3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
4KHPL 3CP0A 1Y14B 2MQHA 3T1HL 2E2HH 2ZJPA 4IFDI 1E22A 3ULLA 4GS3A 1X6OA 4DV4Q 1Q7YC 1N33L 4B3RL 1VQAA 1IBKQ 2JA8G 4LFCL 3PO2H 2QGQA 3S1MH 5M3MH 3BZKA 3RLFA 5IP7G 3DLLA 2YTYA 3S17H 4A3BH 1YHQA 2Q2HA 4LF6Q 4DR2L 1TWGH 3E9HA 4DV5L 2EIFA 3KLWA 4AQYQ 2CKZB 1TWAH 3AQQA 3W1BA 1PH7A 2D0PA 3L0OA 4BBSH 4JOIA 2IX1A 4JCVE 3OTOQ 4APVA 1K8GA 2A1AA 1I94L 3GTGH 2HHHL 4LFAQ 4DAYB 2LXJA 3BZCA 4JC0A 3CC2A 4DV2Q 3RN5A 1B70B 3PO2G 1JMCA 2PNHA 3FKIH 1ASZA 5M3MG 1A8VA 5AJ3L 4JYAL 4B3TQ 3GTJH 2IHEA 2JA9A 2RHQB 2C35B 1PFSA 5M5XH 1X9NA 3U4VA 4UP8A 3H15A 4X64L 4A3BG 4PMWA 4GNXB 2UXDL 1EIFA 4P72A 1PH4A 4TQUS 2KHIA 1SE8A 4GLVB 3S15H 4BBSG 4LF7L 1QZHA 4X62Q 5ELOA 1MKHA 4R4TA 2WP8J 2IT1A 5IE8A 4GKJQ 4JI3L 1FL0A 1NBWA 4JBKA 2UU9Q 3CF5A 2PMZE 2UXCL 1KL9A 2NZHA 2I0QA 4K0KL 4DR1L 2NVTH 1EIYB 4JV5Q 3FKIG 4MNOA 3UDGA 1BKBA 2MNAA 3T1HQ 2HT1A 4KHPQ 1VQOA 1P8LA 2E5LL 1N33Q 3UE1A 3TQYA 4B3RQ 4JI6L 1Q1BA 3D0FA 2NVXH 5BR8Q 1E3PA 5C0XJ 4H02A 3A5ZB 3A0JA 2BH8A 2AWOA 2KBNA 3S1NH 4DR2Q 5JEAG 1I3QH 1XPRA 4DV5Q 2JEBI 3AFQA 3HFZB 3M9BA 2B3GA 3FP9A 4JBJA 4R4IA 4GOPC 4JI4Q 1D7QA 1PV4A 1WI5A 1CKMA 5GADC 1XMOL 1YITA 1SRUA 1VS0A 2NVQH 3PUXA 3G71A 4JBWA 4DR3L 2ES2A 2JE6I 1HZAA 1I94Q 4POFA 3CW2C 1O7IA 2HHHQ 1YHAA 3A5UA 4C3JH 1J5EL 1K0RA 3OYYA 3VDYA 3S16H 2N3SA 3T1YL 1JJ2A 2UUAL 3MEFA 2K14A 3W1GA 5AJ3Q 1PH2A 4JYAQ 4DV1L 2DGYA 5HY6A 1QZGA 4IFDG 2UXBQ 4X64Q 3TS2A 1VQ4A 4JI5Q 3E9IA 3PUWA 3KJPA 4XTCS 2VZAA 4C2MH 3KFUA 1JT8A 3ER0A 5EAYA 4NXML 4JI8L 1UE6A 1G291 2H5XA 5E7NA 4DR4L 4LF7Q 4R1JA 1SN8A 2K75A 3PUZA 3JAMi 3RZDH 4JI3Q 3M4OH 2LXKA 3W5OA 1IZ6A 1K73C 1W3SA 1VQ5A 1GD7A 4K0KQ 1UE7A 2WB1E 1X65A 2IX0A 3K80C 1V43A 4YHHL 1MJEA 4GKKL 2OTJA 1VQHA 1CUKA 5IWAQ 4LUVA 1MIUA 4DV0L 1KRTA 2E5LQ 2E8GA 1M90C 2FXQA 3UDXA 1YHBA 2CQOA 4BA1I 4JI6Q 3S1QH 4NXNL 1KQSA 4X66L 5JJLA 1HR0W 4IJLA 1KD1C 3MXNB 4GNXA 4DV3L 1QVFA 1VQ9A 3PO3H 1MJCA 4JOIC 1E7ZA 1X3FA 2GVAA 1PHJA 2CCZA 2ZJQA 3EN2A 4UY8C 2VY3A 3DM3A 4O2DA 2JQOA 5HGQA 3NBHB 1AH9A 1OXXK 1CKOA 2CFMA 1YJNA 2R93H 2WB1G 4IOCA 3S24A 5C3EH 4DR3Q 3ZJYC 2ID0A 1Y1WH 3M7NA 4GLAC 4QL5A 2NN6I 1VQBA 1FVIA 1J5EQ 2K5NA 2OQKA 3CPFA 2OTLA 2ZM6L 4KHZA 3T1YQ 1W2BA 4J15A 2UUAQ 2YU9H 1L1OA 1UEBA 1LM0A 2K52A 2PI2E 4IPCA 4R4QA 4DV1Q 1IBML 4R4OA 1XNQL 3PO3G 3S2DH 1N32L 1C9OA 2NVYH 1VQDA 2LSSA 3ULPA 1K9MC 4YWKA 4NXMQ 1YVCA 4JI8Q 2F4VL 3GTMH 4DR4Q 1PYSB 2R93G 3CD6A 4A75A 4A3FH 5C3EG 1Y1WG 1KXLA 2KENA 3ICEA 5IYBH 4OXPA 5C4JH 3JC66 1WOCA 1XTDA 1NMGA 3RN2A 2I5MX 4YHHQ 2V1CC 4GKKQ 4HJ5A 5FLMH 3K7UC 5K36G 3BU2A 4X65L 5M5WH 3D31A 1Q82C 3KF6B 3J80i 3STBC 4DR7L 4X66Q 3ERSX 3HOUH 1B8AA 3NEMA 3CQZH 5FLXc 3F8TA 3PCOB 2MFIA 1EFWA 4DV7L 3CCUA 4IOAA 4A3FG 2R6GA 1QVCA 4QY7A 1WCMH 2K5HA 4LF9Q 4X6AH 4LFBL 5IYBG 4LF8L 3Q8DA 1I5FA 1N36Q 4JBMA 1HZ9A 4C3HH 2PQAA 5IP9H 2YV5A 2F52A 4JG2A 4OWWB 3U4ZA 5C4XH 5FLMG 4B3MQ 4A4IA 5LMUQ 3GO5A 1NE3A 2YTVA 4DR5Q 3OW2A 3PSIA 2L15A 2XGTA 2ZTDA 3CXCA 2Z0SA 3J80c 2ZM6Q 3HOUG 3GTLH 4UP9A 2ALYB 5IYCH 5C44H 3G4SA 1IBMQ 1XNQQ 3J7ZC 1K83H 1PA6A 2HIXA 2NZOA 1N32Q 1L1OB 4DK3C 1NJIC 4GN4B 4LFCQ 3K7AH 1WCMG 4UP7A 1Z9FA 3HKZE 2IHFA 5ELNA 4YCWA 4IJHA 3CCQA 4OONA 4YCVA 5IP9G 2EQSA 3TEHB 1VQFA 4KLKA 5C4XG 4IPDA 2ASBA 1IBLL 1OXUA 2N49A 3RR5A 2Q2IA 4YCUA 3PIPA 2VQEL 1V1QA 5IYCG 5C44G 4KI0A 4QJFA 4PZ7A 1FGUA 4PG3A 4X65Q 4GNXC 2UUBL 4QGUA 5LMNL 2NN6G 1A62A 1FJGL 1JJGA 2K5VA 4JI0L 3F2BA 4DUZL 2MO0A 1EWIA 1OXTA 3HKZG 4O0AA 4A76A 4LW1A 1K8AC 1IL2A 3TRZA 1EUJA 1Q1EA 4YY3L 1PH9A 1CSQA 1R9TH 2UXDQ 3L2PA 1CSPA 3GD7A 1EYGA 1HH2P 3K0XA 1HR0L 4LFBQ 3CCMA 1LTLA 3PUYA 2KCTA 4JI1L 1RIPA 2BH2A 4A3DG 1VQCA 4A3EH 4LF5L 4R4CA 1VQGA 4IFDJ 3PUVA 4HJ9A 3EIVA 2PQAB 2R92H 1AE2A 2CWAA 3HOXH 4BBRH 1L1OC 2UXCQ 4EX5A 3M4QA 3I55A 4A3LH 2AMCB 5LMNW 1HJPA 4DR1Q 5IYDH 1AE3A 3J81i 2RF4A 3KDFA 3KF6A 1CKNB 1U5KA 4MTNA 3F2CA 1PYBA 5GROA 3PV0A 1IBKL 3K81C 2BA1A 3M3YH 2JK8A 3RZOH 1VQNA 5JJIA 1S72A 2DUDA 3AFPA 2D62A 3S1RH 3U50C 1TWFH 1L0WA 4A3EG 4WJ4A 4HIKA 1H95A 3K8AA 4RG1A 2QEXA 2F3IA 3H0GH 2R92G 3HOXG 3AEVA 1V9PA 5DLQE 4BBRG 1QUQB 1PH8A 1IBLQ 1XMOQ 1OXSC 4RMFA 5C0XI 4A3LG 1YI2A 1B7YB 5IYDG 4OO1I 3ULJA 2VQEQ 3BJUA 3J81c 2JA7H 2Q2UA 1VQPA 2AHOB 3H3VI 2I5HA 2RHSB 1LYLA 5JJKA 2AWNA 4AIMA 4P74A 4OWTB 4BY1H 1I6HH 3RLOA 2RCNA 3KYHC 2Z6KA 4HIDA 1EOVA 2JA5H 1XMQL 4LUOA 1VQKA 3S14H 1X3GA 2ATWA 2AKWB 4OX9L 2R7DA 1YJWA 4MZ9A 4YY3Q 1BBWA 3H0GG 1HR0Q 1E24A 1VQMA 3HKSA 4DR6L 4B3SL 4JI7L 4JI1Q 4DK6C 4OWXB 3RLNA 4LF5Q 1X54A 1YIJA 4GKJL 4WJ3M 2D0OA 4IPHA 2JA7G 1GKHA 1VQ8A 4Y52H 4BY1G 4HJ7A 1WFQA 1Q12A 2CWPA 5M3FH 1TWHH 2JA5G 1A0IA 1LUZA 4Y7NH 1G51A 1UWVA 4UPAA 3GTPH 4DV0Q 3CMEA 4L5TA 2YTXA 3AYHB 1UE5A 1JB7A 4A93H 2Q2TA 1BVSA 3J7A5 3KDFB 4NXNQ 1IYJB 5BR8L 3CMAA 1SROA 3RNUA 4EQ5A 1NTGA 1Y1VH 3EBEA 3G6EA 2B29A 1GO3E 1DGSA 2BA0A 4P71A 4PZ6A 4DV3Q 1GM5A 2UUCL 3PF4A 1D8LA 2B63H 1Q46A 3UE0A 2VQFL 4A3CH 1VQEA 5GAGC 3NELA 3STBD 4JI4L 4POGA 1TXYA 3LGJA 1JJCB 4LWCA 1I50H 3CPWA 1BBUA 2QA4A 5IT9c 5M3FG 2VW9A 3G48A 4DUYL 1XJVA 1OTCA 4A3JH 1XPUA 3J81j 4A3KH 1G6PA 5GQOA 1N34L 3HOWH 3I7FA 1IXRA 4HIMA 3HOVH 4GOPB 3M4PA 5GAHC 4A93G 3CCLA 1TWCH 3B6YA 1CKNA 2JJQA 3F2DA 1X56A 3TS0A 1ASYA 1XMQQ 2K50A 3CAMA 1Y1VG 2K4KA 4JI2L 2I5LX 2UXBL 4L5RC 1SLJA 2WFWA 3H3VH 4DKAC 5H1SE 4JI5L 1M1KC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 2B63G 3GTOH 4A3CG 4QIWE 5M5YH 1Z47A 1PH3A 4DR6Q 4B3SQ 4JI7Q 4A3GH 2F4VQ 3GTKH 1UE1A 3FHWA 1N8RC 4DNIA 3S2HH 1QUQA 4PZ8A 4A3JG 3GTQH 1VQ7A 1Q8KA 4A3KG 1C7YA 2VNUD 1RL2A 2A8VA 3TREA 1YZ6A 4DV6L 3HOWG 3HOVG 3PGZA 4A3DH 4C3IH 1X3EA 1EQQA 5C0XG 1OXVA 1KC8C 4BA2I 1PVOA 1PH1A 4OO1G 5IWAL 4AYBE 3M85A 5JEAJ 1HNWL 4IO9A 1HNZL 4GLXA 1X55A 1XNRL 3WWVA 1VQIA 4A3MH 3HOZH 1N9WA 2OQ0A 4P73A 4HJAA 4DR7Q 3SGIA 1J6QA 1YEZA 4HJ8A 1GVPA 4GN3B 2MO1A 2KCMA 4A3GG 3KJOA 3CC7A 3E0EA 4LUZA 1HNXL 1NMFA 4DPGA 5FJ8H 4DV7Q 1HZBA 4NPSA 1KIXA 3CCEA 2JA6H 1SMXA 2VQFQ 4LF8Q 2PI2A 3GDEA 4NB3A 1EQRA 4DUYQ 4A3IH 1U0LA 3IRBA 3CCSA 2N78A 5GAEC 4L5SA 2R7ZH 3I4NH 1HZCA 1C0AA 2Z6KC 4AYBG 1SFOH 2N8NA 1N34Q 2WAQE 3HOYH 2KHJA 4YWMA 1Q86C 2JEAI 1WYDA 4A3MG 3HOZG 3U58A 2XTIA 2VUMH 3NENA 1VCIA 2E2IH 4JI2Q 4DV4L 2HQLA 2UUCQ 5FJ8G 2ZTCA 4LF4Q 1VQJA 2JA6G 1VQ6A 4BY7H 3A74A 4BXXH 3CCRA 4HIOA 1VQLA 2ZTEA 4A3IG 1K3RA 1YBYA 1JE5A 1KRSA 1T9HA 3I4OA 2E2JH 1NY4A 4TVAB 2YYZA 1KAWA 4LF6L 3I4NG 4P75A 2R7ZG 3KOJA 4AQYL 4DV6Q 3CCJA 1YNXA 3UDIA 2WAQG 2HIVA 3CCVA 3CC4A 3HOYG 4XIGS 3I56A 1KHIA 1A63A 4ME3A 3UDFA 3OTOL 2EXDA 4QQBX 4GOPA 2VUMG 1YJ9A 1S3OA 4LFAL 2OCEA 3F1ZA 1HNWQ 3I4MH 1HNZQ 4DV2L 2OWOA 2VS1A 2UUBQ 1FJGQ 4FDBA 4AH6A 2Y0SE 5LMNQ 1P16A 3PF5A 1XNRQ 4LNQA 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 2VL6A 4DAMA 4DUZQ 4ALPA 4B3TL 4BXXG 2IY5B 3I2ZA 3L7ZC 1HNXQ 1XPOA 1S40A 1PH5A 1SR3A 2JA8H 3JAMc 1PH6A 4LF9L 5IP7H 1N36L 2GN5A 3PIOA 1L2FA 4X62L 4GN5A 4IPGA 4L5QA 2A19A 5J3BA 2UU9L 4B3ML 2ZJRA 5LMUL 3I4MG 4DR5L 1QVGA 1Q81C 3KF8B 2Y0SG 4YWLA 4JV5L
chains in the Genus database with same CATH superfamily
2MQHA 5CV5A 1RTNA 2O4XA 1BNCA 2K6AA 4LH7A 4IZ8A 3PO2H 3BVZA 4O4LF 5M3MH 3BZKA 3DLLA 2J4XA 4TKOB 2YTYA 4Y7NB 4DV0H 4KK7A 3GTPB 1PLFA 3MTSA 4ZLTF 4DR2L 4LF6Q 4AQYQ 1TS5A 4ED8A 3W1BA 3PW0A 1XTCD 2D0PA 3L0OA 3Q0AA 5CV8A 1CHQD 4APVA 3PN1A 3FPUB 3N52A 2B63B 4BWSC 2HHHL 1KLGD 2WV6D 1B6SA 4DV2Q 1B70B 2XSCA 1I50B 4C1NK 4K2KA 3FKIH 1A8VA 5AJ3L 5D14A 4A3JB 4A3KB 5C4XB 1X9NA 4A3BG 3M9MB 3U4VA 3H15A 3M9OB 3KK7A 3Q8QB 2Z1CA 1NNXA 1EIFA 1PH4A 4TQUS 1SE8A 4LF4H 3S15H 1XMQH 2JYOA 4BBSG 1SCUB 2RDGA 4ABNA 4G4KA 4PQXA 5L37A 5ELOA 1MKHA 2A68C 4R4TA 2WP8J 3TZDA 4OX9H 3OSOA 5C4HA 1FL0A 2UU9Q 1U4PA 4ZUIA 1QCBD 4O1NA 2UXCL 4DR6H 2I0QA 4K0KL 4DR1L 3RMHA 1S10A 3H0GA 1SYDA 1KDAA 1N33Q 3UE1A 4JI6L 1Q1BA 2XD4A 2L11A 2NVXH 1PRTF 4DXFA 2F0TA 2CW7A 5KNDA 3A0JA 4CDCC 3CU7A 4C5BA 5JEAG 1XPRA 3NBHA 4DR7H 2JEBI 3AFQA 3HFZB 3A8IE 4R4IA 3C46A 1D7QA 1WI5A 4QB4A 5GADC 3V4ZA 3RIZA 4G3IA 1SRUA 2UUCH 4O42A 2NVQH 3PUXA 3G71A 1Z7TA 2JE6I 1B33N 3KF8A 4POFA 1YHAA 2M2LA 1K0RA 3NE5B 3GIMA 3K5LA 2MHVA 5FO9B 3A56A 1SFOB 5HY6A 4QUFA 2UXBQ 4UCRA 3M9NB 2WAQB 4F4ZA 3JAML 4FF1A 3T5KA 4JI5Q 4ED6A 4MIUA 4C2MH 3KFUA 3GTPA 4F7XA 3C2PA 2ZDHA 4RU9A 3SE0A 4CKCA 3NK9A 1O7LA 5ELEA 3QIAA 2Z4HA 4GC6A 4FM9A 3PUZA 2JEFA 2DPJA 1K73C 4C3JG 4BY7B 4MA0A 1GD7A 1JOOA 1LACA 2B63A 1CUKA 1I50A 2PCFB 3GV3A 5FK9C 1YHBA 4JW0A 3JAMW 4NXNL 4FXKC 1RD9D 2UVVA 3MXNB 3H4BA 4DAVA 5CV7A 4V190 3I4MB 1SE4A 3PO3H 2UUBH 3QB3A 1SNMA 1X3FA 1ZKOA 2Y0SB 2CCZA 1GGOA 3BZDB 5KG0A 4J9NA 4O2DA 1TU2B 2FPPB 5HGQA 5IGDA 1NUCA 1WTXA 2FK3A 3OW7A 4DR3Q 5C3EH 1SAPA 3M7NA 4GLAC 4L6TB 1FVIA 2K5NA 2OQKA 3SK5A 2WYOA 2ZM6L 3T1YQ 4ODGA 1W2BA 1GUWA 2YU9H 1WSCA 4ED0A 4YAKB 1UEBA 1LM0A 1QOHA 1SDFA 1XNQL 5K36H 5L1LA 1F2ZA 2QDLA 1K9MC 4UHVA 4M8AA 2NUCA 1F77A 3I90A 2R8HA 1JICA 1PYSB 4WFN3 4A75A 3CD6A 2R93G 1Y1WG 3ORRA 4A93B 3ICEA 3PO2B 3VR4A 5IYBH 5C4JH 5M3MB 2OF1A 4ETSA 2I5MX 1V1PA 2V1CC 1EY7A 2ICIA 1O75A 1CM9A 2R8KA 3D6WA 3DHQA 5C1PA 2B2UC 1CK1A 2VPQA 4XX0B 3J80i 5DLFA 3OTOH 4V0BA 4X66Q 1S97A 1SFOA 5EQ0A 2WAQA 4CKEA 1LO5D 2MFIA 2H1EA 3CCUA 4MV8A 5IYZF 3Q8RB 1JKJB 1WCMH 5KFEA 2ZDGA 4YIJA 4LFBL 3FKIB 1N36Q 4JBMA 2B2WC 4X3TA 4C3HH 2L4NA 4RAUC 3RB3A 3U4ZA 2JN4A 4B3MQ 3OW2A 3PSIA 1ONLA 2W7OA 5LHY1 1PFBA 3CRLC 3HOUG 2ALYB 2A68D 5CMDA 1VBGA 2QW7A 4JV2A 2EJFC 2NZOA 1L1OB 2NN6H 4J9QA 2Q8TA 4DK3C 3MXNA 5JH7F 2RGRA 1Z9FA 1EQVA 3T1HH 1LTID 1PTOH 1X3QA 4YCVA 2Y0SA 3ETHA 5IP9G 3JRXA 4ZOLF 1ICFB 4A3MB 2SEBD 5C4XG 4IPDA 2F03A 2NVXB 5J2TF 1DCZA 2FJZA 4FU0A 4KY6A 5J1ZA 2K03A 3NXWA 1HTPA 5A35A 5KFQA 2MUYA 2A5HA 4DV5H 1FGUA 4PG3A 5KEEA 4GNXC 4QGUA 1UNSA 1A62A 1JJGA 1VAJA 1BQQT 2NVQB 2K5VA 3F2BA 3IL8A 4DUZL 1EWIA 2R7ZB 1K8AC 4J0MA 1I4GA 2O2LD 4TRDA 2EYMA 2UXDQ 5F9NA 3L2PA 1EYGA 1HR0L 3MFGA 3N41B 4FP5D 4J9MA 4OGQC 2KCTA 1K8MA 2BH2A 4X64H 3BG3A 4F50A 1S0OA 4MAMA 4MN3A 4K8IA 3TINA 3HOXH 4C2MB 1QNKA 3N6RA 4OHJA 1HJPA 2W57A 4MTKA 4LF7H 2ASLA 4HTHA 2X6GA 3BYYB 2Z4IA 1MHWC 2RF4A 3KDFA 1CKNB 5ISRA 1CA6A 4F8MA 2RDJA 5GROA 3PV0A 2BA1A 2JK8A 5IIFA 2EE1A 3X3NA 1Y69U 4RZRA 5LOVF 2D62A 3S1RH 3TBIB 2E5LH 1L0WA 2KUMA 3FKIA 3T51B 3RV3A 1OO9B 4RUAA 2QEXA 2R92G 1KDBA 1TT2A 4EBCA 4P2CB 4JK1C 4A3LG 1JB3A 1YI2A 5DQHA 4YR3A 2DNCA 4IWYA 2R61A 3J81c 3WO0A 1V8QA 1VQPA 2RHSB 1DD2A 5KFAA 4K14A 3J81E 5KX5F 1EOVA 5T1GA 2EY1A 2JA5H 5C3EB 5CV9A 1XMQL 1O7ZA 1X3GA 1J5EH 2W9AA 2NU6B 4ME6A 4OX9L 1BBWA 5IGFA 1VQMA 2XGQA 3HKSA 4E6IA 4DR6L 4DK6C 1STEA 3MWEA 2NVXA 4M9UA 4IPHA 2EOTA 2JA7G 4JI8H 4Y52H 1C3OA 4HJ7A 1WFQA 1Q12A 2A74C 2HD3A 1XYIA 3LWBA 2XGPA 3CMEA 3I73A 1MZBA 5C4JB 1UE5A 1JB7A 2R7ZA 2Q2TA 4F87A 3J7A5 4DL3A 4KMUC 3PW5A 4YHHH 4GKKH 3RNUA 4EQ5A 4RGMA 3I8ZA 2UUCL 2TMPA 4ZAIA 3PW4A 1BR9A 5NUCA 4IWXA 1PX2A 3V4SA 1V51A 2NUAB 5C8YF 3WOFA 5GAGC 3NELA 1FR3A 3BABA 1TXYA 3CPWA 1OTCA 5DNFA 2SCUB 4C2MA 4ZUJA 3J81j 3JSNA 4FXGC 5GQOA 3HOWH 1BCPF 1WCMB 5LL6X 4A93G 5KG7A 3CCLA 3B6YA 3BDCA 2QEJC 1CKNA 3TS0A 1X56A 3ND9A 4CKBA 1WR2A 2UXBL 4KN7C 3H3VH 2HDLA 4JI5L 5H1SE 1M1KC 4IUVA 3LP8A 5M5YH 4RGNA 4A3GH 4B3SQ 2F4VQ 1UE1A 5M9OA 1XXGA 1SYGA 1I4QA 3I70A 3GTQH 1JXLA 1Q8KA 4OIKA 1AZPA 1C7YA 