3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
2R6GA 4NXNQ 5IYBH 1NTGA 1MKHA 1ASYA 5GROA 4JI1L 4BY7G 5IY0A 3BZKA 1CKNB 1OXXK 1WCMG 4B3MQ 4YCWA 4B3SL 2CCZA 3J80i 2K14A 4B3TQ 4GKJQ 1GVPA 1YEZA 3I4MG 4IJLA 1HZAA 5IT9c 4DV4Q 3PGZA 3KF8B 1PH7A 4OWWB 1WOCA 1I6HH 1H95A 3MXNB 1Y1WH 2I5HA 1JE5A 3JC66 4A3KG 2JEAI 3A74A 2QGQA 3UE0A 2VL6A 3NEMA 4A3GH 1M1KC 3B6YA 3W1BA 4JCVE 4A93G 4JI8Q 3A0JA 1PH3A 4L5RC 4A3FG 4LF6L 5JJKA 1HH2P 2UUAL 4DK6C 1X54A 3KLWA 2MFIA 3KDFB 4DPGA 4A3CG 4C3JH 1N36Q 3PSIA 4DV7L 4X66L 2ZJPA 3KF6B 1PH8A 4L5SA 3S16H 4BXXG 4P71A 4JI2L 4JI6L 1HNWQ 1BKBA 4OONA 3HOXH 1VQIA 2F4VQ 3HOUG 3PO3H 4QIWE 4GKJL 5C44G 3NBHB 4IFDJ 1YITA 2R92G 1MJEA 3CC7A 4GKKL 1X3FA 1AH9A 1O7IA 4UP8A 3E9IA 2EIFA 5IP7H 1U5KA 3ULPA 4LF4L 4JI7L 2AWNA 1XPUA 1FL0A 1YNXA 4DUYQ 3F2CA 1FGUA 2N78A 3VDYA 1U0LA 4A3EH 5GAGC 2ASBA 2VUMH 1HZBA 1KQSA 4JBJA 2NVXH 4JI0Q 4JI7Q 4IPCA 2VQEL 2JA6G 5M3MG 4A3LG 1PVOA 1A8VA 1XTDA 4MNOA 2HHHQ 5C0XI 2UU9Q 4DR3L 3CCLA 4IOCA 4X64Q 4XIGS 4JI1Q 4GN4B 3DM3A 2AKWB 3CQZH 3IRBA 1TWFH 2ID0A 5C4XH 4YY3Q 4JC0A 4DV5L 1I94Q 1N32L 5IE8A 2HHHL 2ZM6L 1GKHA 3AQQA 3TRZA 4A3KH 2YV5A 2OCEA 1UE5A 1VQLA 3M9BA 1VQ4A 3J7ZC 1D7QA 4X62L 3T1HL 3KJPA 4A3FH 4DV0Q 1PFSA 3S1MH 5K36G 3BZCA 2ZM6Q 3HKSA 4FDBA 5IYCH 2R7ZH 4HJ8A 1PH2A 1Q7YC 1HZ9A 3K80C 4JI4Q 2N49A 1E22A 1X65A 2VZAA 5C4JH 4LNQA 1CSQA 1YI2A 1ASZA 3RN5A 3GO5A 1VQKA 1NBWA 3CPFA 4JOIC 2A19A 3BJUA 2CWPA 5DLQE 1YHAA 5J3BA 3H3VH 2IX0A 4JI6Q 3CCSA 1QVGA 4B3RQ 1N32Q 1Z9FA 3S1NH 1YJWA 2NVQH 4BY7H 1EIFA 4YCUA 4GNXC 4LF5L 2UXBQ 1N9WA 4YHHL 1UE6A 2B63G 1EQRA 1X55A 3TS2A 1Z47A 2MO1A 2Y0SE 4DNIA 1G291 1IYJB 4QY7A 1XMQL 4LF8L 1HNXQ 4PZ7A 4A3LH 2E5LL 2AWOA 2VUMG 2ALYB 4IFDG 3K0XA 4JI4L 2L15A 2NN6G 3I4OA 4LUVA 1Q1EA 1K83H 4GN5A 3CC4A 3ERSX 2UUBQ 4JI0L 2R7FA 4DR7L 1CUKA 2K50A 1G51A 3T1YQ 2R93H 2XGTA 3OYYA 4UY8C 2LSSA 1PH1A 2CFMA 1T9HA 4LFCL 2DGYA 3AEVA 3M3YH 4NXMQ 2PQAA 3H15A 1JT8A 4LF4Q 1WCMH 4DAMA 3U58A 3G4SA 3Q8DA 1OXTA 3TEHB 5H1SE 1Y1WG 2UUBL 1HNWL 3KJOA 3E9HA 4OXPA 2BH8A 1I50H 3PIPA 5M3FH 4DV1Q 4ME3A 1Q86C 2E2JH 3JAMc 4HIKA 3M4OH 4BA2I 1J6QA 4R4CA 3U4ZA 5HGQA 1SRUA 4DV3Q 1XPRA 4LF7Q 2JJQA 3FKIH 5FJ8H 2HT1A 1E24A 3NELA 3ULJA 3RZOH 3CCJA 3OW2A 2MQHA 2JA5G 1VQJA 3RR5A 3GD7A 1V1QA 2E2IH 4JBWA 2EXDA 3U50C 2ZJQA 1J5EL 2BA0A 2HIVA 3CXCA 4KLKA 1LYLA 3I4MH 5GADC 1A62A 4DR5Q 1VQBA 1WJJA 4RG1A 2WAQG 3ZJYC 1XMOQ 1OTCA 4KHPL 2MO0A 4A76A 3PF5A 3CF5A 2B29A 4Y7NH 2KBNA 1OXVA 1VQOA 3DLLA 3FHWA 4OWXB 1E7ZA 4DK3C 1VQCA 3K8AA 3E0EA 3CCQA 4DV5Q 3PUVA 1K8AC 3K7UC 4BBSH 1JMCA 4HIMA 4IFDI 3HOWH 1Y1VG 2CWAA 1VQPA 1HZCA 4OWTB 3M85A 3HOZH 4A3DH 4A3JH 1I3QH 1AE3A 4A3MH 4LF5Q 1EWIA 1E1TA 4L5TA 3PUXA 4TQUS 5M3FG 4LW1A 2YU9H 1PH4A 1HNZQ 4NXML 4HJAA 1KAWA 1XNRL 1GM5A 1L1OB 3RLNA 4GLAC 1EOVA 4ALPA 5JEAG 3RLOA 1HR0L 1P16A 2LXKA 3M4QA 2Q2TA 4P72A 1MIUA 1TXYA 4AQYL 2JEBI 1VCIA 2JK8A 3HOYG 4PZ6A 3I55A 4HIOA 1UE1A 5IYDG 1HR0W 3CCVA 1VQ6A 4LFBQ 1RL2A 3H0GG 4TVAB 1BBWA 1FVIA 3RZDH 2Z6KA 5ELNA 1YZ6A 3A5UA 1LM0A 3CCRA 1SFOH 1YBYA 4DAYB 1R9TH 3BU2A 2R7DA 2K52A 3CMEA 5M5WH 3G48A 4JI3Q 4POGA 1FJGL 1HNZL 2Q2HA 3KDFA 3S2HH 1YJ9A 2D0OA 3HOZG 4A3DG 4DR1Q 2OTJA 5M5XH 2Y0SG 3KF6A 4BY1H 3M4PA 1LTLA 1NMGA 4X64L 3PUWA 3HOXG 3HOUH 3T1YL 1OXUA 3OTOL 2YYZA 1VQ9A 5FLMH 3KOJA 4A3BG 1N33L 3D0FA 2A1AA 3CCEA 4DV2Q 1E1OA 1IBLQ 2ZTDA 3AFQA 3PO2H 3S15H 1IL2A 4MZ9A 2D62A 1PA6A 4JYAQ 4K0KQ 1K9MC 1L1OC 3HOYH 3J80c 2IY5B 4DV3L 3ICEA 3KFUA 4BBRG 4KHZA 2NN6I 3G71A 1QZHA 1VQNA 4DV4L 3G6EA 4GOPC 4DR4Q 4P73A 4NPSA 3EBEA 1L2FA 1AE2A 2PNHA 4JG2A 3EN2A 1KIXA 3GTOH 1CKMA 3U4VA 4JYAL 1TWGH 4UPAA 4K0KL 4OO1I 3EIVA 2CKZB 1P8LA 1Q82C 2NZOA 3GTGH 1B70B 2A8VA 3FKIG 4GLVB 4DR2L 2Q2UA 3HOVG 2WB1E 3JAMi 4YCVA 1EFWA 5LMNL 4DR4L 2RF4A 3CC2A 4IPHA 4KHPQ 3SGIA 1L0WA 4HIDA 4WJ3M 4APVA 5M3MH 2ATWA 2JA6H 1CSPA 4AYBG 4JI2Q 2AMCB 4Y52H 4WJ4A 4DR6L 1IXRA 1S3OA 2D0PA 3UDGA 1CKNA 2E5LQ 5JEAJ 3PO2G 2ZJRA 1W2BA 3S17H 2KCMA 3LGJA 3STBC 4OX9L 4A3IG 3RLFA 2I5MX 2WB1G 1XPOA 5LMUQ 1SR3A 3HKZG 2OTLA 1FJGQ 2UXCQ 1TWHH 4LFAL 4R4IA 2NVYH 4YWMA 5FLMG 2PI2E 4UP9A 3MEFA 1D8LA 2NVTH 1EUJA 3L2PA 1C0AA 3W1GA 1OXSC 5C4XG 4GLXA 1TWAH 5FJ8G 3S1QH 4LFBL 3J81c 4R4OA 1B8AA 4IPGA 4PG3A 4AH6A 4GKKQ 3J81i 2B63H 4YWKA 2K5VA 3PUZA 3K81C 1VQFA 1PH5A 5LMNW 5BR8Q 2KHIA 2ES2A 3GTQH 4DUYL 1EIYB 4JBMA 3M7NA 3GTLH 2BH2A 4A3GG 4JI3L 1Y1VH 1UWVA 4YWLA 4C3IH 1VQDA 2AHOB 3CD6A 3HOWG 4LF9L 1NMFA 3PV0A 4J15A 1EYGA 4LFAQ 3CW2C 4GOPB 2WP8J 1UE7A 2OQ0A 4R4QA 4R4TA 4JOIA 5FLXc 4DR3Q 4B3TL 4YY3L 4QGUA 1BBUA 2VQFL 3CCUA 4GNXA 1KL9A 2PQAB 4BA1I 1CKOA 2DUDA 3GDEA 4NXNL 4IO9A 2N3SA 1YVCA 2JE6I 1SMXA 4GN3B 1VS0A 5GQOA 1PHJA 4B3ML 5C44H 1DGSA 1C9OA 1VQ7A 2UUAQ 4XTCS 2NZHA 4OO1G 1C7YA 3H0GH 4EQ5A 4IJHA 4POFA 1PH9A 4PMWA 4O0AA 4X65L 1SE8A 3J81j 4X6AH 1A0IA 1LUZA 2VW9A 3I7FA 1XNQL 2UXDQ 2R93G 3HFZB 1YJNA 1HNXL 3J7A5 1GO3E 1B7YB 5AJ3L 3PO3G 4JI8L 1KRSA 5IYCG 2R7ZG 2VNUD 3GTJH 1JJ2A 5IYDH 1PYSB 1SN8A 4JBKA 2UXBL 2MNAA 2QEXA 3RN2A 2H5XA 1N36L 1XNQQ 2UXDL 4MTNA 4IPDA 1K3RA 5IYBG 1N34L 4JV5L 5M5YH 3S14H 4A3BH 2F4VL 1XMQQ 4LF8Q 3GTPH 4LWCA 4UP7A 1NJIC 5E7NA 3GTKH 4DUZL 4OX9Q 5C3EH 1S40A 4HJ5A 2YTXA 1X56A 1QUQB 1X3EA 5GAEC 4HJ9A 1N34Q 1NY4A 5IWAQ 2OQKA 1YIJA 4P74A 1QVCA 4IOAA 2UU9L 1WFQA 1XNRQ 1Q12A 4NB3A 4DV1L 5JJIA 2ZTCA 5C0XG 3F2BA 2PMZE 2IHFA 4LUOA 2RCNA 4PZ8A 4BBRH 5EAYA 1XJVA 4KI0A 4LF7L 2FXQA 1I94L 4A93H 4LFCQ 3NENA 1JB7A 2IX1A 4QL5A 2GN5A 2YTYA 1K73C 3PCOB 3F2DA 2UXCL 1V9PA 1VQMA 2VQEQ 3TS0A 1UEBA 2UUCL 1V43A 5C0XJ 2OWOA 2I5LX 2B3GA 1KC8C 2WFWA 2E2HH 2PI2A 2YTVA 4C2MH 1KRTA 4DV2L 1VQGA 3HKZE 1K0RA 1WI5A 3PF4A 1KHIA 1N8RC 2R92H 4DR1L 2UUCQ 1Q46A 1PH6A 2KHJA 3UDXA 5BR8L 1Q8KA 5IP7G 4X65Q 1JJGA 2HQLA 2JQOA 2BA1A 3L7ZC 3FP9A 4X62Q 3T1HQ 4A3JG 1J5EQ 4RMFA 1YHBA 4A75A 2C35B 1N33Q 4LF9Q 5IP9H 1YHQA 2K75A 3WWVA 5AJ3Q 3UDFA 1X9NA 1Q81C 5GAHC 4X66Q 3K7AH 1IBMQ 4C3HH 1BVSA 2VY3A 2GVAA 3S1RH 1L1OA 1WYDA 1SROA 4DR2Q 2Q2IA 1X3GA 2E8GA 1Y14B 2Z0SA 2ZTEA 4H02A 5LMNQ 1KXLA 3F8TA 2N8NA 4GOPA 1VQEA 2WAQE 4HJ7A 4A3EG 1NE3A 1VQHA 1IBKQ 1VQ5A 3I4NH 1I5FA 2K5NA 3L0OA 4GS3A 3AYHB 1VQ8A 2VS1A 4YHHQ 1M90C 2KCTA 2JA5H 3GTMH 3CAMA 4DV6Q 3STBD 1HJPA 4DR7Q 3ER0A 1HR0Q 2XTIA 2Z6KC 4DKAC 3KYHC 1A63A 4AQYQ 1IBKL 2K4KA 3W5OA 1JJCB 2JA8H 4AYBE 4DV6L 3A5ZB 1IBML 4JV5Q 1Q1BA 4BY1G 1IBLL 3HOVH 4DR6Q 1K8GA 4A4IA 1KD1C 5IP9G 2IHEA 4O2DA 4JI5L 2EQSA 4AIMA 2JA7H 4DUZQ 1QUQA 2RHSB 2CQOA 4BBSG 4DV7Q 1TWCH 2JA9A 2V1CC 5IWAL 1G6PA 1EQQA 4P75A 5LMUL 3H3VI 2QA4A 4R1JA 4EX5A 3F1ZA 3OTOQ 1IZ6A 1W3SA 1X6OA 2F52A 3S24A 3PIOA 3I4NG 4DV0L 3CMAA 2RHQB 2IT1A 1S72A 4B3SQ 2KENA 2I0QA 1VQAA 3CP0A 5HY6A 3CPWA 3RNUA 4A3IH 4DR5L 2F3IA 1SLJA 1MJCA 3I56A 4GNXB 4A3MG 3AFPA 3UE1A 3ULLA 3TREA 1XMOL 1PV4A 2GVBA 4LUZA 3PUYA 4L5QA 1QVFA 4B3RL 4A3CH 4QQBX 3D31A 4JI5Q 1GD7A 2HIXA 1E3PA 5ELOA 2JA8G 3UDIA 5C3EG 1RIPA 2VQFQ 4QJFA 1PYBA 4LF6Q 2LXJA 4BXXH 3I2ZA 3S2DH 1QZGA 5JJLA 2K5HA 2JA7G 3CCMA 3TQYA
chains in the Genus database with same CATH superfamily
2D9UA 4RAZA 4J9OA 4NMZA 3E3XA 4BY7G 5IY0A 1I6VC 3O13A 1CKNB 4FVMA 1KABA 2G9DA 4YCWA 1CZGA 3RGZA 2YZMA 4GKJQ 2FINB 1GVPA 4IHJF 2CQYA 2AQ1B 1YEZA 3VR6A 2MUYA 3I4MG 1TS3A 4WD3A 3L4JA 1HZAA 1Q3LA 4DV4Q 4I4TF 3LNNA 1JR0D 3KF8B 5IGBA 4HNVA 4ECYA 1D1KA 1I4PA 2I5HA 3MXNB 1Y1WH 4JI2H 1GXDC 3BG3A 2JA5A 2QGQA 3I12A 3UE0A 3RAQA 5KNBA 3W1BA 1GSAA 3A0JA 5LP6F 5E1FA 1HH2P 4PMBA 1PK8A 4DK6C 4XYQA 3EPGA 3X3MA 1XNQH 2W71A 1N36Q 3KF6B 5FLXL 4FYDA 4JI6L 3NE5B 4ED6A 2GA4B 3WO0A 1YNJC 3D4DA 4IFDJ 3NBHB 1YITA 2R7ZA 5EOYA 5HV6A 1V1OA 3R5XA 3Q8PB 2VQEH 4JV0A 2EIFA 5D65A 2PNRC 1TY2A 4O4HF 2AWNA 1XPUA 2FPIB 2R7KA 1DZ1A 5COYA 3F2CA 4F4YA 2N78A 4ZRZA 3K5IA 2KOLA 4C2MB 4ZI7F 2K5DA 2WIIB 2JXMB 1KQSA 1JORA 4MV1A 1J5EH 3T56B 3V96A 1A8VA 1XTDA 4MNOA 5M5WB 5C0XI 1TS4A 3CCLA 4IOCA 4X64Q 4ED7A 4QWBA 4JI1Q 3S1NH 3IRBA 1TWFH 2CW0D 5IE8A 2YU9A 2HHHL 2ZM6L 1TIID 3AQQA 3TRZA 4LFAH 4DL5A 1UE5A 2R7MA 1VAJA 3M9BA 1VQ4A 2HD3A 4A3IB 4A3FH 4ZQ3A 4DV0Q 1GJXA 3GIKA 2FKLA 2W7OA 2IP4A 3GTPB 5DG9A 2R7ZH 1IBKH 2FMCA 1Q7YC 1X65A 4QCLA 3OWFA 1E4EB 4DR2H 5EKIA 1YI2A 3RN5A 1I3QA 1VQKA 1NBWA 2FLPA 2M9VA 4RKLA 2CWPA 5D3DA 3CCSA 5EBDA 1EZ8A 3D4WA 4C3IG 1N32Q 1ONLA 2NVQH 4LF7H 1EIFA 2K05A 1N9WA 3N43B 1X3PA 3JAME 1S5DD 4JI0H 4JV2A 1Z47A 1BXTA 4ZKBB 4J9LA 1S5ED 4QY7A 1HNXQ 4M8AA 4CJ2C 3A54A 2MPMA 2AWOA 1J8IA 4YBZB 1PRTD 2UXDH 4RGOS 3K57A 4HR7B 4LUVA 2EYMA 1Q1EA 3IKJA 3S1MB 4MA0A 3ETHA 4JI0L 3ERSX 2GLTA 3BA9A 4KN7C 2LSSA 1LTAD 2DGYA 3H15A 1WR2A 4LF4Q 2ZM6H 4DAMA 3G4SA 3TEHB 2ZJTA 4OXPA 1E2ZA 2BH8A 3KAKA 1CT1D 4ME3A 4A3GB 4IUNA 2C00A 5KGUA 4OHJA 2EYHA 2F0MA 4HQ6A 3M4OH 1B2TA 4BA2I 4YJ2F 4R4CA 3U4ZA 4DV3Q 3QO2A 1E24A 2PMZA 4I65A 5I9PA 3CCJA 1LTSD 3OW2A 2MQHA 1PFBA 3T5JA 3TQTA 3BYYB 1FD7D 3RAXA 3G7LA 2EY5A 3OMCA 2BA0A 3RMHA 2HIVA 3CXCA 2N88A 4IUPA 1HUNA 1E4GT 1B44D 3ETJA 4IRCA 3MWEA 1LYLA 3I4MH 5GADC 1A62A 4RG1A 2WAQG 1XMOQ 2W9CA 2MO0A 4A76A 1TS2A 2V58A 3PF5A 3IL8A 4RH6A 2B29A 1N32H 3GTPA 3CQZB 2W6OA 3T1YH 1WTRA 5CC4A 2ALZA 3E0EA 1N33H 3BAAA 4BBSH 3PQIA 1JMCA 2WKDA 4HIMA 1KAAA 4YAJB 4N9PA 2W70A 1DYQA 4HCSA 2YZNA 2F0TA 1WTOA 5BPFA 1N48A 2E76C 1LT4D 3HOZH 3LP8A 4B08A 4CDCC 4FF1A 2SNSA 1KDBA 1CS0A 2NVYB 5KNCA 1I3QH 1WD0A 1AE3A 4LF5Q 3I4NB 1PZID 2AQ3B 4JV5H 4A3DB 2I8CA 2FLNA 1F2YA 4K0KH 4NXML 1IHZA 3V4ZA 4GC6A 1BNZA 5JQWA 1GM5A 1L1OB 4GLAC 2L5TA 4HEDA 3M4QA 1KJJA 4HR7A 2DZDA 2JEBI 3L3OC 2B2UC 2CH4W 4UCVA 3HOYG 4DV1H 4PZ6A 5IYDG 1TWCB 1GUSA 1RL2A 4F50A 2IW3A 4C3HG 4I50F 3H0GG 1TVXA 3E0JA 3KLRA 4M1UB 3RZDH 1SYFA 1K83A 4AYBA 3GTKA 1YZ6A 4WRDA 4DL3A 2MGSA 1R9TH 4HMJA 5LOVF 5DQHA 2R7DA 2K52A 3D6WA 1CM9A 1HNZL 2Q2HA 2OEOA 3PW4A 2UVRA 2OTJA 1IOWA 1BCPD 1I4XA 4X64L 4XYLB 1EY0A 4IURA 1W6KA 2JSOA 5K5PA 2DPJA 4G3IA 4ECVA 3TN2A 4DLKA 2ATLA 3JRWA 3CCEA 1E1OA 3QWNA 3JZIA 1WVLA 3VYSA 4B3MH 1IL2A 1F9RA 4RFBA 1VBHA 4ED3A 2WV6D 4X3TA 1K9MC 4ED2A 2AQ4A 2IY5B 1DIKA 4DV3L 4O3SA 4I7AA 3SHLA 3URYA 2NYZD 2RA4A 2NVQB 2R8KA 1FNWA 3MXUA 4P73A 4Y7NB 1K8MA 4JG2A 2E2IB 3HXLA 2XGQA 4K0KL 4KKSA 3U4VA 3GIPA 1NUCA 1Q82C 1G2SA 5LL6S 3HOVG 2HVRA 4YCVA 5LMNL 1RDPD 3NGDA 1Y1WA 3SGIA 4BS9A 1TWAA 2B2VA 4M9UA 2EPBA 1I50B 2JA6H 4ZK9B 2UUBH 4JI2Q 2AMCB 4Y52H 4WJ4A 4DR6L 3S17B 1BDOA 2YS6A 1I6UA 2NU7B 4FF2A 3PO2G 1A2TA 4HYKA 3PZPA 1B9MA 4ZUJA 1EY9A 2F0JA 1GUOA 1BUVT 1K28A 2I5MX 2WB1G 3MR5A 1FJGQ 2QYZA 3RBDA 2UXCQ 1E0BA 4LFAL 4R4IA 2NVYH 2CW0C 5FLMG 5C3XA 3VMMA 2F0UA 5K36H 1D8LA 2F0IA 2J4XA 5L9XA 3MFIA 1OXSC 1TWAH 5FJ8G 5KG7A 4IUVA 4LFBL 3Q8QB 4ED8A 2L12A 1HR0H 1E2VA 2FMMA 2OXPA 4GKKQ 5KT6A 5KFVA 3MC0B 3HGBA 3PUZA 5A2QE 5LMNW 4C3HB 2KHIA 4ECRA 3T5KA 1L0YB 4DUYL 3M7NA 2BH2A 3PR5B 4JI3L 1Y1VH 1S0NA 2LKVA 1NMFA 1STAA 1QCBD 3PV0A 5DM73 2DPIA 3AU7A 5ELDA 5E4XA 1M8AA 5FPRA 2V4DA 4DV5H 1ZKOA 4HCEA 1UE7A 4ED1A 1VF7A 1EIHA 4TSSA 5KNDA 1I94H 3G6YA 2UVWA 2ZXPA 2VQFL 4JUZA 4JI1H 5LMUH 1MI2A 2PQAB 3A8IE 2I87A 4QMGA 1B1ZA 3JRXA 2ASJA 4UHVA 3MR2A 2N3SA 2E2HB 2VA3A 5GQOA 1VS0A 2HDMA 1GGOA 1DOKA 2O4XA 2FHTA 5E4WC 4EVOA 1C9OA 2UUAQ 2O5JC 1W93A 4OO1G 1C7YA 5DEHA 4POFA 1PH9A 1SAPA 3RUPA 4X6AH 2MCTA 1A0IA 2V4RA 2B63A 5CBAE 3SK6A 3SK4A 3KHLA 2R93G 3HFZB 