3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
2Q2HA 1Q46A 4DK3C 4YHHQ 2R93H 1JT8A 1SN8A 2B3GA 2IX1A 1D8LA 5GAGC 5K36G 3D0FA 2AKWB 3STBD 3CC7A 3CMAA 4DR5Q 2NZHA 4R4OA 3A74A 2CCZA 1UE1A 4DUZL 2VZAA 2LXJA 1K3RA 4OXPA 1PH5A 4BBSH 4YCUA 2UUBL 2IHEA 1E3PA 2WB1G 3CCSA 4BA1I 3HOWH 2MQHA 1UE5A 5M5XH 1QVGA 3CC2A 1B8AA 4JBJA 2ZTEA 3KJOA 4LF5L 1WFQA 4JI8Q 3RZOH 1YBYA 3JC66 4GN4B 1VQ8A 3S1QH 4AYBE 5JJKA 5M5YH 4JV5L 4DR2L 3PIPA 3KDFA 2Y0SG 4IFDG 1WOCA 4B3ML 3FKIG 1GVPA 4IPHA 3I4NH 5C0XI 3OYYA 3RLFA 5C4XH 4BY1G 1BKBA 2Z6KC 1IBKL 1X6OA 1PVOA 1D7QA 1PH1A 3ULJA 1GD7A 4DV1Q 4LF8L 4DV2Q 5HGQA 1C9OA 2D62A 1U5KA 4KLKA 1VQDA 4B3TL 1HJPA 4IOCA 2VL6A 5FLXc 1L1OB 2JQOA 3KJPA 1N33Q 4JI6Q 1JB7A 4AQYL 4R4QA 1X56A 2UXDL 1Q1BA 3CC4A 1S3OA 2Q2TA 4X65L 1Q12A 3TQYA 1LTLA 2K5NA 1MKHA 2EQSA 5IYBG 3S1RH 1J5EL 1JMCA 3I4MG 1HZAA 4QL5A 4APVA 1PYSB 2YTVA 1IBLQ 1V1QA 1OXXK 2ZM6Q 2OQKA 1HNZL 4DR3L 3RLNA 4GN5A 1HZBA 3CQZH 4P72A 4A75A 2A8VA 3PUZA 1EIFA 1Y14B 4GOPC 1G51A 1Z47A 4R4CA 4R4IA 4C3JH 3S17H 1VCIA 3ER0A 3F2DA 1MIUA 5LMUQ 4Y52H 1N9WA 1CSPA 1Y1VG 2ALYB 4LUVA 2GN5A 1PV4A 1EUJA 4BBRG 3PO3G 4A3LG 4B3SQ 1E1TA 1SRUA 4JCVE 3A5ZB 2OQ0A 2Q2IA 1VQNA 4DUZQ 3S2DH 4GN3B 1N36L 1VQPA 4LF6Q 4BY7G 1KXLA 1BBUA 1QVCA 3CCVA 3AQQA 3I4MH 3KOJA 3I2ZA 1L0WA 1HNXQ 2UXCL 5LMNW 2UUBQ 1AE3A 1Y1WG 3PUWA 1C0AA 1XPOA 3M4OH 4LF5Q 5IYDH 5C3EG 2I5MX 5ELOA 2VQFL 1I3QH 3PGZA 1XNQL 1PH9A 1KRTA 4DR2Q 2IY5B 4X64L 2ZTDA 4JYAL 5M3FG 5C44G 4B3MQ 2B63H 1I50H 1PA6A 4A3DG 2BH8A 3K80C 2NN6I 5BR8L 4DV4L 4DR5L 3CCLA 2JEBI 1J6QA 3MEFA 4AH6A 3U58A 5IT9c 1IBKQ 2QEXA 3KDFB 3T1HL 2F4VL 1Y1VH 3OW2A 4A3LH 1K83H 4HIDA 3L7ZC 4LWCA 1SR3A 3LGJA 1YHBA 4A3EG 3RLOA 3H3VH 4JI7Q 4IPDA 4POFA 3GTQH 1A63A 3HOXG 2EIFA 2ID0A 2KBNA 4BY7H 4IFDJ 3AFQA 1X3EA 4A3BH 4A3GG 3HFZB 4EX5A 4AYBG 4AQYQ 4A3FG 2D0PA 4DV5L 1W3SA 3L2PA 2UXDQ 1P16A 3BZKA 1YNXA 2CKZB 1GO3E 2V1CC 3KF8B 5E7NA 4X65Q 3GTJH 2QA4A 2Z6KA 3G6EA 3F2BA 1J5EQ 2ES2A 4GKJL 4MTNA 1DGSA 4DAYB 1K8GA 3BU2A 2KENA 1N34L 3AFPA 3RN2A 4OX9L 4HIKA 1QZHA 3HOUG 2E8GA 3UDFA 1HNZQ 3PUXA 3ULPA 4A3DH 4DR1Q 4B3RQ 1PH6A 2JA6G 3HOVG 1X65A 1I94L 1A0IA 4PMWA 1VQKA 4BXXG 2D0OA 1NMFA 2AWOA 2KCTA 2L15A 4R1JA 1KL9A 3CF5A 2JEAI 1PYBA 1IXRA 3JAMi 1VQIA 3HOXH 4GKKQ 5IYCG 4XTCS 2R6GA 1SROA 2OTLA 3RZDH 3H3VI 1JE5A 2MO1A 2N49A 2WAQE 1WCMG 2YYZA 1N36Q 3MXNB 1VQMA 2E2IH 3I55A 1OXTA 2N8NA 3ZJYC 1B70B 1YHQA 3E9HA 2EXDA 4YY3L 4GOPA 2R7ZG 3I7FA 4JI0L 3Q8DA 2GVAA 3L0OA 1WYDA 5M3MG 2IHFA 4LFAQ 4HJ7A 3VDYA 4HJ5A 2VQEQ 3HOVH 1VQ7A 1XNQQ 3PUYA 4MNOA 2A1AA 2JK8A 4J15A 4X64Q 4PZ8A 4JYAQ 4HIOA 3OTOL 2VNUD 5AJ3L 1YEZA 4A3CG 2MO0A 1CKOA 3B6YA 3AEVA 4OWWB 2OTJA 3FP9A 2JA7H 4DV6L 2FXQA 5IYCH 3J81i 1X3GA 1KHIA 1RL2A 1VQHA 2JA5H 2K50A 3KFUA 1P8LA 4LF9L 3KYHC 1PHJA 4IOAA 1HNWL 2JJQA 3IRBA 4JI5L 3PIOA 3UDGA 2UUCQ 3GTOH 2LSSA 2PQAA 5IE8A 1AE2A 4A3KG 1SE8A 3ICEA 4JBMA 1VQJA 2H5XA 2VS1A 3PCOB 2YV5A 5HY6A 2K52A 3A0JA 5IP9G 1XJVA 2UU9L 1X54A 4IJLA 3GDEA 3M85A 3S24A 1XMOL 1WI5A 3I4OA 2E2HH 3S14H 2N3SA 1M90C 3NELA 4X66Q 3EN2A 1Q81C 1MJEA 3PO2G 4UY8C 1N34Q 2PI2A 1K73C 1NY4A 1FGUA 1U0LA 3CAMA 4DPGA 4LF7Q 3HOZG 3D31A 4GLAC 3CCJA 4JI4Q 4HJ9A 1G6PA 1KAWA 2K5VA 3PSIA 4PZ7A 4LFCL 2R92G 1OXVA 1LM0A 4DNIA 5IY0A 2RHQB 4JI3L 2DUDA 4UPAA 4OWTB 3FKIH 2JA8G 1EYGA 2XTIA 1H95A 4JI2L 1VQGA 5GADC 1YJWA 3KLWA 4P73A 5LMNL 4BY1H 4UP8A 4JI1L 2QGQA 2WFWA 4NPSA 4A3KH 4A3IG 1YJNA 2A19A 2UUAL 3U50C 1SLJA 2JA9A 1SMXA 4OWXB 3M3YH 4NXNL 1VQFA 5ELNA 1W2BA 1MJCA 4DV0L 4YY3Q 1VQ5A 2K75A 4DV7L 4L5SA 4JI0Q 1VQ6A 2IT1A 1I6HH 1QVFA 5IYBH 1VQCA 4DR6L 2CFMA 4TVAB 2PI2E 4GOPB 3J81j 4DAMA 3J80c 4A3MG 3H0GG 4JC0A 5AJ3Q 3K7UC 2WAQG 4DKAC 4LFBL 2Z0SA 2KCMA 1K0RA 1Q7YC 2HT1A 1NMGA 1VQEA 4DV6Q 4JV5Q 2ASBA 2NVYH 4TQUS 3U4VA 4X62L 4IFDI 1JJCB 2VUMG 2VW9A 1PH7A 4RMFA 5EAYA 1VQLA 1KQSA 4LF9Q 2NVQH 2PNHA 3JAMc 1HNWQ 4JI5Q 3CCUA 4NB3A 4L5TA 1OXUA 4JOIC 1G291 4BBRH 3PO3H 4NXML 1IBML 3CD6A 3FHWA 3TS2A 4LF8Q 4ALPA 3AYHB 5C4JH 1WJJA 2RHSB 3CP0A 1HR0W 4B3TQ 1YZ6A 4X6AH 4YWMA 1XMOQ 2Q2UA 2PQAB 1CUKA 4IJHA 3A5UA 5GQOA 4KHPL 1VQ4A 1HZ9A 1E1OA 4DR4L 4FDBA 3GO5A 1Y1WH 1XMQL 2YU9H 1GM5A 1Q8KA 3H15A 3RR5A 2XGTA 5C3EH 1E22A 3HOYG 3EIVA 5IP7G 3HKSA 3J80i 4JI8L 3NBHB 1EQRA 4JI3Q 2NVTH 5M3FH 5C44H 4DUYL 2VUMH 4LW1A 4DR3Q 3J7A5 4JI2Q 3GTLH 3PF4A 2C35B 5LMNQ 3BJUA 1V9PA 2B29A 1X55A 5C0XG 3J81c 3PV0A 4A76A 4IO9A 2HHHL 4A3EH 4QJFA 1UEBA 3CPFA 4A3JG 4JBKA 1V43A 4NXNQ 1UWVA 3ULLA 2AHOB 3DLLA 1S72A 4A3GH 4GNXC 1EOVA 4A3FH 2RF4A 2KHJA 1XNRL 3GD7A 2JE6I 1N33L 4JI6L 1JJ2A 3K8AA 2BA1A 1O7IA 4DR6Q 1FVIA 2YTYA 3KF6A 3TS0A 2ATWA 2UXCQ 3UDXA 5IP7H 4BBSG 4K0KL 1VS0A 2GVBA 1B7YB 4HIMA 2BH2A 3HOWG 1N32L 1HH2P 3HOUH 1TWCH 4P74A 1IBLL 4LFBQ 1OXSC 2VQFQ 5JEAG 5GAHC 3K0XA 2OCEA 1AH9A 2JA6H 1YHAA 3E0EA 4O2DA 2ZM6L 5H1SE 1YITA 3CCQA 1FJGL 3UE1A 4BXXH 5GAEC 3T1YL 2I5HA 2WP8J 3CW2C 3BZCA 1EWIA 3M9BA 4OONA 3STBC 3UE0A 5BR8Q 4AIMA 2VY3A 2HIVA 5GROA 3J7ZC 2ZJPA 5LMUL 5C4XG 1LUZA 4QGUA 3T1HQ 2F4VQ 4P75A 1EFWA 1IBMQ 4NXMQ 4PG3A 1CKMA 4UP9A 2F3IA 1WCMH 2LXKA 1CSQA 4C3IH 1Q82C 4B3SL 1PFSA 1PH2A 2OWOA 4O0AA 1LYLA 2IX0A 4GLXA 4L5RC 3F8TA 4LF6L 2E5LL 4DR4Q 4KHPQ 4A93G 1BBWA 1TWAH 2R7ZH 4DV5Q 4LF4L 1XMQQ 1HNXL 4LUZA 1TXYA 4Y7NH 4GKJQ 5M3MH 1XPUA 1YJ9A 2HIXA 4UP7A 4JOIA 3WWVA 4DV4Q 4OX9Q 5J3BA 5DLQE 4DUYQ 1XTDA 4A3CH 1L1OC 1PH8A 3ERSX 1EQQA 1I94Q 3M4PA 4IPGA 1ASYA 2NN6G 1M1KC 1IL2A 1IZ6A 5IWAL 2HHHQ 4HJAA 1OTCA 4DR7L 2UXBL 3S15H 1PH4A 4JI7L 3CPWA 4WJ4A 4YCWA 3HKZE 4A93H 1XNRQ 3G4SA 5IP9H 4C3HH 5C0XJ 1KC8C 3CXCA 4JG2A 4YWLA 1GKHA 1CKNA 4KHZA 3W5OA 3I4NG 1NE3A 3SGIA 3S2HH 3PO2H 4K0KQ 2MFIA 2ZTCA 4WJ3M 4R4TA 2PMZE 1N32Q 3GTGH 2RCNA 5FLMG 1TWFH 4DK6C 1K9MC 3KF6B 1Z9FA 1EIYB 2R7DA 3HOZH 5IYDG 3I56A 4HJ8A 3S1NH 1L2FA 2DGYA 4PZ6A 4EQ5A 2K14A 1QUQA 4IPCA 1VQBA 4GNXA 4DR1L 2YTXA 1YIJA 2I0QA 1FJGQ 2R92H 4B3RL 4OO1G 3OTOQ 1HR0L 1Q86C 5JJLA 2K4KA 3T1YQ 2JA8H 2B63G 1VQAA 3F1ZA 1I5FA 1A8VA 4QIWE 4GKKL 5JEAJ 3TEHB 4DV3L 5M5WH 4A3IH 2WB1E 4GLVB 1KRSA 5FJ8G 3PF5A 3GTKH 4LUOA 1S40A 3CMEA 4YHHL 1BVSA 1RIPA 3PUVA 3S1MH 4A3BG 2E5LQ 3TRZA 2I5LX 4BA2I 4QY7A 4LF4Q 1C7YA 2UU9Q 1KD1C 2Y0SE 5FLMH 1PH3A 2NVXH 3RN5A 3G71A 1QZGA 4LFAL 2E2JH 4POGA 3GTPH 2AWNA 2VQEL 1E7ZA 4QQBX 4A3MH 3CCRA 3H0GH 3E9IA 1Q1EA 2CWPA 1HZCA 3U4ZA 3W1BA 4JBWA 3NENA 3EBEA 4LFCQ 4RG1A 2BA0A 3TREA 1NJIC 3M4QA 3GTMH 4P71A 5IWAQ 1TWGH 1YVCA 4L5QA 1UE6A 2CWAA 3UDIA 5FJ8H 3CCEA 1KIXA 1VQ9A 2NZOA 4DR7Q 3NEMA 2UXBQ 4GS3A 1SFOH 4JI1Q 4ME3A 1X3FA 3CCMA 3M7NA 2UUAQ 2UUCL 1R9TH 3W1GA 2MNAA 1L1OA 3RNUA 2F52A 1UE7A 4DV1L 2R93G 2HQLA 4YCVA 4DV2L 1YI2A 2N78A 4DV0Q 1X9NA 2KHIA 4DV7Q 2AMCB 4LNQA 4X66L 1VQOA 4H02A 4XIGS 1CKNB 1XPRA 3DM3A 1E24A 1TWHH 4LF7L 3HOYH 4A4IA 1A62A 1FL0A 3G48A 4JI4L 4OO1I 3HKZG 3K7AH 3F2CA 1HR0Q 4YWKA 2K5HA 2R7FA 1ASZA 1NBWA 1IYJB 2CQOA 1N8RC 5JJIA 1JJGA 1QUQB 2ZJQA 4GNXB 2JA7G 4X62Q 1K8AC 3S16H 4DV3Q 2ZJRA 1NTGA 4KI0A 1T9HA 3K81C 4MZ9A 2JA5G 4C2MH 4A3JH
chains in the Genus database with same CATH superfamily
1J9OA 2EPBA 3EVQA 3S2DB 2R93H 4DR3H 2QDLA 3GV6A 2IX1A 3I4LA 5FO9B 1HHVA 1D8LA 3A55A 5GAGC 5K36G 4QW9A 3H4DA 3D6CA 3CC7A 3CMAA 2W7OA 1DYQA 2YZMA 5KFTA 2KEDA 4DUZL 3ND8A 4LMYA 2FINB 5KYIA 4BBSH 5DNFA 4JV0A 3HOWH 2MQHA 1QVGA 3CC2A 2JA5A 4JBJA 3KJOA 1WFQA 4YR0A 5E4WC 4KKSA 3G6VA 4IALA 5KFSA 3S1QH 2DY7A 4KY6A 4AYBE 5JJKA 4JV5L 4ZK9B 3OSPA 4UCRA 1X32A 1K83B 1Z6HA 2ICIA 2XRSD 3OYYA 3ND9A 5C4XH 4BY1G 4TUYF 4QWDA 3GQBA 4KJOA 4A3BB 2W9AA 1XNQH 1BDOA 2V4RA 4JYAH 3Q8PB 5IT9L 3WO1A 1RD9D 2NU6B 4DV1Q 2WB1A 4DR5H 1PYWD 1HTLD 1EL0A 3KF8A 5DQGA 1SE2A 2VL6A 3T1HH 5KKNB 3N44B 1E0BA 3KJPA 4DAYA 1EYDA 1JB7A 2UXDL 1JE4A 3NBHA 4X65L 3MR6A 3OWFA 4J9NA 3I4MG 4DAVA 4RNOA 2FPIB 4C1NK 1HZAA 5G3LF 4FM9A 4DR4H 4APVA 1PYSB 2YTVA 2IA6A 2HGSA 3T16A 1BR9A 2OQKA 4H0LC 4DR3L 4GKJH 5KFOA 4ECRA 4O3QA 4HR7B 3R2IA 1C48A 2I46A 3NQTA 4IHJF 4R8UA 3FPUB 2A6EC 3MXUA 4Y52H 3IAYA 3T5LA 3MFHA 2I07B 1EUJA 4LK1C 2I80A 3K5HA 1B3QA 5C5JA 2OQ0A 2Q2IA 4YIJA 4GN3B 4Q5VA 2M9VA 4LAAA 1RJTA 1T5EA 5M9OA 5C1PA 3I2ZA 1L0WA 2UUBQ 2WYOA 1I4HA 4ODGA 3BG5A 4KV6A 2O5IC 1XPOA 2NVYA 3TN2A 4QUFA 2FJZA 4LF5Q 5IYDH 5ELOA 2IJ0A 3D8GA 1JICA 1I3QH 3PGZA 1XNQL 1PH9A 4G3IA 2IY5B 3SI8A 4X64L 2JA5B 4JYAL 2XNAC 4JI0H 5M3FG 4XYQA 3OMGA 4DNTB 1ICWA 4EYIB 3RAXA 4A3DG 1FD7D 4DR5L 4MTDA 4CGYB 1J6QA 2F0KA 4KN4C 3OMCA 1ZYRC 3HS0C 3T1HL 1Y1VH 1A3VA 3OTOH 1F9QA 4LWCA 3LGJA 2XCLA 5FPOA 2PO4A 2ID0A 4BY7H 4O2BF 3AFQA 3S14B 4A3GG 1LT3D 4EX5A 2D5DA 2WB1B 4AQYQ 4A3FG 2IPKD 4LF9H 1P16A 3BZKA 1YNXA 2CKZB 1GO3E 2V1CC 3KF8B 3BZDB 4GKJL 3GTJH 3BJYA 2Z6KA 2Z8LA 1DGSA 1STEA 2DNCA 4DAYB 5FOBB 3GTLA 2PQEA 3NHHA 3BU2A 1EY7A 1W6KA 3EROA 3PVXA 2UU9H 1QZHA 3UDFA 3PUXA 1JC7A 3HOVG 2LKVA 4WBNF 1U4LA 5LYJF 1FNWA 3M7GA 4K14A 3VYSA 1NMFA 2KCTA 4AYBA 2UVUA 3CF5A 2JEAI 1PYBA 1TR5A 1BO0A 5I4DA 5IYCG 3M3YB 4R8UB 5J1ZA 3RV4A 2L55A 2M05A 4JI2H 2N8NA 2B2VA 2R7ZG 3I7FA 4JI0L 2AGQA 2GVAA 2NU7B 2XWJB 4DL7A 1G2TA 2NVYB 1JKJB 4FXGC 4HIOA 3OTOL 1KJJA 5AJ3L 1YEZA 4DR6H 3B6YA 1UNSA 1FYCA 4EQOA 3R5XA 2JA7H 2FXQA 3TDQA 3J81i 1X3GA 1VQHA 1RL2A 4PV1C 4DGZA 2A68C 2FP4B 5HV6A 1T3NA 1HR0H 5C4JB 1TWAA 4LF9L 4MV6A 2JJQA 2TSSA 3G6JB 3IRBA 3PIOA 3JAML 2UUCQ 4MV3A 2F0PA 5IE8A 4X62H 1SE8A 5HBRB 3RBEA 1VQJA 1EEID 2H5XA 4KTAA 5HY6A 4PMCA 2ZDGA 3A0JA 2UU9L 1XJVA 1DV2A 3CRLC 5KFMA 2E2HH 2N3SA 1Q81C 3PO2G 3A7AB 2F03A 4RB0A 1N34Q 1O75A 1Z2OX 2PI2A 5CMDA 1ULZA 1CQFA 1W93A 1SNMA 1IYUA 1ONLA 4GLAC 3GTLB 5EWEA 5D3IB 2R8KA 1G6PA 4KHPH 3FMCA 1Z2PX 1OXVA 2F0OA 3CRKC 3K0YA 1L2ZA 4ECUA 2DUDA 5EGTA 2LY7A 1SMYC 1ENAA 2IX3A 4JI2L 1YJWA 5C3XA 4BY1H 2QGQA 2WFWA 1SAPA 2ZXOA 4AYBB 4A3IG 3C46A 1CK1A 1ICFB 1DOMA 2D9UA 2JA9A 4IR9A 5KFGA 2K6AA 3MWYW 1GUNA 3QFFA 3W2DA 1CT1D 1W2BA 1ZHQA 2A6ED 5KFLA 5C4ZA 5CV9A 2K75A 2F0MA 4RGOS 3RB6A 1VQ6A 2R92A 3KHGA 1PMRA 4DR6L 4RUCA 1H9SA 4KKUA 1S5CD 1S97A 4DAMA 3JRWA 4UFZA 1L0XB 3OUUA 4A3MG 3R23A 2W7PA 5KIXA 1QG7A 3J81W 5JVG3 4FP5D 4RA8A 2KCMA 5KT6A 4H13C 1NMGA 1VQEA 4DV6Q 1ILPA 4K0KH 2ASBA 2EYHA 4X62L 1PZKD 2VW9A 4J9SA 1H9KA 5EAYA 1VQLA 1KQSA 3H91A 4X3SA 4C3IB 4RNMA 3SE0A 3EJIA 4JI5Q 1AZPA 4HNVA 3H6MA 3NBIA 3QWNA 1FJGH 4JOIC 5KEEA 4NXML 1TWAB 1HQMC 4LF8Q 4ALPA 1WJJA 2EYOA 2RHSB 3CP0A 5ISRA 4F4WA 4RWSC 1XMOQ 1JIHA 1ZYRD 3ETJA 3H0GA 2FK3A 2K03A 4KHPL 1VQ4A 1HZ9A 1E1OA 1I50A 4FDBA 4DL2A 1GM5A 3TZUA 2E75C 4HCSA 1WTXA 4YBZB 1SE3A 3EIVA 3VYRA 1SFOA 1DXMA 1GUGA 1SSOA 2NVTH 5M3FH 3GIKA 2VUMH 2VB2X 3KTMA 5I6YA 1DZ1A 2B29A 4L1KA 2W6NA 4WORA 2ASDA 2VA2A 2F1MA 2K28A 1PXUA 2JEJA 4IWXA 2H1EA 2RKSA 5KX5F 1V43A 2RSNA 3S2HB 4A3GH 5IWAH 3I72A 3QG1A 1TWHA 4A3FH 3C1EA 3GD7A 2JE6I 1GHJA 1O7IA 5HGTA 5BPHA 1SE4A 2ATWA 3URYA 3PIP3 3Q0AA 4K0KL 1VS0A 1A3UA 2WV6D 3NXWA 2DJFC 1LACA 4RH6A 3SDZA 2R92B 5CB4F 4TQSA 1TWCH 2JA8B 4LFBQ 1H9SB 3HG9A 4CDFC 1RJRA 1S10A 4K2LA 5EWGA 1FJGL 3E0JA 5GAEC 1SNPA 2FK2A 3J7AK 1U4RA 3CW2C 1SXTA 4AIMA 4DK0A 4K6DA 1K73C 3I4NG 2VY3A 2KQ3A 4HAEA 5DM73 2F4VQ 5KFXA 4HNUA 2FMAA 1E2VA 1S5BD 2R86A 4RAYA 2R8JA 1CKMA 1QNUA 1CSQA 1Q82C 5DLFA 4MV8A 2W71A 1FNVA 5K2MA 3ERQA 2E2JB 2C2RA 2A68D 2E5LL 3P20A 4A93G 4DV3H 2R7ZH 3PN1A 5IOCA 4C3HG 2EXZA 5IIFA 1I4QA 