4L63B 2VNUD 3HOVG 5LL6b 1PTOB 3PGZA 3PQIA 5JVDF 1SNDA 3I3CA 1EQQA 1KC8C 4DR2H 4AYBE 1LT5D 4RCOA 4LSAA 1EYZA 2QCPX 4RKBA 3M4IA 1VQIA 3HOZH 5H80A 4P73A 4HJAA 4HJ8A 1J6QA 1GVPA 3A8KE 3NWSA 4GN3B 2MO1A 1CQJB 3KJOA 5EKLA 2WIIB 2X0SA 3FDTA 5FJ8H 4DV7Q 2YU9A 3CCEA 3MR6A 3S16B 3Q8SB 2J6UA 1FGBD 3H6MA 2JEJA 4NB3A 4A3IH 1K28A 1CTMA 3IRBA 3V6JA 3J81L 1I6UA 2B2TA 1NR4A 1TAEA 3HOYH 3EFXD 1Q86C 3VPCA 1WYDA 4HNTA 4A3MG 2YRXA 5KFCA 2OH2A 4O2AF 3U58A 1EYAA 3FMAA 4QWCA 1R4QB 5KT4A 1S0NA 3RZDB 2XWJB 1SYXB 2IJ0A 3HOXB 2FINB 3C3LA 1DV1A 5KFWA 2UXCH 3TP7A 4DR1H 2IMWP 4LF4Q 2JA6G 2WB1B 1FD7D 1SXTA 3CCRA 1VQLA 2ZTEA 2F0IA 1YBYA 2PO4A 2E2JH 3HG9A 4CC6A 1G91A 2YYZA 2R7ZG 1SEIA 3J81W 2K5QA 2HGSA 4N8FA 3UDIA 3K5MA 1I4PA 1O80A 4ME3A 3OTOL 2EXDA 3SK8A 1WCMA 1YNJD 2VUMG 1YJ9A 1S3OA 3OHAA 2OCEA 1D6EC 3F1ZA 4ECYA 2IA6A 2YS6A 2OWOA 2VS1A 5LMNQ 2KOLA 2EYLA 1ZYRC 1IL8A 5C5MA 2VL6A 4KD4A 3G6JB 4IHJF 3ERQA 2IY5B 3L7ZC 4EVOA 1HNXQ 1EUDB 3KHLA 1SR3A 4MV6A 1PH6A 1N36L 1GHJA 2J6TA 2GN5A 3TDQA 4J9LA 3QOJA 4IPGA 2B2YC 4L5QA 4B3ML 4JI1H 5COYA 4LF5H 4ECUA 4YWLA 1B6RA 3T1HL 2ZJPA 1E22A 2PQEA 1WTWA 1TY2A 2ZXPA 2JA8G 3FVQA 2QGQA 5KG1A 2PW5A 3S17H 1BCPB 2L5TA 3P20A 3VPBA 5CORA 5M5WB 2W8KA 4DV5L 4NXNH 4L8JA 2K32A 1PH7A 4HSPA 3CQZB 4XQNA 5KFRA 4WORA 2IX1A 4JCVE 2XC9A 2F0OA 2HJWA 4R8UB 1PFNA 4LFAQ 3J7AV 3IG0A 1QNUA 1BBXC 1DV2A 1JR0D 2WDTA 4B3TQ 2RHQB 3HOWB 2E74C 4IURA 4X64L 4PMWA 2UXDL 5KNBA 4YAJB 4XYMB 1XNQH 4LF7L 1QZHA 1K0SA 1Z6HA 3RV4A 5IE8A 5E4XA 1QILA 1NBWA 1B3QA 1L2ZA 3K7AB 2PMZE 1CZGA 3O13A 1K3BC 1D5MC 4QIWB 4JI7H 3I72A 4A3GB 1A15A 1GUTA 4C5AA 4JV5Q 4KHPQ 4CHTB 1BKBA 2HT1A 4MTEA 3GTQB 2YYAA 2X6LA 1P8LA 2E5LL 2KSWA 2BDNA 4B3RQ 5KRUA 2V4RA 2J9GA 3MWMA 1QE6A 1LV9A 1F9SA 2F1MA 3K59A 3E5SA 1ENAA 4NP5A 2B8FA 2BH8A 4IFDH 1NSNS 3S1NH 2JA5A 3NWTA 2SNMA 3HOZB 3M9BA 2RDFA 4JBJA 4JI4Q 1SE3A 4TV9F 4JBWA 1Z2PX 1I94Q 4KJOA 1BGWA 3A5UA 1J5EL 5TSSA 1AEXA 3VDYA 3K58A 4DUYH 3MEHA 2N3SA 4A3IB 5DAUA 3BA8A 2K14A 3W1GA 5KFSA 4JYAQ 2FMAA 5EZYF 1N34H 1QZGA 3BQ0A 3HOYB 4ECSA 1VQ4A 4I7AA 4OELB 3E9IA 2DN8A 1DJRD 1JT8A 3NQIA 3N6XA 4JI8L 1DOLA 5E7NA 1G291 2H5XA 2BR0A 4JI2H 1UEAB 1K8OA 4JI3Q 5KKNB 1SNCA 4Q0FA 2N55A 4F4YA 5C1OA 3V6KA 3K80C 1A2UA 1X65A 1I7NA 4HR7A 1V43A 4YHHL 2E2JB 1MJEA 4GKKL 5IWAQ 1NCVA 4DN4M 1SEBD 3H0GB 2I80A 3S1QH 2MJ8A 1UC9A 1GSHA 1U4MA 4IJLA 1KD1C 1A3UA 2HDMA 3SE7A 1HNZH 5KG5A 1XNRH 1MJCA 2ZT9C 1E7ZA 4JOIC 2GVAA 3R93A 3EN2A 1ZYRD 4DUZH 2DNEA 5CYUA 3NBHB 5KFGA 3BS1A 2CFMA 5L9XA 1YJNA 4KY5A 2WB1G 5D1OB 3S24A 4QIWA 3ZJYC 2ID0A 3PIO3 2B2VA 4WRDA 1L0YB 4MA5A 2NN6I 1VQBA 2XIWA 3GTQA 4TSSA 3CPFA 1RK6A 3OUUA 2UUAQ 4H13C 1FNUA 2PMZA 4BWGB 4DV1Q 5D3DA 2PI2E 4ILWA 3TN2A 4QW8A 1C9OA 2NVYH 2LSSA 3PMFA 2DJGC 2OXPA 4NXMQ 3GTMH 2F4VL 1E2WA 3GIQA 4DR4Q 1T36A 5C5LA 2FB9A 1J8IA 1BXRA 1BOSA 2HUGA 1KXLA 2CW8A 3N43B 1BO0A 4OXPA 2YCHA 4HMIA 3JC66 4HCEA 3EYYA 3QJYA 3RN2A 2I07B 1HCZA 4AQYH 3TP8A 5FLMH 3K7UC 3KAKA 3RBEA 4X65L 1HPCA 4PMCA 1KTKA 2C00A 1EIGA 3ERSX 1B8AA 3M4YA 5BN4A 5FLXc 1CQVA 5C5JA 3F8TA 4DA2A 4DV2H 3OPOA 4DV7L 4IOAA 4A3FG 4UDUC 4QY7A 4IR1A 5FLXE 3CHBD 4LF9Q 4XYLB 3I12A 2NYZD 1HZ9A 4U673 4JG2A 1STYA 5ELCA 2WKCA 5EKIA 1N56A 3VR2A 2YTVA 2JEGA 2XGTA 1CI3M 2ZTDA 2Z0SA 2WKDA 1SYBA 3GTLH 2V5AA 2UVRA 2SDFA 4RHRA 5IYCH 2UU9H 1IBMQ 2G9HD 4ZQ3A 1K83H 1PA6A 1ET6A 2C2DA 4ZKCB 2HIXA 1N32Q 3MR5A 1S0MA 4GN4B 1DXMA 4UP7A 2RQXA 4ZCKA 3K57A 4TV8F 5DGBA 2K7VA 5ELNA 4IJHA 3URYA 4OONA 3CCQA 3KBGA 3SK4A 4Z9CB 2E76C 3TEHB 3R3OA 2FMMA 3GIPA 3WNZA 4KLKA 3KHRA 2BDOA 5D1OA 2EXZA 2F0HA 1OXUA 2N49A 5IGBA 4YCUA 3SEBA 1V4YA 4LAAA 4KV6A 3S1NB 3BJYA 3VR5A 5C44G 1H9SB 1V1PB 1W6JA 3UI2A 5LMNL 2B8GA 1T3NA 1STNA 3HKZG 4QUCA 4LW1A 4A76A 4J9OA 2FLLA 2DIKA 3D3RA 1UUPA 3ND8A 1B1ZA 1CSQA 1R9TH 1PRTC 1HH2P 2N88A 1Q90A 4JI1L 1STBA 3MR2A 2PN1A 4K5VA 1VQCA 4A3EH 4LF5L 2UXBH 1JC7A 1UNNC 1GXDC 1VQGA 4IFDJ 5A2QE 3Q2OA 4TQSA 4JI5H 4HJ9A 4J9SA 5FD5A 4FF4A 2CWAA 1L1OC 4IRCA 4DK1A 4EX5A 3OMGA 5LMNW 1JLLB 1Y8PB 1EU4A 2I87A 3J81i 2M05A 4RAZA 4DFAA 1M6VA 4O4HF 3Q1KA 4QWAA 4IUPA 3M3YH 1HRJA 5LA6F 4EEYA 1GSOA 5JJIA 2W6NA 2DUDA 1JWUD 1E4EB 1TVXA 1TWFH 3HB9A 2VB3X 2QILA 4FBTA 3S1QB 4XXEA 1FNVA 4CDEC 5J39A 3AEVA 1V9PA 1PH8A 4BBRG 1QUQB 1IBLQ 3G6XA 1OXSC 5KT2A 5IYDG 3MFHA 3L3OC 1CHPD 3I4LA 3MFIA 2FMCA 4C56C 2VQEQ 1AFPA 3H3VI 1LABA 1LYLA 2AWNA 1I6HH 5F2DA 3RLOA 3SI8A 2RCNA 4HIDA 4DR3H 2YZNA 4LUOA 1HHVA 2V58A 1EU3A 2R7DA 1YJWA 1BNZA 4YY3Q 2D5DA 3T1YH 3H0GG 5JVLA 1E24A 4IUQA 4JI7L 4HNUA 3P75A 1RJPA 3VR6A 4K8JA 4RA8A 1X54A 2QYZA 4Q5VA 2NVYB 1JX4A 5I6YA 1VQ8A 1MD2D 4BY1G 5KFTA 2HCIA 2CWPA 4ZKBB 5M3FH 5F9LA 2IWHA 1H9SA 1IOWA 4XZ3B 1LUZA 5FLXW 3KXYT 2C28A 2AUJD 1G51A 2AGOA 3N42B 2CQAA 3H40A 4YQWA 3KDFB 3TZUA 4LSXA 1IYJB 2FE3A 2NU8B 2NBFA 1SROA 5KG6A 1NTGA 1Y1VH 3EBEA 4DV3Q 4P71A 2ASDA 2BA0A 3PF4A 3VYUA 1TY0A 1D8LA 5D8DA 3E5NA 5DQIA 3FPPA 4X66H 1VQEA 4JI4L 4POGA 1JJCB 4DUYL 1XJVA 1BBUA 2SOBA 4CBVA 4CDFC 5HV6A 5T14A 4YR0A 5IGEA 1S68A 4UCUA 4NW2A 1G6PA 1N34L 5DG7A 1RYRA 1ZHSA 1N36H 3UFXB 3M4PA 3S15B 5GAHC 2GPSA 2J0TD 1SJED 2F3VA 3OIPA 2Q8RE 4K6DA 5C0XH 4FF3A 3L4JA 1QJOA 1ASYA 2F0KA 2IL8A 4OO1H 1F9PA 3BDOA 3VPDA 4UAIA 4B3MH 4JI2L 2W7PA 4L5RC 2WFWA 1ZETA 2B63G 5D1PA 4UCOA 5JAVA 2ENBA 1E4EA 4KKUA 2HVQA 4A3CG 3TMEA 3RB6A 3GTLB 1H9JA 3RTXA 1F2MA 2KQ3A 3V96A 1K83B 1QUQA 4PZ8A 4A3JG 3KUPA 1VQ7A 4ECRA 4A3KG 1KJIA 1VMCA 4UCSA 1BXTA 4A3DH 4DF7A 4H0LC 4C3IH 1MI2A 2XVSA 5IWAL 2FLPA 1HNZL 3MHBA 1XNRL 1YNNC 4Q44A 1N9WA 2OQ0A 1WD0A 5A2QW 1PTOF 4JVZA 1T5XD 3CC7A 2ZJTA 4DPGA 1HZBA 3VR3A 4HEDA 2VQFQ 1CT1D 5K2MA 1E2VA 4LF8Q 1GOZA 4CDDC 4FYDA 2YRWA 3T5JA 4RB1A 1PZKD 2NVYA 3R5XA 5EPLA 1HUNA 5GAEC 4ULLA 3I4NH 1HZCA 1U4LA 2UXDH 2Z6KC 1R9TB 1EYCA 1PZJD 1PRTD 2MPMA 1KABA 4YWMA 4ZHQF 5EWGA 4A3EB 2XTIA 2RCFA 1JDEA 1RJRA 4MV1A 1VCIA 1X32A 4X3SA 2HQLA 5KG3A 3U9SA 2ZTCA 3IN5A 5GONF 1D5ZC 1VQJA 4EFBA 3TQ1A 2K5DA 1YNJC 1K3RA 3NTIA 5G3LF 4LF6L 3K3VA 5EWEA 4RH6A 2K33A 3M3YB 3KOJA 4AQYL 2R7KA 4DV6Q 4ED3A 3R5HA 3CCVA 2WAQG 2HIVA 3CC4A 3KHHA 4J9KA 1KHIA 5KFPA 2F0SA 1TWFB 2Z9HA 3PO3B 3MXPA 1EEID 2W6MA 3LNNA 3A8JE 1HNWQ 2HQEA 4DV2L 3D4WA 4FDBA 1GUOA 1FJGQ 4L1KA 1P16A 4Q43A 4YP3A 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 4BXXG 4G7OC 2R6FA 2LY7A 3T53B 1XPOA 3KTMA 2C9OA 3GTLA 1G2SA 1PH5A 5EOYA 1I6HB 4LF9L 5ELBA 4ZI7F 1K83A 2YU9B 2QF7A 2J6SA 3MFYA 4IR9A 4G7ZC 1RJQA 4XYOA 4HSVA 4IN3A 4ECVA 3NTKA 2UU9L 4ED2A 3PZPA 2ZJRA 3I4MG 3GP7A 1QVGA 4LMQD 2I46A 2Y0SG 3CP0A 1EIHA 4DAPA 4IFDI 1LT4D 2R7LA 1X6OA 3SR1A 4DV4Q 1Q7YC 1N33L 1IBKQ 5M3FB 5IP7G 4YBZB 3RLFA 1ZQ7A 2JXMB 3RFCA 4A3BH 1WTVA 4CJ0B 1TWGH 3E9HA 3QG1A 4LK1C 2EIFA 3KLWA 2LFNA 2CKZB 3GV6A 1TWAH 3AQQA 2O5JC 4IUNA 1LT3D 4BBSH 3NGDA 5L1JA 4TQRA 1Y1VB 1R9TA 4O2BF 4J6HA 2FLNA 5KFFA 3GTGH 2QK4A 2EYOA 4XQJA 4DAYB 4TUYF 3BZCA 4JC0A 2EJMA 2IX3A 3A55A 3RN5A 5AFWA 5KFDA 2FK1A 3PO2G 3NP8A 2PNHA 4C3HB 1ENFA 4B9WA 1BJTA 5M3MG 3BQ2A 1SYEA 2JA9A 1RHPA 5CGKA 4GNXB 3KAJA 2KHIA 2CH4W 1I4HA 3A7AB 2YZGA 4X62Q 3OIQA 5I9OA 4GKJQ 2VXWA 5I9PA 5KIXA 5JEAH 4JBKA 5JUMA 1HFNA 3CF5A 2F4IA 4EEQA 2JEIA 3DWAA 1TWFA 1HQRD 2NZHA 2F4VH 1O7YA 3FKIG 4MNOA 2XCPA 4UFZA 2K01A 1VQOA 1BCPC 2FPIB 3C1EA 3TQYA 4UCVA 4A3DB 2BCOA 3QR8A 4C3IB 5BR8Q 1E3PA 5C0XJ 4H02A 4HAEA 2ZDQA 4EBEA 2B39A 3T13A 3K0YA 2B2UA 4AYBB 2AWOA 4X65H 4FS2A 4DR2Q 1D1IA 5CA0F 1I3QH 1YNND 5ELDA 3GIJA 1S5DD 4GOPC 4Y8VB 1PV4A 1CKMA 4NMZA 3GQCA 3VYRA 1VS0A 3SVMA 4DV7H 4DR3L 1EWHA 3EPIA 1D1KA 1STHA 3T5LA 2Q8IB 1HZAA 4FBUA 4MV7A 2B2WA 1O7IA 2HHHQ 4C3JH 2KEDA 2DZDA 3T1YL 1B3AA 3MEFA 1X3PA 5AJ3Q 1PH2A 4MHEA 1EEFD 1Q3LA 3ZYYX 3GILA 3TS2A 2YZMA 3GV5B 3PUWA 2VZAA 4C5CA 5C4ZA 1EZ1A 4XYQA 1UE6A 1LLRD 1SN8A 1PFMA 2K75A 3WOEA 3JAMi 1I4RA 2I8CA 3M4OH 2LXKA 3W5OA 1IZ6A 4EQPA 1E2ZA 1Y1VA 1W3SA 4O3PA 2R8IA 4Q0YA 3KALA 2WTFA 4IUTA 4K0KQ 3S1RB 1UE7A 2WB1E 2IX0A 2K04A 4DAYA 1VQHA 4FS1A 4LUVA 2O5IC 2RA4A 1KRTA 3SDZA 2EYPA 4KKTA 4JI6Q 5CV4A 1EZ8A 2R8GA 1KQSA 4X66L 2W70A 4O4IF 1DOMA 1EY5A 4GNXA 4DXGA 4DV3L 1QVFA 4O3QA 4LMYA 1RK5A 3IKJA 5FO7B 5LMNH 1A9XA 1PHJA 2YS7A 2DPIA 1PMRA 4R8IA 2JA5B 3R5FA 1AH9A 1B9NA 1CKOA 2ASJA 2AGPA 2R93H 1HNXH 4NKLA 3DMUA 4IOCA 1Y1WH 3I91A 4YB8B 3MVVA 3TIGA 1EY9A 5BN5A 2QKIC 4G7HC 2KHSA 3GIIA 1H9KA 3OHXC 1PXUA 5G3LD 3DWQA 2K52A 5EGTA 4R4QA 5KFZA 1WTHA 3S2DH 2XIGA 3PO3G 2SNSA 3DM1A 2UVWA 3ULPA 4AYBA 4DGZA 1H9RA 4XQQA 3EPGA 3T56B 1YVCA 2Z6BA 4F88A 1RTOA 5C3EG 1AN8A 2KENA 4ZK9B 1B2TA 1JCKB 3NTHA 4ECXA 2DJFC 4A3BB 3F8NA 3MR3A 1TWGB 4HR7B 2V4QA 5K36G 4J9PA 1TWAB 1Q82C 2UVUA 1S5FD 4BBSB 3KF6B 3T16A 3HOUH 2OEOA 3TIIA 3NEMA 3FRPB 5KYLA 4DLKA 4LFAH 3GTGB 1DONA 3PCOB 1QB5D 2R6GA 1Z2OX 3Q6SA 5EKKA 1SNOA 2ZXRA 4X6AH 5IYBG 4LF8L 4B3TH 1I5FA 1M7JA 1ICWA 2EJGC 4O3SA 4K5WA 2PQAA 5IP9H 1U9RA 3LX0A 1ZHQA 3RGZA 5DQGA 2F52A 2NTSA 4OWWB 2IBKA 1JWMD 4FXDA 5C4XH 3RD4A 4A4IA 5LMUQ 3GO5A 1NE3A 4DR5Q 5M5YB 3AB9A 2L15A 4CC5A 1Z2NX 1V1OA 3CXCA 2ZM6Q 1SSOA 4DU9A 3G4SA 1XNQQ 5FPRA 3J7ZC 5LXTF 2PMZB 4WJWA 1NJIC 4LFCQ 2OLSA 3EQLC 3HBLA 1WCMG 3VYTA 3GQBA 4JV5H 4KHPH 3HKZE 2IHFA 4U68A 4YCWA 4HN7A 4PDBA 1ZXTA 4RNMA 4C3HG 1BCPD 4B3RH 1S03G 2EQSA 2C2EA 3L4KA 1EY8A 1EQTA 2ASBA 3G6VA 3RB4A 4WBNF 2Q2IA 3HP3A 4OIJA 5K5PA 5KFOA 5KFJA 3PIPA 4RB2C 1V1QA 1B50A 3PIP3 4N8X1 1LTTD 4QJFA 4PZ7A 5DEHA 4JI4H 1FJGL 2HVSA 2AQ1B 2NN6G 3N40P 3GIDA 5LYJF 3NHHA 2W9CB 4JI0L 1TKWB 3EROA 1JOQA 1OXTA 2C5CA 1WH2A 1I94H 3TRZA 3S9WA 1Q1EA 4C3JB 1S9FA 2F0NA 1KAAA 1CSPA 2A6EC 3GD7A 5E3FA 3K0XA 4LFBQ 3NPPA 2EYHA 3CCMA 2R7NA 3HXLA 1W93A 2XN9C 2FJ2A 4YR2A 4A3DG 1IW7C 1KJ9A 1NAPA 3BG5A 3NSWA 3R8BA 2PNRC 3PUVA 1CS0A 5HGTA 2R92H 1AE2A 2R7MA 3I55A 2EVBA 4A3LH 1K1QA 1TWGA 2YW2A 1AE3A 1TWAA 5D3IB 4JI3H 1SBBB 1R4PB 1ZEQX 3KF6A 4HCSA 1PYBA 2RGVA 1IBKL 3K81C 3GTGA 2FP4B 4HNVA 4EGQA 2GA4B 1J9OA 5IWAH 1S72A 1A6XA 3AFPA 4NLGA 1LTBD 5KFIA 1H95A 3K8AA 3G7LA 5CBEE 3RZOH 2F0GA 1TR5A 2L12A 2EY6A 3HOXG 3QZ7A 1XMOQ 1KC7A 5C0XI 3PR5B 2XRSD 4OO1I 1WTPA 3ULJA 3GV7B 2OT2A 1SMYC 3BJUA 4DL7A 2JA7H 3U9OA 1II3A 4M1UB 2AU0A 3ONAB 1ILPA 2HVRA 1E0BA 2W6PA 2R93B 3KLSX 4LJZC 3K5HA 1Y1WB 2AQ4A 5T1IA 1VQKA 1EFID 1KNEA 3S14H 2VA2A 3NBIA 1M4VA 2AKWB 2C2RA 4MZ9A 5I6WA 1KEEA 2UUAH 1HR0Q 3W2DA 3MWDA 4B3SL 4MV3A 4DV1H 3CKIB 3RLNA 1TIID 1KJJA 3PW2A 3S2DB 4GKJL 4WJ3M 4F4WA 1C48A 3G8CA 2EYFA 4NXMH 5D65A 3PVXA 4DR4H 1I3QA 3S17B 1XDNA 1DM0B 4LF6H 1TWHH 2WACA 4KY7A 2JA5G 1A0IA 1UWVA 4DV0Q 3MWYW 4L5TA 2W9CA 1F2YA 4A93H 1BVSA 1SJHD 3OWEB 4KTAA 1MGSA 5BR8L 5JQWA 1EOTA 1UAPA 1WTQA 2B29A 1GO3E 1DGSA 1AZQA 4FF2A 1Q46A 2GPWA 3HRZC 2DY7A 3HOUB 1CE8A 5KG2A 3LGJA 3CRKC 4LWCA 2QA4A 2G5DA 3NQTA 5IT9c 2VW9A 2KCNA 1XPUA 3IAYA 3D6CA 4LF9H 3QFFA 3I7FA 1IXRA 4X3KA 3HOVH 5IT9E 5I2YA 1KNAA 2B2YA 5CR3A 1JDBB 1TWCH 2JJQA 1HFGA 1XMQQ 3IFTA 2K50A 3CAMA 4QWEA 1M0TA 4GC7A 5EBDA 4RCNA 1SLJA 2QDBA 3D4DA 4K5XA 4DKAC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 3GTOH 5KFNA 4DL2A 2LMCB 3VA7A 4DR6Q 2LKVA 3MJFA 3GTKH 3K5IA 1IBMH 4OL7A 1N8RC 4IRKA 1N33H 3QO2A 1MBYA 3S2HH 1EY0A 5KT7A 2W8LA 1N32H 1EWCA 1RL2A 1FYCA 2KCCA 4G57A 3TREA 3HOWG 4I65A 3GLKA 4DL6A 2BQUA 3TSSA 1OXVA 4BA2I 1PVOA 1KBLA 5FD6A 1PH1A 4YJ2F 3V6HA 3M85A 3X3MA 