3RF2A 5CORA 3TP8A 3SXHA 1GO3E 3ND9A 2EJMA 3K3PA 5IYCG 2VNUD 5IYDH 5CGKA 5DLFA 3RN2A 2QEXA 1XNQQ 3TIIA 4GKJH 4TQSA 4IPDA 1K3RA 3BYTB 4GZYC 3DUZA 4LF8Q 3GTPH 3S16B 4PWQA 4UP7A 1NJIC 5E7NA 3GTKH 3M4IA 1KEEA 1X3QA 5JVH3 2XCPA 1EQVA 2WKCA 3HBLA 1N34Q 5IWAQ 2WB1B 1QVCA 4IOAA 1C30A 4FXDA 2ZTCA 3NPPA 2YYAA 2F4VH 2C2EA 1XX8A 1CA6A 1LLRD 4U6PA 1CHPD 4E4TA 4MTKA 2UXCL 3TP5A 3VR4A 1ICWA 2O03A 1A15A 1A3TA 3TBIB 3V05A 4ECXA 3J80E 3C46A 3H4BA 2PI2A 2YTVA 3BQ2A 1KRTA 1GUNA 4ZYSA 1WI5A 4CBVA 2R7LA 4C3JB 1KHIA 1N8RC 4UFZA 5D3IB 1PH6A 1RJPA 4IUQA 1A9XA 3L7ZC 1J5EQ 4A3JG 4A75A 1N33Q 1DONA 5C5LA 5IP9H 1RJTA 2E2HA 2DNEA 2FLLA 3WWVA 3GTGB 4OX9H 3QG1A 5GAHC 3OMGA 3CU7A 1IOVA 2GVAA 3S1RH 1AEXA 1Y14B 2Z0SA 5LMNQ 4DL6A 3K5HA 1EUDB 4IALA 2WAQE 4HJ7A 3QZ7A 1VQHA 1VQ5A 2OLSA 4G7HC 4A3MB 2C22A 1IYVA 3AYHB 1STEA 1VQ8A 1TKWB 2KCTA 2K01A 1V8QA 3G6JB 3GP7A 1HR0Q 1TU2B 5DG7A 2KQ3A 2B2WA 4J9RA 1GYFA 2A6HC 3OIPA 4AQYQ 2K4KA 1PX2A 5CV9A 2EJFC 3K7AB 4AYBE 4G7ZC 1IBML 4JV5Q 3D4RA 4FO2A 3HOVH 1PTOC 2FPPB 2IHEA 4AIMA 2UXBH 2I07B 4DUZQ 2CQOA 3WNZA 5IT9W 1TWCH 4JVZA 2CW8A 4DR1H 5D14A 1C48A 3X3NA 4DK0A 1F9PA 3OTOQ 1X6OA 3I4NG 3PMFA 4RCNA 5DQGA 2IT1A 3MXGA 4E6IA 3UQ8A 5EQ0A 4YAKB 2K5WA 4A3MG 1B6SA 4PNYA 3RJ0A 3MJFA 4B3RL 4JI5Q 4A93B 4QUCA 1PZJD 4RGMA 1VDZA 1E3PA 4CDDC 1RIPA 2VQFQ 4Q5VA 5EJWA 5JJLA 4O3OA 4PQXA 4A3JB 2XN9C 3TQYA 1PDQA 2R6GA 3F2UA 3M9MB 1MKHA 4JI1L 4DV3H 3DXJC 3T53B 1PZKD 3HOYB 2A6EC 3A7AB 1OXXK 1WCMG 5JUMA 2K14A 1JC7A 4K6LA 4B3TQ 2K28A 4DNTB 1RODA 1QOHA 5JPNC 5ISRA 4R9WA 1WCMA 3PGZA 1WOCA 1I6HH 4CC6A 3OHAA 3VYTA 4A3KG 1I7LA 2NN6H 4A3GH 4B3SH 4UCRA 4F4WA 1JE4A 1PH3A 4L5RC 4LF6L 5EKLA 4LH7A 1EY7A 4A3CG 3KDFB 1GHKA 2R61A 1H9RA 2I80A 4IUUA 4J9SA 2SNMA 3VA7A 1AUXA 2K6AA 2ZJPA 4L5SA 5E3FA 3PO3H 4B9WA 2QILA 3JSNA 5CA1F 1DCZA 3DWPA 4UCSA 3CC7A 2WTFA 1HFNA 5DGBA 2WDTA 4YR0A 3K6OA 1U5KA 3ULPA 2LFNA 4LF4L 2WAQA 4JI7L 4MV3A 3G6XA 5L1KA 1YNXA 1QWYA 3KF8A 4DU9A 1HNZH 5KFKA 3P75A 3VDYA 5AFWA 4FS1A 4JI0Q 4JBJA 4IPCA 5M3MG 1PVOA 2K7VA 1KDAA 5CAEB 2UU9Q 3S2DB 1Y1VA 4I7HA 4C3IB 5A35A 2R8JA 4GN4B 2PBZA 2XWBB 3DM3A 2AKWB 4YY3Q 4TUYF 1RF2D 1N32L 4TKOB 5BMVF 3L4KA 1BCPC 1ENFA 4QIWB 3T51B 4MV7A 4DV2H 3J7AV 2EOTA 4KMUC 2XVSA 5EPJA 3J7ZC 3KJPA 2PCFB 4ULLA 1M6VA 4HJ8A 3K80C 2NVXA 4JPBW 4CC5A 1DD2A 5DG8A 3UFXB 3TDQA 1JDBB 2UVUA 3H3VH 3BJUA 4J6HA 2KEEA 5C0XH 1SFOA 3NP8A 4OIJA 3Q24A 1DM0B 3BG5A 4GNXC 4LF5L 3GIMA 2UXBQ 1SE4A 2PQEA 2B63G 2VB3X 2BE5D 5I2XA 5T14A 5M3FB 3D8GA 3Q6SA 3R5HA 2VUMG 3VYRA 2ALYB 2RDHA 1MZBA 4JI4L 1TWFA 3FMCA 1ZXTA 4Q44A 2V59A 3J80L 3I4OA 3MAQA 2VXWA 1EL0A 3VPCA 2VOBA 2RKSA 2F0SA 3N41B 2R7FA 4DR7L 2XIWA 1CUKA 2K50A 1GOZA 3H09A 2LY7A 3BVGA 5CV4A 3TP7A 5C4ZA 1T9HA 4LFCL 3AEVA 1SEIA 4JI5H 4NXMQ 4UCTA 5BPHA 1QNKA 1O7LA 2UUBL 5KFQA 3PIPA 5M3FH 4DV1Q 4QWAA 1Q86C 5M5YB 3UI2A 1EYDA 5HGQA 4EGJA 3GQCA 2JJQA 3FKIH 1ET9A 3NELA 2M2LA 1SE2A 3GD7A 3R2TA 5KFLA 2ASDA 1IKLA 5JOBA 1KBLA 4IN3A 1WTVA 2SCUB 4KLKA 3VR5A 4U68A 4EBDA 3OSOA 2X0SA 1XWEA 1VQBA 1WJJA 1R4PB 2K32A 4KHPL 3SI8A 4F8MA 3P7JA 1TWHA 4K2LA 4U673 2M00A 3CF5A 4XXEA 3BVZA 5I4DA 2KBNA 5KG0A 3MWYW 1E7ZA 1CQIB 4L8JA 3PUVA 4LF9H 1CHQD 3SK8A 3G8CA 1HNXH 3CRLC 3K0YA 2Y0SB 1VQPA 1HZCA 3M85A 2L9HA 5BN3A 5IT9E 2EY1A 4DAVA 2W8LA 1SMYC 3RUZA 1H9JA 1EWIA 4A3MH 2EY2A 4L5TA 3PUXA 2L55A 3E5SA 3KK7A 3NSWA 4LW1A 2NUCA 4TQUS 5M3FG 1HNZQ 4XYMB 1HA6A 4N9TA 4JYAH 1XNRL 1HUMA 1PTOF 5KFJA 2Z8LA 4RZQA 1EWHA 1S4ZA 2XNAC 1O78A 2Q2TA 2RGVA 2EJGC 1MIUA 1TXYA 1WTQA 2HGSA 4DV6H 2JK8A 1BGWA 5L1JA 1UE1A 4LFBQ 1S5BD 3N6XA 3GV8B 5FO7B 2DJGC 1BBWA 1N56A 2Z6KA 1LM0A 5FPOA 3BU2A 1FJGL 4JI3Q 5M5WH 4RB2C 4A3DG 2FMAA 2Y0SG 3KF6A 4XYOA 4BY1H 3PUWA 2VQFH 2F0NA 1OXUA 2O5IC 4EG0A 5FLMH 3J7YW 4K6DA 2NTTA 1DOMA 2RDGA 2EY6A 1Z6HA 3OUUA 1KNAA 4OEMB 1IBLQ 2VUGA 4MV8A 5C4HA 2RDJA 2L4NA 2F0DA 4JYAQ 3HOYH 3J80c 2FK2A 1SNPA 1TWGB 5J2TF 1MHWC 2NN6I 4KHZA 3G71A 1QZHA 2J6TA 4DV4L 4DR4Q 1K83B 4NPSA 3EBEA 1L2FA 1AE2A 1KIXA 2H1EA 4NKLA 3D3RA 1RYSA 4UPAA 5J22A 3S1QB 3DWQA 1UAPA 2LS01 2BDNA 3FPPA 2IMWP 2C9OA 2WB1E 2R82A 1N36H 2RF4A 4KHPQ 3QJYA 4HTHA 4HIDA 4B9XA 3I90A 5M3MH 3V4SA 4N8X1 1WTHA 4IR9A 5KX5F 2GPSA 1AW7A 1NAPA 3ORQA 3QOJA 1JOOA 4DR3H 2FP4B 2D0PA 4CKBA 1SNDA 4FXGC 5JEAJ 2NZ1D 1STGA 1W2BA 1TY0A 1CFMA 3NQTA 2A68C 3U9SA 1RK6A 1STNA 5JH7F 2X6LA 1EEID 2OTLA 2V4QA 4YWMA 2CVRA 1B4OA 3GTJB 1D5ZC 1JX4A 4FBUA 3MWMA 4QWDA 3HOVB 1EUJA 1I4RA 4FS2A 4GLXA 1BO0A 3S1QH 3BABA 4R4OA 2MHVA 4MTDA 3FVQA 2R8IA 4DFAA 2XRQD 2B63H 4YWKA 4NLGA 3K81C 1VQFA 1EIYB 4EFEA 4KJNA 3GTLH 2KJXA 1UWVA 3HG9A 4YWLA 3CD6A 2AU0A 2R6FA 3JSLA 4J15A 1XYIA 1AP0A 1BBXC 4CGYB 5M9OA 3CW2C 3HS0C 4GOPB 1Y69U 3GTMB 1PRTC 2OQ0A 5FLXc 4DR3Q 2XRSD 2HCIA 4RUAA 5KFRA 1H9KA 4KJOA 4ME5A 4R8NA 4RUCA 4RB3C 2Z4HA 3Q8RB 1LACA 1EY4A 4QGUA 5KFNA 3KBXA 4J9MA 5CYUA 4GNXA 3OPOA 4JI4H 3KHHA 2DUDA 3TSSA 4NXNL 1SMXA 1TWGA 1XNRH 5KFDA 3BQ1A 3GV5B 5IODA 1CE8A 4BWSC 2AGOA 2R3ZA 4B3ML 1EYZA 1VQ7A 3R23A 2WE6A 1CK1A 1JKJB 1YNNC 4IJHA 1D6EC 1B3QA 4PMWA 3J81j 3HB9A 1LUZA 1LV9A 2ASLA 4RB1A 2UXDQ 1HNXL 4HSVA 4LF5H 1T5XD 3DEOA 1ET6A 2R7ZG 1EHIA 4IWXA 2XIGA 2AGPA 1PYSB 1SN8A 1GHJA 4RGTA 5C4JB 4XQJA 2F0LA 2PZTA 4JV5L 1II3A 4V0BA 5C44B 3CQZA 4A3BH 3S14H 5ELBA 2EE1A 1XMQQ 4RWSC 4DUZL 4JI8H 1SCUB 4Q0YA 2NU9B 2QK4A 1QUQB 1X3EA 2EDGA 4HJ9A 4IRDA 3GTKB 5FD5A 3R93A 1WFQA 1Q12A 3W2DA 1CQVA 1SJED 5L1LA 1IBLH 2PMZE 4C1NK 4UCOA 2JP1A 4LUOA 2IBKA 2NTSA 1I94L 1MSHA 1TWFB 5FO9B 5G3LD 2GN5A 3RB6A 1K73C 3PCOB 5KFAA 1VQMA 3EVQA 2XCAA 3TS0A 3GTLB 2VUMB 2UUCL 4FBTA 5KG6A 2F3VA 2WFWA 1HCZA 1UNSA 2E2HH 4C2MH 4FU0A 4C5BA 5I47A 4ME6A 1AZQA 3HKZE 1GSHA 3PF4A 5L1IA 1Q46A 4KKUA 2A69C 4BY7B 4JI7H 1Q8KA 5T1GA 5C3EB 5IP7G 4X65Q 2HQLA 2QDBA 4KK7A 1X32A 2JQOA 2BA1A 4X62Q 2Q8RE 3T1HQ 2NVYA 1FR3A 4KHVA 4R7RA 1MSGA 1YHBA 4J9KA 2QEJC 2RDIA 1S68A 5ELCA 2K75A 3DWAA 5AJ3Q 1Q81C 3DMUA 1ZYRD 3KXYT 3MA2B 4O3NA 4YY3H 4LF6H 1IBMQ 2YL2A 2A68D 2VY3A 5DGAA 5KYLA 1ML0D 1WYDA 3MR6A 5JAVA 1X3GA 2W6QA 1TWAB 5ELEA 3BDLA 1KXLA 4PV1C 3F8TA 1VQEA 4EBCA 2O2LD 1IBKQ 1FJGH 3I4NH 3K59A 2R86A 3L0OA 4O1NA 2A5HA 1E4EA 4YP3A 2JA7A 5KFXA 1S97A 1RKNA 2Z6KC 3OHXC 4DKAC 4GKKH 2RSNA 4ECSA 2B2VC 4FM9A 3W5OA 4DL4A 4DV6L 4DR6Q 3C3LA 1K8GA 4A4IA 2UUCH 4JI5L 4LFCH 3PVXA 4BWGB 1QUQA 3R3OA 2ZDGA 5IOCA 1G6PA 3I4MB 2IX3A 1EQQA 2IL8A 3H3VI 2IA6A 4F88A 2QA4A 3CMAA 1S9FA 3K5MA 4QW9A 2KENA 3IFTA 1VQAA 3CP0A 3RNUA 5D1OA 4DR5L 3GTLA 1IL8A 1SLJA 2F3IA 3I56A 2VUMA 1B3AA 3TREA 4LUZA 1AZPA 1RTOA 3PUYA 3M4OB 4O42A 2YCHA 4M7EA 2P5ZX 3I8ZA 3D31A 1GD7A 2HQEA 4AQYH 2JA8G 2C2RA 4LF6Q 4BXXH 2PN1A 2J0TD 4ID6A 1HQMC 4RAUC 4C1NI 1XPRA 3S2DH 1Z2NX 1EYAA 2DNCA 4NXNQ 1D2BA 4EQPA 4HNUA 3CVZA 3GTOB 1AN8A 3DF7A 5GONF 4B3MQ 4B3SL 2CCZA 4G4KA 3J80i 4RHRA 3ITPA 1KJQA 1EY6A 4OELB 4XX0B 3J81L 4IRKA 1H9SB 4IJLA 5IT9c 4MAMA 1S5CD 2W6ZA 1PH7A 1DOLA 3N44B 2B39A 3G6VA 3Q0AA 3NEMA 3RZDB 1W96A 4A93G 4A3FG 3EQLC 2UUAL 1X54A 4DPGA 4C3JH 1PLFA 5H80A 3PSIA 5KEEA 4DV7L 1V1PB 2FPGB 4C5AA 1JWMD 3E6ZX 4BXXG 4P71A 1QJOA 2Q8IB 3HOXH 3HOUG 5EWGA 4QIWE 4RNNA 3RB3A 2B2TC 4YB8B 2SEBD 2R92G 4R8UA 5KG4A 1MJEA 1SYCA 3GIIA 3PW5A 5C8YF 4GKKL 1IW7C 1X3FA 1AH9A 4HAEA 4J9PA 3E9IA 5BN5A 5IP7H 3JAMW 3RGXA 2G5DA 5KFFA 2F03A 4EYHB 1FL0A 4DUYQ 1JCKB 1U4MA 1FGBD 1O7YA 2ZDHA 1FGUA 3HEJA 2R8HA 4F87A 4OO1H 4A3EH 5GAGC 2IJ0A 1HZBA 2NVXH 2JA6G 2R93B 5FLXW 1DV2A 2HHHQ 2VQDA 1S03G 3V2TA 5EBCA 4C3JG 1QNUA 4AYBB 3CQZH 5C4XH 2ID0A 3R2IA 4TRDA 2OH2A 2WINB 4PMCA 4ECWA 4FXKC 4ZAIA 3RD4A 3FDSA 2OCEA 4EBEA 3HOUB 3OHBA 4X62L 1JOKA 1QILA 3T1HL 1PFSA 4O2BF 3W3AA 3BZCA 2ZM6Q 3HKSA 5L37A 3JAML 4O3PA 1PH2A 1KJIA 3V6HA 4JI4Q 2N49A 5C1PA 1K0SA 4JOIC 2A19A 4DGZA 3T4AC 1YHAA 2IX0A 4TV9F 1LTBD 1QVGA 1UC8A 1PMRA 1Z9FA 3QZ8A 4BY7H 4F4XA 4YCUA 2JEIA 2K1BA 1SYBA 3S1RB 1EQRA 3TS2A 2R92A 2D5DA 2MO1A 5C5MA 2Y0SE 4DNIA 1G291 2AUJD 2I46A 1DV1A 4LF8L 1G6ZA 4PZ7A 3TIGA 2E5LL 4XQNA 3TP6A 3P1HA 5CV7A 2NN6G 3M9OB 1T36A 3N42B 1K83H 4GN5A 3CC4A 4TV8F 4R8UB 2B2WC 2R93H 1B53A 1XMQH 2XGTA 3KALA 1PH1A 2CFMA 3GIJA 3M3YH 2W6NA 4EGQA 1RK5A 4ZHQF 1JT8A 3T5LA 1WCMH 3U58A 1OXTA 5H1SE 3H20A 3R8BA 3LMLA 2FJZA 3E9HA 1I50H 3BVMA 2JA6B 4K5XA 3JAMc 1FYCA 2E2JH 4A3BB 1R4QB 2A73B 4HIKA 1J6QA 4LK1C 4LF7Q 2HT1A 1RJRA 1WH2A 3T16A 3RZOH 5EWEA 2EYLA 4Z9CB 2R7ZB 4RU9A 2NUAB 2TMPA 4ECQA 1V1QA 2E2IH 2ZJQA 1ILPA 4DV4H 1J5EL 4EQOA 2PVPA 1JWUD 3IAYA 4MHEA 5LYJF 3SDZA 5BR8H 1OTCA 1FKAH 1EOTA 1JWSD 1F2MA 1I6HB 3WDNA 4X66H 5LMNH 5A2QL 4J9QA 1Y8NB 3ZYYX 4Y7NH 3S1NB 3HKZA 1OXVA 3DLLA 3FHWA 1VQCA 1WCMB 3K8AA 3CCQA 4HSPA 3ERQA 3K7UC 5KFWA 4IFDI 1D5XC 3C1FA 3P20A 3VPDA 1Y1VG 4NW2A 5KG5A 2CWAA 4YJ3F 4NXMH 4DAYA 1D5MC 1SYEA 1SYXB 3RTXA 4OWTB 2K33A 2WACA 1RTNA 2KECA 4UAIA 1PH4A 1D1IA 1T5EA 2F0QA 3CKIB 1KAWA 3KAJA 2DY7A 3J7AF 3OWEB 5JEAG 3HZXA 2PO4A 3RLOA 4YHHH 4DV7H 1P16A 1OWTA 4P72A 5F9NA 1JB3A 3LWEA 2WAQB 2W6PA 3IG0A 4XZ3B 3T13A 4HIOA 1HR0W 3OSNA 3CCVA 3Q8SB 3K58A 2HHHH 5EGTA 1R9TB 1KDCA 2JA7B 3AB9A 3SK5A 1DJRD 5ELNA 1WTXA 4Y8VB 1SFOH 1WTWA 3H0GA 4ZUIA 3PIP3 3G48A 3S2HH 1Y1VB 3KDFA 3OUZA 5EDWA 2D0OA 3HOZG 4KHPH 4DR1Q 2YS7A 4EFBA 3WOFA 3M4PA 4EEYA 1LTLA 1NMGA 3HOXG 3HOUH 4GC7A 3S2HB 1PRTF 2KHSA 1JDEA 3KOJA 4A3BG 3D0FA 1DXMA 2A1AA 4DN4M 3I3CA 2JN4A 4DV2Q 3SE7A 5KFTA 4YR3A 1BQQT 2ZTDA 3AFQA 1SNMA 3S15H 1PA6A 4K0KQ 1L1OC 2NVXB 4OIKA 4CHTB 3ICEA 4BBRG 1VQNA 5JJZA 3G6EA 4GOPC 3SEBA 2R85A 2DJFC 3EN2A 1SFOB 1TWGH 4G57A 1IW7D 2E2DC 3H94A 3J81E 3EIVA 1AUVA 2FK3A 2CKZB 1P8LA 3TZUA 2NZOA 5IT9L 1B70B 2A8VA 3PO3G 2B2TA 1HTLD 1KLUD 3SR1A 5JVG3 3C2PA 4IPHA 1JIHA 4WJ3M 4APVA 4YR2A 2EXZA 5IGFA 3N8DA 2UUAH 4J1MA 2L11A 3M9NB 3TINA 3GTOA 1CKNA 3CHBD 2E5LQ 2PW7A 2X6GA 4FF3A 3HOWB 1K8OA 2F0KA 4F7XA 4EGVA 2ZJRA 3S17H 3NHHA 2E75C 4H7BA 4HN7A 1XPOA 3GLKA 4HNTA 1A2UA 2F0EA 5CV6A 5LMUQ 3MWDA 3PR4A 1TWHH 1JXLA 3BA8A 1XDNA 1HPCA 3MTSA 4EEQA 1HQRD 4UP9A 4RZRA 2NVTH 3L2PA 2W7PA 1C0AA 1TR5A 3GTQB 4HMIA 4ECUA 4DR7H 3PW7A 4QIWA 1B8AA 4IPGA 1GUGA 1HTPA 1PH5A 4DR5H 1WD1A 2V9WA 1SDFA 5TSSA 4JBMA 1IKMA 4KD4A 4C3IH 1VQDA 2AHOB 5CV5A 3FEWX 4LF9L 3KTMA 3OOCA 3Q1KA 2F3WA 3QR8A 2ZDQA 2JA5B 4JOIA 2R84A 1IYUA 5HGTA 1M0WA 4K8JA 1BBUA 1RYRA 1EIGA 2NU8B 1CKOA 2JE6I 2CH4A 4QB4A 3NBHA 1PHJA 5C44H 5KFPA 2AGQA 3PO3B 4XTCS 2RSOA 2NB0A 1ESFA 3H0GH 4EQ5A 2Y0SA 3M3YB 4X65L 4O0AA 1WSCA 1QE6A 1SE8A 4B3RH 1TA8A 2VW9A 2PPBC 3I7FA 5FKAC 1L0XB 1XNQL 4XQQA 4APMA 1HXYD 1YJNA 4A3FB 3J7A5 3A55A 5AJ3L 4C2MA 4PDBA 1STYA 4JI8L 4QF4A 4LFBH 2BQ3A 4JBKA 3PO2B 1JLLB 4MTNA 5IYBG 1N34L 1ZETA 2LMCB 5M5YH 2Z4IA 1I3QB 2F4VL 4V190 5KT7A 1S0OA 1F9SA 2R87A 4JI3H 2BR0A 1SNOA 4OX9Q 1S40A 2IWHA 3VA5A 4HJ5A 1EU3A 3KBGA 2YTXA 1NY4A 2OQKA 1YIJA 5DM63 1C3OA 3FMAA 1SBBB 1XNRQ 2XC9A 4NB3A 5IIFA 1EQTA 4DV1L 5JJIA 4BBRH 5EAYA 1B33N 3RB4A 4KI0A 2Q8TA 5EKKA 4A93H 1ENCA 2JEJA 1ESRA 5CBEE 3C0FB 4CJ0B 4ZCKA 2Z9HA 3NQIA 4ZOLF 1V9PA 2F0FA 2VQEQ 5CA0F 4QWCA 5KT3A 2K5QA 1C4QA 1V43A 3H3VC 4MV9A 3FDTA 5C0XJ 2A74C 1ICFB 1KC8C 4WBNF 4X3SA 5KT4A 4DV2L 2W57A 1VQGA 4L63B 1K0RA 4J8QA 4CKEA 2C28A 3J7AK 5KIXA 4ZQIA 1RJQA 4MV4A 2BQRA 3UDXA 2QCPX 2VB2X 1G91A 2EZVA 3KHRA 2B8FA 4DNRB 1F2ZA 3S9WA 4LF9Q 1YHQA 4EQNA 1X9NA 2QDLA 