3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
4AYBG 1X6OA 3KDFB 4QL5A 3STBD 3I4NG 2IX0A 2PI2E 3K0XA 1Z9FA 3D0FA 1V1QA 3FP9A 3L0OA 3F2CA 3PUYA 2Z0SA 1IXRA 2D0OA 1UE7A 4OWXB 5LMNW 2JA7H 2MO1A 3W1BA 1K3RA 5C4XH 1A8VA 3HOWG 4JI3Q 4DR4Q 4AIMA 3NENA 4GLAC 4NXNL 5GAGC 5C0XJ 1K8AC 1VQLA 1S3OA 1NMFA 4JC0A 4DR1L 1JE5A 2B63G 4GLVB 4JG2A 2HHHL 3PUZA 1J5EQ 3EN2A 4BXXH 4RMFA 3JAMi 4IO9A 1D8LA 5IYCG 4DV5L 2UUAQ 4DV1Q 2UXCQ 1EFWA 4A3DH 4R4TA 2UXCL 3CCEA 2YTYA 3HOUH 3H15A 1UEBA 1YVCA 4X66L 4UP7A 4NB3A 2UXDQ 2PI2A 2R93H 3RNUA 3CCRA 1XTDA 4EQ5A 1VQOA 1VQHA 1G291 1TWCH 4GS3A 2KCTA 4A3JH 2ES2A 4GKKQ 4JOIA 3D31A 5C3EH 2RCNA 4YWKA 1XMOQ 4XIGS 4JI5Q 1Y14B 1J6QA 1RIPA 2WB1E 4X62Q 1Z47A 4DR5Q 3UE0A 1VQ7A 1EWIA 1BVSA 3K81C 3CCJA 3S2DH 3T1HQ 2HIXA 1YZ6A 4XTCS 1IBLQ 1KXLA 2OTLA 2UU9L 4JI8Q 4JI8L 4JCVE 4JYAL 1NY4A 2BA1A 1FJGQ 1YHBA 1Q7YC 1IYJB 1MJCA 1TWGH 1SE8A 4IOCA 1VQKA 1PH9A 4QY7A 1SN8A 1VQCA 4MTNA 4DPGA 3S16H 1G51A 2OQ0A 2JA5H 1PFSA 2UUBL 4A3CH 4LFAQ 2UUBQ 1K83H 2B63H 2YYZA 1M1KC 1XNQQ 4MNOA 4YCWA 2EXDA 2A19A 4DV6L 4GNXC 1E7ZA 1X3EA 2UUCL 5M5XH 1OXXK 4AH6A 1PH2A 4HJ8A 2HHHQ 2MO0A 4UPAA 1J5EL 4QQBX 2NVYH 5C44G 1JJGA 4DUZL 1EOVA 1E3PA 2ZM6Q 1IBMQ 4BY1H 4DUZQ 3PO3H 1JMCA 4DV1L 5IP9G 3KOJA 1VQNA 1RL2A 1CKMA 1L2FA 4A3FH 2NZOA 5ELNA 1A63A 4A93H 1PV4A 2KENA 3J81j 2I5HA 1YIJA 2R7ZH 1Q1BA 1JB7A 1FGUA 1QUQB 3S1NH 2EQSA 2ZTDA 4MZ9A 3J81c 4LF5L 1PH8A 3PO2H 2D0PA 2KBNA 4FDBA 1YJNA 5GADC 2DUDA 2K52A 3G48A 1HNXL 3VDYA 2Z6KC 2VQFQ 2ZJQA 2F4VL 4DV4Q 3I2ZA 3ERSX 4C2MH 4O0AA 4DV4L 2PQAB 1L0WA 3PF4A 2AMCB 4IPHA 1T9HA 2KHIA 3TS0A 3KLWA 2VQEL 2OWOA 1VQDA 4C3HH 1PYSB 3ULLA 2BA0A 1N9WA 2VNUD 3A74A 3K7AH 2BH8A 1XPRA 4J15A 4P75A 1IL2A 2VY3A 3HOXG 1B8AA 3EIVA 3E9HA 4IFDI 4B3RL 3BJUA 4AQYL 2WAQE 1P8LA 3KDFA 3RLNA 3UE1A 1C7YA 3PO2G 2PMZE 4OX9Q 2Q2HA 1YEZA 1X3FA 1BBWA 3J7A5 1EUJA 4L5TA 4OWWB 1HR0Q 3J7ZC 1MIUA 2NN6G 4JI6L 4DUYQ 4IOAA 2NVQH 1VQ8A 3PO3G 3B6YA 3I4MG 1VQJA 3CPFA 4OWTB 4IJLA 1HNZQ 4DR6Q 3CCVA 3OTOL 1WFQA 2FXQA 3CCSA 3CXCA 4DV2Q 2Y0SE 2R92H 4A3JG 4DV2L 2CQOA 3A0JA 4QGUA 5FJ8H 3CMEA 4HJ9A 4LF6Q 3M3YH 3GD7A 3Q8DA 5LMUL 4OO1I 3RLFA 3I4OA 3U58A 2LSSA 1VQGA 1E24A 4LF5Q 1QUQA 1UE1A 1WCMH 2YTVA 4BY7G 2NVXH 1N32L 4DAYB 4R4OA 4YY3Q 5C4JH 1PHJA 1KHIA 3ZJYC 4DV6Q 2N49A 1A0IA 3A5ZB 4IJHA 3WWVA 2UUCQ 4L5QA 1XMQL 3PIOA 1B7YB 5JJIA 2ZJPA 3JC66 3FKIG 3CQZH 1O7IA 1BBUA 2JK8A 5BR8Q 1I94Q 1X55A 2ZM6L 1IBML 2ATWA 4UP9A 3HOWH 1N36L 2YTXA 1KIXA 3RZOH 5JJLA 1K73C 3OYYA 1OXSC 1VQEA 5IT9c 1VQ4A 4RG1A 5C3EG 3J80c 1TXYA 3GTPH 1SR3A 5IWAQ 3S1QH 3NELA 1OXUA 2RHSB 5FJ8G 1JT8A 5M3FG 1LM0A 3M4QA 4A75A 4GKJL 1Q81C 2VUMG 4ALPA 4GKJQ 4KI0A 1CSQA 1W2BA 1PH4A 4LF9L 1YITA 3LGJA 4UP8A 2NVTH 3K80C 1DGSA 2VQFL 4JI5L 4DK3C 1HH2P 4JI3L 2ZJRA 3HOXH 4DUYL 1PH7A 3AFQA 1H95A 1SRUA 5LMNL 4HIOA 1VQ6A 3RLOA 1S72A 4JI7L 1UE5A 3HOYG 4DR7Q 3CD6A 4A3LH 1Q82C 4L5SA 4GN5A 3KF6B 3RN2A 3G4SA 3E9IA 5FLMG 4KHPL 3GTKH 4A3GG 4LF6L 1SFOH 3PV0A 1GVPA 1UE6A 2JA7G 4IFDG 1QVFA 5J3BA 5C0XG 1YJWA 3CW2C 1R9TH 4WJ4A 4A3GH 4YCUA 3MEFA 1S40A 1XPOA 1FL0A 3STBC 4DKAC 2K14A 3M4PA 3NEMA 1K0RA 2QEXA 4JBWA 4NXML 4APVA 2L15A 5M3MG 1QVGA 3J80i 1VQ9A 3KJOA 3CC7A 3M7NA 4JV5L 3F8TA 1I6HH 4A93G 2NN6I 4JI6Q 1IBKL 2JA8H 2OCEA 2E2IH 1KL9A 4QJFA 1VQBA 3FHWA 4DV0Q 1N36Q 5M5WH 3T1HL 1E1OA 4A3IH 1X56A 3M85A 1IBLL 3S2HH 2NZHA 4C3IH 4K0KQ 1EIYB 1SMXA 2K75A 2ZTEA 5M3MH 5H1SE 2C35B 3PF5A 4R4CA 2K5VA 5M3FH 1WOCA 3W5OA 4A3FG 1NJIC 2E2JH 4LF8L 4OO1G 2UXBQ 1U0LA 2GVAA 1HNWL 4A3MH 4A4IA 2JA5G 2JA6H 4LF9Q 1TWHH 3RZDH 1HNXQ 1VS0A 3HOVH 3BZKA 4JI1L 1I3QH 1PYBA 4DV7Q 4JI1Q 3H0GH 1N33Q 4BBRH 1KD1C 3CCLA 1KQSA 4GOPB 3K8AA 3K7UC 4LUZA 3CCQA 1PA6A 4JI7Q 4WJ3M 4X65L 3OW2A 3RR5A 2AWNA 4B3ML 3HOYH 4HIDA 2UUAL 2WB1G 5GAEC 1VQ5A 3G6EA 3AQQA 2VW9A 2VZAA 2IX1A 1EYGA 4JI4Q 1WCMG 4X66Q 4DR3Q 4X64Q 3KF8B 1E1TA 1N8RC 1MJEA 3NBHB 2D62A 4DNIA 5JEAJ 1XNRL 2BH2A 5E7NA 1XNRQ 1TWAH 3TREA 2MNAA 2K50A 4LUVA 1HZAA 4LW1A 3J81i 2VUMH 3CF5A 3KFUA 3PGZA 4OX9L 2XTIA 2JEAI 4P73A 4GN4B 3ULPA 4NXMQ 1GO3E 4JV5Q 2I5LX 2KCMA 1L1OB 2H5XA 1K9MC 3I4MH 2E2HH 3EBEA 4LF4L 2A8VA 1CKNB 4YWLA 4UY8C 4KLKA 5GROA 4DV3Q 5AJ3L 4LF7L 4JI0Q 4O2DA 3F1ZA 4HJ7A 4LF7Q 3KJPA 3TS2A 1PH3A 4HIMA 1X3GA 4TQUS 1E22A 5GQOA 3GTJH 2HQLA 5FLXc 4K0KL 3GDEA 3CMAA 1UWVA 1KAWA 2WAQG 3F2DA 1ASZA 4B3SL 1FJGL 4LFBQ 3E0EA 2F52A 3CC2A 2UXBL 3BZCA 2AWOA 1VQAA 4POGA 4AQYQ 5C0XI 4A3DG 4GOPA 2Y0SG 4EX5A 4BY7H 2JA6G 3S1RH 5IE8A 2E5LL 5IYDH 4BXXG 4YY3L 1MKHA 1IZ6A 4PZ8A 1I50H 2JA9A 1JJ2A 2KHJA 3GTOH 1XMQQ 4BBRG 3H3VH 4A3KH 5JEAG 1EQRA 1Y1VG 1HJPA 4IPDA 4PZ6A 4R4IA 3G71A 1IBKQ 2AKWB 5C4XG 4B3MQ 4R4QA 4NPSA 2JJQA 3U4ZA 5EAYA 4AYBE 3AFPA 4DV5Q 4LUOA 3JAMc 2XGTA 4A3MG 1HNZL 3GTLH 4DR7L 4DR6L 4JI4L 3I4NH 3OTOQ 2MQHA 4Y7NH 4BBSG 1WYDA 2IHFA 3HKZE 3UDFA 2UXDL 2N78A 4JBJA 2RHQB 3H3VI 4JI2Q 1YBYA 5IWAL 2OQKA 4L5RC 1V43A 3I56A 2CCZA 1CUKA 4LF8Q 5DLQE 1TWFH 1LYLA 4PMWA 4OXPA 4PG3A 3U4VA 1FVIA 4YHHQ 3TRZA 5K36G 5IP9H 3GTQH 2YU9H 1GD7A 1BKBA 1B70B 3TEHB 1VQPA 4NXNQ 4DR4L 1A62A 3GTMH 1EIFA 2ZTCA 4X62L 2N3SA 2PNHA 4DR5L 1PH1A 1SLJA 1G6PA 4P71A 5ELOA 3M4OH 1P16A 4JBMA 4A3EH 4A3LG 1Y1WH 2Z6KA 2MFIA 1AE3A 4C3JH 3M9BA 2QGQA 1YHAA 4YCVA 4LFBL 1K8GA 2CFMA 2JQOA 4B3RQ 1OXVA 1NE3A 3MXNB 2B3GA 2Q2UA 3HOZH 4DR2Q 4YWMA 5FLMH 3PIPA 4DR2L 2F3IA 3L7ZC 3U50C 3T1YQ 1Q86C 4GLXA 3T1YL 1XPUA 4GKKL 1PVOA 4DK6C 1WJJA 1X54A 2VS1A 3L2PA 1YJ9A 2ASBA 3S15H 4GNXA 1NBWA 1Q12A 3SGIA 4LF4Q 4BBSH 3UDIA 5AJ3Q 3UDGA 3CP0A 4DV3L 1AE2A 5LMNQ 5HY6A 1KRSA 5C44H 1HZ9A 4HJ5A 4DV0L 2OTJA 2CWPA 3KF6A 3KYHC 4A3BG 3A5UA 1SROA 3CPWA 4GNXB 4IFDJ 2UU9Q 3HKSA 4A3KG 2I5MX 1AH9A 3FKIH 2R6GA 2LXKA 2K5NA 1XJVA 2IHEA 1Q1EA 5HGQA 4B3SQ 1CKOA 1L1OC 2ALYB 4JI2L 1VCIA 5IYBG 5JJKA 2WFWA 5LMUQ 1VQFA 1PH6A 4A3CG 3PUVA 2R93G 4LNQA 1X65A 5IP7G 3RN5A 1GKHA 2E8GA 4YHHL 4BA1I 2R7FA 3HKZG 4LWCA 2EIFA 3PCOB 4OONA 1C0AA 1C9OA 5IYCH 4JBKA 4DV7L 1L1OA 1YNXA 5IP7H 3PUXA 1HZBA 3UDXA 5IYBH 1LTLA 2PQAA 2GN5A 3F2BA 4R1JA 2B29A 4TVAB 5BR8L 4POFA 1NTGA 2R7DA 2GVBA 3S1MH 1EQQA 1I94L 3GO5A 1HR0W 4A3BH 5IY0A 4JOIC 1M90C 1OTCA 3CCUA 2K5HA 1NMGA 4X64L 3DLLA 1WI5A 5M5YH 1GM5A 3S17H 3I7FA 3I55A 2R92G 3AYHB 1KC8C 1X9NA 2VL6A 4P72A 4BA2I 2JEBI 1VQIA 2IT1A 1W3SA 4A3IG 1QZGA 3HOZG 1I5FA 2F4VQ 2YV5A 4H02A 2LXJA 1PH5A 1V9PA 3HOUG 3CAMA 3S24A 1VQMA 1XMOL 1N33L 2Q2IA 3ULJA 3PUWA 1HNWQ 4KHZA 1D7QA 2VQEQ 2QA4A 1Q8KA 5IYDG 4HJAA 4X65Q 4DR1Q 4JI0L 4A3EG 1CSPA 3BU2A 2JE6I 4A76A 4Y52H 2RF4A 1LUZA 1ASYA 4KHPQ 3ER0A 2A1AA 3H0GG 3CC4A 4DR3L 2HT1A 2V1CC 3TQYA 4QIWE 3HOVG 1KRTA 3W1GA 2AHOB 1YI2A 1N32Q 2CWAA 5GAHC 3CCMA 1Y1WG 1N34Q 4LFCQ 2E5LQ 1U5KA 4HIKA 4LFCL 1N34L 2HIVA 4IPGA 2K4KA 1HR0L 4LFAL 2R7ZG 1CKNA 1JJCB 2I0QA 1XNQL 4GN3B 2DGYA 4P74A 3ICEA 1OXTA 1HZCA 4B3TQ 3HFZB 4IPCA 3AEVA 2IY5B 4X6AH 4B3TL 4PZ7A 2ID0A 1QVCA 2WP8J 4BY1G 3DM3A 2JA8G 4GOPC 1QZHA 4ME3A 4DAMA 2CKZB 1YHQA 1Y1VH 2Q2TA 3PSIA 2N8NA 3IRBA 3GTGH 4JYAQ 1Q46A 3S14H
chains in the Genus database with same CATH superfamily
4AYBG 1A9XA 4KD4A 1GUGA 1SSOA 2R82A 2DPJA 3FEWX 3JAME 1Z9FA 1TWFB 2ZDGA 2Z0SA 2IWHA 2JA7H 3U9TA 2RBMA 5C4XH 4Q0YA 2ALZA 4JI3Q 1J8IA 4AIMA 3GTPB 1K8AC 1VBHA 3GTOA 4NDXA 1JE5A 4HCSA 4JG2A 1NR2A 2WB1A 4RMFA 4A2AA 4IO9A 1D8LA 4RGTA 5IYCG 4DV5L 4DV1Q 2YTYA 3HOUH 3GTOB 4I50F 4EBCA 5M5YB 5KT2A 3VR5A 4U68A 4EQ5A 3CCRA 1VQHA 4ECXA 3ND8A 1TWCH 4GS3A 2KCTA 1STNA 2YZNA 1KNAA 5FD6A 2W9CA 2I07B 1K0SA 1BXTA 1LTID 4JI5Q 4K2LA 1PRTC 1Y14B 1J6QA 1SNQA 2WB1E 5FPOA 4X62Q 1Z47A 2Z8LA 4DR5Q 2F0HA 4Q5VA 5KG7A 3UE0A 1VQ7A 3CCJA 1I3QB 3IKJA 2OTLA 1TWHB 2CQYA 1NY4A 1H9KA 1RODA 2GLTA 5DQGA 1E4EA 1TWGH 5EKLA 2PMZA 2VA3A 3LWUA 4IOCA 1PH9A 3EQLC 4QY7A 1SN8A 3W3AA 1T5XD 2I46A 1JOKA 3OHAA 4C3JG 1K83H 2VQEH 2FB9A 4KV6A 2EXDA 4XQJA 1X3EA 4IRDA 4DK1A 1OXXK 1WD0A 2HHHQ 2MO0A 2WACA 1I6HB 1WH2A 4QQBX 5C44G 4LH7A 4DUZL 1EOVA 1IBMQ 4BY1H 1ZEQX 1JMCA 4DV1L 4U7CA 3KOJA 3GIJA 4C3HB 5C5LA 1CKMA 4DU9A 4A3FH 1N36H 4QUFA 1CA6A 3RB6A 2EJMA 2SDFA 1PV4A 2KENA 3G6JB 4JI0H 1Q1BA 4MTKA 3JSLA 1K8OA 1YJNA 1U9RA 1LTGD 2DUDA 2F4VL 2YZMA 5C0XH 1SYBA 2VQFQ 5KFNA 4C2MH 4O0AA 3CRKC 4IHJF 4IR9A 1LO5D 4B3MH 3KLWA 2VQEL 3ULLA 3IN5A 2L4NA 5KYLA 4RU9A 1CFMA 2VNUD 3VR3A 1EU3A 3A74A 4J6HA 3RV4A 1IL2A 2RCFA 2E2HA 1B8AA 4IFDI 3P75A 3WOFA 3NXWA 5IGDA 2G5DA 2O03A 1RJPA 3C1EA 3KDFA 2HJWA 1SYGA 3RLNA 3UE1A 1AP0A 4OX9Q 1IKLA 1G6ZA 3OMGA 3FPPA 5FLXW 4KY6A 1YEZA 2EYOA 3BDLA 3HG9A 2K33A 4L5TA 2R3ZA 3Q0AA 3HOWB 4DL5A 1MIUA 3R3OA 2F0GA 2YS6A 1VQ8A 1EIGA 1W93A 1I6UA 2K28A 3PO3G 1VQJA 3CPFA 3Q8RB 3J7YW 3PW7A 1HNZQ 1B4OA 3GTQA 4JYAH 1AUXA 2AQ4A 2FK1A 1WCMB 1IOWA 1S5ED 3A0JA 2NVTB 2A5HA 3GD7A 3NBHA 3Q8DA 1TT2A 5LMUL 3RLFA 3M3YB 3I4OA 3U58A 2JA7A 2PYKA 1VQGA 2SNMA 3A8JE 3T5KA 1SDFA 3J7AV 2E76C 1Z6HA 4C1NI 5C4JH 3D8GA 4KY7A 1KHIA 4X3UA 1JIHA 3ZJYC 4ECQA 3A5ZB 1J5EH 1XMQL 1B7YB 2NVQB 3QFFA 1DYQA 5EDWA 1EEID 2GPWA 1O7IA 2IP4A 3RTXA 2VOBA 3URYA 2F3WA 4UP9A 3GTLA 2YTXA 4ULLA 3MEHA 1M6VA 3MC0B 2WAQB 3MFYA 1VQ4A 3N40P 3D4DA 3GTPH 1SR3A 4PWQA 1JT8A 2HCIA 5C4JB 2BQ3A 3GIKA 3GTKA 1LM0A 2K5QA 2O2LD 3M4QA 4LSAA 1Q81C 4YP3A 4XYOA 1HR0H 2B2UC 4KI0A 2JP1A 2TSSA 1QG7A 5DLGA 1E0BA 3JZIA 3K80C 1DGSA 2VQFL 4JI3L 3S14B 2EYJA 1VF5C 2PBZA 4IWXA 5D65A 5C3XA 2A68D 3AFQA 1H95A 4HIOA 1VQ6A 4OGQC 2W6ZA 4OL7A 1Q82C 3GTKH 2Z9HA 3NE5B 1JORA 5EWEA 2KOLA 2WTFA 2K32A 4FNFA 2W9BB 4XYMB 4IFDH 1UE6A 3IG0A 5KFCA 4XQNA 5J3BA 2PW5A 2RQXA 4C3IB 1PK8A 3RGZA 1JR0D 1R9TH 5IGCA 4A3GH 1GJXA 3MEFA 3J81L 1XPOA 2VPQA 2A6HC 4DKAC 5EKKA 2EY6A 2F0QA 4JBWA 2NUAB 5M3MG 4JV5L 2R7ZA 4YY3H 4ME5A 2NN6I 4L63B 2JA8H 1TS4A 2XWJB 3I3CA 1X56A 1VBGA 4WRDA 1T36A 2KCCA 1C3OA 3SK8A 4DV1H 1SMXA 5M3MH 3QZ8A 3OIQA 3MFIA 3VYUA 1DOMA 2ZXPA 2BCOA 4LF8L 2UXBQ 1W96A 3GTKB 1I3QA 2GVAA 5IWAH 3F8NA 4K6DA 1EUDB 4HR7B 3HOVH 4JI1L 5KFOA 4UHVA 4JI1Q 4B3RH 1WVLA 1N33Q 1CQIB 3SE7A 2P5ZX 2R8KA 5KT5A 4FBTA 3FRPB 1EY4A 1OO9B 4JI7Q 4DR4H 3OW2A 5KFRA 2AWNA 2NVYB 2ICEC 2HVQA 3I73A 3ETJA 4KJNA 2FK2A 3PR5B 3KK7A 3AQQA 2FINB 4WORA 1EYGA 2IX1A 1ILQA 1RTOA 1WCMG 2K04A 3BVMA 4C5AA 1E1TA 1N8RC 3NBHB 4DV3H 2D62A 1XNRL 2BH2A 2F0PA 1WTWA 4WFN3 3TREA 2K50A 1DM0B 1B9MA 4LUVA 4RA8A 4X3KA 3J81i 3S16B 1KJQA 4LF8H 2CVRA 2XTIA 3F2UA 4DAYA 1GO3E 4EGQA 4JV5Q 4GKKH 2H5XA 4KY5A 2E2HH 2A74C 2A8VA 4C2MA 3FKIB 1E4EB 5DQHA 4HJ7A 3KJPA 3M9OB 4CHTB 4TQUS 1E22A 2DY7A 4CC6A 1A15A 2HDMA 2HQLA 5FLXc 3KBXA 3CVZA 1GUNA 1KAWA 2WAQG 4UCTA 2L5TA 4EEQA 4CJ2C 2F0MA 3BZCA 1BCPD 1VQAA 2ICIA 3S9WA 5C0XI 4G7OC 1ENAA 2Y0SG 1F2MA 3S1RH 2VB3X 2E5LL 4OHJA 2NVYA 4O1NA 5FPRA 3D3RA 1V51A 3HOZB 4J9QA 4PZ8A 1I50H 2JA9A 4O42A 4DL2A 4A3KH 5JEAG 1EQRA 4GKJH 1M0TA 4IPDA 3G71A 3PIP3 4R4IA 3C0FB 3CU7A 2AKWB 3BA9A 4B3MQ 2Z4HA 4R4QA 5JH7F 2FMCA 4AYBE 3AFPA 4N8X1 5CC4A 5LP6F 1E2ZA 3I4NH 1GGOA 3DHQA 4EFBA 5JPNC 4Y7NH 4BBSG 1WYDA 5CMDA 3HKZE 2UXDL 4M8AA 3H3VI 4IALA 2CW0C 4JI2Q 2B63A 4L5RC 3EPIA 3I56A 3M9NB 5BMVF 3G6XA 5DLQE 4Q43A 1JWMD 4YHHQ 1S5FD 1DV2A 4B3TH 1X3QA 3GTQH 4ZCKA 1BNCA 2BQRA 1O78A 1RF2D 1A62A 5C6AA 1EIFA 2PNHA 4RGNA 5A35A 2FLPA 2UUAH 1IL8A 5EPJA 1SLJA 1PH1A 3GTJA 4P71A 5ELOA 1AW7A 3M4OH 1P16A 1B6RA 4A3EH 4TQRA 4IUTA 2R8HA 1AE3A 5KG4A 