KF8B 2D0OA 4B3RQ 5C3EG 4DR2L 4LF7L 2OTJA 3CCMA 2E2IH 2NVXH 2D0PA 4GN3B 2IT1A 4L5TA 2OTLA 3J81i 3EIVA 4DV1L 4HIMA 1Q82C 3KOJA 4IO9A 4HJ7A 5JJLA 1SE8A 3PF5A 3A0JA 1X54A 3PUXA 3E0EA 4P73A 1UE7A 1XNRQ 2R93H 1A62A 3AYHB 1HR0L 3TRZA 2L15A 1VQDA 4LW1A 4MNOA 2YV5A 5ELNA 2KENA 5C44G 1N36L 5JJIA 2PQAB 2Y0SE 3S16H 2RCNA 2YTVA 3CP0A 4LFBQ 1QVGA 3K7AH 3T1YQ 4OWTB 1XPOA 3Q8DA 1NMGA 3K7UC 1BVSA 4BA1I 3HOVG 3PO3G 4DUYL 3EN2A 1XMOL 3I4MG 1N33Q 3KDFA 4HIDA 4A3FG 3KFUA 5C4XG 1VQHA 5IYBH 1M1KC 4UP7A 5FLMG 4DUZQ 4GKKL 2BA1A 2K14A 4DR7L 1YZ6A 4B3TL 3F2DA 1FL0A 1QUQA 4DR2Q 3T1HL 3HOWH 4LF7Q 1EIFA 5IT9c 3F2CA 4IPDA 2LSSA 3BJUA 3M9BA 1K8GA 3I2ZA 3A5UA 1EUJA 4DV1Q 2K52A 1VQIA 3UE0A 4A3GH 1UE6A 2WFWA 1C7YA 3J81c 1HR0Q 2CCZA 4A3CH 2EQSA 3HOXH 3L0OA 4A3DH 4JOIC 4GN4B 2VS1A 1N36Q 1IBLQ 4IOCA 4ALPA 2JA9A 3E9HA 3STBC 3S14H 4LWCA 1PH6A 2K75A 3S1QH 4A3MG 2MNAA 5E7NA 5IYBG 3PUWA 4OONA 1BKBA 3RLNA 4PZ6A 1PH8A 2F52A 1JB7A 1OXXK 4EX5A 5C0XI 2A8VA 3ZJYC 4DV2L 4HJAA 2HHHQ 3S17H 1XJVA 2K4KA 4GKKQ 2YTXA 2Q2UA 4A3LH 4X66L 1NJIC 4BY1G 4B3TQ 4DR7Q 2JEBI 4BBRG 2F3IA 4H02A 1U5KA 3T1HQ 1Q46A 1KQSA 3UDXA 2F4VL 2PMZE 3H0GH 3CCVA 5C0XG 1E1OA 1HZCA 1KHIA 3HOZH 1AE2A 3M4QA 1CKNA 2WB1G 1YEZA 4AQYL 4OWXB 2I0QA 3RR5A 2PNHA 4JI5L 3B6YA 1A8VA 5AJ3L 2Y0SG 4YCVA 4JI6Q 1VQCA 4JC0A 3JAMi 4PMWA 1EYGA 2GVAA 3KF6A 1D7QA 4Y7NH 2E2JH 1CSPA 2GVBA 5IWAL 3TQYA 2VUMH 3PO2H 2Z6KA 4LNQA 1HZBA 1L2FA 3M7NA 3GTGH 4KHPL 3KJOA 2B63H 2E8GA 1VQEA 3OTOL 5M3FH 4DV4L 2R7ZH 3GTPH 3F1ZA 4JI7L 4GS3A 1VQ9A 4A3LG 1GO3E 3TREA 1WOCA 1JE5A 3J81j 1K73C 1N8RC 1KRSA 3M4PA 3FKIG 3H0GG 1CSQA 3LGJA 4GOPB 1IL2A 1JJGA 1KRTA 3UDFA 1YHBA 4X66Q 3HOZG 2NVTH 3I4NG 2XTIA 3EBEA 4DR5L 2F4VQ 2B3GA 4L5RC 4JOIA 1PH9A 1MJCA 4BA2I 1HNZQ 4LFBL 1LM0A 3L7ZC 3BZCA 1HNWL 1Q7YC 3OYYA 4AQYQ 2PQAA 1M90C 1KIXA 1EFWA 3S1MH 2K50A 4JI5Q 4UY8C 1TWGH 3S15H 4IPCA 5C44H 3S1NH 1VQAA 2VUMG 1QVCA 4GNXC 4C3IH 1TWAH 5EAYA 3HOYH 3GO5A 4NXML 1K8AC 4Y52H 2VZAA 1Y14B 5M3MG 3S24A 3HOVH 1U0LA 3CCQA 1HZAA 4YCUA 2R6GA 3PO3H 3PF4A 3CQZH 3BU2A 3I4MH 1FGUA 4NXNL 3MXNB 4QJFA 1VQGA 4C3JH 5C4XH 3TEHB 4A76A 4A3FH 1VQ4A 1EQQA 2IX0A 1NTGA 3BZKA 3OTOQ 3J7ZC 1NMFA 4DV4Q 5FLMH 1S72A 1XPUA 4JI7Q 4EQ5A 2OQ0A 4QGUA 1YHQA 1TWCH 5BR8L 4JBWA 3W1BA 1YJNA 1MJEA 2IY5B 1NY4A 2NZOA 4GOPC 5JJKA 4A3BG 2HQLA 2NN6I 5FJ8H 4UPAA 2WB1E 4JBMA 1X9NA 3W5OA 4DR5Q 2EIFA 1IBLL 2OQKA 4HIKA 4JI2L 4X62L 2UUBQ 3PUZA 4GLXA 4ME3A 1A63A 3HOYG 1HNWQ 1PV4A 4JI3L 4DAYB 4KI0A 1NBWA 1V9PA 4R4QA 4LUOA 5M5YH 2RHQB 2ZJPA 2AWOA 1DGSA 3FP9A 1N9WA 5GAEC 4NXMQ 1I3QH 2QA4A 2FXQA 4A3MH 1Q86C 4WJ3M 4PZ8A 2VY3A 2I5HA 1HR0W 2HHHL 4YWLA 4L5QA 4JCVE 1XPRA 5HY6A 4QIWE 1VQ6A 1W3SA 2B29A 4AH6A 1P8LA 3AFPA 1WYDA 1BBWA 2R7FA 2KHJA 2PI2A 1VQ7A 4NXNQ 3CW2C 1BBUA 4RMFA 4AYBG 2UU9L 5JEAJ 3HKZE 1E24A 4R4OA 4PZ7A 5LMNL 4POGA 3HOUG 1YHAA 1C9OA 1WCMG 4A4IA 1WFQA 4BBRH 5FJ8G 1VQMA 1VQ5A 4BY1H 3J7A5 1SFOH 4JYAL 1YI2A 1L1OC 5BR8Q 1L0WA 2BA0A 5GAHC 2ZTDA 1YITA 4JI6L 4BY7H 2CQOA 2CKZB 3HKSA 2JA6G 4FDBA 4DV5L 3GTJH 4JI4L 2JK8A 2ID0A 4JI2Q 4X62Q 2KHIA 4MZ9A 1I50H 3RLOA 1KAWA 1TWHH 4HJ9A 1KL9A 2RHSB 4POFA 4JI3Q 2MO1A 2A1AA 1K3RA 3CPFA 2A19A 4JV5L 1N34L 1HJPA 1O7IA 4A3JG 2IX1A 2Z0SA 5HGQA 4DR6L 2IHFA 4YY3L 1ASYA 4OWWB 3WWVA 1SRUA 1Q81C 4GN5A 1HNXQ 1N32Q 1J5EL 2CWAA 1PHJA 4X64Q 2WP8J 3GTOH 5ELOA 1J6QA 4R4IA 3TS0A 4BBSG 4GOPA 3D31A 5IY0A 1I5FA 3FKIH 4BXXG 2UU9Q 3H3VI 4JI0L 3CCSA 5LMNQ 1FJGL 1PH3A 1HNZL 1K83H 4BY7G 2AWNA 3I4NH 1B70B 4JYAQ 3I7FA 2UXDL 1YIJA 4JI8L 1MIUA 4C2MH 4GNXB 2VQEL 2NVYH 1X56A 1T9HA 1SN8A 3VDYA 1KD1C 4DV7L 4DV5Q 1TWFH 4GLAC 3G6EA 4JI4Q 3RZOH 4UP8A 4JI1L
chains in the Genus database with same CATH superfamily
3S1QB 4O0AA 4YWKA 1HZ9A 5M3MH 4DR1H 3G71A 3NSWA 4YCWA 1WTRA 4DR6Q 4IRKA 5ELFA 2WIIB 1MSHA 3GTQH 2FKLA 1B7YB 3S17B 3ERSX 3PIO3 1Y1VA 3GTKH 2I87A 4OIJA 2R7LA 1CTMA 4FF3A 4LF4H 4ZYSA 2ATWA 4WFN3 1I7NA 1Q1EA 1STEA 1CI3M 4DAMA 3MVVA 4EG0A 4M8AA 1JDEA 2H4OA 1N32H 4JI0Q 5BN4A 4QW8A 1TIID 2YYZA 3V05A 1RJRA 1PVOA 1LTSD 1PH2A 3K58A 1E4EB 1TY0A 4JI8Q 4LFAH 3H6MA 2ICIA 3DMUA 4HTHA 4V190 3G8CA 3OSNA 2VQEQ 5LMNH 4MV1A 4DAYA 3MXPA 2GLTA 5KT4A 4RNNA 1EEID 1Y1WA 3I91A 1QJOA 2VB2X 4UCRA 2PZTA 1O7YA 1PTOH 3FVQA 3IFTA 2V1CC 4ZUIA 1WR2A 3U4ZA 2B63B 1IBML 2ZJQA 4LF6L 3R5FA 3GTPB 2R7ZB 2I5LX 4KKSA 3N6RA 2UXCH 4J0MA 3DM3A 1KNAA 2AUJD 3HB9A 3U9SA 1F2YA 2B2UA 1STNA 1PRTD 2OH2A 1S40A 3RN2A 2J6SA 1WCMH 4ED3A 1EFID 4FVMA 1I94Q 1F2ZA 2KQ3A 1ZQ7A 2YRXA 3CC4A 3KLWA 2AMCB 2PI2E 5KFHA 1H9SB 1Y1VG 3PCOB 2JE6I 4IUTA 1LV9A 2DLNA 2EPBA 5C44B 3A8KE 1WTPA 2M05A 3QIAA 1TA8A 3SXHA 1FYCA 4DAVA 4A3IG 4M9UA 4XDXA 1KC8C 4RH6A 4R8UA 4DA2A 1STBA 3EVQA 2D62A 2K03A 4X64L 4B3MQ 3I70A 4FXDA 5C4XB 4C3JB 3SEBA 3RFCA 2KBNA 2UUCQ 4ZK9B 2QEXA 1JORA 1Y1WG 1TY2A 2VQFQ 1EIYB 3RN5A 4UCSA 1CA5A 3OIPA 3DXJC 3NXWA 4GNXA 5KT7A 4DV6H 2B2YC 2F0QA 2KVMA 4X3SA 1DJRD 5ELDA 3WDNA 4DR1Q 1OXSC 4EVOA 3S16B 1LT6D 1I6HH 1SYXB 3I73A 3CCEA 3GD7A 1EEFD 5D1PA 1MI2A 5LMNW 3A56A 1SYBA 3D4DA 4MTKA 4NDXA 5EPLA 4CDCC 3SVMA 1S3OA 4R4TA 4H13C 5K2MA 3PVXA 1TS3A 4LF4Q 1GJXA 1O7ZA 4APMA 1C0AA 5IP9H 1EUDB 2SNMA 5DAUA 2GPWA 4C56C 2LXKA 3CMEA 1PYWD 5LMUL 2AU0A 1TU2B 3I8ZA 4HIOA 3U4VA 1G6PA 3FRPB 4LFAQ 3GV3A 1IKMA 3OMGA 4DR4L 1UUPA 2PZUA 5KX5F 2R6FA 3AQQA 4N8FA 3RB3A 4J9NA 4ILWA 5GQOA 5C6AA 1K9MC 2WKCA 4OO1I 1FVIA 3DWPA 5COYA 4O2BF 1PRTF 1I6UA 3KDFB 1P16A 2A73B 4KJOA 2K28A 4RNOA 1SYDA 1G51A 2SOBA 4J9SA 5KFYA 5KFMA 4IN3A 4DV0L 1CKOA 2C35B 5FO9B 2QDBA 4JBKA 4UCVA 2R85A 4P75A 3T51B 2UXCQ 4XTCS 1A3VA 2IA6A 3CXCA 1BCPB 4RHRA 5EZYF 1S5FD 4JVZA 4ZCKA 1YJ9A 3C46A 2E2DC 4TSSA 1XMQH 1HFNA 5C4ZA 3JSNA 3N43B 2UVRA 3HOXG 4A3DG 2R7MA 1PRTC 2Q8IB 2YZGA 4IFDG 3I72A 3W1GA 4KLKA 2LXJA 5E4XA 4EQNA 1PZJD 4FF4A 4HCEA 3FKIB 1YNXA 1MKHA 4TUYF 1GLVA 1DOMA 2PMZA 4P74A 3EPGA 2L11A 1XNQH 1VKZA 1Z2PX 1UE1A 5T14A 1K1SA 1ZKOA 2Z6BA 4ZOLF 3RAQA 4KHZA 1X55A 5M5WH 4Y7NB 4ETSA 4DF7A 1RCVD 1D5XC 4RUCA 1STAA 1C30A 1XMOH 2JEGA 1OXTA 2WAQE 1QWYA 4EFEA 1Q1BA 1GUWA 1X3GA 2F4IA 1CKNB 1I4PA 4FF2A 4DR7H 2HDMA 5KT6A 2F0LA 5IYDH 1G91A 2Q2IA 2JQOA 5D1OB 3N52A 1JC7A 1TWCA 1FNVA 2KCMA 3PO2G 3PR4A 4C3HH 1JE4A 4HNTA 2AUKA 4HMIA 4ECYA 3LNNA 1IZ6A 2OT2A 3RLFA 4DUZL 2W6MA 4HNVA 5KFEA 4YHHH 2E74C 1G291 2K6AA 2BQRA 3KF8B 1EOTA 3RIZA 2D0OA 3H4BA 2LKVA 4DNTB 3V96A 3UQ8A 4QUFA 4I65A 2ZXRA 2CW7A 3CCMA 3WO0A 2W6OA 2B2VC 2VA2A 3HEJA 3EYYA 2O2LD 3J81i 5KFWA 1DYQA 4HJ7A 1Q8IA 4O3OA 1SE8A 3NK9A 3TMEA 1I3QA 3GV8B 1N48A 4P73A 1UE7A 3TP8A 3GQCA 1VQDA 4DL2A 4KY5A 1VF5C 2VPSA 3A8IE 1QILA 4Q45A 2PQAB 4UCUA 4DL5A 5ELEA 2UVWA 1F9PA 3V6HA 1GYFA 2DPJA 3HBLA 1T3NA 4OWTB 3J80E 3HOVG 5F2DA 2E75C 4DUYL 3H09A 1Y8OB 1EWCA 2PW7A 3M3YB 4YB8B 5C1OA 1EIGA 3KFUA 3H40A 1VQHA 5D3DA 5IYBH 2KJXA 4EYHB 3K6OA 1M0WA 3GTJA 1FL0A 1QUQA 5FO7B 5M5YB 5IGCA 5IT9c 5DGAA 5C3XA 3MR5A 3A5UA 1EUJA 4J1MA 1I3QB 5KNCA 1VF7A 3OTOH 2CW0D 4EBCA 3O13A 2K52A 1VQIA 3UE0A 4A3GH 3T5HA 2WFWA 3VMMA 4YBZB 1VMPA 3WOEA 2EQSA 1EWHA 4CDFC 4IOCA 4ALPA 2JA9A 3S14H 5I2XA 4KMUC 4CC6A 2MNAA 5IYBG 5FKAC 2F52A 1AEXA 3M7GA 2XWBB 4EX5A 5C0XI 3TQTA 2A8VA 4DV2L 4JV0A 2B2WC 3MWDA 2QYZA 1XJVA 3N41B 5KG3A 2K4KA 5JPMC 2Q2UA 1NJIC 4BY1G 4B3TQ 4DR7Q 1VMCA 4EEYA 2IL8A 3IN5A 2QK4A 1U5KA 4JW0A 1CQJB 4KJNA 1BQQT 2EJMA 2JXMB 1AE2A 4B9XA 4LSAA 4RHSA 2I0QA 3KBXA 2K01A 3VR5A 1A8VA 4LMQD 2V4RA 1BOSA 1I4QA 4A3KB 3JAMi 1H9KA 2XIWA 5BR8H 1GHKA 4YP3A 2GVAA 2FP4B 3Q22A 3HKZB 2B2YA 4DLKA 2GVBA 1HCZA 3TQYA 2D5DA 5JEAH 2FB9A 1L2FA 3M7NA 3GTGH 2F03A 4KHPL 5LYJF 3ORQA 4ECVA 5DM73 1N56A 1VQ9A 2R84A 4MIUA 2NU7B 1WOCA 1JE5A 5T1IA 1TWFB 4XQQA 3LGJA 3SE7A 1JJGA 1KJJA 4KKUA 4ID6A 1JCKB 2RDIA 4KHVA 4DR5L 3J80L 2YYAA 2XWJB 2EY5A 2XRSD 5CR3A 4L5RC 3DEPA 1KEEA 2XCAA 1C8CA 1CA6A 3L7ZC 1ESRA 3RMHA 2K50A 1TWGH 1L0YB 1LT3D 4IPCA 4A3EB 3S15H 4C3IH 5ISRA 4JYAH 5CV5A 5D65A 5C4JB 3CCQA 1HZAA 1E2ZA 1R9TB 1CZGA 4EBEA 3CQZH 3BU2A 4MV9A 4YQWA 2W9BB 4A3FH 1VQGA 1VQ4A 3TEHB 3Q24A 1EQQA 1S5CD 5CV7A 3OTOQ 1F9RA 3J7ZC 4CKEA 3J7YW 5C1PA 3N40P 3S2HB 3H4DA 4QGUA 1YHQA 3MR3A 4L63B 3FMAA 4QWDA 3R2TA 3H20A 2CW0C 3M9MB 3A54A 2NZOA 4M7EA 4XYLB 5JJKA 5FLXW 4UPAA 4JBMA 1X9NA 5LL6b 2O03A 1J5EH 3BA9A 1ILQA 4X62L 1YNND 3SK5A 1A63A 2FFKB 1KABA 4JI3L 1I4GA 1C3OA 1NBWA 4XYMB 2RHQB 1PMRA 3MA2B 1SYGA 2AWOA 1HNZH 2GPSA 2JA8B 2SNSA 4KN4C 2QA4A 1JOKA 4JI5H 4J9RA 2I5HA 4FYDA 2A69D 2LFNA 1RHPA 2EJGC 4KK7A 4MV8A 4A2BA 2XGPA 4ED8A 1VQ6A 2B29A 5HURA 1WSCA 2L12A 2PI2A 3TP5A 1B33N 3CW2C 4R8NA 1CHPD 2UU9L 4IZOA 1BCPD 1O7LA 1E24A 2R8HA 5LMNL 3NUCA 3HOUG 4A4IA 3R2IA 2V58A 5BR8Q 4LFCH 2BA0A 1SNMA 5GAHC 3IAYA 3OHBA 1EYZA 4JI6L 2FLLA 4RGOS 2ZXPA 4BY7H 2CQOA 4B3SH 3HKSA 2K32A 2BCOA 4FDBA 5CV8A 4DV5L 2JA7A 3ITPA 3GIDA 3BQ0A 2VUGA 1I50H 3RLOA 3CPFA 4JV5L 1N34L 3GTMA 4A3JG 4ECTA 1HNWH 2AGPA 2B2VA 4GN5A 5CAEB 1UNNC 1STGA 2NUCA 4X64Q 3GTOH 1J6QA 4BBSG 4GOPA 3D31A 2ZT9C 1B3AA 3OW7A 2ZDHA 3M4IA 4BY7G 4JYAQ 1MZBA 1NR4A 3I7FA 2UXDL 1WTWA 2J7ZA 1KNEA 5EBDA 5EKKA 1JDBB 3TDQA 2QEJC 1EQTA 3DWAA 4YIJA 3ETHA 3T5KA 4DV7L 3I90A 3E3XA 4GLAC 4JI4Q 4FNFA 3RZOH 4UP8A 2DJFC 4FS2A 2PYKA 3NEMA 1BGWA 2K5NA 1FNWA 3NWSA 4NKLA 5IOCA 1UWVA 5GADC 2YRWA 2C5CA 5M5XH 3Q8SB 1RDPD 4LJZC 1LTTD 1R4QB 2JA7G 4YY3Q 2R92B 2VW9A 4DV6L 1TS5A 4Q8EA 2W6NA 1J5EQ 2MPMA 4LUZA 1WTVA 3U50C 1EHIA 1B8AA 3NWTA 2UXBL 1KDBA 1HNXH 1BCPF 1PFSA 3BVMA 4DK6C 4DR4Q 1TAEA 2UUBL 4IRDA 2QKIC 1YNNC 4A3BH 2ZJTA 4OX9H 1UEAB 4HR7A 5IYCH 1ILPA 3J81W 3NBHB 2EXZA 1I6VC 4LF5H 1ONLA 3P75A 1E4FT 1K1QA 1KJQA 4ECUA 4RU9A 2E2JB 4ECXA 5IGFA 2NN6H 3ETJA 2A69C 2N88A 3RAXA 2B2WA 4P71A 4YWMA 3M4OH 1ASZA 4C5AA 3QJYA 3CCLA 2GA4B 4PQXA 5M3FB 2JEFA 1VQBA 3LWUA 5IT9E 5GAGC 3MEHA 5DM63 4LFCQ 4EFBA 4ZKCB 5I9PA 2BH8A 4GC6A 2FJZA 3JC66 4NPSA 4X65L 1L1OB 2E2IA 2NVXA 5DLGA 4ZRZA 1LTAD 4B3SQ 5KFQA 5DLFA 4MTNA 1Y69U 2E5LQ 1UE5A 3I55A 3T53B 3OWFA 4ED1A 4LF8L 1O75A 2V4DA 1BNCA 4DR6H 1WI5A 4DFAA 3RD4A 5IYCG 1GD7A 4K0KQ 2WAQA 2R93A 3K59A 4DL6A 3MFHA 2F0KA 3M4YA 4DK3C 2DY7A 3M9NB 1XMQL 1QZGA 4LUVA 3S1MB 2JA6H 2NN6G 3FPUB 2M9VA 3R93A 3GTLH 3NTKA 3CHBD 4B08A 4EGJA 1RD9D 1TQOA 5KG0A 2G9DA 4GKJQ 1KBLA 5K36H 3PO3B 2YZMA 2VQEH 2L4NA 3C1EA 3I4MB 4K8JA 3RB6A 3TQ1A 1YJWA 1XNQL 1W2BA 4QCLA 4DV3H 3FDTA 4RGNA 3AU7A 1B04A 2MO0A 4IQZA 4CJ0B 1YBYA 1WTXA 2JEJA 1QCBD 2ZJRA 1PH1A 3D0FA 4ABNA 2YU9H 4GLVB 4OIKA 1DV2A 1V43A 2HCCA 3KJPA 2RDJA 2CH4A 3HFZB 1SJHD 4FM9A 4YAJB 4O2DA 1S03G 2DUDA 1EU3A 2ES2A 1EUCB 5TSSA 1PDQA 3NTIA 4CDDC 2AHOB 4MN3A 1JQYD 4RCOA 2FE3A 3TSSA 2I80A 5K36G 3S2DH 2L55A 2JA5H 2UUAH 2W9AA 2WAQG 2R93G 4QWCA 4BWSC 4A3MB 1PFMA 2CZGA 3JAMW 4ED2A 2X69A 2PBZA 2YS6A 4WJ4A 4NB3A 4YHHL 4DR3Q 1NUCA 5JVLA 2PO4A 3OW2A 1SNQA 4OX9Q 4IZ8A 4MHEA 3M85A 5E4WC 1I4HA 4H7BA 3SGIA 4LF9L 1JOOA 4LF5Q 4RZRA 1SBBB 