3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
3A74A 2R7FA 3K7AH 4PZ8A 2E2IH 2ZM6Q 1PH7A 2OCEA 2YTXA 4DR5Q 4GLXA 2MFIA 2EQSA 5LMUL 1HNXQ 2Q2UA 1B8AA 2B63G 4UP7A 2NVYH 1QVGA 3CCEA 4JV5Q 3H15A 1L0WA 5GAHC 3HOVH 1SLJA 1IBLL 3HKZG 1SFOH 1VQ9A 3MXNB 1VQKA 5M5XH 1K0RA 1Q8KA 4GS3A 3BJUA 4IPGA 1BBWA 5IYBG 4L5SA 1V1QA 4IFDG 2JA5H 4JI4L 1FJGQ 3HOZG 3I7FA 3K8AA 3HOZH 4A3GH 4A3JG 5JJKA 4Y7NH 1S3OA 3HOWG 5C0XJ 2N78A 2JA6G 3CP0A 3T1HL 1E1OA 4PG3A 4LNQA 3J7A5 1IXRA 3J7ZC 1Y1WG 1NTGA 2WFWA 2AWOA 4LF6L 2VUMG 3AQQA 3GTJH 3B6YA 2ZTDA 4X64Q 3ULJA 1TWCH 4R1JA 1DGSA 2Y0SG 4QIWE 3I4NH 4DNIA 4GNXA 4BA1I 1C9OA 1GVPA 4BBSG 1HNZL 3UDXA 4DV0Q 1Y1VG 2OQKA 4LF9L 1HZBA 1WJJA 3CCLA 2KCTA 4IPHA 3CF5A 4AYBG 2Q2HA 2D0OA 3NELA 4MTNA 4TQUS 3CCVA 2ZJQA 5M3FG 1KD1C 4IO9A 2VQEL 4JC0A 2E2JH 1L1OA 4HJAA 2NVTH 1D7QA 5C0XG 4UP8A 3PO3H 1EIYB 4H02A 4KHZA 2PI2A 3NEMA 1HR0Q 2E5LL 2HIXA 4L5RC 3TS0A 4DV3Q 4A3MH 3JC66 3U4VA 5C4JH 3TEHB 2E2HH 3PF4A 1N9WA 1X3GA 1SROA 4DUYL 3PUZA 4UP9A 1BBUA 4GOPC 1L1OB 4LF4Q 4JI6L 1NMGA 1JJCB 4JI0Q 4JV5L 3NBHB 5AJ3Q 4A4IA 2UUCL 4GKKL 3RLOA 2A19A 4R4OA 1HZAA 5FLXc 4AH6A 1I94L 4POFA 4LF8L 1N32L 3S2DH 5K36G 1G291 1VQ8A 4X62L 3S2HH 3VDYA 2B63H 1UE6A 1VQFA 1CSQA 1TWHH 5DLQE 5C4XH 1NBWA 4JI4Q 1FJGL 4A93G 1PVOA 3AFPA 2F3IA 1XNRQ 2A8VA 2CWPA 1Q12A 2VZAA 2MO1A 2XTIA 1PH9A 3J81j 4GN4B 1MKHA 4IOCA 1TXYA 3CW2C 1X65A 3J81i 4LF9Q 2JA8H 2UU9Q 4RG1A 1B7YB 1KL9A 3G6EA 4JBMA 2JJQA 4LWCA 5IYCH 3SGIA 1OXVA 4X65Q 3JAMi 5LMUQ 4YCVA 1HNXL 1N34Q 2UXCQ 3NENA 4JBJA 4LFBL 4BXXH 3S24A 2R92G 2KENA 4DV2L 1VQHA 4DR1L 5FJ8H 3GTKH 1CSPA 3T1HQ 2R7ZG 3I56A 2FXQA 1TWGH 1X6OA 1IYJB 3KDFA 4DUYQ 2JK8A 1OXTA 1J6QA 3GTPH 3F2BA 3HOYH 4OX9L 1HZ9A 1YHAA 1O7IA 1Y1VH 3RR5A 2MNAA 2NVXH 3ULLA 2CKZB 2UXBL 2JA6H 3M4PA 1E22A 2ALYB 3I4NG 3T1YQ 3RLFA 2IHFA 3UDIA 2YYZA 1QUQB 1GM5A 4A3MG 2HHHL 1FVIA 1PHJA 4BY7G 1K83H 4YWMA 1K73C 5JEAJ 3FP9A 4JYAL 2UXBQ 2XGTA 3L2PA 2A1AA 4DAYB 4P71A 2YV5A 5LMNQ 4YHHQ 3KOJA 4A3CH 3PO2G 4QL5A 5M3FH 4BY7H 3E9HA 1E1TA 2JA5G 4JI7L 5IT9c 5LMNL 1MJCA 4XTCS 3CAMA 1VQPA 1LTLA 1CKMA 3BU2A 4B3SQ 4A3LH 4IFDJ 2HIVA 3W5OA 2KHJA 1BVSA 3I4OA 4JG2A 2F52A 4GNXC 5ELOA 4LUOA 3RZOH 3HFZB 3G4SA 1P8LA 4LFBQ 1J5EQ 1GD7A 1KRSA 2Z6KC 1N34L 2I5HA 1EQQA 3OTOQ 2IHEA 2Q2TA 4PZ6A 4HJ5A 2CFMA 5BR8Q 3PUVA 2GVAA 5M5WH 1D8LA 4NPSA 2YTYA 1K8AC 1B70B 3CCUA 4GOPB 4YCUA 4A3EH 2N3SA 1W3SA 2AKWB 4A3IH 2IX1A 4A3IG 3DLLA 2BA1A 1EIFA 1SRUA 5C44H 5EAYA 1PH5A 2UXCL 3UDGA 1C0AA 1JT8A 3A0JA 1KHIA 4YY3L 1CKNB 4NXNL 3E0EA 3L7ZC 4L5TA 5IWAL 2JA9A 3TS2A 1NJIC 4DV1Q 4DR5L 1R9TH 1QVFA 5IY0A 4AQYQ 3G48A 1YJWA 4X66L 4BA2I 1G51A 2ZTCA 1FL0A 3JAMc 4DV0L 1XMQQ 2UUBQ 1TWAH 4YHHL 2R7ZH 2IX0A 1OXSC 3GTMH 4MNOA 4A3FG 2NN6G 1XNRL 4B3TQ 2F4VL 1N33L 3S14H 4B3RQ 1E7ZA 4JI3L 5IE8A 5JJIA 4B3ML 1VQ7A 2YU9H 4WJ3M 1LUZA 5IP7H 4X65L 1UE5A 3F1ZA 3AFQA 4B3MQ 3HKSA 1EQRA 1KRTA 2K50A 2VUMH 3LGJA 1SE8A 4J15A 2JQOA 3ER0A 1Q81C 3RZDH 4O0AA 1PH3A 3OYYA 4NB3A 2JEAI 4JCVE 3H3VH 3PO3G 2BH2A 2R6GA 3CQZH 2CWAA 1X54A 2AMCB 1TWFH 3J81c 1UE7A 5IYBH 4DV5L 5M3MG 4X62Q 1HZCA 2ATWA 1XMOQ 4C2MH 4LF5L 2I5LX 3H0GH 2JEBI 4LF8Q 4P72A 4A3BG 4QQBX 1H95A 2WAQG 2PNHA 5C0XI 3F8TA 1WCMH 3L0OA 4C3IH 1M1KC 1WCMG 4B3SL 2K52A 2ZTEA 3J80c 1ASZA 2ZM6L 2VW9A 1KIXA 4QGUA 2MO0A 4BY1H 1HNZQ 2N49A 4A3KG 4BY1G 5JJLA 3ZJYC 2VQFQ 4R4QA 1VQ4A 1IL2A 2RHSB 1Q7YC 2PMZE 4MZ9A 3ULPA 4JYAQ 2ZJPA 4JI8L 4DK6C 4R4TA 1OTCA 4DK3C 3S1RH 4A3EG 3UE0A 2QA4A 1VQLA 4A3KH 2PQAA 4HIMA 1K8GA 1IBLQ 3EN2A 1IZ6A 1WI5A 4TVAB 1Z47A 2K4KA 1Q1BA 2K75A 2B3GA 5AJ3L 3PUXA 1C7YA 3CD6A 4KHPL 1EUJA 2ZJRA 1L2FA 4GLAC 5LMNW 2GVBA 1QZHA 1VQIA 2C35B 2K14A 1EOVA 1X56A 3RNUA 4GKJL 1GO3E 2AWNA 1Q82C 1AH9A 1HJPA 3GTLH 3S17H 4X66Q 1A62A 3ERSX 4IPDA 3RN2A 3GTQH 1UE1A 1VS0A 3KLWA 1YVCA 2R7DA 3HKZE 1YEZA 4DUZL 3I4MH 1XMOL 3I4MG 1VQCA 4DR2L 1HR0W 4APVA 5GQOA 5GAGC 5C3EH 3FKIG 2NVQH 1LM0A 4LF7Q 2IY5B 2KCMA 2L15A 3RN5A 2D62A 1YHBA 4JI5L 1YJNA 4EQ5A 4P75A 1I94Q 4OO1I 3I55A 3HOXH 2UUAQ 2OTJA 1RIPA 4GN3B 5GROA 1A63A 2JA8G 4OONA 4K0KQ 3GTGH 1W2BA 1S40A 4OXPA 3EIVA 2CCZA 3KF8B 1JJGA 1VQ6A 4A93H 1Q1EA 4HIOA 3S1NH 1I6HH 4A3FH 2UUAL 2K5NA 3F2DA 4YWLA 2KHIA 3OTOL 4FDBA 2D0PA 1I50H 1XJVA 3STBD 4A3DG 1CUKA 1JJ2A 3AEVA 4B3RL 1J5EL 1EWIA 1RL2A 5FLMH 5IP7G 3E9IA 1MIUA 3KF6A 3IRBA 2F4VQ 1X3EA 3GTOH 2KBNA 2VQEQ 5GAEC 2R93G 4A76A 3S1QH 4O2DA 4UPAA 3PF5A 2QGQA 3BZCA 2WP8J 1EFWA 2RCNA 4LUZA 4JI8Q 3PIOA 4DR3L 1XPRA 1IBKQ 1VQ5A 4LFAL 4DV6Q 4LFCQ 4A3GG 3OW2A 4X6AH 4R4IA 4DV3L 4DV4L 1N8RC 3PIPA 2Y0SE 1UEBA 2NN6I 4L5QA 3K81C 4NXNQ 1YIJA 2Z0SA 1X9NA 3HOWH 1Y14B 3U50C 4A3JH 3A5UA 2ID0A 4DV1L 2H5XA 1WOCA 3J80i 4ALPA 1U0LA 4JI0L 3TREA 3PO2H 2GN5A 3DM3A 4GLVB 1PYSB 5ELNA 4KLKA 2Z6KA 1MJEA 1PH1A 4DPGA 3G71A 1I5FA 3PCOB 5J3BA 4JI7Q 3K7UC 1VQJA 4PZ7A 1EYGA 2OWOA 3D0FA 2LXKA 4C3JH 5IP9H 4DV2Q 4DR1Q 5IP9G 3CXCA 4JI3Q 4LF7L 3H3VI 1A8VA 1V43A 3TQYA 2VY3A 5JEAG 1S72A 4JBWA 1ASYA 1SR3A 1YI2A 3S16H 1BKBA 1FGUA 4UY8C 1QZGA 1Z9FA 1XPUA 5IYDH 1HH2P 4AYBE 1E24A 3HOUG 3WWVA 4YY3Q 4IJHA 4NXML 4PMWA 3PGZA 1YHQA 1VQEA 4DUZQ 1KXLA 4B3TL 4A3LG 2UXDQ 1G6PA 4JI2L 1GKHA 2V1CC 1Q46A 1K9MC 1JMCA 4DV5Q 3HOXG 3KDFB 3I2ZA 3PV0A 4LFCL 4DV6L 4LW1A 1SN8A 2K5HA 3PUYA 4ME3A 4AIMA 3HOUH 1LYLA 2ES2A 1OXXK 5C3EG 2Q2IA 5FLMG 1YBYA 2LXJA 2CQOA 3GDEA 2RHQB 1XNQL 1CKNA 5IWAQ 3CCJA 3CCRA 3F2CA 2MQHA 5GADC 1NMFA 3UDFA 4JOIC 3CPWA 3T1YL 2HHHQ 2QEXA 4A75A 5IYDG 3W1GA 2JA7G 1IBMQ 1I3QH 2HQLA 3STBC 2VQFL 1X3FA 3H0GG 4IPCA 4HIDA 4A3BH 3MEFA 5C4XG 4DR4Q 3KJOA 2HT1A 1NY4A 3Q8DA 1UWVA 4KI0A 2YTVA 1VQDA 5H1SE 1IBML 5BR8L 4LFAQ 5E7NA 1YNXA 4BBRH 3PUWA 1YITA 2DUDA 4YCWA 4BXXG 2R93H 3FHWA 3HOYG 1JE5A 4JI1L 5M3MH 1K3RA 2E8GA 5IYCG 1PA6A 4LF5Q 1VQOA 1SMXA 4QY7A 3KFUA 2UUCQ 4GKKQ 1U5KA 4A3DH 4DR7L 4JI2Q 3M85A 1PH4A 2OTLA 4DR3Q 4P74A 3EBEA 1IBKL 1VQNA 2R92H 3PSIA 2B29A 1WYDA 3GO5A 2I0QA 2LSSA 4DAMA 1NE3A 1PH8A 2I5MX 1AE2A 1VQGA 4GN5A 1KC8C 4WJ4A 1QUQA 4X64L 3S1MH 1QVCA 2VL6A 4LF6Q 4NXMQ 4HJ9A 2EXDA 5FJ8G 4JI6Q 1XTDA 4RMFA 1VQMA 3D31A 3M3YH 4DV7Q 3CC2A 4HIKA 5M5YH 3GD7A 1Y1WH 3TRZA 3U4ZA 3CCMA 1OXUA 4C3HH 2JE6I 4OX9Q 4QJFA 2WAQE 3S15H 3HOVG 3CCQA 3RLNA 1A0IA 3KJPA 2OQ0A 1PH2A 4DKAC 2PI2E 4GNXB 2NZHA 3KF6B 4AQYL 5HGQA 2UUBL 3M9BA 1YZ6A 4JI5Q 1PFSA 1T9HA 2AHOB 2VS1A 3K80C 2ASBA 4DR6L 4OWWB 1PYBA 1E3PA 4HJ8A 1YJ9A 1Q86C 1P16A 3A5ZB 1AE3A 4OWTB 4Y52H 4LUVA 1N33Q 2UU9L 3CC4A 2N8NA 4JI1Q 3U58A 1KAWA 4DV4Q 3FKIH 2BH8A 4GOPA 4DR6Q 3CMEA 4DR4L 1WFQA 3ICEA 4A3CG 2RF4A 5HY6A 2K5VA 3M4QA 1JB7A 1X55A 1PV4A 4GKJQ 4XIGS 4R4CA 4YWKA 1KQSA 4HJ7A 4DR7Q 4IOAA 2VNUD 1VCIA 2NZOA 2UXDL 1CKOA 4BBSH 1N32Q 4IJLA 3BZKA 1N36L 4P73A 4JOIA 1HR0L 2E5LQ 4OO1G 1HNWQ 2EIFA 3UE1A 1L1OC 5C44G 3CCSA 4DV7L 3KYHC 1PH6A 4EX5A 2JA7H 3CMAA 3M4OH 4BBRG 1HNWL 2DGYA 4OWXB 3AYHB 4DR2Q 2IT1A 1N36Q 2PQAB 1V9PA 1VQAA 3W1BA 1VQBA 4JBKA 2BA0A 2WB1G 2WB1E 3K0XA 1M90C 4LF4L 1XPOA 1XNQQ 3CC7A 4K0KL 4POGA 4KHPQ 4IFDI 3M7NA 1XMQL 3CPFA
chains in the Genus database with same CATH superfamily
4F4XA 2NTTA 3PR5B 2P0AA 1PH7A 3S1MB 3K3VA 4DLKA 2NTSA 2QCPX 1EUCB 2B2TC 2YTXA 2A69C 3SXHA 2JEJA 2Q2UA 2ALZA 2QDBA 2KUMA 3V6JA 5KEEA 1B1ZA 4DL4A 1L0WA 4RB3C 3MTSA 1EFID 1Q8KA 2F0GA 3GIMA 3NTIA 4G57A 1D2BA 2NYZD 4IPGA 4O1NA 1BBWA 5IYBG 4L5SA 4RGNA 1V1QA 4IFDG 2EYOA 3BDCA 3I7FA 1JR0D 4NW2A 3S1QB 5JQWA 5C0XJ 2BR0A 3RB4A 2N78A 4FNFA 3CP0A 1N33H 4RCOA 4HYKA 1NTGA 2AWOA 1SXTA 3IKJA 2DY7A 4JV1A 3B6YA 1PTOD 4X3TA 2YRWA 4YHHH 1TQOA 3ULJA 1KJJA 4KJNA 3I4NH 1I6UA 4DNIA 3GTGA 1BO0A 4IALA 3DF7A 1A6XA 4Q0FA 1ICWA 1QOHA 4H44C 4DV0Q 1Y1VG 1TWCA 5KG5A 4Z9CB 3CCLA 5IWAH 3PN1A 4MTNA 3NELA 2EJFC 2K28A 4C5BA 2ZJQA 4J9MA 4IO9A 2B2VA 3S14B 2X69A 2VQEL 1D7QA 1FNWA 1EZ8A 4U6PA 2B2WC 4H02A 2PI2A 3TP8A 4F7XA 3NEMA 3TMEA 4WBNF 5ELDA 3JC66 1WD1A 4IWYA 1LTTD 1V1PA 5EBCA 4LF7H 2EDGA 2G9HD 5FD5A 4C3HB 4G7OC 3DWPA 4J9QA 5KFNA 5DEHA 3MXPA 1FYCA 4JI0Q 2AU0A 3VR3A 2RGVA 4I55F 4A4IA 3GTLB 4GKKL 2F0WA 1HZAA 4POFA 4LF8L 2HGSA 3A56A 1PLFA 2IW3A 1LTRD 1TWHH 1PVOA 3FPUB 3AFPA 2F3IA 1Q12A 3AU7A 5JVG3 2OF1A 1PH9A 4RHRA 3J81j 1OWTA 4GN4B 1MKHA 4IOCA 2W70A 5IGEA 4UCSA 4MA0A 5BPHA 3G6EA 4F50A 2C28A 1EU4A 4C3IB 2QYZA 5KG0A 4LFAH 3HKZA 3QJYA 3HS0C 3SGIA 3JAMi 4FXDA 3GTKB 1STAA 3KLSA 4LFBL 2R92G 1SNQA 5L9XA 4QWBA 1HTLD 3T1HQ 5KIXA 2ZDQA 3G6VA 2QKIC 2JK8A 2X0SA 4A3BB 2W6OA 1DOKA 2EYFA 2JA6A 5EWGA 1UNSA 1WH2A 2F0VA 3MXUA 4OX9L 1TWGA 4RUAA 1Y1VH 2FK1A 2I80A 5I6WA 5DLGA 3N6RA 1PTOH 1ENAA 4YP3A 3M4PA 4RB1A 1E22A 2AQ3B 1GUOA 3I4NG 2YYZA 1GM5A 4A3MG 3CVZA 1PHJA 3VR6A 4YWMA 5LP6F 4RNNA 5JEAJ 3FP9A 3MZ5A 3OHAA 4F4ZA 4P71A 5LMNQ 3KALA 5C5MA 1BQQT 4C3JG 3IG0A 1JCKB 5COYA 4TKOB 4BY7H 3E9HA 4JI7L 1B53A 3H3VC 1MJCA 4XTCS 3VYSA 5IGGA 1VMPA 2D5DA 3I8ZA 1CKMA 1IKMA 2W6MA 3MXNA 1XXGA 3RTXA 5CGKA 4GNXC 2QW7A 4LUOA 1RCVD 4FF4A 4MV6A 5T1GA 1N34L 1MGSA 2I5HA 4KHPH 1V8QA 2IHEA 4DNRB 3QO2A 2F0FA 2GVAA 5M5WH 5ELFA 2YTYA 5EOYA 3NTKA 5FLXW 4BY7B 4GOPB 3MXGA 4A3MB 2WYOA 2UXCH 3J7AF 1S68A 3S2HB 3DLLA 2BA1A 4IR9A 1C48A 5EAYA 3UDGA 1IW7D 2XSCA 3A0JA 4XQQA 4UHVA 1B4OA 3NWSA 4QCLA 1R4QB 3L7ZC 5I4DA 1D1KA 1B3QA 3OHXC 4UCOA 2V4RA 4J9KA 4DR5L 5IGCA 1QVFA 1WTHA 4OL7A 1G51A 1FL0A 5J2UF 4OO1H 2AGPA 1STGA 3KHRA 3LX0A 2UUBQ 5ELEA 1TWAH 2W9BB 4MTDA 2BE5C 4Q5VA 4R8NA 4O2BF 3KHLA 1K8MA 4N9TA 4B3RQ 4JI3L 5JJIA 1E4GT 1EY9A 1EEID 1VQ7A 2G5DA 4HNUA 5KFSA 1H9JA 3VR5A 3BVMA 5LL6b 3AFQA 1DYQA 2VUMH 3N6XA 2K5DA 3LGJA 2XIWA 2NU9B 1E2WA 1PRTC 1Q81C 3DXJC 2O4XA 4OHJA 3H3VH 3PO3G 4EGJA 3TQTA 4GZYC 3CQZH 4LMYA 1X54A 3GV7B 3MJFA 5M3MG 1PX2A 1UEAB 1RODA 2I5LX 4A3BG 1T3NA 5C5LA 4DR1H 4EYHB 2PNHA 2GA4B 2W71A 5GONF 3L0OA 4C3IH 1WCMG 1SJHD 4XXEA 1HNXH 2NU7B 4QGUA 1I4RA 3K7AB 3T4AC 1WVLA 4TQSA 3BQ2A 2RHSB 1CHQD 1Q7YC 3FMAA 2H4OA 2ZJPA 4DK6C 2D9UA 3UE0A 2NUCA 2PQAA 2F0DA 1Y1VA 2K4KA 4XYLB 2OH2A 3RZOB 3Q8SB 4ZCKA 1EU3A 3QOLA 3CD6A 1AUXA 1N32H 1EUJA 4XYQA 1DD2A 1L2FA 5LMNW 1RF2D 2GVBA 5DQHA 5I9PA 4R9WA 2K14A 4GKJL 2DIKA 1GO3E 4CKEA 4I7HA 4WD3A 1AH9A 1HJPA 1SSOA 5JAVA 3GTLH 3GIIA 1U4LA 3ERSX 1D5MC 3RN2A 3GTQH 1UE1A 3KLWA 3HKZE 3GTJA 4N8X1 1O78A 5C3EH 3PO2B 4EBCA 1LM0A 3U9OA 5KG6A 5I6YA 3HOXH 1M0WA 1HFNA 1Y8NB 4RZRA 1ILQA 4FBTA 1XTCD 1S5ED 2EYHA 3A8JE 1EZ6A 1LABA 2N55A 3EIVA 4A93H 3S1NH 1LTID 5A35A 4A3FH 2NB0A 2UUAL 3SK4A 1JDEA 2UVRA 2M00A 3F2DA 3RV3A 1I7LA 4A3DG 4ZHQF 1JJ2A 1J5EL 5L1KA 2K01A 1RL2A 5EPKA 5FLMH 5AFWA 4RAYA 1KTKA 1SYXB 3IRBA 2O03A 3H40A 4ZKCB 2KBNA 2VQEQ 2EY5A 1E2VA 3PF5A 3S1QH 4QMGA 3T1HH 2BQRA 2RCNA 3PIOA 5KKNB 5TSSA 4LFCQ 4DV3L 4HSVA 4DV4L 4KN7C 1S0OA 4U7CA 5KG7A 3WNZA 2E2HB 3R2IA 3BVZA 2A6EC 3H6MA 1YIJA 2O5IC 3GTOB 3H0GA 3GTQB 3A5UA 2H5XA 1WOCA 2QDLA 4ALPA 4X62H 1CA6A 2K33A 1IL8A 4LF8H 3TREA 3PO2H 3DM3A 2BDNA 4HR7A 5KG3A 2WIIB 2A73B 2Z6KA 5HV6A 1MBYA 1VQJA 5FO8B 1EYGA 1PXUA 3MWDA 2YZMA 1HPCA 3K5HA 4J9PA 4DR1Q 3H3VI 4K0KH 2FE3A 1A8VA 3TQYA 5JEAG 3HOXB 2XIGA 1RYRA 3I3CA 3R8BA 4UFZA 1K8OA 4XYMB 3PGZA 3RF2A 3Q22A 4DUZQ 1CZWA 2M2LA 1G6PA 1Y8PB 1K9MC 3WOEA 1U4RA 3I2ZA 3PV0A 4LFCL 4ME3A 5KFHA 2B63A 1GHKA 2Q2IA 2NUAB 3KLSX 2F1MA 3GTQA 2CQOA 3C0FB 1XNQL 3W2DA 3DEOA 5IWAQ 3CCRA 3MWEA 1KC7A 1TVXA 2F0EA 2XC9A 1B33N 1HTPA 1EWCA 