3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
1S3OA 4BXXH 3BZCA 4HJ8A 4UP7A 4L5QA 2HQLA 2K52A 3FKIG 4R1JA 3IRBA 4LF8L 4NPSA 2KBNA 4JI1L 4A3EH 1GM5A 3AFQA 2E2JH 1JMCA 4BBRG 1YJNA 2UXDL 1XPOA 3F8TA 2C35B 5IYCG 4NXNL 2K4KA 1B7YB 4LUOA 1KRTA 4AQYQ 1Q82C 2R7FA 2HIXA 3RLNA 4MTNA 1KC8C 1XMQL 2F4VQ 3I4NH 1M1KC 4LF6Q 4DR6L 4HJ5A 2Q2UA 2PI2A 4JI4L 2A19A 4KHPQ 5JJIA 1YVCA 5HGQA 1EIFA 2UUAL 3DLLA 3U58A 4BY7G 5AJ3Q 2ZJQA 4DUYQ 1A8VA 1O7IA 4A93G 1HZCA 4LFBL 5FJ8H 2VL6A 4HIOA 3S15H 1JJ2A 1X65A 4JG2A 2BA1A 4ALPA 4AYBG 4X65Q 2ASBA 2XGTA 1G291 2CWAA 2JA8G 3HOYH 3OTOL 4OONA 4OWXB 3KF8B 1HH2P 3F2DA 4RG1A 1KHIA 1Q8KA 2JEBI 4YHHQ 3ULPA 4IJLA 2IHFA 4JI0L 3I4OA 5ELOA 4DK3C 4DV7L 2JA5G 1I6HH 1VQKA 1YEZA 4X66L 4JV5Q 4GKJL 1KD1C 5IYDG 5C44H 3S24A 3CCRA 1EQRA 2HHHL 5M5YH 1SLJA 1SFOH 1KIXA 1DGSA 3U4VA 4JI5L 1VQ6A 2YU9H 3W5OA 3CMAA 3S17H 2PI2E 3HOXG 1VQNA 4LFAQ 2K5VA 2B63G 4DAYB 3T1YL 4JI3L 4LF4Q 5GADC 3M7NA 3A5ZB 4A3KG 1PH4A 2PMZE 1X54A 3E0EA 2OWOA 3HKZG 3KOJA 2VNUD 4IFDG 1Y1VG 3CCUA 3PV0A 5C3EH 1VQ8A 2NZOA 2CQOA 1PH1A 1HR0Q 1Q86C 4YWLA 3GD7A 1PH7A 4APVA 4QJFA 4GKKL 4A3CG 1FL0A 4LF5L 2WP8J 4LF8Q 1CUKA 3GTGH 1YITA 4Y52H 4K0KL 3TEHB 5GAEC 3H3VH 2UXDQ 2I5MX 3PUYA 3RLOA 4YY3Q 5M3MH 3MXNB 1JB7A 2WAQE 3HOVH 2B29A 2K50A 4NXNQ 1W3SA 2A8VA 5J3BA 1XMQQ 3UDGA 4XTCS 2KCMA 3CC2A 4X64L 1SROA 5IY0A 3CMEA 4DR6Q 2VS1A 4P73A 3I2ZA 1QVGA 1JJGA 1YJ9A 4JI4Q 3WWVA 4A3JG 3PO3H 2ES2A 3CCQA 1EIYB 2UUAQ 4BBSH 1AH9A 2NN6G 5IP7G 1LUZA 3L0OA 3H15A 4GOPB 4IOAA 4LFBQ 1I50H 1D8LA 2DUDA 4OO1G 5JEAG 4B3TL 2QGQA 1B8AA 3K81C 1OTCA 1PHJA 2UU9L 3K8AA 3OTOQ 1QZGA 1UE5A 2YTYA 5C4XG 1N8RC 4O2DA 1NE3A 1E3PA 2GVBA 3RR5A 1EWIA 4DAMA 4JI0Q 1XNQQ 1NJIC 3ER0A 5C4JH 2JJQA 4DV7Q 1QVCA 4A3BH 2IX1A 4X66Q 3G6EA 4DV3L 4HJAA 5FLXc 4QY7A 5FLMH 3PIPA 2NVXH 3EN2A 3K7UC 4TVAB 2VQEQ 1Y1WH 2K5HA 1T9HA 2HHHQ 2AMCB 2Q2IA 1VQCA 3RZDH 3PF4A 4HIMA 4JI5Q 3TS2A 5GQOA 5C0XJ 4A3LH 4C3JH 4QIWE 3TREA 4L5SA 1GD7A 2LXKA 4EQ5A 5EAYA 4A3FG 2E2HH 1WOCA 4DV4L 5IP9G 1WYDA 4IFDI 5DLQE 2Z0SA 3L2PA 1VQHA 2MO0A 2YTXA 1E7ZA 3CAMA 3PUXA 4DK6C 1IBML 1QUQB 3HFZB 4A3MH 2CWPA 2MO1A 4GKKQ 5H1SE 4LF5Q 3K80C 4LNQA 4WJ4A 5LMNW 2WAQG 4P75A 4R4QA 3ERSX 1HJPA 5LMNL 3RLFA 4K0KQ 1E1OA 4C3HH 4UP9A 1PH8A 1E24A 1HNXL 1UE6A 4PMWA 3W1BA 4BXXG 3K7AH 4DV5L 4A75A 2VUMH 3UE1A 2ZJPA 1CSQA 1LM0A 1X55A 4X64Q 3CC4A 3CCLA 4A3EG 4GLAC 1KAWA 1BVSA 3OW2A 1XPRA 4IPGA 4R4CA 4JOIC 2R7ZH 1KXLA 2R6GA 1XNRL 2VW9A 2KCTA 1VQPA 3STBD 3S1MH 2NN6I 1JJCB 4DV2L 3I4NG 4QL5A 4DR5L 2JE6I 1GO3E 2ZTCA 3CPFA 4H02A 4NB3A 3G48A 1BKBA 4KI0A 3KJPA 1L2FA 4UY8C 4DR4L 4OO1I 3KDFB 4B3TQ 2IX0A 2QEXA 2RCNA 2UU9Q 1IBKL 4POGA 4YWKA 1D7QA 3PUWA 2R7DA 2R93H 2Z6KC 1K8GA 4DV6L 2HIVA 3UDIA 3NEMA 1OXUA 5FJ8G 2D62A 2MFIA 4ME3A 2D0OA 4B3ML 5ELNA 1VQMA 1PH5A 2AWOA 3GTLH 1I94L 1V1QA 4DUZL 3HOYG 4R4IA 1I5FA 1Q1BA 4DV3Q 2XTIA 1YHQA 4IOCA 2KENA 1Q81C 1X3FA 1MIUA 2OCEA 5LMUL 2D0PA 4GN5A 2IY5B 5C44G 2RHSB 3EBEA 1IBLL 1AE2A 3HOZH 4A3GH 1MJEA 4GNXC 3W1GA 4DV4Q 2ALYB 1HZAA 4EX5A 1AE3A 2BA0A 3PO2H 4JOIA 2NVQH 1IBMQ 1KL9A 4UP8A 2WB1E 1EQQA 1N32L 2B3GA 3H0GH 4DNIA 3PF5A 3DM3A 5LMNQ 1WCMH 5C3EG 1EFWA 1XPUA 2IHEA 1HNXQ 2JA7H 3GTOH 2E5LL 1VQDA 2ID0A 4DV5Q 2Z6KA 3HKZE 2H5XA 3GTQH 2UXCL 1G6PA 2Q2HA 3J81i 2EXDA 3HOUH 1I3QH 3S14H 3PUVA 4JI1Q 4DR3L 5M3MG 5E7NA 4IO9A 3HOVG 3U4ZA 1IL2A 2YYZA 1XNRQ 1MJCA 4A3IH 3J7A5 3M3YH 4LF7L 3MEFA 4HJ7A 1L0WA 4B3SL 2VY3A 4DR1L 3M85A 4DR5Q 3M4OH 3B6YA 3G71A 3TRZA 1VQ5A 2NZHA 4IPDA 2CCZA 4LFCL 5M5WH 3PO3G 4DR4Q 4BBSG 3PGZA 4LUVA 2NVYH 4LWCA 4A76A 1C0AA 2EIFA 3CXCA 2PQAA 4JBJA 1YBYA 4DV6Q 2N8NA 4GNXA 5M5XH 3J81c 1NMFA 1X9NA 1VQLA 1RIPA 1V43A 1SMXA 3UDXA 1L1OC 1QZHA 1FGUA 2V1CC 1K8AC 3L7ZC 4JC0A 2I0QA 4B3MQ 3CQZH 1FJGL 3UE0A 3I4MH 4KLKA 1I94Q 4IPHA 4DUZQ 3RN5A 5JJLA 1OXVA 4JBWA 1K73C 3HOWH 4YCVA 5M3FH 3FP9A 4YCUA 1HNZL 5C0XG 3NELA 4KHZA 3STBC 4A3DG 1CKNA 4A3BG 5LMUQ 1M90C 5IT9c 4L5RC 2AKWB 4JI2L 2JA6G 3LGJA 3NENA 5FLMG 4GKJQ 2MQHA 1IBLQ 3CC7A 1PFSA 4P71A 3AEVA 4JI7L 1VCIA 1FVIA 1HZBA 2WB1G 3FHWA 2R92H 2Y0SE 3RZOH 3J81j 3CPWA 1S72A 4A3LG 3D31A 1TWGH 2BH2A 3ULJA 3T1YQ 4JI3Q 4TQUS 4OWTB 4GS3A 2PQAB 3F2CA 3AQQA 1HNWL 5AJ3L 3TS0A 2ZM6L 1PH2A 4JYAL 4J15A 1UEBA 2E8GA 2RF4A 4P72A 1PH6A 4YCWA 1IZ6A 3J7ZC 1PV4A 1WFQA 4A3MG 2E5LQ 3KF6A 2OTLA 3M4QA 2K75A 2I5LX 2OQKA 4GN3B 5IYBH 2UXCQ 1VQAA 1VQBA 4MNOA 3KFUA 4HIDA 2F3IA 2ATWA 3H3VI 4BY1H 1L1OA 5GROA 4DR3Q 1J5EL 3CD6A 1CKMA 5JJKA 1CKNB 3JC66 1E1TA 1J6QA 1BBUA 4XIGS 2VUMG 1PYSB 4HIKA 4B3SQ 4DR1Q 3NBHB 2WFWA 1N34L 1ASZA 1X3GA 4L5TA 2N49A 4Y7NH 2Q2TA 1VQOA 1YIJA 1XMOL 3G4SA 2R7ZG 3E9IA 3A5UA 3ICEA 3CCMA 4R4TA 5K36G 3A0JA 1Z9FA 1YJWA 2PNHA 4DR2L 4B3RL 2OQ0A 1PH3A 1OXXK 3CCVA 4JBMA 1FJGQ 2KHIA 4DKAC 4UPAA 1E22A 3CF5A 1BBWA 3GTPH 1HR0W 4OX9L 1R9TH 1C9OA 2R93G 1X6OA 3GO5A 4A3DH 4DV0L 1LYLA 1CSPA 3ZJYC 2L15A 5C0XI 1Q12A 1HNZQ 1L1OB 2BH8A 3FKIH 2CKZB 2ZTDA 3CW2C 3S1NH 1YHBA 2UXBL 4YY3L 4JI2Q 1YNXA 2LSSA 4BBRH 3D0FA 5IYCH 3U50C 2Y0SG 4JI7Q 4P74A 1S40A 2MNAA 1K3RA 4GOPC 1X3EA 1JT8A 1NY4A 5GAHC 1VQGA 4BA1I 3S1QH 3I7FA 3A74A 1A62A 1VQEA 2CFMA 5BR8L 3HOZG 4A3GG 3ULLA 3CCEA 1Z47A 4DV1L 1UE7A 1WI5A 3BJUA 3KJOA 1HNWQ 4BY7H 2ZM6Q 1YZ6A 2LXJA 4JYAQ 3PO2G 4A93H 2JK8A 4NXML 1NMGA 4PZ7A 4WJ3M 1VQJA 3CCSA 2UUCL 2DGYA 1H95A 3H0GG 3RN2A 3KLWA 1UWVA 4IPCA 2UUBL 3F1ZA 4OWWB 1VQ9A 2JA8H 3Q8DA 1TWCH 1WCMG 4JI8L 5IWAL 1Q7YC 1A0IA 1NTGA 1J5EQ 4JI6L 2JA7G 4GLXA 2ZJRA 1XNQL 3OYYA 2JA9A 3S16H 1K0RA 2JA5H 1N34Q 3HOUG 4AH6A 4GN4B 2VQEL 1N36L 5IYDH 1XMOQ 2QA4A 4LF9L 4X62L 1U0LA 1SN8A 1NBWA 4A3IG 2AHOB 4BA2I 3RNUA 4X6AH 2NVTH 1TXYA 1EOVA 3HOXH 1XJVA 4DV2Q 4DR2Q 2B63H 2VQFL 4JBKA 4B3RQ 3GTMH 4A3KH 3T1HL 4LW1A 2KHJA 4GOPA 1CKOA 2JQOA 3JAMi 1PH9A 3GTKH 1Y1VH 1P8LA 1IBKQ 1EUJA 3AYHB 4OX9Q 4PG3A 1N33L 1YHAA 1TWHH 2K5NA 3PUZA 4DR7L 1UE1A 4DV0Q 3HKSA 3M4PA 3VDYA 1W2BA 1TWFH 3S2DH 1V9PA 4A3CH 1JE5A 3I4MG 4R4OA 4DPGA 4OXPA 2JEAI 2UXBQ 1WJJA 1IYJB 4A4IA 1VQFA 3HOWG 4IFDJ 1KRSA 1SRUA 1OXSC 1Q46A 5M3FG 4PZ6A 4GLVB 2RHQB 1PA6A 4FDBA 2AWNA 3JAMc 4POFA 1C7YA 2F52A 4A3JH 2A1AA 4JCVE 3J80i 5BR8Q 4LUZA 1XTDA 1Y1WG 4AQYL 4DV1Q 2EQSA 3CCJA 2F4VL 2R92G 5IP7H 4LF6L 3SGIA 3I55A 4NXMQ 1X56A 1VQIA 1IXRA 2UUCQ 2OTJA 3BZKA 4KHPL 1N32Q 3GTJH 1Q1EA 1QUQA 1KQSA 3BU2A 2UUBQ 1PYBA 3CP0A 2E2IH 2YV5A 4GNXB 2FXQA 1TWAH 3EIVA 4JI8Q 5IWAQ 4DUYL 5C4XH 1PVOA 1Y14B 4JI6Q 4MZ9A 1ASYA 1GKHA 1LTLA 1G51A 5IYBG 2ZTEA 4X65L 3J80c 4IJHA 5JEAJ 2JA6H 3S1RH 4BY1G 4AYBE 1K9MC 1N9WA 1N36Q 1A63A 1SE8A 3M9BA 4YHHL 4LF9Q 4X62Q 3K0XA 2YTVA 4RMFA 1MKHA 3I56A 1K83H 4O0AA 4QQBX 3TQYA 4LF7Q 4QGUA 3PIOA 2N78A 2I5HA 2IT1A 3KYHC 2VQFQ 5HY6A 3UDFA 4JV5L 3T1HQ 4C3IH 1SR3A 1RL2A 4AIMA 1B70B 4C2MH 4A3FH 1EYGA 3PSIA 1VQ4A 5IP9H 3F2BA 4LFCQ 3KDFA 1N33Q 3PCOB 2K14A 1VQ7A 1P16A 3GDEA 4LF4L 4LFAL 3S2HH 4DR7Q 1QVFA 5GAGC 1OXTA 1VS0A 3AFPA 2VZAA 1GVPA 2GN5A 4YWMA 1U5KA 5IE8A 4PZ8A 1HZ9A 4HJ9A 2GVAA 3E9HA 1YI2A 2HT1A 3KF6B 1HR0L 2N3SA
chains in the Genus database with same CATH superfamily
5KKNB 2LMCB 4JI6H 1EY8A 5KFOA 2ZDQA 4UP7A 4L5QA 5M5XB 3FKIG 3MFIA 1Z7TA 2QDLA 1BCPC 5C6AA 2L55A 4A3EH 1MSHA 3CQZB 3QWNA 2VQEH 3F8TA 2C35B 1T36A 4NXNL 3G8CA 4MA0A 2HJWA 4AQYQ 4JI3H 4JI5H 1I4XA 1QWYA 3QO2A 5DM73 2R8IA 5DG7A 3I4NH 1GGOA 2I8CA 4LF6Q 4HJ5A 2WYOA 1EYAA 4H7BA 5KFNA 5BN3A 3T1HH 2UUAL 3VR4A 4OIKA 1Y1WB 3DF7A 2R8JA 1O7IA 3J81L 1BGWA 4ZLTF 5FJ8H 3WNZA 2BE5D 4DR7H 4JG2A 3VR6A 3RZOB 3NPPA 2ASBA 1G291 2CWAA 1WTOA 3TP5A 4K0KH 4OWXB 4ECRA 2Z9HA 4EYIB 2EY6A 4RG1A 1Q8KA 4EBEA 1TR5A 1DIKA 3Q8SB 4IJLA 3JAMW 3I4OA 4L6TB 2M9VA 2F0PA 3JAML 3LP8A 4PMBA 4R8NA 1YEZA 1DOLA 4X66L 5JPNC 2VPSA 2Z8LA 2R85A 3HZXA 1S5CD 5EKIA 3BYTB 2HHHL 1PDQA 5M5YH 1KIXA 5HV6A 1VQ6A 3CMAA 1JC7A 4M1UB 3HOXG 1STGA 4LFAQ 5CV8A 3T1YL 4JI3L 4LF4Q 5GADC 1X3PA 3HB9A 5KT7A 1W93A 1STBA 2O5IC 2OWOA 4QB4A 2UU9H 3HKZG 4QUCA 4YBZB 1HFNA 2N55A 4Y7NB 3S9WA 3Q1KA 2CQOA 1PH1A 3J80W 1BR9A 1L0YB 4YWLA 1Q86C 1PH7A 3BG5A 3J80L 4MV3A 4GKKL 1IL8A 2WP8J 2B2YA 3NQTA 1ET6A 3GTGH 3TEHB 3NGDA 2UXDQ 3BS1A 3GTPB 1R9TB 1F77A 2A8VA 3PN1A 3C46A 2NTTA 1GHJA 4MTEA 3PR5B 3CC2A 4IR1A 4V0BA 3CMEA 2VS1A 3TZDA 1IHZA 4Y8VB 3CCQA 4BBSH 2P5ZX 4ZOLF 4NLGA 1EUCB 3I3CA 1WR2A 5IP7G 1CK1A 1IBMH 4GOPB 4LFBQ 4IOAA 3KAJA 1I50H 2BDOA 2DUDA 4OO1G 4PDBA 2R8KA 3QJYA 2YU9A 1II3A 1JIHA 4U68A 3AU7A 4B9WA 5C4XG 5D1OB 3E5SA 4JI0Q 5KRUA 3ER0A 2JJQA 2NVQB 2F0KA 1YNJD 4HJAA 4QY7A 2NVXH 3V2TA 4CHTB 3K7UC 2VQEQ 2QYZA 4DL2A 1XNRH 1PZKD 2K5HA 1T9HA 2TSSA 3MA2B 2XN9C 1PTOH 4JI5Q 1PTOC 5GONF 1WD1A 2X69A 1K8MA 3NTHA 4DR4H 1IYUA 4QIWE 3S16B 1ZYRC 1A3TA 1GD7A 4F4WA 5EAYA 2SOBA 2K6AA 4IFDI 2Z4IA 5ELFA 5F9LA 1U9RA 2D5DA 4R8UB 1RCVD 5H1SE 3VR5A 3M4OB 3GTMB 4HN7A 2AU0A 3ERSX 4K0KQ 3BDLA 2FPIB 1E1OA 5CBAE 4JV2A 3GTKB 1Y1VB 2SDFA 1UE6A 4KKUA 1L0XB 1SDFA 3K7AH 4CDCC 4A75A 2F0FA 2UVVA 4XQNA 5LMUH 1TWFB 4DFAA 3CC4A 5LL6X 3VA7A 4GLAC 3X3MA 2OH2A 2J6SA 4IPGA 4JOIC 1NR4A 2HHHH 5K36H 2HVSA 3UQ8A 5HBRB 4QL5A 4DR5L 4M7EA 2JE6I 3CPFA 2ZTCA 4UCRA 3T1YH 2E74C 4KI0A 1BKBA 4NB3A 3KJPA 1L2FA 3Q23A 2FPGB 5LYJF 2UU9Q 2K5QA 4F4ZA 4YWKA 1D7QA 2R7DA 3FDSA 2C22A 4CBVA 3MVVA 2XCPA 2DPIA 4Q8EA 2D62A 2MFIA 5C1PA 5J39A 4B3ML 4YJ2F 4XDXA 2IWHA 1SNMA 4G4KA 4DUZL 4O3RA 1Q1BA 2JYOA 1YHQA 2XTIA 4IOCA 4O2AF 3H6MA 1F2LA 1TWAB 1MIUA 3IFTA 4QWDA 1D1IA 1EU4A 4RUAA 1EEFD 2XWBB 1ILQA 2RA4A 4GN5A 2RHSB 3HOZH 5C4ZA 1C4QA 3S1RB 1MJEA 1EHIA 4G3IA 3W1GA 4DV4Q 4K2KA 1AE3A 2BA0A 2C5CA 3FRPB 1IBMQ 1N32L 3CRLC 1CQJB 3KAKA 2PN1A 2R86A 5C3EG 1XPUA 2C2RA 3SK6A 1FNUA 3K59A 4ZUJA 2F0UA 2IHEA 2JA7H 1HNZH 1QG7A 3S2HB 4EYHB 1G6PA 3H4DA 1AZQA 5EKLA 3HOUH 1JQYD 2DJFC 2K03A 3D8GA 4JI2H 3PUVA 3PZPA 2QF7A 5M3MG 4TQRA 4IO9A 3HOVG 1XNRQ 2MHVA 3M3YH 1CQVA 1G2SA 4HJ7A 2NU7B 4O2BF 1ILPA 2Z6BA 1AUVA 3M85A 2PVPA 3B6YA 1BCPB 3G71A 5C1OA 2PBZA 4DR4Q 3JAME 4LFCL 5M5WH 1LTID 1EU3A 4A3EB 3S1NB 4MA5A 4LWCA 3OWEB 1MD2D 5IGGA 1C0AA 4PMCA 4YAKB 1M0WA 3MR3A 2N8NA 1JOQA 1M6VA 3Q2OA 3I4NB 2EOTA 2VUGA 1FGUA 1FJGL 1Q90A 4KLKA 3RN5A 1OXVA 4JBWA 3MHBA 5BN5A 1CA6A 2CHBD 2IPKD 2EYLA 1CKNA 3H94A 5LMUQ 5IT9c 3J80E 4EG0A 4ZCKA 3NBHA 1PFSA 4IUVA 3CC7A 4P71A 2W6PA 3TQ1A 1VCIA 3FHWA 1HZBA 1WTPA 1E4EA 2R92H 1BO0A 5EDWA 4A3LG 4QIWB 2XCAA 2BH2A 2V4RA 1RD9D 3T1YQ 2F0GA 4ZK9B 4JI3Q 3F2CA 5K2MA 2TMPA 3AQQA 1HNWL 4MV7A 5AJ3L 1SE4A 1HQRD 4OIJA 1PH6A 5M5YB 4DV0H 1GOZA 3E0JA 1WFQA 4I7ZC 4A3MG 2O03A 2NVYA 4B3MH 1M8AA 2UXCQ 1KLUD 1VQAA 4MNOA 4TRDA 1SCUB 2UXBH 4IRKA 1B9NA 2F0SA 2OT2A 1S0OA 1L1OA 4C3HG 2YZMA 4I7HA 3LMLA 2NU6B 4ZAIA 2ZJTA 1C30A 2MJ8A 2VUMG 4NMZA 4KJOA 3KBGA 4KKTA 4B3SQ 2ASDA 2WFWA 3WDNA 1ASZA 1B9MA 5IODA 3GTGB 1VQOA 3G4SA 2A69C 3BQ2A 2DNEA 3I4LA 3PR4A 4ED2A 4X3SA 1EZ8A 1Z9FA 1XDNA 4FBUA 1YJWA 1SYBA 1JCKB 3TP6A 3ORRA 1VMPA 1PH3A 1N32H 4XYMB 1HTPA 4JBMA 2KHIA 3C3LA 1IOVA 4K5XA 5EGTA 1HR0W 4OX9L 4BBSB 3GO5A 4A3DH 3TP7A 4DK0A 4NDXA 1LYLA 5KFJA 1BNCA 2L15A 5C0XI 1Q12A 1SE2A 1HNZQ 2BH8A 4UCOA 1I50B 3MXPA 1YHBA 2A6HD 4JI2Q 2VXWA 4X62H 2NUCA 1D5XC 1EWCA 2MNAA 4TQSA 2YS6A 1JT8A 4RCNA 1NY4A 2VQFH 1A62A 1VQEA 2EVBA 1EYZA 2IX3A 5DM63 4EFEA 4DAYA 4LFCH 2JA6B 1DYQA 2NVXB 3K5IA 1QOHA 4BY7H 1QILA 4JYAQ 5L1KA 5KT2A 3PO2G 4A93H 