4A3GG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3gG01
3GTLH 4OONA 4OX9Q 3I55A 4LF9Q 1K83H 2A1AA 4UP8A 4A3GH 1I6HH 1X6OA 3DLLA 2PQAB 4IJLA 3CCMA 5IYDG 3WWVA 1VQFA 4L5TA 2B29A 2N49A 4X66Q 3JAMc 3ULPA 4A3JH 5IY0A 1N36L 4B3ML 3LGJA 4GOPA 4QL5A 2HT1A 1XMQL 1UWVA 4OXPA 2UXBL 2NN6I 4LFAL 4A3MG 4GKJQ 4Y7NH 3ULLA 3TQYA 1VQ5A 1AE2A 3PIPA 3CF5A 3T1YQ 1XMQQ 2VQEQ 4UY8C 2YTVA 3A0JA 4GKKL 2EQSA 1PA6A 1MJCA 1SRUA 3KF6B 4IFDJ 4XTCS 2UUBL 3L2PA 1FJGL 1L1OA 1X9NA 3M85A 1Y1WH 3F2DA 5IYDH 5M5YH 5IYBH 1QVFA 3I2ZA 3CMAA 2UUCQ 1IBMQ 3HOYH 2MO0A 3H3VI 3E9IA 2K5NA 2JEBI 2AHOB 3RLNA 4A75A 5HGQA 2JA8H 5BR8Q 5IYCH 2NZOA 4LF8Q 4A3LG 2CKZB 4IPGA 1J5EL 2IHFA 2ATWA 2JA6G 4WJ4A 1WFQA 2WP8J 1IBLQ 4JG2A 1L1OB 1PH2A 1B8AA 2F3IA 3M4QA 1TXYA 4LF4Q 3I4MH 1UEBA 3UE1A 3AFPA 3PUVA 4B3RQ 5GAGC 2NVXH 3I7FA 1HZ9A 1HR0L 4YWKA 1NY4A 2L15A 4UPAA 3KJOA 4B3TQ 2WB1G 5FJ8H 3W5OA 4LF5L 5K36G 3KJPA 3G6EA 4DNIA 1TWCH 1HNWL 2Z6KA 4DV1Q 4L5RC 4LF7L 2QEXA 4K0KL 2ZJPA 3M7NA 4JI1Q 4AQYQ 4JBJA 4JI1L 5M3MH 1VQKA 3JAMi 4K0KQ 4KHPL 4BY7G 4OO1G 2WFWA 2YYZA 4DV5Q 1KXLA 1X56A 1Y1VH 4DR3Q 3STBC 3CCRA 2Q2IA 1PH5A 3KDFA 4QQBX 2HIXA 3HOWG 1EWIA 1KAWA 5GAHC 1GVPA 1U5KA 4IJHA 2R6GA 4BY7H 1PYBA 2A8VA 3CCJA 1IBKQ 3CCVA 3HOZG 3S1MH 2VZAA 2Y0SG 3D0FA 3UDIA 3TEHB 1HZBA 4GS3A 4DV0L 3GTKH 4GN5A 1K73C 1N34L 1VQIA 1X65A 3BZCA 4JBWA 4R4TA 4BBSH 3A5ZB 2N8NA 3KDFB 1YJ9A 3U4ZA 2VQFQ 4YWMA 2UUAQ 1Q12A 2D0PA 3AFQA 3HKSA 4DV6L 4JI8Q 1OXTA 4DR7Q 1S40A 3CC7A 3CCSA 1CSPA 2EIFA 5C3EH 5C44G 5M3MG 3I4MG 3HOUG 3PF4A 4OWXB 4BA2I 3L7ZC 3EIVA 5IYCG 1V43A 1XPOA 3PGZA 2CWPA 3G48A 4R4QA 2K5VA 3RLOA 3S1QH 1JMCA 3TRZA 2IX0A 4IPHA 3K7UC 4DK3C 1HNXL 4JI5Q 3M4OH 4PMWA 1E3PA 1N33Q 1S72A 2WAQE 4AIMA 4GOPB 2AWOA 3CXCA 3U50C 4APVA 4DV7Q 2F52A 2R7ZG 5FLXc 1XNQQ 4AQYL 1VQ6A 2Q2UA 3OTOQ 4NB3A 4DR6Q 4A3EH 1S3OA 3CD6A 4DV1L 1UE5A 4KI0A 4A93G 4O2DA 2CFMA 4IPDA 2Z6KC 5IP9H 4JYAQ 5HY6A 2JA9A 4R1JA 2ZTDA 1YJNA 1D8LA 3F1ZA 1HR0Q 1N34Q 4JOIA 1JJCB 2JA5G 2LXKA 2MO1A 1KC8C 4TQUS 4HIDA 1Q46A 4X65L 2Z0SA 3I56A 1M1KC 2VUMG 4IFDI 2OWOA 3H0GH 1XTDA 3F8TA 2E2JH 5C0XJ 4DAMA 1NTGA 2I5HA 3PSIA 2BA1A 4GN4B 5GAEC 1H95A 4MZ9A 1PH4A 2UU9Q 3CCLA 2XTIA 3BJUA 3K81C 1X3EA 5E7NA 1BBWA 3MXNB 2NZHA 4LUVA 2Q2HA 4FDBA 4PZ6A 4DAYB 1K3RA 5H1SE 3UDGA 1EFWA 2UUCL 2K14A 2MNAA 4BBRG 2VS1A 4P74A 3FP9A 4GLVB 3CAMA 1VQ4A 4DR6L 4O0AA 1LYLA 1YNXA 3PUZA 4PG3A 4P71A 5C44H 3OTOL 4DUYL 3S17H 4YHHL 1PH3A 2CQOA 3FHWA 4NXNQ 3K0XA 4GKKQ 3CW2C 2UXCQ 4GNXA 3ICEA 2B63H 4KLKA 2JJQA 5JEAJ 1VQGA 4JI5L 4R4IA 1YBYA 1HNXQ 1OTCA 4LF5Q 2R7DA 1XNRQ 2RHSB 1BBUA 1Q8KA 4HJ8A 2IX1A 1O7IA 4A3IH 1VQDA 5M5XH 2ZJRA 4JV5Q 1PVOA 2I5MX 4AYBG 3AYHB 1SROA 3TREA 3PUWA 4JV5L 5FJ8G 1RIPA 1GKHA 4DR2Q 1W2BA 1TWFH 1QVCA 3HOWH 1N32Q 3GTPH 3S1NH 2WB1E 3S2DH 1JB7A 4BBSG 2PNHA 3CCQA 1YIJA 3HOYG 1EQRA 2NVYH 1V1QA 1Z9FA 2YTYA 3NBHB 4A3IG 1IBKL 2NVQH 2RHQB 3NENA 1KIXA 2KBNA 1IXRA 1WCMG 3ER0A 1C9OA 1Z47A 2UXDQ 2ZM6L 4QGUA 4BY1G 2VW9A 1XPUA 2VY3A 4JI3L 4OWTB 1X55A 1AE3A 3HKZG 4JCVE 4LFAQ 3S2HH 2E5LQ 2UXBQ 5GROA 1VQ8A 4X62L 1GD7A 2K5HA 1QVGA 1U0LA 1PFSA 5FLMH 3K80C 4A3FH 1K9MC 1E1OA 1GM5A 2OCEA 1KRTA 4DUYQ 1M90C 4POFA 3TS0A 1YI2A 4YCUA 4B3MQ 4A3CG 4A3LH 1CKMA 1TWGH 3RN5A 3GDEA 4LF7Q 4L5QA 3VDYA 4X62Q 3PO3G 2D0OA 2JK8A 4LF9L 1KRSA 4OX9L 4JI3Q 2IY5B 1TWHH 1JE5A 2R93H 1RL2A 3EN2A 2KHIA 3D31A 4GN3B 4JI0L 5ELOA 3RZDH 3J81i 4LFBL 4LF4L 3KF6A 4DKAC 3HOUH 1Y1WG 3GO5A 1PV4A 4C3HH 5FLMG 1KHIA 1J5EQ 3I4NH 3TS2A 1LM0A 1I94L 4JI0Q 4DV3Q 1OXXK 1LTLA 1BKBA 2RF4A 3J81j 4A76A 4DR1L 1UE7A 1PH1A 2ALYB 1PH8A 5JJIA 4A3KH 3PUYA 1VQAA 3I4NG 3L0OA 4LW1A 1FGUA 3J80c 4JI2L 2WAQG 3ULJA 4LFCQ 1SLJA 3FKIG 1E1TA 2MFIA 4P75A 3GTMH 2R92G 4A93H 2UUBQ 3H3VH 3H0GG 5LMUL 1N9WA 3HOZH 4HIKA 1FVIA 4X6AH 2H5XA 1IYJB 3OYYA 5IP9G 5IWAQ 1SFOH 3A74A 3S14H 4ALPA 2B63G 3GD7A 4LUOA 1VQHA 4IOAA 2C35B 3PV0A 1IL2A 1KL9A 1P16A 2LXJA 1N36Q 1KQSA 1HNZL 1Q1EA 4WJ3M 2GVAA 2RCNA 4IO9A 2GN5A 4JI8L 2PI2A 4JI2Q 2JA8G 1YHAA 1C0AA 5JJKA 2VQFL 1PHJA 3M3YH 1L0WA 4A3KG 2YV5A 4J15A 3DM3A 3J7ZC 3PF5A 1YHQA 3S24A 1CKOA 4R4CA 4EX5A 1YITA 2ZTEA 4MNOA 1I94Q 5IP7H 1I3QH 3PO3H 5M5WH 1K8GA 3UDFA 4YWLA 4DV0Q 4QY7A 4H02A 1HH2P 2Q2TA 1G6PA 1QZHA 4QJFA 4C3JH 1XMOL 5EAYA 5JEAG 4LF6L 1DGSA 2QGQA 3NEMA 1VQEA 1B70B 1HZCA 3Q8DA 4UP9A 3G71A 4JI7L 4JYAL 4A3BG 3UE0A 1VS0A 4DV2Q 4A3MH 2KCTA 3RZOH 4DR3L 3JC66 4TVAB 1EUJA 4IPCA 4POGA 5J3BA 4NXMQ 1EIFA 1HJPA 1NBWA 1ASZA 4YHHQ 1VQOA 2R92H 2A19A 3W1GA 2F4VL 2JQOA 2AWNA 1B7YB 4DV4Q 3RNUA 3PO2G 1TWAH 4A3DG 5ELNA 4AYBE 4NXML 3HOXG 4C2MH 5GQOA 2HHHQ 1PYSB 3F2CA 4HJ7A 1VQ7A 4GLAC 2CCZA 2E2HH 1WOCA 2AKWB 4DV2L 4HIMA 1SE8A 3T1HL 2ES2A 2ZM6Q 4HIOA 4A3BH 2UXDL 3HOXH 3J80i 3RLFA 1SN8A 1QZGA 4LF6Q 3G4SA 1X3FA 3AEVA 3H15A 1CKNA 1A8VA 1IZ6A 1CSQA 2NN6G 4P73A 4DV6Q 2VUMH 1QUQB 2K75A 1YJWA 3SGIA 3FKIH 2DUDA 5C0XI 1YZ6A 2YTXA 1NE3A 4XIGS 4IOCA 2HQLA 3UDXA 1N32L 4RG1A 1Q82C 3HOVG 4JC0A 1OXVA 2JEAI 1BVSA 3HKZE 4HJ9A 4MTNA 3GTGH 2I5LX 4A3CH 3CP0A 2JA7H 4L5SA 4BBRH 4JI4L 1XNQL 2HIVA 1JJGA 4DV7L 5AJ3L 3BU2A 3E9HA 1Y14B 3I4OA 2VQEL 5IP7G 1VQJA 1XNRL 2KENA 4HJ5A 2I0QA 1EYGA 3PUXA 1WI5A 4YY3Q 3ZJYC 4GKJL 1UE6A 1X3GA 4YCWA 2ZJQA 1UE1A 1WCMH 2EXDA 4B3SQ 3CPFA 3M9BA 1KD1C 1Q7YC 1VQLA 1NMFA 4ME3A 1PH9A 4KHZA 2F4VQ 1YHBA 4R4OA 4JI4Q 4JI6Q 1VQNA 1LUZA 4DR7L 3CMEA 2AMCB 4LFCL 1NJIC 2LSSA 4A3FG 3B6YA 2ZTCA 1OXSC 1YVCA 2MQHA 1VQ9A 4A4IA 2N78A 1WJJA 4AH6A 2UU9L 3IRBA 4JI7Q 4DV3L 4Y52H 5C4XH 3KLWA 4B3RL 2OQKA 3E0EA 3GTQH 4OO1I 2JE6I 4JBKA 1IBLL 1VQMA 4A3JG 1L2FA 1SR3A 3U4VA 1JT8A 1G291 4BXXG 4LFBQ 1K0RA 4UP7A 1EIYB 3EBEA 1I50H 2PQAA 1A0IA 4RMFA 1G51A 3MEFA 4A3GG 1P8LA 3CCEA 3T1HQ 1EQQA 3KYHC 4GLXA 2FXQA 4DR4L 1QUQA 4OWWB 1E22A 3CQZH 3M4PA 2HHHL 3BZKA 1SMXA 4P72A 1Q1BA 2JA7G 2BH8A 4PZ8A 1HNZQ 1PH7A 4JI6L 2JA6H 1GO3E 3CC4A 4QIWE 4GNXC 1X54A 4B3SL 5LMNQ 1MIUA 1FL0A 3T1YL 1PH6A 2E5LL 4LUZA 3KF8B 3NELA 3KOJA 1N33L 4YY3L 1A63A 5IWAL 1VQCA 1WYDA 2D62A 4B3TL 3W1BA 3U58A 4C3IH 1ASYA 1EOVA 3J81c 5AJ3Q 5IYBG 5C0XG 1I5FA 5IT9c 1A62A 1VQBA 3RR5A 3OW2A 1VQPA 3KFUA 1XMOQ 2JA5H 4DR5L 1E7ZA 3S15H 2PMZE 5LMNW 2E2IH 1AH9A 3K8AA 2IHEA 2VL6A 2XGTA 2IT1A 1N8RC 2UUAL 4LF8L 1W3SA 4YCVA 4DK6C 1J6QA 2CWAA 3RN2A 5GADC 1K8AC 4LWCA 3CPWA 2VNUD 2PI2E 1Y1VG 2DGYA 3S16H 4IFDG 4JOIC 4DR2L 1JJ2A 4X64Q 1MJEA 1IBML 3PIOA 2ASBA 2Y0SE 4A3EG 1HR0W 1YEZA 3PO2H 2GVBA 4DR5Q 1FJGQ 4BXXH 4LNQA 3CC2A 2OQ0A 3S1RH 4GOPC 2K4KA 4EQ5A 1OXUA 2NVTH 1T9HA 5JJLA 3ERSX 2E8GA 4DPGA 3K7AH 4DV5L 5LMNL 1C7YA 4BY1H 4KHPQ 4DUZQ 1E24A 2UXCL 1D7QA 5DLQE 4NXNL 2YU9H 3J7A5 2ID0A 4DV4L 3CCUA 5LMUQ 1Q86C 4X66L 4BA1I 1V9PA 3A5UA 4A3DH 3GTOH 2R7ZH 5C4JH 4DUZL 1XPRA 3F2BA 1HNWQ 2R93G 5M3FH 2N3SA 2KHJA 3HOVH 3AQQA 5IE8A 4NPSA 4DR4Q 2OTJA 2BA0A 3STBD 1L1OC 4PZ7A 4DR1Q 2K52A 4GNXB 1MKHA 3HFZB 1HZAA 5M3FG 2V1CC 2R7FA 2KCMA 1NMGA 5C3EG 4HJAA 4X65Q 1R9TH 5C4XG 2OTLA 4X64L 2B3GA 2K50A 1Q81C 1CUKA 5BR8L 2QA4A 2BH2A 1CKNB 3PCOB 1XJVA 4JBMA 3GTJH 1VCIA
chains in the Genus database with same CATH superfamily
1CHQD 4G7HC 1D2BA 4LSXA 5KEEA 1I6HH 2R82A 1RYSA 4IJLA 4HNVA 5FOBB 3J81W 4K8IA 5IY0A 2F0WA 2EZVA 4DAYA 2HT1A 3QO2A 4QL5A 5M9OA 2V4RA 2IL8A 3BYTB 4LFAL 3D8GA 1QB5D 1RJRA 3TQYA 1IKLA 4PNYA 1S10A 1XMQQ 3M4IA 2YTVA 3A0JA 2EYPA 3HEJA 1PA6A 1S5DD 2VUGA 4F50A 5DGAA 4DR7H 1LT4D 1BDOA 2DNCA 4XYMB 5IYDH 5M5YH 5IYBH 1QVFA 3SR1A 4X3KA 2G9HD 1SMYC 3HOYH 2MO0A 2R61A 3RGZA 1GUTA 2W8LA 1R9TA 4HCEA 3CQZA 4FXGC 5BR8Q 4LF8Q 4C3HB 5C4ZA 4KHPH 2K03A 2WP8J 4MIUA 4JG2A 5LMUH 3WDNA 1PH2A 5IT9L 3M4QA 3UE1A 3WOFA 3AFPA 4ZK9B 1TIID 5GAGC 2NVXH 2K6AA 2L15A 3E3XA 1SNPA 4B3TQ 4FP5D 2B39A 2W71A 3G6EA 2R93A 2XGPA 1HNWL 4DV1Q 4LF7L 4ZQ3A 5FLXW 1LABA 1VQKA 2YRXA 4K0KQ 2JEFA 4RKBA 1J5EH 2WFWA 1KXLA 4JI0H 1Y1VH 1F9QA 3BG3A 2SNMA 3CCRA 4HMIA 2Q2IA 2HIXA 1MSHA 3HOWG 1KAWA 5GAHC 1GVPA 1U5KA 4ED6A 3W3AA 4LF9H 1PYBA 1B50A 2GPSA 2RVLA 3S1MH 4EBDA 4K6DA 1KJIA 5FPOA 4K2LA 3RZOB 1YNNC 4CBVA 1T94A 2NU6B 4ILWA 3BDLA 2FFKB 2ZT9C 1CFMA 2L11A 3BQ0A 2PQEA 3AFQA 3HKSA 4JI8Q 5IGBA 1T5XD 4K5XA 1I50B 4DFAA 3CCSA 3Q8SB 4BA2I 1TWCB 3I70A 5C44G 1RTNA 2F4IA 1Z6HA 2C28A 1V43A 2F0PA 1VMPA 4R4QA 3RLOA 3J81L 2HVQA 4DK1A 3K7UC 1HNXL 1ET6A 1E3PA 5I9OA 3H4BA 1S72A 2K1BA 4CHTB 2OH2A 4JV1A 2F52A 4QWEA 2AGQA 1C4QA 4JV2A 1VQ6A 1SNDA 1EHIA 4IALA 4A3EH 1S3OA 2IP4A 4YB8B 3J81E 3RV4A 4HR7A 3URYA 2Z6KC 4JYAQ 3FPPA 2E5LH 2JEJA 1YJNA 5KFAA 1EUCB 1N34Q 3H0GB 4FS1A 5C3WA 2WB1A 2LXKA 1KC8C 1M1KC 4HIDA 3I56A 1JE4A 1LTBD 2Z0SA 2VUMG 5KFTA 4N8FA 1D5MC 2E2JH 3BQ2A 3MR6A 4GN4B 1EY6A 4MZ9A 2UU9Q 2R3ZA 4Q5VA 3CCLA 4DR3H 4EGVA 2FLLA 3K81C 5E7NA 1BBWA 2Q2HA 1K3RA 4O4LF 4BBRG 1AP0A 4NMZA 3CAMA 1LYLA 5C44H 4DUYL 2E2JB 3FHWA 1HQRD 3K0XA 4ECRA 2IBKA 4HSPA 2W6ZA 3BABA 4KLKA 1IW7C 3QWNA 2YRWA 1LO5D 4M1UB 3FDTA 1PTOF 1G8ZD 2R7DA 2NB0A 2RHSB 4KY5A 5JJZA 1Q8KA 2WINB 2UUAH 1EZ8A 3FEWX 3GTPA 5E1FA 1F2MA 1VQDA 5M5XH 3S1QB 4JV5Q 3T16A 4Y8VB 4I7AA 3L9AX 5CA1F 1SROA 2E2HA 1Y1VB 1TA8A 4GZYC 5KFVA 1GKHA 2A69C 2EDGA 2LKVA 1W2BA 3HOWH 3T53B 3GTPH 1WTHA 1AN7A 3GTJB 5KGUA 2VB3X 1V1PB 1MI2A 1ZEQX 1STEA 5M5XB 5KT6A 1V1QA 4CC6A 1X3PA 2FLNA 1JLLB 4JI6H 2YTYA 4F4ZA 2UUCH 3ERQA 5JAVA 1IXRA 1C9OA 4H44C 3GTQB 2HJWA 5J22A 4BY1G 4QGUA 2VW9A 2VY3A 4G7ZC 4AYBB 4JI3L 4I4TF 2BR0A 1X55A 3DEOA 4LFAQ 2UXBQ 1GD7A 2K5HA 1HR0H 2K33A 5D3IB 1I4QA 2OCEA 4B3MQ 1EY7A 4A3CG 4F4XA 4YCUA 1CKMA 1TS4A 1TWGH 4QW9A 4LFBH 4L5QA 3PO3G 4X62Q 2ZXPA 4DV2H 1SSOA 4JI3Q 3NSWA 2IY5B 1WCMB 3JAME 1CQJB 2KVMA 5JQWA 3ND9A 3RZDH 1PFMA 4LFBL 2FK1A 3KF6A 5IGCA 4AQYH 3QB3A 2FMCA 3GO5A 2XRSD 2QYZA 5ELFA 2B2YC 4ECSA 3ND8A 1OXXK 1LTLA 4F4WA 4O3SA 1UE7A 3I4NB 5KNBA 2Z1CA 5JJIA 4F7XA 3PUYA 5CAEB 2ICEC 3T5KA 3MWYW 4LF6H 4DLKA 2J7ZA 3RZDB 2F0TA 1ZQ7A 4Q0FA 2IX3A 5FLXL 1E1TA 4MAMA 1VKZA 4ECUA 1N9WA 3H40A 3SDZA 2HD3A 4A3MB 4HIKA 4X6AH 3S2HB 1IYJB 5CV7A 5IWAQ 1SFOH 3QR8A 3A74A 4RNNA 1MD2D 4ALPA 1VQHA 3TMEA 2YS6A 1S0NA 5EDWA 1N36Q 1JDBB 4Q8EA 2EVBA 4WJ3M 4FS2A 4JI8L 3FVQA 5CV6A 2PI2A 4ZAIA 3GTPB 5KFUA 1ENCA 2R92B 5DQHA 2YV5A 3J7ZC 3DM3A 1YHQA 4EX5A 2N88A 4DL2A 2HVRA 1DOKA 4WD3A 4MNOA 1I3QH 2IPKD 1KTKA 3C0FB 4L63B 2R6FA 4DV0Q 4QY7A 2Q2TA 1G6PA 3VPDA 3RIZA 5DQIA 3BDCA 3TQ1A 3KAKA 1EWHA 4C3JH 1XMOL 4R8UB 1J8IA 1B9NA 5JEAG 2E2IA 2JA7A 5IT9W 1DGSA 4JI7L 1WTWA 5JOBA 1IL8A 1B6SA 2EYMA 4JYAL 4BY1B 1HTLD 4DR3L 5BN3A 4BBRB 2GA4B 4POGA 4NXMQ 1UAPA 1ESFA 1WTXA 3BA8A 4ED2A 5JPNC 3W1GA 5BN4A 2F4VL 2JQOA 2AWNA 1B7YB 4DV4Q 1BNCA 1TWAH 2WYOA 5ELNA 1N48A 1IHZA 4C2MH 3PO3B 2HHHQ 5EPJA 3H0GA 2F0KA 4HJ7A 2A68C 3K5NA 2B2UA 2CHBD 1BCPC 4AYBA 2AKWB 3PIO3 4HIMA 1SE8A 1PLFA 4ZKBB 3T1HL 3KAJA 4OELB 4ZYSA 2UXDL 4J9RA 1MGSA 4J9KA 3RLFA 1SN8A 1QZGA 3AEVA 4MV1A 1X3FA 2L9HA 1A8VA 1GSAA 4F87A 1I7NA 3R2IA 2K04A 4PMBA 2NN6G 5KFFA 2MP1A 4DV6Q 3WO1A 1TS3A 2XWBB 1SXTA 4WBNF 4IOCA 4LF5H 4QWCA 3Q24A 4J9PA 4JC0A 1AUVA 1OXVA 2JEAI 1BO0A 5KT3A 1STAA 5K5PA 3LP8A 1A6XA 4A3FB 4A3CH 3D6WA 3U9TA 5DG9A 2JA7H 4JI4L 2BQUA 2NVYB 2TSSA 4DV7L 4WFN3 3BU2A 1UEAB 4OL7A 2YS7A 2C2RA 1XNRL 2KENA 5EBCA 4HJ5A 3PUXA 4GKJL 1UE6A 4B08A 2ZJQA 1UE1A 2F0MA 3NWTA 4WRDA 3G6XA 1I94H 5I2YA 1PH9A 4KHZA 1ULZA 2NWGA 4JI4Q 1LUZA 3BVMA 3B6YA 2UXDH 