4BBRB 1SEBD 1VQNA 1KC7A 1SFOB 2ZM6L 2UUCH 1WJJA 4HAEA 5EBCA 1V1QA 3OUUA 1DZ1A 1PXUA 3J80c 3HGBA 1S97A 1NE3A 3KALA 4DUYQ 1E4EA 4FF1A 4UHVA 3MXUA 3T1YH 4ECSA 1F9SA 5IT9L 3HOWG 3CCJA 2E2HH 2JA5G 3DLLA 3MJFA 1TWHB 3ERQA 1N33H 2A6ED 2QILA 2VUMA 3A7LA 1OWTA 3NTHA 1H9RA 2MUYA 4IOAA 2ASBA 2I5MX 2XRQD 3L9AX 5FO8B 2F0VA 1GSHA 1RJQA 2B63A 4R7RA 2MCTA 3GTPA 2R7ZA 1HA5A 3L4KA 1E22A 1VQJA 2IX3A 2F0MA 2GN5A 3D3RA 4QIWB 4K5WA 1DONA 3BVZA 2N8NA 4ECRA 4TV9F 3A8JE 2J0TD 5IE8A 3MZ5A 4DV1H 1MGSA 1ZXTA 1K83B 1Y8PB 3KYHC 3STBD 3I4NB 4RFBA 4B3RL 1RJPA 4R1JA 1KJ9A 4XT3B 4C2MB 1BDOA 1H9SA 4QQBX 4IPHA 2NVYB 3UE1A 1IBKL 1X3FA 4IWXA 3CU7A 3CD6A 3TIIA 3LWBA 2W6PA 2EY6A 4DPGA 1Y1VH 3PW7A 3VR2A 4DV2Q 4DV3Q 2VUMB 5JH7F 2HDLA 1XXGA 3OMCA 3E9IA 2C22A 4A3IH 5M3MB 4JG2A 2OWOA 2R8JA 2PCFB 3CCRA 1A0IA 4GKKH 1LYLA 1SR3A 3IFDA 4C1NI 4IUUA 1EWIA 3MFYA 1EY0A 3PUVA 2EVBA 2EYOA 4UP9A 4IPGA 1ENAA 2Q2TA 4ECWA 4HN7A 3S9WA 3PW5A 5FOBB 3PZPA 2HVSA 1Y1WH 1EZ6A 2RDFA 2B63G 2JSOA 3DF7A 2R7ZG 2UUAQ 3G4SA 2RGVA 4MA5A 2Q2HA 1F2LA 1Q90A 4DR2L 5KFJA 3S1NB 1EYCA 4LF7L 4O3NA 3HOYB 2D0PA 3BA8A 4L5TA 1RK5A 5D8DA 1D5ZC 2OTLA 3EIVA 4DL3A 4HIMA 3TP6A 4IO9A 3PF5A 1B9MA 3MXGA 1XNRQ 3C1FA 4O3PA 1A62A 1V51A 3TRZA 3KHRA 5BMVF 4MNOA 5JJIA 2YV5A 2KENA 5C44G 1ICWA 2SEBD 2W6ZA 2Y0SE 3S16H 2RCNA 3CP0A 3HS0C 4FXKC 1NAPA 5KFZA 2RGRA 3BVGA 1KLUD 2FMCA 2PW5A 3T1YQ 2F4VH 1XPOA 3Q8DA 1BVSA 5CYUA 2P0AA 1WCMB 2QW7A 3UI2A 3EN2A 1N33Q 3KDFA 5C4XG 3BAAA 4C3JG 2BR0A 1EY5A 2P5ZX 4U68A 1M1KC 5FLMG 4Y8VB 2A6EC 1II3A 3T1HL 1GUGA 3F2CA 4MAMA 1BXRA 1DOLA 3GP7A 4BS9A 1IHZA 2V59A 3QO2A 4DV1Q 1CM9A 4DV4H 1GOZA 4ECQA 1UE6A 1C7YA 1HR0Q 2L9HA 2CCZA 3HOXH 2DZDA 4A3DH 4A2AA 4RKBA 4IFDH 2VS1A 1N36Q 3FKIA 3STBC 1K0SA 2WINB 1HQMC 4LWCA 4E4TA 5KFFA 1ET9A 4L8JA 1YNJD 5E7NA 4I55F 3PUWA 4KN7C 4DK0A 5G3LF 1JB7A 1OXXK 5KFUA 1IOWA 4KY6A 3ZJYC 4HJAA 3PMFA 1I6HB 4K5XA 1KDCA 4GKKQ 4XX0B 4A3LH 4X66L 1HUNA 4OL7A 2C2RA 1KQSA 5FPOA 4O4HF 1Y8NB 3RBEA 5CV4A 3D8GA 1CZWA 1A6XA 3M9OB 3LMLA 2L1BA 1CKNA 5KNBA 1YEZA 4AQYL 3BZDB 3RR5A 4JI5L 3QFFA 2HVRA 1S10A 5AJ3L 5EPKA 1O80A 4JI6Q 5I6YA 5D1OA 1TR5A 1JWMD 1S0NA 4F88A 4PMWA 1EYGA 3MFGA 4Y7NH 5IWAL 3JAME 3PO2H 3GQBA 2PN1A 1AUXA 2W8LA 3D4WA 2E8GA 1VQEA 1Z2OX 3KF8A 4JI7L 5LOVF 4A3LG 2AQ4A 1GO3E 1D1IA 3HXLA 5EWGA 3VPDA 1EY9A 1K73C 4ZKBB 1N8RC 4RAYA 3FKIG 5DEHA 1IL2A 1UC8A 5A35A 2W9CB 3BQ1A 1YHBA 1XX8A 1DOKA 4HSPA 3H3VC 2W57A 3EBEA 2F4VQ 1SNOA 4JOIA 4BA2I 4LFBL 4B3TH 1HNWL 1Q7YC 2PQAA 4XQNA 1IW7D 2F0OA 3ND8A 1LT4D 1VQAA 2K5QA 2C00A 3OUZA 3JRXA 1T5XD 1A2TA 3GO5A 4NXML 4Y52H 5IGGA 2HJWA 3HOVH 2J9GA 1A2UA 3GV6A 3T5JA 5JUMA 3MXNB 4QJFA 4O4LF 2XNAC 3W2DA 1NMFA 4DV4Q 2RBMA 3K5OA 4C1NK 2OQ0A 4FS1A 5EWFA 1SE2A 1TWCH 5M5WB 1AZQA 3K3VA 3BDCA 4FU0A 1YJNA 1FD7D 4FP5D 3GIJA 3G6XA 1E2WA 2X0SA 4GOPC 2FLPA 2MGSA 2NN6I 2OXPA 5FJ8H 1CT1D 1SDFA 1HFGA 3W5OA 1S5BD 3RZDB 1IBLL 1V1PA 4HIKA 4JI2L 2UUBQ 5DQGA 4RCNA 2KA7A 1KLGD 1YNJC 4R4QA 5M5YH 5DNFA 2ZJPA 4UCOA 4QW9A 4C3HB 1FJGH 5BPHA 3EA6A 5JJZA 5JVH3 5KFOA 1N9WA 2WDTA 4WJ3M 1I3QH 2FXQA 4ZQIA 4PZ8A 2HHHL 3RV4A 2F3VA 4UFZA 4JCVE 2VOBA 5HY6A 4QIWE 5CGKA 3OSPA 1W3SA 1EY4A 1P8LA 3AFPA 4NXNQ 1SMYD 2KHJA 5EQ0A 4A93B 4ULLA 5DG7A 4R4OA 4POGA 1YHAA 4BY1H 1WFQA 3QOJA 5FJ8G 4RA8A 1VQMA 5NUCA 3BS1A 1L1OC 4EYIB 3JAML 2ZTDA 2C28A 4J6HA 2F0PA 1V1PB 3KAJA 2WKDA 1CQFA 1W6KA 3GTJH 5KFPA 3G7LA 5C4HA 1TVXA 2ID0A 2JK8A 2IWHA 2ASDA 2K7VA 2FJ2A 2DN8A 3HKZA 4HJ9A 1KL9A 1S4ZA 2RHSB 5C5LA 2MO1A 3N42B 1K3RA 4RGTA 1B9NA 2I8CA 1HJPA 2NB0A 1JICA 2Z0SA 3R8BA 4I7ZC 4V0BA 5M9OA 4XQJA 1ASYA 4DR6L 3AB9A 3WWVA 4N9TA 2EJFC 1Q81C 1SNDA 4HEDA 4N9PA 2CWAA 1GSOA 4IAJA 1PHJA 1TWFA 2CQYA 5J22A 3TS0A 4FXGC 3WOFA 4BXXG 4ZUJA 2A5HA 4JI0L 3KHHA 3E5SA 2W8KA 3MR2A 1IBMH 1WTHA 4LF6H 3K5MA 4JI8L 4JPBW 1HUMA 4ED6A 2F1MA 2VQEL 4A3GB 2Z8LA 1CS0A 1LABA 5LA6F 4B9WA 2EYHA 3VDYA 2N55A 1CK1A 3EPIA 1KD1C 1TWFH 3G6EA 1JWSD 2DY8A 3IRBA 4QL5A 4U673 2W7PA 3QR8A 1R9TA 2B2TC 1E1TA 2ZTEA 4MA0A 1GVPA 1PH4A 2W9BA 1LTID 5FLXc 3OPOA 4TQUS 1FR3A 1RYSA 4QY7A 4I7HA 3SHLA 1NR2A 4A3KG 4EGQA 3CC2A 1SAPA 1SCUB 3HKZG 3OHAA 2K33A 3RNUA 3AFQA 4WBNF 3F8NA 2KUMA 2R82A 3S1RH 1I94L 3RJ0A 1ICFB 1FKAH 3E6ZX 4X64H 1OXVA 1FJGQ 1M7JA 3Q8QB 1B50A 4NW2A 3A7AB 3MEFA 5J2TF 1EZ8A 5KFAA 4IR9A 3GIMA 2HCIA 4DNIA 2JJQA 1JX4A 5KFCA 1KAAA 3PIP3 1PLFA 1PH5A 2ZTCA 3S2HH 1SXTA 1G6ZA 1K0RA 2F0UA 5C0XJ 1TXYA 2NZHA 3E0JA 1JJCB 4B3ML 1E3PA 4JI1Q 3GTGB 4J15A 4XYQA 1SMYC 3G6JB 2UUCL 4JI4H 4A3EG 2N78A 3CCUA 4IJLA 4PNYA 5C3EB 2VQFL 2BQUA 2WACA 3Q0AA 1MBYA 3HOUH 4IJHA 3ULPA 5JQWA 4APVA 4YY3H 2JA8H 2FPGB 3LWEA 3RTXA 4DR1L 1S0MA 1V1OA 1C4QA 3TZUA 1B6SA 4JBJA 5L9XA 3BG3A 1TWGB 3S15B 1AFPA 1VBHA 4DR4H 2AKWB 1IBKQ 4C3IB 4LF4L 1OO9B 1VQOA 1QOHA 3VA7A 1E7ZA 5I2YA 2H1EA 2VL6A 1N32L 4DL7A 3NP8A 5LHY1 3CQZB 5J3BA 4YJ2F 1ZETA 4A3JH 5H80A 1QVFA 3MR6A 4A3FB 4F4ZA 1IXRA 1IBMQ 4LF6Q 4DV0H 1SYFA 4LFAL 5CORA 3GV7B 3HZXA 4P2CB 1AE3A 3H94A 3J80i 1GM5A 2QGQA 3BYTB 4BBSH 1K8OA 2JA8G 2HD3A 1IYUA 3V4ZA 2OF1A 4IRCA 3MTSA 2Q8RE 3I4LA 3KBGA 1IYJB 3L2PA 1PTOF 4OXPA 2E5LH 1OTCA 2Z6KC 3E5NA 3BG5A 5JVG3 2UXCL 3H3VH 2O5JC 1SLJA 1X65A 2IJ0A 2Y0SA 3V6JA 4K0KH 5T1GA 3VR6A 3P1HA 3K5LA 4L6TB 1AP0A 2QF7A 2XD4A 4F87A 5KGUA 3N6XA 4G7HC 1H95A 1VS0A 3ND9A 3MAQA 2CWPA 1JJ2A 4G3IA 5KG2A 2XCLA 3QZ8A 1HH2P 2DGYA 4PMCA 2DIKA 2JYOA 3A5ZB 4Q43A 2R92A 1RODA 3KLSX 1QB5D 1JLLB 2JA7H 1JOQA 3R23A 2W71A 4ED7A 2PNRC 2R7KA 4GKJH 3I56A 1TKWB 2NVQH 2FLNA 4RGMA 3ULJA 3P7JA 2OLSA 3VYUA 1MSGA 3NPPA 3DM1A 5BPFA 1O78A 1Q12A 3GTMH 1B1ZA 4CBVA 4EGVA 1VCIA 3T13A 4BY7B 3NBHA 1J8IA 2WB1B 3QOLA 1CQIB 2R92H 2B8FA 1F77A 2Y0SB 4OO1G 4F4WA 4G7ZC 3PGZA 4WD3A 2C2EA 1I50B 4IFDI 2V4QA 1S9FA 2MP1A 4DUZH 3CAMA 3UDGA 4Q0FA 1JMCA 1EYDA 5KFLA 4A3CG 1SMXA 3P20A 3PUYA 4Q8FA 1RYRA 5KFTA 1STHA 3FMCA 1L1OA 3F8TA 2HIXA 3GTOB 5LMUQ 2ALYB 1RL2A 1AUVA 2ATLA 3PSIA 3ICEA 3H0GB 5C5MA 2JEAI 5CMDA 4DR3H 3HOZB 3HG9A 1VQ8A 4HJ8A 1RK6A 1SROA 4HJ5A 1PYSB 1X3PA 2R92G 3CC7A 1XDNA 1AW7A 3UFXB 5KT3A 1AZPA 4GC7A 3NHHA 5FD5A 4O1NA 1CE8A 1LTLA 1D8LA 4RG1A 3VYRA 2VPQA 4DV0Q 2DJGC 3RZOB 4KV6A 3TBIB 4DUYH 2EXDA 3NQTA 2ZDQA 5EKIA 4WJWA 1CUKA 5I4DA 1IL8A 3KAKA 1BCPC 2R7DA 3PIOA 1B2TA 1LT5D 4M1UB 1WH2A 4J9QA 4A75A 2K5VA 2XIGA 4MV7A 1PA6A 1PH7A 1K28A 5AJ3Q 5LXTF 3AEVA 5KKNB 3KF6B 2NVTB 1BBXC 2BH2A 2LS01 2PQEA 4RAUC 5E1FA 2V9WA 2Z9HA 1VQLA 2FK3A 5M3FG 1JT8A 1G2SA 1TS4A 5IWAQ 4CJ2C 1D2BA 4A3BB 3TP7A 3JAMc 1DXMA 2EYFA 4XT1B 2XC9A 3KHLA 4EBDA 3K5NA 2B2TA 2E2IH 1TWAB 2NVXH 3TN2A 3Q6SA 3GIIA 2RSNA 4RZQA 1X3QA 1WD0A 1Q82C 5FK9C 1T94A 5JJLA 3A0JA 1X54A 3M4OB 4JV1A 2R93H 3AYHB 1RTOA 2NU9B 2F0HA 2DWCA 3KLSA 4DV2H 5ELNA 1GXDC 3DHQA 2WE6A 4LFBQ 2R86A 2AQ1B 5BN5A 1QVGA 3K7AH 5EPJA 3VR3A 4AYBB 2VB3X 4CC5A 2KECA 1NMGA 3K7UC 4KD3A 1E4GT 1SFOA 1VDZA 4IUPA 3PO3G 4G57A 1XMOL 3I4MG 1HTPA 4UAIA 4J9KA 4UP7A 4DUZQ 3RGXA 2BA1A 4DR7L 1YZ6A 4B3TL 3F2DA 4QB4A 1BR9A 2JA6B 3GIKA 3HOWH 5FLXE 1RKNA 1TWHA 4LMYA 3GTLB 4IPDA 2LSSA 3BJUA 3M9BA 1K8GA 1E2VA 2BDNA 2XN9C 4KHPH 1KTKA 1XYIA 2BE5D 2K04A 1C48A 2AGQA 4ZI7F 5L37A 4CHTB 4QIWA 1BF4A 4JOIC 2MHVA 1IBLQ 1XTCD 1XNRH 5IGDA 2PVPA 4WRDA 3E9HA 1PH6A 3KUPA 3S1QH 4A3MG 2R7NA 1K83A 4OONA 2YU9B 3WO1A 4QUCA 4BWGB 4DNRB 1PH8A 1A15A 1CHQD 5F9LA 4X3TA 5KIXA 3N44B 5KG5A 4C2MA 4O3RA 3JSLA 1V8QA 2NVYA 4OHJA 1KJ8A 5KFXA 3PQIA 1BJTA 2YZNA 2HHHQ 5EOYA 3S17H 3MC0B 2YTXA 3X3NA 1ET6A 5KG6A 4BBRG 1U4LA 4WORA 2EYPA 1Q46A 3EJIA 3S2DB 2JA5B 5C0XG 1S68A 1V4YA 1KHIA 1HZCA 4I4TF 2YCHA 3M4QA 5IGBA 3RUZA 2PNHA 3TINA 1EU4A 3B6YA 3QWNA 2NTTA 1EY7A 1VQCA 3GTKA 4UDUC 1KDAA 1DCZA 3J7AV 3TIGA 2KEDA 1CSPA 2VUMH 5CA0F 2WV6D 2Z6KA 2EZVA 1HZBA 4LNQA 1DD2A 1B6RA 1HR0H 2EY2A 1CFMA 3KJOA 2B63H 1K8MA 3OTOL 4UCTA 2R7ZH 3GTPH 1N36H 3F1ZA 4RNMA 4X62H 4MTDA 4TRDA 3TREA 4JI3H 4IUQA 1KRSA 3M4PA 5CC4A 2Z4IA 1MHWC 4RB3C 2E2HB 1PX2A 1KRTA 3UDFA 4QF4A 2BOSA 4MTEA 1GUNA 1IYVA 2LY7A 3QG1A 3K5HA 3I4NG 2ASLA 4ZLTF 3FEWX 3VR4A 5KT5A 1PH9A 2EOTA 2CH4W 3BZCA 3GTQB 3HP3A 1M90C 4DU9A 3PW0A 5JOBA 3GTKB 3S1NH 2UU9H 5C44H 5G3LD 1JKJB 2VUMG 1QVCA 3SR1A 2EYJA 3OSOA 3HOYH 4OEMB 1PFNA 1K8AC 3FDSA 4YR0A 2VZAA 1VAJA 1SNCA 4HSVA 5J1ZA 5M3MG 5FLXL 1WCMA 4ZHQF 3T5LA 4J8QA 1DIKA 4JI6H 2R6GA 3PF4A 2V5AA 3K5IA 3J80W 4XXEA 5C4XH 4KHPQ 4C3JH 4A76A 4O3QA 5K5PA 2XGQA 2IX0A 1NTGA 4DV5H 2VA3A 1S72A 3IL8A 5FLMH 5KG1A 4ZAIA 3EROA 1Y1VB 4IUNA 5CBAE 1PFBA 2BE5C 5BR8L 4JBWA 3W1BA 1MJEA 2IY5B 4JV5H 3T4AC 4L1KA 1N34H 1IKLA 1PTOB 3J81E 4R8IA 2JP1A 3MHBA 4A3IB 2FK1A 2HQLA 3GIPA 4TQRA 2WB1E 4OELB 2F0DA 4DR5Q 5L1JA 2EIFA 5KFKA 2OQKA 2K5DA 4DXGA 3PUZA 4GLXA 4ME3A 4NP5A 2RVLA 2RQXA 3HOYG 2QDLA 1PV4A 4QWEA 4DAYB 1ZHSA 3VA5A 1V9PA 2YW2A 1Y1WB 4H0LC 5L1IA 5LL6X 1DGSA 4RUAA 5GAEC 2UXDH 2XVSA 1Q86C 2HVQA 1HR0W 2XCPA 1L2ZA 4YWLA 4L5QA 1XPRA 4AH6A 3BJYA 2F0SA 1VQ7A 1WYDA 1ZHQA 2NU8B 4RMFA 4DV7H 5JEAJ 1QE6A 4EEQA 3D6CA 4PZ7A 1C9OA 1WCMG 4JYAL 5ELCA 3I3CA 4K6DA 1NCVA 3JRWA 1TS2A 1YITA 1J9OA 4HCSA 3R3OA 3R5HA 2KSWA 2CKZB 4PWQA 4HNUA 2I07B 5IYZF 4JI4L 2F0TA 4X62Q 2E76C 2KHIA 1Z6HA 2ENBA 3Q8RB 4POFA 3U9TA 4JI3Q 3LX0A 2UXBH 3JZIA 2RDGA 2BDOA 2A19A 4R8UB 2UUBH 5I9OA 2R8KA 3W3AA 3OWEB 2IX1A 1LTRD 1ML0D 3NBIA 5HGQA 4YY3L 4OWWB 3GV5B 2F0NA 1SRUA 1N32Q 1J5EL 4GZYC 4I50F 2WP8J 1B53A 4R4IA 1E0BA 3J7AK 4TKOB 5IIFA 2W9CA 4G4KA 5IY0A 2A74C 2FINB 3FKIH 2UU9Q 3H3VI 5LMNQ 5A2QW 1PH3A 1HNZL 2F0EA 4NXNH 1B70B 1EQVA 2ZDGA 4HMJA 1MIUA 4Z9CB 4GNXB 5EJWA 4NMZA 3Q1KA 1T9HA 3D4RA 5FPRA 4X65H 3HOXB 1SN8A 4F7XA 4A3DB 3PN1A 1TT2A 2NZ1D 1RF2D 2FMAA 4DV5Q 1EYAA 1ZEQX 4LF8H 1ENCA 4EQOA 5JPNC 3AMUA 1UEBA 3BDOA 3OHXC 2MJ8A 1OXUA 3TZDA 5IP9G 4LFCL 4O2AF 1BUVT 1LTBD 3A55A 3CRKC 3MXNA 4JV5Q 1EL0A 1N34Q 3J81L 4CGYB 3UDIA 2KCTA 4B3SL 2YL2A 2E5LL 5IGEA 4AYBE 4J9LA 2EYMA 4DKAC 4K0KL 2AQ2B 2TSSA 1JIHA 2M2LA 3RB0A 1WD1A 3X3MA 2Z1CA 2KEEA 3ER0A 3MWYW 3CVZA 5F9NA 5IP7H 5KRUA 1GUSA 4O4IF 2UXDQ 4KTAA 3RV3A 2L0CA 2RCFA 4CDEC 1XTDA 1JB3A 1SJED 4MV6A 2XGTA 4PG3A 4GKJL 2EDGA 4DV7Q 1EZ1A 4TVAB 2W70A 5C5JA 3PO2B 2R8GA 2F0WA 1KJIA 3U58A 2OCEA 1EQRA 3IKJA 1PZKD 4K2LA 2LMCB 5KFDA 3RZDH 5IODA 3F2BA 5FD6A 2K5HA 3VYTA 3H15A 2IHEA 5I6WA 4DV6Q 1M0TA 5C3WA 3G48A 2ICEC 2NWGA 5GROA 1HRJA 2I46A 3L3OC 5CB4F 3M3YH 5IP7G 1EOVA 2MQHA 2PMZB 4HYKA 2UXBQ 4YJ3F 3MFIA 5H1SE 2QCPX 2R87A 1B4OA 3PIPA 5HV6A 2MFIA 1WTOA 4E6IA 2RF4A 4A93H 4K2KA 1FNUA 2CQAA 4LF9H 1VBGA 4XIGS 4X6AH 2ZM6H 1I7LA 3A74A 3CMAA 2X6LA 2B8GA 3HOVB 5L1LA 2HIVA 4KD4A 1HNXL 4TV8F 1A3TA 4DR3L 2O5IC 2EE1A 3SK6A 4OX9L 4IUVA 5IYDG 1KXLA 5EWEA 1LLRD 3Q23A 1U4RA 4S3SA 5AFWA 4LF5L 1S0OA 1IOVA 4JI1H 4C3HG 4X3UA 1Q8KA 1TWCB 4X65Q 4CKBA 2L5TA 4IR1A 4LSXA 4BXXH 2W7OA 4DN4M 4DK1A 5KG4A 3ULLA 4LF8Q 3LP8A 4XYOA 3URYA 4QWBA 3K80C 4A93G 4MV3A 2AGOA 1I4RA 2HT1A 3QZ7A 5JAVA 