3M4IA

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 1.95 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
190
Chain Sequence
TDPRKSELYVVEGDSAGMFQAILPLRGRIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Isomerase
molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 60
structure length 190
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3m4iA02
3IG0A 2ZJTA 3M4IA
chains in the Genus database with same CATH superfamily
3R5XA 4ME6A 4A3KG 1EUDB 4BXXG 1K1SA 5KFWA 2RDIA 1X9NA 4EG0A 2W6MA 5CAEB 4RU9A 3PVXA 2C28A 2W9BA 2FPPB 4LMYA 4HNUA 4RZRA 2F4VH 4GLXA 1RJPA 1DIKA 1E4FT 3QZ8A 4FBUA 1KJIA 1I94H 1FJGH 4O2AF 5KT4A 4XX0B 2VA3A 2W7OA 3K3PA 3BQ2A 2DPJA 2CKZB 5FJ8G 5EWEA 5KFNA 5F9NA 4B3TH 3K5HA 4MV8A 5DQIA 4DL7A 5KG7A 3H20A 4DL2A 2FB9A 4EFEA 1I3QA 2UXCH 4NLGA 3ORQA 1M0WA 5KG5A 4EBEA 2RGRA 2R8GA 1GSAA 5LL6b 4C5BA 2YL2A 2IMWP 2YW2A 4HQ6A 2R87A 4J9MA 4ZI7F 1T3NA 4HNTA 3BABA 1B33N 4I7HA 3Q8RB 4EYIB 3H0GG 2YU9A 4DV5H 3GTGA 3PW5A 4O3RA 1JDEA 4RUAA 1GGOA 4AQYH 5C4XG 3MFHA 5DG9A 4OX9H 2V9WA 5H80A 4IR1A 2W71A 3N8DA 3M9NB 1IOVA 3GTOA 5C1OA 2R7ZG 4DV3H 5EDWA 3H0GA 3H3VH 4ED3A 3M9MB 1AN7A 3RF2A 4APMA 4O3PA 5IWAH 4YJ2F 1I7LA 2YZGA 2BQUA 1WSCA 2R7NA 4O4HF 3T5LA 5J2TF 3HKZA 4BY7G 4DR7H 2R7ZA 2VUGA 3L4KA 4A2BA 4F50A 1ZQ7A 2XGPA 4YY3H 5JUMA 4FBTA 2I87A 1Z2NX 4Q8FA 2AGQA 4XYMB 1Y14B 4MV1A 3F8NA 4IRCA 1TWGA 4I4TF 5FLMG 4FS1A 2FPIB 4MV6A 4L1KA 2WTFA 1JDBB 1T94A 4YQWA 2UXBH 1Y1WA 1KBLA 5KX5F 5D1OB 1M7JA 4WBNF 4ZQIA 2HVRA 2ZM6H 1N32H 3LWBA 2ZDQA 3EYYA 3RV3A 4B3RH 4X64H 1PX2A 2B63G 2C2RA 4DV0H 4MTEA 3IG0A 2W7PA 4ECSA 4GC7A 4QJFA 2HVQA 2O03A 3BG5A 2J9GA 4XYLB 5KFYA 1BNCA 2RDJA 4A3IG 3CQZA 4I55F 1TA8A 4ECRA 4QWDA 1SCUB 3PR5B 4ECXA 3ETJA 3GIJA 4DL5A 4DR1H 4A3FG 4DR2H 2C2DA 5IYDG 4AYBE 3BQ0A 3K3VA 2R7LA 2VUMA 2R84A 4ECQA 2FK3A 3HXLA 1FVIA 3ORRA 4EGQA 3Q8SB 4TQRA 3IN5A 1B04A 4LFCH 1BJTA 1C30A 1TAEA 3L2PA 4K0KH 5KFGA 3EPIA 4QW8A 2WYOA 3CVZA 2R7KA 2C2EA 5FPOA 3GIIA 3RFCA 4F4XA 4TQSA 3GIDA 4UFZA 2W6PA 2VPQA 1K1QA 1E4GT 4R8UB 1MZBA 5DQGA 1RK6A 3KHRA 2R8IA 2VQDA 4ECUA 3RBEA 1BXRA 4X66H 3T1HH 1S0OA 