1WTQA 1PTOB 4PZ7A 4GZYC 2R7ZA 1C3OA 2RSNA 2UUCL 3H0GG 1O7ZA 2JA8H 1RYSA 1X3QA 5KFFA 3WOEA 1IYVA 1Q7YC 1A0IA 1J5EQ 1C48A 4GLXA 5IT9W 4RB3C 3TMEA 3EQLC 5IT9L 2JA9A 3L4JA 2HGSA 3SE7A 3MWEA 1SEIA 3PMFA 2O5JC 2DPJA 1UAPA 4LF9L 4ZKBB 1NBWA 2AHOB 2F4VH 3ORQA 4BA2I 3GTLA 5KG2A 1TXYA 3E3XA 1XJVA 3K7AB 4B3RQ 4A3KH 5LL6S 4LW1A 2FHTA 2V59A 1DOMA 1CKOA 2WV6D 2JQOA 1VKZA 4EQOA 4ETSA 4IFDH 5E3FA 2WKCA 4DUYH 2MCTA 1YHAA 2RDGA 2L4NA 3OOCA 3GQBA 4DV0Q 4MV1A 3HKSA 1NSNS 3HP3A 1ESRA 3OHXC 5KG7A 4R4OA 2F0NA 2PQEA 1CI3M 2E75C 3QG1A 2Q8IB 2UXBQ 3O13A 2ICEC 2W57A 1IW7C 4FDBA 2AWNA 3KUPA 4IAJA 2QEJC 4POFA 1C7YA 3MZ5A 4A3JH 5JQWA 2XCLA 5BR8Q 5FPRA 1Y1WG 4AQYL 4DGZA 2KCNA 1JLLB 4C5BA 3U9OA 4QWBA 4LF6L 1J8IA 1X56A 1N32Q 2FINB 4H44C 4LJZC 2EXZA 2A68D 3CP0A 3HOZB 3SI8A 2FXQA 4JI8Q 1HR0H 2OXPA 1RJPA 2R8HA 3HKZA 1GKHA 2ZTEA 3FDTA 2LFNA 1H9KA 2ZXOA 1K9MC 3WOFA 4AYBE 2EY1A 4DNTB 1BNZA 4X62Q 3HXLA 4IR9A 1S10A 3ITPA 2JA7B 4DR6H 3KYHC 2IT1A 2VQFQ 3HOUB 3BVZA 1RL2A 5G3LF 4C2MH 4A3FH 4LFCQ 1VQ4A 5IP9H 3NXWA 2F0WA 5M3MB 1N33Q 1SNQA 3PVXA 4LFAL 2R87A 1MHWC 4LF4L 3M3YB 3MJFA 1QVFA 1QE6A 2L9HA 4DK1A 2NU8B 1V51A 2AQ3B 4PZ8A 4HJ9A 1SNCA 2GVAA 2OEOA 4CKCA 1TWGA 3KF6B 1PMRA 3RGXA 2HIXA 1KQSA 2XC9A 1SYEA 1KAAA 3OUUA 4BXXH 1F9RA 4HJ8A 2HQLA 2K52A 3IRBA 4DV7H 3PW2A 2OLSA 2XVSA 4O3SA 4JI1L 2XIGA 4QW8A 3SVMA 3AFQA 4UCVA 1LTTD 2UXDL 2DY8A 4L8JA 4KN7C 4N9TA 1XPOA 2F3WA 4LF9H 1KRTA 1Q82C 2R7FA 3ETJA 2F4VQ 4TKOB 2RDJA 4KTAA 1RDPD 3DWAA 4HEDA 4YR3A 4YQWA 5JJIA 5HGQA 2PMZA 4FS1A 3T5LA 5EBDA 4MV8A 3DLLA 5AJ3Q 2ZJQA 4DUYQ 2V4DA 1ZHQA 4LFBL 2VL6A 3S15H 3RZDB 1X65A 2R92B 3D4WA 4ALPA 3SK8A 4JW0A 3HOYH 4OONA 5KT5A 3KF8B 5KFPA 2RDIA 5A2QW 2E2HB 5KFRA 1HHVA 1CHQD 5A2QL 3K0YA 1V1PA 2IHFA 4JI0L 1KBLA 1GXDC 3F2UA 2YRXA 4A3MB 1VF7A 4KJNA 5IYDG 5C44H 3CCRA 4KMUC 1RKNA 3OHBA 2W9CB 1DGSA 4JI5L 3W5OA 2PI2E 2B63G 2K5VA 4IZ8A 2CW0D 2R7MA 3A5ZB 1BF4A 1PH4A 2F0TA 3KOJA 4LMQD 5KIXA 1Y1VG 1EY9A 2KHSA 1Y8OB 1HR0Q 3KALA 4O1NA 4V190 4A3CG 3Q8RB 1EY4A 3QZ8A 1K3BC 3H40A 3RAQA 4QMGA 1YITA 4TUYF 1FYCA 3TN2A 4K0KL 3GV8B 4KKSA 1TY0A 4X3KA 4ED1A 1FD7D 2B29A 4J6HA 1NCVA 1XMQQ 4XTCS 2KCMA 4DR6Q 1SROA 4LH6A 4P73A 1QVGA 1JJGA 5FKAC 4JI4Q 4DN4M 3GIJA 2F0MA 3PO3H 2ES2A 5IT9E 1HXYD 3R23A 1RHPA 4O3PA 1AUXA 1A3VA 3RV3A 2JA5A 2KSWA 1S4ZA 3H15A 4LF4H 3IFDA 3PQIA 3SHLA 1B4OA 3DXJC 3N40P 2QGQA 4HCSA 1GUSA 5KGUA 1OTCA 2UU9L 2QK4A 1PHJA 1BXRA 3K8AA 1QZGA 4K8JA 1F2YA 2SNMA 1CQFA 2YTYA 3GP7A 3ZYYX 5EQ0A 4O2DA 1N8RC 1NE3A 4BY7B 2GVBA 2R7LA 2K05A 3P7JA 1PRTC 4A93B 5C0XH 5C4JH 4DV7Q 1QVCA 4AYBB 3J7AF 4A3BH 3DHQA 4JI1H 3G6EA 1SNPA 4DL6A 3KBXA 5FLMH 3PIPA 2JA8B 4PWQA 2AGOA 5COYA 1JOKA 5KX5F 5DGAA 1EIGA 2PPBC 2HCIA 2O2LD 4QW9A 4C3JH 1GUTA 4L5SA 3OPOA 2LXKA 2JEGA 4TV9F 1WOCA 3W2DA 4DV4L 5L1JA 1VQHA 4ZUIA 2CQYA 5KFZA 2YTXA 4DK6C 1IBML 4CDFC 2KEDA 3HRZC 3SK4A 4WJ4A 2ZT9C 1K1QA 4LSAA 3RLFA 5FD5A 2J6UA 1TS2A 4UP9A 1PH8A 1E24A 3OHAA 4RHSA 3GTJA 2JN4A 5EZYF 4JI0H 1EY0A 5T14A 2ZDHA 2ZJPA 1LM0A 1SMYC 1X55A 3TZUA 4A3EG 5D14A 4DXFA 1XPRA 2R7ZH 1KXLA 1B2TA 1XNRL 3KHGA 2KCTA 3STBD 4K2LA 2NN6I 3BJYA 1JJCB 3I4NG 4FF2A 4C5AA 4DR4L 4IRDA 2W9BA 1K83A 1JDEA 2F0IA 2YYAA 1QNUA 4BWGB 3VMMA 2R93H 2Z6KC 2NUAB 4EBDA 3JSLA 3UDIA 5ISRA 5FJ8G 2K01A 3FMAA 2WE6A 1PH5A 3T53B 2AWOA 3GTLH 4M9UA 1V1QA 4R4IA 2D9UA 5KNCA 2F1MA 4HR7A 5DNFA 4HTHA 1OO9B 5D3DA 4UHVA 4S3SA 2G5DA 3KXYT 2WAQA 3NSWA 3VPDA 4C1NK 4RZRA 4DR1H 5LMUL 4FS2A 3NTIA 1T3NA 1STEA 2IY5B 1PK8A 1Z2OX 3M9MB 2VUMA 4GNXC 1UNNC 2CH4A 2K33A 2ALYB 4EX5A 1LT3D 2RCFA 3CVZA 4Q45A 1ENAA 3NWSA 1BOSA 1EQQA 2WB1E 3NUCA 1SBBB 2K04A 4RNOA 1NAPA 3PF5A 4DA2A 2D2CC 3DM3A 1WCMH 4UCSA 4C2MB 2LY7A 4J9MA 5I6YA 3J7AV 3HG9A 3TQTA 2QKIC 4DV5Q 2H5XA 2UXCL 2FK1A 2EXDA 4MTKA 1U4RA 3K5NA 4JI1Q 3MWMA 5E7NA 2W8KA 3U4ZA 2YYZA 5IGFA 3H20A 4LF7L 3MEFA 4FNFA 4B3SL 1PFNA 5A2QE 1LTRD 4ECUA 5FO7B 2YL2A 2NZHA 4IPDA 2CCZA 1W96A 2ATLA 2F0DA 4LUVA 4BBSG 5JH7F 4DV4H 4U673 4K8IA 3I72A 1SE3A 2YZNA 5EPJA 3CXCA 2PQAA 4JBJA 5BPFA 2R7NA 1WTVA 3D6CA 1QZHA 1O80A 2R61A 1SFOA 2YCHA 1Y69U 4IPHA 5JJLA 2ICIA 1GSOA 1HNZL 3K5HA 3NELA 3QB3A 5CORA 4L5RC 1RJRA 4JI2L 2JA6G 4RZQA 3GTOA 3SR1A 3HOYB 1WTRA 1IKMA 4KY7A 3VA5A 2FKLA 1VMCA 1KTKA 1S72A 1TWGH 4CJ2C 2W7OA 3QOJA 1CTMA 5KFUA 5C44B 4JYAL 3CKIB 4GC7A 3MR2A 1IZ6A 4K6LA 2W6OA 2DLNA 2E5LQ 5BPHA 3M4QA 2K75A 2I5LX 5IYBH 2B63B 1VQBA 3C0FB 3GIDA 5D65A 4IZOA 3KFUA 4HIDA 3H3VI 2J7ZA 4ECQA 5CA1F 1J5EL 1CKNB 1SXTA 5CV7A 3CQZA 1E1TA 1J6QA 2B2WC 3P75A 4OEMB 1LTSD 1TWHB 1PYSB 4Q5VA 4HIKA 5CAEB 1STHA 1MSGA 2MUYA 4DR1Q 3NBHB 5L1LA 1AN8A 3QOLA 4OL7A 2Q2TA 2CVRA 1YIJA 4CJ0B 2I46A 3E9IA 1LV9A 3ICEA 3HBLA 3R93A 3CCMA 5K36G 1TS4A 5T1GA 2RGRA 4R7RA 4B3RL 2B2VC 3BYYB 1Y1WA 3TIGA 1Q8IA 3RTXA 2UUBH 4DKAC 3MXUA 1E22A 2HDLA 1RF2D 4FO2A 4RAUC 4FXKC 3CF5A 2QW7A 4H0LC 3PO3B 1C9OA 1X6OA 2AQ2B 4DV0L 1CSPA 5ELDA 5DAUA 1U4PA 2QDBA 1L1OB 4UAIA 2UXCH 1V8QA 1WD0A 4PQXA 2V5AA 1EUDB 2EJGC 4YY3L 5C5LA 2UXBL 1B3AA 4BBRH 3Q22A 1TQOA 5IYCH 2KA7A 5KFGA 1HRJA 5T1IA 4XT1B 3VYSA 1K28A 3R8BA 2F0LA 1PRTB 1RK5A 4LF7H 1SSOA 1X3EA 3NK9A 1JR0D 2IJ0A 2NYZD 4FYDA 3S1QH 1B04A 4EBCA 4B3SH 2B39A 5C4JB 2CFMA 1RYRA 3V96A 4A3BB 2PNRC 5BR8L 3HOZG 3N42B 3AB9A 3ULLA 2C00A 1Z47A 4I7AA 2YW2A 4LAAA 4O4HF 3BJUA 2ZM6Q 3GIPA 1YZ6A 1TU2B 2LXJA 2YZGA 2JK8A 1B1ZA 2WB1B 1HQMC 4WJ3M 1VQJA 3CCSA 1H95A 5LOVF 3RN2A 2EDGA 3KLWA 2RSOA 4C3JB 3F1ZA 2KJXA 1VQ9A 2IP4A 3W3AA 3Q8DA 5CR3A 4JI8L 4HNVA 1GHKA 3R2IA 5KFQA 4RAYA 2JA7G 1XNQL 4FU0A 4TV8F 4QWCA 1NUCA 4MTDA 1I4GA 3OYYA 4DLKA 1R9TA 2X6LA 2JA5H 3HOUG 2B2TC 5KFSA 3BA8A 2EYJA 1G8ZD 3N52A 3MAQA 4HNTA 1Y8PB 1KDAA 1TIID 1B6RA 1JXLA 1B6SA 2EYMA 4X62L 5C8YF 2A74C 2NVTH 1BCPD 5DLGA 1V1OA 5I4DA 4ZQIA 2VQFL 1QB5D 2Y0SA 4GOPA 2KHJA 4MV4A 3OMCA 1SJHD 2R7ZB 1EUJA 3AYHB 1HTLD 1N33L 5JOBA 3F8NA 4F88A 4JYAH 2UVWA 2FJ2A 4RB0A 5F2DA 1O75A 1W2BA 3S2DH 1WTWA 4RFBA 5D1OA 5IGEA 1JE5A 2R7KA 3FPUB 1EEID 2XWJB 4OXPA 2JEFA 2JEAI 3P1HA 2WINB 4A4IA 2IL8A 1VQFA 3MTSA 3AMUA 1ZQ7A 5CGKA 4IFDJ 1KRSA 2ZDGA 3RJ0A 2R93B 1OXSC 3MFHA 2C9OA 1J5EH 4PZ6A 1Z2PX 3BDCA 1R4PB 5DQGA 3QFFA 4JV5H 3QIAA 5CA0F 2A6EC 2A1AA 3GTLB 4UCUA 1SYGA 1X32A 1XTDA 1PXUA 5KYLA 4OGQC 4YP3A 3M7GA 3BABA 1UC8A 2KECA 2EQSA 2NN6H 2F4VL 2R92G 3T51B 4NXMQ 4B3RH 1DONA 5JEAH 1LO5D 3BZKA 5JPMC 2C2EA 3GTJH 1Q1EA 4R8UA 3BU2A 3OWFA 2UUBQ 4EEQA 1PYBA 2R8GA 1KC7A 4GNXB 1HFGA 5L37A 2FE3A 4C5CA 3Q6SA 4DUYL 3EIVA 3GTMA 2DJGC 1KJ9A 5JUMA 3GTKA 1LTLA 1Y1VA 2XRQD 1ULZA 2SCUB 4IALA 1EY5A 4YY3H 1PLFA 1N36Q 1WCMB 1U4MA 4ILWA 2YTVA 2P0AA 1K83H 4O0AA 4IN3A 4LF7Q 4IUPA 5TSSA 2I5HA 4KN4C 4RNNA 5BR8H 4C3IH 1SR3A 1WSCA 3A8JE 4AIMA 1RK6A 1B70B 3TIIA 1EYGA 5KT6A 1YNNC 2ALZA 1OWTA 5G3LD 4RH6A 1P16A 3GDEA 3SE0A 4E4TA 1GUNA 1ML0D 5KFMA 5GAGC 1OXTA 1LTGD 3GV6A 1VS0A 4B9XA 1HZ9A 1YI2A 4JI8H 2HT1A 3DEPA 4A3DG 3KHLA 1HR0L 2N3SA 2IW3A 5E4XA 4JBKA 1XNQH 5I47A 4R1JA 1G6ZA 2L5TA 4NPSA 4I65A 2FJZA 1PRTF 5KFCA 2E2JH 3R5FA 1JMCA 3FMCA 3G6XA 2WIIB 4LUOA 4EGQA 3RLNA 4MTNA 4YIJA 1XMQL 1I4QA 1KC8C 1KJ8A 1M1KC 5LL6b 3DWQA 4DR6L 4FVMA 1TAEA 2Q2UA 2BOSA 4XYLB 4JI4L 2A19A 3IL8A 4KHPQ 4Q0FA 3N8DA 3R5HA 5KG1A 2J9GA 3U58A 2PW7A 1PTOD 4BY7G 4F4XA 1N33H 4I50F 2B2YC 4A93G 4RNMA 3IN5A 4F4YA 1JJ2A 2BA1A 1ZYRD 4HCEA 4EFBA 4AYBG 4LF5H 2XGTA 2JA8G 1TT2A 1HH2P 1JWUD 3F2DA 1VBHA 2JEBI 4YHHQ 3ULPA 4LH7A 5ELOA 4DK3C 1QNKA 2AUKA 3JSNA 4X64H 2NWGA 4DV7L 1I6HH 5IIFA 5I9PA 1VQKA 4JV5Q 4JPBW 1KD1C 2KVMA 1CQIB 3S24A 3G7LA 3FKIA 1BCPF 1SFOH 3U4VA 3S17H 2YU9H 2RVLA 3VYUA 5DLFA 1SYFA 3MXGA 4ZI7F 5KT4A 3M7NA 4L1KA 4A3KG 4B3TH 3LX0A 4QWEA 3G6YA 2VNUD 4IFDG 1VQ8A 4A2BA 3E5NA 2XGQA 2NZOA 3A54A 3GD7A 4J9LA 4QJFA 2FMAA 1FL0A 4LF8Q 1CUKA 2G9DA 3N6RA 4RB2C 5GAEC 3H3VH 1DV1A 4CDEC 1EZ1A 2I5MX 4YY3Q 3RLOA 2RDFA 3MXNB 1JB7A 2WAQE 4N8FA 2K50A 5CC4A 3BA9A 1W3SA 5J3BA 3Q8PB 1ZXTA 5E1FA 1TWCA 2DNCA 5IY0A 3I2ZA 3DEOA 1YJ9A 3WWVA 4A3JG 3VPBA 4QIWA 1JWMD 1EIYB 4XXEA 4WFN3 5KFWA 3DMUA 4DL7A 3LWUA 2HQEA 3S1QB 4QF4A 3K81C 3NP8A 1EFID 4RU9A 3OTOQ 1SYDA 1MGSA 1F2ZA 5E4WC 2E2DC 1T5XD 2MGSA 1E2VA 1E3PA 3RR5A 1EWIA 4DAMA 3D3RA 1XNQQ 1S5BD 4XZ3B 1NJIC 1AZPA 1FNVA 4RGTA 1JWSD 5EPLA 1AP0A 5FLXc 4EVOA 1Y1WH 2SEBD 1RTNA 2BCOA 2Q2IA 1S5ED 3PF4A 3GTGA 3FEWX 4HIMA 3TS2A 3KLSX 1XMQH 3J7AK 5GQOA 2XIWA 1KDCA 5C0XJ 3WO1A 1GYFA 4O3OA 2BE5C 4JI4H 5D1PA 1T94A 3A7LA 1W6KA 5I6WA 1UEAB 4A3FG 3RMHA 4XX0B 5IP9G 3DWPA 4DV6H 2F0VA 5ELBA 3PUXA 2MO0A 1Q3LA 3K57A 1QUQB 3HFZB 4KY6A 5J22A 2NVTB 2CWPA 5IGCA 4LNQA 4LF5Q 5KFKA 2JXMB 3N6XA 3GV5B 4DL4A 1JB3A 1BDOA 5M5WB 2A5HA 3R2TA 2H4OA 4BXXG 5J1ZA 4IURA 4DV5L 3UE1A 3MR6A 1H9SB 1CSQA 2E2IA 2Z1CA 4X64Q 1A2TA 3CCLA 1KAWA 3LWBA 1HCZA 4CKEA 1IBLH 1BVSA 3BG3A 1D2BA 1DM0B 1WTHA 4IUTA 4ME5A 2VW9A 3I12A 1DV2A 1CS0A 2JA6A 4EQNA 5C3WA 4DV2L 1H9JA 2NVXA 1DZ1A 4H02A 3PW0A 3G48A 4OO1I 4UY8C 3KDFB 4B3TQ 2M05A 1H9MA 1N48A 1PTOF 2B8FA 1IBKL 4POGA 2PYKA 2HIVA 3NEMA 1OXUA 4EGJA 2J4XA 3MFYA 2XRSD 5ELNA 2Q8TA 4NKLA 2G9HD 3HOYG 1DCZA 2NU9B 1I5FA 4DV3Q 1A2UA 4RCOA 1SAPA 2KENA 5CBEE 2IBKA 1Q81C 5NUCA 1NR2A 1BUVT 1X3FA 3K3VA 5KFTA 1EIHA 5IGBA 2D0PA 1FGBD 4IUUA 2PZWA 1SYXB 5C44G 2M2LA 3EBEA 4A3GH 4F87A 3RB3A 4ULLA 1GSAA 1T5EA 3ND8A 3DM1A 4JOIA 2NVQH 4OELB 1K83B 4UP8A 2CQAA 2A69D 3T5JA 2NB0A 1KNAA 1E4GT 1DJRD 1YNJC 4C3IB 5LMNQ 1AFPA 4HQ6A 1SYCA 4Q43A 1HNXQ 2HD3A 2E5LL 1EY7A 4DAPA 3QR8A 5FLXW 3J81i 5FLXL 3MR5A 2DZDA 1U4LA 3KTMA 2WAQB 1O78A 4UCTA 1LABA 3TSSA 4JI7H 3JRWA 1IL2A 2RGVA 2O4XA 2JEJA 4A3IH 4NW2A 3RGZA 5HGTA 4A3DB 1UNSA 5C3XA 3UI2A 4ECTA 4O3QA 2VY3A 4DR1L 1D5MC 3M4OH 3EA6A 2K1BA 1VQ5A 3PO3G 3GV7B 3SDZA 2E2JB 3PGZA 1JORA 2NVYH 3T56B 4DV6Q 3OIPA 3J81c 1X9NA 1VQLA 3UDXA 3OW7A 1QCBD 1L1OC 2V1CC 4JC0A 3I4MH 4ED3A 3UE0A 1G91A 1I94Q 5JVH3 1EQVA 2H1EA 3A56A 4DL3A 3HOWH 2L0CA 4YCVA 1E2ZA 3FP9A 5M3FH 5C0XG 4DV5H 3MC0B 4KHZA 3RFCA 1S9FA 1DXMA 4U7CA 2AGQA 4DNRB 1N34H 4A3BG 3HS0C 1JX4A 1M90C 2AKWB 3BVGA 3BZDB 4N8X1 1HA6A 3NENA 5FLMG 5DQHA 1XMOH 2JA7A 1IBLQ 1KJJA 3EROA 4IUNA 4Z9CB 2WB1G 4ED6A 4DV2H 4DR2H 1QJOA 3RUPA 2Y0SE 3MEHA 3PIO3 5JAVA 2F0OA 3NWTA 3ULJA 4C3JG 1I7NA 4TQUS 1XWEA 5FO8B 1I6HB 3H91A 2PQAB 2FMCA 3SK5A 1IBKH 2F0EA 2ZM6L 4O4IF 4J15A 2RF4A 4P72A 4YCWA 2K5DA 5IGDA 5JJZA 3J7ZC 1PV4A 2YU9B 3S17B 3KF6A 4GN3B 2OQKA 1NNXA 2NZ1D 2JSOA 4CGYB 4A3KB 1TY2A 4BY1H 5FPOA 5GROA 4C56C 3BAAA 4IHJF 3OMGA 2M00A 4J9NA 4DR3Q 5CV5A 3CD6A 1CKMA 2FFKB 3EJIA 5I2XA 5JJKA 3JC66 1ZKOA 1PZJD 4XIGS 1ICWA 5DG9A 1X3GA 4L5TA 5F9NA 2VPQA 4YR2A 5KFDA 4HSPA 5EOYA 2R7ZG 4DV1H 1VF5C 1IW7D 3RV4A 1KNEA 4R4TA 3U9SA 2EYFA 2PNHA 2OQ0A 5KNDA 2I87A 4LMYA 3CCVA 1A6XA 4A2AA 2R92A 4JV1A 4A3JB 5IWAH 1B3QA 1PFBA 2R93G 1VAJA 4ABNA 4JVZA 3RAXA 1ENCA 3KF8A 4ED0A 1W6JA 2E5LH 1HA5A 2E2HA 1MZBA 3FKIH 2EYOA 4HYKA 2ZTDA 5DEHA 3S1NH 4PNYA 5KFBA 1S03G 2XGPA 2LSSA 1CA5A 3D0FA 3TDQA 4JI7Q 3SEBA 1Z6HA 4P74A 4CDDC 2ASLA 5GAHC 2W9CA 2RQXA 1VQGA 2KCCA 4BA1I 5KNBA 3CHBD 3D6WA 2BQ3A 3CCEA 1WI5A 3J81W 2R84A 2WTFA 1D5ZC 3SXHA 4MHEA 4NXML 1NMGA 1I4PA 2DGYA 4JV0A 4ME6A 3BDOA 4IPCA 2UUBL 4RGNA 4OWWB 2HUGA 1TWCH 1WCMG 5KFEA 1MI2A 4A3FB 1NTGA 3K5LA 2CW8A 4HNUA 4LK1C 2FMMA 1EQTA 5DQIA 1K0RA 1N34Q 4AH6A 4GN4B 1N36L 1XMOQ 1U0LA 