4A3GG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3gG01
4NXNQ 1HR0Q 2WFWA 5FLMG 1IBML 4PZ7A 1AE3A 1SROA 4P74A 5GAGC 1XMOL 5M3MG 4JI0L 4HIMA 1N34Q 1HZAA 4R4OA 4A3KG 2ZTEA 1SMXA 1X56A 3G71A 2JA7H 2B3GA 2EXDA 3TREA 3F2CA 4JI4Q 1A0IA 3H0GH 4TQUS 3EBEA 1YI2A 3ICEA 4JOIC 2LXJA 5IYDG 4YWKA 2VQFL 4B3TQ 4GLAC 4HJ9A 4A3EG 2AKWB 1N34L 3G6EA 4JG2A 1K9MC 4JI2L 1TWHH 3TRZA 2MFIA 5FLXc 5AJ3Q 3I55A 1FJGL 1R9TH 3PUZA 1N32Q 4BY7G 5GADC 2AHOB 4A3LG 4AQYL 1GM5A 3CD6A 3LGJA 5GQOA 1XTDA 4GS3A 3U58A 2IHFA 2HIVA 1PH9A 1JB7A 3AFPA 5ELOA 2KHJA 4JI7L 4A3GH 4GKJL 3PO2H 4RMFA 1Y14B 1LM0A 1YVCA 3KOJA 4NPSA 1E1TA 3G4SA 2XGTA 2QEXA 3RNUA 3T1HQ 1HZ9A 1OTCA 2JE6I 1SE8A 3JC66 2B29A 4JI5Q 1CKNB 1WOCA 2HHHQ 3GTOH 4UP9A 3GTPH 1GVPA 4P73A 1IZ6A 4R1JA 4A3BG 4YCWA 3H3VH 3JAMi 2A19A 3DLLA 4DR4L 4DV1L 4JYAL 5EAYA 4OX9L 4UP8A 1EQRA 2UXBQ 1VQHA 4QJFA 4R4QA 4QQBX 2MO1A 4MTNA 1K0RA 4OONA 1H95A 2JA8H 3PF5A 1PFSA 4LFCQ 4DV2Q 4WJ4A 1VQBA 3T1YQ 4GOPA 4LF7Q 3NELA 3RN2A 2UXDQ 1CSPA 5C44G 3K8AA 3MEFA 2DUDA 4C3HH 3T1YL 4JI8L 1PH3A 4LF7L 4JOIA 1VQJA 1X3EA 3U4ZA 3HOZG 4BXXG 1I5FA 1WI5A 3RR5A 3OTOL 3CF5A 3CCMA 4UY8C 1UEBA 4YHHL 5M5XH 5LMUQ 3B6YA 1CKOA 4JYAQ 1Y1VH 4P72A 4YHHQ 4A3MG 4HJ8A 4YCVA 2K5VA 2CKZB 1D8LA 4DK6C 4KHPL 2Y0SE 2R92G 2E5LQ 5FJ8H 2WB1G 2LSSA 3EN2A 4A3JG 2B63G 2F4VL 2IHEA 2D62A 1P8LA 1L1OB 3S24A 2E2JH 3S1QH 4DNIA 3M4QA 1V1QA 2WB1E 4ME3A 2JEAI 5IE8A 3CAMA 5IP7G 4OWWB 4R4CA 4IFDJ 4NB3A 2ZJPA 1TWAH 3E0EA 4YY3Q 4A76A 3VDYA 1S72A 3S16H 2YTYA 1X9NA 4GNXA 2PI2A 2CWPA 2UU9Q 4FDBA 4NXMQ 1X6OA 3I7FA 4LWCA 1XPOA 4POGA 2N3SA 1QVFA 1JJCB 1Q12A 3T1HL 1U5KA 3HOWH 4IFDI 2Q2HA 1IXRA 3K80C 4H02A 3KJPA 1VQMA 4JI4L 4LF8Q 2H5XA 3J81i 2WAQE 5M3FH 4JI0Q 3HKZE 1HNWL 4IOAA 2F4VQ 3CC4A 1HR0L 4LF4Q 2UUAL 3A74A 3M4PA 1KC8C 4A93H 2VQFQ 4B3TL 4JI3Q 1X65A 5IYBH 3W1BA 1PH7A 3GDEA 1I94L 3U50C 3UDXA 1NJIC 2QA4A 3CMAA 4B3SL 2OQ0A 4P75A 1JE5A 4PMWA 5C4JH 3K7AH 2VUMG 3KDFA 1S3OA 4JCVE 1UE7A 4POFA 4LFCL 1S40A 2JA6G 2OWOA 3PO3H 5IWAQ 2VUMH 2N78A 3AQQA 1J6QA 1QVCA 5M5WH 1O7IA 1LTLA 5IWAL 3F8TA 5E7NA 2YYZA 1UWVA 4X64Q 1IBLQ 4L5QA 1N33Q 1Q1EA 3M7NA 4A3FH 4AIMA 2YTXA 3G48A 5IYBG 2JA5G 3CMEA 1HNWQ 4A93G 5GROA 2F52A 4A75A 1OXUA 1HJPA 5BR8Q 4DR3L 2A1AA 4ALPA 1E24A 1BBUA 1QVGA 2E2IH 1VQAA 1Q86C 2UXBL 3M9BA 1N36Q 2N49A 1FL0A 1I6HH 4YWMA 2WP8J 1HNXQ 5M3FG 1BKBA 1CKNA 2CCZA 3AFQA 3RLFA 3UDFA 1BBWA 2AWNA 4C2MH 3GTQH 4GKKL 2UUAQ 2VS1A 3W5OA 5IT9c 4UPAA 3PUVA 4GN4B 1EFWA 2BH2A 4K0KL 3I4OA 4AQYQ 2Z6KC 4GN3B 4AH6A 4LF9L 2HT1A 1GO3E 4DR7L 2I5LX 3HOXG 1T9HA 1PH5A 4DR6Q 1KIXA 1IBLL 5AJ3L 1G51A 1V43A 2K14A 2K52A 4LUVA 3KYHC 5C3EH 2K75A 4X66L 3CCQA 3TEHB 2L15A 1SFOH 4DR6L 2A8VA 3AEVA 3RN5A 1A8VA 2NN6G 3D0FA 5IP7H 3F1ZA 5C3EG 1PA6A 2YU9H 3K0XA 1Q8KA 4JI2Q 4IJLA 3E9HA 4DR2L 4LF6Q 3HOXH 4HJ5A 3M4OH 5JJKA 2Q2IA 2HIXA 2JK8A 3A0JA 1YHBA 2B63H 2R92H 1HZCA 5K36G 1B7YB 4MZ9A 4JI7Q 2ASBA 2GN5A 2ATWA 2UXDL 4LW1A 2ZJQA 3CXCA 4RG1A 1YJWA 1KD1C 2BA0A 4QY7A 3UDGA 3TS0A 1VQ5A 2ES2A 4LF9Q 2K4KA 2GVAA 2K5HA 1E3PA 2OTJA 1E7ZA 4DUZQ 3HOZH 3MXNB 2KENA 1YNXA 3STBD 3E9IA 5C44H 4A3FG 2JA5H 3J81c 1E22A 2VY3A 1A62A 2R6GA 3L7ZC 1YJNA 2K5NA 1N36L 3IRBA 5GAHC 2JA8G 3M3YH 3CCRA 4JI5L 2JJQA 1VQLA 3PUWA 3PO3G 2JA6H 2ZTCA 1L0WA 4O2DA 4AYBE 4YCUA 2ID0A 4LF5L 3AYHB 1VQDA 3STBC 3K7UC 4DV5L 1W2BA 2Q2TA 3A5UA 1VQFA 4L5RC 3S14H 4QGUA 3A5ZB 4DV5Q 1HR0W 1J5EL 3M85A 3CCEA 4P71A 4LF5Q 1NY4A 2NZHA 1EIYB 3H15A 5M5YH 1C9OA 4DKAC 1U0LA 4OWTB 3PO2G 4JV5Q 4DAYB 4L5SA 3UE0A 3CQZH 3PUXA 1SLJA 4R4IA 4AYBG 2VQEL 3J7A5 4A3GG 4OO1G 1OXSC 2NVYH 4QIWE 5LMNL 4OXPA 3CCSA 2RCNA 3CC2A 2ZTDA 1KQSA 1KHIA 2Y0SG 4IPCA 4JI6Q 4DR2Q 4LF6L 1KRSA 1LUZA 2MO0A 2N8NA 3BU2A 4JBMA 3S17H 2OCEA 3S2DH 1X3GA 5DLQE 3HOWG 1EWIA 4A3EH 4DR1L 1GKHA 2Z0SA 1PH4A 1Z9FA 3I2ZA 1PYSB 3RLOA 1J5EQ 4LF4L 2CQOA 5IYDH 4YWLA 3RZOH 5JJIA 3CW2C 1CKMA 4C3IH 2I0QA 1JJGA 1I50H 3KLWA 2KHIA 4JBWA 2ZM6Q 1X55A 3ZJYC 4LF8L 4A3KH 1TXYA 3S15H 2FXQA 5M3MH 4Y7NH 2PI2E 1EYGA 3ER0A 2YTVA 1XNQL 1GD7A 4LNQA 2EIFA 1X54A 4EX5A 2UUCQ 4DR5L 2Z6KA 1L1OC 4K0KQ 1NE3A 1WYDA 4JV5L 1YJ9A 4BA2I 5IYCH 4GKKQ 1OXTA 1Y1WG 4IFDG 4IO9A 3FKIG 3FP9A 5C0XG 2F3IA 1I94Q 4WJ3M 4DK3C 4A3DH 1I3QH 4A3JH 3KFUA 3HFZB 4X6AH 5FJ8G 2LXKA 1N33L 4X64L 2NVTH 4A3CG 1NMFA 2PQAA 3PSIA 4IPGA 4KI0A 2UXCQ 4A3MH 4IPHA 1Y1VG 1EUJA 2GVBA 1X3FA 4DV6L 1K73C 1VQPA 2JA9A 1WJJA 3CCVA 4HJ7A 1PH1A 4B3SQ 4BXXH 4KHPQ 1AE2A 1HH2P 1KL9A 3JAMc 1HNXL 4JC0A 2D0PA 3ULPA 1K8GA 2IX0A 2KCTA 4HIOA 1EOVA 1EQQA 1JMCA 4OX9Q 1VQNA 1L2FA 1HNZL 4DV7Q 1M1KC 2UU9L 2CWAA 1XPRA 4NXML 4B3RQ 1KRTA 1YZ6A 4LFAQ 1G6PA 3NEMA 4HIKA 3GTJH 4GLXA 1YIJA 3H3VI 1L1OA 4QL5A 2I5HA 4GNXC 2RF4A 5HY6A 4JBKA 4HIDA 1WFQA 1N8RC 1UE1A 1Q46A 1DGSA 1EIFA 3CCJA 1PV4A 1ASYA 1XNQQ 1D7QA 1VQCA 4B3MQ 5ELNA 4A3BH 4J15A 4OWXB 3J81j 3ERSX 1VQ4A 4GKJQ 4B3ML 2BA1A 3DM3A 3CPFA 5HGQA 1OXXK 2R7ZH 2VW9A 1A63A 1SRUA 4DAMA 4GN5A 1JT8A 4DV1Q 1XJVA 4A3IG 1QZGA 4A4IA 3L0OA 4PZ6A 3UE1A 4DV4L 3S2HH 1P16A 4BA1I 4Y52H 1ASZA 3D31A 1TWFH 3HOVG 1SR3A 2D0OA 1VQOA 3I4NG 4A3LH 5GAEC 4JI3L 1BVSA 4GLVB 1QUQA 3ULJA 2MNAA 3F2DA 4BY1H 1G291 4BY7H 1VQGA 4O0AA 1IYJB 2ALYB 4BBRH 5IP9G 1XMQQ 1MIUA 4JI1L 2I5MX 1VQKA 4JI8Q 4DV0Q 1C0AA 1JJ2A 1IBKQ 2E8GA 1YBYA 3EIVA 4YY3L 3H0GG 1Q7YC 1XPUA 1W3SA 1TWCH 1PH6A 2JA7G 4OO1I 1N32L 3RZDH 4DR1Q 3CCUA 2XTIA 3KF6B 4JI1Q 3GO5A 1CUKA 2WAQG 1HNZQ 2IX1A 4PZ8A 3HKZG 5FLMH 3S1RH 3HKSA 2ZJRA 1VQIA 4DV3Q 3ULLA 3KF6A 4XIGS 4JI6L 2VNUD 2JEBI 2NVQH 1YEZA 1CSQA 3FHWA 4EQ5A 4X62Q 1V9PA 2CFMA 3KDFB 5LMNW 3UDIA 5BR8L 4DR3Q 3Q8DA 4DPGA 1Q81C 2JQOA 2HHHL 2UUCL 1XMOQ 3I4MH 4UP7A 3CPWA 4IJHA 5LMUL 2BH8A 3F2BA 3BZKA 4TVAB 2V1CC 3I4MG 2IY5B 1VQ9A 1N9WA 2ZM6L 1UE5A 2R93H 1K8AC 3J80c 3BJUA 3PV0A 4BBSG 1Q82C 1IBKL 4APVA 4DV0L 3PUYA 4DV2L 1C7YA 3GTGH 4X65L 1RIPA 2KCMA 4XTCS 2OTLA 4B3RL 4DV7L 3GTKH 1VCIA 3K81C 3OYYA 2RHSB 4DV3L 2UUBQ 5JEAG 1YITA 1VQ8A 2E2HH 4JBJA 3W1GA 3PGZA 3OTOQ 3HOUH 1QZHA 1M90C 2PQAB 4DV4Q 1KXLA 1PH2A 2R7FA 2VL6A 4BBRG 1NBWA 5IP9H 3GTMH 1RL2A 2MQHA 5J3BA 1AH9A 4BY1G 3PF4A 2HQLA 5C4XG 3I4NH 3SGIA 1MJCA 3OW2A 3HOVH 3HOYG 1XMQL 3CCLA 4LFBQ 2NN6I 4KHZA 1VS0A 4A3IH 1WCMG 1PHJA 2NVXH 1VQ6A 3TS2A 4LFBL 5C0XI 1KAWA 4GOPB 4MNOA 3S1MH 1B8AA 2R7ZG 2OQKA 1WCMH 1XNRL 4DR4Q 4LFAL 1PVOA 5IY0A 1FJGQ 1LYLA 3HOYH 3PIOA 3GD7A 4PG3A 3NENA 2DGYA 3CP0A 1OXVA 4R4TA 1NTGA 3NBHB 2NZOA 4DR5Q 5C4XH 2QGQA 1FGUA 1PH8A 4C3JH 2AWOA 1XNRQ 3WWVA 3KJOA 1TWGH 1FVIA 1VQ7A 5LMNQ 2UUBL 4L5TA 4IPDA 4KLKA 4LUOA 1UE6A 3J7ZC 3HOUG 1IL2A 2K50A 4DV6Q 2PNHA 4DUYQ 1IBMQ 5JJLA 2EQSA 5JEAJ 3J80i 2E5LL 3U4VA 2UXCL 4GNXB 3GTLH 1VQEA 1HZBA 1SN8A 3PCOB 2RHQB 1YHAA 1NMGA 2KBNA 1Z47A 4IOCA 2R7DA 1QUQB 3TQYA 2IT1A 4BBSH 1MKHA 1YHQA 4LUZA 3CC7A 2AMCB 2C35B 4HJAA 2R93G 3PIPA 2VQEQ 3L2PA 3S1NH 4GOPC 1MJEA 3RLNA 1K83H 1B70B 4X65Q 4A3CH 4X62L 2YV5A 1PYBA 4DUYL 1Q1BA 4NXNL 5H1SE 4A3DG 3FKIH 4X66Q 3BZCA 2VZAA 1Y1WH 5IYCG 4DUZL 1K3RA 3KF8B 1E1OA 2Q2UA 5C0XJ 2PMZE 3I56A 4DR7Q
chains in the Genus database with same CATH superfamily
1HR0Q 3G6XA 3IAYA 5FLMG 1FNWA 1AE3A 4RAUC 5GAGC 4RB1A 5M3MG 1N34Q 4R4OA 3KHHA 1X56A 3G71A 2B3GA 3TREA 2G9HD 1AZQA 1BBXC 1DV1A 2QYZA 3H0GH 3ICEA 1I6VC 4JOIC 4K8IA 4HSVA 1BQQT 4B3TQ 4A3DB 2E2IA 2J4XA 1N34L 5JJLA 1D1KA 4JI2L 3I55A 3E5SA 4BY7G 5GADC 1GM5A 3CD6A 3LGJA 4GS3A 1H9KA 2IHFA 5I2YA 2B2VC 3S14B 1PH9A 1JB7A 4ED1A 5DLFA 1G6ZA 4NXMH 5D3DA 2C22A 2QEXA 4DL2A 1YVCA 3G4SA 3RNUA 5C5MA 3T1HQ 1B6RA 4DXFA 1OTCA 4JI5Q 1CKNB 1WOCA 3GTOH 1W93A 5EWGA 4R1JA 4YCWA 1K3BC 3H3VH 2SEBD 1HHVA 2A19A 3G6VA 1LACA 2B2YC 3RB3A 1S0MA 1HCZA 1YNND 1BCPB 3I8ZA 4QQBX 1H95A 2MO1A 4MTNA 1K0RA 5LL6b 2JA8H 4OIJA 2EYOA 1B9NA 1PFSA 1VAJA 1VQBA 2R8KA 4GOPA 3MWDA 3K7AB 1K83B 4C3HH 3T1YL 4LF7L 1KC7A 5HGTA 3HP3A 3U4ZA 2QDBA 1I5FA 3NBHA 1BCPF 1SCUB 3GIIA 2KA7A 2Z6BA 1LTGD 4YHHL 3B6YA 4JYAQ 3QIAA 4YHHQ 5CGKA 3ETJA 3NHHA 2K5VA 4RGNA 4DK6C 1M4VA 3MXUA 4FF3A 4KHPL 2B2TC 5FJ8H 1RHPA 2B63G 4K0KH 4EBEA 2A69D 4G7HC 1B2TA 5EWEA 4JV5H 3S24A 2ICIA 3S1QH 1R9TA 4DNIA 4O4IF 1V1QA 2Z4HA 4NB3A 3E0EA 4P2CB 3QZ7A 3H4BA 4OEMB 4NXMQ 1EHIA 3KXYT 1HQMC 2W8LA 1QE6A 1XPOA 3GIQA 1S5BD 2B2UA 4I50F 1QVFA 1JJCB 1Q90A 3T1HL 1U5KA 3WOFA 4JI4L 1KLUD 1V8QA 3CKIB 3SK4A 4J9OA 3J81i 3EVQA 4JI0Q 4RB0A 2W57A 5C1PA 3GTPB 3DEOA 4IOAA 2J6TA 1EU3A 4KJNA 2Y0SA 2UUAL 3A74A 5LHY1 4EEYA 1TWGB 4GKKH 2YZGA 2V4RA 2R8IA 3FPPA 1X65A 1XXGA 5IYBH 4JI3Q 3U50C 3E0JA 4RGMA 5EOYA 4MV1A 4K6LA 1RK6A 5LYJF 3K7AH 4DR4H 2VUMG 1LTBD 2RKSA 5E4XA 1S3OA 3PW7A 2KEDA 2D5DA 3V6HA 2XSCA 1GUNA 1J6QA 4U673 4ED8A 2F0HA 4LF9H 5M5WH 1O7IA 1LTLA 1SYGA 1SYBA 5IWAL 4O2AF 2YYZA 1UWVA 1Z2OX 4DUZH 1IKLA 2WIIB 1SE3A 3CMEA 2EDGA 5GROA 3J80W 4YAKB 1EY9A 3QOLA 4TKOB 5BR8Q 5KT7A 2I07B 4ECXA 5FK9C 1Q86C 4BWSC 2F0EA 5FD5A 1FL0A 2VXWA 1A3VA 4YWMA 4JPBW 1HNXQ 5M3FG 2F0PA 5C4XB 4XQNA 2YU9A 2A6ED 1XYIA 1LO5D 5E1FA 1Z6HA 1ENAA 3GTQH 2VS1A 4GKKL 3OSNA 4GN4B 3N41B 4ED7A 2Z6KC 4AH6A 2HT1A 4DR1H 5LP6F 4EG0A 1B3QA 4R7RA 4O3RA 2BCOA 1U9RA 1K0SA 3FDSA 2EXZA 1G51A 2K14A 1QB5D 5DNFA 2ATLA 1RTNA 2MP1A 2L15A 4DR6L 3TMEA 3T4AC 5KRUA 2KJXA 5C3EG 3GTOB 3V96A 4O3PA 2NU8B 4JI2Q 4MV4A 4LF6Q 5C6AA 3JSLA 4J9QA 2JA5A 4X3TA 1IHZA 2FMAA 1A2UA 3AU7A 1BNCA 5CV7A 4JI7Q 5A2QE 4ZUJA 4FYDA 2UXDL 4LW1A 4CJ2C 1YJWA 2F0LA 2RSNA 1B53A 3S9WA 2ES2A 4JI5H 4A2AA 5C4ZA 1TWAB 2KOLA 3PN1A 1PRTC 2B39A 4WRDA 1KJJA 2WB1B 2B8GA 4IURA 3V2TA 1AN7A 3STBD 1I94H 4A3FG 3GILA 1D1IA 2EY1A 2VY3A 1IBLH 5BR8H 5KFMA 5GAHC 1RD9D 2UUCH 4MTKA 1SNQA 3I91A 4TUYF 1T5EA 2E2HA 2JA6H 2HD3A 1L0WA 5J2UF 4AYBE 4RU9A 3AYHB 3BG5A 3STBC 2Q2TA 1SYFA 3E3XA 3A5UA 5KNDA 3M85A 3KBXA 4BS9A 4UFZA 1PTOB 1NY4A 1EIYB 5M5YH 4XZ3B 3MWEA 1JC7A 2CH4A 1U0LA 4OWTB 5I47A 2R93A 2F3VA 1TR5A 3VR6A 1SLJA 4KY6A 4R4IA 4AYBG 5L1KA 2NVYH 3T16A 4QIWE 4TQSA 4NP5A 4K5XA 4F7XA 4L6TB 4Z9CB 2Y0SG 4BY1B 4IPCA 3GTLB 4DR2Q 3G8CA 3BU2A 3IKJA 1EQTA 3S2DH 1KTKA 1EWIA 2R8HA 2Z0SA 1TS3A 1Z9FA 1PMRA 3RLOA 4LF4L 5IYDH 1I4PA 5LMNH 3URYA 4QW8A 5HURA 4LF8L 5DG7A 4A3KH 1PLFA 2VUMA 2R84A 3HOWB 2GPWA 4JI0H 1CFMA 3VYSA 2NVTB 4LNQA 2F0GA 1MD2D 2UUCQ 5CA1F 3CU7A 1ESRA 2KVMA 1E4GT 1B9MA 3N8DA 1EY7A 2X69A 3QFFA 1H9MA 5IYCH 1D5MC 5A35A 4IFDG 2RDIA 5C0XG 4B3MH 2Z1CA 1I94Q 2I46A 4IN3A 4DK3C 3H0GA 1I3QH 2CQAA 4A3JH 3H91A 2QEJC 4X6AH 3J81L 1N33L 1JWMD 1PX2A 5KG0A 2ALZA 2QW7A 1I50A 2PQAA 2W6MA 3W3AA 2F0JA 3GLKA 2R92A 4IUUA 4IWYA 4RUAA 1EUJA 1CA5A 3C46A 3SK6A 2DNEA 1VQPA 4HJ7A 1PH1A 4YIJA 1HH2P 4B9WA 5EKLA 1IOWA 4ECRA 1KL9A 2JA5B 4JC0A 2D0PA 3ULPA 2OXPA 1K8GA 1ENFA 2KCTA 4A3BB 1CQIB 3L4JA 4IWXA 4DV7Q 2XRSD 4B3RQ 2ZDGA 4LFAQ 4HIKA 4GLXA 4J9RA 1L1OA 2B2WA 4GNXC 2RF4A 1B6SA 4LF5H 1N8RC 2DZDA 2PBZA 2R8GA 4DL3A 1EWHA 1TVXA 4V190 4OWXB 1VQ4A 3ERSX 4GKJQ 5KKNB 5KFPA 5DGBA 2V4QA 2RCFA 1GHJA 2F0KA 1SJHD 4DU9A 5HGQA 4XQJA 2RDJA 1N32H 1NCVA 2M2LA 2VW9A 2WE6A 3MC0B 5EKIA 2WAQB 1RYSA 1PRTB 3UE1A 4ZUIA 1P16A 4XT3B 4BA1I 3D31A 3HOVG 3M9MB 2PW5A 2E2HB 3M3YB 4RB3C 1VQOA 5DM73 4A3LH 5GAEC 3DEPA 4JI3L 4DA2A 2VPSA 4ED3A 2J0TD 1G291 4O4LF 4BBRH 2VB2X 1IYJB 1KLGD 2ALYB 4O0AA 5IP9G 1XMQQ 1IOVA 2R86A 2UUBH 4KKSA 3RB0A 1VQKA 4DV0Q 4MTDA 4EBCA 1CTMA 5DM63 3DWQA 1W3SA 4OO1I 1PH6A 3E5NA 3A54A 