3I4NG

8-oxoguanine containing rna polymerase ii elongation complex e
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4nG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4nG01
1YITA 4GNXB 1TWCH 4LUZA 1M90C 4DR4L 2UXDQ 1CSQA 4JI1Q 4A3JH 4NXMQ 2K5HA 3H0GG 4JYAQ 1IBMQ 2UU9Q 3I4NG 4KHPL 2UUAL 1T9HA 3E9HA 1DGSA 1G291 3H3VH 1UE1A 1E7ZA 1Q1BA 1EYGA 1PH2A 4UP8A 3S24A 4OWWB 3KF6B 2D0PA 5JJIA 3GDEA 4TVAB 3HOXG 1K8AC 4JI3L 4WJ4A 5GADC 4R4QA 4GN4B 4BY7G 1XMQL 4YCWA 1VQHA 3STBC 3PO3H 4R4IA 1VCIA 5C3EH 1PH4A 1VQ5A 3GTPH 3I4MG 3CCSA 2PI2A 4DAMA 1YIJA 1SLJA 1WYDA 4BBSH 2IT1A 1X54A 4AQYL 1XNRL 1OXVA 1QVGA 4ALPA 3L2PA 2A8VA 2UXBQ 4LFCL 5LMUQ 4GNXC 1E1OA 4UY8C 3J81j 4PG3A 1VQOA 1HJPA 2YV5A 3JAMc 2K50A 1SRUA 3OW2A 4PZ8A 3HOVG 1I3QH 4GLAC 4UP9A 2YU9H 1I6HH 1YHQA 3CCLA 5IYBH 2EIFA 4DR5Q 3PUXA 4APVA 2FXQA 3PV0A 4L5TA 4UP7A 1X65A 4DR7Q 5C0XG 4B3TQ 5K36G 4A3BG 2K4KA 3PGZA 1WCMG 3M4PA 1Y1WH 1PVOA 4KI0A 4LFBL 3KYHC 4R4OA 3OTOQ 2E2JH 1VQKA 4JI0L 1YJWA 4DV0L 1VQNA 2HHHQ 3CC2A 2DUDA 4DV3Q 4HJAA 1L1OC 4HIKA 3PF5A 1R9TH 5C4XG 1ASYA 2UU9L 4LF5Q 1U5KA 4BA1I 2YTXA 4MZ9A 4GOPA 4BY1H 3S16H 1WJJA 3UDGA 4IOAA 1L0WA 2K5VA 2VY3A 5E7NA 2JJQA 1IZ6A 1VQAA 4DUYQ 2QEXA 4LNQA 2IHEA 1KRSA 2NVTH 4POGA 2GN5A 1E1TA 2NVXH 2ZJQA 1VQFA 4P71A 1HR0W 4A3DH 2IY5B 3S15H 4A3MG 3M4OH 3E0EA 2PNHA 4DV5Q 3TS2A 4R4TA 1NMGA 2OQ0A 1L2FA 2ZJRA 2WP8J 4YCVA 3A0JA 2VW9A 2VQEL 4BA2I 5FLXc 3KF8B 1OTCA 4OX9Q 4HJ8A 1M1KC 4QL5A 1YEZA 4MNOA 4HIOA 4LF4Q 5IYCH 2Q2TA 4B3MQ 1N34L 4A93H 3S1RH 2JA8G 3HKZE 3I7FA 1XNQQ 4A3LH 4ME3A 2RF4A 1VQJA 3CF5A 2R7ZG 5JEAG 4DV2Q 4HJ5A 3HKSA 1CKNA 1EWIA 1EFWA 4WJ3M 1HR0Q 4OONA 3BJUA 1VQ8A 5C44H 4C3JH 4A3KH 2RHSB 3HOYG 4YWLA 3CC4A 4JBMA 4IFDG 1GVPA 2YTYA 4IPGA 4DNIA 5H1SE 4DR5L 1E3PA 2BA0A 1QZGA 3RNUA 1N36Q 4RG1A 3H0GH 3F2BA 4JI8Q 3HKZG 4DR7L 2D0OA 3I4NH 2VNUD 2I0QA 4GN5A 3KFUA 1N33Q 4JBWA 2AWOA 3AFPA 3L0OA 3CXCA 4IOCA 1K83H 2HHHL 3T1HL 2GVAA 3NELA 4JCVE 4DV4Q 4JI2L 1XPUA 4DV3L 2HQLA 3HOXH 4GNXA 4YHHQ 3K7UC 2ZTDA 3AFQA 1JE5A 1CSPA 4DR1L 4DR3Q 4JI4L 1VQ6A 1Q1EA 3CP0A 2C35B 2WB1G 2Y0SG 4GLXA 1KQSA 3CCQA 3K0XA 4P72A 2UUCQ 4LF5L 3LGJA 1H95A 3I4MH 3PF4A 3JC66 3I55A 4LUVA 1D7QA 1QUQA 5LMNW 4DK3C 5C0XI 4DV6Q 2JA9A 1PH3A 5GQOA 4DV5L 4DUZQ 3HOZG 3TQYA 2ZM6Q 3F2CA 2OTLA 1I5FA 4LF7Q 4C3IH 3KOJA 1EQQA 1KC8C 4OX9L 3J7ZC 4LF4L 2N78A 1P8LA 1PFSA 4MTNA 4JI7Q 1SFOH 5GAHC 2PQAA 1XNQL 1BBWA 3AQQA 5IYDG 1XJVA 1PH5A 1S40A 4DV2L 3J80i 1NE3A 3GTKH 4A3BH 1WCMH 3T1YL 3CD6A 4Y52H 1LYLA 3J81c 1SROA 2YTVA 1B70B 2HIXA 3ULJA 5GAEC 3GTLH 4IJLA 1FGUA 1X3FA 1N36L 3WWVA 4DV1Q 5J3BA 1KL9A 4QGUA 2Q2HA 1PH7A 5C4XH 1XPOA 2N8NA 1HNZQ 5FLMG 2R93G 2AWNA 2BH8A 3K81C 1KHIA 2EXDA 1E22A 4JOIA 4DR2Q 1IBKQ 1S72A 2OQKA 4A3GG 5EAYA 3PCOB 4PZ7A 3UDXA 1NY4A 1L1OB 3PIPA 1VQPA 1YI2A 1J5EQ 4LF6Q 3TREA 1FJGQ 4YHHL 2KHJA 3HOWG 1YZ6A 1RIPA 2NVYH 3I4OA 3U50C 3M85A 4DR3L 1I94L 2UUCL 5M5YH 4OO1G 2NN6G 4DK6C 4A3MH 1HNWL 1K3RA 2PMZE 2B3GA 3CMEA 5C4JH 3M3YH 3W5OA 2N3SA 3STBD 1X6OA 4A4IA 1VQ4A 4POFA 1IBLQ 1G6PA 4O0AA 1WFQA 4A3EG 5JJKA 3DM3A 4DV6L 1TXYA 2E2HH 2JA8H 1SN8A 2HIVA 1VQ9A 3CPFA 1VQLA 1WI5A 3PUZA 1A8VA 1VQGA 5HY6A 2LXKA 3M9BA 1YJNA 4JBKA 2R7ZH 3U4ZA 2R7FA 5IWAQ 2OTJA 3GD7A 4JV5Q 3HOYH 2KBNA 2UXDL 1SE8A 1SMXA 4YWMA 4TQUS 4JI1L 4NXNQ 1PYBA 5IP7G 4NXML 5C44G 4DR6Q 4JYAL 1RL2A 2I5MX 1IBML 1B8AA 3AEVA 1PH6A 4LF8Q 3M7NA 3KJOA 1D8LA 3GTOH 4A3CG 4KLKA 4OWXB 3PUYA 1Q86C 1BKBA 2MNAA 3RR5A 3K7AH 4K0KQ 2ES2A 1V1QA 5ELOA 4JI5Q 3CC7A 1Z9FA 5AJ3Q 4JBJA 2AMCB 3FKIG 3UE1A 3CPWA 4BXXG 4B3RQ 1MJCA 3S14H 4IPCA 4DV7Q 1BVSA 3S2DH 1XMOQ 4OWTB 4LF9Q 1OXXK 2N49A 2RCNA 3M4QA 4IPHA 4DR2L 2AHOB 5ELNA 1IBKL 1ASZA 1J5EL 2BH2A 3ICEA 2ID0A 1FJGL 2Q2IA 4XTCS 4LUOA 2UXBL 1NBWA 5IP9H 2LSSA 5LMUL 1X3EA 4QJFA 5C3EG 1YVCA 1X9NA 4GKKQ 4KHZA 2NZHA 2JE6I 1YNXA 2NVQH 4QIWE 3HOZH 1A0IA 3FHWA 4XIGS 1Q46A 1WOCA 1X3GA 2EQSA 2UXCQ 1VQ7A 3BZKA 1IBLL 1EUJA 1OXUA 3KDFA 4Y7NH 1N8RC 2QA4A 2WB1E 3G48A 2Y0SE 4X64Q 1N9WA 4IO9A 4B3TL 3OYYA 5IYDH 3MEFA 3ULPA 2OWOA 1LTLA 3OTOL 4DR4Q 4P73A 5IWAL 1O7IA 3J80c 4OO1I 2JA6G 1MJEA 4NXNL 1NMFA 1Y1WG 1XTDA 3GTMH 3PSIA 1EIFA 2I5LX 1J6QA 1KAWA 2NZOA 1HZCA 5M3MG 4YCUA 2R93H 5FLMH 4GN3B 1GM5A 4L5RC 4LF8L 2F4VQ 4JI3Q 1MKHA 4DUYL 4A3GH 2KCMA 1UE7A 5HGQA 3GTJH 1C0AA 1XMQQ 4A3FG 1GO3E 1IXRA 2KENA 3KF6A 4JI5L 1TWGH 3D31A 1Q12A 3HOWH 1NJIC 1CKMA 2JK8A 3SGIA 2R92G 4B3RL 3K80C 2I5HA 4DV7L 3MXNB 1VQMA 4DKAC 3CCRA 1XMOL 1S3OA 4PZ6A 1MIUA 2ZTCA 3PUVA 3UDIA 5IY0A 3HOVH 2B63G 5M5XH 2Z6KC 2VQFQ 1VQCA 1PHJA 3HOUG 1L1OA 4B3ML 3S1NH 4GOPC 3U4VA 1I50H 2ZTEA 3ULLA 4A3EH 4GKKL 3NBHB 1KRTA 3KLWA 1V43A 2GVBA 5M3FG 4HIDA 3TRZA 1E24A 3NENA 1K73C 2IX1A 4AH6A 1NTGA 1W2BA 5LMNQ 1Z47A 2IHFA 1X55A 4UPAA 1HR0L 2HT1A 2VUMG 3CMAA 2K5NA 1Q8KA 2UXCL 5DLQE 3A5UA 1UEBA 2VS1A 5IE8A 3KJPA 1OXSC 2E5LQ 2ATWA 4X64L 3L7ZC 5IP7H 1YHAA 2R7DA 2Z0SA 4AYBG 4JI8L 3G4SA 4JI0Q 4DV0Q 3CAMA 1IL2A 1VQBA 3GTQH 4JG2A 3EN2A 3S2HH 4O2DA 4A3IG 4P75A 1N33L 3PIOA 4A3CH 2CKZB 4BBRG 3I56A 4GS3A 3CCVA 2A19A 1PYSB 4DV4L 3CCJA 3ZJYC 2F3IA 1UE5A 1Y1VG 5FJ8G 4X62Q 3FKIH 1PH8A 5M5WH 3PO2G 3B6YA 3GTGH 4BXXH 1QUQB 3HFZB 3RLOA 2F4VL 4IFDI 3G71A 4X66Q 3EBEA 4X65Q 1KIXA 1JJCB 2WAQE 2A1AA 4IJHA 4LFAQ 2MO0A 1FVIA 4YY3Q 1Q7YC 2CWPA 4AIMA 1OXTA 3Q8DA 1Q82C 1PH1A 3E9IA 2CFMA 3PUWA 2CQOA 2VQEQ 4B3SQ 4DUZL 2R6GA 3W1BA 2ZM6L 2MO1A 4R4CA 1HZAA 3FP9A 1K8GA 1C7YA 4LF7L 1N34Q 2PQAB 4BY7H 3J7A5 1EIYB 3A5ZB 1HH2P 2VQFL 1AH9A 2MFIA 4HIMA 5GAGC 2JA7G 1LM0A 2WAQG 4R1JA 4GLVB 4JI7L 3H15A 2JA5G 3DLLA 1A63A 3RLFA 1YBYA 3G6EA 2AKWB 4NB3A 2K14A 2E8GA 1P16A 5LMNL 4HJ9A 4A3JG 4JI4Q 1PV4A 2IX0A 2JQOA 3F1ZA 3NEMA 5C0XJ 1KXLA 2WFWA 3J81i 1FL0A 3F2DA 2E5LL 2JA6H 4DV1L 4RMFA 2MQHA 3K8AA 3RLNA 1HNZL 2UUBQ 4GKJQ 4JI6Q 1TWAH 1TWHH 3I2ZA 2E2IH 5M3MH 3T1HQ 4LW1A 4JI2Q 1CUKA 4YWKA 4A76A 1HNXQ 1EOVA 2LXJA 5GROA 2Z6KA 4DR1Q 3PO3G 1C9OA 1B7YB 1XPRA 2D62A 4A3FH 1KD1C 4LF6L 1JB7A 2B29A 3A74A 4BBSG 4X62L 3GO5A 1QZHA 2JEAI 2R92H 4OXPA 3U58A 3RN5A 2PI2E 1K9MC 4H02A 1VS0A 2RHQB 3EIVA 4X66L 3JAMi 1JMCA 4X65L 1U0LA 2JEBI 4LFAL 4YY3L 2B63H 3HOUH 2ZJPA 1VQDA 4DAYB 1JT8A 5BR8Q 4JOIC 3CCMA 5M3FH 3D0FA 4B3SL 2VL6A 2K52A 1N32Q 5IYBG 1QVCA 3S17H 1K0RA 3RN2A 3CQZH 2VUMH 4L5QA 4NPSA 5JEAJ 3ERSX 4DPGA 1YHBA 4GOPB 4JV5L 1V9PA 4KHPQ 2K75A 2QGQA 1A62A 2NN6I 1PA6A 2UUAQ 2H5XA 4L5SA 4DR6L 1G51A 3TEHB 3T1YQ 1UE6A 4QQBX 1GD7A 4EX5A 4IFDJ 1JJGA 2XTIA 2DGYA 1HZBA 4J15A 1TWFH 1W3SA 3IRBA 3TS0A 4A3IH 2CCZA 4QY7A 2F52A 4BBRH 3RZOH 4K0KL 5JJLA 4IPDA 1YJ9A 4BY1G 1VQEA 4X6AH 2ALYB 5AJ3L 1QVFA 2OCEA 2YYZA 1IYJB 1Y14B 1Q81C 2UUBL 1Y1VH 5FJ8H 4JI6L 4GKJL 4AQYQ 1XNRQ 4A75A 3PO2H 2VZAA 4C3HH 4LF9L 3VDYA 4LFCQ 1HNXL 4HJ7A 1EQRA 4A3DG 3BZCA 1UWVA 2ASBA 4EQ5A 3BU2A 1HZ9A 1BBUA 2V1CC 4PMWA 1CKNB 1HNWQ 3UDFA 4AYBE 1GKHA 2KCTA 3UE0A 5IT9c 2XGTA 4LWCA 2L15A 3AYHB 1VQIA 2BA1A 3KDFB 1AE3A 4FDBA 5IP9G 5IYCG 3RZDH 1JJ2A 1X56A 4A93G 3CCEA 3CCUA 1PH9A 1AE2A 3H3VI 4A3LG 3ER0A 1I94Q 4C2MH 3F8TA 3S1QH 1LUZA 3CW2C 4P74A 1CKOA 3S1MH 2JA7H 1SR3A 3W1GA 4LFBQ 2Q2UA 2KHIA 2JA5H 2CWAA 5BR8L 4A3KG 1N32L 4JC0A
chains in the Genus database with same CATH superfamily
4LF5H 2BR0A 4HNTA 5G3LD 3JAML 1M90C 4CC5A 4JI1Q 4A3JH 4NXMQ 3BVMA 3H0GG 2AUKA 1IBMQ 2XGQA 1PLFA 4X3TA 1T9HA 4IAJA 3QIAA 2QF7A 1E7ZA 1Q1BA 2B2WC 3KF6B 1JE4A 1EZ8A 4JI3L 1SYGA 4YCWA 1I4RA 1NR2A 3STBC 4LF4H 2V4RA 1VQ5A 1BJTA 5F9NA 4QCLA 5DGAA 3PO3B 1XNQH 2WE6A 1XNRL 3GTPB 4ALPA 3L2PA 2SNSA 4ECRA 2JA6A 4DV2H 3I3CA 3IFTA 5LMUQ 1B2TA 3FMCA 1TWAA 1HR0H 1HXYD 2O03A 1Z2OX 3E5SA 3V96A 2HDLA 3GILA 3VPCA 2NVYB 1B04A 3T4AC 1SRUA 4PNYA 3OW2A 3HOVG 1I3QH 3F8NA 4UP9A 2J9GA 1KDCA 3OWEB 4XYOA 3OHAA 4JI8H 2EIFA 2J6UA 4RGNA 3PUXA 1O78A 1I6HB 1KLGD 4ZQ3A 2R7KA 4CDFC 1S10A 1PRTC 3TDQA 5C0XG 5K36G 4DV4H 1I6UA 1L0XB 1TY0A 1PVOA 2OF1A 1GXDC 2XCLA 3KYHC 4R4OA 4LH7A 2W9AA 4FO2A 2B63A 1I94H 1A15A 3T13A 4XX0B 1STAA 2HHHQ 1D6EC 4U6PA 1PZID 4DV3Q 4HJAA 2NYZD 4Q0YA 4FS1A 5CV5A 1TS2A 4IUQA 4LF5Q 2FB9A 3V4ZA 4JK1C 1WJJA 3CQZA 5E7NA 2VUMA 5BN5A 4WFN3 1I4HA 3GP7A 2FLLA 4F7XA 5DLFA 2WYOA 4DUZH 1AP0A 4L63B 1UNNC 1JB3A 4O1NA 1HR0W 4A3DH 1TWFA 2PNHA 3TS2A 1NMGA 2OQ0A 1L2FA 2HCCA 2VXWA 3URYA 1BR9A 5KFLA 2VW9A 2VQEL 3S14B 3H0GA 1M1KC 2RBMA 4LF4Q 4ZKBB 1PX2A 2Q2TA 4F4ZA 1Y1VA 2JA8G 3I7FA 1XNQQ 1QG7A 4EYHB 1EEID 1B50A 5I9PA 4DV2Q 2C2EA 4K8JA 2G9DA 3HKSA 1CKNA 1EFWA 3C1EA 4WJ3M 1L0YB 2BE5C 4OIJA 1HR0Q 3BJUA 1JQYD 1G8ZD 3M9MB 1A2UA 4X3KA 4JI4L 2YTYA 1QZGA 5T1IA 4DR5L 5C44B 4MV3A 4JI8Q 4DR7L 2I0QA 4GN5A 3KFUA 4Q44A 2DY8A 4C2MA 3I4NB 3C0FB 3T1HL 3NELA 4DV4Q 1AZPA 4JI2L 3RF2A 3LNNA 2HQLA 3HOXH 2W7PA 4G7HC 5FLXE 3BA8A 4NMZA 4TKOB 5L1IA 1I94Q 3CP0A 2WB1G 4O2BF 2XGPA 4P72A 1GJXA 5KFIA 1IBLH 4H13C 2IX3A 2AU0A 3JC66 5K2MA 2W6NA 1HFGA 5G3LF 3PW0A 3T1HH 5GONF 3K5NA 3I4MB 4RHSA 3QWNA 4DK3C 3T5HA 4IWYA 3GTJB 3OSNA 1EWCA 1PH3A 5GQOA 5FLXW 4DUZQ 3HOZG 4U68A 3F2CA 2OTLA 4HCEA 4C3IH 4CKBA 5FPRA 4O42A 2AQ4A 4LK1C 1KC8C 1AEXA 4XXEA 3J7ZC 4M1UB 3GTPA 4WD3A 4K0KH 2Q8RE 1W6JA 4JI5H 1WCMH 4I7HA 3KHLA 1LYLA 2R82A 1B70B 1FYCA 4YP3A 3FVQA 4ED1A 1XMOH 1AW7A 2K7VA 4J6HA 5I6WA 5BPHA 2PMZB 4QGUA 5C4XH 5A2QE 5FLMG 3K81C 2EXDA 3IFDA 4RKBA 5KFXA 1GLVA 5DEHA 3G6YA 4JOIA 4KKTA 5NUCA 1JJGA 4PZ7A 1VQPA 1NY4A 1L1OB 4QB4A 5C5MA 3TREA 1QWYA 5JVDF 4XT1B 3TBIB 2KHJA 1YZ6A 1RIPA 3M85A 3R5HA 2MGSA 3IAYA 2EY2A 4DK6C 2EPBA 4IZ8A 5KFSA 3BABA 1XDNA 4YR0A 2O5IC 3W5OA 3STBD 4IALA 1SYEA 2F0NA 1R4PB 1VQ4A 3H91A 1IBLQ 5C4JB 5DGBA 3MR3A 2V59A 1WFQA 4DR4H 4DV6L 2XSCA 4RAUC 4RNOA 2HIVA 2ZXOA 4IUUA 1VQ9A 1VQLA 1WI5A 1VQGA 1LTTD 4JBKA 4FS2A 2R7FA 4WRDA 4NKLA 4UCVA 1KC7A 3HOYH 1SE8A 2CQAA 2DPJA 4TQUS 3E0JA 4PQXA 2X69A 1RL2A 2B8GA 2LKVA 3M7NA 1PK8A 1D8LA 3GTOH 4KLKA 4QWCA 1PZKD 4Q45A 3GV7B 2JEFA 4K0KQ 1X3PA 5CORA 4JI5Q 1RTOA 3UE1A 3CPWA 2PCFB 4BXXG 4R7RA 1QB5D 4IPCA 4RWSC 3V05A 2YRWA 1XMOQ 1VDZA 3SE0A 1OXXK 2N49A 3M4QA 1IBKL 2FE3A 2AHOB 4QWAA 3ICEA 5KFNA 5BN3A 2ID0A 5CB4F 2Q2IA 4XTCS 5IP9H 1TS4A 5C3EG 4IRDA 1X9NA 2I46A 4KHZA 1MZBA 2FPPB 1U4MA 4KY7A 4QIWE 5KG3A 3NTHA 4XIGS 3MXGA 3VYSA 1WOCA 1X3GA 3K5MA 2EQSA 4DV0H 3V6JA 1UNSA 3Q23A 2W9BB 5IGCA 5J2TF 4RB0A 2E2DC 3G48A 3T5KA 4HSPA 3BYTB 3KXYT 5IYDH 5L1JA 5LL6b 3OWFA 4RB1A 4DR4Q 4P73A 1O7IA 3J80c 4QW9A 3I90A 3WDNA 1BCPD 2R8IA 2EJFC 1NMFA 2NWGA 1Y1WG 3GTMH 2W57A 3A54A 4X65H 1T5EA 4LFAH 5FO8B 4GN3B 3GV3A 3I72A 1A3TA 4E4TA 2NTSA 2R93B 2A68C 1C0AA 2EY6A 2AQ2B 1ZYRD 3D31A 1NJIC 3RV4A 4DLKA 2KECA 2I80A 1O7LA 3SGIA 4B3RL 4OO1H 2PMZA 3K80C 4DV7L 2F0JA 1ENCA 1V1PB 1JWSD 1S3OA 4I4TF 2R85A 2KCCA 3HOVH 1HFNA 2X6GA 5DQGA 1PHJA 1L1OA 2KEDA 4B3ML 2MUYA 3S1NH 1WH2A 4RA8A 3NBHB 2IW3A 4WORA 3KLWA 1V43A 1KRTA 4HIDA 1K73C 2IX1A 5E1FA 4AH6A 1EU4A 1NTGA 1W2BA 2ICEC 1EUDB 5KGUA 2RDIA 2IHFA 1X55A 4ED3A 4WJWA 4NW2A 4CC6A 4YR2A 1MGSA 4DA2A 3DM1A 2QCPX 1BNCA 1UEBA 3VYTA 1EY9A 5IE8A 5HBRB 2JEGA 3S1QB 3ORQA 1YHAA 3ERQA 2D9UA 1RCVD 3G4SA 4DV0Q 3CAMA 3MVVA 1VQBA 2DNCA 2FFKB 1IL2A 3EN2A 3S2HH 4RZQA 1NCVA 5IOCA 1ZXTA 1TIID 3A8IE 4A3JB 2RVLA 4K2KA 1K28A 3BYYB 1G91A 2R8HA 4UCOA 3FKIH 3GTGH 4FF4A 3HFZB 3RLOA 2F4VL 4IFDI 5FD6A 3ORRA 2W70A 4X65Q 2B2YA 4LFAQ 1GGOA 1AUVA 4AIMA 1NSNS 1PH1A 4A2AA 2F0VA 