2ZTCA 5KFOA 4C5BA 1EEFD 4M8AA 4UAIA 3EPIA 2SCUB 5C5MA 4Y52H 4DUZH 5C4XH 1BQQT 4PV1C 2Q8RE 1RDPD 1YNJD 3U4VA 1A2UA 2BCOA 2O03A 2V4QA 3QIAA 3EBEA 1G2SA 3P75A 4YJ3F 2B63A 1AFPA 1QJOA 1ILPA 1JWMD 5KT4A 1TKWB 4HQ6A 1Q8IA 1DCZA 2EYHA 4OWWB 2ZM6H 3BZKA 1SMXA 4NLGA 1S9FA 3QZ7A 2BQRA 5L1LA 1GO3E 2W6OA 2NVTB 3GV6A 2BOSA 3K5LA 3DF7A 4LUZA 3NELA 3CRKC 1N33L 1A63A 4YY3L 4MV9A 2WKCA 1O7LA 1WYDA 2FB9A 5C3XA 1EOVA 4ECVA 1B53A 3RR5A 1VQBA 3NTIA 1GLVA 3E0JA 2JA5H 1E7ZA 5JEAH 3QZ8A 1IKMA 3MC0B 1TT2A 4FF3A 2J4XA 4EVOA 4EFEA 2CWAA 3RN2A 4IUPA 2VNUD 4G7OC 3NTKA 4LWCA 2PI2E 1HHVA 1WTOA 3S16H 3HB9A 2O2LD 2F3WA 1JJ2A 1IBML 4NP5A 4A3EG 2EPBA 4MV3A 3TIIA 2QILA 3Q8RB 4DR5Q 1FJGQ 3G8CA 1TWHB 1S97A 2XIGA 1GOZA 4LH7A 4JI2H 2RCFA 4M9UA 1OXUA 1BOSA 5KFWA 2K32A 2HDLA 3A54A 5KRUA 4LF8H 4JYAH 5IGFA 3NWSA 4KHPQ 4U6PA 4DV4L 5LMUQ 2M00A 4X66L 1F9RA 2EYLA 3J80E 3HRZC 3OHAA 4CDCC 5M3FH 3Q8PB 5CB4F 2Q8TA 4IUVA 3AQQA 5JVLA 4NPSA 5ELDA 3STBD 5CV8A 4GNXB 1MSGA 1MKHA 2ENBA 2MCTA 1ET9A 1CA5A 4DK0A 1GUWA 4ED3A 1TWHA 4HJAA 3S14B 1R9TH 3K0YA 3T56B 1TWAA 5KG3A 2BH2A 2QA4A 5LA6F 4JBMA 3JZIA 4XQJA 4OIKA 3GTJH 5KFCA 1I6HB 1I3QB 2PW5A 3I55A 1RKNA 2F0OA 4UP8A 2I80A 3BDOA 1ENAA 3DWQA 4ZUIA 3CCMA 4QUFA 1Z7TA 3TDQA 1XMOH 1VQFA 3ULPA 2N49A 1N36L 1MBYA 1STNA 3GTGB 4JV5L 2W6PA 4GOPA 3MHBA 1HUMA 1UWVA 5CBAE 2UXBL 4GKJQ 4DR2H 1QOHA 1VQ5A 1AE2A 1SYEA 4K5VA 1DIKA 3I73A 3E6ZX 3QOLA 1SRUA 2ASDA 1CE8A 3WOEA 3IFDA 5A35A 2G5DA 4GC6A 1IBMQ 2J0TD 1SAPA 3MFYA 4MTEA 5HGQA 5NUCA 3F8NA 2JA8H 5IYCH 2NZOA 4A3LG 5DQGA 1B4OA 1XNQH 1S03G 1TXYA 4C1NI 4FVMA 3I4MH 1VF7A 3GTJA 1HR0L 2QEJC 3IG0A 4KKSA 1UNNC 4UPAA 3GIJA 4DR4H 5FJ8H 2XN9C 3W5OA 1S0MA 4FU0A 4R8UA 4JI3H 5FKAC 4IURA 3N44B 3M7NA 4AQYQ 2F0QA 1PRTC 4JI1L 2DLNA 5EQ0A 5KIXA 5M3MH 5KG4A 2D9UA 3V6KA 4OO1G 2MPMA 4DV5Q 2YYZA 1X56A 1TAEA 1WTPA 2J9GA 4DV3H 4BBSB 4EBEA 3KDFA 4QQBX 4RB1A 1GUOA 4J9NA 2PPBC 2B8GA 3OPOA 4BY7H 4A3BB 4O42A 3CCVA 1LTGD 2VZAA 3D0FA 3UDIA 3G6VA 1HZBA 5C3EB 4IR9A 3NE5B 2UUBH 1JWUD 5LMNH 3BZCA 2M05A 4R4TA 4BBSH 1CS0A 3A5ZB 2N8NA 3KTMA 1YJ9A 1KDCA 3TP7A 4J1MA 4YWMA 1D5XC 4BY7B 2UUAQ 1XMQH 1Q12A 3MFIA 2VQEH 4DL6A 3HS0C 1OXTA 3NXWA 4A93B 3GV3A 4DR7Q 1S40A 5C3EH 3PZPA 1NCVA 5M3MG 2EY2A 4C56C 5IT9E 1PRTF 2ICIA 2CWPA 2PZWA 3G48A 3Q8QB 1EY4A 2IX0A 4HEDA 4IPHA 4JI5Q 3M4OH 1STYA 1EZ1A 3OUUA 1I3QA 3NTHA 1N33Q 2FK3A 2WAQE 3TIGA 4ZHQF 4AIMA 1WSCA 2Z4IA 4YR0A 2L5TA 4DXFA 3U50C 2R7ZG 2Q2UA 4KN7C 2Q8IB 2F0UA 2IJ0A 2KA7A 2XRQD 5AFWA 1H9SB 5L37A 4YBZB 4KI0A 2WE6A 3L3OC 3R2TA 3FKIB 2JA5B 4QW8A 1D8LA 4OEMB 4X3UA 5T14A 1DV1A 1JJCB 4DV1H 3Q1KA 4EG0A 1Q46A 5KNDA 1KEEA 1VMCA 3VYTA 3F8TA 1CA6A 4DV4H 1HNWH 4K6LA 5C0XJ 4DAMA 1NTGA 3S16B 3PSIA 4R7RA 5GAEC 4BWSC 5KFJA 4RKLA 4HNUA 3BJUA 3OW7A 2Z9HA 4FBTA 1X3EA 2PN1A 1FKAH 3MXNB 2JA8B 3KBXA 2JP1A 1EFWA 4DAYB 5H1SE 1Y69U 1ICWA 3J7YW 2K14A 3M7GA 2VS1A 5HURA 1VQ4A 4O0AA 1YNXA 4PG3A 4P71A 2I87A 4YHHL 1PH3A 2W9CA 1BCPB 3H91A 1HFNA 3CW2C 1II3A 3SK8A 2PMZB 4GNXA 2B63H 4LH6A 5JEAJ 4C3IG 1U4MA 1AW7A 3QJYA 5EPKA 1VQGA 2A74C 4R4IA 4CJ1B 5BMVF 1I4RA 1XNRQ 4BS9A 1BBUA 1ZYRC 2FPGB 4HJ8A 4PDBA 2C22A 1OWTA 3BA9A 2LS01 1PVOA 2HUGA 4ABNA 3I12A 3L4KA 3AYHB 4MN3A 1RIPA 4HR7B 3S1RB 4RA8A 5CA0F 1TWFH 1QVCA 1D6EC 2H1EA 3WNZA 3MAQA 4OHJA 3CCQA 3HOYG 1EQRA 2F0DA 4JK1C 2V9WA 5KFLA 4KN4C 3C46A 3NBHB 2DNEA 1IBKL 2NVQH 2R7LA 5DM73 1Q3LA 1ZHSA 5KT2A 1XWEA 1WR2A 4EQPA 4FO2A 3D4DA 2ZDQA 3OIPA 4C5CA 3BVGA 2E5LQ 4ZRZA 2QCPX 4X62L 1VQ8A 1QVGA 2W6MA 3M9OB 2HCIA 5FLMH 1E1OA 2V58A 3GTQA 1KRTA 4TUYF 5EJWA 4POFA 1YI2A 2AQ3B 1JOQA 4K8JA 1RHPA 2JK8A 2EJMA 3A7AB 4O3OA 2OT2A 1HA5A 3AB9A 4A3IB 1TWHH 1IW7D 1JE5A 5EKLA 3AU7A 3EN2A 2KHIA 1SBBB 4JI0L 1BGWA 3J81i 2VQDA 3MA2B 4MHEA 1Y1WG 4DGZA 1B04A 4IAJA 4MV7A 1J5EQ 2C5CA 3I4NH 2R8IA 1I94L 4JI0Q 5HBRB 2RGRA 1IYUA 1A9XA 3V96A 1PH1A 4FYDA 5KT7A 2L12A 1Y8PB 3L0OA 1FGUA 3J80c 2C00A 4CKEA 3K5IA 3GIKA 4J0MA 1O7YA 2R92G 3H0GG 4LMQD 3BAAA 5JPMC 1FNWA 3FMCA 2H5XA 3OYYA 4C3IB 4FF1A 1KDBA 5C8YF 5KX5F 3A8JE 3S14H 2JXMB 3FDSA 1M6VA 4CDFC 4J9SA 1STHA 3GTMA 4XX0B 4N9TA 2B8FA 2LXJA 1Q1EA 1D5ZC 5IOCA 5F9NA 1LTSD 4IO9A 3BJYA 3N41B 4JI2Q 2JA8G 1VBGA 2VQFL 2B2WC 1PHJA 3M3YH 5KG7A 1RF2D 3PF5A 1G91A 2F0NA 3S24A 3NBIA 1YITA 4LFAH 2ZTEA 5ELEA 2UXBH 5IP7H 1Z2PX 1ENFA 4XQNA 2F03A 3PO3H 4ECZA 1HH2P 1UC8A 3A55A 3H3VC 1QZHA 1UNSA 4QJFA 2CW7A 4RUCA 5CC4A 3C2PA 5J1ZA 4LF6L 1GXDC 3NEMA 4RCOA 1C8CA 2WB1B 1B70B 1HZCA 1L0XB 4RGNA 2KSWA 5KKNB 4LJZC 2UVUA 4CJ0B 1JB3A 5LOVF 2BE5C 2BE5D 4A3MH 3V4SA 4U7CA 1BUVT 2TMPA 5L1IA 2UVWA 2O5JC 1NBWA 1ASZA 4YHHQ 1NR2A 2A19A 1S5CD 2NVQB 4X65H 4AYBE 5GQOA 4R8NA 2UU9H 3F2CA 2K5QA 5CR3A 1VQ7A 4GLAC 3PR4A 2E2HH 1DXMA 4DV2L 4C1NK 5KG0A 1AEXA 2ES2A 2ZM6Q 3I4MB 3FMAA 4PWQA 1ZYRD 3G4SA 1WH2A 1GHJA 1CKNA 1IZ6A 5IGEA 4P73A 3VYRA 4GKKH 5JVH3 2VUMH 2K75A 3FKIH 2PNRC 1KLGD 1YZ6A 2YTXA 4XIGS 4EFBA 3UDXA 4LSAA 2L1BA 1XYIA 2FHTA 5IWAH 1Q82C 3HOVG 1PYWD 2J6TA 1BJTA 2EJFC 3RF2A 4TQRA 2LFNA 2F0JA 4BBRH 1RYRA 1NSNS 2HIVA 3DHQA 1GGOA 5AJ3L 4Y7NB 1SEIA 3OMGA 4KY6A 2EY6A 1IBMH 3DM1A 2WV6D 5D65A 4YY3Q 1TR5A 1Q7YC 3OHXC 4ECWA 1NMFA 2FLPA 3MXGA 1YHBA 4DV0H 1FJGH 3VYUA 2VOBA 3CMEA 3PW7A 1NJIC 2LSSA 3FPUB 4A3FG 1T3NA 2I46A 2MQHA 1BNZA 2P0AA 2EXZA 4A4IA 3N8DA 1WJJA 2OF1A 3IRBA 4NW2A 5DM63 3GTQH 4OO1I 3H4DA 5JVG3 2JE6I 5KYLA 3PW0A 4DXGA 4RZQA 2ASLA 1G291 2PW7A 4LFBQ 1K0RA 5COYA 4N9PA 5D14A 5EPLA 4I65A 3MEFA 1RJTA 4ZOLF 3CCEA 4ED7A 4GLXA 2FXQA 3MFHA 3CQZH 3M4PA 4YP3A 1DOMA 2XGQA 2VA2A 3V05A 4PZ8A 1HNZQ 5HGTA 4O4IF 1W93A 2JA6H 1I50A 1KJQA 5CMDA 4G4KA 1LTRD 3CC4A 4RH6A 4GNXC 4A3DB 4B3SL 2D2CC 1TY0A 3NPPA 3K5HA 2E5LL 3ORQA 3K7AB 3GQCA 1JCKB 2VR1A 1VQCA 2AUJD 2L55A 4ZCKA 4O4HF 2D62A 3HOWB 3W1BA 2EYJA 5FD5A 1ASYA 2IA6A 2PMZA 2JA6A 2WDTA 3KFUA 3QG1A 3CRLC 1XMOQ 3S15H 4RWSC 3D4RA 5LMNW 2JN4A 1TWFA 1AH9A 2MUYA 3K8AA 5FO8B 1EY9A 5L1KA 1N8RC 2IT1A 4LK1C 2UUAL 3GILA 1J6QA 2AQ1B 1Y1VG 5KG1A 2W8KA 2A6ED 1STBA 5KFRA 4X64Q 3GV8B 1RODA 5G3LD 1B44D 2ASBA 2R92A 4DV7H 3PO2H 1K28A 2GVBA 3JRXA 4JI4H 3EYYA 2E75C 5FD6A 2RA4A 3GTKA 4LNQA 4UCOA 4HN7A 2WACA 3CC2A 4H7BA 3Q0AA 1K1QA 4MV4A 4GOPC 4RB2C 2R8GA 2NVTH 1T9HA 1Y1WB 2HGSA 1EYCA 1WVLA 5JJLA 3BYYB 2E2IB 3WO0A 2V59A 3VR2A 4DV5L 2CZGA 1LACA 5LMNL 4BY1H 2UXCL 3PIP3 1L2ZA 2ID0A 3H94A 2XC9A 4DUZL 5G3LF 2SOBA 2N3SA 2KHJA 3HOVH 2OTJA 1RK6A 4IWYA 4TRDA 3T1HH 1L1OC 4PZ7A 2NU8B 2K5WA 1TWGA 2W9BB 2ALZA 4DR1Q 2RDIA 1R4PB 5KFYA 3RJ0A 1HZAA 3NUCA 2V1CC 3EFXD 3RB0A 4A3JB 5C4XG 1VBHA 3U9OA 2B3GA 2HHHH 1Q81C 4YR2A 1CUKA 5F9LA 2UXCH 3HKZA 3PCOB 2AQ4A 2DPJA 2RDJA 1F9PA 3GTLH 4OONA 4OX9Q 4NDXA 2R7ZB 2VPSA 2Y0SA 3CKIB 2A1AA 1ZETA 1PFBA 4A3GH 1X6OA 3K59A 5A2QL 3DLLA 3DWAA 4V190 2XSCA 5IYDG 5CORA 3WWVA 4L5TA 2B29A 4X66Q 4A3JH 4B3ML 5BPFA 4XZ3B 1CT1D 1EEID 1XXGA 3Q6SA 2GLTA 1XMQL 4OXPA 1FYCA 4A3MG 5JH7F 4EGQA 1EZ6A 3ULLA 2W9BA 3V6JA 3CF5A 3T1YQ 2VQEQ 2DZDA 4UY8C 5CBEE 4GKKL 2EQSA 2ZJTA 2YW2A 4IFDJ 4XTCS 2UUBL 3L2PA 3I72A 1CM9A 1X9NA 1GYFA 4DR5H 4ZUJA 2QK4A 2FE3A 3H3VI 3E9IA 4JI5H 2K5NA 1UC9A 2JEBI 2KJXA 3PO2B 2CKZB 4UCUA 1PFNA 2IHFA 1J5EL 2JA6G 1EY5A 1WFQA 1IBLQ 3J80W 4MV8A 3Q2OA 4B3RQ 4YQWA 1XTCD 1I4GA 3I7FA 4LF7H 1HZ9A 1I4XA 4F8MA 1JOOA 1NY4A 2JYOA 2L4NA 2K01A 4EEQA 2XWJB 5K36G 3KJPA 5CGKA 5KFNA 3KK7A 3LWEA 4DNIA 2K05A 2Z6KA 4L5RC 1FNUA 3R93A 2QEXA 4K0KL 4HCSA 2ZJPA 2NUAB 4JI1Q 2R87A 4ECTA 4ETSA 5L1JA 1Y8NB 4KHPL 1B6RA 1CZWA 4BY7G 2JA5A 2ATLA 2DJFC 3KLSA 5BPHA 2A6HC 2RDFA 5KFIA 3UI2A 3OIQA 2R6GA 4OO1H 3KLSX 1DYQA 1H9JA 3N6XA 2A8VA 3CCJA 1IBKQ 3DMUA 1S5ED 1B2TA 1FNVA 4UHVA 4DV0L 3GTKH 1CQFA 1N34L 1VQIA 1O78A 1X65A 4JBWA 3HOVB 3M9MB 5KYIA 4ME6A 4EYIB 1EFID 2VQFQ 3VA7A 4C5AA 4KHVA 2D0PA 3ZYYX 3MEHA 2YU9B 2KUMA 3CC7A 3BVZA 3PF4A 4OWXB 2P5ZX 4CKCA 3L7ZC 2DJGC 3EIVA 3NGDA 4RU9A 5IYCG 1E4GT 2PBZA 5I4DA 2K5VA 1JMCA 3TRZA 4DK3C 5EKIA 3T51B 4PMWA 3GTLB 3RBEA 1PX2A 2A5HA 2AWOA 3TP6A 4QB4A 5KFZA 3E5SA 1ZXTA 5FLXc 1XNQQ 5CYUA 1H9KA 4DR6Q 3NP8A 3CD6A 4E6IA 1UE5A 1SMYD 1RK5A 4A93G 2K5DA 4O2DA 4HYKA 2CFMA 1PZKD 1PRTB 2W7PA 5IP9H 4A3KB 5HY6A 3S15B 2JA9A 3NBHA 2WKDA 4R1JA 3F1ZA 1Q90A 3SVMA 2EYFA 3DUZA 3TQTA 1K0SA 2YU9A 4IFDI 3TSSA 3SE7A 4DAVA 4X3TA 2KHSA 3ETJA 2Z4HA 1HUNA 1MZBA 5LL6b 1H95A 1PH4A 4QIWB 2XTIA 4RAUC 5F2DA 4JVZA 2IWHA 4LUVA 4RNOA 3KHHA 4GLVB 3HP3A 4XQQA 4DR6L 1G6ZA 3PUZA 3OTOL 4XYQA 3H09A 2CQOA 5M5YB 4GKKQ 1ILQA 4DAPA 5KFDA 1E0BA 1WD0A 4QIWA 1JKJB 2PO4A 4YAJB 1HNXQ 1YBYA 2E2DC 2W6NA 1GUNA 1NUCA 3JSNA 4MTDA 1FGBD 2IX1A 2AGOA 3RD4A 2BDOA 2ZJRA 2F1MA 3LMLA 4YIJA 2NZ1D 2I5MX 1QE6A 1B9MA 2NBFA 1HPCA 1TU2B 3TREA 3UQ8A 3PQIA 1WTQA 1HQMC 1M7JA 3G6YA 4DR2Q 1SYXB 4GKJH 1GSHA 3SK6A 4V0BA 1N32Q 2ZDGA 3S1NH 2WB1E 4YY3H 1TVXA 3S2DH 1JB7A 1JIHA 3KHGA 5A2QE 2PNHA 4BBSG 1N33H 1YIJA 3NHHA 3VA5A 4RGTA 5L9XA 3E5NA 5KFPA 4A3IG 2XCLA 2RHQB 3NENA 2KBNA 3LNNA 1SDFA 1Z47A 3F2UA 5K36H 2O5IC 5M3FB 2ZM6L 2A6HD 2VXWA 3SEBA 1E4EB 4JCVE 3S2HH 4YAKB 3KHRA 1JR0D 4ZI7F 2NU7B 4YR3A 1U0LA 1PFSA 4A3FH 3LX0A 3K80C 3N43B 4OGQC 1GM5A 4RNMA 1M90C 4A3LH 3RN5A 1R9TB 2FJZA 3VDYA 1GSOA 1Z2OX 4LF9L 1KRSA 2I8CA 3GIMA 2DY8A 2R93H 3OSNA 1RL2A 3IL8A 4XDXA 1F2ZA 4GN3B 5ELOA 5I2XA 3SK4A 4YHHH 4LF4L 3VR4A 5GONF 4ED8A 4DU9A 1CQIB 1PV4A 5FLMG 3N40P 1KHIA 3TS2A 1LM0A 4DV5H 4DV3Q 2RF4A 4A76A 4ECXA 2ALYB 2Z6BA 1B1ZA 4A2BA 4A3KH 3I4NG 1XNRH 4LW1A 3GIDA 3TINA 1SYCA 4LFCQ 1SLJA 3FKIG 4P75A 4Q43A 4P2CB 2UUBQ 4IN3A 5LMUL 1EQVA 3HOZH 5EWEA 4ZLTF 1K83A 3GTMB 1FVIA 1DONA 1EYAA 1WTVA 3RB4A 1RJQA 5IP9G 3RUZA 1X32A 1MHWC 3RGXA 2B63G 3IN5A 3GD7A 4LUOA 1BR9A 3TBIB 1VDZA 3K3VA 3PV0A 1P16A 4L1KA 3I4LA 1KQSA 3RV3A 1HNZL 4FF4A 2M9VA 2KEEA 4QWAA 2RCNA 4F88A 2GN5A 5LHY1 3M3YB 4EQOA 1DV2A 2BQ3A 1EU4A 3SXHA 5JJKA 2UVRA 2UVVA 2F0FA 4WORA 5KNCA 4A3KG 4J15A 1QCBD 1CKOA 4R4CA 4B3SH 3D6CA 5KG5A 5M5WH 4YWLA 3MWEA 3SE0A 3KBGA 4H02A 1ZHQA 2XCAA 4J9LA 3R8BA 3RFCA 5EAYA 4QWBA 3R5XA 3G71A 3Q8DA 3I3CA 4UP9A 4FXKC 1W6KA 3NQTA 3RTXA 2KCTA 1RCVD 4QMGA 5CV4A 1SYFA 4QWDA 2MJ8A 1EUJA 3MTSA 4IPCA 5I6WA 5J3BA 3GTOB 3N42B 4TQSA 4IWXA 1VQOA 1CQVA 5A2QW 2WAQA 1Z2NX 4NXML 1QG7A 1VF5C 3SHLA 3OUZA 4ODGA 5IIFA 4IR1A 1SYBA 1X3QA 4FXDA 4HIOA 3HOXH 3J80i 3EPGA 3GP7A 5J2TF 5IODA 4F4YA 4CJ2C 3HKZB 2R85A 1RTOA 1CSQA 4C2MA 5FO7B 2W9AA 1CZGA 2Y0SB 2R7ZA 1QUQB 5C1PA 4K2KA 4O3NA 3D4WA 5C0XI 1A3VA 1KAAA 1NE3A 3LWUA 2HQLA 1N32L 2FPPB 1T36A 1EQTA 4RG1A 5FPRA 2R93B 1JXLA 3HOXB 2K7VA 3HKZE 4O2BF 2I5LX 3CP0A 1M4VA 1EYDA 5I47A 3MWMA 5T1GA 1XNQL 4KV6A 3R5FA 2R8HA 4TSSA 3UFXB 3E9HA 1Y14B 3I4OA 3VR6A 1F9SA 2VQEL 5IP7G 4RHSA 1VQJA 3VYSA 1EYGA 2MHVA 4IUTA 4DL4A 1X3GA 3GTKB 2WIIB 2XVSA 1PMRA 4X64H 1WD1A 1SCUB 1WCMH 2EXDA 3CPFA 3M9BA 1KD1C 1VQLA 2E2HB 3PVXA 3EA6A 1LLRD 3L4JA 5DAUA 1H9MA 3K5MA 4UCVA 4B3RH 1OXSC 1ZKOA 5C4HA 2EOTA 2ZXRA 1HFGA 1VQ9A 5C5JA 4B3TH 2WTFA 4KKUA 4X3SA 5M5WB 4KJNA 1SE2A 4AH6A 2UU9L 4KJOA 4JI7Q 4DV3L 4JW0A 4B3RL 3KLWA 1JWSD 4DUYH 1DJRD 1BXTA 5IYZF 4JI1H 1S4ZA 1L2FA 1SR3A 1AZPA 1Y1WA 3TN2A 3ETHA 2R8JA 1QNUA 4K0KH 1I7LA 2PQAA 2R7KA 4HSVA 4A3GG 1P8LA 3O13A 3MFGA 3S1MB 3T1HQ 1E4EA 4CDEC 3KYHC 1EQQA 1A3UA 2A68D 5C4JB 4EGJA 3GV7B 2L0CA 2CW0C 2JA7B 4DA2A 2HHHL 2J6UA 4KY7A 4O1NA 4P72A 2AQ2B 2JA7G 2B2WA 