4UHVA 2XTIA 2RBMA 3KF6B 4IUQA 1CUKA 2WAQG 2IPKD 5FO8B 2V4DA 1S4ZA 1YNNC 3SK5A 4E6IA 4K5WA 1HNZQ 1B1ZA 1MBYA 1U4MA 3DXJC 4DV4H 4KK7A 2VNUD 3OOCA 3EROA 2CFMA 1ONLA 5LMNW 4FXGC 4LH7A 3HOXB 1Q3LA 4DPGA 4IHJF 2PZWA 2QF7A 3OUZA 2VA3A 2HHHL 4I7HA 1LTID 1XMOQ 4UP7A 2A68C 4GZYC 2BE5D 1CE8A 3SHLA 2JN4A 4DV7H 3MFIA 2IY5B 2W71A 1BXTA 1VQ9A 1KJ9A 2XCLA 1K8AC 3BJUA 3PV0A 3NPPA 3TZUA 4BBSG 3VMMA 1Q82C 1BXRA 3K58A 2FK1A 4DV0L 2F1MA 3A7LA 1TY2A 3WO1A 2L0CA 2R7NA 2OTLA 4FM9A 2KUMA 3NP8A 2KQ3A 3K81C 1YITA 3H0GB 1WH2A 3QB3A 1Y8NB 3HOUH 1BCPD 2NB0A 2IJ0A 2JEIA 2FINB 2F0UA 3SEBA 2PQAB 1PH2A 4O3SA 4FF4A 3J81W 3U9OA 2JSOA 2NYZD 4RAZA 1AH9A 2Z8LA 2HQLA 2IL8A 2FJ2A 5KFDA 5C0XI 4GOPB 4MNOA 3S1MH 2R7ZG 1XNRL 1M7JA 3TBIB 3D6CA 4LMQD 4RKBA 4G3IA 3NENA 3N6RA 4R4TA 3BABA 4ECTA 2L55A 3NBHB 4DR5Q 2C2RA 1CHQD 4ZLTF 1PH8A 3SK8A 1SNMA 3WWVA 1FVIA 1VQ7A 5LMNQ 4IPDA 4MV7A 1ZEQX 1UE6A 1F9SA 3H6MA 3HOUG 4DV6Q 1X32A 3M9NB 1V1PB 3MR5A 1PRTF 4OL7A 1AW7A 3J80i 5CV5A 1GUGA 2NTTA 3LWEA 4J9LA 3R93A 5KG1A 1XMOH 1DZ1A 4FBUA 4YR2A 2OH2A 3KUPA 1QUQB 4JV0A 3RGZA 4BBSH 2UXDH 1Y8OB 3MXNA 1WD0A 1B04A 2AMCB 1BNZA 1TWCB 4RFBA 3T5HA 2VQEQ 3RLNA 4X65Q 4R8IA 4APMA 4X62L 1J8IA 3G7LA 4R8UB 4A3DG 3HRZC 5H1SE 2XCAA 1EYAA 4X66Q 3SVMA 2WINB 2VZAA 1Y1WH 2F0IA 2YZNA 2H4OA 5EBCA 4HYKA 1L0YB 4MA5A 3KF8A 3J7AK 1IBML 2BQRA 4PZ7A 2PO4A 2K5QA 4HIMA 3OHAA 1TWGA 2ZTEA 1SMXA 3RAQA 4XT1B 4JI4Q 1A0IA 3M7GA 1CQVA 1DJRD 4PDBA 5KX5F 2LXJA 1S68A 3L4KA 4YWKA 4JI7H 4A3EG 3RV4A 4JG2A 3QWNA 5EPJA 1TWHH 2A73B 2MFIA 5FLXc 1R4PB 5AJ3Q 3TRZA 5KFGA 1R9TH 2QCPX 3GTLA 3PUZA 1N32Q 4A3LG 5F9LA 4AQYL 3RUZA 5GQOA 1XTDA 1OO9B 3HZXA 4QWDA 3AMUA 1S10A 3AFPA 5ELOA 2KHJA 1QNKA 4K2KA 2R61A 4EQPA 1SE2A 3PO2H 2NU6B 4RMFA 1Y14B 2BE5C 2XN9C 1XPUA 1ILPA 1E1TA 2FP4B 2XGTA 4ODGA 2CVRA 1F9QA 2JE6I 3NWTA 2B29A 2HHHQ 4UP9A 2L9HA 1GVPA 4P73A 5LL6S 3GTPH 3FRPB 2YCHA 3RF2A 5HV6A 4WORA 5I2XA 3DLLA 1EYDA 4DR4L 4YAJB 1BCPC 1ML0D 4DV1L 3WO0A 2DJGC 4OX9L 1EZ8A 4X3UA 2XWBB 3R5XA 2IA6A 2UXBQ 1VQHA 4QJFA 4R4QA 1A6XA 4EGQA 3TIIA 5EZYF 3RV3A 4LFCQ 4IUNA 1JR0D 3I72A 2UXDQ 3MEFA 2W6QA 2A6EC 2K28A 4DR3H 3RFCA 4X65H 1WI5A 4FF1A 3RR5A 1ZXTA 3CCMA 4UY8C 5FO7B 5M5XH 1MSHA 1ZKOA 3HOVB 2XGPA 2F0WA 2X6LA 5KFJA 1EY4A 4YCVA 3TN2A 1I7LA 2SDFA 5K36H 2Y0SE 1GHKA 2R92G 2E5LQ 2V5AA 2WB1G 4A3JG 3R2IA 2IHEA 1FYCA 2NVQB 4B3TH 4IFDH 1L1OB 2WB1E 2JEAI 1OWTA 3CAMA 1GUSA 5IP7G 4R4CA 4OWWB 2ZJPA 1CK1A 1TWAH 3KLSA 4IR1A 1I3QB 3VDYA 2YTYA 4X64H 3T53B 1F2YA 3VYUA 4GNXA 1BUVT 3CRKC 2UU9Q 4G4KA 5DG8A 1Q12A 1WR2A 4Y7NB 1PZID 4MAMA 3PR5B 2XCPA 1H9RA 4MTEA 3HKZE 3KK7A 4YBZB 1IYUA 4HR7B 1EYZA 3CVZA 4RB2C 4B3SH 2BDNA 2F4VQ 1NNXA 5GONF 2O2LD 1HR0L 5CB4F 4GC6A 3EPIA 3J80E 4DAYA 1GUOA 1STNA 1GUWA 1L0XB 5IGBA 1KC8C 1LT3D 4QIWB 2I8CA 4U6PA 4B3TL 1RDPD 2CQYA 1PH7A 3W1BA 3UDXA 2UXBH 1NJIC 2N88A 3CMAA 3OHXC 1GYFA 4PMWA 1IYVA 2ZDQA 4E4TA 4JCVE 1UE7A 2JA6G 1S40A 3S16B 4FVMA 4N9TA 4UAIA 4ZQIA 1TIID 1QVCA 4ED6A 3GV8B 1G8ZD 1MHWC 3BYTB 5CV9A 5E7NA 4C3IB 1S0NA 1N33Q 3S1QB 2IX3A 3M4OB 4A3FH 5CR3A 4AIMA 3G48A 4A93G 2F52A 5KYLA 2JA6B 1DIKA 2A1AA 2E2IH 3OPOA 3OUUA 1N36Q 2I80A 4YY3H 2N49A 2N55A 1I6HH 1HR0H 2W9BA 2EYFA 2MPMA 1BKBA 4X66H 3SE0A 1FD7D 3RLFA 5CV4A 2UUAQ 1AN8A 2F4VH 2FFKB 1JOQA 4LF9L 5DG9A 1GO3E 4WFN3 1PH5A 1KIXA 3WOEA 1IBLL 3F8NA 1GSHA 2TSSA 2K52A 2OT2A 1DD2A 5KFHA 4IRCA 5C3EH 2K75A 1JXLA 2C2DA 2PW7A 3TEHB 1SFOH 4IALA 2A8VA 2HDMA 4IUTA 4NDXA 5EQ0A 2QILA 4G57A 5KFVA 4HMIA 3D0FA 1KBLA 2AU0A 3F1ZA 5ELDA 3K0XA 1Q8KA 1BR9A 1D5ZC 5C3WA 4DR2L 2K32A 2M00A 5JJKA 3MR2A 2Q2IA 4ME6A 2JK8A 1YHBA 1LTAD 3PQIA 2K5DA 2PNRC 4EGVA 2ASBA 1GSOA 4R9WA 2ATWA 4ZYSA 2RDGA 2ZJQA 1TWAA 2A5HA 3ERQA 1ET9A 3NBIA 3CRLC 4LAAA 4QY7A 3EPGA 3MXGA 1JWSD 4XXEA 4LF9Q 2GVAA 2OTJA 2KSWA 2G5DA 4C1NI 2Z9HA 3M4IA 2B63B 3HOZH 4CKCA 4A93B 1UC9A 1EEID 5C44H 3E9IA 1II3A 4CDDC 1E22A 2K7VA 4B08A 1A62A 2R6GA 2GPSA 3M3YH 4C1NK 4ECZA 3OIPA 3EQLC 3CCRA 2DY8A 2K1BA 3GQCA 2ZTCA 4JK1C 1TWCA 1SNCA 2ID0A 4LF5L 1N56A 2J6SA 4CGYB 3FKIB 4DV5L 4O3OA 1STEA 4JUZA 1VQFA 2F4IA 3JRXA 4TSSA 5KNCA 3S14H 3H3VC 3OWEB 3ETHA 4C3JB 4MA0A 5DQHA 4P71A 2FK3A 3UI2A 1K1SA 4J1MA 3H15A 2MHVA 2ASLA 4JV5Q 3UE0A 1CZWA 2VQEL 4A3GG 2EJMA 1OXSC 4AQYH 2RCNA 2VB3X 3BA9A 1HTPA 2PCFB 3MFHA 4JI6Q 3VR4A 4V0BA 2HDLA 2WV6D 4LF6L 3T1YH 1KDCA 4LF7H 3S17H 5CV6A 3PW4A 4C5AA 3EA6A 2E2IB 3I2ZA 1H9SB 1PYSB 3RTXA 1J5EQ 3G6YA 4RZQA 1EYCA 1NAPA 1CKMA 3E6ZX 3ITPA 1JJGA 4EVOA 1I50H 3KLWA 4JBWA 1JLLB 4WD3A 4F87A 1TXYA 5D1OA 4X3SA 4JYAH 2FXQA 2PI2E 1PK8A 3ER0A 1UAPA 2EIFA 3GTKB 1X54A 4EX5A 4DV5H 2YL2A 1AEXA 3R8BA 4LF4H 4BA2I 4GKKQ 1OXTA 3FP9A 4WJ3M 5BN5A 3GIJA 5M3MB 3KLRA 2Z4IA 2LXKA 5KEEA 5FJ8G 2R92B 5LOVF 1PDQA 4A3CG 2FK2A 5ISRA 4J9MA 4KI0A 1SJED 3PSIA 2PYKA 4IPHA 2AQ2B 2O4XA 3IFDA 4EFEA 2DJFC 2GVBA 1ZYRC 3UQ8A 4DV6L 2JA9A 4QCLA 1STYA 3CCVA 1K28A 3T5LA 3JAMc 1HNXL 1WTOA 3K5HA 1EOVA 1I4RA 4OX9Q 3UFXB 2FMCA 2UU9L 2CWAA 4MV9A 1C3OA 1G6PA 3NEMA 1N33H 3H3VI 3LNNA 5L1JA 1U4LA 3GV3A 5HY6A 4HIDA 3MR6A 1WFQA 1Q46A 5JJZA 4KJOA 3CCJA 3Q2OA 4KKUA 5FD6A 4J15A 3DM3A 1OXXK 1EIHA 1JT8A 2BOSA 3S2HH 4A3EB 4G7ZC 5EJWA 1ASZA 2P5ZX 5IWAH 2D0OA 2E2DC 3GV7B 1BVSA 3ULJA 1QUQA 4BY1H 3F2DA 4BY7H 2HVQA 3BAAA 3GV5B 3VR2A 3QR8A 1HFNA 3ZYYX 4RNOA 3KHRA 1JORA 1IW7C 3GTGB 4JI1L 3JRWA 2I5MX 2YRXA 5CMDA 1DYQA 4LF6H 3L9AX 2E8GA 4IRKA 4CHTB 1UUPA 2ZT9C 3H0GG 3RAXA 1STBA 2RVLA 5D65A 1N32L 4DR1Q 4JI1Q 4C2MB 5KT6A 3GO5A 2B8FA 4A3IB 2BDOA 5LMUH 3D4WA 4PZ8A 2MUYA 5FLMH 1XNQH 1NSNS 4TRDA 2ZJRA 4XIGS 3Q8SB 2NVQH 3I4NB 4EQ5A 4X62Q 3KDFB 2A74C 3NUCA 2W8KA 3Q8DA 4ID6A 2EJFC 4RZRA 3I4MH 3CPWA 4IJHA 5ELEA 2XWJB 4I4TF 1HUMA 2V1CC 3I4MG 1TQOA 1ZHQA 3GIDA 2NUAB 2ZM6L 1UE5A 2R93H 3I70A 1FNUA 3IG0A 1VF5C 3X3NA 1CS0A 2XD4A 1C7YA 3HXLA 3GTGH 3JZIA 1RIPA 2KCMA 3BQ0A 4B3RL 3Q6SA 4DV7L 3OYYA 1WTQA 3MAQA 2NUCA 3VA7A 2E2HH 3W1GA 1HNZH 2EYPA 1TS4A 1M90C 2RQXA 1KXLA 3LP8A 2JP1A 4CDCC 1FR3A 3J7AF 1TY0A 1RL2A 4C3JG 4BY1G 3H09A 5C4XG 3DHQA 3SGIA 3OW2A 1XMQL 4L8JA 5K5PA 3RD4A 3NTIA 1F9RA 1VQ6A 1WCMG 2K04A 2NVXH 2EYJA 1Y1VA 1KAWA 1Y1WA 4LFAL 1BF4A 2P0AA 4DL5A 4EYIB 4DR7H 3KLSX 3HOYH 2AQ1B 4PG3A 1QILA 3PIOA 1NTGA 5DGAA 3GTOA 3NQIA 3S1NB 4ED2A 4CC6A 3T1HH 3KJOA 1TWGH 4OHJA 5KFZA 3RBDA 3C3LA 4LUOA 3AB9A 4H0LC 4C56C 2VQDA 1N48A 4DUYQ 5JEAH 2EYLA 2F0NA 2E5LL 3BVGA 4A3FB 4J8QA 3MA2B 2UXCL 2UVVA 2NZ1D 4K2LA 1O80A 1SN8A 4K5VA 1YHAA 1NMGA 2EYMA 4EQOA 3TP6A 2F0SA 3TQYA 5L1IA 1L2ZA 1MKHA 3VR3A 4HCSA 3HKZA 4LSXA 3K5OA 1O7YA 3S1NH 3L2PA 1Z2PX 3T13A 5KIXA 1A3UA 1B70B 4A3CH 4ECUA 2EE1A 1JOOA 1PYBA 3GTPA 1JICA 3PMFA 1A2TA 4HN7A 4DUZL 1K3RA 1STHA 1E1OA 3BDLA 4J9PA 4Y8VB 5C0XJ 3CXCA 4DR7Q 4NXNQ 2WFWA 4UCTA 3OW7A 3Q1KA 4ZKCB 1SROA 4JI0L 1SYCA 3S2HB 4JV1A 1HZAA 2JA7H 2EXDA 3F2CA 1O75A 4QW9A 3EBEA 1YI2A 4ECVA 3QG1A 2VQFL 1EZ1A 4HJ9A 3VA5A 1K9MC 5C1OA 2TMPA 3SR1A 2ZJTA 1ENCA 1FKAH 3DMUA 1SBBB 4HQ6A 3U58A 5JVDF 4A3GH 4JI7L 1V1OA 4JI8H 2ENBA 1TT2A 3D6WA 2C00A 4JVZA 1E2ZA 2A69C 3JC66 2YU9B 4JV2A 3JAME 2IW3A 4I7AA 3JAMi 5FPRA 2C28A 4CC5A 1F2ZA 2X6GA 4JYAL 2KECA 5EAYA 1U4PA 2JA7A 4OONA 2O03A 3VPCA 4AYBA 3ND9A 2NTSA 5KFSA 5F9NA 3Q8PB 4NMZA 1G91A 3T1YQ 3RMHA 4LF7Q 1CSPA 5C44G 3O13A 1KJIA 2DUDA 1PH3A 4DL7A 5KG6A 4UCRA 3HOZG 1GXDC 3NWSA 3CF5A 3FPUB 2W6ZA 1UEBA 2PQEA 3ND8A 1JKJB 1SNDA 5LMUQ 5CV8A 1E4FT 3ORRA 1CKOA 4P72A 4A3MG 1D8LA 4XDXA 3A56A 2F0DA 1IKMA 2F4VL 2LSSA 3EN2A 1BDOA 4NXNH 2WYOA 1QOHA 3IFTA 2D62A 1P8LA 2E2JH 2RSOA 2NU9B 3TQTA 3M4QA 4O1NA 1QG7A 2FLLA 2CW0D 1BOSA 1S03G 3V05A 5KFRA 4YY3Q 1S72A 3GTJB 1DV2A 3MJFA 1GUTA 2LY7A 1LTSD 3I73A 3NGDA 2PI2A 5EDWA 2CWPA 4FDBA 1C48A 2GA4B 4QB4A 5L9XA 1X6OA 4K6DA 4C3IG 1RCVD 4LWCA 5IODA 1O7ZA 1X3QA 4IZOA 2CW0C 5CA0F 4ILWA 4KKTA 5JAVA 4TV8F 2Q2HA 3K80C 3KJPA 1MZBA 2L11A 3EYYA 4U68A 3OTOH 4LF8Q 2W7OA 2Y0SB 2WAQE 1MGSA 2SCUB 1HNWL 3CC4A 1B44D 4CJ1B 3PIO3 4OO1H 3NE5B 1LT5D 3M4PA 2YS6A 1M0WA 4TQRA 1KABA 5C5LA 4A93H 4F88A 4C2MA 4O3NA 1NUCA 1I94L 3GDEA 1K1QA 4L63B 2QA4A 4B3SL 1C4QA 1JE5A 4QUFA 5C4JH 3C1FA 1E2VA 1CM9A 3BDCA 3IL8A 3KDFA 3W2DA 4EQNA 4HEDA 2Q8RE 1I4QA 4LFCL 3PO3H 1T3NA 2OWOA 5IWAQ 1RJQA 1ZETA 5BMVF 4Q44A 5J22A 4X64Q 4L5QA 3SDZA 4XQQA 2JA5G 3I4MB 3LWUA 4HSPA 4KTAA 4BWGB 4A75A 4ZHQF 3NTKA 5JVH3 4ALPA 4Q0YA 5BPHA 1E24A 2W7PA 5J39A 3KHGA 4O3QA 3M9BA 3K6OA 1T94A 2WP8J 1I6UA 1CKNA 2CCZA 3AFQA 5EBDA 4C2MH 5ELBA 3W5OA 2VR1A 3TP7A 4FS1A 5C3XA 3I4OA 4AQYQ 1PFBA 4IZ8A 4ECQA 4Q43A 4FO2A 3VYRA 4DR7L 4PQXA 2I5LX 3HOXG 1T9HA 4MV6A 4PMCA 4DR6Q 2CW7A 1VMPA 1V43A 4LUVA 3P1HA 5FLXW 3KYHC 5C8YF 1RKNA 3S15B 4EGJA 3CCQA 1HA6A 4ZI7F 3GIMA 4G7OC 2RDHA 3AEVA 3HEJA 3RN5A 1A8VA 2NN6G 2YU9H 5IP7H 1PA6A 1E4EB 4FU0A 4RHRA 1WTHA 3NK9A 4DXGA 5M3FB 1HTLD 4IJLA 2XGQA 1XWEA 2EY2A 4A2BA 2HIXA 1S5DD 3A0JA 2W6PA 5KFXA 1PXUA 2Q8IB 2R92H 4JI1H 5K36G 2E75C 4Q0FA 5FOBB 2UVRA 1D6EC 5J2TF 1TS2A 4RG1A 4YJ2F 5C4JB 2BA0A 3TS0A 1VQ5A 4ZRZA 1KNEA 2DY7A 2K4KA 1E3PA 2K5HA 2WACA 4DUZQ 2W9CA 2QK4A 2XRQD 2KENA 1YNXA 3I4LA 2WB1A 3RB6A 5IGCA 2R3ZA 1TU2B 1YJNA 2K5NA 2R7KA 1N36L 3I12A 1S0OA 3BG3A 4JI5L 3C0FB 2WDTA 3GIKA 2JJQA 5EGTA 2R7ZB 3PUWA 3HKZB 4O2DA 1SYDA 1K8OA 4RHSA 1VQDA 3K5NA 4A3MB 1SSOA 4DR5H 2KCNA 1H9JA 4L5RC 3GTGA 4QGUA 3A5ZB 3M4YA 5LL6X 4RNNA 2FPGB 1GOZA 1TA8A 5BN3A 3ORQA 1C9OA 2ZXPA 3R5HA 1JDEA 4RAYA 3PO2G 4ECSA 4DAYB 3C2PA 4L5SA 1UNNC 1HPCA 1XX8A 3CQZH 2R7MA 2JA8B 5L37A 5LMNL 4OXPA 3CCSA 3GTQA 1KQSA 2CH4W 5KFQA 4CKEA 1KRSA 2MO0A 2N8NA 4MIUA 2AQ4A 2OCEA 1CHPD 1X3GA 3F2UA 4OX9H 3HOWG 4A3EH 4DR1L 1PH4A 5KFIA 4RH6A 3D8GA 2CQOA 5JJIA 3RZOH 5D1OB 2F0QA 3TQ1A 1B3AA 1F2LA 2KHIA 2ZM6Q 1X55A 2HQEA 5CORA 3ZJYC 3HOUB 5C3EB 1SAPA 1SEIA 4A3JB 4QWBA 4HTHA 4Y7NH 2YTVA 1GD7A 3L3OC 4LFAH 4Q45A 2IBKA 4DR5L 2Z6KA 3A8JE 1VBGA 2F0FA 4K0KQ 1NE3A 2AGOA 1WYDA 4JV5L 1TS5A 1YJ9A 5A2QW 5DQGA 5I6WA 1Y1WG 4IO9A 3P75A 2F3IA 1PTOH 4A3DH 4GKJH 2IWHA 3KFUA 3HFZB 4HNVA 2E74C 4X64L 4UDUC 2NVTH 1CQFA 1ESFA 1NMFA 4IPGA 4IQZA 1WTWA 2JA7B 1Y1VG 1TWFB 3HG9A 3TSSA 1SMYC 1I50B 1W6JA 1X3FA 4AYBB 1ZYRD 1WJJA 1SYEA 4BXXH 4B3SQ 1GSAA 3MHBA 1AE2A 1QWYA 5F2DA 5DLGA 3BZDB 3J7AV 2NVYB 3QO2A 1Y1WB 4HIOA 5M5XB 1KDAA 1JQYD 2V59A 4MHEA 2JEJA 4ETSA 5ELCA 1M1KC 4NXML 1XPRA 3LWBA 1KRTA 4QWAA 1ZHSA 3OIQA 1I4GA 3GTJH 1U4RA 4QL5A 1YIJA 4X62H 2ZXOA 1B4OA 3NTHA 1UE1A 1EIFA 2XVSA 1PV4A 1XNQQ 1HNXH 1PZKD 1VQCA 4H7BA 5ELNA 4A3BH 3J81j 1AUXA 2VOBA 2R87A 3PVXA 2BA1A 2ASDA 1LLRD 1ET6A 2R7ZH 2FJZA 3RGXA 4FXKC 4DAMA 4GN5A 4DV1Q 1XJVA 5KFAA 5G3LD 4A4IA 3L0OA 1QZGA 4DN4M 1EUCB 1ZQ7A 5J1ZA 4Y52H 3GTJA 5BPFA 2NBFA 1TWFH 3V4SA 1DONA 3P20A 4RNMA 2A6HC 5KG2A 4GLVB 1JX4A 4PWQA 4KHPH 2ZXRA 4YR0A 3N44B 3PO2B 1F9PA 2PMZA 4YB8B 4DV2H 4XYLB 1CZGA 4JI8Q 1EOTA 2OLSA 2FLPA 1C0AA 4YHHH 1IBKQ 1PTOC 2YZMA 3KTMA 2NVXA 1VBHA 3EIVA 2FPIB 2JEGA 2RA4A 3FKIA 3RZDH 3CCUA 2Q8TA 5JUMA 3HS0C 1O7LA 2IX1A 2L1BA 4LFCH 1DOLA 3HKSA 3U9SA 1VQIA 4DV3Q 3ULLA 3KF6A 4CBVA 2PPBC 1VMCA 4JI6L 2JEBI 2RGVA 1S5FD 1YEZA 3GP7A 2XNAC 3RZOB 3UDIA 5BR8L 2HVRA 2DNCA 2SNMA 3PW2A 5CAEB 4C5CA 2DIKA 1JIHA 4FXDA 1Y69U 3T51B 3F2BA 5KFWA 3S1RB 2MJ8A 4KN7C 3BQ2A 4GC7A 3DWAA 1N9WA 3M9OB 4ULLA 4LMYA 2DLNA 4ZAIA 3GTMA 4A3GB 1IBKL 1BJTA 2QDLA 3PUYA 5DQIA 