3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
1K3RA 4A3JG 5IYDG 4DR3L 4GOPB 1TWFH 2NZHA 3CP0A 3PGZA 2F52A 3G48A 4FDBA 5C4XH 4K0KL 3NELA 4GKJQ 3GD7A 5C3EH 4GNXC 4OONA 5M5YH 3I4NG 3PIPA 3A74A 1CKOA 2JJQA 2KHJA 2ZJRA 1N33Q 2PQAA 4JI7L 1NMFA 4NXNL 3CCRA 4H02A 4DV1L 4A3KG 2RF4A 1L1OC 4DR3Q 1TWAH 2IT1A 1VS0A 3VDYA 3K8AA 5IP7H 4BY1H 1QZHA 4A3GH 3I56A 1VQIA 1HNXL 2N3SA 1VQ9A 1YZ6A 3DM3A 4AYBG 3I4MG 4MTNA 2VUMH 4GKJL 2KCMA 4C3JH 5IT9c 1QVCA 3UE0A 2I5LX 3A0JA 3KLWA 3RNUA 2MO1A 1BBUA 1Y1WH 4A93G 4LF7Q 1FJGL 1PV4A 1DGSA 4EX5A 5LMNW 1XMOQ 4JI7Q 1E7ZA 2K5VA 4DV3L 1K73C 5J3BA 2N49A 3KDFA 4DV1Q 5ELNA 4DAYB 4IPGA 1E22A 4A3MG 4A3BG 2PI2E 4Y52H 3KF6A 3KYHC 2LXJA 1PH4A 1I94Q 2KCTA 1TWGH 3JAMi 4LF8L 4TVAB 2OCEA 2MNAA 1I6HH 1HNZQ 4GLXA 4DR7L 1Y14B 3GDEA 1Y1VG 1EYGA 2JA5H 1PH7A 1FJGQ 3HOVG 1UEBA 4P75A 3PO2H 4A3CH 3PF5A 1Q1EA 5K36G 5AJ3Q 3G6EA 3L7ZC 4X66L 5IWAQ 1N34L 1VQ5A 3M4QA 1WFQA 2R92H 3HOYG 3M7NA 1X6OA 4GLAC 2ZJPA 1H95A 3K7UC 1R9TH 3GTOH 2UUAQ 3DLLA 2JA9A 3ULPA 1X65A 3GTKH 4DV5Q 5IYBG 4TQUS 1K8GA 3BZCA 5DLQE 1XNQL 2UXBL 2D0PA 3J81c 2K5NA 3OW2A 4POGA 2N8NA 3BZKA 4LWCA 5ELOA 3H3VH 4A3KH 4YY3Q 2VW9A 4DR5L 1QUQA 1EUJA 5GAHC 1XPUA 2IHEA 2ZJQA 2OWOA 3KJOA 5JEAG 1MIUA 1KAWA 4DV4Q 4R4QA 1Q7YC 2NVTH 3GTQH 3HFZB 3HOXG 1IBMQ 2YTYA 5LMNL 3TS2A 1CSQA 1FVIA 2I5HA 1UE5A 4LUZA 4MNOA 5FJ8G 4JI1L 1B8AA 1SROA 2PNHA 4LNQA 4LF9L 1X9NA 3UDXA 2ATWA 4YHHQ 3PO2G 5C0XG 3TEHB 1S40A 1PH6A 3JAMc 2JA7G 4POFA 5LMUQ 4DK6C 3PCOB 2E5LQ 2CFMA 1IBLQ 1ASZA 1CKNA 2JA7H 3ERSX 4JI5L 3I55A 1C9OA 4BXXG 1YJ9A 2AWNA 3W1GA 3AYHB 1HZBA 2PI2A 3NBHB 1IXRA 4RMFA 4BBRG 1VQJA 3I4OA 1PH8A 1SR3A 1VQAA 2NN6I 4MZ9A 4NXNQ 4IFDG 4HJAA 2EIFA 4LF9Q 2HQLA 2UXCL 4JI2L 4IFDJ 3EIVA 2H5XA 4JOIC 1Q86C 1JJGA 2A8VA 5IE8A 3UE1A 3CQZH 3J7ZC 4L5TA 2JA5G 3BU2A 4JYAL 4BY7G 4DNIA 2E2JH 4KI0A 1IZ6A 1X56A 5LMUL 4A3EG 5JEAJ 1IBLL 4X65L 4B3SL 3CCSA 3J7A5 4X64L 2WB1G 3H15A 1XNRL 2Q2TA 3S17H 1SFOH 4B3TQ 1IYJB 3OTOQ 2V1CC 4IJLA 4GOPA 1VQEA 4LF5Q 2Y0SG 1Q46A 2MFIA 1E3PA 3AFQA 1KRTA 5C0XI 4OX9Q 4YCWA 4JI6Q 4JI0L 5HY6A 3M4PA 1PH3A 1N32Q 4P71A 2F3IA 3J81i 2EXDA 2JEBI 1HH2P 1VQDA 2OQKA 2VL6A 4NPSA 4DUYQ 4IO9A 1EIFA 3HOYH 1SMXA 1WCMG 5EAYA 4J15A 3AFPA 1BKBA 1ASYA 2WAQG 4JI8Q 1EQRA 2B63H 3CD6A 3STBC 4L5QA 4JI6L 2E2IH 2Q2HA 2ZM6Q 2UXDQ 4C2MH 4R1JA 4O2DA 4OWTB 1N36L 1YJNA 2K50A 2A1AA 1N8RC 2BH8A 4JI3Q 5GAGC 5H1SE 5IP7G 4A3GG 3MEFA 3HOWH 5IYDH 1YJWA 1PH9A 1BVSA 1P16A 3GTLH 2AMCB 1LUZA 1OXSC 1VQ8A 3I4MH 4LFBL 3GTPH 1C0AA 4HJ7A 3S1NH 5C4XG 4YCVA 5BR8Q 1GVPA 4BY1G 3LGJA 2R7ZG 1J5EL 4LF4L 4NB3A 3U4ZA 2JK8A 4DV4L 3T1YQ 1VQMA 2MO0A 5M5WH 2R93H 1CSPA 1A8VA 4QJFA 2UUBL 3B6YA 1VQBA 3ULJA 4GKKQ 3CPWA 2YYZA 2RHQB 1WYDA 2K5HA 1Q82C 4BBSH 4PZ7A 1OTCA 3S1RH 2VQEL 1HZAA 3J80i 3CCMA 1HR0W 1CKMA 4ME3A 1FGUA 4DV2Q 4GNXA 1AE3A 1L2FA 2K14A 2UUCQ 2HHHQ 2MQHA 1XMOL 1M1KC 4NXML 2JEAI 5IY0A 2UU9L 4PG3A 4K0KQ 5M3MG 3H0GH 1VQHA 5IYCH 2ID0A 4R4OA 4HIOA 1JMCA 3HOWG 4LF8Q 1K9MC 1MKHA 2UUAL 3HOXH 3NEMA 4GN3B 1RL2A 3S24A 1V43A 3FHWA 3K80C 3S1MH 2CWAA 1UWVA 1XTDA 2R6GA 4LFCL 4A76A 1AE2A 1KQSA 3M3YH 2NVYH 1N34Q 2NN6G 3I4NH 2VQFQ 4A3FH 1I5FA 3E0EA 2HIXA 3RR5A 1VQOA 2YU9H 2OQ0A 3ICEA 2UU9Q 2ZTCA 4X64Q 1K8AC 1KD1C 4B3RL 4A3IG 1PA6A 4IPDA 4DV2L 4NXMQ 2BA0A 1UE1A 3FKIH 3T1HQ 3GTJH 1VQKA 1I3QH 3RLOA 5M3MH 2ZTDA 5IYCG 5LMNQ 4JV5Q 4L5RC 1HR0Q 2KENA 3RZDH 4DV0L 1HNXQ 4QQBX 2C35B 3TRZA 2K52A 3CCLA 1HZCA 4C3IH 3AEVA 2DGYA 2Q2IA 2VS1A 3CMAA 4QIWE 3U50C 1OXTA 3CCJA 2LXKA 3HOZH 1VQPA 1V9PA 4LF7L 3PUVA 1E1TA 2RCNA 4A3DH 1YVCA 2XTIA 2Z0SA 4DV6L 3I7FA 1JJCB 4B3RQ 3EBEA 4YWMA 4LF6Q 1VQ6A 2QEXA 1XJVA 4JI1Q 1NJIC 2K4KA 5C44H 1AH9A 1I94L 2B29A 2VNUD 4JCVE 2UXCQ 2ES2A 2E5LL 4DV7L 1B7YB 1WJJA 1JE5A 3RN2A 5FLXc 4B3ML 4A93H 1UE7A 3HKZG 2QA4A 1N36Q 4JI3L 1G291 1A63A 2WB1E 1SE8A 1L1OA 4DR6Q 3RZOH 4JI5Q 2JE6I 3S2DH 3HKSA 4DV6Q 3HKZE 1IBKL 3TS0A 4GOPC 1GKHA 4AQYL 4C3HH 1QUQB 2JA6H 5C0XJ 2R92G 3S2HH 1X3EA 3ER0A 1KXLA 1OXXK 4JI2Q 2BH2A 1A0IA 4PZ6A 2KHIA 2YV5A 3S15H 1MJCA 4AH6A 4EQ5A 3PV0A 3M9BA 1BBWA 1X3FA 3HOUG 1X55A 2ZTEA 2OTLA 1CUKA 3MXNB 4QL5A 3F2CA 4HJ8A 2D0OA 3CC4A 4B3MQ 1G51A 4XIGS 4DR4Q 4DR2Q 1SLJA 1U5KA 1Z47A 3K0XA 1YITA 2R7DA 1S72A 2I0QA 3FKIG 2LSSA 4OWXB 1PYBA 3UDGA 4BA1I 1K0RA 4DPGA 1PH2A 1PFSA 3TREA 3FP9A 1XMQL 4B3TL 3L2PA 1V1QA 2RHSB 1PVOA 1CKNB 1X3GA 4YHHL 1K83H 2D62A 5IP9G 2EQSA 4LW1A 4P72A 1NMGA 4JG2A 4DR1L 1QVGA 5IP9H 1N32L 4P73A 4R4CA 3PF4A 4UY8C 2GN5A 4Y7NH 3M4OH 1VQ4A 2NVQH 4DR2L 1N9WA 4JBJA 4A3EH 5GQOA 2VZAA 1LTLA 2JQOA 2L15A 2XGTA 3D0FA 2NZOA 1KRSA 3W5OA 3CCUA 4WJ3M 1G6PA 4LUOA 2NVXH 4A3LH 4BXXH 3PUWA 3KOJA 3GTMH 3AQQA 2OTJA 2HT1A 4GS3A 4DV3Q 4A75A 3PO3H 4IPCA 1PH1A 1WOCA 3PO3G 3HOVH 3CAMA 1X54A 3W1BA 3CXCA 4A3CG 1HNWQ 1FL0A 2KBNA 1TWHH 4AIMA 2A19A 4HIKA 1IL2A 1VCIA 1YNXA 2BA1A 3ULLA 4DV0Q 1GM5A 5GROA 3CF5A 3CC7A 1VQNA 5JJIA 1VQLA 2VUMG 1J6QA 3UDIA 5BR8L 3KF8B 3U4VA 3A5ZB 2VY3A 4LUVA 2B63G 4LFBQ 2R93G 4LF5L 3CMEA 4HIMA 1XNRQ 3T1YL 5GADC 2JA8H 4A3LG 4A3JH 1HR0L 4LF6L 2ALYB 3HOZG 2UUCL 4LF4Q 1MJEA 4WJ4A 3I2ZA 1HJPA 1WCMH 3K81C 1W3SA 4BY7H 2IY5B 2WAQE 3J80c 4YWLA 1XPOA 4OWWB 1PHJA 4IPHA 4QY7A 3G71A 1Y1VH 2IHFA 4GKKL 3E9IA 4L5SA 1M90C 2HIVA 1B70B 3KF6B 4O0AA 4DUYL 4OXPA 5FLMH 5M3FG 1XNQQ 2IX1A 2UXBQ 3KDFB 4JOIA 1N33L 1P8LA 2GVAA 1YHQA 4LFCQ 4KHZA 4IJHA 5FLMG 5M3FH 1E24A 1EOVA 1I50H 2AHOB 2VQFL 2JA8G 4HJ5A 4GN5A 1IBML 1NBWA 4KHPL 4HJ9A 2Y0SE 3CW2C 3HOUH 1KIXA 1VQFA 4DAMA 1QZGA 1EWIA 3K7AH 1PH5A 2GVBA 4X62Q 4BBRH 4GNXB 3M85A 4UP8A 1GO3E 1OXUA 1WI5A 5JJLA 3F1ZA 5C44G 4A4IA 1Q12A 3CPFA 1E1OA 1UE6A 1EFWA 2CKZB 4YWKA 2N78A 2Z6KA 1J5EQ 2WFWA 1YIJA 3E9HA 4DR4L 5E7NA 4QGUA 4OO1G 2PQAB 5AJ3L 3H3VI 4BBSG 1KC8C 2Z6KC 4IOCA 1KL9A 3GO5A 1KHIA 5M5XH 1SRUA 1EQQA 3T1HL 4JV5L 2CWPA 1QVFA 3PUXA 4PMWA 5C3EG 3PIOA 2UUBQ 4JBKA 3SGIA 1W2BA 3PSIA 4P74A 1JJ2A 4X62L 1Y1WG 1HNZL 1PYSB 4DR7Q 4JYAQ 3PUYA 2WP8J 4DV5L 4KLKA 1Q81C 4JI4Q 2R7ZH 2AWOA 1S3OA 3U58A 2YTXA 4DR6L 4BA2I 4YCUA 3S16H 5IWAL 4X66Q 5HGQA 3S1QH 1YHBA 1EIYB 1O7IA 2HHHL 4PZ8A 3OTOL 4B3SQ 1T9HA 3Q8DA 3IRBA 1L0WA 2F4VQ 4A3DG 4AQYQ 4IOAA 3F8TA 1LM0A 3ZJYC 4ALPA 4DV7Q 1SN8A 1D7QA 4DK3C 1HNWL 4JI4L 4JI0Q 4GN4B 1JT8A 2R7FA 4YY3L 3BJUA 4DR5Q 3J81j 1IBKQ 4HIDA 2JA6G 4A3MH 4A3BH 4JBWA 4GLVB 4JBMA 1TXYA 3CC2A 4UP7A 1LYLA 2F4VL 2CQOA 1JB7A 2I5MX 1Q1BA 2DUDA 3L0OA 4JI8L 3TQYA 2FXQA 4LFAQ 1NY4A 2E8GA 2E2HH 3STBD 3CCQA 4DKAC 3RN5A 1OXVA 3JC66 1A62A 1YHAA 3CCVA 4OO1I 3WWVA 4DUZL 2ZM6L 2UXDL 4X6AH 5C4JH 4X65Q 5FJ8H 1VQ7A 2ASBA 4R4IA 3KJPA 3OYYA 2K75A 1C7YA 3CCEA 1U0LA 1NTGA 4AYBE 3F2BA 1NE3A 1YEZA 3PUZA 1Q8KA 3A5UA 1YI2A 2QGQA 4A3FG 1XMQQ 1L1OB 4LFAL 1RIPA 2Q2UA 4OX9L 2IX0A 3G4SA 3RLFA 4A3IH 1HZ9A 3S14H 2YTVA 4IFDI 4KHPQ 5GAEC 3D31A 2AKWB 3KFUA 4DR1Q 3EN2A 4APVA 3NENA 1XPRA 4XTCS 4RG1A 1D8LA 5IYBH 3UDFA 1GD7A 4UP9A 1YBYA 4DUZQ 2B3GA 2PMZE 3F2DA 1Z9FA 4UPAA 2CCZA 4R4TA 5JJKA 1VQCA 2VQEQ 3GTGH 1VQGA 3RLNA 1TWCH 3H0GG 4JC0A
chains in the Genus database with same CATH superfamily
2NUAB 5FD5A 4X62H 2BCOA 1BO0A 2YZMA 2F52A 3G8CA 4L8JA 5C4XH 1FR3A 3NELA 2K05A 2NU9B 1BBXC 5C5JA 2ZT9C 1B3AA 4GNXC 4FBUA 3T16A 2GLTA 1WR2A 1HUMA 5M5YH 3I91A 2JEFA 2KHJA 1TS2A 3EA6A 2KEDA 5EBDA 1TS5A 3SXHA 1B53A 3CCRA 5DM73 4H02A 4A3KG 2PMZA 1XXGA 1L1OC 4DR3Q 1WD0A 3VDYA 2K5DA 3K8AA 4PNYA 3SR1A 3GLKA 1QZHA 5C4JB 1HNXL 3Q0AA 3VR5A 1VQ9A 3DEOA 2VUMH 3KLSX 3UE0A 2I5LX 3A0JA 3HOUB 3RNUA 1AP0A 2EPBA 1BBUA 4CGYB 1MSHA 5ISRA 4A93G 1BXRA 1PV4A 3EROA 5CR3A 4U68A 3KDFA 2J6SA 1RJRA 1GGOA 4Y52H 4H7BA 3PMFA 1TS3A 5C4HA 1M0WA 2RDIA 1H9RA 3KYHC 1AUVA 5FLXW 1I94Q 3GIDA 2KCTA 3A55A 3JAMi 1EUDB 4Q0YA 4LF8L 3GP7A 4TVAB 2OCEA 2MNAA 1A15A 1I6HH 1Z2OX 4CC6A 5D1OB 1I4QA 1Y14B 1DCZA 2P5ZX 1FJGQ 3HOVG 1UEBA 5LA6F 2FB9A 3LP8A 1B33N 1TY2A 5IWAQ 1N34L 1VQ5A 2R92H 2V4QA 3HOYG 3TZDA 2DY8A 1X6OA 3KF8A 2WB1B 1H95A 1R9TH 3ULPA 1EIGA 3GTKH 4TQUS 1XNQL 3D6WA 1STBA 5IGGA 4UCTA 4N8FA 3BZKA 3MZ5A 3H3VH 1STYA 4RB2C 2QF7A 4EBCA 4DUYH 2VW9A 4IUUA 2CQAA 1EUJA 4Q5VA 2FK1A 2IHEA 2ZJQA 4ED1A 2F0IA 5ELFA 3KJOA 4M8AA 3P7JA 4RH6A 4ED3A 2YTYA 4ED2A 1EQTA 4ED7A 4KHPH 3QJYA 4LUZA 1O78A 4OIKA 4JI1L 2PNHA 4RCNA 4ZQIA 1WTHA 4V0BA 4NW2A 5C0XG 2NVQB 5DG8A 4RKLA 1PH6A 2JA7G 3CKIB 5LYJF 5DQHA 3PCOB 3V4SA 4MV3A 5HGTA 3I55A 4BXXG 2GA4B 1HZBA 3DUZA 1W93A 1AFPA 1SR3A 1XYIA 3OWFA 4NXNQ 2K5WA 2KJXA 3RB6A 4WFN3 1JOOA 3NTKA 2HQLA 4LF9Q 3OUUA 5M3FB 4K5XA 5CC4A 3T5LA 4JV5H 1ENAA 4IFDH 1JX4A 3Q2OA 3BU2A 1STAA 1GOZA 5JOBA 4X65L 4MV1A 3CCSA 1XNRL 2VXWA 2Q2TA 4V190 3TP8A 1EWHA 1PRTC 2JP1A 3FRPB 5KT7A 3MEHA 2CQYA 2IBKA 1QCBD 1TWCA 3CRKC 3RV4A 1N32Q 5KKNB 4N9TA 3GQCA 4FF4A 1IW7C 4XQNA 3J81i 4YY3H 4NPSA 1VQDA 3TQ1A 2CZGA 3C1FA 3C1EA 2PBZA 1N34H 4UDUC 2FPGB 4U7CA 4ODGA 2OLSA 4KTAA 1JDEA 1DXMA 4XYQA 4EQPA 1GUWA 5KGUA 1EQRA 2B63H 1XWEA 3M3YB 2E2IH 1CQJB 2ZM6Q 2M05A 4C2MH 4O2DA 4OWTB 4JI3Q 1YJNA 1N8RC 2BH8A 5GAGC 5H1SE 4MTDA 2F0EA 2DPJA 5IYDH 1YJWA 1BCPC 1VQ8A 1C0AA 5J22A 4DR4H 3GTPH 1SYFA 2DNEA 4YCVA 5T1IA 2C22A 3TQTA 1ET6A 3V6KA 3F8NA 4JI1H 1VQMA 4PV1C 5IGFA 2R93H 1A8VA 2ASLA 2UUBL 1RHPA 3B6YA 4RB3C 1M0TA 4BS9A 3W2DA 4CDFC 2EYHA 3M4OB 1MD2D 4BBSH 2W9BB 4KKTA 4RGOS 2B2TA 5KFYA 3J80i 2VQDA 1U4PA 2UUCQ 1KABA 3OTOH 1RYSA 2HHHQ 3NUCA 1Y1VA 3MXUA 1VQHA 2SCUB 2ID0A 4QW9A 4YQWA 2O4XA 4DFAA 4JUZA 1HNWH 3HOXH 4GN3B 4CBVA 2NBFA 5EBCA 3K80C 3S1MH 1KC7A 4FM9A 4IUQA 1QB5D 1UWVA 1CA6A 4TSSA 2R6GA 5DGAA 5KFOA 3QOLA 2NN6G 1WVLA 3AU7A 4A3FH 3RR5A 2YU9H 3IKJA 3ICEA 2F0HA 2F4IA 2MPMA 4NXMQ 4Y8VB 4HNTA 5KG5A 1VQKA 1I3QH 3RLOA 5M3MH 1U9RA 4L5RC 1RTNA 2KENA 1TVXA 4DV0L 1WTPA 3TRZA 3CCLA 2I80A 2Q2IA 4B9WA 2WINB 2Y0SA 1X3QA 3HOZH 1V9PA 3PUVA 4O42A 1BCPF 1E1TA 1STNA 2XTIA 3MFGA 1PTOD 2QDLA 3I7FA 4A3DH 5L1JA 3EBEA 4LF6Q 5BR8H 3E0JA 2QEXA 1EOTA 3K5OA 5DEHA 3L9AX 1LLRD 1U4LA 2K4KA 4Z9CB 1JQYD 3TMEA 4DV3H 3T1YH 4JCVE 3EPIA 3BVZA 1B7YB 5FKAC 4U6PA 3QG1A 5FLXc 1G2TA 4IZOA 4U673 5ELEA 4DNRB 4K2LA 2WKCA 2VB2X 3CQZA 1BCPB 4N9PA 3H20A 1LABA 1STEA 3PW2A 3HKZE 2SOBA 1IBKL 1J5EH 3H0GB 4C5CA 3J80E 4AYBA 5A35A 4QF4A 4C3HH 3FDSA 4BBRB 1X3EA 1ENFA 3C0FB 4P2CB 4J0MA 1BBWA 5KFDA 3HOUG 1CUKA 2F0NA 2D0OA 1HQMC 5I2YA 2XGPA 1NAPA 4IQZA 3GV3A 1U5KA 3K0XA 1YITA 2RSOA 3FKIG 5FO9B 3UDGA 1K0RA 4DPGA 1PFSA 1HUNA 2PW5A 4DLKA 1A3TA 1XMQL 4B3TL 3V6HA 4PDBA 1PVOA 4YHHL 3BABA 3GV5B 2EJFC 1KTKA 2D62A 4J9OA 3S1NB 4LW1A 3FEWX 3NTIA 2CVRA 4ZOLF 2XRQD 1HNXH 4GC7A 4JG2A 4QUCA 5IOCA 2AGPA 4RKBA 3CHBD 1N9WA 3RIZA 2VZAA 1F2LA 1LTLA 2JQOA 5CA1F 4FO2A 4WJ3M 1KAAA 3W5OA 5KG7A 1HTPA 4LUOA 5M5WB 3GTMH 2PZWA 5CMDA 1PFBA 4JW0A 4IRCA 4ILWA 4GS3A 4A75A 2LFNA 3MR6A 2A5HA 1GUGA 3CAMA 1X54A 2UXCH 2KBNA 2HVQA 2JEJA 2IX3A 4DR7H 3N44B 1CQFA 5JJIA 2WACA 3D4DA 2OEOA 5KFWA 2K33A 5BR8L 3KF8B 3S1QB 2WIIB 3U4VA 2Z1CA 1XTCD 2B63G 3ORQA 2CH4W 3CMEA 4X65H 2RGRA 1B9NA 2PQEA 4X64H 2A6HC 4ZKCB 3HOZG 4RWSC 3IAYA 4HTHA 2F4VH 3J80c 2B2VA 3VYUA 4C1NI 4OWWB 3BYYB 3G71A 4ZYSA 4GKKL 5M5XB 3E9IA 3T5HA 4L5SA 3KF6B 4O0AA 1QWYA 1S68A 3JSLA 1SBBB 4DUYL 5M3FG 1IYVA 1PZKD 3KDFB 1N33L 4XXEA 4LFCQ 5FK9C 5K2MA 5LL6S 1SEBD 3OMGA 3GIIA 1SYCA 1E24A 1BNZA 4KHPL 5DQGA 1B6RA 1PRTD 4XDXA 5JVDF 1CS0A 2GVBA 1JWMD 