3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
2UUBL 3CF5A 3J80i 2OCEA 5ELNA 4IJHA 1WFQA 1VQPA 3S1NH 3RN2A 4PZ6A 2GVAA 3CCMA 1JJCB 2UXBQ 1EOVA 3W5OA 4BXXG 5C0XG 2CFMA 4KHZA 1PYSB 5ELOA 3I7FA 5C4JH 1Z47A 3CP0A 4L5SA 4B3SQ 4DV3Q 2AWNA 4A3FH 1GD7A 1L0WA 4BY1G 3HOYH 3CPFA 5H1SE 4JYAQ 4JI1Q 4JI8L 4A3EH 1HJPA 1I3QH 3CQZH 1X54A 4WJ3M 4EQ5A 3ERSX 4IO9A 4JI3Q 4DR6L 2B29A 4TQUS 1VQIA 2MO1A 2NZOA 1LUZA 2V1CC 4DR2L 3UDGA 4LF8Q 4A93H 4A3IG 4L5RC 4POFA 2VW9A 3CW2C 2Z6KA 1QZHA 1HNXL 5IYDH 4UP9A 4X64L 5LMNW 4GOPA 4B3TL 1Y1WH 1K8GA 5JEAG 4J15A 4LF5L 1XNRL 1YEZA 4HJ8A 4AIMA 1QVCA 4QGUA 2UXCL 2HIVA 4JI7L 2UU9L 3JAMi 3PO3H 4GLVB 4LF4L 3UE1A 1V9PA 4BBSH 2JA5H 4KI0A 2R6GA 2Z6KC 3J81j 4GOPC 1PHJA 3AQQA 4LF7L 4P72A 1GO3E 1SLJA 3F1ZA 2JEAI 4DR7L 1XPUA 3I2ZA 2JA8H 3FKIG 3GDEA 1U5KA 4A3MG 2A8VA 1JJGA 3CCUA 3IRBA 4B3ML 1VQDA 3PUZA 2JQOA 3GO5A 4A3GG 3A5ZB 3GTGH 4DV1L 2UUCL 2BA1A 3CCVA 1MJCA 1Y1VH 1PH2A 2K5HA 1PYBA 4X62L 2L15A 2E5LQ 3NEMA 4A3DH 4HIMA 3S24A 3U4VA 3CMEA 4GOPB 1YZ6A 1OXVA 3TRZA 1HNWL 4RMFA 5FJ8G 1IBLL 1A0IA 1CSPA 4DUZQ 4A3KG 2ID0A 3W1BA 1E3PA 1UE6A 2OQ0A 5IT9c 1VQ9A 3K7UC 2VQEQ 2AWOA 2YU9H 1SR3A 4NXML 4GKJL 4DR3L 4LWCA 2PI2E 5C3EH 4L5QA 4DV6L 4DNIA 4O0AA 5IE8A 1I50H 4Y7NH 4R4OA 4X65Q 4GKKL 2WB1G 1C7YA 4DR4L 4JBJA 5J3BA 4LNQA 3M4OH 3TS0A 1Q7YC 4OWXB 1KIXA 3RR5A 4R4QA 3J81i 2CKZB 3G71A 1BVSA 2YTVA 3M9BA 1WJJA 4FDBA 1QVGA 1TWGH 5IP9G 2JA6H 4YWKA 2NVYH 2FXQA 3AFQA 1CKNA 3L7ZC 2JK8A 4OO1I 2F4VQ 2AHOB 2NZHA 4YWLA 1YHQA 1WCMG 4K0KQ 2VQFL 1MJEA 4MTNA 4P71A 4DV7Q 4A3JG 3PO2H 3ULLA 1L1OA 2QA4A 1EWIA 1V43A 2KBNA 4IOAA 2Q2IA 4OXPA 3M3YH 3K80C 3KDFA 1EQRA 1FJGQ 4IOCA 1U0LA 4BBRG 5LMNQ 4NPSA 1K9MC 2I0QA 4A3BH 3GTOH 3S1RH 1X55A 1TWCH 1XJVA 3PUVA 1L1OC 4A93G 5IYBH 2LXJA 3F2DA 1XNQL 4DV3L 4O2DA 3GTQH 2R93G 4DV4L 1Y1WG 2IHEA 3GTMH 2E8GA 4DV5L 2I5HA 3U58A 2JA7H 4JYAL 2VNUD 1J5EL 1HZAA 2CWAA 2IY5B 4YCVA 4ALPA 4DKAC 3T1YL 4HJ7A 4JI3L 3HOWG 2A19A 4JI5L 3RZOH 4DUYQ 4B3RQ 1DGSA 5IP7H 2K5NA 1SE8A 1L1OB 1BBWA 1YVCA 3RLOA 1GKHA 2ZTEA 3H15A 1LYLA 4HIKA 2E2JH 1G6PA 2XGTA 3OTOL 1N32L 5IYCG 2E2IH 2OTJA 5BR8Q 2XTIA 3HKZG 2CWPA 3L0OA 1N34L 4LFCQ 2BH2A 1E22A 3MEFA 3AYHB 1O7IA 2VUMH 2K50A 5AJ3Q 2UUAQ 4YWMA 4YCUA 1OXUA 2K5VA 3JC66 1JB7A 1VQ8A 2KCMA 2DUDA 1OXTA 2VY3A 2ZM6L 4PZ8A 5IY0A 1PH4A 4DR5Q 3ULJA 1KHIA 2JEBI 3CCEA 1W2BA 1E7ZA 4XTCS 2R7ZG 4LF6L 3TQYA 3K8AA 2EXDA 1MKHA 5C4XH 4OX9Q 3CCQA 1W3SA 3H0GH 1NJIC 4GLAC 1EYGA 3HOUH 4IPDA 1KQSA 2VS1A 1X6OA 4IPHA 4A3LH 4HIOA 4X66Q 3GD7A 1XMOQ 3RZDH 1K3RA 1KL9A 4UP8A 4LFAL 2WAQG 2Z0SA 4DUZL 1IBMQ 2YV5A 4JV5L 1PH3A 1HH2P 3E9IA 1I94Q 1EIYB 5FLMG 1A63A 1QUQA 1PV4A 3AFPA 3FHWA 4LF9Q 3CCSA 3NELA 2H5XA 1JMCA 3HOZG 1IZ6A 1NY4A 1X3FA 1K73C 4IFDI 1VQGA 4OWTB 1YBYA 3I4NG 4A3CG 2R7FA 3PSIA 3PV0A 3T1HQ 3S14H 3F2CA 1X9NA 3M4PA 1JE5A 1S3OA 2GVBA 5M3MG 4KLKA 2UXDL 3VDYA 1SROA 2ZTDA 3Q8DA 4GN5A 3D31A 2JA9A 3TREA 4JI0Q 2MNAA 1KXLA 4POGA 1NMGA 1QZGA 3GTLH 1SMXA 3PF5A 5HY6A 4P74A 2JA7G 1G51A 4LW1A 4JV5Q 2Q2TA 2IX0A 5C44G 1HZ9A 4LUOA 5LMNL 1PH9A 2RF4A 4DV2Q 3H3VH 3UE0A 3G4SA 1RIPA 1IBKQ 2I5MX 1QUQB 3BU2A 3CPWA 1Q86C 3HOVG 4OONA 5GAGC 1SRUA 2OTLA 3BZKA 4DAMA 4H02A 4OO1G 4R1JA 3RLFA 1NMFA 4DV0Q 3KF6A 3CMAA 4DR1L 2JE6I 1UE7A 5E7NA 3PIOA 4IJLA 3S16H 5M3FG 1IL2A 5LMUL 2B63G 4LFBQ 2N49A 2VUMG 2WB1E 3MXNB 1XMQQ 4YHHQ 3OW2A 1VQ4A 2CQOA 1X3EA 3I4OA 1VQEA 2PNHA 3I56A 2GN5A 4DUYL 4JI4L 1VQHA 3GTPH 1VQBA 3CC7A 5GADC 4JG2A 1N36Q 2A1AA 2BH8A 4APVA 3S17H 2UUBQ 3CC2A 1KRTA 4IPGA 2ZJRA 1VQOA 4JI6L 3I4MH 1KAWA 1HR0W 4NXNL 2UUAL 3F2BA 2YYZA 3NBHB 1C9OA 1Q8KA 5GAHC 5IWAL 4YY3L 1K83H 2KHJA 2IHFA 2K52A 1N33L 2D62A 4DK6C 4GLXA 1CSQA 5M5WH 4OWWB 4BY7H 3LGJA 1VQLA 4A3FG 1CKMA 1KC8C 2ALYB 4QQBX 1YJNA 3HOYG 1EUJA 4Y52H 1VCIA 1XPOA 4LUVA 1PH7A 3S15H 2LXKA 4A3EG 2UXBL 2N8NA 4DR6Q 3ER0A 3G6EA 1D7QA 4BXXH 3DM3A 3CCRA 3SGIA 1UE1A 4B3SL 3B6YA 1HNXQ 5IYDG 4X64Q 4B3TQ 1OTCA 1Q81C 2Y0SG 1XPRA 2ZJQA 2C35B 1Q12A 4BY1H 4LF5Q 1XNRQ 5EAYA 1PH1A 1UWVA 4HJ9A 1P8LA 3STBC 1PH6A 2UXCQ 4JI7Q 4BA1I 1WOCA 3HKZE 4JI1L 3STBD 1S72A 3OYYA 1GM5A 2UU9Q 1K0RA 4LF4Q 3PO3G 1CKNB 3EIVA 4BBSG 2JA5G 2ZJPA 1AE2A 2QGQA 3RNUA 4LF8L 4QL5A 2I5LX 4LF7Q 4JI2Q 4GNXA 4DR7Q 2ZTCA 2JA8G 2HQLA 3BJUA 3S1QH 3BZCA 3KDFB 1Z9FA 4ME3A 3J80c 4KHPQ 3RLNA 2NVQH 4DV1Q 1VS0A 4GN3B 4IPCA 1X65A 4X62Q 1Y1VG 2D0OA 4GNXC 3CC4A 4A3DG 1NTGA 4IFDG 1FGUA 5C0XJ 4AH6A 1Q1BA 2ASBA 1HNWQ 2RCNA 3FKIH 4A3MH 4JBKA 1I6HH 4AQYQ 3HOXH 4NXMQ 1VQCA 1D8LA 2IT1A 4DR3Q 2WAQE 3KJOA 4A3GH 1HR0Q 5HGQA 5C3EG 4DV6Q 1EIFA 5JJKA 1Y14B 3ICEA 1OXXK 1RL2A 4GKKQ 1N8RC 3I4MG 1IXRA 2B3GA 4GNXB 2E5LL 1UE5A 1YJWA 1SFOH 1E1OA 3H3VI 1L2FA 2DGYA 4A3KH 1FVIA 2HIXA 1PFSA 4NB3A 1YJ9A 2NN6I 3NENA 4PG3A 3UDXA 2JA6G 1UEBA 2VQEL 4UY8C 3KJPA 5GQOA 4PMWA 5JEAJ 4C3JH 1HNZQ 1PA6A 1SN8A 2HHHQ 3K7AH 2F52A 4DPGA 1P16A 1N36L 1ASZA 4GN4B 1VQ7A 3PO2G 2N78A 3JAMc 4BY7G 1VQ6A 4X65L 2Q2HA 2YTYA 4DAYB 5FLXc 4RG1A 3A5UA 1E24A 3HKSA 1VQFA 1G291 5IP9H 2NVXH 1BKBA 4A3BG 3D0FA 1HZCA 3CXCA 1MIUA 2F4VL 1WCMH 4K0KL 2MFIA 5IYBG 1XNQQ 1JT8A 2D0PA 4A3JH 4DV7L 3PF4A 4DV4Q 4JCVE 3K0XA 4DV5Q 1EQQA 1R9TH 3CAMA 4EX5A 1B7YB 1J5EQ 2Q2UA 3T1YQ 4BBRH 1FJGL 3F8TA 4QY7A 4JI5Q 2R92H 2PI2A 1AE3A 3J7ZC 1YIJA 1H95A 5IP7G 1X56A 3TEHB 1PH5A 4JOIA 2LSSA 1V1QA 4MNOA 1VQAA 3FP9A 3OTOQ 3AEVA 2RHQB 1M90C 1N32Q 4C3HH 2R93H 1N34Q 4MZ9A 5JJLA 2JJQA 2RHSB 3U50C 2N3SA 1N9WA 1HZBA 1NE3A 1B8AA 4R4TA 1QVFA 5C0XI 3S2DH 1J6QA 1WYDA 1YHAA 3HOWH 3J81c 4JOIC 2OQKA 5GROA 1CKOA 2PQAA 5M5XH 4B3RL 1AH9A 2ZM6Q 4JI2L 1C0AA 3EN2A 2IX1A 1A62A 2HT1A 4QIWE 2ES2A 3PUYA 5IYCH 4LF6Q 1YHBA 1GVPA 2WFWA 1BBUA 1KRSA 2BA0A 2VZAA 4LFCL 5BR8L 3HOXG 4HJAA 1JJ2A 1EFWA 3CCLA 4KHPL 5C4XG 3EBEA 2K75A 4R4CA 5AJ3L 1Q1EA 1K8AC 2NVTH 3H0GG 3ULPA 3KFUA 1YNXA 3HOUG 1PH8A 2EQSA 1IYJB 4A3LG 1VQMA 5GAEC 1T9HA 3KF6B 2MO0A 3UDFA 4A76A 2VL6A 4LFAQ 1TWHH 3W1GA 4DR5L 3S1MH 2R7ZH 1VQJA 3CCJA 4AQYL 2K4KA 3KF8B 3PUWA 1KD1C 4GS3A 4PZ7A 2Y0SE 3RN5A 1HR0L 4JI8Q 4OX9L 1VQ5A 1VQKA 1YITA 2PQAB 1Q46A 1LM0A 5M5YH 1TWFH 3ZJYC 4DR2Q 4X66L 3UDIA 1XMOL 4C2MH 2QEXA 1OXSC 3M7NA 4A75A 1TWAH 1IBML 3E9HA 3M85A 3WWVA 4UP7A 2UXDQ 4AYBE 2AKWB 5FLMH 1I94L 1S40A 1HNZL 2HHHL 3E0EA 1M1KC 1PVOA 4P75A 1TXYA 4LF9L 2EIFA 2YTXA 3HOZH 3GTJH 1A8VA 4A3CH 3I4NH 3G48A 1LTLA 4TVAB 4A3IH 3PCOB 3T1HL 1E1TA 5DLQE 4X6AH 4IFDJ 3A0JA 4AYBG 5M3MH 1XTDA 2R92G 3S2HH 4P73A 4B3MQ 1B70B 4HJ5A 2NN6G 2UUCQ 3A74A 4JI0L 4DR1Q 4BA2I 3GTKH 5K36G 2PMZE 2MQHA 4JC0A 4QJFA 5LMUQ 1X3GA 2AMCB 4A4IA 3HFZB 1ASYA 2F3IA 5C44H 4L5TA 4YCWA 1IBLQ 3K81C 2CCZA 4DV2L 1CUKA 3KOJA 4JI4Q 4JBMA 2R7DA 1IBKL 4C3IH 3I55A 3HOVH 4GKJQ 3KLWA 1NBWA 3KYHC 2WP8J 3DLLA 1I5FA 2ATWA 3M4QA 3U4ZA 2KCTA 4DV0L 4DK3C 4JI6Q 5M3FH 1YI2A 2E2HH 4DR4Q 4HIDA 2B63H 3CD6A 4LFBL 3PUXA 4XIGS 4NXNQ 4UPAA 1WI5A 5FJ8H 1XMQL 2K14A 4YHHL 1FL0A 3TS2A 5IWAQ 4YY3Q 2KHIA 3PIPA 1VQNA 3J7A5 4R4IA 4LUZA 4JBWA 1N33Q 2OWOA 4WJ4A 2VQFQ 2KENA 1Q82C 3L2PA 5JJIA 3PGZA
chains in the Genus database with same CATH superfamily
5ELFA 2CQYA 4ECZA 2UUBL 2NU7B 3J80i 5ELNA 2E2JB 3F8NA 5ISRA 5F9NA 3S1QB 2QF7A 1PYSB 4UAIA 5C4JH 3Q1KA 1D5ZC 1RD9D 3N43B 5EPKA 4A2AA 4JI8H 2VPSA 5DGBA 3HOYH 1WSCA 1JX4A 4JI8L 3KHHA 1HJPA 1I3QH 1I6VC 3ERSX 1F9RA 4IO9A 4DR6L 3LMLA 4LK1C 2XGPA 2FINB 2G5DA 4X64H 1BCPF 1PMRA 5KT7A 1XNRH 4L5RC 1WCMA 1SNPA 4POFA 2OLSA 2AQ3B 4GC6A 4X64L 4G4KA 1Y1WH 1K8GA 1XNRL 4J15A 5LXTF 1M8AA 2W6NA 1YEZA 1JORA 4QWDA 4QWEA 3C0FB 4QGUA 4XQQA 3RBEA 2EVBA 2PW5A 3JAMi 4KY6A 4Q5VA 2BOSA 5I9PA 1QJOA 4BBSH 3Q8QB 2R92A 2J6TA 2I87A 4GOPC 3PW4A 3IG0A 1SLJA 1XPUA 2NWGA 2J9GA 1SYFA 3TP8A 2A8VA 3GDEA 1JJGA 1A3TA 5DG8A 3LP8A 4UCSA 3S14B 4X62H 1SMYD 3BJYA 3A5ZB 2XC9A 1PH2A 4ZOLF 2K5HA 1PYBA 4X62L 1CS0A 4F50A 2L15A 1KNAA 4A3JB 2NUAB 5A2QW 2FP4B 3I73A 2VXWA 1YZ6A 1HNWL 3TRZA 4GKJH 1RTNA 1PZID 2K28A 4RMFA 1A0IA 5FJ8G 3GTLB 1C4QA 4WJWA 3W1BA 5IT9c 2YU9H 1PDQA 4DV6H 1GSAA 4GKJL 2VUGA 2R92B 2R8GA 2F4IA 2O5JC 4DR4H 4DV6L 1LLRD 1IYVA 1I50H 1SEBD 3VYTA 1M0WA 2HVQA 2EOTA 4DR4L 1TS3A 4C3HB 2V4QA 1TWHA 4FDBA 3S16B 2ASLA 1SYXB 1E4FT 2FXQA 4XYLB 3J7AF 3A7LA 5FLXL 1PRTB 2QYZA 5CV5A 1MJEA 1V8QA 1A3VA 1HUMA 3PO2H 3DHQA 1L1OA 3HG9A 3CRLC 2QDBA 3M3YH 2FE3A 3K80C 3KDFA 2F1MA 3QG1A 2IP4A 1PX2A 3RAXA 3CU7A 5D3IB 1K9MC 2I0QA 4DV3H 2FLLA 1X55A 2PNRC 3D4WA 4A93G 1AN7A 1QWYA 3TINA 4DV3L 4JYAH 4O2DA 4HNTA 1SXTA 3GTJA 3IKJA 3T1YH 2E8GA 3U58A 4JYAL 3R5FA 1TWHB 2CWAA 5TSSA 5CR3A 3T1YL 3Q24A 1XDNA 5E3FA 4KN7C 4B3RQ 3OTOH 2P5ZX 1RTOA 4IWYA 1L1OB 1BBWA 4HIKA 1HQMC 3QZ7A 3OTOL 2D5DA 4WFN3 5IYCG 1KXLA 5BR8Q 4IUPA 4LFCQ 2EYHA 2BH2A 4P2CB 3M4YA 3AYHB 4M9UA 2VUMH 2K50A 5AJ3Q 1JLLB 3NWSA 5D3DA 2AQ2B 1VQ8A 3TBIB 4O4LF 4H44C 5E4WC 5KFSA 4XT1B 5BPFA 3H4DA 4FVMA 1KHIA 3QIAA 5EKKA 4O4HF 5IGCA 4QF4A 4XTCS 3K8AA 4A3IB 4EYHB 1JQYD 4PQXA 2X6GA 5L1LA 1C30A 4HCSA 1MKHA 1SFOA 1KDBA 1O7ZA 5KFEA 3ETHA 2VS1A 4HIOA 2ZXRA 5C5MA 4X66Q 3MFGA 4HR7B 1D5XC 2Z0SA 1PK8A 1PH3A 3E9IA 5C8YF 1I6HB 5L9XA 1QUQA 4RH6A 4U6PA 3AFPA 2QILA 4C3IB 1QILA 4IFDI 2VOBA 2ZDQA 1IZ6A 1K73C 3N6XA 4MV9A 5D65A 1VQGA 4F4YA 3I4NG 2Z4IA 4HMJA 1JC7A 3PW2A 3T1HQ 1IW7C 3LX0A 2EE1A 5M3MG 4KLKA 3P20A 1SFOB 1E4GT 5KT6A 4DV7H 1EUDB 2EY2A 3VMMA 3VDYA 5KNBA 3Q8DA 4YB8B 1EY4A 2A74C 2JA9A 1OWTA 4JI0Q 2XVSA 2MNAA 2YZMA 2WIIB 4POGA 1GUGA 1QZGA 3JRWA 1G51A 2IX0A 2G9DA 1HZ9A 1DV1A 1I4QA 2WB1B 4O3RA 4DV2Q 4KKUA 3N44B 2I5MX 1HRJA 1QUQB 3CPWA 3PN1A 2NN6H 4XZ3B 1W6KA 3EFXD 3BZKA 2C2EA 3MEHA 4R1JA 3KLSA 5K36H 4DV0Q 4I55F 2JA5A 5KG0A 1KEEA 3RV4A 1IL2A 2ZXPA 2B63G 4LFBQ 2N49A 3HEJA 1XMQQ 3OW2A 4ECYA 3UFXB 3T5LA 3PZPA 4EQPA 4JI4L 2GN5A 2W7OA 3QO2A 2EY5A 4JI6H 1SSOA 3GTGA 4KN4C 5JVLA 2XNAC 1KLGD 4JG2A 1Y1VA 2GA4B 3I8ZA 2UUBQ 3I4MH 5C3XA 4JI6L 2ZJRA 3J7YW 1IOWA 1JE4A 3Q2OA 1CT1D 1KAWA 3PMFA 1HR0W 1JOQA 3CHBD 1N33H 4BWSC 1S9FA 1Q8KA 5GAHC 5IWAL 5L37A 1N33L 3ITPA 3WNZA 3OWEB 2RSOA 5DEHA 1M7JA 4BY7H 5DM63 1TA8A 5IGDA 4Q8FA 1CKMA 4ECUA 2IWHA 4G57A 4KD3A 2AU0A 5EKLA 1VCIA 2V58A 1XPOA 3VA5A 4DN4M 5FLXW 4C2MA 3HKZB 2MGSA 4DR6Q 5HURA 2Q8TA 1D7QA 2J7ZA 2TMPA 4IZ8A 3H6MA 3GTGB 5FPOA 2F0LA 1Y1VB 5HV6A 3JZIA 5IYDG 4X64Q 1EY6A 4DK0A 4JI1H 1XNRQ 4CDCC 1RHPA 4FS1A 4HJ9A 1PLFA 2QCPX 4KK7A 4JI1L 3STBD 1GM5A 2R7ZB 1CKNB 1X3PA 1AE2A 5KFAA 1H9KA 4QL5A 4JI2Q 3FRPB 1F2YA 4Y7NB 1SJED 3SK6A 5M5YB 1TWFB 3BQ1A 4EBDA 3DEPA 2ZTCA 3GTQA 2HQLA 5CAEB 3J81L 1ENFA 5EPJA 4C2MB 1M0TA 1S10A 1EWCA 2WAQB 3RLNA 2NVQH 1DOKA 1SNCA 4GN3B 4X62Q 2UVVA 4CGYB 1CI3M 1K8OA 3BG3A 5C0XJ 1HNWQ 4ME6A 2RCNA 1SE4A 4UHVA 3ZYYX 3MR3A 1D8LA 3OOCA 3JAME 4RB3C 4M1UB 2MCTA 1HR0Q 5HGQA 3S2HB 4DV6Q 2E5LH 4K5XA 1II3A 1RL2A 2AUKA 1N8RC 1EEID 4MTEA 1NR4A 2E5LL 4YHHH 1E1OA 4RU9A 2FJZA 2VQEH 4OHJA 2DGYA 1FVIA 1O7YA 2HIXA 4NB3A 4MV1A 4FM9A 3UDXA 2JA6G 1ZHQA 2VQEL 3IL8A 5JEAJ 5KG6A 3QWNA 4C3JH 4IUQA 1PA6A 1HNZQ 2HHHQ 2K33A 5JAVA 1ASZA 2VPQA 2VR1A 1DZ1A 4EVOA 5EWGA 1BUVT 3SXHA 4J9NA 3A5UA 1JB3A 1M4VA 3QR8A 2W7PA 4RGOS 1VQFA 1G291 4IUVA 2NVXH 1KDAA 1K28A 4OIJA 1PTOC 1DONA 5CA0F 5KFFA 3PF4A 1R4PB 1FJGH 4EX5A 4C5BA 3W2DA 2VB2X 4JK1C 2KCCA 3T1YQ 2RDJA 1X32A 1FJGL 3K5HA 2Y0SA 4I7HA 3OHAA 3J7ZC 1DXMA 2W9BA 1S5ED 1G2TA 3Q8PB 2OT2A 1DV2A 3TEHB 