3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
1UE1A 1JJ2A 2BA1A 3F8TA 4DNIA 1NMFA 1X3EA 4QJFA 4YWMA 5AJ3L 2PQAB 1VQGA 1K3RA 4LF6Q 1N36L 1Y1VH 1HNZQ 4X65L 3CPWA 4LUZA 2ZJRA 2VQFL 1VQ5A 3RR5A 4LFAQ 3G4SA 1CSPA 2WB1G 2ZTDA 1X6OA 3PUYA 4HJ8A 3PUVA 2IHFA 2IHEA 1N34Q 3I4MH 1I6HH 4A3CG 4IOCA 3OTOQ 1CSQA 5IYCH 5LMNQ 3PV0A 4DV4L 1J5EQ 4HJ5A 1X54A 1KXLA 2Q2IA 4OO1G 4JI5L 4ME3A 4APVA 2N78A 4DV3L 1K8GA 1GO3E 3SGIA 3RNUA 1YITA 1SFOH 3BZKA 2RF4A 3CCEA 1K8AC 1KRSA 2ZJPA 1UWVA 5M5WH 4JV5Q 1C0AA 4X66Q 1X3FA 4JBWA 3TEHB 1NBWA 4R4QA 4A4IA 4A3IG 2PI2A 3A5ZB 3S1QH 3L0OA 3UDFA 3T1HQ 5J3BA 1ASYA 2IX1A 3TRZA 2JA7H 4BY1G 4A3FG 4L5SA 2Q2TA 2OQKA 3S2DH 4IJHA 4RMFA 5DLQE 5JEAJ 4IFDI 3NEMA 5LMUL 4GN3B 3HOUH 4HJ9A 3GTOH 1JJCB 4IPGA 1OXSC 4P72A 3K7UC 5K36G 2N8NA 3PUXA 4GNXB 4DR3Q 4YCVA 4TVAB 2ATWA 1QUQB 1LM0A 3I55A 3PF4A 5EAYA 1X55A 4LF6L 3T1YQ 1M1KC 2OWOA 3U4VA 1Y1WG 1HNZL 1PFSA 3KJOA 1PYBA 1VQ9A 2MNAA 2AHOB 3AYHB 5GAGC 2E5LQ 4LFAL 4A3EG 4IFDJ 3VDYA 3AQQA 4XIGS 1UE7A 1PV4A 3W1BA 3M3YH 1Y14B 3CF5A 1N34L 1VQ4A 2F3IA 1L0WA 1G291 2HIXA 3OTOL 1HZBA 3G48A 3ULPA 5HY6A 5LMNL 4L5RC 3CAMA 4Y52H 1Y1VG 4GLAC 2N3SA 2NN6G 3JC66 4BBSH 1NTGA 3BU2A 5HGQA 3TREA 4AYBE 5M5XH 1HNXQ 3JAMc 3I56A 4AIMA 2UUBL 4P74A 2PNHA 1M90C 4JV5L 3I4MG 4LF5Q 1YEZA 3CPFA 1VQCA 2YU9H 2VZAA 3D31A 3CCSA 4A3JG 4LF9L 2UXBL 5IP7G 2R7ZH 1YHAA 1IBKQ 2AWOA 1JB7A 3T1HL 2ID0A 1YJ9A 1I94Q 4MTNA 2NVYH 4JI8L 4LFCQ 4Y7NH 2JA5H 1QZHA 1IZ6A 3FHWA 3S1NH 2AMCB 3J81c 2NVQH 3ZJYC 3GTKH 5IE8A 1N32L 3TS2A 3PO2G 3FKIH 1L1OB 1JE5A 1YHBA 4PZ7A 1YJNA 1PH6A 5IYDG 1WI5A 2KHJA 3G6EA 5M5YH 1BKBA 4LF4Q 3F2BA 2KBNA 1EYGA 2F4VL 2JA7G 2UUCL 3A0JA 1OXTA 3CC7A 4A3GH 5JJKA 1EWIA 1MKHA 3T1YL 4OWWB 2B29A 2FXQA 1G51A 2CWAA 1BBWA 1VQIA 3H0GH 1AE2A 4DV4Q 4KLKA 5JEAG 2E5LL 3HOUG 2K50A 3KFUA 1Z47A 4JI5Q 4A93H 4MZ9A 2R6GA 3MEFA 5FLMH 4IPDA 3UDXA 4C3HH 1FVIA 1EIFA 5JJLA 4JCVE 4BBRG 4OXPA 4UY8C 1HH2P 1SR3A 3GTPH 1N9WA 3KLWA 4DUZL 1UE5A 3U50C 5C4XH 1UEBA 4DV7L 1KD1C 4GKJQ 1R9TH 3M9BA 4GN4B 4DUYQ 2B3GA 4IFDG 2HQLA 2PQAA 4OX9Q 1H95A 1HNXL 3GTQH 1BBUA 3KJPA 1YHQA 4DAMA 4IPCA 4DV0Q 1TWCH 5M3MH 4LF8Q 2GVBA 3DM3A 4A75A 4LF5L 4DR2L 2VS1A 1S72A 3PIOA 2QGQA 5LMUQ 1SROA 1YZ6A 1E3PA 3K8AA 1IBKL 3K7AH 4C3JH 1A63A 3CCVA 1XNQL 2LXKA 4BBSG 1X65A 1I94L 4LFCL 4GOPB 3WWVA 4JI6Q 2JK8A 4POFA 3KDFA 3HOZG 4UP7A 1HR0Q 2LSSA 1VQNA 5C0XI 4JI0Q 4DKAC 3L7ZC 1RIPA 4YY3Q 2OTLA 2R7FA 4POGA 1VQOA 2ZJQA 3S15H 1PH1A 4B3RQ 1NMGA 3CCMA 3CC2A 1PH5A 1CKOA 4LF4L 3RZOH 2NVXH 5ELNA 1K83H 2D0OA 3D0FA 1PHJA 4DV1Q 3KDFB 3PUWA 2D62A 1FJGL 1AE3A 4R4CA 3CCUA 2MQHA 5C0XJ 3CXCA 2UXDQ 4IOAA 3FKIG 5FLXc 1E1OA 4BY7H 4YCWA 4LFBL 2EIFA 4B3SQ 1Q7YC 1EOVA 5GADC 1PH3A 2Y0SE 4LUOA 4X6AH 2K14A 4GNXC 2UUBQ 4A3GG 3S14H 3KOJA 5IY0A 3CCJA 2UXCL 1I5FA 4DV2Q 4B3MQ 3A5UA 3H0GG 4LF9Q 2UXBQ 3HFZB 3J80i 3CC4A 4GKJL 4GNXA 4A3BH 1LYLA 4DUYL 4A93G 5FLMG 1Q8KA 1QUQA 2H5XA 4YHHQ 3GTJH 3B6YA 2K5HA 2ZM6Q 4OX9L 2Z6KC 4JI8Q 5IP9H 3MXNB 3HOXH 4DV0L 4J15A 4LF8L 1PH9A 2WP8J 1OXXK 1N32Q 2Z0SA 2Z6KA 3M4OH 1B70B 1IBMQ 4BA1I 4BA2I 1PH4A 2MO0A 4C2MH 3RN5A 4JI6L 2F4VQ 2OCEA 1VQDA 5ELOA 2UUCQ 1HR0L 3H15A 4JI0L 3ER0A 1WJJA 5M3MG 5M3FH 4YY3L 4A3KH 3A74A 1LUZA 4JI7Q 1WYDA 3EIVA 2BH8A 4XTCS 3ICEA 2JEAI 1A8VA 2K4KA 2IX0A 2JA8H 4B3RL 5H1SE 5BR8Q 1MJEA 2NZHA 4JBMA 1XTDA 3KF8B 4DV1L 4A76A 3HOYH 1XPUA 4DUZQ 1N33Q 4IO9A 1Q12A 4JBKA 2UXDL 2EXDA 1VQEA 1EQRA 4DV7Q 4B3SL 1OTCA 1L1OC 1WOCA 2KHIA 1RL2A 2E2JH 4QQBX 2GN5A 2OQ0A 1VQ7A 2HIVA 4DR2Q 4DV2L 1HZAA 1L1OA 1LTLA 4P73A 4DK6C 5IYCG 4B3ML 2Q2UA 3W5OA 4JOIC 2NVTH 2A19A 4X62Q 4HIDA 2BA0A 3CCLA 1KL9A 5C0XG 1QVFA 1XNQQ 4BY7G 4YHHL 2RHQB 2F52A 3KF6B 2ZM6L 2A8VA 3F1ZA 3RN2A 4JOIA 1QVCA 4UPAA 1XNRL 2WFWA 4PG3A 4YWLA 4JI1Q 1EUJA 4HIOA 4LF7Q 1S3OA 2PMZE 2ZTCA 3I4OA 5IWAQ 1IBML 2VQEL 1ASZA 1K9MC 5FJ8H 3E9IA 3L2PA 1QZGA 2JA9A 2K5VA 1E1TA 3W1GA 1PH8A 4A3BG 2WAQE 1GKHA 2R7DA 5LMNW 4JC0A 4HIKA 1W3SA 3M4QA 2MO1A 3GO5A 3RLNA 3TQYA 4QY7A 4PMWA 5IP9G 3HOXG 4A3LH 2KCMA 3GD7A 4A3MH 3DLLA 4HIMA 5C4JH 1PH7A 1FJGQ 1B8AA 2K75A 4L5QA 2K5NA 4NPSA 1DGSA 4UP8A 5BR8L 1XMOL 4LFBQ 3HOWH 3GTGH 2RHSB 4KI0A 2EQSA 4JI3Q 1VCIA 3J7A5 1OXVA 2WB1E 3F2CA 4DR5L 4GOPC 5M3FG 2CKZB 3EBEA 4R1JA 2UXCQ 1E7ZA 3M4PA 4A3KG 1N33L 2K52A 1PH2A 4JYAQ 1VQFA 1A62A 2A1AA 4P71A 1GM5A 3ULJA 4GOPA 1CUKA 1P8LA 3U4ZA 1Q82C 1P16A 1KC8C 2JA8G 1KHIA 1CKNA 5IT9c 1L2FA 3H3VI 4AYBG 1TWFH 2ALYB 1JT8A 4EX5A 4WJ4A 2CCZA 3U58A 1YI2A 4X62L 1PA6A 2YYZA 4MNOA 2KENA 1VQJA 3CQZH 1W2BA 3PO3H 1VQLA 2E2HH 4NXMQ 4R4IA 1CKNB 1K73C 4JI1L 1KRTA 4GLXA 4TQUS 3RLFA 4LF7L 4KHPQ 1VS0A 1G6PA 1OXUA 5IWAL 2R7ZG 1N8RC 5GROA 4BXXH 1FGUA 4WJ3M 2NN6I 3CCQA 1VQ8A 2WAQG 2YTXA 3CMEA 2JA5G 4NXNQ 3G71A 1YBYA 3I7FA 4O2DA 4HJAA 4A3EH 1WFQA 4LUVA 2YTVA 5JJIA 1X9NA 2I5LX 3UDGA 4GN5A 4QL5A 3RZDH 4DR7Q 5FJ8G 3S2HH 4JI3L 1YNXA 1PVOA 3STBC 1X56A 5C44H 4A3LG 1Q1BA 2LXJA 3GTLH 4A3MG 1HNWQ 3TS0A 3CP0A 1VQAA 3NELA 3BZCA 3UE1A 4JYAL 1JJGA 2JA6H 1VQKA 1VQHA 3J7ZC 2QA4A 2OTJA 1U5KA 4FDBA 4RG1A 2HT1A 2XGTA 4B3TQ 3HOWG 1E22A 1U0LA 3E0EA 2R93H 4C3IH 5GQOA 4DR6L 1HZ9A 1O7IA 1XNRQ 4GLVB 4K0KL 2KCTA 4A3JH 4DV6Q 5IP7H 2ES2A 1E24A 1X3GA 1JMCA 1FL0A 3AFPA 4AH6A 1XPOA 2UUAQ 2B63H 1SLJA 1TWHH 2BH2A 1VQPA 3HKZE 4JI2Q 5C4XG 2VQEQ 4DR4Q 2YV5A 4P75A 3CD6A 2R92H 3PF5A 1SN8A 1V9PA 4OONA 3KYHC 4GS3A 3J80c 1I3QH 5C3EH 1KIXA 4NXML 4GKKL 2VNUD 2MFIA 3PO2H 2HHHL 4KHPL 2JE6I 1NE3A 5IYDH 1TXYA 2CQOA 1HZCA 4JI4L 5IYBH 3K0XA 1VQMA 4HJ7A 1XMOQ 3S17H 1IYJB 3CW2C 3HOVH 3PO3G 2ZTEA 4L5TA 4NXNL 1C9OA 4DR5Q 1S40A 1HJPA 2AWNA 2DGYA 3OW2A 3PSIA 4DV5Q 2VUMH 4KHZA 4AQYQ 3NENA 3BJUA 1SE8A 4X64Q 3KF6A 4DR7L 4BXXG 1Z9FA 3K80C 4BBRH 1NJIC 3I4NH 1CKMA 1BVSA 1TWAH 4DR1Q 1XMQQ 4A3DH 1T9HA 2VW9A 1C7YA 1EQQA 2Y0SG 1HNWL 2GVAA 2I5MX 3JAMi 1D7QA 3LGJA 1TWGH 2L15A 1Q86C 3ULLA 2IY5B 1WCMH 1HR0W 4B3TL 1EFWA 3CMAA 2V1CC 3S24A 2D0PA 1V43A 1J5EL 4DV6L 4PZ6A 5C44G 4ALPA 4YWKA 1IBLQ 2UUAL 4JI7L 4LWCA 2ASBA 4LW1A 4JI2L 1GVPA 2JA6G 4DR4L 2C35B 1Q1EA 3J81i 4O0AA 2UU9Q 3HOZH 4OO1I 2JJQA 3HKZG 2XTIA 3PCOB 1SMXA 5GAEC 2DUDA 5E7NA 4X66L 4H02A 3AFQA 4UP9A 4DAYB 3PGZA 3UDIA 4QGUA 3CCRA 4DPGA 1IXRA 3S1RH 2N49A 3F2DA 3K81C 2RCNA 1EIYB 2B63G 3M85A 1V1QA 1UE6A 3GTMH 5GAHC 2YTYA 4EQ5A 1K0RA 1J6QA 1XJVA 4R4TA 2VY3A 5AJ3Q 3ERSX 2CWPA 2R92G 4A3CH 1IL2A 1KAWA 3I2ZA 3J81j 4DK3C 2E2IH 1N36Q 3GDEA 5C3EG 1AH9A 4X65Q 2VQFQ 4DV5L 4AQYL 4YCUA 2QEXA 1I50H 3Q8DA 1Q81C 4X64L 1YIJA 2NZOA 3E9HA 5IYBG 4DR3L 4OWXB 1MIUA 1XMQL 4IPHA 4DR1L 3HOVG 4PZ8A 1XPRA 1VQBA 4DR6Q 1MJCA 4A3IH 1SRUA 3OYYA 4JG2A 4K0KQ 3HKSA 3HOYG 3PUZA 4QIWE 2VUMG 4DV3Q 3S16H 4BY1H 3IRBA 4A3FH 1QVGA 3S1MH 4NB3A 2JEBI 3NBHB 2R93G 3UE0A 3I4NG 4A3DG 1PYSB 4GKKQ 2AKWB 2I0QA 1IBLL 1NY4A 1YVCA 2Q2HA 2CFMA 4JBJA 2JQOA 3PIPA 1Q46A 2HHHQ 1B7YB 2VL6A 3AEVA 2IT1A 3H3VH 3FP9A 2I5HA 4JI4Q 4IJLA 2UU9L 1KQSA 1WCMG 3EN2A 1D8LA 1A0IA 1GD7A 4LNQA 3RLOA 2PI2E 1Y1WH 1YJWA 1VQ6A 4OWTB 3M7NA 4R4OA 2E8GA 3STBD
chains in the Genus database with same CATH superfamily
4JW0A 2F0GA 1JKJB 2WB1A 4JV5H 2K6AA 1GUGA 4UCOA 4E6IA 2PQAB 3KLRA 3MWYW 3SEBA 4LF9H 3LX0A 3VYRA 4LF6Q 1N36L 3T1HH 3NK9A 3OSNA 3VA5A 4FF1A 4F4XA 2ZJRA 2VQFL 4JI8H 3C2PA 2BE5D 3EYYA 3TBIB 3BA8A 2WB1G 2IA6A 2VA2A 4NKLA 2ZTDA 1D5XC 4HCEA 1I50A 5L1IA 3MXPA 3NSWA 2IHFA 5CV5A 1N34Q 5FO7B 4A3CG 1TA8A 1T36A 4DV4L 2Z1CA 4QF4A 4OO1G 1IKMA 4IAJA 3S1NB 5L1JA 2UUCH 5KFUA 1JWSD 1E2WA 5KIXA 1EZ6A 1TY0A 1HUNA 2DPIA 2ZJPA 1UWVA 5HURA 5M5WH 3R93A 4LMYA 3H3VC 4R4QA 4A3IG 3D8GA 2DZDA 1TS2A 3L0OA 1CM9A 3UDFA 3S1QH 2IMWP 2IX1A 4FXKC 1O78A 1ZYRD 2G5DA 2A6HC 3SXHA 4ECRA 2QF7A 1PTOH 3WOFA 1M8AA 4RMFA 4IFDI 1BGWA 4FXDA 4TQRA 2EY1A 1SYXB 3K7UC 2K01A 5K36G 2N8NA 3MHBA 3PUXA 1DZ1A 2IBKA 4UCRA 1LT4D 1SNOA 2QDLA 2WACA 3ND8A 3T1YQ 1V4YA 2D9UA 1PFSA 3KJOA 1IL8A 5JVG3 2QK4A 1VQ9A 4IUVA 3MWEA 2MNAA 3AYHB 4IFDJ 1K1QA 2R85A 1PRTF 3VDYA 5CA0F 4IFDH 5I2YA 5EPJA 2VUGA 4APMA 5CV8A 1I4XA 4C3JB 3V96A 2F3IA 5F2DA 5KRUA 4IWXA 2HIXA 3OTOL 5HY6A 5LMNL 4L5RC 1AUVA 2J6SA 2FMAA 4BBSH 5C5LA 1GHKA 1F2MA 1HUMA 5HGQA 3C0FB 2R7KA 5FLXL 4AIMA 3DEOA 2YYAA 4DGZA 4JV5L 1SMYC 4C3IG 4LFBH 1ENFA 3D31A 4O42A 1EYDA 3N6XA 1I3QA 4A3JG 4LF9L 3JAME 1YHAA 1IBKQ 3T1HL 2F3WA 3MA2B 2NVYH 4JI8L 4LFCQ 4Y7NH 2JA7A 3OHBA 3FHWA 3BYYB 2MCTA 3J81c 4OX9H 5IE8A 3TS2A 1HRJA 4DV0H 1YHBA 4PZ7A 1PH6A 2PBZA 4U673 1K28A 5IYDG 4OEMB 3A7AB 1SNCA 2GPWA 3RB3A 2JA7G 3OWEB 1ZQ7A 2XIWA 2UUCL 3S1QB 3Q0AA 1OXTA 5JJKA 1I4HA 1B04A 2B29A 1G51A 2FXQA 2J7ZA 4CKCA 1Z2PX 1BBWA 3EQLC 3HOXB 3OIQA 5JEAG 1JOKA 5KFIA 4QMGA 2DPJA 4X3KA 2WTFA 3UDXA 1FVIA 4YY3H 4JCVE 4MHEA 4OXPA 5KNCA 3MFGA 4G7HC 1N9WA 2X6GA 4RB0A 3U50C 2XRQD 1AZPA 1R9TH 1HTPA 2HQLA 1W96A 5EWFA 5CORA 1EY6A 2JA8B 2AQ3B 2K1BA 2UXDH 2EDGA 4LF8Q 1WD0A 5M3MH 1IYUA 1SCUB 3OPOA 1VKZA 1HQMC 3I91A 3NXWA 4AYBB 5LMUQ 3G8CA 1E3PA 1HTLD 2RA4A 3Q2OA 5IIFA 3K7AH 2NWGA 2NBFA 1A63A 2R82A 2NZ1D 1HNWH 3WWVA 3VR4A 1EL0A 4POFA 3HOZG 3GIQA 4UP7A 4BWSC 5ELEA 4DL5A 2JA5A 1WTHA 2OTLA 1GXDC 4IZOA 4YHHH 3IAYA 4O4LF 5KFKA 1IKLA 1X32A 3FKIA 3CCMA 1SYBA 2F0SA 1CKOA 5ELNA 1I6VC 1SNPA 3D0FA 3PUWA 4IR1A 2EY5A 2R8HA 4Y7NB 3H4DA 3CCUA 4EBDA 4ZHQF 4HN7A 3FKIG 4LFBL 3U9TA 4YAKB 2WYOA 2UUBQ 4KJOA 1JXLA 2F0JA 1I5FA 4DV2Q 3HRZC 3A5UA 1RTNA 1KLGD 3HFZB 2UXBQ 3J80i 1DXMA 4C5BA 4DR5H 4OX9L 4C3HG 2CZGA 4DV0L 3MXNB 3GTQA 4PNYA 2C22A 5KFHA 5I2XA 1PH9A 1BO0A 3K5HA 4YBZB 1N32Q 2W71A 1KDCA 4MTEA 2Z6KA 3URYA 3M4OH 1CQVA 4BA2I 4E4TA 3RN5A 3VR2A 1VQDA 5ELOA 4X62H 4U7CA 3E5SA 3ER0A 4HR7A 4YY3L 4A3KH 1PFBA 4XYQA 2ZJTA 5JUMA 1A8VA 1JCKB 1TS4A 1MJEA 1TVXA 4JI1H 1XTDA 3KF8B 3K7AB 5IGGA 2EZVA 4KD3A 1I4QA 1G2TA 2PO4A 4EGQA 3LMLA 3SDZA 1Q12A 2UXDL 4LH6A 5KG7A 2QYZA 2R8JA 4DL3A 4DV7Q 1LT5D 1XWEA 2J6UA 4ULLA 1L1OC 1CE8A 2CH4W 2CW0D 1VMCA 2OQ0A 2A74C 3FPUB 2HIVA 1VQ7A 2BR0A 3TP5A 2L11A 5E4WC 4Q0FA 5KT4A 1QOHA 2XD4A 5IYCG 1PTOF 2Q2UA 4ZK9B 5E4XA 3J7AF 4JI3H 4HIDA 4RUCA 1KL9A 5C0XG 4A2AA 4YHHL 4Q8FA 4UPAA 1CA6A 4ED8A 2FKLA 1S3OA 2ZXRA 4CC6A 1ZEQX 2D2CC 5C44B 3RD4A 4LSAA 2K33A 2WV6D 4I7ZC 4K0KH 2PW5A 1WH2A 2JA6B 3NP8A 4U6PA 5LMNW 4JC0A 4HIKA 3GO5A 2FB9A 3KXYT 4HCSA 4TRDA 3OWFA 2R93B 5C4JH 2JEIA 1FJGQ 1BXTA 2EYFA 2K5NA 4GKKH 5FLXW 4ID6A 1V1PB 4JVZA 2RHSB 4KI0A 3J7AV 4O3PA 2R92B 4JI4H 4GOPC 4DR5L 4J9RA 3TP6A 3EBEA 4R1JA 3M4PA 1RD9D 2YZNA 3U4ZA 4ZYSA 1KC8C 2MJ8A 1MI2A 1P16A 1Y8PB 4KY6A 4G7OC 1CFMA 2W6OA 2HVRA 3H3VI 1DOKA 1D5ZC 3HOVB 1JT8A 4EX5A 4WJ4A 5LP6F 2OEOA 4X62L 1YI2A 2YYZA 1WTVA 1EU3A 1I4GA 1VQJA 2ICIA 4TSSA 4M7EA 3PO3H 5KFRA 2B8GA 4R4IA 1CKNB 5BN4A 4YIJA 4JI1L 3T53B 4TQUS 4B3TH 5C6AA 3MFHA 2K5QA 2R7ZG 4BXXH 5GROA 5D1OA 4OIJA 1FGUA 1RTOA 2BQ3A 3KHRA 2B2WA 4F88A 3CCQA 4JI2H 4GZYC 2YTXA 3JAML 4NXNQ 3L4KA 1I7NA 3D3RA 4O2DA 2PQEA 4A3EH 1WFQA 4LUVA 5EWEA 4YB8B 3KHGA 3TDQA 4IUQA 4QL5A 2FJZA 2JXMB 3S2HH 5CAEB 3FDSA 3GTGA 1ICFB 4JI3L 3SK5A 1YNXA 3STBC 2R8GA 2RCFA 5J2UF 2GLTA 4F50A 2NYZD 5JJZA 5KFSA 3BDOA 3T5LA 3M4YA 4I65A 3S1RB 5M9OA 1U5KA 3A8IE 2Q8RE 2P5ZX 2HT1A 1BBXC 1D1IA 1KJIA 3E0EA 1AEXA 1HZ9A 1JWUD 2NB0A 3VYTA 1XNRQ 4K0KL 1XTCD 4JI7Q 3V05A 3N52A 5IP7H 2WE6A 3JRWA 3PW5A 2ZDHA 1AW7A 1TWHH 1J9OA 3QR8A 4NDXA 3TZDA 2BH2A 1XMQH 