1TXYA 3H0GB 4LJZC 2F0TA 1YNJC 1XPUA 5D1PA 2MCTA 2PMZA 1I50B 5J2UF 4TQRA 2YCHA 3N41B 1RK6A 5J3BA 4ZHQF 4DUYQ 4CKBA 2XIGA 3GTOA 4M9UA 3NE5B 1SFOB 2C22A 1I94Q 1ASYA 1IL2A 4Q45A 5IWAL 1D6EC 1KDBA 2KHSA 5A2QE 4C3JG 1WD1A 5KFZA 1GGOA 3T5KA 5NUCA 1VBHA 4WJ4A 4XT3B 3HKZE 3N6XA 1SMYD 1EY6A 4DXGA 3KLRA 4YWLA 1CKNA 3W5OA 3LWBA 4BWGB 5BPFA 1TWHB 3HOYB 3V4SA 3PO2H 2MFIA 4IUQA 2UUCH 3P7JA 2UVRA 2WKCA 1TWFH 2AUKA 1F9RA 5EJWA 3X3MA 4J9RA 4HJ8A 4EQ5A 2DGYA 4RGTA 4OO1G 3DWPA 1DOKA 2CVRA 5JJLA 1M8AA 1S5ED 2L9HA 1H9RA 3TINA 4A3JB 4HMJA 3F1ZA 1VKZA 1I5FA 4RUAA 5JEAJ 3TEHB 4DV3L 4A3IH 1KRSA 4J6HA 3GTKH 3OWEB 4LUOA 2MGSA 1S40A 3CMEA 1BVSA 1A2UA 3KBXA 3OHBA 4A3BG 5KG6A 3TRZA 3V05A 4G7OC 2EYFA 1KD1C 4M8AA 1PH3A 3SK6A 2VPSA 4JVZA 2SEBD 3G71A 2B63A 4POGA 2V4DA 3GTPH 1GYFA 1DV1A 4QQBX 4A3MH 4KJNA 3CCRA 3E9IA 2PMZB 5FO7B 2XC9A 3K3PA 2QCPX 2Z4IA 1EY0A 3DHQA 2I87A 3I91A 3GTMH 3GTOB 4L5QA 1KIXA 3N6RA 5FJ8H 3CCEA 1VQ9A 3NEMA 2UXBQ 3EFXD 4JV1A 1Y1WA 4JV2A 2XD4A 1R4QB 1RHPA 2PZTA 5CV6A 3OUZA 2UUAQ 2UUCL 1NCVA 1R9TH 4ED3A 2MNAA 4B3MH 1L1OA 1EYAA 5LHY1 1ESRA 3RNUA 3MWEA 2R93G 4RZQA 5EWFA 4DF7A 3IKJA 4X3KA 1X9NA 4JI5H 2KHIA 1TY2A 3KAJA 3ORRA 4DV7Q 2EY6A 5KFPA 3GLKA 1VQOA 4XIGS 1AUVA 4MTEA 1CKNB 4LF8H 3DM3A 1E24A 1M6VA 1VBGA 3K7AH 5LL6S 2G9DA 5D3DA 1IYJB 3PW5A 5C6AA 1N8RC 2F0SA 1ZEQX 2R84A 3H4BA 2QDBA 1WH2A 2EY5A 2E2IA 1NTGA 4HEDA 1RKNA 2JA5G 3PW7A 3TBIB 3R5FA 1Q46A 4RKBA 4YHHQ 3RUPA 1JT8A 1SN8A 4ZOLF 2J9GA 4OL7A 1A3TA 2JA6A 3OSOA 1WSCA 1TU2B 3HKZA 2J6SA 1CHQD 3MC0B 1EU4A 2LXJA 3MZ5A 3C0FB 4UCOA 4OXPA 2BQRA 2IHEA 2WB1G 5CV5A 2B63B 5M5XH 4JUZA 5C4HA 1EYCA 1CQVA 1TKWB 1YBYA 3JC66 4GN4B 1CA5A 1IW7C 1YNJD 4R7RA 2F0EA 3PIPA 5GONF 2M2LA 3KDFA 2Y0SG 2SCUB 4B3ML 2A6HC 4IPHA 1GVPA 3I4NH 2R8GA 2HUGA 3RLFA 1S4ZA 2Z6KC 1I6UA 2F0WA 1X6OA 2CQAA 1D7QA 1PH1A 3MJFA 1JOQA 4LF8L 3RGZA 4KLKA 5DGBA 2ENBA 1SNCA 3MFGA 4IRCA 1WTOA 2HDMA 2KOLA 2F4VH 1L1OB 3FDSA 1XXGA 2F0QA 2Q2TA 1Q90A 3TQYA 1J5EL 1MKHA 3FKIA 3RB3A 4KHVA 4ZKCB 1O78A 1EQTA 4QL5A 2GPWA 4O4IF 2K5QA 4IURA 1IBLQ 2NBFA 5IT9W 4RB3C 4KD4A 1HNZL 3RLNA 3HOXB 3PR4A 3E5SA 1U9RA 2B2VC 1G51A 1Z47A 4C3JH 4DUYH 3S17H 1CQJB 3ER0A 3F2DA 1IOVA 2E2IB 2XCPA 3GTGA 2FMMA 4B08A 4Q43A 3MXNA 1I94H 1Y1VG 2ALYB 3PW2A 3J7YW 1E1TA 1SRUA 4JCVE 3UFXB 3S2DH 3MA2B 3NTHA 4QWEA 1VQPA 4LF6Q 4BY7G 1Z2NX 1O7LA 3KOJA 4G4KA 1HNXQ 4K8JA 5LMNW 2JA6B 3HKZB 2VR1A 1VMCA 1K1SA 3PUWA 4OHJA 4WFN3 3FMAA 4ZCKA 2J7ZA 2MP1A 1KRTA 4DR2Q 2NTSA 4MV7A 3EPGA 1PFBA 2BH8A 3K80C 3BA9A 3MWDA 4YP3A 3G6YA 3CCLA 3BQ2A 3U58A 1IBKQ 3KDFB 2F4VL 1JQYD 4UDUC 1K83H 3L7ZC 1YHBA 4EGVA 2YU9A 4R9WA 2XN9C 2ASLA 3RMHA 2KBNA 3DM1A 2RVLA 4A3BH 4IFDJ 1UNNC 4AYBG 1D1KA 3A8IE 2D0PA 3ETHA 4QWCA 5C5LA 2XGPA 1S9FA 4Z9CB 2QA4A 1PK8A 3G6EA 3V6HA 1B53A 3M4IA 1K8GA 2RQXA 2PCFB 5KT3A 5FLXL 3NGDA 3FKIB 2FPGB 4DR1Q 4B3RQ 5FPRA 3S15B 1S68A 1I94L 1I7LA 4N9TA 5KG0A 4A3KB 5I9PA 2F0UA 3FDTA 1KJ9A 4ECVA 4HSVA 4P2CB 5KNDA 3NTKA 4XYOA 3JAMi 1VQIA 2ZJTA 2EOTA 2R6GA 1SROA 3MEHA 1IHZA 3QJYA 2WAQE 1N36Q 3GTGB 4C3IG 1QJOA 3MXNB 2UXBH 5LMNH 3PZPA 1JWMD 2LS01 1OXTA 4K6LA 3ZJYC 4X3UA 4ZAIA 1B70B 4ZRZA 3E9HA 4GOPA 1VMPA 5DG7A 2UUAH 1BJTA 1W96A 4ZI7F 3L0OA 2N55A 2IHFA 4LFAQ 2ATLA 2DJGC 5EZYF 3JRXA 2F0NA 4C2MA 4HJ5A 4NXNH 2QILA 4DV7H 2A1AA 2JK8A 4DAPA 5KFJA 3T56B 2W6ZA 3BVZA 2VNUD 2MO0A 3WDNA 1CKOA 1K1QA 2NVQB 2OTJA 3FP9A 3MR2A 1PLFA 2JA5H 1P8LA 1A2TA 1TS5A 1CHPD 3DF7A 2AGOA 1GSHA 1IW7D 2EY1A 1OO9B 2LSSA 2PQAA 4ILWA 2A6HD 4J0MA 2CH4W 3PCOB 5IP9G 2YU9B 3J80W 2K52A 2UVVA 5KG3A 2QEJC 3S24A 1JOOA 5C3EB 1XTCD 1A6XA 3I4OA 3S14H 1M90C 1MJEA 4EQPA 2C2DA 1SYEA 4DU9A 4WJWA 5IODA 3CAMA 4DPGA 5LXTF 4YJ2F 1TVXA 4JI4Q 1X3PA 1PRTF 3PSIA 4OIJA 4PZ7A 3F2UA 2R92G 3JAMW 2C5CA 3FVQA 4DNIA 1TS4A 2JA8G 3LWEA 1EYGA 2XTIA 1VQGA 2YZNA 1LT4D 5LMNL 4L8JA 1F2LA 4NPSA 1YJNA 4ZQ3A 2UUAL 2R82A 4C1NI 1EY8A 1SMXA 3M3YH 4NXNL 5DGAA 1EUDB 4YY3Q 3EYYA 5CAEB 1VQ5A 4QB4A 4DV7L 3SK4A 3D4WA 4BWSC 2CZGA 2IT1A 3HOUB 3O13A 5FKAC 1GUTA 1BNZA 1FNUA 2PI2E 4UAIA 4GOPB 4XX0B 3BDCA 2SOBA 4ME5A 3J81j 4RHRA 2VUGA 2H4OA 1Q8IA 4PNYA 3H0GG 1LT5D 3D4RA 3R2TA 5JPMC 4N9PA 1QE6A 4O3RA 2NVYH 4TQUS 2VUMG 1IBLH 4ZYSA 4RMFA 1PDQA 5JJZA 1HNWQ 4IUNA 4NB3A 2EDGA 4DNRB 1EY5A 3U9OA 1WD0A 3CD6A 3FHWA 3J7AV 3T1YH 3DMUA 5C4JH 3I12A 1HR0W 4B3TQ 4X6AH 3NUCA 5M3MB 2PQAB 1CUKA 2Z9HA 4EVOA 1G91A 2WAQA 3K5IA 1GHKA 1Y8PB 3N52A 2HVSA 5LA6F 4DR4L 4XQQA 1AN8A 2TMPA 4DXFA 1FGBD 5E4XA 2BDNA 4YAJB 3RR5A 5KGUA 3BS1A 1E4FT 5KFBA 2R8HA 4LF6H 3HOYG 2V9WA 1EY4A 3HKSA 3NBHB 2KECA 1HNXH 4LF4H 4ID6A 1EQRA 4JI3Q 2I8CA 2YZGA 2K7VA 3Q24A 3WNZA 3GTLH 3PF4A 2C35B 5JUMA 1V9PA 3M9NB 3BYTB 1EWHA 1PTOB 3J81c 1KJQA 3PV0A 4A76A 4IO9A 4DR2H 2EJFC 5BN5A 1UEBA 5EBDA 4A3JG 1LTGD 2GPSA 4J8QA 3ULLA 2PN1A 1KAAA 4O3SA 2WINB 1EOVA 3P75A 4DR7H 3Q1KA 4RCOA 2FLLA 3BG3A 3TS0A 2UXCQ 2KJXA 1RJQA 5IP7H 4RFBA 2RCFA 5DG8A 5ELDA 1IBLL 1OXSC 2VQFQ 5JEAG 5GAHC 2QYZA 3Q8RB 1KJ8A 2CW8A 2A69C 1UC9A 3J80L 3UE1A 1V1OA 5M5WB 3WO0A 3T1YL 2I5HA 1N48A 2DPJA 3BZCA 1EWIA 5BR8Q 2ZJPA 5GROA 4DR1H 2ALZA 4B3RH 3S1MB 1RTOA 3M9OB 1IBMQ 4HYKA 2QKIC 1E4EA 4Q8EA 3OOCA 2FPPB 4ME6A 4A2AA 2F3IA 1WTWA 4C3IH 4MV1A 4DL3A 1B9MA 2L12A 1PH2A 3FEWX 1EZ6A 4LF6L 3LX0A 3OHAA 1BBWA 1TWAH 4DV5Q 4LF4L 1XMQQ 1HNXL 2NUAB 4LUZA 2K1BA 1CZGA 2WAQB 3HEJA 2GLTA 4O42A 4UP7A 2IL8A 3M4YA 2FMCA 5DAUA 1MSHA 5KFWA 2C28A 2FLPA 3RF2A 5DLQE 2K5WA 2BQUA 2AQ3B 3SK8A 1XTDA 2R3ZA 1L1OC 3ERSX 3SHLA 5KFAA 1WR2A 5KG4A 2F3WA 4LFAH 4C5BA 1IZ6A 3J81E 3U9SA 2HHHQ 1RYSA 1EHIA 4DR7L 1STYA 1D5MC 2L1BA 3IG0A 1XNRQ 5AFWA 5IP9H 3G4SA 5C0XJ 1KC8C 4V190 4QMGA 4ED8A 5JVH3 3S2HH 2K04A 2PMZE 1N32Q 3A8JE 2MUYA 1K9MC 4DV1H 3T53B 2Q8RE 1AFPA 2R7DA 4ECSA 3Q2OA 1L2FA 4PZ6A 1GUOA 4L63B 1VQBA 4GNXA 4DR1L 2YTXA 2R92H 3S16B 2D2CC 4B3RL 1B33N 1A9XA 1HR0L 4XYMB 2JA8H 2KSWA 2B63G 5F9NA 2N88A 1SNDA 4ED7A 3WOEA 2RGRA 4EGJA 4JI4H 3K58A 4QIWE 4DL5A 1NNXA 1AW7A 1SYXB 4J9PA 5FJ8G 4FVMA 3PF5A 2EYJA 1QNKA 4QCLA 1E4EB 2I5LX 1STHA 1LO5D 1D2BA 4EGQA 4L6TB 4FNFA 5FLMH 1O80A 3TP5A 1MI2A 1STGA 3N43B 1MSGA 4LFAL 2E2JH 3H09A 1F77A 3RZOB 1GUSA 3TQTA 3PMFA 5M5YB 1PFMA 3H0GH 3RAQA 3U4ZA 4JBWA 4IAJA 4RG1A 2UUBH 4P71A 2A73B 5EKKA 1UE6A 2CWAA 3VR4A 2NZOA 1CM9A 5EPKA 4LF5H 1SFOH 4JI1Q 5LOVF 5FD5A 4ME3A 4GC7A 1F9SA 5DEHA 2RA4A 1GSOA 4GZYC 2DWCA 5L37A 4DV1L 1UEAB 2HQLA 4YCVA 4HN7A 1HNWH 1YI2A 4ECQA 3S1RB 2XRQD 1S0NA 1G6ZA 1AP0A 2LFNA 3IL8A 2MJ8A 4EBEA 5IYZF 4UCUA 2W8KA 4B3TH 1TWHH 2XSCA 3HOYH 4A4IA 1A62A 2FFKB 4JI4L 3J7AF 3HKZG 3F2CA 2WTFA 4AQYH 4YWKA 4LMQD 4YR3A 2BR0A 1NBWA 2X6LA 4GNXB 2YS6A 1UUPA 5KFCA 2ZJRA 3E5NA 4KI0A 1T9HA 4MZ9A 4IZOA 1H9JA 1J8IA 5KFIA 4JI3H 2B2UA 1U4MA 4A3JH 2Q2HA 2A69D 5KT7A 3I4MB 3D0FA 3M9MB 2B2TC 2NZHA 3M4OB 1UE1A 1SYGA 2RBMA 2VZAA 3LWUA 2EJMA 4RB1A 1B2TA 4MAMA 1PH5A 4UHVA 1WTQA 4YCUA 2UUBL 2CW7A 1HFNA 3CCSA 4BA1I 2B8FA 1UE5A 5JEAH 1B8AA 4LF5L 2ZTEA 2W6QA 3R3OA 5JQWA 4JI8Q 5KFYA 2UXCH 1VQ8A 5DM63 3VPDA 4HTHA 4IFDG 1WOCA 3L4JA 3FKIG 3DUZA 3TP6A 2VQFH 3A56A 4RCNA 3RV3A 4FF3A 3DXJC 1EIHA 2NZ1D 3D4DA 2YRWA 1PVOA 3N8DA 4QIWA 2SDFA 3HB9A 4DV2Q 1EEFD 1BGWA 5BR8H 1C9OA 2D62A 1PZJD 4B3TL 1VQDA 2HVQA 5CA0F 4G57A 5FLXc 3TP7A 1S5DD 4JI6Q 3DEOA 4AQYL 4C56C 1CFMA 1Q1BA 1RODA 3SEBA 5M3FB 1S3OA 1Q12A 2F4IA 4DFAA 2EQSA 4A3DB 3ITPA 4O4LF 2ZDHA 3MR5A 4DV5H 3AMUA 1OXXK 4B9WA 5IGGA 2FHTA 3CQZH 2KCNA 3GV3A 4QWBA 1N34H 4A3GB 5CV7A 4GOPC 3RZDB 4ED0A 2X69A 2BE5C 1VCIA 2O4XA 4TKOB 1MIUA 5LMUQ 3GV5B 3G6XA 1N9WA 4K8IA 2R85A 3E6ZX 4LUVA 2EY2A 1PV4A 2GN5A 3RUZA 1ZQ7A 2F0IA 1DD2A 1SBBB 1VQNA 5F9LA 3A5ZB 4DUZQ 3EPIA 2DZDA 1BBUA 1QVCA 2AQ2B 3CCVA 2UXCL 3HOVB 5KFVA 1C0AA 3V2TA 3CVZA 1XNRH 5CA1F 4TV8F 5C3EG 2KUMA 2I5MX 1SJED 2VQFL 1X3QA 4NDXA 2F0FA 4G7HC 4J1MA 2F0GA 1T94A 1B6RA 2VXWA 2B63H 1EYZA 1PA6A 5BR8L 4OELB 3MEFA 4AH6A 5IT9c 2XWBB 4A3LH 4EBCA 1SR3A 3RLOA 5KT5A 4JI7Q 3GTQH 3SXHA 1I7NA 2EIFA 5I9OA 4DV6H 3RTXA 4QIWB 2K05A 2EYLA 4J9QA 2W6OA 4DV5L 2UXDQ 1PTOC 3C1FA 3L2PA 1SCUB 4FF4A 3NQIA 4X65Q 3KHRA 2ES2A 1I4GA 5KFDA 4U673 1SNQA 1N34L 3RN2A 4CBVA 4HIKA 3HOUG 1XWEA 2E8GA 2JYOA 2RDGA 4F8MA 1XMOH 3QR8A 3ULPA 3GQCA 1M0TA 1A0IA 3NSWA 3K57A 4ECYA 2VB3X 2SNMA 1KL9A 1IOWA 1IXRA 2NTTA 3HOXH 4GKKQ 2PW7A 2V4QA 2X6GA 1ESFA 5FLXW 5KYLA 1S5FD 2N49A 3L4KA 1I6HB 1PZID 1SYCA 2E2IH 3I55A 2F0DA 2EE1A 1BXTA 4JI1H 2C00A 3BQ1A 1SEIA 1YHQA 1EWCA 2EXDA 3NP8A 4DA2A 2EZVA 5EPJA 5M3MG 4HJ7A 3VDYA 1SYFA 4HCEA 1B3AA 1XNQQ 4YQWA 4MNOA 4X64Q 4JYAQ 1BCPB 4H7BA 4A3IB 5KG1A 4A3CG 4IQZA 3VR3A 1R4PB 1B6SA 4IRDA 4U6PA 4RAUC 4OWWB 1WCMA 4DV6L 5CV4A 3ORQA 3PO3B 4BBRB 4XXEA 4LFBH 1AEXA 3KYHC 2XIWA 4JI5L 3UDGA 1XYIA 1AE2A 1LTID 3Q8QB 4RU9A 2OT2A 1EZ8A 1Y1WB 2PZWA 2PZUA 2YV5A 4CDEC 1X54A 3GDEA 3PQIA 5LP6F 1XMOL 5ELBA 3QIAA 1WI5A 3E3XA 4KKTA 2HVRA 4YR2A 3EN2A 1AUXA 5A35A 4FF2A 4UY8C 4CJ0B 1ET9A 1NY4A 5C44B 3G7LA 1C30A 1FGUA 3D31A 5CGKA 2V5AA 1KAWA 3MXGA 5KNCA 5IY0A 2CQYA 2YW2A 4IFDH 4UPAA 3FKIH 4A3EB 5T1IA 2IWHA 2F0LA 4P73A 1C8CA 3TIGA 1QOHA 4HMIA 1W6JA 1U4PA 4S3SA 4UP8A 4JI1L 4JI8H 4A3KH 2A19A 1KLUD 1UAPA 5A2QL 1SLJA 1B1ZA 3V6KA 5D65A 1MJCA 4EBDA 2IW3A 2BE5D 4L5SA 3K7AB 4JI0Q 4F7XA 4ZUJA 3Q23A 1QVFA 2J0TD 4MTKA 2W6PA 2PVPA 4CJ2C 4DV2H 4TVAB 3MFIA 5E1FA 2J4XA 3RFCA 3J80c 1KTKA 4JI6H 3BDOA 4JC0A 5AJ3Q 2WAQG 4LFBL 1STAA 2Z0SA 2FK1A 1Q7YC 4XZ3B 2RDJA 1T36A 4WRDA 2DY8A 4TRDA 2SNSA 4CKEA 4IFDI 1JJCB 1EFID 5KFFA 5CV8A 1JXLA 1PH7A 4ABNA 4LF9Q 1SYDA 1WCMB 3I90A 4FO2A 3JAMc 2NVQH 1QB5D 5KFRA 4A2BA 3CCUA 2NVXA 2BDOA 4KN7C 1D5ZC 3TS2A 1B50A 1K0SA 3AYHB 4Y7NB 4Q0YA 2EVBA 3K6OA 1YZ6A 2Q2UA 1KDCA 5LMUH 4MHEA 5EOYA 4IJHA 3A5UA 5ELCA 5KFUA 4ULLA 3RIZA 3GO5A 1GJXA 2KVMA 2YU9H 4M1UB 2BOSA 2BCOA 1TWGA 5C3EH 1E22A 2B2WA 2VQDA 5IP7G 3J80i 4JI8L 1PTOD 2WDTA 2B8GA 4F50A 4DUYL 1NR4A 3J7A5 4JI2Q 4RAZA 5ELFA 3I70A 3BJUA 3OW7A 4I7ZC 2K5DA 5C0XG 1VDZA 1HA6A 4A93B 5FD6A 2IBKA 4OGQC 1EIGA 4C3HB 2RSOA 3NWSA 4QJFA 3Q22A 4CKCA 4J9OA 2UVWA 5FO8B 1UWVA 1GUWA 4QUCA 4GNXC 4EEYA 4DK1A 1KNEA 4HNTA 2RF4A 3D3RA 3NTIA 4I55F 4JI6L 2JN4A 2BA1A 3K8AA 1Q3LA 4DR6Q 1FVIA 2YTYA 3QB3A 3HOZB 4JI7H 3S1NB 4XDXA 4CJ1B 3TP8A 2HD3A 1HUMA 3BVGA 5KT4A 4K5XA 1B7YB 2BH2A 1ENCA 1OWTA 3KHLA 1HH2P 3HOUH 4YJ3F 3CU7A 3KLSA 2UXDH 4ED1A 5CBEE 4BS9A 2OCEA 1YHAA 3E0EA 4O2DA 4QW8A 5H1SE 1TS2A 1IKLA 4RHSA 1YITA 3CCQA 2R93A 1O7YA 4LSAA 2WP8J 3UE0A 4OONA 5K5PA 3STBC 4DV4Q 3J7ZC 3GP7A 5LMUL 1LUZA 3JAME 4QGUA 4P75A 4EFBA 3QOJA 3ZYYX 5JVDF 5KG2A 1EFWA 4NXMQ 2J6TA 4NMZA 1ZETA 2WKDA 4PG3A 1DJRD 4UP9A 5D1OA 2AU0A 1E2ZA 2OWOA 2NVXB 4O0AA 4GLXA 4GKKH 4KHPQ 3H3VC 1STNA 2JEGA 3BDLA 4JPBW 2Q8TA 2EYPA 5M3MH 4CHTB 1WTVA 2PW5A 4YHHH 2HDLA 3L9AX 4KY5A 3VR5A 1ENFA 2FKLA 2HIXA 3MWMA 3UQ8A 2VA3A 2QW7A 3KXYT 2OXPA 2RDHA 3WWVA 4OX9Q 1S03G 2B2YA 3SE7A 1TWGB 3D6WA 4N8X1 4NW2A 4A3CH 5T14A 2HCCA 3M4PA 4IPGA 2F0JA 2NN6G 1M1KC 5DQHA 4X64H 5L1JA 4HJAA 4IUPA 2UXBL 1I4RA 1PH4A 4JI7L 1AZQA 1PTOH 1T5XD 1HPCA 2MHVA 5T1GA 4FS2A 3MHBA 2XVSA 3MR3A 5CYUA 2EJGC 1GKHA 1LLRD 1PTOF 4CDDC 1GOZA 1NE3A 2Y0SA 5TSSA 2X0SA 4K0KQ 2ZTCA 2DNEA 4R4TA 4FS1A 4YAKB 2RCNA 1QILA 5FLMG 4DK6C 4CC5A 2LMCB 1Z9FA 1HFGA 1MBYA 2B2UC 2C9OA 5DQIA 4IRKA 2O5JC 2K14A 1I4PA 4IPCA 5E3FA 