4A3GG

Rna polymerase ii initial transcribing complex with a 2nt dna-rna hybrid
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3gG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3gG01
2F4VL 2JA8H 1P16A 3GTLH 3KOJA 5ELNA 5JJKA 3HOUG 1WFQA 3GTGH 4GKKQ 4BY1G 4IPDA 1W2BA 3K8AA 4HJ8A 3CD6A 3PCOB 4DV3Q 3TQYA 4DV4L 1A8VA 2ASBA 1XNRQ 1Q81C 2CWAA 3PV0A 2IX0A 1P8LA 2Q2UA 1FGUA 3CF5A 5IYDH 2BA0A 4YCUA 4DV3L 4GS3A 1TWAH 1PH7A 3HOXG 2L15A 1XNRL 4DR1Q 3J7A5 4NXNQ 1JJ2A 4DPGA 3GTKH 3D31A 3HOUH 3J7ZC 4DV4Q 2A19A 1D7QA 3CCEA 3GTJH 4O2DA 1BVSA 1J6QA 3K80C 3MEFA 4UP9A 5HGQA 2WAQE 4A3LH 3CCLA 1Y1VG 5JJIA 1VQAA 4DR1L 2K5VA 3F1ZA 1YHBA 2R7FA 1O7IA 5GROA 4NXNL 3AFPA 4AYBG 2VUMH 1NBWA 1BBWA 3BU2A 3K81C 4DAMA 3CPFA 3S24A 1X65A 2OTLA 1EQRA 3T1HQ 4A3MG 1TWHH 1VQNA 3KFUA 4NB3A 1KXLA 2NVYH 1QUQB 2E5LQ 2CFMA 4A4IA 5GAHC 2EQSA 4GNXA 3AFQA 3PUXA 3HOYG 1PYSB 1HZCA 5C3EG 1UWVA 1AE2A 2OQ0A 3CXCA 3T1HL 3J80i 3I4MG 2E5LL 3S1NH 3GTPH 1PVOA 1VCIA 1GO3E 4A75A 1Q12A 3L7ZC 4PZ7A 4P74A 3K0XA 4P71A 2IT1A 4JI3Q 4L5TA 3M9BA 3NBHB 4AQYQ 1U0LA 1A62A 4YY3Q 3G4SA 3BZCA 1KIXA 1NY4A 4K0KQ 1HZ9A 3CCRA 3CC7A 2NVQH 4DR2Q 2HHHQ 4JI3L 2Y0SE 4AQYL 1SN8A 4R4QA 3EBEA 2RHQB 4YY3L 2JA9A 3EN2A 5M3MG 4DV0Q 2K4KA 4JBWA 1C9OA 4L5RC 5IP7H 2QGQA 3L2PA 2CCZA 5LMNQ 4PZ8A 2I0QA 2AHOB 2HQLA 3PO3H 5IE8A 2MO1A 4GOPA 1S72A 2I5LX 1HNZQ 5H1SE 2HHHL 2I5MX 2OWOA 1V1QA 3I56A 4BY7H 2UXCQ 4X66Q 3A74A 4DV0L 4DKAC 4UP8A 3H3VI 5LMNL 4UPAA 3HOVG 1HNZL 4X65Q 1BKBA 2WB1G 3KLWA 1PH6A 4H02A 3UDFA 2UXCL 4X66L 4IFDG 1SRUA 4MTNA 4IO9A 4A3EH 4LF4Q 2N78A 4HJ7A 1NJIC 1S3OA 1SLJA 1XMOQ 2B3GA 4X65L 1CKMA 4BBSH 1GM5A 1LM0A 3CC2A 4JI4Q 3W1GA 1VQ8A 3PO2G 4LF8Q 4R1JA 4AYBE 1VQFA 2D0OA 4JYAQ 2K50A 4LF4L 2D62A 1K3RA 3U50C 5IP9H 4LW1A 2R93H 5JJLA 4JV5Q 5FJ8G 4BBRH 4YCVA 1XMOL 1WI5A 5M5WH 2R7ZG 3RN5A 4PMWA 4JC0A 2KCMA 1AE3A 2AWOA 2ALYB 4YWLA 1RIPA 4APVA 1VQOA 4JYAL 2JA8G 1IBML 1I94Q 3I2ZA 3KJPA 4B3SQ 1HR0L 2PI2E 4IPCA 1MJEA 4JV5L 4DUYQ 4GKJQ 1VQ4A 3HKZG 1XJVA 1EUJA 1VQBA 4LFAQ 5IWAQ 3S1RH 3M4QA 4OXPA 5AJ3Q 4HIOA 2F3IA 4MZ9A 2K5NA 1I94L 4B3SL 1X3GA 3PSIA 3RN2A 1S40A 1PH3A 4JI7Q 1L1OC 3HOWH 4DUYL 3VDYA 1GD7A 2CWPA 4LWCA 5IYDG 2ZJQA 1HH2P 5HY6A 4HIDA 4GKJL 1VQJA 3PUYA 3KF6B 1A0IA 3TREA 3I4OA 5IWAL 3M85A 2Z6KC 4P73A 4LFAL 5AJ3L 4KHPQ 3ZJYC 2NN6G 2ZJRA 3PIPA 4JI7L 1WCMH 5J3BA 4B3MQ 3PUZA 3DM3A 4IJHA 2E8GA 1YVCA 3AQQA 3TEHB 4ALPA 1QVGA 1M90C 2UUCQ 4A3LG 2PQAA 3RLFA 2VS1A 3I7FA 3J81c 5C0XJ 5IYCH 4KHPL 1D8LA 1IZ6A 2VUMG 4GKKL 3OW2A 4A3FH 4R4CA 2MFIA 3RZDH 4B3ML 1J5EQ 1Q46A 1OXSC 3H3VH 4J15A 5FLMG 1V43A 3ULPA 1Q82C 2UUCL 4DR3Q 3B6YA 3G71A 3CCQA 1PH4A 4WJ4A 5JEAG 1KRTA 4DNIA 4A3GH 1X3EA 2PNHA 4BXXG 2LXKA 1HJPA 2NZHA 4B3RQ 4LFBQ 1X9NA 2RF4A 2IHEA 2KHJA 5GAEC 3J80c 5LMNW 1X6OA 4YCWA 1OXUA 3J81i 2N8NA 4DR3L 3HOZH 3L0OA 3GDEA 1YIJA 1GVPA 3S2DH 2K75A 1TWGH 4A3IH 1E1TA 3CP0A 4OX9Q 5ELOA 2JA7H 4A3KH 4B3RL 4LF7Q 4A3BH 4LFBL 1QZGA 1PHJA 3AYHB 1EQQA 3TS2A 1KRSA 3CMEA 1KQSA 1MKHA 4P75A 1QVCA 3GTQH 1WYDA 4KI0A 4A76A 1OTCA 2K52A 3UE1A 4BXXH 1Q1EA 4OX9L 3G48A 3ULLA 4LF7L 3BJUA 3IRBA 4KHZA 1IBLQ 4Y7NH 4HIKA 2UXBQ 2JA5H 4OONA 3ERSX 1E22A 3FKIG 2UU9Q 4A3DH 2WP8J 1L1OB 1K83H 3F2DA 1HNXQ 3NENA 1PH2A 1VQ6A 2XTIA 1CUKA 1EIYB 4B3TQ 4PZ6A 1LYLA 1I5FA 2K5HA 3RNUA 1IBLL 1Z9FA 1PH1A 1FJGQ 5IP7G 4JCVE 1VQLA 3M7NA 1Y1WH 2UXBL 3JAMc 5FLXc 2UU9L 3PO3G 4OWTB 1X56A 3KF8B 2LSSA 3Q8DA 3UDXA 1HNXL 1YZ6A 4TQUS 1YI2A 4P72A 1R9TH 1CSQA 2NVXH 3I4NH 3EIVA 4BY7G 4JOIC 4JI6Q 4B3TL 1VQGA 4HJAA 2R92H 5M3FH 1FJGL 3E9HA 3FKIH 4OO1I 4GOPB 3UDGA 1QUQA 2ZTCA 3HKSA 1EFWA 3U4ZA 5C4XH 4A93H 4DR4L 3HFZB 4LF9Q 3M4OH 4IOAA 1W3SA 2R7DA 1UE5A 4JI6L 4C3JH 3H0GH 4IOCA 4K0KL 1E24A 4A3EG 4DUZQ 2ATWA 2A1AA 3JAMi 3ICEA 2ZTDA 2QEXA 4DR2L 3F2BA 4BBSG 2K14A 4LF9L 2CKZB 4GLAC 2Q2HA 1VQCA 4C2MH 4DV6Q 2GN5A 5C44G 2WFWA 1RL2A 2XGTA 2UXDQ 4DUZL 5IP9G 2R93G 4QL5A 2AWNA 2BH8A 1KC8C 4BBRG 2ZM6Q 2ZTEA 1I6HH 4EQ5A 3PUVA 1CKNB 4R4TA 4DK3C 3PF5A 3FP9A 1JB7A 4BA2I 1L0WA 4DV6L 2UXDL 2QA4A 3BZKA 3KDFA 1GKHA 3S1MH 1N36Q 1PFSA 2ZM6L 4L5SA 3RLNA 1OXVA 1SROA 3OYYA 5EAYA 1SMXA 3CCMA 4R4IA 4POGA 5C44H 4IPHA 1K73C 4IFDJ 1EYGA 2HT1A 1MIUA 4LNQA 2WAQG 4DR6Q 4IPGA 1N36L 3HOWG 2VNUD 2YTYA 3S17H 4QGUA 5DLQE 4JI5Q 2JE6I 4JI4L 1X55A 2VQEQ 2UUAQ 4LF8L 1UEBA 1B7YB 2YV5A 4QY7A 1KAWA 5LMUQ 4DR6L 1WCMG 1G291 1YNXA 4JI5L 2BA1A 1A63A 1NMFA 2VZAA 4XTCS 2KHIA 1XNQQ 1IXRA 2VQEL 2UUAL 4O0AA 3K7UC 2VQFQ 1YITA 5IYCG 1XPUA 1Q1BA 2AMCB 3STBC 5LMUL 3A0JA 5BR8Q 1KD1C 4A3FG 4LF6Q 2IY5B 1HZBA 1Q86C 1Q8KA 1XMQQ 3A5ZB 1N9WA 1U5KA 2B29A 2OCEA 3PUWA 3A5UA 1XNQL 4GLVB 1YBYA 4JI0Q 1G6PA 3U58A 2E2JH 4JBKA 4A3GG 1UE7A 4DR7Q 3LGJA 5BR8L 4LF6L 2R6GA 4C3IH 1XMQL 2C35B 4OWXB 1JMCA 3JC66 3HOZG 4IJLA 1HR0Q 4JI0L 3I55A 2PMZE 4HJ9A 4GOPC 4A3IG 4DR7L 1G51A 1NMGA 4HJ5A 1NTGA 4A3KG 2JA7G 1X54A 4A3BG 1PH5A 1YJ9A 2BH2A 2V1CC 2KENA 2JEBI 4JOIA 1XPRA 2GVAA 2PI2A 4DV1Q 4A3JH 1K8AC 2YU9H 4AIMA 3S1QH 3OTOQ 3NEMA 2E2HH 1LTLA 1N32Q 4GLXA 1Y14B 2DGYA 1J5EL 1KHIA 1C7YA 5IT9c 1K0RA 3S16H 2OQKA 1VS0A 2FXQA 4MNOA 4GNXB 1UE6A 2N3SA 2WB1E 3KF6A 4DV1L 1VQHA 5IYBH 1VQ5A 2JA5G 5JEAJ 2B63H 4A3DG 4X62Q 2IHFA 2KCTA 3OTOL 1ASYA 4OWWB 1N32L 1VQMA 1TWFH 1YHAA 4DV7Q 4DV5Q 2RHSB 1YJNA 2JA6H 3NELA 1I3QH 1WOCA 3CQZH 5FLMH 4QQBX 1B70B 1Y1WG 4QIWE 4QJFA 3PGZA 2RCNA 4XIGS 4X62L 2ID0A 3G6EA 3TS0A 3I4NG 1SE8A 2YTXA 3T1YQ 1IL2A 4YWMA 4LUVA 3CCJA 1EOVA 4DV2Q 4DV7L 4DV5L 3CC4A 4BY1H 4R4OA 2R92G 5M3FG 2Z0SA 1HZAA 1WJJA 1K8GA 1SR3A 2KBNA 1FVIA 1KL9A 1X3FA 1TWCH 4RMFA 1OXTA 1YJWA 3W1BA 5C4XG 4A93G 2JK8A 2GVBA 3T1YL 4DV2L 1HNWQ 3H0GG 3UDIA 1YEZA 1VQ7A 1Z47A 1I50H 3WWVA 4DR5Q 3HOXH 4TVAB 4DR4Q 2YTVA 3HKZE 3TRZA 2JQOA 3F8TA 5GAGC 2NZOA 2IX1A 1OXXK 1IYJB 4X6AH 4YHHQ 1HNWL 1PH9A 3M4PA 4JI8Q 3J81j 1XPOA 1CKOA 2MO0A 2ES2A 1Y1VH 3ER0A 4GN5A 2A8VA 2CQOA 3KYHC 4DR5L 1VQKA 3CCSA 1QVFA 2VY3A 4IFDI 2Q2IA 4KLKA 4YHHL 4JI8L 2F52A 1PH8A 4A3MH 1NE3A 1Q7YC 4Y52H 1PYBA 2DUDA 4JBJA 1E1OA 3STBD 5M5XH 3RZOH 3HOYH 4RG1A 1CSPA 1L1OA 4JI2Q 1VQEA 2E2IH 5C3EH 3MXNB 3ULJA 2Q2TA 1QZHA 1YHQA 4HIMA 1M1KC 3KDFB 4LUOA 2D0PA 4ME3A 5M5YH 2Z6KA 3KJOA 3CCVA 3I4MH 5K36G 4NXMQ 3F2CA 3RR5A 3U4VA 1E7ZA 4JI2L 2NVTH 1HR0W 3D0FA 4GN4B 3W5OA 2HIVA 1JJCB 4X64Q 1B8AA 3RLOA 1PV4A 2I5HA 2VW9A 4C3HH 3PIOA 1N8RC 1TXYA 4NXML 3CMAA 2ZJPA 2AKWB 1XTDA 4YWKA 4NPSA 2EIFA 1K9MC 3GO5A 4X64L 3CAMA 2EXDA 4GNXC 1VQPA 5E7NA 2HIXA 3UE0A 3GTOH 2H5XA 5C0XI 4OO1G 1LUZA 3CPWA 1C0AA 2JJQA 4JI1Q 4BA1I 2JEAI 2VL6A 1AH9A 2NN6I 1EIFA 1EWIA 2MQHA 1T9HA 5M3MH 3CCUA 4UP7A 4UY8C 3PF4A 1VQ9A 4JBMA 5GADC 1VQIA 4A3CG 3GD7A 2LXJA 1DGSA 3S14H 4JI1L 1CKNA 4FDBA 3DLLA 1IBKQ 4LF5Q 1ASZA 1PA6A 1IBMQ 3M3YH 3K7AH 3S2HH 1N33Q 3E0EA 1FL0A 4LFCQ 3CW2C 3HOVH 1H95A 4DK6C 4EX5A 5C4JH 1L2FA 2PQAB 1JT8A 3GTMH 2MNAA 3E9IA 2VQFL 1N34Q 1V9PA 4DAYB 1IBKL 4LF5L 4A3JG 2N49A 1JE5A 1JJGA 3FHWA 1N33L 4LFCL 4WJ3M 4GN3B 4A3CH 3S15H 2YYZA 5GQOA 2OTJA 1VQDA 3SGIA 3AEVA 4POFA 1UE1A 1N34L 3PO2H 2UUBQ 2F4VQ 4JG2A 5IYBG 2B63G 1MJCA 4AH6A 4PG3A 5FJ8H 1SFOH 2JA6G 2R7ZH 4LUZA 3H15A 1E3PA 1BBUA 2Y0SG 4L5QA 5C0XG 2UUBL 5IY0A
chains in the Genus database with same CATH superfamily
1EY9A 2JA8H 1P16A 3TP8A 1KLGD 2AQ2B 1DONA 5DG9A 1G2SA 1N32H 3GTGH 2F4IA 1M8AA 4BY1G 1W2BA 3HXLA 4ECRA 5IIFA 4RCOA 3K5NA 5EPLA 2CHBD 1TU2B 1RJQA 2WE6A 2A68C 4YP3A 1JB3A 4J9LA 1E4FT 1SNOA 2Q2UA 1FGUA 1BJTA 5DGBA 2BA0A 4DV3L 5C0XH 2EOTA 3G6XA 2YZMA 1D2BA 4HQ6A 3D31A 3HOUH 1RYSA 4UP9A 4DV2H 3K80C 4FXGC 3CCLA 3GIJA 2JEGA 3MVVA 5A2QE 2K5VA 3F1ZA 2O5JC 1V51A 1O7IA 1LTID 4NXNL 3AFPA 3URYA 2RDJA 4F4WA 1HNXH 2XWJB 4DAMA 3S24A 4WBNF 4A3MG 2KSWA 1TWHH 4NB3A 1F9PA 1HFGA 5M9OA 2CFMA 1B50A 2EQSA 5JEAH 2F0TA 3BDOA 3PUXA 1WCMB 1IYVA 4A2BA 3RGZA 3J81W 1OWTA 4YHHH 4FF4A 3JAME 2WB1A 1UWVA 5FLXE 1AE2A 5CBEE 1CA6A 1T36A 3I4MG 2LFNA 3K5LA 3Q8PB 1JE4A 1PVOA 3GIMA 3SK8A 4KV6A 1GO3E 5D3IB 3DUZA 3ERQA 4IUVA 1DYQA 1KJJA 2D2CC 5E4XA 1FNUA 4P74A 4QWCA 3K0XA 5KNDA 5KFUA 5C5MA 4JI3Q 4L5TA 3M9BA 3NBHB 2MCTA 4JI2H 1U0LA 4RGNA 4YY3Q 3G4SA 2ATLA 2MP1A 5EQ0A 2I46A 1S68A 5C1OA 5FD6A 1SN8A 1TWFB 3C3LA 5M3MG 4R8UB 2K4KA 4JBWA 2Y0SB 5ELCA 4X64H 3QWNA 5DM73 4EQPA 5IP7H 3UFXB 3PO3H 4IRCA 3MHBA 3R2IA 5H1SE 2HHHL 1SYFA 2I5MX 4BY1B 4BY7H 2EY1A 1SMYC 2UXCQ 4DV0L 2JA5B 4S3SA 1TWAA 4DF7A 3ORRA 1I6VC 1RD9D 1TWCB 1EZ6A 2B2WA 2QDLA 5LMNL 3H3VI 2FK3A 4RB3C 1HNZL 2WB1G 3GTKA 3V6HA 2J0TD 4IFDG 4ZI7F 1I50B 4Q5VA 5I2XA 2QW7A 3DEPA 4KY7A 1S3OA 3RV3A 1XMOQ 5JH7F 4X65L 3SI8A 1RK5A 1ILQA 1DJRD 4JI4Q 4EEYA 3A55A 5IODA 3J81L 2Q8IB 5I47A 4LF5H 2D62A 3U50C 2R93H 1BGWA 3G6JB 5JJLA 4UDUC 3L4JA 1O7LA 1NSNS 1WI5A 2R7ZG 3WO0A 3RN5A 2PZUA 2KCMA 5ELFA 1N34H 4A3MB 1IBML 4RKLA 2LKVA 1A6XA 1MJEA 2V9WA 1EUJA 5EPKA 1KJIA 1LABA 4HIOA 2F3IA 1I94L 2K5NA 4IUNA 4B3SL 3N6RA 5J39A 3EFXD 3RN2A 3HOWH 2L0CA 3VDYA 3GP7A 1GD7A 3R5XA 3F2UA 2DLNA 1R9TA 3D6CA 1IOVA 2AQ3B 1R4PB 3PW2A 3TREA 5IWAL 4KHPQ 1Z2PX 3VYTA 2R92A 1WTQA 2NN6G 3H6MA 2ZJRA 1JDEA 3FKIA 1WCMH 3QOJA 4QWBA 2YS6A 2TSSA 1F2ZA 1YVCA 4ALPA 1QVGA 1M90C 1EYCA 5FPRA 3GV8B 2VS1A 1GJXA 5CMDA 1T3NA 2ZT9C 1S10A 3S17B 5T1IA 5KFPA 3DWAA 2C9OA 2NU9B 4RKBA 4B3ML 4YJ2F 1TVXA 5KFZA 5BN5A 4M7EA 2K28A 1VF7A 2UUCL 3TIIA 1SEBD 5M3MB 4C2MA 1A2TA 1PH4A 4G3IA 2Z8LA 4ECZA 2P5ZX 2PNHA 3TP6A 1HJPA 1UAPA 2NZHA 4B3RQ 3BQ0A 5IGDA 5GAEC 1JR0D 4YCWA 3V4SA 3J81i 3GIPA 3L0OA 4NW2A 1GVPA 4RFBA 5LP6F 3Q1KA 4LFBL 2J9GA 4LF7Q 1K28A 2WIIB 3MC0B 1Z6HA 1KRSA 3TS2A 1Z2NX 1KQSA 4JW0A 4ZCKA 1WYDA 4XQQA 5CGKA 2PW5A 3OW7A 4A76A 2BE5C 3NPPA 1OTCA 3RUPA 4OX9L 1N48A 3BA9A 5DLGA 4K5WA 1VDZA 2IPKD 1D1IA 4Y7NH 2FKLA 2JA5H 2QF7A 3FKIG 2A6HD 1VQ6A 1PTOF 2R7ZB 1IBLL 3RNUA 3M9NB 5DAUA 3KHLA 4JCVE 4X3KA 5IGBA 2UXBL 2Z9HA 3KF8B 2LSSA 3VPDA 4RB2C 2R85A 3I4NH 1CSQA 4RHRA 2XIGA 4JI6Q 2W57A 4HJAA 5M3FH 4YAKB 3T5KA 1PRTC 1QUQA 3SHLA 1B53A 1EWCA 2ZTCA 5NUCA 3U4ZA 1EFWA 4FF3A 2DIKA 4LF9Q 3M4OH 3PR5B 1LT4D 1TWAB 4A3EG 2A1AA 3ICEA 2ZTDA 4I7AA 4QF4A 1E4GT 4J9NA 1HQMC 5EGTA 1L0YB 1ESRA 4X3UA 2W7OA 4ABNA 5HURA 2UXCH 4EFEA 4Q0FA 2BH8A 1QOHA 2ZTEA 4EQ5A 2NTTA 4ED7A 3PF5A 1NUCA 4BA2I 4UCUA 2VA3A 4DV6L 4WJWA 1TIID 3MXNA 2IBKA 1IW7D 2QA4A 1TQOA 1GKHA 3R3OA 5LL6S 3S1MH 4HEDA 2ZM6L 1BNZA 2B63A 1XMOH 4FM9A 4IRDA 1SROA 2FJZA 2K32A 1B3AA 2F3VA 5C44H 2JEFA 1Y1VB 2PZWA 3J7AV 2M2LA 1I3QA 3M9MB 3S1NB 2WAQG 4DR6Q 4IPGA 2VB3X 3S17H 4JI4L 2UUAQ 5IOCA 2VQEQ 2F0JA 1PZKD 3VPBA 5EBDA 3RZOB 4IUTA 3RBEA 4JI5L 1K83A 4XTCS 2KHIA 1XNQQ 2L9HA 4O0AA 2IX3A 2VQFQ 4IALA 5IYCG 1Q1BA 5LMUL 1LT5D 4LF6Q 3D4WA 4FVMA 4A3FG 2J6UA 3I4LA 1Q86C 1A3TA 2B29A 1IOWA 1TS3A 4QW9A 5DGAA 3RB6A 5C5JA 1G6PA 4JBKA 4KHPH 1EZ1A 3T16A 4Y8VB 4G7ZC 5JJZA 4AYBA 3PZPA 2EYLA 3JC66 1XNRH 1RJPA 4N9PA 1HR0Q 4JI0L 4M8AA 2C5CA 3RMHA 4GOPC 1VAJA 1NAPA 2JA7G 1NTGA 2F0IA 2FPIB 3TQ1A 2PMZB 2V1CC 3P1HA 2RDIA 1OO9B 2PI2A 2CZGA 5TSSA 2ZDHA 4A3EB 4A3JH 2F0SA 4AIMA 1L2ZA 2W9BA 5LA6F 1Y14B 1S0MA 4B3RH 5IT9c 4KMUC 1VS0A 1BCPD 1H9KA 1UE6A 4BWSC 3KF6A 3ORQA 1VQHA 1CZGA 5IYBH 1VQ5A 4I55F 3KHHA 3HOVB 4NMZA 4LF7H 2RHSB 5BN3A 4TSSA 1X3PA 4QIWE 4QJFA 3PGZA 2RCNA 4X62L 2ID0A 2NZ1D 2YTXA 1IL2A 4LUVA 4Q8FA 3GTOA 4WORA 5DQIA 3AU7A 3VR5A 1SR3A 5C5LA 3RD4A 2WAQB 2FB9A 2DWCA 