4DV2L 1FGBD 1B33N 3JSNA 5KFOA 1IBMH 1HFGA 4X65L 3K0YA 3DWPA 1E2WA 4RGTA 5A2QL 2RHSB 3HB9A 2CW8A 3PW5A 5NUCA 1JB3A 1VQ8A 1RTOA 2A6HD 2ICEC 1KJ8A 3OTOQ 4N8FA 1CT1D 5COYA 1RJTA 3KAKA 3CQZA 3A8IE 4DV4Q 1WTRA 1VDZA 2F0OA 2FE3A 2R82A 3MEHA 5C4HA 5KG3A 2C5CA 5KFKA 2VL6A 4BBRG 5IP9H 3GTMH 4WBNF 3PF4A 3U9TA 3PIP3 1Y1VB 3HOVH 3CCLA 2NN6I 1I4XA 4KHZA 3MFYA 4DV0H 1EL0A 1VS0A 5KFLA 3VPBA 1PRTD 3I3CA 1MSGA 1B8AA 4KV6A 1TAEA 3PO3B 2XC9A 5KFBA 1PVOA 1NR4A 1FJGQ 2LKVA 3GD7A 4K14A 3CP0A 4M8AA 2NZOA 2QGQA 1FGUA 3FDTA 2NVXB 5IT9E 4HNTA 4N9PA 1XNRQ 1A9XA 1PFNA 2UUBL 2V58A 1RK5A 3R5FA 4KLKA 2C2EA 3K59A 4F8MA 3J7ZC 2K50A 4YJ3F 4DV3H 2EQSA 3OMGA 1CI3M 1TWHA 3U4VA 3GTLH 1DM0B 1VQEA 1HZBA 2PVPA 3K5IA 4MV8A 2F03A 2KBNA 1Z47A 1FNVA 2KCCA 3J7YW 4IOCA 1A3TA 4HMJA 3KHLA 1S9FA 4UCUA 1EY0A 2WAQA 3CC7A 1G2SA 2C35B 3BYYB 4HJAA 1J5EH 1MJEA 2M05A 4EYHB 4DR6H 1UEAB 2J9GA 1GJXA 4J9KA 4CDFC 2YV5A 1Q1BA 5FLXE 4Q8FA 2R7ZA 5C0XH 3BZCA 3H20A 2KHSA 5IYCG 3FEWX 3KF8B 2R85A 4F4XA 2Q2UA 3LMLA 3MWMA 3A55A 5FO9B 4XYQA 5DEHA 5I6YA 4CKBA 4P74A 2K6AA 1XMOL 3J81E 4A3KG 1O78A 1RODA 1EY8A 3JAMW 4TQUS 1MI2A 5IYDG 4GLAC 5K2MA 2HJWA 2AKWB 4DV1H 4XYOA 3G6EA 1QNUA 4ZQ3A 5CBEE 4M1UB 1FJGL 2D2CC 3D4DA 4YR3A 2AHOB 4M7EA 4DK1A 3KAJA 1KNAA 3A7AB 2J6UA 2HIVA 3WDNA 3RJ0A 2B2YA 1H9SA 2M9VA 2UU9H 3SI8A 3Q24A 4GKJL 5C5JA 4PNYA 1IBLQ 1LM0A 3NSWA 3KOJA 4NPSA 4R8NA 1XNRH 1HZ9A 1AZPA 2ZDHA 1SE8A 4LJZC 5HBRB 1IZ6A 4A3BG 2HUGA 4YQWA 3GIPA 4ZKBB 3K57A 2K05A 3OWFA 4ED0A 3NXWA 4UP8A 1EQRA 2HCCA 3HOZB 1NR2A 2CZGA 4RCNA 5CC4A 2EY5A 2QKIC 3PF5A 4DV2Q 4NKLA 5KYIA 4WJ4A 5FLXL 1W96A 3VPDA 4DK0A 3NELA 3RN2A 2FKLA 4JI3H 3TIGA 2B2UC 3K8AA 3BA8A 4JI8L 1F2MA 4JOIA 1VQJA 1X3EA 5E4WC 3PR4A 4BXXG 5IIFA 3S1MB 3OSOA 1YNJC 2FB9A 1WD1A 3OTOL 4F4WA 1HNWH 2W6NA 1EU4A 1HQRD 2E2JB 2HVSA 2RDFA 1Y1VH 1XTCD 3HBLA 1S5CD 4HJ8A 2NVYA 2CKZB 5ELFA 1C8CA 5JQWA 1Z7TA 5M5WB 5JH7F 2JXMB 1WVLA 4FS2A 4ME3A 2BQ3A 4FNFA 3FMCA 1KDBA 5IE8A 4IFDJ 1V1PA 3BDOA 3RZDB 1AFPA 4J9NA 2HHHH 1EQVA 5M9OA 4A76A 3N42B 3S16H 3KBGA 2PZTA 3BVMA 1X9NA 4EFBA 4ME5A 3I7FA 2WKCA 4POGA 2N3SA 3WNZA 3T5JA 4RCOA 2L4NA 3CHBD 3HOWH 4IFDI 1IXRA 3RIZA 4H02A 1VQMA 4HR7A 5KFTA 5D14A 4DF7A 2R7LA 1STGA 2H5XA 1QJOA 4JW0A 5M3FH 1SFOA 2KEEA 1GGOA 4R8UA 4LF4Q 3MVVA 2F3WA 3RUPA 4QIWA 1I7NA 1PZJD 3OSPA 1DCZA 2K03A 2AUJD 1F77A 1ULZA 1W6KA 5BN4A 4QWEA 3GQBA 2K5WA 2AQ3B 2VQFQ 4B3RH 4S3SA 3JAML 3HOYB 5IT9L 5IGGA 1EY6A 2GLTA 3T56B 4LSAA 2UVWA 2OQ0A 4P75A 5KT5A 1HXYD 2B2VA 4QMGA 2F0VA 1WTVA 3MZ5A 1LT6D 3GTQB 4TV9F 4XX0B 2PZUA 3R2TA 4POFA 4K8JA 4O42A 1I4HA 2VUMH 2N78A 3AQQA 4FBTA 4NLGA 1Z2NX 1STAA 3F8TA 1LV9A 1Q1EA 3M7NA 1HNWQ 5IYBG 2YTXA 1T36A 2B2TA 1OXUA 1HJPA 1TKWB 4DR3L 3V4ZA 2BR0A 3GTMB 1B50A 1BBUA 1QVGA 5I9OA 2LMCB 1XDNA 1VQAA 3SXHA 2UXBL 1EUDB 2LFNA 4KD4A 4J0MA 4F50A 5IGEA 3UDFA 1IBKH 1BBWA 2AWNA 1BGWA 1N34H 2W9BB 5IT9c 4UPAA 3PUVA 5JOBA 1EFWA 2BH2A 4K0KL 5KG4A 2E76C 5KT3A 3Q8RB 3CQZB 1WCMB 4GN3B 2NWGA 4M9UA 4DNTB 3QOJA 5AJ3L 4DR2H 3TP5A 3BS1A 2NN6H 4A3KB 3ONAB 5FKAC 4X66L 4WJWA 1E4EA 4MV3A 5KFNA 3BVZA 4EBDA 2XIWA 4ABNA 2FLNA 2ZM6H 4QUCA 5LA6F 3E9HA 2IP4A 3HOXH 4HJ5A 3M4OH 1ICFB 3IN5A 3EFXD 3D3RA 1WSCA 4MN3A 4PV1C 2LS01 4I7ZC 4B9XA 2B63H 4JI4H 1YNJD 1EWCA 2J7ZA 1HZCA 1UNSA 1B7YB 4MZ9A 5KGUA 2ASJA 2K01A 2GN5A 4IUVA 1KJQA 2UUAH 1KD1C 3UDGA 4O4HF 2W9AA 2FMMA 4QF4A 4KY5A 1E7ZA 4ZK9B 3OHBA 1TWHB 1KAAA 1EEFD 3MXNB 4C3HG 2JA5H 3J81c 2B63A 3VR5A 2G9DA 1PYWD 3L7ZC 1RJRA 3IRBA 2SNSA 2JA8G 3FMAA 4UCOA 1EZ6A 2EJGC 4HAEA 1VQLA 3PO3G 2L12A 1SFOB 4RA8A 4YCUA 3S2DB 1SDFA 3K5MA 3H40A 5C44B 3K7UC 3BJYA 1W2BA 4EEQA 1SYXB 1JWUD 5EPKA 5T1GA 5EWFA 4DV5Q 1HR0W 1X3PA 1N36H 1J5EL 3CCEA 5JVLA 2BQUA 4LF5Q 1Q8IA 1R4QB 2NZHA 4C3HB 1J9OA 4JI2H 4DKAC 5KFUA 1M8AA 4FF2A 4DUYH 3QJYA 1QCBD 3PUXA 3J7A5 4OO1G 3DF7A 5IT9W 3T5KA 1IL8A 5JVG3 3CC2A 2R93B 4J6HA 2ZTDA 4FP5D 1KHIA 1WTPA 5KT4A 4DGZA 5IYZF 5JPNC 1LUZA 4JBMA 1C30A 2A68D 5DLQE 2EPBA 1GKHA 5KG7A 2VPQA 4NW2A 4YWLA 3CW2C 4OGQC 4C3IH 2I0QA 5CYUA 3K3PA 5CBAE 3S15H 1ICWA 3J80L 5M3MH 1WTXA 2W70A 4U7CA 2CHBD 1K8MA 1EYGA 1BO0A 1XNQL 2VQEH 2VUMB 5E3FA 3TDQA 5KNBA 1L1OC 2B2WC 3OMCA 3N6XA 4UCVA 3QZ8A 3I90A 3K5LA 1V4YA 4DV6H 2R8JA 3MFGA 3FKIG 3FVQA 2D9UA 3Q8QB 1HUNA 1WCMA 3A8KE 1GLVA 2DPJA 1TWFA 1D5XC 2VA2A 2UXCQ 1AUVA 5KFCA 3Q23A 4A3MH 4RWSC 4F4YA 3Q22A 1KEEA 4IAJA 2VQFH 1K73C 2C9OA 2DWCA 5KT2A 4KHPQ 4IUPA 1SXTA 3RBEA 4J9SA 4DNRB 1G2TA 2AGPA 4QWCA 2IX0A 1EQQA 4Q8EA 1JMCA 1VQNA 4OELB 4ECYA 1L2FA 4XYMB 1HNZL 2F0MA 5D1PA 2YRWA 1YZ6A 3TZDA 2MGSA 3N43B 1HA5A 2I5HA 3KALA 5D8DA 4JBKA 5JPMC 1R9TB 2X0SA 1LTTD 4JI6H 1DGSA 2SOBA 1ASYA 1D7QA 4B3MQ 2W6OA 1EY5A 3NQTA 5IGDA 1I3QA 4B3ML 4BY7B 1S5ED 3CPFA 5KG5A 1JE4A 1SRUA 1PFMA 3EJIA 1LTRD 4RKLA 3N52A 4A3IG 4DV4L 4PZ6A 4DL4A 2O5JC 3MR3A 2RGRA 5H80A 1SR3A 2W9CB 4KD3A 1JOKA 1LT4D 2PMZB 3I4NG 2MNAA 1A63A 2AGQA 4ZOLF 4DLKA 3Q0AA 1VQGA 2IMWP 1MIUA 2F0TA 1FJGH 3DUZA 1JJ2A 1YBYA 2R6FA 2JYOA 4PMBA 5KFEA 4YY3L 1Q7YC 3C1EA 3H94A 1TWCH 2JA7G 2E5LH 3R23A 2UXCH 2EVBA 3PZPA 3HKZG 3MWYW 2K33A 3G6JB 3S1RH 4RUCA 2HGSA 4L1KA 1CSQA 3FHWA 1V9PA 1RF2D 5IGFA 2PN1A 5KFYA 5T1IA 4DR3Q 5IOCA 4LH6A 1Q81C 1RJPA 2JQOA 5KFFA 4HCEA 2UUCL 1JDBB 4LFBH 5LMUL 2BH8A 4DAPA 3BZKA 4TVAB 4ZCKA 3K3VA 3LX0A 1S97A 2AUKA 3J80c 1LABA 5AFWA 4DFAA 2JA6A 2H1EA 2FPPB 1XMQH 5G3LF 1E0BA 1EFID 3MTSA 4APVA 1D2BA 2YW2A 1SNPA 3TINA 4KN4C 4YP3A 5M5YB 1IW7D 3DM1A 1PTOF 3GV6A 4XTCS 3PW0A 3GTKH 1HRJA 1VCIA 2EY6A 4BBSB 4DV3L 2UUBQ 5JEAG 2JEFA 2EZVA 3GTKA 1EIGA 4JBJA 3PGZA 4H13C 1SNOA 1QZHA 1A15A 5EPLA 2R7FA 1VF7A 1DOKA 1NBWA 3HGBA 4N8X1 2MQHA 5J3BA 3TP8A 1Y8PB 2FHTA 3I4NH 1MJCA 1CQJB 4UCSA 3HOYG 4LFBQ 2YS7A 4C5BA 4KY7A 5T14A 4H44C 4LF8H 4RGOS 4A3IH 1PHJA 4LFBL 3TS2A 3X3MA 5TSSA 1T5XD 2OQKA 1WCMH 4DR4Q 1K83A 2WTFA 3P7JA 1AP0A 4IRDA 5IY0A 4KHVA 1V51A 1PTOD 1LYLA 2OF1A 2DGYA 1OXVA 5EKKA 1RYRA 1ILQA 5C4XH 2YYAA 4IR9A 4C3JH 2AWOA 5DAUA 4BBRB 5LXTF 4L5TA 4DAVA 4O2BF 3BQ1A 3N40P 2MCTA 4HNUA 3VYTA 4I55F 4LK1C 1IL2A 2O5IC 2VUGA 5L1LA 4I65A 2DPIA 2PNHA 1IBMQ 5JEAJ 1SMYD 3D4RA 4F4ZA 4GNXB 1CA6A 1DXMA 4KMUC 4X3KA 3H4DA 4DL6A 2XIGA 3PCOB 3SE7A 1JCKB 2RHQB 3S17B 1DOMA 5I9PA 2R7DA 1SE4A 2OEOA 5FPOA 2IT1A 1M0TA 4ECWA 1YHQA 2EOTA 4LUZA 2R93G 3V6KA 2HCIA 3V6JA 3PIPA 2I87A 1SEBD 4GOPC 2UVUA 1K83H 1VKZA 1M6VA 4OIKA 3R3OA 2NU7B 2L5TA 4Q5VA 2V9WA 4DUYL 4NXNL 2WKDA 3FKIH 2EYHA 4CJ0B 5D3IB 1I6HB 3RB4A 4CDEC 5I4DA 1UC8A 3MXPA 2DN8A 2PMZE 3I56A
chains in the Genus database with same CATH topology
4NXNQ 1HR0Q 2WFWA 5FLMG 1IBML 4PZ7A 1AE3A 1SROA 4P74A 5GAGC 1XMOL 5M3MG 4JI0L 4HIMA 1N34Q 1HZAA 4R4OA 4A3KG 2ZTEA 1SMXA 1X56A 3G71A 2JA7H 2B3GA 2EXDA 3TREA 3F2CA 4JI4Q 1A0IA 3H0GH 4TQUS 3EBEA 1YI2A 3ICEA 4JOIC 2LXJA 5IYDG 4YWKA 2VQFL 4B3TQ 4GLAC 4HJ9A 4A3EG 2AKWB 1N34L 3G6EA 4JG2A 1K9MC 4JI2L 1TWHH 3TRZA 2MFIA 5FLXc 5AJ3Q 3I55A 1FJGL 1R9TH 3PUZA 1N32Q 4BY7G 5GADC 2AHOB 4A3LG 4AQYL 1GM5A 3CD6A 3LGJA 5GQOA 1XTDA 4GS3A 3U58A 2IHFA 2HIVA 1PH9A 1JB7A 3AFPA 5ELOA 2KHJA 4JI7L 4A3GH 4GKJL 3PO2H 4RMFA 1Y14B 1LM0A 1YVCA 3KOJA 4NPSA 1E1TA 3G4SA 2XGTA 2QEXA 3RNUA 3T1HQ 1HZ9A 1OTCA 2JE6I 1SE8A 3JC66 2B29A 4JI5Q 1CKNB 1WOCA 2HHHQ 3GTOH 4UP9A 3GTPH 1GVPA 4P73A 1IZ6A 4R1JA 4A3BG 4YCWA 3H3VH 3JAMi 2A19A 3DLLA 4DR4L 4DV1L 4JYAL 5EAYA 4OX9L 4UP8A 1EQRA 2UXBQ 1VQHA 4QJFA 4R4QA 4QQBX 2MO1A 4MTNA 1K0RA 4OONA 1H95A 2JA8H 3PF5A 1PFSA 4LFCQ 4DV2Q 4WJ4A 1VQBA 3T1YQ 4GOPA 4LF7Q 3NELA 3RN2A 2UXDQ 1CSPA 5C44G 3K8AA 3MEFA 2DUDA 4C3HH 3T1YL 4JI8L 1PH3A 4LF7L 4JOIA 1VQJA 1X3EA 3U4ZA 3HOZG 4BXXG 1I5FA 1WI5A 3RR5A 3OTOL 3CF5A 3CCMA 4UY8C 1UEBA 4YHHL 5M5XH 5LMUQ 3B6YA 1CKOA 4JYAQ 1Y1VH 4P72A 4YHHQ 4A3MG 4HJ8A 4YCVA 2K5VA 2CKZB 1D8LA 4DK6C 4KHPL 2Y0SE 2R92G 2E5LQ 5FJ8H 2WB1G 2LSSA 3EN2A 4A3JG 2B63G 2F4VL 2IHEA 2D62A 1P8LA 1L1OB 3S24A 2E2JH 3S1QH 4DNIA 3M4QA 1V1QA 2WB1E 4ME3A 2JEAI 5IE8A 3CAMA 5IP7G 4OWWB 4R4CA 4IFDJ 4NB3A 2ZJPA 1TWAH 3E0EA 4YY3Q 4A76A 3VDYA 1S72A 3S16H 2YTYA 1X9NA 4GNXA 2PI2A 2CWPA 2UU9Q 4FDBA 4NXMQ 1X6OA 3I7FA 4LWCA 1XPOA 4POGA 2N3SA 1QVFA 1JJCB 1Q12A 3T1HL 1U5KA 3HOWH 4IFDI 2Q2HA 1IXRA 3K80C 4H02A 3KJPA 1VQMA 4JI4L 4LF8Q 2H5XA 3J81i 2WAQE 5M3FH 4JI0Q 3HKZE 1HNWL 4IOAA 2F4VQ 3CC4A 1HR0L 4LF4Q 2UUAL 3A74A 3M4PA 1KC8C 4A93H 2VQFQ 4B3TL 4JI3Q 1X65A 5IYBH 3W1BA 1PH7A 3GDEA 1I94L 3U50C 3UDXA 1NJIC 2QA4A 3CMAA 4B3SL 2OQ0A 4P75A 1JE5A 4PMWA 5C4JH 3K7AH 2VUMG 3KDFA 1S3OA 4JCVE 1UE7A 4POFA 4LFCL 1S40A 2JA6G 2OWOA 3PO3H 5IWAQ 2VUMH 2N78A 3AQQA 1J6QA 1QVCA 5M5WH 1O7IA 1LTLA 5IWAL 3F8TA 5E7NA 2YYZA 1UWVA 4X64Q 1IBLQ 4L5QA 1N33Q 1Q1EA 3M7NA 4A3FH 4AIMA 2YTXA 3G48A 5IYBG 2JA5G 3CMEA 1HNWQ 4A93G 5GROA 2F52A 4A75A 1OXUA 1HJPA 5BR8Q 4DR3L 2A1AA 4ALPA 1E24A 1BBUA 1QVGA 2E2IH 1VQAA 1Q86C 2UXBL 3M9BA 1N36Q 2N49A 1FL0A 1I6HH 4YWMA 2WP8J 1HNXQ 5M3FG 1BKBA 1CKNA 2CCZA 3AFQA 3RLFA 3UDFA 1BBWA 2AWNA 4C2MH 3GTQH 4GKKL 2UUAQ 2VS1A 3W5OA 5IT9c 4UPAA 3PUVA 4GN4B 1EFWA 2BH2A 4K0KL 3I4OA 4AQYQ 2Z6KC 4GN3B 4AH6A 4LF9L 2HT1A 1GO3E 4DR7L 2I5LX 3HOXG 1T9HA 1PH5A 4DR6Q 1KIXA 1IBLL 5AJ3L 1G51A 1V43A 2K14A 2K52A 4LUVA 3KYHC 5C3EH 2K75A 4X66L 3CCQA 3TEHB 2L15A 1SFOH 4DR6L 2A8VA 3AEVA 3RN5A 1A8VA 2NN6G 3D0FA 5IP7H 3F1ZA 5C3EG 1PA6A 2YU9H 3K0XA 1Q8KA 4JI2Q 4IJLA 3E9HA 4DR2L 4LF6Q 3HOXH 4HJ5A 3M4OH 5JJKA 2Q2IA 2HIXA 2JK8A 3A0JA 1YHBA 2B63H 2R92H 1HZCA 5K36G 1B7YB 4MZ9A 4JI7Q 2ASBA 2GN5A 2ATWA 2UXDL 4LW1A 2ZJQA 3CXCA 4RG1A 1YJWA 1KD1C 2BA0A 4QY7A 3UDGA 3TS0A 1VQ5A 2ES2A 4LF9Q 2K4KA 2GVAA 2K5HA 1E3PA 2OTJA 1E7ZA 4DUZQ 3HOZH 3MXNB 2KENA 1YNXA 3STBD 3E9IA 5C44H 4A3FG 2JA5H 3J81c 1E22A 2VY3A 1A62A 2R6GA 3L7ZC 1YJNA 2K5NA 1N36L 3IRBA 5GAHC 2JA8G 3M3YH 3CCRA 4JI5L 2JJQA 1VQLA 3PUWA 3PO3G 2JA6H 2ZTCA 1L0WA 4O2DA 4AYBE 4YCUA 2ID0A 4LF5L 3AYHB 1VQDA 3STBC 3K7UC 4DV5L 1W2BA 2Q2TA 3A5UA 1VQFA 4L5RC 3S14H 4QGUA 3A5ZB 4DV5Q 1HR0W 1J5EL 3M85A 3CCEA 4P71A 4LF5Q 1NY4A 2NZHA 1EIYB 3H15A 5M5YH 1C9OA 4DKAC 1U0LA 4OWTB 3PO2G 4JV5Q 4DAYB 4L5SA 3UE0A 3CQZH 3PUXA 1SLJA 4R4IA 4AYBG 2VQEL 3J7A5 4A3GG 4OO1G 1OXSC 2NVYH 4QIWE 5LMNL 4OXPA 3CCSA 2RCNA 3CC2A 2ZTDA 1KQSA 1KHIA 2Y0SG 4IPCA 4JI6Q 4DR2Q 4LF6L 1KRSA 1LUZA 2MO0A 2N8NA 3BU2A 4JBMA 3S17H 2OCEA 3S2DH 1X3GA 5DLQE 3HOWG 1EWIA 4A3EH 4DR1L 1GKHA 2Z0SA 1PH4A 1Z9FA 3I2ZA 1PYSB 3RLOA 1J5EQ 4LF4L 2CQOA 5IYDH 4YWLA 3RZOH 5JJIA 3CW2C 1CKMA 4C3IH 2I0QA 1JJGA 1I50H 3KLWA 2KHIA 4JBWA 2ZM6Q 1X55A 3ZJYC 4LF8L 4A3KH 1TXYA 3S15H 2FXQA 5M3MH 4Y7NH 2PI2E 1EYGA 3ER0A 2YTVA 1XNQL 1GD7A 4LNQA 2EIFA 1X54A 4EX5A 2UUCQ 4DR5L 2Z6KA 1L1OC 4K0KQ 1NE3A 1WYDA 4JV5L 1YJ9A 4BA2I 5IYCH 4GKKQ 1OXTA 1Y1WG 4IFDG 4IO9A 3FKIG 3FP9A 5C0XG 2F3IA 1I94Q 4WJ3M 4DK3C 4A3DH 1I3QH 4A3JH 3KFUA 3HFZB 4X6AH 5FJ8G 2LXKA 1N33L 4X64L 2NVTH 4A3CG 1NMFA 2PQAA 3PSIA 4IPGA 4KI0A 2UXCQ 4A3MH 4IPHA 1Y1VG 1EUJA 2GVBA 1X3FA 4DV6L 1K73C 1VQPA 2JA9A 1WJJA 3CCVA 4HJ7A 1PH1A 4B3SQ 4BXXH 4KHPQ 1AE2A 1HH2P 1KL9A 3JAMc 1HNXL 4JC0A 2D0PA 3ULPA 1K8GA 2IX0A 2KCTA 4HIOA 1EOVA 1EQQA 1JMCA 4OX9Q 1VQNA 1L2FA 1HNZL 4DV7Q 1M1KC 2UU9L 2CWAA 1XPRA 4NXML 4B3RQ 1KRTA 1YZ6A 4LFAQ 1G6PA 3NEMA 4HIKA 3GTJH 4GLXA 1YIJA 3H3VI 1L1OA 4QL5A 2I5HA 4GNXC 2RF4A 5HY6A 4JBKA 4HIDA 1WFQA 1N8RC 1UE1A 