1XMQQ 3TS2A 3GIQA 2ALZA 1YVCA 2F0FA 4K8IA 1RIPA 2HUGA 3GDEA 1QZHA 2SCUB 3RBDA 2X6GA 4B3RH 1Z9FA 3G6VA 2KCCA 1H9MA 1IBKH 1UNSA 2CW8A 4AIMA 1AH9A 4J9OA 1I4XA 2WYOA 4A3KH 1XNQQ 4F4XA 1SNPA 5KFSA 1X32A 2M00A 4R4CA 3ZYYX 3K81C 1PK8A 4BY1B 4U6PA 3D6WA 5DG9A 2DPIA 5KFBA 2ZXOA 4F50A 1IW7C 2H5XA 3CPWA 4FO2A 3KHGA 1UC9A 2C9OA 3NENA 2IW3A 4LH7A 1XMOQ 3V6KA 1L0XB 4RB1A 1M8AA 1JWUD 2HQEA 3GTJB 1Z47A 4IURA 4DV3L 1QUQB 3BDLA 4H44C 3S14B 3PV0A 5DLQE 3CKIB 3PR5B 4ED0A 2CHBD 1CKMA 3GTGA 1GUTA 4P72A 1GKHA 2F3WA 3V2TA 4A3GG 4C5CA 4IALA 1ULZA 4DR2H 4LF7H 3CRLC 1ENFA 2JEIA 4YAKB 4A3EH 2YTYA 2OTJA 4YHHQ 2ASJA 5IT9W 1PTOD 4L5SA 4J9PA 3VPBA 4FBUA 1ESFA 5C4JH 2R61A 2D2CC 2N49A 2UUAL 4LF9Q 4F4YA 1NNXA 1X3EA 1R9TH 5KFRA 1VQKA 2FPIB 2FPPB 4PMBA 2ZM6Q 3K0XA 1GSAA 5KYIA 2A6HD 1R4PB 1D5MC 3FHWA 1TWGA 1LUZA 2JN4A 5CBEE 2NUAB 5C3EH 3BQ2A 3T16A 5KNDA 1B44D 5A2QE 3CF5A 4XZ3B 1D6EC 2YS7A 5LP6F 1XNRL 4F8MA 2VXWA 1F2MA 2Z4HA 2K05A 5GONF 2K1BA 4YR2A 1B3QA 3CQZA 5KFNA 4RB2C 3MWMA 2CFMA 3I4OA 5DQIA 4C5BA 2NU6B 5KFIA 5ELBA 4X3KA 2FMMA 3T1YL 3T1HH 2N3SA 2K5WA 3NELA 3IG0A 3T56B 5KFGA 4RWSC 2FHTA 3K8AA 4RB0A 5JEAG 3EFXD 4FBTA 1X6OA 1PYBA 1S5ED 3S1RB 1N33L 2J6UA 1VQPA 2KHSA 3SI8A 3GILA 1W96A 1QNKA 5LMUH 1VQFA 1PZID 2VNUD 2F0GA 3FPPA 2EY1A 3ONAB 4B3RQ 5C3EG 1SSOA 2PPBC 4ZQ3A 5EKLA 2A68D 4K14A 4GN3B 2IT1A 4Q5VA 3F2UA 3N8DA 2G5DA 4DV1L 1T36A 1GGOA 3KOJA 4DAPA 3PUXA 3E0EA 5CA1F 4I7AA 2J4XA 1HR0L 2F0JA 2L15A 3KTMA 3MWEA 2BQ3A 4LW1A 3RB4A 1M4VA 4KKTA 1N36L 3SE0A 1HXYD 3VPCA 1STYA 2NYZD 4C3IG 4X66H 2YTVA 1LTGD 4O3SA 4YR3A 2B39A 4BA1I 3HOUB 5KFVA 1QG7A 4R9WA 4TQSA 1XWEA 1Z2NX 4HIDA 4A3FG 4AQYH 2WB1A 3WNZA 4GKKL 2R8IA 2K14A 1ZYRD 1U4MA 1BNZA 4DR2Q 2IPKD 1I50A 4LF7Q 5EDWA 1EIFA 1BO0A 4DL4A 4OO1H 5IWAH 1HHVA 2IBKA 3Q8PB 3I2ZA 4HQ6A 1PRTB 4LH6A 1W6JA 2Q8TA 3C2PA 4JI7H 1FGBD 1T5EA 3K0YA 4A3JB 1PTOC 3J81c 4A3CH 5J2UF 3L0OA 3GTOA 2IMWP 4GN4B 1EY6A 4BBSB 3H0GA 2K75A 3RGZA 4LK1C 5A2QL 2A6HC 5J39A 1BKBA 1G8ZD 3RLNA 4PZ6A 4LFBH 3BABA 4MV4A 1SE4A 5DGBA 4PDBA 1M6VA 4RKLA 5KYLA 1A3UA 2JEBI 2UVUA 4NXMH 2F3IA 2KOLA 4H02A 1EIHA 2DNCA 3T1HQ 2F4VL 1JR0D 3UDXA 2PMZE 3H0GH 2RDHA 3CCVA 5KT2A 2IP4A 1E1OA 2RSOA 3HOZH 2B2UC 1NSNS 2KCNA 2WB1G 1RJTA 4OGQC 4OWXB 1Q3LA 2Y0SG 4YCVA 1WVLA 3KLRA 4KY7A 1G2TA 2JA7B 4JC0A 4EQPA 3KF6A 2NVQB 1D7QA 2E2JH 3EQLC 5D14A 4CJ1B 1U9RA 1WTQA 1SEIA 2OEOA 3GTMB 3PW2A 5M3FH 4DV4L 2A68C 1HQRD 1IBLH 4G7OC 4JI2H 4GS3A 2XSCA 3L4JA 4K6LA 3NE5B 2SDFA 5KG7A 2W6QA 3J81j 3U9OA 1TWAA 3H0GG 1CSQA 3OOCA 4DGZA 4GOPB 5C8YF 3C0FB 4X66Q 3HOZG 5CV9A 2NVTH 1DV1A 2XTIA 1S5DD 2RA4A 2TMPA 5HGTA 1EY8A 2NBFA 5M5XB 2HHHH 1F9QA 2B3GA 2O4XA 1MJCA 2F0IA 3DUZA 1HNZQ 1HA6A 3K57A 4Q0YA 1LM0A 1MD2D 3OYYA 4AQYQ 1KIXA 1EFWA 3S1MH 4ECZA 4JI5Q 4UY8C 4U7CA 5JVDF 1LO5D 3H91A 4GNXC 4RAZA 4AYBA 1TWAH 1BXTA 2PZWA 5EAYA 4IHJF 1K3BC 1SYEA 3NQIA 1Y14B 3S24A 1U0LA 4YCUA 3PO3H 4Q44A 1W93A 5E3FA 1ZYRC 3C3LA 3I4MH 1FGUA 4NXNL 2AQ3B 5HBRB 4IFDJ 3BZKA 4DXFA 1GUOA 1H9JA 2VR1A 3G6YA 1XPUA 4LAAA 1D1KA 4K5VA 4JI7Q 2JA6A 4EQ5A 5DQHA 4IWYA 3GLKA 3GTLA 1GHJA 3DWQA 5DG8A 2DNEA 1NY4A 1AN7A 4A3BG 2FK2A 3SK4A 3OIQA 2WTFA 1DM0B 4HR7B 2UVVA 2HGSA 3DEOA 2D9UA 4QMGA 1JXLA 1HNWQ 3VYSA 4KI0A 4LUOA 3V4SA 1LACA 4JI0H 3SDZA 2YU9A 1A9XA 3FP9A 4NXMQ 4A3MH 4JI8H 3KXYT 2VY3A 4J9MA 3I12A 2R7FA 1BBWA 3K3PA 5CV6A 1BBUA 4AYBG 1HPCA 2E2IB 3HKZE 2NVXB 2CVRA 5L1KA 4BBRH 1VQ5A 3J7A5 2JA5A 1QNUA 1SFOH 4PV1C 1YI2A 1HTLD 4JUZA 5D3IB 1L0WA 4ME6A 5C0XH 2WAQB 3QB3A 2R93B 5EGTA 5KEEA 3BYYB 1SE3A 2J6TA 3ORRA 3RUPA 2JA6G 4O42A 2VQDA 1Z7TA 2C2DA 4JI2Q 2R3ZA 3HRZC 4MZ9A 3K7AB 1KAWA 1TWHH 3KK7A 5BN3A 3R5XA 1UAPA 1I94H 4DR5H 2A1AA 3Q2OA 4N8X1 4ME5A 3RF2A 4JV2A 1O7IA 2EYLA 2IHFA 4JK1C 1HNXQ 5ELOA 2NTSA 2E2HA 4ODGA 3HOWB 1SYCA 2G9HD 1I5FA 3SK8A 3CCSA 1FJGL 4B3MH 1U4PA 1K83H 1AN8A 2AWNA 4CKCA 3I4NH 3NGDA 3PW4A 1YIJA 5LL6S 4NLGA 4C2MH 5I47A 3GTQA 2NVYH 1X56A 3J7AF 2VQFH 2RKSA 4QWAA 1CQVA 1RTNA 4JI1L
chains in the Genus database with same CATH topology
3IRBA 4QL5A 3NEMA 4O0AA 4YWKA 1UEBA 2K5NA 1HZ9A 1E1TA 1OXUA 2ZTEA 1UWVA 1GVPA 4LFCL 5IP9G 5M3MH 4YCWA 5M5XH 5GADC 5FLXc 4TQUS 3G71A 1PH4A 1N34Q 4JV5Q 4QY7A 4DR6Q 2JA7G 4YY3Q 4A3KG 2VW9A 3UDIA 2KCTA 4DV6L 3CC2A 4B3SL 3GTQH 1B7YB 2E5LL 3ERSX 4AYBE 3GTKH 3HKZG 1J5EQ 4LUZA 3U50C 2ATWA 3RNUA 3AFQA 4DKAC 3S1RH 1I94L 4K0KL 1B8AA 1Q1EA 2UXBL 4DAMA 1PFSA 4DK6C 4DR4Q 1OXVA 2UUBL 4JI0Q 3ER0A 1FJGQ 4A3BH 2YYZA 5IP7H 5IYCH 1PVOA 3MEFA 1PH2A 3NBHB 2UXDQ 4JI8Q 4DNIA 2JJQA 2VQEQ 1XTDA 1PH5A 2ZTCA 3S2HH 2XGTA 4PG3A 1K0RA 5C0XJ 4GKJL 1TXYA 4DV7Q 4TVAB 2NZHA 1JJCB 4P71A 4YWMA 1E3PA 4B3ML 3M4OH 4JI1Q 2V1CC 1ASZA 3U58A 4J15A 3U4ZA 2OCEA 1EQRA 3CCLA 1IBML 2ZJQA 2UUCL 4LF6L 1VQBA 5GAGC 4LFCQ 2I5LX 3RZDH 3F2BA 2N78A 4A3EG 3CCUA 2BH8A 3DM3A 4IJLA 2VQFL 2K5HA 3JC66 4NPSA 1L1OB 4X65L 3H15A 2IHEA 4DV6Q 4B3SQ 3G48A 4MTNA 2E5LQ 5GROA 1UE5A 3I55A 1S40A 4LF8L 3RN2A 3HOUH 4IJHA 1WCMH 3ULPA 3M3YH 4APVA 5IP7G 1EOVA 1WI5A 2JA8H 2MQHA 5IYCG 1GD7A 1I94Q 4K0KQ 2UXBQ 4DR1L 3CC4A 3KLWA 5H1SE 2AMCB 4DK3C 2PI2E 4JBJA 1XMQL 3PIPA 1QZGA 4LUVA 1Y1VG 2MFIA 2JE6I 3PCOB 2JA6H 2RF4A 4A93H 2NN6G 2AKWB 1IBKQ 3GTLH 4XIGS 4X6AH 4LF4L 4A3IG 1VQOA 1KC8C 3A74A 1E7ZA 3CMAA 2VL6A 2HIVA 4GKJQ 1HNXL 1N32L 2D62A 5J3BA 4X64L 4DR3L 4A3JH 4B3MQ 1QVFA 1KXLA 4OX9L 5IYDG 1YJWA 1XNQL 1IXRA 1W2BA 1IBMQ 2KBNA 2UUCQ 4LF6Q 4LFAL 2QEXA 4LF5L 1AE3A 2MO0A 1Y1WG 3J80i 1GM5A 2QGQA 1Q8KA 1YBYA 4X65Q 2VQFQ 4BBSH 2ZJRA 2JA8G 1EIYB 3RN5A 3D0FA 1PH1A 4BXXH 2YU9H 4GLVB 1V43A 3ULLA 4LF8Q 3KJPA 3L2PA 1IYJB 3HFZB 4OXPA 4GNXA 3K80C 4A93G 1OTCA 4DR1Q 4O2DA 1OXSC 2DUDA 2Z6KC 1I6HH 2ES2A 2HT1A 2UXCL 3CCEA 3GD7A 1XMQQ 3H3VH 1SLJA 1X65A 2AHOB 3TS2A 5LMNW 1YVCA 5K36G 1RIPA 3S2DH 1VS0A 1S3OA 3GDEA 4R4TA 2JA5H 1H95A 2WAQG 1QZHA 4LF4Q 2R93G 2CWPA 1Z9FA 1JJ2A 1C0AA 5IP9H 4WJ4A 1HH2P 2DGYA 4NB3A 3A5ZB 2LXKA 4YHHL 3CMEA 4DR3Q 5LMUL 4AIMA 1AH9A 3OW2A 4IFDJ 4OX9Q 3M85A 2JA7H 4A3KH 1XNQQ 4HIOA 3U4VA 1G6PA 4R4CA 3I56A 4LFAQ 2NVQH 3SGIA 4LF9L 3K81C 4LF5Q 4DR4L 3AQQA 3ULJA 1VQNA 5GQOA 1K9MC 2ZM6L 4OO1I 1FVIA 1WJJA 1V1QA 1Q12A 2H5XA 3CPWA 3GTMH 3KDFB 1VCIA 3J80c 1P16A 1NE3A 3NENA 4DUYQ 1XMOQ 1G51A 2R92H 4DV0L 1CKOA 1Z47A 2C35B 4DV3L 3HOWG 4JBKA 1QUQB 3CCJA 2E2HH 2JA5G 4OO1G 3PGZA 4P75A 3DLLA 2UXCQ 3PV0A 5DLQE 4XTCS 4IFDI 3CXCA 4IOAA 2ASBA 2I5MX 1CKMA 3CAMA 4P72A 3UDGA 1YJ9A 1GKHA 4A3GG 1JMCA 4A3CG 1E22A 1SMXA 3HOXG 3PUYA 4A3DG 1VQJA 4KHPQ 4IFDG 1L1OA 2GN5A 3F8TA 4A3EH 2HIXA 2YTYA 3W1GA 4KLKA 4YHHQ 5LMUQ 2N8NA 2ALYB 1RL2A 2LXJA 4L5SA 5IE8A 3PSIA 3ICEA 1YNXA 2JEAI 1MKHA 5C4JH 2N49A 2UUAL 4LF9Q 1X3EA 1R9TH 3KYHC 4P74A 3STBD 1VQ8A 1VQKA 4HJ8A 4B3RL 1SROA 2ZM6Q 3K0XA 4HJ5A 1PYSB 2R92G 4R1JA 3CC7A 1UE1A 3FHWA 4QQBX 4IPHA 3UE1A 1IBKL 1X3FA 3CD6A 4KHZA 1X55A 1LUZA 4DPGA 1LTLA 1Y1VH 5C3EH 1D8LA 4RG1A 5M5WH 4DV2Q 3CF5A 4DV0Q 4DV3Q 1XNRL 2EXDA 3E9IA 1OXTA 2WAQE 4A3IH 1Q1BA 1CUKA 4JG2A 2OWOA 1X3GA 2CFMA 3CCRA 1CKNB 1A0IA 2R7DA 1LYLA 3I4OA 3PIOA 1SR3A 1EWIA 5IYDH 3PUVA 4A75A 3T1YL 2N3SA 2K5VA 2JQOA 2Q2IA 4UP9A 3NELA 2Q2TA 4IPGA 1PA6A 1PH7A 3K8AA 2KCMA 5AJ3Q 3AEVA 5JEAG 3KF6B 1Y1WH 4C3HH 3PO2G 1X6OA 1PYBA 1N33L 2BH2A 1VQPA 2B63G 1VQLA 1IZ6A 3RLFA 5M3FG 4DUZL 2R7ZG 1JT8A 2UUAQ 5IWAQ 3G4SA 1G291 1VQFA 2Q2HA 3JAMc 2VNUD 3KF8B 2D0OA 4B3RQ 5C3EG 4DR2L 4LF7L 2OTJA 3CCMA 2E2IH 2NVXH 2D0PA 4GN3B 2IT1A 4L5TA 2OTLA 3J81i 3EIVA 4DV1L 4HIMA 1Q82C 3KOJA 4IO9A 4HJ7A 5JJLA 1SE8A 3PF5A 3A0JA 1X54A 3PUXA 3E0EA 4P73A 1UE7A 1XNRQ 2R93H 1A62A 3AYHB 1HR0L 3TRZA 2L15A 1VQDA 4LW1A 4MNOA 2YV5A 5ELNA 2KENA 5C44G 1N36L 5JJIA 2PQAB 2Y0SE 3S16H 2RCNA 2YTVA 3CP0A 4LFBQ 1QVGA 3K7AH 3T1YQ 4OWTB 1XPOA 3Q8DA 1NMGA 3K7UC 1BVSA 4BA1I 3HOVG 3PO3G 4DUYL 3EN2A 1XMOL 3I4MG 1N33Q 3KDFA 4HIDA 4A3FG 3KFUA 5C4XG 1VQHA 5IYBH 1M1KC 4UP7A 5FLMG 4DUZQ 4GKKL 2BA1A 2K14A 4DR7L 1YZ6A 4B3TL 3F2DA 1FL0A 1QUQA 4DR2Q 3T1HL 3HOWH 4LF7Q 1EIFA 5IT9c 3F2CA 4IPDA 2LSSA 3BJUA 3M9BA 1K8GA 3I2ZA 3A5UA 1EUJA 4DV1Q 2K52A 1VQIA 3UE0A 4A3GH 1UE6A 2WFWA 1C7YA 3J81c 1HR0Q 2CCZA 4A3CH 2EQSA 3HOXH 3L0OA 4A3DH 4JOIC 4GN4B 2VS1A 1N36Q 1IBLQ 4IOCA 4ALPA 2JA9A 3E9HA 3STBC 3S14H 4LWCA 1PH6A 2K75A 3S1QH 4A3MG 2MNAA 5E7NA 5IYBG 3PUWA 4OONA 1BKBA 3RLNA 4PZ6A 1PH8A 2F52A 1JB7A 1OXXK 4EX5A 5C0XI 2A8VA 3ZJYC 4DV2L 4HJAA 2HHHQ 3S17H 1XJVA 2K4KA 4GKKQ 2YTXA 2Q2UA 4A3LH 4X66L 1NJIC 4BY1G 4B3TQ 4DR7Q 2JEBI 4BBRG 2F3IA 4H02A 1U5KA 3T1HQ 1Q46A 1KQSA 3UDXA 2F4VL 2PMZE 3H0GH 3CCVA 5C0XG 1E1OA 1HZCA 1KHIA 3HOZH 1AE2A 3M4QA 1CKNA 2WB1G 1YEZA 4AQYL 4OWXB 2I0QA 3RR5A 2PNHA 4JI5L 3B6YA 1A8VA 5AJ3L 2Y0SG 4YCVA 4JI6Q 1VQCA 4JC0A 3JAMi 4PMWA 1EYGA 2GVAA 3KF6A 1D7QA 4Y7NH 2E2JH 1CSPA 2GVBA 5IWAL 3TQYA 2VUMH 3PO2H 2Z6KA 4LNQA 1HZBA 1L2FA 3M7NA 3GTGH 4KHPL 3KJOA 2B63H 2E8GA 1VQEA 3OTOL 5M3FH 4DV4L 2R7ZH 3GTPH 3F1ZA 4JI7L 4GS3A 1VQ9A 4A3LG 1GO3E 3TREA 1WOCA 1JE5A 3J81j 1K73C 1N8RC 1KRSA 3M4PA 3FKIG 3H0GG 1CSQA 3LGJA 4GOPB 1IL2A 1JJGA 1KRTA 3UDFA 1YHBA 4X66Q 3HOZG 2NVTH 3I4NG 2XTIA 3EBEA 4DR5L 2F4VQ 2B3GA 4L5RC 4JOIA 1PH9A 1MJCA 4BA2I 1HNZQ 4LFBL 1LM0A 3L7ZC 3BZCA 1HNWL 1Q7YC 3OYYA 4AQYQ 2PQAA 1M90C 1KIXA 1EFWA 3S1MH 2K50A 4JI5Q 4UY8C 1TWGH 3S15H 4IPCA 5C44H 3S1NH 1VQAA 2VUMG 1QVCA 4GNXC 4C3IH 1TWAH 5EAYA 3HOYH 3GO5A 4NXML 1K8AC 4Y52H 2VZAA 1Y14B 5M3MG 3S24A 3HOVH 1U0LA 3CCQA 1HZAA 4YCUA 2R6GA 3PO3H 3PF4A 3CQZH 3BU2A 3I4MH 1FGUA 4NXNL 3MXNB 4QJFA 1VQGA 4C3JH 5C4XH 3TEHB 4A76A 4A3FH 1VQ4A 1EQQA 2IX0A 1NTGA 3BZKA 3OTOQ 3J7ZC 1NMFA 4DV4Q 5FLMH 1S72A 1XPUA 4JI7Q 4EQ5A 2OQ0A 4QGUA 1YHQA 1TWCH 5BR8L 4JBWA 3W1BA 1YJNA 1MJEA 2IY5B 1NY4A 2NZOA 4GOPC 5JJKA 4A3BG 2HQLA 2NN6I 5FJ8H 4UPAA 2WB1E 4JBMA 1X9NA 3W5OA 4DR5Q 2EIFA 1IBLL 2OQKA 4HIKA 4JI2L 4X62L 2UUBQ 3PUZA 4GLXA 4ME3A 1A63A 3HOYG 1HNWQ 1PV4A 4JI3L 4DAYB 4KI0A 1NBWA 1V9PA 4R4QA 4LUOA 5M5YH 2RHQB 2ZJPA 2AWOA 1DGSA 3FP9A 1N9WA 5GAEC 4NXMQ 1I3QH 2QA4A 2FXQA 4A3MH 1Q86C 4WJ3M 4PZ8A 2VY3A 2I5HA 1HR0W 2HHHL 4YWLA 4L5QA 4JCVE 1XPRA 5HY6A 4QIWE 1VQ6A 1W3SA 2B29A 4AH6A 1P8LA 3AFPA 1WYDA 1BBWA 2R7FA 2KHJA 2PI2A 1VQ7A 4NXNQ 3CW2C 1BBUA 4RMFA 4AYBG 2UU9L 5JEAJ 3HKZE 1E24A 4R4OA 4PZ7A 5LMNL 4POGA 3HOUG 1YHAA 1C9OA 1WCMG 4A4IA 1WFQA 4BBRH 5FJ8G 1VQMA 1VQ5A 4BY1H 3J7A5 1SFOH 4JYAL 1YI2A 1L1OC 5BR8Q 1L0WA 2BA0A 5GAHC 2ZTDA 1YITA 4JI6L 4BY7H 2CQOA 2CKZB 3HKSA 2JA6G 4FDBA 4DV5L 3GTJH 4JI4L 2JK8A 2ID0A 4JI2Q 4X62Q 2KHIA 4MZ9A 1I50H 3RLOA 1KAWA 1TWHH 4HJ9A 1KL9A 2RHSB 4POFA 4JI3Q 2MO1A 2A1AA 1K3RA 3CPFA 2A19A 4JV5L 1N34L 1HJPA 1O7IA 4A3JG 2IX1A 2Z0SA 5HGQA 4DR6L 2IHFA 4YY3L 1ASYA 4OWWB 3WWVA 1SRUA 1Q81C 4GN5A 1HNXQ 1N32Q 1J5EL 2CWAA 1PHJA 4X64Q 2WP8J 3GTOH 5ELOA 1J6QA 4R4IA 3TS0A 4BBSG 4GOPA 3D31A 5IY0A 1I5FA 3FKIH 4BXXG 2UU9Q 3H3VI 4JI0L 3CCSA 5LMNQ 1FJGL 1PH3A 1HNZL 1K83H 4BY7G 