3PVXA 4JOIA 4L8JA 5CA1F 1S0NA 4MNOA 3OTOQ 1M90C 4R8NA 4ED6A 5CV8A 4RKBA 4FBTA 2YYAA 2JJQA 1PXUA 5KGUA 2N3SA 1AZPA 4R4TA 1UNSA 2MHVA 5KG3A 1YNNC 1B4OA 5C0XI 4A3FB 1WYDA 4C5AA 4J9LA 3J81c 2F0NA 2KCNA 4DR7H 2OQKA 1RDPD 2PQAA 3MWDA 1AH9A 4A3EB 4HYKA 3CQZB 3VPCA 4KD4A 3BDOA 4QIWE 5IYCH 5FPRA 4KHPH 2F0HA 1KRSA 2NZ1D 3H3VC 1QOHA 2Y0SB 4KHPL 4R4CA 1GHKA 2HGSA 1ZYRD 2EQSA 2OEOA 3PO3B 1F9PA 1T9HA 1SNMA 4YAKB 3KF6B 2MO0A 1UC9A 2VL6A 3S1MH 3CCJA 1PZKD 3PUWA 2L5TA 1J8IA 2QW7A 1PRTC 1TS5A 1Z6HA 2PQAB 2H1EA 1F2LA 4V190 5E1FA 1XMOL 4K14A 3D6CA 1NSNS 2K03A 4A3DB 3DM1A 5DM73 3K3VA 4UP7A 4DAPA 4LF9H 1HFNA 5D1PA 1S40A 1MGSA 1M1KC 3T5HA 4P75A 4LF9L 2EIFA 2FPGB 3I4NH 5COYA 5KFTA 1K1SA 3BQ0A 1E1TA 5DLQE 1EYZA 2G9HD 5M3MH 5EWFA 2R92G 5JEAH 3GTMA 4J6HA 4B3MQ 4RZQA 4ED7A 1AUXA 1G6ZA 2CQAA 5KFXA 4WBNF 1TWGB 1J9OA 2UUCQ 1J5EH 3RGXA 2PMZE 1BO0A 1LT4D 4C3HG 2KOLA 4QJFA 3J81W 4JI5H 2AMCB 1IBKH 1EEFD 4YCWA 1IBLQ 3UQ8A 3K81C 2PBZA 3G6VA 3RV3A 1HTPA 1LTGD 3LWEA 1CUKA 3E5NA 2E2IA 4JI4Q 4JBMA 2E75C 1IBKL 3MHBA 2MPMA 3KLRA 4A3BB 2WP8J 2KCTA 1TWCB 1ET6A 4K6DA 2BR0A 4JI6Q 2PO4A 2B63H 4QWAA 3CD6A 2ENBA 1C3OA 1SCUB 2M9VA 4DXFA 1WTVA 2XSCA 2FMMA 4Z9CB 2HUGA 3GTMB 3FKIA 3A54A 5IWAQ 3C46A 3PIPA 4FS2A 1RK5A 5IGGA 3FEWX 3J7A5 4LUZA 2EJFC 1N33Q 4ZKCB 1RK6A 1H9MA 2JXMB 3L2PA 4O4IF 3PGZA 3VYUA 2GPSA 3P75A 3DXJC 2RDGA 3ONAB 1VQPA 2GLTA 4IJHA 3RN2A 4CKCA 4PZ6A 2GVAA 2E2IB 1BF4A 2K5WA 3W5OA 4BXXG 1AN8A 3VPDA 4N9PA 2M05A 2R8KA 2IW3A 4L5SA 3CP0A 3U9OA 3R5HA 2W6OA 4KV6A 1GD7A 2RQXA 4XYOA 4IAJA 2B8GA 2WACA 2XCLA 3PR4A 4JI1Q 3R5XA 4WJ3M 5KFZA 4EQ5A 1JR0D 1B2TA 5EOYA 3CKIB 2V1CC 1EYCA 1U4PA 4A3IG 3H0GB 1XX8A 1QZHA 5IYDH 5LMNW 5I47A 1EL0A 4MV4A 3GV7B 1RJTA 3K5MA 5D14A 4FF2A 5KFGA 2RA4A 2KVMA 1WVLA 4FF4A 3Q8RB 2UU9L 1F77A 3PR5B 2R6GA 1C8CA 1FNVA 5IT9E 2Z6KC 3K7AB 4J9SA 4RWSC 4JUZA 1GO3E 4ETSA 5CB4F 4IRDA 4QWBA 2R93A 5ELEA 4O2AF 4DV1H 2UVWA 4DR1H 4L6TB 1Z2NX 3PUZA 4C3IG 2R87A 2EXZA 5LL6S 1TVXA 3GO5A 4DV1L 3CCVA 1MJCA 1WH2A 5KFYA 4ECQA 4N9TA 2E5LQ 4HIMA 4EGVA 5KT3A 1XWEA 2E2DC 4DUZQ 3BZDB 2ID0A 2OTJA 1E3PA 1UE6A 2OQ0A 4JV5Q 3KHGA 2R8HA 2PZUA 2VQEQ 3V96A 4GKKH 4LWCA 5BN4A 4HCEA 1F9SA 4O0AA 2B2YC 5CV9A 5K2MA 2C2RA 4GKKL 3M9OB 2WB1G 3R8BA 3HP3A 4JBJA 3M4OH 2R93B 4TQRA 1KBLA 3RR5A 4R4QA 3J81i 3G71A 1CK1A 2YTVA 3TP6A 2R61A 1WJJA 5JVH3 1V4YA 4KTAA 2VQFH 2JA6H 4YWKA 3L7ZC 3TSSA 4OO1I 1CQJB 2YS7A 2VQFL 3KLSX 4P71A 3HGBA 1EWIA 2JN4A 1V43A 4DAVA 4IOAA 3RD4A 1MI2A 2B39A 2CVRA 3T4AC 3OWFA 1FJGQ 4IOCA 1CFMA 5LMNQ 2YL2A 1XJVA 2NVTB 3I3CA 3GIIA 4CBVA 1AZQA 1XNQL 5KX5F 4O3PA 2IHEA 1ONLA 2WDTA 3KUPA 4JI3H 4DF7A 2JA7H 3NSWA 1ZEQX 2B2TC 3GV6A 1FR3A 1CZWA 4HJ7A 4JI3L 1PTOF 2B2UC 1I7LA 3L4JA 1DGSA 1N32H 2K5NA 2EYFA 4OIKA 4TV8F 4KKSA 2R8JA 1LTAD 2EDGA 2E2JH 1YVCA 4IN3A 2ZTEA 1CA5A 1LYLA 1D2BA 3GTKA 1SYEA 1N32L 4DL2A 3HKZG 3TZDA 1XYIA 4I7ZC 1E22A 1E4EA 5C6AA 2RDFA 4BY1B 2UUAQ 4XYQA 2K5VA 4KKTA 3BAAA 2KCMA 4F4XA 4M8AA 2ZM6L 1PH4A 3ULJA 4DU9A 4ILWA 2R7ZG 3GIPA 2HCCA 4DL7A 2XWJB 4X3UA 4BWGB 1JDEA 2QDLA 4UDUC 1W3SA 1NJIC 1YNJC 3DWAA 4QW9A 5KFHA 1T94A 4FNFA 1X6OA 2AGQA 1PTOH 4IPHA 1PFBA 2XD4A 1XMOQ 3GTKB 1K3RA 1KL9A 3TZUA 1RF2D 2IJ0A 4UP8A 2WAQG 1E4EB 3M4IA 1HH2P 4F8MA 2DY7A 2A69D 4ZCKA 2HQEA 5FLMG 4A3MB 2JSOA 4LF9Q 2CHBD 1JMCA 4A3CG 3MXUA 3UI2A 3PSIA 1QG7A 1PRTF 3S14H 5CORA 2F4VH 5JJZA 1ILQA 1S3OA 2GVBA 5ELDA 1EU3A 5EJWA 5J22A 2C5CA 1SROA 3L3OC 1H9JA 3TREA 1I3QA 4IRKA 2FMCA 1EIHA 5KYIA 1EHIA 4CJ1B 3FMAA 1NMGA 1OO9B 4H7BA 1O78A 4IQZA 1SMXA 3PF5A 3GTLH 1KJIA 4DL6A 2A6HD 2SOBA 4LUOA 3OHBA 3H94A 2J0TD 1Y1WA 3H3VH 1KJ9A 1IBKQ 2ALZA 1LTRD 3T16A 1SRUA 2OTLA 2Q8RE 4DAMA 4H02A 1NMFA 3A8JE 2D2CC 5C4JB 1WCMB 4IJLA 4MHEA 3S16H 5CBEE 5KFIA 4L1KA 3PIO3 4CDFC 4DUYH 2WB1E 3HOYB 3KBXA 3A55A 3HZXA 1VQ4A 2NB0A 3RFCA 4DUYL 1VQEA 1I3QB 5FO7B 4BBRB 3GTPH 3Q6SA 2W71A 3RIZA 1B6RA 5GADC 2XIGA 1N36Q 2BH8A 4APVA 4F7XA 4ED3A 2LMCB 1WD1A 4F87A 4YY3H 1Y1WB 2LFNA 3R3OA 1B44D 2YYZA 2F0DA 4UCOA 5BN5A 2YU9A 3C1EA 4YY3L 2KHJA 2IHFA 2K52A 1SBBB 2DNEA 1W6JA 3C2PA 4BBSB 2D62A 4DK6C 3K3PA 4MIUA 1LTBD 4FP5D 5M5XB 1VQLA 1I50A 4OX9H 4J1MA 2AQ1B 4A3FG 1KC8C 2UXBH 3H09A 4Y52H 1Q3LA 1PH7A 3M7GA 2JEJA 4A3EG 2UXBL 3T5KA 4BXXH 1TWAA 3BYYB 4V0BA 3G6YA 3CCRA 4IRCA 1I4HA 4C56C 3B6YA 1SYDA 4I65A 1OTCA 4K8JA 2Y0SG 5IGEA 1XPRA 2ZJQA 2ATLA 1W93A 1PFMA 3STBC 1C48A 1HPCA 1PZJD 3OMGA 1VMPA 3HKZE 5G3LD 4BA1I 1S72A 2UU9Q 5JJLA 2NU8B 1K0RA 3PO3G 4JV0A 1XXGA 5EBCA 2QGQA 4ODGA 3RNUA 3FPPA 1WTQA 1VMCA 2H4OA 5KYLA 2EYPA 1GXDC 4GNXA 4LH7A 3GIKA 2RCFA 1BNZA 3MA2B 2JA8G 2R7MA 4YQWA 3KDFB 3NHHA 3BDCA 5CBAE 1TWAB 4DV1Q 2RDIA 1HUNA 2NYZD 2ICIA 3CC4A 4A3DG 1NTGA 1FGUA 3I72A 4RGNA 4AH6A 1Q1BA 1QB5D 2B2WC 3GTJB 4JBKA 1I6HH 4AQYQ 1STEA 3HOXH 3M3YB 1EFID 2IT1A 2WAQE 4CHTB 3K5OA 2VUMA 1A2UA 3GQCA 1SNDA 1Y14B 2I07B 4HEDA 4GKKQ 4RCOA 2F0QA 1AP0A 2R7KA 4GNXB 1UE5A 2OXPA 1YJWA 1SFOH 2AGOA 1JWMD 1PFSA 1YJ9A 2JEIA 4MV8A 2NN6I 3NENA 5C44B 3KJPA 4X65H 1Z2PX 4K5WA 5ELBA 1VQ7A 2PCFB 1P16A 1ILPA 2F03A 4GN4B 4RGTA 1R4QB 2N78A 4ZRZA 5T1IA 4E4TA 3U9TA 4X65L 3T13A 2JYOA 4RG1A 5FLXc 1KJQA 2KEDA 1I7NA 5D8DA 4K0KH 2K32A 5M3FB 4A3BG 1STBA 3VYRA 1GUWA 5C5LA 2VUMB 3CXCA 1MIUA 4K0KL 5IYBG 1XNQQ 4KJNA 2FLNA 3MFYA 4H0LC 4DV7L 4LSAA 1ET9A 1SNQA 1FYCA 2BQ3A 3GIJA 2CW0C 2R85A 1CQIB 5FO8B 4YJ3F 5LP6F 3IN5A 5KFJA 1AE3A 2XCAA 3S1NB 1YIJA 1TS4A 5KFNA 1RJPA 1NAPA 3K58A 1V1PA 3URYA 3NQIA 1CHQD 1VQAA 5AFWA 1K1QA 1N32Q 4DNRB 4ZQ3A 3RB0A 4MZ9A 4RAZA 1STNA 2RHSB 3CRKC 4LF4H 3U50C 3KF8A 1B8AA 1QVFA 4R8IA 2K5QA 4LF7H 4AYBA 1J6QA 3C1FA 1GGOA 1HFGA 4YIJA 1CKOA 2ZM6Q 4ED2A 1BQQT 4O42A 4TV9F 3PUYA 4I4TF 4S3SA 2WFWA 3EA6A 2VZAA 3ORRA 1N48A 2FHTA 3CCLA 5C4XG 3EBEA 2K75A 1U4RA 1ZYRC 3H0GG 3KFUA 1YNXA 2EY6A 2SNSA 4DR5H 1IYJB 1L0XB 1V1PB 3DWPA 3SI8A 4DR5L 4U68A 4ZKBB 2JA5B 3W1GA 1AEXA 1VQJA 2R7ZH 2SEBD 3KF8B 2Z9HA 3OPOA 1CZGA 3T56B 4GS3A 4PZ7A 1IHZA 4RB2C 2LS01 2Y0SE 4FXDA 4AYBB 4JI8Q 2M00A 1HA6A 4CKBA 1Q46A 1SJHD 1LM0A 5M5YH 1TWFH 5IGFA 2IX3A 3ERQA 4APMA 3H40A 3D3RA 5CMDA 2NVYA 3R2TA 2B2VC 1IBMH 1SYGA 1BNCA 2XWBB 2YRXA 4C2MH 3J80E 1NNXA 1I94H 1OXSC 2N88A 1V51A 2NTSA 1VKZA 1IBML 4PMBA 2KJXA 2ZJTA 4O3NA 3M85A 2V5AA 2FK1A 3G7LA 3A8IE 2B8FA 3N40P 2AKWB 5FLMH 1I94L 2V4DA 2PPBC 1T5XD 3E0EA 3S17B 5F9LA 1TXYA 3GIMA 4PMCA 4A3CH 4TVAB 1LTLA 5C3EB 2DN8A 3N52A 3PCOB 4X6AH 4J9QA 3I4MB 4RUCA 3S2HH 2BQRA 2BE5C 2PZTA 2YZGA 4IWXA 4IZOA 3RB4A 1WTWA 4YBZB 4U7CA 2NVYB 4YAJB 4MAMA 1A6XA 2BCOA 4WRDA 3TQTA 1JICA 4A4IA 1EWHA 3HFZB 1ASYA 4BY7B 4ZAIA 3RAQA 3T51B 3HS0C 4XDXA 3TN2A 4GKJQ 4J9PA 2P0AA 2SCUB 1MSGA 3FVQA 1EIGA 5DLGA 2W9CA 3DF7A 2AGPA 2E2HH 3MTSA 4DR4Q 4HIDA 3GTQB 4UPAA 2FFKB 1WI5A 5FJ8H 2L4NA 2K14A 4YHHL 4ED0A 3OSNA 4YY3Q 2KHIA 1PYWD 4RA8A 2X69A 2O03A 3TP7A 5D1OA 1A15A 1Q82C 1STHA 2A73B 2OCEA 4RHSA 1WFQA 2ZXOA 2A68D 3JSLA 3CCMA 5L1JA 1JJCB 3P1HA 2UXBQ 4NKLA 2HDMA 4J9OA 1FKAH 1TY0A 1EOVA 3DEOA 2QKIC 2CFMA 2NVQB 1B50A 1L2ZA 4BS9A 2W9CB 1UEAB 4DV3Q 2AWNA 1HTLD 3NTKA 3V4SA 3TQ1A 4A3FH 3HXLA 1L0WA 4BY1G 1BJTA 2O4XA 3CPFA 1G8ZD 5H1SE 4JYAQ 2FPPB 2DY8A 2I46A 2ZT9C 3GIQA 4A3EH 4DR2H 3CQZH 2HVSA 1IKLA 2B29A 4TQUS 2HDLA 2X0SA 1S97A 4B3TH 2NZOA 1LUZA 4DR2L 4K6LA 3UDGA 4LF5H 4DK1A 4A93H 3DUZA 2UXDH 3HOUB 3E5SA 4U673 1IW7D 4GOPA 1WTOA 4B3TL 4JI7H 2I8CA 1TY2A 4X3SA 4LF5L 5KFWA 1IOVA 4QWCA 1T3NA 2CW8A 4AIMA 4JI7L 3PO3H 5JH7F 3A8KE 3MFIA 4KI0A 2XGQA 1IL8A 4C3JB 4R8UA 3GV5B 1PHJA 3AQQA 2ASDA 4P72A 4J9KA 4EBCA 4MV6A 2JEAI 4DR7L 1GHJA 3J80L 3I2ZA 4XQJA 2JA8H 4A3MG 2F0OA 3CCUA 3IRBA 3NBHA 1S0MA 4Y8VB 2V9WA 1VQDA 2JQOA 2F3VA 4WORA 5T1GA 2VA3A 4IR9A 1HA5A 3OUUA 2W9BB 5C1OA 4A3DH 4ZI7F 4TUYF 3S24A 4QMGA 4GOPB 3FDSA 4EFEA 5DG7A 1OXVA 3V6KA 4HTHA 1CSPA 4LJZC 3RJ0A 2KQ3A 4R9WA 3K7UC 4G7ZC 2AWOA 3BA8A 2HCIA 1KABA 2PI2E 4RHRA 1ZHSA 4DNIA 4K5VA 4R8UB 4R4OA 4O1NA 4X65Q 4NMZA 4C1NK 5E4XA 5J3BA 4LNQA 4K8IA 1Q7YC 3RB6A 2KEEA 4OWXB 2CKZB 3M9BA 3O13A 1TWGH 5IP9G 3AFQA 2W6MA 3JAML 2NU6B 2AHOB 2NZHA 4YWLA 4K0KQ 1WCMG 3EPGA 4MTNA 4DV7Q 4A3JG 2QA4A 5FD6A 2XIWA 1FNUA 2KBNA 5KKNB 2Q2IA 4RAUC 2F0JA 3U9SA 1ULZA 5HBRB 1ENCA 4DXGA 1RYSA 3LWBA 1U0LA 3NTIA 4BBRG 4NPSA 2BQUA 4A3BH 2PYKA 1Y8PB 3GTOH 3S1RH 1TWCH 2YCHA 3PUVA 3Q0AA 1L1OC 5IYBH 2RKSA 2LXJA 4KMUC 3F2DA 2DZDA 4C1NI 3AU7A 2EZVA 1WTHA 1Y1WG 2VA2A 3GTMH 4UCTA 3KBGA 5M5WB 5A2QE 2VNUD 1J5EL 2WE6A 3NUCA 4ALPA 4DKAC 2IA6A 1SAPA 3MR5A 3G6JB 4TRDA 2A19A 4JI5L 3RTXA 1I4XA 3RZOH 4ZUIA 3S15B 3RLOA 4DL4A 4CC6A 1GKHA 1GUTA 4ED1A 2OH2A 2E2IH 3CVZA 2XTIA 3L0OA 1WTPA 3MEFA 2J6UA 2K6AA 2XRQD 3K57A 2E74C 1WD0A 3WOEA 3MWEA 3JC66 1JB7A 2DUDA 2W9AA 2A6EC 4MV7A 4LF6H 2VY3A 5IY0A 4DR5Q 2A5HA 1DCZA 2JEBI 5LHY1 5DQGA 1W2BA 4LF6L 1QNKA 2L11A 2EXDA 2LKVA 3N8DA 1UC8A 1GUOA 2B63A 1GSHA 4X3TA 1SE3A 5L1IA 4TSSA 5C4XH 2PQEA 3HRZC 3AMUA 3CCQA 3H0GH 1KC7A 2DIKA 1EYGA 1LT3D 4LFAH 1B33N 3GD7A 2F0KA 3NP8A 3SDZA 1Y8NB 1K0SA 3RZDH 4B9XA 4ECWA 4LFAL 3P7JA 1KAAA 1IBMQ 1KJ8A 3QOJA 3C3LA 1I94Q 1EY5A 3FKIB 2XRSD 1B9NA 3D4RA 3NELA 2FJ2A 3V05A 4A3GB 4OWTB 1YBYA 3R93A 3PV0A 1CHPD 3F2CA 1X9NA 3M4PA 1E0BA 4ECRA 2EYLA 1DM0B 1R9TA 5ELCA 2O2LD 3LNNA 3D31A 4XT3B 4A3KB 1O75A 3KTMA 1PTOD 2K04A 1CQVA 5HY6A 4P74A 4LW1A 4RFBA 2F0PA 1FGBD 5C44G 4PV1C 2F3WA 3D4DA 2RF4A 5LOVF 4J0MA 3NE5B 1RJRA 4ECXA 3G4SA 1RIPA 5F2DA 4O3SA 1SMYC 2PVPA 1QCBD 3MWMA 4DR1L 3CMAA 1Z7TA 1UE7A 5M3FG 4B3RH 1UUPA 2F0VA 2VUMG 2ICEC 3S9WA 1YNND 2NUCA 5I6WA 4YHHQ 5KG7A 1R9TB 2CQOA 1SEIA 3H4BA 3I4OA 3I56A 1EOTA 2PNHA 5DGAA 2L12A 1QE6A 5BR8H 4LFCH 1VQBA 1WR2A 2SDFA 4NXNH 5FO9B 2VB3X 3CC2A 1KRTA 4IPGA 1VQOA 3EYYA 4YR0A 5A2QL 4NXNL 4CC5A 5C1PA 3NPPA 4HNUA 5IOCA 3F2BA 1LO5D 3RBDA 1C9OA 5KT5A 1K83H 4NDXA 4ZUJA 4DL5A 3QB3A 3S2DB 2EPBA 3NGDA 3HOWB 4GLXA 4OWWB 3ETJA 1EZ8A 5C5JA 2RGRA 1CQFA 3LGJA 3OHXC 1CTMA 3RF2A 2F0UA 2ALYB 4QQBX 4UCVA 3JAMW 1DD2A 1BCPD 1VDZA 1TIID 1ICWA 3KAKA 5DNFA 1LABA 2RSNA 4DGZA 2N8NA 4EEQA 4X66H 3ER0A 2BDOA 2K01A 4B3SH 3DM3A 2JA6A 1S5FD 3SGIA 1UE1A 1TT2A 4B3SL 4B3TQ 1Q81C 4BY1H 1Q12A 4LF5Q 4LAAA 1P8LA 5IIFA 1PH6A 4JI7Q 1WOCA 5JVG3 4LF8H 2UVRA 4TKOB 1KLUD 2JA5G 2ZJPA 4GZYC 1E2ZA 4HQ6A 2IPKD 4LSXA 4LF8L 3LWUA 1LT5D 1SYBA 2E76C 4OGQC 4DR7Q 5T14A 1JWUD 3M4OB 3BJUA 1V1OA 4WD3A 3S1QH 1D6EC 3BZCA 2JA7A 3EJIA 5IGBA 1D1IA 1EU4A 5C4HA 4IALA 4KHPQ 3N42B 1MSHA 1Y1VG 1RODA 2D0OA 5EQ0A 4IFDG 2ASBA 4DAYA 3BG5A 3HOZB 1PFNA 2R3ZA 4A3MH 1VQCA 4DV0H 2W6QA 5FLXE 3SK8A 5C3EG 5JJKA 4EBEA 1EQVA 1OXXK 3ICEA 2I80A 5JQWA 3I4MG 1IXRA 1XMQH 2B3GA 5EDWA 5IT9L 1AUVA 5LYJF 1JCKB 3H3VI 1L2FA 3WDNA 1TAEA 2JA7B 3FPUB 4PG3A 4YR3A 5GQOA 2UUBH 4I7AA 1SN8A 1GJXA 2F52A 4DPGA 4BY7G 4Q0FA 3HOVB 4NLGA 3PW0A 2C9OA 4DAYB 1TS2A 2Z1CA 2ASJA 3HKSA 5KG5A 1BGWA 3KHRA 5IP9H 1BKBA 1KNEA 1DOLA 4HAEA 2XN9C 1XTCD 2F4VL 1WCMH 2MFIA 5DAUA 1JT8A 2D0PA 4A3JH 3TIGA 2Z8LA 1KJJA 4K2KA 4DR6H 1BOSA 1E2WA 1A3UA 1J5EQ 2Q2UA 4QW8A 1B3AA 4B9WA 3VYSA 3ORQA 4BBRH 1E2VA 4RNNA 3QFFA 4JI5Q 2R92H 1JKJB 1B3QA 5IODA 3RMHA 3K5IA 5DLFA 2DPJA 5IP7G 1PH5A 4Q43A 2R8IA 2K5DA 3EROA 2LSSA 1V1QA 3FP9A 3AEVA 1PTOB 2RHQB 4K2LA 2R82A 1STGA 4C3HH 1K3BC 2WYOA 3J7AK 3GTLA 3KK7A 4RGMA 4G7HC 1N9WA 1HZBA 1NE3A 2SNMA 5FKAC 4JI2H 1YHAA 1S4ZA 