3I4MG

8-oxoguanine containing rna polymerase ii elongation complex d
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Molecular basis of transcriptional mutagenesis at 8-oxoguanine
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2009-07-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 3i4mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 3i4mG01
1VQHA 3E9HA 1NE3A 4LF5Q 1WI5A 4XIGS 3J7ZC 2N49A 1UE7A 2FXQA 4A3BG 2NZOA 5BR8Q 4C3IH 1N34Q 1S3OA 1D7QA 1XPUA 3M3YH 3FP9A 4JBJA 1N33Q 4TVAB 1Q7YC 4YCVA 2VNUD 3OYYA 3Q8DA 5LMNW 1PH1A 5C0XG 4UY8C 2HHHQ 3CCLA 1TXYA 3PIOA 3CMAA 3CAMA 2KHIA 3BJUA 1X65A 2ZJQA 1N9WA 1H95A 2AWOA 1W3SA 4AYBG 1E1TA 5C3EH 1HNWL 4JI1L 2YV5A 4JI3L 2OQKA 1WYDA 4UPAA 2JA7H 4BBSH 3H0GH 2IY5B 2WP8J 4A3LG 1X56A 4JI5L 3AQQA 1N36Q 3ICEA 4AYBE 2UXDQ 2UXCQ 4GLVB 4XTCS 3UDGA 3T1HL 2PQAA 3HFZB 1VQ4A 2ASBA 1MIUA 3E9IA 1DGSA 2CWPA 3UDXA 4AQYQ 2UU9Q 2Q2IA 1VQFA 4LFBL 3CCRA 1K3RA 1SMXA 5IE8A 2MO1A 1R9TH 2KCTA 1UEBA 2JA8H 4DK6C 4A3MG 5J3BA 1PYSB 1LYLA 1C7YA 4BXXG 1A8VA 5GADC 1KC8C 4B3SL 2K5NA 3PUYA 5IYDH 4A3KH 4GS3A 4JI6Q 1EOVA 4P75A 4IPGA 2MQHA 1PH8A 5GAGC 4LFCL 2CQOA 3BZCA 1S40A 5C4XH 1BKBA 3HOZH 2F4VL 2PMZE 4X66Q 1XMOQ 3GTKH 2N8NA 3S24A 5LMUQ 4IOAA 1HZAA 1VQAA 1N34L 4R4QA 2H5XA 3T1YL 3RZDH 2ES2A 1Q81C 1UWVA 4B3ML 3MXNB 4DV1Q 1QZGA 1VQ9A 2R92H 4DR4L 4JG2A 1XNRL 4A93G 2VZAA 4GLXA 3CF5A 4LF7L 4L5RC 1CKNB 3PIPA 3RR5A 4NXMQ 2A1AA 3KF6A 1Y1WH 3S2DH 1Q1EA 3HOVG 4GKJL 1I50H 4DPGA 2E2HH 1NMGA 1SE8A 2VL6A 5IP7G 3I56A 2VQEL 1PHJA 1NBWA 1GO3E 3J80c 1Q82C 2EIFA 1OXVA 5GROA 4JI7Q 1B70B 4EQ5A 2I5MX 4OWWB 3RLNA 5M3MG 3JAMi 4DV2Q 3PO3G 1YITA 4DK3C 1XNQQ 1WJJA 1EQQA 1OXSC 1PFSA 1YEZA 3PSIA 5H1SE 5IYBG 4NXNQ 4A4IA 2K14A 3I2ZA 1N32L 1VQJA 4ME3A 5IYCG 1HJPA 5LMNQ 1EFWA 3J80i 1E3PA 3PF4A 1M1KC 3RLOA 3I4MH 2C35B 1HZBA 2VW9A 2HT1A 5JJKA 2LXKA 4BA2I 4R4IA 1Z9FA 4Y7NH 3HOXG 3PUVA 1SROA 1U0LA 5GAEC 3OTOQ 4B3RL 5C44G 2DGYA 2WB1G 1VQ8A 4YCWA 5IY0A 2B63G 2YU9H 4YWMA 1I94Q 3AEVA 1OXXK 2KCMA 3HOWH 4BBRG 3CC4A 1XTDA 4HIMA 4X62L 1SR3A 1CSPA 1E1OA 2Z6KA 1PH4A 1UE6A 2I0QA 5FLMG 4OXPA 2B29A 4X64L 1O7IA 1VQNA 1VQIA 2ID0A 3PUWA 4DR2L 3HOYG 1YZ6A 2AMCB 1HNZQ 4DR7Q 4GNXC 3S1MH 3FKIH 3M85A 1WFQA 2HIXA 3L7ZC 1YI2A 4QJFA 1KHIA 1V43A 4DV7Q 3OW2A 1M90C 1ASZA 1OXTA 4OONA 2AKWB 4P74A 4DV3Q 2Q2TA 2UUAL 4A3DH 1I6HH 4MNOA 3MEFA 5IP9G 1JJ2A 4BY1H 2VUMG 2CFMA 1XMQL 1PH7A 2UUCQ 4JI2L 3KF8B 3CW2C 2E2JH 4MTNA 4UP8A 2R7ZH 3PO2H 4QL5A 4YHHL 4WJ3M 1AH9A 3TRZA 1RL2A 2OTLA 4LF6Q 4A3CH 4ALPA 1X6OA 3PV0A 4DV5Q 5FJ8H 1IXRA 1YJNA 3W1BA 2UXBQ 4HJ9A 5JJLA 4DR1L 1PH9A 4C2MH 3S14H 1B8AA 4P72A 4APVA 4A3EH 4NB3A 1FL0A 1VQDA 1VQ5A 4DUYQ 2ZM6Q 1GVPA 1B7YB 4L5SA 3KF6B 1SFOH 3CD6A 3S1QH 3AFPA 2OTJA 1A62A 5BR8L 4LF4L 3GTJH 1T9HA 3W5OA 2JA5G 4A3BH 1K8AC 1N33L 1QUQA 1RIPA 5HY6A 4YY3Q 2A8VA 3UE1A 1UE1A 3B6YA 4WJ4A 3ZJYC 1XJVA 3ULLA 4LF9Q 4A3JG 1VQ7A 4GN3B 3K7AH 4HJ7A 4BY7H 4DV0Q 1KXLA 1NMFA 1NY4A 3CCVA 4GOPB 1YJ9A 4UP7A 1BVSA 2LSSA 4GKKL 3F2CA 4OO1G 4A3GH 3K8AA 4HIDA 2MNAA 4HJ8A 3S1NH 1AE2A 4UP9A 3GDEA 1OXUA 2E8GA 1Q12A 2BA1A 2F52A 4JBMA 4X65L 3DM3A 1KQSA 4AQYL 5C0XJ 1CSQA 4QY7A 1P8LA 1G51A 5C3EG 1V1QA 4IOCA 3GTOH 4LNQA 1IBKQ 3M9BA 4J15A 4JI1Q 4POGA 4BBSG 3S17H 4BXXH 1EQRA 1Y14B 4K0KL 4TQUS 2IHFA 4IFDI 3GTMH 1X54A 1Y1VH 4JI6L 3I7FA 3GTLH 2D0PA 3KJPA 1VQBA 2RF4A 3K81C 4KHZA 4B3TL 4X66L 3HOUH 5M5WH 4DV4L 4LFBQ 2JA8G 4LUOA 1QVGA 1HR0L 5LMUL 3DLLA 5IT9c 4DR3Q 4HIOA 3KDFB 3G48A 3S1RH 4LUZA 4DR6L 1N8RC 4JBKA 1KD1C 1SN8A 4B3SQ 3S16H 2NVXH 4JI8Q 4A93H 2NN6I 1A63A 4KLKA 2JE6I 2PI2E 4QGUA 3A74A 5DLQE 4LFCQ 2KBNA 2QA4A 3PCOB 3G4SA 1YIJA 1PH3A 3I4NG 4PG3A 2D62A 5ELNA 4L5TA 4FDBA 1K9MC 2JA6G 5IP7H 4GNXA 1GD7A 1TWHH 1L1OB 1HZ9A 1X55A 3EIVA 4RG1A 3L2PA 3T1YQ 1S72A 2E5LL 2R92G 3KFUA 4B3MQ 2QEXA 3F2BA 1VQCA 2Y0SG 3M4PA 3NENA 2N3SA 5M3MH 4DV2L 4A3FH 4LF7Q 5ELOA 1XNQL 2R93H 3G71A 1FGUA 1K83H 1BBUA 1TWGH 1VQGA 1WOCA 2RHQB 4A76A 1X9NA 3H15A 1ASYA 1AE3A 1VQMA 2Y0SE 4GKJQ 1Q1BA 3L0OA 2F3IA 3U50C 1V9PA 4OX9Q 5LMNL 1IL2A 2VQEQ 1D8LA 2I5HA 1QVFA 2EXDA 1CUKA 1GM5A 1QUQB 3AYHB 3M4OH 4MZ9A 4A75A 4OWTB 2IX0A 1Z47A 4PZ6A 1J5EQ 1XPRA 1KRTA 2RCNA 3HOXH 3W1GA 4IO9A 3OTOL 3RN5A 4JV5L 4Y52H 1G6PA 5IWAL 5C44H 3ULPA 1IBML 2K50A 1UE5A 2ZTEA 1N32Q 2B63H 4DR5L 1I94L 1VQPA 2VY3A 2OCEA 2WB1E 3AFQA 5M5XH 5M3FH 5C0XI 3GTGH 3S2HH 3SGIA 4A3IG 4BBRH 4IFDG 1VQEA 2PQAB 2Q2UA 3H3VH 3TS0A 3CMEA 4JOIC 1SLJA 2KENA 2ZTDA 1I3QH 3JC66 3ERSX 4JBWA 3U4VA 4DUZQ 1K8GA 1C0AA 2K5VA 5AJ3Q 2AWNA 3GTPH 5FLMH 1I5FA 3VDYA 1HNZL 4DR7L 3GO5A 3HOYH 2UUBQ 1WCMH 3RNUA 1PH6A 1FJGL 3KYHC 3TREA 1IYJB 1FVIA 2VS1A 1K0RA 4IPCA 2CKZB 3PUZA 4NPSA 3K7UC 4JC0A 1HNXL 4JI0L 5IP9H 3PF5A 4P73A 3CPFA 3LGJA 2BH8A 4AH6A 2VUMH 5K36G 4R4CA 2VQFQ 3KLWA 3GTQH 2GVAA 1LTLA 4X64Q 1JB7A 4LFAL 2JJQA 4DV6Q 4JI4Q 2I5LX 4DKAC 4DR2Q 2E2IH 1HR0W 4LF8L 4GLAC 4JYAL 4LWCA 1KAWA 4R1JA 4DAMA 4LF5L 1CKMA 3J81j 4R4TA 1MJCA 4DUYL 3TS2A 3UDFA 1NTGA 3KOJA 2K5HA 2R7ZG 1XMQQ 4IPHA 4HJ5A 4GOPC 4LUVA 4JI2Q 2V1CC 4BA1I 2IX1A 2NVQH 1U5KA 2JA5H 4YHHQ 3CCQA 2R7DA 3CQZH 2LXJA 4KHPQ 4GN5A 3D0FA 5FJ8G 2HHHL 1MJEA 1QVCA 1HH2P 3EN2A 1NJIC 1IBLQ 4DR1Q 3BZKA 4LF9L 2R6GA 3I55A 3K0XA 5JEAG 4RMFA 1G291 3CXCA 2JA9A 4R4OA 3UDIA 1N36L 4A3LH 4LF4Q 3RZOH 1TWFH 2JEAI 2UXDL 1OTCA 3J7A5 2UXCL 4YWKA 1BBWA 2K4KA 1LM0A 3A0JA 1YHAA 1EUJA 2UU9L 2K75A 3M4QA 4BY7G 3HKSA 2RHSB 1HNWQ 3TEHB 3IRBA 3NEMA 2JA7G 4JI3Q 1K73C 3H0GG 3U4ZA 4A3MH 1IBKL 2YYZA 2Z6KC 4GKKQ 5JEAJ 3CCMA 1KIXA 4JI5Q 4A3GG 2BA0A 4LW1A 4IPDA 3S15H 1IZ6A 2CCZA 1SRUA 3T1HQ 2WAQG 1PYBA 1XMOL 1XPOA 4IJHA 5GAHC 1JJCB 2NZHA 1X3EA 2HQLA 4X65Q 2N78A 4O0AA 2EQSA 4DR3L 4PZ8A 5C4JH 3CCSA 2YTYA 4AIMA 2GN5A 1E22A 2WAQE 4DV1L 1VQOA 4X6AH 3GD7A 1KRSA 2OQ0A 5IYDG 1PV4A 4A3KG 2MFIA 1TWCH 4K0KQ 1L1OC 1Y1VG 4YWLA 3H3VI 1JJGA 4JI8L 2B3GA 4JCVE 4NXML 1VQ6A 5C4XG 3HOZG 4IJLA 4JOIA 2KHJA 2F4VQ 1VCIA 2YTVA 2JEBI 3HOUG 3HOVH 3A5ZB 4B3TQ 3K80C 3HKZG 3J81c 3ER0A 4DV4Q 2OWOA 1P16A 3I4NH 4KI0A 1HR0Q 1CKOA 2JA6H 4JI7L 3G6EA 3F1ZA 3NBHB 4DAYB 4DR4Q 1GKHA 3I4OA 1XNRQ 1Q8KA 4DR6Q 4C3HH 3HKZE 3KJOA 1YHQA 1TWAH 1JT8A 3PO3H 3EBEA 3JAMc 1VS0A 1Y1WG 4O2DA 4NXNL 3RLFA 3RN2A 1EWIA 5IYBH 1HZCA 4QIWE 2L15A 3J81i 5IYCH 3CC2A 1LUZA 2NVYH 4OX9L 4PZ7A 4YCUA 4GN4B 3A5UA 2E5LQ 4POFA 5JJIA 4H02A 2PI2A 2K52A 1PA6A 4A3FG 1EIYB 1VQKA 1J5EL 2R93G 2A19A 2ZJPA 4PMWA 2YTXA 4GOPA 2MO0A 1EYGA 2DUDA 3WWVA 1KL9A 3I4MG 2GVBA 1PH5A 5GQOA 2ALYB 3NELA 2ZTCA 5EAYA 3U58A 1Q46A 3CCEA 3UE0A 1J6QA 4A3IH 2WFWA 5E7NA 4B3RQ 1YJWA 2NVTH 4DUZL 4OO1I 5AJ3L 2Q2HA 4JV5Q 3PUXA 2JK8A 5IWAQ 3CC7A 2XTIA 1IBMQ 3HOWG 4OWXB 2R7FA 5M3FG 4DV7L 2UUBL 4DR5Q 5FLXc 4DV3L 2ZJRA 3CCUA 1X3GA 2QGQA 2NN6G 2HIVA 4X62Q 1YBYA 3CPWA 3STBC 1PVOA 2UUCL 3FHWA 2D0OA 4IFDJ 1YHBA 1L2FA 3D31A 4L5QA 1PH2A 1MKHA 4LF6L 2VQFL 2PNHA 1L0WA 1C9OA 3KDFA 4DNIA 2IHEA 4DV5L 3FKIG 2UXBL 3BU2A 5HGQA 3F2DA 3E0EA 4DV6L 4JI4L 2BH2A 1E24A 3ULJA 3STBD 1CKNA 1WCMG 2JQOA 1VQLA 4A3DG 1JE5A 5M5YH 2Z0SA 2UUAQ 1FJGQ 3CCJA 2ZM6L 4QQBX 4BY1G 1EIFA 2CWAA 2AHOB 2XGTA 3F8TA 4HIKA 1YVCA 3PO2G 1Q86C 1HNXQ 4JI0Q 2ATWA 1X3FA 3TQYA 4HJAA 1JMCA 4A3CG 4GNXB 1A0IA 3CP0A 3PGZA 4YY3L 1W2BA 4EX5A 1L1OA 1QZHA 1YNXA 3M7NA 2IT1A 4LFAQ 4C3JH 4KHPL 4LF8Q 1E7ZA 4JYAQ 4A3EG 1IBLL 4A3JH 4DV0L 4P71A
chains in the Genus database with same CATH superfamily
1VQHA 5FOBB 4J9KA 4XIGS 1O75A 5EPKA 3H40A 3VYTA 1DZ1A 2FXQA 3VYSA 2LS01 1QE6A 3C2PA 4WD3A 3HOUB 4JBJA 4O4LF 1KJIA 2VUMA 5BMVF 1RK5A 3N40P 4FBTA 5LMNW 3GTQA 5C0XG 1EHIA 4UY8C 4R9WA 3S1RB 4B08A 3CMAA 3CAMA 1X65A 4I4TF 4CBVA 1H95A 1S5BD 1PTOD 4JI1L 4XXEA 3L4JA 4IUTA 1L2ZA 5FPRA 2FFKB 4JI5L 4ZAIA 2IL8A 4X64H 1KJ9A 4OELB 4DR2H 4WRDA 1HA6A 4KY6A 2A68D 1KNEA 1MIUA 4LFBL 4J8QA 5KT4A 1VQFA 1F77A 5EGTA 2HVRA 1SMXA 2UUAH 3J81W 3NTIA 2F4IA 4C3HB 1PYSB 1PRTB 1TWAB 2QDLA 4BXXG 1K83B 1LV9A 2EYOA 4IURA 4B3SL 3PUYA 1ZHQA 1K1QA 2BQRA 4JI6Q 4MIUA 1TS2A 3RB3A 3V6KA 5CBEE 4MV6A 5GAGC 3A7LA 3WOFA 3MC0B 1BKBA 2F4VL 4J9OA 1XMOQ 4YJ3F 2EYLA 3S24A 4ZHQF 2DNCA 1HXYD 4O2AF 3NWSA 1N34L 3T1YL 4LSAA 4FU0A 2ENBA 2EOTA 1LT5D 4B3ML 2R85A 4K5WA 1QZGA 4DR4L 4DU9A 4JG2A 1C30A 3WO0A 4LF7L 2JA7A 5KNBA 3KLRA 5CV9A 1PTOH 5KX5F 3A54A 5A2QW 4M7EA 2WYOA 3HOVG 2E2HH 4TKOB 1CZGA 1NBWA 5J22A 2FMMA 2EIFA 1OXVA 1WTRA 4JI7Q 4O3OA 1B70B 4EQ5A 2I5MX 2A74C 4OL7A 3PO3G 5FLXE 1WJJA 2O4XA 1OXSC 1PFSA 4RNMA 1FYCA 1K8OA 3RV4A 4A4IA 4X65H 3Q2OA 4AQYH 5LMNQ 1UUPA 2B2UC 2VUMB 4K0KH 4WFN3 2O2LD 5JJKA 4K6DA 3GTQB 3GV3A 2R8IA 4XYMB 1SROA 4UFZA 3VA7A 5GAEC 2DGYA 4X66H 5IY0A 4G7ZC 3SK5A 3RGZA 2EY2A 1I94Q 3AEVA 1Y1WA 2KCMA 1I50A 4BBRG 4J9PA 2CZGA 2JA5B 4ZLTF 2NN6H 3CQZB 1CA5A 1BJTA 1PDQA 3KHRA 2KEDA 1X3PA 4X64L 1O7IA 4DR2L 3PUWA 4GNXC 3L7ZC 1PLFA 3MEHA 4DV7Q 4LMYA 1ASZA 4DAVA 1OXTA 2ASDA 1SMYD 4P74A 2UUAL 2V58A 2E5LH 1BR9A 3RBEA 1RJPA 2RBMA 1PH7A 1XNQH 2ZT9C 2NUAB 5EWFA 4JV0A 2KHSA 4ME5A 1H9SB 1RL2A 4LF6Q 4ED7A 3MVVA 3NBHA 2KQ3A 5FJ8H 4IRKA 1YJNA 3OHBA 1DXMA 4L1KA 4C2MH 1CQVA 3S14H 3C0FB 4ETSA 4J9RA 1B1ZA 1VQ5A 5KFYA 4WJWA 2XGQA 1IL8A 2ZM6Q 4L5SA 2C2EA 3S15B 4ECSA 1A62A 1RK6A 4UCRA 2BE5C 4HTHA 3IG0A 2IWHA 5IWAH 5I4DA 1HA5A 3B6YA 3RUZA 2JA8B 4WJ4A 4DR5H 3K3VA 4GN3B 4HJ7A 3FPPA 1TWCB 4UP7A 3QIAA 1V8QA 3TIGA 1GLVA 3SVMA 5KFXA 4HIDA 3HOVB 1GSAA 1FNWA 1EUCB 3S1NH 4IZ8A 1HNZH 1OXUA 2BCOA 1S0OA 1Q12A 2DJGC 4XQNA 4X65L 3DM3A 3JAME 4AQYL 5C0XJ 2FJZA 2WV6D 1S0NA 4LF9H 1G51A 1SJHD 4RB2C 3PO3B 1PYWD 1EZ6A 3HG9A 1HNXH 4JI0H 3M9BA 4POGA 2RDJA 3MXPA 1Y14B 4K0KL 2XVSA 4TQUS 1A9XA 3Q8QB 5E4XA 3GTMH 1X54A 1Y1VH 3HEJA 2VQDA 5KT3A 5EKLA 2K7VA 1FGBD 4LFAH 1A3VA 4LF8H 3PIP3 1YNJC 1EZ1A 4X66L 5KG0A 3GIQA 1LACA 3CKIB 2QKIC 1KLGD 4RCOA 3D6WA 4K2KA 3VPDA 3G48A 1H9RA 3H3VC 4LAAA 4MV1A 1EUDB 2A6HD 1CHQD 4A93H 5KFRA 4JI8Q 1A63A 4KLKA 2JE6I 1FR3A 3IFTA 2X69A 3NTHA 3RD4A 4DL4A 1YIJA 3I4NG 4QUFA 5LA6F 5ELNA 1Y8OB 3EPIA 5IP7H 1X55A 2EJFC 2K5WA 2E5LL 2NVTB 1AEXA 3F2BA 2R86A 5E3FA 4TV9F 4CKCA 5M3MH 1XNQL 2B2VC 1WOCA 2EYFA 3K5MA 1EEID 4RUCA 3K5NA 1EU4A 1MBYA 2VA2A 1GHKA 5JJZA 1V9PA 2NZ1D 2J6TA 5IGCA 4UCSA 1GM5A 3AYHB 4XYOA 2SDFA 2KECA 3M4OH 3TP7A 3NGDA 3JRWA 3NK9A 4KTAA 1Z47A 2RCNA 1XMOH 2NVXA 2W9CB 1G6PA 5IWAL 5C44H 4Q45A 3GLKA 1F9PA 1BCPB 2ZTEA 1N32Q 4RAYA 2B63H 2I87A 3DUZA 4DR5L 4QWCA 1RKNA 4DR3H 3AFQA 4ZUJA 5C0XI 3S2HH 1XDNA 4YAJB 2F1MA 4F4YA 3PR5B 2PPBC 2V4RA 2MCTA 2DNEA 3EA6A 3U4VA 4C1NI 1AN8A 4I7AA 2AWNA 1U4PA 2K28A 3IFDA 2R93A 1PX2A 1TWGA 3VDYA 1HNZL 3J7AV 2KSWA 5KG3A 2FLNA 3GO5A 3HOYH 2UUBQ 5CA0F 2ICIA 1PH6A 2XCAA 5IGEA 5KYLA 4KK7A 4IPCA 5C5MA 2CKZB 3PZPA 1EQVA 3PUZA 2FK1A 1HNXL 4JI0L 5IP9H 3PF5A 2YZNA 4AH6A 4LH7A 3SK4A 2B8FA 1LABA 1B2TA 1L0YB 3KLWA 2GVAA 2Q8TA 4LFAL 4BY7B 4KKSA 4DV6Q 2IW3A 2I5LX 4LF8L 4OX9H 4GLAC 5LXTF 3PIO3 3G6JB 4R1JA 4DAMA 4TUYF 5KFMA 1KDAA 3OMGA 3FEWX 3SDZA 1MHWC 4HJ5A 5KFOA 2I8CA 4DK0A 3LWUA 4CJ0B 5E1FA 2YRXA 3CCQA 4UAIA 1HRJA 2R82A 3N6XA 1I3QA 4KHPQ 5FJ8G 3D0FA 1I4PA 3OUUA 1MJEA 4UCUA 1DJRD 3CRKC 4OIKA 3W2DA 3GV7B 3GTPA 3BZKA 1WTHA 2R6GA 5KFLA 3S17B 2F3WA 2AQ1B 2OEOA 1WCMA 3CXCA 2ALZA 4QWEA 5ELBA 2FINB 1TWFH 5C4HA 3LMLA 4HN7A 4DGZA 2RDGA 3HKZB 3LWEA 4YR3A 4DV7H 1EUJA 5KRUA 1F9QA 3HKSA 4C2MA 1TT2A 3IRBA 4IWYA 2NVXB 