1G6ZA 3GIKA 3RAXA 2R93A 1X55A 2Z8LA 3WWVA 4A3MH 1Y1WA 3T4AC 1C8CA 4DR7Q 3H09A 3SGIA 1YEZA 1HTLD 4A3GG 2KCMA 4A2BA 4Q8EA 2W6QA 3E0EA 1XX8A 1HNXL 2UUCQ 1KIXA 2JA6H 1EL0A 2L0CA 1M8AA 1TS2A 2PI2A 2WE6A 1EQRA 2V4DA 3D8GA 1U0LA 4OEMB 2N78A 1ULZA 4L5SA 2R7ZH 1C0AA 1IOVA 2FPGB 1PK8A 3OHBA 2N8NA 2MGSA 2WAQE 2A6ED 5DM63 2VUGA 3HOZG 1RDPD 5KG4A 1IW7D 2VUMH 3VMMA 1WVLA 1MSGA 2E2IH 2R92B 5FJ8G 2CZGA 1SNQA 1VQ6A 3E0JA 1B9MA 3OMCA 1GSAA 4A3IG 5I2XA 1JE5A 2R3ZA 4I55F 1NY4A 1LTAD 2EZVA 4P75A 1VF7A 2PZWA 1YNXA 3HOYG 2A69C 2VB2X 4XIGS 1A63A 4QQBX 3AMUA 2R84A 3JRWA 1TQOA 4LFAL 4O3NA 3RZOB 4BS9A 1IBLH 2UUBQ 1LT6D 1IKMA 4AH6A 2Y0SE 3PF5A 1F9RA 3ETJA 4H44C 1S4ZA 5FLXL 4DAMA 4B3TL 4ALPA 2VQEH 4I7HA 4EFEA 2JA7B 1SMYD 1SE2A 3DUZA 4JUZA 3NUCA 2JA8H 3MXGA 4RNNA 2K05A 4IQZA 1AN7A 3P1HA 3K5OA 5IT9L 4CJ2C 4QW9A 3S14B 5CA1F 5J3BA 2A19A 4O3OA 4YY3H 5EWFA 5LMUL 4DR5L 1TA8A 1Q81C 1I6VC 2F0PA 4RKLA 3GTMB 5EDWA 3R2IA 2RSOA 4JV5L 4KHPL 4JPBW 1Y14B 2IP4A 4JV0A 2E2HH 1JORA 3ULLA 4GS3A 3UQ8A 4B3RL 1OWTA 1VQAA 1MSHA 1QG7A 4LFCL 3S1MH 4QF4A 1TWHB 2L55A 3V2TA 3HGBA 1B53A 4EG0A 5IT9W 5DM73 1YHQA 2Q2HA 2GLTA 1FKAH 2NU9B 1IHZA 4J9RA 2WINB 4JOIA 4DV3H 3OTOQ 5I47A 1K8GA 4ECZA 2A1AA 1I94L 1LTGD 3FEWX 4A2AA 1BF4A 2LXJA 4S3SA 3CC2A 2G9DA 2PVPA 4DNRB 5KFUA 5LP6F 1JMCA 5JVH3 1ASZA 2F0MA 2R92A 1GUGA 2FHTA 4R9WA 2L9HA 3TP6A 3GTJH 4JYAL 5KT3A 2IHEA 5M5XH 2C35B 1PFSA 5KFLA 4UP8A 4EGVA 3K5NA 3HOVB 2KECA 5A2QL 5CV6A 1CZWA 4P72A 3K6OA 1HA6A 1RJTA 1TWCB 2R86A 2B2TC 4GLVB 1RCVD 2NWGA 1HA5A 2IT1A 5EBCA 4JI3L 1VKZA 4RAYA 3T5HA 3GTOB 1PRTB 1KL9A 1ML0D 2R85A 1SYCA 4ED1A 4XDXA 3GTKB 2RDIA 2NVTH 1EIYB 3UDGA 4HYKA 2MNAA 3T1HQ 5CC4A 3S2HB 3WDNA 1VMPA 1B04A 3D0FA 3RF2A 4KN4C 2JA7A 4CJ1B 3ITPA 4MV4A 3A5ZB 3G6YA 5L1KA 4U6PA 3KBXA 2KBNA 5DG8A 1GHKA 4DL5A 4DV5Q 5BPHA 4IALA 1XWEA 2B3GA 3FP9A 2LS01 1LTRD 4PNYA 1XMOL 2EPBA 1YITA 1I4XA 1PDQA 2ES2A 3HEJA 4IAJA 4I7ZC 3GTMA 3CW2C 4ZYSA 1A2TA 2JA6B 2VQFH 4LF8H 5E1FA 4FNFA 2F0QA 3OYYA 3S16H 4EQOA 3GV8B 4WD3A 2UUAL 1JJ2A 5L1IA 3WO1A 2W71A 5ELFA 3VYSA 4DV1L 2DGYA 4IFDG 4X64Q 1TWHA 3KJPA 4XTCS 2VPSA 4RWSC 3ER0A 5EAYA 1PTOC 4NXML 3N44B 2VUMB 1STAA 2XRQD 1HUMA 4DR4L 4LF7Q 2E2IB 4XT3B 2FFKB 4R1JA 3SHLA 3RZDH 4ECQA 2MCTA 3KHGA 5FPOA 4RB0A 1VQ5A 2DLNA 3H20A 1VBHA 3R23A 3LWEA 4IZOA 2OTJA 2PZTA 5JOBA 5CB4F 4DV6H 1MIUA 4DK0A 4DV0L 2E5LQ 2E8GA 1M90C 2PBZA 2FXQA 3UDXA 1WTOA 2CQOA 4BA1I 2A69D 2XCAA 1GLVA 3ORQA 3RAQA 1HXYD 2F0EA 2RVLA 1HR0W 5JJLA 4PMBA 4ED7A 1HNWH 4KD3A 2C22A 1VQ9A 1TWCA 1FJGH 3RUZA 4ECTA 2BQ3A 2CW0C 2ZJQA 4UY8C 1F9QA 2VY3A 3DM3A 3HZXA 4JI0H 2JQOA 3BVGA 2DWCA 5KFVA 1OXXK 3GTOA 3RB0A 4IRDA 1C30A 2KEEA 2JA8B 2NU7B 3GTKA 1S5BD 4QL5A 1J5EQ 1T5EA 5KFKA 2OTLA 4KHZA 1CQFA 2ZXOA 4J15A 4QMGA 2XWBB 1K1SA 3BAAA 1Q8IA 1L1OA 1W96A 1IBML 4JV1A 1JE4A 3HS0C 4IPCA 3L9AX 3RUPA 4R4OA 1N32L 4EBDA 1VQDA 1SNPA 3MC0B 4RB3C 2V9WA 1BDOA 4YWKA 2CH4A 2PYKA 4RFBA 4JI8Q 2E2HB 4DV4H 1QWYA 3MZ5A 4A3FH 1DIKA 1IBKH 2M9VA 1AW7A 1STGA 3S1MB 1E4GT 5KFBA 2D9UA 1WOCA 1XTDA 1NMGA 1GYFA 2JA6A 4YHHQ 4M7EA 4F4XA 4GKKQ 3DF7A 4HJ5A 1ESRA 1AUXA 3BU2A 5M5WH 3D31A 3E3XA 4DR7L 1ENCA 3STBC 2R82A 1TS3A 3CQZH 4EYIB 2F0VA 1EFWA 1AUVA 4ME5A 2VUMA 1QVCA 2RBMA 2K5HA 2E2IA 1CFMA 3Q8DA 1B4OA 5IODA 3OSPA 3GTJB 3H4DA 2F0DA 5M5XB 2YV5A 4UCTA 1O78A 5FLMG 2PZUA 1W6KA 4B3SH 2ALZA 1TS4A 1PZID 2BOSA 2KA7A 3Q24A 4I50F 2EY2A 4X62H 3J80c 4APMA 4RUCA 3OWFA 4GKJH 4UP9A 5CBAE 5C44H 2K28A 1DZ1A 1G2TA 2NB0A 3EJIA 2F3WA 3J80E 2AQ2B 2CVRA 2RDHA 3K7AH 2NVTB 2W6OA 3QOLA 1CQIB 5EJWA 5EPKA 5IGCA 5IOCA 3DWPA 4Q45A 1VQFA 3AU7A 4KJNA 1M0WA 4XT1B 5HURA 5BR8H 1IBLL 1B44D 2K5WA 3RR5A 3OOCA 4HMJA 3SXHA 2FKLA 1KJ8A 4QCLA 2VQEL 5IYCG 2F0LA 4KI0A 5FO8B 2O03A 1EHIA 4X65Q 2H4OA 2UUBL 1WTRA 4K2LA 2KVMA 2P0AA 2YL2A 2F0UA 2MO0A 4O0AA 1IL2A 3I4NB 2HHHH 1EUJA 5KGUA 3H3VC 3FMCA 4YY3L 1PH9A 2E2HA 2JP1A 4MTDA 3TP5A 1LTLA 2B2VC 3PUYA 3V05A 1RIPA 2AGQA 1RKNA 1ESFA 4R4CA 2F0WA 2AQ3B 3C1FA 5BN3A 3U9TA 3EIVA 2PQAB 1IKLA 2F0FA 4BBRH 2UXCQ 1JIHA 3M4QA 4O3RA 1PTOD 2AMCB 4DR1Q 4FVMA 5IYDH 3IFDA 1KLUD 4J8QA 3EA6A 1G8ZD 4MV9A 1U5KA 4MTNA 5KYIA 4GZYC 3F2CA 4U7CA 4K0KH 1I7LA 1VQNA 3U50C 4C1NI 3D4RA 4A3EG 4WJ4A 4JI6H 4HIKA 4R8NA 4RG1A 3GTJA 2F3IA 3H0GH 1VF5C 5DLQE 4YJ3F 2A6HC 4RMFA 1B7YB 1PYWD 1L0XB 1GJXA 2FK2A 3PW7A 4ECWA 2Q2UA 2AHOB 5HBRB 2I5HA 2VR1A 2VA3A 2CW0D 3VA5A 5JJKA 4AIMA 4P74A 4OWTB 3SK6A 4BY1H 3JSLA 3KYHC 2Z6KA 1LTSD 4FO2A 1D2BA 2ATWA 2V59A 1UC8A 3C0FB 1Y8NB 4J1MA 5J2UF 2BE5C 4QWDA 5KFMA 5KFYA 3CVZA 2PPBC 4JI1Q 1VDZA 1GUNA 4OWXB 4LF5Q 2R8JA 1YIJA 2R87A 2D0OA 1EZ6A 5J22A 1GKHA 1DOKA 1F2LA 1HQMC 1C4QA 1NR2A 3J80L 3EVQA 4DNTB 1FNWA 4A3FB 3OSNA 3JZIA 1ET9A 4Y7NH 4UPAA 3GTPH 3MXUA 2IPKD 2YTXA 1H9MA 3AYHB 2EYJA 4NXNQ 1RODA 3CMAA 4KKSA 4I4TF 3MAQA 3H91A 3G6EA 4PZ6A 1GM5A 5BMVF 3A54A 1RYSA 2TSSA 1JQYD 1CA5A 2B63H 3MA2B 3UE0A 4B08A 4R7RA 2VQFL 2L1BA 4A3CH 3STBD 3R2TA 2W9BB 4RNOA 1I50H 1A3TA 3BQ1A 5M3FG 3G48A 1S5CD 4CGYB 1WD1A 3BVMA 3J80W 4A3JH 3KLSA 4A3KH 3DXJC 4HIMA 4GOPB 5C6AA 3OUZA 3LMLA 2MP1A 4HQ6A 1A3VA 3F2DA 3Q23A 1DYQA 5JJZA 1Y1VG 2K4KA 4N9TA 5LMUH 2I5LX 2J7ZA 2NZ1D 1E4FT 5C3XA 2WB1A 4DR5H 4Q8FA 5JPNC 2ZM6H 4QIWE 4X3UA 1Z47A 4B9XA 3FDSA 1PH3A 4JI7Q 5C44B 3PR4A 3DEOA 3FHWA 4DNIA 3RJ0A 4RGOS 1S5ED 4LFCH 4KHVA 2A8VA 4RGTA 1YZ6A 4DV6L 1N48A 3HKZB 5KT5A 2P5ZX 1X3EA 2RSNA 5DGAA 5C0XG 1EYDA 4ZQIA 2DY8A 5EPJA 4OO1G 1IYUA 1I3QB 4QWBA 5JEAJ 1EY4A 4IO9A 1HNWL 4EYHB 4GLXA 1EUCB 1RF2D 3RBDA 5KFXA 3BYTB 5I4DA 1BUVT 5KNCA 5DLGA 2W6ZA 3BDLA 2K1BA 5FOBB 4LUZA 1ILQA 1NMFA 1SYFA 4NPSA 1SMXA 4RZQA 3TQTA 3N8DA 2ATLA 4JYAH 2KJXA 3GDEA 3H94A 3LWUA 4DUYQ 1EY6A 2AUKA 4C3IG 3CCSA 1JWSD 5CAEB 1KJQA 2E75C 2XNAC 4AYBG 1SFOH 1N34Q 4LFBH 1KDCA 3Q8PB 2KHJA 4PV1C 5IGGA 2JEAI 3QZ8A 1GUSA 3NENA 4N9PA 3M4OB 5LL6S 1IYVA 4JI2Q 4DV4L 4BBRB 3M7GA 4PWQA 2XCLA 4BY7H 3A74A 5BPFA 4BXXH 2E2DC 5JVG3 3BA9A 2CHBD 4HIOA 2BQRA 5DG9A 5JPMC 1KRSA 3I4OA 1T9HA 4ZRZA 2VQDA 4TVAB 3K3PA 2JSOA 1KAWA 4K6LA 3I4NG 3CQZA 2W9BA 4LH6A 4DL4A 2HCCA 3CCJA 1AP0A 4R8UA 3DEPA 3I56A 3A7LA 5KT6A 3UDFA 2VOBA 2PW7A 2NTTA 4GOPA 5FKAC 3W3AA 3Q22A 3I4MH 1HNZQ 1XNRQ 1XMOH 1U4RA 2A6HD 3F2UA 4LNQA 5E4WC 4IUUA 2X69A 4DUZQ 3J7AK 2F0JA 3QWNA 4E4TA 2A73B 4RHSA 1JOKA 4H7BA 2ICEC 2EDGA 3I2ZA 1D5XC 1S40A 5KFHA 4BY1B 3JAMc 3RGXA 3KLRA 3J7YW 5IP7H 4ID6A 4EGJA 3PIOA 2D2CC 1L2FA 2EY5A 2RKSA 4X62L 3JAME 1Y8OB 4GN5A 4EQNA 3HKZA 3P7JA 2BE5D 3J7AF 1HR0H 1T94A 5C3WA 2IW3A 2CQYA 3KF8B 3E6ZX 4NDXA 2M00A
chains in the Genus database with same CATH topology
4KHPL 3CP0A 1Y14B 2MQHA 3T1HL 2E2HH 2ZJPA 4IFDI 1E22A 3ULLA 4GS3A 1X6OA 4DV4Q 1Q7YC 1N33L 4B3RL 1VQAA 1IBKQ 2JA8G 4LFCL 3PO2H 2QGQA 3S1MH 5M3MH 3BZKA 3RLFA 5IP7G 3DLLA 2YTYA 3S17H 4A3BH 1YHQA 2Q2HA 4LF6Q 4DR2L 1TWGH 3E9HA 4DV5L 2EIFA 3KLWA 4AQYQ 2CKZB 1TWAH 3AQQA 3W1BA 1PH7A 2D0PA 3L0OA 4BBSH 4JOIA 2IX1A 4JCVE 3OTOQ 4APVA 1K8GA 2A1AA 1I94L 3GTGH 2HHHL 4LFAQ 4DAYB 2LXJA 3BZCA 4JC0A 3CC2A 4DV2Q 3RN5A 1B70B 3PO2G 1JMCA 2PNHA 3FKIH 1ASZA 5M3MG 1A8VA 5AJ3L 4JYAL 4B3TQ 3GTJH 2IHEA 2JA9A 2RHQB 2C35B 1PFSA 5M5XH 1X9NA 3U4VA 4UP8A 3H15A 4X64L 4A3BG 4PMWA 4GNXB 2UXDL 1EIFA 4P72A 1PH4A 4TQUS 2KHIA 1SE8A 4GLVB 3S15H 4BBSG 4LF7L 1QZHA 4X62Q 5ELOA 1MKHA 4R4TA 2WP8J 2IT1A 5IE8A 4GKJQ 4JI3L 1FL0A 1NBWA 4JBKA 2UU9Q 3CF5A 2PMZE 2UXCL 1KL9A 2NZHA 2I0QA 4K0KL 4DR1L 2NVTH 1EIYB 4JV5Q 3FKIG 4MNOA 3UDGA 1BKBA 2MNAA 3T1HQ 2HT1A 4KHPQ 1VQOA 1P8LA 2E5LL 1N33Q 3UE1A 3TQYA 4B3RQ 4JI6L 1Q1BA 3D0FA 2NVXH 5BR8Q 1E3PA 5C0XJ 4H02A 3A5ZB 3A0JA 2BH8A 2AWOA 2KBNA 3S1NH 4DR2Q 5JEAG 1I3QH 1XPRA 4DV5Q 2JEBI 3AFQA 3HFZB 3M9BA 2B3GA 3FP9A 4JBJA 4R4IA 4GOPC 4JI4Q 1D7QA 1PV4A 1WI5A 1CKMA 5GADC 1XMOL 1YITA 1SRUA 1VS0A 2NVQH 3PUXA 3G71A 4JBWA 4DR3L 2ES2A 2JE6I 1HZAA 1I94Q 4POFA 3CW2C 1O7IA 2HHHQ 1YHAA 3A5UA 4C3JH 1J5EL 1K0RA 3OYYA 3VDYA 3S16H 2N3SA 3T1YL 1JJ2A 2UUAL 3MEFA 2K14A 3W1GA 5AJ3Q 1PH2A 4JYAQ 4DV1L 2DGYA 5HY6A 1QZGA 4IFDG 2UXBQ 4X64Q 3TS2A 1VQ4A 4JI5Q 3E9IA 3PUWA 3KJPA 4XTCS 2VZAA 4C2MH 3KFUA 1JT8A 3ER0A 5EAYA 4NXML 4JI8L 1UE6A 1G291 2H5XA 5E7NA 4DR4L 4LF7Q 4R1JA 1SN8A 2K75A 3PUZA 3JAMi 3RZDH 4JI3Q 3M4OH 2LXKA 3W5OA 1IZ6A 1K73C 1W3SA 1VQ5A 1GD7A 4K0KQ 1UE7A 2WB1E 1X65A 2IX0A 3K80C 1V43A 4YHHL 1MJEA 4GKKL 2OTJA 1VQHA 1CUKA 5IWAQ 4LUVA 1MIUA 4DV0L 1KRTA 2E5LQ 2E8GA 1M90C 2FXQA 3UDXA 1YHBA 2CQOA 4BA1I 4JI6Q 3S1QH 4NXNL 1KQSA 4X66L 5JJLA 1HR0W 4IJLA 1KD1C 3MXNB 4GNXA 4DV3L 1QVFA 1VQ9A 3PO3H 1MJCA 4JOIC 1E7ZA 1X3FA 2GVAA 1PHJA 2CCZA 2ZJQA 3EN2A 4UY8C 2VY3A 3DM3A 4O2DA 2JQOA 5HGQA 3NBHB 1AH9A 1OXXK 1CKOA 2CFMA 1YJNA 2R93H 2WB1G 4IOCA 3S24A 5C3EH 4DR3Q 3ZJYC 2ID0A 1Y1WH 3M7NA 4GLAC 4QL5A 2NN6I 1VQBA 1FVIA 1J5EQ 2K5NA 2OQKA 3CPFA 2OTLA 2ZM6L 4KHZA 3T1YQ 1W2BA 4J15A 2UUAQ 2YU9H 1L1OA 1UEBA 1LM0A 2K52A 2PI2E 4IPCA 4R4QA 4DV1Q 1IBML 4R4OA 1XNQL 3PO3G 3S2DH 1N32L 1C9OA 2NVYH 1VQDA 2LSSA 3ULPA 1K9MC 4YWKA 4NXMQ 1YVCA 4JI8Q 2F4VL 3GTMH 4DR4Q 1PYSB 2R93G 3CD6A 4A75A 4A3FH 5C3EG 1Y1WG 1KXLA 2KENA 3ICEA 5IYBH 4OXPA 5C4JH 3JC66 1WOCA 1XTDA 1NMGA 3RN2A 2I5MX 4YHHQ 2V1CC 4GKKQ 4HJ5A 5FLMH 3K7UC 5K36G 3BU2A 4X65L 5M5WH 3D31A 1Q82C 3KF6B 3J80i 3STBC 4DR7L 4X66Q 3ERSX 3HOUH 1B8AA 3NEMA 3CQZH 5FLXc 3F8TA 3PCOB 2MFIA 1EFWA 4DV7L 3CCUA 4IOAA 4A3FG 2R6GA 1QVCA 4QY7A 1WCMH 2K5HA 4LF9Q 4X6AH 4LFBL 5IYBG 4LF8L 3Q8DA 1I5FA 1N36Q 4JBMA 1HZ9A 4C3HH 2PQAA 5IP9H 2YV5A 2F52A 4JG2A 4OWWB 3U4ZA 5C4XH 5FLMG 4B3MQ 4A4IA 5LMUQ 3GO5A 1NE3A 2YTVA 4DR5Q 3OW2A 3PSIA 2L15A 2XGTA 2ZTDA 3CXCA 2Z0SA 3J80c 2ZM6Q 3HOUG 3GTLH 4UP9A 2ALYB 5IYCH 5C44H 3G4SA 1IBMQ 1XNQQ 3J7ZC 1K83H 1PA6A 2HIXA 2NZOA 1N32Q 1L1OB 4DK3C 1NJIC 4GN4B 4LFCQ 3K7AH 1WCMG 4UP7A 1Z9FA 3HKZE 2IHFA 5ELNA 4YCWA 4IJHA 3CCQA 4OONA 4YCVA 5IP9G 2EQSA 3TEHB 1VQFA 4KLKA 5C4XG 4IPDA 2ASBA 1IBLL 1OXUA 2N49A 3RR5A 2Q2IA 4YCUA 3PIPA 2VQEL 1V1QA 5IYCG 5C44G 4KI0A 4QJFA 4PZ7A 1FGUA 4PG3A 4X65Q 4GNXC 2UUBL 4QGUA 5LMNL 2NN6G 1A62A 1FJGL 1JJGA 2K5VA 4JI0L 3F2BA 4DUZL 2MO0A 1EWIA 1OXTA 3HKZG 4O0AA 4A76A 4LW1A 1K8AC 1IL2A 3TRZA 1EUJA 1Q1EA 4YY3L 1PH9A 1CSQA 1R9TH 2UXDQ 3L2PA 1CSPA 3GD7A 1EYGA 1HH2P 3K0XA 1HR0L 4LFBQ 3CCMA 1LTLA 3PUYA 2KCTA 4JI1L 1RIPA 2BH2A 4A3DG 1VQCA 4A3EH 4LF5L 4R4CA 1VQGA 4IFDJ 3PUVA 4HJ9A 3EIVA 2PQAB 2R92H 1AE2A 2CWAA 3HOXH 4BBRH 1L1OC 2UXCQ 4EX5A 3M4QA 3I55A 4A3LH 2AMCB 5LMNW 1HJPA 4DR1Q 5IYDH 1AE3A 3J81i 2RF4A 3KDFA 3KF6A 1CKNB 1U5KA 4MTNA 3F2CA 1PYBA 5GROA 3PV0A 1IBKL 3K81C 2BA1A 3M3YH 2JK8A 3RZOH 1VQNA 5JJIA 1S72A 2DUDA 3AFPA 2D62A 3S1RH 3U50C 1TWFH 1L0WA 4A3EG 4WJ4A 4HIKA 1H95A 3K8AA 4RG1A 2QEXA 2F3IA 3H0GH 2R92G 3HOXG 3AEVA 1V9PA 5DLQE 4BBRG 1QUQB 1PH8A 1IBLQ 1XMOQ 1OXSC 4RMFA 5C0XI 4A3LG 1YI2A 1B7YB 5IYDG 4OO1I 3ULJA 2VQEQ 3BJUA 3J81c 2JA7H 2Q2UA 1VQPA 2AHOB 3H3VI 2I5HA 2RHSB 1LYLA 5JJKA 2AWNA 4AIMA 4P74A 4OWTB 4BY1H 1I6HH 3RLOA 2RCNA 3KYHC 2Z6KA 4HIDA 1EOVA 2JA5H 1XMQL 4LUOA 1VQKA 3S14H 1X3GA 2ATWA 2AKWB 4OX9L 2R7DA 1YJWA 4MZ9A 4YY3Q 1BBWA 3H0GG 1HR0Q 1E24A 1VQMA 3HKSA 4DR6L 4B3SL 4JI7L 4JI1Q 4DK6C 4OWXB 3RLNA 4LF5Q 1X54A 1YIJA 4GKJL 4WJ3M 2D0OA 4IPHA 2JA7G 1GKHA 1VQ8A 4Y52H 4BY1G 4HJ7A 1WFQA 1Q12A 2CWPA 5M3FH 1TWHH 2JA5G 1A0IA 1LUZA 4Y7NH 1G51A 1UWVA 4UPAA 3GTPH 4DV0Q 3CMEA 