1HTPA 1T5XD 3PUWA 5KFAA 2CQOA 3H09A 3RGZA 1Q90A 1TAEA 2R6GA 1BDOA 2ZM6L 2MO1A 1DD2A 1SNDA 2G9HD 4RB2C 2X0SA 2FPIB 3K59A 4N8X1 3N44B 3A5ZB 3SVMA 1HH2P 2N55A 4BWGB 2MFIA 1AH9A 2Y0SA 4IWXA 4JI7L 3UFXB 2ZDQA 3NQIA 1RJQA 3DLLA 2L11A 3MWMA 4YB8B 1AN8A 1SYDA 5IGFA 5CAEB 2E8GA 3CU7A 3TP5A 4A3JG 3PN1A 3VPBA 4JUZA 5I2XA 3MWYW 4L6TB 3TP7A 4AQYH 1CZGA 1KXLA 3MFIA 1JDEA 3F2DA 4HEDA 4DV1L 2W9BA 1TWHH 3KHGA 4LW1A 2DN8A 5J39A 5EKKA 5M3MB 2F0MA 3GIDA 5KFRA 1C9OA 4LF6L 2FK1A 4A3FH 5JQWA 2FJZA 2K05A 5JUMA 5CC4A 4X62L 2NTTA 4FF1A 2JSOA 2RDFA 2R92B 3VYUA 2R93A 1RODA 2FHTA 3OMGA 2EYJA 4FP5D 1XYIA 4DL3A 4ECQA 1VQDA 2QDBA 3A8KE 3PIO3 1WTOA 3BAAA 2UXDH 1DOMA 4XDXA 5M3FH 2UU9H 2K52A 1CM9A 1STHA 2O4XA 1XXGA 3VR4A 5EPJA 1V1PA 4RGMA 5IT9L 5I2YA 4XQQA 4DPGA 4YJ2F 4JV5L 1R4QB 3ERSX 1YHBA 4GOPB 4EBDA 2F0FA 1A62A 4G7ZC 3NWTA 4L5SA 3TMEA 4EX5A 2TMPA 3NBHA 4K6DA 1AZQA 3N42B 1W3SA 3OMCA 4Q8EA 4AYBB 1SYCA 4BBRH 3RZOH 5JVH3 3L3OC 5JJLA 5KFPA 4A3IB 1VQEA 4K5VA 2UXBH 5AFWA 1SE3A 1FNWA 3RJ0A 2A6HC 1Y14B 4ME5A 2UUBL 4DL4A 2RKSA 4JI6L 4AQYQ 4KMUC 1VF5C 4C3HH 5L9XA 1B9NA 1V8QA 2D5DA 3SK8A 1EQRA 4A3DG 3BZCA 4ZI7F 4R8NA 3QZ7A 3GTQA 1NAPA 1HZ9A 2V1CC 4K6LA 3HOXB 4ZUIA 4R9WA 4PMWA 1ULZA 3UDFA 3J80E 1GKHA 2EDGA 2A68D 2B2UC 4LWCA 4B3TH 4FDBA 3TSSA 2IP4A 3ITPA 2A74C 4FXGC 3RZDB 1DOKA 3I91A 3WNZA 2WKDA 2V9WA 3W1GA 1EL0A 2KHIA 2JA5H 3HB9A 2PBZA 3J80W 2IA6A 1KBLA 1B44D 4NP5A 2R8GA 1PDQA 3NP8A 4LUZA 1YNJD 2UXDQ 4C3IB 1CSQA 3KBXA 2K5HA 2K01A 4DUYH 1TWCB 2UU9Q 4KHPL 1D5MC 3E9HA 4YAJB 3HEJA 2VOBA 5J1ZA 1JDBB 1ONLA 2D0PA 5C1OA 4YQWA 1WCMB 3HOXG 1F77A 4WJ4A 2BQ3A 5GADC 2PZWA 1PRTB 5KFQA 1XMQL 3PMFA 5C3EH 1PH4A 1CQIB 1KTKA 4I7ZC 2VB3X 2PI2A 3QG1A 1SMYD 1SLJA 2HQEA 4DAMA 5C4XB 3BQ1A 4EEYA 1QVGA 3Q1KA 1Y8NB 3QO2A 2F0PA 4BBSB 2UXBQ 4LFCL 4GNXC 4UY8C 5K5PA 3NK9A 5CA0F 4J9KA 2E2IA 3HXLA 4O4IF 2YV5A 3JAMc 3BQ2A 1N36H 4CDCC 1CTMA 1EIHA 4PZ8A 2XIWA 2YU9H 4DNRB 1YHQA 1LTRD 2DJFC 3R2IA 3MWEA 3EQLC 3PR4A 2R92A 4J9RA 4L5TA 2L1BA 4B3TQ 4C1NI 2B2VA 3PGZA 1WCMG 1Y1WH 2V58A 4YHHH 4ID6A 4LFBL 2E2JH 1VQKA 5D1OB 4DR3H 2XWBB 2UUCH 1VQNA 2P0AA 3C46A 5KFYA 1EYAA 4EBCA 4K2LA 3Q6SA 3PF5A 1JIHA 3VR6A 1R9TH 5C4XG 1ASYA 1U5KA 2YTXA 4XT3B 4GOPA 3S16H 5ELDA 1L0WA 1IW7D 2RGVA 4RAYA 1LLRD 2JJQA 5IIFA 4DUYQ 4QMGA 3HKZB 4BY1B 1GYFA 2QEXA 4X3SA 2YW2A 3OHBA 2GN5A 2NVXH 2ZJQA 4LF7H 3S15H 4AYBA 3NPPA 4OL7A 2Q8IB 4ECVA 2A6EC 4R4TA 2EYHA 5KG5A 2F0UA 2R8JA 2ZJRA 3A0JA 5HGTA 5FLXc 2ZDGA 4HJ8A 4K5WA 2QK4A 4MNOA 4HIOA 1M6VA 4OGQC 1N34L 5LMNH 2KOLA 2DLNA 1BF4A 3SHLA 1I7LA 2RF4A 4A93B 4ZCKA 5DQIA 3S1RB 5D3DA 2B2WA 2B2TC 1VQ8A 4A3KH 5IGEA 3BQ0A 2WINB 4YWLA 3HOYG 1LT5D 1Y8PB 3RBDA 1JOKA 1E3PA 2BA0A 1N36Q 3RNUA 3RAQA 4C3JB 4KK7A 3KLSX 1CZWA 4RG1A 3HKZG 1M8AA 3GV6A 5ELBA 1ENFA 3L0OA 1JKJB 2HHHL 1XPUA 2XCPA 1LTID 3T51B 2NU7B 4DV3L 2WAQA 1S68A 4L8JA 4YHHQ 1K83B 4DR3Q 4BY7H 1VQ6A 3GIQA 5C4ZA 2UUCQ 4LF5L 3CCQA 3K0XA 1TWCA 3JSLA 4YY3H 3LGJA 3FRPB 4X3UA 4EFBA 1DJRD 3U9TA 4LH6A 5CV8A 3RMHA 2CW7A 5LMNW 2VPQA 5C0XI 3KALA 2JA9A 2ZXRA 2YZGA 4OELB 4RAZA 4NXNH 4ZAIA 5FK9C 5JH7F 2CW0D 4LF7Q 4IUVA 4DR6H 1LTGD 2IBKA 1O80A 4J9LA 2WTFA 4LF4L 2W8LA 2N78A 3HOVB 3PW7A 4MV7A 1XNQL 4I65A 4MN3A 5IYDG 4BS9A 1SFOB 4OHJA 4DV2L 1PYWD 3J80i 3GTKH 4A3BH 3T1YL 4IQZA 3T53B 2EJGC 3GTLH 4XYLB 4IJLA 4FNFA 1Q3LA 1FGUA 3KBGA 3HZXA 3WWVA 4LF9H 3PW2A 2O5JC 1XPOA 2N8NA 2SOBA 5IGGA 5KFCA 2AWNA 3GIIA 4KTAA 1SXTA 2A5HA 3U9SA 4GKKH 1E22A 1KABA 1H9SB 5IGBA 5EAYA 3PCOB 3UDXA 3S2HB 1BUVT 1Z6HA 1T3NA 3EFXD 1GUTA 4GZYC 4P2CB 2JP1A 5EGTA 3KK7A 4OO1G 5L37A 1I94L 5JOBA 4A3MH 1TU2B 1HNWL 1EY8A 2UVVA 1K3RA 3GQBA 3CMEA 1LTAD 3FKIB 5M5YB 3M3YH 3GTGB 4RGOS 3RD4A 4XQNA 3SR1A 1N32H 3HKZA 4POFA 1G6PA 1STBA 1ZEQX 3J81E 1A3UA 2HD3A 3QOJA 4RUAA 2GA4B 1D5XC 2FLNA 1A8VA 5HY6A 1YJNA 2R7ZH 2JA8B 1EY5A 2HCIA 4DAYA 1RJTA 4ECSA 4FBUA 1BO0A 2OTJA 5KT7A 1EQTA 2KBNA 4CJ0B 1SMXA 4ZRZA 4YWMA 4NXNQ 4IFDH 4JI3H 3A7LA 5EPLA 4DR6Q 4JYAL 3J81W 3DF7A 3KJOA 2RSNA 1HRJA 1F9RA 1EHIA 4OWXB 2R6FA 4EEQA 4PMBA 5DLGA 1Q86C 1WTVA 4MAMA 1BKBA 3JAME 2MNAA 1V1QA 1PTOD 2AMCB 3K7AB 3FKIG 5BR8L 3N43B 5EKIA 3PZPA 1RD9D 2VQFH 4YJ3F 3MR6A 4LF9Q 4R8IA 1ASZA 2WB1B 1TWHB 2BH2A 3S2DB 4MV8A 4XZ3B 1NBWA 1PFMA 4H7BA 4QJFA 2ALZA 3JAMW 1YVCA 1Q8IA 3PQIA 4GKKQ 3QZ8A 3GV5B 5KT4A 4ED0A 1K83A 3K57A 2F3WA 2NZHA 4N9TA 2UVRA 1BCPC 5ISRA 2E5LH 2NVQH 5F2DA 3T16A 1MSGA 2FKLA 1Q46A 1PZJD 2RDJA 1H9KA 3I73A 3HOZB 3BZKA 1IBLL 2A6ED 3KDFA 4Y7NH 4O3NA 2RDGA 2BOSA 1N8RC 2HVSA 4IO9A 1BGWA 1TT2A 2CH4W 3OYYA 3MEFA 1ZYRC 4DU9A 1NNXA 5KYLA 1GUSA 3X3NA 3OTOL 2PZTA 5M3FB 2Z1CA 4F50A 2RSOA 2YZMA 2J6TA 1MJEA 3N6XA 4UCTA 3RUPA 1VF7A 1EIFA 1KJ8A 4X66H 1J6QA 4UFZA 2ASLA 1DXMA 3N40P 4L5RC 2BQRA 1SFOA 1QNKA 3D6CA 4JI3Q 2WACA 3Q8SB 2BQUA 4A3GH 1UE7A 2XN9C 2VQEH 5EDWA 5KFGA 4A3FG 1IXRA 3KF6A 2W8KA 4JI5L 1TWGH 4BBRB 1Q12A 2UVUA 3HOWH 4TSSA 2JK8A 1Z2PX 1UAPA 3MXNB 4DKAC 2MJ8A 1XMOL 5C3WA 1JR0D 2ZTCA 5IY0A 1EQVA 2RGRA 4C3HB 1H9SA 2Z6KC 3FPUB 2VQFQ 3BG3A 1JOQA 3U4VA 2FMMA 4JI4H 1CT1D 3ND9A 1I50H 2F0SA 3KLSA 5M5XB 5LHY1 5M3FG 2YYAA 3T5JA 1VAJA 2NVYA 3CMAA 3FKIA 1K3BC 1Q8KA 1EY6A 1RDPD 3GTGA 5JPMC 1HA5A 1RK6A 1A3VA 2LFNA 3BVZA 3MEHA 2VS1A 3KJPA 2E5LQ 3M4IA 2ENBA 5EQ0A 2ATWA 3QFFA 4JI2H 1H9JA 3NTKA 2W71A 3TIIA 3TQTA 1HNXH 5KFEA 4JG2A 3AU7A 1N33L 3PIOA 4A3CH 2CKZB 2EYLA 4BBRG 2A19A 4U673 2PVPA 1PFBA 1WR2A 1ICWA 4ILWA 2F3IA 1C8CA 3N8DA 1UE5A 1JICA 1RTNA 4JV1A 5M5WH 1SEIA 3B6YA 4C3HG 5LL6S 1QUQB 4HNVA 4IR9A 2F4IA 5A2QW 3G71A 1HHVA 4X66Q 3J7AK 1SBBB 3EBEA 1KIXA 1JJCB 4G4KA 2A1AA 2WAQE 4IJHA 1J8IA 1OXTA 3NGDA 4APMA 3HG9A 2VQEQ 5C3EB 4HN7A 3Q2OA 2UUAH 5LOVF 1C7YA 1TQOA 1L2ZA 2PQAB 5LL6X 2WB1A 1PTOF 3CKIB 1LM0A 3VMMA 2JA5G 3QJYA 4JV2A 3G6EA 3HP3A 1JX4A 1SJHD 5JJZA 1P16A 4JI4Q 3H3VC 2HUGA 1SEBD 4ETSA 3J81i 3OSOA 1FL0A 2JA6H 4RZRA 2MQHA 3RLNA 1HNZL 1TWAH 4LMQD 5D65A 2XRSD 1G2SA 4UCSA 1Y1WB 1LACA 3T1HQ 4V190 5HURA 4JI2Q 2E2JB 2R8KA 1HNXQ 1EOVA 3MC0B 3BZDB 2PNRC 3OIQA 1XPRA 3K3PA 4YIJA 3F2UA 1SAPA 5KFFA 2JEAI 1V4YA 3RN5A 3RB3A 4O3QA 2VB2X 3I4LA 2RHQB 3BVGA 3D3RA 3EIVA 4DL2A 3JAMi 4X65L 2JEBI 3R93A 4LFAL 2B63H 3HOUH 2CW8A 1EZ1A 1KJ9A 3VR5A 4F88A 2VPSA 3S15B 2EYPA 1JT8A 4G3IA 3GTJA 4JOIC 3D0FA 4DL7A 2ZT9C 4RB3C 2RCFA 3S17H 1N48A 3RN2A 3CQZH 4C5BA 2VUMH 1DZ1A 5JAVA 2K75A 2UUAQ 2NN6I 1PA6A 2H5XA 1WTRA 1G51A 3TEHB 4IFDJ 2V5AA 2DGYA 2XTIA 1HZBA 5KFTA 1TWFH 2WDTA 3IRBA 2IJ0A 4QY7A 1DV1A 4A3KB 2HJWA 2I8CA 1RYRA 4IPDA 5KNBA 3MXUA 4QUCA 4KY5A 5AJ3L 2OCEA 2YYZA 4J1MA 1Y1VH 4YAKB 3PO2H 3RAXA 4I50F 3KHRA 2BDOA 4EG0A 3VDYA 1HUNA 4B9WA 1C48A 3NE5B 1UWVA 5C8YF 1SE2A 1JORA 1YNJC 2M00A 5IT9c 3UE0A 4MV4A 2XGTA 1KAAA 5A35A 1QJOA 1ZHSA 1VQIA 2BA1A 5EPKA 1JJ2A 3R8BA 1QE6A 3M4YA 3CCEA 4ZK9B 1QOHA 4C2MH 5KFJA 5F9LA 2CQYA 3CW2C 2JA7H 1SR3A 2EVBA 2L4NA 4KD3A 2CWAA 4A3KG 1QNUA 4IURA 1EUCB 2GLTA 2EYOA 1YITA 4DAPA 4L1KA 4GNXB 5FO9B 1BXRA 1MSHA 1JWMD 1JXLA 1AN7A 1SMYC 3MJFA 2FLPA 1S0NA 2JXMB 3D4RA 2W6QA 1G291 3H3VH 1UE1A 4O3PA 3H40A 4YBZB 1CQVA 1EYGA 3DWQA 4O4HF 3M7GA 4OWWB 3GTKB 4A3BB 5JJIA 4RUCA 3GDEA 4TVAB 4UDUC 4DV5H 1FGBD 4BY7G 2L55A 4OX9H 3PO3H 3EA6A 2KVMA 2JN4A 2F0LA 1VCIA 3GTPH 4B3MH 3V4SA 3CCSA 1YIJA 1WYDA 2PN1A 2W6ZA 1X54A 4AQYL 1OXVA 3A7AB 3SI8A 2AGPA 4KJNA 1Y1WA 2K5QA 1E1OA 4Q5VA 2EOTA 3J81j 1SYXB 4KV6A 1B3QA 1GUGA 3Q22A 4GLAC 3A8JE 1I6HH 2ZXPA 5IYBH 3MHBA 1I3QB 3NHHA 1IW7C 1WD1A 2N88A 3OOCA 4RU9A 3TP8A 4APVA 3PV0A 2YS6A 2IL8A 4HQ6A 1EYZA 4A3BG 2K4KA 4F4YA 1B1ZA 1TY2A 2MCTA 1PRTF 3G8CA 2VA2A 2H1EA 4JI0L 4O3OA 3G6JB 2NU9B 2A69D 4FF3A 2R7ZB 3MTSA 3CC2A 2DUDA 1L1OC 3DMUA 3S9WA 1FKAH 4IRCA 2UU9L 3LWEA 4BA1I 4N9PA 4MZ9A 3G6XA 3UDGA 3R3OA 3JSNA 5I9OA 2K5VA 2ZDHA 2B2UA 1VQAA 4A2BA 1SNPA 4LNQA 2IHEA 2ZM6H 4POGA 1S5CD 1E1TA 2F0KA 4P71A 2I07B 1CHQD 2Z8LA 1PXUA 2K03A 1GOZA 4A3MG 4ZOLF 3M4OH 3E0EA 4DV5Q 1HA6A 4A3DB 1EY7A 1ML0D 4JI7H 3P75A 1II3A 1OTCA 4OX9Q 1YEZA 4EYIB 5IYCH 3C3LA 4J9OA 4B3MQ 3GIPA 4A3LH 4EGJA 4ME3A 1M7JA 1VQJA 5DNFA 3SXHA 2MHVA 2R7ZG 4YR3A 4O3RA 5I6YA 1EWIA 4DV1H 2ATLA 1T94A 1STYA 1YNND 4OONA 1VBHA 5C44H 3CC4A 4IFDG 4IPGA 5KFVA 4H44C 4DR2H 3R23A 1J5EH 3F2BA 1FJGH 3U9OA 2VNUD 3I4NH 5JVLA 4LF6H 4ABNA 3QB3A 1S9FA 4TQRA 3M9NB 2ZJTA 4IHJF 4JBWA 2AWOA 3CXCA 2R3ZA 4IOCA 2FJ2A 3WO1A 4JCVE 4Y8VB 1C4QA 4GNXA 4EQOA 3K7UC 2ZTDA 2CW0C 1HQMC 4DR1L 3GIKA 4GLXA 3MR2A 5EKLA 1MD2D 3D8GA 5CMDA 5ELCA 4DNTB 3I4MH 1BQQT 3PF4A 4CGYB 3H6MA 5M9OA 3FDTA 1D7QA 3RB4A 2FPGB 3Q24A 1DM0B 5DG8A 5KFZA 5D14A 5FO7B 4ZLTF 5IWAH 5DG7A 4FXDA 3MXPA 3MFHA 4JV5H 1B6RA 1I7NA 4IR1A 3HOWB 3TQYA 2ZM6Q 1I5FA 4CJ2C 1TA8A 3RB0A 3KOJA 1EQQA 1G6ZA 4KY6A 4LF8H 1P8LA 3K58A 3J7AV 1BBXC 4JI7Q 1CA6A 5GAHC 1BBWA 5KFHA 1XJVA 2KEEA 4M9UA 3WO0A 1PH5A 1O75A 4B9XA 4J9SA 4QF4A 4HCSA 3J81c 1SROA 3R5FA 3ULJA 5GAEC 2QW7A 5IT9E 4KHVA 5CV7A 4EVOA 3L4KA 1N36L 4DV1Q 1I3QA 2EYFA 3Q8QB 2Q2HA 5LXTF 5C3XA 1B6SA 1V1OA 5KG7A 1LTBD 2BH8A 1TVXA 2DY7A 2KQ3A 4ECUA 4A3GG 4DR2Q 1S72A 2OQKA 4Y52H 1J5EQ 1E4EB 1WVLA 1FJGQ 5CA1F 4LF6Q 1J9OA 4YHHL 3HOWG 5IT9W 3I4OA 4DR3L 2UUCL 4I7AA 2UXCH 1STGA 4I55F 3K5LA 4ECXA 2PMZE 2B3GA 4X64H 5C4JH 5M5WB 4KD4A 2K33A 2N3SA 3D4DA 3OSPA 1X6OA 3NQTA 1GSAA 1CS0A 3I70A 1S0OA 1TXYA 3V2TA 2E2HH 1E2WA 1SN8A 5KG6A 2B39A 3CPFA 4QW8A 2NUCA 2LXKA 3M9BA 1IKLA 1O7YA 5JEAH 2F0GA 5IWAQ 2AQ1B 1PTOC 5COYA 3SEBA 2VR1A 3N52A 4E6IA 1OO9B 4JV5Q 4JI1L 4NXML 2AUJD 3HOYB 1IBML 1BCPB 1F9SA 4MV1A 5EZYF 5BPFA 1XMQH 1PH6A 4LF8Q 4A3CG 3PUYA 3QR8A 4FYDA 1RJPA 5CV6A 3GTOB 3TN2A 5ELOA 5ELEA 4ME6A 1XTCD 4XYQA 4EFEA 4QIWB 4EGVA 1U4LA 1PFNA 1MJCA 4DAVA 1BVSA 3LMLA 1JC7A 4PV1C 4DF7A 4U7CA 1TWAB 4IPHA 2OXPA 5ELNA 2R7MA 2W6PA 4LUOA 5LMUL 5C5JA 1EZ6A 2K1BA 4RGTA 1LT6D 1G2TA 4UCRA 4HNUA 2JE6I 1YNXA 1D1KA 2MP1A 3FHWA 2XCAA 4LFBH 1H9MA 3W3AA 1RK5A 1S5FD 2UXCQ 2D2CC 1K1QA 3SE7A 1EUJA 1OXUA 1U4PA 2SEBD 3WOFA 4X64Q 2Y0SE 2FINB 3IL8A 3HOUB 3PIP3 4DK0A 4MA0A 3ULPA 2OWOA 1LTLA 4QWDA 1S4ZA 4OO1I 3S17B 2JA6G 3TZDA 4NXNL 1XTDA 1GUOA 2I5LX 4FF2A 3MA2B 3JZIA 1KAWA 2NZOA 1HZCA 2VA3A 2R93H 3GTMB 3EVQA 5KNDA 3OW7A 1Z7TA 2KCMA 2FMAA 4B3SH 4MTEA 1XMQQ 2KENA 1WTXA 1WCMA 2B2VC 5IODA 1N34H 4UHVA 1CKMA 1LTSD 4K5XA 2DIKA 3HS0C 2NN6H 3CCRA 2RDHA 2C22A 1SJED 2OEOA 1MIUA 1Y1VB 3PUVA 4ZUJA 3UDIA 2WIIB 4ECTA 1F2ZA 3PO2B 3VYRA 2B63G 3HOUG 2BCOA 1E4EA 3PW4A 1STNA 4LMYA 4GOPC 4GKKL 4A3EH 1KJIA 4JVZA 3TRZA 1E24A 3NENA 3S1NB 4LSXA 3W2DA 3K6OA 5LMNQ 4UPAA 1HR0L 2VUMG 3DWPA 1EYCA 1I4GA 2K5NA 1BNZA 2NUAB 4GKJH 5C1PA 3A5UA 2C00A 3N6RA 1OXSC 4C2MB 1PTOH 5IP7H 5FPOA 1STEA 2Z0SA 1Z2NX 4JI8L 2QEJC 3HBLA 3GTQH 2JA7B 2XVSA 4PDBA 1F9PA 5LP6F 2Z9HA 4DFAA 5D1OA 1PYSB 4DV4L 3KUPA 3EPIA 2XWJB 1Y1VG 4QWBA 3VR2A 1CFMA 1PH8A 3PO2G 1CI3M 3BS1A 4R8UB 4ECYA 2HGSA 3UQ8A 2R84A 4Q43A 1W96A 1W93A 5BR8H 1HCZA 4YY3Q 2V4QA 2G5DA 1FVIA 1Q7YC 3GTOA 3T56B 1Q82C 5KT6A 3E9IA 5ELFA 1K8OA 2R86A 4CKCA 4B3SQ 2TSSA 4QIWA 4DUZL 2W7OA 4RNNA 2EE1A 3FP9A 1K8GA 1N34Q 2EY1A 3VA5A 3LP8A 5D1PA 4ED7A 3T1YH 3J7A5 1EIYB 2VQFL 1DIKA 2H4OA 4EBEA 2JA7G 4R1JA 3CRLC 1UEAB 1D1IA 2DNEA 1YBYA 1K1SA 4XYMB 5KFUA 2K14A 4B08A 2XNAC 1RKNA 3EJIA 2J7ZA 2IX0A 3F1ZA 2IPKD 3NEMA 5FLXL 1SYFA 1XNRH 5E3FA 2WFWA 4EQPA 5L1KA 2E5LL 3K8AA 2E75C 4GKJQ 