2BH8A 4Q45A 1PH7A 4JI6L 4EQNA 1EOTA 1A15A 1HTPA 2VA3A 1BCPF 3MJFA 1M0TA 1SJED 1PH6A 1B3QA 1I4HA 5IWAL 2B63B 1TWFB 2VB2X 4B3TL 4C3IH 4R9WA 4KK7A 5AJ3Q 5IYBG 5ELBA 5IT9c 3OW2A 3T5LA 1VQPA 2C2EA 4DR5L 4IUNA 4X66H 2E2IH 3VPBA 2IHEA 3TZUA 4LF8L 1I4PA 1TQOA 1W3SA 5GADC 2MGSA 4LMYA 2FJ2A 4MTKA 1BCPD 4UCRA 4EYHB 3T1YH 1SYDA 4A3EB 1MJEA 2AUKA 1M0WA 2V4DA 2B2TC 1YEZA 2F0SA 5EWGA 5D8DA 2NN6H 5C0XH 2OEOA 1NNXA 5DG8A 1GJXA 1V1PA 2B2VA 2OQ0A 2KOLA 4DL5A 4EQ5A 4FNFA 2BDNA 1PZJD 2FPIB 4IHJF 2X6LA 3ERSX 3K7AH 1C7YA 2GPWA 1D7QA 1E24A 3KALA 1KBLA 2PYKA 3J7A5 4A93H 5DLFA 1IBLH 1U4RA 3CCUA 1Q86C 4BA1I 3MR5A 3OHBA 4O3PA 5H80A 3RUPA 4UCTA 3TZDA 1S5BD 2R7ZH 5J2UF 1SNQA 1LT6D 3F2BA 2R93G 4XYOA 1NAPA 1D1IA 1N56A 1XDNA 2BA0A 1LV9A 1JX4A 2F0VA 2LMCB 3HFZB 3BG5A 3KF8A 1PRTD 2R7FA 4UDUC 1EL0A 1I6VC 5C3EG 1HNZH 5FLXE 4A2AA 4X65Q 3GTGA 4QF4A 1LTAD 2K50A 4FBUA 1CKNB 4NKLA 5IGDA 1XJVA 2K28A 3IAYA 1VCIA 2YZGA 4A3GB 2C9OA 1HNXH 4LF9Q 1WCMA 1K83H 3M4YA 1UUPA 5KFHA 1QWYA 4RAZA 5JVDF 1IBKH 2PQAB 3GV5B 3JAMc 4ULLA 4U673 3RAXA 3LGJA 1SEBD 4UFZA 3RB3A 1S5FD 1CK1A 4KD4A 5EZYF 3MXPA 2NN6I 4Y7NH 1B33N 3PIPA 2VUMB 1STGA 1MJCA 3KF6B 4KKTA 2R86A 2RGVA 4ZKCB 1FJGL 5I6YA 1L1OA 3M85A 1Y1WH 3F2DA 4K14A 4ZQIA 3I2ZA 3CMAA 2UUCQ 1GHKA 3MWDA 2XIWA 3LWBA 1KABA 5D3DA 3RLNA 2AHOB 4A75A 4G3IA 1E2WA 2FP4B 4EBCA 4IPGA 4TKOB 2ATWA 4WJ4A 4JUZA 2F4VH 4H13C 5I9PA 1TWCA 4DR6H 1L1OB 1B8AA 2F3IA 4LF4Q 2NU9B 1BBXC 1UEBA 3HBLA 3PUVA 1SNCA 3PR5B 4YWKA 2DWCA 4X62H 1KNEA 2SDFA 1QILA 3KJOA 2WB1G 4LF5L 4OIJA 1CI3M 4DR1H 4KTAA 1TWCH 1OO9B 4IRKA 3OOCA 3K58A 2QDLA 2R8KA 4RB3C 3GLKA 4JBJA 2AU0A 1PTOC 3JAMi 1ICFB 3S9WA 2JA6B 1YNND 4DR3Q 3STBC 1PZID 4I50F 2FMMA 1PH5A 1BF4A 3EROA 3P20A 1EWIA 3NK9A 3P1HA 2CQYA 4IJHA 4G57A 4OX9H 3TP5A 2F0EA 1U9RA 2KQ3A 4J9OA 3HOZG 2EY1A 2Y0SG 5EBDA 3DEPA 3TEHB 4GS3A 4UCSA 2OXPA 4GN5A 1K73C 1O75A 2DN8A 3R3OA 5C1OA 3KDFB 3I90A 4M7EA 4I7HA 4HAEA 3U4ZA 1LT3D 1KNAA 1FR3A 1SNOA 3FRPB 2QDBA 4ECQA 5KFQA 3A8KE 4DV6L 4C3JG 4JPBW 1CSPA 2EIFA 1F77A 3T13A 3I4MG 4MA5A 3HOUG 2ASJA 4RFBA 1B3AA 1DM0B 1SFOB 1K3BC 1XPOA 3PGZA 3S1QH 1DZ1A 4RCNA 2RSNA 1F2YA 4IRDA 4KMUC 5KG6A 5BR8H 4GOPB 4XT1B 3CXCA 1O80A 4APVA 4DV7Q 2W57A 5T1IA 3R23A 4APMA 2E76C 3VR5A 5JUMA 4AQYL 3OTOQ 4E4TA 4NB3A 2A69D 4DV1L 1JICA 2LY7A 2I07B 2VPQA 2HQEA 4ID6A 4IPDA 2CQAA 3IKJA 2R7MA 4FF2A 2W6QA 3PN1A 3X3NA 1F2LA 3A8IE 4GC7A 2HVSA 2ZTDA 3ITPA 3C1EA 1HR0Q 4I7ZC 4JOIA 5EOYA 2JA5G 2MO1A 4RAYA 1KLUD 4TQUS 4X65L 4CKBA 1HRJA 5E4WC 2NVYA 2FINB 2OWOA 3H0GH 1XTDA 4DL7A 2NTSA 4O3QA 5LP6F 2I5HA 2CH4W 3PW4A 1DOLA 2BA1A 3GTOA 4K5WA 2JSOA 3AMUA 2X69A 2NZHA 4PZ6A 4FDBA 3UDGA 4ED1A 2UUCL 2CVRA 2MNAA 5DLGA 4P74A 3FP9A 3S17H 3OMCA 3HGBA 1RJPA 4NXNQ 3S2DB 2HDMA 3NQIA 2UXCQ 5DNFA 3ICEA 3KXYT 4N8X1 2JJQA 1SE3A 4TV9F 1DD2A 3G6JB 3V6HA 4JI5L 1OTCA 4LF5Q 3MXNA 5EKKA 2VQFH 2ZXOA 4LFCH 5FO9B 1O7IA 3EVQA 4A3IH 2D5DA 4JI8H 3I8ZA 1TY2A 5KFGA 4AYBG 2KEDA 4H0LC 3Q22A 1KC7A 3PUWA 4Q44A 4RGMA 5FJ8G 2KCCA 4DF7A 2RBMA 2RDHA 3A56A 5LXTF 1J9OA 2NVYH 1N36H 3H20A 1Z9FA 4QUCA 2FKLA 5M3MB 1KIXA 4MA0A 2VUMA 1WCMG 3ER0A 4WJWA 3BZDB 2UXDQ 4RB0A 4KD3A 1XPUA 5D1OA 3EJIA 1D1KA 2CW8A 4OWTB 2XD4A 4TV8F 5K2MA 1AE3A 3HKZG 1I6UA 4HTHA 2SEBD 5GROA 3VMMA 4L6TB 2PZUA 4XT3B 3G7LA 1K9MC 1N34H 1O7ZA 3CHBD 2A6EC 3IFTA 2J6SA 5DG7A 1VAJA 3P7JA 4DUYQ 3TS0A 2FMAA 3GIPA 3RMHA 3GDEA 4LF7Q 2D0OA 2DY7A 3K57A 4OX9L 2NVXA 2XNAC 2CH4A 5C6AA 2E74C 3M9NB 3D31A 4NXMH 1JQYD 4DKAC 3HOUH 1U4PA 3SK5A 1JC7A 1SYGA 2YZNA 4C3HH 1JORA 2QF7A 2EY5A 1TS2A 2C2DA 2EJGC 4J8QA 3J81j 1BKBA 1EY0A 4DR1L 4CDDC 2B2TA 3T5HA 3C1FA 1IYVA 1PH8A 3EQLC 1KJ8A 3GIIA 1VQAA 4JI2L 3C3LA 2SNSA 2WAQG 4C3JB 3ULJA 1E4FT 2NYZD 1BXRA 3ORRA 1WTRA 2MFIA 2WAQB 4CGYB 3GTMH 1W6JA 4JV5H 3H3VH 4DV6H 2V5AA 3OSOA 3S1NB 5ELCA 1EY8A 2F0GA 2IMWP 4RGOS 1HA6A 5KFMA 3VPCA 4IRCA 1N32H 3CQZB 4R8IA 4IOAA 4DL3A 2C35B 1IL2A 4DNTB 1KL9A 1C48A 3V4ZA 4L8JA 4C2MB 3JAMW 4IZOA 2GVAA 2F3VA 3GQBA 1CTMA 4Z9CB 1SJHD 5KFEA 1YHAA 1C0AA 3BQ1A 1L0WA 1KDAA 5LL6X 2X6GA 3HXLA 3GIQA 1I94Q 1PK8A 1K8GA 3UDFA 3KUPA 2JEGA 2YL2A 3KLRA 4B3MH 3ONAB 2W9CB 1EU3A 2QKIC 4MV6A 1PDQA 2QGQA 1VQEA 2F0IA 5KT5A 3U9SA 4A3BG 3UE0A 1VS0A 3HOZB 4DV2Q 1S68A 4BWGB 3PMFA 2M2LA 1IOWA 3RZOH 3KHLA 4IUUA 3JC66 4TVAB 3J7AF 2YYAA 1EIFA 1HJPA 3SI8A 1JOKA 1RD9D 2R92H 5DGBA 2B2VC 5EWFA 3RNUA 3T5JA 1E2ZA 3A7LA 3PO2G 4A3DG 3VR3A 3T4AC 3HOXG 4HNTA 1XX8A 2JEIA 3MVVA 1PYSB 2CCZA 1PTOD 3V2TA 1WOCA 3MXUA 2RQXA 3HZXA 3DXJC 2IW3A 4A3BH 3FKIA 3GTLA 1M8AA 4XXEA 3HOUB 2QW7A 4PQXA 4LF6Q 1Y1VA 4QCLA 5KFKA 3H15A 5HV6A 5KFBA 1JDEA 1KJJA 2R84A 3RBDA 1C30A 1HCZA 4O2AF 1YJWA 2PVPA 5CV9A 2DUDA 2PZTA 3SGIA 3DWPA 2FK2A 3BS1A 1GUSA 2NVXB 3N52A 5ISRA 1TWAB 3N6RA 1BVSA 4HJ9A 4MTNA 3GTGH 4PMCA 4L5SA 4IUQA 1V1OA 1JJGA 4O3RA 2RSOA 1HXYD 3CU7A 5C44B 4ECYA 1V4YA 2NUCA 2RKSA 2I0QA 1WI5A 3ZJYC 3CVZA 2AGPA 4YCWA 1LTID 4ED0A 1EIGA 2CW0D 4B3SQ 3MZ5A 4ME3A 3K3PA 2W70A 3QFFA 2F4VQ 4R4OA 1VQNA 4JI6Q 3RB6A 2KCNA 3MR2A 1YNJC 4DR7L 5IGGA 3J80L 5KFXA 4LF4H 2AMCB 1EIHA 4LFCL 4FM9A 1Y8OB 4S3SA 5CV5A 3JSLA 1YVCA 3PW2A 1AN8A 2N78A 4ME5A 4RHRA 4IQZA 1IOVA 2A73B 2OQKA 3E0EA 3OWFA 4C3HG 4XYLB 5TSSA 4HMJA 2DIKA 4JBKA 1IBLL 1VQMA 5D1PA 4A3JG 5C4XB 1ESRA 1JT8A 5FK9C 4BXXG 1A3TA 1EIYB 4UP7A 1I50H 1LT5D 1SNMA 4RMFA 1A0IA 3PW5A 1G51A 1GUGA 3QOJA 2X0SA 4CC5A 2R7NA 4DNRB 4DR4L 4JV0A 3H6MA 1QUQA 1E22A 4DN4M 1PTOB 1ONLA 1Q1BA 1AUXA 1R4QB 3D3RA 1V8QA 1PXUA 2B2YA 4QIWE 3JRWA 1X54A 4YJ2F 5LMNQ 5LYJF 1MIUA 1FL0A 3T1YL 1A2TA 3RAQA 3HOYB 3KF8B 3TP8A 3KOJA 4EEYA 1LTTD 5BN5A 1E2VA 3K5OA 3U58A 1SE4A 3J81c 1FD7D 5C0XG 1I5FA 4Q8FA 1A62A 2ZDHA 2HCCA 1NR4A 3OSPA 2PMZE 5J39A 1K8OA 2XCPA 2VL6A 2XGTA 4YCVA 4DK6C 5EGTA 1K8AC 3CPWA 3S17B 1AZQA 2DGYA 1C3OA 2YCHA 4IFDG 4JOIC 1TWGB 4DR2L 1S0OA 4J9MA 5KG2A 1T5EA 4U68A 3PIOA 1SFOA 2G9DA 2B2UC 2Y0SE 4IZ8A 3K6OA 1HR0W 1CHPD 1K1SA 4RUAA 4B9XA 3R5HA 4BXXH 3OTOH 2KECA 5LL6S 2Z8LA 1V51A 3I91A 2O4XA 3M4OB 3S1RH 2NTTA 3X3MA 2OLSA 2K4KA 2EYOA 3J7AV 3MR3A 2N55A 1K8MA 2DPIA 2E8GA 5E3FA 4DPGA 4JI7H 4DUZQ 3JAML 5DLQE 1ML0D 1H9RA 4NXNL 2YU9H 3J7AK 4A3DH 3A5UA 1V9PA 5DEHA 4J9QA 3GTOH 1QNKA 5C4JH 1XPRA 4LAAA 1K83B 1HNWQ 1EUDB 1EYZA 4B9WA 1EWCA 2PCFB 4Q0YA 1TS5A 4DR4Q 5IE8A 5E4XA 1W96A 4I55F 4IFDH 4RZRA 1KJ9A 2YZMA 2K52A 1H9SA 5KFSA 2F0HA 5M3FG 3HG9A 2KCMA 2EE1A 2H4OA 1NMGA 3W2DA 1U4LA 2RDGA 3Q23A 2W7OA 2OTLA 4NXNH 4X64L 5BR8L 3OWEB 1L0YB 5D1OB 5C5LA 4J6HA 2F0LA 1G2TA 1PTOH
chains in the Genus database with same CATH topology
3GTLH 4OONA 4OX9Q 3I55A 4LF9Q 1K83H 2A1AA 4UP8A 4A3GH 1I6HH 1X6OA 3DLLA 2PQAB 4IJLA 3CCMA 5IYDG 3WWVA 1VQFA 4L5TA 2B29A 2N49A 4X66Q 3JAMc 3ULPA 4A3JH 5IY0A 1N36L 4B3ML 3LGJA 4GOPA 4QL5A 2HT1A 1XMQL 1UWVA 4OXPA 2UXBL 2NN6I 4LFAL 4A3MG 4GKJQ 4Y7NH 3ULLA 3TQYA 1VQ5A 1AE2A 3PIPA 3CF5A 3T1YQ 1XMQQ 2VQEQ 4UY8C 2YTVA 3A0JA 4GKKL 2EQSA 1PA6A 1MJCA 1SRUA 3KF6B 4IFDJ 4XTCS 2UUBL 3L2PA 1FJGL 1L1OA 1X9NA 3M85A 1Y1WH 3F2DA 5IYDH 5M5YH 5IYBH 1QVFA 3I2ZA 3CMAA 2UUCQ 1IBMQ 3HOYH 2MO0A 3H3VI 3E9IA 2K5NA 2JEBI 2AHOB 3RLNA 4A75A 5HGQA 2JA8H 5BR8Q 5IYCH 2NZOA 4LF8Q 4A3LG 2CKZB 4IPGA 1J5EL 2IHFA 2ATWA 2JA6G 4WJ4A 1WFQA 2WP8J 1IBLQ 4JG2A 1L1OB 1PH2A 1B8AA 2F3IA 3M4QA 1TXYA 4LF4Q 3I4MH 1UEBA 3UE1A 3AFPA 3PUVA 4B3RQ 5GAGC 2NVXH 3I7FA 1HZ9A 1HR0L 4YWKA 1NY4A 2L15A 4UPAA 3KJOA 4B3TQ 2WB1G 5FJ8H 3W5OA 4LF5L 5K36G 3KJPA 3G6EA 4DNIA 1TWCH 1HNWL 2Z6KA 4DV1Q 4L5RC 4LF7L 2QEXA 4K0KL 2ZJPA 3M7NA 4JI1Q 4AQYQ 4JBJA 4JI1L 5M3MH 1VQKA 3JAMi 4K0KQ 4KHPL 4BY7G 4OO1G 2WFWA 2YYZA 4DV5Q 1KXLA 1X56A 1Y1VH 4DR3Q 3STBC 3CCRA 2Q2IA 1PH5A 3KDFA 4QQBX 2HIXA 3HOWG 1EWIA 1KAWA 5GAHC 1GVPA 1U5KA 4IJHA 2R6GA 4BY7H 1PYBA 2A8VA 3CCJA 1IBKQ 3CCVA 3HOZG 3S1MH 2VZAA 2Y0SG 3D0FA 3UDIA 3TEHB 1HZBA 4GS3A 4DV0L 3GTKH 4GN5A 1K73C 1N34L 1VQIA 1X65A 3BZCA 4JBWA 4R4TA 4BBSH 3A5ZB 2N8NA 3KDFB 1YJ9A 3U4ZA 2VQFQ 4YWMA 2UUAQ 1Q12A 2D0PA 3AFQA 3HKSA 4DV6L 4JI8Q 1OXTA 4DR7Q 1S40A 3CC7A 3CCSA 1CSPA 2EIFA 5C3EH 5C44G 5M3MG 3I4MG 3HOUG 3PF4A 4OWXB 4BA2I 3L7ZC 3EIVA 5IYCG 1V43A 1XPOA 3PGZA 2CWPA 3G48A 4R4QA 2K5VA 3RLOA 3S1QH 1JMCA 3TRZA 2IX0A 4IPHA 3K7UC 4DK3C 1HNXL 4JI5Q 3M4OH 4PMWA 1E3PA 1N33Q 1S72A 2WAQE 4AIMA 4GOPB 2AWOA 3CXCA 3U50C 4APVA 4DV7Q 2F52A 2R7ZG 5FLXc 1XNQQ 4AQYL 1VQ6A 2Q2UA 3OTOQ 4NB3A 4DR6Q 4A3EH 1S3OA 3CD6A 4DV1L 1UE5A 4KI0A 4A93G 4O2DA 2CFMA 4IPDA 2Z6KC 5IP9H 4JYAQ 5HY6A 2JA9A 4R1JA 2ZTDA 1YJNA 1D8LA 3F1ZA 1HR0Q 1N34Q 4JOIA 1JJCB 2JA5G 2LXKA 2MO1A 1KC8C 4TQUS 4HIDA 1Q46A 4X65L 2Z0SA 3I56A 1M1KC 2VUMG 4IFDI 2OWOA 3H0GH 1XTDA 3F8TA 2E2JH 5C0XJ 4DAMA 1NTGA 2I5HA 3PSIA 2BA1A 4GN4B 5GAEC 1H95A 4MZ9A 1PH4A 2UU9Q 3CCLA 2XTIA 3BJUA 3K81C 1X3EA 5E7NA 1BBWA 3MXNB 2NZHA 4LUVA 2Q2HA 4FDBA 4PZ6A 4DAYB 1K3RA 5H1SE 3UDGA 1EFWA 2UUCL 2K14A 2MNAA 4BBRG 2VS1A 4P74A 3FP9A 4GLVB 3CAMA 1VQ4A 4DR6L 4O0AA 1LYLA 1YNXA 3PUZA 4PG3A 4P71A 5C44H 3OTOL 4DUYL 3S17H 4YHHL 1PH3A 2CQOA 3FHWA 4NXNQ 3K0XA 4GKKQ 3CW2C 2UXCQ 4GNXA 3ICEA 2B63H 4KLKA 2JJQA 5JEAJ 1VQGA 4JI5L 4R4IA 1YBYA 1HNXQ 1OTCA 4LF5Q 2R7DA 1XNRQ 2RHSB 1BBUA 1Q8KA 4HJ8A 2IX1A 1O7IA 4A3IH 1VQDA 5M5XH 2ZJRA 4JV5Q 1PVOA 2I5MX 4AYBG 3AYHB 1SROA 3TREA 3PUWA 4JV5L 5FJ8G 1RIPA 1GKHA 4DR2Q 1W2BA 1TWFH 1QVCA 3HOWH 1N32Q 3GTPH 3S1NH 2WB1E 3S2DH 1JB7A 4BBSG 2PNHA 3CCQA 1YIJA 3HOYG 1EQRA 2NVYH 1V1QA 1Z9FA 2YTYA 3NBHB 4A3IG 1IBKL 2NVQH 2RHQB 3NENA 1KIXA 2KBNA 1IXRA 1WCMG 3ER0A 1C9OA 1Z47A 2UXDQ 2ZM6L 4QGUA 4BY1G 2VW9A 1XPUA 2VY3A 4JI3L 4OWTB 1X55A 1AE3A 3HKZG 4JCVE 4LFAQ 3S2HH 2E5LQ 2UXBQ 5GROA 1VQ8A 4X62L 1GD7A 2K5HA 1QVGA 1U0LA 1PFSA 5FLMH 3K80C 4A3FH 1K9MC 1E1OA 1GM5A 2OCEA 1KRTA 4DUYQ 1M90C 4POFA 3TS0A 1YI2A 4YCUA 4B3MQ 4A3CG 4A3LH 1CKMA 1TWGH 3RN5A 3GDEA 4LF7Q 4L5QA 3VDYA 4X62Q 3PO3G 2D0OA 2JK8A 4LF9L 1KRSA 4OX9L 4JI3Q 2IY5B 1TWHH 1JE5A 2R93H 1RL2A 3EN2A 2KHIA 3D31A 4GN3B 4JI0L 5ELOA 3RZDH 3J81i 4LFBL 4LF4L 3KF6A 4DKAC 3HOUH 1Y1WG 3GO5A 1PV4A 4C3HH 5FLMG 1KHIA 1J5EQ 3I4NH 3TS2A 1LM0A 1I94L 4JI0Q 4DV3Q 1OXXK 1LTLA 1BKBA 2RF4A 3J81j 4A76A 4DR1L 1UE7A 1PH1A 2ALYB 1PH8A 5JJIA 4A3KH 3PUYA 1VQAA 3I4NG 3L0OA 4LW1A 1FGUA 3J80c 4JI2L 2WAQG 3ULJA 4LFCQ 1SLJA 3FKIG 1E1TA 2MFIA 4P75A 3GTMH 2R92G 4A93H 2UUBQ 3H3VH 3H0GG 5LMUL 1N9WA 3HOZH 4HIKA 1FVIA 4X6AH 2H5XA 1IYJB 3OYYA 5IP9G 5IWAQ 1SFOH 3A74A 3S14H 4ALPA 2B63G 3GD7A 4LUOA 1VQHA 4IOAA 2C35B 3PV0A 1IL2A 1KL9A 1P16A 2LXJA 1N36Q 1KQSA 1HNZL 1Q1EA 4WJ3M 2GVAA 2RCNA 4IO9A 2GN5A 4JI8L 2PI2A 4JI2Q 2JA8G 1YHAA 1C0AA 5JJKA 2VQFL 1PHJA 3M3YH 1L0WA 4A3KG 2YV5A 4J15A 3DM3A 3J7ZC 3PF5A 1YHQA 3S24A 1CKOA 4R4CA 4EX5A 1YITA 2ZTEA 4MNOA 1I94Q 5IP7H 1I3QH 3PO3H 5M5WH 1K8GA 3UDFA 4YWLA 4DV0Q 4QY7A 4H02A 1HH2P 2Q2TA 1G6PA 1QZHA 4QJFA 4C3JH 1XMOL 5EAYA 5JEAG 4LF6L 1DGSA 2QGQA 3NEMA 1VQEA 1B70B 1HZCA 3Q8DA 4UP9A 3G71A 4JI7L 4JYAL 4A3BG 3UE0A 1VS0A 4DV2Q 4A3MH 2KCTA 3RZOH 4DR3L 3JC66 4TVAB 1EUJA 4IPCA 4POGA 5J3BA 4NXMQ 1EIFA 1HJPA 1NBWA 1ASZA 4YHHQ 1VQOA 2R92H 2A19A 3W1GA 2F4VL 2JQOA 2AWNA 1B7YB 4DV4Q 3RNUA 3PO2G 1TWAH 4A3DG 5ELNA 4AYBE 4NXML 3HOXG 4C2MH 5GQOA 2HHHQ 1PYSB 3F2CA 4HJ7A 1VQ7A 4GLAC 2CCZA 2E2HH 1WOCA 2AKWB 4DV2L 4HIMA 1SE8A 3T1HL 2ES2A 2ZM6Q 4HIOA 4A3BH 2UXDL 3HOXH 3J80i 3RLFA 