2M2LA 1EYAA 1YHAA 4RB2C 1HCZA 1HHVA 4J9LA 2CFMA 3OWEB 1ZYRD 4YHHH 2YL2A 1I50B 2PO4A 4DR2Q 5JQWA 5D1OB 1LABA 4DR2L 3U50C 1ICWA 5JOBA 1XPUA 4DR1H 1U4LA 4QWEA 5CGKA 1JC7A 4DK6C 4LFBH 2VS1A 3EA6A 3OSNA 1PTOF 1NBWA 4BBSH 3VMMA 1C4QA 3UDIA 5IT9E 3CP0A 2B63B 5C44H 4HJ5A 3NGDA 3SVMA 3G8CA 4DV0L 3PW0A 5FKAC 1SBBB 3KF6A 4A3KG 1XJVA 2GPSA 3MAQA 1Q1EA 1BNZA 4YR3A 4BWGB 4B3SQ 1K1QA 5JJKA 3KAKA 3MVVA 5LMUQ 4A3CG 3KBGA 2WDTA 5CORA 4YHHL 1HUMA 4LWCA 1C0AA 5K5PA 1I94H 1XWEA 2F3VA 4DV7L 1L1OA 1PFBA 1YNXA 3ORQA 2DNEA 3V6KA 1QOHA 2PQAA 1JWUD 1SYDA 5C5JA 1IHZA 2MUYA 4Q0FA 4POFA 2GVBA 5DM73 1B50A 3LP8A 3GO5A 4A3BH 2BDNA 1K8MA 1KJ8A 5KG3A 4PNYA 5IY0A 5KFFA 1SEBD 3JRWA 3BYTB 4X64L 2P0AA 3KHLA 3E6ZX 1FNUA 1WI5A 3V2TA 5M5YH 2YRXA 3S17H 5KFHA 5CBEE 4XDXA 1JX4A 4P72A 3IL8A 4BA2I 4FF1A 1Y8NB 2XIGA 3TDQA 1QZGA 3DEPA 3GP7A 3SR1A 2UVRA 5CV8A 2F0WA 2YV5A 4EBEA 2LXJA 1Z7TA 2W8KA 3NBIA 4EYIB 2AGQA 3CAMA 4V0BA 1VQMA 1N33L 4NP5A 2XC9A 3PUWA 2O4XA 1LT5D 1AEXA 4HEDA 4IQZA 4HJAA 4JI0L 1D5MC 2R8JA 3A7AB 1PZKD 4Y52H 2F0DA 1LUZA 1Q3LA 4KHPQ 1CQVA 3H0GG 4O3NA 4AQYH 1B6SA 3BS1A 1S68A 2V1CC 4QIWE 3HOVG 1KRTA 1BGWA 5EPKA 2AHOB 1QE6A 3VR6A 2CWAA 2XSCA 4X62H 4DR5H 3V96A 5ELDA 3VA7A 3CCMA 4O3SA 4LFCQ 1SXTA 1KJ9A 4LFCL 2KEEA 4IPGA 2K4KA 4RGMA 2C28A 2I0QA 1JJCB 1AFPA 2DGYA 1DD2A 2B2TC 1RTNA 1KDBA 3AEVA 2IY5B 1S5DD 4EGJA 1LLRD 3O13A 1BOSA 2M00A 5I2XA 1S9FA 2RDFA 2CKZB 1YHQA 3TIIA 2ASLA 1QILA 1JB3A 3PSIA 2BE5D 2N8NA 4JYAQ 4TV8F 4ETSA 2NU7B 2H4OA 3HOXB 2IPKD 2RGVA 1HNZH 4TSSA 4UFZA 1X6OA 2X6LA 2A6HD 3H4BA 2PI2E 4I65A 1HQMC 3FP9A 3K0XA 4YQWA 1QWYA 5IT9W 1UE7A 1I4RA 2QW7A 3HZXA 3W1BA 2IX3A 3Q23A 1A8VA 4N8FA 4U6PA 5KNBA 4GLAC 4NXNL 1Y69U 4LH6A 2Z1CA 1NMFA 2F0NA 3JAML 1KTKA 4FF3A 1SE4A 3N52A 4FXGC 1J5EQ 3I4MB 4JI8H 1U4PA 2D5DA 2UUAQ 1GHKA 1KEEA 2UXCL 4RZQA 3L4KA 1KJJA 1YVCA 1WTPA 2UXDQ 5J2UF 3GIPA 2F0SA 4UCVA 2KJXA 3NSWA 3RNUA 4HNUA 5KX5F 4ECZA 3RBDA 1V1PB 2EOTA 1Y1WA 3NQIA 1TKWB 1BUVT 3GV6A 2OF1A 4EQPA 5C3EH 2RCNA 1SCUB 1CQFA 1XMOQ 1ZETA 1XNRH 2VQDA 1ET6A 5BN3A 1MSHA 4E4TA 3MXGA 3S2DH 4DR7L 1EWIA 3K81C 5EZYF 3T1HQ 1SYEA 1EY6A 1SNMA 4XTCS 1M4VA 1TAEA 4JI8Q 4I7HA 3DWAA 4JI8L 5CAEB 1PX2A 3WOEA 2F0EA 1YHBA 1IYJB 1RYSA 5IODA 5M3FB 3QOLA 1VQKA 1EY7A 2Y0SA 3TP8A 1VQCA 3S16H 4EYHB 5LMUH 2OQ0A 4J0MA 1ULZA 5IOCA 4B3SH 2J6SA 3NHHA 4IURA 4O4HF 1LT6D 4C5CA 2C22A 4MNOA 2FMMA 4DV6L 2D2CC 2UUCL 1PZJD 1E7ZA 4DV7H 5J2TF 5M5XH 4AH6A 1A3TA 4UPAA 3HOYB 5I9OA 1JJGA 2ZM6Q 4O3PA 4TQSA 1B9NA 5IP9G 4WD3A 2XGQA 2VQFH 1VQNA 1NCVA 5CA0F 5FLXE 3WDNA 4KMUC 4IUNA 2A6ED 3SK5A 4A93H 3VR4A 3J81j 2KCNA 2CH4W 2R7ZH 4DL7A 1RD9D 5D1PA 2IBKA 2ZT9C 1QUQB 3S1NH 4IUVA 2R85A 1RJTA 4LF5L 1PH8A 3R23A 1Y1WB 4MTEA 2KBNA 4FDBA 5HV6A 2EZVA 1HNXL 1EQVA 3I2ZA 4DV4L 1XX8A 1L0WA 4A93B 4IPHA 2AMCB 1T9HA 4ECUA 1CZWA 4C3HH 2PQEA 1PYSB 4A2BA 3T5LA 3EYYA 1PRTD 2VB2X 2HGSA 1G2TA 5C8YF 3LNNA 1R9TA 2XVSA 1GOZA 4DV4H 1U4RA 2BH8A 1XPRA 2VPSA 2EYFA 3T5JA 4NMZA 4P75A 4DXFA 4XQQA 4BWSC 5DNFA 5LXTF 1EYDA 3EIVA 4B3RL 5L1JA 4AQYL 4ED1A 2K01A 2WIIB 5F9LA 3I4NB 4HSVA 3J7A5 1BBWA 1EUJA 1FGBD 2BOSA 1MD2D 1SFOB 5KKNB 3J7ZC 2NN6G 1TR5A 2B2YC 5KFSA 1EY9A 4DUYQ 2NVQH 3NP8A 4FS2A 2NBFA 4RB0A 5DEHA 4RAYA 2HVRA 3I4MG 2WB1B 3NWTA 3CCVA 3I12A 4LK1C 2FXQA 2L11A 2Y0SE 4DV2L 3CMEA 5FJ8H 4LF6Q 4JK1C 2KVMA 2LSSA 4LF5Q 1DCZA 1UE1A 2YTVA 3MR2A 4R4OA 3T53B 3CRLC 3DXJC 4DL3A 4DV6Q 2UUCQ 3WWVA 3KLSA 5JJIA 3JC66 1BBUA 5TSSA 5BR8Q 1X55A 2ZM6L 1N36L 3FDSA 3RZOH 2JA6A 5JJLA 3TSSA 1OXSC 3QB3A 4HTHA 5GONF 1I4PA 3ITPA 5IT9c 3DM1A 5C3EG 4LF9H 2NUCA 1TXYA 2RDJA 3S1QH 5FJ8G 1OXUA 4JPBW 3U9OA 2NTTA 5M3FG 4DAPA 1EWHA 4A75A 4GKJL 3IFTA 4GKJQ 5LMNH 3HRZC 4LF9L 1V4YA 1YITA 3LGJA 4QB4A 2HDLA 4DK3C 5DG7A 1BDOA 3P1HA 4QW9A 5LMNL 3DUZA 3HOYG 1EHIA 1UE5A 5AFWA 3K5HA 2UUBH 4A3LH 5BR8H 4L5SA 4GN5A 1GYFA 1XXGA 3QJYA 4MIUA 3J80E 4KHPL 1LTAD 2KECA 4ZAIA 4MN3A 5KNDA 4LF6L 1TWAA 1SFOH 2EY1A 2ZJTA 1GVPA 2JA7G 3T16A 4MV8A 5C0XG 3CW2C 1S5BD 1I7LA 4HYKA 5JJZA 1S40A 1GUWA 3G6VA 2K14A 3NEMA 4ZI7F 4NXML 1MHWC 5FO7B 5KFDA 3CC7A 3K5LA 4A93G 1XTCD 1K28A 4JI6Q 4RUAA 4J9OA 1IBKL 2Q8RE 2OCEA 1O7ZA 5KRUA 1KL9A 3FHWA 4DV0Q 5CV5A 3VPDA 1E1OA 5KIXA 3S2HH 3EROA 3NUCA 4OIKA 2NZHA 1AZQA 3MR3A 5KT7A 2K75A 3MXNA 3NK9A 1I4XA 1A2TA 2C35B 3I8ZA 5M3FH 3PF5A 1WOCA 3BA8A 2UXDH 2E2JH 4DR3H 3S1NB 1ENCA 4IAJA 2PZWA 1NR4A 1TWHH 4MTDA 4LF4H 4YAKB 2QDLA 4ZUIA 5G3LF 5F9NA 3H0GH 1KD1C 2WINB 4EQOA 4GOPB 3K8AA 3K7UC 4X65L 1D1IA 3RR5A 2UUAL 2F0VA 5GAEC 4A3BB 2UVVA 5M5XB 1HA6A 1BJTA 3N42B 1ML0D 4JI4Q 3GV8B 2OT2A 1E2VA 4DR3Q 3KF8B 1HUNA 3RB0A 3S1QB 3NTKA 5I9PA 4DNIA 2XIWA 5JEAJ 2R93B 1QJOA 4APMA 2FE3A 2MNAA 1B33N 4LW1A 2J0TD 3QOJA 2VUMH 3CF5A 2PVPA 3RZOB 4LF7H 3PGZA 4RGOS 4OX9L 4MV1A 5E4WC 5KG1A 4P73A 3RGXA 4YIJA 1CHQD 1CA5A 2JEJA 1L1OB 1K9MC 2NYZD 4HMJA 1CKNB 2BE5C 4UDUC 4YWLA 4UY8C 4KLKA 5LYJF 5GROA 2X69A 3NTHA 4LF7L 1PDQA 4JI4H 3TS2A 1EZ8A 3W2DA 4HIMA 4QCLA 3OW7A 1JICA 1DV1A 3MR5A 2C00A 1TWCA 1NAPA 3H4DA 1ASZA 4MV3A 2IL8A 2XWBB 5T1GA 3OOCA 1N33H 1O80A 1KAAA 4AQYQ 4GOPA 4IRKA 1TS5A 2F0LA 5IE8A 4JI7H 2RKSA 4YY3L 1WTVA 2NB0A 3M4IA 1IZ6A 1B04A 1E4GT 1STAA 2FJ2A 3HOUB 2EPBA 2NU9B 2JEGA 1Y1VG 4PZ6A 1IBKQ 2A68C 4PDBA 2B2VA 3U4ZA 5EAYA 4A3EB 3GTLH 5D3DA 2W71A 2XGTA 4LMYA 4MV4A 4UCRA 4YR0A 4DR6L 5KFTA 3OTOQ 2AUJD 3C3LA 5F2DA 1XMOH 2UVUA 5ELCA 2IHFA 1TU2B 2SNSA 4E6IA 1FNVA 1PTOD 4JBJA 2LS01 4JV5H 1YBYA 2JA7B 2OQKA 3Q22A 3T1YH 1V43A 4RCOA 2TMPA 2CW8A 3K7AB 1YNNC 4FXDA 4PG3A 5KFJA 1TVXA 3TRZA 1H9JA 5KFZA 1BKBA 1BO0A 2RGRA 4NXNQ 4EGVA 4RKLA 3GTMH 4FM9A 4PV1C 4ZRZA 2R61A 1M0WA 2LKVA 4F7XA 1I6VC 1DONA 2FPIB 4A3LG 1SNCA 1FYCA 5CV6A 4B3RQ 4JI1H 1SFOA 1NE3A 3CHBD 4AYBB 4KHPH 4LF6H 2RDGA 4XX0B 1B2TA 4XYLB 4YWMA 3T1YQ 1Q86C 2F0JA 3E0JA 1S03G 2FMAA 3RJ0A 2ASBA 5IIFA 4GNXA 1Q12A 3S1MB 4CDDC 2F4VH 2C2EA 2OTJA 2CWPA 4A3BG 1KC7A 1GLVA 3A5UA 4ODGA 1AH9A 4IFDJ 1DIKA 1CHPD 4ZUJA 3FKIH 3FMAA 3R5FA 4JI6H 4NW2A 4LSXA 2N55A 1CKOA 1V8QA 4OIJA 2WFWA 2R93G 3PUVA 3RN5A 1S0NA 1GKHA 3UFXB 1EY8A 2CW0D 3HKZG 3PCOB 2JEIA 5CV4A 3PUXA 1J9OA 4CJ0B 3UDXA 1BQQT 5D3IB 5KFGA 3F2BA 2OEOA 4R1JA 2XGPA 4TVAB 5BR8L 2R7DA 3FKIA 5DGAA 1I50A 2J9GA 1XDNA 2OLSA 1HR0W 2SEBD 2RDHA 2PN1A 1TWHA 3A54A 2JA5A 1M90C 3OSPA 1OTCA 1F77A 2M9VA 3DLLA 4UCUA 3Q8QB 4JUZA 3I7FA 1FKAH 2R92G 2JN4A 2GA4B 2R87A 1ZYRC 3GV3A 2JEBI 1VQIA 1KJIA 2IT1A 4G7ZC 1W3SA 4A3IG 2E2JB 2B2YA 3N8DA 4ED3A 1PH5A 2IW3A 3FDTA 3H91A 3UQ8A 2BQUA 4HQ6A 1STBA 1TY0A 2VQEQ 3A7LA 3T56B 5C4XB 2QA4A 1Q8KA 5IYDG 4X65Q 4A3EG 1CSPA 1D6EC 1ICFB 3BU2A 4A76A 1QCBD 2RF4A 4C3HG 4B9WA 4C5BA 3J7AK 1H9RA 3ER0A 3OUUA 1F9PA 1H9MA 1GXDC 4DR3L 2UVWA 4I7ZC 4PMBA 5EGTA 2MPMA 3W1GA 2F1MA 4CBVA 1N48A 4BS9A 1MZBA 1MI2A 4J9NA 4J9RA 1N34Q 2Z4IA 1U5KA 2E5LQ 1VKZA 2X6GA 3WO1A 2HIVA 4F87A 4LFAL 4YJ3F 1XNQL 1K1SA 4X65H 4P74A 2AU0A 1I4QA 2L55A 4JI5H 2B2VC 3D6WA 1JWSD 2B39A 4B3TL 4PZ7A 3M4OB 3NWSA 4KHVA 4TKOB 4ID6A 4NXMH 4MV9A 2NVXA 2JA8G 4FXKC 2EVBA 4DAMA 1QZHA 2HCCA 3EFXD 2Q2TA 4QIWA 1GUOA 4O4IF 3GTGH 5L1IA 2G9DA 1IBKH 1C48A 1Q46A 4MV6A 3S14H 4CKCA 3PVXA 4K5VA 4FF4A 3OHXC 3KDFB 3BG5A 1ET9A 4QL5A 3STBD 3AMUA 2K05A 3R8BA 3D0FA 2HQEA 3L0OA 3PUYA 2HHHH 2F4IA 5LMNW 1GHJA 3LWEA 4CDEC 2B2WC 3HOWG 4M7EA 2RSNA 3M9MB 4DR4Q 2OXPA 3NENA 5GAGC 4K14A 5C0XJ 1YNJD 1IYVA 4YB8B 1S3OA 4JC0A 2JSOA 4DR1L 2EXZA 2HHHL 1V1OA 3PUZA 2AGOA 3EN2A 5KFQA 3Q8SB 2A73B 3CQZB 1EFWA 2LFNA 4P2CB 3CCEA 3H15A 1UEBA 4X66L 2DWCA 2PI2A 2R93H 4QW8A 1XTDA 2FJZA 3GV7B 2PZTA 2ES2A 4GKKQ 1R4PB 4BY7B 3RF2A 4JOIA 3D31A 1CI3M 3OMCA 4DV2H 5H80A 5KFBA 2W7OA 1RIPA 5KFYA 1KXLA 1PLFA 2HIXA 1YZ6A 3J80W 2FPPB 4JCVE 2BA1A 4KKSA 1VMPA 1MJCA 3QR8A 3PW5A 4NKLA 4PMCA 4H7BA 5EBCA 4MTNA 2VUMB 1QNUA 1RK6A 1PFSA 1UEAB 3T13A 4A3IB 4LFAQ 2UUBL 2UUBQ 2B63H 1M1KC 1HFGA 1XNQQ 1RHPA 2E2IB 4JV1A 2V9WA 3AB9A 4YCWA 4GNXC 3K5IA 2KA7A 5DAUA 1VF7A 1KDCA 3TQTA 2W8LA 2NVYH 3K57A 1Z2OX 2FHTA 2NZ1D 1E3PA 2XNAC 3PO3H 4DUZQ 4KKTA 2AQ1B 3OUZA 5KFPA 1RL2A 1L2FA 2NZOA 4A3GB 4QMGA 3VA5A 2W9BA 1A63A 4ABNA 4MHEA 2I5HA 1YIJA 2DLNA 2ZTDA 4MZ9A 3LX0A 1WTOA 1I4HA 5I6YA 5GADC 2K52A 2G9HD 3VDYA 2Z6KC 3GV5B 5M3MB 2R6FA 2RA4A 2VXWA 2PQAB 1E4FT 3PF4A 3GTMB 1EYZA 1BR9A 2KHIA 1Y8PB 5I6WA 5JEAH 1PRTB 1G8ZD 2OWOA 1VQDA 4MAMA 1MBYA 5BN5A 3H6MA 2BA0A 1N9WA 1ZXTA 1RKNA 4ZQ3A 3JSNA 2B2WA 4EQNA 2JA8B 5KEEA 3ORRA 4XT1B 1O7LA 4J15A 3GTMA 3BABA 3BJUA 3LWBA 2WAQE 1P8LA 3PO2G 1C7YA 2PMZE 5E4XA 2Q2HA 2YZGA 2JA5B 1L0XB 1TWFA 4DL4A 2XRQD 2C5CA 1HR0Q 5KYIA 3QZ7A 5C4ZA 3H40A 1ONLA 4IOAA 3KUPA 4U673 5J39A 3H20A 1STHA 5KNCA 3L9AX 3B6YA 3GILA 3DMUA 4OWTB 3Q2OA 3GQCA 3RFCA 5KT4A 5CV9A 1KABA 3CXCA 4WBNF 4A3JG 2CQOA 1JOOA 4HJ9A 1BBXC 1T94A 1L0YB 2F0OA 3MA2B 1E24A 1B3AA 1QUQA 3SXHA 4BY7G 1N32L 4DAYB 2V59A 4YY3Q 2DNCA 3TZDA 2W9AA 4K2KA 1KNEA 3OHBA 2W6NA 2N49A 4IJHA 2WE6A 3HBLA 3PIOA 5ISRA 1EQTA 5KFWA 1N32H 3M7GA 3CQZH 3FKIG 2JK8A 5JVLA 1IBML 3HOWH 4RZRA 1U4MA 1VMCA 3SEBA 3SE0A 1KIXA 1GSAA 1CQJB 3KALA 3R2IA 2FPGB 2W70A 1VQEA 3P7JA 5KFVA 3J80c 5KT6A 4HNVA 1UNSA 4H13C 2AQ3B 5IWAQ 3MFGA 2ZDQA 2R92A 4RAZA 4F4WA 2EYMA 5LHY1 3A8KE 2Y0SB 2VUMG 4KK7A 1RJRA 4DA2A 3K0YA 1W2BA 4OELB 1TS3A 1PH4A 4R8UA 4OX9H 2ZJRA 4JI5L 1TWGA 3HOXH 4TV9F 3V4SA 4BBRB 1PH7A 2F03A 1A2UA 2EYLA 3X3MA 1BCPB 1EIHA 4JI7L 1M8AA 4DR7Q 2E74C 3Q6SA 3KF6B 5FLMG 3Q8PB 4JI3H 3ZYYX 4A3GG 5KGUA 5EWFA 4LFCH 1HNXH 3KLRA 1D2BA 1NUCA 1YNJC 5A2QW 1ESRA 2A6EC 3HS0C 3IFDA 1QVFA 2FK3A 5KFXA 4KKUA 1DOLA 3NTIA 3S2HB 3PR4A 4CGYB 4L8JA 4EG0A 2QEXA 2WYOA 1E2WA 2L15A 1QVGA 5IYDH 3J80i 3M7NA 3KJOA 4DL6A 3F8TA 1XYIA 2MJ8A 3BDOA 5DGBA 1BF4A 4DV0H 4RCNA 5JPMC 2E2IH 2RDIA 4ECWA 5M5WH 1S4ZA 1F2LA 4UCSA 5CR3A 4X66H 2EYHA 5HBRB 2DJGC 3HP3A 3OIPA 4C3IH 2YCHA 3KHGA 1EIYB 2E75C 1EUCB 2K5VA 1TWGB 3D4WA 4ME6A 5KG5A 3W5OA 1NJIC 2OH2A 4OO1G 5ELBA 3PO2B 4L1KA 4A3MH 4K8JA 4A4IA 2JA5G 5M9OA 1VS0A 1VDZA 3BZKA 1PYBA 4DV7Q 5C1PA 3CQZA 3S17B 4QWCA 3BG3A 4BBRH 3ETHA 4L6TB 1IOVA 3TZUA 3CCQA 3I90A 1S10A 4WJ3M 2K7VA 3PO3B 1SE3A 4B3ML 3HOYH 3TN2A 1VQ5A 1PTOC 4O4LF 3G6EA 3HKZA 4A3JB 4X66Q 4X64Q 1MJEA 2PCFB 3VPCA 3BVGA 2DIKA 5E7NA 1XNRQ 1HZAA 1S97A 1MGSA 1EFID 3OSOA 3KFUA 2W6PA 2D9UA 2JEAI 3RB4A 4GN4B 1UC9A 1VAJA 4R8NA 2I5LX 4G57A 3I4MH 2UU9H 4G4KA 5CYUA 4ED7A 3QIAA 4M9UA 4ED2A 1FD7D 3F1ZA 1TY2A 3C1FA 1CTMA 3TBIB 5EKIA 2IA6A 2QF7A 4IN3A 4B3SL 3F2DA 4LFBQ 2K5WA 1ENFA 1RK5A 4R7RA 2RVLA 2UXCH 2F52A 3CC2A 2UXBL 4XXEA 2PPBC 2AWOA 1T5EA 4KN4C 4POGA 3T51B 4BY7H 4S3SA 2VUGA 2W6QA 5ELFA 4R8UB 1MKHA 4RB1A 3HGBA 3TP5A 2I8CA 1JJ2A 1H9SB 2KHJA 2UXBH 1XMQQ 4X3SA 4BBRG 1JOQA 3H3VH 3TIGA 2SCUB 1HJPA 1IBLH 1G91A 4H44C 3RAXA 4LUOA 3M4YA 1HNZL 2QEJC 4OO1H 3V6HA 1N56A 2MQHA 2NN6H 4M1UB 2N78A 1EU4A 1K83A 2R84A 2CCZA 1CUKA 4C3IG 4LF8Q 1D5ZC 1LYLA 4OXPA 4PMWA 5EWGA 5J22A 2MP1A 5IP9H 1ILPA 2YU9H 1B70B 3GTGB 1SJHD 3T4AC 2N3SA 4JVZA 2V4DA 3C46A 1G6PA 4DV6H 2UUCH 5IGFA 4IR1A 3U9SA 4JBMA 4MA0A 4RAUC 2Z6KA 2MFIA 1BCPC 3BVZA 4DNTB 2QGQA 4LFBL 2CQAA 1K8GA 5G3LD 1CS0A 2JQOA 2PMZB 3HOZH 1D5XC 3RUZA 4HN7A 5FLMH 1PVOA 2FLNA 4EBDA 1WJJA 1X54A 1F9SA 3MJFA 3DEOA 2XCLA 4RUCA 1IBMH 3E5SA 4J9KA 3VR2A 1K83B 1AE2A 4DK0A 1KRSA 2N88A 3WNZA 1ZKOA 3KYHC 4XZ3B 4CJ1B 