1ICWA 4DR4Q 2YV5A 2Q8TA 3KUPA 3QG1A 1C4QA 5C1PA 1V9PA 2F0TA 4GKKL 4NXML 1KIXA 2VNUD 3WO0A 4J9KA 1EUCB 4MIUA 2W8LA 1XDNA 1KC7A 3TQTA 1NE3A 2YS6A 1TXYA 2CQOA 4ZUIA 4K2LA 1HZCA 4JI4L 1D5MC 3S17H 2J4XA 1CZGA 4A3FB 1EHIA 5DQIA 1SBBB 1MHWC 5I6YA 2CQYA 1HA5A 2UU9H 2AWNA 3EROA 4MAMA 5I6WA 1SE8A 1SNMA 4X64Q 3KF6A 2VPSA 1C3OA 4EBCA 1PZID 1PFMA 4RCOA 1GYFA 1G91A 1HXYD 2I5MX 1Y1WB 5HV6A 2Z6BA 4A3EB 4B3TL 4X65H 2K32A 3HG9A 2QKIC 4O1NA 4KN7C 3TP7A 1V43A 3HP3A 4G4KA 3S2HB 4ALPA 2PW7A 4WFN3 4KJNA 4M1UB 3Q6SA 4ETSA 1WTQA 4JI2L 2F0MA 2B63A 1GVPA 3I4LA 4G3IA 2R87A 5FO8B 3J81i 4O0AA 3H20A 4KY5A 2N88A 3PCOB 1SMXA 4JI5H 1KNAA 4UP9A 3HKZB 1T94A 4ZQIA 1B33N 2WINB 1I6HB 5LA6F 4HNTA 3F2DA 2B63G 3GIDA 3GTMH 2L5TA 5GAHC 2YTYA 3ERQA 1Q8IA 1J6QA 4K6LA 1SYGA 2EYPA 4FM9A 1MD2D 1TWHB 1L0YB 1SFOB 1Y69U 4DK3C 1F2ZA 4Q0YA 1N36Q 3MFYA 2O5IC 4C5AA 5ELBA 2VQFQ 1F77A 1NR2A 4YCUA 3J7AK 1YIJA 2B2YC 1O80A 4OWXB 3E3XA 1XMQL 1SE3A 5KGUA 5EJWA 3S17B 3MXUA 1MJCA 1SRUA 3OYYA 1STNA 4WJWA 2F0HA 4RB3C 2XVSA 4YAJB 2SEBD 3S16H 1H9SB 1RCVD 1WTRA 3HOUB 2A5HA 3IRBA 3NBIA 1WTWA 1QVGA 2FK2A 2FPPB 2JEBI 5A2QE 3I4NG 4A3DG 2L12A 1EY5A 2Z4HA 4XYOA 4ECTA 1EIGA 3PIPA 2EY6A 4GC6A 4ECZA 1A9XA 2I5HA 2UU9L 1QCBD 3EN2A 1ILPA 4R9WA 2ZDQA 2PI2E 2AQ4A 3M3YB 2F0KA 3R2TA 4NLGA 3SR1A 4R4OA 3C46A 1Z2NX 1UE1A 1OWTA 4DNIA 4B3MH 1X3EA 1C30A 1I6UA 3T4AC 5ISRA 3TIGA 1VQGA 4H0LC 1CA5A 5E1FA 1Y1VH 1JWMD 4X65L 2K5DA 2UVVA 3RR5A 2AGOA 3G4SA 2V5AA 2E75C 1CSPA 2YU9B 2KEDA 1X6OA 3PUYA 3M9OB 5KT5A 4MN3A 2CH4A 1AFPA 2EXZA 1SAPA 3I4MH 3GTMB 5E3FA 3OTOQ 1D2BA 4DK1A 5LMNQ 1J5EQ 4UDUC 3VR3A 2MP1A 1KXLA 3VA7A 4JI5L 1JOQA 2N78A 3P75A 3SGIA 1WVLA 3JAMW 2AGPA 3NGDA 4ECQA 4JV5Q 3ONAB 4QIWB 4X66Q 2RGRA 1X3FA 5KFVA 2N55A 4A3GB 1NBWA 3N44B 4A4IA 4YJ2F 3OHAA 1B3AA 2PI2A 2V4DA 3H0GB 3T1HQ 3TRZA 5JVLA 5KFAA 4BY1G 2C28A 4EGVA 4A93B 3S16B 3H91A 4RAZA 1N56A 3RJ0A 1B9MA 2XWBB 4DF7A 2FINB 1NR4A 3NEMA 4XXEA 5IT9L 4GN3B 3PN1A 1SYFA 1HNXH 3K58A 3GTOH 1DM0B 3RB6A 4CDEC 2SNMA 5CV7A 4YCVA 3I55A 3BDCA 1F2YA 3PF4A 5EAYA 4RGNA 2OWOA 3U4VA 1XNQH 2DIKA 1I94H 1PYBA 4O4IF 5GAGC 2F0EA 4XIGS 1UE7A 4K6DA 3A56A 5IOCA 4RH6A 3W1BA 3CF5A 2H4OA 1L0WA 5I4DA 1HZBA 2DY8A 2AU0A 3PQIA 4CDCC 5CBEE 4LF4H 5FD5A 2QEJC 2JN4A 4ZOLF 3TREA 3KK7A 4AYBE 2E76C 3I56A 1RJPA 1BCPB 3CPFA 2Z9HA 2KSWA 5EZYF 3VMMA 1YNJD 5KNDA 2UXCH 1OO9B 4KKUA 1SNDA 5BN5A 3MR2A 2YS7A 1IZ6A 5DNFA 3S1NH 4DUYH 2AMCB 2V59A 3GTKH 5JPNC 2W9CB 1L1OB 1SE4A 2R6FA 1H9JA 5IGDA 3HXLA 2KHJA 4C56C 2XCPA 3NBHA 3J81E 3F2BA 3PIO3 1EYGA 5KFBA 4A3BB 3RGZA 2O2LD 1WTXA 1L2ZA 1EWIA 1CQIB 3GTJB 4OWWB 5D1PA 1RYSA 1STGA 3H94A 2CWAA 3H6MA 3L3OC 3J80L 4KLKA 4JI6H 2MGSA 1DIKA 2R6GA 3MEFA 5FLMH 4JI0H 4IPDA 3GTOB 1EIFA 5KFYA 1EQTA 2FLLA 4BBRG 2FFKB 3I3CA 4R8UB 4B3RH 5IODA 1SR3A 3BABA 2FLPA 3KLWA 1CHPD 3R5HA 4KK7A 1DV2A 1UE5A 1KD1C 3KHLA 5FD6A 1HCZA 1V1OA 1KBLA 4IFDG 4F4WA 4OX9Q 1HNXL 4IPCA 4DV0Q 4XQQA 4LK1C 1YNND 4XT1B 4DR7H 4B3SH 1S72A 1YZ6A 3K8AA 1LV9A 4C3JH 3T51B 4HMJA 2A73B 4H44C 1XNQL 2LXKA 4BBSG 1I94L 1M0TA 1S5ED 4ZLTF 4GOPB 2DNEA 3Q22A 2NVYA 2LSSA 2AQ2B 1VQNA 2W7PA 3L7ZC 1RIPA 4YY3Q 1ZKOA 1RHPA 4O3RA 2ZM6H 2ZJQA 4TUYF 1IYVA 3T13A 4IQZA 1BXRA 2HDMA 4LF4L 3EPIA 2NVXH 3M9NB 1S5BD 1C8CA 1K83H 3JRXA 3HBLA 2VQEH 1II3A 1SYDA 1AE3A 2QW7A 4R4CA 1XXGA 2UXDQ 1LTGD 4IOAA 5FLXc 3GTKB 3RUZA 3BAAA 1Q7YC 5GADC 4LSXA 5NUCA 4RNNA 4EBEA 2K14A 3NQIA 4FVMA 5EQ0A 3S14H 5IY0A 2Z4IA 3GIJA 1BOSA 2A6HD 3CCJA 2UXCL 4QUCA 3GP7A 3DUZA 3CC4A 4GNXA 4DUYL 1Q8KA 1QUQA 2H5XA 4YHHQ 4ZCKA 1R9TA 4DV5H 3G6VA 1N33H 2Z6KC 5IP9H 4CKEA 3HOXH 4S3SA 3RMHA 1KEEA 1GUOA 1SNQA 3BG5A 4DR1H 3A8JE 5A2QL 1PH4A 2MO0A 2L1BA 2NUAB 4C2MH 4JI6L 2F4VQ 3K5NA 3EPGA 4RGMA 1BCPF 4JI0L 5M3MG 1WJJA 2R84A 1NAPA 1LUZA 1DONA 4PMBA 1WYDA 5LHY1 4B3RL 3FVQA 2JA8H 2PVPA 4KY7A 1EUDB 4LF7H 3ITPA 1MBYA 3CQZB 1ZHSA 4A76A 2XIGA 2E2HB 3RF2A 1XPUA 4DUZQ 3I72A 5DQHA 1SMYD 4UCVA 2EXDA 4Q8EA 1EU4A 4B3SL 1LTBD 1OTCA 1WOCA 1M4VA 2KHIA 4QQBX 1QB5D 3KLSX 1O7LA 4UCTA 5IT9W 5DG9A 2HJWA 4ED0A 1LTSD 2NVXB 1K83B 4NW2A 1HZAA 1LTLA 4DR2Q 1TAEA 2NVTH 2Y0SB 4X62Q 4GC7A 2BA0A 2ZXOA 2C2RA 1KNEA 2ZM6L 2SNSA 4DL7A 4JOIA 4JYAH 4FBUA 4H7BA 4PG3A 4YWLA 4JI1Q 3R23A 3KHHA 4O3NA 1F9SA 3S14B 5BPFA 2ZTCA 3ORRA 2VQEL 1ASZA 3GTLB 3E9IA 2JA9A 1E1TA 4RHRA 5IGBA 2HDLA 5CV4A 2R7DA 3N8DA 1TKWB 1W3SA 2MO1A 3RLNA 1BR9A 1RJTA 2KCMA 3DLLA 5DEHA 5KFEA 4EQNA 5J2TF 5EWGA 4WD3A 5IGCA 3HOWH 2IJ0A 3KLSA 2HHHH 4KHPH 4H13C 3PR4A 2E74C 4JI3Q 1IOVA 3J7A5 4C2MB 2F3VA 3KTMA 3RTXA 2CKZB 1STBA 2EE1A 4A3KG 1N33L 1UC8A 3TINA 1A62A 2A1AA 1CHQD 1JDBB 5KG4A 1QILA 2HCCA 2KOLA 4ED2A 3RB0A 4IRDA 3PW0A 5KX5F 1CKNA 3VPBA 1MGSA 1TWFH 3OW7A 1VBGA 2XGPA 4J1MA 4KTAA 2RQXA 3U58A 2HVSA 3DMUA 1SSOA 2KENA 4IR9A 2VUMB 5D3DA 4QW9A 1W2BA 1VQLA 3J80W 3QOLA 4NXMQ 1TWAB 4LF7L 3A7LA 4J9SA 1G6PA 2B2WC 1F9RA 5K36H 1TS3A 3RAQA 4WJ3M 2NVTB 1TWGB 4DV6H 3UFXB 5D3IB 1I7LA 2KA7A 1WCMB 2PMZB 3OUZA 4YR2A 2JA5G 2WAQB 2QDBA 2I5LX 3VYSA 3UDGA 2MHVA 5K5PA 4UCSA 3CHBD 3V2TA 2K28A 3NWTA 4ZUJA 5DG7A 2EYOA 5C44H 2FLNA 1TY2A 1S9FA 3TS0A 3GTPA 3BZCA 1FYCA 2EJMA 3UE1A 4JYAL 2JA6H 1EOTA 3J81L 2OTJA 1SE2A 2WB1B 4B3TQ 1E22A 4IUTA 1U0LA 2R93H 4C3IH 5GQOA 2CW7A 4F7XA 3DXJC 3HOWB 4GLVB 1IW7C 2KCTA 4A3JH 1TWCA 1JQYD 1E24A 4QUFA 1JMCA 1FL0A 4AH6A 4HSVA 1VQPA 3HKZE 4JI2Q 5C4XG 1BCPD 3CD6A 2R92H 4OONA 4FBTA 3DF7A 1I3QH 5C3EH 1F9PA 1LT3D 2HHHL 4KHPL 5JQWA 3V6JA 5IYDH 4O3OA 2OXPA 4A3IB 1TWFB 2F0UA 4HMIA 1CTMA 5IYBH 5FPRA 1VQMA 4CHTB 2K5WA 4HJ7A 3CW2C 1XMOQ 5GONF 3HOVH 3OUUA 1EYCA 4XDXA 3PO3G 4RZQA 4EFEA 5KFOA 3G6JB 4L5TA 4ZKCB 3S1MB 5JEAH 1Y8NB 4O2AF 1PXUA 2DGYA 3BVZA 1CQFA 3EFXD 1FKAH 3NENA 2AGQA 1STYA 5EDWA 2X69A 4BXXG 4K5VA 1NJIC 1BVSA 1XMQQ 4TKOB 1T9HA 3EJIA 4QB4A 3MR6A 3U9SA 1RODA 1HNWL 5A2QW 1T5EA 3LGJA 2L15A 4DA2A 4YJ3F 1PRTC 4ZQ3A 3CMAA 4V0BA 1STHA 2XCLA 3HKZA 3MR3A 3S24A 4OELB 2D0PA 3BQ0A 3A55A 4PZ6A 4DV6L 4CBVA 4FP5D 4LW1A 1CS0A 3K5IA 2ASJA 2LFNA 2UU9Q 3HOZH 5LOVF 1PFNA 3HKZG 3P7JA 5GAEC 2DUDA 2KJXA 3CCRA 1PH8A 4DV3H 4QGUA 1O75A 1LTID 1IXRA 2RVLA 3S1RH 2N49A 4C3IB 2RCNA 2VXWA 3M85A 4A3JB 1KJQA 1XJVA 4KV6A 4R4TA 1DV1A 5IYZF 2VY3A 4LJZC 3J81j 1M7JA 1GHJA 2E2IH 4M8AA 2W6QA 1JC7A 1FNVA 4X65Q 2W9BB 2QCPX 1PYWD 1I3QB 5C3EB 5H80A 3SVMA 4UFZA 2QEXA 3Q8DA 1Q81C 2NZOA 5LMUH 1PZKD 1E0BA 2A6ED 1GSOA 4FS2A 4PZ8A 2WKDA 1VQBA 4DFAA 1XPRA 4DR6Q 2JA7B 1L0XB 4RNMA 1E2ZA 3S2DB 4K5XA 3MJFA 1S03G 1BF4A 3HOYG 4DL4A 4QIWE 5IT9E 3ETJA 4A3FH 2F4IA 1HNZH 4XQJA 2V9WA 4NB3A 4O4HF 4LFAH 1GJXA 1KJJA 2F0LA 4K8IA 2AKWB 2I0QA 1SEIA 5KT7A 4YP3A 3FDTA 3RV4A 1NY4A 2Q2HA 5ELCA 2JQOA 1Q46A 1B7YB 4IURA 2IT1A 3H3VH 1VF7A 1A15A 1KQSA 2YRXA 1LABA 1A0IA 1GD7A 5DM63 4K2KA 1Y1WH 1D6EC 4ODGA 3RGXA 5G3LF 3STBD 3GIIA 2UUBH 5CV6A 1TT2A 1B6SA 3GTMA 4YWMA 1ENCA 3G6XA 2UXBH 5CMDA 1BQQT 1UUPA 5M5XB 4QCLA 2FPGB 2MPMA 4B08A 3HOZB 2OH2A 5KFJA 3OOCA 3CPWA 5KYLA 1VQ5A 1S5FD 2R86A 4EYHB 1S10A 1N48A 4HJ8A 1STAA 3PUVA 4QWCA 2OLSA 1N32H 3MVVA 1A2UA 2EYJA 1I6HH 3KBXA 1PDQA 4OL7A 4IOCA 4FYDA 3N41B 1CSQA 2J9GA 3UI2A 3IFDA 5IYCH 1EYZA 3KALA 4FU0A 2RDJA 3RUPA 4HJ5A 4IWYA 4J9OA 4ME3A 4APVA 2E2IB 3IL8A 4DV3L 1K8GA 1GO3E 2NUCA 3RNUA 1YITA 1SFOH 3T5KA 3BZKA 3FKIB 3M7GA 1K8MA 5EPLA 3CCEA 1ZHQA 1KRSA 2E5LH 1NUCA 5M5YB 2B2TC 1SJHD 2WKCA 3KAJA 2PZUA 4JBWA 3O13A 2PNRC 4KD4A 3NTKA 3A5ZB 3J80E 5J3BA 1ASYA 4JV1A 4L5SA 2Q2TA 4QWDA 4C3HB 2DJFC 4MTDA 4DV7H 3RAXA 4CGYB 3HGBA 1FNUA 4EQPA 5LMUL 2HVQA 3JSLA 3C1EA 3HOUH 2EYHA 3J81W 3Q8RB 1JJCB 4IPGA 1OXSC 1AUXA 3PW4A 4FS1A 3I70A 4LF5H 1D1KA 5K2MA 1CQJB 4CC5A 4DR3Q 4TVAB 5KYIA 2J6TA 2SOBA 4NMZA 5ELFA 1M1KC 3GTQB 1HNZL 5CA1F 4N8X1 1Y1VA 2DJGC 2AHOB 4LFAL 2QILA 4IHJF 3NTIA 1QWYA 3AQQA 2XGQA 1EZ8A 1PV4A 3RIZA 3M3YH 4EYIB 1Y14B 1GUSA 3Q8PB 2E2DC 2XSCA 4IRKA 1G291 1CT1D 1H9RA 3DWPA 3G48A 3ULPA 4I50F 5KG5A 2AQ1B 1BDOA 1C48A 1Y1VG 4Y52H 3DWAA 1PMRA 1DJRD 2N3SA 3E0JA 1G6ZA 4ECYA 2BQRA 2NN6G 2X0SA 3JC66 1NTGA 2C9OA 2EY2A 3H40A 2ICEC 3MFIA 1FJGH 1HNXQ 3I73A 4ECVA 2UUBL 2PNHA 5KG2A 1M90C 3I4MG 3RZOB 1VQCA 2YU9H 3ZYYX 1SYCA 5FO9B 2UXBL 2R7ZH 2B8FA 4EG0A 1M0WA 3N43B 2F0VA 2AWOA 1JB7A 5DQGA 4F87A 1PTOC 4DXGA 1YJ9A 1I94Q 3NPPA 4IRCA 5BMVF 2ALZA 4GKJH 3BQ1A 1WTPA 4Q45A 1KDBA 1N32L 3ZJYC 3QB3A 4K14A 5CV9A 3PO2G 1LTTD 1JR0D 1JE5A 1DD2A 3GTOA 2NU6B 3G6EA 1EY8A 2M05A 4LF4Q 2KBNA 1SYEA 4ZRZA 4ABNA 3CC7A 4A3GH 4EGJA 1MKHA 4ZKBB 1VQIA 3H0GH 1AE2A 4DV4Q 2UVUA 2FE3A 2E5LL 1EY7A 4JPBW 5KNBA 3KFUA 1Z47A 2HD3A 4MV1A 2ASLA 4A93H 4MZ9A 1HR0H 5JJLA 1PZJD 4Q5VA 4UY8C 1FNWA 3GIKA 4ECWA 1JLLB 2W57A 1UEBA 4DV7L 1U4RA 3QJYA 4L6TB 4DV1H 4DUYQ 2PQAA 1H95A 1BBUA 2SDFA 4F4ZA 2GVBA 5G3LD 4LF5L 2VS1A 3PIOA 2QGQA 1SROA 2R3ZA 5COYA 2Q8IB 3NWSA 1Z2OX 1EEID 2K05A 2F0IA 4JI6Q 4PV1C 1A3TA 2LMCB 3T5HA 3TZUA 3LWBA 4JI0Q 5C1OA 2R7FA 4RGOS 4POGA 1E4FT 3GTKA 3S15H 1XNRH 4B3RQ 1NMGA 1XX8A 5KG6A 3CC2A 4HNUA 2R7ZB 1W93A 2D0OA 3E5NA 1IBMH 1PHJA 3KAKA 3KDFB 1KAAA 1FJGL 3IG0A 4X3SA 5KFPA 1EWHA 2B2VA 4KN4C 2F0PA 1ML0D 1E1OA 2FHTA 3GV3A 4YCWA 4BY7H 4B3SQ 4ED3A 1EOVA 4IN3A 3GV8B 1PH3A 4PDBA 2Y0SE 4LUOA 2C00A 3QO2A 4GNXC 4MTKA 5BR8H 1ESRA 1F9QA 2XN9C 1VAJA 4LF9Q 3FEWX 4GKJL 1B3QA 1DCZA 1LYLA 4A3BH 2LS01 5FLMG 3ETHA 5CC4A 3GTJH 5LXTF 5KFZA 2K5HA 2ZM6Q 4J9PA 3P20A 4JI8Q 4CKBA 4J15A 2NU7B 2H1EA 3GTGB 2FMCA 2WP8J 1JDEA 4X64H 1OXXK 4XT3B 2B2UA 2A69C 1RJQA 4O3SA 1B44D 1B70B 2I87A 1G2SA 1V51A 2OCEA 2UUCQ 1HR0L 3H15A 1A3VA 4ED1A 3OMCA 2J0TD 4V190 5M3FH 1EIHA 4DN4M 3A74A 2W70A 1I4PA 4WRDA 2PZWA 3MTSA 3ICEA 4K5WA 2JEAI 4C3JG 5H1SE 4X3TA 2NZHA 1HPCA 2OF1A 1ILQA 2NVXA 5IWAH 2HGSA 4FXGC 1K83A 4DV1L 3CRLC 5IGEA 4XQNA 1N33Q 1B6RA 4RAYA 1EQRA 3D6CA 1BNZA 4TV9F 3S15B 1E4EB 4LAAA 3Q23A 1BNCA 3R5XA 4B3ML 2RDGA 3W5OA 4JOIC 2A19A 2NTSA 1AN8A 2EVBA 1A6XA 2F52A 3KF6B 4RFBA 3RN2A 4BY7B 3UQ8A 1XNRL 3AMUA 2YCHA 3BA9A 5L9XA 1S0OA 1EUJA 2WDTA 4LF7Q 5EGTA 2VR1A 2PMZE 1O7ZA 3I4OA 2C2EA 1IBML 5FJ8H 5I47A 2K5VA 3W1GA 2WAQE 1GKHA 4XZ3B 3ND9A 1GUTA 3M4QA 4C2MA 4QY7A 4PMWA 5IP9G 3HOXG 4A3LH 4I7HA 5DLFA 2EYLA 4A3MH 1PH7A 4HIMA 2V58A 1PRTB 1B8AA 2K75A 4NPSA 1K8OA 1DGSA 3T16A 4UP8A 5BR8L 2B63B 4LFBQ 1RK6A 1UAPA 2EQSA 4YR0A 2ENBA 2RBMA 2A68C 1VCIA 3HS0C 5JOBA 1YNJC 2WB1E 4AYBA 1EY4A 1ZXTA 4IUUA 4BWGB 4QW8A 4DLKA 1GUNA 2K52A 5M3FB 4JYAQ 2R7MA 1VQFA 4N9TA 3WDNA 4J9MA 3V6HA 1H9KA 2JA8G 1CUKA 1P8LA 3NUCA 3R5FA 2W8KA 1U9RA 1KHIA 4QWAA 4ME5A 4AYBG 3Q1KA 3ORQA 5EKLA 2L4NA 4G7ZC 3H09A 5IGFA 4MNOA 1S4ZA 3CQZH 3MWDA 3BG3A 1B53A 1S5CD 5KFXA 2E2HH 1EEFD 1K73C 4A3DB 2WAQA 5DGBA 4K8JA 4KHPQ 2C2DA 5IWAL 2YZMA 2F0FA 1EFID 1N8RC 1J5EH 2F0DA 3L9AX 2UUAH 1ENAA 2M9VA 2W6ZA 4R8NA 1HFNA 1GSHA 2WAQG 3CMEA 4EEYA 3JZIA 1YBYA 5KFDA 4CJ1B 1KABA 2YTVA 1EZ1A 1GUWA 4X66H 1SXTA 1YNNC 2TSSA 2LY7A 2W6NA 3MXNA 3M4IA 4JV0A 2ZT9C 1X56A 3RV3A 1Q1BA 2B39A 2LXJA 3GTLH 1HNWQ 3CP0A 4RNOA 1JJGA 4A3MB 1VQHA 3J7ZC 5KFNA 4FDBA 1LO5D 3PMFA 3QIAA 1VMPA 2XGTA 3HOWG 5KFMA 4HAEA 4KHVA 1KDAA 2BDOA 4RWSC 2BE5C 1O7IA 5EKKA 4AQYH 4JV2A 4WBNF 2I46A 4DV6Q 1CK1A 1X3GA 3BS1A 1XPOA 1TWFA 3N42B 2YZGA 1SLJA 5EOYA 2R8IA 3KF8A 1JE4A 2HQEA 2HUGA 1AZQA 1SN8A 1RYRA 2JSOA 1JX4A 1SDFA 1U4LA 5FPOA 3VR5A 4EFBA 3S9WA 3K0XA 1IYJB 5FK9C 