1Q46A 1DGSA 1EIFA 3CCJA 1PV4A 1ASYA 1XNQQ 1D7QA 1VQCA 4B3MQ 5ELNA 4A3BH 4J15A 4OWXB 3J81j 3ERSX 1VQ4A 4GKJQ 4B3ML 2BA1A 3DM3A 3CPFA 5HGQA 1OXXK 2R7ZH 2VW9A 1A63A 1SRUA 4DAMA 4GN5A 1JT8A 4DV1Q 1XJVA 4A3IG 1QZGA 4A4IA 3L0OA 4PZ6A 3UE1A 4DV4L 3S2HH 1P16A 4BA1I 4Y52H 1ASZA 3D31A 1TWFH 3HOVG 1SR3A 2D0OA 1VQOA 3I4NG 4A3LH 5GAEC 4JI3L 1BVSA 4GLVB 1QUQA 3ULJA 2MNAA 3F2DA 4BY1H 1G291 4BY7H 1VQGA 4O0AA 1IYJB 2ALYB 4BBRH 5IP9G 1XMQQ 1MIUA 4JI1L 2I5MX 1VQKA 4JI8Q 4DV0Q 1C0AA 1JJ2A 1IBKQ 2E8GA 1YBYA 3EIVA 4YY3L 3H0GG 1Q7YC 1XPUA 1W3SA 1TWCH 1PH6A 2JA7G 4OO1I 1N32L 3RZDH 4DR1Q 3CCUA 2XTIA 3KF6B 4JI1Q 3GO5A 1CUKA 2WAQG 1HNZQ 2IX1A 4PZ8A 3HKZG 5FLMH 3S1RH 3HKSA 2ZJRA 1VQIA 4DV3Q 3ULLA 3KF6A 4XIGS 4JI6L 2VNUD 2JEBI 2NVQH 1YEZA 1CSQA 3FHWA 4EQ5A 4X62Q 1V9PA 2CFMA 3KDFB 5LMNW 3UDIA 5BR8L 4DR3Q 3Q8DA 4DPGA 1Q81C 2JQOA 2HHHL 2UUCL 1XMOQ 3I4MH 4UP7A 3CPWA 4IJHA 5LMUL 2BH8A 3F2BA 3BZKA 4TVAB 2V1CC 3I4MG 2IY5B 1VQ9A 1N9WA 2ZM6L 1UE5A 2R93H 1K8AC 3J80c 3BJUA 3PV0A 4BBSG 1Q82C 1IBKL 4APVA 4DV0L 3PUYA 4DV2L 1C7YA 3GTGH 4X65L 1RIPA 2KCMA 4XTCS 2OTLA 4B3RL 4DV7L 3GTKH 1VCIA 3K81C 3OYYA 2RHSB 4DV3L 2UUBQ 5JEAG 1YITA 1VQ8A 2E2HH 4JBJA 3W1GA 3PGZA 3OTOQ 3HOUH 1QZHA 1M90C 2PQAB 4DV4Q 1KXLA 1PH2A 2R7FA 2VL6A 4BBRG 1NBWA 5IP9H 3GTMH 1RL2A 2MQHA 5J3BA 1AH9A 4BY1G 3PF4A 2HQLA 5C4XG 3I4NH 3SGIA 1MJCA 3OW2A 3HOVH 3HOYG 1XMQL 3CCLA 4LFBQ 2NN6I 4KHZA 1VS0A 4A3IH 1WCMG 1PHJA 2NVXH 1VQ6A 3TS2A 4LFBL 5C0XI 1KAWA 4GOPB 4MNOA 3S1MH 1B8AA 2R7ZG 2OQKA 1WCMH 1XNRL 4DR4Q 4LFAL 1PVOA 5IY0A 1FJGQ 1LYLA 3HOYH 3PIOA 3GD7A 4PG3A 3NENA 2DGYA 3CP0A 1OXVA 4R4TA 1NTGA 3NBHB 2NZOA 4DR5Q 5C4XH 2QGQA 1FGUA 1PH8A 4C3JH 2AWOA 1XNRQ 3WWVA 3KJOA 1TWGH 1FVIA 1VQ7A 5LMNQ 2UUBL 4L5TA 4IPDA 4KLKA 4LUOA 1UE6A 3J7ZC 3HOUG 1IL2A 2K50A 4DV6Q 2PNHA 4DUYQ 1IBMQ 5JJLA 2EQSA 5JEAJ 3J80i 2E5LL 3U4VA 2UXCL 4GNXB 3GTLH 1VQEA 1HZBA 1SN8A 3PCOB 2RHQB 1YHAA 1NMGA 2KBNA 1Z47A 4IOCA 2R7DA 1QUQB 3TQYA 2IT1A 4BBSH 1MKHA 1YHQA 4LUZA 3CC7A 2AMCB 2C35B 4HJAA 2R93G 3PIPA 2VQEQ 3L2PA 3S1NH 4GOPC 1MJEA 3RLNA 1K83H 1B70B 4X65Q 4A3CH 4X62L 2YV5A 1PYBA 4DUYL 1Q1BA 4NXNL 5H1SE 4A3DG 3FKIH 4X66Q 3BZCA 2VZAA 1Y1WH 5IYCG 4DUZL 1K3RA 3KF8B 1E1OA 2Q2UA 5C0XJ 2PMZE 3I56A 4DR7Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NXN Q;  1HR0 Q;  2WFW A;  5FLM G;  1IBM L;  4PZ7 A;  1AE3 A;  1SRO A;  4P74 A;  5GAG C;  1XMO L;  5M3M G;  4JI0 L;  4HIM A;  1N34 Q;  1HZA A;  4R4O A;  4A3K G;  2ZTE A;  1SMX A;  1X56 A;  3G71 A;  2JA7 H;  2B3G A;  2EXD A;  3TRE A;  3F2C A;  4JI4 Q;  1A0I A;  3H0G H;  4TQU S;  3EBE A;  1YI2 A;  3ICE A;  4JOI C;  2LXJ A;  5IYD G;  4YWK A;  2VQF L;  4B3T Q;  4GLA C;  4HJ9 A;  4A3E G;  2AKW B;  1N34 L;  3G6E A;  4JG2 A;  1K9M C;  4JI2 L;  1TWH H;  3TRZ A;  2MFI A;  5FLX c;  5AJ3 Q;  3I55 A;  1FJG L;  1R9T H;  3PUZ A;  1N32 Q;  4BY7 G;  5GAD C;  2AHO B;  4A3L G;  4AQY L;  1GM5 A;  3CD6 A;  3LGJ A;  5GQO A;  1XTD A;  4GS3 A;  3U58 A;  2IHF A;  2HIV A;  1PH9 A;  1JB7 A;  3AFP A;  5ELO A;  2KHJ A;  4JI7 L;  4A3G H;  4GKJ L;  3PO2 H;  4RMF A;  1Y14 B;  1LM0 A;  1YVC A;  3KOJ A;  4NPS A;  1E1T A;  3G4S A;  2XGT A;  2QEX A;  3RNU A;  3T1H Q;  1HZ9 A;  1OTC A;  2JE6 I;  1SE8 A;  3JC6 6;  2B29 A;  4JI5 Q;  1CKN B;  1WOC A;  2HHH Q;  3GTO H;  4UP9 A;  3GTP H;  1GVP A;  4P73 A;  1IZ6 A;  4R1J A;  4A3B G;  4YCW A;  3H3V H;  3JAM i;  2A19 A;  3DLL A;  4DR4 L;  4DV1 L;  4JYA L;  5EAY A;  4OX9 L;  4UP8 A;  1EQR A;  2UXB Q;  1VQH A;  4QJF A;  4R4Q A;  4QQB X;  2MO1 A;  4MTN A;  1K0R A;  4OON A;  1H95 A;  2JA8 H;  3PF5 A;  1PFS A;  4LFC Q;  4DV2 Q;  4WJ4 A;  1VQB A;  3T1Y Q;  4GOP A;  4LF7 Q;  3NEL A;  3RN2 A;  2UXD Q;  1CSP A;  5C44 G;  3K8A A;  3MEF A;  2DUD A;  4C3H H;  3T1Y L;  4JI8 L;  1PH3 A;  4LF7 L;  4JOI A;  1VQJ A;  1X3E A;  3U4Z A;  3HOZ G;  4BXX G;  1I5F A;  1WI5 A;  3RR5 A;  3OTO L;  3CF5 A;  3CCM A;  4UY8 C;  1UEB A;  4YHH L;  5M5X H;  5LMU Q;  3B6Y A;  1CKO A;  4JYA Q;  1Y1V H;  4P72 A;  4YHH Q;  4A3M G;  4HJ8 A;  4YCV A;  2K5V A;  2CKZ B;  1D8L A;  4DK6 C;  4KHP L;  2Y0S E;  2R92 G;  2E5L Q;  5FJ8 H;  2WB1 G;  2LSS A;  3EN2 A;  4A3J G;  2B63 G;  2F4V L;  2IHE A;  2D62 A;  1P8L A;  1L1O B;  3S24 A;  2E2J H;  3S1Q H;  4DNI A;  3M4Q A;  1V1Q A;  2WB1 E;  4ME3 A;  2JEA I;  5IE8 A;  3CAM A;  5IP7 G;  4OWW B;  4R4C A;  4IFD J;  4NB3 A;  2ZJP A;  1TWA H;  3E0E A;  4YY3 Q;  4A76 A;  3VDY A;  1S72 A;  3S16 H;  2YTY A;  1X9N A;  4GNX A;  2PI2 A;  2CWP A;  2UU9 Q;  4FDB A;  4NXM Q;  1X6O A;  3I7F A;  4LWC A;  1XPO A;  4POG A;  2N3S A;  1QVF A;  1JJC B;  1Q12 A;  3T1H L;  1U5K A;  3HOW H;  4IFD I;  2Q2H A;  1IXR A;  3K80 C;  4H02 A;  3KJP A;  1VQM A;  4JI4 L;  4LF8 Q;  2H5X A;  3J81 i;  2WAQ E;  5M3F H;  4JI0 Q;  3HKZ E;  1HNW L;  4IOA A;  2F4V Q;  3CC4 A;  1HR0 L;  4LF4 Q;  2UUA L;  3A74 A;  3M4P A;  1KC8 C;  4A93 H;  2VQF Q;  4B3T L;  4JI3 Q;  1X65 A;  5IYB H;  3W1B A;  1PH7 A;  3GDE A;  1I94 L;  3U50 C;  3UDX A;  1NJI C;  2QA4 A;  3CMA A;  4B3S L;  2OQ0 A;  4P75 A;  1JE5 A;  4PMW A;  5C4J H;  3K7A H;  2VUM G;  3KDF A;  1S3O A;  4JCV E;  1UE7 A;  4POF A;  4LFC L;  1S40 A;  2JA6 G;  2OWO A;  3PO3 H;  5IWA Q;  2VUM H;  2N78 A;  3AQQ A;  1J6Q A;  1QVC A;  5M5W H;  1O7I A;  1LTL A;  5IWA L;  3F8T A;  5E7N A;  2YYZ A;  1UWV A;  4X64 Q;  1IBL Q;  4L5Q A;  1N33 Q;  1Q1E A;  3M7N A;  4A3F H;  4AIM A;  2YTX A;  3G48 A;  5IYB G;  2JA5 G;  3CME A;  1HNW Q;  4A93 G;  5GRO A;  2F52 A;  4A75 A;  1OXU A;  1HJP A;  5BR8 Q;  4DR3 L;  2A1A A;  4ALP A;  1E24 A;  1BBU A;  1QVG A;  2E2I H;  1VQA A;  1Q86 C;  2UXB L;  3M9B A;  1N36 Q;  2N49 A;  1FL0 A;  1I6H H;  4YWM A;  2WP8 J;  1HNX Q;  5M3F G;  1BKB A;  1CKN A;  2CCZ A;  3AFQ A;  3RLF A;  3UDF A;  1BBW A;  2AWN A;  4C2M H;  3GTQ H;  4GKK L;  2UUA Q;  2VS1 A;  3W5O A;  5IT9 c;  4UPA A;  3PUV A;  4GN4 B;  1EFW A;  2BH2 A;  4K0K L;  3I4O A;  4AQY Q;  2Z6K C;  4GN3 B;  4AH6 A;  4LF9 L;  2HT1 A;  1GO3 E;  4DR7 L;  2I5L X;  3HOX G;  1T9H A;  1PH5 A;  4DR6 Q;  1KIX A;  1IBL L;  5AJ3 L;  1G51 A;  1V43 A;  2K14 A;  2K52 A;  4LUV A;  3KYH C;  5C3E H;  2K75 A;  4X66 L;  3CCQ A;  3TEH B;  2L15 A;  1SFO H;  4DR6 L;  2A8V A;  3AEV A;  3RN5 A;  1A8V A;  2NN6 G;  3D0F A;  5IP7 H;  3F1Z A;  5C3E G;  1PA6 A;  2YU9 H;  3K0X A;  1Q8K A;  4JI2 Q;  4IJL A;  3E9H A;  4DR2 L;  4LF6 Q;  3HOX H;  4HJ5 A;  3M4O H;  5JJK A;  2Q2I A;  2HIX A;  2JK8 A;  3A0J A;  1YHB A;  2B63 H;  2R92 H;  1HZC A;  5K36 G;  1B7Y B;  4MZ9 A;  4JI7 Q;  2ASB A;  2GN5 A;  2ATW A;  2UXD L;  4LW1 A;  2ZJQ A;  3CXC A;  4RG1 A;  1YJW A;  1KD1 C;  2BA0 A;  4QY7 A;  3UDG A;  3TS0 A;  1VQ5 A;  2ES2 A;  4LF9 Q;  2K4K A;  2GVA A;  2K5H A;  1E3P A;  2OTJ A;  1E7Z A;  4DUZ Q;  3HOZ H;  3MXN B;  2KEN A;  1YNX A;  3STB D;  3E9I A;  5C44 H;  4A3F G;  2JA5 H;  3J81 c;  1E22 A;  2VY3 A;  1A62 A;  2R6G A;  3L7Z C;  1YJN A;  2K5N A;  1N36 L;  3IRB A;  5GAH C;  2JA8 G;  3M3Y H;  3CCR A;  4JI5 L;  2JJQ A;  1VQL A;  3PUW A;  3PO3 G;  2JA6 H;  2ZTC A;  1L0W A;  4O2D A;  4AYB E;  4YCU A;  2ID0 A;  4LF5 L;  3AYH B;  1VQD A;  3STB C;  3K7U C;  4DV5 L;  1W2B A;  2Q2T A;  3A5U A;  1VQF A;  4L5R C;  3S14 H;  4QGU A;  3A5Z B;  4DV5 Q;  1HR0 W;  1J5E L;  3M85 A;  3CCE A;  4P71 A;  4LF5 Q;  1NY4 A;  2NZH A;  1EIY B;  3H15 A;  5M5Y H;  1C9O A;  4DKA C;  1U0L A;  4OWT B;  3PO2 G;  4JV5 Q;  4DAY B;  4L5S A;  3UE0 A;  3CQZ H;  3PUX A;  1SLJ A;  4R4I A;  4AYB G;  2VQE L;  3J7A 5;  4A3G G;  4OO1 G;  1OXS C;  2NVY H;  4QIW E;  5LMN L;  4OXP A;  3CCS A;  2RCN A;  3CC2 A;  2ZTD A;  1KQS A;  1KHI A;  2Y0S G;  4IPC A;  4JI6 Q;  4DR2 Q;  4LF6 L;  1KRS A;  1LUZ A;  2MO0 A;  2N8N A;  3BU2 A;  4JBM A;  3S17 H;  2OCE A;  3S2D H;  1X3G A;  5DLQ E;  3HOW G;  1EWI A;  4A3E H;  4DR1 L;  1GKH A;  2Z0S A;  1PH4 A;  1Z9F A;  3I2Z A;  1PYS B;  3RLO A;  1J5E Q;  4LF4 L;  2CQO A;  5IYD H;  4YWL A;  3RZO H;  5JJI A;  3CW2 C;  1CKM A;  4C3I H;  2I0Q A;  1JJG A;  1I50 H;  3KLW A;  2KHI A;  4JBW A;  2ZM6 Q;  1X55 A;  3ZJY C;  4LF8 L;  4A3K H;  1TXY A;  3S15 H;  2FXQ A;  5M3M H;  4Y7N H;  2PI2 E;  1EYG A;  3ER0 A;  2YTV A;  1XNQ L;  1GD7 A;  4LNQ A;  2EIF A;  1X54 A;  4EX5 A;  2UUC Q;  4DR5 L;  2Z6K A;  1L1O C;  4K0K Q;  1NE3 A;  1WYD A;  4JV5 L;  1YJ9 A;  4BA2 I;  5IYC H;  4GKK Q;  1OXT A;  1Y1W G;  4IFD G;  4IO9 A;  3FKI G;  3FP9 A;  5C0X G;  2F3I A;  1I94 Q;  4WJ3 M;  4DK3 C;  4A3D H;  1I3Q H;  4A3J H;  3KFU A;  3HFZ B;  4X6A H;  5FJ8 G;  2LXK A;  1N33 L;  4X64 L;  2NVT H;  4A3C G;  1NMF A;  2PQA A;  3PSI A;  4IPG A;  4KI0 A;  2UXC Q;  4A3M H;  4IPH A;  1Y1V G;  1EUJ A;  2GVB A;  1X3F A;  4DV6 L;  1K73 C;  1VQP A;  2JA9 A;  1WJJ A;  3CCV A;  4HJ7 A;  1PH1 A;  4B3S Q;  4BXX H;  4KHP Q;  1AE2 A;  1HH2 P;  1KL9 A;  3JAM c;  1HNX L;  4JC0 A;  2D0P A;  3ULP A;  1K8G A;  2IX0 A;  2KCT A;  4HIO A;  1EOV A;  1EQQ A;  1JMC A;  4OX9 Q;  1VQN A;  1L2F A;  1HNZ L;  4DV7 Q;  1M1K C;  2UU9 L;  2CWA A;  1XPR A;  4NXM L;  4B3R Q;  1KRT A;  1YZ6 A;  4LFA Q;  1G6P A;  3NEM A;  4HIK A;  3GTJ H;  4GLX A;  1YIJ A;  3H3V I;  1L1O A;  4QL5 A;  2I5H A;  4GNX C;  2RF4 A;  5HY6 A;  4JBK A;  4HID A;  1WFQ A;  1N8R C;  1UE1 A;  1Q46 A;  1DGS A;  1EIF A;  3CCJ A;  1PV4 A;  1ASY A;  1XNQ Q;  1D7Q A;  1VQC A;  4B3M Q;  5ELN A;  4A3B H;  4J15 A;  4OWX B;  3J81 j;  3ERS X;  1VQ4 A;  4GKJ Q;  4B3M L;  2BA1 A;  3DM3 A;  3CPF A;  5HGQ A;  1OXX K;  2R7Z H;  2VW9 A;  1A63 A;  1SRU A;  4DAM A;  4GN5 A;  1JT8 A;  4DV1 Q;  1XJV A;  4A3I G;  1QZG A;  4A4I A;  3L0O A;  4PZ6 A;  3UE1 A;  4DV4 L;  3S2H H;  1P16 A;  4BA1 I;  4Y52 H;  1ASZ A;  3D31 A;  1TWF H;  3HOV G;  1SR3 A;  2D0O A;  1VQO A;  3I4N G;  4A3L H;  5GAE C;  4JI3 L;  1BVS A;  4GLV B;  1QUQ A;  3ULJ A;  2MNA A;  3F2D A;  4BY1 H;  1G29 1;  4BY7 H;  1VQG A;  4O0A A;  1IYJ B;  2ALY B;  4BBR H;  5IP9 G;  1XMQ Q;  1MIU A;  4JI1 L;  2I5M X;  1VQK A;  4JI8 Q;  4DV0 Q;  1C0A A;  1JJ2 A;  1IBK Q;  2E8G A;  1YBY A;  3EIV A;  4YY3 L;  3H0G G;  1Q7Y C;  1XPU A;  1W3S A;  1TWC H;  1PH6 A;  2JA7 G;  4OO1 I;  1N32 L;  3RZD H;  4DR1 Q;  3CCU A;  2XTI A;  3KF6 B;  4JI1 Q;  3GO5 A;  1CUK A;  2WAQ G;  1HNZ Q;  2IX1 A;  4PZ8 A;  3HKZ G;  5FLM H;  3S1R H;  3HKS A;  2ZJR A;  1VQI A;  4DV3 Q;  3ULL A;  3KF6 A;  4XIG S;  4JI6 L;  2VNU D;  2JEB I;  2NVQ H;  1YEZ A;  1CSQ A;  3FHW A;  4EQ5 A;  4X62 Q;  1V9P A;  2CFM A;  3KDF B;  5LMN W;  3UDI A;  5BR8 L;  4DR3 Q;  3Q8D A;  4DPG A;  1Q81 C;  2JQO A;  2HHH L;  2UUC L;  1XMO Q;  3I4M H;  4UP7 A;  3CPW A;  4IJH A;  5LMU L;  2BH8 A;  3F2B A;  3BZK A;  4TVA B;  2V1C C;  3I4M G;  2IY5 B;  1VQ9 A;  1N9W A;  2ZM6 L;  1UE5 A;  2R93 H;  1K8A C;  3J80 c;  3BJU A;  3PV0 A;  4BBS G;  1Q82 C;  1IBK L;  4APV A;  4DV0 L;  3PUY A;  4DV2 L;  1C7Y A;  3GTG H;  4X65 L;  1RIP A;  2KCM A;  4XTC S;  2OTL A;  4B3R L;  4DV7 L;  3GTK H;  1VCI A;  3K81 C;  3OYY A;  2RHS B;  4DV3 L;  2UUB Q;  5JEA G;  1YIT A;  1VQ8 A;  2E2H H;  4JBJ A;  3W1G A;  3PGZ A;  3OTO Q;  3HOU H;  1QZH A;  1M90 C;  2PQA B;  4DV4 Q;  1KXL A;  1PH2 A;  2R7F A;  2VL6 A;  4BBR G;  1NBW A;  5IP9 H;  3GTM H;  1RL2 A;  2MQH A;  5J3B A;  1AH9 A;  4BY1 G;  3PF4 A;  2HQL A;  5C4X G;  3I4N H;  3SGI A;  1MJC A;  3OW2 A;  3HOV H;  3HOY G;  1XMQ L;  3CCL A;  4LFB Q;  2NN6 I;  4KHZ A;  1VS0 A;  4A3I H;  1WCM G;  1PHJ A;  2NVX H;  1VQ6 A;  3TS2 A;  4LFB L;  5C0X I;  1KAW A;  4GOP B;  4MNO A;  3S1M H;  1B8A A;  2R7Z G;  2OQK A;  1WCM H;  1XNR L;  4DR4 Q;  4LFA L;  1PVO A;  5IY0 A;  1FJG Q;  1LYL A;  3HOY H;  3PIO A;  3GD7 A;  4PG3 A;  3NEN A;  2DGY A;  3CP0 A;  1OXV A;  4R4T A;  1NTG A;  3NBH B;  2NZO A;  4DR5 Q;  5C4X H;  2QGQ A;  1FGU A;  1PH8 A;  4C3J H;  2AWO A;  1XNR Q;  3WWV A;  3KJO A;  1TWG H;  1FVI A;  1VQ7 A;  5LMN Q;  2UUB L;  4L5T A;  4IPD A;  4KLK A;  4LUO A;  1UE6 A;  3J7Z C;  3HOU G;  1IL2 A;  2K50 A;  4DV6 Q;  2PNH A;  4DUY Q;  1IBM Q;  5JJL A;  2EQS A;  5JEA J;  3J80 i;  2E5L L;  3U4V A;  2UXC L;  4GNX B;  3GTL H;  1VQE A;  1HZB A;  1SN8 A;  3PCO B;  2RHQ B;  1YHA A;  1NMG A;  2KBN A;  1Z47 A;  4IOC A;  2R7D A;  1QUQ B;  3TQY A;  2IT1 A;  4BBS H;  1MKH A;  1YHQ A;  4LUZ A;  3CC7 A;  2AMC B;  2C35 B;  4HJA A;  2R93 G;  3PIP A;  2VQE Q;  3L2P A;  3S1N H;  4GOP C;  1MJE A;  3RLN A;  1K83 H;  1B70 B;  4X65 Q;  4A3C H;  4X62 L;  2YV5 A;  1PYB A;  4DUY L;  1Q1B A;  4NXN L;  5H1S E;  4A3D G;  3FKI H;  4X66 Q;  3BZC A;  2VZA A;  1Y1W H;  5IYC G;  4DUZ L;  1K3R A;  3KF8 B;  1E1O A;  2Q2U A;  5C0X J;  2PMZ E;  3I56 A;  4DR7 Q; 