1SN8A 1EYCA 3ETHA 4J9KA 3PW4A 3RNUA 4X6AH 2W6MA 1WH2A 1CHPD 4ZHQF 1EY6A 3HOXH 4IWYA 4DV2Q 4DR2Q 5D8DA 4H13C 5EPKA 1B44D 2EJFC 4KD4A 3FVQA 3D4RA 2W6QA 5FD6A 3K3PA 1S5DD 1P8LA 1IBKQ 3EYYA 2ZM6H 2FK2A 2K5NA 1UE1A 1RTOA 3GIMA 4X65H 1TS5A 1A3UA 5ELEA 1SJED 3ERQA 3TINA 3RB6A 4DPGA 4J9RA 1WJJA 5AFWA 1L2ZA 1IYJB 1CM9A 3N43B 4AYBA 1SRUA 1Q46A 3H0GA 3BQ0A 4GLVB 3T13A 4J9OA 3S15B 4J9QA 2FLNA 3Q24A 1S97A 2XD4A 3NQIA 4PV1C 1D6EC 4JCVE 4ZKCB 5L9XA 4LUZA 5FLXE 4DV1Q 3GTQA 4G7OC 3R5XA 3CCJA 2Y0SB 5KG3A 5IP7H 1FNWA 1FR3A 1I3QA 3I55A 1B53A 1S0NA 1VQIA 1IXRA 4OO1H 2OTJA 1MBYA 3ONAB 4KHPL 3I70A 2E2IH 2YV5A 4A3GB 4QUFA 2A6HC 5IWAQ 2QCPX 2V4QA 5C4XH 4JI6Q 4MZ9A 3RBDA 5CV4A 3URYA 2R82A 4I4TF 4M8AA 1G51A 5IYBG 4DL5A 4IJHA 5JEAJ 2JA6H 2FB9A 2LKVA 4F50A 3OSPA 3JRXA 1A63A 4NXNH 3M9BA 4YHHL 3K0XA 1F9SA 5LHY1 1ICFB 3I56A 3A55A 3V6JA 1RJTA 2F4IA 4QQBX 3TQYA 4FXDA 2N78A 4JV5L 4O4LF 3M4IA 2UVUA 3T1HQ 1E4EB 2MP1A 2UUAH 1PVOA 1D1KA 5I2YA 3F2BA 1PZID 1IKLA 2L12A 1LTBD 4MN3A 3VYRA 4YR0A 1VQ7A 4A3IB 4DR7Q 1STNA 2F0HA 4NXMH 2N88A 1I4HA 3AFPA 1GVPA 2GN5A 2NTSA 3R3OA 3RD4A 5FOBB 1ZEQX 3CRKC 2FK3A 2R3ZA 2NVYB 3HKZE 3E6ZX 1S3OA 3WO0A 4Q44A 2F03A 1LT4D 3BZCA 5KFVA 4LF8L 2KBNA 3I8ZA 4X66H 1GM5A 3I4MB 1LT5D 2AGPA 3OUZA 5C5JA 3TBIB 4BBRG 1YJNA 1N36H 5IYCG 2JP1A 4CJ1B 4J9PA 1PRTD 1B7YB 2K4KA 4HMIA 1KEEA 3HOWB 3HGBA 1XYIA 5M3FB 1LTAD 1ESFA 2PI2A 1G2TA 4XT3B 1TVXA 3IG0A 1YVCA 1EIFA 3RF2A 3FPPA 1A8VA 4C1NI 1HZCA 3MWYW 4HIOA 4YAJB 4GKKH 1LLRD 4C2MA 4ECXA 2PO4A 4X65Q 5I9OA 5LA6F 3OTOL 2W8LA 2F0JA 5KT3A 1E4FT 5KG4A 3MFGA 1KHIA 2B2UA 5EWFA 3GILA 2CH4W 3GTPA 2JA5G 5M9OA 4GKJL 1EQRA 2EY5A 4BY1B 1SLJA 2A68C 1SMYD 4FP5D 1VQNA 2ASJA 4DAYB 5KFYA 3KLRA 2FLLA 2YS7A 1M7JA 2PMZE 5EBCA 1X54A 3E0EA 5KFAA 4KHPH 4O42A 5DG8A 2VA3A 2AQ4A 4F8MA 3PV0A 5C3EH 3CCUA 4WD3A 1FKAH 2EPBA 4APVA 4UDUC 5ELCA 3J81E 4LF5L 2UVRA 2K32A 4KK7A 4QCLA 4Y52H 3NHHA 1EZ6A 3PUYA 4RWSC 2VQDA 5M3MH 3GIQA 1UUPA 3HOVH 2W7PA 4NXNQ 1WTXA 4RA8A 1TKWB 1KDBA 2ENBA 2HVQA 4YHHH 1JICA 3X3NA 3UDGA 3H09A 4ZRZA 4X64L 3FKIB 2L1BA 2UUAQ 3PW7A 3P20A 1AH9A 1EL0A 2EY2A 2NN6G 2JEIA 3C1EA 1KABA 1LUZA 3L0OA 1JE4A 4LSXA 1D8LA 1BJTA 5JEAG 4B3TL 1O7LA 1B8AA 1GUWA 5KFLA 5KG0A 3LWEA 2B63A 1UE5A 2AUJD 2IA6A 3D4DA 2ZXPA 5FO9B 4LF8H 2HVRA 5CV9A 4X66Q 4DV3L 2IX1A 1TWHA 4IWXA 4HMJA 3EN2A 2DWCA 4TVAB 1TWFA 1TWCB 2HHHQ 2AMCB 1VQCA 3RZDH 4IRCA 5FK9C 3KHRA 4DR5H 2KOLA 4WORA 4P2CB 4A3LH 5KG5A 4CC6A 3TREA 3G6JB 4UFZA 4Q8FA 4C3IG 4EQ5A 2SNSA 5JVG3 2E2HH 1I6VC 4ECSA 2IMWP 1WYDA 5DLQE 2Z0SA 3L2PA 4ZQ3A 1E7ZA 3CAMA 4A3MH 2MO1A 3HOXB 1F9QA 4GKKQ 5EWGA 2FLPA 1F9PA 4RHRA 5KFXA 3K80C 1I6UA 4DUZH 5L1IA 5LMNW 2WAQG 4JK1C 4P75A 4R4QA 5C4HA 1AN7A 3OTOH 5LMNL 1HJPA 1I4RA 3HKZB 4C3HH 3K5MA 2J0TD 2I07B 4PMWA 3IKJA 3W1BA 3RUZA 1HNXL 2W9AA 3K6OA 2VUMH 1VDZA 2DN8A 1S68A 1TWAA 1PFMA 3L9AX 1N56A 4GKJH 2CW0C 4K14A 4KD3A 3OW2A 4R4CA 2R6GA 1S0MA 1VQPA 3S1MH 2WKDA 1R4QB 1VBGA 5JVDF 3C1FA 2AQ1B 1GO3E 2WB1A 2IX0A 2BDNA 2EJMA 4ODGA 2QEXA 2EZVA 1SNDA 2RCNA 2W70A 1XTCD 4JUZA 3PUWA 2CZGA 3OSNA 1K8GA 2PCFB 1E2WA 4DV6L 1ENFA 3G6VA 3EPIA 4ME3A 1BXTA 1J9OA 2D0OA 2VR1A 1VQMA 1JKJB 1TWGB 1AW7A 2KUMA 3T16A 1I94L 4Q0YA 4ECYA 1I7LA 5J2UF 1A15A 1M0TA 4N9PA 4CC5A 2E2IB 5HURA 4DU9A 1DD2A 5C4XB 1KLGD 3GIIA 4U6PA 2OCEA 1GUGA 4ED8A 4RAZA 1DOKA 5IOCA 1IBLL 1AE2A 1LT6D 4DAVA 4FF1A 3KK7A 1HZAA 1STYA 3PO2H 3V4ZA 3C2PA 1KL9A 2PMZB 2B3GA 1FJGH 3H0GH 4DNIA 3BVMA 3U9TA 4L63B 2PZUA 1EFWA 2X0SA 3H4BA 3GTOH 3NBIA 5D3IB 3OSOA 1VQDA 2ID0A 5KEEA 1K8OA 2Z6KA 3GTQH 4XYOA 2Q2HA 2R93A 2V9WA 3EPGA 4DV3H 1I3QH 3S14H 4QWAA 1V1PB 2KEEA 1EWHA 4DR3L 3H3VC 2YRWA 3QZ7A 2C28A 1MJCA 1C8CA 3ND9A 4IUQA 4DXGA 3J7A5 2WDTA 2F3VA 1L0WA 4DR5Q 4MAMA 3TRZA 2E76C 2NBFA 1HNWH 3OIQA 4A76A 5CB4F 3M4YA 4BBRB 3I91A 2EIFA 1YBYA 2HDMA 2GLTA 4EQPA 2W71A 4GNXA 5M5XH 2VA2A 1NMFA 3T4AC 4BS9A 1CT1D 4F7XA 5K5PA 1RIPA 1V43A 1SMXA 2Q8RE 3I90A 1K8AC 4B3MQ 3GV3A 3L7ZC 2I0QA 4KV6A 1KJQA 3CQZH 4DUZQ 3GLKA 1CZGA 4J0MA 5LMNH 3BQ1A 1K73C 1M4VA 4EEYA 1HNXH 4YCUA 3PW5A 2X6GA 3STBC 1WCMA 3J7YW 1CE8A 4FXGC 3GQCA 3LGJA 5CV6A 4GKJQ 2I80A 2MQHA 1E0BA 1LACA 2LS01 3AEVA 4JI7L 1FVIA 5H80A 4KHVA 4J8QA 1Y8NB 4ID6A 3RZOH 3J81j 3CPWA 2GPSA 2OF1A 3D31A 1PYWD 3V6KA 5BMVF 4OWTB 4CKBA 4GS3A 2JA5B 4RKLA 1ZHSA 3K58A 4RKBA 3MWDA 4OX9H 1CZWA 3TS0A 1PH2A 3N41B 4TSSA 1UEBA 2E8GA 2XSCA 2V58A 2VB2X 5LP6F 3RIZA 2K5WA 2GA4B 2OTLA 1GJXA 4K5VA 1I94H 2F3IA 2ATWA 4APMA 1I50A 4XQQA 4MV6A 5C3EB 5KYIA 3T5KA 1BBUA 4RGMA 1ZETA 2EYHA 2A73B 1N34L 1STAA 3S2DB 2N49A 4ECZA 4K5WA 4Y7NH 1XMOL 1XX8A 4J1MA 3A5UA 3A0JA 3HOVB 2FP4B 5KG6A 4DR2L 3L4KA 3V6HA 1UC9A 2A6ED 2UUCH 3LNNA 1SNOA 1OXXK 5A35A 2B2UC 4RUCA 1WVLA 1FJGQ 2RKSA 4UPAA 5BN4A 1BBWA 3GTPH 2W6ZA 2EE1A 1BQQT 1R9TH 4FF3A 4IQZA 4G7ZC 4DF7A 3ZJYC 1ET9A 2CKZB 2L11A 3CW2C 2VB3X 1B50A 1RJQA 4G57A 1YNXA 3M9NB 3GTJB 1B33N 1BBXC 4YJ3F 4DR3H 3U50C 1GUOA 2Y0SG 5C5MA 1HUMA 5EJWA 1S40A 2KQ3A 1K3RA 4GOPC 3I73A 1Z2NX 5KFIA 2Z4HA 3EFXD 3I7FA 2B2WA 3A74A 5KFHA 2C2DA 4ZYSA 1TS3A 4A3GG 4FF4A 1K0SA 4WJWA 4DV1L 3TP8A 1UE7A 3KJOA 1HNWQ 4RGOS 2F0QA 2PZTA 5JVLA 4B08A 2W9BB 4ECWA 3HEJA 3IAYA 1EYDA 3JZIA 2K7VA 2BQUA 1UWVA 1YNND 2B2VA 2GPWA 3CU7A 4R9WA 4R8IA 2R6FA 5IWAL 3V4SA 3GIKA 4JI6L 4EGVA 2ZJRA 3MXNA 3Q0AA 2PW5A 3A8KE 4HR7B 2QILA 4G7HC 3S16H 5CMDA 2VQEL 5IYDH 1HUNA 1JOOA 2RBMA 2QA4A 4AQYH 4OHJA 4ED7A 4C3HB 4A3IG 3VR3A 2HCCA 3RBEA 4LF6H 1EOVA 2B63H 3RB4A 2VUMB 4NP5A 3GTMH 4X3UA 3RB0A 3T1HL 3VYTA 2W6NA 1RODA 3JAMi 1PH9A 3GTKH 1Y1VH 4XYQA 4OX9Q 4PG3A 1TWHH 3PUZA 4DR7L 3S1MB 4ECVA 3M4PA 2VOBA 4MV9A 3VDYA 3UFXB 1H9RA 1TWFH 1V9PA 1F2MA 4A3CH 1GLVA 1KJIA 2J6TA 3I4MG 4J9SA 1CFMA 5J2TF 3A8IE 4I55F 4GC6A 3HOWG 3DUZA 5M3FG 2BQRA 1AEXA 2RHQB 1PA6A 1IOWA 3JAMc 3NE5B 4WBNF 2F52A 3PIP3 1SEBD 2ZXRA 3J80i 4KY5A 2XNAC 2B2TA 5LXTF 3T5HA 4LFAH 2B8GA 3VR2A 2RDHA 3SGIA 2BR0A 3M9OB 4HSVA 4YB8B 2UUCQ 1QUQA 2K28A 1K1SA 1HPCA 4XQJA 5IYZF 3V05A 1ONLA 1TWAH 3EVQA 1EOTA 4HAEA 1XXGA 1Y14B 1SFOB 1TA8A 4MIUA 1ASYA 3PO2B 4X3TA 1S5FD 4X65L 2DIKA 5EKKA 4E6IA 3J80c 1JDBB 3K5OA 4O3NA 4RB1A 3H0GB 1H9SA 4BY1G 3S1RH 3Q8QB 1N9WA 4BWSC 2UXDH 1SE8A 2EYPA 4FBTA 4LF9Q 5CYUA 4RMFA 1MKHA 1PX2A 3GTOB 3L3OC 4QGUA 3PIOA 3KHHA 3GTQB 3N44B 5HY6A 3UDFA 4K6DA 2CW7A 3NTKA 5DGBA 2DY7A 1GSHA 2FPPB 1I3QB 3S14B 3PSIA 1A9XA 3KLSA 5EWEA 3KDFA 4FM9A 4WRDA 4LFBH 3PCOB 2K14A 3S2HH 1V4YA 3A7AB 2VZAA 4YWMA 1U5KA 2MPMA 5IE8A 2WACA 3E9HA 3VPCA 1O7YA
chains in the Genus database with same CATH topology
1S3OA 4BXXH 3BZCA 4HJ8A 4UP7A 4L5QA 2HQLA 2K52A 3FKIG 4R1JA 3IRBA 4LF8L 4NPSA 2KBNA 4JI1L 4A3EH 1GM5A 3AFQA 2E2JH 1JMCA 4BBRG 1YJNA 2UXDL 1XPOA 3F8TA 2C35B 5IYCG 4NXNL 2K4KA 1B7YB 4LUOA 1KRTA 4AQYQ 1Q82C 2R7FA 2HIXA 3RLNA 4MTNA 1KC8C 1XMQL 2F4VQ 3I4NH 1M1KC 4LF6Q 4DR6L 4HJ5A 2Q2UA 2PI2A 4JI4L 2A19A 4KHPQ 5JJIA 1YVCA 5HGQA 1EIFA 2UUAL 3DLLA 3U58A 4BY7G 5AJ3Q 2ZJQA 4DUYQ 1A8VA 1O7IA 4A93G 1HZCA 4LFBL 5FJ8H 2VL6A 4HIOA 3S15H 1JJ2A 1X65A 4JG2A 2BA1A 4ALPA 4AYBG 4X65Q 2ASBA 2XGTA 1G291 2CWAA 2JA8G 3HOYH 3OTOL 4OONA 4OWXB 3KF8B 1HH2P 3F2DA 4RG1A 1KHIA 1Q8KA 2JEBI 4YHHQ 3ULPA 4IJLA 2IHFA 4JI0L 3I4OA 5ELOA 4DK3C 4DV7L 2JA5G 1I6HH 1VQKA 1YEZA 4X66L 4JV5Q 4GKJL 1KD1C 5IYDG 5C44H 3S24A 3CCRA 1EQRA 2HHHL 5M5YH 1SLJA 1SFOH 1KIXA 1DGSA 3U4VA 4JI5L 1VQ6A 2YU9H 3W5OA 3CMAA 3S17H 2PI2E 3HOXG 1VQNA 4LFAQ 2K5VA 2B63G 4DAYB 3T1YL 4JI3L 4LF4Q 5GADC 3M7NA 3A5ZB 4A3KG 1PH4A 2PMZE 1X54A 3E0EA 2OWOA 3HKZG 3KOJA 2VNUD 4IFDG 1Y1VG 3CCUA 3PV0A 5C3EH 1VQ8A 2NZOA 2CQOA 1PH1A 1HR0Q 1Q86C 4YWLA 3GD7A 1PH7A 4APVA 4QJFA 4GKKL 4A3CG 1FL0A 4LF5L 2WP8J 4LF8Q 1CUKA 3GTGH 1YITA 4Y52H 4K0KL 3TEHB 5GAEC 3H3VH 2UXDQ 2I5MX 3PUYA 3RLOA 4YY3Q 5M3MH 3MXNB 1JB7A 2WAQE 3HOVH 2B29A 2K50A 4NXNQ 1W3SA 2A8VA 5J3BA 1XMQQ 3UDGA 4XTCS 2KCMA 3CC2A 4X64L 1SROA 5IY0A 3CMEA 4DR6Q 2VS1A 4P73A 3I2ZA 1QVGA 1JJGA 1YJ9A 4JI4Q 3WWVA 4A3JG 3PO3H 2ES2A 3CCQA 1EIYB 2UUAQ 4BBSH 1AH9A 2NN6G 5IP7G 1LUZA 3L0OA 3H15A 4GOPB 4IOAA 4LFBQ 1I50H 1D8LA 2DUDA 4OO1G 5JEAG 4B3TL 2QGQA 1B8AA 3K81C 1OTCA 1PHJA 2UU9L 3K8AA 3OTOQ 1QZGA 1UE5A 2YTYA 5C4XG 1N8RC 4O2DA 1NE3A 1E3PA 2GVBA 3RR5A 1EWIA 4DAMA 4JI0Q 1XNQQ 1NJIC 3ER0A 5C4JH 2JJQA 4DV7Q 1QVCA 4A3BH 2IX1A 4X66Q 3G6EA 4DV3L 4HJAA 5FLXc 4QY7A 5FLMH 3PIPA 2NVXH 3EN2A 3K7UC 4TVAB 2VQEQ 1Y1WH 2K5HA 1T9HA 2HHHQ 2AMCB 2Q2IA 1VQCA 3RZDH 3PF4A 4HIMA 4JI5Q 3TS2A 5GQOA 5C0XJ 4A3LH 4C3JH 4QIWE 3TREA 4L5SA 1GD7A 2LXKA 4EQ5A 5EAYA 4A3FG 2E2HH 1WOCA 4DV4L 5IP9G 1WYDA 4IFDI 5DLQE 2Z0SA 3L2PA 1VQHA 2MO0A 2YTXA 1E7ZA 3CAMA 3PUXA 4DK6C 1IBML 1QUQB 3HFZB 4A3MH 2CWPA 2MO1A 4GKKQ 5H1SE 4LF5Q 3K80C 4LNQA 4WJ4A 5LMNW 2WAQG 4P75A 4R4QA 3ERSX 1HJPA 5LMNL 3RLFA 4K0KQ 1E1OA 4C3HH 4UP9A 1PH8A 1E24A 1HNXL 1UE6A 4PMWA 3W1BA 4BXXG 3K7AH 4DV5L 4A75A 2VUMH 3UE1A 2ZJPA 1CSQA 1LM0A 1X55A 4X64Q 3CC4A 3CCLA 4A3EG 4GLAC 1KAWA 1BVSA 3OW2A 1XPRA 4IPGA 4R4CA 4JOIC 2R7ZH 1KXLA 2R6GA 1XNRL 2VW9A 2KCTA 1VQPA 3STBD 3S1MH 2NN6I 1JJCB 4DV2L 3I4NG 4QL5A 4DR5L 2JE6I 1GO3E 2ZTCA 3CPFA 4H02A 4NB3A 3G48A 1BKBA 4KI0A 3KJPA 1L2FA 4UY8C 4DR4L 4OO1I 3KDFB 4B3TQ 2IX0A 2QEXA 2RCNA 2UU9Q 1IBKL 4POGA 4YWKA 1D7QA 3PUWA 2R7DA 2R93H 2Z6KC 1K8GA 4DV6L 2HIVA 3UDIA 3NEMA 1OXUA 5FJ8G 2D62A 2MFIA 4ME3A 2D0OA 4B3ML 5ELNA 1VQMA 1PH5A 2AWOA 3GTLH 1I94L 1V1QA 4DUZL 3HOYG 4R4IA 1I5FA 1Q1BA 4DV3Q 2XTIA 1YHQA 4IOCA 2KENA 1Q81C 1X3FA 1MIUA 2OCEA 5LMUL 2D0PA 4GN5A 2IY5B 5C44G 2RHSB 3EBEA 1IBLL 1AE2A 3HOZH 4A3GH 1MJEA 4GNXC 3W1GA 4DV4Q 2ALYB 1HZAA 4EX5A 1AE3A 2BA0A 3PO2H 4JOIA 2NVQH 1IBMQ 1KL9A 4UP8A 2WB1E 1EQQA 1N32L 2B3GA 3H0GH 4DNIA 3PF5A 3DM3A 5LMNQ 1WCMH 5C3EG 1EFWA 1XPUA 2IHEA 1HNXQ 2JA7H 3GTOH 2E5LL 1VQDA 2ID0A 4DV5Q 2Z6KA 3HKZE 2H5XA 3GTQH 2UXCL 1G6PA 2Q2HA 3J81i 2EXDA 3HOUH 1I3QH 3S14H 3PUVA 4JI1Q 4DR3L 5M3MG 5E7NA 4IO9A 3HOVG 3U4ZA 1IL2A 2YYZA 1XNRQ 1MJCA 4A3IH 3J7A5 3M3YH 4LF7L 3MEFA 4HJ7A 1L0WA 4B3SL 2VY3A 4DR1L 3M85A 4DR5Q 3M4OH 3B6YA 3G71A 3TRZA 1VQ5A 2NZHA 4IPDA 2CCZA 4LFCL 5M5WH 3PO3G 4DR4Q 4BBSG 3PGZA 4LUVA 2NVYH 4LWCA 4A76A 1C0AA 2EIFA 3CXCA 2PQAA 4JBJA 1YBYA 4DV6Q 2N8NA 4GNXA 5M5XH 3J81c 1NMFA 1X9NA 1VQLA 1RIPA 1V43A 1SMXA 3UDXA 1L1OC 1QZHA 1FGUA 2V1CC 1K8AC 3L7ZC 4JC0A 2I0QA 4B3MQ 3CQZH 1FJGL 3UE0A 3I4MH 4KLKA 1I94Q 4IPHA 4DUZQ 3RN5A 5JJLA 1OXVA 4JBWA 1K73C 3HOWH 4YCVA 5M3FH 3FP9A 4YCUA 1HNZL 5C0XG 3NELA 4KHZA 3STBC 4A3DG 1CKNA 4A3BG 5LMUQ 1M90C 5IT9c 4L5RC 2AKWB 4JI2L 2JA6G 3LGJA 3NENA 5FLMG 4GKJQ 2MQHA 1IBLQ 3CC7A 1PFSA 4P71A 3AEVA 4JI7L 1VCIA 1FVIA 1HZBA 2WB1G 3FHWA 2R92H 2Y0SE 3RZOH 3J81j 3CPWA 1S72A 4A3LG 3D31A 1TWGH 2BH2A 3ULJA 3T1YQ 4JI3Q 4TQUS 4OWTB 4GS3A 2PQAB 3F2CA 3AQQA 1HNWL 5AJ3L 3TS0A 2ZM6L 1PH2A 4JYAL 4J15A 1UEBA 2E8GA 2RF4A 4P72A 1PH6A 4YCWA 1IZ6A 3J7ZC 1PV4A 1WFQA 4A3MG 2E5LQ 3KF6A 2OTLA 3M4QA 2K75A 2I5LX 2OQKA 4GN3B 5IYBH 2UXCQ 1VQAA 1VQBA 4MNOA 3KFUA 4HIDA 2F3IA 2ATWA 3H3VI 4BY1H 1L1OA 5GROA 4DR3Q 1J5EL 3CD6A 1CKMA 5JJKA 1CKNB 3JC66 1E1TA 1J6QA 1BBUA 4XIGS 2VUMG 1PYSB 4HIKA 4B3SQ 4DR1Q 3NBHB 2WFWA 1N34L 1ASZA 1X3GA 4L5TA 2N49A 4Y7NH 2Q2TA 1VQOA 1YIJA 1XMOL 3G4SA 2R7ZG 3E9IA 3A5UA 3ICEA 3CCMA 4R4TA 5K36G 3A0JA 1Z9FA 1YJWA 2PNHA 4DR2L 4B3RL 2OQ0A 1PH3A 