3T1YL 2UU9H 4O3QA 4KY6A 2Y0SB 3W1GA 5KNBA 3SI8A 2K32A 2K05A 4A3BH 1NR4A 4E4TA 3EPIA 1SE2A 3MEFA 5T14A 2VUMB 3JSLA 2UUBH 5EWFA 2L12A 3C2PA 4DV1H 5H1SE 1VQDA 4RUCA 4BWGB 2A6ED 4I7AA 1IBML 4IUPA 5E7NA 1YNXA 2EY1A 3HOZB 1GOZA 1JOKA 4R8UA 3FHWA 3R2TA 3HOVB 5I2XA 1NCVA 2VPSA 4J9OA 4LF5Q 3V2TA 3I73A 3KFUA 4I7ZC 1U5KA 3TDQA 1H9SB 2YS6A 4DR7L 4JI2Q 1PH4A 2OTLA 4DR3Q 4P74A 1VQNA 2R92H 2VA2A 4A3DB 2I0QA 4EGVA 4DAMA 2YW2A 2I5MX 1AE2A 1VQGA 4WJ4A 2A6HD 1QUQA 4X64L 2DLNA 4DR7H 2VL6A 5KFKA 5KT7A 2RDIA 5KFMA 3OWEB 4DA2A 1XTDA 1JLLB 4RMFA 2YU9B 3D31A 4CC5A 2CW7A 3CC2A 2DZDA 4HIKA 1B3AA 4LFCH 3U4ZA 3CCMA 2FB9A 4C3HH 4QJFA 1PYWD 2NBFA 1IBMH 4CGYB 3CCQA 1F2ZA 4Q0YA 2W9BA 1A0IA 4IRDA 2FK3A 3FDSA 2BDOA 3KF6B 1PTOF 2UUBL 3A7LA 4JI5Q 4PNYA 4HJ8A 2MCTA 5CC4A 4C2MA 2NZ1D 1UAPA 3CC4A 4K6LA 1SBBB 3GTPA 1FD7D 2XGQA 3A54A 3CMEA 4XT1B 2F0UA 3ICEA 3M4QA 1EY5A 1X55A 4FM9A 4R4CA 1KQSA 4DR7Q 4HJ7A 3SK5A 1TWFA 1T94A 2VNUD 4HCSA 2J6SA 1E4EA 4EEYA 4PQXA 4QUCA 1CKOA 4F88A 1N36L 3K6OA 4ODGA 4P73A 5J22A 2B2WA 4HR7B 5EJWA 1PTOB 4PMCA 4JVZA 5C44G 1BDOA 5E4XA 4DV7L 4JI8H 3T16A 3R3OA 4OWXB 1JE4A 1R4PB 4KK7A 2BCOA 1TWHA 2BA0A 2WB1G 2WB1E 3J81L 1ESRA 1WCMB 2CVRA 4RFBA 4K0KL 4YJ2F 3CPFA 4BWSC 4J1MA 1CQJB 2JYOA 4FXKC 3QB3A 1AFPA 1V4YA 2JEFA 4F8MA 2B63G 1Z2OX 2NVYH 1GUNA 1QVGA 2RDHA 4A2BA 5GAHC 3GTJB 3HKZG 1SFOH 4FS2A 4JI1H 1TWFB 3RB6A 1VQKA 5M5XH 1TS4A 3J81E 3BJUA 2JA5H 4JI4L 3D6CA 3IFDA 3M7GA 3HOZH 4L63B 3G8CA 4A3JG 3DM1A 1LT5D 1S3OA 2A68D 4Y7NH 4QIWB 1DV1A 2IJ0A 1GSAA 2JA6G 4ZOLF 2F4VH 2PO4A 1IXRA 1I50B 3PMFA 4TQRA 4LF6L 1TWHB 2VUMG 3AQQA 4WJWA 2DNEA 5FPOA 4GKJH 1DIKA 3BYTB 2WTFA 5KT3A 4Q44A 1HNZL 4EFBA 2O5JC 4FU0A 3MWMA 2KOLA 4AYBG 2Q2HA 2D0OA 1Z2PX 2TSSA 4TQUS 5K36H 1SYEA 3RGXA 2HDMA 5M3FG 1AUVA 4ECQA 1L1OA 1AN7A 3GQBA 3VPDA 4UP8A 3Q0AA 1EIYB 4A3KB 2E5LL 3GTOA 1Y69U 4L5RC 1GSOA 1R9TA 4DUZH 2EY6A 3U4VA 3M9MB 1PFBA 3TEHB 3PF4A 1N9WA 1S5FD 1H9SA 3PUZA 4ILWA 1I7NA 4UP9A 3GIPA 4GOPC 3E5NA 1NMGA 5IODA 1JJCB 5A2QE 3NBHB 4R4OA 3MA2B 4KJOA 1N32L 4XT3B 4ETSA 2KCNA 3S2DH 1LTAD 3S1RB 1VMCA 1JWSD 1VQ8A 1F2YA 5C1OA 1ICFB 2B63H 5DG8A 2VQDA 1CSQA 4JI4Q 4A93G 1G2SA 1XNRQ 2X6GA 4XX0B 2VZAA 5ELBA 2MO1A 4ECYA 5E1FA 4DNTB 1O7LA 4J9RA 4LF9Q 2GLTA 2YZGA 4ZLTF 2UVWA 4LMQD 3GTPB 3HB9A 1JWMD 2HHHH 4UCRA 1WCMA 3MR6A 1QILA 1CA5A 1BGWA 2J6UA 3RMHA 5IYCH 5LOVF 4X65Q 1OXVA 5LMUQ 4YCVA 4CJ0B 1N34Q 1HNXL 2UXCQ 1E4FT 3OIPA 4DR1L 4TV8F 4K14A 5FJ8H 5KGUA 4LK1C 3C46A 4B3RH 4DV0H 4O3PA 4IRCA 4MV3A 1J6QA 2HDLA 3GTPH 2DWCA 2QILA 3HOYH 4X3UA 1HZ9A 1YNND 4RKBA 1TS5A 3BG5A 2NVXH 2ZXPA 1RJTA 4XDXA 2MGSA 2ALYB 3Q23A 4LSXA 2HHHL 1QUQB 1FVIA 1K83H 1KEEA 1WR2A 4ZK9B 2UXBQ 2HQEA 4JI3H 2A1AA 4DAYB 2YV5A 5IT9E 4HQ6A 3PO2G 3NE5B 5M3FH 4ZQIA 3V4ZA 3MEHA 1JIHA 1N34H 2I46A 1JDBB 2HVSA 3CAMA 4B3SQ 4KN4C 2YYAA 2RDFA 1SNPA 3I70A 2M9VA 2LFNA 3I4OA 4KD3A 1ENFA 1F77A 4KHPQ 5ELOA 3RZOH 2W9CA 3HFZB 4LFBQ 4F4WA 1DZ1A 1J5EQ 2FMCA 1GD7A 3T51B 1KRSA 5D8DA 4CC6A 1KBLA 4JI7H 1EY7A 5JEAH 2Q2TA 4PZ6A 4EQPA 3N52A 1TS3A 3PUVA 3A7AB 1GJXA 1D8LA 4FP5D 1PZKD 1K8AC 1B70B 4RAZA 4XYOA 5EWEA 3CCUA 4YCUA 4A3EH 2N3SA 1SJED 4ECUA 1EIFA 1GUSA 4RHSA 4ZYSA 1SE3A 1D5XC 2UXCL 2A74C 5D1OA 1C0AA 1AN8A 1KHIA 1SYFA 4EVOA 3SHLA 2UXBH 3KUPA 2R93A 3RIZA 3E0EA 4LAAA 2B2UA 3K5MA 4IZOA 2JA9A 3GV8B 2KVMA 3JAME 4AQYQ 4K8JA 1YJWA 4X66L 1HNZH 2L55A 1LT3D 3FKIA 3SVMA 5LL6X 4LF5H 1IYUA 2FJZA 2BQ3A 2R7ZH 3U9SA 1RJRA 4LFBH 4A3FG 2KSWA 5M3MB 3BQ0A 4K8IA 1SNOA 1MHWC 2JEGA 3X3MA 3RD4A 1E7ZA 5IE8A 4B3ML 4RNOA 1O75A 4JI4H 3F1ZA 4MAMA 2ASLA 4B3MQ 3HKSA 3I12A 1ET9A 1KRTA 1KJ9A 3R5HA 2NU8B 1SE8A 3MFYA 4J15A 1GSHA 4O0AA 3EJIA 2F0OA 4NB3A 3V96A 2C00A 1XYIA 2EJGC 2PZTA 5IYBH 2VB3X 5LMUH 3CQZB 5CBAE 1SYDA 4C2MH 3H0GH 3SK6A 1SYBA 2JEBI 4QIWA 3V4SA 4ZUIA 3JAMW 4DV2H 4JI6H 4LSAA 3F8TA 1RYSA 2R7ZB 2XRQD 3M4YA 2ICEC 4C1NI 2RBMA 3DEPA 2VQFQ 1M0TA 2F0TA 2PMZE 4MZ9A 1BOSA 4JI8L 5M3FB 4DK3C 4DXGA 2V5AA 5DG7A 2NVYB 3P75A 2VQEH 2F0PA 1A2TA 1VQLA 3D8GA 1IBLQ 1CE8A 3EN2A 1IZ6A 1WI5A 3T5HA 2C2EA 1Q1BA 2DNCA 1C7YA 2N88A 4UDUC 1KJIA 1XX8A 3CU7A 1CM9A 4RA8A 3VYUA 4ECZA 3R5FA 1YVCA 1YNJD 3I4MH 1S0NA 3GTLA 3I4MG 4KHVA 5GQOA 2NVQH 3P7JA 2IY5B 2L15A 3EFXD 5KFQA 1YHBA 1YJNA 2W8KA 1I94Q 2HVQA 3I55A 2UUAQ 3VPCA 2JEIA 4Y8VB 4GN3B 2Z4HA 3HKZB 3S1NB 1JB3A 3NP8A 3PQIA 4K0KQ 1W2BA 4G7HC 2KEEA 4DAYA 1WTVA 4MA5A 3KF8B 1VQ6A 1A15A 1I6HH 3M4IA 4LF9H 5BN5A 4APMA 4K5VA 2K5NA 5KFTA 3QR8A 2FP4B 1EYCA 4X64H 5FKAC 2B2TA 1GUTA 1ZYRD 5IOCA 4DN4M 4FF2A 3E9IA 4IWXA 2F4VQ 4DL5A 2Q8RE 5KFXA 1TY2A 5GAEC 2WB1B 3NHHA 1E4EB 3BZCA 2R92B 2WP8J 1EFWA 4JI8Q 4DR3L 1XPRA 1Z6HA 1IBKQ 1VQ5A 1Y1WA 2B39A 2A68C 3C1FA 1I4QA 4DV6Q 1WSCA 3K5OA 4HMJA 1DOLA 2FHTA 1EIGA 2AQ2B 2Y0SE 1LTBD 2A5HA 1HUMA 3OMCA 5C3XA 4A3JB 5KFOA 1QJOA 5EBDA 1C3OA 3K81C 4NXNQ 2Z0SA 1X9NA 3HOWH 1Y14B 4UAIA 1L0YB 2PNRC 2ID0A 4DV1L 4IR1A 3H0GB 1BCPB 3PW2A 4KKSA 3S9WA 1NAPA 4YIJA 5A2QW 4GLVB 3K59A 5CAEB 4CHTB 1PYSB 4KLKA 2UUCH 3QWNA 1PH1A 5EKIA 3PCOB 2W8LA 2EVBA 3D0FA 5DNFA 4C3JH 4C56C 5IP9H 4DV2Q 3CXCA 1V43A 2VY3A 5CMDA 1S72A 1ASYA 1SR3A 4DR6H 3S16H 2R8HA 1BKBA 5IYDH 1JX4A 3BG3A 4O42A 1KABA 1HH2P 3EROA 1E24A 3HOUG 1WTRA 2JA5A 1YHQA 3VPBA 3LNNA 4A3LG 1Y8OB 3NWTA 4JI2L 1GKHA 2R3ZA 4RKLA 5C44B 4DV6L 3P1HA 4K5XA 4LW1A 1SN8A 3HEJA 2UXDH 3RV4A 1LTSD 4AIMA 3HOUH 3KTMA 3N41B 5KFDA 5LA6F 3GDEA 4IAJA 4O4IF 3E6ZX 2W6PA 1SYGA 2MQHA 3CPWA 1JWUD 3M9OB 4A75A 1STNA 4LF6H 2XN9C 4HCEA 2LKVA 2HQLA 3STBC 3MFIA 1X3FA 4IPCA 4NDXA 5BN4A 2PBZA 3EQLC 5C4XG 5CV8A 3BJYA 3MAQA 2IWHA 4KI0A 2H1EA 2ZXRA 3PUWA 1YITA 2DUDA 1HQRD 1H9RA 4YCWA 4BXXG 4Y7NB 1RHPA 3U9TA 2CQYA 1K3RA 2VR1A 2SNSA 4G4KA 2R93B 1VQOA 1SMXA 3FRPB 3SDZA 5IYZF 2VQFH 5DQGA 3H4DA 1SNMA 3PSIA 1VF7A 1NE3A 3UFXB 1A3TA 3OWFA 5F2DA 4X3KA 1SMYD 2OLSA 2YL2A 3S1MH 4LF6Q 3TP7A 4DFAA 5ISRA 4HJ9A 5FJ8G 2YU9A 3J80L 4JI6Q 3MHBA 1VQMA 2YRXA 1VBHA 1GLVA 2E2JB 3TRZA 4DV6H 5CA1F 2JE6I 3S15H 3HOVG 3I4MB 2OQ0A 2R7KA 1PH2A 1F9SA 3ND8A 4AQYL 3H20A 1XWEA 4O3OA 1PFSA 1T9HA 2AHOB 4H0LC 2VS1A 2ASBA 4DR6L 3BQ1A 3GTKA 4LJZC 1W93A 5IIFA 1ILPA 1S9FA 3NPPA 5I47A 4DR4H 3GLKA 3D4RA 2XCAA 4RGTA 1QNUA 1S03G 4A3CG 3FKIH 3T56B 3OW7A 5C4JB 1WFQA 2K5VA 1ESFA 1PV4A 4IOAA 2NZOA 4DK1A 4JV0A 2R87A 3N42B 2TMPA 3BZKA 5C3EB 1EYDA 3K58A 1HR0L 5K2MA 5G3LF 1FKAH 2ASJA 1SE4A 2EIFA 4J0MA 3UE1A 1L1OC 3TQ1A 1GYFA 3KYHC 3NBHA 4BBRG 4A3GB 2DGYA 4HN7A 2J4XA 1HNWL 2VOBA 4DR2Q 2J0TD 2IT1A 5KX5F 1B9NA 2NVTB 1VQBA 1XNQQ 1M8AA 2C5CA 4LF4L 3T5LA 4DR3H 2MP1A 3CC7A 3HZXA 1I4HA 1SMYC 3TIGA 3RBEA 5KFGA 3M7NA 4EBDA 2KECA 1CI3M 2R7FA 3RFCA 3Q24A 3HG9A 4PZ8A 3VYRA 2IX3A 2ZM6Q 2E2IH 1A9XA 4B08A 4LH6A 2IL8A 1KNAA 2MFIA 1B8AA 3OTOH 2AUJD 4UCUA 5BN3A 3HOVH 2KCCA 2PZUA 1SLJA 1IBLL 1ZXTA 5DGAA 5JPMC 3MXNB 1X32A 2W6QA 5KT5A 1S4ZA 2W57A 5KFLA 4V190 5EDWA 4G3IA 4OELB 2VUGA 3BZDB 2WKDA 3GTGB 1FJGQ 4JI5H 5FO9B 3K8AA 3GIJA 4A3GH 3VR2A 2EXZA 5JJZA 1S97A 2SDFA 1ZKOA 4P2CB 2FKLA 1I50A 1E1OA 4LNQA 3J7A5 4M9UA 1Y1WG 3J7ZC 2WFWA 5C4XB 3ORRA 2F0NA 1GUWA 2YS7A 1I3QB 1TWCH 4R1JA 4BA1I 2WE6A 1C9OA 3G6XA 2RQXA 3UDXA 4YJ3F 4DXFA 2OQKA 4LF9L 2DPJA 3Q6SA 1ONLA 1EY6A 2KCTA 5KFYA 3MWYW 3CF5A 3K3PA 1DXMA 1SFOB 3CCVA 1QWYA 1KD1C 1NSNS 1K1QA 3KAKA 2E2JH 2O2LD 2NVTH 4HJAA 1TY0A 5C6AA 5C0XG 3PO3H 4BY1B 4KHZA 1U4PA 4NKLA 4ME6A 2B8GA 1X3PA 1B9MA 4A3MH 3LWBA 5C4JH 2MPMA 2E2HH 1X3GA 4DUYL 1BCPC 2KQ3A 4JI6L 1CQIB 3K5IA 4LH7A 4TV9F 5AJ3Q 2K03A 5D1OB 3PO3B 5FLXc 3G7LA 4AH6A 1II3A 3HRZC 1BF4A 5K36G 3CKIB 1G291 2M05A 5KFFA 4X62L 3PW0A 3S2HH 3VDYA 4KTAA 5I2YA 5DLQE 1NBWA 1FJGL 4ZI7F 4JYAH 1WTQA 2XTIA 1EEFD 2R7NA 2JA8H 3GTMA 1PZID 1TXYA 5L37A 1DOMA 3J81i 4RU9A 3DWAA 4RG1A 1B7YB 4JBMA 3BS1A 2JA7A 2JJQA 1RKNA 2WDTA 4FS1A 1B2TA 2B2UC 4O4HF 1S5DD 3ZYYX 4OX9H 3NENA 2BQUA 4CDCC 3N43B 3H09A 2KENA 4DV2L 4DL7A 3GTKH 3EA6A 3I56A 1TWGH 3BDLA 1HRJA 3P20A 4EQOA 2WAQB 4DUYQ 1KNEA 1T5EA 4DL3A 5CV4A 1OXTA 2AUKA 2FLPA 2UUAH 3PVXA 3QOJA 3D3RA 3RR5A 2MNAA 1PRTD 2CKZB 2Z9HA 2UXBL 2JA6H 2L4NA 4A3IB 1F9QA 1X3QA 2IHFA 4BY7G 4JV2A 3J7AV 2GPWA 1T5XD 4JYAL 4KY5A 2XGTA 3L2PA 3S2DB 2EYMA 4CJ2C 2IA6A 4YHHQ 4ULLA 3Q8PB 3E0JA 5KFJA 2JA5G 5IT9c 3BU2A 3H91A 4K2LA 2IPKD 2HIVA 1AEXA 3W5OA 2F52A 4PWQA 4C3JB 4U68A 4R8UB 4DUYH 2Z6KC 4RCNA 4HJ5A 1PFMA 2PW7A 3HXLA 5KFEA 1EUDB 2PPBC 1W3SA 4A3IH 1B44D 4A3IG 2K6AA 2EY2A 3S16B 4I50F 5C44H 1CTMA 2FINB 1PH5A 3Q2OA 1I3QA 1JT8A 2RA4A 1YNJC 1CKNB 4NXNL 4KMUC 5KNCA 5IWAL 3TS2A 4BBSB 3L4JA 4DV1Q 2KA7A 1UNNC 5FO7B 5C4ZA 1TWAA 2HJWA 3X3NA 4BA2I 4CKBA 4TSSA 1I4PA 2ZTCA 3A55A 5G3LD 3JAMc 4DV0L 4ECRA 2EYJA 4DV5H 4YHHL 4IUTA 1VAJA 5LMNH 1OXSC 3GTMH 4MNOA 3NGDA 2L5TA 2R8GA 2R8KA 3S15B 2NN6G 3GV6A 2ATLA 2PQEA 1XNRL 3HOWB 1WTOA 1N33L 3S14H 2JA5B 1O7ZA 5EPLA 2UVUA 2CHBD 4FF1A 1UE5A 2E75C 2RKSA 5KT4A 3JRXA 3I91A 1RJPA 3MVVA 1EYAA 3KK7A 3RZDH 1PH3A 3I4NB 1K3BC 2F3VA 2PW5A 4JCVE 2JEAI 2BH2A 2R6GA 1V1PB 3BVGA 2R84A 2AMCB 1TWFH 3J81c 1UE7A 2C2DA 1RJQA 4ZKBB 4DV5L 2YZNA 2F0SA 4X62Q 2ATWA 1DJRD 4A3FB 4LF8Q 4QQBX 1H95A 4P72A 3E5SA 2PVPA 3IN5A 2WAQG 5C0XI 5KYIA 1WCMH 5IT9W 1TWGB 1WTPA 4B3SL 2K52A 2SEBD 1EY4A 1A2UA 2ZTEA 1D5ZC 3ERQA 2XNAC 2VW9A 2ZM6L 1ASZA 3N40P 5KG1A 2DY8A 3R23A 2MO0A 4L8JA 4NXNH 4BY1H 5JJLA 2N49A 4BY1G 1W96A 1IYVA 3ZJYC 4L1KA 5FOBB 5FLXL 1VQ4A 1IL2A 2E5LH 4J9LA 4IUVA 2VA3A 4PMBA 2XCPA 3ULPA 2SCUB 4NLGA 1CQFA 3S1RH 3DHQA 2B2VC 2V4QA 2QA4A 4NMZA 3M4OB 5JH7F 1S5BD 1K8GA 4TVAB 1Z47A 4DAVA 3PIP3 1A3VA 1Z7TA 2B3GA 4HSPA 5AJ3L 4KHPL 4J6HA 4EEQA 2JXMB 2PN1A 4GLAC 3BA9A 4YR0A 4ECXA 5M5WB 1BBXC 5D1PA 1N48A 2ZDHA 4YR3A 3GQCA 1Q82C 2E2IA 4YBZB 3S17H 3MFHA 1CFMA 4IPDA 2J6TA 2R7DA 1YEZA 4C3HG 4DUZL 4HNVA 4K2KA 1XMOL 4CDFC 5BMVF 1HR0W 4APVA 5GAGC 3FKIG 4LF7Q 2KCMA 3RN5A 4FBUA 5JVH3 3E3XA 1K28A 4P75A 4OO1I 2OTJA 1RIPA 2F0KA 2ASDA 4XQJA 2SOBA 1Q3LA 1J8IA 3GTGH 1J9OA 4ABNA 1S40A 4OXPA 2CCZA 5CV6A 3MR5A 4V0BA 2KHIA 5T1IA 4G7ZC 1U9RA 1SEIA 1I50H 1XJVA 2A69D 1CUKA 3AEVA 5KG4A 2FLNA 1I4GA 2PMZB 3CHBD 1Y1VB 4DF7A 5IP7G 3KF6A 1PTOC 5J39A 2RSOA 2XWBB 3TBIB 3HBLA 2QEJC 4A76A 2B8FA 4O2DA 1EHIA 4CJ1B 5L1JA 4LUZA 2E2IB 5EGTA 1LO5D 4LFAL 5EKKA 4BBRB 4A3GG 3CRKC 1HFGA 1Y1WB 3OW2A 4RZQA 3EVQA 4R4IA 4TUYF 4O3RA 3D4DA 2E74C 4EQNA 1PZJD 4L5QA 2R7ZA 1QCBD 2R7MA 3RAXA 2Q8TA 5BR8H 2CH4W 3U50C 4O4LF 5IGDA 4EBEA 4C5AA 5K5PA 1N36H 3TP5A 1I6VC 2NWGA 4WFN3 5KFVA 4EGQA 5KRUA 5C3WA 2JA7B 1ET6A 1RK5A 1FR3A 1U0LA 2VB2X 2ZDGA 2GN5A 1RD9D 4IN3A 2JSOA 2OXPA 4GKKH 2E2HA 1MSGA 1KDBA 5J2TF 1QB5D 1I5FA 3G71A 2F0MA 4PZ7A 1MSHA 2OWOA 2WKCA 2LXKA 5JOBA 4LF7L 2QF7A 1Q90A 5DM73 4JUZA 2K1BA 2Q8IB 5HGTA 2WINB 5E3FA 2W9CB 4UY8C 3NTHA 1BXRA 3V6KA 1EOTA 3WOFA 1CHPD 4AYBE 2WACA 5CBEE 4I4TF 3WWVA 1K0SA 4NXML 4DV7H 1TAEA 1BCPF 2UXDQ 2WAQA 1BXTA 5EPJA 2V1CC 1V1OA 4DV5Q 3HOXG 3KDFB 4MHEA 3PUYA 2K5HA 3ETHA 4DL6A 4RAUC 5C3EG 2HVRA 3QIAA 5FLMG 1YBYA 4U673 2LXJA 3FEWX 4AYBB 3RUPA 1LACA 2K04A 3O13A 3W3AA 5C1PA 4C5CA 1NMFA 1PRTB 3UDFA 2HHHQ 2W9AA 2DJGC 2QEXA 4FO2A 5KT2A 1K83A 5IYDG 1C8CA 2JA7G 1IBMQ 3WDNA 4HIDA 1KLGD 3HGBA 4DR4Q 3KJOA 4DL2A 1NR2A 2J7ZA 3Q8DA 1UWVA 3OPOA 2FPPB 1F9PA 1PDQA 5J1ZA 3I72A 5CA0F 3HOYG 5EQ0A 5JUMA 1EY0A 1IBLH 4C2MB 1V51A 4KY7A 3QG1A 1PA6A 