3H94A 5D14A 3T1YL 5DNFA 4MTKA 4C3JG 1FYCA 1PFBA 3H0GG 5KFFA 3Q24A 1VQ7A 4G7OC 4DK0A 3L9AX 3KK7A 4DR5Q 3HOXH 4TVAB 3HBLA 2KOLA 3QZ7A 4EYHB 2JQOA 3MEHA 2HDMA 4AQYH 2IX1A 1OXXK 1HNWL 4JI6H 1RTNA 4JI8Q 3RJ0A 2V5AA 1O78A 1Y1VH 2ES2A 3GTMA 2JSOA 2EYMA 2PPBC 2HUGA 4A3FB 4IFDI 4C5AA 2F0EA 5JAVA 3RZDB 1AZPA 2NU8B 3OHBA 2F52A 3V05A 1JDBB 5GONF 2R8HA 1GHJA 2NB0A 3PW0A 2WINB 4HR7A 4Y52H 2DUDA 5JOBA 3STBD 3T56B 3RZOH 5DQHA 4ME5A 2A74C 1VQEA 4OGQC 2R82A 3MXNB 3ULJA 1DM0B 2WYOA 3MXGA 2Z6KA 3CCVA 1S0OA 2R8GA 3S2DB 2VUMB 1TWGB 1I7NA 2FMAA 4YBZB 3OUZA 4J6HA 2JA7B 1E7ZA 1RTOA 3MTSA 3TMEA 1HR0W 2CW0C 4GN4B 3W5OA 1YNJC 1EYAA 3KTMA 4CKCA 2SNMA 2XNAC 4DL5A 1B04A 4XT1B 4NXML 2XGPA 4ECTA 1JXLA 2F0NA 5KT6A 5F9NA 3GO5A 2X6GA 1PFNA 4ZK9B 5E7NA 2HIXA 4RNOA 1VF5C 3IAYA 5KKNB 3MXPA 4DR6H 2PZTA 2H5XA 4CBVA 2NBFA 1LUZA 1QG7A 2MUYA 5JVH3 4JI1Q 3SDZA 2UUAH 2VQEH 2VL6A 2NN6I 3U9TA 1SYGA 2MQHA 4WFN3 3K57A 3G8CA 3CCUA 4UY8C 1VQ9A 1WH2A 4JBMA 5GADC 3RAQA 1RCVD 2NVXB 3M4IA 1DGSA 1XNQH 4LFAH 5T1GA 1TWHA 3S2HH 4LF6H 3R5HA 4O3RA 3HOVH 3NP8A 1G91A 4IUUA 1H95A 2KQ3A 4EX5A 3AMUA 2YL2A 4C3JB 3H0GB 2MNAA 1HPCA 2V4QA 2VQFL 4DAYB 1IBKL 1JJGA 3A54A 4MN3A 1EYZA 3NBIA 3KHRA 1N33L 1PXUA 4TUYF 1MHWC 5GQOA 2OTJA 3K58A 1F2LA 2F0VA 3AEVA 1EZ8A 1DXMA 1KLUD 3J80L 3NHHA 5K2MA 3PO2H 2C2RA 2AGPA 4KD4A 5C4ZA 1MJCA 4AH6A 5LL6X 1LTTD 3TINA 3J81E 4DL3A 1MZBA 3Q8QB 1HTLD 1L0XB 2O03A 3H15A 1LLRD 4L5QA 5C0XG 5IY0A 1HR0L 2F4VL 3GTLH 1IYUA 5ELNA 4KKSA 3HOUG 1WFQA 4GKKQ 1B33N 4J0MA 4IPDA 1CQIB 5KFAA 3GQCA 3K8AA 4DV3Q 3TIGA 4DV4L 1A8VA 1Q81C 2CWAA 4NKLA 3PV0A 2IX0A 5J2UF 4OELB 1M0WA 3H40A 2NYZD 4O3SA 2F0OA 1SE3A 3M7GA 3CVZA 2AQ4A 4YCUA 1RYRA 3N40P 4H7BA 2L15A 5KFJA 5KT4A 4NXNQ 4DPGA 1W96A 3FDSA 2BQRA 3J7ZC 1PRTF 3GTJH 3CCEA 1BVSA 5HGQA 5CV4A 2A6ED 5JJIA 2EY2A 1VQAA 4O2BF 4DR1L 1YHBA 1EEID 2VUMH 2N88A 1NBWA 3TBIB 1PTOD 3BU2A 4I7ZC 3CPFA 4MV9A 1CK1A 1YNNC 1X65A 2QEJC 5JVLA 1VQNA 1FJGH 3KFUA 3TP7A 1Q90A 2NU6B 3GIKA 1ICFB 4DR5H 4J9RA 3X3MA 3TP5A 3SEBA 2R93A 1J9OA 1PYSB 5EJWA 5C3EG 5I6WA 3LNNA 1AUXA 3F8NA 2W9CB 4JI8H 3QR8A 4K6DA 3CXCA 3T1HL 3J80i 3KXYT 3OHXC 5KNCA 3LWBA 1SXTA 4H0LC 3GTPH 4IURA 4A75A 4LMYA 2RDGA 3A8KE 1Q12A 4ECYA 2AUKA 4A3GB 2WDTA 1W6KA 4P71A 3GQBA 2E2HB 3GIQA 4QB4A 2P0AA 2XC9A 3OIQA 2F0FA 1KIXA 1HZ9A 2ASJA 3P20A 3PW5A 4A3IB 4DR2Q 3FDTA 2HHHQ 5ELDA 2Y0SE 3EBEA 2BOSA 4DV0Q 4B9XA 1A3VA 3CQZB 5KFYA 1C9OA 2QGQA 2R6FA 4ME6A 5LMNQ 3I72A 2I0QA 2AHOB 3G7LA 2MO1A 1HNZQ 2I5LX 2OWOA 1D5XC 1O80A 3A74A 2VOBA 4ZOLF 4O3NA 3RB0A 3RGXA 1GSAA 4UPAA 5KT2A 1DCZA 4BWGB 1BKBA 4X65Q 1D1KA 5D1OB 4QCLA 4JI1H 4E4TA 4X66L 1SRUA 4MTNA 2TMPA 4YB8B 4IO9A 2N78A 1SYDA 4HJ7A 1NJIC 3N43B 2SCUB 2EYOA 1RJTA 2B3GA 2C22A 1GM5A 1SAPA 5JQWA 4LF8Q 1E2VA 4R1JA 4CJ0B 1B2TA 2D0OA 4YAJB 2K50A 5COYA 2RCFA 2NVYA 1MI2A 5IP9H 3VA7A 5FJ8G 4A93B 5KFRA 1ONLA 2ALYB 3W2DA 1F9SA 1RIPA 1VQOA 1S4ZA 1I94Q 3JRWA 3I2ZA 3KJPA 4B3SQ 4IPCA 1AUVA 4EGJA 2PYKA 1VQBA 4HTHA 5IWAQ 3S1RH 3M4QA 1KNAA 4OXPA 2R8IA 4MZ9A 3PSIA 2OEOA 2YRXA 3N41B 2ZJQA 4M1UB 4F7XA 4LK1C 5IYDG 4GKJL 1WR2A 1HH2P 1BCPB 4ECUA 3PUYA 3VR3A 4EBEA 1A0IA 1PYWD 3M85A 3R93A 4L63B 5AJ3L 2Z1CA 4DXGA 1TAEA 4J8QA 3OTOH 1MSGA 4MV3A 4JI7L 5J3BA 4B3MQ 4ZYSA 3QB3A 2HVSA 4IJHA 3AQQA 3TEHB 3WOEA 4A3LG 2IJ0A 3Q8SB 2UUCQ 4DV3H 2PQAA 3SK4A 3NXWA 4KJNA 2CVRA 3MZ5A 1D8LA 1IZ6A 1E2ZA 3A56A 4ED1A 2JP1A 4GKKL 1WD0A 4DAPA 4DL4A 2MFIA 5C3WA 1EYDA 3KBXA 3H3VH 3O13A 3ULPA 3HS0C 3NE5B 3B6YA 4WJ4A 4C56C 4NXNH 4DNIA 4A3GH 1I4PA 1X3EA 4IHJF 4LFBQ 4Q44A 4UCTA 2CH4W 3P75A 2KHJA 3S14B 3J80c 5LMNW 1X6OA 2QDBA 4DR3L 2F0UA 1LT3D 1EQTA 2C2DA 4A3IH 1E1TA 3CP0A 4OX9Q 5ELOA 1WTHA 4QUFA 4A3BH 2FHTA 1EQQA 1BOSA 2DNEA 1MKHA 1SMYD 2KCNA 4P75A 2PN1A 4MV6A 5KG1A 2EY5A 1HXYD 3ND8A 1K0SA 1Q1EA 3VPCA 3G48A 3V2TA 2UVUA 1KDCA 1V8QA 1EY6A 3IRBA 4KHZA 1IBLQ 3TZDA 2UXBQ 1DOMA 2K5QA 3E6ZX 3ERSX 3MXUA 5KX5F 4A3DH 2WP8J 1DV1A 1L1OB 1RF2D 1RJRA 2M00A 1EQVA 3WNZA 4TQSA 3ND9A 2G9HD 1I5FA 4YJ3F 2GPSA 3BG3A 4YR2A 1Y1WH 5CC4A 3S1QB 1IKMA 4OWTB 1X56A 5L1IA 3UDXA 3LWUA 2K6AA 1HNXL 5IT9W 1YI2A 4P72A 1VQGA 4FS2A 1HQRD 1UNSA 5A35A 3E9HA 4APMA 3CRLC 3M9OB 1EY5A 4K2LA 4A93H 4DR4L 5L37A 4FU0A 2HHHH 4R9WA 3NQIA 3RB4A 1UE5A 2JA6B 2XCPA 1IL8A 4DV0H 1BR9A 1TS4A 1ZKOA 5LMNH 2QEXA 2DZDA 4DR2L 4BBSG 2K03A 1HNZH 2K14A 2Q2HA 1VQCA 3GIIA 4DV6Q 2GN5A 5C44G 1RL2A 4NP5A 2XGTA 3A7AB 4DUZL 4JVZA 4KY6A 2AWNA 4PWQA 3I90A 4BBRG 3WOFA 2ZM6Q 5G3LF 4X65H 3PUVA 1CKNB 4DK3C 1L0WA 3IL8A 2R7KA 5FOBB 2K5WA 3BZKA 4U7CA 3VYRA 1ULZA 3N52A 3LP8A 4HNVA 2RGVA 5KFNA 5EAYA 3OYYA 3RV4A 2RVLA 1K73C 3SE0A 4IFDJ 1MIUA 1T94A 1IBMH 4KY5A 3GTQA 2M9VA 5K36H 3MA2B 3KBGA 1N36L 2HDLA 1SNCA 2YTYA 4JI5Q 4HYKA 4ZHQF 1A2UA 1FNVA 1RKNA 2H1EA 4LF8L 1BXTA 3HZXA 1B7YB 1KAWA 1I94H 5LMUQ 4B3SH 3FMCA 1G291 4RAUC 4ZKBB 4EFBA 2XVSA 2E2IB 2VZAA 5IT9L 5CA0F 1DD2A 2L12A 1AEXA 5IWAH 4RZQA 3I4MB 4UHVA 2IY5B 1DOLA 4EQOA 2NVQB 2BE5D 2NVTB 5CORA 1HFNA 3T5HA 4ZKCB 3PUWA 3PMFA 1U5KA 2OCEA 4RGTA 4YIJA 2F0GA 2PCFB 1VBHA 1V4YA 4GLVB 5KG4A 1B1ZA 4O3QA 4JI0Q 3OUUA 4JPBW 1TY2A 4CJ2C 1UE7A 1EY0A 4BS9A 4CGYB 5D65A 1JLLB 3QO2A 1XMQL 4B3MH 4XT3B 3DWQA 1JMCA 2RGRA 2UUCH 3HOZG 2ZJTA 2EJFC 1ET9A 4Z9CB 4HCEA 2PMZE 4HJ9A 1E2WA 2KUMA 4A3KG 5EOYA 4FYDA 4RUAA 2JEBI 2XWBB 2OT2A 1PTOB 3EA6A 3S1QH 1PRTD 1LTLA 4RZRA 4IRKA 1KNEA 4LFBH 1KHIA 5KT3A 2PQEA 2OQKA 2FXQA 2V4RA 4MNOA 2VPSA 2J7ZA 4DV1L 4X62Q 2IHFA 1ASYA 4OWWB 2FLNA 4BBRB 1VQMA 2WB1B 4OX9H 1STHA 3IFTA 2ALZA 1TWFH 1YHAA 5M5WB 2JEJA 1YJNA 2JA6H 2Q8RE 5FO9B 4QQBX 2YZGA 5FLMH 1XWEA 1N56A 3G6EA 4NLGA 3S15B 5D8DA 3T1YQ 3R5FA 1KDAA 3WO1A 4BY1H 1EOVA 4DV7L 4DV5L 1GGOA 4R4OA 2R92G 1IBLH 2Z0SA 1QNUA 2UXBH 2K05A 1FVIA 1KL9A 1KTKA 1EOTA 1TWCH 4X3TA 4RMFA 3GLKA 1A9XA 3W1BA 5C4XG 2JK8A 4ZUJA 5HBRB 1HNWQ 3EJIA 3KLRA 4P2CB 3UDIA 3PW4A 1YEZA 4YR0A 3J7AK 1I50H 2DPIA 3HKZE 5IGGA 3TN2A 2GPWA 4JI3H 1JOKA 4I65A 4X6AH 1PH9A 3C2PA 3M4PA 3J81j 4YY3H 1XPOA 4G4KA 3ER0A 4GN5A 2BQ3A 3KYHC 3NQTA 1VQKA 5KFQA 2KA7A 2Q2IA 2HGSA 3I70A 1PH8A 4A3MH 5CBAE 1O75A 5KYLA 1Q7YC 1PLFA 1PYBA 2Z4HA 4JBJA 1E1OA 2LY7A 4K5VA 3HP3A 3GTKB 1AN7A 1KC7A 5L1KA 2E2IH 3NWTA 4DV6H 2RA4A 3HOZB 3P7JA 3KJOA 3I4MH 2NUCA 1JC7A 2YU9A 3PN1A 4NXMQ 2ZM6H 3GTLA 3FEWX 5KFBA 4A3KB 2NVTH 4F50A 4LSXA 2HIVA 3KALA 1QWYA 2V58A 1B8AA 3HKZA 3MR6A 1PV4A 2RDFA 2VW9A 4K8IA 4RGMA 5A2QW 3UQ8A 4HCSA 1LTSD 1TXYA 1N8RC 3E5SA 4TV9F 4RB1A 4UCOA 2AKWB 2B8GA 4YWKA 4R8NA 4JI4H 2G5DA 1K9MC 4EGQA 4ZAIA 3Q0AA 2N55A 3CAMA 1UC8A 2EXDA 4GNXC 2RSNA 1XXGA 4ULLA 3BYTB 1H9SA 4JI5H 5KG7A 2OF1A 2IA6A 4OO1G 1C48A 3CPWA 1SBBB 3GTJA 2QKIC 2F0MA 1H9RA 4MIUA 5ISRA 5M3MH 2VQDA 3A8IE 1T9HA 5KFWA 4KN4C 4UP7A 3I12A 5JPNC 5LMUH 3Q2OA 4C3IG 1R9TB 3GD7A 1FKAH 5KEEA 5KFCA 3DLLA 5J22A 1IBKQ 2R92B 1ASZA 1LV9A 1PA6A 4IAJA 1GYFA 3BABA 3FKIB 1N33Q 4H13C 1ZHQA 5BPFA 5C4XB 3MWDA 3KLSX 1L2FA 2FFKB 4IFDH 3H91A 4EGVA 4JI0H 1BF4A 3OPOA 4LFCL 5FD5A 4XYQA 4WJ3M 5LYJF 4ED2A 3S15H 2F1MA 3GTPA 2W6ZA 1VQDA 5CA1F 4C2MB 5CR3A 5E1FA 1UE1A 1K8MA 2ICIA 1C4QA 2EYJA 3QIAA 4JG2A 2B63G 2F4VQ 4U6PA 4MV4A 2EPBA 1CE8A 2J6SA 2NWGA 2KCCA 1EHIA 2R7ZH 3H3VC 2R61A 4LUZA 1CQJB 1E3PA 3PVXA 1BBUA 5I6YA 4JV1A 4CDFC 4DV4Q 2UUBL 4KHVA 2SEBD 4IWXA 5A2QL 4YR3A 1E4EA 4HJ8A 3CD6A 2HCIA 3PCOB 3TQYA 1HCZA 2ASBA 2R8KA 5EDWA 4XXEA 1PK8A 5KFDA 2K33A 1VKZA 1B4OA 4HSVA 3NWSA 3CF5A 2PO4A 1I4GA 4DNRB 1TWAH 4IQZA 3QZ8A 2F0WA 4ED3A 1XNRL 4DR1Q 3JAML 5FLXL 1SYCA 2PNRC 3GTKH 2NN6H 2IWHA 2A19A 4K8JA 4ODGA 4O42A 4O2DA 3MEFA 1D7QA 3BAAA 3T1YH 3D6WA 1LACA 2Z4IA 4FXKC 2DY7A 1II3A 2NU7B 3N8DA 2F3WA 3G6YA 1LT6D 2CW0D 1YNJD 2QILA 5GROA 2NUAB 4AYBG 5KFKA 4MV1A 1BBWA 1JIHA 3K81C 1HNWH 2K01A 3VR4A 3T1HQ 2OTLA 1IHZA 1KXLA 3KUPA 2XRQD 1QUQB 2EJMA 2E2JB 4A4IA 4GNXA 2W8KA 3AFQA 3HOYG 1JOOA 2B2UC 4C3IB 3GIDA 1ZQ7A 3CKIB 2KECA 1XYIA 5EZYF 2ZXPA 4OEMB 1B3QA 2E5LL 3S1NH 1GUTA 3TDQA 5F2DA 4LF9H 1C8CA 2WKDA 4QIWA 1AP0A 3L7ZC 2LMCB 3NTHA 2DN8A 4C3HG 1KJ8A 1BXRA 3J80W 1SFOA 1A62A 3H4DA 3S16B 1NY4A 4K0KQ 5KFHA 3U9OA 3CCRA 1HTPA 3FRPB 1SE4A 4DN4M 5KGUA 2B63B 3OSOA 4NXMH 1JWSD 3MR5A 5CV6A 4AQYL 2AGQA 3GTGA 4R4QA 2BDNA 2JA9A 3EN2A 1I3QB 2UVWA 3MR3A 3L2PA 1WTRA 3H4BA 2HQLA 5IE8A 4GOPA 1S72A 3V6KA 4L1KA 1V1QA 4DGZA 3I56A 4X66Q 1S5ED 4UP8A 2F0HA 3ETJA 1M7JA 4Q43A 1K83B 4TV8F 4ZQIA 3C1EA 3KLWA 4H02A 2SOBA 2WTFA 2X6LA 4A3EH 3V4ZA 1BNCA 4ETSA 4DL7A 2C2EA 1JKJB 1Z2OX 4J9OA 5ELBA 1SLJA 3SVMA 1CKMA 1NCVA 1V1OA 1LM0A 2VQFH 3K5IA 2XGQA 1IBKH 1VQFA 1QCBD 4LF4L 3SE7A 1K3RA 1N33H 4AYBB 5KT5A 1Z7TA 4QUCA 2AWOA 1U4RA 1BBXC 4APVA 1Q3LA 4JYAL 2JA8G 2L55A 4IR9A 5M5XB 4JV5L 3C46A 3HOYB 4GKJQ 1GSHA 1JICA 1VQ4A 4DAVA 1XJVA 4RH6A 1YNND 1HR0H 1CQFA 2W9BB 1CFMA 5AJ3Q 1PRTB 3V96A 5M5YB 1X3GA 1I6HB 1Y1WA 4LSAA 1PH3A 4JI7Q 1L1OC 1QNKA 3MJFA 4DUYL 2CWPA 4LWCA 4FF1A 1EIGA 4N8X1 5HY6A 4HIDA 4F8MA 2B2UA 1E4EB 1VQJA 3Q8RB 3KF6B 2QK4A 4LFAL 4DV4H 2EYFA 3TQTA 1CQVA 3ZJYC 2BDOA 1V1PA 3DM3A 3VA5A 2E8GA 5CAEB 3RLFA 5C0XJ 4DL2A 1S5DD 5IYCH 1WD1A 3N44B 2CH4A 5IT9E 3OW2A 3GTOB 4A3FH 4R4CA 3RZDH 1J5EQ 5KG3A 1Q46A 1OXSC 4J15A 5FLMG 1V43A 2HVRA 2VR1A 2E2DC 2L11A 4DR3Q 1UC9A 2IP4A 3K5HA 3OSNA 4JK1C 4WRDA 5JEAG 1KRTA 5EWFA 2LXKA 4QW8A 2AQ1B 2GA4B 4QWDA 2RF4A 4F88A 2IHEA 3BVGA 1F9QA 4XYLB 1C3OA 1RHPA 3M3YB 5J2TF 3S2DH 1TWGH 3R23A 2RSOA 5LHY1 2JA7H 1D5MC 1PHJA 1PX2A 3GTMB 3T1HH 5DQGA 4CHTB 1TY0A 4BXXH 1KJ9A 2X0SA 3L3OC 3ULLA 2PVPA 2W6MA 3PR4A 1ZYRC 4HR7B 4CDCC 3CU7A 2B2VC 5I9OA 4HIKA 1E22A 2DPJA 3DWPA 1K83H 2DNCA 3IFDA 1HNXQ 3T13A 2XTIA 2I87A 5HV6A 1CUKA 2A69C 1SYEA 4B9WA 1LYLA 2K5DA 2K5HA 1G2TA 1PH1A 5IP7G 1VQLA 1S5BD 4XQJA 2W70A 2JA8B 3JAMc 2BR0A 1STAA 2VB2X 3EQLC 5FLXc 2UU9L 3PO3G 3Q8DA 1YZ6A 4TQUS 4DR4Q 2NVXH 3MFIA 3EIVA 4BY7G 4JOIC 4LMQD 4XYMB 2KEEA 4B3TL 3IG0A 2PBZA 5IYZF 5C6AA 2AGOA 1FJGL 5I9PA 1ENCA 2YCHA 5JPMC 3JSNA 4OO1I 4GOPB 2NTSA 1B9NA 4L8JA 4DK1A 4IOAA 3HFZB 1T5EA 1W3SA 1WCMA 3HRZC 2YS7A 4C3JH 3H0GH 4K0KL 3FPPA 1Y8NB 4ZQ3A 4DUZQ 2ATWA 3EYYA 1S03G 2ZDQA 3T4AC 3HOUB 2CKZB 4MHEA 2J6TA 4KKUA 3I73A 4X66H 5KFGA 4DLKA 1MBYA 2R93G 5DG7A 4QL5A 1KC8C 2UVRA 2ASDA 1I6HH 3BVMA 4R4TA 2FP4B 1JB7A 3D3RA 5EWEA 3E5NA 3NBHA 5CV9A 2OH2A 1TWHB 2UXDL 1U9RA 1TS2A 2CQYA 1ZETA 1N36Q 2XRSD 3A7LA 1PFSA 4L5SA 2A68D 1TA8A 1OXVA 2B2TC 4QMGA 2H4OA 3VR2A 4K6LA 4CJ1B 2JN4A 3CCMA 1DZ1A 4IPHA 1EYGA 2XN9C 3RUZA 2JA7A 4RUCA 4R8UA 1HA6A 2Y0SA 2VNUD 3HOWG 3VMMA 4HMIA 1EY8A 2WACA 3SK5A 5L9XA 2JE6I 1KBLA 1X55A 1UEBA 2I80A 2EZVA 2YV5A 1GUGA 5J1ZA 4XYOA 2JA5A 1Y8PB 1WCMG 1YNXA 1TWCA 2BA1A 3K5OA 4GKJH 5C3EB 1SJED 3K7UC 1WTPA 2AMCB 1I50A 1VMCA 1HZBA 4JI7H 1ZXTA 1XMQQ 1N9WA 3A5UA 4FNFA 3QFFA 2EY6A 1MD2D 3I91A 4M9UA 3LWEA 2B2VA 4KN7C 2FLPA 1BO0A 1K1QA 3LGJA 5BR8L 3PO3B 2R6GA 1LO5D 2W9AA 4EBCA 2DJGC 4GKKH 2VXWA 4NDXA 2C35B 3RAXA 4BY7B 2F0PA 4LJZC 4RAZA 4IJLA 2W6OA 2Q8TA 4DR7L 1NMGA 4HJ5A 2EYPA 3TZUA 1YJ9A 2KENA 4JOIA 1XPRA 1WVLA 4DR3H 5BPHA 1K1SA 4DV1Q 3Q6SA 3NEMA 2E2HH 3IN5A 1J5EL 1SE2A 5BMVF 3K6OA 5KG6A 3S9WA 2JA5G 4UFZA 2WB1E 2R93B 2KCTA 3OTOL 1N32L 3GILA 4J9QA 4DV7Q 4DV5Q 3NELA 1WOCA 3CQZH 4DL6A 3MR2A 2A5HA 2SNSA 5CB4F 3I4NG 1GUNA 3TS0A 4J9KA 2RKSA 4YWMA 3CC4A 2MHVA 4EG0A 1ET6A 4EQNA 1F77A 5M3FG 3VYSA 1K8GA 1BCPF 3NK9A 