1OXXK 3CCVA 4JBMA 1FJGQ 2KHIA 4DKAC 4UPAA 1E22A 3CF5A 1BBWA 3GTPH 1HR0W 4OX9L 1R9TH 1C9OA 2R93G 1X6OA 3GO5A 4A3DH 4DV0L 1LYLA 1CSPA 3ZJYC 2L15A 5C0XI 1Q12A 1HNZQ 1L1OB 2BH8A 3FKIH 2CKZB 2ZTDA 3CW2C 3S1NH 1YHBA 2UXBL 4YY3L 4JI2Q 1YNXA 2LSSA 4BBRH 3D0FA 5IYCH 3U50C 2Y0SG 4JI7Q 4P74A 1S40A 2MNAA 1K3RA 4GOPC 1X3EA 1JT8A 1NY4A 5GAHC 1VQGA 4BA1I 3S1QH 3I7FA 3A74A 1A62A 1VQEA 2CFMA 5BR8L 3HOZG 4A3GG 3ULLA 3CCEA 1Z47A 4DV1L 1UE7A 1WI5A 3BJUA 3KJOA 1HNWQ 4BY7H 2ZM6Q 1YZ6A 2LXJA 4JYAQ 3PO2G 4A93H 2JK8A 4NXML 1NMGA 4PZ7A 4WJ3M 1VQJA 3CCSA 2UUCL 2DGYA 1H95A 3H0GG 3RN2A 3KLWA 1UWVA 4IPCA 2UUBL 3F1ZA 4OWWB 1VQ9A 2JA8H 3Q8DA 1TWCH 1WCMG 4JI8L 5IWAL 1Q7YC 1A0IA 1NTGA 1J5EQ 4JI6L 2JA7G 4GLXA 2ZJRA 1XNQL 3OYYA 2JA9A 3S16H 1K0RA 2JA5H 1N34Q 3HOUG 4AH6A 4GN4B 2VQEL 1N36L 5IYDH 1XMOQ 2QA4A 4LF9L 4X62L 1U0LA 1SN8A 1NBWA 4A3IG 2AHOB 4BA2I 3RNUA 4X6AH 2NVTH 1TXYA 1EOVA 3HOXH 1XJVA 4DV2Q 4DR2Q 2B63H 2VQFL 4JBKA 4B3RQ 3GTMH 4A3KH 3T1HL 4LW1A 2KHJA 4GOPA 1CKOA 2JQOA 3JAMi 1PH9A 3GTKH 1Y1VH 1P8LA 1IBKQ 1EUJA 3AYHB 4OX9Q 4PG3A 1N33L 1YHAA 1TWHH 2K5NA 3PUZA 4DR7L 1UE1A 4DV0Q 3HKSA 3M4PA 3VDYA 1W2BA 1TWFH 3S2DH 1V9PA 4A3CH 1JE5A 3I4MG 4R4OA 4DPGA 4OXPA 2JEAI 2UXBQ 1WJJA 1IYJB 4A4IA 1VQFA 3HOWG 4IFDJ 1KRSA 1SRUA 1OXSC 1Q46A 5M3FG 4PZ6A 4GLVB 2RHQB 1PA6A 4FDBA 2AWNA 3JAMc 4POFA 1C7YA 2F52A 4A3JH 2A1AA 4JCVE 3J80i 5BR8Q 4LUZA 1XTDA 1Y1WG 4AQYL 4DV1Q 2EQSA 3CCJA 2F4VL 2R92G 5IP7H 4LF6L 3SGIA 3I55A 4NXMQ 1X56A 1VQIA 1IXRA 2UUCQ 2OTJA 3BZKA 4KHPL 1N32Q 3GTJH 1Q1EA 1QUQA 1KQSA 3BU2A 2UUBQ 1PYBA 3CP0A 2E2IH 2YV5A 4GNXB 2FXQA 1TWAH 3EIVA 4JI8Q 5IWAQ 4DUYL 5C4XH 1PVOA 1Y14B 4JI6Q 4MZ9A 1ASYA 1GKHA 1LTLA 1G51A 5IYBG 2ZTEA 4X65L 3J80c 4IJHA 5JEAJ 2JA6H 3S1RH 4BY1G 4AYBE 1K9MC 1N9WA 1N36Q 1A63A 1SE8A 3M9BA 4YHHL 4LF9Q 4X62Q 3K0XA 2YTVA 4RMFA 1MKHA 3I56A 1K83H 4O0AA 4QQBX 3TQYA 4LF7Q 4QGUA 3PIOA 2N78A 2I5HA 2IT1A 3KYHC 2VQFQ 5HY6A 3UDFA 4JV5L 3T1HQ 4C3IH 1SR3A 1RL2A 4AIMA 1B70B 4C2MH 4A3FH 1EYGA 3PSIA 1VQ4A 5IP9H 3F2BA 4LFCQ 3KDFA 1N33Q 3PCOB 2K14A 1VQ7A 1P16A 3GDEA 4LF4L 4LFAL 3S2HH 4DR7Q 1QVFA 5GAGC 1OXTA 1VS0A 3AFPA 2VZAA 1GVPA 2GN5A 4YWMA 1U5KA 5IE8A 4PZ8A 1HZ9A 4HJ9A 2GVAA 3E9HA 1YI2A 2HT1A 3KF6B 1HR0L 2N3SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3O A;  4BXX H;  3BZC A;  4HJ8 A;  4UP7 A;  4L5Q A;  2HQL A;  2K52 A;  3FKI G;  4R1J A;  3IRB A;  4LF8 L;  4NPS A;  2KBN A;  4JI1 L;  4A3E H;  1GM5 A;  3AFQ A;  2E2J H;  1JMC A;  4BBR G;  1YJN A;  2UXD L;  1XPO A;  3F8T A;  2C35 B;  5IYC G;  4NXN L;  2K4K A;  1B7Y B;  4LUO A;  1KRT A;  4AQY Q;  1Q82 C;  2R7F A;  2HIX A;  3RLN A;  4MTN A;  1KC8 C;  1XMQ L;  2F4V Q;  3I4N H;  1M1K C;  4LF6 Q;  4DR6 L;  4HJ5 A;  2Q2U A;  2PI2 A;  4JI4 L;  2A19 A;  4KHP Q;  5JJI A;  1YVC A;  5HGQ A;  1EIF A;  2UUA L;  3DLL A;  3U58 A;  4BY7 G;  5AJ3 Q;  2ZJQ A;  4DUY Q;  1A8V A;  1O7I A;  4A93 G;  1HZC A;  4LFB L;  5FJ8 H;  2VL6 A;  4HIO A;  3S15 H;  1JJ2 A;  1X65 A;  4JG2 A;  2BA1 A;  4ALP A;  4AYB G;  4X65 Q;  2ASB A;  2XGT A;  1G29 1;  2CWA A;  2JA8 G;  3HOY H;  3OTO L;  4OON A;  4OWX B;  3KF8 B;  1HH2 P;  3F2D A;  4RG1 A;  1KHI A;  1Q8K A;  2JEB I;  4YHH Q;  3ULP A;  4IJL A;  2IHF A;  4JI0 L;  3I4O A;  5ELO A;  4DK3 C;  4DV7 L;  2JA5 G;  1I6H H;  1VQK A;  1YEZ A;  4X66 L;  4JV5 Q;  4GKJ L;  1KD1 C;  5IYD G;  5C44 H;  3S24 A;  3CCR A;  1EQR A;  2HHH L;  5M5Y H;  1SLJ A;  1SFO H;  1KIX A;  1DGS A;  3U4V A;  4JI5 L;  1VQ6 A;  2YU9 H;  3W5O A;  3CMA A;  3S17 H;  2PI2 E;  3HOX G;  1VQN A;  4LFA Q;  2K5V A;  2B63 G;  4DAY B;  3T1Y L;  4JI3 L;  4LF4 Q;  5GAD C;  3M7N A;  3A5Z B;  4A3K G;  1PH4 A;  2PMZ E;  1X54 A;  3E0E A;  2OWO A;  3HKZ G;  3KOJ A;  2VNU D;  4IFD G;  1Y1V G;  3CCU A;  3PV0 A;  5C3E H;  1VQ8 A;  2NZO A;  2CQO A;  1PH1 A;  1HR0 Q;  1Q86 C;  4YWL A;  3GD7 A;  1PH7 A;  4APV A;  4QJF A;  4GKK L;  4A3C G;  1FL0 A;  4LF5 L;  2WP8 J;  4LF8 Q;  1CUK A;  3GTG H;  1YIT A;  4Y52 H;  4K0K L;  3TEH B;  5GAE C;  3H3V H;  2UXD Q;  2I5M X;  3PUY A;  3RLO A;  4YY3 Q;  5M3M H;  3MXN B;  1JB7 A;  2WAQ E;  3HOV H;  2B29 A;  2K50 A;  4NXN Q;  1W3S A;  2A8V A;  5J3B A;  1XMQ Q;  3UDG A;  4XTC S;  2KCM A;  3CC2 A;  4X64 L;  1SRO A;  5IY0 A;  3CME A;  4DR6 Q;  2VS1 A;  4P73 A;  3I2Z A;  1QVG A;  1JJG A;  1YJ9 A;  4JI4 Q;  3WWV A;  4A3J G;  3PO3 H;  2ES2 A;  3CCQ A;  1EIY B;  2UUA Q;  4BBS H;  1AH9 A;  2NN6 G;  5IP7 G;  1LUZ A;  3L0O A;  3H15 A;  4GOP B;  4IOA A;  4LFB Q;  1I50 H;  1D8L A;  2DUD A;  4OO1 G;  5JEA G;  4B3T L;  2QGQ A;  1B8A A;  3K81 C;  1OTC A;  1PHJ A;  2UU9 L;  3K8A A;  3OTO Q;  1QZG A;  1UE5 A;  2YTY A;  5C4X G;  1N8R C;  4O2D A;  1NE3 A;  1E3P A;  2GVB A;  3RR5 A;  1EWI A;  4DAM A;  4JI0 Q;  1XNQ Q;  1NJI C;  3ER0 A;  5C4J H;  2JJQ A;  4DV7 Q;  1QVC A;  4A3B H;  2IX1 A;  4X66 Q;  3G6E A;  4DV3 L;  4HJA A;  5FLX c;  4QY7 A;  5FLM H;  3PIP A;  2NVX H;  3EN2 A;  3K7U C;  4TVA B;  2VQE Q;  1Y1W H;  2K5H A;  1T9H A;  2HHH Q;  2AMC B;  2Q2I A;  1VQC A;  3RZD H;  3PF4 A;  4HIM A;  4JI5 Q;  3TS2 A;  5GQO A;  5C0X J;  4A3L H;  4C3J H;  4QIW E;  3TRE A;  4L5S A;  1GD7 A;  2LXK A;  4EQ5 A;  5EAY A;  4A3F G;  2E2H H;  1WOC A;  4DV4 L;  5IP9 G;  1WYD A;  4IFD I;  5DLQ E;  2Z0S A;  3L2P A;  1VQH A;  2MO0 A;  2YTX A;  1E7Z A;  3CAM A;  3PUX A;  4DK6 C;  1IBM L;  1QUQ B;  3HFZ B;  4A3M H;  2CWP A;  2MO1 A;  4GKK Q;  5H1S E;  4LF5 Q;  3K80 C;  4LNQ A;  4WJ4 A;  5LMN W;  2WAQ G;  4P75 A;  4R4Q A;  3ERS X;  1HJP A;  5LMN L;  3RLF A;  4K0K Q;  1E1O A;  4C3H H;  4UP9 A;  1PH8 A;  1E24 A;  1HNX L;  1UE6 A;  4PMW A;  3W1B A;  4BXX G;  3K7A H;  4DV5 L;  4A75 A;  2VUM H;  3UE1 A;  2ZJP A;  1CSQ A;  1LM0 A;  1X55 A;  4X64 Q;  3CC4 A;  3CCL A;  4A3E G;  4GLA C;  1KAW A;  1BVS A;  3OW2 A;  1XPR A;  4IPG A;  4R4C A;  4JOI C;  2R7Z H;  1KXL A;  2R6G A;  1XNR L;  2VW9 A;  2KCT A;  1VQP A;  3STB D;  3S1M H;  2NN6 I;  1JJC B;  4DV2 L;  3I4N G;  4QL5 A;  4DR5 L;  2JE6 I;  1GO3 E;  2ZTC A;  3CPF A;  4H02 A;  4NB3 A;  3G48 A;  1BKB A;  4KI0 A;  3KJP A;  1L2F A;  4UY8 C;  4DR4 L;  4OO1 I;  3KDF B;  4B3T Q;  2IX0 A;  2QEX A;  2RCN A;  2UU9 Q;  1IBK L;  4POG A;  4YWK A;  1D7Q A;  3PUW A;  2R7D A;  2R93 H;  2Z6K C;  1K8G A;  4DV6 L;  2HIV A;  3UDI A;  3NEM A;  1OXU A;  5FJ8 G;  2D62 A;  2MFI A;  4ME3 A;  2D0O A;  4B3M L;  5ELN A;  1VQM A;  1PH5 A;  2AWO A;  3GTL H;  1I94 L;  1V1Q A;  4DUZ L;  3HOY G;  4R4I A;  1I5F A;  1Q1B A;  4DV3 Q;  2XTI A;  1YHQ A;  4IOC A;  2KEN A;  1Q81 C;  1X3F A;  1MIU A;  2OCE A;  5LMU L;  2D0P A;  4GN5 A;  2IY5 B;  5C44 G;  2RHS B;  3EBE A;  1IBL L;  1AE2 A;  3HOZ H;  4A3G H;  1MJE A;  4GNX C;  3W1G A;  4DV4 Q;  2ALY B;  1HZA A;  4EX5 A;  1AE3 A;  2BA0 A;  3PO2 H;  4JOI A;  2NVQ H;  1IBM Q;  1KL9 A;  4UP8 A;  2WB1 E;  1EQQ A;  1N32 L;  2B3G A;  3H0G H;  4DNI A;  3PF5 A;  3DM3 A;  5LMN Q;  1WCM H;  5C3E G;  1EFW A;  1XPU A;  2IHE A;  1HNX Q;  2JA7 H;  3GTO H;  2E5L L;  1VQD A;  2ID0 A;  4DV5 Q;  2Z6K A;  3HKZ E;  2H5X A;  3GTQ H;  2UXC L;  1G6P A;  2Q2H A;  3J81 i;  2EXD A;  3HOU H;  1I3Q H;  3S14 H;  3PUV A;  4JI1 Q;  4DR3 L;  5M3M G;  5E7N A;  4IO9 A;  3HOV G;  3U4Z A;  1IL2 A;  2YYZ A;  1XNR Q;  1MJC A;  4A3I H;  3J7A 5;  3M3Y H;  4LF7 L;  3MEF A;  4HJ7 A;  1L0W A;  4B3S L;  2VY3 A;  4DR1 L;  3M85 A;  4DR5 Q;  3M4O H;  3B6Y A;  3G71 A;  3TRZ A;  1VQ5 A;  2NZH A;  4IPD A;  2CCZ A;  4LFC L;  5M5W H;  3PO3 G;  4DR4 Q;  4BBS G;  3PGZ A;  4LUV A;  2NVY H;  4LWC A;  4A76 A;  1C0A A;  2EIF A;  3CXC A;  2PQA A;  4JBJ A;  1YBY A;  4DV6 Q;  2N8N A;  4GNX A;  5M5X H;  3J81 c;  1NMF A;  1X9N A;  1VQL A;  1RIP A;  1V43 A;  1SMX A;  3UDX A;  1L1O C;  1QZH A;  1FGU A;  2V1C C;  1K8A C;  3L7Z C;  4JC0 A;  2I0Q A;  4B3M Q;  3CQZ H;  1FJG L;  3UE0 A;  3I4M H;  4KLK A;  1I94 Q;  4IPH A;  4DUZ Q;  3RN5 A;  5JJL A;  1OXV A;  4JBW A;  1K73 C;  3HOW H;  4YCV A;  5M3F H;  3FP9 A;  4YCU A;  1HNZ L;  5C0X G;  3NEL A;  4KHZ A;  3STB C;  4A3D G;  1CKN A;  4A3B G;  5LMU Q;  1M90 C;  5IT9 c;  4L5R C;  2AKW B;  4JI2 L;  2JA6 G;  3LGJ A;  3NEN A;  5FLM G;  4GKJ Q;  2MQH A;  1IBL Q;  3CC7 A;  1PFS A;  4P71 A;  3AEV A;  4JI7 L;  1VCI A;  1FVI A;  1HZB A;  2WB1 G;  3FHW A;  2R92 H;  2Y0S E;  3RZO H;  3J81 j;  3CPW A;  1S72 A;  4A3L G;  3D31 A;  1TWG H;  2BH2 A;  3ULJ A;  3T1Y Q;  4JI3 Q;  4TQU S;  4OWT B;  4GS3 A;  2PQA B;  3F2C A;  3AQQ A;  1HNW L;  5AJ3 L;  3TS0 A;  2ZM6 L;  1PH2 A;  4JYA L;  4J15 A;  1UEB A;  2E8G A;  2RF4 A;  4P72 A;  1PH6 A;  4YCW A;  1IZ6 A;  3J7Z C;  1PV4 A;  1WFQ A;  4A3M G;  2E5L Q;  3KF6 A;  2OTL A;  3M4Q A;  2K75 A;  2I5L X;  2OQK A;  4GN3 B;  5IYB H;  2UXC Q;  1VQA A;  1VQB A;  4MNO A;  3KFU A;  4HID A;  2F3I A;  2ATW A;  3H3V I;  4BY1 H;  1L1O A;  5GRO A;  4DR3 Q;  1J5E L;  3CD6 A;  1CKM A;  5JJK A;  1CKN B;  3JC6 6;  1E1T A;  1J6Q A;  1BBU A;  4XIG S;  2VUM G;  1PYS B;  4HIK A;  4B3S Q;  4DR1 Q;  3NBH B;  2WFW A;  1N34 L;  1ASZ A;  1X3G A;  4L5T A;  2N49 A;  4Y7N H;  2Q2T A;  1VQO A;  1YIJ A;  1XMO L;  3G4S A;  2R7Z G;  3E9I A;  3A5U A;  3ICE A;  3CCM A;  4R4T A;  5K36 G;  3A0J A;  1Z9F A;  1YJW A;  2PNH A;  4DR2 L;  4B3R L;  2OQ0 A;  1PH3 A;  1OXX K;  3CCV A;  4JBM A;  1FJG Q;  2KHI A;  4DKA C;  4UPA A;  1E22 A;  3CF5 A;  1BBW A;  3GTP H;  1HR0 W;  4OX9 L;  1R9T H;  1C9O A;  2R93 G;  1X6O A;  3GO5 A;  4A3D H;  4DV0 L;  1LYL A;  1CSP A;  3ZJY C;  2L15 A;  5C0X I;  1Q12 A;  1HNZ Q;  1L1O B;  2BH8 A;  3FKI H;  2CKZ B;  2ZTD A;  3CW2 C;  3S1N H;  1YHB A;  2UXB L;  4YY3 L;  4JI2 Q;  1YNX A;  2LSS A;  4BBR H;  3D0F A;  5IYC H;  3U50 C;  2Y0S G;  4JI7 Q;  4P74 A;  1S40 A;  2MNA A;  1K3R A;  4GOP C;  1X3E A;  1JT8 A;  1NY4 A;  5GAH C;  1VQG A;  4BA1 I;  3S1Q H;  3I7F A;  3A74 A;  1A62 A;  1VQE A;  2CFM A;  5BR8 L;  3HOZ G;  4A3G G;  3ULL A;  3CCE A;  1Z47 A;  4DV1 L;  1UE7 A;  1WI5 A;  3BJU A;  3KJO A;  1HNW Q;  4BY7 H;  2ZM6 Q;  1YZ6 A;  2LXJ A;  4JYA Q;  3PO2 G;  4A93 H;  2JK8 A;  4NXM L;  1NMG A;  4PZ7 A;  4WJ3 M;  1VQJ A;  3CCS A;  2UUC L;  2DGY A;  1H95 A;  3H0G G;  3RN2 A;  3KLW A;  1UWV A;  4IPC A;  2UUB L;  3F1Z A;  4OWW B;  1VQ9 A;  2JA8 H;  3Q8D A;  1TWC H;  1WCM G;  4JI8 L;  5IWA L;  1Q7Y C;  1A0I A;  1NTG A;  1J5E Q;  4JI6 L;  2JA7 G;  4GLX A;  2ZJR A;  1XNQ L;  3OYY A;  2JA9 A;  3S16 H;  1K0R A;  2JA5 H;  1N34 Q;  3HOU G;  4AH6 A;  4GN4 B;  2VQE L;  1N36 L;  5IYD H;  1XMO Q;  2QA4 A;  4LF9 L;  4X62 L;  1U0L A;  1SN8 A;  1NBW A;  4A3I G;  2AHO B;  4BA2 I;  3RNU A;  4X6A H;  2NVT H;  1TXY A;  1EOV A;  3HOX H;  1XJV A;  4DV2 Q;  4DR2 Q;  2B63 H;  2VQF L;  4JBK A;  4B3R Q;  3GTM H;  4A3K H;  3T1H L;  4LW1 A;  2KHJ A;  4GOP A;  1CKO A;  2JQO A;  3JAM i;  1PH9 A;  3GTK H;  1Y1V H;  1P8L A;  1IBK Q;  1EUJ A;  3AYH B;  4OX9 Q;  4PG3 A;  1N33 L;  1YHA A;  1TWH H;  2K5N A;  3PUZ A;  4DR7 L;  1UE1 A;  4DV0 Q;  3HKS A;  3M4P A;  3VDY A;  1W2B A;  1TWF H;  3S2D H;  1V9P A;  4A3C H;  1JE5 A;  3I4M G;  4R4O A;  4DPG A;  4OXP A;  2JEA I;  2UXB Q;  1WJJ A;  1IYJ B;  4A4I A;  1VQF A;  3HOW G;  4IFD J;  1KRS A;  1SRU A;  1OXS C;  1Q46 A;  5M3F G;  4PZ6 A;  4GLV B;  2RHQ B;  1PA6 A;  4FDB A;  2AWN A;  3JAM c;  4POF A;  1C7Y A;  2F52 A;  4A3J H;  2A1A A;  4JCV E;  3J80 i;  5BR8 Q;  4LUZ A;  1XTD A;  1Y1W G;  4AQY L;  4DV1 Q;  2EQS A;  3CCJ A;  2F4V L;  2R92 G;  5IP7 H;  4LF6 L;  3SGI A;  3I55 A;  4NXM Q;  1X56 A;  1VQI A;  1IXR A;  2UUC Q;  2OTJ A;  3BZK A;  4KHP L;  1N32 Q;  3GTJ H;  1Q1E A;  1QUQ A;  1KQS A;  3BU2 A;  2UUB Q;  1PYB A;  3CP0 A;  2E2I H;  2YV5 A;  4GNX B;  2FXQ A;  1TWA H;  3EIV A;  4JI8 Q;  5IWA Q;  4DUY L;  5C4X H;  1PVO A;  1Y14 B;  4JI6 Q;  4MZ9 A;  1ASY A;  1GKH A;  1LTL A;  1G51 A;  5IYB G;  2ZTE A;  4X65 L;  3J80 c;  4IJH A;  5JEA J;  2JA6 H;  3S1R H;  4BY1 G;  4AYB E;  1K9M C;  1N9W A;  1N36 Q;  1A63 A;  1SE8 A;  3M9B A;  4YHH L;  4LF9 Q;  4X62 Q;  3K0X A;  2YTV A;  4RMF A;  1MKH A;  3I56 A;  1K83 H;  4O0A A;  4QQB X;  3TQY A;  4LF7 Q;  4QGU A;  3PIO A;  2N78 A;  2I5H A;  2IT1 A;  3KYH C;  2VQF Q;  5HY6 A;  3UDF A;  4JV5 L;  3T1H Q;  4C3I H;  1SR3 A;  1RL2 A;  4AIM A;  1B70 B;  4C2M H;  4A3F H;  1EYG A;  3PSI A;  1VQ4 A;  5IP9 H;  3F2B A;  4LFC Q;  3KDF A;  1N33 Q;  3PCO B;  2K14 A;  1VQ7 A;  1P16 A;  3GDE A;  4LF4 L;  4LFA L;  3S2H H;  4DR7 Q;  1QVF A;  5GAG C;  1OXT A;  1VS0 A;  3AFP A;  2VZA A;  1GVP A;  2GN5 A;  4YWM A;  1U5K A;  5IE8 A;  4PZ8 A;  1HZ9 A;  4HJ9 A;  2GVA A;  3E9H A;  1YI2 A;  2HT1 A;  3KF6 B;  1HR0 L;  2N3S A; 