4BBRH 5H80A 4GNXB 4O3PA 4C3HB 5K36H 4XQJA 3F1ZA 4XT3B 5C44G 3BG5A 2B2TC 4MV9A 4IUTA 1SJHD 4A3GB 4YWKA 5KG6A 2MJ8A 4QMGA 2MUYA 5I9OA 3E9HA 4DR4L 5E7NA 4OO1G 3MVVA 4DXGA 4CJ0B 4BBSG 2HVSA 2RDHA 5KFKA 2Z6KC 3PVXA 4ECYA 5JJZA 3GO5A 1KHIA 5M5XH 1SRUA 1EQQA 4MA5A 2CWPA 5C3EG 3M9OB 4JBKA 2J0TD 2FLPA 3PSIA 1JJ2A 3R2TA 1ICFB 5ELBA 1PYSB 4Q8FA 5L37A 2WP8J 1B2TA 4L1KA 4MN3A 1F77A 4O3QA 3FMAA 3PW0A 2YTXA 4BA2I 4ZLTF 3S16H 4DGZA 3S1QH 5HGQA 1WTWA 1EIYB 4KY5A 4B3SQ 3OTOL 1L0WA 4G7OC 4A3DG 3PW4A 3GTMA 2QILA 4DV7Q 3A54A 1D7QA 3JAMW 1UAPA 1GLVA 1PLFA 4YP3A 4F4ZA 3BJUA 2E2DC 1TWHA 2K04A 1JWUD 4A3MH 3GTOB 4GLVB 4JBMA 3CC2A 4UP7A 2F4VL 2CQOA 1JB7A 3DMUA 2TMPA 3L0OA 4JI8L 3BVGA 1TWGA 2KVMA 3URYA 2E2HH 1S5FD 3STBD 3E5SA 1OXVA 4DV0H 2RDGA 3I90A 1M7JA 1K83A 2C2DA 3CCVA 2QK4A 2EZVA 1GJXA 3AB9A 2KCNA 3BQ0A 2UXDL 4X6AH 2K6AA 5JVG3 4LFBH 1VQ7A 3GIKA 4BY1B 2V4RA 2K75A 3J7AF 1U0LA 4AYBE 2A73B 2KCCA 1YEZA 5CV5A 2ZXRA 3WDNA 3A5UA 1NSNS 3K5HA 2IX0A 2UUBH 2EJMA 1HZ9A 4A3IH 2Z9HA 1G6ZA 4YIJA 2AKWB 1HA6A 3KFUA 1H9KA 4YAJB 2UVWA 1XPRA 4XTCS 1E4GT 1AZPA 4YAKB 4UP9A 1YBYA 3GTQA 1Z9FA 3DWPA 4J6HA 5JJKA 4A3DB 3BQ2A 4F8MA 4KD3A 4J9PA 1MSGA 4J9SA 3HS0C 1AN7A 1Z2NX 4R7RA 3GTGB 4G57A 5KT2A 2E75C 1WTVA 2PNRC 2Q8TA 4K0KL 2IP4A 4GKJQ 4HSVA 2Q8RE 3KLRA 1DIKA 3J7YW 5IGCA 1EYDA 3I4NG 3PIPA 1BJTA 4F88A 4ECXA 1GUTA 5BN5A 1I4RA 4JI7L 1ML0D 4DV1L 2FKLA 4ECUA 4B3TH 1TWAH 2YYAA 3J81W 4K2KA 1VS0A 5KFIA 3TIIA 1L2ZA 3L4KA 4BWSC 3GILA 4UCOA 3DM3A 3MC0B 4NDXA 3NSWA 2XVSA 3K7AB 3T56B 5IODA 1VMCA 2MO1A 3VYTA 1Y1WH 2V59A 1XMOQ 4DV3L 2K5VA 2DJFC 1EHIA 4OELB 2JA8B 4KKSA 5ELNA 4A3MG 4J9NA 2PI2E 4WD3A 2J7ZA 4IWXA 5J1ZA 5LP6F 4IN3A 2LXJA 5HV6A 2YS6A 2R93B 5LXTF 4JI0H 2BE5C 4LJZC 4XYMB 1HNZQ 4GLXA 4DR7L 2E2HA 3GDEA 4CKEA 4O3OA 1IKMA 4F4XA 1EYCA 1EL0A 1UC9A 4ZUJA 3OIQA 3L7ZC 4X66L 3G6EA 1GSHA 1TT2A 4GLAC 5JUMA 1FYCA 2F0FA 1KJJA 4EEQA 3J81L 5AFWA 2JA9A 3DLLA 1JWSD 2UUAQ 4DV5Q 5L1LA 2UXBL 2X6LA 2XWBB 2D0PA 4GKKH 2K5NA 4TV8F 2DPIA 2N8NA 3PW5A 5ELOA 2A6EC 1PMRA 4A3KH 1O7LA 4YY3Q 3TBIB 4DR5L 3G6XA 3UI2A 1N33H 2LKVA 1XPUA 5BPFA 5KFTA 1ESRA 5JEAG 5KT4A 1KAWA 4DV4Q 1XMQH 4RFBA 1Q7YC 5IT9W 5G3LD 1ZYRD 5L1KA 2ICEC 5LMNL 3TS2A 5C6AA 1RDPD 2QW7A 1FVIA 1JR0D 2K03A 2ZDGA 1B8AA 4HCSA 2XCAA 2BQ3A 2B63B 4LNQA 1EU3A 1GUOA 4IWYA 1I4HA 3TEHB 3SVMA 4RGNA 3JAMc 4POFA 5LMUQ 2CFMA 1IBLQ 1ASZA 1RKNA 2JA7H 3KHLA 3ERSX 4JI5L 1C9OA 4LMQD 4DL5A 4J9KA 3AYHB 3NBHB 5GONF 5DLGA 3Q8SB 1SNPA 1VQJA 3I4OA 3PW7A 4GZYC 2EIFA 2UXCL 1RK6A 1ZQ7A 5L1IA 1J9OA 2EVBA 4JV1A 2PMZB 1Q86C 1JJGA 4UCUA 4F4YA 2NTSA 3CQZH 4XYLB 4L5TA 1K1QA 4DNIA 2IW3A 1KJ8A 1F9RA 1X56A 4FS1A 3I12A 4RAUC 2CW0D 3LX0A 3J7A5 4X64L 3EJIA 2M00A 3H15A 5C44B 4G4KA 3RAXA 3EQLC 2VUMB 1DOMA 1I4XA 2V1CC 4LF5Q 3E6ZX 2R7MA 2FK2A 2Y0SG 1KRTA 3AFQA 4I7AA 3TN2A 3RGXA 4QWAA 4YCWA 4JI6Q 3RZOB 5HY6A 1WTQA 2F03A 2R7NA 1S97A 4LF8H 1PH3A 4EFBA 1GSAA 1IYUA 3UFXB 2I46A 2F3IA 2EYOA 3DEPA 2JEBI 2OQKA 5BN3A 5EWEA 2B8FA 4OL7A 5KT5A 3VA7A 3HOYH 1WCMG 2F0UA 4LF7H 4UHVA 3KBGA 1SE3A 2JXMB 3AFPA 3VPDA 1IBMH 4OGQC 1BKBA 1ASYA 3P75A 1EY5A 4JV0A 1KNEA 1H9MA 4K6DA 3LWUA 2J9GA 3HBLA 1QG7A 3Q8PB 1I94H 3ONAB 2Q2HA 1N36L 2R8KA 2K50A 2A1AA 4K6LA 2E5LH 3GV6A 5I4DA 3MEFA 4B3MH 4O3RA 1P16A 1OXSC 4LFBL 5KFHA 4ECZA 5F9LA 1S5ED 4JK1C 4HJ7A 4R8NA 2A68D 5BR8Q 1CQVA 1BF4A 4MV8A 4QWCA 1M6VA 1CTMA 2W70A 2XWJB 3U4ZA 2F0MA 3I8ZA 1EEFD 5T14A 1TQOA 2A69D 3S1RB 3IG0A 2K1BA 2BDNA 1R9TB 1Q8IA 4ZCKA 4Y7NB 2RHQB 5EZYF 2AU0A 1WYDA 1OTCA 2AQ1B 3Q23A 2VQEL 5KFFA 3CCMA 5D3IB 4DV2Q 4GNXA 1G6PA 3EPGA 1I6HB 3D6CA 2MQHA 4DAPA 5IY0A 2UU9L 3WO0A 4ZAIA 3HOWG 1TY0A 4R4OA 3S2DB 1K9MC 2EXZA 1U4RA 5EKLA 3OIPA 3S24A 2L12A 2CWAA 3ZYYX 1XTDA 3OSNA 4A76A 2SNSA 1KQSA 4DR2H 1IL8A 1ZETA 2VQFQ 1I7NA 3HKZA 4F50A 4KN7C 4IUNA 4B3RL 4A3IG 2NUCA 2TSSA 4IPDA 5IT9E 2BA0A 4JI8H 2RQXA 4JV5Q 4A2BA 5CV4A 5C8YF 5DG9A 3ND9A 2C2RA 5F2DA 4MA0A 3LNNA 1HNXQ 5D8DA 3G6YA 2C35B 1ZKOA 4RNMA 4ECRA 2DGYA 5CV6A 4A93B 3CMAA 4QIWE 1OXTA 2LXKA 3N43B 1V4YA 4LF7L 1YVCA 2AQ3B 2IPKD 3TIGA 3NTHA 4ZKBB 2NU8B 3MAQA 1XJVA 5DNFA 1FGBD 4IUVA 1AH9A 1AW7A 1TR5A 1H9SA 2B29A 3VYRA 2VNUD 1X3PA 3I4NB 4TQSA 1ZHQA 2NVYB 1Y8NB 4KV6A 2E5LL 3VMMA 3OHBA 1WJJA 3RN2A 4B3ML 4A93H 3R5HA 2QA4A 2A68C 1A63A 4DR6Q 1YNJD 4HAEA 1L0YB 3CVZA 5DLFA 5KG3A 2FPIB 3TS0A 1GXDC 4IZ8A 2JA6H 1A2UA 5ELCA 2G5DA 1CA5A 5JEAH 1SFOA 1KXLA 4JI2Q 3S15H 2YV5A 3M9BA 3OHXC 2CW7A 2OTLA 3GIPA 3F2CA 5KFGA 5HURA 4XIGS 1SLJA 1GUNA 2R7DA 2LSSA 1XX8A 2UU9H 3RJ0A 4C56C 3FP9A 1Y1VB 2V9WA 5LMNH 4DL4A 1K83H 3E3XA 1HFNA 2EQSA 1Y8OB 3N52A 3H40A 2B2VC 3C3LA 4AYBB 3I4MB 2PZTA 3GTLB 4HN7A 1V1PB 5IP9H 3PF4A 2UVUA 1IBKH 4Y7NH 2B63A 3JRXA 1VQ4A 5IGDA 1C48A 3GTMB 4DR2L 2E2IA 1UUPA 1STHA 4WJWA 2UVRA 2QCPX 1KRSA 1LTRD 5LOVF 3GTLA 3KOJA 2OTJA 3AQQA 1DOLA 3N8DA 2OH2A 1LTBD 2HT1A 2AQ2B 2IA6A 2VPQA 1PH1A 3QZ7A 1PYWD 2NB0A 1WOCA 2XC9A 1MHWC 1BDOA 2EY1A 3RUZA 1HNWQ 4IR1A 4KHVA 1GSOA 4AIMA 2A19A 1B50A 2PVPA 1YNXA 2BA1A 1VQNA 2K28A 3CF5A 2VUMG 4JI4H 1B1ZA 4J9MA 3A5ZB 2VY3A 4LUVA 3N40P 2Y0SB 4YR3A 5CGKA 4HIMA 4A3EB 3G7LA 3T1YL 1XNRQ 4X66H 1I4PA 4IALA 4YJ3F 4IRKA 2UUCL 4LF4Q 1LTID 1SFOB 3I2ZA 2CH4A 4BY7H 3MJFA 1HA5A 2WAQE 2IWHA 1XPOA 4EGQA 1EY8A 2VA3A 3ORRA 4ME5A 4QY7A 4ECWA 4ECSA 3PR4A 2LS01 5E4WC 4DR5H 4OXPA 5FLMH 1I50B 1SMYD 1XNQQ 2XIWA 2D9UA 2W7PA 2F0TA 1P8LA 2L9HA 4QB4A 3GIMA 1YHQA 1T3NA 4DUZH 2A6ED 1KLGD 3J7AV 5KNBA 2ICIA 4GN5A 1IBML 4FF1A 3JZIA 4HJ9A 3BDCA 1KIXA 1VQFA 1QZGA 5BMVF 1X32A 1F9SA 4X62Q 1S0NA 2R85A 3BA9A 3GV7B 1WI5A 2FINB 5JJLA 1N36H 5C4ZA 4QW8A 3M9MB 1PTOB 4OO1H 1F9PA 1T5EA 1ILPA 1EFWA 4I65A 5D1PA 4JI5H 2Z6KA 1J5EQ 4LK1C 1FKAH 2SNMA 4QGUA 2RBMA 2K32A 3VR3A 1IOVA 2NU7B 3H3VI 1ENCA 4ZK9B 2RA4A 3D4RA 3JAME 3I70A 3T1HL 3PUXA 4PMWA 3PIOA 4KKUA 2UUBQ 1KJQA 2R6FA 1IHZA 3MR3A 1WCMB 1CM9A 1WTXA 5KFVA 4JYAQ 2N88A 4DV5L 1A6XA 4I4TF 2DIKA 1V51A 2R7ZH 2ZXPA 1ONLA 1TWFB 1SEIA 2AWOA 3VPBA 5COYA 1DJRD 3IFTA 3C46A 3WNZA 4YCUA 4RB0A 2VQEH 1S0OA 2RKSA 3TP7A 3K5NA 4J9LA 2HHHL 3HRZC 4C3IB 2EE1A 4PZ8A 5I6WA 2ZJTA 3PIO3 5KFRA 1TS4A 4IOAA 2AGQA 1I6UA 2L0CA 2VUMA 1HTLD 3ZJYC 1JKJB 4DL2A 1DONA 1EYZA 4I55F 4JI4L 4ECTA 5KFMA 4GN4B 1JT8A 3J81j 4NP5A 3PZPA 1A3UA 4C3IG 2OF1A 2EJGC 3NQIA 4ED8A 1LYLA 1CHQD 2I5MX 1Q1BA 5J39A 1RD9D 3S9WA 2FXQA 3FMCA 4LFAQ 3QOJA 1NY4A 3CCQA 4DKAC 3BDLA 4EEYA 3WWVA 1UNNC 4DUZL 1CZGA 3BA8A 3BZDB 3RMHA 2ZM6L 1Y69U 4HMIA 4E6IA 4X65Q 5FJ8H 2ASBA 1BOSA 4RU9A 4ZRZA 3OUZA 4E4TA 3RGZA 1YNNC 3DF7A 2DN8A 4M9UA 2PYKA 2WKDA 2QGQA 2XN9C 4A3FG 4G3IA 1L1OB 4PQXA 2Q2UA 3T51B 3RAQA 2E2IB 1Y1WB 1EY9A 3RLFA 1LACA 3S14H 4IFDI 1JXLA 5GAEC 2GPWA 1EWCA 5KFLA 2MCTA 4DR1Q 1SSOA 4APVA 1DOKA 5KT6A 1JCKB 3SK5A 4GC6A 1D8LA 5IYBH 3U9OA 4EBEA 5KFNA 5KX5F 1W6JA 2PMZE 1U4MA 2CCZA 4N8X1 4R4TA 1LTAD 4I7ZC 4KK7A 1S5CD 2XD4A 2W6QA 3GQBA 4FVMA 1VQGA 2R8HA 1E2ZA 1JOKA 3H0GG 2F0WA 1B6SA 3SEBA 4AQYH 5J2UF 5IYDG 4DR3L 4MHEA 2QYZA 3J81E 2UUAH 4O2BF 1GHJA 5CYUA 1TWFH 2NZHA 3CP0A 4FDBA 3G48A 1EEID 3FKIB 4YR2A 2B2YA 3ETHA 1FD7D 2O2LD 1M8AA 2HDMA 1LT5D 3A74A 5LL6X 1CKOA 2JJQA 3ERQA 1N33Q 1B9MA 3S14B 3MWYW 4M1UB 1EZ1A 4NXNL 2RF4A 4RHRA 5EWGA 1RJQA 4HYKA 2ZDHA 1ILQA 2IT1A 4DNTB 2OT2A 3GIQA 3OMCA 1N32H 2B2WC 4MTNA 3NPPA 3R93A 4C3JH 4GKJL 5IT9c 1QVCA 4Q8EA 3QB3A 4TQRA 3M9NB 3KLWA 1MGSA 4QIWA 1SMYC 3NWTA 3MXGA 1D1IA 1D1KA 2Z6BA 4MV6A 2FLLA 1FJGL 4B3SH 1DGSA 4EX5A 5LMNW 4JI7Q 2N49A 4DV1Q 5C3WA 4IPGA 1E22A 4H44C 4A3BG 4G7HC 5CB4F 3KF6A 4S3SA 3GIJA 4DV7H 4IRDA 2W57A 1PH4A 1V1PA 1V1OA 2UXDH 4JI3H 5E1FA 4KJNA 4DK1A 1Y1VG 1PH7A 3Q22A 2FMAA 2FPPB 1V8QA 1Q1EA 5AJ3Q 5CORA 4IAJA 3M7NA 4MAMA 3M4QA 1WFQA 1ICWA 3M7GA 1WSCA 4RA8A 5FPRA 4K5VA 2ZJPA 3K7UC 1KJIA 3GTOH 1QNKA 2C9OA 4WORA 3MXNA 2F0LA 1K8GA 3BZCA 1L0XB 3MTSA 2E74C 2MP1A 1S0MA 1VAJA 1M4VA 3IFDA 3J81c 3OW2A 3T13A 2R92B 3GTPA 4LWCA 2NVTB 4BWGB 1O80A 3MXPA 5C1OA 2R7KA 5GAHC 2OWOA 3BS1A 3FKIA 1JLLB 4TUYF 1JICA 2J6UA 3HOXG 4DR3H 3ETJA 3M4IA 2F3WA 2I5HA 4MNOA 5FJ8G 4K0KH 3A7AB 2NTTA 1LT6D 1CZWA 1SROA 2WAQB 4LF9L 1S03G 1YNND 2ATWA 4HSPA 3NXWA 4YHHQ 3RUPA 2KEEA 3L4JA 4DK6C 2E5LQ 1H9SB 5C5LA 3J80L 1EYAA 3K5MA 3S15B 4PMBA 1SNOA 1K83B 1YJ9A 4HR7B 2IJ0A 2X69A 2G9DA 3W1GA 5D65A 3QWNA 4BBRG 1PH8A 2NN6I 2PPBC 4NLGA 4C5AA 3T53B 1KLUD 2W9CB 2NYZD 3T1HH 1O75A 4O3NA 1JE4A 3EIVA 2H5XA 4JOIC 1OWTA 1W96A 2A8VA 5IE8A 1FNUA 3AMUA 3J7ZC 2JA5G 1TA8A 1VKZA 4HQ6A 5CBAE 4BY7G 2P0AA 5FD6A 3A8KE 1IZ6A 5LMUL 3IL8A 5JEAJ 1IBLL 2W8LA 1FJGH 4FXGC 4UCSA 4K14A 3J7AK 2JA6A 1PK8A 1I3QA 2W8KA 3S17H 2H4OA 2UUCH 1SFOH 4OIJA 1IYJB 3OTOQ 4B3TQ 3K3VA 4IJLA 4GOPA 1VQEA 2HHHH 4J9RA 2MFIA 3TZUA 1E3PA 4OX9Q 1SYGA 1SYXB 1PDQA 2K7VA 5KFZA 4JI0L 3DWAA 3SE0A 3Q8RB 1F2YA 1F2MA 3HOWB 4F4WA 2IL8A 1ESFA 3X3MA 4QWEA 1SYBA 4O4IF 5I9PA 1EIFA 5L9XA 1XDNA 2B39A 4FF3A 5KYIA 4CDEC 2VQFH 4DV6H 2K5QA 2F0SA 2RGVA 1EZ6A 2WAQG 1EY0A 4NMZA 1DM0B 1HXYD 1SNMA 4JI8Q 5KFCA 5EDWA 2HUGA 4LMYA 2B8GA 3T4AC 3CD6A 5D14A 4YBZB 3DXJC 4HMJA 4JI6L 1TWAA 2R86A 4R1JA 3SK8A 1AN8A 4DA2A 5M9OA 2UVVA 5IP7G 4A3GG 3R23A 3HOWH 1JC7A 1PH9A 2YZGA 2ATLA 5KYLA 3OW7A 3GTLH 3I4MH 3HZXA 1SE2A 2FHTA 5C4XG 3F2UA 3RTXA 1GVPA 4BY1G 1HFGA 2R7ZG 5HBRB 4RHSA 3T1YQ 1TWGB 2L1BA 3OSOA 5D1OA 5M5WH 1CSPA 2W71A 1Z7TA 1VF5C 1VQBA 4CJ1B 3R5XA 4GKKQ 1HCZA 3G6VA 3OPOA 3V6JA 2YYZA 2DWCA 1JIHA 1VBGA 4EQOA 4PZ7A 5EWFA 3S1RH 3L3OC 4CJ2C 4FP5D 4ECQA 4QIWB 1AE3A 2K14A 2R3ZA 3NP8A 5EPLA 2R61A 1JORA 5M3MG 2RVLA 3FPUB 4HIOA 1RK5A 3KBXA 3R5FA 3KTMA 2UUAL 5C1PA 2VA2A 3FHWA 2V5AA 1IBLH 2WTFA 4MTEA 1I50A 4I50F 1AE2A 2NVYH 3R2IA 4QCLA 3I4NH 1I5FA 4EVOA 1VQOA 2ZTCA 2F1MA 5C3EB 4XYOA 4NXNH 1CI3M 4DV2L 4H13C 1UE1A 4EGVA 3MHBA 3GTJH 3P1HA 2ZTDA 5LMNQ 3HOYB 1EY4A 2J6TA 1PFMA 3RZDH 4RAZA 5CA0F 1KDAA 1HZCA 3AEVA 2VS1A 5KG0A 2W6NA 2AUKA 1VQPA 3N42B 5ELDA 2ZDQA 2Z0SA 4DV6L 2W7OA 1JJCB 2M9VA 2HJWA 3PN1A 1VQ6A 4EBDA 4ME6A 1NJIC 5C44H 2CHBD 3K5LA 4J9QA 1I94L 4CKCA 4DU9A 4UCRA 2UXCQ 1DD2A 2PO4A 4DV7L 1K28A 4FS2A 1JE5A 5FO8B 1BXTA 4EGJA 1UE7A 3HKZG 3BYTB 2DLNA 3VR6A 4JI3L 1G291 2WB1E 5EPKA 5KEEA 1D5MC 2Z4HA 1L1OA 2CW0C 3RZOH 1ZXTA 2F3VA 2JE6I 2NZ1D 3S2DH 2V58A 1I3QB 5M3MB 2HDLA 1BQQT 3TINA 4AQYL 2FK3A 1QUQB 2YCHA 1NCVA 3ER0A 1LTTD 5I47A 3T5KA 1RYRA 1OXXK 2BH2A 1A0IA 2KHIA 4PMCA 1MJCA 3ITPA 4QWBA 3PV0A 4Q43A 1VF7A 1X55A 2ZTEA 2R8GA 4HJ8A 3TSSA 3MWEA 4A3JB 1S9FA 4B3MQ 2O5IC 1G51A 5BN4A 3HOXB 4CDDC 3KK7A 1H9JA 3T5JA 4DR4Q 2VR1A 4IUPA 2WV6D 2KA7A 4OWXB 4BA1I 1G91A 2ASJA 4HR7A 5DQIA 3CU7A 2RHSB 2XGQA 3KXYT 2R87A 5IP9G 3V05A 1DV1A 5CAEB 4A3KB 1N32L 4P73A 2WYOA 4EQNA 4UY8C 1WD1A 3M4OH 1TIID 2BDOA 4RZQA 2NWGA 5KFJA 4JBJA 5GQOA 4CKBA 2KQ3A 4DAYA 4B3RH 3D0FA 2NZOA 1G2SA 4DV2H 3BAAA 1PX2A 4K8JA 2NVXH 4A3LH 3PUWA 2C5CA 3PO3H 3QO2A 4IHJF 4IPCA 4LSXA 4CDCC 1Z6HA 4O4LF 3HOVH 3W1BA 3GTPB 2PW7A 2B2WA 1TWHH 5KNCA 4HIKA 1IL2A 1VCIA 4DV0Q 3ULLA 1GM5A 2YW2A 3CC7A 2R84A 1VQLA 2AUJD 1J6QA 3QR8A 3UDIA 3JSNA 1EQVA 1F2ZA 4XQQA 2KOLA 5CBEE 1BR9A 1UNSA 1EY6A 5GADC 2JA8H 4A3LG 1HR0L 4LF6L 1KJ9A 2XNAC 2ALZA 3TDQA 1MJEA 4WJ4A 1HJPA 3K81C 1W3SA 5C3XA 2O5JC 2B2YC 3I4LA 3LWBA 2RSNA 1PHJA 5CV8A 3MR5A 3OSPA 1M90C 2HIVA 2QDBA 2EYMA 1B70B 3CQZB 2IX1A 2EY5A 2UXBQ 4JOIA 