2F0SA 3W3AA 4F88A 4LMYA 4JOIC 5GROA 5M5XH 1IKMA 1S5CD 4JI2L 1C0AA 3EN2A 2KSWA 3GIDA 3OUZA 3I91A 2RBMA 2QEJC 4LF6Q 1YHBA 3E3XA 5GONF 5BMVF 4HJAA 3GV8B 2BA0A 4CDEC 4HN7A 1T36A 5EPLA 5FOBB 1JJ2A 3DWQA 4ID6A 5EKIA 1K8AC 1Q1EA 3JRXA 5KFKA 1HNWH 3HOUG 1PH8A 2L1BA 1EUCB 5KNDA 4R7RA 2WINB 1B9MA 4A3LG 1VQMA 2K05A 3GTPA 1W96A 5KFRA 3MJFA 3MFHA 3UDFA 4A76A 4XXEA 1MD2D 1TWHH 4LFAQ 1H95A 1HR0H 2KA7A 1ZQ7A 2K4KA 2XCPA 3QOLA 4CJ0B 4IURA 2IL8A 1GUNA 1D5MC 3RN5A 1VAJA 1HR0L 2W57A 4C3JG 4OX9L 1VQKA 4ZK9B 4ULLA 3ZJYC 2RDHA 1ENAA 1LTID 4ECSA 5HGTA 1EZ6A 1Q8IA 3MVVA 3TMEA 3UDIA 2YS6A 3SR1A 2QEXA 2YZNA 1TKWB 3V2TA 5LA6F 3M7NA 3H20A 4A75A 1TWAH 1HNZH 2HHHH 4DLKA 3WWVA 1BR9A 4AYBE 1BCPB 1RKNA 3E0JA 1HNZL 2HHHL 1JOKA 2YU9B 1PVOA 2YTXA 4C5CA 4EQOA 4IUNA 3GTJH 1A8VA 3GTPB 1EY0A 5EBDA 5M9OA 3PW7A 5A35A 4A3IH 3IFTA 1I50B 4IFDJ 2CH4W 1XTDA 4P73A 1B70B 1EQTA 3M9NB 4BA2I 4DR1Q 5JPMC 3I4LA 3VR5A 2KHSA 1LTTD 1AW7A 5NUCA 2MQHA 4JC0A 1M6VA 5KFOA 1X3GA 2YRWA 3BQ2A 2F3IA 4OL7A 2DJGC 2K1BA 5C44H 3PO2B 2LY7A 2DJFC 2CCZA 1EZ1A 3X3NA 4XQNA 4C3IH 1NBWA 3KYHC 1I5FA 2JP1A 3SK4A 2ATWA 4FU0A 4HR7A 5KG2A 3SEBA 4DK3C 5M3FH 1YI2A 4RNMA 4G3IA 2EJMA 2EYOA 1B53A 3PUXA 4XIGS 5JOBA 4NXNQ 4N8FA 1VQNA 5IT9W 3WOFA 4R4IA 3KXYT 4JBWA 4WJ4A 3PIP3 2OWOA 3N41B 4JV1A 2VQFQ 2KENA 4QUCA 4Q0YA 3EQLC 1BXTA 4KJOA 1S0OA 2A68C 3CF5A 3TDQA 3S1NH 3I70A 3GQBA 1YNJD 1Y8OB 5C0XG 4KHZA 5ELOA 3I7FA 1Z47A 1DOMA 4J8QA 4B3SQ 2O5IC 5EGTA 1ZKOA 2WB1A 3J81E 2FB9A 1ESFA 2FKLA 4M7EA 2IBKA 3HOXB 1X54A 5FK9C 3K0YA 4JI3Q 1AFPA 4MV3A 1VQIA 2MO1A 2J6SA 1ICFB 4MA5A 1HNXH 2W8KA 4LF8Q 3IFDA 5DG9A 2VW9A 3CW2C 2Z6KA 1F9QA 1HNXL 4UP9A 2UXCH 4EQNA 5JEAG 5KFLA 2PZWA 4HJ8A 5KT2A 1QVCA 2NBFA 3E6ZX 2UXCL 2HIVA 2PW7A 1T5EA 3M9MB 4GLVB 4HSPA 4LF4L 3UE1A 1JOOA 1V9PA 3J7AV 2HJWA 2L9HA 2JA5H 4F4WA 3NBIA 4ECVA 4KY7A 3J81j 3EPIA 5G3LF 4LF7L 4B3MH 5KIXA 3F1ZA 4EEYA 3FKIG 1U5KA 4CDDC 1GSOA 1U4LA 2UUCH 4B3ML 5IYZF 4YR2A 3T5JA 4A3GG 3GTGH 2UUCL 1U9RA 2BA1A 1Y1VH 5J2TF 5KFMA 1IBLH 2MP1A 3NEMA 4NW2A 2B2YA 4IFDH 3U4VA 4NXMH 3CMEA 4JI4H 4IR1A 3GLKA 1WTXA 1Z2OX 4DR3H 1IBLL 4A3KG 4GC7A 3HKZA 3S17H 4NXML 1VQ9A 1DYQA 1SR3A 3RGZA 4DR3L 4ED8A 1JWSD 3A56A 5C3EH 4L5QA 2FPIB 3VR6A 3RUZA 5I6YA 5IE8A 4Y7NH 4EFBA 3G6XA 1C7YA 3VR2A 1SNOA 5IWAH 3L4KA 3TS0A 2FMAA 1SE2A 1KIXA 1QVGA 1GUSA 1BVSA 2R7ZA 2NVYH 1SDFA 5L1KA 1CKNA 2JK8A 3D6WA 2F4VQ 2R7LA 5CV4A 1YHQA 3Q23A 2V59A 2ZDGA 3ULLA 4ZHQF 1TWFA 2AUJD 5I9OA 1JIHA 4OXPA 4RAYA 4J9RA 1EQRA 3MAQA 2WAQA 1L0YB 3OMCA 3MXPA 3BABA 5EWEA 2B2TA 1HHVA 2C22A 2F0TA 4DV4H 4IHJF 4XYMB 3PW5A 2RVLA 4DV5H 4ZYSA 2B2UA 3VPBA 4J9MA 3X3MA 3GTQH 2R93G 5KFPA 4DV4L 2HD3A 4EGQA 4DV5L 4JV2A 4QUFA 2I5HA 1VF7A 1LV9A 1HZAA 2IY5B 4YCVA 2VQDA 3R23A 4O3QA 2DNCA 4IUUA 1B6SA 2W6ZA 3HOWG 5BN3A 1B1ZA 2C2DA 4DUYQ 1NCVA 3R2IA 5IP7H 1SE8A 1N34H 3H15A 1G6PA 4QCLA 1I4GA 2XGTA 1N34L 2CWPA 3TP5A 4RB0A 3Q8SB 1KTKA 5KFUA 1TQOA 2D9UA 4ABNA 1O7IA 2Z6BA 2L55A 4YWMA 4YCUA 1OXUA 3GILA 2K7VA 1LACA 1OXTA 1ZXTA 4PZ8A 3QZ8A 4KY5A 3CCEA 1E7ZA 2KECA 3TQYA 2E2HA 4RB1A 3V6JA 5DQIA 4OX9Q 1BXRA 1VF5C 2J4XA 4KHVA 4GLAC 3HOUH 4IPDA 4H13C 1KQSA 1D1KA 4A3LH 3K59A 3ND9A 4CJ2C 3Q22A 4RZRA 4DUZH 4JV5H 2WKDA 3AB9A 3F2UA 1A9XA 5KEEA 4DUZL 5CGKA 5KRUA 2YV5A 3NK9A 4JV5L 5KT4A 4TQSA 1VBGA 1EIYB 2F0WA 3SK5A 3GP7A 1A63A 1PV4A 3FHWA 3CCSA 2NVXA 2H5XA 3HOZG 3RB3A 1NY4A 1X3FA 5D1OB 2R7FA 4Q44A 4UFZA 5JUMA 4EG0A 1CE8A 2E2HB 1JE5A 1S68A 3MXNA 2FK3A 1UNNC 3MXGA 3V6HA 2UXDL 1IYUA 4O2BF 2ZTDA 4N8X1 4GN5A 1MZBA 3CQZA 3JSNA 5I2YA 2DLNA 3FDTA 2R7NA 3OIQA 4FF3A 4JW0A 2GPWA 5LMNH 1HCZA 5KFDA 1I4PA 4DFAA 2JA7G 4PDBA 2Q2TA 5EZYF 4FO2A 4HNVA 4MA0A 2CW0D 2V4RA 5LMNL 1PH9A 4RKLA 2CZGA 4YJ2F 2JEFA 3UE0A 3BU2A 1Q86C 3HOVG 4OONA 5GAGC 2NVXB 3MC0B 5LMUH 4OO1G 3RLFA 3KF6A 2JE6I 5E7NA 3PIOA 5KFBA 4YP3A 2OF1A 5LMUL 3KHLA 3MXNB 2ZDHA 1X3EA 1GYFA 1A2TA 2R6FA 1VQHA 3CC7A 3RUPA 1X3QA 2A1AA 1HQRD 4OELB 4A93B 2UUAH 4FXGC 1MBYA 3K6OA 4JVZA 2UUAL 3NBHB 2RGVA 3VA7A 5LL6X 2M2LA 2CW7A 2PN1A 3IAYA 1CSQA 5M5WH 1EY7A 4DL3A 3HBLA 5CYUA 1BCPC 1YJNA 3HOYG 1EUJA 4LUVA 2JA8B 3S15H 2F0IA 2LXKA 4XX0B 2C28A 1H9SA 1DJRD 3BYTB 3G6EA 2KUMA 1RCVD 1DIKA 1TWGA 1HXYD 3TIIA 5C0XH 1XMOH 1KDCA 3PQIA 5DQHA 1I4RA 1VBHA 1HNXQ 2EJGC 1I6UA 4EYIB 2C35B 4ME5A 2EYJA 5EAYA 1PH1A 1UWVA 3NQTA 2R84A 4UCRA 2UXCQ 3S1MB 1WTRA 3NTHA 4HMIA 3OYYA 3SHLA 4LF4Q 1RYRA 3EIVA 4BBSG 3GTOA 4MTDA 1TWCA 1FNWA 2I5LX 3BVGA 4LF7Q 4FYDA 3WO0A 1FD7D 1H9RA 4MN3A 1QNUA 4Q45A 1CM9A 2Q8IB 5JPNC 2B2WA 3L9AX 4ZQIA 1NR2A 1H9SB 2BE5D 1Z9FA 4ME3A 3J80c 5KFCA 1ML0D 3OSPA 2R86A 1VS0A 3VR3A 4IPCA 1X65A 3G8CA 2X6LA 1BDOA 4GNXC 1ESRA 3K5LA 2QK4A 3BA9A 3BS1A 3FKIH 1O80A 3NXWA 1TU2B 4DA2A 3I4NB 4NXMQ 3KALA 1G2SA 4RCNA 1STAA 4PWQA 4DR3Q 3BDLA 3KJOA 4A3GH 3BVZA 5BPHA 5M3MB 3HB9A 3GTOB 1EIFA 3S1RB 1EYAA 5I2XA 4I50F 3WO1A 4X3KA 2UVUA 5K5PA 3VR4A 4A3KH 2F0GA 2AQ4A 4E6IA 1BBXC 4FF1A 1N36H 1UEBA 2A69C 4UY8C 3OSOA 5CV6A 4PMWA 3MR6A 1EYDA 3K7AH 3H0GA 3RZOB 1N36L 1B04A 1JXLA 3PO2G 3JAMc 1VQ6A 2Q2HA 2YTYA 1F2ZA 3D8GA 1MHWC 4QIWA 1E24A 2FK2A 4LMQD 2B63B 3D0FA 1HZCA 1Q90A 1JDBB 1N56A 3I90A 2W8LA 5LL6b 4DV4Q 4JCVE 3K5NA 5C4ZA 3K0XA 4DV5Q 5KG1A 1TR5A 2MUYA 1EQQA 4ZLTF 3CAMA 1R9TH 2WV6D 1B7YB 5H80A 2A6HC 4EGJA 4DNTB 3F8TA 4QY7A 2PI2A 5C4XB 4LH6A 4O3OA 1X56A 1Y69U 3J80W 2R93H 2UU9H 4QIWB 1NUCA 1N34Q 4RUAA 2F0EA 3SE0A 3OIPA 3RZDB 3S2DH 4UCUA 3HOWH 3NWTA 4B3RL 2EY1A 2WKCA 2IX1A 1A62A 2HT1A 2HVRA 2ES2A 3ND8A 5J39A 1GVPA 3HOXG 1BBUA 5BR8L 3H91A 4LFCL 1CA6A 5FD5A 1S5DD 3T53B 1EFWA 3MWYW 5J2UF 4RNOA 2YW2A 3KAJA 5AJ3L 2NVTH 5CC4A 1EY9A 5J1ZA 3ULPA 4B08A 3BVMA 1O7LA 4AQYH 2PMZA 5GAEC 5KFQA 1GOZA 2W6PA 2B2VA 4AQYL 1KD1C 2DWCA 3MZ5A 4Q8EA 4CKEA 1PRTD 3OW7A 1VQ5A 1YITA 4IUTA 2L0CA 1U4MA 1K83A 4DR2Q 3GV3A 4X66L 4A2BA 2NU9B 4G7OC 3E9HA 5C3WA 4HSVA 2UXDQ 2Z4HA 3FMCA 1SYCA 2F0MA 4QB4A 2EYMA 3T1HH 3HOZH 2TSSA 1K8MA 2PMZB 5KG4A 5KFVA 3G48A 2NTTA 1LTSD 2FLPA 3T1HL 3N6RA 4OEMB 3A0JA 4NP5A 4AYBG 5JVDF 1XNQH 4JI0H 4HJ5A 2CH4A 3MR2A 1RJQA 2NN6G 4MTKA 1EY8A 4ECTA 3A74A 4JI0L 2JA6B 1K83B 3GTKH 3QJYA 3EVQA 5K36G 2C00A 4FBUA 1G91A 1GLVA 5LMUQ 1S5BD 2MJ8A 4DV2H 5CV7A 4L5TA 2WTFA 2F0FA 5I4DA 4JPBW 4DV2L 2DPIA 3KOJA 4F4ZA 3I12A 2R7DA 3HOVH 3I55A 1F2MA 3KLWA 2JEGA 4OO1H 3DMUA 3DLLA 4LFBH 3A7AB 3M4QA 3U4ZA 2BDNA 3SVMA 4DV0L 3V4ZA 1UAPA 4LFBL 4FXKC 5KNCA 2ZM6H 1S03G 1XMQL 1LT6D 1FL0A 3TS2A 1STYA 2W70A 4PNYA 2A6ED 2N55A 1ZETA 3SE7A 5JJIA 4L63B 2IMWP
chains in the Genus database with same CATH topology
2UUBL 3CF5A 3J80i 2OCEA 5ELNA 4IJHA 1WFQA 1VQPA 3S1NH 3RN2A 4PZ6A 2GVAA 3CCMA 1JJCB 2UXBQ 1EOVA 3W5OA 4BXXG 5C0XG 2CFMA 4KHZA 1PYSB 5ELOA 3I7FA 5C4JH 1Z47A 3CP0A 4L5SA 4B3SQ 4DV3Q 2AWNA 4A3FH 1GD7A 1L0WA 4BY1G 3HOYH 3CPFA 5H1SE 4JYAQ 4JI1Q 4JI8L 4A3EH 1HJPA 1I3QH 3CQZH 1X54A 4WJ3M 4EQ5A 3ERSX 4IO9A 4JI3Q 4DR6L 2B29A 4TQUS 1VQIA 2MO1A 2NZOA 1LUZA 2V1CC 4DR2L 3UDGA 4LF8Q 4A93H 4A3IG 4L5RC 4POFA 2VW9A 3CW2C 2Z6KA 1QZHA 1HNXL 5IYDH 4UP9A 4X64L 5LMNW 4GOPA 4B3TL 1Y1WH 1K8GA 5JEAG 4J15A 4LF5L 1XNRL 1YEZA 4HJ8A 4AIMA 1QVCA 4QGUA 2UXCL 2HIVA 4JI7L 2UU9L 3JAMi 3PO3H 4GLVB 4LF4L 3UE1A 1V9PA 4BBSH 2JA5H 4KI0A 2R6GA 2Z6KC 3J81j 4GOPC 1PHJA 3AQQA 4LF7L 4P72A 1GO3E 1SLJA 3F1ZA 2JEAI 4DR7L 1XPUA 3I2ZA 2JA8H 3FKIG 3GDEA 1U5KA 4A3MG 2A8VA 1JJGA 3CCUA 3IRBA 4B3ML 1VQDA 3PUZA 2JQOA 3GO5A 4A3GG 3A5ZB 3GTGH 4DV1L 2UUCL 2BA1A 3CCVA 1MJCA 1Y1VH 1PH2A 2K5HA 1PYBA 4X62L 2L15A 2E5LQ 3NEMA 4A3DH 4HIMA 3S24A 3U4VA 3CMEA 4GOPB 1YZ6A 1OXVA 3TRZA 1HNWL 4RMFA 5FJ8G 1IBLL 1A0IA 1CSPA 4DUZQ 4A3KG 2ID0A 3W1BA 1E3PA 1UE6A 2OQ0A 5IT9c 1VQ9A 3K7UC 2VQEQ 2AWOA 2YU9H 1SR3A 4NXML 4GKJL 4DR3L 4LWCA 2PI2E 5C3EH 4L5QA 4DV6L 4DNIA 4O0AA 5IE8A 1I50H 4Y7NH 4R4OA 4X65Q 4GKKL 2WB1G 1C7YA 4DR4L 4JBJA 5J3BA 4LNQA 3M4OH 3TS0A 1Q7YC 4OWXB 1KIXA 3RR5A 4R4QA 3J81i 2CKZB 3G71A 1BVSA 2YTVA 3M9BA 1WJJA 4FDBA 1QVGA 1TWGH 5IP9G 2JA6H 4YWKA 2NVYH 2FXQA 3AFQA 1CKNA 3L7ZC 2JK8A 4OO1I 2F4VQ 2AHOB 2NZHA 4YWLA 1YHQA 1WCMG 4K0KQ 2VQFL 1MJEA 4MTNA 4P71A 4DV7Q 4A3JG 3PO2H 3ULLA 1L1OA 2QA4A 1EWIA 1V43A 2KBNA 4IOAA 2Q2IA 4OXPA 3M3YH 3K80C 3KDFA 1EQRA 1FJGQ 4IOCA 1U0LA 4BBRG 5LMNQ 4NPSA 1K9MC 2I0QA 4A3BH 3GTOH 3S1RH 1X55A 1TWCH 1XJVA 3PUVA 1L1OC 4A93G 5IYBH 2LXJA 3F2DA 1XNQL 4DV3L 4O2DA 3GTQH 2R93G 4DV4L 1Y1WG 2IHEA 3GTMH 2E8GA 4DV5L 2I5HA 3U58A 2JA7H 4JYAL 2VNUD 1J5EL 1HZAA 2CWAA 2IY5B 4YCVA 4ALPA 4DKAC 3T1YL 4HJ7A 4JI3L 3HOWG 2A19A 4JI5L 3RZOH 4DUYQ 4B3RQ 1DGSA 5IP7H 2K5NA 1SE8A 1L1OB 1BBWA 1YVCA 3RLOA 1GKHA 2ZTEA 3H15A 1LYLA 4HIKA 2E2JH 1G6PA 2XGTA 3OTOL 1N32L 5IYCG 2E2IH 2OTJA 5BR8Q 2XTIA 3HKZG 2CWPA 3L0OA 1N34L 4LFCQ 2BH2A 1E22A 3MEFA 3AYHB 1O7IA 2VUMH 2K50A 5AJ3Q 2UUAQ 4YWMA 4YCUA 1OXUA 2K5VA 3JC66 1JB7A 1VQ8A 2KCMA 2DUDA 1OXTA 2VY3A 2ZM6L 4PZ8A 5IY0A 1PH4A 4DR5Q 3ULJA 1KHIA 2JEBI 3CCEA 1W2BA 1E7ZA 4XTCS 2R7ZG 4LF6L 3TQYA 3K8AA 2EXDA 1MKHA 5C4XH 4OX9Q 3CCQA 1W3SA 3H0GH 1NJIC 4GLAC 1EYGA 3HOUH 4IPDA 1KQSA 2VS1A 1X6OA 4IPHA 4A3LH 4HIOA 4X66Q 3GD7A 1XMOQ 3RZDH 1K3RA 1KL9A 4UP8A 4LFAL 2WAQG 2Z0SA 4DUZL 1IBMQ 2YV5A 4JV5L 1PH3A 1HH2P 3E9IA 1I94Q 1EIYB 5FLMG 1A63A 1QUQA 1PV4A 3AFPA 3FHWA 4LF9Q 3CCSA 3NELA 2H5XA 1JMCA 3HOZG 1IZ6A 1NY4A 1X3FA 1K73C 4IFDI 1VQGA 4OWTB 1YBYA 3I4NG 4A3CG 2R7FA 3PSIA 3PV0A 3T1HQ 3S14H 3F2CA 1X9NA 3M4PA 1JE5A 1S3OA 2GVBA 5M3MG 4KLKA 2UXDL 3VDYA 1SROA 2ZTDA 3Q8DA 4GN5A 3D31A 2JA9A 3TREA 4JI0Q 2MNAA 1KXLA 4POGA 1NMGA 1QZGA 3GTLH 1SMXA 3PF5A 5HY6A 4P74A 2JA7G 1G51A 4LW1A 4JV5Q 2Q2TA 2IX0A 5C44G 1HZ9A 4LUOA 5LMNL 1PH9A 2RF4A 4DV2Q 3H3VH 3UE0A 3G4SA 1RIPA 1IBKQ 2I5MX 1QUQB 3BU2A 3CPWA 1Q86C 3HOVG 4OONA 5GAGC 1SRUA 2OTLA 3BZKA 4DAMA 4H02A 4OO1G 4R1JA 3RLFA 1NMFA 4DV0Q 3KF6A 3CMAA 4DR1L 2JE6I 1UE7A 5E7NA 3PIOA 4IJLA 3S16H 5M3FG 1IL2A 5LMUL 2B63G 4LFBQ 2N49A 2VUMG 2WB1E 3MXNB 1XMQQ 4YHHQ 3OW2A 1VQ4A 2CQOA 1X3EA 3I4OA 1VQEA 2PNHA 3I56A 2GN5A 4DUYL 4JI4L 1VQHA 3GTPH 1VQBA 3CC7A 5GADC 4JG2A 1N36Q 2A1AA 2BH8A 4APVA 3S17H 2UUBQ 3CC2A 1KRTA 4IPGA 2ZJRA 1VQOA 4JI6L 3I4MH 1KAWA 1HR0W 4NXNL 2UUAL 3F2BA 2YYZA 3NBHB 1C9OA 1Q8KA 5GAHC 5IWAL 4YY3L 1K83H 2KHJA 2IHFA 2K52A 1N33L 2D62A 4DK6C 4GLXA 1CSQA 5M5WH 4OWWB 4BY7H 3LGJA 1VQLA 4A3FG 1CKMA 1KC8C 2ALYB 4QQBX 1YJNA 3HOYG 1EUJA 4Y52H 1VCIA 1XPOA 4LUVA 1PH7A 3S15H 2LXKA 4A3EG 2UXBL 2N8NA 4DR6Q 3ER0A 3G6EA 1D7QA 4BXXH 3DM3A 3CCRA 3SGIA 1UE1A 4B3SL 3B6YA 1HNXQ 5IYDG 4X64Q 4B3TQ 1OTCA 1Q81C 2Y0SG 1XPRA 2ZJQA 2C35B 1Q12A 4BY1H 4LF5Q 1XNRQ 5EAYA 1PH1A 1UWVA 4HJ9A 1P8LA 3STBC 1PH6A 2UXCQ 4JI7Q 4BA1I 1WOCA 3HKZE 4JI1L 3STBD 1S72A 3OYYA 1GM5A 2UU9Q 1K0RA 4LF4Q 3PO3G 1CKNB 3EIVA 4BBSG 2JA5G 2ZJPA 1AE2A 2QGQA 3RNUA 4LF8L 4QL5A 2I5LX 4LF7Q 4JI2Q 4GNXA 4DR7Q 2ZTCA 2JA8G 2HQLA 3BJUA 3S1QH 3BZCA 3KDFB 1Z9FA 4ME3A 3J80c 4KHPQ 3RLNA 2NVQH 4DV1Q 1VS0A 4GN3B 4IPCA 1X65A 4X62Q 1Y1VG 2D0OA 4GNXC 3CC4A 4A3DG 1NTGA 4IFDG 1FGUA 5C0XJ 4AH6A 1Q1BA 2ASBA 1HNWQ 2RCNA 3FKIH 4A3MH 4JBKA 1I6HH 4AQYQ 3HOXH 4NXMQ 1VQCA 1D8LA 2IT1A 4DR3Q 2WAQE 3KJOA 4A3GH 1HR0Q 5HGQA 5C3EG 4DV6Q 1EIFA 5JJKA 1Y14B 3ICEA 1OXXK 1RL2A 4GKKQ 1N8RC 3I4MG 1IXRA 2B3GA 4GNXB 2E5LL 1UE5A 1YJWA 1SFOH 1E1OA 3H3VI 1L2FA 2DGYA 4A3KH 1FVIA 2HIXA 1PFSA 4NB3A 1YJ9A 