4QY7A 3GV3A 2UUCQ 1ULZA 1O80A 1BNZA 3M85A 3T13A 3EBEA 4QWCA 2B29A 2B63B 1WYDA 3GO5A 4R8IA 4EFEA 3N44B 2LSSA 4HTHA 1STEA 1XNQH 4NXMQ 5KFPA 1I4XA 2L11A 2EXDA 4OIJA 2PCFB 3V05A 1Q8IA 3GD7A 1LTGD 1HNWH 4ED8A 1SYCA 4MN3A 2VUMA 3MFGA 5DAUA 2MUYA 4OX9Q 3HOUB 2AQ4A 4ECVA 2IBKA 2PZWA 1HR0H 1F2LA 4DKAC 1ZHSA 2NZHA 5HGQA 4N9PA 3Q8QB 3M9BA 1HQMC 4OGQC 1YZ6A 1ML0D 2L9HA 3K80C 4MTEA 3KBGA 4OWWB 1PYBA 1E3PA 4B9WA 1Q86C 2KHSA 4O2AF 3A5ZB 4OWTB 4Y52H 4LUVA 1N33Q 3FDTA 2UU9L 3T1YH 5M5YB 1BCPD 2N8NA 3NSWA 1LLRD 4JI1Q 2LS01 3U58A 1JQYD 3WO0A 4JPBW 5C8YF 4DR4L 1ZHQA 1TIID 2RF4A 3PIO3 1JB7A 4YWKA 5FPRA 4PV1C 3LWEA 1ENCA 4AQYH 4BBSH 1N32Q 4IJLA 3KXYT 1EZ1A 4JOIA 2Z6BA 2F3WA 1HNWQ 3HP3A 1G6ZA 3I4LA 3QZ7A 5FLXE 2JA7H 2F0HA 2XGPA 1HXYD 1O7YA 3K0YA 4DAPA 2PQAB 1V9PA 1EQVA 2CH4A 2CW0D 4DGZA 4JBKA 1DONA 4MV8A 3K0XA 1M90C 1HA6A 4ZQ3A 5KT6A 5FK9C 3TP6A 3UQ8A 3TINA 5F9NA 1S5CD 3A74A 3K7AH 2P5ZX 5F9LA 1CT1D 4IUQA 2OCEA 4QWEA 5IGFA 4DR5Q 4GLXA 3BDOA 2EQSA 2NN6H 4IZ8A 5LMUL 1HNXQ 2NVXA 4UP7A 2W7PA 3CCEA 4JV5Q 3H15A 1UUPA 5HURA 5CB4F 4C1NK 2JA8B 1VQ9A 4XZ3B 4M8AA 4KD4A 2F0QA 4TRDA 1K0RA 4GS3A 3HOYB 3OMGA 3MR2A 4IURA 4HEDA 3HOZG 1XDNA 4DV4H 4DV3H 5JJKA 3HOWG 4QW8A 5L1LA 4B3MH 5JVDF 1XMOH 1TS2A 4J9SA 3T1HL 1TWAB 4PG3A 2A6HC 1QG7A 3GTJH 1AW7A 2ZTDA 4X64Q 3EPGA 1DGSA 2Y0SG 4QIWE 4GNXA 1TA8A 1GVPA 1PRTF 4BBSG 5CV7A 4IHJF 3F2UA 3PW5A 1HZBA 1WJJA 1G2TA 1JXLA 2LMCB 4IPHA 4K5WA 3NK9A 2FK2A 3GILA 3OUZA 3ITPA 1I6HB 4EYIB 2NVQB 4JC0A 1STYA 4Q45A 2IP4A 3TZDA 2V4DA 5HBRB 3ONAB 1HR0Q 4FXGC 2HIXA 3TS0A 4DV3Q 1MZBA 1OO9B 5D14A 4H7BA 3OSOA 4R7RA 1BJTA 2DJFC 2ZJTA 1KDCA 2ZM6H 3TN2A 1SROA 2V9WA 3D4WA 1GHJA 4M1UB 1BBUA 3MR3A 1L1OB 4LF4Q 2HD3A 2LY7A 1BR9A 4JV5L 3EYYA 2ZXOA 2XCLA 2UUCL 3RLOA 2A19A 3BA8A 3IAYA 5LXTF 1I94L 4JI0H 2FMMA 2VXWA 2E76C 1TR5A 1MI2A 1VF5C 1BUVT 3A8IE 1UE6A 1VQFA 5C4XH 3RBDA 1JORA 3L9AX 3CQZA 1KJQA 1CQVA 2A8VA 3PZPA 2CWPA 4E6IA 4RB2C 4FVMA 4CDEC 3CW2C 1X65A 3H94A 2K5WA 5KFAA 3RZDB 2UU9Q 3SK8A 1KL9A 2X6LA 1GGOA 4HAEA 4LWCA 2I07B 4ED1A 4M7EA 1EIHA 4AYBA 4JBJA 1JICA 5M9OA 3S24A 4BXXH 1VQHA 1CSPA 2FJ2A 2R7ZG 2FXQA 4DU9A 1X6OA 1IYJB 3DUZA 3KDFA 3OSPA 1K1SA 1N56A 3F2BA 4C3IG 4DR5H 5C4HA 1YHAA 1O7IA 3ULLA 2R85A 4JW0A 3M3YB 5L1IA 5CYUA 3T1YQ 3RLFA 3UDIA 3C3LA 2KJXA 1H9MA 1K73C 1EYZA 1TKWB 1PMRA 1M6VA 4DR2H 3S17B 4ME5A 1E0BA 2B2YC 4A3CH 3KOJA 1PFNA 3FKIB 1XNRH 4QL5A 1E1TA 1HA5A 2J9GA 3BABA 1W6JA 5LMNL 3JSNA 2RSNA 4IRKA 1U4MA 1VQPA 1LTLA 4A3LH 4IFDJ 5EKLA 2MJ8A 2KHJA 1BVSA 4JG2A 4NP5A 4B9XA 3G4SA 3Q1KA 1P8LA 3NUCA 5DQIA 1RDPD 3VA5A 1EQQA 1QNKA 4I65A 3OTOQ 3BAAA 5DGBA 2CFMA 5BR8Q 1HHVA 2CW8A 2EJMA 4NPSA 4J8QA 3T53B 5CR3A 3F8NA 5KG2A 2AKWB 2IX1A 3KHHA 3UI2A 3BYYB 2F0LA 3LWUA 3VR4A 2ZT9C 2W6NA 1SRUA 3TZUA 1JOQA 4HMIA 4MTKA 4YY3L 2F4IA 3SEBA 3NXWA 4L5TA 4QUFA 3QFFA 3SE7A 3OSNA 1NJIC 2JN4A 1R9TH 3J81W 4RNMA 5IY0A 2C9OA 2EYPA 2MHVA 3G48A 3LMLA 1SAPA 4N8FA 1A3UA 4RGOS 3A8KE 1LT6D 3URYA 4RH6A 2OT2A 5DG9A 2RCFA 1XMQQ 3RGZA 3RB3A 1TU2B 1LV9A 2IX0A 2D2CC 2CQAA 2RGRA 1IKLA 5IGBA 4B3TQ 2F4VL 1B04A 4KKTA 2WB1A 1K83B 4YB8B 2R92A 1RTOA 2YU9H 4WJ3M 1LUZA 2EOTA 5IP7H 4X65L 1EL0A 1RK6A 3Q8RB 1E2ZA 2PMZA 2NVXB 3ETJA 1EQRA 4A93B 3M9NB 2K50A 4X65H 1T36A 5DLFA 2C2RA 2JQOA 3ER0A 3I90A 2R61A 2F0IA 3FPPA 3OYYA 3T5JA 4Q8FA 2CWAA 4MV1A 2BE5D 3DWQA 3LP8A 1VBGA 1HZCA 2XVSA 1XMOQ 4LF5L 2RDJA 2SNMA 2NVYA 2HCIA 4X66H 4KKUA 1M1KC 3VYTA 1ZQ7A 3J80c 3CRLC 1KIXA 1SFOA 3SR1A 2OEOA 3H4BA 3KLRA 2XRSD 1HNZQ 4A3KG 4YY3H 1IW7C 4R4QA 4KV6A 2FFKB 5JVLA 3NBIA 3J7YW 3AB9A 4JYAQ 1OTCA 2V59A 4R4TA 2FPIB 4A3EG 1NUCA 5C0XH 3RB0A 2DPIA 5CORA 2KEDA 3SE0A 4A3KH 1KLUD 1IHZA 4DK0A 4HIMA 1FJGH 1B6SA 2FMAA 5EZYF 5D3DA 1EQTA 2K75A 1EY8A 4YQWA 1F2MA 4FF3A 5C5JA 4YAJB 3PR4A 3PUXA 2ZJRA 5KFBA 4QW9A 1L2ZA 1QZHA 2JP1A 4ZAIA 1VQIA 4MV7A 2K5QA 4O3NA 2C35B 5BPFA 1EOVA 1X56A 3RNUA 2AWNA 4X66Q 1A62A 1AZPA 5D3IB 1RTNA 1VS0A 2QK4A 1AZQA 1VQCA 4UCVA 4DR2L 3MC0B 1DCZA 2D62A 1S0MA 5KFZA 4JI5L 4EQ5A 2I8CA 3NQTA 5KFUA 5GROA 3K57A 1A63A 4X3SA 2JA8G 3KBXA 1L0XB 5ELCA 4CBVA 4OONA 1KJ8A 4K6DA 4S3SA 1JJGA 1WTWA 2F0JA 1Q1EA 4MIUA 4HIOA 1FNUA 4WRDA 4GC7A 4YWLA 2B2YA 3TSSA 3OTOL 2RDGA 4FDBA 2D0PA 3STBD 4YAKB 3J7AK 3QZ8A 1FGBD 1Z2NX 1C4QA 4B3RL 3FVQA 5I9OA 1EWIA 2I87A 1UC9A 3JAML 1NNXA 1F9RA 4RB0A 1MIUA 1GUGA 2Z4IA 3GTOH 1X3EA 3NQIA 2R82A 1XMQH 2R93G 4UPAA 2QGQA 1DV2A 1SCUB 4YR2A 1BNCA 2CW0C 5CV9A 4X6AH 2GPSA 1N8RC 2EYLA 3GIDA 2JA6B 3J80W 4ED0A 3PIPA 3C1EA 4IQZA 2Y0SA 3OUUA 1UEBA 2W7OA 2NN6I 1FNVA 4IUNA 4J9NA 1ZETA 3VMMA 1C30A 4A3JH 2HCCA 1SEBD 3D6WA 3J80i 4ED6A 2DN8A 4RWSC 2YCHA 2G9DA 3WO1A 1D6EC 4RGMA 4JI0L 3KAJA 1I94H 1CZGA 5D65A 4MV4A 5ELNA 1STBA 3N8DA 1MJEA 2FLLA 4JV5H 4DPGA 3KF8A 1G8ZD 2Z1CA 5J3BA 3PW4A 4JI7Q 1MD2D 2AQ1B 3K7UC 2PYKA 2NU6B 1WD0A 5IT9L 1VDZA 3JZIA 1D1IA 5IP9G 1KAAA 4JI3Q 3R5XA 4OIKA 4LF4H 1LT4D 4JBWA 4CDDC 1YI2A 2L1BA 1HUNA 1FGUA 5LHY1 3IL8A 1Z9FA 4ZRZA 1QZGA 1XPUA 2UVVA 1M4VA 2EZVA 4YY3Q 2R6FA 4IJHA 1SDFA 4PMWA 4IUUA 1VQEA 1KXLA 4F87A 4B3TL 1ZEQX 2K7VA 5JPNC 1Q46A 3J80E 1JMCA 1G91A 4NXMH 2F03A 5KFCA 1LYLA 2ES2A 1OXXK 3G6JB 4ZUJA 4QB4A 4QWAA 3GIQA 1CS0A 1R9TB 2RHQB 4BS9A 1CKNA 3PW7A 3CCJA 2AGOA 4HNTA 3F2CA 1KDAA 5GADC 4ECWA 1HCZA 5LL6S 4ED7A 4JOIC 1B50A 4ED2A 1ZYRC 1QE6A 4JK1C 3OHBA 3DMUA 5LYJF 1I3QH 1TWCB 2VQFL 2E2DC 3GTMB 3H0GG 5FD6A 4Q43A 3L4KA 3K5LA 2HT1A 5DM63 1NY4A 1M7JA 2YTVA 1VKZA 5BR8L 4LFAQ 4BBRH 4Q8EA 4MV9A 2BOSA 4OEMB 2R93H 2Z8LA 3OIQA 1S10A 2C22A 1JE5A 4JI1L 5M3MH 1WTXA 1YNNC 2E8GA 3RAQA 5CV5A 5E4WC 5IYCG 4ECTA 3T5KA 3K5NA 4GKKQ 2WV6D 1W6KA 4A3DH 5A2QL 1GXDC 1DM0B 4QWDA 3ND9A 1IBKL 4A2AA 1AP0A 1SNDA 2CZGA 1PH8A 4GC6A 1IBKH 1J5EH 3RJ0A 1SNCA 4GN5A 4H13C 1KC8C 4IFDH 2VPQA 1QVCA 2IMWP 1JKJB 5KFIA 2R86A 3G6YA 5NUCA 2R8IA 2RVLA 3M3YH 4DV7Q 5M5YH 4UCTA 1Y1WH 3RUZA 2R7LA 4O3SA 1OXUA 3GP7A 4ID6A 2WAQE 2XD4A 4QF4A 1H9KA 4XQNA 2EE1A 3RLNA 3KJPA 2ICIA 2PI2E 3L3OC 4GNXB 4CKCA 5H80A 2L0CA 4L6TB 3GIKA 3R93A 1EWHA 1YJ9A 3V6HA 1P16A 4EG0A 1AE3A 3AMUA 1IOVA 3JRWA 1STHA 3KHGA 2W6ZA 3TIIA 1JC7A 1KAWA 4PDBA 4DV4Q 4DR6Q 2BH8A 4GOPA 3FMCA 4FYDA 4ECSA 5HY6A 5KFRA 4GKJQ 3GV5B 4XIGS 2EPBA 2AGQA 4ED3A 1VCIA 3OOCA 4WORA 2UXDL 2V58A 5KFWA 1UC8A 4A3EB 2XWJB 2E5LQ 4OO1G 4JI2H 2HUGA 1JOOA 4B3TH 3CCSA 1TT2A 3M4OH 1PH6A 5KYLA 4EX5A 1B6RA 3CMAA 5KNDA 2FPGB 3IFTA 3AYHB 1IOWA 3ORQA 1N36Q 1VQAA 3W1BA 3VA7A 2R8JA 2ENBA 1XPOA 1CK1A 4POGA 4IFDI 4F4YA 5M5XB 1XMQL 1PK8A 4B3SH
chains in the Genus database with same CATH topology
3A74A 2R7FA 3K7AH 4PZ8A 2E2IH 2ZM6Q 1PH7A 2OCEA 2YTXA 4DR5Q 4GLXA 2MFIA 2EQSA 5LMUL 1HNXQ 2Q2UA 1B8AA 2B63G 4UP7A 2NVYH 1QVGA 3CCEA 4JV5Q 3H15A 1L0WA 5GAHC 3HOVH 1SLJA 1IBLL 3HKZG 1SFOH 1VQ9A 3MXNB 1VQKA 5M5XH 1K0RA 1Q8KA 4GS3A 3BJUA 4IPGA 1BBWA 5IYBG 4L5SA 1V1QA 4IFDG 2JA5H 4JI4L 1FJGQ 3HOZG 3I7FA 3K8AA 3HOZH 4A3GH 4A3JG 5JJKA 4Y7NH 1S3OA 3HOWG 5C0XJ 2N78A 2JA6G 3CP0A 3T1HL 1E1OA 4PG3A 4LNQA 3J7A5 1IXRA 3J7ZC 1Y1WG 1NTGA 2WFWA 2AWOA 4LF6L 2VUMG 3AQQA 3GTJH 3B6YA 2ZTDA 4X64Q 3ULJA 1TWCH 4R1JA 1DGSA 2Y0SG 4QIWE 3I4NH 4DNIA 4GNXA 4BA1I 1C9OA 1GVPA 4BBSG 1HNZL 3UDXA 4DV0Q 1Y1VG 2OQKA 4LF9L 1HZBA 1WJJA 3CCLA 2KCTA 4IPHA 3CF5A 4AYBG 2Q2HA 2D0OA 3NELA 4MTNA 4TQUS 3CCVA 2ZJQA 5M3FG 1KD1C 4IO9A 2VQEL 4JC0A 2E2JH 1L1OA 4HJAA 2NVTH 1D7QA 5C0XG 4UP8A 3PO3H 1EIYB 4H02A 4KHZA 2PI2A 3NEMA 1HR0Q 2E5LL 2HIXA 4L5RC 3TS0A 4DV3Q 4A3MH 3JC66 3U4VA 5C4JH 3TEHB 2E2HH 3PF4A 1N9WA 1X3GA 1SROA 4DUYL 3PUZA 4UP9A 1BBUA 4GOPC 1L1OB 4LF4Q 4JI6L 1NMGA 1JJCB 4JI0Q 4JV5L 3NBHB 5AJ3Q 4A4IA 2UUCL 4GKKL 3RLOA 2A19A 4R4OA 1HZAA 5FLXc 4AH6A 1I94L 4POFA 4LF8L 1N32L 3S2DH 5K36G 1G291 1VQ8A 4X62L 3S2HH 3VDYA 2B63H 1UE6A 1VQFA 1CSQA 1TWHH 5DLQE 5C4XH 1NBWA 4JI4Q 1FJGL 4A93G 1PVOA 3AFPA 2F3IA 1XNRQ 2A8VA 2CWPA 1Q12A 2VZAA 2MO1A 2XTIA 1PH9A 3J81j 4GN4B 1MKHA 4IOCA 1TXYA 3CW2C 1X65A 3J81i 4LF9Q 2JA8H 2UU9Q 4RG1A 1B7YB 1KL9A 3G6EA 4JBMA 2JJQA 4LWCA 5IYCH 3SGIA 1OXVA 4X65Q 3JAMi 5LMUQ 4YCVA 1HNXL 1N34Q 2UXCQ 3NENA 4JBJA 4LFBL 4BXXH 3S24A 2R92G 2KENA 4DV2L 1VQHA 4DR1L 5FJ8H 3GTKH 1CSPA 3T1HQ 2R7ZG 3I56A 2FXQA 1TWGH 1X6OA 1IYJB 3KDFA 4DUYQ 2JK8A 1OXTA 1J6QA 3GTPH 3F2BA 3HOYH 4OX9L 1HZ9A 1YHAA 1O7IA 1Y1VH 3RR5A 2MNAA 2NVXH 3ULLA 2CKZB 2UXBL 2JA6H 3M4PA 1E22A 2ALYB 3I4NG 3T1YQ 3RLFA 2IHFA 3UDIA 2YYZA 1QUQB 1GM5A 4A3MG 2HHHL 1FVIA 1PHJA 4BY7G 1K83H 4YWMA 1K73C 5JEAJ 3FP9A 4JYAL 2UXBQ 2XGTA 3L2PA 2A1AA 4DAYB 4P71A 2YV5A 5LMNQ 4YHHQ 3KOJA 4A3CH 3PO2G 4QL5A 5M3FH 4BY7H 3E9HA 1E1TA 2JA5G 4JI7L 5IT9c 5LMNL 1MJCA 4XTCS 3CAMA 1VQPA 1LTLA 1CKMA 3BU2A 4B3SQ 4A3LH 4IFDJ 2HIVA 3W5OA 2KHJA 1BVSA 3I4OA 4JG2A 2F52A 4GNXC 5ELOA 4LUOA 3RZOH 3HFZB 3G4SA 1P8LA 4LFBQ 1J5EQ 1GD7A 1KRSA 2Z6KC 1N34L 2I5HA 1EQQA 3OTOQ 2IHEA 2Q2TA 4PZ6A 4HJ5A 2CFMA 5BR8Q 3PUVA 2GVAA 5M5WH 1D8LA 4NPSA 2YTYA 1K8AC 1B70B 3CCUA 4GOPB 4YCUA 4A3EH 2N3SA 1W3SA 2AKWB 4A3IH 2IX1A 4A3IG 3DLLA 2BA1A 1EIFA 1SRUA 5C44H 5EAYA 1PH5A 2UXCL 3UDGA 1C0AA 1JT8A 3A0JA 1KHIA 4YY3L 1CKNB 4NXNL 3E0EA 3L7ZC 4L5TA 5IWAL 2JA9A 3TS2A 1NJIC 4DV1Q 4DR5L 1R9TH 1QVFA 5IY0A 4AQYQ 3G48A 1YJWA 4X66L 4BA2I 1G51A 2ZTCA 1FL0A 3JAMc 4DV0L 1XMQQ 2UUBQ 1TWAH 4YHHL 2R7ZH 2IX0A 1OXSC 3GTMH 4MNOA 4A3FG 2NN6G 1XNRL 4B3TQ 2F4VL 1N33L 3S14H 4B3RQ 1E7ZA 4JI3L 5IE8A 5JJIA 4B3ML 1VQ7A 2YU9H 4WJ3M 1LUZA 5IP7H 4X65L 1UE5A 3F1ZA 3AFQA 4B3MQ 3HKSA 1EQRA 1KRTA 2K50A 2VUMH 3LGJA 1SE8A 4J15A 2JQOA 3ER0A 1Q81C 3RZDH 4O0AA 1PH3A 3OYYA 4NB3A 2JEAI 4JCVE 3H3VH 3PO3G 2BH2A 2R6GA 3CQZH 2CWAA 1X54A 2AMCB 1TWFH 3J81c 1UE7A 5IYBH 4DV5L 5M3MG 4X62Q 1HZCA 2ATWA 1XMOQ 4C2MH 4LF5L 2I5LX 3H0GH 2JEBI 4LF8Q 4P72A 4A3BG 4QQBX 1H95A 2WAQG 2PNHA 5C0XI 3F8TA 1WCMH 3L0OA 4C3IH 1M1KC 1WCMG 4B3SL 2K52A 2ZTEA 3J80c 1ASZA 2ZM6L 2VW9A 1KIXA 4QGUA 2MO0A 4BY1H 1HNZQ 2N49A 4A3KG 4BY1G 5JJLA 3ZJYC 2VQFQ 4R4QA 1VQ4A 1IL2A 2RHSB 1Q7YC 2PMZE 4MZ9A 3ULPA 4JYAQ 2ZJPA 4JI8L 4DK6C 4R4TA 1OTCA 4DK3C 3S1RH 4A3EG 3UE0A 2QA4A 1VQLA 4A3KH 2PQAA 4HIMA 1K8GA 1IBLQ 3EN2A 1IZ6A 1WI5A 4TVAB 1Z47A 2K4KA 1Q1BA 2K75A 2B3GA 5AJ3L 3PUXA 1C7YA 3CD6A 4KHPL 1EUJA 2ZJRA 1L2FA 4GLAC 5LMNW 2GVBA 1QZHA 1VQIA 2C35B 2K14A 1EOVA 1X56A 3RNUA 4GKJL 1GO3E 2AWNA 1Q82C 1AH9A 1HJPA 3GTLH 3S17H 4X66Q 1A62A 3ERSX 4IPDA 3RN2A 3GTQH 1UE1A 1VS0A 3KLWA 1YVCA 2R7DA 3HKZE 1YEZA 4DUZL 3I4MH 1XMOL 3I4MG 1VQCA 4DR2L 1HR0W 4APVA 5GQOA 5GAGC 5C3EH 3FKIG 2NVQH 1LM0A 4LF7Q 2IY5B 2KCMA 2L15A 3RN5A 2D62A 1YHBA 4JI5L 1YJNA 4EQ5A 4P75A 1I94Q 4OO1I 3I55A 3HOXH 2UUAQ 2OTJA 1RIPA 4GN3B 5GROA 1A63A 2JA8G 4OONA 4K0KQ 3GTGH 1W2BA 1S40A 4OXPA 3EIVA 2CCZA 3KF8B 1JJGA 1VQ6A 4A93H 1Q1EA 4HIOA 3S1NH 1I6HH 4A3FH 2UUAL 2K5NA 3F2DA 4YWLA 2KHIA 3OTOL 4FDBA 2D0PA 1I50H 1XJVA 3STBD 4A3DG 1CUKA 1JJ2A 3AEVA 4B3RL 1J5EL 1EWIA 1RL2A 5FLMH 5IP7G 3E9IA 1MIUA 3KF6A 3IRBA 2F4VQ 1X3EA 3GTOH 2KBNA 2VQEQ 5GAEC 2R93G 4A76A 3S1QH 4O2DA 4UPAA 3PF5A 2QGQA 3BZCA 2WP8J 1EFWA 2RCNA 4LUZA 4JI8Q 3PIOA 4DR3L 1XPRA 1IBKQ 1VQ5A 4LFAL 4DV6Q 4LFCQ 4A3GG 3OW2A 4X6AH 4R4IA 4DV3L 4DV4L 1N8RC 3PIPA 2Y0SE 1UEBA 2NN6I 4L5QA 3K81C 4NXNQ 1YIJA 2Z0SA 1X9NA 3HOWH 1Y14B 3U50C 4A3JH 3A5UA 2ID0A 4DV1L 2H5XA 1WOCA 3J80i 4ALPA 1U0LA 4JI0L 3TREA 3PO2H 2GN5A 3DM3A 4GLVB 