2AWNA 3I4NH 1B70B 4JYAQ 3I7FA 2UXDL 1YIJA 4JI8L 1MIUA 4C2MH 4GNXB 2VQEL 2NVYH 1X56A 1T9HA 1SN8A 3VDYA 1KD1C 4DV7L 4DV5Q 1TWFH 4GLAC 3G6EA 4JI4Q 3RZOH 4UP8A 4JI1L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IRB A;  4QL5 A;  3NEM A;  4O0A A;  4YWK A;  1UEB A;  2K5N A;  1HZ9 A;  1E1T A;  1OXU A;  2ZTE A;  1UWV A;  1GVP A;  4LFC L;  5IP9 G;  5M3M H;  4YCW A;  5M5X H;  5GAD C;  5FLX c;  4TQU S;  3G71 A;  1PH4 A;  1N34 Q;  4JV5 Q;  4QY7 A;  4DR6 Q;  2JA7 G;  4YY3 Q;  4A3K G;  2VW9 A;  3UDI A;  2KCT A;  4DV6 L;  3CC2 A;  4B3S L;  3GTQ H;  1B7Y B;  2E5L L;  3ERS X;  4AYB E;  3GTK H;  3HKZ G;  1J5E Q;  4LUZ A;  3U50 C;  2ATW A;  3RNU A;  3AFQ A;  4DKA C;  3S1R H;  1I94 L;  4K0K L;  1B8A A;  1Q1E A;  2UXB L;  4DAM A;  1PFS A;  4DK6 C;  4DR4 Q;  1OXV A;  2UUB L;  4JI0 Q;  3ER0 A;  1FJG Q;  4A3B H;  2YYZ A;  5IP7 H;  5IYC H;  1PVO A;  3MEF A;  1PH2 A;  3NBH B;  2UXD Q;  4JI8 Q;  4DNI A;  2JJQ A;  2VQE Q;  1XTD A;  1PH5 A;  2ZTC A;  3S2H H;  2XGT A;  4PG3 A;  1K0R A;  5C0X J;  4GKJ L;  1TXY A;  4DV7 Q;  4TVA B;  2NZH A;  1JJC B;  4P71 A;  4YWM A;  1E3P A;  4B3M L;  3M4O H;  4JI1 Q;  2V1C C;  1ASZ A;  3U58 A;  4J15 A;  3U4Z A;  2OCE A;  1EQR A;  3CCL A;  1IBM L;  2ZJQ A;  2UUC L;  4LF6 L;  1VQB A;  5GAG C;  4LFC Q;  2I5L X;  3RZD H;  3F2B A;  2N78 A;  4A3E G;  3CCU A;  2BH8 A;  3DM3 A;  4IJL A;  2VQF L;  2K5H A;  3JC6 6;  4NPS A;  1L1O B;  4X65 L;  3H15 A;  2IHE A;  4DV6 Q;  4B3S Q;  3G48 A;  4MTN A;  2E5L Q;  5GRO A;  1UE5 A;  3I55 A;  1S40 A;  4LF8 L;  3RN2 A;  3HOU H;  4IJH A;  1WCM H;  3ULP A;  3M3Y H;  4APV A;  5IP7 G;  1EOV A;  1WI5 A;  2JA8 H;  2MQH A;  5IYC G;  1GD7 A;  1I94 Q;  4K0K Q;  2UXB Q;  4DR1 L;  3CC4 A;  3KLW A;  5H1S E;  2AMC B;  4DK3 C;  2PI2 E;  4JBJ A;  1XMQ L;  3PIP A;  1QZG A;  4LUV A;  1Y1V G;  2MFI A;  2JE6 I;  3PCO B;  2JA6 H;  2RF4 A;  4A93 H;  2NN6 G;  2AKW B;  1IBK Q;  3GTL H;  4XIG S;  4X6A H;  4LF4 L;  4A3I G;  1VQO A;  1KC8 C;  3A74 A;  1E7Z A;  3CMA A;  2VL6 A;  2HIV A;  4GKJ Q;  1HNX L;  1N32 L;  2D62 A;  5J3B A;  4X64 L;  4DR3 L;  4A3J H;  4B3M Q;  1QVF A;  1KXL A;  4OX9 L;  5IYD G;  1YJW A;  1XNQ L;  1IXR A;  1W2B A;  1IBM Q;  2KBN A;  2UUC Q;  4LF6 Q;  4LFA L;  2QEX A;  4LF5 L;  1AE3 A;  2MO0 A;  1Y1W G;  3J80 i;  1GM5 A;  2QGQ A;  1Q8K A;  1YBY A;  4X65 Q;  2VQF Q;  4BBS H;  2ZJR A;  2JA8 G;  1EIY B;  3RN5 A;  3D0F A;  1PH1 A;  4BXX H;  2YU9 H;  4GLV B;  1V43 A;  3ULL A;  4LF8 Q;  3KJP A;  3L2P A;  1IYJ B;  3HFZ B;  4OXP A;  4GNX A;  3K80 C;  4A93 G;  1OTC A;  4DR1 Q;  4O2D A;  1OXS C;  2DUD A;  2Z6K C;  1I6H H;  2ES2 A;  2HT1 A;  2UXC L;  3CCE A;  3GD7 A;  1XMQ Q;  3H3V H;  1SLJ A;  1X65 A;  2AHO B;  3TS2 A;  5LMN W;  1YVC A;  5K36 G;  1RIP A;  3S2D H;  1VS0 A;  1S3O A;  3GDE A;  4R4T A;  2JA5 H;  1H95 A;  2WAQ G;  1QZH A;  4LF4 Q;  2R93 G;  2CWP A;  1Z9F A;  1JJ2 A;  1C0A A;  5IP9 H;  4WJ4 A;  1HH2 P;  2DGY A;  4NB3 A;  3A5Z B;  2LXK A;  4YHH L;  3CME A;  4DR3 Q;  5LMU L;  4AIM A;  1AH9 A;  3OW2 A;  4IFD J;  4OX9 Q;  3M85 A;  2JA7 H;  4A3K H;  1XNQ Q;  4HIO A;  3U4V A;  1G6P A;  4R4C A;  3I56 A;  4LFA Q;  2NVQ H;  3SGI A;  4LF9 L;  3K81 C;  4LF5 Q;  4DR4 L;  3AQQ A;  3ULJ A;  1VQN A;  5GQO A;  1K9M C;  2ZM6 L;  4OO1 I;  1FVI A;  1WJJ A;  1V1Q A;  1Q12 A;  2H5X A;  3CPW A;  3GTM H;  3KDF B;  1VCI A;  3J80 c;  1P16 A;  1NE3 A;  3NEN A;  4DUY Q;  1XMO Q;  1G51 A;  2R92 H;  4DV0 L;  1CKO A;  1Z47 A;  2C35 B;  4DV3 L;  3HOW G;  4JBK A;  1QUQ B;  3CCJ A;  2E2H H;  2JA5 G;  4OO1 G;  3PGZ A;  4P75 A;  3DLL A;  2UXC Q;  3PV0 A;  5DLQ E;  4XTC S;  4IFD I;  3CXC A;  4IOA A;  2ASB A;  2I5M X;  1CKM A;  3CAM A;  4P72 A;  3UDG A;  1YJ9 A;  1GKH A;  4A3G G;  1JMC A;  4A3C G;  1E22 A;  1SMX A;  3HOX G;  3PUY A;  4A3D G;  1VQJ A;  4KHP Q;  4IFD G;  1L1O A;  2GN5 A;  3F8T A;  4A3E H;  2HIX A;  2YTY A;  3W1G A;  4KLK A;  4YHH Q;  5LMU Q;  2N8N A;  2ALY B;  1RL2 A;  2LXJ A;  4L5S A;  5IE8 A;  3PSI A;  3ICE A;  1YNX A;  2JEA I;  1MKH A;  5C4J H;  2N49 A;  2UUA L;  4LF9 Q;  1X3E A;  1R9T H;  3KYH C;  4P74 A;  3STB D;  1VQ8 A;  1VQK A;  4HJ8 A;  4B3R L;  1SRO A;  2ZM6 Q;  3K0X A;  4HJ5 A;  1PYS B;  2R92 G;  4R1J A;  3CC7 A;  1UE1 A;  3FHW A;  4QQB X;  4IPH A;  3UE1 A;  1IBK L;  1X3F A;  3CD6 A;  4KHZ A;  1X55 A;  1LUZ A;  4DPG A;  1LTL A;  1Y1V H;  5C3E H;  1D8L A;  4RG1 A;  5M5W H;  4DV2 Q;  3CF5 A;  4DV0 Q;  4DV3 Q;  1XNR L;  2EXD A;  3E9I A;  1OXT A;  2WAQ E;  4A3I H;  1Q1B A;  1CUK A;  4JG2 A;  2OWO A;  1X3G A;  2CFM A;  3CCR A;  1CKN B;  1A0I A;  2R7D A;  1LYL A;  3I4O A;  3PIO A;  1SR3 A;  1EWI A;  5IYD H;  3PUV A;  4A75 A;  3T1Y L;  2N3S A;  2K5V A;  2JQO A;  2Q2I A;  4UP9 A;  3NEL A;  2Q2T A;  4IPG A;  1PA6 A;  1PH7 A;  3K8A A;  2KCM A;  5AJ3 Q;  3AEV A;  5JEA G;  3KF6 B;  1Y1W H;  4C3H H;  3PO2 G;  1X6O A;  1PYB A;  1N33 L;  2BH2 A;  1VQP A;  2B63 G;  1VQL A;  1IZ6 A;  3RLF A;  5M3F G;  4DUZ L;  2R7Z G;  1JT8 A;  2UUA Q;  5IWA Q;  3G4S A;  1G29 1;  1VQF A;  2Q2H A;  3JAM c;  2VNU D;  3KF8 B;  2D0O A;  4B3R Q;  5C3E G;  4DR2 L;  4LF7 L;  2OTJ A;  3CCM A;  2E2I H;  2NVX H;  2D0P A;  4GN3 B;  2IT1 A;  4L5T A;  2OTL A;  3J81 i;  3EIV A;  4DV1 L;  4HIM A;  1Q82 C;  3KOJ A;  4IO9 A;  4HJ7 A;  5JJL A;  1SE8 A;  3PF5 A;  3A0J A;  1X54 A;  3PUX A;  3E0E A;  4P73 A;  1UE7 A;  1XNR Q;  2R93 H;  1A62 A;  3AYH B;  1HR0 L;  3TRZ A;  2L15 A;  1VQD A;  4LW1 A;  4MNO A;  2YV5 A;  5ELN A;  2KEN A;  5C44 G;  1N36 L;  5JJI A;  2PQA B;  2Y0S E;  3S16 H;  2RCN A;  2YTV A;  3CP0 A;  4LFB Q;  1QVG A;  3K7A H;  3T1Y Q;  4OWT B;  1XPO A;  3Q8D A;  1NMG A;  3K7U C;  1BVS A;  4BA1 I;  3HOV G;  3PO3 G;  4DUY L;  3EN2 A;  1XMO L;  3I4M G;  1N33 Q;  3KDF A;  4HID A;  4A3F G;  3KFU A;  5C4X G;  1VQH A;  5IYB H;  1M1K C;  4UP7 A;  5FLM G;  4DUZ Q;  4GKK L;  2BA1 A;  2K14 A;  4DR7 L;  1YZ6 A;  4B3T L;  3F2D A;  1FL0 A;  1QUQ A;  4DR2 Q;  3T1H L;  3HOW H;  4LF7 Q;  1EIF A;  5IT9 c;  3F2C A;  4IPD A;  2LSS A;  3BJU A;  3M9B A;  1K8G A;  3I2Z A;  3A5U A;  1EUJ A;  4DV1 Q;  2K52 A;  1VQI A;  3UE0 A;  4A3G H;  1UE6 A;  2WFW A;  1C7Y A;  3J81 c;  1HR0 Q;  2CCZ A;  4A3C H;  2EQS A;  3HOX H;  3L0O A;  4A3D H;  4JOI C;  4GN4 B;  2VS1 A;  1N36 Q;  1IBL Q;  4IOC A;  4ALP A;  2JA9 A;  3E9H A;  3STB C;  3S14 H;  4LWC A;  1PH6 A;  2K75 A;  3S1Q H;  4A3M G;  2MNA A;  5E7N A;  5IYB G;  3PUW A;  4OON A;  1BKB A;  3RLN A;  4PZ6 A;  1PH8 A;  2F52 A;  1JB7 A;  1OXX K;  4EX5 A;  5C0X I;  2A8V A;  3ZJY C;  4DV2 L;  4HJA A;  2HHH Q;  3S17 H;  1XJV A;  2K4K A;  4GKK Q;  2YTX A;  2Q2U A;  4A3L H;  4X66 L;  1NJI C;  4BY1 G;  4B3T Q;  4DR7 Q;  2JEB I;  4BBR G;  2F3I A;  4H02 A;  1U5K A;  3T1H Q;  1Q46 A;  1KQS A;  3UDX A;  2F4V L;  2PMZ E;  3H0G H;  3CCV A;  5C0X G;  1E1O A;  1HZC A;  1KHI A;  3HOZ H;  1AE2 A;  3M4Q A;  1CKN A;  2WB1 G;  1YEZ A;  4AQY L;  4OWX B;  2I0Q A;  3RR5 A;  2PNH A;  4JI5 L;  3B6Y A;  1A8V A;  5AJ3 L;  2Y0S G;  4YCV A;  4JI6 Q;  1VQC A;  4JC0 A;  3JAM i;  4PMW A;  1EYG A;  2GVA A;  3KF6 A;  1D7Q A;  4Y7N H;  2E2J H;  1CSP A;  2GVB A;  5IWA L;  3TQY A;  2VUM H;  3PO2 H;  2Z6K A;  4LNQ A;  1HZB A;  1L2F A;  3M7N A;  3GTG H;  4KHP L;  3KJO A;  2B63 H;  2E8G A;  1VQE A;  3OTO L;  5M3F H;  4DV4 L;  2R7Z H;  3GTP H;  3F1Z A;  4JI7 L;  4GS3 A;  1VQ9 A;  4A3L G;  1GO3 E;  3TRE A;  1WOC A;  1JE5 A;  3J81 j;  1K73 C;  1N8R C;  1KRS A;  3M4P A;  3FKI G;  3H0G G;  1CSQ A;  3LGJ A;  4GOP B;  1IL2 A;  1JJG A;  1KRT A;  3UDF A;  1YHB A;  4X66 Q;  3HOZ G;  2NVT H;  3I4N G;  2XTI A;  3EBE A;  4DR5 L;  2F4V Q;  2B3G A;  4L5R C;  4JOI A;  1PH9 A;  1MJC A;  4BA2 I;  1HNZ Q;  4LFB L;  1LM0 A;  3L7Z C;  3BZC A;  1HNW L;  1Q7Y C;  3OYY A;  4AQY Q;  2PQA A;  1M90 C;  1KIX A;  1EFW A;  3S1M H;  2K50 A;  4JI5 Q;  4UY8 C;  1TWG H;  3S15 H;  4IPC A;  5C44 H;  3S1N H;  1VQA A;  2VUM G;  1QVC A;  4GNX C;  4C3I H;  1TWA H;  5EAY A;  3HOY H;  3GO5 A;  4NXM L;  1K8A C;  4Y52 H;  2VZA A;  1Y14 B;  5M3M G;  3S24 A;  3HOV H;  1U0L A;  3CCQ A;  1HZA A;  4YCU A;  2R6G A;  3PO3 H;  3PF4 A;  3CQZ H;  3BU2 A;  3I4M H;  1FGU A;  4NXN L;  3MXN B;  4QJF A;  1VQG A;  4C3J H;  5C4X H;  3TEH B;  4A76 A;  4A3F H;  1VQ4 A;  1EQQ A;  2IX0 A;  1NTG A;  3BZK A;  3OTO Q;  3J7Z C;  1NMF A;  4DV4 Q;  5FLM H;  1S72 A;  1XPU A;  4JI7 Q;  4EQ5 A;  2OQ0 A;  4QGU A;  1YHQ A;  1TWC H;  5BR8 L;  4JBW A;  3W1B A;  1YJN A;  1MJE A;  2IY5 B;  1NY4 A;  2NZO A;  4GOP C;  5JJK A;  4A3B G;  2HQL A;  2NN6 I;  5FJ8 H;  4UPA A;  2WB1 E;  4JBM A;  1X9N A;  3W5O A;  4DR5 Q;  2EIF A;  1IBL L;  2OQK A;  4HIK A;  4JI2 L;  4X62 L;  2UUB Q;  3PUZ A;  4GLX A;  4ME3 A;  1A63 A;  3HOY G;  1HNW Q;  1PV4 A;  4JI3 L;  4DAY B;  4KI0 A;  1NBW A;  1V9P A;  4R4Q A;  4LUO A;  5M5Y H;  2RHQ B;  2ZJP A;  2AWO A;  1DGS A;  3FP9 A;  1N9W A;  5GAE C;  4NXM Q;  1I3Q H;  2QA4 A;  2FXQ A;  4A3M H;  1Q86 C;  4WJ3 M;  4PZ8 A;  2VY3 A;  2I5H A;  1HR0 W;  2HHH L;  4YWL A;  4L5Q A;  4JCV E;  1XPR A;  5HY6 A;  4QIW E;  1VQ6 A;  1W3S A;  2B29 A;  4AH6 A;  1P8L A;  3AFP A;  1WYD A;  1BBW A;  2R7F A;  2KHJ A;  2PI2 A;  1VQ7 A;  4NXN Q;  3CW2 C;  1BBU A;  4RMF A;  4AYB G;  2UU9 L;  5JEA J;  3HKZ E;  1E24 A;  4R4O A;  4PZ7 A;  5LMN L;  4POG A;  3HOU G;  1YHA A;  1C9O A;  1WCM G;  4A4I A;  1WFQ A;  4BBR H;  5FJ8 G;  1VQM A;  1VQ5 A;  4BY1 H;  3J7A 5;  1SFO H;  4JYA L;  1YI2 A;  1L1O C;  5BR8 Q;  1L0W A;  2BA0 A;  5GAH C;  2ZTD A;  1YIT A;  4JI6 L;  4BY7 H;  2CQO A;  2CKZ B;  3HKS A;  2JA6 G;  4FDB A;  4DV5 L;  3GTJ H;  4JI4 L;  2JK8 A;  2ID0 A;  4JI2 Q;  4X62 Q;  2KHI A;  4MZ9 A;  1I50 H;  3RLO A;  1KAW A;  1TWH H;  4HJ9 A;  1KL9 A;  2RHS B;  4POF A;  4JI3 Q;  2MO1 A;  2A1A A;  1K3R A;  3CPF A;  2A19 A;  4JV5 L;  1N34 L;  1HJP A;  1O7I A;  4A3J G;  2IX1 A;  2Z0S A;  5HGQ A;  4DR6 L;  2IHF A;  4YY3 L;  1ASY A;  4OWW B;  3WWV A;  1SRU A;  1Q81 C;  4GN5 A;  1HNX Q;  1N32 Q;  1J5E L;  2CWA A;  1PHJ A;  4X64 Q;  2WP8 J;  3GTO H;  5ELO A;  1J6Q A;  4R4I A;  3TS0 A;  4BBS G;  4GOP A;  3D31 A;  5IY0 A;  1I5F A;  3FKI H;  4BXX G;  2UU9 Q;  3H3V I;  4JI0 L;  3CCS A;  5LMN Q;  1FJG L;  1PH3 A;  1HNZ L;  1K83 H;  4BY7 G;  2AWN A;  3I4N H;  1B70 B;  4JYA Q;  3I7F A;  2UXD L;  1YIJ A;  4JI8 L;  1MIU A;  4C2M H;  4GNX B;  2VQE L;  2NVY H;  1X56 A;  1T9H A;  1SN8 A;  3VDY A;  1KD1 C;  4DV7 L;  4DV5 Q;  1TWF H;  4GLA C;  3G6E A;  4JI4 Q;  3RZO H;  4UP8 A;  4JI1 L; 
#chains in the Genus database with same CATH topology