4L5TA 2YTXA 3AYHB 1UE5A 1JB7A 4A93H 2Q2TA 1BVSA 3J7A5 3KDFB 4NXNQ 1IYJB 5BR8L 3CMAA 1SROA 3RNUA 4EQ5A 1NTGA 1Y1VH 3EBEA 3G6EA 2B29A 1GO3E 1DGSA 2BA0A 4P71A 4PZ6A 4DV3Q 1GM5A 2UUCL 3PF4A 1D8LA 2B63H 1Q46A 3UE0A 2VQFL 4A3CH 1VQEA 5GAGC 3NELA 3STBD 4JI4L 4POGA 1TXYA 3LGJA 1JJCB 4LWCA 1I50H 3CPWA 1BBUA 2QA4A 5IT9c 5M3FG 2VW9A 3G48A 4DUYL 1XJVA 1OTCA 4A3JH 1XPUA 3J81j 4A3KH 1G6PA 5GQOA 1N34L 3HOWH 3I7FA 1IXRA 4HIMA 3HOVH 4GOPB 3M4PA 5GAHC 4A93G 3CCLA 1TWCH 3B6YA 1CKNA 2JJQA 3F2DA 1X56A 3TS0A 1ASYA 1XMQQ 2K50A 3CAMA 1Y1VG 2K4KA 4JI2L 2I5LX 2UXBL 4L5RC 1SLJA 2WFWA 3H3VH 4DKAC 5H1SE 4JI5L 1M1KC 4OX9Q 5IY0A 1E1OA 2GVBA 4LF4L 2B63G 3GTOH 4A3CG 4QIWE 5M5YH 1Z47A 1PH3A 4DR6Q 4B3SQ 4JI7Q 4A3GH 2F4VQ 3GTKH 1UE1A 3FHWA 1N8RC 4DNIA 3S2HH 1QUQA 4PZ8A 4A3JG 3GTQH 1VQ7A 1Q8KA 4A3KG 1C7YA 2VNUD 1RL2A 2A8VA 3TREA 1YZ6A 4DV6L 3HOWG 3HOVG 3PGZA 4A3DH 4C3IH 1X3EA 1EQQA 5C0XG 1OXVA 1KC8C 4BA2I 1PVOA 1PH1A 4OO1G 5IWAL 4AYBE 3M85A 5JEAJ 1HNWL 4IO9A 1HNZL 4GLXA 1X55A 1XNRL 3WWVA 1VQIA 4A3MH 3HOZH 1N9WA 2OQ0A 4P73A 4HJAA 4DR7Q 3SGIA 1J6QA 1YEZA 4HJ8A 1GVPA 4GN3B 2MO1A 2KCMA 4A3GG 3KJOA 3CC7A 3E0EA 4LUZA 1HNXL 1NMFA 4DPGA 5FJ8H 4DV7Q 1HZBA 4NPSA 1KIXA 3CCEA 2JA6H 1SMXA 2VQFQ 4LF8Q 2PI2A 3GDEA 4NB3A 1EQRA 4DUYQ 4A3IH 1U0LA 3IRBA 3CCSA 2N78A 5GAEC 4L5SA 2R7ZH 3I4NH 1HZCA 1C0AA 2Z6KC 4AYBG 1SFOH 2N8NA 1N34Q 2WAQE 3HOYH 2KHJA 4YWMA 1Q86C 2JEAI 1WYDA 4A3MG 3HOZG 3U58A 2XTIA 2VUMH 3NENA 1VCIA 2E2IH 4JI2Q 4DV4L 2HQLA 2UUCQ 5FJ8G 2ZTCA 4LF4Q 1VQJA 2JA6G 1VQ6A 4BY7H 3A74A 4BXXH 3CCRA 4HIOA 1VQLA 2ZTEA 4A3IG 1K3RA 1YBYA 1JE5A 1KRSA 1T9HA 3I4OA 2E2JH 1NY4A 4TVAB 2YYZA 1KAWA 4LF6L 3I4NG 4P75A 2R7ZG 3KOJA 4AQYL 4DV6Q 3CCJA 1YNXA 3UDIA 2WAQG 2HIVA 3CCVA 3CC4A 3HOYG 4XIGS 3I56A 1KHIA 1A63A 4ME3A 3UDFA 3OTOL 2EXDA 4QQBX 4GOPA 2VUMG 1YJ9A 1S3OA 4LFAL 2OCEA 3F1ZA 1HNWQ 3I4MH 1HNZQ 4DV2L 2OWOA 2VS1A 2UUBQ 1FJGQ 4FDBA 4AH6A 2Y0SE 5LMNQ 1P16A 3PF5A 1XNRQ 4LNQA 4BY7G 4JI0Q 2R7FA 1E1TA 1WJJA 2VL6A 4DAMA 4DUZQ 4ALPA 4B3TL 4BXXG 2IY5B 3I2ZA 3L7ZC 1HNXQ 1XPOA 1S40A 1PH5A 1SR3A 2JA8H 3JAMc 1PH6A 4LF9L 5IP7H 1N36L 2GN5A 3PIOA 1L2FA 4X62L 4GN5A 4IPGA 4L5QA 2A19A 5J3BA 2UU9L 4B3ML 2ZJRA 5LMUL 3I4MG 4DR5L 1QVGA 1Q81C 3KF8B 2Y0SG 4YWLA 4JV5L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KHP L;  3CP0 A;  1Y14 B;  2MQH A;  3T1H L;  2E2H H;  2ZJP A;  4IFD I;  1E22 A;  3ULL A;  4GS3 A;  1X6O A;  4DV4 Q;  1Q7Y C;  1N33 L;  4B3R L;  1VQA A;  1IBK Q;  2JA8 G;  4LFC L;  3PO2 H;  2QGQ A;  3S1M H;  5M3M H;  3BZK A;  3RLF A;  5IP7 G;  3DLL A;  2YTY A;  3S17 H;  4A3B H;  1YHQ A;  2Q2H A;  4LF6 Q;  4DR2 L;  1TWG H;  3E9H A;  4DV5 L;  2EIF A;  3KLW A;  4AQY Q;  2CKZ B;  1TWA H;  3AQQ A;  3W1B A;  1PH7 A;  2D0P A;  3L0O A;  4BBS H;  4JOI A;  2IX1 A;  4JCV E;  3OTO Q;  4APV A;  1K8G A;  2A1A A;  1I94 L;  3GTG H;  2HHH L;  4LFA Q;  4DAY B;  2LXJ A;  3BZC A;  4JC0 A;  3CC2 A;  4DV2 Q;  3RN5 A;  1B70 B;  3PO2 G;  1JMC A;  2PNH A;  3FKI H;  1ASZ A;  5M3M G;  1A8V A;  5AJ3 L;  4JYA L;  4B3T Q;  3GTJ H;  2IHE A;  2JA9 A;  2RHQ B;  2C35 B;  1PFS A;  5M5X H;  1X9N A;  3U4V A;  4UP8 A;  3H15 A;  4X64 L;  4A3B G;  4PMW A;  4GNX B;  2UXD L;  1EIF A;  4P72 A;  1PH4 A;  4TQU S;  2KHI A;  1SE8 A;  4GLV B;  3S15 H;  4BBS G;  4LF7 L;  1QZH A;  4X62 Q;  5ELO A;  1MKH A;  4R4T A;  2WP8 J;  2IT1 A;  5IE8 A;  4GKJ Q;  4JI3 L;  1FL0 A;  1NBW A;  4JBK A;  2UU9 Q;  3CF5 A;  2PMZ E;  2UXC L;  1KL9 A;  2NZH A;  2I0Q A;  4K0K L;  4DR1 L;  2NVT H;  1EIY B;  4JV5 Q;  3FKI G;  4MNO A;  3UDG A;  1BKB A;  2MNA A;  3T1H Q;  2HT1 A;  4KHP Q;  1VQO A;  1P8L A;  2E5L L;  1N33 Q;  3UE1 A;  3TQY A;  4B3R Q;  4JI6 L;  1Q1B A;  3D0F A;  2NVX H;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  3A5Z B;  3A0J A;  2BH8 A;  2AWO A;  2KBN A;  3S1N H;  4DR2 Q;  5JEA G;  1I3Q H;  1XPR A;  4DV5 Q;  2JEB I;  3AFQ A;  3HFZ B;  3M9B A;  2B3G A;  3FP9 A;  4JBJ A;  4R4I A;  4GOP C;  4JI4 Q;  1D7Q A;  1PV4 A;  1WI5 A;  1CKM A;  5GAD C;  1XMO L;  1YIT A;  1SRU A;  1VS0 A;  2NVQ H;  3PUX A;  3G71 A;  4JBW A;  4DR3 L;  2ES2 A;  2JE6 I;  1HZA A;  1I94 Q;  4POF A;  3CW2 C;  1O7I A;  2HHH Q;  1YHA A;  3A5U A;  4C3J H;  1J5E L;  1K0R A;  3OYY A;  3VDY A;  3S16 H;  2N3S A;  3T1Y L;  1JJ2 A;  2UUA L;  3MEF A;  2K14 A;  3W1G A;  5AJ3 Q;  1PH2 A;  4JYA Q;  4DV1 L;  2DGY A;  5HY6 A;  1QZG A;  4IFD G;  2UXB Q;  4X64 Q;  3TS2 A;  1VQ4 A;  4JI5 Q;  3E9I A;  3PUW A;  3KJP A;  4XTC S;  2VZA A;  4C2M H;  3KFU A;  1JT8 A;  3ER0 A;  5EAY A;  4NXM L;  4JI8 L;  1UE6 A;  1G29 1;  2H5X A;  5E7N A;  4DR4 L;  4LF7 Q;  4R1J A;  1SN8 A;  2K75 A;  3PUZ A;  3JAM i;  3RZD H;  4JI3 Q;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  1K73 C;  1W3S A;  1VQ5 A;  1GD7 A;  4K0K Q;  1UE7 A;  2WB1 E;  1X65 A;  2IX0 A;  3K80 C;  1V43 A;  4YHH L;  1MJE A;  4GKK L;  2OTJ A;  1VQH A;  1CUK A;  5IWA Q;  4LUV A;  1MIU A;  4DV0 L;  1KRT A;  2E5L Q;  2E8G A;  1M90 C;  2FXQ A;  3UDX A;  1YHB A;  2CQO A;  4BA1 I;  4JI6 Q;  3S1Q H;  4NXN L;  1KQS A;  4X66 L;  5JJL A;  1HR0 W;  4IJL A;  1KD1 C;  3MXN B;  4GNX A;  4DV3 L;  1QVF A;  1VQ9 A;  3PO3 H;  1MJC A;  4JOI C;  1E7Z A;  1X3F A;  2GVA A;  1PHJ A;  2CCZ A;  2ZJQ A;  3EN2 A;  4UY8 C;  2VY3 A;  3DM3 A;  4O2D A;  2JQO A;  5HGQ A;  3NBH B;  1AH9 A;  1OXX K;  1CKO A;  2CFM A;  1YJN A;  2R93 H;  2WB1 G;  4IOC A;  3S24 A;  5C3E H;  4DR3 Q;  3ZJY C;  2ID0 A;  1Y1W H;  3M7N A;  4GLA C;  4QL5 A;  2NN6 I;  1VQB A;  1FVI A;  1J5E Q;  2K5N A;  2OQK A;  3CPF A;  2OTL A;  2ZM6 L;  4KHZ A;  3T1Y Q;  1W2B A;  4J15 A;  2UUA Q;  2YU9 H;  1L1O A;  1UEB A;  1LM0 A;  2K52 A;  2PI2 E;  4IPC A;  4R4Q A;  4DV1 Q;  1IBM L;  4R4O A;  1XNQ L;  3PO3 G;  3S2D H;  1N32 L;  1C9O A;  2NVY H;  1VQD A;  2LSS A;  3ULP A;  1K9M C;  4YWK A;  4NXM Q;  1YVC A;  4JI8 Q;  2F4V L;  3GTM H;  4DR4 Q;  1PYS B;  2R93 G;  3CD6 A;  4A75 A;  4A3F H;  5C3E G;  1Y1W G;  1KXL A;  2KEN A;  3ICE A;  5IYB H;  4OXP A;  5C4J H;  3JC6 6;  1WOC A;  1XTD A;  1NMG A;  3RN2 A;  2I5M X;  4YHH Q;  2V1C C;  4GKK Q;  4HJ5 A;  5FLM H;  3K7U C;  5K36 G;  3BU2 A;  4X65 L;  5M5W H;  3D31 A;  1Q82 C;  3KF6 B;  3J80 i;  3STB C;  4DR7 L;  4X66 Q;  3ERS X;  3HOU H;  1B8A A;  3NEM A;  3CQZ H;  5FLX c;  3F8T A;  3PCO B;  2MFI A;  1EFW A;  4DV7 L;  3CCU A;  4IOA A;  4A3F G;  2R6G A;  1QVC A;  4QY7 A;  1WCM H;  2K5H A;  4LF9 Q;  4X6A H;  4LFB L;  5IYB G;  4LF8 L;  3Q8D A;  1I5F A;  1N36 Q;  4JBM A;  1HZ9 A;  4C3H H;  2PQA A;  5IP9 H;  2YV5 A;  2F52 A;  4JG2 A;  4OWW B;  3U4Z A;  5C4X H;  5FLM G;  4B3M Q;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  2YTV A;  4DR5 Q;  3OW2 A;  3PSI A;  2L15 A;  2XGT A;  2ZTD A;  3CXC A;  2Z0S A;  3J80 c;  2ZM6 Q;  3HOU G;  3GTL H;  4UP9 A;  2ALY B;  5IYC H;  5C44 H;  3G4S A;  1IBM Q;  1XNQ Q;  3J7Z C;  1K83 H;  1PA6 A;  2HIX A;  2NZO A;  1N32 Q;  1L1O B;  4DK3 C;  1NJI C;  4GN4 B;  4LFC Q;  3K7A H;  1WCM G;  4UP7 A;  1Z9F A;  3HKZ E;  2IHF A;  5ELN A;  4YCW A;  4IJH A;  3CCQ A;  4OON A;  4YCV A;  5IP9 G;  2EQS A;  3TEH B;  1VQF A;  4KLK A;  5C4X G;  4IPD A;  2ASB A;  1IBL L;  1OXU A;  2N49 A;  3RR5 A;  2Q2I A;  4YCU A;  3PIP A;  2VQE L;  1V1Q A;  5IYC G;  5C44 G;  4KI0 A;  4QJF A;  4PZ7 A;  1FGU A;  4PG3 A;  4X65 Q;  4GNX C;  2UUB L;  4QGU A;  5LMN L;  2NN6 G;  1A62 A;  1FJG L;  1JJG A;  2K5V A;  4JI0 L;  3F2B A;  4DUZ L;  2MO0 A;  1EWI A;  1OXT A;  3HKZ G;  4O0A A;  4A76 A;  4LW1 A;  1K8A C;  1IL2 A;  3TRZ A;  1EUJ A;  1Q1E A;  4YY3 L;  1PH9 A;  1CSQ A;  1R9T H;  2UXD Q;  3L2P A;  1CSP A;  3GD7 A;  1EYG A;  1HH2 P;  3K0X A;  1HR0 L;  4LFB Q;  3CCM A;  1LTL A;  3PUY A;  2KCT A;  4JI1 L;  1RIP A;  2BH2 A;  4A3D G;  1VQC A;  4A3E H;  4LF5 L;  4R4C A;  1VQG A;  4IFD J;  3PUV A;  4HJ9 A;  3EIV A;  2PQA B;  2R92 H;  1AE2 A;  2CWA A;  3HOX H;  4BBR H;  1L1O C;  2UXC Q;  4EX5 A;  3M4Q A;  3I55 A;  4A3L H;  2AMC B;  5LMN W;  1HJP A;  4DR1 Q;  5IYD H;  1AE3 A;  3J81 i;  2RF4 A;  3KDF A;  3KF6 A;  1CKN B;  1U5K A;  4MTN A;  3F2C A;  1PYB A;  5GRO A;  3PV0 A;  1IBK L;  3K81 C;  2BA1 A;  3M3Y H;  2JK8 A;  3RZO H;  1VQN A;  5JJI A;  1S72 A;  2DUD A;  3AFP A;  2D62 A;  3S1R H;  3U50 C;  1TWF H;  1L0W A;  4A3E G;  4WJ4 A;  4HIK A;  1H95 A;  3K8A A;  4RG1 A;  2QEX A;  2F3I A;  3H0G H;  2R92 G;  3HOX G;  3AEV A;  1V9P A;  5DLQ E;  4BBR G;  1QUQ B;  1PH8 A;  1IBL Q;  1XMO Q;  1OXS C;  4RMF A;  5C0X I;  4A3L G;  1YI2 A;  1B7Y B;  5IYD G;  4OO1 I;  3ULJ A;  2VQE Q;  3BJU A;  3J81 c;  2JA7 H;  2Q2U A;  1VQP A;  2AHO B;  3H3V I;  2I5H A;  2RHS B;  1LYL A;  5JJK A;  2AWN A;  4AIM A;  4P74 A;  4OWT B;  4BY1 H;  1I6H H;  3RLO A;  2RCN A;  3KYH C;  2Z6K A;  4HID A;  1EOV A;  2JA5 H;  1XMQ L;  4LUO A;  1VQK A;  3S14 H;  1X3G A;  2ATW A;  2AKW B;  4OX9 L;  2R7D A;  1YJW A;  4MZ9 A;  4YY3 Q;  1BBW A;  3H0G G;  1HR0 Q;  1E24 A;  1VQM A;  3HKS A;  4DR6 L;  4B3S L;  4JI7 L;  4JI1 Q;  4DK6 C;  4OWX B;  3RLN A;  4LF5 Q;  1X54 A;  1YIJ A;  4GKJ L;  4WJ3 M;  2D0O A;  4IPH A;  2JA7 G;  1GKH A;  1VQ8 A;  4Y52 H;  4BY1 G;  4HJ7 A;  1WFQ A;  1Q12 A;  2CWP A;  5M3F H;  1TWH H;  2JA5 G;  1A0I A;  1LUZ A;  4Y7N H;  1G51 A;  1UWV A;  4UPA A;  3GTP H;  4DV0 Q;  3CME A;  4L5T A;  2YTX A;  3AYH B;  1UE5 A;  1JB7 A;  4A93 H;  2Q2T A;  1BVS A;  3J7A 5;  3KDF B;  4NXN Q;  1IYJ B;  5BR8 L;  3CMA A;  1SRO A;  3RNU A;  4EQ5 A;  1NTG A;  1Y1V H;  3EBE A;  3G6E A;  2B29 A;  1GO3 E;  1DGS A;  2BA0 A;  4P71 A;  4PZ6 A;  4DV3 Q;  1GM5 A;  2UUC L;  3PF4 A;  1D8L A;  2B63 H;  1Q46 A;  3UE0 A;  2VQF L;  4A3C H;  1VQE A;  5GAG C;  3NEL A;  3STB D;  4JI4 L;  4POG A;  1TXY A;  3LGJ A;  1JJC B;  4LWC A;  1I50 H;  3CPW A;  1BBU A;  2QA4 A;  5IT9 c;  5M3F G;  2VW9 A;  3G48 A;  4DUY L;  1XJV A;  1OTC A;  4A3J H;  1XPU A;  3J81 j;  4A3K H;  1G6P A;  5GQO A;  1N34 L;  3HOW H;  3I7F A;  1IXR A;  4HIM A;  3HOV H;  4GOP B;  3M4P A;  5GAH C;  4A93 G;  3CCL A;  1TWC H;  3B6Y A;  1CKN A;  2JJQ A;  3F2D A;  1X56 A;  3TS0 A;  1ASY A;  1XMQ Q;  2K50 A;  3CAM A;  1Y1V G;  2K4K A;  4JI2 L;  2I5L X;  2UXB L;  4L5R C;  1SLJ A;  2WFW A;  3H3V H;  4DKA C;  5H1S E;  4JI5 L;  1M1K C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  2B63 G;  3GTO H;  4A3C G;  4QIW E;  5M5Y H;  1Z47 A;  1PH3 A;  4DR6 Q;  4B3S Q;  4JI7 Q;  4A3G H;  2F4V Q;  3GTK H;  1UE1 A;  3FHW A;  1N8R C;  4DNI A;  3S2H H;  1QUQ A;  4PZ8 A;  4A3J G;  3GTQ H;  1VQ7 A;  1Q8K A;  4A3K G;  1C7Y A;  2VNU D;  1RL2 A;  2A8V A;  3TRE A;  1YZ6 A;  4DV6 L;  3HOW G;  3HOV G;  3PGZ A;  4A3D H;  4C3I H;  1X3E A;  1EQQ A;  5C0X G;  1OXV A;  1KC8 C;  4BA2 I;  1PVO A;  1PH1 A;  4OO1 G;  5IWA L;  4AYB E;  3M85 A;  5JEA J;  1HNW L;  4IO9 A;  1HNZ L;  4GLX A;  1X55 A;  1XNR L;  3WWV A;  1VQI A;  4A3M H;  3HOZ H;  1N9W A;  2OQ0 A;  4P73 A;  4HJA A;  4DR7 Q;  3SGI A;  1J6Q A;  1YEZ A;  4HJ8 A;  1GVP A;  4GN3 B;  2MO1 A;  2KCM A;  4A3G G;  3KJO A;  3CC7 A;  3E0E A;  4LUZ A;  1HNX L;  1NMF A;  4DPG A;  5FJ8 H;  4DV7 Q;  1HZB A;  4NPS A;  1KIX A;  3CCE A;  2JA6 H;  1SMX A;  2VQF Q;  4LF8 Q;  2PI2 A;  3GDE A;  4NB3 A;  1EQR A;  4DUY Q;  4A3I H;  1U0L A;  3IRB A;  3CCS A;  2N78 A;  5GAE C;  4L5S A;  2R7Z H;  3I4N H;  1HZC A;  1C0A A;  2Z6K C;  4AYB G;  1SFO H;  2N8N A;  1N34 Q;  2WAQ E;  3HOY H;  2KHJ A;  4YWM A;  1Q86 C;  2JEA I;  1WYD A;  4A3M G;  3HOZ G;  3U58 A;  2XTI A;  2VUM H;  3NEN A;  1VCI A;  2E2I H;  4JI2 Q;  4DV4 L;  2HQL A;  2UUC Q;  5FJ8 G;  2ZTC A;  4LF4 Q;  1VQJ A;  2JA6 G;  1VQ6 A;  4BY7 H;  3A74 A;  4BXX H;  3CCR A;  4HIO A;  1VQL A;  2ZTE A;  4A3I G;  1K3R A;  1YBY A;  1JE5 A;  1KRS A;  1T9H A;  3I4O A;  2E2J H;  1NY4 A;  4TVA B;  2YYZ A;  1KAW A;  4LF6 L;  3I4N G;  4P75 A;  2R7Z G;  3KOJ A;  4AQY L;  4DV6 Q;  3CCJ A;  1YNX A;  3UDI A;  2WAQ G;  2HIV A;  3CCV A;  3CC4 A;  3HOY G;  4XIG S;  3I56 A;  1KHI A;  1A63 A;  4ME3 A;  3UDF A;  3OTO L;  2EXD A;  4QQB X;  4GOP A;  2VUM G;  1YJ9 A;  1S3O A;  4LFA L;  2OCE A;  3F1Z A;  1HNW Q;  3I4M H;  1HNZ Q;  4DV2 L;  2OWO A;  2VS1 A;  2UUB Q;  1FJG Q;  4FDB A;  4AH6 A;  2Y0S E;  5LMN Q;  1P16 A;  3PF5 A;  1XNR Q;  4LNQ A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  2VL6 A;  4DAM A;  4DUZ Q;  4ALP A;  4B3T L;  4BXX G;  2IY5 B;  3I2Z A;  3L7Z C;  1HNX Q;  1XPO A;  1S40 A;  1PH5 A;  1SR3 A;  2JA8 H;  3JAM c;  1PH6 A;  4LF9 L;  5IP7 H;  1N36 L;  2GN5 A;  3PIO A;  1L2F A;  4X62 L;  4GN5 A;  4IPG A;  4L5Q A;  2A19 A;  5J3B A;  2UU9 L;  4B3M L;  2ZJR A;  5LMU L;  3I4M G;  4DR5 L;  1QVG A;  1Q81 C;  3KF8 B;  2Y0S G;  4YWL A;  4JV5 L; 