2QYZA 3LX0A 1HQRD 5KG1A 3I2ZA 2E2IH 5M3MH 4ODGA 1HNWH 4YWKA 1GSOA 4ZQIA 1ET6A 2PPBC 5BMVF 2Z6KA 2W9CB 2SDFA 3NUCA 1NUCA 3PO3G 4RCOA 3ZYYX 3ND8A 3GO5A 1VMCA 4A3FB 3CRKC 2R92H 4OXPA 1B53A 5TSSA 3U58A 2NU6B 2PI2E 1ZQ7A 3FMAA 3RTXA 3ETJA 3WOEA 3GTMA 1VS0A 4X66L 1SCUB 1GSHA 2C5CA 1ICFB 1ESRA 1WTWA 2XIGA 2ZJPA 2JYOA 5BR8Q 3M4OB 1EY0A 4RHRA 1N32Q 2L12A 4JYAH 2XRQD 3DWAA 2J0TD 5IYBG 1JCKB 1QVCA 4KJOA 1K0RA 4MV6A 2M2LA 5JEAJ 2Z6BA 4OIKA 2KCNA 2QGQA 4HTHA 5KIXA 1EOTA 5A2QL 2M05A 4EQNA 4ZHQF 3DXJC 1UE6A 3T1YQ 2JEJA 4TQSA 4J15A 4A3IH 2C9OA 1DONA 4K0KL 2QDLA 2PW5A 4FU0A 3RGXA 2SNMA 1QVFA 3RZOB 1IYJB 3KAKA 5FJ8H 4MV9A 1D2BA 1XNRQ 2KA7A 2VZAA 1B9MA 5EBCA 1SNOA 2JA7A 1U4RA 1HNXL 4HJ7A 4C1NK 5KFMA 2E76C 2ASBA 4EQ5A 3BU2A 3KAJA 1BBUA 3TP6A 1HNWQ 4J8QA 4AYBE 4DR5H 3A55A 3N41B 2K5WA 4HMIA 2W6OA 4DR7H 5IYCG 3RZDH 2R7NA 3CCUA 4R8UA 1AE2A 2ICIA 4A3LG 3OTOH 3Q0AA 2KSWA 3RV3A 3MZ5A 3H20A 2KJXA 3NTIA 3S1MH 4DXFA 3JRXA 1SNCA 5D3IB 2Q2UA 2L9HA 1H9RA 5C44G 2IMWP 3KHHA 1KEEA 2BDNA 1TWCH 2JA5B 4DR4L 1F9QA 2AGQA 3D6WA 2LY7A 5C5LA 3EPGA 4JYAQ 1I4QA 2GPWA 3I4NG 3K3VA 2UUAL 1DGSA 4CHTB 1KJJA 4GC7A 1HUMA 2WV6D 1A2TA 2Z4HA 1PH2A 4UP8A 3S24A 1F2YA 1S97A 1QILA 3SK6A 1KDAA 1K8AC 4JV0A 4DGZA 5DM73 1ZETA 4R4QA 2Z4IA 1S5BD 4GN4B 1VQHA 2F03A 5J2UF 4R4IA 1C3OA 2EXZA 3I4MG 1M0WA 5FOBB 4BBSH 1E2ZA 1EEFD 2IT1A 2A8VA 2A73B 3OUZA 2KHSA 1E2VA 2A69C 1TWHA 4RH6A 1DOLA 4PG3A 2F3VA 1VQOA 1HJPA 3VPDA 2W9CA 4UCUA 2K50A 3GQCA 3V6HA 1EWHA 1S03G 4LJZC 4F8MA 2HVQA 5DAUA 5KT2A 4CDDC 3CCLA 1I4PA 5IYZF 4DR5Q 3QOLA 1N33H 2YU9B 4N8FA 1UC8A 3ETHA 2FXQA 4UP7A 1X65A 4DR7Q 3BDLA 2C2DA 3EROA 3M4PA 2E2HB 4KI0A 1B33N 3OTOQ 4ED8A 2HDMA 1YJWA 4DV0L 2R61A 3Q8RB 1VKZA 2JEIA 2YRXA 4HIKA 4H0LC 2NZ1D 1A6XA 1A9XA 5CYUA 3DEPA 5KT5A 4ED2A 4Q0FA 4BY1H 1R9TB 4IOAA 3DHQA 2HVRA 2VY3A 4PMCA 4DV6H 1IZ6A 3S16B 1PRTD 2PYKA 3P20A 1KRSA 2NVTH 3IG0A 2DPIA 2K5DA 4M8AA 4MTKA 2IY5B 1VQFA 5CV4A 1YNNC 5I47A 3BDCA 4MA5A 2NVXB 2W6MA 2WP8J 4YCVA 4K8IA 4BA2I 5FD5A 3KF8B 4K14A 2Y0SB 1C30A 1UUPA 3RFCA 1Y69U 4QL5A 3MXNA 2DJGC 4G57A 3D4WA 4A93H 3S1RH 1E4GT 3HKZE 5KFKA 1LT4D 3MAQA 3CF5A 2FP4B 5JEAG 4HJ5A 4LAAA 3SK4A 3MR5A 4XQJA 2OLSA 1HNZH 4Q8FA 4C3JH 5JVG3 2RHSB 2MPMA 3TZUA 4JBMA 3IKJA 2F0OA 1GVPA 4KN4C 4DNIA 5H1SE 4HYKA 4FM9A 3G7LA 1HPCA 5KNCA 1IBKH 2FK3A 3H0GH 2F0DA 2D0OA 3VA7A 4OEMB 1MI2A 2EZVA 1N33Q 4TRDA 3I12A 2CHBD 3HRZC 3AFPA 1K83H 2GVAA 3CVZA 3EYYA 5KX5F 4MTDA 2JA5A 3AFQA 1JE5A 2BE5D 1CSPA 3P1HA 1Q1EA 3MFGA 2C35B 1LABA 2Y0SG 4TV8F 1TS3A 1KQSA 1E0BA 1JWUD 1K8MA 4BY7B 1H95A 5IGDA 1T36A 1I6VC 4KKUA 2YCHA 2LMCB 4LUVA 3I55A 3Q8PB 1IL8A 5EBDA 4F87A 1QUQA 4DV6Q 1X3QA 1EU3A 2NU8B 4FBTA 1FNUA 4FXKC 1IOVA 2ASJA 4DV5L 2FK2A 4WBNF 3M9OB 4S3SA 4RKLA 4JPBW 4C56C 1RJRA 4J0MA 1SNMA 4OX9L 5KFBA 3GV8B 3TINA 1PFSA 4MTNA 2VUGA 1SFOH 1KDBA 1K0SA 2C28A 2PQAA 5C4HA 2F0EA 3AQQA 1ZHQA 2K6AA 5EJWA 4IUTA 1S40A 5C0XH 2P5ZX 4A3EB 5K36H 1NE3A 3C1FA 4EGQA 3G6VA 3CD6A 1AUXA 2YTVA 2HIXA 5E4WC 5DQHA 4B3RH 1SNQA 4DV7H 2XD4A 1X3FA 1EYDA 5J3BA 1KLUD 3GTLB 1KL9A 1PH7A 1ILPA 1HNZQ 3H4BA 2R93G 2YU9A 3RB6A 1GHJA 4O3SA 3RUZA 1KHIA 3GLKA 1PTOB 4DK1A 4FVMA 1IBKQ 3NSWA 3FDSA 1U9RA 1RF2D 3T5LA 2E2HA 2EYMA 3GTQB 1YI2A 1MBYA 1V51A 3PIPA 5EOYA 1F2LA 1SE4A 2NVYH 3U50C 4RCNA 2K28A 5M5YH 2NN6G 2R7LA 4F4WA 1R9TA 4A3MB 3BDOA 5LYJF 4A4IA 1VBGA 1X32A 3M3YB 4O0AA 4A3EG 4RFBA 2LS01 5JJKA 3DM3A 3R5XA 2JA8H 1IYVA 3PUZA 1QCBD 2NBFA 1WSCA 3U4ZA 2NVXA 5CBEE 5DG9A 4IZOA 1XWEA 3GD7A 3KF8A 2M9VA 2EY5A 4IRKA 2QILA 2UXDL 2UVWA 2DZDA 2XC9A 2F4VH 4ZYSA 1PYBA 5IP7G 1IOWA 2OH2A 1SSOA 2I5MX 3NBIA 1GUWA 1B8AA 3E3XA 1XX8A 3AEVA 2F0IA 3NXWA 3MFYA 2I87A 3VR3A 5KT3A 3RR5A 3K7AH 2WKCA 2J6SA 1TR5A 2ES2A 3HGBA 3CC7A 1Z9FA 3A56A 5AJ3Q 4JBJA 4CKEA 3IN5A 4MHEA 1SDFA 3J80L 4B3RQ 1EY4A 3S14H 4DV7Q 5D8DA 2AQ3B 1S0MA 3S2DH 5CR3A 3E6ZX 4LSAA 4OWTB 2RCNA 3SK5A 3MWDA 4HMJA 4DR2L 2E74C 4IUNA 2E2IB 1J5EL 4JW0A 1FJGL 3CHBD 4ECZA 2UXBL 2LSSA 1I4XA 1X3EA 5I4DA 2F0WA 1D5ZC 5L1LA 5EWFA 2RA4A 2F0QA 1S5DD 3HOZH 1A0IA 1BCPF 4J9MA 4JI0H 1M4VA 2NVQB 2B2YC 1VQ7A 2GPSA 5DM63 4CJ1B 2O2LD 2X6LA 2QA4A 1OWTA 2WB1E 1N9WA 3FPPA 1UC9A 4Y7NB 4B3TL 2KUMA 2EJMA 4G7OC 3J7YW 5IWAL 4X62H 3ONAB 1JLLB 5HV6A 3E5NA 2K04A 1VMPA 1WD0A 3PSIA 1MHWC 3SDZA 4YCUA 5M3MG 5FLMH 1GM5A 4LF8L 2F4VQ 1FNVA 1LV9A 4IUPA 1LO5D 1MKHA 4DUYL 1CQFA 2RQXA 5HGQA 3GTJH 3OUUA 4J9NA 1GO3E 3TIGA 4O2AF 3GTKA 4A3GB 5JPNC 3LWUA 2R92G 3GTLA 2I5HA 1TWGB 5H80A 4M7EA 1E4FT 1VQMA 3H4DA 4BWSC 4PZ6A 1KNEA 1ET9A 5M5XH 1VQCA 4KKSA 3ULLA 2ZTEA 5KG2A 2B8FA 1RYSA 2GVBA 4C5AA 1I50B 4J9QA 3GIJA 4HSVA 2IWHA 1Z47A 2HT1A 1CA5A 2UUBH 4JI6H 3BG5A 2UXCL 1FR3A 5DLQE 2K32A 2CZGA 3OIPA 4X64L 3L7ZC 1SYBA 2J4XA 1N56A 2R7DA 4AYBG 4JI0Q 5KFOA 3RIZA 4DR1H 3S1MB 1KJQA 4DL5A 2WAQB 5T14A 4O2DA 4A3IG 4P75A 3I56A 1LT3D 4HR7B 4MIUA 4QWEA 4GS3A 3CCVA 3CCJA 2R7ZA 3ZJYC 5CGKA 3J7AF 5FJ8G 4X62Q 3R2TA 4F4XA 5C6AA 1TKWB 4BXXH 1IKMA 1Y8OB 1WTPA 2B2TA 1BXTA 2CH4A 5KKNB 1RHPA 3PW5A 2L5TA 4ED6A 2CVRA 2F0HA 2MO0A 2CWPA 2SCUB 2QKIC 4O4LF 3Q8DA 2PQEA 4CBVA 2VQDA 2CFMA 3LWBA 2F0TA 3K0YA 1DV2A 1GHKA 4RNMA 4KHPH 3W1BA 5LA6F 3I8ZA 4R4CA 1HZAA 4LF7L 3L4JA 3BJYA 2C2RA 2OT2A 4HIMA 5GAGC 4C5CA 2WAQG 4GLVB 1PMRA 3H15A 3RBEA 1A63A 4C3IG 3RLFA 3DEOA 1W6KA 3FEWX 2AKWB 4NB3A 5LMNL 5CBAE 1IYUA 4KN7C 4HJ9A 1PV4A 1DCZA 2JQOA 5C0XJ 5KFWA 3PR5B 3UI2A 3DUZA 5KG0A 1TS5A 4LFCH 4IN3A 4RMFA 5BN4A 1DYQA 2UUBQ 2ASDA 4JI6Q 2JA6B 4NDXA 4DXGA 1CUKA 1CK1A 1WTHA 4A76A 5KEEA 3JRWA 1ESFA 1ZKOA 2LXJA 1JOOA 5GROA 5KFDA 4DR1Q 1KD1C 1B7YB 5KG4A 2D62A 4CDEC 1CE8A 3TQ1A 1JB7A 2B29A 3A74A 5CV9A 4BBSG 1M0TA 5KYIA 5EWEA 1QZHA 1FD7D 4J9PA 4UAIA 4QUFA 2AGOA 1K9MC 1IHZA 4H02A 1ILQA 1GUNA 1WTQA 1JMCA 1U0LA 1BOSA 1HTLD 2NVTB 4YY3L 3GIMA 2NB0A 3K5OA 3BA9A 4DAYB 4DL6A 4JI1H 1B3AA 4NXMH 2B63B 3X3MA 4B3SL 3CCMA 4Z9CB 1ENAA 2VL6A 5FKAC 1IBMH 3KLRA 1TWGA 4ULLA 5KRUA 3C2PA 2Q8TA 4TUYF 4L5QA 4NPSA 5EWGA 1EIGA 1V9PA 4KHPQ 2YL2A 3CQZB 2VUMB 3L9AX 4DR6L 3KTMA 4QQBX 1GD7A 5J22A 4GC6A 1AFPA 1I50A 4TV9F 3TS0A 2CCZA 3H94A 1S5ED 4HAEA 2F52A 4PWQA 1TWFB 2PW7A 1YJ9A 3AB9A 4BY1G 2DWCA 3K5HA 4X6AH 2ALYB 5LMUH 1Q81C 3OHXC 3H0GB 4GKJL 1CQJB 4A75A 3NWSA 4LF9L 4LFCQ 3V6KA 3O13A 3AMUA 3J81L 5T1GA 4HR7A 1B4OA 3P7JA 1CHPD 2R87A 1CKNB 2F1MA 1EFID 3OPOA 1NR4A 2KCTA 5E4XA 1KNAA 2L0CA 2L15A 3AYHB 2YZNA 3KDFB 1AE3A 5IP9G 4A93G 4V0BA 1X56A 1PH9A 2YS7A 3K5IA 2A6HD 3H3VI 3ER0A 3F8TA 3S1QH 1LUZA 2HHHH 3PVXA 2FMCA 4P74A 2V4DA 1CKOA 4DV3H 4DN4M 1F2MA 4LFBQ 4ECWA 1O7ZA 2PZUA 4ZKCB 4NLGA 2PO4A 4C3JG 1N32L 4JC0A
chains in the Genus database with same CATH topology
1YITA 4GNXB 1TWCH 4LUZA 1M90C 4DR4L 2UXDQ 1CSQA 4JI1Q 4A3JH 4NXMQ 2K5HA 3H0GG 4JYAQ 1IBMQ 2UU9Q 3I4NG 4KHPL 2UUAL 1T9HA 3E9HA 1DGSA 1G291 3H3VH 1UE1A 1E7ZA 1Q1BA 1EYGA 1PH2A 4UP8A 3S24A 4OWWB 3KF6B 2D0PA 5JJIA 3GDEA 4TVAB 3HOXG 1K8AC 4JI3L 4WJ4A 5GADC 4R4QA 4GN4B 4BY7G 1XMQL 4YCWA 1VQHA 3STBC 3PO3H 4R4IA 1VCIA 5C3EH 1PH4A 1VQ5A 3GTPH 3I4MG 3CCSA 2PI2A 4DAMA 1YIJA 1SLJA 1WYDA 4BBSH 2IT1A 1X54A 4AQYL 1XNRL 1OXVA 1QVGA 4ALPA 3L2PA 2A8VA 2UXBQ 4LFCL 5LMUQ 4GNXC 1E1OA 4UY8C 3J81j 4PG3A 1VQOA 1HJPA 2YV5A 3JAMc 2K50A 1SRUA 3OW2A 4PZ8A 3HOVG 1I3QH 4GLAC 4UP9A 2YU9H 1I6HH 1YHQA 3CCLA 5IYBH 2EIFA 4DR5Q 3PUXA 4APVA 2FXQA 3PV0A 4L5TA 4UP7A 1X65A 4DR7Q 5C0XG 4B3TQ 5K36G 4A3BG 2K4KA 3PGZA 1WCMG 3M4PA 1Y1WH 1PVOA 4KI0A 4LFBL 3KYHC 4R4OA 3OTOQ 2E2JH 1VQKA 4JI0L 1YJWA 4DV0L 1VQNA 2HHHQ 3CC2A 2DUDA 4DV3Q 4HJAA 1L1OC 4HIKA 3PF5A 1R9TH 5C4XG 1ASYA 2UU9L 4LF5Q 1U5KA 4BA1I 2YTXA 4MZ9A 4GOPA 4BY1H 3S16H 1WJJA 3UDGA 4IOAA 1L0WA 2K5VA 2VY3A 5E7NA 2JJQA 1IZ6A 1VQAA 4DUYQ 2QEXA 4LNQA 2IHEA 1KRSA 2NVTH 4POGA 2GN5A 1E1TA 2NVXH 2ZJQA 1VQFA 4P71A 1HR0W 4A3DH 2IY5B 3S15H 4A3MG 3M4OH 3E0EA 2PNHA 4DV5Q 3TS2A 4R4TA 1NMGA 2OQ0A 1L2FA 2ZJRA 2WP8J 4YCVA 3A0JA 2VW9A 2VQEL 4BA2I 5FLXc 3KF8B 1OTCA 4OX9Q 4HJ8A 1M1KC 4QL5A 1YEZA 4MNOA 4HIOA 4LF4Q 5IYCH 2Q2TA 4B3MQ 1N34L 4A93H 3S1RH 2JA8G 3HKZE 3I7FA 1XNQQ 4A3LH 4ME3A 2RF4A 1VQJA 3CF5A 2R7ZG 5JEAG 4DV2Q 4HJ5A 3HKSA 1CKNA 1EWIA 1EFWA 4WJ3M 1HR0Q 4OONA 3BJUA 1VQ8A 5C44H 4C3JH 4A3KH 2RHSB 3HOYG 4YWLA 3CC4A 4JBMA 4IFDG 1GVPA 2YTYA 4IPGA 4DNIA 5H1SE 4DR5L 1E3PA 2BA0A 1QZGA 3RNUA 1N36Q 4RG1A 3H0GH 3F2BA 4JI8Q 3HKZG 4DR7L 2D0OA 3I4NH 2VNUD 2I0QA 4GN5A 3KFUA 1N33Q 4JBWA 2AWOA 3AFPA 3L0OA 3CXCA 4IOCA 1K83H 2HHHL 3T1HL 2GVAA 3NELA 4JCVE 4DV4Q 4JI2L 1XPUA 4DV3L 2HQLA 3HOXH 4GNXA 4YHHQ 3K7UC 2ZTDA 3AFQA 1JE5A 1CSPA 4DR1L 4DR3Q 4JI4L 1VQ6A 1Q1EA 3CP0A 2C35B 2WB1G 2Y0SG 4GLXA 1KQSA 3CCQA 3K0XA 4P72A 2UUCQ 4LF5L 3LGJA 1H95A 3I4MH 3PF4A 3JC66 3I55A 4LUVA 1D7QA 1QUQA 5LMNW 4DK3C 5C0XI 4DV6Q 2JA9A 1PH3A 5GQOA 4DV5L 4DUZQ 3HOZG 3TQYA 2ZM6Q 3F2CA 2OTLA 1I5FA 4LF7Q 4C3IH 3KOJA 1EQQA 1KC8C 4OX9L 3J7ZC 4LF4L 2N78A 1P8LA 1PFSA 4MTNA 4JI7Q 1SFOH 5GAHC 2PQAA 1XNQL 1BBWA 3AQQA 5IYDG 1XJVA 1PH5A 1S40A 4DV2L 3J80i 1NE3A 3GTKH 4A3BH 1WCMH 3T1YL 3CD6A 4Y52H 1LYLA 3J81c 1SROA 2YTVA 1B70B 2HIXA 3ULJA 5GAEC 3GTLH 4IJLA 1FGUA 1X3FA 1N36L 3WWVA 4DV1Q 5J3BA 1KL9A 4QGUA 2Q2HA 1PH7A 5C4XH 1XPOA 2N8NA 1HNZQ 5FLMG 2R93G 2AWNA 2BH8A 3K81C 1KHIA 2EXDA 1E22A 4JOIA 4DR2Q 1IBKQ 1S72A 2OQKA 4A3GG 5EAYA 3PCOB 4PZ7A 3UDXA 1NY4A 1L1OB 3PIPA 1VQPA 1YI2A 1J5EQ 4LF6Q 3TREA 1FJGQ 4YHHL 2KHJA 3HOWG 1YZ6A 1RIPA 2NVYH 3I4OA 3U50C 3M85A 4DR3L 1I94L 2UUCL 5M5YH 4OO1G 2NN6G 4DK6C 4A3MH 1HNWL 1K3RA 2PMZE 2B3GA 3CMEA 5C4JH 3M3YH 3W5OA 2N3SA 3STBD 1X6OA 4A4IA 1VQ4A 4POFA 1IBLQ 1G6PA 4O0AA 1WFQA 4A3EG 5JJKA 3DM3A 4DV6L 1TXYA 2E2HH 2JA8H 1SN8A 2HIVA 1VQ9A 3CPFA 1VQLA 1WI5A 3PUZA 1A8VA 1VQGA 5HY6A 2LXKA 3M9BA 1YJNA 4JBKA 2R7ZH 3U4ZA 2R7FA 5IWAQ 2OTJA 3GD7A 4JV5Q 3HOYH 2KBNA 2UXDL 1SE8A 1SMXA 4YWMA 4TQUS 4JI1L 4NXNQ 1PYBA 5IP7G 4NXML 5C44G 4DR6Q 4JYAL 1RL2A 2I5MX 1IBML 1B8AA 3AEVA 1PH6A 4LF8Q 3M7NA 3KJOA 1D8LA 3GTOH 4A3CG 4KLKA 4OWXB 3PUYA 1Q86C 1BKBA 2MNAA 3RR5A 3K7AH 4K0KQ 2ES2A 1V1QA 5ELOA 4JI5Q 3CC7A 1Z9FA 5AJ3Q 4JBJA 2AMCB 3FKIG 3UE1A 3CPWA 4BXXG 4B3RQ 1MJCA 3S14H 4IPCA 4DV7Q 1BVSA 3S2DH 1XMOQ 4OWTB 4LF9Q 1OXXK 2N49A 2RCNA 3M4QA 4IPHA 4DR2L 2AHOB 5ELNA 1IBKL 1ASZA 1J5EL 2BH2A 3ICEA 2ID0A 1FJGL 2Q2IA 4XTCS 4LUOA 2UXBL 1NBWA 5IP9H 2LSSA 5LMUL 1X3EA 4QJFA 5C3EG 1YVCA 1X9NA 4GKKQ 4KHZA 2NZHA 2JE6I 1YNXA 2NVQH 4QIWE 3HOZH 1A0IA 3FHWA 4XIGS 1Q46A 1WOCA 1X3GA 2EQSA 2UXCQ 1VQ7A 3BZKA 1IBLL 1EUJA 1OXUA 3KDFA 4Y7NH 1N8RC 2QA4A 2WB1E 3G48A 2Y0SE 4X64Q 1N9WA 4IO9A 4B3TL 3OYYA 5IYDH 3MEFA 3ULPA 2OWOA 1LTLA 3OTOL 4DR4Q 4P73A 5IWAL 1O7IA 3J80c 4OO1I 2JA6G 1MJEA 4NXNL 1NMFA 1Y1WG 1XTDA 3GTMH 3PSIA 1EIFA 2I5LX 1J6QA 1KAWA 2NZOA 1HZCA 5M3MG 4YCUA 2R93H 5FLMH 4GN3B 1GM5A 4L5RC 4LF8L 2F4VQ 4JI3Q 1MKHA 4DUYL 4A3GH 2KCMA 1UE7A 5HGQA 3GTJH 1C0AA 1XMQQ 4A3FG 1GO3E 1IXRA 2KENA 3KF6A 4JI5L 1TWGH 3D31A 1Q12A 3HOWH 1NJIC 1CKMA 2JK8A 3SGIA 2R92G 4B3RL 3K80C 2I5HA 4DV7L 3MXNB 1VQMA 4DKAC 3CCRA 1XMOL 1S3OA 4PZ6A 1MIUA 2ZTCA 3PUVA 3UDIA 5IY0A 3HOVH 2B63G 5M5XH 2Z6KC 2VQFQ 1VQCA 1PHJA 3HOUG 1L1OA 4B3ML 3S1NH 4GOPC 3U4VA 1I50H 2ZTEA 3ULLA 4A3EH 4GKKL 3NBHB 1KRTA 3KLWA 1V43A 2GVBA 5M3FG 4HIDA 3TRZA 1E24A 3NENA 1K73C 2IX1A 4AH6A 1NTGA 1W2BA 5LMNQ 1Z47A 2IHFA 1X55A 4UPAA 1HR0L 2HT1A 2VUMG 