3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
2FXQA 3PSIA 5C4JH 1Z9FA 2E5LQ 2K52A 1VQ5A 3HOYH 4GS3A 1PH3A 2R92G 4APVA 3KF6A 5HGQA 5J3BA 1P16A 2RF4A 4NXMQ 3W1BA 5DLQE 2WAQE 4DR3L 1KQSA 1IBKQ 2E8GA 4JYAQ 2AWOA 4DV0L 3BZKA 3S24A 1UE6A 1HH2P 3W5OA 5FLMH 2R7FA 3CCVA 1OXXK 4LWCA 4LFCL 3CMEA 4B3TL 4UP9A 4DR7Q 4O2DA 3TS0A 1N34L 3FKIH 4DV2L 1A63A 4A3MH 3JAMc 3OTOL 2ALYB 4QY7A 1Q81C 4LF9L 3GO5A 1DGSA 3K80C 4YHHQ 3EBEA 4X62L 4GOPA 1L1OA 3TEHB 4YY3L 4HIDA 5BR8Q 1VCIA 4HIMA 4K0KL 3NBHB 5C0XJ 4LF8Q 4DKAC 1IBLL 1VQNA 2OTJA 4YWKA 2VQFL 3UDGA 4X6AH 3PUXA 4HJAA 4A3KG 2ID0A 1N36Q 3CPFA 3I4NG 3CC4A 3BU2A 1VQEA 4JV5Q 2ZM6L 4JI0Q 1K73C 4DUYL 3I7FA 1YHAA 3M4PA 4LUZA 3ICEA 4JG2A 2MFIA 4DAMA 2I5MX 1OXTA 4MZ9A 4ME3A 5EAYA 4YCWA 4BBSH 2KHIA 2PQAA 2Z6KC 2D0OA 1X6OA 2ZTDA 4PZ8A 3NEMA 3CCMA 4DR5Q 4DR2Q 1HZ9A 3CF5A 1M90C 3HOZG 2UXBL 3PCOB 1OXVA 1VQBA 2Z0SA 2ASBA 4BBRG 1W2BA 2Q2TA 5FLXc 3KLWA 4A3CG 1Z47A 1XPOA 1VQKA 1NY4A 4A3GH 5K36G 1IL2A 3SGIA 2H5XA 1X54A 4POGA 4B3RQ 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 1PH4A 2F52A 4JI8Q 1YI2A 5IYBH 2Y0SE 1X56A 4DPGA 1HZAA 3J81c 1PFSA 3K8AA 5ELNA 2PI2A 2JA8H 1TWFH 2B3GA 3UE0A 1N9WA 2RHQB 4R4OA 1VQ6A 3GTPH 4GKJQ 1Y1VG 4QL5A 4X64Q 5M3FG 4JI5Q 1XNQL 1K83H 1I94L 2AHOB 1B8AA 4OWTB 2VW9A 5M5YH 4JI4L 2UXCQ 5LMUL 3STBD 3HOWG 2R92H 4O0AA 1Q46A 3FKIG 2AWNA 4YWLA 1EQQA 2YYZA 1VQGA 2A19A 4JBMA 4AYBE 5JEAG 1V9PA 3H0GG 2VZAA 4DR1Q 2JA6H 1UE7A 1QZGA 1GD7A 2L15A 5GAEC 3K7AH 1Q1BA 3G48A 5ELOA 1W3SA 3CCLA 1VQCA 1A0IA 1BKBA 1YHBA 2UU9Q 4X66Q 4IO9A 4LFCQ 4A3FH 5C3EG 1QZHA 1IBMQ 3M3YH 1FJGL 3CXCA 2R93G 2WB1E 3L2PA 4JI6L 3S2HH 5IWAL 1Q1EA 5GAHC 2IHEA 4C3HH 4JI2L 1N32Q 4LF5L 1X3FA 3JC66 4DV6Q 1I5FA 4R4CA 2LXJA 4MTNA 5GQOA 5AJ3L 4DV7L 1R9TH 2WP8J 1A62A 1NMFA 4YY3Q 1J6QA 2NZHA 4NXNQ 1UE1A 4BBSG 3I4MG 1TWAH 3U50C 4KHPL 3RLOA 3PUYA 3RLFA 2Z6KA 2JJQA 5GADC 3I4NH 1K3RA 4R4TA 4AQYL 1SRUA 1T9HA 3PUZA 4JI3Q 2ZTEA 3HOUG 2R7ZG 4UY8C 1D7QA 4A3GG 4P73A 2JEBI 3LGJA 2XTIA 5LMNW 1J5EQ 2F4VL 4WJ3M 3CCJA 3AFPA 4C2MH 4KLKA 3AYHB 3CCSA 4Y52H 1TXYA 3HOZH 1EIFA 5IYBG 4JI7Q 1N33L 3PIOA 2F3IA 1KRSA 3HKSA 1L2FA 2PI2E 5IP9G 5LMNQ 1GO3E 2BH2A 3PF4A 4AYBG 4BBRH 1X3EA 4HJ5A 3OW2A 4HJ8A 3CCRA 4JOIA 1VQ8A 3M7NA 2BA1A 4IFDG 3GTMH 1ASYA 3L7ZC 1YEZA 3PUVA 2D62A 2ZTCA 5JJKA 2NZOA 3ULJA 3M85A 1G6PA 1BBUA 3KDFA 1CKOA 4H02A 4KI0A 2UUCQ 4DV4Q 4LF7Q 2JA6G 1VQAA 1K9MC 4DV1L 5C44G 4A3JH 4IFDI 2YTXA 2JE6I 3CC7A 1Y1VH 1C9OA 2EIFA 1CKNA 2K50A 3PUWA 5M3FH 1YIJA 5E7NA 2CCZA 2UUAQ 2UUBQ 3A74A 2IHFA 2VQEL 2ZJPA 1E1TA 3DM3A 4BY1G 3HOWH 4A3FG 4DUZL 5IYDH 3CW2C 3GTJH 2OTLA 4JI4Q 4HJ9A 4IOCA 4B3SL 4GKKL 2EQSA 3E0EA 4A3IH 3H0GH 3KJPA 3F1ZA 2I5LX 1PYBA 4X65Q 5IYCH 3G71A 1XJVA 3DLLA 1I6HH 4AIMA 4LFAL 1XNRQ 3TQYA 4A3BH 4OX9L 4FDBA 3CMAA 5C3EH 2GN5A 3CC2A 2R93H 2QEXA 4JBJA 3HKZG 3PO3H 4PG3A 2HIVA 3F8TA 2MQHA 4A3EG 4RMFA 1XMQL 4LFBQ 5IY0A 3ER0A 4GN5A 1FL0A 1HR0W 1E1OA 3K7UC 4A76A 2HQLA 4P74A 1WJJA 1VQDA 4DR4L 1XMOL 3I4MH 1VS0A 4P72A 2YV5A 1VQ9A 4A93H 2YTYA 4B3MQ 1HR0Q 1PA6A 1PYSB 2HHHL 2JA9A 2DGYA 2IX0A 5M5WH 2WAQG 3KDFB 3F2DA 3PF5A 1HNXL 2JEAI 2R7ZH 4DV3L 3MEFA 3HOUH 1HNZQ 3GTOH 1QVFA 4JBKA 4LF6L 3NENA 3T1YQ 4UPAA 4A75A 1CUKA 2MO0A 1CKNB 2UXDQ 1GVPA 2A1AA 3FP9A 1CKMA 2NN6G 4DV5L 1PHJA 4LF4L 2Q2IA 1VQ7A 4TQUS 1PH9A 3S2DH 4L5TA 1FGUA 4LUVA 5IP9H 4JI1L 4L5SA 1NMGA 4JOIC 4A3JG 1YHQA 3T1HL 3GTGH 1LYLA 4A3DH 3J80c 3D31A 3RN2A 1VQOA 2GVBA 4DR6L 1I50H 3CQZH 4JBWA 5JJLA 5IYDG 3H15A 1VQJA 2VS1A 4C3IH 1KL9A 4UP7A 2E5LL 4R1JA 4QGUA 4A3IG 1KD1C 1KIXA 1Y1WH 2B63H 5JJIA 3CCEA 3EN2A 3IRBA 2R7DA 4GLXA 2AKWB 1CSQA 2VY3A 3MXNB 5C44H 1PH1A 4NXML 1IZ6A 1YBYA 2QA4A 4DR3Q 4JYAL 5IYCG 4DV0Q 3CCQA 2KCTA 1JB7A 1IBKL 2YU9H 4ALPA 1MKHA 4YCUA 4B3TQ 1M1KC 4A3BG 3PGZA 4BY1H 2NVXH 1LM0A 4R4QA 4A3LH 1JT8A 3UDXA 1FVIA 4IPHA 3JAMi 3PO3G 4DR7L 2VL6A 2NVQH 3J7A5 1GM5A 3KJOA 1N34Q 3S1MH 2K5NA 4DV2Q 4LUOA 1OXSC 3OTOQ 4GNXB 4LF9Q 5IP7G 2HT1A 1PV4A 2Q2HA 1UEBA 4DAYB 3A5ZB 3PIPA 1Y14B 4YHHL 4X62Q 3I56A 4BA1I 2ATWA 2JA7G 1KAWA 2XGTA 5BR8L 4K0KQ 4A93G 3K81C 1IBLQ 1XTDA 4LF8L 2VQFQ 4LNQA 2GVAA 3J81j 1E7ZA 3F2BA 4A3EH 4BY7G 2Y0SG 5C4XH 1JMCA 1N36L 1NTGA 4POFA 2OCEA 3K0XA 1OXUA 1U5KA 2ZM6Q 4OWXB 4JV5L 4JI0L 3A5UA 1VQLA 4DUYQ 1WI5A 1SN8A 3HFZB 2N3SA 1PH6A 1K8GA 1B7YB 4Y7NH 4BA2I 2JQOA 3AFQA 3RR5A 3G4SA 4GNXC 1PH7A 5GROA 3U4VA 4L5RC 2B29A 1YJ9A 1YVCA 2A8VA 3B6YA 3PV0A 4DR5L 1Q82C 2KCMA 2UXBQ 4DR2L 1PH2A 3CCUA 3L0OA 3UDFA 4YWMA 3I55A 4A3DG 1QVCA 1BVSA 3NELA 3M4QA 1K0RA 3I4OA 1KC8C 3TS2A 4C3JH 1D8LA 2YTVA 1Q86C 3M9BA 4WJ4A 1S40A 4OXPA 1MIUA 2K5VA 2ZJRA 4B3RL 3J81i 1A8VA 1V43A 2WB1G 1Y1WG 4LF4Q 2B63G 2CFMA 4JI8L 5H1SE 2AMCB 1LTLA 1X55A 1UWVA 3OYYA 1KRTA 3GTKH 4GKJL 4IFDJ 2I0QA 1XNQQ 1X65A 1JE5A 4DNIA 4JI5L 3UE1A 4X64L 1I94Q 1N8RC 4A3LG 2UXCL 1XPRA 4J15A 5LMUQ 1QVGA 2KHJA 2N8NA 1LUZA 2K5HA 4HIKA 3A0JA 1AH9A 2PMZE 1WCMG 5M3MG 1X9NA 4HJ7A 3E9HA 4DR1L 1GKHA 3H3VI 1XPUA 2OWOA 1O7IA 1VQPA 3S14H 1E24A 1YNXA 3ULLA 4PZ7A 1NJIC 3GTLH 1PH5A 1QUQB 5C0XG 1HNWL 2UU9L 2IY5B 4X66L 4IJHA 4RG1A 1FJGQ 5C4XG 1IBML 4JI6Q 2V1CC 1YZ6A 3KFUA 5IWAQ 4BXXG 3KYHC 4JI2Q 1X3GA 1N32L 1SFOH 4LF5Q 2E2HH 5IP7H 1RIPA 1E3PA 2K75A 5IE8A 3RZOH 2QGQA 3Q8DA 3F2CA 3S17H 4DV6L 4DV7Q 5AJ3Q 1YJWA 2JA7H 5C0XI 4NB3A 1SMXA 3GDEA 4NXNL 4GN4B 2HIXA 2RHSB 4L5QA 4AH6A 3ERSX 5FJ8G 4BY7H 1IYJB 2ES2A 4GNXA 4KHPQ 2VNUD 2RCNA 2WFWA 2MO1A 1UE5A 2CWPA 4AQYQ 1MJCA 1VQIA 5M5XH 3EIVA 1HJPA 3BJUA 1OTCA 4JI3L 4JC0A 1JJ2A 1U0LA 2VUMG 1P8LA 4HIOA 5GAGC 2DUDA 1YITA 4QQBX 3M4OH 3UDIA 2F4VQ 1J5EL 3S15H 4NPSA 3PO2G 1MJEA 1HZCA 3S1RH 1N33Q 2JK8A 4JI7L 5LMNL 4PMWA 2JA5G 1SROA 2K4KA 3J7ZC 1EFWA 2BA0A 2KENA 2NN6I 3KF6B 3WWVA 2E2IH 4XTCS 1KXLA 1C7YA 2E2JH 1V1QA 4UP8A 3ULPA 2BH8A 1VQHA 2IT1A 3CPWA 4TVAB 3W1GA 4OO1G 1Q8KA 1H95A 1BBWA 3FHWA 1EOVA 2UUCL 1KHIA 1EQRA 4EQ5A 4DV4L 3RNUA 3RLNA 3RZDH 4LF7L 4OONA 4A4IA 3HOXH 1RL2A 4EX5A 4DV1Q 3GTQH 3HOVH 3AQQA 3H3VH 1VQFA 3S1NH 2UUBL 2UUAL 1Q12A 1E22A 4IPGA 1PVOA 2LSSA 2CQOA 1HZBA 1NE3A 2VQEQ 3I2ZA 5FLMG 4OO1I 1TWCH 4DUZQ 1JJGA 1WYDA 3RN5A 4GOPB 1L1OB 4B3SQ 4DK6C 4GKKQ 1WCMH 3TREA 4LW1A 5M3MH 4P71A 2R6GA 5JEAJ 4IOAA 1EWIA 3KF8B 2I5HA 3U4ZA 2NVTH 4XIGS 4YCVA 4A3MG 1VQMA 3VDYA 4X65L 2MNAA 1G51A 4IJLA 4LFAQ 2Q2UA 1XNRL 4GLAC 2N49A 1G291 4OX9Q 1S3OA 2ZJQA 1K8AC 1HNWQ 1XMQQ 4BXXH 1I3QH 2KBNA 2LXKA 4LFBL 2C35B 1Q7YC 2PQAB 4QJFA 1QUQA 3BZCA 3CD6A 1WOCA 1L1OC 4GOPC 1L0WA 1ASZA 2CWAA 4R4IA 1YJNA 2K14A 1EYGA 1VQ4A 4DR4Q 1XMOQ 1IXRA 5FJ8H 2EXDA 1TWHH 4GLVB 4GN3B 3U58A 1EIYB 4B3ML 1HR0L 4OWWB 2OQKA 4JCVE 4A3KH 2HHHQ 1HNXQ 3D0FA 1SR3A 5IT9c 2VUMH 1S72A 3AEVA 4DV3Q 3S16H 3E9IA 4MNOA 1JJCB 2N78A 1HNZL 2NVYH 3S1QH 1WFQA 3G6EA 4LF6Q 4IPCA 1CSPA 1B70B 3KOJA 3T1YL 3PO2H 1AE2A 1SE8A 2UXDL 1NBWA 4IPDA 4DV5Q 4PZ6A 3STBC 3TRZA 3ZJYC 3HKZE 4JI1Q 3GD7A 3J80i 3HOXG 1EUJA 1TWGH 2D0PA 1SLJA 3CP0A 4KHZA 3T1HQ 2JA5H 2IX1A 1AE3A 2PNHA 2JA8G 3HOVG 4A3CH 4DR6Q 2OQ0A 5HY6A 1C0AA 4QIWE 4P75A
chains in the Genus database with same CATH superfamily
2FXQA 3PSIA 1MZBA 2EPBA 2SEBD 1ZHQA 4GS3A 5FPOA 2R8GA 2NUAB 3Q23A 2EY5A 1PFBA 4LF8H 2R61A 1KQSA 4CDCC 1KBLA 2AWOA 4WFN3 1V8QA 5CBAE 1LTTD 2RVLA 3MEHA 3Q24A 3HBLA 3BZKA 4LFBH 3W5OA 4A3JB 2X6GA 1G91A 1T3NA 1SYEA 3CMEA 4UP9A 4O2DA 5L1IA 2C5CA 1ONLA 1S5DD 3WO0A 3LWEA 5KT6A 1A63A 4HQ6A 3OTOL 2LKVA 2ALYB 5KYIA 2B2WA 2UVUA 5KFGA 5ELEA 4AYBA 1QE6A 1B44D 2OLSA 5KFQA 2RCFA 4K0KL 4M7EA 2I87A 4LF8Q 4DKAC 1IBLL 4TRDA 4YWKA 3BYTB 4QWDA 3I4NG 3CPFA 5NUCA 3TMEA 4MV3A 4C5BA 3MJFA 2EYJA 5AFWA 1JICA 3NK9A 4KD4A 1D5XC 3ICEA 5JVLA 1HQMC 1GHKA 1SFOB 3NGDA 4BBSH 1C8CA 4Q43A 1PTOD 2KHIA 4DR5Q 2K03A 1X6OA 3S17B 4PZ8A 4X6AH 3EPGA 4DK0A 4JI5H 2F0EA 2M00A 2JA7B 2W9AA 4RGNA 1NSNS 2QDBA 1VQBA 2ENBA 2Z0SA 1JWSD 2VPQA 1Z47A 2B2VA 2GPSA 1FR3A 1NY4A 4RGMA 2PYKA 3MA2B 2F0WA 1X54A 4POGA 3JAME 1STYA 3M4OB 2F52A 1PK8A 4DPGA 1X56A 3S15B 1MHWC 5ELNA 1IBMH 3S2DB 3T5HA 4F4ZA 1FNUA 3GTPH 2W6NA 1N34H 4AYBB 4JI5Q 1KJQA 1K83H 1HA6A 3W3AA 3RMHA 4A3DB 2AGPA 5FLXW 2WV6D 4O0AA 2HDMA 2AWNA 3FKIG 4YWLA 3RGZA 1EQQA 2YYZA 1VQGA 2A19A 5K5PA 1XYIA 4AYBE 5JEAG 1V9PA 2FKLA 2WAQA 1LT4D 2WB1B 4KY5A 2B63B 5KFKA 3R5FA 1Q1BA 3U9SA 1SYDA 1KDBA 5C44B 1BGWA 3T51B 2V5AA 4A3FH 5C3EG 1CA5A 1IBMQ 2X0SA 5DQGA 1KJIA 1SCUB 4I50F 2K6AA 2WB1E 2EOTA 4JI6L 4BY1B 5IWAL 2NVXB 1V4YA 4JI2L 3IAYA 2R86A 1IW7C 1F2ZA 2V9WA 4N9TA 4G57A 1X3FA 3JC66 4DV6Q 5GQOA 3KAKA 5AJ3L 3SDZA 5F9NA 1A62A 2NZHA 3GLKA 1UE1A 2NVTB 2Q8TA 1HUMA 2C2EA 4KHPL 1UC8A 5KFNA 5GADC 3PMFA 3RLFA 3I4NH 2EYOA 4R4TA 4AQYL 1SRUA 2M2LA 1UUPA 4DAPA 2VPSA 1A9XA 4UY8C 1D7QA 3HGBA 4A3GG 5KEEA 1L2ZA 5LMNW 2JEBI 2Q8IB 2F4VL 5T1GA 4TQSA 4RUAA 5KG6A 1S68A 2YRWA 5EWFA 3NTIA 1DONA 2WYOA 3GTLA 4Y52H 5DG9A 4HYKA 4FXDA 4V0BA 5GONF 4J9NA 5KT4A 1XNQH 1KRSA 5IP9G 1GO3E 1KJ9A 2WTFA 3UFXB 2WAQB 1W6KA 2F0NA 2VUMB 3PUVA 4FYDA 4Y8VB 2NZOA 4XQQA 3M85A 3MVVA 2Y0SA 4QWAA 4H02A 1K1QA 4KJOA 4OEMB 4ZHQF 2D9UA 4OELB 2JE6I 3N8DA 1FJGH 1CKNA 1HXYD 4UCSA 3SEBA 5LL6b 3KHLA 1O80A 3NBIA 2A68D 3GTJH 4HJ9A 2PZTA 1K8MA 2ZDHA 4GKKL 5LL6X 3E0EA 4R8UA 3ZYYX 1C48A 5JEAH 3URYA 1WVLA 3GTGA 5C1PA 2R7LA 2KQ3A 4DNTB 5BN4A 4FM9A 1NCVA 5KFOA 1S0MA 1SNPA 3TQYA 4A3BH 1M6VA 1C30A 5C3EH 2ZDQA 2QEXA 2XIWA 3HKZG 3TP5A 2W6OA 1LACA 2W8KA 1SNQA 1DZ1A 1EUDB 2SNMA 3BG3A 5IY0A 3ER0A 4GN5A 1HHVA 4RZQA 4A76A 2YU9A 1N33H 3VR4A 5I6YA 2YW2A 1NR2A 1WJJA 2V59A 4F4YA 4PQXA 1XMOL 4P72A 4KKTA 4O3QA 4Q8FA 1PYSB 2A73B 4DA2A 2JA9A 2DGYA 5M5WH 3PF5A 1FD7D 2JEAI 3PW2A 1JLLB 3GTOH 1QVFA 2GPWA 2XWJB 4K8IA 3I72A 4UPAA 1CUKA 1CKNB 2KEEA 4WORA 5M9OA 4DV1H 2Q2IA 1VQ7A 3V6JA 1PH9A 4L5TA 4EVOA 5IP9H 3CHBD 4JI1L 2J6UA 1MBYA 2I07B 4L5SA 4JOIC 1I3QA 1YHQA 4R8UB 4EFEA 3GTGH 1M0WA 5JPMC 4APMA 4B3SH 3OTOH 1ZQ7A 1I50H 2JEFA 4YJ2F 2AQ2B 2O03A 3SK5A 3GIQA 4F88A 1RF2D 3NWSA 4A3IG 1JOQA 3CCEA 3IRBA 4GLXA 1KNAA 5KX5F 4FXGC 1CSQA 2VY3A 3H6MA 4ECWA 4NXML 4BWSC 2QA4A 3DHQA 2YU9H 4GZYC 2Q8RE 5EKKA 2RDJA 3FPUB 2LMCB 1W93A 4R4QA 4A3LH 4CDDC 3DWPA 2K28A 1HTPA 2SNSA 3S1NB 2AQ4A 3PO3G 1Z2OX 2NVQH 2LS01 3KLSX 3J7A5 1BXTA 3S1MH 2EY1A 1BOSA 4LUOA 1OXSC 3T16A 3OTOQ 4GNXB 5E4XA 5IP7G 2FPIB 2Q2HA 4DAYB 2EJMA 2VA2A 4X3TA 3P7JA 2FMMA 1KAWA 1HNXH 4K0KQ 4A93G 1IBLQ 2WKCA 5C4HA 3R5HA 2GVAA 3K7AB 5C4XH 5A2QW 1NTGA 1A2TA 2F0QA 3K0XA 1S03G 1EYCA 4JI0L 3A5UA 1G2TA 1VQLA 1E4EA 3HFZB 1PH6A 4ZQ3A 4J0MA 2HQEA 3RR5A 3ITPA 3Q22A 3PW0A 1I4QA 2EE1A 3N6RA 5FO7B 3U4VA 2K01A 1YVCA 5I2XA 3B6YA 1Q82C 2J6TA 1G6ZA 5L37A 1CE8A 4L1KA 2J9GA 3MZ5A 3SVMA 3VA5A 1V1PA 5IOCA 1BVSA 4A3KB 3M4QA 5IGCA 5EQ0A 1KC8C 3S16B 3JZIA 2YTVA 1Q86C 4JYAH 1IBKH 2BQUA 1SJED 3J81i 4CHTB 4IWYA 1WR2A 1UWVA 2JN4A 4DR7H 5IWAH 2PMZB 4LMQD 3OWFA 4GKJL 4JI2H 1TWGB 2DPJA 1EU4A 2NTTA 1N8RC 4FS2A 2N8NA 2K5HA 3Q1KA 3K59A 4ZK9B 4X3KA 4YHHH 2IJ0A 2PMZE 1WCMG 1X9NA 2L5TA 3NE5B 3E9HA 1D1KA 1D2BA 3CKIB 3HOYB 2FE3A 3CVZA 5FLXL 4HMIA 1X32A 1E24A 3A8KE 3SXHA 1N36H 3CU7A 4JV5H 3IG0A 4X66L 1UC9A 4IJHA 5KFMA 4JI6Q 5IWAQ 4BXXG 2XRSD 4JI2Q 1B50A 5DEHA 3VR5A 1XX8A 2FJZA 4RB2C 5DM63 3GTQA 5IP7H 3RZOH 2Z9HA 2QGQA 3Q8DA 3F2CA 2NYZD 4ZUJA 1V1PB 5AJ3Q 5C0XI 4KJNA 2KA7A 3GDEA 4NXNL 5J2UF 2HIXA 2RHSB 1DCZA 