#chains in the Genus database with same CATH topology
 2MQH A;  5CV5 A;  1RTN A;  2O4X A;  1BNC A;  2K6A A;  4LH7 A;  4IZ8 A;  3PO2 H;  3BVZ A;  4O4L F;  5M3M H;  3BZK A;  3DLL A;  2J4X A;  4TKO B;  2YTY A;  4Y7N B;  4DV0 H;  4KK7 A;  3GTP B;  1PLF A;  3MTS A;  4ZLT F;  4DR2 L;  4LF6 Q;  4AQY Q;  1TS5 A;  4ED8 A;  3W1B A;  3PW0 A;  1XTC D;  2D0P A;  3L0O A;  3Q0A A;  5CV8 A;  1CHQ D;  4APV A;  3PN1 A;  3FPU B;  3N52 A;  2B63 B;  4BWS C;  2HHH L;  1KLG D;  2WV6 D;  1B6S A;  4DV2 Q;  1B70 B;  2XSC A;  1I50 B;  4C1N K;  4K2K A;  3FKI H;  1A8V A;  5AJ3 L;  5D14 A;  4A3J B;  4A3K B;  5C4X B;  1X9N A;  4A3B G;  3M9M B;  3U4V A;  3H15 A;  3M9O B;  3KK7 A;  3Q8Q B;  2Z1C A;  1NNX A;  1EIF A;  1PH4 A;  4TQU S;  1SE8 A;  4LF4 H;  3S15 H;  1XMQ H;  2JYO A;  4BBS G;  1SCU B;  2RDG A;  4ABN A;  4G4K A;  4PQX A;  5L37 A;  5ELO A;  1MKH A;  2A68 C;  4R4T A;  2WP8 J;  3TZD A;  4OX9 H;  3OSO A;  5C4H A;  1FL0 A;  2UU9 Q;  1U4P A;  4ZUI A;  1QCB D;  4O1N A;  2UXC L;  4DR6 H;  2I0Q A;  4K0K L;  4DR1 L;  3RMH A;  1S10 A;  3H0G A;  1SYD A;  1KDA A;  1N33 Q;  3UE1 A;  4JI6 L;  1Q1B A;  2XD4 A;  2L11 A;  2NVX H;  1PRT F;  4DXF A;  2F0T A;  2CW7 A;  5KND A;  3A0J A;  4CDC C;  3CU7 A;  4C5B A;  5JEA G;  1XPR A;  3NBH A;  4DR7 H;  2JEB I;  3AFQ A;  3HFZ B;  3A8I E;  4R4I A;  3C46 A;  1D7Q A;  1WI5 A;  4QB4 A;  5GAD C;  3V4Z A;  3RIZ A;  4G3I A;  1SRU A;  2UUC H;  4O42 A;  2NVQ H;  3PUX A;  3G71 A;  1Z7T A;  2JE6 I;  1B33 N;  3KF8 A;  4POF A;  1YHA A;  2M2L A;  1K0R A;  3NE5 B;  3GIM A;  3K5L A;  2MHV A;  5FO9 B;  3A56 A;  1SFO B;  5HY6 A;  4QUF A;  2UXB Q;  4UCR A;  3M9N B;  2WAQ B;  4F4Z A;  3JAM L;  4FF1 A;  3T5K A;  4JI5 Q;  4ED6 A;  4MIU A;  4C2M H;  3KFU A;  3GTP A;  4F7X A;  3C2P A;  2ZDH A;  4RU9 A;  3SE0 A;  4CKC A;  3NK9 A;  1O7L A;  5ELE A;  3QIA A;  2Z4H A;  4GC6 A;  4FM9 A;  3PUZ A;  2JEF A;  2DPJ A;  1K73 C;  4C3J G;  4BY7 B;  4MA0 A;  1GD7 A;  1JOO A;  1LAC A;  2B63 A;  1CUK A;  1I50 A;  2PCF B;  3GV3 A;  5FK9 C;  1YHB A;  4JW0 A;  3JAM W;  4NXN L;  4FXK C;  1RD9 D;  2UVV A;  3MXN B;  3H4B A;  4DAV A;  5CV7 A;  4V19 0;  3I4M B;  1SE4 A;  3PO3 H;  2UUB H;  3QB3 A;  1SNM A;  1X3F A;  1ZKO A;  2Y0S B;  2CCZ A;  1GGO A;  3BZD B;  5KG0 A;  4J9N A;  4O2D A;  1TU2 B;  2FPP B;  5HGQ A;  5IGD A;  1NUC A;  1WTX A;  2FK3 A;  3OW7 A;  4DR3 Q;  5C3E H;  1SAP A;  3M7N A;  4GLA C;  4L6T B;  1FVI A;  2K5N A;  2OQK A;  3SK5 A;  2WYO A;  2ZM6 L;  3T1Y Q;  4ODG A;  1W2B A;  1GUW A;  2YU9 H;  1WSC A;  4ED0 A;  4YAK B;  1UEB A;  1LM0 A;  1QOH A;  1SDF A;  1XNQ L;  5K36 H;  5L1L A;  1F2Z A;  2QDL A;  1K9M C;  4UHV A;  4M8A A;  2NUC A;  1F77 A;  3I90 A;  2R8H A;  1JIC A;  1PYS B;  4WFN 3;  4A75 A;  3CD6 A;  2R93 G;  1Y1W G;  3ORR A;  4A93 B;  3ICE A;  3PO2 B;  3VR4 A;  5IYB H;  5C4J H;  5M3M B;  2OF1 A;  4ETS A;  2I5M X;  1V1P A;  2V1C C;  1EY7 A;  2ICI A;  1O75 A;  1CM9 A;  2R8K A;  3D6W A;  3DHQ A;  5C1P A;  2B2U C;  1CK1 A;  2VPQ A;  4XX0 B;  3J80 i;  5DLF A;  3OTO H;  4V0B A;  4X66 Q;  1S97 A;  1SFO A;  5EQ0 A;  2WAQ A;  4CKE A;  1LO5 D;  2MFI A;  2H1E A;  3CCU A;  4MV8 A;  5IYZ F;  3Q8R B;  1JKJ B;  1WCM H;  5KFE A;  2ZDG A;  4YIJ A;  4LFB L;  3FKI B;  1N36 Q;  4JBM A;  2B2W C;  4X3T A;  4C3H H;  2L4N A;  4RAU C;  3RB3 A;  3U4Z A;  2JN4 A;  4B3M Q;  3OW2 A;  3PSI A;  1ONL A;  2W7O A;  5LHY 1;  1PFB A;  3CRL C;  3HOU G;  2ALY B;  2A68 D;  5CMD A;  1VBG A;  2QW7 A;  4JV2 A;  2EJF C;  2NZO A;  1L1O B;  2NN6 H;  4J9Q A;  2Q8T A;  4DK3 C;  3MXN A;  5JH7 F;  2RGR A;  1Z9F A;  1EQV A;  3T1H H;  1LTI D;  1PTO H;  1X3Q A;  4YCV A;  2Y0S A;  3ETH A;  5IP9 G;  3JRX A;  4ZOL F;  1ICF B;  4A3M B;  2SEB D;  5C4X G;  4IPD A;  2F03 A;  2NVX B;  5J2T F;  1DCZ A;  2FJZ A;  4FU0 A;  4KY6 A;  5J1Z A;  2K03 A;  3NXW A;  1HTP A;  5A35 A;  5KFQ A;  2MUY A;  2A5H A;  4DV5 H;  1FGU A;  4PG3 A;  5KEE A;  4GNX C;  4QGU A;  1UNS A;  1A62 A;  1JJG A;  1VAJ A;  1BQQ T;  2NVQ B;  2K5V A;  3F2B A;  3IL8 A;  4DUZ L;  1EWI A;  2R7Z B;  1K8A C;  4J0M A;  1I4G A;  2O2L D;  4TRD A;  2EYM A;  2UXD Q;  5F9N A;  3L2P A;  1EYG A;  1HR0 L;  3MFG A;  3N41 B;  4FP5 D;  4J9M A;  4OGQ C;  2KCT A;  1K8M A;  2BH2 A;  4X64 H;  3BG3 A;  4F50 A;  1S0O A;  4MAM A;  4MN3 A;  4K8I A;  3TIN A;  3HOX H;  4C2M B;  1QNK A;  3N6R A;  4OHJ A;  1HJP A;  2W57 A;  4MTK A;  4LF7 H;  2ASL A;  4HTH A;  2X6G A;  3BYY B;  2Z4I A;  1MHW C;  2RF4 A;  3KDF A;  1CKN B;  5ISR A;  1CA6 A;  4F8M A;  2RDJ A;  5GRO A;  3PV0 A;  2BA1 A;  2JK8 A;  5IIF A;  2EE1 A;  3X3N A;  1Y69 U;  4RZR A;  5LOV F;  2D62 A;  3S1R H;  3TBI B;  2E5L H;  1L0W A;  2KUM A;  3FKI A;  3T51 B;  3RV3 A;  1OO9 B;  4RUA A;  2QEX A;  2R92 G;  1KDB A;  1TT2 A;  4EBC A;  4P2C B;  4JK1 C;  4A3L G;  1JB3 A;  1YI2 A;  5DQH A;  4YR3 A;  2DNC A;  4IWY A;  2R61 A;  3J81 c;  3WO0 A;  1V8Q A;  1VQP A;  2RHS B;  1DD2 A;  5KFA A;  4K14 A;  3J81 E;  5KX5 F;  1EOV A;  5T1G A;  2EY1 A;  2JA5 H;  5C3E B;  5CV9 A;  1XMQ L;  1O7Z A;  1X3G A;  1J5E H;  2W9A A;  2NU6 B;  4ME6 A;  4OX9 L;  1BBW A;  5IGF A;  1VQM A;  2XGQ A;  3HKS A;  4E6I A;  4DR6 L;  4DK6 C;  1STE A;  3MWE A;  2NVX A;  4M9U A;  4IPH A;  2EOT A;  2JA7 G;  4JI8 H;  4Y52 H;  1C3O A;  4HJ7 A;  1WFQ A;  1Q12 A;  2A74 C;  2HD3 A;  1XYI A;  3LWB A;  2XGP A;  3CME A;  3I73 A;  1MZB A;  5C4J B;  1UE5 A;  1JB7 A;  2R7Z A;  2Q2T A;  4F87 A;  3J7A 5;  4DL3 A;  4KMU C;  3PW5 A;  4YHH H;  4GKK H;  3RNU A;  4EQ5 A;  4RGM A;  3I8Z A;  2UUC L;  2TMP A;  4ZAI A;  3PW4 A;  1BR9 A;  5NUC A;  4IWX A;  1PX2 A;  3V4S A;  1V51 A;  2NUA B;  5C8Y F;  3WOF A;  5GAG C;  3NEL A;  1FR3 A;  3BAB A;  1TXY A;  3CPW A;  1OTC A;  5DNF A;  2SCU B;  4C2M A;  4ZUJ A;  3J81 j;  3JSN A;  4FXG C;  5GQO A;  3HOW H;  1BCP F;  1WCM B;  5LL6 X;  4A93 G;  5KG7 A;  3CCL A;  3B6Y A;  3BDC A;  2QEJ C;  1CKN A;  3TS0 A;  1X56 A;  3ND9 A;  4CKB A;  1WR2 A;  2UXB L;  4KN7 C;  3H3V H;  2HDL A;  4JI5 L;  5H1S E;  1M1K C;  4IUV A;  3LP8 A;  5M5Y H;  4RGN A;  4A3G H;  4B3S Q;  2F4V Q;  1UE1 A;  5M9O A;  1XXG A;  1SYG A;  1I4Q A;  3I70 A;  3GTQ H;  1JXL A;  1Q8K A;  4OIK A;  1AZP A;  1C7Y A;  4L63 B;  2VNU D;  3HOV G;  5LL6 b;  1PTO B;  3PGZ A;  3PQI A;  5JVD F;  1SND A;  3I3C A;  1EQQ A;  1KC8 C;  4DR2 H;  4AYB E;  1LT5 D;  4RCO A;  4LSA A;  1EYZ A;  2QCP X;  4RKB A;  3M4I A;  1VQI A;  3HOZ H;  5H80 A;  4P73 A;  4HJA A;  4HJ8 A;  1J6Q A;  1GVP A;  3A8K E;  3NWS A;  4GN3 B;  2MO1 A;  1CQJ B;  3KJO A;  5EKL A;  2WII B;  2X0S A;  3FDT A;  5FJ8 H;  4DV7 Q;  2YU9 A;  3CCE A;  3MR6 A;  3S16 B;  3Q8S B;  2J6U A;  1FGB D;  3H6M A;  2JEJ A;  4NB3 A;  4A3I H;  1K28 A;  1CTM A;  3IRB A;  3V6J A;  3J81 L;  1I6U A;  2B2T A;  1NR4 A;  1TAE A;  3HOY H;  3EFX D;  1Q86 C;  3VPC A;  1WYD A;  4HNT A;  4A3M G;  2YRX A;  5KFC A;  2OH2 A;  4O2A F;  3U58 A;  1EYA A;  3FMA A;  4QWC A;  1R4Q B;  5KT4 A;  1S0N A;  3RZD B;  2XWJ B;  1SYX B;  2IJ0 A;  3HOX B;  2FIN B;  3C3L A;  1DV1 A;  5KFW A;  2UXC H;  3TP7 A;  4DR1 H;  2IMW P;  4LF4 Q;  2JA6 G;  2WB1 B;  1FD7 D;  1SXT A;  3CCR A;  1VQL A;  2ZTE A;  2F0I A;  1YBY A;  2PO4 A;  2E2J H;  3HG9 A;  4CC6 A;  1G91 A;  2YYZ A;  2R7Z G;  1SEI A;  3J81 W;  2K5Q A;  2HGS A;  4N8F A;  3UDI A;  3K5M A;  1I4P A;  1O80 A;  4ME3 A;  3OTO L;  2EXD A;  3SK8 A;  1WCM A;  1YNJ D;  2VUM G;  1YJ9 A;  1S3O A;  3OHA A;  2OCE A;  1D6E C;  3F1Z A;  4ECY A;  2IA6 A;  2YS6 A;  2OWO A;  2VS1 A;  5LMN Q;  2KOL A;  2EYL A;  1ZYR C;  1IL8 A;  5C5M A;  2VL6 A;  4KD4 A;  3G6J B;  4IHJ F;  3ERQ A;  2IY5 B;  3L7Z C;  4EVO A;  1HNX Q;  1EUD B;  3KHL A;  1SR3 A;  4MV6 A;  1PH6 A;  1N36 L;  1GHJ A;  2J6T A;  2GN5 A;  3TDQ A;  4J9L A;  3QOJ A;  4IPG A;  2B2Y C;  4L5Q A;  4B3M L;  4JI1 H;  5COY A;  4LF5 H;  4ECU A;  4YWL A;  1B6R A;  3T1H L;  2ZJP A;  1E22 A;  2PQE A;  1WTW A;  1TY2 A;  2ZXP A;  2JA8 G;  3FVQ A;  2QGQ A;  5KG1 A;  2PW5 A;  3S17 H;  1BCP B;  2L5T A;  3P20 A;  3VPB A;  5COR A;  5M5W B;  2W8K A;  4DV5 L;  4NXN H;  4L8J A;  2K32 A;  1PH7 A;  4HSP A;  3CQZ B;  4XQN A;  5KFR A;  4WOR A;  2IX1 A;  4JCV E;  2XC9 A;  2F0O A;  2HJW A;  4R8U B;  1PFN A;  4LFA Q;  3J7A V;  3IG0 A;  1QNU A;  1BBX C;  1DV2 A;  1JR0 D;  2WDT A;  4B3T Q;  2RHQ B;  3HOW B;  2E74 C;  4IUR A;  4X64 L;  4PMW A;  2UXD L;  5KNB A;  4YAJ B;  4XYM B;  1XNQ H;  4LF7 L;  1QZH A;  1K0S A;  1Z6H A;  3RV4 A;  5IE8 A;  5E4X A;  1QIL A;  1NBW A;  1B3Q A;  1L2Z A;  3K7A B;  2PMZ E;  1CZG A;  3O13 A;  1K3B C;  1D5M C;  4QIW B;  4JI7 H;  3I72 A;  4A3G B;  1A15 A;  1GUT A;  4C5A A;  4JV5 Q;  4KHP Q;  4CHT B;  1BKB A;  2HT1 A;  4MTE A;  3GTQ B;  2YYA A;  2X6L A;  1P8L A;  2E5L L;  2KSW A;  2BDN A;  4B3R Q;  5KRU A;  2V4R A;  2J9G A;  3MWM A;  1QE6 A;  1LV9 A;  1F9S A;  2F1M A;  3K59 A;  3E5S A;  1ENA A;  4NP5 A;  2B8F A;  2BH8 A;  4IFD H;  1NSN S;  3S1N H;  2JA5 A;  3NWT A;  2SNM A;  3HOZ B;  3M9B A;  2RDF A;  4JBJ A;  4JI4 Q;  1SE3 A;  4TV9 F;  4JBW A;  1Z2P X;  1I94 Q;  4KJO A;  1BGW A;  3A5U A;  1J5E L;  5TSS A;  1AEX A;  3VDY A;  3K58 A;  4DUY H;  3MEH A;  2N3S A;  4A3I B;  5DAU A;  3BA8 A;  2K14 A;  3W1G A;  5KFS A;  4JYA Q;  2FMA A;  5EZY F;  1N34 H;  1QZG A;  3BQ0 A;  3HOY B;  4ECS A;  1VQ4 A;  4I7A A;  4OEL B;  3E9I A;  2DN8 A;  1DJR D;  1JT8 A;  3NQI A;  3N6X A;  4JI8 L;  1DOL A;  5E7N A;  1G29 1;  2H5X A;  2BR0 A;  4JI2 H;  1UEA B;  1K8O A;  4JI3 Q;  5KKN B;  1SNC A;  4Q0F A;  2N55 A;  4F4Y A;  5C1O A;  3V6K A;  3K80 C;  1A2U A;  1X65 A;  1I7N A;  4HR7 A;  1V43 A;  