3CMAA 2K5NA 1Q8KA 2UXCL 5DLQE 3A5UA 1UEBA 2VS1A 5IE8A 3KJPA 1OXSC 2E5LQ 2ATWA 4X64L 3L7ZC 5IP7H 1YHAA 2R7DA 2Z0SA 4AYBG 4JI8L 3G4SA 4JI0Q 4DV0Q 3CAMA 1IL2A 1VQBA 3GTQH 4JG2A 3EN2A 3S2HH 4O2DA 4A3IG 4P75A 1N33L 3PIOA 4A3CH 2CKZB 4BBRG 3I56A 4GS3A 3CCVA 2A19A 1PYSB 4DV4L 3CCJA 3ZJYC 2F3IA 1UE5A 1Y1VG 5FJ8G 4X62Q 3FKIH 1PH8A 5M5WH 3PO2G 3B6YA 3GTGH 4BXXH 1QUQB 3HFZB 3RLOA 2F4VL 4IFDI 3G71A 4X66Q 3EBEA 4X65Q 1KIXA 1JJCB 2WAQE 2A1AA 4IJHA 4LFAQ 2MO0A 1FVIA 4YY3Q 1Q7YC 2CWPA 4AIMA 1OXTA 3Q8DA 1Q82C 1PH1A 3E9IA 2CFMA 3PUWA 2CQOA 2VQEQ 4B3SQ 4DUZL 2R6GA 3W1BA 2ZM6L 2MO1A 4R4CA 1HZAA 3FP9A 1K8GA 1C7YA 4LF7L 1N34Q 2PQAB 4BY7H 3J7A5 1EIYB 3A5ZB 1HH2P 2VQFL 1AH9A 2MFIA 4HIMA 5GAGC 2JA7G 1LM0A 2WAQG 4R1JA 4GLVB 4JI7L 3H15A 2JA5G 3DLLA 1A63A 3RLFA 1YBYA 3G6EA 2AKWB 4NB3A 2K14A 2E8GA 1P16A 5LMNL 4HJ9A 4A3JG 4JI4Q 1PV4A 2IX0A 2JQOA 3F1ZA 3NEMA 5C0XJ 1KXLA 2WFWA 3J81i 1FL0A 3F2DA 2E5LL 2JA6H 4DV1L 4RMFA 2MQHA 3K8AA 3RLNA 1HNZL 2UUBQ 4GKJQ 4JI6Q 1TWAH 1TWHH 3I2ZA 2E2IH 5M3MH 3T1HQ 4LW1A 4JI2Q 1CUKA 4YWKA 4A76A 1HNXQ 1EOVA 2LXJA 5GROA 2Z6KA 4DR1Q 3PO3G 1C9OA 1B7YB 1XPRA 2D62A 4A3FH 1KD1C 4LF6L 1JB7A 2B29A 3A74A 4BBSG 4X62L 3GO5A 1QZHA 2JEAI 2R92H 4OXPA 3U58A 3RN5A 2PI2E 1K9MC 4H02A 1VS0A 2RHQB 3EIVA 4X66L 3JAMi 1JMCA 4X65L 1U0LA 2JEBI 4LFAL 4YY3L 2B63H 3HOUH 2ZJPA 1VQDA 4DAYB 1JT8A 5BR8Q 4JOIC 3CCMA 5M3FH 3D0FA 4B3SL 2VL6A 2K52A 1N32Q 5IYBG 1QVCA 3S17H 1K0RA 3RN2A 3CQZH 2VUMH 4L5QA 4NPSA 5JEAJ 3ERSX 4DPGA 1YHBA 4GOPB 4JV5L 1V9PA 4KHPQ 2K75A 2QGQA 1A62A 2NN6I 1PA6A 2UUAQ 2H5XA 4L5SA 4DR6L 1G51A 3TEHB 3T1YQ 1UE6A 4QQBX 1GD7A 4EX5A 4IFDJ 1JJGA 2XTIA 2DGYA 1HZBA 4J15A 1TWFH 1W3SA 3IRBA 3TS0A 4A3IH 2CCZA 4QY7A 2F52A 4BBRH 3RZOH 4K0KL 5JJLA 4IPDA 1YJ9A 4BY1G 1VQEA 4X6AH 2ALYB 5AJ3L 1QVFA 2OCEA 2YYZA 1IYJB 1Y14B 1Q81C 2UUBL 1Y1VH 5FJ8H 4JI6L 4GKJL 4AQYQ 1XNRQ 4A75A 3PO2H 2VZAA 4C3HH 4LF9L 3VDYA 4LFCQ 1HNXL 4HJ7A 1EQRA 4A3DG 3BZCA 1UWVA 2ASBA 4EQ5A 3BU2A 1HZ9A 1BBUA 2V1CC 4PMWA 1CKNB 1HNWQ 3UDFA 4AYBE 1GKHA 2KCTA 3UE0A 5IT9c 2XGTA 4LWCA 2L15A 3AYHB 1VQIA 2BA1A 3KDFB 1AE3A 4FDBA 5IP9G 5IYCG 3RZDH 1JJ2A 1X56A 4A93G 3CCEA 3CCUA 1PH9A 1AE2A 3H3VI 4A3LG 3ER0A 1I94Q 4C2MH 3F8TA 3S1QH 1LUZA 3CW2C 4P74A 1CKOA 3S1MH 2JA7H 1SR3A 3W1GA 4LFBQ 2Q2UA 2KHIA 2JA5H 2CWAA 5BR8L 4A3KG 1N32L 4JC0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YIT A;  4GNX B;  1TWC H;  4LUZ A;  1M90 C;  4DR4 L;  2UXD Q;  1CSQ A;  4JI1 Q;  4A3J H;  4NXM Q;  2K5H A;  3H0G G;  4JYA Q;  1IBM Q;  2UU9 Q;  3I4N G;  4KHP L;  2UUA L;  1T9H A;  3E9H A;  1DGS A;  1G29 1;  3H3V H;  1UE1 A;  1E7Z A;  1Q1B A;  1EYG A;  1PH2 A;  4UP8 A;  3S24 A;  4OWW B;  3KF6 B;  2D0P A;  5JJI A;  3GDE A;  4TVA B;  3HOX G;  1K8A C;  4JI3 L;  4WJ4 A;  5GAD C;  4R4Q A;  4GN4 B;  4BY7 G;  1XMQ L;  4YCW A;  1VQH A;  3STB C;  3PO3 H;  4R4I A;  1VCI A;  5C3E H;  1PH4 A;  1VQ5 A;  3GTP H;  3I4M G;  3CCS A;  2PI2 A;  4DAM A;  1YIJ A;  1SLJ A;  1WYD A;  4BBS H;  2IT1 A;  1X54 A;  4AQY L;  1XNR L;  1OXV A;  1QVG A;  4ALP A;  3L2P A;  2A8V A;  2UXB Q;  4LFC L;  5LMU Q;  4GNX C;  1E1O A;  4UY8 C;  3J81 j;  4PG3 A;  1VQO A;  1HJP A;  2YV5 A;  3JAM c;  2K50 A;  1SRU A;  3OW2 A;  4PZ8 A;  3HOV G;  1I3Q H;  4GLA C;  4UP9 A;  2YU9 H;  1I6H H;  1YHQ A;  3CCL A;  5IYB H;  2EIF A;  4DR5 Q;  3PUX A;  4APV A;  2FXQ A;  3PV0 A;  4L5T A;  4UP7 A;  1X65 A;  4DR7 Q;  5C0X G;  4B3T Q;  5K36 G;  4A3B G;  2K4K A;  3PGZ A;  1WCM G;  3M4P A;  1Y1W H;  1PVO A;  4KI0 A;  4LFB L;  3KYH C;  4R4O A;  3OTO Q;  2E2J H;  1VQK A;  4JI0 L;  1YJW A;  4DV0 L;  1VQN A;  2HHH Q;  3CC2 A;  2DUD A;  4DV3 Q;  4HJA A;  1L1O C;  4HIK A;  3PF5 A;  1R9T H;  5C4X G;  1ASY A;  2UU9 L;  4LF5 Q;  1U5K A;  4BA1 I;  2YTX A;  4MZ9 A;  4GOP A;  4BY1 H;  3S16 H;  1WJJ A;  3UDG A;  4IOA A;  1L0W A;  2K5V A;  2VY3 A;  5E7N A;  2JJQ A;  1IZ6 A;  1VQA A;  4DUY Q;  2QEX A;  4LNQ A;  2IHE A;  1KRS A;  2NVT H;  4POG A;  2GN5 A;  1E1T A;  2NVX H;  2ZJQ A;  1VQF A;  4P71 A;  1HR0 W;  4A3D H;  2IY5 B;  3S15 H;  4A3M G;  3M4O H;  3E0E A;  2PNH A;  4DV5 Q;  3TS2 A;  4R4T A;  1NMG A;  2OQ0 A;  1L2F A;  2ZJR A;  2WP8 J;  4YCV A;  3A0J A;  2VW9 A;  2VQE L;  4BA2 I;  5FLX c;  3KF8 B;  1OTC A;  4OX9 Q;  4HJ8 A;  1M1K C;  4QL5 A;  1YEZ A;  4MNO A;  4HIO A;  4LF4 Q;  5IYC H;  2Q2T A;  4B3M Q;  1N34 L;  4A93 H;  3S1R H;  2JA8 G;  3HKZ E;  3I7F A;  1XNQ Q;  4A3L H;  4ME3 A;  2RF4 A;  1VQJ A;  3CF5 A;  2R7Z G;  5JEA G;  4DV2 Q;  4HJ5 A;  3HKS A;  1CKN A;  1EWI A;  1EFW A;  4WJ3 M;  1HR0 Q;  4OON A;  3BJU A;  1VQ8 A;  5C44 H;  4C3J H;  4A3K H;  2RHS B;  3HOY G;  4YWL A;  3CC4 A;  4JBM A;  4IFD G;  1GVP A;  2YTY A;  4IPG A;  4DNI A;  5H1S E;  4DR5 L;  1E3P A;  2BA0 A;  1QZG A;  3RNU A;  1N36 Q;  4RG1 A;  3H0G H;  3F2B A;  4JI8 Q;  3HKZ G;  4DR7 L;  2D0O A;  3I4N H;  2VNU D;  2I0Q A;  4GN5 A;  3KFU A;  1N33 Q;  4JBW A;  2AWO A;  3AFP A;  3L0O A;  3CXC A;  4IOC A;  1K83 H;  2HHH L;  3T1H L;  2GVA A;  3NEL A;  4JCV E;  4DV4 Q;  4JI2 L;  1XPU A;  4DV3 L;  2HQL A;  3HOX H;  4GNX A;  4YHH Q;  3K7U C;  2ZTD A;  3AFQ A;  1JE5 A;  1CSP A;  4DR1 L;  4DR3 Q;  4JI4 L;  1VQ6 A;  1Q1E A;  3CP0 A;  2C35 B;  2WB1 G;  2Y0S G;  4GLX A;  1KQS A;  3CCQ A;  3K0X A;  4P72 A;  2UUC Q;  4LF5 L;  3LGJ A;  1H95 A;  3I4M H;  3PF4 A;  3JC6 6;  3I55 A;  4LUV A;  1D7Q A;  1QUQ A;  5LMN W;  4DK3 C;  5C0X I;  4DV6 Q;  2JA9 A;  1PH3 A;  5GQO A;  4DV5 L;  4DUZ Q;  3HOZ G;  3TQY A;  2ZM6 Q;  3F2C A;  2OTL A;  1I5F A;  4LF7 Q;  4C3I H;  3KOJ A;  1EQQ A;  1KC8 C;  4OX9 L;  3J7Z C;  4LF4 L;  2N78 A;  1P8L A;  1PFS A;  4MTN A;  4JI7 Q;  1SFO H;  5GAH C;  2PQA A;  1XNQ L;  1BBW A;  3AQQ A;  5IYD G;  1XJV A;  1PH5 A;  1S40 A;  4DV2 L;  3J80 i;  1NE3 A;  3GTK H;  4A3B H;  1WCM H;  3T1Y L;  3CD6 A;  4Y52 H;  1LYL A;  3J81 c;  1SRO A;  2YTV A;  1B70 B;  2HIX A;  3ULJ A;  5GAE C;  3GTL H;  4IJL A;  1FGU A;  1X3F A;  1N36 L;  3WWV A;  4DV1 Q;  5J3B A;  1KL9 A;  4QGU A;  2Q2H A;  1PH7 A;  5C4X H;  1XPO A;  2N8N A;  1HNZ Q;  5FLM G;  2R93 G;  2AWN A;  2BH8 A;  3K81 C;  1KHI A;  2EXD A;  1E22 A;  4JOI A;  4DR2 Q;  1IBK Q;  1S72 A;  2OQK A;  4A3G G;  5EAY A;  3PCO B;  4PZ7 A;  3UDX A;  1NY4 A;  1L1O B;  3PIP A;  1VQP A;  1YI2 A;  1J5E Q;  4LF6 Q;  3TRE A;  1FJG Q;  4YHH L;  2KHJ A;  3HOW G;  1YZ6 A;  1RIP A;  2NVY H;  3I4O A;  3U50 C;  3M85 A;  4DR3 L;  1I94 L;  2UUC L;  5M5Y H;  4OO1 G;  2NN6 G;  4DK6 C;  4A3M H;  1HNW L;  1K3R A;  2PMZ E;  2B3G A;  3CME A;  5C4J H;  3M3Y H;  3W5O A;  2N3S A;  3STB D;  1X6O A;  4A4I A;  1VQ4 A;  4POF A;  1IBL Q;  1G6P A;  4O0A A;  1WFQ A;  4A3E G;  5JJK A;  3DM3 A;  4DV6 L;  1TXY A;  2E2H H;  2JA8 H;  1SN8 A;  2HIV A;  1VQ9 A;  3CPF A;  1VQL A;  1WI5 A;  3PUZ A;  1A8V A;  1VQG A;  5HY6 A;  2LXK A;  3M9B A;  1YJN A;  4JBK A;  2R7Z H;  3U4Z A;  2R7F A;  5IWA Q;  2OTJ A;  3GD7 A;  4JV5 Q;  3HOY H;  2KBN A;  2UXD L;  1SE8 A;  1SMX A;  4YWM A;  4TQU S;  4JI1 L;  4NXN Q;  1PYB A;  5IP7 G;  4NXM L;  5C44 G;  4DR6 Q;  4JYA L;  1RL2 A;  2I5M X;  1IBM L;  1B8A A;  3AEV A;  1PH6 A;  4LF8 Q;  3M7N A;  3KJO A;  1D8L A;  3GTO H;  4A3C G;  4KLK A;  4OWX B;  3PUY A;  1Q86 C;  1BKB A;  2MNA A;  3RR5 A;  3K7A H;  4K0K Q;  2ES2 A;  1V1Q A;  5ELO A;  4JI5 Q;  3CC7 A;  1Z9F A;  5AJ3 Q;  4JBJ A;  2AMC B;  3FKI G;  3UE1 A;  3CPW A;  4BXX G;  4B3R Q;  1MJC A;  3S14 H;  4IPC A;  4DV7 Q;  1BVS A;  3S2D H;  1XMO Q;  4OWT B;  4LF9 Q;  1OXX K;  2N49 A;  2RCN A;  3M4Q A;  4IPH A;  4DR2 L;  2AHO B;  5ELN A;  1IBK L;  1ASZ A;  1J5E L;  2BH2 A;  3ICE A;  2ID0 A;  1FJG L;  2Q2I A;  4XTC S;  4LUO A;  2UXB L;  1NBW A;  5IP9 H;  2LSS A;  5LMU L;  1X3E A;  4QJF A;  5C3E G;  1YVC A;  1X9N A;  4GKK Q;  4KHZ A;  2NZH A;  2JE6 I;  1YNX A;  2NVQ H;  4QIW E;  3HOZ H;  1A0I A;  3FHW A;  4XIG S;  1Q46 A;  1WOC A;  1X3G A;  2EQS A;  2UXC Q;  1VQ7 A;  3BZK A;  1IBL L;  1EUJ A;  1OXU A;  3KDF A;  4Y7N H;  1N8R C;  2QA4 A;  2WB1 E;  3G48 A;  2Y0S E;  4X64 Q;  1N9W A;  4IO9 A;  4B3T L;  3OYY A;  5IYD H;  3MEF A;  3ULP A;  2OWO A;  1LTL A;  3OTO L;  4DR4 Q;  4P73 A;  5IWA L;  1O7I A;  3J80 c;  4OO1 I;  2JA6 G;  1MJE A;  4NXN L;  1NMF A;  1Y1W G;  1XTD A;  3GTM H;  3PSI A;  1EIF A;  2I5L X;  1J6Q A;  1KAW A;  2NZO A;  1HZC A;  5M3M G;  4YCU A;  2R93 H;  5FLM H;  4GN3 B;  1GM5 A;  4L5R C;  4LF8 L;  2F4V Q;  4JI3 Q;  1MKH A;  4DUY L;  4A3G H;  2KCM A;  1UE7 A;  5HGQ A;  3GTJ H;  1C0A A;  1XMQ Q;  4A3F G;  1GO3 E;  1IXR A;  2KEN A;  3KF6 A;  4JI5 L;  1TWG H;  3D31 A;  1Q12 A;  3HOW H;  1NJI C;  1CKM A;  2JK8 A;  3SGI A;  2R92 G;  4B3R L;  3K80 C;  2I5H A;  4DV7 L;  3MXN B;  1VQM A;  4DKA C;  3CCR A;  1XMO L;  1S3O A;  4PZ6 A;  1MIU A;  2ZTC A;  3PUV A;  3UDI A;  5IY0 A;  3HOV H;  2B63 G;  5M5X H;  2Z6K C;  2VQF Q;  1VQC A;  1PHJ A;  3HOU G;  1L1O A;  4B3M L;  3S1N H;  4GOP C;  3U4V A;  1I50 H;  2ZTE A;  3ULL A;  4A3E H;  4GKK L;  3NBH B;  1KRT A;  3KLW A;  1V43 A;  2GVB A;  5M3F G;  4HID A;  3TRZ A;  1E24 A;  3NEN A;  1K73 C;  2IX1 A;  4AH6 A;  1NTG A;  1W2B A;  5LMN Q;  1Z47 A;  2IHF A;  1X55 A;  4UPA A;  1HR0 L;  2HT1 A;  2VUM G;  3CMA A;  2K5N A;  1Q8K A;  2UXC L;  5DLQ E;  3A5U A;  1UEB A;  2VS1 A;  5IE8 A;  3KJP A;  1OXS C;  2E5L Q;  2ATW A;  4X64 L;  3L7Z C;  5IP7 H;  1YHA A;  2R7D A;  2Z0S A;  4AYB G;  4JI8 L;  3G4S A;  4JI0 Q;  4DV0 Q;  3CAM A;  1IL2 A;  1VQB A;  3GTQ H;  4JG2 A;  3EN2 A;  3S2H H;  4O2D A;  4A3I G;  4P75 A;  1N33 L;  3PIO A;  4A3C H;  2CKZ B;  4BBR G;  3I56 A;  4GS3 A;  3CCV A;  2A19 A;  1PYS B;  4DV4 L;  3CCJ A;  3ZJY C;  2F3I A;  1UE5 A;  1Y1V G;  5FJ8 G;  4X62 Q;  3FKI H;  1PH8 A;  5M5W H;  3PO2 G;  3B6Y A;  3GTG H;  4BXX H;  1QUQ B;  3HFZ B;  3RLO A;  2F4V L;  4IFD I;  3G71 A;  4X66 Q;  3EBE A;  4X65 Q;  1KIX A;  1JJC B;  2WAQ E;  2A1A A;  4IJH A;  4LFA Q;  2MO0 A;  1FVI A;  4YY3 Q;  1Q7Y C;  2CWP A;  4AIM A;  1OXT A;  3Q8D A;  1Q82 C;  1PH1 A;  3E9I A;  2CFM A;  3PUW A;  2CQO A;  2VQE Q;  4B3S Q;  4DUZ L;  2R6G A;  3W1B A;  2ZM6 L;  2MO1 A;  4R4C A;  1HZA A;  3FP9 A;  1K8G A;  1C7Y A;  4LF7 L;  1N34 Q;  2PQA B;  4BY7 H;  3J7A 5;  1EIY B;  3A5Z B;  1HH2 P;  2VQF L;  1AH9 A;  2MFI A;  4HIM A;  5GAG C;  2JA7 G;  1LM0 A;  2WAQ G;  4R1J A;  4GLV B;  4JI7 L;  3H15 A;  2JA5 G;  3DLL A;  1A63 A;  3RLF A;  1YBY A;  3G6E A;  2AKW B;  4NB3 A;  2K14 A;  2E8G A;  1P16 A;  5LMN L;  4HJ9 A;  4A3J G;  4JI4 Q;  1PV4 A;  2IX0 A;  2JQO A;  3F1Z A;  3NEM A;  5C0X J;  1KXL A;  2WFW A;  3J81 i;  1FL0 A;  3F2D A;  2E5L L;  2JA6 H;  4DV1 L;  4RMF A;  2MQH A;  3K8A A;  3RLN A;  1HNZ L;  2UUB Q;  4GKJ Q;  4JI6 Q;  1TWA H;  1TWH H;  3I2Z A;  2E2I H;  5M3M H;  3T1H Q;  4LW1 A;  4JI2 Q;  1CUK A;  4YWK A;  4A76 A;  1HNX Q;  1EOV A;  2LXJ A;  5GRO A;  2Z6K A;  4DR1 Q;  3PO3 G;  1C9O A;  1B7Y B;  1XPR A;  2D62 A;  4A3F H;  1KD1 C;  4LF6 L;  1JB7 A;  2B29 A;  3A74 A;  4BBS G;  4X62 L;  3GO5 A;  1QZH A;  2JEA I;  2R92 H;  4OXP A;  3U58 A;  3RN5 A;  2PI2 E;  1K9M C;  4H02 A;  1VS0 A;  2RHQ B;  3EIV A;  4X66 L;  3JAM i;  1JMC A;  4X65 L;  1U0L A;  2JEB I;  4LFA L;  4YY3 L;  2B63 H;  3HOU H;  2ZJP A;  1VQD A;  4DAY B;  1JT8 A;  5BR8 Q;  4JOI C;  3CCM A;  5M3F H;  3D0F A;  4B3S L;  2VL6 A;  2K52 A;  1N32 Q;  5IYB G;  1QVC A;  3S17 H;  1K0R A;  3RN2 A;  3CQZ H;  2VUM H;  4L5Q A;  4NPS A;  5JEA J;  3ERS X;  4DPG A;  1YHB A;  4GOP B;  4JV5 L;  1V9P A;  4KHP Q;  2K75 A;  2QGQ A;  1A62 A;  2NN6 I;  1PA6 A;  2UUA Q;  2H5X A;  4L5S A;  4DR6 L;  1G51 A;  3TEH B;  3T1Y Q;  1UE6 A;  4QQB X;  1GD7 A;  4EX5 A;  4IFD J;  1JJG A;  2XTI A;  2DGY A;  1HZB A;  4J15 A;  1TWF H;  1W3S A;  3IRB A;  3TS0 A;  4A3I H;  2CCZ A;  4QY7 A;  2F52 A;  4BBR H;  3RZO H;  4K0K L;  5JJL A;  4IPD A;  1YJ9 A;  4BY1 G;  1VQE A;  4X6A H;  2ALY B;  5AJ3 L;  1QVF A;  2OCE A;  2YYZ A;  1IYJ B;  1Y14 B;  1Q81 C;  2UUB L;  1Y1V H;  5FJ8 H;  4JI6 L;  4GKJ L;  4AQY Q;  1XNR Q;  4A75 A;  3PO2 H;  2VZA A;  4C3H H;  4LF9 L;  3VDY A;  4LFC Q;  1HNX L;  4HJ7 A;  1EQR A;  4A3D G;  3BZC A;  1UWV A;  2ASB A;  4EQ5 A;  3BU2 A;  1HZ9 A;  1BBU A;  2V1C C;  4PMW A;  1CKN B;  1HNW Q;  3UDF A;  4AYB E;  1GKH A;  2KCT A;  3UE0 A;  5IT9 c;  2XGT A;  4LWC A;  2L15 A;  3AYH B;  1VQI A;  2BA1 A;  3KDF B;  1AE3 A;  4FDB A;  5IP9 G;  5IYC G;  3RZD H;  1JJ2 A;  1X56 A;  4A93 G;  3CCE A;  3CCU A;  1PH9 A;  1AE2 A;  3H3V I;  4A3L G;  3ER0 A;  1I94 Q;  4C2M H;  3F8T A;  3S1Q H;  1LUZ A;  3CW2 C;  4P74 A;  1CKO A;  3S1M H;  2JA7 H;  1SR3 A;  3W1G A;  4LFB Q;  2Q2U A;  2KHI A;  2JA5 H;  2CWA A;  5BR8 L;  4A3K G;  1N32 L;  4JC0 A; 