 3S1Q B;  4O0A A;  4YWK A;  1HZ9 A;  5M3M H;  4DR1 H;  3G71 A;  3NSW A;  4YCW A;  1WTR A;  4DR6 Q;  4IRK A;  5ELF A;  2WII B;  1MSH A;  3GTQ H;  2FKL A;  1B7Y B;  3S17 B;  3ERS X;  3PIO 3;  1Y1V A;  3GTK H;  2I87 A;  4OIJ A;  2R7L A;  1CTM A;  4FF3 A;  4LF4 H;  4ZYS A;  2ATW A;  4WFN 3;  1I7N A;  1Q1E A;  1STE A;  1CI3 M;  4DAM A;  3MVV A;  4EG0 A;  4M8A A;  1JDE A;  2H4O A;  1N32 H;  4JI0 Q;  5BN4 A;  4QW8 A;  1TII D;  2YYZ A;  3V05 A;  1RJR A;  1PVO A;  1LTS D;  1PH2 A;  3K58 A;  1E4E B;  1TY0 A;  4JI8 Q;  4LFA H;  3H6M A;  2ICI A;  3DMU A;  4HTH A;  4V19 0;  3G8C A;  3OSN A;  2VQE Q;  5LMN H;  4MV1 A;  4DAY A;  3MXP A;  2GLT A;  5KT4 A;  4RNN A;  1EEI D;  1Y1W A;  3I91 A;  1QJO A;  2VB2 X;  4UCR A;  2PZT A;  1O7Y A;  1PTO H;  3FVQ A;  3IFT A;  2V1C C;  4ZUI A;  1WR2 A;  3U4Z A;  2B63 B;  1IBM L;  2ZJQ A;  4LF6 L;  3R5F A;  3GTP B;  2R7Z B;  2I5L X;  4KKS A;  3N6R A;  2UXC H;  4J0M A;  3DM3 A;  1KNA A;  2AUJ D;  3HB9 A;  3U9S A;  1F2Y A;  2B2U A;  1STN A;  1PRT D;  2OH2 A;  1S40 A;  3RN2 A;  2J6S A;  1WCM H;  4ED3 A;  1EFI D;  4FVM A;  1I94 Q;  1F2Z A;  2KQ3 A;  1ZQ7 A;  2YRX A;  3CC4 A;  3KLW A;  2AMC B;  2PI2 E;  5KFH A;  1H9S B;  1Y1V G;  3PCO B;  2JE6 I;  4IUT A;  1LV9 A;  2DLN A;  2EPB A;  5C44 B;  3A8K E;  1WTP A;  2M05 A;  3QIA A;  1TA8 A;  3SXH A;  1FYC A;  4DAV A;  4A3I G;  4M9U A;  4XDX A;  1KC8 C;  4RH6 A;  4R8U A;  4DA2 A;  1STB A;  3EVQ A;  2D62 A;  2K03 A;  4X64 L;  4B3M Q;  3I70 A;  4FXD A;  5C4X B;  4C3J B;  3SEB A;  3RFC A;  2KBN A;  2UUC Q;  4ZK9 B;  2QEX A;  1JOR A;  1Y1W G;  1TY2 A;  2VQF Q;  1EIY B;  3RN5 A;  4UCS A;  1CA5 A;  3OIP A;  3DXJ C;  3NXW A;  4GNX A;  5KT7 A;  4DV6 H;  2B2Y C;  2F0Q A;  2KVM A;  4X3S A;  1DJR D;  5ELD A;  3WDN A;  4DR1 Q;  1OXS C;  4EVO A;  3S16 B;  1LT6 D;  1I6H H;  1SYX B;  3I73 A;  3CCE A;  3GD7 A;  1EEF D;  5D1P A;  1MI2 A;  5LMN W;  3A56 A;  1SYB A;  3D4D A;  4MTK A;  4NDX A;  5EPL A;  4CDC C;  3SVM A;  1S3O A;  4R4T A;  4H13 C;  5K2M A;  3PVX A;  1TS3 A;  4LF4 Q;  1GJX A;  1O7Z A;  4APM A;  1C0A A;  5IP9 H;  1EUD B;  2SNM A;  5DAU A;  2GPW A;  4C56 C;  2LXK A;  3CME A;  1PYW D;  5LMU L;  2AU0 A;  1TU2 B;  3I8Z A;  4HIO A;  3U4V A;  1G6P A;  3FRP B;  4LFA Q;  3GV3 A;  1IKM A;  3OMG A;  4DR4 L;  1UUP A;  2PZU A;  5KX5 F;  2R6F A;  3AQQ A;  4N8F A;  3RB3 A;  4J9N A;  4ILW A;  5GQO A;  5C6A A;  1K9M C;  2WKC A;  4OO1 I;  1FVI A;  3DWP A;  5COY A;  4O2B F;  1PRT F;  1I6U A;  3KDF B;  1P16 A;  2A73 B;  4KJO A;  2K28 A;  4RNO A;  1SYD A;  1G51 A;  2SOB A;  4J9S A;  5KFY A;  5KFM A;  4IN3 A;  4DV0 L;  1CKO A;  2C35 B;  5FO9 B;  2QDB A;  4JBK A;  4UCV A;  2R85 A;  4P75 A;  3T51 B;  2UXC Q;  4XTC S;  1A3V A;  2IA6 A;  3CXC A;  1BCP B;  4RHR A;  5EZY F;  1S5F D;  4JVZ A;  4ZCK A;  1YJ9 A;  3C46 A;  2E2D C;  4TSS A;  1XMQ H;  1HFN A;  5C4Z A;  3JSN A;  3N43 B;  2UVR A;  3HOX G;  4A3D G;  2R7M A;  1PRT C;  2Q8I B;  2YZG A;  4IFD G;  3I72 A;  3W1G A;  4KLK A;  2LXJ A;  5E4X A;  4EQN A;  1PZJ D;  4FF4 A;  4HCE A;  3FKI B;  1YNX A;  1MKH A;  4TUY F;  1GLV A;  1DOM A;  2PMZ A;  4P74 A;  3EPG A;  2L11 A;  1XNQ H;  1VKZ A;  1Z2P X;  1UE1 A;  5T14 A;  1K1S A;  1ZKO A;  2Z6B A;  4ZOL F;  3RAQ A;  4KHZ A;  1X55 A;  5M5W H;  4Y7N B;  4ETS A;  4DF7 A;  1RCV D;  1D5X C;  4RUC A;  1STA A;  1C30 A;  1XMO H;  2JEG A;  1OXT A;  2WAQ E;  1QWY A;  4EFE A;  1Q1B A;  1GUW A;  1X3G A;  2F4I A;  1CKN B;  1I4P A;  4FF2 A;  4DR7 H;  2HDM A;  5KT6 A;  2F0L A;  5IYD H;  1G91 A;  2Q2I A;  2JQO A;  5D1O B;  3N52 A;  1JC7 A;  1TWC A;  1FNV A;  2KCM A;  3PO2 G;  3PR4 A;  4C3H H;  1JE4 A;  4HNT A;  2AUK A;  4HMI A;  4ECY A;  3LNN A;  1IZ6 A;  2OT2 A;  3RLF A;  4DUZ L;  2W6M A;  4HNV A;  5KFE A;  4YHH H;  2E74 C;  1G29 1;  2K6A A;  2BQR A;  3KF8 B;  1EOT A;  3RIZ A;  2D0O A;  3H4B A;  2LKV A;  4DNT B;  3V96 A;  3UQ8 A;  4QUF A;  4I65 A;  2ZXR A;  2CW7 A;  3CCM A;  3WO0 A;  2W6O A;  2B2V C;  2VA2 A;  3HEJ A;  3EYY A;  2O2L D;  3J81 i;  5KFW A;  1DYQ A;  4HJ7 A;  1Q8I A;  4O3O A;  1SE8 A;  3NK9 A;  3TME A;  1I3Q A;  3GV8 B;  1N48 A;  4P73 A;  1UE7 A;  3TP8 A;  3GQC A;  1VQD A;  4DL2 A;  4KY5 A;  1VF5 C;  2VPS A;  3A8I E;  1QIL A;  4Q45 A;  2PQA B;  4UCU A;  4DL5 A;  5ELE A;  2UVW A;  1F9P A;  3V6H A;  1GYF A;  2DPJ A;  3HBL A;  1T3N A;  4OWT B;  3J80 E;  3HOV G;  5F2D A;  2E75 C;  4DUY L;  3H09 A;  1Y8O B;  1EWC A;  2PW7 A;  3M3Y B;  4YB8 B;  5C1O A;  1EIG A;  3KFU A;  3H40 A;  1VQH A;  5D3D A;  5IYB H;  2KJX A;  4EYH B;  3K6O A;  1M0W A;  3GTJ A;  1FL0 A;  1QUQ A;  5FO7 B;  5M5Y B;  5IGC A;  5IT9 c;  5DGA A;  5C3X A;  3MR5 A;  3A5U A;  1EUJ A;  4J1M A;  1I3Q B;  5KNC A;  1VF7 A;  3OTO H;  2CW0 D;  4EBC A;  3O13 A;  2K52 A;  1VQI A;  3UE0 A;  4A3G H;  3T5H A;  2WFW A;  3VMM A;  4YBZ B;  1VMP A;  3WOE A;  2EQS A;  1EWH A;  4CDF C;  4IOC A;  4ALP A;  2JA9 A;  3S14 H;  5I2X A;  4KMU C;  4CC6 A;  2MNA A;  5IYB G;  5FKA C;  2F52 A;  1AEX A;  3M7G A;  2XWB B;  4EX5 A;  5C0X I;  3TQT A;  2A8V A;  4DV2 L;  4JV0 A;  2B2W C;  3MWD A;  2QYZ A;  1XJV A;  3N41 B;  5KG3 A;  2K4K A;  5JPM C;  2Q2U A;  1NJI C;  4BY1 G;  4B3T Q;  4DR7 Q;  1VMC A;  4EEY A;  2IL8 A;  3IN5 A;  2QK4 A;  1U5K A;  4JW0 A;  1CQJ B;  4KJN A;  1BQQ T;  2EJM A;  2JXM B;  1AE2 A;  4B9X A;  4LSA A;  4RHS A;  2I0Q A;  3KBX A;  2K01 A;  3VR5 A;  1A8V A;  4LMQ D;  2V4R A;  1BOS A;  1I4Q A;  4A3K B;  3JAM i;  1H9K A;  2XIW A;  5BR8 H;  1GHK A;  4YP3 A;  2GVA A;  2FP4 B;  3Q22 A;  3HKZ B;  2B2Y A;  4DLK A;  2GVB A;  1HCZ A;  3TQY A;  2D5D A;  5JEA H;  2FB9 A;  1L2F A;  3M7N A;  3GTG H;  2F03 A;  4KHP L;  5LYJ F;  3ORQ A;  4ECV A;  5DM7 3;  1N56 A;  1VQ9 A;  2R84 A;  4MIU A;  2NU7 B;  1WOC A;  1JE5 A;  5T1I A;  1TWF B;  4XQQ A;  3LGJ A;  3SE7 A;  1JJG A;  1KJJ A;  4KKU A;  4ID6 A;  1JCK B;  2RDI A;  4KHV A;  4DR5 L;  3J80 L;  2YYA A;  2XWJ B;  2EY5 A;  2XRS D;  5CR3 A;  4L5R C;  3DEP A;  1KEE A;  2XCA A;  1C8C A;  1CA6 A;  3L7Z C;  1ESR A;  3RMH A;  2K50 A;  1TWG H;  1L0Y B;  1LT3 D;  4IPC A;  4A3E B;  3S15 H;  4C3I H;  5ISR A;  4JYA H;  5CV5 A;  5D65 A;  5C4J B;  3CCQ A;  1HZA A;  1E2Z A;  1R9T B;  1CZG A;  4EBE A;  3CQZ H;  3BU2 A;  4MV9 A;  4YQW A;  2W9B B;  4A3F H;  1VQG A;  1VQ4 A;  3TEH B;  3Q24 A;  1EQQ A;  1S5C D;  5CV7 A;  3OTO Q;  1F9R A;  3J7Z C;  4CKE A;  3J7Y W;  5C1P A;  3N40 P;  3S2H B;  3H4D A;  4QGU A;  1YHQ A;  3MR3 A;  4L63 B;  3FMA A;  4QWD A;  3R2T A;  3H20 A;  2CW0 C;  3M9M B;  3A54 A;  2NZO A;  4M7E A;  4XYL B;  5JJK A;  5FLX W;  4UPA A;  4JBM A;  1X9N A;  5LL6 b;  2O03 A;  1J5E H;  3BA9 A;  1ILQ A;  4X62 L;  1YNN D;  3SK5 A;  1A63 A;  2FFK B;  1KAB A;  4JI3 L;  1I4G A;  1C3O A;  1NBW A;  4XYM B;  2RHQ B;  1PMR A;  3MA2 B;  1SYG A;  2AWO A;  1HNZ H;  2GPS A;  2JA8 B;  2SNS A;  4KN4 C;  2QA4 A;  1JOK A;  4JI5 H;  4J9R A;  2I5H A;  4FYD A;  2A69 D;  2LFN A;  1RHP A;  2EJG C;  4KK7 A;  4MV8 A;  4A2B A;  2XGP A;  4ED8 A;  1VQ6 A;  2B29 A;  5HUR A;  1WSC A;  2L12 A;  2PI2 A;  3TP5 A;  1B33 N;  3CW2 C;  4R8N A;  1CHP D;  2UU9 L;  4IZO A;  1BCP D;  1O7L A;  1E24 A;  2R8H A;  5LMN L;  3NUC A;  3HOU G;  4A4I A;  3R2I A;  2V58 A;  5BR8 Q;  4LFC H;  2BA0 A;  1SNM A;  5GAH C;  3IAY A;  3OHB A;  1EYZ A;  4JI6 L;  2FLL A;  4RGO S;  2ZXP A;  4BY7 H;  2CQO A;  4B3S H;  3HKS A;  2K32 A;  2BCO A;  4FDB A;  5CV8 A;  4DV5 L;  2JA7 A;  3ITP A;  3GID A;  3BQ0 A;  2VUG A;  1I50 H;  3RLO A;  3CPF A;  4JV5 L;  1N34 L;  3GTM A;  4A3J G;  4ECT A;  1HNW H;  2AGP A;  2B2V A;  4GN5 A;  5CAE B;  1UNN C;  1STG A;  2NUC A;  4X64 Q;  3GTO H;  1J6Q A;  4BBS G;  4GOP A;  3D31 A;  2ZT9 C;  1B3A A;  3OW7 A;  2ZDH A;  3M4I A;  4BY7 G;  4JYA Q;  1MZB A;  1NR4 A;  3I7F A;  2UXD L;  1WTW A;  2J7Z A;  1KNE A;  5EBD A;  5EKK A;  1JDB B;  3TDQ A;  2QEJ C;  1EQT A;  3DWA A;  4YIJ A;  3ETH A;  3T5K A;  4DV7 L;  3I90 A;  3E3X A;  4GLA C;  4JI4 Q;  4FNF A;  3RZO H;  4UP8 A;  2DJF C;  4FS2 A;  2PYK A;  3NEM A;  1BGW A;  2K5N A;  1FNW A;  3NWS A;  4NKL A;  5IOC A;  1UWV A;  5GAD C;  2YRW A;  2C5C A;  5M5X H;  3Q8S B;  1RDP D;  4LJZ C;  1LTT D;  1R4Q B;  2JA7 G;  4YY3 Q;  2R92 B;  2VW9 A;  4DV6 L;  1TS5 A;  4Q8E A;  2W6N A;  1J5E Q;  2MPM A;  4LUZ A;  1WTV A;  3U50 C;  1EHI A;  1B8A A;  3NWT A;  2UXB L;  1KDB A;  1HNX H;  1BCP F;  1PFS A;  3BVM A;  4DK6 C;  4DR4 Q;  1TAE A;  2UUB L;  4IRD A;  2QKI C;  1YNN C;  4A3B H;  2ZJT A;  4OX9 H;  1UEA B;  4HR7 A;  5IYC H;  1ILP A;  3J81 W;  3NBH B;  2EXZ A;  1I6V C;  4LF5 H;  1ONL A;  3P75 A;  1E4F T;  1K1Q A;  1KJQ A;  4ECU A;  4RU9 A;  2E2J B;  4ECX A;  5IGF A;  2NN6 H;  3ETJ A;  2A69 C;  2N88 A;  3RAX A;  2B2W A;  4P71 A;  4YWM A;  3M4O H;  1ASZ A;  4C5A A;  3QJY A;  3CCL A;  2GA4 B;  4PQX A;  5M3F B;  2JEF A;  1VQB A;  3LWU A;  5IT9 E;  5GAG C;  3MEH A;  5DM6 3;  4LFC Q;  4EFB A;  4ZKC B;  5I9P A;  2BH8 A;  4GC6 A;  2FJZ A;  3JC6 6;  4NPS A;  4X65 L;  1L1O B;  2E2I A;  2NVX A;  5DLG A;  4ZRZ A;  1LTA D;  4B3S Q;  5KFQ A;  5DLF A;  4MTN A;  1Y69 U;  2E5L Q;  1UE5 A;  3I55 A;  3T53 B;  3OWF A;  4ED1 A;  4LF8 L;  1O75 A;  2V4D A;  1BNC A;  4DR6 H;  1WI5 A;  4DFA A;  3RD4 A;  5IYC G;  1GD7 A;  4K0K Q;  2WAQ A;  2R93 A;  3K59 A;  4DL6 A;  3MFH A;  2F0K A;  3M4Y A;  4DK3 C;  2DY7 A;  3M9N B;  1XMQ L;  1QZG A;  4LUV A;  3S1M B;  2JA6 H;  2NN6 G;  3FPU B;  2M9V A;  3R93 A;  3GTL H;  3NTK A;  3CHB D;  4B08 A;  4EGJ A;  1RD9 D;  1TQO A;  5KG0 A;  2G9D A;  4GKJ Q;  1KBL A;  5K36 H;  3PO3 B;  2YZM A;  2VQE H;  2L4N A;  3C1E A;  3I4M B;  4K8J A;  3RB6 A;  3TQ1 A;  1YJW A;  1XNQ L;  1W2B A;  4QCL A;  4DV3 H;  3FDT A;  4RGN A;  3AU7 A;  1B04 A;  2MO0 A;  4IQZ A;  4CJ0 B;  1YBY A;  1WTX A;  2JEJ A;  1QCB D;  2ZJR A;  1PH1 A;  3D0F A;  4ABN A;  2YU9 H;  4GLV B;  4OIK A;  1DV2 A;  1V43 A;  2HCC A;  3KJP A;  2RDJ A;  2CH4 A;  3HFZ B;  1SJH D;  4FM9 A;  4YAJ B;  4O2D A;  1S03 G;  2DUD A;  1EU3 A;  2ES2 A;  1EUC B;  5TSS A;  1PDQ A;  3NTI A;  4CDD C;  2AHO B;  4MN3 A;  1JQY D;  4RCO A;  2FE3 A;  3TSS A;  2I80 A;  5K36 G;  3S2D H;  2L55 A;  2JA5 H;  2UUA H;  2W9A A;  2WAQ G;  2R93 G;  4QWC A;  4BWS C;  4A3M B;  1PFM A;  2CZG A;  3JAM W;  4ED2 A;  2X69 A;  2PBZ A;  2YS6 A;  4WJ4 A;  4NB3 A;  4YHH L;  4DR3 Q;  1NUC A;  5JVL A;  2PO4 A;  3OW2 A;  1SNQ A;  4OX9 Q;  4IZ8 A;  4MHE A;  3M85 A;  5E4W C;  1I4H A;  4H7B A;  3SGI A;  4LF9 L;  1JOO A;  4LF5 Q;  4RZR A;  1SBB B;  4BBR B;  1SEB D;  1VQN A;  1KC7 A;  1SFO B;  2ZM6 L;  2UUC H;  1WJJ A;  4HAE A;  5EBC A;  1V1Q A;  3OUU A;  1DZ1 A;  1PXU A;  3J80 c;  3HGB A;  1S97 A;  1NE3 A;  3KAL A;  4DUY Q;  1E4E A;  4FF1 A;  4UHV A;  3MXU A;  3T1Y H;  4ECS A;  1F9S A;  5IT9 L;  3HOW G;  3CCJ A;  2E2H