1PTOB 2C9OA 3KHGA 4JI5Q 4FF2A 4LF6H 5KG2A 3DEPA 1BNZA 3N52A 4IPDA 2CCZA 1SRUA 1XMOL 1YNNC 5DQIA 2Z4IA 5KFFA 5KFIA 2E74C 2NUCA 1QILA 5JH7F 2XSCA 2ZM6H 3WDNA 4DR3L 3CCSA 3K57A 5IGBA 5IYDG 2OQ0A 1R4PB 3BDCA 4H13C 2R93B 5EQ0A 1Y1VG 1JJGA 5CV7A 1I4QA 5I9PA 3HOZG 4FP5D 4JOIA 2VA3A 2F4VQ 4OGQC 4CDEC 3K5HA 5D1OA 2KJXA 4B3TQ 4NLGA 5DGAA 2L5TA 3MJFA 2D2CC 4JI7L 1I6UA 5FO9B 4DAYB 2JXMB 4DR4Q 4ID6A 4DR6Q 1LTGD 4C3HH 1YHQA 3KJOA 4EBDA 1TWAH 3ND9A 1JT8A 1S5ED 3F2UA 2PMZA 4ODGA 1BQQT 1ESFA 2FK2A 1WTOA 3QOJA 2L55A 3T13A 3RN2A 5IYBH 2UVRA 3OMCA 4U6PA 4A2AA 1LTID 1HNWH 4OX9L 4JI3H 1PZJD 2F0HA 4Q0YA 3Q23A 1BCPC 3SI8A 1EL0A 1O80A 3A5UA 4K14A 5JJIA 4R8UA 4RB1A 2PI2A 2K52A 1ENFA 4E6IA 1DOKA 3IN5A 3D4RA 2ZJPA 4R8NA 4RAUC 2A6ED 2EYHA 1EYGA 4MV4A 1VAJA 5JVH3 2X0SA 3WWVA 2GVBA 2VB2X 1PH5A 1T94A 4N9TA 3FMAA 2R3ZA 2ALYB 4M9UA 5EAYA 2NU9B 2JA6A 3UE0A 1J6QA 3KLSA 4ED6A 4WORA 2WFWA 2LMCB 5E7NA 3KXYT 4EYIB 3V6HA 4C2MB 3S14B 1EWHA 4EFBA 4JV5Q 2Q2HA 3BS1A 2HUGA 3T16A 2NWGA 3K5IA 5C5JA 1IBMQ 1MSGA 2R7FA 1ICWA 1JE4A 4DV7L 3GIJA 5FLXc 1WTQA 3TMEA 3M7GA 2NVYA 2W9BA 2F0GA 3D4DA 1MZBA 3PMFA 1PVOA 2NVQB 1IKLA 3FHWA 5LL6X 5DG7A 4HNUA 1UC9A 1A3UA 1HCZA 4LF6L 1L0WA 3KDFA 3FKIG 1STAA 5HGQA 2A73B 3VR5A 2KUMA 4AYBB 2WB1A 1ZKOA 4A3DG 1T5XD 2UUAQ 1NNXA 3GV8B 2ZM6L 1EIFA 3S1NB 5T1GA 2GPSA 5DM73 3PO2G 4XX0B 4YAKB 4GC6A 5DM63 4HQ6A 2IPKD 4HJAA 3BQ2A 4A3CG 1FNVA 3N44B 1QZHA 1N32H 4R8IA 1DV1A 1E7ZA 4JYAQ 4A3MB 4EQPA 1Q3LA 4A3JH 3E9HA 1NE3A 2PMZB 2FJ2A 4B9XA 1Y1VB 4LF5Q 2OH2A 1UE7A 4DAPA 2NZOA 4LSXA 1S3OA 4Q43A 1XPUA 3OOCA 5BN5A 3FP9A 1PTOC 2AUKA 3HXLA 2XIGA 3R5FA 1SEBD 3VR4A 4QW8A 3OYYA 2XIWA 4CDFC 3CCLA 5K2MA 2F0LA 2KHIA 2ZJQA 5FKAC 1N9WA 1BO0A 2IJ0A 1ML0D 4A93B 1HFNA 1HNWL 2A68C 2YV5A 3R2TA 4JW0A 4JI3L 4UPAA 2JA7H 4O2BF 4G3IA 2QCPX 2IY5B 2L0CA 2WP8J 1PK8A 3V05A 3J81E 3AQQA 3ICEA 4RNNA 2UXDQ 4BWGB 4E4TA 4XTCS 1K0SA 2WE6A 3GIIA 3UDGA 5KG7A 2PQAA 1DGSA 1TVXA 4AQYQ 2UU9Q 2Q2IA 2WIIB 1K3RA 3IL8A 5IE8A 2JA8H 1UEBA 1O7YA 3R23A 5M3MB 1AUXA 3E6ZX 1C7YA 1RJQA 1KBLA 1EY8A 3OIQA 5GADC 5ISRA 2C5CA 2C2RA 1Z2PX 2R8JA 3MFGA 4X66Q 1KEEA 2F3VA 1PMRA 3HS0C 3K5OA 2EY5A 3J7YW 1RTNA 3M4OB 1HZAA 2ZXPA 3I8ZA 5A2QE 3RZDH 2EVBA 5BR8H 1VMCA 5C44B 3CF5A 1N33H 3BJYA 1SDFA 3RR5A 2B63B 3GIDA 1Y8NB 3O13A 2DY7A 3E0JA 3CVZA 5L9XA 1Y1WH 3S2HB 3AMUA 3QR8A 1I50H 3T5LA 3VYRA 4DPGA 3MWDA 1PHJA 1EU3A 3RIZA 1WVLA 5CV6A 4DNTB 3KHHA 1LT4D 3GQBA 4C3HG 4RCNA 3JAMi 2UVUA 3CHBD 1XNQQ 4HCEA 3HOYB 4MA5A 3PSIA 5H1SE 5IYBG 2ZDGA 5G3LF 2HD3A 3I2ZA 1N32L 1KDCA 4ED8A 4ZRZA 1HJPA 1B44D 4O42A 2R8GA 1E3PA 3OWFA 3RLOA 3I4MH 2W8KA 2C35B 1HZBA 3FRPB 2VW9A 2NBFA 4BA2I 4TRDA 4NMZA 5IT9L 1Z9FA 1U0LA 4X3UA 4F4XA 2Y0SA 3D4WA 4B3TH 1VQ8A 2BOSA 1GYFA 4YWMA 4FF1A 1A6XA 1NAPA 3HOWH 4DR6H 3LWBA 1C8CA 1DIKA 4XQQA 2JEFA 1E1OA 4MV3A 4MN3A 1M0TA 1B6SA 1GUOA 3TQTA 1SMYC 4C56C 5FLMG 2B29A 2XN9C 4ZKCB 3NQTA 1X32A 3GV6A 5BPFA 2PBZA 1YZ6A 2AMCB 4QMGA 1HNZQ 3U9SA 4FYDA 3S1MH 3VPBA 2JYOA 2HIXA 2CQAA 1KHIA 1V43A 2BDNA 1M90C 4QWDA 4OONA 2AKWB 1TWFB 4ZOLF 5KFUA 4QB4A 4BY1H 2VUMG 4DV2H 4TSSA 1ZXTA 5H80A 1TU2B 3Q8PB 2E2JH 1ZETA 3C46A 4UP8A 4WJ3M 4ALPA 4C5AA 3W1BA 5JJLA 4HJ9A 5EWEA 4IWXA 5C3EB 4MV7A 4FVMA 2YS7A 4HCSA 1I6VC 1PZKD 3K0YA 1FL0A 4NB3A 4ED1A 2DZDA 1O78A 5KT2A 3OSOA 5CORA 3AFPA 2OTJA 5BR8L 5BN3A 2JA5G 4A3BH 4JV5H 1QCBD 1Z2OX 1K8AC 1N33L 1QUQA 1RIPA 5HY6A 4YY3Q 4U68A 1S68A 4YB8B 3U9TA 4XDXA 1IBMH 3AU7A 3ULLA 4A3JG 3K7AH 4BY7H 3PW4A 4DV0Q 1NMFA 2J4XA 2RQXA 3CCVA 4GOPB 5DQHA 2C22A 1RYSA 1BCPF 1UEAB 3P7JA 5KG6A 4OO1G 5EKIA 2ZDQA 1AE2A 1AUVA 4JPBW 2R7ZA 1ZYRD 3UQ8A 3C1EA 2BA1A 3RFCA 4Z9CB 2L12A 1E2ZA 3G8CA 1P8LA 5D65A 4IOCA 5KFJA 2Y0SB 1TAEA 1JOKA 4RGNA 2HJWA 4J15A 2R7KA 2ASLA 1ILQA 3S17H 2IA6A 1EQRA 4CC5A 2IHFA 4IFDI 1F2ZA 5IYZF 3PVXA 3J80E 2PW7A 3I7FA 3GTJA 1JXLA 1VQBA 2RF4A 2MPMA 5TSSA 1DV2A 4JYAH 4KHZA 4FF3A 4B3TL 2A6HC 4YJ2F 4ECXA 5M5WH 1W6JA 4LF5H 2JA8G 4LUOA 1QVGA 4DR3Q 4J1MA 4HIOA 1TQOA 1ZHSA 3QFFA 4DR6L 3OW7A 4JBKA 5JVG3 3I72A 3S16H 1I4XA 2NVXH 4G4KA 3TINA 1HUMA 4YP3A 4EBCA 5BN4A 1GUNA 4LFCQ 3G4SA 1SYBA 4ABNA 1HUNA 5JQWA 2X6GA 2D62A 1CTMA 2KEEA 3DXJC 4PG3A 4EFEA 1K9MC 2WAQA 3V6JA 3NQIA 1GD7A 1L1OB 1U4RA 3EIVA 1AFPA 4ECZA 2R7NA 1RJTA 1Z7TA 1PXUA 2UXDH 3M4PA 2N3SA 4R8UB 5CC4A 4DV2L 1MD2D 2R93H 3G71A 1VDZA 1TWGH 1VQGA 2EJGC 3BVMA 4PMBA 1X9NA 1IKMA 2FPIB 4DL3A 2UU9H 3GTLA 2RSOA 2F0SA 3L0OA 2F3IA 3VMMA 3G6YA 4OX9Q 1IL2A 1GGOA 2I5HA 5KEEA 1IBKH 1QVFA 1QUQB 2CVRA 3G7LA 3T53B 3F8NA 3L4KA 1UC8A 1CM9A 4A75A 2CH4A 2IX0A 1RD9D 4PZ6A 3SK6A 5FD6A 1KRTA 3M9MB 3HOXH 3K5LA 4Y52H 4JV5L 1GXDC 4IUQA 4QIWA 5IGDA 5HV6A 2R87A 2F0EA 1ET6A 1LT6D 3D3RA 1IBML 1UE5A 2EPBA 1I6HB 2XWBB 4CJ2C 4I7HA 5M3FH 2OCEA 3FMCA 3GTGH 4KJNA 4ED0A 1X3QA 3TBIB 3NWTA 1VQEA 3H6MA 1TWHA 3CMEA 1SLJA 2KENA 2YYAA 1I3QH 3JC66 2F0UA 1RODA 1C0AA 5LL6b 4A3JB 3UFXB 1WD1A 3GTPH 1WCMH 4ZYSA 3KYHC 3Q0AA 2VS1A 4QWAA 1SNMA 4CDDC 4TQSA 3GV5B 1G2SA 3CPFA 1TY0A 3LGJA 5D3IB 1EWCA 2JN4A 4R4CA 1NR4A 5LP6F 2JJQA 4RU9A 5JOBA 4JYAL 5D1PA 2JA7B 1E2WA 4LF5L 1CKMA 5CYUA 4R4TA 1D5XC 1NTGA 2AGQA 1SE3A 4RGTA 3R8BA 3X3NA 1G2TA 1J5EH 4GOPC 2IX1A 2V1CC 2WAQB 4BA1I 2NVQH 1U5KA 1KJJA 5KT6A 1IYUA 4P2CB 3DMUA 1QVCA 2CHBD 1HH2P 4CKBA 3EN2A 5C6AA 4DR1Q 4LF9L 1SYFA 4ED2A 4IRCA 2L11A 4RMFA 2SNSA 4R4OA 2NU7B 3UDIA 1PRTC 1XWEA 3A56A 4A3LH 2UXDL 1OTCA 3J7A5 4YWKA 4MHEA 1LM0A 2JP1A 2SOBA 3RZDB 1I4HA 1EY5A 2WACA 2UU9L 3ONAB 2K75A 4BY7G 4V190 4K5VA 4DK1A 1AZQA 4QW9A 2B2TA 2RHSB 2E2IA 1HNWQ 3NEMA 5IT9W 3K58A 4QIWB 4JI3Q 1K73C 4A3MH 2G9HD 1IBKL 1E4FT 5KFTA 4RFBA 4GKKQ 1HTPA 1Y1WB 1HHVA 2J9GA 1I50B 2NYZD 4LW1A 2B8GA 1IZ6A 1LTBD 1QJOA 4JI4H 1XPOA 4DFAA 4IJHA 2FB9A 2N78A 1D2BA 2EQSA 2NU6B 4PZ8A 2YS6A 4L8JA 2PYKA 1KRSA 3GD7A 3KALA 1AW7A 1SYEA 4YY3H 1L1OC 3I4LA 3H3VI 1VQ6A 2I46A 5EOYA 5L1IA 1VCIA 2EZVA 3I4MB 1JX4A 3PN1A 1IBLH 4DV0H 4XYLB 1V1PA 3HKZG 3J81c 1VBGA 2OWOA 3KF8A 4KI0A 4NW2A 2N88A 5I6WA 3LP8A 5CA1F 2JA6H 1G6ZA 3F1ZA 3NBHB 1GKHA 3GIMA 3HKZE 3MR6A 3V4ZA 2HCCA 2P0AA 1QNUA 3HOWB 3M9NB 1STGA 5M5XB 5D14A 1TY2A 1S9FA 2L15A 3J81i 5IYCH 4TV8F 2NVYH 2QDBA 2TMPA 1B6RA 1IYVA 2A6EC 5CAEB 1TIID 2CH4W 3CRLC 2Z9HA 1B9MA 1VQKA 2L4NA 5K5PA 1J5EL 3S1MB 2R93G 2JSOA 3T1HH 3BDLA 2MO0A 5IODA 3AB9A 2HCIA 1JOOA 2D5DA 1PFNA 3BYTB 1KL9A 3H20A 3N8DA 1QOHA 4BY1B 3I91A 2RDFA 3MWYW 1AP0A 3NELA 2E2JB 4ME6A 4RUAA 2ZTCA 1GUGA 3RV3A 5FLXW 3D6CA 1FNUA 3U58A 1DYQA 3SE0A 1SYXB 4A3IH 4EGQA 1C48A 2WTFA 4LFCH 3R93A 1SXTA 2E2IB 5FD5A 4OO1I 4MAMA 5C1PA 5AJ3L 1SNOA 1WR2A 3VR2A 3MWEA 2BQ3A 1GUWA 2EE1A 4OWXB 5C8YF 5M3FG 4ECRA 4A3BB 3CCUA 1XNRH 2QGQA 2NN6G 2K5DA 2K32A 1EYZA 1YBYA 5EBCA 2EY6A 1DOMA 3FDSA 1PH2A 1KJQA 2XCPA 2QK4A 1EOTA 3K7AB 2PNHA 3MXNA 1C9OA 3TDQA 3BG3A 4DNIA 1CA6A 3BU2A 2BH2A 3VYUA 3E0EA 2WINB 4JI4L 2DWCA 3STBD 1CKNA 1BGWA 2W7OA 1WCMG 1BBXC 1JE5A 4ECTA 3JSNA 3RTXA 2MGSA 3CCJA 3GTGA 4KD3A 4QQBX 3GIKA 3RZOB 3URYA 1B04A 4UCTA 4HMJA 4PNYA 2Z8LA 1K28A 1YVCA 4HIKA 1X3FA 3MA2B 3TQYA 2PVPA 1A0IA 3PGZA 4YY3L 4G7OC 2W70A 3M7NA 4J9LA 4FBUA 2IT1A 4C3JH 4L6TB 1JIHA 4Q8EA 4EGVA 3JRXA 1IBLL 3A8IE 5DLGA 4DV0L 2W71A 2K05A 3CPWA 5ELEA 2ZDHA 3L3OC 5JEAH 2V5AA 5BR8Q 3E3XA 4B3RH 5KFPA 1DOLA 3M3YH 5M5WB 4IZOA 1N33Q 4L63B 1SE2A 3L9AX 4RGMA 4TVAB 3SEBA 5JAVA 1Q7YC 3J7AF 2VNUD 3Q8DA 5LYJF 1PH1A 1PZID 2IX3A 2HHHQ 1D6EC 1TXYA 3PIOA 1WTWA 1EEFD 1BXRA 2AGOA 3BJUA 2DPIA 2J6UA 5KIXA 1W3SA 5J1ZA 4AYBG 3S16B 1E1TA 5C3EH 2FPGB 4X62H 5ELDA 2PW5A 2OQKA 1WYDA 1A2UA 1U4MA 3H0GH 2PZTA 4A3LG 2EXZA 4DL2A 1SNDA 1X56A 4AYBE 3PW2A 4CDCC 3T1HL 1F9RA 3HFZB 1F2YA 3E9IA 3UDXA 2CWPA 5I2XA 1Z6HA 1JDBB 2JEGA 3CCRA 2MO1A 2F0KA 4A3MG 1LYLA 5EWGA 1TWGB 1KC8C 4ZQIA 4BWSC 4J0MA 3EQLC 3Q8RB 1H9MA 4I55F 4A3KH 2BDOA 3T56B 1EOVA 2ZJTA 3JAMW 2MQHA 5KFCA 4LFCL 2CQOA 1XXGA 1S40A 5C4XH 4DR1H 2PMZE 2N8NA 4JV1A 2NB0A 3TZDA 3GQCA 2C28A 4R4QA 1LTTD 4ED3A 1Q81C 2H1EA 3PQIA 3HOXB 3MXNB 1S03G 4A93G 1VQ9A 1XNRL 2VZAA 4GLXA 4M1UB 1CKNB 2E2DC 2E75C 4EEQA 2YCHA 4NXMQ 1II3A 2TSSA 5M3FB 3KF6A 1G8ZD 3GTGB 2K04A 3S2DH 1NMGA 1SE8A 5IP7G 1HFGA 3I56A 3J80c 4TQRA 5KNCA 4GKKH 2XWJB 1I3QB 4FS1A 3TP6A 1SCUB 5GONF 1R9TA 1G91A 3RLNA 5M3MG 3GTPB 2FLPA 4DV2Q 1YITA 4K8IA 4UHVA 4DK3C 1Y69U 1JLLB 3Q8SB 1EQQA 1WCMB 4B9WA 2K14A 4Q44A 1VQJA 4ME3A 2M9VA 5IYCG 3OSNA 3GTKA 1EFWA 5EBDA 3J80i 3H94A 5I9OA 3A55A 2WKDA 4R4IA 1N48A 1BOSA 2O5JC 1PRTF 2R92A 3K3PA 2DIKA 2FE3A 4B3RL 5C44G 2WB1G 3I90A 2B63G 5KGUA 5LMUH 1SNCA 1CI3M 2F0IA 4Q5VA 3CC4A 5HURA 3H09A 2AUJD 1ZQ7A 1XTDA 4HIMA 3JSLA 3C3LA 4G57A 4X62L 1S4ZA 2RSNA 1CSPA 1PH4A 4J9QA 4C1NK 1UE6A 2I0QA 2L1BA 1HPCA 1I7NA 3QB3A 3HOYG 1ICFB 3VA5A 2JEIA 3M85A 1WFQA 1TR5A 3TSSA 1YI2A 4EGJA 4IHJF 3NP8A 2W6NA 4DV3Q 4C3IB 1I6HH 4MNOA 1Y8PB 3MEFA 1RF2D 5IP9G 5D1OB 3Q6SA 2UUCQ 4H7BA 2R7ZH 4MTNA 2VR1A 4QL5A 1D5MC 5FK9C 1AZPA 2G9DA 2L9HA 2OTLA 4DV5Q 1OO9B 2UXBQ 4DR1L 5I2YA 4NP5A 3V2TA 4P72A 2GLTA 4APVA 4EQOA 5KFAA 4A3EH 4BBSB 2YU9A 1VQDA 1W93A 3KF6B 4G7HC 2FHTA 3S1QH 1KABA 1PFBA 1O7ZA 3GTJH 1T9HA 3W5OA 3OTOH 5EPJA 3UE1A 4KKUA 5EZYF 2F0VA 1R9TB 4N8FA 3TP5A 2VXWA 4LF9Q 3P1HA 1S0MA 3SR1A 3MR5A 1NY4A 1WSCA 1ZYRC 2LSSA 4GKKL 2YL2A 3ETHA 3HBLA 4UP9A 2FMCA 4DR7H 2R61A 2O03A 2JA6B 2F52A 2QILA 1STHA 4FNFA 1CSQA 3ND8A 4QY7A 3T51B 2R92B 1EZ8A 5C3EG 1V1QA 1MI2A 3N6RA 1IBKQ 1M4VA 4IAJA 4BXXH 2HDLA 5C3XA 2YZMA 1CS0A 1SFOA 2B2WA 1TA8A 3GTLH 2D0PA 2NVYB 2W9BB 2V4QA 3E5SA 3K81C 1ENCA 3KLSX 4YBZB 3RB0A 1IW7D 4KN7C 1CQFA 5LMUL 3DLLA 4QWBA 4DUYH 5KG5A 3KDFB 2AQ3B 3DM1A 4LUZA 2WB1B 4ZUIA 1SN8A 2F03A 3H0GA 2NN6I 3KTMA 4QGUA 5KG1A 1E4EA 2HHHH 5ELCA 2Q8RE 1GUTA 5JVLA 2QA4A 1VKZA 3QOLA 4L5TA 4EEYA 4PMCA 5CV4A 4A3IB 4GNXA 1TWHH 1HZ9A 3KFUA 5LOVF 1S72A 3GTOA 1VQCA 2Y0SG 3NENA 3FVQA 1MGSA 4A3FH 2YRWA 5AFWA 4KD4A 2RHQB 1ASYA 5KFEA 1W6KA 1RHPA 5KNDA 4ECUA 3H15A 1AE3A 1QWYA 2SEBD 3T4AC 2Y0SE 4RGOS 4GKJQ 3D8GA 1VMPA 3OWEB 1EYCA 2VQEQ 4F50A 1D8LA 3MFIA 1CUKA 4DF7A 1LTAD 5COYA 1S10A 2UVWA 3JZIA 1J5EQ 1JWMD 1F9SA 2I07B 3OTOL 4IO9A 3RN5A 4ZI7F 4DXGA 1SAPA 4QF4A 3ULPA 4O3SA 1A2TA 4FM9A 4KJOA 3PW7A 2VY3A 5M5XH 5L1KA 1MSHA 1M0WA 4DLKA 4APMA 1B9NA 4BBRH 1KLUD 2J0TD 2PQAB 3TS0A 1JOQA 1JKJB 4NXMH 5IIFA 4JOIC 4O3NA 5KFWA 4C3JB 1K8GA 1J9OA 4F4ZA 2LKVA 1HQMC 1LT3D 1S5FD 4RNOA 3PW5A 5AJ3Q 2K1BA 2V59A 2KVMA 2M05A 5KT5A 4DR7L 5KFBA 2W6QA 1GOZA 3GP7A 3N41B 3BVGA 5IOCA 3RNUA 1SFOB 4KY7A 3TREA 1IYJB 3M3YB 1K0RA 4UCOA 1SYCA 3K7UC 2AU0A 4P73A 4DL5A 3MAQA 4IRDA 4ZK9B 3IAYA 4A2BA 1F2MA 1JB7A 4JI4Q 3MXGA 3V4SA 2E2IH 1HR0W 3NUCA 4EG0A 3H0GB 1CQIB 2XRSD 1EY9A 1BUVT 5JUMA 1Q8IA 5KFGA 1MJCA 4A3GB 4DUYL 4Y8VB 3HRZC 3UDFA 4HSVA 2EYPA 2LY7A 2K5HA 4RAZA 1STYA 1XMQQ 2R7ZG 1JORA 3DWAA 4JI2Q 3T5KA 4YHHQ 4JUZA 1EY6A 4CKEA 2KOLA 5D3DA 2HHHL 3Q24A 2G5DA 1STBA 1TS4A 1IBLQ 2VB3X 1ENAA 3I55A 3NTKA 4O3QA 4HR7A 1ONLA 1WTPA 4A3KB 3ETJA 4DN4M 1W96A 5FLXL 1NSNS 5C4XB 4LF4Q 3Q22A 3RZOH 2JEAI 4DUZH 3S9WA 2QYZA 5IT9E 4I65A 4YR0A 2K4KA 3A0JA 1YHAA 2V9WA 2B2VA 2YW2A 4DV3H 3KAJA 2P5ZX 2JA7G 3U4ZA 2UUCH 2PQEA 2YYZA 2F0PA 5JEAJ 1KIXA 3S2DB 2BA0A 2VQFH 4DV5H 1JDEA 2UXBH 1ZEQX 3T1HQ 2WAQG 3WO1A 5DEHA 2JA5A 5GAHC 2RVLA 3CQZA 2NZHA 2A69D 2HQLA 1C4QA 1DONA 5F9NA 3KBXA 3I70A 2CW8A 5C4JH 2H4OA 5IGGA 2YTYA 