#chains in the Genus database with same CATH topology
 4LF5 H;  2BR0 A;  4HNT A;  5G3L D;  3JAM L;  1M90 C;  4CC5 A;  4JI1 Q;  4A3J H;  4NXM Q;  3BVM A;  3H0G G;  2AUK A;  1IBM Q;  2XGQ A;  1PLF A;  4X3T A;  1T9H A;  4IAJ A;  3QIA A;  2QF7 A;  1E7Z A;  1Q1B A;  2B2W C;  3KF6 B;  1JE4 A;  1EZ8 A;  4JI3 L;  1SYG A;  4YCW A;  1I4R A;  1NR2 A;  3STB C;  4LF4 H;  2V4R A;  1VQ5 A;  1BJT A;  5F9N A;  4QCL A;  5DGA A;  3PO3 B;  1XNQ H;  2WE6 A;  1XNR L;  3GTP B;  4ALP A;  3L2P A;  2SNS A;  4ECR A;  2JA6 A;  4DV2 H;  3I3C A;  3IFT A;  5LMU Q;  1B2T A;  3FMC A;  1TWA A;  1HR0 H;  1HXY D;  2O03 A;  1Z2O X;  3E5S A;  3V96 A;  2HDL A;  3GIL A;  3VPC A;  2NVY B;  1B04 A;  3T4A C;  1SRU A;  4PNY A;  3OW2 A;  3HOV G;  1I3Q H;  3F8N A;  4UP9 A;  2J9G A;  1KDC A;  3OWE B;  4XYO A;  3OHA A;  4JI8 H;  2EIF A;  2J6U A;  4RGN A;  3PUX A;  1O78 A;  1I6H B;  1KLG D;  4ZQ3 A;  2R7K A;  4CDF C;  1S10 A;  1PRT C;  3TDQ A;  5C0X G;  5K36 G;  4DV4 H;  1I6U A;  1L0X B;  1TY0 A;  1PVO A;  2OF1 A;  1GXD C;  2XCL A;  3KYH C;  4R4O A;  4LH7 A;  2W9A A;  4FO2 A;  2B63 A;  1I94 H;  1A15 A;  3T13 A;  4XX0 B;  1STA A;  2HHH Q;  1D6E C;  4U6P A;  1PZI D;  4DV3 Q;  4HJA A;  2NYZ D;  4Q0Y A;  4FS1 A;  5CV5 A;  1TS2 A;  4IUQ A;  4LF5 Q;  2FB9 A;  3V4Z A;  4JK1 C;  1WJJ A;  3CQZ A;  5E7N A;  2VUM A;  5BN5 A;  4WFN 3;  1I4H A;  3GP7 A;  2FLL A;  4F7X A;  5DLF A;  2WYO A;  4DUZ H;  1AP0 A;  4L63 B;  1UNN C;  1JB3 A;  4O1N A;  1HR0 W;  4A3D H;  1TWF A;  2PNH A;  3TS2 A;  1NMG A;  2OQ0 A;  1L2F A;  2HCC A;  2VXW A;  3URY A;  1BR9 A;  5KFL A;  2VW9 A;  2VQE L;  3S14 B;  3H0G A;  1M1K C;  2RBM A;  4LF4 Q;  4ZKB B;  1PX2 A;  2Q2T A;  4F4Z A;  1Y1V A;  2JA8 G;  3I7F A;  1XNQ Q;  1QG7 A;  4EYH B;  1EEI D;  1B50 A;  5I9P A;  4DV2 Q;  2C2E A;  4K8J A;  2G9D A;  3HKS A;  1CKN A;  1EFW A;  3C1E A;  4WJ3 M;  1L0Y B;  2BE5 C;  4OIJ A;  1HR0 Q;  3BJU A;  1JQY D;  1G8Z D;  3M9M B;  1A2U A;  4X3K A;  4JI4 L;  2YTY A;  1QZG A;  5T1I A;  4DR5 L;  5C44 B;  4MV3 A;  4JI8 Q;  4DR7 L;  2I0Q A;  4GN5 A;  3KFU A;  4Q44 A;  2DY8 A;  4C2M A;  3I4N B;  3C0F B;  3T1H L;  3NEL A;  4DV4 Q;  1AZP A;  4JI2 L;  3RF2 A;  3LNN A;  2HQL A;  3HOX H;  2W7P A;  4G7H C;  5FLX E;  3BA8 A;  4NMZ A;  4TKO B;  5L1I A;  1I94 Q;  3CP0 A;  2WB1 G;  4O2B F;  2XGP A;  4P72 A;  1GJX A;  5KFI A;  1IBL H;  4H13 C;  2IX3 A;  2AU0 A;  3JC6 6;  5K2M A;  2W6N A;  1HFG A;  5G3L F;  3PW0 A;  3T1H H;  5GON F;  3K5N A;  3I4M B;  4RHS A;  3QWN A;  4DK3 C;  3T5H A;  4IWY A;  3GTJ B;  3OSN A;  1EWC A;  1PH3 A;  5GQO A;  5FLX W;  4DUZ Q;  3HOZ G;  4U68 A;  3F2C A;  2OTL A;  4HCE A;  4C3I H;  4CKB A;  5FPR A;  4O42 A;  2AQ4 A;  4LK1 C;  1KC8 C;  1AEX A;  4XXE A;  3J7Z C;  4M1U B;  3GTP A;  4WD3 A;  4K0K H;  2Q8R E;  1W6J A;  4JI5 H;  1WCM H;  4I7H A;  3KHL A;  1LYL A;  2R82 A;  1B70 B;  1FYC A;  4YP3 A;  3FVQ A;  4ED1 A;  1XMO H;  1AW7 A;  2K7V A;  4J6H A;  5I6W A;  5BPH A;  2PMZ B;  4QGU A;  5C4X H;  5A2Q E;  5FLM G;  3K81 C;  2EXD A;  3IFD A;  4RKB A;  5KFX A;  1GLV A;  5DEH A;  3G6Y A;  4JOI A;  4KKT A;  5NUC A;  1JJG A;  4PZ7 A;  1VQP A;  1NY4 A;  1L1O B;  4QB4 A;  5C5M A;  3TRE A;  1QWY A;  5JVD F;  4XT1 B;  3TBI B;  2KHJ A;  1YZ6 A;  1RIP A;  3M85 A;  3R5H A;  2MGS A;  3IAY A;  2EY2 A;  4DK6 C;  2EPB A;  4IZ8 A;  5KFS A;  3BAB A;  1XDN A;  4YR0 A;  2O5I C;  3W5O A;  3STB D;  4IAL A;  1SYE A;  2F0N A;  1R4P B;  1VQ4 A;  3H91 A;  1IBL Q;  5C4J B;  5DGB A;  3MR3 A;  2V59 A;  1WFQ A;  4DR4 H;  4DV6 L;  2XSC A;  4RAU C;  4RNO A;  2HIV A;  2ZXO A;  4IUU A;  1VQ9 A;  1VQL A;  1WI5 A;  1VQG A;  1LTT D;  4JBK A;  4FS2 A;  2R7F A;  4WRD A;  4NKL A;  4UCV A;  1KC7 A;  3HOY H;  1SE8 A;  2CQA A;  2DPJ A;  4TQU S;  3E0J A;  4PQX A;  2X69 A;  1RL2 A;  2B8G A;  2LKV A;  3M7N A;  1PK8 A;  1D8L A;  3GTO H;  4KLK A;  4QWC A;  1PZK D;  4Q45 A;  3GV7 B;  2JEF A;  4K0K Q;  1X3P A;  5COR A;  4JI5 Q;  1RTO A;  3UE1 A;  3CPW A;  2PCF B;  4BXX G;  4R7R A;  1QB5 D;  4IPC A;  4RWS C;  3V05 A;  2YRW A;  1XMO Q;  1VDZ A;  3SE0 A;  1OXX K;  2N49 A;  3M4Q A;  1IBK L;  2FE3 A;  2AHO B;  4QWA A;  3ICE A;  5KFN A;  5BN3 A;  2ID0 A;  5CB4 F;  2Q2I A;  4XTC S;  5IP9 H;  1TS4 A;  5C3E G;  4IRD A;  1X9N A;  2I46 A;  4KHZ A;  1MZB A;  2FPP B;  1U4M A;  4KY7 A;  4QIW E;  5KG3 A;  3NTH A;  4XIG S;  3MXG A;  3VYS A;  1WOC A;  1X3G A;  3K5M A;  2EQS A;  4DV0 H;  3V6J A;  1UNS A;  3Q23 A;  2W9B B;  5IGC A;  5J2T F;  4RB0 A;  2E2D C;  3G48 A;  3T5K A;  4HSP A;  3BYT B;  3KXY T;  5IYD H;  5L1J A;  5LL6 b;  3OWF A;  4RB1 A;  4DR4 Q;  4P73 A;  1O7I A;  3J80 c;  4QW9 A;  3I90 A;  3WDN A;  1BCP D;  2R8I A;  2EJF C;  1NMF A;  2NWG A;  1Y1W G;  3GTM H;  2W57 A;  3A54 A;  4X65 H;  1T5E A;  4LFA H;  5FO8 B;  4GN3 B;  3GV3 A;  3I72 A;  1A3T A;  4E4T A;  2NTS A;  2R93 B;  2A68 C;  1C0A A;  2EY6 A;  2AQ2 B;  1ZYR D;  3D31 A;  1NJI C;  3RV4 A;  4DLK A;  2KEC A;  2I80 A;  1O7L A;  3SGI A;  4B3R L;  4OO1 H;  2PMZ A;  3K80 C;  4DV7 L;  2F0J A;  1ENC A;  1V1P B;  1JWS D;  1S3O A;  4I4T F;  2R85 A;  2KCC A;  3HOV H;  1HFN A;  2X6G A;  5DQG A;  1PHJ A;  1L1O A;  2KED A;  4B3M L;  2MUY A;  3S1N H;  1WH2 A;  4RA8 A;  3NBH B;  2IW3 A;  4WOR A;  3KLW A;  1V43 A;  1KRT A;  4HID A;  1K73 C;  2IX1 A;  5E1F A;  4AH6 A;  1EU4 A;  1NTG A;  1W2B A;  2ICE C;  1EUD B;  5KGU A;  2RDI A;  2IHF A;  1X55 A;  4ED3 A;  4WJW A;  4NW2 A;  4CC6 A;  4YR2 A;  1MGS A;  4DA2 A;  3DM1 A;  2QCP X;  1BNC A;  1UEB A;  3VYT A;  1EY9 A;  5IE8 A;  5HBR B;  2JEG A;  3S1Q B;  3ORQ A;  1YHA A;  3ERQ A;  2D9U A;  1RCV D;  3G4S A;  4DV0 Q;  3CAM A;  3MVV A;  1VQB A;  2DNC A;  2FFK B;  1IL2 A;  3EN2 A;  3S2H H;  4RZQ A;  1NCV A;  5IOC A;  1ZXT A;  1TII D;  3A8I E;  4A3J B;  2RVL A;  4K2K A;  1K28 A;  3BYY B;  1G91 A;  2R8H A;  4UCO A;  3FKI H;  3GTG H;  4FF4 A;  3HFZ B;  3RLO A;  2F4V L;  4IFD I;  5FD6 A;  3ORR A;  2W70 A;  4X65 Q;  2B2Y A;  4LFA Q;  1GGO A;  1AUV A;  4AIM A;  1NSN S;  1PH1 A;  4A2A A;  2F0V A;  1HTP A;  1T5X D;  3PUW A;  5KFA A;  2CQO A;  3H09 A;  3RGZ A;  1Q90 A;  1TAE A;  2R6G A;  1BDO A;  2ZM6 L;  2MO1 A;  1DD2 A;  1SND A;  2G9H D;  4RB2 C;  2X0S A;  2FPI B;  3K59 A;  4N8X 1;  3N44 B;  3A5Z B;  3SVM A;  1HH2 P;  2N55 A;  4BWG B;  2MFI A;  1AH9 A;  2Y0S A;  4IWX A;  4JI7 L;  3UFX B;  2ZDQ A;  3NQI A;  1RJQ A;  3DLL A;  2L11 A;  3MWM A;  4YB8 B;  1AN8 A;  1SYD A;  5IGF A;  5CAE B;  2E8G A;  3CU7 A;  3TP5 A;  4A3J G;  3PN1 A;  3VPB A;  4JUZ A;  5I2X A;  3MWY W;  4L6T B;  3TP7 A;  4AQY H;  1CZG A;  1KXL A;  3MFI A;  1JDE A;  3F2D A;  4HED A;  4DV1 L;  2W9B A;  1TWH H;  3KHG A;  4LW1 A;  2DN8 A;  5J39 A;  5EKK A;  5M3M B;  2F0M A;  3GID A;  5KFR A;  1C9O A;  4LF6 L;  2FK1 A;  4A3F H;  5JQW A;  2FJZ A;  2K05 A;  5JUM A;  5CC4 A;  4X62 L;  2NTT A;  4FF1 A;  2JSO A;  2RDF A;  2R92 B;  3VYU A;  2R93 A;  1ROD A;  2FHT A;  3OMG A;  2EYJ A;  4FP5 D;  1XYI A;  4DL3 A;  4ECQ A;  1VQD A;  2QDB A;  3A8K E;  3PIO 3;  1WTO A;  3BAA A;  2UXD H;  1DOM A;  4XDX A;  5M3F H;  2UU9 H;  2K52 A;  1CM9 A;  1STH A;  2O4X A;  1XXG A;  3VR4 A;  5EPJ A;  1V1P A;  4RGM A;  5IT9 L;  5I2Y A;  4XQQ A;  4DPG A;  4YJ2 F;  4JV5 L;  1R4Q B;  3ERS X;  1YHB A;  4GOP B;  4EBD A;  2F0F A;  1A62 A;  4G7Z C;  3NWT A;  4L5S A;  3TME A;  4EX5 A;  2TMP A;  3NBH A;  4K6D A;  1AZQ A;  3N42 B;  1W3S A;  3OMC A;  4Q8E A;  4AYB B;  1SYC A;  4BBR H;  3RZO H;  5JVH 3;  3L3O C;  5JJL A;  5KFP A;  4A3I B;  1VQE A;  4K5V A;  2UXB H;  5AFW A;  1SE3 A;  1FNW A;  3RJ0 A;  2A6H C;  1Y14 B;  4ME5 A;  2UUB L;  4DL4 A;  2RKS A;  4JI6 L;  4AQY Q;  4KMU C;  1VF5 C;  4C3H H;  5L9X A;  1B9N A;  1V8Q A;  2D5D A;  3SK8 A;  1EQR A;  4A3D G;  3BZC A;  4ZI7 F;  4R8N A;  3QZ7 A;  3GTQ A;  1NAP A;  1HZ9 A;  2V1C C;  4K6L A;  3HOX B;  4ZUI A;  4R9W A;  4PMW A;  1ULZ A;  3UDF A;  3J80 E;  1GKH A;  2EDG A;  2A68 D;  2B2U C;  4LWC A;  4B3T H;  4FDB A;  3TSS A;  2IP4 A;  3ITP A;  2A74 C;  4FXG C;  3RZD B;  1DOK A;  3I91 A;  3WNZ A;  2WKD A;  2V9W A;  3W1G A;  1EL0 A;  2KHI A;  2JA5 H;  3HB9 A;  2PBZ A;  3J80 W;  2IA6 A;  1KBL A;  1B44 D;  4NP5 A;  2R8G A;  1PDQ A;  3NP8 A;  4LUZ A;  1YNJ D;  2UXD Q;  4C3I B;  1CSQ A;  3KBX A;  2K5H A;  2K01 A;  4DUY H;  1TWC B;  2UU9 Q;  4KHP L;  1D5M C;  3E9H A;  4YAJ B;  3HEJ A;  2VOB A;  5J1Z A;  1JDB B;  1ONL A;  2D0P A;  5C1O A;  4YQW A;  1WCM B;  3HOX G;  1F77 A;  4WJ4 A;  2BQ3 A;  5GAD C;  2PZW A;  1PRT B;  5KFQ A;  1XMQ L;  3PMF A;  5C3E H;  1PH4 A;  1CQI B;  1KTK A;  4I7Z C;  2VB3 X;  2PI2 A;  3QG1 A;  1SMY D;  1SLJ A;  2HQE A;  4DAM A;  5C4X B;  3BQ1 A;  4EEY A;  1QVG A;  3Q1K A;  1Y8N B;  3QO2 A;  2F0P A;  4BBS B;  2UXB Q;  4LFC L;  4GNX C;  4UY8 C;  5K5P A;  3NK9 A;  5CA0 F;  4J9K A;  2E2I A;  3HXL A;  4O4I F;  2YV5 A;  3JAM c;  3BQ2 A;  1N36 H;  4CDC C;  1CTM A;  1EIH A;  4PZ8 A;  2XIW A;  2YU9 H;  4DNR B;  1YHQ A;  1LTR D;  2DJF C;  3R2I A;  3MWE A;  3EQL C;  3PR4 A;  2R92 A;  4J9R A;  4L5T A;  2L1B A;  4B3T Q;  4C1N I;  2B2V A;  3PGZ A;  1WCM G;  1Y1W H;  2V58 A;  4YHH H;  4ID6 A;  4LFB L;  2E2J H;  1VQK A;  5D1O B;  4DR3 H;  2XWB B;  2UUC H;  1VQN A;  2P0A A;  3C46 A;  5KFY A;  1EYA A;  4EBC A;  4K2L A;  3Q6S A;  3PF5 A;  1JIH A;  3VR6 A;  1R9T H;  5C4X G;  1ASY A;  1U5K A;  2YTX A;  4XT3 B;  4GOP A;  3S16 H;  5ELD A;  1L0W A;  1IW7 D;  2RGV A;  4RAY A;  1LLR D;  2JJQ A;  5IIF A;  4DUY Q;  4QMG A;  3HKZ B;  4BY1 B;  1GYF A;  2QEX A;  4X3S A;  2YW2 A;  3OHB A;  2GN5 