1D5MC 1IYJB 2ES2A 2KUMA 4KHPQ 2HVQA 4RNMA 2R92A 4AQYQ 1HJPA 3BJUA 3TDQA 3V05A 5GAGC 3UDIA 3MWEA 5IIFA 2F4VQ 4C3JG 1J5EL 2VR1A 2SOBA 2FK3A 1HZCA 3ERQA 3TQ1A 5FD5A 3S1RH 3RD4A 1VAJA 2PVPA 4JI7L 5KG1A 1EOTA 5LMNL 4FBUA 2UXCH 3I4MB 4O4LF 5L1JA 4GKKH 4OGQC 5E4WC 1EFWA 4F4XA 2BA0A 1TR5A 4L8JA 2NN6I 1T94A 2EYLA 4DR1H 3ULPA 2R7ZB 1TWHA 3K3PA 1EWCA 2O4XA 4TVAB 1PRTD 5A35A 3NUCA 4OO1G 1H95A 3RB3A 5KFFA 3RZDH 4IR1A 3GTQH 1HNWH 1RL2A 4IUTA 2PW7A 3H3VH 1PTOB 2QCPX 5KYLA 2UUBL 1E22A 4IPGA 2JSOA 2R7KA 5JPNC 5CORA 3GV5B 3I2ZA 3ETJA 1YNJC 1LT5D 2R7NA 4PWQA 3D6WA 4GOPB 3Q0AA 4GKKQ 3RIZA 1WCMH 2L1BA 1XMOH 3PVXA 2R6GA 1S5ED 3KF8B 4DXGA 3SK6A 5EOYA 1F2MA 1I6VC 4LSXA 2I80A 1G51A 3TSSA 2M05A 2Q2UA 2X69A 4Q44A 4OIJA 3GV3A 1SAPA 3A8IE 5CV5A 1I4XA 1S3OA 2TMPA 2ZJQA 5COYA 3MC0B 1HNWQ 2J0TD 4H13C 4BXXH 3N44B 4LFBL 1WTPA 2F0PA 1HFGA 4QJFA 1QUQA 3CD6A 1WOCA 4ZQIA 1L0WA 3RFCA 5JQWA 2CWAA 1YJNA 2K14A 1EYGA 1Y1VA 1XMOQ 1IXRA 3ND8A 1TWHH 1BUVT 4GLVB 2BDNA 1RYSA 4ECTA 2OQKA 4JCVE 1TWAB 2IX3A 1FNVA 2MJ8A 2UVVA 3H0GA 3NTKA 2BE5C 1CS0A 4KKUA 4WRDA 1EFID 3NSWA 3S1QH 2DLNA 2DWCA 3TQTA 2C9OA 3NBHA 3MWMA 2D5DA 1B70B 3KOJA 1ZYRD 3IN5A 1AE2A 2W9BA 2UUCH 2R85A 4H7BA 5KFBA 3M4IA 2R93A 3GIDA 2YRXA 5L1KA 4JI1Q 3ETHA 3J80i 4RNOA 1N56A 1TKWB 4ZI7F 2D0PA 3C3LA 4LH7A 1R4PB 2JA8G 3P75A 4TSSA 3I73A 1HA5A 1WH2A 4BBRB 1HRJA 4A2AA 3BG5A 1XTCD 5C4JH 4O3OA 5D3IB 1Z9FA 4OO1H 1VQ5A 2H1EA 5KFEA 3R8BA 1PH3A 3V96A 2EJGC 1M0TA 1P16A 4NXMQ 3W1BA 2IBKA 2R6FA 4UCUA 1EZ8A 2XWBB 3MWDA 3CCVA 1UE6A 1E4FT 4IN3A 4IUUA 3VPDA 4GC6A 1N34L 3KBGA 3R2TA 5KFRA 1U4RA 2PO4A 3A54A 3EBEA 4CC6A 4QUCA 3TEHB 1AP0A 4HIDA 1VCIA 2WKDA 4HIMA 1VBHA 3NBHB 5C0XJ 2OTJA 3CQZA 3SI8A 4YP3A 4HJAA 1DD2A 5LXTF 3BU2A 1VQEA 4EYIB 2R93B 4KHVA 2JA6A 1YNNC 4JI0Q 1Q3LA 1M8AA 2IL8A 5EGTA 3I7FA 4LUZA 4DAMA 4UCRA 3LNNA 2I5MX 5C5MA 1OXTA 4ECQA 4ME3A 5EAYA 4YCWA 5A2QL 2WACA 5CYUA 2R8IA 4FVMA 2PQAA 2Z6KC 5CV8A 3NEMA 1HQRD 1HZ9A 3CF5A 1IHZA 4HNUA 1EQTA 4O3RA 3NQIA 2ASBA 4A3CG 3KLWA 3KXYT 1Z2NX 5K36G 5M5XB 1IL2A 2NBFA 4O42A 4YR2A 1XWEA 5EKLA 4O1NA 1K1SA 1PH4A 1B04A 1STNA 5IYBH 1QB5D 2JA8H 2L4NA 4R7RA 2MHVA 4R4OA 2RHQB 3WNZA 4GKJQ 1GYFA 4IFDH 3K5MA 1XNQL 4DV2H 2AHOB 2VW9A 3VYSA 4C2MA 5M5YH 4LF9H 3DWQA 3STBD 3QOLA 3CQZB 2RBMA 4YY3H 1UNSA 4JBMA 2JA6H 2E2JB 4RKBA 1CHPD 1GD7A 2F0SA 1Y1WB 5GAEC 5ELOA 3G48A 1IYUA 3G6YA 1BKBA 4O2BF 4X66Q 4IO9A 1Y8PB 4DL5A 2HGSA 1J5EH 3WDNA 5DM73 1FJGL 3CXCA 4F7XA 2B2WC 3BDOA 1LTGD 3KLRA 5GAHC 3PW4A 2UVRA 2L9HA 4JI7H 2QKIC 1RHPA 1I5FA 2UXBH 4MTNA 1II3A 4DV7L 2O5JC 2XNAC 3MFIA 3FEWX 1R9TH 2WP8J 2HD3A 4LK1C 1NMFA 2F0UA 1J6QA 2N88A 4YY3Q 4NXNQ 4BBSG 1EYZA 5LP6F 1NR4A 3J81E 2AGOA 2Z6KA 5EBDA 5C4ZA 5ELFA 5DGBA 1SXTA 2PZWA 1TU2B 1JQYD 2IW3A 3LGJA 1J5EQ 4WJ3M 5FPRA 3CCJA 4UAIA 4C2MH 3RBDA 4KLKA 2OH2A 4RH6A 4Y7NB 1TXYA 4CKCA 4YJ3F 1EUCB 4JI7Q 1N33L 3JRWA 1STAA 2F3IA 5LMNQ 4EQPA 1F9PA 4AYBG 1KC7A 1SFOA 3M9OB 4HJ8A 2E2HA 4HEDA 5K36H 3M7NA 2BA1A 3GTMH 3EYYA 1Z7TA 3L7ZC 2JA7A 1YEZA 1MD2D 2ZTCA 3ULJA 1G6PA 1BBUA 2AGQA 3RUPA 5KFZA 4KI0A 1K9MC 4DV1L 5C44G 4A3JH 1B6SA 2EIFA 3PUWA 2UUBQ 1STEA 5E7NA 4GC7A 3A74A 1I4PA 2YZMA 1E1TA 3DM3A 4BY1G 5IT9E 1F9RA 4A3FG 2OTLA 3Q6SA 1LTSD 4OL7A 1VF7A 4B3SL 1AN7A 3M7GA 3Q8SB 2I5LX 1PYBA 2DZDA 3AMUA 5IYCH 1SMYD 3G71A 3VA7A 3VMMA 1S0OA 4AIMA 4J9LA 4DL4A 4DL7A 1MGSA 4XYMB 2G5DA 4FDBA 3CC2A 1PZKD 3S14B 4JBJA 2BQRA 2WB1A 4U6PA 1H9JA 2B63A 4RMFA 4FP5D 4LFBQ 3VR3A 2B2TC 1FL0A 1HR0W 1K3BC 1E1OA 3K7UC 1G2SA 2NB0A 4EGJA 5KT3A 1B6RA 1BNCA 1VQDA 2E2HB 1CZWA 2NVXA 1KJJA 3C46A 4HR7B 2YTYA 1TAEA 4B9WA 2HDLA 1U4MA 4TKOB 3OUZA 3AU7A 3LP8A 2IX0A 2XSCA 2WAQG 1HNXL 4DV3L 1BBXC 1LT6D 1DIKA 1AEXA 2ZJTA 1WTHA 5DG7A 1ICWA 4XXEA 4JW0A 4ETSA 4DV5L 1PHJA 2WE6A 1H9RA 3QR8A 4TQUS 3S2DH 5HGTA 4XYQA 4DN4M 1ESRA 4A3DH 4I4TF 1VMCA 4RU9A 3LMLA 3D31A 1T5EA 2GVBA 2B8GA 3BZDB 4JBWA 1VQJA 2L0CA 2EYFA 2E5LL 2E2IB 1JDBB 3NTHA 2B63H 4LFAH 5JJIA 5I4DA 2VQDA 4QCLA 2K7VA 4OX9H 5C44H 3MXNB 4KMUC 2FPGB 1IZ6A 4JYAL 1AFPA 2VUMA 1IBKL 3CCQA 2KCTA 1JB7A 2EYPA 1DM0B 4ALPA 5KFDA 2F3WA 4M8AA 2FFKB 3E5SA 2NVYA 3GIMA 1EU3A 3HOXB 1RDPD 4RGOS 3PGZA 4C1NK 4BY1H 2NVXH 3HOVB 1LM0A 4A3BG 4QWEA 1JT8A 3V2TA 1FVIA 2F0KA 3GTPB 4DR7L 2XRQD 3PZPA 2FLLA 1PYWD 3EQLC 1GM5A 3KJOA 1N34Q 4BS9A 2W9CB 2K5NA 1KLGD 4Q0FA 2B2TA 5M3MB 4G7ZC 1UEBA 3PIPA 3A5ZB 1Y14B 4YHHL 3KUPA 5BR8L 5ELBA 2RSNA 4LNQA 3GIPA 3JSNA 3D3RA 4BY7G 1E7ZA 4C5AA 3FRPB 2QYZA 2Y0SG 2QK4A 2I46A 4LF6H 1N36L 4ZYSA 3J80E 2FP4B 4JV5L 4I55F 4LF4H 2EY6A 1WI5A 3K0YA 2N3SA 1B7YB 1EHIA 4MAMA 4BA2I 2DY7A 4EBCA 4GNXC 4DK1A 5GROA 4L5RC 3K58A 1YJ9A 2PPBC 2O2LD 2EYHA 4EYHB 1PH2A 3UDFA 3N41B 3I55A 5C8YF 4HNTA 4CDFC 1CQJB 1K0RA 3RV3A 1D8LA 3X3NA 4UCTA 5KNDA 4G4KA 2NVYB 1S40A 2ZJRA 4B3RL 4LF4Q 4YR3A 3PO2B 4J9SA 1ZXTA 3QJYA 5H1SE 2AMCB 4FO2A 1LTLA 3HRZC 2FMCA 3DUZA 2SDFA 3NQTA 1KRTA 1GSOA 4ECZA 1E0BA 2FPPB 2FLNA 4Q45A 5KRUA 1XNQQ 3DEOA 1JE5A 4BWGB 4DNIA 4A3LG 2CW0C 2UXCL 4QWCA 1QVGA 5LYJF 2BQ3A 1UAPA 4DV7H 2C2RA 3SE0A 1E2WA 3JRXA 4RB1A 3A0JA 2YS7A 5KT7A 5CA1F 3MTSA 1S4ZA 4DR1L 3H3VI 5HBRB 2OWOA 4YIJA 3NXWA 3ULLA 4PZ7A 4MV8A 3GTLH 1K0SA 4HCSA 1HNWL 1PLFA 2Z4IA 4X3UA 4ZLTF 1FJGQ 5C4XG 2V1CC 2DIKA 3KYHC 2FB9A 5E3FA 3OPOA 4OIKA 1RIPA 1E3PA 2K75A 5IE8A 3FKIB 3SHLA 4DV7Q 1YJWA 4DR2H 4A3MB 1EY7A 1L0YB 1SMXA 4MTKA 3A7LA 4GN4B 5KFHA 4AH6A 4L5QA 1WTRA 3ERSX 5EPLA 4BY7H 1YNJD 4GNXA 2VNUD 3K57A 3MFYA 4DFAA 1UE5A 4DAYA 5D1OB 1CT1D 4JC0A 2EDGA 1P8LA 4IAJA 5C3EB 1YITA 4JI8H 4NPSA 2W7OA 4HMJA 2A6HC 2RDFA 2CQYA 5CV9A 4WJWA 1B3QA 2FINB 1N33Q 3VR6A 3DM1A 2CVRA 4PMWA 2PZUA 1SROA 3T56B 2E74C 3J7ZC 2BDOA 2ICEC 3KF6B 4Z9CB 3WWVA 2XIGA 2MP1A 1C7YA 3C2PA 4DLKA 2YZGA 2BH8A 5KG0A 5KG7A 3NHHA 4A3GB 2MCTA 3GTOB 4PV1C 3OHBA 1Q8KA 1Y8OB 5CR3A 1EOVA 1IKLA 1KHIA 2UUCL 4FF1A 3MXUA 4DV4L 3RNUA 3RLNA 4LF7L 5CMDA 4OONA 4DV1Q 3BQ1A 4EX5A 3V4SA 2BE5D 3VR2A 3DEPA 3S1NH 1S5CD 4RGTA 2UUAL 1PVOA 1N32H 2DY8A 2LSSA 1TWFB 2EXZA 1BCPB 2KOLA 4OO1I 2NZ1D 1JJGA 1WYDA 3D4RA 1L1OB 3OSPA 4B3SQ 4J1MA 2PMZA 4P71A 1ENFA 4DF7A 1EWIA 1I50B 5C5LA 3VPBA 4UHVA 1TWGA 1BDOA 2A69D 2F0GA 4ME6A 5JVH3 1VQMA 4X65L 2XD4A 3ORQA 1STHA 2B39A 1A6XA 4DV3H 3E0JA 4IHJF 3TP7A 2QF7A 4PNYA 5I2YA 1K8AC 1TS2A 2VUGA 1I3QH 3H4BA 2KBNA 3K5OA 4DV5H 2C35B 4O2AF 3M3YB 4Q5VA 3BZCA 4J6HA 4K2KA 3I4LA 4GOPC 3S2HB 1VQ4A 3S1MB 1CTMA 1HTLD 2EXDA 3VYUA 1ZEQX 3OUUA 1JWUD 1HR0L 2B8FA 2IA6A 1B53A 4A3KH 4LMYA 1HNXQ 3D0FA 5IT9c 2E5LH 3AEVA 4ME5A 5EJWA 4DV3Q 3E9IA 1STGA 1JJCB 2N78A 3S16H 1ILPA 2W6ZA 3R23A 2XCAA 1STBA 4G3IA 1KNEA 4B08A 4PMBA 4IPDA 4DV5Q 4MV4A 2XC9A 2JEJA 2RSOA 5G3LF 5KFTA 4R8IA 3TRZA 4YBZB 3RB4A 2L12A 4QIWB 3HKZE 3GD7A 3P20A 1TWGH 3TBIB 4KHZA 1YNND 3HOZB 2PNHA 4A2BA 1B9MA 4XQJA 3PIO3 1GUGA 3KLSA 5D1PA 5HY6A 1F77A 4ED7A 5DQIA 2QDLA 4P75A 2A6ED 4QIWE 3FVQA 1VF5C 2K33A 3BYYB 2E5LQ 3HOYH 2R92G 3N42B 5BR8H 3MR5A 4APVA 5HGQA 5J3BA 4JYAQ 4DR3L 1IBKQ 2R3ZA 1BQQT 2E8GA 1H9KA 1LTRD 4DGZA 2CZGA 2C22A 1LTAD 5FKAC 5C3XA 2HVSA 2R7ZA 2KEDA 3S24A 1UNNC 1NNXA 3KBXA 4LWCA 1H9MA 1TQOA 1J8IA 3MFHA 4DR7Q 4CC5A 3TS0A 2W70A 3QFFA 1S97A 3HOWB 1B4OA 4DV2L 1GLVA 3JAMc 4C3HG 3Q2OA 4QY7A 1Q81C 4LF9L 2F1MA 3K80C 3MHBA 4YHHQ 4A3IB 4B3MH 4YR0A 3OHAA 4GOPA 4YY3L 1KAAA 4KD3A 2J6SA 1TIID 5BR8Q 3KF8A 1VQNA 1I6HB 2VA3A 2PQEA 5CGKA 2ID0A 2XGPA 1N36Q 4HNVA 2W8LA 3CC4A 3T1YH 2DNEA 4JV5Q 4FF4A 4B3RH 2UXDH 3L3OC 1H9SB 2ZM6L 5CB4F 5BPHA 4IWXA 5KKNB 3PO3B 5IGFA 1YHAA 3M4PA 1D6EC 2K5DA 2MFIA 5KFAA 3KAJA 3GILA 3T5LA 2BR0A 4MZ9A 4I7HA 3CCMA 3ORRA 2C00A 1EYAA 2UXBL 1M90C 2AQ1B 1JE4A 3SK8A 5J2TF 1ZKOA 3OW7A 4CKEA 4EQNA 4A93B 5CAEB 1G8ZD 2ZXOA 2K04A 4BBRG 1W2BA 2Q2TA 3E5NA 3CRKC 5KFJA 3RBEA 1SEIA 1CFMA 1WTQA 1XPOA 3TP8A 1VQKA 1PDQA 3H20A 1SNMA 3HOUB 3OSNA 2AU0A 1TS4A 1TWAA 2H5XA 3IFTA 2A68C 4B3RQ 3PW5A 3I12A 4JV2A 1YI2A 3C1EA 2HUGA 3FDTA 4QW8A 4B3TH 1HZAA 4LFCH 3QO2A 3K8AA 2PI2A 3JSLA 2B3GA 1SE2A 1N9WA 1WD0A 1SJHD 1Y1VG 1E2ZA 1QG7A 1KTKA 3QG1A 4QL5A 5M3FG 4OWTB 1B8AA 2UXCQ 4F50A 1B1ZA 2R92H 1ET6A 5JVDF 1ILQA 4X62H 4KV6A 3BA8A 4IUPA 5I47A 3H0GG 4DR1Q 1F2YA 1HUNA 1DOLA 2NU7B 2VQFH 4J9QA 1JC7A 3CCLA 1VQCA 3FPPA 4LFCQ 4G7OC 1QZHA 2R93G 1FGBD 4EEYA 3L2PA 1Q1EA 3MXGA 2IHEA 4C3HH 4IRDA 5CV4A 3T13A 3TP6A 1T5XD 4CJ1B 4R4CA 2LXJA 1WCMB 4MV7A 3RGXA 3PN1A 5T1IA 1TWAH 1EY4A 4RB0A 3PUYA 1SBBB 3J7YW 1K3RA 3D4DA 3IL8A 1T9HA 5HURA 2K5QA 1JWMD 1OO9B 4A3EB 2V4QA 4DV4H 4LF7H 2XTIA 5DLGA 2JP1A 3AFPA 1CI3M 5KFPA 2RGRA 4J9PA 2UUAH 2WIIB 5EDWA 1EIFA 3GIIA 5IYBG 5F9LA 1F9QA 3PIOA 1L2FA 2PI2E 2BH2A 1GUTA 4JI4H 4BBRH 1X3EA 5C3WA 3OW2A 2OEOA 1JORA 1EY6A 3JAML 1ESFA 3CCRA 1VQ8A 1FYCA 4IFDG 3N40P 1CA6A 1ASYA 2NTSA 2F0HA 4J9KA 1M7JA 4X65H 2AQ3B 2TSSA 4JK1C 1S5BD 5JJKA 4C3IG 4C3JB 3KDFA 2SCUB 4ECSA 3F2UA 2E2DC 2UUCQ 2FLPA 2JA6G 4DV4Q 4LF7Q 4MV1A 1VQAA 3PQIA 3CC7A 1Y1VH 4QUFA 1C9OA 3BVZA 4PMCA 2F03A 4HSVA 5M3FH 1YIJA 2CCZA 2UUAQ 5L9XA 2ZJPA 4LF5H 3GTKB 5IYDH 3CW2C 4RAYA 4JI4Q 4I7AA 4QB4A 2GA4B 4J9OA 4RWSC 3OHXC 3A7AB 2EQSA 1WTOA 3H0GH 3KJPA 3F1ZA 1HR0H 2R8JA 2G9HD 2OXPA 4X65Q 4CKBA 1PZID 4MN3A 1XJVA 3DLLA 3ND9A 4LFAL 4L63B 5LHY1 4OX9L 1K8OA 4HN7A 3CMAA 2R93H 2C28A 2FHTA 4HAEA 3RAXA 2BCOA 3BJYA 5JAVA 1GSHA 1Y1WA 3F8TA 1M4VA 4RKLA 1TS3A 3I90A 4S3SA 2KCNA 3H4DA 2DNCA 2KVMA 3I8ZA 4P74A 3RV4A 2A5HA 1GUSA 1O7YA 2YZNA 1EZ6A 4ABNA 1HR0Q 1PA6A 2AUKA 4TQRA 3PR5B 3OSOA 5KFSA 1IW7D 2G9DA 3HEJA 2ASLA 3F2DA 3KDFB 1LT3D 2CHBD 5K2MA 4LF6L 4DR3H 5E1FA 2MO0A 3KK7A 2A1AA 3U9OA 3FP9A 2NN6G 4LF4L 4LSAA 3G6VA 5EPJA 1CQFA 1SDFA 4IUNA 5FO8B 3NP8A 1WTXA 3OMCA 1FGUA 4LUVA 3HS0C 1NMGA 2Z8LA 4A3JG 4DUZH 1VQOA 1TS5A 3CQZH 1I4GA 3H15A 5JJLA 2VS1A 3L4KA 4C3IH 1D5ZC 1KL9A 4UP7A 3E3XA 5KFIA 1SYBA 1KD1C 4RCNA 1Y1WH 5CC4A 3EN2A 3D8GA 2R7DA 1PH1A 4DR3Q 2J7ZA 3HZXA 5IYCG 1BJTA 3BQ2A 1RTOA 1XMQH 2ZM6H 1M1KC 2JA8B 1CZGA 4IPHA 2ASJA 4EEQA 3V6KA 5J1ZA 2W7PA 4CDEC 5FLXE 1ENAA 1KDAA 5KT2A 4U68A 4DR4H 4DV2Q 1TWCB 1ML0D 1B33N 1SNCA 4LF9Q 3U9TA 2HT1A 1I6UA 3L9AX 2JA5A 3I56A 2ATWA 4BA1I 2HHHH 2JEGA 2JA7G 5KFWA 4MHEA 3PIP3 3K81C 4HTHA 1XTDA 3J81j 5JVG3 1Q90A 4POFA 2OCEA 3C0FB 2ZM6Q 4OWXB 5IGEA 1ENCA 1SN8A 1X3PA 1K8GA 4FXKC 4F8MA 4Y7NH 3AFQA 4CBVA 3G4SA 2RA4A 1PH7A 3T1HH 2V4DA 2B29A 4DXFA 5H80A 1RD9D 5JUMA 2UXBQ 4DR6H 4QF4A 4DR2L 2QEJC 1DV1A 4ECXA 2IMWP 3N6XA 5C6AA 4A3DG 1EY8A 4HR7A 3TS2A 3MXPA 3M9BA 2NN6H 3K5IA 1S10A 4OXPA 1MIUA 2RDGA 4XT1B 1A8VA 1A3VA 1V43A 2WB1G 2B63G 5EZYF 5I6WA 4JI8L 2ZXPA 1DYQA 1DV2A 1N48A 1X55A 5IGBA 4C1NI 3GQCA 5JH7F 5I9PA 3QWNA 1X65A 4X64L 2JA5B 1JXLA 1EL0A 1XPRA 5EWEA 4HIKA 3K5LA 1AH9A 2IWHA 5M3MG 3GTMB 5KFLA 1ET9A 4HJ7A 1JOKA 4RHSA 4JV1A 3RB6A 1XPUA 2OT2A 2CH4A 3S14H 2F0JA 1YNXA 2E2IA 2H4OA 1NJIC 3GV7B 5DQHA 1RK5A 2UU9L 1LO5D 2Z4HA 5ISRA 5HV6A 3MXNA 2KCCA 4RG1A 3D4WA 1QILA 5TSSA 1N32L 2WDTA 1SFOH 3KALA 4TUYF 3WO1A 2E2HH 3G6XA 3OIQA 2W6PA 5I9OA 4DR5H 3S17H 1RODA 3EVQA 4KK7A 2JA7H 3GTPA 4MV6A 3NWTA 1RKNA 2W9CA 1ZYRC 1BXRA 3R93A 1K83A 2B2YA 5LL6S 3DF7A 4RCOA 5KFVA 3OOCA 3FMCA 4JI3L 4RNNA 2VUMG 4K2LA 2F0MA 3M4OH 2PW5A 1JCKB 4O4HF 3S15H 3PO2G 1EIHA 4ECVA 1SNOA 2I8CA 1BCPF 1K28A 2JK8A 4I7ZC 4MV9A 2FK2A 4BBSB 3MAQA 2K4KA 3TZUA 4TV8F 2FK1A 2HCIA 2KENA 3WOFA 