3SVMA 4X66Q 1EUCB 2NU6B 3K7AH 4KKTA 4C3HH 1BVSA 1ENAA 1MD2D 1SE3A 1LT6D 2K04A 2Q2IA 2E8GA 4H02A 3L9AX 2CQAA 4WFN3 4NP5A 2N8NA 2P0AA 3H4DA 4A3EG 2N55A 3BS1A 5T1IA 2EYOA 1I5FA 2E74C 4GS3A 1CA5A 4YHHQ 5IYZF 3OW7A 5FLXE 2JA5H 3MEHA 2NBFA 4MN3A 3CAMA 2SOBA 3VR2A 3ER0A 1V51A 3E5NA 3KYHC 1U4PA 1A63A 3K3VA 5CB4F 1I4GA 5KFUA 5KKNB 1KTKA 2ENBA 3GIQA 4TQRA 2MJ8A 2BCOA 1JJCB 3A5ZB 4XT3B 3IFDA 2Z6BA 1Q1BA 4BY1G 3MHBA 1OO9B 1LABA 1A3VA 1Z7TA 5IP9G 5KT2A 2JA8B 3RFCA 2EQSA 5KT5A 2JA7H 2FE3A 4BBSG 1H9MA 4DV7Q 2XD4A 4IUTA 5LHY1 2W9CB 2G9HD 1F9QA 2GPWA 4IWYA 2B2YC 1IBMH 3EPIA 4R1JA 4EX5A 1U4RA 3V6JA 1W3SA 2F52A 3S24A 1S5FD 3PIOA 2XCLA 2RHQB 4B3SQ 1J9OA 2I0QA 4A3IH 3GILA 3CPWA 2W9BB 1PRTB 1BXRA 2RBMA 1IBLL 2JEAI 2YRXA 3AFPA 3ULLA 1XMOL 1PV4A 1E2WA 4Q43A 2WYOA 2HVQA 4A3CH 2JYOA 1RCVD 4ZLTF 3A56A 2J9GA 2R8GA 3UDIA 3C1EA 2LXJA 2DN8A 2PZWA 3I2ZA 1QZGA 2VA2A 2K5HA 4B3RQ 2KCNA 3CCMA 2JA7G 4LSXA 5D8DA 5IYBH 5I6WA 1UNNC 1NTGA 5F9LA 1ASYA 5GROA 2Z1CA 3BZKA 4U7CA 1EZ1A 4FF4A 4K5VA 2ICIA 4RNOA 1BOSA 1CI3M 3EROA 2E2JB 2RVLA 1TWCA 4OWWB 1H95A 2E5LH 5C1OA 1JE5A 3JC66 1Q8IA 5C5JA 4DR4H 3GTMA 3F8NA 3A74A 2VL6A 1M1KC 1EEFD 3B6YA 3HRZC 1SYDA 4JCVE 4JI8Q 5KG2A 5JJKA 4J0MA 4X3KA 3KLWA 2MFIA 5BN4A 1BCPB 4C56C 2KCCA 1PH8A 1EY5A 4X66L 2E2IA 3S16H 2UXCH 1HNWQ 4JI2L 1BKBA 4OONA 2YU9B 1VQIA 2F4VQ 1TT2A 3VYUA 3MR3A 3GV3A 5C44G 4GKJL 4DV0H 2ZT9C 4I55F 3H91A 4Q8FA 1Y1WB 3Q2OA 2FJ2A 4ECTA 3H40A 1O7IA 4UP8A 1BR9A 5DAUA 1Z2OX 4BBRB 4ECZA 1PXUA 4JI6H 1H9SA 1E4FT 3BQ0A 1LTTD 3U9TA 3NTHA 4H0LC 4UDUC 1U0LA 2PYKA 1M4VA 4BBSB 4MIUA 2D2CC 2ASBA 2VUMH 3K5LA 4JI7Q 4A3LG 2VQEL 5EZYF 2OF1A 5D1PA 2BQUA 4X65H 4J9NA 4DR3L 4WJWA 5HBRB 3I91A 4XIGS 1SNQA 1SNCA 4JV1A 4DV5L 4JC0A 1I94Q 3TMEA 3LWUA 4RCOA 4O2AF 1GKHA 4A3KH 5FK9C 2YV5A 4IZ8A 3PN1A 5LL6b 2DIKA 3LWBA 2DLNA 1VQLA 1S10A 4O3QA 3N52A 1D7QA 3RB0A 2YW2A 1NR2A 4JW0A 5A2QW 3S1MH 1FNVA 5K36G 4FDBA 2YRWA 2RCFA 5IYCH 2F1MA 5LXTF 1HZ9A 1ILQA 1E22A 2EVBA 1T3NA 2VZAA 5C4JH 4LNQA 1CSQA 1HA5A 4DUYH 1W6JA 1ASZA 3GO5A 1L2ZA 4RAYA 3CPFA 5J3BA 1LO5D 2L0CA 1U9RA 5DLQE 3I73A 4JI6Q 4YIJA 3NWTA 4RGNA 5IGEA 1Q90A 5C3WA 1YJWA 5DQIA 1KLGD 2VR1A 1K1QA 4YHHL 1UE6A 2H4OA 5ELFA 3NXWA 1X55A 1XXGA 2CHBD 2J7ZA 1IYJB 2PMZB 1XMQL 1SMYD 5JVDF 4A3LH 4IFDG 1N34H 3K0XA 2L15A 3FKIA 1G2TA 1T94A 4O3RA 3RV4A 3BDOA 1RD9D 4KTAA 2UUBQ 2X69A 5DLGA 3RBEA 5KYIA 3T1YQ 1G51A 3K5OA 5KRUA 3VR3A 4LF8H 3OYYA 4UY8C 5KFZA 4K8IA 4MA5A 1B9NA 2UU9H 2PQAA 1JQYD 1Y1WG 3Q8DA 3KUPA 1HNWL 4IFDH 3KJOA 1GUWA 1Z2PX 1F77A 1KJ8A 1SRUA 1BJTA 3EFXD 5EWFA 3TQ1A 5FJ8H 4K2KA 3ULJA 2F0PA 2JA5G 2AUKA 1VQJA 3RR5A 2B63B 4LAAA 4LH6A 2WB1A 2B8GA 1EU4A 4JBWA 2EXDA 1GUTA 3U50C 1QG7A 1NSNS 4DR5Q 3ZJYC 2NVTB 2TSSA 2DY8A 1NNXA 3GV6A 2VPQA 1F2LA 3K5NA 1ZHSA 4H44C 1VQOA 1KC7A 4OWXB 4DK3C 1ZQ7A 1YNJD 2QW7A 4DV5Q 4KY6A 1K8AC 2F0OA 3J81W 2SDFA 5D1OB 5KFHA 3HOWH 3N40P 1UEAB 2RDFA 4ZKCB 1M7JA 4LF4H 5C6AA 4A3DH 2HVSA 4ILWA 5HURA 1SEBD 4A3JH 1BNCA 5DNFA 1E1TA 3HOZB 1XTCD 4OGQC 2YU9H 2BDOA 4K5WA 2B2YA 3MFYA 1KJ9A 2YZGA 4HJAA 4LMYA 4IZOA 3RLNA 1EOVA 3PIO3 4ALPA 2XWJB 1HR0L 5KFBA 1S0MA 2LXKA 3KLSA 4AQYL 1VCIA 4IAJA 1VBGA 1NCVA 3I55A 1VQ6A 2PZUA 1FNUA 2F0WA 4DXFA 4DR6H 4TVAB 4CKCA 5IWAH 3S15B 1EZ6A 1FVIA 3NUCA 3OTOH 1B04A 3NTIA 4CDFC 3A5UA 3CCRA 3OIQA 1HRJA 2V5AA 1YBYA 4ED0A 5KFCA 3DHQA 4DAYB 2W6MA 3OSPA 2R93A 2FFKB 3CMEA 2A69D 2F0VA 4POGA 1A6XA 3GV7B 1YJ9A 2PW5A 3J80W 3T5HA 5KFMA 5M5XH 2QF7A 1B50A 4KY7A 3MFHA 1LTRD 3T1YL 3OTOL 1VQ9A 2YYZA 3A8JE 2FB9A 2XGPA 1XMOH 1I50A 1N33L 4O4IF 3I70A 1I7NA 1B6RA 2EYPA 3WO1A 3PO2H 4N8FA 1I4QA 3MXNA 2D62A 4MZ9A 3A8KE 1O75A 1SSOA 4RA8A 2CW7A 1WTPA 2W9AA 3I4LA 2BE5C 4I7ZC 3KFUA 2L1BA 4X62H 4ODGA 4QWEA 2W9BA 1NR4A 4X3UA 4R8IA 1GSOA 4EYIB 3T1HH 1SYGA 4DK1A 1EWCA 5JEAH 1TAEA 5IGGA 2PNHA 4A2BA 3GTOH 5I9OA 1CKMA 4JYAL 1PTOH 4OO1I 3KHGA 1CTMA 4Q8EA 1HFGA 3GTGH 3FKIG 4GLVB 4DR2L 2Q2UA 1CQJB 2HJWA 3JAMi 3NTKA 1EFWA 4B3TH 5EPKA 1A3UA 4DR4L 3CC2A 2KVMA 2KUMA 1L0WA 1PTOD 2ATWA 1CSPA 4AYBG 2C5CA 2DWCA 2BOSA 1HHVA 1IXRA 1S3OA 3UDGA 1K1SA 3EA6A 4ETSA 3DEPA 5LL6X 3RZOB 2KA7A 3S14B 2KCMA 4LSAA 3LGJA 3STBC 4XDXA 4OX9L 4A3IG 3RLFA 1SR3A 3HKZG 1VKZA 1STBA 5LA6F 3DM1A 1VMCA 3EJIA 2PI2E 4DL2A 4QW8A 3SE0A 2MP1A 3MEFA 3NBIA 2F0GA 3W1GA 5C4XG 2HCCA 5KFIA 1PTOB 2ICEC 3J81c 2A6ED 4Q45A 4DL7A 4RKBA 1UC9A 2JA6A 4PG3A 5KFOA 4AH6A 3J81i 2K5VA 2ES2A 5BR8Q 3CRKC 3GTQH 3FKIB 1UUPA 1MGSA 5F2DA 3RIZA 4A3GG 3IN5A 4DUZH 2ZXRA 1PFNA 4KV6A 5IGCA 3HOWG 3AMUA 1MBYA 3PW2A 1EYGA 1TWHB 1CZWA 1SJHD 4MV6A 4LFAQ 1KNEA 2WP8J 4FNFA 5G3LF 1Y8OB 2J6UA 4R4QA 4R4TA 3HP3A 5K2MA 3FPUB 4OL7A 4CDEC 4L1KA 5J2UF 2F0HA 1O80A 5CMDA 4B3TL 4YY3L 4X64H 3CCUA 1BF4A 1KL9A 3HKZB 4BA1I 4DXGA 3GDEA 4IO9A 1YVCA 4GN3B 3FRPB 3D6CA 1DGSA 3PW0A 1I4HA 2NZHA 2OT2A 1V4YA 4H13C 2UVVA 3Q22A 2QKIC 2F4IA 4NXNH 4RB0A 1PYWD 4KY5A 1M0TA 1U4LA 1B7YB 4FP5D 4UCUA 1KRSA 1O7ZA 3GTJH 1JJ2A 5KFGA 4A3KB 3TZDA 2UXBL 2MNAA 2H5XA 1N36L 2UXDL 2HUGA 3A7LA 2KSWA 4O4LF 5FOBB 3I72A 4LWCA 2ZXOA 5C3EH 1R9TA 1JICA 2EYFA 1X56A 5GAEC 4KN4C 1V1PA 1ZYRC 4P74A 4WORA 1G8ZD 2UU9L 2M05A 4C5CA 5C0XG 3F2BA 3H0GB 1EY8A 2IHFA 3GTGA 2RCNA 3NWSA 4PZ8A 5CV8A 1XJVA 2IPKD 4LF7L 2FXQA 1EFID 1HNWH 5C4XB 2FK1A 4LFCQ 3NENA 1LTGD 1JB7A 4QL5A 3BDCA 5M3MB 2YTYA 2IX1A 5NUCA 3MVVA 3F2DA 1UEBA 1Y8PB 3BZDB 4QUFA 5KG3A 5IGDA 4NDXA 2RGRA 1C8CA 2OWOA 5FO8B 3GIDA 2I5LX 5CR3A 2B3GA 4G7OC 3WOEA 4A3EB 3BJYA 3GQBA 5I2YA 1PFMA 5J39A 2EYJA 4YQWA 2C2DA 3R5FA 3GTJA 2R92H 2JEFA 4DR1L 1LT3D 2UUCQ 2KHJA 5BR8L 4IQZA 1JJGA 1K3BC 2A6HD 2HDLA 4DF7A 4RNMA 1STHA 3FP9A 3KLSX 2W8KA 3RV3A 4RMFA 2C35B 2AQ2B 1ZEQX 1TQOA 5JPMC 2J6SA 3UDFA 1QB5D 4BY1B 1JOQA 3MZ5A 4CJ1B 5JVLA 1SXTA 1L1OA 4DR2Q 1SROA 4S3SA 2ZTEA 4LJZC 3EYYA 4GOPA 2RQXA 4IR1A 1NE3A 4KD3A 2K5NA 1VMPA 2VS1A 1M90C 3QFFA 5KG1A 3GTMH 3QOLA 2KEDA 4DV6Q 3QB3A 3STBD 1HJPA 4DR7Q 4F4ZA 2XTIA 4K14A 1ZHQA 4MTEA 3VPBA 4DA2A 3HOXB 1IBKL 3M7GA 3U9OA 3M4YA 2CZGA 2JA8H 4ABNA 5I6YA 1RHPA 5M5XB 1LT5D 1VF5C 4LMQD 3ORRA 3MXPA 3V6KA 1CQFA 1YNND 1KD1C 1EYCA 3N6RA 4O2DA 3GTQA 4RHSA 5J1ZA 2RHSB 4Q0FA 2R7NA 5KFYA 3Q23A 2JA9A 2V1CC 5IWAL 4XT1B 5KFEA 1AFPA 3LX0A 1AN7A 4P75A 5LMUL 4DAPA 5FD6A 3MFGA 1BCPF 1TS5A 4P2CB 3F1ZA 3NK9A 1IZ6A 2XSCA 4JK1C 1GLVA 4DV0L 2K03A 1S72A 2VPSA 5HY6A 4GNXB 1MJCA 2B2UA 1ULZA 3UE1A 3ND8A 2GVBA 1QVFA 4L5QA 5EPLA 3H6MA 4QQBX 2JEGA 4L6TB 3QIAA 5KFSA 2HIXA 5ELOA 5C3EG 1LTID 4QJFA 1PYBA 2NWGA 2R92B 4A2AA 3ONAB
chains in the Genus database with same CATH topology
2R6GA 4NXNQ 5IYBH 1NTGA 1MKHA 1ASYA 5GROA 4JI1L 4BY7G 5IY0A 3BZKA 1CKNB 1OXXK 1WCMG 4B3MQ 4YCWA 4B3SL 2CCZA 3J80i 2K14A 4B3TQ 4GKJQ 1GVPA 1YEZA 3I4MG 4IJLA 1HZAA 5IT9c 4DV4Q 3PGZA 3KF8B 1PH7A 4OWWB 1WOCA 1I6HH 1H95A 3MXNB 1Y1WH 2I5HA 1JE5A 3JC66 4A3KG 2JEAI 3A74A 2QGQA 3UE0A 2VL6A 3NEMA 4A3GH 1M1KC 3B6YA 3W1BA 4JCVE 4A93G 4JI8Q 3A0JA 1PH3A 4L5RC 4A3FG 4LF6L 5JJKA 1HH2P 2UUAL 4DK6C 1X54A 3KLWA 2MFIA 3KDFB 4DPGA 4A3CG 4C3JH 1N36Q 3PSIA 4DV7L 4X66L 2ZJPA 3KF6B 1PH8A 4L5SA 3S16H 4BXXG 4P71A 4JI2L 4JI6L 1HNWQ 1BKBA 4OONA 3HOXH 1VQIA 2F4VQ 3HOUG 3PO3H 4QIWE 4GKJL 5C44G 3NBHB 4IFDJ 1YITA 2R92G 1MJEA 3CC7A 4GKKL 1X3FA 1AH9A 1O7IA 4UP8A 3E9IA 2EIFA 5IP7H 1U5KA 3ULPA 4LF4L 4JI7L 2AWNA 1XPUA 1FL0A 1YNXA 4DUYQ 3F2CA 1FGUA 2N78A 3VDYA 1U0LA 4A3EH 5GAGC 2ASBA 2VUMH 1HZBA 1KQSA 4JBJA 2NVXH 4JI0Q 4JI7Q 4IPCA 2VQEL 2JA6G 5M3MG 4A3LG 1PVOA 1A8VA 1XTDA 4MNOA 2HHHQ 5C0XI 2UU9Q 4DR3L 3CCLA 4IOCA 4X64Q 4XIGS 4JI1Q 4GN4B 3DM3A 2AKWB 3CQZH 3IRBA 1TWFH 2ID0A 5C4XH 4YY3Q 4JC0A 4DV5L 1I94Q 1N32L 5IE8A 2HHHL 2ZM6L 1GKHA 3AQQA 3TRZA 4A3KH 2YV5A 2OCEA 1UE5A 1VQLA 3M9BA 1VQ4A 3J7ZC 1D7QA 4X62L 3T1HL 3KJPA 4A3FH 4DV0Q 1PFSA 3S1MH 5K36G 3BZCA 2ZM6Q 3HKSA 4FDBA 5IYCH 2R7ZH 4HJ8A 1PH2A 1Q7YC 1HZ9A 3K80C 4JI4Q 2N49A 1E22A 1X65A 2VZAA 5C4JH 4LNQA 1CSQA 1YI2A 1ASZA 3RN5A 3GO5A 1VQKA 1NBWA 3CPFA 4JOIC 2A19A 3BJUA 2CWPA 5DLQE 1YHAA 5J3BA 3H3VH 2IX0A 4JI6Q 3CCSA 1QVGA 4B3RQ 1N32Q 1Z9FA 3S1NH 1YJWA 2NVQH 4BY7H 1EIFA 4YCUA 4GNXC 4LF5L 2UXBQ 1N9WA 4YHHL 1UE6A 2B63G 1EQRA 1X55A 3TS2A 1Z47A 2MO1A 2Y0SE 4DNIA 1G291 1IYJB 4QY7A 1XMQL 4LF8L 1HNXQ 4PZ7A 4A3LH 2E5LL 2AWOA 2VUMG 2ALYB 4IFDG 3K0XA 4JI4L 2L15A 2NN6G 3I4OA 4LUVA 1Q1EA 1K83H 4GN5A 3CC4A 3ERSX 2UUBQ 4JI0L 2R7FA 4DR7L 1CUKA 2K50A 1G51A 3T1YQ 2R93H 2XGTA 3OYYA 4UY8C 2LSSA 1PH1A 2CFMA 1T9HA 4LFCL 2DGYA 3AEVA 3M3YH 4NXMQ 2PQAA 3H15A 1JT8A 4LF4Q 1WCMH 4DAMA 3U58A 3G4SA 3Q8DA 1OXTA 3TEHB 5H1SE 1Y1WG 2UUBL 1HNWL 3KJOA 3E9HA 4OXPA 2BH8A 1I50H 3PIPA 5M3FH 4DV1Q 4ME3A 1Q86C 2E2JH 3JAMc 4HIKA 3M4OH 4BA2I 1J6QA 4R4CA 3U4ZA 5HGQA 1SRUA 4DV3Q 1XPRA 4LF7Q 2JJQA 3FKIH 5FJ8H 2HT1A 1E24A 3NELA 3ULJA 3RZOH 3CCJA 3OW2A 2MQHA 2JA5G 1VQJA 3RR5A 3GD7A 1V1QA 2E2IH 4JBWA 2EXDA 3U50C 2ZJQA 1J5EL 2BA0A 2HIVA 3CXCA 4KLKA 1LYLA 3I4MH 5GADC 1A62A 4DR5Q 1VQBA 1WJJA 4RG1A 2WAQG 3ZJYC 1XMOQ 1OTCA 4KHPL 2MO0A 4A76A 3PF5A 3CF5A 2B29A 4Y7NH 2KBNA 1OXVA 1VQOA 3DLLA 3FHWA 4OWXB 1E7ZA 4DK3C 1VQCA 3K8AA 3E0EA 3CCQA 4DV5Q 3PUVA 1K8AC 3K7UC 4BBSH 1JMCA 4HIMA 4IFDI 3HOWH 1Y1VG 2CWAA 1VQPA 1HZCA 4OWTB 3M85A 3HOZH 4A3DH 4A3JH 1I3QH 1AE3A 4A3MH 4LF5Q 1EWIA 1E1TA 4L5TA 3PUXA 4TQUS 5M3FG 4LW1A 2YU9H 1PH4A 1HNZQ 4NXML 4HJAA 1KAWA 1XNRL 1GM5A 1L1OB 3RLNA 4GLAC 1EOVA 4ALPA 5JEAG 3RLOA 1HR0L 1P16A 2LXKA 3M4QA 2Q2TA 4P72A 1MIUA 1TXYA 4AQYL 2JEBI 1VCIA 2JK8A 3HOYG 4PZ6A 3I55A 4HIOA 1UE1A 5IYDG 1HR0W 3CCVA 1VQ6A 4LFBQ 1RL2A 3H0GG 4TVAB 1BBWA 1FVIA 3RZDH 2Z6KA 5ELNA 1YZ6A 3A5UA 1LM0A 3CCRA 1SFOH 1YBYA 4DAYB 1R9TH 3BU2A 2R7DA 2K52A 3CMEA 5M5WH 3G48A 4JI3Q 4POGA 1FJGL 1HNZL 2Q2HA 3KDFA 3S2HH 1YJ9A 2D0OA 3HOZG 4A3DG 4DR1Q 2OTJA 5M5XH 2Y0SG 3KF6A 4BY1H 3M4PA 1LTLA 1NMGA 4X64L 3PUWA 3HOXG 3HOUH 3T1YL 1OXUA 3OTOL 2YYZA 1VQ9A 5FLMH 3KOJA 4A3BG 1N33L 3D0FA 2A1AA 3CCEA 4DV2Q 1E1OA 1IBLQ 2ZTDA 3AFQA 3PO2H 3S15H 1IL2A 4MZ9A 2D62A 1PA6A 4JYAQ 4K0KQ 1K9MC 1L1OC 3HOYH 3J80c 2IY5B 4DV3L 3ICEA 3KFUA 4BBRG 4KHZA 2NN6I 3G71A 1QZHA 1VQNA 4DV4L 3G6EA 4GOPC 4DR4Q 4P73A 4NPSA 3EBEA 1L2FA 1AE2A 2PNHA 4JG2A 3EN2A 1KIXA 3GTOH 1CKMA 3U4VA 4JYAL 1TWGH 4UPAA 4K0KL 4OO1I 3EIVA 2CKZB 1P8LA 1Q82C 2NZOA 3GTGH 1B70B 2A8VA 3FKIG 4GLVB 4DR2L 2Q2UA 3HOVG 2WB1E 3JAMi 4YCVA 1EFWA 5LMNL 4DR4L 2RF4A 3CC2A 4IPHA 4KHPQ 3SGIA 1L0WA 4HIDA 4WJ3M 4APVA 5M3MH 2ATWA 2JA6H 1CSPA 4AYBG 4JI2Q 2AMCB 4Y52H 4WJ4A 4DR6L 1IXRA 1S3OA 2D0PA 3UDGA 1CKNA 2E5LQ 5JEAJ 3PO2G 2ZJRA 1W2BA 3S17H 2KCMA 3LGJA 3STBC 4OX9L 4A3IG 3RLFA 2I5MX 2WB1G 1XPOA 5LMUQ 1SR3A 3HKZG 2OTLA 1FJGQ 2UXCQ 1TWHH 4LFAL 4R4IA 2NVYH 4YWMA 5FLMG 2PI2E 4UP9A 3MEFA 1D8LA 2NVTH 1EUJA 3L2PA 1C0AA 3W1GA 1OXSC 5C4XG 4GLXA 1TWAH 5FJ8G 3S1QH 4LFBL 3J81c 4R4OA 1B8AA 4IPGA 4PG3A 4AH6A 4GKKQ 3J81i 2B63H 4YWKA 2K5VA 3PUZA 3K81C 1VQFA 1PH5A 5LMNW 5BR8Q 2KHIA 2ES2A 3GTQH 4DUYL 1EIYB 4JBMA 3M7NA 3GTLH 2BH2A 4A3GG 4JI3L 1Y1VH 1UWVA 4YWLA 4C3IH 1VQDA 2AHOB 3CD6A 3HOWG 4LF9L 1NMFA 3PV0A 4J15A 1EYGA 4LFAQ 3CW2C 4GOPB 2WP8J 1UE7A 2OQ0A 4R4QA 4R4TA 4JOIA 5FLXc 4DR3Q 4B3TL 4YY3L 4QGUA 1BBUA 2VQFL 3CCUA 4GNXA 1KL9A 2PQAB 4BA1I 1CKOA 2DUDA 3GDEA 4NXNL 4IO9A 2N3SA 1YVCA 2JE6I 1SMXA 4GN3B 1VS0A 5GQOA 1PHJA 4B3ML 5C44H 1DGSA 1C9OA 1VQ7A 2UUAQ 