#chains in the Genus database with same CATH topology
 1HR0 Q;  3G6X A;  3IAY A;  5FLM G;  1FNW A;  1AE3 A;  4RAU C;  5GAG C;  4RB1 A;  5M3M G;  1N34 Q;  4R4O A;  3KHH A;  1X56 A;  3G71 A;  2B3G A;  3TRE A;  2G9H D;  1AZQ A;  1BBX C;  1DV1 A;  2QYZ A;  3H0G H;  3ICE A;  1I6V C;  4JOI C;  4K8I A;  4HSV A;  1BQQ T;  4B3T Q;  4A3D B;  2E2I A;  2J4X A;  1N34 L;  5JJL A;  1D1K A;  4JI2 L;  3I55 A;  3E5S A;  4BY7 G;  5GAD C;  1GM5 A;  3CD6 A;  3LGJ A;  4GS3 A;  1H9K A;  2IHF A;  5I2Y A;  2B2V C;  3S14 B;  1PH9 A;  1JB7 A;  4ED1 A;  5DLF A;  1G6Z A;  4NXM H;  5D3D A;  2C22 A;  2QEX A;  4DL2 A;  1YVC A;  3G4S A;  3RNU A;  5C5M A;  3T1H Q;  1B6R A;  4DXF A;  1OTC A;  4JI5 Q;  1CKN B;  1WOC A;  3GTO H;  1W93 A;  5EWG A;  4R1J A;  4YCW A;  1K3B C;  3H3V H;  2SEB D;  1HHV A;  2A19 A;  3G6V A;  1LAC A;  2B2Y C;  3RB3 A;  1S0M A;  1HCZ A;  1YNN D;  1BCP B;  3I8Z A;  4QQB X;  1H95 A;  2MO1 A;  4MTN A;  1K0R A;  5LL6 b;  2JA8 H;  4OIJ A;  2EYO A;  1B9N A;  1PFS A;  1VAJ A;  1VQB A;  2R8K A;  4GOP A;  3MWD A;  3K7A B;  1K83 B;  4C3H H;  3T1Y L;  4LF7 L;  1KC7 A;  5HGT A;  3HP3 A;  3U4Z A;  2QDB A;  1I5F A;  3NBH A;  1BCP F;  1SCU B;  3GII A;  2KA7 A;  2Z6B A;  1LTG D;  4YHH L;  3B6Y A;  4JYA Q;  3QIA A;  4YHH Q;  5CGK A;  3ETJ A;  3NHH A;  2K5V A;  4RGN A;  4DK6 C;  1M4V A;  3MXU A;  4FF3 A;  4KHP L;  2B2T C;  5FJ8 H;  1RHP A;  2B63 G;  4K0K H;  4EBE A;  2A69 D;  4G7H C;  1B2T A;  5EWE A;  4JV5 H;  3S24 A;  2ICI A;  3S1Q H;  1R9T A;  4DNI A;  4O4I F;  1V1Q A;  2Z4H A;  4NB3 A;  3E0E A;  4P2C B;  3QZ7 A;  3H4B A;  4OEM B;  4NXM Q;  1EHI A;  3KXY T;  1HQM C;  2W8L A;  1QE6 A;  1XPO A;  3GIQ A;  1S5B D;  2B2U A;  4I50 F;  1QVF A;  1JJC B;  1Q90 A;  3T1H L;  1U5K A;  3WOF A;  4JI4 L;  1KLU D;  1V8Q A;  3CKI B;  3SK4 A;  4J9O A;  3J81 i;  3EVQ A;  4JI0 Q;  4RB0 A;  2W57 A;  5C1P A;  3GTP B;  3DEO A;  4IOA A;  2J6T A;  1EU3 A;  4KJN A;  2Y0S A;  2UUA L;  3A74 A;  5LHY 1;  4EEY A;  1TWG B;  4GKK H;  2YZG A;  2V4R A;  2R8I A;  3FPP A;  1X65 A;  1XXG A;  5IYB H;  4JI3 Q;  3U50 C;  3E0J A;  4RGM A;  5EOY A;  4MV1 A;  4K6L A;  1RK6 A;  5LYJ F;  3K7A H;  4DR4 H;  2VUM G;  1LTB D;  2RKS A;  5E4X A;  1S3O A;  3PW7 A;  2KED A;  2D5D A;  3V6H A;  2XSC A;  1GUN A;  1J6Q A;  4U67 3;  4ED8 A;  2F0H A;  4LF9 H;  5M5W H;  1O7I A;  1LTL A;  1SYG A;  1SYB A;  5IWA L;  4O2A F;  2YYZ A;  1UWV A;  1Z2O X;  4DUZ H;  1IKL A;  2WII B;  1SE3 A;  3CME A;  2EDG A;  5GRO A;  3J80 W;  4YAK B;  1EY9 A;  3QOL A;  4TKO B;  5BR8 Q;  5KT7 A;  2I07 B;  4ECX A;  5FK9 C;  1Q86 C;  4BWS C;  2F0E A;  5FD5 A;  1FL0 A;  2VXW A;  1A3V A;  4YWM A;  4JPB W;  1HNX Q;  5M3F G;  2F0P A;  5C4X B;  4XQN A;  2YU9 A;  2A6E D;  1XYI A;  1LO5 D;  5E1F A;  1Z6H A;  1ENA A;  3GTQ H;  2VS1 A;  4GKK L;  3OSN A;  4GN4 B;  3N41 B;  4ED7 A;  2Z6K C;  4AH6 A;  2HT1 A;  4DR1 H;  5LP6 F;  4EG0 A;  1B3Q A;  4R7R A;  4O3R A;  2BCO A;  1U9R A;  1K0S A;  3FDS A;  2EXZ A;  1G51 A;  2K14 A;  1QB5 D;  5DNF A;  2ATL A;  1RTN A;  2MP1 A;  2L15 A;  4DR6 L;  3TME A;  3T4A C;  5KRU A;  2KJX A;  5C3E G;  3GTO B;  3V96 A;  4O3P A;  2NU8 B;  4JI2 Q;  4MV4 A;  4LF6 Q;  5C6A A;  3JSL A;  4J9Q A;  2JA5 A;  4X3T A;  1IHZ A;  2FMA A;  1A2U A;  3AU7 A;  1BNC A;  5CV7 A;  4JI7 Q;  5A2Q E;  4ZUJ A;  4FYD A;  2UXD L;  4LW1 A;  4CJ2 C;  1YJW A;  2F0L A;  2RSN A;  1B53 A;  3S9W A;  2ES2 A;  4JI5 H;  4A2A A;  5C4Z A;  1TWA B;  2KOL A;  3PN1 A;  1PRT C;  2B39 A;  4WRD A;  1KJJ A;  2WB1 B;  2B8G A;  4IUR A;  3V2T A;  1AN7 A;  3STB D;  1I94 H;  4A3F G;  3GIL A;  1D1I A;  2EY1 A;  2VY3 A;  1IBL H;  5BR8 H;  5KFM A;  5GAH C;  1RD9 D;  2UUC H;  4MTK A;  1SNQ A;  3I91 A;  4TUY F;  1T5E A;  2E2H A;  2JA6 H;  2HD3 A;  1L0W A;  5J2U F;  4AYB E;  4RU9 A;  3AYH B;  3BG5 A;  3STB C;  2Q2T A;  1SYF A;  3E3X A;  3A5U A;  5KND A;  3M85 A;  3KBX A;  4BS9 A;  4UFZ A;  1PTO B;  1NY4 A;  1EIY B;  5M5Y H;  4XZ3 B;  3MWE A;  1JC7 A;  2CH4 A;  1U0L A;  4OWT B;  5I47 A;  2R93 A;  2F3V A;  1TR5 A;  3VR6 A;  1SLJ A;  4KY6 A;  4R4I A;  4AYB G;  5L1K A;  2NVY H;  3T16 A;  4QIW E;  4TQS A;  4NP5 A;  4K5X A;  4F7X A;  4L6T B;  4Z9C B;  2Y0S G;  4BY1 B;  4IPC A;  3GTL B;  4DR2 Q;  3G8C A;  3BU2 A;  3IKJ A;  1EQT A;  3S2D H;  1KTK A;  1EWI A;  2R8H A;  2Z0S A;  1TS3 A;  1Z9F A;  1PMR A;  3RLO A;  4LF4 L;  5IYD H;  1I4P A;  5LMN H;  3URY A;  4QW8 A;  5HUR A;  4LF8 L;  5DG7 A;  4A3K H;  1PLF A;  2VUM A;  2R84 A;  3HOW B;  2GPW A;  4JI0 H;  1CFM A;  3VYS A;  2NVT B;  4LNQ A;  2F0G A;  1MD2 D;  2UUC Q;  5CA1 F;  3CU7 A;  1ESR A;  2KVM A;  1E4G T;  1B9M A;  3N8D A;  1EY7 A;  2X69 A;  3QFF A;  1H9M A;  5IYC H;  1D5M C;  5A35 A;  4IFD G;  2RDI A;  5C0X G;  4B3M H;  2Z1C A;  1I94 Q;  2I46 A;  4IN3 A;  4DK3 C;  3H0G A;  1I3Q H;  2CQA A;  4A3J H;  3H91 A;  2QEJ C;  4X6A H;  3J81 L;  1N33 L;  1JWM D;  1PX2 A;  5KG0 A;  2ALZ A;  2QW7 A;  1I50 A;  2PQA A;  2W6M A;  3W3A A;  2F0J A;  3GLK A;  2R92 A;  4IUU A;  4IWY A;  4RUA A;  1EUJ A;  1CA5 A;  3C46 A;  3SK6 A;  2DNE A;  1VQP A;  4HJ7 A;  1PH1 A;  4YIJ A;  1HH2 P;  4B9W A;  5EKL A;  1IOW A;  4ECR A;  1KL9 A;  2JA5 B;  4JC0 A;  2D0P A;  3ULP A;  2OXP A;  1K8G A;  1ENF A;  2KCT A;  4A3B B;  1CQI B;  3L4J A;  4IWX A;  4DV7 Q;  2XRS D;  4B3R Q;  2ZDG A;  4LFA Q;  4HIK A;  4GLX A;  4J9R A;  1L1O A;  2B2W A;  4GNX C;  2RF4 A;  1B6S A;  4LF5 H;  1N8R C;  2DZD A;  2PBZ A;  2R8G A;  4DL3 A;  1EWH A;  1TVX A;  4V19 0;  4OWX B;  1VQ4 A;  3ERS X;  4GKJ Q;  5KKN B;  5KFP A;  5DGB A;  2V4Q A;  2RCF A;  1GHJ A;  2F0K A;  1SJH D;  4DU9 A;  5HGQ A;  4XQJ A;  2RDJ A;  1N32 H;  1NCV A;  2M2L A;  2VW9 A;  2WE6 A;  3MC0 B;  5EKI A;  2WAQ B;  1RYS A;  1PRT B;  3UE1 A;  4ZUI A;  1P16 A;  4XT3 B;  4BA1 I;  3D31 A;  3HOV G;  3M9M B;  2PW5 A;  2E2H B;  3M3Y B;  4RB3 C;  1VQO A;  5DM7 3;  4A3L H;  5GAE C;  3DEP A;  4JI3 L;  4DA2 A;  2VPS A;  4ED3 A;  2J0T D;  1G29 1;  4O4L F;  4BBR H;  2VB2 X;  1IYJ B;  1KLG D;  2ALY B;  4O0A A;  5IP9 G;  1XMQ Q;  1IOV A;  2R86 A;  2UUB H;  4KKS A;  3RB0 A;  1VQK A;  4DV0 Q;  4MTD A;  4EBC A;  1CTM A;  5DM6 3;  3DWQ A;  1W3S A;  4OO1 I;  1PH6 A;  3E5N A;  3A54 A;  4UHV A;  2XTI A;  2RBM A;  3KF6 B;  4IUQ A;  1CUK A;  2WAQ G;  2IPK D;  5FO8 B;  2V4D A;  1S4Z A;  1YNN C;  3SK5 A;  4E6I A;  4K5W A;  1HNZ Q;  1B1Z A;  1MBY A;  1U4M A;  3DXJ C;  4DV4 H;  4KK7 A;  2VNU D;  3OOC A;  3ERO A;  2CFM A;  1ONL A;  5LMN W;  4FXG C;  4LH7 A;  3HOX B;  1Q3L A;  4DPG A;  4IHJ F;  2PZW A;  2QF7 A;  3OUZ A;  2VA3 A;  2HHH L;  4I7H A;  1LTI D;  1XMO Q;  4UP7 A;  2A68 C;  4GZY C;  2BE5 D;  1CE8 A;  3SHL A;  2JN4 A;  4DV7 H;  3MFI A;  2IY5 B;  2W71 A;  1BXT A;  1VQ9 A;  1KJ9 A;  2XCL A;  1K8A C;  3BJU A;  3PV0 A;  3NPP A;  3TZU A;  4BBS G;  3VMM A;  1Q82 C;  1BXR A;  3K58 A;  2FK1 A;  4DV0 L;  2F1M A;  3A7L A;  1TY2 A;  3WO1 A;  2L0C A;  2R7N A;  2OTL A;  4FM9 A;  2KUM A;  3NP8 A;  2KQ3 A;  3K81 C;  1YIT A;  3H0G B;  1WH2 A;  3QB3 A;  1Y8N B;  3HOU H;  1BCP D;  2NB0 A;  2IJ0 A;  2JEI A;  2FIN B;  2F0U A;  3SEB A;  2PQA B;  1PH2 A;  4O3S A;  4FF4 A;  3J81 W;  3U9O A;  2JSO A;  2NYZ D;  4RAZ A;  1AH9 A;  2Z8L A;  2HQL A;  2IL8 A;  2FJ2 A;  5KFD A;  5C0X I;  4GOP B;  4MNO A;  3S1M H;  2R7Z G;  1XNR L;  1M7J A;  3TBI B;  3D6C A;  4LMQ D;  4RKB A;  4G3I A;  3NEN A;  3N6R A;  4R4T A;  3BAB A;  4ECT A;  2L55 A;  3NBH B;  4DR5 Q;  2C2R A;  1CHQ D;  4ZLT F;  1PH8 A;  3SK8 A;  1SNM A;  3WWV A;  1FVI A;  1VQ7 A;  5LMN Q;  4IPD A;  4MV7 A;  1ZEQ X;  1UE6 A;  1F9S A;  3H6M A;  3HOU G;  4DV6 Q;  1X32 A;  3M9N B;  1V1P B;  3MR5 A;  1PRT F;  4OL7 A;  1AW7 A;  3J80 i;  5CV5 A;  1GUG A;  2NTT A;  3LWE A;  4J9L A;  3R93 A;  5KG1 A;  1XMO H;  1DZ1 A;  4FBU A;  4YR2 A;  2OH2 A;  3KUP A;  1QUQ B;  4JV0 A;  3RGZ A;  4BBS H;  2UXD H;  1Y8O B;  3MXN A;  1WD0 A;  1B04 A;  2AMC B;  1BNZ A;  1TWC B;  4RFB A;  3T5H A;  2VQE Q;  3RLN A;  4X65 Q;  4R8I A;  4APM A;  4X62 L;  1J8I A;  3G7L A;  4R8U B;  4A3D G;  3HRZ C;  5H1S E;  2XCA A;  1EYA A;  4X66 Q;  3SVM A;  2WIN B;  2VZA A;  1Y1W H;  2F0I A;  2YZN A;  2H4O A;  5EBC A;  4HYK A;  1L0Y B;  4MA5 A;  3KF8 A;  3J7A K;  1IBM L;  2BQR A;  4PZ7 A;  2PO4 A;  2K5Q A;  4HIM A;  3OHA A;  1TWG A;  2ZTE A;  1SMX A;  3RAQ A;  4XT1 B;  4JI4 Q;  1A0I A;  3M7G A;  1CQV A;  1DJR D;  4PDB A;  5KX5 F;  2LXJ A;  1S68 A;  3L4K A;  4YWK A;  4JI7 H;  4A3E G;  3RV4 A;  4JG2 A;  3QWN A;  5EPJ A;  1TWH H;  2A73 B;  2MFI A;  5FLX c;  1R4P B;  5AJ3 Q;  3TRZ A;  5KFG A;  1R9T H;  2QCP X;  3GTL A;  3PUZ A;  1N32 Q;  4A3L G;  5F9L A;  4AQY L;  3RUZ A;  5GQO A;  1XTD A;  1OO9 B;  3HZX A;  4QWD A;  3AMU A;  1S10 A;  3AFP A;  5ELO A;  2KHJ A;  1QNK A;  4K2K A;  2R61 A;  4EQP A;  1SE2 A;  3PO2 H;  2NU6 B;  4RMF A;  1Y14 B;  2BE5 C;  2XN9 C;  1XPU A;  1ILP A;  1E1T A;  2FP4 B;  2XGT A;  4ODG A;  2CVR A;  1F9Q A;  2JE6 I;  3NWT A;  2B29 A;  2HHH Q;  4UP9 A;  2L9H A;  1GVP A;  4P73 A;  5LL6 S;  3GTP H;  3FRP B;  2YCH A;  3RF2 A;  5HV6 A;  4WOR A;  5I2X A;  3DLL A;  1EYD A;  4DR4 L;  4YAJ B;  1BCP C;  1ML0 D;  4DV1 L;  3WO0 A;  2DJG C;  4OX9 L;  1EZ8 A;  4X3U A;  2XWB B;  3R5X A;  2IA6 A;  2UXB Q;  1VQH A;  4QJF A;  4R4Q A;  1A6X A;  4EGQ A;  3TII A;  5EZY F;  3RV3 A;  4LFC Q;  4IUN A;  1JR0 D;  3I72 A;  2UXD Q;  3MEF A;  2W6Q A;  2A6E C;  2K28 A;  4DR3 H;  3RFC A;  4X65 H;  1WI5 A;  4FF1 A;  3RR5 A;  1ZXT A;  3CCM A;  4UY8 C;  5FO7 B;  5M5X H;  1MSH A;  1ZKO A;  3HOV B;  2XGP A;  2F0W A;  2X6L A;  5KFJ A;  1EY4 A;  4YCV A;  3TN2 