1IBLH 1TS5A 1M6VA 4BY1B 3A8KE 1K0SA 2KEEA 3SK6A 4KMUC 1TR5A 2NTTA 4DR5Q 1HJPA 3OW2A 1ZYRC 2VUMH 1TQOA 3BJUA 4DR7L 2YRWA 2XWJB 4RZRA 4XYMB 1Z9FA 4BBRH 1TWAH 1K3BC 2RSOA 1MZBA 3TN2A 3A54A 1C7YA 3FMCA 1KTKA 4Q44A 2BQUA 1D7QA 2KCCA 3D4DA 1TWGH 1Q86C 2PPBC 4RA8A 2JA6A 1WCMH 1HR0W 1U4MA 1EFWA 4XYLB 1ZETA 5KFCA 3QOJA 4DL6A 4RB2C 2V1CC 2R93A 4UCUA 1J5EL 5KFTA 2DLNA 2UUAL 5C44G 4YWKA 4F8MA 4LWCA 2ASBA 4DU9A 2JA6G 1V1PA 4OO1I 2R92A 3C3LA 4L1KA 4N8FA 3Q8SB 5E7NA 4X66L 2R93G 4DAYB 2W9BA 2JEJA 3PGZA 3UDIA 4DPGA 5EKIA 4MV7A 1EIYB 1DOMA 1B50A 3BDLA 2FJ2A 5I9PA 4EQ5A 3IKJA 3T56B 4FF2A 4PWQA 3SK8A 5KG1A 5KFWA 3ERSX 3VR6A 2R92G 4A3CH 1QNUA 4G57A 1IL2A 3I2ZA 3J7YW 4YR3A 2JYOA 3L4JA 3GDEA 5C3EG 1AH9A 3SE0A 4OO1H 3DWQA 5M5WB 4DV5L 2XC9A 5L37A 4AQYL 1I50H 3E9HA 1H9MA 5CBAE 5IYBG 2VB2X 2EOTA 4IPHA 4DR1L 5L1LA 3HOVG 2YW2A 4A3IH 1I4RA 4K0KQ 5JVDF 2VA3A 1PTOB 1K1SA 3K6OA 3HKSA 3PUZA 1WTOA 4DV3Q 4LF6H 4MV3A 3BVGA 4HEDA 3I90A 4MA0A 3S1MH 3N40P 1STEA 2KHSA 4C1NI 3NBHB 2O5JC 3UE0A 1ULZA 4GKKQ 4IUPA 4BBRB 2BOSA 3D4RA 3MXGA 5CR3A 1IBLL 1YVCA 2O4XA 2CFMA 4JBJA 4R7RA 5KG3A 2TMPA 3NQTA 3AEVA 3PZPA 1N34H 3FP9A 4JI4Q 4IJLA 4U68A 4LNQA 1D8LA 3FPPA 3RLOA 1RKNA 5LL6S 4CJ0B 2IL8A 3F2UA 1JJ2A 3TQ1A 2BA1A 1IOWA 3F8TA 1NMFA 4QJFA 5AJ3L 4BBSB 3MEHA 3DEPA 1BJTA 1K3RA 2ZXPA 3AB9A 1HNZQ 1KJ9A 2E2IA 4LUZA 4LFAQ 1IW7D 4M9UA 3AU7A 2F0QA 2L9HA 5JPMC 2IHEA 4HYKA 3D6WA 1NNXA 2NVYB 2CW8A 3PV0A 1X54A 2Q2IA 2F4VH 2EJGC 2IX3A 3D4WA 4FO2A 3MWMA 4LH7A 4ZI7F 3T1YH 5DG8A 2RF4A 5EPKA 1K8AC 4C5CA 2AUKA 1I50B 5CGKA 3W2DA 1MSGA 1C0AA 4JK1C 2G9HD 3TEHB 5CYUA 1WR2A 5LL6b 4ED6A 2JA7H 4A3FG 4DUZH 4L8JA 2OQKA 3S2DH 1GOZA 5KEEA 4IJHA 5DLQE 5JEAJ 3X3MA 3QZ7A 1UC9A 1Y1WA 3LWUA 3HEJA 2FP4B 4HJ9A 5J39A 2NU9B 4MA5A 4P72A 4O3QA 1TU2B 1B2TA 3GQCA 4GNXB 5KT6A 3GIMA 2I07B 4DR2H 1QG7A 1ESFA 1QUQB 1LM0A 1R9TB 2ATWA 1IBKH 1X55A 4LF6L 1PRTD 1Y1WG 2IPKD 3BVMA 5FKAC 1BCPC 5M3MB 3HZXA 4LFCH 2E5LQ 5DLGA 4A3EG 5KFLA 5C4HA 3QWNA 2UVWA 3DHQA 2YL2A 5BPHA 1N34L 2KQ3A 1VQ4A 4YQWA 3QFFA 3PW2A 2EPBA 3CAMA 2FMMA 4GLAC 4UHVA 3QZ8A 5FOBB 3BU2A 1TWHA 5M5XH 1RJRA 1SFOA 1V8QA 2DY7A 3JAMc 5CB4F 4J9LA 4P2CB 3RFCA 4P74A 3G6YA 4LF5Q 1YEZA 3W3AA 3Q8QB 2EJFC 1ET6A 2VZAA 3CKIB 3CCSA 3CVZA 5IP7G 4Y8VB 2FK1A 2CW0C 1RF2D 1QE6A 2ID0A 2K04A 2CQAA 4MTNA 4DNTB 3LP8A 1E2VA 3MR5A 2JA5H 1QZHA 2W6PA 2NVQH 3FKIH 1B9NA 1H9SA 4ECSA 4Z9CB 1SEBD 1YJNA 4LF8H 3V4ZA 1WI5A 4PQXA 1EY9A 2BDNA 5M5YH 1BKBA 5C3XA 2F4VL 3A0JA 2P0AA 3T1YL 1VDZA 1X3QA 3E6ZX 2KECA 1GGOA 3HOUG 2K50A 4NXMH 4JI5Q 2F1MA 1QNKA 4C3HH 4MV6A 3CU7A 3M4OB 4FF3A 3Q24A 2IP4A 5JH7F 1R4PB 1HH2P 1S5DD 3GTPH 4RKBA 4DUZL 1AP0A 1ONLA 4B9XA 5C4XH 4GKJQ 4A3KB 4JUZA 3M9BA 4GN4B 4A2BA 2B3GA 1KLUD 4DAVA 3GTQH 5T14A 3KJPA 1YHQA 4DAMA 1TWCH 2GPSA 5HGTA 5J22A 3DM3A 4A75A 4DR2L 3FRPB 5F9LA 3C1FA 3TMEA 3RBDA 2YU9A 1IBKL 2A6EC 1EWCA 2R7ZA 3CCVA 5KFFA 3RBEA 3OHXC 1X65A 2HCIA 4CJ2C 4LFCL 3FMAA 3VPCA 4DV2H 2JK8A 3KDFA 1RK5A 5C4ZA 1HR0Q 5C0XI 4DKAC 4DXFA 2K03A 1UEAB 1VQOA 3K57A 3GLKA 1PH1A 1PH5A 3RZOH 5DAUA 1EYAA 2B2VC 2VQDA 4QIWA 1DYQA 1FR3A 4DV1Q 4MV4A 2XRSD 2D62A 1PX2A 2RGVA 1X3PA 3R2IA 1FGBD 4RKLA 2MQHA 4IUNA 5C0XJ 3CXCA 2JA5B 3H0GA 5C0XH 5KFGA 1LTAD 2EIFA 3SK4A 2NVQB 2ATLA 1A2TA 4X6AH 5F9NA 4A3GG 3KOJA 5A35A 3PR5B 4FF4A 4DNRB 1XMOH 4B3MQ 2DNCA 3H0GG 2PN1A 5C4JB 4I7AA 4J8QA 4R8IA 4A93G 1SJED 2B2UC 3B6YA 4LF8L 4NP5A 4N9PA 2ZDGA 2D5DA 2M00A 2Z0SA 3BQ2A 3GTPB 1IBMQ 4BA1I 4MV8A 5KFQA 1CZWA 5C4XB 1S0NA 5J1ZA 2PCFB 5DM73 1TWCB 2X6LA 3EIVA 2BH8A 4XTCS 1WD1A 3K5OA 2K4KA 2IX0A 4WORA 3VYUA 5BR8Q 4JBMA 1E4EA 4I55F 2I8CA 3U9OA 1HA6A 4DK0A 2RKSA 3PO3B 3HOYH 2R7NA 3I12A 2XCAA 4HR7B 4IO9A 4JBKA 1UNSA 1VQEA 2L55A 1JIHA 1RL2A 2E2JH 3P1HA 2GN5A 1JOOA 1PTOD 2K7VA 3M9MB 1T3NA 2CVRA 2W9CA 4DV2L 1L1OA 4DK6C 4P73A 3TIIA 2R8KA 4CDFC 1EY0A 4J0MA 3CCLA 4BY7G 1LT6D 1QVFA 1XNQQ 2RHQB 1WSCA 2A8VA 3F1ZA 4HNVA 5JVH3 3GTJA 2JP1A 1QVCA 4B9WA 3V6KA 3K3VA 3T5JA 2WFWA 2FPIB 3H4BA 2UVRA 2NU8B 4J6HA 4HIOA 5KT2A 2IWHA 5IWAQ 4DR6H 1W6KA 1K9MC 5EBCA 1QZGA 2EYMA 3L2PA 4A3BG 1O7YA 4R8UA 5C5JA 4IZ8A 3TQYA 3DM1A 3GD7A 5T1GA 2F0OA 4HSPA 3K0YA 2RDFA 4L5QA 1MSHA 4EEQA 5D65A 4O2BF 1XMOL 1PLFA 2W6MA 3GTGH 1EQVA 1CI3M 3OSPA 1OXVA 1TIID 3F2CA 5M3FG 2UXCQ 1E7ZA 2OT2A 5KKNB 1PH2A 1GM5A 4P71A 3OMGA 4NXNH 3ULJA 4GOPA 1Q82C 1Z6HA 4RB1A 1J8IA 1GSAA 4RHSA 5IT9c 1L2FA 3IFTA 1A3UA 5ELDA 1NSNS 3EVQA 2F0WA 3JSNA 1DOLA 5C8YF 4ECUA 5TSSA 4RUAA 3NTHA 2ALYB 1NCVA 2VOBA 2CCZA 2KVMA 4XX0B 2R61A 3K3PA 4J9NA 1VF5C 2IW3A 1PA6A 1GLVA 3HOYB 2I80A 1QJOA 5LL6X 3GV5B 4ECXA 2ASDA 3R8BA 3R3OA 4MV9A 3K5MA 5I9OA 1KRTA 4GLXA 2E2JB 3RLFA 2KUMA 1VS0A 1VBHA 1OXUA 4LMQD 1S97A 4RGTA 1ET9A 3GV7B 4JI7H 2NN6I 5JAVA 1VQ8A 2RDHA 3V4SA 4DR4H 3GQBA 3G71A 3I7FA 4HJAA 5JJIA 1X9NA 1UNNC 1LACA 2W7OA 4GN5A 3RZDH 1PK8A 1R4QB 4DR7Q 5FJ8G 5D1OB 2BCOA 4DL2A 5C5MA 1B4OA 1PVOA 4HTHA 5FLXE 2F0NA 3SI8A 4A3LG 4A3MG 4L63B 1W6JA 2NN6H 1VQAA 3MZ5A 3NELA 3PVXA 2F03A 1JICA 1VQKA 2QA4A 4X3UA 3GILA 4RG1A 2A69D 2VPQA 3X3NA 4DR6L 3GIPA 1B1ZA 2WIIB 2UUAQ 2ES2A 4RAUC 2W9AA 4DR3H 2B63H 3AFPA 3N6RA 2M2LA 1JB3A 1F2LA 3SE7A 2VQEQ 4P75A 3PF5A 2C5CA 1HQRD 2MUYA 2RSNA 4HQ6A 3CQZA 5EBDA 3KYHC 4GS3A 3J80c 1T5XD 2MFIA 3BYTB 2E2HA 3PO2H 3OSOA 5AFWA 5D14A 2JE6I 2XNAC 2B2TA 1U4PA 4UAIA 3CRKC 2KCNA 1LTRD 1G8ZD 2O03A 4J9QA 2ZTEA 4NXNL 1C9OA 1JORA 4F4YA 1S40A 2V4RA 2Y0SA 3LWEA 4I4TF 3PSIA 4DV5Q 4KHZA 4AQYQ 4ME6A 3LNNA 4C1NK 3K80C 3I4NH 1CKMA 1Q90A 4A3DH 4DR1Q 4ILWA 2GA4B 2VW9A 3F8NA 3NE5B 4OGQC 1EQQA 2Y0SG 2GVAA 3MAQA 3JAMi 1E4GT 2PZTA 3IN5A 3GTLA 1N36H 3ULLA 2IY5B 1S0MA 1IHZA 2G9DA 2RDIA 2L0CA 5D8DA 1Y8OB 4DAYA 2VQFH 2V4QA 2DWCA 1BUVT 3RZDB 5C3WA 5BN3A 4EVOA 4KKTA 4JI7L 1IBLQ 1S68A 2DN8A 4QWBA 4PMCA 4BS9A 1Y1VB 4ZAIA 4TQSA 4DR4L 2C35B 1Q1EA 4OHJA 5L1KA 4EQOA 4DV4H 2JJQA 2XTIA 3MC0B 3BZDB 4H02A 3AFQA 3K5LA 3TP8A 3I4MB 3K81C 5HBRB 4Q43A 2A68D 1Z7TA 3HB9A 1V1QA 1UE6A 2CHBD 1K0RA 4RU9A 2SCUB 3TSSA 5AJ3Q 3WOEA 2CWPA 1Q3LA 3GV6A 1KAWA 3PIP3 1FD7D 1HHVA 3WO1A 1XYIA 5LYJF 3RB4A 3NHHA 5DGAA 4DAPA 2LKVA 3K59A 3PO2B 4X64L 2VUMA 1LLRD 4DR3L 4IALA 1MIUA 3OIPA 2JEFA 1TWAA 2B2YA 4JG2A 2PYKA 2VUMG 3I8ZA 4BY1H 1TWGA 3PW7A 5KG0A 2VB3X 1KJ8A 2PMZA 1WCMA 4KKSA 2FK3A 1RDPD 1PYSB 1HFGA 4ED7A 3I4NB 4RCNA 5T1IA 3KBGA 2HHHQ 3VPDA 4OIKA 2VL6A 3OTOH 3SHLA 5KT3A 2AUJD 5LMNH 1WCMG 4CDDC 1AN7A 4TV8F 3WNZA 2JEGA 3EA6A 1YJWA 1VQ6A 4QWEA 4OWTB 3M7NA 2R7LA 3BJYA 2Z8LA 2E8GA 4FNFA 3G7LA
chains in the Genus database with same CATH topology
1UE1A 1JJ2A 2BA1A 3F8TA 4DNIA 1NMFA 1X3EA 4QJFA 4YWMA 5AJ3L 2PQAB 1VQGA 1K3RA 4LF6Q 1N36L 1Y1VH 1HNZQ 4X65L 3CPWA 4LUZA 2ZJRA 2VQFL 1VQ5A 3RR5A 4LFAQ 3G4SA 1CSPA 2WB1G 2ZTDA 1X6OA 3PUYA 4HJ8A 3PUVA 2IHFA 2IHEA 1N34Q 3I4MH 1I6HH 4A3CG 4IOCA 3OTOQ 1CSQA 5IYCH 5LMNQ 3PV0A 4DV4L 1J5EQ 4HJ5A 1X54A 1KXLA 2Q2IA 4OO1G 4JI5L 4ME3A 4APVA 2N78A 4DV3L 1K8GA 1GO3E 3SGIA 3RNUA 1YITA 1SFOH 3BZKA 2RF4A 3CCEA 1K8AC 1KRSA 2ZJPA 1UWVA 5M5WH 4JV5Q 1C0AA 4X66Q 1X3FA 4JBWA 3TEHB 1NBWA 4R4QA 4A4IA 4A3IG 2PI2A 3A5ZB 3S1QH 3L0OA 3UDFA 3T1HQ 5J3BA 1ASYA 2IX1A 3TRZA 2JA7H 4BY1G 4A3FG 4L5SA 2Q2TA 2OQKA 3S2DH 4IJHA 4RMFA 5DLQE 5JEAJ 4IFDI 3NEMA 5LMUL 4GN3B 3HOUH 4HJ9A 3GTOH 1JJCB 4IPGA 1OXSC 4P72A 3K7UC 5K36G 2N8NA 3PUXA 4GNXB 4DR3Q 4YCVA 4TVAB 2ATWA 1QUQB 1LM0A 3I55A 3PF4A 5EAYA 1X55A 4LF6L 3T1YQ 1M1KC 2OWOA 3U4VA 1Y1WG 1HNZL 1PFSA 3KJOA 1PYBA 1VQ9A 2MNAA 2AHOB 3AYHB 5GAGC 2E5LQ 4LFAL 4A3EG 4IFDJ 3VDYA 3AQQA 4XIGS 1UE7A 1PV4A 3W1BA 3M3YH 1Y14B 3CF5A 1N34L 1VQ4A 2F3IA 1L0WA 1G291 2HIXA 3OTOL 1HZBA 3G48A 3ULPA 5HY6A 5LMNL 4L5RC 3CAMA 4Y52H 1Y1VG 4GLAC 2N3SA 2NN6G 3JC66 4BBSH 1NTGA 3BU2A 5HGQA 3TREA 4AYBE 5M5XH 1HNXQ 3JAMc 3I56A 4AIMA 2UUBL 4P74A 2PNHA 1M90C 4JV5L 3I4MG 4LF5Q 1YEZA 3CPFA 1VQCA 2YU9H 2VZAA 3D31A 3CCSA 4A3JG 4LF9L 2UXBL 5IP7G 2R7ZH 1YHAA 1IBKQ 2AWOA 1JB7A 3T1HL 2ID0A 1YJ9A 1I94Q 4MTNA 2NVYH 4JI8L 4LFCQ 4Y7NH 2JA5H 1QZHA 1IZ6A 3FHWA 3S1NH 2AMCB 3J81c 2NVQH 3ZJYC 3GTKH 5IE8A 1N32L 3TS2A 3PO2G 3FKIH 1L1OB 1JE5A 1YHBA 4PZ7A 1YJNA 1PH6A 5IYDG 1WI5A 2KHJA 3G6EA 5M5YH 1BKBA 4LF4Q 3F2BA 2KBNA 1EYGA 2F4VL 2JA7G 2UUCL 3A0JA 1OXTA 3CC7A 4A3GH 5JJKA 1EWIA 1MKHA 3T1YL 4OWWB 2B29A 2FXQA 1G51A 2CWAA 1BBWA 1VQIA 3H0GH 1AE2A 4DV4Q 4KLKA 5JEAG 2E5LL 3HOUG 2K50A 3KFUA 1Z47A 4JI5Q 4A93H 4MZ9A 2R6GA 3MEFA 5FLMH 4IPDA 3UDXA 4C3HH 1FVIA 1EIFA 5JJLA 4JCVE 4BBRG 4OXPA 4UY8C 1HH2P 1SR3A 3GTPH 1N9WA 3KLWA 4DUZL 1UE5A 3U50C 5C4XH 1UEBA 4DV7L 1KD1C 4GKJQ 1R9TH 3M9BA 4GN4B 4DUYQ 2B3GA 4IFDG 2HQLA 2PQAA 4OX9Q 1H95A 1HNXL 3GTQH 1BBUA 3KJPA 1YHQA 4DAMA 4IPCA 4DV0Q 1TWCH 5M3MH 4LF8Q 2GVBA 3DM3A 4A75A 4LF5L 4DR2L 2VS1A 1S72A 3PIOA 2QGQA 5LMUQ 1SROA 1YZ6A 1E3PA 3K8AA 1IBKL 3K7AH 4C3JH 1A63A 3CCVA 1XNQL 2LXKA 4BBSG 1X65A 1I94L 4LFCL 4GOPB 3WWVA 4JI6Q 2JK8A 4POFA 3KDFA 3HOZG 4UP7A 1HR0Q 2LSSA 1VQNA 5C0XI 4JI0Q 4DKAC 3L7ZC 1RIPA 4YY3Q 2OTLA 2R7FA 4POGA 1VQOA 2ZJQA 3S15H 1PH1A 4B3RQ 1NMGA 3CCMA 3CC2A 1PH5A 1CKOA 4LF4L 3RZOH 2NVXH 5ELNA 1K83H 2D0OA 3D0FA 1PHJA 4DV1Q 3KDFB 3PUWA 2D62A 1FJGL 1AE3A 4R4CA 3CCUA 2MQHA 5C0XJ 3CXCA 2UXDQ 4IOAA 3FKIG 5FLXc 1E1OA 4BY7H 4YCWA 4LFBL 2EIFA 4B3SQ 1Q7YC 1EOVA 5GADC 1PH3A 2Y0SE 4LUOA 4X6AH 2K14A 4GNXC 2UUBQ 4A3GG 3S14H 3KOJA 5IY0A 3CCJA 2UXCL 1I5FA 4DV2Q 4B3MQ 3A5UA 3H0GG 4LF9Q 2UXBQ 3HFZB 3J80i 3CC4A 4GKJL 4GNXA 4A3BH 1LYLA 4DUYL 4A93G 5FLMG 1Q8KA 1QUQA 2H5XA 4YHHQ 3GTJH 3B6YA 2K5HA 2ZM6Q 4OX9L 2Z6KC 4JI8Q 5IP9H 3MXNB 3HOXH 4DV0L 4J15A 4LF8L 1PH9A 2WP8J 1OXXK 1N32Q 2Z0SA 2Z6KA 3M4OH 1B70B 1IBMQ 4BA1I 4BA2I 1PH4A 2MO0A 4C2MH 3RN5A 4JI6L 2F4VQ 2OCEA 1VQDA 5ELOA 2UUCQ 1HR0L 3H15A 4JI0L 3ER0A 1WJJA 5M3MG 5M3FH 4YY3L 4A3KH 3A74A 1LUZA 4JI7Q 1WYDA 3EIVA 2BH8A 4XTCS 3ICEA 2JEAI 1A8VA 2K4KA 2IX0A 2JA8H 4B3RL 5H1SE 5BR8Q 1MJEA 2NZHA 4JBMA 1XTDA 3KF8B 4DV1L 4A76A 3HOYH 1XPUA 4DUZQ 1N33Q 4IO9A 1Q12A 4JBKA 2UXDL 2EXDA 1VQEA 1EQRA 4DV7Q 4B3SL 1OTCA 1L1OC 1WOCA 2KHIA 1RL2A 2E2JH 4QQBX 2GN5A 2OQ0A 1VQ7A 2HIVA 4DR2Q 4DV2L 1HZAA 1L1OA 1LTLA 4P73A 4DK6C 5IYCG 4B3ML 2Q2UA 3W5OA 4JOIC 2NVTH 2A19A 4X62Q 4HIDA 2BA0A 3CCLA 1KL9A 5C0XG 1QVFA 1XNQQ 4BY7G 4YHHL 2RHQB 2F52A 3KF6B 2ZM6L 2A8VA 3F1ZA 3RN2A 4JOIA 1QVCA 4UPAA 1XNRL 2WFWA 4PG3A 4YWLA 4JI1Q 1EUJA 4HIOA 4LF7Q 1S3OA 2PMZE 2ZTCA 3I4OA 5IWAQ 1IBML 2VQEL 1ASZA 1K9MC 5FJ8H 3E9IA 3L2PA 1QZGA 2JA9A 2K5VA 1E1TA 3W1GA 1PH8A 4A3BG 2WAQE 1GKHA 2R7DA 5LMNW 4JC0A 4HIKA 1W3SA 3M4QA 2MO1A 3GO5A 3RLNA 3TQYA 4QY7A 4PMWA 5IP9G 3HOXG 4A3LH 2KCMA 3GD7A 4A3MH 3DLLA 4HIMA 5C4JH 1PH7A 1FJGQ 1B8AA 2K75A 4L5QA 2K5NA 4NPSA 1DGSA 4UP8A 5BR8L 1XMOL 4LFBQ 3HOWH 3GTGH 2RHSB 4KI0A 2EQSA 4JI3Q 1VCIA 3J7A5 1OXVA 2WB1E 3F2CA 4DR5L 4GOPC 5M3FG 2CKZB 3EBEA 4R1JA 2UXCQ 1E7ZA 3M4PA 4A3KG 1N33L 2K52A 1PH2A 4JYAQ 1VQFA 1A62A 2A1AA 4P71A 1GM5A 3ULJA 4GOPA 1CUKA 1P8LA 3U4ZA 1Q82C 1P16A 1KC8C 2JA8G 1KHIA 1CKNA 5IT9c 1L2FA 3H3VI 4AYBG 1TWFH 2ALYB 1JT8A 4EX5A 4WJ4A 2CCZA 3U58A 1YI2A 4X62L 1PA6A 2YYZA 4MNOA 2KENA 1VQJA 3CQZH 1W2BA 3PO3H 1VQLA 2E2HH 4NXMQ 4R4IA 1CKNB 1K73C 4JI1L 1KRTA 4GLXA 4TQUS 3RLFA 4LF7L 4KHPQ 1VS0A 1G6PA 1OXUA 5IWAL 2R7ZG 1N8RC 5GROA 4BXXH 1FGUA 4WJ3M 2NN6I 3CCQA 1VQ8A 2WAQG 2YTXA 3CMEA 2JA5G 