4YHH L;  2E2J B;  1MJE A;  4GKK L;  5IWA Q;  1NCV A;  4DN4 M;  1SEB D;  3H0G B;  2I80 A;  3S1Q H;  2MJ8 A;  1UC9 A;  1GSH A;  1U4M A;  4IJL A;  1KD1 C;  1A3U A;  2HDM A;  3SE7 A;  1HNZ H;  5KG5 A;  1XNR H;  1MJC A;  2ZT9 C;  1E7Z A;  4JOI C;  2GVA A;  3R93 A;  3EN2 A;  1ZYR D;  4DUZ H;  2DNE A;  5CYU A;  3NBH B;  5KFG A;  3BS1 A;  2CFM A;  5L9X A;  1YJN A;  4KY5 A;  2WB1 G;  5D1O B;  3S24 A;  4QIW A;  3ZJY C;  2ID0 A;  3PIO 3;  2B2V A;  4WRD A;  1L0Y B;  4MA5 A;  2NN6 I;  1VQB A;  2XIW A;  3GTQ A;  4TSS A;  3CPF A;  1RK6 A;  3OUU A;  2UUA Q;  4H13 C;  1FNU A;  2PMZ A;  4BWG B;  4DV1 Q;  5D3D A;  2PI2 E;  4ILW A;  3TN2 A;  4QW8 A;  1C9O A;  2NVY H;  2LSS A;  3PMF A;  2DJG C;  2OXP A;  4NXM Q;  3GTM H;  2F4V L;  1E2W A;  3GIQ A;  4DR4 Q;  1T36 A;  5C5L A;  2FB9 A;  1J8I A;  1BXR A;  1BOS A;  2HUG A;  1KXL A;  2CW8 A;  3N43 B;  1BO0 A;  4OXP A;  2YCH A;  4HMI A;  3JC6 6;  4HCE A;  3EYY A;  3QJY A;  3RN2 A;  2I07 B;  1HCZ A;  4AQY H;  3TP8 A;  5FLM H;  3K7U C;  3KAK A;  3RBE A;  4X65 L;  1HPC A;  4PMC A;  1KTK A;  2C00 A;  1EIG A;  3ERS X;  1B8A A;  3M4Y A;  5BN4 A;  5FLX c;  1CQV A;  5C5J A;  3F8T A;  4DA2 A;  4DV2 H;  3OPO A;  4DV7 L;  4IOA A;  4A3F G;  4UDU C;  4QY7 A;  4IR1 A;  5FLX E;  3CHB D;  4LF9 Q;  4XYL B;  3I12 A;  2NYZ D;  1HZ9 A;  4U67 3;  4JG2 A;  1STY A;  5ELC A;  2WKC A;  5EKI A;  1N56 A;  3VR2 A;  2YTV A;  2JEG A;  2XGT A;  1CI3 M;  2ZTD A;  2Z0S A;  2WKD A;  1SYB A;  3GTL H;  2V5A A;  2UVR A;  2SDF A;  4RHR A;  5IYC H;  2UU9 H;  1IBM Q;  2G9H D;  4ZQ3 A;  1K83 H;  1PA6 A;  1ET6 A;  2C2D A;  4ZKC B;  2HIX A;  1N32 Q;  3MR5 A;  1S0M A;  4GN4 B;  1DXM A;  4UP7 A;  2RQX A;  4ZCK A;  3K57 A;  4TV8 F;  5DGB A;  2K7V A;  5ELN A;  4IJH A;  3URY A;  4OON A;  3CCQ A;  3KBG A;  3SK4 A;  4Z9C B;  2E76 C;  3TEH B;  3R3O A;  2FMM A;  3GIP A;  3WNZ A;  4KLK A;  3KHR A;  2BDO A;  5D1O A;  2EXZ A;  2F0H A;  1OXU A;  2N49 A;  5IGB A;  4YCU A;  3SEB A;  1V4Y A;  4LAA A;  4KV6 A;  3S1N B;  3BJY A;  3VR5 A;  5C44 G;  1H9S B;  1V1P B;  1W6J A;  3UI2 A;  5LMN L;  2B8G A;  1T3N A;  1STN A;  3HKZ G;  4QUC A;  4LW1 A;  4A76 A;  4J9O A;  2FLL A;  2DIK A;  3D3R A;  1UUP A;  3ND8 A;  1B1Z A;  1CSQ A;  1R9T H;  1PRT C;  1HH2 P;  2N88 A;  1Q90 A;  4JI1 L;  1STB A;  3MR2 A;  2PN1 A;  4K5V A;  1VQC A;  4A3E H;  4LF5 L;  2UXB H;  1JC7 A;  1UNN C;  1GXD C;  1VQG A;  4IFD J;  5A2Q E;  3Q2O A;  4TQS A;  4JI5 H;  4HJ9 A;  4J9S A;  5FD5 A;  4FF4 A;  2CWA A;  1L1O C;  4IRC A;  4DK1 A;  4EX5 A;  3OMG A;  5LMN W;  1JLL B;  1Y8P B;  1EU4 A;  2I87 A;  3J81 i;  2M05 A;  4RAZ A;  4DFA A;  1M6V A;  4O4H F;  3Q1K A;  4QWA A;  4IUP A;  3M3Y H;  1HRJ A;  5LA6 F;  4EEY A;  1GSO A;  5JJI A;  2W6N A;  2DUD A;  1JWU D;  1E4E B;  1TVX A;  1TWF H;  3HB9 A;  2VB3 X;  2QIL A;  4FBT A;  3S1Q B;  4XXE A;  1FNV A;  4CDE C;  5J39 A;  3AEV A;  1V9P A;  1PH8 A;  4BBR G;  1QUQ B;  1IBL Q;  3G6X A;  1OXS C;  5KT2 A;  5IYD G;  3MFH A;  3L3O C;  1CHP D;  3I4L A;  3MFI A;  2FMC A;  4C56 C;  2VQE Q;  1AFP A;  3H3V I;  1LAB A;  1LYL A;  2AWN A;  1I6H H;  5F2D A;  3RLO A;  3SI8 A;  2RCN A;  4HID A;  4DR3 H;  2YZN A;  4LUO A;  1HHV A;  2V58 A;  1EU3 A;  2R7D A;  1YJW A;  1BNZ A;  4YY3 Q;  2D5D A;  3T1Y H;  3H0G G;  5JVL A;  1E24 A;  4IUQ A;  4JI7 L;  4HNU A;  3P75 A;  1RJP A;  3VR6 A;  4K8J A;  4RA8 A;  1X54 A;  2QYZ A;  4Q5V A;  2NVY B;  1JX4 A;  5I6Y A;  1VQ8 A;  1MD2 D;  4BY1 G;  5KFT A;  2HCI A;  2CWP A;  4ZKB B;  5M3F H;  5F9L A;  2IWH A;  1H9S A;  1IOW A;  4XZ3 B;  1LUZ A;  5FLX W;  3KXY T;  2C28 A;  2AUJ D;  1G51 A;  2AGO A;  3N42 B;  2CQA A;  3H40 A;  4YQW A;  3KDF B;  3TZU A;  4LSX A;  1IYJ B;  2FE3 A;  2NU8 B;  2NBF A;  1SRO A;  5KG6 A;  1NTG A;  1Y1V H;  3EBE A;  4DV3 Q;  4P71 A;  2ASD A;  2BA0 A;  3PF4 A;  3VYU A;  1TY0 A;  1D8L A;  5D8D A;  3E5N A;  5DQI A;  3FPP A;  4X66 H;  1VQE A;  4JI4 L;  4POG A;  1JJC B;  4DUY L;  1XJV A;  1BBU A;  2SOB A;  4CBV A;  4CDF C;  5HV6 A;  5T14 A;  4YR0 A;  5IGE A;  1S68 A;  4UCU A;  4NW2 A;  1G6P A;  1N34 L;  5DG7 A;  1RYR A;  1ZHS A;  1N36 H;  3UFX B;  3M4P A;  3S15 B;  5GAH C;  2GPS A;  2J0T D;  1SJE D;  2F3V A;  3OIP A;  2Q8R E;  4K6D A;  5C0X H;  4FF3 A;  3L4J A;  1QJO A;  1ASY A;  2F0K A;  2IL8 A;  4OO1 H;  1F9P A;  3BDO A;  3VPD A;  4UAI A;  4B3M H;  4JI2 L;  2W7P A;  4L5R C;  2WFW A;  1ZET A;  2B63 G;  5D1P A;  4UCO A;  5JAV A;  2ENB A;  1E4E A;  4KKU A;  2HVQ A;  4A3C G;  3TME A;  3RB6 A;  3GTL B;  1H9J A;  3RTX A;  1F2M A;  2KQ3 A;  3V96 A;  1K83 B;  1QUQ A;  4PZ8 A;  4A3J G;  3KUP A;  1VQ7 A;  4ECR A;  4A3K G;  1KJI A;  1VMC A;  4UCS A;  1BXT A;  4A3D H;  4DF7 A;  4H0L C;  4C3I H;  1MI2 A;  2XVS A;  5IWA L;  2FLP A;  1HNZ L;  3MHB A;  1XNR L;  1YNN C;  4Q44 A;  1N9W A;  2OQ0 A;  1WD0 A;  5A2Q W;  1PTO F;  4JVZ A;  1T5X D;  3CC7 A;  2ZJT A;  4DPG A;  1HZB A;  3VR3 A;  4HED A;  2VQF Q;  1CT1 D;  5K2M A;  1E2V A;  4LF8 Q;  1GOZ A;  4CDD C;  4FYD A;  2YRW A;  3T5J A;  4RB1 A;  1PZK D;  2NVY A;  3R5X A;  5EPL A;  1HUN A;  5GAE C;  4ULL A;  3I4N H;  1HZC A;  1U4L A;  2UXD H;  2Z6K C;  1R9T B;  1EYC A;  1PZJ D;  1PRT D;  2MPM A;  1KAB A;  4YWM A;  4ZHQ F;  5EWG A;  4A3E B;  2XTI A;  2RCF A;  1JDE A;  1RJR A;  4MV1 A;  1VCI A;  1X32 A;  4X3S A;  2HQL A;  5KG3 A;  3U9S A;  2ZTC A;  3IN5 A;  5GON F;  1D5Z C;  1VQJ A;  4EFB A;  3TQ1 A;  2K5D A;  1YNJ C;  1K3R A;  3NTI A;  5G3L F;  4LF6 L;  3K3V A;  5EWE A;  4RH6 A;  2K33 A;  3M3Y B;  3KOJ A;  4AQY L;  2R7K A;  4DV6 Q;  4ED3 A;  3R5H A;  3CCV A;  2WAQ G;  2HIV A;  3CC4 A;  3KHH A;  4J9K A;  1KHI A;  5KFP A;  2F0S A;  1TWF B;  2Z9H A;  3PO3 B;  3MXP A;  1EEI D;  2W6M A;  3LNN A;  3A8J E;  1HNW Q;  2HQE A;  4DV2 L;  3D4W A;  4FDB A;  1GUO A;  1FJG Q;  4L1K A;  1P16 A;  4Q43 A;  4YP3 A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  4BXX G;  4G7O C;  2R6F A;  2LY7 A;  3T53 B;  1XPO A;  3KTM A;  2C9O A;  3GTL A;  1G2S A;  1PH5 A;  5EOY A;  1I6H B;  4LF9 L;  5ELB A;  4ZI7 F;  1K83 A;  2YU9 B;  2QF7 A;  2J6S A;  3MFY A;  4IR9 A;  4G7Z C;  1RJQ A;  4XYO A;  4HSV A;  4IN3 A;  4ECV A;  3NTK A;  2UU9 L;  4ED2 A;  3PZP A;  2ZJR A;  3I4M G;  3GP7 A;  1QVG A;  4LMQ D;  2I46 A;  2Y0S G;  3CP0 A;  1EIH A;  4DAP A;  4IFD I;  1LT4 D;  2R7L A;  1X6O A;  3SR1 A;  4DV4 Q;  1Q7Y C;  1N33 L;  1IBK Q;  5M3F B;  5IP7 G;  4YBZ B;  3RLF A;  1ZQ7 A;  2JXM B;  3RFC A;  4A3B H;  1WTV A;  4CJ0 B;  1TWG H;  3E9H A;  3QG1 A;  4LK1 C;  2EIF A;  3KLW A;  2LFN A;  2CKZ B;  3GV6 A;  1TWA H;  3AQQ A;  2O5J C;  4IUN A;  1LT3 D;  4BBS H;  3NGD A;  5L1J A;  4TQR A;  1Y1V B;  1R9T A;  4O2B F;  4J6H A;  2FLN A;  5KFF A;  3GTG H;  2QK4 A;  2EYO A;  4XQJ A;  4DAY B;  4TUY F;  3BZC A;  4JC0 A;  2EJM A;  2IX3 A;  3A55 A;  3RN5 A;  5AFW A;  5KFD A;  2FK1 A;  3PO2 G;  3NP8 A;  2PNH A;  4C3H B;  1ENF A;  4B9W A;  1BJT A;  5M3M G;  3BQ2 A;  1SYE A;  2JA9 A;  1RHP A;  5CGK A;  4GNX B;  3KAJ A;  2KHI A;  2CH4 W;  1I4H A;  3A7A B;  2YZG A;  4X62 Q;  3OIQ A;  5I9O A;  4GKJ Q;  2VXW A;  5I9P A;  5KIX A;  5JEA H;  4JBK A;  5JUM A;  1HFN A;  3CF5 A;  2F4I A;  4EEQ A;  2JEI A;  3DWA A;  1TWF A;  1HQR D;  2NZH A;  2F4V H;  1O7Y A;  3FKI G;  4MNO A;  2XCP A;  4UFZ A;  2K01 A;  1VQO A;  1BCP C;  2FPI B;  3C1E A;  3TQY A;  4UCV A;  4A3D B;  2BCO A;  3QR8 A;  4C3I B;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  4HAE A;  2ZDQ A;  4EBE A;  2B39 A;  3T13 A;  3K0Y A;  2B2U A;  4AYB B;  2AWO A;  4X65 H;  4FS2 A;  4DR2 Q;  1D1I A;  5CA0 F;  1I3Q H;  1YNN D;  5ELD A;  3GIJ A;  1S5D D;  4GOP C;  4Y8V B;  1PV4 A;  1CKM A;  4NMZ A;  3GQC A;  3VYR A;  1VS0 A;  3SVM A;  4DV7 H;  4DR3 L;  1EWH A;  3EPI A;  1D1K A;  1STH A;  3T5L A;  2Q8I B;  1HZA A;  4FBU A;  4MV7 A;  2B2W A;  1O7I A;  2HHH Q;  4C3J H;  2KED A;  2DZD A;  3T1Y L;  1B3A A;  3MEF A;  1X3P A;  5AJ3 Q;  1PH2 A;  4MHE A;  1EEF D;  1Q3L A;  3ZYY X;  3GIL A;  3TS2 A;  2YZM A;  3GV5 B;  3PUW A;  2VZA A;  4C5C A;  5C4Z A;  1EZ1 A;  4XYQ A;  1UE6 A;  1LLR D;  1SN8 A;  1PFM A;  2K75 A;  3WOE A;  3JAM i;  1I4R A;  2I8C A;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  4EQP A;  1E2Z A;  1Y1V A;  1W3S A;  4O3P A;  2R8I A;  4Q0Y A;  3KAL A;  2WTF A;  4IUT A;  4K0K Q;  3S1R B;  1UE7 A;  2WB1 E;  2IX0 A;  2K04 A;  4DAY A;  1VQH A;  4FS1 A;  4LUV A;  2O5I C;  2RA4 A;  1KRT A;  3SDZ A;  2EYP A;  4KKT A;  4JI6 Q;  5CV4 A;  1EZ8 A;  2R8G A;  1KQS A;  4X66 L;  2W70 A;  4O4I F;  1DOM A;  1EY5 A;  4GNX A;  4DXG A;  4DV3 L;  1QVF A;  4O3Q A;  4LMY A;  1RK5 A;  3IKJ A;  5FO7 B;  5LMN H;  1A9X A;  1PHJ A;  2YS7 A;  2DPI A;  1PMR A;  4R8I A;  2JA5 B;  3R5F A;  1AH9 A;  1B9N A;  1CKO A;  2ASJ A;  2AGP A;  2R93 H;  1HNX H;  4NKL A;  3DMU A;  4IOC A;  1Y1W H;  3I91 A;  4YB8 B;  3MVV A;  3TIG A;  1EY9 A;  5BN5 A;  2QKI C;  4G7H C;  2KHS A;  3GII A;  1H9K A;  3OHX C;  1PXU A;  5G3L D;  3DWQ A;  2K52 A;  5EGT A;  4R4Q A;  5KFZ A;  1WTH A;  3S2D H;  2XIG A;  3PO3 G;  2SNS A;  3DM1 A;  2UVW A;  3ULP A;  4AYB A;  4DGZ A;  1H9R A;  4XQQ A;  3EPG A;  3T56 B;  1YVC A;  2Z6B A;  4F88 A;  1RTO A;  5C3E G;  1AN8 A;  2KEN A;  4ZK9 B;  1B2T A;  1JCK B;  3NTH A;  4ECX A;  2DJF C;  4A3B B;  3F8N A;  3MR3 A;  1TWG B;  4HR7 B;  2V4Q A;  5K36 G;  4J9P A;  1TWA B;  1Q82 C;  2UVU A;  1S5F D;  4BBS B;  3KF6 B;  3T16 A;  3HOU H;  2OEO A;  3TII A;  3NEM A;  3FRP B;  5KYL A;  4DLK A;  4LFA H;  3GTG B;  1DON A;  3PCO B;  1QB5 D;  2R6G A;  1Z2O X;  3Q6S A;  5EKK A;  1SNO A;  2ZXR A;  4X6A H;  5IYB G;  4LF8 L;  4B3T H;  1I5F A;  1M7J A;  1ICW A;  2EJG C;  4O3S A;  4K5W A;  2PQA A;  5IP9 H;  1U9R A;  3LX0 A;  1ZHQ A;  3RGZ A;  5DQG A;  2F52 A;  2NTS A;  4OWW B;  2IBK A;  1JWM D;  4FXD A;  5C4X H;  3RD4 A;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  4DR5 Q;  5M5Y B;  3AB9 A;  2L15 A;  4CC5 A;  1Z2N X;  1V1O A;  3CXC A;  2ZM6 Q;  1SSO A;  4DU9 A;  3G4S A;  1XNQ Q;  5FPR A;  3J7Z C;  5LXT F;  2PMZ B;  4WJW A;  1NJI C;  4LFC Q;  2OLS A;  3EQL C;  3HBL A;  1WCM G;  3VYT A;  3GQB A;  4JV5 H;  4KHP H;  3HKZ E;  2IHF A;  4U68 A;  4YCW A;  4HN7 A;  4PDB A;  1ZXT A;  4RNM A;  4C3H G;  1BCP D;  4B3R H;  1S03 G;  2EQS A;  2C2E A;  3L4K A;  1EY8 A;  1EQT A;  2ASB A;  3G6V A;  3RB4 A;  4WBN F;  2Q2I A;  3HP3 A;  4OIJ A;  5K5P A;  5KFO A;  5KFJ A;  3PIP A;  4RB2 C;  1V1Q A;  1B50 A;  3PIP 3;  4N8X 1;  1LTT D;  4QJF A;  4PZ7 A;  5DEH A;  4JI4 H;  1FJG L;  2HVS A;  2AQ1 B;  2NN6 G;  3N40 P;  3GID A;  5LYJ F;  3NHH A;  2W9C B;  4JI0 L;  1TKW B;  3ERO A;  1JOQ A;  1OXT A;  2C5C A;  1WH2 A;  1I94 H;  3TRZ A;  3S9W A;  1Q1E A;  4C3J B;  1S9F A;  2F0N A;  1KAA A;  1CSP A;  2A6E C;  3GD7 A;  5E3F A;  3K0X A;  4LFB Q;  3NPP A;  2EYH A;  3CCM A;  2R7N A;  3HXL A;  1W93 A;  2XN9 C;  2FJ2 A;  4YR2 A;  4A3D G;  1IW7 C;  1KJ9 A;  1NAP A;  3BG5 A;  3NSW A;  3R8B A;  2PNR C;  3PUV A;  1CS0 A;  5HGT A;  2R92 H;  1AE2 A;  2R7M A;  3I55 A;  2EVB A;  4A3L H;  1K1Q A;  1TWG A;  2YW2 A;  1AE3 A;  1TWA A;  5D3I B;  4JI3 H;  1SBB