1I7NA 4EBDA 1Z6HA 2E2IH 4XTCS 3RJ0A 3TINA 4UP8A 1B2TA 1VQHA 5KG5A 1T36A 3W1GA 2NWGA 4QW9A 4EGVA 3N43B 1BBWA 2PNRC 4Q8EA 1EQRA 1QNUA 2ZDGA 1JR0D 2EY2A 3N52A 4A4IA 3HOXH 3HOVH 3AQQA 4C56C 3K3VA 1Q12A 1A15A 1HZBA 1NE3A 4R8NA 5FLMG 3BQ0A 3RN5A 5DNFA 4DV6H 2GLTA 1K83B 5M3MH 1EY0A 5JEAJ 1C3OA 3U4ZA 1QOHA 5JOBA 2NVTH 4ODGA 4A3MG 1PRTB 1GXDC 4H0LC 4U7CA 4UDUC 3L4JA 1LV9A 2ZXRA 3A56A 4LFAQ 3F8NA 1XNRL 4GLAC 2N49A 1G291 4V190 4OX9Q 3J81W 1DXMA 2F0OA 2RQXA 3H91A 4J8QA 4IUQA 4KN4C 4LH6A 1X3QA 4IZ8A 3KHRA 1SYFA 4A3FB 1BCPC 2KECA 3AB9A 2XGQA 3UI2A 5D65A 1L1OC 1ASZA 4U673 3TIIA 2ASDA 5DG8A 4GN3B 1EIYB 4B3ML 3GTJA 1CK1A 4X3SA 2J4XA 3FKIA 2VOBA 3EFXD 2VUMH 4IUVA 1SR3A 5A2QE 1S72A 1W96A 3I4NB 4MNOA 3FDSA 5EBCA 1HNZL 2NVYH 1WFQA 3G6EA 4LF6Q 3PO2H 3T1YL 1SE8A 4N9PA 4NW2A 2UXDL 1BR9A 5D1OA 5CBEE 4PZ6A 4WD3A 3STBC 1A3TA 4ULLA 3T53B 4ZKCB 1SYGA 2IX1A 5G3LD 1SLJA 3QIAA 4ED6A 4EQOA 2OQ0A 5IT9W 1GOZA 1C0AA 1EEFD 2F0LA 1BF4A 2K52A 3ONAB 3SE7A 2F0IA 4E6IA 2DJFC 4IR9A 3KF6A 2HVRA 2RF4A 1WTVA 5DLQE 2WAQE 3LWUA 4EBEA 2K5WA 4DV0L 2ZT9C 1Y8NB 3MWYW 3GTOA 1HH2P 4B3TL 5FLMH 2R7FA 5CV6A 1OXXK 4LFCL 2P0AA 4O4IF 4F87A 4NLGA 3FKIH 4XYOA 2YCHA 2C2DA 2VB2X 4A3MH 3GTJB 1QNKA 4RA8A 5F2DA 1TWFA 3GO5A 4ED1A 1DGSA 1U4PA 1NUCA 4X62L 1L1OA 4CJ2C 1I7LA 4H44C 5DAUA 3I70A 3LWBA 1JIHA 1JKJB 4HCEA 1SYXB 1I50A 4NP5A 2VQFL 3UDGA 4K5VA 3GIJA 3PUXA 1EY9A 4A3KG 4A3BB 1DOKA 3GTLB 2EJFC 5EPKA 1K73C 4DUYL 4O3NA 5CA0F 3VYRA 4JG2A 1PTOF 2L11A 4P2CB 3BS1A 2MUYA 4K6LA 1EZ1A 3JAMW 5L1LA 3QOJA 4O3SA 2D0OA 2I0QA 2ZTDA 1V51A 4X64H 4DR2Q 1HPCA 3HOZG 2X6LA 1ZETA 3PCOB 2CQAA 1OXVA 3G8CA 4ZAIA 4BY7B 3RAQA 4NMZA 5FLXc 2Y0SB 3RUZA 3BDLA 4A3GH 5M5WB 5D14A 5KNBA 4WBNF 1JX4A 3SGIA 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 1IYVA 3X3MA 4JI8Q 2IP4A 3HKZA 2Y0SE 2UU9H 3J81c 1PFSA 4J9RA 2KHSA 3HG9A 1TWFH 3UE0A 4YAKB 2CH4W 1IL8A 1MI2A 1VQ6A 1AUXA 1KABA 1SMYC 4X64Q 3H09A 1I94L 4QIWA 3R3OA 3GTGB 4JI4L 1L0XB 1UEAB 1E4GT 5LMUL 3HOWG 4FU0A 5DLFA 3MFGA 1EYDA 1Q46A 1XDNA 1ICFB 2OF1A 3H94A 1PX2A 2VZAA 2HJWA 2R8KA 4K0KH 1UE7A 2V4RA 1IBLH 1QZGA 1CM9A 3GIKA 2L15A 3K7AH 3NPPA 1W3SA 3I3CA 4JI3H 1GUNA 1A0IA 4JUZA 1YHBA 2UU9Q 2YU9B 1PTOC 2CW7A 2JYOA 3M3YH 3EPIA 3J80W 4KN7C 2KSWA 3S2HH 4ILWA 1KEEA 2F0VA 1N32Q 5C5JA 2D2CC 2EYMA 4LF5L 1SSOA 2NVQB 5KG4A 2RDHA 1I4RA 5D8DA 2XCLA 1LLRD 3I4MG 3Q8PB 3U50C 4NKLA 3RLOA 3Q8RB 1SEBD 4MA0A 2JJQA 4K8JA 5J22A 3V6HA 5D3DA 3PUZA 4JI3Q 2NU6B 2ZTEA 3HKZB 1I4HA 3HOUG 2R7ZG 5C4XB 4RUCA 3R5XA 3H3VC 1R4QB 4KTAA 4P73A 1I3QB 3M4YA 3C1FA 4QMGA 2L55A 5IYZF 3AYHB 3CCSA 1H9SA 3HOZH 3A8JE 3HKSA 2W57A 3PF4A 2PCFB 4HJ5A 3OIPA 2DJGC 3GQBA 4YAJB 3SR1A 4JOIA 3KHHA 1JB3A 3IFDA 1SNDA 2D62A 4RZRA 1XNRH 1EQVA 5KGUA 4JPBW 4RAZA 4UFZA 1CKOA 2E75C 1TY2A 5KNCA 4EGQA 1EY5A 4IFDI 3J7AV 2YTXA 5LA6F 4ZCKA 2K50A 1CQIB 4JI6H 3PR4A 4YQWA 1AN8A 1RJRA 2IHFA 2VQEL 4K5WA 3HOWH 3G7LA 1GJXA 4DL6A 4PDBA 4DUZL 4FF3A 4G7HC 4FS1A 4IOCA 4IURA 4A3IH 4FF2A 4XZ3B 5EWGA 1RTNA 2QILA 4TV9F 4KHPH 4RFBA 2JXMB 1I6HH 1XNRQ 1AUVA 4AQYH 1VDZA 2IPKD 3BVMA 4XDXA 3QZ7A 1BO0A 3KTMA 1HNZH 1E4EB 1AZPA 1VMPA 2GN5A 1CHQD 2FMAA 2O5IC 2P5ZX 3PO3H 4PG3A 2HIVA 4A3EG 2MQHA 1XMQL 3J7AF 2YL2A 4ZOLF 2Z1CA 3KHGA 1WSCA 2F4VH 1EEID 4DU9A 1O78A 1ZHSA 1LABA 4ZRZA 4ID6A 3RTXA 1LTID 3J81L 2HQLA 2RGVA 4IZOA 4DR4L 4F4WA 2NU8B 3I4MH 3RZOB 2F0FA 1VS0A 3BVGA 4ECUA 2YV5A 4ED8A 1VQ9A 4A93H 4B3MQ 2XVSA 2HHHL 1GUWA 1WCMA 3HOUH 2R7ZH 3MEFA 3MR2A 5EKIA 1HNZQ 5DGAA 2DPIA 1SE4A 5KT5A 4JBKA 3NENA 5FOBB 1GUOA 4A75A 3T1YQ 2UXDQ 4DV0H 1GVPA 1CKMA 1U4LA 1PTOH 1C4QA 4ED2A 1TA8A 3HXLA 1RK6A 5KFCA 1IOVA 5BMVF 3S1RB 4EG0A 1LTBD 4ED3A 3T1HL 1EIGA 1LYLA 2QW7A 3J80c 5KG2A 4IALA 3RN2A 4DR6L 1OWTA 4MTDA 5IYDG 3J7AK 3S9WA 5IGGA 4R1JA 4QGUA 1KIXA 1O7LA 3EJIA 2AKWB 3K5HA 4K14A 1F2LA 1PXUA 4N8X1 1YBYA 5IT9L 1Y69U 4DV0Q 3CRLC 4O3PA 3V4ZA 3RZDB 1MKHA 1AW7A 4YCUA 1A2UA 4B3TQ 3GTQB 4DUYH 3IKJA 3UDXA 1FNWA 3RB0A 1S9FA 3JAMi 3DXJC 2VL6A 4MIUA 1B9NA 3K5NA 5KFYA 3OWEB 4RAUC 4C5CA 1EWHA 1CQVA 4QQBX 1PV4A 3GTKA 3T4AC 2R92B 3DWAA 4X62Q 3MR3A 1SYCA 5ELCA 2XGTA 2YYAA 1S0NA 3MR6A 4M9UA 4LF8L 2VQFQ 1DOMA 1NAPA 3F2BA 4K5XA 4A3EH 3QZ8A 1JMCA 3GP7A 5FD6A 1RCVD 3G6JB 2N55A 1OXUA 1U5KA 3FMAA 5T14A 2RKSA 3O13A 4DUYQ 1QJOA 3DMUA 3EROA 5KFXA 4JVZA 4B9XA 4KY6A 4JI1H 5KG3A 2JQOA 5CV7A 4YB8B 4C3HB 3E6ZX 3LX0A 2BOSA 2ALZA 2MPMA 2A8VA 3PV0A 4DR5L 5KFUA 2KCMA 1Q8IA 3T5JA 1I94H 2PN1A 4DAVA 3CCUA 5LMUH 1FKAH 1TWHB 3SK4A 3L0OA 1DJRD 4YWMA 2R87A 2B2UC 1A3UA 1QVCA 2AUJD 3T5KA 3W2DA 3NELA 3BDCA 3I4OA 4ECRA 2EVBA 2KJXA 4C3JH 4Q0YA 1PFMA 4WJ4A 4ECYA 4NXMH 3S1QB 2K5VA 2W71A 1GSAA 1Y1WG 2CFMA 5IGDA 3Q8QB 1RJQA 3H40A 1TVXA 4KKSA 3HB9A 3OYYA 2A69C 3A55A 3GTKH 4J9MA 5FO9B 4IFDJ 2Z6BA 4ED0A 4JI5L 3UE1A 1I94Q 4J15A 5LMUQ 1PZJD 3P1HA 4NDXA 2KHJA 1IKMA 1LUZA 1S5FD 4IRCA 4OHJA 5C4JB 2XCPA 4L6TB 2K32A 1GKHA 3WOEA 4IRKA 2JEIA 1O7IA 1VQPA 4DL3A 1HCZA 2ATLA 1PH5A 1QUQB 2VXWA 5C0XG 2PBZA 3M9NB 2R8HA 4JI0H 2IY5B 3BAAA 1W6JA 2HCCA 1Y1VB 1IBML 5M3FB 1YZ6A 3KFUA 1X3GA 2FJ2A 5LOVF 2ICIA 4LF5Q 1PMRA 4ZKBB 4HSPA 5BN5A 4DV6L 2NU9B 2A74C 4R9WA 5J39A 4NB3A 1JDEA 4XYLB 4RB3C 2WINB 3H0GB 3J80L 2W6QA 1TWCA 3TIGA 5FJ8G 4JV0A 1Z2PX 2RCNA 2WFWA 2MO1A 3TZDA 1TT2A 2W9BB 2CWPA 4MTEA 1MJCA 1VQIA 5M5XH 1B3AA 3EIVA 1OTCA 1JJ2A 1U0LA 4HIOA 1U9RA 2XN9C 2DUDA 4ZUIA 4E4TA 2B2UA 5C1OA 2R82A 3R2IA 2MGSA 4LAAA 4CGYB 1MJEA 3TN2A 2A6EC 1WD1A 1V1OA 4GKJH 1O75A 2VQEH 1AZQA 4MA5A 1ULZA 2JA5G 1BCPD 1MSGA 5FK9C 5JJZA 1WTWA 1VBGA 2YS6A 1PRTF 1SE3A 3HP3A 1KXLA 2E2JH 1V1QA 1R9TA 2IT1A 3CPWA 4KY7A 1J9OA 1XXGA 4XT3B 1RJPA 3FHWA 2LY7A 4EQ5A 1RYRA 4X66H 5KIXA 3RF2A 1VQFA 2F3VA 2VB3X 3GV6A 4I65A 2NUCA 5BN3A 2CQOA 2VQEQ 2K05A 1TWCH 4LJZC 4DUZQ 4XX0B 2UVWA 4DK6C 3TREA 4LW1A 3M9MB 3VYTA 5M5YB 4IOAA 2R84A 3BABA 4NXNH 2I5HA 1F9SA 2E76C 1BNZA 4XIGS 2LFNA 4YCVA 4C3IB 3BA9A 3VDYA 1RJTA 2MNAA 3VPCA 2V58A 4IJLA 2JA6B 2CW0D 2EZVA 5C0XH 5IODA 3GTMA 4QWBA 1XMQQ 2RDIA 1QCBD 2M9VA 2LXKA 2F0TA 1PFNA 1Q7YC 2PQAB 5ELDA 3I91A 2K1BA 1VKZA 4R4IA 2B2YC 2R7MA 1QWYA 4DR4Q 1KJ8A 5LMNH 4XQNA 1TY0A 5FJ8H 4N8FA 5BPFA 3EA6A 4UCOA 1GGOA 4IQZA 1PRTC 3D6CA 3U58A 1JOOA 1R9TB 4OWWB 2W6MA 1KLUD 1KDCA 1MSHA 2HHHQ 4K6DA 3QB3A 4DL2A 3K6OA 3GV8B 2CW8A 1IOWA 4M1UB 4IPCA 1CSPA 3OMGA 1E2VA 1GHJA 1NBWA 2F4IA 1HFNA 4CJ0B 2UUBH 3ZJYC 4C2MB 4EFBA 1D1IA 3HOXG 1EUJA 3CP0A 4DNRB 3T1HQ 2JA5H 3HOVG 3PW7A 2F0DA 1AE3A 2B2VC 4RHRA 4A3CH 4DR6Q 4UCVA 2DN8A 4FBTA 1O7ZA 2A6HD 3UQ8A 4FNFA
chains in the Genus database with same CATH topology
2FXQA 3PSIA 5C4JH 1Z9FA 2E5LQ 2K52A 1VQ5A 3HOYH 4GS3A 1PH3A 2R92G 4APVA 3KF6A 5HGQA 5J3BA 1P16A 2RF4A 4NXMQ 3W1BA 5DLQE 2WAQE 4DR3L 1KQSA 1IBKQ 2E8GA 4JYAQ 2AWOA 4DV0L 3BZKA 3S24A 1UE6A 1HH2P 3W5OA 5FLMH 2R7FA 3CCVA 1OXXK 4LWCA 4LFCL 3CMEA 4B3TL 4UP9A 4DR7Q 4O2DA 3TS0A 1N34L 3FKIH 4DV2L 1A63A 4A3MH 3JAMc 3OTOL 2ALYB 4QY7A 1Q81C 4LF9L 3GO5A 1DGSA 3K80C 4YHHQ 3EBEA 4X62L 4GOPA 1L1OA 3TEHB 4YY3L 4HIDA 5BR8Q 1VCIA 4HIMA 4K0KL 3NBHB 5C0XJ 4LF8Q 4DKAC 1IBLL 1VQNA 2OTJA 4YWKA 2VQFL 3UDGA 4X6AH 3PUXA 4HJAA 4A3KG 2ID0A 1N36Q 3CPFA 3I4NG 3CC4A 3BU2A 1VQEA 4JV5Q 2ZM6L 4JI0Q 1K73C 4DUYL 3I7FA 1YHAA 3M4PA 4LUZA 3ICEA 4JG2A 2MFIA 4DAMA 2I5MX 1OXTA 4MZ9A 4ME3A 5EAYA 4YCWA 4BBSH 2KHIA 2PQAA 2Z6KC 2D0OA 1X6OA 2ZTDA 4PZ8A 3NEMA 3CCMA 4DR5Q 4DR2Q 1HZ9A 3CF5A 1M90C 3HOZG 2UXBL 3PCOB 1OXVA 1VQBA 2Z0SA 2ASBA 4BBRG 1W2BA 2Q2TA 5FLXc 3KLWA 4A3CG 1Z47A 1XPOA 1VQKA 1NY4A 4A3GH 5K36G 1IL2A 3SGIA 2H5XA 1X54A 4POGA 4B3RQ 4DK3C 2CKZB 3HOYG 1PH8A 3CAMA 1PH4A 2F52A 4JI8Q 1YI2A 5IYBH 2Y0SE 1X56A 4DPGA 1HZAA 3J81c 1PFSA 3K8AA 5ELNA 2PI2A 2JA8H 1TWFH 2B3GA 3UE0A 1N9WA 2RHQB 4R4OA 1VQ6A 3GTPH 4GKJQ 1Y1VG 4QL5A 4X64Q 5M3FG 4JI5Q 1XNQL 1K83H 1I94L 2AHOB 1B8AA 4OWTB 2VW9A 5M5YH 4JI4L 2UXCQ 5LMUL 3STBD 3HOWG 2R92H 4O0AA 1Q46A 3FKIG 2AWNA 4YWLA 1EQQA 2YYZA 1VQGA 2A19A 4JBMA 4AYBE 5JEAG 1V9PA 3H0GG 2VZAA 4DR1Q 2JA6H 1UE7A 1QZGA 1GD7A 2L15A 5GAEC 3K7AH 1Q1BA 3G48A 5ELOA 1W3SA 3CCLA 1VQCA 1A0IA 1BKBA 1YHBA 2UU9Q 4X66Q 4IO9A 4LFCQ 4A3FH 5C3EG 1QZHA 1IBMQ 3M3YH 1FJGL 3CXCA 2R93G 2WB1E 3L2PA 4JI6L 3S2HH 5IWAL 1Q1EA 5GAHC 2IHEA 4C3HH 4JI2L 1N32Q 4LF5L 1X3FA 3JC66 4DV6Q 1I5FA 4R4CA 2LXJA 4MTNA 5GQOA 5AJ3L 4DV7L 1R9TH 2WP8J 1A62A 1NMFA 4YY3Q 1J6QA 2NZHA 4NXNQ 1UE1A 4BBSG 3I4MG 1TWAH 3U50C 4KHPL 3RLOA 3PUYA 3RLFA 2Z6KA 2JJQA 5GADC 3I4NH 1K3RA 4R4TA 4AQYL 1SRUA 1T9HA 3PUZA 4JI3Q 2ZTEA 3HOUG 2R7ZG 4UY8C 1D7QA 4A3GG 4P73A 2JEBI 3LGJA 2XTIA 5LMNW 1J5EQ 2F4VL 4WJ3M 3CCJA 3AFPA 4C2MH 4KLKA 3AYHB 3CCSA 4Y52H 1TXYA 3HOZH 1EIFA 5IYBG 4JI7Q 1N33L 3PIOA 2F3IA 1KRSA 3HKSA 1L2FA 2PI2E 5IP9G 5LMNQ 1GO3E 2BH2A 3PF4A 4AYBG 4BBRH 1X3EA 4HJ5A 3OW2A 4HJ8A 3CCRA 4JOIA 1VQ8A 3M7NA 2BA1A 4IFDG 3GTMH 1ASYA 3L7ZC 1YEZA 3PUVA 2D62A 2ZTCA 5JJKA 2NZOA 3ULJA 3M85A 1G6PA 1BBUA 3KDFA 1CKOA 4H02A 4KI0A 2UUCQ 4DV4Q 4LF7Q 2JA6G 1VQAA 1K9MC 4DV1L 5C44G 4A3JH 4IFDI 2YTXA 2JE6I 3CC7A 1Y1VH 1C9OA 2EIFA 1CKNA 2K50A 3PUWA 5M3FH 1YIJA 5E7NA 2CCZA 2UUAQ 2UUBQ 3A74A 2IHFA 2VQEL 2ZJPA 1E1TA 3DM3A 4BY1G 3HOWH 4A3FG 4DUZL 5IYDH 3CW2C 3GTJH 2OTLA 4JI4Q 4HJ9A 4IOCA 4B3SL 4GKKL 2EQSA 3E0EA 4A3IH 3H0GH 3KJPA 3F1ZA 2I5LX 1PYBA 4X65Q 5IYCH 3G71A 1XJVA 3DLLA 1I6HH 4AIMA 4LFAL 1XNRQ 3TQYA 4A3BH 4OX9L 4FDBA 3CMAA 5C3EH 2GN5A 3CC2A 2R93H 2QEXA 4JBJA 3HKZG 3PO3H 4PG3A 2HIVA 3F8TA 2MQHA 4A3EG 4RMFA 1XMQL 4LFBQ 5IY0A 3ER0A 4GN5A 1FL0A 1HR0W 1E1OA 3K7UC 4A76A 2HQLA 4P74A 1WJJA 1VQDA 4DR4L 1XMOL 3I4MH 1VS0A 4P72A 2YV5A 1VQ9A 4A93H 2YTYA 4B3MQ 1HR0Q 1PA6A 1PYSB 2HHHL 2JA9A 2DGYA 2IX0A 5M5WH 2WAQG 3KDFB 3F2DA 3PF5A 1HNXL 2JEAI 2R7ZH 4DV3L 3MEFA 3HOUH 1HNZQ 3GTOH 1QVFA 4JBKA 4LF6L 3NENA 3T1YQ 4UPAA 4A75A 1CUKA 2MO0A 1CKNB 2UXDQ 1GVPA 2A1AA 3FP9A 1CKMA 2NN6G 4DV5L 1PHJA 4LF4L 2Q2IA 1VQ7A 4TQUS 1PH9A 3S2DH 4L5TA 1FGUA 4LUVA 5IP9H 4JI1L 4L5SA 1NMGA 4JOIC 4A3JG 1YHQA 3T1HL 3GTGH 1LYLA 4A3DH 3J80c 3D31A 3RN2A 1VQOA 2GVBA 4DR6L 1I50H 3CQZH 4JBWA 5JJLA 5IYDG 3H15A 1VQJA 2VS1A 4C3IH 1KL9A 4UP7A 2E5LL 4R1JA 4QGUA 4A3IG 1KD1C 1KIXA 1Y1WH 2B63H 5JJIA 3CCEA 3EN2A 3IRBA 2R7DA 4GLXA 2AKWB 1CSQA 2VY3A 3MXNB 5C44H 1PH1A 4NXML 1IZ6A 1YBYA 2QA4A 4DR3Q 4JYAL 5IYCG 4DV0Q 3CCQA 2KCTA 1JB7A 1IBKL 2YU9H 4ALPA 1MKHA 4YCUA 4B3TQ 1M1KC 4A3BG 3PGZA 4BY1H 2NVXH 1LM0A 4R4QA 4A3LH 1JT8A 3UDXA 1FVIA 4IPHA 3JAMi 3PO3G 4DR7L 2VL6A 2NVQH 3J7A5 1GM5A 3KJOA 1N34Q 3S1MH 2K5NA 4DV2Q 4LUOA 1OXSC 3OTOQ 4GNXB 4LF9Q 5IP7G 2HT1A 1PV4A 2Q2HA 1UEBA 4DAYB 3A5ZB 3PIPA 1Y14B 4YHHL 4X62Q 3I56A 4BA1I 2ATWA 2JA7G 1KAWA 2XGTA 5BR8L 4K0KQ 4A93G 3K81C 1IBLQ 1XTDA 4LF8L 2VQFQ 4LNQA 2GVAA 3J81j 1E7ZA 3F2BA 4A3EH 4BY7G 2Y0SG 5C4XH 1JMCA 1N36L 1NTGA 4POFA 2OCEA 3K0XA 1OXUA 1U5KA 2ZM6Q 4OWXB 4JV5L 4JI0L 3A5UA 1VQLA 4DUYQ 1WI5A 1SN8A 3HFZB 2N3SA 1PH6A 1K8GA 1B7YB 4Y7NH 4BA2I 2JQOA 3AFQA 3RR5A 3G4SA 4GNXC 1PH7A 5GROA 3U4VA 4L5RC 2B29A 1YJ9A 1YVCA 2A8VA 3B6YA 3PV0A 4DR5L 1Q82C 2KCMA 2UXBQ 4DR2L 1PH2A 3CCUA 3L0OA 3UDFA 4YWMA 3I55A 4A3DG 1QVCA 1BVSA 3NELA 3M4QA 1K0RA 3I4OA 1KC8C 3TS2A 4C3JH 1D8LA 2YTVA 1Q86C 3M9BA 4WJ4A 1S40A 4OXPA 1MIUA 2K5VA 2ZJRA 4B3RL 3J81i 1A8VA 1V43A 2WB1G 1Y1WG 4LF4Q 2B63G 2CFMA 4JI8L 5H1SE 2AMCB 1LTLA 