4O3PA 2KCCA 2GN5A 2WAQE 4MTKA 5KFKA 3VPCA 1PV4A 2MFIA 3R2IA 3MHBA 2K5QA 3RGXA 2B3GA 4NXML 3NHHA 2KHJA 2FPPB 2VOBA 5F2DA 2IP4A 2YTVA 1CQJB 1GJXA 2JEBI 2CW0D 3I4NH 4DV4Q 2WDTA 1P16A 1HR0Q 3K59A 3G6EA 1H9SA 5FO7B 1JQYD 3I4OA 1XNRQ 4LJZC 4FO2A 3A7AB 3NBIA 3HGBA 3OUZA 2DPJA 1VS0A 1BF4A 1Y1WG 2OLSA 5ELFA 4C5CA 1HZCA 3R3OA 4QIWE 1D5ZC 1LUZA 3M4YA 2SNMA 4PZ7A 1FD7D 1K8MA 4DL6A 3EROA 1KNAA 1D1KA 2V4DA 1STNA 4JV2A 2XNAC 3ERQA 2F0WA 3G6XA 5J2TF 1PTOF 4A3FG 3I73A 1EIYB 1TWCA 4PMWA 2IMWP 4HR7B 1M7JA 1WTVA 3P75A 1K3BC 3I4MG 4UCVA 5GQOA 2R7LA 4JVZA 2R7ZB 4IR1A 2F0NA 1JWSD 5C3WA 3R5XA 3CCEA 4RWSC 3U9OA 3SE7A 2B2WC 4B3RQ 2VPSA 5CBAE 2F0JA 5JPNC 2QW7A 4DUZL 1YJWA 4FXGC 4GC7A 3JAML 3PUXA 4A3EB 4PQXA 2JK8A 2XTIA 3HOWG 1AN7A 1FKAH 4J6HA 3S1QB 4DV3L 3GTJB 5L1JA 1X3GA 1GHJA 4X3SA 2HIVA 4X62Q 5BPHA 3STBC 2UUCL 2D0OA 5CMDA 3KK7A 3RBDA 1L2FA 3D31A 3I3CA 1MKHA 4GKJH 2VQFL 4DV5L 2VPQA 2UXBL 3F2DA 2VQEH 1E24A 1STEA 2F0QA 3EPGA 1VQLA 3ORRA 5M5YH 1FJGQ 1D1IA 4MA0A 4BY1G 5LL6S 1ET9A 2AHOB 2Z6BA 1Q86C 4HYKA 1LTRD 2MUYA 1LTSD 3IKJA 1JMCA 5C5LA 3DF7A 4KHVA 3CP0A 1W2BA 1BXTA 4EX5A 4CHTB 2FKLA 3PF4A 4DXFA 1WI5A 1H9JA 4HSPA 3J7ZC 2RGVA 3GTLB 2N49A 3BG5A 4A3BG 4C3IH 1B53A 4HEDA 1E4GT 2KCNA 1D7QA 4YQWA 4KN4C 4NKLA 4YCVA 4C5BA 1E2VA 4PV1C 2PNRC 2IBKA 3A8JE 3BYYB 4OIJA 2AWOA 1M8AA 3WOEA 2W9CA 4IUUA 4IUPA 2PN1A 4BBSH 5DAUA 2AGPA 1N36Q 1CT1D 4ECYA 2UXCQ 4LH6A 3M4IA 4MTEA 4F4WA 4GLVB 1RCVD 2R6FA 1TWHB 1VF7A 3EVQA 1VQ4A 2ASBA 1GSOA 2O5IC 2R84A 1BDOA 1R9TH 2KCTA 4DK6C 1EIHA 3DEOA 4A3FB 5J3BA 1CE8A 1XMQH 1A8VA 2A5HA 1ESRA 5DNFA 4JI2H 4CGYB 3QZ7A 3MXUA 2K5NA 4YHHH 5IYDH 4X3TA 4GS3A 1EYDA 4IPGA 4P75A 1PH8A 1GUSA 3BZCA 4F87A 3HOZH 1K1SA 1VBHA 3GTKH 1XYIA 2CW7A 1IOVA 1LO5D 2XRQD 5LMUQ 4IOAA 1VQAA 3PW0A 2ES2A 2H5XA 3DHQA 5KYIA 1UWVA 3J80W 2R92H 4DV1Q 4LF4H 3KHLA 4N9PA 1JICA 1V51A 4L5RC 2XC9A 4F8MA 1DM0B 3PIPA 5KFHA 5FPOA 2A1AA 2KA7A 1Q1EA 4GKJL 1U4LA 1SYDA 4BBRB 5E4WC 2VL6A 3DWQA 3HZXA 2VQEL 1OWTA 1GO3E 4KV6A 4O4HF 3RUPA 4Q8FA 2MHVA 1Q82C 4FS2A 4PDBA 5GROA 3SXHA 3BZDB 3SHLA 2F0DA 5EKKA 3NSWA 4OWWB 4PWQA 3MR2A 3BA8A 4GZYC 2K33A 1YEZA 2BQUA 3M9OB 4NXNQ 4KKTA 1B50A 3J7AK 2ICEC 2R8KA 5L37A 1S5DD 2C2DA 4K8JA 5CR3A 1M1KC 4R7RA 4IALA 4RKLA 5T14A 4K5XA 3OSPA 1I7LA 2HT1A 2QF7A 5I6YA 2LXKA 4IFDH 3HKZA 3RMHA 4IN3A 2HGSA 4JI6H 4Y7NH 3HOXG 3PUVA 4O1NA 4MV8A 3OTOQ 4NDXA 3NPPA 2K01A 4RKBA 3OHXC 4YCWA 4DV4H 4DL7A 5JVDF 4Q0FA 2EYMA 3NE5B 1HR0H 1KDBA 2YU9H 2VUGA 1OXXK 1A3TA 2E2HA 3QG1A 1EIGA 3BQ1A 3QJYA 1SR3A 2RDHA 2Z6KA 4K6LA 5K36H 4OXPA 4BS9A 2J6SA 5JPMC 1VQIA 2ID0A 1QNKA 5KG4A 4DR7Q 4EBEA 3FKIH 1RYRA 3LNNA 4QJFA 2NU8B 4FXKC 3OW2A 4JI7H 4J9MA 2EJMA 2Q2TA 4A3DH 2SCUB 3TIIA 2W8LA 1JJ2A 1EQTA 3VR3A 2CFMA 4JK1C 1V1PB 1E0BA 1XMQL 2ZXOA 5CV8A 4JI2L 2DLNA 3KF8B 1RDPD 2HQEA 3CW2C 3PO2H 2W6OA 5KKNB 4YHHL 3N43B 4KY5A 1AH9A 3TRZA 4A3CH 4YR2A 1X6OA 3PV0A 4DAYA 1IXRA 4U7CA 2YZGA 3MTSA 5LMNH 1PH9A 2F0MA 1KJ8A 4DNRB 1B8AA 3CU7A 3ITPA 5EJWA 4IUVA 4DUYQ 1GVPA 1B7YB 1QG7A 2RA4A 4ZQ3A 1SFOH 3CD6A 4CJ1B 4LF4L 1PFMA 2OXPA 1B3QA 2A8VA 3TQ1A 1UE1A 4RA8A 3FPUB 3ZJYC 5C4JB 1I94H 1XJVA 2JEJA 1WH2A 1L0XB 1VQ7A 1JB3A 2BE5D 2F0TA 2F0OA 1KXLA 4CC6A 2HVSA 1YJ9A 4ULLA 2B2YA 1BVSA 1VF5C 1I4GA 4C3IG 3F2CA 2ATLA 2CQYA 4A3GH 3K8AA 5KFVA 2MNAA 4HJ8A 3I4NB 3LX0A 1GSHA 3GDEA 1HTLD 1A15A 2EY1A 4RHSA 2E8GA 3N42B 4JBMA 4ECVA 2K6AA 1KQSA 1FJGH 1QB5D 4RH6A 1PRTD 3GTOH 4LNQA 2M2LA 3MZ5A 4JI1Q 4BBSG 4QCLA 3BA9A 3BDOA 1IW7C 4U673 3KAKA 2HDMA 2F0FA 4JI6L 2E2HB 3KJPA 5KT7A 3PR4A 4IUNA 3C1FA 4QUCA 4WBNF 4F88A 3HOUH 4DV4L 5NUCA 4LFBQ 2I80A 2RGRA 5DG9A 1HR0L 3SK8A 5IT9c 4IR9A 3OHAA 4I7ZC 5KFNA 3S1RH 1DCZA 3RF2A 1SNQA 1YNJD 1N8RC 1LLRD 1KD1C 4AYBA 4XT3B 4B3SQ 1XTCD 2FP4B 3R5HA 2PI2E 1NR2A 1EYAA 3A74A 5DLQE 1EY0A 2KBNA 3PCOB 2GA4B 1PH3A 1CHPD 1CFMA 4FDBA 2JA6G 3BQ0A 2FLLA 3HB9A 2FMAA 1N34Q 1VQNA 2K03A 3T1YQ 4RG1A 3L2PA 2R92G 5IGFA 1N36H 4B3MQ 4HMIA 3RJ0A 2QEXA 1DD2A 2UXCH 3MR3A 4J9NA 4O4IF 4LF7Q 3BAAA 5ELOA 1FGUA 1K83H 1BBUA 3GTMA 5HGTA 4A76A 1Y1VA 2W6ZA 1SBBB 3FDTA 4IQZA 1ILPA 5EPLA 1VQMA 1NUCA 2B2TC 1Q1BA 4H44C 4EVOA 1C3OA 3U50C 2MJ8A 2R7MA 3H4BA 5LMNL 3V96A 2EXDA 4OEMB 4EQNA 4ZCKA 3WNZA 4MZ9A 4OWTB 3QO2A 3T5HA 4HNTA 2Q8IB 1RTOA 1XPRA 2OF1A 3G6VA 4N8X1 3W1GA 5M5YB 2K50A 4XYQA 1KAAA 5T1IA 5CB4F 1I94L 1VQPA 2WB1E 1CK1A 4DV1H 3SGIA 4A3IG 4IFDG 3J81L 2Q2UA 2RDIA 3H3VH 4OHJA 4JI8H 4HAEA 2ZTDA 4JBWA 3ERSX 3TZUA 2E76C 4DUZQ 4RB3C 2K5VA 2B39A 5FLMH 1T3NA 2D9UA 1I5FA 3DWPA 2ASJA 2DJFC 4M8AA 4X3KA 5HBRB 1SSOA 1FJGL 2W6MA 3MFHA 1S5CD 1FVIA 1U9RA 1O7LA 4NPSA 3RAQA 2XCLA 4JC0A 4ECQA 2PZUA 4HNVA 2BH8A 2VUMH 3BVZA 5K36G 4NXNH 1NCVA 2VQFQ 2XD4A 3GTQH 2PCFB 1LTLA 4X64Q 2DN8A 4DKAC 4DR2Q 4H0LC 5A2QL 3VR6A 4LWCA 1KAWA 2HVQA 3J81j 3Q1KA 3OIPA 2B63A 5F9LA 3TS2A 3EYYA 1N56A 3KOJA 3GILA 4IPHA 4LUVA 1Q90A 4S3SA 2N55A 4ILWA 2JA5H 4C3JG 2R7DA 3CQZH 2LXJA 1JR0D 4GN5A 5C0XH 2J7ZA 1JCKB 1NJIC 1TS5A 1B4OA 1EFID 5KFSA 3FKIA 2NTSA 1BNCA 5I47A 1WD0A 4XQJA 3K0XA 5JEAG 4J9SA 2AQ2B 2NTTA 3GTMB 4EYHB 1G291 2PO4A 2AQ4A 5G3LD 1UNNC 2JA9A 1V1OA 2QEJC 3EJIA 4ECWA 3HOZB 1N36L 3X3MA 3GTKB 3GIPA 4OO1H 2DY8A 3KUPA 2UXCL 2R8HA 2ZXRA 4DA2A 4FF4A 1BBWA 3QWNA 2UUBH 1HQRD 3M4QA 3TEHB 3H0GG 2B2UA 4V0BA 3A8KE 2Z6KC 3CCMA 2A69C 4A3GG 3P20A 3MFYA 1SJED 2PZWA 3S15H 4DV6H 1EY4A 5L1LA 1PYBA 2RCFA 1M6VA 1IHZA 1JJCB 3TP8A 2MP1A 1X3EA 4X65Q 4O0AA 2Z4HA 3W3AA 3RAXA 4ZKBB 4AIMA 4X6AH 1E22A 4DV1L 1VQOA 1YNND 2CW0C 2W6PA 4A3KG 2M00A 1TWCH 4K0KQ 3TN2A 4YWLA 3E5NA 5C4ZA 4JI8L 1J8IA 3KBGA 4JCVE 5C4XG 4IJLA 4KHPH 1TWFA 5FO8B 3EFXD 3HOUG 3HOVH 5DLFA 3A5ZB 3K80C 3ER0A 5A35A 4Y7NB 2X6LA 1CKOA 2GPWA 1R4QB 2OT2A 1Q8KA 1Z2NX 4XZ3B 5J39A 3UI2A 5DG8A 1CZWA 3PO3H 3EBEA 3JAMc 2YU9B 1JWUD 4O2DA 4NXNL 3RLFA 5DQGA 1EWIA 2C00A 4YIJA 1RJRA 4K2LA 3CC2A 3H91A 2XGPA 2B2YC 4JI1H 5KFZA 4YCUA 4GN4B 1XX8A 4RZRA 2E5LQ 4JI5H 2RKSA 4POFA 4H02A 1H9KA 1PA6A 1SEIA 1KC7A 4FXDA 3FKIB 2A19A 2YTXA 4GOPA 1UNSA 2LFNA 4LFBH 1BCPD 1TS3A 4A3DB 2DUDA 1SYGA 3ORQA 5C1OA 3PO2B 4I50F 2UVVA 4B3SH 1IOWA 1WTXA 1Q46A 5LHY1 1B33N 4RZQA 2W7PA 1V4YA 1S97A 3T5JA 1KTKA 2W57A 5KFDA 4RHRA 2NVTH 3H4DA 2F4VH 1I4RA 1TWAA 1K83A 1T36A 2WKCA 5IWAQ 3CC7A 4UDUC 1N34H 3T1YH 5J2UF 2UUBL 4DR5Q 5EDWA 3RB6A 2ZJRA 4B3MH 3I12A 4DR4H 5KFQA 1TKWB 3BABA 4LF7H 2W9AA 3J80L 4F7XA 4IFDJ 1YHBA 4LMQD 1SE4A 5D8DA 4L5QA 3QZ8A 2FK3A 3NXWA 2IHEA 3RB4A 4KMUC 4XT1B 3ZYYX 3K6OA 4DV6L 3ULJA 1ULZA 2JQOA 3OPOA 1B3AA 5CV5A 1JC7A 2Z0SA 1E4EB 4MV9A 2Z1CA 5M9OA 4MTDA 2CWAA 1UAPA 2XGTA 3F8TA 1SNPA 2EDGA 1HNXQ 4JI0Q 2ATWA 4O3RA 3HP3A 4LK1C 2BR0A 4GNXB 1L1OA 1F2LA 4RB0A 1T5EA 1YNXA 5CGKA 4KHPL 4LFAQ 3GTOB 5DGBA 4LF8Q 3MWMA 2EYJA 4A3EG 1EY7A 4P71A
chains in the Genus database with same CATH topology
1VQHA 3E9HA 1NE3A 4LF5Q 1WI5A 4XIGS 3J7ZC 2N49A 1UE7A 2FXQA 4A3BG 2NZOA 5BR8Q 4C3IH 1N34Q 1S3OA 1D7QA 1XPUA 3M3YH 3FP9A 4JBJA 1N33Q 4TVAB 1Q7YC 4YCVA 2VNUD 3OYYA 3Q8DA 5LMNW 1PH1A 5C0XG 4UY8C 2HHHQ 3CCLA 1TXYA 3PIOA 3CMAA 3CAMA 2KHIA 3BJUA 1X65A 2ZJQA 1N9WA 1H95A 2AWOA 1W3SA 4AYBG 1E1TA 5C3EH 1HNWL 4JI1L 2YV5A 4JI3L 2OQKA 1WYDA 4UPAA 2JA7H 4BBSH 3H0GH 2IY5B 2WP8J 4A3LG 1X56A 4JI5L 3AQQA 1N36Q 3ICEA 4AYBE 2UXDQ 2UXCQ 4GLVB 4XTCS 3UDGA 3T1HL 2PQAA 3HFZB 1VQ4A 2ASBA 1MIUA 3E9IA 1DGSA 2CWPA 3UDXA 4AQYQ 2UU9Q 2Q2IA 1VQFA 4LFBL 3CCRA 1K3RA 1SMXA 5IE8A 2MO1A 1R9TH 2KCTA 1UEBA 2JA8H 4DK6C 4A3MG 5J3BA 1PYSB 1LYLA 1C7YA 4BXXG 1A8VA 5GADC 1KC8C 4B3SL 2K5NA 3PUYA 5IYDH 4A3KH 4GS3A 4JI6Q 1EOVA 4P75A 4IPGA 2MQHA 1PH8A 5GAGC 4LFCL 2CQOA 3BZCA 1S40A 5C4XH 1BKBA 3HOZH 2F4VL 2PMZE 4X66Q 1XMOQ 3GTKH 2N8NA 3S24A 5LMUQ 4IOAA 1HZAA 1VQAA 1N34L 4R4QA 2H5XA 3T1YL 3RZDH 2ES2A 1Q81C 1UWVA 4B3ML 3MXNB 4DV1Q 1QZGA 1VQ9A 2R92H 4DR4L 4JG2A 1XNRL 4A93G 2VZAA 4GLXA 3CF5A 4LF7L 4L5RC 1CKNB 3PIPA 3RR5A 4NXMQ 2A1AA 3KF6A 1Y1WH 3S2DH 1Q1EA 3HOVG 4GKJL 1I50H 4DPGA 2E2HH 1NMGA 1SE8A 2VL6A 5IP7G 3I56A 2VQEL 1PHJA 1NBWA 1GO3E 3J80c 1Q82C 2EIFA 1OXVA 5GROA 4JI7Q 1B70B 4EQ5A 2I5MX 4OWWB 3RLNA 5M3MG 3JAMi 4DV2Q 3PO3G 1YITA 4DK3C 1XNQQ 1WJJA 1EQQA 1OXSC 1PFSA 1YEZA 3PSIA 5H1SE 5IYBG 4NXNQ 4A4IA 2K14A 3I2ZA 1N32L 1VQJA 4ME3A 5IYCG 1HJPA 5LMNQ 1EFWA 3J80i 1E3PA 3PF4A 1M1KC 3RLOA 3I4MH 2C35B 1HZBA 2VW9A 2HT1A 5JJKA 2LXKA 4BA2I 4R4IA 1Z9FA 4Y7NH 3HOXG 3PUVA 1SROA 1U0LA 5GAEC 3OTOQ 4B3RL 5C44G 2DGYA 2WB1G 1VQ8A 4YCWA 5IY0A 2B63G 2YU9H 4YWMA 1I94Q 3AEVA 1OXXK 2KCMA 3HOWH 4BBRG 3CC4A 1XTDA 4HIMA 4X62L 1SR3A 1CSPA 1E1OA 2Z6KA 1PH4A 1UE6A 2I0QA 5FLMG 4OXPA 2B29A 4X64L 1O7IA 1VQNA 1VQIA 2ID0A 3PUWA 4DR2L 3HOYG 1YZ6A 2AMCB 1HNZQ 4DR7Q 4GNXC 3S1MH 3FKIH 3M85A 1WFQA 2HIXA 3L7ZC 1YI2A 4QJFA 1KHIA 1V43A 4DV7Q 3OW2A 1M90C 1ASZA 1OXTA 4OONA 2AKWB 4P74A 4DV3Q 2Q2TA 2UUAL 4A3DH 1I6HH 4MNOA 3MEFA 5IP9G 1JJ2A 4BY1H 2VUMG 2CFMA 1XMQL 1PH7A 2UUCQ 4JI2L 3KF8B 3CW2C 2E2JH 4MTNA 4UP8A 2R7ZH 3PO2H 4QL5A 4YHHL 4WJ3M 1AH9A 3TRZA 1RL2A 2OTLA 4LF6Q 4A3CH 4ALPA 1X6OA 3PV0A 4DV5Q 5FJ8H 1IXRA 1YJNA 3W1BA 2UXBQ 4HJ9A 5JJLA 4DR1L 1PH9A 4C2MH 3S14H 1B8AA 4P72A 4APVA 4A3EH 4NB3A 1FL0A 1VQDA 1VQ5A 4DUYQ 2ZM6Q 1GVPA 1B7YB 4L5SA 3KF6B 1SFOH 3CD6A 3S1QH 3AFPA 2OTJA 1A62A 5BR8L 4LF4L 3GTJH 1T9HA 3W5OA 2JA5G 4A3BH 1K8AC 1N33L 1QUQA 1RIPA 5HY6A 4YY3Q 2A8VA 3UE1A 1UE1A 3B6YA 4WJ4A 3ZJYC 1XJVA 3ULLA 4LF9Q 4A3JG 1VQ7A 4GN3B 3K7AH 4HJ7A 4BY7H 4DV0Q 1KXLA 1NMFA 1NY4A 3CCVA 4GOPB 1YJ9A 4UP7A 1BVSA 2LSSA 4GKKL 3F2CA 4OO1G 4A3GH 3K8AA 4HIDA 2MNAA 4HJ8A 3S1NH 1AE2A 4UP9A 3GDEA 1OXUA 2E8GA 1Q12A 2BA1A 2F52A 4JBMA 4X65L 3DM3A 1KQSA 4AQYL 5C0XJ 1CSQA 4QY7A 1P8LA 1G51A 5C3EG 1V1QA 4IOCA 3GTOH 4LNQA 1IBKQ 3M9BA 4J15A 4JI1Q 4POGA 4BBSG 3S17H 4BXXH 1EQRA 1Y14B 4K0KL 4TQUS 2IHFA 4IFDI 3GTMH 1X54A 1Y1VH 4JI6L 3I7FA 3GTLH 2D0PA 3KJPA 1VQBA 2RF4A 3K81C 4KHZA 4B3TL 4X66L 3HOUH 5M5WH 4DV4L 4LFBQ 2JA8G 4LUOA 1QVGA 1HR0L 5LMUL 3DLLA 5IT9c 4DR3Q 4HIOA 3KDFB 3G48A 3S1RH 4LUZA 4DR6L 1N8RC 4JBKA 1KD1C 1SN8A 4B3SQ 3S16H 2NVXH 4JI8Q 4A93H 2NN6I 1A63A 4KLKA 2JE6I 2PI2E 4QGUA 3A74A 5DLQE 4LFCQ 2KBNA 2QA4A 3PCOB 3G4SA 1YIJA 1PH3A 3I4NG 4PG3A 2D62A 5ELNA 4L5TA 4FDBA 1K9MC 2JA6G 5IP7H 4GNXA 1GD7A 1TWHH 1L1OB 1HZ9A 1X55A 3EIVA 4RG1A 3L2PA 3T1YQ 1S72A 2E5LL 2R92G 3KFUA 4B3MQ 2QEXA 3F2BA 1VQCA 2Y0SG 3M4PA 3NENA 2N3SA 5M3MH 4DV2L 4A3FH 4LF7Q 5ELOA 1XNQL 2R93H 3G71A 1FGUA 1K83H 1BBUA 1TWGH 1VQGA 1WOCA 2RHQB 4A76A 1X9NA 3H15A 1ASYA 1AE3A 1VQMA 2Y0SE 4GKJQ 1Q1BA 3L0OA 2F3IA 3U50C 1V9PA 4OX9Q 5LMNL 1IL2A 2VQEQ 1D8LA 2I5HA 1QVFA 2EXDA 1CUKA 1GM5A 1QUQB 3AYHB 3M4OH 4MZ9A 4A75A 4OWTB 2IX0A 1Z47A 4PZ6A 1J5EQ 1XPRA 1KRTA 2RCNA 3HOXH 3W1GA 4IO9A 3OTOL 3RN5A 4JV5L 4Y52H 1G6PA 5IWAL 5C44H 3ULPA 1IBML 2K50A 1UE5A 2ZTEA 1N32Q 2B63H 4DR5L 1I94L 1VQPA 2VY3A 2OCEA 2WB1E 3AFQA 5M5XH 5M3FH 5C0XI 3GTGH 3S2HH 3SGIA 4A3IG 4BBRH 4IFDG 1VQEA 2PQAB 2Q2UA 3H3VH 3TS0A 3CMEA 4JOIC 1SLJA 2KENA 2ZTDA 1I3QH 3JC66 3ERSX 4JBWA 3U4VA 4DUZQ 1K8GA 1C0AA 2K5VA 5AJ3Q 2AWNA 3GTPH 5FLMH 1I5FA 3VDYA 1HNZL 4DR7L 3GO5A 3HOYH 2UUBQ 1WCMH 3RNUA 1PH6A 1FJGL 3KYHC 3TREA 1IYJB 1FVIA 2VS1A 1K0RA 4IPCA 2CKZB 3PUZA 4NPSA 3K7UC 4JC0A 1HNXL 4JI0L 5IP9H 3PF5A 4P73A 3CPFA 3LGJA 2BH8A 4AH6A 2VUMH 5K36G 4R4CA 2VQFQ 3KLWA 3GTQH 2GVAA 1LTLA 4X64Q 1JB7A 4LFAL 2JJQA 4DV6Q 