A;  2NVX H;  2ZJQ A;  4LF7 H;  3S15 H;  4AYB A;  3NPP A;  4OL7 A;  2Q8I B;  4ECV A;  2A6E C;  4R4T A;  2EYH A;  5KG5 A;  2F0U A;  2R8J A;  2ZJR A;  3A0J A;  5HGT A;  5FLX c;  2ZDG A;  4HJ8 A;  4K5W A;  2QK4 A;  4MNO A;  4HIO A;  1M6V A;  4OGQ C;  1N34 L;  5LMN H;  2KOL A;  2DLN A;  1BF4 A;  3SHL A;  1I7L A;  2RF4 A;  4A93 B;  4ZCK A;  5DQI A;  3S1R B;  5D3D A;  2B2W A;  2B2T C;  1VQ8 A;  4A3K H;  5IGE A;  3BQ0 A;  2WIN B;  4YWL A;  3HOY G;  1LT5 D;  1Y8P B;  3RBD A;  1JOK A;  1E3P A;  2BA0 A;  1N36 Q;  3RNU A;  3RAQ A;  4C3J B;  4KK7 A;  3KLS X;  1CZW A;  4RG1 A;  3HKZ G;  1M8A A;  3GV6 A;  5ELB A;  1ENF A;  3L0O A;  1JKJ B;  2HHH L;  1XPU A;  2XCP A;  1LTI D;  3T51 B;  2NU7 B;  4DV3 L;  2WAQ A;  1S68 A;  4L8J A;  4YHH Q;  1K83 B;  4DR3 Q;  4BY7 H;  1VQ6 A;  3GIQ A;  5C4Z A;  2UUC Q;  4LF5 L;  3CCQ A;  3K0X A;  1TWC A;  3JSL A;  4YY3 H;  3LGJ A;  3FRP B;  4X3U A;  4EFB A;  1DJR D;  3U9T A;  4LH6 A;  5CV8 A;  3RMH A;  2CW7 A;  5LMN W;  2VPQ A;  5C0X I;  3KAL A;  2JA9 A;  2ZXR A;  2YZG A;  4OEL B;  4RAZ A;  4NXN H;  4ZAI A;  5FK9 C;  5JH7 F;  2CW0 D;  4LF7 Q;  4IUV A;  4DR6 H;  1LTG D;  2IBK A;  1O80 A;  4J9L A;  2WTF A;  4LF4 L;  2W8L A;  2N78 A;  3HOV B;  3PW7 A;  4MV7 A;  1XNQ L;  4I65 A;  4MN3 A;  5IYD G;  4BS9 A;  1SFO B;  4OHJ A;  4DV2 L;  1PYW D;  3J80 i;  3GTK H;  4A3B H;  3T1Y L;  4IQZ A;  3T53 B;  2EJG C;  3GTL H;  4XYL B;  4IJL A;  4FNF A;  1Q3L A;  1FGU A;  3KBG A;  3HZX A;  3WWV A;  4LF9 H;  3PW2 A;  2O5J C;  1XPO A;  2N8N A;  2SOB A;  5IGG A;  5KFC A;  2AWN A;  3GII A;  4KTA A;  1SXT A;  2A5H A;  3U9S A;  4GKK H;  1E22 A;  1KAB A;  1H9S B;  5IGB A;  5EAY A;  3PCO B;  3UDX A;  3S2H B;  1BUV T;  1Z6H A;  1T3N A;  3EFX D;  1GUT A;  4GZY C;  4P2C B;  2JP1 A;  5EGT A;  3KK7 A;  4OO1 G;  5L37 A;  1I94 L;  5JOB A;  4A3M H;  1TU2 B;  1HNW L;  1EY8 A;  2UVV A;  1K3R A;  3GQB A;  3CME A;  1LTA D;  3FKI B;  5M5Y B;  3M3Y H;  3GTG B;  4RGO S;  3RD4 A;  4XQN A;  3SR1 A;  1N32 H;  3HKZ A;  4POF A;  1G6P A;  1STB A;  1ZEQ X;  3J81 E;  1A3U A;  2HD3 A;  3QOJ A;  4RUA A;  2GA4 B;  1D5X C;  2FLN A;  1A8V A;  5HY6 A;  1YJN A;  2R7Z H;  2JA8 B;  1EY5 A;  2HCI A;  4DAY A;  1RJT A;  4ECS A;  4FBU A;  1BO0 A;  2OTJ A;  5KT7 A;  1EQT A;  2KBN A;  4CJ0 B;  1SMX A;  4ZRZ A;  4YWM A;  4NXN Q;  4IFD H;  4JI3 H;  3A7L A;  5EPL A;  4DR6 Q;  4JYA L;  3J81 W;  3DF7 A;  3KJO A;  2RSN A;  1HRJ A;  1F9R A;  1EHI A;  4OWX B;  2R6F A;  4EEQ A;  4PMB A;  5DLG A;  1Q86 C;  1WTV A;  4MAM A;  1BKB A;  3JAM E;  2MNA A;  1V1Q A;  1PTO D;  2AMC B;  3K7A B;  3FKI G;  5BR8 L;  3N43 B;  5EKI A;  3PZP A;  1RD9 D;  2VQF H;  4YJ3 F;  3MR6 A;  4LF9 Q;  4R8I A;  1ASZ A;  2WB1 B;  1TWH B;  2BH2 A;  3S2D B;  4MV8 A;  4XZ3 B;  1NBW A;  1PFM A;  4H7B A;  4QJF A;  2ALZ A;  3JAM W;  1YVC A;  1Q8I A;  3PQI A;  4GKK Q;  3QZ8 A;  3GV5 B;  5KT4 A;  4ED0 A;  1K83 A;  3K57 A;  2F3W A;  2NZH A;  4N9T A;  2UVR A;  1BCP C;  5ISR A;  2E5L H;  2NVQ H;  5F2D A;  3T16 A;  1MSG A;  2FKL A;  1Q46 A;  1PZJ D;  2RDJ A;  1H9K A;  3I73 A;  3HOZ B;  3BZK A;  1IBL L;  2A6E D;  3KDF A;  4Y7N H;  4O3N A;  2RDG A;  2BOS A;  1N8R C;  2HVS A;  4IO9 A;  1BGW A;  1TT2 A;  2CH4 W;  3OYY A;  3MEF A;  1ZYR C;  4DU9 A;  1NNX A;  5KYL A;  1GUS A;  3X3N A;  3OTO L;  2PZT A;  5M3F B;  2Z1C A;  4F50 A;  2RSO A;  2YZM A;  2J6T A;  1MJE A;  3N6X A;  4UCT A;  3RUP A;  1VF7 A;  1EIF A;  1KJ8 A;  4X66 H;  1J6Q A;  4UFZ A;  2ASL A;  1DXM A;  3N40 P;  4L5R C;  2BQR A;  1SFO A;  1QNK A;  3D6C A;  4JI3 Q;  2WAC A;  3Q8S B;  2BQU A;  4A3G H;  1UE7 A;  2XN9 C;  2VQE H;  5EDW A;  5KFG A;  4A3F G;  1IXR A;  3KF6 A;  2W8K A;  4JI5 L;  1TWG H;  4BBR B;  1Q12 A;  2UVU A;  3HOW H;  4TSS A;  2JK8 A;  1Z2P X;  1UAP A;  3MXN B;  4DKA C;  2MJ8 A;  1XMO L;  5C3W A;  1JR0 D;  2ZTC A;  5IY0 A;  1EQV A;  2RGR A;  4C3H B;  1H9S A;  2Z6K C;  3FPU B;  2VQF Q;  3BG3 A;  1JOQ A;  3U4V A;  2FMM A;  4JI4 H;  1CT1 D;  3ND9 A;  1I50 H;  2F0S A;  3KLS A;  5M5X B;  5LHY 1;  5M3F G;  2YYA A;  3T5J A;  1VAJ A;  2NVY A;  3CMA A;  3FKI A;  1K3B C;  1Q8K A;  1EY6 A;  1RDP D;  3GTG A;  5JPM C;  1HA5 A;  1RK6 A;  1A3V A;  2LFN A;  3BVZ A;  3MEH A;  2VS1 A;  3KJP A;  2E5L Q;  3M4I A;  2ENB A;  5EQ0 A;  2ATW A;  3QFF A;  4JI2 H;  1H9J A;  3NTK A;  2W71 A;  3TII A;  3TQT A;  1HNX H;  5KFE A;  4JG2 A;  3AU7 A;  1N33 L;  3PIO A;  4A3C H;  2CKZ B;  2EYL A;  4BBR G;  2A19 A;  4U67 3;  2PVP A;  1PFB A;  1WR2 A;  1ICW A;  4ILW A;  2F3I A;  1C8C A;  3N8D A;  1UE5 A;  1JIC A;  1RTN A;  4JV1 A;  5M5W H;  1SEI A;  3B6Y A;  4C3H G;  5LL6 S;  1QUQ B;  4HNV A;  4IR9 A;  2F4I A;  5A2Q W;  3G71 A;  1HHV A;  4X66 Q;  3J7A K;  1SBB B;  3EBE A;  1KIX A;  1JJC B;  4G4K A;  2A1A A;  2WAQ E;  4IJH A;  1J8I A;  1OXT A;  3NGD A;  4APM A;  3HG9 A;  2VQE Q;  5C3E B;  4HN7 A;  3Q2O A;  2UUA H;  5LOV F;  1C7Y A;  1TQO A;  1L2Z A;  2PQA B;  5LL6 X;  2WB1 A;  1PTO F;  3CKI B;  1LM0 A;  3VMM A;  2JA5 G;  3QJY A;  4JV2 A;  3G6E A;  3HP3 A;  1JX4 A;  1SJH D;  5JJZ A;  1P16 A;  4JI4 Q;  3H3V C;  2HUG A;  1SEB D;  4ETS A;  3J81 i;  3OSO A;  1FL0 A;  2JA6 H;  4RZR A;  2MQH A;  3RLN A;  1HNZ L;  1TWA H;  4LMQ D;  5D65 A;  2XRS D;  1G2S A;  4UCS A;  1Y1W B;  1LAC A;  3T1H Q;  4V19 0;  5HUR A;  4JI2 Q;  2E2J B;  2R8K A;  1HNX Q;  1EOV A;  3MC0 B;  3BZD B;  2PNR C;  3OIQ A;  1XPR A;  3K3P A;  4YIJ A;  3F2U A;  1SAP A;  5KFF A;  2JEA I;  1V4Y A;  3RN5 A;  3RB3 A;  4O3Q A;  2VB2 X;  3I4L A;  2RHQ B;  3BVG A;  3D3R A;  3EIV A;  4DL2 A;  3JAM i;  4X65 L;  2JEB I;  3R93 A;  4LFA L;  2B63 H;  3HOU H;  2CW8 A;  1EZ1 A;  1KJ9 A;  3VR5 A;  4F88 A;  2VPS A;  3S15 B;  2EYP A;  1JT8 A;  4G3I A;  3GTJ A;  4JOI C;  3D0F A;  4DL7 A;  2ZT9 C;  4RB3 C;  2RCF A;  3S17 H;  1N48 A;  3RN2 A;  3CQZ H;  4C5B A;  2VUM H;  1DZ1 A;  5JAV A;  2K75 A;  2UUA Q;  2NN6 I;  1PA6 A;  2H5X A;  1WTR A;  1G51 A;  3TEH B;  4IFD J;  2V5A A;  2DGY A;  2XTI A;  1HZB A;  5KFT A;  1TWF H;  2WDT A;  3IRB A;  2IJ0 A;  4QY7 A;  1DV1 A;  4A3K B;  2HJW A;  2I8C A;  1RYR A;  4IPD A;  5KNB A;  3MXU A;  4QUC A;  4KY5 A;  5AJ3 L;  2OCE A;  2YYZ A;  4J1M A;  1Y1V H;  4YAK B;  3PO2 H;  3RAX A;  4I50 F;  3KHR A;  2BDO A;  4EG0 A;  3VDY A;  1HUN A;  4B9W A;  1C48 A;  3NE5 B;  1UWV A;  5C8Y F;  1SE2 A;  1JOR A;  1YNJ C;  2M00 A;  5IT9 c;  3UE0 A;  4MV4 A;  2XGT A;  1KAA A;  5A35 A;  1QJO A;  1ZHS A;  1VQI A;  2BA1 A;  5EPK A;  1JJ2 A;  3R8B A;  1QE6 A;  3M4Y A;  3CCE A;  4ZK9 B;  1QOH A;  4C2M H;  5KFJ A;  5F9L A;  2CQY A;  3CW2 C;  2JA7 H;  1SR3 A;  2EVB A;  2L4N A;  4KD3 A;  2CWA A;  4A3K G;  1QNU A;  4IUR A;  1EUC B;  2GLT A;  2EYO A;  1YIT A;  4DAP A;  4L1K A;  4GNX B;  5FO9 B;  1BXR A;  1MSH A;  1JWM D;  1JXL A;  1AN7 A;  1SMY C;  3MJF A;  2FLP A;  1S0N A;  2JXM B;  3D4R A;  2W6Q A;  1G29 1;  3H3V H;  1UE1 A;  4O3P A;  3H40 A;  4YBZ B;  1CQV A;  1EYG A;  3DWQ A;  4O4H F;  3M7G A;  4OWW B;  3GTK B;  4A3B B;  5JJI A;  4RUC A;  3GDE A;  4TVA B;  4UDU C;  4DV5 H;  1FGB D;  4BY7 G;  2L55 A;  4OX9 H;  3PO3 H;  3EA6 A;  2KVM A;  2JN4 A;  2F0L A;  1VCI A;  3GTP H;  4B3M H;  3V4S A;  3CCS A;  1YIJ A;  1WYD A;  2PN1 A;  2W6Z A;  1X54 A;  4AQY L;  1OXV A;  3A7A B;  3SI8 A;  2AGP A;  4KJN A;  1Y1W A;  2K5Q A;  1E1O A;  4Q5V A;  2EOT A;  3J81 j;  1SYX B;  4KV6 A;  1B3Q A;  1GUG A;  3Q22 A;  4GLA C;  3A8J E;  1I6H H;  2ZXP A;  5IYB H;  3MHB A;  1I3Q B;  3NHH A;  1IW7 C;  1WD1 A;  2N88 A;  3OOC A;  4RU9 A;  3TP8 A;  4APV A;  3PV0 A;  2YS6 A;  2IL8 A;  4HQ6 A;  1EYZ A;  4A3B G;  2K4K A;  4F4Y A;  1B1Z A;  1TY2 A;  2MCT A;  1PRT F;  3G8C A;  2VA2 A;  2H1E A;  4JI0 L;  4O3O A;  3G6J B;  2NU9 B;  2A69 D;  4FF3 A;  2R7Z B;  3MTS A;  3CC2 A;  2DUD A;  1L1O C;  3DMU A;  3S9W A;  1FKA H;  4IRC A;  2UU9 L;  3LWE A;  4BA1 I;  4N9P A;  4MZ9 A;  3G6X A;  3UDG A;  3R3O A;  3JSN A;  5I9O A;  2K5V A;  2ZDH A;  2B2U A;  1VQA A;  4A2B A;  1SNP A;  4LNQ A;  2IHE A;  2ZM6 H;  4POG A;  1S5C D;  1E1T A;  2F0K A;  4P71 A;  2I07 B;  1CHQ D;  2Z8L A;  1PXU A;  2K03 A;  1GOZ A;  4A3M G;  4ZOL F;  3M4O H;  3E0E A;  4DV5 Q;  1HA6 A;  4A3D B;  1EY7 A;  1ML0 D;  4JI7 H;  3P75 A;  1II3 A;  1OTC A;  4OX9 Q;  1YEZ A;  4EYI B;  5IYC H;  3C3L A;  4J9O A;  4B3M Q;  3GIP A;  4A3L H;  4EGJ A;  4ME3 A;  1M7J A;  1VQJ A;  5DNF A;  3SXH A;  2MHV A;  2R7Z G;  4YR3 A;  4O3R A;  5I6Y A;  1EWI A;  4DV1 H;  2ATL A;  1T94 A;  1STY A;  1YNN D;  4OON A;  1VBH A;  5C44 H;  3CC4 A;  4IFD G;  4IPG A;  5KFV A;  4H44 C;  4DR2 H;  3R23 A;  1J5E H;  3F2B A;  1FJG H;  3U9O A;  2VNU D;  3I4N H;  5JVL A;  4LF6 H;  4ABN A;  3QB3 A;  1S9F A;  4TQR A;  3M9N B;  2ZJT A;  4IHJ F;  4JBW A;  2AWO A;  3CXC A;  2R3Z A;  4IOC A;  2FJ2 A;  3WO1 A;  4JCV E;  4Y8V B;  1C4Q A;  4GNX A;  4EQO A;  3K7U C;  2ZTD A;  2CW0 C;  1HQM C;  4DR1 L;  3GIK A;  4GLX A;  3MR2 A;  5EKL A;  1MD2 D;  3D8G A;  5CMD A;  5ELC A;  4DNT B;  3I4M H;  1BQQ T;  3PF4 A;  4CGY B;  3H6M A;  5M9O A;  3FDT A;  1D7Q A;  3RB4 A;  2FPG B;  3Q24 A;  1DM0 B;  5DG8 A;  5KFZ A;  5D14 A;  5FO7 B;  4ZLT F;  5IWA H;  5DG7 A;  4FXD A;  3MXP A;  3MFH A;  4JV5 H;  1B6R A;  1I7N A;  4IR1 A;  3HOW B;  3TQY A;  2ZM6 Q;  1I5F A;  4CJ2 C;  1TA8 A;  3RB0 A;  3KOJ A;  1EQQ A;  1G6Z A;  4KY6 A;  4LF8 H;  1P8L A;  3K58 A;  3J7A V;  1BBX C;  4JI7 Q;  1CA6 A;  5GAH C;  1BBW A;  5KFH A;  1XJV A;  2KEE A;  4M9U A;  3WO0 A;  1PH5 A;  1O75 A;  4B9X A;  4J9S A;  4QF4 A;  4HCS A;  3J81 c;  1SRO A;  3R5F A;  3ULJ A;  5GAE C;  2QW7 A;  5IT9 E;  4KHV A;  5CV7 A;  4EVO A;  3L4K A;  1N36 L;  4DV1 Q;  1I3Q A;  2EYF A;  3Q8Q B;  2Q2H A;  5LXT F;  5C3X A;  1B6S A;  1V1O A;  5KG7 A;  1LTB D;  2BH8 A;  1TVX A;  2DY7 A;  2KQ3 A;  4ECU A;  4A3G G;  4DR2 Q;  1S72 A;  2OQK A;  4Y52 H;  1J5E Q;  1E4E B;  1WVL A;  1FJG Q;  5CA1 F;  4LF6 Q;  1J9O A;  4YHH L;  3HOW G;  5IT9 W;  3I4O A;  4DR3 L;  2UUC L;  4I7A A;  2UXC H;  1STG A;  4I55 F;  3K5L A;  4ECX A;  2PMZ E;  2B3G A;  4X64 H;  5C4J H;  5M5W B;  4KD4 A;  2K33 A;  2N3S A;  3D4D A;  3OSP A;  1X6O A;  3NQT A;  1GSA A;  1CS0 A;  3I70 A;  1S0O A;  1TXY A;  3V2T A;  2E2H H;  1E2W A;  1SN8 A;  5KG6 A;  2B39 A;  3CPF A;  4QW8 A;  2NUC A;  2LXK A;  3M9B A;  1IKL A;  1O7Y A;  5JEA H;  2F0G A;  5IWA Q;  2AQ1 B;  1PTO C;  5COY A;  3SEB A;  2VR1 A;  3N52 A;  4E6I A;  1OO9 B;  4JV5 Q;  4JI1 L;  4NXM L;  2AUJ D;  3HOY B;  1IBM L;  1BCP B;  1F9S A;  4MV1 A;  5EZY F;  5BPF A;  1XMQ H;  1PH6 A;  4LF8 Q;  4A3C G;  3PUY A;  3QR8 A;  4FYD A;  1RJP A;  5CV6 A;  3GTO B;  3TN2 A;  5ELO A;  5ELE A;  4ME6 A;  1XTC D;  4XYQ A;  4EFE A;  4QIW B;  4EGV A;  1U4L A;  1PFN A;  1MJC A;  4DAV A;  1BVS A;  3LML A;  1JC7 A;  4PV1 C;  4DF7 A;  4U7C A;  1TWA B;  4IPH A;  2OXP A;  5ELN A;  2R7M A;  2W6P A;  4LUO A;  5LMU L;  5C5J A;  1EZ6 A;  2K1B A;  4RGT A;  1LT6 D;  1G2T A;  4UCR A;  4HNU A;  2JE6 I;  1YNX A;  1D1K A;  2MP1 A;  3FHW A;  2XCA A;  4LFB H;  1H9M A;  3W3A A;  1RK5 A;  1S5F D;  2UXC Q;  2D2C C;  1K1Q A;  3SE7 A;  1EUJ A;  1OXU