1X55A 1UWVA 3OYYA 1KRTA 3GTKH 4GKJL 4IFDJ 2I0QA 1XNQQ 1X65A 1JE5A 4DNIA 4JI5L 3UE1A 4X64L 1I94Q 1N8RC 4A3LG 2UXCL 1XPRA 4J15A 5LMUQ 1QVGA 2KHJA 2N8NA 1LUZA 2K5HA 4HIKA 3A0JA 1AH9A 2PMZE 1WCMG 5M3MG 1X9NA 4HJ7A 3E9HA 4DR1L 1GKHA 3H3VI 1XPUA 2OWOA 1O7IA 1VQPA 3S14H 1E24A 1YNXA 3ULLA 4PZ7A 1NJIC 3GTLH 1PH5A 1QUQB 5C0XG 1HNWL 2UU9L 2IY5B 4X66L 4IJHA 4RG1A 1FJGQ 5C4XG 1IBML 4JI6Q 2V1CC 1YZ6A 3KFUA 5IWAQ 4BXXG 3KYHC 4JI2Q 1X3GA 1N32L 1SFOH 4LF5Q 2E2HH 5IP7H 1RIPA 1E3PA 2K75A 5IE8A 3RZOH 2QGQA 3Q8DA 3F2CA 3S17H 4DV6L 4DV7Q 5AJ3Q 1YJWA 2JA7H 5C0XI 4NB3A 1SMXA 3GDEA 4NXNL 4GN4B 2HIXA 2RHSB 4L5QA 4AH6A 3ERSX 5FJ8G 4BY7H 1IYJB 2ES2A 4GNXA 4KHPQ 2VNUD 2RCNA 2WFWA 2MO1A 1UE5A 2CWPA 4AQYQ 1MJCA 1VQIA 5M5XH 3EIVA 1HJPA 3BJUA 1OTCA 4JI3L 4JC0A 1JJ2A 1U0LA 2VUMG 1P8LA 4HIOA 5GAGC 2DUDA 1YITA 4QQBX 3M4OH 3UDIA 2F4VQ 1J5EL 3S15H 4NPSA 3PO2G 1MJEA 1HZCA 3S1RH 1N33Q 2JK8A 4JI7L 5LMNL 4PMWA 2JA5G 1SROA 2K4KA 3J7ZC 1EFWA 2BA0A 2KENA 2NN6I 3KF6B 3WWVA 2E2IH 4XTCS 1KXLA 1C7YA 2E2JH 1V1QA 4UP8A 3ULPA 2BH8A 1VQHA 2IT1A 3CPWA 4TVAB 3W1GA 4OO1G 1Q8KA 1H95A 1BBWA 3FHWA 1EOVA 2UUCL 1KHIA 1EQRA 4EQ5A 4DV4L 3RNUA 3RLNA 3RZDH 4LF7L 4OONA 4A4IA 3HOXH 1RL2A 4EX5A 4DV1Q 3GTQH 3HOVH 3AQQA 3H3VH 1VQFA 3S1NH 2UUBL 2UUAL 1Q12A 1E22A 4IPGA 1PVOA 2LSSA 2CQOA 1HZBA 1NE3A 2VQEQ 3I2ZA 5FLMG 4OO1I 1TWCH 4DUZQ 1JJGA 1WYDA 3RN5A 4GOPB 1L1OB 4B3SQ 4DK6C 4GKKQ 1WCMH 3TREA 4LW1A 5M3MH 4P71A 2R6GA 5JEAJ 4IOAA 1EWIA 3KF8B 2I5HA 3U4ZA 2NVTH 4XIGS 4YCVA 4A3MG 1VQMA 3VDYA 4X65L 2MNAA 1G51A 4IJLA 4LFAQ 2Q2UA 1XNRL 4GLAC 2N49A 1G291 4OX9Q 1S3OA 2ZJQA 1K8AC 1HNWQ 1XMQQ 4BXXH 1I3QH 2KBNA 2LXKA 4LFBL 2C35B 1Q7YC 2PQAB 4QJFA 1QUQA 3BZCA 3CD6A 1WOCA 1L1OC 4GOPC 1L0WA 1ASZA 2CWAA 4R4IA 1YJNA 2K14A 1EYGA 1VQ4A 4DR4Q 1XMOQ 1IXRA 5FJ8H 2EXDA 1TWHH 4GLVB 4GN3B 3U58A 1EIYB 4B3ML 1HR0L 4OWWB 2OQKA 4JCVE 4A3KH 2HHHQ 1HNXQ 3D0FA 1SR3A 5IT9c 2VUMH 1S72A 3AEVA 4DV3Q 3S16H 3E9IA 4MNOA 1JJCB 2N78A 1HNZL 2NVYH 3S1QH 1WFQA 3G6EA 4LF6Q 4IPCA 1CSPA 1B70B 3KOJA 3T1YL 3PO2H 1AE2A 1SE8A 2UXDL 1NBWA 4IPDA 4DV5Q 4PZ6A 3STBC 3TRZA 3ZJYC 3HKZE 4JI1Q 3GD7A 3J80i 3HOXG 1EUJA 1TWGH 2D0PA 1SLJA 3CP0A 4KHZA 3T1HQ 2JA5H 2IX1A 1AE3A 2PNHA 2JA8G 3HOVG 4A3CH 4DR6Q 2OQ0A 5HY6A 1C0AA 4QIWE 4P75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FXQ A;  3PSI A;  5C4J H;  1Z9F A;  2E5L Q;  2K52 A;  1VQ5 A;  3HOY H;  4GS3 A;  1PH3 A;  2R92 G;  4APV A;  3KF6 A;  5HGQ A;  5J3B A;  1P16 A;  2RF4 A;  4NXM Q;  3W1B A;  5DLQ E;  2WAQ E;  4DR3 L;  1KQS A;  1IBK Q;  2E8G A;  4JYA Q;  2AWO A;  4DV0 L;  3BZK A;  3S24 A;  1UE6 A;  1HH2 P;  3W5O A;  5FLM H;  2R7F A;  3CCV A;  1OXX K;  4LWC A;  4LFC L;  3CME A;  4B3T L;  4UP9 A;  4DR7 Q;  4O2D A;  3TS0 A;  1N34 L;  3FKI H;  4DV2 L;  1A63 A;  4A3M H;  3JAM c;  3OTO L;  2ALY B;  4QY7 A;  1Q81 C;  4LF9 L;  3GO5 A;  1DGS A;  3K80 C;  4YHH Q;  3EBE A;  4X62 L;  4GOP A;  1L1O A;  3TEH B;  4YY3 L;  4HID A;  5BR8 Q;  1VCI A;  4HIM A;  4K0K L;  3NBH B;  5C0X J;  4LF8 Q;  4DKA C;  1IBL L;  1VQN A;  2OTJ A;  4YWK A;  2VQF L;  3UDG A;  4X6A H;  3PUX A;  4HJA A;  4A3K G;  2ID0 A;  1N36 Q;  3CPF A;  3I4N G;  3CC4 A;  3BU2 A;  1VQE A;  4JV5 Q;  2ZM6 L;  4JI0 Q;  1K73 C;  4DUY L;  3I7F A;  1YHA A;  3M4P A;  4LUZ A;  3ICE A;  4JG2 A;  2MFI A;  4DAM A;  2I5M X;  1OXT A;  4MZ9 A;  4ME3 A;  5EAY A;  4YCW A;  4BBS H;  2KHI A;  2PQA A;  2Z6K C;  2D0O A;  1X6O A;  2ZTD A;  4PZ8 A;  3NEM A;  3CCM A;  4DR5 Q;  4DR2 Q;  1HZ9 A;  3CF5 A;  1M90 C;  3HOZ G;  2UXB L;  3PCO B;  1OXV A;  1VQB A;  2Z0S A;  2ASB A;  4BBR G;  1W2B A;  2Q2T A;  5FLX c;  3KLW A;  4A3C G;  1Z47 A;  1XPO A;  1VQK A;  1NY4 A;  4A3G H;  5K36 G;  1IL2 A;  3SGI A;  2H5X A;  1X54 A;  4POG A;  4B3R Q;  4DK3 C;  2CKZ B;  3HOY G;  1PH8 A;  3CAM A;  1PH4 A;  2F52 A;  4JI8 Q;  1YI2 A;  5IYB H;  2Y0S E;  1X56 A;  4DPG A;  1HZA A;  3J81 c;  1PFS A;  3K8A A;  5ELN A;  2PI2 A;  2JA8 H;  1TWF H;  2B3G A;  3UE0 A;  1N9W A;  2RHQ B;  4R4O A;  1VQ6 A;  3GTP H;  4GKJ Q;  1Y1V G;  4QL5 A;  4X64 Q;  5M3F G;  4JI5 Q;  1XNQ L;  1K83 H;  1I94 L;  2AHO B;  1B8A A;  4OWT B;  2VW9 A;  5M5Y H;  4JI4 L;  2UXC Q;  5LMU L;  3STB D;  3HOW G;  2R92 H;  4O0A A;  1Q46 A;  3FKI G;  2AWN A;  4YWL A;  1EQQ A;  2YYZ A;  1VQG A;  2A19 A;  4JBM A;  4AYB E;  5JEA G;  1V9P A;  3H0G G;  2VZA A;  4DR1 Q;  2JA6 H;  1UE7 A;  1QZG A;  1GD7 A;  2L15 A;  5GAE C;  3K7A H;  1Q1B A;  3G48 A;  5ELO A;  1W3S A;  3CCL A;  1VQC A;  1A0I A;  1BKB A;  1YHB A;  2UU9 Q;  4X66 Q;  4IO9 A;  4LFC Q;  4A3F H;  5C3E G;  1QZH A;  1IBM Q;  3M3Y H;  1FJG L;  3CXC A;  2R93 G;  2WB1 E;  3L2P A;  4JI6 L;  3S2H H;  5IWA L;  1Q1E A;  5GAH C;  2IHE A;  4C3H H;  4JI2 L;  1N32 Q;  4LF5 L;  1X3F A;  3JC6 6;  4DV6 Q;  1I5F A;  4R4C A;  2LXJ A;  4MTN A;  5GQO A;  5AJ3 L;  4DV7 L;  1R9T H;  2WP8 J;  1A62 A;  1NMF A;  4YY3 Q;  1J6Q A;  2NZH A;  4NXN Q;  1UE1 A;  4BBS G;  3I4M G;  1TWA H;  3U50 C;  4KHP L;  3RLO A;  3PUY A;  3RLF A;  2Z6K A;  2JJQ A;  5GAD C;  3I4N H;  1K3R A;  4R4T A;  4AQY L;  1SRU A;  1T9H A;  3PUZ A;  4JI3 Q;  2ZTE A;  3HOU G;  2R7Z G;  4UY8 C;  1D7Q A;  4A3G G;  4P73 A;  2JEB I;  3LGJ A;  2XTI A;  5LMN W;  1J5E Q;  2F4V L;  4WJ3 M;  3CCJ A;  3AFP A;  4C2M H;  4KLK A;  3AYH B;  3CCS A;  4Y52 H;  1TXY A;  3HOZ H;  1EIF A;  5IYB G;  4JI7 Q;  1N33 L;  3PIO A;  2F3I A;  1KRS A;  3HKS A;  1L2F A;  2PI2 E;  5IP9 G;  5LMN Q;  1GO3 E;  2BH2 A;  3PF4 A;  4AYB G;  4BBR H;  1X3E A;  4HJ5 A;  3OW2 A;  4HJ8 A;  3CCR A;  4JOI A;  1VQ8 A;  3M7N A;  2BA1 A;  4IFD G;  3GTM H;  1ASY A;  3L7Z C;  1YEZ A;  3PUV A;  2D62 A;  2ZTC A;  5JJK A;  2NZO A;  3ULJ A;  3M85 A;  1G6P A;  1BBU A;  3KDF A;  1CKO A;  4H02 A;  4KI0 A;  2UUC Q;  4DV4 Q;  4LF7 Q;  2JA6 G;  1VQA A;  1K9M C;  4DV1 L;  5C44 G;  4A3J H;  4IFD I;  2YTX A;  2JE6 I;  3CC7 A;  1Y1V H;  1C9O A;  2EIF A;  1CKN A;  2K50 A;  3PUW A;  5M3F H;  1YIJ A;  5E7N A;  2CCZ A;  2UUA Q;  2UUB Q;  3A74 A;  2IHF A;  2VQE L;  2ZJP A;  1E1T A;  3DM3 A;  4BY1 G;  3HOW H;  4A3F G;  4DUZ L;  5IYD H;  3CW2 C;  3GTJ H;  2OTL A;  4JI4 Q;  4HJ9 A;  4IOC A;  4B3S L;  4GKK L;  2EQS A;  3E0E A;  4A3I H;  3H0G H;  3KJP A;  3F1Z A;  2I5L X;  1PYB A;  4X65 Q;  5IYC H;  3G71 A;  1XJV A;  3DLL A;  1I6H H;  4AIM A;  4LFA L;  1XNR Q;  3TQY A;  4A3B H;  4OX9 L;  4FDB A;  3CMA A;  5C3E H;  2GN5 A;  3CC2 A;  2R93 H;  2QEX A;  4JBJ A;  3HKZ G;  3PO3 H;  4PG3 A;  2HIV A;  3F8T A;  2MQH A;  4A3E G;  4RMF A;  1XMQ L;  4LFB Q;  5IY0 A;  3ER0 A;  4GN5 A;  1FL0 A;  1HR0 W;  1E1O A;  3K7U C;  4A76 A;  2HQL A;  4P74 A;  1WJJ A;  1VQD A;  4DR4 L;  1XMO L;  3I4M H;  1VS0 A;  4P72 A;  2YV5 A;  1VQ9 A;  4A93 H;  2YTY A;  4B3M Q;  1HR0 Q;  1PA6 A;  1PYS B;  2HHH L;  2JA9 A;  2DGY A;  2IX0 A;  5M5W H;  2WAQ G;  3KDF B;  3F2D A;  3PF5 A;  1HNX L;  2JEA I;  2R7Z H;  4DV3 L;  3MEF A;  3HOU H;  1HNZ Q;  3GTO H;  1QVF A;  4JBK A;  4LF6 L;  3NEN A;  3T1Y Q;  4UPA A;  4A75 A;  1CUK A;  2MO0 A;  1CKN B;  2UXD Q;  1GVP A;  2A1A A;  3FP9 A;  1CKM A;  2NN6 G;  4DV5 L;  1PHJ A;  4LF4 L;  2Q2I A;  1VQ7 A;  4TQU S;  1PH9 A;  3S2D H;  4L5T A;  1FGU A;  4LUV A;  5IP9 H;  4JI1 L;  4L5S A;  1NMG A;  4JOI C;  4A3J G;  1YHQ A;  3T1H L;  3GTG H;  1LYL A;  4A3D H;  3J80 c;  3D31 A;  3RN2 A;  1VQO A;  2GVB A;  4DR6 L;  1I50 H;  3CQZ H;  4JBW A;  5JJL A;  5IYD G;  3H15 A;  1VQJ A;  2VS1 A;  4C3I H;  1KL9 A;  4UP7 A;  2E5L L;  4R1J A;  4QGU A;  4A3I G;  1KD1 C;  1KIX A;  1Y1W H;  2B63 H;  5JJI A;  3CCE A;  3EN2 A;  3IRB A;  2R7D A;  4GLX A;  2AKW B;  1CSQ A;  2VY3 A;  3MXN B;  5C44 H;  1PH1 A;  4NXM L;  1IZ6 A;  1YBY A;  2QA4 A;  4DR3 Q;  4JYA L;  5IYC G;  4DV0 Q;  3CCQ A;  2KCT A;  1JB7 A;  1IBK L;  2YU9 H;  4ALP A;  1MKH A;  4YCU A;  4B3T Q;  1M1K C;  4A3B G;  3PGZ A;  4BY1 H;  2NVX H;  1LM0 A;  4R4Q A;  4A3L H;  1JT8 A;  3UDX A;  1FVI A;  4IPH A;  3JAM i;  3PO3 G;  4DR7 L;  2VL6 A;  2NVQ H;  3J7A 5;  1GM5 A;  3KJO A;  1N34 Q;  3S1M H;  2K5N A;  4DV2 Q;  4LUO A;  1OXS C;  3OTO Q;  4GNX B;  4LF9 Q;  5IP7 G;  2HT1 A;  1PV4 A;  2Q2H A;  1UEB A;  4DAY B;  3A5Z B;  3PIP A;  1Y14 B;  4YHH L;  4X62 Q;  3I56 A;  4BA1 I;  2ATW A;  2JA7 G;  1KAW A;  2XGT A;  5BR8 L;  4K0K Q;  4A93 G;  3K81 C;  1IBL Q;  1XTD A;  4LF8 L;  2VQF Q;  4LNQ A;  2GVA A;  3J81 j;  1E7Z A;  3F2B A;  4A3E H;  4BY7 G;  2Y0S G;  5C4X H;  1JMC A;  1N36 L;  1NTG A;  4POF A;  2OCE A;  3K0X A;  1OXU A;  1U5K A;  2ZM6 Q;  4OWX B;  4JV5 L;  4JI0 L;  3A5U A;  1VQL A;  4DUY Q;  1WI5 A;  1SN8 A;  3HFZ B;  2N3S A;  1PH6 A;  1K8G A;  1B7Y B;  4Y7N H;  4BA2 I;  2JQO A;  3AFQ A;  3RR5 A;  3G4S A;  4GNX C;  1PH7 A;  5GRO A;  3U4V A;  4L5R C;  2B29 A;  1YJ9 A;  1YVC A;  2A8V A;  3B6Y A;  3PV0 A;  4DR5 L;  1Q82 C;  2KCM A;  2UXB Q;  4DR2 L;  1PH2 A;  3CCU A;  3L0O A;  3UDF A;  4YWM A;  3I55 A;  4A3D G;  1QVC A;  1BVS A;  3NEL A;  3M4Q A;  1K0R A;  3I4O A;  1KC8 C;  3TS2 A;  4C3J H;  1D8L A;  2YTV A;  1Q86 C;  3M9B A;  4WJ4 A;  1S40 A;  4OXP A;  1MIU A;  2K5V A;  2ZJR A;  4B3R L;  3J81 i;  1A8V A;  1V43 A;  2WB1 G;  1Y1W G;  4LF4 Q;  2B63 G;  2CFM A;  4JI8 L;  5H1S E;  2AMC B;  1LTL A;  1X55 A;  1UWV A;  3OYY A;  1KRT A;  3GTK H;  4GKJ L;  4IFD J;  2I0Q A;  1XNQ Q;  1X65 A;  1JE5 A;  4DNI A;  4JI5 L;  3UE1 A;  4X64 L;  1I94 Q;  1N8R C;  4A3L G;  2UXC L;  1XPR A;  4J15 A;  5LMU Q;  1QVG A;  2KHJ A;  2N8N A;  1LUZ A;  2K5H A;  4HIK A;  3A0J A;  1AH9 A;  2PMZ E;  1WCM G;  5M3M G;  1X9N A;  4HJ7 A;  3E9H A;  4DR1 L;  1GKH A;  3H3V I;  1XPU A;  2OWO A;  1O7I A;  1VQP A;  3S14 H;  1E24 A;  1YNX A;  3ULL A;  4PZ7 A;  1NJI C;  3GTL H;  1PH5 A;  1QUQ B;  5C0X G;  1HNW L;  2UU9 L;  2IY5 B;  4X66 L;  4IJH A;  4RG1 A;  1FJG Q;  5C4X G;  1IBM L;  4JI6 Q;  2V1C C;  1YZ6 A;  3KFU A;  5IWA Q;  4BXX G;  3KYH C;  4JI2 Q;  1X3G A;  1N32 L;  1SFO H;  4LF5 Q;  2E2H H;  5IP7 H;  1RIP A;  1E3P A;  2K75 A;  5IE8 A;  3RZO H;  2QGQ A;  3Q8D A;  3F2C A;  3S17 H;  4DV6 L;  4DV7 Q;  5AJ3 Q;  1YJW A;  2JA7 H;  5C0X I;  4NB3 A;  1SMX A;  3GDE A;  4NXN L;  4GN4 B;  2HIX A;  2RHS B;  4L5Q A;  4AH6 A;  3ERS X;  5FJ8 G;  4BY7 H;  1IYJ B;  2ES2 A;  4GNX A;  4KHP Q;  2VNU D;  2RCN A;  2WFW A;  2MO1 A;  1UE5 A;  2CWP A;  4AQY Q;  1MJC A;  1VQI A;  5M5X H;  3EIV A;  1HJP A;  3BJU A;  1OTC A;  4JI3 L;  4JC0 A;  1JJ2 A;  1U0L A;  2VUM G;  1P8L A;  4HIO A;  5GAG C;  2DUD A;  1YIT A;  4QQB X;  3M4O H;  3UDI A;  2F4V Q;  1J5E L;  3S15 H;  4NPS A;  3PO2 G;  1MJE A;  1HZC A;  3S1R H;  1N33 Q;  2JK8 A;  4JI7 L;  5LMN L;  4PMW A;  2JA5 G;  1SRO A;  2K4K A;  3J7Z C;  1EFW A;  2BA0 A;  2KEN A;  2NN6 I;  3KF6 B;  3WWV A;  2E2I H;  4XTC S;  1KXL A;  1C7Y A;  2E2J H;  1V1Q A;  4UP8 A;  3ULP A;  2BH8 A;  1VQH A;  2IT1 A;  3CPW A;  4TVA B;  3W1G A;  4OO1 G;  1Q8K A;  1H95 A;  1BBW A;  3FHW A;  1EOV A;  2UUC L;  1KHI A;  1EQR A;  4EQ5 A;  4DV4 L;  3RNU A;  3RLN A;  3RZD H;  4LF7 L;  4OON A;  4A4I A;  3HOX H;  1RL2 A;  4EX5 A;  4DV1 Q;  3GTQ H;  3HOV H;  3AQQ A;  3H3V H;  1VQF A;  3S1N H;  2UUB L;  2UUA L;  1Q12 A;  1E22 A;  4IPG A;  1PVO A;  2LSS A;  2CQO A;  1HZB A;  1NE3 A;  2VQE Q;  3I2Z A;  5FLM G;  4OO1 I;  1TWC H;  4DUZ Q;  1JJG A;  1WYD A;  3RN5 A;  4GOP B;  1L1O B;  4B3S Q;  4DK6 C;  4GKK Q;  1WCM H;  3TRE A;  4LW1 A;  5M3M H;  4P71 A;  2R6G A;  5JEA J;  4IOA A;  1EWI A;  3KF8 B;  2I5H A;  3U4Z A;  2NVT H;  4XIG S;  4YCV A;  4A3M G;  1VQM A;  3VDY A;  4X65 L;  2MNA A;  1G51 A;  4IJL A;  4LFA Q;  2Q2U A;  1XNR L;  4GLA C;  2N49 A;  1G29 1;  4OX9 Q;  1S3O A;  2ZJQ A;  1K8A C;  1HNW Q;  1XMQ Q;  4BXX H;  1I3Q H;  2KBN A;  2LXK A;  4LFB L;  2C35 B;  1Q7Y C;  2PQA B;  4QJF A;  1QUQ A;  3BZC A;  3CD6 A;  1WOC A;  1L1O C;  4GOP C;  1L0W A;  1ASZ A;  2CWA A;  4R4I A;  1YJN A;  2K14 A;  1EYG A;  1VQ4 A;  4DR4 Q;  1XMO Q;  1IXR A;  5FJ8 H;  2EXD A;  1TWH H;  4GLV B;  4GN3 B;  3U58 A;  1EIY B;  4B3M L;  1HR0 L;  4OWW B;  2OQK A;  4JCV E;  4A3K H;  2HHH Q;  1HNX Q;  3D0F A;  1SR3 A;  5IT9 c;  2VUM H;  1S72 A;  3AEV A;  4DV3 Q;  3S16 H;  3E9I A;  4MNO A;  1JJC B;  2N78 A;  1HNZ L;  2NVY H;  3S1Q H;  1WFQ A;  3G6E A;  4LF6 Q;  4IPC A;  1CSP A;  1B70 B;  3KOJ A;  3T1Y L;  3PO2 H;  1AE2 A;  1SE8 A;  2UXD L;  1NBW A;  4IPD A;  4DV5 Q;  4PZ6 A;  3STB C;  3TRZ A;  3ZJY C;  3HKZ E;  4JI1 Q;  3GD7 A;  3J80 i;  3HOX G;  1EUJ A;  1TWG H;  2D0P A;  1SLJ A;  3CP0 A;  4KHZ A;  3T1H Q;  2JA5 H;  2IX1 A;  1AE3 A;  2PNH A;  2JA8 G;  3HOV G;  4A3C H;  4DR6 Q;  2OQ0 A;  5HY6 A;  1C0A A;  4QIW E;  4P75 A; 