3NUCA 3HOWB 2B39A 4DV2L 3OHAA 2B2TA 1Z47A 2SDFA 1B44D 3R2TA 3PQIA 5L1LA 1EY7A 1VMPA 3ITPA 4HNTA 4DR4H 5FO8B 1IYJB 5KNBA 4ECWA 2FK1A 4O1NA 2FLLA 1NR4A 2CQOA 5KIXA 2JEIA 4DXFA 1EUCB 1HHVA 3CCSA 1EIHA 1QVFA 4DR2H 2R87A 2VY3A 4CKEA 1M6VA 2WV6D 3QG1A 4YHHL 1H9JA 1GUSA 1G6ZA 3MWEA 4XDXA 3BA8A 4DUZH 3H20A 4CDDC 1CA5A 2V59A 4PNYA 5C3EH 3JSLA 3WDNA 2Q2TA 1YHQA 4HIMA 2M05A 2R7ZA 2FPPB 4LUOA 1DV2A 2D0PA 4ME3A 3I8ZA 5I4DA 3E3XA 5EBCA 1CHQD 3F2CA 2MPMA 1I4RA 4ECVA 3KF8A 4JI2L 3D0FA 4QWEA 1D6EC 1JJCB 2NVYB 4J9SA 3N42B 3PIOA 5KFIA 1N36H 3CMAA 1H9MA 1JQYD 1JCKB 2ZJPA 4NPSA 2EIFA 4LF8H 3LX0A 1X32A 4X64L 4Y7NB 4O4LF 1BQQT 2L5TA 4DA2A 3RB3A 1HUMA 1B6RA 5HGTA 3UE0A 2F03A 4V190 2R7MA 5C0XI 2WKCA 2DJFC 1RODA 4O2AF 5JVG3 1U4MA 2Z6BA 1EIFA 1EWIA 3BQ2A 1F2MA 1EL0A 1PZID 2O4XA 4RCNA 1S5FD 1VQIA 4TKOB 3I4NB 2LXJA 4E6IA 3S14H 1STEA 1AN8A 2JYOA 4FDBA 4EVOA 5M3FB 4XQNA 5AFWA 1ESFA 4LFCQ 1FL0A 1EY4A 1TR5A 2LS01 3CW2C 5EPJA 3M4OB 1STNA 1XMQH 4ECQA 3PW7A 4MV7A 3MAQA 2PQAB 1JT8A 3T5JA 3RBDA 3NTIA 1V9PA 4LF5L 4A3JG 2N49A 1JE5A 5L1JA 1Y1VA 2AUJD 4EBDA 3Q22A 5C4HA 1STBA 5H80A 4GN3B 4A3CH 2F0QA 1B9MA 2YYZA 4I4TF 1SSOA 2HVQA 5C8YF 4POFA 4RNMA 1N34L 2UUBQ 1M4VA 5IYBG 4RA8A 5FK9C 5FJ8H 3W3AA 2CW7A 4ZRZA 4OHJA 1W93A 1GXDC 5C3XA 3BYYB 1K8OA 1LTRD 2K1BA 1X3QA 2L4NA 4DV1H 4IR1A 3S1MB 3KOJA 1CHPD 1WTOA 5JJKA 2R7LA 4BBSB 3X3NA 3OWEB 4ECXA 5C44B 1KEEA 1JOQA 1XNRQ 4F4ZA 1SJHD 5DG8A 3J80E 1O7ZA 1P8LA 1R4QB 5IYDH 4DV7H 4DV5H 2XCAA 1GLVA 4C5CA 4DU9A 1PH7A 4GS3A 3HOXG 1B6SA 3J7A5 1JJ2A 4GC7A 2KVMA 4R8IA 4TQRA 1J6QA 2VUGA 2R86A 3RF2A 1O7YA 1Y8OB 2WAQE 4A3LH 2PMZA 1Y1VG 3OSPA 3A8JE 1D5ZC 4F87A 2W6QA 3D4RA 2R7FA 4ZLTF 3HB9A 4IUQA 3KAKA 3HGBA 4TRDA 3EPIA 3GV7B 1EQRA 2OLSA 4PMCA 2NVYH 2E5LQ 2QYZA 5GAHC 4FXDA 3C1FA 2X69A 3T51B 1HZCA 2OQ0A 1SNMA 3KAJA 2O2LD 3RIZA 4G57A 2DY8A 4X3SA 1VCIA 3CHBD 1EUDB 4C1NI 2B2YC 3BG5A 1FR3A 3EPGA 1SCUB 2EDGA 4PZ7A 4A3JB 1VBGA 4U68A 2G9DA 2IT1A 4FS1A 2ZDGA 4AQYQ 2WAQA 1NNXA 3DF7A 3K3PA 3BZCA 4N9TA 1PFMA 3H09A 3BJYA 1JX4A 2F0LA 4FBTA 4IZ8A 1EEFD 4RAYA 3PIO3 3CC7A 2NVQH 4JI3L 5CV8A 1FD7D 2RHQB 4YY3L 3OOCA 3GTQB 5CYUA 4L5RC 5KFXA 2CCZA 4RWSC 4PZ8A 5KRUA 3BDCA 4RU9A 5DEHA 4UCVA 4QWAA 3VR6A 4MA0A 4K14A 2EXZA 2IL8A 4DKAC 1ILPA 2W7PA 2FPGB 4ID6A 3HOVG 3K5MA 2HJWA 5KFOA 1PH6A 3UDFA 3JAMW 4KD3A 2UXCL 1AFPA 5FLXW 4LF4Q 4Q0YA 2XSCA 2A6HC 2FMMA 3HOXB 2UVVA 1PTOH 3I3CA 3MWYW 4BBSH 1TWGA 2VUMA 3SK6A 1ENFA 1GSOA 4DFAA 3CC2A 4UCRA 3W1GA 1VQ8A 4L6TB 3PO2G 4A2AA 3CRKC 4AYBE 4CKBA 4JYAQ 2R7NA 4EYIB 1CT1D 5E4WC 4LW1A 4FP5D 4JV5Q 4LFCH 4BBRH 3OIPA 1LTBD 2MJ8A 2ZXOA 4YCVA 1RDPD 1XMOL 5M5WH 4PMWA 4JC0A 1AE3A 4YWLA 1QE6A 3SXHA 2YW2A 3BZDB 1I6UA 1NR2A 2B8FA 2PI2E 3RFCA 5KFMA 4DUYQ 4KK7A 3HKZG 2D5DA 4LFAQ 5T14A 2UUBH 1KJQA 2FK2A 1S40A 3K0YA 2L1BA 1CM9A 2W71A 4XX0B 2NVXA 3LMLA 1T5XD 1CZWA 2IW3A 3GV6A 1JWMD 3I4OA 2FE3A 2Z6KC 4P73A 2HD3A 5FO7B 4JUZA 2RBMA 3BQ1A 3PIPA 4IZOA 2AU0A 3PUZA 1IW7C 2PW7A 1JWUD 3MFHA 3J81c 3Q23A 2B2YA 3I7FA 3H0GA 1I4XA 5EKLA 4UCSA 4DAYA 3OWFA 5KYIA 4KHPL 4X62H 3ZYYX 4JV2A 2VUMG 4RB0A 5EKIA 1Y69U 3FMAA 1LTAD 2JXMB 2XD4A 1EWHA 1KABA 4PMBA 1Q82C 3DMUA 3G71A 3CCQA 4CC5A 1M0TA 4BXXG 5CV7A 4U673 3C0FB 1X9NA 4EEQA 4OIKA 1OXUA 2N8NA 3HOZH 2ASLA 3GDEA 3UI2A 1YIJA 2EE1A 4Q45A 2K75A 3S2HB 4B3RL 4A3KH 5ELEA 1QZGA 1UNNC 4I50F 3AYHB 4H44C 3CMEA 3GTQH 1QVCA 4FF2A 2C00A 4KI0A 2E5LH 2O5IC 4MA5A 2K52A 3UE1A 1DIKA 1XTCD 4LF7L 4LH7A 3BJUA 3PO2B 4OONA 3BS1A 2UU9Q 2F0DA 3F2DA 1SYXB 3NENA 3KLSA 2HQEA 1PH2A 4MTEA 5KG5A 1EIYB 4B3TQ 4PZ6A 3MFYA 4LH6A 3VYUA 1Z9FA 4IUPA 4KJOA 3E0JA 1FJGQ 2FJ2A 3M7NA 2YU9B 1J8IA 5E3FA 3GTLB 2K7VA 4R7RA 1R9TH 4J1MA 5LXTF 2I07B 3HKZB 2R92H 1EFID 2RQXA 3FKIH 5G3LD 3UDGA 3DHQA 4C5BA 1MGSA 3HKSA 3ONAB 4KTAA 5C4XH 3R8BA 3KHGA 1EU4A 2R7DA 4JI6L 1BCPC 4IOCA 1SEIA 1E24A 2OXPA 2W9CA 5D3DA 3RTXA 4ED6A 1EU3A 1H9SB 3GV5B 3JAMi 1ML0D 4HAEA 3FVQA 1U4LA 1PMRA 3AB9A 3F2BA 1WTWA 2ICEC 4LF9L 3GTJB 4GLAC 1Q8IA 4C2MH 2BQUA 2HCCA 2WFWA 4MV8A 2UXDQ 3NGDA 1QB5D 2FMCA 5IP9G 2C28A 4RNNA 4Q8EA 2E2HA 2EYHA 3FP9A 1K3BC 3NTKA 4V0BA 3HEJA 4KKTA 4GC6A 3JRXA 4JV0A 1S0NA 3KDFA 4LF4H 3V6JA 1QILA 5D1PA 3L4KA 5IGCA 4C1NK 3TSSA 5BN4A 3RLNA 4POGA 4O4HF 4HMJA 1SMXA 4R4IA 4UAIA 1W6JA 2HT1A 4LNQA 4JYAH 1TKWB 1IKLA 3CQZA 3DEOA 3GTPB 4JV5H 2GLTA 4O4IF 1SNDA 5DLQE 4QGUA 2YZNA 2IMWP 3QJYA 3EVQA 5LL6b 5CV5A 2R84A 4FO2A 1CTMA 4HSPA 1ZHSA 2J4XA 4QY7A 3SR1A 2W6PA 1ICWA 4DR6L 4IN3A 4DUYH 1A63A 1NMFA 5IGFA 5LOVF 1TT2A 3M4YA 1I7LA 1IXRA 2VQEL 2UUAL 4B08A 1YITA 5D1OA 3D4DA 2F4VH 1XPUA 3U9SA 3STBC 3FPUB 1AZQA 2EVBA 3G6VA 3A0JA 5BR8Q 3PIP3 1KD1C 5DM63 3D8GA 1Q8KA 4YQWA 3A5ZB 4OO1H 1SNPA 1XNQL 1GUOA 1KDBA 3J7YW 4ED8A 1YBYA 2MGSA 1ZYRD 1HA5A 3U58A 4C3HB 2E2JH 1FGBD 4A3GG 4CC6A 4DR7Q 4LF6L 1GUWA 4C3IH 1F2YA 2R8JA 1STGA 4OWXB 4MAMA 4I7HA 1MSHA 2A69D 5KG0A 5DLFA 3I55A 4A3IG 3QOLA 1G51A 1X54A 1WTXA 4A3BG 1PH5A 2D9UA 2BH2A 4PV1C 5JUMA 2GVAA 4PQXA 4DR1H 1K8AC 4K2KA 2YU9H 5KT7A 4MTDA 4G7HC 5I2YA 3OTOQ 4HNUA 4RGOS 1N32Q 3MWMA 4GLXA 2DGYA 1C7YA 1K0RA 3S16H 1RK6A 4GNXB 2N3SA 3K7AB 2B63H 4A3DG 1SDFA 5JEAJ 3J7AF 2KHSA 4N8FA 5EKKA 5C4JB 3N6XA 4RHSA 2KJXA 1G8ZD 1I3QH 2ZXRA 4OL7A 1B70B 1Y1WG 3BDLA 4F4YA 1HRJA 4XIGS 4HN7A 1SE8A 3OMCA 4QIWB 1AW7A 3CCJA 4DV2Q 5KG2A 1QJOA 1HZAA 2BCOA 2CQAA 1WJJA 3S1RB 2KBNA 1X3FA 2UU9H 1OXTA 1YJWA 4A93G 1SFOB 5FPOA 1A15A 2GVBA 1CS0A 3T53B 1HUNA 4B3TH 2ENBA 4IWYA 2W6NA 1FNWA 3JZIA 3WWVA 4CDEC 2YYAA 2K04A 4ECSA 2YRWA 1BUVT 2YTVA 1TS5A 3TRZA 3F8TA 5GAGC 1DOKA 3GTGB 2NZOA 3OMGA 4ZUIA 4YHHQ 3MFGA 4K0KH 2VPQA 1CKOA 2MO0A 2XIWA 2A8VA 1BDOA 5EWGA 4DR5L 3K59A 1GHKA 2XCLA 4KLKA 4JI8L 1ENAA 1GOZA 4J9MA 2EJGC 3BVZA 1NE3A 4PDBA 5M5XH 1WTVA 4F4XA 3HOYH 4RG1A 1CSPA 1ZEQX 1L1OA 4JI2Q 2F0KA 1QZHA 1M1KC 4XZ3B 3KDFB 2UXDH 1UUPA 3GV3A 5M5YH 1F9RA 5K36G 3DXJC 4ED0A 3RR5A 3U4VA 1I4HA 1S97A 4A3BB 2QCPX 1LTGD 2A6EC 4X64Q 1C30A 3K3VA 3RLOA 2I5HA 5JVDF 1JORA 1CI3M 1PTOC 1PZJD 4C3HH 2RDHA 3EROA 1XTDA 1A3UA 1TWFA 5KFSA 2JA6A 5KFEA 1VQPA 2V4DA 5C1PA 4J9PA 1I4QA 4A3DB 4DNTB 3GTOH 4LAAA 1XX8A 3IKJA 1C0AA 5K5PA 2JJQA 3T5LA 4BA1I 2JEAI 3NSWA 1PDQA 2E74C 1AH9A 1XDNA 4O3OA 2VA2A 1Y1WB 3PF4A 2R3ZA 2KEDA 1WSCA 4A3CG 5F9LA 4K5XA 4GZYC 3HG9A 4JI1L 1CKNA 4WD3A 4LF5Q 1UEAB 1KAAA 4OIJA 1IBMQ 3M3YH 2FINB 3K7AH 1S9FA 1V1PB 1SNQA 3E0EA 5BR8H 2W8LA 2E75C 4DK6C 5KFLA 5C4JH 5KFTA 3GTMH 3DM1A 3E9IA 4ILWA 1N34Q 4O3PA 1S5CD 1U4PA 3FHWA 4DR7H 1STYA 3ETHA 3SGIA 5KFVA 1E0BA 2E76C 1SYBA 5IGEA 4FBUA 4PG3A 1SFOH 2I8CA 1J5EH 5FKAC 2JA6G 2E2IA 2CW8A 2Y0SG 2A73B 2B2WC
chains in the Genus database with same CATH topology
2F4VL 2JA8H 1P16A 3GTLH 3KOJA 5ELNA 5JJKA 3HOUG 1WFQA 3GTGH 4GKKQ 4BY1G 4IPDA 1W2BA 3K8AA 4HJ8A 3CD6A 3PCOB 4DV3Q 3TQYA 4DV4L 1A8VA 2ASBA 1XNRQ 1Q81C 2CWAA 3PV0A 2IX0A 1P8LA 2Q2UA 1FGUA 3CF5A 5IYDH 2BA0A 4YCUA 4DV3L 4GS3A 1TWAH 1PH7A 3HOXG 2L15A 1XNRL 4DR1Q 3J7A5 4NXNQ 1JJ2A 4DPGA 3GTKH 3D31A 3HOUH 3J7ZC 4DV4Q 2A19A 1D7QA 3CCEA 3GTJH 4O2DA 1BVSA 1J6QA 3K80C 3MEFA 4UP9A 5HGQA 2WAQE 4A3LH 3CCLA 1Y1VG 5JJIA 1VQAA 4DR1L 2K5VA 3F1ZA 1YHBA 2R7FA 1O7IA 5GROA 4NXNL 3AFPA 4AYBG 2VUMH 1NBWA 1BBWA 3BU2A 3K81C 4DAMA 3CPFA 3S24A 1X65A 2OTLA 1EQRA 3T1HQ 4A3MG 1TWHH 1VQNA 3KFUA 4NB3A 1KXLA 2NVYH 1QUQB 2E5LQ 2CFMA 4A4IA 5GAHC 2EQSA 4GNXA 3AFQA 3PUXA 3HOYG 1PYSB 1HZCA 5C3EG 1UWVA 1AE2A 2OQ0A 3CXCA 3T1HL 3J80i 3I4MG 2E5LL 3S1NH 3GTPH 1PVOA 1VCIA 1GO3E 4A75A 1Q12A 3L7ZC 4PZ7A 4P74A 3K0XA 4P71A 2IT1A 4JI3Q 4L5TA 3M9BA 3NBHB 4AQYQ 1U0LA 1A62A 4YY3Q 3G4SA 3BZCA 1KIXA 1NY4A 4K0KQ 1HZ9A 3CCRA 3CC7A 2NVQH 4DR2Q 2HHHQ 4JI3L 2Y0SE 4AQYL 1SN8A 4R4QA 3EBEA 2RHQB 4YY3L 2JA9A 3EN2A 5M3MG 4DV0Q 2K4KA 4JBWA 1C9OA 4L5RC 5IP7H 2QGQA 3L2PA 2CCZA 5LMNQ 4PZ8A 2I0QA 2AHOB 2HQLA 3PO3H 5IE8A 2MO1A 4GOPA 1S72A 2I5LX 1HNZQ 5H1SE 2HHHL 2I5MX 2OWOA 1V1QA 3I56A 4BY7H 2UXCQ 4X66Q 3A74A 4DV0L 4DKAC 4UP8A 3H3VI 5LMNL 4UPAA 3HOVG 1HNZL 4X65Q 1BKBA 2WB1G 3KLWA 1PH6A 4H02A 3UDFA 2UXCL 4X66L 4IFDG 1SRUA 4MTNA 4IO9A 4A3EH 4LF4Q 2N78A 4HJ7A 1NJIC 1S3OA 1SLJA 1XMOQ 2B3GA 4X65L 1CKMA 4BBSH 1GM5A 1LM0A 3CC2A 4JI4Q 3W1GA 1VQ8A 3PO2G 4LF8Q 4R1JA 4AYBE 1VQFA 2D0OA 4JYAQ 2K50A 4LF4L 2D62A 1K3RA 3U50C 5IP9H 4LW1A 2R93H 5JJLA 4JV5Q 5FJ8G 4BBRH 4YCVA 1XMOL 1WI5A 5M5WH 2R7ZG 3RN5A 4PMWA 4JC0A 2KCMA 1AE3A 2AWOA 2ALYB 4YWLA 1RIPA 4APVA 1VQOA 4JYAL 2JA8G 1IBML 1I94Q 3I2ZA 3KJPA 4B3SQ 1HR0L 2PI2E 4IPCA 1MJEA 4JV5L 4DUYQ 4GKJQ 1VQ4A 3HKZG 1XJVA 1EUJA 1VQBA 4LFAQ 5IWAQ 3S1RH 3M4QA 4OXPA 5AJ3Q 4HIOA 2F3IA 4MZ9A 2K5NA 1I94L 4B3SL 1X3GA 3PSIA 3RN2A 1S40A 1PH3A 4JI7Q 1L1OC 3HOWH 4DUYL 3VDYA 1GD7A 2CWPA 4LWCA 5IYDG 2ZJQA 1HH2P 5HY6A 4HIDA 4GKJL 1VQJA 3PUYA 3KF6B 1A0IA 3TREA 3I4OA 5IWAL 3M85A 2Z6KC 4P73A 4LFAL 5AJ3L 4KHPQ 3ZJYC 2NN6G 2ZJRA 3PIPA 4JI7L 1WCMH 5J3BA 4B3MQ 3PUZA 3DM3A 4IJHA 2E8GA 1YVCA 3AQQA 3TEHB 4ALPA 1QVGA 1M90C 2UUCQ 4A3LG 2PQAA 3RLFA 2VS1A 3I7FA 3J81c 5C0XJ 5IYCH 4KHPL 1D8LA 1IZ6A 2VUMG 4GKKL 3OW2A 4A3FH 4R4CA 2MFIA 3RZDH 4B3ML 1J5EQ 1Q46A 1OXSC 3H3VH 4J15A 5FLMG 1V43A 3ULPA 1Q82C 2UUCL 4DR3Q 3B6YA 3G71A 3CCQA 1PH4A 4WJ4A 5JEAG 1KRTA 4DNIA 4A3GH 1X3EA 2PNHA 4BXXG 2LXKA 1HJPA 2NZHA 4B3RQ 4LFBQ 1X9NA 2RF4A 2IHEA 2KHJA 5GAEC 3J80c 5LMNW 1X6OA 4YCWA 1OXUA 3J81i 2N8NA 4DR3L 3HOZH 3L0OA 3GDEA 1YIJA 1GVPA 3S2DH 2K75A 1TWGH 4A3IH 1E1TA 3CP0A 4OX9Q 5ELOA 2JA7H 4A3KH 4B3RL 4LF7Q 4A3BH 4LFBL 1QZGA 1PHJA 3AYHB 1EQQA 3TS2A 1KRSA 3CMEA 1KQSA 1MKHA 4P75A 1QVCA 3GTQH 1WYDA 4KI0A 4A76A 1OTCA 2K52A 3UE1A 4BXXH 1Q1EA 4OX9L 3G48A 3ULLA 4LF7L 3BJUA 3IRBA 4KHZA 1IBLQ 4Y7NH 4HIKA 2UXBQ 2JA5H 4OONA 3ERSX 1E22A 3FKIG 2UU9Q 4A3DH 2WP8J 1L1OB 1K83H 3F2DA 1HNXQ 3NENA 1PH2A 1VQ6A 2XTIA 1CUKA 1EIYB 4B3TQ 4PZ6A 1LYLA 1I5FA 2K5HA 3RNUA 1IBLL 1Z9FA 1PH1A 1FJGQ 5IP7G 4JCVE 1VQLA 3M7NA 1Y1WH 2UXBL 3JAMc 5FLXc 2UU9L 3PO3G 4OWTB 1X56A 3KF8B 2LSSA 3Q8DA 3UDXA 1HNXL 1YZ6A 4TQUS 1YI2A 4P72A 1R9TH 1CSQA 2NVXH 3I4NH 3EIVA 4BY7G 4JOIC 4JI6Q 4B3TL 1VQGA 4HJAA 2R92H 5M3FH 1FJGL 3E9HA 3FKIH 4OO1I 4GOPB 3UDGA 1QUQA 2ZTCA 3HKSA 1EFWA 3U4ZA 5C4XH 4A93H 4DR4L 3HFZB 4LF9Q 3M4OH 4IOAA 1W3SA 2R7DA 1UE5A 4JI6L 4C3JH 3H0GH 4IOCA 4K0KL 1E24A 4A3EG 4DUZQ 2ATWA 2A1AA 3JAMi 3ICEA 2ZTDA 2QEXA 4DR2L 3F2BA 4BBSG 2K14A 4LF9L 2CKZB 4GLAC 2Q2HA 1VQCA 4C2MH 4DV6Q 2GN5A 5C44G 2WFWA 1RL2A 2XGTA 2UXDQ 4DUZL 5IP9G 2R93G 4QL5A 2AWNA 2BH8A 1KC8C 4BBRG 2ZM6Q 2ZTEA 1I6HH 4EQ5A 3PUVA 1CKNB 4R4TA 4DK3C 3PF5A 3FP9A 1JB7A 4BA2I 1L0WA 4DV6L 2UXDL 2QA4A 3BZKA 3KDFA 1GKHA 3S1MH 1N36Q 1PFSA 2ZM6L 4L5SA 3RLNA 1OXVA 1SROA 3OYYA 5EAYA 1SMXA 3CCMA 4R4IA 4POGA 5C44H 4IPHA 1K73C 4IFDJ 1EYGA 2HT1A 1MIUA 4LNQA 2WAQG 4DR6Q 4IPGA 1N36L 3HOWG 2VNUD 2YTYA 3S17H 4QGUA 5DLQE 4JI5Q 2JE6I 4JI4L 1X55A 2VQEQ 2UUAQ 4LF8L 1UEBA 1B7YB 2YV5A 4QY7A 1KAWA 5LMUQ 4DR6L 1WCMG 1G291 1YNXA 4JI5L 2BA1A 1A63A 1NMFA 2VZAA 4XTCS 2KHIA 1XNQQ 1IXRA 2VQEL 2UUAL 4O0AA 3K7UC 2VQFQ 1YITA 5IYCG 1XPUA 1Q1BA 2AMCB 3STBC 5LMUL 3A0JA 5BR8Q 1KD1C 4A3FG 4LF6Q 2IY5B 1HZBA 1Q86C 1Q8KA 1XMQQ 3A5ZB 1N9WA 1U5KA 2B29A 2OCEA 3PUWA 3A5UA 1XNQL 4GLVB 1YBYA 4JI0Q 1G6PA 3U58A 2E2JH 4JBKA 4A3GG 1UE7A 4DR7Q 3LGJA 5BR8L 4LF6L 2R6GA 4C3IH 1XMQL 2C35B 4OWXB 1JMCA 3JC66 3HOZG 4IJLA 1HR0Q 4JI0L 