4JI4Q 2I5LX 4DKAC 4DR2Q 2E2IH 1HR0W 4LF8L 4GLAC 4JYAL 4LWCA 1KAWA 4R1JA 4DAMA 4LF5L 1CKMA 3J81j 4R4TA 1MJCA 4DUYL 3TS2A 3UDFA 1NTGA 3KOJA 2K5HA 2R7ZG 1XMQQ 4IPHA 4HJ5A 4GOPC 4LUVA 4JI2Q 2V1CC 4BA1I 2IX1A 2NVQH 1U5KA 2JA5H 4YHHQ 3CCQA 2R7DA 3CQZH 2LXJA 4KHPQ 4GN5A 3D0FA 5FJ8G 2HHHL 1MJEA 1QVCA 1HH2P 3EN2A 1NJIC 1IBLQ 4DR1Q 3BZKA 4LF9L 2R6GA 3I55A 3K0XA 5JEAG 4RMFA 1G291 3CXCA 2JA9A 4R4OA 3UDIA 1N36L 4A3LH 4LF4Q 3RZOH 1TWFH 2JEAI 2UXDL 1OTCA 3J7A5 2UXCL 4YWKA 1BBWA 2K4KA 1LM0A 3A0JA 1YHAA 1EUJA 2UU9L 2K75A 3M4QA 4BY7G 3HKSA 2RHSB 1HNWQ 3TEHB 3IRBA 3NEMA 2JA7G 4JI3Q 1K73C 3H0GG 3U4ZA 4A3MH 1IBKL 2YYZA 2Z6KC 4GKKQ 5JEAJ 3CCMA 1KIXA 4JI5Q 4A3GG 2BA0A 4LW1A 4IPDA 3S15H 1IZ6A 2CCZA 1SRUA 3T1HQ 2WAQG 1PYBA 1XMOL 1XPOA 4IJHA 5GAHC 1JJCB 2NZHA 1X3EA 2HQLA 4X65Q 2N78A 4O0AA 2EQSA 4DR3L 4PZ8A 5C4JH 3CCSA 2YTYA 4AIMA 2GN5A 1E22A 2WAQE 4DV1L 1VQOA 4X6AH 3GD7A 1KRSA 2OQ0A 5IYDG 1PV4A 4A3KG 2MFIA 1TWCH 4K0KQ 1L1OC 1Y1VG 4YWLA 3H3VI 1JJGA 4JI8L 2B3GA 4JCVE 4NXML 1VQ6A 5C4XG 3HOZG 4IJLA 4JOIA 2KHJA 2F4VQ 1VCIA 2YTVA 2JEBI 3HOUG 3HOVH 3A5ZB 4B3TQ 3K80C 3HKZG 3J81c 3ER0A 4DV4Q 2OWOA 1P16A 3I4NH 4KI0A 1HR0Q 1CKOA 2JA6H 4JI7L 3G6EA 3F1ZA 3NBHB 4DAYB 4DR4Q 1GKHA 3I4OA 1XNRQ 1Q8KA 4DR6Q 4C3HH 3HKZE 3KJOA 1YHQA 1TWAH 1JT8A 3PO3H 3EBEA 3JAMc 1VS0A 1Y1WG 4O2DA 4NXNL 3RLFA 3RN2A 1EWIA 5IYBH 1HZCA 4QIWE 2L15A 3J81i 5IYCH 3CC2A 1LUZA 2NVYH 4OX9L 4PZ7A 4YCUA 4GN4B 3A5UA 2E5LQ 4POFA 5JJIA 4H02A 2PI2A 2K52A 1PA6A 4A3FG 1EIYB 1VQKA 1J5EL 2R93G 2A19A 2ZJPA 4PMWA 2YTXA 4GOPA 2MO0A 1EYGA 2DUDA 3WWVA 1KL9A 3I4MG 2GVBA 1PH5A 5GQOA 2ALYB 3NELA 2ZTCA 5EAYA 3U58A 1Q46A 3CCEA 3UE0A 1J6QA 4A3IH 2WFWA 5E7NA 4B3RQ 1YJWA 2NVTH 4DUZL 4OO1I 5AJ3L 2Q2HA 4JV5Q 3PUXA 2JK8A 5IWAQ 3CC7A 2XTIA 1IBMQ 3HOWG 4OWXB 2R7FA 5M3FG 4DV7L 2UUBL 4DR5Q 5FLXc 4DV3L 2ZJRA 3CCUA 1X3GA 2QGQA 2NN6G 2HIVA 4X62Q 1YBYA 3CPWA 3STBC 1PVOA 2UUCL 3FHWA 2D0OA 4IFDJ 1YHBA 1L2FA 3D31A 4L5QA 1PH2A 1MKHA 4LF6L 2VQFL 2PNHA 1L0WA 1C9OA 3KDFA 4DNIA 2IHEA 4DV5L 3FKIG 2UXBL 3BU2A 5HGQA 3F2DA 3E0EA 4DV6L 4JI4L 2BH2A 1E24A 3ULJA 3STBD 1CKNA 1WCMG 2JQOA 1VQLA 4A3DG 1JE5A 5M5YH 2Z0SA 2UUAQ 1FJGQ 3CCJA 2ZM6L 4QQBX 4BY1G 1EIFA 2CWAA 2AHOB 2XGTA 3F8TA 4HIKA 1YVCA 3PO2G 1Q86C 1HNXQ 4JI0Q 2ATWA 1X3FA 3TQYA 4HJAA 1JMCA 4A3CG 4GNXB 1A0IA 3CP0A 3PGZA 4YY3L 1W2BA 4EX5A 1L1OA 1QZHA 1YNXA 3M7NA 2IT1A 4LFAQ 4C3JH 4KHPL 4LF8Q 1E7ZA 4JYAQ 4A3EG 1IBLL 4A3JH 4DV0L 4P71A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQH A;  3E9H A;  1NE3 A;  4LF5 Q;  1WI5 A;  4XIG S;  3J7Z C;  2N49 A;  1UE7 A;  2FXQ A;  4A3B G;  2NZO A;  5BR8 Q;  4C3I H;  1N34 Q;  1S3O A;  1D7Q A;  1XPU A;  3M3Y H;  3FP9 A;  4JBJ A;  1N33 Q;  4TVA B;  1Q7Y C;  4YCV A;  2VNU D;  3OYY A;  3Q8D A;  5LMN W;  1PH1 A;  5C0X G;  4UY8 C;  2HHH Q;  3CCL A;  1TXY A;  3PIO A;  3CMA A;  3CAM A;  2KHI A;  3BJU A;  1X65 A;  2ZJQ A;  1N9W A;  1H95 A;  2AWO A;  1W3S A;  4AYB G;  1E1T A;  5C3E H;  1HNW L;  4JI1 L;  2YV5 A;  4JI3 L;  2OQK A;  1WYD A;  4UPA A;  2JA7 H;  4BBS H;  3H0G H;  2IY5 B;  2WP8 J;  4A3L G;  1X56 A;  4JI5 L;  3AQQ A;  1N36 Q;  3ICE A;  4AYB E;  2UXD Q;  2UXC Q;  4GLV B;  4XTC S;  3UDG A;  3T1H L;  2PQA A;  3HFZ B;  1VQ4 A;  2ASB A;  1MIU A;  3E9I A;  1DGS A;  2CWP A;  3UDX A;  4AQY Q;  2UU9 Q;  2Q2I A;  1VQF A;  4LFB L;  3CCR A;  1K3R A;  1SMX A;  5IE8 A;  2MO1 A;  1R9T H;  2KCT A;  1UEB A;  2JA8 H;  4DK6 C;  4A3M G;  5J3B A;  1PYS B;  1LYL A;  1C7Y A;  4BXX G;  1A8V A;  5GAD C;  1KC8 C;  4B3S L;  2K5N A;  3PUY A;  5IYD H;  4A3K H;  4GS3 A;  4JI6 Q;  1EOV A;  4P75 A;  4IPG A;  2MQH A;  1PH8 A;  5GAG C;  4LFC L;  2CQO A;  3BZC A;  1S40 A;  5C4X H;  1BKB A;  3HOZ H;  2F4V L;  2PMZ E;  4X66 Q;  1XMO Q;  3GTK H;  2N8N A;  3S24 A;  5LMU Q;  4IOA A;  1HZA A;  1VQA A;  1N34 L;  4R4Q A;  2H5X A;  3T1Y L;  3RZD H;  2ES2 A;  1Q81 C;  1UWV A;  4B3M L;  3MXN B;  4DV1 Q;  1QZG A;  1VQ9 A;  2R92 H;  4DR4 L;  4JG2 A;  1XNR L;  4A93 G;  2VZA A;  4GLX A;  3CF5 A;  4LF7 L;  4L5R C;  1CKN B;  3PIP A;  3RR5 A;  4NXM Q;  2A1A A;  3KF6 A;  1Y1W H;  3S2D H;  1Q1E A;  3HOV G;  4GKJ L;  1I50 H;  4DPG A;  2E2H H;  1NMG A;  1SE8 A;  2VL6 A;  5IP7 G;  3I56 A;  2VQE L;  1PHJ A;  1NBW A;  1GO3 E;  3J80 c;  1Q82 C;  2EIF A;  1OXV A;  5GRO A;  4JI7 Q;  1B70 B;  4EQ5 A;  2I5M X;  4OWW B;  3RLN A;  5M3M G;  3JAM i;  4DV2 Q;  3PO3 G;  1YIT A;  4DK3 C;  1XNQ Q;  1WJJ A;  1EQQ A;  1OXS C;  1PFS A;  1YEZ A;  3PSI A;  5H1S E;  5IYB G;  4NXN Q;  4A4I A;  2K14 A;  3I2Z A;  1N32 L;  1VQJ A;  4ME3 A;  5IYC G;  1HJP A;  5LMN Q;  1EFW A;  3J80 i;  1E3P A;  3PF4 A;  1M1K C;  3RLO A;  3I4M H;  2C35 B;  1HZB A;  2VW9 A;  2HT1 A;  5JJK A;  2LXK A;  4BA2 I;  4R4I A;  1Z9F A;  4Y7N H;  3HOX G;  3PUV A;  1SRO A;  1U0L A;  5GAE C;  3OTO Q;  4B3R L;  5C44 G;  2DGY A;  2WB1 G;  1VQ8 A;  4YCW A;  5IY0 A;  2B63 G;  2YU9 H;  4YWM A;  1I94 Q;  3AEV A;  1OXX K;  2KCM A;  3HOW H;  4BBR G;  3CC4 A;  1XTD A;  4HIM A;  4X62 L;  1SR3 A;  1CSP A;  1E1O A;  2Z6K A;  1PH4 A;  1UE6 A;  2I0Q A;  5FLM G;  4OXP A;  2B29 A;  4X64 L;  1O7I A;  1VQN A;  1VQI A;  2ID0 A;  3PUW A;  4DR2 L;  3HOY G;  1YZ6 A;  2AMC B;  1HNZ Q;  4DR7 Q;  4GNX C;  3S1M H;  3FKI H;  3M85 A;  1WFQ A;  2HIX A;  3L7Z C;  1YI2 A;  4QJF A;  1KHI A;  1V43 A;  4DV7 Q;  3OW2 A;  1M90 C;  1ASZ A;  1OXT A;  4OON A;  2AKW B;  4P74 A;  4DV3 Q;  2Q2T A;  2UUA L;  4A3D H;  1I6H H;  4MNO A;  3MEF A;  5IP9 G;  1JJ2 A;  4BY1 H;  2VUM G;  2CFM A;  1XMQ L;  1PH7 A;  2UUC Q;  4JI2 L;  3KF8 B;  3CW2 C;  2E2J H;  4MTN A;  4UP8 A;  2R7Z H;  3PO2 H;  4QL5 A;  4YHH L;  4WJ3 M;  1AH9 A;  3TRZ A;  1RL2 A;  2OTL A;  4LF6 Q;  4A3C H;  4ALP A;  1X6O A;  3PV0 A;  4DV5 Q;  5FJ8 H;  1IXR A;  1YJN A;  3W1B A;  2UXB Q;  4HJ9 A;  5JJL A;  4DR1 L;  1PH9 A;  4C2M H;  3S14 H;  1B8A A;  4P72 A;  4APV A;  4A3E H;  4NB3 A;  1FL0 A;  1VQD A;  1VQ5 A;  4DUY Q;  2ZM6 Q;  1GVP A;  1B7Y B;  4L5S A;  3KF6 B;  1SFO H;  3CD6 A;  3S1Q H;  3AFP A;  2OTJ A;  1A62 A;  5BR8 L;  4LF4 L;  3GTJ H;  1T9H A;  3W5O A;  2JA5 G;  4A3B H;  1K8A C;  1N33 L;  1QUQ A;  1RIP A;  5HY6 A;  4YY3 Q;  2A8V A;  3UE1 A;  1UE1 A;  3B6Y A;  4WJ4 A;  3ZJY C;  1XJV A;  3ULL A;  4LF9 Q;  4A3J G;  1VQ7 A;  4GN3 B;  3K7A H;  4HJ7 A;  4BY7 H;  4DV0 Q;  1KXL A;  1NMF A;  1NY4 A;  3CCV A;  4GOP B;  1YJ9 A;  4UP7 A;  1BVS A;  2LSS A;  4GKK L;  3F2C A;  4OO1 G;  4A3G H;  3K8A A;  4HID A;  2MNA A;  4HJ8 A;  3S1N H;  1AE2 A;  4UP9 A;  3GDE A;  1OXU A;  2E8G A;  1Q12 A;  2BA1 A;  2F52 A;  4JBM A;  4X65 L;  3DM3 A;  1KQS A;  4AQY L;  5C0X J;  1CSQ A;  4QY7 A;  1P8L A;  1G51 A;  5C3E G;  1V1Q A;  4IOC A;  3GTO H;  4LNQ A;  1IBK Q;  3M9B A;  4J15 A;  4JI1 Q;  4POG A;  4BBS G;  3S17 H;  4BXX H;  1EQR A;  1Y14 B;  4K0K L;  4TQU S;  2IHF A;  4IFD I;  3GTM H;  1X54 A;  1Y1V H;  4JI6 L;  3I7F A;  3GTL H;  2D0P A;  3KJP A;  1VQB A;  2RF4 A;  3K81 C;  4KHZ A;  4B3T L;  4X66 L;  3HOU H;  5M5W H;  4DV4 L;  4LFB Q;  2JA8 G;  4LUO A;  1QVG A;  1HR0 L;  5LMU L;  3DLL A;  5IT9 c;  4DR3 Q;  4HIO A;  3KDF B;  3G48 A;  3S1R H;  4LUZ A;  4DR6 L;  1N8R C;  4JBK A;  1KD1 C;  1SN8 A;  4B3S Q;  3S16 H;  2NVX H;  4JI8 Q;  4A93 H;  2NN6 I;  1A63 A;  4KLK A;  2JE6 I;  2PI2 E;  4QGU A;  3A74 A;  5DLQ E;  4LFC Q;  2KBN A;  2QA4 A;  3PCO B;  3G4S A;  1YIJ A;  1PH3 A;  3I4N G;  4PG3 A;  2D62 A;  5ELN A;  4L5T A;  4FDB A;  1K9M C;  2JA6 G;  5IP7 H;  4GNX A;  1GD7 A;  1TWH H;  1L1O B;  1HZ9 A;  1X55 A;  3EIV A;  4RG1 A;  3L2P A;  3T1Y Q;  1S72 A;  2E5L L;  2R92 G;  3KFU A;  4B3M Q;  2QEX A;  3F2B A;  1VQC A;  2Y0S G;  3M4P A;  3NEN A;  2N3S A;  5M3M H;  4DV2 L;  4A3F H;  4LF7 Q;  5ELO A;  1XNQ L;  2R93 H;  3G71 A;  1FGU A;  1K83 H;  1BBU A;  1TWG H;  1VQG A;  1WOC A;  2RHQ B;  4A76 A;  1X9N A;  3H15 A;  1ASY A;  1AE3 A;  1VQM A;  2Y0S E;  4GKJ Q;  1Q1B A;  3L0O A;  2F3I A;  3U50 C;  1V9P A;  4OX9 Q;  5LMN L;  1IL2 A;  2VQE Q;  1D8L A;  2I5H A;  1QVF A;  2EXD A;  1CUK A;  1GM5 A;  1QUQ B;  3AYH B;  3M4O H;  4MZ9 A;  4A75 A;  4OWT B;  2IX0 A;  1Z47 A;  4PZ6 A;  1J5E Q;  1XPR A;  1KRT A;  2RCN A;  3HOX H;  3W1G A;  4IO9 A;  3OTO L;  3RN5 A;  4JV5 L;  4Y52 H;  1G6P A;  5IWA L;  5C44 H;  3ULP A;  1IBM L;  2K50 A;  1UE5 A;  2ZTE A;  1N32 Q;  2B63 H;  4DR5 L;  1I94 L;  1VQP A;  2VY3 A;  2OCE A;  2WB1 E;  3AFQ A;  5M5X H;  5M3F H;  5C0X I;  3GTG H;  3S2H H;  3SGI A;  4A3I G;  4BBR H;  4IFD G;  1VQE A;  2PQA B;  2Q2U A;  3H3V H;  3TS0 A;  3CME A;  4JOI C;  1SLJ A;  2KEN A;  2ZTD A;  1I3Q H;  3JC6 6;  3ERS X;  4JBW A;  3U4V A;  4DUZ Q;  1K8G A;  1C0A A;  2K5V A;  5AJ3 Q;  2AWN A;  3GTP H;  5FLM H;  1I5F A;  3VDY A;  1HNZ L;  4DR7 L;  3GO5 A;  3HOY H;  2UUB Q;  1WCM H;  3RNU A;  1PH6 A;  1FJG L;  3KYH C;  3TRE A;  1IYJ B;  1FVI A;  2VS1 A;  1K0R A;  4IPC A;  2CKZ B;  3PUZ A;  4NPS A;  3K7U C;  4JC0 A;  1HNX L;  4JI0 L;  5IP9 H;  3PF5 A;  4P73 A;  3CPF A;  3LGJ A;  2BH8 A;  4AH6 A;  2VUM H;  5K36 G;  4R4C A;  2VQF Q;  3KLW A;  3GTQ H;  2GVA A;  1LTL A;  4X64 Q;  1JB7 A;  4LFA L;  2JJQ A;  4DV6 Q;  4JI4 Q;  2I5L X;  4DKA C;  4DR2 Q;  2E2I H;  1HR0 W;  4LF8 L;  4GLA C;  4JYA L;  4LWC A;  1KAW A;  4R1J A;  4DAM A;  4LF5 L;  1CKM A;  3J81 j;  4R4T A;  1MJC A;  4DUY L;  3TS2 A;  3UDF A;  1NTG A;  3KOJ A;  2K5H A;  2R7Z G;  1XMQ Q;  4IPH A;  4HJ5 A;  4GOP C;  4LUV A;  4JI2 Q;  2V1C C;  4BA1 I;  2IX1 A;  2NVQ H;  1U5K A;  2JA5 H;  4YHH Q;  3CCQ A;  2R7D A;  3CQZ H;  2LXJ A;  4KHP Q;  4GN5 A;  3D0F A;  5FJ8 G;  2HHH L;  1MJE A;  1QVC A;  1HH2 P;  3EN2 A;  1NJI C;  1IBL Q;  4DR1 Q;  3BZK A;  4LF9 L;  2R6G A;  3I55 A;  3K0X A;  5JEA G;  4RMF A;  1G29 1;  3CXC A;  2JA9 A;  4R4O A;  3UDI A;  1N36 L;  4A3L H;  4LF4 Q;  3RZO H;  1TWF H;  2JEA I;  2UXD L;  1OTC A;  3J7A 5;  2UXC L;  4YWK A;  1BBW A;  2K4K A;  1LM0 A;  3A0J A;  1YHA A;  1EUJ A;  2UU9 L;  2K75 A;  3M4Q A;  4BY7 G;  3HKS A;  2RHS B;  1HNW Q;  3TEH B;  3IRB A;  3NEM A;  2JA7 G;  4JI3 Q;  1K73 C;  3H0G G;  3U4Z A;  4A3M H;  1IBK L;  2YYZ A;  2Z6K C;  4GKK Q;  5JEA J;  3CCM A;  1KIX A;  4JI5 Q;  4A3G G;  2BA0 A;  4LW1 A;  4IPD A;  3S15 H;  1IZ6 A;  2CCZ A;  1SRU A;  3T1H Q;  2WAQ G;  1PYB A;  1XMO L;  1XPO A;  4IJH A;  5GAH C;  1JJC B;  2NZH A;  1X3E A;  2HQL A;  4X65 Q;  2N78 A;  4O0A A;  2EQS A;  4DR3 L;  4PZ8 A;  5C4J H;  3CCS A;  2YTY A;  4AIM A;  2GN5 A;  1E22 A;  2WAQ E;  4DV1 L;  1VQO A;  4X6A H;  3GD7 A;  1KRS A;  2OQ0 A;  5IYD G;  1PV4 A;  4A3K G;  2MFI A;  1TWC H;  4K0K Q;  1L1O C;  1Y1V G;  4YWL A;  3H3V I;  1JJG A;  4JI8 L;  2B3G A;  4JCV E;  4NXM L;  1VQ6 A;  5C4X G;  3HOZ G;  4IJL A;  4JOI A;  2KHJ A;  2F4V Q;  1VCI A;  2YTV A;  2JEB I;  3HOU G;  3HOV H;  3A5Z B;  4B3T Q;  3K80 C;  3HKZ G;  3J81 c;  3ER0 A;  4DV4 Q;  2OWO A;  1P16 A;  3I4N H;  4KI0 A;  1HR0 Q;  1CKO A;  2JA6 H;  4JI7 L;  3G6E A;  3F1Z A;  3NBH B;  4DAY B;  4DR4 Q;  1GKH A;  3I4O A;  1XNR Q;  1Q8K A;  4DR6 Q;  4C3H H;  3HKZ E;  3KJO A;  1YHQ A;  1TWA H;  1JT8 A;  3PO3 H;  3EBE A;  3JAM c;  1VS0 A;  1Y1W G;  4O2D A;  4NXN L;  3RLF A;  3RN2 A;  1EWI A;  5IYB H;  1HZC A;  4QIW E;  2L15 A;  3J81 i;  5IYC H;  3CC2 A;  1LUZ A;  2NVY H;  4OX9 L;  4PZ7 A;  4YCU A;  4GN4 B;  3A5U A;  2E5L Q;  4POF A;  5JJI A;  4H02 A;  2PI2 A;  2K52 A;  1PA6 A;  4A3F G;  1EIY B;  1VQK A;  1J5E L;  2R93 G;  2A19 A;  2ZJP A;  4PMW A;  2YTX A;  4GOP A;  2MO0 A;  1EYG A;  2DUD A;  3WWV A;  1KL9 A;  3I4M G;  2GVB A;  1PH5 A;  5GQO A;  2ALY B;  3NEL A;  2ZTC A;  5EAY A;  3U58 A;  1Q46 A;  3CCE A;  3UE0 A;  1J6Q A;  4A3I H;  2WFW A;  5E7N A;  4B3R Q;  1YJW A;  2NVT H;  4DUZ L;  4OO1 I;  5AJ3 L;  2Q2H A;  4JV5 Q;  3PUX A;  2JK8 A;  5IWA Q;  3CC7 A;  2XTI A;  1IBM Q;  3HOW G;  4OWX B;  2R7F A;  5M3F G;  4DV7 L;  2UUB L;  4DR5 Q;  5FLX c;  4DV3 L;  2ZJR A;  3CCU A;  1X3G A;  2QGQ A;  2NN6 G;  2HIV A;  4X62 Q;  1YBY A;  3CPW A;  3STB C;  1PVO A;  2UUC L;  3FHW A;  2D0O A;  4IFD J;  1YHB A;  1L2F A;  3D31 A;  4L5Q A;  1PH2 A;  1MKH A;  4LF6 L;  2VQF L;  2PNH A;  1L0W A;  1C9O A;  3KDF A;  4DNI A;  2IHE A;  4DV5 L;  3FKI G;  2UXB L;  3BU2 A;  5HGQ A;  3F2D A;  3E0E A;  4DV6 L;  4JI4 L;  2BH2 A;  1E24 A;  3ULJ A;  3STB D;  1CKN A;  1WCM G;  2JQO A;  1VQL A;  4A3D G;  1JE5 A;  5M5Y H;  2Z0S A;  2UUA Q;  1FJG Q;  3CCJ A;  2ZM6 L;  4QQB X;  4BY1 G;  1EIF A;  2CWA A;  2AHO B;  2XGT A;  3F8T A;  4HIK A;  1YVC A;  3PO2 G;  1Q86 C;  1HNX Q;  4JI0 Q;  2ATW A;  1X3F A;  3TQY A;  4HJA A;  1JMC A;  4A3C G;  4GNX B;  1A0I A;  3CP0 A;  3PGZ A;  4YY3 L;  1W2B A;  4EX5 A;  1L1O A;  1QZH A;  1YNX A;  3M7N A;  2IT1 A;  4LFA Q;  4C3J H;  4KHP L;  4LF8 Q;  1E7Z A;  4JYA Q;  4A3E G;  1IBL L;  4A3J H;  4DV0 L;  4P71 A; 