4NXNQ 3G71A 1YBYA 3I7FA 4O2DA 4HJAA 4A3EH 1WFQA 4LUVA 2YTVA 5JJIA 1X9NA 2I5LX 3UDGA 4GN5A 4QL5A 3RZDH 4DR7Q 5FJ8G 3S2HH 4JI3L 1YNXA 1PVOA 3STBC 1X56A 5C44H 4A3LG 1Q1BA 2LXJA 3GTLH 4A3MG 1HNWQ 3TS0A 3CP0A 1VQAA 3NELA 3BZCA 3UE1A 4JYAL 1JJGA 2JA6H 1VQKA 1VQHA 3J7ZC 2QA4A 2OTJA 1U5KA 4FDBA 4RG1A 2HT1A 2XGTA 4B3TQ 3HOWG 1E22A 1U0LA 3E0EA 2R93H 4C3IH 5GQOA 4DR6L 1HZ9A 1O7IA 1XNRQ 4GLVB 4K0KL 2KCTA 4A3JH 4DV6Q 5IP7H 2ES2A 1E24A 1X3GA 1JMCA 1FL0A 3AFPA 4AH6A 1XPOA 2UUAQ 2B63H 1SLJA 1TWHH 2BH2A 1VQPA 3HKZE 4JI2Q 5C4XG 2VQEQ 4DR4Q 2YV5A 4P75A 3CD6A 2R92H 3PF5A 1SN8A 1V9PA 4OONA 3KYHC 4GS3A 3J80c 1I3QH 5C3EH 1KIXA 4NXML 4GKKL 2VNUD 2MFIA 3PO2H 2HHHL 4KHPL 2JE6I 1NE3A 5IYDH 1TXYA 2CQOA 1HZCA 4JI4L 5IYBH 3K0XA 1VQMA 4HJ7A 1XMOQ 3S17H 1IYJB 3CW2C 3HOVH 3PO3G 2ZTEA 4L5TA 4NXNL 1C9OA 4DR5Q 1S40A 1HJPA 2AWNA 2DGYA 3OW2A 3PSIA 4DV5Q 2VUMH 4KHZA 4AQYQ 3NENA 3BJUA 1SE8A 4X64Q 3KF6A 4DR7L 4BXXG 1Z9FA 3K80C 4BBRH 1NJIC 3I4NH 1CKMA 1BVSA 1TWAH 4DR1Q 1XMQQ 4A3DH 1T9HA 2VW9A 1C7YA 1EQQA 2Y0SG 1HNWL 2GVAA 2I5MX 3JAMi 1D7QA 3LGJA 1TWGH 2L15A 1Q86C 3ULLA 2IY5B 1WCMH 1HR0W 4B3TL 1EFWA 3CMAA 2V1CC 3S24A 2D0PA 1V43A 1J5EL 4DV6L 4PZ6A 5C44G 4ALPA 4YWKA 1IBLQ 2UUAL 4JI7L 4LWCA 2ASBA 4LW1A 4JI2L 1GVPA 2JA6G 4DR4L 2C35B 1Q1EA 3J81i 4O0AA 2UU9Q 3HOZH 4OO1I 2JJQA 3HKZG 2XTIA 3PCOB 1SMXA 5GAEC 2DUDA 5E7NA 4X66L 4H02A 3AFQA 4UP9A 4DAYB 3PGZA 3UDIA 4QGUA 3CCRA 4DPGA 1IXRA 3S1RH 2N49A 3F2DA 3K81C 2RCNA 1EIYB 2B63G 3M85A 1V1QA 1UE6A 3GTMH 5GAHC 2YTYA 4EQ5A 1K0RA 1J6QA 1XJVA 4R4TA 2VY3A 5AJ3Q 3ERSX 2CWPA 2R92G 4A3CH 1IL2A 1KAWA 3I2ZA 3J81j 4DK3C 2E2IH 1N36Q 3GDEA 5C3EG 1AH9A 4X65Q 2VQFQ 4DV5L 4AQYL 4YCUA 2QEXA 1I50H 3Q8DA 1Q81C 4X64L 1YIJA 2NZOA 3E9HA 5IYBG 4DR3L 4OWXB 1MIUA 1XMQL 4IPHA 4DR1L 3HOVG 4PZ8A 1XPRA 1VQBA 4DR6Q 1MJCA 4A3IH 1SRUA 3OYYA 4JG2A 4K0KQ 3HKSA 3HOYG 3PUZA 4QIWE 2VUMG 4DV3Q 3S16H 4BY1H 3IRBA 4A3FH 1QVGA 3S1MH 4NB3A 2JEBI 3NBHB 2R93G 3UE0A 3I4NG 4A3DG 1PYSB 4GKKQ 2AKWB 2I0QA 1IBLL 1NY4A 1YVCA 2Q2HA 2CFMA 4JBJA 2JQOA 3PIPA 1Q46A 2HHHQ 1B7YB 2VL6A 3AEVA 2IT1A 3H3VH 3FP9A 2I5HA 4JI4Q 4IJLA 2UU9L 1KQSA 1WCMG 3EN2A 1D8LA 1A0IA 1GD7A 4LNQA 3RLOA 2PI2E 1Y1WH 1YJWA 1VQ6A 4OWTB 3M7NA 4R4OA 2E8GA 3STBD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UE1 A;  1JJ2 A;  2BA1 A;  3F8T A;  4DNI A;  1NMF A;  1X3E A;  4QJF A;  4YWM A;  5AJ3 L;  2PQA B;  1VQG A;  1K3R A;  4LF6 Q;  1N36 L;  1Y1V H;  1HNZ Q;  4X65 L;  3CPW A;  4LUZ A;  2ZJR A;  2VQF L;  1VQ5 A;  3RR5 A;  4LFA Q;  3G4S A;  1CSP A;  2WB1 G;  2ZTD A;  1X6O A;  3PUY A;  4HJ8 A;  3PUV A;  2IHF A;  2IHE A;  1N34 Q;  3I4M H;  1I6H H;  4A3C G;  4IOC A;  3OTO Q;  1CSQ A;  5IYC H;  5LMN Q;  3PV0 A;  4DV4 L;  1J5E Q;  4HJ5 A;  1X54 A;  1KXL A;  2Q2I A;  4OO1 G;  4JI5 L;  4ME3 A;  4APV A;  2N78 A;  4DV3 L;  1K8G A;  1GO3 E;  3SGI A;  3RNU A;  1YIT A;  1SFO H;  3BZK A;  2RF4 A;  3CCE A;  1K8A C;  1KRS A;  2ZJP A;  1UWV A;  5M5W H;  4JV5 Q;  1C0A A;  4X66 Q;  1X3F A;  4JBW A;  3TEH B;  1NBW A;  4R4Q A;  4A4I A;  4A3I G;  2PI2 A;  3A5Z B;  3S1Q H;  3L0O A;  3UDF A;  3T1H Q;  5J3B A;  1ASY A;  2IX1 A;  3TRZ A;  2JA7 H;  4BY1 G;  4A3F G;  4L5S A;  2Q2T A;  2OQK A;  3S2D H;  4IJH A;  4RMF A;  5DLQ E;  5JEA J;  4IFD I;  3NEM A;  5LMU L;  4GN3 B;  3HOU H;  4HJ9 A;  3GTO H;  1JJC B;  4IPG A;  1OXS C;  4P72 A;  3K7U C;  5K36 G;  2N8N A;  3PUX A;  4GNX B;  4DR3 Q;  4YCV A;  4TVA B;  2ATW A;  1QUQ B;  1LM0 A;  3I55 A;  3PF4 A;  5EAY A;  1X55 A;  4LF6 L;  3T1Y Q;  1M1K C;  2OWO A;  3U4V A;  1Y1W G;  1HNZ L;  1PFS A;  3KJO A;  1PYB A;  1VQ9 A;  2MNA A;  2AHO B;  3AYH B;  5GAG C;  2E5L Q;  4LFA L;  4A3E G;  4IFD J;  3VDY A;  3AQQ A;  4XIG S;  1UE7 A;  1PV4 A;  3W1B A;  3M3Y H;  1Y14 B;  3CF5 A;  1N34 L;  1VQ4 A;  2F3I A;  1L0W A;  1G29 1;  2HIX A;  3OTO L;  1HZB A;  3G48 A;  3ULP A;  5HY6 A;  5LMN L;  4L5R C;  3CAM A;  4Y52 H;  1Y1V G;  4GLA C;  2N3S A;  2NN6 G;  3JC6 6;  4BBS H;  1NTG A;  3BU2 A;  5HGQ A;  3TRE A;  4AYB E;  5M5X H;  1HNX Q;  3JAM c;  3I56 A;  4AIM A;  2UUB L;  4P74 A;  2PNH A;  1M90 C;  4JV5 L;  3I4M G;  4LF5 Q;  1YEZ A;  3CPF A;  1VQC A;  2YU9 H;  2VZA A;  3D31 A;  3CCS A;  4A3J G;  4LF9 L;  2UXB L;  5IP7 G;  2R7Z H;  1YHA A;  1IBK Q;  2AWO A;  1JB7 A;  3T1H L;  2ID0 A;  1YJ9 A;  1I94 Q;  4MTN A;  2NVY H;  4JI8 L;  4LFC Q;  4Y7N H;  2JA5 H;  1QZH A;  1IZ6 A;  3FHW A;  3S1N H;  2AMC B;  3J81 c;  2NVQ H;  3ZJY C;  3GTK H;  5IE8 A;  1N32 L;  3TS2 A;  3PO2 G;  3FKI H;  1L1O B;  1JE5 A;  1YHB A;  4PZ7 A;  1YJN A;  1PH6 A;  5IYD G;  1WI5 A;  2KHJ A;  3G6E A;  5M5Y H;  1BKB A;  4LF4 Q;  3F2B A;  2KBN A;  1EYG A;  2F4V L;  2JA7 G;  2UUC L;  3A0J A;  1OXT A;  3CC7 A;  4A3G H;  5JJK A;  1EWI A;  1MKH A;  3T1Y L;  4OWW B;  2B29 A;  2FXQ A;  1G51 A;  2CWA A;  1BBW A;  1VQI A;  3H0G H;  1AE2 A;  4DV4 Q;  4KLK A;  5JEA G;  2E5L L;  3HOU G;  2K50 A;  3KFU A;  1Z47 A;  4JI5 Q;  4A93 H;  4MZ9 A;  2R6G A;  3MEF A;  5FLM H;  4IPD A;  3UDX A;  4C3H H;  1FVI A;  1EIF A;  5JJL A;  4JCV E;  4BBR G;  4OXP A;  4UY8 C;  1HH2 P;  1SR3 A;  3GTP H;  1N9W A;  3KLW A;  4DUZ L;  1UE5 A;  3U50 C;  5C4X H;  1UEB A;  4DV7 L;  1KD1 C;  4GKJ Q;  1R9T H;  3M9B A;  4GN4 B;  4DUY Q;  2B3G A;  4IFD G;  2HQL A;  2PQA A;  4OX9 Q;  1H95 A;  1HNX L;  3GTQ H;  1BBU A;  3KJP A;  1YHQ A;  4DAM A;  4IPC A;  4DV0 Q;  1TWC H;  5M3M H;  4LF8 Q;  2GVB A;  3DM3 A;  4A75 A;  4LF5 L;  4DR2 L;  2VS1 A;  1S72 A;  3PIO A;  2QGQ A;  5LMU Q;  1SRO A;  1YZ6 A;  1E3P A;  3K8A A;  1IBK L;  3K7A H;  4C3J H;  1A63 A;  3CCV A;  1XNQ L;  2LXK A;  4BBS G;  1X65 A;  1I94 L;  4LFC L;  4GOP B;  3WWV A;  4JI6 Q;  2JK8 A;  4POF A;  3KDF A;  3HOZ G;  4UP7 A;  1HR0 Q;  2LSS A;  1VQN A;  5C0X I;  4JI0 Q;  4DKA C;  3L7Z C;  1RIP A;  4YY3 Q;  2OTL A;  2R7F A;  4POG A;  1VQO A;  2ZJQ A;  3S15 H;  1PH1 A;  4B3R Q;  1NMG A;  3CCM A;  3CC2 A;  1PH5 A;  1CKO A;  4LF4 L;  3RZO H;  2NVX H;  5ELN A;  1K83 H;  2D0O A;  3D0F A;  1PHJ A;  4DV1 Q;  3KDF B;  3PUW A;  2D62 A;  1FJG L;  1AE3 A;  4R4C A;  3CCU A;  2MQH A;  5C0X J;  3CXC A;  2UXD Q;  4IOA A;  3FKI G;  5FLX c;  1E1O A;  4BY7 H;  4YCW A;  4LFB L;  2EIF A;  4B3S Q;  1Q7Y C;  1EOV A;  5GAD C;  1PH3 A;  2Y0S E;  4LUO A;  4X6A H;  2K14 A;  4GNX C;  2UUB Q;  4A3G G;  3S14 H;  3KOJ A;  5IY0 A;  3CCJ A;  2UXC L;  1I5F A;  4DV2 Q;  4B3M Q;  3A5U A;  3H0G G;  4LF9 Q;  2UXB Q;  3HFZ B;  3J80 i;  3CC4 A;  4GKJ L;  4GNX A;  4A3B H;  1LYL A;  4DUY L;  4A93 G;  5FLM G;  1Q8K A;  1QUQ A;  2H5X A;  4YHH Q;  3GTJ H;  3B6Y A;  2K5H A;  2ZM6 Q;  4OX9 L;  2Z6K C;  4JI8 Q;  5IP9 H;  3MXN B;  3HOX H;  4DV0 L;  4J15 A;  4LF8 L;  1PH9 A;  2WP8 J;  1OXX K;  1N32 Q;  2Z0S A;  2Z6K A;  3M4O H;  1B70 B;  1IBM Q;  4BA1 I;  4BA2 I;  1PH4 A;  2MO0 A;  4C2M H;  3RN5 A;  4JI6 L;  2F4V Q;  2OCE A;  1VQD A;  5ELO A;  2UUC Q;  1HR0 L;  3H15 A;  4JI0 L;  3ER0 A;  1WJJ A;  5M3M G;  5M3F H;  4YY3 L;  4A3K H;  3A74 A;  1LUZ A;  4JI7 Q;  1WYD A;  3EIV A;  2BH8 A;  4XTC S;  3ICE A;  2JEA I;  1A8V A;  2K4K A;  2IX0 A;  2JA8 H;  4B3R L;  5H1S E;  5BR8 Q;  1MJE A;  2NZH A;  4JBM A;  1XTD A;  3KF8 B;  4DV1 L;  4A76 A;  3HOY H;  1XPU A;  4DUZ Q;  1N33 Q;  4IO9 A;  1Q12 A;  4JBK A;  2UXD L;  2EXD A;  1VQE A;  1EQR A;  4DV7 Q;  4B3S L;  1OTC A;  1L1O C;  1WOC A;  2KHI A;  1RL2 A;  2E2J H;  4QQB X;  2GN5 A;  2OQ0 A;  1VQ7 A;  2HIV A;  4DR2 Q;  4DV2 L;  1HZA A;  1L1O A;  1LTL A;  4P73 A;  4DK6 C;  5IYC G;  4B3M L;  2Q2U A;  3W5O A;  4JOI C;  2NVT H;  2A19 A;  4X62 Q;  4HID A;  2BA0 A;  3CCL A;  1KL9 A;  5C0X G;  1QVF A;  1XNQ Q;  4BY7 G;  4YHH L;  2RHQ B;  2F52 A;  3KF6 B;  2ZM6 L;  2A8V A;  3F1Z A;  3RN2 A;  4JOI A;  1QVC A;  4UPA A;  1XNR L;  2WFW A;  4PG3 A;  4YWL A;  4JI1 Q;  1EUJ A;  4HIO A;  4LF7 Q;  1S3O A;  2PMZ E;  2ZTC A;  3I4O A;  5IWA Q;  1IBM L;  2VQE L;  1ASZ A;  1K9M C;  5FJ8 H;  3E9I A;  3L2P A;  1QZG A;  2JA9 A;  2K5V A;  1E1T A;  3W1G A;  1PH8 A;  4A3B G;  2WAQ E;  1GKH A;  2R7D A;  5LMN W;  4JC0 A;  4HIK A;  1W3S A;  3M4Q A;  2MO1 A;  3GO5 A;  3RLN A;  3TQY A;  4QY7 A;  4PMW A;  5IP9 G;  3HOX G;  4A3L H;  2KCM A;  3GD7 A;  4A3M H;  3DLL A;  4HIM A;  5C4J H;  1PH7 A;  1FJG Q;  1B8A A;  2K75 A;  4L5Q A;  2K5N A;  4NPS A;  1DGS A;  4UP8 A;  5BR8 L;  1XMO L;  4LFB Q;  3HOW H;  3GTG H;  2RHS B;  4KI0 A;  2EQS A;  4JI3 Q;  1VCI A;  3J7A 5;  1OXV A;  2WB1 E;  3F2C A;  4DR5 L;  4GOP C;  5M3F G;  2CKZ B;  3EBE A;  4R1J A;  2UXC Q;  1E7Z A;  3M4P A;  4A3K G;  1N33 L;  2K52 A;  1PH2 A;  4JYA Q;  1VQF A;  1A62 A;  2A1A A;  4P71 A;  1GM5 A;  3ULJ A;  4GOP A;  1CUK A;  1P8L A;  3U4Z A;  1Q82 C;  1P16 A;  1KC8 C;  2JA8 G;  1KHI A;  1CKN A;  5IT9 c;  1L2F A;  3H3V I;  4AYB G;  1TWF H;  2ALY B;  1JT8 A;  4EX5 A;  4WJ4 A;  2CCZ A;  3U58 A;  1YI2 A;  4X62 L;  1PA6 A;  2YYZ A;  4MNO A;  2KEN A;  1VQJ A;  3CQZ H;  1W2B A;  3PO3 H;  1VQL A;  2E2H H;  4NXM Q;  4R4I A;  1CKN B;  1K73 C;  4JI1 L;  1KRT A;  4GLX A;  4TQU S;  3RLF A;  4LF7 L;  4KHP Q;  1VS0 A;  1G6P A;  1OXU A;  5IWA L;  2R7Z G;  1N8R C;  5GRO A;  4BXX H;  1FGU A;  4WJ3 M;  2NN6 I;  3CCQ A;  1VQ8 A;  2WAQ G;  2YTX A;  3CME A;  2JA5 G;  4NXN Q;  3G71 A;  1YBY A;  3I7F A;  4O2D A;  4HJA A;  4A3E H;  1WFQ A;  4LUV A;  2YTV A;  5JJI A;  1X9N A;  2I5L X;  3UDG A;  4GN5 A;  4QL5 A;  3RZD H;  4DR7 Q;  5FJ8 G;  3S2H H;  4JI3 L;  1YNX A;  1PVO A;  3STB C;  1X56 A;  5C44 H;  4A3L G;  1Q1B A;  2LXJ A;  3GTL H;  4A3M G;  1HNW Q;  3TS0 A;  3CP0 A;  1VQA A;  3NEL A;  3BZC A;  3UE1 A;  4JYA L;  1JJG A;  2JA6 H;  1VQK A;  1VQH A;  3J7Z C;  2QA4 A;  2OTJ A;  1U5K A;  4FDB A;  4RG1 A;  2HT1 A;  2XGT A;  4B3T Q;  3HOW G;  1E22 A;  1U0L A;  3E0E A;  2R93 H;  4C3I H;  5GQO A;  4DR6 L;  1HZ9 A;  1O7I A;  1XNR Q;  4GLV B;  4K0K L;  2KCT A;  4A3J H;  4DV6 Q;  5IP7 H;  2ES2 A;  1E24 A;  1X3G A;  1JMC A;  1FL0 A;  3AFP A;  4AH6 A;  1XPO A;  2UUA Q;  2B63 H;  1SLJ A;  1TWH H;  2BH2 A;  1VQP A;  3HKZ E;  4JI2 Q;  5C4X G;  2VQE Q;  4DR4 Q;  2YV5 A;  4P75 A;  3CD6 A;  2R92 H;  3PF5 A;  1SN8 A;  1V9P A;  4OON A;  3KYH C;  4GS3 A;  3J80 c;  1I3Q H;  5C3E H;  1KIX A;  4NXM L;  4GKK L;  2VNU D;  2MFI A;  3PO2 H;  2HHH L;  4KHP L;  2JE6 I;  1NE3 A;  5IYD H;  1TXY A;  2CQO A;  1HZC A;  4JI4 L;  5IYB H;  3K0X A;  1VQM A;  4HJ7 A;  1XMO Q;  3S17 H;  1IYJ B;  3CW2 C;  3HOV H;  3PO3 G;  2ZTE A;  4L5T A;  4NXN L;  1C9O A;  4DR5 Q;  1S40 A;  1HJP A;  2AWN A;  2DGY A;  3OW2 A;  3PSI A;  4DV5 Q;  2VUM H;  4KHZ A;  4AQY Q;  3NEN A;  3BJU A;  1SE8 A;  4X64 Q;  3KF6 A;  4DR7 L;  4BXX G;  1Z9F A;  3K80 C;  4BBR H;  1NJI C;  3I4N H;  1CKM A;  1BVS A;  1TWA H;  4DR1 Q;  1XMQ Q;  4A3D H;  1T9H A;  2VW9 A;  1C7Y A;  1EQQ A;  2Y0S G;  1HNW L;  2GVA A;  2I5M X;  3JAM i;  1D7Q A;  3LGJ A;  1TWG H;  2L15 A;  1Q86 C;  3ULL A;  2IY5 B;  1WCM H;  1HR0 W;  4B3T L;  1EFW A;  3CMA A;  2V1C C;  3S24 A;  2D0P A;  1V43 A;  1J5E L;  4DV6 L;  4PZ6 A;  5C44 G;  4ALP A;  4YWK A;  1IBL Q;  2UUA L;  4JI7 L;  4LWC A;  2ASB A;  4LW1 A;  4JI2 L;  1GVP A;  2JA6 G;  4DR4 L;  2C35 B;  1Q1E A;  3J81 i;  4O0A A;  2UU9 Q;  3HOZ H;  4OO1 I;  2JJQ A;  3HKZ G;  2XTI A;  3PCO B;  1SMX A;  5GAE C;  2DUD A;  5E7N A;  4X66 L;  4H02 A;  3AFQ A;  4UP9 A;  4DAY B;  3PGZ A;  3UDI A;  4QGU A;  3CCR A;  4DPG A;  1IXR A;  3S1R H;  2N49 A;  3F2D A;  3K81 C;  2RCN A;  1EIY B;  2B63 G;  3M85 A;  1V1Q A;  1UE6 A;  3GTM H;  5GAH C;  2YTY A;  4EQ5 A;  1K0R A;  1J6Q A;  1XJV A;  4R4T A;  2VY3 A;  5AJ3 Q;  3ERS X;  2CWP A;  2R92 G;  4A3C H;  1IL2 A;  1KAW A;  3I2Z A;  3J81 j;  4DK3 C;  2E2I H;  1N36 Q;  3GDE A;  5C3E G;  1AH9 A;  4X65 Q;  2VQF Q;  4DV5 L;  4AQY L;  4YCU A;  2QEX A;  1I50 H;  3Q8D A;  1Q81 C;  4X64 L;  1YIJ A;  2NZO A;  3E9H A;  5IYB G;  4DR3 L;  4OWX B;  1MIU A;  1XMQ L;  4IPH A;  4DR1 L;  3HOV G;  4PZ8 A;  1XPR A;  1VQB A;  4DR6 Q;  1MJC A;  4A3I H;  1SRU A;  3OYY A;  4JG2 A;  4K0K Q;  3HKS A;  3HOY G;  3PUZ A;  4QIW E;  2VUM G;  4DV3 Q;  3S16 H;  4BY1 H;  3IRB A;  4A3F H;  1QVG A;  3S1M H;  4NB3 A;  2JEB I;  3NBH B;  2R93 G;  3UE0 A;  3I4N G;  4A3D G;  1PYS B;  4GKK Q;  2AKW B;  2I0Q A;  1IBL L;  1NY4 A;  1YVC A;  2Q2H A;  2CFM A;  4JBJ A;  2JQO A;  3PIP A;  1Q46 A;  2HHH Q;  1B7Y B;  2VL6 A;  3AEV A;  2IT1 A;  3H3V H;  3FP9 A;  2I5H A;  4JI4 Q;  4IJL A;  2UU9 L;  1KQS A;  1WCM G;  3EN2 A;  1D8L A;  1A0I A;  1GD7 A;  4LNQ A;  3RLO A;  2PI2 E;  1Y1W H;  1YJW A;  1VQ6 A;  4OWT B;  3M7N A;  4R4O A;  2E8G A;  3STB D; 