2NN6I 3NENA 4PG3A 3UDXA 2JA6G 1UEBA 2VQEL 4UY8C 3KJPA 5GQOA 4PMWA 5JEAJ 4C3JH 1HNZQ 1PA6A 1SN8A 2HHHQ 3K7AH 2F52A 4DPGA 1P16A 1N36L 1ASZA 4GN4B 1VQ7A 3PO2G 2N78A 3JAMc 4BY7G 1VQ6A 4X65L 2Q2HA 2YTYA 4DAYB 5FLXc 4RG1A 3A5UA 1E24A 3HKSA 1VQFA 1G291 5IP9H 2NVXH 1BKBA 4A3BG 3D0FA 1HZCA 3CXCA 1MIUA 2F4VL 1WCMH 4K0KL 2MFIA 5IYBG 1XNQQ 1JT8A 2D0PA 4A3JH 4DV7L 3PF4A 4DV4Q 4JCVE 3K0XA 4DV5Q 1EQQA 1R9TH 3CAMA 4EX5A 1B7YB 1J5EQ 2Q2UA 3T1YQ 4BBRH 1FJGL 3F8TA 4QY7A 4JI5Q 2R92H 2PI2A 1AE3A 3J7ZC 1YIJA 1H95A 5IP7G 1X56A 3TEHB 1PH5A 4JOIA 2LSSA 1V1QA 4MNOA 1VQAA 3FP9A 3OTOQ 3AEVA 2RHQB 1M90C 1N32Q 4C3HH 2R93H 1N34Q 4MZ9A 5JJLA 2JJQA 2RHSB 3U50C 2N3SA 1N9WA 1HZBA 1NE3A 1B8AA 4R4TA 1QVFA 5C0XI 3S2DH 1J6QA 1WYDA 1YHAA 3HOWH 3J81c 4JOIC 2OQKA 5GROA 1CKOA 2PQAA 5M5XH 4B3RL 1AH9A 2ZM6Q 4JI2L 1C0AA 3EN2A 2IX1A 1A62A 2HT1A 4QIWE 2ES2A 3PUYA 5IYCH 4LF6Q 1YHBA 1GVPA 2WFWA 1BBUA 1KRSA 2BA0A 2VZAA 4LFCL 5BR8L 3HOXG 4HJAA 1JJ2A 1EFWA 3CCLA 4KHPL 5C4XG 3EBEA 2K75A 4R4CA 5AJ3L 1Q1EA 1K8AC 2NVTH 3H0GG 3ULPA 3KFUA 1YNXA 3HOUG 1PH8A 2EQSA 1IYJB 4A3LG 1VQMA 5GAEC 1T9HA 3KF6B 2MO0A 3UDFA 4A76A 2VL6A 4LFAQ 1TWHH 3W1GA 4DR5L 3S1MH 2R7ZH 1VQJA 3CCJA 4AQYL 2K4KA 3KF8B 3PUWA 1KD1C 4GS3A 4PZ7A 2Y0SE 3RN5A 1HR0L 4JI8Q 4OX9L 1VQ5A 1VQKA 1YITA 2PQAB 1Q46A 1LM0A 5M5YH 1TWFH 3ZJYC 4DR2Q 4X66L 3UDIA 1XMOL 4C2MH 2QEXA 1OXSC 3M7NA 4A75A 1TWAH 1IBML 3E9HA 3M85A 3WWVA 4UP7A 2UXDQ 4AYBE 2AKWB 5FLMH 1I94L 1S40A 1HNZL 2HHHL 3E0EA 1M1KC 1PVOA 4P75A 1TXYA 4LF9L 2EIFA 2YTXA 3HOZH 3GTJH 1A8VA 4A3CH 3I4NH 3G48A 1LTLA 4TVAB 4A3IH 3PCOB 3T1HL 1E1TA 5DLQE 4X6AH 4IFDJ 3A0JA 4AYBG 5M3MH 1XTDA 2R92G 3S2HH 4P73A 4B3MQ 1B70B 4HJ5A 2NN6G 2UUCQ 3A74A 4JI0L 4DR1Q 4BA2I 3GTKH 5K36G 2PMZE 2MQHA 4JC0A 4QJFA 5LMUQ 1X3GA 2AMCB 4A4IA 3HFZB 1ASYA 2F3IA 5C44H 4L5TA 4YCWA 1IBLQ 3K81C 2CCZA 4DV2L 1CUKA 3KOJA 4JI4Q 4JBMA 2R7DA 1IBKL 4C3IH 3I55A 3HOVH 4GKJQ 3KLWA 1NBWA 3KYHC 2WP8J 3DLLA 1I5FA 2ATWA 3M4QA 3U4ZA 2KCTA 4DV0L 4DK3C 4JI6Q 5M3FH 1YI2A 2E2HH 4DR4Q 4HIDA 2B63H 3CD6A 4LFBL 3PUXA 4XIGS 4NXNQ 4UPAA 1WI5A 5FJ8H 1XMQL 2K14A 4YHHL 1FL0A 3TS2A 5IWAQ 4YY3Q 2KHIA 3PIPA 1VQNA 3J7A5 4R4IA 4LUZA 4JBWA 1N33Q 2OWOA 4WJ4A 2VQFQ 2KENA 1Q82C 3L2PA 5JJIA 3PGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2UUB L;  3CF5 A;  3J80 i;  2OCE A;  5ELN A;  4IJH A;  1WFQ A;  1VQP A;  3S1N H;  3RN2 A;  4PZ6 A;  2GVA A;  3CCM A;  1JJC B;  2UXB Q;  1EOV A;  3W5O A;  4BXX G;  5C0X G;  2CFM A;  4KHZ A;  1PYS B;  5ELO A;  3I7F A;  5C4J H;  1Z47 A;  3CP0 A;  4L5S A;  4B3S Q;  4DV3 Q;  2AWN A;  4A3F H;  1GD7 A;  1L0W A;  4BY1 G;  3HOY H;  3CPF A;  5H1S E;  4JYA Q;  4JI1 Q;  4JI8 L;  4A3E H;  1HJP A;  1I3Q H;  3CQZ H;  1X54 A;  4WJ3 M;  4EQ5 A;  3ERS X;  4IO9 A;  4JI3 Q;  4DR6 L;  2B29 A;  4TQU S;  1VQI A;  2MO1 A;  2NZO A;  1LUZ A;  2V1C C;  4DR2 L;  3UDG A;  4LF8 Q;  4A93 H;  4A3I G;  4L5R C;  4POF A;  2VW9 A;  3CW2 C;  2Z6K A;  1QZH A;  1HNX L;  5IYD H;  4UP9 A;  4X64 L;  5LMN W;  4GOP A;  4B3T L;  1Y1W H;  1K8G A;  5JEA G;  4J15 A;  4LF5 L;  1XNR L;  1YEZ A;  4HJ8 A;  4AIM A;  1QVC A;  4QGU A;  2UXC L;  2HIV A;  4JI7 L;  2UU9 L;  3JAM i;  3PO3 H;  4GLV B;  4LF4 L;  3UE1 A;  1V9P A;  4BBS H;  2JA5 H;  4KI0 A;  2R6G A;  2Z6K C;  3J81 j;  4GOP C;  1PHJ A;  3AQQ A;  4LF7 L;  4P72 A;  1GO3 E;  1SLJ A;  3F1Z A;  2JEA I;  4DR7 L;  1XPU A;  3I2Z A;  2JA8 H;  3FKI G;  3GDE A;  1U5K A;  4A3M G;  2A8V A;  1JJG A;  3CCU A;  3IRB A;  4B3M L;  1VQD A;  3PUZ A;  2JQO A;  3GO5 A;  4A3G G;  3A5Z B;  3GTG H;  4DV1 L;  2UUC L;  2BA1 A;  3CCV A;  1MJC A;  1Y1V H;  1PH2 A;  2K5H A;  1PYB A;  4X62 L;  2L15 A;  2E5L Q;  3NEM A;  4A3D H;  4HIM A;  3S24 A;  3U4V A;  3CME A;  4GOP B;  1YZ6 A;  1OXV A;  3TRZ A;  1HNW L;  4RMF A;  5FJ8 G;  1IBL L;  1A0I A;  1CSP A;  4DUZ Q;  4A3K G;  2ID0 A;  3W1B A;  1E3P A;  1UE6 A;  2OQ0 A;  5IT9 c;  1VQ9 A;  3K7U C;  2VQE Q;  2AWO A;  2YU9 H;  1SR3 A;  4NXM L;  4GKJ L;  4DR3 L;  4LWC A;  2PI2 E;  5C3E H;  4L5Q A;  4DV6 L;  4DNI A;  4O0A A;  5IE8 A;  1I50 H;  4Y7N H;  4R4O A;  4X65 Q;  4GKK L;  2WB1 G;  1C7Y A;  4DR4 L;  4JBJ A;  5J3B A;  4LNQ A;  3M4O H;  3TS0 A;  1Q7Y C;  4OWX B;  1KIX A;  3RR5 A;  4R4Q A;  3J81 i;  2CKZ B;  3G71 A;  1BVS A;  2YTV A;  3M9B A;  1WJJ A;  4FDB A;  1QVG A;  1TWG H;  5IP9 G;  2JA6 H;  4YWK A;  2NVY H;  2FXQ A;  3AFQ A;  1CKN A;  3L7Z C;  2JK8 A;  4OO1 I;  2F4V Q;  2AHO B;  2NZH A;  4YWL A;  1YHQ A;  1WCM G;  4K0K Q;  2VQF L;  1MJE A;  4MTN A;  4P71 A;  4DV7 Q;  4A3J G;  3PO2 H;  3ULL A;  1L1O A;  2QA4 A;  1EWI A;  1V43 A;  2KBN A;  4IOA A;  2Q2I A;  4OXP A;  3M3Y H;  3K80 C;  3KDF A;  1EQR A;  1FJG Q;  4IOC A;  1U0L A;  4BBR G;  5LMN Q;  4NPS A;  1K9M C;  2I0Q A;  4A3B H;  3GTO H;  3S1R H;  1X55 A;  1TWC H;  1XJV A;  3PUV A;  1L1O C;  4A93 G;  5IYB H;  2LXJ A;  3F2D A;  1XNQ L;  4DV3 L;  4O2D A;  3GTQ H;  2R93 G;  4DV4 L;  1Y1W G;  2IHE A;  3GTM H;  2E8G A;  4DV5 L;  2I5H A;  3U58 A;  2JA7 H;  4JYA L;  2VNU D;  1J5E L;  1HZA A;  2CWA A;  2IY5 B;  4YCV A;  4ALP A;  4DKA C;  3T1Y L;  4HJ7 A;  4JI3 L;  3HOW G;  2A19 A;  4JI5 L;  3RZO H;  4DUY Q;  4B3R Q;  1DGS A;  5IP7 H;  2K5N A;  1SE8 A;  1L1O B;  1BBW A;  1YVC A;  3RLO A;  1GKH A;  2ZTE A;  3H15 A;  1LYL A;  4HIK A;  2E2J H;  1G6P A;  2XGT A;  3OTO L;  1N32 L;  5IYC G;  2E2I H;  2OTJ A;  5BR8 Q;  2XTI A;  3HKZ G;  2CWP A;  3L0O A;  1N34 L;  4LFC Q;  2BH2 A;  1E22 A;  3MEF A;  3AYH B;  1O7I A;  2VUM H;  2K50 A;  5AJ3 Q;  2UUA Q;  4YWM A;  4YCU A;  1OXU A;  2K5V A;  3JC6 6;  1JB7 A;  1VQ8 A;  2KCM A;  2DUD A;  1OXT A;  2VY3 A;  2ZM6 L;  4PZ8 A;  5IY0 A;  1PH4 A;  4DR5 Q;  3ULJ A;  1KHI A;  2JEB I;  3CCE A;  1W2B A;  1E7Z A;  4XTC S;  2R7Z G;  4LF6 L;  3TQY A;  3K8A A;  2EXD A;  1MKH A;  5C4X H;  4OX9 Q;  3CCQ A;  1W3S A;  3H0G H;  1NJI C;  4GLA C;  1EYG A;  3HOU H;  4IPD A;  1KQS A;  2VS1 A;  1X6O A;  4IPH A;  4A3L H;  4HIO A;  4X66 Q;  3GD7 A;  1XMO Q;  3RZD H;  1K3R A;  1KL9 A;  4UP8 A;  4LFA L;  2WAQ G;  2Z0S A;  4DUZ L;  1IBM Q;  2YV5 A;  4JV5 L;  1PH3 A;  1HH2 P;  3E9I A;  1I94 Q;  1EIY B;  5FLM G;  1A63 A;  1QUQ A;  1PV4 A;  3AFP A;  3FHW A;  4LF9 Q;  3CCS A;  3NEL A;  2H5X A;  1JMC A;  3HOZ G;  1IZ6 A;  1NY4 A;  1X3F A;  1K73 C;  4IFD I;  1VQG A;  4OWT B;  1YBY A;  3I4N G;  4A3C G;  2R7F A;  3PSI A;  3PV0 A;  3T1H Q;  3S14 H;  3F2C A;  1X9N A;  3M4P A;  1JE5 A;  1S3O A;  2GVB A;  5M3M G;  4KLK A;  2UXD L;  3VDY A;  1SRO A;  2ZTD A;  3Q8D A;  4GN5 A;  3D31 A;  2JA9 A;  3TRE A;  4JI0 Q;  2MNA A;  1KXL A;  4POG A;  1NMG A;  1QZG A;  3GTL H;  1SMX A;  3PF5 A;  5HY6 A;  4P74 A;  2JA7 G;  1G51 A;  4LW1 A;  4JV5 Q;  2Q2T A;  2IX0 A;  5C44 G;  1HZ9 A;  4LUO A;  5LMN L;  1PH9 A;  2RF4 A;  4DV2 Q;  3H3V H;  3UE0 A;  3G4S A;  1RIP A;  1IBK Q;  2I5M X;  1QUQ B;  3BU2 A;  3CPW A;  1Q86 C;  3HOV G;  4OON A;  5GAG C;  1SRU A;  2OTL A;  3BZK A;  4DAM A;  4H02 A;  4OO1 G;  4R1J A;  3RLF A;  1NMF A;  4DV0 Q;  3KF6 A;  3CMA A;  4DR1 L;  2JE6 I;  1UE7 A;  5E7N A;  3PIO A;  4IJL A;  3S16 H;  5M3F G;  1IL2 A;  5LMU L;  2B63 G;  4LFB Q;  2N49 A;  2VUM G;  2WB1 E;  3MXN B;  1XMQ Q;  4YHH Q;  3OW2 A;  1VQ4 A;  2CQO A;  1X3E A;  3I4O A;  1VQE A;  2PNH A;  3I56 A;  2GN5 A;  4DUY L;  4JI4 L;  1VQH A;  3GTP H;  1VQB A;  3CC7 A;  5GAD C;  4JG2 A;  1N36 Q;  2A1A A;  2BH8 A;  4APV A;  3S17 H;  2UUB Q;  3CC2 A;  1KRT A;  4IPG A;  2ZJR A;  1VQO A;  4JI6 L;  3I4M H;  1KAW A;  1HR0 W;  4NXN L;  2UUA L;  3F2B A;  2YYZ A;  3NBH B;  1C9O A;  1Q8K A;  5GAH C;  5IWA L;  4YY3 L;  1K83 H;  2KHJ A;  2IHF A;  2K52 A;  1N33 L;  2D62 A;  4DK6 C;  4GLX A;  1CSQ A;  5M5W H;  4OWW B;  4BY7 H;  3LGJ A;  1VQL A;  4A3F G;  1CKM A;  1KC8 C;  2ALY B;  4QQB X;  1YJN A;  3HOY G;  1EUJ A;  4Y52 H;  1VCI A;  1XPO A;  4LUV A;  1PH7 A;  3S15 H;  2LXK A;  4A3E G;  2UXB L;  2N8N A;  4DR6 Q;  3ER0 A;  3G6E A;  1D7Q A;  4BXX H;  3DM3 A;  3CCR A;  3SGI A;  1UE1 A;  4B3S L;  3B6Y A;  1HNX Q;  5IYD G;  4X64 Q;  4B3T Q;  1OTC A;  1Q81 C;  2Y0S G;  1XPR A;  2ZJQ A;  2C35 B;  1Q12 A;  4BY1 H;  4LF5 Q;  1XNR Q;  5EAY A;  1PH1 A;  1UWV A;  4HJ9 A;  1P8L A;  3STB C;  1PH6 A;  2UXC Q;  4JI7 Q;  4BA1 I;  1WOC A;  3HKZ E;  4JI1 L;  3STB D;  1S72 A;  3OYY A;  1GM5 A;  2UU9 Q;  1K0R A;  4LF4 Q;  3PO3 G;  1CKN B;  3EIV A;  4BBS G;  2JA5 G;  2ZJP A;  1AE2 A;  2QGQ A;  3RNU A;  4LF8 L;  4QL5 A;  2I5L X;  4LF7 Q;  4JI2 Q;  4GNX A;  4DR7 Q;  2ZTC A;  2JA8 G;  2HQL A;  3BJU A;  3S1Q H;  3BZC A;  3KDF B;  1Z9F A;  4ME3 A;  3J80 c;  4KHP Q;  3RLN A;  2NVQ H;  4DV1 Q;  1VS0 A;  4GN3 B;  4IPC A;  1X65 A;  4X62 Q;  1Y1V G;  2D0O A;  4GNX C;  3CC4 A;  4A3D G;  1NTG A;  4IFD G;  1FGU A;  5C0X J;  4AH6 A;  1Q1B A;  2ASB A;  1HNW Q;  2RCN A;  3FKI H;  4A3M H;  4JBK A;  1I6H H;  4AQY Q;  3HOX H;  4NXM Q;  1VQC A;  1D8L A;  2IT1 A;  4DR3 Q;  2WAQ E;  3KJO A;  4A3G H;  1HR0 Q;  5HGQ A;  5C3E G;  4DV6 Q;  1EIF A;  5JJK A;  1Y14 B;  3ICE A;  1OXX K;  1RL2 A;  4GKK Q;  1N8R C;  3I4M G;  1IXR A;  2B3G A;  4GNX B;  2E5L L;  1UE5 A;  1YJW A;  1SFO H;  1E1O A;  3H3V I;  1L2F A;  2DGY A;  4A3K H;  1FVI A;  2HIX A;  1PFS A;  4NB3 A;  1YJ9 A;  2NN6 I;  3NEN A;  4PG3 A;  3UDX A;  2JA6 G;  1UEB A;  2VQE L;  4UY8 C;  3KJP A;  5GQO A;  4PMW A;  5JEA J;  4C3J H;  1HNZ Q;  1PA6 A;  1SN8 A;  2HHH Q;  3K7A H;  2F52 A;  4DPG A;  1P16 A;  1N36 L;  1ASZ A;  4GN4 B;  1VQ7 A;  3PO2 G;  2N78 A;  3JAM c;  4BY7 G;  1VQ6 A;  4X65 L;  2Q2H A;  2YTY A;  4DAY B;  5FLX c;  4RG1 A;  3A5U A;  1E24 A;  3HKS A;  1VQF A;  1G29 1;  5IP9 H;  2NVX H;  1BKB A;  4A3B G;  3D0F A;  1HZC A;  3CXC A;  1MIU A;  2F4V L;  1WCM H;  4K0K L;  2MFI A;  5IYB G;  1XNQ Q;  1JT8 A;  2D0P A;  4A3J H;  4DV7 L;  3PF4 A;  4DV4 Q;  4JCV E;  3K0X A;  4DV5 Q;  1EQQ A;  1R9T H;  3CAM A;  4EX5 A;  1B7Y B;  1J5E Q;  2Q2U A;  3T1Y Q;  4BBR H;  1FJG L;  3F8T A;  4QY7 A;  4JI5 Q;  2R92 H;  2PI2 A;  1AE3 A;  3J7Z C;  1YIJ A;  1H95 A;  5IP7 G;  1X56 A;  3TEH B;  1PH5 A;  4JOI A;  2LSS A;  1V1Q A;  4MNO A;  1VQA A;  3FP9 A;  3OTO Q;  3AEV A;  2RHQ B;  1M90 C;  1N32 Q;  4C3H H;  2R93 H;  1N34 Q;  4MZ9 A;  5JJL A;  2JJQ A;  2RHS B;  3U50 C;  2N3S A;  1N9W A;  1HZB A;  1NE3 A;  1B8A A;  4R4T A;  1QVF A;  5C0X I;  3S2D H;  1J6Q A;  1WYD A;  1YHA A;  3HOW H;  3J81 c;  4JOI C;  2OQK A;  5GRO A;  1CKO A;  2PQA A;  5M5X H;  4B3R L;  1AH9 A;  2ZM6 Q;  4JI2 L;  1C0A A;  3EN2 A;  2IX1 A;  1A62 A;  2HT1 A;  4QIW E;  2ES2 A;  3PUY A;  5IYC H;  4LF6 Q;  1YHB A;  1GVP A;  2WFW A;  1BBU A;  1KRS A;  2BA0 A;  2VZA A;  4LFC L;  5BR8 L;  3HOX G;  4HJA A;  1JJ2 A;  1EFW A;  3CCL A;  4KHP L;  5C4X G;  3EBE A;  2K75 A;  4R4C A;  5AJ3 L;  1Q1E A;  1K8A C;  2NVT H;  3H0G G;  3ULP A;  3KFU A;  1YNX A;  3HOU G;  1PH8 A;  2EQS A;  1IYJ B;  4A3L G;  1VQM A;  5GAE C;  1T9H A;  3KF6 B;  2MO0 A;  3UDF A;  4A76 A;  2VL6 A;  4LFA Q;  1TWH H;  3W1G A;  4DR5 L;  3S1M H;  2R7Z H;  1VQJ A;  3CCJ A;  4AQY L;  2K4K A;  3KF8 B;  3PUW A;  1KD1 C;  4GS3 A;  4PZ7 A;  2Y0S E;  3RN5 A;  1HR0 L;  4JI8 Q;  4OX9 L;  1VQ5 A;  1VQK A;  1YIT A;  2PQA B;  1Q46 A;  1LM0 A;  5M5Y H;  1TWF H;  3ZJY C;  4DR2 Q;  4X66 L;  3UDI A;  1XMO L;  4C2M H;  2QEX A;  1OXS C;  3M7N A;  4A75 A;  1TWA H;  1IBM L;  3E9H A;  3M85 A;  3WWV A;  4UP7 A;  2UXD Q;  4AYB E;  2AKW B;  5FLM H;  1I94 L;  1S40 A;  1HNZ L;  2HHH L;  3E0E A;  1M1K C;  1PVO A;  4P75 A;  1TXY A;  4LF9 L;  2EIF A;  2YTX A;  3HOZ H;  3GTJ H;  1A8V A;  4A3C H;  3I4N H;  3G48 A;  1LTL A;  4TVA B;  4A3I H;  3PCO B;  3T1H L;  1E1T A;  5DLQ E;  4X6A H;  4IFD J;  3A0J A;  4AYB G;  5M3M H;  1XTD A;  2R92 G;  3S2H H;  4P73 A;  4B3M Q;  1B70 B;  4HJ5 A;  2NN6 G;  2UUC Q;  3A74 A;  4JI0 L;  4DR1 Q;  4BA2 I;  3GTK H;  5K36 G;  2PMZ E;  2MQH A;  4JC0 A;  4QJF A;  5LMU Q;  1X3G A;  2AMC B;  4A4I A;  3HFZ B;  1ASY A;  2F3I A;  5C44 H;  4L5T A;  4YCW A;  1IBL Q;  3K81 C;  2CCZ A;  4DV2 L;  1CUK A;  3KOJ A;  4JI4 Q;  4JBM A;  2R7D A;  1IBK L;  4C3I H;  3I55 A;  3HOV H;  4GKJ Q;  3KLW A;  1NBW A;  3KYH C;  2WP8 J;  3DLL A;  1I5F A;  2ATW A;  3M4Q A;  3U4Z A;  2KCT A;  4DV0 L;  4DK3 C;  4JI6 Q;  5M3F H;  1YI2 A;  2E2H H;  4DR4 Q;  4HID A;  2B63 H;  3CD6 A;  4LFB L;  3PUX A;  4XIG S;  4NXN Q;  4UPA A;  1WI5 A;  5FJ8 H;  1XMQ L;  2K14 A;  4YHH L;  1FL0 A;  3TS2 A;  5IWA Q;  4YY3 Q;  2KHI A;  3PIP A;  1VQN A;  3J7A 5;  4R4I A;  4LUZ A;  4JBW A;  1N33 Q;  2OWO A;  4WJ4 A;  2VQF Q;  2KEN A;  1Q82 C;  3L2P A;  5JJI A;  3PGZ A; 