1SROA 4GNXB 1EL0A 2UU9Q 3HKSA 1WR2A 3N6RA 2K5NA 2IHEA 5HGQA 1L1OC 2ALYB 4JI2L 1IKMA 5NUCA 2Q8IB 5HGTA 4HAEA 1PH6A 2ZDHA 3EJIA 2VA2A 1RDPD 1X65A 1B53A 5IP7G 2R7NA 4DGZA 4O3QA 2B2TA 2AGPA 2E8GA 3N6XA 4ZK9B 2EIFA 4OONA 1C9OA 5IYCH 1TWAB 4CDFC 5IP7H 1EWCA 3SK6A 4HSPA 5C3WA 1HZBA 4N9PA 5IYBH 1ZQ7A 1LTLA 5IYZF 3GTGA 1PZID 4LJZC 4PQXA 2B29A 3S1MH 1EQQA 1I94L 3HB9A 3KTMA 2QKIC 2ASJA 3S15B 4ZKBB 4K8IA 3MHBA 4FF2A 2W6MA 4JOIC 1R4QB 1Y8OB 2K5HA 5DM63 5DLFA 5EOYA 1I4GA 2WKDA 4DUYH 3I70A 1X9NA 2VL6A 2B8FA 2VUMA 4ECTA 3EVQA 4X64H 3HOZG 1I5FA 4OEMB 1WTQA 1V9PA 1PXUA 4IWYA 1DXMA 3S24A 1XMOL 3ULJA 3A55A 3RUPA 4KHZA 1SYCA 1CE8A 1D7QA 2F0IA 1CT1D 1O7YA 1UC8A 3GTQB 5JUMA 3CC4A 4MV7A 4BBSB 3JAMW 3TQYA 2EJGC 5KFKA 5FLXL 2ASDA 1YI2A 4YAJB 3MWMA 4Y7NB 4ECRA 3GQBA 4K5XA 5K36H 2XCAA 2EE1A 2V5AA 1Y1WG 5DG9A 3PZPA 3L4JA 3T1HH 2R7ZG 2CZGA 3GLKA 4GN3B 2W6OA 4R9WA 4J9PA 3K6OA 3ICEA 1HPCA 5L9XA 2BR0A 1HZCA 3HFZB 2EYPA 1B44D 1TQOA 4C56C 3V6JA 2YU9A 4DXGA 2L0CA 2ID0A 2IJ0A 4BY1G 2DY8A 1B1ZA 3L3OC 3DM3A 4ZQIA 4FS1A 4B08A 4ME3A 2W9CB 3KHRA 1EY0A 3SK4A 4XT3B 3IRBA 2ZXOA 4Q8EA 4EEYA 4GC6A 5CBAE 2YU9B 1JDBB 3VPBA 2K5DA 4DN4M 4F4ZA 3I4NG 2IX0A 1Y1VA 1CZGA 3F2CA 4F4YA 1V1QA 1HNWQ 4IUPA 2Z6BA 1IXRA 2D0OA 4OWXB 5KFIA 2MO1A 1K3RA 5CB4F 3WO0A 1VQLA 1PTOH 2V4RA 5KFLA 2B63G 4GLVB 5FO9B 2QDBA 1WSCA 4BXXH 3JAMi 1H9SA 4A3KB 2UXCQ 4A3DH 4R4TA 2PNRC 3H94A 5JVG3 4UP7A 4NB3A 1SNDA 1VQOA 1ZHSA 2J7ZA 1G291 1UNNC 4A3JH 1PYWD 2CHBD 5E3FA 1B3QA 2QCPX 1S0OA 2V4QA 4YWKA 4XIGS 4QWAA 1QNKA 4ZKCB 3GTJB 5T14A 3PW4A 3MWDA 1BVSA 1IBLQ 2UU9L 1STYA 3RZDB 2JXMB 5KFAA 2R7KA 2VR1A 3HEJA 4F88A 4JYAL 2XN9C 2E2HB 1FJGQ 1Q7YC 4QF4A 4DR7H 4LAAA 1SE8A 1LTSD 4DPGA 3RIZA 1PMRA 1G51A 2JA5H 1TA8A 4R8IA 5EBDA 1F2ZA 1XNQH 3MWYW 3VYSA 4A3CH 2MGSA 2A69C 3CKIB 4HR7A 2YYZA 4C1NK 4MA5A 4GZYC 1NSNS 2A19A 1L2ZA 1PH2A 3H3VC 4HJ8A 1J5EL 3H09A 2NTSA 4EVOA 5LA6F 2NU8B 2FFKB 5DG8A 1EEFD 1X32A 5CA1F 4O2AF 2E2IA 3R93A 1AN7A 3KAJA 5HURA 3H0GB 5ELNA 2C2DA 1IW7D 4K0KH 4LMQD 3HOVB 2JYOA 5D14A 4I7AA 5EQ0A 5C1OA 5DQIA 1S5CD 1JB7A 1FGUA 4FVMA 4O2BF 2EQSA 4DF7A 3J81c 3PO2H 5L37A 3RV3A 2BDOA 2D0PA 2W7PA 1WCMA 3G48A 2ZJQA 2R7ZB 3V05A 4DV4Q 3ERSX 4JV0A 3JRXA 1RJQA 2HVSA 1X3PA 4K5WA 5I2YA 3TS0A 3D6CA 1HTPA 3AU7A 2EDGA 3BQ0A 4YBZB 4NLGA 5M5WB 1SEIA 1WTXA 4GC7A 1RCVD 2WKCA 4BY1B 4ED8A 2K1BA 4KD3A 2EY5A 3QG1A 4KJOA 1JXLA 3K7AH 3ERQA 3J80L 2LY7A 2VY3A 3MZ5A 3HOXG 4DR6H 3E9HA 4O3OA 4Z9CB 2Q8TA 3BAAA 4QWDA 3RMHA 4V190 3FVQA 1GSHA 5FOBB 4RB3C 1X3FA 1JQYD 3GIMA 2J4XA 4ED6A 4OWWB 1FR3A 3PQIA 3OTOH 5COYA 4ED0A 2L1BA 4JI6L 3H0GA 1I7NA 1YNND 2R7MA 2J6UA 4IJLA 2XCPA 4H0LC 1AUVA 2C9OA 3S1RB 4DR6Q 3DF7A 3OTOL 3K59A 1WFQA 3CCSA 4DV2Q 5BN4A 2R92H 2X0SA 4QGUA 4ZLTF 2R93A 3M3YH 3NQTA 4I55F 5BPHA 4OO1I 4RNNA 1LACA 1KLUD 1DOKA 1WCMH 2RSOA 3PIO3 2NVXH 3ND9A 1PHJA 1ESFA 5J1ZA 4RHRA 3J7AF 1A0IA 1M7JA 4L5QA 3TMEA 4RFBA 2ZJPA 4FBUA 1I94Q 1A6XA 1LV9A 3D4RA 3QO2A 4JW0A 2ATWA 4KN7C 5D1OA 3NPPA 1K73C 3OYYA 4QIWB 1HQRD 4DLKA 1C30A 4RG1A 3NELA 2RHSB 1WTHA 2R7LA 1HRJA 2K03A 2NVXB 5I4DA 3N41B 4ALPA 5K2MA 1PFNA 3K58A 1CSQA 4X3TA 4DUZH 1Z2NX 2ATLA 4UP8A 2L12A 2NVTH 4TUYF 4F4XA 1HH2P 4DUYL 3PN1A 5D8DA 2LMCB 3IAYA 3VYTA 1C8CA 1W6JA 2R8GA 1Y1VB 1SRUA 3RLOA 1S72A 3CD6A 3G7LA 4A3MB 3RN2A 3G4SA 3E9IA 2PZUA 2DZDA 4IRCA 1N34H 1KLGD 3MXUA 2DJFC 4N9TA 3BJYA 2QK4A 5JVDF 4QWBA 4HNTA 1KBLA 3PV0A 3EPGA 4IFDG 1HNWH 3E5NA 1PFMA 1YJWA 1DZ1A 4WJ4A 2B8GA 2AQ2B 1IYUA 4YCUA 1FL0A 3STBC 3M4PA 1K0RA 3OWFA 4IUUA 3HXLA 3RAQA 5KFMA 4APVA 1LTRD 1VQ9A 1I6HH 3BZDB 5ELEA 1UAPA 1Q90A 4RHSA 3I72A 3QWNA 2M05A 1NNXA 1AN8A 1VQBA 4QJFA 4WJWA 1N36Q 3BYYB 3T1HL 4A3IH 1O75A 4ZOLF 3M85A 1IBLL 1R9TB 5EJWA 4K0KQ 1D1KA 3RBEA 3FMCA 4C2MB 2ZTEA 5H1SE 4AYBA 4ILWA 2ZXRA 4R4CA 3K3PA 1W6KA 1SMYD 2NU6B 1CK1A 5IT9L 4A3FG 1OWTA 4J9SA 1U0LA 1HNWL 2V58A 1MSGA 2JA6H 1RYRA 4LF9Q 1EZ1A 3RZDH 1HNXQ 4HCEA 1ZHQA 1I3QH 5KT3A 3DWQA 1WD1A 4RNOA 5A2QL 1A3UA 3CCLA 4Q44A 4LFAH 1KQSA 4DR2H 4LUZA 3J81E 1PA6A 2EY2A 5BPFA 1S0MA 3DWPA 3PW2A 2XD4A 4HIDA 2WB1G 4CC5A 2H1EA 1HFNA 2VW9A 3MWEA 2VZAA 4JV2A 1JKJB 2E2DC 2CH4A 2R86A 4O3RA 1F9QA 1LTTD 5FO8B 4FU0A 1TWAH 3PMFA 5I47A 3HKZB 1A3VA 4F50A 3ULPA 5T1IA 4NXMQ 2KCMA 5LOVF 1SJED 3EBEA 3I4LA 4LF4L 4RKBA 2QILA 4Q8FA 4CKBA 5A2QE 4DV3Q 4FYDA 3V4ZA 4CDCC 5AJ3L 4JI0Q 4O2DA 4YJ2F 1WTRA 4RWSC 4LF7Q 1SMYC 1PH3A 3S2DB 2WV6D 2I87A 1X3GA 3FPUB 3LMLA 4RNMA 4KTAA 2XRSD 5GQOA 3GTJH 4K0KL 3R5HA 1FNWA 3GDEA 3CMAA 2QYZA 1UWVA 2W57A 1XMQH 1EZ6A 5C3EB 1FJGL 4DV5H 3E0EA 3VYRA 3C2PA 1JDEA 3G6YA 2SOBA 2KSWA 1JE4A 1GUTA 2R92B 1G2SA 4A3DG 5KG6A 4EX5A 4IZOA 4CKEA 2JA6G 5FD5A 4UCOA 2R8IA 1T3NA 2DN8A 1II3A 3TP6A 4BXXG 5CV7A 3GTOH 3N43B 5L1KA 5LL6b 5C5MA 1QB5D 2CW7A 5C4XG 2F0TA 1KDAA 5E1FA 2YYAA 5KFUA 1HXYD 4NPSA 2JJQA 4DV5Q 3N44B 5FK9C 4A3MG 3JAMc 4J1MA 3SI8A 4JI4L 3MXPA 1SE2A 3UDFA 2RHQB 5IWAL 1SNOA 2PW7A 3X3NA 3U4VA 1TWFH 4ECSA 1FVIA 5K36G 4G7HC 3TQ1A 3A56A 1GD7A 3BQ2A 1LT4D 1JCKB 1LT3D 3TEHB 1VQPA 3K5OA 1UUPA 4DR4L 2ZTCA 4X62L 4DR5L 2YS7A 3GIQA 4LF5H 2AUKA 5L1LA 2L9HA 1Y1WH 4C3JH 3SHLA 3M9BA 2IMWP 3Q24A 4YCVA 2A69D 2KHSA 1OXVA 2MCTA 3MXNB 2B3GA 2Q2UA 2F0KA 4A3FB 3PIPA 2F3IA 3L7ZC 5KG0A 4GLXA 3T1YL 4GKKL 3MFHA 1LTBD 3L2PA 1YJ9A 3S15H 4ZYSA 4LF4Q 3SGIA 2FKLA 4K6LA 1TIID 4QUCA 3GTPA 2ZM6H 2JEFA 2NWGA 4F8MA 5AJ3Q 3UDGA 1Z2PX 4DV3L 5LMNQ 2O5JC 5HY6A 1HZ9A 1AZPA 4Y8VB 3CPWA 1CM9A 2C2RA 4IZ8A 2I5MX 2YRWA 2R6GA 1BXRA 2LXKA 1EYCA 2F0FA 1SYXB 2HUGA 1VCIA 3KF8A 5IYBG 3GIDA 1VQFA 5KG2A 4LNQA 1V1PA 3I91A 5JVH3 5LL6S 2E5LH 2FP4B 1BCPF 4TRDA 4BA1I 2R7FA 1GSOA 3TINA 3KXYT 1TS2A 3K5MA 4JBKA 4IUQA 1PRTF 5IGBA 4J8QA 4ECVA 2YW2A 2GN5A 5IGGA 3J81W 2KEDA 1NTGA 4NXNH 4YR2A 3TP7A 1TWCB 2KQ3A 1STGA 4FP5D 4G3IA 2B2UA 3CCUA 1NMGA 5EPLA 1K3BC 4DFAA 1GM5A 3I55A 2HD3A 4RH6A 1F2YA 3A8IE 3AYHB 1KC8C 4A3DB 1GUSA 2JA6B 1SYFA 4Q45A 1DJRD 3BDCA 4DNRB 1HTLD 1SNPA 1STEA 4C3JB 2WAQA 2KUMA 2J6TA 2I80A 2F4VQ 3OPOA 4H02A 3HOUG 1PTOB 4DAVA 4UAIA 2Q2IA 3MTSA 5JAVA 2MHVA 4HMIA 4DR1Q 3KHHA 5C44B 2FLLA 1HA5A 3R5XA 3T5HA 2JE6I 5IGEA 1ASYA 1IW7C 3E3XA 2A1AA 3UI2A 5KFEA 3P20A 3R2TA 2HT1A 3K3VA 1JLLB 4FO2A 1FJGH 3K5NA 1N32Q 3ONAB 3GIIA 5GAHC 1EY5A 3BQ1A 2F0UA 4HIKA 1N34L 3GTLB 1HR0L 1CKNA 3RB3A 5C4HA 3RD4A 4I4TF 4XYQA 1Q8IA 1OXTA 2EJFC 4B3TQ 4IPCA 4X6AH 1SAPA 4EFEA 2DPIA 2K6AA 1F9RA 1QVCA 2WP8J 3MR6A 2O5IC 1EOTA 4GOPC 5LL6X 4JI2H 4ZHQF 4ECYA 1Y1VH 3SDZA 3Q1KA 4B9XA 4J9MA 2ENBA 3KLSX
chains in the Genus database with same CATH topology
4AYBG 1X6OA 3KDFB 4QL5A 3STBD 3I4NG 2IX0A 2PI2E 3K0XA 1Z9FA 3D0FA 1V1QA 3FP9A 3L0OA 3F2CA 3PUYA 2Z0SA 1IXRA 2D0OA 1UE7A 4OWXB 5LMNW 2JA7H 2MO1A 3W1BA 1K3RA 5C4XH 1A8VA 3HOWG 4JI3Q 4DR4Q 4AIMA 3NENA 4GLAC 4NXNL 5GAGC 5C0XJ 1K8AC 1VQLA 1S3OA 1NMFA 4JC0A 4DR1L 1JE5A 2B63G 4GLVB 4JG2A 2HHHL 3PUZA 1J5EQ 3EN2A 4BXXH 4RMFA 3JAMi 4IO9A 1D8LA 5IYCG 4DV5L 2UUAQ 4DV1Q 2UXCQ 1EFWA 4A3DH 4R4TA 2UXCL 3CCEA 2YTYA 3HOUH 3H15A 1UEBA 1YVCA 4X66L 4UP7A 4NB3A 2UXDQ 2PI2A 2R93H 3RNUA 3CCRA 1XTDA 4EQ5A 1VQOA 1VQHA 1G291 1TWCH 4GS3A 2KCTA 4A3JH 2ES2A 4GKKQ 4JOIA 3D31A 5C3EH 2RCNA 4YWKA 1XMOQ 4XIGS 4JI5Q 1Y14B 1J6QA 1RIPA 2WB1E 4X62Q 1Z47A 4DR5Q 3UE0A 1VQ7A 1EWIA 1BVSA 3K81C 3CCJA 3S2DH 3T1HQ 2HIXA 1YZ6A 4XTCS 1IBLQ 1KXLA 2OTLA 2UU9L 4JI8Q 4JI8L 4JCVE 4JYAL 1NY4A 2BA1A 1FJGQ 1YHBA 1Q7YC 1IYJB 1MJCA 1TWGH 1SE8A 4IOCA 1VQKA 1PH9A 4QY7A 1SN8A 1VQCA 4MTNA 4DPGA 3S16H 1G51A 2OQ0A 2JA5H 1PFSA 2UUBL 4A3CH 4LFAQ 2UUBQ 1K83H 2B63H 2YYZA 1M1KC 1XNQQ 4MNOA 4YCWA 2EXDA 2A19A 4DV6L 4GNXC 1E7ZA 1X3EA 2UUCL 5M5XH 1OXXK 4AH6A 1PH2A 4HJ8A 2HHHQ 2MO0A 4UPAA 1J5EL 4QQBX 2NVYH 5C44G 1JJGA 4DUZL 1EOVA 1E3PA 2ZM6Q 1IBMQ 4BY1H 4DUZQ 3PO3H 1JMCA 4DV1L 5IP9G 3KOJA 1VQNA 1RL2A 1CKMA 1L2FA 4A3FH 2NZOA 5ELNA 1A63A 4A93H 1PV4A 2KENA 3J81j 2I5HA 1YIJA 2R7ZH 1Q1BA 1JB7A 1FGUA 1QUQB 3S1NH 2EQSA 2ZTDA 4MZ9A 3J81c 4LF5L 1PH8A 3PO2H 2D0PA 2KBNA 4FDBA 1YJNA 5GADC 2DUDA 2K52A 3G48A 1HNXL 3VDYA 2Z6KC 2VQFQ 2ZJQA 2F4VL 4DV4Q 3I2ZA 3ERSX 4C2MH 4O0AA 4DV4L 2PQAB 1L0WA 3PF4A 2AMCB 4IPHA 1T9HA 2KHIA 3TS0A 3KLWA 2VQEL 2OWOA 1VQDA 4C3HH 1PYSB 3ULLA 2BA0A 1N9WA 2VNUD 3A74A 3K7AH 2BH8A 1XPRA 4J15A 4P75A 1IL2A 2VY3A 3HOXG 1B8AA 3EIVA 3E9HA 4IFDI 4B3RL 3BJUA 4AQYL 2WAQE 1P8LA 3KDFA 3RLNA 3UE1A 1C7YA 3PO2G 2PMZE 4OX9Q 2Q2HA 1YEZA 1X3FA 1BBWA 3J7A5 1EUJA 4L5TA 4OWWB 1HR0Q 3J7ZC 1MIUA 2NN6G 4JI6L 4DUYQ 4IOAA 2NVQH 1VQ8A 3PO3G 3B6YA 3I4MG 1VQJA 3CPFA 4OWTB 4IJLA 1HNZQ 4DR6Q 3CCVA 3OTOL 1WFQA 2FXQA 3CCSA 3CXCA 4DV2Q 2Y0SE 2R92H 4A3JG 4DV2L 2CQOA 3A0JA 4QGUA 5FJ8H 3CMEA 4HJ9A 4LF6Q 3M3YH 3GD7A 3Q8DA 5LMUL 4OO1I 3RLFA 3I4OA 3U58A 2LSSA 1VQGA 1E24A 4LF5Q 1QUQA 1UE1A 1WCMH 2YTVA 4BY7G 2NVXH 1N32L 4DAYB 4R4OA 4YY3Q 5C4JH 1PHJA 1KHIA 3ZJYC 4DV6Q 2N49A 1A0IA 3A5ZB 4IJHA 3WWVA 2UUCQ 4L5QA 1XMQL 3PIOA 1B7YB 5JJIA 2ZJPA 3JC66 3FKIG 3CQZH 1O7IA 1BBUA 2JK8A 5BR8Q 1I94Q 1X55A 2ZM6L 1IBML 2ATWA 4UP9A 3HOWH 1N36L 2YTXA 1KIXA 3RZOH 5JJLA 1K73C 3OYYA 1OXSC 1VQEA 5IT9c 1VQ4A 4RG1A 5C3EG 3J80c 1TXYA 3GTPH 1SR3A 5IWAQ 3S1QH 3NELA 1OXUA 2RHSB 5FJ8G 1JT8A 5M3FG 1LM0A 3M4QA 4A75A 4GKJL 1Q81C 2VUMG 4ALPA 4GKJQ 4KI0A 1CSQA 1W2BA 1PH4A 4LF9L 1YITA 3LGJA 4UP8A 2NVTH 3K80C 1DGSA 2VQFL 4JI5L 4DK3C 1HH2P 4JI3L 2ZJRA 3HOXH 4DUYL 1PH7A 3AFQA 1H95A 1SRUA 5LMNL 4HIOA 1VQ6A 3RLOA 1S72A 4JI7L 1UE5A 3HOYG 4DR7Q 3CD6A 4A3LH 1Q82C 4L5SA 4GN5A 3KF6B 3RN2A 3G4SA 3E9IA 5FLMG 4KHPL 3GTKH 4A3GG 4LF6L 1SFOH 3PV0A 1GVPA 1UE6A 2JA7G 4IFDG 1QVFA 5J3BA 5C0XG 1YJWA 3CW2C 1R9TH 4WJ4A 4A3GH 4YCUA 3MEFA 1S40A 1XPOA 1FL0A 3STBC 4DKAC 2K14A 3M4PA 3NEMA 1K0RA 2QEXA 4JBWA 4NXML 4APVA 2L15A 5M3MG 1QVGA 3J80i 1VQ9A 3KJOA 3CC7A 3M7NA 4JV5L 3F8TA 1I6HH 4A93G 2NN6I 4JI6Q 1IBKL 2JA8H 2OCEA 2E2IH 1KL9A 4QJFA 1VQBA 3FHWA 4DV0Q 1N36Q 5M5WH 3T1HL 1E1OA 4A3IH 1X56A 3M85A 1IBLL 3S2HH 2NZHA 4C3IH 4K0KQ 1EIYB 1SMXA 2K75A 2ZTEA 5M3MH 5H1SE 2C35B 3PF5A 4R4CA 2K5VA 5M3FH 1WOCA 3W5OA 4A3FG 1NJIC 2E2JH 4LF8L 4OO1G 2UXBQ 1U0LA 2GVAA 1HNWL 4A3MH 4A4IA 2JA5G 2JA6H 4LF9Q 1TWHH 3RZDH 1HNXQ 1VS0A 3HOVH 3BZKA 4JI1L 1I3QH 1PYBA 4DV7Q 4JI1Q 3H0GH 1N33Q 4BBRH 1KD1C 3CCLA 1KQSA 4GOPB 3K8AA 3K7UC 4LUZA 3CCQA 1PA6A 4JI7Q 4WJ3M 4X65L 3OW2A 3RR5A 2AWNA 4B3ML 3HOYH 4HIDA 2UUAL 2WB1G 5GAEC 1VQ5A 3G6EA 3AQQA 2VW9A 2VZAA 2IX1A 1EYGA 4JI4Q 1WCMG 4X66Q 4DR3Q 4X64Q 3KF8B 1E1TA 1N8RC 1MJEA 3NBHB 2D62A 4DNIA 5JEAJ 1XNRL 2BH2A 5E7NA 1XNRQ 1TWAH 3TREA 2MNAA 2K50A 4LUVA 1HZAA 4LW1A 3J81i 2VUMH 3CF5A 3KFUA 3PGZA 4OX9L 2XTIA 2JEAI 4P73A 4GN4B 3ULPA 4NXMQ 1GO3E 4JV5Q 2I5LX 2KCMA 1L1OB 2H5XA 1K9MC 3I4MH 2E2HH 3EBEA 4LF4L 2A8VA 1CKNB 4YWLA 4UY8C 4KLKA 5GROA 4DV3Q 5AJ3L 4LF7L 4JI0Q 4O2DA 3F1ZA 4HJ7A 4LF7Q 3KJPA 3TS2A 1PH3A 4HIMA 1X3GA 4TQUS 1E22A 5GQOA 3GTJH 2HQLA 5FLXc 4K0KL 3GDEA 3CMAA 1UWVA 1KAWA 2WAQG 3F2DA 1ASZA 4B3SL 1FJGL 4LFBQ 3E0EA 2F52A 3CC2A 2UXBL 3BZCA 2AWOA 1VQAA 4POGA 4AQYQ 5C0XI 4A3DG 4GOPA 2Y0SG 4EX5A 4BY7H 2JA6G 3S1RH 5IE8A 2E5LL 5IYDH 4BXXG 4YY3L 1MKHA 1IZ6A 4PZ8A 1I50H 2JA9A 1JJ2A 2KHJA 3GTOH 1XMQQ 4BBRG 3H3VH 4A3KH 5JEAG 1EQRA 1Y1VG 1HJPA 4IPDA 4PZ6A 4R4IA 3G71A 1IBKQ 2AKWB 5C4XG 4B3MQ 4R4QA 4NPSA 2JJQA 3U4ZA 5EAYA 4AYBE 3AFPA 4DV5Q 4LUOA 3JAMc 