#chains in the Genus database with same CATH topology
 2FXQ A;  3PSI A;  1MZB A;  2EPB A;  2SEB D;  1ZHQ A;  4GS3 A;  5FPO A;  2R8G A;  2NUA B;  3Q23 A;  2EY5 A;  1PFB A;  4LF8 H;  2R61 A;  1KQS A;  4CDC C;  1KBL A;  2AWO A;  4WFN 3;  1V8Q A;  5CBA E;  1LTT D;  2RVL A;  3MEH A;  3Q24 A;  3HBL A;  3BZK A;  4LFB H;  3W5O A;  4A3J B;  2X6G A;  1G91 A;  1T3N A;  1SYE A;  3CME A;  4UP9 A;  4O2D A;  5L1I A;  2C5C A;  1ONL A;  1S5D D;  3WO0 A;  3LWE A;  5KT6 A;  1A63 A;  4HQ6 A;  3OTO L;  2LKV A;  2ALY B;  5KYI A;  2B2W A;  2UVU A;  5KFG A;  5ELE A;  4AYB A;  1QE6 A;  1B44 D;  2OLS A;  5KFQ A;  2RCF A;  4K0K L;  4M7E A;  2I87 A;  4LF8 Q;  4DKA C;  1IBL L;  4TRD A;  4YWK A;  3BYT B;  4QWD A;  3I4N G;  3CPF A;  5NUC A;  3TME A;  4MV3 A;  4C5B A;  3MJF A;  2EYJ A;  5AFW A;  1JIC A;  3NK9 A;  4KD4 A;  1D5X C;  3ICE A;  5JVL A;  1HQM C;  1GHK A;  1SFO B;  3NGD A;  4BBS H;  1C8C A;  4Q43 A;  1PTO D;  2KHI A;  4DR5 Q;  2K03 A;  1X6O A;  3S17 B;  4PZ8 A;  4X6A H;  3EPG A;  4DK0 A;  4JI5 H;  2F0E A;  2M00 A;  2JA7 B;  2W9A A;  4RGN A;  1NSN S;  2QDB A;  1VQB A;  2ENB A;  2Z0S A;  1JWS D;  2VPQ A;  1Z47 A;  2B2V A;  2GPS A;  1FR3 A;  1NY4 A;  4RGM A;  2PYK A;  3MA2 B;  2F0W A;  1X54 A;  4POG A;  3JAM E;  1STY A;  3M4O B;  2F52 A;  1PK8 A;  4DPG A;  1X56 A;  3S15 B;  1MHW C;  5ELN A;  1IBM H;  3S2D B;  3T5H A;  4F4Z A;  1FNU A;  3GTP H;  2W6N A;  1N34 H;  4AYB B;  4JI5 Q;  1KJQ A;  1K83 H;  1HA6 A;  3W3A A;  3RMH A;  4A3D B;  2AGP A;  5FLX W;  2WV6 D;  4O0A A;  2HDM A;  2AWN A;  3FKI G;  4YWL A;  3RGZ A;  1EQQ A;  2YYZ A;  1VQG A;  2A19 A;  5K5P A;  1XYI A;  4AYB E;  5JEA G;  1V9P A;  2FKL A;  2WAQ A;  1LT4 D;  2WB1 B;  4KY5 A;  2B63 B;  5KFK A;  3R5F A;  1Q1B A;  3U9S A;  1SYD A;  1KDB A;  5C44 B;  1BGW A;  3T51 B;  2V5A A;  4A3F H;  5C3E G;  1CA5 A;  1IBM Q;  2X0S A;  5DQG A;  1KJI A;  1SCU B;  4I50 F;  2K6A A;  2WB1 E;  2EOT A;  4JI6 L;  4BY1 B;  5IWA L;  2NVX B;  1V4Y A;  4JI2 L;  3IAY A;  2R86 A;  1IW7 C;  1F2Z A;  2V9W A;  4N9T A;  4G57 A;  1X3F A;  3JC6 6;  4DV6 Q;  5GQO A;  3KAK A;  5AJ3 L;  3SDZ A;  5F9N A;  1A62 A;  2NZH A;  3GLK A;  1UE1 A;  2NVT B;  2Q8T A;  1HUM A;  2C2E A;  4KHP L;  1UC8 A;  5KFN A;  5GAD C;  3PMF A;  3RLF A;  3I4N H;  2EYO A;  4R4T A;  4AQY L;  1SRU A;  2M2L A;  1UUP A;  4DAP A;  2VPS A;  1A9X A;  4UY8 C;  1D7Q A;  3HGB A;  4A3G G;  5KEE A;  1L2Z A;  5LMN W;  2JEB I;  2Q8I B;  2F4V L;  5T1G A;  4TQS A;  4RUA A;  5KG6 A;  1S68 A;  2YRW A;  5EWF A;  3NTI A;  1DON A;  2WYO A;  3GTL A;  4Y52 H;  5DG9 A;  4HYK A;  4FXD A;  4V0B A;  5GON F;  4J9N A;  5KT4 A;  1XNQ H;  1KRS A;  5IP9 G;  1GO3 E;  1KJ9 A;  2WTF A;  3UFX B;  2WAQ B;  1W6K A;  2F0N A;  2VUM B;  3PUV A;  4FYD A;  4Y8V B;  2NZO A;  4XQQ A;  3M85 A;  3MVV A;  2Y0S A;  4QWA A;  4H02 A;  1K1Q A;  4KJO A;  4OEM B;  4ZHQ F;  2D9U A;  4OEL B;  2JE6 I;  3N8D A;  1FJG H;  1CKN A;  1HXY D;  4UCS A;  3SEB A;  5LL6 b;  3KHL A;  1O80 A;  3NBI A;  2A68 D;  3GTJ H;  4HJ9 A;  2PZT A;  1K8M A;  2ZDH A;  4GKK L;  5LL6 X;  3E0E A;  4R8U A;  3ZYY X;  1C48 A;  5JEA H;  3URY A;  1WVL A;  3GTG A;  5C1P A;  2R7L A;  2KQ3 A;  4DNT B;  5BN4 A;  4FM9 A;  1NCV A;  5KFO A;  1S0M A;  1SNP A;  3TQY A;  4A3B H;  1M6V A;  1C30 A;  5C3E H;  2ZDQ A;  2QEX A;  2XIW A;  3HKZ G;  3TP5 A;  2W6O A;  1LAC A;  2W8K A;  1SNQ A;  1DZ1 A;  1EUD B;  2SNM A;  3BG3 A;  5IY0 A;  3ER0 A;  4GN5 A;  1HHV A;  4RZQ A;  4A76 A;  2YU9 A;  1N33 H;  3VR4 A;  5I6Y A;  2YW2 A;  1NR2 A;  1WJJ A;  2V59 A;  4F4Y A;  4PQX A;  1XMO L;  4P72 A;  4KKT A;  4O3Q A;  4Q8F A;  1PYS B;  2A73 B;  4DA2 A;  2JA9 A;  2DGY A;  5M5W H;  3PF5 A;  1FD7 D;  2JEA I;  3PW2 A;  1JLL B;  3GTO H;  1QVF A;  2GPW A;  2XWJ B;  4K8I A;  3I72 A;  4UPA A;  1CUK A;  1CKN B;  2KEE A;  4WOR A;  5M9O A;  4DV1 H;  2Q2I A;  1VQ7 A;  3V6J A;  1PH9 A;  4L5T A;  4EVO A;  5IP9 H;  3CHB D;  4JI1 L;  2J6U A;  1MBY A;  2I07 B;  4L5S A;  4JOI C;  1I3Q A;  1YHQ A;  4R8U B;  4EFE A;  3GTG H;  1M0W A;  5JPM C;  4APM A;  4B3S H;  3OTO H;  1ZQ7 A;  1I50 H;  2JEF A;  4YJ2 F;  2AQ2 B;  2O03 A;  3SK5 A;  3GIQ A;  4F88 A;  1RF2 D;  3NWS A;  4A3I G;  1JOQ A;  3CCE A;  3IRB A;  4GLX A;  1KNA A;  5KX5 F;  4FXG C;  1CSQ A;  2VY3 A;  3H6M A;  4ECW A;  4NXM L;  4BWS C;  2QA4 A;  3DHQ A;  2YU9 H;  4GZY C;  2Q8R E;  5EKK A;  2RDJ A;  3FPU B;  2LMC B;  1W93 A;  4R4Q A;  4A3L H;  4CDD C;  3DWP A;  2K28 A;  1HTP A;  2SNS A;  3S1N B;  2AQ4 A;  3PO3 G;  1Z2O X;  2NVQ H;  2LS0 1;  3KLS X;  3J7A 5;  1BXT A;  3S1M H;  2EY1 A;  1BOS A;  4LUO A;  1OXS C;  3T16 A;  3OTO Q;  4GNX B;  5E4X A;  5IP7 G;  2FPI B;  2Q2H A;  4DAY B;  2EJM A;  2VA2 A;  4X3T A;  3P7J A;  2FMM A;  1KAW A;  1HNX H;  4K0K Q;  4A93 G;  1IBL Q;  2WKC A;  5C4H A;  3R5H A;  2GVA A;  3K7A B;  5C4X H;  5A2Q W;  1NTG A;  1A2T A;  2F0Q A;  3K0X A;  1S03 G;  1EYC A;  4JI0 L;  3A5U A;  1G2T A;  1VQL A;  1E4E A;  3HFZ B;  1PH6 A;  4ZQ3 A;  4J0M A;  2HQE A;  3RR5 A;  3ITP A;  3Q22 A;  3PW0 A;  1I4Q A;  2EE1 A;  3N6R A;  5FO7 B;  3U4V A;  2K01 A;  1YVC A;  5I2X A;  3B6Y A;  1Q82 C;  2J6T A;  1G6Z A;  5L37 A;  1CE8 A;  4L1K A;  2J9G A;  3MZ5 A;  3SVM A;  3VA5 A;  1V1P A;  5IOC A;  1BVS A;  4A3K B;  3M4Q A;  5IGC A;  5EQ0 A;  1KC8 C;  3S16 B;  3JZI A;  2YTV A;  1Q86 C;  4JYA H;  1IBK H;  2BQU A;  1SJE D;  3J81 i;  4CHT B;  4IWY A;  1WR2 A;  1UWV A;  2JN4 A;  4DR7 H;  5IWA H;  2PMZ B;  4LMQ D;  3OWF A;  4GKJ L;  4JI2 H;  1TWG B;  2DPJ A;  1EU4 A;  2NTT A;  1N8R C;  4FS2 A;  2N8N A;  2K5H A;  3Q1K A;  3K59 A;  4ZK9 B;  4X3K A;  4YHH H;  2IJ0 A;  2PMZ E;  1WCM G;  1X9N A;  2L5T A;  3NE5 B;  3E9H A;  1D1K A;  1D2B A;  3CKI B;  3HOY B;  2FE3 A;  3CVZ A;  5FLX L;  4HMI A;  1X32 A;  1E24 A;  3A8K E;  3SXH A;  1N36 H;  3CU7 A;  4JV5 H;  3IG0 A;  4X66 L;  1UC9 A;  4IJH A;  5KFM A;  4JI6 Q;  5IWA Q;  4BXX G;  2XRS D;  4JI2 Q;  1B50 A;  5DEH A;  3VR5 A;  1XX8 A;  2FJZ A;  4RB2 C;  5DM6 3;  3GTQ A;  5IP7 H;  3RZO H;  2Z9H A;  2QGQ A;  3Q8D A;  3F2C A;  2NYZ D;  4ZUJ A;  1V1P B;  5AJ3 Q;  5C0X I;  4KJN A;  2KA7 A;  3GDE A;  4NXN L;  5J2U F;  2HIX A;  2RHS B;  1DCZ A;  1D5M C;  1IYJ B;  2ES2 A;  2KUM A;  4KHP Q;  2HVQ A;  4RNM A;  2R92 A;  4AQY Q;  1HJP A;  3BJU A;  3TDQ A;  3V05 A;  5GAG C;  3UDI A;  3MWE A;  5IIF A;  2F4V Q;  4C3J G;  1J5E L;  2VR1 A;  2SOB A;  2FK3 A;  1HZC A;  3ERQ A;  3TQ1 A;  5FD5 A;  3S1R H;  3RD4 A;  1VAJ A;  2PVP A;  4JI7 L;  5KG1 A;  1EOT A;  5LMN L;  4FBU A;  2UXC H;  3I4M B;  4O4L F;  5L1J A;  4GKK H;  4OGQ C;  5E4W C;  1EFW A;  4F4X A;  2BA0 A;  1TR5 A;  4L8J A;  2NN6 I;  1T94 A;  2EYL A;  4DR1 H;  3ULP A;  2R7Z B;  1TWH A;  3K3P A;  1EWC A;  2O4X A;  4TVA B;  1PRT D;  5A35 A;  3NUC A;  4OO1 G;  1H95 A;  3RB3 A;  5KFF A;  3RZD H;  4IR1 A;  3GTQ H;  1HNW H;  1RL2 A;  4IUT A;  2PW7 A;  3H3V H;  1PTO B;  2QCP X;  5KYL A;  2UUB L;  1E22 A;  4IPG A;  2JSO A;  2R7K A;  5JPN C;  5COR A;  3GV5 B;  3I2Z A;  3ETJ A;  1YNJ C;  1LT5 D;  2R7N A;  4PWQ A;  3D6W A;  4GOP B;  3Q0A A;  4GKK Q;  3RIZ A;  1WCM H;  2L1B A;  1XMO H;  3PVX A;  2R6G A;  1S5E D;  3KF8 B;  4DXG A;  3SK6 A;  5EOY A;  1F2M A;  1I6V C;  4LSX A;  2I80 A;  1G51 A;  3TSS A;  2M05 A;  2Q2U A;  2X69 A;  4Q44 A;  4OIJ A;  3GV3 A;  1SAP A;  3A8I E;  5CV5 A;  1I4X A;  1S3O A;  2TMP A;  2ZJQ A;  5COY A;  3MC0 B;  1HNW Q;  2J0T D;  4H13 C;  4BXX H;  3N44 B;  4LFB L;  1WTP A;  2F0P A;  1HFG A;  4QJF A;  1QUQ A;  3CD6 A;  1WOC A;  4ZQI A;  1L0W A;  3RFC A;  5JQW A;  2CWA A;  1YJN A;  2K14 A;  1EYG A;  1Y1V A;  1XMO Q;  1IXR A;  3ND8 A;  1TWH H;  1BUV T;  4GLV B;  2BDN A;  1RYS A;  4ECT A;  2OQK A;  4JCV E;  1TWA B;  2IX3 A;  1FNV A;  2MJ8 A;  2UVV A;  3H0G A;  3NTK A;  2BE5 C;  1CS0 A;  4KKU A;  4WRD A;  1EFI D;  3NSW A;  3S1Q H;  2DLN A;  2DWC A;  3TQT A;  2C9O A;  3NBH A;  3MWM A;  2D5D A;  1B70 B;  3KOJ A;  1ZYR D;  3IN5 A;  1AE2 A;  2W9B A;  2UUC H;  2R85 A;  4H7B A;  5KFB A;  3M4I A;  2R93 A;  3GID A;  2YRX A;  5L1K A;  4JI1 Q;  3ETH A;  3J80 i;  4RNO A;  1N56 A;  1TKW B;  4ZI7 F;  2D0P A;  3C3L A;  4LH7 A;  1R4P B;  2JA8 G;  3P75 A;  4TSS A;  3I73 A;  1HA5 A;  1WH2 A;  4BBR B;  1HRJ A;  4A2A A;  3BG5 A;  1XTC D;  5C4J H;  4O3O A;  5D3I B;  1Z9F A;  4OO1 H;  1VQ5 A;  2H1E A;  5KFE A;  3R8B A;  1PH3 A;  3V96 A;  2EJG C;  1M0T A;  1P16 A;  4NXM Q;  3W1B A;  2IBK A;  2R6F A;  4UCU A;  1EZ8 A;  2XWB B;  3MWD A;  3CCV A;  1UE6 A;  1E4F T;  4IN3 A;  4IUU A;  3VPD A;  4GC6 A;  1N34 L;  3KBG A;  3R2T A;  5KFR A;  1U4R A;  2PO4 A;  3A54 A;  3EBE A;  4CC6 A;  4QUC A;  3TEH B;  1AP0 A;  4HID A;  1VCI A;  2WKD A;  4HIM A;  1VBH A;  3NBH B;  5C0X J;  2OTJ A;  3CQZ A;  3SI8 A;  4YP3 A;  4HJA A;  1DD2 A;  5LXT F;  3BU2 A;  1VQE A;  4EYI B;  2R93 B;  4KHV A;  2JA6 A;  1YNN C;  4JI0 Q;  1Q3L A;  1M8A A;  2IL8 A;  5EGT A;  3I7F A;  4LUZ A;  4DAM A;  4UCR A;  3LNN A;  2I5M X;  5C5M A;  1OXT A;  4ECQ A;  4ME3 A;  5EAY A;  4YCW A;  5A2Q L;  2WAC A;  5CYU A;  2R8I A;  4FVM A;  2PQA A;  2Z6K C;  5CV8 A;  3NEM A;  1HQR D;  1HZ9 A;  3CF5 A;  1IHZ A;  4HNU A;  1EQT A;  4O3R A;  3NQI A;  2ASB A;  4A3C G;  3KLW A;  3KXY T;  1Z2N X;  5K36 G;  5M5X B;  1IL2 A;  2NBF A;  4O42 A;  4YR2 A;  1XWE A;  5EKL A;  4O1N A;  1K1S A;  1PH4 A;  1B04 A;  1STN A;  5IYB H;  1QB5 D;  2JA8 H;  2L4N A;  4R7R A;  2MHV A;  4R4O A;  2RHQ B;  3WNZ A;  4GKJ Q;  1GYF A;  4IFD H;  3K5M A;  1XNQ L;  4DV2 H;  2AHO B;  2VW9 A;  3VYS A;  4C2M A;  5M5Y H;  4LF9 H;  3DWQ A;  3STB D;  