1YIJA 1FJGQ 5EDWA 2ZT9C 2NYZD 1DM0B 2K4KA 4C2MB 1ILQA 1BBXC 1VF7A 2ZXPA 4O3OA 1VQAA 2R93B 1KLGD 3KAKA 4ED2A 1A8VA 3QZ8A 4GKKL 2V58A 4LSXA 5M5WH 3A54A 1KABA 3IFDA 5LL6b 1WVLA 1MZBA 4IWYA 2YL2A 4YHHL 3LNNA 1F9PA 1RIPA 3PUVA 3S1MH 2E5LQ 1QCBD 4BBSB 4QY7A 3MFYA 4NKLA 1EQVA 1C7YA 5D1OB 5IGFA 3HOWB 4FXDA 1I3QA 2FLNA 1QZGA 4N8FA 2M00A 3T13A 3S1QB 2CH4A 1Y1VA 1ET6A 5C4XB 4LFCQ 2Q8IB 2BA0A 3OIPA 5D14A 3TREA 5IWAQ 2R7LA 3HRZC 3BVMA 1Z7TA 4O4HF 3R8BA 2OLSA 2A74C 4GS3A 1VAJA 1V1PA 1TS3A 3QO2A 1EZ1A 1X3FA 3CCMA 3M7NA 3GTJA 3MXPA 5EBCA 1PRTB 2B39A 3DWQA 2R61A 2N78A 5EKIA 4DV0Q 3BYYB 1IBKH 4O3PA 1CI3M 2FJ2A 3T5HA 3RD4A 2AMCB 4XT1B 5JH7F 4H02A 5IGDA 4J9KA 1BOSA 2Y0SB 3VMMA 2JEIA 2J6UA 5FK9C 4K5WA 3SR1A 4EEQA 2F3VA 4M7EA 2K5HA 4IUUA 2R7FA 3K5MA 2NWGA 2CQOA 4FYDA 5JJIA 3VPCA 2ZJQA 1YNNC 4V0BA 1B44D 3T4AC 5LL6X 5C0XH 3S16H 5KG5A 3T51B 4DV3Q 2IP4A 3FRPB 4F88A 5CR3A 4DK3C 3A7LA 4R8IA 1BCPC 2B3GA 1KC7A 1XX8A 3DWAA 2KA7A 4DN4M 4RNNA 2AKWB 3STBD 3CKIB 2RDIA 4R4OA 3A74A 2CCZA 5KFKA 3RB0A 4C5CA 2C2EA 1K3RA 1DIKA 1S0OA 1I3QB 3VYUA 5KFNA 1E3PA 2JA7A 3H94A 1RYRA 1N36H 1V51A 1NUCA 3P1HA 5DLGA 5C3WA 2Z4HA 3RZOH 1BNCA 1V4YA 5M5YH 4DR2L 1Y1VB 5J39A 1C4QA 5KT2A 1GLVA 3N42B 4PWQA 5HURA 1HA5A 1LTAD 5C0XI 1G8ZD 1BKBA 4BY7B 4MV9A 1K28A 1IBKL 5K36H 3BABA 4RGMA 2VOBA 3RBDA 2E2HA 1V1PB 3AU7A 4MIUA 3ULJA 3GV7B 1GD7A 3HBLA 5HGQA 4DV4H 2W8LA 1U5KA 3KHHA 3GTJB 1EOTA 1HJPA 3NPPA 3HZXA 4IOCA 2JQOA 4QWAA 3VA7A 1N33Q 4NXMH 4R8NA 4R4QA 1I6VC 1X56A 3CC4A 4I65A 3HXLA 5IYBG 1LTLA 2K5NA 1JMCA 3S1RH 2RGVA 3OIQA 4RZRA 4ZUIA 1KNAA 4U7CA 1V1QA 1RF2D 2ZM6Q 3S9WA 1GXDC 4GN5A 1HZBA 3A8KE 4P72A 1RCVD 2NN6H 4A75A 3PUZA 2A8VA 1NSNS 1EIFA 1Y14B 4K5VA 4OX9H 3VYTA 3K5LA 4R4IA 4R4CA 4F87A 1B9NA 1LABA 3L3OC 2DN8A 3KLSX 2HQEA 3BAAA 3GIJA 3I73A 1CSPA 5EQ0A 3PO3G 4BBRG 4A3LG 4B3SQ 3H40A 3WOFA 1N36L 2L4NA 1KXLA 4PDBA 3AQQA 3G8CA 3I4MH 1KEEA 1G2SA 1AE3A 1Y1WG 5L1KA 1NR2A 4KK7A 3M4OH 3K59A 1I4XA 1Y69U 5JVLA 5L1LA 2JA7B 4YY3H 5F2DA 5JPNC 2ZTDA 5C44G 4B3MQ 1I50H 4IZ8A 3BA8A 2NN6I 3KK7A 4DV4L 5IGBA 2AQ4A 2JEBI 1STBA 2QEXA 3OW2A 4FF1A 1WTPA 4KD3A 4KMUC 4HIDA 4ECZA 4A3EG 3H3VH 1WTHA 4IPDA 4POFA 1A63A 3HOXG 2HCIA 1X3EA 2CW0C 2E2HB 2OEOA 3HFZB 2DPIA 1B4OA 2F0VA 4JK1C 2R7MA 5EKLA 1W3SA 4O3NA 4J9MA 4I50F 1J5EQ 5E7NA 2VUMA 1FR3A 3F2BA 4G7ZC 4YB8B 4MTNA 1HUNA 1SYBA 4MA5A 3IN5A 1JB3A 2E5LH 5J2TF 2KENA 3MVVA 3AFPA 4MN3A 3VR2A 1LTSD 2PYKA 4OX9L 3GILA 1HNZQ 5CORA 4A3DH 2E74C 1PH6A 3OHXC 2JA6G 4BY1B 1X65A 3CHBD 3GIQA 4TSSA 2K01A 2W9CA 4NLGA 1RDPD 4PMWA 1VQKA 4BXXG 5CC4A 3EA6A 2NU9B 2D0OA 1CTMA 2AWOA 2L15A 4R1JA 2XGQA 2OH2A 3TMEA 1ML0D 1DOLA 4LFCH 4XTCS 4I4TF 4WD3A 1MHWC 2OTLA 3RZDH 3H3VI 3SK5A 2DLNA 1JE5A 1YNND 2MO1A 4O2AF 1WCMG 2YYZA 5H80A 1AN7A 1VQMA 1CS0A 4NP5A 3TIIA 1TWCA 3W3AA 5KFQA 5I6WA 2RDFA 2IMWP 5BN3A 1BF4A 2K33A 4YY3L 4LH7A 4XYLB 2PNRC 1BCPD 3Q8DA 3Q6SA 2W9BA 1JR0D 1WYDA 2MPMA 3TSSA 3PW4A 2VQEQ 4DV0H 3HOVH 1VQ7A 3PUYA 4J15A 2GA4B 4PZ8A 4ED6A 5L9XA 4MA0A 2AUJD 5KG7A 3AEVA 5IYCH 3FPPA 1JWUD 3V6JA 1KHIA 1FKAH 2K50A 4B9XA 3KFUA 2R7ZA 2W70A 3RB4A 1PHJA 4IOAA 1JOKA 1HNWL 4JW0A 1IKMA 2B2WC 4K2KA 2O03A 3GTOH 1BXRA 3ICEA 4A3KG 3R93A 3K5NA 2Z6BA 4JBMA 4E6IA 1SDFA 2VS1A 3U9TA 4IJLA 3M85A 4QF4A 2VPQA 3NELA 4X66Q 1PX2A 4ECXA 1IBMH 3RGXA 4EYHB 4UCVA 2NVTB 2VUMB 1U0LA 2ZXRA 1Y8NB 4LF7Q 3HOZG 3CCJA 4ZQIA 4F4YA 4HJ9A 1LTTD 2JSOA 5C8YF 2K5VA 4H44C 4LFCL 1LM0A 1XMQH 4LH6A 2RHQB 4JI3L 4OWTB 2QF7A 3AB9A 1H95A 1QWYA 3GIDA 5KNBA 5GADC 2W9CB 3KLWA 2OF1A 5IGCA 1SJHD 2R87A 3J81L 4A3FB 3U50C 5BN4A 1EUCB 4OWXB 4PQXA 1XDNA 1TWFA 4FBUA 3SVMA 2V59A 1CQIB 1VQFA 3MTSA 4U68A 5ELNA 4DV0L 4OEMB 4XQNA 2HHHH 3H20A 4E4TA 3CQZA 1I6HH 1TWCB 2G9HD 5IYBH 1VQCA 2DIKA 1F2MA 2CFMA 3V4ZA 3QOLA 1LT6D 1RTNA 4TV9F 2E76C 2W9BB 1RJPA 1K8OA 3PR5B 1N33H 3K7UC 4DKAC 4UCSA 5A2QW 1K0RA 5IGEA 3GTKA 2HT1A 1E4GT 3T5JA 4JV5Q 3U4VA 1N32H 5COYA 1BUVT 4IUTA 1Y8OB 3K3VA 4UCTA 5D8DA 1S0MA 1SNOA 1LTRD 2PNHA 5KFEA 2ZM6H 2W6MA 5DG9A 3I3CA 4L5TA 3UI2A 1OXUA 3JSNA 1BCPF 1G291 4BBRH 3PO3H 1IBML 2XCAA 2AGPA 2R7ZB 3GTPA 2B2YC 3OPOA 4HSPA 4YWMA 3I8ZA 5CBAE 3VPBA 5I2XA 4DL6A 4IR1A 4I7AA 5GQOA 1DONA 1LV9A 5FLXE 5KRUA 1Y1WH 1XMQL 4FU0A 1Q8KA 3EQLC 3H15A 1F2ZA 3LMLA 2XGTA 4DLKA 4B3SH 3QZ7A 2CW0D 3HP3A 5C5MA 3GTMA 4ETSA 1PRTC 3VA5A 5JAVA 3JSLA 2R7KA 3GTQA 5C44H 4ECTA 4LW1A 4DR3Q 1R9TA 5LMNQ 3K5OA 4IUVA 1X55A 4APMA 4F4ZA 2G5DA 4FXKC 2HHHL 2JP1A 4XQJA 4A3EH 4JBKA 3CPFA 2A5HA 1ZXTA 1O7ZA 4NXNQ 3LP8A 2ICEC 2AHOB 3DLLA 1S72A 3PO2B 4Q0FA 2O2LD 1XNRL 2KHJA 4RGNA 2FE3A 1ZHSA 1N33L 1TWFB 3KUPA 3MAQA 1JJ2A 3KF6A 4FBTA 1M4VA 1TT2A 1IL8A 3UDXA 4BBSG 3CQZB 1MD2D 2GVBA 4HIMA 3HOWG 1N32L 3DEPA 2YYAA 1K3BC 4P74A 3F8NA 2YS7A 5KFHA 3K0XA 5ELEA 1D5XC 4EQNA 2JA6H 2ZM6L 1AH9A 1J5EH 4CC6A 1CZWA 4BXXH 2K32A 4CDCC 3GTKB 2YRXA 4HQ6A 1BQQT 3M9BA 4DR5Q 3VR6A 1HRJA 1HNZH 4Q44A 2HIVA 4RKLA 5C4XG 3T1HQ 1EU3A 1ZKOA 5IT9E 2P0AA 4EG0A 1F2YA 1WCMH 2LXKA 4B3SL 1JDBB 1IYVA 1PFSA 4PMBA 2CHBD 1LYLA 2JEFA 2L5TA 2IX0A 4L5RC 3F8TA 1HCZA 3GTPB 4DR4Q 1KJIA 2R8IA 5JOBA 3GIPA 3R5HA 4A3MB 4Y7NH 4RB2C 4GKJQ 4J9LA 2R6FA 1YJ9A 3NWTA 4JOIA 1L0YB 3GTMB 4I7HA 1PH8A 1EQQA 3JZIA 2AQ1B 3GTQB 3X3NA 4MV4A 1UC8A 2VQEH 4KY7A 1R9TB 1OTCA 2ZDQA 3S15H 3CPWA 4YCWA 1B04A 1JDEA 4A93H 3KBGA 2KCCA 1HXYD 4C3HH 3CXCA 4JG2A 3V96A 2PBZA 1WTRA 2R7NA 3GV8B 2WE6A 4KHZA 1C3OA 3SGIA 4ZLTF 1CE8A 2KEEA 1PFNA 4WJ3M 2FB9A 3OSNA 4X3TA 4ZKBB 3GTGH 3GIIA 4Y8VB 1TAEA 3KF6B 1EIYB 1JORA 1JCKB 2NUCA 1K8MA 3HOZH 4EFEA 5IYDG 3I56A 3S1NH 1KDAA 1QUQA 2P5ZX 2I0QA 2QK4A 3Q8SB 4X66H 3ONAB 3OTOQ 1LTBD 1Q86C 3C3LA 5C1OA 3T1YQ 1VF5C 2NB0A 4LF7H 1CA6A 5I47A 3KALA 4GC6A 2WB1E 4GLVB 3GIMA 5J22A 2L11A 2ASJA 1TY0A 2WACA 4Q8FA 1JLLB 5EPLA 3IFTA 1M0WA 1N56A 4BA2I 4LF4Q 2UU9Q 2F0HA 2HJWA 2Y0SE 1M7JA 2NVXH 5M5XB 3RN5A 5I2YA 1MGSA 1JWSD 2AWNA 2NU8B 4IN3A 1E7ZA 4OIKA 2VQEL 2PPBC 4OO1H 3PW0A 1Q1EA 2B2TA 4DUZH 2CWPA 4C5AA 1HZCA 3I4NB 3W1BA 1EY9A 3NENA 1KBLA 3NK9A 1TA8A 4DL4A 1NAPA 3EBEA 1K83A 2BQ3A 1SEBD 1NJIC 3M4QA 1RK5A 2EYMA 4F4XA 1TWGH 1YVCA 2L0CA 3UDIA 2W57A 3TQ1A 1D1IA 5G3LD 3TZDA 1PRTD 4DR7Q 1DCZA 3RJ0A 4JV5H 1TQOA 3W1GA 2F52A 4ECWA 1UE7A 3BQ0A 1HQRD 4DV2L 1H9MA 1E2WA 1HTPA 5BMVF 1II3A 4LNQA 4X66L 2WIIB 1XPRA 4LF7L 4OO1I 1FL0A 3G48A 3HGBA 3J80E 1HR0Q 1TIID 1JX4A 4HR7A 1ASZA 1GSAA 1JJGA 2E2DC 4C3JB 3PIO3 4X65H 1QUQB 2Z1CA 3S17B 3N40P 2JA7G 4X62Q 1K8AC 3C2PA 1A15A 2JXMB 3K81C 4C2MH 5L1IA 1V8QA 4O1NA
chains in the Genus database with same CATH topology
2Q2HA 1Q46A 4DK3C 4YHHQ 2R93H 1JT8A 1SN8A 2B3GA 2IX1A 1D8LA 5GAGC 5K36G 3D0FA 2AKWB 3STBD 3CC7A 3CMAA 4DR5Q 2NZHA 4R4OA 3A74A 2CCZA 1UE1A 4DUZL 2VZAA 2LXJA 1K3RA 4OXPA 1PH5A 4BBSH 4YCUA 2UUBL 2IHEA 1E3PA 2WB1G 3CCSA 4BA1I 3HOWH 2MQHA 1UE5A 5M5XH 1QVGA 3CC2A 1B8AA 4JBJA 2ZTEA 3KJOA 4LF5L 1WFQA 4JI8Q 3RZOH 1YBYA 3JC66 4GN4B 1VQ8A 3S1QH 4AYBE 5JJKA 5M5YH 4JV5L 4DR2L 3PIPA 3KDFA 2Y0SG 4IFDG 1WOCA 4B3ML 3FKIG 1GVPA 4IPHA 3I4NH 5C0XI 3OYYA 3RLFA 5C4XH 4BY1G 1BKBA 2Z6KC 1IBKL 1X6OA 1PVOA 1D7QA 1PH1A 3ULJA 1GD7A 4DV1Q 4LF8L 4DV2Q 5HGQA 1C9OA 2D62A 1U5KA 4KLKA 1VQDA 4B3TL 1HJPA 4IOCA 2VL6A 5FLXc 1L1OB 2JQOA 3KJPA 1N33Q 4JI6Q 1JB7A 4AQYL 4R4QA 1X56A 2UXDL 1Q1BA 3CC4A 1S3OA 2Q2TA 4X65L 1Q12A 3TQYA 1LTLA 2K5NA 1MKHA 2EQSA 5IYBG 3S1RH 1J5EL 1JMCA 3I4MG 1HZAA 4QL5A 4APVA 1PYSB 2YTVA 1IBLQ 1V1QA 1OXXK 2ZM6Q 2OQKA 1HNZL 4DR3L 3RLNA 4GN5A 1HZBA 3CQZH 4P72A 4A75A 2A8VA 3PUZA 1EIFA 1Y14B 4GOPC 1G51A 1Z47A 4R4CA 4R4IA 4C3JH 3S17H 1VCIA 3ER0A 3F2DA 1MIUA 5LMUQ 4Y52H 1N9WA 1CSPA 1Y1VG 2ALYB 4LUVA 2GN5A 1PV4A 1EUJA 4BBRG 3PO3G 4A3LG 4B3SQ 1E1TA 1SRUA 4JCVE 3A5ZB 2OQ0A 2Q2IA 1VQNA 4DUZQ 3S2DH 4GN3B 1N36L 1VQPA 4LF6Q 4BY7G 1KXLA 1BBUA 1QVCA 3CCVA 3AQQA 3I4MH 3KOJA 3I2ZA 1L0WA 1HNXQ 2UXCL 5LMNW 2UUBQ 1AE3A 1Y1WG 3PUWA 1C0AA 1XPOA 3M4OH 4LF5Q 5IYDH 5C3EG 2I5MX 5ELOA 2VQFL 1I3QH 3PGZA 1XNQL 1PH9A 1KRTA 4DR2Q 2IY5B 4X64L 2ZTDA 4JYAL 5M3FG 5C44G 4B3MQ 2B63H 1I50H 1PA6A 4A3DG 2BH8A 3K80C 2NN6I 5BR8L 4DV4L 4DR5L 3CCLA 2JEBI 1J6QA 3MEFA 4AH6A 3U58A 5IT9c 1IBKQ 2QEXA 3KDFB 3T1HL 2F4VL 1Y1VH 3OW2A 4A3LH 1K83H 4HIDA 3L7ZC 4LWCA 1SR3A 3LGJA 1YHBA 4A3EG 3RLOA 3H3VH 4JI7Q 4IPDA 4POFA 3GTQH 1A63A 3HOXG 2EIFA 2ID0A 2KBNA 4BY7H 4IFDJ 3AFQA 1X3EA 4A3BH 4A3GG 3HFZB 4EX5A 4AYBG 4AQYQ 4A3FG 2D0PA 4DV5L 1W3SA 3L2PA 2UXDQ 1P16A 3BZKA 1YNXA 2CKZB 1GO3E 2V1CC 3KF8B 5E7NA 4X65Q 3GTJH 2QA4A 2Z6KA 3G6EA 3F2BA 1J5EQ 2ES2A 4GKJL 4MTNA 1DGSA 4DAYB 1K8GA 3BU2A 2KENA 1N34L 3AFPA 3RN2A 4OX9L 4HIKA 1QZHA 3HOUG 2E8GA 3UDFA 1HNZQ 3PUXA 3ULPA 4A3DH 4DR1Q 4B3RQ 1PH6A 2JA6G 3HOVG 1X65A 1I94L 1A0IA 4PMWA 1VQKA 4BXXG 2D0OA 1NMFA 2AWOA 2KCTA 2L15A 4R1JA 1KL9A 3CF5A 2JEAI 1PYBA 1IXRA 3JAMi 1VQIA 3HOXH 4GKKQ 5IYCG 4XTCS 2R6GA 1SROA 2OTLA 3RZDH 3H3VI 1JE5A 2MO1A 2N49A 2WAQE 1WCMG 2YYZA 1N36Q 3MXNB 1VQMA 2E2IH 3I55A 1OXTA 2N8NA 3ZJYC 1B70B 1YHQA 3E9HA 2EXDA 4YY3L 4GOPA 2R7ZG 3I7FA 4JI0L 3Q8DA 2GVAA 3L0OA 1WYDA 5M3MG 2IHFA 4LFAQ 4HJ7A 3VDYA 4HJ5A 2VQEQ 3HOVH 1VQ7A 1XNQQ 3PUYA 4MNOA 2A1AA 2JK8A 4J15A 4X64Q 4PZ8A 4JYAQ 4HIOA 3OTOL 2VNUD 5AJ3L 1YEZA 4A3CG 2MO0A 1CKOA 3B6YA 3AEVA 4OWWB 2OTJA 3FP9A 2JA7H 4DV6L 2FXQA 5IYCH 3J81i 1X3GA 1KHIA 1RL2A 1VQHA 2JA5H 2K50A 3KFUA 1P8LA 4LF9L 3KYHC 1PHJA 4IOAA 1HNWL 2JJQA 3IRBA 4JI5L 3PIOA 3UDGA 2UUCQ 3GTOH 2LSSA 2PQAA 5IE8A 1AE2A 4A3KG 1SE8A 3ICEA 4JBMA 1VQJA 2H5XA 2VS1A 3PCOB 2YV5A 5HY6A 2K52A 3A0JA 5IP9G 1XJVA 2UU9L 1X54A 4IJLA 3GDEA 3M85A 3S24A 1XMOL 1WI5A 3I4OA 2E2HH 3S14H 2N3SA 1M90C 3NELA 4X66Q 3EN2A 1Q81C 1MJEA 3PO2G 4UY8C 1N34Q 2PI2A 1K73C 1NY4A 1FGUA 1U0LA 3CAMA 4DPGA 4LF7Q 3HOZG 3D31A 4GLAC 3CCJA 4JI4Q 4HJ9A 1G6PA 1KAWA 2K5VA 3PSIA 4PZ7A 4LFCL 2R92G 1OXVA 1LM0A 4DNIA 5IY0A 2RHQB 4JI3L 2DUDA 4UPAA 4OWTB 3FKIH 2JA8G 1EYGA 2XTIA 1H95A 4JI2L 1VQGA 5GADC 1YJWA 3KLWA 4P73A 5LMNL 4BY1H 4UP8A 4JI1L 2QGQA 2WFWA 4NPSA 4A3KH 4A3IG 1YJNA 2A19A 2UUAL 3U50C 1SLJA 2JA9A 1SMXA 4OWXB 3M3YH 4NXNL 1VQFA 5ELNA 1W2BA 1MJCA 4DV0L 4YY3Q 1VQ5A 2K75A 4DV7L 4L5SA 4JI0Q 1VQ6A 2IT1A 1I6HH 1QVFA 5IYBH 1VQCA 4DR6L 2CFMA 4TVAB 2PI2E 4GOPB 3J81j 4DAMA 3J80c 4A3MG 3H0GG 4JC0A 5AJ3Q 3K7UC 2WAQG 4DKAC 4LFBL 2Z0SA 2KCMA 1K0RA 1Q7YC 2HT1A 1NMGA 1VQEA 4DV6Q 4JV5Q 2ASBA 2NVYH 4TQUS 3U4VA 4X62L 4IFDI 1JJCB 2VUMG 2VW9A 1PH7A 4RMFA 5EAYA 1VQLA 1KQSA 4LF9Q 2NVQH 2PNHA 3JAMc 1HNWQ 4JI5Q 3CCUA 4NB3A 4L5TA 1OXUA 4JOIC 1G291 4BBRH 3PO3H 4NXML 1IBML 3CD6A 3FHWA 3TS2A 4LF8Q 4ALPA 3AYHB 5C4JH 1WJJA 2RHSB 3CP0A 1HR0W 4B3TQ 1YZ6A 4X6AH 4YWMA 1XMOQ 2Q2UA 2PQAB 1CUKA 4IJHA 3A5UA 5GQOA 4KHPL 1VQ4A 1HZ9A 1E1OA 4DR4L 4FDBA 3GO5A 1Y1WH 1XMQL 2YU9H 1GM5A 1Q8KA 3H15A 3RR5A 2XGTA 5C3EH 1E22A 3HOYG 3EIVA 5IP7G 3HKSA 3J80i 4JI8L 3NBHB 1EQRA 4JI3Q 2NVTH 5M3FH 5C44H 4DUYL 2VUMH 4LW1A 4DR3Q 3J7A5 4JI2Q 3GTLH 3PF4A 2C35B 5LMNQ 3BJUA 1V9PA 2B29A 1X55A 5C0XG 3J81c 3PV0A 4A76A 4IO9A 2HHHL 4A3EH 4QJFA 1UEBA 3CPFA 4A3JG 4JBKA 1V43A 4NXNQ 1UWVA 3ULLA 2AHOB 3DLLA 1S72A 4A3GH 4GNXC 1EOVA 4A3FH 2RF4A 2KHJA 1XNRL 3GD7A 2JE6I 1N33L 4JI6L 1JJ2A 3K8AA 2BA1A 1O7IA 4DR6Q 1FVIA 2YTYA 3KF6A 3TS0A 2ATWA 2UXCQ 3UDXA 5IP7H 4BBSG 4K0KL 1VS0A 2GVBA 1B7YB 4HIMA 2BH2A 3HOWG 1N32L 1HH2P 3HOUH 1TWCH 