H;  2JA5 G;  3DLL A;  3MJF A;  1TWH B;  3ERQ A;  1N33 H;  2A6E D;  2QIL A;  2VUM A;  3A7L A;  1OWT A;  3NTH A;  1H9R A;  2MUY A;  4IOA A;  2ASB A;  2I5M X;  2XRQ D;  3L9A X;  5FO8 B;  2F0V A;  1GSH A;  1RJQ A;  2B63 A;  4R7R A;  2MCT A;  3GTP A;  2R7Z A;  1HA5 A;  3L4K A;  1E22 A;  1VQJ A;  2IX3 A;  2F0M A;  2GN5 A;  3D3R A;  4QIW B;  4K5W A;  1DON A;  3BVZ A;  2N8N A;  4ECR A;  4TV9 F;  3A8J E;  2J0T D;  5IE8 A;  3MZ5 A;  4DV1 H;  1MGS A;  1ZXT A;  1K83 B;  1Y8P B;  3KYH C;  3STB D;  3I4N B;  4RFB A;  4B3R L;  1RJP A;  4R1J A;  1KJ9 A;  4XT3 B;  4C2M B;  1BDO A;  1H9S A;  4QQB X;  4IPH A;  2NVY B;  3UE1 A;  1IBK L;  1X3F A;  4IWX A;  3CU7 A;  3CD6 A;  3TII A;  3LWB A;  2W6P A;  2EY6 A;  4DPG A;  1Y1V H;  3PW7 A;  3VR2 A;  4DV2 Q;  4DV3 Q;  2VUM B;  5JH7 F;  2HDL A;  1XXG A;  3OMC A;  3E9I A;  2C22 A;  4A3I H;  5M3M B;  4JG2 A;  2OWO A;  2R8J A;  2PCF B;  3CCR A;  1A0I A;  4GKK H;  1LYL A;  1SR3 A;  3IFD A;  4C1N I;  4IUU A;  1EWI A;  3MFY A;  1EY0 A;  3PUV A;  2EVB A;  2EYO A;  4UP9 A;  4IPG A;  1ENA A;  2Q2T A;  4ECW A;  4HN7 A;  3S9W A;  3PW5 A;  5FOB B;  3PZP A;  2HVS A;  1Y1W H;  1EZ6 A;  2RDF A;  2B63 G;  2JSO A;  3DF7 A;  2R7Z G;  2UUA Q;  3G4S A;  2RGV A;  4MA5 A;  2Q2H A;  1F2L A;  1Q90 A;  4DR2 L;  5KFJ A;  3S1N B;  1EYC A;  4LF7 L;  4O3N A;  3HOY B;  2D0P A;  3BA8 A;  4L5T A;  1RK5 A;  5D8D A;  1D5Z C;  2OTL A;  3EIV A;  4DL3 A;  4HIM A;  3TP6 A;  4IO9 A;  3PF5 A;  1B9M A;  3MXG A;  1XNR Q;  3C1F A;  4O3P A;  1A62 A;  1V51 A;  3TRZ A;  3KHR A;  5BMV F;  4MNO A;  5JJI A;  2YV5 A;  2KEN A;  5C44 G;  1ICW A;  2SEB D;  2W6Z A;  2Y0S E;  3S16 H;  2RCN A;  3CP0 A;  3HS0 C;  4FXK C;  1NAP A;  5KFZ A;  2RGR A;  3BVG A;  1KLU D;  2FMC A;  2PW5 A;  3T1Y Q;  2F4V H;  1XPO A;  3Q8D A;  1BVS A;  5CYU A;  2P0A A;  1WCM B;  2QW7 A;  3UI2 A;  3EN2 A;  1N33 Q;  3KDF A;  5C4X G;  3BAA A;  4C3J G;  2BR0 A;  1EY5 A;  2P5Z X;  4U68 A;  1M1K C;  5FLM G;  4Y8V B;  2A6E C;  1II3 A;  3T1H L;  1GUG A;  3F2C A;  4MAM A;  1BXR A;  1DOL A;  3GP7 A;  4BS9 A;  1IHZ A;  2V59 A;  3QO2 A;  4DV1 Q;  1CM9 A;  4DV4 H;  1GOZ A;  4ECQ A;  1UE6 A;  1C7Y A;  1HR0 Q;  2L9H A;  2CCZ A;  3HOX H;  2DZD A;  4A3D H;  4A2A A;  4RKB A;  4IFD H;  2VS1 A;  1N36 Q;  3FKI A;  3STB C;  1K0S A;  2WIN B;  1HQM C;  4LWC A;  4E4T A;  5KFF A;  1ET9 A;  4L8J A;  1YNJ D;  5E7N A;  4I55 F;  3PUW A;  4KN7 C;  4DK0 A;  5G3L F;  1JB7 A;  1OXX K;  5KFU A;  1IOW A;  4KY6 A;  3ZJY C;  4HJA A;  3PMF A;  1I6H B;  4K5X A;  1KDC A;  4GKK Q;  4XX0 B;  4A3L H;  4X66 L;  1HUN A;  4OL7 A;  2C2R A;  1KQS A;  5FPO A;  4O4H F;  1Y8N B;  3RBE A;  5CV4 A;  3D8G A;  1CZW A;  1A6X A;  3M9O B;  3LML A;  2L1B A;  1CKN A;  5KNB A;  1YEZ A;  4AQY L;  3BZD B;  3RR5 A;  4JI5 L;  3QFF A;  2HVR A;  1S10 A;  5AJ3 L;  5EPK A;  1O80 A;  4JI6 Q;  5I6Y A;  5D1O A;  1TR5 A;  1JWM D;  1S0N A;  4F88 A;  4PMW A;  1EYG A;  3MFG A;  4Y7N H;  5IWA L;  3JAM E;  3PO2 H;  3GQB A;  2PN1 A;  1AUX A;  2W8L A;  3D4W A;  2E8G A;  1VQE A;  1Z2O X;  3KF8 A;  4JI7 L;  5LOV F;  4A3L G;  2AQ4 A;  1GO3 E;  1D1I A;  3HXL A;  5EWG A;  3VPD A;  1EY9 A;  1K73 C;  4ZKB B;  1N8R C;  4RAY A;  3FKI G;  5DEH A;  1IL2 A;  1UC8 A;  5A35 A;  2W9C B;  3BQ1 A;  1YHB A;  1XX8 A;  1DOK A;  4HSP A;  3H3V C;  2W57 A;  3EBE A;  2F4V Q;  1SNO A;  4JOI A;  4BA2 I;  4LFB L;  4B3T H;  1HNW L;  1Q7Y C;  2PQA A;  4XQN A;  1IW7 D;  2F0O A;  3ND8 A;  1LT4 D;  1VQA A;  2K5Q A;  2C00 A;  3OUZ A;  3JRX A;  1T5X D;  1A2T A;  3GO5 A;  4NXM L;  4Y52 H;  5IGG A;  2HJW A;  3HOV H;  2J9G A;  1A2U A;  3GV6 A;  3T5J A;  5JUM A;  3MXN B;  4QJF A;  4O4L F;  2XNA C;  3W2D A;  1NMF A;  4DV4 Q;  2RBM A;  3K5O A;  4C1N K;  2OQ0 A;  4FS1 A;  5EWF A;  1SE2 A;  1TWC H;  5M5W B;  1AZQ A;  3K3V A;  3BDC A;  4FU0 A;  1YJN A;  1FD7 D;  4FP5 D;  3GIJ A;  3G6X A;  1E2W A;  2X0S A;  4GOP C;  2FLP A;  2MGS A;  2NN6 I;  2OXP A;  5FJ8 H;  1CT1 D;  1SDF A;  1HFG A;  3W5O A;  1S5B D;  3RZD B;  1IBL L;  1V1P A;  4HIK A;  4JI2 L;  2UUB Q;  5DQG A;  4RCN A;  2KA7 A;  1KLG D;  1YNJ C;  4R4Q A;  5M5Y H;  5DNF A;  2ZJP A;  4UCO A;  4QW9 A;  4C3H B;  1FJG H;  5BPH A;  3EA6 A;  5JJZ A;  5JVH 3;  5KFO A;  1N9W A;  2WDT A;  4WJ3 M;  1I3Q H;  2FXQ A;  4ZQI A;  4PZ8 A;  2HHH L;  3RV4 A;  2F3V A;  4UFZ A;  4JCV E;  2VOB A;  5HY6 A;  4QIW E;  5CGK A;  3OSP A;  1W3S A;  1EY4 A;  1P8L A;  3AFP A;  4NXN Q;  1SMY D;  2KHJ A;  5EQ0 A;  4A93 B;  4ULL A;  5DG7 A;  4R4O A;  4POG A;  1YHA A;  4BY1 H;  1WFQ A;  3QOJ A;  5FJ8 G;  4RA8 A;  1VQM A;  5NUC A;  3BS1 A;  1L1O C;  4EYI B;  3JAM L;  2ZTD A;  2C28 A;  4J6H A;  2F0P A;  1V1P B;  3KAJ A;  2WKD A;  1CQF A;  1W6K A;  3GTJ H;  5KFP A;  3G7L A;  5C4H A;  1TVX A;  2ID0 A;  2JK8 A;  2IWH A;  2ASD A;  2K7V A;  2FJ2 A;  2DN8 A;  3HKZ A;  4HJ9 A;  1KL9 A;  1S4Z A;  2RHS B;  5C5L A;  2MO1 A;  3N42 B;  1K3R A;  4RGT A;  1B9N A;  2I8C A;  1HJP A;  2NB0 A;  1JIC A;  2Z0S A;  3R8B A;  4I7Z C;  4V0B A;  5M9O A;  4XQJ A;  1ASY A;  4DR6 L;  3AB9 A;  3WWV A;  4N9T A;  2EJF C;  1Q81 C;  1SND A;  4HED A;  4N9P A;  2CWA A;  1GSO A;  4IAJ A;  1PHJ A;  1TWF A;  2CQY A;  5J22 A;  3TS0 A;  4FXG C;  3WOF A;  4BXX G;  4ZUJ A;  2A5H A;  4JI0 L;  3KHH A;  3E5S A;  2W8K A;  3MR2 A;  1IBM H;  1WTH A;  4LF6 H;  3K5M A;  4JI8 L;  4JPB W;  1HUM A;  4ED6 A;  2F1M A;  2VQE L;  4A3G B;  2Z8L A;  1CS0 A;  1LAB A;  5LA6 F;  4B9W A;  2EYH A;  3VDY A;  2N55 A;  1CK1 A;  3EPI A;  1KD1 C;  1TWF H;  3G6E A;  1JWS D;  2DY8 A;  3IRB A;  4QL5 A;  4U67 3;  2W7P A;  3QR8 A;  1R9T A;  2B2T C;  1E1T A;  2ZTE A;  4MA0 A;  1GVP A;  1PH4 A;  2W9B A;  1LTI D;  5FLX c;  3OPO A;  4TQU S;  1FR3 A;  1RYS A;  4QY7 A;  4I7H A;  3SHL A;  1NR2 A;  4A3K G;  4EGQ A;  3CC2 A;  1SAP A;  1SCU B;  3HKZ G;  3OHA A;  2K33 A;  3RNU A;  3AFQ A;  4WBN F;  3F8N A;  2KUM A;  2R82 A;  3S1R H;  1I94 L;  3RJ0 A;  1ICF B;  1FKA H;  3E6Z X;  4X64 H;  1OXV A;  1FJG Q;  1M7J A;  3Q8Q B;  1B50 A;  4NW2 A;  3A7A B;  3MEF A;  5J2T F;  1EZ8 A;  5KFA A;  4IR9 A;  3GIM A;  2HCI A;  4DNI A;  2JJQ A;  1JX4 A;  5KFC A;  1KAA A;  3PIP 3;  1PLF A;  1PH5 A;  2ZTC A;  3S2H H;  1SXT A;  1G6Z A;  1K0R A;  2F0U A;  5C0X J;  1TXY A;  2NZH A;  3E0J A;  1JJC B;  4B3M L;  1E3P A;  4JI1 Q;  3GTG B;  4J15 A;  4XYQ A;  1SMY C;  3G6J B;  2UUC L;  4JI4 H;  4A3E G;  2N78 A;  3CCU A;  4IJL A;  4PNY A;  5C3E B;  2VQF L;  2BQU A;  2WAC A;  3Q0A A;  1MBY A;  3HOU H;  4IJH A;  3ULP A;  5JQW A;  4APV A;  4YY3 H;  2JA8 H;  2FPG B;  3LWE A;  3RTX A;  4DR1 L;  1S0M A;  1V1O A;  1C4Q A;  3TZU A;  1B6S A;  4JBJ A;  5L9X A;  3BG3 A;  1TWG B;  3S15 B;  1AFP A;  1VBH A;  4DR4 H;  2AKW B;  1IBK Q;  4C3I B;  4LF4 L;  1OO9 B;  1VQO A;  1QOH A;  3VA7 A;  1E7Z A;  5I2Y A;  2H1E A;  2VL6 A;  1N32 L;  4DL7 A;  3NP8 A;  5LHY 1;  3CQZ B;  5J3B A;  4YJ2 F;  1ZET A;  4A3J H;  5H80 A;  1QVF A;  3MR6 A;  4A3F B;  4F4Z A;  1IXR A;  1IBM Q;  4LF6 Q;  4DV0 H;  1SYF A;  4LFA L;  5COR A;  3GV7 B;  3HZX A;  4P2C B;  1AE3 A;  3H94 A;  3J80 i;  1GM5 A;  2QGQ A;  3BYT B;  4BBS H;  1K8O A;  2JA8 G;  2HD3 A;  1IYU A;  3V4Z A;  2OF1 A;  4IRC A;  3MTS A;  2Q8R E;  3I4L A;  3KBG A;  1IYJ B;  3L2P A;  1PTO F;  4OXP A;  2E5L H;  1OTC A;  2Z6K C;  3E5N A;  3BG5 A;  5JVG 3;  2UXC L;  3H3V H;  2O5J C;  1SLJ A;  1X65 A;  2IJ0 A;  2Y0S A;  3V6J A;  4K0K H;  5T1G A;  3VR6 A;  3P1H A;  3K5L A;  4L6T B;  1AP0 A;  2QF7 A;  2XD4 A;  4F87 A;  5KGU A;  3N6X A;  4G7H C;  1H95 A;  1VS0 A;  3ND9 A;  3MAQ A;  2CWP A;  1JJ2 A;  4G3I A;  5KG2 A;  2XCL A;  3QZ8 A;  1HH2 P;  2DGY A;  4PMC A;  2DIK A;  2JYO A;  3A5Z B;  4Q43 A;  2R92 A;  1ROD A;  3KLS X;  1QB5 D;  1JLL B;  2JA7 H;  1JOQ A;  3R23 A;  2W71 A;  4ED7 A;  2PNR C;  2R7K A;  4GKJ H;  3I56 A;  1TKW B;  2NVQ H;  2FLN A;  4RGM A;  3ULJ A;  3P7J A;  2OLS A;  3VYU A;  1MSG A;  3NPP A;  3DM1 A;  5BPF A;  1O78 A;  1Q12 A;  3GTM H;  1B1Z A;  4CBV A;  4EGV A;  1VCI A;  3T13 A;  4BY7 B;  3NBH A;  1J8I A;  2WB1 B;  3QOL A;  1CQI B;  2R92 H;  2B8F A;  1F77 A;  2Y0S B;  4OO1 G;  4F4W A;  4G7Z C;  3PGZ A;  4WD3 A;  2C2E A;  1I50 B;  4IFD I;  2V4Q A;  1S9F A;  2MP1 A;  4DUZ H;  3CAM A;  3UDG A;  4Q0F A;  1JMC A;  1EYD A;  5KFL A;  4A3C G;  1SMX A;  3P20 A;  3PUY A;  4Q8F A;  1RYR A;  5KFT A;  1STH A;  3FMC A;  1L1O A;  3F8T A;  2HIX A;  3GTO B;  5LMU Q;  2ALY B;  1RL2 A;  1AUV A;  2ATL A;  3PSI A;  3ICE A;  3H0G B;  5C5M A;  2JEA I;  5CMD A;  4DR3 H;  3HOZ B;  3HG9 A;  1VQ8 A;  4HJ8 A;  1RK6 A;  1SRO A;  4HJ5 A;  1PYS B;  1X3P A;  2R92 G;  3CC7 A;  1XDN A;  1AW7 A;  3UFX B;  5KT3 A;  1AZP A;  4GC7 A;  3NHH A;  5FD5 A;  4O1N A;  1CE8 A;  1LTL A;  1D8L A;  4RG1 A;  3VYR A;  2VPQ A;  4DV0 Q;  2DJG C;  3RZO B;  4KV6 A;  3TBI B;  4DUY H;  2EXD A;  3NQT A;  2ZDQ A;  5EKI A;  4WJW A;  1CUK A;  5I4D A;  1IL8 A;  3KAK A;  1BCP C;  2R7D A;  3PIO A;  1B2T A;  1LT5 D;  4M1U B;  1WH2 A;  4J9Q A;  4A75 A;  2K5V A;  2XIG A;  4MV7 A;  1PA6 A;  1PH7 A;  1K28 A;  5AJ3 Q;  5LXT F;  3AEV A;  5KKN B;  3KF6 B;  2NVT B;  1BBX C;  2BH2 A;  2LS0 1;  2PQE A;  4RAU C;  5E1F A;  2V9W A;  2Z9H A;  1VQL A;  2FK3 A;  5M3F G;  1JT8 A;  1G2S A;  1TS4 A;  5IWA Q;  4CJ2 C;  1D2B A;  4A3B B;  3TP7 A;  3JAM c;  1DXM A;  2EYF A;  4XT1 B;  2XC9 A;  3KHL A;  4EBD A;  3K5N A;  2B2T A;  2E2I H;  1TWA B;  2NVX H;  3TN2 A;  3Q6S A;  3GII A;  2RSN A;  4RZQ A;  1X3Q A;  1WD0 A;  1Q82 C;  5FK9 C;  1T94 A;  5JJL A;  3A0J A;  1X54 A;  3M4O B;  4JV1 A;  2R93 H;  3AYH B;  1RTO A;  2NU9 B;  2F0H A;  2DWC A;  3KLS A;  4DV2 H;  5ELN A;  1GXD C;  3DHQ A;  2WE6 A;  4LFB Q;  2R86 A;  2AQ1 B;  5BN5 A;  1QVG A;  3K7A H;  5EPJ A;  3VR3 A;  4AYB B;  2VB3 X;  4CC5 A;  2KEC A;  1NMG A;  3K7U C;  4KD3 A;  1E4G T;  1SFO A;  1VDZ A;  4IUP A;  3PO3 G;  4G57 A;  1XMO L;  3I4M G;  1HTP A;  4UAI A;  4J9K A;  4UP7 A;  4DUZ Q;  3RGX A;  2BA1 A;  4DR7 L;  1YZ6 A;  4B3T L;  3F2D A;  4QB4 A;  1BR9 A;  2JA6 B;  3GIK A;  3HOW H;  5FLX E;  1RKN A;  1TWH A;  4LMY A;  3GTL B;  4IPD A;  2LSS A;  3BJU A;  3M9B A;  1K8G A;  1E2V A;  2BDN A;  2XN9 C;  4KHP H;  1KTK A;  1XYI A;  2BE5 D;  2K04 A;  1C48 A;  2AGQ A;  4ZI7 F;  5L37 A;  4CHT B;  4QIW A;  1BF4 A;  4JOI C;  2MHV A;  1IBL Q;  1XTC D;  1XNR H;  5IGD A;  2PVP A;  4WRD A;  3E9H A;  1PH6 A;  3KUP A;  3S1Q H;  4A3M G;  2R7N A;  1K83 A;  4OON A;  2YU9 B;  3WO1 A;  4QUC A;  4BWG B;  4DNR B;  1PH8 A;  1A15 A;  1CHQ D;  5F9L A;  4X3T A;  5KIX A;  3N44 B;  5KG5 A;  4C2M A;  4O3R A;  3JSL A;  1V8Q A;  2NVY A;  4OHJ A;  1KJ8 A;  5KFX A;  3PQI A;  1BJT A;  2YZN A;  2HHH Q;  5EOY