A;  1I7L A;  2SDF A;  5K36 H;  2Y0S E;  1GHK A;  2R92 G;  2E5L Q;  2V5A A;  2WB1 G;  4A3J G;  3R2I A;  2IHE A;  1FYC A;  2NVQ B;  4B3T H;  4IFD H;  1L1O B;  2WB1 E;  2JEA I;  1OWT A;  3CAM A;  1GUS A;  5IP7 G;  4R4C A;  4OWW B;  2ZJP A;  1CK1 A;  1TWA H;  3KLS A;  4IR1 A;  1I3Q B;  3VDY A;  2YTY A;  4X64 H;  3T53 B;  1F2Y A;  3VYU A;  4GNX A;  1BUV T;  3CRK C;  2UU9 Q;  4G4K A;  5DG8 A;  1Q12 A;  1WR2 A;  4Y7N B;  1PZI D;  4MAM A;  3PR5 B;  2XCP A;  1H9R A;  4MTE A;  3HKZ E;  3KK7 A;  4YBZ B;  1IYU A;  4HR7 B;  1EYZ A;  3CVZ A;  4RB2 C;  4B3S H;  2BDN A;  2F4V Q;  1NNX A;  5GON F;  2O2L D;  1HR0 L;  5CB4 F;  4GC6 A;  3EPI A;  3J80 E;  4DAY A;  1GUO A;  1STN A;  1GUW A;  1L0X B;  5IGB A;  1KC8 C;  1LT3 D;  4QIW B;  2I8C A;  4U6P A;  4B3T L;  1RDP D;  2CQY A;  1PH7 A;  3W1B A;  3UDX A;  2UXB H;  1NJI C;  2N88 A;  3CMA A;  3OHX C;  1GYF A;  4PMW A;  1IYV A;  2ZDQ A;  4E4T A;  4JCV E;  1UE7 A;  2JA6 G;  1S40 A;  3S16 B;  4FVM A;  4N9T A;  4UAI A;  4ZQI A;  1TII D;  1QVC A;  4ED6 A;  3GV8 B;  1G8Z D;  1MHW C;  3BYT B;  5CV9 A;  5E7N A;  4C3I B;  1S0N A;  1N33 Q;  3S1Q B;  2IX3 A;  3M4O B;  4A3F H;  5CR3 A;  4AIM A;  3G48 A;  4A93 G;  2F52 A;  5KYL A;  2JA6 B;  1DIK A;  2A1A A;  2E2I H;  3OPO A;  3OUU A;  1N36 Q;  2I80 A;  4YY3 H;  2N49 A;  2N55 A;  1I6H H;  1HR0 H;  2W9B A;  2EYF A;  2MPM A;  1BKB A;  4X66 H;  3SE0 A;  1FD7 D;  3RLF A;  5CV4 A;  2UUA Q;  1AN8 A;  2F4V H;  2FFK B;  1JOQ A;  4LF9 L;  5DG9 A;  1GO3 E;  4WFN 3;  1PH5 A;  1KIX A;  3WOE A;  1IBL L;  3F8N A;  1GSH A;  2TSS A;  2K52 A;  2OT2 A;  1DD2 A;  5KFH A;  4IRC A;  5C3E H;  2K75 A;  1JXL A;  2C2D A;  2PW7 A;  3TEH B;  1SFO H;  4IAL A;  2A8V A;  2HDM A;  4IUT A;  4NDX A;  5EQ0 A;  2QIL A;  4G57 A;  5KFV A;  4HMI A;  3D0F A;  1KBL A;  2AU0 A;  3F1Z A;  5ELD A;  3K0X A;  1Q8K A;  1BR9 A;  1D5Z C;  5C3W A;  4DR2 L;  2K32 A;  2M00 A;  5JJK A;  3MR2 A;  2Q2I A;  4ME6 A;  2JK8 A;  1YHB A;  1LTA D;  3PQI A;  2K5D A;  2PNR C;  4EGV A;  2ASB A;  1GSO A;  4R9W A;  2ATW A;  4ZYS A;  2RDG A;  2ZJQ A;  1TWA A;  2A5H A;  3ERQ A;  1ET9 A;  3NBI A;  3CRL C;  4LAA A;  4QY7 A;  3EPG A;  3MXG A;  1JWS D;  4XXE A;  4LF9 Q;  2GVA A;  2OTJ A;  2KSW A;  2G5D A;  4C1N I;  2Z9H A;  3M4I A;  2B63 B;  3HOZ H;  4CKC A;  4A93 B;  1UC9 A;  1EEI D;  5C44 H;  3E9I A;  1II3 A;  4CDD C;  1E22 A;  2K7V A;  4B08 A;  1A62 A;  2R6G A;  2GPS A;  3M3Y H;  4C1N K;  4ECZ A;  3OIP A;  3EQL C;  3CCR A;  2DY8 A;  2K1B A;  3GQC A;  2ZTC A;  4JK1 C;  1TWC A;  1SNC A;  2ID0 A;  4LF5 L;  1N56 A;  2J6S A;  4CGY B;  3FKI B;  4DV5 L;  4O3O A;  1STE A;  4JUZ A;  1VQF A;  2F4I A;  3JRX A;  4TSS A;  5KNC A;  3S14 H;  3H3V C;  3OWE B;  3ETH A;  4C3J B;  4MA0 A;  5DQH A;  4P71 A;  2FK3 A;  3UI2 A;  1K1S A;  4J1M A;  3H15 A;  2MHV A;  2ASL A;  4JV5 Q;  3UE0 A;  1CZW A;  2VQE L;  4A3G G;  2EJM A;  1OXS C;  4AQY H;  2RCN A;  2VB3 X;  3BA9 A;  1HTP A;  2PCF B;  3MFH A;  4JI6 Q;  3VR4 A;  4V0B A;  2HDL A;  2WV6 D;  4LF6 L;  3T1Y H;  1KDC A;  4LF7 H;  3S17 H;  5CV6 A;  3PW4 A;  4C5A A;  3EA6 A;  2E2I B;  3I2Z A;  1H9S B;  1PYS B;  3RTX A;  1J5E Q;  3G6Y A;  4RZQ A;  1EYC A;  1NAP A;  1CKM A;  3E6Z X;  3ITP A;  1JJG A;  4EVO A;  1I50 H;  3KLW A;  4JBW A;  1JLL B;  4WD3 A;  4F87 A;  1TXY A;  5D1O A;  4X3S A;  4JYA H;  2FXQ A;  2PI2 E;  1PK8 A;  3ER0 A;  1UAP A;  2EIF A;  3GTK B;  1X54 A;  4EX5 A;  4DV5 H;  2YL2 A;  1AEX A;  3R8B A;  4LF4 H;  4BA2 I;  4GKK Q;  1OXT A;  3FP9 A;  4WJ3 M;  5BN5 A;  3GIJ A;  5M3M B;  3KLR A;  2Z4I A;  2LXK A;  5KEE A;  5FJ8 G;  2R92 B;  5LOV F;  1PDQ A;  4A3C G;  2FK2 A;  5ISR A;  4J9M A;  4KI0 A;  1SJE D;  3PSI A;  2PYK A;  4IPH A;  2AQ2 B;  2O4X A;  3IFD A;  4EFE A;  2DJF C;  2GVB A;  1ZYR C;  3UQ8 A;  4DV6 L;  2JA9 A;  4QCL A;  1STY A;  3CCV A;  1K28 A;  3T5L A;  3JAM c;  1HNX L;  1WTO A;  3K5H A;  1EOV A;  1I4R A;  4OX9 Q;  3UFX B;  2FMC A;  2UU9 L;  2CWA A;  4MV9 A;  1C3O A;  1G6P A;  3NEM A;  1N33 H;  3H3V I;  3LNN A;  5L1J A;  1U4L A;  3GV3 A;  5HY6 A;  4HID A;  3MR6 A;  1WFQ A;  1Q46 A;  5JJZ A;  4KJO A;  3CCJ A;  3Q2O A;  4KKU A;  5FD6 A;  4J15 A;  3DM3 A;  1OXX K;  1EIH A;  1JT8 A;  2BOS A;  3S2H H;  4A3E B;  4G7Z C;  5EJW A;  1ASZ A;  2P5Z X;  5IWA H;  2D0O A;  2E2D C;  3GV7 B;  1BVS A;  3ULJ A;  1QUQ A;  4BY1 H;  3F2D A;  4BY7 H;  2HVQ A;  3BAA A;  3GV5 B;  3VR2 A;  3QR8 A;  1HFN A;  3ZYY X;  4RNO A;  3KHR A;  1JOR A;  1IW7 C;  3GTG B;  4JI1 L;  3JRW A;  2I5M X;  2YRX A;  5CMD A;  1DYQ A;  4LF6 H;  3L9A X;  2E8G A;  4IRK A;  4CHT B;  1UUP A;  2ZT9 C;  3H0G G;  3RAX A;  1STB A;  2RVL A;  5D65 A;  1N32 L;  4DR1 Q;  4JI1 Q;  4C2M B;  5KT6 A;  3GO5 A;  2B8F A;  4A3I B;  2BDO A;  5LMU H;  3D4W A;  4PZ8 A;  2MUY A;  5FLM H;  1XNQ H;  1NSN S;  4TRD A;  2ZJR A;  4XIG S;  3Q8S B;  2NVQ H;  3I4N B;  4EQ5 A;  4X62 Q;  3KDF B;  2A74 C;  3NUC A;  2W8K A;  3Q8D A;  4ID6 A;  2EJF C;  4RZR A;  3I4M H;  3CPW A;  4IJH A;  5ELE A;  2XWJ B;  4I4T F;  1HUM A;  2V1C C;  3I4M G;  1TQO A;  1ZHQ A;  3GID A;  2NUA B;  2ZM6 L;  1UE5 A;  2R93 H;  3I70 A;  1FNU A;  3IG0 A;  1VF5 C;  3X3N A;  1CS0 A;  2XD4 A;  1C7Y A;  3HXL A;  3GTG H;  3JZI A;  1RIP A;  2KCM A;  3BQ0 A;  4B3R L;  3Q6S A;  4DV7 L;  3OYY A;  1WTQ A;  3MAQ A;  2NUC A;  3VA7 A;  2E2H H;  3W1G A;  1HNZ H;  2EYP A;  1TS4 A;  1M90 C;  2RQX A;  1KXL A;  3LP8 A;  2JP1 A;  4CDC C;  1FR3 A;  3J7A F;  1TY0 A;  1RL2 A;  4C3J G;  4BY1 G;  3H09 A;  5C4X G;  3DHQ A;  3SGI A;  3OW2 A;  1XMQ L;  4L8J A;  5K5P A;  3RD4 A;  3NTI A;  1F9R A;  1VQ6 A;  1WCM G;  2K04 A;  2NVX H;  2EYJ A;  1Y1V A;  1KAW A;  1Y1W A;  4LFA L;  1BF4 A;  2P0A A;  4DL5 A;  4EYI B;  4DR7 H;  3KLS X;  3HOY H;  2AQ1 B;  4PG3 A;  1QIL A;  3PIO A;  1NTG A;  5DGA A;  3GTO A;  3NQI A;  3S1N B;  4ED2 A;  4CC6 A;  3T1H H;  3KJO A;  1TWG H;  4OHJ A;  5KFZ A;  3RBD A;  3C3L A;  4LUO A;  3AB9 A;  4H0L C;  4C56 C;  2VQD A;  1N48 A;  4DUY Q;  5JEA H;  2EYL A;  2F0N A;  2E5L L;  3BVG A;  4A3F B;  4J8Q A;  3MA2 B;  2UXC L;  2UVV A;  2NZ1 D;  4K2L A;  1O80 A;  1SN8 A;  4K5V A;  1YHA A;  1NMG A;  2EYM A;  4EQO A;  3TP6 A;  2F0S A;  3TQY A;  5L1I A;  1L2Z A;  1MKH A;  3VR3 A;  4HCS A;  3HKZ A;  4LSX A;  3K5O A;  1O7Y A;  3S1N H;  3L2P A;  1Z2P X;  3T13 A;  5KIX A;  1A3U A;  1B70 B;  4A3C H;  4ECU A;  2EE1 A;  1JOO A;  1PYB A;  3GTP A;  1JIC A;  3PMF A;  1A2T A;  4HN7 A;  4DUZ L;  1K3R A;  1STH A;  1E1O A;  3BDL A;  4J9P A;  4Y8V B;  5C0X J;  3CXC A;  4DR7 Q;  4NXN Q;  2WFW A;  4UCT A;  3OW7 A;  3Q1K A;  4ZKC B;  1SRO A;  4JI0 L;  1SYC A;  3S2H B;  4JV1 A;  1HZA A;  2JA7 H;  2EXD A;  3F2C A;  1O75 A;  4QW9 A;  3EBE A;  1YI2 A;  4ECV A;  3QG1 A;  2VQF L;  1EZ1 A;  4HJ9 A;  3VA5 A;  1K9M C;  5C1O A;  2TMP A;  3SR1 A;  2ZJT A;  1ENC A;  1FKA H;  3DMU A;  1SBB B;  4HQ6 A;  3U58 A;  5JVD F;  4A3G H;  4JI7 L;  1V1O A;  4JI8 H;  2ENB A;  1TT2 A;  3D6W A;  2C00 A;  4JVZ A;  1E2Z A;  2A69 C;  3JC6 6;  2YU9 B;  4JV2 A;  3JAM E;  2IW3 A;  4I7A A;  3JAM i;  5FPR A;  2C28 A;  4CC5 A;  1F2Z A;  2X6G A;  4JYA L;  2KEC A;  5EAY A;  1U4P A;  2JA7 A;  4OON A;  2O03 A;  3VPC A;  4AYB A;  3ND9 A;  2NTS A;  5KFS A;  5F9N A;  3Q8P B;  4NMZ A;  1G91 A;  3T1Y Q;  3RMH A;  4LF7 Q;  1CSP A;  5C44 G;  3O13 A;  1KJI A;  2DUD A;  1PH3 A;  4DL7 A;  5KG6 A;  4UCR A;  3HOZ G;  1GXD C;  3NWS A;  3CF5 A;  3FPU B;  2W6Z A;  1UEB A;  2PQE A;  3ND8 A;  1JKJ B;  1SND A;  5LMU Q;  5CV8 A;  1E4F T;  3ORR A;  1CKO A;  4P72 A;  4A3M G;  1D8L A;  4XDX A;  3A56 A;  2F0D A;  1IKM A;  2F4V L;  2LSS A;  3EN2 A;  1BDO A;  4NXN H;  2WYO A;  1QOH A;  3IFT A;  2D62 A;  1P8L A;  2E2J H;  2RSO A;  2NU9 B;  3TQT A;  3M4Q A;  4O1N A;  1QG7 A;  2FLL A;  2CW0 D;  1BOS A;  1S03 G;  3V05 A;  5KFR A;  4YY3 Q;  1S72 A;  3GTJ B;  1DV2 A;  3MJF A;  1GUT A;  2LY7 A;  1LTS D;  3I73 A;  3NGD A;  2PI2 A;  5EDW A;  2CWP A;  4FDB A;  1C48 A;  2GA4 B;  4QB4 A;  5L9X A;  1X6O A;  4K6D A;  4C3I G;  1RCV D;  4LWC A;  5IOD A;  1O7Z A;  1X3Q A;  4IZO A;  2CW0 C;  5CA0 F;  4ILW A;  4KKT A;  5JAV A;  4TV8 F;  2Q2H A;  3K80 C;  3KJP A;  1MZB A;  2L11 A;  3EYY A;  4U68 A;  3OTO H;  4LF8 Q;  2W7O A;  2Y0S B;  2WAQ E;  1MGS A;  2SCU B;  1HNW L;  3CC4 A;  1B44 D;  4CJ1 B;  3PIO 3;  4OO1 H;  3NE5 B;  1LT5 D;  3M4P A;  2YS6 A;  1M0W A;  4TQR A;  1KAB A;  5C5L A;  4A93 H;  4F88 A;  4C2M A;  4O3N A;  1NUC A;  1I94 L;  3GDE A;  1K1Q A;  4L63 B;  2QA4 A;  4B3S L;  1C4Q A;  1JE5 A;  4QUF A;  5C4J H;  3C1F A;  1E2V A;  1CM9 A;  3BDC A;  3IL8 A;  3KDF A;  3W2D A;  4EQN A;  4HED A;  2Q8R E;  1I4Q A;  4LFC L;  3PO3 H;  1T3N A;  2OWO A;  5IWA Q;  1RJQ A;  1ZET A;  5BMV F;  4Q44 A;  5J22 A;  4X64 Q;  4L5Q A;  3SDZ A;  4XQQ A;  2JA5 G;  3I4M B;  3LWU A;  4HSP A;  4KTA A;  4BWG B;  4A75 A;  4ZHQ F;  3NTK A;  5JVH 3;  4ALP A;  4Q0Y A;  5BPH A;  1E24 A;  2W7P A;  5J39 A;  3KHG A;  4O3Q A;  3M9B A;  3K6O A;  1T94 A;  2WP8 J;  1I6U A;  1CKN A;  2CCZ A;  3AFQ A;  5EBD A;  4C2M H;  5ELB A;  3W5O A;  2VR1 A;  3TP7 A;  4FS1 A;  5C3X A;  3I4O A;  4AQY Q;  1PFB A;  4IZ8 A;  4ECQ A;  4Q43 A;  4FO2 A;  3VYR A;  4DR7 L;  4PQX A;  2I5L X;  3HOX G;  1T9H A;  4MV6 A;  4PMC A;  4DR6 Q;  2CW7 A;  1VMP A;  1V43 A;  4LUV A;  3P1H A;  5FLX W;  3KYH C;  5C8Y F;  1RKN A;  3S15 B;  4EGJ A;  3CCQ A;  1HA6 A;  4ZI7 F;  3GIM A;  4G7O C;  2RDH A;  3AEV A;  3HEJ A;  3RN5 A;  1A8V A;  2NN6 G;  2YU9 H;  5IP7 H;  1PA6 A;  1E4E B;  4FU0 A;  4RHR A;  1WTH A;  3NK9 A;  4DXG A;  5M3F B;  1HTL D;  4IJL A;  2XGQ A;  1XWE A;  2EY2 A;  4A2B A;  2HIX A;  1S5D D;  3A0J A;  2W6P A;  5KFX A;  1PXU A;  2Q8I B;  2R92 H;  4JI1 H;  5K36 G;  2E75 C;  4Q0F A;  5FOB B;  2UVR A;  1D6E C;  5J2T F;  1TS2 A;  4RG1 A;  4YJ2 F;  5C4J B;  2BA0 A;  3TS0 A;  1VQ5 A;  4ZRZ A;  1KNE A;  2DY7 A;  2K4K A;  1E3P A;  2K5H A;  2WAC A;  4DUZ Q;  2W9C A;  2QK4 A;  2XRQ D;  2KEN A;  1YNX A;  3I4L A;  2WB1 A;  3RB6 A;  5IGC A;  2R3Z A;  1TU2 B;  1YJN A;  2K5N A;  2R7K A;  1N36 L;  3I12 A;  1S0O A;  3BG3 A;  4JI5 L;  3C0F B;  2WDT A;  3GIK A;  2JJQ A;  5EGT A;  2R7Z B;  3PUW A;  3HKZ B;  4O2D A;  1SYD A;  1K8O A;  4RHS A;  1VQD A;  3K5N A;  4A3M B;  1SSO A;  4DR5 H;  2KCN A;  1H9J A;  4L5R C;  3GTG A;  4QGU A;  3A5Z B;  3M4Y A;  5LL6 X;  4RNN A;  2FPG B;  1GOZ A;  1TA8 A;  5BN3 A;  3ORQ A;  1C9O A;  2ZXP A;  3R5H A;  1JDE A;  4RAY A;  3PO2 G;  4ECS A;  4DAY B;  3C2P A;  4L5S A;  1UNN C;  1HPC A;  1XX8 A;  3CQZ H;  2R7M A;  2JA8 B;  5L37 A;  5LMN L;  4OXP A;  3CCS A;  3GTQ A;  1KQS A;  2CH4 W;  5KFQ A;  4CKE A;  1KRS A;  2MO0 A;  2N8N A;  4MIU A;  2AQ4 A;  2OCE A;  1CHP D;  1X3G A;  3F2U A;  4OX9 H;  3HOW G;  4A3E H;  4DR1 L;  1PH4 A;  5KFI A;  4RH6 A;  3D8G A;  2CQO A;  5JJI A;  3RZO H;  5D1O B;  2F0Q A;  3TQ1 A;  1B3A A;  1F2L A;  2KHI A;  2ZM6 Q;  1X55 A;  2HQE A;  5COR A;  3ZJY C;  3HOU B;  5C3E B;  1SAP A;  1SEI A;  4A3J B;  4QWB A;  4HTH A;  4Y7N H;  2YTV A;  1GD7 A;  3L3O C;  4LFA H;  4Q45 A;  2IBK A;  4DR5 L;  2Z6K