4P74A 1IBLL 4LFBQ 1OXSC 2VQFQ 5JEAG 5GAHC 3K0XA 2OCEA 1AH9A 2JA6H 1YHAA 3E0EA 4O2DA 2ZM6L 5H1SE 1YITA 3CCQA 1FJGL 3UE1A 4BXXH 5GAEC 3T1YL 2I5HA 2WP8J 3CW2C 3BZCA 1EWIA 3M9BA 4OONA 3STBC 3UE0A 5BR8Q 4AIMA 2VY3A 2HIVA 5GROA 3J7ZC 2ZJPA 5LMUL 5C4XG 1LUZA 4QGUA 3T1HQ 2F4VQ 4P75A 1EFWA 1IBMQ 4NXMQ 4PG3A 1CKMA 4UP9A 2F3IA 1WCMH 2LXKA 1CSQA 4C3IH 1Q82C 4B3SL 1PFSA 1PH2A 2OWOA 4O0AA 1LYLA 2IX0A 4GLXA 4L5RC 3F8TA 4LF6L 2E5LL 4DR4Q 4KHPQ 4A93G 1BBWA 1TWAH 2R7ZH 4DV5Q 4LF4L 1XMQQ 1HNXL 4LUZA 1TXYA 4Y7NH 4GKJQ 5M3MH 1XPUA 1YJ9A 2HIXA 4UP7A 4JOIA 3WWVA 4DV4Q 4OX9Q 5J3BA 5DLQE 4DUYQ 1XTDA 4A3CH 1L1OC 1PH8A 3ERSX 1EQQA 1I94Q 3M4PA 4IPGA 1ASYA 2NN6G 1M1KC 1IL2A 1IZ6A 5IWAL 2HHHQ 4HJAA 1OTCA 4DR7L 2UXBL 3S15H 1PH4A 4JI7L 3CPWA 4WJ4A 4YCWA 3HKZE 4A93H 1XNRQ 3G4SA 5IP9H 4C3HH 5C0XJ 1KC8C 3CXCA 4JG2A 4YWLA 1GKHA 1CKNA 4KHZA 3W5OA 3I4NG 1NE3A 3SGIA 3S2HH 3PO2H 4K0KQ 2MFIA 2ZTCA 4WJ3M 4R4TA 2PMZE 1N32Q 3GTGH 2RCNA 5FLMG 1TWFH 4DK6C 1K9MC 3KF6B 1Z9FA 1EIYB 2R7DA 3HOZH 5IYDG 3I56A 4HJ8A 3S1NH 1L2FA 2DGYA 4PZ6A 4EQ5A 2K14A 1QUQA 4IPCA 1VQBA 4GNXA 4DR1L 2YTXA 1YIJA 2I0QA 1FJGQ 2R92H 4B3RL 4OO1G 3OTOQ 1HR0L 1Q86C 5JJLA 2K4KA 3T1YQ 2JA8H 2B63G 1VQAA 3F1ZA 1I5FA 1A8VA 4QIWE 4GKKL 5JEAJ 3TEHB 4DV3L 5M5WH 4A3IH 2WB1E 4GLVB 1KRSA 5FJ8G 3PF5A 3GTKH 4LUOA 1S40A 3CMEA 4YHHL 1BVSA 1RIPA 3PUVA 3S1MH 4A3BG 2E5LQ 3TRZA 2I5LX 4BA2I 4QY7A 4LF4Q 1C7YA 2UU9Q 1KD1C 2Y0SE 5FLMH 1PH3A 2NVXH 3RN5A 3G71A 1QZGA 4LFAL 2E2JH 4POGA 3GTPH 2AWNA 2VQEL 1E7ZA 4QQBX 4A3MH 3CCRA 3H0GH 3E9IA 1Q1EA 2CWPA 1HZCA 3U4ZA 3W1BA 4JBWA 3NENA 3EBEA 4LFCQ 4RG1A 2BA0A 3TREA 1NJIC 3M4QA 3GTMH 4P71A 5IWAQ 1TWGH 1YVCA 4L5QA 1UE6A 2CWAA 3UDIA 5FJ8H 3CCEA 1KIXA 1VQ9A 2NZOA 4DR7Q 3NEMA 2UXBQ 4GS3A 1SFOH 4JI1Q 4ME3A 1X3FA 3CCMA 3M7NA 2UUAQ 2UUCL 1R9TH 3W1GA 2MNAA 1L1OA 3RNUA 2F52A 1UE7A 4DV1L 2R93G 2HQLA 4YCVA 4DV2L 1YI2A 2N78A 4DV0Q 1X9NA 2KHIA 4DV7Q 2AMCB 4LNQA 4X66L 1VQOA 4H02A 4XIGS 1CKNB 1XPRA 3DM3A 1E24A 1TWHH 4LF7L 3HOYH 4A4IA 1A62A 1FL0A 3G48A 4JI4L 4OO1I 3HKZG 3K7AH 3F2CA 1HR0Q 4YWKA 2K5HA 2R7FA 1ASZA 1NBWA 1IYJB 2CQOA 1N8RC 5JJIA 1JJGA 1QUQB 2ZJQA 4GNXB 2JA7G 4X62Q 1K8AC 3S16H 4DV3Q 2ZJRA 1NTGA 4KI0A 1T9HA 3K81C 4MZ9A 2JA5G 4C2MH 4A3JH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2H A;  1Q46 A;  4DK3 C;  4YHH Q;  2R93 H;  1JT8 A;  1SN8 A;  2B3G A;  2IX1 A;  1D8L A;  5GAG C;  5K36 G;  3D0F A;  2AKW B;  3STB D;  3CC7 A;  3CMA A;  4DR5 Q;  2NZH A;  4R4O A;  3A74 A;  2CCZ A;  1UE1 A;  4DUZ L;  2VZA A;  2LXJ A;  1K3R A;  4OXP A;  1PH5 A;  4BBS H;  4YCU A;  2UUB L;  2IHE A;  1E3P A;  2WB1 G;  3CCS A;  4BA1 I;  3HOW H;  2MQH A;  1UE5 A;  5M5X H;  1QVG A;  3CC2 A;  1B8A A;  4JBJ A;  2ZTE A;  3KJO A;  4LF5 L;  1WFQ A;  4JI8 Q;  3RZO H;  1YBY A;  3JC6 6;  4GN4 B;  1VQ8 A;  3S1Q H;  4AYB E;  5JJK A;  5M5Y H;  4JV5 L;  4DR2 L;  3PIP A;  3KDF A;  2Y0S G;  4IFD G;  1WOC A;  4B3M L;  3FKI G;  1GVP A;  4IPH A;  3I4N H;  5C0X I;  3OYY A;  3RLF A;  5C4X H;  4BY1 G;  1BKB A;  2Z6K C;  1IBK L;  1X6O A;  1PVO A;  1D7Q A;  1PH1 A;  3ULJ A;  1GD7 A;  4DV1 Q;  4LF8 L;  4DV2 Q;  5HGQ A;  1C9O A;  2D62 A;  1U5K A;  4KLK A;  1VQD A;  4B3T L;  1HJP A;  4IOC A;  2VL6 A;  5FLX c;  1L1O B;  2JQO A;  3KJP A;  1N33 Q;  4JI6 Q;  1JB7 A;  4AQY L;  4R4Q A;  1X56 A;  2UXD L;  1Q1B A;  3CC4 A;  1S3O A;  2Q2T A;  4X65 L;  1Q12 A;  3TQY A;  1LTL A;  2K5N A;  1MKH A;  2EQS A;  5IYB G;  3S1R H;  1J5E L;  1JMC A;  3I4M G;  1HZA A;  4QL5 A;  4APV A;  1PYS B;  2YTV A;  1IBL Q;  1V1Q A;  1OXX K;  2ZM6 Q;  2OQK A;  1HNZ L;  4DR3 L;  3RLN A;  4GN5 A;  1HZB A;  3CQZ H;  4P72 A;  4A75 A;  2A8V A;  3PUZ A;  1EIF A;  1Y14 B;  4GOP C;  1G51 A;  1Z47 A;  4R4C A;  4R4I A;  4C3J H;  3S17 H;  1VCI A;  3ER0 A;  3F2D A;  1MIU A;  5LMU Q;  4Y52 H;  1N9W A;  1CSP A;  1Y1V G;  2ALY B;  4LUV A;  2GN5 A;  1PV4 A;  1EUJ A;  4BBR G;  3PO3 G;  4A3L G;  4B3S Q;  1E1T A;  1SRU A;  4JCV E;  3A5Z B;  2OQ0 A;  2Q2I A;  1VQN A;  4DUZ Q;  3S2D H;  4GN3 B;  1N36 L;  1VQP A;  4LF6 Q;  4BY7 G;  1KXL A;  1BBU A;  1QVC A;  3CCV A;  3AQQ A;  3I4M H;  3KOJ A;  3I2Z A;  1L0W A;  1HNX Q;  2UXC L;  5LMN W;  2UUB Q;  1AE3 A;  1Y1W G;  3PUW A;  1C0A A;  1XPO A;  3M4O H;  4LF5 Q;  5IYD H;  5C3E G;  2I5M X;  5ELO A;  2VQF L;  1I3Q H;  3PGZ A;  1XNQ L;  1PH9 A;  1KRT A;  4DR2 Q;  2IY5 B;  4X64 L;  2ZTD A;  4JYA L;  5M3F G;  5C44 G;  4B3M Q;  2B63 H;  1I50 H;  1PA6 A;  4A3D G;  2BH8 A;  3K80 C;  2NN6 I;  5BR8 L;  4DV4 L;  4DR5 L;  3CCL A;  2JEB I;  1J6Q A;  3MEF A;  4AH6 A;  3U58 A;  5IT9 c;  1IBK Q;  2QEX A;  3KDF B;  3T1H L;  2F4V L;  1Y1V H;  3OW2 A;  4A3L H;  1K83 H;  4HID A;  3L7Z C;  4LWC A;  1SR3 A;  3LGJ A;  1YHB A;  4A3E G;  3RLO A;  3H3V H;  4JI7 Q;  4IPD A;  4POF A;  3GTQ H;  1A63 A;  3HOX G;  2EIF A;  2ID0 A;  2KBN A;  4BY7 H;  4IFD J;  3AFQ A;  1X3E A;  4A3B H;  4A3G G;  3HFZ B;  4EX5 A;  4AYB G;  4AQY Q;  4A3F G;  2D0P A;  4DV5 L;  1W3S A;  3L2P A;  2UXD Q;  1P16 A;  3BZK A;  1YNX A;  2CKZ B;  1GO3 E;  2V1C C;  3KF8 B;  5E7N A;  4X65 Q;  3GTJ H;  2QA4 A;  2Z6K A;  3G6E A;  3F2B A;  1J5E Q;  2ES2 A;  4GKJ L;  4MTN A;  1DGS A;  4DAY B;  1K8G A;  3BU2 A;  2KEN A;  1N34 L;  3AFP A;  3RN2 A;  4OX9 L;  4HIK A;  1QZH A;  3HOU G;  2E8G A;  3UDF A;  1HNZ Q;  3PUX A;  3ULP A;  4A3D H;  4DR1 Q;  4B3R Q;  1PH6 A;  2JA6 G;  3HOV G;  1X65 A;  1I94 L;  1A0I A;  4PMW A;  1VQK A;  4BXX G;  2D0O A;  1NMF A;  2AWO A;  2KCT A;  2L15 A;  4R1J A;  1KL9 A;  3CF5 A;  2JEA I;  1PYB A;  1IXR A;  3JAM i;  1VQI A;  3HOX H;  4GKK Q;  5IYC G;  4XTC S;  2R6G A;  1SRO A;  2OTL A;  3RZD H;  3H3V I;  1JE5 A;  2MO1 A;  2N49 A;  2WAQ E;  1WCM G;  2YYZ A;  1N36 Q;  3MXN B;  1VQM A;  2E2I H;  3I55 A;  1OXT A;  2N8N A;  3ZJY C;  1B70 B;  1YHQ A;  3E9H A;  2EXD A;  4YY3 L;  4GOP A;  2R7Z G;  3I7F A;  4JI0 L;  3Q8D A;  2GVA A;  3L0O A;  1WYD A;  5M3M G;  2IHF A;  4LFA Q;  4HJ7 A;  3VDY A;  4HJ5 A;  2VQE Q;  3HOV H;  1VQ7 A;  1XNQ Q;  3PUY A;  4MNO A;  2A1A A;  2JK8 A;  4J15 A;  4X64 Q;  4PZ8 A;  4JYA Q;  4HIO A;  3OTO L;  2VNU D;  5AJ3 L;  1YEZ A;  4A3C G;  2MO0 A;  1CKO A;  3B6Y A;  3AEV A;  4OWW B;  2OTJ A;  3FP9 A;  2JA7 H;  4DV6 L;  2FXQ A;  5IYC H;  3J81 i;  1X3G A;  1KHI A;  1RL2 A;  1VQH A;  2JA5 H;  2K50 A;  3KFU A;  1P8L A;  4LF9 L;  3KYH C;  1PHJ A;  4IOA A;  1HNW L;  2JJQ A;  3IRB A;  4JI5 L;  3PIO A;  3UDG A;  2UUC Q;  3GTO H;  2LSS A;  2PQA A;  5IE8 A;  1AE2 A;  4A3K G;  1SE8 A;  3ICE A;  4JBM A;  1VQJ A;  2H5X A;  2VS1 A;  3PCO B;  2YV5 A;  5HY6 A;  2K52 A;  3A0J A;  5IP9 G;  1XJV A;  2UU9 L;  1X54 A;  4IJL A;  3GDE A;  3M85 A;  3S24 A;  1XMO L;  1WI5 A;  3I4O A;  2E2H H;  3S14 H;  2N3S A;  1M90 C;  3NEL A;  4X66 Q;  3EN2 A;  1Q81 C;  1MJE A;  3PO2 G;  4UY8 C;  1N34 Q;  2PI2 A;  1K73 C;  1NY4 A;  1FGU A;  1U0L A;  3CAM A;  4DPG A;  4LF7 Q;  3HOZ G;  3D31 A;  4GLA C;  3CCJ A;  4JI4 Q;  4HJ9 A;  1G6P A;  1KAW A;  2K5V A;  3PSI A;  4PZ7 A;  4LFC L;  2R92 G;  1OXV A;  1LM0 A;  4DNI A;  5IY0 A;  2RHQ B;  4JI3 L;  2DUD A;  4UPA A;  4OWT B;  3FKI H;  2JA8 G;  1EYG A;  2XTI A;  1H95 A;  4JI2 L;  1VQG A;  5GAD C;  1YJW A;  3KLW A;  4P73 A;  5LMN L;  4BY1 H;  4UP8 A;  4JI1 L;  2QGQ A;  2WFW A;  4NPS A;  4A3K H;  4A3I G;  1YJN A;  2A19 A;  2UUA L;  3U50 C;  1SLJ A;  2JA9 A;  1SMX A;  4OWX B;  3M3Y H;  4NXN L;  1VQF A;  5ELN A;  1W2B A;  1MJC A;  4DV0 L;  4YY3 Q;  1VQ5 A;  2K75 A;  4DV7 L;  4L5S A;  4JI0 Q;  1VQ6 A;  2IT1 A;  1I6H H;  1QVF A;  5IYB H;  1VQC A;  4DR6 L;  2CFM A;  4TVA B;  2PI2 E;  4GOP B;  3J81 j;  4DAM A;  3J80 c;  4A3M G;  3H0G G;  4JC0 A;  5AJ3 Q;  3K7U C;  2WAQ G;  4DKA C;  4LFB L;  2Z0S A;  2KCM A;  1K0R A;  1Q7Y C;  2HT1 A;  1NMG A;  1VQE A;  4DV6 Q;  4JV5 Q;  2ASB A;  2NVY H;  4TQU S;  3U4V A;  4X62 L;  4IFD I;  1JJC B;  2VUM G;  2VW9 A;  1PH7 A;  4RMF A;  5EAY A;  1VQL A;  1KQS A;  4LF9 Q;  2NVQ H;  2PNH A;  3JAM c;  1HNW Q;  4JI5 Q;  3CCU A;  4NB3 A;  4L5T A;  1OXU A;  4JOI C;  1G29 1;  4BBR H;  3PO3 H;  4NXM L;  1IBM L;  3CD6 A;  3FHW A;  3TS2 A;  4LF8 Q;  4ALP A;  3AYH B;  5C4J H;  1WJJ A;  2RHS B;  3CP0 A;  1HR0 W;  4B3T Q;  1YZ6 A;  4X6A H;  4YWM A;  1XMO Q;  2Q2U A;  2PQA B;  1CUK A;  4IJH A;  3A5U A;  5GQO A;  4KHP L;  1VQ4 A;  1HZ9 A;  1E1O A;  4DR4 L;  4FDB A;  3GO5 A;  1Y1W H;  1XMQ L;  2YU9 H;  1GM5 A;  1Q8K A;  3H15 A;  3RR5 A;  2XGT A;  5C3E H;  1E22 A;  3HOY G;  3EIV A;  5IP7 G;  3HKS A;  3J80 i;  4JI8 L;  3NBH B;  1EQR A;  4JI3 Q;  2NVT H;  5M3F H;  5C44 H;  4DUY L;  2VUM H;  4LW1 A;  4DR3 Q;  3J7A 5;  4JI2 Q;  3GTL H;  3PF4 A;  2C35 B;  5LMN Q;  3BJU A;  1V9P A;  2B29 A;  1X55 A;  5C0X G;  3J81 c;  3PV0 A;  4A76 A;  4IO9 A;  2HHH L;  4A3E H;  4QJF A;  1UEB A;  3CPF A;  4A3J G;  4JBK A;  1V43 A;  4NXN Q;  1UWV A;  3ULL A;  2AHO B;  3DLL A;  1S72 A;  4A3G H;  4GNX C;  1EOV A;  4A3F H;  2RF4 A;  2KHJ A;  1XNR L;  3GD7 A;  2JE6 I;  1N33 L;  4JI6 L;  1JJ2 A;  3K8A A;  2BA1 A;  1O7I A;  4DR6 Q;  1FVI A;  2YTY A;  3KF6 A;  3TS0 A;  2ATW A;  2UXC Q;  3UDX A;  5IP7 H;  4BBS G;  4K0K L;  1VS0 A;  2GVB A;  1B7Y B;  4HIM A;  2BH2 A;  3HOW G;  1N32 L;  1HH2 P;  3HOU H;  1TWC H;  4P74 A;  1IBL L;  4LFB Q;  1OXS C;  2VQF Q;  5JEA G;  5GAH C;  3K0X A;  2OCE A;  1AH9 A;  2JA6 H;  1YHA A;  3E0E A;  4O2D A;  2ZM6 L;  5H1S E;  1YIT A;  3CCQ A;  1FJG L;  3UE1 A;  4BXX H;  5GAE C;  3T1Y L;  2I5H A;  2WP8 J;  3CW2 C;  3BZC A;  1EWI A;  3M9B A;  4OON A;  3STB C;  3UE0 A;  5BR8 Q;  4AIM A;  2VY3 A;  2HIV A;  5GRO A;  3J7Z C;  2ZJP A;  5LMU L;  5C4X G;  1LUZ A;  4QGU A;  3T1H Q;  2F4V Q;  4P75 A;  1EFW A;  1IBM Q;  4NXM Q;  4PG3 A;  1CKM A;  4UP9 A;  2F3I A;  1WCM H;  2LXK A;  1CSQ A;  4C3I H;  1Q82 C;  4B3S L;  1PFS A;  1PH2 A;  2OWO A;  4O0A A;  1LYL A;  2IX0 A;  4GLX A;  4L5R C;  3F8T A;  4LF6 L;  2E5L L;  4DR4 Q;  4KHP Q;  4A93 G;  1BBW A;  1TWA H;  2R7Z H;  4DV5 Q;  4LF4 L;  1XMQ Q;  1HNX L;  4LUZ A;  1TXY A;  4Y7N H;  4GKJ Q;  5M3M H;  1XPU A;  1YJ9 A;  2HIX A;  4UP7 A;  4JOI A;  3WWV A;  4DV4 Q;  4OX9 Q;  5J3B A;  5DLQ E;  4DUY Q;  1XTD A;  4A3C H;  1L1O C;  1PH8 A;  3ERS X;  1EQQ A;  1I94 Q;  3M4P A;  4IPG A;  1ASY A;  2NN6 G;  1M1K C;  1IL2 A;  1IZ6 A;  5IWA L;  2HHH Q;  4HJA A;  1OTC A;  4DR7 L;  2UXB L;  3S15 H;  1PH4 A;  4JI7 L;  3CPW A;  4WJ4 A;  4YCW A;  3HKZ E;  4A93 H;  1XNR Q;  3G4S A;  5IP9 H;  4C3H H;  5C0X J;  1KC8 C;  3CXC A;  4JG2 A;  4YWL A;  1GKH A;  1CKN A;  4KHZ A;  3W5O A;  3I4N G;  1NE3 A;  3SGI A;  3S2H H;  3PO2 H;  4K0K Q;  2MFI A;  2ZTC A;  4WJ3 M;  4R4T A;  2PMZ E;  1N32 Q;  3GTG H;  2RCN A;  5FLM G;  1TWF H;  4DK6 C;  1K9M C;  3KF6 B;  1Z9F A;  1EIY B;  2R7D A;  3HOZ H;  5IYD G;  3I56 A;  4HJ8 A;  3S1N H;  1L2F A;  2DGY A;  4PZ6 A;  4EQ5 A;  2K14 A;  1QUQ A;  4IPC A;  1VQB A;  4GNX A;  4DR1 L;  2YTX A;  1YIJ A;  2I0Q A;  1FJG Q;  2R92 H;  4B3R L;  4OO1 G;  3OTO Q;  1HR0 L;  1Q86 C;  5JJL A;  2K4K A;  3T1Y Q;  2JA8 H;  2B63 G;  1VQA A;  3F1Z A;  1I5F A;  1A8V A;  4QIW E;  4GKK L;  5JEA J;  3TEH B;  4DV3 L;  5M5W H;  4A3I H;  2WB1 E;  4GLV B;  1KRS A;  5FJ8 G;  3PF5 A;  3GTK H;  4LUO A;  1S40 A;  3CME A;  4YHH L;  1BVS A;  1RIP A;  3PUV A;  3S1M H;  4A3B G;  2E5L Q;  3TRZ A;  2I5L X;  4BA2 I;  4QY7 A;  4LF4 Q;  1C7Y A;  2UU9 Q;  1KD1 C;  2Y0S E;  5FLM H;  1PH3 A;  2NVX H;  3RN5 A;  3G71 A;  1QZG A;  4LFA L;  2E2J H;  4POG A;  3GTP H;  2AWN A;  2VQE L;  1E7Z A;  4QQB X;  4A3M H;  3CCR A;  3H0G H;  3E9I A;  1Q1E A;  2CWP A;  1HZC A;  3U4Z A;  3W1B A;  4JBW A;  3NEN A;  3EBE A;  4LFC Q;  4RG1 A;  2BA0 A;  3TRE A;  1NJI C;  3M4Q A;  3GTM H;  4P71 A;  5IWA Q;  1TWG H;  1YVC A;  4L5Q A;  1UE6 A;  2CWA A;  3UDI A;  5FJ8 H;  3CCE A;  1KIX A;  1VQ9 A;  2NZO A;  4DR7 Q;  3NEM A;  2UXB Q;  4GS3 A;  1SFO H;  4JI1 Q;  4ME3 A;  1X3F A;  3CCM A;  3M7N A;  2UUA Q;  2UUC L;  1R9T H;  3W1G A;  2MNA A;  1L1O A;  3RNU A;  2F52 A;  1UE7 A;  4DV1 L;  2R93 G;  2HQL A;  4YCV A;  4DV2 L;  1YI2 A;  2N78 A;  4DV0 Q;  1X9N A;  2KHI A;  4DV7 Q;  2AMC B;  4LNQ A;  4X66 L;  1VQO A;  4H02 A;  4XIG S;  1CKN B;  1XPR A;  3DM3 A;  1E24 A;  1TWH H;  4LF7 L;  3HOY H;  4A4I A;  1A62 A;  1FL0 A;  3G48 A;  4JI4 L;  4OO1 I;  3HKZ G;  3K7A H;  3F2C A;  1HR0 Q;  4YWK A;  2K5H A;  2R7F A;  1ASZ A;  1NBW A;  1IYJ B;  2CQO A;  1N8R C;  5JJI A;  1JJG A;  1QUQ B;  2ZJQ A;  4GNX B;  2JA7 G;  4X62 Q;  1K8A C;  3S16 H;  4DV3 Q;  2ZJR A;  1NTG A;  4KI0 A;  1T9H A;  3K81 C;  4MZ9 A;  2JA5 G;  4C2M H;  4A3J H; 