4G7ZC 1C8CA 4LSAA 5FLMG 4IJHA 1PZJD 1ET9A 5K5PA 5KFSA 5A2QW 2JA8G 2AHOB 2VQFL 1SDFA 3KAKA 4FU0A 4HJ5A 5KFBA 1A3VA 4CHTB 1DZ1A 1RJPA 5EPJA 2Y0SE 3CW2C 4DAMA 3X3NA 1EWIA 2F0KA 3K7AH 5TSSA 2ENBA 5C0XH 4LFAH 4O2AF 2F0DA 2JA7B 1G8ZD 1Q90A 2DY7A 1OXUA 5E3FA 1EZ8A 4ECVA 1KBLA 1LTGD 1E1OA 1PTOC 2SEBD 1SNCA 3LWEA 5FLXE 2N78A 2WFWA 1HHVA 5JVH3 2C00A 1KC8C 4IOCA 4FNFA 3D4WA 4FF2A 1B04A 2BOSA 2A69C 2PZUA 1QVFA 2VPSA 1D2BA 4JI2H 1B4OA 3SGIA 3RBDA 1W2BA 3ND8A 1SNQA 3WO1A 1LTSD 5G3LF 2BQRA 4B08A 4X62L 1Y1WG 5F9NA 3PUYA 3CRLC 1KDCA 1R4PB 3A8JE 1Q81C 3K58A 4A2AA 2FFKB 3BG3A 1RCVD 3A8IE 3U58A 4DR6L 5IWAL 3SI8A 1YHBA 3GTOA 4F7XA 1S10A 3IRBA 2F4VQ 5KFQA 4L63B 3LMLA 1TWHB 3F8TA 3GTJB 4DL6A 4ALPA 1QE6A 1Y8PB 4APMA 1SE4A 3RF2A 5LL6b 2W9BA 1Y1WA 5EJWA 1O7YA 3K57A 2JA6G 1CHPD 2FP4B 4L6TB 2O03A 2DJGC 1TXYA 2DUDA 3QZ8A 3GV8B 2MHVA 3TQYA 2WE6A 4A3MB 2C28A 1ULZA 3RN5A 2R8JA 1A62A 4C1NK 1BNCA 2JA5A 4DL7A 3Q1KA 1SYEA 4RCOA 2XIGA 3NK9A 4J8QA 3UQ8A 3OYYA 1C7YA 3PR5B 1NTGA 1TWAB 3VYSA 3F2BA 3PUZA 4ED0A 1Q8KA 2R7LA 4LF4H 1XMQQ 4DV4H 3W3AA 2EY6A 3S16B 3G4SA 3BQ1A 4KHPQ 2YTVA 1TAEA 1MZBA 5CV7A 1K0SA 4C3HG 3NBHA 3EN2A 3NENA 1BUVT 1MBYA 4QWDA 3JAML 4RG1A 1XNQH 3UDFA 4ID6A 1GD7A 4DUZQ 2B3GA 2PCFB 3F2DA 4LH6A 2WDTA 1DYQA 3IN5A 3GTGH 2HQEA 4YB8B 3RLNA 1TWCH 4Q45A 4JC0A 1K3RA 3STBC 4A3JG 4ULLA 4GOPB 5BPHA 4KY6A 3PGZA 4DV5H 1WCMA 1LT3D 2YRWA 3GD7A 5C3EH 4OONA 1Q3LA 2RDFA 2X6GA 3KUPA 5C4XB 3A7LA 2KUMA 3G6JB 4ZI7F 2ZJRA 2XCLA 5KG1A 4KY7A 3KHGA 4A3IB 2PQAA 1NMFA 2LY7A 4X3KA 4DF7A 2D5DA 1PXUA 2W6ZA 5IP7H 5KRUA 4BY1H 4Q0FA 4A3GH 1T36A 3I56A 1VQIA 4C3JG 3OWEB 2N3SA 1RJTA 1YZ6A 4AYBG 3I4MG 5JH7F 1EY7A 2F0OA 2KCMA 4FBTA 3SK6A 4EYIB 3SE7A 3VR4A 2ZXOA 3E5NA 2E2HB 5JPNC 5IT9L 4O3SA 3I73A 4LF7Q 2R93A 1E7ZA 5J3BA 4DAYB 2RCFA 4X3TA 1RODA 4O1NA 1EUCB 3I72A 4RGMA 1TWGH 2ZM6H 5EOYA 5KFAA 1HQRD 2FJ2A 2M2LA 2MGSA 1EYGA 1PRTF 2JA5H 1K1SA 4F87A 3Q6SA 3V96A 4A3CH 4P75A 3PO2H 5K36G 3PF5A 1SJED 1A9XA 1JOQA 1HR0H 5EKIA 1PTOF 1T94A 3NWSA 1N48A 1X65A 5IYBG 3KHHA 5DLQE 4MIUA 4POGA 4DN4M 1C30A 3N6RA 1NNXA 3PO2B 2F0VA 5JVLA 4JPBW 1QUQA 4FYDA 4LAAA 2BE5D 3RB3A 2EYJA 1MIUA 3GTJA 4KJOA 4R4QA 2NVTH 3GTQH 3H91A 3HFZB 1RTOA 2FMMA 1IBMQ 1IKLA 4RAYA 5E4XA 1CSQA 3GTGA 1UE5A 2G9HD 4RNNA 2IMWP 4DR1H 1I4GA 3UDXA 1X9NA 3PO2G 4ABNA 1S40A 2KSWA 1QILA 3WOFA 5KIXA 3RBEA 1CKNA 2ASDA 4H0LC 1LV9A 1S5BD 1E4EB 2AWNA 2PI2A 3HXLA 1IXRA 4RMFA 1VQAA 2FMCA 3K3PA 4MZ9A 4IFDG 4HJAA 4NXMH 3NGDA 2W9AA 4JI2L 2JEIA 4IFDJ 4GKJH 4CC5A 2HGSA 3D3RA 3UE1A 1S5DD 4JYAL 1HNZH 1STGA 4WRDA 2E2JH 4KI0A 3S17B 4R8IA 4A3EG 1CFMA 4B3SL 1ZHSA 2WB1G 4OEMB 4FXKC 4LF6H 5IWAH 1KEEA 1CQIB 1NUCA 1VBHA 1N56A 1Q46A 3RFCA 1Z2PX 5C0XI 2BQUA 5CV9A 4UAIA 2J4XA 3M4PA 2R82A 1S4ZA 5FOBB 3HOZB 1TWCB 4P71A 1TWFA 1QJOA 4DUYQ 2EXDA 1HH2P 2VL6A 4IO9A 2E76C 1F9QA 4I7HA 4WBNF 1SMXA 5EAYA 4J15A 1IOWA 3A56A 1R4QB 3KAJA 5DGBA 2W6PA 2YRXA 5KG4A 1EFID 1HRJA 3C2PA 5FPOA 1C4QA 1PZID 4L5QA 2UXDQ 3U9TA 2FE3A 2JSOA 3N6XA 4HCEA 4MV4A 2I87A 1BVSA 3HG9A 2YZNA 2AMCB 1LUZA 1A2TA 1K3BC 1E0BA 1DV2A 4R8UB 5KFXA 3S1NH 2F0PA 2VOBA 3LGJA 1J5EL 3FDTA 4LF4L 3K59A 2HCIA 4NB3A 2JK8A 4DV4L 2MO0A 1MI2A 4YJ2F 4LF9H 4A3FB 3U9SA 1WTRA 4QJFA 2D2CC 1VDZA 4KD4A 5FLXL 2EYFA 3ULJA 5IGEA 3WOEA 4BBSB 3CPWA 1NR4A 2XRSD 3S1MB 2W6MA 1CE8A 2C2EA 2K5HA 1Q82C 2Z8LA 2L11A 3KHRA 4DR6H 4JVZA 1HZAA 1I6VC 1K8MA 2RDJA 1HR0W 1CKMA 1SAPA 1FGUA 4ME3A 4NXML 1L2FA 3QFFA 1QNUA 2JEAI 3KALA 1XMOL 5KFPA 1M1KC 2JA7A 4PG3A 4K0KQ 5IYCH 3H0GH 1JMCA 5NUCA 5JQWA 5DG7A 2R92A 4LF8Q 3DWQA 1MKHA 4YHHH 3DHQA 1R9TA 3NEMA 1RL2A 5LMUH 1V43A 4QUFA 1EU4A 2XSCA 4RNOA 4TRDA 4LFCL 3M3YH 2N55A 1N34Q 1BGWA 2K01A 2F0QA 3EFXD 3E0EA 2HIXA 3FPPA 3S2HB 2OQ0A 2NN6H 1K8AC 4X64Q 1KD1C 3R3OA 4C3JB 2UU9Q 1PA6A 2R8IA 3FKIH 3T1HQ 4IURA 5IYCG 4ETSA 5EKKA 3Q8QB 4QQBX 2HD3A 2A6HD 4ED6A 2K52A 4UFZA 1PFNA 4C3IH 4TV9F 3U50C 3CCJA 3EYYA 1E2VA 2RCNA 3N41B 1FNWA 2JEGA 4B3RQ 4YWMA 2FJZA 3RB4A 3RV3A 3K0YA 4LF5H 1D5XC 4JI1Q 4O4HF 1AEXA 4OX9H 2YU9B 4JI6H 1SYDA 1O7ZA 3TP6A 2ES2A 4Q44A 1N36Q 1AUXA 2JN4A 1C3OA 1SE8A 5EQ0A 2L55A 4JI5Q 1J8IA 3HKSA 5JAVA 4DV6Q 4B9XA 5C5MA 3SK4A 1EIHA 3D8GA 4GOPC 1GKHA 5I2XA 3MR2A 2KHSA 2OXPA 4DAVA 5C0XJ 2R92G 3S2HH 4HNUA 3RD4A 2NU6B 2YL2A 4K5WA 4PZ6A 1UEAB 5DM63 4AH6A 4EQ5A 1X3FA 4R9WA 1LT4D 5KG2A 1YNJC 4QL5A 3MXNB 1HPCA 3CC4A 3DM1A 3HP3A 4DR2Q 1Z47A 1S72A 2F0JA 2I0QA 2X0SA 2CW8A 1PYBA 2HVRA 1PH2A 1E4EA 3TREA 1NR2A 4ZQ3A 2AQ4A 3P20A 3L2PA 1V1QA 3EVQA 1CKNB 1X3GA 3K5IA 2VB3X 4LH7A 3HOVB 4P72A 1NMGA 2SDFA 3KLSA 4DR1L 1QVGA 2R7ZA 4R4CA 4M7EA 3H0GA 4XZ3B 2BR0A 3PO3B 2GN5A 1E2WA 2NVQH 2JYOA 3H4BA 2NVXB 4A3EH 4C2MB 4C2MA 3GTKB 2L15A 2XGTA 2AGOA 5A2QL 3CCUA 1D6EC 2B2UA 4BXXH 4XT1B 2R7ZB 1KDBA 2L4NA 3NBIA 4X3UA 4DV3Q 4EYHB 2F0GA 1I7LA 1CT1D 3PO3G 4A3CG 3CXCA 1TU2B 3MFIA 1ZEQX 1FL0A 2QEJC 1CK1A 2EDGA 5GROA 3H6MA 5I6YA 3BVMA 4JYAH 2KECA 2EYLA 2L5TA 3OHAA 4EFEA 4LFBQ 2R93G 4LF5L 2EOTA 4ZUIA 4A3JH 1PTOH 2ALYB 1WCMH 3SDZA 2IY5B 3RB0A 4YWLA 1KNAA 1AZQA 4IPHA 3VA5A 1Y1VH 2IHFA 3VPCA 4J1MA 3H4DA 4EG0A 4RB1A 2QKIC 3MFHA 2GVAA 4RGTA 4KHZA 5M3FH 4FXDA 1EOVA 1I50H 1II3A 2NVYA 1E4FT 4MTKA 1NBWA 2EYPA 5IIFA 3NHHA 2YU9A 3HOUH 4UCVA 4X3SA 1PH5A 3HGBA 2EY2A 3M85A 4R8UA 4UP8A 1GO3E 2E2JB 1B3QA 4PWQA 4A4IA 1Q12A 5EGTA 3CPFA 4DL3A 1UE6A 1W6KA 2CKZB 2DNCA 3MWDA 3H94A 5KNDA 1D5ZC 1WH2A 1YIJA 2Z4IA 2PQAB 2I07B 5AJ3L 3MWMA 1TKWB 1KL9A 2YS7A 4JV5L 3PQIA 5A2QE 3RZDB 4OHJA 3MFYA 5D3DA 4P74A 5M5YB 4ZHQF 2FLNA 4BY7B 1SXTA 1HNZL 3HKZB 4DR7Q 2W6OA 5J2TF 4KLKA 2B2UC 1BCPD 4JI4Q 4IR9A 2PN1A 1IW7D 1S3OA 4C5BA 1XNRH 3HB9A 2Q8IB 4X66Q 1JB3A 4KN4C 2WAQA 4YR0A 5KT3A 3JRWA 1O7IA 1T9HA 3Q8DA 3GTQB 1XMOH 4HEDA 4JI7H 1OO9B 4AQYQ 4DV1H 1ZYRC 3I3CA 2VUGA 5DAUA 1LM0A 4XX0B 1GHKA 3OOCA 1SN8A 1K8OA 4DK3C 1HNWL 1RF2D 4JI0Q 4KMUC 2R7FA 2V4DA 3NQTA 4YY3L 4DR5Q 4K8IA 1IBKQ 4HIDA 4RUAA 3FVQA 4LFCH 3SHLA 4A3BH 4JBWA 4TKOB 3H09A 1JDBB 2I8CA 4RZRA 1UC8A 5LHY1 3QIAA 2WB1A 3M4YA 4A3BB 4MV7A 2JA5B 2E8GA 5IYZF 3PIP3 3JC66 1YHAA 2JA6B 3K6OA 4OO1I 2DZDA 1LO5D 3NE5B 3J80W 5C4JH 4HNVA 3MA2B 3HEJA 4R4IA 1PRTB 3Q24A 3KJPA 2GPSA 3CCEA 1K73C 1NE3A 5IGBA 1GYFA 1YI2A 4NKLA 3VR2A 4JV2A 3GTKA 1VMPA 1FNVA 1RIPA 3TP5A 4LFAL 2W9CA 4OX9L 2NVXA 5KFUA 1GUSA 4DXFA 1SNDA 3D31A 4RUCA 3R8BA 5JPMC 2A74C 2HCCA 2H1EA 1T5XD 3BDOA 1QOHA 5KFEA 3V4ZA 2UXBH 3BJYA 3V2TA 3O13A 2LMCB 5FO7B 5T1GA 3H3VC 4UPAA 1SCUB 1VQCA 1WTOA 2VQEQ 2XCPA 1B44D 1HR0Q 4DK0A
chains in the Genus database with same CATH topology
1K3RA 4A3JG 5IYDG 4DR3L 4GOPB 1TWFH 2NZHA 3CP0A 3PGZA 2F52A 3G48A 4FDBA 5C4XH 4K0KL 3NELA 4GKJQ 3GD7A 5C3EH 4GNXC 4OONA 5M5YH 3I4NG 3PIPA 3A74A 1CKOA 2JJQA 2KHJA 2ZJRA 1N33Q 2PQAA 4JI7L 1NMFA 4NXNL 3CCRA 4H02A 4DV1L 4A3KG 2RF4A 1L1OC 4DR3Q 1TWAH 2IT1A 1VS0A 3VDYA 3K8AA 5IP7H 4BY1H 1QZHA 4A3GH 3I56A 1VQIA 1HNXL 2N3SA 1VQ9A 1YZ6A 3DM3A 4AYBG 3I4MG 4MTNA 2VUMH 4GKJL 2KCMA 4C3JH 5IT9c 1QVCA 3UE0A 2I5LX 3A0JA 3KLWA 3RNUA 2MO1A 1BBUA 1Y1WH 4A93G 4LF7Q 1FJGL 1PV4A 1DGSA 4EX5A 5LMNW 1XMOQ 4JI7Q 1E7ZA 2K5VA 4DV3L 1K73C 5J3BA 2N49A 3KDFA 4DV1Q 5ELNA 4DAYB 4IPGA 1E22A 4A3MG 4A3BG 2PI2E 4Y52H 3KF6A 3KYHC 2LXJA 1PH4A 1I94Q 2KCTA 1TWGH 3JAMi 4LF8L 4TVAB 2OCEA 2MNAA 1I6HH 1HNZQ 4GLXA 4DR7L 1Y14B 3GDEA 1Y1VG 1EYGA 2JA5H 1PH7A 1FJGQ 3HOVG 1UEBA 4P75A 3PO2H 4A3CH 3PF5A 1Q1EA 5K36G 5AJ3Q 3G6EA 3L7ZC 4X66L 5IWAQ 1N34L 1VQ5A 3M4QA 1WFQA 2R92H 3HOYG 3M7NA 1X6OA 4GLAC 2ZJPA 1H95A 3K7UC 1R9TH 3GTOH 2UUAQ 3DLLA 2JA9A 3ULPA 1X65A 3GTKH 4DV5Q 5IYBG 4TQUS 1K8GA 3BZCA 5DLQE 1XNQL 2UXBL 2D0PA 3J81c 2K5NA 3OW2A 4POGA 2N8NA 3BZKA 4LWCA 5ELOA 3H3VH 4A3KH 4YY3Q 2VW9A 4DR5L 1QUQA 1EUJA 5GAHC 1XPUA 2IHEA 2ZJQA 2OWOA 3KJOA 5JEAG 1MIUA 1KAWA 4DV4Q 4R4QA 1Q7YC 2NVTH 3GTQH 3HFZB 3HOXG 1IBMQ 2YTYA 5LMNL 3TS2A 1CSQA 1FVIA 2I5HA 1UE5A 4LUZA 4MNOA 5FJ8G 4JI1L 1B8AA 1SROA 2PNHA 4LNQA 4LF9L 1X9NA 3UDXA 2ATWA 4YHHQ 3PO2G 5C0XG 3TEHB 1S40A 1PH6A 3JAMc 2JA7G 4POFA 5LMUQ 4DK6C 3PCOB 2E5LQ 2CFMA 1IBLQ 1ASZA 1CKNA 2JA7H 3ERSX 4JI5L 3I55A 1C9OA 4BXXG 1YJ9A 2AWNA 3W1GA 3AYHB 1HZBA 2PI2A 3NBHB 1IXRA 4RMFA 4BBRG 1VQJA 3I4OA 1PH8A 1SR3A 1VQAA 2NN6I 4MZ9A 4NXNQ 4IFDG 4HJAA 2EIFA 4LF9Q 2HQLA 2UXCL 4JI2L 4IFDJ 3EIVA 2H5XA 4JOIC 1Q86C 1JJGA 2A8VA 5IE8A 3UE1A 3CQZH 3J7ZC 4L5TA 2JA5G 3BU2A 4JYAL 4BY7G 4DNIA 2E2JH 4KI0A 1IZ6A 1X56A 5LMUL 4A3EG 5JEAJ 1IBLL 4X65L 4B3SL 3CCSA 3J7A5 4X64L 2WB1G 3H15A 1XNRL 2Q2TA 3S17H 1SFOH 4B3TQ 1IYJB 3OTOQ 2V1CC 4IJLA 4GOPA 1VQEA 4LF5Q 2Y0SG 1Q46A 2MFIA 1E3PA 3AFQA 1KRTA 5C0XI 4OX9Q 4YCWA 4JI6Q 4JI0L 5HY6A 3M4PA 1PH3A 1N32Q 4P71A 2F3IA 3J81i 2EXDA 2JEBI 1HH2P 1VQDA 2OQKA 2VL6A 4NPSA 4DUYQ 4IO9A 1EIFA 3HOYH 1SMXA 1WCMG 5EAYA 4J15A 3AFPA 1BKBA 1ASYA 2WAQG 4JI8Q 1EQRA 2B63H 3CD6A 3STBC 4L5QA 4JI6L 2E2IH 2Q2HA 2ZM6Q 2UXDQ 4C2MH 4R1JA 4O2DA 4OWTB 1N36L 1YJNA 2K50A 2A1AA 1N8RC 2BH8A 4JI3Q 5GAGC 5H1SE 5IP7G 4A3GG 3MEFA 3HOWH 5IYDH 1YJWA 1PH9A 1BVSA 1P16A 3GTLH 2AMCB 1LUZA 1OXSC 1VQ8A 3I4MH 4LFBL 3GTPH 1C0AA 4HJ7A 3S1NH 5C4XG 4YCVA 5BR8Q 1GVPA 4BY1G 3LGJA 2R7ZG 1J5EL 4LF4L 4NB3A 3U4ZA 2JK8A 4DV4L 3T1YQ 1VQMA 2MO0A 5M5WH 2R93H 1CSPA 1A8VA 4QJFA 2UUBL 3B6YA 1VQBA 3ULJA 4GKKQ 3CPWA 2YYZA 2RHQB 1WYDA 2K5HA 1Q82C 4BBSH 4PZ7A 1OTCA 3S1RH 2VQEL 1HZAA 3J80i 3CCMA 1HR0W 1CKMA 4ME3A 1FGUA 4DV2Q 4GNXA 1AE3A 1L2FA 2K14A 2UUCQ 2HHHQ 2MQHA 1XMOL 1M1KC 4NXML 2JEAI 5IY0A 2UU9L 4PG3A 4K0KQ 5M3MG 3H0GH 1VQHA 5IYCH 2ID0A 4R4OA 4HIOA 1JMCA 3HOWG 4LF8Q 1K9MC 1MKHA 2UUAL 3HOXH 3NEMA 4GN3B 1RL2A 3S24A 1V43A 3FHWA 3K80C 3S1MH 2CWAA 1UWVA 1XTDA 2R6GA 4LFCL 4A76A 1AE2A 1KQSA 3M3YH 2NVYH 1N34Q 2NN6G 3I4NH 2VQFQ 4A3FH 1I5FA 3E0EA 2HIXA 3RR5A 1VQOA 2YU9H 2OQ0A 3ICEA 2UU9Q 2ZTCA 4X64Q 1K8AC 1KD1C 4B3RL 4A3IG 1PA6A 4IPDA 4DV2L 4NXMQ 2BA0A 1UE1A 3FKIH 3T1HQ 3GTJH 1VQKA 1I3QH 3RLOA 5M3MH 2ZTDA 5IYCG 5LMNQ 4JV5Q 4L5RC 1HR0Q 2KENA 3RZDH 4DV0L 1HNXQ 4QQBX 2C35B 3TRZA 2K52A 3CCLA 1HZCA 4C3IH 3AEVA 2DGYA 2Q2IA 2VS1A 3CMAA 4QIWE 3U50C 1OXTA 3CCJA 2LXKA 3HOZH 1VQPA 1V9PA 4LF7L 3PUVA 1E1TA 2RCNA 4A3DH 1YVCA 2XTIA 2Z0SA 4DV6L 3I7FA 1JJCB 4B3RQ 3EBEA 4YWMA 4LF6Q 1VQ6A 2QEXA 1XJVA 4JI1Q 1NJIC 2K4KA 5C44H 1AH9A 1I94L 2B29A 2VNUD 4JCVE 2UXCQ 2ES2A 2E5LL 4DV7L 1B7YB 1WJJA 1JE5A 3RN2A 5FLXc 4B3ML 4A93H 1UE7A 3HKZG 2QA4A 1N36Q 4JI3L 1G291 1A63A 2WB1E 1SE8A 1L1OA 4DR6Q 3RZOH 4JI5Q 2JE6I 3S2DH 3HKSA 4DV6Q 3HKZE 1IBKL 3TS0A 4GOPC 1GKHA 4AQYL 4C3HH 1QUQB 2JA6H 5C0XJ 2R92G 3S2HH 1X3EA 3ER0A 1KXLA 1OXXK 4JI2Q 2BH2A 1A0IA 4PZ6A 2KHIA 2YV5A 3S15H 1MJCA 4AH6A 4EQ5A 3PV0A 3M9BA 1BBWA 1X3FA 3HOUG 1X55A 2ZTEA 2OTLA 1CUKA 3MXNB 4QL5A 3F2CA 4HJ8A 2D0OA 3CC4A 4B3MQ 1G51A 4XIGS 4DR4Q 4DR2Q 1SLJA 1U5KA 1Z47A 3K0XA 1YITA 2R7DA 1S72A 2I0QA 3FKIG 2LSSA 4OWXB 1PYBA 3UDGA 4BA1I 1K0RA 4DPGA 1PH2A 1PFSA 3TREA 3FP9A 1XMQL 4B3TL 3L2PA 1V1QA 2RHSB 1PVOA 1CKNB 1X3GA 4YHHL 1K83H 2D62A 5IP9G 2EQSA 4LW1A 4P72A 1NMGA 4JG2A 4DR1L 1QVGA 5IP9H 1N32L 4P73A 4R4CA 3PF4A 4UY8C 2GN5A 4Y7NH 3M4OH 1VQ4A 2NVQH 4DR2L 1N9WA 4JBJA 4A3EH 5GQOA 2VZAA 1LTLA 2JQOA 2L15A 2XGTA 3D0FA 2NZOA 1KRSA 3W5OA 3CCUA 4WJ3M 1G6PA 4LUOA 2NVXH 4A3LH 4BXXH 3PUWA 3KOJA 3GTMH 3AQQA 2OTJA 2HT1A 4GS3A 4DV3Q 4A75A 3PO3H 4IPCA 1PH1A 1WOCA 