1SN8A 1QZGA 4LF6Q 3G4SA 1X3FA 3AEVA 3H15A 1CKNA 1A8VA 1IZ6A 1CSQA 2NN6G 4P73A 4DV6Q 2VUMH 1QUQB 2K75A 1YJWA 3SGIA 3FKIH 2DUDA 5C0XI 1YZ6A 2YTXA 1NE3A 4XIGS 4IOCA 2HQLA 3UDXA 1N32L 4RG1A 1Q82C 3HOVG 4JC0A 1OXVA 2JEAI 1BVSA 3HKZE 4HJ9A 4MTNA 3GTGH 2I5LX 4A3CH 3CP0A 2JA7H 4L5SA 4BBRH 4JI4L 1XNQL 2HIVA 1JJGA 4DV7L 5AJ3L 3BU2A 3E9HA 1Y14B 3I4OA 2VQEL 5IP7G 1VQJA 1XNRL 2KENA 4HJ5A 2I0QA 1EYGA 3PUXA 1WI5A 4YY3Q 3ZJYC 4GKJL 1UE6A 1X3GA 4YCWA 2ZJQA 1UE1A 1WCMH 2EXDA 4B3SQ 3CPFA 3M9BA 1KD1C 1Q7YC 1VQLA 1NMFA 4ME3A 1PH9A 4KHZA 2F4VQ 1YHBA 4R4OA 4JI4Q 4JI6Q 1VQNA 1LUZA 4DR7L 3CMEA 2AMCB 4LFCL 1NJIC 2LSSA 4A3FG 3B6YA 2ZTCA 1OXSC 1YVCA 2MQHA 1VQ9A 4A4IA 2N78A 1WJJA 4AH6A 2UU9L 3IRBA 4JI7Q 4DV3L 4Y52H 5C4XH 3KLWA 4B3RL 2OQKA 3E0EA 3GTQH 4OO1I 2JE6I 4JBKA 1IBLL 1VQMA 4A3JG 1L2FA 1SR3A 3U4VA 1JT8A 1G291 4BXXG 4LFBQ 1K0RA 4UP7A 1EIYB 3EBEA 1I50H 2PQAA 1A0IA 4RMFA 1G51A 3MEFA 4A3GG 1P8LA 3CCEA 3T1HQ 1EQQA 3KYHC 4GLXA 2FXQA 4DR4L 1QUQA 4OWWB 1E22A 3CQZH 3M4PA 2HHHL 3BZKA 1SMXA 4P72A 1Q1BA 2JA7G 2BH8A 4PZ8A 1HNZQ 1PH7A 4JI6L 2JA6H 1GO3E 3CC4A 4QIWE 4GNXC 1X54A 4B3SL 5LMNQ 1MIUA 1FL0A 3T1YL 1PH6A 2E5LL 4LUZA 3KF8B 3NELA 3KOJA 1N33L 4YY3L 1A63A 5IWAL 1VQCA 1WYDA 2D62A 4B3TL 3W1BA 3U58A 4C3IH 1ASYA 1EOVA 3J81c 5AJ3Q 5IYBG 5C0XG 1I5FA 5IT9c 1A62A 1VQBA 3RR5A 3OW2A 1VQPA 3KFUA 1XMOQ 2JA5H 4DR5L 1E7ZA 3S15H 2PMZE 5LMNW 2E2IH 1AH9A 3K8AA 2IHEA 2VL6A 2XGTA 2IT1A 1N8RC 2UUAL 4LF8L 1W3SA 4YCVA 4DK6C 1J6QA 2CWAA 3RN2A 5GADC 1K8AC 4LWCA 3CPWA 2VNUD 2PI2E 1Y1VG 2DGYA 3S16H 4IFDG 4JOIC 4DR2L 1JJ2A 4X64Q 1MJEA 1IBML 3PIOA 2ASBA 2Y0SE 4A3EG 1HR0W 1YEZA 3PO2H 2GVBA 4DR5Q 1FJGQ 4BXXH 4LNQA 3CC2A 2OQ0A 3S1RH 4GOPC 2K4KA 4EQ5A 1OXUA 2NVTH 1T9HA 5JJLA 3ERSX 2E8GA 4DPGA 3K7AH 4DV5L 5LMNL 1C7YA 4BY1H 4KHPQ 4DUZQ 1E24A 2UXCL 1D7QA 5DLQE 4NXNL 2YU9H 3J7A5 2ID0A 4DV4L 3CCUA 5LMUQ 1Q86C 4X66L 4BA1I 1V9PA 3A5UA 4A3DH 3GTOH 2R7ZH 5C4JH 4DUZL 1XPRA 3F2BA 1HNWQ 2R93G 5M3FH 2N3SA 2KHJA 3HOVH 3AQQA 5IE8A 4NPSA 4DR4Q 2OTJA 2BA0A 3STBD 1L1OC 4PZ7A 4DR1Q 2K52A 4GNXB 1MKHA 3HFZB 1HZAA 5M3FG 2V1CC 2R7FA 2KCMA 1NMGA 5C3EG 4HJAA 4X65Q 1R9TH 5C4XG 2OTLA 4X64L 2B3GA 2K50A 1Q81C 1CUKA 5BR8L 2QA4A 2BH2A 1CKNB 3PCOB 1XJVA 4JBMA 3GTJH 1VCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTL H;  4OON A;  4OX9 Q;  3I55 A;  4LF9 Q;  1K83 H;  2A1A A;  4UP8 A;  4A3G H;  1I6H H;  1X6O A;  3DLL A;  2PQA B;  4IJL A;  3CCM A;  5IYD G;  3WWV A;  1VQF A;  4L5T A;  2B29 A;  2N49 A;  4X66 Q;  3JAM c;  3ULP A;  4A3J H;  5IY0 A;  1N36 L;  4B3M L;  3LGJ A;  4GOP A;  4QL5 A;  2HT1 A;  1XMQ L;  1UWV A;  4OXP A;  2UXB L;  2NN6 I;  4LFA L;  4A3M G;  4GKJ Q;  4Y7N H;  3ULL A;  3TQY A;  1VQ5 A;  1AE2 A;  3PIP A;  3CF5 A;  3T1Y Q;  1XMQ Q;  2VQE Q;  4UY8 C;  2YTV A;  3A0J A;  4GKK L;  2EQS A;  1PA6 A;  1MJC A;  1SRU A;  3KF6 B;  4IFD J;  4XTC S;  2UUB L;  3L2P A;  1FJG L;  1L1O A;  1X9N A;  3M85 A;  1Y1W H;  3F2D A;  5IYD H;  5M5Y H;  5IYB H;  1QVF A;  3I2Z A;  3CMA A;  2UUC Q;  1IBM Q;  3HOY H;  2MO0 A;  3H3V I;  3E9I A;  2K5N A;  2JEB I;  2AHO B;  3RLN A;  4A75 A;  5HGQ A;  2JA8 H;  5BR8 Q;  5IYC H;  2NZO A;  4LF8 Q;  4A3L G;  2CKZ B;  4IPG A;  1J5E L;  2IHF A;  2ATW A;  2JA6 G;  4WJ4 A;  1WFQ A;  2WP8 J;  1IBL Q;  4JG2 A;  1L1O B;  1PH2 A;  1B8A A;  2F3I A;  3M4Q A;  1TXY A;  4LF4 Q;  3I4M H;  1UEB A;  3UE1 A;  3AFP A;  3PUV A;  4B3R Q;  5GAG C;  2NVX H;  3I7F A;  1HZ9 A;  1HR0 L;  4YWK A;  1NY4 A;  2L15 A;  4UPA A;  3KJO A;  4B3T Q;  2WB1 G;  5FJ8 H;  3W5O A;  4LF5 L;  5K36 G;  3KJP A;  3G6E A;  4DNI A;  1TWC H;  1HNW L;  2Z6K A;  4DV1 Q;  4L5R C;  4LF7 L;  2QEX A;  4K0K L;  2ZJP A;  3M7N A;  4JI1 Q;  4AQY Q;  4JBJ A;  4JI1 L;  5M3M H;  1VQK A;  3JAM i;  4K0K Q;  4KHP L;  4BY7 G;  4OO1 G;  2WFW A;  2YYZ A;  4DV5 Q;  1KXL A;  1X56 A;  1Y1V H;  4DR3 Q;  3STB C;  3CCR A;  2Q2I A;  1PH5 A;  3KDF A;  4QQB X;  2HIX A;  3HOW G;  1EWI A;  1KAW A;  5GAH C;  1GVP A;  1U5K A;  4IJH A;  2R6G A;  4BY7 H;  1PYB A;  2A8V A;  3CCJ A;  1IBK Q;  3CCV A;  3HOZ G;  3S1M H;  2VZA A;  2Y0S G;  3D0F A;  3UDI A;  3TEH B;  1HZB A;  4GS3 A;  4DV0 L;  3GTK H;  4GN5 A;  1K73 C;  1N34 L;  1VQI A;  1X65 A;  3BZC A;  4JBW A;  4R4T A;  4BBS H;  3A5Z B;  2N8N A;  3KDF B;  1YJ9 A;  3U4Z A;  2VQF Q;  4YWM A;  2UUA Q;  1Q12 A;  2D0P A;  3AFQ A;  3HKS A;  4DV6 L;  4JI8 Q;  1OXT A;  4DR7 Q;  1S40 A;  3CC7 A;  3CCS A;  1CSP A;  2EIF A;  5C3E H;  5C44 G;  5M3M G;  3I4M G;  3HOU G;  3PF4 A;  4OWX B;  4BA2 I;  3L7Z C;  3EIV A;  5IYC G;  1V43 A;  1XPO A;  3PGZ A;  2CWP A;  3G48 A;  4R4Q A;  2K5V A;  3RLO A;  3S1Q H;  1JMC A;  3TRZ A;  2IX0 A;  4IPH A;  3K7U C;  4DK3 C;  1HNX L;  4JI5 Q;  3M4O H;  4PMW A;  1E3P A;  1N33 Q;  1S72 A;  2WAQ E;  4AIM A;  4GOP B;  2AWO A;  3CXC A;  3U50 C;  4APV A;  4DV7 Q;  2F52 A;  2R7Z G;  5FLX c;  1XNQ Q;  4AQY L;  1VQ6 A;  2Q2U A;  3OTO Q;  4NB3 A;  4DR6 Q;  4A3E H;  1S3O A;  3CD6 A;  4DV1 L;  1UE5 A;  4KI0 A;  4A93 G;  4O2D A;  2CFM A;  4IPD A;  2Z6K C;  5IP9 H;  4JYA Q;  5HY6 A;  2JA9 A;  4R1J A;  2ZTD A;  1YJN A;  1D8L A;  3F1Z A;  1HR0 Q;  1N34 Q;  4JOI A;  1JJC B;  2JA5 G;  2LXK A;  2MO1 A;  1KC8 C;  4TQU S;  4HID A;  1Q46 A;  4X65 L;  2Z0S A;  3I56 A;  1M1K C;  2VUM G;  4IFD I;  2OWO A;  3H0G H;  1XTD A;  3F8T A;  2E2J H;  5C0X J;  4DAM A;  1NTG A;  2I5H A;  3PSI A;  2BA1 A;  4GN4 B;  5GAE C;  1H95 A;  4MZ9 A;  1PH4 A;  2UU9 Q;  3CCL A;  2XTI A;  3BJU A;  3K81 C;  1X3E A;  5E7N A;  1BBW A;  3MXN B;  2NZH A;  4LUV A;  2Q2H A;  4FDB A;  4PZ6 A;  4DAY B;  1K3R A;  5H1S E;  3UDG A;  1EFW A;  2UUC L;  2K14 A;  2MNA A;  4BBR G;  2VS1 A;  4P74 A;  3FP9 A;  4GLV B;  3CAM A;  1VQ4 A;  4DR6 L;  4O0A A;  1LYL A;  1YNX A;  3PUZ A;  4PG3 A;  4P71 A;  5C44 H;  3OTO L;  4DUY L;  3S17 H;  4YHH L;  1PH3 A;  2CQO A;  3FHW A;  4NXN Q;  3K0X A;  4GKK Q;  3CW2 C;  2UXC Q;  4GNX A;  3ICE A;  2B63 H;  4KLK A;  2JJQ A;  5JEA J;  1VQG A;  4JI5 L;  4R4I A;  1YBY A;  1HNX Q;  1OTC A;  4LF5 Q;  2R7D A;  1XNR Q;  2RHS B;  1BBU A;  1Q8K A;  4HJ8 A;  2IX1 A;  1O7I A;  4A3I H;  1VQD A;  5M5X H;  2ZJR A;  4JV5 Q;  1PVO A;  2I5M X;  4AYB G;  3AYH B;  1SRO A;  3TRE A;  3PUW A;  4JV5 L;  5FJ8 G;  1RIP A;  1GKH A;  4DR2 Q;  1W2B A;  1TWF H;  1QVC A;  3HOW H;  1N32 Q;  3GTP H;  3S1N H;  2WB1 E;  3S2D H;  1JB7 A;  4BBS G;  2PNH A;  3CCQ A;  1YIJ A;  3HOY G;  1EQR A;  2NVY H;  1V1Q A;  1Z9F A;  2YTY A;  3NBH B;  4A3I G;  1IBK L;  2NVQ H;  2RHQ B;  3NEN A;  1KIX A;  2KBN A;  1IXR A;  1WCM G;  3ER0 A;  1C9O A;  1Z47 A;  2UXD Q;  2ZM6 L;  4QGU A;  4BY1 G;  2VW9 A;  1XPU A;  2VY3 A;  4JI3 L;  4OWT B;  1X55 A;  1AE3 A;  3HKZ G;  4JCV E;  4LFA Q;  3S2H H;  2E5L Q;  2UXB Q;  5GRO A;  1VQ8 A;  4X62 L;  1GD7 A;  2K5H A;  1QVG A;  1U0L A;  1PFS A;  5FLM H;  3K80 C;  4A3F H;  1K9M C;  1E1O A;  1GM5 A;  2OCE A;  1KRT A;  4DUY Q;  1M90 C;  4POF A;  3TS0 A;  1YI2 A;  4YCU A;  4B3M Q;  4A3C G;  4A3L H;  1CKM A;  1TWG H;  3RN5 A;  3GDE A;  4LF7 Q;  4L5Q A;  3VDY A;  4X62 Q;  3PO3 G;  2D0O A;  2JK8 A;  4LF9 L;  1KRS A;  4OX9 L;  4JI3 Q;  2IY5 B;  1TWH H;  1JE5 A;  2R93 H;  1RL2 A;  3EN2 A;  2KHI A;  3D31 A;  4GN3 B;  4JI0 L;  5ELO A;  3RZD H;  3J81 i;  4LFB L;  4LF4 L;  3KF6 A;  4DKA C;  3HOU H;  1Y1W G;  3GO5 A;  1PV4 A;  4C3H H;  5FLM G;  1KHI A;  1J5E Q;  3I4N H;  3TS2 A;  1LM0 A;  1I94 L;  4JI0 Q;  4DV3 Q;  1OXX K;  1LTL A;  1BKB A;  2RF4 A;  3J81 j;  4A76 A;  4DR1 L;  1UE7 A;  1PH1 A;  2ALY B;  1PH8 A;  5JJI A;  4A3K H;  3PUY A;  1VQA A;  3I4N G;  3L0O A;  4LW1 A;  1FGU A;  3J80 c;  4JI2 L;  2WAQ G;  3ULJ A;  4LFC Q;  1SLJ A;  3FKI G;  1E1T A;  2MFI A;  4P75 A;  3GTM H;  2R92 G;  4A93 H;  2UUB Q;  3H3V H;  3H0G G;  5LMU L;  1N9W A;  3HOZ H;  4HIK A;  1FVI A;  4X6A H;  2H5X A;  1IYJ B;  3OYY A;  5IP9 G;  5IWA Q;  1SFO H;  3A74 A;  3S14 H;  4ALP A;  2B63 G;  3GD7 A;  4LUO A;  1VQH A;  4IOA A;  2C35 B;  3PV0 A;  1IL2 A;  1KL9 A;  1P16 A;  2LXJ A;  1N36 Q;  1KQS A;  1HNZ L;  1Q1E A;  4WJ3 M;  2GVA A;  2RCN A;  4IO9 A;  2GN5 A;  4JI8 L;  2PI2 A;  4JI2 Q;  2JA8 G;  1YHA A;  1C0A A;  5JJK A;  2VQF L;  1PHJ A;  3M3Y H;  1L0W A;  4A3K G;  2YV5 A;  4J15 A;  3DM3 A;  3J7Z C;  3PF5 A;  1YHQ A;  3S24 A;  1CKO A;  4R4C A;  4EX5 A;  1YIT A;  2ZTE A;  4MNO A;  1I94 Q;  5IP7 H;  1I3Q H;  3PO3 H;  5M5W H;  1K8G A;  3UDF A;  4YWL A;  4DV0 Q;  4QY7 A;  4H02 A;  1HH2 P;  2Q2T A;  1G6P A;  1QZH A;  4QJF A;  4C3J H;  1XMO L;  5EAY A;  5JEA G;  4LF6 L;  1DGS A;  2QGQ A;  3NEM A;  1VQE A;  1B70 B;  1HZC A;  3Q8D A;  4UP9 A;  3G71 A;  4JI7 L;  4JYA L;  4A3B G;  3UE0 A;  1VS0 A;  4DV2 Q;  4A3M H;  2KCT A;  3RZO H;  4DR3 L;  3JC6 6;  4TVA B;  1EUJ A;  4IPC A;  4POG A;  5J3B A;  4NXM Q;  1EIF A;  1HJP A;  1NBW A;  1ASZ A;  4YHH Q;  1VQO A;  2R92 H;  2A19 A;  3W1G A;  2F4V L;  2JQO A;  2AWN A;  1B7Y B;  4DV4 Q;  3RNU A;  3PO2 G;  1TWA H;  4A3D G;  5ELN A;  4AYB E;  4NXM L;  3HOX G;  4C2M H;  5GQO A;  2HHH Q;  1PYS B;  3F2C A;  4HJ7 A;  1VQ7 A;  4GLA C;  2CCZ A;  2E2H H;  1WOC A;  2AKW B;  4DV2 L;  4HIM A;  1SE8 A;  3T1H L;  2ES2 A;  2ZM6 Q;  4HIO A;  4A3B H;  2UXD L;  3HOX H;  3J80 i;  3RLF A;  1SN8 A;  1QZG A;  4LF6 Q;  3G4S A;  1X3F A;  3AEV A;  3H15 A;  1CKN A;  1A8V A;  1IZ6 A;  1CSQ A;  2NN6 G;  4P73 A;  4DV6 Q;  2VUM H;  1QUQ B;  2K75 A;  1YJW A;  3SGI A;  3FKI H;  2DUD A;  5C0X I;  1YZ6 A;  2YTX A;  1NE3 A;  4XIG S;  4IOC A;  2HQL A;  3UDX A;  1N32 L;  4RG1 A;  1Q82 C;  3HOV G;  4JC0 A;  1OXV A;  2JEA I;  1BVS A;  3HKZ E;  4HJ9 A;  4MTN A;  3GTG H;  2I5L X;  4A3C H;  3CP0 A;  2JA7 H;  4L5S A;  4BBR H;  4JI4 L;  1XNQ L;  2HIV A;  1JJG A;  4DV7 L;  5AJ3 L;  3BU2 A;  3E9H A;  1Y14 B;  3I4O A;  2VQE L;  5IP7 G;  1VQJ A;  1XNR L;  2KEN A;  4HJ5 A;  2I0Q A;  1EYG A;  3PUX A;  1WI5 A;  4YY3 Q;  3ZJY C;  4GKJ L;  1UE6 A;  1X3G A;  4YCW A;  2ZJQ A;  1UE1 A;  1WCM H;  2EXD A;  4B3S Q;  3CPF A;  3M9B A;  1KD1 C;  1Q7Y C;  1VQL A;  1NMF A;  4ME3 A;  1PH9 A;  4KHZ A;  2F4V Q;  1YHB A;  4R4O A;  4JI4 Q;  4JI6 Q;  1VQN A;  1LUZ A;  4DR7 L;  3CME A;  2AMC B;  4LFC L;  1NJI C;  2LSS A;  4A3F G;  3B6Y A;  2ZTC A;  1OXS C;  1YVC A;  2MQH A;  1VQ9 A;  4A4I A;  2N78 A;  1WJJ A;  4AH6 A;  2UU9 L;  3IRB A;  4JI7 Q;  4DV3 L;  4Y52 H;  5C4X H;  3KLW A;  4B3R L;  2OQK A;  3E0E A;  3GTQ H;  4OO1 I;  2JE6 I;  4JBK A;  1IBL L;  1VQM A;  4A3J G;  1L2F A;  1SR3 A;  3U4V A;  1JT8 A;  1G29 1;  4BXX G;  4LFB Q;  1K0R A;  4UP7 A;  1EIY B;  3EBE A;  1I50 H;  2PQA A;  1A0I A;  4RMF A;  1G51 A;  3MEF A;  4A3G G;  1P8L A;  3CCE A;  3T1H Q;  1EQQ A;  3KYH C;  4GLX A;  2FXQ A;  4DR4 L;  1QUQ A;  4OWW B;  1E22 A;  3CQZ H;  3M4P A;  2HHH L;  3BZK A;  1SMX A;  4P72 A;  1Q1B A;  2JA7 G;  2BH8 A;  4PZ8 A;  1HNZ Q;  1PH7 A;  4JI6 L;  2JA6 H;  1GO3 E;  3CC4 A;  4QIW E;  4GNX C;  1X54 A;  4B3S L;  5LMN Q;  1MIU A;  1FL0 A;  3T1Y L;  1PH6 A;  2E5L L;  4LUZ A;  3KF8 B;  3NEL A;  3KOJ A;  1N33 L;  4YY3 L;  1A63 A;  5IWA L;  1VQC A;  1WYD A;  2D62 A;  4B3T L;  3W1B A;  3U58 A;  4C3I H;  1ASY A;  1EOV A;  3J81 c;  5AJ3 Q;  5IYB G;  5C0X G;  1I5F A;  5IT9 c;  1A62 A;  1VQB A;  3RR5 A;  3OW2 A;  1VQP A;  3KFU A;  1XMO Q;  2JA5 H;  4DR5 L;  1E7Z A;  3S15 H;  2PMZ E;  5LMN W;  2E2I H;  1AH9 A;  3K8A A;  2IHE A;  2VL6 A;  2XGT A;  2IT1 A;  1N8R C;  2UUA L;  4LF8 L;  1W3S A;  4YCV A;  4DK6 C;  1J6Q A;  2CWA A;  3RN2 A;  5GAD C;  1K8A C;  4LWC A;  3CPW A;  2VNU D;  2PI2 E;  1Y1V G;  2DGY A;  3S16 H;  4IFD G;  4JOI C;  4DR2 L;  1JJ2 A;  4X64 Q;  1MJE A;  1IBM L;  3PIO A;  2ASB A;  2Y0S E;  4A3E G;  1HR0 W;  1YEZ A;  3PO2 H;  2GVB A;  4DR5 Q;  1FJG Q;  4BXX H;  4LNQ A;  3CC2 A;  2OQ0 A;  3S1R H;  4GOP C;  2K4K A;  4EQ5 A;  1OXU A;  2NVT H;  1T9H A;  5JJL A;  3ERS X;  2E8G A;  4DPG A;  3K7A H;  4DV5 L;  5LMN L;  1C7Y A;  4BY1 H;  4KHP Q;  4DUZ Q;  1E24 A;  2UXC L;  1D7Q A;  5DLQ E;  4NXN L;  2YU9 H;  3J7A 5;  2ID0 A;  4DV4 L;  3CCU A;  5LMU Q;  1Q86 C;  4X66 L;  4BA1 I;  1V9P A;  3A5U A;  4A3D H;  3GTO H;  2R7Z H;  5C4J H;  4DUZ L;  1XPR A;  3F2B A;  1HNW Q;  2R93 G;  5M3F H;  2N3S A;  2KHJ A;  3HOV H;  3AQQ A;  5IE8 A;  4NPS A;  4DR4 Q;  2OTJ A;  2BA0 A;  3STB D;  1L1O C;  4PZ7 A;  4DR1 Q;  2K52 A;  4GNX B;  1MKH A;  3HFZ B;  1HZA A;  5M3F G;  2V1C C;  2R7F A;  2KCM A;  1NMG A;  5C3E G;  4HJA A;  4X65 Q;  1R9T H;  5C4X G;  2OTL A;  4X64 L;  2B3G A;  2K50 A;  1Q81 C;  1CUK A;  5BR8 L;  2QA4 A;  2BH2 A;  1CKN B;  3PCO B;  1XJV A;  4JBM A;  3GTJ H;  1VCI A; 
