3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
4IJHA 3BU2A 2KHJA 3AFQA 4MZ9A 4LFAQ 2CFMA 2VY3A 1FL0A 4JI8L 2A19A 4DV4L 3OTOQ 2ZJRA 4HJ7A 3KF6B 1HZCA 3OW2A 3PF4A 5IYCH 5HY6A 1SE8A 4C3IH 4AIMA 4DR1Q 2D62A 3WWVA 4L5RC 1Q86C 2K4KA 2ZTCA 4NPSA 4YWLA 1EWIA 4BY1G 1GO3E 3L7ZC 1QZGA 2F52A 4YY3Q 1WI5A 3MEFA 3UDIA 5AJ3Q 2JA5H 4LF7Q 3HKSA 3J80i 1NMGA 3HOWG 3GTQH 4LF4L 1X9NA 4A3JG 1KD1C 3ULPA 4DUZL 1XPRA 1NJIC 1D7QA 1QUQB 4GOPC 2I0QA 4JI6Q 2GN5A 2R7DA 1V9PA 4A3GH 2R93G 1HNZQ 3KJPA 1XNRQ 3M4OH 1AE2A 5IYDG 2VW9A 4IFDI 4A3FG 2UXBL 4A3EG 3LGJA 3NEMA 4QIWE 1SN8A 2VQFL 4UP7A 2JA5G 2YTVA 4LF6Q 1XMQL 5IP7H 4GKJQ 2IX0A 1NMFA 3CCRA 5GAEC 4DR5L 4R4IA 1IBMQ 1Q8KA 2QGQA 2R92H 1NY4A 1Q1EA 1KXLA 3U4VA 4B3TQ 4O0AA 1KQSA 4OWXB 3S1RH 1N36L 4JI4Q 3ER0A 3PO3H 2UU9L 1T9HA 3A5UA 3K7AH 3J81c 2VQFQ 4GKKL 3PF5A 4OO1I 1IL2A 1EYGA 3BZCA 1B7YB 1I6HH 3L0OA 3GTOH 2BH8A 2I5MX 3H3VI 1J5EQ 1L1OA 4JI3L 1Q82C 3I4NG 1J6QA 1VQDA 4B3MQ 4DR3Q 4LF9L 1PVOA 4WJ3M 3GTPH 1X56A 4FDBA 4C3HH 1SFOH 4GN4B 1R9TH 3CCVA 4BA2I 5GROA 1IBLL 3TRZA 2ATWA 5BR8L 2OWOA 4IPCA 3J7ZC 1A63A 2R7ZH 4A3EH 1L1OC 1YNXA 2K5VA 3I4OA 1D8LA 2EIFA 2VS1A 3J81i 3I55A 4BXXH 2VNUD 3M7NA 3KFUA 4A3KH 1TWGH 1TWFH 2LXJA 3OYYA 3RR5A 4APVA 5GAGC 1K8GA 4DR1L 1WCMG 2UUBL 3U4ZA 3T1YL 2UXCL 2VL6A 4DUYL 3CP0A 4A3MG 4B3SL 2YV5A 4X64Q 2RHQB 4DR4Q 1G51A 3FP9A 4JI2Q 1N34Q 1E7ZA 4L5SA 1H95A 3TS2A 4GN5A 4AQYL 4A3BG 4NB3A 2OTJA 3F1ZA 1Q12A 5IT9c 3S17H 3RZOH 3H0GG 4IPDA 4GS3A 2VQEL 5IP7G 1Y1VH 5IY0A 1N34L 4JYAL 4K0KQ 3JAMc 5C0XG 4DR4L 1GD7A 2Q2HA 4JV5L 1NTGA 2AWOA 2I5HA 4A3FH 1CKNB 1N33L 1JE5A 1VQIA 2OQKA 3S1NH 3ULLA 2N8NA 2WFWA 5C3EG 5K36G 2R92G 2ZM6L 1K3RA 5LMNL 4DR5Q 1YHAA 2H5XA 1OXTA 1DGSA 3CMAA 4R4CA 1PH2A 1N33Q 2A1AA 2F4VL 3JC66 4LFBQ 3BJUA 2OQ0A 2PMZE 5IYBH 5C44G 3CF5A 1PH8A 2E5LQ 2VUMG 3H3VH 3S2DH 1M90C 3CCLA 4A3GG 4UY8C 1CUKA 3S2HH 2R7FA 4LFCQ 5M5WH 4X66Q 5C4JH 5C4XH 1X3FA 1A0IA 2JA8G 1YI2A 2F3IA 4A3DG 1RIPA 2ZJQA 3HOWH 4A76A 1VQ6A 1PYSB 4GOPA 2Q2TA 1S3OA 1HNWQ 2BH2A 1Y1WG 3H0GH 5ELOA 2UXDL 3PV0A 4OONA 4BY1H 3HOXH 5FJ8H 3CC4A 3TREA 2K52A 3KJOA 2JEAI 4LF6L 4A4IA 1LUZA 1KRSA 3CW2C 4XIGS 4LUOA 4YWMA 4C3JH 1K9MC 3PUYA 3UDXA 2PI2E 3CQZH 1YJNA 4DR2L 1NE3A 2K5NA 1Y1VG 1TXYA 1VQOA 1PH3A 4TVAB 4JG2A 1C9OA 4DUZQ 3U50C 1V43A 1HJPA 3M4QA 3CCUA 2MO1A 4POFA 4OWTB 3T1HQ 1I94Q 3L2PA 2BA0A 4DK3C 4DV2L 1YJWA 3K7UC 2Q2UA 3G4SA 4AQYQ 2I5LX 5M5XH 1KIXA 1O7IA 3I7FA 1B8AA 1M1KC 3E0EA 4DV6Q 3HOVG 3CCQA 2CQOA 4A3LH 1I94L 2IX1A 1HZ9A 2JE6I 3T1HL 3T1YQ 3CAMA 1VQAA 3I4NH 2CWAA 4A3JH 1FJGQ 1EUJA 5LMUQ 1A62A 1L2FA 3BZKA 3MXNB 1L0WA 3F2CA 3S16H 2RCNA 3Q8DA 4DV3Q 1VQFA 1JB7A 2HT1A 3HOVH 3NENA 3G6EA 4IPGA 4YY3L 4LNQA 3PSIA 3KOJA 4ALPA 2GVBA 5LMUL 1KHIA 2IT1A 5IWAL 4AYBE 2KENA 2N49A 4DV7Q 1Q81C 4DR3L 3M9BA 5IYCG 1PH9A 1UE7A 2PQAB 4IFDJ 1WOCA 1VQLA 3HKZE 4IJLA 3CCSA 2UXBQ 2NVTH 1OXXK 3B6YA 4KHZA 4PZ6A 3CXCA 3RZDH 1N9WA 5M3MH 4JYAQ 3CC7A 2UUBQ 5IE8A 1KAWA 4Y7NH 3K8AA 2ZM6Q 2E2JH 1SMXA 4JI3Q 1AE3A 3PO2H 3W1BA 2Y0SG 4LFBL 1X3GA 1I50H 1YVCA 1I5FA 3HOZH 3NBHB 1E1TA 4QL5A 3A5ZB 3RN5A 4BBRH 4DV1L 2WP8J 4JBKA 1QVCA 2YYZA 2CCZA 2IHFA 4DV5Q 1SRUA 3CC2A 1E1OA 5M3FH 4OX9Q 1IYJB 1FGUA 2WB1E 1HR0W 2ALYB 1KC8C 4JOIC 4DV3L 3W1GA 5GAHC 2YU9H 5AJ3L 1GKHA 1AH9A 1YBYA 2L15A 5GQOA 4DK6C 4QGUA 3W5OA 4DPGA 3D31A 4DV5L 4RG1A 1HZAA 1VS0A 1IXRA 4P75A 4JI0L 2CWPA 2PI2A 1EIYB 2JA9A 3PIPA 1K73C 3HOYG 3S15H 1Y14B 3CCJA 1WJJA 2NVXH 1J5EL 2KCTA 4JI1L 1PH5A 1U0LA 2WB1G 4LW1A 2LXKA 2F4VQ 5FLMG 4JC0A 1XPUA 4HJ5A 1X65A 4X62L 3PUWA 2E8GA 4A3CH 1LYLA 2EQSA 4QY7A 4EQ5A 2N3SA 4HJ9A 3KDFA 4GLAC 2NN6I 4DR2Q 2MQHA 1E3PA 2V1CC 4BBRG 4C2MH 1MIUA 1VQMA 1ASZA 1MKHA 2JJQA 3GTJH 3J7A5 4DR6Q 2JA7G 4DV0Q 3S1QH 4NXMQ 1LTLA 4GLXA 2LSSA 1HZBA 1WCMH 2UXCQ 1VQCA 2WAQG 1BVSA 4JBJA 1WYDA 1TWCH 4LF8L 4HIDA 3DM3A 1V1QA 3SGIA 4O2DA 4LWCA 4GNXA 4A3LG 3EN2A 4JCVE 3G48A 4BXXG 4ME3A 1K83H 1Q1BA 4NXNL 3NELA 4X65L 4H02A 2OTLA 3S1MH 2K50A 1VQEA 2VQEQ 4QQBX 3A0JA 1FJGL 1JJGA 1MJCA 4DV7L 4PMWA 2NVQH 3FKIH 5JJKA 3FKIG 2B63H 2XTIA 4A3IG 1SR3A 1VQGA 4JBWA 4DV1Q 1IBKL 1VQNA 1OXUA 3IRBA 1FVIA 2B29A 3E9IA 1PH6A 1VQKA 3CD6A 2K14A 4L5QA 1E22A 1GVPA 5GADC 1E24A 2YTYA 1Q46A 3PO3G 2R93H 4OXPA 4KI0A 1SLJA 3PCOB 4X62Q 2ES2A 4BY7H 4DAMA 4LF9Q 3A74A 5J3BA 3I4MH 2E5LL 1YITA 5FLMH 2RHSB 1OXSC 2JA7H 2IY5B 4J15A 3OTOL 3VDYA 2Y0SE 1VQ8A 5BR8Q 4DKAC 1CSPA 1PH7A 2UUCQ 1GM5A 5FLXc 1VQ7A 4TQUS 4UPAA 3CCMA 1YZ6A 1BBWA 5IP9H 3PGZA 1Q7YC 4B3TL 5H1SE 3K80C 4R4QA 1N32Q 1XJVA 1HNWL 1C7YA 4PG3A 4GNXC 2Z6KC 1QUQA 3UE1A 1VQHA 2UUCL 1A8VA 4MNOA 4B3SQ 4LF7L 3RNUA 4DV4Q 1MJEA 2Z0SA 1X6OA 1U5KA 2E2IH 2MFIA 3HOUG 3M3YH 2YTXA 4DR7Q 1EOVA 3STBD 4AYBG 2ASBA 2PQAA 5IP9G 5E7NA 4JI5L 4AH6A 1XTDA 4BY7G 4DAYB 2D0PA 1PA6A 3RLFA 1VQBA 2MNAA 4KLKA 4DV0L 3ZJYC 2UUAL 4JBMA 2JQOA 1S72A 3AFPA 1PH1A 2NZHA 3CCEA 3E9HA 4B3RQ 4A3DH 5M3FG 1EQQA 1VQ9A 4A93G 2QA4A 5C0XI 4HIMA 4GLVB 4YCUA 5IWAQ 5LMNW 1X54A 4LUVA 4DV6L 4POGA 4P72A 4JI2L 1UE5A 3RLOA 1VQ5A 4PZ8A 4P71A 4R4TA 1IBKQ 1HR0Q 3HOZG 2KHIA 4LFAL 1XNRL 1VCIA 3KLWA 1VQJA 4B3ML 5C3EH 2AMCB 1XNQQ 4LFCL 4HJ8A 1UE1A 1XMOQ 4OWWB 3TEHB 3GTLH 4X65Q 2RF4A 1L1OB 2JA6H 1I3QH 3EBEA 2MO0A 1IZ6A 2R7ZG 2UU9Q 4GKKQ 1YHQA 2NVYH 4Y52H 3RLNA 1N36Q 4BBSG 2XGTA 1CKMA 1G291 4JI6L 5LMNQ 1UWVA 2PNHA 2K75A 5DLQE 1HNXL 1JT8A 3I2ZA 3HOXG 4R4OA 3AYHB 3STBC 4GN3B 4BA1I 4DNIA 2R6GA 4KHPL 1B70B 4BBSH 5JEAJ 1JJ2A 1G6PA 4X64L 1P16A 1S40A 2E2HH 2HQLA 1W3SA 5JEAG 5IYDH 2JA8H 5C4XG 3J81j 1YJ9A 3HOYH 4YHHL 1LM0A 4LF8Q 5HGQA 3U58A 5JJIA 2HIXA 3KF6A 2B3GA 5FJ8G 2N78A 1OTCA 1KRTA 2WAQE 3CPFA 1PFSA 3AEVA 5C44H 1Y1WH 2VUMH 4LF5Q 4DR7L 1C0AA 2FXQA 4QJFA 3AQQA 1PHJA 2ID0A 1CSQA 2HHHQ 4R1JA 1TWAH 1JMCA 4DUYQ 3I4MG 3UDGA 4GOPB 1BBUA 1PH4A 4JI7Q 2CKZB 2DGYA 3F2DA 4IFDG 1XPOA 2C35B 1X55A 4IOCA 4P74A 2HHHL 1PYBA 3ERSX 5IYBG 1QZHA 2AWNA 4EX5A 4MTNA 2D0OA 4PZ7A 4UP8A 4K0KL 2DUDA 1P8LA 4YWKA 4GNXB 1N32L 1W2BA 4A75A 4DV2Q 2OCEA 4NXML 4OO1G 3JAMi 1X3EA 4LF4Q 3S14H 5M3MG 2ZTEA 3K0XA 3KF8B 1UEBA 3PUZA 3HOUH 1K8AC 4B3RL 3KYHC 4IO9A 1JJCB 4WJ4A 3M85A 1BKBA 1HNZL 3GTKH 1KL9A 4YCVA 4HIOA 3PO2G 4IOAA 3KDFB 2UUAQ 1QVFA 2HIVA 4YHHQ 2ZTDA 3DLLA 1EIFA 5C0XJ 2KBNA 2ZJPA 4A3BH 1HNXQ 3FHWA 4DR6L 3HFZB 4JI1Q 3F8TA 1YHBA 3RN2A 3M4PA 2AKWB 1SROA 3G71A 2GVAA 4RMFA 4JI4L 1K0RA 2JK8A 2IHEA 3J80c 1XNQL 4UP9A 4JI5Q 2KCMA 1XMOL 2B63G 4JOIA 4A3CG 5ELNA 4L5TA 4JI7L 3S24A 3D0FA 1IBML 2UXDQ 1Z47A 4IPHA 1WFQA 3GDEA 1HR0L 1EFWA 3CMEA 4LUZA 1HH2P 4LF5L 1CKOA 3HKZG 3K81C 1YIJA 3CPWA 1QVGA 1UE6A 1YEZA 4HIKA 2Q2IA 4A3IH 1CKNA 4JI0Q 4HJAA 1XMQQ 1ASYA 3EIVA 4GKJL 5EAYA 5JJLA 3PIOA 1N8RC 4YCWA 3UE0A 4XTCS 3ULJA 1IBLQ 4NXNQ 2JA6G 2EXDA 2JEBI 4A3MH 2A8VA 4JV5Q 2NZOA 1NBWA 4X6AH 2QEXA 2AHOB 4KHPQ 3F2BA 4A93H 3ICEA 3PUVA 4OX9L 3UDFA 2K5HA 5M5YH 1PV4A 1VQ4A 4A3KG 1OXVA 1TWHH 2Z6KA 2VZAA 3I56A 3TS0A 2BA1A 3GTMH 3H15A 3GTGH 1EQRA 1VQPA 4JI8Q 3PUXA 3TQYA 3GO5A 2NN6G 3GD7A 4P73A 4X66L 1RL2A 1Z9FA
chains in the Genus database with same CATH superfamily
2PBZA 1CFMA 4LFAQ 1EIGA 1ESRA 4DXFA 4DV4L 4DV1H 4MV1A 3RAXA 2O4XA 3H0GB 2VQEH 2BDNA 3OOCA 3OW2A 1SCUB 3K3PA 4DR1Q 3TQTA 4K2LA 1KJJA 4RA8A 4L5RC 4O3QA 1JOQA 4YWLA 5KFCA 1RKNA 3HOZB 2EYOA 4QW8A 1GO3E 3E3XA 3GTOB 4B3SH 5DG7A 3S2DB 5AJ3Q 5G3LF 2VUMB 5KFUA 3HKSA 5DM73 1NMGA 2FK3A 1D5MC 3A8KE 1TAEA 1X9NA 3JRXA 3H6MA 2V4RA 4DUZL 1XPRA 2RBMA 4GOPC 5LXTF 2I0QA 5M3FB 5DG8A 3RB6A 1I50A 2V5AA 2R7DA 4C5AA 3IKJA 2G9DA 1XNRQ 4A3FG 2W7OA 4QIWE 1SN8A 2M00A 1TIID 1IBMQ 4FF4A 2R92H 1NY4A 4YIJA 1KXLA 3U4VA 3RB4A 4O0AA 4DXGA 1B9MA 1R4PB 1KQSA 4O42A 3ER0A 5KFOA 1LT6D 3A5UA 2VQFQ 3PF5A 2XCLA 4MTEA 2ICEC 1X32A 1QJOA 2C2EA 5EKLA 4V190 2I5MX 3H3VI 1L1OA 1Q82C 1X56A 1RYSA 3WOEA 4FDBA 4RKLA 3URYA 5I6YA 1R9TH 4ED1A 1KTKA 3F2UA 4A3FB 1BCPB 4TV8F 5BR8L 4K6LA 4RAYA 2UXBH 2QDBA 1L1OC 4EYIB 3I55A 1KLGD 3HOXB 5D14A 1EZ6A 2LXJA 2F0VA 2UXCL 1PDQA 4FXGC 1D2BA 2AQ2B 2VL6A 4DUYL 2C00A 1K3BC 3ERQA 4A3MG 2IX3A 4ZOLF 2YV5A 2RHQB 4JV1A 5KT3A 4QCLA 1N34Q 1E7ZA 1H95A 4RB0A 2FLLA 2RGRA 1SDFA 4AQYL 4IQZA 2ZDGA 1QG7A 2E76C 1TVXA 1VDZA 1FNVA 4QWCA 5JQWA 3S17H 4IPDA 5IY0A 2XD4A 4K0KQ 4HNVA 4ETSA 1M8AA 1OO9B 2I5HA 4HCEA 4Y7NB 3OSNA 1FKAH 1VQIA 5ELEA 4IAJA 3X3MA 4EGVA 1B04A 4EBCA 5COYA 4PMCA 2JSOA 1YHAA 1ZQ7A 1N33Q 3CMAA 1G2TA 2A1AA 2F4VL 3JC66 4X3UA 5G3LD 2OQ0A 3OIQA 5C44G 1RJTA 4RAZA 3H3VH 3ITPA 3S2DH 3MXGA 3CCLA 4YAJB 1RF2D 4UY8C 2F0FA 4E6IA 4Q5VA 2Z6BA 5M5WH 4K2KA 4X66Q 1UAPA 5C4XH 3MHBA 3DWPA 4A3BB 2CHBD 1YI2A 4DLKA 1ZHQA 1ILQA 2Q2TA 1GSHA 3K5IA 4EEQA 4KN4C 2BH2A 4A3MB 1S0MA 2RA4A 4FO2A 2QKIC 4B3TH 4HQ6A 3KJOA 2A74C 1K83A 3P20A 1KC7A 3DM1A 2E2JB 3PUYA 2R7NA 2K5DA 4HYKA 4RFBA 3V6JA 1S0OA 1VQOA 3RUZA 2F0EA 4CKBA 1PTOC 2Q2UA 3L2PA 5KG7A 1YJWA 2YYAA 3MFGA 3G4SA 2DY7A 1KIXA 2R93A 3BVMA 1B8AA 1UEAB 3HOVG 1A2UA 1ZEQX 5FKAC 3TQ1A 3T1YQ 5KFWA 1PZJD 1EY9A 3U9TA 3I4NH 1O75A 4EYHB 3I90A 3GIKA 2G5DA 3MC0B 1GSAA 5LMUQ 3BZKA 1L2FA 3F2CA 2ZJTA 3S16H 2RCNA 4I55F 2C22A 1VQFA 1JB7A 4WD3A 2PCFB 4XQJA 3MZ5A 2C2RA 2GVBA 1H9SB 3GTOA 2N49A 4DV7Q 2YW2A 2N88A 4ZQ3A 1UE7A 2VUGA 2PQAB 2W9CB 1WOCA 3KBXA 1JOOA 1IW7D 1PRTF 1R9TA 1C30A 3RZDH 4PNYA 1BBXC 1N9WA 4JYAQ 3CC7A 4XQQA 5IE8A 5IGEA 4Y7NH 2PYKA 2YZNA 5C8YF 1LV9A 2J6SA 4MV6A 2JEIA 3C1FA 2B2VC 3A54A 5D1PA 1JICA 3RN5A 1PMRA 5BPHA 4DV1L 4DV4H 3T51B 1PTOF 1CQJB 5KNCA 3R93A 4U68A 1GUWA 5KFJA 1HFGA 1NUCA 2C5CA 2IHFA 4JI0H 3KLSA 4OX9Q 3LX0A 1IYJB 1Y8OB 4KKUA 1FGUA 2WB1E 1HR0W 3K3VA 1KC8C 2HDMA 2OEOA 4JK1C 5EPLA 3RD4A 3W1GA 5ISRA 3AMUA 5IYZF 3DEOA 2EYLA 1O7LA 5IODA 1GKHA 1AH9A 4DK6C 3D3RA 1A15A 3W5OA 4DV5L 1HZAA 2YZMA 4JI0L 2PI2A 2JA9A 1B6RA 4H7BA 1WJJA 3PW0A 2FPGB 2YRXA 2NVYA 4XYLB 3GTPA 4C1NI 5FOBB 3RMHA 1SEIA 4LW1A 2DJFC 5J1ZA 1YNJD 2K05A 3FKIB 5FLMG 4XZ3B 3GIDA 4CKEA 1KJIA 4J9SA 2E8GA 1A3VA 1HUMA 2W6MA 3R5HA 4Q44A 3MXUA 4EQ5A 4HJ9A 3KDFA 4C3HB 2O5IC 5A2QW 3RAQA 2J4XA 2MQHA 2V1CC 3TP5A 4C2MH 1MIUA 5L1JA 3I91A 1ASZA 2RKSA 4DR6Q 5C5JA 2YS6A 2R93B 4HTHA 1FR3A 2UXCQ 4A2BA 2WAQG 4HIDA 4Q0FA 4IWYA 5A2QL 3WO1A 4JCVE 2NU9B 1B4OA 1FGBD 4ME3A 1MD2D 4X65L 3S1MH 5DG9A 1DD2A 2VQEQ 3VYTA 2NVQH 3SVMA 3Q0AA 1PTOB 5JJKA 3GV6A 3S9WA 2WYOA 5EBCA 3ETJA 3OIPA 3TZDA 1VQNA 2KVMA 1AW7A 1PH6A 2FMCA 1VQKA 1BNZA 4L5QA 2CW7A 1U9RA 4ZQIA 3TZUA 2L55A 2R93H 2IMWP 1ZETA 4DAMA 3NTHA 4LF8H 4R9WA 4A93B 5FLMH 5I47A 1NAPA 3Q22A 1LTID 2F0QA 2IY5B 3VDYA 4DKAC 2EVBA 1CSPA 4R8UB 1L2ZA 1IHZA 4BS9A 2XCAA 2HHHH 3BVZA 2WINB 2W9BB 1CK1A 3CCMA 4QUFA 4I7AA 3O13A 1K8MA 1EYZA 4B3TL 2Y0SA 1M7JA 3K80C 2V59A 1K1SA 1XJVA 3V05A 4ECXA 2EYPA 3GP7A 3N44B 1ZYRC 4DV4Q 1MJEA 2A69D 1U5KA 4P2CB 4TRDA 3N42B 3M3YH 3I12A 1EWCA 1TWCB 1QNKA 3GTLB 4YHHH 1Z7TA 3RLFA 1TWHB 3P75A 1S72A 2X69A 1AUXA 2CW0D 3AFPA 3GQBA 2F4VH 5CR3A 2F0LA 3CCEA 4IZ8A 4DNTB 1IL8A 1I4QA 2F0IA 4MHEA 5C0XI 5LP6F 4UCRA 4GLVB 4YCUA 5LMNW 4CDEC 2FKLA 4BBSB 2UVRA 1BXTA 3C0FB 2F4IA 1VQ5A 1HR0Q 4P71A 3RGZA 2KHIA 5EKKA 3RZDB 1MSHA 2ATLA 4B3ML 2AMCB 1XNQQ 4LFCL 4HJ8A 4DL5A 2F0HA 2ZXOA 1L1OB 1W6KA 2HDLA 3SK8A 1IZ6A 3MWYW 2UU9Q 1BCPC 4IURA 2NVYH 2R92A 2UXCH 3IL8A 1HNXL 3GTKB 5IGCA 3I2ZA 3BDLA 3STBC 2W70A 1RYRA 2R6GA 4BBSH 2P5ZX 3RV4A 1JJ2A 3Q8SB 3E6ZX 