3PO3G 3HOVH 3CAMA 1X54A 3W1BA 3CXCA 4A3CG 1HNWQ 1FL0A 2KBNA 1TWHH 4AIMA 2A19A 4HIKA 1IL2A 1VCIA 1YNXA 2BA1A 3ULLA 4DV0Q 1GM5A 5GROA 3CF5A 3CC7A 1VQNA 5JJIA 1VQLA 2VUMG 1J6QA 3UDIA 5BR8L 3KF8B 3U4VA 3A5ZB 2VY3A 4LUVA 2B63G 4LFBQ 2R93G 4LF5L 3CMEA 4HIMA 1XNRQ 3T1YL 5GADC 2JA8H 4A3LG 4A3JH 1HR0L 4LF6L 2ALYB 3HOZG 2UUCL 4LF4Q 1MJEA 4WJ4A 3I2ZA 1HJPA 1WCMH 3K81C 1W3SA 4BY7H 2IY5B 2WAQE 3J80c 4YWLA 1XPOA 4OWWB 1PHJA 4IPHA 4QY7A 3G71A 1Y1VH 2IHFA 4GKKL 3E9IA 4L5SA 1M90C 2HIVA 1B70B 3KF6B 4O0AA 4DUYL 4OXPA 5FLMH 5M3FG 1XNQQ 2IX1A 2UXBQ 3KDFB 4JOIA 1N33L 1P8LA 2GVAA 1YHQA 4LFCQ 4KHZA 4IJHA 5FLMG 5M3FH 1E24A 1EOVA 1I50H 2AHOB 2VQFL 2JA8G 4HJ5A 4GN5A 1IBML 1NBWA 4KHPL 4HJ9A 2Y0SE 3CW2C 3HOUH 1KIXA 1VQFA 4DAMA 1QZGA 1EWIA 3K7AH 1PH5A 2GVBA 4X62Q 4BBRH 4GNXB 3M85A 4UP8A 1GO3E 1OXUA 1WI5A 5JJLA 3F1ZA 5C44G 4A4IA 1Q12A 3CPFA 1E1OA 1UE6A 1EFWA 2CKZB 4YWKA 2N78A 2Z6KA 1J5EQ 2WFWA 1YIJA 3E9HA 4DR4L 5E7NA 4QGUA 4OO1G 2PQAB 5AJ3L 3H3VI 4BBSG 1KC8C 2Z6KC 4IOCA 1KL9A 3GO5A 1KHIA 5M5XH 1SRUA 1EQQA 3T1HL 4JV5L 2CWPA 1QVFA 3PUXA 4PMWA 5C3EG 3PIOA 2UUBQ 4JBKA 3SGIA 1W2BA 3PSIA 4P74A 1JJ2A 4X62L 1Y1WG 1HNZL 1PYSB 4DR7Q 4JYAQ 3PUYA 2WP8J 4DV5L 4KLKA 1Q81C 4JI4Q 2R7ZH 2AWOA 1S3OA 3U58A 2YTXA 4DR6L 4BA2I 4YCUA 3S16H 5IWAL 4X66Q 5HGQA 3S1QH 1YHBA 1EIYB 1O7IA 2HHHL 4PZ8A 3OTOL 4B3SQ 1T9HA 3Q8DA 3IRBA 1L0WA 2F4VQ 4A3DG 4AQYQ 4IOAA 3F8TA 1LM0A 3ZJYC 4ALPA 4DV7Q 1SN8A 1D7QA 4DK3C 1HNWL 4JI4L 4JI0Q 4GN4B 1JT8A 2R7FA 4YY3L 3BJUA 4DR5Q 3J81j 1IBKQ 4HIDA 2JA6G 4A3MH 4A3BH 4JBWA 4GLVB 4JBMA 1TXYA 3CC2A 4UP7A 1LYLA 2F4VL 2CQOA 1JB7A 2I5MX 1Q1BA 2DUDA 3L0OA 4JI8L 3TQYA 2FXQA 4LFAQ 1NY4A 2E8GA 2E2HH 3STBD 3CCQA 4DKAC 3RN5A 1OXVA 3JC66 1A62A 1YHAA 3CCVA 4OO1I 3WWVA 4DUZL 2ZM6L 2UXDL 4X6AH 5C4JH 4X65Q 5FJ8H 1VQ7A 2ASBA 4R4IA 3KJPA 3OYYA 2K75A 1C7YA 3CCEA 1U0LA 1NTGA 4AYBE 3F2BA 1NE3A 1YEZA 3PUZA 1Q8KA 3A5UA 1YI2A 2QGQA 4A3FG 1XMQQ 1L1OB 4LFAL 1RIPA 2Q2UA 4OX9L 2IX0A 3G4SA 3RLFA 4A3IH 1HZ9A 3S14H 2YTVA 4IFDI 4KHPQ 5GAEC 3D31A 2AKWB 3KFUA 4DR1Q 3EN2A 4APVA 3NENA 1XPRA 4XTCS 4RG1A 1D8LA 5IYBH 3UDFA 1GD7A 4UP9A 1YBYA 4DUZQ 2B3GA 2PMZE 3F2DA 1Z9FA 4UPAA 2CCZA 4R4TA 5JJKA 1VQCA 2VQEQ 3GTGH 1VQGA 3RLNA 1TWCH 3H0GG 4JC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K3R A;  4A3J G;  5IYD G;  4DR3 L;  4GOP B;  1TWF H;  2NZH A;  3CP0 A;  3PGZ A;  2F52 A;  3G48 A;  4FDB A;  5C4X H;  4K0K L;  3NEL A;  4GKJ Q;  3GD7 A;  5C3E H;  4GNX C;  4OON A;  5M5Y H;  3I4N G;  3PIP A;  3A74 A;  1CKO A;  2JJQ A;  2KHJ A;  2ZJR A;  1N33 Q;  2PQA A;  4JI7 L;  1NMF A;  4NXN L;  3CCR A;  4H02 A;  4DV1 L;  4A3K G;  2RF4 A;  1L1O C;  4DR3 Q;  1TWA H;  2IT1 A;  1VS0 A;  3VDY A;  3K8A A;  5IP7 H;  4BY1 H;  1QZH A;  4A3G H;  3I56 A;  1VQI A;  1HNX L;  2N3S A;  1VQ9 A;  1YZ6 A;  3DM3 A;  4AYB G;  3I4M G;  4MTN A;  2VUM H;  4GKJ L;  2KCM A;  4C3J H;  5IT9 c;  1QVC A;  3UE0 A;  2I5L X;  3A0J A;  3KLW A;  3RNU A;  2MO1 A;  1BBU A;  1Y1W H;  4A93 G;  4LF7 Q;  1FJG L;  1PV4 A;  1DGS A;  4EX5 A;  5LMN W;  1XMO Q;  4JI7 Q;  1E7Z A;  2K5V A;  4DV3 L;  1K73 C;  5J3B A;  2N49 A;  3KDF A;  4DV1 Q;  5ELN A;  4DAY B;  4IPG A;  1E22 A;  4A3M G;  4A3B G;  2PI2 E;  4Y52 H;  3KF6 A;  3KYH C;  2LXJ A;  1PH4 A;  1I94 Q;  2KCT A;  1TWG H;  3JAM i;  4LF8 L;  4TVA B;  2OCE A;  2MNA A;  1I6H H;  1HNZ Q;  4GLX A;  4DR7 L;  1Y14 B;  3GDE A;  1Y1V G;  1EYG A;  2JA5 H;  1PH7 A;  1FJG Q;  3HOV G;  1UEB A;  4P75 A;  3PO2 H;  4A3C H;  3PF5 A;  1Q1E A;  5K36 G;  5AJ3 Q;  3G6E A;  3L7Z C;  4X66 L;  5IWA Q;  1N34 L;  1VQ5 A;  3M4Q A;  1WFQ A;  2R92 H;  3HOY G;  3M7N A;  1X6O A;  4GLA C;  2ZJP A;  1H95 A;  3K7U C;  1R9T H;  3GTO H;  2UUA Q;  3DLL A;  2JA9 A;  3ULP A;  1X65 A;  3GTK H;  4DV5 Q;  5IYB G;  4TQU S;  1K8G A;  3BZC A;  5DLQ E;  1XNQ L;  2UXB L;  2D0P A;  3J81 c;  2K5N A;  3OW2 A;  4POG A;  2N8N A;  3BZK A;  4LWC A;  5ELO A;  3H3V H;  4A3K H;  4YY3 Q;  2VW9 A;  4DR5 L;  1QUQ A;  1EUJ A;  5GAH C;  1XPU A;  2IHE A;  2ZJQ A;  2OWO A;  3KJO A;  5JEA G;  1MIU A;  1KAW A;  4DV4 Q;  4R4Q A;  1Q7Y C;  2NVT H;  3GTQ H;  3HFZ B;  3HOX G;  1IBM Q;  2YTY A;  5LMN L;  3TS2 A;  1CSQ A;  1FVI A;  2I5H A;  1UE5 A;  4LUZ A;  4MNO A;  5FJ8 G;  4JI1 L;  1B8A A;  1SRO A;  2PNH A;  4LNQ A;  4LF9 L;  1X9N A;  3UDX A;  2ATW A;  4YHH Q;  3PO2 G;  5C0X G;  3TEH B;  1S40 A;  1PH6 A;  3JAM c;  2JA7 G;  4POF A;  5LMU Q;  4DK6 C;  3PCO B;  2E5L Q;  2CFM A;  1IBL Q;  1ASZ A;  1CKN A;  2JA7 H;  3ERS X;  4JI5 L;  3I55 A;  1C9O A;  4BXX G;  1YJ9 A;  2AWN A;  3W1G A;  3AYH B;  1HZB A;  2PI2 A;  3NBH B;  1IXR A;  4RMF A;  4BBR G;  1VQJ A;  3I4O A;  1PH8 A;  1SR3 A;  1VQA A;  2NN6 I;  4MZ9 A;  4NXN Q;  4IFD G;  4HJA A;  2EIF A;  4LF9 Q;  2HQL A;  2UXC L;  4JI2 L;  4IFD J;  3EIV A;  2H5X A;  4JOI C;  1Q86 C;  1JJG A;  2A8V A;  5IE8 A;  3UE1 A;  3CQZ H;  3J7Z C;  4L5T A;  2JA5 G;  3BU2 A;  4JYA L;  4BY7 G;  4DNI A;  2E2J H;  4KI0 A;  1IZ6 A;  1X56 A;  5LMU L;  4A3E G;  5JEA J;  1IBL L;  4X65 L;  4B3S L;  3CCS A;  3J7A 5;  4X64 L;  2WB1 G;  3H15 A;  1XNR L;  2Q2T A;  3S17 H;  1SFO H;  4B3T Q;  1IYJ B;  3OTO Q;  2V1C C;  4IJL A;  4GOP A;  1VQE A;  4LF5 Q;  2Y0S G;  1Q46 A;  2MFI A;  1E3P A;  3AFQ A;  1KRT A;  5C0X I;  4OX9 Q;  4YCW A;  4JI6 Q;  4JI0 L;  5HY6 A;  3M4P A;  1PH3 A;  1N32 Q;  4P71 A;  2F3I A;  3J81 i;  2EXD A;  2JEB I;  1HH2 P;  1VQD A;  2OQK A;  2VL6 A;  4NPS A;  4DUY Q;  4IO9 A;  1EIF A;  3HOY H;  1SMX A;  1WCM G;  5EAY A;  4J15 A;  3AFP A;  1BKB A;  1ASY A;  2WAQ G;  4JI8 Q;  1EQR A;  2B63 H;  3CD6 A;  3STB C;  4L5Q A;  4JI6 L;  2E2I H;  2Q2H A;  2ZM6 Q;  2UXD Q;  4C2M H;  4R1J A;  4O2D A;  4OWT B;  1N36 L;  1YJN A;  2K50 A;  2A1A A;  1N8R C;  2BH8 A;  4JI3 Q;  5GAG C;  5H1S E;  5IP7 G;  4A3G G;  3MEF A;  3HOW H;  5IYD H;  1YJW A;  1PH9 A;  1BVS A;  1P16 A;  3GTL H;  2AMC B;  1LUZ A;  1OXS C;  1VQ8 A;  3I4M H;  4LFB L;  3GTP H;  1C0A A;  4HJ7 A;  3S1N H;  5C4X G;  4YCV A;  5BR8 Q;  1GVP A;  4BY1 G;  3LGJ A;  2R7Z G;  1J5E L;  4LF4 L;  4NB3 A;  3U4Z A;  2JK8 A;  4DV4 L;  3T1Y Q;  1VQM A;  2MO0 A;  5M5W H;  2R93 H;  1CSP A;  1A8V A;  4QJF A;  2UUB L;  3B6Y A;  1VQB A;  3ULJ A;  4GKK Q;  3CPW A;  2YYZ A;  2RHQ B;  1WYD A;  2K5H A;  1Q82 C;  4BBS H;  4PZ7 A;  1OTC A;  3S1R H;  2VQE L;  1HZA A;  3J80 i;  3CCM A;  1HR0 W;  1CKM A;  4ME3 A;  1FGU A;  4DV2 Q;  4GNX A;  1AE3 A;  1L2F A;  2K14 A;  2UUC Q;  2HHH Q;  2MQH A;  1XMO L;  1M1K C;  4NXM L;  2JEA I;  5IY0 A;  2UU9 L;  4PG3 A;  4K0K Q;  5M3M G;  3H0G H;  1VQH A;  5IYC H;  2ID0 A;  4R4O A;  4HIO A;  1JMC A;  3HOW G;  4LF8 Q;  1K9M C;  1MKH A;  2UUA L;  3HOX H;  3NEM A;  4GN3 B;  1RL2 A;  3S24 A;  1V43 A;  3FHW A;  3K80 C;  3S1M H;  2CWA A;  1UWV A;  1XTD A;  2R6G A;  4LFC L;  4A76 A;  1AE2 A;  1KQS A;  3M3Y H;  2NVY H;  1N34 Q;  2NN6 G;  3I4N H;  2VQF Q;  4A3F H;  1I5F A;  3E0E A;  2HIX A;  3RR5 A;  1VQO A;  2YU9 H;  2OQ0 A;  3ICE A;  2UU9 Q;  2ZTC A;  4X64 Q;  1K8A C;  1KD1 C;  4B3R L;  4A3I G;  1PA6 A;  4IPD A;  4DV2 L;  4NXM Q;  2BA0 A;  1UE1 A;  3FKI H;  3T1H Q;  3GTJ H;  1VQK A;  1I3Q H;  3RLO A;  5M3M H;  2ZTD A;  5IYC G;  5LMN Q;  4JV5 Q;  4L5R C;  1HR0 Q;  2KEN A;  3RZD H;  4DV0 L;  1HNX Q;  4QQB X;  2C35 B;  3TRZ A;  2K52 A;  3CCL A;  1HZC A;  4C3I H;  3AEV A;  2DGY A;  2Q2I A;  2VS1 A;  3CMA A;  4QIW E;  3U50 C;  1OXT A;  3CCJ A;  2LXK A;  3HOZ H;  1VQP A;  1V9P A;  4LF7 L;  3PUV A;  1E1T A;  2RCN A;  4A3D H;  1YVC A;  2XTI A;  2Z0S A;  4DV6 L;  3I7F A;  1JJC B;  4B3R Q;  3EBE A;  4YWM A;  4LF6 Q;  1VQ6 A;  2QEX A;  1XJV A;  4JI1 Q;  1NJI C;  2K4K A;  5C44 H;  1AH9 A;  1I94 L;  2B29 A;  2VNU D;  4JCV E;  2UXC Q;  2ES2 A;  2E5L L;  4DV7 L;  1B7Y B;  1WJJ A;  1JE5 A;  3RN2 A;  5FLX c;  4B3M L;  4A93 H;  1UE7 A;  3HKZ G;  2QA4 A;  1N36 Q;  4JI3 L;  1G29 1;  1A63 A;  2WB1 E;  1SE8 A;  1L1O A;  4DR6 Q;  3RZO H;  4JI5 Q;  2JE6 I;  3S2D H;  3HKS A;  4DV6 Q;  3HKZ E;  1IBK L;  3TS0 A;  4GOP C;  1GKH A;  4AQY L;  4C3H H;  1QUQ B;  2JA6 H;  5C0X J;  2R92 G;  3S2H H;  1X3E A;  3ER0 A;  1KXL A;  1OXX K;  4JI2 Q;  2BH2 A;  1A0I A;  4PZ6 A;  2KHI A;  2YV5 A;  3S15 H;  1MJC A;  4AH6 A;  4EQ5 A;  3PV0 A;  3M9B A;  1BBW A;  1X3F A;  3HOU G;  1X55 A;  2ZTE A;  2OTL A;  1CUK A;  3MXN B;  4QL5 A;  3F2C A;  4HJ8 A;  2D0O A;  3CC4 A;  4B3M Q;  1G51 A;  4XIG S;  4DR4 Q;  4DR2 Q;  1SLJ A;  1U5K A;  1Z47 A;  3K0X A;  1YIT A;  2R7D A;  1S72 A;  2I0Q A;  3FKI G;  2LSS A;  4OWX B;  1PYB A;  3UDG A;  4BA1 I;  1K0R A;  4DPG A;  1PH2 A;  1PFS A;  3TRE A;  3FP9 A;  1XMQ L;  4B3T L;  3L2P A;  1V1Q A;  2RHS B;  1PVO A;  1CKN B;  1X3G A;  4YHH L;  1K83 H;  2D62 A;  5IP9 G;  2EQS A;  4LW1 A;  4P72 A;  1NMG A;  4JG2 A;  4DR1 L;  1QVG A;  5IP9 H;  1N32 L;  4P73 A;  4R4C A;  3PF4 A;  4UY8 C;  2GN5 A;  4Y7N H;  3M4O H;  1VQ4 A;  2NVQ H;  4DR2 L;  1N9W A;  4JBJ A;  4A3E H;  5GQO A;  2VZA A;  1LTL A;  2JQO A;  2L15 A;  2XGT A;  3D0F A;  2NZO A;  1KRS A;  3W5O A;  3CCU A;  4WJ3 M;  1G6P A;  4LUO A;  2NVX H;  4A3L H;  4BXX H;  3PUW A;  3KOJ A;  3GTM H;  3AQQ A;  2OTJ A;  2HT1 A;  4GS3 A;  4DV3 Q;  4A75 A;  3PO3 H;  4IPC A;  1PH1 A;  1WOC A;  3PO3 G;  3HOV H;  3CAM A;  1X54 A;  3W1B A;  3CXC A;  4A3C G;  1HNW Q;  1FL0 A;  2KBN A;  1TWH H;  4AIM A;  2A19 A;  4HIK A;  1IL2 A;  1VCI A;  1YNX A;  2BA1 A;  3ULL A;  4DV0 Q;  1GM5 A;  5GRO A;  3CF5 A;  3CC7 A;  1VQN A;  5JJI A;  1VQL A;  2VUM G;  1J6Q A;  3UDI A;  5BR8 L;  3KF8 B;  3U4V A;  3A5Z B;  2VY3 A;  4LUV A;  2B63 G;  4LFB Q;  2R93 G;  4LF5 L;  3CME A;  4HIM A;  1XNR Q;  3T1Y L;  5GAD C;  2JA8 H;  4A3L G;  4A3J H;  1HR0 L;  4LF6 L;  2ALY B;  3HOZ G;  2UUC L;  4LF4 Q;  1MJE A;  4WJ4 A;  3I2Z A;  1HJP A;  1WCM H;  3K81 C;  1W3S A;  4BY7 H;  2IY5 B;  2WAQ E;  3J80 c;  4YWL A;  1XPO A;  4OWW B;  1PHJ A;  4IPH A;  4QY7 A;  3G71 A;  1Y1V H;  2IHF A;  4GKK L;  3E9I A;  4L5S A;  1M90 C;  2HIV A;  1B70 B;  3KF6 B;  4O0A A;  4DUY L;  4OXP A;  5FLM H;  5M3F G;  1XNQ Q;  2IX1 A;  2UXB Q;  3KDF B;  4JOI A;  1N33 L;  1P8L A;  2GVA A;  1YHQ A;  4LFC Q;  4KHZ A;  4IJH A;  5FLM G;  5M3F H;  1E24 A;  1EOV A;  1I50 H;  2AHO B;  2VQF L;  2JA8 G;  4HJ5 A;  4GN5 A;  1IBM L;  1NBW A;  4KHP L;  4HJ9 A;  2Y0S E;  3CW2 C;  3HOU H;  1KIX A;  1VQF A;  4DAM A;  1QZG A;  1EWI A;  3K7A H;  1PH5 A;  2GVB A;  4X62 Q;  4BBR H;  4GNX B;  3M85 A;  4UP8 A;  1GO3 E;  1OXU A;  1WI5 A;  5JJL A;  3F1Z A;  5C44 G;  4A4I A;  1Q12 A;  3CPF A;  1E1O A;  1UE6 A;  1EFW A;  2CKZ B;  4YWK A;  2N78 A;  2Z6K A;  1J5E Q;  2WFW A;  1YIJ A;  3E9H A;  4DR4 L;  5E7N A;  4QGU A;  4OO1 G;  2PQA B;  5AJ3 L;  3H3V I;  4BBS G;  1KC8 C;  2Z6K C;  4IOC A;  1KL9 A;  3GO5 A;  1KHI A;  5M5X H;  1SRU A;  1EQQ A;  3T1H L;  4JV5 L;  2CWP A;  1QVF A;  3PUX A;  4PMW A;  5C3E G;  3PIO A;  2UUB Q;  4JBK A;  3SGI A;  1W2B A;  3PSI A;  4P74 A;  1JJ2 A;  4X62 L;  1Y1W G;  1HNZ L;  1PYS B;  4DR7 Q;  4JYA Q;  3PUY A;  2WP8 J;  4DV5 L;  4KLK A;  1Q81 C;  4JI4 Q;  2R7Z H;  2AWO A;  1S3O A;  3U58 A;  2YTX A;  4DR6 L;  4BA2 I;  4YCU A;  3S16 H;  5IWA L;  4X66 Q;  5HGQ A;  3S1Q H;  1YHB A;  1EIY B;  1O7I A;  2HHH L;  4PZ8 A;  3OTO L;  4B3S Q;  1T9H A;  3Q8D A;  3IRB A;  1L0W A;  2F4V Q;  4A3D G;  4AQY Q;  4IOA A;  3F8T A;  1LM0 A;  3ZJY C;  4ALP A;  4DV7 Q;  1SN8 A;  1D7Q A;  4DK3 C;  1HNW L;  4JI4 L;  4JI0 Q;  4GN4 B;  1JT8 A;  2R7F A;  4YY3 L;  3BJU A;  4DR5 Q;  3J81 j;  1IBK Q;  4HID A;  2JA6 G;  4A3M H;  4A3B H;  4JBW A;  4GLV B;  4JBM A;  1TXY A;  3CC2 A;  4UP7 A;  1LYL A;  2F4V L;  2CQO A;  1JB7 A;  2I5M X;  1Q1B A;  2DUD A;  3L0O A;  4JI8 L;  3TQY A;  2FXQ A;  4LFA Q;  1NY4 A;  2E8G A;  2E2H H;  3STB D;  3CCQ A;  4DKA C;  3RN5 A;  1OXV A;  3JC6 6;  1A62 A;  1YHA A;  3CCV A;  4OO1 I;  3WWV A;  4DUZ L;  2ZM6 L;  2UXD L;  4X6A H;  5C4J H;  4X65 Q;  5FJ8 H;  1VQ7 A;  2ASB A;  4R4I A;  3KJP A;  3OYY A;  2K75 A;  1C7Y A;  3CCE A;  1U0L A;  1NTG A;  4AYB E;  3F2B A;  1NE3 A;  1YEZ A;  3PUZ A;  1Q8K A;  3A5U A;  1YI2 A;  2QGQ A;  4A3F G;  1XMQ Q;  1L1O B;  4LFA L;  1RIP A;  2Q2U A;  4OX9 L;  2IX0 A;  3G4S A;  3RLF A;  4A3I H;  1HZ9 A;  3S14 H;  2YTV A;  4IFD I;  4KHP Q;  5GAE C;  3D31 A;  2AKW B;  3KFU A;  4DR1 Q;  3EN2 A;  4APV A;  3NEN A;  1XPR A;  4XTC S;  4RG1 A;  1D8L A;  5IYB H;  3UDF A;  1GD7 A;  4UP9 A;  1YBY A;  4DUZ Q;  2B3G A;  2PMZ E;  3F2D A;  1Z9F A;  4UPA A;  2CCZ A;  4R4T A;  5JJK A;  1VQC A;  2VQE Q;  3GTG H;  1VQG A;  3RLN A;  1TWC H;  3H0G G;  4JC0 A; 