A;  1U4P A;  2SEB D;  3WOF A;  4X64 Q;  2Y0S E;  2FIN B;  3IL8 A;  3HOU B;  3PIP 3;  4DK0 A;  4MA0 A;  3ULP A;  2OWO A;  1LTL A;  4QWD A;  1S4Z A;  4OO1 I;  3S17 B;  2JA6 G;  3TZD A;  4NXN L;  1XTD A;  1GUO A;  2I5L X;  4FF2 A;  3MA2 B;  3JZI A;  1KAW A;  2NZO A;  1HZC A;  2VA3 A;  2R93 H;  3GTM B;  3EVQ A;  5KND A;  3OW7 A;  1Z7T A;  2KCM A;  2FMA A;  4B3S H;  4MTE A;  1XMQ Q;  2KEN A;  1WTX A;  1WCM A;  2B2V C;  5IOD A;  1N34 H;  4UHV A;  1CKM A;  1LTS D;  4K5X A;  2DIK A;  3HS0 C;  2NN6 H;  3CCR A;  2RDH A;  2C22 A;  1SJE D;  2OEO A;  1MIU A;  1Y1V B;  3PUV A;  4ZUJ A;  3UDI A;  2WII B;  4ECT A;  1F2Z A;  3PO2 B;  3VYR A;  2B63 G;  3HOU G;  2BCO A;  1E4E A;  3PW4 A;  1STN A;  4LMY A;  4GOP C;  4GKK L;  4A3E H;  1KJI A;  4JVZ A;  3TRZ A;  1E24 A;  3NEN A;  3S1N B;  4LSX A;  3W2D A;  3K6O A;  5LMN Q;  4UPA A;  1HR0 L;  2VUM G;  3DWP A;  1EYC A;  1I4G A;  2K5N A;  1BNZ A;  2NUA B;  4GKJ H;  5C1P A;  3A5U A;  2C00 A;  3N6R A;  1OXS C;  4C2M B;  1PTO H;  5IP7 H;  5FPO A;  1STE A;  2Z0S A;  1Z2N X;  4JI8 L;  2QEJ C;  3HBL A;  3GTQ H;  2JA7 B;  2XVS A;  4PDB A;  1F9P A;  5LP6 F;  2Z9H A;  4DFA A;  5D1O A;  1PYS B;  4DV4 L;  3KUP A;  3EPI A;  2XWJ B;  1Y1V G;  4QWB A;  3VR2 A;  1CFM A;  1PH8 A;  3PO2 G;  1CI3 M;  3BS1 A;  4R8U B;  4ECY A;  2HGS A;  3UQ8 A;  2R84 A;  4Q43 A;  1W96 A;  1W93 A;  5BR8 H;  1HCZ A;  4YY3 Q;  2V4Q A;  2G5D A;  1FVI A;  1Q7Y C;  3GTO A;  3T56 B;  1Q82 C;  5KT6 A;  3E9I A;  5ELF A;  1K8O A;  2R86 A;  4CKC A;  4B3S Q;  2TSS A;  4QIW A;  4DUZ L;  2W7O A;  4RNN A;  2EE1 A;  3FP9 A;  1K8G A;  1N34 Q;  2EY1 A;  3VA5 A;  3LP8 A;  5D1P A;  4ED7 A;  3T1Y H;  3J7A 5;  1EIY B;  2VQF L;  1DIK A;  2H4O A;  4EBE A;  2JA7 G;  4R1J A;  3CRL C;  1UEA B;  1D1I A;  2DNE A;  1YBY A;  1K1S A;  4XYM B;  5KFU A;  2K14 A;  4B08 A;  2XNA C;  1RKN A;  3EJI A;  2J7Z A;  2IX0 A;  3F1Z A;  2IPK D;  3NEM A;  5FLX L;  1SYF A;  1XNR H;  5E3F A;  2WFW A;  4EQP A;  5L1K A;  2E5L L;  3K8A A;  2E75 C;  4GKJ Q;  2QYZ A;  3LX0 A;  1HQR D;  5KG1 A;  3I2Z A;  2E2I H;  5M3M H;  4ODG A;  1HNW H;  4YWK A;  1GSO A;  4ZQI A;  1ET6 A;  2PPB C;  5BMV F;  2Z6K A;  2W9C B;  2SDF A;  3NUC A;  1NUC A;  3PO3 G;  4RCO A;  3ZYY X;  3ND8 A;  3GO5 A;  1VMC A;  4A3F B;  3CRK C;  2R92 H;  4OXP A;  1B53 A;  5TSS A;  3U58 A;  2NU6 B;  2PI2 E;  1ZQ7 A;  3FMA A;  3RTX A;  3ETJ A;  3WOE A;  3GTM A;  1VS0 A;  4X66 L;  1SCU B;  1GSH A;  2C5C A;  1ICF B;  1ESR A;  1WTW A;  2XIG A;  2ZJP A;  2JYO A;  5BR8 Q;  3M4O B;  1EY0 A;  4RHR A;  1N32 Q;  2L12 A;  4JYA H;  2XRQ D;  3DWA A;  2J0T D;  5IYB G;  1JCK B;  1QVC A;  4KJO A;  1K0R A;  4MV6 A;  2M2L A;  5JEA J;  2Z6B A;  4OIK A;  2KCN A;  2QGQ A;  4HTH A;  5KIX A;  1EOT A;  5A2Q L;  2M05 A;  4EQN A;  4ZHQ F;  3DXJ C;  1UE6 A;  3T1Y Q;  2JEJ A;  4TQS A;  4J15 A;  4A3I H;  2C9O A;  1DON A;  4K0K L;  2QDL A;  2PW5 A;  4FU0 A;  3RGX A;  2SNM A;  1QVF A;  3RZO B;  1IYJ B;  3KAK A;  5FJ8 H;  4MV9 A;  1D2B A;  1XNR Q;  2KA7 A;  2VZA A;  1B9M A;  5EBC A;  1SNO A;  2JA7 A;  1U4R A;  1HNX L;  4HJ7 A;  4C1N K;  5KFM A;  2E76 C;  2ASB A;  4EQ5 A;  3BU2 A;  3KAJ A;  1BBU A;  3TP6 A;  1HNW Q;  4J8Q A;  4AYB E;  4DR5 H;  3A55 A;  3N41 B;  2K5W A;  4HMI A;  2W6O A;  4DR7 H;  5IYC G;  3RZD H;  2R7N A;  3CCU A;  4R8U A;  1AE2 A;  2ICI A;  4A3L G;  3OTO H;  3Q0A A;  2KSW A;  3RV3 A;  3MZ5 A;  3H20 A;  2KJX A;  3NTI A;  3S1M H;  4DXF A;  3JRX A;  1SNC A;  5D3I B;  2Q2U A;  2L9H A;  1H9R A;  5C44 G;  2IMW P;  3KHH A;  1KEE A;  2BDN A;  1TWC H;  2JA5 B;  4DR4 L;  1F9Q A;  2AGQ A;  3D6W A;  2LY7 A;  5C5L A;  3EPG A;  4JYA Q;  1I4Q A;  2GPW A;  3I4N G;  3K3V A;  2UUA L;  1DGS A;  4CHT B;  1KJJ A;  4GC7 A;  1HUM A;  2WV6 D;  1A2T A;  2Z4H A;  1PH2 A;  4UP8 A;  3S24 A;  1F2Y A;  1S97 A;  1QIL A;  3SK6 A;  1KDA A;  1K8A C;  4JV0 A;  4DGZ A;  5DM7 3;  1ZET A;  4R4Q A;  2Z4I A;  1S5B D;  4GN4 B;  1VQH A;  2F03 A;  5J2U F;  4R4I A;  1C3O A;  2EXZ A;  3I4M G;  1M0W A;  5FOB B;  4BBS H;  1E2Z A;  1EEF D;  2IT1 A;  2A8V A;  2A73 B;  3OUZ A;  2KHS A;  1E2V A;  2A69 C;  1TWH A;  4RH6 A;  1DOL A;  4PG3 A;  2F3V A;  1VQO A;  1HJP A;  3VPD A;  2W9C A;  4UCU A;  2K50 A;  3GQC A;  3V6H A;  1EWH A;  1S03 G;  4LJZ C;  4F8M A;  2HVQ A;  5DAU A;  5KT2 A;  4CDD C;  3CCL A;  1I4P A;  5IYZ F;  4DR5 Q;  3QOL A;  1N33 H;  2YU9 B;  4N8F A;  1UC8 A;  3ETH A;  2FXQ A;  4UP7 A;  1X65 A;  4DR7 Q;  3BDL A;  2C2D A;  3ERO A;  3M4P A;  2E2H B;  4KI0 A;  1B33 N;  3OTO Q;  4ED8 A;  2HDM A;  1YJW A;  4DV0 L;  2R61 A;  3Q8R B;  1VKZ A;  2JEI A;  2YRX A;  4HIK A;  4H0L C;  2NZ1 D;  1A6X A;  1A9X A;  5CYU A;  3DEP A;  5KT5 A;  4ED2 A;  4Q0F A;  4BY1 H;  1R9T B;  4IOA A;  3DHQ A;  2HVR A;  2VY3 A;  4PMC A;  4DV6 H;  1IZ6 A;  3S16 B;  1PRT D;  2PYK A;  3P20 A;  1KRS A;  2NVT H;  3IG0 A;  2DPI A;  2K5D A;  4M8A A;  4MTK A;  2IY5 B;  1VQF A;  5CV4 A;  1YNN C;  5I47 A;  3BDC A;  4MA5 A;  2NVX B;  2W6M A;  2WP8 J;  4YCV A;  4K8I A;  4BA2 I;  5FD5 A;  3KF8 B;  4K14 A;  2Y0S B;  1C30 A;  1UUP A;  3RFC A;  1Y69 U;  4QL5 A;  3MXN A;  2DJG C;  4G57 A;  3D4W A;  4A93 H;  3S1R H;  1E4G T;  3HKZ E;  5KFK A;  1LT4 D;  3MAQ A;  3CF5 A;  2FP4 B;  5JEA G;  4HJ5 A;  4LAA A;  3SK4 A;  3MR5 A;  4XQJ A;  2OLS A;  1HNZ H;  4Q8F A;  4C3J H;  5JVG 3;  2RHS B;  2MPM A;  3TZU A;  4JBM A;  3IKJ A;  2F0O A;  1GVP A;  4KN4 C;  4DNI A;  5H1S E;  4HYK A;  4FM9 A;  3G7L A;  1HPC A;  5KNC A;  1IBK H;  2FK3 A;  3H0G H;  2F0D A;  2D0O A;  3VA7 A;  4OEM B;  1MI2 A;  2EZV A;  1N33 Q;  4TRD A;  3I12 A;  2CHB D;  3HRZ C;  3AFP A;  1K83 H;  2GVA A;  3CVZ A;  3EYY A;  5KX5 F;  4MTD A;  2JA5 A;  3AFQ A;  1JE5 A;  2BE5 D;  1CSP A;  3P1H A;  1Q1E A;  3MFG A;  2C35 B;  1LAB A;  2Y0S G;  4TV8 F;  1TS3 A;  1KQS A;  1E0B A;  1JWU D;  1K8M A;  4BY7 B;  1H95 A;  5IGD A;  1T36 A;  1I6V C;  4KKU A;  2YCH A;  2LMC B;  4LUV A;  3I55 A;  3Q8P B;  1IL8 A;  5EBD A;  4F87 A;  1QUQ A;  4DV6 Q;  1X3Q A;  1EU3 A;  2NU8 B;  4FBT A;  1FNU A;  4FXK C;  1IOV A;  2ASJ A;  4DV5 L;  2FK2 A;  4WBN F;  3M9O B;  4S3S A;  4RKL A;  4JPB W;  4C56 C;  1RJR A;  4J0M A;  1SNM A;  4OX9 L;  5KFB A;  3GV8 B;  3TIN A;  1PFS A;  4MTN A;  2VUG A;  1SFO H;  1KDB A;  1K0S A;  2C28 A;  2PQA A;  5C4H A;  2F0E A;  3AQQ A;  1ZHQ A;  2K6A A;  5EJW A;  4IUT A;  1S40 A;  5C0X H;  2P5Z X;  4A3E B;  5K36 H;  1NE3 A;  3C1F A;  4EGQ A;  3G6V A;  3CD6 A;  1AUX A;  2YTV A;  2HIX A;  5E4W C;  5DQH A;  4B3R H;  1SNQ A;  4DV7 H;  2XD4 A;  1X3F A;  1EYD A;  5J3B A;  1KLU D;  3GTL B;  1KL9 A;  1PH7 A;  1ILP A;  1HNZ Q;  3H4B A;  2R93 G;  2YU9 A;  3RB6 A;  1GHJ A;  4O3S A;  3RUZ A;  1KHI A;  3GLK A;  1PTO B;  4DK1 A;  4FVM A;  1IBK Q;  3NSW A;  3FDS A;  1U9R A;  1RF2 D;  3T5L A;  2E2H A;  2EYM A;  3GTQ B;  1YI2 A;  1MBY A;  1V51 A;  3PIP A;  5EOY A;  1F2L A;  1SE4 A;  2NVY H;  3U50 C;  4RCN A;  2K28 A;  5M5Y H;  2NN6 G;  2R7L A;  4F4W A;  1R9T A;  4A3M B;  3BDO A;  5LYJ F;  4A4I A;  1VBG A;  1X32 A;  3M3Y B;  4O0A A;  4A3E G;  4RFB A;  2LS0 1;  5JJK A;  3DM3 A;  3R5X A;  2JA8 H;  1IYV A;  3PUZ A;  1QCB D;  2NBF A;  1WSC A;  3U4Z A;  2NVX A;  5CBE E;  5DG9 A;  4IZO A;  1XWE A;  3GD7 A;  3KF8 A;  2M9V A;  2EY5 A;  4IRK A;  2QIL A;  2UXD L;  2UVW A;  2DZD A;  2XC9 A;  2F4V H;  4ZYS A;  1PYB A;  5IP7 G;  1IOW A;  2OH2 A;  1SSO A;  2I5M X;  3NBI A;  1GUW A;  1B8A A;  3E3X A;  1XX8 A;  3AEV A;  2F0I A;  3NXW A;  3MFY A;  2I87 A;  3VR3 A;  5KT3 A;  3RR5 A;  3K7A H;  2WKC A;  2J6S A;  1TR5 A;  2ES2 A;  3HGB A;  3CC7 A;  1Z9F A;  3A56 A;  5AJ3 Q;  4JBJ A;  4CKE A;  3IN5 A;  4MHE A;  1SDF A;  3J80 L;  4B3R Q;  1EY4 A;  3S14 H;  4DV7 Q;  5D8D A;  2AQ3 B;  1S0M A;  3S2D H;  5CR3 A;  3E6Z X;  4LSA A;  4OWT B;  2RCN A;  3SK5 A;  3MWD A;  4HMJ A;  4DR2 L;  2E74 C;  4IUN A;  2E2I B;  1J5E L;  4JW0 A;  1FJG L;  3CHB D;  4ECZ A;  2UXB L;  2LSS A;  1I4X A;  1X3E A;  5I4D A;  2F0W A;  1D5Z C;  5L1L A;  5EWF A;  2RA4 A;  2F0Q A;  1S5D D;  3HOZ H;  1A0I A;  1BCP F;  4J9M A;  4JI0 H;  1M4V A;  2NVQ B;  2B2Y C;  1VQ7 A;  2GPS A;  5DM6 3;  4CJ1 B;  2O2L D;  2X6L A;  2QA4 A;  1OWT A;  2WB1 E;  1N9W A;  3FPP A;  1UC9 A;  4Y7N B;  4B3T L;  2KUM A;  2EJM A;  4G7O C;  3J7Y W;  5IWA L;  4X62 H;  3ONA B;  1JLL B;  5HV6 A;  3E5N A;  2K04 A;  1VMP A;  1WD0 A;  3PSI A;  1MHW C;  3SDZ A;  4YCU A;  5M3M G;  5FLM H;  1GM5 A;  4LF8 L;  2F4V Q;  1FNV A;  1LV9 A;  4IUP A;  1LO5 D;  1MKH A;  4DUY L;  1CQF A;  2RQX A;  5HGQ A;  3GTJ H;  3OUU A;  4J9N A;  1GO3 E;  3TIG A;  4O2A F;  3GTK A;  4A3G B;  5JPN C;  3LWU A;  2R92 G;  3GTL A;  2I5H A;  1TWG B;  5H80 A;  4M7E A;  1E4F T;  1VQM A;  3H4D A;  4BWS C;  4PZ6 A;  1KNE A;  1ET9 A;  5M5X H;  1VQC A;  4KKS A;  3ULL A;  2ZTE A;  5KG2 A;  2B8F A;  1RYS A;  2GVB A;  4C5A A;  1I50 B;  4J9Q A;  3GIJ A;  4HSV A;  2IWH A;  1Z47 A;  2HT1 A;  1CA5 A;  2UUB H;  4JI6 H;  3BG5 A;  2UXC L;  1FR3 A;  5DLQ E;  2K32 A;  2CZG A;  3OIP A;  4X64 L;  3L7Z C;  1SYB A;  2J4X A;  1N56 A;  2R7D A;  4AYB G;  4JI0 Q;  5KFO A;  3RIZ A;  4DR1 H;  3S1M B;  1KJQ A;  4DL5 A;  2WAQ B;  5T14 A;  4O2D A;  4A3I G;  4P75 A;  3I56 A;  1LT3 D;  4HR7 B;  4MIU A;  4QWE A;  4GS3 A;  3CCV A;  3CCJ A;  2R7Z A;  3ZJY C;  5CGK A;  3J7A F;  5FJ8 G;  4X62 Q;  3R2T A;  4F4X A;  5C6A A;  1TKW B;  4BXX H;  1IKM A;  1Y8O B;  1WTP A;  2B2T A;  1BXT A;  2CH4 A;  5KKN B;  1RHP A;  3PW5 A;  2L5T A;  4ED6 A;  2CVR A;  2F0H A;  2MO0 A;  2CWP A;  2SCU B;  2QKI C;  4O4L F;  3Q8D A;  2PQE A;  4CBV A;  2VQD A;  2CFM A;  3LWB A;  2F0T A;  3K0Y A;  1DV2 A;  1GHK A;  4RNM A;  4KHP H;  3W1B A;  5LA6 F;  3I8Z A;  4R4C A;  1HZA A;  4LF7 L;  3L4J A;  3BJY A;  2C2R A;  2OT2 A;  4HIM A;  5GAG C;  4C5C A;  2WAQ G;  4GLV B;  1PMR A;  3H15 A;  3RBE A;  1A63 A;  4C3I G;  3RLF A;  3DEO A;  1W6K A;  3FEW X;  2AKW B;  4NB3 A;  5LMN L;  5CBA E;  1IYU A;  4KN7 C;  4HJ9 A;  1PV4 A;  1DCZ A;  2JQO A;  5C0X J;  5KFW A;  3PR5 B;  3UI2 A;  3DUZ A;  5KG0 A;  1TS5 A;  4LFC H;  4IN3 A;  4RMF A;  5BN4 A;  1DYQ A;  2UUB Q;  2ASD A;  4JI6 Q;  2JA6 B;  4NDX A;  4DXG A;  1CUK A;  1CK1 A;  1WTH A;  4A76 A;  5KEE A;  3JRW A;  1ESF A;  1ZKO A;  2LXJ A;  1JOO A;  5GRO A;  5KFD A;  4DR1 Q;  1KD1 C;  1B7Y B;  5KG4 A;  2D62 A;  4CDE C;  1CE8 A;  3TQ1 A;  1JB7 A;  2B29 A;  3A74 A;  5CV9 A;  4BBS G;  1M0T A;  5KYI A;  5EWE A;  1QZH A;  1FD7 D;  4J9P A;  4UAI A;  4QUF A;  2AGO A;  1K9M C;  1IHZ A;  4H02 A;  1ILQ A;  1GUN A;  1WTQ A;  1JMC A;  1U0L A;  1BOS A;  1HTL D;  2NVT B;  4YY3 L;  3GIM A;  2NB0 A;  3K5O A;  3BA9 A;  4DAY B;  4DL6 A;  4JI1 H;  1B3A A;  4NXM H;  2B63 B;  3X3M A;  4B3S L;  3CCM A;  4Z9C B;  1ENA A;  2VL6 A;  5FKA C;  1IBM H;  3KLR A;  1TWG A;  4ULL A;  5KRU A;  3C2P A;  2Q8T A;  4TUY F;  4L5Q A;  4NPS A;  5EWG A;  1EIG A;  1V9P A;  4KHP Q;  2YL2 A;  3CQZ B;  2VUM B;  3L9A X;  4DR6 L;  3KTM A;  4QQB X;  1GD7 A;  5J22 A;  4GC6 A;  1AFP A;  1I50 A;  4TV9 F;  3TS0 A;  2CCZ A;  3H94 A;  1S5E D;  4HAE A;  2F52 A;  4PWQ A;  1TWF B;  2PW7 A;  1YJ9 A;  3AB9 A;  4BY1 G;  2DWC A;  3K5H A;  4X6A H;  2ALY B;  5LMU H;  1Q81 C;  3OHX C;  3H0G B;  4GKJ L;  1CQJ B;  4A75 A;  3NWS A;  4LF9 L;  4LFC Q;  3V6K A;  3O13 A;  3AMU A;  3J81 L;  5T1G A;  4HR7 A;  1B4O A;  3P7J A;  1CHP D;  2R87 A;  1CKN B;  2F1M A;  1EFI D;  3OPO A;  1NR4 A;  2KCT A;  5E4X A;  1KNA A;  2L0C A;  2L15 A;  3AYH B;  2YZN A;  3KDF B;  1AE3 A;  5IP9 G;  4A93 G;  4V0B A;  1X56 A;  1PH9 A;  2YS7 A;  3K5I A;  2A6H D;  3H3V I;  3ER0 A;  3F8T A;  3S1Q H;  1LUZ A;  2HHH H;  3PVX A;  2FMC A;  4P74 A;  2V4D A;  1CKO A;  4DV3 H;  4DN4 M;  1F2M A;  4LFB Q;  4ECW A;  1O7Z A;  2PZU A;  4ZKC B;  4NLG A;  2PO4 A;  4C3J G;  1N32 L;  4JC0 A; 