1PYSB 5ELNA 4KLKA 2Z6KA 1MJEA 1PH1A 4DPGA 3G71A 1I5FA 3PCOB 5J3BA 4JI7Q 3K7UC 1VQJA 4PZ7A 1EYGA 2OWOA 3D0FA 2LXKA 4C3JH 5IP9H 4DV2Q 4DR1Q 5IP9G 3CXCA 4JI3Q 4LF7L 3H3VI 1A8VA 1V43A 3TQYA 2VY3A 5JEAG 1S72A 4JBWA 1ASYA 1SR3A 1YI2A 3S16H 1BKBA 1FGUA 4UY8C 1QZGA 1Z9FA 1XPUA 5IYDH 1HH2P 4AYBE 1E24A 3HOUG 3WWVA 4YY3Q 4IJHA 4NXML 4PMWA 3PGZA 1YHQA 1VQEA 4DUZQ 1KXLA 4B3TL 4A3LG 2UXDQ 1G6PA 4JI2L 1GKHA 2V1CC 1Q46A 1K9MC 1JMCA 4DV5Q 3HOXG 3KDFB 3I2ZA 3PV0A 4LFCL 4DV6L 4LW1A 1SN8A 2K5HA 3PUYA 4ME3A 4AIMA 3HOUH 1LYLA 2ES2A 1OXXK 5C3EG 2Q2IA 5FLMG 1YBYA 2LXJA 2CQOA 3GDEA 2RHQB 1XNQL 1CKNA 5IWAQ 3CCJA 3CCRA 3F2CA 2MQHA 5GADC 1NMFA 3UDFA 4JOIC 3CPWA 3T1YL 2HHHQ 2QEXA 4A75A 5IYDG 3W1GA 2JA7G 1IBMQ 1I3QH 2HQLA 3STBC 2VQFL 1X3FA 3H0GG 4IPCA 4HIDA 4A3BH 3MEFA 5C4XG 4DR4Q 3KJOA 2HT1A 1NY4A 3Q8DA 1UWVA 4KI0A 2YTVA 1VQDA 5H1SE 1IBML 5BR8L 4LFAQ 5E7NA 1YNXA 4BBRH 3PUWA 1YITA 2DUDA 4YCWA 4BXXG 2R93H 3FHWA 3HOYG 1JE5A 4JI1L 5M3MH 1K3RA 2E8GA 5IYCG 1PA6A 4LF5Q 1VQOA 1SMXA 4QY7A 3KFUA 2UUCQ 4GKKQ 1U5KA 4A3DH 4DR7L 4JI2Q 3M85A 1PH4A 2OTLA 4DR3Q 4P74A 3EBEA 1IBKL 1VQNA 2R92H 3PSIA 2B29A 1WYDA 3GO5A 2I0QA 2LSSA 4DAMA 1NE3A 1PH8A 2I5MX 1AE2A 1VQGA 4GN5A 1KC8C 4WJ4A 1QUQA 4X64L 3S1MH 1QVCA 2VL6A 4LF6Q 4NXMQ 4HJ9A 2EXDA 5FJ8G 4JI6Q 1XTDA 4RMFA 1VQMA 3D31A 3M3YH 4DV7Q 3CC2A 4HIKA 5M5YH 3GD7A 1Y1WH 3TRZA 3U4ZA 3CCMA 1OXUA 4C3HH 2JE6I 4OX9Q 4QJFA 2WAQE 3S15H 3HOVG 3CCQA 3RLNA 1A0IA 3KJPA 2OQ0A 1PH2A 4DKAC 2PI2E 4GNXB 2NZHA 3KF6B 4AQYL 5HGQA 2UUBL 3M9BA 1YZ6A 4JI5Q 1PFSA 1T9HA 2AHOB 2VS1A 3K80C 2ASBA 4DR6L 4OWWB 1PYBA 1E3PA 4HJ8A 1YJ9A 1Q86C 1P16A 3A5ZB 1AE3A 4OWTB 4Y52H 4LUVA 1N33Q 2UU9L 3CC4A 2N8NA 4JI1Q 3U58A 1KAWA 4DV4Q 3FKIH 2BH8A 4GOPA 4DR6Q 3CMEA 4DR4L 1WFQA 3ICEA 4A3CG 2RF4A 5HY6A 2K5VA 3M4QA 1JB7A 1X55A 1PV4A 4GKJQ 4XIGS 4R4CA 4YWKA 1KQSA 4HJ7A 4DR7Q 4IOAA 2VNUD 1VCIA 2NZOA 2UXDL 1CKOA 4BBSH 1N32Q 4IJLA 3BZKA 1N36L 4P73A 4JOIA 1HR0L 2E5LQ 4OO1G 1HNWQ 2EIFA 3UE1A 1L1OC 5C44G 3CCSA 4DV7L 3KYHC 1PH6A 4EX5A 2JA7H 3CMAA 3M4OH 4BBRG 1HNWL 2DGYA 4OWXB 3AYHB 4DR2Q 2IT1A 1N36Q 2PQAB 1V9PA 1VQAA 3W1BA 1VQBA 4JBKA 2BA0A 2WB1G 2WB1E 3K0XA 1M90C 4LF4L 1XPOA 1XNQQ 3CC7A 4K0KL 4POGA 4KHPQ 4IFDI 3M7NA 1XMQL 3CPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A74 A;  2R7F A;  3K7A H;  4PZ8 A;  2E2I H;  2ZM6 Q;  1PH7 A;  2OCE A;  2YTX A;  4DR5 Q;  4GLX A;  2MFI A;  2EQS A;  5LMU L;  1HNX Q;  2Q2U A;  1B8A A;  2B63 G;  4UP7 A;  2NVY H;  1QVG A;  3CCE A;  4JV5 Q;  3H15 A;  1L0W A;  5GAH C;  3HOV H;  1SLJ A;  1IBL L;  3HKZ G;  1SFO H;  1VQ9 A;  3MXN B;  1VQK A;  5M5X H;  1K0R A;  1Q8K A;  4GS3 A;  3BJU A;  4IPG A;  1BBW A;  5IYB G;  4L5S A;  1V1Q A;  4IFD G;  2JA5 H;  4JI4 L;  1FJG Q;  3HOZ G;  3I7F A;  3K8A A;  3HOZ H;  4A3G H;  4A3J G;  5JJK A;  4Y7N H;  1S3O A;  3HOW G;  5C0X J;  2N78 A;  2JA6 G;  3CP0 A;  3T1H L;  1E1O A;  4PG3 A;  4LNQ A;  3J7A 5;  1IXR A;  3J7Z C;  1Y1W G;  1NTG A;  2WFW A;  2AWO A;  4LF6 L;  2VUM G;  3AQQ A;  3GTJ H;  3B6Y A;  2ZTD A;  4X64 Q;  3ULJ A;  1TWC H;  4R1J A;  1DGS A;  2Y0S G;  4QIW E;  3I4N H;  4DNI A;  4GNX A;  4BA1 I;  1C9O A;  1GVP A;  4BBS G;  1HNZ L;  3UDX A;  4DV0 Q;  1Y1V G;  2OQK A;  4LF9 L;  1HZB A;  1WJJ A;  3CCL A;  2KCT A;  4IPH A;  3CF5 A;  4AYB G;  2Q2H A;  2D0O A;  3NEL A;  4MTN A;  4TQU S;  3CCV A;  2ZJQ A;  5M3F G;  1KD1 C;  4IO9 A;  2VQE L;  4JC0 A;  2E2J H;  1L1O A;  4HJA A;  2NVT H;  1D7Q A;  5C0X G;  4UP8 A;  3PO3 H;  1EIY B;  4H02 A;  4KHZ A;  2PI2 A;  3NEM A;  1HR0 Q;  2E5L L;  2HIX A;  4L5R C;  3TS0 A;  4DV3 Q;  4A3M H;  3JC6 6;  3U4V A;  5C4J H;  3TEH B;  2E2H H;  3PF4 A;  1N9W A;  1X3G A;  1SRO A;  4DUY L;  3PUZ A;  4UP9 A;  1BBU A;  4GOP C;  1L1O B;  4LF4 Q;  4JI6 L;  1NMG A;  1JJC B;  4JI0 Q;  4JV5 L;  3NBH B;  5AJ3 Q;  4A4I A;  2UUC L;  4GKK L;  3RLO A;  2A19 A;  4R4O A;  1HZA A;  5FLX c;  4AH6 A;  1I94 L;  4POF A;  4LF8 L;  1N32 L;  3S2D H;  5K36 G;  1G29 1;  1VQ8 A;  4X62 L;  3S2H H;  3VDY A;  2B63 H;  1UE6 A;  1VQF A;  1CSQ A;  1TWH H;  5DLQ E;  5C4X H;  1NBW A;  4JI4 Q;  1FJG L;  4A93 G;  1PVO A;  3AFP A;  2F3I A;  1XNR Q;  2A8V A;  2CWP A;  1Q12 A;  2VZA A;  2MO1 A;  2XTI A;  1PH9 A;  3J81 j;  4GN4 B;  1MKH A;  4IOC A;  1TXY A;  3CW2 C;  1X65 A;  3J81 i;  4LF9 Q;  2JA8 H;  2UU9 Q;  4RG1 A;  1B7Y B;  1KL9 A;  3G6E A;  4JBM A;  2JJQ A;  4LWC A;  5IYC H;  3SGI A;  1OXV A;  4X65 Q;  3JAM i;  5LMU Q;  4YCV A;  1HNX L;  1N34 Q;  2UXC Q;  3NEN A;  4JBJ A;  4LFB L;  4BXX H;  3S24 A;  2R92 G;  2KEN A;  4DV2 L;  1VQH A;  4DR1 L;  5FJ8 H;  3GTK H;  1CSP A;  3T1H Q;  2R7Z G;  3I56 A;  2FXQ A;  1TWG H;  1X6O A;  1IYJ B;  3KDF A;  4DUY Q;  2JK8 A;  1OXT A;  1J6Q A;  3GTP H;  3F2B A;  3HOY H;  4OX9 L;  1HZ9 A;  1YHA A;  1O7I A;  1Y1V H;  3RR5 A;  2MNA A;  2NVX H;  3ULL A;  2CKZ B;  2UXB L;  2JA6 H;  3M4P A;  1E22 A;  2ALY B;  3I4N G;  3T1Y Q;  3RLF A;  2IHF A;  3UDI A;  2YYZ A;  1QUQ B;  1GM5 A;  4A3M G;  2HHH L;  1FVI A;  1PHJ A;  4BY7 G;  1K83 H;  4YWM A;  1K73 C;  5JEA J;  3FP9 A;  4JYA L;  2UXB Q;  2XGT A;  3L2P A;  2A1A A;  4DAY B;  4P71 A;  2YV5 A;  5LMN Q;  4YHH Q;  3KOJ A;  4A3C H;  3PO2 G;  4QL5 A;  5M3F H;  4BY7 H;  3E9H A;  1E1T A;  2JA5 G;  4JI7 L;  5IT9 c;  5LMN L;  1MJC A;  4XTC S;  3CAM A;  1VQP A;  1LTL A;  1CKM A;  3BU2 A;  4B3S Q;  4A3L H;  4IFD J;  2HIV A;  3W5O A;  2KHJ A;  1BVS A;  3I4O A;  4JG2 A;  2F52 A;  4GNX C;  5ELO A;  4LUO A;  3RZO H;  3HFZ B;  3G4S A;  1P8L A;  4LFB Q;  1J5E Q;  1GD7 A;  1KRS A;  2Z6K C;  1N34 L;  2I5H A;  1EQQ A;  3OTO Q;  2IHE A;  2Q2T A;  4PZ6 A;  4HJ5 A;  2CFM A;  5BR8 Q;  3PUV A;  2GVA A;  5M5W H;  1D8L A;  4NPS A;  2YTY A;  1K8A C;  1B70 B;  3CCU A;  4GOP B;  4YCU A;  4A3E H;  2N3S A;  1W3S A;  2AKW B;  4A3I H;  2IX1 A;  4A3I G;  3DLL A;  2BA1 A;  1EIF A;  1SRU A;  5C44 H;  5EAY A;  1PH5 A;  2UXC L;  3UDG A;  1C0A A;  1JT8 A;  3A0J A;  1KHI A;  4YY3 L;  1CKN B;  4NXN L;  3E0E A;  3L7Z C;  4L5T A;  5IWA L;  2JA9 A;  3TS2 A;  1NJI C;  4DV1 Q;  4DR5 L;  1R9T H;  1QVF A;  5IY0 A;  4AQY Q;  3G48 A;  1YJW A;  4X66 L;  4BA2 I;  1G51 A;  2ZTC A;  1FL0 A;  3JAM c;  4DV0 L;  1XMQ Q;  2UUB Q;  1TWA H;  4YHH L;  2R7Z H;  2IX0 A;  1OXS C;  3GTM H;  4MNO A;  4A3F G;  2NN6 G;  1XNR L;  4B3T Q;  2F4V L;  1N33 L;  3S14 H;  4B3R Q;  1E7Z A;  4JI3 L;  5IE8 A;  5JJI A;  4B3M L;  1VQ7 A;  2YU9 H;  4WJ3 M;  1LUZ A;  5IP7 H;  4X65 L;  1UE5 A;  3F1Z A;  3AFQ A;  4B3M Q;  3HKS A;  1EQR A;  1KRT A;  2K50 A;  2VUM H;  3LGJ A;  1SE8 A;  4J15 A;  2JQO A;  3ER0 A;  1Q81 C;  3RZD H;  4O0A A;  1PH3 A;  3OYY A;  4NB3 A;  2JEA I;  4JCV E;  3H3V H;  3PO3 G;  2BH2 A;  2R6G A;  3CQZ H;  2CWA A;  1X54 A;  2AMC B;  1TWF H;  3J81 c;  1UE7 A;  5IYB H;  4DV5 L;  5M3M G;  4X62 Q;  1HZC A;  2ATW A;  1XMO Q;  4C2M H;  4LF5 L;  2I5L X;  3H0G H;  2JEB I;  4LF8 Q;  4P72 A;  4A3B G;  4QQB X;  1H95 A;  2WAQ G;  2PNH A;  5C0X I;  3F8T A;  1WCM H;  3L0O A;  4C3I H;  1M1K C;  1WCM G;  4B3S L;  2K52 A;  2ZTE A;  3J80 c;  1ASZ A;  2ZM6 L;  2VW9 A;  1KIX A;  4QGU A;  2MO0 A;  4BY1 H;  1HNZ Q;  2N49 A;  4A3K G;  4BY1 G;  5JJL A;  3ZJY C;  2VQF Q;  4R4Q A;  1VQ4 A;  1IL2 A;  2RHS B;  1Q7Y C;  2PMZ E;  4MZ9 A;  3ULP A;  4JYA Q;  2ZJP A;  4JI8 L;  4DK6 C;  4R4T A;  1OTC A;  4DK3 C;  3S1R H;  4A3E G;  3UE0 A;  2QA4 A;  1VQL A;  4A3K H;  2PQA A;  4HIM A;  1K8G A;  1IBL Q;  3EN2 A;  1IZ6 A;  1WI5 A;  4TVA B;  1Z47 A;  2K4K A;  1Q1B A;  2K75 A;  2B3G A;  5AJ3 L;  3PUX A;  1C7Y A;  3CD6 A;  4KHP L;  1EUJ A;  2ZJR A;  1L2F A;  4GLA C;  5LMN W;  2GVB A;  1QZH A;  1VQI A;  2C35 B;  2K14 A;  1EOV A;  1X56 A;  3RNU A;  4GKJ L;  1GO3 E;  2AWN A;  1Q82 C;  1AH9 A;  1HJP A;  3GTL H;  3S17 H;  4X66 Q;  1A62 A;  3ERS X;  4IPD A;  3RN2 A;  3GTQ H;  1UE1 A;  1VS0 A;  3KLW A;  1YVC A;  2R7D A;  3HKZ E;  1YEZ A;  4DUZ L;  3I4M H;  1XMO L;  3I4M G;  1VQC A;  4DR2 L;  1HR0 W;  4APV A;  5GQO A;  5GAG C;  5C3E H;  3FKI G;  2NVQ H;  1LM0 A;  4LF7 Q;  2IY5 B;  2KCM A;  2L15 A;  3RN5 A;  2D62 A;  1YHB A;  4JI5 L;  1YJN A;  4EQ5 A;  4P75 A;  1I94 Q;  4OO1 I;  3I55 A;  3HOX H;  2UUA Q;  2OTJ A;  1RIP A;  4GN3 B;  5GRO A;  1A63 A;  2JA8 G;  4OON A;  4K0K Q;  3GTG H;  1W2B A;  1S40 A;  4OXP A;  3EIV A;  2CCZ A;  3KF8 B;  1JJG A;  1VQ6 A;  4A93 H;  1Q1E A;  4HIO A;  3S1N H;  1I6H H;  4A3F H;  2UUA L;  2K5N A;  3F2D A;  4YWL A;  2KHI A;  3OTO L;  4FDB A;  2D0P A;  1I50 H;  1XJV A;  3STB D;  4A3D G;  1CUK A;  1JJ2 A;  3AEV A;  4B3R L;  1J5E L;  1EWI A;  1RL2 A;  5FLM H;  5IP7 G;  3E9I A;  1MIU A;  3KF6 A;  3IRB A;  2F4V Q;  1X3E A;  3GTO H;  2KBN A;  2VQE Q;  5GAE C;  2R93 G;  4A76 A;  3S1Q H;  4O2D A;  4UPA A;  3PF5 A;  2QGQ A;  3BZC A;  2WP8 J;  1EFW A;  2RCN A;  4LUZ A;  4JI8 Q;  3PIO A;  4DR3 L;  1XPR A;  1IBK Q;  1VQ5 A;  4LFA L;  4DV6 Q;  4LFC Q;  4A3G G;  3OW2 A;  4X6A H;  4R4I A;  4DV3 L;  4DV4 L;  1N8R C;  3PIP A;  2Y0S E;  1UEB A;  2NN6 I;  4L5Q A;  3K81 C;  4NXN Q;  1YIJ A;  2Z0S A;  1X9N A;  3HOW H;  1Y14 B;  3U50 C;  4A3J H;  3A5U A;  2ID0 A;  4DV1 L;  2H5X A;  1WOC A;  3J80 i;  4ALP A;  1U0L A;  4JI0 L;  3TRE A;  3PO2 H;  2GN5 A;  3DM3 A;  4GLV B;  1PYS B;  5ELN A;  4KLK A;  2Z6K A;  1MJE A;  1PH1 A;  4DPG A;  3G71 A;  1I5F A;  3PCO B;  5J3B A;  4JI7 Q;  3K7U C;  1VQJ A;  4PZ7 A;  1EYG A;  2OWO A;  3D0F A;  2LXK A;  4C3J H;  5IP9 H;  4DV2 Q;  4DR1 Q;  5IP9 G;  3CXC A;  4JI3 Q;  4LF7 L;  3H3V I;  1A8V A;  1V43 A;  3TQY A;  2VY3 A;  5JEA G;  1S72 A;  4JBW A;  1ASY A;  1SR3 A;  1YI2 A;  3S16 H;  1BKB A;  1FGU A;  4UY8 C;  1QZG A;  1Z9F A;  1XPU A;  5IYD H;  1HH2 P;  4AYB E;  1E24 A;  3HOU G;  3WWV A;  4YY3 Q;  4IJH A;  4NXM L;  4PMW A;  3PGZ A;  1YHQ A;  1VQE A;  4DUZ Q;  1KXL A;  4B3T L;  4A3L G;  2UXD Q;  1G6P A;  4JI2 L;  1GKH A;  2V1C C;  1Q46 A;  1K9M C;  1JMC A;  4DV5 Q;  3HOX G;  3KDF B;  3I2Z A;  3PV0 A;  4LFC L;  4DV6 L;  4LW1 A;  1SN8 A;  2K5H A;  3PUY A;  4ME3 A;  4AIM A;  3HOU H;  1LYL A;  2ES2 A;  1OXX K;  5C3E G;  2Q2I A;  5FLM G;  1YBY A;  2LXJ A;  2CQO A;  3GDE A;  2RHQ B;  1XNQ L;  1CKN A;  5IWA Q;  3CCJ A;  3CCR A;  3F2C A;  2MQH A;  5GAD C;  1NMF A;  3UDF A;  4JOI C;  3CPW A;  3T1Y L;  2HHH Q;  2QEX A;  4A75 A;  5IYD G;  3W1G A;  2JA7 G;  1IBM Q;  1I3Q H;  2HQL A;  3STB C;  2VQF L;  1X3F A;  3H0G G;  4IPC A;  4HID A;  4A3B H;  3MEF A;  5C4X G;  4DR4 Q;  3KJO A;  2HT1 A;  1NY4 A;  3Q8D A;  1UWV A;  4KI0 A;  2YTV A;  1VQD A;  5H1S E;  1IBM L;  5BR8 L;  4LFA Q;  5E7N A;  1YNX A;  4BBR H;  3PUW A;  1YIT A;  2DUD A;  4YCW A;  4BXX G;  2R93 H;  3FHW A;  3HOY G;  1JE5 A;  4JI1 L;  5M3M H;  1K3R A;  2E8G A;  5IYC G;  1PA6 A;  4LF5 Q;  1VQO A;  1SMX A;  4QY7 A;  3KFU A;  2UUC Q;  4GKK Q;  1U5K A;  4A3D H;  4DR7 L;  4JI2 Q;  3M85 A;  1PH4 A;  2OTL A;  4DR3 Q;  4P74 A;  3EBE A;  1IBK L;  1VQN A;  2R92 H;  3PSI A;  2B29 A;  1WYD A;  3GO5 A;  2I0Q A;  2LSS A;  4DAM A;  1NE3 A;  1PH8 A;  2I5M X;  1AE2 A;  1VQG A;  4GN5 A;  1KC8 C;  4WJ4 A;  1QUQ A;  4X64 L;  3S1M H;  1QVC A;  2VL6 A;  4LF6 Q;  4NXM Q;  4HJ9 A;  2EXD A;  5FJ8 G;  4JI6 Q;  1XTD A;  4RMF A;  1VQM A;  3D31 A;  3M3Y H;  4DV7 Q;  3CC2 A;  4HIK A;  5M5Y H;  3GD7 A;  1Y1W H;  3TRZ A;  3U4Z A;  3CCM A;  1OXU A;  4C3H H;  2JE6 I;  4OX9 Q;  4QJF A;  2WAQ E;  3S15 H;  3HOV G;  3CCQ A;  3RLN A;  1A0I A;  3KJP A;  2OQ0 A;  1PH2 A;  4DKA C;  2PI2 E;  4GNX B;  2NZH A;  3KF6 B;  4AQY L;  5HGQ A;  2UUB L;  3M9B A;  1YZ6 A;  4JI5 Q;  1PFS A;  1T9H A;  2AHO B;  2VS1 A;  3K80 C;  2ASB A;  4DR6 L;  4OWW B;  1PYB A;  1E3P A;  4HJ8 A;  1YJ9 A;  1Q86 C;  1P16 A;  3A5Z B;  1AE3 A;  4OWT B;  4Y52 H;  4LUV A;  1N33 Q;  2UU9 L;  3CC4 A;  2N8N A;  4JI1 Q;  3U58 A;  1KAW A;  4DV4 Q;  3FKI H;  2BH8 A;  4GOP A;  4DR6 Q;  3CME A;  4DR4 L;  1WFQ A;  3ICE A;  4A3C G;  2RF4 A;  5HY6 A;  2K5V A;  3M4Q A;  1JB7 A;  1X55 A;  1PV4 A;  4GKJ Q;  4XIG S;  4R4C A;  4YWK A;  1KQS A;  4HJ7 A;  4DR7 Q;  4IOA A;  2VNU D;  1VCI A;  2NZO A;  2UXD L;  1CKO A;  4BBS H;  1N32 Q;  4IJL A;  3BZK A;  1N36 L;  4P73 A;  4JOI A;  1HR0 L;  2E5L Q;  4OO1 G;  1HNW Q;  2EIF A;  3UE1 A;  1L1O C;  5C44 G;  3CCS A;  4DV7 L;  3KYH C;  1PH6 A;  4EX5 A;  2JA7 H;  3CMA A;  3M4O H;  4BBR G;  1HNW L;  2DGY A;  4OWX B;  3AYH B;  4DR2 Q;  2IT1 A;  1N36 Q;  2PQA B;  1V9P A;  1VQA A;  3W1B A;  1VQB A;  4JBK A;  2BA0 A;  2WB1 G;  2WB1 E;  3K0X A;  1M90 C;  4LF4 L;  1XPO A;  1XNQ Q;  3CC7 A;  4K0K L;  4POG A;  4KHP Q;  4IFD I;  3M7N A;  1XMQ L;  3CPF A; 