#chains in the Genus database with same CATH topology
 1CHQ D;  4G7H C;  1D2B A;  4LSX A;  5KEE A;  1I6H H;  2R82 A;  1RYS A;  4IJL A;  4HNV A;  5FOB B;  3J81 W;  4K8I A;  5IY0 A;  2F0W A;  2EZV A;  4DAY A;  2HT1 A;  3QO2 A;  4QL5 A;  5M9O A;  2V4R A;  2IL8 A;  3BYT B;  4LFA L;  3D8G A;  1QB5 D;  1RJR A;  3TQY A;  1IKL A;  4PNY A;  1S10 A;  1XMQ Q;  3M4I A;  2YTV A;  3A0J A;  2EYP A;  3HEJ A;  1PA6 A;  1S5D D;  2VUG A;  4F50 A;  5DGA A;  4DR7 H;  1LT4 D;  1BDO A;  2DNC A;  4XYM B;  5IYD H;  5M5Y H;  5IYB H;  1QVF A;  3SR1 A;  4X3K A;  2G9H D;  1SMY C;  3HOY H;  2MO0 A;  2R61 A;  3RGZ A;  1GUT A;  2W8L A;  1R9T A;  4HCE A;  3CQZ A;  4FXG C;  5BR8 Q;  4LF8 Q;  4C3H B;  5C4Z A;  4KHP H;  2K03 A;  2WP8 J;  4MIU A;  4JG2 A;  5LMU H;  3WDN A;  1PH2 A;  5IT9 L;  3M4Q A;  3UE1 A;  3WOF A;  3AFP A;  4ZK9 B;  1TII D;  5GAG C;  2NVX H;  2K6A A;  2L15 A;  3E3X A;  1SNP A;  4B3T Q;  4FP5 D;  2B39 A;  2W71 A;  3G6E A;  2R93 A;  2XGP A;  1HNW L;  4DV1 Q;  4LF7 L;  4ZQ3 A;  5FLX W;  1LAB A;  1VQK A;  2YRX A;  4K0K Q;  2JEF A;  4RKB A;  1J5E H;  2WFW A;  1KXL A;  4JI0 H;  1Y1V H;  1F9Q A;  3BG3 A;  2SNM A;  3CCR A;  4HMI A;  2Q2I A;  2HIX A;  1MSH A;  3HOW G;  1KAW A;  5GAH C;  1GVP A;  1U5K A;  4ED6 A;  3W3A A;  4LF9 H;  1PYB A;  1B50 A;  2GPS A;  2RVL A;  3S1M H;  4EBD A;  4K6D A;  1KJI A;  5FPO A;  4K2L A;  3RZO B;  1YNN C;  4CBV A;  1T94 A;  2NU6 B;  4ILW A;  3BDL A;  2FFK B;  2ZT9 C;  1CFM A;  2L11 A;  3BQ0 A;  2PQE A;  3AFQ A;  3HKS A;  4JI8 Q;  5IGB A;  1T5X D;  4K5X A;  1I50 B;  4DFA A;  3CCS A;  3Q8S B;  4BA2 I;  1TWC B;  3I70 A;  5C44 G;  1RTN A;  2F4I A;  1Z6H A;  2C28 A;  1V43 A;  2F0P A;  1VMP A;  4R4Q A;  3RLO A;  3J81 L;  2HVQ A;  4DK1 A;  3K7U C;  1HNX L;  1ET6 A;  1E3P A;  5I9O A;  3H4B A;  1S72 A;  2K1B A;  4CHT B;  2OH2 A;  4JV1 A;  2F52 A;  4QWE A;  2AGQ A;  1C4Q A;  4JV2 A;  1VQ6 A;  1SND A;  1EHI A;  4IAL A;  4A3E H;  1S3O A;  2IP4 A;  4YB8 B;  3J81 E;  3RV4 A;  4HR7 A;  3URY A;  2Z6K C;  4JYA Q;  3FPP A;  2E5L H;  2JEJ A;  1YJN A;  5KFA A;  1EUC B;  1N34 Q;  3H0G B;  4FS1 A;  5C3W A;  2WB1 A;  2LXK A;  1KC8 C;  1M1K C;  4HID A;  3I56 A;  1JE4 A;  1LTB D;  2Z0S A;  2VUM G;  5KFT A;  4N8F A;  1D5M C;  2E2J H;  3BQ2 A;  3MR6 A;  4GN4 B;  1EY6 A;  4MZ9 A;  2UU9 Q;  2R3Z A;  4Q5V A;  3CCL A;  4DR3 H;  4EGV A;  2FLL A;  3K81 C;  5E7N A;  1BBW A;  2Q2H A;  1K3R A;  4O4L F;  4BBR G;  1AP0 A;  4NMZ A;  3CAM A;  1LYL A;  5C44 H;  4DUY L;  2E2J B;  3FHW A;  1HQR D;  3K0X A;  4ECR A;  2IBK A;  4HSP A;  2W6Z A;  3BAB A;  4KLK A;  1IW7 C;  3QWN A;  2YRW A;  1LO5 D;  4M1U B;  3FDT A;  1PTO F;  1G8Z D;  2R7D A;  2NB0 A;  2RHS B;  4KY5 A;  5JJZ A;  1Q8K A;  2WIN B;  2UUA H;  1EZ8 A;  3FEW X;  3GTP A;  5E1F A;  1F2M A;  1VQD A;  5M5X H;  3S1Q B;  4JV5 Q;  3T16 A;  4Y8V B;  4I7A A;  3L9A X;  5CA1 F;  1SRO A;  2E2H A;  1Y1V B;  1TA8 A;  4GZY C;  5KFV A;  1GKH A;  2A69 C;  2EDG A;  2LKV A;  1W2B A;  3HOW H;  3T53 B;  3GTP H;  1WTH A;  1AN7 A;  3GTJ B;  5KGU A;  2VB3 X;  1V1P B;  1MI2 A;  1ZEQ X;  1STE A;  5M5X B;  5KT6 A;  1V1Q A;  4CC6 A;  1X3P A;  2FLN A;  1JLL B;  4JI6 H;  2YTY A;  4F4Z A;  2UUC H;  3ERQ A;  5JAV A;  1IXR A;  1C9O A;  4H44 C;  3GTQ B;  2HJW A;  5J22 A;  4BY1 G;  4QGU A;  2VW9 A;  2VY3 A;  4G7Z C;  4AYB B;  4JI3 L;  4I4T F;  2BR0 A;  1X55 A;  3DEO A;  4LFA Q;  2UXB Q;  1GD7 A;  2K5H A;  1HR0 H;  2K33 A;  5D3I B;  1I4Q A;  2OCE A;  4B3M Q;  1EY7 A;  4A3C G;  4F4X A;  4YCU A;  1CKM A;  1TS4 A;  1TWG H;  4QW9 A;  4LFB H;  4L5Q A;  3PO3 G;  4X62 Q;  2ZXP A;  4DV2 H;  1SSO A;  4JI3 Q;  3NSW A;  2IY5 B;  1WCM B;  3JAM E;  1CQJ B;  2KVM A;  5JQW A;  3ND9 A;  3RZD H;  1PFM A;  4LFB L;  2FK1 A;  3KF6 A;  5IGC A;  4AQY H;  3QB3 A;  2FMC A;  3GO5 A;  2XRS D;  2QYZ A;  5ELF A;  2B2Y C;  4ECS A;  3ND8 A;  1OXX K;  1LTL A;  4F4W A;  4O3S A;  1UE7 A;  3I4N B;  5KNB A;  2Z1C A;  5JJI A;  4F7X A;  3PUY A;  5CAE B;  2ICE C;  3T5K A;  3MWY W;  4LF6 H;  4DLK A;  2J7Z A;  3RZD B;  2F0T A;  1ZQ7 A;  4Q0F A;  2IX3 A;  5FLX L;  1E1T A;  4MAM A;  1VKZ A;  4ECU A;  1N9W A;  3H40 A;  3SDZ A;  2HD3 A;  4A3M B;  4HIK A;  4X6A H;  3S2H B;  1IYJ B;  5CV7 A;  5IWA Q;  1SFO H;  3QR8 A;  3A74 A;  4RNN A;  1MD2 D;  4ALP A;  1VQH A;  3TME A;  2YS6 A;  1S0N A;  5EDW A;  1N36 Q;  1JDB B;  4Q8E A;  2EVB A;  4WJ3 M;  4FS2 A;  4JI8 L;  3FVQ A;  5CV6 A;  2PI2 A;  4ZAI A;  3GTP B;  5KFU A;  1ENC A;  2R92 B;  5DQH A;  2YV5 A;  3J7Z C;  3DM3 A;  1YHQ A;  4EX5 A;  2N88 A;  4DL2 A;  2HVR A;  1DOK A;  4WD3 A;  4MNO A;  1I3Q H;  2IPK D;  1KTK A;  3C0F B;  4L63 B;  2R6F A;  4DV0 Q;  4QY7 A;  2Q2T A;  1G6P A;  3VPD A;  3RIZ A;  5DQI A;  3BDC A;  3TQ1 A;  3KAK A;  1EWH A;  4C3J H;  1XMO L;  4R8U B;  1J8I A;  1B9N A;  5JEA G;  2E2I A;  2JA7 A;  5IT9 W;  1DGS A;  4JI7 L;  1WTW A;  5JOB A;  1IL8 A;  1B6S A;  2EYM A;  4JYA L;  4BY1 B;  1HTL D;  4DR3 L;  5BN3 A;  4BBR B;  2GA4 B;  4POG A;  4NXM Q;  1UAP A;  1ESF A;  1WTX A;  3BA8 A;  4ED2 A;  5JPN C;  3W1G A;  5BN4 A;  2F4V L;  2JQO A;  2AWN A;  1B7Y B;  4DV4 Q;  1BNC A;  1TWA H;  2WYO A;  5ELN A;  1N48 A;  1IHZ A;  4C2M H;  3PO3 B;  2HHH Q;  5EPJ A;  3H0G A;  2F0K A;  4HJ7 A;  2A68 C;  3K5N A;  2B2U A;  2CHB D;  1BCP C;  4AYB A;  2AKW B;  3PIO 3;  4HIM A;  1SE8 A;  1PLF A;  4ZKB B;  3T1H L;  3KAJ A;  4OEL B;  4ZYS A;  2UXD L;  4J9R A;  1MGS A;  4J9K A;  3RLF A;  1SN8 A;  1QZG A;  3AEV A;  4MV1 A;  1X3F A;  2L9H A;  1A8V A;  1GSA A;  4F87 A;  1I7N A;  3R2I A;  2K04 A;  4PMB A;  2NN6 G;  5KFF A;  2MP1 A;  4DV6 Q;  3WO1 A;  1TS3 A;  2XWB B;  1SXT A;  4WBN F;  4IOC A;  4LF5 H;  4QWC A;  3Q24 A;  4J9P A;  4JC0 A;  1AUV A;  1OXV A;  2JEA I;  1BO0 A;  5KT3 A;  1STA A;  5K5P A;  3LP8 A;  1A6X A;  4A3F B;  4A3C H;  3D6W A;  3U9T A;  5DG9 A;  2JA7 H;  4JI4 L;  2BQU A;  2NVY B;  2TSS A;  4DV7 L;  4WFN 3;  3BU2 A;  1UEA B;  4OL7 A;  2YS7 A;  2C2R A;  1XNR L;  2KEN A;  5EBC A;  4HJ5 A;  3PUX A;  4GKJ L;  1UE6 A;  4B08 A;  2ZJQ A;  1UE1 A;  2F0M A;  3NWT A;  4WRD A;  3G6X A;  1I94 H;  5I2Y A;  1PH9 A;  4KHZ A;  1ULZ A;  2NWG A;  4JI4 Q;  1LUZ A;  3BVM A;  3B6Y A;  2UXD H;  2ZTC A;  5KFO A;  4C5B A;  1EEF D;  4M8A A;  4UAI A;  3EPI A;  2SCU B;  5C5M A;  4Y52 H;  4DUZ H;  5C4X H;  1BQQ T;  4PV1 C;  2Q8R E;  1RDP D;  1YNJ D;  3U4V A;  1A2U A;  2BCO A;  2O03 A;  2V4Q A;  3QIA A;  3EBE A;  1G2S A;  3P75 A;  4YJ3 F;  2B63 A;  1AFP A;  1QJO A;  1ILP A;  1JWM D;  5KT4 A;  1TKW B;  4HQ6 A;  1Q8I A;  1DCZ A;  2EYH A;  4OWW B;  2ZM6 H;  3BZK A;  1SMX A;  4NLG A;  1S9F A;  3QZ7 A;  2BQR A;  5L1L A;  1GO3 E;  2W6O A;  2NVT B;  3GV6 A;  2BOS A;  3K5L A;  3DF7 A;  4LUZ A;  3NEL A;  3CRK C;  1N33 L;  1A63 A;  4YY3 L;  4MV9 A;  2WKC A;  1O7L A;  1WYD A;  2FB9 A;  5C3X A;  1EOV A;  4ECV A;  1B53 A;  3RR5 A;  1VQB A;  3NTI A;  1GLV A;  3E0J A;  2JA5 H;  1E7Z A;  5JEA H;  3QZ8 A;  1IKM A;  3MC0 B;  1TT2 A;  4FF3 A;  2J4X A;  4EVO A;  4EFE A;  2CWA A;  3RN2 A;  4IUP A;  2VNU D;  4G7O C;  3NTK A;  4LWC A;  2PI2 E;  1HHV A;  1WTO A;  3S16 H;  3HB9 A;  2O2L D;  2F3W A;  1JJ2 A;  1IBM L;  4NP5 A;  4A3E G;  2EPB A;  4MV3 A;  3TII A;  2QIL A;  3Q8R B;  4DR5 Q;  1FJG Q;  3G8C A;  1TWH B;  1S97 A;  2XIG A;  1GOZ A;  4LH7 A;  4JI2 H;  2RCF A;  4M9U A;  1OXU A;  1BOS A;  5KFW A;  2K32 A;  2HDL A;  3A54 A;  5KRU A;  4LF8 H;  4JYA H;  5IGF A;  3NWS A;  4KHP Q;  4U6P A;  4DV4 L;  5LMU Q;  2M00 A;  4X66 L;  1F9R A;  2EYL A;  3J80 E;  3HRZ C;  3OHA A;  4CDC C;  5M3F H;  3Q8P B;  5CB4 F;  2Q8T A;  4IUV A;  3AQQ A;  5JVL A;  4NPS A;  5ELD A;  3STB D;  5CV8 A;  4GNX B;  1MSG A;  1MKH A;  2ENB A;  2MCT A;  1ET9 A;  1CA5 A;  4DK0 A;  1GUW A;  4ED3 A;  1TWH A;  4HJA A;  3S14 B;  1R9T H;  3K0Y A;  3T56 B;  1TWA A;  5KG3 A;  2BH2 A;  2QA4 A;  5LA6 F;  4JBM A;  3JZI A;  4XQJ A;  4OIK A;  3GTJ H;  5KFC A;  1I6H B;  1I3Q B;  2PW5 A;  3I55 A;  1RKN A;  2F0O A;  4UP8 A;  2I80 A;  3BDO A;  1ENA A;  3DWQ A;  4ZUI A;  3CCM A;  4QUF A;  1Z7T A;  3TDQ A;  1XMO H;  1VQF A;  3ULP A;  2N49 A;  1N36 L;  1MBY A;  1STN A;  3GTG B;  4JV5 L;  2W6P A;  4GOP A;  3MHB A;  1HUM A;  1UWV A;  5CBA E;  2UXB L;  4GKJ Q;  4DR2 H;  1QOH A;  1VQ5 A;  1AE2 A;  1SYE A;  4K5V A;  1DIK A;  3I73 A;  3E6Z X;  3QOL A;  1SRU A;  2ASD A;  1CE8 A;  3WOE A;  3IFD A;  5A35 A;  2G5D A;  4GC6 A;  1IBM Q;  2J0T D;  1SAP A;  3MFY A;  4MTE A;  5HGQ A;  5NUC A;  3F8N A;  2JA8 H;  5IYC H;  2NZO A;  4A3L G;  5DQG A;  1B4O A;  1XNQ H;  1S03 G;  1TXY A;  4C1N I;  4FVM A;  3I4M H;  1VF7 A;  3GTJ A;  1HR0 L;  2QEJ C;  3IG0 A;  4KKS A;  1UNN C;  4UPA A;  3GIJ A;  4DR4 H;  5FJ8 H;  2XN9 C;  3W5O A;  1S0M A;  4FU0 A;  4R8U A;  4JI3 H;  5FKA C;  4IUR A;  3N44 B;  3M7N A;  4AQY Q;  2F0Q A;  1PRT C;  4JI1 L;  2DLN A;  5EQ0 A;  5KIX A;  5M3M H;  5KG4 A;  2D9U A;  3V6K A;  4OO1 G;  2MPM A;  4DV5 Q;  2YYZ A;  1X56 A;  1TAE A;  1WTP A;  2J9G A;  4DV3 H;  4BBS B;  4EBE A;  3KDF A;  4QQB X;  4RB1 A;  1GUO A;  4J9N A;  2PPB C;  2B8G A;  3OPO A;  4BY7 H;  4A3B B;  4O42 A;  3CCV A;  1LTG D;  2VZA A;  3D0F A;  3UDI A;  3G6V A;  1HZB A;  5C3E B;  4IR9 A;  3NE5 B;  2UUB H;  1JWU D;  5LMN H;  3BZC A;  2M05 A;  4R4T A;  4BBS H;  1CS0 A;  3A5Z B;  2N8N A;  3KTM A;  1YJ9 A;  1KDC A;  3TP7 A;  4J1M A;  4YWM A;  1D5X C;  4BY7 B;  2UUA Q;  1XMQ H;  1Q12 A;  3MFI A;  2VQE H;  4DL6 A;  3HS0 C;  1OXT A;  3NXW A;  4A93 B;  3GV3 A;  4DR7 Q;  1S40 A;  5C3E H;  3PZP A;  1NCV A;  5M3M G;  2EY2 A;  4C56 C;  5IT9 E;  1PRT F;  2ICI A;  2CWP