#chains in the Genus database with same CATH topology
 4JW0 A;  2F0G A;  1JKJ B;  2WB1 A;  4JV5 H;  2K6A A;  1GUG A;  4UCO A;  4E6I A;  2PQA B;  3KLR A;  3MWY W;  3SEB A;  4LF9 H;  3LX0 A;  3VYR A;  4LF6 Q;  1N36 L;  3T1H H;  3NK9 A;  3OSN A;  3VA5 A;  4FF1 A;  4F4X A;  2ZJR A;  2VQF L;  4JI8 H;  3C2P A;  2BE5 D;  3EYY A;  3TBI B;  3BA8 A;  2WB1 G;  2IA6 A;  2VA2 A;  4NKL A;  2ZTD A;  1D5X C;  4HCE A;  1I50 A;  5L1I A;  3MXP A;  3NSW A;  2IHF A;  5CV5 A;  1N34 Q;  5FO7 B;  4A3C G;  1TA8 A;  1T36 A;  4DV4 L;  2Z1C A;  4QF4 A;  4OO1 G;  1IKM A;  4IAJ A;  3S1N B;  5L1J A;  2UUC H;  5KFU A;  1JWS D;  1E2W A;  5KIX A;  1EZ6 A;  1TY0 A;  1HUN A;  2DPI A;  2ZJP A;  1UWV A;  5HUR A;  5M5W H;  3R93 A;  4LMY A;  3H3V C;  4R4Q A;  4A3I G;  3D8G A;  2DZD A;  1TS2 A;  3L0O A;  1CM9 A;  3UDF A;  3S1Q H;  2IMW P;  2IX1 A;  4FXK C;  1O78 A;  1ZYR D;  2G5D A;  2A6H C;  3SXH A;  4ECR A;  2QF7 A;  1PTO H;  3WOF A;  1M8A A;  4RMF A;  4IFD I;  1BGW A;  4FXD A;  4TQR A;  2EY1 A;  1SYX B;  3K7U C;  2K01 A;  5K36 G;  2N8N A;  3MHB A;  3PUX A;  1DZ1 A;  2IBK A;  4UCR A;  1LT4 D;  1SNO A;  2QDL A;  2WAC A;  3ND8 A;  3T1Y Q;  1V4Y A;  2D9U A;  1PFS A;  3KJO A;  1IL8 A;  5JVG 3;  2QK4 A;  1VQ9 A;  4IUV A;  3MWE A;  2MNA A;  3AYH B;  4IFD J;  1K1Q A;  2R85 A;  1PRT F;  3VDY A;  5CA0 F;  4IFD H;  5I2Y A;  5EPJ A;  2VUG A;  4APM A;  5CV8 A;  1I4X A;  4C3J B;  3V96 A;  2F3I A;  5F2D A;  5KRU A;  4IWX A;  2HIX A;  3OTO L;  5HY6 A;  5LMN L;  4L5R C;  1AUV A;  2J6S A;  2FMA A;  4BBS H;  5C5L A;  1GHK A;  1F2M A;  1HUM A;  5HGQ A;  3C0F B;  2R7K A;  5FLX L;  4AIM A;  3DEO A;  2YYA A;  4DGZ A;  4JV5 L;  1SMY C;  4C3I G;  4LFB H;  1ENF A;  3D31 A;  4O42 A;  1EYD A;  3N6X A;  1I3Q A;  4A3J G;  4LF9 L;  3JAM E;  1YHA A;  1IBK Q;  3T1H L;  2F3W A;  3MA2 B;  2NVY H;  4JI8 L;  4LFC Q;  4Y7N H;  2JA7 A;  3OHB A;  3FHW A;  3BYY B;  2MCT A;  3J81 c;  4OX9 H;  5IE8 A;  3TS2 A;  1HRJ A;  4DV0 H;  1YHB A;  4PZ7 A;  1PH6 A;  2PBZ A;  4U67 3;  1K28 A;  5IYD G;  4OEM B;  3A7A B;  1SNC A;  2GPW A;  3RB3 A;  2JA7 G;  3OWE B;  1ZQ7 A;  2XIW A;  2UUC L;  3S1Q B;  3Q0A A;  1OXT A;  5JJK A;  1I4H A;  1B04 A;  2B29 A;  1G51 A;  2FXQ A;  2J7Z A;  4CKC A;  1Z2P X;  1BBW A;  3EQL C;  3HOX B;  3OIQ A;  5JEA G;  1JOK A;  5KFI A;  4QMG A;  2DPJ A;  4X3K A;  2WTF A;  3UDX A;  1FVI A;  4YY3 H;  4JCV E;  4MHE A;  4OXP A;  5KNC A;  3MFG A;  4G7H C;  1N9W A;  2X6G A;  4RB0 A;  3U50 C;  2XRQ D;  1AZP A;  1R9T H;  1HTP A;  2HQL A;  1W96 A;  5EWF A;  5COR A;  1EY6 A;  2JA8 B;  2AQ3 B;  2K1B A;  2UXD H;  2EDG A;  4LF8 Q;  1WD0 A;  5M3M H;  1IYU A;  1SCU B;  3OPO A;  1VKZ A;  1HQM C;  3I91 A;  3NXW A;  4AYB B;  5LMU Q;  3G8C A;  1E3P A;  1HTL D;  2RA4 A;  3Q2O A;  5IIF A;  3K7A H;  2NWG A;  2NBF A;  1A63 A;  2R82 A;  2NZ1 D;  1HNW H;  3WWV A;  3VR4 A;  1EL0 A;  4POF A;  3HOZ G;  3GIQ A;  4UP7 A;  4BWS C;  5ELE A;  4DL5 A;  2JA5 A;  1WTH A;  2OTL A;  1GXD C;  4IZO A;  4YHH H;  3IAY A;  4O4L F;  5KFK A;  1IKL A;  1X32 A;  3FKI A;  3CCM A;  1SYB A;  2F0S A;  1CKO A;  5ELN A;  1I6V C;  1SNP A;  3D0F A;  3PUW A;  4IR1 A;  2EY5 A;  2R8H A;  4Y7N B;  3H4D A;  3CCU A;  4EBD A;  4ZHQ F;  4HN7 A;  3FKI G;  4LFB L;  3U9T A;  4YAK B;  2WYO A;  2UUB Q;  4KJO A;  1JXL A;  2F0J A;  1I5F A;  4DV2 Q;  3HRZ C;  3A5U A;  1RTN A;  1KLG D;  3HFZ B;  2UXB Q;  3J80 i;  1DXM A;  4C5B A;  4DR5 H;  4OX9 L;  4C3H G;  2CZG A;  4DV0 L;  3MXN B;  3GTQ A;  4PNY A;  2C22 A;  5KFH A;  5I2X A;  1PH9 A;  1BO0 A;  3K5H A;  4YBZ B;  1N32 Q;  2W71 A;  1KDC A;  4MTE A;  2Z6K A;  3URY A;  3M4O H;  1CQV A;  4BA2 I;  4E4T A;  3RN5 A;  3VR2 A;  1VQD A;  5ELO A;  4X62 H;  4U7C A;  3E5S A;  3ER0 A;  4HR7 A;  4YY3 L;  4A3K H;  1PFB A;  4XYQ A;  2ZJT A;  5JUM A;  1A8V A;  1JCK B;  1TS4 A;  1MJE A;  1TVX A;  4JI1 H;  1XTD A;  3KF8 B;  3K7A B;  5IGG A;  2EZV A;  4KD3 A;  1I4Q A;  1G2T A;  2PO4 A;  4EGQ A;  3LML A;  3SDZ A;  1Q12 A;  2UXD L;  4LH6 A;  5KG7 A;  2QYZ A;  2R8J A;  4DL3 A;  4DV7 Q;  1LT5 D;  1XWE A;  2J6U A;  4ULL A;  1L1O C;  1CE8 A;  2CH4 W;  2CW0 D;  1VMC A;  2OQ0 A;  2A74 C;  3FPU B;  2HIV A;  1VQ7 A;  2BR0 A;  3TP5 A;  2L11 A;  5E4W C;  4Q0F A;  5KT4 A;  1QOH A;  2XD4 A;  5IYC G;  1PTO F;  2Q2U A;  4ZK9 B;  5E4X A;  3J7A F;  4JI3 H;  4HID A;  4RUC A;  1KL9 A;  5C0X G;  4A2A A;  4YHH L;  4Q8F A;  4UPA A;  1CA6 A;  4ED8 A;  2FKL A;  1S3O A;  2ZXR A;  4CC6 A;  1ZEQ X;  2D2C C;  5C44 B;  3RD4 A;  4LSA A;  2K33 A;  2WV6 D;  4I7Z C;  4K0K H;  2PW5 A;  1WH2 A;  2JA6 B;  3NP8 A;  4U6P A;  5LMN W;  4JC0 A;  4HIK A;  3GO5 A;  2FB9 A;  3KXY T;  4HCS A;  4TRD A;  3OWF A;  2R93 B;  5C4J H;  2JEI A;  1FJG Q;  1BXT A;  2EYF A;  2K5N A;  4GKK H;  5FLX W;  4ID6 A;  1V1P B;  4JVZ A;  2RHS B;  4KI0 A;  3J7A V;  4O3P A;  2R92 B;  4JI4 H;  4GOP C;  4DR5 L;  4J9R A;  3TP6 A;  3EBE A;  4R1J A;  3M4P A;  1RD9 D;  2YZN A;  3U4Z A;  4ZYS A;  1KC8 C;  2MJ8 A;  1MI2 A;  1P16 A;  1Y8P B;  4KY6 A;  4G7O C;  1CFM A;  2W6O A;  2HVR A;  3H3V I;  1DOK A;  1D5Z C;  3HOV B;  1JT8 A;  4EX5 A;  4WJ4 A;  5LP6 F;  2OEO A;  4X62 L;  1YI2 A;  2YYZ A;  1WTV A;  1EU3 A;  1I4G A;  1VQJ A;  2ICI A;  4TSS A;  4M7E A;  3PO3 H;  5KFR A;  2B8G A;  4R4I A;  1CKN B;  5BN4 A;  4YIJ A;  4JI1 L;  3T53 B;  4TQU S;  4B3T H;  5C6A A;  3MFH A;  2K5Q A;  2R7Z G;  4BXX H;  5GRO A;  5D1O A;  4OIJ A;  1FGU A;  1RTO A;  2BQ3 A;  3KHR A;  2B2W A;  4F88 A;  3CCQ A;  4JI2 H;  4GZY C;  2YTX A;  3JAM L;  4NXN Q;  3L4K A;  1I7N A;  3D3R A;  4O2D A;  2PQE A;  4A3E H;  1WFQ A;  4LUV A;  5EWE A;  4YB8 B;  3KHG A;  3TDQ A;  4IUQ A;  4QL5 A;  2FJZ A;  2JXM B;  3S2H H;  5CAE B;  3FDS A;  3GTG A;  1ICF B;  4JI3 L;  3SK5 A;  1YNX A;  3STB C;  2R8G A;  2RCF A;  5J2U F;  2GLT A;  4F50 A;  2NYZ D;  5JJZ A;  5KFS A;  3BDO A;  3T5L A;  3M4Y A;  4I65 A;  3S1R B;  5M9O A;  1U5K A;  3A8I E;  2Q8R E;  2P5Z X;  2HT1 A;  1BBX C;  1D1I A;  1KJI A;  3E0E A;  1AEX A;  1HZ9 A;  1JWU D;  2NB0 A;  3VYT A;  1XNR Q;  4K0K L;  1XTC D;  4JI7 Q;  3V05 A;  3N52 A;  5IP7 H;  2WE6 A;  3JRW A;  3PW5 A;  2ZDH A;  1AW7 A;  1TWH H;  1J9O A;  3QR8 A;  4NDX A;  3TZD A;  2BH2 A;  1XMQ H;  1ICW A;  4DR4 Q;  2YV5 A;  2Q8T A;  3KUP A;  3QG1 A;  1C4Q A;  5C1P A;  1V9P A;  2F0T A;  4GKK L;  4NXM L;  1KIX A;  2VNU D;  3WO0 A;  4J9K A;  1EUC B;  4MIU A;  2W8L A;  1XDN A;  1KC7 A;  3TQT A;  1NE3 A;  2YS6 A;  1TXY A;  2CQO A;  4ZUI A;  4K2L A;  1HZC A;  4JI4 L;  1D5M C;  3S17 H;  2J4X A;  1CZG A;  4A3F B;  1EHI A;  5DQI A;  1SBB B;  1MHW C;  5I6Y A;  2CQY A;  1HA5 A;  2UU9 H;  2AWN A;  3ERO A;  4MAM A;  5I6W A;  1SE8 A;  1SNM A;  4X64 Q;  3KF6 A;  2VPS A;  1C3O A;  4EBC A;  1PZI D;  1PFM A;  4RCO A;  1GYF A;  1G91 A;  1HXY D;  2I5M X;  1Y1W B;  5HV6 A;  2Z6B A;  4A3E B;  4B3T L;  4X65 H;  2K32 A;  3HG9 A;  2QKI C;  4O1N A;  4KN7 C;  3TP7 A;  1V43 A;  3HP3 A;  4G4K A;  3S2H B;  4ALP A;  2PW7 A;  4WFN 3;  4KJN A;  4M1U B;  3Q6S A;  4ETS A;  1WTQ A;  4JI2 L;  2F0M A;  2B63 A;  1GVP A;  3I4L A;  4G3I A;  2R87 A;  5FO8 B;  3J81 i;  4O0A A;  3H20 A;  4KY5 A;  2N88 A;  3PCO B;  1SMX A;  4JI5 H;  1KNA A;  4UP9 A;  3HKZ B;  1T94 A;  4ZQI A;  1B33 N;  2WIN B;  1I6H B;  5LA6 F;  4HNT A;  3F2D A;  2B63 G;  3GID A;  3GTM H;  2L5T A;  5GAH C;  2YTY A;  3ERQ A;  1Q8I A;  1J6Q A;  4K6L A;  1SYG A;  2EYP A;  4FM9 A;  1MD2 D;  1TWH B;  1L0Y B;  1SFO B;  1Y69 U;  4DK3 C;  1F2Z A;  4Q0Y A;  1N36 Q;  3MFY A;  2O5I C;  4C5A A;  5ELB A;  2VQF Q;  1F77 A;  1NR2 A;  4YCU A;  3J7A K;  1YIJ A;  2B2Y C;  1O80 A;  4OWX B;  3E3X A;  1XMQ L;  1SE3 A;  5KGU A;  5EJW A;  3S17 B;  3MXU A;  1MJC A;  1SRU A;  3OYY A;  1STN A;  4WJW A;  2F0H A;  4RB3 C;  2XVS A;  4YAJ B;  2SEB D;  3S16 H;  1H9S B;  1RCV D;  1WTR A;  3HOU B;  2A5H A;  3IRB A;  3NBI A;  1WTW A;  1QVG A;  2FK2 A;  2FPP B;  2JEB I;  5A2Q E;  3I4N G;  4A3D G;  2L12 A;  1EY5 A;  2Z4H A;  4XYO A;  4ECT A;  1EIG A;  3PIP A;  2EY6 A;  4GC6 A;  4ECZ A;  1A9X A;  2I5H A;  2UU9 L;  1QCB D;  3EN2 A;  1ILP A;  4R9W A;  2ZDQ A;  2PI2 E;  2AQ4 A;  3M3Y B;  2F0K A;  3R2T A;  4NLG A;  3SR1 A;  4R4O A;  3C46 A;  1Z2N X;  1UE1 A;  1OWT A;  4DNI A;  4B3M H;  1X3E A;  1C30 A;  1I6U A;  3T4A C;  5ISR A;  3TIG A;  1VQG A;  4H0L C;  1CA5 A;  5E1F A;  1Y1V H;  1JWM D;  4X65 L;  2K5D A;  2UVV A;  3RR5 A;  2AGO A;  3G4S A;  2V5A A;  2E75 C;  1CSP A;  2YU9 B;  2KED A;  1X6O A;  3PUY A;  3M9O B;  5KT5 A;  4MN3 A;  2CH4 A;  1AFP A;  2EXZ A;  1SAP A;  3I4M H;  3GTM B;  5E3F A;  3OTO Q;  1D2B A;  4DK1 A;  5LMN Q;  1J5E Q;  4UDU C;  3VR3 A;  2MP1 A;  1KXL A;  3VA7 A;  4JI5 L;  1JOQ A;  2N78 A;  3P75 A;  3SGI A;  1WVL A;  3JAM W;  2AGP A;  3NGD A;  4ECQ A;  4JV5 Q;  3ONA B;  4QIW B;  4X66 Q;  2RGR A;  1X3F A;  5KFV A;  2N55 A;  4A3G B;  1NBW A;  3N44 B;  4A4I A;  4YJ2 F;  3OHA A;  1B3A A;  2PI2 A;  2V4D A;  3H0G B;  3T1H Q;  3TRZ A;  5JVL A;  5KFA A;  4BY1 G;  2C28 A;  4EGV A;  4A93 B;  3S16 B;  3H91 A;  4RAZ A;  1N56 A;  3RJ0 A;  1B9M A;  2XWB B;  4DF7 A;  2FIN B;  1NR4 A;  3NEM A;  4XXE A;  5IT9 L;  4GN3 B;  3PN1 A;  1SYF A;  1HNX H;  3K58 A;  3GTO H;  1DM0 B;  3RB6 A;  4CDE C;  2SNM A;  5CV7 A;  4YCV A;  3I55 A;  3BDC A;  1F2Y A;  3PF4 A;  5EAY A;  4RGN A;  2OWO A;  3U4V A;  1XNQ H;  2DIK A;  1I94 H;  1PYB A;  4O4I F;  5GAG C;  2F0E A;  4XIG S;  1UE7 A;  4K6D A;  3A56 A;  5IOC A;  4RH6 A;  3W1B A;  3CF5 A;  2H4O A;  1L0W A;  5I4D A;  1HZB A;  2DY8 A;  2AU0 A;  3PQI A;  4CDC C;  5CBE E;  4LF4 H;  5FD5 A;  2QEJ C;  2JN4 A;  