3LMLA 3GQCA 2W8KA 5C1OA 1S40A 3KXYT 4YY3H 1L0YB 5KFEA 1GYFA 3PW5A 2KA7A 4ZLTF 1YJ9A 3HOYH 4IRCA 4C1NK 3U58A 3GIPA 1PYWD 1F2ZA 4JI5H 3KF6A 2N78A 2K32A 2WAQE 1KRTA 4Q0YA 5FPRA 3N52A 5C44H 1AP0A 2WACA 1T36A 4PWQA 2FXQA 1PHJA 3JAMW 4FBTA 1JMCA 3TSSA 3UI2A 4GOPB 4MV3A 3VMMA 3RZOB 4IFDG 4C3IG 1VF7A 2CW0C 1X55A 4ZYSA 3KHRA 3ERSX 1NSNS 2AWNA 5CV7A 4C2MB 3C3LA 2B2WC 4UP8A 4F8MA 4K0KL 4DAYA 5C3EB 4IUVA 4YWKA 1ENFA 1W2BA 1AZPA 1GUOA 2E5LH 2NB0A 2OCEA 3ND8A 4NXML 4OO1G 3S14H 1LLRD 5M3MG 2XGQA 1BCPF 2HD3A 3KYHC 4FVMA 3M85A 1BKBA 3PO2G 4YCVA 2Z1CA 1T5EA 1STAA 2UUAQ 2HIVA 4YHHQ 2K5WA 1EIHA 3J7AF 5GONF 2ZJPA 4O3OA 1SYGA 1GOZA 2PMZA 2JEFA 4ZUJA 4IRKA 3BG3A 4R8NA 1TWCA 4O3PA 4MV7A 1YHBA 3HG9A 3WDNA 3NK9A 5EWGA 1E4EA 2BR0A 1TWFB 1RODA 2FHTA 1MI2A 3SK5A 1SYCA 5IGDA 5JJZA 3J80c 4ULLA 4UP9A 2KCMA 1XMOL 4JOIA 5KFQA 4JI7L 2ZXPA 3Q2OA 2WAQB 3K5NA 3DMUA 2NUAB 1I6UA 3AU7A 4MTKA 1EFWA 3CRKC 1HH2P 2CH4W 1GUTA 2I07B 4ZK9B 1I3QB 3E5SA 2KSWA 1YIJA 2F3WA 3GIJA 3CKIB 1S4ZA 3P1HA 3CPWA 1YEZA 2Z4HA 4C3HG 1SFOB 2AQ4A 1J9OA 4X62H 4RUCA 3CQZA 4Q8FA 4ED7A 4YCWA 1BF4A 5KFSA 3UE0A 2O2LD 3ULJA 1IBLQ 2R82A 3FDTA 2G9HD 1IKLA 4X6AH 2QEXA 4KHPQ 2BDOA 3P7JA 1JB3A 2K5HA 1WCMB 1OXVA 1TWHH 2NBFA 3I56A 1IYVA 4IZOA 5DLGA 2KEDA 3EROA 2NVXB 3GTLA 4ECVA 1EU3A 1ZYRD 2IPKD 2NN6G 2NVQB 4R8IA 1OWTA 4ECSA 3KF8A 1I4PA 4U673 4P73A 3GV7B 1RL2A 1Z9FA 1PXUA 3BU2A 4KD3A 5L1LA 2BQ3A 2F0DA 3AFQA 3CVZA 2CQAA 2VY3A 2A19A 4DR4H 3OTOQ 2ZJRA 2OXPA 2EY1A 4HJ7A 3SE0A 3EFXD 3KF6B 3K6OA 5KG0A 5IYCH 5HY6A 2E2HB 4C3IH 4AIMA 1Q86C 1DIKA 4NPSA 1EWIA 1LACA 1JDEA 4RGNA 2F0SA 1UC8A 3L7ZC 4DR5H 5IGGA 3RIZA 1WTHA 3UDIA 4KKSA 2F0TA 3J80i 4LF4L 1EYCA 1EUDB 3HZXA 4A3JG 1KD1C 3ULPA 1D7QA 1QUQB 2IJ0A 4QIWA 3V96A 1V9PA 5I4DA 3M4OH 5LA6F 1AE2A 2F0JA 2VW9A 4RNNA 1A3UA 2HQEA 2QEJC 5D1OB 2MGSA 3KTMA 3NEMA 2VQFL 1SYBA 4UP7A 1D1KA 4LF6Q 1HHVA 1XMQL 4C3IB 1BOSA 3TP6A 3CCRA 4DR5L 4Q43A 2QGQA 1Q1EA 1E4EB 3KHHA 2ENBA 3J7YW 4J9OA 1GXDC 5KIXA 3HOUB 3PO3H 2E2DC 3K7AH 1ULZA 3H20A 1JX4A 4OO1I 5FLXE 4FP5D 3HBLA 3ORQA 3D4WA 2ASLA 3L0OA 4DR7H 2MJ8A 1HXYD 2BH8A 1LT4D 3VYUA 1RTOA 1J6QA 1VQDA 2AQ1B 3GTPH 2E75C 1SFOH 4XYOA 2NTSA 5M5WB 5GROA 1IBLL 3L4KA 2OWOA 3GIMA 2K5VA 4RGOS 3I4OA 5C6AA 2EIFA 3J81i 3M7NA 5DGAA 4YQWA 2EYFA 5KFTA 3RR5A 2HUGA 4DR1L 1DJRD 2PW5A 3VR5A 1LTAD 1R4QB 2UXDH 1Y1WB 2B2UC 4DR4Q 3RUPA 1G51A 5KFVA 3FP9A 4JI2Q 1WCMA 2JA6B 4GN5A 2K33A 5KFZA 3NP8A 2C9OA 4J9PA 1DOLA 4NB3A 1O7ZA 2WKDA 3F1ZA 4QMGA 3OSPA 5IT9c 1K1QA 3H0GG 1XNRH 3R8BA 4JYAL 1A3TA 3JAMc 3Q1KA 2AWOA 4RU9A 1WTQA 1CM9A 2H1EA 3KLSX 1N33L 3RBEA 1JE5A 3S1NH 3NSWA 2N8NA 2NVXA 3R5XA 2KUMA 1A6XA 4KJOA 5JVDF 3ND9A 3VPCA 3QZ7A 1DGSA 1PH2A 3J81E 2FJ2A 2KJXA 1DCZA 5BN4A 5EPKA 3BJUA 4LFBQ 4J9QA 2WAQA 2DPJA 2H4OA 2NU6B 2W6QA 1N34H 2F0KA 2UUAH 4A3GG 4LFCQ 1SYFA 2F03A 4O4IF 4O3RA 5C4JH 3J81L 5EOYA 1A0IA 4ECWA 2ICIA 1RIPA 5FPOA 2PZWA 2UUCH 4GOPA 5IGFA 1LTTD 2IWHA 3GV8B 2WV6D 1Y1WG 2M9VA 3H0GH 3VR4A 1U4LA 1V51A 3PV0A 4OONA 2WB1A 4BY1H 3M9NB 5FJ8H 1CQVA 2B2YA 3CC4A 4ECTA 4WRDA 1E2VA 1H9KA 2K52A 2BQUA 4LF5H 5KT4A 3U9OA 4A4IA 1LUZA 1KRSA 4XIGS 4LUOA 2A73B 4IUPA 2ASJA 2EZVA 2PI2E 3CQZH 4DR2L 1ZXTA 3MFIA 2K03A 2P0AA 1PH3A 1XNQH 5F9LA 3U50C 1V43A 1HJPA 1GHKA 1F9RA 4DK3C 2XC9A 5M5XH 4M1UB 3GLKA 4CJ1B 4ECQA 1M1KC 4CHTB 1TWHA 3WNZA 4A3LH 1SSOA 3KAJA 3GTMA 1RJPA 2SDFA 4GKKH 3GTGA 1B44D 1N36H 2JA8B 4DA2A 3T1HL 1M4VA 3CAMA 2CWAA 4CKCA 3I70A 4TQRA 1FJGQ 3MXNB 4QIWB 3Q8DA 4WJWA 2HT1A 3S1MB 4G3IA 3G6EA 4IPGA 4YY3L 4LNQA 1K8OA 4ALPA 3PR5B 4LMYA 2AQ3B 1PTOH 1EQTA 5IWAL 1AZQA 1ICFB 1XTCD 1CHQD 2KENA 1SMYC 1Q81C 2R8GA 2VA3A 1H9JA 5IYCG 2NUCA 5CC4A 5LHY1 5M5XB 3OMGA 1AN7A 1HNXH 3G7LA 3BA8A 3M4OB 1I7LA 2D9UA 4J9RA 1OXXK 2FINB 3B6YA 3OW7A 5M3MH 3C2PA 4F87A 1KAWA 2ZM6Q 3K8AA 1VAJA 3M4YA 3Q23A 2EJFC 3HKZA 4J9MA 4LFCH 4DK0A 1JKJB 1SMXA 4JI3Q 3J7AV 1AE3A 3PO2H 3W1BA 2Y0SG 4LMQD 3Q8QB 1X3GA 3HOZH 1O7YA 1YVCA 3NBHB 3BQ2A 4G4KA 4KY6A 3A5ZB 2RQXA 4BBRH 4JI8H 3OPOA 2WP8J 1U4PA 1ILPA 2QF7A 3MFHA 2CCZA 1HA6A 5M3FH 1Y1VB 1F2LA 4ME5A 5CV9A 2E74C 1ZHSA 2GPWA 3GV5B 5C4JB 2L9HA 4DV3L 5GAHC 1LT5D 4H44C 2BOSA 2ZDQA 1VS0A 5K5PA 1IXRA 4JI6H 3E0JA 2CWPA 1II3A 2J6TA 4QF4A 5LL6b 2JA6A 3HOYG 2V4QA 1SFOA 5EDWA 2R8HA 2LXKA 4PDBA 1MHWC 1S0NA 4GKJH 1X65A 3BYTB 3MTSA 2F0WA 2A68C 3ONAB 4NP5A 2N3SA 4GLAC 1Q3LA 5IT9L 1E3PA 4BBRG 1PRTD 2WTFA 5LL6S 5KG1A 2JA7G 4DV0Q 3KHGA 2LSSA 4LK1C 1WCMH 1IBMH 1VQCA 1GUGA 1TWCH 2F0UA 4LF8L 3JRWA 3BQ0A 2A6HD 4A3JB 3PIO3 3DM3A 1V1QA 3TP8A 1D1IA 4GNXA 4A3LG 4YBZB 3EN2A 5IT9W 5JVLA 3NXWA 2XRSD 1K83H 1Q1BA 2OTLA 1X3PA 1JJGA 1WTXA 4F7XA 1MJCA 1EZ8A 4DV7L 4PMWA 2ZT9C 3BZDB 4A3IG 2B63H 4JBWA 1IBKL 2Z9HA 4A3IB 2OF1A 3V2TA 2W6OA 3V4SA 5ELBA 1IKMA 2VR1A 4Y8VB 2K14A 1ESFA 5HBRB 1JQYD 2YCHA 1SYDA 1SLJA 4BY7H 2RGVA 4K14A 2I46A 3A74A 1WR2A 4MV8A 1YITA 2EYJA 2RHSB 1N32H 2KCNA 3M4IA 1OXSC 2JA7H 3OTOH 5DQGA 3BABA 1ZKOA 3OTOL 4MA0A 2Y0SE 1VQ8A 2R61A 4OIKA 1I6HB 1EY7A 1SE4A 4I4TF 4TV9F 3JAME 1JORA 4BBRB 3PGZA 1Q7YC 3H0GA 2X6LA 1HNWL 1C7YA 4PG3A 3N40P 3G6XA 1SNOA 2Z8LA 3UE1A 3SE7A 4MNOA 4B3SQ 5DEHA 5KFRA 1Y8PB 1JCKB 2E2IH 2MFIA 2YTXA 4DR7Q 1O78A 4AYBG 2ASBA 4DV7H 4B9WA 1XTDA 4BY7G 4DAYB 4RHSA 1VQBA 3SEBA 4KLKA 1PRTC 2JQOA 4UAIA 2YL2A 3TDQA 2GLTA 3KK7A 1PH1A 1WTPA 1E2ZA 3RBDA 4A3DH 5LMNH 2BE5D 3CRLC 4JV0A 2V58A 4IFDH 2EY5A 2F1MA 1VQ9A 1GSOA 4HN7A 1FNUA 3I73A 4LUVA 4DV6L 4P72A 4XDXA 5CGKA 1KAAA 4JI2L 2QDLA 3RLOA 4HMJA 4LFAL 1VCIA 3KLWA 1VQJA 5C3EH 2FJZA 4UCTA 4OWWB 3TEHB 2NU7B 3EVQA 1SNMA 4MN3A 4HMIA 4TSSA 2JA6H 1I3QH 1MZBA 2R7ZG 4KV6A 3T4AC 1YHQA 2EDGA 3RLNA 2DNEA 4Y52H 5FLXW 3QZ8A 2UVUA 4JI6L 2PNHA 1JT8A 2K75A 2F0GA 5DLQE 1Q90A 3HOXG 1DZ1A 4GN3B 4DNIA 4KHPL 1B70B 4DV3H 1G6PA 3M9MB 4QWAA 1RK5A 1KBLA 2JYOA 2JA8H 4E4TA 4ZUIA 4APMA 3J81j 3ORRA 5KT7A 5BN3A 3KHLA 1LM0A 5JJIA 1LTSD 1D6EC 4LF9H 1L0XB 5FJ8G 1OTCA 2DWCA 2QK4A 4RNMA 3CPFA 3MAQA 3I4MB 1C0AA 3NQTA 3OSOA 2FPIB 3CU7A 2AUKA 2N55A 2BCOA 4IUUA 2B8GA 1TKWB 2NTTA 4DUYQ 3M7GA 1S5DD 1F2MA 1PH4A 4JI7Q 2CKZB 1VMCA 2DGYA 5C3XA 3F2DA 4P74A 4PV1C 1QZHA 4MTNA 3F8NA 5I9PA 2PQEA 2SNSA 2DUDA 3R2IA 4GNXB 4DV2Q 4HNUA 5NUCA 1U4MA 3S16B 1AEXA 2FLPA 3QJYA 4B3RL 4HSPA 4CJ0B 4IO9A 1JJCB 1K83B 4K6DA 1KL9A 1QNUA 1SNCA 3T1HH 2W6ZA 1CS0A 2ZTDA 3DLLA 4A3DB 3TIIA 1CTMA 1W6JA 5C0XJ 5JOBA 1PZKD 1DV1A 3NBIA 1FJGH 4IR1A 3HFZB 4HNTA 4A3GB 3PW7A 1C48A 2AKWB 3JZIA 2NVTB 1K0RA 1LO5D 2IHEA 1XNQL 3I72A 4JI5Q 4O4LF 2JN4A 4X66H 2UXDQ 4DR2H 3GDEA 1HR0L 4TUYF 2W9AA 2B63A 4RHRA 3VYSA 4LF5L 4EVOA 3K81C 3R2TA 3JSNA 3TINA 1M0WA 1EEID 3K0YA 4ECUA 5KT2A 3GTPB 4OX9H 2XCPA 2DLNA 5A35A 1ASYA 5JJLA 4F50A 3PIOA 4AQYH 1N8RC 2D5DA 3BVGA 4XTCS 4JV5Q 1S68A 2EXDA 2JA7A 2NZOA 1NBWA 3FVQA 1SNDA 3F2BA 4DUYH 1I7NA 5KFAA 1PLFA 1GGOA 3VPBA 5J2UF 2Z6KA 2BA1A 3GTMH 4YB8B 3GTGH 3NUCA 1VQPA 3PUXA 4UFZA 2RDJA 1EY0A 1YNJC 3DWQA 4I50F 1B2TA 2B63B 2E2IA 2V4DA 4IJHA 4XQNA 3J80W 2KHJA 2CFMA 3R23A 1FL0A 4ECZA 4ZCKA 1TS2A 4G7ZC 2ALZA 1A2TA 2K04A 3T56B 1WVLA 3V6KA 1JXLA 1SE8A 3ETHA 4IUTA 3BA9A 3A55A 4RCNA 5C5MA 3WWVA 2XNAC 2K4KA 2ZTCA 4RGTA 5F2DA 2HJWA 1ENCA 1D5ZC 2PZUA 4YY3Q 4KHVA 2QCPX 5C44B 4LF7Q 4DR1H 4K5VA 4OELB 2XWJB 2DZDA 4Q45A 4CC5A 1WTVA 1EEFD 2GN5A 2LY7A 4A3GH 2R93G 1HNZQ 3PZPA 5IYDG 4IFDI 3MR3A 1WD0A 1IBLH 4A3EG 3LGJA 2JA5G 5EWFA 3BS1A 2YTVA 1SNQA 2FMMA 4GKJQ 5FLXL 2IX0A 5GAEC 4R4IA 5HV6A 4RUAA 2OH2A 4FF1A 5FO9B 4DFAA 4ME6A 4G57A 4B3TQ 2HVSA 4OWXB 1SJHD 3S1RH 4HR7A 1I94H 4I7ZC 2UU9L 1T9HA 2UVVA 1LTGD 1STHA 2IA6A 4GC7A 4ED2A 1B7YB 5FD6A 2K7VA 1SYXB 3I4NG 2ZDHA 4RWSC 3DEPA 3NWTA 4B3MQ 1G2SA 4H13C 1XMQH 5C4XB 4L8JA 3CCVA 3V4ZA 1A63A 3MXPA 4K8JA 4LJZC 4IPCA 5D3DA 2R7ZH 4A3EH 1YNXA 2VNUD 1D8LA 2VS1A 5DAUA 4UCSA 3BAAA 4LF6H 5KT5A 4YJ2F 3D6CA 2VA2A 4A3KH 3MWEA 1TWFH 3OYYA 4APVA 2UUBL 3D4DA 1K8GA 3GIQA 1EQVA 1SNPA 2L0CA 3T1YL 5F9NA 1STEA 5HGTA 3CP0A 1UNNC 1M6VA 3QR8A 4X64Q 4J6HA 4N8FA 4A3BG 1XXGA 4K5WA 3Q6SA 2OTJA 3FRPB 3RZOH 3EPIA 2K28A 2W9BA 3KALA 3Q24A 5C0XG 4DR4L 2RSOA 5C5LA 1NTGA 4ZKBB 4JV5L 2VXWA 4RZQA 3S1QB 2OQKA 3I8ZA 3OWFA 5KFLA 1UNSA 3ULLA 2B2UA 3KLRA 2WFWA 5C3EG 2JP1A 2ZM6L 1K3RA 2MUYA 1STNA 1OXTA 2RDIA 2B2TA 3QB3A 4O1NA 3IAYA 2J6UA 2PMZE 5ELFA 5IYBH 1IW7C 1PH8A 2VUMG 4O4HF 1M90C 5ELDA 4RB3C 1N48A 1CUKA 2R7FA 1S9FA 4CJ2C 3NTKA 2XRQD 1BO0A 1X3FA 4J1MA 1WTWA 2F3IA 4F88A 2XIGA 2WB1B 4LF7H 5EZYF 2R6FA 1PYSB 3DWAA 5KG4A 4N8X1 4RCOA 2FPPB 1HNWQ 3HOYB 1AUVA 5ELOA 4M7EA 3C1EA 1B3QA 1G8ZD 3HOXH 4J9NA 2UUBH 3TREA 2A6ED 3M3YB 5M3MB 5C3WA 2KCCA 1HFNA 2AGOA 2JEAI 2FB9A 4LF6L 3T5JA 3RJ0A 4YWMA 1H9RA 5CBEE 1K9MC 4FNFA 4IWXA 1NE3A 2K5NA 1SBBB 1TXYA 1VMPA 4MAMA 1C9OA 1EYAA 1PX2A 2ASDA 3CCUA 3M4QA 1FYCA 2MO1A 4OWTB 4WFN3 1I94Q 3RTXA 2R7ZB 1I4GA 1PTOD 4DV2L 2Q8IB 4AQYQ 2I5LX 2FE3A 1RHPA 1O7IA 2EYHA 5KYIA 3CCQA 2CQOA 3LP8A 2UU9H 1BXRA 4OHJA 1I94L 1RJQA 1HZ9A 1XX8A 5IGBA 2JE6I 4RB2C 4ID6A 2MCTA 3TMEA 3J80L 4A3JH 4FS1A 5D65A 1L0WA 4NXNH 1VF5C 4JPBW 1RDPD 3MR5A 3S2HB 1TY2A 1KEEA 3KOJA 4BWSC 5LMUL 3GILA 1KHIA 2IT1A 2NVYB 2RVLA 3SHLA 4HAEA 3M9BA 1I3QA 4QW9A 4K0KH 3SK4A 4KJNA 1S5ED 4KMUC 3MR2A 2JXMB 2OLSA 1VQLA 3SI8A 4IJLA 4KHZA 4PZ6A 4L1KA 3H91A 1HTPA 1B3AA 4RGMA 3GTQA 4IR9A 1PK8A 4DL6A 2CQYA 1I5FA 1BNCA 3H4BA 4CBVA 1AFPA 2X0SA 4HR7B 1QVCA 4BWGB 2YYZA 3CC2A 1E1OA 2W71A 1WH2A 5KNBA 5KFFA 2I87A 2ALYB 4JOIC 5AJ3L 2W8LA 1YBYA 2L15A 5GQOA 5I2YA 5KG2A 4P75A 2FLNA 5KFPA 1LTRD 2EYMA 3D4RA 1T3NA 3T16A 2NVXH 1J5EL 2KCTA 5KGUA 5LL6X 3D8GA 2LKVA 1PH5A 1U0LA 4KN7C 2F4VQ 5FO7B 4JC0A 1XPUA 2R7ZA 1EY8A 4B3MH 2BE5C 3PUWA 5L1KA 1Q8IA 1ET9A 1F77A 3LWBA 4N9PA 3MWDA 1LYLA 1CA5A 4HSVA 5KFNA 2NN6I 1PFBA 1SE2A 5EPJA 1MKHA 3GTJH 4J8QA 1B1ZA 2NWGA 3OUUA 2R8IA 3S1QH 1HR0H 4NXMQ 1LTLA 2RCFA 3PN1A 1JDBB 1HZBA 5M9OA 2VUMA 1Y1WA 4JBJA 2JA7B 1WYDA 5IT9E 3VPDA 4TKOB 2DN8A 3L3OC 3SGIA 1JE4A 5I2XA 4NXNL 1Y1VA 1EYDA 3NELA 2FK1A 1NCVA 3A0JA 2XWBB 1FJGL 2UVWA 1JOKA 2B2WA 5EGTA 1SMYD 3RV3A 3NTIA 3FKIG 1WSCA 3TIGA 4IRDA 4DV1Q 1LT3D 1OXUA 3K57A 3IRBA 1EL0A 2B29A 3BYYB 1TA8A 3E9IA 4IALA 4FXKC 1GVPA 5GADC 1E24A 1K28A 2YTYA 4UHVA 1Q46A 3PO3G 3RGXA 4OXPA 4DV2H 4WBNF 4KI0A 2EE1A 4FYDA 3PCOB 4X62Q 3HS0C 1LABA 4XYQA 4CDDC 3I4MH 2PZTA 5J3BA 3JSLA 4DGZA 3GTKA 2QW7A 3OWEB 5FD5A 1PH7A 4NKLA 1GM5A 1SEBD 1DM0B 5FLXc 1HA5A 4UPAA 3PMFA 1CHPD 2Z4IA 1RJRA 5LYJF 1I4RA 1BBWA 3QIAA 3VR3A 5H1SE 3K5HA 3KAKA 2KEEA 4GNXC 1QUQA 5KFHA 2Y0SB 4LF7L 4DN4M 3JAML 4F4WA 3HOUG 4EFBA 2TMPA 3N43B 1B50A 5IP9G 4AH6A 4ODGA 3NBHA 3PR4A 2D0PA 1PA6A 2MNAA 3EQLC 4JBMA 2LMCB 3OHXC 4QB4A 2NZHA 3PW4A 4Z9CB 1Y69U 1FNWA 5KNDA 2L11A 3E9HA 5L37A 4B3RQ 4UCOA 1RD9D 1GLVA 1TU2B 1RCVD 5IIFA 1SE3A 3A8IE 3H09A 3Q8RB 2B2TC 1KJ8A 4HIMA 2Q8RE 5CV6A 4DAVA 1JWSD 2D2CC 1WTOA 4JV5H 1YNND 1UE5A 2PW7A 1I4XA 4S3SA 3SK6A 4PZ8A 3HOZG 4R4TA 1IBKQ 5KFIA 5DGBA 4UDUC 3GTJB 1Z2NX 1CA6A 4G7HC 5K36H 2K5QA 1V4YA 2W57A 1JC7A 1O80A 4X3TA 1XMOQ 3FEWX 4LFAH 4NLGA 1W96A 3RB0A 3EBEA 1F2YA 3GTQB 5TSSA 4V0BA 5E4XA 4DV6H 2QILA 2XGTA 1CKMA 2M05A 5LMNQ 1UWVA 4DV5H 4ZKCB 1EHIA 3L4JA 5D3IB 1TQOA 4DR3H 3TN2A 4IHJF 1GUNA 2VPSA 5JEAJ 2KOLA 3DUZA 1P16A 5IYDH 2HGSA 4HEDA 5C4XG 5IOCA 4PMBA 1ENAA 4FXDA 1UUPA 3SR1A 4LF8Q 1RTNA 