B;  1R4P B;  1ZEQ X;  3KF6 A;  4HCS A;  1PYB A;  2RGV A;  1IBK L;  3K81 C;  3GTG A;  2FP4 B;  4HNV A;  4EGQ A;  2GA4 B;  1J9O A;  5IWA H;  1S72 A;  1A6X A;  3AFP A;  4NLG A;  1LTB D;  5KFI A;  1H95 A;  3K8A A;  3G7L A;  5CBE E;  3RZO H;  2F0G A;  1TR5 A;  2L12 A;  2EY6 A;  3HOX G;  3QZ7 A;  1XMO Q;  1KC7 A;  5C0X I;  3PR5 B;  2XRS D;  4OO1 I;  1WTP A;  3ULJ A;  3GV7 B;  2OT2 A;  1SMY C;  3BJU A;  4DL7 A;  2JA7 H;  3U9O A;  1II3 A;  4M1U B;  2AU0 A;  3ONA B;  1ILP A;  2HVR A;  1E0B A;  2W6P A;  2R93 B;  3KLS X;  4LJZ C;  3K5H A;  1Y1W B;  2AQ4 A;  5T1I A;  1VQK A;  1EFI D;  1KNE A;  3S14 H;  2VA2 A;  3NBI A;  1M4V A;  2AKW B;  2C2R A;  4MZ9 A;  5I6W A;  1KEE A;  2UUA H;  1HR0 Q;  3W2D A;  3MWD A;  4B3S L;  4MV3 A;  4DV1 H;  3CKI B;  3RLN A;  1TII D;  1KJJ A;  3PW2 A;  3S2D B;  4GKJ L;  4WJ3 M;  4F4W A;  1C48 A;  3G8C A;  2EYF A;  4NXM H;  5D65 A;  3PVX A;  4DR4 H;  1I3Q A;  3S17 B;  1XDN A;  1DM0 B;  4LF6 H;  1TWH H;  2WAC A;  4KY7 A;  2JA5 G;  1A0I A;  1UWV A;  4DV0 Q;  3MWY W;  4L5T A;  2W9C A;  1F2Y A;  4A93 H;  1BVS A;  1SJH D;  3OWE B;  4KTA A;  1MGS A;  5BR8 L;  5JQW A;  1EOT A;  1UAP A;  1WTQ A;  2B29 A;  1GO3 E;  1DGS A;  1AZQ A;  4FF2 A;  1Q46 A;  2GPW A;  3HRZ C;  2DY7 A;  3HOU B;  1CE8 A;  5KG2 A;  3LGJ A;  3CRK C;  4LWC A;  2QA4 A;  2G5D A;  3NQT A;  5IT9 c;  2VW9 A;  2KCN A;  1XPU A;  3IAY A;  3D6C A;  4LF9 H;  3QFF A;  3I7F A;  1IXR A;  4X3K A;  3HOV H;  5IT9 E;  5I2Y A;  1KNA A;  2B2Y A;  5CR3 A;  1JDB B;  1TWC H;  2JJQ A;  1HFG A;  1XMQ Q;  3IFT A;  2K50 A;  3CAM A;  4QWE A;  1M0T A;  4GC7 A;  5EBD A;  4RCN A;  1SLJ A;  2QDB A;  3D4D A;  4K5X A;  4DKA C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  3GTO H;  5KFN A;  4DL2 A;  2LMC B;  3VA7 A;  4DR6 Q;  2LKV A;  3MJF A;  3GTK H;  3K5I A;  1IBM H;  4OL7 A;  1N8R C;  4IRK A;  1N33 H;  3QO2 A;  1MBY A;  3S2H H;  1EY0 A;  5KT7 A;  2W8L A;  1N32 H;  1EWC A;  1RL2 A;  1FYC A;  2KCC A;  4G57 A;  3TRE A;  3HOW G;  4I65 A;  3GLK A;  4DL6 A;  2BQU A;  3TSS A;  1OXV A;  4BA2 I;  1PVO A;  1KBL A;  5FD6 A;  1PH1 A;  4YJ2 F;  3V6H A;  3M85 A;  3X3M A;  1G6Z A;  3GIK A;  3RAX A;  2R93 A;  1X55 A;  2Z8L A;  3WWV A;  4A3M H;  1Y1W A;  3T4A C;  1C8C A;  4DR7 Q;  3H09 A;  3SGI A;  1YEZ A;  1HTL D;  4A3G G;  2KCM A;  4A2B A;  4Q8E A;  2W6Q A;  3E0E A;  1XX8 A;  1HNX L;  2UUC Q;  1KIX A;  2JA6 H;  1EL0 A;  2L0C A;  1M8A A;  1TS2 A;  2PI2 A;  2WE6 A;  1EQR A;  2V4D A;  3D8G A;  1U0L A;  4OEM B;  2N78 A;  1ULZ A;  4L5S A;  2R7Z H;  1C0A A;  1IOV A;  2FPG B;  1PK8 A;  3OHB A;  2N8N A;  2MGS A;  2WAQ E;  2A6E D;  5DM6 3;  2VUG A;  3HOZ G;  1RDP D;  5KG4 A;  1IW7 D;  2VUM H;  3VMM A;  1WVL A;  1MSG A;  2E2I H;  2R92 B;  5FJ8 G;  2CZG A;  1SNQ A;  1VQ6 A;  3E0J A;  1B9M A;  3OMC A;  1GSA A;  4A3I G;  5I2X A;  1JE5 A;  2R3Z A;  4I55 F;  1NY4 A;  1LTA D;  2EZV A;  4P75 A;  1VF7 A;  2PZW A;  1YNX A;  3HOY G;  2A69 C;  2VB2 X;  4XIG S;  1A63 A;  4QQB X;  3AMU A;  2R84 A;  3JRW A;  1TQO A;  4LFA L;  4O3N A;  3RZO B;  4BS9 A;  1IBL H;  2UUB Q;  1LT6 D;  1IKM A;  4AH6 A;  2Y0S E;  3PF5 A;  1F9R A;  3ETJ A;  4H44 C;  1S4Z A;  5FLX L;  4DAM A;  4B3T L;  4ALP A;  2VQE H;  4I7H A;  4EFE A;  2JA7 B;  1SMY D;  1SE2 A;  3DUZ A;  4JUZ A;  3NUC A;  2JA8 H;  3MXG A;  4RNN A;  2K05 A;  4IQZ A;  1AN7 A;  3P1H A;  3K5O A;  5IT9 L;  4CJ2 C;  4QW9 A;  3S14 B;  5CA1 F;  5J3B A;  2A19 A;  4O3O A;  4YY3 H;  5EWF A;  5LMU L;  4DR5 L;  1TA8 A;  1Q81 C;  1I6V C;  2F0P A;  4RKL A;  3GTM B;  5EDW A;  3R2I A;  2RSO A;  4JV5 L;  4KHP L;  4JPB W;  1Y14 B;  2IP4 A;  4JV0 A;  2E2H H;  1JOR A;  3ULL A;  4GS3 A;  3UQ8 A;  4B3R L;  1OWT A;  1VQA A;  1MSH A;  1QG7 A;  4LFC L;  3S1M H;  4QF4 A;  1TWH B;  2L55 A;  3V2T A;  3HGB A;  1B53 A;  4EG0 A;  5IT9 W;  5DM7 3;  1YHQ A;  2Q2H A;  2GLT A;  1FKA H;  2NU9 B;  1IHZ A;  4J9R A;  2WIN B;  4JOI A;  4DV3 H;  3OTO Q;  5I47 A;  1K8G A;  4ECZ A;  2A1A A;  1I94 L;  1LTG D;  3FEW X;  4A2A A;  1BF4 A;  2LXJ A;  4S3S A;  3CC2 A;  2G9D A;  2PVP A;  4DNR B;  5KFU A;  5LP6 F;  1JMC A;  5JVH 3;  1ASZ A;  2F0M A;  2R92 A;  1GUG A;  2FHT A;  4R9W A;  2L9H A;  3TP6 A;  3GTJ H;  4JYA L;  5KT3 A;  2IHE A;  5M5X H;  2C35 B;  1PFS A;  5KFL A;  4UP8 A;  4EGV A;  3K5N A;  3HOV B;  2KEC A;  5A2Q L;  5CV6 A;  1CZW A;  4P72 A;  3K6O A;  1HA6 A;  1RJT A;  1TWC B;  2R86 A;  2B2T C;  4GLV B;  1RCV D;  2NWG A;  1HA5 A;  2IT1 A;  5EBC A;  4JI3 L;  1VKZ A;  4RAY A;  3T5H A;  3GTO B;  1PRT B;  1KL9 A;  1ML0 D;  2R85 A;  1SYC A;  4ED1 A;  4XDX A;  3GTK B;  2RDI A;  2NVT H;  1EIY B;  3UDG A;  4HYK A;  2MNA A;  3T1H Q;  5CC4 A;  3S2H B;  3WDN A;  1VMP A;  1B04 A;  3D0F A;  3RF2 A;  4KN4 C;  2JA7 A;  4CJ1 B;  3ITP A;  4MV4 A;  3A5Z B;  3G6Y A;  5L1K A;  4U6P A;  3KBX A;  2KBN A;  5DG8 A;  1GHK A;  4DL5 A;  4DV5 Q;  5BPH A;  4IAL A;  1XWE A;  2B3G A;  3FP9 A;  2LS0 1;  1LTR D;  4PNY A;  1XMO L;  2EPB A;  1YIT A;  1I4X A;  1PDQ A;  2ES2 A;  3HEJ A;  4IAJ A;  4I7Z C;  3GTM A;  3CW2 C;  4ZYS A;  1A2T A;  2JA6 B;  2VQF H;  4LF8 H;  5E1F A;  4FNF A;  2F0Q A;  3OYY A;  3S16 H;  4EQO A;  3GV8 B;  4WD3 A;  2UUA L;  1JJ2 A;  5L1I A;  3WO1 A;  2W71 A;  5ELF A;  3VYS A;  4DV1 L;  2DGY A;  4IFD G;  4X64 Q;  1TWH A;  3KJP A;  4XTC S;  2VPS A;  4RWS C;  3ER0 A;  5EAY A;  1PTO C;  4NXM L;  3N44 B;  2VUM B;  1STA A;  2XRQ D;  1HUM A;  4DR4 L;  4LF7 Q;  2E2I B;  4XT3 B;  2FFK B;  4R1J A;  3SHL A;  3RZD H;  4ECQ A;  2MCT A;  3KHG A;  5FPO A;  4RB0 A;  1VQ5 A;  2DLN A;  3H20 A;  1VBH A;  3R23 A;  3LWE A;  4IZO A;  2OTJ A;  2PZT A;  5JOB A;  5CB4 F;  4DV6 H;  1MIU A;  4DK0 A;  4DV0 L;  2E5L Q;  2E8G A;  1M90 C;  2PBZ A;  2FXQ A;  3UDX A;  1WTO A;  2CQO A;  4BA1 I;  2A69 D;  2XCA A;  1GLV A;  3ORQ A;  3RAQ A;  1HXY D;  2F0E A;  2RVL A;  1HR0 W;  5JJL A;  4PMB A;  4ED7 A;  1HNW H;  4KD3 A;  2C22 A;  1VQ9 A;  1TWC A;  1FJG H;  3RUZ A;  4ECT A;  2BQ3 A;  2CW0 C;  2ZJQ A;  4UY8 C;  1F9Q A;  2VY3 A;  3DM3 A;  3HZX A;  4JI0 H;  2JQO A;  3BVG A;  2DWC A;  5KFV A;  1OXX K;  3GTO A;  3RB0 A;  4IRD A;  1C30 A;  2KEE A;  2JA8 B;  2NU7 B;  3GTK A;  1S5B D;  4QL5 A;  1J5E Q;  1T5E A;  5KFK A;  2OTL A;  4KHZ A;  1CQF A;  2ZXO A;  4J15 A;  4QMG A;  2XWB B;  1K1S A;  3BAA A;  1Q8I A;  1L1O A;  1W96 A;  1IBM L;  4JV1 A;  1JE4 A;  3HS0 C;  4IPC A;  3L9A X;  3RUP A;  4R4O A;  1N32 L;  4EBD A;  1VQD A;  1SNP A;  3MC0 B;  4RB3 C;  2V9W A;  1BDO A;  4YWK A;  2CH4 A;  2PYK A;  4RFB A;  4JI8 Q;  2E2H B;  4DV4 H;  1QWY A;  3MZ5 A;  4A3F H;  1DIK A;  1IBK H;  2M9V A;  1AW7 A;  1STG A;  3S1M B;  1E4G T;  5KFB A;  2D9U A;  1WOC A;  1XTD A;  1NMG A;  1GYF A;  2JA6 A;  4YHH Q;  4M7E A;  4F4X A;  4GKK Q;  3DF7 A;  4HJ5 A;  1ESR A;  1AUX A;  3BU2 A;  5M5W H;  3D31 A;  3E3X A;  4DR7 L;  1ENC A;  3STB C;  2R82 A;  1TS3 A;  3CQZ H;  4EYI B;  2F0V A;  1EFW A;  1AUV A;  4ME5 A;  2VUM A;  1QVC A;  2RBM A;  2K5H A;  2E2I A;  1CFM A;  3Q8D A;  1B4O A;  5IOD A;  3OSP A;  3GTJ B;  3H4D A;  2F0D A;  5M5X B;  2YV5 A;  4UCT A;  1O78 A;  5FLM G;  2PZU A;  1W6K A;  4B3S H;  2ALZ A;  1TS4 A;  1PZI D;  2BOS A;  2KA7 A;  3Q24 A;  4I50 F;  2EY2 A;  4X62 H;  3J80 c;  4APM A;  4RUC A;  3OWF A;  4GKJ H;  4UP9 A;  5CBA E;  5C44 H;  2K28 A;  1DZ1 A;  1G2T A;  2NB0 A;  3EJI A;  2F3W A;  3J80 E;  2AQ2 B;  2CVR A;  2RDH A;  3K7A H;  2NVT B;  2W6O A;  3QOL A;  1CQI B;  5EJW A;  5EPK A;  5IGC A;  5IOC A;  3DWP A;  4Q45 A;  1VQF A;  3AU7 A;  4KJN A;  1M0W A;  4XT1 B;  5HUR A;  5BR8 H;  1IBL L;  1B44 D;  2K5W A;  3RR5 A;  3OOC A;  4HMJ A;  3SXH A;  2FKL A;  1KJ8 A;  4QCL A;  2VQE L;  5IYC G;  2F0L A;  4KI0 A;  5FO8 B;  2O03 A;  1EHI A;  4X65 Q;  2H4O A;  2UUB L;  1WTR A;  4K2L A;  2KVM A;  2P0A A;  2YL2 A;  2F0U A;  2MO0 A;  4O0A A;  1IL2 A;  3I4N B;  2HHH H;  1EUJ A;  5KGU A;  3H3V C;  3FMC A;  4YY3 L;  1PH9 A;  2E2H A;  2JP1 A;  4MTD A;  3TP5 A;  1LTL A;  2B2V C;  3PUY A;  3V05 A;  1RIP A;  2AGQ A;  1RKN A;  1ESF A;  4R4C A;  2F0W A;  2AQ3 B;  3C1F A;  5BN3 A;  3U9T A;  3EIV A;  2PQA B;  1IKL A;  2F0F A;  4BBR H;  2UXC Q;  1JIH A;  3M4Q A;  4O3R A;  1PTO D;  2AMC B;  4DR1 Q;  4FVM A;  5IYD H;  3IFD A;  1KLU D;  4J8Q A;  3EA6 A;  1G8Z D;  4MV9 A;  1U5K A;  4MTN A;  5KYI A;  4GZY C;  3F2C A;  4U7C A;  4K0K H;  1I7L A;  1VQN A;  3U50 C;  4C1N I;  3D4R A;  4A3E G;  4WJ4 A;  4JI6 H;  4HIK A;  4R8N A;  4RG1 A;  3GTJ A;  2F3I A;  3H0G H;  1VF5 C;  5DLQ E;  4YJ3 F;  2A6H C;  4RMF A;  1B7Y B;  1PYW D;  1L0X B;  1GJX A;  2FK2 A;  3PW7 A;  4ECW A;  2Q2U A;  2AHO B;  5HBR B;  2I5H A;  2VR1 A;  2VA3 A;  2CW0 D;  3VA5 A;  5JJK A;  4AIM A;  4P74 A;  4OWT B;  3SK6 A;  4BY1 H;  3JSL A;  3KYH C;  2Z6K A;  1LTS D;  4FO2 A;  1D2B A;  2ATW A;  2V59 A;  1UC8 A;  3C0F B;  1Y8N B;  4J1M A;  5J2U F;  2BE5 C;  4QWD A;  5KFM A;  5KFY A;  3CVZ A;  2PPB C;  4JI1 Q;  1VDZ A;  1GUN A;  4OWX B;  4LF5 Q;  2R8J A;  1YIJ A;  2R87 A;  2D0O A;  1EZ6 A;  5J22 A;  1GKH A;  1DOK A;  1F2L A;  1HQM C;  1C4Q A;  1NR2 A;  3J80 L;  3EVQ A;  4DNT B;  1FNW A;  4A3F B;  3OSN A;  3JZI A;  1ET9 A;  4Y7N H;  4UPA A;  3GTP H;  3MXU A;  2IPK D;  2YTX A;  1H9M A;  3AYH B;  2EYJ A;  4NXN Q;  1ROD A;  3CMA A;  4KKS A;  4I4T F;  3MAQ A;  3H91 A;  3G6E A;  4PZ6 A;  1GM5 A;  5BMV F;  3A54 A;  1RYS A;  2TSS A;  1JQY D;  1CA5 A;  2B63 H;  3MA2 B;  3UE0 A;  4B08 A;  4R7R A;  2VQF L;  2L1B A;  4A3C H;  3STB D;  3R2T A;  2W9B B;  4RNO A;  1I50 H;  1A3T A;  3BQ1 A;  5M3F G;  3G48 A;  1S5C D;  4CGY B;  1WD1 A;  3BVM A;  3J80 W;  4A3J H;  3KLS A;  4A3K H;  3DXJ C;  4HIM A;  4GOP B;  5C6A A;  3OUZ A;  3LML A;  2MP1 A;  4HQ6 A;  1A3V A;  3F2D A;  3Q23 A;  1DYQ A;  5JJZ A;  1Y1V G;  2K4K A;  4N9T A;  5LMU H;  2I5L X;  2J7Z A;  2NZ1 D;  1E4F T;  5C3X A;  2WB1 A;  4DR5 H;  4Q8F A;  5JPN C;  2ZM6 H;  4QIW E;  4X3U A;  1Z47 A;  4B9X A;  3FDS A;  1PH3 A;  4JI7 Q;  5C44 B;  3PR4 A;  3DEO A;  3FHW A;  4DNI A;  3RJ0 A;  4RGO S;  1S5E D;  4LFC H;  4KHV A;  2A8V A;  4RGT A;  1YZ6 A;  4DV6 L;  1N48 A;  3HKZ B;  5KT5 A;  2P5Z X;  1X3E A;  2RSN A;  5DGA A;  5C0X G;  1EYD A;  4ZQI A;  2DY8 A;  5EPJ A;  4OO1 G;  1IYU A;  1I3Q B;  4QWB A;  5JEA J;  1EY4 A;  4IO9 A;  1HNW L;  4EYH B;  4GLX A;  1EUC B;  1RF2 D;  3RBD A;  5KFX A;  3BYT B;  5I4D A;  1BUV T;  5KNC A;  5DLG A;  2W6Z A;  3BDL A;  2K1B A;  5FOB B;  4LUZ A;  1ILQ A;  1NMF A;  1SYF A;  4NPS A;  1SMX A;  4RZQ A;  3TQT A;  3N8D A;  2ATL A;  4JYA H;  2KJX A;  3GDE A;  3H94 A;  3LWU A;  4DUY Q;  1EY6 A;  2AUK A;  4C3I G;  3CCS A;  1JWS D;  5CAE B;  1KJQ A;  2E75 C;  2XNA C;  4AYB G;  1SFO H;  1N34 Q;  4LFB H;  1KDC A;  3Q8P B;  2KHJ A;  4PV1 C;  5IGG A;  2JEA I;  3QZ8 A;  1GUS A;  3NEN A;  4N9P A;  3M4O B;  5LL6 S;  1IYV A;  4JI2 Q;  4DV4 L;  4BBR B;  3M7G A;  4PWQ A;  2XCL A;  4BY7 H;  3A74 A;  5BPF A;  4BXX H;  2E2D C;  5JVG 3;  3BA9 A;  2CHB D;  4HIO A;  2BQR A;  5DG9 A;  5JPM C;  1KRS A;  3I4O A;  1T9H A;  4ZRZ A;  2VQD A;  4TVA B;  3K3P A;  2JSO A;  1KAW A;  4K6L A;  3I4N G;  3CQZ A;  2W9B A;  4LH6 A;  4DL4 A;  2HCC A;  3CCJ A;  1AP0 A;  4R8U A;  3DEP A;  3I56 A;  3A7L A;  5KT6 A;  3UDF A;  2VOB A;  2PW7 A;  2NTT A;  4GOP A;  5FKA C;  3W3A A;  3Q22 A;  3I4M H;  1HNZ Q;  1XNR Q;  1XMO H;  1U4R A;  2A6H D;  3F2U A;  4LNQ A;  5E4W C;  4IUU A;  2X69 A;  4DUZ Q;  3J7A K;  2F0J A;  3QWN A;  4E4T A;  2A73 B;  4RHS A;  1JOK A;  4H7B A;  2ICE C;  2EDG A;  3I2Z A;  1D5X C;  1S40 A;  5KFH A;  4BY1 B;  3JAM c;  3RGX A;  3KLR A;  3J7Y W;  5IP7 H;  4ID6 A;  4EGJ A;  3PIO A;  2D2C C;  1L2F A;  2EY5 A;  2RKS A;  4X62 L;  3JAM E;  1Y8O B;  4GN5 A;  4EQN A;  3HKZ A;  3P7J A;  2BE5 D;  3J7A F;  1HR0 H;  1T94 A;  5C3W A;  2IW3 A;  2CQY A;  3KF8 B;  3E6Z X;  4NDX A;  2M00 A; 