3QOL A;  3CQZ B;  2RBM A;  4YY3 H;  1UNS A;  4JBM A;  2JA6 H;  2E2J B;  4RKB A;  1CHP D;  1GD7 A;  2F0S A;  1Y1W B;  5GAE C;  5ELO A;  3G48 A;  1IYU A;  3G6Y A;  1BKB A;  4O2B F;  4X66 Q;  4IO9 A;  1Y8P B;  4DL5 A;  2HGS A;  1J5E H;  3WDN A;  5DM7 3;  1FJG L;  3CXC A;  4F7X A;  2B2W C;  3BDO A;  1LTG D;  3KLR A;  5GAH C;  3PW4 A;  2UVR A;  2L9H A;  4JI7 H;  2QKI C;  1RHP A;  1I5F A;  2UXB H;  4MTN A;  1II3 A;  4DV7 L;  2O5J C;  2XNA C;  3MFI A;  3FEW X;  1R9T H;  2WP8 J;  2HD3 A;  4LK1 C;  1NMF A;  2F0U A;  1J6Q A;  2N88 A;  4YY3 Q;  4NXN Q;  4BBS G;  1EYZ A;  5LP6 F;  1NR4 A;  3J81 E;  2AGO A;  2Z6K A;  5EBD A;  5C4Z A;  5ELF A;  5DGB A;  1SXT A;  2PZW A;  1TU2 B;  1JQY D;  2IW3 A;  3LGJ A;  1J5E Q;  4WJ3 M;  5FPR A;  3CCJ A;  4UAI A;  4C2M H;  3RBD A;  4KLK A;  2OH2 A;  4RH6 A;  4Y7N B;  1TXY A;  4CKC A;  4YJ3 F;  1EUC B;  4JI7 Q;  1N33 L;  3JRW A;  1STA A;  2F3I A;  5LMN Q;  4EQP A;  1F9P A;  4AYB G;  1KC7 A;  1SFO A;  3M9O B;  4HJ8 A;  2E2H A;  4HED A;  5K36 H;  3M7N A;  2BA1 A;  3GTM H;  3EYY A;  1Z7T A;  3L7Z C;  2JA7 A;  1YEZ A;  1MD2 D;  2ZTC A;  3ULJ A;  1G6P A;  1BBU A;  2AGQ A;  3RUP A;  5KFZ A;  4KI0 A;  1K9M C;  4DV1 L;  5C44 G;  4A3J H;  1B6S A;  2EIF A;  3PUW A;  2UUB Q;  1STE A;  5E7N A;  4GC7 A;  3A74 A;  1I4P A;  2YZM A;  1E1T A;  3DM3 A;  4BY1 G;  5IT9 E;  1F9R A;  4A3F G;  2OTL A;  3Q6S A;  1LTS D;  4OL7 A;  1VF7 A;  4B3S L;  1AN7 A;  3M7G A;  3Q8S B;  2I5L X;  1PYB A;  2DZD A;  3AMU A;  5IYC H;  1SMY D;  3G71 A;  3VA7 A;  3VMM A;  1S0O A;  4AIM A;  4J9L A;  4DL4 A;  4DL7 A;  1MGS A;  4XYM B;  2G5D A;  4FDB A;  3CC2 A;  1PZK D;  3S14 B;  4JBJ A;  2BQR A;  2WB1 A;  4U6P A;  1H9J A;  2B63 A;  4RMF A;  4FP5 D;  4LFB Q;  3VR3 A;  2B2T C;  1FL0 A;  1HR0 W;  1K3B C;  1E1O A;  3K7U C;  1G2S A;  2NB0 A;  4EGJ A;  5KT3 A;  1B6R A;  1BNC A;  1VQD A;  2E2H B;  1CZW A;  2NVX A;  1KJJ A;  3C46 A;  4HR7 B;  2YTY A;  1TAE A;  4B9W A;  2HDL A;  1U4M A;  4TKO B;  3OUZ A;  3AU7 A;  3LP8 A;  2IX0 A;  2XSC A;  2WAQ G;  1HNX L;  4DV3 L;  1BBX C;  1LT6 D;  1DIK A;  1AEX A;  2ZJT A;  1WTH A;  5DG7 A;  1ICW A;  4XXE A;  4JW0 A;  4ETS A;  4DV5 L;  1PHJ A;  2WE6 A;  1H9R A;  3QR8 A;  4TQU S;  3S2D H;  5HGT A;  4XYQ A;  4DN4 M;  1ESR A;  4A3D H;  4I4T F;  1VMC A;  4RU9 A;  3LML A;  3D31 A;  1T5E A;  2GVB A;  2B8G A;  3BZD B;  4JBW A;  1VQJ A;  2L0C A;  2EYF A;  2E5L L;  2E2I B;  1JDB B;  3NTH A;  2B63 H;  4LFA H;  5JJI A;  5I4D A;  2VQD A;  4QCL A;  2K7V A;  4OX9 H;  5C44 H;  3MXN B;  4KMU C;  2FPG B;  1IZ6 A;  4JYA L;  1AFP A;  2VUM A;  1IBK L;  3CCQ A;  2KCT A;  1JB7 A;  2EYP A;  1DM0 B;  4ALP A;  5KFD A;  2F3W A;  4M8A A;  2FFK B;  3E5S A;  2NVY A;  3GIM A;  1EU3 A;  3HOX B;  1RDP D;  4RGO S;  3PGZ A;  4C1N K;  4BY1 H;  2NVX H;  3HOV B;  1LM0 A;  4A3B G;  4QWE A;  1JT8 A;  3V2T A;  1FVI A;  2F0K A;  3GTP B;  4DR7 L;  2XRQ D;  3PZP A;  2FLL A;  1PYW D;  3EQL C;  1GM5 A;  3KJO A;  1N34 Q;  4BS9 A;  2W9C B;  2K5N A;  1KLG D;  4Q0F A;  2B2T A;  5M3M B;  4G7Z C;  1UEB A;  3PIP A;  3A5Z B;  1Y14 B;  4YHH L;  3KUP A;  5BR8 L;  5ELB A;  2RSN A;  4LNQ A;  3GIP A;  3JSN A;  3D3R A;  4BY7 G;  1E7Z A;  4C5A A;  3FRP B;  2QYZ A;  2Y0S G;  2QK4 A;  2I46 A;  4LF6 H;  1N36 L;  4ZYS A;  3J80 E;  2FP4 B;  4JV5 L;  4I55 F;  4LF4 H;  2EY6 A;  1WI5 A;  3K0Y A;  2N3S A;  1B7Y B;  1EHI A;  4MAM A;  4BA2 I;  2DY7 A;  4EBC A;  4GNX C;  4DK1 A;  5GRO A;  4L5R C;  3K58 A;  1YJ9 A;  2PPB C;  2O2L D;  2EYH A;  4EYH B;  1PH2 A;  3UDF A;  3N41 B;  3I55 A;  5C8Y F;  4HNT A;  4CDF C;  1CQJ B;  1K0R A;  3RV3 A;  1D8L A;  3X3N A;  4UCT A;  5KND A;  4G4K A;  2NVY B;  1S40 A;  2ZJR A;  4B3R L;  4LF4 Q;  4YR3 A;  3PO2 B;  4J9S A;  1ZXT A;  3QJY A;  5H1S E;  2AMC B;  4FO2 A;  1LTL A;  3HRZ C;  2FMC A;  3DUZ A;  2SDF A;  3NQT A;  1KRT A;  1GSO A;  4ECZ A;  1E0B A;  2FPP B;  2FLN A;  4Q45 A;  5KRU A;  1XNQ Q;  3DEO A;  1JE5 A;  4BWG B;  4DNI A;  4A3L G;  2CW0 C;  2UXC L;  4QWC A;  1QVG A;  5LYJ F;  2BQ3 A;  1UAP A;  4DV7 H;  2C2R A;  3SE0 A;  1E2W A;  3JRX A;  4RB1 A;  3A0J A;  2YS7 A;  5KT7 A;  5CA1 F;  3MTS A;  1S4Z A;  4DR1 L;  3H3V I;  5HBR B;  2OWO A;  4YIJ A;  3NXW A;  3ULL A;  4PZ7 A;  4MV8 A;  3GTL H;  1K0S A;  4HCS A;  1HNW L;  1PLF A;  2Z4I A;  4X3U A;  4ZLT F;  1FJG Q;  5C4X G;  2V1C C;  2DIK A;  3KYH C;  2FB9 A;  5E3F A;  3OPO A;  4OIK A;  1RIP A;  1E3P A;  2K75 A;  5IE8 A;  3FKI B;  3SHL A;  4DV7 Q;  1YJW A;  4DR2 H;  4A3M B;  1EY7 A;  1L0Y B;  1SMX A;  4MTK A;  3A7L A;  4GN4 B;  5KFH A;  4AH6 A;  4L5Q A;  1WTR A;  3ERS X;  5EPL A;  4BY7 H;  1YNJ D;  4GNX A;  2VNU D;  3K57 A;  3MFY A;  4DFA A;  1UE5 A;  4DAY A;  5D1O B;  1CT1 D;  4JC0 A;  2EDG A;  1P8L A;  4IAJ A;  5C3E B;  1YIT A;  4JI8 H;  4NPS A;  2W7O A;  4HMJ A;  2A6H C;  2RDF A;  2CQY A;  5CV9 A;  4WJW A;  1B3Q A;  2FIN B;  1N33 Q;  3VR6 A;  3DM1 A;  2CVR A;  4PMW A;  2PZU A;  1SRO A;  3T56 B;  2E74 C;  3J7Z C;  2BDO A;  2ICE C;  3KF6 B;  4Z9C B;  3WWV A;  2XIG A;  2MP1 A;  1C7Y A;  3C2P A;  4DLK A;  2YZG A;  2BH8 A;  5KG0 A;  5KG7 A;  3NHH A;  4A3G B;  2MCT A;  3GTO B;  4PV1 C;  3OHB A;  1Q8K A;  1Y8O B;  5CR3 A;  1EOV A;  1IKL A;  1KHI A;  2UUC L;  4FF1 A;  3MXU A;  4DV4 L;  3RNU A;  3RLN A;  4LF7 L;  5CMD A;  4OON A;  4DV1 Q;  3BQ1 A;  4EX5 A;  3V4S A;  2BE5 D;  3VR2 A;  3DEP A;  3S1N H;  1S5C D;  4RGT A;  2UUA L;  1PVO A;  1N32 H;  2DY8 A;  2LSS A;  1TWF B;  2EXZ A;  1BCP B;  2KOL A;  4OO1 I;  2NZ1 D;  1JJG A;  1WYD A;  3D4R A;  1L1O B;  3OSP A;  4B3S Q;  4J1M A;  2PMZ A;  4P71 A;  1ENF A;  4DF7 A;  1EWI A;  1I50 B;  5C5L A;  3VPB A;  4UHV A;  1TWG A;  1BDO A;  2A69 D;  2F0G A;  4ME6 A;  5JVH 3;  1VQM A;  4X65 L;  2XD4 A;  3ORQ A;  1STH A;  2B39 A;  1A6X A;  4DV3 H;  3E0J A;  4IHJ F;  3TP7 A;  2QF7 A;  4PNY A;  5I2Y A;  1K8A C;  1TS2 A;  2VUG A;  1I3Q H;  3H4B A;  2KBN A;  3K5O A;  4DV5 H;  2C35 B;  4O2A F;  3M3Y B;  4Q5V A;  3BZC A;  4J6H A;  4K2K A;  3I4L A;  4GOP C;  3S2H B;  1VQ4 A;  3S1M B;  1CTM A;  1HTL D;  2EXD A;  3VYU A;  1ZEQ X;  3OUU A;  1JWU D;  1HR0 L;  2B8F A;  2IA6 A;  1B53 A;  4A3K H;  4LMY A;  1HNX Q;  3D0F A;  5IT9 c;  2E5L H;  3AEV A;  4ME5 A;  5EJW A;  4DV3 Q;  3E9I A;  1STG A;  1JJC B;  2N78 A;  3S16 H;  1ILP A;  2W6Z A;  3R23 A;  2XCA A;  1STB A;  4G3I A;  1KNE A;  4B08 A;  4PMB A;  4IPD A;  4DV5 Q;  4MV4 A;  2XC9 A;  2JEJ A;  2RSO A;  5G3L F;  5KFT A;  4R8I A;  3TRZ A;  4YBZ B;  3RB4 A;  2L12 A;  4QIW B;  3HKZ E;  3GD7 A;  3P20 A;  1TWG H;  3TBI B;  4KHZ A;  1YNN D;  3HOZ B;  2PNH A;  4A2B A;  1B9M A;  4XQJ A;  3PIO 3;  1GUG A;  3KLS A;  5D1P A;  5HY6 A;  1F77 A;  4ED7 A;  5DQI A;  2QDL A;  4P75 A;  2A6E D;  4QIW E;  3FVQ A;  1VF5 C;  2K33 A;  3BYY B;  2E5L Q;  3HOY H;  2R92 G;  3N42 B;  5BR8 H;  3MR5 A;  4APV A;  5HGQ A;  5J3B A;  4JYA Q;  4DR3 L;  1IBK Q;  2R3Z A;  1BQQ T;  2E8G A;  1H9K A;  1LTR D;  4DGZ A;  2CZG A;  2C22 A;  1LTA D;  5FKA C;  5C3X A;  2HVS A;  2R7Z A;  2KED A;  3S24 A;  1UNN C;  1NNX A;  3KBX A;  4LWC A;  1H9M A;  1TQO A;  1J8I A;  3MFH A;  4DR7 Q;  4CC5 A;  3TS0 A;  2W70 A;  3QFF A;  1S97 A;  3HOW B;  1B4O A;  4DV2 L;  1GLV A;  3JAM c;  4C3H G;  3Q2O A;  4QY7 A;  1Q81 C;  4LF9 L;  2F1M A;  3K80 C;  3MHB A;  4YHH Q;  4A3I B;  4B3M H;  4YR0 A;  3OHA A;  4GOP A;  4YY3 L;  1KAA A;  4KD3 A;  2J6S A;  1TII D;  5BR8 Q;  3KF8 A;  1VQN A;  1I6H B;  2VA3 A;  2PQE A;  5CGK A;  2ID0 A;  2XGP A;  1N36 Q;  4HNV A;  2W8L A;  3CC4 A;  3T1Y H;  2DNE A;  4JV5 Q;  4FF4 A;  4B3R H;  2UXD H;  3L3O C;  1H9S B;  2ZM6 L;  5CB4 F;  5BPH A;  4IWX A;  5KKN B;  3PO3 B;  5IGF A;  1YHA A;  3M4P A;  1D6E C;  2K5D A;  2MFI A;  5KFA A;  3KAJ A;  3GIL A;  3T5L A;  2BR0 A;  4MZ9 A;  4I7H A;  3CCM A;  3ORR A;  2C00 A;  1EYA A;  2UXB L;  1M90 C;  2AQ1 B;  1JE4 A;  3SK8 A;  5J2T F;  1ZKO A;  3OW7 A;  4CKE A;  4EQN A;  4A93 B;  5CAE B;  1G8Z D;  2ZXO A;  2K04 A;  4BBR G;  1W2B A;  2Q2T A;  3E5N A;  3CRK C;  5KFJ A;  3RBE A;  1SEI A;  1CFM A;  1WTQ A;  1XPO A;  3TP8 A;  1VQK A;  1PDQ A;  3H20 A;  1SNM A;  3HOU B;  3OSN A;  2AU0 A;  1TS4 A;  1TWA A;  2H5X A;  3IFT A;  2A68 C;  4B3R Q;  3PW5 A;  3I12 A;  4JV2 A;  1YI2 A;  3C1E A;  2HUG A;  3FDT A;  4QW8 A;  4B3T H;  1HZA A;  4LFC H;  3QO2 A;  3K8A A;  2PI2 A;  3JSL A;  2B3G A;  1SE2 A;  1N9W A;  1WD0 A;  1SJH D;  1Y1V G;  1E2Z A;  1QG7 A;  1KTK A;  3QG1 A;  4QL5 A;  5M3F G;  4OWT B;  1B8A A;  2UXC Q;  4F50 A;  1B1Z A;  2R92 H;  1ET6 A;  5JVD F;  1ILQ A;  4X62 H;  4KV6 A;  3BA8 A;  4IUP A;  5I47 A;  3H0G G;  4DR1 Q;  1F2Y A;  1HUN A;  1DOL A;  2NU7 B;  2VQF H;  4J9Q A;  1JC7 A;  3CCL A;  1VQC A;  3FPP A;  4LFC Q;  4G7O C;  1QZH A;  2R93 G;  1FGB D;  4EEY A;  3L2P A;  1Q1E A;  3MXG A;  2IHE A;  4C3H H;  4IRD A;  5CV4 A;  3T13 A;  3TP6 A;  1T5X D;  4CJ1 B;  4R4C A;  2LXJ A;  1WCM B;  4MV7 A;  3RGX A;  3PN1 A;  5T1I A;  1TWA H;  1EY4 A;  4RB0 A;  3PUY A;  1SBB B;  3J7Y W;  1K3R A;  3D4D A;  3IL8 A;  1T9H A;  5HUR A;  2K5Q A;  1JWM D;  1OO9 B;  4A3E B;  2V4Q A;  4DV4 H;  4LF7 H;  2XTI A;  5DLG A;  2JP1 A;  3AFP A;  1CI3 M;  5KFP A;  2RGR A;  4J9P A;  2UUA H;  2WII B;  5EDW A;  1EIF A;  3GII A;  5IYB G;  5F9L A;  1F9Q A;  3PIO A;  1L2F A;  2PI2 E;  2BH2 A;  1GUT A;  4JI4 H;  4BBR H;  1X3E A;  5C3W A;  3OW2 A;  2OEO A;  1JOR A;  1EY6 A;  3JAM L;  1ESF A;  3CCR A;  1VQ8 A;  1FYC A;  4IFD G;  3N40 P;  1CA6 A;  1ASY A;  2NTS A;  2F0H A;  4J9K A;  1M7J A;  4X65 H;  2AQ3 B;  2TSS A;  4JK1 C;  1S5B D;  5JJK A;  4C3I G;  4C3J B;  3KDF A;  2SCU B;  4ECS A;  3F2U A;  2E2D C;  2UUC Q;  2FLP A;  2JA6 G;  4DV4 Q;  4LF7 Q;  4MV1 A;  1VQA A;  3PQI A;  3CC7 A;  1Y1V H;  4QUF A;  1C9O A;  3BVZ A;  4PMC A;  2F03 A;  4HSV A;  5M3F H;  1YIJ A;  2CCZ A;  2UUA Q;  5L9X A;  2ZJP A;  4LF5 H;  3GTK B;  5IYD H;  3CW2 C;  4RAY A;  4JI4 Q;  4I7A A;  4QB4 A;  2GA4 B;  4J9O A;  4RWS C;  3OHX C;  3A7A B;  2EQS A;  1WTO A;  3H0G H;  3KJP A;  3F1Z A;  1HR0 H;  2R8J A;  2G9H D;  2OXP A;  4X65 Q;  4CKB A;  1PZI D;  4MN3 A;  1XJV A;  3DLL A;  3ND9 A;  4LFA L;  4L63 B;  5LHY 1;  4OX9 L;  1K8O A;  4HN7 A;  3CMA A;  2R93 H;  2C28 A;  2FHT A;  4HAE A;  3RAX A;  2BCO A;  3BJY A;  5JAV A;  1GSH A;  1Y1W A;  3F8T A;  1M4V A;  4RKL A;  1TS3 A;  3I90 A;  4S3S A;  2KCN A;  3H4D A;  2DNC A;  2KVM A;  3I8Z A;  4P74 A;  3RV4 A;  2A5H A;  1GUS A;  1O7Y A;  2YZN A;  1EZ6 A;  4ABN A;  1HR0 Q;  1PA6 A;  2AUK A;  4TQR A;  3PR5 B;  3OSO A;  5KFS A;  1IW7 D;  2G9D A;  3HEJ A;  2ASL A;  3F2D A;  3KDF B;  1LT3 D;  2CHB D;  5K2M A;  4LF6 L;  4DR3 H;  5E1F A;  2MO0 A;  3KK7 A;  2A1A A;  3U9O A;  3FP9 A;  2NN6 G;  4LF4 L;  4LSA A;  3G6V A;  5EPJ A;  1CQF A;  1SDF A;  4IUN A;  5FO8 B;  3NP8 A;  1WTX A;  3OMC A;  1FGU A;  4LUV A;  3HS0 C;  1NMG A;  2Z8L A;  4A3J G;  4DUZ H;  1VQO A;  1TS5 A;  3CQZ H;  1I4G A;  3H15 A;  5JJL A;  2VS1 A;  3L4K A;  4C3I H;  1D5Z C;  1KL9 A;  4UP7 A;  3E3X A;  5KFI A;  1SYB A;  1KD1 C;  4RCN A;  1Y1W H;  5CC4 A;  3EN2 A;  3D8G