2HIXA 2B3GA 3HXLA 2R8JA 3AEVA 2JA5A 4DNRB 2VUMH 5L9XA 3H4DA 3AQQA 2WKCA 2ID0A 5C4ZA 1CSQA 2HHHQ 1TWGA 1TWAH 4FBUA 2CVRA 4MV4A 2YU9A 1HNWH 3H94A 3I4MG 1BBUA 1QOHA 2DJGC 1ONLA 2R7MA 2NYZD 4IOCA 4RB1A 3J80E 3T13A 4EX5A 2FP4B 4MA5A 2AGPA 1P8LA 1T5XD 1N32L 5JVH3 5KFBA 2KHSA 1VBHA 3A8JE 2RDGA 4KTAA 1KABA 4LF4Q 4ECRA 1HRJA 1NR4A 4FU0A 3K0XA 4U6PA 5J22A 3HOUH 3PO3B 1K8AC 4X3SA 2SCUB 2KECA 3C46A 4WJ4A 2NU8B 4IOAA 2FFKB 4J9KA 1IBKH 4CDCC 3KDFB 1R9TB 5KYLA 4XT3B 1EWHA 3RB3A 4A3BH 3A7AB 3FHWA 2A6EC 1HNXQ 1K0SA 1BGWA 3MVVA 2I8CA 2VPQA 1KJQA 2YS7A 2RSNA 4DR6L 1KDAA 3F8TA 1TS3A 3RF2A 4RNOA 4J0MA 3RN2A 5C0XH 1SROA 2CH4A 2FMAA 4RMFA 1VKZA 2JK8A 4UCUA 5H80A 2B63G 2O03A 2A68D 4CGYB 4L5TA 1C4QA 1PFMA 3D0FA 1IBML 4KK7A 1Z47A 2EJMA 4IPHA 5JUMA 1DOKA 4LUZA 4XXEA 3PVXA 2R3ZA 3HB9A 1CKOA 3HKZG 2LFNA 5EBDA 1YNNC 3W2DA 3CQZB 1UE6A 1M0TA 4J9LA 2R8KA 2KQ3A 3K58A 4JI0Q 3UQ8A 4QWDA 4F4XA 4KD4A 2XVSA 4GKJL 1EY4A 2JEBI 3HP3A 4OIJA 1C8CA 3SDZA 2MPMA 2EXZA 5ELCA 4FS2A 4A93H 3ICEA 3PUVA 2EPBA 3UDFA 3K5OA 4OX9L 3IG0A 1Z2OX 2QYZA 1E2WA 4A3KG 2VZAA 1CT1D 3TS0A 2HVRA 4YP3A 3H15A 4Q8EA 2B2YC 3TQYA 4I7HA 1V8QA 1JLLB 2W6PA 4X66L 2Q8TA 5CV4A 2YRWA 3NQIA 4MZ9A 2AGQA 4JI8L 4JI3H 3I4LA 1KNAA 1HZCA 1STYA 3NWSA 5JPNC 2PO4A 3PF4A 4EQOA 3NHHA 2D62A 5BPFA 4O2AF 2WE6A 4BY1G 3U9SA 1D5XC 1QZGA 2F52A 2ZXRA 2YZGA 1WI5A 2XIWA 3MEFA 4CDFC 2JA5H 4A2AA 4B3RH 5HURA 3HOWG 3GTQH 4DF7A 2K6AA 5KG6A 4KY5A 1NJIC 1LTBD 1TWAA 4C5CA 3T5LA 4EQPA 3IFDA 5A2QE 4JI6Q 3QWNA 3KJPA 1DYQA 3N6RA 2UXBL 1CZWA 5BR8H 5KFKA 4A3KB 5CAEB 1QE6A 5IP7H 1STBA 2EY6A 3I4NB 1NMFA 5T1IA 4KKTA 1Q8KA 4BY7B 4ZHQF 3BJYA 5E1FA 2AUJD 2F0NA 2X6GA 3GIIA 3VR6A 1N36L 1XYIA 1DV2A 4JI4Q 4GKKL 3J81c 2B8FA 1IL2A 1EYGA 3BZCA 1NNXA 3GTOH 1I6HH 1J5EQ 1BCPD 4JI3L 1I4HA 1QWYA 1PVOA 4LF9L 4DR3Q 4WJ3M 4O3NA 4FM9A 4B08A 3SXHA 4C3HH 5KFMA 4GN4B 4BA2I 2IBKA 3TRZA 2ATWA 3J7ZC 3G8CA 4YR2A 4BXXH 2E2IB 3DXJC 1N56A 3T5KA 3KFUA 4KHPH 1JR0D 4DUZH 2AU0A 1TWGH 5GAGC 3QO2A 1WCMG 4X3KA 5EWEA 3U4ZA 2R7KA 3GTJA 4RKBA 4B3SL 4AYBA 1H9SA 1G6ZA 1B9NA 4ZI7F 2K1BA 4L5SA 3TS2A 4ABNA 2IP4A 1Q12A 2M2LA 4EGQA 2EOTA 4GS3A 2VQEL 5IP7G 1Y1VH 1N34L 2L1BA 1GD7A 2Q2HA 4JI2H 3K5LA 4A3FH 4JUZA 2DNCA 1CKNB 1W93A 1SYEA 2RDHA 1XDNA 3OMCA 2A69C 1G91A 2B2VA 3S14B 2R84A 4XYMB 4R7RA 5K36G 2R92G 3UFXB 1IOVA 4M9UA 5LMNL 4DR5Q 2H5XA 4ZRZA 4R4CA 2BQRA 3K7AB 3LWEA 1E4FT 3X3NA 5JAVA 1I50B 2E5LQ 3CF5A 5KFGA 5KT6A 4DR6H 3TP7A 3S2HH 1CE8A 5CMDA 3VA5A 4AYBB 1EZ1A 4C2MA 2GA4B 3H3VC 2IL8A 2VB3X 2JA8G 5KX5F 5CYUA 2PPBC 4A3DG 2ZJQA 3HOWH 3EYYA 4TQSA 5BN5A 1STGA 4O3SA 4A76A 1VQ6A 2PMZB 1S3OA 3L9AX 4RH6A 2LS01 1S10A 1EUCB 4I65A 3QFFA 1Z6HA 2UXDL 2FK2A 4MV9A 2V9WA 2JEGA 3HEJA 3ZYYX 2VQDA 5I6WA 4G7OC 1MBYA 4C3JH 3CW2C 3MEHA 1GUSA 3UDXA 2K01A 1YJNA 1ET6A 1Y1VG 4TVAB 4JG2A 4DUZQ 3T1HQ 1S03G 1GJXA 4POFA 4JI4H 4OGQC 2BA0A 1S5FD 3K7UC 3OHBA 4L6TB 5T14A 5KKNB 1PZID 3I7FA 1EU4A 3E0EA 4DV6Q 4LH7A 1DONA 2IX1A 3WO0A 3MXNA 4DL7A 4DL3A 1VQAA 1HNZH 1EUJA 1TWGB 1A62A 1I6VC 3LNNA 3FDSA 5AFWA 3BQ1A 1TWAB 1V1PB 4DV3Q 3S1RB 3HOVH 1HPCA 1KJ9A 3NENA 1Z2PX 2VQFH 4JV2A 2JA5B 1KDBA 3PSIA 5FK9C 3M9OB 4ED3A 4AYBE 1EFID 4YR3A 3G6VA 4IUQA 4UCVA 2VB2X 4DR3L 1BJTA 1VBGA 4JW0A 1PH9A 4LF4H 3AB9A 4IFDJ 4IN3A 2J7ZA 4XT1B 3HKZE 4FF3A 3CCSA 2UXBQ 2NVTH 2DPIA 3CXCA 2SOBA 2UUBQ 5C4HA 4BY1B 2A5HA 1ICWA 2MHVA 2E2JH 3VR2A 1TWFA 3V6HA 4LFBL 2F3VA 1WTRA 1I50H 3HOVB 1FD7D 5JH7F 1E1TA 2L12A 4QL5A 3PO2B 4RAUC 2VOBA 1E4GT 3NE5B 2I80A 4JBKA 4LSAA 4DV5Q 1SRUA 5E4WC 2R87A 3N6XA 4X64H 1T94A 4U7CA 2YU9H 3LWUA 4QGUA 4DPGA 2MP1A 3D31A 4RG1A 1EIYB 3PIPA 1K73C 3H40A 3S15H 1Y14B 3HRZC 3CCJA 3GTMB 2JEJA 1F9SA 4JI1L 5KFDA 2WB1G 4C3JB 1BDOA 1CI3M 4LAAA 1SXTA 3A56A 4HJ5A 3J7AK 1JIHA 4X62L 1QILA 4DAPA 4A3CH 5D1OA 2EQSA 4QY7A 2E2HA 4DR2Q 5JEAH 1VQMA 4K8IA 5CORA 1F9PA 2HCCA 3HKZB 4C56C 2JJQA 5DM63 4A3EB 3J7A5 1RK6A 4EBDA 1DOMA 4CC6A 3NGDA 5JVG3 4GLXA 2WIIB 4HCSA 3OUZA 5IWAH 1BVSA 2PNRC 4NDXA 4NW2A 1KNEA 4WORA 5CB4F 5EJWA 4O2DA 4LWCA 2EY2A 4RZRA 3G48A 5CV8A 3FPUB 1WD1A 4BXXG 4EBEA 1HTLD 1A9XA 4DV0H 4H02A 2K50A 1VQEA 4QQBX 3OHAA 4OO1H 4EGJA 3MA2B 3FKIH 3MJFA 2XTIA 5CV5A 1SR3A 1VQGA 3N41B 2W7PA 1KLUD 3PW2A 4ED8A 3QG1A 1FVIA 4ED0A 3MWMA 2CZGA 3FPPA 4EQNA 4OL7A 3CD6A 3S1NB 2W6NA 1E22A 4EEYA 5BMVF 1EOTA 4ZAIA 3WOFA 4NXMH 4K5XA 2ES2A 3R3OA 4LF9Q 2E5LL 1TR5A 4C5BA 4IUNA 4J15A 4MTDA 5BR8Q 2UUCQ 1AN8A 1B33N 1VQ7A 4TQUS 1YZ6A 4QUCA 1TT2A 5IP9H 3EJIA 4R4QA 1N32Q 2O5JC 5CA0F 2RDFA 3RFCA 2Z6KC 5DNFA 2SNMA 3IN5A 1VQHA 2L5TA 2UUCL 1A8VA 3RNUA 1BUVT 2Z0SA 1X6OA 1HUNA 1Y8NB 4C3JG 1EOVA 3STBD 4GC6A 5K2MA 2PQAA 2PVPA 1J5EH 5E7NA 4JI5L 3KUPA 5KFXA 4DV0L 3QOJA 3ZJYC 2UUAL 4M8AA 5EQ0A 2R86A 4EG0A 3N8DA 1BR9A 1TY0A 1CQIB 3G6YA 1EY6A 3D6WA 5T1GA 5CA1F 4YAKB 1HQMC 5KFYA 3HGBA 1CQFA 5M3FG 5KG5A 1EQQA 4A93G 2QA4A 3TBIB 5IWAQ 4MIUA 1N33H 1X54A 3HOWB 4POGA 1MSGA 2HCIA 5L1IA 4L63B 4JYAH 1HCZA 1XNRL 3BG5A 1NR2A 2B39A 1UE1A 3GTLH 4X65Q 2RF4A 4JI1H 2L4NA 3EPGA 2MO0A 4GKKQ 4YJ3F 1N36Q 4EFEA 2EJGC 3K5MA 4BBSG 1G291 5I9OA 1C3OA 4R4OA 3AYHB 4BA1I 4F4ZA 5CBAE 5LMUH 1UC9A 5KRUA 4X64L 3KBGA 2E2HH 2HQLA 1W3SA 5JEAG 1E0BA 4PQXA 1GHJA 2R7LA 3W3AA 1XWEA 2GPSA 4YHHL 3Q8PB 5HGQA 1QB5D 3J81W 1PFSA 4OEMB 3FMAA 1Y1WH 4DR7L 4LF5Q 4LFBH 4QJFA 3I3CA 1V1OA 4R1JA 2R85A 4JVZA 3UDGA 1SJED 4O2BF 4QWEA 3A7LA 5JPMC 3VA7A 3R5FA 2W9CA 1JWUD 4ECYA 4B9XA 1XPOA 2C35B 3VYRA 3DF7A 2HHHL 1PYBA 3FKIA 2J0TD 5IYBG 2DY8A 5DLFA 4F4YA 1BQQT 2D0OA 4PZ7A 1IYUA 1HQRD 4A75A 5EKIA 2TSSA 1PFNA 3JAMi 1X3EA 2NN6H 3G6JB 2C28A 4KY7A 2ZTEA 3KF8B 1UEBA 3PUZA 3GTGB 2J9GA 5J2TF 4ED6A 5FO8B 4ILWA 3BDOA 1HNZL 3GTKH 1IOWA 4HIOA 2PN1A 5LOVF 1QVFA 5E3FA 1X3QA 3BDCA 1EIFA 1S5CD 1CZGA 2KBNA 3MFYA 3E5NA 4R8UA 4DL4A 3PIP3 2YU9B 3CHBD 4QWBA 4LSXA 4JI1Q 4X65H 1S97A 4XX0B 3M4PA 3G71A 2WDTA 4JI4L 2F0MA 1QCBD 2GVAA 3FMCA 3EA6A 4N9TA 2C2DA 1U4RA 4A3CG 3DHQA 5ELNA 1V1PA 3S24A 2OT2A 2ZM6H 3S15B 5M5YB 2R92B 1WFQA 2SEBD 2HVQA 3CMEA 1JWMD 1B6SA 5D8DA 3T5HA 3K59A 3T53B 4DU9A 4DL2A 5DQIA 2CW8A 1QVGA 1MGSA 4HIKA 2Q2IA 4H0LC 4DK1A 4A3IH 1F9QA 1CKNA 1SAPA 4NMZA 4HJAA 5DQHA 1XMQQ 3EIVA 4FF2A 5EAYA 2IW3A 4YR0A 2A6HC 2XN9C 2XGPA 1B53A 2NZ1D 4NXNQ 1KDCA 2JA6G 4A3MH 2A8VA 1PRTB 2XSCA 1J8IA 2AHOB 2F0OA 3IFTA 4GZYC 3QOLA 3MR6A 3T1YH 1PV4A 5M5YH 5KG3A 1VQ4A 4LH6A 5KEEA 3PQIA 1TS5A 2F0PA 1EY5A 1H9MA 5C1PA 1EQRA 4JI8Q 5J39A 1DXMA 3GO5A 1ML0D 1S5BD 3S17B 3GD7A 3NPPA 4JI7H 2DIKA 3GV3A 1TS4A 1XMOH
chains in the Genus database with same CATH topology
4IJHA 3BU2A 2KHJA 3AFQA 4MZ9A 4LFAQ 2CFMA 2VY3A 1FL0A 4JI8L 2A19A 4DV4L 3OTOQ 2ZJRA 4HJ7A 3KF6B 1HZCA 3OW2A 3PF4A 5IYCH 5HY6A 1SE8A 4C3IH 4AIMA 4DR1Q 2D62A 3WWVA 4L5RC 1Q86C 2K4KA 2ZTCA 4NPSA 4YWLA 1EWIA 4BY1G 1GO3E 3L7ZC 1QZGA 2F52A 4YY3Q 1WI5A 3MEFA 3UDIA 5AJ3Q 2JA5H 4LF7Q 3HKSA 3J80i 1NMGA 3HOWG 3GTQH 4LF4L 1X9NA 4A3JG 1KD1C 3ULPA 4DUZL 1XPRA 1NJIC 1D7QA 1QUQB 4GOPC 2I0QA 4JI6Q 2GN5A 2R7DA 1V9PA 4A3GH 2R93G 1HNZQ 3KJPA 1XNRQ 3M4OH 1AE2A 5IYDG 2VW9A 4IFDI 4A3FG 2UXBL 4A3EG 3LGJA 3NEMA 4QIWE 1SN8A 2VQFL 4UP7A 2JA5G 2YTVA 4LF6Q 1XMQL 5IP7H 4GKJQ 2IX0A 1NMFA 3CCRA 5GAEC 4DR5L 4R4IA 1IBMQ 1Q8KA 2QGQA 2R92H 1NY4A 1Q1EA 1KXLA 3U4VA 4B3TQ 4O0AA 1KQSA 4OWXB 3S1RH 1N36L 4JI4Q 3ER0A 3PO3H 2UU9L 1T9HA 3A5UA 3K7AH 3J81c 2VQFQ 4GKKL 3PF5A 4OO1I 1IL2A 1EYGA 3BZCA 1B7YB 1I6HH 3L0OA 3GTOH 2BH8A 2I5MX 3H3VI 1J5EQ 1L1OA 4JI3L 1Q82C 3I4NG 1J6QA 1VQDA 4B3MQ 4DR3Q 4LF9L 1PVOA 4WJ3M 3GTPH 1X56A 4FDBA 4C3HH 1SFOH 4GN4B 1R9TH 3CCVA 4BA2I 5GROA 1IBLL 3TRZA 2ATWA 5BR8L 2OWOA 4IPCA 3J7ZC 1A63A 2R7ZH 4A3EH 1L1OC 1YNXA 2K5VA 3I4OA 1D8LA 2EIFA 2VS1A 3J81i 3I55A 4BXXH 2VNUD 3M7NA 3KFUA 4A3KH 1TWGH 1TWFH 2LXJA 3OYYA 3RR5A 4APVA 5GAGC 1K8GA 4DR1L 1WCMG 2UUBL 3U4ZA 3T1YL 2UXCL 2VL6A 4DUYL 3CP0A 4A3MG 4B3SL 2YV5A 4X64Q 2RHQB 4DR4Q 1G51A 3FP9A 4JI2Q 1N34Q 1E7ZA 4L5SA 1H95A 3TS2A 4GN5A 4AQYL 4A3BG 4NB3A 2OTJA 3F1ZA 1Q12A 5IT9c 3S17H 3RZOH 3H0GG 4IPDA 4GS3A 2VQEL 5IP7G 1Y1VH 5IY0A 1N34L 4JYAL 4K0KQ 3JAMc 5C0XG 4DR4L 1GD7A 2Q2HA 4JV5L 1NTGA 2AWOA 2I5HA 4A3FH 1CKNB 1N33L 1JE5A 1VQIA 2OQKA 3S1NH 3ULLA 2N8NA 2WFWA 5C3EG 5K36G 2R92G 2ZM6L 1K3RA 5LMNL 4DR5Q 1YHAA 2H5XA 1OXTA 1DGSA 3CMAA 4R4CA 1PH2A 1N33Q 2A1AA 2F4VL 3JC66 4LFBQ 3BJUA 2OQ0A 2PMZE 5IYBH 5C44G 3CF5A 1PH8A 2E5LQ 2VUMG 3H3VH 3S2DH 1M90C 3CCLA 4A3GG 4UY8C 1CUKA 3S2HH 2R7FA 4LFCQ 5M5WH 4X66Q 5C4JH 5C4XH 1X3FA 1A0IA 2JA8G 1YI2A 2F3IA 4A3DG 1RIPA 2ZJQA 3HOWH 4A76A 1VQ6A 1PYSB 4GOPA 2Q2TA 1S3OA 1HNWQ 2BH2A 1Y1WG 3H0GH 5ELOA 2UXDL 3PV0A 4OONA 4BY1H 3HOXH 5FJ8H 3CC4A 3TREA 2K52A 3KJOA 2JEAI 4LF6L 4A4IA 1LUZA 1KRSA 3CW2C 4XIGS 4LUOA 4YWMA 4C3JH 1K9MC 3PUYA 3UDXA 2PI2E 3CQZH 1YJNA 4DR2L 1NE3A 2K5NA 1Y1VG 1TXYA 1VQOA 1PH3A 4TVAB 4JG2A 1C9OA 4DUZQ 3U50C 1V43A 1HJPA 3M4QA 3CCUA 2MO1A 4POFA 4OWTB 3T1HQ 1I94Q 3L2PA 2BA0A 4DK3C 4DV2L 1YJWA 3K7UC 2Q2UA 3G4SA 4AQYQ 2I5LX 5M5XH 1KIXA 1O7IA 3I7FA 1B8AA 1M1KC 3E0EA 4DV6Q 3HOVG 3CCQA 2CQOA 4A3LH 1I94L 2IX1A 1HZ9A 2JE6I 3T1HL 3T1YQ 3CAMA 1VQAA 3I4NH 2CWAA 4A3JH 1FJGQ 1EUJA 5LMUQ 1A62A 1L2FA 3BZKA 3MXNB 1L0WA 3F2CA 3S16H 2RCNA 3Q8DA 4DV3Q 1VQFA 1JB7A 2HT1A 3HOVH 3NENA 3G6EA 4IPGA 4YY3L 4LNQA 3PSIA 3KOJA 4ALPA 2GVBA 5LMUL 1KHIA 2IT1A 5IWAL 4AYBE 2KENA 2N49A 4DV7Q 1Q81C 4DR3L 3M9BA 5IYCG 1PH9A 1UE7A 2PQAB 4IFDJ 1WOCA 1VQLA 3HKZE 4IJLA 3CCSA 2UXBQ 2NVTH 1OXXK 3B6YA 4KHZA 4PZ6A 3CXCA 3RZDH 1N9WA 5M3MH 4JYAQ 3CC7A 2UUBQ 5IE8A 1KAWA 4Y7NH 3K8AA 2ZM6Q 2E2JH 1SMXA 4JI3Q 1AE3A 3PO2H 3W1BA 2Y0SG 4LFBL 1X3GA 1I50H 1YVCA 1I5FA 3HOZH 3NBHB 1E1TA 4QL5A 3A5ZB 3RN5A 4BBRH 4DV1L 2WP8J 4JBKA 1QVCA 2YYZA 2CCZA 2IHFA 4DV5Q 1SRUA 3CC2A 1E1OA 5M3FH 4OX9Q 1IYJB 1FGUA 2WB1E 1HR0W 2ALYB 1KC8C 4JOIC 4DV3L 3W1GA 5GAHC 2YU9H 5AJ3L 1GKHA 1AH9A 1YBYA 2L15A 5GQOA 4DK6C 4QGUA 3W5OA 4DPGA 3D31A 4DV5L 4RG1A 1HZAA 1VS0A 1IXRA 4P75A 4JI0L 2CWPA 2PI2A 1EIYB 2JA9A 3PIPA 1K73C 3HOYG 3S15H 1Y14B 3CCJA 1WJJA 2NVXH 1J5EL 2KCTA 4JI1L 1PH5A 1U0LA 2WB1G 4LW1A 2LXKA 2F4VQ 5FLMG 4JC0A 1XPUA 4HJ5A 1X65A 4X62L 3PUWA 2E8GA 4A3CH 1LYLA 2EQSA 4QY7A 4EQ5A 2N3SA 4HJ9A 3KDFA 4GLAC 2NN6I 4DR2Q 2MQHA 1E3PA 2V1CC 4BBRG 4C2MH 1MIUA 1VQMA 1ASZA 1MKHA 2JJQA 3GTJH 3J7A5 4DR6Q 2JA7G 4DV0Q 3S1QH 4NXMQ 1LTLA 4GLXA 2LSSA 1HZBA 1WCMH 2UXCQ 1VQCA 2WAQG 1BVSA 4JBJA 1WYDA 1TWCH 4LF8L 4HIDA 3DM3A 1V1QA 3SGIA 4O2DA 4LWCA 4GNXA 4A3LG 3EN2A 4JCVE 3G48A 4BXXG 4ME3A 1K83H 1Q1BA 4NXNL 3NELA 4X65L 4H02A 2OTLA 3S1MH 2K50A 1VQEA 2VQEQ 4QQBX 3A0JA 1FJGL 1JJGA 1MJCA 4DV7L 4PMWA 2NVQH 3FKIH 5JJKA 3FKIG 2B63H 2XTIA 4A3IG 1SR3A 1VQGA 4JBWA 4DV1Q 1IBKL 1VQNA 1OXUA 3IRBA 1FVIA 2B29A 3E9IA 1PH6A 1VQKA 3CD6A 2K14A 4L5QA 1E22A 1GVPA 5GADC 1E24A 2YTYA 1Q46A 3PO3G 2R93H 4OXPA 4KI0A 1SLJA 3PCOB 4X62Q 2ES2A 4BY7H 4DAMA 4LF9Q 3A74A 5J3BA 3I4MH 2E5LL 1YITA 5FLMH 2RHSB 1OXSC 2JA7H 2IY5B 4J15A 3OTOL 3VDYA 2Y0SE 1VQ8A 5BR8Q 4DKAC 1CSPA 1PH7A 2UUCQ 1GM5A 5FLXc 1VQ7A 4TQUS 4UPAA 3CCMA 1YZ6A 1BBWA 5IP9H 3PGZA 1Q7YC 4B3TL 5H1SE 3K80C 4R4QA 1N32Q 1XJVA 1HNWL 1C7YA 4PG3A 4GNXC 2Z6KC 1QUQA 3UE1A 1VQHA 2UUCL 1A8VA 4MNOA 4B3SQ 4LF7L 3RNUA 4DV4Q 1MJEA 2Z0SA 1X6OA 1U5KA 2E2IH 2MFIA 3HOUG 3M3YH 2YTXA 4DR7Q 1EOVA 3STBD 4AYBG 2ASBA 2PQAA 5IP9G 