#chains in the Genus database with same CATH topology
 5KKN B;  2LMC B;  4JI6 H;  1EY8 A;  5KFO A;  2ZDQ A;  4UP7 A;  4L5Q A;  5M5X B;  3FKI G;  3MFI A;  1Z7T A;  2QDL A;  1BCP C;  5C6A A;  2L55 A;  4A3E H;  1MSH A;  3CQZ B;  3QWN A;  2VQE H;  3F8T A;  2C35 B;  1T36 A;  4NXN L;  3G8C A;  4MA0 A;  2HJW A;  4AQY Q;  4JI3 H;  4JI5 H;  1I4X A;  1QWY A;  3QO2 A;  5DM7 3;  2R8I A;  5DG7 A;  3I4N H;  1GGO A;  2I8C A;  4LF6 Q;  4HJ5 A;  2WYO A;  1EYA A;  4H7B A;  5KFN A;  5BN3 A;  3T1H H;  2UUA L;  3VR4 A;  4OIK A;  1Y1W B;  3DF7 A;  2R8J A;  1O7I A;  3J81 L;  1BGW A;  4ZLT F;  5FJ8 H;  3WNZ A;  2BE5 D;  4DR7 H;  4JG2 A;  3VR6 A;  3RZO B;  3NPP A;  2ASB A;  1G29 1;  2CWA A;  1WTO A;  3TP5 A;  4K0K H;  4OWX B;  4ECR A;  2Z9H A;  4EYI B;  2EY6 A;  4RG1 A;  1Q8K A;  4EBE A;  1TR5 A;  1DIK A;  3Q8S B;  4IJL A;  3JAM W;  3I4O A;  4L6T B;  2M9V A;  2F0P A;  3JAM L;  3LP8 A;  4PMB A;  4R8N A;  1YEZ A;  1DOL A;  4X66 L;  5JPN C;  2VPS A;  2Z8L A;  2R85 A;  3HZX A;  1S5C D;  5EKI A;  3BYT B;  2HHH L;  1PDQ A;  5M5Y H;  1KIX A;  5HV6 A;  1VQ6 A;  3CMA A;  1JC7 A;  4M1U B;  3HOX G;  1STG A;  4LFA Q;  5CV8 A;  3T1Y L;  4JI3 L;  4LF4 Q;  5GAD C;  1X3P A;  3HB9 A;  5KT7 A;  1W93 A;  1STB A;  2O5I C;  2OWO A;  4QB4 A;  2UU9 H;  3HKZ G;  4QUC A;  4YBZ B;  1HFN A;  2N55 A;  4Y7N B;  3S9W A;  3Q1K A;  2CQO A;  1PH1 A;  3J80 W;  1BR9 A;  1L0Y B;  4YWL A;  1Q86 C;  1PH7 A;  3BG5 A;  3J80 L;  4MV3 A;  4GKK L;  1IL8 A;  2WP8 J;  2B2Y A;  3NQT A;  1ET6 A;  3GTG H;  3TEH B;  3NGD A;  2UXD Q;  3BS1 A;  3GTP B;  1R9T B;  1F77 A;  2A8V A;  3PN1 A;  3C46 A;  2NTT A;  1GHJ A;  4MTE A;  3PR5 B;  3CC2 A;  4IR1 A;  4V0B A;  3CME A;  2VS1 A;  3TZD A;  1IHZ A;  4Y8V B;  3CCQ A;  4BBS H;  2P5Z X;  4ZOL F;  4NLG A;  1EUC B;  3I3C A;  1WR2 A;  5IP7 G;  1CK1 A;  1IBM H;  4GOP B;  4LFB Q;  4IOA A;  3KAJ A;  1I50 H;  2BDO A;  2DUD A;  4OO1 G;  4PDB A;  2R8K A;  3QJY A;  2YU9 A;  1II3 A;  1JIH A;  4U68 A;  3AU7 A;  4B9W A;  5C4X G;  5D1O B;  3E5S A;  4JI0 Q;  5KRU A;  3ER0 A;  2JJQ A;  2NVQ B;  2F0K A;  1YNJ D;  4HJA A;  4QY7 A;  2NVX H;  3V2T A;  4CHT B;  3K7U C;  2VQE Q;  2QYZ A;  4DL2 A;  1XNR H;  1PZK D;  2K5H A;  1T9H A;  2TSS A;  3MA2 B;  2XN9 C;  1PTO H;  4JI5 Q;  1PTO C;  5GON F;  1WD1 A;  2X69 A;  1K8M A;  3NTH A;  4DR4 H;  1IYU A;  4QIW E;  3S16 B;  1ZYR C;  1A3T A;  1GD7 A;  4F4W A;  5EAY A;  2SOB A;  2K6A A;  4IFD I;  2Z4I A;  5ELF A;  5F9L A;  1U9R A;  2D5D A;  4R8U B;  1RCV D;  5H1S E;  3VR5 A;  3M4O B;  3GTM B;  4HN7 A;  2AU0 A;  3ERS X;  4K0K Q;  3BDL A;  2FPI B;  1E1O A;  5CBA E;  4JV2 A;  3GTK B;  1Y1V B;  2SDF A;  1UE6 A;  4KKU A;  1L0X B;  1SDF A;  3K7A H;  4CDC C;  4A75 A;  2F0F A;  2UVV A;  4XQN A;  5LMU H;  1TWF B;  4DFA A;  3CC4 A;  5LL6 X;  3VA7 A;  4GLA C;  3X3M A;  2OH2 A;  2J6S A;  4IPG A;  4JOI C;  1NR4 A;  2HHH H;  5K36 H;  2HVS A;  3UQ8 A;  5HBR B;  4QL5 A;  4DR5 L;  4M7E A;  2JE6 I;  3CPF A;  2ZTC A;  4UCR A;  3T1Y H;  2E74 C;  4KI0 A;  1BKB A;  4NB3 A;  3KJP A;  1L2F A;  3Q23 A;  2FPG B;  5LYJ F;  2UU9 Q;  2K5Q A;  4F4Z A;  4YWK A;  1D7Q A;  2R7D A;  3FDS A;  2C22 A;  4CBV A;  3MVV A;  2XCP A;  2DPI A;  4Q8E A;  2D62 A;  2MFI A;  5C1P A;  5J39 A;  4B3M L;  4YJ2 F;  4XDX A;  2IWH A;  1SNM A;  4G4K A;  4DUZ L;  4O3R A;  1Q1B A;  2JYO A;  1YHQ A;  2XTI A;  4IOC A;  4O2A F;  3H6M A;  1F2L A;  1TWA B;  1MIU A;  3IFT A;  4QWD A;  1D1I A;  1EU4 A;  4RUA A;  1EEF D;  2XWB B;  1ILQ A;  2RA4 A;  4GN5 A;  2RHS B;  3HOZ H;  5C4Z A;  1C4Q A;  3S1R B;  1MJE A;  1EHI A;  4G3I A;  3W1G A;  4DV4 Q;  4K2K A;  1AE3 A;  2BA0 A;  2C5C A;  3FRP B;  1IBM Q;  1N32 L;  3CRL C;  1CQJ B;  3KAK A;  2PN1 A;  2R86 A;  5C3E G;  1XPU A;  2C2R A;  3SK6 A;  1FNU A;  3K59 A;  4ZUJ A;  2F0U A;  2IHE A;  2JA7 H;  1HNZ H;  1QG7 A;  3S2H B;  4EYH B;  1G6P A;  3H4D A;  1AZQ A;  5EKL A;  3HOU H;  1JQY D;  2DJF C;  2K03 A;  3D8G A;  4JI2 H;  3PUV A;  3PZP A;  2QF7 A;  5M3M G;  4TQR A;  4IO9 A;  3HOV G;  1XNR Q;  2MHV A;  3M3Y H;  1CQV A;  1G2S A;  4HJ7 A;  2NU7 B;  4O2B F;  1ILP A;  2Z6B A;  1AUV A;  3M85 A;  2PVP A;  3B6Y A;  1BCP B;  3G71 A;  5C1O A;  2PBZ A;  4DR4 Q;  3JAM E;  4LFC L;  5M5W H;  1LTI D;  1EU3 A;  4A3E B;  3S1N B;  4MA5 A;  4LWC A;  3OWE B;  1MD2 D;  5IGG A;  1C0A A;  4PMC A;  4YAK B;  1M0W A;  3MR3 A;  2N8N A;  1JOQ A;  1M6V A;  3Q2O A;  3I4N B;  2EOT A;  2VUG A;  1FGU A;  1FJG L;  1Q90 A;  4KLK A;  3RN5 A;  1OXV A;  4JBW A;  3MHB A;  5BN5 A;  1CA6 A;  2CHB D;  2IPK D;  2EYL A;  1CKN A;  3H94 A;  5LMU Q;  5IT9 c;  3J80 E;  4EG0 A;  4ZCK A;  3NBH A;  1PFS A;  4IUV A;  3CC7 A;  4P71 A;  2W6P A;  3TQ1 A;  1VCI A;  3FHW A;  1HZB A;  1WTP A;  1E4E A;  2R92 H;  1BO0 A;  5EDW A;  4A3L G;  4QIW B;  2XCA A;  2BH2 A;  2V4R A;  1RD9 D;  3T1Y Q;  2F0G A;  4ZK9 B;  4JI3 Q;  3F2C A;  5K2M A;  2TMP A;  3AQQ A;  1HNW L;  4MV7 A;  5AJ3 L;  1SE4 A;  1HQR D;  4OIJ A;  1PH6 A;  5M5Y B;  4DV0 H;  1GOZ A;  3E0J A;  1WFQ A;  4I7Z C;  4A3M G;  2O03 A;  2NVY A;  4B3M H;  1M8A A;  2UXC Q;  1KLU D;  1VQA A;  4MNO A;  4TRD A;  1SCU B;  2UXB H;  4IRK A;  1B9N A;  2F0S A;  2OT2 A;  1S0O A;  1L1O A;  4C3H G;  2YZM A;  4I7H A;  3LML A;  2NU6 B;  4ZAI A;  2ZJT A;  1C30 A;  2MJ8 A;  2VUM G;  4NMZ A;  4KJO A;  3KBG A;  4KKT A;  4B3S Q;  2ASD A;  2WFW A;  3WDN A;  1ASZ A;  1B9M A;  5IOD A;  3GTG B;  1VQO A;  3G4S A;  2A69 C;  3BQ2 A;  2DNE A;  3I4L A;  3PR4 A;  4ED2 A;  4X3S A;  1EZ8 A;  1Z9F A;  1XDN A;  4FBU A;  1YJW A;  1SYB A;  1JCK B;  3TP6 A;  3ORR A;  1VMP A;  1PH3 A;  1N32 H;  4XYM B;  1HTP A;  4JBM A;  2KHI A;  3C3L A;  1IOV A;  4K5X A;  5EGT A;  1HR0 W;  4OX9 L;  4BBS B;  3GO5 A;  4A3D H;  3TP7 A;  4DK0 A;  4NDX A;  1LYL A;  5KFJ A;  1BNC A;  2L15 A;  5C0X I;  1Q12 A;  1SE2 A;  1HNZ Q;  2BH8 A;  4UCO A;  1I50 B;  3MXP A;  1YHB A;  2A6H D;  4JI2 Q;  2VXW A;  4X62 H;  2NUC A;  1D5X C;  1EWC A;  2MNA A;  4TQS A;  2YS6 A;  1JT8 A;  4RCN A;  1NY4 A;  2VQF H;  1A62 A;  1VQE A;  2EVB A;  1EYZ A;  2IX3 A;  5DM6 3;  4EFE A;  4DAY A;  4LFC H;  2JA6 B;  1DYQ A;  2NVX B;  3K5I A;  1QOH A;  4BY7 H;  1QIL A;  4JYA Q;  5L1K A;  5KT2 A;  3PO2 G;  4A93 H;  1WTQ A;  1PTO B;  4PZ7 A;  4GZY C;  2R7Z A;  1C3O A;  2RSN A;  2UUC L;  3H0G G;  1O7Z A;  2JA8 H;  1RYS A;  1X3Q A;  5KFF A;  3WOE A;  1IYV A;  1Q7Y C;  1A0I A;  1J5E Q;  1C48 A;  4GLX A;  5IT9 W;  4RB3 C;  3TME A;  3EQL C;  5IT9 L;  2JA9 A;  3L4J A;  2HGS A;  3SE7 A;  3MWE A;  1SEI A;  3PMF A;  2O5J C;  2DPJ A;  1UAP A;  4LF9 L;  4ZKB B;  1NBW A;  2AHO B;  2F4V H;  3ORQ A;  4BA2 I;  3GTL A;  5KG2 A;  1TXY A;  3E3X A;  1XJV A;  3K7A B;  4B3R Q;  4A3K H;  5LL6 S;  4LW1 A;  2FHT A;  2V59 A;  1DOM A;  1CKO A;  2WV6 D;  2JQO A;  1VKZ A;  4EQO A;  4ETS A;  4IFD H;  5E3F A;  2WKC A;  4DUY H;  2MCT A;  1YHA A;  2RDG A;  2L4N A;  3OOC A;  3GQB A;  4DV0 Q;  4MV1 A;  3HKS A;  1NSN S;  3HP3 A;  1ESR A;  3OHX C;  5KG7 A;  4R4O A;  2F0N A;  2PQE A;  1CI3 M;  2E75 C;  3QG1 A;  2Q8I B;  2UXB Q;  3O13 A;  2ICE C;  2W57 A;  1IW7 C;  4FDB A;  2AWN A;  3KUP A;  4IAJ A;  2QEJ C;  4POF A;  1C7Y A;  3MZ5 A;  4A3J H;  5JQW A;  2XCL A;  5BR8 Q;  5FPR A;  1Y1W G;  4AQY L;  4DGZ A;  2KCN A;  1JLL B;  4C5B A;  3U9O A;  4QWB A;  4LF6 L;  1J8I A;  1X56 A;  1N32 Q;  2FIN B;  4H44 C;  4LJZ C;  2EXZ A;  2A68 D;  3CP0 A;  3HOZ B;  3SI8 A;  2FXQ A;  4JI8 Q;  1HR0 H;  2OXP A;  1RJP A;  2R8H A;  3HKZ A;  1GKH A;  2ZTE A;  3FDT A;  2LFN A;  1H9K A;  2ZXO A;  1K9M C;  3WOF A;  4AYB E;  2EY1 A;  4DNT B;  1BNZ A;  4X62 Q;  3HXL A;  4IR9 A;  1S10 A;  3ITP A;  2JA7 B;  4DR6 H;  3KYH C;  2IT1 A;  2VQF Q;  3HOU B;  3BVZ A;  1RL2 A;  5G3L F;  4C2M H;  4A3F H;  4LFC Q;  1VQ4 A;  5IP9 H;  3NXW A;  2F0W A;  5M3M B;  1N33 Q;  1SNQ A;  3PVX A;  4LFA L;  2R87 A;  1MHW C;  4LF4 L;  3M3Y B;  3MJF A;  1QVF A;  1QE6 A;  2L9H A;  4DK1 A;  2NU8 B;  1V51 A;  2AQ3 B;  4PZ8 A;  4HJ9 A;  1SNC A;  2GVA A;  2OEO A;  4CKC A;  1TWG A;  3KF6 B;  1PMR A;  3RGX A;  2HIX A;  1KQS A;  2XC9 A;  1SYE A;  1KAA A;  3OUU A;  4BXX H;  1F9R A;  4HJ8 A;  2HQL A;  2K52 A;  3IRB A;  4DV7 H;  3PW2 A;  2OLS A;  2XVS A;  4O3S A;  4JI1 L;  2XIG A;  4QW8 A;  3SVM A;  3AFQ A;  4UCV A;  1LTT D;  2UXD L;  2DY8 A;  4L8J A;  4KN7 C;  4N9T A;  1XPO A;  2F3W A;  4LF9 H;  1KRT A;  1Q82 C;  2R7F A;  3ETJ A;  2F4V Q;  4TKO B;  2RDJ A;  4KTA A;  1RDP D;  3DWA A;  4HED A;  4YR3 A;  4YQW A;  5JJI A;  5HGQ A;  2PMZ A;  4FS1 A;  3T5L A;  5EBD A;  4MV8 A;  3DLL A;  5AJ3 Q;  2ZJQ A;  4DUY Q;  2V4D A;  1ZHQ A;  4LFB L;  2VL6 A;  3S15 H;  3RZD B;  1X65 A;  2R92 B;  3D4W A;  4ALP A;  3SK8 A;  4JW0 A;  3HOY H;  4OON A;  5KT5 A;  3KF8 B;  5KFP A;  2RDI A;  5A2Q W;  2E2H B;  5KFR A;  1HHV A;  1CHQ D;  5A2Q L;  3K0Y A;  1V1P A;  2IHF A;  4JI0 L;  1KBL A;  1GXD C;  3F2U A;  2YRX A;  4A3M B;  1VF7 A;  4KJN A;  5IYD G;  5C44 H;  3CCR A;  4KMU C;  1RKN A;  3OHB A;  2W9C B;  1DGS A;  4JI5 L;  3W5O A;  2PI2 E;  2B63 G;  2K5V A;  4IZ8 A;  2CW0 D;  2R7M A;  3A5Z B;  1BF4 A;  1PH4 A;  2F0T A;  3KOJ A;  4LMQ D;  5KIX A;  1Y1V G;  1EY9 A;  2KHS A;  1Y8O B;  1HR0 Q;  3KAL A;  4O1N A;  4V19 0;  4A3C G;  3Q8R B;  1EY4 A;  3QZ8 A;  1K3B C;  3H40 A;  3RAQ A;  4QMG A;  1YIT A;  4TUY F;  1FYC A;  3TN2 A;  4K0K L;  3GV8 B;  4KKS A;  1TY0 A;  4X3K A;  4ED1 A;  1FD7 D;  2B29 A;  4J6H A;  1NCV A;  1XMQ Q;  4XTC S;  2KCM A;  4DR6 Q;  1SRO A;  4LH6 A;  4P73 A;  1QVG A;  1JJG A;  5FKA C;  4JI4 Q;  4DN4 M;  3GIJ A;  2F0M A;  3PO3 H;  2ES2 A;  5IT9 E;  1HXY D;  