#chains in the Genus database with same CATH topology
 1VQH A;  5FOB B;  4J9K A;  4XIG S;  1O75 A;  5EPK A;  3H40 A;  3VYT A;  1DZ1 A;  2FXQ A;  3VYS A;  2LS0 1;  1QE6 A;  3C2P A;  4WD3 A;  3HOU B;  4JBJ A;  4O4L F;  1KJI A;  2VUM A;  5BMV F;  1RK5 A;  3N40 P;  4FBT A;  5LMN W;  3GTQ A;  5C0X G;  1EHI A;  4UY8 C;  4R9W A;  3S1R B;  4B08 A;  3CMA A;  3CAM A;  1X65 A;  4I4T F;  4CBV A;  1H95 A;  1S5B D;  1PTO D;  4JI1 L;  4XXE A;  3L4J A;  4IUT A;  1L2Z A;  5FPR A;  2FFK B;  4JI5 L;  4ZAI A;  2IL8 A;  4X64 H;  1KJ9 A;  4OEL B;  4DR2 H;  4WRD A;  1HA6 A;  4KY6 A;  2A68 D;  1KNE A;  1MIU A;  4LFB L;  4J8Q A;  5KT4 A;  1VQF A;  1F77 A;  5EGT A;  2HVR A;  1SMX A;  2UUA H;  3J81 W;  3NTI A;  2F4I A;  4C3H B;  1PYS B;  1PRT B;  1TWA B;  2QDL A;  4BXX G;  1K83 B;  1LV9 A;  2EYO A;  4IUR A;  4B3S L;  3PUY A;  1ZHQ A;  1K1Q A;  2BQR A;  4JI6 Q;  4MIU A;  1TS2 A;  3RB3 A;  3V6K A;  5CBE E;  4MV6 A;  5GAG C;  3A7L A;  3WOF A;  3MC0 B;  1BKB A;  2F4V L;  4J9O A;  1XMO Q;  4YJ3 F;  2EYL A;  3S24 A;  4ZHQ F;  2DNC A;  1HXY D;  4O2A F;  3NWS A;  1N34 L;  3T1Y L;  4LSA A;  4FU0 A;  2ENB A;  2EOT A;  1LT5 D;  4B3M L;  2R85 A;  4K5W A;  1QZG A;  4DR4 L;  4DU9 A;  4JG2 A;  1C30 A;  3WO0 A;  4LF7 L;  2JA7 A;  5KNB A;  3KLR A;  5CV9 A;  1PTO H;  5KX5 F;  3A54 A;  5A2Q W;  4M7E A;  2WYO A;  3HOV G;  2E2H H;  4TKO B;  1CZG A;  1NBW A;  5J22 A;  2FMM A;  2EIF A;  1OXV A;  1WTR A;  4JI7 Q;  4O3O A;  1B70 B;  4EQ5 A;  2I5M X;  2A74 C;  4OL7 A;  3PO3 G;  5FLX E;  1WJJ A;  2O4X A;  1OXS C;  1PFS A;  4RNM A;  1FYC A;  1K8O A;  3RV4 A;  4A4I A;  4X65 H;  3Q2O A;  4AQY H;  5LMN Q;  1UUP A;  2B2U C;  2VUM B;  4K0K H;  4WFN 3;  2O2L D;  5JJK A;  4K6D A;  3GTQ B;  3GV3 A;  2R8I A;  4XYM B;  1SRO A;  4UFZ A;  3VA7 A;  5GAE C;  2DGY A;  4X66 H;  5IY0 A;  4G7Z C;  3SK5 A;  3RGZ A;  2EY2 A;  1I94 Q;  3AEV A;  1Y1W A;  2KCM A;  1I50 A;  4BBR G;  4J9P A;  2CZG A;  2JA5 B;  4ZLT F;  2NN6 H;  3CQZ B;  1CA5 A;  1BJT A;  1PDQ A;  3KHR A;  2KED A;  1X3P A;  4X64 L;  1O7I A;  4DR2 L;  3PUW A;  4GNX C;  3L7Z C;  1PLF A;  3MEH A;  4DV7 Q;  4LMY A;  1ASZ A;  4DAV A;  1OXT A;  2ASD A;  1SMY D;  4P74 A;  2UUA L;  2V58 A;  2E5L H;  1BR9 A;  3RBE A;  1RJP A;  2RBM A;  1PH7 A;  1XNQ H;  2ZT9 C;  2NUA B;  5EWF A;  4JV0 A;  2KHS A;  4ME5 A;  1H9S B;  1RL2 A;  4LF6 Q;  4ED7 A;  3MVV A;  3NBH A;  2KQ3 A;  5FJ8 H;  4IRK A;  1YJN A;  3OHB A;  1DXM A;  4L1K A;  4C2M H;  1CQV A;  3S14 H;  3C0F B;  4ETS A;  4J9R A;  1B1Z A;  1VQ5 A;  5KFY A;  4WJW A;  2XGQ A;  1IL8 A;  2ZM6 Q;  4L5S A;  2C2E A;  3S15 B;  4ECS A;  1A62 A;  1RK6 A;  4UCR A;  2BE5 C;  4HTH A;  3IG0 A;  2IWH A;  5IWA H;  5I4D A;  1HA5 A;  3B6Y A;  3RUZ A;  2JA8 B;  4WJ4 A;  4DR5 H;  3K3V A;  4GN3 B;  4HJ7 A;  3FPP A;  1TWC B;  4UP7 A;  3QIA A;  1V8Q A;  3TIG A;  1GLV A;  3SVM A;  5KFX A;  4HID A;  3HOV B;  1GSA A;  1FNW A;  1EUC B;  3S1N H;  4IZ8 A;  1HNZ H;  1OXU A;  2BCO A;  1S0O A;  1Q12 A;  2DJG C;  4XQN A;  4X65 L;  3DM3 A;  3JAM E;  4AQY L;  5C0X J;  2FJZ A;  2WV6 D;  1S0N A;  4LF9 H;  1G51 A;  1SJH D;  4RB2 C;  3PO3 B;  1PYW D;  1EZ6 A;  3HG9 A;  1HNX H;  4JI0 H;  3M9B A;  4POG A;  2RDJ A;  3MXP A;  1Y14 B;  4K0K L;  2XVS A;  4TQU S;  1A9X A;  3Q8Q B;  5E4X A;  3GTM H;  1X54 A;  1Y1V H;  3HEJ A;  2VQD A;  5KT3 A;  5EKL A;  2K7V A;  1FGB D;  4LFA H;  1A3V A;  4LF8 H;  3PIP 3;  1YNJ C;  1EZ1 A;  4X66 L;  5KG0 A;  3GIQ A;  1LAC A;  3CKI B;  2QKI C;  1KLG D;  4RCO A;  3D6W A;  4K2K A;  3VPD A;  3G48 A;  1H9R A;  3H3V C;  4LAA A;  4MV1 A;  1EUD B;  2A6H D;  1CHQ D;  4A93 H;  5KFR A;  4JI8 Q;  1A63 A;  4KLK A;  2JE6 I;  1FR3 A;  3IFT A;  2X69 A;  3NTH A;  3RD4 A;  4DL4 A;  1YIJ A;  3I4N G;  4QUF A;  5LA6 F;  5ELN A;  1Y8O B;  3EPI A;  5IP7 H;  1X55 A;  2EJF C;  2K5W A;  2E5L L;  2NVT B;  1AEX A;  3F2B A;  2R86 A;  5E3F A;  4TV9 F;  4CKC A;  5M3M H;  1XNQ L;  2B2V C;  1WOC A;  2EYF A;  3K5M A;  1EEI D;  4RUC A;  3K5N A;  1EU4 A;  1MBY A;  2VA2 A;  1GHK A;  5JJZ A;  1V9P A;  2NZ1 D;  2J6T A;  5IGC A;  4UCS A;  1GM5 A;  3AYH B;  4XYO A;  2SDF A;  2KEC A;  3M4O H;  3TP7 A;  3NGD A;  3JRW A;  3NK9 A;  4KTA A;  1Z47 A;  2RCN A;  1XMO H;  2NVX A;  2W9C B;  1G6P A;  5IWA L;  5C44 H;  4Q45 A;  3GLK A;  1F9P A;  1BCP B;  2ZTE A;  1N32 Q;  4RAY A;  2B63 H;  2I87 A;  3DUZ A;  4DR5 L;  4QWC A;  1RKN A;  4DR3 H;  3AFQ A;  4ZUJ A;  5C0X I;  3S2H H;  1XDN A;  4YAJ B;  2F1M A;  4F4Y A;  3PR5 B;  2PPB C;  2V4R A;  2MCT A;  2DNE A;  3EA6 A;  3U4V A;  4C1N I;  1AN8 A;  4I7A A;  2AWN A;  1U4P A;  2K28 A;  3IFD A;  2R93 A;  1PX2 A;  1TWG A;  3VDY A;  1HNZ L;  3J7A V;  2KSW A;  5KG3 A;  2FLN A;  3GO5 A;  3HOY H;  2UUB Q;  5CA0 F;  2ICI A;  1PH6 A;  2XCA A;  5IGE A;  5KYL A;  4KK7 A;  4IPC A;  5C5M A;  2CKZ B;  3PZP A;  1EQV A;  3PUZ A;  2FK1 A;  1HNX L;  4JI0 L;  5IP9 H;  3PF5 A;  2YZN A;  4AH6 A;  4LH7 A;  3SK4 A;  2B8F A;  1LAB A;  1B2T A;  1L0Y B;  3KLW A;  2GVA A;  2Q8T A;  4LFA L;  4BY7 B;  4KKS A;  4DV6 Q;  2IW3 A;  2I5L X;  4LF8 L;  4OX9 H;  4GLA C;  5LXT F;  3PIO 3;  3G6J B;  4R1J A;  4DAM A;  4TUY F;  5KFM A;  1KDA A;  3OMG A;  3FEW X;  3SDZ A;  1MHW C;  4HJ5 A;  5KFO A;  2I8C A;  4DK0 A;  3LWU A;  4CJ0 B;  5E1F A;  2YRX A;  3CCQ A;  4UAI A;  1HRJ A;  2R82 A;  3N6X A;  1I3Q A;  4KHP Q;  5FJ8 G;  3D0F A;  1I4P A;  3OUU A;  1MJE A;  4UCU A;  1DJR D;  3CRK C;  4OIK A;  3W2D A;  3GV7 B;  3GTP A;  3BZK A;  1WTH A;  2R6G A;  5KFL A;  3S17 B;  2F3W A;  2AQ1 B;  2OEO A;  1WCM A;  3CXC A;  2ALZ A;  4QWE A;  5ELB A;  2FIN B;  1TWF H;  5C4H A;  3LML A;  4HN7 A;  4DGZ A;  2RDG A;  3HKZ B;  3LWE A;  4YR3 A;  4DV7 H;  1EUJ A;  5KRU A;  1F9Q A;  3HKS A;  4C2M A;  1TT2 A;  3IRB A;  4IWY A;  2NVX B;  1PTO B;  2C9O A;  3KHG A;  4JI5 Q;  4FF2 A;  4LF6 H;  5KG2 A;  3DEP A;  1BNZ A;  3N52 A;  4IPD A;  2CCZ A;  1SRU A;  1XMO L;  1YNN C;  5DQI A;  2Z4I A;  5KFF A;  5KFI A;  2E74 C;  2NUC A;  1QIL A;  5JH7 F;  2XSC A;  2ZM6 H;  3WDN A;  4DR3 L;  3CCS A;  3K57 A;  5IGB A;  5IYD G;  2OQ0 A;  1R4P B;  3BDC A;  4H13 C;  2R93 B;  5EQ0 A;  1Y1V G;  1JJG A;  5CV7 A;  1I4Q A;  5I9P A;  3HOZ G;  4FP5 D;  4JOI A;  2VA3 A;  2F4V Q;  4OGQ C;  4CDE C;  3K5H A;  5D1O A;  2KJX A;  4B3T Q;  4NLG A;  5DGA A;  2L5T A;  3MJF A;  2D2C C;  4JI7 L;  1I6U A;  5FO9 B;  4DAY B;  2JXM B;  4DR4 Q;  4ID6 A;  4DR6 Q;  1LTG D;  4C3H H;  1YHQ A;  3KJO A;  4EBD A;  1TWA H;  3ND9 A;  1JT8 A;  1S5E D;  3F2U A;  2PMZ A;  4ODG A;  1BQQ T;  1ESF A;  2FK2 A;  1WTO A;  3QOJ A;  2L55 A;  3T13 A;  3RN2 A;  5IYB H;  2UVR A;  3OMC A;  4U6P A;  4A2A A;  1LTI D;  1HNW H;  4OX9 L;  4JI3 H;  1PZJ D;  2F0H A;  4Q0Y A;  3Q23 A;  1BCP C;  3SI8 A;  1EL0 A;  1O80 A;  3A5U A;  4K14 A;  5JJI A;  4R8U A;  4RB1 A;  2PI2 A;  2K52 A;  1ENF A;  4E6I A;  1DOK A;  3IN5 A;  3D4R A;  2ZJP A;  4R8N A;  4RAU C;  2A6E D;  2EYH A;  1EYG A;  4MV4 A;  1VAJ A;  5JVH 3;  2X0S A;  3WWV A;  2GVB A;  2VB2 X;  1PH5 A;  1T94 A;  4N9T A;  3FMA A;  2R3Z A;  2ALY B;  4M9U A;  5EAY A;  2NU9 B;  2JA6 A;  3UE0 A;  1J6Q A;  3KLS A;  4ED6 A;  4WOR A;  2WFW A;  2LMC B;  5E7N A;  3KXY T;  4EYI B;  3V6H A;  4C2M B;  3S14 B;  1EWH A;  4EFB A;  4JV5 Q;  2Q2H A;  3BS1 A;  2HUG A;  3T16 A;  2NWG A;  3K5I A;  5C5J A;  1IBM Q;  1MSG A;  2R7F A;  1ICW A;  1JE4 A;  4DV7 L;  3GIJ A;  5FLX c;  1WTQ A;  3TME A;  3M7G A;  2NVY A;  2W9B A;  2F0G A;  3D4D A;  1MZB A;  3PMF A;  1PVO A;  2NVQ B;  1IKL A;  3FHW A;  5LL6 X;  5DG7 A;  4HNU A;  1UC9 A;  1A3U A;  1HCZ A;  4LF6 L;  1L0W A;  3KDF A;  3FKI G;  1STA A;  5HGQ A;  2A73 B;  3VR5 A;  2KUM A;  4AYB B;  2WB1 A;  1ZKO A;  4A3D G;  1T5X D;  2UUA Q;  1NNX A;  3GV8 B;  2ZM6 L;  1EIF A;  3S1N B;  5T1G A;  2GPS A;  5DM7 3;  3PO2 G;  4XX0 B;  4YAK B;  4GC6 A;  5DM6 3;  4HQ6 A;  2IPK D;  4HJA A;  3BQ2 A;  4A3C G;  1FNV A;  3N44 B;  1QZH A;  1N32 H;  4R8I A;  1DV1 A;  1E7Z A;  4JYA Q;  4A3M B;  4EQP A;  1Q3L A;  4A3J H;  3E9H A;  1NE3 A;  2PMZ B;  2FJ2 A;  4B9X A;  1Y1V B;  4LF5 Q;  2OH2 A;  1UE7 A;  4DAP A;  2NZO A;  4LSX A;  1S3O A;  4Q43 A;  1XPU A;  3OOC A;  5BN5 A;  3FP9 A;  1PTO C;  2AUK A;  3HXL A;  2XIG A;  3R5F A;  1SEB D;  3VR4 A;  4QW8 A;  3OYY A;  2XIW A;  4CDF C;  3CCL A;  5K2M A;  2F0L A;  2KHI A;  2ZJQ A;  5FKA C;  1N9W A;  1BO0 A;  2IJ0 A;  1ML0 D;  4A93 B;  1HFN A;  1HNW L;  2A68 C;  2YV5 A;  3R2T A;  4JW0 A;  4JI3 L;  4UPA A;  2JA7 H;  4O2B F;  4G3I A;  2QCP X;  2IY5 B;  2L0C A;  2WP8 J;  1PK8 A;  3V05 A;  3J81 E;  3AQQ A;  3ICE A;  4RNN A;  2UXD Q;  4BWG B;  4E4T A;  4XTC S;  1K0S A;  2WE6 A;  3GII A;  3UDG A;  5KG7 A;  2PQA A;  1DGS A;  1TVX A;  4AQY Q;  2UU9 Q;  2Q2I A;  2WII B;  1K3R A;  3IL8 A;  5IE8 A;  2JA8 H;  1UEB A;  1O7Y A;  3R23 A;  5M3M B;  1AUX A;  3E6Z X;  1C7Y A;  1RJQ A;  1KBL A;  1EY8 A;  3OIQ A;  5GAD C;  5ISR A;  2C5C A;  2C2R A;  1Z2P X;  2R8J A;  3MFG A;  4X66 Q;  1KEE A;  2F3V A;  1PMR A;  3HS0 C;  3K5O A;  2EY5 A;  3J7Y W;  1RTN A;  3M4O B;  1HZA A;  2ZXP A;  3I8Z A;  5A2Q E;  3RZD H;  2EVB A;  5BR8 H;  1VMC A;  5C44 B;  3CF5 A;  1N33 H;  3BJY A;  1SDF A;  3RR5 A;  2B63 B;  3GID A;  1Y8N B;  3O13 A;  2DY7 A;  3E0J A;  3CVZ A;  5L9X A;  1Y1W H;  3S2H B;  3AMU A;  3QR8 A;  1I50 H;  3T5L A;  3VYR A;  4DPG A;  3MWD A;  1PHJ A;  1EU3 A;  3RIZ A;  1WVL A;  5CV6 A;  4DNT B;  3KHH A;  1LT4 D;  3GQB A;  4C3H G;  4RCN A;  3JAM i;  2UVU A;  3CHB D;  