A;  2R7D A;  1PH1 A;  4DR3 Q;  2J7Z A;  3HZX A;  5IYC G;  1BJT A;  3BQ2 A;  1RTO A;  1XMQ H;  2ZM6 H;  1M1K C;  2JA8 B;  1CZG A;  4IPH A;  2ASJ A;  4EEQ A;  3V6K A;  5J1Z A;  2W7P A;  4CDE C;  5FLX E;  1ENA A;  1KDA A;  5KT2 A;  4U68 A;  4DR4 H;  4DV2 Q;  1TWC B;  1ML0 D;  1B33 N;  1SNC A;  4LF9 Q;  3U9T A;  2HT1 A;  1I6U A;  3L9A X;  2JA5 A;  3I56 A;  2ATW A;  4BA1 I;  2HHH H;  2JEG A;  2JA7 G;  5KFW A;  4MHE A;  3PIP 3;  3K81 C;  4HTH A;  1XTD A;  3J81 j;  5JVG 3;  1Q90 A;  4POF A;  2OCE A;  3C0F B;  2ZM6 Q;  4OWX B;  5IGE A;  1ENC A;  1SN8 A;  1X3P A;  1K8G A;  4FXK C;  4F8M A;  4Y7N H;  3AFQ A;  4CBV A;  3G4S A;  2RA4 A;  1PH7 A;  3T1H H;  2V4D A;  2B29 A;  4DXF A;  5H80 A;  1RD9 D;  5JUM A;  2UXB Q;  4DR6 H;  4QF4 A;  4DR2 L;  2QEJ C;  1DV1 A;  4ECX A;  2IMW P;  3N6X A;  5C6A A;  4A3D G;  1EY8 A;  4HR7 A;  3TS2 A;  3MXP A;  3M9B A;  2NN6 H;  3K5I A;  1S10 A;  4OXP A;  1MIU A;  2RDG A;  4XT1 B;  1A8V A;  1A3V A;  1V43 A;  2WB1 G;  2B63 G;  5EZY F;  5I6W A;  4JI8 L;  2ZXP A;  1DYQ A;  1DV2 A;  1N48 A;  1X55 A;  5IGB A;  4C1N I;  3GQC A;  5JH7 F;  5I9P A;  3QWN A;  1X65 A;  4X64 L;  2JA5 B;  1JXL A;  1EL0 A;  1XPR A;  5EWE A;  4HIK A;  3K5L A;  1AH9 A;  2IWH A;  5M3M G;  3GTM B;  5KFL A;  1ET9 A;  4HJ7 A;  1JOK A;  4RHS A;  4JV1 A;  3RB6 A;  1XPU A;  2OT2 A;  2CH4 A;  3S14 H;  2F0J A;  1YNX A;  2E2I A;  2H4O A;  1NJI C;  3GV7 B;  5DQH A;  1RK5 A;  2UU9 L;  1LO5 D;  2Z4H A;  5ISR A;  5HV6 A;  3MXN A;  2KCC A;  4RG1 A;  3D4W A;  1QIL A;  5TSS A;  1N32 L;  2WDT A;  1SFO H;  3KAL A;  4TUY F;  3WO1 A;  2E2H H;  3G6X A;  3OIQ A;  2W6P A;  5I9O A;  4DR5 H;  3S17 H;  1ROD A;  3EVQ A;  4KK7 A;  2JA7 H;  3GTP A;  4MV6 A;  3NWT A;  1RKN A;  2W9C A;  1ZYR C;  1BXR A;  3R93 A;  1K83 A;  2B2Y A;  5LL6 S;  3DF7 A;  4RCO A;  5KFV A;  3OOC A;  3FMC A;  4JI3 L;  4RNN A;  2VUM G;  4K2L A;  2F0M A;  3M4O H;  2PW5 A;  1JCK B;  4O4H F;  3S15 H;  3PO2 G;  1EIH A;  4ECV A;  1SNO A;  2I8C A;  1BCP F;  1K28 A;  2JK8 A;  4I7Z C;  4MV9 A;  2FK2 A;  4BBS B;  3MAQ A;  2K4K A;  3TZU A;  4TV8 F;  2FK1 A;  2HCI A;  2KEN A;  3WOF A;  1I7N A;  4EBD A;  1Z6H A;  2E2I H;  4XTC S;  3RJ0 A;  3TIN A;  4UP8 A;  1B2T A;  1VQH A;  5KG5 A;  1T36 A;  3W1G A;  2NWG A;  4QW9 A;  4EGV A;  3N43 B;  1BBW A;  2PNR C;  4Q8E A;  1EQR A;  1QNU A;  2ZDG A;  1JR0 D;  2EY2 A;  3N52 A;  4A4I A;  3HOX H;  3HOV H;  3AQQ A;  4C56 C;  3K3V A;  1Q12 A;  1A15 A;  1HZB A;  1NE3 A;  4R8N A;  5FLM G;  3BQ0 A;  3RN5 A;  5DNF A;  4DV6 H;  2GLT A;  1K83 B;  5M3M H;  1EY0 A;  5JEA J;  1C3O A;  3U4Z A;  1QOH A;  5JOB A;  2NVT H;  4ODG A;  4A3M G;  1PRT B;  1GXD C;  4H0L C;  4U7C A;  4UDU C;  3L4J A;  1LV9 A;  2ZXR A;  3A56 A;  4LFA Q;  3F8N A;  1XNR L;  4GLA C;  2N49 A;  1G29 1;  4V19 0;  4OX9 Q;  3J81 W;  1DXM A;  2F0O A;  2RQX A;  3H91 A;  4J8Q A;  4IUQ A;  4KN4 C;  4LH6 A;  1X3Q A;  4IZ8 A;  3KHR A;  1SYF A;  4A3F B;  1BCP C;  2KEC A;  3AB9 A;  2XGQ A;  3UI2 A;  5D65 A;  1L1O C;  1ASZ A;  4U67 3;  3TII A;  2ASD A;  5DG8 A;  4GN3 B;  1EIY B;  4B3M L;  3GTJ A;  1CK1 A;  4X3S A;  2J4X A;  3FKI A;  2VOB A;  3EFX D;  2VUM H;  4IUV A;  1SR3 A;  5A2Q E;  1S72 A;  1W96 A;  3I4N B;  4MNO A;  3FDS A;  5EBC A;  1HNZ L;  2NVY H;  1WFQ A;  3G6E A;  4LF6 Q;  3PO2 H;  3T1Y L;  1SE8 A;  4N9P A;  4NW2 A;  2UXD L;  1BR9 A;  5D1O A;  5CBE E;  4PZ6 A;  4WD3 A;  3STB C;  1A3T A;  4ULL A;  3T53 B;  4ZKC B;  1SYG A;  2IX1 A;  5G3L D;  1SLJ A;  3QIA A;  4ED6 A;  4EQO A;  2OQ0 A;  5IT9 W;  1GOZ A;  1C0A A;  1EEF D;  2F0L A;  1BF4 A;  2K52 A;  3ONA B;  3SE7 A;  2F0I A;  4E6I A;  2DJF C;  4IR9 A;  3KF6 A;  2HVR A;  2RF4 A;  1WTV A;  5DLQ E;  2WAQ E;  3LWU A;  4EBE A;  2K5W A;  4DV0 L;  2ZT9 C;  1Y8N B;  3MWY W;  3GTO A;  1HH2 P;  4B3T L;  5FLM H;  2R7F A;  5CV6 A;  1OXX K;  4LFC L;  2P0A A;  4O4I F;  4F87 A;  4NLG A;  3FKI H;  4XYO A;  2YCH A;  2C2D A;  2VB2 X;  4A3M H;  3GTJ B;  1QNK A;  4RA8 A;  5F2D A;  1TWF A;  3GO5 A;  4ED1 A;  1DGS A;  1U4P A;  1NUC A;  4X62 L;  1L1O A;  4CJ2 C;  1I7L A;  4H44 C;  5DAU A;  3I70 A;  3LWB A;  1JIH A;  1JKJ B;  4HCE A;  1SYX B;  1I50 A;  4NP5 A;  2VQF L;  3UDG A;  4K5V A;  3GIJ A;  3PUX A;  1EY9 A;  4A3K G;  4A3B B;  1DOK A;  3GTL B;  2EJF C;  5EPK A;  1K73 C;  4DUY L;  4O3N A;  5CA0 F;  3VYR A;  4JG2 A;  1PTO F;  2L11 A;  4P2C B;  3BS1 A;  2MUY A;  4K6L A;  1EZ1 A;  3JAM W;  5L1L A;  3QOJ A;  4O3S A;  2D0O A;  2I0Q A;  2ZTD A;  1V51 A;  4X64 H;  4DR2 Q;  1HPC A;  3HOZ G;  2X6L A;  1ZET A;  3PCO B;  2CQA A;  1OXV A;  3G8C A;  4ZAI A;  4BY7 B;  3RAQ A;  4NMZ A;  5FLX c;  2Y0S B;  3RUZ A;  3BDL A;  4A3G H;  5M5W B;  5D14 A;  5KNB A;  4WBN F;  1JX4 A;  3SGI A;  4DK3 C;  2CKZ B;  3HOY G;  1PH8 A;  3CAM A;  1IYV A;  3X3M A;  4JI8 Q;  2IP4 A;  3HKZ A;  2Y0S E;  2UU9 H;  3J81 c;  1PFS A;  4J9R A;  2KHS A;  3HG9 A;  1TWF H;  3UE0 A;  4YAK B;  2CH4 W;  1IL8 A;  1MI2 A;  1VQ6 A;  1AUX A;  1KAB A;  1SMY C;  4X64 Q;  3H09 A;  1I94 L;  4QIW A;  3R3O A;  3GTG B;  4JI4 L;  1L0X B;  1UEA B;  1E4G T;  5LMU L;  3HOW G;  4FU0 A;  5DLF A;  3MFG A;  1EYD A;  1Q46 A;  1XDN A;  1ICF B;  2OF1 A;  3H94 A;  1PX2 A;  2VZA A;  2HJW A;  2R8K A;  4K0K H;  1UE7 A;  2V4R A;  1IBL H;  1QZG A;  1CM9 A;  3GIK A;  2L15 A;  3K7A H;  3NPP A;  1W3S A;  3I3C A;  4JI3 H;  1GUN A;  1A0I A;  4JUZ A;  1YHB A;  2UU9 Q;  2YU9 B;  1PTO C;  2CW7 A;  2JYO A;  3M3Y H;  3EPI A;  3J80 W;  4KN7 C;  2KSW A;  3S2H H;  4ILW A;  1KEE A;  2F0V A;  1N32 Q;  5C5J A;  2D2C C;  2EYM A;  4LF5 L;  1SSO A;  2NVQ B;  5KG4 A;  2RDH A;  1I4R A;  5D8D A;  2XCL A;  1LLR D;  3I4M G;  3Q8P B;  3U50 C;  4NKL A;  3RLO A;  3Q8R B;  1SEB D;  4MA0 A;  2JJQ A;  4K8J A;  5J22 A;  3V6H A;  5D3D A;  3PUZ A;  4JI3 Q;  2NU6 B;  2ZTE A;  3HKZ B;  1I4H A;  3HOU G;  2R7Z G;  5C4X B;  4RUC A;  3R5X A;  3H3V C;  1R4Q B;  4KTA A;  4P73 A;  1I3Q B;  3M4Y A;  3C1F A;  4QMG A;  2L55 A;  5IYZ F;  3AYH B;  3CCS A;  1H9S A;  3HOZ H;  3A8J E;  3HKS A;  2W57 A;  3PF4 A;  2PCF B;  4HJ5 A;  3OIP A;  2DJG C;  3GQB A;  4YAJ B;  3SR1 A;  4JOI A;  3KHH A;  1JB3 A;  3IFD A;  1SND A;  2D62 A;  4RZR A;  1XNR H;  1EQV A;  5KGU A;  4JPB W;  4RAZ A;  4UFZ A;  1CKO A;  2E75 C;  1TY2 A;  5KNC A;  4EGQ A;  1EY5 A;  4IFD I;  3J7A V;  2YTX A;  5LA6 F;  4ZCK A;  2K50 A;  1CQI B;  4JI6 H;  3PR4 A;  4YQW A;  1AN8 A;  1RJR A;  2IHF A;  2VQE L;  4K5W A;  3HOW H;  3G7L A;  1GJX A;  4DL6 A;  4PDB A;  4DUZ L;  4FF3 A;  4G7H C;  4FS1 A;  4IOC A;  4IUR A;  4A3I H;  4FF2 A;  4XZ3 B;  5EWG A;  1RTN A;  2QIL A;  4TV9 F;  4KHP H;  4RFB A;  2JXM B;  1I6H H;  1XNR Q;  1AUV A;  4AQY H;  1VDZ A;  2IPK D;  3BVM A;  4XDX A;  3QZ7 A;  1BO0 A;  3KTM A;  1HNZ H;  1E4E B;  1AZP A;  1VMP A;  2GN5 A;  1CHQ D;  2FMA A;  2O5I C;  2P5Z X;  3PO3 H;  4PG3 A;  2HIV A;  4A3E G;  2MQH A;  1XMQ L;  3J7A F;  2YL2 A;  4ZOL F;  2Z1C A;  3KHG A;  1WSC A;  2F4V H;  1EEI D;  4DU9 A;  1O78 A;  1ZHS A;  1LAB A;  4ZRZ A;  4ID6 A;  3RTX A;  1LTI D;  3J81 L;  2HQL A;  2RGV A;  4IZO A;  4DR4 L;  4F4W A;  2NU8 B;  3I4M H;  3RZO B;  2F0F A;  1VS0 A;  3BVG A;  4ECU A;  2YV5 A;  4ED8 A;  1VQ9 A;  4A93 H;  4B3M Q;  2XVS A;  2HHH L;  1GUW A;  1WCM A;  3HOU H;  2R7Z H;  3MEF A;  3MR2 A;  5EKI A;  1HNZ Q;  5DGA A;  2DPI A;  1SE4 A;  5KT5 A;  4JBK A;  3NEN A;  5FOB B;  1GUO A;  4A75 A;  3T1Y Q;  2UXD Q;  4DV0 H;  1GVP A;  1CKM A;  1U4L A;  1PTO H;  1C4Q A;  4ED2 A;  1TA8 A;  3HXL A;  1RK6 A;  5KFC A;  1IOV A;  5BMV F;  3S1R B;  4EG0 A;  1LTB D;  4ED3 A;  3T1H L;  1EIG A;  1LYL A;  2QW7 A;  3J80 c;  5KG2 A;  4IAL A;  3RN2 A;  4DR6 L;  1OWT A;  4MTD A;  5IYD G;  3J7A K;  3S9W A;  5IGG A;  4R1J A;  4QGU A;  1KIX A;  1O7L A;  3EJI A;  2AKW B;  3K5H A;  4K14 A;  1F2L A;  1PXU A;  4N8X 1;  1YBY A;  5IT9 L;  1Y69 U;  4DV0 Q;  3CRL C;  4O3P A;  3V4Z A;  3RZD B;  1MKH A;  1AW7 A;  4YCU A;  1A2U A;  4B3T Q;  3GTQ B;  4DUY H;  3IKJ A;  3UDX A;  1FNW A;  3RB0 A;  1S9F A;  3JAM i;  3DXJ C;  2VL6 A;  4MIU A;  1B9N A;  3K5N A;  5KFY A;  3OWE B;  4RAU C;  4C5C A;  1EWH A;  1CQV A;  4QQB X;  1PV4 A;  3GTK A;  3T4A C;  2R92 B;  3DWA A;  4X62 Q;  3MR3 A;  1SYC A;  5ELC A;  2XGT A;  2YYA A;  1S0N A;  3MR6 A;  4M9U A;  4LF8 L;  2VQF Q;  1DOM A;  1NAP A;  3F2B A;  4K5X A;  4A3E H;  3QZ8 A;  1JMC A;  3GP7 A;  5FD6 A;  1RCV D;  3G6J B;  2N55 A;  1OXU A;  1U5K A;  3FMA A;  5T14 A;  2RKS A;  3O13 A;  4DUY Q;  1QJO A;  3DMU A;  3ERO A;  5KFX A;  4JVZ A;  4B9X A;  4KY6 A;  4JI1 H;  5KG3 A;  2JQO A;  5CV7 A;  4YB8 B;  4C3H B;  3E6Z X;  3LX0 A;  2BOS A;  2ALZ A;  2MPM A;  2A8V A;  3PV0 A;  4DR5 L;  5KFU A;  2KCM A;  1Q8I A;  3T5J A;  1I94 H;  2PN1 A;  4DAV A;  3CCU A;  5LMU H;  1FKA H;  1TWH B;  3SK4 A;  3L0O A;  1DJR D;  4YWM A;  2R87 A;  2B2U C;  1A3U A;  1QVC A;  2AUJ D;  3T5K A;  3W2D A;  3NEL A;  3BDC A;  3I4O A;  4ECR A;  2EVB A;  2KJX A;  4C3J H;  4Q0Y A;  1PFM A;  4WJ4 A;  4ECY A;  4NXM H;  3S1Q B;  2K5V A;  2W71 A;  1GSA A;  1Y1W G;  2CFM A;  5IGD A;  3Q8Q B;  1RJQ A;  3H40 A;  1TVX A;  4KKS A;  3HB9 A;  3OYY A;  2A69 C;  3A55 A;  3GTK H;  4J9M A;  5FO9 B;  4IFD J;  2Z6B A;  4ED0 A;  4JI5 L;  3UE1 A;  1I94 Q;  4J15 A;  5LMU Q;  1PZJ D;  3P1H A;  4NDX A;  2KHJ A;  1IKM A;  1LUZ A;  1S5F D;  4IRC A;  4OHJ A;  5C4J B;  2XCP A;  4L6T B;  2K32 A;  1GKH A;  3WOE A;  4IRK A;  2JEI A;  1O7I A;  1VQP A;  4DL3 A;  1HCZ A;  2ATL A;  1PH5 A;  1QUQ B;  2VXW A;  5C0X G;  2PBZ A;  3M9N B;  2R8H A;  4JI0 H;  2IY5 B;  3BAA A;  1W6J A;  2HCC A;  1Y1V B;  1IBM L;  5M3F B;  1YZ6 A;  3KFU A;  1X3G A;  2FJ2 A;  5LOV F;  2ICI A;  4LF5 Q;  1PMR A;  4ZKB B;  4HSP A;  5BN5 A;  4DV6 L;  2NU9 B;  2A74 C;  4R9W A;  5J39 A;  4NB3 A;  1JDE A;  4XYL B;  4RB3 C;  2WIN B;  3H0G B;  3J80 L;  2W6Q A;  1TWC A;  3TIG A;  5FJ8 G;  4JV0 A;  1Z2P X;  2RCN A;  2WFW A;  2MO1 A;  3TZD A;  1TT2 A;  2W9B B;  2CWP A;  4MTE A;  1MJC A;  1VQI A;  5M5X H;  1B3A A;  3EIV A;  1OTC A;  1JJ2 A;  1U0L A;  4HIO A;  1U9R A;  2XN9 C;  2DUD A;  4ZUI A;  4E4T A;  2B2U A;  5C1O A;  2R82 A;  3R2I A;  2MGS A;  4LAA A;  4CGY B;  1MJE A;  3TN2 A;  2A6E C;  1WD1 A;  1V1O A;  4GKJ H;  1O75 A;  2VQE H;  1AZQ A;  4MA5 A;  1ULZ A;  2JA5 G;  1BCP D;  1MSG A;  5FK9 C;  5JJZ A;  1WTW A;  1VBG A;  2YS6 A;  1PRT F;  1SE3 A;  3HP3 A;  1KXL A;  2E2J H;  1V1Q A;  1R9T A;  2IT1 A;  3CPW A;  4KY7 A;  1J9O A;  1XXG A;  4XT3 B;  1RJP A;  3FHW A;  2LY7 A;  4EQ5 A;  1RYR A;  4X66 H;  5KIX A;  3RF2 A;  1VQF A;  2F3V A;  2VB3 X;  3GV6 A;  4I65 A;  2NUC A;  5BN3 A;  2CQO A;  2VQE Q;  2K05 A;  1TWC H;  4LJZ C;  4DUZ Q;  4XX0 B;  2UVW A;  4DK6 C;  3TRE A;  4LW1 A;  3M9M B;  3VYT A;  5M5Y B;  4IOA A;  2R84 A;  3BAB A;  4NXN H;  2I5H A;  1F9S A;  2E76 C;  1BNZ A;  4XIG S;  2LFN A;  4YCV A;  4C3I B;  3BA9 A;  3VDY A;  1RJT A;  2MNA A;  3VPC A;  2V58 A;  4IJL A;  2JA6 B;  2CW0 D;  2EZV A;  5C0X H;  5IOD A;  3GTM A;  4QWB A;  1XMQ Q;  2RDI A;  1QCB D;  2M9V A;  2LXK A;  2F0T A;  1PFN A;  1Q7Y C;  2PQA B;  5ELD A;  3I91 A;  2K1B A;  1VKZ A;  4R4I A;  2B2Y C;  2R7M A;  1QWY A;  4DR4 Q;  1KJ8 A;  5LMN H;  4XQN A;  1TY0 A;  5FJ8 H;  4N8F A;  5BPF A;  3EA6 A;  4UCO A;  1GGO A;  4IQZ A;  1PRT C;  3D6C A;  3U58 A;  1JOO A;  1R9T B;  4OWW B;  2W6M A;  1KLU D;  1KDC A;  1MSH A;  2HHH Q;  4K6D A;  3QB3 A;  4DL2 A;  3K6O A;  3GV8 B;  2CW8 A;  1IOW A;  4M1U B;  4IPC A;  1CSP A;  3OMG A;  1E2V A;  1GHJ A;  1NBW A;  2F4I A;  1HFN A;  4CJ0 B;  2UUB H;  3ZJY C;  4C2M B;  4EFB A;  1D1I A;  3HOX G;  1EUJ A;  3CP0 A;  4DNR B;  3T1H Q;  2JA5 H;  3HOV G;  3PW7 A;  2F0D A;  1AE3 A;  2B2V C;  4RHR A;  4A3C H;  4DR6 Q;  4UCV A;  2DN8 A;  4FBT A;  1O7Z A;  2A6H D;  3UQ8 A;  4FNF A; 