2XGTA 4A3MG 1HNZL 3GTLH 4DR7L 4DR6L 4JI4L 3I4NH 3OTOQ 2MQHA 4Y7NH 4BBSG 1WYDA 2IHFA 3HKZE 3UDFA 2UXDL 2N78A 4JBJA 2RHQB 3H3VI 4JI2Q 1YBYA 5IWAL 2OQKA 4L5RC 1V43A 3I56A 2CCZA 1CUKA 4LF8Q 5DLQE 1TWFH 1LYLA 4PMWA 4OXPA 4PG3A 3U4VA 1FVIA 4YHHQ 3TRZA 5K36G 5IP9H 3GTQH 2YU9H 1GD7A 1BKBA 1B70B 3TEHB 1VQPA 4NXNQ 4DR4L 1A62A 3GTMH 1EIFA 2ZTCA 4X62L 2N3SA 2PNHA 4DR5L 1PH1A 1SLJA 1G6PA 4P71A 5ELOA 3M4OH 1P16A 4JBMA 4A3EH 4A3LG 1Y1WH 2Z6KA 2MFIA 1AE3A 4C3JH 3M9BA 2QGQA 1YHAA 4YCVA 4LFBL 1K8GA 2CFMA 2JQOA 4B3RQ 1OXVA 1NE3A 3MXNB 2B3GA 2Q2UA 3HOZH 4DR2Q 4YWMA 5FLMH 3PIPA 4DR2L 2F3IA 3L7ZC 3U50C 3T1YQ 1Q86C 4GLXA 3T1YL 1XPUA 4GKKL 1PVOA 4DK6C 1WJJA 1X54A 2VS1A 3L2PA 1YJ9A 2ASBA 3S15H 4GNXA 1NBWA 1Q12A 3SGIA 4LF4Q 4BBSH 3UDIA 5AJ3Q 3UDGA 3CP0A 4DV3L 1AE2A 5LMNQ 5HY6A 1KRSA 5C44H 1HZ9A 4HJ5A 4DV0L 2OTJA 2CWPA 3KF6A 3KYHC 4A3BG 3A5UA 1SROA 3CPWA 4GNXB 4IFDJ 2UU9Q 3HKSA 4A3KG 2I5MX 1AH9A 3FKIH 2R6GA 2LXKA 2K5NA 1XJVA 2IHEA 1Q1EA 5HGQA 4B3SQ 1CKOA 1L1OC 2ALYB 4JI2L 1VCIA 5IYBG 5JJKA 2WFWA 5LMUQ 1VQFA 1PH6A 4A3CG 3PUVA 2R93G 4LNQA 1X65A 5IP7G 3RN5A 1GKHA 2E8GA 4YHHL 4BA1I 2R7FA 3HKZG 4LWCA 2EIFA 3PCOB 4OONA 1C0AA 1C9OA 5IYCH 4JBKA 4DV7L 1L1OA 1YNXA 5IP7H 3PUXA 1HZBA 3UDXA 5IYBH 1LTLA 2PQAA 2GN5A 3F2BA 4R1JA 2B29A 4TVAB 5BR8L 4POFA 1NTGA 2R7DA 2GVBA 3S1MH 1EQQA 1I94L 3GO5A 1HR0W 4A3BH 5IY0A 4JOIC 1M90C 1OTCA 3CCUA 2K5HA 1NMGA 4X64L 3DLLA 1WI5A 5M5YH 1GM5A 3S17H 3I7FA 3I55A 2R92G 3AYHB 1KC8C 1X9NA 2VL6A 4P72A 4BA2I 2JEBI 1VQIA 2IT1A 1W3SA 4A3IG 1QZGA 3HOZG 1I5FA 2F4VQ 2YV5A 4H02A 2LXJA 1PH5A 1V9PA 3HOUG 3CAMA 3S24A 1VQMA 1XMOL 1N33L 2Q2IA 3ULJA 3PUWA 1HNWQ 4KHZA 1D7QA 2VQEQ 2QA4A 1Q8KA 5IYDG 4HJAA 4X65Q 4DR1Q 4JI0L 4A3EG 1CSPA 3BU2A 2JE6I 4A76A 4Y52H 2RF4A 1LUZA 1ASYA 4KHPQ 3ER0A 2A1AA 3H0GG 3CC4A 4DR3L 2HT1A 2V1CC 3TQYA 4QIWE 3HOVG 1KRTA 3W1GA 2AHOB 1YI2A 1N32Q 2CWAA 5GAHC 3CCMA 1Y1WG 1N34Q 4LFCQ 2E5LQ 1U5KA 4HIKA 4LFCL 1N34L 2HIVA 4IPGA 2K4KA 1HR0L 4LFAL 2R7ZG 1CKNA 1JJCB 2I0QA 1XNQL 4GN3B 2DGYA 4P74A 3ICEA 1OXTA 1HZCA 4B3TQ 3HFZB 4IPCA 3AEVA 2IY5B 4X6AH 4B3TL 4PZ7A 2ID0A 1QVCA 2WP8J 4BY1G 3DM3A 2JA8G 4GOPC 1QZHA 4ME3A 4DAMA 2CKZB 1YHQA 1Y1VH 2Q2TA 3PSIA 2N8NA 3IRBA 3GTGH 4JYAQ 1Q46A 3S14H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AYB G;  1X6O A;  3KDF B;  4QL5 A;  3STB D;  3I4N G;  2IX0 A;  2PI2 E;  3K0X A;  1Z9F A;  3D0F A;  1V1Q A;  3FP9 A;  3L0O A;  3F2C A;  3PUY A;  2Z0S A;  1IXR A;  2D0O A;  1UE7 A;  4OWX B;  5LMN W;  2JA7 H;  2MO1 A;  3W1B A;  1K3R A;  5C4X H;  1A8V A;  3HOW G;  4JI3 Q;  4DR4 Q;  4AIM A;  3NEN A;  4GLA C;  4NXN L;  5GAG C;  5C0X J;  1K8A C;  1VQL A;  1S3O A;  1NMF A;  4JC0 A;  4DR1 L;  1JE5 A;  2B63 G;  4GLV B;  4JG2 A;  2HHH L;  3PUZ A;  1J5E Q;  3EN2 A;  4BXX H;  4RMF A;  3JAM i;  4IO9 A;  1D8L A;  5IYC G;  4DV5 L;  2UUA Q;  4DV1 Q;  2UXC Q;  1EFW A;  4A3D H;  4R4T A;  2UXC L;  3CCE A;  2YTY A;  3HOU H;  3H15 A;  1UEB A;  1YVC A;  4X66 L;  4UP7 A;  4NB3 A;  2UXD Q;  2PI2 A;  2R93 H;  3RNU A;  3CCR A;  1XTD A;  4EQ5 A;  1VQO A;  1VQH A;  1G29 1;  1TWC H;  4GS3 A;  2KCT A;  4A3J H;  2ES2 A;  4GKK Q;  4JOI A;  3D31 A;  5C3E H;  2RCN A;  4YWK A;  1XMO Q;  4XIG S;  4JI5 Q;  1Y14 B;  1J6Q A;  1RIP A;  2WB1 E;  4X62 Q;  1Z47 A;  4DR5 Q;  3UE0 A;  1VQ7 A;  1EWI A;  1BVS A;  3K81 C;  3CCJ A;  3S2D H;  3T1H Q;  2HIX A;  1YZ6 A;  4XTC S;  1IBL Q;  1KXL A;  2OTL A;  2UU9 L;  4JI8 Q;  4JI8 L;  4JCV E;  4JYA L;  1NY4 A;  2BA1 A;  1FJG Q;  1YHB A;  1Q7Y C;  1IYJ B;  1MJC A;  1TWG H;  1SE8 A;  4IOC A;  1VQK A;  1PH9 A;  4QY7 A;  1SN8 A;  1VQC A;  4MTN A;  4DPG A;  3S16 H;  1G51 A;  2OQ0 A;  2JA5 H;  1PFS A;  2UUB L;  4A3C H;  4LFA Q;  2UUB Q;  1K83 H;  2B63 H;  2YYZ A;  1M1K C;  1XNQ Q;  4MNO A;  4YCW A;  2EXD A;  2A19 A;  4DV6 L;  4GNX C;  1E7Z A;  1X3E A;  2UUC L;  5M5X H;  1OXX K;  4AH6 A;  1PH2 A;  4HJ8 A;  2HHH Q;  2MO0 A;  4UPA A;  1J5E L;  4QQB X;  2NVY H;  5C44 G;  1JJG A;  4DUZ L;  1EOV A;  1E3P A;  2ZM6 Q;  1IBM Q;  4BY1 H;  4DUZ Q;  3PO3 H;  1JMC A;  4DV1 L;  5IP9 G;  3KOJ A;  1VQN A;  1RL2 A;  1CKM A;  1L2F A;  4A3F H;  2NZO A;  5ELN A;  1A63 A;  4A93 H;  1PV4 A;  2KEN A;  3J81 j;  2I5H A;  1YIJ A;  2R7Z H;  1Q1B A;  1JB7 A;  1FGU A;  1QUQ B;  3S1N H;  2EQS A;  2ZTD A;  4MZ9 A;  3J81 c;  4LF5 L;  1PH8 A;  3PO2 H;  2D0P A;  2KBN A;  4FDB A;  1YJN A;  5GAD C;  2DUD A;  2K52 A;  3G48 A;  1HNX L;  3VDY A;  2Z6K C;  2VQF Q;  2ZJQ A;  2F4V L;  4DV4 Q;  3I2Z A;  3ERS X;  4C2M H;  4O0A A;  4DV4 L;  2PQA B;  1L0W A;  3PF4 A;  2AMC B;  4IPH A;  1T9H A;  2KHI A;  3TS0 A;  3KLW A;  2VQE L;  2OWO A;  1VQD A;  4C3H H;  1PYS B;  3ULL A;  2BA0 A;  1N9W A;  2VNU D;  3A74 A;  3K7A H;  2BH8 A;  1XPR A;  4J15 A;  4P75 A;  1IL2 A;  2VY3 A;  3HOX G;  1B8A A;  3EIV A;  3E9H A;  4IFD I;  4B3R L;  3BJU A;  4AQY L;  2WAQ E;  1P8L A;  3KDF A;  3RLN A;  3UE1 A;  1C7Y A;  3PO2 G;  2PMZ E;  4OX9 Q;  2Q2H A;  1YEZ A;  1X3F A;  1BBW A;  3J7A 5;  1EUJ A;  4L5T A;  4OWW B;  1HR0 Q;  3J7Z C;  1MIU A;  2NN6 G;  4JI6 L;  4DUY Q;  4IOA A;  2NVQ H;  1VQ8 A;  3PO3 G;  3B6Y A;  3I4M G;  1VQJ A;  3CPF A;  4OWT B;  4IJL A;  1HNZ Q;  4DR6 Q;  3CCV A;  3OTO L;  1WFQ A;  2FXQ A;  3CCS A;  3CXC A;  4DV2 Q;  2Y0S E;  2R92 H;  4A3J G;  4DV2 L;  2CQO A;  3A0J A;  4QGU A;  5FJ8 H;  3CME A;  4HJ9 A;  4LF6 Q;  3M3Y H;  3GD7 A;  3Q8D A;  5LMU L;  4OO1 I;  3RLF A;  3I4O A;  3U58 A;  2LSS A;  1VQG A;  1E24 A;  4LF5 Q;  1QUQ A;  1UE1 A;  1WCM H;  2YTV A;  4BY7 G;  2NVX H;  1N32 L;  4DAY B;  4R4O A;  4YY3 Q;  5C4J H;  1PHJ A;  1KHI A;  3ZJY C;  4DV6 Q;  2N49 A;  1A0I A;  3A5Z B;  4IJH A;  3WWV A;  2UUC Q;  4L5Q A;  1XMQ L;  3PIO A;  1B7Y B;  5JJI A;  2ZJP A;  3JC6 6;  3FKI G;  3CQZ H;  1O7I A;  1BBU A;  2JK8 A;  5BR8 Q;  1I94 Q;  1X55 A;  2ZM6 L;  1IBM L;  2ATW A;  4UP9 A;  3HOW H;  1N36 L;  2YTX A;  1KIX A;  3RZO H;  5JJL A;  1K73 C;  3OYY A;  1OXS C;  1VQE A;  5IT9 c;  1VQ4 A;  4RG1 A;  5C3E G;  3J80 c;  1TXY A;  3GTP H;  1SR3 A;  5IWA Q;  3S1Q H;  3NEL A;  1OXU A;  2RHS B;  5FJ8 G;  1JT8 A;  5M3F G;  1LM0 A;  3M4Q A;  4A75 A;  4GKJ L;  1Q81 C;  2VUM G;  4ALP A;  4GKJ Q;  4KI0 A;  1CSQ A;  1W2B A;  1PH4 A;  4LF9 L;  1YIT A;  3LGJ A;  4UP8 A;  2NVT H;  3K80 C;  1DGS A;  2VQF L;  4JI5 L;  4DK3 C;  1HH2 P;  4JI3 L;  2ZJR A;  3HOX H;  4DUY L;  1PH7 A;  3AFQ A;  1H95 A;  1SRU A;  5LMN L;  4HIO A;  1VQ6 A;  3RLO A;  1S72 A;  4JI7 L;  1UE5 A;  3HOY G;  4DR7 Q;  3CD6 A;  4A3L H;  1Q82 C;  4L5S A;  4GN5 A;  3KF6 B;  3RN2 A;  3G4S A;  3E9I A;  5FLM G;  4KHP L;  3GTK H;  4A3G G;  4LF6 L;  1SFO H;  3PV0 A;  1GVP A;  1UE6 A;  2JA7 G;  4IFD G;  1QVF A;  5J3B A;  5C0X G;  1YJW A;  3CW2 C;  1R9T H;  4WJ4 A;  4A3G H;  4YCU A;  3MEF A;  1S40 A;  1XPO A;  1FL0 A;  3STB C;  4DKA C;  2K14 A;  3M4P A;  3NEM A;  1K0R A;  2QEX A;  4JBW A;  4NXM L;  4APV A;  2L15 A;  5M3M G;  1QVG A;  3J80 i;  1VQ9 A;  3KJO A;  3CC7 A;  3M7N A;  4JV5 L;  3F8T A;  1I6H H;  4A93 G;  2NN6 I;  4JI6 Q;  1IBK L;  2JA8 H;  2OCE A;  2E2I H;  1KL9 A;  4QJF A;  1VQB A;  3FHW A;  4DV0 Q;  1N36 Q;  5M5W H;  3T1H L;  1E1O A;  4A3I H;  1X56 A;  3M85 A;  1IBL L;  3S2H H;  2NZH A;  4C3I H;  4K0K Q;  1EIY B;  1SMX A;  2K75 A;  2ZTE A;  5M3M H;  5H1S E;  2C35 B;  3PF5 A;  4R4C A;  2K5V A;  5M3F H;  1WOC A;  3W5O A;  4A3F G;  1NJI C;  2E2J H;  4LF8 L;  4OO1 G;  2UXB Q;  1U0L A;  2GVA A;  1HNW L;  4A3M H;  4A4I A;  2JA5 G;  2JA6 H;  4LF9 Q;  1TWH H;  3RZD H;  1HNX Q;  1VS0 A;  3HOV H;  3BZK A;  4JI1 L;  1I3Q H;  1PYB A;  4DV7 Q;  4JI1 Q;  3H0G H;  1N33 Q;  4BBR H;  1KD1 C;  3CCL A;  1KQS A;  4GOP B;  3K8A A;  3K7U C;  4LUZ A;  3CCQ A;  1PA6 A;  4JI7 Q;  4WJ3 M;  4X65 L;  3OW2 A;  3RR5 A;  2AWN A;  4B3M L;  3HOY H;  4HID A;  2UUA L;  2WB1 G;  5GAE C;  1VQ5 A;  3G6E A;  3AQQ A;  2VW9 A;  2VZA A;  2IX1 A;  1EYG A;  4JI4 Q;  1WCM G;  4X66 Q;  4DR3 Q;  4X64 Q;  3KF8 B;  1E1T A;  1N8R C;  1MJE A;  3NBH B;  2D62 A;  4DNI A;  5JEA J;  1XNR L;  2BH2 A;  5E7N A;  1XNR Q;  1TWA H;  3TRE A;  2MNA A;  2K50 A;  4LUV A;  1HZA A;  4LW1 A;  3J81 i;  2VUM H;  3CF5 A;  3KFU A;  3PGZ A;  4OX9 L;  2XTI A;  2JEA I;  4P73 A;  4GN4 B;  3ULP A;  4NXM Q;  1GO3 E;  4JV5 Q;  2I5L X;  2KCM A;  1L1O B;  2H5X A;  1K9M C;  3I4M H;  2E2H H;  3EBE A;  4LF4 L;  2A8V A;  1CKN B;  4YWL A;  4UY8 C;  4KLK A;  5GRO A;  4DV3 Q;  5AJ3 L;  4LF7 L;  4JI0 Q;  4O2D A;  3F1Z A;  4HJ7 A;  4LF7 Q;  3KJP A;  3TS2 A;  1PH3 A;  4HIM A;  1X3G A;  4TQU S;  1E22 A;  5GQO A;  3GTJ H;  2HQL A;  5FLX c;  4K0K L;  3GDE A;  3CMA A;  1UWV A;  1KAW A;  2WAQ G;  3F2D A;  1ASZ A;  4B3S L;  1FJG L;  4LFB Q;  3E0E A;  2F52 A;  3CC2 A;  2UXB L;  3BZC A;  2AWO A;  1VQA A;  4POG A;  4AQY Q;  5C0X I;  4A3D G;  4GOP A;  2Y0S G;  4EX5 A;  4BY7 H;  2JA6 G;  3S1R H;  5IE8 A;  2E5L L;  5IYD H;  4BXX G;  4YY3 L;  1MKH A;  1IZ6 A;  4PZ8 A;  1I50 H;  2JA9 A;  1JJ2 A;  2KHJ A;  3GTO H;  1XMQ Q;  4BBR G;  3H3V H;  4A3K H;  5JEA G;  1EQR A;  1Y1V G;  1HJP A;  4IPD A;  4PZ6 A;  4R4I A;  3G71 A;  1IBK Q;  2AKW B;  5C4X G;  4B3M Q;  4R4Q A;  4NPS A;  2JJQ A;  3U4Z A;  5EAY A;  4AYB E;  3AFP A;  4DV5 Q;  4LUO A;  3JAM c;  2XGT A;  4A3M G;  1HNZ L;  3GTL H;  4DR7 L;  4DR6 L;  4JI4 L;  3I4N H;  3OTO Q;  2MQH A;  4Y7N H;  4BBS G;  1WYD A;  2IHF A;  3HKZ E;  3UDF A;  2UXD L;  2N78 A;  4JBJ A;  2RHQ B;  3H3V I;  4JI2 Q;  1YBY A;  5IWA L;  2OQK A;  4L5R C;  1V43 A;  3I56 A;  2CCZ A;  1CUK A;  4LF8 Q;  5DLQ E;  1TWF H;  1LYL A;  4PMW A;  4OXP A;  4PG3 A;  3U4V A;  1FVI A;  4YHH Q;  3TRZ A;  5K36 G;  5IP9 H;  3GTQ H;  2YU9 H;  1GD7 A;  1BKB A;  1B70 B;  3TEH B;  1VQP A;  4NXN Q;  4DR4 L;  1A62 A;  3GTM H;  1EIF A;  2ZTC A;  4X62 L;  2N3S A;  2PNH A;  4DR5 L;  1PH1 A;  1SLJ A;  1G6P A;  4P71 A;  5ELO A;  3M4O H;  1P16 A;  4JBM A;  4A3E H;  4A3L G;  1Y1W H;  2Z6K A;  2MFI A;  1AE3 A;  4C3J H;  3M9B A;  2QGQ A;  1YHA A;  4YCV A;  4LFB L;  1K8G A;  2CFM A;  2JQO A;  4B3R Q;  1OXV A;  1NE3 A;  3MXN B;  2B3G A;  2Q2U A;  3HOZ H;  4DR2 Q;  4YWM A;  5FLM H;  3PIP A;  4DR2 L;  2F3I A;  3L7Z C;  3U50 C;  3T1Y Q;  1Q86 C;  4GLX A;  3T1Y L;  1XPU A;  4GKK L;  1PVO A;  4DK6 C;  1WJJ A;  1X54 A;  2VS1 A;  3L2P A;  1YJ9 A;  2ASB A;  3S15 H;  4GNX A;  1NBW A;  1Q12 A;  3SGI A;  4LF4 Q;  4BBS H;  3UDI A;  5AJ3 Q;  3UDG A;  3CP0 A;  4DV3 L;  1AE2 A;  5LMN Q;  5HY6 A;  1KRS A;  5C44 H;  1HZ9 A;  4HJ5 A;  4DV0 L;  2OTJ A;  2CWP A;  3KF6 A;  3KYH C;  4A3B G;  3A5U A;  1SRO A;  3CPW A;  4GNX B;  4IFD J;  2UU9 Q;  3HKS A;  4A3K G;  2I5M X;  1AH9 A;  3FKI H;  2R6G A;  2LXK A;  2K5N A;  1XJV A;  2IHE A;  1Q1E A;  5HGQ A;  4B3S Q;  1CKO A;  1L1O C;  2ALY B;  4JI2 L;  1VCI A;  5IYB G;  5JJK A;  2WFW A;  5LMU Q;  1VQF A;  1PH6 A;  4A3C G;  3PUV A;  2R93 G;  4LNQ A;  1X65 A;  5IP7 G;  3RN5 A;  1GKH A;  2E8G A;  4YHH L;  4BA1 I;  2R7F A;  3HKZ G;  4LWC A;  2EIF A;  3PCO B;  4OON A;  1C0A A;  1C9O A;  5IYC H;  4JBK A;  4DV7 L;  1L1O A;  1YNX A;  5IP7 H;  3PUX A;  1HZB A;  3UDX A;  5IYB H;  1LTL A;  2PQA A;  2GN5 A;  3F2B A;  4R1J A;  2B29 A;  4TVA B;  5BR8 L;  4POF A;  1NTG A;  2R7D A;  2GVB A;  3S1M H;  1EQQ A;  1I94 L;  3GO5 A;  1HR0 W;  4A3B H;  5IY0 A;  4JOI C;  1M90 C;  1OTC A;  3CCU A;  2K5H A;  1NMG A;  4X64 L;  3DLL A;  1WI5 A;  5M5Y H;  1GM5 A;  3S17 H;  3I7F A;  3I55 A;  2R92 G;  3AYH B;  1KC8 C;  1X9N A;  2VL6 A;  4P72 A;  4BA2 I;  2JEB I;  1VQI A;  2IT1 A;  1W3S A;  4A3I G;  1QZG A;  3HOZ G;  1I5F A;  2F4V Q;  2YV5 A;  4H02 A;  2LXJ A;  1PH5 A;  1V9P A;  3HOU G;  3CAM A;  3S24 A;  1VQM A;  1XMO L;  1N33 L;  2Q2I A;  3ULJ A;  3PUW A;  1HNW Q;  4KHZ A;  1D7Q A;  2VQE Q;  2QA4 A;  1Q8K A;  5IYD G;  4HJA A;  4X65 Q;  4DR1 Q;  4JI0 L;  4A3E G;  1CSP A;  3BU2 A;  2JE6 I;  4A76 A;  4Y52 H;  2RF4 A;  1LUZ A;  1ASY A;  4KHP Q;  3ER0 A;  2A1A A;  3H0G G;  3CC4 A;  4DR3 L;  2HT1 A;  2V1C C;  3TQY A;  4QIW E;  3HOV G;  1KRT A;  3W1G A;  2AHO B;  1YI2 A;  1N32 Q;  2CWA A;  5GAH C;  3CCM A;  1Y1W G;  1N34 Q;  4LFC Q;  2E5L Q;  1U5K A;  4HIK A;  4LFC L;  1N34 L;  2HIV A;  4IPG A;  2K4K A;  1HR0 L;  4LFA L;  2R7Z G;  1CKN A;  1JJC B;  2I0Q A;  1XNQ L;  4GN3 B;  2DGY A;  4P74 A;  3ICE A;  1OXT A;  1HZC A;  4B3T Q;  3HFZ B;  4IPC A;  3AEV A;  2IY5 B;  4X6A H;  4B3T L;  4PZ7 A;  2ID0 A;  1QVC A;  2WP8 J;  4BY1 G;  3DM3 A;  2JA8 G;  4GOP C;  1QZH A;  4ME3 A;  4DAM A;  2CKZ B;  1YHQ A;  1Y1V H;  2Q2T A;  3PSI A;  2N8N A;  3IRB A;  3GTG H;  4JYA Q;  1Q46 A;  3S14 H; 