3I55A 2PMZE 4HJ9A 4GOPC 4A3IG 4DR7L 1G51A 1NMGA 4HJ5A 1NTGA 4A3KG 2JA7G 1X54A 4A3BG 1PH5A 1YJ9A 2BH2A 2V1CC 2KENA 2JEBI 4JOIA 1XPRA 2GVAA 2PI2A 4DV1Q 4A3JH 1K8AC 2YU9H 4AIMA 3S1QH 3OTOQ 3NEMA 2E2HH 1LTLA 1N32Q 4GLXA 1Y14B 2DGYA 1J5EL 1KHIA 1C7YA 5IT9c 1K0RA 3S16H 2OQKA 1VS0A 2FXQA 4MNOA 4GNXB 1UE6A 2N3SA 2WB1E 3KF6A 4DV1L 1VQHA 5IYBH 1VQ5A 2JA5G 5JEAJ 2B63H 4A3DG 4X62Q 2IHFA 2KCTA 3OTOL 1ASYA 4OWWB 1N32L 1VQMA 1TWFH 1YHAA 4DV7Q 4DV5Q 2RHSB 1YJNA 2JA6H 3NELA 1I3QH 1WOCA 3CQZH 5FLMH 4QQBX 1B70B 1Y1WG 4QIWE 4QJFA 3PGZA 2RCNA 4XIGS 4X62L 2ID0A 3G6EA 3TS0A 3I4NG 1SE8A 2YTXA 3T1YQ 1IL2A 4YWMA 4LUVA 3CCJA 1EOVA 4DV2Q 4DV7L 4DV5L 3CC4A 4BY1H 4R4OA 2R92G 5M3FG 2Z0SA 1HZAA 1WJJA 1K8GA 1SR3A 2KBNA 1FVIA 1KL9A 1X3FA 1TWCH 4RMFA 1OXTA 1YJWA 3W1BA 5C4XG 4A93G 2JK8A 2GVBA 3T1YL 4DV2L 1HNWQ 3H0GG 3UDIA 1YEZA 1VQ7A 1Z47A 1I50H 3WWVA 4DR5Q 3HOXH 4TVAB 4DR4Q 2YTVA 3HKZE 3TRZA 2JQOA 3F8TA 5GAGC 2NZOA 2IX1A 1OXXK 1IYJB 4X6AH 4YHHQ 1HNWL 1PH9A 3M4PA 4JI8Q 3J81j 1XPOA 1CKOA 2MO0A 2ES2A 1Y1VH 3ER0A 4GN5A 2A8VA 2CQOA 3KYHC 4DR5L 1VQKA 3CCSA 1QVFA 2VY3A 4IFDI 2Q2IA 4KLKA 4YHHL 4JI8L 2F52A 1PH8A 4A3MH 1NE3A 1Q7YC 4Y52H 1PYBA 2DUDA 4JBJA 1E1OA 3STBD 5M5XH 3RZOH 3HOYH 4RG1A 1CSPA 1L1OA 4JI2Q 1VQEA 2E2IH 5C3EH 3MXNB 3ULJA 2Q2TA 1QZHA 1YHQA 4HIMA 1M1KC 3KDFB 4LUOA 2D0PA 4ME3A 5M5YH 2Z6KA 3KJOA 3CCVA 3I4MH 5K36G 4NXMQ 3F2CA 3RR5A 3U4VA 1E7ZA 4JI2L 2NVTH 1HR0W 3D0FA 4GN4B 3W5OA 2HIVA 1JJCB 4X64Q 1B8AA 3RLOA 1PV4A 2I5HA 2VW9A 4C3HH 3PIOA 1N8RC 1TXYA 4NXML 3CMAA 2ZJPA 2AKWB 1XTDA 4YWKA 4NPSA 2EIFA 1K9MC 3GO5A 4X64L 3CAMA 2EXDA 4GNXC 1VQPA 5E7NA 2HIXA 3UE0A 3GTOH 2H5XA 5C0XI 4OO1G 1LUZA 3CPWA 1C0AA 2JJQA 4JI1Q 4BA1I 2JEAI 2VL6A 1AH9A 2NN6I 1EIFA 1EWIA 2MQHA 1T9HA 5M3MH 3CCUA 4UP7A 4UY8C 3PF4A 1VQ9A 4JBMA 5GADC 1VQIA 4A3CG 3GD7A 2LXJA 1DGSA 3S14H 4JI1L 1CKNA 4FDBA 3DLLA 1IBKQ 4LF5Q 1ASZA 1PA6A 1IBMQ 3M3YH 3K7AH 3S2HH 1N33Q 3E0EA 1FL0A 4LFCQ 3CW2C 3HOVH 1H95A 4DK6C 4EX5A 5C4JH 1L2FA 2PQAB 1JT8A 3GTMH 2MNAA 3E9IA 2VQFL 1N34Q 1V9PA 4DAYB 1IBKL 4LF5L 4A3JG 2N49A 1JE5A 1JJGA 3FHWA 1N33L 4LFCL 4WJ3M 4GN3B 4A3CH 3S15H 2YYZA 5GQOA 2OTJA 1VQDA 3SGIA 3AEVA 4POFA 1UE1A 1N34L 3PO2H 2UUBQ 2F4VQ 4JG2A 5IYBG 2B63G 1MJCA 4AH6A 4PG3A 5FJ8H 1SFOH 2JA6G 2R7ZH 4LUZA 3H15A 1E3PA 1BBUA 2Y0SG 4L5QA 5C0XG 2UUBL 5IY0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F4V L;  2JA8 H;  1P16 A;  3GTL H;  3KOJ A;  5ELN A;  5JJK A;  3HOU G;  1WFQ A;  3GTG H;  4GKK Q;  4BY1 G;  4IPD A;  1W2B A;  3K8A A;  4HJ8 A;  3CD6 A;  3PCO B;  4DV3 Q;  3TQY A;  4DV4 L;  1A8V A;  2ASB A;  1XNR Q;  1Q81 C;  2CWA A;  3PV0 A;  2IX0 A;  1P8L A;  2Q2U A;  1FGU A;  3CF5 A;  5IYD H;  2BA0 A;  4YCU A;  4DV3 L;  4GS3 A;  1TWA H;  1PH7 A;  3HOX G;  2L15 A;  1XNR L;  4DR1 Q;  3J7A 5;  4NXN Q;  1JJ2 A;  4DPG A;  3GTK H;  3D31 A;  3HOU H;  3J7Z C;  4DV4 Q;  2A19 A;  1D7Q A;  3CCE A;  3GTJ H;  4O2D A;  1BVS A;  1J6Q A;  3K80 C;  3MEF A;  4UP9 A;  5HGQ A;  2WAQ E;  4A3L H;  3CCL A;  1Y1V G;  5JJI A;  1VQA A;  4DR1 L;  2K5V A;  3F1Z A;  1YHB A;  2R7F A;  1O7I A;  5GRO A;  4NXN L;  3AFP A;  4AYB G;  2VUM H;  1NBW A;  1BBW A;  3BU2 A;  3K81 C;  4DAM A;  3CPF A;  3S24 A;  1X65 A;  2OTL A;  1EQR A;  3T1H Q;  4A3M G;  1TWH H;  1VQN A;  3KFU A;  4NB3 A;  1KXL A;  2NVY H;  1QUQ B;  2E5L Q;  2CFM A;  4A4I A;  5GAH C;  2EQS A;  4GNX A;  3AFQ A;  3PUX A;  3HOY G;  1PYS B;  1HZC A;  5C3E G;  1UWV A;  1AE2 A;  2OQ0 A;  3CXC A;  3T1H L;  3J80 i;  3I4M G;  2E5L L;  3S1N H;  3GTP H;  1PVO A;  1VCI A;  1GO3 E;  4A75 A;  1Q12 A;  3L7Z C;  4PZ7 A;  4P74 A;  3K0X A;  4P71 A;  2IT1 A;  4JI3 Q;  4L5T A;  3M9B A;  3NBH B;  4AQY Q;  1U0L A;  1A62 A;  4YY3 Q;  3G4S A;  3BZC A;  1KIX A;  1NY4 A;  4K0K Q;  1HZ9 A;  3CCR A;  3CC7 A;  2NVQ H;  4DR2 Q;  2HHH Q;  4JI3 L;  2Y0S E;  4AQY L;  1SN8 A;  4R4Q A;  3EBE A;  2RHQ B;  4YY3 L;  2JA9 A;  3EN2 A;  5M3M G;  4DV0 Q;  2K4K A;  4JBW A;  1C9O A;  4L5R C;  5IP7 H;  2QGQ A;  3L2P A;  2CCZ A;  5LMN Q;  4PZ8 A;  2I0Q A;  2AHO B;  2HQL A;  3PO3 H;  5IE8 A;  2MO1 A;  4GOP A;  1S72 A;  2I5L X;  1HNZ Q;  5H1S E;  2HHH L;  2I5M X;  2OWO A;  1V1Q A;  3I56 A;  4BY7 H;  2UXC Q;  4X66 Q;  3A74 A;  4DV0 L;  4DKA C;  4UP8 A;  3H3V I;  5LMN L;  4UPA A;  3HOV G;  1HNZ L;  4X65 Q;  1BKB A;  2WB1 G;  3KLW A;  1PH6 A;  4H02 A;  3UDF A;  2UXC L;  4X66 L;  4IFD G;  1SRU A;  4MTN A;  4IO9 A;  4A3E H;  4LF4 Q;  2N78 A;  4HJ7 A;  1NJI C;  1S3O A;  1SLJ A;  1XMO Q;  2B3G A;  4X65 L;  1CKM A;  4BBS H;  1GM5 A;  1LM0 A;  3CC2 A;  4JI4 Q;  3W1G A;  1VQ8 A;  3PO2 G;  4LF8 Q;  4R1J A;  4AYB E;  1VQF A;  2D0O A;  4JYA Q;  2K50 A;  4LF4 L;  2D62 A;  1K3R A;  3U50 C;  5IP9 H;  4LW1 A;  2R93 H;  5JJL A;  4JV5 Q;  5FJ8 G;  4BBR H;  4YCV A;  1XMO L;  1WI5 A;  5M5W H;  2R7Z G;  3RN5 A;  4PMW A;  4JC0 A;  2KCM A;  1AE3 A;  2AWO A;  2ALY B;  4YWL A;  1RIP A;  4APV A;  1VQO A;  4JYA L;  2JA8 G;  1IBM L;  1I94 Q;  3I2Z A;  3KJP A;  4B3S Q;  1HR0 L;  2PI2 E;  4IPC A;  1MJE A;  4JV5 L;  4DUY Q;  4GKJ Q;  1VQ4 A;  3HKZ G;  1XJV A;  1EUJ A;  1VQB A;  4LFA Q;  5IWA Q;  3S1R H;  3M4Q A;  4OXP A;  5AJ3 Q;  4HIO A;  2F3I A;  4MZ9 A;  2K5N A;  1I94 L;  4B3S L;  1X3G A;  3PSI A;  3RN2 A;  1S40 A;  1PH3 A;  4JI7 Q;  1L1O C;  3HOW H;  4DUY L;  3VDY A;  1GD7 A;  2CWP A;  4LWC A;  5IYD G;  2ZJQ A;  1HH2 P;  5HY6 A;  4HID A;  4GKJ L;  1VQJ A;  3PUY A;  3KF6 B;  1A0I A;  3TRE A;  3I4O A;  5IWA L;  3M85 A;  2Z6K C;  4P73 A;  4LFA L;  5AJ3 L;  4KHP Q;  3ZJY C;  2NN6 G;  2ZJR A;  3PIP A;  4JI7 L;  1WCM H;  5J3B A;  4B3M Q;  3PUZ A;  3DM3 A;  4IJH A;  2E8G A;  1YVC A;  3AQQ A;  3TEH B;  4ALP A;  1QVG A;  1M90 C;  2UUC Q;  4A3L G;  2PQA A;  3RLF A;  2VS1 A;  3I7F A;  3J81 c;  5C0X J;  5IYC H;  4KHP L;  1D8L A;  1IZ6 A;  2VUM G;  4GKK L;  3OW2 A;  4A3F H;  4R4C A;  2MFI A;  3RZD H;  4B3M L;  1J5E Q;  1Q46 A;  1OXS C;  3H3V H;  4J15 A;  5FLM G;  1V43 A;  3ULP A;  1Q82 C;  2UUC L;  4DR3 Q;  3B6Y A;  3G71 A;  3CCQ A;  1PH4 A;  4WJ4 A;  5JEA G;  1KRT A;  4DNI A;  4A3G H;  1X3E A;  2PNH A;  4BXX G;  2LXK A;  1HJP A;  2NZH A;  4B3R Q;  4LFB Q;  1X9N A;  2RF4 A;  2IHE A;  2KHJ A;  5GAE C;  3J80 c;  5LMN W;  1X6O A;  4YCW A;  1OXU A;  3J81 i;  2N8N A;  4DR3 L;  3HOZ H;  3L0O A;  3GDE A;  1YIJ A;  1GVP A;  3S2D H;  2K75 A;  1TWG H;  4A3I H;  1E1T A;  3CP0 A;  4OX9 Q;  5ELO A;  2JA7 H;  4A3K H;  4B3R L;  4LF7 Q;  4A3B H;  4LFB L;  1QZG A;  1PHJ A;  3AYH B;  1EQQ A;  3TS2 A;  1KRS A;  3CME A;  1KQS A;  1MKH A;  4P75 A;  1QVC A;  3GTQ H;  1WYD A;  4KI0 A;  4A76 A;  1OTC A;  2K52 A;  3UE1 A;  4BXX H;  1Q1E A;  4OX9 L;  3G48 A;  3ULL A;  4LF7 L;  3BJU A;  3IRB A;  4KHZ A;  1IBL Q;  4Y7N H;  4HIK A;  2UXB Q;  2JA5 H;  4OON A;  3ERS X;  1E22 A;  3FKI G;  2UU9 Q;  4A3D H;  2WP8 J;  1L1O B;  1K83 H;  3F2D A;  1HNX Q;  3NEN A;  1PH2 A;  1VQ6 A;  2XTI A;  1CUK A;  1EIY B;  4B3T Q;  4PZ6 A;  1LYL A;  1I5F A;  2K5H A;  3RNU A;  1IBL L;  1Z9F A;  1PH1 A;  1FJG Q;  5IP7 G;  4JCV E;  1VQL A;  3M7N A;  1Y1W H;  2UXB L;  3JAM c;  5FLX c;  2UU9 L;  3PO3 G;  4OWT B;  1X56 A;  3KF8 B;  2LSS A;  3Q8D A;  3UDX A;  1HNX L;  1YZ6 A;  4TQU S;  1YI2 A;  4P72 A;  1R9T H;  1CSQ A;  2NVX H;  3I4N H;  3EIV A;  4BY7 G;  4JOI C;  4JI6 Q;  4B3T L;  1VQG A;  4HJA A;  2R92 H;  5M3F H;  1FJG L;  3E9H A;  3FKI H;  4OO1 I;  4GOP B;  3UDG A;  1QUQ A;  2ZTC A;  3HKS A;  1EFW A;  3U4Z A;  5C4X H;  4A93 H;  4DR4 L;  3HFZ B;  4LF9 Q;  3M4O H;  4IOA A;  1W3S A;  2R7D A;  1UE5 A;  4JI6 L;  4C3J H;  3H0G H;  4IOC A;  4K0K L;  1E24 A;  4A3E G;  4DUZ Q;  2ATW A;  2A1A A;  3JAM i;  3ICE A;  2ZTD A;  2QEX A;  4DR2 L;  3F2B A;  4BBS G;  2K14 A;  4LF9 L;  2CKZ B;  4GLA C;  2Q2H A;  1VQC A;  4C2M H;  4DV6 Q;  2GN5 A;  5C44 G;  2WFW A;  1RL2 A;  2XGT A;  2UXD Q;  4DUZ L;  5IP9 G;  2R93 G;  4QL5 A;  2AWN A;  2BH8 A;  1KC8 C;  4BBR G;  2ZM6 Q;  2ZTE A;  1I6H H;  4EQ5 A;  3PUV A;  1CKN B;  4R4T A;  4DK3 C;  3PF5 A;  3FP9 A;  1JB7 A;  4BA2 I;  1L0W A;  4DV6 L;  2UXD L;  2QA4 A;  3BZK A;  3KDF A;  1GKH A;  3S1M H;  1N36 Q;  1PFS A;  2ZM6 L;  4L5S A;  3RLN A;  1OXV A;  1SRO A;  3OYY A;  5EAY A;  1SMX A;  3CCM A;  4R4I A;  4POG A;  5C44 H;  4IPH A;  1K73 C;  4IFD J;  1EYG A;  2HT1 A;  1MIU A;  4LNQ A;  2WAQ G;  4DR6 Q;  4IPG A;  1N36 L;  3HOW G;  2VNU D;  2YTY A;  3S17 H;  4QGU A;  5DLQ E;  4JI5 Q;  2JE6 I;  4JI4 L;  1X55 A;  2VQE Q;  2UUA Q;  4LF8 L;  1UEB A;  1B7Y B;  2YV5 A;  4QY7 A;  1KAW A;  5LMU Q;  4DR6 L;  1WCM G;  1G29 1;  1YNX A;  4JI5 L;  2BA1 A;  1A63 A;  1NMF A;  2VZA A;  4XTC S;  2KHI A;  1XNQ Q;  1IXR A;  2VQE L;  2UUA L;  4O0A A;  3K7U C;  2VQF Q;  1YIT A;  5IYC G;  1XPU A;  1Q1B A;  2AMC B;  3STB C;  5LMU L;  3A0J A;  5BR8 Q;  1KD1 C;  4A3F G;  4LF6 Q;  2IY5 B;  1HZB A;  1Q86 C;  1Q8K A;  1XMQ Q;  3A5Z B;  1N9W A;  1U5K A;  2B29 A;  2OCE A;  3PUW A;  3A5U A;  1XNQ L;  4GLV B;  1YBY A;  4JI0 Q;  1G6P A;  3U58 A;  2E2J H;  4JBK A;  4A3G G;  1UE7 A;  4DR7 Q;  3LGJ A;  5BR8 L;  4LF6 L;  2R6G A;  4C3I H;  1XMQ L;  2C35 B;  4OWX B;  1JMC A;  3JC6 6;  3HOZ G;  4IJL A;  1HR0 Q;  4JI0 L;  3I55 A;  2PMZ E;  4HJ9 A;  4GOP C;  4A3I G;  4DR7 L;  1G51 A;  1NMG A;  4HJ5 A;  1NTG A;  4A3K G;  2JA7 G;  1X54 A;  4A3B G;  1PH5 A;  1YJ9 A;  2BH2 A;  2V1C C;  2KEN A;  2JEB I;  4JOI A;  1XPR A;  2GVA A;  2PI2 A;  4DV1 Q;  4A3J H;  1K8A C;  2YU9 H;  4AIM A;  3S1Q H;  3OTO Q;  3NEM A;  2E2H H;  1LTL A;  1N32 Q;  4GLX A;  1Y14 B;  2DGY A;  1J5E L;  1KHI A;  1C7Y A;  5IT9 c;  1K0R A;  3S16 H;  2OQK A;  1VS0 A;  2FXQ A;  4MNO A;  4GNX B;  1UE6 A;  2N3S A;  2WB1 E;  3KF6 A;  4DV1 L;  1VQH A;  5IYB H;  1VQ5 A;  2JA5 G;  5JEA J;  2B63 H;  4A3D G;  4X62 Q;  2IHF A;  2KCT A;  3OTO L;  1ASY A;  4OWW B;  1N32 L;  1VQM A;  1TWF H;  1YHA A;  4DV7 Q;  4DV5 Q;  2RHS B;  1YJN A;  2JA6 H;  3NEL A;  1I3Q H;  1WOC A;  3CQZ H;  5FLM H;  4QQB X;  1B70 B;  1Y1W G;  4QIW E;  4QJF A;  3PGZ A;  2RCN A;  4XIG S;  4X62 L;  2ID0 A;  3G6E A;  3TS0 A;  3I4N G;  1SE8 A;  2YTX A;  3T1Y Q;  1IL2 A;  4YWM A;  4LUV A;  3CCJ A;  1EOV A;  4DV2 Q;  4DV7 L;  4DV5 L;  3CC4 A;  4BY1 H;  4R4O A;  2R92 G;  5M3F G;  2Z0S A;  1HZA A;  1WJJ A;  1K8G A;  1SR3 A;  2KBN A;  1FVI A;  1KL9 A;  1X3F A;  1TWC H;  4RMF A;  1OXT A;  1YJW A;  3W1B A;  5C4X G;  4A93 G;  2JK8 A;  2GVB A;  3T1Y L;  4DV2 L;  1HNW Q;  3H0G G;  3UDI A;  1YEZ A;  1VQ7 A;  1Z47 A;  1I50 H;  3WWV A;  4DR5 Q;  3HOX H;  4TVA B;  4DR4 Q;  2YTV A;  3HKZ E;  3TRZ A;  2JQO A;  3F8T A;  5GAG C;  2NZO A;  2IX1 A;  1OXX K;  1IYJ B;  4X6A H;  4YHH Q;  1HNW L;  1PH9 A;  3M4P A;  4JI8 Q;  3J81 j;  1XPO A;  1CKO A;  2MO0 A;  2ES2 A;  1Y1V H;  3ER0 A;  4GN5 A;  2A8V A;  2CQO A;  3KYH C;  4DR5 L;  1VQK A;  3CCS A;  1QVF A;  2VY3 A;  4IFD I;  2Q2I A;  4KLK A;  4YHH L;  4JI8 L;  2F52 A;  1PH8 A;  4A3M H;  1NE3 A;  1Q7Y C;  4Y52 H;  1PYB A;  2DUD A;  4JBJ A;  1E1O A;  3STB D;  5M5X H;  3RZO H;  3HOY H;  4RG1 A;  1CSP A;  1L1O A;  4JI2 Q;  1VQE A;  2E2I H;  5C3E H;  3MXN B;  3ULJ A;  2Q2T A;  1QZH A;  1YHQ A;  4HIM A;  1M1K C;  3KDF B;  4LUO A;  2D0P A;  4ME3 A;  5M5Y H;  2Z6K A;  3KJO A;  3CCV A;  3I4M H;  5K36 G;  4NXM Q;  3F2C A;  3RR5 A;  3U4V A;  1E7Z A;  4JI2 L;  2NVT H;  1HR0 W;  3D0F A;  4GN4 B;  3W5O A;  2HIV A;  1JJC B;  4X64 Q;  1B8A A;  3RLO A;  1PV4 A;  2I5H A;  2VW9 A;  4C3H H;  3PIO A;  1N8R C;  1TXY A;  4NXM L;  3CMA A;  2ZJP A;  2AKW B;  1XTD A;  4YWK A;  4NPS A;  2EIF A;  1K9M C;  3GO5 A;  4X64 L;  3CAM A;  2EXD A;  4GNX C;  1VQP A;  5E7N A;  2HIX A;  3UE0 A;  3GTO H;  2H5X A;  5C0X I;  4OO1 G;  1LUZ A;  3CPW A;  1C0A A;  2JJQ A;  4JI1 Q;  4BA1 I;  2JEA I;  2VL6 A;  1AH9 A;  2NN6 I;  1EIF A;  1EWI A;  2MQH A;  1T9H A;  5M3M H;  3CCU A;  4UP7 A;  4UY8 C;  3PF4 A;  1VQ9 A;  4JBM A;  5GAD C;  1VQI A;  4A3C G;  3GD7 A;  2LXJ A;  1DGS A;  3S14 H;  4JI1 L;  1CKN A;  4FDB A;  3DLL A;  1IBK Q;  4LF5 Q;  1ASZ A;  1PA6 A;  1IBM Q;  3M3Y H;  3K7A H;  3S2H H;  1N33 Q;  3E0E A;  1FL0 A;  4LFC Q;  3CW2 C;  3HOV H;  1H95 A;  4DK6 C;  4EX5 A;  5C4J H;  1L2F A;  2PQA B;  1JT8 A;  3GTM H;  2MNA A;  3E9I A;  2VQF L;  1N34 Q;  1V9P A;  4DAY B;  1IBK L;  4LF5 L;  4A3J G;  2N49 A;  1JE5 A;  1JJG A;  3FHW A;  1N33 L;  4LFC L;  4WJ3 M;  4GN3 B;  4A3C H;  3S15 H;  2YYZ A;  5GQO A;  2OTJ A;  1VQD A;  3SGI A;  3AEV A;  4POF A;  1UE1 A;  1N34 L;  3PO2 H;  2UUB Q;  2F4V Q;  4JG2 A;  5IYB G;  2B63 G;  1MJC A;  4AH6 A;  4PG3 A;  5FJ8 H;  1SFO H;  2JA6 G;  2R7Z H;  4LUZ A;  3H15 A;  1E3P A;  1BBU A;  2Y0S G;  4L5Q A;  5C0X G;  2UUB L;  5IY0 A; 