4XTCS 2NZHA 4OO1G 1C7YA 3H0GH 4EQ5A 4IJHA 4POFA 1PH9A 4PMWA 4O0AA 4X65L 1SE8A 3J81j 4X6AH 1A0IA 1LUZA 2VW9A 3I7FA 1XNQL 2UXDQ 2R93G 3HFZB 1YJNA 1HNXL 3J7A5 1GO3E 1B7YB 5AJ3L 3PO3G 4JI8L 1KRSA 5IYCG 2R7ZG 2VNUD 3GTJH 1JJ2A 5IYDH 1PYSB 1SN8A 4JBKA 2UXBL 2MNAA 2QEXA 3RN2A 2H5XA 1N36L 1XNQQ 2UXDL 4MTNA 4IPDA 1K3RA 5IYBG 1N34L 4JV5L 5M5YH 3S14H 4A3BH 2F4VL 1XMQQ 4LF8Q 3GTPH 4LWCA 4UP7A 1NJIC 5E7NA 3GTKH 4DUZL 4OX9Q 5C3EH 1S40A 4HJ5A 2YTXA 1X56A 1QUQB 1X3EA 5GAEC 4HJ9A 1N34Q 1NY4A 5IWAQ 2OQKA 1YIJA 4P74A 1QVCA 4IOAA 2UU9L 1WFQA 1XNRQ 1Q12A 4NB3A 4DV1L 5JJIA 2ZTCA 5C0XG 3F2BA 2PMZE 2IHFA 4LUOA 2RCNA 4PZ8A 4BBRH 5EAYA 1XJVA 4KI0A 4LF7L 2FXQA 1I94L 4A93H 4LFCQ 3NENA 1JB7A 2IX1A 4QL5A 2GN5A 2YTYA 1K73C 3PCOB 3F2DA 2UXCL 1V9PA 1VQMA 2VQEQ 3TS0A 1UEBA 2UUCL 1V43A 5C0XJ 2OWOA 2I5LX 2B3GA 1KC8C 2WFWA 2E2HH 2PI2A 2YTVA 4C2MH 1KRTA 4DV2L 1VQGA 3HKZE 1K0RA 1WI5A 3PF4A 1KHIA 1N8RC 2R92H 4DR1L 2UUCQ 1Q46A 1PH6A 2KHJA 3UDXA 5BR8L 1Q8KA 5IP7G 4X65Q 1JJGA 2HQLA 2JQOA 2BA1A 3L7ZC 3FP9A 4X62Q 3T1HQ 4A3JG 1J5EQ 4RMFA 1YHBA 4A75A 2C35B 1N33Q 4LF9Q 5IP9H 1YHQA 2K75A 3WWVA 5AJ3Q 3UDFA 1X9NA 1Q81C 5GAHC 4X66Q 3K7AH 1IBMQ 4C3HH 1BVSA 2VY3A 2GVAA 3S1RH 1L1OA 1WYDA 1SROA 4DR2Q 2Q2IA 1X3GA 2E8GA 1Y14B 2Z0SA 2ZTEA 4H02A 5LMNQ 1KXLA 3F8TA 2N8NA 4GOPA 1VQEA 2WAQE 4HJ7A 4A3EG 1NE3A 1VQHA 1IBKQ 1VQ5A 3I4NH 1I5FA 2K5NA 3L0OA 4GS3A 3AYHB 1VQ8A 2VS1A 4YHHQ 1M90C 2KCTA 2JA5H 3GTMH 3CAMA 4DV6Q 3STBD 1HJPA 4DR7Q 3ER0A 1HR0Q 2XTIA 2Z6KC 4DKAC 3KYHC 1A63A 4AQYQ 1IBKL 2K4KA 3W5OA 1JJCB 2JA8H 4AYBE 4DV6L 3A5ZB 1IBML 4JV5Q 1Q1BA 4BY1G 1IBLL 3HOVH 4DR6Q 1K8GA 4A4IA 1KD1C 5IP9G 2IHEA 4O2DA 4JI5L 2EQSA 4AIMA 2JA7H 4DUZQ 1QUQA 2RHSB 2CQOA 4BBSG 4DV7Q 1TWCH 2JA9A 2V1CC 5IWAL 1G6PA 1EQQA 4P75A 5LMUL 3H3VI 2QA4A 4R1JA 4EX5A 3F1ZA 3OTOQ 1IZ6A 1W3SA 1X6OA 2F52A 3S24A 3PIOA 3I4NG 4DV0L 3CMAA 2RHQB 2IT1A 1S72A 4B3SQ 2KENA 2I0QA 1VQAA 3CP0A 5HY6A 3CPWA 3RNUA 4A3IH 4DR5L 2F3IA 1SLJA 1MJCA 3I56A 4GNXB 4A3MG 3AFPA 3UE1A 3ULLA 3TREA 1XMOL 1PV4A 2GVBA 4LUZA 3PUYA 4L5QA 1QVFA 4B3RL 4A3CH 4QQBX 3D31A 4JI5Q 1GD7A 2HIXA 1E3PA 5ELOA 2JA8G 3UDIA 5C3EG 1RIPA 2VQFQ 4QJFA 1PYBA 4LF6Q 2LXJA 4BXXH 3I2ZA 3S2DH 1QZGA 5JJLA 2K5HA 2JA7G 3CCMA 3TQYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R6G A;  4NXN Q;  5IYB H;  1NTG A;  1MKH A;  1ASY A;  5GRO A;  4JI1 L;  4BY7 G;  5IY0 A;  3BZK A;  1CKN B;  1OXX K;  1WCM G;  4B3M Q;  4YCW A;  4B3S L;  2CCZ A;  3J80 i;  2K14 A;  4B3T Q;  4GKJ Q;  1GVP A;  1YEZ A;  3I4M G;  4IJL A;  1HZA A;  5IT9 c;  4DV4 Q;  3PGZ A;  3KF8 B;  1PH7 A;  4OWW B;  1WOC A;  1I6H H;  1H95 A;  3MXN B;  1Y1W H;  2I5H A;  1JE5 A;  3JC6 6;  4A3K G;  2JEA I;  3A74 A;  2QGQ A;  3UE0 A;  2VL6 A;  3NEM A;  4A3G H;  1M1K C;  3B6Y A;  3W1B A;  4JCV E;  4A93 G;  4JI8 Q;  3A0J A;  1PH3 A;  4L5R C;  4A3F G;  4LF6 L;  5JJK A;  1HH2 P;  2UUA L;  4DK6 C;  1X54 A;  3KLW A;  2MFI A;  3KDF B;  4DPG A;  4A3C G;  4C3J H;  1N36 Q;  3PSI A;  4DV7 L;  4X66 L;  2ZJP A;  3KF6 B;  1PH8 A;  4L5S A;  3S16 H;  4BXX G;  4P71 A;  4JI2 L;  4JI6 L;  1HNW Q;  1BKB A;  4OON A;  3HOX H;  1VQI A;  2F4V Q;  3HOU G;  3PO3 H;  4QIW E;  4GKJ L;  5C44 G;  3NBH B;  4IFD J;  1YIT A;  2R92 G;  1MJE A;  3CC7 A;  4GKK L;  1X3F A;  1AH9 A;  1O7I A;  4UP8 A;  3E9I A;  2EIF A;  5IP7 H;  1U5K A;  3ULP A;  4LF4 L;  4JI7 L;  2AWN A;  1XPU A;  1FL0 A;  1YNX A;  4DUY Q;  3F2C A;  1FGU A;  2N78 A;  3VDY A;  1U0L A;  4A3E H;  5GAG C;  2ASB A;  2VUM H;  1HZB A;  1KQS A;  4JBJ A;  2NVX H;  4JI0 Q;  4JI7 Q;  4IPC A;  2VQE L;  2JA6 G;  5M3M G;  4A3L G;  1PVO A;  1A8V A;  1XTD A;  4MNO A;  2HHH Q;  5C0X I;  2UU9 Q;  4DR3 L;  3CCL A;  4IOC A;  4X64 Q;  4XIG S;  4JI1 Q;  4GN4 B;  3DM3 A;  2AKW B;  3CQZ H;  3IRB A;  1TWF H;  2ID0 A;  5C4X H;  4YY3 Q;  4JC0 A;  4DV5 L;  1I94 Q;  1N32 L;  5IE8 A;  2HHH L;  2ZM6 L;  1GKH A;  3AQQ A;  3TRZ A;  4A3K H;  2YV5 A;  2OCE A;  1UE5 A;  1VQL A;  3M9B A;  1VQ4 A;  3J7Z C;  1D7Q A;  4X62 L;  3T1H L;  3KJP A;  4A3F H;  4DV0 Q;  1PFS A;  3S1M H;  5K36 G;  3BZC A;  2ZM6 Q;  3HKS A;  4FDB A;  5IYC H;  2R7Z H;  4HJ8 A;  1PH2 A;  1Q7Y C;  1HZ9 A;  3K80 C;  4JI4 Q;  2N49 A;  1E22 A;  1X65 A;  2VZA A;  5C4J H;  4LNQ A;  1CSQ A;  1YI2 A;  1ASZ A;  3RN5 A;  3GO5 A;  1VQK A;  1NBW A;  3CPF A;  4JOI C;  2A19 A;  3BJU A;  2CWP A;  5DLQ E;  1YHA A;  5J3B A;  3H3V H;  2IX0 A;  4JI6 Q;  3CCS A;  1QVG A;  4B3R Q;  1N32 Q;  1Z9F A;  3S1N H;  1YJW A;  2NVQ H;  4BY7 H;  1EIF A;  4YCU A;  4GNX C;  4LF5 L;  2UXB Q;  1N9W A;  4YHH L;  1UE6 A;  2B63 G;  1EQR A;  1X55 A;  3TS2 A;  1Z47 A;  2MO1 A;  2Y0S E;  4DNI A;  1G29 1;  1IYJ B;  4QY7 A;  1XMQ L;  4LF8 L;  1HNX Q;  4PZ7 A;  4A3L H;  2E5L L;  2AWO A;  2VUM G;  2ALY B;  4IFD G;  3K0X A;  4JI4 L;  2L15 A;  2NN6 G;  3I4O A;  4LUV A;  1Q1E A;  1K83 H;  4GN5 A;  3CC4 A;  3ERS X;  2UUB Q;  4JI0 L;  2R7F A;  4DR7 L;  1CUK A;  2K50 A;  1G51 A;  3T1Y Q;  2R93 H;  2XGT A;  3OYY A;  4UY8 C;  2LSS A;  1PH1 A;  2CFM A;  1T9H A;  4LFC L;  2DGY A;  3AEV A;  3M3Y H;  4NXM Q;  2PQA A;  3H15 A;  1JT8 A;  4LF4 Q;  1WCM H;  4DAM A;  3U58 A;  3G4S A;  3Q8D A;  1OXT A;  3TEH B;  5H1S E;  1Y1W G;  2UUB L;  1HNW L;  3KJO A;  3E9H A;  4OXP A;  2BH8 A;  1I50 H;  3PIP A;  5M3F H;  4DV1 Q;  4ME3 A;  1Q86 C;  2E2J H;  3JAM c;  4HIK A;  3M4O H;  4BA2 I;  1J6Q A;  4R4C A;  3U4Z A;  5HGQ A;  1SRU A;  4DV3 Q;  1XPR A;  4LF7 Q;  2JJQ A;  3FKI H;  5FJ8 H;  2HT1 A;  1E24 A;  3NEL A;  3ULJ A;  3RZO H;  3CCJ A;  3OW2 A;  2MQH A;  2JA5 G;  1VQJ A;  3RR5 A;  3GD7 A;  1V1Q A;  2E2I H;  4JBW A;  2EXD A;  3U50 C;  2ZJQ A;  1J5E L;  2BA0 A;  2HIV A;  3CXC A;  4KLK A;  1LYL A;  3I4M H;  5GAD C;  1A62 A;  4DR5 Q;  1VQB A;  1WJJ A;  4RG1 A;  2WAQ G;  3ZJY C;  1XMO Q;  1OTC A;  4KHP L;  2MO0 A;  4A76 A;  3PF5 A;  3CF5 A;  2B29 A;  4Y7N H;  2KBN A;  1OXV A;  1VQO A;  3DLL A;  3FHW A;  4OWX B;  1E7Z A;  4DK3 C;  1VQC A;  3K8A A;  3E0E A;  3CCQ A;  4DV5 Q;  3PUV A;  1K8A C;  3K7U C;  4BBS H;  1JMC A;  4HIM A;  4IFD I;  3HOW H;  1Y1V G;  2CWA A;  1VQP A;  1HZC A;  4OWT B;  3M85 A;  3HOZ H;  4A3D H;  4A3J H;  1I3Q H;  1AE3 A;  4A3M H;  4LF5 Q;  1EWI A;  1E1T A;  4L5T A;  3PUX A;  4TQU S;  5M3F G;  4LW1 A;  2YU9 H;  1PH4 A;  1HNZ Q;  4NXM L;  4HJA A;  1KAW A;  1XNR L;  1GM5 A;  1L1O B;  3RLN A;  4GLA C;  1EOV A;  4ALP A;  5JEA G;  3RLO A;  1HR0 L;  1P16 A;  2LXK A;  3M4Q A;  2Q2T A;  4P72 A;  1MIU A;  1TXY A;  4AQY L;  2JEB I;  1VCI A;  2JK8 A;  3HOY G;  4PZ6 A;  3I55 A;  4HIO A;  1UE1 A;  5IYD G;  1HR0 W;  3CCV A;  1VQ6 A;  4LFB Q;  1RL2 A;  3H0G G;  4TVA B;  1BBW A;  1FVI A;  3RZD H;  2Z6K A;  5ELN A;  1YZ6 A;  3A5U A;  1LM0 A;  3CCR A;  1SFO H;  1YBY A;  4DAY B;  1R9T H;  3BU2 A;  2R7D A;  2K52 A;  3CME A;  5M5W H;  3G48 A;  4JI3 Q;  4POG A;  1FJG L;  1HNZ L;  2Q2H A;  3KDF A;  3S2H H;  1YJ9 A;  2D0O A;  3HOZ G;  4A3D G;  4DR1 Q;  2OTJ A;  5M5X H;  2Y0S G;  3KF6 A;  4BY1 H;  3M4P A;  1LTL A;  1NMG A;  4X64 L;  3PUW A;  3HOX G;  3HOU H;  3T1Y L;  1OXU A;  3OTO L;  2YYZ A;  1VQ9 A;  5FLM H;  3KOJ A;  4A3B G;  1N33 L;  3D0F A;  2A1A A;  3CCE A;  4DV2 Q;  1E1O A;  1IBL Q;  2ZTD A;  3AFQ A;  3PO2 H;  3S15 H;  1IL2 A;  4MZ9 A;  2D62 A;  1PA6 A;  4JYA Q;  4K0K Q;  1K9M C;  1L1O C;  3HOY H;  3J80 c;  2IY5 B;  4DV3 L;  3ICE A;  3KFU A;  4BBR G;  4KHZ A;  2NN6 I;  3G71 A;  1QZH A;  1VQN A;  4DV4 L;  3G6E A;  4GOP C;  4DR4 Q;  4P73 A;  4NPS A;  3EBE A;  1L2F A;  1AE2 A;  2PNH A;  4JG2 A;  3EN2 A;  1KIX A;  3GTO H;  1CKM A;  3U4V A;  4JYA L;  1TWG H;  4UPA A;  4K0K L;  4OO1 I;  3EIV A;  2CKZ B;  1P8L A;  1Q82 C;  2NZO A;  3GTG H;  1B70 B;  2A8V A;  3FKI G;  4GLV B;  4DR2 L;  2Q2U A;  3HOV G;  2WB1 E;  3JAM i;  4YCV A;  1EFW A;  5LMN L;  4DR4 L;  2RF4 A;  3CC2 A;  4IPH A;  4KHP Q;  3SGI A;  1L0W A;  4HID A;  4WJ3 M;  4APV A;  5M3M H;  2ATW A;  2JA6 H;  1CSP A;  4AYB G;  4JI2 Q;  2AMC B;  4Y52 H;  4WJ4 A;  4DR6 L;  1IXR A;  1S3O A;  2D0P A;  3UDG A;  1CKN A;  2E5L Q;  5JEA J;  3PO2 G;  2ZJR A;  1W2B A;  3S17 H;  2KCM A;  3LGJ A;  3STB C;  4OX9 L;  4A3I G;  3RLF A;  2I5M X;  2WB1 G;  1XPO A;  5LMU Q;  1SR3 A;  3HKZ G;  2OTL A;  1FJG Q;  2UXC Q;  1TWH H;  4LFA L;  4R4I A;  2NVY H;  4YWM A;  5FLM G;  2PI2 E;  4UP9 A;  3MEF A;  1D8L A;  2NVT H;  1EUJ A;  3L2P A;  1C0A A;  3W1G A;  1OXS C;  5C4X G;  4GLX A;  1TWA H;  5FJ8 G;  3S1Q H;  4LFB L;  3J81 c;  4R4O A;  1B8A A;  4IPG A;  4PG3 A;  4AH6 A;  4GKK Q;  3J81 i;  2B63 H;  4YWK A;  2K5V A;  3PUZ A;  3K81 C;  1VQF A;  1PH5 A;  5LMN W;  5BR8 Q;  2KHI A;  2ES2 A;  3GTQ H;  4DUY L;  1EIY B;  4JBM A;  3M7N A;  3GTL H;  2BH2 A;  4A3G G;  4JI3 L;  1Y1V H;  1UWV A;  4YWL A;  4C3I H;  1VQD A;  2AHO B;  3CD6 A;  3HOW G;  4LF9 L;  1NMF A;  3PV0 A;  4J15 A;  1EYG A;  4LFA Q;  3CW2 C;  4GOP B;  2WP8 J;  1UE7 A;  2OQ0 A;  4R4Q A;  4R4T A;  4JOI A;  5FLX c;  4DR3 Q;  4B3T L;  4YY3 L;  4QGU A;  1BBU A;  2VQF L;  3CCU A;  4GNX A;  1KL9 A;  2PQA B;  4BA1 I;  1CKO A;  2DUD A;  3GDE A;  4NXN L;  4IO9 A;  2N3S A;  1YVC A;  2JE6 I;  1SMX A;  4GN3 B;  1VS0 A;  5GQO A;  1PHJ A;  4B3M L;  5C44 H;  1DGS A;  1C9O A;  1VQ7 A;  2UUA Q;  4XTC S;  2NZH A;  4OO1 G;  1C7Y A;  3H0G H;  4EQ5 A;  4IJH A;  4POF A;  1PH9 A;  4PMW A;  4O0A A;  4X65 L;  1SE8 A;  3J81 j;  4X6A H;  1A0I A;  1LUZ A;  2VW9 A;  3I7F A;  1XNQ L;  2UXD Q;  2R93 G;  3HFZ B;  1YJN A;  1HNX L;  3J7A 5;  1GO3 E;  1B7Y B;  5AJ3 L;  3PO3 G;  4JI8 L;  1KRS A;  5IYC G;  2R7Z G;  2VNU D;  3GTJ H;  1JJ2 A;  5IYD H;  1PYS B;  1SN8 A;  4JBK A;  2UXB L;  2MNA A;  2QEX A;  3RN2 A;  2H5X A;  1N36 L;  1XNQ Q;  2UXD L;  4MTN A;  4IPD A;  1K3R A;  5IYB G;  1N34 L;  4JV5 L;  5M5Y H;  3S14 H;  4A3B H;  2F4V L;  1XMQ Q;  4LF8 Q;  3GTP H;  4LWC A;  4UP7 A;  1NJI C;  5E7N A;  3GTK H;  4DUZ L;  4OX9 Q;  5C3E H;  1S40 A;  4HJ5 A;  2YTX A;  1X56 A;  1QUQ B;  1X3E A;  5GAE C;  4HJ9 A;  1N34 Q;  1NY4 A;  5IWA Q;  2OQK A;  1YIJ A;  4P74 A;  1QVC A;  4IOA A;  2UU9 L;  1WFQ A;  1XNR Q;  1Q12 A;  4NB3 A;  4DV1 L;  5JJI A;  2ZTC A;  5C0X G;  3F2B A;  2PMZ E;  2IHF A;  4LUO A;  2RCN A;  4PZ8 A;  4BBR H;  5EAY A;  1XJV A;  4KI0 A;  4LF7 L;  2FXQ A;  1I94 L;  4A93 H;  4LFC Q;  3NEN A;  1JB7 A;  2IX1 A;  4QL5 A;  2GN5 A;  2YTY A;  1K73 C;  3PCO B;  3F2D A;  2UXC L;  1V9P A;  1VQM A;  2VQE Q;  3TS0 A;  1UEB A;  2UUC L;  1V43 A;  5C0X J;  2OWO A;  2I5L X;  2B3G A;  1KC8 C;  2WFW A;  2E2H H;  2PI2 A;  2YTV A;  4C2M H;  1KRT A;  4DV2 L;  1VQG A;  3HKZ E;  1K0R A;  1WI5 A;  3PF4 A;  1KHI A;  1N8R C;  2R92 H;  4DR1 L;  2UUC Q;  1Q46 A;  1PH6 A;  2KHJ A;  3UDX A;  5BR8 L;  1Q8K A;  5IP7 G;  4X65 Q;  1JJG A;  2HQL A;  2JQO A;  2BA1 A;  3L7Z C;  3FP9 A;  4X62 Q;  3T1H Q;  4A3J G;  1J5E Q;  4RMF A;  1YHB A;  4A75 A;  2C35 B;  1N33 Q;  4LF9 Q;  5IP9 H;  1YHQ A;  2K75 A;  3WWV A;  5AJ3 Q;  3UDF A;  1X9N A;  1Q81 C;  5GAH C;  4X66 Q;  3K7A H;  1IBM Q;  4C3H H;  1BVS A;  2VY3 A;  2GVA A;  3S1R H;  1L1O A;  1WYD A;  1SRO A;  4DR2 Q;  2Q2I A;  1X3G A;  2E8G A;  1Y14 B;  2Z0S A;  2ZTE A;  4H02 A;  5LMN Q;  1KXL A;  3F8T A;  2N8N A;  4GOP A;  1VQE A;  2WAQ E;  4HJ7 A;  4A3E G;  1NE3 A;  1VQH A;  1IBK Q;  1VQ5 A;  3I4N H;  1I5F A;  2K5N A;  3L0O A;  4GS3 A;  3AYH B;  1VQ8 A;  2VS1 A;  4YHH Q;  1M90 C;  2KCT A;  2JA5 H;  3GTM H;  3CAM A;  4DV6 Q;  3STB D;  1HJP A;  4DR7 Q;  3ER0 A;  1HR0 Q;  2XTI A;  2Z6K C;  4DKA C;  3KYH C;  1A63 A;  4AQY Q;  1IBK L;  2K4K A;  3W5O A;  1JJC B;  2JA8 H;  4AYB E;  4DV6 L;  3A5Z B;  1IBM L;  4JV5 Q;  1Q1B A;  4BY1 G;  1IBL L;  3HOV H;  4DR6 Q;  1K8G A;  4A4I A;  1KD1 C;  5IP9 G;  2IHE A;  4O2D A;  4JI5 L;  2EQS A;  4AIM A;  2JA7 H;  4DUZ Q;  1QUQ A;  2RHS B;  2CQO A;  4BBS G;  4DV7 Q;  1TWC H;  2JA9 A;  2V1C C;  5IWA L;  1G6P A;  1EQQ A;  4P75 A;  5LMU L;  3H3V I;  2QA4 A;  4R1J A;  4EX5 A;  3F1Z A;  3OTO Q;  1IZ6 A;  1W3S A;  1X6O A;  2F52 A;  3S24 A;  3PIO A;  3I4N G;  4DV0 L;  3CMA A;  2RHQ B;  2IT1 A;  1S72 A;  4B3S Q;  2KEN A;  2I0Q A;  1VQA A;  3CP0 A;  5HY6 A;  3CPW A;  3RNU A;  4A3I H;  4DR5 L;  2F3I A;  1SLJ A;  1MJC A;  3I56 A;  4GNX B;  4A3M G;  3AFP A;  3UE1 A;  3ULL A;  3TRE A;  1XMO L;  1PV4 A;  2GVB A;  4LUZ A;  3PUY A;  4L5Q A;  1QVF A;  4B3R L;  4A3C H;  4QQB X;  3D31 A;  4JI5 Q;  1GD7 A;  2HIX A;  1E3P A;  5ELO A;  2JA8 G;  3UDI A;  5C3E G;  1RIP A;  2VQF Q;  4QJF A;  1PYB A;  4LF6 Q;  2LXJ A;  4BXX H;  3I2Z A;  3S2D H;  1QZG A;  5JJL A;  2K5H A;  2JA7 G;  3CCM A;  3TQY A; 