3R23 A;  1RHP A;  4O3P A;  1AUX A;  1A3V A;  3RV3 A;  2JA5 A;  2KSW A;  1S4Z A;  3H15 A;  4LF4 H;  3IFD A;  3PQI A;  3SHL A;  1B4O A;  3DXJ C;  3N40 P;  2QGQ A;  4HCS A;  1GUS A;  5KGU A;  1OTC A;  2UU9 L;  2QK4 A;  1PHJ A;  1BXR A;  3K8A A;  1QZG A;  4K8J A;  1F2Y A;  2SNM A;  1CQF A;  2YTY A;  3GP7 A;  3ZYY X;  5EQ0 A;  4O2D A;  1N8R C;  1NE3 A;  4BY7 B;  2GVB A;  2R7L A;  2K05 A;  3P7J A;  1PRT C;  4A93 B;  5C0X H;  5C4J H;  4DV7 Q;  1QVC A;  4AYB B;  3J7A F;  4A3B H;  3DHQ A;  4JI1 H;  3G6E A;  1SNP A;  4DL6 A;  3KBX A;  5FLM H;  3PIP A;  2JA8 B;  4PWQ A;  2AGO A;  5COY A;  1JOK A;  5KX5 F;  5DGA A;  1EIG A;  2PPB C;  2HCI A;  2O2L D;  4QW9 A;  4C3J H;  1GUT A;  4L5S A;  3OPO A;  2LXK A;  2JEG A;  4TV9 F;  1WOC A;  3W2D A;  4DV4 L;  5L1J A;  1VQH A;  4ZUI A;  2CQY A;  5KFZ A;  2YTX A;  4DK6 C;  1IBM L;  4CDF C;  2KED A;  3HRZ C;  3SK4 A;  4WJ4 A;  2ZT9 C;  1K1Q A;  4LSA A;  3RLF A;  5FD5 A;  2J6U A;  1TS2 A;  4UP9 A;  1PH8 A;  1E24 A;  3OHA A;  4RHS A;  3GTJ A;  2JN4 A;  5EZY F;  4JI0 H;  1EY0 A;  5T14 A;  2ZDH A;  2ZJP A;  1LM0 A;  1SMY C;  1X55 A;  3TZU A;  4A3E G;  5D14 A;  4DXF A;  1XPR A;  2R7Z H;  1KXL A;  1B2T A;  1XNR L;  3KHG A;  2KCT A;  3STB D;  4K2L A;  2NN6 I;  3BJY A;  1JJC B;  3I4N G;  4FF2 A;  4C5A A;  4DR4 L;  4IRD A;  2W9B A;  1K83 A;  1JDE A;  2F0I A;  2YYA A;  1QNU A;  4BWG B;  3VMM A;  2R93 H;  2Z6K C;  2NUA B;  4EBD A;  3JSL A;  3UDI A;  5ISR A;  5FJ8 G;  2K01 A;  3FMA A;  2WE6 A;  1PH5 A;  3T53 B;  2AWO A;  3GTL H;  4M9U A;  1V1Q A;  4R4I A;  2D9U A;  5KNC A;  2F1M A;  4HR7 A;  5DNF A;  4HTH A;  1OO9 B;  5D3D A;  4UHV A;  4S3S A;  2G5D A;  3KXY T;  2WAQ A;  3NSW A;  3VPD A;  4C1N K;  4RZR A;  4DR1 H;  5LMU L;  4FS2 A;  3NTI A;  1T3N A;  1STE A;  2IY5 B;  1PK8 A;  1Z2O X;  3M9M B;  2VUM A;  4GNX C;  1UNN C;  2CH4 A;  2K33 A;  2ALY B;  4EX5 A;  1LT3 D;  2RCF A;  3CVZ A;  4Q45 A;  1ENA A;  3NWS A;  1BOS A;  1EQQ A;  2WB1 E;  3NUC A;  1SBB B;  2K04 A;  4RNO A;  1NAP A;  3PF5 A;  4DA2 A;  2D2C C;  3DM3 A;  1WCM H;  4UCS A;  4C2M B;  2LY7 A;  4J9M A;  5I6Y A;  3J7A V;  3HG9 A;  3TQT A;  2QKI C;  4DV5 Q;  2H5X A;  2UXC L;  2FK1 A;  2EXD A;  4MTK A;  1U4R A;  3K5N A;  4JI1 Q;  3MWM A;  5E7N A;  2W8K A;  3U4Z A;  2YYZ A;  5IGF A;  3H20 A;  4LF7 L;  3MEF A;  4FNF A;  4B3S L;  1PFN A;  5A2Q E;  1LTR D;  4ECU A;  5FO7 B;  2YL2 A;  2NZH A;  4IPD A;  2CCZ A;  1W96 A;  2ATL A;  2F0D A;  4LUV A;  4BBS G;  5JH7 F;  4DV4 H;  4U67 3;  4K8I A;  3I72 A;  1SE3 A;  2YZN A;  5EPJ A;  3CXC A;  2PQA A;  4JBJ A;  5BPF A;  2R7N A;  1WTV A;  3D6C A;  1QZH A;  1O80 A;  2R61 A;  1SFO A;  2YCH A;  1Y69 U;  4IPH A;  5JJL A;  2ICI A;  1GSO A;  1HNZ L;  3K5H A;  3NEL A;  3QB3 A;  5COR A;  4L5R C;  1RJR A;  4JI2 L;  2JA6 G;  4RZQ A;  3GTO A;  3SR1 A;  3HOY B;  1WTR A;  1IKM A;  4KY7 A;  3VA5 A;  2FKL A;  1VMC A;  1KTK A;  1S72 A;  1TWG H;  4CJ2 C;  2W7O A;  3QOJ A;  1CTM A;  5KFU A;  5C44 B;  4JYA L;  3CKI B;  4GC7 A;  3MR2 A;  1IZ6 A;  4K6L A;  2W6O A;  2DLN A;  2E5L Q;  5BPH A;  3M4Q A;  2K75 A;  2I5L X;  5IYB H;  2B63 B;  1VQB A;  3C0F B;  3GID A;  5D65 A;  4IZO A;  3KFU A;  4HID A;  3H3V I;  2J7Z A;  4ECQ A;  5CA1 F;  1J5E L;  1CKN B;  1SXT A;  5CV7 A;  3CQZ A;  1E1T A;  1J6Q A;  2B2W C;  3P75 A;  4OEM B;  1LTS D;  1TWH B;  1PYS B;  4Q5V A;  4HIK A;  5CAE B;  1STH A;  1MSG A;  2MUY A;  4DR1 Q;  3NBH B;  5L1L A;  1AN8 A;  3QOL A;  4OL7 A;  2Q2T A;  2CVR A;  1YIJ A;  4CJ0 B;  2I46 A;  3E9I A;  1LV9 A;  3ICE A;  3HBL A;  3R93 A;  3CCM A;  5K36 G;  1TS4 A;  5T1G A;  2RGR A;  4R7R A;  4B3R L;  2B2V C;  3BYY B;  1Y1W A;  3TIG A;  1Q8I A;  3RTX A;  2UUB H;  4DKA C;  3MXU A;  1E22 A;  2HDL A;  1RF2 D;  4FO2 A;  4RAU C;  4FXK C;  3CF5 A;  2QW7 A;  4H0L C;  3PO3 B;  1C9O A;  1X6O A;  2AQ2 B;  4DV0 L;  1CSP A;  5ELD A;  5DAU A;  1U4P A;  2QDB A;  1L1O B;  4UAI A;  2UXC H;  1V8Q A;  1WD0 A;  4PQX A;  2V5A A;  1EUD B;  2EJG C;  4YY3 L;  5C5L A;  2UXB L;  1B3A A;  4BBR H;  3Q22 A;  1TQO A;  5IYC H;  2KA7 A;  5KFG A;  1HRJ A;  5T1I A;  4XT1 B;  3VYS A;  1K28 A;  3R8B A;  2F0L A;  1PRT B;  1RK5 A;  4LF7 H;  1SSO A;  1X3E A;  3NK9 A;  1JR0 D;  2IJ0 A;  2NYZ D;  4FYD A;  3S1Q H;  1B04 A;  4EBC A;  4B3S H;  2B39 A;  5C4J B;  2CFM A;  1RYR A;  3V96 A;  4A3B B;  2PNR C;  5BR8 L;  3HOZ G;  3N42 B;  3AB9 A;  3ULL A;  2C00 A;  1Z47 A;  4I7A A;  2YW2 A;  4LAA A;  4O4H F;  3BJU A;  2ZM6 Q;  3GIP A;  1YZ6 A;  1TU2 B;  2LXJ A;  2YZG A;  2JK8 A;  1B1Z A;  2WB1 B;  1HQM C;  4WJ3 M;  1VQJ A;  3CCS A;  1H95 A;  5LOV F;  3RN2 A;  2EDG A;  3KLW A;  2RSO A;  4C3J B;  3F1Z A;  2KJX A;  1VQ9 A;  2IP4 A;  3W3A A;  3Q8D A;  5CR3 A;  4JI8 L;  4HNV A;  1GHK A;  3R2I A;  5KFQ A;  4RAY A;  2JA7 G;  1XNQ L;  4FU0 A;  4TV8 F;  4QWC A;  1NUC A;  4MTD A;  1I4G A;  3OYY A;  4DLK A;  1R9T A;  2X6L A;  2JA5 H;  3HOU G;  2B2T C;  5KFS A;  3BA8 A;  2EYJ A;  1G8Z D;  3N52 A;  3MAQ A;  4HNT A;  1Y8P B;  1KDA A;  1TII D;  1B6R A;  1JXL A;  1B6S A;  2EYM A;  4X62 L;  5C8Y F;  2A74 C;  2NVT H;  1BCP D;  5DLG A;  1V1O A;  5I4D A;  4ZQI A;  2VQF L;  1QB5 D;  2Y0S A;  4GOP A;  2KHJ A;  4MV4 A;  3OMC A;  1SJH D;  2R7Z B;  1EUJ A;  3AYH B;  1HTL D;  1N33 L;  5JOB A;  3F8N A;  4F88 A;  4JYA H;  2UVW A;  2FJ2 A;  4RB0 A;  5F2D A;  1O75 A;  1W2B A;  3S2D H;  1WTW A;  4RFB A;  5D1O A;  5IGE A;  1JE5 A;  2R7K A;  3FPU B;  1EEI D;  2XWJ B;  4OXP A;  2JEF A;  2JEA I;  3P1H A;  2WIN B;  4A4I A;  2IL8 A;  1VQF A;  3MTS A;  3AMU A;  1ZQ7 A;  5CGK A;  4IFD J;  1KRS A;  2ZDG A;  3RJ0 A;  2R93 B;  1OXS C;  3MFH A;  2C9O A;  1J5E H;  4PZ6 A;  1Z2P X;  3BDC A;  1R4P B;  5DQG A;  3QFF A;  4JV5 H;  3QIA A;  5CA0 F;  2A6E C;  2A1A A;  3GTL B;  4UCU A;  1SYG A;  1X32 A;  1XTD A;  1PXU A;  5KYL A;  4OGQ C;  4YP3 A;  3M7G A;  3BAB A;  1UC8 A;  2KEC A;  2EQS A;  2NN6 H;  2F4V L;  2R92 G;  3T51 B;  4NXM Q;  4B3R H;  1DON A;  5JEA H;  1LO5 D;  3BZK A;  5JPM C;  2C2E A;  3GTJ H;  1Q1E A;  4R8U A;  3BU2 A;  3OWF A;  2UUB Q;  4EEQ A;  1PYB A;  2R8G A;  1KC7 A;  4GNX B;  1HFG A;  5L37 A;  2FE3 A;  4C5C A;  3Q6S A;  4DUY L;  3EIV A;  3GTM A;  2DJG C;  1KJ9 A;  5JUM A;  3GTK A;  1LTL A;  1Y1V A;  2XRQ D;  1ULZ A;  2SCU B;  4IAL A;  1EY5 A;  4YY3 H;  1PLF A;  1N36 Q;  1WCM B;  1U4M A;  4ILW A;  2YTV A;  2P0A A;  1K83 H;  4O0A A;  4IN3 A;  4LF7 Q;  4IUP A;  5TSS A;  2I5H A;  4KN4 C;  4RNN A;  5BR8 H;  4C3I H;  1SR3 A;  1WSC A;  3A8J E;  4AIM A;  1RK6 A;  1B70 B;  3TII A;  1EYG A;  5KT6 A;  1YNN C;  2ALZ A;  1OWT A;  5G3L D;  4RH6 A;  1P16 A;  3GDE A;  3SE0 A;  4E4T A;  1GUN A;  1ML0 D;  5KFM A;  5GAG C;  1OXT A;  1LTG D;  3GV6 A;  1VS0 A;  4B9X A;  1HZ9 A;  1YI2 A;  4JI8 H;  2HT1 A;  3DEP A;  4A3D G;  3KHL A;  1HR0 L;  2N3S A;  2IW3 A;  5E4X A;  4JBK A;  1XNQ H;  5I47 A;  4R1J A;  1G6Z A;  2L5T A;  4NPS A;  4I65 A;  2FJZ A;  1PRT F;  5KFC A;  2E2J H;  3R5F A;  1JMC A;  3FMC A;  3G6X A;  2WII B;  4LUO A;  4EGQ A;  3RLN A;  4MTN A;  4YIJ A;  1XMQ L;  1I4Q A;  1KC8 C;  1KJ8 A;  1M1K C;  5LL6 b;  3DWQ A;  4DR6 L;  4FVM A;  1TAE A;  2Q2U A;  2BOS A;  4XYL B;  4JI4 L;  2A19 A;  3IL8 A;  4KHP Q;  4Q0F A;  3N8D A;  3R5H A;  5KG1 A;  2J9G A;  3U58 A;  2PW7 A;  1PTO D;  4BY7 G;  4F4X A;  1N33 H;  4I50 F;  2B2Y C;  4A93 G;  4RNM A;  3IN5 A;  4F4Y A;  1JJ2 A;  2BA1 A;  1ZYR D;  4HCE A;  4EFB A;  4AYB G;  4LF5 H;  2XGT A;  2JA8 G;  1TT2 A;  1HH2 P;  1JWU D;  3F2D A;  1VBH A;  2JEB I;  4YHH Q;  3ULP A;  4LH7 A;  5ELO A;  4DK3 C;  1QNK A;  2AUK A;  3JSN A;  4X64 H;  2NWG A;  4DV7 L;  1I6H H;  5IIF A;  5I9P A;  1VQK A;  4JV5 Q;  4JPB W;  1KD1 C;  2KVM A;  1CQI B;  3S24 A;  3G7L A;  3FKI A;  1BCP F;  1SFO H;  3U4V A;  3S17 H;  2YU9 H;  2RVL A;  3VYU A;  5DLF A;  1SYF A;  3MXG A;  4ZI7 F;  5KT4 A;  3M7N A;  4L1K A;  4A3K G;  4B3T H;  3LX0 A;  4QWE A;  3G6Y A;  2VNU D;  4IFD G;  1VQ8 A;  4A2B A;  3E5N A;  2XGQ A;  2NZO A;  3A54 A;  3GD7 A;  4J9L A;  4QJF A;  2FMA A;  1FL0 A;  4LF8 Q;  1CUK A;  2G9D A;  3N6R A;  4RB2 C;  5GAE C;  3H3V H;  1DV1 A;  4CDE C;  1EZ1 A;  2I5M X;  4YY3 Q;  3RLO A;  2RDF A;  3MXN B;  1JB7 A;  2WAQ E;  4N8F A;  2K50 A;  5CC4 A;  3BA9 A;  1W3S A;  5J3B A;  3Q8P B;  1ZXT A;  5E1F A;  1TWC A;  2DNC A;  5IY0 A;  3I2Z A;  3DEO A;  1YJ9 A;  3WWV A;  4A3J G;  3VPB A;  4QIW A;  1JWM D;  1EIY B;  4XXE A;  4WFN 3;  5KFW A;  3DMU A;  4DL7 A;  3LWU A;  2HQE A;  3S1Q B;  4QF4 A;  3K81 C;  3NP8 A;  1EFI D;  4RU9 A;  3OTO Q;  1SYD A;  1MGS A;  1F2Z A;  5E4W C;  2E2D C;  1T5X D;  2MGS A;  1E2V A;  1E3P A;  3RR5 A;  1EWI A;  4DAM A;  3D3R A;  1XNQ Q;  1S5B D;  4XZ3 B;  1NJI C;  1AZP A;  1FNV A;  4RGT A;  1JWS D;  5EPL A;  1AP0 A;  5FLX c;  4EVO A;  1Y1W H;  2SEB D;  1RTN A;  2BCO A;  2Q2I A;  1S5E D;  3PF4 A;  3GTG A;  3FEW X;  4HIM A;  3TS2 A;  3KLS X;  1XMQ H;  3J7A K;  5GQO A;  2XIW A;  1KDC A;  5C0X J;  3WO1 A;  1GYF A;  4O3O A;  2BE5 C;  4JI4 H;  5D1P A;  1T94 A;  3A7L A;  1W6K A;  5I6W A;  1UEA B;  4A3F G;  3RMH A;  4XX0 B;  5IP9 G;  3DWP A;  4DV6 H;  2F0V A;  5ELB A;  3PUX A;  2MO0 A;  1Q3L A;  3K57 A;  1QUQ B;  3HFZ B;  4KY6 A;  5J22 A;  2NVT B;  2CWP A;  5IGC A;  4LNQ A;  4LF5 Q;  5KFK A;  2JXM B;  3N6X A;  3GV5 B;  4DL4 A;  1JB3 A;  1BDO A;  5M5W B;  2A5H A;  3R2T A;  2H4O A;  4BXX G;  5J1Z A;  4IUR A;  4DV5 L;  3UE1 A;  3MR6 A;  1H9S B;  1CSQ A;  2E2I A;  2Z1C A;  4X64 Q;  1A2T A;  3CCL A;  1KAW A;  3LWB A;  1HCZ A;  4CKE A;  1IBL H;  1BVS A;  3BG3 A;  1D2B A;  1DM0 B;  1WTH A;  4IUT A;  4ME5 A;  2VW9 A;  3I12 A;  1DV2 A;  1CS0 A;  2JA6 A;  4EQN A;  5C3W A;  4DV2 L;  1H9J A;  2NVX A;  1DZ1 A;  4H02 A;  3PW0 A;  3G48 A;  4OO1 I;  4UY8 C;  3KDF B;  4B3T Q;  2M05 A;  1H9M A;  1N48 A;  1PTO F;  2B8F A;  1IBK L;  4POG A;  2PYK A;  2HIV A;  3NEM A;  1OXU A;  4EGJ A;  2J4X A;  3MFY A;  2XRS D;  5ELN A;  2Q8T A;  4NKL A;  2G9H D;  3HOY G;  1DCZ A;  2NU9 B;  1I5F A;  4DV3 Q;  1A2U A;  4RCO A;  1SAP A;  2KEN A;  5CBE E;  2IBK A;  1Q81 C;  5NUC A;  1NR2 A;  1BUV T;  1X3F A;  3K3V A;  5KFT A;  1EIH A;  5IGB A;  2D0P A;  1FGB D;  4IUU A;  2PZW A;  1SYX B;  5C44 G;  2M2L A;  3EBE A;  4A3G H;  4F87 A;  3RB3 A;  4ULL A;  1GSA A;  1T5E A;  3ND8 A;  3DM1 A;  4JOI A;  2NVQ H;  4OEL B;  1K83 B;  4UP8 A;  2CQA A;  2A69 D;  3T5J A;  2NB0 A;  1KNA A;  1E4G T;  1DJR D;  1YNJ C;  4C3I B;  5LMN Q;  1AFP A;  4HQ6 A;  1SYC A;  4Q43 A;  1HNX Q;  2HD3 A;  2E5L L;  1EY7 A;  4DAP A;  3QR8 A;  5FLX W;  3J81 i;  5FLX L;  3MR5 A;  2DZD A;  1U4L A;  3KTM A;  2WAQ B;  1O78 A;  4UCT A;  1LAB A;  3TSS A;  4JI7 H;  3JRW A;  1IL2 A;  2RGV A;  2O4X A;  2JEJ A;  4A3I H;  4NW2 A;  3RGZ A;  5HGT A;  4A3D B;  1UNS A;  5C3X A;  3UI2 A;  4ECT A;  4O3Q A;  2VY3 A;  4DR1 L;  1D5M C;  3M4O H;  3EA6 A;  2K1B A;  1VQ5 A;  3PO3 G;  3GV7 B;  3SDZ A;  2E2J B;  3PGZ A;  1JOR A;  2NVY H;  3T56 B;  4DV6 Q;  3OIP A;  3J81 c;  1X9N A;  1VQL A;  3UDX A;  3OW7 A;  1QCB D;  1L1O C;  2V1C C;  4JC0 A;  3I4M H;  4ED3 A;  3UE0 A;  