1XNQ Q;  4HCE A;  3HOY B;  4MA5 A;  3PSI A;  5H1S E;  5IYB G;  2ZDG A;  5G3L F;  2HD3 A;  3I2Z A;  1N32 L;  1KDC A;  4ED8 A;  4ZRZ A;  1HJP A;  1B44 D;  4O42 A;  2R8G A;  1E3P A;  3OWF A;  3RLO A;  3I4M H;  2W8K A;  2C35 B;  1HZB A;  3FRP B;  2VW9 A;  2NBF A;  4BA2 I;  4TRD A;  4NMZ A;  5IT9 L;  1Z9F A;  1U0L A;  4X3U A;  4F4X A;  2Y0S A;  3D4W A;  4B3T H;  1VQ8 A;  2BOS A;  1GYF A;  4YWM A;  4FF1 A;  1A6X A;  1NAP A;  3HOW H;  4DR6 H;  3LWB A;  1C8C A;  1DIK A;  4XQQ A;  2JEF A;  1E1O A;  4MV3 A;  4MN3 A;  1M0T A;  1B6S A;  1GUO A;  3TQT A;  1SMY C;  4C56 C;  5FLM G;  2B29 A;  2XN9 C;  4ZKC B;  3NQT A;  1X32 A;  3GV6 A;  5BPF A;  2PBZ A;  1YZ6 A;  2AMC B;  4QMG A;  1HNZ Q;  3U9S A;  4FYD A;  3S1M H;  3VPB A;  2JYO A;  2HIX A;  2CQA A;  1KHI A;  1V43 A;  2BDN A;  1M90 C;  4QWD A;  4OON A;  2AKW B;  1TWF B;  4ZOL F;  5KFU A;  4QB4 A;  4BY1 H;  2VUM G;  4DV2 H;  4TSS A;  1ZXT A;  5H80 A;  1TU2 B;  3Q8P B;  2E2J H;  1ZET A;  3C46 A;  4UP8 A;  4WJ3 M;  4ALP A;  4C5A A;  3W1B A;  5JJL A;  4HJ9 A;  5EWE A;  4IWX A;  5C3E B;  4MV7 A;  4FVM A;  2YS7 A;  4HCS A;  1I6V C;  1PZK D;  3K0Y A;  1FL0 A;  4NB3 A;  4ED1 A;  2DZD A;  1O78 A;  5KT2 A;  3OSO A;  5COR A;  3AFP A;  2OTJ A;  5BR8 L;  5BN3 A;  2JA5 G;  4A3B H;  4JV5 H;  1QCB D;  1Z2O X;  1K8A C;  1N33 L;  1QUQ A;  1RIP A;  5HY6 A;  4YY3 Q;  4U68 A;  1S68 A;  4YB8 B;  3U9T A;  4XDX A;  1IBM H;  3AU7 A;  3ULL A;  4A3J G;  3K7A H;  4BY7 H;  3PW4 A;  4DV0 Q;  1NMF A;  2J4X A;  2RQX A;  3CCV A;  4GOP B;  5DQH A;  2C22 A;  1RYS A;  1BCP F;  1UEA B;  3P7J A;  5KG6 A;  4OO1 G;  5EKI A;  2ZDQ A;  1AE2 A;  1AUV A;  4JPB W;  2R7Z A;  1ZYR D;  3UQ8 A;  3C1E A;  2BA1 A;  3RFC A;  4Z9C B;  2L12 A;  1E2Z A;  3G8C A;  1P8L A;  5D65 A;  4IOC A;  5KFJ A;  2Y0S B;  1TAE A;  1JOK A;  4RGN A;  2HJW A;  4J15 A;  2R7K A;  2ASL A;  1ILQ A;  3S17 H;  2IA6 A;  1EQR A;  4CC5 A;  2IHF A;  4IFD I;  1F2Z A;  5IYZ F;  3PVX A;  3J80 E;  2PW7 A;  3I7F A;  3GTJ A;  1JXL A;  1VQB A;  2RF4 A;  2MPM A;  5TSS A;  1DV2 A;  4JYA H;  4KHZ A;  4FF3 A;  4B3T L;  2A6H C;  4YJ2 F;  4ECX A;  5M5W H;  1W6J A;  4LF5 H;  2JA8 G;  4LUO A;  1QVG A;  4DR3 Q;  4J1M A;  4HIO A;  1TQO A;  1ZHS A;  3QFF A;  4DR6 L;  3OW7 A;  4JBK A;  5JVG 3;  3I72 A;  3S16 H;  1I4X A;  2NVX H;  4G4K A;  3TIN A;  1HUM A;  4YP3 A;  4EBC A;  5BN4 A;  1GUN A;  4LFC Q;  3G4S A;  1SYB A;  4ABN A;  1HUN A;  5JQW A;  2X6G A;  2D62 A;  1CTM A;  2KEE A;  3DXJ C;  4PG3 A;  4EFE A;  1K9M C;  2WAQ A;  3V6J A;  3NQI A;  1GD7 A;  1L1O B;  1U4R A;  3EIV A;  1AFP A;  4ECZ A;  2R7N A;  1RJT A;  1Z7T A;  1PXU A;  2UXD H;  3M4P A;  2N3S A;  4R8U B;  5CC4 A;  4DV2 L;  1MD2 D;  2R93 H;  3G71 A;  1VDZ A;  1TWG H;  1VQG A;  2EJG C;  3BVM A;  4PMB A;  1X9N A;  1IKM A;  2FPI B;  4DL3 A;  2UU9 H;  3GTL A;  2RSO A;  2F0S A;  3L0O A;  2F3I A;  3VMM A;  3G6Y A;  4OX9 Q;  1IL2 A;  1GGO A;  2I5H A;  5KEE A;  1IBK H;  1QVF A;  1QUQ B;  2CVR A;  3G7L A;  3T53 B;  3F8N A;  3L4K A;  1UC8 A;  1CM9 A;  4A75 A;  2CH4 A;  2IX0 A;  1RD9 D;  4PZ6 A;  3SK6 A;  5FD6 A;  1KRT A;  3M9M B;  3HOX H;  3K5L A;  4Y52 H;  4JV5 L;  1GXD C;  4IUQ A;  4QIW A;  5IGD A;  5HV6 A;  2R87 A;  2F0E A;  1ET6 A;  1LT6 D;  3D3R A;  1IBM L;  1UE5 A;  2EPB A;  1I6H B;  2XWB B;  4CJ2 C;  4I7H A;  5M3F H;  2OCE A;  3FMC A;  3GTG H;  4KJN A;  4ED0 A;  1X3Q A;  3TBI B;  3NWT A;  1VQE A;  3H6M A;  1TWH A;  3CME A;  1SLJ A;  2KEN A;  2YYA A;  1I3Q H;  3JC6 6;  2F0U A;  1ROD A;  1C0A A;  5LL6 b;  4A3J B;  3UFX B;  1WD1 A;  3GTP H;  1WCM H;  4ZYS A;  3KYH C;  3Q0A A;  2VS1 A;  4QWA A;  1SNM A;  4CDD C;  4TQS A;  3GV5 B;  1G2S A;  3CPF A;  1TY0 A;  3LGJ A;  5D3I B;  1EWC A;  2JN4 A;  4R4C A;  1NR4 A;  5LP6 F;  2JJQ A;  4RU9 A;  5JOB A;  4JYA L;  5D1P A;  2JA7 B;  1E2W A;  4LF5 L;  1CKM A;  5CYU A;  4R4T A;  1D5X C;  1NTG A;  2AGQ A;  1SE3 A;  4RGT A;  3R8B A;  3X3N A;  1G2T A;  1J5E H;  4GOP C;  2IX1 A;  2V1C C;  2WAQ B;  4BA1 I;  2NVQ H;  1U5K A;  1KJJ A;  5KT6 A;  1IYU A;  4P2C B;  3DMU A;  1QVC A;  2CHB D;  1HH2 P;  4CKB A;  3EN2 A;  5C6A A;  4DR1 Q;  4LF9 L;  1SYF A;  4ED2 A;  4IRC A;  2L11 A;  4RMF A;  2SNS A;  4R4O A;  2NU7 B;  3UDI A;  1PRT C;  1XWE A;  3A56 A;  4A3L H;  2UXD L;  1OTC A;  3J7A 5;  4YWK A;  4MHE A;  1LM0 A;  2JP1 A;  2SOB A;  3RZD B;  1I4H A;  1EY5 A;  2WAC A;  2UU9 L;  3ONA B;  2K75 A;  4BY7 G;  4V19 0;  4K5V A;  4DK1 A;  1AZQ A;  4QW9 A;  2B2T A;  2RHS B;  2E2I A;  1HNW Q;  3NEM A;  5IT9 W;  3K58 A;  4QIW B;  4JI3 Q;  1K73 C;  4A3M H;  2G9H D;  1IBK L;  1E4F T;  5KFT A;  4RFB A;  4GKK Q;  1HTP A;  1Y1W B;  1HHV A;  2J9G A;  1I50 B;  2NYZ D;  4LW1 A;  2B8G A;  1IZ6 A;  1LTB D;  1QJO A;  4JI4 H;  1XPO A;  4DFA A;  4IJH A;  2FB9 A;  2N78 A;  1D2B A;  2EQS A;  2NU6 B;  4PZ8 A;  2YS6 A;  4L8J A;  2PYK A;  1KRS A;  3GD7 A;  3KAL A;  1AW7 A;  1SYE A;  4YY3 H;  1L1O C;  3I4L A;  3H3V I;  1VQ6 A;  2I46 A;  5EOY A;  5L1I A;  1VCI A;  2EZV A;  3I4M B;  1JX4 A;  3PN1 A;  1IBL H;  4DV0 H;  4XYL B;  1V1P A;  3HKZ G;  3J81 c;  1VBG A;  2OWO A;  3KF8 A;  4KI0 A;  4NW2 A;  2N88 A;  5I6W A;  3LP8 A;  5CA1 F;  2JA6 H;  1G6Z A;  3F1Z A;  3NBH B;  1GKH A;  3GIM A;  3HKZ E;  3MR6 A;  3V4Z A;  2HCC A;  2P0A A;  1QNU A;  3HOW B;  3M9N B;  1STG A;  5M5X B;  5D14 A;  1TY2 A;  1S9F A;  2L15 A;  3J81 i;  5IYC H;  4TV8 F;  2NVY H;  2QDB A;  2TMP A;  1B6R A;  1IYV A;  2A6E C;  5CAE B;  1TII D;  2CH4 W;  3CRL C;  2Z9H A;  1B9M A;  1VQK A;  2L4N A;  5K5P A;  1J5E L;  3S1M B;  2R93 G;  2JSO A;  3T1H H;  3BDL A;  2MO0 A;  5IOD A;  3AB9 A;  2HCI A;  1JOO A;  2D5D A;  1PFN A;  3BYT B;  1KL9 A;  3H20 A;  3N8D A;  1QOH A;  4BY1 B;  3I91 A;  2RDF A;  3MWY W;  1AP0 A;  3NEL A;  2E2J B;  4ME6 A;  4RUA A;  2ZTC A;  1GUG A;  3RV3 A;  5FLX W;  3D6C A;  1FNU A;  3U58 A;  1DYQ A;  3SE0 A;  1SYX B;  4A3I H;  4EGQ A;  1C48 A;  2WTF A;  4LFC H;  3R93 A;  1SXT A;  2E2I B;  5FD5 A;  4OO1 I;  4MAM A;  5C1P A;  5AJ3 L;  1SNO A;  1WR2 A;  3VR2 A;  3MWE A;  2BQ3 A;  1GUW A;  2EE1 A;  4OWX B;  5C8Y F;  5M3F G;  4ECR A;  4A3B B;  3CCU A;  1XNR H;  2QGQ A;  2NN6 G;  2K5D A;  2K32 A;  1EYZ A;  1YBY A;  5EBC A;  2EY6 A;  1DOM A;  3FDS A;  1PH2 A;  1KJQ A;  2XCP A;  2QK4 A;  1EOT A;  3K7A B;  2PNH A;  3MXN A;  1C9O A;  3TDQ A;  3BG3 A;  4DNI A;  1CA6 A;  3BU2 A;  2BH2 A;  3VYU A;  3E0E A;  2WIN B;  4JI4 L;  2DWC A;  3STB D;  1CKN A;  1BGW A;  2W7O A;  1WCM G;  1BBX C;  1JE5 A;  4ECT A;  3JSN A;  3RTX A;  2MGS A;  3CCJ A;  3GTG A;  4KD3 A;  4QQB X;  3GIK A;  3RZO B;  3URY A;  1B04 A;  4UCT A;  4HMJ A;  4PNY A;  2Z8L A;  1K28 A;  1YVC A;  4HIK A;  1X3F A;  3MA2 B;  3TQY A;  2PVP A;  1A0I A;  3PGZ A;  4YY3 L;  4G7O C;  2W70 A;  3M7N A;  4J9L A;  4FBU A;  2IT1 A;  4C3J H;  4L6T B;  1JIH A;  4Q8E A;  4EGV A;  3JRX A;  1IBL L;  3A8I E;  5DLG A;  4DV0 L;  2W71 A;  2K05 A;  3CPW A;  5ELE A;  2ZDH A;  3L3O C;  5JEA H;  2V5A A;  5BR8 Q;  3E3X A;  4B3R H;  5KFP A;  1DOL A;  3M3Y H;  5M5W B;  4IZO A;  1N33 Q;  4L63 B;  1SE2 A;  3L9A X;  4RGM A;  4TVA B;  3SEB A;  5JAV A;  1Q7Y C;  3J7A F;  2VNU D;  3Q8D A;  5LYJ F;  1PH1 A;  1PZI D;  2IX3 A;  2HHH Q;  1D6E C;  1TXY A;  3PIO A;  1WTW A;  1EEF D;  1BXR A;  2AGO A;  3BJU A;  2DPI A;  2J6U A;  5KIX A;  1W3S A;  5J1Z A;  4AYB G;  3S16 B;  1E1T A;  5C3E H;  2FPG B;  4X62 H;  5ELD A;  2PW5 A;  2OQK A;  1WYD A;  1A2U A;  1U4M A;  3H0G H;  2PZT A;  4A3L G;  2EXZ A;  4DL2 A;  1SND A;  1X56 A;  4AYB E;  3PW2 A;  4CDC C;  3T1H L;  1F9R A;  3HFZ B;  1F2Y A;  3E9I A;  3UDX A;  2CWP A;  5I2X A;  1Z6H A;  1JDB B;  2JEG A;  3CCR A;  2MO1 A;  2F0K A;  4A3M G;  1LYL A;  5EWG A;  1TWG B;  1KC8 C;  4ZQI A;  4BWS C;  4J0M A;  3EQL C;  3Q8R B;  1H9M A;  4I55 F;  4A3K H;  2BDO A;  3T56 B;  1EOV A;  2ZJT A;  3JAM W;  2MQH A;  5KFC A;  4LFC L;  2CQO A;  1XXG A;  1S40 A;  5C4X H;  4DR1 H;  2PMZ E;  2N8N A;  4JV1 A;  2NB0 A;  3TZD A;  3GQC A;  2C28 A;  4R4Q A;  1LTT D;  4ED3 A;  1Q81 C;  2H1E A;  3PQI A;  3HOX B;  3MXN B;  1S03 G;  4A93 G;  1VQ9 A;  1XNR L;  2VZA A;  4GLX A;  4M1U B;  1CKN B;  2E2D C;  2E75 C;  4EEQ A;  2YCH A;  4NXM Q;  1II3 A;  2TSS A;  5M3F B;  3KF6 A;  1G8Z D;  3GTG B;  2K04 A;  3S2D H;  1NMG A;  1SE8 A;  5IP7 G;  1HFG A;  3I56 A;  3J80 c;  4TQR A;  5KNC A;  4GKK H;  2XWJ B;  1I3Q B;  4FS1 A;  3TP6 A;  1SCU B;  5GON F;  1R9T A;  1G91 A;  3RLN A;  5M3M G;  3GTP B;  2FLP A;  4DV2 Q;  1YIT A;  4K8I A;  4UHV A;  4DK3 C;  1Y69 U;  1JLL B;  3Q8S B;  1EQQ A;  1WCM B;  4B9W A;  2K14 A;  4Q44 A;  1VQJ A;  4ME3 A;  2M9V A;  5IYC G;  3OSN A;  3GTK A;  1EFW A;  5EBD A;  3J80 i;  3H94 A;  5I9O A;  3A55 A;  2WKD A;  4R4I A;  1N48 A;  1BOS A;  2O5J C;  1PRT F;  2R92 A;  3K3P A;  2DIK A;  2FE3 A;  4B3R L;  5C44 G;  2WB1 G;  3I90 A;  2B63 G;  5KGU A;  5LMU H;  1SNC A;  1CI3 M;  2F0I A;  4Q5V A;  3CC4 A;  5HUR A;  3H09 A;  2AUJ D;  1ZQ7 A;  1XTD A;  4HIM A;  3JSL A;  3C3L A;  4G57 A;  4X62 L;  1S4Z A;  2RSN A;  1CSP A;  1PH4 A;  4J9Q A;  4C1N K;  1UE6 A;  2I0Q A;  2L1B A;  1HPC A;  1I7N A;  3QB3 A;  3HOY G;  1ICF B;  3VA5 A;  2JEI A;  3M85 A;  1WFQ A;  1TR5 A;  3TSS A;  1YI2 A;  4EGJ A;  4IHJ F;  3NP8 A;  2W6N A;  4DV3 Q;  4C3I B;  1I6H H;  4MNO A;  1Y8P B;  3MEF A;  1RF2 D;  5IP9 G;  5D1O B;  3Q6S A;  2UUC Q;  4H7B A;  2R7Z H;  4MTN A;  2VR1 A;  4QL5 A;  1D5M C;  5FK9 C;  1AZP A;  2G9D A;  2L9H A;  2OTL A;  4DV5 Q;  1OO9 B;  2UXB Q;  4DR1 L;  5I2Y A;  4NP5 A;  3V2T A;  4P72 A;  2GLT A;  4APV A;  4EQO A;  5KFA A;  4A3E H;  4BBS B;  2YU9 A;  1VQD A;  1W93 A;  3KF6 B;  4G7H C;  2FHT A;  3S1Q H;  1KAB A;  1PFB A;  1O7Z A;  3GTJ H;  1T9H A;  3W5O A;  3OTO H;  5EPJ A;  3UE1 A;  4KKU A;  5EZY F;  2F0V A;  1R9T B;  4N8F A;  3TP5 A;  2VXW A;  4LF9 Q;  3P1H A;  1S0M A;  3SR1 A;  3MR5 A;  1NY4 A;  1WSC A;  1ZYR C;  2LSS A;  4GKK L;  2YL2 A;  3ETH A;  3HBL A;  4UP9 A;  2FMC A;  4DR7 H;  2R61 A;  2O03 A;  2JA6 B;  2F52 A;  2QIL A;  1STH A;  4FNF A;  1CSQ A;  3ND8 A;  4QY7 A;  3T51 B;  2R92 B;  1EZ8 A;  5C3E G;  1V1Q A;  1MI2 A;  3N6R A;  1IBK Q;  1M4V A;  4IAJ A;  4BXX H;  2HDL A;  5C3X A;  2YZM A;  1CS0 A;  1SFO A;  2B2W A;  1TA8 A;  3GTL H;  2D0P A;  2NVY B;  2W9B B;  2V4Q A;  3E5S A;  3K81 C;  1ENC A;  3KLS X;  4YBZ B;  3RB0 A;  1IW7 D;  4KN7 C;  1CQF A;  5LMU L;  3DLL A;  4QWB A;  4DUY H;  5KG5 A;  3KDF B;  2AQ3 B;  3DM1 A;  4LUZ A;  2WB1 B;  4ZUI A;  1SN8 A;  2F03 A;  3H0G A;  2NN6 I;  3KTM A;  4QGU A;  5KG1 A;  1E4E A;  2HHH H;  5ELC A;  2Q8R E;  1GUT A;  5JVL A;  2QA4 A;  1VKZ A;  3QOL A;  4L5T A;  4EEY A;  4PMC A;  5CV4 A;  4A3I B;  4GNX A;  1TWH H;  1HZ9 A;  3KFU A;  5LOV F;  1S72 A;  3GTO A;  1VQC A;  2Y0S G;  3NEN A;  3FVQ A;  1MGS A;  4A3F H;  2YRW A;  5AFW A;  4KD4 A;  2RHQ B;  1ASY A;  5KFE A;  1W6K A;  1RHP A;  5KND A;  4ECU A;  3H15 A;  1AE3 A;  1QWY A;  2SEB D;  3T4A C;  2Y0S E;  4RGO S;  4GKJ Q;  3D8G A;  1VMP A;  3OWE B;  1EYC A;  2VQE Q;  4F50 A;  1D8L A;  3MFI A;  1CUK A;  4DF7 A;  1LTA D;  5COY A;  1S10 A;  2UVW A;  3JZI