#chains in the Genus database with same CATH topology
 2D9U A;  4RAZ A;  4J9O A;  4NMZ A;  3E3X A;  4BY7 G;  5IY0 A;  1I6V C;  3O13 A;  1CKN B;  4FVM A;  1KAB A;  2G9D A;  4YCW A;  1CZG A;  3RGZ A;  2YZM A;  4GKJ Q;  2FIN B;  1GVP A;  4IHJ F;  2CQY A;  2AQ1 B;  1YEZ A;  3VR6 A;  2MUY A;  3I4M G;  1TS3 A;  4WD3 A;  3L4J A;  1HZA A;  1Q3L A;  4DV4 Q;  4I4T F;  3LNN A;  1JR0 D;  3KF8 B;  5IGB A;  4HNV A;  4ECY A;  1D1K A;  1I4P A;  2I5H A;  3MXN B;  1Y1W H;  4JI2 H;  1GXD C;  3BG3 A;  2JA5 A;  2QGQ A;  3I12 A;  3UE0 A;  3RAQ A;  5KNB A;  3W1B A;  1GSA A;  3A0J A;  5LP6 F;  5E1F A;  1HH2 P;  4PMB A;  1PK8 A;  4DK6 C;  4XYQ A;  3EPG A;  3X3M A;  1XNQ H;  2W71 A;  1N36 Q;  3KF6 B;  5FLX L;  4FYD A;  4JI6 L;  3NE5 B;  4ED6 A;  2GA4 B;  3WO0 A;  1YNJ C;  3D4D A;  4IFD J;  3NBH B;  1YIT A;  2R7Z A;  5EOY A;  5HV6 A;  1V1O A;  3R5X A;  3Q8P B;  2VQE H;  4JV0 A;  2EIF A;  5D65 A;  2PNR C;  1TY2 A;  4O4H F;  2AWN A;  1XPU A;  2FPI B;  2R7K A;  1DZ1 A;  5COY A;  3F2C A;  4F4Y A;  2N78 A;  4ZRZ A;  3K5I A;  2KOL A;  4C2M B;  4ZI7 F;  2K5D A;  2WII B;  2JXM B;  1KQS A;  1JOR A;  4MV1 A;  1J5E H;  3T56 B;  3V96 A;  1A8V A;  1XTD A;  4MNO A;  5M5W B;  5C0X I;  1TS4 A;  3CCL A;  4IOC A;  4X64 Q;  4ED7 A;  4QWB A;  4JI1 Q;  3S1N H;  3IRB A;  1TWF H;  2CW0 D;  5IE8 A;  2YU9 A;  2HHH L;  2ZM6 L;  1TII D;  3AQQ A;  3TRZ A;  4LFA H;  4DL5 A;  1UE5 A;  2R7M A;  1VAJ A;  3M9B A;  1VQ4 A;  2HD3 A;  4A3I B;  4A3F H;  4ZQ3 A;  4DV0 Q;  1GJX A;  3GIK A;  2FKL A;  2W7O A;  2IP4 A;  3GTP B;  5DG9 A;  2R7Z H;  1IBK H;  2FMC A;  1Q7Y C;  1X65 A;  4QCL A;  3OWF A;  1E4E B;  4DR2 H;  5EKI A;  1YI2 A;  3RN5 A;  1I3Q A;  1VQK A;  1NBW A;  2FLP A;  2M9V A;  4RKL A;  2CWP A;  5D3D A;  3CCS A;  5EBD A;  1EZ8 A;  3D4W A;  4C3I G;  1N32 Q;  1ONL A;  2NVQ H;  4LF7 H;  1EIF A;  2K05 A;  1N9W A;  3N43 B;  1X3P A;  3JAM E;  1S5D D;  4JI0 H;  4JV2 A;  1Z47 A;  1BXT A;  4ZKB B;  4J9L A;  1S5E D;  4QY7 A;  1HNX Q;  4M8A A;  4CJ2 C;  3A54 A;  2MPM A;  2AWO A;  1J8I A;  4YBZ B;  1PRT D;  2UXD H;  4RGO S;  3K57 A;  4HR7 B;  4LUV A;  2EYM A;  1Q1E A;  3IKJ A;  3S1M B;  4MA0 A;  3ETH A;  4JI0 L;  3ERS X;  2GLT A;  3BA9 A;  4KN7 C;  2LSS A;  1LTA D;  2DGY A;  3H15 A;  1WR2 A;  4LF4 Q;  2ZM6 H;  4DAM A;  3G4S A;  3TEH B;  2ZJT A;  4OXP A;  1E2Z A;  2BH8 A;  3KAK A;  1CT1 D;  4ME3 A;  4A3G B;  4IUN A;  2C00 A;  5KGU A;  4OHJ A;  2EYH A;  2F0M A;  4HQ6 A;  3M4O H;  1B2T A;  4BA2 I;  4YJ2 F;  4R4C A;  3U4Z A;  4DV3 Q;  3QO2 A;  1E24 A;  2PMZ A;  4I65 A;  5I9P A;  3CCJ A;  1LTS D;  3OW2 A;  2MQH A;  1PFB A;  3T5J A;  3TQT A;  3BYY B;  1FD7 D;  3RAX A;  3G7L A;  2EY5 A;  3OMC A;  2BA0 A;  3RMH A;  2HIV A;  3CXC A;  2N88 A;  4IUP A;  1HUN A;  1E4G T;  1B44 D;  3ETJ A;  4IRC A;  3MWE A;  1LYL A;  3I4M H;  5GAD C;  1A62 A;  4RG1 A;  2WAQ G;  1XMO Q;  2W9C A;  2MO0 A;  4A76 A;  1TS2 A;  2V58 A;  3PF5 A;  3IL8 A;  4RH6 A;  2B29 A;  1N32 H;  3GTP A;  3CQZ B;  2W6O A;  3T1Y H;  1WTR A;  5CC4 A;  2ALZ A;  3E0E A;  1N33 H;  3BAA A;  4BBS H;  3PQI A;  1JMC A;  2WKD A;  4HIM A;  1KAA A;  4YAJ B;  4N9P A;  2W70 A;  1DYQ A;  4HCS A;  2YZN A;  2F0T A;  1WTO A;  5BPF A;  1N48 A;  2E76 C;  1LT4 D;  3HOZ H;  3LP8 A;  4B08 A;  4CDC C;  4FF1 A;  2SNS A;  1KDB A;  1CS0 A;  2NVY B;  5KNC A;  1I3Q H;  1WD0 A;  1AE3 A;  4LF5 Q;  3I4N B;  1PZI D;  2AQ3 B;  4JV5 H;  4A3D B;  2I8C A;  2FLN A;  1F2Y A;  4K0K H;  4NXM L;  1IHZ A;  3V4Z A;  4GC6 A;  1BNZ A;  5JQW A;  1GM5 A;  1L1O B;  4GLA C;  2L5T A;  4HED A;  3M4Q A;  1KJJ A;  4HR7 A;  2DZD A;  2JEB I;  3L3O C;  2B2U C;  2CH4 W;  4UCV A;  3HOY G;  4DV1 H;  4PZ6 A;  5IYD G;  1TWC B;  1GUS A;  1RL2 A;  4F50 A;  2IW3 A;  4C3H G;  4I50 F;  3H0G G;  1TVX A;  3E0J A;  3KLR A;  4M1U B;  3RZD H;  1SYF A;  1K83 A;  4AYB A;  3GTK A;  1YZ6 A;  4WRD A;  4DL3 A;  2MGS A;  1R9T H;  4HMJ A;  5LOV F;  5DQH A;  2R7D A;  2K52 A;  3D6W A;  1CM9 A;  1HNZ L;  2Q2H A;  2OEO A;  3PW4 A;  2UVR A;  2OTJ A;  1IOW A;  1BCP D;  1I4X A;  4X64 L;  4XYL B;  1EY0 A;  4IUR A;  1W6K A;  2JSO A;  5K5P A;  2DPJ A;  4G3I A;  4ECV A;  3TN2 A;  4DLK A;  2ATL A;  3JRW A;  3CCE A;  1E1O A;  3QWN A;  3JZI A;  1WVL A;  3VYS A;  4B3M H;  1IL2 A;  1F9R A;  4RFB A;  1VBH A;  4ED3 A;  2WV6 D;  4X3T A;  1K9M C;  4ED2 A;  2AQ4 A;  2IY5 B;  1DIK A;  4DV3 L;  4O3S A;  4I7A A;  3SHL A;  3URY A;  2NYZ D;  2RA4 A;  2NVQ B;  2R8K A;  1FNW A;  3MXU A;  4P73 A;  4Y7N B;  1K8M A;  4JG2 A;  2E2I B;  3HXL A;  2XGQ A;  4K0K L;  4KKS A;  3U4V A;  3GIP A;  1NUC A;  1Q82 C;  1G2S A;  5LL6 S;  3HOV G;  2HVR A;  4YCV A;  5LMN L;  1RDP D;  3NGD A;  1Y1W A;  3SGI A;  4BS9 A;  1TWA A;  2B2V A;  4M9U A;  2EPB A;  1I50 B;  2JA6 H;  4ZK9 B;  2UUB H;  4JI2 Q;  2AMC B;  4Y52 H;  4WJ4 A;  4DR6 L;  3S17 B;  1BDO A;  2YS6 A;  1I6U A;  2NU7 B;  4FF2 A;  3PO2 G;  1A2T A;  4HYK A;  3PZP A;  1B9M A;  4ZUJ A;  1EY9 A;  2F0J A;  1GUO A;  1BUV T;  1K28 A;  2I5M X;  2WB1 G;  3MR5 A;  1FJG Q;  2QYZ A;  3RBD A;  2UXC Q;  1E0B A;  4LFA L;  4R4I A;  2NVY H;  2CW0 C;  5FLM G;  5C3X A;  3VMM A;  2F0U A;  5K36 H;  1D8L A;  2F0I A;  2J4X A;  5L9X A;  3MFI A;  1OXS C;  1TWA H;  5FJ8 G;  5KG7 A;  4IUV A;  4LFB L;  3Q8Q B;  4ED8 A;  2L12 A;  1HR0 H;  1E2V A;  2FMM A;  2OXP A;  4GKK Q;  5KT6 A;  5KFV A;  3MC0 B;  3HGB A;  3PUZ A;  5A2Q E;  5LMN W;  4C3H B;  2KHI A;  4ECR A;  3T5K A;  1L0Y B;  4DUY L;  3M7N A;  2BH2 A;  3PR5 B;  4JI3 L;  1Y1V H;  1S0N A;  2LKV A;  1NMF A;  1STA A;  1QCB D;  3PV0 A;  5DM7 3;  2DPI A;  3AU7 A;  5ELD A;  5E4X A;  1M8A A;  5FPR A;  2V4D A;  4DV5 H;  1ZKO A;  4HCE A;  1UE7 A;  4ED1 A;  1VF7 A;  1EIH A;  4TSS A;  5KND A;  1I94 H;  3G6Y A;  2UVW A;  2ZXP A;  2VQF L;  4JUZ A;  4JI1 H;  5LMU H;  1MI2 A;  2PQA B;  3A8I E;  2I87 A;  4QMG A;  1B1Z A;  3JRX A;  2ASJ A;  4UHV A;  3MR2 A;  2N3S A;  2E2H B;  2VA3 A;  5GQO A;  1VS0 A;  2HDM A;  1GGO A;  1DOK A;  2O4X A;  2FHT A;  5E4W C;  4EVO A;  1C9O A;  2UUA Q;  2O5J C;  1W93 A;  4OO1 G;  1C7Y A;  5DEH A;  4POF A;  1PH9 A;  1SAP A;  3RUP A;  4X6A H;  2MCT A;  1A0I A;  2V4R A;  2B63 A;  5CBA E;  3SK6 A;  3SK4 A;  3KHL A;  2R93 G;  3HFZ B;  3RF2 A;  5COR A;  3TP8 A;  3SXH A;  1GO3 E;  3ND9 A;  2EJM A;  3K3P A;  5IYC G;  2VNU D;  5IYD H;  5CGK A;  5DLF A;  3RN2 A;  2QEX A;  1XNQ Q;  3TII A;  4GKJ H;  4TQS A;  4IPD A;  1K3R A;  3BYT B;  4GZY C;  3DUZ A;  4LF8 Q;  3GTP H;  3S16 B;  4PWQ A;  4UP7 A;  1NJI C;  5E7N A;  3GTK H;  3M4I A;  1KEE A;  1X3Q A;  5JVH 3;  2XCP A;  1EQV A;  2WKC A;  3HBL A;  1N34 Q;  5IWA Q;  2WB1 B;  1QVC A;  4IOA A;  1C30 A;  4FXD A;  2ZTC A;  3NPP A;  2YYA A;  2F4V H;  2C2E A;  1XX8 A;  1CA6 A;  1LLR D;  4U6P A;  1CHP D;  4E4T A;  4MTK A;  2UXC L;  3TP5 A;  3VR4 A;  1ICW A;  2O03 A;  1A15 A;  1A3T A;  3TBI B;  3V05 A;  4ECX A;  3J80 E;  3C46 A;  3H4B A;  2PI2 A;  2YTV A;  3BQ2 A;  1KRT A;  1GUN A;  4ZYS A;  1WI5 A;  4CBV A;  2R7L A;  4C3J B;  1KHI A;  1N8R C;  4UFZ A;  5D3I B;  1PH6 A;  1RJP A;  4IUQ A;  1A9X A;  3L7Z C;  1J5E Q;  4A3J G;  4A75 A;  1N33 Q;  1DON A;  5C5L A;  5IP9 H;  1RJT A;  2E2H A;  2DNE A;  2FLL A;  3WWV A;  3GTG B;  4OX9 H;  3QG1 A;  5GAH C;  3OMG A;  3CU7 A;  1IOV A;  2GVA A;  3S1R H;  1AEX A;  1Y14 B;  2Z0S A;  5LMN Q;  4DL6 A;  3K5H A;  1EUD B;  4IAL A;  2WAQ E;  4HJ7 A;  3QZ7 A;  1VQH A;  1VQ5 A;  2OLS A;  4G7H C;  4A3M B;  2C22 A;  1IYV A;  3AYH B;  1STE A;  1VQ8 A;  1TKW B;  2KCT A;  2K01 A;  1V8Q A;  3G6J B;  3GP7 A;  1HR0 Q;  1TU2 B;  5DG7 A;  2KQ3 A;  2B2W A;  4J9R A;  1GYF A;  2A6H C;  3OIP A;  4AQY Q;  2K4K A;  1PX2 A;  5CV9 A;  2EJF C;  3K7A B;  4AYB E;  4G7Z C;  1IBM L;  4JV5 Q;  3D4R A;  4FO2 A;  3HOV H;  1PTO C;  2FPP B;  2IHE A;  4AIM A;  2UXB H;  2I07 B;  4DUZ Q;  2CQO A;  3WNZ A;  5IT9 W;  1TWC H;  4JVZ A;  2CW8 A;  4DR1 H;  5D14 A;  1C48 A;  3X3N A;  4DK0 A;  1F9P A;  3OTO Q;  1X6O A;  3I4N G;  3PMF A;  4RCN A;  5DQG A;  2IT1 A;  3MXG A;  4E6I A;  3UQ8 A;  5EQ0 A;  4YAK B;  2K5W A;  4A3M G;  1B6S A;  4PNY A;  3RJ0 A;  3MJF A;  4B3R L;  4JI5 Q;  4A93 B;  4QUC A;  1PZJ D;  4RGM A;  1VDZ A;  1E3P A;  4CDD C;  1RIP A;  2VQF Q;  4Q5V A;  5EJW A;  5JJL A;  4O3O A;  4PQX A;  4A3J B;  2XN9 C;  3TQY A;  1PDQ A;  2R6G A;  3F2U A;  3M9M B;  1MKH A;  4JI1 L;  4DV3 H;  3DXJ C;  3T53 B;  1PZK D;  3HOY B;  2A6E C;  3A7A B;  1OXX K;  1WCM G;  5JUM A;  2K14 A;  1JC7 A;  4K6L A;  4B3T Q;  2K28 A;  4DNT B;  1ROD A;  1QOH A;  5JPN C;  5ISR A;  4R9W A;  1WCM A;  3PGZ A;  1WOC A;  1I6H H;  4CC6 A;  3OHA A;  3VYT A;  4A3K G;  1I7L A;  2NN6 H;  4A3G H;  4B3S H;  4UCR A;  4F4W A;  1JE4 A;  1PH3 A;  4L5R C;  4LF6 L;  5EKL A;  4LH7 A;  1EY7 A;  4A3C G;  3KDF B;  1GHK A;  2R61 A;  1H9R A;  2I80 A;  4IUU A;  4J9S A;  2SNM A;  3VA7 A;  1AUX A;  2K6A A;  2ZJP A;  4L5S A;  5E3F A;  3PO3 H;  4B9W A;  2QIL A;  3JSN A;  5CA1 F;  1DCZ A;  3DWP A;  4UCS A;  3CC7 A;  2WTF A;  1HFN A;  5DGB A;  2WDT A;  4YR0 A;  3K6O A;  1U5K A;  3ULP A;  2LFN A;  4LF4 L;  2WAQ A;  4JI7 L;  4MV3 A;  3G6X A;  5L1K A;  1YNX A;  1QWY A;  3KF8 A;  4DU9 A;  1HNZ H;  5KFK A;  3P75 A;  3VDY A;  5AFW A;  4FS1 A;  4JI0 Q;  4JBJ A;  4IPC A;  5M3M G;  1PVO A;  2K7V A;  1KDA A;  5CAE B;  2UU9 Q;  3S2D B;  1Y1V A;  4I7H A;  4C3I B;  5A35 A;  2R8J A;  4GN4 B;  2PBZ A;  2XWB B;  3DM3 A;  2AKW B;  4YY3 Q;  4TUY F;  1RF2 D;  1N32 L;  4TKO B;  5BMV F;  3L4K A;  1BCP C;  1ENF A;  4QIW B;  3T51 B;  4MV7 A;  4DV2 H;  3J7A V;  2EOT A;  4KMU C;  2XVS A;  5EPJ A;  3J7Z C;  3KJP A;  