#chains in the Genus database with same CATH topology
 4F4X A;  2NTT A;  3PR5 B;  2P0A A;  1PH7 A;  3S1M B;  3K3V A;  4DLK A;  2NTS A;  2QCP X;  1EUC B;  2B2T C;  2YTX A;  2A69 C;  3SXH A;  2JEJ A;  2Q2U A;  2ALZ A;  2QDB A;  2KUM A;  3V6J A;  5KEE A;  1B1Z A;  4DL4 A;  1L0W A;  4RB3 C;  3MTS A;  1EFI D;  1Q8K A;  2F0G A;  3GIM A;  3NTI A;  4G57 A;  1D2B A;  2NYZ D;  4IPG A;  4O1N A;  1BBW A;  5IYB G;  4L5S A;  4RGN A;  1V1Q A;  4IFD G;  2EYO A;  3BDC A;  3I7F A;  1JR0 D;  4NW2 A;  3S1Q B;  5JQW A;  5C0X J;  2BR0 A;  3RB4 A;  2N78 A;  4FNF A;  3CP0 A;  1N33 H;  4RCO A;  4HYK A;  1NTG A;  2AWO A;  1SXT A;  3IKJ A;  2DY7 A;  4JV1 A;  3B6Y A;  1PTO D;  4X3T A;  2YRW A;  4YHH H;  1TQO A;  3ULJ A;  1KJJ A;  4KJN A;  3I4N H;  1I6U A;  4DNI A;  3GTG A;  1BO0 A;  4IAL A;  3DF7 A;  1A6X A;  4Q0F A;  1ICW A;  1QOH A;  4H44 C;  4DV0 Q;  1Y1V G;  1TWC A;  5KG5 A;  4Z9C B;  3CCL A;  5IWA H;  3PN1 A;  4MTN A;  3NEL A;  2EJF C;  2K28 A;  4C5B A;  2ZJQ A;  4J9M A;  4IO9 A;  2B2V A;  3S14 B;  2X69 A;  2VQE L;  1D7Q A;  1FNW A;  1EZ8 A;  4U6P A;  2B2W C;  4H02 A;  2PI2 A;  3TP8 A;  4F7X A;  3NEM A;  3TME A;  4WBN F;  5ELD A;  3JC6 6;  1WD1 A;  4IWY A;  1LTT D;  1V1P A;  5EBC A;  4LF7 H;  2EDG A;  2G9H D;  5FD5 A;  4C3H B;  4G7O C;  3DWP A;  4J9Q A;  5KFN A;  5DEH A;  3MXP A;  1FYC A;  4JI0 Q;  2AU0 A;  3VR3 A;  2RGV A;  4I55 F;  4A4I A;  3GTL B;  4GKK L;  2F0W A;  1HZA A;  4POF A;  4LF8 L;  2HGS A;  3A56 A;  1PLF A;  2IW3 A;  1LTR D;  1TWH H;  1PVO A;  3FPU B;  3AFP A;  2F3I A;  1Q12 A;  3AU7 A;  5JVG 3;  2OF1 A;  1PH9 A;  4RHR A;  3J81 j;  1OWT A;  4GN4 B;  1MKH A;  4IOC A;  2W70 A;  5IGE A;  4UCS A;  4MA0 A;  5BPH A;  3G6E A;  4F50 A;  2C28 A;  1EU4 A;  4C3I B;  2QYZ A;  5KG0 A;  4LFA H;  3HKZ A;  3QJY A;  3HS0 C;  3SGI A;  3JAM i;  4FXD A;  3GTK B;  1STA A;  3KLS A;  4LFB L;  2R92 G;  1SNQ A;  5L9X A;  4QWB A;  1HTL D;  3T1H Q;  5KIX A;  2ZDQ A;  3G6V A;  2QKI C;  2JK8 A;  2X0S A;  4A3B B;  2W6O A;  1DOK A;  2EYF A;  2JA6 A;  5EWG A;  1UNS A;  1WH2 A;  2F0V A;  3MXU A;  4OX9 L;  1TWG A;  4RUA A;  1Y1V H;  2FK1 A;  2I80 A;  5I6W A;  5DLG A;  3N6R A;  1PTO H;  1ENA A;  4YP3 A;  3M4P A;  4RB1 A;  1E22 A;  2AQ3 B;  1GUO A;  3I4N G;  2YYZ A;  1GM5 A;  4A3M G;  3CVZ A;  1PHJ A;  3VR6 A;  4YWM A;  5LP6 F;  4RNN A;  5JEA J;  3FP9 A;  3MZ5 A;  3OHA A;  4F4Z A;  4P71 A;  5LMN Q;  3KAL A;  5C5M A;  1BQQ T;  4C3J G;  3IG0 A;  1JCK B;  5COY A;  4TKO B;  4BY7 H;  3E9H A;  4JI7 L;  1B53 A;  3H3V C;  1MJC A;  4XTC S;  3VYS A;  5IGG A;  1VMP A;  2D5D A;  3I8Z A;  1CKM A;  1IKM A;  2W6M A;  3MXN A;  1XXG A;  3RTX A;  5CGK A;  4GNX C;  2QW7 A;  4LUO A;  1RCV D;  4FF4 A;  4MV6 A;  5T1G A;  1N34 L;  1MGS A;  2I5H A;  4KHP H;  1V8Q A;  2IHE A;  4DNR B;  3QO2 A;  2F0F A;  2GVA A;  5M5W H;  5ELF A;  2YTY A;  5EOY A;  3NTK A;  5FLX W;  4BY7 B;  4GOP B;  3MXG A;  4A3M B;  2WYO A;  2UXC H;  3J7A F;  1S68 A;  3S2H B;  3DLL A;  2BA1 A;  4IR9 A;  1C48 A;  5EAY A;  3UDG A;  1IW7 D;  2XSC A;  3A0J A;  4XQQ A;  4UHV A;  1B4O A;  3NWS A;  4QCL A;  1R4Q B;  3L7Z C;  5I4D A;  1D1K A;  1B3Q A;  3OHX C;  4UCO A;  2V4R A;  4J9K A;  4DR5 L;  5IGC A;  1QVF A;  1WTH A;  4OL7 A;  1G51 A;  1FL0 A;  5J2U F;  4OO1 H;  2AGP A;  1STG A;  3KHR A;  3LX0 A;  2UUB Q;  5ELE A;  1TWA H;  2W9B B;  4MTD A;  2BE5 C;  4Q5V A;  4R8N A;  4O2B F;  3KHL A;  1K8M A;  4N9T A;  4B3R Q;  4JI3 L;  5JJI A;  1E4G T;  1EY9 A;  1EEI D;  1VQ7 A;  2G5D A;  4HNU A;  5KFS A;  1H9J A;  3VR5 A;  3BVM A;  5LL6 b;  3AFQ A;  1DYQ A;  2VUM H;  3N6X A;  2K5D A;  3LGJ A;  2XIW A;  2NU9 B;  1E2W A;  1PRT C;  1Q81 C;  3DXJ C;  2O4X A;  4OHJ A;  3H3V H;  3PO3 G;  4EGJ A;  3TQT A;  4GZY C;  3CQZ H;  4LMY A;  1X54 A;  3GV7 B;  3MJF A;  5M3M G;  1PX2 A;  1UEA B;  1ROD A;  2I5L X;  4A3B G;  1T3N A;  5C5L A;  4DR1 H;  4EYH B;  2PNH A;  2GA4 B;  2W71 A;  5GON F;  3L0O A;  4C3I H;  1WCM G;  1SJH D;  4XXE A;  1HNX H;  2NU7 B;  4QGU A;  1I4R A;  3K7A B;  3T4A C;  1WVL A;  4TQS A;  3BQ2 A;  2RHS B;  1CHQ D;  1Q7Y C;  3FMA A;  2H4O A;  2ZJP A;  4DK6 C;  2D9U A;  3UE0 A;  2NUC A;  2PQA A;  2F0D A;  1Y1V A;  2K4K A;  4XYL B;  2OH2 A;  3RZO B;  3Q8S B;  4ZCK A;  1EU3 A;  3QOL A;  3CD6 A;  1AUX A;  1N32 H;  1EUJ A;  4XYQ A;  1DD2 A;  1L2F A;  5LMN W;  1RF2 D;  2GVB A;  5DQH A;  5I9P A;  4R9W A;  2K14 A;  4GKJ L;  2DIK A;  1GO3 E;  4CKE A;  4I7H A;  4WD3 A;  1AH9 A;  1HJP A;  1SSO A;  5JAV A;  3GTL H;  3GII A;  1U4L A;  3ERS X;  1D5M C;  3RN2 A;  3GTQ H;  1UE1 A;  3KLW A;  3HKZ E;  3GTJ A;  4N8X 1;  1O78 A;  5C3E H;  3PO2 B;  4EBC A;  1LM0 A;  3U9O A;  5KG6 A;  5I6Y A;  3HOX H;  1M0W A;  1HFN A;  1Y8N B;  4RZR A;  1ILQ A;  4FBT A;  1XTC D;  1S5E D;  2EYH A;  3A8J E;  1EZ6 A;  1LAB A;  2N55 A;  3EIV A;  4A93 H;  3S1N H;  1LTI D;  5A35 A;  4A3F H;  2NB0 A;  2UUA L;  3SK4 A;  1JDE A;  2UVR A;  2M00 A;  3F2D A;  3RV3 A;  1I7L A;  4A3D G;  4ZHQ F;  1JJ2 A;  1J5E L;  5L1K A;  2K01 A;  1RL2 A;  5EPK A;  5FLM H;  5AFW A;  4RAY A;  1KTK A;  1SYX B;  3IRB A;  2O03 A;  3H40 A;  4ZKC B;  2KBN A;  2VQE Q;  2EY5 A;  1E2V A;  3PF5 A;  3S1Q H;  4QMG A;  3T1H H;  2BQR A;  2RCN A;  3PIO A;  5KKN B;  5TSS A;  4LFC Q;  4DV3 L;  4HSV A;  4DV4 L;  4KN7 C;  1S0O A;  4U7C A;  5KG7 A;  3WNZ A;  2E2H B;  3R2I A;  3BVZ A;  2A6E C;  3H6M A;  1YIJ A;  2O5I C;  3GTO B;  3H0G A;  3GTQ B;  3A5U A;  2H5X A;  1WOC A;  2QDL A;  4ALP A;  4X62 H;  1CA6 A;  2K33 A;  1IL8 A;  4LF8 H;  3TRE A;  3PO2 H;  3DM3 A;  2BDN A;  4HR7 A;  5KG3 A;  2WII B;  2A73 B;  2Z6K A;  5HV6 A;  1MBY A;  1VQJ A;  5FO8 B;  1EYG A;  1PXU A;  3MWD A;  2YZM A;  1HPC A;  3K5H A;  4J9P A;  4DR1 Q;  3H3V I;  4K0K H;  2FE3 A;  1A8V A;  3TQY A;  5JEA G;  3HOX B;  2XIG A;  1RYR A;  3I3C A;  3R8B A;  4UFZ A;  1K8O A;  4XYM B;  3PGZ A;  3RF2 A;  3Q22 A;  4DUZ Q;  1CZW A;  2M2L A;  1G6P A;  1Y8P B;  1K9M C;  3WOE A;  1U4R A;  3I2Z A;  3PV0 A;  4LFC L;  4ME3 A;  5KFH A;  2B63 A;  1GHK A;  2Q2I A;  2NUA B;  3KLS X;  2F1M A;  3GTQ A;  2CQO A;  3C0F B;  1XNQ L;  3W2D A;  3DEO A;  5IWA Q;  3CCR A;  3MWE A;  1KC7 A;  1TVX A;  2F0E A;  2XC9 A;  1B33 N;  1HTP A;  1EWC A;  3T1Y L;  2UU9 H;  4O3Q A;  4KY6 A;  2Y0S B;  3W1G A;  5KNB A;  3SI8 A;  2K32 A;  2K05 A;  4A3B H;  1NR4 A;  4E4T A;  3EPI A;  1SE2 A;  3MEF A;  5T14 A;  2VUM B;  3JSL A;  2UUB H;  5EWF A;  2L12 A;  3C2P A;  4DV1 H;  5H1S E;  1VQD A;  4RUC A;  4BWG B;  2A6E D;  4I7A A;  1IBM L;  4IUP A;  5E7N A;  1YNX A;  2EY1 A;  3HOZ B;  1GOZ A;  1JOK A;  4R8U A;  3FHW A;  3R2T A;  3HOV B;  5I2X A;  1NCV A;  2VPS A;  4J9O A;  4LF5 Q;  3V2T A;  3I73 A;  3KFU A;  4I7Z C;  1U5K A;  3TDQ A;  1H9S B;  2YS6 A;  4DR7 L;  4JI2 Q;  1PH4 A;  2OTL A;  4DR3 Q;  4P74 A;  1VQN A;  2R92 H;  2VA2 A;  4A3D B;  2I0Q A;  4EGV A;  4DAM A;  2YW2 A;  2I5M X;  1AE2 A;  1VQG A;  4WJ4 A;  2A6H D;  1QUQ A;  4X64 L;  2DLN A;  4DR7 H;  2VL6 A;  5KFK A;  5KT7 A;  2RDI A;  5KFM A;  3OWE B;  4DA2 A;  1XTD A;  1JLL B;  4RMF A;  2YU9 B;  3D31 A;  4CC5 A;  2CW7 A;  3CC2 A;  2DZD A;  4HIK A;  1B3A A;  4LFC H;  3U4Z A;  3CCM A;  2FB9 A;  4C3H H;  4QJF A;  1PYW D;  2NBF A;  1IBM H;  4CGY B;  3CCQ A;  1F2Z A;  4Q0Y A;  2W9B A;  1A0I A;  4IRD A;  2FK3 A;  3FDS A;  2BDO A;  3KF6 B;  1PTO F;  2UUB L;  3A7L A;  4JI5 Q;  4PNY A;  4HJ8 A;  2MCT A;  5CC4 A;  4C2M A;  2NZ1 D;  1UAP A;  3CC4 A;  4K6L A;  1SBB B;  3GTP A;  1FD7 D;  2XGQ A;  3A54 A;  3CME A;  4XT1 B;  2F0U A;  3ICE A;  3M4Q A;  1EY5 A;  1X55 A;  4FM9 A;  4R4C A;  1KQS A;  4DR7 Q;  4HJ7 A;  3SK5 A;  1TWF A;  1T94 A;  2VNU D;  4HCS A;  2J6S A;  1E4E A;  4EEY A;  4PQX A;  4QUC A;  1CKO A;  4F88 A;  1N36 L;  3K6O A;  4ODG A;  4P73 A;  5J22 A;  2B2W A;  4HR7 B;  5EJW A;  1PTO B;  4PMC A;  4JVZ A;  5C44 G;  1BDO A;  5E4X A;  4DV7 L;  4JI8 H;  3T16 A;  3R3O A;  4OWX B;  1JE4 A;  1R4P B;  4KK7 A;  2BCO A;  1TWH A;  2BA0 A;  2WB1 G;  2WB1 E;  3J81 L;  1ESR A;  1WCM B;  2CVR A;  4RFB A;  4K0K L;  4YJ2 F;  3CPF A;  4BWS C;  4J1M A;  1CQJ B;  2JYO A;  4FXK C;  3QB3 A;  1AFP A;  1V4Y A;  2JEF A;  4F8M A;  2B63 G;  1Z2O X;  2NVY H;  1GUN A;  1QVG A;  2RDH A;  4A2B A;  5GAH C;  3GTJ B;  3HKZ G;  1SFO H;  4FS2 A;  4JI1 H;  1TWF B;  3RB6 A;  1VQK A;  5M5X H;  1TS4 A;  3J81 E;  3BJU A;  2JA5 H;  4JI4 L;  3D6C A;  3IFD A;  3M7G A;  3HOZ H;  4L63 B;  3G8C A;  4A3J G;  3DM1 A;  1LT5 D;  1S3O A;  2A68 D;  4Y7N H;  4QIW B;  1DV1 A;  2IJ0 A;  1GSA A;  2JA6 G;  4ZOL F;  2F4V H;  2PO4 A;  1IXR A;  1I50 B;  3PMF A;  4TQR A;  4LF6 L;  1TWH B;  2VUM G;  3AQQ A;  4WJW A;  2DNE A;  5FPO A;  4GKJ H;  1DIK A;  3BYT B;  2WTF A;  5KT3 A;  4Q44 A;  1HNZ L;  4EFB A;  2O5J C;  4FU0 A;  3MWM A;  2KOL A;  4AYB G;  2Q2H A;  2D0O A;  1Z2P X;  2TSS A;  4TQU S;  5K36 H;  1SYE A;  3RGX A;  2HDM A;  5M3F G;  1AUV A;  4ECQ A;  1L1O A;  1AN7 A;  3GQB A;  3VPD A;  4UP8 A;  3Q0A A;  1EIY B;  4A3K B;  2E5L L;  3GTO A;  1Y69 U;  4L5R C;  1GSO A;  1R9T A;  4DUZ H;  2EY6 A;  3U4V A;  3M9M B;  1PFB A;  3TEH B;  3PF4 A;  1N9W A;  1S5F D;  1H9S A;  3PUZ A;  4ILW A;  1I7N A;  4UP9 A;  3GIP A;  4GOP C;  3E5N A;  1NMG A;  5IOD A;  1JJC B;  5A2Q E;  3NBH B;  4R4O A;  3MA2 B;  4KJO A;  1N32 L;  4XT3 B;  4ETS A;  2KCN A;  3S2D H;  1LTA D;  3S1R B;  1VMC A;  1JWS D;  1VQ8 A;  1F2Y A;  5C1O A;  1ICF B;  2B63 H;  5DG8 A;  2VQD A;  1CSQ A;  4JI4 Q;  4A93 G;  1G2S A;  1XNR Q;  2X6G A;  4XX0 B;  2VZA A;  5ELB A;  2MO1 A;  4ECY A;  5E1F A;  4DNT B;  1O7L A;  4J9R A;  4LF9 Q;  2GLT A;  2YZG A;  