#chains in the Genus database with same CATH topology
 5ELF A;  2CQY A;  4ECZ A;  2UUB L;  2NU7 B;  3J80 i;  5ELN A;  2E2J B;  3F8N A;  5ISR A;  5F9N A;  3S1Q B;  2QF7 A;  1PYS B;  4UAI A;  5C4J H;  3Q1K A;  1D5Z C;  1RD9 D;  3N43 B;  5EPK A;  4A2A A;  4JI8 H;  2VPS A;  5DGB A;  3HOY H;  1WSC A;  1JX4 A;  4JI8 L;  3KHH A;  1HJP A;  1I3Q H;  1I6V C;  3ERS X;  1F9R A;  4IO9 A;  4DR6 L;  3LML A;  4LK1 C;  2XGP A;  2FIN B;  2G5D A;  4X64 H;  1BCP F;  1PMR A;  5KT7 A;  1XNR H;  4L5R C;  1WCM A;  1SNP A;  4POF A;  2OLS A;  2AQ3 B;  4GC6 A;  4X64 L;  4G4K A;  1Y1W H;  1K8G A;  1XNR L;  4J15 A;  5LXT F;  1M8A A;  2W6N A;  1YEZ A;  1JOR A;  4QWD A;  4QWE A;  3C0F B;  4QGU A;  4XQQ A;  3RBE A;  2EVB A;  2PW5 A;  3JAM i;  4KY6 A;  4Q5V A;  2BOS A;  5I9P A;  1QJO A;  4BBS H;  3Q8Q B;  2R92 A;  2J6T A;  2I87 A;  4GOP C;  3PW4 A;  3IG0 A;  1SLJ A;  1XPU A;  2NWG A;  2J9G A;  1SYF A;  3TP8 A;  2A8V A;  3GDE A;  1JJG A;  1A3T A;  5DG8 A;  3LP8 A;  4UCS A;  3S14 B;  4X62 H;  1SMY D;  3BJY A;  3A5Z B;  2XC9 A;  1PH2 A;  4ZOL F;  2K5H A;  1PYB A;  4X62 L;  1CS0 A;  4F50 A;  2L15 A;  1KNA A;  4A3J B;  2NUA B;  5A2Q W;  2FP4 B;  3I73 A;  2VXW A;  1YZ6 A;  1HNW L;  3TRZ A;  4GKJ H;  1RTN A;  1PZI D;  2K28 A;  4RMF A;  1A0I A;  5FJ8 G;  3GTL B;  1C4Q A;  4WJW A;  3W1B A;  5IT9 c;  2YU9 H;  1PDQ A;  4DV6 H;  1GSA A;  4GKJ L;  2VUG A;  2R92 B;  2R8G A;  2F4I A;  2O5J C;  4DR4 H;  4DV6 L;  1LLR D;  1IYV A;  1I50 H;  1SEB D;  3VYT A;  1M0W A;  2HVQ A;  2EOT A;  4DR4 L;  1TS3 A;  4C3H B;  2V4Q A;  1TWH A;  4FDB A;  3S16 B;  2ASL A;  1SYX B;  1E4F T;  2FXQ A;  4XYL B;  3J7A F;  3A7L A;  5FLX L;  1PRT B;  2QYZ A;  5CV5 A;  1MJE A;  1V8Q A;  1A3V A;  1HUM A;  3PO2 H;  3DHQ A;  1L1O A;  3HG9 A;  3CRL C;  2QDB A;  3M3Y H;  2FE3 A;  3K80 C;  3KDF A;  2F1M A;  3QG1 A;  2IP4 A;  1PX2 A;  3RAX A;  3CU7 A;  5D3I B;  1K9M C;  2I0Q A;  4DV3 H;  2FLL A;  1X55 A;  2PNR C;  3D4W A;  4A93 G;  1AN7 A;  1QWY A;  3TIN A;  4DV3 L;  4JYA H;  4O2D A;  4HNT A;  1SXT A;  3GTJ A;  3IKJ A;  3T1Y H;  2E8G A;  3U58 A;  4JYA L;  3R5F A;  1TWH B;  2CWA A;  5TSS A;  5CR3 A;  3T1Y L;  3Q24 A;  1XDN A;  5E3F A;  4KN7 C;  4B3R Q;  3OTO H;  2P5Z X;  1RTO A;  4IWY A;  1L1O B;  1BBW A;  4HIK A;  1HQM C;  3QZ7 A;  3OTO L;  2D5D A;  4WFN 3;  5IYC G;  1KXL A;  5BR8 Q;  4IUP A;  4LFC Q;  2EYH A;  2BH2 A;  4P2C B;  3M4Y A;  3AYH B;  4M9U A;  2VUM H;  2K50 A;  5AJ3 Q;  1JLL B;  3NWS A;  5D3D A;  2AQ2 B;  1VQ8 A;  3TBI B;  4O4L F;  4H44 C;  5E4W C;  5KFS A;  4XT1 B;  5BPF A;  3H4D A;  4FVM A;  1KHI A;  3QIA A;  5EKK A;  4O4H F;  5IGC A;  4QF4 A;  4XTC S;  3K8A A;  4A3I B;  4EYH B;  1JQY D;  4PQX A;  2X6G A;  5L1L A;  1C30 A;  4HCS A;  1MKH A;  1SFO A;  1KDB A;  1O7Z A;  5KFE A;  3ETH A;  2VS1 A;  4HIO A;  2ZXR A;  5C5M A;  4X66 Q;  3MFG A;  4HR7 B;  1D5X C;  2Z0S A;  1PK8 A;  1PH3 A;  3E9I A;  5C8Y F;  1I6H B;  5L9X A;  1QUQ A;  4RH6 A;  4U6P A;  3AFP A;  2QIL A;  4C3I B;  1QIL A;  4IFD I;  2VOB A;  2ZDQ A;  1IZ6 A;  1K73 C;  3N6X A;  4MV9 A;  5D65 A;  1VQG A;  4F4Y A;  3I4N G;  2Z4I A;  4HMJ A;  1JC7 A;  3PW2 A;  3T1H Q;  1IW7 C;  3LX0 A;  2EE1 A;  5M3M G;  4KLK A;  3P20 A;  1SFO B;  1E4G T;  5KT6 A;  4DV7 H;  1EUD B;  2EY2 A;  3VMM A;  3VDY A;  5KNB A;  3Q8D A;  4YB8 B;  1EY4 A;  2A74 C;  2JA9 A;  1OWT A;  4JI0 Q;  2XVS A;  2MNA A;  2YZM A;  2WII B;  4POG A;  1GUG A;  1QZG A;  3JRW A;  1G51 A;  2IX0 A;  2G9D A;  1HZ9 A;  1DV1 A;  1I4Q A;  2WB1 B;  4O3R A;  4DV2 Q;  4KKU A;  3N44 B;  2I5M X;  1HRJ A;  1QUQ B;  3CPW A;  3PN1 A;  2NN6 H;  4XZ3 B;  1W6K A;  3EFX D;  3BZK A;  2C2E A;  3MEH A;  4R1J A;  3KLS A;  5K36 H;  4DV0 Q;  4I55 F;  2JA5 A;  5KG0 A;  1KEE A;  3RV4 A;  1IL2 A;  2ZXP A;  2B63 G;  4LFB Q;  2N49 A;  3HEJ A;  1XMQ Q;  3OW2 A;  4ECY A;  3UFX B;  3T5L A;  3PZP A;  4EQP A;  4JI4 L;  2GN5 A;  2W7O A;  3QO2 A;  2EY5 A;  4JI6 H;  1SSO A;  3GTG A;  4KN4 C;  5JVL A;  2XNA C;  1KLG D;  4JG2 A;  1Y1V A;  2GA4 B;  3I8Z A;  2UUB Q;  3I4M H;  5C3X A;  4JI6 L;  2ZJR A;  3J7Y W;  1IOW A;  1JE4 A;  3Q2O A;  1CT1 D;  1KAW A;  3PMF A;  1HR0 W;  1JOQ A;  3CHB D;  1N33 H;  4BWS C;  1S9F A;  1Q8K A;  5GAH C;  5IWA L;  5L37 A;  1N33 L;  3ITP A;  3WNZ A;  3OWE B;  2RSO A;  5DEH A;  1M7J A;  4BY7 H;  5DM6 3;  1TA8 A;  5IGD A;  4Q8F A;  1CKM A;  4ECU A;  2IWH A;  4G57 A;  4KD3 A;  2AU0 A;  5EKL A;  1VCI A;  2V58 A;  1XPO A;  3VA5 A;  4DN4 M;  5FLX W;  4C2M A;  3HKZ B;  2MGS A;  4DR6 Q;  5HUR A;  2Q8T A;  1D7Q A;  2J7Z A;  2TMP A;  4IZ8 A;  3H6M A;  3GTG B;  5FPO A;  2F0L A;  1Y1V B;  5HV6 A;  3JZI A;  5IYD G;  4X64 Q;  1EY6 A;  4DK0 A;  4JI1 H;  1XNR Q;  4CDC C;  1RHP A;  4FS1 A;  4HJ9 A;  1PLF A;  2QCP X;  4KK7 A;  4JI1 L;  3STB D;  1GM5 A;  2R7Z B;  1CKN B;  1X3P A;  1AE2 A;  5KFA A;  1H9K A;  4QL5 A;  4JI2 Q;  3FRP B;  1F2Y A;  4Y7N B;  1SJE D;  3SK6 A;  5M5Y B;  1TWF B;  3BQ1 A;  4EBD A;  3DEP A;  2ZTC A;  3GTQ A;  2HQL A;  5CAE B;  3J81 L;  1ENF A;  5EPJ A;  4C2M B;  1M0T A;  1S10 A;  1EWC A;  2WAQ B;  3RLN A;  2NVQ H;  1DOK A;  1SNC A;  4GN3 B;  4X62 Q;  2UVV A;  4CGY B;  1CI3 M;  1K8O A;  3BG3 A;  5C0X J;  1HNW Q;  4ME6 A;  2RCN A;  1SE4 A;  4UHV A;  3ZYY X;  3MR3 A;  1D8L A;  3OOC A;  3JAM E;  4RB3 C;  4M1U B;  2MCT A;  1HR0 Q;  5HGQ A;  3S2H B;  4DV6 Q;  2E5L H;  4K5X A;  1II3 A;  1RL2 A;  2AUK A;  1N8R C;  1EEI D;  4MTE A;  1NR4 A;  2E5L L;  4YHH H;  1E1O A;  4RU9 A;  2FJZ A;  2VQE H;  4OHJ A;  2DGY A;  1FVI A;  1O7Y A;  2HIX A;  4NB3 A;  4MV1 A;  4FM9 A;  3UDX A;  2JA6 G;  1ZHQ A;  2VQE L;  3IL8 A;  5JEA J;  5KG6 A;  3QWN A;  4C3J H;  4IUQ A;  1PA6 A;  1HNZ Q;  2HHH Q;  2K33 A;  5JAV A;  1ASZ A;  2VPQ A;  2VR1 A;  1DZ1 A;  4EVO A;  5EWG A;  1BUV T;  3SXH A;  4J9N A;  3A5U A;  1JB3 A;  1M4V A;  3QR8 A;  2W7P A;  4RGO S;  1VQF A;  1G29 1;  4IUV A;  2NVX H;  1KDA A;  1K28 A;  4OIJ A;  1PTO C;  1DON A;  5CA0 F;  5KFF A;  3PF4 A;  1R4P B;  1FJG H;  4EX5 A;  4C5B A;  3W2D A;  2VB2 X;  4JK1 C;  2KCC A;  3T1Y Q;  2RDJ A;  1X32 A;  1FJG L;  3K5H A;  2Y0S A;  4I7H A;  3OHA A;  3J7Z C;  1DXM A;  2W9B A;  1S5E D;  1G2T A;  3Q8P B;  2OT2 A;  1DV2 A;  3TEH B;  3PVX A;  4JOI A;  4L8J A;  5CA1 F;  1S0N A;  4MNO A;  3OTO Q;  1M90 C;  4R8N A;  4ED6 A;  5CV8 A;  4RKB A;  4FBT A;  2YYA A;  2JJQ A;  1PXU A;  5KGU A;  2N3S A;  1AZP A;  4R4T A;  1UNS A;  2MHV A;  5KG3 A;  1YNN C;  1B4O A;  5C0X I;  4A3F B;  1WYD A;  4C5A A;  4J9L A;  3J81 c;  2F0N A;  2KCN A;  4DR7 H;  2OQK A;  1RDP D;  2PQA A;  3MWD A;  1AH9 A;  4A3E B;  4HYK A;  3CQZ B;  3VPC A;  4KD4 A;  3BDO A;  4QIW E;  5IYC H;  5FPR A;  4KHP H;  2F0H A;  1KRS A;  2NZ1 D;  3H3V C;  1QOH A;  2Y0S B;  4KHP L;  4R4C A;  1GHK A;  2HGS A;  1ZYR D;  2EQS A;  2OEO A;  3PO3 B;  1F9P A;  1T9H A;  1SNM A;  4YAK B;  3KF6 B;  2MO0 A;  1UC9 A;  2VL6 A;  3S1M H;  3CCJ A;  1PZK D;  3PUW A;  2L5T A;  1J8I A;  2QW7 A;  1PRT C;  1TS5 A;  1Z6H A;  2PQA B;  2H1E A;  1F2L A;  4V19 0;  5E1F A;  1XMO L;  4K14 A;  3D6C A;  1NSN S;  2K03 A;  4A3D B;  3DM1 A;  5DM7 3;  3K3V A;  4UP7 A;  4DAP A;  4LF9 H;  1HFN A;  5D1P A;  1S40 A;  1MGS A;  1M1K C;  3T5H A;  4P75 A;  4LF9 L;  2EIF A;  2FPG B;  3I4N H;  5COY A;  5KFT A;  1K1S A;  3BQ0 A;  1E1T A;  5DLQ E;  1EYZ A;  2G9H D;  5M3M H;  5EWF A;  2R92 G;  5JEA H;  3GTM A;  4J6H A;  4B3M Q;  4RZQ A;  4ED7 A;  1AUX A;  1G6Z A;  2CQA A;  5KFX A;  4WBN F;  1TWG B;  1J9O A;  2UUC Q;  1J5E H;  3RGX A;  2PMZ E;  1BO0 A;  1LT4 D;  4C3H G;  2KOL A;  4QJF A;  3J81 W;  4JI5 H;  2AMC B;  1IBK H;  1EEF D;  4YCW A;  1IBL Q;  3UQ8 A;  3K81 C;  2PBZ A;  3G6V A;  3RV3 A;  1HTP A;  1LTG D;  3LWE A;  1CUK A;  3E5N A;  2E2I A;  4JI4 Q;  4JBM A;  2E75 C;  1IBK L;  3MHB A;  2MPM A;  3KLR A;  4A3B B;  2WP8 J;  2KCT A;  1TWC B;  1ET6 A;  4K6D A;  2BR0 A;  4JI6 Q;  2PO4 A;  2B63 H;  4QWA A;  3CD6 A;  2ENB A;  1C3O A;  1SCU B;  2M9V A;  4DXF A;  1WTV A;  2XSC A;  2FMM A;  4Z9C B;  2HUG A;  3GTM B;  3FKI A;  3A54 A;  5IWA Q;  3C46 A;  3PIP A;  4FS2 A;  1RK5 A;  5IGG A;  3FEW X;  3J7A 5;  4LUZ A;  2EJF C;  1N33 Q;  4ZKC B;  1RK6 A;  1H9M A;  2JXM B;  3L2P A;  4O4I F;  3PGZ A;  3VYU A;  2GPS A;  3P75 A;  3DXJ C;  2RDG A;  3ONA B;  1VQP A;  2GLT A;  4IJH A;  3RN2 A;  4CKC A;  4PZ6 A;  2GVA A;  2E2I B;  1BF4 A;  2K5W A;  3W5O A;  4BXX G;  1AN8 A;  3VPD A;  4N9P A;  2M05 A;  2R8K A;  2IW3 A;  4L5S A;  3CP0 A;  3U9O A;  3R5H A;  2W6O A;  4KV6 A;  1GD7 A;  2RQX A;  4XYO A;  4IAJ A;  2B8G A;  2WAC A;  2XCL A;  3PR4 A;  4JI1 Q;  3R5X A;  4WJ3 M;  5KFZ A;  4EQ5 A;  1JR0 D;  1B2T A;  5EOY A;  3CKI B;  2V1C C;  1EYC A;  1U4P A;  4A3I G;  3H0G B;  1XX8 A;  1QZH A;  5IYD H;  5LMN W;  5I47 A;  1EL0 A;  4MV4 A;  3GV7 B;  1RJT A;  3K5M A;  5D14 A;  4FF2 A;  5KFG A;  2RA4 A;  2KVM A;  1WVL A;  4FF4 A;  3Q8R B;  2UU9 L;  1F77 A;  3PR5 B;  2R6G A;  1C8C A;  1FNV A;  5IT9 E;  2Z6K C;  3K7A B;  4J9S A;  4RWS C;  4JUZ A;  1GO3 E;  4ETS A;  5CB4 F;  4IRD A;  4QWB A;  2R93 A;  5ELE A;  4O2A F;  4DV1 H;  2UVW A;  4DR1 H;  4L6T B;  1Z2N X;  3PUZ A;  4C3I G;  2R87 A;  2EXZ A;  5LL6 S;  1TVX A;  3GO5 A;  4DV1 L;  3CCV A;  1MJC A;  1WH2 A;  5KFY A;  4ECQ A;  4N9T A;  2E5L Q;  4HIM A;  4EGV A;  5KT3 A;  1XWE A;  2E2D C;  4DUZ Q;  3BZD B;  2ID0 A;  2OTJ A;  1E3P A;  1UE6 A;  2OQ0 A;  4JV5 Q;  3KHG A;  2R8H A;  2PZU A;  2VQE Q;  3V96 A;  4GKK H;  4LWC A;  5BN4 A;  4HCE A;  1F9S A;  4O0A A;  2B2Y C;  5CV9 A;  5K2M A;  2C2R A;  4GKK L;  3M9O B;  2WB1 G;  3R8B A;  3HP3 A;  4JBJ A;  