#chains in the Genus database with same CATH topology
 4AYB G;  1A9X A;  4KD4 A;  1GUG A;  1SSO A;  2R82 A;  2DPJ A;  3FEW X;  3JAM E;  1Z9F A;  1TWF B;  2ZDG A;  2Z0S A;  2IWH A;  2JA7 H;  3U9T A;  2RBM A;  5C4X H;  4Q0Y A;  2ALZ A;  4JI3 Q;  1J8I A;  4AIM A;  3GTP B;  1K8A C;  1VBH A;  3GTO A;  4NDX A;  1JE5 A;  4HCS A;  4JG2 A;  1NR2 A;  2WB1 A;  4RMF A;  4A2A A;  4IO9 A;  1D8L A;  4RGT A;  5IYC G;  4DV5 L;  4DV1 Q;  2YTY A;  3HOU H;  3GTO B;  4I50 F;  4EBC A;  5M5Y B;  5KT2 A;  3VR5 A;  4U68 A;  4EQ5 A;  3CCR A;  1VQH A;  4ECX A;  3ND8 A;  1TWC H;  4GS3 A;  2KCT A;  1STN A;  2YZN A;  1KNA A;  5FD6 A;  2W9C A;  2I07 B;  1K0S A;  1BXT A;  1LTI D;  4JI5 Q;  4K2L A;  1PRT C;  1Y14 B;  1J6Q A;  1SNQ A;  2WB1 E;  5FPO A;  4X62 Q;  1Z47 A;  2Z8L A;  4DR5 Q;  2F0H A;  4Q5V A;  5KG7 A;  3UE0 A;  1VQ7 A;  3CCJ A;  1I3Q B;  3IKJ A;  2OTL A;  1TWH B;  2CQY A;  1NY4 A;  1H9K A;  1ROD A;  2GLT A;  5DQG A;  1E4E A;  1TWG H;  5EKL A;  2PMZ A;  2VA3 A;  3LWU A;  4IOC A;  1PH9 A;  3EQL C;  4QY7 A;  1SN8 A;  3W3A A;  1T5X D;  2I46 A;  1JOK A;  3OHA A;  4C3J G;  1K83 H;  2VQE H;  2FB9 A;  4KV6 A;  2EXD A;  4XQJ A;  1X3E A;  4IRD A;  4DK1 A;  1OXX K;  1WD0 A;  2HHH Q;  2MO0 A;  2WAC A;  1I6H B;  1WH2 A;  4QQB X;  5C44 G;  4LH7 A;  4DUZ L;  1EOV A;  1IBM Q;  4BY1 H;  1ZEQ X;  1JMC A;  4DV1 L;  4U7C A;  3KOJ A;  3GIJ A;  4C3H B;  5C5L A;  1CKM A;  4DU9 A;  4A3F H;  1N36 H;  4QUF A;  1CA6 A;  3RB6 A;  2EJM A;  2SDF A;  1PV4 A;  2KEN A;  3G6J B;  4JI0 H;  1Q1B A;  4MTK A;  3JSL A;  1K8O A;  1YJN A;  1U9R A;  1LTG D;  2DUD A;  2F4V L;  2YZM A;  5C0X H;  1SYB A;  2VQF Q;  5KFN A;  4C2M H;  4O0A A;  3CRK C;  4IHJ F;  4IR9 A;  1LO5 D;  4B3M H;  3KLW A;  2VQE L;  3ULL A;  3IN5 A;  2L4N A;  5KYL A;  4RU9 A;  1CFM A;  2VNU D;  3VR3 A;  1EU3 A;  3A74 A;  4J6H A;  3RV4 A;  1IL2 A;  2RCF A;  2E2H A;  1B8A A;  4IFD I;  3P75 A;  3WOF A;  3NXW A;  5IGD A;  2G5D A;  2O03 A;  1RJP A;  3C1E A;  3KDF A;  2HJW A;  1SYG A;  3RLN A;  3UE1 A;  1AP0 A;  4OX9 Q;  1IKL A;  1G6Z A;  3OMG A;  3FPP A;  5FLX W;  4KY6 A;  1YEZ A;  2EYO A;  3BDL A;  3HG9 A;  2K33 A;  4L5T A;  2R3Z A;  3Q0A A;  3HOW B;  4DL5 A;  1MIU A;  3R3O A;  2F0G A;  2YS6 A;  1VQ8 A;  1EIG A;  1W93 A;  1I6U A;  2K28 A;  3PO3 G;  1VQJ A;  3CPF A;  3Q8R B;  3J7Y W;  3PW7 A;  1HNZ Q;  1B4O A;  3GTQ A;  4JYA H;  1AUX A;  2AQ4 A;  2FK1 A;  1WCM B;  1IOW A;  1S5E D;  3A0J A;  2NVT B;  2A5H A;  3GD7 A;  3NBH A;  3Q8D A;  1TT2 A;  5LMU L;  3RLF A;  3M3Y B;  3I4O A;  3U58 A;  2JA7 A;  2PYK A;  1VQG A;  2SNM A;  3A8J E;  3T5K A;  1SDF A;  3J7A V;  2E76 C;  1Z6H A;  4C1N I;  5C4J H;  3D8G A;  4KY7 A;  1KHI A;  4X3U A;  1JIH A;  3ZJY C;  4ECQ A;  3A5Z B;  1J5E H;  1XMQ L;  1B7Y B;  2NVQ B;  3QFF A;  1DYQ A;  5EDW A;  1EEI D;  2GPW A;  1O7I A;  2IP4 A;  3RTX A;  2VOB A;  3URY A;  2F3W A;  4UP9 A;  3GTL A;  2YTX A;  4ULL A;  3MEH A;  1M6V A;  3MC0 B;  2WAQ B;  3MFY A;  1VQ4 A;  3N40 P;  3D4D A;  3GTP H;  1SR3 A;  4PWQ A;  1JT8 A;  2HCI A;  5C4J B;  2BQ3 A;  3GIK A;  3GTK A;  1LM0 A;  2K5Q A;  2O2L D;  3M4Q A;  4LSA A;  1Q81 C;  4YP3 A;  4XYO A;  1HR0 H;  2B2U C;  4KI0 A;  2JP1 A;  2TSS A;  1QG7 A;  5DLG A;  1E0B A;  3JZI A;  3K80 C;  1DGS A;  2VQF L;  4JI3 L;  3S14 B;  2EYJ A;  1VF5 C;  2PBZ A;  4IWX A;  5D65 A;  5C3X A;  2A68 D;  3AFQ A;  1H95 A;  4HIO A;  1VQ6 A;  4OGQ C;  2W6Z A;  4OL7 A;  1Q82 C;  3GTK H;  2Z9H A;  3NE5 B;  1JOR A;  5EWE A;  2KOL A;  2WTF A;  2K32 A;  4FNF A;  2W9B B;  4XYM B;  4IFD H;  1UE6 A;  3IG0 A;  5KFC A;  4XQN A;  5J3B A;  2PW5 A;  2RQX A;  4C3I B;  1PK8 A;  3RGZ A;  1JR0 D;  1R9T H;  5IGC A;  4A3G H;  1GJX A;  3MEF A;  3J81 L;  1XPO A;  2VPQ A;  2A6H C;  4DKA C;  5EKK A;  2EY6 A;  2F0Q A;  4JBW A;  2NUA B;  5M3M G;  4JV5 L;  2R7Z A;  4YY3 H;  4ME5 A;  2NN6 I;  4L63 B;  2JA8 H;  1TS4 A;  2XWJ B;  3I3C A;  1X56 A;  1VBG A;  4WRD A;  1T36 A;  2KCC A;  1C3O A;  3SK8 A;  4DV1 H;  1SMX A;  5M3M H;  3QZ8 A;  3OIQ A;  3MFI A;  3VYU A;  1DOM A;  2ZXP A;  2BCO A;  4LF8 L;  2UXB Q;  1W96 A;  3GTK B;  1I3Q A;  2GVA A;  5IWA H;  3F8N A;  4K6D A;  1EUD B;  4HR7 B;  3HOV H;  4JI1 L;  5KFO A;  4UHV A;  4JI1 Q;  4B3R H;  1WVL A;  1N33 Q;  1CQI B;  3SE7 A;  2P5Z X;  2R8K A;  5KT5 A;  4FBT A;  3FRP B;  1EY4 A;  1OO9 B;  4JI7 Q;  4DR4 H;  3OW2 A;  5KFR A;  2AWN A;  2NVY B;  2ICE C;  2HVQ A;  3I73 A;  3ETJ A;  4KJN A;  2FK2 A;  3PR5 B;  3KK7 A;  3AQQ A;  2FIN B;  4WOR A;  1EYG A;  2IX1 A;  1ILQ A;  1RTO A;  1WCM G;  2K04 A;  3BVM A;  4C5A A;  1E1T A;  1N8R C;  3NBH B;  4DV3 H;  2D62 A;  1XNR L;  2BH2 A;  2F0P A;  1WTW A;  4WFN 3;  3TRE A;  2K50 A;  1DM0 B;  1B9M A;  4LUV A;  4RA8 A;  4X3K A;  3J81 i;  3S16 B;  1KJQ A;  4LF8 H;  2CVR A;  2XTI A;  3F2U A;  4DAY A;  1GO3 E;  4EGQ A;  4JV5 Q;  4GKK H;  2H5X A;  4KY5 A;  2E2H H;  2A74 C;  2A8V A;  4C2M A;  3FKI B;  1E4E B;  5DQH A;  4HJ7 A;  3KJP A;  3M9O B;  4CHT B;  4TQU S;  1E22 A;  2DY7 A;  4CC6 A;  1A15 A;  2HDM A;  2HQL A;  5FLX c;  3KBX A;  3CVZ A;  1GUN A;  1KAW A;  2WAQ G;  4UCT A;  2L5T A;  4EEQ A;  4CJ2 C;  2F0M A;  3BZC A;  1BCP D;  1VQA A;  2ICI A;  3S9W A;  5C0X I;  4G7O C;  1ENA A;  2Y0S G;  1F2M A;  3S1R H;  2VB3 X;  2E5L L;  4OHJ A;  2NVY A;  4O1N A;  5FPR A;  3D3R A;  1V51 A;  3HOZ B;  4J9Q A;  4PZ8 A;  1I50 H;  2JA9 A;  4O42 A;  4DL2 A;  4A3K H;  5JEA G;  1EQR A;  4GKJ H;  1M0T A;  4IPD A;  3G71 A;  3PIP 3;  4R4I A;  3C0F B;  3CU7 A;  2AKW B;  3BA9 A;  4B3M Q;  2Z4H A;  4R4Q A;  5JH7 F;  2FMC A;  4AYB E;  3AFP A;  4N8X 1;  5CC4 A;  5LP6 F;  1E2Z A;  3I4N H;  1GGO A;  3DHQ A;  4EFB A;  5JPN C;  4Y7N H;  4BBS G;  1WYD A;  5CMD A;  3HKZ E;  2UXD L;  4M8A A;  3H3V I;  4IAL A;  2CW0 C;  4JI2 Q;  2B63 A;  4L5R C;  3EPI A;  3I56 A;  3M9N B;  5BMV F;  3G6X A;  5DLQ E;  4Q43 A;  1JWM D;  4YHH Q;  1S5F D;  1DV2 A;  4B3T H;  1X3Q A;  3GTQ H;  4ZCK A;  1BNC A;  2BQR A;  1O78 A;  1RF2 D;  1A62 A;  5C6A A;  1EIF A;  2PNH A;  4RGN A;  5A35 A;  2FLP A;  2UUA H;  1IL8 A;  5EPJ A;  1SLJ A;  1PH1 A;  3GTJ A;  4P71 A;  5ELO A;  1AW7 A;  3M4O H;  1P16 A;  1B6R A;  4A3E H;  4TQR A;  4IUT A;  2R8H A;  1AE3 A;  5KG4 A;  2M2L A;  1EYA A;  1YHA A;  4RB2 C;  1HCZ A;  1HHV A;  4J9L A;  2CFM A;  3OWE B;  1ZYR D;  4YHH H;  2YL2 A;  1I50 B;  2PO4 A;  4DR2 Q;  5JQW A;  5D1O B;  1LAB A;  4DR2 L;  3U50 C;  1ICW A;  5JOB A;  1XPU A;  4DR1 H;  1U4L A;  4QWE A;  5CGK A;  1JC7 A;  4DK6 C;  4LFB H;  2VS1 A;  3EA6 A;  3OSN A;  1PTO F;  1NBW A;  4BBS H;  3VMM A;  1C4Q A;  3UDI A;  5IT9 E;  3CP0 A;  2B63 B;  5C44 H;  4HJ5 A;  3NGD A;  3SVM A;  3G8C A;  4DV0 L;  3PW0 A;  5FKA C;  1SBB B;  3KF6 A;  4A3K G;  1XJV A;  2GPS A;  3MAQ A;  1Q1E A;  1BNZ A;  4YR3 A;  4BWG B;  4B3S Q;  1K1Q A;  5JJK A;  3KAK A;  3MVV A;  5LMU Q;  4A3C G;  3KBG A;  2WDT A;  5COR A;  4YHH L;  1HUM A;  4LWC A;  1C0A A;  5K5P A;  1I94 H;  1XWE A;  2F3V A;  4DV7 L;  1L1O A;  1PFB A;  1YNX A;  3ORQ A;  2DNE A;  3V6K A;  1QOH A;  2PQA A;  1JWU D;  1SYD A;  5C5J A;  1IHZ A;  2MUY A;  4Q0F A;  4POF A;  2GVB A;  5DM7 3;  1B50 A;  3LP8 A;  3GO5 A;  4A3B H;  2BDN A;  1K8M A;  1KJ8 A;  5KG3 A;  4PNY A;  5IY0 A;  5KFF A;  1SEB D;  3JRW A;  3BYT B;  4X64 L;  2P0A A;  3KHL A;  3E6Z X;  1FNU A;  1WI5 A;  3V2T A;  5M5Y H;  2YRX A;  3S17 H;  5KFH A;  5CBE E;  4XDX A;  1JX4 A;  4P72 A;  3IL8 A;  4BA2 I;  4FF1 A;  1Y8N B;  2XIG A;  3TDQ A;  1QZG A;  3DEP A;  3GP7 A;  3SR1 A;  2UVR A;  5CV8 A;  2F0W A;  2YV5 A;  4EBE A;  2LXJ A;  1Z7T A;  2W8K A;  3NBI A;  4EYI B;  2AGQ A;  3CAM A;  4V0B A;  1VQM A;  1N33 L;  4NP5 A;  2XC9 A;  3PUW A;  2O4X A;  1LT5 D;  1AEX A;  4HED A;  4IQZ A;  4HJA A;  4JI0 L;  1D5M C;  2R8J A;  3A7A B;  1PZK D;  4Y52 H;  2F0D A;  1LUZ A;  1Q3L A;  4KHP Q;  1CQV A;  3H0G G;  4O3N A;  4AQY H;  1B6S A;  3BS1 A;  1S68 A;  2V1C C;  4QIW E;  3HOV G;  1KRT A;  1BGW A;  5EPK A;  2AHO B;  1QE6 A;  3VR6 A;  2CWA A;  2XSC A;  4X62 H;  4DR5 H;  3V96 A;  5ELD A;  3VA7 A;  3CCM A;  4O3S A;  4LFC Q;  1SXT A;  1KJ9 A;  4LFC L;  2KEE A;  4IPG A;  2K4K A;  4RGM A;  2C28 A;  2I0Q A;  1JJC B;  1AFP A;  2DGY A;  1DD2 A;  2B2T C;  1RTN A;  1KDB A;  3AEV A;  2IY5 B;  1S5D D;  4EGJ A;  1LLR D;  3O13 A;  1BOS A;  2M00 A;  5I2X A;  1S9F A;  2RDF A;  2CKZ B;  1YHQ A;  3TII A;  2ASL A;  1QIL A;  1JB3 A;  3PSI A;  2BE5 D;  2N8N A;  4JYA Q;  4TV8 F;  4ETS A;  2NU7 B;  2H4O A;  3HOX B;  2IPK D;  2RGV A;  1HNZ H;  4TSS A;  4UFZ A;  1X6O A;  2X6L A;  2A6H D;  3H4B A;  2PI2 E;  4I65 A;  1HQM C;  3FP9 A;  3K0X A;  4YQW A;  1QWY A;  5IT9 W;  1UE7 A;  1I4R A;  2QW7 A;  3HZX A;  3W1B A;  2IX3 A;  3Q23 A;  1A8V A;  4N8F A;  4U6P A;  5KNB A;  4GLA C;  4NXN L;  1Y69 U;  4LH6 A;  2Z1C A;  1NMF A;  2F0N A;  3JAM L;  1KTK A;  4FF3 A;  1SE4 A;  3N52 A;  4FXG C;  1J5E Q;  3I4M B;  4JI8 H;  1U4P A;  2D5D A;  2UUA Q;  1GHK A;  1KEE A;  2UXC L;  4RZQ A;  3L4K A;  1KJJ A;  1YVC A;  1WTP A;  2UXD Q;  5J2U F;  3GIP A;  2F0S A;  4UCV A;  2KJX A;  3NSW A;  3RNU A;  4HNU A;  5KX5 F;  4ECZ A;  3RBD A;  1V1P B;  2EOT A;  1Y1W A;  3NQI A;  1TKW B;  1BUV T;  3GV6 A;  2OF1 A;  4EQP A;  5C3E H;  2RCN A;  1SCU B;  1CQF A;  1XMO Q;  1ZET A;  1XNR H;  2VQD A;  1ET6 A;  5BN3 A;  1MSH A;  4E4T A;  3MXG A;  3S2D H;  4DR7 L;  1EWI A;  3K81 C;  5EZY F;  3T1H Q;  1SYE A;  1EY6 A;  1SNM A;  4XTC S;  1M4V A;  1TAE A;  4JI8 Q;  4I7H A;  3DWA A;  4JI8 L;  5CAE B;  1PX2 A;  3WOE A;  2F0E A;  1YHB A;  1IYJ B;  1RYS A;  5IOD A;  5M3F B;  3QOL A;  1VQK A;  1EY7 A;  