4ZOL F;  3TRE A;  3KK7 A;  4AYB E;  2E76 C;  3I56 A;  1RJP A;  1BCP B;  3CPF A;  2Z9H A;  2KSW A;  5EZY F;  3VMM A;  1YNJ D;  5KND A;  2UXC H;  1OO9 B;  4KKU A;  1SND A;  5BN5 A;  3MR2 A;  2YS7 A;  1IZ6 A;  5DNF A;  3S1N H;  4DUY H;  2AMC B;  2V59 A;  3GTK H;  5JPN C;  2W9C B;  1L1O B;  1SE4 A;  2R6F A;  1H9J A;  5IGD A;  3HXL A;  2KHJ A;  4C56 C;  2XCP A;  3NBH A;  3J81 E;  3F2B A;  3PIO 3;  1EYG A;  5KFB A;  4A3B B;  3RGZ A;  2O2L D;  1WTX A;  1L2Z A;  1EWI A;  1CQI B;  3GTJ B;  4OWW B;  5D1P A;  1RYS A;  1STG A;  3H94 A;  2CWA A;  3H6M A;  3L3O C;  3J80 L;  4KLK A;  4JI6 H;  2MGS A;  1DIK A;  2R6G A;  3MEF A;  5FLM H;  4JI0 H;  4IPD A;  3GTO B;  1EIF A;  5KFY A;  1EQT A;  2FLL A;  4BBR G;  2FFK B;  3I3C A;  4R8U B;  4B3R H;  5IOD A;  1SR3 A;  3BAB A;  2FLP A;  3KLW A;  1CHP D;  3R5H A;  4KK7 A;  1DV2 A;  1UE5 A;  1KD1 C;  3KHL A;  5FD6 A;  1HCZ A;  1V1O A;  1KBL A;  4IFD G;  4F4W A;  4OX9 Q;  1HNX L;  4IPC A;  4DV0 Q;  4XQQ A;  4LK1 C;  1YNN D;  4XT1 B;  4DR7 H;  4B3S H;  1S72 A;  1YZ6 A;  3K8A A;  1LV9 A;  4C3J H;  3T51 B;  4HMJ A;  2A73 B;  4H44 C;  1XNQ L;  2LXK A;  4BBS G;  1I94 L;  1M0T A;  1S5E D;  4ZLT F;  4GOP B;  2DNE A;  3Q22 A;  2NVY A;  2LSS A;  2AQ2 B;  1VQN A;  2W7P A;  3L7Z C;  1RIP A;  4YY3 Q;  1ZKO A;  1RHP A;  4O3R A;  2ZM6 H;  2ZJQ A;  4TUY F;  1IYV A;  3T13 A;  4IQZ A;  1BXR A;  2HDM A;  4LF4 L;  3EPI A;  2NVX H;  3M9N B;  1S5B D;  1C8C A;  1K83 H;  3JRX A;  3HBL A;  2VQE H;  1II3 A;  1SYD A;  1AE3 A;  2QW7 A;  4R4C A;  1XXG A;  2UXD Q;  1LTG D;  4IOA A;  5FLX c;  3GTK B;  3RUZ A;  3BAA A;  1Q7Y C;  5GAD C;  4LSX A;  5NUC A;  4RNN A;  4EBE A;  2K14 A;  3NQI A;  4FVM A;  5EQ0 A;  3S14 H;  5IY0 A;  2Z4I A;  3GIJ A;  1BOS A;  2A6H D;  3CCJ A;  2UXC L;  4QUC A;  3GP7 A;  3DUZ A;  3CC4 A;  4GNX A;  4DUY L;  1Q8K A;  1QUQ A;  2H5X A;  4YHH Q;  4ZCK A;  1R9T A;  4DV5 H;  3G6V A;  1N33 H;  2Z6K C;  5IP9 H;  4CKE A;  3HOX H;  4S3S A;  3RMH A;  1KEE A;  1GUO A;  1SNQ A;  3BG5 A;  4DR1 H;  3A8J E;  5A2Q L;  1PH4 A;  2MO0 A;  2L1B A;  2NUA B;  4C2M H;  4JI6 L;  2F4V Q;  3K5N A;  3EPG A;  4RGM A;  1BCP F;  4JI0 L;  5M3M G;  1WJJ A;  2R84 A;  1NAP A;  1LUZ A;  1DON A;  4PMB A;  1WYD A;  5LHY 1;  4B3R L;  3FVQ A;  2JA8 H;  2PVP A;  4KY7 A;  1EUD B;  4LF7 H;  3ITP A;  1MBY A;  3CQZ B;  1ZHS A;  4A76 A;  2XIG A;  2E2H B;  3RF2 A;  1XPU A;  4DUZ Q;  3I72 A;  5DQH A;  1SMY D;  4UCV A;  2EXD A;  4Q8E A;  1EU4 A;  4B3S L;  1LTB D;  1OTC A;  1WOC A;  1M4V A;  2KHI A;  4QQB X;  1QB5 D;  3KLS X;  1O7L A;  4UCT A;  5IT9 W;  5DG9 A;  2HJW A;  4ED0 A;  1LTS D;  2NVX B;  1K83 B;  4NW2 A;  1HZA A;  1LTL A;  4DR2 Q;  1TAE A;  2NVT H;  2Y0S B;  4X62 Q;  4GC7 A;  2BA0 A;  2ZXO A;  2C2R A;  1KNE A;  2ZM6 L;  2SNS A;  4DL7 A;  4JOI A;  4JYA H;  4FBU A;  4H7B A;  4PG3 A;  4YWL A;  4JI1 Q;  3R23 A;  3KHH A;  4O3N A;  1F9S A;  3S14 B;  5BPF A;  2ZTC A;  3ORR A;  2VQE L;  1ASZ A;  3GTL B;  3E9I A;  2JA9 A;  1E1T A;  4RHR A;  5IGB A;  2HDL A;  5CV4 A;  2R7D A;  3N8D A;  1TKW B;  1W3S A;  2MO1 A;  3RLN A;  1BR9 A;  1RJT A;  2KCM A;  3DLL A;  5DEH A;  5KFE A;  4EQN A;  5J2T F;  5EWG A;  4WD3 A;  5IGC A;  3HOW H;  2IJ0 A;  3KLS A;  2HHH H;  4KHP H;  4H13 C;  3PR4 A;  2E74 C;  4JI3 Q;  1IOV A;  3J7A 5;  4C2M B;  2F3V A;  3KTM A;  3RTX A;  2CKZ B;  1STB A;  2EE1 A;  4A3K G;  1N33 L;  1UC8 A;  3TIN A;  1A62 A;  2A1A A;  1CHQ D;  1JDB B;  5KG4 A;  1QIL A;  2HCC A;  2KOL A;  4ED2 A;  3RB0 A;  4IRD A;  3PW0 A;  5KX5 F;  1CKN A;  3VPB A;  1MGS A;  1TWF H;  3OW7 A;  1VBG A;  2XGP A;  4J1M A;  4KTA A;  2RQX A;  3U58 A;  2HVS A;  3DMU A;  1SSO A;  2KEN A;  4IR9 A;  2VUM B;  5D3D A;  4QW9 A;  1W2B A;  1VQL A;  3J80 W;  3QOL A;  4NXM Q;  1TWA B;  4LF7 L;  3A7L A;  4J9S A;  1G6P A;  2B2W C;  1F9R A;  5K36 H;  1TS3 A;  3RAQ A;  4WJ3 M;  2NVT B;  1TWG B;  4DV6 H;  3UFX B;  5D3I B;  1I7L A;  2KA7 A;  1WCM B;  2PMZ B;  3OUZ A;  4YR2 A;  2JA5 G;  2WAQ B;  2QDB A;  2I5L X;  3VYS A;  3UDG A;  2MHV A;  5K5P A;  4UCS A;  3CHB D;  3V2T A;  2K28 A;  3NWT A;  4ZUJ A;  5DG7 A;  2EYO A;  5C44 H;  2FLN A;  1TY2 A;  1S9F A;  3TS0 A;  3GTP A;  3BZC A;  1FYC A;  2EJM A;  3UE1 A;  4JYA L;  2JA6 H;  1EOT A;  3J81 L;  2OTJ A;  1SE2 A;  2WB1 B;  4B3T Q;  1E22 A;  4IUT A;  1U0L A;  2R93 H;  4C3I H;  5GQO A;  2CW7 A;  4F7X A;  3DXJ C;  3HOW B;  4GLV B;  1IW7 C;  2KCT A;  4A3J H;  1TWC A;  1JQY D;  1E24 A;  4QUF A;  1JMC A;  1FL0 A;  4AH6 A;  4HSV A;  1VQP A;  3HKZ E;  4JI2 Q;  5C4X G;  1BCP D;  3CD6 A;  2R92 H;  4OON A;  4FBT A;  3DF7 A;  1I3Q H;  5C3E H;  1F9P A;  1LT3 D;  2HHH L;  4KHP L;  5JQW A;  3V6J A;  5IYD H;  4O3O A;  2OXP A;  4A3I B;  1TWF B;  2F0U A;  4HMI A;  1CTM A;  5IYB H;  5FPR A;  1VQM A;  4CHT B;  2K5W A;  4HJ7 A;  3CW2 C;  1XMO Q;  5GON F;  3HOV H;  3OUU A;  1EYC A;  4XDX A;  3PO3 G;  4RZQ A;  4EFE A;  5KFO A;  3G6J B;  4L5T A;  4ZKC B;  3S1M B;  5JEA H;  1Y8N B;  4O2A F;  1PXU A;  2DGY A;  3BVZ A;  1CQF A;  3EFX D;  1FKA H;  3NEN A;  2AGQ A;  1STY A;  5EDW A;  2X69 A;  4BXX G;  4K5V A;  1NJI C;  1BVS A;  1XMQ Q;  4TKO B;  1T9H A;  3EJI A;  4QB4 A;  3MR6 A;  3U9S A;  1ROD A;  1HNW L;  5A2Q W;  1T5E A;  3LGJ A;  2L15 A;  4DA2 A;  4YJ3 F;  1PRT C;  4ZQ3 A;  3CMA A;  4V0B A;  1STH A;  2XCL A;  3HKZ A;  3MR3 A;  3S24 A;  4OEL B;  2D0P A;  3BQ0 A;  3A55 A;  4PZ6 A;  4DV6 L;  4CBV A;  4FP5 D;  4LW1 A;  1CS0 A;  3K5I A;  2ASJ A;  2LFN A;  2UU9 Q;  3HOZ H;  5LOV F;  1PFN A;  3HKZ G;  3P7J A;  5GAE C;  2DUD A;  2KJX A;  3CCR A;  1PH8 A;  4DV3 H;  4QGU A;  1O75 A;  1LTI D;  1IXR A;  2RVL A;  3S1R H;  2N49 A;  4C3I B;  2RCN A;  2VXW A;  3M85 A;  4A3J B;  1KJQ A;  1XJV A;  4KV6 A;  4R4T A;  1DV1 A;  5IYZ F;  2VY3 A;  4LJZ C;  3J81 j;  1M7J A;  1GHJ A;  2E2I H;  4M8A A;  2W6Q A;  1JC7 A;  1FNV A;  4X65 Q;  2W9B B;  2QCP X;  1PYW D;  1I3Q B;  5C3E B;  5H80 A;  3SVM A;  4UFZ A;  2QEX A;  3Q8D A;  1Q81 C;  2NZO A;  5LMU H;  1PZK D;  1E0B A;  2A6E D;  1GSO A;  4FS2 A;  4PZ8 A;  2WKD A;  1VQB A;  4DFA A;  1XPR A;  4DR6 Q;  2JA7 B;  1L0X B;  4RNM A;  1E2Z A;  3S2D B;  4K5X A;  3MJF A;  1S03 G;  1BF4 A;  3HOY G;  4DL4 A;  4QIW E;  5IT9 E;  3ETJ A;  4A3F H;  2F4I A;  1HNZ H;  4XQJ A;  2V9W A;  4NB3 A;  4O4H F;  4LFA H;  1GJX A;  1KJJ A;  2F0L A;  4K8I A;  2AKW B;  2I0Q A;  1SEI A;  5KT7 A;  4YP3 A;  3FDT A;  3RV4 A;  1NY4 A;  2Q2H A;  5ELC A;  2JQO A;  1Q46 A;  1B7Y B;  4IUR A;  2IT1 A;  3H3V H;  1VF7 A;  1A15 A;  1KQS A;  2YRX A;  1LAB A;  1A0I A;  1GD7 A;  5DM6 3;  4K2K A;  1Y1W H;  1D6E C;  4ODG A;  3RGX A;  5G3L F;  3STB D;  3GII A;  2UUB H;  5CV6 A;  1TT2 A;  1B6S A;  3GTM A;  4YWM A;  1ENC A;  3G6X A;  2UXB H;  5CMD A;  1BQQ T;  1UUP A;  5M5X B;  4QCL A;  2FPG B;  2MPM A;  4B08 A;  3HOZ B;  2OH2 A;  5KFJ A;  3OOC A;  3CPW A;  5KYL A;  1VQ5 A;  1S5F D;  2R86 A;  4EYH B;  1S10 A;  1N48 A;  4HJ8 A;  1STA A;  3PUV A;  4QWC A;  2OLS A;  1N32 H;  3MVV A;  1A2U A;  2EYJ A;  1I6H H;  3KBX A;  1PDQ A;  4OL7 A;  4IOC A;  4FYD A;  3N41 B;  1CSQ A;  2J9G A;  3UI2 A;  3IFD A;  5IYC H;  1EYZ A;  3KAL A;  4FU0 A;  2RDJ A;  3RUP A;  4HJ5 A;  4IWY A;  4J9O A;  4ME3 A;  4APV A;  2E2I B;  3IL8 A;  4DV3 L;  1K8G A;  1GO3 E;  2NUC A;  3RNU A;  1YIT A;  1SFO H;  3T5K A;  3BZK A;  3FKI B;  3M7G A;  1K8M A;  5EPL A;  3CCE A;  1ZHQ A;  1KRS A;  2E5L H;  1NUC A;  5M5Y B;  2B2T C;  1SJH D;  2WKC A;  3KAJ A;  2PZU A;  4JBW A;  3O13 A;  2PNR C;  4KD4 A;  3NTK A;  3A5Z B;  3J80 E;  5J3B A;  1ASY A;  4JV1 A;  4L5S A;  2Q2T A;  4QWD A;  4C3H B;  2DJF C;  4MTD A;  4DV7 H;  3RAX A;  4CGY B;  3HGB A;  1FNU A;  4EQP A;  5LMU L;  2HVQ A;  3JSL A;  3C1E A;  3HOU H;  2EYH A;  3J81 W;  3Q8R B;  1JJC B;  4IPG A;  1OXS C;  1AUX A;  3PW4 A;  4FS1 A;  3I70 A;  4LF5 H;  1D1K A;  5K2M A;  1CQJ B;  4CC5 A;  4DR3 Q;  4TVA B;  5KYI A;  2J6T A;  2SOB A;  4NMZ A;  5ELF A;  1M1K C;  3GTQ B;  1HNZ L;  5CA1 F;  4N8X 1;  1Y1V A;  2DJG C;  2AHO B;  4LFA L;  2QIL A;  4IHJ F;  3NTI A;  1QWY A;  3AQQ A;  2XGQ A;  1EZ8 A;  1PV4 A;  3RIZ A;  3M3Y H;  4EYI B;  1Y14 B;  1GUS A;  3Q8P B;  2E2D C;  2XSC A;  4IRK A;  1G29 1;  1CT1 D;  1H9R A;  3DWP A;  3G48 A;  3ULP A;  4I50 F;  5KG5 A;  2AQ1 B;  1BDO A;  1C48 A;  1Y1V G;  4Y52 H;  3DWA A;  1PMR A;  1DJR D;  2N3S A;  3E0J A;  1G6Z A;  4ECY A;  2BQR A;  2NN6 G;  2X0S A;  3JC6 6;  1NTG A;  2C9O A;  2EY2 A;  3H40 A;  2ICE C;  3MFI A;  1FJG H;  1HNX Q;  3I73 A;  4ECV A;  2UUB L;  2PNH A;  5KG2 A;  1M90 C;  3I4M G;  3RZO B;  1VQC A;  2YU9 H;  3ZYY X;  1SYC A;  5FO9 B;  2UXB L;  2R7Z H;  2B8F A;  4EG0 A;  1M0W A;  3N43 B;  2F0V A;  2AWO A;  1JB7 A;  5DQG A;  4F87 A;  1PTO C;  4DXG A;  1YJ9 A;  1I94 Q;  3NPP A;  4IRC A;  5BMV F;  2ALZ A;  4GKJ H;  3BQ1 A;  1WTP A;  4Q45 A;  1KDB A;  1N32 L;  3ZJY C;  3QB3 A;  4K14 A;  5CV9 A;  3PO2 G;  1LTT D;  1JR0 D;  1JE5 A;  1DD2 A;  3GTO A;  2NU6 B;  3G6E A;  1EY8 A;  2M05 A;  4LF4 Q;  2KBN A;  1SYE A;  4ZRZ A;  4ABN A;  3CC7 A;  4A3G H;  4EGJ A;  1MKH A;  4ZKB B;  1VQI A;  3H0G H;  1AE2 A;  4DV4 Q;  2UVU A;  2FE3 A;  2E5L L;  1EY7 A;  4JPB W;  5KNB A;  3KFU A;  1Z47 A;  2HD3 A;  4MV1 A;  2ASL A;  4A93 H;  4MZ9 A;  1HR0 H;  5JJL A;  1PZJ D;  4Q5V A;  4UY8 C;  1FNW A;  3GIK A;  4ECW A;  1JLL B;  2W57 A;  1UEB A;  4DV7 L;  1U4R A;  3QJY A;  4L6T B;  4DV1 H;  4DUY Q;  2PQA A;  1H95 A;  1BBU A;  2SDF A;  4F4Z A;  2GVB A;  5G3L D;  4LF5 L;  2VS1 A;  3PIO A;  2QGQ A;  1SRO A;  2R3Z A;  5COY A;  2Q8I B;  3NWS A;  1Z2O X;  1EEI D;  2K05 A;  2F0I A;  4JI6 Q;  4PV1 C;  1A3T A;  2LMC B;  3T5H A;  3TZU A;  3LWB A;  4JI0 Q;  5C1O A;  2R7F A;  4RGO S;  4POG A;  1E4F T;  3GTK A;  3S15 H;  1XNR H;  4B3R Q;  1NMG A;  1XX8 A;  5KG6 A;  3CC2 A;  4HNU A;  2R7Z B;  1W93 A;  2D0O A;  3E5N A;  1IBM H;  1PHJ A;  3KAK A;  3KDF B;  1KAA A;  1FJG L;  3IG0 A;  4X3S A;  5KFP A;  1EWH A;  2B2V A;  4KN4 C;  2F0P A;  1ML0 D;  1E1O A;  2FHT A;  3GV3 A;  4YCW A;  4BY7 H;  4B3S Q;  4ED3 A;  1EOV A;  4IN3 A;  3GV8 B;  1PH3 A;  4PDB A;  2Y0S E;  4LUO A;  2C00 A;  3QO2 A;  4GNX C;  4MTK A;  5BR8 H;  1ESR A;  1F9Q A;  2XN9 C;  1VAJ A;  4LF9 Q;  3FEW X;  4GKJ L;  1B3Q A;  1DCZ A;  1LYL A;  4A3B H;  2LS0 1;  5FLM G;  3ETH A;  5CC4 A;  3GTJ H;  5LXT F;  5KFZ A;  2K5H A;  2ZM6 Q;  4J9P A;  3P20 A;  4JI8 Q;  4CKB A;  4J15 A;  2NU7 B;  2H1E A;  3GTG B;  2FMC A;  2WP8 J;  1JDE A;  4X64 H;  1OXX K;  4XT3 B;  2B2U A;  2A69 C;  1RJQ A;  4O3S A;  1B44 D;  1B70 B;  2I87 A;  1G2S A;  1V51 A;  2OCE A;  2UUC Q;  1HR0 L;  3H15 A;  1A3V A;  4ED1 A;  3OMC A;  2J0T D;  4V19 0;  5M3F H;  1EIH A;  4DN4 M;  3A74 A;  2W70 A;  1I4P A;  4WRD A;  2PZW A;  3MTS A;  3ICE A;  4K5W A;  2JEA I;  4C3J G;  5H1S E;  4X3T A;  2NZH A;  1HPC A;  2OF1 A;  1ILQ A;  2NVX A;  5IWA H;  2HGS A;  4FXG C;  1K83 A;  4DV1 L;  3CRL C;  5IGE A;  4XQN A;  1N33 Q;  1B6R A;  4RAY A;  1EQR A;  3D6C A;  1BNZ A;  4TV9 F;  3S15 B;  1E4E B;  4LAA A;  3Q23 A;  1BNC A;  3R5X A;  4B3M L;  2RDG A;  