1G91 A;  1I94 Q;  5JVH 3;  1EQV A;  2H1E A;  3A56 A;  4DL3 A;  3HOW H;  2L0C A;  4YCV A;  1E2Z A;  3FP9 A;  5M3F H;  5C0X G;  4DV5 H;  3MC0 B;  4KHZ A;  3RFC A;  1S9F A;  1DXM A;  4U7C A;  2AGQ A;  4DNR B;  1N34 H;  4A3B G;  3HS0 C;  1JX4 A;  1M90 C;  2AKW B;  3BVG A;  3BZD B;  4N8X 1;  1HA6 A;  3NEN A;  5FLM G;  5DQH A;  1XMO H;  2JA7 A;  1IBL Q;  1KJJ A;  3ERO A;  4IUN A;  4Z9C B;  2WB1 G;  4ED6 A;  4DV2 H;  4DR2 H;  1QJO A;  3RUP A;  2Y0S E;  3MEH A;  3PIO 3;  5JAV A;  2F0O A;  3NWT A;  3ULJ A;  4C3J G;  1I7N A;  4TQU S;  1XWE A;  5FO8 B;  1I6H B;  3H91 A;  2PQA B;  2FMC A;  3SK5 A;  1IBK H;  2F0E A;  2ZM6 L;  4O4I F;  4J15 A;  2RF4 A;  4P72 A;  4YCW A;  2K5D A;  5IGD A;  5JJZ A;  3J7Z C;  1PV4 A;  2YU9 B;  3S17 B;  3KF6 A;  4GN3 B;  2OQK A;  1NNX A;  2NZ1 D;  2JSO A;  4CGY B;  4A3K B;  1TY2 A;  4BY1 H;  5FPO A;  5GRO A;  4C56 C;  3BAA A;  4IHJ F;  3OMG A;  2M00 A;  4J9N A;  4DR3 Q;  5CV5 A;  3CD6 A;  1CKM A;  2FFK B;  3EJI A;  5I2X A;  5JJK A;  3JC6 6;  1ZKO A;  1PZJ D;  4XIG S;  1ICW A;  5DG9 A;  1X3G A;  4L5T A;  5F9N A;  2VPQ A;  4YR2 A;  5KFD A;  4HSP A;  5EOY A;  2R7Z G;  4DV1 H;  1VF5 C;  1IW7 D;  3RV4 A;  1KNE A;  4R4T A;  3U9S A;  2EYF A;  2PNH A;  2OQ0 A;  5KND A;  2I87 A;  4LMY A;  3CCV A;  1A6X A;  4A2A A;  2R92 A;  4JV1 A;  4A3J B;  5IWA H;  1B3Q A;  1PFB A;  2R93 G;  1VAJ A;  4ABN A;  4JVZ A;  3RAX A;  1ENC A;  3KF8 A;  4ED0 A;  1W6J A;  2E5L H;  1HA5 A;  2E2H A;  1MZB A;  3FKI H;  2EYO A;  4HYK A;  2ZTD A;  5DEH A;  3S1N H;  4PNY A;  5KFB A;  1S03 G;  2XGP A;  2LSS A;  1CA5 A;  3D0F A;  3TDQ A;  4JI7 Q;  3SEB A;  1Z6H A;  4P74 A;  4CDD C;  2ASL A;  5GAH C;  2W9C A;  2RQX A;  1VQG A;  2KCC A;  4BA1 I;  5KNB A;  3CHB D;  3D6W A;  2BQ3 A;  3CCE A;  1WI5 A;  3J81 W;  2R84 A;  2WTF A;  1D5Z C;  3SXH A;  4MHE A;  4NXM L;  1NMG A;  1I4P A;  2DGY A;  4JV0 A;  4ME6 A;  3BDO A;  4IPC A;  2UUB L;  4RGN A;  4OWW B;  2HUG A;  1TWC H;  1WCM G;  5KFE A;  1MI2 A;  4A3F B;  1NTG A;  3K5L A;  2CW8 A;  4HNU A;  4LK1 C;  2FMM A;  1EQT A;  5DQI A;  1K0R A;  1N34 Q;  4AH6 A;  4GN4 B;  1N36 L;  1XMO Q;  1U0L A;  1SN8 A;  1EYC A;  3ETH A;  4J9K A;  3PW4 A;  3RNU A;  4X6A H;  2W6M A;  1WH2 A;  1CHP D;  4ZHQ F;  1EY6 A;  3HOX H;  4IWY A;  4DV2 Q;  4DR2 Q;  5D8D A;  4H13 C;  5EPK A;  1B44 D;  2EJF C;  4KD4 A;  3FVQ A;  3D4R A;  2W6Q A;  5FD6 A;  3K3P A;  1S5D D;  1P8L A;  1IBK Q;  3EYY A;  2ZM6 H;  2FK2 A;  2K5N A;  1UE1 A;  1RTO A;  3GIM A;  4X65 H;  1TS5 A;  1A3U A;  5ELE A;  1SJE D;  3ERQ A;  3TIN A;  3RB6 A;  4DPG A;  4J9R A;  1WJJ A;  5AFW A;  1L2Z A;  1IYJ B;  1CM9 A;  3N43 B;  4AYB A;  1SRU A;  1Q46 A;  3H0G A;  3BQ0 A;  4GLV B;  3T13 A;  4J9O A;  3S15 B;  4J9Q A;  2FLN A;  3Q24 A;  1S97 A;  2XD4 A;  3NQI A;  4PV1 C;  1D6E C;  4JCV E;  4ZKC B;  5L9X A;  4LUZ A;  5FLX E;  4DV1 Q;  3GTQ A;  4G7O C;  3R5X A;  3CCJ A;  2Y0S B;  5KG3 A;  5IP7 H;  1FNW A;  1FR3 A;  1I3Q A;  3I55 A;  1B53 A;  1S0N A;  1VQI A;  1IXR A;  4OO1 H;  2OTJ A;  1MBY A;  3ONA B;  4KHP L;  3I70 A;  2E2I H;  2YV5 A;  4A3G B;  4QUF A;  2A6H C;  5IWA Q;  2QCP X;  2V4Q A;  5C4X H;  4JI6 Q;  4MZ9 A;  3RBD A;  5CV4 A;  3URY A;  2R82 A;  4I4T F;  4M8A A;  1G51 A;  5IYB G;  4DL5 A;  4IJH A;  5JEA J;  2JA6 H;  2FB9 A;  2LKV A;  4F50 A;  3OSP A;  3JRX A;  1A63 A;  4NXN H;  3M9B A;  4YHH L;  3K0X A;  1F9S A;  5LHY 1;  1ICF B;  3I56 A;  3A55 A;  3V6J A;  1RJT A;  2F4I A;  4QQB X;  3TQY A;  4FXD A;  2N78 A;  4JV5 L;  4O4L F;  3M4I A;  2UVU A;  3T1H Q;  1E4E B;  2MP1 A;  2UUA H;  1PVO A;  1D1K A;  5I2Y A;  3F2B A;  1PZI D;  1IKL A;  2L12 A;  1LTB D;  4MN3 A;  3VYR A;  4YR0 A;  1VQ7 A;  4A3I B;  4DR7 Q;  1STN A;  2F0H A;  4NXM H;  2N88 A;  1I4H A;  3AFP A;  1GVP A;  2GN5 A;  2NTS A;  3R3O A;  3RD4 A;  5FOB B;  1ZEQ X;  3CRK C;  2FK3 A;  2R3Z A;  2NVY B;  3HKZ E;  3E6Z X;  1S3O A;  3WO0 A;  4Q44 A;  2F03 A;  1LT4 D;  3BZC A;  5KFV A;  4LF8 L;  2KBN A;  3I8Z A;  4X66 H;  1GM5 A;  3I4M B;  1LT5 D;  2AGP A;  3OUZ A;  5C5J A;  3TBI B;  4BBR G;  1YJN A;  1N36 H;  5IYC G;  2JP1 A;  4CJ1 B;  4J9P A;  1PRT D;  1B7Y B;  2K4K A;  4HMI A;  1KEE A;  3HOW B;  3HGB A;  1XYI A;  5M3F B;  1LTA D;  1ESF A;  2PI2 A;  1G2T A;  4XT3 B;  1TVX A;  3IG0 A;  1YVC A;  1EIF A;  3RF2 A;  3FPP A;  1A8V A;  4C1N I;  1HZC A;  3MWY W;  4HIO A;  4YAJ B;  4GKK H;  1LLR D;  4C2M A;  4ECX A;  2PO4 A;  4X65 Q;  5I9O A;  5LA6 F;  3OTO L;  2W8L A;  2F0J A;  5KT3 A;  1E4F T;  5KG4 A;  3MFG A;  1KHI A;  2B2U A;  5EWF A;  3GIL A;  2CH4 W;  3GTP A;  2JA5 G;  5M9O A;  4GKJ L;  1EQR A;  2EY5 A;  4BY1 B;  1SLJ A;  2A68 C;  1SMY D;  4FP5 D;  1VQN A;  2ASJ A;  4DAY B;  5KFY A;  3KLR A;  2FLL A;  2YS7 A;  1M7J A;  2PMZ E;  5EBC A;  1X54 A;  3E0E A;  5KFA A;  4KHP H;  4O42 A;  5DG8 A;  2VA3 A;  2AQ4 A;  4F8M A;  3PV0 A;  5C3E H;  3CCU A;  4WD3 A;  1FKA H;  2EPB A;  4APV A;  4UDU C;  5ELC A;  3J81 E;  4LF5 L;  2UVR A;  2K32 A;  4KK7 A;  4QCL A;  4Y52 H;  3NHH A;  1EZ6 A;  3PUY A;  4RWS C;  2VQD A;  5M3M H;  3GIQ A;  1UUP A;  3HOV H;  2W7P A;  4NXN Q;  1WTX A;  4RA8 A;  1TKW B;  1KDB A;  2ENB A;  2HVQ A;  4YHH H;  1JIC A;  3X3N A;  3UDG A;  3H09 A;  4ZRZ A;  4X64 L;  3FKI B;  2L1B A;  2UUA Q;  3PW7 A;  3P20 A;  1AH9 A;  1EL0 A;  2EY2 A;  2NN6 G;  2JEI A;  3C1E A;  1KAB A;  1LUZ A;  3L0O A;  1JE4 A;  4LSX A;  1D8L A;  1BJT A;  5JEA G;  4B3T L;  1O7L A;  1B8A A;  1GUW A;  5KFL A;  5KG0 A;  3LWE A;  2B63 A;  1UE5 A;  2AUJ D;  2IA6 A;  3D4D A;  2ZXP A;  5FO9 B;  4LF8 H;  2HVR A;  5CV9 A;  4X66 Q;  4DV3 L;  2IX1 A;  1TWH A;  4IWX A;  4HMJ A;  3EN2 A;  2DWC A;  4TVA B;  1TWF A;  1TWC B;  2HHH Q;  2AMC B;  1VQC A;  3RZD H;  4IRC A;  5FK9 C;  3KHR A;  4DR5 H;  2KOL A;  4WOR A;  4P2C B;  4A3L H;  5KG5 A;  4CC6 A;  3TRE A;  3G6J B;  4UFZ A;  4Q8F A;  4C3I G;  4EQ5 A;  2SNS A;  5JVG 3;  2E2H H;  1I6V C;  4ECS A;  2IMW P;  1WYD A;  5DLQ E;  2Z0S A;  3L2P A;  4ZQ3 A;  1E7Z A;  3CAM A;  4A3M H;  2MO1 A;  3HOX B;  1F9Q A;  4GKK Q;  5EWG A;  2FLP A;  1F9P A;  4RHR A;  5KFX A;  3K80 C;  1I6U A;  4DUZ H;  5L1I A;  5LMN W;  2WAQ G;  4JK1 C;  4P75 A;  4R4Q A;  5C4H A;  1AN7 A;  3OTO H;  5LMN L;  1HJP A;  1I4R A;  3HKZ B;  4C3H H;  3K5M A;  2J0T D;  2I07 B;  4PMW A;  3IKJ A;  3W1B A;  3RUZ A;  1HNX L;  2W9A A;  3K6O A;  2VUM H;  1VDZ A;  2DN8 A;  1S68 A;  1TWA A;  1PFM A;  3L9A X;  1N56 A;  4GKJ H;  2CW0 C;  4K14 A;  4KD3 A;  3OW2 A;  4R4C A;  2R6G A;  1S0M A;  1VQP A;  3S1M H;  2WKD A;  1R4Q B;  1VBG A;  5JVD F;  3C1F A;  2AQ1 B;  1GO3 E;  2WB1 A;  2IX0 A;  2BDN A;  2EJM A;  4ODG A;  2QEX A;  2EZV A;  1SND A;  2RCN A;  2W70 A;  1XTC D;  4JUZ A;  3PUW A;  2CZG A;  3OSN A;  1K8G A;  2PCF B;  1E2W A;  4DV6 L;  1ENF A;  3G6V A;  3EPI A;  4ME3 A;  1BXT A;  1J9O A;  2D0O A;  2VR1 A;  1VQM A;  1JKJ B;  1TWG B;  1AW7 A;  2KUM A;  3T16 A;  1I94 L;  4Q0Y A;  4ECY A;  1I7L A;  5J2U F;  1A15 A;  1M0T A;  4N9P A;  4CC5 A;  2E2I B;  5HUR A;  4DU9 A;  1DD2 A;  5C4X B;  1KLG D;  3GII A;  4U6P A;  2OCE A;  1GUG A;  4ED8 A;  4RAZ A;  1DOK A;  5IOC A;  1IBL L;  1AE2 A;  1LT6 D;  4DAV A;  4FF1 A;  3KK7 A;  1HZA A;  1STY A;  3PO2 H;  3V4Z A;  3C2P A;  1KL9 A;  2PMZ B;  2B3G A;  1FJG H;  3H0G H;  4DNI A;  3BVM A;  3U9T A;  4L63 B;  2PZU A;  1EFW A;  2X0S A;  3H4B A;  3GTO H;  3NBI A;  5D3I B;  3OSO A;  1VQD A;  2ID0 A;  5KEE A;  1K8O A;  2Z6K A;  3GTQ H;  4XYO A;  2Q2H A;  2R93 A;  2V9W A;  3EPG A;  4DV3 H;  1I3Q H;  3S14 H;  4QWA A;  1V1P B;  2KEE A;  1EWH A;  4DR3 L;  3H3V C;  2YRW A;  3QZ7 A;  2C28 A;  1MJC A;  1C8C A;  3ND9 A;  4IUQ A;  4DXG A;  3J7A 5;  2WDT A;  2F3V A;  1L0W A;  4DR5 Q;  4MAM A;  3TRZ A;  2E76 C;  2NBF A;  1HNW H;  3OIQ A;  4A76 A;  5CB4 F;  3M4Y A;  4BBR B;  3I91 A;  2EIF A;  1YBY A;  2HDM A;  2GLT A;  4EQP A;  2W71 A;  4GNX A;  5M5X H;  2VA2 A;  1NMF A;  3T4A C;  4BS9 A;  1CT1 D;  4F7X A;  5K5P A;  1RIP A;  1V43 A;  1SMX A;  2Q8R E;  3I90 A;  1K8A C;  4B3M Q;  3GV3 A;  3L7Z C;  2I0Q A;  4KV6 A;  1KJQ A;  3CQZ H;  4DUZ Q;  3GLK A;  1CZG A;  4J0M A;  5LMN H;  3BQ1 A;  1K73 C;  1M4V A;  4EEY A;  1HNX H;  4YCU A;  3PW5 A;  2X6G A;  3STB C;  1WCM A;  3J7Y W;  1CE8 A;  4FXG C;  3GQC A;  3LGJ A;  5CV6 A;  4GKJ Q;  2I80 A;  2MQH A;  1E0B A;  1LAC A;  2LS0 1;  3AEV A;  4JI7 L;  1FVI A;  5H80 A;  4KHV A;  4J8Q A;  1Y8N B;  4ID6 A;  3RZO H;  3J81 j;  3CPW A;  2GPS A;  2OF1 A;  3D31 A;  1PYW D;  3V6K A;  5BMV F;  4OWT B;  4CKB A;  4GS3 A;  2JA5 B;  4RKL A;  1ZHS A;  3K58 A;  4RKB A;  3MWD A;  4OX9 H;  1CZW A;  3TS0 A;  1PH2 A;  3N41 B;  4TSS A;  1UEB A;  2E8G A;  2XSC A;  2V58 A;  2VB2 X;  5LP6 F;  3RIZ A;  2K5W A;  2GA4 B;  2OTL A;  1GJX A;  4K5V A;  1I94 H;  2F3I A;  2ATW A;  4APM A;  1I50 A;  4XQQ A;  4MV6 A;  5C3E B;  5KYI A;  3T5K A;  1BBU A;  4RGM A;  1ZET A;  2EYH A;  2A73 B;  1N34 L;  1STA A;  3S2D B;  2N49 A;  4ECZ A;  4K5W A;  4Y7N H;  1XMO L;  1XX8 A;  4J1M A;  3A5U A;  3A0J A;  3HOV B;  2FP4 B;  5KG6 A;  4DR2 L;  3L4K A;  3V6H A;  1UC9 A;  2A6E D;  2UUC H;  3LNN A;  1SNO A;  1OXX K;  5A35 A;  2B2U C;  4RUC A;  1WVL A;  1FJG Q;  2RKS A;  4UPA A;  5BN4 A;  1BBW A;  3GTP H;  2W6Z A;  2EE1 A;  1BQQ T;  1R9T H;  4FF3 A;  4IQZ A;  4G7Z C;  4DF7 A;  3ZJY C;  1ET9 A;  2CKZ B;  2L11 A;  3CW2 C;  2VB3 X;  1B50 A;  1RJQ A;  4G57 A;  1YNX A;  3M9N B;  3GTJ B;  1B33 N;  1BBX C;  4YJ3 F;  4DR3 H;  3U50 C;  1GUO A;  2Y0S G;  5C5M A;  1HUM A;  5EJW A;  1S40 A;  2KQ3 A;  1K3R A;  4GOP C;  3I73 A;  1Z2N X;  5KFI A;  2Z4H A;  3EFX D;  3I7F A;  2B2W A;  3A74 A;  5KFH A;  2C2D A;  4ZYS A;  1TS3 A;  4A3G G;  4FF4 A;  1K0S A;  4WJW A;  4DV1 L;  3TP8 A;  1UE7 A;  3KJO A;  1HNW Q;  4RGO S;  2F0Q A;  2PZT A;  5JVL A;  4B08 A;  2W9B B;  4ECW A;  3HEJ A;  3IAY A;  1EYD A;  3JZI A;  2K7V A;  2BQU A;  1UWV A;  1YNN D;  2B2V A;  2GPW A;  3CU7 A;  4R9W A;  4R8I A;  2R6F A;  5IWA L;  3V4S A;  3GIK A;  4JI6 L;  4EGV A;  2ZJR A;  3MXN A;  3Q0A A;  2PW5 A;  3A8K E;  4HR7 B;  2QIL A;  4G7H C;  3S16 H;  5CMD A;  2VQE L;  5IYD H;  1HUN A;  1JOO A;  2RBM A;  2QA4 A;  4AQY H;  4OHJ A;  4ED7 A;  4C3H B;  4A3I G;  3VR3 A;  2HCC A;  3RBE A;  4LF6 H;  1EOV A;  2B63 H;  3RB4 A;  2VUM B;  4NP5 A;  3GTM H;  4X3U A;  3RB0 A;  3T1H L;  3VYT A;  2W6N A;  1ROD A;  3JAM i;  1PH9 A;  3GTK H;  1Y1V H;  4XYQ A;  4OX9 Q;  4PG3 A;  1TWH H;  3PUZ A;  4DR7 L;  3S1M B;  4ECV A;  3M4P A;  2VOB A;  4MV9 A;  3VDY A;  3UFX B;  1H9R A;  1TWF H;  1V9P A;  1F2M A;  4A3C H;  1GLV A;  1KJI A;  2J6T A;  3I4M G;  4J9S A;  1CFM A;  5J2T F;  3A8I E;  4I55 F;  4GC6 A;  3HOW G;  3DUZ A;  5M3F G;  2BQR A;  1AEX A;  2RHQ B;  1PA6 A;  1IOW A;  3JAM c;  3NE5 B;  4WBN F;  2F52 A;  3PIP 3;  1SEB D;  2ZXR A;  3J80 i;  4KY5 A;  2XNA C;  2B2T A;  5LXT F;  3T5H A;  4LFA H;  2B8G A;  3VR2 A;  2RDH A;  3SGI A;  2BR0 A;  3M9O B;  4HSV A;  4YB8 B;  2UUC Q;  1QUQ A;  2K28 A;  1K1S A;  1HPC A;  4XQJ A;  5IYZ F;  3V05 A;  1ONL A;  1TWA H;  3EVQ A;  1EOT A;  4HAE A;  1XXG A;  1Y14 B;  1SFO B;  1TA8 A;  4MIU A;  1ASY A;  3PO2 B;  4X3T A;  1S5F D;  4X65 L;  2DIK A;  5EKK A;  4E6I A;  3J80 c;  1JDB B;  3K5O A;  4O3N A;  4RB1 A;  3H0G B;  1H9S A;  4BY1 G;  3S1R H;  3Q8Q B;  1N9W A;  4BWS C;  2UXD H;  1SE8 A;  2EYP A;  4FBT A;  4LF9 Q;  5CYU A;  4RMF A;  1MKH A;  1PX2 A;  3GTO B;  3L3O C;  4QGU A;  3PIO A;  3KHH A;  3GTQ B;  3N44 B;  5HY6 A;  3UDF A;  4K6D A;  2CW7 A;  3NTK A;  5DGB A;  2DY7 A;  1GSH A;  2FPP B;  1I3Q B;  3S14 B;  3PSI A;  1A9X A;  3KLS A;  5EWE A;  3KDF A;  4FM9 A;  4WRD A;  4LFB H;  3PCO B;  2K14 A;  3S2H H;  1V4Y A;  3A7A B;  2VZA A;  4YWM A;  1U5K A;  2MPM A;  5IE8 A;  2WAC A;  3E9H A;  3VPC A;  1O7Y A; 