#chains in the Genus database with same CATH topology
 2NUA B;  5FD5 A;  4X62 H;  2BCO A;  1BO0 A;  2YZM A;  2F52 A;  3G8C A;  4L8J A;  5C4X H;  1FR3 A;  3NEL A;  2K05 A;  2NU9 B;  1BBX C;  5C5J A;  2ZT9 C;  1B3A A;  4GNX C;  4FBU A;  3T16 A;  2GLT A;  1WR2 A;  1HUM A;  5M5Y H;  3I91 A;  2JEF A;  2KHJ A;  1TS2 A;  3EA6 A;  2KED A;  5EBD A;  1TS5 A;  3SXH A;  1B53 A;  3CCR A;  5DM7 3;  4H02 A;  4A3K G;  2PMZ A;  1XXG A;  1L1O C;  4DR3 Q;  1WD0 A;  3VDY A;  2K5D A;  3K8A A;  4PNY A;  3SR1 A;  3GLK A;  1QZH A;  5C4J B;  1HNX L;  3Q0A A;  3VR5 A;  1VQ9 A;  3DEO A;  2VUM H;  3KLS X;  3UE0 A;  2I5L X;  3A0J A;  3HOU B;  3RNU A;  1AP0 A;  2EPB A;  1BBU A;  4CGY B;  1MSH A;  5ISR A;  4A93 G;  1BXR A;  1PV4 A;  3ERO A;  5CR3 A;  4U68 A;  3KDF A;  2J6S A;  1RJR A;  1GGO A;  4Y52 H;  4H7B A;  3PMF A;  1TS3 A;  5C4H A;  1M0W A;  2RDI A;  1H9R A;  3KYH C;  1AUV A;  5FLX W;  1I94 Q;  3GID A;  2KCT A;  3A55 A;  3JAM i;  1EUD B;  4Q0Y A;  4LF8 L;  3GP7 A;  4TVA B;  2OCE A;  2MNA A;  1A15 A;  1I6H H;  1Z2O X;  4CC6 A;  5D1O B;  1I4Q A;  1Y14 B;  1DCZ A;  2P5Z X;  1FJG Q;  3HOV G;  1UEB A;  5LA6 F;  2FB9 A;  3LP8 A;  1B33 N;  1TY2 A;  5IWA Q;  1N34 L;  1VQ5 A;  2R92 H;  2V4Q A;  3HOY G;  3TZD A;  2DY8 A;  1X6O A;  3KF8 A;  2WB1 B;  1H95 A;  1R9T H;  3ULP A;  1EIG A;  3GTK H;  4TQU S;  1XNQ L;  3D6W A;  1STB A;  5IGG A;  4UCT A;  4N8F A;  3BZK A;  3MZ5 A;  3H3V H;  1STY A;  4RB2 C;  2QF7 A;  4EBC A;  4DUY H;  2VW9 A;  4IUU A;  2CQA A;  1EUJ A;  4Q5V A;  2FK1 A;  2IHE A;  2ZJQ A;  4ED1 A;  2F0I A;  5ELF A;  3KJO A;  4M8A A;  3P7J A;  4RH6 A;  4ED3 A;  2YTY A;  4ED2 A;  1EQT A;  4ED7 A;  4KHP H;  3QJY A;  4LUZ A;  1O78 A;  4OIK A;  4JI1 L;  2PNH A;  4RCN A;  4ZQI A;  1WTH A;  4V0B A;  4NW2 A;  5C0X G;  2NVQ B;  5DG8 A;  4RKL A;  1PH6 A;  2JA7 G;  3CKI B;  5LYJ F;  5DQH A;  3PCO B;  3V4S A;  4MV3 A;  5HGT A;  3I55 A;  4BXX G;  2GA4 B;  1HZB A;  3DUZ A;  1W93 A;  1AFP A;  1SR3 A;  1XYI A;  3OWF A;  4NXN Q;  2K5W A;  2KJX A;  3RB6 A;  4WFN 3;  1JOO A;  3NTK A;  2HQL A;  4LF9 Q;  3OUU A;  5M3F B;  4K5X A;  5CC4 A;  3T5L A;  4JV5 H;  1ENA A;  4IFD H;  1JX4 A;  3Q2O A;  3BU2 A;  1STA A;  1GOZ A;  5JOB A;  4X65 L;  4MV1 A;  3CCS A;  1XNR L;  2VXW A;  2Q2T A;  4V19 0;  3TP8 A;  1EWH A;  1PRT C;  2JP1 A;  3FRP B;  5KT7 A;  3MEH A;  2CQY A;  2IBK A;  1QCB D;  1TWC A;  3CRK C;  3RV4 A;  1N32 Q;  5KKN B;  4N9T A;  3GQC A;  4FF4 A;  1IW7 C;  4XQN A;  3J81 i;  4YY3 H;  4NPS A;  1VQD A;  3TQ1 A;  2CZG A;  3C1F A;  3C1E A;  2PBZ A;  1N34 H;  4UDU C;  2FPG B;  4U7C A;  4ODG A;  2OLS A;  4KTA A;  1JDE A;  1DXM A;  4XYQ A;  4EQP A;  1GUW A;  5KGU A;  1EQR A;  2B63 H;  1XWE A;  3M3Y B;  2E2I H;  1CQJ B;  2ZM6 Q;  2M05 A;  4C2M H;  4O2D A;  4OWT B;  4JI3 Q;  1YJN A;  1N8R C;  2BH8 A;  5GAG C;  5H1S E;  4MTD A;  2F0E A;  2DPJ A;  5IYD H;  1YJW A;  1BCP C;  1VQ8 A;  1C0A A;  5J22 A;  4DR4 H;  3GTP H;  1SYF A;  2DNE A;  4YCV A;  5T1I A;  2C22 A;  3TQT A;  1ET6 A;  3V6K A;  3F8N A;  4JI1 H;  1VQM A;  4PV1 C;  5IGF A;  2R93 H;  1A8V A;  2ASL A;  2UUB L;  1RHP A;  3B6Y A;  4RB3 C;  1M0T A;  4BS9 A;  3W2D A;  4CDF C;  2EYH A;  3M4O B;  1MD2 D;  4BBS H;  2W9B B;  4KKT A;  4RGO S;  2B2T A;  5KFY A;  3J80 i;  2VQD A;  1U4P A;  2UUC Q;  1KAB A;  3OTO H;  1RYS A;  2HHH Q;  3NUC A;  1Y1V A;  3MXU A;  1VQH A;  2SCU B;  2ID0 A;  4QW9 A;  4YQW A;  2O4X A;  4DFA A;  4JUZ A;  1HNW H;  3HOX H;  4GN3 B;  4CBV A;  2NBF A;  5EBC A;  3K80 C;  3S1M H;  1KC7 A;  4FM9 A;  4IUQ A;  1QB5 D;  1UWV A;  1CA6 A;  4TSS A;  2R6G A;  5DGA A;  5KFO A;  3QOL A;  2NN6 G;  1WVL A;  3AU7 A;  4A3F H;  3RR5 A;  2YU9 H;  3IKJ A;  3ICE A;  2F0H A;  2F4I A;  2MPM A;  4NXM Q;  4Y8V B;  4HNT A;  5KG5 A;  1VQK A;  1I3Q H;  3RLO A;  5M3M H;  1U9R A;  4L5R C;  1RTN A;  2KEN A;  1TVX A;  4DV0 L;  1WTP A;  3TRZ A;  3CCL A;  2I80 A;  2Q2I A;  4B9W A;  2WIN B;  2Y0S A;  1X3Q A;  3HOZ H;  1V9P A;  3PUV A;  4O42 A;  1BCP F;  1E1T A;  1STN A;  2XTI A;  3MFG A;  1PTO D;  2QDL A;  3I7F A;  4A3D H;  5L1J A;  3EBE A;  4LF6 Q;  5BR8 H;  3E0J A;  2QEX A;  1EOT A;  3K5O A;  5DEH A;  3L9A X;  1LLR D;  1U4L A;  2K4K A;  4Z9C B;  1JQY D;  3TME A;  4DV3 H;  3T1Y H;  4JCV E;  3EPI A;  3BVZ A;  1B7Y B;  5FKA C;  4U6P A;  3QG1 A;  5FLX c;  1G2T A;  4IZO A;  4U67 3;  5ELE A;  4DNR B;  4K2L A;  2WKC A;  2VB2 X;  3CQZ A;  1BCP B;  4N9P A;  3H20 A;  1LAB A;  1STE A;  3PW2 A;  3HKZ E;  2SOB A;  1IBK L;  1J5E H;  3H0G B;  4C5C A;  3J80 E;  4AYB A;  5A35 A;  4QF4 A;  4C3H H;  3FDS A;  4BBR B;  1X3E A;  1ENF A;  3C0F B;  4P2C B;  4J0M A;  1BBW A;  5KFD A;  3HOU G;  1CUK A;  2F0N A;  2D0O A;  1HQM C;  5I2Y A;  2XGP A;  1NAP A;  4IQZ A;  3GV3 A;  1U5K A;  3K0X A;  1YIT A;  2RSO A;  3FKI G;  5FO9 B;  3UDG A;  1K0R A;  4DPG A;  1PFS A;  1HUN A;  2PW5 A;  4DLK A;  1A3T A;  1XMQ L;  4B3T L;  3V6H A;  4PDB A;  1PVO A;  4YHH L;  3BAB A;  3GV5 B;  2EJF C;  1KTK A;  2D62 A;  4J9O A;  3S1N B;  4LW1 A;  3FEW X;  3NTI A;  2CVR A;  4ZOL F;  2XRQ D;  1HNX H;  4GC7 A;  4JG2 A;  4QUC A;  5IOC A;  2AGP A;  4RKB A;  3CHB D;  1N9W A;  3RIZ A;  2VZA A;  1F2L A;  1LTL A;  2JQO A;  5CA1 F;  4FO2 A;  4WJ3 M;  1KAA A;  3W5O A;  5KG7 A;  1HTP A;  4LUO A;  5M5W B;  3GTM H;  2PZW A;  5CMD A;  1PFB A;  4JW0 A;  4IRC A;  4ILW A;  4GS3 A;  4A75 A;  2LFN A;  3MR6 A;  2A5H A;  1GUG A;  3CAM A;  1X54 A;  2UXC H;  2KBN A;  2HVQ A;  2JEJ A;  2IX3 A;  4DR7 H;  3N44 B;  1CQF A;  5JJI A;  2WAC A;  3D4D A;  2OEO A;  5KFW A;  2K33 A;  5BR8 L;  3KF8 B;  3S1Q B;  2WII B;  3U4V A;  2Z1C A;  1XTC D;  2B63 G;  3ORQ A;  2CH4 W;  3CME A;  4X65 H;  2RGR A;  1B9N A;  2PQE A;  4X64 H;  2A6H C;  4ZKC B;  3HOZ G;  4RWS C;  3IAY A;  4HTH A;  2F4V H;  3J80 c;  2B2V A;  3VYU A;  4C1N I;  4OWW B;  3BYY B;  3G71 A;  4ZYS A;  4GKK L;  5M5X B;  3E9I A;  3T5H A;  4L5S A;  3KF6 B;  4O0A A;  1QWY A;  1S68 A;  3JSL A;  1SBB B;  4DUY L;  5M3F G;  1IYV A;  1PZK D;  3KDF B;  1N33 L;  4XXE A;  4LFC Q;  5FK9 C;  5K2M A;  5LL6 S;  1SEB D;  3OMG A;  3GII A;  1SYC A;  1E24 A;  1BNZ A;  4KHP L;  5DQG A;  1B6R A;  1PRT D;  4XDX A;  5JVD F;  1CS0 A;  2GVB A;  1JWM D;  4BBR H;  5H80 A;  4GNX B;  4O3P A;  4C3H B;  5K36 H;  4XQJ A;  3F1Z A;  4XT3 B;  5C44 G;  3BG5 A;  2B2T C;  4MV9 A;  4IUT A;  1SJH D;  4A3G B;  4YWK A;  5KG6 A;  2MJ8 A;  4QMG A;  2MUY A;  5I9O A;  3E9H A;  4DR4 L;  5E7N A;  4OO1 G;  3MVV A;  4DXG A;  4CJ0 B;  4BBS G;  2HVS A;  2RDH A;  5KFK A;  2Z6K C;  3PVX A;  4ECY A;  5JJZ A;  3GO5 A;  1KHI A;  5M5X H;  1SRU A;  1EQQ A;  4MA5 A;  2CWP A;  5C3E G;  3M9O B;  4JBK A;  2J0T D;  2FLP A;  3PSI A;  1JJ2 A;  3R2T A;  1ICF B;  5ELB A;  1PYS B;  4Q8F A;  5L37 A;  2WP8 J;  1B2T A;  4L1K A;  4MN3 A;  1F77 A;  4O3Q A;  3FMA A;  3PW0 A;  2YTX A;  4BA2 I;  4ZLT F;  3S16 H;  4DGZ A;  3S1Q H;  5HGQ A;  1WTW A;  1EIY B;  4KY5 A;  4B3S Q;  3OTO L;  1L0W A;  4G7O C;  4A3D G;  3PW4 A;  3GTM A;  2QIL A;  4DV7 Q;  3A54 A;  1D7Q A;  3JAM W;  1UAP A;  1GLV A;  1PLF A;  4YP3 A;  4F4Z A;  3BJU A;  2E2D C;  1TWH A;  2K04 A;  1JWU D;  4A3M H;  3GTO B;  4GLV B;  4JBM A;  3CC2 A;  4UP7 A;  2F4V L;  2CQO A;  1JB7 A;  3DMU A;  2TMP A;  3L0O A;  4JI8 L;  3BVG A;  1TWG A;  2KVM A;  3URY A;  2E2H H;  1S5F D;  3STB D;  3E5S A;  1OXV A;  4DV0 H;  2RDG A;  3I90 A;  1M7J A;  1K83 A;  2C2D A;  3CCV A;  2QK4 A;  2EZV A;  1GJX A;  3AB9 A;  2KCN A;  3BQ0 A;  2UXD L;  4X6A H;  2K6A A;  5JVG 3;  4LFB H;  1VQ7 A;  3GIK A;  4BY1 B;  2V4R A;  2K75 A;  3J7A F;  1U0L A;  4AYB E;  2A73 B;  2KCC A;  1YEZ A;  5CV5 A;  2ZXR A;  3WDN A;  3A5U A;  1NSN S;  3K5H A;  2IX0 A;  2UUB H;  2EJM A;  1HZ9 A;  4A3I H;  2Z9H A;  1G6Z A;  4YIJ A;  2AKW B;  1HA6 A;  3KFU A;  1H9K A;  4YAJ B;  2UVW A;  1XPR A;  4XTC S;  1E4G T;  1AZP A;  4YAK B;  4UP9 A;  1YBY A;  3GTQ A;  1Z9F A;  3DWP A;  4J6H A;  5JJK A;  4A3D B;  3BQ2 A;  4F8M A;  4KD3 A;  4J9P A;  1MSG A;  4J9S A;  3HS0 C;  1AN7 A;  1Z2N X;  4R7R A;  3GTG B;  4G57 A;  5KT2 A;  2E75 C;  1WTV A;  2PNR C;  2Q8T A;  4K0K L;  2IP4 A;  4GKJ Q;  4HSV A;  2Q8R E;  3KLR A;  1DIK A;  3J7Y W;  5IGC A;  1EYD A;  3I4N G;  3PIP A;  1BJT A;  4F88 A;  4ECX A;  1GUT A;  5BN5 A;  1I4R A;  4JI7 L;  1ML0 D;  4DV1 L;  2FKL A;  4ECU A;  4B3T H;  1TWA H;  2YYA A;  3J81 W;  4K2K A;  1VS0 A;  5KFI A;  3TII A;  1L2Z A;  3L4K A;  4BWS C;  3GIL A;  4UCO A;  3DM3 A;  3MC0 B;  4NDX A;  3NSW A;  2XVS A;  3K7A B;  3T56 B;  5IOD A;  1VMC A;  2MO1 A;  3VYT A;  1Y1W H;  2V59 A;  1XMO Q;  4DV3 L;  2K5V A;  2DJF C;  1EHI A;  4OEL B;  2JA8 B;  4KKS A;  5ELN A;  4A3M G;  4J9N A;  2PI2 E;  4WD3 A;  2J7Z A;  4IWX A;  5J1Z A;  5LP6 F;  4IN3 A;  2LXJ A;  5HV6 A;  2YS6 A;  2R93 B;  5LXT F;  4JI0 H;  2BE5 C;  4LJZ C;  4XYM B;  1HNZ Q;  4GLX A;  4DR7 L;  2E2H A;  3GDE A;  4CKE A;  4O3O A;  1IKM A;  4F4X A;  1EYC A;  1EL0 A;  1UC9 A;  4ZUJ A;  3OIQ A;  3L7Z C;  4X66 L;  3G6E A;  1GSH A;  1TT2 A;  4GLA C;  5JUM A;  1FYC A;  2F0F A;  1KJJ A;  4EEQ A;  3J81 L;  5AFW A;  2JA9 A;  3DLL A;  1JWS D;  2UUA Q;  4DV5 Q;  5L1L A;  2UXB L;  2X6L A;  2XWB B;  2D0P A;  4GKK H;  2K5N A;  4TV8 F;  2DPI A;  2N8N A;  3PW5 A;  5ELO A;  2A6E C;  1PMR A;  4A3K H;  1O7L A;  4YY3 Q;  3TBI B;  4DR5 L;  3G6X A;  3UI2 A;  1N33 H;  2LKV A;  1XPU A;  5BPF A;  5KFT A;  1ESR A;  5JEA G;  5KT4 A;  1KAW A;  4DV4 Q;  1XMQ H;  4RFB A;  1Q7Y C;  5IT9 W;  5G3L D;  1ZYR D;  5L1K A;  2ICE C;  5LMN L;  3TS2 A;  5C6A A;  1RDP D;  2QW7 A;  1FVI A;  1JR0 D;  2K03 A;  2ZDG A;  