A;  3S17 H;  3MC0 B;  2YTX A;  3X3N A;  1ET6 A;  5KG6 A;  4BBR G;  1U4L A;  4WOR A;  2EYP A;  1Q46 A;  3EJI A;  3S2D B;  2JA5 B;  5C0X G;  1S68 A;  1V4Y A;  1KHI A;  1HZC A;  4I4T F;  2YCH A;  3M4Q A;  5IGB A;  3RUZ A;  2PNH A;  3TIN A;  1EU4 A;  3B6Y A;  3QWN A;  2NTT A;  1EY7 A;  1VQC A;  3GTK A;  4UDU C;  1KDA A;  1DCZ A;  3J7A V;  3TIG A;  2KED A;  1CSP A;  2VUM H;  5CA0 F;  2WV6 D;  2Z6K A;  2EZV A;  1HZB A;  4LNQ A;  1DD2 A;  1B6R A;  1HR0 H;  2EY2 A;  1CFM A;  3KJO A;  2B63 H;  1K8M A;  3OTO L;  4UCT A;  2R7Z H;  3GTP H;  1N36 H;  3F1Z A;  4RNM A;  4X62 H;  4MTD A;  4TRD A;  3TRE A;  4JI3 H;  4IUQ A;  1KRS A;  3M4P A;  5CC4 A;  2Z4I A;  1MHW C;  4RB3 C;  2E2H B;  1PX2 A;  1KRT A;  3UDF A;  4QF4 A;  2BOS A;  4MTE A;  1GUN A;  1IYV A;  2LY7 A;  3QG1 A;  3K5H A;  3I4N G;  2ASL A;  4ZLT F;  3FEW X;  3VR4 A;  5KT5 A;  1PH9 A;  2EOT A;  2CH4 W;  3BZC A;  3GTQ B;  3HP3 A;  1M90 C;  4DU9 A;  3PW0 A;  5JOB A;  3GTK B;  3S1N H;  2UU9 H;  5C44 H;  5G3L D;  1JKJ B;  2VUM G;  1QVC A;  3SR1 A;  2EYJ A;  3OSO A;  3HOY H;  4OEM B;  1PFN A;  1K8A C;  3FDS A;  4YR0 A;  2VZA A;  1VAJ A;  1SNC A;  4HSV A;  5J1Z A;  5M3M G;  5FLX L;  1WCM A;  4ZHQ F;  3T5L A;  4J8Q A;  1DIK A;  4JI6 H;  2R6G A;  3PF4 A;  2V5A A;  3K5I A;  3J80 W;  4XXE A;  5C4X H;  4KHP Q;  4C3J H;  4A76 A;  4O3Q A;  5K5P A;  2XGQ A;  2IX0 A;  1NTG A;  4DV5 H;  2VA3 A;  1S72 A;  3IL8 A;  5FLM H;  5KG1 A;  4ZAI A;  3ERO A;  1Y1V B;  4IUN A;  5CBA E;  1PFB A;  2BE5 C;  5BR8 L;  4JBW A;  3W1B A;  1MJE A;  2IY5 B;  4JV5 H;  3T4A C;  4L1K A;  1N34 H;  1IKL A;  1PTO B;  3J81 E;  4R8I A;  2JP1 A;  3MHB A;  4A3I B;  2FK1 A;  2HQL A;  3GIP A;  4TQR A;  2WB1 E;  4OEL B;  2F0D A;  4DR5 Q;  5L1J A;  2EIF A;  5KFK A;  2OQK A;  2K5D A;  4DXG A;  3PUZ A;  4GLX A;  4ME3 A;  4NP5 A;  2RVL A;  2RQX A;  3HOY G;  2QDL A;  1PV4 A;  4QWE A;  4DAY B;  1ZHS A;  3VA5 A;  1V9P A;  2YW2 A;  1Y1W B;  4H0L C;  5L1I A;  5LL6 X;  1DGS A;  4RUA A;  5GAE C;  2UXD H;  2XVS A;  1Q86 C;  2HVQ A;  1HR0 W;  2XCP A;  1L2Z A;  4YWL A;  4L5Q A;  1XPR A;  4AH6 A;  3BJY A;  2F0S A;  1VQ7 A;  1WYD A;  1ZHQ A;  2NU8 B;  4RMF A;  4DV7 H;  5JEA J;  1QE6 A;  4EEQ A;  3D6C A;  4PZ7 A;  1C9O A;  1WCM G;  4JYA L;  5ELC A;  3I3C A;  4K6D A;  1NCV A;  3JRW A;  1TS2 A;  1YIT A;  1J9O A;  4HCS A;  3R3O A;  3R5H A;  2KSW A;  2CKZ B;  4PWQ A;  4HNU A;  2I07 B;  5IYZ F;  4JI4 L;  2F0T A;  4X62 Q;  2E76 C;  2KHI A;  1Z6H A;  2ENB A;  3Q8R B;  4POF A;  3U9T A;  4JI3 Q;  3LX0 A;  2UXB H;  3JZI A;  2RDG A;  2BDO A;  2A19 A;  4R8U B;  2UUB H;  5I9O A;  2R8K A;  3W3A A;  3OWE B;  2IX1 A;  1LTR D;  1ML0 D;  3NBI A;  5HGQ A;  4YY3 L;  4OWW B;  3GV5 B;  2F0N A;  1SRU A;  1N32 Q;  1J5E L;  4GZY C;  4I50 F;  2WP8 J;  1B53 A;  4R4I A;  1E0B A;  3J7A K;  4TKO B;  5IIF A;  2W9C A;  4G4K A;  5IY0 A;  2A74 C;  2FIN B;  3FKI H;  2UU9 Q;  3H3V I;  5LMN Q;  5A2Q W;  1PH3 A;  1HNZ L;  2F0E A;  4NXN H;  1B70 B;  1EQV A;  2ZDG A;  4HMJ A;  1MIU A;  4Z9C B;  4GNX B;  5EJW A;  4NMZ A;  3Q1K A;  1T9H A;  3D4R A;  5FPR A;  4X65 H;  3HOX B;  1SN8 A;  4F7X A;  4A3D B;  3PN1 A;  1TT2 A;  2NZ1 D;  1RF2 D;  2FMA A;  4DV5 Q;  1EYA A;  1ZEQ X;  4LF8 H;  1ENC A;  4EQO A;  5JPN C;  3AMU A;  1UEB A;  3BDO A;  3OHX C;  2MJ8 A;  1OXU A;  3TZD A;  5IP9 G;  4LFC L;  4O2A F;  1BUV T;  1LTB D;  3A55 A;  3CRK C;  3MXN A;  4JV5 Q;  1EL0 A;  1N34 Q;  3J81 L;  4CGY B;  3UDI A;  2KCT A;  4B3S L;  2YL2 A;  2E5L L;  5IGE A;  4AYB E;  4J9L A;  2EYM A;  4DKA C;  4K0K L;  2AQ2 B;  2TSS A;  1JIH A;  2M2L A;  3RB0 A;  1WD1 A;  3X3M A;  2Z1C A;  2KEE A;  3ER0 A;  3MWY W;  3CVZ A;  5F9N A;  5IP7 H;  5KRU A;  1GUS A;  4O4I F;  2UXD Q;  4KTA A;  3RV3 A;  2L0C A;  2RCF A;  4CDE C;  1XTD A;  1JB3 A;  1SJE D;  4MV6 A;  2XGT A;  4PG3 A;  4GKJ L;  2EDG A;  4DV7 Q;  1EZ1 A;  4TVA B;  2W70 A;  5C5J A;  3PO2 B;  2R8G A;  2F0W A;  1KJI A;  3U58 A;  2OCE A;  1EQR A;  3IKJ A;  1PZK D;  4K2L A;  2LMC B;  5KFD A;  3RZD H;  5IOD A;  3F2B A;  5FD6 A;  2K5H A;  3VYT A;  3H15 A;  2IHE A;  5I6W A;  4DV6 Q;  1M0T A;  5C3W A;  3G48 A;  2ICE C;  2NWG A;  5GRO A;  1HRJ A;  2I46 A;  3L3O C;  5CB4 F;  3M3Y H;  5IP7 G;  1EOV A;  2MQH A;  2PMZ B;  4HYK A;  2UXB Q;  4YJ3 F;  3MFI A;  5H1S E;  2QCP X;  2R87 A;  1B4O A;  3PIP A;  5HV6 A;  2MFI A;  1WTO A;  4E6I A;  2RF4 A;  4A93 H;  4K2K A;  1FNU A;  2CQA A;  4LF9 H;  1VBG A;  4XIG S;  4X6A H;  2ZM6 H;  1I7L A;  3A74 A;  3CMA A;  2X6L A;  2B8G A;  3HOV B;  5L1L A;  2HIV A;  4KD4 A;  1HNX L;  4TV8 F;  1A3T A;  4DR3 L;  2O5I C;  2EE1 A;  3SK6 A;  4OX9 L;  4IUV A;  5IYD G;  1KXL A;  5EWE A;  1LLR D;  3Q23 A;  1U4R A;  4S3S A;  5AFW A;  4LF5 L;  1S0O A;  1IOV A;  4JI1 H;  4C3H G;  4X3U A;  1Q8K A;  1TWC B;  4X65 Q;  4CKB A;  2L5T A;  4IR1 A;  4LSX A;  4BXX H;  2W7O A;  4DN4 M;  4DK1 A;  5KG4 A;  3ULL A;  4LF8 Q;  3LP8 A;  4XYO A;  3URY A;  4QWB A;  3K80 C;  4A93 G;  4MV3 A;  2AGO A;  1I4R A;  2HT1 A;  3QZ7 A;  5JAV A;  1XMQ Q;  3TS2 A;  3GIQ A;  2ALZ A;  1YVC A;  2F0F A;  4K8I A;  1RIP A;  2HUG A;  3GDE A;  1QZH A;  2SCU B;  3RBD A;  2X6G A;  4B3R H;  1Z9F A;  3G6V A;  2KCC A;  1H9M A;  1IBK H;  1UNS A;  2CW8 A;  4AIM A;  1AH9 A;  4J9O A;  1I4X A;  2WYO A;  4A3K H;  1XNQ Q;  4F4X A;  1SNP A;  5KFS A;  1X32 A;  2M00 A;  4R4C A;  3ZYY X;  3K81 C;  1PK8 A;  4BY1 B;  4U6P A;  3D6W A;  5DG9 A;  2DPI A;  5KFB A;  2ZXO A;  4F50 A;  1IW7 C;  2H5X A;  3CPW A;  4FO2 A;  3KHG A;  1UC9 A;  2C9O A;  3NEN A;  2IW3 A;  4LH7 A;  1XMO Q;  3V6K A;  1L0X B;  4RB1 A;  1M8A A;  1JWU D;  2HQE A;  3GTJ B;  1Z47 A;  4IUR A;  4DV3 L;  1QUQ B;  3BDL A;  4H44 C;  3S14 B;  3PV0 A;  5DLQ E;  3CKI B;  3PR5 B;  4ED0 A;  2CHB D;  1CKM A;  3GTG A;  1GUT A;  4P72 A;  1GKH A;  2F3W A;  3V2T A;  4A3G G;  4C5C A;  4IAL A;  1ULZ A;  4DR2 H;  4LF7 H;  3CRL C;  1ENF A;  2JEI A;  4YAK B;  4A3E H;  2YTY A;  2OTJ A;  4YHH Q;  2ASJ A;  5IT9 W;  1PTO D;  4L5S A;  4J9P A;  3VPB A;  4FBU A;  1ESF A;  5C4J H;  2R61 A;  2D2C C;  2N49 A;  2UUA L;  4LF9 Q;  4F4Y A;  1NNX A;  1X3E A;  1R9T H;  5KFR A;  1VQK A;  2FPI B;  2FPP B;  4PMB A;  2ZM6 Q;  3K0X A;  1GSA A;  5KYI A;  2A6H D;  1R4P B;  1D5M C;  3FHW A;  1TWG A;  1LUZ A;  2JN4 A;  5CBE E;  2NUA B;  5C3E H;  3BQ2 A;  3T16 A;  5KND A;  1B44 D;  5A2Q E;  3CF5 A;  4XZ3 B;  1D6E C;  2YS7 A;  5LP6 F;  1XNR L;  4F8M A;  2VXW A;  1F2M A;  2Z4H A;  2K05 A;  5GON F;  2K1B A;  4YR2 A;  1B3Q A;  3CQZ A;  5KFN A;  4RB2 C;  3MWM A;  2CFM A;  3I4O A;  5DQI A;  4C5B A;  2NU6 B;  5KFI A;  5ELB A;  4X3K A;  2FMM A;  3T1Y L;  3T1H H;  2N3S A;  2K5W A;  3NEL A;  3IG0 A;  3T56 B;  5KFG A;  4RWS C;  2FHT A;  3K8A A;  4RB0 A;  5JEA G;  3EFX D;  4FBT A;  1X6O A;  1PYB A;  1S5E D;  3S1R B;  1N33 L;  2J6U A;  1VQP A;  2KHS A;  3SI8 A;  3GIL A;  1W96 A;  1QNK A;  5LMU H;  1VQF A;  1PZI D;  2VNU D;  2F0G A;  3FPP A;  2EY1 A;  3ONA B;  4B3R Q;  5C3E G;  1SSO A;  2PPB C;  4ZQ3 A;  5EKL A;  2A68 D;  4K14 A;  4GN3 B;  2IT1 A;  4Q5V A;  3F2U A;  3N8D A;  2G5D A;  4DV1 L;  1T36 A;  1GGO A;  3KOJ A;  4DAP A;  3PUX A;  3E0E A;  5CA1 F;  4I7A A;  2J4X A;  1HR0 L;  2F0J A;  2L15 A;  3KTM A;  3MWE A;  2BQ3 A;  4LW1 A;  3RB4 A;  1M4V A;  4KKT A;  1N36 L;  3SE0 A;  1HXY D;  3VPC A;  1STY A;  2NYZ D;  4C3I G;  4X66 H;  2YTV A;  1LTG D;  4O3S A;  4YR3 A;  2B39 A;  4BA1 I;  3HOU B;  5KFV A;  1QG7 A;  4R9W A;  4TQS A;  1XWE A;  1Z2N X;  4HID A;  4A3F G;  4AQY H;  2WB1 A;  3WNZ A;  4GKK L;  2R8I A;  2K14 A;  1ZYR D;  1U4M A;  1BNZ A;  4DR2 Q;  2IPK D;  1I50 A;  4LF7 Q;  5EDW A;  1EIF A;  1BO0 A;  4DL4 A;  4OO1 H;  5IWA H;  1HHV A;  2IBK A;  3Q8P B;  3I2Z A;  4HQ6 A;  1PRT B;  4LH6 A;  1W6J A;  2Q8T A;  3C2P A;  4JI7 H;  1FGB D;  1T5E A;  3K0Y A;  4A3J B;  1PTO C;  3J81 c;  4A3C H;  5J2U F;  3L0O A;  3GTO A;  2IMW P;  4GN4 B;  1EY6 A;  4BBS B;  3H0G A;  2K75 A;  3RGZ A;  4LK1 C;  5A2Q L;  2A6H C;  5J39 A;  1BKB A;  1G8Z D;  3RLN A;  4PZ6 A;  4LFB H;  3BAB A;  4MV4 A;  1SE4 A;  5DGB A;  4PDB A;  1M6V A;  4RKL A;  5KYL A;  1A3U A;  2JEB I;  2UVU A;  4NXM H;  2F3I A;  2KOL A;  4H02 A;  1EIH A;  2DNC A;  3T1H Q;  2F4V L;  1JR0 D;  3UDX A;  2PMZ E;  3H0G H;  2RDH A;  3CCV A;  5KT2 A;  2IP4 A;  1E1O A;  2RSO A;  3HOZ H;  2B2U C;  1NSN S;  2KCN A;  2WB1 G;  1RJT A;  4OGQ C;  4OWX B;  1Q3L A;  2Y0S G;  4YCV A;  1WVL A;  3KLR A;  4KY7 A;  1G2T A;  2JA7 B;  4JC0 A;  4EQP A;  3KF6 A;  2NVQ B;  1D7Q A;  2E2J H;  3EQL C;  5D14 A;  4CJ1 B;  1U9R A;  1WTQ A;  1SEI A;  2OEO A;  3GTM B;  3PW2 A;  5M3F H;  4DV4 L;  2A68 C;  1HQR D;  1IBL H;  4G7O C;  4JI2 H;  4GS3 A;  2XSC A;  3L4J A;  4K6L A;  3NE5 B;  2SDF A;  5KG7 A;  2W6Q A;  3J81 j;  3U9O A;  1TWA A;  3H0G G;  1CSQ A;  3OOC A;  4DGZ A;  4GOP B;  5C8Y F;  3C0F B;  4X66 Q;  3HOZ G;  5CV9 A;  2NVT H;  1DV1 A;  2XTI A;  1S5D D;  2RA4 A;  2TMP A;  5HGT A;  1EY8 A;  2NBF A;  5M5X B;  2HHH H;  1F9Q A;  2B3G A;  2O4X A;  1MJC A;  2F0I A;  3DUZ A;  1HNZ Q;  1HA6 A;  3K57 A;  4Q0Y A;  1LM0 A;  1MD2 D;  3OYY A;  4AQY Q;  1KIX A;  1EFW A;  3S1M H;  4ECZ A;  4JI5 Q;  4UY8 C;  4U7C A;  5JVD F;  1LO5 D;  3H91 A;  4GNX C;  4RAZ A;  4AYB A;  1TWA H;  1BXT A;  2PZW A;  5EAY A;  4IHJ F;  1K3B C;  1SYE A;  3NQI A;  1Y14 B;  3S24 A;  1U0L A;  4YCU A;  3PO3 H;  4Q44 A;  1W93 A;  5E3F A;  1ZYR C;  3C3L A;  3I4M H;  1FGU A;  4NXN L;  2AQ3 B;  5HBR B;  4IFD J;  3BZK A;  4DXF A;  1GUO A;  1H9J A;  2VR1 A;  3G6Y A;  1XPU A;  4LAA A;  1D1K A;  4K5V A;  4JI7 Q;  2JA6 A;  4EQ5 A;  5DQH A;  4IWY A;  3GLK A;  3GTL A;  1GHJ A;  3DWQ A;  5DG8 A;  2DNE A;  1NY4 A;  1AN7 A;  4A3B G;  2FK2 A;  3SK4 A;  3OIQ A;  2WTF A;  1DM0 B;  4HR7 B;  2UVV A;  2HGS A;  3DEO A;  2D9U A;  4QMG A;  1JXL A;  1HNW Q;  3VYS A;  4KI0 A;  4LUO A;  3V4S A;  1LAC A;  4JI0 H;  3SDZ A;  2YU9 A;  1A9X A;  3FP9 A;  4NXM Q;  4A3M H;  4JI8 H;  3KXY T;  2VY3 A;  4J9M A;  3I12 A;  2R7F A;  1BBW A;  3K3P A;  5CV6 A;  1BBU A;  4AYB G;  1HPC A;  2E2I B;  3HKZ E;  2NVX B;  2CVR A;  5L1K A;  4BBR H;  1VQ5 A;  3J7A 5;  2JA5 A;  1QNU A;  1SFO H;  4PV1 C;  1YI2 A;  1HTL D;  4JUZ A;  5D3I B;  1L0W A;  4ME6 A;  5C0X H;  2WAQ B;  3QB3 A;  2R93 B;  5EGT A;  5KEE A;  3BYY B;  1SE3 A;  2J6T A;  3ORR A;  3RUP A;  2JA6 G;  4O42 A;  2VQD A;  1Z7T A;  2C2D A;  4JI2 Q;  2R3Z A;  3HRZ C;  4MZ9 A;  3K7A B;  1KAW A;  1TWH H;  3KK7 A;  5BN3 A;  3R5X A;  1UAP A;  1I94 H;  4DR5 H;  2A1A A;  3Q2O A;  4N8X 1;  4ME5 A;  3RF2 A;  4JV2 A;  1O7I A;  2EYL A;  2IHF A;  4JK1 C;  1HNX Q;  5ELO A;  2NTS A;  2E2H A;  4ODG A;  3HOW B;  1SYC A;  2G9H D;  1I5F A;  3SK8 A;  3CCS A;  1FJG L;  4B3M H;  1U4P A;  1K83 H;  1AN8 A;  2AWN A;  4CKC A;  3I4N H;  3NGD A;  3PW4 A;  1YIJ A;  5LL6 S;  4NLG A;  4C2M H;  5I47 A;  3GTQ A;  2NVY H;  1X56 A;  3J7A F;  2VQF H;  2RKS A;  4QWA A;  1CQV A;  1RTN A;  4JI1 L; 