5E7NA 4JI5L 4AH6A 1XTDA 4BY7G 4DAYB 2D0PA 1PA6A 3RLFA 1VQBA 2MNAA 4KLKA 4DV0L 3ZJYC 2UUAL 4JBMA 2JQOA 1S72A 3AFPA 1PH1A 2NZHA 3CCEA 3E9HA 4B3RQ 4A3DH 5M3FG 1EQQA 1VQ9A 4A93G 2QA4A 5C0XI 4HIMA 4GLVB 4YCUA 5IWAQ 5LMNW 1X54A 4LUVA 4DV6L 4POGA 4P72A 4JI2L 1UE5A 3RLOA 1VQ5A 4PZ8A 4P71A 4R4TA 1IBKQ 1HR0Q 3HOZG 2KHIA 4LFAL 1XNRL 1VCIA 3KLWA 1VQJA 4B3ML 5C3EH 2AMCB 1XNQQ 4LFCL 4HJ8A 1UE1A 1XMOQ 4OWWB 3TEHB 3GTLH 4X65Q 2RF4A 1L1OB 2JA6H 1I3QH 3EBEA 2MO0A 1IZ6A 2R7ZG 2UU9Q 4GKKQ 1YHQA 2NVYH 4Y52H 3RLNA 1N36Q 4BBSG 2XGTA 1CKMA 1G291 4JI6L 5LMNQ 1UWVA 2PNHA 2K75A 5DLQE 1HNXL 1JT8A 3I2ZA 3HOXG 4R4OA 3AYHB 3STBC 4GN3B 4BA1I 4DNIA 2R6GA 4KHPL 1B70B 4BBSH 5JEAJ 1JJ2A 1G6PA 4X64L 1P16A 1S40A 2E2HH 2HQLA 1W3SA 5JEAG 5IYDH 2JA8H 5C4XG 3J81j 1YJ9A 3HOYH 4YHHL 1LM0A 4LF8Q 5HGQA 3U58A 5JJIA 2HIXA 3KF6A 2B3GA 5FJ8G 2N78A 1OTCA 1KRTA 2WAQE 3CPFA 1PFSA 3AEVA 5C44H 1Y1WH 2VUMH 4LF5Q 4DR7L 1C0AA 2FXQA 4QJFA 3AQQA 1PHJA 2ID0A 1CSQA 2HHHQ 4R1JA 1TWAH 1JMCA 4DUYQ 3I4MG 3UDGA 4GOPB 1BBUA 1PH4A 4JI7Q 2CKZB 2DGYA 3F2DA 4IFDG 1XPOA 2C35B 1X55A 4IOCA 4P74A 2HHHL 1PYBA 3ERSX 5IYBG 1QZHA 2AWNA 4EX5A 4MTNA 2D0OA 4PZ7A 4UP8A 4K0KL 2DUDA 1P8LA 4YWKA 4GNXB 1N32L 1W2BA 4A75A 4DV2Q 2OCEA 4NXML 4OO1G 3JAMi 1X3EA 4LF4Q 3S14H 5M3MG 2ZTEA 3K0XA 3KF8B 1UEBA 3PUZA 3HOUH 1K8AC 4B3RL 3KYHC 4IO9A 1JJCB 4WJ4A 3M85A 1BKBA 1HNZL 3GTKH 1KL9A 4YCVA 4HIOA 3PO2G 4IOAA 3KDFB 2UUAQ 1QVFA 2HIVA 4YHHQ 2ZTDA 3DLLA 1EIFA 5C0XJ 2KBNA 2ZJPA 4A3BH 1HNXQ 3FHWA 4DR6L 3HFZB 4JI1Q 3F8TA 1YHBA 3RN2A 3M4PA 2AKWB 1SROA 3G71A 2GVAA 4RMFA 4JI4L 1K0RA 2JK8A 2IHEA 3J80c 1XNQL 4UP9A 4JI5Q 2KCMA 1XMOL 2B63G 4JOIA 4A3CG 5ELNA 4L5TA 4JI7L 3S24A 3D0FA 1IBML 2UXDQ 1Z47A 4IPHA 1WFQA 3GDEA 1HR0L 1EFWA 3CMEA 4LUZA 1HH2P 4LF5L 1CKOA 3HKZG 3K81C 1YIJA 3CPWA 1QVGA 1UE6A 1YEZA 4HIKA 2Q2IA 4A3IH 1CKNA 4JI0Q 4HJAA 1XMQQ 1ASYA 3EIVA 4GKJL 5EAYA 5JJLA 3PIOA 1N8RC 4YCWA 3UE0A 4XTCS 3ULJA 1IBLQ 4NXNQ 2JA6G 2EXDA 2JEBI 4A3MH 2A8VA 4JV5Q 2NZOA 1NBWA 4X6AH 2QEXA 2AHOB 4KHPQ 3F2BA 4A93H 3ICEA 3PUVA 4OX9L 3UDFA 2K5HA 5M5YH 1PV4A 1VQ4A 4A3KG 1OXVA 1TWHH 2Z6KA 2VZAA 3I56A 3TS0A 2BA1A 3GTMH 3H15A 3GTGH 1EQRA 1VQPA 4JI8Q 3PUXA 3TQYA 3GO5A 2NN6G 3GD7A 4P73A 4X66L 1RL2A 1Z9FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJH A;  3BU2 A;  2KHJ A;  3AFQ A;  4MZ9 A;  4LFA Q;  2CFM A;  2VY3 A;  1FL0 A;  4JI8 L;  2A19 A;  4DV4 L;  3OTO Q;  2ZJR A;  4HJ7 A;  3KF6 B;  1HZC A;  3OW2 A;  3PF4 A;  5IYC H;  5HY6 A;  1SE8 A;  4C3I H;  4AIM A;  4DR1 Q;  2D62 A;  3WWV A;  4L5R C;  1Q86 C;  2K4K A;  2ZTC A;  4NPS A;  4YWL A;  1EWI A;  4BY1 G;  1GO3 E;  3L7Z C;  1QZG A;  2F52 A;  4YY3 Q;  1WI5 A;  3MEF A;  3UDI A;  5AJ3 Q;  2JA5 H;  4LF7 Q;  3HKS A;  3J80 i;  1NMG A;  3HOW G;  3GTQ H;  4LF4 L;  1X9N A;  4A3J G;  1KD1 C;  3ULP A;  4DUZ L;  1XPR A;  1NJI C;  1D7Q A;  1QUQ B;  4GOP C;  2I0Q A;  4JI6 Q;  2GN5 A;  2R7D A;  1V9P A;  4A3G H;  2R93 G;  1HNZ Q;  3KJP A;  1XNR Q;  3M4O H;  1AE2 A;  5IYD G;  2VW9 A;  4IFD I;  4A3F G;  2UXB L;  4A3E G;  3LGJ A;  3NEM A;  4QIW E;  1SN8 A;  2VQF L;  4UP7 A;  2JA5 G;  2YTV A;  4LF6 Q;  1XMQ L;  5IP7 H;  4GKJ Q;  2IX0 A;  1NMF A;  3CCR A;  5GAE C;  4DR5 L;  4R4I A;  1IBM Q;  1Q8K A;  2QGQ A;  2R92 H;  1NY4 A;  1Q1E A;  1KXL A;  3U4V A;  4B3T Q;  4O0A A;  1KQS A;  4OWX B;  3S1R H;  1N36 L;  4JI4 Q;  3ER0 A;  3PO3 H;  2UU9 L;  1T9H A;  3A5U A;  3K7A H;  3J81 c;  2VQF Q;  4GKK L;  3PF5 A;  4OO1 I;  1IL2 A;  1EYG A;  3BZC A;  1B7Y B;  1I6H H;  3L0O A;  3GTO H;  2BH8 A;  2I5M X;  3H3V I;  1J5E Q;  1L1O A;  4JI3 L;  1Q82 C;  3I4N G;  1J6Q A;  1VQD A;  4B3M Q;  4DR3 Q;  4LF9 L;  1PVO A;  4WJ3 M;  3GTP H;  1X56 A;  4FDB A;  4C3H H;  1SFO H;  4GN4 B;  1R9T H;  3CCV A;  4BA2 I;  5GRO A;  1IBL L;  3TRZ A;  2ATW A;  5BR8 L;  2OWO A;  4IPC A;  3J7Z C;  1A63 A;  2R7Z H;  4A3E H;  1L1O C;  1YNX A;  2K5V A;  3I4O A;  1D8L A;  2EIF A;  2VS1 A;  3J81 i;  3I55 A;  4BXX H;  2VNU D;  3M7N A;  3KFU A;  4A3K H;  1TWG H;  1TWF H;  2LXJ A;  3OYY A;  3RR5 A;  4APV A;  5GAG C;  1K8G A;  4DR1 L;  1WCM G;  2UUB L;  3U4Z A;  3T1Y L;  2UXC L;  2VL6 A;  4DUY L;  3CP0 A;  4A3M G;  4B3S L;  2YV5 A;  4X64 Q;  2RHQ B;  4DR4 Q;  1G51 A;  3FP9 A;  4JI2 Q;  1N34 Q;  1E7Z A;  4L5S A;  1H95 A;  3TS2 A;  4GN5 A;  4AQY L;  4A3B G;  4NB3 A;  2OTJ A;  3F1Z A;  1Q12 A;  5IT9 c;  3S17 H;  3RZO H;  3H0G G;  4IPD A;  4GS3 A;  2VQE L;  5IP7 G;  1Y1V H;  5IY0 A;  1N34 L;  4JYA L;  4K0K Q;  3JAM c;  5C0X G;  4DR4 L;  1GD7 A;  2Q2H A;  4JV5 L;  1NTG A;  2AWO A;  2I5H A;  4A3F H;  1CKN B;  1N33 L;  1JE5 A;  1VQI A;  2OQK A;  3S1N H;  3ULL A;  2N8N A;  2WFW A;  5C3E G;  5K36 G;  2R92 G;  2ZM6 L;  1K3R A;  5LMN L;  4DR5 Q;  1YHA A;  2H5X A;  1OXT A;  1DGS A;  3CMA A;  4R4C A;  1PH2 A;  1N33 Q;  2A1A A;  2F4V L;  3JC6 6;  4LFB Q;  3BJU A;  2OQ0 A;  2PMZ E;  5IYB H;  5C44 G;  3CF5 A;  1PH8 A;  2E5L Q;  2VUM G;  3H3V H;  3S2D H;  1M90 C;  3CCL A;  4A3G G;  4UY8 C;  1CUK A;  3S2H H;  2R7F A;  4LFC Q;  5M5W H;  4X66 Q;  5C4J H;  5C4X H;  1X3F A;  1A0I A;  2JA8 G;  1YI2 A;  2F3I A;  4A3D G;  1RIP A;  2ZJQ A;  3HOW H;  4A76 A;  1VQ6 A;  1PYS B;  4GOP A;  2Q2T A;  1S3O A;  1HNW Q;  2BH2 A;  1Y1W G;  3H0G H;  5ELO A;  2UXD L;  3PV0 A;  4OON A;  4BY1 H;  3HOX H;  5FJ8 H;  3CC4 A;  3TRE A;  2K52 A;  3KJO A;  2JEA I;  4LF6 L;  4A4I A;  1LUZ A;  1KRS A;  3CW2 C;  4XIG S;  4LUO A;  4YWM A;  4C3J H;  1K9M C;  3PUY A;  3UDX A;  2PI2 E;  3CQZ H;  1YJN A;  4DR2 L;  1NE3 A;  2K5N A;  1Y1V G;  1TXY A;  1VQO A;  1PH3 A;  4TVA B;  4JG2 A;  1C9O A;  4DUZ Q;  3U50 C;  1V43 A;  1HJP A;  3M4Q A;  3CCU A;  2MO1 A;  4POF A;  4OWT B;  3T1H Q;  1I94 Q;  3L2P A;  2BA0 A;  4DK3 C;  4DV2 L;  1YJW A;  3K7U C;  2Q2U A;  3G4S A;  4AQY Q;  2I5L X;  5M5X H;  1KIX A;  1O7I A;  3I7F A;  1B8A A;  1M1K C;  3E0E A;  4DV6 Q;  3HOV G;  3CCQ A;  2CQO A;  4A3L H;  1I94 L;  2IX1 A;  1HZ9 A;  2JE6 I;  3T1H L;  3T1Y Q;  3CAM A;  1VQA A;  3I4N H;  2CWA A;  4A3J H;  1FJG Q;  1EUJ A;  5LMU Q;  1A62 A;  1L2F A;  3BZK A;  3MXN B;  1L0W A;  3F2C A;  3S16 H;  2RCN A;  3Q8D A;  4DV3 Q;  1VQF A;  1JB7 A;  2HT1 A;  3HOV H;  3NEN A;  3G6E A;  4IPG A;  4YY3 L;  4LNQ A;  3PSI A;  3KOJ A;  4ALP A;  2GVB A;  5LMU L;  1KHI A;  2IT1 A;  5IWA L;  4AYB E;  2KEN A;  2N49 A;  4DV7 Q;  1Q81 C;  4DR3 L;  3M9B A;  5IYC G;  1PH9 A;  1UE7 A;  2PQA B;  4IFD J;  1WOC A;  1VQL A;  3HKZ E;  4IJL A;  3CCS A;  2UXB Q;  2NVT H;  1OXX K;  3B6Y A;  4KHZ A;  4PZ6 A;  3CXC A;  3RZD H;  1N9W A;  5M3M H;  4JYA Q;  3CC7 A;  2UUB Q;  5IE8 A;  1KAW A;  4Y7N H;  3K8A A;  2ZM6 Q;  2E2J H;  1SMX A;  4JI3 Q;  1AE3 A;  3PO2 H;  3W1B A;  2Y0S G;  4LFB L;  1X3G A;  1I50 H;  1YVC A;  1I5F A;  3HOZ H;  3NBH B;  1E1T A;  4QL5 A;  3A5Z B;  3RN5 A;  4BBR H;  4DV1 L;  2WP8 J;  4JBK A;  1QVC A;  2YYZ A;  2CCZ A;  2IHF A;  4DV5 Q;  1SRU A;  3CC2 A;  1E1O A;  5M3F H;  4OX9 Q;  1IYJ B;  1FGU A;  2WB1 E;  1HR0 W;  2ALY B;  1KC8 C;  4JOI C;  4DV3 L;  3W1G A;  5GAH C;  2YU9 H;  5AJ3 L;  1GKH A;  1AH9 A;  1YBY A;  2L15 A;  5GQO A;  4DK6 C;  4QGU A;  3W5O A;  4DPG A;  3D31 A;  4DV5 L;  4RG1 A;  1HZA A;  1VS0 A;  1IXR A;  4P75 A;  4JI0 L;  2CWP A;  2PI2 A;  1EIY B;  2JA9 A;  3PIP A;  1K73 C;  3HOY G;  3S15 H;  1Y14 B;  3CCJ A;  1WJJ A;  2NVX H;  1J5E L;  2KCT A;  4JI1 L;  1PH5 A;  1U0L A;  2WB1 G;  4LW1 A;  2LXK A;  2F4V Q;  5FLM G;  4JC0 A;  1XPU A;  4HJ5 A;  1X65 A;  4X62 L;  3PUW A;  2E8G A;  4A3C H;  1LYL A;  2EQS A;  4QY7 A;  4EQ5 A;  2N3S A;  4HJ9 A;  3KDF A;  4GLA C;  2NN6 I;  4DR2 Q;  2MQH A;  1E3P A;  2V1C C;  4BBR G;  4C2M H;  1MIU A;  1VQM A;  1ASZ A;  1MKH A;  2JJQ A;  3GTJ H;  3J7A 5;  4DR6 Q;  2JA7 G;  4DV0 Q;  3S1Q H;  4NXM Q;  1LTL A;  4GLX A;  2LSS A;  1HZB A;  1WCM H;  2UXC Q;  1VQC A;  2WAQ G;  1BVS A;  4JBJ A;  1WYD A;  1TWC H;  4LF8 L;  4HID A;  3DM3 A;  1V1Q A;  3SGI A;  4O2D A;  4LWC A;  4GNX A;  4A3L G;  3EN2 A;  4JCV E;  3G48 A;  4BXX G;  4ME3 A;  1K83 H;  1Q1B A;  4NXN L;  3NEL A;  4X65 L;  4H02 A;  2OTL A;  3S1M H;  2K50 A;  1VQE A;  2VQE Q;  4QQB X;  3A0J A;  1FJG L;  1JJG A;  1MJC A;  4DV7 L;  4PMW A;  2NVQ H;  3FKI H;  5JJK A;  3FKI G;  2B63 H;  2XTI A;  4A3I G;  1SR3 A;  1VQG A;  4JBW A;  4DV1 Q;  1IBK L;  1VQN A;  1OXU A;  3IRB A;  1FVI A;  2B29 A;  3E9I A;  1PH6 A;  1VQK A;  3CD6 A;  2K14 A;  4L5Q A;  1E22 A;  1GVP A;  5GAD C;  1E24 A;  2YTY A;  1Q46 A;  3PO3 G;  2R93 H;  4OXP A;  4KI0 A;  1SLJ A;  3PCO B;  4X62 Q;  2ES2 A;  4BY7 H;  4DAM A;  4LF9 Q;  3A74 A;  5J3B A;  3I4M H;  2E5L L;  1YIT A;  5FLM H;  2RHS B;  1OXS C;  2JA7 H;  2IY5 B;  4J15 A;  3OTO L;  3VDY A;  2Y0S E;  1VQ8 A;  5BR8 Q;  4DKA C;  1CSP A;  1PH7 A;  2UUC Q;  1GM5 A;  5FLX c;  1VQ7 A;  4TQU S;  4UPA A;  3CCM A;  1YZ6 A;  1BBW A;  5IP9 H;  3PGZ A;  1Q7Y C;  4B3T L;  5H1S E;  3K80 C;  4R4Q A;  1N32 Q;  1XJV A;  1HNW L;  1C7Y A;  4PG3 A;  4GNX C;  2Z6K C;  1QUQ A;  3UE1 A;  1VQH A;  2UUC L;  1A8V A;  4MNO A;  4B3S Q;  4LF7 L;  3RNU A;  4DV4 Q;  1MJE A;  2Z0S A;  1X6O A;  1U5K A;  2E2I H;  2MFI A;  3HOU G;  3M3Y H;  2YTX A;  4DR7 Q;  1EOV A;  3STB D;  4AYB G;  2ASB A;  2PQA A;  5IP9 G;  5E7N A;  4JI5 L;  4AH6 A;  1XTD A;  4BY7 G;  4DAY B;  2D0P A;  1PA6 A;  3RLF A;  1VQB A;  2MNA A;  4KLK A;  4DV0 L;  3ZJY C;  2UUA L;  4JBM A;  2JQO A;  1S72 A;  3AFP A;  1PH1 A;  2NZH A;  3CCE A;  3E9H A;  4B3R Q;  4A3D H;  5M3F G;  1EQQ A;  1VQ9 A;  4A93 G;  2QA4 A;  5C0X I;  4HIM A;  4GLV B;  4YCU A;  5IWA Q;  5LMN W;  1X54 A;  4LUV A;  4DV6 L;  4POG A;  4P72 A;  4JI2 L;  1UE5 A;  3RLO A;  1VQ5 A;  4PZ8 A;  4P71 A;  4R4T A;  1IBK Q;  1HR0 Q;  3HOZ G;  2KHI A;  4LFA L;  1XNR L;  1VCI A;  3KLW A;  1VQJ A;  4B3M L;  5C3E H;  2AMC B;  1XNQ Q;  4LFC L;  4HJ8 A;  1UE1 A;  1XMO Q;  4OWW B;  3TEH B;  3GTL H;  4X65 Q;  2RF4 A;  1L1O B;  2JA6 H;  1I3Q H;  3EBE A;  2MO0 A;  1IZ6 A;  2R7Z G;  2UU9 Q;  4GKK Q;  1YHQ A;  2NVY H;  4Y52 H;  3RLN A;  1N36 Q;  4BBS G;  2XGT A;  1CKM A;  1G29 1;  4JI6 L;  5LMN Q;  1UWV A;  2PNH A;  2K75 A;  5DLQ E;  1HNX L;  1JT8 A;  3I2Z A;  3HOX G;  4R4O A;  3AYH B;  3STB C;  4GN3 B;  4BA1 I;  4DNI A;  2R6G A;  4KHP L;  1B70 B;  4BBS H;  5JEA J;  1JJ2 A;  1G6P A;  4X64 L;  1P16 A;  1S40 A;  2E2H H;  2HQL A;  1W3S A;  5JEA G;  5IYD H;  2JA8 H;  5C4X G;  3J81 j;  1YJ9 A;  3HOY H;  4YHH L;  1LM0 A;  4LF8 Q;  5HGQ A;  3U58 A;  5JJI A;  2HIX A;  3KF6 A;  2B3G A;  5FJ8 G;  2N78 A;  1OTC A;  1KRT A;  2WAQ E;  3CPF A;  1PFS A;  3AEV A;  5C44 H;  1Y1W H;  2VUM H;  4LF5 Q;  4DR7 L;  1C0A A;  2FXQ A;  4QJF A;  3AQQ A;  1PHJ A;  2ID0 A;  1CSQ A;  2HHH Q;  4R1J A;  1TWA H;  1JMC A;  4DUY Q;  3I4M G;  3UDG A;  4GOP B;  1BBU A;  1PH4 A;  4JI7 Q;  2CKZ B;  2DGY A;  3F2D A;  4IFD G;  1XPO A;  2C35 B;  1X55 A;  4IOC A;  4P74 A;  2HHH L;  1PYB A;  3ERS X;  5IYB G;  1QZH A;  2AWN A;  4EX5 A;  4MTN A;  2D0O A;  4PZ7 A;  4UP8 A;  4K0K L;  2DUD A;  1P8L A;  4YWK A;  4GNX B;  1N32 L;  1W2B A;  4A75 A;  4DV2 Q;  2OCE A;  4NXM L;  4OO1 G;  3JAM i;  1X3E A;  4LF4 Q;  3S14 H;  5M3M G;  2ZTE A;  3K0X A;  3KF8 B;  1UEB A;  3PUZ A;  3HOU H;  1K8A C;  4B3R L;  3KYH C;  4IO9 A;  1JJC B;  4WJ4 A;  3M85 A;  1BKB A;  1HNZ L;  3GTK H;  1KL9 A;  4YCV A;  4HIO A;  3PO2 G;  4IOA A;  3KDF B;  2UUA Q;  1QVF A;  2HIV A;  4YHH Q;  2ZTD A;  3DLL A;  1EIF A;  5C0X J;  2KBN A;  2ZJP A;  4A3B H;  1HNX Q;  3FHW A;  4DR6 L;  3HFZ B;  4JI1 Q;  3F8T A;  1YHB A;  3RN2 A;  3M4P A;  2AKW B;  1SRO A;  3G71 A;  2GVA A;  4RMF A;  4JI4 L;  1K0R A;  2JK8 A;  2IHE A;  3J80 c;  1XNQ L;  4UP9 A;  4JI5 Q;  2KCM A;  1XMO L;  2B63 G;  4JOI A;  4A3C G;  5ELN A;  4L5T A;  4JI7 L;  3S24 A;  3D0F A;  1IBM L;  2UXD Q;  1Z47 A;  4IPH A;  1WFQ A;  3GDE A;  1HR0 L;  1EFW A;  3CME A;  4LUZ A;  1HH2 P;  4LF5 L;  1CKO A;  3HKZ G;  3K81 C;  1YIJ A;  3CPW A;  1QVG A;  1UE6 A;  1YEZ A;  4HIK A;  2Q2I A;  4A3I H;  1CKN A;  4JI0 Q;  4HJA A;  1XMQ Q;  1ASY A;  3EIV A;  4GKJ L;  5EAY A;  5JJL A;  3PIO A;  1N8R C;  4YCW A;  3UE0 A;  4XTC S;  3ULJ A;  1IBL Q;  4NXN Q;  2JA6 G;  2EXD A;  2JEB I;  4A3M H;  2A8V A;  4JV5 Q;  2NZO A;  1NBW A;  4X6A H;  2QEX A;  2AHO B;  4KHP Q;  3F2B A;  4A93 H;  3ICE A;  3PUV A;  4OX9 L;  3UDF A;  2K5H A;  5M5Y H;  1PV4 A;  1VQ4 A;  4A3K G;  1OXV A;  1TWH H;  2Z6K A;  2VZA A;  3I56 A;  3TS0 A;  2BA1 A;  3GTM H;  3H15 A;  3GTG H;  1EQR A;  1VQP A;  4JI8 Q;  3PUX A;  3TQY A;  3GO5 A;  2NN6 G;  3GD7 A;  4P73 A;  4X66 L;  1RL2 A;  1Z9F A; 