#chains in the Genus database with same CATH topology
 1EY9 A;  2JA8 H;  1P16 A;  3TP8 A;  1KLG D;  2AQ2 B;  1DON A;  5DG9 A;  1G2S A;  1N32 H;  3GTG H;  2F4I A;  1M8A A;  4BY1 G;  1W2B A;  3HXL A;  4ECR A;  5IIF A;  4RCO A;  3K5N A;  5EPL A;  2CHB D;  1TU2 B;  1RJQ A;  2WE6 A;  2A68 C;  4YP3 A;  1JB3 A;  4J9L A;  1E4F T;  1SNO A;  2Q2U A;  1FGU A;  1BJT A;  5DGB A;  2BA0 A;  4DV3 L;  5C0X H;  2EOT A;  3G6X A;  2YZM A;  1D2B A;  4HQ6 A;  3D31 A;  3HOU H;  1RYS A;  4UP9 A;  4DV2 H;  3K80 C;  4FXG C;  3CCL A;  3GIJ A;  2JEG A;  3MVV A;  5A2Q E;  2K5V A;  3F1Z A;  2O5J C;  1V51 A;  1O7I A;  1LTI D;  4NXN L;  3AFP A;  3URY A;  2RDJ A;  4F4W A;  1HNX H;  2XWJ B;  4DAM A;  3S24 A;  4WBN F;  4A3M G;  2KSW A;  1TWH H;  4NB3 A;  1F9P A;  1HFG A;  5M9O A;  2CFM A;  1B50 A;  2EQS A;  5JEA H;  2F0T A;  3BDO A;  3PUX A;  1WCM B;  1IYV A;  4A2B A;  3RGZ A;  3J81 W;  1OWT A;  4YHH H;  4FF4 A;  3JAM E;  2WB1 A;  1UWV A;  5FLX E;  1AE2 A;  5CBE E;  1CA6 A;  1T36 A;  3I4M G;  2LFN A;  3K5L A;  3Q8P B;  1JE4 A;  1PVO A;  3GIM A;  3SK8 A;  4KV6 A;  1GO3 E;  5D3I B;  3DUZ A;  3ERQ A;  4IUV A;  1DYQ A;  1KJJ A;  2D2C C;  5E4X A;  1FNU A;  4P74 A;  4QWC A;  3K0X A;  5KND A;  5KFU A;  5C5M A;  4JI3 Q;  4L5T A;  3M9B A;  3NBH B;  2MCT A;  4JI2 H;  1U0L A;  4RGN A;  4YY3 Q;  3G4S A;  2ATL A;  2MP1 A;  5EQ0 A;  2I46 A;  1S68 A;  5C1O A;  5FD6 A;  1SN8 A;  1TWF B;  3C3L A;  5M3M G;  4R8U B;  2K4K A;  4JBW A;  2Y0S B;  5ELC A;  4X64 H;  3QWN A;  5DM7 3;  4EQP A;  5IP7 H;  3UFX B;  3PO3 H;  4IRC A;  3MHB A;  3R2I A;  5H1S E;  2HHH L;  1SYF A;  2I5M X;  4BY1 B;  4BY7 H;  2EY1 A;  1SMY C;  2UXC Q;  4DV0 L;  2JA5 B;  4S3S A;  1TWA A;  4DF7 A;  3ORR A;  1I6V C;  1RD9 D;  1TWC B;  1EZ6 A;  2B2W A;  2QDL A;  5LMN L;  3H3V I;  2FK3 A;  4RB3 C;  1HNZ L;  2WB1 G;  3GTK A;  3V6H A;  2J0T D;  4IFD G;  4ZI7 F;  1I50 B;  4Q5V A;  5I2X A;  2QW7 A;  3DEP A;  4KY7 A;  1S3O A;  3RV3 A;  1XMO Q;  5JH7 F;  4X65 L;  3SI8 A;  1RK5 A;  1ILQ A;  1DJR D;  4JI4 Q;  4EEY A;  3A55 A;  5IOD A;  3J81 L;  2Q8I B;  5I47 A;  4LF5 H;  2D62 A;  3U50 C;  2R93 H;  1BGW A;  3G6J B;  5JJL A;  4UDU C;  3L4J A;  1O7L A;  1NSN S;  1WI5 A;  2R7Z G;  3WO0 A;  3RN5 A;  2PZU A;  2KCM A;  5ELF A;  1N34 H;  4A3M B;  1IBM L;  4RKL A;  2LKV A;  1A6X A;  1MJE A;  2V9W A;  1EUJ A;  5EPK A;  1KJI A;  1LAB A;  4HIO A;  2F3I A;  1I94 L;  2K5N A;  4IUN A;  4B3S L;  3N6R A;  5J39 A;  3EFX D;  3RN2 A;  3HOW H;  2L0C A;  3VDY A;  3GP7 A;  1GD7 A;  3R5X A;  3F2U A;  2DLN A;  1R9T A;  3D6C A;  1IOV A;  2AQ3 B;  1R4P B;  3PW2 A;  3TRE A;  5IWA L;  4KHP Q;  1Z2P X;  3VYT A;  2R92 A;  1WTQ A;  2NN6 G;  3H6M A;  2ZJR A;  1JDE A;  3FKI A;  1WCM H;  3QOJ A;  4QWB A;  2YS6 A;  2TSS A;  1F2Z A;  1YVC A;  4ALP A;  1QVG A;  1M90 C;  1EYC A;  5FPR A;  3GV8 B;  2VS1 A;  1GJX A;  5CMD A;  1T3N A;  2ZT9 C;  1S10 A;  3S17 B;  5T1I A;  5KFP A;  3DWA A;  2C9O A;  2NU9 B;  4RKB A;  4B3M L;  4YJ2 F;  1TVX A;  5KFZ A;  5BN5 A;  4M7E A;  2K28 A;  1VF7 A;  2UUC L;  3TII A;  1SEB D;  5M3M B;  4C2M A;  1A2T A;  1PH4 A;  4G3I A;  2Z8L A;  4ECZ A;  2P5Z X;  2PNH A;  3TP6 A;  1HJP A;  1UAP A;  2NZH A;  4B3R Q;  3BQ0 A;  5IGD A;  5GAE C;  1JR0 D;  4YCW A;  3V4S A;  3J81 i;  3GIP A;  3L0O A;  4NW2 A;  1GVP A;  4RFB A;  5LP6 F;  3Q1K A;  4LFB L;  2J9G A;  4LF7 Q;  1K28 A;  2WII B;  3MC0 B;  1Z6H A;  1KRS A;  3TS2 A;  1Z2N X;  1KQS A;  4JW0 A;  4ZCK A;  1WYD A;  4XQQ A;  5CGK A;  2PW5 A;  3OW7 A;  4A76 A;  2BE5 C;  3NPP A;  1OTC A;  3RUP A;  4OX9 L;  1N48 A;  3BA9 A;  5DLG A;  4K5W A;  1VDZ A;  2IPK D;  1D1I A;  4Y7N H;  2FKL A;  2JA5 H;  2QF7 A;  3FKI G;  2A6H D;  1VQ6 A;  1PTO F;  2R7Z B;  1IBL L;  3RNU A;  3M9N B;  5DAU A;  3KHL A;  4JCV E;  4X3K A;  5IGB A;  2UXB L;  2Z9H A;  3KF8 B;  2LSS A;  3VPD A;  4RB2 C;  2R85 A;  3I4N H;  1CSQ A;  4RHR A;  2XIG A;  4JI6 Q;  2W57 A;  4HJA A;  5M3F H;  4YAK B;  3T5K A;  1PRT C;  1QUQ A;  3SHL A;  1B53 A;  1EWC A;  2ZTC A;  5NUC A;  3U4Z A;  1EFW A;  4FF3 A;  2DIK A;  4LF9 Q;  3M4O H;  3PR5 B;  1LT4 D;  1TWA B;  4A3E G;  2A1A A;  3ICE A;  2ZTD A;  4I7A A;  4QF4 A;  1E4G T;  4J9N A;  1HQM C;  5EGT A;  1L0Y B;  1ESR A;  4X3U A;  2W7O A;  4ABN A;  5HUR A;  2UXC H;  4EFE A;  4Q0F A;  2BH8 A;  1QOH A;  2ZTE A;  4EQ5 A;  2NTT A;  4ED7 A;  3PF5 A;  1NUC A;  4BA2 I;  4UCU A;  2VA3 A;  4DV6 L;  4WJW A;  1TII D;  3MXN A;  2IBK A;  1IW7 D;  2QA4 A;  1TQO A;  1GKH A;  3R3O A;  5LL6 S;  3S1M H;  4HED A;  2ZM6 L;  1BNZ A;  2B63 A;  1XMO H;  4FM9 A;  4IRD A;  1SRO A;  2FJZ A;  2K32 A;  1B3A A;  2F3V A;  5C44 H;  2JEF A;  1Y1V B;  2PZW A;  3J7A V;  2M2L A;  1I3Q A;  3M9M B;  3S1N B;  2WAQ G;  4DR6 Q;  4IPG A;  2VB3 X;  3S17 H;  4JI4 L;  2UUA Q;  5IOC A;  2VQE Q;  2F0J A;  1PZK D;  3VPB A;  5EBD A;  3RZO B;  4IUT A;  3RBE A;  4JI5 L;  1K83 A;  4XTC S;  2KHI A;  1XNQ Q;  2L9H A;  4O0A A;  2IX3 A;  2VQF Q;  4IAL A;  5IYC G;  1Q1B A;  5LMU L;  1LT5 D;  4LF6 Q;  3D4W A;  4FVM A;  4A3F G;  2J6U A;  3I4L A;  1Q86 C;  1A3T A;  2B29 A;  1IOW A;  1TS3 A;  4QW9 A;  5DGA A;  3RB6 A;  5C5J A;  1G6P A;  4JBK A;  4KHP H;  1EZ1 A;  3T16 A;  4Y8V B;  4G7Z C;  5JJZ A;  4AYB A;  3PZP A;  2EYL A;  3JC6 6;  1XNR H;  1RJP A;  4N9P A;  1HR0 Q;  4JI0 L;  4M8A A;  2C5C A;  3RMH A;  4GOP C;  1VAJ A;  1NAP A;  2JA7 G;  1NTG A;  2F0I A;  2FPI B;  3TQ1 A;  2PMZ B;  2V1C C;  3P1H A;  2RDI A;  1OO9 B;  2PI2 A;  2CZG A;  5TSS A;  2ZDH A;  4A3E B;  4A3J H;  2F0S A;  4AIM A;  1L2Z A;  2W9B A;  5LA6 F;  1Y14 B;  1S0M A;  4B3R H;  5IT9 c;  4KMU C;  1VS0 A;  1BCP D;  1H9K A;  1UE6 A;  4BWS C;  3KF6 A;  3ORQ A;  1VQH A;  1CZG A;  5IYB H;  1VQ5 A;  4I55 F;  3KHH A;  3HOV B;  4NMZ A;  4LF7 H;  2RHS B;  5BN3 A;  4TSS A;  1X3P A;  4QIW E;  4QJF A;  3PGZ A;  2RCN A;  4X62 L;  2ID0 A;  2NZ1 D;  2YTX A;  1IL2 A;  4LUV A;  4Q8F A;  3GTO A;  4WOR A;  5DQI A;  3AU7 A;  3VR5 A;  1SR3 A;  5C5L A;  3RD4 A;  2WAQ B;  2FB9 A;  2DWC A;  3H94 A;  5D14 A;  3T1Y L;  5DNF A;  4MTK A;  4C3J G;  1FYC A;  1PFB A;  3H0G G;  5KFF A;  3Q24 A;  1VQ7 A;  4G7O C;  4DK0 A;  3L9A X;  3KK7 A;  4DR5 Q;  3HOX H;  4TVA B;  3HBL A;  2KOL A;  3QZ7 A;  4EYH B;  2JQO A;  3MEH A;  2HDM A;  4AQY H;  2IX1 A;  1OXX K;  1HNW L;  4JI6 H;  1RTN A;  4JI8 Q;  3RJ0 A;  2V5A A;  1O78 A;  1Y1V H;  2ES2 A;  3GTM A;  2JSO A;  2EYM A;  2PPB C;  2HUG A;  4A3F B;  4IFD I;  4C5A A;  2F0E A;  5JAV A;  3RZD B;  1AZP A;  2NU8 B;  3OHB A;  2F52 A;  3V05 A;  1JDB B;  5GON F;  2R8H A;  1GHJ A;  2NB0 A;  3PW0 A;  2WIN B;  4HR7 A;  4Y52 H;  2DUD A;  5JOB A;  3STB D;  3T56 B;  3RZO H;  5DQH A;  4ME5 A;  2A74 C;  1VQE A;  4OGQ C;  2R82 A;  3MXN B;  3ULJ A;  1DM0 B;  2WYO A;  3MXG A;  2Z6K A;  3CCV A;  1S0O A;  2R8G A;  3S2D B;  2VUM B;  1TWG B;  1I7N A;  2FMA A;  4YBZ B;  3OUZ A;  4J6H A;  2JA7 B;  1E7Z A;  1RTO A;  3MTS A;  3TME A;  1HR0 W;  2CW0 C;  4GN4 B;  3W5O A;  1YNJ C;  1EYA A;  3KTM A;  4CKC A;  2SNM A;  2XNA C;  4DL5 A;  1B04 A;  4XT1 B;  4NXM L;  2XGP A;  4ECT A;  1JXL A;  2F0N A;  5KT6 A;  5F9N A;  3GO5 A;  2X6G A;  1PFN A;  4ZK9 B;  5E7N A;  2HIX A;  4RNO A;  1VF5 C;  3IAY A;  5KKN B;  3MXP A;  4DR6 H;  2PZT A;  2H5X A;  4CBV A;  2NBF A;  1LUZ A;  1QG7 A;  2MUY A;  5JVH 3;  4JI1 Q;  3SDZ A;  2UUA H;  2VQE H;  2VL6 A;  2NN6 I;  3U9T A;  1SYG A;  2MQH A;  4WFN 3;  3K57 A;  3G8C A;  3CCU A;  4UY8 C;  1VQ9 A;  1WH2 A;  4JBM A;  5GAD C;  3RAQ A;  1RCV D;  2NVX B;  3M4I A;  1DGS A;  1XNQ H;  4LFA H;  5T1G A;  1TWH A;  3S2H H;  4LF6 H;  3R5H A;  4O3R A;  3HOV H;  3NP8 A;  1G91 A;  4IUU A;  1H95 A;  2KQ3 A;  4EX5 A;  3AMU A;  2YL2 A;  4C3J B;  3H0G B;  2MNA A;  1HPC A;  2V4Q A;  2VQF L;  4DAY B;  1IBK L;  1JJG A;  3A54 A;  4MN3 A;  1EYZ A;  3NBI A;  3KHR A;  1N33 L;  1PXU A;  4TUY F;  1MHW C;  5GQO A;  2OTJ A;  3K58 A;  1F2L A;  2F0V A;  3AEV A;  1EZ8 A;  1DXM A;  1KLU D;  3J80 L;  3NHH A;  5K2M A;  3PO2 H;  2C2R A;  2AGP A;  4KD4 A;  5C4Z A;  1MJC A;  4AH6 A;  5LL6 X;  1LTT D;  3TIN A;  3J81 E;  4DL3 A;  1MZB A;  3Q8Q B;  1HTL D;  1L0X B;  2O03 A;  3H15 A;  1LLR D;  4L5Q A;  5C0X G;  5IY0 A;  1HR0 L;  2F4V L;  3GTL H;  1IYU A;  5ELN A;  4KKS A;  3HOU G;  1WFQ A;  4GKK Q;  1B33 N;  4J0M A;  4IPD A;  1CQI B;  5KFA A;  3GQC A;  3K8A A;  4DV3 Q;  3TIG A;  4DV4 L;  1A8V A;  1Q81 C;  2CWA A;  4NKL A;  3PV0 A;  2IX0 A;  5J2U F;  4OEL B;  1M0W A;  3H40 A;  2NYZ D;  4O3S A;  2F0O A;  1SE3 A;  3M7G A;  3CVZ A;  2AQ4 A;  4YCU A;  1RYR A;  3N40 P;  4H7B A;  2L15 A;  5KFJ A;  5KT4 A;  4NXN Q;  4DPG A;  1W96 A;  3FDS A;  2BQR A;  3J7Z C;  1PRT F;  3GTJ H;  3CCE A;  1BVS A;  5HGQ A;  5CV4 A;  2A6E D;  5JJI A;  2EY2 A;  1VQA A;  4O2B F;  4DR1 L;  1YHB A;  1EEI D;  2VUM H;  2N88 A;  1NBW A;  3TBI B;  1PTO D;  3BU2 A;  4I7Z C;  3CPF A;  4MV9 A;  1CK1 A;  1YNN C;  1X65 A;  2QEJ C;  5JVL A;  1VQN A;  1FJG H;  3KFU A;  3TP7 A;  1Q90 A;  2NU6 B;  3GIK A;  1ICF B;  4DR5 H;  4J9R A;  3X3M A;  3TP5 A;  3SEB A;  2R93 A;  1J9O A;  1PYS B;  5EJW A;  5C3E G;  5I6W A;  3LNN A;  1AUX A;  3F8N A;  2W9C B;  4JI8 H;  3QR8 A;  4K6D A;  3CXC A;  3T1H L;  3J80 i;  3KXY T;  3OHX C;  5KNC A;  3LWB A;  1SXT A;  4H0L C;  3GTP H;  4IUR A;  4A75 A;  4LMY A;  2RDG A;  3A8K E;  1Q12 A;  4ECY A;  2AUK A;  4A3G B;  2WDT A;  1W6K A;  4P71 A;  3GQB A;  2E2H B;  3GIQ A;  4QB4 A;  2P0A A;  2XC9 A;  3OIQ A;  2F0F A;  1KIX A;  1HZ9 A;  2ASJ A;  3P20 A;  3PW5 A;  4A3I B;  4DR2 Q;  3FDT A;  