A;  3A8J E;  1VBG A;  2F0F A;  4K0K Q;  1NE3 A;  2AGO A;  1WYD A;  4JV5 L;  1TS5 A;  1YJ9 A;  5A2Q W;  5DQG A;  5I6W A;  1Y1W G;  4IO9 A;  3P75 A;  2F3I A;  1PTO H;  4A3D H;  4GKJ H;  2IWH A;  3KFU A;  3HFZ B;  4HNV A;  2E74 C;  4X64 L;  4UDU C;  2NVT H;  1CQF A;  1ESF A;  1NMF A;  4IPG A;  4IQZ A;  1WTW A;  2JA7 B;  1Y1V G;  1TWF B;  3HG9 A;  3TSS A;  1SMY C;  1I50 B;  1W6J A;  1X3F A;  4AYB B;  1ZYR D;  1WJJ A;  1SYE A;  4BXX H;  4B3S Q;  1GSA A;  3MHB A;  1AE2 A;  1QWY A;  5F2D A;  5DLG A;  3BZD B;  3J7A V;  2NVY B;  3QO2 A;  1Y1W B;  4HIO A;  5M5X B;  1KDA A;  1JQY D;  2V59 A;  4MHE A;  2JEJ A;  4ETS A;  5ELC A;  1M1K C;  4NXM L;  1XPR A;  3LWB A;  1KRT A;  4QWA A;  1ZHS A;  3OIQ A;  1I4G A;  3GTJ H;  1U4R A;  4QL5 A;  1YIJ A;  4X62 H;  2ZXO A;  1B4O A;  3NTH A;  1UE1 A;  1EIF A;  2XVS A;  1PV4 A;  1XNQ Q;  1HNX H;  1PZK D;  1VQC A;  4H7B A;  5ELN A;  4A3B H;  3J81 j;  1AUX A;  2VOB A;  2R87 A;  3PVX A;  2BA1 A;  2ASD A;  1LLR D;  1ET6 A;  2R7Z H;  2FJZ A;  3RGX A;  4FXK C;  4DAM A;  4GN5 A;  4DV1 Q;  1XJV A;  5KFA A;  5G3L D;  4A4I A;  3L0O A;  1QZG A;  4DN4 M;  1EUC B;  1ZQ7 A;  5J1Z A;  4Y52 H;  3GTJ A;  5BPF A;  2NBF A;  1TWF H;  3V4S A;  1DON A;  3P20 A;  4RNM A;  2A6H C;  5KG2 A;  4GLV B;  1JX4 A;  4PWQ A;  4KHP H;  2ZXR A;  4YR0 A;  3N44 B;  3PO2 B;  1F9P A;  2PMZ A;  4YB8 B;  4DV2 H;  4XYL B;  1CZG A;  4JI8 Q;  1EOT A;  2OLS A;  2FLP A;  1C0A A;  4YHH H;  1IBK Q;  1PTO C;  2YZM A;  3KTM A;  2NVX A;  1VBH A;  3EIV A;  2FPI B;  2JEG A;  2RA4 A;  3FKI A;  3RZD H;  3CCU A;  2Q8T A;  5JUM A;  3HS0 C;  1O7L A;  2IX1 A;  2L1B A;  4LFC H;  1DOL A;  3HKS A;  3U9S A;  1VQI A;  4DV3 Q;  3ULL A;  3KF6 A;  4CBV A;  2PPB C;  1VMC A;  4JI6 L;  2JEB I;  2RGV A;  1S5F D;  1YEZ A;  3GP7 A;  2XNA C;  3RZO B;  3UDI A;  5BR8 L;  2HVR A;  2DNC A;  2SNM A;  3PW2 A;  5CAE B;  4C5C A;  2DIK A;  1JIH A;  4FXD A;  1Y69 U;  3T51 B;  3F2B A;  5KFW A;  3S1R B;  2MJ8 A;  4KN7 C;  3BQ2 A;  4GC7 A;  3DWA A;  1N9W A;  3M9O B;  4ULL A;  4LMY A;  2DLN A;  4ZAI A;  3GTM A;  4A3G B;  1IBK L;  1BJT A;  2QDL A;  3PUY A;  5DQI A;  4DV2 L;  1FGB D;  1B33 N;  3JSN A;  5KFO A;  1IBM H;  1HFG A;  4X65 L;  3K0Y A;  3DWP A;  1E2W A;  4RGT A;  5A2Q L;  2RHS B;  3HB9 A;  2CW8 A;  3PW5 A;  5NUC A;  1JB3 A;  1VQ8 A;  1RTO A;  2A6H D;  2ICE C;  1KJ8 A;  3OTO Q;  4N8F A;  1CT1 D;  5COY A;  1RJT A;  3KAK A;  3CQZ A;  3A8I E;  4DV4 Q;  1WTR A;  1VDZ A;  2F0O A;  2FE3 A;  2R82 A;  3MEH A;  5C4H A;  5KG3 A;  2C5C A;  5KFK A;  2VL6 A;  4BBR G;  5IP9 H;  3GTM H;  4WBN F;  3PF4 A;  3U9T A;  3PIP 3;  1Y1V B;  3HOV H;  3CCL A;  2NN6 I;  1I4X A;  4KHZ A;  3MFY A;  4DV0 H;  1EL0 A;  1VS0 A;  5KFL A;  3VPB A;  1PRT D;  3I3C A;  1MSG A;  1B8A A;  4KV6 A;  1TAE A;  3PO3 B;  2XC9 A;  5KFB A;  1PVO A;  1NR4 A;  1FJG Q;  2LKV A;  3GD7 A;  4K14 A;  3CP0 A;  4M8A A;  2NZO A;  2QGQ A;  1FGU A;  3FDT A;  2NVX B;  5IT9 E;  4HNT A;  4N9P A;  1XNR Q;  1A9X A;  1PFN A;  2UUB L;  2V58 A;  1RK5 A;  3R5F A;  4KLK A;  2C2E A;  3K59 A;  4F8M A;  3J7Z C;  2K50 A;  4YJ3 F;  4DV3 H;  2EQS A;  3OMG A;  1CI3 M;  1TWH A;  3U4V A;  3GTL H;  1DM0 B;  1VQE A;  1HZB A;  2PVP A;  3K5I A;  4MV8 A;  2F03 A;  2KBN A;  1Z47 A;  1FNV A;  2KCC A;  3J7Y W;  4IOC A;  1A3T A;  4HMJ A;  3KHL A;  1S9F A;  4UCU A;  1EY0 A;  2WAQ A;  3CC7 A;  1G2S A;  2C35 B;  3BYY B;  4HJA A;  1J5E H;  1MJE A;  2M05 A;  4EYH B;  4DR6 H;  1UEA B;  2J9G A;  1GJX A;  4J9K A;  4CDF C;  2YV5 A;  1Q1B A;  5FLX E;  4Q8F A;  2R7Z A;  5C0X H;  3BZC A;  3H20 A;  2KHS A;  5IYC G;  3FEW X;  3KF8 B;  2R85 A;  4F4X A;  2Q2U A;  3LML A;  3MWM A;  3A55 A;  5FO9 B;  4XYQ A;  5DEH A;  5I6Y A;  4CKB A;  4P74 A;  2K6A A;  1XMO L;  3J81 E;  4A3K G;  1O78 A;  1ROD A;  1EY8 A;  3JAM W;  4TQU S;  1MI2 A;  5IYD G;  4GLA C;  5K2M A;  2HJW A;  2AKW B;  4DV1 H;  4XYO A;  3G6E A;  1QNU A;  4ZQ3 A;  5CBE E;  4M1U B;  1FJG L;  2D2C C;  3D4D A;  4YR3 A;  2AHO B;  4M7E A;  4DK1 A;  3KAJ A;  1KNA A;  3A7A B;  2J6U A;  2HIV A;  3WDN A;  3RJ0 A;  2B2Y A;  1H9S A;  2M9V A;  2UU9 H;  3SI8 A;  3Q24 A;  4GKJ L;  5C5J A;  4PNY A;  1IBL Q;  1LM0 A;  3NSW A;  3KOJ A;  4NPS A;  4R8N A;  1XNR H;  1HZ9 A;  1AZP A;  2ZDH A;  1SE8 A;  4LJZ C;  5HBR B;  1IZ6 A;  4A3B G;  2HUG A;  4YQW A;  3GIP A;  4ZKB B;  3K57 A;  2K05 A;  3OWF A;  4ED0 A;  3NXW A;  4UP8 A;  1EQR A;  2HCC A;  3HOZ B;  1NR2 A;  2CZG A;  4RCN A;  5CC4 A;  2EY5 A;  2QKI C;  3PF5 A;  4DV2 Q;  4NKL A;  5KYI A;  4WJ4 A;  5FLX L;  1W96 A;  3VPD A;  4DK0 A;  3NEL A;  3RN2 A;  2FKL A;  4JI3 H;  3TIG A;  2B2U C;  3K8A A;  3BA8 A;  4JI8 L;  1F2M A;  4JOI A;  1VQJ A;  1X3E A;  5E4W C;  3PR4 A;  4BXX G;  5IIF A;  3S1M B;  3OSO A;  1YNJ C;  2FB9 A;  1WD1 A;  3OTO L;  4F4W A;  1HNW H;  2W6N A;  1EU4 A;  1HQR D;  2E2J B;  2HVS A;  2RDF A;  1Y1V H;  1XTC D;  3HBL A;  1S5C D;  4HJ8 A;  2NVY A;  2CKZ B;  5ELF A;  1C8C A;  5JQW A;  1Z7T A;  5M5W B;  5JH7 F;  2JXM B;  1WVL A;  4FS2 A;  4ME3 A;  2BQ3 A;  4FNF A;  3FMC A;  1KDB A;  5IE8 A;  4IFD J;  1V1P A;  3BDO A;  3RZD B;  1AFP A;  4J9N A;  2HHH H;  1EQV A;  5M9O A;  4A76 A;  3N42 B;  3S16 H;  3KBG A;  2PZT A;  3BVM A;  1X9N A;  4EFB A;  4ME5 A;  3I7F A;  2WKC A;  4POG A;  2N3S A;  3WNZ A;  3T5J A;  4RCO A;  2L4N A;  3CHB D;  3HOW H;  4IFD I;  1IXR A;  3RIZ A;  4H02 A;  1VQM A;  4HR7 A;  5KFT A;  5D14 A;  4DF7 A;  2R7L A;  1STG A;  2H5X A;  1QJO A;  4JW0 A;  5M3F H;  1SFO A;  2KEE A;  1GGO A;  4R8U A;  4LF4 Q;  3MVV A;  2F3W A;  3RUP A;  4QIW A;  1I7N A;  1PZJ D;  3OSP A;  1DCZ A;  2K03 A;  2AUJ D;  1F77 A;  1ULZ A;  1W6K A;  5BN4 A;  4QWE A;  3GQB A;  2K5W A;  2AQ3 B;  2VQF Q;  4B3R H;  4S3S A;  3JAM L;  3HOY B;  5IT9 L;  5IGG A;  1EY6 A;  2GLT A;  3T56 B;  4LSA A;  2UVW A;  2OQ0 A;  4P75 A;  5KT5 A;  1HXY D;  2B2V A;  4QMG A;  2F0V A;  1WTV A;  3MZ5 A;  1LT6 D;  3GTQ B;  4TV9 F;  4XX0 B;  2PZU A;  3R2T A;  4POF A;  4K8J A;  4O42 A;  1I4H A;  2VUM H;  2N78 A;  3AQQ A;  4FBT A;  4NLG A;  1Z2N X;  1STA A;  3F8T A;  1LV9 A;  1Q1E A;  3M7N A;  1HNW Q;  5IYB G;  2YTX A;  1T36 A;  2B2T A;  1OXU A;  1HJP A;  1TKW B;  4DR3 L;  3V4Z A;  2BR0 A;  3GTM B;  1B50 A;  1BBU A;  1QVG A;  5I9O A;  2LMC B;  1XDN A;  1VQA A;  3SXH A;  2UXB L;  1EUD B;  2LFN A;  4KD4 A;  4J0M A;  4F50 A;  5IGE A;  3UDF A;  1IBK H;  1BBW A;  2AWN A;  1BGW A;  1N34 H;  2W9B B;  5IT9 c;  4UPA A;  3PUV A;  5JOB A;  1EFW A;  2BH2 A;  4K0K L;  5KG4 A;  2E76 C;  5KT3 A;  3Q8R B;  3CQZ B;  1WCM B;  4GN3 B;  2NWG A;  4M9U A;  4DNT B;  3QOJ A;  5AJ3 L;  4DR2 H;  3TP5 A;  3BS1 A;  2NN6 H;  4A3K B;  3ONA B;  5FKA C;  4X66 L;  4WJW A;  1E4E A;  4MV3 A;  5KFN A;  3BVZ A;  4EBD A;  2XIW A;  4ABN A;  2FLN A;  2ZM6 H;  4QUC A;  5LA6 F;  3E9H A;  2IP4 A;  3HOX H;  4HJ5 A;  3M4O H;  1ICF B;  3IN5 A;  3EFX D;  3D3R A;  1WSC A;  4MN3 A;  4PV1 C;  2LS0 1;  4I7Z C;  4B9X A;  2B63 H;  4JI4 H;  1YNJ D;  1EWC A;  2J7Z A;  1HZC A;  1UNS A;  1B7Y B;  4MZ9 A;  5KGU A;  2ASJ A;  2K01 A;  2GN5 A;  4IUV A;  1KJQ A;  2UUA H;  1KD1 C;  3UDG A;  4O4H F;  2W9A A;  2FMM A;  4QF4 A;  4KY5 A;  1E7Z A;  4ZK9 B;  3OHB A;  1TWH B;  1KAA A;  1EEF D;  3MXN B;  4C3H G;  2JA5 H;  3J81 c;  2B63 A;  3VR5 A;  2G9D A;  1PYW D;  3L7Z C;  1RJR A;  3IRB A;  2SNS A;  2JA8 G;  3FMA A;  4UCO A;  1EZ6 A;  2EJG C;  4HAE A;  1VQL A;  3PO3 G;  2L12 A;  1SFO B;  4RA8 A;  4YCU A;  3S2D B;  1SDF A;  3K5M A;  3H40 A;  5C44 B;  3K7U C;  3BJY A;  1W2B A;  4EEQ A;  1SYX B;  1JWU D;  5EPK A;  5T1G A;  5EWF A;  4DV5 Q;  1HR0 W;  1X3P A;  1N36 H;  1J5E L;  3CCE A;  5JVL A;  2BQU A;  4LF5 Q;  1Q8I A;  1R4Q B;  2NZH A;  4C3H B;  1J9O A;  4JI2 H;  4DKA C;  5KFU A;  1M8A A;  4FF2 A;  4DUY H;  3QJY A;  1QCB D;  3PUX A;  3J7A 5;  4OO1 G;  3DF7 A;  5IT9 W;  3T5K A;  1IL8 A;  5JVG 3;  3CC2 A;  2R93 B;  4J6H A;  2ZTD A;  4FP5 D;  1KHI A;  1WTP A;  5KT4 A;  4DGZ A;  5IYZ F;  5JPN C;  1LUZ A;  4JBM A;  1C30 A;  2A68 D;  5DLQ E;  2EPB A;  1GKH A;  5KG7 A;  2VPQ A;  4NW2 A;  4YWL A;  3CW2 C;  4OGQ C;  4C3I H;  2I0Q A;  5CYU A;  3K3P A;  5CBA E;  3S15 H;  1ICW A;  3J80 L;  5M3M H;  1WTX A;  2W70 A;  4U7C A;  2CHB D;  1K8M A;  1EYG A;  1BO0 A;  1XNQ L;  2VQE H;  2VUM B;  5E3F A;  3TDQ A;  5KNB A;  1L1O C;  2B2W C;  3OMC A;  3N6X A;  4UCV A;  3QZ8 A;  3I90 A;  3K5L A;  1V4Y A;  4DV6 H;  2R8J A;  3MFG A;  3FKI G;  3FVQ A;  2D9U A;  3Q8Q B;  1HUN A;  1WCM A;  3A8K E;  1GLV A;  2DPJ A;  1TWF A;  1D5X C;  2VA2 A;  2UXC Q;  1AUV A;  5KFC A;  3Q23 A;  4A3M H;  4RWS C;  4F4Y A;  3Q22 A;  1KEE A;  4IAJ A;  2VQF H;  1K73 C;  2C9O A;  2DWC A;  5KT2 A;  4KHP Q;  4IUP A;  1SXT A;  3RBE A;  4J9S A;  4DNR B;  1G2T A;  2AGP A;  4QWC A;  2IX0 A;  1EQQ A;  4Q8E A;  1JMC A;  1VQN A;  4OEL B;  4ECY A;  1L2F A;  4XYM B;  1HNZ L;  2F0M A;  5D1P A;  2YRW A;  1YZ6 A;  3TZD A;  2MGS A;  3N43 B;  1HA5 A;  2I5H A;  3KAL A;  5D8D A;  4JBK A;  5JPM C;  1R9T B;  2X0S A;  1LTT D;  4JI6 H;  1DGS A;  2SOB A;  1ASY A;  1D7Q A;  4B3M Q;  2W6O A;  1EY5 A;  3NQT A;  5IGD A;  1I3Q A;  4B3M L;  4BY7 B;  1S5E D;  3CPF A;  5KG5 A;  1JE4 A;  1SRU A;  1PFM A;  3EJI A;  1LTR D;  4RKL A;  3N52 A;  4A3I G;  4DV4 L;  4PZ6 A;  4DL4 A;  2O5J C;  3MR3 A;  2RGR A;  5H80 A;  1SR3 A;  2W9C B;  4KD3 A;  1JOK A;  1LT4 D;  2PMZ B;  3I4N G;  2MNA A;  1A63 A;  2AGQ A;  4ZOL F;  4DLK A;  3Q0A A;  1VQG A;  2IMW P;  1MIU A;  2F0T A;  1FJG H;  3DUZ A;  1JJ2 A;  1YBY A;  2R6F A;  2JYO A;  4PMB A;  5KFE A;  4YY3 L;  1Q7Y C;  3C1E A;  3H94 A;  1TWC H;  2JA7 G;  2E5L H;  3R23 A;  2UXC H;  2EVB A;  3PZP A;  3HKZ G;  3MWY W;  2K33 A;  3G6J B;  3S1R H;  4RUC A;  2HGS A;  4L1K A;  1CSQ A;  3FHW A;  1V9P A;  1RF2 D;  5IGF A;  2PN1 A;  5KFY A;  5T1I A;  4DR3 Q;  5IOC A;  4LH6 A;  1Q81 C;  1RJP A;  2JQO A;  5KFF A;  4HCE A;  2UUC L;  1JDB B;  4LFB H;  5LMU L;  2BH8 A;  4DAP A;  3BZK A;  4TVA B;  4ZCK A;  3K3V A;  3LX0 A;  1S97 A;  2AUK A;  3J80 c;  1LAB A;  5AFW A;  4DFA A;  2JA6 A;  2H1E A;  2FPP B;  1XMQ H;  5G3L F;  1E0B A;  1EFI D;  3MTS A;  4APV A;  1D2B A;  2YW2 A;  1SNP A;  3TIN A;  4KN4 C;  4YP3 A;  5M5Y B;  1IW7 D;  3DM1 A;  1PTO F;  3GV6 A;  4XTC S;  3PW0 A;  3GTK H;  1HRJ A;  1VCI A;  2EY6 A;  4BBS B;  4DV3 L;  2UUB Q;  5JEA G;  2JEF A;  2EZV A;  3GTK A;  1EIG A;  4JBJ A;  3PGZ A;  4H13 C;  1SNO A;  1QZH A;  1A15 A;  5EPL A;  2R7F A;  1VF7 A;  1DOK A;  1NBW A;  3HGB A;  4N8X 1;  2MQH A;  5J3B A;  3TP8 A;  1Y8P B;  2FHT A;  3I4N H;  1MJC A;  1CQJ B;  4UCS A;  3HOY G;  4LFB Q;  2YS7 A;  4C5B A;  4KY7 A;  5T14 A;  4H44 C;  4LF8 H;  4RGO S;  4A3I H;  1PHJ A;  4LFB L;  3TS2 A;  3X3M A;  5TSS A;  1T5X D;  2OQK A;  1WCM H;  4DR4 Q;  1K83 A;  2WTF A;  3P7J A;  1AP0 A;  4IRD A;  5IY0 A;  4KHV A;  1V51 A;  1PTO D;  1LYL A;  2OF1 A;  2DGY A;  1OXV A;  5EKK A;  1RYR A;  1ILQ A;  5C4X H;  2YYA A;  4IR9 A;  4C3J H;  2AWO A;  5DAU A;  4BBR B;  5LXT F;  4L5T A;  4DAV A;  4O2B F;  3BQ1 A;  3N40 P;  2MCT A;  4HNU A;  3VYT A;  4I55 F;  4LK1 C;  1IL2 A;  2O5I C;  2VUG A;  5L1L A;  4I65 A;  2DPI A;  2PNH A;  1IBM Q;  5JEA J;  1SMY D;  3D4R A;  4F4Z A;  4GNX B;  1CA6 A;  1DXM A;  4KMU C;  4X3K A;  3H4D A;  4DL6 A;  2XIG A;  3PCO B;  3SE7 A;  1JCK B;  2RHQ B;  3S17 B;  1DOM A;  5I9P A;  2R7D A;  1SE4 A;  2OEO A;  5FPO A;  2IT1 A;  1M0T A;  4ECW A;  1YHQ A;  2EOT A;  4LUZ A;  2R93 G;  3V6K A;  2HCI A;  3V6J A;  3PIP A;  2I87 A;  1SEB D;  4GOP C;  2UVU A;  1K83 H;  1VKZ A;  1M6V A;  4OIK A;  3R3O A;  2NU7 B;  2L5T A;  4Q5V A;  2V9W A;  4DUY L;  4NXN L;  2WKD A;  3FKI H;  2EYH A;  4CJ0 B;  5D3I B;  1I6H B;  3RB4 A;  4CDE C;  5I4D A;  1UC8 A;  3MXP A;  2DN8 A;  2PMZ E;  3I56 A; 