2PCF B;  4ULL A;  1M6V A;  4HJ8 A;  3K80 C;  2NVX A;  4JPB W;  4CC5 A;  1DD2 A;  5DG8 A;  3UFX B;  3TDQ A;  1JDB B;  2UVU A;  3H3V H;  3BJU A;  4J6H A;  2KEE A;  5C0X H;  1SFO A;  3NP8 A;  4OIJ A;  3Q24 A;  1DM0 B;  3BG5 A;  4GNX C;  4LF5 L;  3GIM A;  2UXB Q;  1SE4 A;  2PQE A;  2B63 G;  2VB3 X;  2BE5 D;  5I2X A;  5T14 A;  5M3F B;  3D8G A;  3Q6S A;  3R5H A;  2VUM G;  3VYR A;  2ALY B;  2RDH A;  1MZB A;  4JI4 L;  1TWF A;  3FMC A;  1ZXT A;  4Q44 A;  2V59 A;  3J80 L;  3I4O A;  3MAQ A;  2VXW A;  1EL0 A;  3VPC A;  2VOB A;  2RKS A;  2F0S A;  3N41 B;  2R7F A;  4DR7 L;  2XIW A;  1CUK A;  2K50 A;  1GOZ A;  3H09 A;  2LY7 A;  3BVG A;  5CV4 A;  3TP7 A;  5C4Z A;  1T9H A;  4LFC L;  3AEV A;  1SEI A;  4JI5 H;  4NXM Q;  4UCT A;  5BPH A;  1QNK A;  1O7L A;  2UUB L;  5KFQ A;  3PIP A;  5M3F H;  4DV1 Q;  4QWA A;  1Q86 C;  5M5Y B;  3UI2 A;  1EYD A;  5HGQ A;  4EGJ A;  3GQC A;  2JJQ A;  3FKI H;  1ET9 A;  3NEL A;  2M2L A;  1SE2 A;  3GD7 A;  3R2T A;  5KFL A;  2ASD A;  1IKL A;  5JOB A;  1KBL A;  4IN3 A;  1WTV A;  2SCU B;  4KLK A;  3VR5 A;  4U68 A;  4EBD A;  3OSO A;  2X0S A;  1XWE A;  1VQB A;  1WJJ A;  1R4P B;  2K32 A;  4KHP L;  3SI8 A;  4F8M A;  3P7J A;  1TWH A;  4K2L A;  4U67 3;  2M00 A;  3CF5 A;  4XXE A;  3BVZ A;  5I4D A;  2KBN A;  5KG0 A;  3MWY W;  1E7Z A;  1CQI B;  4L8J A;  3PUV A;  4LF9 H;  1CHQ D;  3SK8 A;  3G8C A;  1HNX H;  3CRL C;  3K0Y A;  2Y0S B;  1VQP A;  1HZC A;  3M85 A;  2L9H A;  5BN3 A;  5IT9 E;  2EY1 A;  4DAV A;  2W8L A;  1SMY C;  3RUZ A;  1H9J A;  1EWI A;  4A3M H;  2EY2 A;  4L5T A;  3PUX A;  2L55 A;  3E5S A;  3KK7 A;  3NSW A;  4LW1 A;  2NUC A;  4TQU S;  5M3F G;  1HNZ Q;  4XYM B;  1HA6 A;  4N9T A;  4JYA H;  1XNR L;  1HUM A;  1PTO F;  5KFJ A;  2Z8L A;  4RZQ A;  1EWH A;  1S4Z A;  2XNA C;  1O78 A;  2Q2T A;  2RGV A;  2EJG C;  1MIU A;  1TXY A;  1WTQ A;  2HGS A;  4DV6 H;  2JK8 A;  1BGW A;  5L1J A;  1UE1 A;  4LFB Q;  1S5B D;  3N6X A;  3GV8 B;  5FO7 B;  2DJG C;  1BBW A;  1N56 A;  2Z6K A;  1LM0 A;  5FPO A;  3BU2 A;  1FJG L;  4JI3 Q;  5M5W H;  4RB2 C;  4A3D G;  2FMA A;  2Y0S G;  3KF6 A;  4XYO A;  4BY1 H;  3PUW A;  2VQF H;  2F0N A;  1OXU A;  2O5I C;  4EG0 A;  5FLM H;  3J7Y W;  4K6D A;  2NTT A;  1DOM A;  2RDG A;  2EY6 A;  1Z6H A;  3OUU A;  1KNA A;  4OEM B;  1IBL Q;  2VUG A;  4MV8 A;  5C4H A;  2RDJ A;  2L4N A;  2F0D A;  4JYA Q;  3HOY H;  3J80 c;  2FK2 A;  1SNP A;  1TWG B;  5J2T F;  1MHW C;  2NN6 I;  4KHZ A;  3G71 A;  1QZH A;  2J6T A;  4DV4 L;  4DR4 Q;  1K83 B;  4NPS A;  3EBE A;  1L2F A;  1AE2 A;  1KIX A;  2H1E A;  4NKL A;  3D3R A;  1RYS A;  4UPA A;  5J22 A;  3S1Q B;  3DWQ A;  1UAP A;  2LS0 1;  2BDN A;  3FPP A;  2IMW P;  2C9O A;  2WB1 E;  2R82 A;  1N36 H;  2RF4 A;  4KHP Q;  3QJY A;  4HTH A;  4HID A;  4B9X A;  3I90 A;  5M3M H;  3V4S A;  4N8X 1;  1WTH A;  4IR9 A;  5KX5 F;  2GPS A;  1AW7 A;  1NAP A;  3ORQ A;  3QOJ A;  1JOO A;  4DR3 H;  2FP4 B;  2D0P A;  4CKB A;  1SND A;  4FXG C;  5JEA J;  2NZ1 D;  1STG A;  1W2B A;  1TY0 A;  1CFM A;  3NQT A;  2A68 C;  3U9S A;  1RK6 A;  1STN A;  5JH7 F;  2X6L A;  1EEI D;  2OTL A;  2V4Q A;  4YWM A;  2CVR A;  1B4O A;  3GTJ B;  1D5Z C;  1JX4 A;  4FBU A;  3MWM A;  4QWD A;  3HOV B;  1EUJ A;  1I4R A;  4FS2 A;  4GLX A;  1BO0 A;  3S1Q H;  3BAB A;  4R4O A;  2MHV A;  4MTD A;  3FVQ A;  2R8I A;  4DFA A;  2XRQ D;  2B63 H;  4YWK A;  4NLG A;  3K81 C;  1VQF A;  1EIY B;  4EFE A;  4KJN A;  3GTL H;  2KJX A;  1UWV A;  3HG9 A;  4YWL A;  3CD6 A;  2AU0 A;  2R6F A;  3JSL A;  4J15 A;  1XYI A;  1AP0 A;  1BBX C;  4CGY B;  5M9O A;  3CW2 C;  3HS0 C;  4GOP B;  1Y69 U;  3GTM B;  1PRT C;  2OQ0 A;  5FLX c;  4DR3 Q;  2XRS D;  2HCI A;  4RUA A;  5KFR A;  1H9K A;  4KJO A;  4ME5 A;  4R8N A;  4RUC A;  4RB3 C;  2Z4H A;  3Q8R B;  1LAC A;  1EY4 A;  4QGU A;  5KFN A;  3KBX A;  4J9M A;  5CYU A;  4GNX A;  3OPO A;  4JI4 H;  3KHH A;  2DUD A;  3TSS A;  4NXN L;  1SMX A;  1TWG A;  1XNR H;  5KFD A;  3BQ1 A;  3GV5 B;  5IOD A;  1CE8 A;  4BWS C;  2AGO A;  2R3Z A;  4B3M L;  1EYZ A;  1VQ7 A;  3R23 A;  2WE6 A;  1CK1 A;  1JKJ B;  1YNN C;  4IJH A;  1D6E C;  1B3Q A;  4PMW A;  3J81 j;  3HB9 A;  1LUZ A;  1LV9 A;  2ASL A;  4RB1 A;  2UXD Q;  1HNX L;  4HSV A;  4LF5 H;  1T5X D;  3DEO A;  1ET6 A;  2R7Z G;  1EHI A;  4IWX A;  2XIG A;  2AGP A;  1PYS B;  1SN8 A;  1GHJ A;  4RGT A;  5C4J B;  4XQJ A;  2F0L A;  2PZT A;  4JV5 L;  1II3 A;  4V0B A;  5C44 B;  3CQZ A;  4A3B H;  3S14 H;  5ELB A;  2EE1 A;  1XMQ Q;  4RWS C;  4DUZ L;  4JI8 H;  1SCU B;  4Q0Y A;  2NU9 B;  2QK4 A;  1QUQ B;  1X3E A;  2EDG A;  4HJ9 A;  4IRD A;  3GTK B;  5FD5 A;  3R93 A;  1WFQ A;  1Q12 A;  3W2D A;  1CQV A;  1SJE D;  5L1L A;  1IBL H;  2PMZ E;  4C1N K;  4UCO A;  2JP1 A;  4LUO A;  2IBK A;  2NTS A;  1I94 L;  1MSH A;  1TWF B;  5FO9 B;  5G3L D;  2GN5 A;  3RB6 A;  1K73 C;  3PCO B;  5KFA A;  1VQM A;  3EVQ A;  2XCA A;  3TS0 A;  3GTL B;  2VUM B;  2UUC L;  4FBT A;  5KG6 A;  2F3V A;  2WFW A;  1HCZ A;  1UNS A;  2E2H H;  4C2M H;  4FU0 A;  4C5B A;  5I47 A;  4ME6 A;  1AZQ A;  3HKZ E;  1GSH A;  3PF4 A;  5L1I A;  1Q46 A;  4KKU A;  2A69 C;  4BY7 B;  4JI7 H;  1Q8K A;  5T1G A;  5C3E B;  5IP7 G;  4X65 Q;  2HQL A;  2QDB A;  4KK7 A;  1X32 A;  2JQO A;  2BA1 A;  4X62 Q;  2Q8R E;  3T1H Q;  2NVY A;  1FR3 A;  4KHV A;  4R7R A;  1MSG A;  1YHB A;  4J9K A;  2QEJ C;  2RDI A;  1S68 A;  5ELC A;  2K75 A;  3DWA A;  5AJ3 Q;  1Q81 C;  3DMU A;  1ZYR D;  3KXY T;  3MA2 B;  4O3N A;  4YY3 H;  4LF6 H;  1IBM Q;  2YL2 A;  2A68 D;  2VY3 A;  5DGA A;  5KYL A;  1ML0 D;  1WYD A;  3MR6 A;  5JAV A;  1X3G A;  2W6Q A;  1TWA B;  5ELE A;  3BDL A;  1KXL A;  4PV1 C;  3F8T A;  1VQE A;  4EBC A;  2O2L D;  1IBK Q;  1FJG H;  3I4N H;  3K59 A;  2R86 A;  3L0O A;  4O1N A;  2A5H A;  1E4E A;  4YP3 A;  2JA7 A;  5KFX A;  1S97 A;  1RKN A;  2Z6K C;  3OHX C;  4DKA C;  4GKK H;  2RSN A;  4ECS A;  2B2V C;  4FM9 A;  3W5O A;  4DL4 A;  4DV6 L;  4DR6 Q;  3C3L A;  1K8G A;  4A4I A;  2UUC H;  4JI5 L;  4LFC H;  3PVX A;  4BWG B;  1QUQ A;  3R3O A;  2ZDG A;  5IOC A;  1G6P A;  3I4M B;  2IX3 A;  1EQQ A;  2IL8 A;  3H3V I;  2IA6 A;  4F88 A;  2QA4 A;  3CMA A;  1S9F A;  3K5M A;  4QW9 A;  2KEN A;  3IFT A;  1VQA A;  3CP0 A;  3RNU A;  5D1O A;  4DR5 L;  3GTL A;  1IL8 A;  1SLJ A;  2F3I A;  3I56 A;  2VUM A;  1B3A A;  3TRE A;  4LUZ A;  1AZP A;  1RTO A;  3PUY A;  3M4O B;  4O42 A;  2YCH A;  4M7E A;  2P5Z X;  3I8Z A;  3D31 A;  1GD7 A;  2HQE A;  4AQY H;  2JA8 G;  2C2R A;  4LF6 Q;  4BXX H;  2PN1 A;  2J0T D;  4ID6 A;  1HQM C;  4RAU C;  4C1N I;  1XPR A;  3S2D H;  1Z2N X;  1EYA A;  2DNC A;  4NXN Q;  1D2B A;  4EQP A;  4HNU A;  3CVZ A;  3GTO B;  1AN8 A;  3DF7 A;  5GON F;  4B3M Q;  4B3S L;  2CCZ A;  4G4K A;  3J80 i;  4RHR A;  3ITP A;  1KJQ A;  1EY6 A;  4OEL B;  4XX0 B;  3J81 L;  4IRK A;  1H9S B;  4IJL A;  5IT9 c;  4MAM A;  1S5C D;  2W6Z A;  1PH7 A;  1DOL A;  3N44 B;  2B39 A;  3G6V A;  3Q0A A;  3NEM A;  3RZD B;  1W96 A;  4A93 G;  4A3F G;  3EQL C;  2UUA L;  1X54 A;  4DPG A;  4C3J H;  1PLF A;  5H80 A;  3PSI A;  5KEE A;  4DV7 L;  1V1P B;  2FPG B;  4C5A A;  1JWM D;  3E6Z X;  4BXX G;  4P71 A;  1QJO A;  2Q8I B;  3HOX H;  3HOU G;  5EWG A;  4QIW E;  4RNN A;  3RB3 A;  2B2T C;  4YB8 B;  2SEB D;  2R92 G;  4R8U A;  5KG4 A;  1MJE A;  1SYC A;  3GII A;  3PW5 A;  5C8Y F;  4GKK L;  1IW7 C;  1X3F A;  1AH9 A;  4HAE A;  4J9P A;  3E9I A;  5BN5 A;  5IP7 H;  3JAM W;  3RGX A;  2G5D A;  5KFF A;  2F03 A;  4EYH B;  1FL0 A;  4DUY Q;  1JCK B;  1U4M A;  1FGB D;  1O7Y A;  2ZDH A;  1FGU A;  3HEJ A;  2R8H A;  4F87 A;  4OO1 H;  4A3E H;  5GAG C;  2IJ0 A;  1HZB A;  2NVX H;  2JA6 G;  2R93 B;  5FLX W;  1DV2 A;  2HHH Q;  2VQD A;  1S03 G;  3V2T A;  5EBC A;  4C3J G;  1QNU A;  4AYB B;  3CQZ H;  5C4X H;  2ID0 A;  3R2I A;  4TRD A;  2OH2 A;  2WIN B;  4PMC A;  4ECW A;  4FXK C;  4ZAI A;  3RD4 A;  3FDS A;  2OCE A;  4EBE A;  3HOU B;  3OHB A;  4X62 L;  1JOK A;  1QIL A;  3T1H L;  1PFS A;  4O2B F;  3W3A A;  3BZC A;  2ZM6 Q;  3HKS A;  5L37 A;  3JAM L;  4O3P A;  1PH2 A;  1KJI A;  3V6H A;  4JI4 Q;  2N49 A;  5C1P A;  1K0S A;  4JOI C;  2A19 A;  4DGZ A;  3T4A C;  1YHA A;  2IX0 A;  4TV9 F;  1LTB D;  1QVG A;  1UC8 A;  1PMR A;  1Z9F A;  3QZ8 A;  4BY7 H;  4F4X A;  4YCU A;  2JEI A;  2K1B A;  1SYB A;  3S1R B;  1EQR A;  3TS2 A;  2R92 A;  2D5D A;  2MO1 A;  5C5M A;  2Y0S E;  4DNI A;  1G29 1;  2AUJ D;  2I46 A;  1DV1 A;  4LF8 L;  1G6Z A;  4PZ7 A;  3TIG A;  2E5L L;  4XQN A;  3TP6 A;  3P1H A;  5CV7 A;  2NN6 G;  3M9O B;  1T36 A;  3N42 B;  1K83 H;  4GN5 A;  3CC4 A;  4TV8 F;  4R8U B;  2B2W C;  2R93 H;  1B53 A;  1XMQ H;  2XGT A;  3KAL A;  1PH1 A;  2CFM A;  3GIJ A;  3M3Y H;  2W6N A;  4EGQ A;  1RK5 A;  4ZHQ F;  1JT8 A;  3T5L A;  1WCM H;  3U58 A;  1OXT A;  5H1S E;  3H20 A;  3R8B A;  3LML A;  2FJZ A;  3E9H A;  1I50 H;  3BVM A;  2JA6 B;  4K5X A;  3JAM c;  1FYC A;  2E2J H;  4A3B B;  1R4Q B;  2A73 B;  4HIK A;  1J6Q A;  4LK1 C;  4LF7 Q;  2HT1 A;  1RJR A;  1WH2 A;  3T16 A;  3RZO H;  5EWE A;  2EYL A;  4Z9C B;  2R7Z B;  4RU9 A;  2NUA B;  2TMP A;  4ECQ A;  1V1Q A;  2E2I H;  2ZJQ A;  1ILP A;  4DV4 H;  1J5E L;  4EQO A;  2PVP A;  1JWU D;  3IAY A;  4MHE A;  5LYJ F;  3SDZ A;  5BR8 H;  1OTC A;  1FKA H;  1EOT A;  1JWS D;  1F2M A;  1I6H B;  3WDN A;  4X66 H;  5LMN H;  5A2Q L;  4J9Q A;  1Y8N B;  3ZYY X;  4Y7N H;  3S1N B;  3HKZ A;  1OXV A;  3DLL A;  3FHW A;  1VQC A;  1WCM B;  3K8A A;  3CCQ A;  4HSP A;  3ERQ A;  3K7U C;  5KFW A;  4IFD I;  1D5X C;  3C1F A;  3P20 A;  3VPD A;  1Y1V G;  4NW2 A;  5KG5 A;  2CWA A;  4YJ3 F;  4NXM H;  4DAY A;  1D5M C;  1SYE A;  1SYX B;  3RTX A;  4OWT B;  2K33 A;  2WAC A;  1RTN A;  2KEC A;  4UAI A;  1PH4 A;  1D1I A;  1T5E A;  2F0Q A;  3CKI B;  1KAW A;  3KAJ A;  2DY7 A;  3J7A F;  3OWE B;  5JEA G;  3HZX A;  2PO4 A;  3RLO A;  4YHH H;  4DV7 H;  1P16 A;  1OWT A;  4P72 A;  5F9N A;  1JB3 A;  3LWE A;  2WAQ B;  2W6P A;  3IG0 A;  4XZ3 B;  3T13 A;  4HIO A;  1HR0 W;  3OSN A;  3CCV A;  3Q8S B;  3K58 A;  2HHH H;  5EGT A;  1R9T B;  1KDC A;  2JA7 B;  3AB9 A;  3SK5 A;  1DJR D;  5ELN A;  1WTX A;  4Y8V B;  1SFO H;  1WTW A;  3H0G A;  4ZUI A;  3PIP 3;  3G48 A;  3S2H H;  1Y1V B;  3KDF A;  3OUZ A;  5EDW A;  2D0O A;  3HOZ G;  4KHP H;  4DR1 Q;  2YS7 A;  4EFB A;  3WOF A;  3M4P A;  4EEY A;  1LTL A;  1NMG A;  3HOX G;  3HOU H;  4GC7 A;  3S2H B;  1PRT F;  2KHS A;  1JDE A;  3KOJ A;  4A3B G;  3D0F A;  1DXM A;  2A1A A;  4DN4 M;  3I3C A;  2JN4 A;  4DV2 Q;  3SE7 A;  5KFT A;  4YR3 A;  1BQQ T;  2ZTD A;  3AFQ A;  1SNM A;  3S15 H;  1PA6 A;  4K0K Q;  1L1O C;  2NVX B;  4OIK A;  4CHT B;  3ICE A;  4BBR G;  1VQN A;  5JJZ A;  3G6E A;  4GOP C;  3SEB A;  2R85 A;  2DJF C;  3EN2 A;  1SFO B;  1TWG H;  4G57 A;  1IW7 D;  2E2D C;  3H94 A;  3J81 E;  3EIV A;  1AUV A;  2FK3 A;  2CKZ B;  1P8L A;  3TZU A;  2NZO A;  5IT9 L;  1B70 B;  2A8V A;  3PO3 G;  2B2T A;  1HTL D;  1KLU D;  3SR1 A;  5JVG 3;  3C2P A;  4IPH A;  1JIH A;  4WJ3 M;  4APV A;  4YR2 A;  2EXZ A;  5IGF A;  3N8D A;  2UUA H;  4J1M A;  2L11 A;  3M9N B;  3TIN A;  3GTO A;  1CKN A;  3CHB D;  2E5L Q;  2PW7 A;  2X6G A;  4FF3 A;  3HOW B;  1K8O A;  2F0K A;  4F7X A;  