#chains in the Genus database with same CATH topology
 2PBZ A;  1CFM A;  4LFA Q;  1EIG A;  1ESR A;  4DXF A;  4DV4 L;  4DV1 H;  4MV1 A;  3RAX A;  2O4X A;  3H0G B;  2VQE H;  2BDN A;  3OOC A;  3OW2 A;  1SCU B;  3K3P A;  4DR1 Q;  3TQT A;  4K2L A;  1KJJ A;  4RA8 A;  4L5R C;  4O3Q A;  1JOQ A;  4YWL A;  5KFC A;  1RKN A;  3HOZ B;  2EYO A;  4QW8 A;  1GO3 E;  3E3X A;  3GTO B;  4B3S H;  5DG7 A;  3S2D B;  5AJ3 Q;  5G3L F;  2VUM B;  5KFU A;  3HKS A;  5DM7 3;  1NMG A;  2FK3 A;  1D5M C;  3A8K E;  1TAE A;  1X9N A;  3JRX A;  3H6M A;  2V4R A;  4DUZ L;  1XPR A;  2RBM A;  4GOP C;  5LXT F;  2I0Q A;  5M3F B;  5DG8 A;  3RB6 A;  1I50 A;  2V5A A;  2R7D A;  4C5A A;  3IKJ A;  2G9D A;  1XNR Q;  4A3F G;  2W7O A;  4QIW E;  1SN8 A;  2M00 A;  1TII D;  1IBM Q;  4FF4 A;  2R92 H;  1NY4 A;  4YIJ A;  1KXL A;  3U4V A;  3RB4 A;  4O0A A;  4DXG A;  1B9M A;  1R4P B;  1KQS A;  4O42 A;  3ER0 A;  5KFO A;  1LT6 D;  3A5U A;  2VQF Q;  3PF5 A;  2XCL A;  4MTE A;  2ICE C;  1X32 A;  1QJO A;  2C2E A;  5EKL A;  4V19 0;  2I5M X;  3H3V I;  1L1O A;  1Q82 C;  1X56 A;  1RYS A;  3WOE A;  4FDB A;  4RKL A;  3URY A;  5I6Y A;  1R9T H;  4ED1 A;  1KTK A;  3F2U A;  4A3F B;  1BCP B;  4TV8 F;  5BR8 L;  4K6L A;  4RAY A;  2UXB H;  2QDB A;  1L1O C;  4EYI B;  3I55 A;  1KLG D;  3HOX B;  5D14 A;  1EZ6 A;  2LXJ A;  2F0V A;  2UXC L;  1PDQ A;  4FXG C;  1D2B A;  2AQ2 B;  2VL6 A;  4DUY L;  2C00 A;  1K3B C;  3ERQ A;  4A3M G;  2IX3 A;  4ZOL F;  2YV5 A;  2RHQ B;  4JV1 A;  5KT3 A;  4QCL A;  1N34 Q;  1E7Z A;  1H95 A;  4RB0 A;  2FLL A;  2RGR A;  1SDF A;  4AQY L;  4IQZ A;  2ZDG A;  1QG7 A;  2E76 C;  1TVX A;  1VDZ A;  1FNV A;  4QWC A;  5JQW A;  3S17 H;  4IPD A;  5IY0 A;  2XD4 A;  4K0K Q;  4HNV A;  4ETS A;  1M8A A;  1OO9 B;  2I5H A;  4HCE A;  4Y7N B;  3OSN A;  1FKA H;  1VQI A;  5ELE A;  4IAJ A;  3X3M A;  4EGV A;  1B04 A;  4EBC A;  5COY A;  4PMC A;  2JSO A;  1YHA A;  1ZQ7 A;  1N33 Q;  3CMA A;  1G2T A;  2A1A A;  2F4V L;  3JC6 6;  4X3U A;  5G3L D;  2OQ0 A;  3OIQ A;  5C44 G;  1RJT A;  4RAZ A;  3H3V H;  3ITP A;  3S2D H;  3MXG A;  3CCL A;  4YAJ B;  1RF2 D;  4UY8 C;  2F0F A;  4E6I A;  4Q5V A;  2Z6B A;  5M5W H;  4K2K A;  4X66 Q;  1UAP A;  5C4X H;  3MHB A;  3DWP A;  4A3B B;  2CHB D;  1YI2 A;  4DLK A;  1ZHQ A;  1ILQ A;  2Q2T A;  1GSH A;  3K5I A;  4EEQ A;  4KN4 C;  2BH2 A;  4A3M B;  1S0M A;  2RA4 A;  4FO2 A;  2QKI C;  4B3T H;  4HQ6 A;  3KJO A;  2A74 C;  1K83 A;  3P20 A;  1KC7 A;  3DM1 A;  2E2J B;  3PUY A;  2R7N A;  2K5D A;  4HYK A;  4RFB A;  3V6J A;  1S0O A;  1VQO A;  3RUZ A;  2F0E A;  4CKB A;  1PTO C;  2Q2U A;  3L2P A;  5KG7 A;  1YJW A;  2YYA A;  3MFG A;  3G4S A;  2DY7 A;  1KIX A;  2R93 A;  3BVM A;  1B8A A;  1UEA B;  3HOV G;  1A2U A;  1ZEQ X;  5FKA C;  3TQ1 A;  3T1Y Q;  5KFW A;  1PZJ D;  1EY9 A;  3U9T A;  3I4N H;  1O75 A;  4EYH B;  3I90 A;  3GIK A;  2G5D A;  3MC0 B;  1GSA A;  5LMU Q;  3BZK A;  1L2F A;  3F2C A;  2ZJT A;  3S16 H;  2RCN A;  4I55 F;  2C22 A;  1VQF A;  1JB7 A;  4WD3 A;  2PCF B;  4XQJ A;  3MZ5 A;  2C2R A;  2GVB A;  1H9S B;  3GTO A;  2N49 A;  4DV7 Q;  2YW2 A;  2N88 A;  4ZQ3 A;  1UE7 A;  2VUG A;  2PQA B;  2W9C B;  1WOC A;  3KBX A;  1JOO A;  1IW7 D;  1PRT F;  1R9T A;  1C30 A;  3RZD H;  4PNY A;  1BBX C;  1N9W A;  4JYA Q;  3CC7 A;  4XQQ A;  5IE8 A;  5IGE A;  4Y7N H;  2PYK A;  2YZN A;  5C8Y F;  1LV9 A;  2J6S A;  4MV6 A;  2JEI A;  3C1F A;  2B2V C;  3A54 A;  5D1P A;  1JIC A;  3RN5 A;  1PMR A;  5BPH A;  4DV1 L;  4DV4 H;  3T51 B;  1PTO F;  1CQJ B;  5KNC A;  3R93 A;  4U68 A;  1GUW A;  5KFJ A;  1HFG A;  1NUC A;  2C5C A;  2IHF A;  4JI0 H;  3KLS A;  4OX9 Q;  3LX0 A;  1IYJ B;  1Y8O B;  4KKU A;  1FGU A;  2WB1 E;  1HR0 W;  3K3V A;  1KC8 C;  2HDM A;  2OEO A;  4JK1 C;  5EPL A;  3RD4 A;  3W1G A;  5ISR A;  3AMU A;  5IYZ F;  3DEO A;  2EYL A;  1O7L A;  5IOD A;  1GKH A;  1AH9 A;  4DK6 C;  3D3R A;  1A15 A;  3W5O A;  4DV5 L;  1HZA A;  2YZM A;  4JI0 L;  2PI2 A;  2JA9 A;  1B6R A;  4H7B A;  1WJJ A;  3PW0 A;  2FPG B;  2YRX A;  2NVY A;  4XYL B;  3GTP A;  4C1N I;  5FOB B;  3RMH A;  1SEI A;  4LW1 A;  2DJF C;  5J1Z A;  1YNJ D;  2K05 A;  3FKI B;  5FLM G;  4XZ3 B;  3GID A;  4CKE A;  1KJI A;  4J9S A;  2E8G A;  1A3V A;  1HUM A;  2W6M A;  3R5H A;  4Q44 A;  3MXU A;  4EQ5 A;  4HJ9 A;  3KDF A;  4C3H B;  2O5I C;  5A2Q W;  3RAQ A;  2J4X A;  2MQH A;  2V1C C;  3TP5 A;  4C2M H;  1MIU A;  5L1J A;  3I91 A;  1ASZ A;  2RKS A;  4DR6 Q;  5C5J A;  2YS6 A;  2R93 B;  4HTH A;  1FR3 A;  2UXC Q;  4A2B A;  2WAQ G;  4HID A;  4Q0F A;  4IWY A;  5A2Q L;  3WO1 A;  4JCV E;  2NU9 B;  1B4O A;  1FGB D;  4ME3 A;  1MD2 D;  4X65 L;  3S1M H;  5DG9 A;  1DD2 A;  2VQE Q;  3VYT A;  2NVQ H;  3SVM A;  3Q0A A;  1PTO B;  5JJK A;  3GV6 A;  3S9W A;  2WYO A;  5EBC A;  3ETJ A;  3OIP A;  3TZD A;  1VQN A;  2KVM A;  1AW7 A;  1PH6 A;  2FMC A;  1VQK A;  1BNZ A;  4L5Q A;  2CW7 A;  1U9R A;  4ZQI A;  3TZU A;  2L55 A;  2R93 H;  2IMW P;  1ZET A;  4DAM A;  3NTH A;  4LF8 H;  4R9W A;  4A93 B;  5FLM H;  5I47 A;  1NAP A;  3Q22 A;  1LTI D;  2F0Q A;  2IY5 B;  3VDY A;  4DKA C;  2EVB A;  1CSP A;  4R8U B;  1L2Z A;  1IHZ A;  4BS9 A;  2XCA A;  2HHH H;  3BVZ A;  2WIN B;  2W9B B;  1CK1 A;  3CCM A;  4QUF A;  4I7A A;  3O13 A;  1K8M A;  1EYZ A;  4B3T L;  2Y0S A;  1M7J A;  3K80 C;  2V59 A;  1K1S A;  1XJV A;  3V05 A;  4ECX A;  2EYP A;  3GP7 A;  3N44 B;  1ZYR C;  4DV4 Q;  1MJE A;  2A69 D;  1U5K A;  4P2C B;  4TRD A;  3N42 B;  3M3Y H;  3I12 A;  1EWC A;  1TWC B;  1QNK A;  3GTL B;  4YHH H;  1Z7T A;  3RLF A;  1TWH B;  3P75 A;  1S72 A;  2X69 A;  1AUX A;  2CW0 D;  3AFP A;  3GQB A;  2F4V H;  5CR3 A;  2F0L A;  3CCE A;  4IZ8 A;  4DNT B;  1IL8 A;  1I4Q A;  2F0I A;  4MHE A;  5C0X I;  5LP6 F;  4UCR A;  4GLV B;  4YCU A;  5LMN W;  4CDE C;  2FKL A;  4BBS B;  2UVR A;  1BXT A;  3C0F B;  2F4I A;  1VQ5 A;  1HR0 Q;  4P71 A;  3RGZ A;  2KHI A;  5EKK A;  3RZD B;  1MSH A;  2ATL A;  4B3M L;  2AMC B;  1XNQ Q;  4LFC L;  4HJ8 A;  4DL5 A;  2F0H A;  2ZXO A;  1L1O B;  1W6K A;  2HDL A;  3SK8 A;  1IZ6 A;  3MWY W;  2UU9 Q;  1BCP C;  4IUR A;  2NVY H;  2R92 A;  2UXC H;  3IL8 A;  1HNX L;  3GTK B;  5IGC A;  3I2Z A;  3BDL A;  3STB C;  2W70 A;  1RYR A;  2R6G A;  4BBS H;  2P5Z X;  3RV4 A;  1JJ2 A;  3Q8S B;  3E6Z X;  3LML A;  3GQC A;  2W8K A;  5C1O A;  1S40 A;  3KXY T;  4YY3 H;  1L0Y B;  5KFE A;  1GYF A;  3PW5 A;  2KA7 A;  4ZLT F;  1YJ9 A;  3HOY H;  4IRC A;  4C1N K;  3U58 A;  3GIP A;  1PYW D;  1F2Z A;  4JI5 H;  3KF6 A;  2N78 A;  2K32 A;  2WAQ E;  1KRT A;  4Q0Y A;  5FPR A;  3N52 A;  5C44 H;  1AP0 A;  2WAC A;  1T36 A;  4PWQ A;  2FXQ A;  1PHJ A;  3JAM W;  4FBT A;  1JMC A;  3TSS A;  3UI2 A;  4GOP B;  4MV3 A;  3VMM A;  3RZO B;  4IFD G;  4C3I G;  1VF7 A;  2CW0 C;  1X55 A;  4ZYS A;  3KHR A;  3ERS X;  1NSN S;  2AWN A;  5CV7 A;  4C2M B;  3C3L A;  2B2W C;  4UP8 A;  4F8M A;  4K0K L;  4DAY A;  5C3E B;  4IUV A;  4YWK A;  1ENF A;  1W2B A;  1AZP A;  1GUO A;  2E5L H;  2NB0 A;  2OCE A;  3ND8 A;  4NXM L;  4OO1 G;  3S14 H;  1LLR D;  5M3M G;  2XGQ A;  1BCP F;  2HD3 A;  3KYH C;  4FVM A;  3M85 A;  1BKB A;  3PO2 G;  4YCV A;  2Z1C A;  1T5E A;  1STA A;  2UUA Q;  2HIV A;  4YHH Q;  2K5W A;  1EIH A;  3J7A F;  5GON F;  2ZJP A;  4O3O A;  1SYG A;  1GOZ A;  2PMZ A;  2JEF A;  4ZUJ A;  4IRK A;  3BG3 A;  4R8N A;  1TWC A;  4O3P A;  4MV7 A;  1YHB A;  3HG9 A;  3WDN A;  3NK9 A;  5EWG A;  1E4E A;  2BR0 A;  1TWF B;  1ROD A;  2FHT A;  1MI2 A;  3SK5 A;  1SYC A;  5IGD A;  5JJZ A;  3J80 c;  4ULL A;  4UP9 A;  2KCM A;  1XMO L;  4JOI A;  5KFQ A;  4JI7 L;  2ZXP A;  3Q2O A;  2WAQ B;  3K5N A;  3DMU A;  2NUA B;  1I6U A;  3AU7 A;  4MTK A;  1EFW A;  3CRK C;  1HH2 P;  2CH4 W;  1GUT A;  2I07 B;  4ZK9 B;  1I3Q B;  3E5S A;  2KSW A;  1YIJ A;  2F3W A;  3GIJ A;  3CKI B;  1S4Z A;  3P1H A;  3CPW A;  1YEZ A;  2Z4H A;  4C3H G;  1SFO B;  2AQ4 A;  1J9O A;  4X62 H;  4RUC A;  3CQZ A;  4Q8F A;  4ED7 A;  4YCW A;  1BF4 A;  5KFS A;  3UE0 A;  2O2L D;  3ULJ A;  1IBL Q;  2R82 A;  3FDT A;  2G9H D;  1IKL A;  4X6A H;  2QEX A;  4KHP Q;  2BDO A;  3P7J A;  1JB3 A;  2K5H A;  1WCM B;  1OXV A;  1TWH H;  2NBF A;  3I56 A;  1IYV A;  4IZO A;  5DLG A;  2KED A;  3ERO A;  2NVX B;  3GTL A;  4ECV A;  1EU3 A;  1ZYR D;  2IPK D;  2NN6 G;  2NVQ B;  4R8I A;  1OWT A;  4ECS A;  3KF8 A;  1I4P A;  4U67 3;  4P73 A;  3GV7 B;  1RL2 A;  1Z9F A;  1PXU A;  3BU2 A;  4KD3 A;  5L1L A;  2BQ3 A;  2F0D A;  3AFQ A;  3CVZ A;  2CQA A;  2VY3 A;  2A19 A;  4DR4 H;  3OTO Q;  2ZJR A;  2OXP A;  2EY1 A;  4HJ7 A;  3SE0 A;  3EFX D;  3KF6 B;  3K6O A;  5KG0 A;  5IYC H;  5HY6 A;  2E2H B;  4C3I H;  4AIM A;  1Q86 C;  1DIK A;  4NPS A;  1EWI A;  1LAC A;  1JDE A;  4RGN A;  2F0S A;  1UC8 A;  3L7Z C;  4DR5 H;  5IGG A;  3RIZ A;  1WTH A;  3UDI A;  4KKS A;  2F0T A;  3J80 i;  4LF4 L;  1EYC A;  1EUD B;  3HZX A;  4A3J G;  1KD1 C;  3ULP A;  1D7Q A;  1QUQ B;  2IJ0 A;  4QIW A;  3V96 A;  1V9P A;  5I4D A;  3M4O H;  5LA6 F;  1AE2 A;  2F0J A;  2VW9 A;  4RNN A;  1A3U A;  2HQE A;  2QEJ C;  5D1O B;  2MGS A;  3KTM A;  3NEM A;  2VQF L;  1SYB A;  4UP7 A;  1D1K A;  4LF6 Q;  1HHV A;  1XMQ L;  4C3I B;  1BOS A;  3TP6 A;  3CCR A;  4DR5 L;  4Q43 A;  2QGQ A;  1Q1E A;  1E4E B;  3KHH A;  2ENB A;  3J7Y W;  4J9O A;  1GXD C;  5KIX A;  3HOU B;  3PO3 H;  2E2D C;  3K7A H;  1ULZ A;  3H20 A;  1JX4 A;  4OO1 I;  5FLX E;  4FP5 D;  3HBL A;  3ORQ A;  3D4W A;  2ASL A;  3L0O A;  4DR7 H;  2MJ8 A;  1HXY D;  2BH8 A;  1LT4 D;  3VYU A;  1RTO A;  1J6Q A;  1VQD A;  2AQ1 B;  3GTP H;  2E75 C;  1SFO H;  4XYO A;  2NTS A;  5M5W B;  5GRO A;  1IBL L;  3L4K A;  2OWO A;  3GIM A;  2K5V A;  4RGO S;  3I4O A;  5C6A A;  2EIF A;  3J81 i;  