A;  2PZW A;  3G48 A;  3Q8Q B;  1EY4 A;  2IX0 A;  4HED A;  4IPH A;  4JI5 Q;  3M4O H;  1STY A;  1EZ1 A;  3OUU A;  1I3Q A;  3NTH A;  1N33 Q;  2FK3 A;  2WAQ E;  3TIG A;  4ZHQ F;  4AIM A;  1WSC A;  2Z4I A;  4YR0 A;  2L5T A;  4DXF A;  3U50 C;  2R7Z G;  2Q2U A;  4KN7 C;  2Q8I B;  2F0U A;  2IJ0 A;  2KA7 A;  2XRQ D;  5AFW A;  1H9S B;  5L37 A;  4YBZ B;  4KI0 A;  2WE6 A;  3L3O C;  3R2T A;  3FKI B;  2JA5 B;  4QW8 A;  1D8L A;  4OEM B;  4X3U A;  5T14 A;  1DV1 A;  1JJC B;  4DV1 H;  3Q1K A;  4EG0 A;  1Q46 A;  5KND A;  1KEE A;  1VMC A;  3VYT A;  3F8T A;  1CA6 A;  4DV4 H;  1HNW H;  4K6L A;  5C0X J;  4DAM A;  1NTG A;  3S16 B;  3PSI A;  4R7R A;  5GAE C;  4BWS C;  5KFJ A;  4RKL A;  4HNU A;  3BJU A;  3OW7 A;  2Z9H A;  4FBT A;  1X3E A;  2PN1 A;  1FKA H;  3MXN B;  2JA8 B;  3KBX A;  2JP1 A;  1EFW A;  4DAY B;  5H1S E;  1Y69 U;  1ICW A;  3J7Y W;  2K14 A;  3M7G A;  2VS1 A;  5HUR A;  1VQ4 A;  4O0A A;  1YNX A;  4PG3 A;  4P71 A;  2I87 A;  4YHH L;  1PH3 A;  2W9C A;  1BCP B;  3H91 A;  1HFN A;  3CW2 C;  1II3 A;  3SK8 A;  2PMZ B;  4GNX A;  2B63 H;  4LH6 A;  5JEA J;  4C3I G;  1U4M A;  1AW7 A;  3QJY A;  5EPK A;  1VQG A;  2A74 C;  4R4I A;  4CJ1 B;  5BMV F;  1I4R A;  1XNR Q;  4BS9 A;  1BBU A;  1ZYR C;  2FPG B;  4HJ8 A;  4PDB A;  2C22 A;  1OWT A;  3BA9 A;  2LS0 1;  1PVO A;  2HUG A;  4ABN A;  3I12 A;  3L4K A;  3AYH B;  4MN3 A;  1RIP A;  4HR7 B;  3S1R B;  4RA8 A;  5CA0 F;  1TWF H;  1QVC A;  1D6E C;  2H1E A;  3WNZ A;  3MAQ A;  4OHJ A;  3CCQ A;  3HOY G;  1EQR A;  2F0D A;  4JK1 C;  2V9W A;  5KFL A;  4KN4 C;  3C46 A;  3NBH B;  2DNE A;  1IBK L;  2NVQ H;  2R7L A;  5DM7 3;  1Q3L A;  1ZHS A;  5KT2 A;  1XWE A;  1WR2 A;  4EQP A;  4FO2 A;  3D4D A;  2ZDQ A;  3OIP A;  4C5C A;  3BVG A;  2E5L Q;  4ZRZ A;  2QCP X;  4X62 L;  1VQ8 A;  1QVG A;  2W6M A;  3M9O B;  2HCI A;  5FLM H;  1E1O A;  2V58 A;  3GTQ A;  1KRT A;  4TUY F;  5EJW A;  4POF A;  1YI2 A;  2AQ3 B;  1JOQ A;  4K8J A;  1RHP A;  2JK8 A;  2EJM A;  3A7A B;  4O3O A;  2OT2 A;  1HA5 A;  3AB9 A;  4A3I B;  1TWH H;  1IW7 D;  1JE5 A;  5EKL A;  3AU7 A;  3EN2 A;  2KHI A;  1SBB B;  4JI0 L;  1BGW A;  3J81 i;  2VQD A;  3MA2 B;  4MHE A;  1Y1W G;  4DGZ A;  1B04 A;  4IAJ A;  4MV7 A;  1J5E Q;  2C5C A;  3I4N H;  2R8I A;  1I94 L;  4JI0 Q;  5HBR B;  2RGR A;  1IYU A;  1A9X A;  3V96 A;  1PH1 A;  4FYD A;  5KT7 A;  2L12 A;  1Y8P B;  3L0O A;  1FGU A;  3J80 c;  2C00 A;  4CKE A;  3K5I A;  3GIK A;  4J0M A;  1O7Y A;  2R92 G;  3H0G G;  4LMQ D;  3BAA A;  5JPM C;  1FNW A;  3FMC A;  2H5X A;  3OYY A;  4C3I B;  4FF1 A;  1KDB A;  5C8Y F;  5KX5 F;  3A8J E;  3S14 H;  2JXM B;  3FDS A;  1M6V A;  4CDF C;  4J9S A;  1STH A;  3GTM A;  4XX0 B;  4N9T A;  2B8F A;  2LXJ A;  1Q1E A;  1D5Z C;  5IOC A;  5F9N A;  1LTS D;  4IO9 A;  3BJY A;  3N41 B;  4JI2 Q;  2JA8 G;  1VBG A;  2VQF L;  2B2W C;  1PHJ A;  3M3Y H;  5KG7 A;  1RF2 D;  3PF5 A;  1G91 A;  2F0N A;  3S24 A;  3NBI A;  1YIT A;  4LFA H;  2ZTE A;  5ELE A;  2UXB H;  5IP7 H;  1Z2P X;  1ENF A;  4XQN A;  2F03 A;  3PO3 H;  4ECZ A;  1HH2 P;  1UC8 A;  3A55 A;  3H3V C;  1QZH A;  1UNS A;  4QJF A;  2CW7 A;  4RUC A;  5CC4 A;  3C2P A;  5J1Z A;  4LF6 L;  1GXD C;  3NEM A;  4RCO A;  1C8C A;  2WB1 B;  1B70 B;  1HZC A;  1L0X B;  4RGN A;  2KSW A;  5KKN B;  4LJZ C;  2UVU A;  4CJ0 B;  1JB3 A;  5LOV F;  2BE5 C;  2BE5 D;  4A3M H;  3V4S A;  4U7C A;  1BUV T;  2TMP A;  5L1I A;  2UVW A;  2O5J C;  1NBW A;  1ASZ A;  4YHH Q;  1NR2 A;  2A19 A;  1S5C D;  2NVQ B;  4X65 H;  4AYB E;  5GQO A;  4R8N A;  2UU9 H;  3F2C A;  2K5Q A;  5CR3 A;  1VQ7 A;  4GLA C;  3PR4 A;  2E2H H;  1DXM A;  4DV2 L;  4C1N K;  5KG0 A;  1AEX A;  2ES2 A;  2ZM6 Q;  3I4M B;  3FMA A;  4PWQ A;  1ZYR D;  3G4S A;  1WH2 A;  1GHJ A;  1CKN A;  1IZ6 A;  5IGE A;  4P73 A;  3VYR A;  4GKK H;  5JVH 3;  2VUM H;  2K75 A;  3FKI H;  2PNR C;  1KLG D;  1YZ6 A;  2YTX A;  4XIG S;  4EFB A;  3UDX A;  4LSA A;  2L1B A;  1XYI A;  2FHT A;  5IWA H;  1Q82 C;  3HOV G;  1PYW D;  2J6T A;  1BJT A;  2EJF C;  3RF2 A;  4TQR A;  2LFN A;  2F0J A;  4BBR H;  1RYR A;  1NSN S;  2HIV A;  3DHQ A;  1GGO A;  5AJ3 L;  4Y7N B;  1SEI A;  3OMG A;  4KY6 A;  2EY6 A;  1IBM H;  3DM1 A;  2WV6 D;  5D65 A;  4YY3 Q;  1TR5 A;  1Q7Y C;  3OHX C;  4ECW A;  1NMF A;  2FLP A;  3MXG A;  1YHB A;  4DV0 H;  1FJG H;  3VYU A;  2VOB A;  3CME A;  3PW7 A;  1NJI C;  2LSS A;  3FPU B;  4A3F G;  1T3N A;  2I46 A;  2MQH A;  1BNZ A;  2P0A A;  2EXZ A;  4A4I A;  3N8D A;  1WJJ A;  2OF1 A;  3IRB A;  4NW2 A;  5DM6 3;  3GTQ H;  4OO1 I;  3H4D A;  5JVG 3;  2JE6 I;  5KYL A;  3PW0 A;  4DXG A;  4RZQ A;  2ASL A;  1G29 1;  2PW7 A;  4LFB Q;  1K0R A;  5COY A;  4N9P A;  5D14 A;  5EPL A;  4I65 A;  3MEF A;  1RJT A;  4ZOL F;  3CCE A;  4ED7 A;  4GLX A;  2FXQ A;  3MFH A;  3CQZ H;  3M4P A;  4YP3 A;  1DOM A;  2XGQ A;  2VA2 A;  3V05 A;  4PZ8 A;  1HNZ Q;  5HGT A;  4O4I F;  1W93 A;  2JA6 H;  1I50 A;  1KJQ A;  5CMD A;  4G4K A;  1LTR D;  3CC4 A;  4RH6 A;  4GNX C;  4A3D B;  4B3S L;  2D2C C;  1TY0 A;  3NPP A;  3K5H A;  2E5L L;  3ORQ A;  3K7A B;  3GQC A;  1JCK B;  2VR1 A;  1VQC A;  2AUJ D;  2L55 A;  4ZCK A;  4O4H F;  2D62 A;  3HOW B;  3W1B A;  2EYJ A;  5FD5 A;  1ASY A;  2IA6 A;  2PMZ A;  2JA6 A;  2WDT A;  3KFU A;  3QG1 A;  3CRL C;  1XMO Q;  3S15 H;  4RWS C;  3D4R A;  5LMN W;  2JN4 A;  1TWF A;  1AH9 A;  2MUY A;  3K8A A;  5FO8 B;  1EY9 A;  5L1K A;  1N8R C;  2IT1 A;  4LK1 C;  2UUA L;  3GIL A;  1J6Q A;  2AQ1 B;  1Y1V G;  5KG1 A;  2W8K A;  2A6E D;  1STB A;  5KFR A;  4X64 Q;  3GV8 B;  1ROD A;  5G3L D;  1B44 D;  2ASB A;  2R92 A;  4DV7 H;  3PO2 H;  1K28 A;  2GVB A;  3JRX A;  4JI4 H;  3EYY A;  2E75 C;  5FD6 A;  2RA4 A;  3GTK A;  4LNQ A;  4UCO A;  4HN7 A;  2WAC A;  3CC2 A;  4H7B A;  3Q0A A;  1K1Q A;  4MV4 A;  4GOP C;  4RB2 C;  2R8G A;  2NVT H;  1T9H A;  1Y1W B;  2HGS A;  1EYC A;  1WVL A;  5JJL A;  3BYY B;  2E2I B;  3WO0 A;  2V59 A;  3VR2 A;  4DV5 L;  2CZG A;  1LAC A;  5LMN L;  4BY1 H;  2UXC L;  3PIP 3;  1L2Z A;  2ID0 A;  3H94 A;  2XC9 A;  4DUZ L;  5G3L F;  2SOB A;  2N3S A;  2KHJ A;  3HOV H;  2OTJ A;  1RK6 A;  4IWY A;  4TRD A;  3T1H H;  1L1O C;  4PZ7 A;  2NU8 B;  2K5W A;  1TWG A;  2W9B B;  2ALZ A;  4DR1 Q;  2RDI A;  1R4P B;  5KFY A;  3RJ0 A;  1HZA A;  3NUC A;  2V1C C;  3EFX D;  3RB0 A;  4A3J B;  5C4X G;  1VBH A;  3U9O A;  2B3G A;  2HHH H;  1Q81 C;  4YR2 A;  1CUK A;  5F9L A;  2UXC H;  3HKZ A;  3PCO B;  2AQ4 A;  2DPJ A;  2RDJ A;  1F9P A;  3GTL H;  4OON A;  4OX9 Q;  4NDX A;  2R7Z B;  2VPS A;  2Y0S A;  3CKI B;  2A1A A;  1ZET A;  1PFB A;  4A3G H;  1X6O A;  3K59 A;  5A2Q L;  3DLL A;  3DWA A;  4V19 0;  2XSC A;  5IYD G;  5COR A;  3WWV A;  4L5T A;  2B29 A;  4X66 Q;  4A3J H;  4B3M L;  5BPF A;  4XZ3 B;  1CT1 D;  1EEI D;  1XXG A;  3Q6S A;  2GLT A;  1XMQ L;  4OXP A;  1FYC A;  4A3M G;  5JH7 F;  4EGQ A;  1EZ6 A;  3ULL A;  2W9B A;  3V6J A;  3CF5 A;  3T1Y Q;  2VQE Q;  2DZD A;  4UY8 C;  5CBE E;  4GKK L;  2EQS A;  2ZJT A;  2YW2 A;  4IFD J;  4XTC S;  2UUB L;  3L2P A;  3I72 A;  1CM9 A;  1X9N A;  1GYF A;  4DR5 H;  4ZUJ A;  2QK4 A;  2FE3 A;  3H3V I;  3E9I A;  4JI5 H;  2K5N A;  1UC9 A;  2JEB I;  2KJX A;  3PO2 B;  2CKZ B;  4UCU A;  1PFN A;  2IHF A;  1J5E L;  2JA6 G;  1EY5 A;  1WFQ A;  1IBL Q;  3J80 W;  4MV8 A;  3Q2O A;  4B3R Q;  4YQW A;  1XTC D;  1I4G A;  3I7F A;  4LF7 H;  1HZ9 A;  1I4X A;  4F8M A;  1JOO A;  1NY4 A;  2JYO A;  2L4N A;  2K01 A;  4EEQ A;  2XWJ B;  5K36 G;  3KJP A;  5CGK A;  5KFN A;  3KK7 A;  3LWE A;  4DNI A;  2K05 A;  2Z6K A;  4L5R C;  1FNU A;  3R93 A;  2QEX A;  4K0K L;  4HCS A;  2ZJP A;  2NUA B;  4JI1 Q;  2R87 A;  4ECT A;  4ETS A;  5L1J A;  1Y8N B;  4KHP L;  1B6R A;  1CZW A;  4BY7 G;  2JA5 A;  2ATL A;  2DJF C;  3KLS A;  5BPH A;  2A6H C;  2RDF A;  5KFI A;  3UI2 A;  3OIQ A;  2R6G A;  4OO1 H;  3KLS X;  1DYQ A;  1H9J A;  3N6X A;  2A8V A;  3CCJ A;  1IBK Q;  3DMU A;  1S5E D;  1B2T A;  1FNV A;  4UHV A;  4DV0 L;  3GTK H;  1CQF A;  1N34 L;  1VQI A;  1O78 A;  1X65 A;  4JBW A;  3HOV B;  3M9M B;  5KYI A;  4ME6 A;  4EYI B;  1EFI D;  2VQF Q;  3VA7 A;  4C5A A;  4KHV A;  2D0P A;  3ZYY X;  3MEH A;  2YU9 B;  2KUM A;  3CC7 A;  3BVZ A;  3PF4 A;  4OWX B;  2P5Z X;  4CKC A;  3L7Z C;  2DJG C;  3EIV A;  3NGD A;  4RU9 A;  5IYC G;  1E4G T;  2PBZ A;  5I4D A;  2K5V A;  1JMC A;  3TRZ A;  4DK3 C;  5EKI A;  3T51 B;  4PMW A;  3GTL B;  3RBE A;  1PX2 A;  2A5H A;  2AWO A;  3TP6 A;  4QB4 A;  5KFZ A;  3E5S A;  1ZXT A;  5FLX c;  1XNQ Q;  5CYU A;  1H9K A;  4DR6 Q;  3NP8 A;  3CD6 A;  4E6I A;  1UE5 A;  1SMY D;  1RK5 A;  4A93 G;  2K5D A;  4O2D A;  4HYK A;  2CFM A;  1PZK D;  1PRT B;  2W7P A;  5IP9 H;  4A3K B;  5HY6 A;  3S15 B;  2JA9 A;  3NBH A;  2WKD A;  4R1J A;  3F1Z A;  1Q90 A;  3SVM A;  2EYF A;  3DUZ A;  3TQT A;  1K0S A;  2YU9 A;  4IFD I;  3TSS A;  3SE7 A;  4DAV A;  4X3T A;  2KHS A;  3ETJ A;  2Z4H A;  1HUN A;  1MZB A;  5LL6 b;  1H95 A;  1PH4 A;  4QIW B;  2XTI A;  4RAU C;  5F2D A;  4JVZ A;  2IWH A;  4LUV A;  4RNO A;  3KHH A;  4GLV B;  3HP3 A;  4XQQ A;  4DR6 L;  1G6Z A;  3PUZ A;  3OTO L;  4XYQ A;  3H09 A;  2CQO A;  5M5Y B;  4GKK Q;  1ILQ A;  4DAP A;  5KFD A;  1E0B A;  1WD0 A;  4QIW A;  1JKJ B;  2PO4 A;  4YAJ B;  1HNX Q;  1YBY A;  2E2D C;  2W6N A;  1GUN A;  1NUC A;  3JSN A;  4MTD A;  1FGB D;  2IX1 A;  2AGO A;  3RD4 A;  2BDO A;  2ZJR A;  2F1M A;  3LML A;  4YIJ A;  2NZ1 D;  2I5M X;  1QE6 A;  1B9M A;  2NBF A;  1HPC A;  1TU2 B;  3TRE A;  3UQ8 A;  3PQI A;  1WTQ A;  1HQM C;  1M7J A;  3G6Y A;  4DR2 Q;  1SYX B;  4GKJ H;  1GSH A;  3SK6 A;  4V0B A;  1N32 Q;  2ZDG A;  3S1N H;  2WB1 E;  4YY3 H;  1TVX A;  3S2D H;  1JB7 A;  1JIH A;  3KHG A;  5A2Q E;  2PNH A;  4BBS G;  1N33 H;  1YIJ A;  3NHH A;  3VA5 A;  4RGT A;  5L9X A;  3E5N A;  5KFP A;  4A3I G;  2XCL A;  2RHQ B;  3NEN A;  2KBN A;  3LNN A;  1SDF A;  1Z47 A;  3F2U A;  5K36 H;  2O5I C;  5M3F B;  2ZM6 L;  2A6H D;  2VXW A;  3SEB A;  1E4E B;  4JCV E;  3S2H H;  4YAK B;  3KHR A;  1JR0 D;  4ZI7 F;  2NU7 B;  4YR3 A;  1U0L A;  1PFS A;  4A3F H;  3LX0 A;  3K80 C;  3N43 B;  4OGQ C;  1GM5 A;  4RNM A;  1M90 C;  4A3L H;  3RN5 A;  1R9T B;  2FJZ A;  3VDY A;  1GSO A;  1Z2O X;  4LF9 L;  1KRS A;  2I8C A;  3GIM A;  2DY8 A;  2R93 H;  3OSN A;  1RL2 A;  3IL8 A;  4XDX A;  1F2Z A;  4GN3 B;  5ELO A;  5I2X A;  3SK4 A;  4YHH H;  4LF4 L;  3VR4 A;  5GON F;  4ED8 A;  4DU9 A;  1CQI B;  1PV4 A;  5FLM G;  3N40 P;  1KHI A;  3TS2 A;  1LM0 A;  4DV5 H;  4DV3 Q;  2RF4 A;  4A76 A;  4ECX A;  2ALY B;  2Z6B A;  1B1Z A;  4A2B A;  4A3K H;  3I4N G;  1XNR H;  4LW1 A;  3GID A;  3TIN A;  1SYC A;  4LFC Q;  1SLJ A;  3FKI G;  4P75 A;  4Q43 A;  4P2C B;  2UUB Q;  4IN3 A;  5LMU L;  1EQV A;  3HOZ H;  5EWE A;  4ZLT F;  1K83 A;  3GTM B;  1FVI A;  1DON A;  1EYA A;  1WTV A;  3RB4 A;  1RJQ A;  5IP9 G;  3RUZ A;  1X32 A;  1MHW C;  3RGX A;  2B63 G;  3IN5 A;  3GD7 A;  4LUO A;  1BR9 A;  3TBI B;  1VDZ A;  3K3V A;  3PV0 A;  1P16 A;  4L1K A;  3I4L A;  1KQS A;  3RV3 A;  1HNZ L;  4FF4 A;  2M9V A;  2KEE A;  4QWA A;  2RCN A;  4F88 A;  2GN5 A;  5LHY 1;  3M3Y B;  4EQO A;  1DV2 A;  2BQ3 A;  1EU4 A;  3SXH A;  5JJK A;  2UVR A;  2UVV A;  2F0F A;  4WOR