4EGV A;  2ZJR A;  3S17 H;  3NHH A;  2E75 C;  4H7B A;  4HN7 A;  1XPO A;  3GLK A;  4HNT A;  1A2U A;  2F0E A;  5CV6 A;  5LMU Q;  3MWD A;  3PR4 A;  1TWH H;  1JXL A;  3BA8 A;  1XDN A;  1HPC A;  3MTS A;  4EEQ A;  1HQR D;  4UP9 A;  4RZR A;  2NVT H;  3L2P A;  2W7P A;  1C0A A;  1TR5 A;  3GTQ B;  4HMI A;  4ECU A;  4DR7 H;  3PW7 A;  4QIW A;  1B8A A;  4IPG A;  1GUG A;  1HTP A;  1PH5 A;  4DR5 H;  1WD1 A;  2V9W A;  1SDF A;  5TSS A;  4JBM A;  1IKM A;  4KD4 A;  4C3I H;  1VQD A;  2AHO B;  5CV5 A;  3FEW X;  4LF9 L;  3KTM A;  3OOC A;  3Q1K A;  2F3W A;  3QR8 A;  2ZDQ A;  2JA5 B;  4JOI A;  2R84 A;  1IYU A;  5HGT A;  1M0W A;  4K8J A;  1BBU A;  1RYR A;  1EIG A;  2NU8 B;  1CKO A;  2JE6 I;  2CH4 A;  4QB4 A;  3NBH A;  1PHJ A;  5C44 H;  5KFP A;  2AGQ A;  3PO3 B;  4XTC S;  2RSO A;  2NB0 A;  1ESF A;  3H0G H;  4EQ5 A;  2Y0S A;  3M3Y B;  4X65 L;  4O0A A;  1WSC A;  1QE6 A;  1SE8 A;  4B3R H;  1TA8 A;  2VW9 A;  2PPB C;  3I7F A;  5FKA C;  1L0X B;  1XNQ L;  4XQQ A;  4APM A;  1HXY D;  1YJN A;  4A3F B;  3J7A 5;  3A55 A;  5AJ3 L;  4C2M A;  4PDB A;  1STY A;  4JI8 L;  4QF4 A;  4LFB H;  2BQ3 A;  4JBK A;  3PO2 B;  1JLL B;  4MTN A;  5IYB G;  1N34 L;  1ZET A;  2LMC B;  5M5Y H;  2Z4I A;  1I3Q B;  2F4V L;  4V19 0;  5KT7 A;  1S0O A;  1F9S A;  2R87 A;  4JI3 H;  2BR0 A;  1SNO A;  4OX9 Q;  1S40 A;  2IWH A;  3VA5 A;  4HJ5 A;  1EU3 A;  3KBG A;  2YTX A;  1NY4 A;  2OQK A;  1YIJ A;  5DM6 3;  1C3O A;  3FMA A;  1SBB B;  1XNR Q;  2XC9 A;  4NB3 A;  5IIF A;  1EQT A;  4DV1 L;  5JJI A;  4BBR H;  5EAY A;  1B33 N;  3RB4 A;  4KI0 A;  2Q8T A;  5EKK A;  4A93 H;  1ENC A;  2JEJ A;  1ESR A;  5CBE E;  3C0F B;  4CJ0 B;  4ZCK A;  2Z9H A;  3NQI A;  4ZOL F;  1V9P A;  2F0F A;  2VQE Q;  5CA0 F;  4QWC A;  5KT3 A;  2K5Q A;  1C4Q A;  1V43 A;  3H3V C;  4MV9 A;  3FDT A;  5C0X J;  2A74 C;  1ICF B;  1KC8 C;  4WBN F;  4X3S A;  5KT4 A;  4DV2 L;  2W57 A;  1VQG A;  4L63 B;  1K0R A;  4J8Q A;  4CKE A;  2C28 A;  3J7A K;  5KIX A;  4ZQI A;  1RJQ A;  4MV4 A;  2BQR A;  3UDX A;  2QCP X;  2VB2 X;  1G91 A;  2EZV A;  3KHR A;  2B8F A;  4DNR B;  1F2Z A;  3S9W A;  4LF9 Q;  1YHQ A;  4EQN A;  1X9N A;  2QDL A;  3SVM A;  4X66 Q;  1EUC B;  2NU6 B;  3K7A H;  4KKT A;  4C3H H;  1BVS A;  1ENA A;  1MD2 D;  1SE3 A;  1LT6 D;  2K04 A;  2Q2I A;  2E8G A;  4H02 A;  3L9A X;  2CQA A;  4WFN 3;  4NP5 A;  2N8N A;  2P0A A;  3H4D A;  4A3E G;  2N55 A;  3BS1 A;  5T1I A;  2EYO A;  1I5F A;  2E74 C;  4GS3 A;  1CA5 A;  4YHH Q;  5IYZ F;  3OW7 A;  5FLX E;  2JA5 H;  3MEH A;  2NBF A;  4MN3 A;  3CAM A;  2SOB A;  3VR2 A;  3ER0 A;  1V51 A;  3E5N A;  3KYH C;  1U4P A;  1A63 A;  3K3V A;  5CB4 F;  1I4G A;  5KFU A;  5KKN B;  1KTK A;  2ENB A;  3GIQ A;  4TQR A;  2MJ8 A;  2BCO A;  1JJC B;  3A5Z B;  4XT3 B;  3IFD A;  2Z6B A;  1Q1B A;  4BY1 G;  3MHB A;  1OO9 B;  1LAB A;  1A3V A;  1Z7T A;  5IP9 G;  5KT2 A;  2JA8 B;  3RFC A;  2EQS A;  5KT5 A;  2JA7 H;  2FE3 A;  4BBS G;  1H9M A;  4DV7 Q;  2XD4 A;  4IUT A;  5LHY 1;  2W9C B;  2G9H D;  1F9Q A;  2GPW A;  4IWY A;  2B2Y C;  1IBM H;  3EPI A;  4R1J A;  4EX5 A;  1U4R A;  3V6J A;  1W3S A;  2F52 A;  3S24 A;  1S5F D;  3PIO A;  2XCL A;  2RHQ B;  4B3S Q;  1J9O A;  2I0Q A;  4A3I H;  3GIL A;  3CPW A;  2W9B B;  1PRT B;  1BXR A;  2RBM A;  1IBL L;  2JEA I;  2YRX A;  3AFP A;  3ULL A;  1XMO L;  1PV4 A;  1E2W A;  4Q43 A;  2WYO A;  2HVQ A;  4A3C H;  2JYO A;  1RCV D;  4ZLT F;  3A56 A;  2J9G A;  2R8G A;  3UDI A;  3C1E A;  2LXJ A;  2DN8 A;  2PZW A;  3I2Z A;  1QZG A;  2VA2 A;  2K5H A;  4B3R Q;  2KCN A;  3CCM A;  2JA7 G;  4LSX A;  5D8D A;  5IYB H;  5I6W A;  1UNN C;  1NTG A;  5F9L A;  1ASY A;  5GRO A;  2Z1C A;  3BZK A;  4U7C A;  1EZ1 A;  4FF4 A;  4K5V A;  2ICI A;  4RNO A;  1BOS A;  1CI3 M;  3ERO A;  2E2J B;  2RVL A;  1TWC A;  4OWW B;  1H95 A;  2E5L H;  5C1O A;  1JE5 A;  3JC6 6;  1Q8I A;  5C5J A;  4DR4 H;  3GTM A;  3F8N A;  3A74 A;  2VL6 A;  1M1K C;  1EEF D;  3B6Y A;  3HRZ C;  1SYD A;  4JCV E;  4JI8 Q;  5KG2 A;  5JJK A;  4J0M A;  4X3K A;  3KLW A;  2MFI A;  5BN4 A;  1BCP B;  4C56 C;  2KCC A;  1PH8 A;  1EY5 A;  4X66 L;  2E2I A;  3S16 H;  2UXC H;  1HNW Q;  4JI2 L;  1BKB A;  4OON A;  2YU9 B;  1VQI A;  2F4V Q;  1TT2 A;  3VYU A;  3MR3 A;  3GV3 A;  5C44 G;  4GKJ L;  4DV0 H;  2ZT9 C;  4I55 F;  3H91 A;  4Q8F A;  1Y1W B;  3Q2O A;  2FJ2 A;  4ECT A;  3H40 A;  1O7I A;  4UP8 A;  1BR9 A;  5DAU A;  1Z2O X;  4BBR B;  4ECZ A;  1PXU A;  4JI6 H;  1H9S A;  1E4F T;  3BQ0 A;  1LTT D;  3U9T A;  3NTH A;  4H0L C;  4UDU C;  1U0L A;  2PYK A;  1M4V A;  4BBS B;  4MIU A;  2D2C C;  2ASB A;  2VUM H;  3K5L A;  4JI7 Q;  4A3L G;  2VQE L;  5EZY F;  2OF1 A;  5D1P A;  2BQU A;  4X65 H;  4J9N A;  4DR3 L;  4WJW A;  5HBR B;  3I91 A;  4XIG S;  1SNQ A;  1SNC A;  4JV1 A;  4DV5 L;  4JC0 A;  1I94 Q;  3TME A;  3LWU A;  4RCO A;  4O2A F;  1GKH A;  4A3K H;  5FK9 C;  2YV5 A;  4IZ8 A;  3PN1 A;  5LL6 b;  2DIK A;  3LWB A;  2DLN A;  1VQL A;  1S10 A;  4O3Q A;  3N52 A;  1D7Q A;  3RB0 A;  2YW2 A;  1NR2 A;  4JW0 A;  5A2Q W;  3S1M H;  1FNV A;  5K36 G;  4FDB A;  2YRW A;  2RCF A;  5IYC H;  2F1M A;  5LXT F;  1HZ9 A;  1ILQ A;  1E22 A;  2EVB A;  1T3N A;  2VZA A;  5C4J H;  4LNQ A;  1CSQ A;  1HA5 A;  4DUY H;  1W6J A;  1ASZ A;  3GO5 A;  1L2Z A;  4RAY A;  3CPF A;  5J3B A;  1LO5 D;  2L0C A;  1U9R A;  5DLQ E;  3I73 A;  4JI6 Q;  4YIJ A;  3NWT A;  4RGN A;  5IGE A;  1Q90 A;  5C3W A;  1YJW A;  5DQI A;  1KLG D;  2VR1 A;  1K1Q A;  4YHH L;  1UE6 A;  2H4O A;  5ELF A;  3NXW A;  1X55 A;  1XXG A;  2CHB D;  2J7Z A;  1IYJ B;  2PMZ B;  1XMQ L;  1SMY D;  5JVD F;  4A3L H;  4IFD G;  1N34 H;  3K0X A;  2L15 A;  3FKI A;  1G2T A;  1T94 A;  4O3R A;  3RV4 A;  3BDO A;  1RD9 D;  4KTA A;  2UUB Q;  2X69 A;  5DLG A;  3RBE A;  5KYI A;  3T1Y Q;  1G51 A;  3K5O A;  5KRU A;  3VR3 A;  4LF8 H;  3OYY A;  4UY8 C;  5KFZ A;  4K8I A;  4MA5 A;  1B9N A;  2UU9 H;  2PQA A;  1JQY D;  1Y1W G;  3Q8D A;  3KUP A;  1HNW L;  4IFD H;  3KJO A;  1GUW A;  1Z2P X;  1F77 A;  1KJ8 A;  1SRU A;  1BJT A;  3EFX D;  5EWF A;  3TQ1 A;  5FJ8 H;  4K2K A;  3ULJ A;  2F0P A;  2JA5 G;  2AUK A;  1VQJ A;  3RR5 A;  2B63 B;  4LAA A;  4LH6 A;  2WB1 A;  2B8G A;  1EU4 A;  4JBW A;  2EXD A;  1GUT A;  3U50 C;  1QG7 A;  1NSN S;  4DR5 Q;  3ZJY C;  2NVT B;  2TSS A;  2DY8 A;  1NNX A;  3GV6 A;  2VPQ A;  1F2L A;  3K5N A;  1ZHS A;  4H44 C;  1VQO A;  1KC7 A;  4OWX B;  4DK3 C;  1ZQ7 A;  1YNJ D;  2QW7 A;  4DV5 Q;  4KY6 A;  1K8A C;  2F0O A;  3J81 W;  2SDF A;  5D1O B;  5KFH A;  3HOW H;  3N40 P;  1UEA B;  2RDF A;  4ZKC B;  1M7J A;  4LF4 H;  5C6A A;  4A3D H;  2HVS A;  4ILW A;  5HUR A;  1SEB D;  4A3J H;  1BNC A;  5DNF A;  1E1T A;  3HOZ B;  1XTC D;  4OGQ C;  2YU9 H;  2BDO A;  4K5W A;  2B2Y A;  3MFY A;  1KJ9 A;  2YZG A;  4HJA A;  4LMY A;  4IZO A;  3RLN A;  1EOV A;  3PIO 3;  4ALP A;  2XWJ B;  1HR0 L;  5KFB A;  1S0M A;  2LXK A;  3KLS A;  4AQY L;  1VCI A;  4IAJ A;  1VBG A;  1NCV A;  3I55 A;  1VQ6 A;  2PZU A;  1FNU A;  2F0W A;  4DXF A;  4DR6 H;  4TVA B;  4CKC A;  5IWA H;  3S15 B;  1EZ6 A;  1FVI A;  3NUC A;  3OTO H;  1B04 A;  3NTI A;  4CDF C;  3A5U A;  3CCR A;  3OIQ A;  1HRJ A;  2V5A A;  1YBY A;  4ED0 A;  5KFC A;  3DHQ A;  4DAY B;  2W6M A;  3OSP A;  2R93 A;  2FFK B;  3CME A;  2A69 D;  2F0V A;  4POG A;  1A6X A;  3GV7 B;  1YJ9 A;  2PW5 A;  3J80 W;  3T5H A;  5KFM A;  5M5X H;  2QF7 A;  1B50 A;  4KY7 A;  3MFH A;  1LTR D;  3T1Y L;  3OTO L;  1VQ9 A;  2YYZ A;  3A8J E;  2FB9 A;  2XGP A;  1XMO H;  1I50 A;  1N33 L;  4O4I F;  3I70 A;  1I7N A;  1B6R A;  2EYP A;  3WO1 A;  3PO2 H;  4N8F A;  1I4Q A;  3MXN A;  2D62 A;  4MZ9 A;  3A8K E;  1O75 A;  1SSO A;  4RA8 A;  2CW7 A;  1WTP A;  2W9A A;  3I4L A;  2BE5 C;  4I7Z C;  3KFU A;  2L1B A;  4X62 H;  4ODG A;  4QWE A;  2W9B A;  1NR4 A;  4X3U A;  4R8I A;  1GSO A;  4EYI B;  3T1H H;  1SYG A;  4DK1 A;  1EWC A;  5JEA H;  1TAE A;  5IGG A;  2PNH A;  4A2B A;  3GTO H;  5I9O A;  1CKM A;  4JYA L;  1PTO H;  4OO1 I;  3KHG A;  1CTM A;  4Q8E A;  1HFG A;  3GTG H;  3FKI G;  4GLV B;  4DR2 L;  2Q2U A;  1CQJ B;  2HJW A;  3JAM i;  3NTK A;  1EFW A;  4B3T H;  5EPK A;  1A3U A;  4DR4 L;  3CC2 A;  2KVM A;  2KUM A;  1L0W A;  1PTO D;  2ATW A;  1CSP A;  4AYB G;  2C5C A;  2DWC A;  2BOS A;  1HHV A;  1IXR A;  1S3O A;  3UDG A;  1K1S A;  3EA6 A;  4ETS A;  3DEP A;  5LL6 X;  3RZO B;  2KA7 A;  3S14 B;  2KCM A;  4LSA A;  3LGJ A;  3STB C;  4XDX A;  4OX9 L;  4A3I G;  3RLF A;  1SR3 A;  3HKZ G;  1VKZ A;  1STB A;  5LA6 F;  3DM1 A;  1VMC A;  3EJI A;  2PI2 E;  4DL2 A;  4QW8 A;  3SE0 A;  2MP1 A;  3MEF A;  3NBI A;  2F0G A;  3W1G A;  5C4X G;  2HCC A;  5KFI A;  1PTO B;  2ICE C;  3J81 c;  2A6E D;  4Q45 A;  4DL7 A;  4RKB A;  1UC9 A;  2JA6 A;  4PG3 A;  5KFO A;  4AH6 A;  3J81 i;  2K5V A;  2ES2 A;  5BR8 Q;  3CRK C;  3GTQ H;  3FKI B;  1UUP A;  1MGS A;  5F2D A;  3RIZ A;  4A3G G;  3IN5 A;  4DUZ H;  2ZXR A;  1PFN A;  4KV6 A;  5IGC A;  3HOW G;  3AMU A;  1MBY A;  3PW2 A;  1EYG A;  1TWH B;  1CZW A;  1SJH D;  4MV6 A;  4LFA Q;  1KNE A;  2WP8 J;  4FNF A;  5G3L F;  1Y8O B;  2J6U A;  4R4Q A;  4R4T A;  3HP3 A;  5K2M A;  3FPU B;  4OL7 A;  4CDE C;  4L1K A;  5J2U F;  2F0H A;  1O80 A;  5CMD A;  4B3T L;  4YY3 L;  4X64 H;  3CCU A;  1BF4 A;  1KL9 A;  3HKZ B;  4BA1 I;  4DXG A;  3GDE A;  4IO9 A;  1YVC A;  4GN3 B;  3FRP B;  3D6C A;  1DGS A;  3PW0 A;  1I4H A;  2NZH A;  2OT2 A;  1V4Y A;  4H13 C;  2UVV A;  3Q22 A;  2QKI C;  2F4I A;  4NXN H;  4RB0 A;  1PYW D;  4KY5 A;  1M0T A;  1U4L A;  1B7Y B;  4FP5 D;  4UCU A;  1KRS A;  1O7Z A;  3GTJ H;  1JJ2 A;  5KFG A;  4A3K B;  3TZD A;  2UXB L;  2MNA A;  2H5X A;  1N36 L;  2UXD L;  2HUG A;  3A7L A;  2KSW A;  4O4L F;  5FOB B;  3I72 A;  4LWC A;  2ZXO A;  5C3E H;  1R9T A;  1JIC A;  2EYF A;  1X56 A;  5GAE C;  4KN4 C;  1V1P A;  1ZYR C;  4P74 A;  4WOR A;  1G8Z D;  2UU9 L;  2M05 A;  4C5C A;  5C0X G;  3F2B A;  3H0G B;  1EY8 A;  2IHF A;  3GTG A;  2RCN A;  3NWS A;  4PZ8 A;  5CV8 A;  1XJV A;  2IPK D;  4LF7 L;  2FXQ A;  1EFI D;  1HNW H;  5C4X B;  2FK1 A;  4LFC Q;  3NEN A;  1LTG D;  1JB7 A;  4QL5 A;  3BDC A;  5M3M B;  2YTY A;  2IX1 A;  5NUC A;  3MVV A;  3F2D A;  1UEB A;  1Y8P B;  3BZD B;  4QUF A;  5KG3 A;  5IGD A;  4NDX A;  2RGR A;  1C8C A;  2OWO A;  5FO8 B;  3GID A;  2I5L X;  5CR3 A;  2B3G A;  4G7O C;  3WOE A;  4A3E B;  3BJY A;  3GQB A;  5I2Y A;  1PFM A;  5J39 A;  2EYJ A;  4YQW A;  2C2D A;  3R5F A;  3GTJ A;  2R92 H;  2JEF A;  4DR1 L;  1LT3 D;  2UUC Q;  2KHJ A;  5BR8 L;  4IQZ A;  1JJG A;  1K3B C;  2A6H D;  2HDL A;  4DF7 A;  4RNM A;  1STH A;  3FP9 A;  3KLS X;  2W8K A;  3RV3 A;  4RMF A;  2C35 B;  2AQ2 B;  1ZEQ X;  1TQO A;  5JPM C;  2J6S A;  3UDF A;  1QB5 D;  4BY1 B;  1JOQ A;  3MZ5 A;  4CJ1 B;  5JVL A;  1SXT A;  1L1O A;  4DR2 Q;  1SRO A;  4S3S A;  2ZTE A;  4LJZ C;  3EYY A;  4GOP A;  2RQX A;  4IR1 A;  1NE3 A;  4KD3 A;  2K5N A;  1VMP A;  2VS1 A;  1M90 C;  3QFF A;  5KG1 A;  3GTM H;  3QOL A;  2KED A;  4DV6 Q;  3QB3 A;  3STB D;  1HJP A;  4DR7 Q;  4F4Z A;  2XTI A;  4K14 A;  1ZHQ A;  4MTE A;  3VPB A;  4DA2 A;  3HOX B;  1IBK L;  3M7G A;  3U9O A;  3M4Y A;  2CZG A;  2JA8 H;  4ABN A;  5I6Y A;  1RHP A;  5M5X B;  1LT5 D;  1VF5 C;  4LMQ D;  3ORR A;  3MXP A;  3V6K A;  1CQF A;  1YNN D;  1KD1 C;  1EYC A;  3N6R A;  4O2D A;  3GTQ A;  4RHS A;  5J1Z A;  2RHS B;  4Q0F A;  2R7N A;  5KFY A;  3Q23 A;  2JA9 A;  2V1C C;  5IWA L;  4XT1 B;  5KFE A;  1AFP A;  3LX0 A;  1AN7 A;  4P75 A;  5LMU L;  4DAP A;  5FD6 A;  3MFG A;  1BCP F;  1TS5 A;  4P2C B;  3F1Z A;  3NK9 A;  1IZ6 A;  2XSC A;  4JK1 C;  1GLV A;  4DV0 L;  2K03 A;  1S72 A;  2VPS A;  5HY6 A;  4GNX B;  1MJC A;  2B2U A;  1ULZ A;  3UE1 A;  3ND8 A;  2GVB A;  1QVF A;  4L5Q A;  5EPL A;  3H6M A;  4QQB X;  2JEG A;  4L6T B;  3QIA A;  5KFS A;  2HIX A;  5ELO A;  5C3E G;  1LTI D;  4QJF A;  1PYB A;  2NWG A;  2R92 B;  4A2A A;  3ONA B; 