3M7N A;  5DGA A;  4YQW A;  2EYF A;  5KFT A;  3RR5 A;  2HUG A;  4DR1 L;  1DJR D;  2PW5 A;  3VR5 A;  1LTA D;  1R4Q B;  2UXD H;  1Y1W B;  2B2U C;  4DR4 Q;  3RUP A;  1G51 A;  5KFV A;  3FP9 A;  4JI2 Q;  1WCM A;  2JA6 B;  4GN5 A;  2K33 A;  5KFZ A;  3NP8 A;  2C9O A;  4J9P A;  1DOL A;  4NB3 A;  1O7Z A;  2WKD A;  3F1Z A;  4QMG A;  3OSP A;  5IT9 c;  1K1Q A;  3H0G G;  1XNR H;  3R8B A;  4JYA L;  1A3T A;  3JAM c;  3Q1K A;  2AWO A;  4RU9 A;  1WTQ A;  1CM9 A;  2H1E A;  3KLS X;  1N33 L;  3RBE A;  1JE5 A;  3S1N H;  3NSW A;  2N8N A;  2NVX A;  3R5X A;  2KUM A;  1A6X A;  4KJO A;  5JVD F;  3ND9 A;  3VPC A;  3QZ7 A;  1DGS A;  1PH2 A;  3J81 E;  2FJ2 A;  2KJX A;  1DCZ A;  5BN4 A;  5EPK A;  3BJU A;  4LFB Q;  4J9Q A;  2WAQ A;  2DPJ A;  2H4O A;  2NU6 B;  2W6Q A;  1N34 H;  2F0K A;  2UUA H;  4A3G G;  4LFC Q;  1SYF A;  2F03 A;  4O4I F;  4O3R A;  5C4J H;  3J81 L;  5EOY A;  1A0I A;  4ECW A;  2ICI A;  1RIP A;  5FPO A;  2PZW A;  2UUC H;  4GOP A;  5IGF A;  1LTT D;  2IWH A;  3GV8 B;  2WV6 D;  1Y1W G;  2M9V A;  3H0G H;  3VR4 A;  1U4L A;  1V51 A;  3PV0 A;  4OON A;  2WB1 A;  4BY1 H;  3M9N B;  5FJ8 H;  1CQV A;  2B2Y A;  3CC4 A;  4ECT A;  4WRD A;  1E2V A;  1H9K A;  2K52 A;  2BQU A;  4LF5 H;  5KT4 A;  3U9O A;  4A4I A;  1LUZ A;  1KRS A;  4XIG S;  4LUO A;  2A73 B;  4IUP A;  2ASJ A;  2EZV A;  2PI2 E;  3CQZ H;  4DR2 L;  1ZXT A;  3MFI A;  2K03 A;  2P0A A;  1PH3 A;  1XNQ H;  5F9L A;  3U50 C;  1V43 A;  1HJP A;  1GHK A;  1F9R A;  4DK3 C;  2XC9 A;  5M5X H;  4M1U B;  3GLK A;  4CJ1 B;  4ECQ A;  1M1K C;  4CHT B;  1TWH A;  3WNZ A;  4A3L H;  1SSO A;  3KAJ A;  3GTM A;  1RJP A;  2SDF A;  4GKK H;  3GTG A;  1B44 D;  1N36 H;  2JA8 B;  4DA2 A;  3T1H L;  1M4V A;  3CAM A;  2CWA A;  4CKC A;  3I70 A;  4TQR A;  1FJG Q;  3MXN B;  4QIW B;  3Q8D A;  4WJW A;  2HT1 A;  3S1M B;  4G3I A;  3G6E A;  4IPG A;  4YY3 L;  4LNQ A;  1K8O A;  4ALP A;  3PR5 B;  4LMY A;  2AQ3 B;  1PTO H;  1EQT A;  5IWA L;  1AZQ A;  1ICF B;  1XTC D;  1CHQ D;  2KEN A;  1SMY C;  1Q81 C;  2R8G A;  2VA3 A;  1H9J A;  5IYC G;  2NUC A;  5CC4 A;  5LHY 1;  5M5X B;  3OMG A;  1AN7 A;  1HNX H;  3G7L A;  3BA8 A;  3M4O B;  1I7L A;  2D9U A;  4J9R A;  1OXX K;  2FIN B;  3B6Y A;  3OW7 A;  5M3M H;  3C2P A;  4F87 A;  1KAW A;  2ZM6 Q;  3K8A A;  1VAJ A;  3M4Y A;  3Q23 A;  2EJF C;  3HKZ A;  4J9M A;  4LFC H;  4DK0 A;  1JKJ B;  1SMX A;  4JI3 Q;  3J7A V;  1AE3 A;  3PO2 H;  3W1B A;  2Y0S G;  4LMQ D;  3Q8Q B;  1X3G A;  3HOZ H;  1O7Y A;  1YVC A;  3NBH B;  3BQ2 A;  4G4K A;  4KY6 A;  3A5Z B;  2RQX A;  4BBR H;  4JI8 H;  3OPO A;  2WP8 J;  1U4P A;  1ILP A;  2QF7 A;  3MFH A;  2CCZ A;  1HA6 A;  5M3F H;  1Y1V B;  1F2L A;  4ME5 A;  5CV9 A;  2E74 C;  1ZHS A;  2GPW A;  3GV5 B;  5C4J B;  2L9H A;  4DV3 L;  5GAH C;  1LT5 D;  4H44 C;  2BOS A;  2ZDQ A;  1VS0 A;  5K5P A;  1IXR A;  4JI6 H;  3E0J A;  2CWP A;  1II3 A;  2J6T A;  4QF4 A;  5LL6 b;  2JA6 A;  3HOY G;  2V4Q A;  1SFO A;  5EDW A;  2R8H A;  2LXK A;  4PDB A;  1MHW C;  1S0N A;  4GKJ H;  1X65 A;  3BYT B;  3MTS A;  2F0W A;  2A68 C;  3ONA B;  4NP5 A;  2N3S A;  4GLA C;  1Q3L A;  5IT9 L;  1E3P A;  4BBR G;  1PRT D;  2WTF A;  5LL6 S;  5KG1 A;  2JA7 G;  4DV0 Q;  3KHG A;  2LSS A;  4LK1 C;  1WCM H;  1IBM H;  1VQC A;  1GUG A;  1TWC H;  2F0U A;  4LF8 L;  3JRW A;  3BQ0 A;  2A6H D;  4A3J B;  3PIO 3;  3DM3 A;  1V1Q A;  3TP8 A;  1D1I A;  4GNX A;  4A3L G;  4YBZ B;  3EN2 A;  5IT9 W;  5JVL A;  3NXW A;  2XRS D;  1K83 H;  1Q1B A;  2OTL A;  1X3P A;  1JJG A;  1WTX A;  4F7X A;  1MJC A;  1EZ8 A;  4DV7 L;  4PMW A;  2ZT9 C;  3BZD B;  4A3I G;  2B63 H;  4JBW A;  1IBK L;  2Z9H A;  4A3I B;  2OF1 A;  3V2T A;  2W6O A;  3V4S A;  5ELB A;  1IKM A;  2VR1 A;  4Y8V B;  2K14 A;  1ESF A;  5HBR B;  1JQY D;  2YCH A;  1SYD A;  1SLJ A;  4BY7 H;  2RGV A;  4K14 A;  2I46 A;  3A74 A;  1WR2 A;  4MV8 A;  1YIT A;  2EYJ A;  2RHS B;  1N32 H;  2KCN A;  3M4I A;  1OXS C;  2JA7 H;  3OTO H;  5DQG A;  3BAB A;  1ZKO A;  3OTO L;  4MA0 A;  2Y0S E;  1VQ8 A;  2R61 A;  4OIK A;  1I6H B;  1EY7 A;  1SE4 A;  4I4T F;  4TV9 F;  3JAM E;  1JOR A;  4BBR B;  3PGZ A;  1Q7Y C;  3H0G A;  2X6L A;  1HNW L;  1C7Y A;  4PG3 A;  3N40 P;  3G6X A;  1SNO A;  2Z8L A;  3UE1 A;  3SE7 A;  4MNO A;  4B3S Q;  5DEH A;  5KFR A;  1Y8P B;  1JCK B;  2E2I H;  2MFI A;  2YTX A;  4DR7 Q;  1O78 A;  4AYB G;  2ASB A;  4DV7 H;  4B9W A;  1XTD A;  4BY7 G;  4DAY B;  4RHS A;  1VQB A;  3SEB A;  4KLK A;  1PRT C;  2JQO A;  4UAI A;  2YL2 A;  3TDQ A;  2GLT A;  3KK7 A;  1PH1 A;  1WTP A;  1E2Z A;  3RBD A;  4A3D H;  5LMN H;  2BE5 D;  3CRL C;  4JV0 A;  2V58 A;  4IFD H;  2EY5 A;  2F1M A;  1VQ9 A;  1GSO A;  4HN7 A;  1FNU A;  3I73 A;  4LUV A;  4DV6 L;  4P72 A;  4XDX A;  5CGK A;  1KAA A;  4JI2 L;  2QDL A;  3RLO A;  4HMJ A;  4LFA L;  1VCI A;  3KLW A;  1VQJ A;  5C3E H;  2FJZ A;  4UCT A;  4OWW B;  3TEH B;  2NU7 B;  3EVQ A;  1SNM A;  4MN3 A;  4HMI A;  4TSS A;  2JA6 H;  1I3Q H;  1MZB A;  2R7Z G;  4KV6 A;  3T4A C;  1YHQ A;  2EDG A;  3RLN A;  2DNE A;  4Y52 H;  5FLX W;  3QZ8 A;  2UVU A;  4JI6 L;  2PNH A;  1JT8 A;  2K75 A;  2F0G A;  5DLQ E;  1Q90 A;  3HOX G;  1DZ1 A;  4GN3 B;  4DNI A;  4KHP L;  1B70 B;  4DV3 H;  1G6P A;  3M9M B;  4QWA A;  1RK5 A;  1KBL A;  2JYO A;  2JA8 H;  4E4T A;  4ZUI A;  4APM A;  3J81 j;  3ORR A;  5KT7 A;  5BN3 A;  3KHL A;  1LM0 A;  5JJI A;  1LTS D;  1D6E C;  4LF9 H;  1L0X B;  5FJ8 G;  1OTC A;  2DWC A;  2QK4 A;  4RNM A;  3CPF A;  3MAQ A;  3I4M B;  1C0A A;  3NQT A;  3OSO A;  2FPI B;  3CU7 A;  2AUK A;  2N55 A;  2BCO A;  4IUU A;  2B8G A;  1TKW B;  2NTT A;  4DUY Q;  3M7G A;  1S5D D;  1F2M A;  1PH4 A;  4JI7 Q;  2CKZ B;  1VMC A;  2DGY A;  5C3X A;  3F2D A;  4P74 A;  4PV1 C;  1QZH A;  4MTN A;  3F8N A;  5I9P A;  2PQE A;  2SNS A;  2DUD A;  3R2I A;  4GNX B;  4DV2 Q;  4HNU A;  5NUC A;  1U4M A;  3S16 B;  1AEX A;  2FLP A;  3QJY A;  4B3R L;  4HSP A;  4CJ0 B;  4IO9 A;  1JJC B;  1K83 B;  4K6D A;  1KL9 A;  1QNU A;  1SNC A;  3T1H H;  2W6Z A;  1CS0 A;  2ZTD A;  3DLL A;  4A3D B;  3TII A;  1CTM A;  1W6J A;  5C0X J;  5JOB A;  1PZK D;  1DV1 A;  3NBI A;  1FJG H;  4IR1 A;  3HFZ B;  4HNT A;  4A3G B;  3PW7 A;  1C48 A;  2AKW B;  3JZI A;  2NVT B;  1K0R A;  1LO5 D;  2IHE A;  1XNQ L;  3I72 A;  4JI5 Q;  4O4L F;  2JN4 A;  4X66 H;  2UXD Q;  4DR2 H;  3GDE A;  1HR0 L;  4TUY F;  2W9A A;  2B63 A;  4RHR A;  3VYS A;  4LF5 L;  4EVO A;  3K81 C;  3R2T A;  3JSN A;  3TIN A;  1M0W A;  1EEI D;  3K0Y A;  4ECU A;  5KT2 A;  3GTP B;  4OX9 H;  2XCP A;  2DLN A;  5A35 A;  1ASY A;  5JJL A;  4F50 A;  3PIO A;  4AQY H;  1N8R C;  2D5D A;  3BVG A;  4XTC S;  4JV5 Q;  1S68 A;  2EXD A;  2JA7 A;  2NZO A;  1NBW A;  3FVQ A;  1SND A;  3F2B A;  4DUY H;  1I7N A;  5KFA A;  1PLF A;  1GGO A;  3VPB A;  5J2U F;  2Z6K A;  2BA1 A;  3GTM H;  4YB8 B;  3GTG H;  3NUC A;  1VQP A;  3PUX A;  4UFZ A;  2RDJ A;  1EY0 A;  1YNJ C;  3DWQ A;  4I50 F;  1B2T A;  2B63 B;  2E2I A;  2V4D A;  4IJH A;  4XQN A;  3J80 W;  2KHJ A;  2CFM A;  3R23 A;  1FL0 A;  4ECZ A;  4ZCK A;  1TS2 A;  4G7Z C;  2ALZ A;  1A2T A;  2K04 A;  3T56 B;  1WVL A;  3V6K A;  1JXL A;  1SE8 A;  3ETH A;  4IUT A;  3BA9 A;  3A55 A;  4RCN A;  5C5M A;  3WWV A;  2XNA C;  2K4K A;  2ZTC A;  4RGT A;  5F2D A;  2HJW A;  1ENC A;  1D5Z C;  2PZU A;  4YY3 Q;  4KHV A;  2QCP X;  5C44 B;  4LF7 Q;  4DR1 H;  4K5V A;  4OEL B;  2XWJ B;  2DZD A;  4Q45 A;  4CC5 A;  1WTV A;  1EEF D;  2GN5 A;  2LY7 A;  4A3G H;  2R93 G;  1HNZ Q;  3PZP A;  5IYD G;  4IFD I;  3MR3 A;  1WD0 A;  1IBL H;  4A3E G;  3LGJ A;  2JA5 G;  5EWF A;  3BS1 A;  2YTV A;  1SNQ A;  2FMM A;  4GKJ Q;  5FLX L;  2IX0 A;  5GAE C;  4R4I A;  5HV6 A;  4RUA A;  2OH2 A;  4FF1 A;  5FO9 B;  4DFA A;  4ME6 A;  4G57 A;  4B3T Q;  2HVS A;  4OWX B;  1SJH D;  3S1R H;  4HR7 A;  1I94 H;  4I7Z C;  2UU9 L;  1T9H A;  2UVV A;  1LTG D;  1STH A;  2IA6 A;  4GC7 A;  4ED2 A;  1B7Y B;  5FD6 A;  2K7V A;  1SYX B;  3I4N G;  2ZDH A;  4RWS C;  3DEP A;  3NWT A;  4B3M Q;  1G2S A;  4H13 C;  1XMQ H;  5C4X B;  4L8J A;  3CCV A;  3V4Z A;  1A63 A;  3MXP A;  4K8J A;  4LJZ C;  4IPC A;  5D3D A;  2R7Z H;  4A3E H;  1YNX A;  2VNU D;  1D8L A;  2VS1 A;  5DAU A;  4UCS A;  3BAA A;  4LF6 H;  5KT5 A;  4YJ2 F;  3D6C A;  2VA2 A;  4A3K H;  3MWE A;  1TWF H;  3OYY A;  4APV A;  2UUB L;  3D4D A;  1K8G A;  3GIQ A;  1EQV A;  1SNP A;  2L0C A;  3T1Y L;  5F9N A;  1STE A;  5HGT A;  3CP0 A;  1UNN C;  1M6V A;  3QR8 A;  4X64 Q;  4J6H A;  4N8F A;  4A3B G;  1XXG A;  4K5W A;  3Q6S A;  2OTJ A;  3FRP B;  3RZO H;  3EPI A;  2K28 A;  2W9B A;  3KAL A;  3Q24 A;  5C0X G;  4DR4 L;  2RSO A;  5C5L A;  1NTG A;  4ZKB B;  4JV5 L;  2VXW A;  4RZQ A;  3S1Q B;  2OQK A;  3I8Z A;  3OWF A;  5KFL A;  1UNS A;  3ULL A;  2B2U A;  3KLR A;  2WFW A;  5C3E G;  2JP1 A;  2ZM6 L;  1K3R A;  2MUY A;  1STN A;  1OXT A;  2RDI A;  2B2T A;  3QB3 A;  4O1N A;  3IAY A;  2J6U A;  2PMZ E;  5ELF A;  5IYB H;  1IW7 C;  1PH8 A;  2VUM G;  4O4H F;  1M90 C;  5ELD A;  4RB3 C;  1N48 A;  1CUK A;  2R7F A;  1S9F A;  4CJ2 C;  3NTK A;  2XRQ D;  1BO0 A;  1X3F A;  4J1M A;  1WTW A;  2F3I A;  4F88 A;  2XIG A;  2WB1 B;  4LF7 H;  5EZY F;  2R6F A;  1PYS B;  3DWA A;  5KG4 A;  4N8X 1;  4RCO A;  2FPP B;  1HNW Q;  3HOY B;  1AUV A;  5ELO A;  4M7E A;  3C1E A;  1B3Q A;  1G8Z D;  3HOX H;  4J9N A;  2UUB H;  3TRE A;  2A6E D;  3M3Y B;  5M3M B;  5C3W A;  2KCC A;  1HFN A;  2AGO A;  2JEA I;  2FB9 A;  4LF6 L;  3T5J A;  3RJ0 A;  4YWM A;  1H9R A;  5CBE E;  1K9M C;  4FNF A;  4IWX A;  1NE3 A;  2K5N A;  1SBB B;  1TXY A;  1VMP A;  4MAM A;  1C9O A;  1EYA A;  1PX2 A;  2ASD A;  3CCU A;  3M4Q A;  1FYC A;  2MO1 A;  4OWT B;  4WFN 3;  1I94 Q;  3RTX A;  2R7Z B;  1I4G A;  1PTO D;  4DV2 L;  2Q8I B;  4AQY Q;  2I5L X;  2FE3 A;  1RHP A;  1O7I A;  2EYH A;  5KYI A;  3CCQ A;  2CQO A;  3LP8 A;  2UU9 H;  1BXR A;  4OHJ A;  1I94 L;  1RJQ A;  1HZ9 A;  1XX8 A;  5IGB A;  2JE6 I;  4RB2 C;  4ID6 A;  2MCT A;  3TME A;  3J80 L;  4A3J H;  4FS1 A;  5D65 A;  1L0W A;  4NXN H;  1VF5 C;  4JPB W;  1RDP D;  3MR5 A;  3S2H B;  1TY2 A;  1KEE A;  3KOJ A;  4BWS C;  5LMU L;  3GIL A;  1KHI A;  2IT1 A;  2NVY B;  2RVL A;  3SHL A;  4HAE A;  3M9B A;  1I3Q A;  4QW9 A;  4K0K H;  3SK4 A;  4KJN A;  1S5E D;  4KMU C;  3MR2 A;  2JXM B;  2OLS A;  1VQL A;  3SI8 A;  4IJL A;  4KHZ A;  4PZ6 A;  4L1K A;  3H91 A;  1HTP A;  1B3A A;  4RGM A;  3GTQ A;  4IR9 A;  1PK8 A;  4DL6 A;  2CQY A;  1I5F A;  1BNC A;  3H4B A;  4CBV A;  1AFP A;  2X0S A;  4HR7 B;  1QVC A;  4BWG B;  2YYZ A;  3CC2 A;  1E1O A;  2W71 A;  1WH2 A;  5KNB A;  5KFF A;  2I87 A;  2ALY B;  4JOI C;  5AJ3 L;  2W8L A;  1YBY A;  2L15 A;  5GQO A;  5I2Y A;  5KG2 A;  4P75 A;  2FLN A;  5KFP A;  1LTR D;  2EYM A;  3D4R A;  1T3N A;  3T16 A;  2NVX H;  1J5E L;  2KCT A;  5KGU A;  5LL6 X;  3D8G A;  2LKV A;  1PH5 A;  1U0L A;  4KN7 C;  2F4V Q;  5FO7 B;  4JC0 A;  1XPU A;  2R7Z A;  1EY8 A;  4B3M H;  2BE5 C;  3PUW A;  5L1K A;  1Q8I A;  1ET9 A;  1F77 A;  3LWB A;  4N9P A;  3MWD A;  1LYL A;  1CA5 A;  4HSV A;  5KFN A;  2NN6 I;  1PFB A;  1SE2 A;  5EPJ A;  1MKH A;  3GTJ H;  4J8Q A;  1B1Z A;  2NWG A;  3OUU A;  2R8I A;  3S1Q H;  1HR0 H;  4NXM Q;  1LTL A;  