2HHH Q;  5ELD A;  2Y0S E;  3EBE A;  2BOS A;  4DV0 Q;  4B9X A;  1A3V A;  3CQZ B;  5KFY A;  1C9O A;  2QGQ A;  2R6F A;  4ME6 A;  5LMN Q;  3I72 A;  2I0Q A;  2AHO B;  3G7L A;  2MO1 A;  1HNZ Q;  2I5L X;  2OWO A;  1D5X C;  1O80 A;  3A74 A;  2VOB A;  4ZOL F;  4O3N A;  3RB0 A;  3RGX A;  1GSA A;  4UPA A;  5KT2 A;  1DCZ A;  4BWG B;  1BKB A;  4X65 Q;  1D1K A;  5D1O B;  4QCL A;  4JI1 H;  4E4T A;  4X66 L;  1SRU A;  4MTN A;  2TMP A;  4YB8 B;  4IO9 A;  2N78 A;  1SYD A;  4HJ7 A;  1NJI C;  3N43 B;  2SCU B;  2EYO A;  1RJT A;  2B3G A;  2C22 A;  1GM5 A;  1SAP A;  5JQW A;  4LF8 Q;  1E2V A;  4R1J A;  4CJ0 B;  1B2T A;  2D0O A;  4YAJ B;  2K50 A;  5COY A;  2RCF A;  2NVY A;  1MI2 A;  5IP9 H;  3VA7 A;  5FJ8 G;  4A93 B;  5KFR A;  1ONL A;  2ALY B;  3W2D A;  1F9S A;  1RIP A;  1VQO A;  1S4Z A;  1I94 Q;  3JRW A;  3I2Z A;  3KJP A;  4B3S Q;  4IPC A;  1AUV A;  4EGJ A;  2PYK A;  1VQB A;  4HTH A;  5IWA Q;  3S1R H;  3M4Q A;  1KNA A;  4OXP A;  2R8I A;  4MZ9 A;  3PSI A;  2OEO A;  2YRX A;  3N41 B;  2ZJQ A;  4M1U B;  4F7X A;  4LK1 C;  5IYD G;  4GKJ L;  1WR2 A;  1HH2 P;  1BCP B;  4ECU A;  3PUY A;  3VR3 A;  4EBE A;  1A0I A;  1PYW D;  3M85 A;  3R93 A;  4L63 B;  5AJ3 L;  2Z1C A;  4DXG A;  1TAE A;  4J8Q A;  3OTO H;  1MSG A;  4MV3 A;  4JI7 L;  5J3B A;  4B3M Q;  4ZYS A;  3QB3 A;  2HVS A;  4IJH A;  3AQQ A;  3TEH B;  3WOE A;  4A3L G;  2IJ0 A;  3Q8S B;  2UUC Q;  4DV3 H;  2PQA A;  3SK4 A;  3NXW A;  4KJN A;  2CVR A;  3MZ5 A;  1D8L A;  1IZ6 A;  1E2Z A;  3A56 A;  4ED1 A;  2JP1 A;  4GKK L;  1WD0 A;  4DAP A;  4DL4 A;  2MFI A;  5C3W A;  1EYD A;  3KBX A;  3H3V H;  3O13 A;  3ULP A;  3HS0 C;  3NE5 B;  3B6Y A;  4WJ4 A;  4C56 C;  4NXN H;  4DNI A;  4A3G H;  1I4P A;  1X3E A;  4IHJ F;  4LFB Q;  4Q44 A;  4UCT A;  2CH4 W;  3P75 A;  2KHJ A;  3S14 B;  3J80 c;  5LMN W;  1X6O A;  2QDB A;  4DR3 L;  2F0U A;  1LT3 D;  1EQT A;  2C2D A;  4A3I H;  1E1T A;  3CP0 A;  4OX9 Q;  5ELO A;  1WTH A;  4QUF A;  4A3B H;  2FHT A;  1EQQ A;  1BOS A;  2DNE A;  1MKH A;  1SMY D;  2KCN A;  4P75 A;  2PN1 A;  4MV6 A;  5KG1 A;  2EY5 A;  1HXY D;  3ND8 A;  1K0S A;  1Q1E A;  3VPC A;  3G48 A;  3V2T A;  2UVU A;  1KDC A;  1V8Q A;  1EY6 A;  3IRB A;  4KHZ A;  1IBL Q;  3TZD A;  2UXB Q;  1DOM A;  2K5Q A;  3E6Z X;  3ERS X;  3MXU A;  5KX5 F;  4A3D H;  2WP8 J;  1DV1 A;  1L1O B;  1RF2 D;  1RJR A;  2M00 A;  1EQV A;  3WNZ A;  4TQS A;  3ND9 A;  2G9H D;  1I5F A;  4YJ3 F;  2GPS A;  3BG3 A;  4YR2 A;  1Y1W H;  5CC4 A;  3S1Q B;  1IKM A;  4OWT B;  1X56 A;  5L1I A;  3UDX A;  3LWU A;  2K6A A;  1HNX L;  5IT9 W;  1YI2 A;  4P72 A;  1VQG A;  4FS2 A;  1HQR D;  1UNS A;  5A35 A;  3E9H A;  4APM A;  3CRL C;  3M9O B;  1EY5 A;  4K2L A;  4A93 H;  4DR4 L;  5L37 A;  4FU0 A;  2HHH H;  4R9W A;  3NQI A;  3RB4 A;  1UE5 A;  2JA6 B;  2XCP A;  1IL8 A;  4DV0 H;  1BR9 A;  1TS4 A;  1ZKO A;  5LMN H;  2QEX A;  2DZD A;  4DR2 L;  4BBS G;  2K03 A;  1HNZ H;  2K14 A;  2Q2H A;  1VQC A;  3GII A;  4DV6 Q;  2GN5 A;  5C44 G;  1RL2 A;  4NP5 A;  2XGT A;  3A7A B;  4DUZ L;  4JVZ A;  4KY6 A;  2AWN A;  4PWQ A;  3I90 A;  4BBR G;  3WOF A;  2ZM6 Q;  5G3L F;  4X65 H;  3PUV A;  1CKN B;  4DK3 C;  1L0W A;  3IL8 A;  2R7K A;  5FOB B;  2K5W A;  3BZK A;  4U7C A;  3VYR A;  1ULZ A;  3N52 A;  3LP8 A;  4HNV A;  2RGV A;  5KFN A;  5EAY A;  3OYY A;  3RV4 A;  2RVL A;  1K73 C;  3SE0 A;  4IFD J;  1MIU A;  1T94 A;  1IBM H;  4KY5 A;  3GTQ A;  2M9V A;  5K36 H;  3MA2 B;  3KBG A;  1N36 L;  2HDL A;  1SNC A;  2YTY A;  4JI5 Q;  4HYK A;  4ZHQ F;  1A2U A;  1FNV A;  1RKN A;  2H1E A;  4LF8 L;  1BXT A;  3HZX A;  1B7Y B;  1KAW A;  1I94 H;  5LMU Q;  4B3S H;  3FMC A;  1G29 1;  4RAU C;  4ZKB B;  4EFB A;  2XVS A;  2E2I B;  2VZA A;  5IT9 L;  5CA0 F;  1DD2 A;  2L12 A;  1AEX A;  5IWA H;  4RZQ A;  3I4M B;  4UHV A;  2IY5 B;  1DOL A;  4EQO A;  2NVQ B;  2BE5 D;  2NVT B;  5COR A;  1HFN A;  3T5H A;  4ZKC B;  3PUW A;  3PMF A;  1U5K A;  2OCE A;  4RGT A;  4YIJ A;  2F0G A;  2PCF B;  1VBH A;  1V4Y A;  4GLV B;  5KG4 A;  1B1Z A;  4O3Q A;  4JI0 Q;  3OUU A;  4JPB W;  1TY2 A;  4CJ2 C;  1UE7 A;  1EY0 A;  4BS9 A;  4CGY B;  5D65 A;  1JLL B;  3QO2 A;  1XMQ L;  4B3M H;  4XT3 B;  3DWQ A;  1JMC A;  2RGR A;  2UUC H;  3HOZ G;  2ZJT A;  2EJF C;  1ET9 A;  4Z9C B;  4HCE A;  2PMZ E;  4HJ9 A;  1E2W A;  2KUM A;  4A3K G;  5EOY A;  4FYD A;  4RUA A;  2JEB I;  2XWB B;  2OT2 A;  1PTO B;  3EA6 A;  3S1Q H;  1PRT D;  1LTL A;  4RZR A;  4IRK A;  1KNE A;  4LFB H;  1KHI A;  5KT3 A;  2PQE A;  2OQK A;  2FXQ A;  2V4R A;  4MNO A;  2VPS A;  2J7Z A;  4DV1 L;  4X62 Q;  2IHF A;  1ASY A;  4OWW B;  2FLN A;  4BBR B;  1VQM A;  2WB1 B;  4OX9 H;  1STH A;  3IFT A;  2ALZ A;  1TWF H;  1YHA A;  5M5W B;  2JEJ A;  1YJN A;  2JA6 H;  2Q8R E;  5FO9 B;  4QQB X;  2YZG A;  5FLM H;  1XWE A;  1N56 A;  3G6E A;  4NLG A;  3S15 B;  5D8D A;  3T1Y Q;  3R5F A;  1KDA A;  3WO1 A;  4BY1 H;  1EOV A;  4DV7 L;  4DV5 L;  1GGO A;  4R4O A;  2R92 G;  1IBL H;  2Z0S A;  1QNU A;  2UXB H;  2K05 A;  1FVI A;  1KL9 A;  1KTK A;  1EOT A;  1TWC H;  4X3T A;  4RMF A;  3GLK A;  1A9X A;  3W1B A;  5C4X G;  2JK8 A;  4ZUJ A;  5HBR B;  1HNW Q;  3EJI A;  3KLR A;  4P2C B;  3UDI A;  3PW4 A;  1YEZ A;  4YR0 A;  3J7A K;  1I50 H;  2DPI A;  3HKZ E;  5IGG A;  3TN2 A;  2GPW A;  4JI3 H;  1JOK A;  4I65 A;  4X6A H;  1PH9 A;  3C2P A;  3M4P A;  3J81 j;  4YY3 H;  1XPO A;  4G4K A;  3ER0 A;  4GN5 A;  2BQ3 A;  3KYH C;  3NQT A;  1VQK A;  5KFQ A;  2KA7 A;  2Q2I A;  2HGS A;  3I70 A;  1PH8 A;  4A3M H;  5CBA E;  1O75 A;  5KYL A;  1Q7Y C;  1PLF A;  1PYB A;  2Z4H A;  4JBJ A;  1E1O A;  2LY7 A;  4K5V A;  3HP3 A;  3GTK B;  1AN7 A;  1KC7 A;  5L1K A;  2E2I H;  3NWT A;  4DV6 H;  2RA4 A;  3HOZ B;  3P7J A;  3KJO A;  3I4M H;  2NUC A;  1JC7 A;  2YU9 A;  3PN1 A;  4NXM Q;  2ZM6 H;  3GTL A;  3FEW X;  5KFB A;  4A3K B;  2NVT H;  4F50 A;  4LSX A;  2HIV A;  3KAL A;  1QWY A;  2V58 A;  1B8A A;  3HKZ A;  3MR6 A;  1PV4 A;  2RDF A;  2VW9 A;  4K8I A;  4RGM A;  5A2Q W;  3UQ8 A;  4HCS A;  1LTS D;  1TXY A;  1N8R C;  3E5S A;  4TV9 F;  4RB1 A;  4UCO A;  2AKW B;  2B8G A;  4YWK A;  4R8N A;  4JI4 H;  2G5D A;  1K9M C;  4EGQ A;  4ZAI A;  3Q0A A;  2N55 A;  3CAM A;  1UC8 A;  2EXD A;  4GNX C;  2RSN A;  1XXG A;  4ULL A;  3BYT B;  1H9S A;  4JI5 H;  5KG7 A;  2OF1 A;  2IA6 A;  4OO1 G;  1C48 A;  3CPW A;  1SBB B;  3GTJ A;  2QKI C;  2F0M A;  1H9R A;  4MIU A;  5ISR A;  5M3M H;  2VQD A;  3A8I E;  1T9H A;  5KFW A;  4KN4 C;  4UP7 A;  3I12 A;  5JPN C;  5LMU H;  3Q2O A;  4C3I G;  1R9T B;  3GD7 A;  1FKA H;  5KEE A;  5KFC A;  3DLL A;  5J22 A;  1IBK Q;  2R92 B;  1ASZ A;  1LV9 A;  1PA6 A;  4IAJ A;  1GYF A;  3BAB A;  3FKI B;  1N33 Q;  4H13 C;  1ZHQ A;  5BPF A;  5C4X B;  3MWD A;  3KLS X;  1L2F A;  2FFK B;  4IFD H;  3H91 A;  4EGV A;  4JI0 H;  1BF4 A;  3OPO A;  4LFC L;  5FD5 A;  4XYQ A;  4WJ3 M;  5LYJ F;  4ED2 A;  3S15 H;  2F1M A;  3GTP A;  2W6Z A;  1VQD A;  5CA1 F;  4C2M B;  5CR3 A;  5E1F A;  1UE1 A;  1K8M A;  2ICI A;  1C4Q A;  2EYJ A;  3QIA A;  4JG2 A;  2B63 G;  2F4V Q;  4U6P A;  4MV4 A;  2EPB A;  1CE8 A;  2J6S A;  2NWG A;  2KCC A;  1EHI A;  2R7Z H;  3H3V C;  2R61 A;  4LUZ A;  1CQJ B;  1E3P A;  3PVX A;  1BBU A;  5I6Y A;  4JV1 A;  4CDF C;  4DV4 Q;  2UUB L;  4KHV A;  2SEB D;  4IWX A;  5A2Q L;  4YR3 A;  1E4E A;  4HJ8 A;  3CD6 A;  2HCI A;  3PCO B;  3TQY A;  1HCZ A;  2ASB A;  2R8K A;  5EDW A;  4XXE A;  1PK8 A;  5KFD A;  2K33 A;  1VKZ A;  1B4O A;  4HSV A;  3NWS A;  3CF5 A;  2PO4 A;  1I4G A;  4DNR B;  1TWA H;  4IQZ A;  3QZ8 A;  2F0W A;  4ED3 A;  1XNR L;  4DR1 Q;  3JAM L;  5FLX L;  1SYC A;  2PNR C;  3GTK H;  2NN6 H;  2IWH A;  2A19 A;  4K8J A;  4ODG A;  4O42 A;  4O2D A;  3MEF A;  1D7Q A;  3BAA A;  3T1Y H;  3D6W A;  1LAC A;  2Z4I A;  4FXK C;  2DY7 A;  1II3 A;  2NU7 B;  3N8D A;  2F3W A;  3G6Y A;  1LT6 D;  2CW0 D;  1YNJ D;  2QIL A;  5GRO A;  2NUA B;  4AYB G;  5KFK A;  4MV1 A;  1BBW A;  1JIH A;  3K81 C;  1HNW H;  2K01 A;  3VR4 A;  3T1H Q;  2OTL A;  1IHZ A;  1KXL A;  3KUP A;  2XRQ D;  1QUQ B;  2EJM A;  2E2J B;  4A4I A;  4GNX A;  2W8K A;  3AFQ A;  3HOY G;  1JOO A;  2B2U C;  4C3I B;  3GID A;  1ZQ7 A;  3CKI B;  2KEC A;  1XYI A;  5EZY F;  2ZXP A;  4OEM B;  1B3Q A;  2E5L L;  3S1N H;  1GUT A;  3TDQ A;  5F2D A;  4LF9 H;  1C8C A;  2WKD A;  4QIW A;  1AP0 A;  3L7Z C;  2LMC B;  3NTH A;  2DN8 A;  4C3H G;  1KJ8 A;  1BXR A;  3J80 W;  1SFO A;  1A62 A;  3H4D A;  3S16 B;  1NY4 A;  4K0K Q;  5KFH A;  3U9O A;  3CCR A;  1HTP A;  3FRP B;  1SE4 A;  4DN4 M;  5KGU A;  2B63 B;  3OSO A;  4NXM H;  1JWS D;  3MR5 A;  5CV6 A;  4AQY L;  2AGQ A;  3GTG A;  4R4Q A;  2BDN A;  2JA9 A;  3EN2 A;  1I3Q B;  2UVW A;  3MR3 A;  3L2P A;  1WTR A;  3H4B A;  2HQL A;  5IE8 A;  4GOP A;  1S72 A;  3V6K A;  4L1K A;  1V1Q A;  4DGZ A;  3I56 A;  4X66 Q;  1S5E D;  4UP8 A;  2F0H A;  3ETJ A;  1M7J A;  4Q43 A;  1K83 B;  4TV8 F;  4ZQI A;  3C1E A;  3KLW A;  4H02 A;  2SOB A;  2WTF A;  2X6L A;  4A3E H;  3V4Z A;  1BNC A;  4ETS A;  4DL7 A;  2C2E A;  1JKJ B;  1Z2O X;  4J9O A;  5ELB A;  1SLJ A;  3SVM A;  1CKM A;  1NCV A;  1V1O A;  1LM0 A;  2VQF H;  3K5I A;  2XGQ A;  1IBK H;  1VQF A;  1QCB D;  4LF4 L;  3SE7 A;  1K3R A;  1N33 H;  4AYB B;  5KT5 A;  1Z7T A;  4QUC A;  2AWO A;  1U4R A;  1BBX C;  4APV A;  1Q3L A;  4JYA L;  2JA8 G;  2L55 A;  4IR9 A;  5M5X B;  4JV5 L;  3C46 A;  3HOY B;  4GKJ Q;  1GSH A;  1JIC A;  1VQ4 A;  4DAV A;  1XJV A;  4RH6 A;  1YNN D;  1HR0 H;  1CQF A;  2W9B B;  1CFM A;  5AJ3 Q;  1PRT B;  3V96 A;  5M5Y B;  1X3G A;  1I6H B;  1Y1W A;  4LSA A;  1PH3 A;  4JI7 Q;  1L1O C;  1QNK A;  3MJF A;  4DUY L;  2CWP A;  4LWC A;  4FF1 A;  1EIG A;  4N8X 1;  5HY6 A;  4HID A;  4F8M A;  2B2U A;  1E4E B;  1VQJ A;  3Q8R B;  3KF6 B;  2QK4 A;  4LFA L;  4DV4 H;  2EYF A;  3TQT A;  1CQV A;  3ZJY C;  2BDO A;  1V1P A;  3DM3 A;  3VA5 A;  2E8G A;  5CAE B;  3RLF A;  5C0X J;  4DL2 A;  1S5D D;  5IYC H;  1WD1 A;  3N44 B;  2CH4 A;  5IT9 E;  3OW2 A;  3GTO B;  4A3F H;  4R4C A;  3RZD H;  1J5E Q;  5KG3 A;  1Q46 A;  1OXS C;  4J15 A;  5FLM G;  1V43 A;  2HVR A;  2VR1 A;  2E2D C;  2L11 A;  4DR3 Q;  1UC9 A;  2IP4 A;  3K5H A;  3OSN A;  4JK1 C;  4WRD A;  5JEA G;  1KRT A;  5EWF A;  2LXK A;  4QW8 A;  2AQ1 B;  2GA4 B;  4QWD A;  2RF4 A;  4F88 A;  2IHE A;  3BVG A;  1F9Q A;  4XYL B;  1C3O A;  1RHP A;  3M3Y B;  5J2T F;  3S2D H;  1TWG H;  3R23 A;  2RSO A;  5LHY 1;  2JA7 H;  1D5M C;  1PHJ A;  1PX2 A;  3GTM B;  3T1H H;  5DQG A;  4CHT B;  1TY0 A;  4BXX H;  1KJ9 A;  2X0S A;  3L3O C;  3ULL A;  2PVP A;  2W6M A;  3PR4 A;  1ZYR C;  4HR7 B;  4CDC C;  3CU7 A;  2B2V C;  5I9O A;  4HIK A;  1E22 A;  2DPJ A;  3DWP A;  1K83 H;  2DNC A;  3IFD A;  1HNX Q;  3T13 A;  2XTI A;  2I87 A;  5HV6 A;  1CUK A;  2A69 C;  1SYE A;  4B9W A;  1LYL A;  2K5D A;  2K5H A;  1G2T A;  1PH1 A;  5IP7 G;  1VQL A;  1S5B D;  4XQJ A;  2W70 A;  2JA8 B;  3JAM c;  2BR0 A;  1STA A;  2VB2 X;  3EQL C;  5FLX c;  2UU9 L;  3PO3 G;  3Q8D A;  1YZ6 A;  4TQU S;  4DR4 Q;  2NVX H;  3MFI A;  3EIV A;  4BY7 G;  4JOI C;  4LMQ D;  4XYM B;  2KEE A;  4B3T L;  3IG0 A;  2PBZ A;  5IYZ F;  5C6A A;  2AGO A;  1FJG L;  5I9P A;  1ENC A;  2YCH A;  5JPM C;  3JSN A;  4OO1 I;  