2Y0S A;  3TP8 A;  1VQC A;  3S16 H;  4EYH B;  5LMU H;  2OQ0 A;  4J0M A;  1ULZ A;  5IOC A;  4B3S H;  2J6S A;  3NHH A;  4IUR A;  4O4H F;  1LT6 D;  4C5C A;  2C22 A;  4MNO A;  2FMM A;  4DV6 L;  2D2C C;  2UUC L;  1PZJ D;  1E7Z A;  4DV7 H;  5J2T F;  5M5X H;  4AH6 A;  1A3T A;  4UPA A;  3HOY B;  5I9O A;  1JJG A;  2ZM6 Q;  4O3P A;  4TQS A;  1B9N A;  5IP9 G;  4WD3 A;  2XGQ A;  2VQF H;  1VQN A;  1NCV A;  5CA0 F;  5FLX E;  3WDN A;  4KMU C;  4IUN A;  2A6E D;  3SK5 A;  4A93 H;  3VR4 A;  3J81 j;  2KCN A;  2CH4 W;  2R7Z H;  4DL7 A;  1RD9 D;  5D1P A;  2IBK A;  2ZT9 C;  1QUQ B;  3S1N H;  4IUV A;  2R85 A;  1RJT A;  4LF5 L;  1PH8 A;  3R23 A;  1Y1W B;  4MTE A;  2KBN A;  4FDB A;  5HV6 A;  2EZV A;  1HNX L;  1EQV A;  3I2Z A;  4DV4 L;  1XX8 A;  1L0W A;  4A93 B;  4IPH A;  2AMC B;  1T9H A;  4ECU A;  1CZW A;  4C3H H;  2PQE A;  1PYS B;  4A2B A;  3T5L A;  3EYY A;  1PRT D;  2VB2 X;  2HGS A;  1G2T A;  5C8Y F;  3LNN A;  1R9T A;  2XVS A;  1GOZ A;  4DV4 H;  1U4R A;  2BH8 A;  1XPR A;  2VPS A;  2EYF A;  3T5J A;  4NMZ A;  4P75 A;  4DXF A;  4XQQ A;  4BWS C;  5DNF A;  5LXT F;  1EYD A;  3EIV A;  4B3R L;  5L1J A;  4AQY L;  4ED1 A;  2K01 A;  2WII B;  5F9L A;  3I4N B;  4HSV A;  3J7A 5;  1BBW A;  1EUJ A;  1FGB D;  2BOS A;  1MD2 D;  1SFO B;  5KKN B;  3J7Z C;  2NN6 G;  1TR5 A;  2B2Y C;  5KFS A;  1EY9 A;  4DUY Q;  2NVQ H;  3NP8 A;  4FS2 A;  2NBF A;  4RB0 A;  5DEH A;  4RAY A;  2HVR A;  3I4M G;  2WB1 B;  3NWT A;  3CCV A;  3I12 A;  4LK1 C;  2FXQ A;  2L11 A;  2Y0S E;  4DV2 L;  3CME A;  5FJ8 H;  4LF6 Q;  4JK1 C;  2KVM A;  2LSS A;  4LF5 Q;  1DCZ A;  1UE1 A;  2YTV A;  3MR2 A;  4R4O A;  3T53 B;  3CRL C;  3DXJ C;  4DL3 A;  4DV6 Q;  2UUC Q;  3WWV A;  3KLS A;  5JJI A;  3JC6 6;  1BBU A;  5TSS A;  5BR8 Q;  1X55 A;  2ZM6 L;  1N36 L;  3FDS A;  3RZO H;  2JA6 A;  5JJL A;  3TSS A;  1OXS C;  3QB3 A;  4HTH A;  5GON F;  1I4P A;  3ITP A;  5IT9 c;  3DM1 A;  5C3E G;  4LF9 H;  2NUC A;  1TXY A;  2RDJ A;  3S1Q H;  5FJ8 G;  1OXU A;  4JPB W;  3U9O A;  2NTT A;  5M3F G;  4DAP A;  1EWH A;  4A75 A;  4GKJ L;  3IFT A;  4GKJ Q;  5LMN H;  3HRZ C;  4LF9 L;  1V4Y A;  1YIT A;  3LGJ A;  4QB4 A;  2HDL A;  4DK3 C;  5DG7 A;  1BDO A;  3P1H A;  4QW9 A;  5LMN L;  3DUZ A;  3HOY G;  1EHI A;  1UE5 A;  5AFW A;  3K5H A;  2UUB H;  4A3L H;  5BR8 H;  4L5S A;  4GN5 A;  1GYF A;  1XXG A;  3QJY A;  4MIU A;  3J80 E;  4KHP L;  1LTA D;  2KEC A;  4ZAI A;  4MN3 A;  5KND A;  4LF6 L;  1TWA A;  1SFO H;  2EY1 A;  2ZJT A;  1GVP A;  2JA7 G;  3T16 A;  4MV8 A;  5C0X G;  3CW2 C;  1S5B D;  1I7L A;  4HYK A;  5JJZ A;  1S40 A;  1GUW A;  3G6V A;  2K14 A;  3NEM A;  4ZI7 F;  4NXM L;  1MHW C;  5FO7 B;  5KFD A;  3CC7 A;  3K5L A;  4A93 G;  1XTC D;  1K28 A;  4JI6 Q;  4RUA A;  4J9O A;  1IBK L;  2Q8R E;  2OCE A;  1O7Z A;  5KRU A;  1KL9 A;  3FHW A;  4DV0 Q;  5CV5 A;  3VPD A;  1E1O A;  5KIX A;  3S2H H;  3ERO A;  3NUC A;  4OIK A;  2NZH A;  1AZQ A;  3MR3 A;  5KT7 A;  2K75 A;  3MXN A;  3NK9 A;  1I4X A;  1A2T A;  2C35 B;  3I8Z A;  5M3F H;  3PF5 A;  1WOC A;  3BA8 A;  2UXD H;  2E2J H;  4DR3 H;  3S1N B;  1ENC A;  4IAJ A;  2PZW A;  1NR4 A;  1TWH H;  4MTD A;  4LF4 H;  4YAK B;  2QDL A;  4ZUI A;  5G3L F;  5F9N A;  3H0G H;  1KD1 C;  2WIN B;  4EQO A;  4GOP B;  3K8A A;  3K7U C;  4X65 L;  1D1I A;  3RR5 A;  2UUA L;  2F0V A;  5GAE C;  4A3B B;  2UVV A;  5M5X B;  1HA6 A;  1BJT A;  3N42 B;  1ML0 D;  4JI4 Q;  3GV8 B;  2OT2 A;  1E2V A;  4DR3 Q;  3KF8 B;  1HUN A;  3RB0 A;  3S1Q B;  3NTK A;  5I9P A;  4DNI A;  2XIW A;  5JEA J;  2R93 B;  1QJO A;  4APM A;  2FE3 A;  2MNA A;  1B33 N;  4LW1 A;  2J0T D;  3QOJ A;  2VUM H;  3CF5 A;  2PVP A;  3RZO B;  4LF7 H;  3PGZ A;  4RGO S;  4OX9 L;  4MV1 A;  5E4W C;  5KG1 A;  4P73 A;  3RGX A;  4YIJ A;  1CHQ D;  1CA5 A;  2JEJ A;  1L1O B;  1K9M C;  2NYZ D;  4HMJ A;  1CKN B;  2BE5 C;  4UDU C;  4YWL A;  4UY8 C;  4KLK A;  5LYJ F;  5GRO A;  2X69 A;  3NTH A;  4LF7 L;  1PDQ A;  4JI4 H;  3TS2 A;  1EZ8 A;  3W2D A;  4HIM A;  4QCL A;  3OW7 A;  1JIC A;  1DV1 A;  3MR5 A;  2C00 A;  1TWC A;  1NAP A;  3H4D A;  1ASZ A;  4MV3 A;  2IL8 A;  2XWB B;  5T1G A;  3OOC A;  1N33 H;  1O80 A;  1KAA A;  4AQY Q;  4GOP A;  4IRK A;  1TS5 A;  2F0L A;  5IE8 A;  4JI7 H;  2RKS A;  4YY3 L;  1WTV A;  2NB0 A;  3M4I A;  1IZ6 A;  1B04 A;  1E4G T;  1STA A;  2FJ2 A;  3HOU B;  2EPB A;  2NU9 B;  2JEG A;  1Y1V G;  4PZ6 A;  1IBK Q;  2A68 C;  4PDB A;  2B2V A;  3U4Z A;  5EAY A;  4A3E B;  3GTL H;  5D3D A;  2W71 A;  2XGT A;  4LMY A;  4MV4 A;  4UCR A;  4YR0 A;  4DR6 L;  5KFT A;  3OTO Q;  2AUJ D;  3C3L A;  5F2D A;  1XMO H;  2UVU A;  5ELC A;  2IHF A;  1TU2 B;  2SNS A;  4E6I A;  1FNV A;  1PTO D;  4JBJ A;  2LS0 1;  4JV5 H;  1YBY A;  2JA7 B;  2OQK A;  3Q22 A;  3T1Y H;  1V43 A;  4RCO A;  2TMP A;  2CW8 A;  3K7A B;  1YNN C;  4FXD A;  4PG3 A;  5KFJ A;  1TVX A;  3TRZ A;  1H9J A;  5KFZ A;  1BKB A;  1BO0 A;  2RGR A;  4NXN Q;  4EGV A;  4RKL A;  3GTM H;  4FM9 A;  4PV1 C;  4ZRZ A;  2R61 A;  1M0W A;  2LKV A;  4F7X A;  1I6V C;  1DON A;  2FPI B;  4A3L G;  1SNC A;  1FYC A;  5CV6 A;  4B3R Q;  4JI1 H;  1SFO A;  1NE3 A;  3CHB D;  4AYB B;  4KHP H;  4LF6 H;  2RDG A;  4XX0 B;  1B2T A;  4XYL B;  4YWM A;  3T1Y Q;  1Q86 C;  2F0J A;  3E0J A;  1S03 G;  2FMA A;  3RJ0 A;  2ASB A;  5IIF A;  4GNX A;  1Q12 A;  3S1M B;  4CDD C;  2F4V H;  2C2E A;  2OTJ A;  2CWP A;  4A3B G;  1KC7 A;  1GLV A;  3A5U A;  4ODG A;  1AH9 A;  4IFD J;  1DIK A;  1CHP D;  4ZUJ A;  3FKI H;  3FMA A;  3R5F A;  4JI6 H;  4NW2 A;  4LSX A;  2N55 A;  1CKO A;  1V8Q A;  4OIJ A;  2WFW A;  2R93 G;  3PUV A;  3RN5 A;  1S0N A;  1GKH A;  3UFX B;  1EY8 A;  2CW0 D;  3HKZ G;  3PCO B;  2JEI A;  5CV4 A;  3PUX A;  1J9O A;  4CJ0 B;  3UDX A;  1BQQ T;  5D3I B;  5KFG A;  3F2B A;  2OEO A;  4R1J A;  2XGP A;  4TVA B;  5BR8 L;  2R7D A;  3FKI A;  5DGA A;  1I50 A;  2J9G A;  1XDN A;  2OLS A;  1HR0 W;  2SEB D;  2RDH A;  2PN1 A;  1TWH A;  3A54 A;  2JA5 A;  1M90 C;  3OSP A;  1OTC A;  1F77 A;  2M9V A;  3DLL A;  4UCU A;  3Q8Q B;  4JUZ A;  3I7F A;  1FKA H;  2R92 G;  2JN4 A;  2GA4 B;  2R87 A;  1ZYR C;  3GV3 A;  2JEB I;  1VQI A;  1KJI A;  2IT1 A;  4G7Z C;  1W3S A;  4A3I G;  2E2J B;  2B2Y A;  3N8D A;  4ED3 A;  1PH5 A;  2IW3 A;  3FDT A;  3H91 A;  3UQ8 A;  2BQU A;  4HQ6 A;  1STB A;  1TY0 A;  2VQE Q;  3A7L A;  3T56 B;  5C4X B;  2QA4 A;  1Q8K A;  5IYD G;  4X65 Q;  4A3E G;  1CSP A;  1D6E C;  1ICF B;  3BU2 A;  4A76 A;  1QCB D;  2RF4 A;  4C3H G;  4B9W A;  4C5B A;  3J7A K;  1H9R A;  3ER0 A;  3OUU A;  1F9P A;  1H9M A;  1GXD C;  4DR3 L;  2UVW A;  4I7Z C;  4PMB A;  5EGT A;  2MPM A;  3W1G A;  2F1M A;  4CBV A;  1N48 A;  4BS9 A;  1MZB A;  1MI2 A;  4J9N A;  4J9R A;  1N34 Q;  2Z4I A;  1U5K A;  2E5L Q;  1VKZ A;  2X6G A;  3WO1 A;  2HIV A;  4F87 A;  4LFA L;  4YJ3 F;  1XNQ L;  1K1S A;  4X65 H;  4P74 A;  2AU0 A;  1I4Q A;  2L55 A;  4JI5 H;  2B2V C;  3D6W A;  1JWS D;  2B39 A;  4B3T L;  4PZ7 A;  3M4O B;  3NWS A;  4KHV A;  4TKO B;  4ID6 A;  4NXM H;  4MV9 A;  2NVX A;  2JA8 G;  4FXK C;  2EVB A;  4DAM A;  1QZH A;  2HCC A;  3EFX D;  2Q2T A;  4QIW A;  1GUO A;  4O4I F;  3GTG H;  5L1I A;  2G9D A;  1IBK H;  1C48 A;  1Q46 A;  4MV6 A;  3S14 H;  4CKC A;  3PVX A;  4K5V A;  4FF4 A;  3OHX C;  3KDF B;  3BG5 A;  1ET9 A;  4QL5 A;  3STB D;  3AMU A;  2K05 A;  3R8B A;  3D0F A;  2HQE A;  3L0O A;  3PUY A;  2HHH H;  2F4I A;  5LMN W;  1GHJ A;  3LWE A;  4CDE C;  2B2W C;  3HOW G;  4M7E A;  2RSN A;  3M9M B;  4DR4 Q;  2OXP A;  3NEN A;  5GAG C;  4K14 A;  5C0X J;  1YNJ D;  1IYV A;  4YB8 B;  1S3O A;  4JC0 A;  2JSO A;  4DR1 L;  2EXZ A;  2HHH L;  1V1O A;  3PUZ A;  2AGO A;  3EN2 A;  5KFQ A;  3Q8S B;  2A73 B;  3CQZ B;  1EFW A;  2LFN A;  4P2C B;  3CCE A;  3H15 A;  1UEB A;  4X66 L;  2DWC A;  2PI2 A;  2R93 H;  4QW8 A;  1XTD A;  2FJZ A;  3GV7 B;  2PZT A;  2ES2 A;  4GKK Q;  1R4P B;  4BY7 B;  3RF2 A;  4JOI A;  3D31 A;  1CI3 M;  3OMC A;  4DV2 H;  5H80 A;  5KFB A;  2W7O A;  1RIP A;  5KFY A;  1KXL A;  1PLF A;  2HIX A;  1YZ6 A;  3J80 W;  2FPP B;  4JCV E;  2BA1 A;  4KKS A;  1VMP A;  1MJC A;  3QR8 A;  3PW5 A;  4NKL A;  4PMC A;  4H7B A;  5EBC A;  4MTN A;  2VUM B;  1QNU A;  1RK6 A;  1PFS A;  1UEA B;  3T13 A;  4A3I B;  4LFA Q;  2UUB L;  2UUB Q;  2B63 H;  1M1K C;  1HFG A;  1XNQ Q;  1RHP A;  2E2I B;  4JV1 A;  2V9W A;  3AB9 A;  4YCW A;  4GNX C;  3K5I A;  2KA7 A;  5DAU A;  1VF7 A;  1KDC A;  3TQT A;  2W8L A;  2NVY H;  3K57 A;  1Z2O X;  2FHT A;  2NZ1 D;  1E3P A;  2XNA C;  3PO3 H;  4DUZ Q;  4KKT A;  2AQ1 B;  3OUZ A;  5KFP A;  1RL2 A;  1L2F A;  2NZO A;  4A3G B;  4QMG A;  3VA5 A;  2W9B A;  1A63 A;  4ABN A;  4MHE A;  2I5H A;  1YIJ A;  2DLN A;  2ZTD A;  4MZ9 A;  3LX0 A;  1WTO A;  1I4H A;  5I6Y A;  5GAD C;  2K52 A;  2G9H D;  3VDY A;  2Z6K C;  3GV5 B;  5M3M B;  2R6F A;  2RA4 A;  2VXW A;  2PQA B;  1E4F T;  3PF4 A;  3GTM B;  1EYZ A;  1BR9 A;  2KHI A;  1Y8P B;  5I6W A;  5JEA H;  1PRT B;  1G8Z D;  2OWO A;  1VQD A;  4MAM A;  1MBY A;  5BN5 A;  3H6M A;  2BA0 A;  1N9W A;  1ZXT A;  1RKN A;  4ZQ3 A;  3JSN A;  2B2W A;  4EQN A;  2JA8 B;  5KEE A;  3ORR A;  4XT1 B;  1O7L A;  4J15 A;  3GTM A;  3BAB A;  3BJU A;  3LWB A;  2WAQ E;  1P8L A;  3PO2 G;  1C7Y A;  2PMZ E;  5E4X A;  2Q2H A;  2YZG A;  2JA5 B;  1L0X B;  1TWF A;  4DL4 A;  2XRQ D;  2C5C A;  1HR0 Q;  5KYI A;  3QZ7 A;  5C4Z A;  3H40 A;  1ONL A;  4IOA A;  3KUP A;  4U67 3;  5J39 A;  3H20 A;  1STH A;  5KNC A;  3L9A X;  3B6Y A;  3GIL A;  3DMU A;  4OWT B;  3Q2O A;  3GQC A;  3RFC A;  5KT4 A;  5CV9 A;  1KAB A;  3CXC A;  4WBN F;  4A3J G;  2CQO A;  1JOO A;  4HJ9 A;  1BBX C;  1T94 A;  1L0Y B;  2F0O A;  3MA2 B;  1E24 A;  1B3A A;  1QUQ A;  3SXH A;  4BY7 G;  1N32 L;  4DAY B;  2V59 A;  4YY3 Q;  2DNC A;  3TZD A;  2W9A A;  4K2K A;  1KNE A;  3OHB A;  2W6N A;  2N49 A;  4IJH A;  2WE6 A;  3HBL A;  3PIO A;  5ISR A;  1EQT A;  5KFW A;  1N32 H;  3M7G A;  3CQZ H;  3FKI G;  2JK8 A;  5JVL A;  1IBM L;  3HOW H;  4RZR A;  1U4M A;  1VMC A;  3SEB A;  3SE0 A;  1KIX A;  1GSA A;  1CQJ B;  3KAL A;  3R2I A;  2FPG B;  2W70 A;  1VQE A;  3P7J A;  5KFV A;  3J80 c;  5KT6 A;  4HNV A;  1UNS A;  4H13 C;  2AQ3 B;  5IWA Q;  3MFG A;  2ZDQ A;  2R92 A;  4RAZ A;  4F4W A;  2EYM A;  5LHY 1;  3A8K E;  2Y0S B;  2VUM G;  4KK7 A;  1RJR A;  4DA2 A;  3K0Y A;  1W2B A;  4OEL B;  1TS3 A;  1PH4 A;  4R8U A;  4OX9 H;  2ZJR A;  4JI5 L;  1TWG A;  3HOX H;  4TV9 F;  3V4S A;  4BBR B;  1PH7 A;  2F03 A;  1A2U A;  2EYL A;  3X3M A;  1BCP B;  1EIH A;  4JI7 L;  1M8A A;  4DR7 Q;  2E74 C;  3Q6S A;  3KF6 B;  5FLM G;  3Q8P B;  4JI3 H;  3ZYY X;  4A3G G;  5KGU A;  5EWF A;  4LFC H;  1HNX H;  3KLR A;  1D2B A;  1NUC A;  1YNJ C;  5A2Q W;  1ESR A;  2A6E C;  3HS0 C;  3IFD A;  1QVF A;  2FK3 A;  5KFX A;  4KKU A;  1DOL A;  3NTI A;  3S2H B;  3PR4 A;  4CGY B;  4L8J A;  4EG0 A;  2QEX A;  2WYO A;  1E2W A;  2L15 A;  1QVG A;  5IYD H;  3J80 i;  3M7N A;  3KJO A;  4DL6 A;  3F8T A;  1XYI A;  2MJ8 A;  3BDO A;  5DGB A;  1BF4 A;  4DV0 H;  4RCN A;  5JPM C;  2E2I H;  2RDI A;  4ECW A;  5M5W H;  1S4Z A;  1F2L A;  4UCS A;  5CR3 A;  4X66 H;  2EYH A;  5HBR B;  2DJG C;  3HP3 A;  3OIP A;  4C3I H;  2YCH A;  3KHG A;  