2RCF A;  3PN1 A;  1JDB B;  1HZB A;  5M9O A;  2VUM A;  1Y1W A;  4JBJ A;  2JA7 B;  1WYD A;  5IT9 E;  3VPD A;  4TKO B;  2DN8 A;  3L3O C;  3SGI A;  1JE4 A;  5I2X A;  4NXN L;  1Y1V A;  1EYD A;  3NEL A;  2FK1 A;  1NCV A;  3A0J A;  2XWB B;  1FJG L;  2UVW A;  1JOK A;  2B2W A;  5EGT A;  1SMY D;  3RV3 A;  3NTI A;  3FKI G;  1WSC A;  3TIG A;  4IRD A;  4DV1 Q;  1LT3 D;  1OXU A;  3K57 A;  3IRB A;  1EL0 A;  2B29 A;  3BYY B;  1TA8 A;  3E9I A;  4IAL A;  4FXK C;  1GVP A;  5GAD C;  1E24 A;  1K28 A;  2YTY A;  4UHV A;  1Q46 A;  3PO3 G;  3RGX A;  4OXP A;  4DV2 H;  4WBN F;  4KI0 A;  2EE1 A;  4FYD A;  3PCO B;  4X62 Q;  3HS0 C;  1LAB A;  4XYQ A;  4CDD C;  3I4M H;  2PZT A;  5J3B A;  3JSL A;  4DGZ A;  3GTK A;  2QW7 A;  3OWE B;  5FD5 A;  1PH7 A;  4NKL A;  1GM5 A;  1SEB D;  1DM0 B;  5FLX c;  1HA5 A;  4UPA A;  3PMF A;  1CHP D;  2Z4I A;  1RJR A;  5LYJ F;  1I4R A;  1BBW A;  3QIA A;  3VR3 A;  5H1S E;  3K5H A;  3KAK A;  2KEE A;  4GNX C;  1QUQ A;  5KFH A;  2Y0S B;  4LF7 L;  4DN4 M;  3JAM L;  4F4W A;  3HOU G;  4EFB A;  2TMP A;  3N43 B;  1B50 A;  5IP9 G;  4AH6 A;  4ODG A;  3NBH A;  3PR4 A;  2D0P A;  1PA6 A;  2MNA A;  3EQL C;  4JBM A;  2LMC B;  3OHX C;  4QB4 A;  2NZH A;  3PW4 A;  4Z9C B;  1Y69 U;  1FNW A;  5KND A;  2L11 A;  3E9H A;  5L37 A;  4B3R Q;  4UCO A;  1RD9 D;  1GLV A;  1TU2 B;  1RCV D;  5IIF A;  1SE3 A;  3A8I E;  3H09 A;  3Q8R B;  2B2T C;  1KJ8 A;  4HIM A;  2Q8R E;  5CV6 A;  4DAV A;  1JWS D;  2D2C C;  1WTO A;  4JV5 H;  1YNN D;  1UE5 A;  2PW7 A;  1I4X A;  4S3S A;  3SK6 A;  4PZ8 A;  3HOZ G;  4R4T A;  1IBK Q;  5KFI A;  5DGB A;  4UDU C;  3GTJ B;  1Z2N X;  1CA6 A;  4G7H C;  5K36 H;  2K5Q A;  1V4Y A;  2W57 A;  1JC7 A;  1O80 A;  4X3T A;  1XMO Q;  3FEW X;  4LFA H;  4NLG A;  1W96 A;  3RB0 A;  3EBE A;  1F2Y A;  3GTQ B;  5TSS A;  4V0B A;  5E4X A;  4DV6 H;  2QIL A;  2XGT A;  1CKM A;  2M05 A;  5LMN Q;  1UWV A;  4DV5 H;  4ZKC B;  1EHI A;  3L4J A;  5D3I B;  1TQO A;  4DR3 H;  3TN2 A;  4IHJ F;  1GUN A;  2VPS A;  5JEA J;  2KOL A;  3DUZ A;  1P16 A;  5IYD H;  2HGS A;  4HED A;  5C4X G;  5IOC A;  4PMB A;  1ENA A;  4FXD A;  1UUP A;  3SR1 A;  4LF8 Q;  1RTN A;  2HIX A;  2B3G A;  3HXL A;  2R8J A;  3AEV A;  2JA5 A;  4DNR B;  2VUM H;  5L9X A;  3H4D A;  3AQQ A;  2WKC A;  2ID0 A;  5C4Z A;  1CSQ A;  2HHH Q;  1TWG A;  1TWA H;  4FBU A;  2CVR A;  4MV4 A;  2YU9 A;  1HNW H;  3H94 A;  3I4M G;  1BBU A;  1QOH A;  2DJG C;  1ONL A;  2R7M A;  2NYZ D;  4IOC A;  4RB1 A;  3J80 E;  3T13 A;  4EX5 A;  2FP4 B;  4MA5 A;  2AGP A;  1P8L A;  1T5X D;  1N32 L;  5JVH 3;  5KFB A;  2KHS A;  1VBH A;  3A8J E;  2RDG A;  4KTA A;  1KAB A;  4LF4 Q;  4ECR A;  1HRJ A;  1NR4 A;  4FU0 A;  3K0X A;  4U6P A;  5J22 A;  3HOU H;  3PO3 B;  1K8A C;  4X3S A;  2SCU B;  2KEC A;  3C46 A;  4WJ4 A;  2NU8 B;  4IOA A;  2FFK B;  4J9K A;  1IBK H;  4CDC C;  3KDF B;  1R9T B;  5KYL A;  4XT3 B;  1EWH A;  3RB3 A;  4A3B H;  3A7A B;  3FHW A;  2A6E C;  1HNX Q;  1K0S A;  1BGW A;  3MVV A;  2I8C A;  2VPQ A;  1KJQ A;  2YS7 A;  2RSN A;  4DR6 L;  1KDA A;  3F8T A;  1TS3 A;  3RF2 A;  4RNO A;  4J0M A;  3RN2 A;  5C0X H;  1SRO A;  2CH4 A;  2FMA A;  4RMF A;  1VKZ A;  2JK8 A;  4UCU A;  5H80 A;  2B63 G;  2O03 A;  2A68 D;  4CGY B;  4L5T A;  1C4Q A;  1PFM A;  3D0F A;  1IBM L;  4KK7 A;  1Z47 A;  2EJM A;  4IPH A;  5JUM A;  1DOK A;  4LUZ A;  4XXE A;  3PVX A;  2R3Z A;  3HB9 A;  1CKO A;  3HKZ G;  2LFN A;  5EBD A;  1YNN C;  3W2D A;  3CQZ B;  1UE6 A;  1M0T A;  4J9L A;  2R8K A;  2KQ3 A;  3K58 A;  4JI0 Q;  3UQ8 A;  4QWD A;  4F4X A;  4KD4 A;  2XVS A;  4GKJ L;  1EY4 A;  2JEB I;  3HP3 A;  4OIJ A;  1C8C A;  3SDZ A;  2MPM A;  2EXZ A;  5ELC A;  4FS2 A;  4A93 H;  3ICE A;  3PUV A;  2EPB A;  3UDF A;  3K5O A;  4OX9 L;  3IG0 A;  1Z2O X;  2QYZ A;  1E2W A;  4A3K G;  2VZA A;  1CT1 D;  3TS0 A;  2HVR A;  4YP3 A;  3H15 A;  4Q8E A;  2B2Y C;  3TQY A;  4I7H A;  1V8Q A;  1JLL B;  2W6P A;  4X66 L;  2Q8T A;  5CV4 A;  2YRW A;  3NQI A;  4MZ9 A;  2AGQ A;  4JI8 L;  4JI3 H;  3I4L A;  1KNA A;  1HZC A;  1STY A;  3NWS A;  5JPN C;  2PO4 A;  3PF4 A;  4EQO A;  3NHH A;  2D62 A;  5BPF A;  4O2A F;  2WE6 A;  4BY1 G;  3U9S A;  1D5X C;  1QZG A;  2F52 A;  2ZXR A;  2YZG A;  1WI5 A;  2XIW A;  3MEF A;  4CDF C;  2JA5 H;  4A2A A;  4B3R H;  5HUR A;  3HOW G;  3GTQ H;  4DF7 A;  2K6A A;  5KG6 A;  4KY5 A;  1NJI C;  1LTB D;  1TWA A;  4C5C A;  3T5L A;  4EQP A;  3IFD A;  5A2Q E;  4JI6 Q;  3QWN A;  3KJP A;  1DYQ A;  3N6R A;  2UXB L;  1CZW A;  5BR8 H;  5KFK A;  4A3K B;  5CAE B;  1QE6 A;  5IP7 H;  1STB A;  2EY6 A;  3I4N B;  1NMF A;  5T1I A;  4KKT A;  1Q8K A;  4BY7 B;  4ZHQ F;  3BJY A;  5E1F A;  2AUJ D;  2F0N A;  2X6G A;  3GII A;  3VR6 A;  1N36 L;  1XYI A;  1DV2 A;  4JI4 Q;  4GKK L;  3J81 c;  2B8F A;  1IL2 A;  1EYG A;  3BZC A;  1NNX A;  3GTO H;  1I6H H;  1J5E Q;  1BCP D;  4JI3 L;  1I4H A;  1QWY A;  1PVO A;  4LF9 L;  4DR3 Q;  4WJ3 M;  4O3N A;  4FM9 A;  4B08 A;  3SXH A;  4C3H H;  5KFM A;  4GN4 B;  4BA2 I;  2IBK A;  3TRZ A;  2ATW A;  3J7Z C;  3G8C A;  4YR2 A;  4BXX H;  2E2I B;  3DXJ C;  1N56 A;  3T5K A;  3KFU A;  4KHP H;  1JR0 D;  4DUZ H;  2AU0 A;  1TWG H;  5GAG C;  3QO2 A;  1WCM G;  4X3K A;  5EWE A;  3U4Z A;  2R7K A;  3GTJ A;  4RKB A;  4B3S L;  4AYB A;  1H9S A;  1G6Z A;  1B9N A;  4ZI7 F;  2K1B A;  4L5S A;  3TS2 A;  4ABN A;  2IP4 A;  1Q12 A;  2M2L A;  4EGQ A;  2EOT A;  4GS3 A;  2VQE L;  5IP7 G;  1Y1V H;  1N34 L;  2L1B A;  1GD7 A;  2Q2H A;  4JI2 H;  3K5L A;  4A3F H;  4JUZ A;  2DNC A;  1CKN B;  1W93 A;  1SYE A;  2RDH A;  1XDN A;  3OMC A;  2A69 C;  1G91 A;  2B2V A;  3S14 B;  2R84 A;  4XYM B;  4R7R A;  5K36 G;  2R92 G;  3UFX B;  1IOV A;  4M9U A;  5LMN L;  4DR5 Q;  2H5X A;  4ZRZ A;  4R4C A;  2BQR A;  3K7A B;  3LWE A;  1E4F T;  3X3N A;  5JAV A;  1I50 B;  2E5L Q;  3CF5 A;  5KFG A;  5KT6 A;  4DR6 H;  3TP7 A;  3S2H H;  1CE8 A;  5CMD A;  3VA5 A;  4AYB B;  1EZ1 A;  4C2M A;  2GA4 B;  3H3V C;  2IL8 A;  2VB3 X;  2JA8 G;  5KX5 F;  5CYU A;  2PPB C;  4A3D G;  2ZJQ A;  3HOW H;  3EYY A;  4TQS A;  5BN5 A;  1STG A;  4O3S A;  4A76 A;  1VQ6 A;  2PMZ B;  1S3O A;  3L9A X;  4RH6 A;  2LS0 1;  1S10 A;  1EUC B;  4I65 A;  3QFF A;  1Z6H A;  2UXD L;  2FK2 A;  4MV9 A;  2V9W A;  2JEG A;  3HEJ A;  3ZYY X;  2VQD A;  5I6W A;  4G7O C;  1MBY A;  4C3J H;  3CW2 C;  3MEH A;  1GUS A;  3UDX A;  2K01 A;  1YJN A;  1ET6 A;  1Y1V G;  4TVA B;  4JG2 A;  4DUZ Q;  3T1H Q;  1S03 G;  1GJX A;  4POF A;  4JI4 H;  4OGQ C;  2BA0 A;  1S5F D;  3K7U C;  3OHB A;  4L6T B;  5T14 A;  5KKN B;  1PZI D;  3I7F A;  1EU4 A;  3E0E A;  4DV6 Q;  4LH7 A;  1DON A;  2IX1 A;  3WO0 A;  3MXN A;  4DL7 A;  4DL3 A;  1VQA A;  1HNZ H;  1EUJ A;  1TWG B;  1A62 A;  1I6V C;  3LNN A;  3FDS A;  5AFW A;  3BQ1 A;  1TWA B;  1V1P B;  4DV3 Q;  3S1R B;  3HOV H;  1HPC A;  1KJ9 A;  3NEN A;  1Z2P X;  2VQF H;  4JV2 A;  2JA5 B;  1KDB A;  3PSI A;  5FK9 C;  3M9O B;  4ED3 A;  4AYB E;  1EFI D;  4YR3 A;  3G6V A;  4IUQ A;  4UCV A;  2VB2 X;  4DR3 L;  1BJT A;  1VBG A;  4JW0 A;  1PH9 A;  4LF4 H;  3AB9 A;  4IFD J;  4IN3 A;  2J7Z A;  4XT1 B;  3HKZ E;  4FF3 A;  3CCS A;  2UXB Q;  2NVT H;  2DPI A;  3CXC A;  2SOB A;  2UUB Q;  5C4H A;  4BY1 B;  2A5H A;  1ICW A;  2MHV A;  2E2J H;  3VR2 A;  1TWF A;  3V6H A;  4LFB L;  2F3V A;  1WTR A;  1I50 H;  3HOV B;  1FD7 D;  5JH7 F;  1E1T A;  2L12 A;  4QL5 A;  3PO2 B;  4RAU C;  2VOB A;  1E4G T;  3NE5 B;  2I80 A;  4JBK A;  4LSA A;  4DV5 Q;  1SRU A;  5E4W C;  2R87 A;  3N6X A;  4X64 H;  1T94 A;  4U7C A;  2YU9 H;  3LWU A;  4QGU A;  4DPG A;  2MP1 A;  3D31 A;  4RG1 A;  1EIY B;  3PIP A;  1K73 C;  3H40 A;  3S15 H;  1Y14 B;  3HRZ C;  3CCJ A;  3GTM B;  2JEJ A;  1F9S A;  4JI1 L;  5KFD A;  2WB1 G;  4C3J B;  1BDO A;  1CI3 M;  4LAA A;  1SXT A;  3A56 A;  4HJ5 A;  3J7A K;  1JIH A;  4X62 L;  1QIL A;  4DAP A;  4A3C H;  5D1O A;  2EQS A;  4QY7 A;  2E2H A;  4DR2 Q;  5JEA H;  1VQM A;  4K8I A;  5COR A;  1F9P A;  2HCC A;  3HKZ B;  4C56 C;  2JJQ A;  5DM6 3;  4A3E B;  3J7A 5;  1RK6 A;  4EBD A;  1DOM A;  4CC6 A;  3NGD A;  5JVG 3;  4GLX A;  2WII B;  4HCS A;  3OUZ A;  5IWA H;  1BVS A;  2PNR C;  4NDX A;  4NW2 A;  1KNE A;  4WOR A;  5CB4 F;  5EJW A;  4O2D A;  4LWC A;  2EY2 A;  4RZR A;  3G48 A;  5CV8 A;  3FPU B;  1WD1 A;  4BXX G;  4EBE A;  1HTL D;  1A9X A;  4DV0 H;  4H02 A;  2K50 A;  1VQE A;  4QQB X;  3OHA A;  4OO1 H;  4EGJ A;  3MA2 B;  3FKI H;  3MJF A;  2XTI A;  5CV5 A;  1SR3 A;  1VQG A;  3N41 B;  2W7P A;  1KLU D;  3PW2 A;  4ED8 A;  3QG1 A;  1FVI A;  4ED0 A;  3MWM A;  2CZG A;  3FPP A;  4EQN A;  4OL7 A;  3CD6 A;  3S1N B;  2W6N A;  1E22 A;  4EEY A;  5BMV F;  1EOT A;  4ZAI A;  3WOF A;  4NXM H;  4K5X A;  2ES2 A;  3R3O A;  4LF9 Q;  2E5L L;  1TR5 A;  4C5B A;  4IUN A;  4J15 A;  4MTD A;  5BR8 Q;  2UUC Q;  1AN8 A;  1B33 N;  1VQ7 A;  4TQU S;  1YZ6 A;  4QUC A;  1TT2 A;  5IP9 H;  3EJI A;  4R4Q A;  1N32 Q;  2O5J C;  5CA0 F;  2RDF A;  3RFC A;  2Z6K C;  5DNF A;  2SNM A;  3IN5 A;  1VQH A;  2L5T A;  2UUC L;  1A8V A;  3RNU A;  1BUV T;  2Z0S A;  1X6O A;  1HUN A;  1Y8N B;  4C3J G;  1EOV A;  3STB D;  4GC6 A;  5K2M A;  2PQA A;  2PVP A;  1J5E H;  5E7N A;  4JI5 L;  3KUP A;  5KFX A;  4DV0 L;  3QOJ A;  3ZJY C;  2UUA L;  4M8A A;  5EQ0 A;  2R86 A;  4EG0 A;  3N8D A;  1BR9 A;  1TY0 A;  1CQI B;  3G6Y A;  1EY6 A;  3D6W A;  5T1G A;  5CA1 F;  4YAK B;  1HQM C;  5KFY A;  3HGB A;  1CQF A;  5M3F G;  5KG5 A;  1EQQ A;  4A93 G;  2QA4 A;  3TBI B;  5IWA Q;  4MIU A;  1N33 H;  1X54 A;  3HOW B;  4POG A;  1MSG A;  2HCI A;  5L1I A;  4L63 B;  4JYA H;  1HCZ A;  1XNR L;  3BG5 A;  1NR2 A;  2B39 A;  1UE1 A;  3GTL H;  4X65 Q;  2RF4 A;  4JI1 H;  2L4N A;  3EPG A;  2MO0 A;  4GKK Q;  4YJ3 F;  1N36 Q;  4EFE A;  2EJG C;  3K5M A;  4BBS G;  1G29 1;  5I9O A;  1C3O A;  4R4O A;  3AYH B;  4BA1 I;  4F4Z A;  5CBA E;  5LMU H;  1UC9 A;  5KRU A;  4X64 L;  3KBG A;  2E2H H;  2HQL A;  1W3S A;  5JEA G;  1E0B A;  4PQX A;  1GHJ A;  2R7L A;  3W3A A;  1XWE A;  2GPS A;  4YHH L;  3Q8P B;  5HGQ A;  1QB5 D;  3J81 W;  1PFS A;  4OEM B;  3FMA A;  1Y1W H;  4DR7 L;  4LF5 Q;  4LFB H;  4QJF A;  3I3C A;  1V1O A;  4R1J A;  2R85 A;  4JVZ A;  3UDG A;  1SJE D;  4O2B F;  4QWE A;  3A7L A;  5JPM C;  3VA7 A;  3R5F A;  2W9C A;  1JWU D;  4ECY A;  4B9X A;  1XPO A;  2C35 B;  3VYR A;  3DF7 A;  2HHH L;  1PYB A;  3FKI A;  2J0T D;  5IYB G;  2DY8 A;  5DLF A;  4F4Y A;  1BQQ T;  2D0O A;  4PZ7 A;  1IYU A;  1HQR D;  4A75 A;  5EKI A;  2TSS A;  1PFN A;  3JAM i;  1X3E A;  2NN6 H;  3G6J B;  2C28 A;  4KY7 A;  2ZTE A;  3KF8 B;  1UEB A;  3PUZ A;  3GTG B;  2J9G A;  5J2T F;  4ED6 A;  5FO8 B;  4ILW A;  3BDO A;  1HNZ L;  3GTK H;  1IOW A;  4HIO A;  2PN1 A;  5LOV F;  1QVF A;  5E3F A;  1X3Q A;  3BDC A;  1EIF A;  1S5C D;  1CZG A;  2KBN A;  3MFY A;  3E5N A;  4R8U A;  4DL4 A;  3PIP 3;  2YU9 B;  3CHB D;  4QWB A;  4LSX A;  4JI1 Q;  4X65 H;  1S97 A;  4XX0 B;  3M4P A;  3G71 A;  2WDT A;  4JI4 L;  2F0M A;  1QCB D;  2GVA A;  3FMC A;  3EA6 A;  4N9T A;  2C2D A;  1U4R A;  4A3C G;  3DHQ A;  5ELN A;  1V1P A;  3S24 A;  2OT2 A;  2ZM6 H;  3S15 B;  5M5Y B;  2R92 B;  1WFQ A;  2SEB D;  2HVQ A;  3CME A;  1JWM D;  1B6S A;  5D8D A;  3T5H A;  3K59 A;  3T53 B;  4DU9 A;  4DL2 A;  5DQI A;  2CW8 A;  1QVG A;  1MGS A;  4HIK A;  2Q2I A;  4H0L C;  4DK1 A;  4A3I H;  1F9Q A;  1CKN A;  1SAP A;  4NMZ A;  4HJA A;  5DQH A;  1XMQ Q;  3EIV A;  4FF2 A;  5EAY A;  2IW3 A;  4YR0 A;  2A6H C;  2XN9 C;  2XGP A;  1B53 A;  2NZ1 D;  4NXN Q;  1KDC A;  2JA6 G;  4A3M H;  2A8V A;  1PRT B;  2XSC A;  1J8I A;  2AHO B;  2F0O A;  3IFT A;  4GZY C;  3QOL A;  3MR6 A;  3T1Y H;  1PV4 A;  5M5Y H;  5KG3 A;  1VQ4 A;  4LH6 A;  5KEE A;  3PQI A;  1TS5 A;  2F0P A;  1EY5 A;  1H9M A;  5C1P A;  1EQR A;  4JI8 Q;  5J39 A;  1DXM A;  3GO5 A;  1ML0 D;  1S5B D;  3S17 B;  3GD7 A;  3NPP A;  4JI7 H;  2DIK A;  3GV3 A;  1TS4 A;  1XMO H; 