1B8A A;  4HCS A;  2XCA A;  2BQ3 A;  2B63 B;  4LNQ A;  1EU3 A;  1GUO A;  4IWY A;  1I4H A;  3TEH B;  3SVM A;  4RGN A;  3JAM c;  4POF A;  5LMU Q;  2CFM A;  1IBL Q;  1ASZ A;  1RKN A;  2JA7 H;  3KHL A;  3ERS X;  4JI5 L;  1C9O A;  4LMQ D;  4DL5 A;  4J9K A;  3AYH B;  3NBH B;  5GON F;  5DLG A;  3Q8S B;  1SNP A;  1VQJ A;  3I4O A;  3PW7 A;  4GZY C;  2EIF A;  2UXC L;  1RK6 A;  1ZQ7 A;  5L1I A;  1J9O A;  2EVB A;  4JV1 A;  2PMZ B;  1Q86 C;  1JJG A;  4UCU A;  4F4Y A;  2NTS A;  3CQZ H;  4XYL B;  4L5T A;  1K1Q A;  4DNI A;  2IW3 A;  1KJ8 A;  1F9R A;  1X56 A;  4FS1 A;  3I12 A;  4RAU C;  2CW0 D;  3LX0 A;  3J7A 5;  4X64 L;  3EJI A;  2M00 A;  3H15 A;  5C44 B;  4G4K A;  3RAX A;  3EQL C;  2VUM B;  1DOM A;  1I4X A;  2V1C C;  4LF5 Q;  3E6Z X;  2R7M A;  2FK2 A;  2Y0S G;  1KRT A;  3AFQ A;  4I7A A;  3TN2 A;  3RGX A;  4QWA A;  4YCW A;  4JI6 Q;  3RZO B;  5HY6 A;  1WTQ A;  2F03 A;  2R7N A;  1S97 A;  4LF8 H;  1PH3 A;  4EFB A;  1GSA A;  1IYU A;  3UFX B;  2I46 A;  2F3I A;  2EYO A;  3DEP A;  2JEB I;  2OQK A;  5BN3 A;  5EWE A;  2B8F A;  4OL7 A;  5KT5 A;  3VA7 A;  3HOY H;  1WCM G;  2F0U A;  4LF7 H;  4UHV A;  3KBG A;  1SE3 A;  2JXM B;  3AFP A;  3VPD A;  1IBM H;  4OGQ C;  1BKB A;  1ASY A;  3P75 A;  1EY5 A;  4JV0 A;  1KNE A;  1H9M A;  4K6D A;  3LWU A;  2J9G A;  3HBL A;  1QG7 A;  3Q8P B;  1I94 H;  3ONA B;  2Q2H A;  1N36 L;  2R8K A;  2K50 A;  2A1A A;  4K6L A;  2E5L H;  3GV6 A;  5I4D A;  3MEF A;  4B3M H;  4O3R A;  1P16 A;  1OXS C;  4LFB L;  5KFH A;  4ECZ A;  5F9L A;  1S5E D;  4JK1 C;  4HJ7 A;  4R8N A;  2A68 D;  5BR8 Q;  1CQV A;  1BF4 A;  4MV8 A;  4QWC A;  1M6V A;  1CTM A;  2W70 A;  2XWJ B;  3U4Z A;  2F0M A;  3I8Z A;  1EEF D;  5T14 A;  1TQO A;  2A69 D;  3S1R B;  3IG0 A;  2K1B A;  2BDN A;  1R9T B;  1Q8I A;  4ZCK A;  4Y7N B;  2RHQ B;  5EZY F;  2AU0 A;  1WYD A;  1OTC A;  2AQ1 B;  3Q23 A;  2VQE L;  5KFF A;  3CCM A;  5D3I B;  4DV2 Q;  4GNX A;  1G6P A;  3EPG A;  1I6H B;  3D6C A;  2MQH A;  4DAP A;  5IY0 A;  2UU9 L;  3WO0 A;  4ZAI A;  3HOW G;  1TY0 A;  4R4O A;  3S2D B;  1K9M C;  2EXZ A;  1U4R A;  5EKL A;  3OIP A;  3S24 A;  2L12 A;  2CWA A;  3ZYY X;  1XTD A;  3OSN A;  4A76 A;  2SNS A;  1KQS A;  4DR2 H;  1IL8 A;  1ZET A;  2VQF Q;  1I7N A;  3HKZ A;  4F50 A;  4KN7 C;  4IUN A;  4B3R L;  4A3I G;  2NUC A;  2TSS A;  4IPD A;  5IT9 E;  2BA0 A;  4JI8 H;  2RQX A;  4JV5 Q;  4A2B A;  5CV4 A;  5C8Y F;  5DG9 A;  3ND9 A;  2C2R A;  5F2D A;  4MA0 A;  3LNN A;  1HNX Q;  5D8D A;  3G6Y A;  2C35 B;  1ZKO A;  4RNM A;  4ECR A;  2DGY A;  5CV6 A;  4A93 B;  3CMA A;  4QIW E;  1OXT A;  2LXK A;  3N43 B;  1V4Y A;  4LF7 L;  1YVC A;  2AQ3 B;  2IPK D;  3TIG A;  3NTH A;  4ZKB B;  2NU8 B;  3MAQ A;  1XJV A;  5DNF A;  1FGB D;  4IUV A;  1AH9 A;  1AW7 A;  1TR5 A;  1H9S A;  2B29 A;  3VYR A;  2VNU D;  1X3P A;  3I4N B;  4TQS A;  1ZHQ A;  2NVY B;  1Y8N B;  4KV6 A;  2E5L L;  3VMM A;  3OHB A;  1WJJ A;  3RN2 A;  4B3M L;  4A93 H;  3R5H A;  2QA4 A;  2A68 C;  1A63 A;  4DR6 Q;  1YNJ D;  4HAE A;  1L0Y B;  3CVZ A;  5DLF A;  5KG3 A;  2FPI B;  3TS0 A;  1GXD C;  4IZ8 A;  2JA6 H;  1A2U A;  5ELC A;  2G5D A;  1CA5 A;  5JEA H;  1SFO A;  1KXL A;  4JI2 Q;  3S15 H;  2YV5 A;  3M9B A;  3OHX C;  2CW7 A;  2OTL A;  3GIP A;  3F2C A;  5KFG A;  5HUR A;  4XIG S;  1SLJ A;  1GUN A;  2R7D A;  2LSS A;  1XX8 A;  2UU9 H;  3RJ0 A;  4C56 C;  3FP9 A;  1Y1V B;  2V9W A;  5LMN H;  4DL4 A;  1K83 H;  3E3X A;  1HFN A;  2EQS A;  1Y8O B;  3N52 A;  3H40 A;  2B2V C;  3C3L A;  4AYB B;  3I4M B;  2PZT A;  3GTL B;  4HN7 A;  1V1P B;  5IP9 H;  3PF4 A;  2UVU A;  1IBK H;  4Y7N H;  2B63 A;  3JRX A;  1VQ4 A;  5IGD A;  1C48 A;  3GTM B;  4DR2 L;  2E2I A;  1UUP A;  1STH A;  4WJW A;  2UVR A;  2QCP X;  1KRS A;  1LTR D;  5LOV F;  3GTL A;  3KOJ A;  2OTJ A;  3AQQ A;  1DOL A;  3N8D A;  2OH2 A;  1LTB D;  2HT1 A;  2AQ2 B;  2IA6 A;  2VPQ A;  1PH1 A;  3QZ7 A;  1PYW D;  2NB0 A;  1WOC A;  2XC9 A;  1MHW C;  1BDO A;  2EY1 A;  3RUZ A;  1HNW Q;  4IR1 A;  4KHV A;  1GSO A;  4AIM A;  2A19 A;  1B50 A;  2PVP A;  1YNX A;  2BA1 A;  1VQN A;  2K28 A;  3CF5 A;  2VUM G;  4JI4 H;  1B1Z A;  4J9M A;  3A5Z B;  2VY3 A;  4LUV A;  3N40 P;  2Y0S B;  4YR3 A;  5CGK A;  4HIM A;  4A3E B;  3G7L A;  3T1Y L;  1XNR Q;  4X66 H;  1I4P A;  4IAL A;  4YJ3 F;  4IRK A;  2UUC L;  4LF4 Q;  1LTI D;  1SFO B;  3I2Z A;  2CH4 A;  4BY7 H;  3MJF A;  1HA5 A;  2WAQ E;  2IWH A;  1XPO A;  4EGQ A;  1EY8 A;  2VA3 A;  3ORR A;  4ME5 A;  4QY7 A;  4ECW A;  4ECS A;  3PR4 A;  2LS0 1;  5E4W C;  4DR5 H;  4OXP A;  5FLM H;  1I50 B;  1SMY D;  1XNQ Q;  2XIW A;  2D9U A;  2W7P A;  2F0T A;  1P8L A;  2L9H A;  4QB4 A;  3GIM A;  1YHQ A;  1T3N A;  4DUZ H;  2A6E D;  1KLG D;  3J7A V;  5KNB A;  2ICI A;  4GN5 A;  1IBM L;  4FF1 A;  3JZI A;  4HJ9 A;  3BDC A;  1KIX A;  1VQF A;  1QZG A;  5BMV F;  1X32 A;  1F9S A;  4X62 Q;  1S0N A;  2R85 A;  3BA9 A;  3GV7 B;  1WI5 A;  2FIN B;  5JJL A;  1N36 H;  5C4Z A;  4QW8 A;  3M9M B;  1PTO B;  4OO1 H;  1F9P A;  1T5E A;  1ILP A;  1EFW A;  4I65 A;  5D1P A;  4JI5 H;  2Z6K A;  1J5E Q;  4LK1 C;  1FKA H;  2SNM A;  4QGU A;  2RBM A;  2K32 A;  3VR3 A;  1IOV A;  2NU7 B;  3H3V I;  1ENC A;  4ZK9 B;  2RA4 A;  3D4R A;  3JAM E;  3I70 A;  3T1H L;  3PUX A;  4PMW A;  3PIO A;  4KKU A;  2UUB Q;  1KJQ A;  2R6F A;  1IHZ A;  3MR3 A;  1WCM B;  1CM9 A;  1WTX A;  5KFV A;  4JYA Q;  2N88 A;  4DV5 L;  1A6X A;  4I4T F;  2DIK A;  1V51 A;  2R7Z H;  2ZXP A;  1ONL A;  1TWF B;  1SEI A;  2AWO A;  3VPB A;  5COY A;  1DJR D;  3IFT A;  3C46 A;  3WNZ A;  4YCU A;  4RB0 A;  2VQE H;  1S0O A;  2RKS A;  3TP7 A;  3K5N A;  4J9L A;  2HHH L;  3HRZ C;  4C3I B;  2EE1 A;  4PZ8 A;  5I6W A;  2ZJT A;  3PIO 3;  5KFR A;  1TS4 A;  4IOA A;  2AGQ A;  1I6U A;  2L0C A;  2VUM A;  1HTL D;  3ZJY C;  1JKJ B;  4DL2 A;  1DON A;  1EYZ A;  4I55 F;  4JI4 L;  4ECT A;  5KFM A;  4GN4 B;  1JT8 A;  3J81 j;  4NP5 A;  3PZP A;  1A3U A;  4C3I G;  2OF1 A;  2EJG C;  3NQI A;  4ED8 A;  1LYL A;  1CHQ D;  2I5M X;  1Q1B A;  5J39 A;  1RD9 D;  3S9W A;  2FXQ A;  3FMC A;  4LFA Q;  3QOJ A;  1NY4 A;  3CCQ A;  4DKA C;  3BDL A;  4EEY A;  3WWV A;  1UNN C;  4DUZ L;  1CZG A;  3BA8 A;  3BZD B;  3RMH A;  2ZM6 L;  1Y69 U;  4HMI A;  4E6I A;  4X65 Q;  5FJ8 H;  2ASB A;  1BOS A;  4RU9 A;  4ZRZ A;  3OUZ A;  4E4T A;  3RGZ A;  1YNN C;  3DF7 A;  2DN8 A;  4M9U A;  2PYK A;  2WKD A;  2QGQ A;  2XN9 C;  4A3F G;  4G3I A;  1L1O B;  4PQX A;  2Q2U A;  3T51 B;  3RAQ A;  2E2I B;  1Y1W B;  1EY9 A;  3RLF A;  1LAC A;  3S14 H;  4IFD I;  1JXL A;  5GAE C;  2GPW A;  1EWC A;  5KFL A;  2MCT A;  4DR1 Q;  1SSO A;  4APV A;  1DOK A;  5KT6 A;  1JCK B;  3SK5 A;  4GC6 A;  1D8L A;  5IYB H;  3U9O A;  4EBE A;  5KFN A;  5KX5 F;  1W6J A;  2PMZ E;  1U4M A;  2CCZ A;  4N8X 1;  4R4T A;  1LTA D;  4I7Z C;  4KK7 A;  1S5C D;  2XD4 A;  2W6Q A;  3GQB A;  4FVM A;  1VQG A;  2R8H A;  1E2Z A;  1JOK A;  3H0G G;  2F0W A;  1B6S A;  3SEB A;  4AQY H;  5J2U F;  5IYD G;  4DR3 L;  4MHE A;  2QYZ A;  3J81 E;  2UUA H;  4O2B F;  1GHJ A;  5CYU A;  1TWF H;  2NZH A;  3CP0 A;  4FDB A;  3G48 A;  1EEI D;  3FKI B;  4YR2 A;  2B2Y A;  3ETH A;  1FD7 D;  2O2L D;  1M8A A;  2HDM A;  1LT5 D;  3A74 A;  5LL6 X;  1CKO A;  2JJQ A;  3ERQ A;  1N33 Q;  1B9M A;  3S14 B;  3MWY W;  4M1U B;  1EZ1 A;  4NXN L;  2RF4 A;  4RHR A;  5EWG A;  1RJQ A;  4HYK A;  2ZDH A;  1ILQ A;  2IT1 A;  4DNT B;  2OT2 A;  3GIQ A;  3OMC A;  1N32 H;  2B2W C;  4MTN A;  3NPP A;  3R93 A;  4C3J H;  4GKJ L;  5IT9 c;  1QVC A;  4Q8E A;  3QB3 A;  4TQR A;  3M9N B;  3KLW A;  1MGS A;  4QIW A;  1SMY C;  3NWT A;  3MXG A;  1D1I A;  1D1K A;  2Z6B A;  4MV6 A;  2FLL A;  1FJG L;  4B3S H;  1DGS A;  4EX5 A;  5LMN W;  4JI7 Q;  2N49 A;  4DV1 Q;  5C3W A;  4IPG A;  1E22 A;  4H44 C;  4A3B G;  4G7H C;  5CB4 F;  3KF6 A;  4S3S A;  3GIJ A;  4DV7 H;  4IRD A;  2W57 A;  1PH4 A;  1V1P A;  1V1O A;  2UXD H;  4JI3 H;  5E1F A;  4KJN A;  4DK1 A;  1Y1V G;  1PH7 A;  3Q22 A;  2FMA A;  2FPP B;  1V8Q A;  1Q1E A;  5AJ3 Q;  5COR A;  4IAJ A;  3M7N A;  4MAM A;  3M4Q A;  1WFQ A;  1ICW A;  3M7G A;  1WSC A;  4RA8 A;  5FPR A;  4K5V A;  2ZJP A;  3K7U C;  1KJI A;  3GTO H;  1QNK A;  2C9O A;  4WOR A;  3MXN A;  2F0L A;  1K8G A;  3BZC A;  1L0X B;  3MTS A;  2E74 C;  2MP1 A;  1S0M A;  1VAJ A;  1M4V A;  3IFD A;  3J81 c;  3OW2 A;  3T13 A;  2R92 B;  3GTP A;  4LWC A;  2NVT B;  4BWG B;  1O80 A;  3MXP A;  5C1O A;  2R7K A;  5GAH C;  2OWO A;  3BS1 A;  3FKI A;  1JLL B;  4TUY F;  1JIC A;  2J6U A;  3HOX G;  4DR3 H;  3ETJ A;  3M4I A;  2F3W A;  2I5H A;  4MNO A;  5FJ8 G;  4K0K H;  3A7A B;  2NTT A;  1LT6 D;  1CZW A;  1SRO A;  2WAQ B;  4LF9 L;  1S03 G;  1YNN D;  2ATW A;  4HSP A;  3NXW A;  4YHH Q;  3RUP A;  2KEE A;  3L4J A;  4DK6 C;  2E5L Q;  1H9S B;  5C5L A;  3J80 L;  1EYA A;  3K5M A;  3S15 B;  4PMB A;  1SNO A;  1K83 B;  1YJ9 A;  4HR7 B;  2IJ0 A;  2X69 A;  2G9D A;  3W1G A;  5D65 A;  3QWN A;  4BBR G;  1PH8 A;  2NN6 I;  2PPB C;  4NLG A;  4C5A A;  3T53 B;  1KLU D;  2W9C B;  2NYZ D;  3T1H H;  1O75 A;  4O3N A;  1JE4 A;  3EIV A;  2H5X A;  4JOI C;  1OWT A;  1W96 A;  2A8V A;  5IE8 A;  1FNU A;  3AMU A;  3J7Z C;  2JA5 G;  1TA8 A;  1VKZ A;  4HQ6 A;  5CBA E;  4BY7 G;  2P0A A;  5FD6 A;  3A8K E;  1IZ6 A;  5LMU L;  3IL8 A;  5JEA J;  1IBL L;  2W8L A;  1FJG H;  4FXG C;  4UCS A;  4K14 A;  3J7A K;  2JA6 A;  1PK8 A;  1I3Q A;  2W8K A;  3S17 H;  2H4O A;  2UUC H;  1SFO H;  4OIJ A;  1IYJ B;  3OTO Q;  4B3T Q;  3K3V A;  4IJL A;  4GOP A;  1VQE A;  2HHH H;  4J9R A;  2MFI A;  3TZU A;  1E3P A;  4OX9 Q;  1SYG A;  1SYX B;  1PDQ A;  2K7V A;  5KFZ A;  4JI0 L;  3DWA A;  3SE0 A;  3Q8R B;  1F2Y A;  1F2M A;  3HOW B;  4F4W A;  2IL8 A;  1ESF A;  3X3M A;  4QWE A;  1SYB A;  4O4I F;  5I9P A;  1EIF A;  5L9X A;  1XDN A;  2B39 A;  4FF3 A;  5KYI A;  4CDE C;  2VQF H;  4DV6 H;  2K5Q A;  2F0S A;  2RGV A;  1EZ6 A;  2WAQ G;  1EY0 A;  4NMZ A;  1DM0 B;  1HXY D;  1SNM A;  4JI8 Q;  5KFC A;  5EDW A;  2HUG A;  4LMY A;  2B8G A;  3T4A C;  3CD6 A;  5D14 A;  4YBZ B;  3DXJ C;  4HMJ A;  4JI6 L;  1TWA A;  2R86 A;  4R1J A;  3SK8 A;  1AN8 A;  4DA2 A;  5M9O A;  2UVV A;  5IP7 G;  4A3G G;  3R23 A;  3HOW H;  1JC7 A;  1PH9 A;  2YZG A;  2ATL A;  5KYL A;  3OW7 A;  3GTL H;  3I4M H;  3HZX A;  1SE2 A;  2FHT A;  5C4X G;  3F2U A;  3RTX A;  1GVP A;  4BY1 G;  1HFG A;  2R7Z G;  5HBR B;  4RHS A;  3T1Y Q;  1TWG B;  2L1B A;  3OSO A;  5D1O A;  5M5W H;  1CSP A;  2W71 A;  1Z7T A;  1VF5 C;  1VQB A;  4CJ1 B;  3R5X A;  4GKK Q;  1HCZ A;  3G6V A;  3OPO A;  3V6J A;  2YYZ A;  2DWC A;  1JIH A;  1VBG A;  4EQO A;  4PZ7 A;  5EWF A;  3S1R H;  3L3O C;  4CJ2 C;  4FP5 D;  4ECQ A;  4QIW B;  1AE3 A;  2K14 A;  2R3Z A;  3NP8 A;  5EPL A;  2R61 A;  1JOR A;  5M3M G;  2RVL A;  3FPU B;  4HIO A;  1RK5 A;  3KBX A;  3R5F A;  3KTM A;  2UUA L;  5C1P A;  2VA2 A;  3FHW A;  2V5A A;  1IBL H;  2WTF A;  4MTE A;  1I50 A;  4I50 F;  1AE2 A;  2NVY H;  3R2I A;  4QCL A;  3I4N H;  1I5F A;  4EVO A;  1VQO A;  2ZTC A;  2F1M A;  5C3E B;  4XYO A;  4NXN H;  1CI3 M;  4DV2 L;  4H13 C;  1UE1 A;  4EGV A;  3MHB A;  3GTJ H;  3P1H A;  2ZTD A;  5LMN Q;  3HOY B;  1EY4 A;  2J6T A;  1PFM A;  3RZD H;  4RAZ A;  