#chains in the Genus database with same CATH topology
 1J9O A;  2EPB A;  3EVQ A;  3S2D B;  2R93 H;  4DR3 H;  2QDL A;  3GV6 A;  2IX1 A;  3I4L A;  5FO9 B;  1HHV A;  1D8L A;  3A55 A;  5GAG C;  5K36 G;  4QW9 A;  3H4D A;  3D6C A;  3CC7 A;  3CMA A;  2W7O A;  1DYQ A;  2YZM A;  5KFT A;  2KED A;  4DUZ L;  3ND8 A;  4LMY A;  2FIN B;  5KYI A;  4BBS H;  5DNF A;  4JV0 A;  3HOW H;  2MQH A;  1QVG A;  3CC2 A;  2JA5 A;  4JBJ A;  3KJO A;  1WFQ A;  4YR0 A;  5E4W C;  4KKS A;  3G6V A;  4IAL A;  5KFS A;  3S1Q H;  2DY7 A;  4KY6 A;  4AYB E;  5JJK A;  4JV5 L;  4ZK9 B;  3OSP A;  4UCR A;  1X32 A;  1K83 B;  1Z6H A;  2ICI A;  2XRS D;  3OYY A;  3ND9 A;  5C4X H;  4BY1 G;  4TUY F;  4QWD A;  3GQB A;  4KJO A;  4A3B B;  2W9A A;  1XNQ H;  1BDO A;  2V4R A;  4JYA H;  3Q8P B;  5IT9 L;  3WO1 A;  1RD9 D;  2NU6 B;  4DV1 Q;  2WB1 A;  4DR5 H;  1PYW D;  1HTL D;  1EL0 A;  3KF8 A;  5DQG A;  1SE2 A;  2VL6 A;  3T1H H;  5KKN B;  3N44 B;  1E0B A;  3KJP A;  4DAY A;  1EYD A;  1JB7 A;  2UXD L;  1JE4 A;  3NBH A;  4X65 L;  3MR6 A;  3OWF A;  4J9N A;  3I4M G;  4DAV A;  4RNO A;  2FPI B;  4C1N K;  1HZA A;  5G3L F;  4FM9 A;  4DR4 H;  4APV A;  1PYS B;  2YTV A;  2IA6 A;  2HGS A;  3T16 A;  1BR9 A;  2OQK A;  4H0L C;  4DR3 L;  4GKJ H;  5KFO A;  4ECR A;  4O3Q A;  4HR7 B;  3R2I A;  1C48 A;  2I46 A;  3NQT A;  4IHJ F;  4R8U A;  3FPU B;  2A6E C;  3MXU A;  4Y52 H;  3IAY A;  3T5L A;  3MFH A;  2I07 B;  1EUJ A;  4LK1 C;  2I80 A;  3K5H A;  1B3Q A;  5C5J A;  2OQ0 A;  2Q2I A;  4YIJ A;  4GN3 B;  4Q5V A;  2M9V A;  4LAA A;  1RJT A;  1T5E A;  5M9O A;  5C1P A;  3I2Z A;  1L0W A;  2UUB Q;  2WYO A;  1I4H A;  4ODG A;  3BG5 A;  4KV6 A;  2O5I C;  1XPO A;  2NVY A;  3TN2 A;  4QUF A;  2FJZ A;  4LF5 Q;  5IYD H;  5ELO A;  2IJ0 A;  3D8G A;  1JIC A;  1I3Q H;  3PGZ A;  1XNQ L;  1PH9 A;  4G3I A;  2IY5 B;  3SI8 A;  4X64 L;  2JA5 B;  4JYA L;  2XNA C;  4JI0 H;  5M3F G;  4XYQ A;  3OMG A;  4DNT B;  1ICW A;  4EYI B;  3RAX A;  4A3D G;  1FD7 D;  4DR5 L;  4MTD A;  4CGY B;  1J6Q A;  2F0K A;  4KN4 C;  3OMC A;  1ZYR C;  3HS0 C;  3T1H L;  1Y1V H;  1A3V A;  3OTO H;  1F9Q A;  4LWC A;  3LGJ A;  2XCL A;  5FPO A;  2PO4 A;  2ID0 A;  4BY7 H;  4O2B F;  3AFQ A;  3S14 B;  4A3G G;  1LT3 D;  4EX5 A;  2D5D A;  2WB1 B;  4AQY Q;  4A3F G;  2IPK D;  4LF9 H;  1P16 A;  3BZK A;  1YNX A;  2CKZ B;  1GO3 E;  2V1C C;  3KF8 B;  3BZD B;  4GKJ L;  3GTJ H;  3BJY A;  2Z6K A;  2Z8L A;  1DGS A;  1STE A;  2DNC A;  4DAY B;  5FOB B;  3GTL A;  2PQE A;  3NHH A;  3BU2 A;  1EY7 A;  1W6K A;  3ERO A;  3PVX A;  2UU9 H;  1QZH A;  3UDF A;  3PUX A;  1JC7 A;  3HOV G;  2LKV A;  4WBN F;  1U4L A;  5LYJ F;  1FNW A;  3M7G A;  4K14 A;  3VYS A;  1NMF A;  2KCT A;  4AYB A;  2UVU A;  3CF5 A;  2JEA I;  1PYB A;  1TR5 A;  1BO0 A;  5I4D A;  5IYC G;  3M3Y B;  4R8U B;  5J1Z A;  3RV4 A;  2L55 A;  2M05 A;  4JI2 H;  2N8N A;  2B2V A;  2R7Z G;  3I7F A;  4JI0 L;  2AGQ A;  2GVA A;  2NU7 B;  2XWJ B;  4DL7 A;  1G2T A;  2NVY B;  1JKJ B;  4FXG C;  4HIO A;  3OTO L;  1KJJ A;  5AJ3 L;  1YEZ A;  4DR6 H;  3B6Y A;  1UNS A;  1FYC A;  4EQO A;  3R5X A;  2JA7 H;  2FXQ A;  3TDQ A;  3J81 i;  1X3G A;  1VQH A;  1RL2 A;  4PV1 C;  4DGZ A;  2A68 C;  2FP4 B;  5HV6 A;  1T3N A;  1HR0 H;  5C4J B;  1TWA A;  4LF9 L;  4MV6 A;  2JJQ A;  2TSS A;  3G6J B;  3IRB A;  3PIO A;  3JAM L;  2UUC Q;  4MV3 A;  2F0P A;  5IE8 A;  4X62 H;  1SE8 A;  5HBR B;  3RBE A;  1VQJ A;  1EEI D;  2H5X A;  4KTA A;  5HY6 A;  4PMC A;  2ZDG A;  3A0J A;  2UU9 L;  1XJV A;  1DV2 A;  3CRL C;  5KFM A;  2E2H H;  2N3S A;  1Q81 C;  3PO2 G;  3A7A B;  2F03 A;  4RB0 A;  1N34 Q;  1O75 A;  1Z2O X;  2PI2 A;  5CMD A;  1ULZ A;  1CQF A;  1W93 A;  1SNM A;  1IYU A;  1ONL A;  4GLA C;  3GTL B;  5EWE A;  5D3I B;  2R8K A;  1G6P A;  4KHP H;  3FMC A;  1Z2P X;  1OXV A;  2F0O A;  3CRK C;  3K0Y A;  1L2Z A;  4ECU A;  2DUD A;  5EGT A;  2LY7 A;  1SMY C;  1ENA A;  2IX3 A;  4JI2 L;  1YJW A;  5C3X A;  4BY1 H;  2QGQ A;  2WFW A;  1SAP A;  2ZXO A;  4AYB B;  4A3I G;  3C46 A;  1CK1 A;  1ICF B;  1DOM A;  2D9U A;  2JA9 A;  4IR9 A;  5KFG A;  2K6A A;  3MWY W;  1GUN A;  3QFF A;  3W2D A;  1CT1 D;  1W2B A;  1ZHQ A;  2A6E D;  5KFL A;  5C4Z A;  5CV9 A;  2K75 A;  2F0M A;  4RGO S;  3RB6 A;  1VQ6 A;  2R92 A;  3KHG A;  1PMR A;  4DR6 L;  4RUC A;  1H9S A;  4KKU A;  1S5C D;  1S97 A;  4DAM A;  3JRW A;  4UFZ A;  1L0X B;  3OUU A;  4A3M G;  3R23 A;  2W7P A;  5KIX A;  1QG7 A;  3J81 W;  5JVG 3;  4FP5 D;  4RA8 A;  2KCM A;  5KT6 A;  4H13 C;  1NMG A;  1VQE A;  4DV6 Q;  1ILP A;  4K0K H;  2ASB A;  2EYH A;  4X62 L;  1PZK D;  2VW9 A;  4J9S A;  1H9K A;  5EAY A;  1VQL A;  1KQS A;  3H91 A;  4X3S A;  4C3I B;  4RNM A;  3SE0 A;  3EJI A;  4JI5 Q;  1AZP A;  4HNV A;  3H6M A;  3NBI A;  3QWN A;  1FJG H;  4JOI C;  5KEE A;  4NXM L;  1TWA B;  1HQM C;  4LF8 Q;  4ALP A;  1WJJ A;  2EYO A;  2RHS B;  3CP0 A;  5ISR A;  4F4W A;  4RWS C;  1XMO Q;  1JIH A;  1ZYR D;  3ETJ A;  3H0G A;  2FK3 A;  2K03 A;  4KHP L;  1VQ4 A;  1HZ9 A;  1E1O A;  1I50 A;  4FDB A;  4DL2 A;  1GM5 A;  3TZU A;  2E75 C;  4HCS A;  1WTX A;  4YBZ B;  1SE3 A;  3EIV A;  3VYR A;  1SFO A;  1DXM A;  1GUG A;  1SSO A;  2NVT H;  5M3F H;  3GIK A;  2VUM H;  2VB2 X;  3KTM A;  5I6Y A;  1DZ1 A;  2B29 A;  4L1K A;  2W6N A;  4WOR A;  2ASD A;  2VA2 A;  2F1M A;  2K28 A;  1PXU A;  2JEJ A;  4IWX A;  2H1E A;  2RKS A;  5KX5 F;  1V43 A;  2RSN A;  3S2H B;  4A3G H;  5IWA H;  3I72 A;  3QG1 A;  1TWH A;  4A3F H;  3C1E A;  3GD7 A;  2JE6 I;  1GHJ A;  1O7I A;  5HGT A;  5BPH A;  1SE4 A;  2ATW A;  3URY A;  3PIP 3;  3Q0A A;  4K0K L;  1VS0 A;  1A3U A;  2WV6 D;  3NXW A;  2DJF C;  1LAC A;  4RH6 A;  3SDZ A;  2R92 B;  5CB4 F;  4TQS A;  1TWC H;  2JA8 B;  4LFB Q;  1H9S B;  3HG9 A;  4CDF C;  1RJR A;  1S10 A;  4K2L A;  5EWG A;  1FJG L;  3E0J A;  5GAE C;  1SNP A;  2FK2 A;  3J7A K;  1U4R A;  3CW2 C;  1SXT A;  4AIM A;  4DK0 A;  4K6D A;  1K73 C;  3I4N G;  2VY3 A;  2KQ3 A;  4HAE A;  5DM7 3;  2F4V Q;  5KFX A;  4HNU A;  2FMA A;  1E2V A;  1S5B D;  2R86 A;  4RAY A;  2R8J A;  1CKM A;  1QNU A;  1CSQ A;  1Q82 C;  5DLF A;  4MV8 A;  2W71 A;  1FNV A;  5K2M A;  3ERQ A;  2E2J B;  2C2R A;  2A68 D;  2E5L L;  3P20 A;  4A93 G;  4DV3 H;  2R7Z H;  3PN1 A;  5IOC A;  4C3H G;  2EXZ A;  5IIF A;  1I4Q A;  1TXY A;  3H0G B;  4LJZ C;  2F0T A;  1YNJ C;  1XPU A;  5D1P A;  2MCT A;  2PMZ A;  1I50 B;  5J2U F;  4TQR A;  2YCH A;  3N41 B;  1RK6 A;  5J3B A;  4ZHQ F;  4DUY Q;  4CKB A;  2XIG A;  3GTO A;  4M9U A;  3NE5 B;  1SFO B;  2C22 A;  1I94 Q;  1ASY A;  1IL2 A;  4Q45 A;  5IWA L;  1D6E C;  1KDB A;  2KHS A;  5A2Q E;  4C3J G;  1WD1 A;  5KFZ A;  1GGO A;  3T5K A;  5NUC A;  1VBH A;  4WJ4 A;  4XT3 B;  3HKZ E;  3N6X A;  1SMY D;  1EY6 A;  4DXG A;  3KLR A;  4YWL A;  1CKN A;  3W5O A;  3LWB A;  4BWG B;  5BPF A;  1TWH B;  3HOY B;  3V4S A;  3PO2 H;  2MFI A;  4IUQ A;  2UUC H;  3P7J A;  2UVR A;  2WKC A;  1TWF H;  2AUK A;  1F9R A;  5EJW A;  3X3M A;  4J9R A;  4HJ8 A;  4EQ5 A;  2DGY A;  4RGT A;  4OO1 G;  3DWP A;  1DOK A;  2CVR A;  5JJL A;  1M8A A;  1S5E D;  2L9H A;  1H9R A;  3TIN A;  4A3J B;  4HMJ A;  3F1Z A;  1VKZ A;  1I5F A;  4RUA A;  5JEA J;  3TEH B;  4DV3 L;  4A3I H;  1KRS A;  4J6H A;  3GTK H;  3OWE B;  4LUO A;  2MGS A;  1S40 A;  3CME A;  1BVS A;  1A2U A;  3KBX A;  3OHB A;  4A3B G;  5KG6 A;  3TRZ A;  3V05 A;  4G7O C;  2EYF A;  1KD1 C;  4M8A A;  1PH3 A;  3SK6 A;  2VPS A;  4JVZ A;  2SEB D;  3G71 A;  2B63 A;  4POG A;  2V4D A;  3GTP H;  1GYF A;  1DV1 A;  4QQB X;  4A3M H;  4KJN A;  3CCR A;  3E9I A;  2PMZ B;  5FO7 B;  2XC9 A;  3K3P A;  2QCP X;  2Z4I A;  1EY0 A;  3DHQ A;  2I87 A;  3I91 A;  3GTM H;  3GTO B;  4L5Q A;  1KIX A;  3N6R A;  5FJ8 H;  3CCE A;  1VQ9 A;  3NEM A;  2UXB Q;  3EFX D;  4JV1 A;  1Y1W A;  4JV2 A;  2XD4 A;  1R4Q B;  1RHP A;  2PZT A;  5CV6 A;  3OUZ A;  2UUA Q;  2UUC L;  1NCV A;  1R9T H;  4ED3 A;  2MNA A;  4B3M H;  1L1O A;  1EYA A;  5LHY 1;  1ESR A;  3RNU A;  3MWE A;  2R93 G;  4RZQ A;  5EWF A;  4DF7 A;  3IKJ A;  4X3K A;  1X9N A;  4JI5 H;  2KHI A;  1TY2 A;  3KAJ A;  3ORR A;  4DV7 Q;  2EY6 A;  5KFP A;  3GLK A;  1VQO A;  4XIG S;  1AUV A;  4MTE A;  1CKN B;  4LF8 H;  3DM3 A;  1E24 A;  1M6V A;  1VBG A;  3K7A H;  5LL6 S;  2G9D A;  5D3D A;  1IYJ B;  3PW5 A;  5C6A A;  1N8R C;  2F0S A;  1ZEQ X;  2R84 A;  3H4B A;  2QDB A;  1WH2 A;  2EY5 A;  2E2I A;  1NTG A;  4HED A;  1RKN A;  2JA5 G;  3PW7 A;  3TBI B;  3R5F A;  1Q46 A;  4RKB A;  4YHH Q;  3RUP A;  1JT8 A;  1SN8 A;  4ZOL F;  2J9G A;  4OL7 A;  1A3T A;  2JA6 A;  3OSO A;  1WSC A;  1TU2 B;  3HKZ A;  2J6S A;  1CHQ D;  3MC0 B;  1EU4 A;  2LXJ A;  3MZ5 A;  3C0F B;  4UCO A;  4OXP A;  2BQR A;  2IHE A;  2WB1 G;  5CV5 A;  2B63 B;  5M5X H;  4JUZ A;  5C4H A;  1EYC A;  1CQV A;  1TKW B;  1YBY A;  3JC6 6;  4GN4 B;  1CA5 A;  1IW7 C;  1YNJ D;  4R7R A;  2F0E A;  3PIP A;  5GON F;  2M2L A;  3KDF A;  2Y0S G;  2SCU B;  4B3M L;  2A6H C;  4IPH A;  1GVP A;  3I4N H;  2R8G A;  2HUG A;  3RLF A;  1S4Z A;  2Z6K C;  1I6U A;  2F0W A;  1X6O A;  2CQA A;  1D7Q A;  1PH1 A;  3MJF A;  1JOQ A;  4LF8 L;  3RGZ A;  4KLK A;  5DGB A;  2ENB A;  1SNC A;  3MFG A;  4IRC A;  1WTO A;  2HDM A;  2KOL A;  2F4V H;  1L1O B;  3FDS A;  1XXG A;  2F0Q A;  2Q2T A;  1Q90 A;  3TQY A;  1J5E L;  1MKH A;  3FKI A;  3RB3 A;  4KHV A;  4ZKC B;  1O78 A;  1EQT A;  4QL5 A;  2GPW A;  4O4I F;  2K5Q A;  4IUR A;  1IBL Q;  2NBF A;  5IT9 W;  4RB3 C;  4KD4 A;  1HNZ L;  3RLN A;  3HOX B;  3PR4 A;  3E5S A;  1U9R A;  2B2V C;  1G51 A;  1Z47 A;  4C3J H;  4DUY H;  3S17 H;  1CQJ B;  3ER0 A;  3F2D A;  1IOV A;  2E2I B;  2XCP A;  3GTG A;  2FMM A;  4B08 A;  4Q43 A;  3MXN A;  1I94 H;  1Y1V G;  2ALY B;  