#chains in the Genus database with same CATH homology
 2R6G A;  4NXN Q;  5IYB H;  1NTG A;  1MKH A;  1ASY A;  5GRO A;  4JI1 L;  4BY7 G;  5IY0 A;  3BZK A;  1CKN B;  1OXX K;  1WCM G;  4B3M Q;  4YCW A;  4B3S L;  2CCZ A;  3J80 i;  2K14 A;  4B3T Q;  4GKJ Q;  1GVP A;  1YEZ A;  3I4M G;  4IJL A;  1HZA A;  5IT9 c;  4DV4 Q;  3PGZ A;  3KF8 B;  1PH7 A;  4OWW B;  1WOC A;  1I6H H;  1H95 A;  3MXN B;  1Y1W H;  2I5H A;  1JE5 A;  3JC6 6;  4A3K G;  2JEA I;  3A74 A;  2QGQ A;  3UE0 A;  2VL6 A;  3NEM A;  4A3G H;  1M1K C;  3B6Y A;  3W1B A;  4JCV E;  4A93 G;  4JI8 Q;  3A0J A;  1PH3 A;  4L5R C;  4A3F G;  4LF6 L;  5JJK A;  1HH2 P;  2UUA L;  4DK6 C;  1X54 A;  3KLW A;  2MFI A;  3KDF B;  4DPG A;  4A3C G;  4C3J H;  1N36 Q;  3PSI A;  4DV7 L;  4X66 L;  2ZJP A;  3KF6 B;  1PH8 A;  4L5S A;  3S16 H;  4BXX G;  4P71 A;  4JI2 L;  4JI6 L;  1HNW Q;  1BKB A;  4OON A;  3HOX H;  1VQI A;  2F4V Q;  3HOU G;  3PO3 H;  4QIW E;  4GKJ L;  5C44 G;  3NBH B;  4IFD J;  1YIT A;  2R92 G;  1MJE A;  3CC7 A;  4GKK L;  1X3F A;  1AH9 A;  1O7I A;  4UP8 A;  3E9I A;  2EIF A;  5IP7 H;  1U5K A;  3ULP A;  4LF4 L;  4JI7 L;  2AWN A;  1XPU A;  1FL0 A;  1YNX A;  4DUY Q;  3F2C A;  1FGU A;  2N78 A;  3VDY A;  1U0L A;  4A3E H;  5GAG C;  2ASB A;  2VUM H;  1HZB A;  1KQS A;  4JBJ A;  2NVX H;  4JI0 Q;  4JI7 Q;  4IPC A;  2VQE L;  2JA6 G;  5M3M G;  4A3L G;  1PVO A;  1A8V A;  1XTD A;  4MNO A;  2HHH Q;  5C0X I;  2UU9 Q;  4DR3 L;  3CCL A;  4IOC A;  4X64 Q;  4XIG S;  4JI1 Q;  4GN4 B;  3DM3 A;  2AKW B;  3CQZ H;  3IRB A;  1TWF H;  2ID0 A;  5C4X H;  4YY3 Q;  4JC0 A;  4DV5 L;  1I94 Q;  1N32 L;  5IE8 A;  2HHH L;  2ZM6 L;  1GKH A;  3AQQ A;  3TRZ A;  4A3K H;  2YV5 A;  2OCE A;  1UE5 A;  1VQL A;  3M9B A;  1VQ4 A;  3J7Z C;  1D7Q A;  4X62 L;  3T1H L;  3KJP A;  4A3F H;  4DV0 Q;  1PFS A;  3S1M H;  5K36 G;  3BZC A;  2ZM6 Q;  3HKS A;  4FDB A;  5IYC H;  2R7Z H;  4HJ8 A;  1PH2 A;  1Q7Y C;  1HZ9 A;  3K80 C;  4JI4 Q;  2N49 A;  1E22 A;  1X65 A;  2VZA A;  5C4J H;  4LNQ A;  1CSQ A;  1YI2 A;  1ASZ A;  3RN5 A;  3GO5 A;  1VQK A;  1NBW A;  3CPF A;  4JOI C;  2A19 A;  3BJU A;  2CWP A;  5DLQ E;  1YHA A;  5J3B A;  3H3V H;  2IX0 A;  4JI6 Q;  3CCS A;  1QVG A;  4B3R Q;  1N32 Q;  1Z9F A;  3S1N H;  1YJW A;  2NVQ H;  4BY7 H;  1EIF A;  4YCU A;  4GNX C;  4LF5 L;  2UXB Q;  1N9W A;  4YHH L;  1UE6 A;  2B63 G;  1EQR A;  1X55 A;  3TS2 A;  1Z47 A;  2MO1 A;  2Y0S E;  4DNI A;  1G29 1;  1IYJ B;  4QY7 A;  1XMQ L;  4LF8 L;  1HNX Q;  4PZ7 A;  4A3L H;  2E5L L;  2AWO A;  2VUM G;  2ALY B;  4IFD G;  3K0X A;  4JI4 L;  2L15 A;  2NN6 G;  3I4O A;  4LUV A;  1Q1E A;  1K83 H;  4GN5 A;  3CC4 A;  3ERS X;  2UUB Q;  4JI0 L;  2R7F A;  4DR7 L;  1CUK A;  2K50 A;  1G51 A;  3T1Y Q;  2R93 H;  2XGT A;  3OYY A;  4UY8 C;  2LSS A;  1PH1 A;  2CFM A;  1T9H A;  4LFC L;  2DGY A;  3AEV A;  3M3Y H;  4NXM Q;  2PQA A;  3H15 A;  1JT8 A;  4LF4 Q;  1WCM H;  4DAM A;  3U58 A;  3G4S A;  3Q8D A;  1OXT A;  3TEH B;  5H1S E;  1Y1W G;  2UUB L;  1HNW L;  3KJO A;  3E9H A;  4OXP A;  2BH8 A;  1I50 H;  3PIP A;  5M3F H;  4DV1 Q;  4ME3 A;  1Q86 C;  2E2J H;  3JAM c;  4HIK A;  3M4O H;  4BA2 I;  1J6Q A;  4R4C A;  3U4Z A;  5HGQ A;  1SRU A;  4DV3 Q;  1XPR A;  4LF7 Q;  2JJQ A;  3FKI H;  5FJ8 H;  2HT1 A;  1E24 A;  3NEL A;  3ULJ A;  3RZO H;  3CCJ A;  3OW2 A;  2MQH A;  2JA5 G;  1VQJ A;  3RR5 A;  3GD7 A;  1V1Q A;  2E2I H;  4JBW A;  2EXD A;  3U50 C;  2ZJQ A;  1J5E L;  2BA0 A;  2HIV A;  3CXC A;  4KLK A;  1LYL A;  3I4M H;  5GAD C;  1A62 A;  4DR5 Q;  1VQB A;  1WJJ A;  4RG1 A;  2WAQ G;  3ZJY C;  1XMO Q;  1OTC A;  4KHP L;  2MO0 A;  4A76 A;  3PF5 A;  3CF5 A;  2B29 A;  4Y7N H;  2KBN A;  1OXV A;  1VQO A;  3DLL A;  3FHW A;  4OWX B;  1E7Z A;  4DK3 C;  1VQC A;  3K8A A;  3E0E A;  3CCQ A;  4DV5 Q;  3PUV A;  1K8A C;  3K7U C;  4BBS H;  1JMC A;  4HIM A;  4IFD I;  3HOW H;  1Y1V G;  2CWA A;  1VQP A;  1HZC A;  4OWT B;  3M85 A;  3HOZ H;  4A3D H;  4A3J H;  1I3Q H;  1AE3 A;  4A3M H;  4LF5 Q;  1EWI A;  1E1T A;  4L5T A;  3PUX A;  4TQU S;  5M3F G;  4LW1 A;  2YU9 H;  1PH4 A;  1HNZ Q;  4NXM L;  4HJA A;  1KAW A;  1XNR L;  1GM5 A;  1L1O B;  3RLN A;  4GLA C;  1EOV A;  4ALP A;  5JEA G;  3RLO A;  1HR0 L;  1P16 A;  2LXK A;  3M4Q A;  2Q2T A;  4P72 A;  1MIU A;  1TXY A;  4AQY L;  2JEB I;  1VCI A;  2JK8 A;  3HOY G;  4PZ6 A;  3I55 A;  4HIO A;  1UE1 A;  5IYD G;  1HR0 W;  3CCV A;  1VQ6 A;  4LFB Q;  1RL2 A;  3H0G G;  4TVA B;  1BBW A;  1FVI A;  3RZD H;  2Z6K A;  5ELN A;  1YZ6 A;  3A5U A;  1LM0 A;  3CCR A;  1SFO H;  1YBY A;  4DAY B;  1R9T H;  3BU2 A;  2R7D A;  2K52 A;  3CME A;  5M5W H;  3G48 A;  4JI3 Q;  4POG A;  1FJG L;  1HNZ L;  2Q2H A;  3KDF A;  3S2H H;  1YJ9 A;  2D0O A;  3HOZ G;  4A3D G;  4DR1 Q;  2OTJ A;  5M5X H;  2Y0S G;  3KF6 A;  4BY1 H;  3M4P A;  1LTL A;  1NMG A;  4X64 L;  3PUW A;  3HOX G;  3HOU H;  3T1Y L;  1OXU A;  3OTO L;  2YYZ A;  1VQ9 A;  5FLM H;  3KOJ A;  4A3B G;  1N33 L;  3D0F A;  2A1A A;  3CCE A;  4DV2 Q;  1E1O A;  1IBL Q;  2ZTD A;  3AFQ A;  3PO2 H;  3S15 H;  1IL2 A;  4MZ9 A;  2D62 A;  1PA6 A;  4JYA Q;  4K0K Q;  1K9M C;  1L1O C;  3HOY H;  3J80 c;  2IY5 B;  4DV3 L;  3ICE A;  3KFU A;  4BBR G;  4KHZ A;  2NN6 I;  3G71 A;  1QZH A;  1VQN A;  4DV4 L;  3G6E A;  4GOP C;  4DR4 Q;  4P73 A;  4NPS A;  3EBE A;  1L2F A;  1AE2 A;  2PNH A;  4JG2 A;  3EN2 A;  1KIX A;  3GTO H;  1CKM A;  3U4V A;  4JYA L;  1TWG H;  4UPA A;  4K0K L;  4OO1 I;  3EIV A;  2CKZ B;  1P8L A;  1Q82 C;  2NZO A;  3GTG H;  1B70 B;  2A8V A;  3FKI G;  4GLV B;  4DR2 L;  2Q2U A;  3HOV G;  2WB1 E;  3JAM i;  4YCV A;  1EFW A;  5LMN L;  4DR4 L;  2RF4 A;  3CC2 A;  4IPH A;  4KHP Q;  3SGI A;  1L0W A;  4HID A;  4WJ3 M;  4APV A;  5M3M H;  2ATW A;  2JA6 H;  1CSP A;  4AYB G;  4JI2 Q;  2AMC B;  4Y52 H;  4WJ4 A;  4DR6 L;  1IXR A;  1S3O A;  2D0P A;  3UDG A;  1CKN A;  2E5L Q;  5JEA J;  3PO2 G;  2ZJR A;  1W2B A;  3S17 H;  2KCM A;  3LGJ A;  3STB C;  4OX9 L;  4A3I G;  3RLF A;  2I5M X;  2WB1 G;  1XPO A;  5LMU Q;  1SR3 A;  3HKZ G;  2OTL A;  1FJG Q;  2UXC Q;  1TWH H;  4LFA L;  4R4I A;  2NVY H;  4YWM A;  5FLM G;  2PI2 E;  4UP9 A;  3MEF A;  1D8L A;  2NVT H;  1EUJ A;  3L2P A;  1C0A A;  3W1G A;  1OXS C;  5C4X G;  4GLX A;  1TWA H;  5FJ8 G;  3S1Q H;  4LFB L;  3J81 c;  4R4O A;  1B8A A;  4IPG A;  4PG3 A;  4AH6 A;  4GKK Q;  3J81 i;  2B63 H;  4YWK A;  2K5V A;  3PUZ A;  3K81 C;  1VQF A;  1PH5 A;  5LMN W;  5BR8 Q;  2KHI A;  2ES2 A;  3GTQ H;  4DUY L;  1EIY B;  4JBM A;  3M7N A;  3GTL H;  2BH2 A;  4A3G G;  4JI3 L;  1Y1V H;  1UWV A;  4YWL A;  4C3I H;  1VQD A;  2AHO B;  3CD6 A;  3HOW G;  4LF9 L;  1NMF A;  3PV0 A;  4J15 A;  1EYG A;  4LFA Q;  3CW2 C;  4GOP B;  2WP8 J;  1UE7 A;  2OQ0 A;  4R4Q A;  4R4T A;  4JOI A;  5FLX c;  4DR3 Q;  4B3T L;  4YY3 L;  4QGU A;  1BBU A;  2VQF L;  3CCU A;  4GNX A;  1KL9 A;  2PQA B;  4BA1 I;  1CKO A;  2DUD A;  3GDE A;  4NXN L;  4IO9 A;  2N3S A;  1YVC A;  2JE6 I;  1SMX A;  4GN3 B;  1VS0 A;  5GQO A;  1PHJ A;  4B3M L;  5C44 H;  1DGS A;  1C9O A;  1VQ7 A;  2UUA Q;  4XTC S;  2NZH A;  4OO1 G;  1C7Y A;  3H0G H;  4EQ5 A;  4IJH A;  4POF A;  1PH9 A;  4PMW A;  4O0A A;  4X65 L;  1SE8 A;  3J81 j;  4X6A H;  1A0I A;  1LUZ A;  2VW9 A;  3I7F A;  1XNQ L;  2UXD Q;  2R93 G;  3HFZ B;  1YJN A;  1HNX L;  3J7A 5;  1GO3 E;  1B7Y B;  5AJ3 L;  3PO3 G;  4JI8 L;  1KRS A;  5IYC G;  2R7Z G;  2VNU D;  3GTJ H;  1JJ2 A;  5IYD H;  1PYS B;  1SN8 A;  4JBK A;  2UXB L;  2MNA A;  2QEX A;  3RN2 A;  2H5X A;  1N36 L;  1XNQ Q;  2UXD L;  4MTN A;  4IPD A;  1K3R A;  5IYB G;  1N34 L;  4JV5 L;  5M5Y H;  3S14 H;  4A3B H;  2F4V L;  1XMQ Q;  4LF8 Q;  3GTP H;  4LWC A;  4UP7 A;  1NJI C;  5E7N A;  3GTK H;  4DUZ L;  4OX9 Q;  5C3E H;  1S40 A;  4HJ5 A;  2YTX A;  1X56 A;  1QUQ B;  1X3E A;  5GAE C;  4HJ9 A;  1N34 Q;  1NY4 A;  5IWA Q;  2OQK A;  1YIJ A;  4P74 A;  1QVC A;  4IOA A;  2UU9 L;  1WFQ A;  1XNR Q;  1Q12 A;  4NB3 A;  4DV1 L;  5JJI A;  2ZTC A;  5C0X G;  3F2B A;  2PMZ E;  2IHF A;  4LUO A;  2RCN A;  4PZ8 A;  4BBR H;  5EAY A;  1XJV A;  4KI0 A;  4LF7 L;  2FXQ A;  1I94 L;  4A93 H;  4LFC Q;  3NEN A;  1JB7 A;  2IX1 A;  4QL5 A;  2GN5 A;  2YTY A;  1K73 C;  3PCO B;  3F2D A;  2UXC L;  1V9P A;  1VQM A;  2VQE Q;  3TS0 A;  1UEB A;  2UUC L;  1V43 A;  5C0X J;  2OWO A;  2I5L X;  2B3G A;  1KC8 C;  2WFW A;  2E2H H;  2PI2 A;  2YTV A;  4C2M H;  1KRT A;  4DV2 L;  1VQG A;  3HKZ E;  1K0R A;  1WI5 A;  3PF4 A;  1KHI A;  1N8R C;  2R92 H;  4DR1 L;  2UUC Q;  1Q46 A;  1PH6 A;  2KHJ A;  3UDX A;  5BR8 L;  1Q8K A;  5IP7 G;  4X65 Q;  1JJG A;  2HQL A;  2JQO A;  2BA1 A;  3L7Z C;  3FP9 A;  4X62 Q;  3T1H Q;  4A3J G;  1J5E Q;  4RMF A;  1YHB A;  4A75 A;  2C35 B;  1N33 Q;  4LF9 Q;  5IP9 H;  1YHQ A;  2K75 A;  3WWV A;  5AJ3 Q;  3UDF A;  1X9N A;  1Q81 C;  5GAH C;  4X66 Q;  3K7A H;  1IBM Q;  4C3H H;  1BVS A;  2VY3 A;  2GVA A;  3S1R H;  1L1O A;  1WYD A;  1SRO A;  4DR2 Q;  2Q2I A;  1X3G A;  2E8G A;  1Y14 B;  2Z0S A;  2ZTE A;  4H02 A;  5LMN Q;  1KXL A;  3F8T A;  2N8N A;  4GOP A;  1VQE A;  2WAQ E;  4HJ7 A;  4A3E G;  1NE3 A;  1VQH A;  1IBK Q;  1VQ5 A;  3I4N H;  1I5F A;  2K5N A;  3L0O A;  4GS3 A;  3AYH B;  1VQ8 A;  2VS1 A;  4YHH Q;  1M90 C;  2KCT A;  2JA5 H;  3GTM H;  3CAM A;  4DV6 Q;  3STB D;  1HJP A;  4DR7 Q;  3ER0 A;  1HR0 Q;  2XTI A;  2Z6K C;  4DKA C;  3KYH C;  1A63 A;  4AQY Q;  1IBK L;  2K4K A;  3W5O A;  1JJC B;  2JA8 H;  4AYB E;  4DV6 L;  3A5Z B;  1IBM L;  4JV5 Q;  1Q1B A;  4BY1 G;  1IBL L;  3HOV H;  4DR6 Q;  1K8G A;  4A4I A;  1KD1 C;  5IP9 G;  2IHE A;  4O2D A;  4JI5 L;  2EQS A;  4AIM A;  2JA7 H;  4DUZ Q;  1QUQ A;  2RHS B;  2CQO A;  4BBS G;  4DV7 Q;  1TWC H;  2JA9 A;  2V1C C;  5IWA L;  1G6P A;  1EQQ A;  4P75 A;  5LMU L;  3H3V I;  2QA4 A;  4R1J A;  4EX5 A;  3F1Z A;  3OTO Q;  1IZ6 A;  1W3S A;  1X6O A;  2F52 A;  3S24 A;  3PIO A;  3I4N G;  4DV0 L;  3CMA A;  2RHQ B;  2IT1 A;  1S72 A;  4B3S Q;  2KEN A;  2I0Q A;  1VQA A;  3CP0 A;  5HY6 A;  3CPW A;  3RNU A;  4A3I H;  4DR5 L;  2F3I A;  1SLJ A;  1MJC A;  3I56 A;  4GNX B;  4A3M G;  3AFP A;  3UE1 A;  3ULL A;  3TRE A;  1XMO L;  1PV4 A;  2GVB A;  4LUZ A;  3PUY A;  4L5Q A;  1QVF A;  4B3R L;  4A3C H;  4QQB X;  3D31 A;  4JI5 Q;  1GD7 A;  2HIX A;  1E3P A;  5ELO A;  2JA8 G;  3UDI A;  5C3E G;  1RIP A;  2VQF Q;  4QJF A;  1PYB A;  4LF6 Q;  2LXJ A;  4BXX H;  3I2Z A;  3S2D H;  1QZG A;  5JJL A;  2K5H A;  2JA7 G;  3CCM A;  3TQY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...