3W5O A;  4JOI C;  2A19 A;  2NTS A;  1AN8 A;  2EVB A;  1A6X A;  2F52 A;  3KF6 B;  4RFB A;  3RN2 A;  4BY7 B;  3UQ8 A;  1XNR L;  3AMU A;  2YCH A;  3BA9 A;  5L9X A;  1S0O A;  1EUJ A;  2WDT A;  4LF7 Q;  5EGT A;  2VR1 A;  2PMZ E;  1O7Z A;  3I4O A;  2C2E A;  1IBM L;  5FJ8 H;  5I47 A;  2K5V A;  3W1G A;  2WAQ E;  1GKH A;  4XZ3 B;  3ND9 A;  1GUT A;  3M4Q A;  4C2M A;  4QY7 A;  4PMW A;  5IP9 G;  3HOX G;  4A3L H;  4I7H A;  5DLF A;  2EYL A;  4A3M H;  1PH7 A;  4HIM A;  2V58 A;  1PRT B;  1B8A A;  2K75 A;  4NPS A;  1K8O A;  1DGS A;  3T16 A;  4UP8 A;  5BR8 L;  2B63 B;  4LFB Q;  1RK6 A;  1UAP A;  2EQS A;  4YR0 A;  2ENB A;  2RBM A;  2A68 C;  1VCI A;  3HS0 C;  5JOB A;  1YNJ C;  2WB1 E;  4AYB A;  1EY4 A;  1ZXT A;  4IUU A;  4BWG B;  4QW8 A;  4DLK A;  1GUN A;  2K52 A;  5M3F B;  4JYA Q;  2R7M A;  1VQF A;  4N9T A;  3WDN A;  4J9M A;  3V6H A;  1H9K A;  2JA8 G;  1CUK A;  1P8L A;  3NUC A;  3R5F A;  2W8K A;  1U9R A;  1KHI A;  4QWA A;  4ME5 A;  4AYB G;  3Q1K A;  3ORQ A;  5EKL A;  2L4N A;  4G7Z C;  3H09 A;  5IGF A;  4MNO A;  1S4Z A;  3CQZ H;  3MWD A;  3BG3 A;  1B53 A;  1S5C D;  5KFX A;  2E2H H;  1EEF D;  1K73 C;  4A3D B;  2WAQ A;  5DGB A;  4K8J A;  4KHP Q;  2C2D A;  5IWA L;  2YZM A;  2F0F A;  1EFI D;  1N8R C;  1J5E H;  2F0D A;  3L9A X;  2UUA H;  1ENA A;  2M9V A;  2W6Z A;  4R8N A;  1HFN A;  1GSH A;  2WAQ G;  3CME A;  4EEY A;  3JZI A;  1YBY A;  5KFD A;  4CJ1 B;  1KAB A;  2YTV A;  1EZ1 A;  1GUW A;  4X66 H;  1SXT A;  1YNN C;  2TSS A;  2LY7 A;  2W6N A;  3MXN A;  3M4I A;  4JV0 A;  2ZT9 C;  1X56 A;  3RV3 A;  1Q1B A;  2B39 A;  2LXJ A;  3GTL H;  1HNW Q;  3CP0 A;  4RNO A;  1JJG A;  4A3M B;  1VQH A;  3J7Z C;  5KFN A;  4FDB A;  1LO5 D;  3PMF A;  3QIA A;  1VMP A;  2XGT A;  3HOW G;  5KFM A;  4HAE A;  4KHV A;  1KDA A;  2BDO A;  4RWS C;  2BE5 C;  1O7I A;  5EKK A;  4AQY H;  4JV2 A;  4WBN F;  2I46 A;  4DV6 Q;  1CK1 A;  1X3G A;  3BS1 A;  1XPO A;  1TWF A;  3N42 B;  2YZG A;  1SLJ A;  5EOY A;  2R8I A;  3KF8 A;  1JE4 A;  2HQE A;  2HUG A;  1AZQ A;  1SN8 A;  1RYR A;  2JSO A;  1JX4 A;  1SDF A;  1U4L A;  5FPO A;  3VR5 A;  4EFB A;  3S9W A;  3K0X A;  1IYJ B;  5FK9 C;  1IBL H;  1TS5 A;  1M6V A;  4BY1 B;  3A8K E;  1K0S A;  2KEE A;  3SK6 A;  4KMU C;  1TR5 A;  2NTT A;  4DR5 Q;  1HJP A;  3OW2 A;  1ZYR C;  2VUM H;  1TQO A;  3BJU A;  4DR7 L;  2YRW A;  2XWJ B;  4RZR A;  4XYM B;  1Z9F A;  4BBR H;  1TWA H;  1K3B C;  2RSO A;  1MZB A;  3TN2 A;  3A54 A;  1C7Y A;  3FMC A;  1KTK A;  4Q44 A;  2BQU A;  1D7Q A;  2KCC A;  3D4D A;  1TWG H;  1Q86 C;  2PPB C;  4RA8 A;  2JA6 A;  1WCM H;  1HR0 W;  1U4M A;  1EFW A;  4XYL B;  1ZET A;  5KFC A;  3QOJ A;  4DL6 A;  4RB2 C;  2V1C C;  2R93 A;  4UCU A;  1J5E L;  5KFT A;  2DLN A;  2UUA L;  5C44 G;  4YWK A;  4F8M A;  4LWC A;  2ASB A;  4DU9 A;  2JA6 G;  1V1P A;  4OO1 I;  2R92 A;  3C3L A;  4L1K A;  4N8F A;  3Q8S B;  5E7N A;  4X66 L;  2R93 G;  4DAY B;  2W9B A;  2JEJ A;  3PGZ A;  3UDI A;  4DPG A;  5EKI A;  4MV7 A;  1EIY B;  1DOM A;  1B50 A;  3BDL A;  2FJ2 A;  5I9P A;  4EQ5 A;  3IKJ A;  3T56 B;  4FF2 A;  4PWQ A;  3SK8 A;  5KG1 A;  5KFW A;  3ERS X;  3VR6 A;  2R92 G;  4A3C H;  1QNU A;  4G57 A;  1IL2 A;  3I2Z A;  3J7Y W;  4YR3 A;  2JYO A;  3L4J A;  3GDE A;  5C3E G;  1AH9 A;  3SE0 A;  4OO1 H;  3DWQ A;  5M5W B;  4DV5 L;  2XC9 A;  5L37 A;  4AQY L;  1I50 H;  3E9H A;  1H9M A;  5CBA E;  5IYB G;  2VB2 X;  2EOT A;  4IPH A;  4DR1 L;  5L1L A;  3HOV G;  2YW2 A;  4A3I H;  1I4R A;  4K0K Q;  5JVD F;  2VA3 A;  1PTO B;  1K1S A;  3K6O A;  3HKS A;  3PUZ A;  1WTO A;  4DV3 Q;  4LF6 H;  4MV3 A;  3BVG A;  4HED A;  3I90 A;  4MA0 A;  3S1M H;  3N40 P;  1STE A;  2KHS A;  4C1N I;  3NBH B;  2O5J C;  3UE0 A;  1ULZ A;  4GKK Q;  4IUP A;  4BBR B;  2BOS A;  3D4R A;  3MXG A;  5CR3 A;  1IBL L;  1YVC A;  2O4X A;  2CFM A;  4JBJ A;  4R7R A;  5KG3 A;  2TMP A;  3NQT A;  3AEV A;  3PZP A;  1N34 H;  3FP9 A;  4JI4 Q;  4IJL A;  4U68 A;  4LNQ A;  1D8L A;  3FPP A;  3RLO A;  1RKN A;  5LL6 S;  4CJ0 B;  2IL8 A;  3F2U A;  1JJ2 A;  3TQ1 A;  2BA1 A;  1IOW A;  3F8T A;  1NMF A;  4QJF A;  5AJ3 L;  4BBS B;  3MEH A;  3DEP A;  1BJT A;  1K3R A;  2ZXP A;  3AB9 A;  1HNZ Q;  1KJ9 A;  2E2I A;  4LUZ A;  4LFA Q;  1IW7 D;  4M9U A;  3AU7 A;  2F0Q A;  2L9H A;  5JPM C;  2IHE A;  4HYK A;  3D6W A;  1NNX A;  2NVY B;  2CW8 A;  3PV0 A;  1X54 A;  2Q2I A;  2F4V H;  2EJG C;  2IX3 A;  3D4W A;  4FO2 A;  3MWM A;  4LH7 A;  4ZI7 F;  3T1Y H;  5DG8 A;  2RF4 A;  5EPK A;  1K8A C;  4C5C A;  2AUK A;  1I50 B;  5CGK A;  3W2D A;  1MSG A;  1C0A A;  4JK1 C;  2G9H D;  3TEH B;  5CYU A;  1WR2 A;  5LL6 b;  4ED6 A;  2JA7 H;  4A3F G;  4DUZ H;  4L8J A;  2OQK A;  3S2D H;  1GOZ A;  5KEE A;  4IJH A;  5DLQ E;  5JEA J;  3X3M A;  3QZ7 A;  1UC9 A;  1Y1W A;  3LWU A;  3HEJ A;  2FP4 B;  4HJ9 A;  5J39 A;  2NU9 B;  4MA5 A;  4P72 A;  4O3Q A;  1TU2 B;  1B2T A;  3GQC A;  4GNX B;  5KT6 A;  3GIM A;  2I07 B;  4DR2 H;  1QG7 A;  1ESF A;  1QUQ B;  1LM0 A;  1R9T B;  2ATW A;  1IBK H;  1X55 A;  4LF6 L;  1PRT D;  1Y1W G;  2IPK D;  3BVM A;  5FKA C;  1BCP C;  5M3M B;  3HZX A;  4LFC H;  2E5L Q;  5DLG A;  4A3E G;  5KFL A;  5C4H A;  3QWN A;  2UVW A;  3DHQ A;  2YL2 A;  5BPH A;  1N34 L;  2KQ3 A;  1VQ4 A;  4YQW A;  3QFF A;  3PW2 A;  2EPB A;  3CAM A;  2FMM A;  4GLA C;  4UHV A;  3QZ8 A;  5FOB B;  3BU2 A;  1TWH A;  5M5X H;  1RJR A;  1SFO A;  1V8Q A;  2DY7 A;  3JAM c;  5CB4 F;  4J9L A;  4P2C B;  3RFC A;  4P74 A;  3G6Y A;  4LF5 Q;  1YEZ A;  3W3A A;  3Q8Q B;  2EJF C;  1ET6 A;  2VZA A;  3CKI B;  3CCS A;  3CVZ A;  5IP7 G;  4Y8V B;  2FK1 A;  2CW0 C;  1RF2 D;  1QE6 A;  2ID0 A;  2K04 A;  2CQA A;  4MTN A;  4DNT B;  3LP8 A;  1E2V A;  3MR5 A;  2JA5 H;  1QZH A;  2W6P A;  2NVQ H;  3FKI H;  1B9N A;  1H9S A;  4ECS A;  4Z9C B;  1SEB D;  1YJN A;  4LF8 H;  3V4Z A;  1WI5 A;  4PQX A;  1EY9 A;  2BDN A;  5M5Y H;  1BKB A;  5C3X A;  2F4V L;  3A0J A;  2P0A A;  3T1Y L;  1VDZ A;  1X3Q A;  3E6Z X;  2KEC A;  1GGO A;  3HOU G;  2K50 A;  4NXM H;  4JI5 Q;  2F1M A;  1QNK A;  4C3H H;  4MV6 A;  3CU7 A;  3M4O B;  4FF3 A;  3Q24 A;  2IP4 A;  5JH7 F;  1R4P B;  1HH2 P;  1S5D D;  3GTP H;  4RKB A;  4DUZ L;  1AP0 A;  1ONL A;  4B9X A;  5C4X H;  4GKJ Q;  4A3K B;  4JUZ A;  3M9B A;  4GN4 B;  4A2B A;  2B3G A;  1KLU D;  4DAV A;  3GTQ H;  5T14 A;  3KJP A;  1YHQ A;  4DAM A;  1TWC H;  2GPS A;  5HGT A;  5J22 A;  3DM3 A;  4A75 A;  4DR2 L;  3FRP B;  5F9L A;  3C1F A;  3TME A;  3RBD A;  2YU9 A;  1IBK L;  2A6E C;  1EWC A;  2R7Z A;  3CCV A;  5KFF A;  3RBE A;  3OHX C;  1X65 A;  2HCI A;  4CJ2 C;  4LFC L;  3FMA A;  3VPC A;  4DV2 H;  2JK8 A;  3KDF A;  1RK5 A;  5C4Z A;  1HR0 Q;  5C0X I;  4DKA C;  4DXF A;  2K03 A;  1UEA B;  1VQO A;  3K57 A;  3GLK A;  1PH1 A;  1PH5 A;  3RZO H;  5DAU A;  1EYA A;  2B2V C;  2VQD A;  4QIW A;  1DYQ A;  1FR3 A;  4DV1 Q;  4MV4 A;  2XRS D;  2D62 A;  1PX2 A;  2RGV A;  1X3P A;  3R2I A;  1FGB D;  4RKL A;  2MQH A;  4IUN A;  5C0X J;  3CXC A;  2JA5 B;  3H0G A;  5C0X H;  5KFG A;  1LTA D;  2EIF A;  3SK4 A;  2NVQ B;  2ATL A;  1A2T A;  4X6A H;  5F9N A;  4A3G G;  3KOJ A;  5A35 A;  3PR5 B;  4FF4 A;  4DNR B;  1XMO H;  4B3M Q;  2DNC A;  3H0G G;  2PN1 A;  5C4J B;  4I7A A;  4J8Q A;  4R8I A;  4A93 G;  1SJE D;  2B2U C;  3B6Y A;  4LF8 L;  4NP5 A;  4N9P A;  2ZDG A;  2D5D A;  2M00 A;  2Z0S A;  3BQ2 A;  3GTP B;  1IBM Q;  4BA1 I;  4MV8 A;  5KFQ A;  1CZW A;  5C4X B;  1S0N A;  5J1Z A;  2PCF B;  5DM7 3;  1TWC B;  2X6L A;  3EIV A;  2BH8 A;  4XTC S;  1WD1 A;  3K5O A;  2K4K A;  2IX0 A;  4WOR A;  3VYU A;  5BR8 Q;  4JBM A;  1E4E A;  4I55 F;  2I8C A;  3U9O A;  1HA6 A;  4DK0 A;  2RKS A;  3PO3 B;  3HOY H;  2R7N A;  3I12 A;  2XCA A;  4HR7 B;  4IO9 A;  4JBK A;  1UNS A;  1VQE A;  2L55 A;  1JIH A;  1RL2 A;  2E2J H;  3P1H A;  2GN5 A;  1JOO A;  1PTO D;  2K7V A;  3M9M B;  1T3N A;  2CVR A;  2W9C A;  4DV2 L;  1L1O A;  4DK6 C;  4P73 A;  3TII A;  2R8K A;  4CDF C;  1EY0 A;  4J0M A;  3CCL A;  4BY7 G;  1LT6 D;  1QVF A;  1XNQ Q;  2RHQ B;  1WSC A;  2A8V A;  3F1Z A;  4HNV A;  5JVH 3;  3GTJ A;  2JP1 A;  1QVC A;  4B9W A;  3V6K A;  3K3V A;  3T5J A;  2WFW A;  2FPI B;  3H4B A;  2UVR A;  2NU8 B;  4J6H A;  4HIO A;  5KT2 A;  2IWH A;  5IWA Q;  4DR6 H;  1W6K A;  1K9M C;  5EBC A;  1QZG A;  2EYM A;  3L2P A;  4A3B G;  1O7Y A;  4R8U A;  5C5J A;  4IZ8 A;  3TQY A;  3DM1 A;  3GD7 A;  5T1G A;  2F0O A;  4HSP A;  3K0Y A;  2RDF A;  4L5Q A;  1MSH A;  4EEQ A;  5D65 A;  4O2B F;  1XMO L;  1PLF A;  2W6M A;  3GTG H;  1EQV A;  1CI3 M;  3OSP A;  1OXV A;  1TII D;  3F2C A;  5M3F G;  2UXC Q;  1E7Z A;  2OT2 A;  5KKN B;  1PH2 A;  1GM5 A;  4P71 A;  3OMG A;  4NXN H;  3ULJ A;  4GOP A;  1Q82 C;  1Z6H A;  4RB1 A;  1J8I A;  1GSA A;  4RHS A;  5IT9 c;  1L2F A;  3IFT A;  1A3U A;  5ELD A;  1NSN S;  3EVQ A;  2F0W A;  3JSN A;  1DOL A;  5C8Y F;  4ECU A;  5TSS A;  4RUA A;  3NTH A;  2ALY B;  1NCV A;  2VOB A;  2CCZ A;  2KVM A;  4XX0 B;  2R61 A;  3K3P A;  4J9N A;  1VF5 C;  2IW3 A;  1PA6 A;  1GLV A;  3HOY B;  2I80 A;  1QJO A;  5LL6 X;  3GV5 B;  4ECX A;  2ASD A;  3R8B A;  3R3O A;  4MV9 A;  3K5M A;  5I9O A;  1KRT A;  4GLX A;  2E2J B;  3RLF A;  2KUM A;  1VS0 A;  1VBH A;  1OXU A;  4LMQ D;  1S97 A;  4RGT A;  1ET9 A;  3GV7 B;  4JI7 H;  2NN6 I;  5JAV A;  1VQ8 A;  2RDH A;  3V4S A;  4DR4 H;  3GQB A;  3G71 A;  3I7F A;  4HJA A;  5JJI A;  1X9N A;  1UNN C;  1LAC A;  2W7O A;  4GN5 A;  3RZD H;  1PK8 A;  1R4Q B;  4DR7 Q;  5FJ8 G;  5D1O B;  2BCO A;  4DL2 A;  5C5M A;  1B4O A;  1PVO A;  4HTH A;  5FLX E;  2F0N A;  3SI8 A;  4A3L G;  4A3M G;  4L63 B;  1W6J A;  2NN6 H;  1VQA A;  3MZ5 A;  3NEL A;  3PVX A;  2F03 A;  1JIC A;  1VQK A;  2QA4 A;  4X3U A;  3GIL A;  4RG1 A;  2A69 D;  2VPQ A;  3X3N A;  4DR6 L;  3GIP A;  1B1Z A;  2WII B;  2UUA Q;  2ES2 A;  4RAU C;  2W9A A;  4DR3 H;  2B63 H;  3AFP A;  3N6R A;  2M2L A;  1JB3 A;  1F2L A;  3SE7 A;  2VQE Q;  4P75 A;  3PF5 A;  2C5C A;  1HQR D;  2MUY A;  2RSN A;  4HQ6 A;  3CQZ A;  5EBD A;  3KYH C;  4GS3 A;  3J80 c;  1T5X D;  2MFI A;  3BYT B;  2E2H A;  3PO2 H;  3OSO A;  5AFW A;  5D14 A;  2JE6 I;  2XNA C;  2B2T A;  1U4P A;  4UAI A;  3CRK C;  2KCN A;  1LTR D;  1G8Z D;  2O03 A;  4J9Q A;  2ZTE A;  4NXN L;  1C9O A;  1JOR A;  4F4Y A;  1S40 A;  2V4R A;  2Y0S A;  3LWE A;  4I4T F;  3PSI A;  4DV5 Q;  4KHZ A;  4AQY Q;  4ME6 A;  3LNN A;  4C1N K;  3K80 C;  3I4N H;  1CKM A;  1Q90 A;  4A3D H;  4DR1 Q;  4ILW A;  2GA4 B;  2VW9 A;  3F8N A;  3NE5 B;  4OGQ C;  1EQQ A;  2Y0S G;  2GVA A;  3MAQ A;  3JAM i;  1E4G T;  2PZT A;  3IN5 A;  3GTL A;  1N36 H;  3ULL A;  2IY5 B;  1S0M A;  1IHZ A;  2G9D A;  2RDI A;  2L0C A;  5D8D A;  1Y8O B;  4DAY A;  2VQF H;  2V4Q A;  2DWC A;  1BUV T;  3RZD B;  5C3W A;  5BN3 A;  4EVO A;  4KKT A;  4JI7 L;  1IBL Q;  1S68 A;  2DN8 A;  4QWB A;  4PMC A;  4BS9 A;  1Y1V B;  4ZAI A;  4TQS A;  4DR4 L;  2C35 B;  1Q1E A;  4OHJ A;  5L1K A;  4EQO A;  4DV4 H;  2JJQ A;  2XTI A;  3MC0 B;  3BZD B;  4H02 A;  3AFQ A;  3K5L A;  3TP8 A;  3I4M B;  3K81 C;  5HBR B;  4Q43 A;  2A68 D;  1Z7T A;  3HB9 A;  1V1Q A;  1UE6 A;  2CHB D;  1K0R A;  4RU9 A;  2SCU B;  3TSS A;  5AJ3 Q;  3WOE A;  2CWP A;  1Q3L A;  3GV6 A;  1KAW A;  3PIP 3;  1FD7 D;  1HHV A;  3WO1 A;  1XYI A;  5LYJ F;  3RB4 A;  3NHH A;  5DGA A;  4DAP A;  2LKV A;  3K59 A;  3PO2 B;  4X64 L;  2VUM A;  1LLR D;  4DR3 L;  4IAL A;  1MIU A;  3OIP A;  2JEF A;  1TWA A;  2B2Y A;  4JG2 A;  2PYK A;  2VUM G;  3I8Z A;  4BY1 H;  1TWG A;  3PW7 A;  5KG0 A;  2VB3 X;  1KJ8 A;  2PMZ A;  1WCM A;  4KKS A;  2FK3 A;  1RDP D;  1PYS B;  1HFG A;  4ED7 A;  3I4N B;  4RCN A;  5T1I A;  3KBG A;  2HHH Q;  3VPD A;  4OIK A;  2VL6 A;  3OTO H;  3SHL A;  5KT3 A;  2AUJ D;  5LMN H;  1WCM G;  4CDD C;  1AN7 A;  4TV8 F;  3WNZ A;  2JEG A;  3EA6 A;  1YJW A;  1VQ6 A;  4QWE A;  4OWT B;  3M7N A;  2R7L A;  3BJY A;  2Z8L A;  2E8G A;  4FNF A;  3G7L A; 