4ZLT F;  2UVW A;  4LMQ D;  3GTP B;  3HB9 A;  1JWM D;  2HHH H;  4UCR A;  1WCM A;  3MR6 A;  1QIL A;  1CA5 A;  1BGW A;  2J6U A;  3RMH A;  5IYC H;  5LOV F;  4X65 Q;  1OXV A;  5LMU Q;  4YCV A;  4CJ0 B;  1N34 Q;  1HNX L;  2UXC Q;  1E4F T;  3OIP A;  4DR1 L;  4TV8 F;  4K14 A;  5FJ8 H;  5KGU A;  4LK1 C;  3C46 A;  4B3R H;  4DV0 H;  4O3P A;  4IRC A;  4MV3 A;  1J6Q A;  2HDL A;  3GTP H;  2DWC A;  2QIL A;  3HOY H;  4X3U A;  1HZ9 A;  1YNN D;  4RKB A;  1TS5 A;  3BG5 A;  2NVX H;  2ZXP A;  1RJT A;  4XDX A;  2MGS A;  2ALY B;  3Q23 A;  4LSX A;  2HHH L;  1QUQ B;  1FVI A;  1K83 H;  1KEE A;  1WR2 A;  4ZK9 B;  2UXB Q;  2HQE A;  4JI3 H;  2A1A A;  4DAY B;  2YV5 A;  5IT9 E;  4HQ6 A;  3PO2 G;  3NE5 B;  5M3F H;  4ZQI A;  3V4Z A;  3MEH A;  1JIH A;  1N34 H;  2I46 A;  1JDB B;  2HVS A;  3CAM A;  4B3S Q;  4KN4 C;  2YYA A;  2RDF A;  1SNP A;  3I70 A;  2M9V A;  2LFN A;  3I4O A;  4KD3 A;  1ENF A;  1F77 A;  4KHP Q;  5ELO A;  3RZO H;  2W9C A;  3HFZ B;  4LFB Q;  4F4W A;  1DZ1 A;  1J5E Q;  2FMC A;  1GD7 A;  3T51 B;  1KRS A;  5D8D A;  4CC6 A;  1KBL A;  4JI7 H;  1EY7 A;  5JEA H;  2Q2T A;  4PZ6 A;  4EQP A;  3N52 A;  1TS3 A;  3PUV A;  3A7A B;  1GJX A;  1D8L A;  4FP5 D;  1PZK D;  1K8A C;  1B70 B;  4RAZ A;  4XYO A;  5EWE A;  3CCU A;  4YCU A;  4A3E H;  2N3S A;  1SJE D;  4ECU A;  1EIF A;  1GUS A;  4RHS A;  4ZYS A;  1SE3 A;  1D5X C;  2UXC L;  2A74 C;  5D1O A;  1C0A A;  1AN8 A;  1KHI A;  1SYF A;  4EVO A;  3SHL A;  2UXB H;  3KUP A;  2R93 A;  3RIZ A;  3E0E A;  4LAA A;  2B2U A;  3K5M A;  4IZO A;  2JA9 A;  3GV8 B;  2KVM A;  3JAM E;  4AQY Q;  4K8J A;  1YJW A;  4X66 L;  1HNZ H;  2L55 A;  1LT3 D;  3FKI A;  3SVM A;  5LL6 X;  4LF5 H;  1IYU A;  2FJZ A;  2BQ3 A;  2R7Z H;  3U9S A;  1RJR A;  4LFB H;  4A3F G;  2KSW A;  5M3M B;  3BQ0 A;  4K8I A;  1SNO A;  1MHW C;  2JEG A;  3X3M A;  3RD4 A;  1E7Z A;  5IE8 A;  4B3M L;  4RNO A;  1O75 A;  4JI4 H;  3F1Z A;  4MAM A;  2ASL A;  4B3M Q;  3HKS A;  3I12 A;  1ET9 A;  1KRT A;  1KJ9 A;  3R5H A;  2NU8 B;  1SE8 A;  3MFY A;  4J15 A;  1GSH A;  4O0A A;  3EJI A;  2F0O A;  4NB3 A;  3V96 A;  2C00 A;  1XYI A;  2EJG C;  2PZT A;  5IYB H;  2VB3 X;  5LMU H;  3CQZ B;  5CBA E;  1SYD A;  4C2M H;  3H0G H;  3SK6 A;  1SYB A;  2JEB I;  4QIW A;  3V4S A;  4ZUI A;  3JAM W;  4DV2 H;  4JI6 H;  4LSA A;  3F8T A;  1RYS A;  2R7Z B;  2XRQ D;  3M4Y A;  2ICE C;  4C1N I;  2RBM A;  3DEP A;  2VQF Q;  1M0T A;  2F0T A;  2PMZ E;  4MZ9 A;  1BOS A;  4JI8 L;  5M3F B;  4DK3 C;  4DXG A;  2V5A A;  5DG7 A;  2NVY B;  3P75 A;  2VQE H;  2F0P A;  1A2T A;  1VQL A;  3D8G A;  1IBL Q;  1CE8 A;  3EN2 A;  1IZ6 A;  1WI5 A;  3T5H A;  2C2E A;  1Q1B A;  2DNC A;  1C7Y A;  2N88 A;  4UDU C;  1KJI A;  1XX8 A;  3CU7 A;  1CM9 A;  4RA8 A;  3VYU A;  4ECZ A;  3R5F A;  1YVC A;  1YNJ D;  3I4M H;  1S0N A;  3GTL A;  3I4M G;  4KHV A;  5GQO A;  2NVQ H;  3P7J A;  2IY5 B;  2L15 A;  3EFX D;  5KFQ A;  1YHB A;  1YJN A;  2W8K A;  1I94 Q;  2HVQ A;  3I55 A;  2UUA Q;  3VPC A;  2JEI A;  4Y8V B;  4GN3 B;  2Z4H A;  3HKZ B;  3S1N B;  1JB3 A;  3NP8 A;  3PQI A;  4K0K Q;  1W2B A;  4G7H C;  2KEE A;  4DAY A;  1WTV A;  4MA5 A;  3KF8 B;  1VQ6 A;  1A15 A;  1I6H H;  3M4I A;  4LF9 H;  5BN5 A;  4APM A;  4K5V A;  2K5N A;  5KFT A;  3QR8 A;  2FP4 B;  1EYC A;  4X64 H;  5FKA C;  2B2T A;  1GUT A;  1ZYR D;  5IOC A;  4DN4 M;  4FF2 A;  3E9I A;  4IWX A;  2F4V Q;  4DL5 A;  2Q8R E;  5KFX A;  1TY2 A;  5GAE C;  2WB1 B;  3NHH A;  1E4E B;  3BZC A;  2R92 B;  2WP8 J;  1EFW A;  4JI8 Q;  4DR3 L;  1XPR A;  1Z6H A;  1IBK Q;  1VQ5 A;  1Y1W A;  2B39 A;  2A68 C;  3C1F A;  1I4Q A;  4DV6 Q;  1WSC A;  3K5O A;  4HMJ A;  1DOL A;  2FHT A;  1EIG A;  2AQ2 B;  2Y0S E;  1LTB D;  2A5H A;  1HUM A;  3OMC A;  5C3X A;  4A3J B;  5KFO A;  1QJO A;  5EBD A;  1C3O A;  3K81 C;  4NXN Q;  2Z0S A;  1X9N A;  3HOW H;  1Y14 B;  4UAI A;  1L0Y B;  2PNR C;  2ID0 A;  4DV1 L;  4IR1 A;  3H0G B;  1BCP B;  3PW2 A;  4KKS A;  3S9W A;  1NAP A;  4YIJ A;  5A2Q W;  4GLV B;  3K59 A;  5CAE B;  4CHT B;  1PYS B;  4KLK A;  2UUC H;  3QWN A;  1PH1 A;  5EKI A;  3PCO B;  2W8L A;  2EVB A;  3D0F A;  5DNF A;  4C3J H;  4C56 C;  5IP9 H;  4DV2 Q;  3CXC A;  1V43 A;  2VY3 A;  5CMD A;  1S72 A;  1ASY A;  1SR3 A;  4DR6 H;  3S16 H;  2R8H A;  1BKB A;  5IYD H;  1JX4 A;  3BG3 A;  4O42 A;  1KAB A;  1HH2 P;  3ERO A;  1E24 A;  3HOU G;  1WTR A;  2JA5 A;  1YHQ A;  3VPB A;  3LNN A;  4A3L G;  1Y8O B;  3NWT A;  4JI2 L;  1GKH A;  2R3Z A;  4RKL A;  5C44 B;  4DV6 L;  3P1H A;  4K5X A;  4LW1 A;  1SN8 A;  3HEJ A;  2UXD H;  3RV4 A;  1LTS D;  4AIM A;  3HOU H;  3KTM A;  3N41 B;  5KFD A;  5LA6 F;  3GDE A;  4IAJ A;  4O4I F;  3E6Z X;  2W6P A;  1SYG A;  2MQH A;  3CPW A;  1JWU D;  3M9O B;  4A75 A;  1STN A;  4LF6 H;  2XN9 C;  4HCE A;  2LKV A;  2HQL A;  3STB C;  3MFI A;  1X3F A;  4IPC A;  4NDX A;  5BN4 A;  2PBZ A;  3EQL C;  5C4X G;  5CV8 A;  3BJY A;  3MAQ A;  2IWH A;  4KI0 A;  2H1E A;  2ZXR A;  3PUW A;  1YIT A;  2DUD A;  1HQR D;  1H9R A;  4YCW A;  4BXX G;  4Y7N B;  1RHP A;  3U9T A;  2CQY A;  1K3R A;  2VR1 A;  2SNS A;  4G4K A;  2R93 B;  1VQO A;  1SMX A;  3FRP B;  3SDZ A;  5IYZ F;  2VQF H;  5DQG A;  3H4D A;  1SNM A;  3PSI A;  1VF7 A;  1NE3 A;  3UFX B;  1A3T A;  3OWF A;  5F2D A;  4X3K A;  1SMY D;  2OLS A;  2YL2 A;  3S1M H;  4LF6 Q;  3TP7 A;  4DFA A;  5ISR A;  4HJ9 A;  5FJ8 G;  2YU9 A;  3J80 L;  4JI6 Q;  3MHB A;  1VQM A;  2YRX A;  1VBH A;  1GLV A;  2E2J B;  3TRZ A;  4DV6 H;  5CA1 F;  2JE6 I;  3S15 H;  3HOV G;  3I4M B;  2OQ0 A;  2R7K A;  1PH2 A;  1F9S A;  3ND8 A;  4AQY L;  3H20 A;  1XWE A;  4O3O A;  1PFS A;  1T9H A;  2AHO B;  4H0L C;  2VS1 A;  2ASB A;  4DR6 L;  3BQ1 A;  3GTK A;  4LJZ C;  1W93 A;  5IIF A;  1ILP A;  1S9F A;  3NPP A;  5I47 A;  4DR4 H;  3GLK A;  3D4R A;  2XCA A;  4RGT A;  1QNU A;  1S03 G;  4A3C G;  3FKI H;  3T56 B;  3OW7 A;  5C4J B;  1WFQ A;  2K5V A;  1ESF A;  1PV4 A;  4IOA A;  2NZO A;  4DK1 A;  4JV0 A;  2R87 A;  3N42 B;  2TMP A;  3BZK A;  5C3E B;  1EYD A;  3K58 A;  1HR0 L;  5K2M A;  5G3L F;  1FKA H;  2ASJ A;  1SE4 A;  2EIF A;  4J0M A;  3UE1 A;  1L1O C;  3TQ1 A;  1GYF A;  3KYH C;  3NBH A;  4BBR G;  4A3G B;  2DGY A;  4HN7 A;  2J4X A;  1HNW L;  2VOB A;  4DR2 Q;  2J0T D;  2IT1 A;  5KX5 F;  1B9N A;  2NVT B;  1VQB A;  1XNQ Q;  1M8A A;  2C5C A;  4LF4 L;  3T5L A;  4DR3 H;  2MP1 A;  3CC7 A;  3HZX A;  1I4H A;  1SMY C;  3TIG A;  3RBE A;  5KFG A;  3M7N A;  4EBD A;  2KEC A;  1CI3 M;  2R7F A;  3RFC A;  3Q24 A;  3HG9 A;  4PZ8 A;  3VYR A;  2IX3 A;  2ZM6 Q;  2E2I H;  1A9X A;  4B08 A;  4LH6 A;  2IL8 A;  1KNA A;  2MFI A;  1B8A A;  3OTO H;  2AUJ D;  4UCU A;  5BN3 A;  3HOV H;  2KCC A;  2PZU A;  1SLJ A;  1IBL L;  1ZXT A;  5DGA A;  5JPM C;  3MXN B;  1X32 A;  2W6Q A;  5KT5 A;  1S4Z A;  2W57 A;  5KFL A;  4V19 0;  5EDW A;  4G3I A;  4OEL B;  2VUG A;  3BZD B;  2WKD A;  3GTG B;  1FJG Q;  4JI5 H;  5FO9 B;  3K8A A;  3GIJ A;  4A3G H;  3VR2 A;  2EXZ A;  5JJZ A;  1S97 A;  2SDF A;  1ZKO A;  4P2C B;  2FKL A;  1I50 A;  1E1O A;  4LNQ A;  3J7A 5;  4M9U A;  1Y1W G;  3J7Z C;  2WFW A;  5C4X B;  3ORR A;  2F0N A;  1GUW A;  2YS7 A;  1I3Q B;  1TWC H;  4R1J A;  4BA1 I;  2WE6 A;  1C9O A;  3G6X A;  2RQX A;  3UDX A;  4YJ3 F;  4DXF A;  2OQK A;  4LF9 L;  2DPJ A;  3Q6S A;  1ONL A;  1EY6 A;  2KCT A;  5KFY A;  3MWY W;  3CF5 A;  3K3P A;  1DXM A;  1SFO B;  3CCV A;  1QWY A;  1KD1 C;  1NSN S;  1K1Q A;  3KAK A;  2E2J H;  2O2L D;  2NVT H;  4HJA A;  1TY0 A;  5C6A A;  5C0X G;  3PO3 H;  4BY1 B;  4KHZ A;  1U4P A;  4NKL A;  4ME6 A;  2B8G A;  1X3P A;  1B9M A;  4A3M H;  3LWB A;  5C4J H;  2MPM A;  2E2H H;  1X3G A;  4DUY L;  1BCP C;  2KQ3 A;  4JI6 L;  1CQI B;  3K5I A;  4LH7 A;  4TV9 F;  5AJ3 Q;  2K03 A;  5D1O B;  3PO3 B;  5FLX c;  3G7L A;  4AH6 A;  1II3 A;  3HRZ C;  1BF4 A;  5K36 G;  3CKI B;  1G29 1;  2M05 A;  5KFF A;  4X62 L;  3PW0 A;  3S2H H;  3VDY A;  4KTA A;  5I2Y A;  5DLQ E;  1NBW A;  1FJG L;  4ZI7 F;  4JYA H;  1WTQ A;  2XTI A;  1EEF D;  2R7N A;  2JA8 H;  3GTM A;  1PZI D;  1TXY A;  5L37 A;  1DOM A;  3J81 i;  4RU9 A;  3DWA A;  4RG1 A;  1B7Y B;  4JBM A;  3BS1 A;  2JA7 A;  2JJQ A;  1RKN A;  2WDT A;  4FS1 A;  1B2T A;  2B2U C;  4O4H F;  1S5D D;  3ZYY X;  4OX9 H;  3NEN A;  2BQU A;  4CDC C;  3N43 B;  3H09 A;  2KEN A;  4DV2 L;  4DL7 A;  3GTK H;  3EA6 A;  3I56 A;  1TWG H;  3BDL A;  1HRJ A;  3P20 A;  4EQO A;  2WAQ B;  4DUY Q;  1KNE A;  1T5E A;  4DL3 A;  5CV4 A;  1OXT A;  2AUK A;  2FLP A;  2UUA H;  3PVX A;  3QOJ A;  3D3R A;  3RR5 A;  2MNA A;  1PRT D;  2CKZ B;  2Z9H A;  2UXB L;  2JA6 H;  2L4N A;  4A3I B;  1F9Q A;  1X3Q A;  2IHF A;  4BY7 G;  4JV2 A;  3J7A V;  2GPW A;  1T5X D;  4JYA L;  4KY5 A;  2XGT A;  3L2P A;  3S2D B;  2EYM A;  4CJ2 C;  2IA6 A;  4YHH Q;  4ULL A;  3Q8P B;  3E0J A;  5KFJ A;  2JA5 G;  5IT9 c;  3BU2 A;  3H91 A;  4K2L A;  2IPK D;  2HIV A;  1AEX A;  3W5O A;  2F52 A;  4PWQ A;  4C3J B;  4U68 A;  4R8U B;  4DUY H;  2Z6K C;  4RCN A;  4HJ5 A;  1PFM A;  2PW7 A;  3HXL A;  5KFE A;  1EUD B;  2PPB C;  1W3S A;  4A3I H;  1B44 D;  4A3I G;  2K6A A;  2EY2 A;  3S16 B;  4I50 F;  5C44 H;  1CTM A;  2FIN B;  1PH5 A;  3Q2O A;  1I3Q A;  1JT8 A;  2RA4 A;  1YNJ C;  1CKN B;  4NXN L;  4KMU C;  5KNC A;  5IWA L;  3TS2 A;  4BBS B;  3L4J A;  4DV1 Q;  2KA7 A;  1UNN C;  5FO7 B;  5C4Z A;  1TWA A;  2HJW A;  3X3N A;  4BA2 I;  4CKB A;  4TSS A;  1I4P A;  2ZTC A;  3A55 A;  5G3L D;  3JAM c;  4DV0 L;  4ECR A;  2EYJ A;  4DV5 H;  4YHH L;  4IUT A;  1VAJ A;  5LMN H;  1OXS C;  3GTM H;  4MNO A;  3NGD A;  2L5T A;  2R8G A;  2R8K A;  3S15 B;  2NN6 G;  3GV6 A;  2ATL A;  2PQE A;  1XNR L;  3HOW B;  1WTO A;  1N33 L;  3S14 H;  2JA5 B;  1O7Z A;  5EPL A;  2UVU A;  2CHB D;  4FF1 A;  1UE5 A;  2E75 C;  2RKS A;  5KT4 A;  3JRX A;  3I91 A;  1RJP A;  3MVV A;  1EYA A;  3KK7 A;  3RZD H;  1PH3 A;  3I4N B;  1K3B C;  2F3V A;  2PW5 A;  4JCV E;  2JEA I;  2BH2 A;  2R6G A;  1V1P B;  3BVG A;  2R84 A;  2AMC B;  1TWF H;  3J81 c;  1UE7 A;  2C2D A;  1RJQ A;  4ZKB B;  4DV5 L;  2YZN A;  2F0S A;  4X62 Q;  2ATW A;  1DJR D;  4A3F B;  4LF8 Q;  4QQB X;  1H95 A;  4P72 A;  3E5S A;  2PVP A;  3IN5 A;  2WAQ G;  5C0X I;  5KYI A;  1WCM H;  5IT9 W;  1TWG B;  1WTP A;  4B3S L;  2K52 A;  2SEB D;  1EY4 A;  1A2U A;  2ZTE A;  1D5Z C;  3ERQ A;  2XNA C;  2VW9 A;  2ZM6 L;  1ASZ A;  3N40 P;  5KG1 A;  2DY8 A;  3R23 A;  2MO0 A;  4L8J A;  4NXN H;  4BY1 H;  5JJL A;  2N49 A;  4BY1 G;  1W96 A;  1IYV A;  3ZJY C;  4L1K A;  5FOB B;  5FLX L;  1VQ4 A;  1IL2 A;  2E5L H;  4J9L A;  4IUV A;  2VA3 A;  4PMB A;  2XCP A;  3ULP A;  2SCU B;  4NLG A;  1CQF A;  3S1R H;  3DHQ A;  2B2V C;  2V4Q A;  2QA4 A;  4NMZ A;  3M4O B;  5JH7 F;  1S5B D;  1K8G A;  4TVA B;  1Z47 A;  4DAV A;  3PIP 3;  1A3V A;  1Z7T A;  2B3G A;  4HSP A;  5AJ3 L;  4KHP L;  4J6H A;  4EEQ A;  2JXM B;  2PN1 A;  4GLA C;  3BA9 A;  4YR0 A;  4ECX A;  5M5W B;  1BBX C;  5D1P A;  1N48 A;  2ZDH A;  4YR3 A;  3GQC A;  1Q82 C;  2E2I A;  4YBZ B;  3S17 H;  3MFH A;  1CFM A;  4IPD A;  2J6T A;  2R7D A;  1YEZ A;  4C3H G;  4DUZ L;  4HNV A;  4K2K A;  1XMO L;  4CDF C;  5BMV F;  1HR0 W;  4APV A;  5GAG C;  3FKI G;  4LF7 Q;  2KCM A;  3RN5 A;  