3PW2 A;  3J7Y W;  1E1T A;  1SRU A;  4JCV E;  3UFX B;  3S2D H;  3MA2 B;  3NTH A;  4QWE A;  1VQP A;  4LF6 Q;  4BY7 G;  1Z2N X;  1O7L A;  3KOJ A;  4G4K A;  1HNX Q;  4K8J A;  5LMN W;  2JA6 B;  3HKZ B;  2VR1 A;  1VMC A;  1K1S A;  3PUW A;  4OHJ A;  4WFN 3;  3FMA A;  4ZCK A;  2J7Z A;  2MP1 A;  1KRT A;  4DR2 Q;  2NTS A;  4MV7 A;  3EPG A;  1PFB A;  2BH8 A;  3K80 C;  3BA9 A;  3MWD A;  4YP3 A;  3G6Y A;  3CCL A;  3BQ2 A;  3U58 A;  1IBK Q;  3KDF B;  2F4V L;  1JQY D;  4UDU C;  1K83 H;  3L7Z C;  1YHB A;  4EGV A;  2YU9 A;  4R9W A;  2XN9 C;  2ASL A;  3RMH A;  2KBN A;  3DM1 A;  2RVL A;  4A3B H;  4IFD J;  1UNN C;  4AYB G;  1D1K A;  3A8I E;  2D0P A;  3ETH A;  4QWC A;  5C5L A;  2XGP A;  1S9F A;  4Z9C B;  2QA4 A;  1PK8 A;  3G6E A;  3V6H A;  1B53 A;  3M4I A;  1K8G A;  2RQX A;  2PCF B;  5KT3 A;  5FLX L;  3NGD A;  3FKI B;  2FPG B;  4DR1 Q;  4B3R Q;  5FPR A;  3S15 B;  1S68 A;  1I94 L;  1I7L A;  4N9T A;  5KG0 A;  4A3K B;  5I9P A;  2F0U A;  3FDT A;  1KJ9 A;  4ECV A;  4HSV A;  4P2C B;  5KND A;  3NTK A;  4XYO A;  3JAM i;  1VQI A;  2ZJT A;  2EOT A;  2R6G A;  1SRO A;  3MEH A;  1IHZ A;  3QJY A;  2WAQ E;  1N36 Q;  3GTG B;  4C3I G;  1QJO A;  3MXN B;  2UXB H;  5LMN H;  3PZP A;  1JWM D;  2LS0 1;  1OXT A;  4K6L A;  3ZJY C;  4X3U A;  4ZAI A;  1B70 B;  4ZRZ A;  3E9H A;  4GOP A;  1VMP A;  5DG7 A;  2UUA H;  1BJT A;  1W96 A;  4ZI7 F;  3L0O A;  2N55 A;  2IHF A;  4LFA Q;  2ATL A;  2DJG C;  5EZY F;  3JRX A;  2F0N A;  4C2M A;  4HJ5 A;  4NXN H;  2QIL A;  4DV7 H;  2A1A A;  2JK8 A;  4DAP A;  5KFJ A;  3T56 B;  2W6Z A;  3BVZ A;  2VNU D;  2MO0 A;  3WDN A;  1CKO A;  1K1Q A;  2NVQ B;  2OTJ A;  3FP9 A;  3MR2 A;  1PLF A;  2JA5 H;  1P8L A;  1A2T A;  1TS5 A;  1CHP D;  3DF7 A;  2AGO A;  1GSH A;  1IW7 D;  2EY1 A;  1OO9 B;  2LSS A;  2PQA A;  4ILW A;  2A6H D;  4J0M A;  2CH4 W;  3PCO B;  5IP9 G;  2YU9 B;  3J80 W;  2K52 A;  2UVV A;  5KG3 A;  2QEJ C;  3S24 A;  1JOO A;  5C3E B;  1XTC D;  1A6X A;  3I4O A;  3S14 H;  1M90 C;  1MJE A;  4EQP A;  2C2D A;  1SYE A;  4DU9 A;  4WJW A;  5IOD A;  3CAM A;  4DPG A;  5LXT F;  4YJ2 F;  1TVX A;  4JI4 Q;  1X3P A;  1PRT F;  3PSI A;  4OIJ A;  4PZ7 A;  3F2U A;  2R92 G;  3JAM W;  2C5C A;  3FVQ A;  4DNI A;  1TS4 A;  2JA8 G;  3LWE A;  1EYG A;  2XTI A;  1VQG A;  2YZN A;  1LT4 D;  5LMN L;  4L8J A;  1F2L A;  4NPS A;  1YJN A;  4ZQ3 A;  2UUA L;  2R82 A;  4C1N I;  1EY8 A;  1SMX A;  3M3Y H;  4NXN L;  5DGA A;  1EUD B;  4YY3 Q;  3EYY A;  5CAE B;  1VQ5 A;  4QB4 A;  4DV7 L;  3SK4 A;  3D4W A;  4BWS C;  2CZG A;  2IT1 A;  3HOU B;  3O13 A;  5FKA C;  1GUT A;  1BNZ A;  1FNU A;  2PI2 E;  4UAI A;  4GOP B;  4XX0 B;  3BDC A;  2SOB A;  4ME5 A;  3J81 j;  4RHR A;  2VUG A;  2H4O A;  1Q8I A;  4PNY A;  3H0G G;  1LT5 D;  3D4R A;  3R2T A;  5JPM C;  4N9P A;  1QE6 A;  4O3R A;  2NVY H;  4TQU S;  2VUM G;  1IBL H;  4ZYS A;  4RMF A;  1PDQ A;  5JJZ A;  1HNW Q;  4IUN A;  4NB3 A;  2EDG A;  4DNR B;  1EY5 A;  3U9O A;  1WD0 A;  3CD6 A;  3FHW A;  3J7A V;  3T1Y H;  3DMU A;  5C4J H;  3I12 A;  1HR0 W;  4B3T Q;  4X6A H;  3NUC A;  5M3M B;  2PQA B;  1CUK A;  2Z9H A;  4EVO A;  1G91 A;  2WAQ A;  3K5I A;  1GHK A;  1Y8P B;  3N52 A;  2HVS A;  5LA6 F;  4DR4 L;  4XQQ A;  1AN8 A;  2TMP A;  4DXF A;  1FGB D;  5E4X A;  2BDN A;  4YAJ B;  3RR5 A;  5KGU A;  3BS1 A;  1E4F T;  5KFB A;  2R8H A;  4LF6 H;  3HOY G;  2V9W A;  1EY4 A;  3HKS A;  3NBH B;  2KEC A;  1HNX H;  4LF4 H;  4ID6 A;  1EQR A;  4JI3 Q;  2I8C A;  2YZG A;  2K7V A;  3Q24 A;  3WNZ A;  3GTL H;  3PF4 A;  2C35 B;  5JUM A;  1V9P A;  3M9N B;  3BYT B;  1EWH A;  1PTO B;  3J81 c;  1KJQ A;  3PV0 A;  4A76 A;  4IO9 A;  4DR2 H;  2EJF C;  5BN5 A;  1UEB A;  5EBD A;  4A3J G;  1LTG D;  2GPS A;  4J8Q A;  3ULL A;  2PN1 A;  1KAA A;  4O3S A;  2WIN B;  1EOV A;  3P75 A;  4DR7 H;  3Q1K A;  4RCO A;  2FLL A;  3BG3 A;  3TS0 A;  2UXC Q;  2KJX A;  1RJQ A;  5IP7 H;  4RFB A;  2RCF A;  5DG8 A;  5ELD A;  1IBL L;  1OXS C;  2VQF Q;  5JEA G;  5GAH C;  2QYZ A;  3Q8R B;  1KJ8 A;  2CW8 A;  2A69 C;  1UC9 A;  3J80 L;  3UE1 A;  1V1O A;  5M5W B;  3WO0 A;  3T1Y L;  2I5H A;  1N48 A;  2DPJ A;  3BZC A;  1EWI A;  5BR8 Q;  2ZJP A;  5GRO A;  4DR1 H;  2ALZ A;  4B3R H;  3S1M B;  1RTO A;  3M9O B;  1IBM Q;  4HYK A;  2QKI C;  1E4E A;  4Q8E A;  3OOC A;  2FPP B;  4ME6 A;  4A2A A;  2F3I A;  1WTW A;  4C3I H;  4MV1 A;  4DL3 A;  1B9M A;  2L12 A;  1PH2 A;  3FEW X;  1EZ6 A;  4LF6 L;  3LX0 A;  3OHA A;  1BBW A;  1TWA H;  4DV5 Q;  4LF4 L;  1XMQ Q;  1HNX L;  2NUA B;  4LUZ A;  2K1B A;  1CZG A;  2WAQ B;  3HEJ A;  2GLT A;  4O42 A;  4UP7 A;  2IL8 A;  3M4Y A;  2FMC A;  5DAU A;  1MSH A;  5KFW A;  2C28 A;  2FLP A;  3RF2 A;  5DLQ E;  2K5W A;  2BQU A;  2AQ3 B;  3SK8 A;  1XTD A;  2R3Z A;  1L1O C;  3ERS X;  3SHL A;  5KFA A;  1WR2 A;  5KG4 A;  2F3W A;  4LFA H;  4C5B A;  1IZ6 A;  3J81 E;  3U9S A;  2HHH Q;  1RYS A;  1EHI A;  4DR7 L;  1STY A;  1D5M C;  2L1B A;  3IG0 A;  1XNR Q;  5AFW A;  5IP9 H;  3G4S A;  5C0X J;  1KC8 C;  4V19 0;  4QMG A;  4ED8 A;  5JVH 3;  3S2H H;  2K04 A;  2PMZ E;  1N32 Q;  3A8J E;  2MUY A;  1K9M C;  4DV1 H;  3T53 B;  2Q8R E;  1AFP A;  2R7D A;  4ECS A;  3Q2O A;  1L2F A;  4PZ6 A;  1GUO A;  4L63 B;  1VQB A;  4GNX A;  4DR1 L;  2YTX A;  2R92 H;  3S16 B;  2D2C C;  4B3R L;  1B33 N;  1A9X A;  1HR0 L;  4XYM B;  2JA8 H;  2KSW A;  2B63 G;  5F9N A;  2N88 A;  1SND A;  4ED7 A;  3WOE A;  2RGR A;  4EGJ A;  4JI4 H;  3K58 A;  4QIW E;  4DL5 A;  1NNX A;  1AW7 A;  1SYX B;  4J9P A;  5FJ8 G;  4FVM A;  3PF5 A;  2EYJ A;  1QNK A;  4QCL A;  1E4E B;  2I5L X;  1STH A;  1LO5 D;  1D2B A;  4EGQ A;  4L6T B;  4FNF A;  5FLM H;  1O80 A;  3TP5 A;  1MI2 A;  1STG A;  3N43 B;  1MSG A;  4LFA L;  2E2J H;  3H09 A;  1F77 A;  3RZO B;  1GUS A;  3TQT A;  3PMF A;  5M5Y B;  1PFM A;  3H0G H;  3RAQ A;  3U4Z A;  4JBW A;  4IAJ A;  4RG1 A;  2UUB H;  4P71 A;  2A73 B;  5EKK A;  1UE6 A;  2CWA A;  3VR4 A;  2NZO A;  1CM9 A;  5EPK A;  4LF5 H;  1SFO H;  4JI1 Q;  5LOV F;  5FD5 A;  4ME3 A;  4GC7 A;  1F9S A;  5DEH A;  2RA4 A;  1GSO A;  4GZY C;  2DWC A;  5L37 A;  4DV1 L;  1UEA B;  2HQL A;  4YCV A;  4HN7 A;  1HNW H;  1YI2 A;  4ECQ A;  3S1R B;  2XRQ D;  1S0N A;  1G6Z A;  1AP0 A;  2LFN A;  3IL8 A;  2MJ8 A;  4EBE A;  5IYZ F;  4UCU A;  2W8K A;  4B3T H;  1TWH H;  2XSC A;  3HOY H;  4A4I A;  1A62 A;  2FFK B;  4JI4 L;  3J7A F;  3HKZ G;  3F2C A;  2WTF A;  4AQY H;  4YWK A;  4LMQ D;  4YR3 A;  2BR0 A;  1NBW A;  2X6L A;  4GNX B;  2YS6 A;  1UUP A;  5KFC A;  2ZJR A;  3E5N A;  4KI0 A;  1T9H A;  4MZ9 A;  4IZO A;  1H9J A;  1J8I A;  5KFI A;  4JI3 H;  2B2U A;  1U4M A;  4A3J H;  2Q2H A;  2A69 D;  5KT7 A;  3I4M B;  3D0F A;  3M9M B;  2B2T C;  2NZH A;  3M4O B;  1UE1 A;  1SYG A;  2RBM A;  2VZA A;  3LWU A;  2EJM A;  4RB1 A;  1B2T A;  4MAM A;  1PH5 A;  4UHV A;  1WTQ A;  4YCU A;  2UUB L;  2CW7 A;  1HFN A;  3CCS A;  4BA1 I;  2B8F A;  1UE5 A;  5JEA H;  1B8A A;  4LF5 L;  2ZTE A;  2W6Q A;  3R3O A;  5JQW A;  4JI8 Q;  5KFY A;  2UXC H;  1VQ8 A;  5DM6 3;  3VPD A;  4HTH A;  4IFD G;  1WOC A;  3L4J A;  3FKI G;  3DUZ A;  3TP6 A;  2VQF H;  3A56 A;  4RCN A;  3RV3 A;  4FF3 A;  3DXJ C;  1EIH A;  2NZ1 D;  3D4D A;  2YRW A;  1PVO A;  3N8D A;  4QIW A;  2SDF A;  3HB9 A;  4DV2 Q;  1EEF D;  1BGW A;  5BR8 H;  1C9O A;  2D62 A;  1PZJ D;  4B3T L;  1VQD A;  2HVQ A;  5CA0 F;  4G57 A;  5FLX c;  3TP7 A;  1S5D D;  4JI6 Q;  3DEO A;  4AQY L;  4C56 C;  1CFM A;  1Q1B A;  1ROD A;  3SEB A;  5M3F B;  1S3O A;  1Q12 A;  2F4I A;  4DFA A;  2EQS A;  4A3D B;  3ITP A;  4O4L F;  2ZDH A;  3MR5 A;  4DV5 H;  3AMU A;  1OXX K;  4B9W A;  5IGG A;  2FHT A;  3CQZ H;  2KCN A;  3GV3 A;  4QWB A;  1N34 H;  4A3G B;  5CV7 A;  4GOP C;  3RZD B;  4ED0 A;  2X69 A;  2BE5 C;  1VCI A;  2O4X A;  4TKO B;  1MIU A;  5LMU Q;  3GV5 B;  3G6X A;  1N9W A;  4K8I A;  2R85 A;  3E6Z X;  4LUV A;  2EY2 A;  1PV4 A;  2GN5 A;  3RUZ A;  1ZQ7 A;  2F0I A;  1DD2 A;  1SBB B;  1VQN A;  5F9L A;  3A5Z B;  4DUZ Q;  3EPI A;  2DZD A;  1BBU A;  1QVC A;  2AQ2 B;  3CCV A;  2UXC L;  3HOV B;  5KFV A;  1C0A A;  3V2T A;  3CVZ A;  1XNR H;  5CA1 F;  4TV8 F;  5C3E G;  2KUM A;  2I5M X;  1SJE D;  2VQF L;  1X3Q A;  4NDX A;  2F0F A;  4G7H C;  4J1M A;  2F0G A;  1T94 A;  1B6R A;  2VXW A;  2B63 H;  1EYZ A;  1PA6 A;  5BR8 L;  4OEL B;  3MEF A;  4AH6 A;  5IT9 c;  2XWB B;  4A3L H;  4EBC A;  1SR3 A;  3RLO A;  5KT5 A;  4JI7 Q;  3GTQ H;  3SXH A;  1I7N A;  2EIF A;  5I9O A;  4DV6 H;  3RTX A;  4QIW B;  2K05 A;  2EYL A;  4J9Q A;  2W6O A;  4DV5 L;  2UXD Q;  1PTO C;  3C1F A;  3L2P A;  1SCU B;  4FF4 A;  3NQI A;  4X65 Q;  3KHR A;  2ES2 A;  1I4G A;  5KFD A;  4U67 3;  1SNQ A;  1N34 L;  3RN2 A;  4CBV A;  4HIK A;  3HOU G;  1XWE A;  2E8G A;  2JYO A;  2RDG A;  4F8M A;  1XMO H;  3QR8 A;  3ULP A;  3GQC A;  1M0T A;  1A0I A;  3NSW A;  3K57 A;  4ECY A;  2VB3 X;  2SNM A;  1KL9 A;  1IOW A;  1IXR A;  2NTT A;  3HOX H;  4GKK Q;  2PW7 A;  2V4Q A;  2X6G A;  1ESF A;  5FLX W;  5KYL A;  1S5F D;  2N49 A;  3L4K A;  1I6H B;  1PZI D;  1SYC A;  2E2I H;  3I55 A;  2F0D A;  2EE1 A;  1BXT A;  4JI1 H;  2C00 A;  3BQ1 A;  1SEI A;  1YHQ A;  1EWC A;  2EXD A;  3NP8 A;  4DA2 A;  2EZV A;  5EPJ A;  5M3M G;  4HJ7 A;  3VDY A;  1SYF A;  4HCE A;  1B3A A;  1XNQ Q;  4YQW A;  4MNO A;  4X64 Q;  4JYA Q;  1BCP B;  4H7B A;  4A3I B;  5KG1 A;  4A3C G;  4IQZ A;  3VR3 A;  1R4P B;  1B6S A;  4IRD A;  4U6P A;  4RAU C;  4OWW B;  1WCM A;  4DV6 L;  5CV4 A;  3ORQ A;  3PO3 B;  4BBR B;  4XXE A;  4LFB H;  1AEX A;  3KYH C;  2XIW A;  4JI5 L;  3UDG A;  1XYI A;  1AE2 A;  1LTI D;  3Q8Q B;  4RU9 A;  2OT2 A;  1EZ8 A;  1Y1W B;  2PZW A;  2PZU A;  2YV5 A;  4CDE C;  1X54 A;  3GDE A;  3PQI A;  5LP6 F;  1XMO L;  5ELB A;  3QIA A;  1WI5 A;  3E3X A;  4KKT A;  2HVR A;  4YR2 A;  3EN2 A;  1AUX A;  5A35 A;  4FF2 A;  4UY8 C;  4CJ0 B;  1ET9 A;  1NY4 A;  5C44 B;  3G7L A;  1C30 A;  1FGU A;  3D31 A;  5CGK A;  2V5A A;  1KAW A;  3MXG A;  5KNC A;  5IY0 A;  2CQY A;  2YW2 A;  4IFD H;  4UPA A;  3FKI H;  4A3E B;  5T1I A;  2IWH A;  2F0L A;  4P73 A;  1C8C A;  3TIG A;  1QOH A;  4HMI A;  1W6J A;  1U4P A;  4S3S A;  4UP8 A;  4JI1 L;  4JI8 H;  4A3K H;  2A19 A;  1KLU D;  1UAP A;  5A2Q L;  1SLJ A;  1B1Z A;  3V6K A;  5D65 A;  1MJC A;  4EBD A;  2IW3 A;  2BE5 D;  4L5S A;  3K7A B;  4JI0 Q;  4F7X A;  4ZUJ A;  3Q23 A;  1QVF A;  2J0T D;  4MTK A;  2W6P A;  2PVP A;  4CJ2 C;  4DV2 H;  4TVA B;  3MFI A;  5E1F A;  2J4X A;  3RFC A;  3J80 c;  1KTK A;  4JI6 H;  3BDO A;  4JC0 A;  5AJ3 Q;  2WAQ G;  4LFB L;  1STA A;  2Z0S A;  2FK1 A;  1Q7Y C;  4XZ3 B;  2RDJ A;  1T36 A;  4WRD A;  2DY8 A;  4TRD A;  2SNS A;  4CKE A;  4IFD I;  1JJC B;  1EFI D;  5KFF A;  5CV8 A;  1JXL A;  1PH7 A;  4ABN A;  4LF9 Q;  1SYD A;  1WCM B;  3I90 A;  4FO2 A;  3JAM c;  2NVQ H;  1QB5 D;  5KFR A;  4A2B A;  3CCU A;  2NVX A;  2BDO A;  4KN7 C;  1D5Z C;  3TS2 A;  1B50 A;  1K0S A;  3AYH B;  4Y7N B;  4Q0Y A;  2EVB A;  3K6O A;  1YZ6 A;  2Q2U A;  1KDC A;  5LMU H;  4MHE A;  5EOY A;  4IJH A;  3A5U A;  5ELC A;  5KFU A;  4ULL A;  3RIZ A;  3GO5 A;  1GJX A;  2KVM A;  2YU9 H;  4M1U B;  2BOS A;  2BCO A;  1TWG A;  5C3E H;  1E22 A;  2B2W A;  2VQD A;  5IP7 G;  