#chains in the Genus database with same CATH homology
 1UE1 A;  1JJ2 A;  2BA1 A;  3F8T A;  4DNI A;  1NMF A;  1X3E A;  4QJF A;  4YWM A;  5AJ3 L;  2PQA B;  1VQG A;  1K3R A;  4LF6 Q;  1N36 L;  1Y1V H;  1HNZ Q;  4X65 L;  3CPW A;  4LUZ A;  2ZJR A;  2VQF L;  1VQ5 A;  3RR5 A;  4LFA Q;  3G4S A;  1CSP A;  2WB1 G;  2ZTD A;  1X6O A;  3PUY A;  4HJ8 A;  3PUV A;  2IHF A;  2IHE A;  1N34 Q;  3I4M H;  1I6H H;  4A3C G;  4IOC A;  3OTO Q;  1CSQ A;  5IYC H;  5LMN Q;  3PV0 A;  4DV4 L;  1J5E Q;  4HJ5 A;  1X54 A;  1KXL A;  2Q2I A;  4OO1 G;  4JI5 L;  4ME3 A;  4APV A;  2N78 A;  4DV3 L;  1K8G A;  1GO3 E;  3SGI A;  3RNU A;  1YIT A;  1SFO H;  3BZK A;  2RF4 A;  3CCE A;  1K8A C;  1KRS A;  2ZJP A;  1UWV A;  5M5W H;  4JV5 Q;  1C0A A;  4X66 Q;  1X3F A;  4JBW A;  3TEH B;  1NBW A;  4R4Q A;  4A4I A;  4A3I G;  2PI2 A;  3A5Z B;  3S1Q H;  3L0O A;  3UDF A;  3T1H Q;  5J3B A;  1ASY A;  2IX1 A;  3TRZ A;  2JA7 H;  4BY1 G;  4A3F G;  4L5S A;  2Q2T A;  2OQK A;  3S2D H;  4IJH A;  4RMF A;  5DLQ E;  5JEA J;  4IFD I;  3NEM A;  5LMU L;  4GN3 B;  3HOU H;  4HJ9 A;  3GTO H;  1JJC B;  4IPG A;  1OXS C;  4P72 A;  3K7U C;  5K36 G;  2N8N A;  3PUX A;  4GNX B;  4DR3 Q;  4YCV A;  4TVA B;  2ATW A;  1QUQ B;  1LM0 A;  3I55 A;  3PF4 A;  5EAY A;  1X55 A;  4LF6 L;  3T1Y Q;  1M1K C;  2OWO A;  3U4V A;  1Y1W G;  1HNZ L;  1PFS A;  3KJO A;  1PYB A;  1VQ9 A;  2MNA A;  2AHO B;  3AYH B;  5GAG C;  2E5L Q;  4LFA L;  4A3E G;  4IFD J;  3VDY A;  3AQQ A;  4XIG S;  1UE7 A;  1PV4 A;  3W1B A;  3M3Y H;  1Y14 B;  3CF5 A;  1N34 L;  1VQ4 A;  2F3I A;  1L0W A;  1G29 1;  2HIX A;  3OTO L;  1HZB A;  3G48 A;  3ULP A;  5HY6 A;  5LMN L;  4L5R C;  3CAM A;  4Y52 H;  1Y1V G;  4GLA C;  2N3S A;  2NN6 G;  3JC6 6;  4BBS H;  1NTG A;  3BU2 A;  5HGQ A;  3TRE A;  4AYB E;  5M5X H;  1HNX Q;  3JAM c;  3I56 A;  4AIM A;  2UUB L;  4P74 A;  2PNH A;  1M90 C;  4JV5 L;  3I4M G;  4LF5 Q;  1YEZ A;  3CPF A;  1VQC A;  2YU9 H;  2VZA A;  3D31 A;  3CCS A;  4A3J G;  4LF9 L;  2UXB L;  5IP7 G;  2R7Z H;  1YHA A;  1IBK Q;  2AWO A;  1JB7 A;  3T1H L;  2ID0 A;  1YJ9 A;  1I94 Q;  4MTN A;  2NVY H;  4JI8 L;  4LFC Q;  4Y7N H;  2JA5 H;  1QZH A;  1IZ6 A;  3FHW A;  3S1N H;  2AMC B;  3J81 c;  2NVQ H;  3ZJY C;  3GTK H;  5IE8 A;  1N32 L;  3TS2 A;  3PO2 G;  3FKI H;  1L1O B;  1JE5 A;  1YHB A;  4PZ7 A;  1YJN A;  1PH6 A;  5IYD G;  1WI5 A;  2KHJ A;  3G6E A;  5M5Y H;  1BKB A;  4LF4 Q;  3F2B A;  2KBN A;  1EYG A;  2F4V L;  2JA7 G;  2UUC L;  3A0J A;  1OXT A;  3CC7 A;  4A3G H;  5JJK A;  1EWI A;  1MKH A;  3T1Y L;  4OWW B;  2B29 A;  2FXQ A;  1G51 A;  2CWA A;  1BBW A;  1VQI A;  3H0G H;  1AE2 A;  4DV4 Q;  4KLK A;  5JEA G;  2E5L L;  3HOU G;  2K50 A;  3KFU A;  1Z47 A;  4JI5 Q;  4A93 H;  4MZ9 A;  2R6G A;  3MEF A;  5FLM H;  4IPD A;  3UDX A;  4C3H H;  1FVI A;  1EIF A;  5JJL A;  4JCV E;  4BBR G;  4OXP A;  4UY8 C;  1HH2 P;  1SR3 A;  3GTP H;  1N9W A;  3KLW A;  4DUZ L;  1UE5 A;  3U50 C;  5C4X H;  1UEB A;  4DV7 L;  1KD1 C;  4GKJ Q;  1R9T H;  3M9B A;  4GN4 B;  4DUY Q;  2B3G A;  4IFD G;  2HQL A;  2PQA A;  4OX9 Q;  1H95 A;  1HNX L;  3GTQ H;  1BBU A;  3KJP A;  1YHQ A;  4DAM A;  4IPC A;  4DV0 Q;  1TWC H;  5M3M H;  4LF8 Q;  2GVB A;  3DM3 A;  4A75 A;  4LF5 L;  4DR2 L;  2VS1 A;  1S72 A;  3PIO A;  2QGQ A;  5LMU Q;  1SRO A;  1YZ6 A;  1E3P A;  3K8A A;  1IBK L;  3K7A H;  4C3J H;  1A63 A;  3CCV A;  1XNQ L;  2LXK A;  4BBS G;  1X65 A;  1I94 L;  4LFC L;  4GOP B;  3WWV A;  4JI6 Q;  2JK8 A;  4POF A;  3KDF A;  3HOZ G;  4UP7 A;  1HR0 Q;  2LSS A;  1VQN A;  5C0X I;  4JI0 Q;  4DKA C;  3L7Z C;  1RIP A;  4YY3 Q;  2OTL A;  2R7F A;  4POG A;  1VQO A;  2ZJQ A;  3S15 H;  1PH1 A;  4B3R Q;  1NMG A;  3CCM A;  3CC2 A;  1PH5 A;  1CKO A;  4LF4 L;  3RZO H;  2NVX H;  5ELN A;  1K83 H;  2D0O A;  3D0F A;  1PHJ A;  4DV1 Q;  3KDF B;  3PUW A;  2D62 A;  1FJG L;  1AE3 A;  4R4C A;  3CCU A;  2MQH A;  5C0X J;  3CXC A;  2UXD Q;  4IOA A;  3FKI G;  5FLX c;  1E1O A;  4BY7 H;  4YCW A;  4LFB L;  2EIF A;  4B3S Q;  1Q7Y C;  1EOV A;  5GAD C;  1PH3 A;  2Y0S E;  4LUO A;  4X6A H;  2K14 A;  4GNX C;  2UUB Q;  4A3G G;  3S14 H;  3KOJ A;  5IY0 A;  3CCJ A;  2UXC L;  1I5F A;  4DV2 Q;  4B3M Q;  3A5U A;  3H0G G;  4LF9 Q;  2UXB Q;  3HFZ B;  3J80 i;  3CC4 A;  4GKJ L;  4GNX A;  4A3B H;  1LYL A;  4DUY L;  4A93 G;  5FLM G;  1Q8K A;  1QUQ A;  2H5X A;  4YHH Q;  3GTJ H;  3B6Y A;  2K5H A;  2ZM6 Q;  4OX9 L;  2Z6K C;  4JI8 Q;  5IP9 H;  3MXN B;  3HOX H;  4DV0 L;  4J15 A;  4LF8 L;  1PH9 A;  2WP8 J;  1OXX K;  1N32 Q;  2Z0S A;  2Z6K A;  3M4O H;  1B70 B;  1IBM Q;  4BA1 I;  4BA2 I;  1PH4 A;  2MO0 A;  4C2M H;  3RN5 A;  4JI6 L;  2F4V Q;  2OCE A;  1VQD A;  5ELO A;  2UUC Q;  1HR0 L;  3H15 A;  4JI0 L;  3ER0 A;  1WJJ A;  5M3M G;  5M3F H;  4YY3 L;  4A3K H;  3A74 A;  1LUZ A;  4JI7 Q;  1WYD A;  3EIV A;  2BH8 A;  4XTC S;  3ICE A;  2JEA I;  1A8V A;  2K4K A;  2IX0 A;  2JA8 H;  4B3R L;  5H1S E;  5BR8 Q;  1MJE A;  2NZH A;  4JBM A;  1XTD A;  3KF8 B;  4DV1 L;  4A76 A;  3HOY H;  1XPU A;  4DUZ Q;  1N33 Q;  4IO9 A;  1Q12 A;  4JBK A;  2UXD L;  2EXD A;  1VQE A;  1EQR A;  4DV7 Q;  4B3S L;  1OTC A;  1L1O C;  1WOC A;  2KHI A;  1RL2 A;  2E2J H;  4QQB X;  2GN5 A;  2OQ0 A;  1VQ7 A;  2HIV A;  4DR2 Q;  4DV2 L;  1HZA A;  1L1O A;  1LTL A;  4P73 A;  4DK6 C;  5IYC G;  4B3M L;  2Q2U A;  3W5O A;  4JOI C;  2NVT H;  2A19 A;  4X62 Q;  4HID A;  2BA0 A;  3CCL A;  1KL9 A;  5C0X G;  1QVF A;  1XNQ Q;  4BY7 G;  4YHH L;  2RHQ B;  2F52 A;  3KF6 B;  2ZM6 L;  2A8V A;  3F1Z A;  3RN2 A;  4JOI A;  1QVC A;  4UPA A;  1XNR L;  2WFW A;  4PG3 A;  4YWL A;  4JI1 Q;  1EUJ A;  4HIO A;  4LF7 Q;  1S3O A;  2PMZ E;  2ZTC A;  3I4O A;  5IWA Q;  1IBM L;  2VQE L;  1ASZ A;  1K9M C;  5FJ8 H;  3E9I A;  3L2P A;  1QZG A;  2JA9 A;  2K5V A;  1E1T A;  3W1G A;  1PH8 A;  4A3B G;  2WAQ E;  1GKH A;  2R7D A;  5LMN W;  4JC0 A;  4HIK A;  1W3S A;  3M4Q A;  2MO1 A;  3GO5 A;  3RLN A;  3TQY A;  4QY7 A;  4PMW A;  5IP9 G;  3HOX G;  4A3L H;  2KCM A;  3GD7 A;  4A3M H;  3DLL A;  4HIM A;  5C4J H;  1PH7 A;  1FJG Q;  1B8A A;  2K75 A;  4L5Q A;  2K5N A;  4NPS A;  1DGS A;  4UP8 A;  5BR8 L;  1XMO L;  4LFB Q;  3HOW H;  3GTG H;  2RHS B;  4KI0 A;  2EQS A;  4JI3 Q;  1VCI A;  3J7A 5;  1OXV A;  2WB1 E;  3F2C A;  4DR5 L;  4GOP C;  5M3F G;  2CKZ B;  3EBE A;  4R1J A;  2UXC Q;  1E7Z A;  3M4P A;  4A3K G;  1N33 L;  2K52 A;  1PH2 A;  4JYA Q;  1VQF A;  1A62 A;  2A1A A;  4P71 A;  1GM5 A;  3ULJ A;  4GOP A;  1CUK A;  1P8L A;  3U4Z A;  1Q82 C;  1P16 A;  1KC8 C;  2JA8 G;  1KHI A;  1CKN A;  5IT9 c;  1L2F A;  3H3V I;  4AYB G;  1TWF H;  2ALY B;  1JT8 A;  4EX5 A;  4WJ4 A;  2CCZ A;  3U58 A;  1YI2 A;  4X62 L;  1PA6 A;  2YYZ A;  4MNO A;  2KEN A;  1VQJ A;  3CQZ H;  1W2B A;  3PO3 H;  1VQL A;  2E2H H;  4NXM Q;  4R4I A;  1CKN B;  1K73 C;  4JI1 L;  1KRT A;  4GLX A;  4TQU S;  3RLF A;  4LF7 L;  4KHP Q;  1VS0 A;  1G6P A;  1OXU A;  5IWA L;  2R7Z G;  1N8R C;  5GRO A;  4BXX H;  1FGU A;  4WJ3 M;  2NN6 I;  3CCQ A;  1VQ8 A;  2WAQ G;  2YTX A;  3CME A;  2JA5 G;  4NXN Q;  3G71 A;  1YBY A;  3I7F A;  4O2D A;  4HJA A;  4A3E H;  1WFQ A;  4LUV A;  2YTV A;  5JJI A;  1X9N A;  2I5L X;  3UDG A;  4GN5 A;  4QL5 A;  3RZD H;  4DR7 Q;  5FJ8 G;  3S2H H;  4JI3 L;  1YNX A;  1PVO A;  3STB C;  1X56 A;  5C44 H;  4A3L G;  1Q1B A;  2LXJ A;  3GTL H;  4A3M G;  1HNW Q;  3TS0 A;  3CP0 A;  1VQA A;  3NEL A;  3BZC A;  3UE1 A;  4JYA L;  1JJG A;  2JA6 H;  1VQK A;  1VQH A;  3J7Z C;  2QA4 A;  2OTJ A;  1U5K A;  4FDB A;  4RG1 A;  2HT1 A;  2XGT A;  4B3T Q;  3HOW G;  1E22 A;  1U0L A;  3E0E A;  2R93 H;  4C3I H;  5GQO A;  4DR6 L;  1HZ9 A;  1O7I A;  1XNR Q;  4GLV B;  4K0K L;  2KCT A;  4A3J H;  4DV6 Q;  5IP7 H;  2ES2 A;  1E24 A;  1X3G A;  1JMC A;  1FL0 A;  3AFP A;  4AH6 A;  1XPO A;  2UUA Q;  2B63 H;  1SLJ A;  1TWH H;  2BH2 A;  1VQP A;  3HKZ E;  4JI2 Q;  5C4X G;  2VQE Q;  4DR4 Q;  2YV5 A;  4P75 A;  3CD6 A;  2R92 H;  3PF5 A;  1SN8 A;  1V9P A;  4OON A;  3KYH C;  4GS3 A;  3J80 c;  1I3Q H;  5C3E H;  1KIX A;  4NXM L;  4GKK L;  2VNU D;  2MFI A;  3PO2 H;  2HHH L;  4KHP L;  2JE6 I;  1NE3 A;  5IYD H;  1TXY A;  2CQO A;  1HZC A;  4JI4 L;  5IYB H;  3K0X A;  1VQM A;  4HJ7 A;  1XMO Q;  3S17 H;  1IYJ B;  3CW2 C;  3HOV H;  3PO3 G;  2ZTE A;  4L5T A;  4NXN L;  1C9O A;  4DR5 Q;  1S40 A;  1HJP A;  2AWN A;  2DGY A;  3OW2 A;  3PSI A;  4DV5 Q;  2VUM H;  4KHZ A;  4AQY Q;  3NEN A;  3BJU A;  1SE8 A;  4X64 Q;  3KF6 A;  4DR7 L;  4BXX G;  1Z9F A;  3K80 C;  4BBR H;  1NJI C;  3I4N H;  1CKM A;  1BVS A;  1TWA H;  4DR1 Q;  1XMQ Q;  4A3D H;  1T9H A;  2VW9 A;  1C7Y A;  1EQQ A;  2Y0S G;  1HNW L;  2GVA A;  2I5M X;  3JAM i;  1D7Q A;  3LGJ A;  1TWG H;  2L15 A;  1Q86 C;  3ULL A;  2IY5 B;  1WCM H;  1HR0 W;  4B3T L;  1EFW A;  3CMA A;  2V1C C;  3S24 A;  2D0P A;  1V43 A;  1J5E L;  4DV6 L;  4PZ6 A;  5C44 G;  4ALP A;  4YWK A;  1IBL Q;  2UUA L;  4JI7 L;  4LWC A;  2ASB A;  4LW1 A;  4JI2 L;  1GVP A;  2JA6 G;  4DR4 L;  2C35 B;  1Q1E A;  3J81 i;  4O0A A;  2UU9 Q;  3HOZ H;  4OO1 I;  2JJQ A;  3HKZ G;  2XTI A;  3PCO B;  1SMX A;  5GAE C;  2DUD A;  5E7N A;  4X66 L;  4H02 A;  3AFQ A;  4UP9 A;  4DAY B;  3PGZ A;  3UDI A;  4QGU A;  3CCR A;  4DPG A;  1IXR A;  3S1R H;  2N49 A;  3F2D A;  3K81 C;  2RCN A;  1EIY B;  2B63 G;  3M85 A;  1V1Q A;  1UE6 A;  3GTM H;  5GAH C;  2YTY A;  4EQ5 A;  1K0R A;  1J6Q A;  1XJV A;  4R4T A;  2VY3 A;  5AJ3 Q;  3ERS X;  2CWP A;  2R92 G;  4A3C H;  1IL2 A;  1KAW A;  3I2Z A;  3J81 j;  4DK3 C;  2E2I H;  1N36 Q;  3GDE A;  5C3E G;  1AH9 A;  4X65 Q;  2VQF Q;  4DV5 L;  4AQY L;  4YCU A;  2QEX A;  1I50 H;  3Q8D A;  1Q81 C;  4X64 L;  1YIJ A;  2NZO A;  3E9H A;  5IYB G;  4DR3 L;  4OWX B;  1MIU A;  1XMQ L;  4IPH A;  4DR1 L;  3HOV G;  4PZ8 A;  1XPR A;  1VQB A;  4DR6 Q;  1MJC A;  4A3I H;  1SRU A;  3OYY A;  4JG2 A;  4K0K Q;  3HKS A;  3HOY G;  3PUZ A;  4QIW E;  2VUM G;  4DV3 Q;  3S16 H;  4BY1 H;  3IRB A;  4A3F H;  1QVG A;  3S1M H;  4NB3 A;  2JEB I;  3NBH B;  2R93 G;  3UE0 A;  3I4N G;  4A3D G;  1PYS B;  4GKK Q;  2AKW B;  2I0Q A;  1IBL L;  1NY4 A;  1YVC A;  2Q2H A;  2CFM A;  4JBJ A;  2JQO A;  3PIP A;  1Q46 A;  2HHH Q;  1B7Y B;  2VL6 A;  3AEV A;  2IT1 A;  3H3V H;  3FP9 A;  2I5H A;  4JI4 Q;  4IJL A;  2UU9 L;  1KQS A;  1WCM G;  3EN2 A;  1D8L A;  1A0I A;  1GD7 A;  4LNQ A;  3RLO A;  2PI2 E;  1Y1W H;  1YJW A;  1VQ6 A;  4OWT B;  3M7N A;  4R4O A;  2E8G A;  3STB D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...