#chains in the Genus database with same CATH homology
 1YIT A;  4GNX B;  1TWC H;  4LUZ A;  1M90 C;  4DR4 L;  2UXD Q;  1CSQ A;  4JI1 Q;  4A3J H;  4NXM Q;  2K5H A;  3H0G G;  4JYA Q;  1IBM Q;  2UU9 Q;  3I4N G;  4KHP L;  2UUA L;  1T9H A;  3E9H A;  1DGS A;  1G29 1;  3H3V H;  1UE1 A;  1E7Z A;  1Q1B A;  1EYG A;  1PH2 A;  4UP8 A;  3S24 A;  4OWW B;  3KF6 B;  2D0P A;  5JJI A;  3GDE A;  4TVA B;  3HOX G;  1K8A C;  4JI3 L;  4WJ4 A;  5GAD C;  4R4Q A;  4GN4 B;  4BY7 G;  1XMQ L;  4YCW A;  1VQH A;  3STB C;  3PO3 H;  4R4I A;  1VCI A;  5C3E H;  1PH4 A;  1VQ5 A;  3GTP H;  3I4M G;  3CCS A;  2PI2 A;  4DAM A;  1YIJ A;  1SLJ A;  1WYD A;  4BBS H;  2IT1 A;  1X54 A;  4AQY L;  1XNR L;  1OXV A;  1QVG A;  4ALP A;  3L2P A;  2A8V A;  2UXB Q;  4LFC L;  5LMU Q;  4GNX C;  1E1O A;  4UY8 C;  3J81 j;  4PG3 A;  1VQO A;  1HJP A;  2YV5 A;  3JAM c;  2K50 A;  1SRU A;  3OW2 A;  4PZ8 A;  3HOV G;  1I3Q H;  4GLA C;  4UP9 A;  2YU9 H;  1I6H H;  1YHQ A;  3CCL A;  5IYB H;  2EIF A;  4DR5 Q;  3PUX A;  4APV A;  2FXQ A;  3PV0 A;  4L5T A;  4UP7 A;  1X65 A;  4DR7 Q;  5C0X G;  4B3T Q;  5K36 G;  4A3B G;  2K4K A;  3PGZ A;  1WCM G;  3M4P A;  1Y1W H;  1PVO A;  4KI0 A;  4LFB L;  3KYH C;  4R4O A;  3OTO Q;  2E2J H;  1VQK A;  4JI0 L;  1YJW A;  4DV0 L;  1VQN A;  2HHH Q;  3CC2 A;  2DUD A;  4DV3 Q;  4HJA A;  1L1O C;  4HIK A;  3PF5 A;  1R9T H;  5C4X G;  1ASY A;  2UU9 L;  4LF5 Q;  1U5K A;  4BA1 I;  2YTX A;  4MZ9 A;  4GOP A;  4BY1 H;  3S16 H;  1WJJ A;  3UDG A;  4IOA A;  1L0W A;  2K5V A;  2VY3 A;  5E7N A;  2JJQ A;  1IZ6 A;  1VQA A;  4DUY Q;  2QEX A;  4LNQ A;  2IHE A;  1KRS A;  2NVT H;  4POG A;  2GN5 A;  1E1T A;  2NVX H;  2ZJQ A;  1VQF A;  4P71 A;  1HR0 W;  4A3D H;  2IY5 B;  3S15 H;  4A3M G;  3M4O H;  3E0E A;  2PNH A;  4DV5 Q;  3TS2 A;  4R4T A;  1NMG A;  2OQ0 A;  1L2F A;  2ZJR A;  2WP8 J;  4YCV A;  3A0J A;  2VW9 A;  2VQE L;  4BA2 I;  5FLX c;  3KF8 B;  1OTC A;  4OX9 Q;  4HJ8 A;  1M1K C;  4QL5 A;  1YEZ A;  4MNO A;  4HIO A;  4LF4 Q;  5IYC H;  2Q2T A;  4B3M Q;  1N34 L;  4A93 H;  3S1R H;  2JA8 G;  3HKZ E;  3I7F A;  1XNQ Q;  4A3L H;  4ME3 A;  2RF4 A;  1VQJ A;  3CF5 A;  2R7Z G;  5JEA G;  4DV2 Q;  4HJ5 A;  3HKS A;  1CKN A;  1EWI A;  1EFW A;  4WJ3 M;  1HR0 Q;  4OON A;  3BJU A;  1VQ8 A;  5C44 H;  4C3J H;  4A3K H;  2RHS B;  3HOY G;  4YWL A;  3CC4 A;  4JBM A;  4IFD G;  1GVP A;  2YTY A;  4IPG A;  4DNI A;  5H1S E;  4DR5 L;  1E3P A;  2BA0 A;  1QZG A;  3RNU A;  1N36 Q;  4RG1 A;  3H0G H;  3F2B A;  4JI8 Q;  3HKZ G;  4DR7 L;  2D0O A;  3I4N H;  2VNU D;  2I0Q A;  4GN5 A;  3KFU A;  1N33 Q;  4JBW A;  2AWO A;  3AFP A;  3L0O A;  3CXC A;  4IOC A;  1K83 H;  2HHH L;  3T1H L;  2GVA A;  3NEL A;  4JCV E;  4DV4 Q;  4JI2 L;  1XPU A;  4DV3 L;  2HQL A;  3HOX H;  4GNX A;  4YHH Q;  3K7U C;  2ZTD A;  3AFQ A;  1JE5 A;  1CSP A;  4DR1 L;  4DR3 Q;  4JI4 L;  1VQ6 A;  1Q1E A;  3CP0 A;  2C35 B;  2WB1 G;  2Y0S G;  4GLX A;  1KQS A;  3CCQ A;  3K0X A;  4P72 A;  2UUC Q;  4LF5 L;  3LGJ A;  1H95 A;  3I4M H;  3PF4 A;  3JC6 6;  3I55 A;  4LUV A;  1D7Q A;  1QUQ A;  5LMN W;  4DK3 C;  5C0X I;  4DV6 Q;  2JA9 A;  1PH3 A;  5GQO A;  4DV5 L;  4DUZ Q;  3HOZ G;  3TQY A;  2ZM6 Q;  3F2C A;  2OTL A;  1I5F A;  4LF7 Q;  4C3I H;  3KOJ A;  1EQQ A;  1KC8 C;  4OX9 L;  3J7Z C;  4LF4 L;  2N78 A;  1P8L A;  1PFS A;  4MTN A;  4JI7 Q;  1SFO H;  5GAH C;  2PQA A;  1XNQ L;  1BBW A;  3AQQ A;  5IYD G;  1XJV A;  1PH5 A;  1S40 A;  4DV2 L;  3J80 i;  1NE3 A;  3GTK H;  4A3B H;  1WCM H;  3T1Y L;  3CD6 A;  4Y52 H;  1LYL A;  3J81 c;  1SRO A;  2YTV A;  1B70 B;  2HIX A;  3ULJ A;  5GAE C;  3GTL H;  4IJL A;  1FGU A;  1X3F A;  1N36 L;  3WWV A;  4DV1 Q;  5J3B A;  1KL9 A;  4QGU A;  2Q2H A;  1PH7 A;  5C4X H;  1XPO A;  2N8N A;  1HNZ Q;  5FLM G;  2R93 G;  2AWN A;  2BH8 A;  3K81 C;  1KHI A;  2EXD A;  1E22 A;  4JOI A;  4DR2 Q;  1IBK Q;  1S72 A;  2OQK A;  4A3G G;  5EAY A;  3PCO B;  4PZ7 A;  3UDX A;  1NY4 A;  1L1O B;  3PIP A;  1VQP A;  1YI2 A;  1J5E Q;  4LF6 Q;  3TRE A;  1FJG Q;  4YHH L;  2KHJ A;  3HOW G;  1YZ6 A;  1RIP A;  2NVY H;  3I4O A;  3U50 C;  3M85 A;  4DR3 L;  1I94 L;  2UUC L;  5M5Y H;  4OO1 G;  2NN6 G;  4DK6 C;  4A3M H;  1HNW L;  1K3R A;  2PMZ E;  2B3G A;  3CME A;  5C4J H;  3M3Y H;  3W5O A;  2N3S A;  3STB D;  1X6O A;  4A4I A;  1VQ4 A;  4POF A;  1IBL Q;  1G6P A;  4O0A A;  1WFQ A;  4A3E G;  5JJK A;  3DM3 A;  4DV6 L;  1TXY A;  2E2H H;  2JA8 H;  1SN8 A;  2HIV A;  1VQ9 A;  3CPF A;  1VQL A;  1WI5 A;  3PUZ A;  1A8V A;  1VQG A;  5HY6 A;  2LXK A;  3M9B A;  1YJN A;  4JBK A;  2R7Z H;  3U4Z A;  2R7F A;  5IWA Q;  2OTJ A;  3GD7 A;  4JV5 Q;  3HOY H;  2KBN A;  2UXD L;  1SE8 A;  1SMX A;  4YWM A;  4TQU S;  4JI1 L;  4NXN Q;  1PYB A;  5IP7 G;  4NXM L;  5C44 G;  4DR6 Q;  4JYA L;  1RL2 A;  2I5M X;  1IBM L;  1B8A A;  3AEV A;  1PH6 A;  4LF8 Q;  3M7N A;  3KJO A;  1D8L A;  3GTO H;  4A3C G;  4KLK A;  4OWX B;  3PUY A;  1Q86 C;  1BKB A;  2MNA A;  3RR5 A;  3K7A H;  4K0K Q;  2ES2 A;  1V1Q A;  5ELO A;  4JI5 Q;  3CC7 A;  1Z9F A;  5AJ3 Q;  4JBJ A;  2AMC B;  3FKI G;  3UE1 A;  3CPW A;  4BXX G;  4B3R Q;  1MJC A;  3S14 H;  4IPC A;  4DV7 Q;  1BVS A;  3S2D H;  1XMO Q;  4OWT B;  4LF9 Q;  1OXX K;  2N49 A;  2RCN A;  3M4Q A;  4IPH A;  4DR2 L;  2AHO B;  5ELN A;  1IBK L;  1ASZ A;  1J5E L;  2BH2 A;  3ICE A;  2ID0 A;  1FJG L;  2Q2I A;  4XTC S;  4LUO A;  2UXB L;  1NBW A;  5IP9 H;  2LSS A;  5LMU L;  1X3E A;  4QJF A;  5C3E G;  1YVC A;  1X9N A;  4GKK Q;  4KHZ A;  2NZH A;  2JE6 I;  1YNX A;  2NVQ H;  4QIW E;  3HOZ H;  1A0I A;  3FHW A;  4XIG S;  1Q46 A;  1WOC A;  1X3G A;  2EQS A;  2UXC Q;  1VQ7 A;  3BZK A;  1IBL L;  1EUJ A;  1OXU A;  3KDF A;  4Y7N H;  1N8R C;  2QA4 A;  2WB1 E;  3G48 A;  2Y0S E;  4X64 Q;  1N9W A;  4IO9 A;  4B3T L;  3OYY A;  5IYD H;  3MEF A;  3ULP A;  2OWO A;  1LTL A;  3OTO L;  4DR4 Q;  4P73 A;  5IWA L;  1O7I A;  3J80 c;  4OO1 I;  2JA6 G;  1MJE A;  4NXN L;  1NMF A;  1Y1W G;  1XTD A;  3GTM H;  3PSI A;  1EIF A;  2I5L X;  1J6Q A;  1KAW A;  2NZO A;  1HZC A;  5M3M G;  4YCU A;  2R93 H;  5FLM H;  4GN3 B;  1GM5 A;  4L5R C;  4LF8 L;  2F4V Q;  4JI3 Q;  1MKH A;  4DUY L;  4A3G H;  2KCM A;  1UE7 A;  5HGQ A;  3GTJ H;  1C0A A;  1XMQ Q;  4A3F G;  1GO3 E;  1IXR A;  2KEN A;  3KF6 A;  4JI5 L;  1TWG H;  3D31 A;  1Q12 A;  3HOW H;  1NJI C;  1CKM A;  2JK8 A;  3SGI A;  2R92 G;  4B3R L;  3K80 C;  2I5H A;  4DV7 L;  3MXN B;  1VQM A;  4DKA C;  3CCR A;  1XMO L;  1S3O A;  4PZ6 A;  1MIU A;  2ZTC A;  3PUV A;  3UDI A;  5IY0 A;  3HOV H;  2B63 G;  5M5X H;  2Z6K C;  2VQF Q;  1VQC A;  1PHJ A;  3HOU G;  1L1O A;  4B3M L;  3S1N H;  4GOP C;  3U4V A;  1I50 H;  2ZTE A;  3ULL A;  4A3E H;  4GKK L;  3NBH B;  1KRT A;  3KLW A;  1V43 A;  2GVB A;  5M3F G;  4HID A;  3TRZ A;  1E24 A;  3NEN A;  1K73 C;  2IX1 A;  4AH6 A;  1NTG A;  1W2B A;  5LMN Q;  1Z47 A;  2IHF A;  1X55 A;  4UPA A;  1HR0 L;  2HT1 A;  2VUM G;  3CMA A;  2K5N A;  1Q8K A;  2UXC L;  5DLQ E;  3A5U A;  1UEB A;  2VS1 A;  5IE8 A;  3KJP A;  1OXS C;  2E5L Q;  2ATW A;  4X64 L;  3L7Z C;  5IP7 H;  1YHA A;  2R7D A;  2Z0S A;  4AYB G;  4JI8 L;  3G4S A;  4JI0 Q;  4DV0 Q;  3CAM A;  1IL2 A;  1VQB A;  3GTQ H;  4JG2 A;  3EN2 A;  3S2H H;  4O2D A;  4A3I G;  4P75 A;  1N33 L;  3PIO A;  4A3C H;  2CKZ B;  4BBR G;  3I56 A;  4GS3 A;  3CCV A;  2A19 A;  1PYS B;  4DV4 L;  3CCJ A;  3ZJY C;  2F3I A;  1UE5 A;  1Y1V G;  5FJ8 G;  4X62 Q;  3FKI H;  1PH8 A;  5M5W H;  3PO2 G;  3B6Y A;  3GTG H;  4BXX H;  1QUQ B;  3HFZ B;  3RLO A;  2F4V L;  4IFD I;  3G71 A;  4X66 Q;  3EBE A;  4X65 Q;  1KIX A;  1JJC B;  2WAQ E;  2A1A A;  4IJH A;  4LFA Q;  2MO0 A;  1FVI A;  4YY3 Q;  1Q7Y C;  2CWP A;  4AIM A;  1OXT A;  3Q8D A;  1Q82 C;  1PH1 A;  3E9I A;  2CFM A;  3PUW A;  2CQO A;  2VQE Q;  4B3S Q;  4DUZ L;  2R6G A;  3W1B A;  2ZM6 L;  2MO1 A;  4R4C A;  1HZA A;  3FP9 A;  1K8G A;  1C7Y A;  4LF7 L;  1N34 Q;  2PQA B;  4BY7 H;  3J7A 5;  1EIY B;  3A5Z B;  1HH2 P;  2VQF L;  1AH9 A;  2MFI A;  4HIM A;  5GAG C;  2JA7 G;  1LM0 A;  2WAQ G;  4R1J A;  4GLV B;  4JI7 L;  3H15 A;  2JA5 G;  3DLL A;  1A63 A;  3RLF A;  1YBY A;  3G6E A;  2AKW B;  4NB3 A;  2K14 A;  2E8G A;  1P16 A;  5LMN L;  4HJ9 A;  4A3J G;  4JI4 Q;  1PV4 A;  2IX0 A;  2JQO A;  3F1Z A;  3NEM A;  5C0X J;  1KXL A;  2WFW A;  3J81 i;  1FL0 A;  3F2D A;  2E5L L;  2JA6 H;  4DV1 L;  4RMF A;  2MQH A;  3K8A A;  3RLN A;  1HNZ L;  2UUB Q;  4GKJ Q;  4JI6 Q;  1TWA H;  1TWH H;  3I2Z A;  2E2I H;  5M3M H;  3T1H Q;  4LW1 A;  4JI2 Q;  1CUK A;  4YWK A;  4A76 A;  1HNX Q;  1EOV A;  2LXJ A;  5GRO A;  2Z6K A;  4DR1 Q;  3PO3 G;  1C9O A;  1B7Y B;  1XPR A;  2D62 A;  4A3F H;  1KD1 C;  4LF6 L;  1JB7 A;  2B29 A;  3A74 A;  4BBS G;  4X62 L;  3GO5 A;  1QZH A;  2JEA I;  2R92 H;  4OXP A;  3U58 A;  3RN5 A;  2PI2 E;  1K9M C;  4H02 A;  1VS0 A;  2RHQ B;  3EIV A;  4X66 L;  3JAM i;  1JMC A;  4X65 L;  1U0L A;  2JEB I;  4LFA L;  4YY3 L;  2B63 H;  3HOU H;  2ZJP A;  1VQD A;  4DAY B;  1JT8 A;  5BR8 Q;  4JOI C;  3CCM A;  5M3F H;  3D0F A;  4B3S L;  2VL6 A;  2K52 A;  1N32 Q;  5IYB G;  1QVC A;  3S17 H;  1K0R A;  3RN2 A;  3CQZ H;  2VUM H;  4L5Q A;  4NPS A;  5JEA J;  3ERS X;  4DPG A;  1YHB A;  4GOP B;  4JV5 L;  1V9P A;  4KHP Q;  2K75 A;  2QGQ A;  1A62 A;  2NN6 I;  1PA6 A;  2UUA Q;  2H5X A;  4L5S A;  4DR6 L;  1G51 A;  3TEH B;  3T1Y Q;  1UE6 A;  4QQB X;  1GD7 A;  4EX5 A;  4IFD J;  1JJG A;  2XTI A;  2DGY A;  1HZB A;  4J15 A;  1TWF H;  1W3S A;  3IRB A;  3TS0 A;  4A3I H;  2CCZ A;  4QY7 A;  2F52 A;  4BBR H;  3RZO H;  4K0K L;  5JJL A;  4IPD A;  1YJ9 A;  4BY1 G;  1VQE A;  4X6A H;  2ALY B;  5AJ3 L;  1QVF A;  2OCE A;  2YYZ A;  1IYJ B;  1Y14 B;  1Q81 C;  2UUB L;  1Y1V H;  5FJ8 H;  4JI6 L;  4GKJ L;  4AQY Q;  1XNR Q;  4A75 A;  3PO2 H;  2VZA A;  4C3H H;  4LF9 L;  3VDY A;  4LFC Q;  1HNX L;  4HJ7 A;  1EQR A;  4A3D G;  3BZC A;  1UWV A;  2ASB A;  4EQ5 A;  3BU2 A;  1HZ9 A;  1BBU A;  2V1C C;  4PMW A;  1CKN B;  1HNW Q;  3UDF A;  4AYB E;  1GKH A;  2KCT A;  3UE0 A;  5IT9 c;  2XGT A;  4LWC A;  2L15 A;  3AYH B;  1VQI A;  2BA1 A;  3KDF B;  1AE3 A;  4FDB A;  5IP9 G;  5IYC G;  3RZD H;  1JJ2 A;  1X56 A;  4A93 G;  3CCE A;  3CCU A;  1PH9 A;  1AE2 A;  3H3V I;  4A3L G;  3ER0 A;  1I94 Q;  4C2M H;  3F8T A;  3S1Q H;  1LUZ A;  3CW2 C;  4P74 A;  1CKO A;  3S1M H;  2JA7 H;  1SR3 A;  3W1G A;  4LFB Q;  2Q2U A;  2KHI A;  2JA5 H;  2CWA A;  5BR8 L;  4A3K G;  1N32 L;  4JC0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...