#chains in the Genus database with same CATH homology
 3IRB A;  4QL5 A;  3NEM A;  4O0A A;  4YWK A;  1UEB A;  2K5N A;  1HZ9 A;  1E1T A;  1OXU A;  2ZTE A;  1UWV A;  1GVP A;  4LFC L;  5IP9 G;  5M3M H;  4YCW A;  5M5X H;  5GAD C;  5FLX c;  4TQU S;  3G71 A;  1PH4 A;  1N34 Q;  4JV5 Q;  4QY7 A;  4DR6 Q;  2JA7 G;  4YY3 Q;  4A3K G;  2VW9 A;  3UDI A;  2KCT A;  4DV6 L;  3CC2 A;  4B3S L;  3GTQ H;  1B7Y B;  2E5L L;  3ERS X;  4AYB E;  3GTK H;  3HKZ G;  1J5E Q;  4LUZ A;  3U50 C;  2ATW A;  3RNU A;  3AFQ A;  4DKA C;  3S1R H;  1I94 L;  4K0K L;  1B8A A;  1Q1E A;  2UXB L;  4DAM A;  1PFS A;  4DK6 C;  4DR4 Q;  1OXV A;  2UUB L;  4JI0 Q;  3ER0 A;  1FJG Q;  4A3B H;  2YYZ A;  5IP7 H;  5IYC H;  1PVO A;  3MEF A;  1PH2 A;  3NBH B;  2UXD Q;  4JI8 Q;  4DNI A;  2JJQ A;  2VQE Q;  1XTD A;  1PH5 A;  2ZTC A;  3S2H H;  2XGT A;  4PG3 A;  1K0R A;  5C0X J;  4GKJ L;  1TXY A;  4DV7 Q;  4TVA B;  2NZH A;  1JJC B;  4P71 A;  4YWM A;  1E3P A;  4B3M L;  3M4O H;  4JI1 Q;  2V1C C;  1ASZ A;  3U58 A;  4J15 A;  3U4Z A;  2OCE A;  1EQR A;  3CCL A;  1IBM L;  2ZJQ A;  2UUC L;  4LF6 L;  1VQB A;  5GAG C;  4LFC Q;  2I5L X;  3RZD H;  3F2B A;  2N78 A;  4A3E G;  3CCU A;  2BH8 A;  3DM3 A;  4IJL A;  2VQF L;  2K5H A;  3JC6 6;  4NPS A;  1L1O B;  4X65 L;  3H15 A;  2IHE A;  4DV6 Q;  4B3S Q;  3G48 A;  4MTN A;  2E5L Q;  5GRO A;  1UE5 A;  3I55 A;  1S40 A;  4LF8 L;  3RN2 A;  3HOU H;  4IJH A;  1WCM H;  3ULP A;  3M3Y H;  4APV A;  5IP7 G;  1EOV A;  1WI5 A;  2JA8 H;  2MQH A;  5IYC G;  1GD7 A;  1I94 Q;  4K0K Q;  2UXB Q;  4DR1 L;  3CC4 A;  3KLW A;  5H1S E;  2AMC B;  4DK3 C;  2PI2 E;  4JBJ A;  1XMQ L;  3PIP A;  1QZG A;  4LUV A;  1Y1V G;  2MFI A;  2JE6 I;  3PCO B;  2JA6 H;  2RF4 A;  4A93 H;  2NN6 G;  2AKW B;  1IBK Q;  3GTL H;  4XIG S;  4X6A H;  4LF4 L;  4A3I G;  1VQO A;  1KC8 C;  3A74 A;  1E7Z A;  3CMA A;  2VL6 A;  2HIV A;  4GKJ Q;  1HNX L;  1N32 L;  2D62 A;  5J3B A;  4X64 L;  4DR3 L;  4A3J H;  4B3M Q;  1QVF A;  1KXL A;  4OX9 L;  5IYD G;  1YJW A;  1XNQ L;  1IXR A;  1W2B A;  1IBM Q;  2KBN A;  2UUC Q;  4LF6 Q;  4LFA L;  2QEX A;  4LF5 L;  1AE3 A;  2MO0 A;  1Y1W G;  3J80 i;  1GM5 A;  2QGQ A;  1Q8K A;  1YBY A;  4X65 Q;  2VQF Q;  4BBS H;  2ZJR A;  2JA8 G;  1EIY B;  3RN5 A;  3D0F A;  1PH1 A;  4BXX H;  2YU9 H;  4GLV B;  1V43 A;  3ULL A;  4LF8 Q;  3KJP A;  3L2P A;  1IYJ B;  3HFZ B;  4OXP A;  4GNX A;  3K80 C;  4A93 G;  1OTC A;  4DR1 Q;  4O2D A;  1OXS C;  2DUD A;  2Z6K C;  1I6H H;  2ES2 A;  2HT1 A;  2UXC L;  3CCE A;  3GD7 A;  1XMQ Q;  3H3V H;  1SLJ A;  1X65 A;  2AHO B;  3TS2 A;  5LMN W;  1YVC A;  5K36 G;  1RIP A;  3S2D H;  1VS0 A;  1S3O A;  3GDE A;  4R4T A;  2JA5 H;  1H95 A;  2WAQ G;  1QZH A;  4LF4 Q;  2R93 G;  2CWP A;  1Z9F A;  1JJ2 A;  1C0A A;  5IP9 H;  4WJ4 A;  1HH2 P;  2DGY A;  4NB3 A;  3A5Z B;  2LXK A;  4YHH L;  3CME A;  4DR3 Q;  5LMU L;  4AIM A;  1AH9 A;  3OW2 A;  4IFD J;  4OX9 Q;  3M85 A;  2JA7 H;  4A3K H;  1XNQ Q;  4HIO A;  3U4V A;  1G6P A;  4R4C A;  3I56 A;  4LFA Q;  2NVQ H;  3SGI A;  4LF9 L;  3K81 C;  4LF5 Q;  4DR4 L;  3AQQ A;  3ULJ A;  1VQN A;  5GQO A;  1K9M C;  2ZM6 L;  4OO1 I;  1FVI A;  1WJJ A;  1V1Q A;  1Q12 A;  2H5X A;  3CPW A;  3GTM H;  3KDF B;  1VCI A;  3J80 c;  1P16 A;  1NE3 A;  3NEN A;  4DUY Q;  1XMO Q;  1G51 A;  2R92 H;  4DV0 L;  1CKO A;  1Z47 A;  2C35 B;  4DV3 L;  3HOW G;  4JBK A;  1QUQ B;  3CCJ A;  2E2H H;  2JA5 G;  4OO1 G;  3PGZ A;  4P75 A;  3DLL A;  2UXC Q;  3PV0 A;  5DLQ E;  4XTC S;  4IFD I;  3CXC A;  4IOA A;  2ASB A;  2I5M X;  1CKM A;  3CAM A;  4P72 A;  3UDG A;  1YJ9 A;  1GKH A;  4A3G G;  1JMC A;  4A3C G;  1E22 A;  1SMX A;  3HOX G;  3PUY A;  4A3D G;  1VQJ A;  4KHP Q;  4IFD G;  1L1O A;  2GN5 A;  3F8T A;  4A3E H;  2HIX A;  2YTY A;  3W1G A;  4KLK A;  4YHH Q;  5LMU Q;  2N8N A;  2ALY B;  1RL2 A;  2LXJ A;  4L5S A;  5IE8 A;  3PSI A;  3ICE A;  1YNX A;  2JEA I;  1MKH A;  5C4J H;  2N49 A;  2UUA L;  4LF9 Q;  1X3E A;  1R9T H;  3KYH C;  4P74 A;  3STB D;  1VQ8 A;  1VQK A;  4HJ8 A;  4B3R L;  1SRO A;  2ZM6 Q;  3K0X A;  4HJ5 A;  1PYS B;  2R92 G;  4R1J A;  3CC7 A;  1UE1 A;  3FHW A;  4QQB X;  4IPH A;  3UE1 A;  1IBK L;  1X3F A;  3CD6 A;  4KHZ A;  1X55 A;  1LUZ A;  4DPG A;  1LTL A;  1Y1V H;  5C3E H;  1D8L A;  4RG1 A;  5M5W H;  4DV2 Q;  3CF5 A;  4DV0 Q;  4DV3 Q;  1XNR L;  2EXD A;  3E9I A;  1OXT A;  2WAQ E;  4A3I H;  1Q1B A;  1CUK A;  4JG2 A;  2OWO A;  1X3G A;  2CFM A;  3CCR A;  1CKN B;  1A0I A;  2R7D A;  1LYL A;  3I4O A;  3PIO A;  1SR3 A;  1EWI A;  5IYD H;  3PUV A;  4A75 A;  3T1Y L;  2N3S A;  2K5V A;  2JQO A;  2Q2I A;  4UP9 A;  3NEL A;  2Q2T A;  4IPG A;  1PA6 A;  1PH7 A;  3K8A A;  2KCM A;  5AJ3 Q;  3AEV A;  5JEA G;  3KF6 B;  1Y1W H;  4C3H H;  3PO2 G;  1X6O A;  1PYB A;  1N33 L;  2BH2 A;  1VQP A;  2B63 G;  1VQL A;  1IZ6 A;  3RLF A;  5M3F G;  4DUZ L;  2R7Z G;  1JT8 A;  2UUA Q;  5IWA Q;  3G4S A;  1G29 1;  1VQF A;  2Q2H A;  3JAM c;  2VNU D;  3KF8 B;  2D0O A;  4B3R Q;  5C3E G;  4DR2 L;  4LF7 L;  2OTJ A;  3CCM A;  2E2I H;  2NVX H;  2D0P A;  4GN3 B;  2IT1 A;  4L5T A;  2OTL A;  3J81 i;  3EIV A;  4DV1 L;  4HIM A;  1Q82 C;  3KOJ A;  4IO9 A;  4HJ7 A;  5JJL A;  1SE8 A;  3PF5 A;  3A0J A;  1X54 A;  3PUX A;  3E0E A;  4P73 A;  1UE7 A;  1XNR Q;  2R93 H;  1A62 A;  3AYH B;  1HR0 L;  3TRZ A;  2L15 A;  1VQD A;  4LW1 A;  4MNO A;  2YV5 A;  5ELN A;  2KEN A;  5C44 G;  1N36 L;  5JJI A;  2PQA B;  2Y0S E;  3S16 H;  2RCN A;  2YTV A;  3CP0 A;  4LFB Q;  1QVG A;  3K7A H;  3T1Y Q;  4OWT B;  1XPO A;  3Q8D A;  1NMG A;  3K7U C;  1BVS A;  4BA1 I;  3HOV G;  3PO3 G;  4DUY L;  3EN2 A;  1XMO L;  3I4M G;  1N33 Q;  3KDF A;  4HID A;  4A3F G;  3KFU A;  5C4X G;  1VQH A;  5IYB H;  1M1K C;  4UP7 A;  5FLM G;  4DUZ Q;  4GKK L;  2BA1 A;  2K14 A;  4DR7 L;  1YZ6 A;  4B3T L;  3F2D A;  1FL0 A;  1QUQ A;  4DR2 Q;  3T1H L;  3HOW H;  4LF7 Q;  1EIF A;  5IT9 c;  3F2C A;  4IPD A;  2LSS A;  3BJU A;  3M9B A;  1K8G A;  3I2Z A;  3A5U A;  1EUJ A;  4DV1 Q;  2K52 A;  1VQI A;  3UE0 A;  4A3G H;  1UE6 A;  2WFW A;  1C7Y A;  3J81 c;  1HR0 Q;  2CCZ A;  4A3C H;  2EQS A;  3HOX H;  3L0O A;  4A3D H;  4JOI C;  4GN4 B;  2VS1 A;  1N36 Q;  1IBL Q;  4IOC A;  4ALP A;  2JA9 A;  3E9H A;  3STB C;  3S14 H;  4LWC A;  1PH6 A;  2K75 A;  3S1Q H;  4A3M G;  2MNA A;  5E7N A;  5IYB G;  3PUW A;  4OON A;  1BKB A;  3RLN A;  4PZ6 A;  1PH8 A;  2F52 A;  1JB7 A;  1OXX K;  4EX5 A;  5C0X I;  2A8V A;  3ZJY C;  4DV2 L;  4HJA A;  2HHH Q;  3S17 H;  1XJV A;  2K4K A;  4GKK Q;  2YTX A;  2Q2U A;  4A3L H;  4X66 L;  1NJI C;  4BY1 G;  4B3T Q;  4DR7 Q;  2JEB I;  4BBR G;  2F3I A;  4H02 A;  1U5K A;  3T1H Q;  1Q46 A;  1KQS A;  3UDX A;  2F4V L;  2PMZ E;  3H0G H;  3CCV A;  5C0X G;  1E1O A;  1HZC A;  1KHI A;  3HOZ H;  1AE2 A;  3M4Q A;  1CKN A;  2WB1 G;  1YEZ A;  4AQY L;  4OWX B;  2I0Q A;  3RR5 A;  2PNH A;  4JI5 L;  3B6Y A;  1A8V A;  5AJ3 L;  2Y0S G;  4YCV A;  4JI6 Q;  1VQC A;  4JC0 A;  3JAM i;  4PMW A;  1EYG A;  2GVA A;  3KF6 A;  1D7Q A;  4Y7N H;  2E2J H;  1CSP A;  2GVB A;  5IWA L;  3TQY A;  2VUM H;  3PO2 H;  2Z6K A;  4LNQ A;  1HZB A;  1L2F A;  3M7N A;  3GTG H;  4KHP L;  3KJO A;  2B63 H;  2E8G A;  1VQE A;  3OTO L;  5M3F H;  4DV4 L;  2R7Z H;  3GTP H;  3F1Z A;  4JI7 L;  4GS3 A;  1VQ9 A;  4A3L G;  1GO3 E;  3TRE A;  1WOC A;  1JE5 A;  3J81 j;  1K73 C;  1N8R C;  1KRS A;  3M4P A;  3FKI G;  3H0G G;  1CSQ A;  3LGJ A;  4GOP B;  1IL2 A;  1JJG A;  1KRT A;  3UDF A;  1YHB A;  4X66 Q;  3HOZ G;  2NVT H;  3I4N G;  2XTI A;  3EBE A;  4DR5 L;  2F4V Q;  2B3G A;  4L5R C;  4JOI A;  1PH9 A;  1MJC A;  4BA2 I;  1HNZ Q;  4LFB L;  1LM0 A;  3L7Z C;  3BZC A;  1HNW L;  1Q7Y C;  3OYY A;  4AQY Q;  2PQA A;  1M90 C;  1KIX A;  1EFW A;  3S1M H;  2K50 A;  4JI5 Q;  4UY8 C;  1TWG H;  3S15 H;  4IPC A;  5C44 H;  3S1N H;  1VQA A;  2VUM G;  1QVC A;  4GNX C;  4C3I H;  1TWA H;  5EAY A;  3HOY H;  3GO5 A;  4NXM L;  1K8A C;  4Y52 H;  2VZA A;  1Y14 B;  5M3M G;  3S24 A;  3HOV H;  1U0L A;  3CCQ A;  1HZA A;  4YCU A;  2R6G A;  3PO3 H;  3PF4 A;  3CQZ H;  3BU2 A;  3I4M H;  1FGU A;  4NXN L;  3MXN B;  4QJF A;  1VQG A;  4C3J H;  5C4X H;  3TEH B;  4A76 A;  4A3F H;  1VQ4 A;  1EQQ A;  2IX0 A;  1NTG A;  3BZK A;  3OTO Q;  3J7Z C;  1NMF A;  4DV4 Q;  5FLM H;  1S72 A;  1XPU A;  4JI7 Q;  4EQ5 A;  2OQ0 A;  4QGU A;  1YHQ A;  1TWC H;  5BR8 L;  4JBW A;  3W1B A;  1YJN A;  1MJE A;  2IY5 B;  1NY4 A;  2NZO A;  4GOP C;  5JJK A;  4A3B G;  2HQL A;  2NN6 I;  5FJ8 H;  4UPA A;  2WB1 E;  4JBM A;  1X9N A;  3W5O A;  4DR5 Q;  2EIF A;  1IBL L;  2OQK A;  4HIK A;  4JI2 L;  4X62 L;  2UUB Q;  3PUZ A;  4GLX A;  4ME3 A;  1A63 A;  3HOY G;  1HNW Q;  1PV4 A;  4JI3 L;  4DAY B;  4KI0 A;  1NBW A;  1V9P A;  4R4Q A;  4LUO A;  5M5Y H;  2RHQ B;  2ZJP A;  2AWO A;  1DGS A;  3FP9 A;  1N9W A;  5GAE C;  4NXM Q;  1I3Q H;  2QA4 A;  2FXQ A;  4A3M H;  1Q86 C;  4WJ3 M;  4PZ8 A;  2VY3 A;  2I5H A;  1HR0 W;  2HHH L;  4YWL A;  4L5Q A;  4JCV E;  1XPR A;  5HY6 A;  4QIW E;  1VQ6 A;  1W3S A;  2B29 A;  4AH6 A;  1P8L A;  3AFP A;  1WYD A;  1BBW A;  2R7F A;  2KHJ A;  2PI2 A;  1VQ7 A;  4NXN Q;  3CW2 C;  1BBU A;  4RMF A;  4AYB G;  2UU9 L;  5JEA J;  3HKZ E;  1E24 A;  4R4O A;  4PZ7 A;  5LMN L;  4POG A;  3HOU G;  1YHA A;  1C9O A;  1WCM G;  4A4I A;  1WFQ A;  4BBR H;  5FJ8 G;  1VQM A;  1VQ5 A;  4BY1 H;  3J7A 5;  1SFO H;  4JYA L;  1YI2 A;  1L1O C;  5BR8 Q;  1L0W A;  2BA0 A;  5GAH C;  2ZTD A;  1YIT A;  4JI6 L;  4BY7 H;  2CQO A;  2CKZ B;  3HKS A;  2JA6 G;  4FDB A;  4DV5 L;  3GTJ H;  4JI4 L;  2JK8 A;  2ID0 A;  4JI2 Q;  4X62 Q;  2KHI A;  4MZ9 A;  1I50 H;  3RLO A;  1KAW A;  1TWH H;  4HJ9 A;  1KL9 A;  2RHS B;  4POF A;  4JI3 Q;  2MO1 A;  2A1A A;  1K3R A;  3CPF A;  2A19 A;  4JV5 L;  1N34 L;  1HJP A;  1O7I A;  4A3J G;  2IX1 A;  2Z0S A;  5HGQ A;  4DR6 L;  2IHF A;  4YY3 L;  1ASY A;  4OWW B;  3WWV A;  1SRU A;  1Q81 C;  4GN5 A;  1HNX Q;  1N32 Q;  1J5E L;  2CWA A;  1PHJ A;  4X64 Q;  2WP8 J;  3GTO H;  5ELO A;  1J6Q A;  4R4I A;  3TS0 A;  4BBS G;  4GOP A;  3D31 A;  5IY0 A;  1I5F A;  3FKI H;  4BXX G;  2UU9 Q;  3H3V I;  4JI0 L;  3CCS A;  5LMN Q;  1FJG L;  1PH3 A;  1HNZ L;  1K83 H;  4BY7 G;  2AWN A;  3I4N H;  1B70 B;  4JYA Q;  3I7F A;  2UXD L;  1YIJ A;  4JI8 L;  1MIU A;  4C2M H;  4GNX B;  2VQE L;  2NVY H;  1X56 A;  1T9H A;  1SN8 A;  3VDY A;  1KD1 C;  4DV7 L;  4DV5 Q;  1TWF H;  4GLA C;  3G6E A;  4JI4 Q;  3RZO H;  4UP8 A;  4JI1 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...