3J80 i;  4JI8 L;  1PTO D;  2WDT A;  2B8G A;  4F50 A;  4DUY L;  1NR4 A;  3J7A 5;  4JI2 Q;  4RAZ A;  5ELF A;  3I70 A;  3BJU A;  3OW7 A;  4I7Z C;  2K5D A;  5C0X G;  1VDZ A;  1HA6 A;  4A93 B;  5FD6 A;  2IBK A;  4OGQ C;  1EIG A;  4C3H B;  2RSO A;  3NWS A;  4QJF A;  3Q22 A;  4CKC A;  4J9O A;  2UVW A;  5FO8 B;  1UWV A;  1GUW A;  4QUC A;  4GNX C;  4EEY A;  4DK1 A;  1KNE A;  4HNT A;  2RF4 A;  3D3R A;  3NTI A;  4I55 F;  4JI6 L;  2JN4 A;  2BA1 A;  3K8A A;  1Q3L A;  4DR6 Q;  1FVI A;  2YTY A;  3QB3 A;  3HOZ B;  4JI7 H;  3S1N B;  4XDX A;  4CJ1 B;  3TP8 A;  2HD3 A;  1HUM A;  3BVG A;  5KT4 A;  4K5X A;  1B7Y B;  2BH2 A;  1ENC A;  1OWT A;  3KHL A;  1HH2 P;  3HOU H;  4YJ3 F;  3CU7 A;  3KLS A;  2UXD H;  4ED1 A;  5CBE E;  4BS9 A;  2OCE A;  1YHA A;  3E0E A;  4O2D A;  4QW8 A;  5H1S E;  1TS2 A;  1IKL A;  4RHS A;  1YIT A;  3CCQ A;  2R93 A;  1O7Y A;  4LSA A;  2WP8 J;  3UE0 A;  4OON A;  5K5P A;  3STB C;  4DV4 Q;  3J7Z C;  3GP7 A;  5LMU L;  1LUZ A;  3JAM E;  4QGU A;  4P75 A;  4EFB A;  3QOJ A;  3ZYY X;  5JVD F;  5KG2 A;  1EFW A;  4NXM Q;  2J6T A;  4NMZ A;  1ZET A;  2WKD A;  4PG3 A;  1DJR D;  4UP9 A;  5D1O A;  2AU0 A;  1E2Z A;  2OWO A;  2NVX B;  4O0A A;  4GLX A;  4GKK H;  4KHP Q;  3H3V C;  1STN A;  2JEG A;  3BDL A;  4JPB W;  2Q8T A;  2EYP A;  5M3M H;  4CHT B;  1WTV A;  2PW5 A;  4YHH H;  2HDL A;  3L9A X;  4KY5 A;  3VR5 A;  1ENF A;  2FKL A;  2HIX A;  3MWM A;  3UQ8 A;  2VA3 A;  2QW7 A;  3KXY T;  2OXP A;  2RDH A;  3WWV A;  4OX9 Q;  1S03 G;  2B2Y A;  3SE7 A;  1TWG B;  3D6W A;  4N8X 1;  4NW2 A;  4A3C H;  5T14 A;  2HCC A;  3M4P A;  4IPG A;  2F0J A;  2NN6 G;  1M1K C;  5DQH A;  4X64 H;  5L1J A;  4HJA A;  4IUP A;  2UXB L;  1I4R A;  1PH4 A;  4JI7 L;  1AZQ A;  1PTO H;  1T5X D;  1HPC A;  2MHV A;  5T1G A;  4FS2 A;  3MHB A;  2XVS A;  3MR3 A;  5CYU A;  2EJG C;  1GKH A;  1LLR D;  1PTO F;  4CDD C;  1GOZ A;  1NE3 A;  2Y0S A;  5TSS A;  2X0S A;  4K0K Q;  2ZTC A;  2DNE A;  4R4T A;  4FS1 A;  4YAK B;  2RCN A;  1QIL A;  5FLM G;  4DK6 C;  4CC5 A;  2LMC B;  1Z9F A;  1HFG A;  1MBY A;  2B2U C;  2C9O A;  5DQI A;  4IRK A;  2O5J C;  2K14 A;  1I4P A;  4IPC A;  5E3F A;  1YIJ A;  1FJG Q;  5EDW A;  2ZT9 C;  2NYZ D;  1DM0 B;  2K4K A;  4C2M B;  1ILQ A;  1BBX C;  1VF7 A;  2ZXP A;  4O3O A;  1VQA A;  2R93 B;  1KLG D;  3KAK A;  4ED2 A;  1A8V A;  3QZ8 A;  4GKK L;  2V58 A;  4LSX A;  5M5W H;  3A54 A;  1KAB A;  3IFD A;  5LL6 b;  1WVL A;  1MZB A;  4IWY A;  2YL2 A;  4YHH L;  3LNN A;  1F9P A;  1RIP A;  3PUV A;  3S1M H;  2E5L Q;  1QCB D;  4BBS B;  4QY7 A;  3MFY A;  4NKL A;  1EQV A;  1C7Y A;  5D1O B;  5IGF A;  3HOW B;  4FXD A;  1I3Q A;  2FLN A;  1QZG A;  4N8F A;  2M00 A;  3T13 A;  3S1Q B;  2CH4 A;  1Y1V A;  1ET6 A;  5C4X B;  4LFC Q;  2Q8I B;  2BA0 A;  3OIP A;  5D14 A;  3TRE A;  5IWA Q;  2R7L A;  3HRZ C;  3BVM A;  1Z7T A;  4O4H F;  3R8B A;  2OLS A;  2A74 C;  4GS3 A;  1VAJ A;  1V1P A;  1TS3 A;  3QO2 A;  1EZ1 A;  1X3F A;  3CCM A;  3M7N A;  3GTJ A;  3MXP A;  5EBC A;  1PRT B;  2B39 A;  3DWQ A;  2R61 A;  2N78 A;  5EKI A;  4DV0 Q;  3BYY B;  1IBK H;  4O3P A;  1CI3 M;  2FJ2 A;  3T5H A;  3RD4 A;  2AMC B;  4XT1 B;  5JH7 F;  4H02 A;  5IGD A;  4J9K A;  1BOS A;  2Y0S B;  3VMM A;  2JEI A;  2J6U A;  5FK9 C;  4K5W A;  3SR1 A;  4EEQ A;  2F3V A;  4M7E A;  2K5H A;  4IUU A;  2R7F A;  3K5M A;  2NWG A;  2CQO A;  4FYD A;  5JJI A;  3VPC A;  2ZJQ A;  1YNN C;  4V0B A;  1B44 D;  3T4A C;  5LL6 X;  5C0X H;  3S16 H;  5KG5 A;  3T51 B;  4DV3 Q;  2IP4 A;  3FRP B;  4F88 A;  5CR3 A;  4DK3 C;  3A7L A;  4R8I A;  1BCP C;  2B3G A;  1KC7 A;  1XX8 A;  3DWA A;  2KA7 A;  4DN4 M;  4RNN A;  2AKW B;  3STB D;  3CKI B;  2RDI A;  4R4O A;  3A74 A;  2CCZ A;  5KFK A;  3RB0 A;  4C5C A;  2C2E A;  1K3R A;  1DIK A;  1S0O A;  1I3Q B;  3VYU A;  5KFN A;  1E3P A;  2JA7 A;  3H94 A;  1RYR A;  1N36 H;  1V51 A;  1NUC A;  3P1H A;  5DLG A;  5C3W A;  2Z4H A;  3RZO H;  1BNC A;  1V4Y A;  5M5Y H;  4DR2 L;  1Y1V B;  5J39 A;  1C4Q A;  5KT2 A;  1GLV A;  3N42 B;  4PWQ A;  5HUR A;  1HA5 A;  1LTA D;  5C0X I;  1G8Z D;  1BKB A;  4BY7 B;  4MV9 A;  1K28 A;  1IBK L;  5K36 H;  3BAB A;  4RGM A;  2VOB A;  3RBD A;  2E2H A;  1V1P B;  3AU7 A;  4MIU A;  3ULJ A;  3GV7 B;  1GD7 A;  3HBL A;  5HGQ A;  4DV4 H;  2W8L A;  1U5K A;  3KHH A;  3GTJ B;  1EOT A;  1HJP A;  3NPP A;  3HZX A;  4IOC A;  2JQO A;  4QWA A;  3VA7 A;  1N33 Q;  4NXM H;  4R8N A;  4R4Q A;  1I6V C;  1X56 A;  3CC4 A;  4I65 A;  3HXL A;  5IYB G;  1LTL A;  2K5N A;  1JMC A;  3S1R H;  2RGV A;  3OIQ A;  4RZR A;  4ZUI A;  1KNA A;  4U7C A;  1V1Q A;  1RF2 D;  2ZM6 Q;  3S9W A;  1GXD C;  4GN5 A;  1HZB A;  3A8K E;  4P72 A;  1RCV D;  2NN6 H;  4A75 A;  3PUZ A;  2A8V A;  1NSN S;  1EIF A;  1Y14 B;  4K5V A;  4OX9 H;  3VYT A;  3K5L A;  4R4I A;  4R4C A;  4F87 A;  1B9N A;  1LAB A;  3L3O C;  2DN8 A;  3KLS X;  2HQE A;  3BAA A;  3GIJ A;  3I73 A;  1CSP A;  5EQ0 A;  3PO3 G;  4BBR G;  4A3L G;  4B3S Q;  3H40 A;  3WOF A;  1N36 L;  2L4N A;  1KXL A;  4PDB A;  3AQQ A;  3G8C A;  3I4M H;  1KEE A;  1G2S A;  1AE3 A;  1Y1W G;  5L1K A;  1NR2 A;  4KK7 A;  3M4O H;  3K59 A;  1I4X A;  1Y69 U;  5JVL A;  5L1L A;  2JA7 B;  4YY3 H;  5F2D A;  5JPN C;  2ZTD A;  5C44 G;  4B3M Q;  1I50 H;  4IZ8 A;  3BA8 A;  2NN6 I;  3KK7 A;  4DV4 L;  5IGB A;  2AQ4 A;  2JEB I;  1STB A;  2QEX A;  3OW2 A;  4FF1 A;  1WTP A;  4KD3 A;  4KMU C;  4HID A;  4ECZ A;  4A3E G;  3H3V H;  1WTH A;  4IPD A;  4POF A;  1A63 A;  3HOX G;  2HCI A;  1X3E A;  2CW0 C;  2E2H B;  2OEO A;  3HFZ B;  2DPI A;  1B4O A;  2F0V A;  4JK1 C;  2R7M A;  5EKL A;  1W3S A;  4O3N A;  4J9M A;  4I50 F;  1J5E Q;  5E7N A;  2VUM A;  1FR3 A;  3F2B A;  4G7Z C;  4YB8 B;  4MTN A;  1HUN A;  1SYB A;  4MA5 A;  3IN5 A;  1JB3 A;  2E5L H;  5J2T F;  2KEN A;  3MVV A;  3AFP A;  4MN3 A;  3VR2 A;  1LTS D;  2PYK A;  4OX9 L;  3GIL A;  1HNZ Q;  5COR A;  4A3D H;  2E74 C;  1PH6 A;  3OHX C;  2JA6 G;  4BY1 B;  1X65 A;  3CHB D;  3GIQ A;  4TSS A;  2K01 A;  2W9C A;  4NLG A;  1RDP D;  4PMW A;  1VQK A;  4BXX G;  5CC4 A;  3EA6 A;  2NU9 B;  2D0O A;  1CTM A;  2AWO A;  2L15 A;  4R1J A;  2XGQ A;  2OH2 A;  3TME A;  1ML0 D;  1DOL A;  4LFC H;  4XTC S;  4I4T F;  4WD3 A;  1MHW C;  2OTL A;  3RZD H;  3H3V I;  3SK5 A;  2DLN A;  1JE5 A;  1YNN D;  2MO1 A;  4O2A F;  1WCM G;  2YYZ A;  5H80 A;  1AN7 A;  1VQM A;  1CS0 A;  4NP5 A;  3TII A;  1TWC A;  3W3A A;  5KFQ A;  5I6W A;  2RDF A;  2IMW P;  5BN3 A;  1BF4 A;  2K33 A;  4YY3 L;  4LH7 A;  4XYL B;  2PNR C;  1BCP D;  3Q8D A;  3Q6S A;  2W9B A;  1JR0 D;  1WYD A;  2MPM A;  3TSS A;  3PW4 A;  2VQE Q;  4DV0 H;  3HOV H;  1VQ7 A;  3PUY A;  4J15 A;  2GA4 B;  4PZ8 A;  4ED6 A;  5L9X A;  4MA0 A;  2AUJ D;  5KG7 A;  3AEV A;  5IYC H;  3FPP A;  1JWU D;  3V6J A;  1KHI A;  1FKA H;  2K50 A;  4B9X A;  3KFU A;  2R7Z A;  2W70 A;  3RB4 A;  1PHJ A;  4IOA A;  1JOK A;  1HNW L;  4JW0 A;  1IKM A;  2B2W C;  4K2K A;  2O03 A;  3GTO H;  1BXR A;  3ICE A;  4A3K G;  3R93 A;  3K5N A;  2Z6B A;  4JBM A;  4E6I A;  1SDF A;  2VS1 A;  3U9T A;  4IJL A;  3M85 A;  4QF4 A;  2VPQ A;  3NEL A;  4X66 Q;  1PX2 A;  4ECX A;  1IBM H;  3RGX A;  4EYH B;  4UCV A;  2NVT B;  2VUM B;  1U0L A;  2ZXR A;  1Y8N B;  4LF7 Q;  3HOZ G;  3CCJ A;  4ZQI A;  4F4Y A;  4HJ9 A;  1LTT D;  2JSO A;  5C8Y F;  2K5V A;  4H44 C;  4LFC L;  1LM0 A;  1XMQ H;  4LH6 A;  2RHQ B;  4JI3 L;  4OWT B;  2QF7 A;  3AB9 A;  1H95 A;  1QWY A;  3GID A;  5KNB A;  5GAD C;  2W9C B;  3KLW A;  2OF1 A;  5IGC A;  1SJH D;  2R87 A;  3J81 L;  4A3F B;  3U50 C;  5BN4 A;  1EUC B;  4OWX B;  4PQX A;  1XDN A;  1TWF A;  4FBU A;  3SVM A;  2V59 A;  1CQI B;  1VQF A;  3MTS A;  4U68 A;  5ELN A;  4DV0 L;  4OEM B;  4XQN A;  2HHH H;  3H20 A;  4E4T A;  3CQZ A;  1I6H H;  1TWC B;  2G9H D;  5IYB H;  1VQC A;  2DIK A;  1F2M A;  2CFM A;  3V4Z A;  3QOL A;  1LT6 D;  1RTN A;  4TV9 F;  2E76 C;  2W9B B;  1RJP A;  1K8O A;  3PR5 B;  1N33 H;  3K7U C;  4DKA C;  4UCS A;  5A2Q W;  1K0R A;  5IGE A;  3GTK A;  2HT1 A;  1E4G T;  3T5J A;  4JV5 Q;  3U4V A;  1N32 H;  5COY A;  1BUV T;  4IUT A;  1Y8O B;  3K3V A;  4UCT A;  5D8D A;  1S0M A;  1SNO A;  1LTR D;  2PNH A;  5KFE A;  2ZM6 H;  2W6M A;  5DG9 A;  3I3C A;  4L5T A;  3UI2 A;  1OXU A;  3JSN A;  1BCP F;  1G29 1;  4BBR H;  3PO3 H;  1IBM L;  2XCA A;  2AGP A;  2R7Z B;  3GTP A;  2B2Y C;  3OPO A;  4HSP A;  4YWM A;  3I8Z A;  5CBA E;  3VPB A;  5I2X A;  4DL6 A;  4IR1 A;  4I7A A;  5GQO A;  1DON A;  1LV9 A;  5FLX E;  5KRU A;  1Y1W H;  1XMQ L;  4FU0 A;  1Q8K A;  3EQL C;  3H15 A;  1F2Z A;  3LML A;  2XGT A;  4DLK A;  4B3S H;  3QZ7 A;  2CW0 D;  3HP3 A;  5C5M A;  3GTM A;  4ETS A;  1PRT C;  3VA5 A;  5JAV A;  3JSL A;  2R7K A;  3GTQ A;  5C44 H;  4ECT A;  4LW1 A;  4DR3 Q;  1R9T A;  5LMN Q;  3K5O A;  4IUV A;  1X55 A;  4APM A;  4F4Z A;  2G5D A;  4FXK C;  2HHH L;  2JP1 A;  4XQJ A;  4A3E H;  4JBK A;  3CPF A;  2A5H A;  1ZXT A;  1O7Z A;  4NXN Q;  3LP8 A;  2ICE C;  2AHO B;  3DLL A;  1S72 A;  3PO2 B;  4Q0F A;  2O2L D;  1XNR L;  2KHJ A;  4RGN A;  2FE3 A;  1ZHS A;  1N33 L;  1TWF B;  3KUP A;  3MAQ A;  1JJ2 A;  3KF6 A;  4FBT A;  1M4V A;  1TT2 A;  1IL8 A;  3UDX A;  4BBS G;  3CQZ B;  1MD2 D;  2GVB A;  4HIM A;  3HOW G;  1N32 L;  3DEP A;  2YYA A;  1K3B C;  4P74 A;  3F8N A;  2YS7 A;  5KFH A;  3K0X A;  5ELE A;  1D5X C;  4EQN A;  2JA6 H;  2ZM6 L;  1AH9 A;  1J5E H;  4CC6 A;  1CZW A;  4BXX H;  2K32 A;  4CDC C;  3GTK B;  2YRX A;  4HQ6 A;  1BQQ T;  3M9B A;  4DR5 Q;  3VR6 A;  1HRJ A;  1HNZ H;  4Q44 A;  2HIV A;  4RKL A;  5C4X G;  3T1H Q;  1EU3 A;  1ZKO A;  5IT9 E;  2P0A A;  4EG0 A;  1F2Y A;  1WCM H;  2LXK A;  4B3S L;  1JDB B;  1IYV A;  1PFS A;  4PMB A;  2CHB D;  1LYL A;  2JEF A;  2L5T A;  2IX0 A;  4L5R C;  3F8T A;  1HCZ A;  3GTP B;  4DR4 Q;  1KJI A;  2R8I A;  5JOB A;  3GIP A;  3R5H A;  4A3M B;  4Y7N H;  4RB2 C;  4GKJ Q;  4J9L A;  2R6F A;  1YJ9 A;  3NWT A;  4JOI A;  1L0Y B;  3GTM B;  4I7H A;  1PH8 A;  1EQQ A;  3JZI A;  2AQ1 B;  3GTQ B;  3X3N A;  4MV4 A;  1UC8 A;  2VQE H;  4KY7 A;  1R9T B;  1OTC A;  2ZDQ A;  3S15 H;  3CPW A;  4YCW A;  1B04 A;  1JDE A;  4A93 H;  3KBG A;  2KCC A;  1HXY D;  4C3H H;  3CXC A;  4JG2 A;  3V96 A;  2PBZ A;  1WTR A;  2R7N A;  3GV8 B;  2WE6 A;  4KHZ A;  1C3O A;  3SGI A;  4ZLT F;  1CE8 A;  2KEE A;  1PFN A;  4WJ3 M;  2FB9 A;  3OSN A;  4X3T A;  4ZKB B;  3GTG H;  3GII A;  4Y8V B;  1TAE A;  3KF6 B;  1EIY B;  1JOR A;  1JCK B;  2NUC A;  1K8M A;  3HOZ H;  4EFE A;  5IYD G;  3I56 A;  3S1N H;  1KDA A;  1QUQ A;  2P5Z X;  2I0Q A;  2QK4 A;  3Q8S B;  4X66 H;  3ONA B;  3OTO Q;  1LTB D;  1Q86 C;  3C3L A;  5C1O A;  3T1Y Q;  1VF5 C;  2NB0 A;  4LF7 H;  1CA6 A;  5I47 A;  3KAL A;  4GC6 A;  2WB1 E;  4GLV B;  3GIM A;  5J22 A;  2L11 A;  2ASJ A;  1TY0 A;  2WAC A;  4Q8F A;  1JLL B;  5EPL A;  3IFT A;  1M0W A;  1N56 A;  4BA2 I;  4LF4 Q;  2UU9 Q;  2F0H A;  2HJW A;  2Y0S E;  1M7J A;  2NVX H;  5M5X B;  3RN5 A;  5I2Y A;  1MGS A;  1JWS D;  2AWN A;  2NU8 B;  4IN3 A;  1E7Z A;  4OIK A;  2VQE L;  2PPB C;  4OO1 H;  3PW0 A;  1Q1E A;  2B2T A;  4DUZ H;  2CWP A;  4C5A A;  1HZC A;  3I4N B;  3W1B A;  1EY9 A;  3NEN A;  1KBL A;  3NK9 A;  1TA8 A;  4DL4 A;  1NAP A;  3EBE A;  1K83 A;  2BQ3 A;  1SEB D;  1NJI C;  3M4Q A;  1RK5 A;  2EYM A;  4F4X A;  1TWG H;  1YVC A;  2L0C A;  3UDI A;  2W57 A;  3TQ1 A;  1D1I A;  5G3L D;  3TZD A;  1PRT D;  4DR7 Q;  1DCZ A;  3RJ0 A;  4JV5 H;  1TQO A;  3W1G A;  2F52 A;  4ECW A;  1UE7 A;  3BQ0 A;  1HQR D;  4DV2 L;  1H9M A;  1E2W A;  1HTP A;  5BMV F;  1II3 A;  4LNQ A;  4X66 L;  2WII B;  1XPR A;  4LF7 L;  4OO1 I;  1FL0 A;  3G48 A;  3HGB A;  3J80 E;  1HR0 Q;  1TII D;  1JX4 A;  4HR7 A;  1ASZ A;  1GSA A;  1JJG A;  2E2D C;  4C3J B;  3PIO 3;  4X65 H;  1QUQ B;  2Z1C A;  3S17 B;  3N40 P;  2JA7 G;  4X62 Q;  1K8A C;  3C2P A;  1A15 A;  2JXM B;  3K81 C;  4C2M H;  5L1I A;  1V8Q A;  4O1N A; 