1EIY B;  2E75 C;  1EUC B;  2K5V A;  1TWG B;  3D4W A;  4ME6 A;  5KG5 A;  3W5O A;  1NJI C;  2OH2 A;  4OO1 G;  5ELB A;  3PO2 B;  4L1K A;  4A3M H;  4K8J A;  4A4I A;  2JA5 G;  5M9O A;  1VS0 A;  1VDZ A;  3BZK A;  1PYB A;  4DV7 Q;  5C1P A;  3CQZ A;  3S17 B;  4QWC A;  3BG3 A;  4BBR H;  3ETH A;  4L6T B;  1IOV A;  3TZU A;  3CCQ A;  3I90 A;  1S10 A;  4WJ3 M;  2K7V A;  3PO3 B;  1SE3 A;  4B3M L;  3HOY H;  3TN2 A;  1VQ5 A;  1PTO C;  4O4L F;  3G6E A;  3HKZ A;  4A3J B;  4X66 Q;  4X64 Q;  1MJE A;  2PCF B;  3VPC A;  3BVG A;  2DIK A;  5E7N A;  1XNR Q;  1HZA A;  1S97 A;  1MGS A;  1EFI D;  3OSO A;  3KFU A;  2W6P A;  2D9U A;  2JEA I;  3RB4 A;  4GN4 B;  1UC9 A;  1VAJ A;  4R8N A;  2I5L X;  4G57 A;  3I4M H;  2UU9 H;  4G4K A;  5CYU A;  4ED7 A;  3QIA A;  4M9U A;  4ED2 A;  1FD7 D;  3F1Z A;  1TY2 A;  3C1F A;  1CTM A;  3TBI B;  5EKI A;  2IA6 A;  2QF7 A;  4IN3 A;  4B3S L;  3F2D A;  4LFB Q;  2K5W A;  1ENF A;  1RK5 A;  4R7R A;  2RVL A;  2UXC H;  2F52 A;  3CC2 A;  2UXB L;  4XXE A;  2PPB C;  2AWO A;  1T5E A;  4KN4 C;  4POG A;  3T51 B;  4BY7 H;  4S3S A;  2VUG A;  2W6Q A;  5ELF A;  4R8U B;  1MKH A;  4RB1 A;  3HGB A;  3TP5 A;  2I8C A;  1JJ2 A;  1H9S B;  2KHJ A;  2UXB H;  1XMQ Q;  4X3S A;  4BBR G;  1JOQ A;  3H3V H;  3TIG A;  2SCU B;  1HJP A;  1IBL H;  1G91 A;  4H44 C;  3RAX A;  4LUO A;  3M4Y A;  1HNZ L;  2QEJ C;  4OO1 H;  3V6H A;  1N56 A;  2MQH A;  2NN6 H;  4M1U B;  2N78 A;  1EU4 A;  1K83 A;  2R84 A;  2CCZ A;  1CUK A;  4C3I G;  4LF8 Q;  1D5Z C;  1LYL A;  4OXP A;  4PMW A;  5EWG A;  5J22 A;  2MP1 A;  5IP9 H;  1ILP A;  2YU9 H;  1B70 B;  3GTG B;  1SJH D;  3T4A C;  2N3S A;  4JVZ A;  2V4D A;  3C46 A;  1G6P A;  4DV6 H;  2UUC H;  5IGF A;  4IR1 A;  3U9S A;  4JBM A;  4MA0 A;  4RAU C;  2Z6K A;  2MFI A;  1BCP C;  3BVZ A;  4DNT B;  2QGQ A;  4LFB L;  2CQA A;  1K8G A;  5G3L D;  1CS0 A;  2JQO A;  2PMZ B;  3HOZ H;  1D5X C;  3RUZ A;  4HN7 A;  5FLM H;  1PVO A;  2FLN A;  4EBD A;  1WJJ A;  1X54 A;  1F9S A;  3MJF A;  3DEO A;  2XCL A;  4RUC A;  1IBM H;  3E5S A;  4J9K A;  3VR2 A;  1K83 B;  1AE2 A;  4DK0 A;  1KRS A;  2N88 A;  3WNZ A;  1ZKO A;  3KYH C;  4XZ3 B;  4CJ1 B;  1SRO A;  4GNX B;  1EL0 A;  2UU9 Q;  3HKS A;  1WR2 A;  3N6R A;  2K5N A;  2IHE A;  5HGQ A;  1L1O C;  2ALY B;  4JI2 L;  1IKM A;  5NUC A;  2Q8I B;  5HGT A;  4HAE A;  1PH6 A;  2ZDH A;  3EJI A;  2VA2 A;  1RDP D;  1X65 A;  1B53 A;  5IP7 G;  2R7N A;  4DGZ A;  4O3Q A;  2B2T A;  2AGP A;  2E8G A;  3N6X A;  4ZK9 B;  2EIF A;  4OON A;  1C9O A;  5IYC H;  1TWA B;  4CDF C;  5IP7 H;  1EWC A;  3SK6 A;  4HSP A;  5C3W A;  1HZB A;  4N9P A;  5IYB H;  1ZQ7 A;  1LTL A;  5IYZ F;  3GTG A;  1PZI D;  4LJZ C;  4PQX A;  2B29 A;  3S1M H;  1EQQ A;  1I94 L;  3HB9 A;  3KTM A;  2QKI C;  2ASJ A;  3S15 B;  4ZKB B;  4K8I A;  3MHB A;  4FF2 A;  2W6M A;  4JOI C;  1R4Q B;  1Y8O B;  2K5H A;  5DM6 3;  5DLF A;  5EOY A;  1I4G A;  2WKD A;  4DUY H;  3I70 A;  1X9N A;  2VL6 A;  2B8F A;  2VUM A;  4ECT A;  3EVQ A;  4X64 H;  3HOZ G;  1I5F A;  4OEM B;  1WTQ A;  1V9P A;  1PXU A;  4IWY A;  1DXM A;  3S24 A;  1XMO L;  3ULJ A;  3A55 A;  3RUP A;  4KHZ A;  1SYC A;  1CE8 A;  1D7Q A;  2F0I A;  1CT1 D;  1O7Y A;  1UC8 A;  3GTQ B;  5JUM A;  3CC4 A;  4MV7 A;  4BBS B;  3JAM W;  3TQY A;  2EJG C;  5KFK A;  5FLX L;  2ASD A;  1YI2 A;  4YAJ B;  3MWM A;  4Y7N B;  4ECR A;  3GQB A;  4K5X A;  5K36 H;  2XCA A;  2EE1 A;  2V5A A;  1Y1W G;  5DG9 A;  3PZP A;  3L4J A;  3T1H H;  2R7Z G;  2CZG A;  3GLK A;  4GN3 B;  2W6O A;  4R9W A;  4J9P A;  3K6O A;  3ICE A;  1HPC A;  5L9X A;  2BR0 A;  1HZC A;  3HFZ B;  2EYP A;  1B44 D;  1TQO A;  4C56 C;  3V6J A;  2YU9 A;  4DXG A;  2L0C A;  2ID0 A;  2IJ0 A;  4BY1 G;  2DY8 A;  1B1Z A;  3L3O C;  3DM3 A;  4ZQI A;  4FS1 A;  4B08 A;  4ME3 A;  2W9C B;  3KHR A;  1EY0 A;  3SK4 A;  4XT3 B;  3IRB A;  2ZXO A;  4Q8E A;  4EEY A;  4GC6 A;  5CBA E;  2YU9 B;  1JDB B;  3VPB A;  2K5D A;  4DN4 M;  4F4Z A;  3I4N G;  2IX0 A;  1Y1V A;  1CZG A;  3F2C A;  4F4Y A;  1V1Q A;  1HNW Q;  4IUP A;  2Z6B A;  1IXR A;  2D0O A;  4OWX B;  5KFI A;  2MO1 A;  1K3R A;  5CB4 F;  3WO0 A;  1VQL A;  1PTO H;  2V4R A;  5KFL A;  2B63 G;  4GLV B;  5FO9 B;  2QDB A;  1WSC A;  4BXX H;  3JAM i;  1H9S A;  4A3K B;  2UXC Q;  4A3D H;  4R4T A;  2PNR C;  3H94 A;  5JVG 3;  4UP7 A;  4NB3 A;  1SND A;  1VQO A;  1ZHS A;  2J7Z A;  1G29 1;  1UNN C;  4A3J H;  1PYW D;  2CHB D;  5E3F A;  1B3Q A;  2QCP X;  1S0O A;  2V4Q A;  4YWK A;  4XIG S;  4QWA A;  1QNK A;  4ZKC B;  3GTJ B;  5T14 A;  3PW4 A;  3MWD A;  1BVS A;  1IBL Q;  2UU9 L;  1STY A;  3RZD B;  2JXM B;  5KFA A;  2R7K A;  2VR1 A;  3HEJ A;  4F88 A;  4JYA L;  2XN9 C;  2E2H B;  1FJG Q;  1Q7Y C;  4QF4 A;  4DR7 H;  4LAA A;  1SE8 A;  1LTS D;  4DPG A;  3RIZ A;  1PMR A;  1G51 A;  2JA5 H;  1TA8 A;  4R8I A;  5EBD A;  1F2Z A;  1XNQ H;  3MWY W;  3VYS A;  4A3C H;  2MGS A;  2A69 C;  3CKI B;  4HR7 A;  2YYZ A;  4C1N K;  4MA5 A;  4GZY C;  1NSN S;  2A19 A;  1L2Z A;  1PH2 A;  3H3V C;  4HJ8 A;  1J5E L;  3H09 A;  2NTS A;  4EVO A;  5LA6 F;  2NU8 B;  2FFK B;  5DG8 A;  1EEF D;  1X32 A;  5CA1 F;  4O2A F;  2E2I A;  3R93 A;  1AN7 A;  3KAJ A;  5HUR A;  3H0G B;  5ELN A;  2C2D A;  1IW7 D;  4K0K H;  4LMQ D;  3HOV B;  2JYO A;  5D14 A;  4I7A A;  5EQ0 A;  5C1O A;  5DQI A;  1S5C D;  1JB7 A;  1FGU A;  4FVM A;  4O2B F;  2EQS A;  4DF7 A;  3J81 c;  3PO2 H;  5L37 A;  3RV3 A;  2BDO A;  2D0P A;  2W7P A;  1WCM A;  3G48 A;  2ZJQ A;  2R7Z B;  3V05 A;  4DV4 Q;  3ERS X;  4JV0 A;  3JRX A;  1RJQ A;  2HVS A;  1X3P A;  4K5W A;  5I2Y A;  3TS0 A;  3D6C A;  1HTP A;  3AU7 A;  2EDG A;  3BQ0 A;  4YBZ B;  4NLG A;  5M5W B;  1SEI A;  1WTX A;  4GC7 A;  1RCV D;  2WKC A;  4BY1 B;  4ED8 A;  2K1B A;  4KD3 A;  2EY5 A;  3QG1 A;  4KJO A;  1JXL A;  3K7A H;  3ERQ A;  3J80 L;  2LY7 A;  2VY3 A;  3MZ5 A;  3HOX G;  4DR6 H;  3E9H A;  4O3O A;  4Z9C B;  2Q8T A;  3BAA A;  4QWD A;  3RMH A;  4V19 0;  3FVQ A;  1GSH A;  5FOB B;  4RB3 C;  1X3F A;  1JQY D;  3GIM A;  2J4X A;  4ED6 A;  4OWW B;  1FR3 A;  3PQI A;  3OTO H;  5COY A;  4ED0 A;  2L1B A;  4JI6 L;  3H0G A;  1I7N A;  1YNN D;  2R7M A;  2J6U A;  4IJL A;  2XCP A;  4H0L C;  1AUV A;  2C9O A;  3S1R B;  4DR6 Q;  3DF7 A;  3OTO L;  3K59 A;  1WFQ A;  3CCS A;  4DV2 Q;  5BN4 A;  2R92 H;  2X0S A;  4QGU A;  4ZLT F;  2R93 A;  3M3Y H;  3NQT A;  4I55 F;  5BPH A;  4OO1 I;  4RNN A;  1LAC A;  1KLU D;  1DOK A;  1WCM H;  2RSO A;  3PIO 3;  2NVX H;  3ND9 A;  1PHJ A;  1ESF A;  5J1Z A;  4RHR A;  3J7A F;  1A0I A;  1M7J A;  4L5Q A;  3TME A;  4RFB A;  2ZJP A;  4FBU A;  1I94 Q;  1A6X A;  1LV9 A;  3D4R A;  3QO2 A;  4JW0 A;  2ATW A;  4KN7 C;  5D1O A;  3NPP A;  1K73 C;  3OYY A;  4QIW B;  1HQR D;  4DLK A;  1C30 A;  4RG1 A;  3NEL A;  2RHS B;  1WTH A;  2R7L A;  1HRJ A;  2K03 A;  2NVX B;  5I4D A;  3N41 B;  4ALP A;  5K2M A;  1PFN A;  3K58 A;  1CSQ A;  4X3T A;  4DUZ H;  1Z2N X;  2ATL A;  4UP8 A;  2L12 A;  2NVT H;  4TUY F;  4F4X A;  1HH2 P;  4DUY L;  3PN1 A;  5D8D A;  2LMC B;  3IAY A;  3VYT A;  1C8C A;  1W6J A;  2R8G A;  1Y1V B;  1SRU A;  3RLO A;  1S72 A;  3CD6 A;  3G7L A;  4A3M B;  3RN2 A;  3G4S A;  3E9I A;  2PZU A;  2DZD A;  4IRC A;  1N34 H;  1KLG D;  3MXU A;  2DJF C;  4N9T A;  3BJY A;  2QK4 A;  5JVD F;  4QWB A;  4HNT A;  1KBL A;  3PV0 A;  3EPG A;  4IFD G;  1HNW H;  3E5N A;  1PFM A;  1YJW A;  1DZ1 A;  4WJ4 A;  2B8G A;  2AQ2 B;  1IYU A;  4YCU A;  1FL0 A;  3STB C;  3M4P A;  1K0R A;  3OWF A;  4IUU A;  3HXL A;  3RAQ A;  5KFM A;  4APV A;  1LTR D;  1VQ9 A;  1I6H H;  3BZD B;  5ELE A;  1UAP A;  1Q90 A;  4RHS A;  3I72 A;  3QWN A;  2M05 A;  1NNX A;  1AN8 A;  1VQB A;  4QJF A;  4WJW A;  1N36 Q;  3BYY B;  3T1H L;  4A3I H;  1O75 A;  4ZOL F;  3M85 A;  1IBL L;  1R9T B;  5EJW A;  4K0K Q;  1D1K A;  3RBE A;  3FMC A;  4C2M B;  2ZTE A;  5H1S E;  4AYB A;  4ILW A;  2ZXR A;  4R4C A;  3K3P A;  1W6K A;  1SMY D;  2NU6 B;  1CK1 A;  5IT9 L;  4A3F G;  1OWT A;  4J9S A;  1U0L A;  1HNW L;  2V58 A;  1MSG A;  2JA6 H;  1RYR A;  4LF9 Q;  1EZ1 A;  3RZD H;  1HNX Q;  4HCE A;  1ZHQ A;  1I3Q H;  5KT3 A;  3DWQ A;  1WD1 A;  4RNO A;  5A2Q L;  1A3U A;  3CCL A;  4Q44 A;  4LFA H;  1KQS A;  4DR2 H;  4LUZ A;  3J81 E;  1PA6 A;  2EY2 A;  5BPF A;  1S0M A;  3DWP A;  3PW2 A;  2XD4 A;  4HID A;  2WB1 G;  4CC5 A;  2H1E A;  1HFN A;  2VW9 A;  3MWE A;  2VZA A;  4JV2 A;  1JKJ B;  2E2D C;  2CH4 A;  2R86 A;  4O3R A;  1F9Q A;  1LTT D;  5FO8 B;  4FU0 A;  1TWA H;  3PMF A;  5I47 A;  3HKZ B;  1A3V A;  4F50 A;  3ULP A;  5T1I A;  4NXM Q;  2KCM A;  5LOV F;  1SJE D;  3EBE A;  3I4L A;  4LF4 L;  4RKB A;  2QIL A;  4Q8F A;  4CKB A;  5A2Q E;  4DV3 Q;  4FYD A;  3V4Z A;  4CDC C;  5AJ3 L;  4JI0 Q;  4O2D A;  4YJ2 F;  1WTR A;  4RWS C;  4LF7 Q;  1SMY C;  1PH3 A;  3S2D B;  2WV6 D;  2I87 A;  1X3G A;  3FPU B;  3LML A;  4RNM A;  4KTA A;  2XRS D;  5GQO A;  3GTJ H;  4K0K L;  3R5H A;  1FNW A;  3GDE A;  3CMA A;  2QYZ A;  1UWV A;  2W57 A;  1XMQ H;  1EZ6 A;  5C3E B;  1FJG L;  4DV5 H;  3E0E A;  3VYR A;  3C2P A;  1JDE A;  3G6Y A;  2SOB A;  2KSW A;  1JE4 A;  1GUT A;  2R92 B;  1G2S A;  4A3D G;  5KG6 A;  4EX5 A;  4IZO A;  4CKE A;  2JA6 G;  5FD5 A;  4UCO A;  2R8I A;  1T3N A;  2DN8 A;  1II3 A;  3TP6 A;  4BXX G;  5CV7 A;  3GTO H;  3N43 B;  5L1K A;  5LL6 b;  5C5M A;  1QB5 D;  2CW7 A;  5C4X G;  2F0T A;  1KDA A;  5E1F A;  2YYA A;  5KFU A;  1HXY D;  4NPS A;  2JJQ A;  4DV5 Q;  3N44 B;  5FK9 C;  4A3M G;  3JAM c;  4J1M A;  3SI8 A;  4JI4 L;  3MXP A;  1SE2 A;  3UDF A;  2RHQ B;  5IWA L;  1SNO A;  2PW7 A;  3X3N A;  3U4V A;  1TWF H;  4ECS A;  1FVI A;  5K36 G;  4G7H C;  3TQ1 A;  3A56 A;  1GD7 A;  3BQ2 A;  1LT4 D;  1JCK B;  1LT3 D;  3TEH B;  1VQP A;  3K5O A;  1UUP A;  4DR4 L;  2ZTC A;  4X62 L;  4DR5 L;  2YS7 A;  3GIQ A;  4LF5 H;  2AUK A;  5L1L A;  2L9H A;  1Y1W H;  4C3J H;  3SHL A;  3M9B A;  2IMW P;  3Q24 A;  4YCV A;  2A69 D;  2KHS A;  1OXV A;  2MCT A;  3MXN B;  2B3G A;  2Q2U A;  2F0K A;  4A3F B;  3PIP A;  2F3I A;  3L7Z C;  5KG0 A;  4GLX A;  3T1Y L;  4GKK L;  3MFH A;  1LTB D;  3L2P A;  1YJ9 A;  3S15 H;  4ZYS A;  4LF4 Q;  3SGI A;  2FKL A;  4K6L A;  1TII D;  4QUC A;  3GTP A;  2ZM6 H;  2JEF A;  2NWG A;  4F8M A;  5AJ3 Q;  3UDG A;  1Z2P X;  4DV3 L;  5LMN Q;  2O5J C;  5HY6 A;  1HZ9 A;  1AZP A;  4Y8V B;  3CPW A;  1CM9 A;  2C2R A;  4IZ8 A;  2I5M X;  2YRW A;  2R6G A;  1BXR A;  2LXK A;  1EYC A;  2F0F A;  1SYX B;  2HUG A;  1VCI A;  3KF8 A;  5IYB G;  3GID A;  1VQF A;  5KG2 A;  4LNQ A;  1V1P A;  3I91 A;  5JVH 3;  5LL6 S;  2E5L H;  2FP4 B;  1BCP F;  4TRD A;  4BA1 I;  2R7F A;  1GSO A;  3TIN A;  3KXY T;  1TS2 A;  3K5M A;  4JBK A;  4IUQ A;  1PRT F;  5IGB A;  4J8Q A;  4ECV A;  2YW2 A;  2GN5 A;  5IGG A;  3J81 W;  2KED A;  1NTG A;  4NXN H;  4YR2 A;  3TP7 A;  1TWC B;  2KQ3 A;  1STG A;  4FP5 D;  4G3I A;  2B2U A;  3CCU A;  1NMG A;  5EPL A;  1K3B C;  4DFA A;  1GM5 A;  3I55 A;  2HD3 A;  4RH6 A;  1F2Y A;  3A8I E;  3AYH B;  1KC8 C;  4A3D B;  1GUS A;  2JA6 B;  1SYF A;  4Q45 A;  1DJR D;  3BDC A;  4DNR B;  1HTL D;  1SNP A;  1STE A;  4C3J B;  2WAQ A;  2KUM A;  2J6T A;  2I80 A;  2F4V Q;  3OPO A;  4H02 A;  3HOU G;  1PTO B;  4DAV A;  4UAI A;  2Q2I A;  3MTS A;  5JAV A;  2MHV A;  4HMI A;  4DR1 Q;  3KHH A;  5C44 B;  2FLL A;  1HA5 A;  3R5X A;  3T5H A;  2JE6 I;  5IGE A;  1ASY A;  1IW7 C;  3E3X A;  2A1A A;  3UI2 A;  5KFE A;  3P20 A;  3R2T A;  2HT1 A;  3K3V A;  1JLL B;  4FO2 A;  1FJG H;  3K5N A;  1N32 Q;  3ONA B;  3GII A;  5GAH C;  1EY5 A;  3BQ1 A;  2F0U A;  4HIK A;  1N34 L;  3GTL B;  1HR0 L;  1CKN A;  3RB3 A;  5C4H A;  3RD4 A;  4I4T F;  4XYQ A;  1Q8I A;  1OXT A;  2EJF C;  4B3T Q;  4IPC A;  4X6A H;  1SAP A;  4EFE A;  2DPI A;  2K6A A;  1F9R A;  1QVC A;  2WP8 J;  3MR6 A;  2O5I C;  1EOT A;  4GOP C;  5LL6 X;  4JI2 H;  4ZHQ F;  4ECY A;  1Y1V H;  3SDZ A;  3Q1K A;  4B9X A;  4J9M A;  2ENB A;  3KLS X; 