4FBU A;  5JVH 3;  3E3X A;  1K28 A;  4P75 A;  4OO1 I;  2OTJ A;  1RIP A;  2F0K A;  2ASD A;  4XQJ A;  2SOB A;  1Q3L A;  1J8I A;  3GTG H;  1J9O A;  4ABN A;  1S40 A;  4OXP A;  2CCZ A;  5CV6 A;  3MR5 A;  4V0B A;  2KHI A;  5T1I A;  4G7Z C;  1U9R A;  1SEI A;  1I50 H;  1XJV A;  2A69 D;  1CUK A;  3AEV A;  5KG4 A;  2FLN A;  1I4G A;  2PMZ B;  3CHB D;  1Y1V B;  4DF7 A;  5IP7 G;  3KF6 A;  1PTO C;  5J39 A;  2RSO A;  2XWB B;  3TBI B;  3HBL A;  2QEJ C;  4A76 A;  2B8F A;  4O2D A;  1EHI A;  4CJ1 B;  5L1J A;  4LUZ A;  2E2I B;  5EGT A;  1LO5 D;  4LFA L;  5EKK A;  4BBR B;  4A3G G;  3CRK C;  1HFG A;  1Y1W B;  3OW2 A;  4RZQ A;  3EVQ A;  4R4I A;  4TUY F;  4O3R A;  3D4D A;  2E74 C;  4EQN A;  1PZJ D;  4L5Q A;  2R7Z A;  1QCB D;  2R7M A;  3RAX A;  2Q8T A;  5BR8 H;  2CH4 W;  3U50 C;  4O4L F;  5IGD A;  4EBE A;  4C5A A;  5K5P A;  1N36 H;  3TP5 A;  1I6V C;  2NWG A;  4WFN 3;  5KFV A;  4EGQ A;  5KRU A;  5C3W A;  2JA7 B;  1ET6 A;  1RK5 A;  1FR3 A;  1U0L A;  2VB2 X;  2ZDG A;  2GN5 A;  1RD9 D;  4IN3 A;  2JSO A;  2OXP A;  4GKK H;  2E2H A;  1MSG A;  1KDB A;  5J2T F;  1QB5 D;  1I5F A;  3G71 A;  2F0M A;  4PZ7 A;  1MSH A;  2OWO A;  2WKC A;  2LXK A;  5JOB A;  4LF7 L;  2QF7 A;  1Q90 A;  5DM7 3;  4JUZ A;  2K1B A;  2Q8I B;  5HGT A;  2WIN B;  5E3F A;  2W9C B;  4UY8 C;  3NTH A;  1BXR A;  3V6K A;  1EOT A;  3WOF A;  1CHP D;  4AYB E;  2WAC A;  5CBE E;  4I4T F;  3WWV A;  1K0S A;  4NXM L;  4DV7 H;  1TAE A;  1BCP F;  2UXD Q;  2WAQ A;  1BXT A;  5EPJ A;  2V1C C;  1V1O A;  4DV5 Q;  3HOX G;  3KDF B;  4MHE A;  3PUY A;  2K5H A;  3ETH A;  4DL6 A;  4RAU C;  5C3E G;  2HVR A;  3QIA A;  5FLM G;  1YBY A;  4U67 3;  2LXJ A;  3FEW X;  4AYB B;  3RUP A;  1LAC A;  2K04 A;  3O13 A;  3W3A A;  5C1P A;  4C5C A;  1NMF A;  1PRT B;  3UDF A;  2HHH Q;  2W9A A;  2DJG C;  2QEX A;  4FO2 A;  5KT2 A;  1K83 A;  5IYD G;  1C8C A;  2JA7 G;  1IBM Q;  3WDN A;  4HID A;  1KLG D;  3HGB A;  4DR4 Q;  3KJO A;  4DL2 A;  1NR2 A;  2J7Z A;  3Q8D A;  1UWV A;  3OPO A;  2FPP B;  1F9P A;  1PDQ A;  5J1Z A;  3I72 A;  5CA0 F;  3HOY G;  5EQ0 A;  5JUM A;  1EY0 A;  1IBL H;  4C2M B;  1V51 A;  4KY7 A;  3QG1 A;  1PA6 A;  4QY7 A;  3GV3 A;  2UUC Q;  1ULZ A;  1O80 A;  1BNZ A;  3M85 A;  3T13 A;  3EBE A;  4QWC A;  2B29 A;  2B63 B;  1WYD A;  3GO5 A;  4R8I A;  4EFE A;  3N44 B;  2LSS A;  4HTH A;  1STE A;  1XNQ H;  4NXM Q;  5KFP A;  1I4X A;  2L11 A;  2EXD A;  4OIJ A;  2PCF B;  3V05 A;  1Q8I A;  3GD7 A;  1LTG D;  1HNW H;  4ED8 A;  1SYC A;  4MN3 A;  2VUM A;  3MFG A;  5DAU A;  2MUY A;  4OX9 Q;  3HOU B;  2AQ4 A;  4ECV A;  2IBK A;  2PZW A;  1HR0 H;  1F2L A;  4DKA C;  1ZHS A;  2NZH A;  5HGQ A;  4N9P A;  3Q8Q B;  3M9B A;  1HQM C;  4OGQ C;  1YZ6 A;  1ML0 D;  2L9H A;  3K80 C;  4MTE A;  3KBG A;  4OWW B;  1PYB A;  1E3P A;  4B9W A;  1Q86 C;  2KHS A;  4O2A F;  3A5Z B;  4OWT B;  4Y52 H;  4LUV A;  1N33 Q;  3FDT A;  2UU9 L;  3T1Y H;  5M5Y B;  1BCP D;  2N8N A;  3NSW A;  1LLR D;  4JI1 Q;  2LS0 1;  3U58 A;  1JQY D;  3WO0 A;  4JPB W;  5C8Y F;  4DR4 L;  1ZHQ A;  1TII D;  2RF4 A;  3PIO 3;  1JB7 A;  4YWK A;  5FPR A;  4PV1 C;  3LWE A;  1ENC A;  4AQY H;  4BBS H;  1N32 Q;  4IJL A;  3KXY T;  1EZ1 A;  4JOI A;  2Z6B A;  2F3W A;  1HNW Q;  3HP3 A;  1G6Z A;  3I4L A;  3QZ7 A;  5FLX E;  2JA7 H;  2F0H A;  2XGP A;  1HXY D;  1O7Y A;  3K0Y A;  4DAP A;  2PQA B;  1V9P A;  1EQV A;  2CH4 A;  2CW0 D;  4DGZ A;  4JBK A;  1DON A;  4MV8 A;  3K0X A;  1M90 C;  1HA6 A;  4ZQ3 A;  5KT6 A;  5FK9 C;  3TP6 A;  3UQ8 A;  3TIN A;  5F9N A;  1S5C D;  3A74 A;  3K7A H;  2P5Z X;  5F9L A;  1CT1 D;  4IUQ A;  2OCE A;  4QWE A;  5IGF A;  4DR5 Q;  4GLX A;  3BDO A;  2EQS A;  2NN6 H;  4IZ8 A;  5LMU L;  1HNX Q;  2NVX A;  4UP7 A;  2W7P A;  3CCE A;  4JV5 Q;  3H15 A;  1UUP A;  5HUR A;  5CB4 F;  4C1N K;  2JA8 B;  1VQ9 A;  4XZ3 B;  4M8A A;  4KD4 A;  2F0Q A;  4TRD A;  1K0R A;  4GS3 A;  3HOY B;  3OMG A;  3MR2 A;  4IUR A;  4HED A;  3HOZ G;  1XDN A;  4DV4 H;  4DV3 H;  5JJK A;  3HOW G;  4QW8 A;  5L1L A;  4B3M H;  5JVD F;  1XMO H;  1TS2 A;  4J9S A;  3T1H L;  1TWA B;  4PG3 A;  2A6H C;  1QG7 A;  3GTJ H;  1AW7 A;  2ZTD A;  4X64 Q;  3EPG A;  1DGS A;  2Y0S G;  4QIW E;  4GNX A;  1TA8 A;  1GVP A;  1PRT F;  4BBS G;  5CV7 A;  4IHJ F;  3F2U A;  3PW5 A;  1HZB A;  1WJJ A;  1G2T A;  1JXL A;  2LMC B;  4IPH A;  4K5W A;  3NK9 A;  2FK2 A;  3GIL A;  3OUZ A;  3ITP A;  1I6H B;  4EYI B;  2NVQ B;  4JC0 A;  1STY A;  4Q45 A;  2IP4 A;  3TZD A;  2V4D A;  5HBR B;  3ONA B;  1HR0 Q;  4FXG C;  2HIX A;  3TS0 A;  4DV3 Q;  1MZB A;  1OO9 B;  5D14 A;  4H7B A;  3OSO A;  4R7R A;  1BJT A;  2DJF C;  2ZJT A;  1KDC A;  2ZM6 H;  3TN2 A;  1SRO A;  2V9W A;  3D4W A;  1GHJ A;  4M1U B;  1BBU A;  3MR3 A;  1L1O B;  4LF4 Q;  2HD3 A;  2LY7 A;  1BR9 A;  4JV5 L;  3EYY A;  2ZXO A;  2XCL A;  2UUC L;  3RLO A;  2A19 A;  3BA8 A;  3IAY A;  5LXT F;  1I94 L;  4JI0 H;  2FMM A;  2VXW A;  2E76 C;  1TR5 A;  1MI2 A;  1VF5 C;  1BUV T;  3A8I E;  1UE6 A;  1VQF A;  5C4X H;  3RBD A;  1JOR A;  3L9A X;  3CQZ A;  1KJQ A;  1CQV A;  2A8V A;  3PZP A;  2CWP A;  4E6I A;  4RB2 C;  4FVM A;  4CDE C;  3CW2 C;  1X65 A;  3H94 A;  2K5W A;  5KFA A;  3RZD B;  2UU9 Q;  3SK8 A;  1KL9 A;  2X6L A;  1GGO A;  4HAE A;  4LWC A;  2I07 B;  4ED1 A;  4M7E A;  1EIH A;  4AYB A;  4JBJ A;  1JIC A;  5M9O A;  3S24 A;  4BXX H;  1VQH A;  1CSP A;  2FJ2 A;  2R7Z G;  2FXQ A;  4DU9 A;  1X6O A;  1IYJ B;  3DUZ A;  3KDF A;  3OSP A;  1K1S A;  1N56 A;  3F2B A;  4C3I G;  4DR5 H;  5C4H A;  1YHA A;  1O7I A;  3ULL A;  2R85 A;  4JW0 A;  3M3Y B;  5L1I A;  5CYU A;  3T1Y Q;  3RLF A;  3UDI A;  3C3L A;  2KJX A;  1H9M A;  1K73 C;  1EYZ A;  1TKW B;  1PMR A;  1M6V A;  4DR2 H;  3S17 B;  4ME5 A;  1E0B A;  2B2Y C;  4A3C H;  3KOJ A;  1PFN A;  3FKI B;  1XNR H;  4QL5 A;  1E1T A;  1HA5 A;  2J9G A;  3BAB A;  1W6J A;  5LMN L;  3JSN A;  2RSN A;  4IRK A;  1U4M A;  1VQP A;  1LTL A;  4A3L H;  4IFD J;  5EKL A;  2MJ8 A;  2KHJ A;  1BVS A;  4JG2 A;  4NP5 A;  4B9X A;  3G4S A;  3Q1K A;  1P8L A;  3NUC A;  5DQI A;  1RDP D;  3VA5 A;  1EQQ A;  1QNK A;  4I65 A;  3OTO Q;  3BAA A;  5DGB A;  2CFM A;  5BR8 Q;  1HHV A;  2CW8 A;  2EJM A;  4NPS A;  4J8Q A;  3T53 B;  5CR3 A;  3F8N A;  5KG2 A;  2AKW B;  2IX1 A;  3KHH A;  3UI2 A;  3BYY B;  2F0L A;  3LWU A;  3VR4 A;  2ZT9 C;  2W6N A;  1SRU A;  3TZU A;  1JOQ A;  4HMI A;  4MTK A;  4YY3 L;  2F4I A;  3SEB A;  3NXW A;  4L5T A;  4QUF A;  3QFF A;  3SE7 A;  3OSN A;  1NJI C;  2JN4 A;  1R9T H;  3J81 W;  4RNM A;  5IY0 A;  2C9O A;  2EYP A;  2MHV A;  3G48 A;  3LML A;  1SAP A;  4N8F A;  1A3U A;  4RGO S;  3A8K E;  1LT6 D;  3URY A;  4RH6 A;  2OT2 A;  5DG9 A;  2RCF A;  1XMQ Q;  3RGZ A;  3RB3 A;  1TU2 B;  1LV9 A;  2IX0 A;  2D2C C;  2CQA A;  2RGR A;  1IKL A;  5IGB A;  4B3T Q;  2F4V L;  1B04 A;  4KKT A;  2WB1 A;  1K83 B;  4YB8 B;  2R92 A;  1RTO A;  2YU9 H;  4WJ3 M;  1LUZ A;  2EOT A;  5IP7 H;  4X65 L;  1EL0 A;  1RK6 A;  3Q8R B;  1E2Z A;  2PMZ A;  2NVX B;  3ETJ A;  1EQR A;  4A93 B;  3M9N B;  2K50 A;  4X65 H;  1T36 A;  5DLF A;  2C2R A;  2JQO A;  3ER0 A;  3I90 A;  2R61 A;  2F0I A;  3FPP A;  3OYY A;  3T5J A;  4Q8F A;  2CWA A;  4MV1 A;  2BE5 D;  3DWQ A;  3LP8 A;  1VBG A;  1HZC A;  2XVS A;  1XMO Q;  4LF5 L;  2RDJ A;  2SNM A;  2NVY A;  2HCI A;  4X66 H;  4KKU A;  1M1K C;  3VYT A;  1ZQ7 A;  3J80 c;  3CRL C;  1KIX A;  1SFO A;  3SR1 A;  2OEO A;  3H4B A;  3KLR A;  2XRS D;  1HNZ Q;  4A3K G;  4YY3 H;  1IW7 C;  4R4Q A;  4KV6 A;  2FFK B;  5JVL A;  3NBI A;  3J7Y W;  3AB9 A;  4JYA Q;  1OTC A;  2V59 A;  4R4T A;  2FPI B;  4A3E G;  1NUC A;  5C0X H;  3RB0 A;  2DPI A;  5COR A;  2KED A;  3SE0 A;  4A3K H;  1KLU D;  1IHZ A;  4DK0 A;  4HIM A;  1FJG H;  1B6S A;  2FMA A;  5EZY F;  5D3D A;  1EQT A;  2K75 A;  1EY8 A;  4YQW A;  1F2M A;  4FF3 A;  5C5J A;  4YAJ B;  3PR4 A;  3PUX A;  2ZJR A;  5KFB A;  4QW9 A;  1L2Z A;  1QZH A;  2JP1 A;  4ZAI A;  1VQI A;  4MV7 A;  2K5Q A;  4O3N A;  2C35 B;  5BPF A;  1EOV A;  1X56 A;  3RNU A;  2AWN A;  4X66 Q;  1A62 A;  1AZP A;  5D3I B;  1RTN A;  1VS0 A;  2QK4 A;  1AZQ A;  1VQC A;  4UCV A;  4DR2 L;  3MC0 B;  1DCZ A;  2D62 A;  1S0M A;  5KFZ A;  4JI5 L;  4EQ5 A;  2I8C A;  3NQT A;  5KFU A;  5GRO A;  3K57 A;  1A63 A;  4X3S A;  2JA8 G;  3KBX A;  1L0X B;  5ELC A;  4CBV A;  4OON A;  1KJ8 A;  4K6D A;  4S3S A;  1JJG A;  1WTW A;  2F0J A;  1Q1E A;  4MIU A;  4HIO A;  1FNU A;  4WRD A;  4GC7 A;  4YWL A;  2B2Y A;  3TSS A;  3OTO L;  2RDG A;  4FDB A;  2D0P A;  3STB D;  4YAK B;  3J7A K;  3QZ8 A;  1FGB D;  1Z2N X;  1C4Q A;  4B3R L;  3FVQ A;  5I9O A;  1EWI A;  2I87 A;  1UC9 A;  3JAM L;  1NNX A;  1F9R A;  4RB0 A;  1MIU A;  1GUG A;  2Z4I A;  3GTO H;  1X3E A;  3NQI A;  2R82 A;  1XMQ H;  2R93 G;  4UPA A;  2QGQ A;  1DV2 A;  1SCU B;  4YR2 A;  1BNC A;  2CW0 C;  5CV9 A;  4X6A H;  2GPS A;  1N8R C;  2EYL A;  3GID A;  2JA6 B;  3J80 W;  4ED0 A;  3PIP A;  3C1E A;  4IQZ A;  2Y0S A;  3OUU A;  1UEB A;  2W7O A;  2NN6 I;  1FNV A;  4IUN A;  4J9N A;  1ZET A;  3VMM A;  1C30 A;  4A3J H;  2HCC A;  1SEB D;  3D6W A;  3J80 i;  4ED6 A;  2DN8 A;  4RWS C;  2YCH A;  2G9D A;  3WO1 A;  1D6E C;  4RGM A;  4JI0 L;  3KAJ A;  1I94 H;  1CZG A;  5D65 A;  4MV4 A;  5ELN A;  1STB A;  3N8D A;  1MJE A;  2FLL A;  4JV5 H;  4DPG A;  3KF8 A;  1G8Z D;  2Z1C A;  5J3B A;  3PW4 A;  4JI7 Q;  1MD2 D;  2AQ1 B;  3K7U C;  2PYK A;  2NU6 B;  1WD0 A;  5IT9 L;  1VDZ A;  3JZI A;  1D1I A;  5IP9 G;  1KAA A;  4JI3 Q;  3R5X A;  4OIK A;  4LF4 H;  1LT4 D;  4JBW A;  4CDD C;  1YI2 A;  2L1B A;  1HUN A;  1FGU A;  5LHY 1;  3IL8 A;  1Z9F A;  4ZRZ A;  1QZG A;  1XPU A;  2UVV A;  1M4V A;  2EZV A;  4YY3 Q;  2R6F A;  4IJH A;  1SDF A;  4PMW A;  4IUU A;  1VQE A;  1KXL A;  4F87 A;  4B3T L;  1ZEQ X;  2K7V A;  5JPN C;  1Q46 A;  3J80 E;  1JMC A;  1G91 A;  4NXM H;  2F03 A;  5KFC A;  1LYL A;  2ES2 A;  1OXX K;  3G6J B;  4ZUJ A;  4QB4 A;  4QWA A;  3GIQ A;  1CS0 A;  1R9T B;  2RHQ B;  4BS9 A;  1CKN A;  3PW7 A;  3CCJ A;  2AGO A;  4HNT A;  3F2C A;  1KDA A;  5GAD C;  4ECW A;  1HCZ A;  5LL6 S;  4ED7 A;  4JOI C;  1B50 A;  4ED2 A;  1ZYR C;  1QE6 A;  4JK1 C;  3OHB A;  3DMU A;  5LYJ F;  1I3Q H;  1TWC B;  2VQF L;  2E2D C;  3GTM B;  3H0G G;  5FD6 A;  4Q43 A;  3L4K A;  3K5L A;  2HT1 A;  5DM6 3;  1NY4 A;  1M7J A;  2YTV A;  1VKZ A;  5BR8 L;  4LFA Q;  4BBR H;  4Q8E A;  4MV9 A;  2BOS A;  4OEM B;  2R93 H;  2Z8L A;  3OIQ A;  1S10 A;  2C22 A;  1JE5 A;  4JI1 L;  5M3M H;  1WTX A;  1YNN C;  2E8G A;  3RAQ A;  5CV5 A;  5E4W C;  5IYC G;  4ECT A;  3T5K A;  3K5N A;  4GKK Q;  2WV6 D;  1W6K A;  4A3D H;  5A2Q L;  1GXD C;  1DM0 B;  4QWD A;  3ND9 A;  1IBK L;  4A2A A;  1AP0 A;  1SND A;  2CZG A;  1PH8 A;  4GC6 A;  1IBK H;  1J5E H;  3RJ0 A;  1SNC A;  4GN5 A;  4H13 C;  1KC8 C;  4IFD H;  2VPQ A;  1QVC A;  2IMW P;  1JKJ B;  5KFI A;  2R86 A;  3G6Y A;  5NUC A;  2R8I A;  2RVL A;  3M3Y H;  4DV7 Q;  5M5Y H;  4UCT A;  1Y1W H;  3RUZ A;  2R7L A;  4O3S A;  1OXU A;  3GP7 A;  4ID6 A;  2WAQ E;  2XD4 A;  4QF4 A;  1H9K A;  4XQN A;  2EE1 A;  3RLN A;  3KJP A;  2ICI A;  2PI2 E;  3L3O C;  4GNX B;  4CKC A;  5H80 A;  2L0C A;  4L6T B;  3GIK A;  3R93 A;  1EWH A;  1YJ9 A;  3V6H A;  1P16 A;  4EG0 A;  1AE3 A;  3AMU A;  1IOV A;  3JRW A;  1STH A;  3KHG A;  2W6Z A;  3TII A;  1JC7 A;  1KAW A;  4PDB A;  4DV4 Q;  4DR6 Q;  2BH8 A;  4GOP A;  3FMC A;  4FYD A;  4ECS A;  5HY6 A;  5KFR A;  4GKJ Q;  3GV5 B;  4XIG S;  2EPB A;  2AGQ A;  4ED3 A;  1VCI A;  3OOC A;  4WOR A;  2UXD L;  2V58 A;  5KFW A;  1UC8 A;  4A3E B;  2XWJ B;  2E5L Q;  4OO1 G;  4JI2 H;  2HUG A;  1JOO A;  4B3T H;  3CCS A;  1TT2 A;  3M4O H;  1PH6 A;  5KYL A;  4EX5 A;  1B6R A;  3CMA A;  5KND A;  2FPG B;  3IFT A;  3AYH B;  1IOW A;  3ORQ A;  1N36 Q;  1VQA A;  3W1B A;  3VA7 A;  2R8J A;  2ENB A;  1XPO A;  1CK1 A;  4POG A;  4IFD I;  4F4Y A;  5M5X B;  1XMQ L;  1PK8 A;  4B3S H; 