A;  5KNC A;  4A3K G;  4J15 A;  1QCB D;  1CKO A;  4R4C A;  4B3S H;  3D6C A;  5KG5 A;  5M5W H;  4YWL A;  3MWE A;  3SE0 A;  3KBG A;  4H02 A;  1ZHQ A;  2XCA A;  4J9L A;  3R8B A;  3RFC A;  5EAY A;  4QWB A;  3R5X A;  3G71 A;  3Q8D A;  3I3C A;  4UP9 A;  4FXK C;  1W6K A;  3NQT A;  3RTX A;  2KCT A;  1RCV D;  4QMG A;  5CV4 A;  1SYF A;  4QWD A;  2MJ8 A;  1EUJ A;  3MTS A;  4IPC A;  5I6W A;  5J3B A;  3GTO B;  3N42 B;  4TQS A;  4IWX A;  1VQO A;  1CQV A;  5A2Q W;  2WAQ A;  1Z2N X;  4NXM L;  1QG7 A;  1VF5 C;  3SHL A;  3OUZ A;  4ODG A;  5IIF A;  4IR1 A;  1SYB A;  1X3Q A;  4FXD A;  4HIO A;  3HOX H;  3J80 i;  3EPG A;  3GP7 A;  5J2T F;  5IOD A;  4F4Y A;  4CJ2 C;  3HKZ B;  2R85 A;  1RTO A;  1CSQ A;  4C2M A;  5FO7 B;  2W9A A;  1CZG A;  2Y0S B;  2R7Z A;  1QUQ B;  5C1P A;  4K2K A;  4O3N A;  3D4W A;  5C0X I;  1A3V A;  1KAA A;  1NE3 A;  3LWU A;  2HQL A;  1N32 L;  2FPP B;  1T36 A;  1EQT A;  4RG1 A;  5FPR A;  2R93 B;  1JXL A;  3HOX B;  2K7V A;  3HKZ E;  4O2B F;  2I5L X;  3CP0 A;  1M4V A;  1EYD A;  5I47 A;  3MWM A;  5T1G A;  1XNQ L;  4KV6 A;  3R5F A;  2R8H A;  4TSS A;  3UFX B;  3E9H A;  1Y14 B;  3I4O A;  3VR6 A;  1F9S A;  2VQE L;  5IP7 G;  4RHS A;  1VQJ A;  3VYS A;  1EYG A;  2MHV A;  4IUT A;  4DL4 A;  1X3G A;  3GTK B;  2WII B;  2XVS A;  1PMR A;  4X64 H;  1WD1 A;  1SCU B;  1WCM H;  2EXD A;  3CPF A;  3M9B A;  1KD1 C;  1VQL A;  2E2H B;  3PVX A;  3EA6 A;  1LLR D;  3L4J A;  5DAU A;  1H9M A;  3K5M A;  4UCV A;  4B3R H;  1OXS C;  1ZKO A;  5C4H A;  2EOT A;  2ZXR A;  1HFG A;  1VQ9 A;  5C5J A;  4B3T H;  2WTF A;  4KKU A;  4X3S A;  5M5W B;  4KJN A;  1SE2 A;  4AH6 A;  2UU9 L;  4KJO A;  4JI7 Q;  4DV3 L;  4JW0 A;  4B3R L;  3KLW A;  1JWS D;  4DUY H;  1DJR D;  1BXT A;  5IYZ F;  4JI1 H;  1S4Z A;  1L2F A;  1SR3 A;  1AZP A;  1Y1W A;  3TN2 A;  3ETH A;  2R8J A;  1QNU A;  4K0K H;  1I7L A;  2PQA A;  2R7K A;  4HSV A;  4A3G G;  1P8L A;  3O13 A;  3MFG A;  3S1M B;  3T1H Q;  1E4E A;  4CDE C;  3KYH C;  1EQQ A;  1A3U A;  2A68 D;  5C4J B;  4EGJ A;  3GV7 B;  2L0C A;  2CW0 C;  2JA7 B;  4DA2 A;  2HHH L;  2J6U A;  4KY7 A;  4O1N A;  4P72 A;  2AQ2 B;  2JA7 G;  2B2W A;  2BH8 A;  4Q45 A;  1PH7 A;  4JI6 L;  4EQN A;  1EOT A;  1A15 A;  1HTP A;  2VA3 A;  1BCP F;  3MJF A;  1M0T A;  1SJE D;  1PH6 A;  1B3Q A;  1I4H A;  5IWA L;  2B63 B;  1TWF B;  2VB2 X;  4B3T L;  4C3I H;  4R9W A;  4KK7 A;  5AJ3 Q;  5IYB G;  5ELB A;  5IT9 c;  3OW2 A;  3T5L A;  1VQP A;  2C2E A;  4DR5 L;  4IUN A;  4X66 H;  2E2I H;  3VPB A;  2IHE A;  3TZU A;  4LF8 L;  1I4P A;  1TQO A;  1W3S A;  5GAD C;  2MGS A;  4LMY A;  2FJ2 A;  4MTK A;  1BCP D;  4UCR A;  4EYH B;  3T1Y H;  1SYD A;  4A3E B;  1MJE A;  2AUK A;  1M0W A;  2V4D A;  2B2T C;  1YEZ A;  2F0S A;  5EWG A;  5D8D A;  2NN6 H;  5C0X H;  2OEO A;  1NNX A;  5DG8 A;  1GJX A;  1V1P A;  2B2V A;  2OQ0 A;  2KOL A;  4DL5 A;  4EQ5 A;  4FNF A;  2BDN A;  1PZJ D;  2FPI B;  4IHJ F;  2X6L A;  3ERS X;  3K7A H;  1C7Y A;  2GPW A;  1D7Q A;  1E24 A;  3KAL A;  1KBL A;  2PYK A;  3J7A 5;  4A93 H;  5DLF A;  1IBL H;  1U4R A;  3CCU A;  1Q86 C;  4BA1 I;  3MR5 A;  3OHB A;  4O3P A;  5H80 A;  3RUP A;  4UCT A;  3TZD A;  1S5B D;  2R7Z H;  5J2U F;  1SNQ A;  1LT6 D;  3F2B A;  2R93 G;  4XYO A;  1NAP A;  1D1I A;  1N56 A;  1XDN A;  2BA0 A;  1LV9 A;  1JX4 A;  2F0V A;  2LMC B;  3HFZ B;  3BG5 A;  3KF8 A;  1PRT D;  2R7F A;  4UDU C;  1EL0 A;  1I6V C;  5C3E G;  1HNZ H;  5FLX E;  4A2A A;  4X65 Q;  3GTG A;  4QF4 A;  1LTA D;  2K50 A;  4FBU A;  1CKN B;  4NKL A;  5IGD A;  1XJV A;  2K28 A;  3IAY A;  1VCI A;  2YZG A;  4A3G B;  2C9O A;  1HNX H;  4LF9 Q;  1WCM A;  1K83 H;  3M4Y A;  1UUP A;  5KFH A;  1QWY A;  4RAZ A;  5JVD F;  1IBK H;  2PQA B;  3GV5 B;  3JAM c;  4ULL A;  4U67 3;  3RAX A;  3LGJ A;  1SEB D;  4UFZ A;  3RB3 A;  1S5F D;  1CK1 A;  4KD4 A;  5EZY F;  3MXP A;  2NN6 I;  4Y7N H;  1B33 N;  3PIP A;  2VUM B;  1STG A;  1MJC A;  3KF6 B;  4KKT A;  2R86 A;  2RGV A;  4ZKC B;  1FJG L;  5I6Y A;  1L1O A;  3M85 A;  1Y1W H;  3F2D A;  4K14 A;  4ZQI A;  3I2Z A;  3CMA A;  2UUC Q;  1GHK A;  3MWD A;  2XIW A;  3LWB A;  1KAB A;  5D3D A;  3RLN A;  2AHO B;  4A75 A;  4G3I A;  1E2W A;  2FP4 B;  4EBC A;  4IPG A;  4TKO B;  2ATW A;  4WJ4 A;  4JUZ A;  2F4V H;  4H13 C;  5I9P A;  1TWC A;  4DR6 H;  1L1O B;  1B8A A;  2F3I A;  4LF4 Q;  2NU9 B;  1BBX C;  1UEB A;  3HBL A;  3PUV A;  1SNC A;  3PR5 B;  4YWK A;  2DWC A;  4X62 H;  1KNE A;  2SDF A;  1QIL A;  3KJO A;  2WB1 G;  4LF5 L;  4OIJ A;  1CI3 M;  4DR1 H;  4KTA A;  1TWC H;  1OO9 B;  4IRK A;  3OOC A;  3K58 A;  2QDL A;  2R8K A;  4RB3 C;  3GLK A;  4JBJ A;  2AU0 A;  1PTO C;  3JAM i;  1ICF B;  3S9W A;  2JA6 B;  1YNN D;  4DR3 Q;  3STB C;  1PZI D;  4I50 F;  2FMM A;  1PH5 A;  1BF4 A;  3ERO A;  3P20 A;  1EWI A;  3NK9 A;  3P1H A;  2CQY A;  4IJH A;  4G57 A;  4OX9 H;  3TP5 A;  2F0E A;  1U9R A;  2KQ3 A;  4J9O A;  3HOZ G;  2EY1 A;  2Y0S G;  5EBD A;  3DEP A;  3TEH B;  4GS3 A;  4UCS A;  2OXP A;  4GN5 A;  1K73 C;  1O75 A;  2DN8 A;  3R3O A;  5C1O A;  3KDF B;  3I90 A;  4M7E A;  4I7H A;  4HAE A;  3U4Z A;  1LT3 D;  1KNA A;  1FR3 A;  1SNO A;  3FRP B;  2QDB A;  4ECQ A;  5KFQ A;  3A8K E;  4DV6 L;  4C3J G;  4JPB W;  1CSP A;  2EIF A;  1F77 A;  3T13 A;  3I4M G;  4MA5 A;  3HOU G;  2ASJ A;  4RFB A;  1B3A A;  1DM0 B;  1SFO B;  1K3B C;  1XPO A;  3PGZ A;  3S1Q H;  1DZ1 A;  4RCN A;  2RSN A;  1F2Y A;  4IRD A;  4KMU C;  5KG6 A;  5BR8 H;  4GOP B;  4XT1 B;  3CXC A;  1O80 A;  4APV A;  4DV7 Q;  2W57 A;  5T1I A;  3R23 A;  4APM A;  2E76 C;  3VR5 A;  5JUM A;  4AQY L;  3OTO Q;  4E4T A;  4NB3 A;  2A69 D;  4DV1 L;  1JIC A;  2LY7 A;  2I07 B;  2VPQ A;  2HQE A;  4ID6 A;  4IPD A;  2CQA A;  3IKJ A;  2R7M A;  4FF2 A;  2W6Q A;  3PN1 A;  3X3N A;  1F2L A;  3A8I E;  4GC7 A;  2HVS A;  2ZTD A;  3ITP A;  3C1E A;  1HR0 Q;  4I7Z C;  4JOI A;  5EOY A;  2JA5 G;  2MO1 A;  4RAY A;  1KLU D;  4TQU S;  4X65 L;  4CKB A;  1HRJ A;  5E4W C;  2NVY A;  2FIN B;  2OWO A;  3H0G H;  1XTD A;  4DL7 A;  2NTS A;  4O3Q A;  5LP6 F;  2I5H A;  2CH4 W;  3PW4 A;  1DOL A;  2BA1 A;  3GTO A;  4K5W A;  2JSO A;  3AMU A;  2X69 A;  2NZH A;  4PZ6 A;  4FDB A;  3UDG A;  4ED1 A;  2UUC L;  2CVR A;  2MNA A;  5DLG A;  4P74 A;  3FP9 A;  3S17 H;  3OMC A;  3HGB A;  1RJP A;  4NXN Q;  3S2D B;  2HDM A;  3NQI A;  2UXC Q;  5DNF A;  3ICE A;  3KXY T;  4N8X 1;  2JJQ A;  1SE3 A;  4TV9 F;  1DD2 A;  3G6J B;  3V6H A;  4JI5 L;  1OTC A;  4LF5 Q;  3MXN A;  5EKK A;  2VQF H;  2ZXO A;  4LFC H;  5FO9 B;  1O7I A;  3EVQ A;  4A3I H;  2D5D A;  4JI8 H;  3I8Z A;  1TY2 A;  5KFG A;  4AYB G;  2KED A;  4H0L C;  3Q22 A;  1KC7 A;  3PUW A;  4Q44 A;  4RGM A;  5FJ8 G;  2KCC A;  4DF7 A;  2RBM A;  2RDH A;  3A56 A;  5LXT F;  1J9O A;  2NVY H;  1N36 H;  3H20 A;  1Z9F A;  4QUC A;  2FKL A;  5M3M B;  1KIX A;  4MA0 A;  2VUM A;  1WCM G;  3ER0 A;  4WJW A;  3BZD B;  2UXD Q;  4RB0 A;  4KD3 A;  1XPU A;  5D1O A;  3EJI A;  1D1K A;  2CW8 A;  4OWT B;  2XD4 A;  4TV8 F;  5K2M A;  1AE3 A;  3HKZ G;  1I6U A;  4HTH A;  2SEB D;  5GRO A;  3VMM A;  4L6T B;  2PZU A;  4XT3 B;  3G7L A;  1K9M C;  1N34 H;  1O7Z A;  3CHB D;  2A6E C;  3IFT A;  2J6S A;  5DG7 A;  1VAJ A;  3P7J A;  4DUY Q;  3TS0 A;  2FMA A;  3GIP A;  3RMH A;  3GDE A;  4LF7 Q;  2D0O A;  2DY7 A;  3K57 A;  4OX9 L;  2NVX A;  2XNA C;  2CH4 A;  5C6A A;  2E74 C;  3M9N B;  3D31 A;  4NXM H;  1JQY D;  4DKA C;  3HOU H;  1U4P A;  3SK5 A;  1JC7 A;  1SYG A;  2YZN A;  4C3H H;  1JOR A;  2QF7 A;  2EY5 A;  1TS2 A;  2C2D A;  2EJG C;  4J8Q A;  3J81 j;  1BKB A;  1EY0 A;  4DR1 L;  4CDD C;  2B2T A;  3T5H A;  3C1F A;  1IYV A;  1PH8 A;  3EQL C;  1KJ8 A;  3GII A;  1VQA A;  4JI2 L;  3C3L A;  2SNS A;  2WAQ G;  4C3J B;  3ULJ A;  1E4F T;  2NYZ D;  1BXR A;  3ORR A;  1WTR A;  2MFI A;  2WAQ B;  4CGY B;  3GTM H;  1W6J A;  4JV5 H;  3H3V H;  4DV6 H;  2V5A A;  3OSO A;  3S1N B;  5ELC A;  1EY8 A;  2F0G A;  2IMW P;  4RGO S;  1HA6 A;  5KFM A;  3VPC A;  4IRC A;  1N32 H;  3CQZ B;  4R8I A;  4IOA A;  4DL3 A;  2C35 B;  1IL2 A;  4DNT B;  1KL9 A;  1C48 A;  3V4Z A;  4L8J A;  4C2M B;  3JAM W;  4IZO A;  2GVA A;  2F3V A;  3GQB A;  1CTM A;  4Z9C B;  1SJH D;  5KFE A;  1YHA A;  1C0A A;  3BQ1 A;  1L0W A;  1KDA A;  5LL6 X;  2X6G A;  3HXL A;  3GIQ A;  1I94 Q;  1PK8 A;  1K8G A;  3UDF A;  3KUP A;  2JEG A;  2YL2 A;  3KLR A;  4B3M H;  3ONA B;  2W9C B;  1EU3 A;  2QKI C;  4MV6 A;  1PDQ A;  2QGQ A;  1VQE A;  2F0I A;  5KT5 A;  3U9S A;  4A3B G;  3UE0 A;  1VS0 A;  3HOZ B;  4DV2 Q;  1S68 A;  4BWG B;  3PMF A;  2M2L A;  1IOW A;  3RZO H;  3KHL A;  4IUU A;  3JC6 6;  4TVA B;  3J7A F;  2YYA A;  1EIF A;  1HJP A;  3SI8 A;  1JOK A;  1RD9 D;  2R92 H;  5DGB A;  2B2V C;  5EWF A;  3RNU A;  3T5J A;  1E2Z A;  3A7L A;  3PO2 G;  4A3D G;  3VR3 A;  3T4A C;  3HOX G;  4HNT A;  1XX8 A;  2JEI A;  3MVV A;  1PYS B;  2CCZ A;  1PTO D;  3V2T A;  1WOC A;  3MXU A;  2RQX A;  3HZX A;  3DXJ C;  2IW3 A;  4A3B H;  3FKI A;  3GTL A;  1M8A A;  4XXE A;  3HOU B;  2QW7 A;  4PQX A;  4LF6 Q;  1Y1V A;  4QCL A;  5KFK A;  3H15 A;  5HV6 A;  5KFB A;  1JDE A;  1KJJ A;  2R84 A;  3RBD A;  1C30 A;  1HCZ A;  4O2A F;  1YJW A;  2PVP A;  5CV9 A;  2DUD A;  2PZT A;  3SGI A;  3DWP A;  2FK2 A;  3BS1 A;  1GUS A;  2NVX B;  3N52 A;  5ISR A;  1TWA B;  3N6R A;  1BVS A;  4HJ9 A;  4MTN A;  3GTG H;  4PMC A;  4L5S A;  4IUQ A;  1V1O A;  1JJG A;  4O3R A;  2RSO A;  1HXY D;  3CU7 A;  5C44 B;  4ECY A;  1V4Y A;  2NUC A;  2RKS A;  2I0Q A;  1WI5 A;  3ZJY C;  3CVZ A;  2AGP A;  4YCW A;  1LTI D;  4ED0 A;  1EIG A;  2CW0 D;  4B3S Q;  3MZ5 A;  4ME3 A;  3K3P A;  2W70 A;  3QFF A;  2F4V Q;  4R4O A;  1VQN A;  4JI6 Q;  3RB6 A;  2KCN A;  3MR2 A;  1YNJ C;  4DR7 L;  5IGG A;  3J80 L;  5KFX A;  4LF4 H;  2AMC B;  1EIH A;  4LFC L;  4FM9 A;  1Y8O B;  4S3S A;  5CV5 A;  3JSL A;  1YVC A;  3PW2 A;  1AN8 A;  2N78 A;  4ME5 A;  4RHR A;  4IQZ A;  1IOV A;  2A73 B;  2OQK A;  3E0E A;  3OWF A;  4C3H G;  4XYL B;  5TSS A;  4HMJ A;  2DIK A;  4JBK A;  1IBL L;  1VQM A;  5D1P A;  4A3J G;  5C4X B;  1ESR A;  1JT8 A;  5FK9 C;  4BXX G;  1A3T A;  1EIY B;  4UP7 A;  1I50 H;  1LT5 D;  1SNM A;  4RMF A;  1A0I A;  3PW5 A;  1G51 A;  1GUG A;  3QOJ A;  2X0S A;  4CC5 A;  2R7N A;  4DNR B;  4DR4 L;  4JV0 A;  3H6M A;  1QUQ A;  1E22 A;  4DN4 M;  1PTO B;  1ONL A;  1Q1B A;  1AUX A;  1R4Q B;  3D3R A;  1V8Q A;  1PXU A;  2B2Y A;  4QIW E;  3JRW A;  1X54 A;  4YJ2 F;  5LMN Q;  5LYJ F;  1MIU A;  1FL0 A;  3T1Y L;  1A2T A;  3RAQ A;  3HOY B;  3KF8 B;  3TP8 A;  3KOJ A;  4EEY A;  1LTT D;  5BN5 A;  1E2V A;  3K5O A;  3U58 A;  1SE4 A;  3J81 c;  1FD7 D;  5C0X G;  1I5F A;  4Q8F A;  1A62 A;  2ZDH A;  2HCC A;  1NR4 A;  3OSP A;  2PMZ E;  5J39 A;  1K8O A;  2XCP A;  2VL6 A;  2XGT A;  4YCV A;  4DK6 C;  5EGT A;  1K8A C;  3CPW A;  3S17 B;  1AZQ A;  2DGY A;  1C3O A;  2YCH A;  4IFD G;  4JOI C;  1TWG B;  4DR2 L;  1S0O A;  4J9M A;  5KG2 A;  1T5E A;  4U68 A;  3PIO A;  1SFO A;  2G9D A;  2B2U C;  2Y0S E;  4IZ8 A;  3K6O A;  1HR0 W;  1CHP D;  1K1S A;  4RUA A;  4B9X A;  3R5H A;  4BXX H;  3OTO H;  2KEC A;  5LL6 S;  2Z8L A;  1V51 A;  3I91 A;  2O4X A;  3M4O B;  3S1R H;  2NTT A;  3X3M A;  2OLS A;  2K4K A;  2EYO A;  3J7A V;  3MR3 A;  2N55 A;  1K8M A;  2DPI A;  2E8G A;  5E3F A;  4DPG A;  4JI7 H;  4DUZ Q;  3JAM L;  5DLQ E;  1ML0 D;  1H9R A;  4NXN L;  2YU9 H;  3J7A K;  4A3D H;  3A5U A;  1V9P A;  5DEH A;  4J9Q A;  3GTO H;  1QNK A;  5C4J H;  1XPR A;  4LAA A;  1K83 B;  1HNW Q;  1EUD B;  1EYZ A;  4B9W A;  1EWC A;  2PCF B;  4Q0Y A;  1TS5 A;  4DR4 Q;  5IE8 A;  5E4X A;  1W96 A;  4I55 F;  4IFD H;  4RZR A;  1KJ9 A;  2YZM A;  2K52 A;  1H9S A;  5KFS A;  2F0H A;  5M3F G;  3HG9 A;  2KCM A;  2EE1 A;  2H4O A;  1NMG A;  3W2D A;  1U4L A;  2RDG A;  3Q23 A;  2W7O A;  2OTL A;  4NXN H;  4X64 L;  5BR8 L;  3OWE B;  1L0Y B;  5D1O B;  5C5L A;  4J6H A;  2F0L A;  1G2T A;  1PTO H; 