#chains in the Genus database with same CATH homology
 4KHP L;  3CP0 A;  1Y14 B;  2MQH A;  3T1H L;  2E2H H;  2ZJP A;  4IFD I;  1E22 A;  3ULL A;  4GS3 A;  1X6O A;  4DV4 Q;  1Q7Y C;  1N33 L;  4B3R L;  1VQA A;  1IBK Q;  2JA8 G;  4LFC L;  3PO2 H;  2QGQ A;  3S1M H;  5M3M H;  3BZK A;  3RLF A;  5IP7 G;  3DLL A;  2YTY A;  3S17 H;  4A3B H;  1YHQ A;  2Q2H A;  4LF6 Q;  4DR2 L;  1TWG H;  3E9H A;  4DV5 L;  2EIF A;  3KLW A;  4AQY Q;  2CKZ B;  1TWA H;  3AQQ A;  3W1B A;  1PH7 A;  2D0P A;  3L0O A;  4BBS H;  4JOI A;  2IX1 A;  4JCV E;  3OTO Q;  4APV A;  1K8G A;  2A1A A;  1I94 L;  3GTG H;  2HHH L;  4LFA Q;  4DAY B;  2LXJ A;  3BZC A;  4JC0 A;  3CC2 A;  4DV2 Q;  3RN5 A;  1B70 B;  3PO2 G;  1JMC A;  2PNH A;  3FKI H;  1ASZ A;  5M3M G;  1A8V A;  5AJ3 L;  4JYA L;  4B3T Q;  3GTJ H;  2IHE A;  2JA9 A;  2RHQ B;  2C35 B;  1PFS A;  5M5X H;  1X9N A;  3U4V A;  4UP8 A;  3H15 A;  4X64 L;  4A3B G;  4PMW A;  4GNX B;  2UXD L;  1EIF A;  4P72 A;  1PH4 A;  4TQU S;  2KHI A;  1SE8 A;  4GLV B;  3S15 H;  4BBS G;  4LF7 L;  1QZH A;  4X62 Q;  5ELO A;  1MKH A;  4R4T A;  2WP8 J;  2IT1 A;  5IE8 A;  4GKJ Q;  4JI3 L;  1FL0 A;  1NBW A;  4JBK A;  2UU9 Q;  3CF5 A;  2PMZ E;  2UXC L;  1KL9 A;  2NZH A;  2I0Q A;  4K0K L;  4DR1 L;  2NVT H;  1EIY B;  4JV5 Q;  3FKI G;  4MNO A;  3UDG A;  1BKB A;  2MNA A;  3T1H Q;  2HT1 A;  4KHP Q;  1VQO A;  1P8L A;  2E5L L;  1N33 Q;  3UE1 A;  3TQY A;  4B3R Q;  4JI6 L;  1Q1B A;  3D0F A;  2NVX H;  5BR8 Q;  1E3P A;  5C0X J;  4H02 A;  3A5Z B;  3A0J A;  2BH8 A;  2AWO A;  2KBN A;  3S1N H;  4DR2 Q;  5JEA G;  1I3Q H;  1XPR A;  4DV5 Q;  2JEB I;  3AFQ A;  3HFZ B;  3M9B A;  2B3G A;  3FP9 A;  4JBJ A;  4R4I A;  4GOP C;  4JI4 Q;  1D7Q A;  1PV4 A;  1WI5 A;  1CKM A;  5GAD C;  1XMO L;  1YIT A;  1SRU A;  1VS0 A;  2NVQ H;  3PUX A;  3G71 A;  4JBW A;  4DR3 L;  2ES2 A;  2JE6 I;  1HZA A;  1I94 Q;  4POF A;  3CW2 C;  1O7I A;  2HHH Q;  1YHA A;  3A5U A;  4C3J H;  1J5E L;  1K0R A;  3OYY A;  3VDY A;  3S16 H;  2N3S A;  3T1Y L;  1JJ2 A;  2UUA L;  3MEF A;  2K14 A;  3W1G A;  5AJ3 Q;  1PH2 A;  4JYA Q;  4DV1 L;  2DGY A;  5HY6 A;  1QZG A;  4IFD G;  2UXB Q;  4X64 Q;  3TS2 A;  1VQ4 A;  4JI5 Q;  3E9I A;  3PUW A;  3KJP A;  4XTC S;  2VZA A;  4C2M H;  3KFU A;  1JT8 A;  3ER0 A;  5EAY A;  4NXM L;  4JI8 L;  1UE6 A;  1G29 1;  2H5X A;  5E7N A;  4DR4 L;  4LF7 Q;  4R1J A;  1SN8 A;  2K75 A;  3PUZ A;  3JAM i;  3RZD H;  4JI3 Q;  3M4O H;  2LXK A;  3W5O A;  1IZ6 A;  1K73 C;  1W3S A;  1VQ5 A;  1GD7 A;  4K0K Q;  1UE7 A;  2WB1 E;  1X65 A;  2IX0 A;  3K80 C;  1V43 A;  4YHH L;  1MJE A;  4GKK L;  2OTJ A;  1VQH A;  1CUK A;  5IWA Q;  4LUV A;  1MIU A;  4DV0 L;  1KRT A;  2E5L Q;  2E8G A;  1M90 C;  2FXQ A;  3UDX A;  1YHB A;  2CQO A;  4BA1 I;  4JI6 Q;  3S1Q H;  4NXN L;  1KQS A;  4X66 L;  5JJL A;  1HR0 W;  4IJL A;  1KD1 C;  3MXN B;  4GNX A;  4DV3 L;  1QVF A;  1VQ9 A;  3PO3 H;  1MJC A;  4JOI C;  1E7Z A;  1X3F A;  2GVA A;  1PHJ A;  2CCZ A;  2ZJQ A;  3EN2 A;  4UY8 C;  2VY3 A;  3DM3 A;  4O2D A;  2JQO A;  5HGQ A;  3NBH B;  1AH9 A;  1OXX K;  1CKO A;  2CFM A;  1YJN A;  2R93 H;  2WB1 G;  4IOC A;  3S24 A;  5C3E H;  4DR3 Q;  3ZJY C;  2ID0 A;  1Y1W H;  3M7N A;  4GLA C;  4QL5 A;  2NN6 I;  1VQB A;  1FVI A;  1J5E Q;  2K5N A;  2OQK A;  3CPF A;  2OTL A;  2ZM6 L;  4KHZ A;  3T1Y Q;  1W2B A;  4J15 A;  2UUA Q;  2YU9 H;  1L1O A;  1UEB A;  1LM0 A;  2K52 A;  2PI2 E;  4IPC A;  4R4Q A;  4DV1 Q;  1IBM L;  4R4O A;  1XNQ L;  3PO3 G;  3S2D H;  1N32 L;  1C9O A;  2NVY H;  1VQD A;  2LSS A;  3ULP A;  1K9M C;  4YWK A;  4NXM Q;  1YVC A;  4JI8 Q;  2F4V L;  3GTM H;  4DR4 Q;  1PYS B;  2R93 G;  3CD6 A;  4A75 A;  4A3F H;  5C3E G;  1Y1W G;  1KXL A;  2KEN A;  3ICE A;  5IYB H;  4OXP A;  5C4J H;  3JC6 6;  1WOC A;  1XTD A;  1NMG A;  3RN2 A;  2I5M X;  4YHH Q;  2V1C C;  4GKK Q;  4HJ5 A;  5FLM H;  3K7U C;  5K36 G;  3BU2 A;  4X65 L;  5M5W H;  3D31 A;  1Q82 C;  3KF6 B;  3J80 i;  3STB C;  4DR7 L;  4X66 Q;  3ERS X;  3HOU H;  1B8A A;  3NEM A;  3CQZ H;  5FLX c;  3F8T A;  3PCO B;  2MFI A;  1EFW A;  4DV7 L;  3CCU A;  4IOA A;  4A3F G;  2R6G A;  1QVC A;  4QY7 A;  1WCM H;  2K5H A;  4LF9 Q;  4X6A H;  4LFB L;  5IYB G;  4LF8 L;  3Q8D A;  1I5F A;  1N36 Q;  4JBM A;  1HZ9 A;  4C3H H;  2PQA A;  5IP9 H;  2YV5 A;  2F52 A;  4JG2 A;  4OWW B;  3U4Z A;  5C4X H;  5FLM G;  4B3M Q;  4A4I A;  5LMU Q;  3GO5 A;  1NE3 A;  2YTV A;  4DR5 Q;  3OW2 A;  3PSI A;  2L15 A;  2XGT A;  2ZTD A;  3CXC A;  2Z0S A;  3J80 c;  2ZM6 Q;  3HOU G;  3GTL H;  4UP9 A;  2ALY B;  5IYC H;  5C44 H;  3G4S A;  1IBM Q;  1XNQ Q;  3J7Z C;  1K83 H;  1PA6 A;  2HIX A;  2NZO A;  1N32 Q;  1L1O B;  4DK3 C;  1NJI C;  4GN4 B;  4LFC Q;  3K7A H;  1WCM G;  4UP7 A;  1Z9F A;  3HKZ E;  2IHF A;  5ELN A;  4YCW A;  4IJH A;  3CCQ A;  4OON A;  4YCV A;  5IP9 G;  2EQS A;  3TEH B;  1VQF A;  4KLK A;  5C4X G;  4IPD A;  2ASB A;  1IBL L;  1OXU A;  2N49 A;  3RR5 A;  2Q2I A;  4YCU A;  3PIP A;  2VQE L;  1V1Q A;  5IYC G;  5C44 G;  4KI0 A;  4QJF A;  4PZ7 A;  1FGU A;  4PG3 A;  4X65 Q;  4GNX C;  2UUB L;  4QGU A;  5LMN L;  2NN6 G;  1A62 A;  1FJG L;  1JJG A;  2K5V A;  4JI0 L;  3F2B A;  4DUZ L;  2MO0 A;  1EWI A;  1OXT A;  3HKZ G;  4O0A A;  4A76 A;  4LW1 A;  1K8A C;  1IL2 A;  3TRZ A;  1EUJ A;  1Q1E A;  4YY3 L;  1PH9 A;  1CSQ A;  1R9T H;  2UXD Q;  3L2P A;  1CSP A;  3GD7 A;  1EYG A;  1HH2 P;  3K0X A;  1HR0 L;  4LFB Q;  3CCM A;  1LTL A;  3PUY A;  2KCT A;  4JI1 L;  1RIP A;  2BH2 A;  4A3D G;  1VQC A;  4A3E H;  4LF5 L;  4R4C A;  1VQG A;  4IFD J;  3PUV A;  4HJ9 A;  3EIV A;  2PQA B;  2R92 H;  1AE2 A;  2CWA A;  3HOX H;  4BBR H;  1L1O C;  2UXC Q;  4EX5 A;  3M4Q A;  3I55 A;  4A3L H;  2AMC B;  5LMN W;  1HJP A;  4DR1 Q;  5IYD H;  1AE3 A;  3J81 i;  2RF4 A;  3KDF A;  3KF6 A;  1CKN B;  1U5K A;  4MTN A;  3F2C A;  1PYB A;  5GRO A;  3PV0 A;  1IBK L;  3K81 C;  2BA1 A;  3M3Y H;  2JK8 A;  3RZO H;  1VQN A;  5JJI A;  1S72 A;  2DUD A;  3AFP A;  2D62 A;  3S1R H;  3U50 C;  1TWF H;  1L0W A;  4A3E G;  4WJ4 A;  4HIK A;  1H95 A;  3K8A A;  4RG1 A;  2QEX A;  2F3I A;  3H0G H;  2R92 G;  3HOX G;  3AEV A;  1V9P A;  5DLQ E;  4BBR G;  1QUQ B;  1PH8 A;  1IBL Q;  1XMO Q;  1OXS C;  4RMF A;  5C0X I;  4A3L G;  1YI2 A;  1B7Y B;  5IYD G;  4OO1 I;  3ULJ A;  2VQE Q;  3BJU A;  3J81 c;  2JA7 H;  2Q2U A;  1VQP A;  2AHO B;  3H3V I;  2I5H A;  2RHS B;  1LYL A;  5JJK A;  2AWN A;  4AIM A;  4P74 A;  4OWT B;  4BY1 H;  1I6H H;  3RLO A;  2RCN A;  3KYH C;  2Z6K A;  4HID A;  1EOV A;  2JA5 H;  1XMQ L;  4LUO A;  1VQK A;  3S14 H;  1X3G A;  2ATW A;  2AKW B;  4OX9 L;  2R7D A;  1YJW A;  4MZ9 A;  4YY3 Q;  1BBW A;  3H0G G;  1HR0 Q;  1E24 A;  1VQM A;  3HKS A;  4DR6 L;  4B3S L;  4JI7 L;  4JI1 Q;  4DK6 C;  4OWX B;  3RLN A;  4LF5 Q;  1X54 A;  1YIJ A;  4GKJ L;  4WJ3 M;  2D0O A;  4IPH A;  2JA7 G;  1GKH A;  1VQ8 A;  4Y52 H;  4BY1 G;  4HJ7 A;  1WFQ A;  1Q12 A;  2CWP A;  5M3F H;  1TWH H;  2JA5 G;  1A0I A;  1LUZ A;  4Y7N H;  1G51 A;  1UWV A;  4UPA A;  3GTP H;  4DV0 Q;  3CME A;  4L5T A;  2YTX A;  3AYH B;  1UE5 A;  1JB7 A;  4A93 H;  2Q2T A;  1BVS A;  3J7A 5;  3KDF B;  4NXN Q;  1IYJ B;  5BR8 L;  3CMA A;  1SRO A;  3RNU A;  4EQ5 A;  1NTG A;  1Y1V H;  3EBE A;  3G6E A;  2B29 A;  1GO3 E;  1DGS A;  2BA0 A;  4P71 A;  4PZ6 A;  4DV3 Q;  1GM5 A;  2UUC L;  3PF4 A;  1D8L A;  2B63 H;  1Q46 A;  3UE0 A;  2VQF L;  4A3C H;  1VQE A;  5GAG C;  3NEL A;  3STB D;  4JI4 L;  4POG A;  1TXY A;  3LGJ A;  1JJC B;  4LWC A;  1I50 H;  3CPW A;  1BBU A;  2QA4 A;  5IT9 c;  5M3F G;  2VW9 A;  3G48 A;  4DUY L;  1XJV A;  1OTC A;  4A3J H;  1XPU A;  3J81 j;  4A3K H;  1G6P A;  5GQO A;  1N34 L;  3HOW H;  3I7F A;  1IXR A;  4HIM A;  3HOV H;  4GOP B;  3M4P A;  5GAH C;  4A93 G;  3CCL A;  1TWC H;  3B6Y A;  1CKN A;  2JJQ A;  3F2D A;  1X56 A;  3TS0 A;  1ASY A;  1XMQ Q;  2K50 A;  3CAM A;  1Y1V G;  2K4K A;  4JI2 L;  2I5L X;  2UXB L;  4L5R C;  1SLJ A;  2WFW A;  3H3V H;  4DKA C;  5H1S E;  4JI5 L;  1M1K C;  4OX9 Q;  5IY0 A;  1E1O A;  2GVB A;  4LF4 L;  2B63 G;  3GTO H;  4A3C G;  4QIW E;  5M5Y H;  1Z47 A;  1PH3 A;  4DR6 Q;  4B3S Q;  4JI7 Q;  4A3G H;  2F4V Q;  3GTK H;  1UE1 A;  3FHW A;  1N8R C;  4DNI A;  3S2H H;  1QUQ A;  4PZ8 A;  4A3J G;  3GTQ H;  1VQ7 A;  1Q8K A;  4A3K G;  1C7Y A;  2VNU D;  1RL2 A;  2A8V A;  3TRE A;  1YZ6 A;  4DV6 L;  3HOW G;  3HOV G;  3PGZ A;  4A3D H;  4C3I H;  1X3E A;  1EQQ A;  5C0X G;  1OXV A;  1KC8 C;  4BA2 I;  1PVO A;  1PH1 A;  4OO1 G;  5IWA L;  4AYB E;  3M85 A;  5JEA J;  1HNW L;  4IO9 A;  1HNZ L;  4GLX A;  1X55 A;  1XNR L;  3WWV A;  1VQI A;  4A3M H;  3HOZ H;  1N9W A;  2OQ0 A;  4P73 A;  4HJA A;  4DR7 Q;  3SGI A;  1J6Q A;  1YEZ A;  4HJ8 A;  1GVP A;  4GN3 B;  2MO1 A;  2KCM A;  4A3G G;  3KJO A;  3CC7 A;  3E0E A;  4LUZ A;  1HNX L;  1NMF A;  4DPG A;  5FJ8 H;  4DV7 Q;  1HZB A;  4NPS A;  1KIX A;  3CCE A;  2JA6 H;  1SMX A;  2VQF Q;  4LF8 Q;  2PI2 A;  3GDE A;  4NB3 A;  1EQR A;  4DUY Q;  4A3I H;  1U0L A;  3IRB A;  3CCS A;  2N78 A;  5GAE C;  4L5S A;  2R7Z H;  3I4N H;  1HZC A;  1C0A A;  2Z6K C;  4AYB G;  1SFO H;  2N8N A;  1N34 Q;  2WAQ E;  3HOY H;  2KHJ A;  4YWM A;  1Q86 C;  2JEA I;  1WYD A;  4A3M G;  3HOZ G;  3U58 A;  2XTI A;  2VUM H;  3NEN A;  1VCI A;  2E2I H;  4JI2 Q;  4DV4 L;  2HQL A;  2UUC Q;  5FJ8 G;  2ZTC A;  4LF4 Q;  1VQJ A;  2JA6 G;  1VQ6 A;  4BY7 H;  3A74 A;  4BXX H;  3CCR A;  4HIO A;  1VQL A;  2ZTE A;  4A3I G;  1K3R A;  1YBY A;  1JE5 A;  1KRS A;  1T9H A;  3I4O A;  2E2J H;  1NY4 A;  4TVA B;  2YYZ A;  1KAW A;  4LF6 L;  3I4N G;  4P75 A;  2R7Z G;  3KOJ A;  4AQY L;  4DV6 Q;  3CCJ A;  1YNX A;  3UDI A;  2WAQ G;  2HIV A;  3CCV A;  3CC4 A;  3HOY G;  4XIG S;  3I56 A;  1KHI A;  1A63 A;  4ME3 A;  3UDF A;  3OTO L;  2EXD A;  4QQB X;  4GOP A;  2VUM G;  1YJ9 A;  1S3O A;  4LFA L;  2OCE A;  3F1Z A;  1HNW Q;  3I4M H;  1HNZ Q;  4DV2 L;  2OWO A;  2VS1 A;  2UUB Q;  1FJG Q;  4FDB A;  4AH6 A;  2Y0S E;  5LMN Q;  1P16 A;  3PF5 A;  1XNR Q;  4LNQ A;  4BY7 G;  4JI0 Q;  2R7F A;  1E1T A;  1WJJ A;  2VL6 A;  4DAM A;  4DUZ Q;  4ALP A;  4B3T L;  4BXX G;  2IY5 B;  3I2Z A;  3L7Z C;  1HNX Q;  1XPO A;  1S40 A;  1PH5 A;  1SR3 A;  2JA8 H;  3JAM c;  1PH6 A;  4LF9 L;  5IP7 H;  1N36 L;  2GN5 A;  3PIO A;  1L2F A;  4X62 L;  4GN5 A;  4IPG A;  4L5Q A;  2A19 A;  5J3B A;  2UU9 L;  4B3M L;  2ZJR A;  5LMU L;  3I4M G;  4DR5 L;  1QVG A;  1Q81 C;  3KF8 B;  2Y0S G;  4YWL A;  4JV5 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...