4GOP B;  2NTS A;  1B9N A;  4L8J A;  4DK1 A;  4IOA A;  3HFZ B;  1T5E A;  1W3S A;  1WCM A;  3HRZ C;  2YS7 A;  4C3J H;  3H0G H;  4K0K L;  3FPP A;  1Y8N B;  4ZQ3 A;  4DUZ Q;  2ATW A;  3EYY A;  1S03 G;  2ZDQ A;  3T4A C;  3HOU B;  2CKZ B;  4MHE A;  2J6T A;  4KKU A;  3I73 A;  4X66 H;  5KFG A;  4DLK A;  1MBY A;  2R93 G;  5DG7 A;  4QL5 A;  1KC8 C;  2UVR A;  2ASD A;  1I6H H;  3BVM A;  4R4T A;  2FP4 B;  1JB7 A;  3D3R A;  5EWE A;  3E5N A;  3NBH A;  5CV9 A;  2OH2 A;  1TWH B;  2UXD L;  1U9R A;  1TS2 A;  2CQY A;  1ZET A;  1N36 Q;  2XRS D;  3A7L A;  1PFS A;  4L5S A;  2A68 D;  1TA8 A;  1OXV A;  2B2T C;  4QMG A;  2H4O A;  3VR2 A;  4K6L A;  4CJ1 B;  2JN4 A;  3CCM A;  1DZ1 A;  4IPH A;  1EYG A;  2XN9 C;  3RUZ A;  2JA7 A;  4RUC A;  4R8U A;  1HA6 A;  2Y0S A;  2VNU D;  3HOW G;  3VMM A;  4HMI A;  1EY8 A;  2WAC A;  3SK5 A;  5L9X A;  2JE6 I;  1KBL A;  1X55 A;  1UEB A;  2I80 A;  2EZV A;  2YV5 A;  1GUG A;  5J1Z A;  4XYO A;  2JA5 A;  1Y8P B;  1WCM G;  1YNX A;  1TWC A;  2BA1 A;  3K5O A;  4GKJ H;  5C3E B;  1SJE D;  3K7U C;  1WTP A;  2AMC B;  1I50 A;  1VMC A;  1HZB A;  4JI7 H;  1ZXT A;  1XMQ Q;  1N9W A;  3A5U A;  4FNF A;  3QFF A;  2EY6 A;  1MD2 D;  3I91 A;  4M9U A;  3LWE A;  2B2V A;  4KN7 C;  2FLP A;  1BO0 A;  1K1Q A;  3LGJ A;  5BR8 L;  3PO3 B;  2R6G A;  1LO5 D;  2W9A A;  4EBC A;  2DJG C;  4GKK H;  2VXW A;  4NDX A;  2C35 B;  3RAX A;  4BY7 B;  2F0P A;  4LJZ C;  4RAZ A;  4IJL A;  2W6O A;  2Q8T A;  4DR7 L;  1NMG A;  4HJ5 A;  2EYP A;  3TZU A;  1YJ9 A;  2KEN A;  4JOI A;  1XPR A;  1WVL A;  4DR3 H;  5BPH A;  1K1S A;  4DV1 Q;  3Q6S A;  3NEM A;  2E2H H;  3IN5 A;  1J5E L;  1SE2 A;  5BMV F;  3K6O A;  5KG6 A;  3S9W A;  2JA5 G;  4UFZ A;  2WB1 E;  2R93 B;  2KCT A;  3OTO L;  1N32 L;  3GIL A;  4J9Q A;  4DV7 Q;  4DV5 Q;  3NEL A;  1WOC A;  3CQZ H;  4DL6 A;  3MR2 A;  2A5H A;  2SNS A;  5CB4 F;  3I4N G;  1GUN A;  3TS0 A;  4J9K A;  2RKS A;  4YWM A;  3CC4 A;  2MHV A;  4EG0 A;  1ET6 A;  4EQN A;  1F77 A;  5M3F G;  3VYS A;  1K8G A;  1BCP F;  3NK9 A;  3NUC A;  3HOW B;  2B39 A;  4DV2 L;  3OHA A;  2B2T A;  1Z47 A;  2SDF A;  1B44 D;  3R2T A;  3PQI A;  5L1L A;  1EY7 A;  1VMP A;  3ITP A;  4HNT A;  4DR4 H;  5FO8 B;  1IYJ B;  5KNB A;  4ECW A;  2FK1 A;  4O1N A;  2FLL A;  1NR4 A;  2CQO A;  5KIX A;  2JEI A;  4DXF A;  1EUC B;  1HHV A;  3CCS A;  1EIH A;  1QVF A;  4DR2 H;  2R87 A;  2VY3 A;  4CKE A;  1M6V A;  2WV6 D;  3QG1 A;  4YHH L;  1H9J A;  1GUS A;  1G6Z A;  3MWE A;  4XDX A;  3BA8 A;  4DUZ H;  3H20 A;  4CDD C;  1CA5 A;  2V59 A;  4PNY A;  5C3E H;  3JSL A;  3WDN A;  2Q2T A;  1YHQ A;  4HIM A;  2M05 A;  2R7Z A;  2FPP B;  4LUO A;  1DV2 A;  2D0P A;  4ME3 A;  3I8Z A;  5I4D A;  3E3X A;  5EBC A;  1CHQ D;  3F2C A;  2MPM A;  1I4R A;  4ECV A;  3KF8 A;  4JI2 L;  3D0F A;  4QWE A;  1D6E C;  1JJC B;  2NVY B;  4J9S A;  3N42 B;  3PIO A;  5KFI A;  1N36 H;  3CMA A;  1H9M A;  1JQY D;  1JCK B;  2ZJP A;  4NPS A;  2EIF A;  4LF8 H;  3LX0 A;  1X32 A;  4X64 L;  4Y7N B;  4O4L F;  1BQQ T;  2L5T A;  4DA2 A;  3RB3 A;  1HUM A;  1B6R A;  5HGT A;  3UE0 A;  2F03 A;  4V19 0;  2R7M A;  5C0X I;  2WKC A;  2DJF C;  1ROD A;  4O2A F;  5JVG 3;  1U4M A;  2Z6B A;  1EIF A;  1EWI A;  3BQ2 A;  1F2M A;  1EL0 A;  1PZI D;  2O4X A;  4RCN A;  1S5F D;  1VQI A;  4TKO B;  3I4N B;  2LXJ A;  4E6I A;  3S14 H;  1STE A;  1AN8 A;  2JYO A;  4FDB A;  4EVO A;  5M3F B;  4XQN A;  5AFW A;  1ESF A;  4LFC Q;  1FL0 A;  1EY4 A;  1TR5 A;  2LS0 1;  3CW2 C;  5EPJ A;  3M4O B;  1STN A;  1XMQ H;  4ECQ A;  3PW7 A;  4MV7 A;  3MAQ A;  2PQA B;  1JT8 A;  3T5J A;  3RBD A;  3NTI A;  1V9P A;  4LF5 L;  4A3J G;  2N49 A;  1JE5 A;  5L1J A;  1Y1V A;  2AUJ D;  4EBD A;  3Q22 A;  5C4H A;  1STB A;  5H80 A;  4GN3 B;  4A3C H;  2F0Q A;  1B9M A;  2YYZ A;  4I4T F;  1SSO A;  2HVQ A;  5C8Y F;  4POF A;  4RNM A;  1N34 L;  2UUB Q;  1M4V A;  5IYB G;  4RA8 A;  5FK9 C;  5FJ8 H;  3W3A A;  2CW7 A;  4ZRZ A;  4OHJ A;  1W93 A;  1GXD C;  5C3X A;  3BYY B;  1K8O A;  1LTR D;  2K1B A;  1X3Q A;  2L4N A;  4DV1 H;  4IR1 A;  3S1M B;  3KOJ A;  1CHP D;  1WTO A;  5JJK A;  2R7L A;  4BBS B;  3X3N A;  3OWE B;  4ECX A;  5C44 B;  1KEE A;  1JOQ A;  1XNR Q;  4F4Z A;  1SJH D;  5DG8 A;  3J80 E;  1O7Z A;  1P8L A;  1R4Q B;  5IYD H;  4DV7 H;  4DV5 H;  2XCA A;  1GLV A;  4C5C A;  4DU9 A;  1PH7 A;  4GS3 A;  3HOX G;  1B6S A;  3J7A 5;  1JJ2 A;  4GC7 A;  2KVM A;  4R8I A;  4TQR A;  1J6Q A;  2VUG A;  2R86 A;  3RF2 A;  1O7Y A;  1Y8O B;  2WAQ E;  4A3L H;  2PMZ A;  1Y1V G;  3OSP A;  3A8J E;  1D5Z C;  4F87 A;  2W6Q A;  3D4R A;  2R7F A;  4ZLT F;  3HB9 A;  4IUQ A;  3KAK A;  3HGB A;  4TRD A;  3EPI A;  3GV7 B;  1EQR A;  2OLS A;  4PMC A;  2NVY H;  2E5L Q;  2QYZ A;  5GAH C;  4FXD A;  3C1F A;  2X69 A;  3T51 B;  1HZC A;  2OQ0 A;  1SNM A;  3KAJ A;  2O2L D;  3RIZ A;  4G57 A;  2DY8 A;  4X3S A;  1VCI A;  3CHB D;  1EUD B;  4C1N I;  2B2Y C;  3BG5 A;  1FR3 A;  3EPG A;  1SCU B;  2EDG A;  4PZ7 A;  4A3J B;  1VBG A;  4U68 A;  2G9D A;  2IT1 A;  4FS1 A;  2ZDG A;  4AQY Q;  2WAQ A;  1NNX A;  3DF7 A;  3K3P A;  3BZC A;  4N9T A;  1PFM A;  3H09 A;  3BJY A;  1JX4 A;  2F0L A;  4FBT A;  4IZ8 A;  1EEF D;  4RAY A;  3PIO 3;  3CC7 A;  2NVQ H;  4JI3 L;  5CV8 A;  1FD7 D;  2RHQ B;  4YY3 L;  3OOC A;  3GTQ B;  5CYU A;  4L5R C;  5KFX A;  2CCZ A;  4RWS C;  4PZ8 A;  5KRU A;  3BDC A;  4RU9 A;  5DEH A;  4UCV A;  4QWA A;  3VR6 A;  4MA0 A;  4K14 A;  2EXZ A;  2IL8 A;  4DKA C;  1ILP A;  2W7P A;  2FPG B;  4ID6 A;  3HOV G;  3K5M A;  2HJW A;  5KFO A;  1PH6 A;  3UDF A;  3JAM W;  4KD3 A;  2UXC L;  1AFP A;  5FLX W;  4LF4 Q;  4Q0Y A;  2XSC A;  2A6H C;  2FMM A;  3HOX B;  2UVV A;  1PTO H;  3I3C A;  3MWY W;  4BBS H;  1TWG A;  2VUM A;  3SK6 A;  1ENF A;  1GSO A;  4DFA A;  3CC2 A;  4UCR A;  3W1G A;  1VQ8 A;  4L6T B;  3PO2 G;  4A2A A;  3CRK C;  4AYB E;  4CKB A;  4JYA Q;  2R7N A;  4EYI B;  1CT1 D;  5E4W C;  4LW1 A;  4FP5 D;  4JV5 Q;  4LFC H;  4BBR H;  3OIP A;  1LTB D;  2MJ8 A;  2ZXO A;  4YCV A;  1RDP D;  1XMO L;  5M5W H;  4PMW A;  4JC0 A;  1AE3 A;  4YWL A;  1QE6 A;  3SXH A;  2YW2 A;  3BZD B;  1I6U A;  1NR2 A;  2B8F A;  2PI2 E;  3RFC A;  5KFM A;  4DUY Q;  4KK7 A;  3HKZ G;  2D5D A;  4LFA Q;  5T14 A;  2UUB H;  1KJQ A;  2FK2 A;  1S40 A;  3K0Y A;  2L1B A;  1CM9 A;  2W71 A;  4XX0 B;  2NVX A;  3LML A;  1T5X D;  1CZW A;  2IW3 A;  3GV6 A;  1JWM D;  3I4O A;  2FE3 A;  2Z6K C;  4P73 A;  2HD3 A;  5FO7 B;  4JUZ A;  2RBM A;  3BQ1 A;  3PIP A;  4IZO A;  2AU0 A;  3PUZ A;  1IW7 C;  2PW7 A;  1JWU D;  3MFH A;  3J81 c;  3Q23 A;  2B2Y A;  3I7F A;  3H0G A;  1I4X A;  5EKL A;  4UCS A;  4DAY A;  3OWF A;  5KYI A;  4KHP L;  4X62 H;  3ZYY X;  4JV2 A;  2VUM G;  4RB0 A;  5EKI A;  1Y69 U;  3FMA A;  1LTA D;  2JXM B;  2XD4 A;  1EWH A;  1KAB A;  4PMB A;  1Q82 C;  3DMU A;  3G71 A;  3CCQ A;  4CC5 A;  1M0T A;  4BXX G;  5CV7 A;  4U67 3;  3C0F B;  1X9N A;  4EEQ A;  4OIK A;  1OXU A;  2N8N A;  3HOZ H;  2ASL A;  3GDE A;  3UI2 A;  1YIJ A;  2EE1 A;  4Q45 A;  2K75 A;  3S2H B;  4B3R L;  4A3K H;  5ELE A;  1QZG A;  1UNN C;  4I50 F;  3AYH B;  4H44 C;  3CME A;  3GTQ H;  1QVC A;  4FF2 A;  2C00 A;  4KI0 A;  2E5L H;  2O5I C;  4MA5 A;  2K52 A;  3UE1 A;  1DIK A;  1XTC D;  4LF7 L;  4LH7 A;  3BJU A;  3PO2 B;  4OON A;  3BS1 A;  2UU9 Q;  2F0D A;  3F2D A;  1SYX B;  3NEN A;  3KLS A;  2HQE A;  1PH2 A;  4MTE A;  5KG5 A;  1EIY B;  4B3T Q;  4PZ6 A;  3MFY A;  4LH6 A;  3VYU A;  1Z9F A;  4IUP A;  4KJO A;  3E0J A;  1FJG Q;  2FJ2 A;  3M7N A;  2YU9 B;  1J8I A;  5E3F A;  3GTL B;  2K7V A;  4R7R A;  1R9T H;  4J1M A;  5LXT F;  2I07 B;  3HKZ B;  2R92 H;  1EFI D;  2RQX A;  3FKI H;  5G3L D;  3UDG A;  3DHQ A;  4C5B A;  1MGS A;  3HKS A;  3ONA B;  4KTA A;  5C4X H;  3R8B A;  3KHG A;  1EU4 A;  2R7D A;  4JI6 L;  1BCP C;  4IOC A;  1SEI A;  1E24 A;  2OXP A;  2W9C A;  5D3D A;  3RTX A;  4ED6 A;  1EU3 A;  1H9S B;  3GV5 B;  3JAM i;  1ML0 D;  4HAE A;  3FVQ A;  1U4L A;  1PMR A;  3AB9 A;  3F2B A;  1WTW A;  2ICE C;  4LF9 L;  3GTJ B;  4GLA C;  1Q8I A;  4C2M H;  2BQU A;  2HCC A;  2WFW A;  4MV8 A;  2UXD Q;  3NGD A;  1QB5 D;  2FMC A;  5IP9 G;  2C28 A;  4RNN A;  4Q8E A;  2E2H A;  2EYH A;  3FP9 A;  1K3B C;  3NTK A;  4V0B A;  3HEJ A;  4KKT A;  4GC6 A;  3JRX A;  4JV0 A;  1S0N A;  3KDF A;  4LF4 H;  3V6J A;  1QIL A;  5D1P A;  3L4K A;  5IGC A;  4C1N K;  3TSS A;  5BN4 A;  3RLN A;  4POG A;  4O4H F;  4HMJ A;  1SMX A;  4R4I A;  4UAI A;  1W6J A;  2HT1 A;  4LNQ A;  4JYA H;  1TKW B;  1IKL A;  3CQZ A;  3DEO A;  3GTP B;  4JV5 H;  2GLT A;  4O4I F;  1SND A;  5DLQ E;  4QGU A;  2YZN A;  2IMW P;  3QJY A;  3EVQ A;  5LL6 b;  5CV5 A;  2R84 A;  4FO2 A;  1CTM A;  4HSP A;  1ZHS A;  2J4X A;  4QY7 A;  3SR1 A;  2W6P A;  1ICW A;  4DR6 L;  4IN3 A;  4DUY H;  1A63 A;  1NMF A;  5IGF A;  5LOV F;  1TT2 A;  3M4Y A;  1I7L A;  1IXR A;  2VQE L;  2UUA L;  4B08 A;  1YIT A;  5D1O A;  3D4D A;  2F4V H;  1XPU A;  3U9S A;  3STB C;  3FPU B;  1AZQ A;  2EVB A;  3G6V A;  3A0J A;  5BR8 Q;  3PIP 3;  1KD1 C;  5DM6 3;  3D8G A;  1Q8K A;  4YQW A;  3A5Z B;  4OO1 H;  1SNP A;  1XNQ L;  1GUO A;  1KDB A;  3J7Y W;  4ED8 A;  1YBY A;  2MGS A;  1ZYR D;  1HA5 A;  3U58 A;  4C3H B;  2E2J H;  1FGB D;  4A3G G;  4CC6 A;  4DR7 Q;  4LF6 L;  1GUW A;  4C3I H;  1F2Y A;  2R8J A;  1STG A;  4OWX B;  4MAM A;  4I7H A;  1MSH A;  2A69 D;  5KG0 A;  5DLF A;  3I55 A;  4A3I G;  3QOL A;  1G51 A;  1X54 A;  1WTX A;  4A3B G;  1PH5 A;  2D9U A;  2BH2 A;  4PV1 C;  5JUM A;  2GVA A;  4PQX A;  4DR1 H;  1K8A C;  4K2K A;  2YU9 H;  5KT7 A;  4MTD A;  4G7H C;  5I2Y A;  3OTO Q;  4HNU A;  4RGO S;  1N32 Q;  3MWM A;  4GLX A;  2DGY A;  1C7Y A;  1K0R A;  3S16 H;  1RK6 A;  4GNX B;  2N3S A;  3K7A B;  2B63 H;  4A3D G;  1SDF A;  5JEA J;  3J7A F;  2KHS A;  4N8F A;  5EKK A;  5C4J B;  3N6X A;  4RHS A;  2KJX A;  1G8Z D;  1I3Q H;  2ZXR A;  4OL7 A;  1B70 B;  1Y1W G;  3BDL A;  4F4Y A;  1HRJ A;  4XIG S;  4HN7 A;  1SE8 A;  3OMC A;  4QIW B;  1AW7 A;  3CCJ A;  4DV2 Q;  5KG2 A;  1QJO A;  1HZA A;  2BCO A;  2CQA A;  1WJJ A;  3S1R B;  2KBN A;  1X3F A;  2UU9 H;  1OXT A;  1YJW A;  4A93 G;  1SFO B;  5FPO A;  1A15 A;  2GVB A;  1CS0 A;  3T53 B;  1HUN A;  4B3T H;  2ENB A;  4IWY A;  2W6N A;  1FNW A;  3JZI A;  3WWV A;  4CDE C;  2YYA A;  2K04 A;  4ECS A;  2YRW A;  1BUV T;  2YTV A;  1TS5 A;  3TRZ A;  3F8T A;  5GAG C;  1DOK A;  3GTG B;  2NZO A;  3OMG A;  4ZUI A;  4YHH Q;  3MFG A;  4K0K H;  2VPQ A;  1CKO A;  2MO0 A;  2XIW A;  2A8V A;  1BDO A;  5EWG A;  4DR5 L;  3K59 A;  1GHK A;  2XCL A;  4KLK A;  4JI8 L;  1ENA A;  1GOZ A;  4J9M A;  2EJG C;  3BVZ A;  1NE3 A;  4PDB A;  5M5X H;  1WTV A;  4F4X A;  3HOY H;  4RG1 A;  1CSP A;  1ZEQ X;  1L1O A;  4JI2 Q;  2F0K A;  1QZH A;  1M1K C;  4XZ3 B;  3KDF B;  2UXD H;  1UUP A;  3GV3 A;  5M5Y H;  1F9R A;  5K36 G;  3DXJ C;  4ED0 A;  3RR5 A;  3U4V A;  1I4H A;  1S97 A;  4A3B B;  2QCP X;  1LTG D;  2A6E C;  4X64 Q;  1C30 A;  3K3V A;  3RLO A;  2I5H A;  5JVD F;  1JOR A;  1CI3 M;  1PTO C;  1PZJ D;  4C3H H;  2RDH A;  3ERO A;  1XTD A;  1A3U A;  1TWF A;  5KFS A;  2JA6 A;  5KFE A;  1VQP A;  2V4D A;  5C1P A;  4J9P A;  1I4Q A;  4A3D B;  4DNT B;  3GTO H;  4LAA A;  1XX8 A;  3IKJ A;  1C0A A;  5K5P A;  2JJQ A;  3T5L A;  4BA1 I;  2JEA I;  3NSW A;  1PDQ A;  2E74 C;  1AH9 A;  1XDN A;  4O3O A;  2VA2 A;  1Y1W B;  3PF4 A;  2R3Z A;  2KED A;  1WSC A;  4A3C G;  5F9L A;  4K5X A;  4GZY C;  3HG9 A;  4JI1 L;  1CKN A;  4WD3 A;  4LF5 Q;  1UEA B;  1KAA A;  4OIJ A;  1IBM Q;  3M3Y H;  2FIN B;  3K7A H;  1S9F A;  1V1P B;  1SNQ A;  3E0E A;  5BR8 H;  2W8L A;  2E75 C;  4DK6 C;  5KFL A;  5C4J H;  5KFT A;  3GTM H;  3DM1 A;  3E9I A;  4ILW A;  1N34 Q;  4O3P A;  1S5C D;  1U4P A;  3FHW A;  4DR7 H;  1STY A;  3ETH A;  3SGI A;  5KFV A;  1E0B A;  2E76 C;  1SYB A;  5IGE A;  4FBU A;  4PG3 A;  1SFO H;  2I8C A;  1J5E H;  5FKA C;  2JA6 G;  2E2I A;  2CW8 A;  2Y0S G;  2A73 B;  2B2W C; 