#chains in the Genus database with same CATH homology
 4AYB G;  1X6O A;  3KDF B;  4QL5 A;  3STB D;  3I4N G;  2IX0 A;  2PI2 E;  3K0X A;  1Z9F A;  3D0F A;  1V1Q A;  3FP9 A;  3L0O A;  3F2C A;  3PUY A;  2Z0S A;  1IXR A;  2D0O A;  1UE7 A;  4OWX B;  5LMN W;  2JA7 H;  2MO1 A;  3W1B A;  1K3R A;  5C4X H;  1A8V A;  3HOW G;  4JI3 Q;  4DR4 Q;  4AIM A;  3NEN A;  4GLA C;  4NXN L;  5GAG C;  5C0X J;  1K8A C;  1VQL A;  1S3O A;  1NMF A;  4JC0 A;  4DR1 L;  1JE5 A;  2B63 G;  4GLV B;  4JG2 A;  2HHH L;  3PUZ A;  1J5E Q;  3EN2 A;  4BXX H;  4RMF A;  3JAM i;  4IO9 A;  1D8L A;  5IYC G;  4DV5 L;  2UUA Q;  4DV1 Q;  2UXC Q;  1EFW A;  4A3D H;  4R4T A;  2UXC L;  3CCE A;  2YTY A;  3HOU H;  3H15 A;  1UEB A;  1YVC A;  4X66 L;  4UP7 A;  4NB3 A;  2UXD Q;  2PI2 A;  2R93 H;  3RNU A;  3CCR A;  1XTD A;  4EQ5 A;  1VQO A;  1VQH A;  1G29 1;  1TWC H;  4GS3 A;  2KCT A;  4A3J H;  2ES2 A;  4GKK Q;  4JOI A;  3D31 A;  5C3E H;  2RCN A;  4YWK A;  1XMO Q;  4XIG S;  4JI5 Q;  1Y14 B;  1J6Q A;  1RIP A;  2WB1 E;  4X62 Q;  1Z47 A;  4DR5 Q;  3UE0 A;  1VQ7 A;  1EWI A;  1BVS A;  3K81 C;  3CCJ A;  3S2D H;  3T1H Q;  2HIX A;  1YZ6 A;  4XTC S;  1IBL Q;  1KXL A;  2OTL A;  2UU9 L;  4JI8 Q;  4JI8 L;  4JCV E;  4JYA L;  1NY4 A;  2BA1 A;  1FJG Q;  1YHB A;  1Q7Y C;  1IYJ B;  1MJC A;  1TWG H;  1SE8 A;  4IOC A;  1VQK A;  1PH9 A;  4QY7 A;  1SN8 A;  1VQC A;  4MTN A;  4DPG A;  3S16 H;  1G51 A;  2OQ0 A;  2JA5 H;  1PFS A;  2UUB L;  4A3C H;  4LFA Q;  2UUB Q;  1K83 H;  2B63 H;  2YYZ A;  1M1K C;  1XNQ Q;  4MNO A;  4YCW A;  2EXD A;  2A19 A;  4DV6 L;  4GNX C;  1E7Z A;  1X3E A;  2UUC L;  5M5X H;  1OXX K;  4AH6 A;  1PH2 A;  4HJ8 A;  2HHH Q;  2MO0 A;  4UPA A;  1J5E L;  4QQB X;  2NVY H;  5C44 G;  1JJG A;  4DUZ L;  1EOV A;  1E3P A;  2ZM6 Q;  1IBM Q;  4BY1 H;  4DUZ Q;  3PO3 H;  1JMC A;  4DV1 L;  5IP9 G;  3KOJ A;  1VQN A;  1RL2 A;  1CKM A;  1L2F A;  4A3F H;  2NZO A;  5ELN A;  1A63 A;  4A93 H;  1PV4 A;  2KEN A;  3J81 j;  2I5H A;  1YIJ A;  2R7Z H;  1Q1B A;  1JB7 A;  1FGU A;  1QUQ B;  3S1N H;  2EQS A;  2ZTD A;  4MZ9 A;  3J81 c;  4LF5 L;  1PH8 A;  3PO2 H;  2D0P A;  2KBN A;  4FDB A;  1YJN A;  5GAD C;  2DUD A;  2K52 A;  3G48 A;  1HNX L;  3VDY A;  2Z6K C;  2VQF Q;  2ZJQ A;  2F4V L;  4DV4 Q;  3I2Z A;  3ERS X;  4C2M H;  4O0A A;  4DV4 L;  2PQA B;  1L0W A;  3PF4 A;  2AMC B;  4IPH A;  1T9H A;  2KHI A;  3TS0 A;  3KLW A;  2VQE L;  2OWO A;  1VQD A;  4C3H H;  1PYS B;  3ULL A;  2BA0 A;  1N9W A;  2VNU D;  3A74 A;  3K7A H;  2BH8 A;  1XPR A;  4J15 A;  4P75 A;  1IL2 A;  2VY3 A;  3HOX G;  1B8A A;  3EIV A;  3E9H A;  4IFD I;  4B3R L;  3BJU A;  4AQY L;  2WAQ E;  1P8L A;  3KDF A;  3RLN A;  3UE1 A;  1C7Y A;  3PO2 G;  2PMZ E;  4OX9 Q;  2Q2H A;  1YEZ A;  1X3F A;  1BBW A;  3J7A 5;  1EUJ A;  4L5T A;  4OWW B;  1HR0 Q;  3J7Z C;  1MIU A;  2NN6 G;  4JI6 L;  4DUY Q;  4IOA A;  2NVQ H;  1VQ8 A;  3PO3 G;  3B6Y A;  3I4M G;  1VQJ A;  3CPF A;  4OWT B;  4IJL A;  1HNZ Q;  4DR6 Q;  3CCV A;  3OTO L;  1WFQ A;  2FXQ A;  3CCS A;  3CXC A;  4DV2 Q;  2Y0S E;  2R92 H;  4A3J G;  4DV2 L;  2CQO A;  3A0J A;  4QGU A;  5FJ8 H;  3CME A;  4HJ9 A;  4LF6 Q;  3M3Y H;  3GD7 A;  3Q8D A;  5LMU L;  4OO1 I;  3RLF A;  3I4O A;  3U58 A;  2LSS A;  1VQG A;  1E24 A;  4LF5 Q;  1QUQ A;  1UE1 A;  1WCM H;  2YTV A;  4BY7 G;  2NVX H;  1N32 L;  4DAY B;  4R4O A;  4YY3 Q;  5C4J H;  1PHJ A;  1KHI A;  3ZJY C;  4DV6 Q;  2N49 A;  1A0I A;  3A5Z B;  4IJH A;  3WWV A;  2UUC Q;  4L5Q A;  1XMQ L;  3PIO A;  1B7Y B;  5JJI A;  2ZJP A;  3JC6 6;  3FKI G;  3CQZ H;  1O7I A;  1BBU A;  2JK8 A;  5BR8 Q;  1I94 Q;  1X55 A;  2ZM6 L;  1IBM L;  2ATW A;  4UP9 A;  3HOW H;  1N36 L;  2YTX A;  1KIX A;  3RZO H;  5JJL A;  1K73 C;  3OYY A;  1OXS C;  1VQE A;  5IT9 c;  1VQ4 A;  4RG1 A;  5C3E G;  3J80 c;  1TXY A;  3GTP H;  1SR3 A;  5IWA Q;  3S1Q H;  3NEL A;  1OXU A;  2RHS B;  5FJ8 G;  1JT8 A;  5M3F G;  1LM0 A;  3M4Q A;  4A75 A;  4GKJ L;  1Q81 C;  2VUM G;  4ALP A;  4GKJ Q;  4KI0 A;  1CSQ A;  1W2B A;  1PH4 A;  4LF9 L;  1YIT A;  3LGJ A;  4UP8 A;  2NVT H;  3K80 C;  1DGS A;  2VQF L;  4JI5 L;  4DK3 C;  1HH2 P;  4JI3 L;  2ZJR A;  3HOX H;  4DUY L;  1PH7 A;  3AFQ A;  1H95 A;  1SRU A;  5LMN L;  4HIO A;  1VQ6 A;  3RLO A;  1S72 A;  4JI7 L;  1UE5 A;  3HOY G;  4DR7 Q;  3CD6 A;  4A3L H;  1Q82 C;  4L5S A;  4GN5 A;  3KF6 B;  3RN2 A;  3G4S A;  3E9I A;  5FLM G;  4KHP L;  3GTK H;  4A3G G;  4LF6 L;  1SFO H;  3PV0 A;  1GVP A;  1UE6 A;  2JA7 G;  4IFD G;  1QVF A;  5J3B A;  5C0X G;  1YJW A;  3CW2 C;  1R9T H;  4WJ4 A;  4A3G H;  4YCU A;  3MEF A;  1S40 A;  1XPO A;  1FL0 A;  3STB C;  4DKA C;  2K14 A;  3M4P A;  3NEM A;  1K0R A;  2QEX A;  4JBW A;  4NXM L;  4APV A;  2L15 A;  5M3M G;  1QVG A;  3J80 i;  1VQ9 A;  3KJO A;  3CC7 A;  3M7N A;  4JV5 L;  3F8T A;  1I6H H;  4A93 G;  2NN6 I;  4JI6 Q;  1IBK L;  2JA8 H;  2OCE A;  2E2I H;  1KL9 A;  4QJF A;  1VQB A;  3FHW A;  4DV0 Q;  1N36 Q;  5M5W H;  3T1H L;  1E1O A;  4A3I H;  1X56 A;  3M85 A;  1IBL L;  3S2H H;  2NZH A;  4C3I H;  4K0K Q;  1EIY B;  1SMX A;  2K75 A;  2ZTE A;  5M3M H;  5H1S E;  2C35 B;  3PF5 A;  4R4C A;  2K5V A;  5M3F H;  1WOC A;  3W5O A;  4A3F G;  1NJI C;  2E2J H;  4LF8 L;  4OO1 G;  2UXB Q;  1U0L A;  2GVA A;  1HNW L;  4A3M H;  4A4I A;  2JA5 G;  2JA6 H;  4LF9 Q;  1TWH H;  3RZD H;  1HNX Q;  1VS0 A;  3HOV H;  3BZK A;  4JI1 L;  1I3Q H;  1PYB A;  4DV7 Q;  4JI1 Q;  3H0G H;  1N33 Q;  4BBR H;  1KD1 C;  3CCL A;  1KQS A;  4GOP B;  3K8A A;  3K7U C;  4LUZ A;  3CCQ A;  1PA6 A;  4JI7 Q;  4WJ3 M;  4X65 L;  3OW2 A;  3RR5 A;  2AWN A;  4B3M L;  3HOY H;  4HID A;  2UUA L;  2WB1 G;  5GAE C;  1VQ5 A;  3G6E A;  3AQQ A;  2VW9 A;  2VZA A;  2IX1 A;  1EYG A;  4JI4 Q;  1WCM G;  4X66 Q;  4DR3 Q;  4X64 Q;  3KF8 B;  1E1T A;  1N8R C;  1MJE A;  3NBH B;  2D62 A;  4DNI A;  5JEA J;  1XNR L;  2BH2 A;  5E7N A;  1XNR Q;  1TWA H;  3TRE A;  2MNA A;  2K50 A;  4LUV A;  1HZA A;  4LW1 A;  3J81 i;  2VUM H;  3CF5 A;  3KFU A;  3PGZ A;  4OX9 L;  2XTI A;  2JEA I;  4P73 A;  4GN4 B;  3ULP A;  4NXM Q;  1GO3 E;  4JV5 Q;  2I5L X;  2KCM A;  1L1O B;  2H5X A;  1K9M C;  3I4M H;  2E2H H;  3EBE A;  4LF4 L;  2A8V A;  1CKN B;  4YWL A;  4UY8 C;  4KLK A;  5GRO A;  4DV3 Q;  5AJ3 L;  4LF7 L;  4JI0 Q;  4O2D A;  3F1Z A;  4HJ7 A;  4LF7 Q;  3KJP A;  3TS2 A;  1PH3 A;  4HIM A;  1X3G A;  4TQU S;  1E22 A;  5GQO A;  3GTJ H;  2HQL A;  5FLX c;  4K0K L;  3GDE A;  3CMA A;  1UWV A;  1KAW A;  2WAQ G;  3F2D A;  1ASZ A;  4B3S L;  1FJG L;  4LFB Q;  3E0E A;  2F52 A;  3CC2 A;  2UXB L;  3BZC A;  2AWO A;  1VQA A;  4POG A;  4AQY Q;  5C0X I;  4A3D G;  4GOP A;  2Y0S G;  4EX5 A;  4BY7 H;  2JA6 G;  3S1R H;  5IE8 A;  2E5L L;  5IYD H;  4BXX G;  4YY3 L;  1MKH A;  1IZ6 A;  4PZ8 A;  1I50 H;  2JA9 A;  1JJ2 A;  2KHJ A;  3GTO H;  1XMQ Q;  4BBR G;  3H3V H;  4A3K H;  5JEA G;  1EQR A;  1Y1V G;  1HJP A;  4IPD A;  4PZ6 A;  4R4I A;  3G71 A;  1IBK Q;  2AKW B;  5C4X G;  4B3M Q;  4R4Q A;  4NPS A;  2JJQ A;  3U4Z A;  5EAY A;  4AYB E;  3AFP A;  4DV5 Q;  4LUO A;  3JAM c;  2XGT A;  4A3M G;  1HNZ L;  3GTL H;  4DR7 L;  4DR6 L;  4JI4 L;  3I4N H;  3OTO Q;  2MQH A;  4Y7N H;  4BBS G;  1WYD A;  2IHF A;  3HKZ E;  3UDF A;  2UXD L;  2N78 A;  4JBJ A;  2RHQ B;  3H3V I;  4JI2 Q;  1YBY A;  5IWA L;  2OQK A;  4L5R C;  1V43 A;  3I56 A;  2CCZ A;  1CUK A;  4LF8 Q;  5DLQ E;  1TWF H;  1LYL A;  4PMW A;  4OXP A;  4PG3 A;  3U4V A;  1FVI A;  4YHH Q;  3TRZ A;  5K36 G;  5IP9 H;  3GTQ H;  2YU9 H;  1GD7 A;  1BKB A;  1B70 B;  3TEH B;  1VQP A;  4NXN Q;  4DR4 L;  1A62 A;  3GTM H;  1EIF A;  2ZTC A;  4X62 L;  2N3S A;  2PNH A;  4DR5 L;  1PH1 A;  1SLJ A;  1G6P A;  4P71 A;  5ELO A;  3M4O H;  1P16 A;  4JBM A;  4A3E H;  4A3L G;  1Y1W H;  2Z6K A;  2MFI A;  1AE3 A;  4C3J H;  3M9B A;  2QGQ A;  1YHA A;  4YCV A;  4LFB L;  1K8G A;  2CFM A;  2JQO A;  4B3R Q;  1OXV A;  1NE3 A;  3MXN B;  2B3G A;  2Q2U A;  3HOZ H;  4DR2 Q;  4YWM A;  5FLM H;  3PIP A;  4DR2 L;  2F3I A;  3L7Z C;  3U50 C;  3T1Y Q;  1Q86 C;  4GLX A;  3T1Y L;  1XPU A;  4GKK L;  1PVO A;  4DK6 C;  1WJJ A;  1X54 A;  2VS1 A;  3L2P A;  1YJ9 A;  2ASB A;  3S15 H;  4GNX A;  1NBW A;  1Q12 A;  3SGI A;  4LF4 Q;  4BBS H;  3UDI A;  5AJ3 Q;  3UDG A;  3CP0 A;  4DV3 L;  1AE2 A;  5LMN Q;  5HY6 A;  1KRS A;  5C44 H;  1HZ9 A;  4HJ5 A;  4DV0 L;  2OTJ A;  2CWP A;  3KF6 A;  3KYH C;  4A3B G;  3A5U A;  1SRO A;  3CPW A;  4GNX B;  4IFD J;  2UU9 Q;  3HKS A;  4A3K G;  2I5M X;  1AH9 A;  3FKI H;  2R6G A;  2LXK A;  2K5N A;  1XJV A;  2IHE A;  1Q1E A;  5HGQ A;  4B3S Q;  1CKO A;  1L1O C;  2ALY B;  4JI2 L;  1VCI A;  5IYB G;  5JJK A;  2WFW A;  5LMU Q;  1VQF A;  1PH6 A;  4A3C G;  3PUV A;  2R93 G;  4LNQ A;  1X65 A;  5IP7 G;  3RN5 A;  1GKH A;  2E8G A;  4YHH L;  4BA1 I;  2R7F A;  3HKZ G;  4LWC A;  2EIF A;  3PCO B;  4OON A;  1C0A A;  1C9O A;  5IYC H;  4JBK A;  4DV7 L;  1L1O A;  1YNX A;  5IP7 H;  3PUX A;  1HZB A;  3UDX A;  5IYB H;  1LTL A;  2PQA A;  2GN5 A;  3F2B A;  4R1J A;  2B29 A;  4TVA B;  5BR8 L;  4POF A;  1NTG A;  2R7D A;  2GVB A;  3S1M H;  1EQQ A;  1I94 L;  3GO5 A;  1HR0 W;  4A3B H;  5IY0 A;  4JOI C;  1M90 C;  1OTC A;  3CCU A;  2K5H A;  1NMG A;  4X64 L;  3DLL A;  1WI5 A;  5M5Y H;  1GM5 A;  3S17 H;  3I7F A;  3I55 A;  2R92 G;  3AYH B;  1KC8 C;  1X9N A;  2VL6 A;  4P72 A;  4BA2 I;  2JEB I;  1VQI A;  2IT1 A;  1W3S A;  4A3I G;  1QZG A;  3HOZ G;  1I5F A;  2F4V Q;  2YV5 A;  4H02 A;  2LXJ A;  1PH5 A;  1V9P A;  3HOU G;  3CAM A;  3S24 A;  1VQM A;  1XMO L;  1N33 L;  2Q2I A;  3ULJ A;  3PUW A;  1HNW Q;  4KHZ A;  1D7Q A;  2VQE Q;  2QA4 A;  1Q8K A;  5IYD G;  4HJA A;  4X65 Q;  4DR1 Q;  4JI0 L;  4A3E G;  1CSP A;  3BU2 A;  2JE6 I;  4A76 A;  4Y52 H;  2RF4 A;  1LUZ A;  1ASY A;  4KHP Q;  3ER0 A;  2A1A A;  3H0G G;  3CC4 A;  4DR3 L;  2HT1 A;  2V1C C;  3TQY A;  4QIW E;  3HOV G;  1KRT A;  3W1G A;  2AHO B;  1YI2 A;  1N32 Q;  2CWA A;  5GAH C;  3CCM A;  1Y1W G;  1N34 Q;  4LFC Q;  2E5L Q;  1U5K A;  4HIK A;  4LFC L;  1N34 L;  2HIV A;  4IPG A;  2K4K A;  1HR0 L;  4LFA L;  2R7Z G;  1CKN A;  1JJC B;  2I0Q A;  1XNQ L;  4GN3 B;  2DGY A;  4P74 A;  3ICE A;  1OXT A;  1HZC A;  4B3T Q;  3HFZ B;  4IPC A;  3AEV A;  2IY5 B;  4X6A H;  4B3T L;  4PZ7 A;  2ID0 A;  1QVC A;  2WP8 J;  4BY1 G;  3DM3 A;  2JA8 G;  4GOP C;  1QZH A;  4ME3 A;  4DAM A;  2CKZ B;  1YHQ A;  1Y1V H;  2Q2T A;  3PSI A;  2N8N A;  3IRB A;  3GTG H;  4JYA Q;  1Q46 A;  3S14 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...