3M4O H;  2R93 B;  4TQR A;  1KBL A;  3RR5 A;  4R4Q A;  3J81 i;  3G71 A;  1CK1 A;  2YTV A;  3TP6 A;  2R61 A;  1WJJ A;  5JVH 3;  1V4Y A;  4KTA A;  2VQF H;  2JA6 H;  4YWK A;  3L7Z C;  3TSS A;  4OO1 I;  1CQJ B;  2YS7 A;  2VQF L;  3KLS X;  4P71 A;  3HGB A;  1EWI A;  2JN4 A;  1V43 A;  4DAV A;  4IOA A;  3RD4 A;  1MI2 A;  2B39 A;  2CVR A;  3T4A C;  3OWF A;  1FJG Q;  4IOC A;  1CFM A;  5LMN Q;  2YL2 A;  1XJV A;  2NVT B;  3I3C A;  3GII A;  4CBV A;  1AZQ A;  1XNQ L;  5KX5 F;  4O3P A;  2IHE A;  1ONL A;  2WDT A;  3KUP A;  4JI3 H;  4DF7 A;  2JA7 H;  3NSW A;  1ZEQ X;  2B2T C;  3GV6 A;  1FR3 A;  1CZW A;  4HJ7 A;  4JI3 L;  1PTO F;  2B2U C;  1I7L A;  3L4J A;  1DGS A;  1N32 H;  2K5N A;  2EYF A;  4OIK A;  4TV8 F;  4KKS A;  2R8J A;  1LTA D;  2EDG A;  2E2J H;  1YVC A;  4IN3 A;  2ZTE A;  1CA5 A;  1LYL A;  1D2B A;  3GTK A;  1SYE A;  1N32 L;  4DL2 A;  3HKZ G;  3TZD A;  1XYI A;  4I7Z C;  1E22 A;  1E4E A;  5C6A A;  2RDF A;  4BY1 B;  2UUA Q;  4XYQ A;  2K5V A;  4KKT A;  3BAA A;  2KCM A;  4F4X A;  4M8A A;  2ZM6 L;  1PH4 A;  3ULJ A;  4DU9 A;  4ILW A;  2R7Z G;  3GIP A;  2HCC A;  4DL7 A;  2XWJ B;  4X3U A;  4BWG B;  1JDE A;  2QDL A;  4UDU C;  1W3S A;  1NJI C;  1YNJ C;  3DWA A;  4QW9 A;  5KFH A;  1T94 A;  4FNF A;  1X6O A;  2AGQ A;  1PTO H;  4IPH A;  1PFB A;  2XD4 A;  1XMO Q;  3GTK B;  1K3R A;  1KL9 A;  3TZU A;  1RF2 D;  2IJ0 A;  4UP8 A;  2WAQ G;  1E4E B;  3M4I A;  1HH2 P;  4F8M A;  2DY7 A;  2A69 D;  4ZCK A;  2HQE A;  5FLM G;  4A3M B;  2JSO A;  4LF9 Q;  2CHB D;  1JMC A;  4A3C G;  3MXU A;  3UI2 A;  3PSI A;  1QG7 A;  1PRT F;  3S14 H;  5COR A;  2F4V H;  5JJZ A;  1ILQ A;  1S3O A;  2GVB A;  5ELD A;  1EU3 A;  5EJW A;  5J22 A;  2C5C A;  1SRO A;  3L3O C;  1H9J A;  3TRE A;  1I3Q A;  4IRK A;  2FMC A;  1EIH A;  5KYI A;  1EHI A;  4CJ1 B;  3FMA A;  1NMG A;  1OO9 B;  4H7B A;  1O78 A;  4IQZ A;  1SMX A;  3PF5 A;  3GTL H;  1KJI A;  4DL6 A;  2A6H D;  2SOB A;  4LUO A;  3OHB A;  3H94 A;  2J0T D;  1Y1W A;  3H3V H;  1KJ9 A;  1IBK Q;  2ALZ A;  1LTR D;  3T16 A;  1SRU A;  2OTL A;  2Q8R E;  4DAM A;  4H02 A;  1NMF A;  3A8J E;  2D2C C;  5C4J B;  1WCM B;  4IJL A;  4MHE A;  3S16 H;  5CBE E;  5KFI A;  4L1K A;  3PIO 3;  4CDF C;  4DUY H;  2WB1 E;  3HOY B;  3KBX A;  3A55 A;  3HZX A;  1VQ4 A;  2NB0 A;  3RFC A;  4DUY L;  1VQE A;  1I3Q B;  5FO7 B;  4BBR B;  3GTP H;  3Q6S A;  2W71 A;  3RIZ A;  1B6R A;  5GAD C;  2XIG A;  1N36 Q;  2BH8 A;  4APV A;  4F7X A;  4ED3 A;  2LMC B;  1WD1 A;  4F87 A;  4YY3 H;  1Y1W B;  2LFN A;  3R3O A;  1B44 D;  2YYZ A;  2F0D A;  4UCO A;  5BN5 A;  2YU9 A;  3C1E A;  4YY3 L;  2KHJ A;  2IHF A;  2K52 A;  1SBB B;  2DNE A;  1W6J A;  3C2P A;  4BBS B;  2D62 A;  4DK6 C;  3K3P A;  4MIU A;  1LTB D;  4FP5 D;  5M5X B;  1VQL A;  1I50 A;  4OX9 H;  4J1M A;  2AQ1 B;  4A3F G;  1KC8 C;  2UXB H;  3H09 A;  4Y52 H;  1Q3L A;  1PH7 A;  3M7G A;  2JEJ A;  4A3E G;  2UXB L;  3T5K A;  4BXX H;  1TWA A;  3BYY B;  4V0B A;  3G6Y A;  3CCR A;  4IRC A;  1I4H A;  4C56 C;  3B6Y A;  1SYD A;  4I65 A;  1OTC A;  4K8J A;  2Y0S G;  5IGE A;  1XPR A;  2ZJQ A;  2ATL A;  1W93 A;  1PFM A;  3STB C;  1C48 A;  1HPC A;  1PZJ D;  3OMG A;  1VMP A;  3HKZ E;  5G3L D;  4BA1 I;  1S72 A;  2UU9 Q;  5JJL A;  2NU8 B;  1K0R A;  3PO3 G;  4JV0 A;  1XXG A;  5EBC A;  2QGQ A;  4ODG A;  3RNU A;  3FPP A;  1WTQ A;  1VMC A;  2H4O A;  5KYL A;  2EYP A;  1GXD C;  4GNX A;  4LH7 A;  3GIK A;  2RCF A;  1BNZ A;  3MA2 B;  2JA8 G;  2R7M A;  4YQW A;  3KDF B;  3NHH A;  3BDC A;  5CBA E;  1TWA B;  4DV1 Q;  2RDI A;  1HUN A;  2NYZ D;  2ICI A;  3CC4 A;  4A3D G;  1NTG A;  1FGU A;  3I72 A;  4RGN A;  4AH6 A;  1Q1B A;  1QB5 D;  2B2W C;  3GTJ B;  4JBK A;  1I6H H;  4AQY Q;  1STE A;  3HOX H;  3M3Y B;  1EFI D;  2IT1 A;  2WAQ E;  4CHT B;  3K5O A;  2VUM A;  1A2U A;  3GQC A;  1SND A;  1Y14 B;  2I07 B;  4HED A;  4GKK Q;  4RCO A;  2F0Q A;  1AP0 A;  2R7K A;  4GNX B;  1UE5 A;  2OXP A;  1YJW A;  1SFO H;  2AGO A;  1JWM D;  1PFS A;  1YJ9 A;  2JEI A;  4MV8 A;  2NN6 I;  3NEN A;  5C44 B;  3KJP A;  4X65 H;  1Z2P X;  4K5W A;  5ELB A;  1VQ7 A;  2PCF B;  1P16 A;  1ILP A;  2F03 A;  4GN4 B;  4RGT A;  1R4Q B;  2N78 A;  4ZRZ A;  5T1I A;  4E4T A;  3U9T A;  4X65 L;  3T13 A;  2JYO A;  4RG1 A;  5FLX c;  1KJQ A;  2KED A;  1I7N A;  5D8D A;  4K0K H;  2K32 A;  5M3F B;  4A3B G;  1STB A;  3VYR A;  1GUW A;  5C5L A;  2VUM B;  3CXC A;  1MIU A;  4K0K L;  5IYB G;  1XNQ Q;  4KJN A;  2FLN A;  3MFY A;  4H0L C;  4DV7 L;  4LSA A;  1ET9 A;  1SNQ A;  1FYC A;  2BQ3 A;  3GIJ A;  2CW0 C;  2R85 A;  1CQI B;  5FO8 B;  4YJ3 F;  5LP6 F;  3IN5 A;  5KFJ A;  1AE3 A;  2XCA A;  3S1N B;  1YIJ A;  1TS4 A;  5KFN A;  1RJP A;  1NAP A;  3K58 A;  1V1P A;  3URY A;  3NQI A;  1CHQ D;  1VQA A;  5AFW A;  1K1Q A;  1N32 Q;  4DNR B;  4ZQ3 A;  3RB0 A;  4MZ9 A;  4RAZ A;  1STN A;  2RHS B;  3CRK C;  4LF4 H;  3U50 C;  3KF8 A;  1B8A A;  1QVF A;  4R8I A;  2K5Q A;  4LF7 H;  4AYB A;  1J6Q A;  3C1F A;  1GGO A;  1HFG A;  4YIJ A;  1CKO A;  2ZM6 Q;  4ED2 A;  1BQQ T;  4O42 A;  4TV9 F;  3PUY A;  4I4T F;  4S3S A;  2WFW A;  3EA6 A;  2VZA A;  3ORR A;  1N48 A;  2FHT A;  3CCL A;  5C4X G;  3EBE A;  2K75 A;  1U4R A;  1ZYR C;  3H0G G;  3KFU A;  1YNX A;  2EY6 A;  2SNS A;  4DR5 H;  1IYJ B;  1L0X B;  1V1P B;  3DWP A;  3SI8 A;  4DR5 L;  4U68 A;  4ZKB B;  2JA5 B;  3W1G A;  1AEX A;  1VQJ A;  2R7Z H;  2SEB D;  3KF8 B;  2Z9H A;  3OPO A;  1CZG A;  3T56 B;  4GS3 A;  4PZ7 A;  1IHZ A;  4RB2 C;  2LS0 1;  2Y0S E;  4FXD A;  4AYB B;  4JI8 Q;  2M00 A;  1HA6 A;  4CKB A;  1Q46 A;  1SJH D;  1LM0 A;  5M5Y H;  1TWF H;  5IGF A;  2IX3 A;  3ERQ A;  4APM A;  3H40 A;  3D3R A;  5CMD A;  2NVY A;  3R2T A;  2B2V C;  1IBM H;  1SYG A;  1BNC A;  2XWB B;  2YRX A;  4C2M H;  3J80 E;  1NNX A;  1I94 H;  1OXS C;  2N88 A;  1V51 A;  2NTS A;  1VKZ A;  1IBM L;  4PMB A;  2KJX A;  2ZJT A;  4O3N A;  3M85 A;  2V5A A;  2FK1 A;  3G7L A;  3A8I E;  2B8F A;  3N40 P;  2AKW B;  5FLM H;  1I94 L;  2V4D A;  2PPB C;  1T5X D;  3E0E A;  3S17 B;  5F9L A;  1TXY A;  3GIM A;  4PMC A;  4A3C H;  4TVA B;  1LTL A;  5C3E B;  2DN8 A;  3N52 A;  3PCO B;  4X6A H;  4J9Q A;  3I4M B;  4RUC A;  3S2H H;  2BQR A;  2BE5 C;  2PZT A;  2YZG A;  4IWX A;  4IZO A;  3RB4 A;  1WTW A;  4YBZ B;  4U7C A;  2NVY B;  4YAJ B;  4MAM A;  1A6X A;  2BCO A;  4WRD A;  3TQT A;  1JIC A;  4A4I A;  1EWH A;  3HFZ B;  1ASY A;  4BY7 B;  4ZAI A;  3RAQ A;  3T51 B;  3HS0 C;  4XDX A;  3TN2 A;  4GKJ Q;  4J9P A;  2P0A A;  2SCU B;  1MSG A;  3FVQ A;  1EIG A;  5DLG A;  2W9C A;  3DF7 A;  2AGP A;  2E2H H;  3MTS A;  4DR4 Q;  4HID A;  3GTQ B;  4UPA A;  2FFK B;  1WI5 A;  5FJ8 H;  2L4N A;  2K14 A;  4YHH L;  4ED0 A;  3OSN A;  4YY3 Q;  2KHI A;  1PYW D;  4RA8 A;  2X69 A;  2O03 A;  3TP7 A;  5D1O A;  1A15 A;  1Q82 C;  1STH A;  2A73 B;  2OCE A;  4RHS A;  1WFQ A;  2ZXO A;  2A68 D;  3JSL A;  3CCM A;  5L1J A;  1JJC B;  3P1H A;  2UXB Q;  4NKL A;  2HDM A;  4J9O A;  1FKA H;  1TY0 A;  1EOV A;  3DEO A;  2QKI C;  2CFM A;  2NVQ B;  1B50 A;  1L2Z A;  4BS9 A;  2W9C B;  1UEA B;  4DV3 Q;  2AWN A;  1HTL D;  3NTK A;  3V4S A;  3TQ1 A;  4A3F H;  3HXL A;  1L0W A;  4BY1 G;  1BJT A;  2O4X A;  3CPF A;  1G8Z D;  5H1S E;  4JYA Q;  2FPP B;  2DY8 A;  2I46 A;  2ZT9 C;  3GIQ A;  4A3E H;  4DR2 H;  3CQZ H;  2HVS A;  1IKL A;  2B29 A;  4TQU S;  2HDL A;  2X0S A;  1S97 A;  4B3T H;  2NZO A;  1LUZ A;  4DR2 L;  4K6L A;  3UDG A;  4LF5 H;  4DK1 A;  4A93 H;  3DUZ A;  2UXD H;  3HOU B;  3E5S A;  4U67 3;  1IW7 D;  4GOP A;  1WTO A;  4B3T L;  4JI7 H;  2I8C A;  1TY2 A;  4X3S A;  4LF5 L;  5KFW A;  1IOV A;  4QWC A;  1T3N A;  2CW8 A;  4AIM A;  4JI7 L;  3PO3 H;  5JH7 F;  3A8K E;  3MFI A;  4KI0 A;  2XGQ A;  1IL8 A;  4C3J B;  4R8U A;  3GV5 B;  1PHJ A;  3AQQ A;  2ASD A;  4P72 A;  4J9K A;  4EBC A;  4MV6 A;  2JEA I;  4DR7 L;  1GHJ A;  3J80 L;  3I2Z A;  4XQJ A;  2JA8 H;  4A3M G;  2F0O A;  3CCU A;  3IRB A;  3NBH A;  1S0M A;  4Y8V B;  2V9W A;  1VQD A;  2JQO A;  2F3V A;  4WOR A;  5T1G A;  2VA3 A;  4IR9 A;  1HA5 A;  3OUU A;  2W9B B;  5C1O A;  4A3D H;  4ZI7 F;  4TUY F;  3S24 A;  4QMG A;  4GOP B;  3FDS A;  4EFE A;  5DG7 A;  1OXV A;  3V6K A;  4HTH A;  1CSP A;  4LJZ C;  3RJ0 A;  2KQ3 A;  4R9W A;  3K7U C;  4G7Z C;  2AWO A;  3BA8 A;  2HCI A;  1KAB A;  2PI2 E;  4RHR A;  1ZHS A;  4DNI A;  4K5V A;  4R8U B;  4R4O A;  4O1N A;  4X65 Q;  4NMZ A;  4C1N K;  5E4X A;  5J3B A;  4LNQ A;  4K8I A;  1Q7Y C;  3RB6 A;  2KEE A;  4OWX B;  2CKZ B;  3M9B A;  3O13 A;  1TWG H;  5IP9 G;  3AFQ A;  2W6M A;  3JAM L;  2NU6 B;  2AHO B;  2NZH A;  4YWL A;  4K0K Q;  1WCM G;  3EPG A;  4MTN A;  4DV7 Q;  4A3J G;  2QA4 A;  5FD6 A;  2XIW A;  1FNU A;  2KBN A;  5KKN B;  2Q2I A;  4RAU C;  2F0J A;  3U9S A;  1ULZ A;  5HBR B;  1ENC A;  4DXG A;  1RYS A;  3LWB A;  1U0L A;  3NTI A;  4BBR G;  4NPS A;  2BQU A;  4A3B H;  2PYK A;  1Y8P B;  3GTO H;  3S1R H;  1TWC H;  2YCH A;  3PUV A;  3Q0A A;  1L1O C;  5IYB H;  2RKS A;  2LXJ A;  4KMU C;  3F2D A;  2DZD A;  4C1N I;  3AU7 A;  2EZV A;  1WTH A;  1Y1W G;  2VA2 A;  3GTM H;  4UCT A;  3KBG A;  5M5W B;  5A2Q E;  2VNU D;  1J5E L;  2WE6 A;  3NUC A;  4ALP A;  4DKA C;  2IA6 A;  1SAP A;  3MR5 A;  3G6J B;  4TRD A;  2A19 A;  4JI5 L;  3RTX A;  1I4X A;  3RZO H;  4ZUI A;  3S15 B;  3RLO A;  4DL4 A;  4CC6 A;  1GKH A;  1GUT A;  4ED1 A;  2OH2 A;  2E2I H;  3CVZ A;  2XTI A;  3L0O A;  1WTP A;  3MEF A;  2J6U A;  2K6A A;  2XRQ D;  3K57 A;  2E74 C;  1WD0 A;  3WOE A;  3MWE A;  3JC6 6;  1JB7 A;  2DUD A;  2W9A A;  2A6E C;  4MV7 A;  4LF6 H;  2VY3 A;  5IY0 A;  4DR5 Q;  2A5H A;  1DCZ A;  2JEB I;  5LHY 1;  5DQG A;  1W2B A;  4LF6 L;  1QNK A;  2L11 A;  2EXD A;  2LKV A;  3N8D A;  1UC8 A;  1GUO A;  2B63 A;  1GSH A;  4X3T A;  1SE3 A;  5L1I A;  4TSS A;  5C4X H;  2PQE A;  3HRZ C;  3AMU A;  3CCQ A;  3H0G H;  1KC7 A;  2DIK A;  1EYG A;  1LT3 D;  4LFA H;  1B33 N;  3GD7 A;  2F0K A;  3NP8 A;  3SDZ A;  1Y8N B;  1K0S A;  3RZD H;  4B9X A;  4ECW A;  4LFA L;  3P7J A;  1KAA A;  1IBM Q;  1KJ8 A;  3QOJ A;  3C3L A;  1I94 Q;  1EY5 A;  3FKI B;  2XRS D;  1B9N A;  3D4R A;  3NEL A;  2FJ2 A;  3V05 A;  4A3G B;  4OWT B;  1YBY A;  3R93 A;  3PV0 A;  1CHP D;  3F2C A;  1X9N A;  3M4P A;  1E0B A;  4ECR A;  2EYL A;  1DM0 B;  1R9T A;  5ELC A;  2O2L D;  3LNN A;  3D31 A;  4XT3 B;  4A3K B;  1O75 A;  3KTM A;  1PTO D;  2K04 A;  1CQV A;  5HY6 A;  4P74 A;  4LW1 A;  4RFB A;  2F0P A;  1FGB D;  5C44 G;  4PV1 C;  2F3W A;  3D4D A;  2RF4 A;  5LOV F;  4J0M A;  3NE5 B;  1RJR A;  4ECX A;  3G4S A;  1RIP A;  5F2D A;  4O3S A;  1SMY C;  2PVP A;  1QCB D;  3MWM A;  4DR1 L;  3CMA A;  1Z7T A;  1UE7 A;  5M3F G;  4B3R H;  1UUP A;  2F0V A;  2VUM G;  2ICE C;  3S9W A;  1YNN D;  2NUC A;  5I6W A;  4YHH Q;  5KG7 A;  1R9T B;  2CQO A;  1SEI A;  3H4B A;  3I4O A;  3I56 A;  1EOT A;  2PNH A;  5DGA A;  2L12 A;  1QE6 A;  5BR8 H;  4LFC H;  1VQB A;  1WR2 A;  2SDF A;  4NXN H;  5FO9 B;  2VB3 X;  3CC2 A;  1KRT A;  4IPG A;  1VQO A;  3EYY A;  4YR0 A;  5A2Q L;  4NXN L;  4CC5 A;  5C1P A;  3NPP A;  4HNU A;  5IOC A;  3F2B A;  1LO5 D;  3RBD A;  1C9O A;  5KT5 A;  1K83 H;  4NDX A;  4ZUJ A;  4DL5 A;  3QB3 A;  3S2D B;  2EPB A;  