#chains in the Genus database with same CATH homology
 2F4V L;  2JA8 H;  1P16 A;  3GTL H;  3KOJ A;  5ELN A;  5JJK A;  3HOU G;  1WFQ A;  3GTG H;  4GKK Q;  4BY1 G;  4IPD A;  1W2B A;  3K8A A;  4HJ8 A;  3CD6 A;  3PCO B;  4DV3 Q;  3TQY A;  4DV4 L;  1A8V A;  2ASB A;  1XNR Q;  1Q81 C;  2CWA A;  3PV0 A;  2IX0 A;  1P8L A;  2Q2U A;  1FGU A;  3CF5 A;  5IYD H;  2BA0 A;  4YCU A;  4DV3 L;  4GS3 A;  1TWA H;  1PH7 A;  3HOX G;  2L15 A;  1XNR L;  4DR1 Q;  3J7A 5;  4NXN Q;  1JJ2 A;  4DPG A;  3GTK H;  3D31 A;  3HOU H;  3J7Z C;  4DV4 Q;  2A19 A;  1D7Q A;  3CCE A;  3GTJ H;  4O2D A;  1BVS A;  1J6Q A;  3K80 C;  3MEF A;  4UP9 A;  5HGQ A;  2WAQ E;  4A3L H;  3CCL A;  1Y1V G;  5JJI A;  1VQA A;  4DR1 L;  2K5V A;  3F1Z A;  1YHB A;  2R7F A;  1O7I A;  5GRO A;  4NXN L;  3AFP A;  4AYB G;  2VUM H;  1NBW A;  1BBW A;  3BU2 A;  3K81 C;  4DAM A;  3CPF A;  3S24 A;  1X65 A;  2OTL A;  1EQR A;  3T1H Q;  4A3M G;  1TWH H;  1VQN A;  3KFU A;  4NB3 A;  1KXL A;  2NVY H;  1QUQ B;  2E5L Q;  2CFM A;  4A4I A;  5GAH C;  2EQS A;  4GNX A;  3AFQ A;  3PUX A;  3HOY G;  1PYS B;  1HZC A;  5C3E G;  1UWV A;  1AE2 A;  2OQ0 A;  3CXC A;  3T1H L;  3J80 i;  3I4M G;  2E5L L;  3S1N H;  3GTP H;  1PVO A;  1VCI A;  1GO3 E;  4A75 A;  1Q12 A;  3L7Z C;  4PZ7 A;  4P74 A;  3K0X A;  4P71 A;  2IT1 A;  4JI3 Q;  4L5T A;  3M9B A;  3NBH B;  4AQY Q;  1U0L A;  1A62 A;  4YY3 Q;  3G4S A;  3BZC A;  1KIX A;  1NY4 A;  4K0K Q;  1HZ9 A;  3CCR A;  3CC7 A;  2NVQ H;  4DR2 Q;  2HHH Q;  4JI3 L;  2Y0S E;  4AQY L;  1SN8 A;  4R4Q A;  3EBE A;  2RHQ B;  4YY3 L;  2JA9 A;  3EN2 A;  5M3M G;  4DV0 Q;  2K4K A;  4JBW A;  1C9O A;  4L5R C;  5IP7 H;  2QGQ A;  3L2P A;  2CCZ A;  5LMN Q;  4PZ8 A;  2I0Q A;  2AHO B;  2HQL A;  3PO3 H;  5IE8 A;  2MO1 A;  4GOP A;  1S72 A;  2I5L X;  1HNZ Q;  5H1S E;  2HHH L;  2I5M X;  2OWO A;  1V1Q A;  3I56 A;  4BY7 H;  2UXC Q;  4X66 Q;  3A74 A;  4DV0 L;  4DKA C;  4UP8 A;  3H3V I;  5LMN L;  4UPA A;  3HOV G;  1HNZ L;  4X65 Q;  1BKB A;  2WB1 G;  3KLW A;  1PH6 A;  4H02 A;  3UDF A;  2UXC L;  4X66 L;  4IFD G;  1SRU A;  4MTN A;  4IO9 A;  4A3E H;  4LF4 Q;  2N78 A;  4HJ7 A;  1NJI C;  1S3O A;  1SLJ A;  1XMO Q;  2B3G A;  4X65 L;  1CKM A;  4BBS H;  1GM5 A;  1LM0 A;  3CC2 A;  4JI4 Q;  3W1G A;  1VQ8 A;  3PO2 G;  4LF8 Q;  4R1J A;  4AYB E;  1VQF A;  2D0O A;  4JYA Q;  2K50 A;  4LF4 L;  2D62 A;  1K3R A;  3U50 C;  5IP9 H;  4LW1 A;  2R93 H;  5JJL A;  4JV5 Q;  5FJ8 G;  4BBR H;  4YCV A;  1XMO L;  1WI5 A;  5M5W H;  2R7Z G;  3RN5 A;  4PMW A;  4JC0 A;  2KCM A;  1AE3 A;  2AWO A;  2ALY B;  4YWL A;  1RIP A;  4APV A;  1VQO A;  4JYA L;  2JA8 G;  1IBM L;  1I94 Q;  3I2Z A;  3KJP A;  4B3S Q;  1HR0 L;  2PI2 E;  4IPC A;  1MJE A;  4JV5 L;  4DUY Q;  4GKJ Q;  1VQ4 A;  3HKZ G;  1XJV A;  1EUJ A;  1VQB A;  4LFA Q;  5IWA Q;  3S1R H;  3M4Q A;  4OXP A;  5AJ3 Q;  4HIO A;  2F3I A;  4MZ9 A;  2K5N A;  1I94 L;  4B3S L;  1X3G A;  3PSI A;  3RN2 A;  1S40 A;  1PH3 A;  4JI7 Q;  1L1O C;  3HOW H;  4DUY L;  3VDY A;  1GD7 A;  2CWP A;  4LWC A;  5IYD G;  2ZJQ A;  1HH2 P;  5HY6 A;  4HID A;  4GKJ L;  1VQJ A;  3PUY A;  3KF6 B;  1A0I A;  3TRE A;  3I4O A;  5IWA L;  3M85 A;  2Z6K C;  4P73 A;  4LFA L;  5AJ3 L;  4KHP Q;  3ZJY C;  2NN6 G;  2ZJR A;  3PIP A;  4JI7 L;  1WCM H;  5J3B A;  4B3M Q;  3PUZ A;  3DM3 A;  4IJH A;  2E8G A;  1YVC A;  3AQQ A;  3TEH B;  4ALP A;  1QVG A;  1M90 C;  2UUC Q;  4A3L G;  2PQA A;  3RLF A;  2VS1 A;  3I7F A;  3J81 c;  5C0X J;  5IYC H;  4KHP L;  1D8L A;  1IZ6 A;  2VUM G;  4GKK L;  3OW2 A;  4A3F H;  4R4C A;  2MFI A;  3RZD H;  4B3M L;  1J5E Q;  1Q46 A;  1OXS C;  3H3V H;  4J15 A;  5FLM G;  1V43 A;  3ULP A;  1Q82 C;  2UUC L;  4DR3 Q;  3B6Y A;  3G71 A;  3CCQ A;  1PH4 A;  4WJ4 A;  5JEA G;  1KRT A;  4DNI A;  4A3G H;  1X3E A;  2PNH A;  4BXX G;  2LXK A;  1HJP A;  2NZH A;  4B3R Q;  4LFB Q;  1X9N A;  2RF4 A;  2IHE A;  2KHJ A;  5GAE C;  3J80 c;  5LMN W;  1X6O A;  4YCW A;  1OXU A;  3J81 i;  2N8N A;  4DR3 L;  3HOZ H;  3L0O A;  3GDE A;  1YIJ A;  1GVP A;  3S2D H;  2K75 A;  1TWG H;  4A3I H;  1E1T A;  3CP0 A;  4OX9 Q;  5ELO A;  2JA7 H;  4A3K H;  4B3R L;  4LF7 Q;  4A3B H;  4LFB L;  1QZG A;  1PHJ A;  3AYH B;  1EQQ A;  3TS2 A;  1KRS A;  3CME A;  1KQS A;  1MKH A;  4P75 A;  1QVC A;  3GTQ H;  1WYD A;  4KI0 A;  4A76 A;  1OTC A;  2K52 A;  3UE1 A;  4BXX H;  1Q1E A;  4OX9 L;  3G48 A;  3ULL A;  4LF7 L;  3BJU A;  3IRB A;  4KHZ A;  1IBL Q;  4Y7N H;  4HIK A;  2UXB Q;  2JA5 H;  4OON A;  3ERS X;  1E22 A;  3FKI G;  2UU9 Q;  4A3D H;  2WP8 J;  1L1O B;  1K83 H;  3F2D A;  1HNX Q;  3NEN A;  1PH2 A;  1VQ6 A;  2XTI A;  1CUK A;  1EIY B;  4B3T Q;  4PZ6 A;  1LYL A;  1I5F A;  2K5H A;  3RNU A;  1IBL L;  1Z9F A;  1PH1 A;  1FJG Q;  5IP7 G;  4JCV E;  1VQL A;  3M7N A;  1Y1W H;  2UXB L;  3JAM c;  5FLX c;  2UU9 L;  3PO3 G;  4OWT B;  1X56 A;  3KF8 B;  2LSS A;  3Q8D A;  3UDX A;  1HNX L;  1YZ6 A;  4TQU S;  1YI2 A;  4P72 A;  1R9T H;  1CSQ A;  2NVX H;  3I4N H;  3EIV A;  4BY7 G;  4JOI C;  4JI6 Q;  4B3T L;  1VQG A;  4HJA A;  2R92 H;  5M3F H;  1FJG L;  3E9H A;  3FKI H;  4OO1 I;  4GOP B;  3UDG A;  1QUQ A;  2ZTC A;  3HKS A;  1EFW A;  3U4Z A;  5C4X H;  4A93 H;  4DR4 L;  3HFZ B;  4LF9 Q;  3M4O H;  4IOA A;  1W3S A;  2R7D A;  1UE5 A;  4JI6 L;  4C3J H;  3H0G H;  4IOC A;  4K0K L;  1E24 A;  4A3E G;  4DUZ Q;  2ATW A;  2A1A A;  3JAM i;  3ICE A;  2ZTD A;  2QEX A;  4DR2 L;  3F2B A;  4BBS G;  2K14 A;  4LF9 L;  2CKZ B;  4GLA C;  2Q2H A;  1VQC A;  4C2M H;  4DV6 Q;  2GN5 A;  5C44 G;  2WFW A;  1RL2 A;  2XGT A;  2UXD Q;  4DUZ L;  5IP9 G;  2R93 G;  4QL5 A;  2AWN A;  2BH8 A;  1KC8 C;  4BBR G;  2ZM6 Q;  2ZTE A;  1I6H H;  4EQ5 A;  3PUV A;  1CKN B;  4R4T A;  4DK3 C;  3PF5 A;  3FP9 A;  1JB7 A;  4BA2 I;  1L0W A;  4DV6 L;  2UXD L;  2QA4 A;  3BZK A;  3KDF A;  1GKH A;  3S1M H;  1N36 Q;  1PFS A;  2ZM6 L;  4L5S A;  3RLN A;  1OXV A;  1SRO A;  3OYY A;  5EAY A;  1SMX A;  3CCM A;  4R4I A;  4POG A;  5C44 H;  4IPH A;  1K73 C;  4IFD J;  1EYG A;  2HT1 A;  1MIU A;  4LNQ A;  2WAQ G;  4DR6 Q;  4IPG A;  1N36 L;  3HOW G;  2VNU D;  2YTY A;  3S17 H;  4QGU A;  5DLQ E;  4JI5 Q;  2JE6 I;  4JI4 L;  1X55 A;  2VQE Q;  2UUA Q;  4LF8 L;  1UEB A;  1B7Y B;  2YV5 A;  4QY7 A;  1KAW A;  5LMU Q;  4DR6 L;  1WCM G;  1G29 1;  1YNX A;  4JI5 L;  2BA1 A;  1A63 A;  1NMF A;  2VZA A;  4XTC S;  2KHI A;  1XNQ Q;  1IXR A;  2VQE L;  2UUA L;  4O0A A;  3K7U C;  2VQF Q;  1YIT A;  5IYC G;  1XPU A;  1Q1B A;  2AMC B;  3STB C;  5LMU L;  3A0J A;  5BR8 Q;  1KD1 C;  4A3F G;  4LF6 Q;  2IY5 B;  1HZB A;  1Q86 C;  1Q8K A;  1XMQ Q;  3A5Z B;  1N9W A;  1U5K A;  2B29 A;  2OCE A;  3PUW A;  3A5U A;  1XNQ L;  4GLV B;  1YBY A;  4JI0 Q;  1G6P A;  3U58 A;  2E2J H;  4JBK A;  4A3G G;  1UE7 A;  4DR7 Q;  3LGJ A;  5BR8 L;  4LF6 L;  2R6G A;  4C3I H;  1XMQ L;  2C35 B;  4OWX B;  1JMC A;  3JC6 6;  3HOZ G;  4IJL A;  1HR0 Q;  4JI0 L;  3I55 A;  2PMZ E;  4HJ9 A;  4GOP C;  4A3I G;  4DR7 L;  1G51 A;  1NMG A;  4HJ5 A;  1NTG A;  4A3K G;  2JA7 G;  1X54 A;  4A3B G;  1PH5 A;  1YJ9 A;  2BH2 A;  2V1C C;  2KEN A;  2JEB I;  4JOI A;  1XPR A;  2GVA A;  2PI2 A;  4DV1 Q;  4A3J H;  1K8A C;  2YU9 H;  4AIM A;  3S1Q H;  3OTO Q;  3NEM A;  2E2H H;  1LTL A;  1N32 Q;  4GLX A;  1Y14 B;  2DGY A;  1J5E L;  1KHI A;  1C7Y A;  5IT9 c;  1K0R A;  3S16 H;  2OQK A;  1VS0 A;  2FXQ A;  4MNO A;  4GNX B;  1UE6 A;  2N3S A;  2WB1 E;  3KF6 A;  4DV1 L;  1VQH A;  5IYB H;  1VQ5 A;  2JA5 G;  5JEA J;  2B63 H;  4A3D G;  4X62 Q;  2IHF A;  2KCT A;  3OTO L;  1ASY A;  4OWW B;  1N32 L;  1VQM A;  1TWF H;  1YHA A;  4DV7 Q;  4DV5 Q;  2RHS B;  1YJN A;  2JA6 H;  3NEL A;  1I3Q H;  1WOC A;  3CQZ H;  5FLM H;  4QQB X;  1B70 B;  1Y1W G;  4QIW E;  4QJF A;  3PGZ A;  2RCN A;  4XIG S;  4X62 L;  2ID0 A;  3G6E A;  3TS0 A;  3I4N G;  1SE8 A;  2YTX A;  3T1Y Q;  1IL2 A;  4YWM A;  4LUV A;  3CCJ A;  1EOV A;  4DV2 Q;  4DV7 L;  4DV5 L;  3CC4 A;  4BY1 H;  4R4O A;  2R92 G;  5M3F G;  2Z0S A;  1HZA A;  1WJJ A;  1K8G A;  1SR3 A;  2KBN A;  1FVI A;  1KL9 A;  1X3F A;  1TWC H;  4RMF A;  1OXT A;  1YJW A;  3W1B A;  5C4X G;  4A93 G;  2JK8 A;  2GVB A;  3T1Y L;  4DV2 L;  1HNW Q;  3H0G G;  3UDI A;  1YEZ A;  1VQ7 A;  1Z47 A;  1I50 H;  3WWV A;  4DR5 Q;  3HOX H;  4TVA B;  4DR4 Q;  2YTV A;  3HKZ E;  3TRZ A;  2JQO A;  3F8T A;  5GAG C;  2NZO A;  2IX1 A;  1OXX K;  1IYJ B;  4X6A H;  4YHH Q;  1HNW L;  1PH9 A;  3M4P A;  4JI8 Q;  3J81 j;  1XPO A;  1CKO A;  2MO0 A;  2ES2 A;  1Y1V H;  3ER0 A;  4GN5 A;  2A8V A;  2CQO A;  3KYH C;  4DR5 L;  1VQK A;  3CCS A;  1QVF A;  2VY3 A;  4IFD I;  2Q2I A;  4KLK A;  4YHH L;  4JI8 L;  2F52 A;  1PH8 A;  4A3M H;  1NE3 A;  1Q7Y C;  4Y52 H;  1PYB A;  2DUD A;  4JBJ A;  1E1O A;  3STB D;  5M5X H;  3RZO H;  3HOY H;  4RG1 A;  1CSP A;  1L1O A;  4JI2 Q;  1VQE A;  2E2I H;  5C3E H;  3MXN B;  3ULJ A;  2Q2T A;  1QZH A;  1YHQ A;  4HIM A;  1M1K C;  3KDF B;  4LUO A;  2D0P A;  4ME3 A;  5M5Y H;  2Z6K A;  3KJO A;  3CCV A;  3I4M H;  5K36 G;  4NXM Q;  3F2C A;  3RR5 A;  3U4V A;  1E7Z A;  4JI2 L;  2NVT H;  1HR0 W;  3D0F A;  4GN4 B;  3W5O A;  2HIV A;  1JJC B;  4X64 Q;  1B8A A;  3RLO A;  1PV4 A;  2I5H A;  2VW9 A;  4C3H H;  3PIO A;  1N8R C;  1TXY A;  4NXM L;  3CMA A;  2ZJP A;  2AKW B;  1XTD A;  4YWK A;  4NPS A;  2EIF A;  1K9M C;  3GO5 A;  4X64 L;  3CAM A;  2EXD A;  4GNX C;  1VQP A;  5E7N A;  2HIX A;  3UE0 A;  3GTO H;  2H5X A;  5C0X I;  4OO1 G;  1LUZ A;  3CPW A;  1C0A A;  2JJQ A;  4JI1 Q;  4BA1 I;  2JEA I;  2VL6 A;  1AH9 A;  2NN6 I;  1EIF A;  1EWI A;  2MQH A;  1T9H A;  5M3M H;  3CCU A;  4UP7 A;  4UY8 C;  3PF4 A;  1VQ9 A;  4JBM A;  5GAD C;  1VQI A;  4A3C G;  3GD7 A;  2LXJ A;  1DGS A;  3S14 H;  4JI1 L;  1CKN A;  4FDB A;  3DLL A;  1IBK Q;  4LF5 Q;  1ASZ A;  1PA6 A;  1IBM Q;  3M3Y H;  3K7A H;  3S2H H;  1N33 Q;  3E0E A;  1FL0 A;  4LFC Q;  3CW2 C;  3HOV H;  1H95 A;  4DK6 C;  4EX5 A;  5C4J H;  1L2F A;  2PQA B;  1JT8 A;  3GTM H;  2MNA A;  3E9I A;  2VQF L;  1N34 Q;  1V9P A;  4DAY B;  1IBK L;  4LF5 L;  4A3J G;  2N49 A;  1JE5 A;  1JJG A;  3FHW A;  1N33 L;  4LFC L;  4WJ3 M;  4GN3 B;  4A3C H;  3S15 H;  2YYZ A;  5GQO A;  2OTJ A;  1VQD A;  3SGI A;  3AEV A;  4POF A;  1UE1 A;  1N34 L;  3PO2 H;  2UUB Q;  2F4V Q;  4JG2 A;  5IYB G;  2B63 G;  1MJC A;  4AH6 A;  4PG3 A;  5FJ8 H;  1SFO H;  2JA6 G;  2R7Z H;  4LUZ A;  3H15 A;  1E3P A;  1BBU A;  2Y0S G;  4L5Q A;  5C0X G;  2UUB L;  5IY0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...