#chains in the Genus database with same CATH homology
 3GTL H;  4OON A;  4OX9 Q;  3I55 A;  4LF9 Q;  1K83 H;  2A1A A;  4UP8 A;  4A3G H;  1I6H H;  1X6O A;  3DLL A;  2PQA B;  4IJL A;  3CCM A;  5IYD G;  3WWV A;  1VQF A;  4L5T A;  2B29 A;  2N49 A;  4X66 Q;  3JAM c;  3ULP A;  4A3J H;  5IY0 A;  1N36 L;  4B3M L;  3LGJ A;  4GOP A;  4QL5 A;  2HT1 A;  1XMQ L;  1UWV A;  4OXP A;  2UXB L;  2NN6 I;  4LFA L;  4A3M G;  4GKJ Q;  4Y7N H;  3ULL A;  3TQY A;  1VQ5 A;  1AE2 A;  3PIP A;  3CF5 A;  3T1Y Q;  1XMQ Q;  2VQE Q;  4UY8 C;  2YTV A;  3A0J A;  4GKK L;  2EQS A;  1PA6 A;  1MJC A;  1SRU A;  3KF6 B;  4IFD J;  4XTC S;  2UUB L;  3L2P A;  1FJG L;  1L1O A;  1X9N A;  3M85 A;  1Y1W H;  3F2D A;  5IYD H;  5M5Y H;  5IYB H;  1QVF A;  3I2Z A;  3CMA A;  2UUC Q;  1IBM Q;  3HOY H;  2MO0 A;  3H3V I;  3E9I A;  2K5N A;  2JEB I;  2AHO B;  3RLN A;  4A75 A;  5HGQ A;  2JA8 H;  5BR8 Q;  5IYC H;  2NZO A;  4LF8 Q;  4A3L G;  2CKZ B;  4IPG A;  1J5E L;  2IHF A;  2ATW A;  2JA6 G;  4WJ4 A;  1WFQ A;  2WP8 J;  1IBL Q;  4JG2 A;  1L1O B;  1PH2 A;  1B8A A;  2F3I A;  3M4Q A;  1TXY A;  4LF4 Q;  3I4M H;  1UEB A;  3UE1 A;  3AFP A;  3PUV A;  4B3R Q;  5GAG C;  2NVX H;  3I7F A;  1HZ9 A;  1HR0 L;  4YWK A;  1NY4 A;  2L15 A;  4UPA A;  3KJO A;  4B3T Q;  2WB1 G;  5FJ8 H;  3W5O A;  4LF5 L;  5K36 G;  3KJP A;  3G6E A;  4DNI A;  1TWC H;  1HNW L;  2Z6K A;  4DV1 Q;  4L5R C;  4LF7 L;  2QEX A;  4K0K L;  2ZJP A;  3M7N A;  4JI1 Q;  4AQY Q;  4JBJ A;  4JI1 L;  5M3M H;  1VQK A;  3JAM i;  4K0K Q;  4KHP L;  4BY7 G;  4OO1 G;  2WFW A;  2YYZ A;  4DV5 Q;  1KXL A;  1X56 A;  1Y1V H;  4DR3 Q;  3STB C;  3CCR A;  2Q2I A;  1PH5 A;  3KDF A;  4QQB X;  2HIX A;  3HOW G;  1EWI A;  1KAW A;  5GAH C;  1GVP A;  1U5K A;  4IJH A;  2R6G A;  4BY7 H;  1PYB A;  2A8V A;  3CCJ A;  1IBK Q;  3CCV A;  3HOZ G;  3S1M H;  2VZA A;  2Y0S G;  3D0F A;  3UDI A;  3TEH B;  1HZB A;  4GS3 A;  4DV0 L;  3GTK H;  4GN5 A;  1K73 C;  1N34 L;  1VQI A;  1X65 A;  3BZC A;  4JBW A;  4R4T A;  4BBS H;  3A5Z B;  2N8N A;  3KDF B;  1YJ9 A;  3U4Z A;  2VQF Q;  4YWM A;  2UUA Q;  1Q12 A;  2D0P A;  3AFQ A;  3HKS A;  4DV6 L;  4JI8 Q;  1OXT A;  4DR7 Q;  1S40 A;  3CC7 A;  3CCS A;  1CSP A;  2EIF A;  5C3E H;  5C44 G;  5M3M G;  3I4M G;  3HOU G;  3PF4 A;  4OWX B;  4BA2 I;  3L7Z C;  3EIV A;  5IYC G;  1V43 A;  1XPO A;  3PGZ A;  2CWP A;  3G48 A;  4R4Q A;  2K5V A;  3RLO A;  3S1Q H;  1JMC A;  3TRZ A;  2IX0 A;  4IPH A;  3K7U C;  4DK3 C;  1HNX L;  4JI5 Q;  3M4O H;  4PMW A;  1E3P A;  1N33 Q;  1S72 A;  2WAQ E;  4AIM A;  4GOP B;  2AWO A;  3CXC A;  3U50 C;  4APV A;  4DV7 Q;  2F52 A;  2R7Z G;  5FLX c;  1XNQ Q;  4AQY L;  1VQ6 A;  2Q2U A;  3OTO Q;  4NB3 A;  4DR6 Q;  4A3E H;  1S3O A;  3CD6 A;  4DV1 L;  1UE5 A;  4KI0 A;  4A93 G;  4O2D A;  2CFM A;  4IPD A;  2Z6K C;  5IP9 H;  4JYA Q;  5HY6 A;  2JA9 A;  4R1J A;  2ZTD A;  1YJN A;  1D8L A;  3F1Z A;  1HR0 Q;  1N34 Q;  4JOI A;  1JJC B;  2JA5 G;  2LXK A;  2MO1 A;  1KC8 C;  4TQU S;  4HID A;  1Q46 A;  4X65 L;  2Z0S A;  3I56 A;  1M1K C;  2VUM G;  4IFD I;  2OWO A;  3H0G H;  1XTD A;  3F8T A;  2E2J H;  5C0X J;  4DAM A;  1NTG A;  2I5H A;  3PSI A;  2BA1 A;  4GN4 B;  5GAE C;  1H95 A;  4MZ9 A;  1PH4 A;  2UU9 Q;  3CCL A;  2XTI A;  3BJU A;  3K81 C;  1X3E A;  5E7N A;  1BBW A;  3MXN B;  2NZH A;  4LUV A;  2Q2H A;  4FDB A;  4PZ6 A;  4DAY B;  1K3R A;  5H1S E;  3UDG A;  1EFW A;  2UUC L;  2K14 A;  2MNA A;  4BBR G;  2VS1 A;  4P74 A;  3FP9 A;  4GLV B;  3CAM A;  1VQ4 A;  4DR6 L;  4O0A A;  1LYL A;  1YNX A;  3PUZ A;  4PG3 A;  4P71 A;  5C44 H;  3OTO L;  4DUY L;  3S17 H;  4YHH L;  1PH3 A;  2CQO A;  3FHW A;  4NXN Q;  3K0X A;  4GKK Q;  3CW2 C;  2UXC Q;  4GNX A;  3ICE A;  2B63 H;  4KLK A;  2JJQ A;  5JEA J;  1VQG A;  4JI5 L;  4R4I A;  1YBY A;  1HNX Q;  1OTC A;  4LF5 Q;  2R7D A;  1XNR Q;  2RHS B;  1BBU A;  1Q8K A;  4HJ8 A;  2IX1 A;  1O7I A;  4A3I H;  1VQD A;  5M5X H;  2ZJR A;  4JV5 Q;  1PVO A;  2I5M X;  4AYB G;  3AYH B;  1SRO A;  3TRE A;  3PUW A;  4JV5 L;  5FJ8 G;  1RIP A;  1GKH A;  4DR2 Q;  1W2B A;  1TWF H;  1QVC A;  3HOW H;  1N32 Q;  3GTP H;  3S1N H;  2WB1 E;  3S2D H;  1JB7 A;  4BBS G;  2PNH A;  3CCQ A;  1YIJ A;  3HOY G;  1EQR A;  2NVY H;  1V1Q A;  1Z9F A;  2YTY A;  3NBH B;  4A3I G;  1IBK L;  2NVQ H;  2RHQ B;  3NEN A;  1KIX A;  2KBN A;  1IXR A;  1WCM G;  3ER0 A;  1C9O A;  1Z47 A;  2UXD Q;  2ZM6 L;  4QGU A;  4BY1 G;  2VW9 A;  1XPU A;  2VY3 A;  4JI3 L;  4OWT B;  1X55 A;  1AE3 A;  3HKZ G;  4JCV E;  4LFA Q;  3S2H H;  2E5L Q;  2UXB Q;  5GRO A;  1VQ8 A;  4X62 L;  1GD7 A;  2K5H A;  1QVG A;  1U0L A;  1PFS A;  5FLM H;  3K80 C;  4A3F H;  1K9M C;  1E1O A;  1GM5 A;  2OCE A;  1KRT A;  4DUY Q;  1M90 C;  4POF A;  3TS0 A;  1YI2 A;  4YCU A;  4B3M Q;  4A3C G;  4A3L H;  1CKM A;  1TWG H;  3RN5 A;  3GDE A;  4LF7 Q;  4L5Q A;  3VDY A;  4X62 Q;  3PO3 G;  2D0O A;  2JK8 A;  4LF9 L;  1KRS A;  4OX9 L;  4JI3 Q;  2IY5 B;  1TWH H;  1JE5 A;  2R93 H;  1RL2 A;  3EN2 A;  2KHI A;  3D31 A;  4GN3 B;  4JI0 L;  5ELO A;  3RZD H;  3J81 i;  4LFB L;  4LF4 L;  3KF6 A;  4DKA C;  3HOU H;  1Y1W G;  3GO5 A;  1PV4 A;  4C3H H;  5FLM G;  1KHI A;  1J5E Q;  3I4N H;  3TS2 A;  1LM0 A;  1I94 L;  4JI0 Q;  4DV3 Q;  1OXX K;  1LTL A;  1BKB A;  2RF4 A;  3J81 j;  4A76 A;  4DR1 L;  1UE7 A;  1PH1 A;  2ALY B;  1PH8 A;  5JJI A;  4A3K H;  3PUY A;  1VQA A;  3I4N G;  3L0O A;  4LW1 A;  1FGU A;  3J80 c;  4JI2 L;  2WAQ G;  3ULJ A;  4LFC Q;  1SLJ A;  3FKI G;  1E1T A;  2MFI A;  4P75 A;  3GTM H;  2R92 G;  4A93 H;  2UUB Q;  3H3V H;  3H0G G;  5LMU L;  1N9W A;  3HOZ H;  4HIK A;  1FVI A;  4X6A H;  2H5X A;  1IYJ B;  3OYY A;  5IP9 G;  5IWA Q;  1SFO H;  3A74 A;  3S14 H;  4ALP A;  2B63 G;  3GD7 A;  4LUO A;  1VQH A;  4IOA A;  2C35 B;  3PV0 A;  1IL2 A;  1KL9 A;  1P16 A;  2LXJ A;  1N36 Q;  1KQS A;  1HNZ L;  1Q1E A;  4WJ3 M;  2GVA A;  2RCN A;  4IO9 A;  2GN5 A;  4JI8 L;  2PI2 A;  4JI2 Q;  2JA8 G;  1YHA A;  1C0A A;  5JJK A;  2VQF L;  1PHJ A;  3M3Y H;  1L0W A;  4A3K G;  2YV5 A;  4J15 A;  3DM3 A;  3J7Z C;  3PF5 A;  1YHQ A;  3S24 A;  1CKO A;  4R4C A;  4EX5 A;  1YIT A;  2ZTE A;  4MNO A;  1I94 Q;  5IP7 H;  1I3Q H;  3PO3 H;  5M5W H;  1K8G A;  3UDF A;  4YWL A;  4DV0 Q;  4QY7 A;  4H02 A;  1HH2 P;  2Q2T A;  1G6P A;  1QZH A;  4QJF A;  4C3J H;  1XMO L;  5EAY A;  5JEA G;  4LF6 L;  1DGS A;  2QGQ A;  3NEM A;  1VQE A;  1B70 B;  1HZC A;  3Q8D A;  4UP9 A;  3G71 A;  4JI7 L;  4JYA L;  4A3B G;  3UE0 A;  1VS0 A;  4DV2 Q;  4A3M H;  2KCT A;  3RZO H;  4DR3 L;  3JC6 6;  4TVA B;  1EUJ A;  4IPC A;  4POG A;  5J3B A;  4NXM Q;  1EIF A;  1HJP A;  1NBW A;  1ASZ A;  4YHH Q;  1VQO A;  2R92 H;  2A19 A;  3W1G A;  2F4V L;  2JQO A;  2AWN A;  1B7Y B;  4DV4 Q;  3RNU A;  3PO2 G;  1TWA H;  4A3D G;  5ELN A;  4AYB E;  4NXM L;  3HOX G;  4C2M H;  5GQO A;  2HHH Q;  1PYS B;  3F2C A;  4HJ7 A;  1VQ7 A;  4GLA C;  2CCZ A;  2E2H H;  1WOC A;  2AKW B;  4DV2 L;  4HIM A;  1SE8 A;  3T1H L;  2ES2 A;  2ZM6 Q;  4HIO A;  4A3B H;  2UXD L;  3HOX H;  3J80 i;  3RLF A;  1SN8 A;  1QZG A;  4LF6 Q;  3G4S A;  1X3F A;  3AEV A;  3H15 A;  1CKN A;  1A8V A;  1IZ6 A;  1CSQ A;  2NN6 G;  4P73 A;  4DV6 Q;  2VUM H;  1QUQ B;  2K75 A;  1YJW A;  3SGI A;  3FKI H;  2DUD A;  5C0X I;  1YZ6 A;  2YTX A;  1NE3 A;  4XIG S;  4IOC A;  2HQL A;  3UDX A;  1N32 L;  4RG1 A;  1Q82 C;  3HOV G;  4JC0 A;  1OXV A;  2JEA I;  1BVS A;  3HKZ E;  4HJ9 A;  4MTN A;  3GTG H;  2I5L X;  4A3C H;  3CP0 A;  2JA7 H;  4L5S A;  4BBR H;  4JI4 L;  1XNQ L;  2HIV A;  1JJG A;  4DV7 L;  5AJ3 L;  3BU2 A;  3E9H A;  1Y14 B;  3I4O A;  2VQE L;  5IP7 G;  1VQJ A;  1XNR L;  2KEN A;  4HJ5 A;  2I0Q A;  1EYG A;  3PUX A;  1WI5 A;  4YY3 Q;  3ZJY C;  4GKJ L;  1UE6 A;  1X3G A;  4YCW A;  2ZJQ A;  1UE1 A;  1WCM H;  2EXD A;  4B3S Q;  3CPF A;  3M9B A;  1KD1 C;  1Q7Y C;  1VQL A;  1NMF A;  4ME3 A;  1PH9 A;  4KHZ A;  2F4V Q;  1YHB A;  4R4O A;  4JI4 Q;  4JI6 Q;  1VQN A;  1LUZ A;  4DR7 L;  3CME A;  2AMC B;  4LFC L;  1NJI C;  2LSS A;  4A3F G;  3B6Y A;  2ZTC A;  1OXS C;  1YVC A;  2MQH A;  1VQ9 A;  4A4I A;  2N78 A;  1WJJ A;  4AH6 A;  2UU9 L;  3IRB A;  4JI7 Q;  4DV3 L;  4Y52 H;  5C4X H;  3KLW A;  4B3R L;  2OQK A;  3E0E A;  3GTQ H;  4OO1 I;  2JE6 I;  4JBK A;  1IBL L;  1VQM A;  4A3J G;  1L2F A;  1SR3 A;  3U4V A;  1JT8 A;  1G29 1;  4BXX G;  4LFB Q;  1K0R A;  4UP7 A;  1EIY B;  3EBE A;  1I50 H;  2PQA A;  1A0I A;  4RMF A;  1G51 A;  3MEF A;  4A3G G;  1P8L A;  3CCE A;  3T1H Q;  1EQQ A;  3KYH C;  4GLX A;  2FXQ A;  4DR4 L;  1QUQ A;  4OWW B;  1E22 A;  3CQZ H;  3M4P A;  2HHH L;  3BZK A;  1SMX A;  4P72 A;  1Q1B A;  2JA7 G;  2BH8 A;  4PZ8 A;  1HNZ Q;  1PH7 A;  4JI6 L;  2JA6 H;  1GO3 E;  3CC4 A;  4QIW E;  4GNX C;  1X54 A;  4B3S L;  5LMN Q;  1MIU A;  1FL0 A;  3T1Y L;  1PH6 A;  2E5L L;  4LUZ A;  3KF8 B;  3NEL A;  3KOJ A;  1N33 L;  4YY3 L;  1A63 A;  5IWA L;  1VQC A;  1WYD A;  2D62 A;  4B3T L;  3W1B A;  3U58 A;  4C3I H;  1ASY A;  1EOV A;  3J81 c;  5AJ3 Q;  5IYB G;  5C0X G;  1I5F A;  5IT9 c;  1A62 A;  1VQB A;  3RR5 A;  3OW2 A;  1VQP A;  3KFU A;  1XMO Q;  2JA5 H;  4DR5 L;  1E7Z A;  3S15 H;  2PMZ E;  5LMN W;  2E2I H;  1AH9 A;  3K8A A;  2IHE A;  2VL6 A;  2XGT A;  2IT1 A;  1N8R C;  2UUA L;  4LF8 L;  1W3S A;  4YCV A;  4DK6 C;  1J6Q A;  2CWA A;  3RN2 A;  5GAD C;  1K8A C;  4LWC A;  3CPW A;  2VNU D;  2PI2 E;  1Y1V G;  2DGY A;  3S16 H;  4IFD G;  4JOI C;  4DR2 L;  1JJ2 A;  4X64 Q;  1MJE A;  1IBM L;  3PIO A;  2ASB A;  2Y0S E;  4A3E G;  1HR0 W;  1YEZ A;  3PO2 H;  2GVB A;  4DR5 Q;  1FJG Q;  4BXX H;  4LNQ A;  3CC2 A;  2OQ0 A;  3S1R H;  4GOP C;  2K4K A;  4EQ5 A;  1OXU A;  2NVT H;  1T9H A;  5JJL A;  3ERS X;  2E8G A;  4DPG A;  3K7A H;  4DV5 L;  5LMN L;  1C7Y A;  4BY1 H;  4KHP Q;  4DUZ Q;  1E24 A;  2UXC L;  1D7Q A;  5DLQ E;  4NXN L;  2YU9 H;  3J7A 5;  2ID0 A;  4DV4 L;  3CCU A;  5LMU Q;  1Q86 C;  4X66 L;  4BA1 I;  1V9P A;  3A5U A;  4A3D H;  3GTO H;  2R7Z H;  5C4J H;  4DUZ L;  1XPR A;  3F2B A;  1HNW Q;  2R93 G;  5M3F H;  2N3S A;  2KHJ A;  3HOV H;  3AQQ A;  5IE8 A;  4NPS A;  4DR4 Q;  2OTJ A;  2BA0 A;  3STB D;  1L1O C;  4PZ7 A;  4DR1 Q;  2K52 A;  4GNX B;  1MKH A;  3HFZ B;  1HZA A;  5M3F G;  2V1C C;  2R7F A;  2KCM A;  1NMG A;  5C3E G;  4HJA A;  4X65 Q;  1R9T H;  5C4X G;  2OTL A;  4X64 L;  2B3G A;  2K50 A;  1Q81 C;  1CUK A;  5BR8 L;  2QA4 A;  2BH2 A;  1CKN B;  3PCO B;  1XJV A;  4JBM A;  3GTJ H;  1VCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...