5CA0 F;  1KDA A;  1HZC A;  3AEV A;  2VS1 A;  5KG0 A;  2W6N A;  2AUK A;  1VQP A;  3N42 B;  5ELD A;  2ZDQ A;  2Z0S A;  4DV6 L;  2W7O A;  1JJC B;  2M9V A;  2HJW A;  3PN1 A;  1VQ6 A;  4EBD A;  4ME6 A;  1NJI C;  5C44 H;  2CHB D;  3K5L A;  4J9Q A;  1I94 L;  4CKC A;  4DU9 A;  4UCR A;  2UXC Q;  1DD2 A;  2PO4 A;  4DV7 L;  1K28 A;  4FS2 A;  1JE5 A;  5FO8 B;  1BXT A;  4EGJ A;  1UE7 A;  3HKZ G;  3BYT B;  2DLN A;  3VR6 A;  4JI3 L;  1G29 1;  2WB1 E;  5EPK A;  5KEE A;  1D5M C;  2Z4H A;  1L1O A;  2CW0 C;  3RZO H;  1ZXT A;  2F3V A;  2JE6 I;  2NZ1 D;  3S2D H;  2V58 A;  1I3Q B;  5M3M B;  2HDL A;  1BQQ T;  3TIN A;  4AQY L;  2FK3 A;  1QUQ B;  2YCH A;  1NCV A;  3ER0 A;  1LTT D;  5I47 A;  3T5K A;  1RYR A;  1OXX K;  2BH2 A;  1A0I A;  2KHI A;  4PMC A;  1MJC A;  3ITP A;  4QWB A;  3PV0 A;  4Q43 A;  1VF7 A;  1X55 A;  2ZTE A;  2R8G A;  4HJ8 A;  3TSS A;  3MWE A;  4A3J B;  1S9F A;  4B3M Q;  2O5I C;  1G51 A;  5BN4 A;  3HOX B;  4CDD C;  3KK7 A;  1H9J A;  3T5J A;  4DR4 Q;  2VR1 A;  4IUP A;  2WV6 D;  2KA7 A;  4OWX B;  4BA1 I;  1G91 A;  2ASJ A;  4HR7 A;  5DQI A;  3CU7 A;  2RHS B;  2XGQ A;  3KXY T;  2R87 A;  5IP9 G;  3V05 A;  1DV1 A;  5CAE B;  4A3K B;  1N32 L;  4P73 A;  2WYO A;  4EQN A;  4UY8 C;  1WD1 A;  3M4O H;  1TII D;  2BDO A;  4RZQ A;  2NWG A;  5KFJ A;  4JBJ A;  5GQO A;  4CKB A;  2KQ3 A;  4DAY A;  4B3R H;  3D0F A;  2NZO A;  1G2S A;  4DV2 H;  3BAA A;  1PX2 A;  4K8J A;  2NVX H;  4A3L H;  3PUW A;  2C5C A;  3PO3 H;  3QO2 A;  4IHJ F;  4IPC A;  4LSX A;  4CDC C;  1Z6H A;  4O4L F;  3HOV H;  3W1B A;  3GTP B;  2PW7 A;  2B2W A;  1TWH H;  5KNC A;  4HIK A;  1IL2 A;  1VCI A;  4DV0 Q;  3ULL A;  1GM5 A;  2YW2 A;  3CC7 A;  2R84 A;  1VQL A;  2AUJ D;  1J6Q A;  3QR8 A;  3UDI A;  3JSN A;  1EQV A;  1F2Z A;  4XQQ A;  2KOL A;  5CBE E;  1BR9 A;  1UNS A;  1EY6 A;  5GAD C;  2JA8 H;  4A3L G;  1HR0 L;  4LF6 L;  1KJ9 A;  2XNA C;  2ALZ A;  3TDQ A;  1MJE A;  4WJ4 A;  1HJP A;  3K81 C;  1W3S A;  5C3X A;  2O5J C;  2B2Y C;  3I4L A;  3LWB A;  2RSN A;  1PHJ A;  5CV8 A;  3MR5 A;  3OSP A;  1M90 C;  2HIV A;  2QDB A;  2EYM A;  1B70 B;  3CQZ B;  2IX1 A;  2EY5 A;  2UXB Q;  4JOI A;  4G7Z C;  1C8C A;  4LSA A;  5FLM G;  4IJH A;  1PZJ D;  1ET9 A;  5K5P A;  5KFS A;  5A2Q W;  2JA8 G;  2AHO B;  2VQF L;  1SDF A;  3KAK A;  4FU0 A;  4HJ5 A;  5KFB A;  1A3V A;  4CHT B;  1DZ1 A;  1RJP A;  5EPJ A;  2Y0S E;  3CW2 C;  4DAM A;  3X3N A;  1EWI A;  2F0K A;  3K7A H;  5TSS A;  2ENB A;  5C0X H;  4LFA H;  4O2A F;  2F0D A;  2JA7 B;  1G8Z D;  1Q90 A;  2DY7 A;  1OXU A;  5E3F A;  1EZ8 A;  4ECV A;  1KBL A;  1LTG D;  1E1O A;  1PTO C;  2SEB D;  1SNC A;  3LWE A;  5FLX E;  2N78 A;  2WFW A;  1HHV A;  5JVH 3;  2C00 A;  1KC8 C;  4IOC A;  4FNF A;  3D4W A;  4FF2 A;  1B04 A;  2BOS A;  2A69 C;  2PZU A;  1QVF A;  2VPS A;  1D2B A;  4JI2 H;  1B4O A;  3SGI A;  3RBD A;  1W2B A;  3ND8 A;  1SNQ A;  3WO1 A;  1LTS D;  5G3L F;  2BQR A;  4B08 A;  4X62 L;  1Y1W G;  5F9N A;  3PUY A;  3CRL C;  1KDC A;  1R4P B;  3A8J E;  1Q81 C;  3K58 A;  4A2A A;  2FFK B;  3BG3 A;  1RCV D;  3A8I E;  3U58 A;  4DR6 L;  5IWA L;  3SI8 A;  1YHB A;  3GTO A;  4F7X A;  1S10 A;  3IRB A;  2F4V Q;  5KFQ A;  4L63 B;  3LML A;  1TWH B;  3F8T A;  3GTJ B;  4DL6 A;  4ALP A;  1QE6 A;  1Y8P B;  4APM A;  1SE4 A;  3RF2 A;  5LL6 b;  2W9B A;  1Y1W A;  5EJW A;  1O7Y A;  3K57 A;  2JA6 G;  1CHP D;  2FP4 B;  4L6T B;  2O03 A;  2DJG C;  1TXY A;  2DUD A;  3QZ8 A;  3GV8 B;  2MHV A;  3TQY A;  2WE6 A;  4A3M B;  2C28 A;  1ULZ A;  3RN5 A;  2R8J A;  1A62 A;  4C1N K;  1BNC A;  2JA5 A;  4DL7 A;  3Q1K A;  1SYE A;  4RCO A;  2XIG A;  3NK9 A;  4J8Q A;  3UQ8 A;  3OYY A;  1C7Y A;  3PR5 B;  1NTG A;  1TWA B;  3VYS A;  3F2B A;  3PUZ A;  4ED0 A;  1Q8K A;  2R7L A;  4LF4 H;  1XMQ Q;  4DV4 H;  3W3A A;  2EY6 A;  3S16 B;  3G4S A;  3BQ1 A;  4KHP Q;  2YTV A;  1TAE A;  1MZB A;  5CV7 A;  1K0S A;  4C3H G;  3NBH A;  3EN2 A;  3NEN A;  1BUV T;  1MBY A;  4QWD A;  3JAM L;  4RG1 A;  1XNQ H;  3UDF A;  4ID6 A;  1GD7 A;  4DUZ Q;  2B3G A;  2PCF B;  3F2D A;  4LH6 A;  2WDT A;  1DYQ A;  3IN5 A;  3GTG H;  2HQE A;  4YB8 B;  3RLN A;  1TWC H;  4Q45 A;  4JC0 A;  1K3R A;  3STB C;  4A3J G;  4ULL A;  4GOP B;  5BPH A;  4KY6 A;  3PGZ A;  4DV5 H;  1WCM A;  1LT3 D;  2YRW A;  3GD7 A;  5C3E H;  4OON A;  1Q3L A;  2RDF A;  2X6G A;  3KUP A;  5C4X B;  3A7L A;  2KUM A;  3G6J B;  4ZI7 F;  2ZJR A;  2XCL A;  5KG1 A;  4KY7 A;  3KHG A;  4A3I B;  2PQA A;  1NMF A;  2LY7 A;  4X3K A;  4DF7 A;  2D5D A;  1PXU A;  2W6Z A;  5IP7 H;  5KRU A;  4BY1 H;  4Q0F A;  4A3G H;  1T36 A;  3I56 A;  1VQI A;  4C3J G;  3OWE B;  2N3S A;  1RJT A;  1YZ6 A;  4AYB G;  3I4M G;  5JH7 F;  1EY7 A;  2F0O A;  2KCM A;  4FBT A;  3SK6 A;  4EYI B;  3SE7 A;  3VR4 A;  2ZXO A;  3E5N A;  2E2H B;  5JPN C;  5IT9 L;  4O3S A;  3I73 A;  4LF7 Q;  2R93 A;  1E7Z A;  5J3B A;  4DAY B;  2RCF A;  4X3T A;  1ROD A;  4O1N A;  1EUC B;  3I72 A;  4RGM A;  1TWG H;  2ZM6 H;  5EOY A;  5KFA A;  1HQR D;  2FJ2 A;  2M2L A;  2MGS A;  1EYG A;  1PRT F;  2JA5 H;  1K1S A;  4F87 A;  3Q6S A;  3V96 A;  4A3C H;  4P75 A;  3PO2 H;  5K36 G;  3PF5 A;  1SJE D;  1A9X A;  1JOQ A;  1HR0 H;  5EKI A;  1PTO F;  1T94 A;  3NWS A;  1N48 A;  1X65 A;  5IYB G;  3KHH A;  5DLQ E;  4MIU A;  4POG A;  4DN4 M;  1C30 A;  3N6R A;  1NNX A;  3PO2 B;  2F0V A;  5JVL A;  4JPB W;  1QUQ A;  4FYD A;  4LAA A;  2BE5 D;  3RB3 A;  2EYJ A;  1MIU A;  3GTJ A;  4KJO A;  4R4Q A;  2NVT H;  3GTQ H;  3H91 A;  3HFZ B;  1RTO A;  2FMM A;  1IBM Q;  1IKL A;  4RAY A;  5E4X A;  1CSQ A;  3GTG A;  1UE5 A;  2G9H D;  4RNN A;  2IMW P;  4DR1 H;  1I4G A;  3UDX A;  1X9N A;  3PO2 G;  4ABN A;  1S40 A;  2KSW A;  1QIL A;  3WOF A;  5KIX A;  3RBE A;  1CKN A;  2ASD A;  4H0L C;  1LV9 A;  1S5B D;  1E4E B;  2AWN A;  2PI2 A;  3HXL A;  1IXR A;  4RMF A;  1VQA A;  2FMC A;  3K3P A;  4MZ9 A;  4IFD G;  4HJA A;  4NXM H;  3NGD A;  2W9A A;  4JI2 L;  2JEI A;  4IFD J;  4GKJ H;  4CC5 A;  2HGS A;  3D3R A;  3UE1 A;  1S5D D;  4JYA L;  1HNZ H;  1STG A;  4WRD A;  2E2J H;  4KI0 A;  3S17 B;  4R8I A;  4A3E G;  1CFM A;  4B3S L;  1ZHS A;  2WB1 G;  4OEM B;  4FXK C;  4LF6 H;  5IWA H;  1KEE A;  1CQI B;  1NUC A;  1VBH A;  1N56 A;  1Q46 A;  3RFC A;  1Z2P X;  5C0X I;  2BQU A;  5CV9 A;  4UAI A;  2J4X A;  3M4P A;  2R82 A;  1S4Z A;  5FOB B;  3HOZ B;  1TWC B;  4P71 A;  1TWF A;  1QJO A;  4DUY Q;  2EXD A;  1HH2 P;  2VL6 A;  4IO9 A;  2E76 C;  1F9Q A;  4I7H A;  4WBN F;  1SMX A;  5EAY A;  4J15 A;  1IOW A;  3A56 A;  1R4Q B;  3KAJ A;  5DGB A;  2W6P A;  2YRX A;  5KG4 A;  1EFI D;  1HRJ A;  3C2P A;  5FPO A;  1C4Q A;  1PZI D;  4L5Q A;  2UXD Q;  3U9T A;  2FE3 A;  2JSO A;  3N6X A;  4HCE A;  4MV4 A;  2I87 A;  1BVS A;  3HG9 A;  2YZN A;  2AMC B;  1LUZ A;  1A2T A;  1K3B C;  1E0B A;  1DV2 A;  4R8U B;  5KFX A;  3S1N H;  2F0P A;  2VOB A;  3LGJ A;  1J5E L;  3FDT A;  4LF4 L;  3K59 A;  2HCI A;  4NB3 A;  2JK8 A;  4DV4 L;  2MO0 A;  1MI2 A;  4YJ2 F;  4LF9 H;  4A3F B;  3U9S A;  1WTR A;  4QJF A;  2D2C C;  1VDZ A;  4KD4 A;  5FLX L;  2EYF A;  3ULJ A;  5IGE A;  3WOE A;  4BBS B;  3CPW A;  1NR4 A;  2XRS D;  3S1M B;  2W6M A;  1CE8 A;  2C2E A;  2K5H A;  1Q82 C;  2Z8L A;  2L11 A;  3KHR A;  4DR6 H;  4JVZ A;  1HZA A;  1I6V C;  1K8M A;  2RDJ A;  1HR0 W;  1CKM A;  1SAP A;  1FGU A;  4ME3 A;  4NXM L;  1L2F A;  3QFF A;  1QNU A;  2JEA I;  3KAL A;  1XMO L;  5KFP A;  1M1K C;  2JA7 A;  4PG3 A;  4K0K Q;  5IYC H;  3H0G H;  1JMC A;  5NUC A;  5JQW A;  5DG7 A;  2R92 A;  4LF8 Q;  3DWQ A;  1MKH A;  4YHH H;  3DHQ A;  1R9T A;  3NEM A;  1RL2 A;  5LMU H;  1V43 A;  4QUF A;  1EU4 A;  2XSC A;  4RNO A;  4TRD A;  4LFC L;  3M3Y H;  2N55 A;  1N34 Q;  1BGW A;  2K01 A;  2F0Q A;  3EFX D;  3E0E A;  2HIX A;  3FPP A;  3S2H B;  2OQ0 A;  2NN6 H;  1K8A C;  4X64 Q;  1KD1 C;  3R3O A;  4C3J B;  2UU9 Q;  1PA6 A;  2R8I A;  3FKI H;  3T1H Q;  4IUR A;  5IYC G;  4ETS A;  5EKK A;  3Q8Q B;  4QQB X;  2HD3 A;  2A6H D;  4ED6 A;  2K52 A;  4UFZ A;  1PFN A;  4C3I H;  4TV9 F;  3U50 C;  3CCJ A;  3EYY A;  1E2V A;  2RCN A;  3N41 B;  1FNW A;  2JEG A;  4B3R Q;  4YWM A;  2FJZ A;  3RB4 A;  3RV3 A;  3K0Y A;  4LF5 H;  1D5X C;  4JI1 Q;  4O4H F;  1AEX A;  4OX9 H;  2YU9 B;  4JI6 H;  1SYD A;  1O7Z A;  3TP6 A;  2ES2 A;  4Q44 A;  1N36 Q;  1AUX A;  2JN4 A;  1C3O A;  1SE8 A;  5EQ0 A;  2L55 A;  4JI5 Q;  1J8I A;  3HKS A;  5JAV A;  4DV6 Q;  4B9X A;  5C5M A;  3SK4 A;  1EIH A;  3D8G A;  4GOP C;  1GKH A;  5I2X A;  3MR2 A;  2KHS A;  2OXP A;  4DAV A;  5C0X J;  2R92 G;  3S2H H;  4HNU A;  3RD4 A;  2NU6 B;  2YL2 A;  4K5W A;  4PZ6 A;  1UEA B;  5DM6 3;  4AH6 A;  4EQ5 A;  1X3F A;  4R9W A;  1LT4 D;  5KG2 A;  1YNJ C;  4QL5 A;  3MXN B;  1HPC A;  3CC4 A;  3DM1 A;  3HP3 A;  4DR2 Q;  1Z47 A;  1S72 A;  2F0J A;  2I0Q A;  2X0S A;  2CW8 A;  1PYB A;  2HVR A;  1PH2 A;  1E4E A;  3TRE A;  1NR2 A;  4ZQ3 A;  2AQ4 A;  3P20 A;  3L2P A;  1V1Q A;  3EVQ A;  1CKN B;  1X3G A;  3K5I A;  2VB3 X;  4LH7 A;  3HOV B;  4P72 A;  1NMG A;  2SDF A;  3KLS A;  4DR1 L;  1QVG A;  2R7Z A;  4R4C A;  4M7E A;  3H0G A;  4XZ3 B;  2BR0 A;  3PO3 B;  2GN5 A;  1E2W A;  2NVQ H;  2JYO A;  3H4B A;  2NVX B;  4A3E H;  4C2M B;  4C2M A;  3GTK B;  2L15 A;  2XGT A;  2AGO A;  5A2Q L;  3CCU A;  1D6E C;  2B2U A;  4BXX H;  4XT1 B;  2R7Z B;  1KDB A;  2L4N A;  3NBI A;  4X3U A;  4DV3 Q;  4EYH B;  2F0G A;  1I7L A;  1CT1 D;  3PO3 G;  4A3C G;  3CXC A;  1TU2 B;  3MFI A;  1ZEQ X;  1FL0 A;  2QEJ C;  1CK1 A;  2EDG A;  5GRO A;  3H6M A;  5I6Y A;  3BVM A;  4JYA H;  2KEC A;  2EYL A;  2L5T A;  3OHA A;  4EFE A;  4LFB Q;  2R93 G;  4LF5 L;  2EOT A;  4ZUI A;  4A3J H;  1PTO H;  2ALY B;  1WCM H;  3SDZ A;  2IY5 B;  3RB0 A;  4YWL A;  1KNA A;  1AZQ A;  4IPH A;  3VA5 A;  1Y1V H;  2IHF A;  3VPC A;  4J1M A;  3H4D A;  4EG0 A;  4RB1 A;  2QKI C;  3MFH A;  2GVA A;  4RGT A;  4KHZ A;  5M3F H;  4FXD A;  1EOV A;  1I50 H;  1II3 A;  2NVY A;  1E4F T;  4MTK A;  1NBW A;  2EYP A;  5IIF A;  3NHH A;  2YU9 A;  3HOU H;  4UCV A;  4X3S A;  1PH5 A;  3HGB A;  2EY2 A;  3M85 A;  4R8U A;  4UP8 A;  1GO3 E;  2E2J B;  1B3Q A;  4PWQ A;  4A4I A;  1Q12 A;  5EGT A;  3CPF A;  4DL3 A;  1UE6 A;  1W6K A;  2CKZ B;  2DNC A;  3MWD A;  3H94 A;  5KND A;  1D5Z C;  1WH2 A;  1YIJ A;  2Z4I A;  2PQA B;  2I07 B;  5AJ3 L;  3MWM A;  1TKW B;  1KL9 A;  2YS7 A;  4JV5 L;  3PQI A;  5A2Q E;  3RZD B;  4OHJ A;  3MFY A;  5D3D A;  4P74 A;  5M5Y B;  4ZHQ F;  2FLN A;  4BY7 B;  1SXT A;  1HNZ L;  3HKZ B;  4DR7 Q;  2W6O A;  5J2T F;  4KLK A;  2B2U C;  1BCP D;  4JI4 Q;  4IR9 A;  2PN1 A;  1IW7 D;  1S3O A;  4C5B A;  1XNR H;  3HB9 A;  2Q8I B;  4X66 Q;  1JB3 A;  4KN4 C;  2WAQ A;  4YR0 A;  5KT3 A;  3JRW A;  1O7I A;  1T9H A;  3Q8D A;  3GTQ B;  1XMO H;  4HED A;  4JI7 H;  1OO9 B;  4AQY Q;  4DV1 H;  1ZYR C;  3I3C A;  2VUG A;  5DAU A;  1LM0 A;  4XX0 B;  1GHK A;  3OOC A;  1SN8 A;  1K8O A;  4DK3 C;  1HNW L;  1RF2 D;  4JI0 Q;  4KMU C;  2R7F A;  2V4D A;  3NQT A;  4YY3 L;  4DR5 Q;  4K8I A;  1IBK Q;  4HID A;  4RUA A;  3FVQ A;  4LFC H;  3SHL A;  4A3B H;  4JBW A;  4TKO B;  3H09 A;  1JDB B;  2I8C A;  4RZR A;  1UC8 A;  5LHY 1;  3QIA A;  2WB1 A;  3M4Y A;  4A3B B;  4MV7 A;  2JA5 B;  2E8G A;  5IYZ F;  3PIP 3;  3JC6 6;  1YHA A;  2JA6 B;  3K6O A;  4OO1 I;  2DZD A;  1LO5 D;  3NE5 B;  3J80 W;  5C4J H;  4HNV A;  3MA2 B;  3HEJ A;  4R4I A;  1PRT B;  3Q24 A;  3KJP A;  2GPS A;  3CCE A;  1K73 C;  1NE3 A;  5IGB A;  1GYF A;  1YI2 A;  4NKL A;  3VR2 A;  4JV2 A;  3GTK A;  1VMP A;  1FNV A;  1RIP A;  3TP5 A;  4LFA L;  2W9C A;  4OX9 L;  2NVX A;  5KFU A;  1GUS A;  4DXF A;  1SND A;  3D31 A;  4RUC A;  3R8B A;  5JPM C;  2A74 C;  2HCC A;  2H1E A;  1T5X D;  3BDO A;  1QOH A;  5KFE A;  3V4Z A;  2UXB H;  3BJY A;  3V2T A;  3O13 A;  2LMC B;  5FO7 B;  5T1G A;  3H3V C;  4UPA A;  1SCU B;  1VQC A;  1WTO A;  2VQE Q;  2XCP A;  1B44 D;  1HR0 Q;  4DK0 A; 