3NGD A;  3HOW B;  4GLX A;  4OWW B;  3ETJ A;  1EZ8 A;  5C5J A;  2RGR A;  1CQF A;  3LGJ A;  3OHX C;  1CTM A;  3RF2 A;  2F0U A;  2ALY B;  4QQB X;  4UCV A;  3JAM W;  1DD2 A;  1BCP D;  1VDZ A;  1TII D;  1ICW A;  3KAK A;  5DNF A;  1LAB A;  2RSN A;  4DGZ A;  2N8N A;  4EEQ A;  4X66 H;  3ER0 A;  2BDO A;  2K01 A;  4B3S H;  3DM3 A;  2JA6 A;  1S5F D;  3SGI A;  1UE1 A;  1TT2 A;  4B3S L;  4B3T Q;  1Q81 C;  4BY1 H;  1Q12 A;  4LF5 Q;  4LAA A;  1P8L A;  5IIF A;  1PH6 A;  4JI7 Q;  1WOC A;  5JVG 3;  4LF8 H;  2UVR A;  4TKO B;  1KLU D;  2JA5 G;  2ZJP A;  4GZY C;  1E2Z A;  4HQ6 A;  2IPK D;  4LSX A;  4LF8 L;  3LWU A;  1LT5 D;  1SYB A;  2E76 C;  4OGQ C;  4DR7 Q;  5T14 A;  1JWU D;  3M4O B;  3BJU A;  1V1O A;  4WD3 A;  3S1Q H;  1D6E C;  3BZC A;  2JA7 A;  3EJI A;  5IGB A;  1D1I A;  1EU4 A;  5C4H A;  4IAL A;  4KHP Q;  3N42 B;  1MSH A;  1Y1V G;  1ROD A;  2D0O A;  5EQ0 A;  4IFD G;  2ASB A;  4DAY A;  3BG5 A;  3HOZ B;  1PFN A;  2R3Z A;  4A3M H;  1VQC A;  4DV0 H;  2W6Q A;  5FLX E;  3SK8 A;  5C3E G;  5JJK A;  4EBE A;  1EQV A;  1OXX K;  3ICE A;  2I80 A;  5JQW A;  3I4M G;  1IXR A;  1XMQ H;  2B3G A;  5EDW A;  5IT9 L;  1AUV A;  5LYJ F;  1JCK B;  3H3V I;  1L2F A;  3WDN A;  1TAE A;  2JA7 B;  3FPU B;  4PG3 A;  4YR3 A;  5GQO A;  2UUB H;  4I7A A;  1SN8 A;  1GJX A;  2F52 A;  4DPG A;  4BY7 G;  4Q0F A;  3HOV B;  4NLG A;  3PW0 A;  2C9O A;  4DAY B;  1TS2 A;  2Z1C A;  2ASJ A;  3HKS A;  5KG5 A;  1BGW A;  3KHR A;  5IP9 H;  1BKB A;  1KNE A;  1DOL A;  4HAE A;  2XN9 C;  1XTC D;  2F4V L;  1WCM H;  2MFI A;  5DAU A;  1JT8 A;  2D0P A;  4A3J H;  3TIG A;  2Z8L A;  1KJJ A;  4K2K A;  4DR6 H;  1BOS A;  1E2W A;  1A3U A;  1J5E Q;  2Q2U A;  4QW8 A;  1B3A A;  4B9W A;  3VYS A;  3ORQ A;  4BBR H;  1E2V A;  4RNN A;  3QFF A;  4JI5 Q;  2R92 H;  1JKJ B;  1B3Q A;  5IOD A;  3RMH A;  3K5I A;  5DLF A;  2DPJ A;  5IP7 G;  1PH5 A;  4Q43 A;  2R8I A;  2K5D A;  3ERO A;  2LSS A;  1V1Q A;  3FP9 A;  3AEV A;  1PTO B;  2RHQ B;  4K2L A;  2R82 A;  1STG A;  4C3H H;  1K3B C;  2WYO A;  3J7A K;  3GTL A;  3KK7 A;  4RGM A;  4G7H C;  1N9W A;  1HZB A;  1NE3 A;  2SNM A;  5FKA C;  4JI2 H;  1YHA A;  1S4Z A;  2F0S A;  3W3A A;  4F88 A;  4LMY A;  4JOI C;  5GRO A;  5M5X H;  1IKM A;  1S5C D;  4JI2 L;  1C0A A;  3EN2 A;  2KSW A;  3GID A;  3OUZ A;  3I91 A;  2RBM A;  2QEJ C;  4LF6 Q;  1YHB A;  3E3X A;  5GON F;  5BMV F;  4HJA A;  3GV8 B;  2BA0 A;  4CDE C;  4HN7 A;  1T36 A;  5EPL A;  5FOB B;  1JJ2 A;  3DWQ A;  4ID6 A;  5EKI A;  1K8A C;  1Q1E A;  3JRX A;  5KFK A;  1HNW H;  3HOU G;  1PH8 A;  2L1B A;  1EUC B;  5KND A;  4R7R A;  2WIN B;  1B9M A;  4A3L G;  1VQM A;  2K05 A;  3GTP A;  1W96 A;  5KFR A;  3MJF A;  3MFH A;  3UDF A;  4A76 A;  4XXE A;  1MD2 D;  1TWH H;  4LFA Q;  1H95 A;  1HR0 H;  2KA7 A;  1ZQ7 A;  2K4K A;  2XCP A;  3QOL A;  4CJ0 B;  4IUR A;  2IL8 A;  1GUN A;  1D5M C;  3RN5 A;  1VAJ A;  1HR0 L;  2W57 A;  4C3J G;  4OX9 L;  1VQK A;  4ZK9 B;  4ULL A;  3ZJY C;  2RDH A;  1ENA A;  1LTI D;  4ECS A;  5HGT A;  1EZ6 A;  1Q8I A;  3MVV A;  3TME A;  3UDI A;  2YS6 A;  3SR1 A;  2QEX A;  2YZN A;  1TKW B;  3V2T A;  5LA6 F;  3M7N A;  3H20 A;  4A75 A;  1TWA H;  1HNZ H;  2HHH H;  4DLK A;  3WWV A;  1BR9 A;  4AYB E;  1BCP B;  1RKN A;  3E0J A;  1HNZ L;  2HHH L;  1JOK A;  2YU9 B;  1PVO A;  2YTX A;  4C5C A;  4EQO A;  4IUN A;  3GTJ H;  1A8V A;  3GTP B;  1EY0 A;  5EBD A;  5M9O A;  3PW7 A;  5A35 A;  4A3I H;  3IFT A;  1I50 B;  4IFD J;  2CH4 W;  1XTD A;  4P73 A;  1B70 B;  1EQT A;  3M9N B;  4BA2 I;  4DR1 Q;  5JPM C;  3I4L A;  3VR5 A;  2KHS A;  1LTT D;  1AW7 A;  5NUC A;  2MQH A;  4JC0 A;  1M6V A;  5KFO A;  1X3G A;  2YRW A;  3BQ2 A;  2F3I A;  4OL7 A;  2DJG C;  2K1B A;  5C44 H;  3PO2 B;  2LY7 A;  2DJF C;  2CCZ A;  1EZ1 A;  3X3N A;  4XQN A;  4C3I H;  1NBW A;  3KYH C;  1I5F A;  2JP1 A;  3SK4 A;  2ATW A;  4FU0 A;  4HR7 A;  5KG2 A;  3SEB A;  4DK3 C;  5M3F H;  1YI2 A;  4RNM A;  4G3I A;  2EJM A;  2EYO A;  1B53 A;  3PUX A;  4XIG S;  5JOB A;  4NXN Q;  4N8F A;  1VQN A;  5IT9 W;  3WOF A;  4R4I A;  3KXY T;  4JBW A;  4WJ4 A;  3PIP 3;  2OWO A;  3N41 B;  4JV1 A;  2VQF Q;  2KEN A;  4QUC A;  4Q0Y A;  3EQL C;  1BXT A;  4KJO A;  1S0O A;  2A68 C;  3CF5 A;  3TDQ A;  3S1N H;  3I70 A;  3GQB A;  1YNJ D;  1Y8O B;  5C0X G;  4KHZ A;  5ELO A;  3I7F A;  1Z47 A;  1DOM A;  4J8Q A;  4B3S Q;  2O5I C;  5EGT A;  1ZKO A;  2WB1 A;  3J81 E;  2FB9 A;  1ESF A;  2FKL A;  4M7E A;  2IBK A;  3HOX B;  1X54 A;  5FK9 C;  3K0Y A;  4JI3 Q;  1AFP A;  4MV3 A;  1VQI A;  2MO1 A;  2J6S A;  1ICF B;  4MA5 A;  1HNX H;  2W8K A;  4LF8 Q;  3IFD A;  5DG9 A;  2VW9 A;  3CW2 C;  2Z6K A;  1F9Q A;  1HNX L;  4UP9 A;  2UXC H;  4EQN A;  5JEA G;  5KFL A;  2PZW A;  4HJ8 A;  5KT2 A;  1QVC A;  2NBF A;  3E6Z X;  2UXC L;  2HIV A;  2PW7 A;  1T5E A;  3M9M B;  4GLV B;  4HSP A;  4LF4 L;  3UE1 A;  1JOO A;  1V9P A;  3J7A V;  2HJW A;  2L9H A;  2JA5 H;  4F4W A;  3NBI A;  4ECV A;  4KY7 A;  3J81 j;  3EPI A;  5G3L F;  4LF7 L;  4B3M H;  5KIX A;  3F1Z A;  4EEY A;  3FKI G;  1U5K A;  4CDD C;  1GSO A;  1U4L A;  2UUC H;  4B3M L;  5IYZ F;  4YR2 A;  3T5J A;  4A3G G;  3GTG H;  2UUC L;  1U9R A;  2BA1 A;  1Y1V H;  5J2T F;  5KFM A;  1IBL H;  2MP1 A;  3NEM A;  4NW2 A;  2B2Y A;  4IFD H;  3U4V A;  4NXM H;  3CME A;  4JI4 H;  4IR1 A;  3GLK A;  1WTX A;  1Z2O X;  4DR3 H;  1IBL L;  4A3K G;  4GC7 A;  3HKZ A;  3S17 H;  4NXM L;  1VQ9 A;  1DYQ A;  1SR3 A;  3RGZ A;  4DR3 L;  4ED8 A;  1JWS D;  3A56 A;  5C3E H;  4L5Q A;  2FPI B;  3VR6 A;  3RUZ A;  5I6Y A;  5IE8 A;  4Y7N H;  4EFB A;  3G6X A;  1C7Y A;  3VR2 A;  1SNO A;  5IWA H;  3L4K A;  3TS0 A;  2FMA A;  1SE2 A;  1KIX A;  1QVG A;  1GUS A;  1BVS A;  2R7Z A;  2NVY H;  1SDF A;  5L1K A;  1CKN A;  2JK8 A;  3D6W A;  2F4V Q;  2R7L A;  5CV4 A;  1YHQ A;  3Q23 A;  2V59 A;  2ZDG A;  3ULL A;  4ZHQ F;  1TWF A;  2AUJ D;  5I9O A;  1JIH A;  4OXP A;  4RAY A;  4J9R A;  1EQR A;  3MAQ A;  2WAQ A;  1L0Y B;  3OMC A;  3MXP A;  3BAB A;  5EWE A;  2B2T A;  1HHV A;  2C22 A;  2F0T A;  4DV4 H;  4IHJ F;  4XYM B;  3PW5 A;  2RVL A;  4DV5 H;  4ZYS A;  2B2U A;  3VPB A;  4J9M A;  3X3M A;  3GTQ H;  2R93 G;  5KFP A;  4DV4 L;  2HD3 A;  4EGQ A;  4DV5 L;  4JV2 A;  4QUF A;  2I5H A;  1VF7 A;  1LV9 A;  1HZA A;  2IY5 B;  4YCV A;  2VQD A;  3R23 A;  4O3Q A;  2DNC A;  4IUU A;  1B6S A;  2W6Z A;  3HOW G;  5BN3 A;  1B1Z A;  2C2D A;  4DUY Q;  1NCV A;  3R2I A;  5IP7 H;  1SE8 A;  1N34 H;  3H15 A;  1G6P A;  4QCL A;  1I4G A;  2XGT A;  1N34 L;  2CWP A;  3TP5 A;  4RB0 A;  3Q8S B;  1KTK A;  5KFU A;  1TQO A;  2D9U A;  4ABN A;  1O7I A;  2Z6B A;  2L55 A;  4YWM A;  4YCU A;  1OXU A;  3GIL A;  2K7V A;  1LAC A;  1OXT A;  1ZXT A;  4PZ8 A;  3QZ8 A;  4KY5 A;  3CCE A;  1E7Z A;  2KEC A;  3TQY A;  2E2H A;  4RB1 A;  3V6J A;  5DQI A;  4OX9 Q;  1BXR A;  1VF5 C;  2J4X A;  4KHV A;  4GLA C;  3HOU H;  4IPD A;  4H13 C;  1KQS A;  1D1K A;  4A3L H;  3K59 A;  3ND9 A;  4CJ2 C;  3Q22 A;  4RZR A;  4DUZ H;  4JV5 H;  2WKD A;  3AB9 A;  3F2U A;  1A9X A;  5KEE A;  4DUZ L;  5CGK A;  5KRU A;  2YV5 A;  3NK9 A;  4JV5 L;  5KT4 A;  4TQS A;  1VBG A;  1EIY B;  2F0W A;  3SK5 A;  3GP7 A;  1A63 A;  1PV4 A;  3FHW A;  3CCS A;  2NVX A;  2H5X A;  3HOZ G;  3RB3 A;  1NY4 A;  1X3F A;  5D1O B;  2R7F A;  4Q44 A;  4UFZ A;  5JUM A;  4EG0 A;  1CE8 A;  2E2H B;  1JE5 A;  1S68 A;  3MXN A;  2FK3 A;  1UNN C;  3MXG A;  3V6H A;  2UXD L;  1IYU A;  4O2B F;  2ZTD A;  4N8X 1;  4GN5 A;  1MZB A;  3CQZ A;  3JSN A;  5I2Y A;  2DLN A;  3FDT A;  2R7N A;  3OIQ A;  4FF3 A;  4JW0 A;  2GPW A;  5LMN H;  1HCZ A;  5KFD A;  1I4P A;  4DFA A;  2JA7 G;  4PDB A;  2Q2T A;  5EZY F;  4FO2 A;  4HNV A;  4MA0 A;  2CW0 D;  2V4R A;  5LMN L;  1PH9 A;  4RKL A;  2CZG A;  4YJ2 F;  2JEF A;  3UE0 A;  3BU2 A;  1Q86 C;  3HOV G;  4OON A;  5GAG C;  2NVX B;  3MC0 B;  5LMU H;  4OO1 G;  3RLF A;  3KF6 A;  2JE6 I;  5E7N A;  3PIO A;  5KFB A;  4YP3 A;  2OF1 A;  5LMU L;  3KHL A;  3MXN B;  2ZDH A;  1X3E A;  1GYF A;  1A2T A;  2R6F A;  1VQH A;  3CC7 A;  3RUP A;  1X3Q A;  2A1A A;  1HQR D;  4OEL B;  4A93 B;  2UUA H;  4FXG C;  1MBY A;  3K6O A;  4JVZ A;  2UUA L;  3NBH B;  2RGV A;  3VA7 A;  5LL6 X;  2M2L A;  2CW7 A;  2PN1 A;  3IAY A;  1CSQ A;  5M5W H;  1EY7 A;  4DL3 A;  3HBL A;  5CYU A;  1BCP C;  1YJN A;  3HOY G;  1EUJ A;  4LUV A;  2JA8 B;  3S15 H;  2F0I A;  2LXK A;  4XX0 B;  2C28 A;  1H9S A;  1DJR D;  3BYT B;  3G6E A;  2KUM A;  1RCV D;  1DIK A;  1TWG A;  1HXY D;  3TII A;  5C0X H;  1XMO H;  1KDC A;  3PQI A;  5DQH A;  1I4R A;  1VBH A;  1HNX Q;  2EJG C;  1I6U A;  4EYI B;  2C35 B;  4ME5 A;  2EYJ A;  5EAY A;  1PH1 A;  1UWV A;  3NQT A;  2R84 A;  4UCR A;  2UXC Q;  3S1M B;  1WTR A;  3NTH A;  4HMI A;  3OYY A;  3SHL A;  4LF4 Q;  1RYR A;  3EIV A;  4BBS G;  3GTO A;  4MTD A;  1TWC A;  1FNW A;  2I5L X;  3BVG A;  4LF7 Q;  4FYD A;  3WO0 A;  1FD7 D;  1H9R A;  4MN3 A;  1QNU A;  4Q45 A;  1CM9 A;  2Q8I B;  5JPN C;  2B2W A;  3L9A X;  4ZQI A;  1NR2 A;  1H9S B;  2BE5 D;  1Z9F A;  4ME3 A;  3J80 c;  5KFC A;  1ML0 D;  3OSP A;  2R86 A;  1VS0 A;  3VR3 A;  4IPC A;  1X65 A;  3G8C A;  2X6L A;  1BDO A;  4GNX C;  1ESR A;  3K5L A;  2QK4 A;  3BA9 A;  3BS1 A;  3FKI H;  1O80 A;  3NXW A;  1TU2 B;  4DA2 A;  3I4N B;  4NXM Q;  3KAL A;  1G2S A;  4RCN A;  1STA A;  4PWQ A;  4DR3 Q;  3BDL A;  3KJO A;  4A3G H;  3BVZ A;  5BPH A;  5M3M B;  3HB9 A;  3GTO B;  1EIF A;  3S1R B;  1EYA A;  5I2X A;  4I50 F;  3WO1 A;  4X3K A;  2UVU A;  5K5P A;  3VR4 A;  4A3K H;  2F0G A;  2AQ4 A;  4E6I A;  1BBX C;  4FF1 A;  1N36 H;  1UEB A;  2A69 C;  4UY8 C;  3OSO A;  5CV6 A;  4PMW A;  3MR6 A;  1EYD A;  3K7A H;  3H0G A;  3RZO B;  1N36 L;  1B04 A;  1JXL A;  3PO2 G;  3JAM c;  1VQ6 A;  2Q2H A;  2YTY A;  1F2Z A;  3D8G A;  1MHW C;  4QIW A;  1E24 A;  2FK2 A;  4LMQ D;  2B63 B;  3D0F A;  1HZC A;  1Q90 A;  1JDB B;  1N56 A;  3I90 A;  2W8L A;  5LL6 b;  4DV4 Q;  4JCV E;  3K5N A;  5C4Z A;  3K0X A;  4DV5 Q;  5KG1 A;  1TR5 A;  2MUY A;  1EQQ A;  4ZLT F;  3CAM A;  1R9T H;  2WV6 D;  1B7Y B;  5H80 A;  2A6H C;  4EGJ A;  4DNT B;  3F8T A;  4QY7 A;  2PI2 A;  5C4X B;  4LH6 A;  4O3O A;  1X56 A;  1Y69 U;  3J80 W;  2R93 H;  2UU9 H;  4QIW B;  1NUC A;  1N34 Q;  4RUA A;  2F0E A;  3SE0 A;  3OIP A;  3RZD B;  3S2D H;  4UCU A;  3HOW H;  3NWT A;  4B3R L;  2EY1 A;  2WKC A;  2IX1 A;  1A62 A;  2HT1 A;  2HVR A;  2ES2 A;  3ND8 A;  5J39 A;  1GVP A;  3HOX G;  1BBU A;  5BR8 L;  3H91 A;  4LFC L;  1CA6 A;  5FD5 A;  1S5D D;  3T53 B;  1EFW A;  3MWY W;  5J2U F;  4RNO A;  2YW2 A;  3KAJ A;  5AJ3 L;  2NVT H;  5CC4 A;  1EY9 A;  5J1Z A;  3ULP A;  4B08 A;  3BVM A;  1O7L A;  4AQY H;  2PMZ A;  5GAE C;  5KFQ A;  1GOZ A;  2W6P A;  2B2V A;  4AQY L;  1KD1 C;  2DWC A;  3MZ5 A;  4Q8E A;  4CKE A;  1PRT D;  3OW7 A;  1VQ5 A;  1YIT A;  4IUT A;  2L0C A;  1U4M A;  1K83 A;  4DR2 Q;  3GV3 A;  4X66 L;  4A2B A;  2NU9 B;  4G7O C;  3E9H A;  5C3W A;  4HSV A;  2UXD Q;  2Z4H A;  3FMC A;  1SYC A;  2F0M A;  4QB4 A;  2EYM A;  3T1H H;  3HOZ H;  2TSS A;  1K8M A;  2PMZ B;  5KG4 A;  5KFV A;  3G48 A;  2NTT A;  1LTS D;  2FLP A;  3T1H L;  3N6R A;  4OEM B;  3A0J A;  4NP5 A;  4AYB G;  5JVD F;  1XNQ H;  4JI0 H;  4HJ5 A;  2CH4 A;  3MR2 A;  1RJQ A;  2NN6 G;  4MTK A;  1EY8 A;  4ECT A;  3A74 A;  4JI0 L;  2JA6 B;  1K83 B;  3GTK H;  3QJY A;  3EVQ A;  5K36 G;  2C00 A;  4FBU A;  1G91 A;  1GLV A;  5LMU Q;  1S5B D;  2MJ8 A;  4DV2 H;  5CV7 A;  4L5T A;  2WTF A;  2F0F A;  5I4D A;  4JPB W;  4DV2 L;  2DPI A;  3KOJ A;  4F4Z A;  3I12 A;  2R7D A;  3HOV H;  3I55 A;  1F2M A;  3KLW A;  2JEG A;  4OO1 H;  3DMU A;  3DLL A;  4LFB H;  3A7A B;  3M4Q A;  3U4Z A;  2BDN A;  3SVM A;  4DV0 L;  3V4Z A;  1UAP A;  4LFB L;  4FXK C;  5KNC A;  2ZM6 H;  1S03 G;  1XMQ L;  1LT6 D;  1FL0 A;  3TS2 A;  1STY A;  2W70 A;  4PNY A;  2A6E D;  2N55 A;  1ZET A;  3SE7 A;  5JJI A;  4L63 B;  2IMW P; 