#chains in the Genus database with same CATH homology
 3A74 A;  2R7F A;  3K7A H;  4PZ8 A;  2E2I H;  2ZM6 Q;  1PH7 A;  2OCE A;  2YTX A;  4DR5 Q;  4GLX A;  2MFI A;  2EQS A;  5LMU L;  1HNX Q;  2Q2U A;  1B8A A;  2B63 G;  4UP7 A;  2NVY H;  1QVG A;  3CCE A;  4JV5 Q;  3H15 A;  1L0W A;  5GAH C;  3HOV H;  1SLJ A;  1IBL L;  3HKZ G;  1SFO H;  1VQ9 A;  3MXN B;  1VQK A;  5M5X H;  1K0R A;  1Q8K A;  4GS3 A;  3BJU A;  4IPG A;  1BBW A;  5IYB G;  4L5S A;  1V1Q A;  4IFD G;  2JA5 H;  4JI4 L;  1FJG Q;  3HOZ G;  3I7F A;  3K8A A;  3HOZ H;  4A3G H;  4A3J G;  5JJK A;  4Y7N H;  1S3O A;  3HOW G;  5C0X J;  2N78 A;  2JA6 G;  3CP0 A;  3T1H L;  1E1O A;  4PG3 A;  4LNQ A;  3J7A 5;  1IXR A;  3J7Z C;  1Y1W G;  1NTG A;  2WFW A;  2AWO A;  4LF6 L;  2VUM G;  3AQQ A;  3GTJ H;  3B6Y A;  2ZTD A;  4X64 Q;  3ULJ A;  1TWC H;  4R1J A;  1DGS A;  2Y0S G;  4QIW E;  3I4N H;  4DNI A;  4GNX A;  4BA1 I;  1C9O A;  1GVP A;  4BBS G;  1HNZ L;  3UDX A;  4DV0 Q;  1Y1V G;  2OQK A;  4LF9 L;  1HZB A;  1WJJ A;  3CCL A;  2KCT A;  4IPH A;  3CF5 A;  4AYB G;  2Q2H A;  2D0O A;  3NEL A;  4MTN A;  4TQU S;  3CCV A;  2ZJQ A;  5M3F G;  1KD1 C;  4IO9 A;  2VQE L;  4JC0 A;  2E2J H;  1L1O A;  4HJA A;  2NVT H;  1D7Q A;  5C0X G;  4UP8 A;  3PO3 H;  1EIY B;  4H02 A;  4KHZ A;  2PI2 A;  3NEM A;  1HR0 Q;  2E5L L;  2HIX A;  4L5R C;  3TS0 A;  4DV3 Q;  4A3M H;  3JC6 6;  3U4V A;  5C4J H;  3TEH B;  2E2H H;  3PF4 A;  1N9W A;  1X3G A;  1SRO A;  4DUY L;  3PUZ A;  4UP9 A;  1BBU A;  4GOP C;  1L1O B;  4LF4 Q;  4JI6 L;  1NMG A;  1JJC B;  4JI0 Q;  4JV5 L;  3NBH B;  5AJ3 Q;  4A4I A;  2UUC L;  4GKK L;  3RLO A;  2A19 A;  4R4O A;  1HZA A;  5FLX c;  4AH6 A;  1I94 L;  4POF A;  4LF8 L;  1N32 L;  3S2D H;  5K36 G;  1G29 1;  1VQ8 A;  4X62 L;  3S2H H;  3VDY A;  2B63 H;  1UE6 A;  1VQF A;  1CSQ A;  1TWH H;  5DLQ E;  5C4X H;  1NBW A;  4JI4 Q;  1FJG L;  4A93 G;  1PVO A;  3AFP A;  2F3I A;  1XNR Q;  2A8V A;  2CWP A;  1Q12 A;  2VZA A;  2MO1 A;  2XTI A;  1PH9 A;  3J81 j;  4GN4 B;  1MKH A;  4IOC A;  1TXY A;  3CW2 C;  1X65 A;  3J81 i;  4LF9 Q;  2JA8 H;  2UU9 Q;  4RG1 A;  1B7Y B;  1KL9 A;  3G6E A;  4JBM A;  2JJQ A;  4LWC A;  5IYC H;  3SGI A;  1OXV A;  4X65 Q;  3JAM i;  5LMU Q;  4YCV A;  1HNX L;  1N34 Q;  2UXC Q;  3NEN A;  4JBJ A;  4LFB L;  4BXX H;  3S24 A;  2R92 G;  2KEN A;  4DV2 L;  1VQH A;  4DR1 L;  5FJ8 H;  3GTK H;  1CSP A;  3T1H Q;  2R7Z G;  3I56 A;  2FXQ A;  1TWG H;  1X6O A;  1IYJ B;  3KDF A;  4DUY Q;  2JK8 A;  1OXT A;  1J6Q A;  3GTP H;  3F2B A;  3HOY H;  4OX9 L;  1HZ9 A;  1YHA A;  1O7I A;  1Y1V H;  3RR5 A;  2MNA A;  2NVX H;  3ULL A;  2CKZ B;  2UXB L;  2JA6 H;  3M4P A;  1E22 A;  2ALY B;  3I4N G;  3T1Y Q;  3RLF A;  2IHF A;  3UDI A;  2YYZ A;  1QUQ B;  1GM5 A;  4A3M G;  2HHH L;  1FVI A;  1PHJ A;  4BY7 G;  1K83 H;  4YWM A;  1K73 C;  5JEA J;  3FP9 A;  4JYA L;  2UXB Q;  2XGT A;  3L2P A;  2A1A A;  4DAY B;  4P71 A;  2YV5 A;  5LMN Q;  4YHH Q;  3KOJ A;  4A3C H;  3PO2 G;  4QL5 A;  5M3F H;  4BY7 H;  3E9H A;  1E1T A;  2JA5 G;  4JI7 L;  5IT9 c;  5LMN L;  1MJC A;  4XTC S;  3CAM A;  1VQP A;  1LTL A;  1CKM A;  3BU2 A;  4B3S Q;  4A3L H;  4IFD J;  2HIV A;  3W5O A;  2KHJ A;  1BVS A;  3I4O A;  4JG2 A;  2F52 A;  4GNX C;  5ELO A;  4LUO A;  3RZO H;  3HFZ B;  3G4S A;  1P8L A;  4LFB Q;  1J5E Q;  1GD7 A;  1KRS A;  2Z6K C;  1N34 L;  2I5H A;  1EQQ A;  3OTO Q;  2IHE A;  2Q2T A;  4PZ6 A;  4HJ5 A;  2CFM A;  5BR8 Q;  3PUV A;  2GVA A;  5M5W H;  1D8L A;  4NPS A;  2YTY A;  1K8A C;  1B70 B;  3CCU A;  4GOP B;  4YCU A;  4A3E H;  2N3S A;  1W3S A;  2AKW B;  4A3I H;  2IX1 A;  4A3I G;  3DLL A;  2BA1 A;  1EIF A;  1SRU A;  5C44 H;  5EAY A;  1PH5 A;  2UXC L;  3UDG A;  1C0A A;  1JT8 A;  3A0J A;  1KHI A;  4YY3 L;  1CKN B;  4NXN L;  3E0E A;  3L7Z C;  4L5T A;  5IWA L;  2JA9 A;  3TS2 A;  1NJI C;  4DV1 Q;  4DR5 L;  1R9T H;  1QVF A;  5IY0 A;  4AQY Q;  3G48 A;  1YJW A;  4X66 L;  4BA2 I;  1G51 A;  2ZTC A;  1FL0 A;  3JAM c;  4DV0 L;  1XMQ Q;  2UUB Q;  1TWA H;  4YHH L;  2R7Z H;  2IX0 A;  1OXS C;  3GTM H;  4MNO A;  4A3F G;  2NN6 G;  1XNR L;  4B3T Q;  2F4V L;  1N33 L;  3S14 H;  4B3R Q;  1E7Z A;  4JI3 L;  5IE8 A;  5JJI A;  4B3M L;  1VQ7 A;  2YU9 H;  4WJ3 M;  1LUZ A;  5IP7 H;  4X65 L;  1UE5 A;  3F1Z A;  3AFQ A;  4B3M Q;  3HKS A;  1EQR A;  1KRT A;  2K50 A;  2VUM H;  3LGJ A;  1SE8 A;  4J15 A;  2JQO A;  3ER0 A;  1Q81 C;  3RZD H;  4O0A A;  1PH3 A;  3OYY A;  4NB3 A;  2JEA I;  4JCV E;  3H3V H;  3PO3 G;  2BH2 A;  2R6G A;  3CQZ H;  2CWA A;  1X54 A;  2AMC B;  1TWF H;  3J81 c;  1UE7 A;  5IYB H;  4DV5 L;  5M3M G;  4X62 Q;  1HZC A;  2ATW A;  1XMO Q;  4C2M H;  4LF5 L;  2I5L X;  3H0G H;  2JEB I;  4LF8 Q;  4P72 A;  4A3B G;  4QQB X;  1H95 A;  2WAQ G;  2PNH A;  5C0X I;  3F8T A;  1WCM H;  3L0O A;  4C3I H;  1M1K C;  1WCM G;  4B3S L;  2K52 A;  2ZTE A;  3J80 c;  1ASZ A;  2ZM6 L;  2VW9 A;  1KIX A;  4QGU A;  2MO0 A;  4BY1 H;  1HNZ Q;  2N49 A;  4A3K G;  4BY1 G;  5JJL A;  3ZJY C;  2VQF Q;  4R4Q A;  1VQ4 A;  1IL2 A;  2RHS B;  1Q7Y C;  2PMZ E;  4MZ9 A;  3ULP A;  4JYA Q;  2ZJP A;  4JI8 L;  4DK6 C;  4R4T A;  1OTC A;  4DK3 C;  3S1R H;  4A3E G;  3UE0 A;  2QA4 A;  1VQL A;  4A3K H;  2PQA A;  4HIM A;  1K8G A;  1IBL Q;  3EN2 A;  1IZ6 A;  1WI5 A;  4TVA B;  1Z47 A;  2K4K A;  1Q1B A;  2K75 A;  2B3G A;  5AJ3 L;  3PUX A;  1C7Y A;  3CD6 A;  4KHP L;  1EUJ A;  2ZJR A;  1L2F A;  4GLA C;  5LMN W;  2GVB A;  1QZH A;  1VQI A;  2C35 B;  2K14 A;  1EOV A;  1X56 A;  3RNU A;  4GKJ L;  1GO3 E;  2AWN A;  1Q82 C;  1AH9 A;  1HJP A;  3GTL H;  3S17 H;  4X66 Q;  1A62 A;  3ERS X;  4IPD A;  3RN2 A;  3GTQ H;  1UE1 A;  1VS0 A;  3KLW A;  1YVC A;  2R7D A;  3HKZ E;  1YEZ A;  4DUZ L;  3I4M H;  1XMO L;  3I4M G;  1VQC A;  4DR2 L;  1HR0 W;  4APV A;  5GQO A;  5GAG C;  5C3E H;  3FKI G;  2NVQ H;  1LM0 A;  4LF7 Q;  2IY5 B;  2KCM A;  2L15 A;  3RN5 A;  2D62 A;  1YHB A;  4JI5 L;  1YJN A;  4EQ5 A;  4P75 A;  1I94 Q;  4OO1 I;  3I55 A;  3HOX H;  2UUA Q;  2OTJ A;  1RIP A;  4GN3 B;  5GRO A;  1A63 A;  2JA8 G;  4OON A;  4K0K Q;  3GTG H;  1W2B A;  1S40 A;  4OXP A;  3EIV A;  2CCZ A;  3KF8 B;  1JJG A;  1VQ6 A;  4A93 H;  1Q1E A;  4HIO A;  3S1N H;  1I6H H;  4A3F H;  2UUA L;  2K5N A;  3F2D A;  4YWL A;  2KHI A;  3OTO L;  4FDB A;  2D0P A;  1I50 H;  1XJV A;  3STB D;  4A3D G;  1CUK A;  1JJ2 A;  3AEV A;  4B3R L;  1J5E L;  1EWI A;  1RL2 A;  5FLM H;  5IP7 G;  3E9I A;  1MIU A;  3KF6 A;  3IRB A;  2F4V Q;  1X3E A;  3GTO H;  2KBN A;  2VQE Q;  5GAE C;  2R93 G;  4A76 A;  3S1Q H;  4O2D A;  4UPA A;  3PF5 A;  2QGQ A;  3BZC A;  2WP8 J;  1EFW A;  2RCN A;  4LUZ A;  4JI8 Q;  3PIO A;  4DR3 L;  1XPR A;  1IBK Q;  1VQ5 A;  4LFA L;  4DV6 Q;  4LFC Q;  4A3G G;  3OW2 A;  4X6A H;  4R4I A;  4DV3 L;  4DV4 L;  1N8R C;  3PIP A;  2Y0S E;  1UEB A;  2NN6 I;  4L5Q A;  3K81 C;  4NXN Q;  1YIJ A;  2Z0S A;  1X9N A;  3HOW H;  1Y14 B;  3U50 C;  4A3J H;  3A5U A;  2ID0 A;  4DV1 L;  2H5X A;  1WOC A;  3J80 i;  4ALP A;  1U0L A;  4JI0 L;  3TRE A;  3PO2 H;  2GN5 A;  3DM3 A;  4GLV B;  1PYS B;  5ELN A;  4KLK A;  2Z6K A;  1MJE A;  1PH1 A;  4DPG A;  3G71 A;  1I5F A;  3PCO B;  5J3B A;  4JI7 Q;  3K7U C;  1VQJ A;  4PZ7 A;  1EYG A;  2OWO A;  3D0F A;  2LXK A;  4C3J H;  5IP9 H;  4DV2 Q;  4DR1 Q;  5IP9 G;  3CXC A;  4JI3 Q;  4LF7 L;  3H3V I;  1A8V A;  1V43 A;  3TQY A;  2VY3 A;  5JEA G;  1S72 A;  4JBW A;  1ASY A;  1SR3 A;  1YI2 A;  3S16 H;  1BKB A;  1FGU A;  4UY8 C;  1QZG A;  1Z9F A;  1XPU A;  5IYD H;  1HH2 P;  4AYB E;  1E24 A;  3HOU G;  3WWV A;  4YY3 Q;  4IJH A;  4NXM L;  4PMW A;  3PGZ A;  1YHQ A;  1VQE A;  4DUZ Q;  1KXL A;  4B3T L;  4A3L G;  2UXD Q;  1G6P A;  4JI2 L;  1GKH A;  2V1C C;  1Q46 A;  1K9M C;  1JMC A;  4DV5 Q;  3HOX G;  3KDF B;  3I2Z A;  3PV0 A;  4LFC L;  4DV6 L;  4LW1 A;  1SN8 A;  2K5H A;  3PUY A;  4ME3 A;  4AIM A;  3HOU H;  1LYL A;  2ES2 A;  1OXX K;  5C3E G;  2Q2I A;  5FLM G;  1YBY A;  2LXJ A;  2CQO A;  3GDE A;  2RHQ B;  1XNQ L;  1CKN A;  5IWA Q;  3CCJ A;  3CCR A;  3F2C A;  2MQH A;  5GAD C;  1NMF A;  3UDF A;  4JOI C;  3CPW A;  3T1Y L;  2HHH Q;  2QEX A;  4A75 A;  5IYD G;  3W1G A;  2JA7 G;  1IBM Q;  1I3Q H;  2HQL A;  3STB C;  2VQF L;  1X3F A;  3H0G G;  4IPC A;  4HID A;  4A3B H;  3MEF A;  5C4X G;  4DR4 Q;  3KJO A;  2HT1 A;  1NY4 A;  3Q8D A;  1UWV A;  4KI0 A;  2YTV A;  1VQD A;  5H1S E;  1IBM L;  5BR8 L;  4LFA Q;  5E7N A;  1YNX A;  4BBR H;  3PUW A;  1YIT A;  2DUD A;  4YCW A;  4BXX G;  2R93 H;  3FHW A;  3HOY G;  1JE5 A;  4JI1 L;  5M3M H;  1K3R A;  2E8G A;  5IYC G;  1PA6 A;  4LF5 Q;  1VQO A;  1SMX A;  4QY7 A;  3KFU A;  2UUC Q;  4GKK Q;  1U5K A;  4A3D H;  4DR7 L;  4JI2 Q;  3M85 A;  1PH4 A;  2OTL A;  4DR3 Q;  4P74 A;  3EBE A;  1IBK L;  1VQN A;  2R92 H;  3PSI A;  2B29 A;  1WYD A;  3GO5 A;  2I0Q A;  2LSS A;  4DAM A;  1NE3 A;  1PH8 A;  2I5M X;  1AE2 A;  1VQG A;  4GN5 A;  1KC8 C;  4WJ4 A;  1QUQ A;  4X64 L;  3S1M H;  1QVC A;  2VL6 A;  4LF6 Q;  4NXM Q;  4HJ9 A;  2EXD A;  5FJ8 G;  4JI6 Q;  1XTD A;  4RMF A;  1VQM A;  3D31 A;  3M3Y H;  4DV7 Q;  3CC2 A;  4HIK A;  5M5Y H;  3GD7 A;  1Y1W H;  3TRZ A;  3U4Z A;  3CCM A;  1OXU A;  4C3H H;  2JE6 I;  4OX9 Q;  4QJF A;  2WAQ E;  3S15 H;  3HOV G;  3CCQ A;  3RLN A;  1A0I A;  3KJP A;  2OQ0 A;  1PH2 A;  4DKA C;  2PI2 E;  4GNX B;  2NZH A;  3KF6 B;  4AQY L;  5HGQ A;  2UUB L;  3M9B A;  1YZ6 A;  4JI5 Q;  1PFS A;  1T9H A;  2AHO B;  2VS1 A;  3K80 C;  2ASB A;  4DR6 L;  4OWW B;  1PYB A;  1E3P A;  4HJ8 A;  1YJ9 A;  1Q86 C;  1P16 A;  3A5Z B;  1AE3 A;  4OWT B;  4Y52 H;  4LUV A;  1N33 Q;  2UU9 L;  3CC4 A;  2N8N A;  4JI1 Q;  3U58 A;  1KAW A;  4DV4 Q;  3FKI H;  2BH8 A;  4GOP A;  4DR6 Q;  3CME A;  4DR4 L;  1WFQ A;  3ICE A;  4A3C G;  2RF4 A;  5HY6 A;  2K5V A;  3M4Q A;  1JB7 A;  1X55 A;  1PV4 A;  4GKJ Q;  4XIG S;  4R4C A;  4YWK A;  1KQS A;  4HJ7 A;  4DR7 Q;  4IOA A;  2VNU D;  1VCI A;  2NZO A;  2UXD L;  1CKO A;  4BBS H;  1N32 Q;  4IJL A;  3BZK A;  1N36 L;  4P73 A;  4JOI A;  1HR0 L;  2E5L Q;  4OO1 G;  1HNW Q;  2EIF A;  3UE1 A;  1L1O C;  5C44 G;  3CCS A;  4DV7 L;  3KYH C;  1PH6 A;  4EX5 A;  2JA7 H;  3CMA A;  3M4O H;  4BBR G;  1HNW L;  2DGY A;  4OWX B;  3AYH B;  4DR2 Q;  2IT1 A;  1N36 Q;  2PQA B;  1V9P A;  1VQA A;  3W1B A;  1VQB A;  4JBK A;  2BA0 A;  2WB1 G;  2WB1 E;  3K0X A;  1M90 C;  4LF4 L;  1XPO A;  1XNQ Q;  3CC7 A;  4K0K L;  4POG A;  4KHP Q;  4IFD I;  3M7N A;  1XMQ L;  3CPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...