A;  1J5E Q;  1JWM D;  1F9S A;  2I07 B;  3OTO L;  4IO9 A;  3RN5 A;  4ZI7 F;  4DXG A;  1SAP A;  4QF4 A;  3ULP A;  4O3S A;  1A2T A;  4FM9 A;  4KJO A;  3PW7 A;  2VY3 A;  5M5X H;  5L1K A;  1MSH A;  1M0W A;  4DLK A;  4APM A;  1B9N A;  4BBR H;  1KLU D;  2J0T D;  2PQA B;  3TS0 A;  1JOQ A;  1JKJ B;  4NXM H;  5IIF A;  4JOI C;  4O3N A;  5KFW A;  4C3J B;  1K8G A;  1J9O A;  4F4Z A;  2LKV A;  1HQM C;  1LT3 D;  1S5F D;  4RNO A;  3PW5 A;  5AJ3 Q;  2K1B A;  2V59 A;  2KVM A;  2M05 A;  5KT5 A;  4DR7 L;  5KFB A;  2W6Q A;  1GOZ A;  3GP7 A;  3N41 B;  3BVG A;  5IOC A;  3RNU A;  1SFO B;  4KY7 A;  3TRE A;  1IYJ B;  3M3Y B;  1K0R A;  4UCO A;  1SYC A;  3K7U C;  2AU0 A;  4P73 A;  4DL5 A;  3MAQ A;  4IRD A;  4ZK9 B;  3IAY A;  4A2B A;  1F2M A;  1JB7 A;  4JI4 Q;  3MXG A;  3V4S A;  2E2I H;  1HR0 W;  3NUC A;  4EG0 A;  3H0G B;  1CQI B;  2XRS D;  1EY9 A;  1BUV T;  5JUM A;  1Q8I A;  5KFG A;  1MJC A;  4A3G B;  4DUY L;  4Y8V B;  3HRZ C;  3UDF A;  4HSV A;  2EYP A;  2LY7 A;  2K5H A;  4RAZ A;  1STY A;  1XMQ Q;  2R7Z G;  1JOR A;  3DWA A;  4JI2 Q;  3T5K A;  4YHH Q;  4JUZ A;  1EY6 A;  4CKE A;  2KOL A;  5D3D A;  2HHH L;  3Q24 A;  2G5D A;  1STB A;  1TS4 A;  1IBL Q;  2VB3 X;  1ENA A;  3I55 A;  3NTK A;  4O3Q A;  4HR7 A;  1ONL A;  1WTP A;  4A3K B;  3ETJ A;  4DN4 M;  1W96 A;  5FLX L;  1NSN S;  5C4X B;  4LF4 Q;  3Q22 A;  3RZO H;  2JEA I;  4DUZ H;  3S9W A;  2QYZ A;  5IT9 E;  4I65 A;  4YR0 A;  2K4K A;  3A0J A;  1YHA A;  2V9W A;  2B2V A;  2YW2 A;  4DV3 H;  3KAJ A;  2P5Z X;  2JA7 G;  3U4Z A;  2UUC H;  2PQE A;  2YYZ A;  2F0P A;  5JEA J;  1KIX A;  3S2D B;  2BA0 A;  2VQF H;  4DV5 H;  1JDE A;  2UXB H;  1ZEQ X;  3T1H Q;  2WAQ G;  3WO1 A;  5DEH A;  2JA5 A;  5GAH C;  2RVL A;  3CQZ A;  2NZH A;  2A69 D;  2HQL A;  1C4Q A;  1DON A;  5F9N A;  3KBX A;  3I70 A;  2CW8 A;  5C4J H;  2H4O A;  5IGG A;  2YTY A;  4O3P A;  2KCC A;  2GN5 A;  2WAQ E;  4MTK A;  5KFK A;  3VPC A;  1PV4 A;  2MFI A;  3R2I A;  3MHB A;  2K5Q A;  3RGX A;  2B3G A;  4NXM L;  3NHH A;  2KHJ A;  2FPP B;  2VOB A;  5F2D A;  2IP4 A;  2YTV A;  1CQJ B;  1GJX A;  2JEB I;  2CW0 D;  3I4N H;  4DV4 Q;  2WDT A;  1P16 A;  1HR0 Q;  3K59 A;  3G6E A;  1H9S A;  5FO7 B;  1JQY D;  3I4O A;  1XNR Q;  4LJZ C;  4FO2 A;  3A7A B;  3NBI A;  3HGB A;  3OUZ A;  2DPJ A;  1VS0 A;  1BF4 A;  1Y1W G;  2OLS A;  5ELF A;  4C5C A;  1HZC A;  3R3O A;  4QIW E;  1D5Z C;  1LUZ A;  3M4Y A;  2SNM A;  4PZ7 A;  1FD7 D;  1K8M A;  4DL6 A;  3ERO A;  1KNA A;  1D1K A;  2V4D A;  1STN A;  4JV2 A;  2XNA C;  3ERQ A;  2F0W A;  3G6X A;  5J2T F;  1PTO F;  4A3F G;  3I73 A;  1EIY B;  1TWC A;  4PMW A;  2IMW P;  4HR7 B;  1M7J A;  1WTV A;  3P75 A;  1K3B C;  3I4M G;  4UCV A;  5GQO A;  2R7L A;  4JVZ A;  2R7Z B;  4IR1 A;  2F0N A;  1JWS D;  5C3W A;  3R5X A;  3CCE A;  4RWS C;  3U9O A;  3SE7 A;  2B2W C;  4B3R Q;  2VPS A;  5CBA E;  2F0J A;  5JPN C;  2QW7 A;  4DUZ L;  1YJW A;  4FXG C;  4GC7 A;  3JAM L;  3PUX A;  4A3E B;  4PQX A;  2JK8 A;  2XTI A;  3HOW G;  1AN7 A;  1FKA H;  4J6H A;  3S1Q B;  4DV3 L;  3GTJ B;  5L1J A;  1X3G A;  1GHJ A;  4X3S A;  2HIV A;  4X62 Q;  5BPH A;  3STB C;  2UUC L;  2D0O A;  5CMD A;  3KK7 A;  3RBD A;  1L2F A;  3D31 A;  3I3C A;  1MKH A;  4GKJ H;  2VQF L;  4DV5 L;  2VPQ A;  2UXB L;  3F2D A;  2VQE H;  1E24 A;  1STE A;  2F0Q A;  3EPG A;  1VQL A;  3ORR A;  5M5Y H;  1FJG Q;  1D1I A;  4MA0 A;  4BY1 G;  5LL6 S;  1ET9 A;  2AHO B;  2Z6B A;  1Q86 C;  4HYK A;  1LTR D;  2MUY A;  1LTS D;  3IKJ A;  1JMC A;  5C5L A;  3DF7 A;  4KHV A;  3CP0 A;  1W2B A;  1BXT A;  4EX5 A;  4CHT B;  2FKL A;  3PF4 A;  4DXF A;  1WI5 A;  1H9J A;  4HSP A;  3J7Z C;  2RGV A;  3GTL B;  2N49 A;  3BG5 A;  4A3B G;  4C3I H;  1B53 A;  4HED A;  1E4G T;  2KCN A;  1D7Q A;  4YQW A;  4KN4 C;  4NKL A;  4YCV A;  4C5B A;  1E2V A;  4PV1 C;  2PNR C;  2IBK A;  3A8J E;  3BYY B;  4OIJ A;  2AWO A;  1M8A A;  3WOE A;  2W9C A;  4IUU A;  4IUP A;  2PN1 A;  4BBS H;  5DAU A;  2AGP A;  1N36 Q;  1CT1 D;  4ECY A;  2UXC Q;  4LH6 A;  3M4I A;  4MTE A;  4F4W A;  4GLV B;  1RCV D;  2R6F A;  1TWH B;  1VF7 A;  3EVQ A;  1VQ4 A;  2ASB A;  1GSO A;  2O5I C;  2R84 A;  1BDO A;  1R9T H;  2KCT A;  4DK6 C;  1EIH A;  3DEO A;  4A3F B;  5J3B A;  1CE8 A;  1XMQ H;  1A8V A;  2A5H A;  1ESR A;  5DNF A;  4JI2 H;  4CGY B;  3QZ7 A;  3MXU A;  2K5N A;  4YHH H;  5IYD H;  4X3T A;  4GS3 A;  1EYD A;  4IPG A;  4P75 A;  1PH8 A;  1GUS A;  3BZC A;  4F87 A;  3HOZ H;  1K1S A;  1VBH A;  3GTK H;  1XYI A;  2CW7 A;  1IOV A;  1LO5 D;  2XRQ D;  5LMU Q;  4IOA A;  1VQA A;  3PW0 A;  2ES2 A;  2H5X A;  3DHQ A;  5KYI A;  1UWV A;  3J80 W;  2R92 H;  4DV1 Q;  4LF4 H;  3KHL A;  4N9P A;  1JIC A;  1V51 A;  4L5R C;  2XC9 A;  4F8M A;  1DM0 B;  3PIP A;  5KFH A;  5FPO A;  2A1A A;  2KA7 A;  1Q1E A;  4GKJ L;  1U4L A;  1SYD A;  4BBR B;  5E4W C;  2VL6 A;  3DWQ A;  3HZX A;  2VQE L;  1OWT A;  1GO3 E;  4KV6 A;  4O4H F;  3RUP A;  4Q8F A;  2MHV A;  1Q82 C;  4FS2 A;  4PDB A;  5GRO A;  3SXH A;  3BZD B;  3SHL A;  2F0D A;  5EKK A;  3NSW A;  4OWW B;  4PWQ A;  3MR2 A;  3BA8 A;  4GZY C;  2K33 A;  1YEZ A;  2BQU A;  3M9O B;  4NXN Q;  4KKT A;  1B50 A;  3J7A K;  2ICE C;  2R8K A;  5L37 A;  1S5D D;  2C2D A;  4K8J A;  5CR3 A;  1M1K C;  4R7R A;  4IAL A;  4RKL A;  5T14 A;  4K5X A;  3OSP A;  1I7L A;  2HT1 A;  2QF7 A;  5I6Y A;  2LXK A;  4IFD H;  3HKZ A;  3RMH A;  4IN3 A;  2HGS A;  4JI6 H;  4Y7N H;  3HOX G;  3PUV A;  4O1N A;  4MV8 A;  3OTO Q;  4NDX A;  3NPP A;  2K01 A;  4RKB A;  3OHX C;  4YCW A;  4DV4 H;  4DL7 A;  5JVD F;  4Q0F A;  2EYM A;  3NE5 B;  1HR0 H;  1KDB A;  2YU9 H;  2VUG A;  1OXX K;  1A3T A;  2E2H A;  3QG1 A;  1EIG A;  3BQ1 A;  3QJY A;  1SR3 A;  2RDH A;  2Z6K A;  4K6L A;  5K36 H;  4OXP A;  4BS9 A;  2J6S A;  5JPM C;  1VQI A;  2ID0 A;  1QNK A;  5KG4 A;  4DR7 Q;  4EBE A;  3FKI H;  1RYR A;  3LNN A;  4QJF A;  2NU8 B;  4FXK C;  3OW2 A;  4JI7 H;  4J9M A;  2EJM A;  2Q2T A;  4A3D H;  2SCU B;  3TII A;  2W8L A;  1JJ2 A;  1EQT A;  3VR3 A;  2CFM A;  4JK1 C;  1V1P B;  1E0B A;  1XMQ L;  2ZXO A;  5CV8 A;  4JI2 L;  2DLN A;  3KF8 B;  1RDP D;  2HQE A;  3CW2 C;  3PO2 H;  2W6O A;  5KKN B;  4YHH L;  3N43 B;  4KY5 A;  1AH9 A;  3TRZ A;  4A3C H;  4YR2 A;  1X6O A;  3PV0 A;  4DAY A;  1IXR A;  4U7C A;  2YZG A;  3MTS A;  5LMN H;  1PH9 A;  2F0M A;  1KJ8 A;  4DNR B;  1B8A A;  3CU7 A;  3ITP A;  5EJW A;  4IUV A;  4DUY Q;  1GVP A;  1B7Y B;  1QG7 A;  2RA4 A;  4ZQ3 A;  1SFO H;  3CD6 A;  4CJ1 B;  4LF4 L;  1PFM A;  2OXP A;  1B3Q A;  2A8V A;  3TQ1 A;  1UE1 A;  4RA8 A;  3FPU B;  3ZJY C;  5C4J B;  1I94 H;  1XJV A;  2JEJ A;  1WH2 A;  1L0X B;  1VQ7 A;  1JB3 A;  2BE5 D;  2F0T A;  2F0O A;  1KXL A;  4CC6 A;  2HVS A;  1YJ9 A;  4ULL A;  2B2Y A;  1BVS A;  1VF5 C;  1I4G A;  4C3I G;  3F2C A;  2ATL A;  2CQY A;  4A3G H;  3K8A A;  5KFV A;  2MNA A;  4HJ8 A;  3I4N B;  3LX0 A;  1GSH A;  3GDE A;  1HTL D;  1A15 A;  2EY1 A;  4RHS A;  2E8G A;  3N42 B;  4JBM A;  4ECV A;  2K6A A;  1KQS A;  1FJG H;  1QB5 D;  4RH6 A;  1PRT D;  3GTO H;  4LNQ A;  2M2L A;  3MZ5 A;  4JI1 Q;  4BBS G;  4QCL A;  3BA9 A;  3BDO A;  1IW7 C;  4U67 3;  3KAK A;  2HDM A;  2F0F A;  4JI6 L;  2E2H B;  3KJP A;  5KT7 A;  3PR4 A;  4IUN A;  3C1F A;  4QUC A;  4WBN F;  4F88 A;  3HOU H;  4DV4 L;  5NUC A;  4LFB Q;  2I80 A;  2RGR A;  5DG9 A;  1HR0 L;  3SK8 A;  5IT9 c;  4IR9 A;  3OHA A;  4I7Z C;  5KFN A;  3S1R H;  1DCZ A;  3RF2 A;  1SNQ A;  1YNJ D;  1N8R C;  1LLR D;  1KD1 C;  4AYB A;  4XT3 B;  4B3S Q;  1XTC D;  2FP4 B;  3R5H A;  2PI2 E;  1NR2 A;  1EYA A;  3A74 A;  5DLQ E;  1EY0 A;  2KBN A;  3PCO B;  2GA4 B;  1PH3 A;  1CHP D;  1CFM A;  4FDB A;  2JA6 G;  3BQ0 A;  2FLL A;  3HB9 A;  2FMA A;  1N34 Q;  1VQN A;  2K03 A;  3T1Y Q;  4RG1 A;  3L2P A;  2R92 G;  5IGF A;  1N36 H;  4B3M Q;  4HMI A;  3RJ0 A;  2QEX A;  1DD2 A;  2UXC H;  3MR3 A;  4J9N A;  4O4I F;  4LF7 Q;  3BAA A;  5ELO A;  1FGU A;  1K83 H;  1BBU A;  3GTM A;  5HGT A;  4A76 A;  1Y1V A;  2W6Z A;  1SBB B;  3FDT A;  4IQZ A;  1ILP A;  5EPL A;  1VQM A;  1NUC A;  2B2T C;  1Q1B A;  4H44 C;  4EVO A;  1C3O A;  3U50 C;  2MJ8 A;  2R7M A;  3H4B A;  5LMN L;  3V96 A;  2EXD A;  4OEM B;  4EQN A;  4ZCK A;  3WNZ A;  4MZ9 A;  4OWT B;  3QO2 A;  3T5H A;  4HNT A;  2Q8I B;  1RTO A;  1XPR A;  2OF1 A;  3G6V A;  4N8X 1;  3W1G A;  5M5Y B;  2K50 A;  4XYQ A;  1KAA A;  5T1I A;  5CB4 F;  1I94 L;  1VQP A;  2WB1 E;  1CK1 A;  4DV1 H;  3SGI A;  4A3I G;  4IFD G;  3J81 L;  2Q2U A;  2RDI A;  3H3V H;  4OHJ A;  4JI8 H;  4HAE A;  2ZTD A;  4JBW A;  3ERS X;  3TZU A;  2E76 C;  4DUZ Q;  4RB3 C;  2K5V A;  2B39 A;  5FLM H;  1T3N A;  2D9U A;  1I5F A;  3DWP A;  2ASJ A;  2DJF C;  4M8A A;  4X3K A;  5HBR B;  1SSO A;  1FJG L;  2W6M A;  3MFH A;  1S5C D;  1FVI A;  1U9R A;  1O7L A;  4NPS A;  3RAQ A;  2XCL A;  4JC0 A;  4ECQ A;  2PZU A;  4HNV A;  2BH8 A;  2VUM H;  3BVZ A;  5K36 G;  4NXN H;  1NCV A;  2VQF Q;  2XD4 A;  3GTQ H;  2PCF B;  1LTL A;  4X64 Q;  2DN8 A;  4DKA C;  4DR2 Q;  4H0L C;  5A2Q L;  3VR6 A;  4LWC A;  1KAW A;  2HVQ A;  3J81 j;  3Q1K A;  3OIP A;  2B63 A;  5F9L A;  3TS2 A;  3EYY A;  1N56 A;  3KOJ A;  3GIL A;  4IPH A;  4LUV A;  1Q90 A;  4S3S A;  2N55 A;  4ILW A;  2JA5 H;  4C3J G;  2R7D A;  3CQZ H;  2LXJ A;  1JR0 D;  4GN5 A;  5C0X H;  2J7Z A;  1JCK B;  1NJI C;  1TS5 A;  1B4O A;  1EFI D;  5KFS A;  3FKI A;  2NTS A;  1BNC A;  5I47 A;  1WD0 A;  4XQJ A;  3K0X A;  5JEA G;  4J9S A;  2AQ2 B;  2NTT A;  3GTM B;  4EYH B;  1G29 1;  2PO4 A;  2AQ4 A;  5G3L D;  1UNN C;  2JA9 A;  1V1O A;  2QEJ C;  3EJI A;  4ECW A;  3HOZ B;  1N36 L;  3X3M A;  3GTK B;  3GIP A;  4OO1 H;  2DY8 A;  3KUP A;  2UXC L;  2R8H A;  2ZXR A;  4DA2 A;  4FF4 A;  1BBW A;  3QWN A;  2UUB H;  1HQR D;  3M4Q A;  3TEH B;  3H0G G;  2B2U A;  4V0B A;  3A8K E;  2Z6K C;  3CCM A;  2A69 C;  4A3G G;  3P20 A;  3MFY A;  1SJE D;  2PZW A;  3S15 H;  4DV6 H;  1EY4 A;  5L1L A;  1PYB A;  2RCF A;  1M6V A;  1IHZ A;  1JJC B;  3TP8 A;  2MP1 A;  1X3E A;  4X65 Q;  4O0A A;  2Z4H A;  3W3A A;  3RAX A;  4ZKB B;  4AIM A;  4X6A H;  1E22 A;  4DV1 L;  1VQO A;  1YNN D;  2CW0 C;  2W6P A;  4A3K G;  2M00 A;  1TWC H;  4K0K Q;  3TN2 A;  4YWL A;  3E5N A;  5C4Z A;  4JI8 L;  1J8I A;  3KBG A;  4JCV E;  5C4X G;  4IJL A;  4KHP H;  1TWF A;  5FO8 B;  3EFX D;  3HOU G;  3HOV H;  5DLF A;  3A5Z B;  3K80 C;  3ER0 A;  5A35 A;  4Y7N B;  2X6L A;  1CKO A;  2GPW A;  1R4Q B;  2OT2 A;  1Q8K A;  1Z2N X;  4XZ3 B;  5J39 A;  3UI2 A;  5DG8 A;  1CZW A;  3PO3 H;  3EBE A;  3JAM c;  2YU9 B;  1JWU D;  4O2D A;  4NXN L;  3RLF A;  5DQG A;  1EWI A;  2C00 A;  4YIJ A;  1RJR A;  4K2L A;  3CC2 A;  3H91 A;  2XGP A;  2B2Y C;  4JI1 H;  5KFZ A;  4YCU A;  4GN4 B;  1XX8 A;  4RZR A;  2E5L Q;  4JI5 H;  2RKS A;  4POF A;  4H02 A;  1H9K A;  1PA6 A;  1SEI A;  1KC7 A;  4FXD A;  3FKI B;  2A19 A;  2YTX A;  4GOP A;  1UNS A;  2LFN A;  4LFB H;  1BCP D;  1TS3 A;  4A3D B;  2DUD A;  1SYG A;  3ORQ A;  5C1O A;  3PO2 B;  4I50 F;  2UVV A;  4B3S H;  1IOW A;  1WTX A;  1Q46 A;  5LHY 1;  1B33 N;  4RZQ A;  2W7P A;  1V4Y A;  1S97 A;  3T5J A;  1KTK A;  2W57 A;  5KFD A;  4RHR A;  2NVT H;  3H4D A;  2F4V H;  1I4R A;  1TWA A;  1K83 A;  1T36 A;  2WKC A;  5IWA Q;  3CC7 A;  4UDU C;  1N34 H;  3T1Y H;  5J2U F;  2UUB L;  4DR5 Q;  5EDW A;  3RB6 A;  2ZJR A;  4B3M H;  3I12 A;  4DR4 H;  5KFQ A;  1TKW B;  3BAB A;  4LF7 H;  2W9A A;  3J80 L;  4F7X A;  4IFD J;  1YHB A;  4LMQ D;  1SE4 A;  5D8D A;  4L5Q A;  3QZ8 A;  2FK3 A;  3NXW A;  2IHE A;  3RB4 A;  4KMU C;  4XT1 B;  3ZYY X;  3K6O A;  4DV6 L;  3ULJ A;  1ULZ A;  2JQO A;  3OPO A;  1B3A A;  5CV5 A;  1JC7 A;  2Z0S A;  1E4E B;  4MV9 A;  2Z1C A;  5M9O A;  4MTD A;  2CWA A;  1UAP A;  2XGT A;  3F8T A;  1SNP A;  2EDG A;  1HNX Q;  4JI0 Q;  2ATW A;  4O3R A;  3HP3 A;  4LK1 C;  2BR0 A;  4GNX B;  1L1O A;  1F2L A;  4RB0 A;  1T5E A;  1YNX A;  5CGK A;  4KHP L;  4LFA Q;  3GTO B;  5DGB A;  4LF8 Q;  3MWM A;  2EYJ A;  4A3E G;  1EY7 A;  4P71 A; 