#chains in the Genus database with same CATH homology
 2UUB L;  3CF5 A;  3J80 i;  2OCE A;  5ELN A;  4IJH A;  1WFQ A;  1VQP A;  3S1N H;  3RN2 A;  4PZ6 A;  2GVA A;  3CCM A;  1JJC B;  2UXB Q;  1EOV A;  3W5O A;  4BXX G;  5C0X G;  2CFM A;  4KHZ A;  1PYS B;  5ELO A;  3I7F A;  5C4J H;  1Z47 A;  3CP0 A;  4L5S A;  4B3S Q;  4DV3 Q;  2AWN A;  4A3F H;  1GD7 A;  1L0W A;  4BY1 G;  3HOY H;  3CPF A;  5H1S E;  4JYA Q;  4JI1 Q;  4JI8 L;  4A3E H;  1HJP A;  1I3Q H;  3CQZ H;  1X54 A;  4WJ3 M;  4EQ5 A;  3ERS X;  4IO9 A;  4JI3 Q;  4DR6 L;  2B29 A;  4TQU S;  1VQI A;  2MO1 A;  2NZO A;  1LUZ A;  2V1C C;  4DR2 L;  3UDG A;  4LF8 Q;  4A93 H;  4A3I G;  4L5R C;  4POF A;  2VW9 A;  3CW2 C;  2Z6K A;  1QZH A;  1HNX L;  5IYD H;  4UP9 A;  4X64 L;  5LMN W;  4GOP A;  4B3T L;  1Y1W H;  1K8G A;  5JEA G;  4J15 A;  4LF5 L;  1XNR L;  1YEZ A;  4HJ8 A;  4AIM A;  1QVC A;  4QGU A;  2UXC L;  2HIV A;  4JI7 L;  2UU9 L;  3JAM i;  3PO3 H;  4GLV B;  4LF4 L;  3UE1 A;  1V9P A;  4BBS H;  2JA5 H;  4KI0 A;  2R6G A;  2Z6K C;  3J81 j;  4GOP C;  1PHJ A;  3AQQ A;  4LF7 L;  4P72 A;  1GO3 E;  1SLJ A;  3F1Z A;  2JEA I;  4DR7 L;  1XPU A;  3I2Z A;  2JA8 H;  3FKI G;  3GDE A;  1U5K A;  4A3M G;  2A8V A;  1JJG A;  3CCU A;  3IRB A;  4B3M L;  1VQD A;  3PUZ A;  2JQO A;  3GO5 A;  4A3G G;  3A5Z B;  3GTG H;  4DV1 L;  2UUC L;  2BA1 A;  3CCV A;  1MJC A;  1Y1V H;  1PH2 A;  2K5H A;  1PYB A;  4X62 L;  2L15 A;  2E5L Q;  3NEM A;  4A3D H;  4HIM A;  3S24 A;  3U4V A;  3CME A;  4GOP B;  1YZ6 A;  1OXV A;  3TRZ A;  1HNW L;  4RMF A;  5FJ8 G;  1IBL L;  1A0I A;  1CSP A;  4DUZ Q;  4A3K G;  2ID0 A;  3W1B A;  1E3P A;  1UE6 A;  2OQ0 A;  5IT9 c;  1VQ9 A;  3K7U C;  2VQE Q;  2AWO A;  2YU9 H;  1SR3 A;  4NXM L;  4GKJ L;  4DR3 L;  4LWC A;  2PI2 E;  5C3E H;  4L5Q A;  4DV6 L;  4DNI A;  4O0A A;  5IE8 A;  1I50 H;  4Y7N H;  4R4O A;  4X65 Q;  4GKK L;  2WB1 G;  1C7Y A;  4DR4 L;  4JBJ A;  5J3B A;  4LNQ A;  3M4O H;  3TS0 A;  1Q7Y C;  4OWX B;  1KIX A;  3RR5 A;  4R4Q A;  3J81 i;  2CKZ B;  3G71 A;  1BVS A;  2YTV A;  3M9B A;  1WJJ A;  4FDB A;  1QVG A;  1TWG H;  5IP9 G;  2JA6 H;  4YWK A;  2NVY H;  2FXQ A;  3AFQ A;  1CKN A;  3L7Z C;  2JK8 A;  4OO1 I;  2F4V Q;  2AHO B;  2NZH A;  4YWL A;  1YHQ A;  1WCM G;  4K0K Q;  2VQF L;  1MJE A;  4MTN A;  4P71 A;  4DV7 Q;  4A3J G;  3PO2 H;  3ULL A;  1L1O A;  2QA4 A;  1EWI A;  1V43 A;  2KBN A;  4IOA A;  2Q2I A;  4OXP A;  3M3Y H;  3K80 C;  3KDF A;  1EQR A;  1FJG Q;  4IOC A;  1U0L A;  4BBR G;  5LMN Q;  4NPS A;  1K9M C;  2I0Q A;  4A3B H;  3GTO H;  3S1R H;  1X55 A;  1TWC H;  1XJV A;  3PUV A;  1L1O C;  4A93 G;  5IYB H;  2LXJ A;  3F2D A;  1XNQ L;  4DV3 L;  4O2D A;  3GTQ H;  2R93 G;  4DV4 L;  1Y1W G;  2IHE A;  3GTM H;  2E8G A;  4DV5 L;  2I5H A;  3U58 A;  2JA7 H;  4JYA L;  2VNU D;  1J5E L;  1HZA A;  2CWA A;  2IY5 B;  4YCV A;  4ALP A;  4DKA C;  3T1Y L;  4HJ7 A;  4JI3 L;  3HOW G;  2A19 A;  4JI5 L;  3RZO H;  4DUY Q;  4B3R Q;  1DGS A;  5IP7 H;  2K5N A;  1SE8 A;  1L1O B;  1BBW A;  1YVC A;  3RLO A;  1GKH A;  2ZTE A;  3H15 A;  1LYL A;  4HIK A;  2E2J H;  1G6P A;  2XGT A;  3OTO L;  1N32 L;  5IYC G;  2E2I H;  2OTJ A;  5BR8 Q;  2XTI A;  3HKZ G;  2CWP A;  3L0O A;  1N34 L;  4LFC Q;  2BH2 A;  1E22 A;  3MEF A;  3AYH B;  1O7I A;  2VUM H;  2K50 A;  5AJ3 Q;  2UUA Q;  4YWM A;  4YCU A;  1OXU A;  2K5V A;  3JC6 6;  1JB7 A;  1VQ8 A;  2KCM A;  2DUD A;  1OXT A;  2VY3 A;  2ZM6 L;  4PZ8 A;  5IY0 A;  1PH4 A;  4DR5 Q;  3ULJ A;  1KHI A;  2JEB I;  3CCE A;  1W2B A;  1E7Z A;  4XTC S;  2R7Z G;  4LF6 L;  3TQY A;  3K8A A;  2EXD A;  1MKH A;  5C4X H;  4OX9 Q;  3CCQ A;  1W3S A;  3H0G H;  1NJI C;  4GLA C;  1EYG A;  3HOU H;  4IPD A;  1KQS A;  2VS1 A;  1X6O A;  4IPH A;  4A3L H;  4HIO A;  4X66 Q;  3GD7 A;  1XMO Q;  3RZD H;  1K3R A;  1KL9 A;  4UP8 A;  4LFA L;  2WAQ G;  2Z0S A;  4DUZ L;  1IBM Q;  2YV5 A;  4JV5 L;  1PH3 A;  1HH2 P;  3E9I A;  1I94 Q;  1EIY B;  5FLM G;  1A63 A;  1QUQ A;  1PV4 A;  3AFP A;  3FHW A;  4LF9 Q;  3CCS A;  3NEL A;  2H5X A;  1JMC A;  3HOZ G;  1IZ6 A;  1NY4 A;  1X3F A;  1K73 C;  4IFD I;  1VQG A;  4OWT B;  1YBY A;  3I4N G;  4A3C G;  2R7F A;  3PSI A;  3PV0 A;  3T1H Q;  3S14 H;  3F2C A;  1X9N A;  3M4P A;  1JE5 A;  1S3O A;  2GVB A;  5M3M G;  4KLK A;  2UXD L;  3VDY A;  1SRO A;  2ZTD A;  3Q8D A;  4GN5 A;  3D31 A;  2JA9 A;  3TRE A;  4JI0 Q;  2MNA A;  1KXL A;  4POG A;  1NMG A;  1QZG A;  3GTL H;  1SMX A;  3PF5 A;  5HY6 A;  4P74 A;  2JA7 G;  1G51 A;  4LW1 A;  4JV5 Q;  2Q2T A;  2IX0 A;  5C44 G;  1HZ9 A;  4LUO A;  5LMN L;  1PH9 A;  2RF4 A;  4DV2 Q;  3H3V H;  3UE0 A;  3G4S A;  1RIP A;  1IBK Q;  2I5M X;  1QUQ B;  3BU2 A;  3CPW A;  1Q86 C;  3HOV G;  4OON A;  5GAG C;  1SRU A;  2OTL A;  3BZK A;  4DAM A;  4H02 A;  4OO1 G;  4R1J A;  3RLF A;  1NMF A;  4DV0 Q;  3KF6 A;  3CMA A;  4DR1 L;  2JE6 I;  1UE7 A;  5E7N A;  3PIO A;  4IJL A;  3S16 H;  5M3F G;  1IL2 A;  5LMU L;  2B63 G;  4LFB Q;  2N49 A;  2VUM G;  2WB1 E;  3MXN B;  1XMQ Q;  4YHH Q;  3OW2 A;  1VQ4 A;  2CQO A;  1X3E A;  3I4O A;  1VQE A;  2PNH A;  3I56 A;  2GN5 A;  4DUY L;  4JI4 L;  1VQH A;  3GTP H;  1VQB A;  3CC7 A;  5GAD C;  4JG2 A;  1N36 Q;  2A1A A;  2BH8 A;  4APV A;  3S17 H;  2UUB Q;  3CC2 A;  1KRT A;  4IPG A;  2ZJR A;  1VQO A;  4JI6 L;  3I4M H;  1KAW A;  1HR0 W;  4NXN L;  2UUA L;  3F2B A;  2YYZ A;  3NBH B;  1C9O A;  1Q8K A;  5GAH C;  5IWA L;  4YY3 L;  1K83 H;  2KHJ A;  2IHF A;  2K52 A;  1N33 L;  2D62 A;  4DK6 C;  4GLX A;  1CSQ A;  5M5W H;  4OWW B;  4BY7 H;  3LGJ A;  1VQL A;  4A3F G;  1CKM A;  1KC8 C;  2ALY B;  4QQB X;  1YJN A;  3HOY G;  1EUJ A;  4Y52 H;  1VCI A;  1XPO A;  4LUV A;  1PH7 A;  3S15 H;  2LXK A;  4A3E G;  2UXB L;  2N8N A;  4DR6 Q;  3ER0 A;  3G6E A;  1D7Q A;  4BXX H;  3DM3 A;  3CCR A;  3SGI A;  1UE1 A;  4B3S L;  3B6Y A;  1HNX Q;  5IYD G;  4X64 Q;  4B3T Q;  1OTC A;  1Q81 C;  2Y0S G;  1XPR A;  2ZJQ A;  2C35 B;  1Q12 A;  4BY1 H;  4LF5 Q;  1XNR Q;  5EAY A;  1PH1 A;  1UWV A;  4HJ9 A;  1P8L A;  3STB C;  1PH6 A;  2UXC Q;  4JI7 Q;  4BA1 I;  1WOC A;  3HKZ E;  4JI1 L;  3STB D;  1S72 A;  3OYY A;  1GM5 A;  2UU9 Q;  1K0R A;  4LF4 Q;  3PO3 G;  1CKN B;  3EIV A;  4BBS G;  2JA5 G;  2ZJP A;  1AE2 A;  2QGQ A;  3RNU A;  4LF8 L;  4QL5 A;  2I5L X;  4LF7 Q;  4JI2 Q;  4GNX A;  4DR7 Q;  2ZTC A;  2JA8 G;  2HQL A;  3BJU A;  3S1Q H;  3BZC A;  3KDF B;  1Z9F A;  4ME3 A;  3J80 c;  4KHP Q;  3RLN A;  2NVQ H;  4DV1 Q;  1VS0 A;  4GN3 B;  4IPC A;  1X65 A;  4X62 Q;  1Y1V G;  2D0O A;  4GNX C;  3CC4 A;  4A3D G;  1NTG A;  4IFD G;  1FGU A;  5C0X J;  4AH6 A;  1Q1B A;  2ASB A;  1HNW Q;  2RCN A;  3FKI H;  4A3M H;  4JBK A;  1I6H H;  4AQY Q;  3HOX H;  4NXM Q;  1VQC A;  1D8L A;  2IT1 A;  4DR3 Q;  2WAQ E;  3KJO A;  4A3G H;  1HR0 Q;  5HGQ A;  5C3E G;  4DV6 Q;  1EIF A;  5JJK A;  1Y14 B;  3ICE A;  1OXX K;  1RL2 A;  4GKK Q;  1N8R C;  3I4M G;  1IXR A;  2B3G A;  4GNX B;  2E5L L;  1UE5 A;  1YJW A;  1SFO H;  1E1O A;  3H3V I;  1L2F A;  2DGY A;  4A3K H;  1FVI A;  2HIX A;  1PFS A;  4NB3 A;  1YJ9 A;  2NN6 I;  3NEN A;  4PG3 A;  3UDX A;  2JA6 G;  1UEB A;  2VQE L;  4UY8 C;  3KJP A;  5GQO A;  4PMW A;  5JEA J;  4C3J H;  1HNZ Q;  1PA6 A;  1SN8 A;  2HHH Q;  3K7A H;  2F52 A;  4DPG A;  1P16 A;  1N36 L;  1ASZ A;  4GN4 B;  1VQ7 A;  3PO2 G;  2N78 A;  3JAM c;  4BY7 G;  1VQ6 A;  4X65 L;  2Q2H A;  2YTY A;  4DAY B;  5FLX c;  4RG1 A;  3A5U A;  1E24 A;  3HKS A;  1VQF A;  1G29 1;  5IP9 H;  2NVX H;  1BKB A;  4A3B G;  3D0F A;  1HZC A;  3CXC A;  1MIU A;  2F4V L;  1WCM H;  4K0K L;  2MFI A;  5IYB G;  1XNQ Q;  1JT8 A;  2D0P A;  4A3J H;  4DV7 L;  3PF4 A;  4DV4 Q;  4JCV E;  3K0X A;  4DV5 Q;  1EQQ A;  1R9T H;  3CAM A;  4EX5 A;  1B7Y B;  1J5E Q;  2Q2U A;  3T1Y Q;  4BBR H;  1FJG L;  3F8T A;  4QY7 A;  4JI5 Q;  2R92 H;  2PI2 A;  1AE3 A;  3J7Z C;  1YIJ A;  1H95 A;  5IP7 G;  1X56 A;  3TEH B;  1PH5 A;  4JOI A;  2LSS A;  1V1Q A;  4MNO A;  1VQA A;  3FP9 A;  3OTO Q;  3AEV A;  2RHQ B;  1M90 C;  1N32 Q;  4C3H H;  2R93 H;  1N34 Q;  4MZ9 A;  5JJL A;  2JJQ A;  2RHS B;  3U50 C;  2N3S A;  1N9W A;  1HZB A;  1NE3 A;  1B8A A;  4R4T A;  1QVF A;  5C0X I;  3S2D H;  1J6Q A;  1WYD A;  1YHA A;  3HOW H;  3J81 c;  4JOI C;  2OQK A;  5GRO A;  1CKO A;  2PQA A;  5M5X H;  4B3R L;  1AH9 A;  2ZM6 Q;  4JI2 L;  1C0A A;  3EN2 A;  2IX1 A;  1A62 A;  2HT1 A;  4QIW E;  2ES2 A;  3PUY A;  5IYC H;  4LF6 Q;  1YHB A;  1GVP A;  2WFW A;  1BBU A;  1KRS A;  2BA0 A;  2VZA A;  4LFC L;  5BR8 L;  3HOX G;  4HJA A;  1JJ2 A;  1EFW A;  3CCL A;  4KHP L;  5C4X G;  3EBE A;  2K75 A;  4R4C A;  5AJ3 L;  1Q1E A;  1K8A C;  2NVT H;  3H0G G;  3ULP A;  3KFU A;  1YNX A;  3HOU G;  1PH8 A;  2EQS A;  1IYJ B;  4A3L G;  1VQM A;  5GAE C;  1T9H A;  3KF6 B;  2MO0 A;  3UDF A;  4A76 A;  2VL6 A;  4LFA Q;  1TWH H;  3W1G A;  4DR5 L;  3S1M H;  2R7Z H;  1VQJ A;  3CCJ A;  4AQY L;  2K4K A;  3KF8 B;  3PUW A;  1KD1 C;  4GS3 A;  4PZ7 A;  2Y0S E;  3RN5 A;  1HR0 L;  4JI8 Q;  4OX9 L;  1VQ5 A;  1VQK A;  1YIT A;  2PQA B;  1Q46 A;  1LM0 A;  5M5Y H;  1TWF H;  3ZJY C;  4DR2 Q;  4X66 L;  3UDI A;  1XMO L;  4C2M H;  2QEX A;  1OXS C;  3M7N A;  4A75 A;  1TWA H;  1IBM L;  3E9H A;  3M85 A;  3WWV A;  4UP7 A;  2UXD Q;  4AYB E;  2AKW B;  5FLM H;  1I94 L;  1S40 A;  1HNZ L;  2HHH L;  3E0E A;  1M1K C;  1PVO A;  4P75 A;  1TXY A;  4LF9 L;  2EIF A;  2YTX A;  3HOZ H;  3GTJ H;  1A8V A;  4A3C H;  3I4N H;  3G48 A;  1LTL A;  4TVA B;  4A3I H;  3PCO B;  3T1H L;  1E1T A;  5DLQ E;  4X6A H;  4IFD J;  3A0J A;  4AYB G;  5M3M H;  1XTD A;  2R92 G;  3S2H H;  4P73 A;  4B3M Q;  1B70 B;  4HJ5 A;  2NN6 G;  2UUC Q;  3A74 A;  4JI0 L;  4DR1 Q;  4BA2 I;  3GTK H;  5K36 G;  2PMZ E;  2MQH A;  4JC0 A;  4QJF A;  5LMU Q;  1X3G A;  2AMC B;  4A4I A;  3HFZ B;  1ASY A;  2F3I A;  5C44 H;  4L5T A;  4YCW A;  1IBL Q;  3K81 C;  2CCZ A;  4DV2 L;  1CUK A;  3KOJ A;  4JI4 Q;  4JBM A;  2R7D A;  1IBK L;  4C3I H;  3I55 A;  3HOV H;  4GKJ Q;  3KLW A;  1NBW A;  3KYH C;  2WP8 J;  3DLL A;  1I5F A;  2ATW A;  3M4Q A;  3U4Z A;  2KCT A;  4DV0 L;  4DK3 C;  4JI6 Q;  5M3F H;  1YI2 A;  2E2H H;  4DR4 Q;  4HID A;  2B63 H;  3CD6 A;  4LFB L;  3PUX A;  4XIG S;  4NXN Q;  4UPA A;  1WI5 A;  5FJ8 H;  1XMQ L;  2K14 A;  4YHH L;  1FL0 A;  3TS2 A;  5IWA Q;  4YY3 Q;  2KHI A;  3PIP A;  1VQN A;  3J7A 5;  4R4I A;  4LUZ A;  4JBW A;  1N33 Q;  2OWO A;  4WJ4 A;  2VQF Q;  2KEN A;  1Q82 C;  3L2P A;  5JJI A;  3PGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...