#chains in the Genus database with same CATH homology
 1K3R A;  4A3J G;  5IYD G;  4DR3 L;  4GOP B;  1TWF H;  2NZH A;  3CP0 A;  3PGZ A;  2F52 A;  3G48 A;  4FDB A;  5C4X H;  4K0K L;  3NEL A;  4GKJ Q;  3GD7 A;  5C3E H;  4GNX C;  4OON A;  5M5Y H;  3I4N G;  3PIP A;  3A74 A;  1CKO A;  2JJQ A;  2KHJ A;  2ZJR A;  1N33 Q;  2PQA A;  4JI7 L;  1NMF A;  4NXN L;  3CCR A;  4H02 A;  4DV1 L;  4A3K G;  2RF4 A;  1L1O C;  4DR3 Q;  1TWA H;  2IT1 A;  1VS0 A;  3VDY A;  3K8A A;  5IP7 H;  4BY1 H;  1QZH A;  4A3G H;  3I56 A;  1VQI A;  1HNX L;  2N3S A;  1VQ9 A;  1YZ6 A;  3DM3 A;  4AYB G;  3I4M G;  4MTN A;  2VUM H;  4GKJ L;  2KCM A;  4C3J H;  5IT9 c;  1QVC A;  3UE0 A;  2I5L X;  3A0J A;  3KLW A;  3RNU A;  2MO1 A;  1BBU A;  1Y1W H;  4A93 G;  4LF7 Q;  1FJG L;  1PV4 A;  1DGS A;  4EX5 A;  5LMN W;  1XMO Q;  4JI7 Q;  1E7Z A;  2K5V A;  4DV3 L;  1K73 C;  5J3B A;  2N49 A;  3KDF A;  4DV1 Q;  5ELN A;  4DAY B;  4IPG A;  1E22 A;  4A3M G;  4A3B G;  2PI2 E;  4Y52 H;  3KF6 A;  3KYH C;  2LXJ A;  1PH4 A;  1I94 Q;  2KCT A;  1TWG H;  3JAM i;  4LF8 L;  4TVA B;  2OCE A;  2MNA A;  1I6H H;  1HNZ Q;  4GLX A;  4DR7 L;  1Y14 B;  3GDE A;  1Y1V G;  1EYG A;  2JA5 H;  1PH7 A;  1FJG Q;  3HOV G;  1UEB A;  4P75 A;  3PO2 H;  4A3C H;  3PF5 A;  1Q1E A;  5K36 G;  5AJ3 Q;  3G6E A;  3L7Z C;  4X66 L;  5IWA Q;  1N34 L;  1VQ5 A;  3M4Q A;  1WFQ A;  2R92 H;  3HOY G;  3M7N A;  1X6O A;  4GLA C;  2ZJP A;  1H95 A;  3K7U C;  1R9T H;  3GTO H;  2UUA Q;  3DLL A;  2JA9 A;  3ULP A;  1X65 A;  3GTK H;  4DV5 Q;  5IYB G;  4TQU S;  1K8G A;  3BZC A;  5DLQ E;  1XNQ L;  2UXB L;  2D0P A;  3J81 c;  2K5N A;  3OW2 A;  4POG A;  2N8N A;  3BZK A;  4LWC A;  5ELO A;  3H3V H;  4A3K H;  4YY3 Q;  2VW9 A;  4DR5 L;  1QUQ A;  1EUJ A;  5GAH C;  1XPU A;  2IHE A;  2ZJQ A;  2OWO A;  3KJO A;  5JEA G;  1MIU A;  1KAW A;  4DV4 Q;  4R4Q A;  1Q7Y C;  2NVT H;  3GTQ H;  3HFZ B;  3HOX G;  1IBM Q;  2YTY A;  5LMN L;  3TS2 A;  1CSQ A;  1FVI A;  2I5H A;  1UE5 A;  4LUZ A;  4MNO A;  5FJ8 G;  4JI1 L;  1B8A A;  1SRO A;  2PNH A;  4LNQ A;  4LF9 L;  1X9N A;  3UDX A;  2ATW A;  4YHH Q;  3PO2 G;  5C0X G;  3TEH B;  1S40 A;  1PH6 A;  3JAM c;  2JA7 G;  4POF A;  5LMU Q;  4DK6 C;  3PCO B;  2E5L Q;  2CFM A;  1IBL Q;  1ASZ A;  1CKN A;  2JA7 H;  3ERS X;  4JI5 L;  3I55 A;  1C9O A;  4BXX G;  1YJ9 A;  2AWN A;  3W1G A;  3AYH B;  1HZB A;  2PI2 A;  3NBH B;  1IXR A;  4RMF A;  4BBR G;  1VQJ A;  3I4O A;  1PH8 A;  1SR3 A;  1VQA A;  2NN6 I;  4MZ9 A;  4NXN Q;  4IFD G;  4HJA A;  2EIF A;  4LF9 Q;  2HQL A;  2UXC L;  4JI2 L;  4IFD J;  3EIV A;  2H5X A;  4JOI C;  1Q86 C;  1JJG A;  2A8V A;  5IE8 A;  3UE1 A;  3CQZ H;  3J7Z C;  4L5T A;  2JA5 G;  3BU2 A;  4JYA L;  4BY7 G;  4DNI A;  2E2J H;  4KI0 A;  1IZ6 A;  1X56 A;  5LMU L;  4A3E G;  5JEA J;  1IBL L;  4X65 L;  4B3S L;  3CCS A;  3J7A 5;  4X64 L;  2WB1 G;  3H15 A;  1XNR L;  2Q2T A;  3S17 H;  1SFO H;  4B3T Q;  1IYJ B;  3OTO Q;  2V1C C;  4IJL A;  4GOP A;  1VQE A;  4LF5 Q;  2Y0S G;  1Q46 A;  2MFI A;  1E3P A;  3AFQ A;  1KRT A;  5C0X I;  4OX9 Q;  4YCW A;  4JI6 Q;  4JI0 L;  5HY6 A;  3M4P A;  1PH3 A;  1N32 Q;  4P71 A;  2F3I A;  3J81 i;  2EXD A;  2JEB I;  1HH2 P;  1VQD A;  2OQK A;  2VL6 A;  4NPS A;  4DUY Q;  4IO9 A;  1EIF A;  3HOY H;  1SMX A;  1WCM G;  5EAY A;  4J15 A;  3AFP A;  1BKB A;  1ASY A;  2WAQ G;  4JI8 Q;  1EQR A;  2B63 H;  3CD6 A;  3STB C;  4L5Q A;  4JI6 L;  2E2I H;  2Q2H A;  2ZM6 Q;  2UXD Q;  4C2M H;  4R1J A;  4O2D A;  4OWT B;  1N36 L;  1YJN A;  2K50 A;  2A1A A;  1N8R C;  2BH8 A;  4JI3 Q;  5GAG C;  5H1S E;  5IP7 G;  4A3G G;  3MEF A;  3HOW H;  5IYD H;  1YJW A;  1PH9 A;  1BVS A;  1P16 A;  3GTL H;  2AMC B;  1LUZ A;  1OXS C;  1VQ8 A;  3I4M H;  4LFB L;  3GTP H;  1C0A A;  4HJ7 A;  3S1N H;  5C4X G;  4YCV A;  5BR8 Q;  1GVP A;  4BY1 G;  3LGJ A;  2R7Z G;  1J5E L;  4LF4 L;  4NB3 A;  3U4Z A;  2JK8 A;  4DV4 L;  3T1Y Q;  1VQM A;  2MO0 A;  5M5W H;  2R93 H;  1CSP A;  1A8V A;  4QJF A;  2UUB L;  3B6Y A;  1VQB A;  3ULJ A;  4GKK Q;  3CPW A;  2YYZ A;  2RHQ B;  1WYD A;  2K5H A;  1Q82 C;  4BBS H;  4PZ7 A;  1OTC A;  3S1R H;  2VQE L;  1HZA A;  3J80 i;  3CCM A;  1HR0 W;  1CKM A;  4ME3 A;  1FGU A;  4DV2 Q;  4GNX A;  1AE3 A;  1L2F A;  2K14 A;  2UUC Q;  2HHH Q;  2MQH A;  1XMO L;  1M1K C;  4NXM L;  2JEA I;  5IY0 A;  2UU9 L;  4PG3 A;  4K0K Q;  5M3M G;  3H0G H;  1VQH A;  5IYC H;  2ID0 A;  4R4O A;  4HIO A;  1JMC A;  3HOW G;  4LF8 Q;  1K9M C;  1MKH A;  2UUA L;  3HOX H;  3NEM A;  4GN3 B;  1RL2 A;  3S24 A;  1V43 A;  3FHW A;  3K80 C;  3S1M H;  2CWA A;  1UWV A;  1XTD A;  2R6G A;  4LFC L;  4A76 A;  1AE2 A;  1KQS A;  3M3Y H;  2NVY H;  1N34 Q;  2NN6 G;  3I4N H;  2VQF Q;  4A3F H;  1I5F A;  3E0E A;  2HIX A;  3RR5 A;  1VQO A;  2YU9 H;  2OQ0 A;  3ICE A;  2UU9 Q;  2ZTC A;  4X64 Q;  1K8A C;  1KD1 C;  4B3R L;  4A3I G;  1PA6 A;  4IPD A;  4DV2 L;  4NXM Q;  2BA0 A;  1UE1 A;  3FKI H;  3T1H Q;  3GTJ H;  1VQK A;  1I3Q H;  3RLO A;  5M3M H;  2ZTD A;  5IYC G;  5LMN Q;  4JV5 Q;  4L5R C;  1HR0 Q;  2KEN A;  3RZD H;  4DV0 L;  1HNX Q;  4QQB X;  2C35 B;  3TRZ A;  2K52 A;  3CCL A;  1HZC A;  4C3I H;  3AEV A;  2DGY A;  2Q2I A;  2VS1 A;  3CMA A;  4QIW E;  3U50 C;  1OXT A;  3CCJ A;  2LXK A;  3HOZ H;  1VQP A;  1V9P A;  4LF7 L;  3PUV A;  1E1T A;  2RCN A;  4A3D H;  1YVC A;  2XTI A;  2Z0S A;  4DV6 L;  3I7F A;  1JJC B;  4B3R Q;  3EBE A;  4YWM A;  4LF6 Q;  1VQ6 A;  2QEX A;  1XJV A;  4JI1 Q;  1NJI C;  2K4K A;  5C44 H;  1AH9 A;  1I94 L;  2B29 A;  2VNU D;  4JCV E;  2UXC Q;  2ES2 A;  2E5L L;  4DV7 L;  1B7Y B;  1WJJ A;  1JE5 A;  3RN2 A;  5FLX c;  4B3M L;  4A93 H;  1UE7 A;  3HKZ G;  2QA4 A;  1N36 Q;  4JI3 L;  1G29 1;  1A63 A;  2WB1 E;  1SE8 A;  1L1O A;  4DR6 Q;  3RZO H;  4JI5 Q;  2JE6 I;  3S2D H;  3HKS A;  4DV6 Q;  3HKZ E;  1IBK L;  3TS0 A;  4GOP C;  1GKH A;  4AQY L;  4C3H H;  1QUQ B;  2JA6 H;  5C0X J;  2R92 G;  3S2H H;  1X3E A;  3ER0 A;  1KXL A;  1OXX K;  4JI2 Q;  2BH2 A;  1A0I A;  4PZ6 A;  2KHI A;  2YV5 A;  3S15 H;  1MJC A;  4AH6 A;  4EQ5 A;  3PV0 A;  3M9B A;  1BBW A;  1X3F A;  3HOU G;  1X55 A;  2ZTE A;  2OTL A;  1CUK A;  3MXN B;  4QL5 A;  3F2C A;  4HJ8 A;  2D0O A;  3CC4 A;  4B3M Q;  1G51 A;  4XIG S;  4DR4 Q;  4DR2 Q;  1SLJ A;  1U5K A;  1Z47 A;  3K0X A;  1YIT A;  2R7D A;  1S72 A;  2I0Q A;  3FKI G;  2LSS A;  4OWX B;  1PYB A;  3UDG A;  4BA1 I;  1K0R A;  4DPG A;  1PH2 A;  1PFS A;  3TRE A;  3FP9 A;  1XMQ L;  4B3T L;  3L2P A;  1V1Q A;  2RHS B;  1PVO A;  1CKN B;  1X3G A;  4YHH L;  1K83 H;  2D62 A;  5IP9 G;  2EQS A;  4LW1 A;  4P72 A;  1NMG A;  4JG2 A;  4DR1 L;  1QVG A;  5IP9 H;  1N32 L;  4P73 A;  4R4C A;  3PF4 A;  4UY8 C;  2GN5 A;  4Y7N H;  3M4O H;  1VQ4 A;  2NVQ H;  4DR2 L;  1N9W A;  4JBJ A;  4A3E H;  5GQO A;  2VZA A;  1LTL A;  2JQO A;  2L15 A;  2XGT A;  3D0F A;  2NZO A;  1KRS A;  3W5O A;  3CCU A;  4WJ3 M;  1G6P A;  4LUO A;  2NVX H;  4A3L H;  4BXX H;  3PUW A;  3KOJ A;  3GTM H;  3AQQ A;  2OTJ A;  2HT1 A;  4GS3 A;  4DV3 Q;  4A75 A;  3PO3 H;  4IPC A;  1PH1 A;  1WOC A;  3PO3 G;  3HOV H;  3CAM A;  1X54 A;  3W1B A;  3CXC A;  4A3C G;  1HNW Q;  1FL0 A;  2KBN A;  1TWH H;  4AIM A;  2A19 A;  4HIK A;  1IL2 A;  1VCI A;  1YNX A;  2BA1 A;  3ULL A;  4DV0 Q;  1GM5 A;  5GRO A;  3CF5 A;  3CC7 A;  1VQN A;  5JJI A;  1VQL A;  2VUM G;  1J6Q A;  3UDI A;  5BR8 L;  3KF8 B;  3U4V A;  3A5Z B;  2VY3 A;  4LUV A;  2B63 G;  4LFB Q;  2R93 G;  4LF5 L;  3CME A;  4HIM A;  1XNR Q;  3T1Y L;  5GAD C;  2JA8 H;  4A3L G;  4A3J H;  1HR0 L;  4LF6 L;  2ALY B;  3HOZ G;  2UUC L;  4LF4 Q;  1MJE A;  4WJ4 A;  3I2Z A;  1HJP A;  1WCM H;  3K81 C;  1W3S A;  4BY7 H;  2IY5 B;  2WAQ E;  3J80 c;  4YWL A;  1XPO A;  4OWW B;  1PHJ A;  4IPH A;  4QY7 A;  3G71 A;  1Y1V H;  2IHF A;  4GKK L;  3E9I A;  4L5S A;  1M90 C;  2HIV A;  1B70 B;  3KF6 B;  4O0A A;  4DUY L;  4OXP A;  5FLM H;  5M3F G;  1XNQ Q;  2IX1 A;  2UXB Q;  3KDF B;  4JOI A;  1N33 L;  1P8L A;  2GVA A;  1YHQ A;  4LFC Q;  4KHZ A;  4IJH A;  5FLM G;  5M3F H;  1E24 A;  1EOV A;  1I50 H;  2AHO B;  2VQF L;  2JA8 G;  4HJ5 A;  4GN5 A;  1IBM L;  1NBW A;  4KHP L;  4HJ9 A;  2Y0S E;  3CW2 C;  3HOU H;  1KIX A;  1VQF A;  4DAM A;  1QZG A;  1EWI A;  3K7A H;  1PH5 A;  2GVB A;  4X62 Q;  4BBR H;  4GNX B;  3M85 A;  4UP8 A;  1GO3 E;  1OXU A;  1WI5 A;  5JJL A;  3F1Z A;  5C44 G;  4A4I A;  1Q12 A;  3CPF A;  1E1O A;  1UE6 A;  1EFW A;  2CKZ B;  4YWK A;  2N78 A;  2Z6K A;  1J5E Q;  2WFW A;  1YIJ A;  3E9H A;  4DR4 L;  5E7N A;  4QGU A;  4OO1 G;  2PQA B;  5AJ3 L;  3H3V I;  4BBS G;  1KC8 C;  2Z6K C;  4IOC A;  1KL9 A;  3GO5 A;  1KHI A;  5M5X H;  1SRU A;  1EQQ A;  3T1H L;  4JV5 L;  2CWP A;  1QVF A;  3PUX A;  4PMW A;  5C3E G;  3PIO A;  2UUB Q;  4JBK A;  3SGI A;  1W2B A;  3PSI A;  4P74 A;  1JJ2 A;  4X62 L;  1Y1W G;  1HNZ L;  1PYS B;  4DR7 Q;  4JYA Q;  3PUY A;  2WP8 J;  4DV5 L;  4KLK A;  1Q81 C;  4JI4 Q;  2R7Z H;  2AWO A;  1S3O A;  3U58 A;  2YTX A;  4DR6 L;  4BA2 I;  4YCU A;  3S16 H;  5IWA L;  4X66 Q;  5HGQ A;  3S1Q H;  1YHB A;  1EIY B;  1O7I A;  2HHH L;  4PZ8 A;  3OTO L;  4B3S Q;  1T9H A;  3Q8D A;  3IRB A;  1L0W A;  2F4V Q;  4A3D G;  4AQY Q;  4IOA A;  3F8T A;  1LM0 A;  3ZJY C;  4ALP A;  4DV7 Q;  1SN8 A;  1D7Q A;  4DK3 C;  1HNW L;  4JI4 L;  4JI0 Q;  4GN4 B;  1JT8 A;  2R7F A;  4YY3 L;  3BJU A;  4DR5 Q;  3J81 j;  1IBK Q;  4HID A;  2JA6 G;  4A3M H;  4A3B H;  4JBW A;  4GLV B;  4JBM A;  1TXY A;  3CC2 A;  4UP7 A;  1LYL A;  2F4V L;  2CQO A;  1JB7 A;  2I5M X;  1Q1B A;  2DUD A;  3L0O A;  4JI8 L;  3TQY A;  2FXQ A;  4LFA Q;  1NY4 A;  2E8G A;  2E2H H;  3STB D;  3CCQ A;  4DKA C;  3RN5 A;  1OXV A;  3JC6 6;  1A62 A;  1YHA A;  3CCV A;  4OO1 I;  3WWV A;  4DUZ L;  2ZM6 L;  2UXD L;  4X6A H;  5C4J H;  4X65 Q;  5FJ8 H;  1VQ7 A;  2ASB A;  4R4I A;  3KJP A;  3OYY A;  2K75 A;  1C7Y A;  3CCE A;  1U0L A;  1NTG A;  4AYB E;  3F2B A;  1NE3 A;  1YEZ A;  3PUZ A;  1Q8K A;  3A5U A;  1YI2 A;  2QGQ A;  4A3F G;  1XMQ Q;  1L1O B;  4LFA L;  1RIP A;  2Q2U A;  4OX9 L;  2IX0 A;  3G4S A;  3RLF A;  4A3I H;  1HZ9 A;  3S14 H;  2YTV A;  4IFD I;  4KHP Q;  5GAE C;  3D31 A;  2AKW B;  3KFU A;  4DR1 Q;  3EN2 A;  4APV A;  3NEN A;  1XPR A;  4XTC S;  4RG1 A;  1D8L A;  5IYB H;  3UDF A;  1GD7 A;  4UP9 A;  1YBY A;  4DUZ Q;  2B3G A;  2PMZ E;  3F2D A;  1Z9F A;  4UPA A;  2CCZ A;  4R4T A;  5JJK A;  1VQC A;  2VQE Q;  3GTG H;  1VQG A;  3RLN A;  1TWC H;  3H0G G;  4JC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...