#chains in the Genus database with same CATH homology
 1VQH A;  3E9H A;  1NE3 A;  4LF5 Q;  1WI5 A;  4XIG S;  3J7Z C;  2N49 A;  1UE7 A;  2FXQ A;  4A3B G;  2NZO A;  5BR8 Q;  4C3I H;  1N34 Q;  1S3O A;  1D7Q A;  1XPU A;  3M3Y H;  3FP9 A;  4JBJ A;  1N33 Q;  4TVA B;  1Q7Y C;  4YCV A;  2VNU D;  3OYY A;  3Q8D A;  5LMN W;  1PH1 A;  5C0X G;  4UY8 C;  2HHH Q;  3CCL A;  1TXY A;  3PIO A;  3CMA A;  3CAM A;  2KHI A;  3BJU A;  1X65 A;  2ZJQ A;  1N9W A;  1H95 A;  2AWO A;  1W3S A;  4AYB G;  1E1T A;  5C3E H;  1HNW L;  4JI1 L;  2YV5 A;  4JI3 L;  2OQK A;  1WYD A;  4UPA A;  2JA7 H;  4BBS H;  3H0G H;  2IY5 B;  2WP8 J;  4A3L G;  1X56 A;  4JI5 L;  3AQQ A;  1N36 Q;  3ICE A;  4AYB E;  2UXD Q;  2UXC Q;  4GLV B;  4XTC S;  3UDG A;  3T1H L;  2PQA A;  3HFZ B;  1VQ4 A;  2ASB A;  1MIU A;  3E9I A;  1DGS A;  2CWP A;  3UDX A;  4AQY Q;  2UU9 Q;  2Q2I A;  1VQF A;  4LFB L;  3CCR A;  1K3R A;  1SMX A;  5IE8 A;  2MO1 A;  1R9T H;  2KCT A;  1UEB A;  2JA8 H;  4DK6 C;  4A3M G;  5J3B A;  1PYS B;  1LYL A;  1C7Y A;  4BXX G;  1A8V A;  5GAD C;  1KC8 C;  4B3S L;  2K5N A;  3PUY A;  5IYD H;  4A3K H;  4GS3 A;  4JI6 Q;  1EOV A;  4P75 A;  4IPG A;  2MQH A;  1PH8 A;  5GAG C;  4LFC L;  2CQO A;  3BZC A;  1S40 A;  5C4X H;  1BKB A;  3HOZ H;  2F4V L;  2PMZ E;  4X66 Q;  1XMO Q;  3GTK H;  2N8N A;  3S24 A;  5LMU Q;  4IOA A;  1HZA A;  1VQA A;  1N34 L;  4R4Q A;  2H5X A;  3T1Y L;  3RZD H;  2ES2 A;  1Q81 C;  1UWV A;  4B3M L;  3MXN B;  4DV1 Q;  1QZG A;  1VQ9 A;  2R92 H;  4DR4 L;  4JG2 A;  1XNR L;  4A93 G;  2VZA A;  4GLX A;  3CF5 A;  4LF7 L;  4L5R C;  1CKN B;  3PIP A;  3RR5 A;  4NXM Q;  2A1A A;  3KF6 A;  1Y1W H;  3S2D H;  1Q1E A;  3HOV G;  4GKJ L;  1I50 H;  4DPG A;  2E2H H;  1NMG A;  1SE8 A;  2VL6 A;  5IP7 G;  3I56 A;  2VQE L;  1PHJ A;  1NBW A;  1GO3 E;  3J80 c;  1Q82 C;  2EIF A;  1OXV A;  5GRO A;  4JI7 Q;  1B70 B;  4EQ5 A;  2I5M X;  4OWW B;  3RLN A;  5M3M G;  3JAM i;  4DV2 Q;  3PO3 G;  1YIT A;  4DK3 C;  1XNQ Q;  1WJJ A;  1EQQ A;  1OXS C;  1PFS A;  1YEZ A;  3PSI A;  5H1S E;  5IYB G;  4NXN Q;  4A4I A;  2K14 A;  3I2Z A;  1N32 L;  1VQJ A;  4ME3 A;  5IYC G;  1HJP A;  5LMN Q;  1EFW A;  3J80 i;  1E3P A;  3PF4 A;  1M1K C;  3RLO A;  3I4M H;  2C35 B;  1HZB A;  2VW9 A;  2HT1 A;  5JJK A;  2LXK A;  4BA2 I;  4R4I A;  1Z9F A;  4Y7N H;  3HOX G;  3PUV A;  1SRO A;  1U0L A;  5GAE C;  3OTO Q;  4B3R L;  5C44 G;  2DGY A;  2WB1 G;  1VQ8 A;  4YCW A;  5IY0 A;  2B63 G;  2YU9 H;  4YWM A;  1I94 Q;  3AEV A;  1OXX K;  2KCM A;  3HOW H;  4BBR G;  3CC4 A;  1XTD A;  4HIM A;  4X62 L;  1SR3 A;  1CSP A;  1E1O A;  2Z6K A;  1PH4 A;  1UE6 A;  2I0Q A;  5FLM G;  4OXP A;  2B29 A;  4X64 L;  1O7I A;  1VQN A;  1VQI A;  2ID0 A;  3PUW A;  4DR2 L;  3HOY G;  1YZ6 A;  2AMC B;  1HNZ Q;  4DR7 Q;  4GNX C;  3S1M H;  3FKI H;  3M85 A;  1WFQ A;  2HIX A;  3L7Z C;  1YI2 A;  4QJF A;  1KHI A;  1V43 A;  4DV7 Q;  3OW2 A;  1M90 C;  1ASZ A;  1OXT A;  4OON A;  2AKW B;  4P74 A;  4DV3 Q;  2Q2T A;  2UUA L;  4A3D H;  1I6H H;  4MNO A;  3MEF A;  5IP9 G;  1JJ2 A;  4BY1 H;  2VUM G;  2CFM A;  1XMQ L;  1PH7 A;  2UUC Q;  4JI2 L;  3KF8 B;  3CW2 C;  2E2J H;  4MTN A;  4UP8 A;  2R7Z H;  3PO2 H;  4QL5 A;  4YHH L;  4WJ3 M;  1AH9 A;  3TRZ A;  1RL2 A;  2OTL A;  4LF6 Q;  4A3C H;  4ALP A;  1X6O A;  3PV0 A;  4DV5 Q;  5FJ8 H;  1IXR A;  1YJN A;  3W1B A;  2UXB Q;  4HJ9 A;  5JJL A;  4DR1 L;  1PH9 A;  4C2M H;  3S14 H;  1B8A A;  4P72 A;  4APV A;  4A3E H;  4NB3 A;  1FL0 A;  1VQD A;  1VQ5 A;  4DUY Q;  2ZM6 Q;  1GVP A;  1B7Y B;  4L5S A;  3KF6 B;  1SFO H;  3CD6 A;  3S1Q H;  3AFP A;  2OTJ A;  1A62 A;  5BR8 L;  4LF4 L;  3GTJ H;  1T9H A;  3W5O A;  2JA5 G;  4A3B H;  1K8A C;  1N33 L;  1QUQ A;  1RIP A;  5HY6 A;  4YY3 Q;  2A8V A;  3UE1 A;  1UE1 A;  3B6Y A;  4WJ4 A;  3ZJY C;  1XJV A;  3ULL A;  4LF9 Q;  4A3J G;  1VQ7 A;  4GN3 B;  3K7A H;  4HJ7 A;  4BY7 H;  4DV0 Q;  1KXL A;  1NMF A;  1NY4 A;  3CCV A;  4GOP B;  1YJ9 A;  4UP7 A;  1BVS A;  2LSS A;  4GKK L;  3F2C A;  4OO1 G;  4A3G H;  3K8A A;  4HID A;  2MNA A;  4HJ8 A;  3S1N H;  1AE2 A;  4UP9 A;  3GDE A;  1OXU A;  2E8G A;  1Q12 A;  2BA1 A;  2F52 A;  4JBM A;  4X65 L;  3DM3 A;  1KQS A;  4AQY L;  5C0X J;  1CSQ A;  4QY7 A;  1P8L A;  1G51 A;  5C3E G;  1V1Q A;  4IOC A;  3GTO H;  4LNQ A;  1IBK Q;  3M9B A;  4J15 A;  4JI1 Q;  4POG A;  4BBS G;  3S17 H;  4BXX H;  1EQR A;  1Y14 B;  4K0K L;  4TQU S;  2IHF A;  4IFD I;  3GTM H;  1X54 A;  1Y1V H;  4JI6 L;  3I7F A;  3GTL H;  2D0P A;  3KJP A;  1VQB A;  2RF4 A;  3K81 C;  4KHZ A;  4B3T L;  4X66 L;  3HOU H;  5M5W H;  4DV4 L;  4LFB Q;  2JA8 G;  4LUO A;  1QVG A;  1HR0 L;  5LMU L;  3DLL A;  5IT9 c;  4DR3 Q;  4HIO A;  3KDF B;  3G48 A;  3S1R H;  4LUZ A;  4DR6 L;  1N8R C;  4JBK A;  1KD1 C;  1SN8 A;  4B3S Q;  3S16 H;  2NVX H;  4JI8 Q;  4A93 H;  2NN6 I;  1A63 A;  4KLK A;  2JE6 I;  2PI2 E;  4QGU A;  3A74 A;  5DLQ E;  4LFC Q;  2KBN A;  2QA4 A;  3PCO B;  3G4S A;  1YIJ A;  1PH3 A;  3I4N G;  4PG3 A;  2D62 A;  5ELN A;  4L5T A;  4FDB A;  1K9M C;  2JA6 G;  5IP7 H;  4GNX A;  1GD7 A;  1TWH H;  1L1O B;  1HZ9 A;  1X55 A;  3EIV A;  4RG1 A;  3L2P A;  3T1Y Q;  1S72 A;  2E5L L;  2R92 G;  3KFU A;  4B3M Q;  2QEX A;  3F2B A;  1VQC A;  2Y0S G;  3M4P A;  3NEN A;  2N3S A;  5M3M H;  4DV2 L;  4A3F H;  4LF7 Q;  5ELO A;  1XNQ L;  2R93 H;  3G71 A;  1FGU A;  1K83 H;  1BBU A;  1TWG H;  1VQG A;  1WOC A;  2RHQ B;  4A76 A;  1X9N A;  3H15 A;  1ASY A;  1AE3 A;  1VQM A;  2Y0S E;  4GKJ Q;  1Q1B A;  3L0O A;  2F3I A;  3U50 C;  1V9P A;  4OX9 Q;  5LMN L;  1IL2 A;  2VQE Q;  1D8L A;  2I5H A;  1QVF A;  2EXD A;  1CUK A;  1GM5 A;  1QUQ B;  3AYH B;  3M4O H;  4MZ9 A;  4A75 A;  4OWT B;  2IX0 A;  1Z47 A;  4PZ6 A;  1J5E Q;  1XPR A;  1KRT A;  2RCN A;  3HOX H;  3W1G A;  4IO9 A;  3OTO L;  3RN5 A;  4JV5 L;  4Y52 H;  1G6P A;  5IWA L;  5C44 H;  3ULP A;  1IBM L;  2K50 A;  1UE5 A;  2ZTE A;  1N32 Q;  2B63 H;  4DR5 L;  1I94 L;  1VQP A;  2VY3 A;  2OCE A;  2WB1 E;  3AFQ A;  5M5X H;  5M3F H;  5C0X I;  3GTG H;  3S2H H;  3SGI A;  4A3I G;  4BBR H;  4IFD G;  1VQE A;  2PQA B;  2Q2U A;  3H3V H;  3TS0 A;  3CME A;  4JOI C;  1SLJ A;  2KEN A;  2ZTD A;  1I3Q H;  3JC6 6;  3ERS X;  4JBW A;  3U4V A;  4DUZ Q;  1K8G A;  1C0A A;  2K5V A;  5AJ3 Q;  2AWN A;  3GTP H;  5FLM H;  1I5F A;  3VDY A;  1HNZ L;  4DR7 L;  3GO5 A;  3HOY H;  2UUB Q;  1WCM H;  3RNU A;  1PH6 A;  1FJG L;  3KYH C;  3TRE A;  1IYJ B;  1FVI A;  2VS1 A;  1K0R A;  4IPC A;  2CKZ B;  3PUZ A;  4NPS A;  3K7U C;  4JC0 A;  1HNX L;  4JI0 L;  5IP9 H;  3PF5 A;  4P73 A;  3CPF A;  3LGJ A;  2BH8 A;  4AH6 A;  2VUM H;  5K36 G;  4R4C A;  2VQF Q;  3KLW A;  3GTQ H;  2GVA A;  1LTL A;  4X64 Q;  1JB7 A;  4LFA L;  2JJQ A;  4DV6 Q;  4JI4 Q;  2I5L X;  4DKA C;  4DR2 Q;  2E2I H;  1HR0 W;  4LF8 L;  4GLA C;  4JYA L;  4LWC A;  1KAW A;  4R1J A;  4DAM A;  4LF5 L;  1CKM A;  3J81 j;  4R4T A;  1MJC A;  4DUY L;  3TS2 A;  3UDF A;  1NTG A;  3KOJ A;  2K5H A;  2R7Z G;  1XMQ Q;  4IPH A;  4HJ5 A;  4GOP C;  4LUV A;  4JI2 Q;  2V1C C;  4BA1 I;  2IX1 A;  2NVQ H;  1U5K A;  2JA5 H;  4YHH Q;  3CCQ A;  2R7D A;  3CQZ H;  2LXJ A;  4KHP Q;  4GN5 A;  3D0F A;  5FJ8 G;  2HHH L;  1MJE A;  1QVC A;  1HH2 P;  3EN2 A;  1NJI C;  1IBL Q;  4DR1 Q;  3BZK A;  4LF9 L;  2R6G A;  3I55 A;  3K0X A;  5JEA G;  4RMF A;  1G29 1;  3CXC A;  2JA9 A;  4R4O A;  3UDI A;  1N36 L;  4A3L H;  4LF4 Q;  3RZO H;  1TWF H;  2JEA I;  2UXD L;  1OTC A;  3J7A 5;  2UXC L;  4YWK A;  1BBW A;  2K4K A;  1LM0 A;  3A0J A;  1YHA A;  1EUJ A;  2UU9 L;  2K75 A;  3M4Q A;  4BY7 G;  3HKS A;  2RHS B;  1HNW Q;  3TEH B;  3IRB A;  3NEM A;  2JA7 G;  4JI3 Q;  1K73 C;  3H0G G;  3U4Z A;  4A3M H;  1IBK L;  2YYZ A;  2Z6K C;  4GKK Q;  5JEA J;  3CCM A;  1KIX A;  4JI5 Q;  4A3G G;  2BA0 A;  4LW1 A;  4IPD A;  3S15 H;  1IZ6 A;  2CCZ A;  1SRU A;  3T1H Q;  2WAQ G;  1PYB A;  1XMO L;  1XPO A;  4IJH A;  5GAH C;  1JJC B;  2NZH A;  1X3E A;  2HQL A;  4X65 Q;  2N78 A;  4O0A A;  2EQS A;  4DR3 L;  4PZ8 A;  5C4J H;  3CCS A;  2YTY A;  4AIM A;  2GN5 A;  1E22 A;  2WAQ E;  4DV1 L;  1VQO A;  4X6A H;  3GD7 A;  1KRS A;  2OQ0 A;  5IYD G;  1PV4 A;  4A3K G;  2MFI A;  1TWC H;  4K0K Q;  1L1O C;  1Y1V G;  4YWL A;  3H3V I;  1JJG A;  4JI8 L;  2B3G A;  4JCV E;  4NXM L;  1VQ6 A;  5C4X G;  3HOZ G;  4IJL A;  4JOI A;  2KHJ A;  2F4V Q;  1VCI A;  2YTV A;  2JEB I;  3HOU G;  3HOV H;  3A5Z B;  4B3T Q;  3K80 C;  3HKZ G;  3J81 c;  3ER0 A;  4DV4 Q;  2OWO A;  1P16 A;  3I4N H;  4KI0 A;  1HR0 Q;  1CKO A;  2JA6 H;  4JI7 L;  3G6E A;  3F1Z A;  3NBH B;  4DAY B;  4DR4 Q;  1GKH A;  3I4O A;  1XNR Q;  1Q8K A;  4DR6 Q;  4C3H H;  3HKZ E;  3KJO A;  1YHQ A;  1TWA H;  1JT8 A;  3PO3 H;  3EBE A;  3JAM c;  1VS0 A;  1Y1W G;  4O2D A;  4NXN L;  3RLF A;  3RN2 A;  1EWI A;  5IYB H;  1HZC A;  4QIW E;  2L15 A;  3J81 i;  5IYC H;  3CC2 A;  1LUZ A;  2NVY H;  4OX9 L;  4PZ7 A;  4YCU A;  4GN4 B;  3A5U A;  2E5L Q;  4POF A;  5JJI A;  4H02 A;  2PI2 A;  2K52 A;  1PA6 A;  4A3F G;  1EIY B;  1VQK A;  1J5E L;  2R93 G;  2A19 A;  2ZJP A;  4PMW A;  2YTX A;  4GOP A;  2MO0 A;  1EYG A;  2DUD A;  3WWV A;  1KL9 A;  3I4M G;  2GVB A;  1PH5 A;  5GQO A;  2ALY B;  3NEL A;  2ZTC A;  5EAY A;  3U58 A;  1Q46 A;  3CCE A;  3UE0 A;  1J6Q A;  4A3I H;  2WFW A;  5E7N A;  4B3R Q;  1YJW A;  2NVT H;  4DUZ L;  4OO1 I;  5AJ3 L;  2Q2H A;  4JV5 Q;  3PUX A;  2JK8 A;  5IWA Q;  3CC7 A;  2XTI A;  1IBM Q;  3HOW G;  4OWX B;  2R7F A;  5M3F G;  4DV7 L;  2UUB L;  4DR5 Q;  5FLX c;  4DV3 L;  2ZJR A;  3CCU A;  1X3G A;  2QGQ A;  2NN6 G;  2HIV A;  4X62 Q;  1YBY A;  3CPW A;  3STB C;  1PVO A;  2UUC L;  3FHW A;  2D0O A;  4IFD J;  1YHB A;  1L2F A;  3D31 A;  4L5Q A;  1PH2 A;  1MKH A;  4LF6 L;  2VQF L;  2PNH A;  1L0W A;  1C9O A;  3KDF A;  4DNI A;  2IHE A;  4DV5 L;  3FKI G;  2UXB L;  3BU2 A;  5HGQ A;  3F2D A;  3E0E A;  4DV6 L;  4JI4 L;  2BH2 A;  1E24 A;  3ULJ A;  3STB D;  1CKN A;  1WCM G;  2JQO A;  1VQL A;  4A3D G;  1JE5 A;  5M5Y H;  2Z0S A;  2UUA Q;  1FJG Q;  3CCJ A;  2ZM6 L;  4QQB X;  4BY1 G;  1EIF A;  2CWA A;  2AHO B;  2XGT A;  3F8T A;  4HIK A;  1YVC A;  3PO2 G;  1Q86 C;  1HNX Q;  4JI0 Q;  2ATW A;  1X3F A;  3TQY A;  4HJA A;  1JMC A;  4A3C G;  4GNX B;  1A0I A;  3CP0 A;  3PGZ A;  4YY3 L;  1W2B A;  4EX5 A;  1L1O A;  1QZH A;  1YNX A;  3M7N A;  2IT1 A;  4LFA Q;  4C3J H;  4KHP L;  4LF8 Q;  1E7Z A;  4JYA Q;  4A3E G;  1IBL L;  4A3J H;  4DV0 L;  4P71 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...