#chains in the Genus database with same CATH homology
 4IJH A;  3BU2 A;  2KHJ A;  3AFQ A;  4MZ9 A;  4LFA Q;  2CFM A;  2VY3 A;  1FL0 A;  4JI8 L;  2A19 A;  4DV4 L;  3OTO Q;  2ZJR A;  4HJ7 A;  3KF6 B;  1HZC A;  3OW2 A;  3PF4 A;  5IYC H;  5HY6 A;  1SE8 A;  4C3I H;  4AIM A;  4DR1 Q;  2D62 A;  3WWV A;  4L5R C;  1Q86 C;  2K4K A;  2ZTC A;  4NPS A;  4YWL A;  1EWI A;  4BY1 G;  1GO3 E;  3L7Z C;  1QZG A;  2F52 A;  4YY3 Q;  1WI5 A;  3MEF A;  3UDI A;  5AJ3 Q;  2JA5 H;  4LF7 Q;  3HKS A;  3J80 i;  1NMG A;  3HOW G;  3GTQ H;  4LF4 L;  1X9N A;  4A3J G;  1KD1 C;  3ULP A;  4DUZ L;  1XPR A;  1NJI C;  1D7Q A;  1QUQ B;  4GOP C;  2I0Q A;  4JI6 Q;  2GN5 A;  2R7D A;  1V9P A;  4A3G H;  2R93 G;  1HNZ Q;  3KJP A;  1XNR Q;  3M4O H;  1AE2 A;  5IYD G;  2VW9 A;  4IFD I;  4A3F G;  2UXB L;  4A3E G;  3LGJ A;  3NEM A;  4QIW E;  1SN8 A;  2VQF L;  4UP7 A;  2JA5 G;  2YTV A;  4LF6 Q;  1XMQ L;  5IP7 H;  4GKJ Q;  2IX0 A;  1NMF A;  3CCR A;  5GAE C;  4DR5 L;  4R4I A;  1IBM Q;  1Q8K A;  2QGQ A;  2R92 H;  1NY4 A;  1Q1E A;  1KXL A;  3U4V A;  4B3T Q;  4O0A A;  1KQS A;  4OWX B;  3S1R H;  1N36 L;  4JI4 Q;  3ER0 A;  3PO3 H;  2UU9 L;  1T9H A;  3A5U A;  3K7A H;  3J81 c;  2VQF Q;  4GKK L;  3PF5 A;  4OO1 I;  1IL2 A;  1EYG A;  3BZC A;  1B7Y B;  1I6H H;  3L0O A;  3GTO H;  2BH8 A;  2I5M X;  3H3V I;  1J5E Q;  1L1O A;  4JI3 L;  1Q82 C;  3I4N G;  1J6Q A;  1VQD A;  4B3M Q;  4DR3 Q;  4LF9 L;  1PVO A;  4WJ3 M;  3GTP H;  1X56 A;  4FDB A;  4C3H H;  1SFO H;  4GN4 B;  1R9T H;  3CCV A;  4BA2 I;  5GRO A;  1IBL L;  3TRZ A;  2ATW A;  5BR8 L;  2OWO A;  4IPC A;  3J7Z C;  1A63 A;  2R7Z H;  4A3E H;  1L1O C;  1YNX A;  2K5V A;  3I4O A;  1D8L A;  2EIF A;  2VS1 A;  3J81 i;  3I55 A;  4BXX H;  2VNU D;  3M7N A;  3KFU A;  4A3K H;  1TWG H;  1TWF H;  2LXJ A;  3OYY A;  3RR5 A;  4APV A;  5GAG C;  1K8G A;  4DR1 L;  1WCM G;  2UUB L;  3U4Z A;  3T1Y L;  2UXC L;  2VL6 A;  4DUY L;  3CP0 A;  4A3M G;  4B3S L;  2YV5 A;  4X64 Q;  2RHQ B;  4DR4 Q;  1G51 A;  3FP9 A;  4JI2 Q;  1N34 Q;  1E7Z A;  4L5S A;  1H95 A;  3TS2 A;  4GN5 A;  4AQY L;  4A3B G;  4NB3 A;  2OTJ A;  3F1Z A;  1Q12 A;  5IT9 c;  3S17 H;  3RZO H;  3H0G G;  4IPD A;  4GS3 A;  2VQE L;  5IP7 G;  1Y1V H;  5IY0 A;  1N34 L;  4JYA L;  4K0K Q;  3JAM c;  5C0X G;  4DR4 L;  1GD7 A;  2Q2H A;  4JV5 L;  1NTG A;  2AWO A;  2I5H A;  4A3F H;  1CKN B;  1N33 L;  1JE5 A;  1VQI A;  2OQK A;  3S1N H;  3ULL A;  2N8N A;  2WFW A;  5C3E G;  5K36 G;  2R92 G;  2ZM6 L;  1K3R A;  5LMN L;  4DR5 Q;  1YHA A;  2H5X A;  1OXT A;  1DGS A;  3CMA A;  4R4C A;  1PH2 A;  1N33 Q;  2A1A A;  2F4V L;  3JC6 6;  4LFB Q;  3BJU A;  2OQ0 A;  2PMZ E;  5IYB H;  5C44 G;  3CF5 A;  1PH8 A;  2E5L Q;  2VUM G;  3H3V H;  3S2D H;  1M90 C;  3CCL A;  4A3G G;  4UY8 C;  1CUK A;  3S2H H;  2R7F A;  4LFC Q;  5M5W H;  4X66 Q;  5C4J H;  5C4X H;  1X3F A;  1A0I A;  2JA8 G;  1YI2 A;  2F3I A;  4A3D G;  1RIP A;  2ZJQ A;  3HOW H;  4A76 A;  1VQ6 A;  1PYS B;  4GOP A;  2Q2T A;  1S3O A;  1HNW Q;  2BH2 A;  1Y1W G;  3H0G H;  5ELO A;  2UXD L;  3PV0 A;  4OON A;  4BY1 H;  3HOX H;  5FJ8 H;  3CC4 A;  3TRE A;  2K52 A;  3KJO A;  2JEA I;  4LF6 L;  4A4I A;  1LUZ A;  1KRS A;  3CW2 C;  4XIG S;  4LUO A;  4YWM A;  4C3J H;  1K9M C;  3PUY A;  3UDX A;  2PI2 E;  3CQZ H;  1YJN A;  4DR2 L;  1NE3 A;  2K5N A;  1Y1V G;  1TXY A;  1VQO A;  1PH3 A;  4TVA B;  4JG2 A;  1C9O A;  4DUZ Q;  3U50 C;  1V43 A;  1HJP A;  3M4Q A;  3CCU A;  2MO1 A;  4POF A;  4OWT B;  3T1H Q;  1I94 Q;  3L2P A;  2BA0 A;  4DK3 C;  4DV2 L;  1YJW A;  3K7U C;  2Q2U A;  3G4S A;  4AQY Q;  2I5L X;  5M5X H;  1KIX A;  1O7I A;  3I7F A;  1B8A A;  1M1K C;  3E0E A;  4DV6 Q;  3HOV G;  3CCQ A;  2CQO A;  4A3L H;  1I94 L;  2IX1 A;  1HZ9 A;  2JE6 I;  3T1H L;  3T1Y Q;  3CAM A;  1VQA A;  3I4N H;  2CWA A;  4A3J H;  1FJG Q;  1EUJ A;  5LMU Q;  1A62 A;  1L2F A;  3BZK A;  3MXN B;  1L0W A;  3F2C A;  3S16 H;  2RCN A;  3Q8D A;  4DV3 Q;  1VQF A;  1JB7 A;  2HT1 A;  3HOV H;  3NEN A;  3G6E A;  4IPG A;  4YY3 L;  4LNQ A;  3PSI A;  3KOJ A;  4ALP A;  2GVB A;  5LMU L;  1KHI A;  2IT1 A;  5IWA L;  4AYB E;  2KEN A;  2N49 A;  4DV7 Q;  1Q81 C;  4DR3 L;  3M9B A;  5IYC G;  1PH9 A;  1UE7 A;  2PQA B;  4IFD J;  1WOC A;  1VQL A;  3HKZ E;  4IJL A;  3CCS A;  2UXB Q;  2NVT H;  1OXX K;  3B6Y A;  4KHZ A;  4PZ6 A;  3CXC A;  3RZD H;  1N9W A;  5M3M H;  4JYA Q;  3CC7 A;  2UUB Q;  5IE8 A;  1KAW A;  4Y7N H;  3K8A A;  2ZM6 Q;  2E2J H;  1SMX A;  4JI3 Q;  1AE3 A;  3PO2 H;  3W1B A;  2Y0S G;  4LFB L;  1X3G A;  1I50 H;  1YVC A;  1I5F A;  3HOZ H;  3NBH B;  1E1T A;  4QL5 A;  3A5Z B;  3RN5 A;  4BBR H;  4DV1 L;  2WP8 J;  4JBK A;  1QVC A;  2YYZ A;  2CCZ A;  2IHF A;  4DV5 Q;  1SRU A;  3CC2 A;  1E1O A;  5M3F H;  4OX9 Q;  1IYJ B;  1FGU A;  2WB1 E;  1HR0 W;  2ALY B;  1KC8 C;  4JOI C;  4DV3 L;  3W1G A;  5GAH C;  2YU9 H;  5AJ3 L;  1GKH A;  1AH9 A;  1YBY A;  2L15 A;  5GQO A;  4DK6 C;  4QGU A;  3W5O A;  4DPG A;  3D31 A;  4DV5 L;  4RG1 A;  1HZA A;  1VS0 A;  1IXR A;  4P75 A;  4JI0 L;  2CWP A;  2PI2 A;  1EIY B;  2JA9 A;  3PIP A;  1K73 C;  3HOY G;  3S15 H;  1Y14 B;  3CCJ A;  1WJJ A;  2NVX H;  1J5E L;  2KCT A;  4JI1 L;  1PH5 A;  1U0L A;  2WB1 G;  4LW1 A;  2LXK A;  2F4V Q;  5FLM G;  4JC0 A;  1XPU A;  4HJ5 A;  1X65 A;  4X62 L;  3PUW A;  2E8G A;  4A3C H;  1LYL A;  2EQS A;  4QY7 A;  4EQ5 A;  2N3S A;  4HJ9 A;  3KDF A;  4GLA C;  2NN6 I;  4DR2 Q;  2MQH A;  1E3P A;  2V1C C;  4BBR G;  4C2M H;  1MIU A;  1VQM A;  1ASZ A;  1MKH A;  2JJQ A;  3GTJ H;  3J7A 5;  4DR6 Q;  2JA7 G;  4DV0 Q;  3S1Q H;  4NXM Q;  1LTL A;  4GLX A;  2LSS A;  1HZB A;  1WCM H;  2UXC Q;  1VQC A;  2WAQ G;  1BVS A;  4JBJ A;  1WYD A;  1TWC H;  4LF8 L;  4HID A;  3DM3 A;  1V1Q A;  3SGI A;  4O2D A;  4LWC A;  4GNX A;  4A3L G;  3EN2 A;  4JCV E;  3G48 A;  4BXX G;  4ME3 A;  1K83 H;  1Q1B A;  4NXN L;  3NEL A;  4X65 L;  4H02 A;  2OTL A;  3S1M H;  2K50 A;  1VQE A;  2VQE Q;  4QQB X;  3A0J A;  1FJG L;  1JJG A;  1MJC A;  4DV7 L;  4PMW A;  2NVQ H;  3FKI H;  5JJK A;  3FKI G;  2B63 H;  2XTI A;  4A3I G;  1SR3 A;  1VQG A;  4JBW A;  4DV1 Q;  1IBK L;  1VQN A;  1OXU A;  3IRB A;  1FVI A;  2B29 A;  3E9I A;  1PH6 A;  1VQK A;  3CD6 A;  2K14 A;  4L5Q A;  1E22 A;  1GVP A;  5GAD C;  1E24 A;  2YTY A;  1Q46 A;  3PO3 G;  2R93 H;  4OXP A;  4KI0 A;  1SLJ A;  3PCO B;  4X62 Q;  2ES2 A;  4BY7 H;  4DAM A;  4LF9 Q;  3A74 A;  5J3B A;  3I4M H;  2E5L L;  1YIT A;  5FLM H;  2RHS B;  1OXS C;  2JA7 H;  2IY5 B;  4J15 A;  3OTO L;  3VDY A;  2Y0S E;  1VQ8 A;  5BR8 Q;  4DKA C;  1CSP A;  1PH7 A;  2UUC Q;  1GM5 A;  5FLX c;  1VQ7 A;  4TQU S;  4UPA A;  3CCM A;  1YZ6 A;  1BBW A;  5IP9 H;  3PGZ A;  1Q7Y C;  4B3T L;  5H1S E;  3K80 C;  4R4Q A;  1N32 Q;  1XJV A;  1HNW L;  1C7Y A;  4PG3 A;  4GNX C;  2Z6K C;  1QUQ A;  3UE1 A;  1VQH A;  2UUC L;  1A8V A;  4MNO A;  4B3S Q;  4LF7 L;  3RNU A;  4DV4 Q;  1MJE A;  2Z0S A;  1X6O A;  1U5K A;  2E2I H;  2MFI A;  3HOU G;  3M3Y H;  2YTX A;  4DR7 Q;  1EOV A;  3STB D;  4AYB G;  2ASB A;  2PQA A;  5IP9 G;  5E7N A;  4JI5 L;  4AH6 A;  1XTD A;  4BY7 G;  4DAY B;  2D0P A;  1PA6 A;  3RLF A;  1VQB A;  2MNA A;  4KLK A;  4DV0 L;  3ZJY C;  2UUA L;  4JBM A;  2JQO A;  1S72 A;  3AFP A;  1PH1 A;  2NZH A;  3CCE A;  3E9H A;  4B3R Q;  4A3D H;  5M3F G;  1EQQ A;  1VQ9 A;  4A93 G;  2QA4 A;  5C0X I;  4HIM A;  4GLV B;  4YCU A;  5IWA Q;  5LMN W;  1X54 A;  4LUV A;  4DV6 L;  4POG A;  4P72 A;  4JI2 L;  1UE5 A;  3RLO A;  1VQ5 A;  4PZ8 A;  4P71 A;  4R4T A;  1IBK Q;  1HR0 Q;  3HOZ G;  2KHI A;  4LFA L;  1XNR L;  1VCI A;  3KLW A;  1VQJ A;  4B3M L;  5C3E H;  2AMC B;  1XNQ Q;  4LFC L;  4HJ8 A;  1UE1 A;  1XMO Q;  4OWW B;  3TEH B;  3GTL H;  4X65 Q;  2RF4 A;  1L1O B;  2JA6 H;  1I3Q H;  3EBE A;  2MO0 A;  1IZ6 A;  2R7Z G;  2UU9 Q;  4GKK Q;  1YHQ A;  2NVY H;  4Y52 H;  3RLN A;  1N36 Q;  4BBS G;  2XGT A;  1CKM A;  1G29 1;  4JI6 L;  5LMN Q;  1UWV A;  2PNH A;  2K75 A;  5DLQ E;  1HNX L;  1JT8 A;  3I2Z A;  3HOX G;  4R4O A;  3AYH B;  3STB C;  4GN3 B;  4BA1 I;  4DNI A;  2R6G A;  4KHP L;  1B70 B;  4BBS H;  5JEA J;  1JJ2 A;  1G6P A;  4X64 L;  1P16 A;  1S40 A;  2E2H H;  2HQL A;  1W3S A;  5JEA G;  5IYD H;  2JA8 H;  5C4X G;  3J81 j;  1YJ9 A;  3HOY H;  4YHH L;  1LM0 A;  4LF8 Q;  5HGQ A;  3U58 A;  5JJI A;  2HIX A;  3KF6 A;  2B3G A;  5FJ8 G;  2N78 A;  1OTC A;  1KRT A;  2WAQ E;  3CPF A;  1PFS A;  3AEV A;  5C44 H;  1Y1W H;  2VUM H;  4LF5 Q;  4DR7 L;  1C0A A;  2FXQ A;  4QJF A;  3AQQ A;  1PHJ A;  2ID0 A;  1CSQ A;  2HHH Q;  4R1J A;  1TWA H;  1JMC A;  4DUY Q;  3I4M G;  3UDG A;  4GOP B;  1BBU A;  1PH4 A;  4JI7 Q;  2CKZ B;  2DGY A;  3F2D A;  4IFD G;  1XPO A;  2C35 B;  1X55 A;  4IOC A;  4P74 A;  2HHH L;  1PYB A;  3ERS X;  5IYB G;  1QZH A;  2AWN A;  4EX5 A;  4MTN A;  2D0O A;  4PZ7 A;  4UP8 A;  4K0K L;  2DUD A;  1P8L A;  4YWK A;  4GNX B;  1N32 L;  1W2B A;  4A75 A;  4DV2 Q;  2OCE A;  4NXM L;  4OO1 G;  3JAM i;  1X3E A;  4LF4 Q;  3S14 H;  5M3M G;  2ZTE A;  3K0X A;  3KF8 B;  1UEB A;  3PUZ A;  3HOU H;  1K8A C;  4B3R L;  3KYH C;  4IO9 A;  1JJC B;  4WJ4 A;  3M85 A;  1BKB A;  1HNZ L;  3GTK H;  1KL9 A;  4YCV A;  4HIO A;  3PO2 G;  4IOA A;  3KDF B;  2UUA Q;  1QVF A;  2HIV A;  4YHH Q;  2ZTD A;  3DLL A;  1EIF A;  5C0X J;  2KBN A;  2ZJP A;  4A3B H;  1HNX Q;  3FHW A;  4DR6 L;  3HFZ B;  4JI1 Q;  3F8T A;  1YHB A;  3RN2 A;  3M4P A;  2AKW B;  1SRO A;  3G71 A;  2GVA A;  4RMF A;  4JI4 L;  1K0R A;  2JK8 A;  2IHE A;  3J80 c;  1XNQ L;  4UP9 A;  4JI5 Q;  2KCM A;  1XMO L;  2B63 G;  4JOI A;  4A3C G;  5ELN A;  4L5T A;  4JI7 L;  3S24 A;  3D0F A;  1IBM L;  2UXD Q;  1Z47 A;  4IPH A;  1WFQ A;  3GDE A;  1HR0 L;  1EFW A;  3CME A;  4LUZ A;  1HH2 P;  4LF5 L;  1CKO A;  3HKZ G;  3K81 C;  1YIJ A;  3CPW A;  1QVG A;  1UE6 A;  1YEZ A;  4HIK A;  2Q2I A;  4A3I H;  1CKN A;  4JI0 Q;  4HJA A;  1XMQ Q;  1ASY A;  3EIV A;  4GKJ L;  5EAY A;  5JJL A;  3PIO A;  1N8R C;  4YCW A;  3UE0 A;  4XTC S;  3ULJ A;  1IBL Q;  4NXN Q;  2JA6 G;  2EXD A;  2JEB I;  4A3M H;  2A8V A;  4JV5 Q;  2NZO A;  1NBW A;  4X6A H;  2QEX A;  2AHO B;  4KHP Q;  3F2B A;  4A93 H;  3ICE A;  3PUV A;  4OX9 L;  3UDF A;  2K5H A;  5M5Y H;  1PV4 A;  1VQ4 A;  4A3K G;  1OXV A;  1TWH H;  2Z6K A;  2VZA A;  3I56 A;  3TS0 A;  2BA1 A;  3GTM H;  3H15 A;  3GTG H;  1EQR A;  1VQP A;  4JI8 Q;  3PUX A;  3TQY A;  3GO5 A;  2NN6 G;  3GD7 A;  4P73 A;  4X66 L;  1RL2 A;  1Z9F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...