#chains in the Genus database with same CATH homology
 4NXN Q;  1HR0 Q;  2WFW A;  5FLM G;  1IBM L;  4PZ7 A;  1AE3 A;  1SRO A;  4P74 A;  5GAG C;  1XMO L;  5M3M G;  4JI0 L;  4HIM A;  1N34 Q;  1HZA A;  4R4O A;  4A3K G;  2ZTE A;  1SMX A;  1X56 A;  3G71 A;  2JA7 H;  2B3G A;  2EXD A;  3TRE A;  3F2C A;  4JI4 Q;  1A0I A;  3H0G H;  4TQU S;  3EBE A;  1YI2 A;  3ICE A;  4JOI C;  2LXJ A;  5IYD G;  4YWK A;  2VQF L;  4B3T Q;  4GLA C;  4HJ9 A;  4A3E G;  2AKW B;  1N34 L;  3G6E A;  4JG2 A;  1K9M C;  4JI2 L;  1TWH H;  3TRZ A;  2MFI A;  5FLX c;  5AJ3 Q;  3I55 A;  1FJG L;  1R9T H;  3PUZ A;  1N32 Q;  4BY7 G;  5GAD C;  2AHO B;  4A3L G;  4AQY L;  1GM5 A;  3CD6 A;  3LGJ A;  5GQO A;  1XTD A;  4GS3 A;  3U58 A;  2IHF A;  2HIV A;  1PH9 A;  1JB7 A;  3AFP A;  5ELO A;  2KHJ A;  4JI7 L;  4A3G H;  4GKJ L;  3PO2 H;  4RMF A;  1Y14 B;  1LM0 A;  1YVC A;  3KOJ A;  4NPS A;  1E1T A;  3G4S A;  2XGT A;  2QEX A;  3RNU A;  3T1H Q;  1HZ9 A;  1OTC A;  2JE6 I;  1SE8 A;  3JC6 6;  2B29 A;  4JI5 Q;  1CKN B;  1WOC A;  2HHH Q;  3GTO H;  4UP9 A;  3GTP H;  1GVP A;  4P73 A;  1IZ6 A;  4R1J A;  4A3B G;  4YCW A;  3H3V H;  3JAM i;  2A19 A;  3DLL A;  4DR4 L;  4DV1 L;  4JYA L;  5EAY A;  4OX9 L;  4UP8 A;  1EQR A;  2UXB Q;  1VQH A;  4QJF A;  4R4Q A;  4QQB X;  2MO1 A;  4MTN A;  1K0R A;  4OON A;  1H95 A;  2JA8 H;  3PF5 A;  1PFS A;  4LFC Q;  4DV2 Q;  4WJ4 A;  1VQB A;  3T1Y Q;  4GOP A;  4LF7 Q;  3NEL A;  3RN2 A;  2UXD Q;  1CSP A;  5C44 G;  3K8A A;  3MEF A;  2DUD A;  4C3H H;  3T1Y L;  4JI8 L;  1PH3 A;  4LF7 L;  4JOI A;  1VQJ A;  1X3E A;  3U4Z A;  3HOZ G;  4BXX G;  1I5F A;  1WI5 A;  3RR5 A;  3OTO L;  3CF5 A;  3CCM A;  4UY8 C;  1UEB A;  4YHH L;  5M5X H;  5LMU Q;  3B6Y A;  1CKO A;  4JYA Q;  1Y1V H;  4P72 A;  4YHH Q;  4A3M G;  4HJ8 A;  4YCV A;  2K5V A;  2CKZ B;  1D8L A;  4DK6 C;  4KHP L;  2Y0S E;  2R92 G;  2E5L Q;  5FJ8 H;  2WB1 G;  2LSS A;  3EN2 A;  4A3J G;  2B63 G;  2F4V L;  2IHE A;  2D62 A;  1P8L A;  1L1O B;  3S24 A;  2E2J H;  3S1Q H;  4DNI A;  3M4Q A;  1V1Q A;  2WB1 E;  4ME3 A;  2JEA I;  5IE8 A;  3CAM A;  5IP7 G;  4OWW B;  4R4C A;  4IFD J;  4NB3 A;  2ZJP A;  1TWA H;  3E0E A;  4YY3 Q;  4A76 A;  3VDY A;  1S72 A;  3S16 H;  2YTY A;  1X9N A;  4GNX A;  2PI2 A;  2CWP A;  2UU9 Q;  4FDB A;  4NXM Q;  1X6O A;  3I7F A;  4LWC A;  1XPO A;  4POG A;  2N3S A;  1QVF A;  1JJC B;  1Q12 A;  3T1H L;  1U5K A;  3HOW H;  4IFD I;  2Q2H A;  1IXR A;  3K80 C;  4H02 A;  3KJP A;  1VQM A;  4JI4 L;  4LF8 Q;  2H5X A;  3J81 i;  2WAQ E;  5M3F H;  4JI0 Q;  3HKZ E;  1HNW L;  4IOA A;  2F4V Q;  3CC4 A;  1HR0 L;  4LF4 Q;  2UUA L;  3A74 A;  3M4P A;  1KC8 C;  4A93 H;  2VQF Q;  4B3T L;  4JI3 Q;  1X65 A;  5IYB H;  3W1B A;  1PH7 A;  3GDE A;  1I94 L;  3U50 C;  3UDX A;  1NJI C;  2QA4 A;  3CMA A;  4B3S L;  2OQ0 A;  4P75 A;  1JE5 A;  4PMW A;  5C4J H;  3K7A H;  2VUM G;  3KDF A;  1S3O A;  4JCV E;  1UE7 A;  4POF A;  4LFC L;  1S40 A;  2JA6 G;  2OWO A;  3PO3 H;  5IWA Q;  2VUM H;  2N78 A;  3AQQ A;  1J6Q A;  1QVC A;  5M5W H;  1O7I A;  1LTL A;  5IWA L;  3F8T A;  5E7N A;  2YYZ A;  1UWV A;  4X64 Q;  1IBL Q;  4L5Q A;  1N33 Q;  1Q1E A;  3M7N A;  4A3F H;  4AIM A;  2YTX A;  3G48 A;  5IYB G;  2JA5 G;  3CME A;  1HNW Q;  4A93 G;  5GRO A;  2F52 A;  4A75 A;  1OXU A;  1HJP A;  5BR8 Q;  4DR3 L;  2A1A A;  4ALP A;  1E24 A;  1BBU A;  1QVG A;  2E2I H;  1VQA A;  1Q86 C;  2UXB L;  3M9B A;  1N36 Q;  2N49 A;  1FL0 A;  1I6H H;  4YWM A;  2WP8 J;  1HNX Q;  5M3F G;  1BKB A;  1CKN A;  2CCZ A;  3AFQ A;  3RLF A;  3UDF A;  1BBW A;  2AWN A;  4C2M H;  3GTQ H;  4GKK L;  2UUA Q;  2VS1 A;  3W5O A;  5IT9 c;  4UPA A;  3PUV A;  4GN4 B;  1EFW A;  2BH2 A;  4K0K L;  3I4O A;  4AQY Q;  2Z6K C;  4GN3 B;  4AH6 A;  4LF9 L;  2HT1 A;  1GO3 E;  4DR7 L;  2I5L X;  3HOX G;  1T9H A;  1PH5 A;  4DR6 Q;  1KIX A;  1IBL L;  5AJ3 L;  1G51 A;  1V43 A;  2K14 A;  2K52 A;  4LUV A;  3KYH C;  5C3E H;  2K75 A;  4X66 L;  3CCQ A;  3TEH B;  2L15 A;  1SFO H;  4DR6 L;  2A8V A;  3AEV A;  3RN5 A;  1A8V A;  2NN6 G;  3D0F A;  5IP7 H;  3F1Z A;  5C3E G;  1PA6 A;  2YU9 H;  3K0X A;  1Q8K A;  4JI2 Q;  4IJL A;  3E9H A;  4DR2 L;  4LF6 Q;  3HOX H;  4HJ5 A;  3M4O H;  5JJK A;  2Q2I A;  2HIX A;  2JK8 A;  3A0J A;  1YHB A;  2B63 H;  2R92 H;  1HZC A;  5K36 G;  1B7Y B;  4MZ9 A;  4JI7 Q;  2ASB A;  2GN5 A;  2ATW A;  2UXD L;  4LW1 A;  2ZJQ A;  3CXC A;  4RG1 A;  1YJW A;  1KD1 C;  2BA0 A;  4QY7 A;  3UDG A;  3TS0 A;  1VQ5 A;  2ES2 A;  4LF9 Q;  2K4K A;  2GVA A;  2K5H A;  1E3P A;  2OTJ A;  1E7Z A;  4DUZ Q;  3HOZ H;  3MXN B;  2KEN A;  1YNX A;  3STB D;  3E9I A;  5C44 H;  4A3F G;  2JA5 H;  3J81 c;  1E22 A;  2VY3 A;  1A62 A;  2R6G A;  3L7Z C;  1YJN A;  2K5N A;  1N36 L;  3IRB A;  5GAH C;  2JA8 G;  3M3Y H;  3CCR A;  4JI5 L;  2JJQ A;  1VQL A;  3PUW A;  3PO3 G;  2JA6 H;  2ZTC A;  1L0W A;  4O2D A;  4AYB E;  4YCU A;  2ID0 A;  4LF5 L;  3AYH B;  1VQD A;  3STB C;  3K7U C;  4DV5 L;  1W2B A;  2Q2T A;  3A5U A;  1VQF A;  4L5R C;  3S14 H;  4QGU A;  3A5Z B;  4DV5 Q;  1HR0 W;  1J5E L;  3M85 A;  3CCE A;  4P71 A;  4LF5 Q;  1NY4 A;  2NZH A;  1EIY B;  3H15 A;  5M5Y H;  1C9O A;  4DKA C;  1U0L A;  4OWT B;  3PO2 G;  4JV5 Q;  4DAY B;  4L5S A;  3UE0 A;  3CQZ H;  3PUX A;  1SLJ A;  4R4I A;  4AYB G;  2VQE L;  3J7A 5;  4A3G G;  4OO1 G;  1OXS C;  2NVY H;  4QIW E;  5LMN L;  4OXP A;  3CCS A;  2RCN A;  3CC2 A;  2ZTD A;  1KQS A;  1KHI A;  2Y0S G;  4IPC A;  4JI6 Q;  4DR2 Q;  4LF6 L;  1KRS A;  1LUZ A;  2MO0 A;  2N8N A;  3BU2 A;  4JBM A;  3S17 H;  2OCE A;  3S2D H;  1X3G A;  5DLQ E;  3HOW G;  1EWI A;  4A3E H;  4DR1 L;  1GKH A;  2Z0S A;  1PH4 A;  1Z9F A;  3I2Z A;  1PYS B;  3RLO A;  1J5E Q;  4LF4 L;  2CQO A;  5IYD H;  4YWL A;  3RZO H;  5JJI A;  3CW2 C;  1CKM A;  4C3I H;  2I0Q A;  1JJG A;  1I50 H;  3KLW A;  2KHI A;  4JBW A;  2ZM6 Q;  1X55 A;  3ZJY C;  4LF8 L;  4A3K H;  1TXY A;  3S15 H;  2FXQ A;  5M3M H;  4Y7N H;  2PI2 E;  1EYG A;  3ER0 A;  2YTV A;  1XNQ L;  1GD7 A;  4LNQ A;  2EIF A;  1X54 A;  4EX5 A;  2UUC Q;  4DR5 L;  2Z6K A;  1L1O C;  4K0K Q;  1NE3 A;  1WYD A;  4JV5 L;  1YJ9 A;  4BA2 I;  5IYC H;  4GKK Q;  1OXT A;  1Y1W G;  4IFD G;  4IO9 A;  3FKI G;  3FP9 A;  5C0X G;  2F3I A;  1I94 Q;  4WJ3 M;  4DK3 C;  4A3D H;  1I3Q H;  4A3J H;  3KFU A;  3HFZ B;  4X6A H;  5FJ8 G;  2LXK A;  1N33 L;  4X64 L;  2NVT H;  4A3C G;  1NMF A;  2PQA A;  3PSI A;  4IPG A;  4KI0 A;  2UXC Q;  4A3M H;  4IPH A;  1Y1V G;  1EUJ A;  2GVB A;  1X3F A;  4DV6 L;  1K73 C;  1VQP A;  2JA9 A;  1WJJ A;  3CCV A;  4HJ7 A;  1PH1 A;  4B3S Q;  4BXX H;  4KHP Q;  1AE2 A;  1HH2 P;  1KL9 A;  3JAM c;  1HNX L;  4JC0 A;  2D0P A;  3ULP A;  1K8G A;  2IX0 A;  2KCT A;  4HIO A;  1EOV A;  1EQQ A;  1JMC A;  4OX9 Q;  1VQN A;  1L2F A;  1HNZ L;  4DV7 Q;  1M1K C;  2UU9 L;  2CWA A;  1XPR A;  4NXM L;  4B3R Q;  1KRT A;  1YZ6 A;  4LFA Q;  1G6P A;  3NEM A;  4HIK A;  3GTJ H;  4GLX A;  1YIJ A;  3H3V I;  1L1O A;  4QL5 A;  2I5H A;  4GNX C;  2RF4 A;  5HY6 A;  4JBK A;  4HID A;  1WFQ A;  1N8R C;  1UE1 A;  1Q46 A;  1DGS A;  1EIF A;  3CCJ A;  1PV4 A;  1ASY A;  1XNQ Q;  1D7Q A;  1VQC A;  4B3M Q;  5ELN A;  4A3B H;  4J15 A;  4OWX B;  3J81 j;  3ERS X;  1VQ4 A;  4GKJ Q;  4B3M L;  2BA1 A;  3DM3 A;  3CPF A;  5HGQ A;  1OXX K;  2R7Z H;  2VW9 A;  1A63 A;  1SRU A;  4DAM A;  4GN5 A;  1JT8 A;  4DV1 Q;  1XJV A;  4A3I G;  1QZG A;  4A4I A;  3L0O A;  4PZ6 A;  3UE1 A;  4DV4 L;  3S2H H;  1P16 A;  4BA1 I;  4Y52 H;  1ASZ A;  3D31 A;  1TWF H;  3HOV G;  1SR3 A;  2D0O A;  1VQO A;  3I4N G;  4A3L H;  5GAE C;  4JI3 L;  1BVS A;  4GLV B;  1QUQ A;  3ULJ A;  2MNA A;  3F2D A;  4BY1 H;  1G29 1;  4BY7 H;  1VQG A;  4O0A A;  1IYJ B;  2ALY B;  4BBR H;  5IP9 G;  1XMQ Q;  1MIU A;  4JI1 L;  2I5M X;  1VQK A;  4JI8 Q;  4DV0 Q;  1C0A A;  1JJ2 A;  1IBK Q;  2E8G A;  1YBY A;  3EIV A;  4YY3 L;  3H0G G;  1Q7Y C;  1XPU A;  1W3S A;  1TWC H;  1PH6 A;  2JA7 G;  4OO1 I;  1N32 L;  3RZD H;  4DR1 Q;  3CCU A;  2XTI A;  3KF6 B;  4JI1 Q;  3GO5 A;  1CUK A;  2WAQ G;  1HNZ Q;  2IX1 A;  4PZ8 A;  3HKZ G;  5FLM H;  3S1R H;  3HKS A;  2ZJR A;  1VQI A;  4DV3 Q;  3ULL A;  3KF6 A;  4XIG S;  4JI6 L;  2VNU D;  2JEB I;  2NVQ H;  1YEZ A;  1CSQ A;  3FHW A;  4EQ5 A;  4X62 Q;  1V9P A;  2CFM A;  3KDF B;  5LMN W;  3UDI A;  5BR8 L;  4DR3 Q;  3Q8D A;  4DPG A;  1Q81 C;  2JQO A;  2HHH L;  2UUC L;  1XMO Q;  3I4M H;  4UP7 A;  3CPW A;  4IJH A;  5LMU L;  2BH8 A;  3F2B A;  3BZK A;  4TVA B;  2V1C C;  3I4M G;  2IY5 B;  1VQ9 A;  1N9W A;  2ZM6 L;  1UE5 A;  2R93 H;  1K8A C;  3J80 c;  3BJU A;  3PV0 A;  4BBS G;  1Q82 C;  1IBK L;  4APV A;  4DV0 L;  3PUY A;  4DV2 L;  1C7Y A;  3GTG H;  4X65 L;  1RIP A;  2KCM A;  4XTC S;  2OTL A;  4B3R L;  4DV7 L;  3GTK H;  1VCI A;  3K81 C;  3OYY A;  2RHS B;  4DV3 L;  2UUB Q;  5JEA G;  1YIT A;  1VQ8 A;  2E2H H;  4JBJ A;  3W1G A;  3PGZ A;  3OTO Q;  3HOU H;  1QZH A;  1M90 C;  2PQA B;  4DV4 Q;  1KXL A;  1PH2 A;  2R7F A;  2VL6 A;  4BBR G;  1NBW A;  5IP9 H;  3GTM H;  1RL2 A;  2MQH A;  5J3B A;  1AH9 A;  4BY1 G;  3PF4 A;  2HQL A;  5C4X G;  3I4N H;  3SGI A;  1MJC A;  3OW2 A;  3HOV H;  3HOY G;  1XMQ L;  3CCL A;  4LFB Q;  2NN6 I;  4KHZ A;  1VS0 A;  4A3I H;  1WCM G;  1PHJ A;  2NVX H;  1VQ6 A;  3TS2 A;  4LFB L;  5C0X I;  1KAW A;  4GOP B;  4MNO A;  3S1M H;  1B8A A;  2R7Z G;  2OQK A;  1WCM H;  1XNR L;  4DR4 Q;  4LFA L;  1PVO A;  5IY0 A;  1FJG Q;  1LYL A;  3HOY H;  3PIO A;  3GD7 A;  4PG3 A;  3NEN A;  2DGY A;  3CP0 A;  1OXV A;  4R4T A;  1NTG A;  3NBH B;  2NZO A;  4DR5 Q;  5C4X H;  2QGQ A;  1FGU A;  1PH8 A;  4C3J H;  2AWO A;  1XNR Q;  3WWV A;  3KJO A;  1TWG H;  1FVI A;  1VQ7 A;  5LMN Q;  2UUB L;  4L5T A;  4IPD A;  4KLK A;  4LUO A;  1UE6 A;  3J7Z C;  3HOU G;  1IL2 A;  2K50 A;  4DV6 Q;  2PNH A;  4DUY Q;  1IBM Q;  5JJL A;  2EQS A;  5JEA J;  3J80 i;  2E5L L;  3U4V A;  2UXC L;  4GNX B;  3GTL H;  1VQE A;  1HZB A;  1SN8 A;  3PCO B;  2RHQ B;  1YHA A;  1NMG A;  2KBN A;  1Z47 A;  4IOC A;  2R7D A;  1QUQ B;  3TQY A;  2IT1 A;  4BBS H;  1MKH A;  1YHQ A;  4LUZ A;  3CC7 A;  2AMC B;  2C35 B;  4HJA A;  2R93 G;  3PIP A;  2VQE Q;  3L2P A;  3S1N H;  4GOP C;  1MJE A;  3RLN A;  1K83 H;  1B70 B;  4X65 Q;  4A3C H;  4X62 L;  2YV5 A;  1PYB A;  4DUY L;  1Q1B A;  4NXN L;  5H1S E;  4A3D G;  3FKI H;  4X66 Q;  3BZC A;  2VZA A;  1Y1W H;  5IYC G;  4DUZ L;  1K3R A;  3KF8 B;  1E1O A;  2Q2U A;  5C0X J;  2PMZ E;  3I56 A;  4DR7 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...