#chains in the Genus database with same CATH homology
 2Q2H A;  1Q46 A;  4DK3 C;  4YHH Q;  2R93 H;  1JT8 A;  1SN8 A;  2B3G A;  2IX1 A;  1D8L A;  5GAG C;  5K36 G;  3D0F A;  2AKW B;  3STB D;  3CC7 A;  3CMA A;  4DR5 Q;  2NZH A;  4R4O A;  3A74 A;  2CCZ A;  1UE1 A;  4DUZ L;  2VZA A;  2LXJ A;  1K3R A;  4OXP A;  1PH5 A;  4BBS H;  4YCU A;  2UUB L;  2IHE A;  1E3P A;  2WB1 G;  3CCS A;  4BA1 I;  3HOW H;  2MQH A;  1UE5 A;  5M5X H;  1QVG A;  3CC2 A;  1B8A A;  4JBJ A;  2ZTE A;  3KJO A;  4LF5 L;  1WFQ A;  4JI8 Q;  3RZO H;  1YBY A;  3JC6 6;  4GN4 B;  1VQ8 A;  3S1Q H;  4AYB E;  5JJK A;  5M5Y H;  4JV5 L;  4DR2 L;  3PIP A;  3KDF A;  2Y0S G;  4IFD G;  1WOC A;  4B3M L;  3FKI G;  1GVP A;  4IPH A;  3I4N H;  5C0X I;  3OYY A;  3RLF A;  5C4X H;  4BY1 G;  1BKB A;  2Z6K C;  1IBK L;  1X6O A;  1PVO A;  1D7Q A;  1PH1 A;  3ULJ A;  1GD7 A;  4DV1 Q;  4LF8 L;  4DV2 Q;  5HGQ A;  1C9O A;  2D62 A;  1U5K A;  4KLK A;  1VQD A;  4B3T L;  1HJP A;  4IOC A;  2VL6 A;  5FLX c;  1L1O B;  2JQO A;  3KJP A;  1N33 Q;  4JI6 Q;  1JB7 A;  4AQY L;  4R4Q A;  1X56 A;  2UXD L;  1Q1B A;  3CC4 A;  1S3O A;  2Q2T A;  4X65 L;  1Q12 A;  3TQY A;  1LTL A;  2K5N A;  1MKH A;  2EQS A;  5IYB G;  3S1R H;  1J5E L;  1JMC A;  3I4M G;  1HZA A;  4QL5 A;  4APV A;  1PYS B;  2YTV A;  1IBL Q;  1V1Q A;  1OXX K;  2ZM6 Q;  2OQK A;  1HNZ L;  4DR3 L;  3RLN A;  4GN5 A;  1HZB A;  3CQZ H;  4P72 A;  4A75 A;  2A8V A;  3PUZ A;  1EIF A;  1Y14 B;  4GOP C;  1G51 A;  1Z47 A;  4R4C A;  4R4I A;  4C3J H;  3S17 H;  1VCI A;  3ER0 A;  3F2D A;  1MIU A;  5LMU Q;  4Y52 H;  1N9W A;  1CSP A;  1Y1V G;  2ALY B;  4LUV A;  2GN5 A;  1PV4 A;  1EUJ A;  4BBR G;  3PO3 G;  4A3L G;  4B3S Q;  1E1T A;  1SRU A;  4JCV E;  3A5Z B;  2OQ0 A;  2Q2I A;  1VQN A;  4DUZ Q;  3S2D H;  4GN3 B;  1N36 L;  1VQP A;  4LF6 Q;  4BY7 G;  1KXL A;  1BBU A;  1QVC A;  3CCV A;  3AQQ A;  3I4M H;  3KOJ A;  3I2Z A;  1L0W A;  1HNX Q;  2UXC L;  5LMN W;  2UUB Q;  1AE3 A;  1Y1W G;  3PUW A;  1C0A A;  1XPO A;  3M4O H;  4LF5 Q;  5IYD H;  5C3E G;  2I5M X;  5ELO A;  2VQF L;  1I3Q H;  3PGZ A;  1XNQ L;  1PH9 A;  1KRT A;  4DR2 Q;  2IY5 B;  4X64 L;  2ZTD A;  4JYA L;  5M3F G;  5C44 G;  4B3M Q;  2B63 H;  1I50 H;  1PA6 A;  4A3D G;  2BH8 A;  3K80 C;  2NN6 I;  5BR8 L;  4DV4 L;  4DR5 L;  3CCL A;  2JEB I;  1J6Q A;  3MEF A;  4AH6 A;  3U58 A;  5IT9 c;  1IBK Q;  2QEX A;  3KDF B;  3T1H L;  2F4V L;  1Y1V H;  3OW2 A;  4A3L H;  1K83 H;  4HID A;  3L7Z C;  4LWC A;  1SR3 A;  3LGJ A;  1YHB A;  4A3E G;  3RLO A;  3H3V H;  4JI7 Q;  4IPD A;  4POF A;  3GTQ H;  1A63 A;  3HOX G;  2EIF A;  2ID0 A;  2KBN A;  4BY7 H;  4IFD J;  3AFQ A;  1X3E A;  4A3B H;  4A3G G;  3HFZ B;  4EX5 A;  4AYB G;  4AQY Q;  4A3F G;  2D0P A;  4DV5 L;  1W3S A;  3L2P A;  2UXD Q;  1P16 A;  3BZK A;  1YNX A;  2CKZ B;  1GO3 E;  2V1C C;  3KF8 B;  5E7N A;  4X65 Q;  3GTJ H;  2QA4 A;  2Z6K A;  3G6E A;  3F2B A;  1J5E Q;  2ES2 A;  4GKJ L;  4MTN A;  1DGS A;  4DAY B;  1K8G A;  3BU2 A;  2KEN A;  1N34 L;  3AFP A;  3RN2 A;  4OX9 L;  4HIK A;  1QZH A;  3HOU G;  2E8G A;  3UDF A;  1HNZ Q;  3PUX A;  3ULP A;  4A3D H;  4DR1 Q;  4B3R Q;  1PH6 A;  2JA6 G;  3HOV G;  1X65 A;  1I94 L;  1A0I A;  4PMW A;  1VQK A;  4BXX G;  2D0O A;  1NMF A;  2AWO A;  2KCT A;  2L15 A;  4R1J A;  1KL9 A;  3CF5 A;  2JEA I;  1PYB A;  1IXR A;  3JAM i;  1VQI A;  3HOX H;  4GKK Q;  5IYC G;  4XTC S;  2R6G A;  1SRO A;  2OTL A;  3RZD H;  3H3V I;  1JE5 A;  2MO1 A;  2N49 A;  2WAQ E;  1WCM G;  2YYZ A;  1N36 Q;  3MXN B;  1VQM A;  2E2I H;  3I55 A;  1OXT A;  2N8N A;  3ZJY C;  1B70 B;  1YHQ A;  3E9H A;  2EXD A;  4YY3 L;  4GOP A;  2R7Z G;  3I7F A;  4JI0 L;  3Q8D A;  2GVA A;  3L0O A;  1WYD A;  5M3M G;  2IHF A;  4LFA Q;  4HJ7 A;  3VDY A;  4HJ5 A;  2VQE Q;  3HOV H;  1VQ7 A;  1XNQ Q;  3PUY A;  4MNO A;  2A1A A;  2JK8 A;  4J15 A;  4X64 Q;  4PZ8 A;  4JYA Q;  4HIO A;  3OTO L;  2VNU D;  5AJ3 L;  1YEZ A;  4A3C G;  2MO0 A;  1CKO A;  3B6Y A;  3AEV A;  4OWW B;  2OTJ A;  3FP9 A;  2JA7 H;  4DV6 L;  2FXQ A;  5IYC H;  3J81 i;  1X3G A;  1KHI A;  1RL2 A;  1VQH A;  2JA5 H;  2K50 A;  3KFU A;  1P8L A;  4LF9 L;  3KYH C;  1PHJ A;  4IOA A;  1HNW L;  2JJQ A;  3IRB A;  4JI5 L;  3PIO A;  3UDG A;  2UUC Q;  3GTO H;  2LSS A;  2PQA A;  5IE8 A;  1AE2 A;  4A3K G;  1SE8 A;  3ICE A;  4JBM A;  1VQJ A;  2H5X A;  2VS1 A;  3PCO B;  2YV5 A;  5HY6 A;  2K52 A;  3A0J A;  5IP9 G;  1XJV A;  2UU9 L;  1X54 A;  4IJL A;  3GDE A;  3M85 A;  3S24 A;  1XMO L;  1WI5 A;  3I4O A;  2E2H H;  3S14 H;  2N3S A;  1M90 C;  3NEL A;  4X66 Q;  3EN2 A;  1Q81 C;  1MJE A;  3PO2 G;  4UY8 C;  1N34 Q;  2PI2 A;  1K73 C;  1NY4 A;  1FGU A;  1U0L A;  3CAM A;  4DPG A;  4LF7 Q;  3HOZ G;  3D31 A;  4GLA C;  3CCJ A;  4JI4 Q;  4HJ9 A;  1G6P A;  1KAW A;  2K5V A;  3PSI A;  4PZ7 A;  4LFC L;  2R92 G;  1OXV A;  1LM0 A;  4DNI A;  5IY0 A;  2RHQ B;  4JI3 L;  2DUD A;  4UPA A;  4OWT B;  3FKI H;  2JA8 G;  1EYG A;  2XTI A;  1H95 A;  4JI2 L;  1VQG A;  5GAD C;  1YJW A;  3KLW A;  4P73 A;  5LMN L;  4BY1 H;  4UP8 A;  4JI1 L;  2QGQ A;  2WFW A;  4NPS A;  4A3K H;  4A3I G;  1YJN A;  2A19 A;  2UUA L;  3U50 C;  1SLJ A;  2JA9 A;  1SMX A;  4OWX B;  3M3Y H;  4NXN L;  1VQF A;  5ELN A;  1W2B A;  1MJC A;  4DV0 L;  4YY3 Q;  1VQ5 A;  2K75 A;  4DV7 L;  4L5S A;  4JI0 Q;  1VQ6 A;  2IT1 A;  1I6H H;  1QVF A;  5IYB H;  1VQC A;  4DR6 L;  2CFM A;  4TVA B;  2PI2 E;  4GOP B;  3J81 j;  4DAM A;  3J80 c;  4A3M G;  3H0G G;  4JC0 A;  5AJ3 Q;  3K7U C;  2WAQ G;  4DKA C;  4LFB L;  2Z0S A;  2KCM A;  1K0R A;  1Q7Y C;  2HT1 A;  1NMG A;  1VQE A;  4DV6 Q;  4JV5 Q;  2ASB A;  2NVY H;  4TQU S;  3U4V A;  4X62 L;  4IFD I;  1JJC B;  2VUM G;  2VW9 A;  1PH7 A;  4RMF A;  5EAY A;  1VQL A;  1KQS A;  4LF9 Q;  2NVQ H;  2PNH A;  3JAM c;  1HNW Q;  4JI5 Q;  3CCU A;  4NB3 A;  4L5T A;  1OXU A;  4JOI C;  1G29 1;  4BBR H;  3PO3 H;  4NXM L;  1IBM L;  3CD6 A;  3FHW A;  3TS2 A;  4LF8 Q;  4ALP A;  3AYH B;  5C4J H;  1WJJ A;  2RHS B;  3CP0 A;  1HR0 W;  4B3T Q;  1YZ6 A;  4X6A H;  4YWM A;  1XMO Q;  2Q2U A;  2PQA B;  1CUK A;  4IJH A;  3A5U A;  5GQO A;  4KHP L;  1VQ4 A;  1HZ9 A;  1E1O A;  4DR4 L;  4FDB A;  3GO5 A;  1Y1W H;  1XMQ L;  2YU9 H;  1GM5 A;  1Q8K A;  3H15 A;  3RR5 A;  2XGT A;  5C3E H;  1E22 A;  3HOY G;  3EIV A;  5IP7 G;  3HKS A;  3J80 i;  4JI8 L;  3NBH B;  1EQR A;  4JI3 Q;  2NVT H;  5M3F H;  5C44 H;  4DUY L;  2VUM H;  4LW1 A;  4DR3 Q;  3J7A 5;  4JI2 Q;  3GTL H;  3PF4 A;  2C35 B;  5LMN Q;  3BJU A;  1V9P A;  2B29 A;  1X55 A;  5C0X G;  3J81 c;  3PV0 A;  4A76 A;  4IO9 A;  2HHH L;  4A3E H;  4QJF A;  1UEB A;  3CPF A;  4A3J G;  4JBK A;  1V43 A;  4NXN Q;  1UWV A;  3ULL A;  2AHO B;  3DLL A;  1S72 A;  4A3G H;  4GNX C;  1EOV A;  4A3F H;  2RF4 A;  2KHJ A;  1XNR L;  3GD7 A;  2JE6 I;  1N33 L;  4JI6 L;  1JJ2 A;  3K8A A;  2BA1 A;  1O7I A;  4DR6 Q;  1FVI A;  2YTY A;  3KF6 A;  3TS0 A;  2ATW A;  2UXC Q;  3UDX A;  5IP7 H;  4BBS G;  4K0K L;  1VS0 A;  2GVB A;  1B7Y B;  4HIM A;  2BH2 A;  3HOW G;  1N32 L;  1HH2 P;  3HOU H;  1TWC H;  4P74 A;  1IBL L;  4LFB Q;  1OXS C;  2VQF Q;  5JEA G;  5GAH C;  3K0X A;  2OCE A;  1AH9 A;  2JA6 H;  1YHA A;  3E0E A;  4O2D A;  2ZM6 L;  5H1S E;  1YIT A;  3CCQ A;  1FJG L;  3UE1 A;  4BXX H;  5GAE C;  3T1Y L;  2I5H A;  2WP8 J;  3CW2 C;  3BZC A;  1EWI A;  3M9B A;  4OON A;  3STB C;  3UE0 A;  5BR8 Q;  4AIM A;  2VY3 A;  2HIV A;  5GRO A;  3J7Z C;  2ZJP A;  5LMU L;  5C4X G;  1LUZ A;  4QGU A;  3T1H Q;  2F4V Q;  4P75 A;  1EFW A;  1IBM Q;  4NXM Q;  4PG3 A;  1CKM A;  4UP9 A;  2F3I A;  1WCM H;  2LXK A;  1CSQ A;  4C3I H;  1Q82 C;  4B3S L;  1PFS A;  1PH2 A;  2OWO A;  4O0A A;  1LYL A;  2IX0 A;  4GLX A;  4L5R C;  3F8T A;  4LF6 L;  2E5L L;  4DR4 Q;  4KHP Q;  4A93 G;  1BBW A;  1TWA H;  2R7Z H;  4DV5 Q;  4LF4 L;  1XMQ Q;  1HNX L;  4LUZ A;  1TXY A;  4Y7N H;  4GKJ Q;  5M3M H;  1XPU A;  1YJ9 A;  2HIX A;  4UP7 A;  4JOI A;  3WWV A;  4DV4 Q;  4OX9 Q;  5J3B A;  5DLQ E;  4DUY Q;  1XTD A;  4A3C H;  1L1O C;  1PH8 A;  3ERS X;  1EQQ A;  1I94 Q;  3M4P A;  4IPG A;  1ASY A;  2NN6 G;  1M1K C;  1IL2 A;  1IZ6 A;  5IWA L;  2HHH Q;  4HJA A;  1OTC A;  4DR7 L;  2UXB L;  3S15 H;  1PH4 A;  4JI7 L;  3CPW A;  4WJ4 A;  4YCW A;  3HKZ E;  4A93 H;  1XNR Q;  3G4S A;  5IP9 H;  4C3H H;  5C0X J;  1KC8 C;  3CXC A;  4JG2 A;  4YWL A;  1GKH A;  1CKN A;  4KHZ A;  3W5O A;  3I4N G;  1NE3 A;  3SGI A;  3S2H H;  3PO2 H;  4K0K Q;  2MFI A;  2ZTC A;  4WJ3 M;  4R4T A;  2PMZ E;  1N32 Q;  3GTG H;  2RCN A;  5FLM G;  1TWF H;  4DK6 C;  1K9M C;  3KF6 B;  1Z9F A;  1EIY B;  2R7D A;  3HOZ H;  5IYD G;  3I56 A;  4HJ8 A;  3S1N H;  1L2F A;  2DGY A;  4PZ6 A;  4EQ5 A;  2K14 A;  1QUQ A;  4IPC A;  1VQB A;  4GNX A;  4DR1 L;  2YTX A;  1YIJ A;  2I0Q A;  1FJG Q;  2R92 H;  4B3R L;  4OO1 G;  3OTO Q;  1HR0 L;  1Q86 C;  5JJL A;  2K4K A;  3T1Y Q;  2JA8 H;  2B63 G;  1VQA A;  3F1Z A;  1I5F A;  1A8V A;  4QIW E;  4GKK L;  5JEA J;  3TEH B;  4DV3 L;  5M5W H;  4A3I H;  2WB1 E;  4GLV B;  1KRS A;  5FJ8 G;  3PF5 A;  3GTK H;  4LUO A;  1S40 A;  3CME A;  4YHH L;  1BVS A;  1RIP A;  3PUV A;  3S1M H;  4A3B G;  2E5L Q;  3TRZ A;  2I5L X;  4BA2 I;  4QY7 A;  4LF4 Q;  1C7Y A;  2UU9 Q;  1KD1 C;  2Y0S E;  5FLM H;  1PH3 A;  2NVX H;  3RN5 A;  3G71 A;  1QZG A;  4LFA L;  2E2J H;  4POG A;  3GTP H;  2AWN A;  2VQE L;  1E7Z A;  4QQB X;  4A3M H;  3CCR A;  3H0G H;  3E9I A;  1Q1E A;  2CWP A;  1HZC A;  3U4Z A;  3W1B A;  4JBW A;  3NEN A;  3EBE A;  4LFC Q;  4RG1 A;  2BA0 A;  3TRE A;  1NJI C;  3M4Q A;  3GTM H;  4P71 A;  5IWA Q;  1TWG H;  1YVC A;  4L5Q A;  1UE6 A;  2CWA A;  3UDI A;  5FJ8 H;  3CCE A;  1KIX A;  1VQ9 A;  2NZO A;  4DR7 Q;  3NEM A;  2UXB Q;  4GS3 A;  1SFO H;  4JI1 Q;  4ME3 A;  1X3F A;  3CCM A;  3M7N A;  2UUA Q;  2UUC L;  1R9T H;  3W1G A;  2MNA A;  1L1O A;  3RNU A;  2F52 A;  1UE7 A;  4DV1 L;  2R93 G;  2HQL A;  4YCV A;  4DV2 L;  1YI2 A;  2N78 A;  4DV0 Q;  1X9N A;  2KHI A;  4DV7 Q;  2AMC B;  4LNQ A;  4X66 L;  1VQO A;  4H02 A;  4XIG S;  1CKN B;  1XPR A;  3DM3 A;  1E24 A;  1TWH H;  4LF7 L;  3HOY H;  4A4I A;  1A62 A;  1FL0 A;  3G48 A;  4JI4 L;  4OO1 I;  3HKZ G;  3K7A H;  3F2C A;  1HR0 Q;  4YWK A;  2K5H A;  2R7F A;  1ASZ A;  1NBW A;  1IYJ B;  2CQO A;  1N8R C;  5JJI A;  1JJG A;  1QUQ B;  2ZJQ A;  4GNX B;  2JA7 G;  4X62 Q;  1K8A C;  3S16 H;  4DV3 Q;  2ZJR A;  1NTG A;  4KI0 A;  1T9H A;  3K81 C;  4MZ9 A;  2JA5 G;  4C2M H;  4A3J H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...