#chains in the Genus database with same CATH homology
 1S3O A;  4BXX H;  3BZC A;  4HJ8 A;  4UP7 A;  4L5Q A;  2HQL A;  2K52 A;  3FKI G;  4R1J A;  3IRB A;  4LF8 L;  4NPS A;  2KBN A;  4JI1 L;  4A3E H;  1GM5 A;  3AFQ A;  2E2J H;  1JMC A;  4BBR G;  1YJN A;  2UXD L;  1XPO A;  3F8T A;  2C35 B;  5IYC G;  4NXN L;  2K4K A;  1B7Y B;  4LUO A;  1KRT A;  4AQY Q;  1Q82 C;  2R7F A;  2HIX A;  3RLN A;  4MTN A;  1KC8 C;  1XMQ L;  2F4V Q;  3I4N H;  1M1K C;  4LF6 Q;  4DR6 L;  4HJ5 A;  2Q2U A;  2PI2 A;  4JI4 L;  2A19 A;  4KHP Q;  5JJI A;  1YVC A;  5HGQ A;  1EIF A;  2UUA L;  3DLL A;  3U58 A;  4BY7 G;  5AJ3 Q;  2ZJQ A;  4DUY Q;  1A8V A;  1O7I A;  4A93 G;  1HZC A;  4LFB L;  5FJ8 H;  2VL6 A;  4HIO A;  3S15 H;  1JJ2 A;  1X65 A;  4JG2 A;  2BA1 A;  4ALP A;  4AYB G;  4X65 Q;  2ASB A;  2XGT A;  1G29 1;  2CWA A;  2JA8 G;  3HOY H;  3OTO L;  4OON A;  4OWX B;  3KF8 B;  1HH2 P;  3F2D A;  4RG1 A;  1KHI A;  1Q8K A;  2JEB I;  4YHH Q;  3ULP A;  4IJL A;  2IHF A;  4JI0 L;  3I4O A;  5ELO A;  4DK3 C;  4DV7 L;  2JA5 G;  1I6H H;  1VQK A;  1YEZ A;  4X66 L;  4JV5 Q;  4GKJ L;  1KD1 C;  5IYD G;  5C44 H;  3S24 A;  3CCR A;  1EQR A;  2HHH L;  5M5Y H;  1SLJ A;  1SFO H;  1KIX A;  1DGS A;  3U4V A;  4JI5 L;  1VQ6 A;  2YU9 H;  3W5O A;  3CMA A;  3S17 H;  2PI2 E;  3HOX G;  1VQN A;  4LFA Q;  2K5V A;  2B63 G;  4DAY B;  3T1Y L;  4JI3 L;  4LF4 Q;  5GAD C;  3M7N A;  3A5Z B;  4A3K G;  1PH4 A;  2PMZ E;  1X54 A;  3E0E A;  2OWO A;  3HKZ G;  3KOJ A;  2VNU D;  4IFD G;  1Y1V G;  3CCU A;  3PV0 A;  5C3E H;  1VQ8 A;  2NZO A;  2CQO A;  1PH1 A;  1HR0 Q;  1Q86 C;  4YWL A;  3GD7 A;  1PH7 A;  4APV A;  4QJF A;  4GKK L;  4A3C G;  1FL0 A;  4LF5 L;  2WP8 J;  4LF8 Q;  1CUK A;  3GTG H;  1YIT A;  4Y52 H;  4K0K L;  3TEH B;  5GAE C;  3H3V H;  2UXD Q;  2I5M X;  3PUY A;  3RLO A;  4YY3 Q;  5M3M H;  3MXN B;  1JB7 A;  2WAQ E;  3HOV H;  2B29 A;  2K50 A;  4NXN Q;  1W3S A;  2A8V A;  5J3B A;  1XMQ Q;  3UDG A;  4XTC S;  2KCM A;  3CC2 A;  4X64 L;  1SRO A;  5IY0 A;  3CME A;  4DR6 Q;  2VS1 A;  4P73 A;  3I2Z A;  1QVG A;  1JJG A;  1YJ9 A;  4JI4 Q;  3WWV A;  4A3J G;  3PO3 H;  2ES2 A;  3CCQ A;  1EIY B;  2UUA Q;  4BBS H;  1AH9 A;  2NN6 G;  5IP7 G;  1LUZ A;  3L0O A;  3H15 A;  4GOP B;  4IOA A;  4LFB Q;  1I50 H;  1D8L A;  2DUD A;  4OO1 G;  5JEA G;  4B3T L;  2QGQ A;  1B8A A;  3K81 C;  1OTC A;  1PHJ A;  2UU9 L;  3K8A A;  3OTO Q;  1QZG A;  1UE5 A;  2YTY A;  5C4X G;  1N8R C;  4O2D A;  1NE3 A;  1E3P A;  2GVB A;  3RR5 A;  1EWI A;  4DAM A;  4JI0 Q;  1XNQ Q;  1NJI C;  3ER0 A;  5C4J H;  2JJQ A;  4DV7 Q;  1QVC A;  4A3B H;  2IX1 A;  4X66 Q;  3G6E A;  4DV3 L;  4HJA A;  5FLX c;  4QY7 A;  5FLM H;  3PIP A;  2NVX H;  3EN2 A;  3K7U C;  4TVA B;  2VQE Q;  1Y1W H;  2K5H A;  1T9H A;  2HHH Q;  2AMC B;  2Q2I A;  1VQC A;  3RZD H;  3PF4 A;  4HIM A;  4JI5 Q;  3TS2 A;  5GQO A;  5C0X J;  4A3L H;  4C3J H;  4QIW E;  3TRE A;  4L5S A;  1GD7 A;  2LXK A;  4EQ5 A;  5EAY A;  4A3F G;  2E2H H;  1WOC A;  4DV4 L;  5IP9 G;  1WYD A;  4IFD I;  5DLQ E;  2Z0S A;  3L2P A;  1VQH A;  2MO0 A;  2YTX A;  1E7Z A;  3CAM A;  3PUX A;  4DK6 C;  1IBM L;  1QUQ B;  3HFZ B;  4A3M H;  2CWP A;  2MO1 A;  4GKK Q;  5H1S E;  4LF5 Q;  3K80 C;  4LNQ A;  4WJ4 A;  5LMN W;  2WAQ G;  4P75 A;  4R4Q A;  3ERS X;  1HJP A;  5LMN L;  3RLF A;  4K0K Q;  1E1O A;  4C3H H;  4UP9 A;  1PH8 A;  1E24 A;  1HNX L;  1UE6 A;  4PMW A;  3W1B A;  4BXX G;  3K7A H;  4DV5 L;  4A75 A;  2VUM H;  3UE1 A;  2ZJP A;  1CSQ A;  1LM0 A;  1X55 A;  4X64 Q;  3CC4 A;  3CCL A;  4A3E G;  4GLA C;  1KAW A;  1BVS A;  3OW2 A;  1XPR A;  4IPG A;  4R4C A;  4JOI C;  2R7Z H;  1KXL A;  2R6G A;  1XNR L;  2VW9 A;  2KCT A;  1VQP A;  3STB D;  3S1M H;  2NN6 I;  1JJC B;  4DV2 L;  3I4N G;  4QL5 A;  4DR5 L;  2JE6 I;  1GO3 E;  2ZTC A;  3CPF A;  4H02 A;  4NB3 A;  3G48 A;  1BKB A;  4KI0 A;  3KJP A;  1L2F A;  4UY8 C;  4DR4 L;  4OO1 I;  3KDF B;  4B3T Q;  2IX0 A;  2QEX A;  2RCN A;  2UU9 Q;  1IBK L;  4POG A;  4YWK A;  1D7Q A;  3PUW A;  2R7D A;  2R93 H;  2Z6K C;  1K8G A;  4DV6 L;  2HIV A;  3UDI A;  3NEM A;  1OXU A;  5FJ8 G;  2D62 A;  2MFI A;  4ME3 A;  2D0O A;  4B3M L;  5ELN A;  1VQM A;  1PH5 A;  2AWO A;  3GTL H;  1I94 L;  1V1Q A;  4DUZ L;  3HOY G;  4R4I A;  1I5F A;  1Q1B A;  4DV3 Q;  2XTI A;  1YHQ A;  4IOC A;  2KEN A;  1Q81 C;  1X3F A;  1MIU A;  2OCE A;  5LMU L;  2D0P A;  4GN5 A;  2IY5 B;  5C44 G;  2RHS B;  3EBE A;  1IBL L;  1AE2 A;  3HOZ H;  4A3G H;  1MJE A;  4GNX C;  3W1G A;  4DV4 Q;  2ALY B;  1HZA A;  4EX5 A;  1AE3 A;  2BA0 A;  3PO2 H;  4JOI A;  2NVQ H;  1IBM Q;  1KL9 A;  4UP8 A;  2WB1 E;  1EQQ A;  1N32 L;  2B3G A;  3H0G H;  4DNI A;  3PF5 A;  3DM3 A;  5LMN Q;  1WCM H;  5C3E G;  1EFW A;  1XPU A;  2IHE A;  1HNX Q;  2JA7 H;  3GTO H;  2E5L L;  1VQD A;  2ID0 A;  4DV5 Q;  2Z6K A;  3HKZ E;  2H5X A;  3GTQ H;  2UXC L;  1G6P A;  2Q2H A;  3J81 i;  2EXD A;  3HOU H;  1I3Q H;  3S14 H;  3PUV A;  4JI1 Q;  4DR3 L;  5M3M G;  5E7N A;  4IO9 A;  3HOV G;  3U4Z A;  1IL2 A;  2YYZ A;  1XNR Q;  1MJC A;  4A3I H;  3J7A 5;  3M3Y H;  4LF7 L;  3MEF A;  4HJ7 A;  1L0W A;  4B3S L;  2VY3 A;  4DR1 L;  3M85 A;  4DR5 Q;  3M4O H;  3B6Y A;  3G71 A;  3TRZ A;  1VQ5 A;  2NZH A;  4IPD A;  2CCZ A;  4LFC L;  5M5W H;  3PO3 G;  4DR4 Q;  4BBS G;  3PGZ A;  4LUV A;  2NVY H;  4LWC A;  4A76 A;  1C0A A;  2EIF A;  3CXC A;  2PQA A;  4JBJ A;  1YBY A;  4DV6 Q;  2N8N A;  4GNX A;  5M5X H;  3J81 c;  1NMF A;  1X9N A;  1VQL A;  1RIP A;  1V43 A;  1SMX A;  3UDX A;  1L1O C;  1QZH A;  1FGU A;  2V1C C;  1K8A C;  3L7Z C;  4JC0 A;  2I0Q A;  4B3M Q;  3CQZ H;  1FJG L;  3UE0 A;  3I4M H;  4KLK A;  1I94 Q;  4IPH A;  4DUZ Q;  3RN5 A;  5JJL A;  1OXV A;  4JBW A;  1K73 C;  3HOW H;  4YCV A;  5M3F H;  3FP9 A;  4YCU A;  1HNZ L;  5C0X G;  3NEL A;  4KHZ A;  3STB C;  4A3D G;  1CKN A;  4A3B G;  5LMU Q;  1M90 C;  5IT9 c;  4L5R C;  2AKW B;  4JI2 L;  2JA6 G;  3LGJ A;  3NEN A;  5FLM G;  4GKJ Q;  2MQH A;  1IBL Q;  3CC7 A;  1PFS A;  4P71 A;  3AEV A;  4JI7 L;  1VCI A;  1FVI A;  1HZB A;  2WB1 G;  3FHW A;  2R92 H;  2Y0S E;  3RZO H;  3J81 j;  3CPW A;  1S72 A;  4A3L G;  3D31 A;  1TWG H;  2BH2 A;  3ULJ A;  3T1Y Q;  4JI3 Q;  4TQU S;  4OWT B;  4GS3 A;  2PQA B;  3F2C A;  3AQQ A;  1HNW L;  5AJ3 L;  3TS0 A;  2ZM6 L;  1PH2 A;  4JYA L;  4J15 A;  1UEB A;  2E8G A;  2RF4 A;  4P72 A;  1PH6 A;  4YCW A;  1IZ6 A;  3J7Z C;  1PV4 A;  1WFQ A;  4A3M G;  2E5L Q;  3KF6 A;  2OTL A;  3M4Q A;  2K75 A;  2I5L X;  2OQK A;  4GN3 B;  5IYB H;  2UXC Q;  1VQA A;  1VQB A;  4MNO A;  3KFU A;  4HID A;  2F3I A;  2ATW A;  3H3V I;  4BY1 H;  1L1O A;  5GRO A;  4DR3 Q;  1J5E L;  3CD6 A;  1CKM A;  5JJK A;  1CKN B;  3JC6 6;  1E1T A;  1J6Q A;  1BBU A;  4XIG S;  2VUM G;  1PYS B;  4HIK A;  4B3S Q;  4DR1 Q;  3NBH B;  2WFW A;  1N34 L;  1ASZ A;  1X3G A;  4L5T A;  2N49 A;  4Y7N H;  2Q2T A;  1VQO A;  1YIJ A;  1XMO L;  3G4S A;  2R7Z G;  3E9I A;  3A5U A;  3ICE A;  3CCM A;  4R4T A;  5K36 G;  3A0J A;  1Z9F A;  1YJW A;  2PNH A;  4DR2 L;  4B3R L;  2OQ0 A;  1PH3 A;  1OXX K;  3CCV A;  4JBM A;  1FJG Q;  2KHI A;  4DKA C;  4UPA A;  1E22 A;  3CF5 A;  1BBW A;  3GTP H;  1HR0 W;  4OX9 L;  1R9T H;  1C9O A;  2R93 G;  1X6O A;  3GO5 A;  4A3D H;  4DV0 L;  1LYL A;  1CSP A;  3ZJY C;  2L15 A;  5C0X I;  1Q12 A;  1HNZ Q;  1L1O B;  2BH8 A;  3FKI H;  2CKZ B;  2ZTD A;  3CW2 C;  3S1N H;  1YHB A;  2UXB L;  4YY3 L;  4JI2 Q;  1YNX A;  2LSS A;  4BBR H;  3D0F A;  5IYC H;  3U50 C;  2Y0S G;  4JI7 Q;  4P74 A;  1S40 A;  2MNA A;  1K3R A;  4GOP C;  1X3E A;  1JT8 A;  1NY4 A;  5GAH C;  1VQG A;  4BA1 I;  3S1Q H;  3I7F A;  3A74 A;  1A62 A;  1VQE A;  2CFM A;  5BR8 L;  3HOZ G;  4A3G G;  3ULL A;  3CCE A;  1Z47 A;  4DV1 L;  1UE7 A;  1WI5 A;  3BJU A;  3KJO A;  1HNW Q;  4BY7 H;  2ZM6 Q;  1YZ6 A;  2LXJ A;  4JYA Q;  3PO2 G;  4A93 H;  2JK8 A;  4NXM L;  1NMG A;  4PZ7 A;  4WJ3 M;  1VQJ A;  3CCS A;  2UUC L;  2DGY A;  1H95 A;  3H0G G;  3RN2 A;  3KLW A;  1UWV A;  4IPC A;  2UUB L;  3F1Z A;  4OWW B;  1VQ9 A;  2JA8 H;  3Q8D A;  1TWC H;  1WCM G;  4JI8 L;  5IWA L;  1Q7Y C;  1A0I A;  1NTG A;  1J5E Q;  4JI6 L;  2JA7 G;  4GLX A;  2ZJR A;  1XNQ L;  3OYY A;  2JA9 A;  3S16 H;  1K0R A;  2JA5 H;  1N34 Q;  3HOU G;  4AH6 A;  4GN4 B;  2VQE L;  1N36 L;  5IYD H;  1XMO Q;  2QA4 A;  4LF9 L;  4X62 L;  1U0L A;  1SN8 A;  1NBW A;  4A3I G;  2AHO B;  4BA2 I;  3RNU A;  4X6A H;  2NVT H;  1TXY A;  1EOV A;  3HOX H;  1XJV A;  4DV2 Q;  4DR2 Q;  2B63 H;  2VQF L;  4JBK A;  4B3R Q;  3GTM H;  4A3K H;  3T1H L;  4LW1 A;  2KHJ A;  4GOP A;  1CKO A;  2JQO A;  3JAM i;  1PH9 A;  3GTK H;  1Y1V H;  1P8L A;  1IBK Q;  1EUJ A;  3AYH B;  4OX9 Q;  4PG3 A;  1N33 L;  1YHA A;  1TWH H;  2K5N A;  3PUZ A;  4DR7 L;  1UE1 A;  4DV0 Q;  3HKS A;  3M4P A;  3VDY A;  1W2B A;  1TWF H;  3S2D H;  1V9P A;  4A3C H;  1JE5 A;  3I4M G;  4R4O A;  4DPG A;  4OXP A;  2JEA I;  2UXB Q;  1WJJ A;  1IYJ B;  4A4I A;  1VQF A;  3HOW G;  4IFD J;  1KRS A;  1SRU A;  1OXS C;  1Q46 A;  5M3F G;  4PZ6 A;  4GLV B;  2RHQ B;  1PA6 A;  4FDB A;  2AWN A;  3JAM c;  4POF A;  1C7Y A;  2F52 A;  4A3J H;  2A1A A;  4JCV E;  3J80 i;  5BR8 Q;  4LUZ A;  1XTD A;  1Y1W G;  4AQY L;  4DV1 Q;  2EQS A;  3CCJ A;  2F4V L;  2R92 G;  5IP7 H;  4LF6 L;  3SGI A;  3I55 A;  4NXM Q;  1X56 A;  1VQI A;  1IXR A;  2UUC Q;  2OTJ A;  3BZK A;  4KHP L;  1N32 Q;  3GTJ H;  1Q1E A;  1QUQ A;  1KQS A;  3BU2 A;  2UUB Q;  1PYB A;  3CP0 A;  2E2I H;  2YV5 A;  4GNX B;  2FXQ A;  1TWA H;  3EIV A;  4JI8 Q;  5IWA Q;  4DUY L;  5C4X H;  1PVO A;  1Y14 B;  4JI6 Q;  4MZ9 A;  1ASY A;  1GKH A;  1LTL A;  1G51 A;  5IYB G;  2ZTE A;  4X65 L;  3J80 c;  4IJH A;  5JEA J;  2JA6 H;  3S1R H;  4BY1 G;  4AYB E;  1K9M C;  1N9W A;  1N36 Q;  1A63 A;  1SE8 A;  3M9B A;  4YHH L;  4LF9 Q;  4X62 Q;  3K0X A;  2YTV A;  4RMF A;  1MKH A;  3I56 A;  1K83 H;  4O0A A;  4QQB X;  3TQY A;  4LF7 Q;  4QGU A;  3PIO A;  2N78 A;  2I5H A;  2IT1 A;  3KYH C;  2VQF Q;  5HY6 A;  3UDF A;  4JV5 L;  3T1H Q;  4C3I H;  1SR3 A;  1RL2 A;  4AIM A;  1B70 B;  4C2M H;  4A3F H;  1EYG A;  3PSI A;  1VQ4 A;  5IP9 H;  3F2B A;  4LFC Q;  3KDF A;  1N33 Q;  3PCO B;  2K14 A;  1VQ7 A;  1P16 A;  3GDE A;  4LF4 L;  4LFA L;  3S2H H;  4DR7 Q;  1QVF A;  5GAG C;  1OXT A;  1VS0 A;  3AFP A;  2VZA A;  1GVP A;  2GN5 A;  4YWM A;  1U5K A;  5IE8 A;  4PZ8 A;  1HZ9 A;  4HJ9 A;  2GVA A;  3E9H A;  1YI2 A;  2HT1 A;  3KF6 B;  1HR0 L;  2N3S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...