#chains in the Genus database with same CATH homology
 2FXQ A;  3PSI A;  5C4J H;  1Z9F A;  2E5L Q;  2K52 A;  1VQ5 A;  3HOY H;  4GS3 A;  1PH3 A;  2R92 G;  4APV A;  3KF6 A;  5HGQ A;  5J3B A;  1P16 A;  2RF4 A;  4NXM Q;  3W1B A;  5DLQ E;  2WAQ E;  4DR3 L;  1KQS A;  1IBK Q;  2E8G A;  4JYA Q;  2AWO A;  4DV0 L;  3BZK A;  3S24 A;  1UE6 A;  1HH2 P;  3W5O A;  5FLM H;  2R7F A;  3CCV A;  1OXX K;  4LWC A;  4LFC L;  3CME A;  4B3T L;  4UP9 A;  4DR7 Q;  4O2D A;  3TS0 A;  1N34 L;  3FKI H;  4DV2 L;  1A63 A;  4A3M H;  3JAM c;  3OTO L;  2ALY B;  4QY7 A;  1Q81 C;  4LF9 L;  3GO5 A;  1DGS A;  3K80 C;  4YHH Q;  3EBE A;  4X62 L;  4GOP A;  1L1O A;  3TEH B;  4YY3 L;  4HID A;  5BR8 Q;  1VCI A;  4HIM A;  4K0K L;  3NBH B;  5C0X J;  4LF8 Q;  4DKA C;  1IBL L;  1VQN A;  2OTJ A;  4YWK A;  2VQF L;  3UDG A;  4X6A H;  3PUX A;  4HJA A;  4A3K G;  2ID0 A;  1N36 Q;  3CPF A;  3I4N G;  3CC4 A;  3BU2 A;  1VQE A;  4JV5 Q;  2ZM6 L;  4JI0 Q;  1K73 C;  4DUY L;  3I7F A;  1YHA A;  3M4P A;  4LUZ A;  3ICE A;  4JG2 A;  2MFI A;  4DAM A;  2I5M X;  1OXT A;  4MZ9 A;  4ME3 A;  5EAY A;  4YCW A;  4BBS H;  2KHI A;  2PQA A;  2Z6K C;  2D0O A;  1X6O A;  2ZTD A;  4PZ8 A;  3NEM A;  3CCM A;  4DR5 Q;  4DR2 Q;  1HZ9 A;  3CF5 A;  1M90 C;  3HOZ G;  2UXB L;  3PCO B;  1OXV A;  1VQB A;  2Z0S A;  2ASB A;  4BBR G;  1W2B A;  2Q2T A;  5FLX c;  3KLW A;  4A3C G;  1Z47 A;  1XPO A;  1VQK A;  1NY4 A;  4A3G H;  5K36 G;  1IL2 A;  3SGI A;  2H5X A;  1X54 A;  4POG A;  4B3R Q;  4DK3 C;  2CKZ B;  3HOY G;  1PH8 A;  3CAM A;  1PH4 A;  2F52 A;  4JI8 Q;  1YI2 A;  5IYB H;  2Y0S E;  1X56 A;  4DPG A;  1HZA A;  3J81 c;  1PFS A;  3K8A A;  5ELN A;  2PI2 A;  2JA8 H;  1TWF H;  2B3G A;  3UE0 A;  1N9W A;  2RHQ B;  4R4O A;  1VQ6 A;  3GTP H;  4GKJ Q;  1Y1V G;  4QL5 A;  4X64 Q;  5M3F G;  4JI5 Q;  1XNQ L;  1K83 H;  1I94 L;  2AHO B;  1B8A A;  4OWT B;  2VW9 A;  5M5Y H;  4JI4 L;  2UXC Q;  5LMU L;  3STB D;  3HOW G;  2R92 H;  4O0A A;  1Q46 A;  3FKI G;  2AWN A;  4YWL A;  1EQQ A;  2YYZ A;  1VQG A;  2A19 A;  4JBM A;  4AYB E;  5JEA G;  1V9P A;  3H0G G;  2VZA A;  4DR1 Q;  2JA6 H;  1UE7 A;  1QZG A;  1GD7 A;  2L15 A;  5GAE C;  3K7A H;  1Q1B A;  3G48 A;  5ELO A;  1W3S A;  3CCL A;  1VQC A;  1A0I A;  1BKB A;  1YHB A;  2UU9 Q;  4X66 Q;  4IO9 A;  4LFC Q;  4A3F H;  5C3E G;  1QZH A;  1IBM Q;  3M3Y H;  1FJG L;  3CXC A;  2R93 G;  2WB1 E;  3L2P A;  4JI6 L;  3S2H H;  5IWA L;  1Q1E A;  5GAH C;  2IHE A;  4C3H H;  4JI2 L;  1N32 Q;  4LF5 L;  1X3F A;  3JC6 6;  4DV6 Q;  1I5F A;  4R4C A;  2LXJ A;  4MTN A;  5GQO A;  5AJ3 L;  4DV7 L;  1R9T H;  2WP8 J;  1A62 A;  1NMF A;  4YY3 Q;  1J6Q A;  2NZH A;  4NXN Q;  1UE1 A;  4BBS G;  3I4M G;  1TWA H;  3U50 C;  4KHP L;  3RLO A;  3PUY A;  3RLF A;  2Z6K A;  2JJQ A;  5GAD C;  3I4N H;  1K3R A;  4R4T A;  4AQY L;  1SRU A;  1T9H A;  3PUZ A;  4JI3 Q;  2ZTE A;  3HOU G;  2R7Z G;  4UY8 C;  1D7Q A;  4A3G G;  4P73 A;  2JEB I;  3LGJ A;  2XTI A;  5LMN W;  1J5E Q;  2F4V L;  4WJ3 M;  3CCJ A;  3AFP A;  4C2M H;  4KLK A;  3AYH B;  3CCS A;  4Y52 H;  1TXY A;  3HOZ H;  1EIF A;  5IYB G;  4JI7 Q;  1N33 L;  3PIO A;  2F3I A;  1KRS A;  3HKS A;  1L2F A;  2PI2 E;  5IP9 G;  5LMN Q;  1GO3 E;  2BH2 A;  3PF4 A;  4AYB G;  4BBR H;  1X3E A;  4HJ5 A;  3OW2 A;  4HJ8 A;  3CCR A;  4JOI A;  1VQ8 A;  3M7N A;  2BA1 A;  4IFD G;  3GTM H;  1ASY A;  3L7Z C;  1YEZ A;  3PUV A;  2D62 A;  2ZTC A;  5JJK A;  2NZO A;  3ULJ A;  3M85 A;  1G6P A;  1BBU A;  3KDF A;  1CKO A;  4H02 A;  4KI0 A;  2UUC Q;  4DV4 Q;  4LF7 Q;  2JA6 G;  1VQA A;  1K9M C;  4DV1 L;  5C44 G;  4A3J H;  4IFD I;  2YTX A;  2JE6 I;  3CC7 A;  1Y1V H;  1C9O A;  2EIF A;  1CKN A;  2K50 A;  3PUW A;  5M3F H;  1YIJ A;  5E7N A;  2CCZ A;  2UUA Q;  2UUB Q;  3A74 A;  2IHF A;  2VQE L;  2ZJP A;  1E1T A;  3DM3 A;  4BY1 G;  3HOW H;  4A3F G;  4DUZ L;  5IYD H;  3CW2 C;  3GTJ H;  2OTL A;  4JI4 Q;  4HJ9 A;  4IOC A;  4B3S L;  4GKK L;  2EQS A;  3E0E A;  4A3I H;  3H0G H;  3KJP A;  3F1Z A;  2I5L X;  1PYB A;  4X65 Q;  5IYC H;  3G71 A;  1XJV A;  3DLL A;  1I6H H;  4AIM A;  4LFA L;  1XNR Q;  3TQY A;  4A3B H;  4OX9 L;  4FDB A;  3CMA A;  5C3E H;  2GN5 A;  3CC2 A;  2R93 H;  2QEX A;  4JBJ A;  3HKZ G;  3PO3 H;  4PG3 A;  2HIV A;  3F8T A;  2MQH A;  4A3E G;  4RMF A;  1XMQ L;  4LFB Q;  5IY0 A;  3ER0 A;  4GN5 A;  1FL0 A;  1HR0 W;  1E1O A;  3K7U C;  4A76 A;  2HQL A;  4P74 A;  1WJJ A;  1VQD A;  4DR4 L;  1XMO L;  3I4M H;  1VS0 A;  4P72 A;  2YV5 A;  1VQ9 A;  4A93 H;  2YTY A;  4B3M Q;  1HR0 Q;  1PA6 A;  1PYS B;  2HHH L;  2JA9 A;  2DGY A;  2IX0 A;  5M5W H;  2WAQ G;  3KDF B;  3F2D A;  3PF5 A;  1HNX L;  2JEA I;  2R7Z H;  4DV3 L;  3MEF A;  3HOU H;  1HNZ Q;  3GTO H;  1QVF A;  4JBK A;  4LF6 L;  3NEN A;  3T1Y Q;  4UPA A;  4A75 A;  1CUK A;  2MO0 A;  1CKN B;  2UXD Q;  1GVP A;  2A1A A;  3FP9 A;  1CKM A;  2NN6 G;  4DV5 L;  1PHJ A;  4LF4 L;  2Q2I A;  1VQ7 A;  4TQU S;  1PH9 A;  3S2D H;  4L5T A;  1FGU A;  4LUV A;  5IP9 H;  4JI1 L;  4L5S A;  1NMG A;  4JOI C;  4A3J G;  1YHQ A;  3T1H L;  3GTG H;  1LYL A;  4A3D H;  3J80 c;  3D31 A;  3RN2 A;  1VQO A;  2GVB A;  4DR6 L;  1I50 H;  3CQZ H;  4JBW A;  5JJL A;  5IYD G;  3H15 A;  1VQJ A;  2VS1 A;  4C3I H;  1KL9 A;  4UP7 A;  2E5L L;  4R1J A;  4QGU A;  4A3I G;  1KD1 C;  1KIX A;  1Y1W H;  2B63 H;  5JJI A;  3CCE A;  3EN2 A;  3IRB A;  2R7D A;  4GLX A;  2AKW B;  1CSQ A;  2VY3 A;  3MXN B;  5C44 H;  1PH1 A;  4NXM L;  1IZ6 A;  1YBY A;  2QA4 A;  4DR3 Q;  4JYA L;  5IYC G;  4DV0 Q;  3CCQ A;  2KCT A;  1JB7 A;  1IBK L;  2YU9 H;  4ALP A;  1MKH A;  4YCU A;  4B3T Q;  1M1K C;  4A3B G;  3PGZ A;  4BY1 H;  2NVX H;  1LM0 A;  4R4Q A;  4A3L H;  1JT8 A;  3UDX A;  1FVI A;  4IPH A;  3JAM i;  3PO3 G;  4DR7 L;  2VL6 A;  2NVQ H;  3J7A 5;  1GM5 A;  3KJO A;  1N34 Q;  3S1M H;  2K5N A;  4DV2 Q;  4LUO A;  1OXS C;  3OTO Q;  4GNX B;  4LF9 Q;  5IP7 G;  2HT1 A;  1PV4 A;  2Q2H A;  1UEB A;  4DAY B;  3A5Z B;  3PIP A;  1Y14 B;  4YHH L;  4X62 Q;  3I56 A;  4BA1 I;  2ATW A;  2JA7 G;  1KAW A;  2XGT A;  5BR8 L;  4K0K Q;  4A93 G;  3K81 C;  1IBL Q;  1XTD A;  4LF8 L;  2VQF Q;  4LNQ A;  2GVA A;  3J81 j;  1E7Z A;  3F2B A;  4A3E H;  4BY7 G;  2Y0S G;  5C4X H;  1JMC A;  1N36 L;  1NTG A;  4POF A;  2OCE A;  3K0X A;  1OXU A;  1U5K A;  2ZM6 Q;  4OWX B;  4JV5 L;  4JI0 L;  3A5U A;  1VQL A;  4DUY Q;  1WI5 A;  1SN8 A;  3HFZ B;  2N3S A;  1PH6 A;  1K8G A;  1B7Y B;  4Y7N H;  4BA2 I;  2JQO A;  3AFQ A;  3RR5 A;  3G4S A;  4GNX C;  1PH7 A;  5GRO A;  3U4V A;  4L5R C;  2B29 A;  1YJ9 A;  1YVC A;  2A8V A;  3B6Y A;  3PV0 A;  4DR5 L;  1Q82 C;  2KCM A;  2UXB Q;  4DR2 L;  1PH2 A;  3CCU A;  3L0O A;  3UDF A;  4YWM A;  3I55 A;  4A3D G;  1QVC A;  1BVS A;  3NEL A;  3M4Q A;  1K0R A;  3I4O A;  1KC8 C;  3TS2 A;  4C3J H;  1D8L A;  2YTV A;  1Q86 C;  3M9B A;  4WJ4 A;  1S40 A;  4OXP A;  1MIU A;  2K5V A;  2ZJR A;  4B3R L;  3J81 i;  1A8V A;  1V43 A;  2WB1 G;  1Y1W G;  4LF4 Q;  2B63 G;  2CFM A;  4JI8 L;  5H1S E;  2AMC B;  1LTL A;  1X55 A;  1UWV A;  3OYY A;  1KRT A;  3GTK H;  4GKJ L;  4IFD J;  2I0Q A;  1XNQ Q;  1X65 A;  1JE5 A;  4DNI A;  4JI5 L;  3UE1 A;  4X64 L;  1I94 Q;  1N8R C;  4A3L G;  2UXC L;  1XPR A;  4J15 A;  5LMU Q;  1QVG A;  2KHJ A;  2N8N A;  1LUZ A;  2K5H A;  4HIK A;  3A0J A;  1AH9 A;  2PMZ E;  1WCM G;  5M3M G;  1X9N A;  4HJ7 A;  3E9H A;  4DR1 L;  1GKH A;  3H3V I;  1XPU A;  2OWO A;  1O7I A;  1VQP A;  3S14 H;  1E24 A;  1YNX A;  3ULL A;  4PZ7 A;  1NJI C;  3GTL H;  1PH5 A;  1QUQ B;  5C0X G;  1HNW L;  2UU9 L;  2IY5 B;  4X66 L;  4IJH A;  4RG1 A;  1FJG Q;  5C4X G;  1IBM L;  4JI6 Q;  2V1C C;  1YZ6 A;  3KFU A;  5IWA Q;  4BXX G;  3KYH C;  4JI2 Q;  1X3G A;  1N32 L;  1SFO H;  4LF5 Q;  2E2H H;  5IP7 H;  1RIP A;  1E3P A;  2K75 A;  5IE8 A;  3RZO H;  2QGQ A;  3Q8D A;  3F2C A;  3S17 H;  4DV6 L;  4DV7 Q;  5AJ3 Q;  1YJW A;  2JA7 H;  5C0X I;  4NB3 A;  1SMX A;  3GDE A;  4NXN L;  4GN4 B;  2HIX A;  2RHS B;  4L5Q A;  4AH6 A;  3ERS X;  5FJ8 G;  4BY7 H;  1IYJ B;  2ES2 A;  4GNX A;  4KHP Q;  2VNU D;  2RCN A;  2WFW A;  2MO1 A;  1UE5 A;  2CWP A;  4AQY Q;  1MJC A;  1VQI A;  5M5X H;  3EIV A;  1HJP A;  3BJU A;  1OTC A;  4JI3 L;  4JC0 A;  1JJ2 A;  1U0L A;  2VUM G;  1P8L A;  4HIO A;  5GAG C;  2DUD A;  1YIT A;  4QQB X;  3M4O H;  3UDI A;  2F4V Q;  1J5E L;  3S15 H;  4NPS A;  3PO2 G;  1MJE A;  1HZC A;  3S1R H;  1N33 Q;  2JK8 A;  4JI7 L;  5LMN L;  4PMW A;  2JA5 G;  1SRO A;  2K4K A;  3J7Z C;  1EFW A;  2BA0 A;  2KEN A;  2NN6 I;  3KF6 B;  3WWV A;  2E2I H;  4XTC S;  1KXL A;  1C7Y A;  2E2J H;  1V1Q A;  4UP8 A;  3ULP A;  2BH8 A;  1VQH A;  2IT1 A;  3CPW A;  4TVA B;  3W1G A;  4OO1 G;  1Q8K A;  1H95 A;  1BBW A;  3FHW A;  1EOV A;  2UUC L;  1KHI A;  1EQR A;  4EQ5 A;  4DV4 L;  3RNU A;  3RLN A;  3RZD H;  4LF7 L;  4OON A;  4A4I A;  3HOX H;  1RL2 A;  4EX5 A;  4DV1 Q;  3GTQ H;  3HOV H;  3AQQ A;  3H3V H;  1VQF A;  3S1N H;  2UUB L;  2UUA L;  1Q12 A;  1E22 A;  4IPG A;  1PVO A;  2LSS A;  2CQO A;  1HZB A;  1NE3 A;  2VQE Q;  3I2Z A;  5FLM G;  4OO1 I;  1TWC H;  4DUZ Q;  1JJG A;  1WYD A;  3RN5 A;  4GOP B;  1L1O B;  4B3S Q;  4DK6 C;  4GKK Q;  1WCM H;  3TRE A;  4LW1 A;  5M3M H;  4P71 A;  2R6G A;  5JEA J;  4IOA A;  1EWI A;  3KF8 B;  2I5H A;  3U4Z A;  2NVT H;  4XIG S;  4YCV A;  4A3M G;  1VQM A;  3VDY A;  4X65 L;  2MNA A;  1G51 A;  4IJL A;  4LFA Q;  2Q2U A;  1XNR L;  4GLA C;  2N49 A;  1G29 1;  4OX9 Q;  1S3O A;  2ZJQ A;  1K8A C;  1HNW Q;  1XMQ Q;  4BXX H;  1I3Q H;  2KBN A;  2LXK A;  4LFB L;  2C35 B;  1Q7Y C;  2PQA B;  4QJF A;  1QUQ A;  3BZC A;  3CD6 A;  1WOC A;  1L1O C;  4GOP C;  1L0W A;  1ASZ A;  2CWA A;  4R4I A;  1YJN A;  2K14 A;  1EYG A;  1VQ4 A;  4DR4 Q;  1XMO Q;  1IXR A;  5FJ8 H;  2EXD A;  1TWH H;  4GLV B;  4GN3 B;  3U58 A;  1EIY B;  4B3M L;  1HR0 L;  4OWW B;  2OQK A;  4JCV E;  4A3K H;  2HHH Q;  1HNX Q;  3D0F A;  1SR3 A;  5IT9 c;  2VUM H;  1S72 A;  3AEV A;  4DV3 Q;  3S16 H;  3E9I A;  4MNO A;  1JJC B;  2N78 A;  1HNZ L;  2NVY H;  3S1Q H;  1WFQ A;  3G6E A;  4LF6 Q;  4IPC A;  1CSP A;  1B70 B;  3KOJ A;  3T1Y L;  3PO2 H;  1AE2 A;  1SE8 A;  2UXD L;  1NBW A;  4IPD A;  4DV5 Q;  4PZ6 A;  3STB C;  3TRZ A;  3ZJY C;  3HKZ E;  4JI1 Q;  3GD7 A;  3J80 i;  3HOX G;  1EUJ A;  1TWG H;  2D0P A;  1SLJ A;  3CP0 A;  4KHZ A;  3T1H Q;  2JA5 H;  2IX1 A;  1AE3 A;  2PNH A;  2JA8 G;  3HOV G;  4A3C H;  4DR6 Q;  2OQ0 A;  5HY6 A;  1C0A A;  4QIW E;  4P75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...