2IA6A 3RV4A 5KT6A 3RAQA 1TWCA 2FK2A 3RB0A 2R93G 1XDNA 4YP3A 4JI4H 2R8JA 2JEIA 1IBKH 3GQCA 3TQ1A 4J9SA 2BQRA 4EEQA 2VOBA 5LMUH 2MCTA 5KFRA 2W8KA 4QIWE 4LH6A 3UQ8A 4J9KA 4RAYA 4RUCA 1I7NA 4JYAH 3MFIA 1Y1VG 4JI7H 5L1IA 4JV1A 5LOVF 3T5KA 2R93A 4Q44A 4MA5A 3WO0A 1ZHQA 5D1OA 1JLLB 5KKNB 5DLGA 5KT2A 4ED7A 4EFBA 4MTDA 5DG7A 1WR2A 2FK1A 1B6SA 3BA9A 3RTXA 1N36H 2PMZE 4TUYF 1ZHSA 5EOYA 1SYXB 1TWFA 3WNZA 1Y1VA 4DUYH 5L1JA 3PN1A 2YZNA 2DPIA 1RJQA 4Q43A 2PVPA 2R6FA 5FD6A 3BA8A 5K2MA 3N42B 1N48A 2W9AA 4LF8H 3RB3A 2NU7B 4GKKH 2ZDGA 4AYBA 1S03G 1VKZA 3N41B 3R5HA 2YZMA 4X65H 5KFQA 4JI8H 1M0TA 4O4IF 1CS0A 5DG8A 2JEJA 2FKLA 2YRWA 1M6VA 5FPRA 4NXMH 4LH7A 4BWSC 5KFPA 3H4DA 5A2QW 3N40P 3MR3A 1RJRA 3FMAA 5KFEA 4YAKB 1HR0H 1DV2A 2FP4B 4LFBH 2J6SA 2ATLA 4RB2C 3KALA 4R8UA 2HVSA 5EWGA 3M4IA 4DR3H 2ASLA 2Q2UA 4DV6H 4JI3H 4QIWA 2UVUA 4B3MH 3AYHB 2W8LA 1GYFA 3G8CA 2DIKA 1A0IA 3KHHA 3SE7A 1RYRA 4YB8B 1JKJB 5DQHA 3Q8QB 2DLNA 3Q8PB 4F4YA 2R86A 5CB4F 4YR3A 1FKAH 4G3IA 4F4ZA 1XMOH 4BBSG 4ED6A 5CA1F 2PMZA 3GLKA 4GC6A 1L2ZA 3PO2G 1SEIA 1A9XA 5LMNH 5BMVF 3KHGA 4C2MA 2PN1A 4J0MA 3G6YA 3T5HA 2R8KA 4KHPH 2FJZA 4IR9A 2OH2A 1S68A 2J6TA 4DUZH 4ECYA 5D1PA 5GONF 1HNXH 4O3NA 2WAQE 5IYZF 1EYZA 5CA0F 1N56A 4LF9H 3RB6A 2CW8A 4J9PA 4A2AA 4A3DG 5LP6F 3PO3G 1E4EB 1AUXA 2M05A 4BY1G 4EBCA 3RGXA 4LSAA 4LFAH 5BPHA 5HV6A 1CE8A 5KFKA 1XNQH 4MV4A 2KSWA 4E4TA 3PR4A 5KG0A 4HYKA 2OLSA 3VMMA 4YJ3F 2AGPA 3GV8B 4JV0A 5KFZA 2IBKA 4C5CA 3HOYG 3BQ1A 2NU6B 4RB1A 3BJYA 2HHHH 5JQWA 2JEFA 3JSLA 5J2UF 1WCMG 2UVRA 3GTPA 1PK8A 2UVVA 3NGDA 5FD5A 4QWCA 4JUZA 5IP9G 1DGSA 3RJ0A 2VQFH 5BPFA 1CQJB 2FMAA 2B63A 4RAZA 2GLTA 3OUUA 4C5AA 4RNOA 3PW2A 3I12A 4DL4A 2UUCH 4O3SA 3RIZA 3J81W 1RYSA 3FDSA 2SCUB 2YS6A 2ZJTA 3GIQA 1WCMA 4CC6A 4B3SH 2E2HA 4TV8F 4MV9A 4ED0A 1IBLH 4RB3C 3QZ7A 1XMQH 2UU9H 3GTMA 4QWBA 5KG6A 5IP7G 2W9BB 2I80A 1S97A 4LF4H 4A93G 4QW9A 3G6XA 4IWXA 3ETHA 1VAJA 3RGZA 3KTMA 4DL3A 4X62H 3GIPA 2NU9B 1KC7A 5LA6F 2WB1E 2VQEH 3SI8A 5KFSA 3V6JA 3Q2OA 2ZDHA 4R7RA 5KT7A 3PW4A 1I6UA 2CQYA 4JI2H 4FS2A 4I50F 2WAQA 2YYAA 3R5FA 4UCSA 5KG3A 4J9QA 2E5LH 4GKJH 1GO3E 4JI0H 3I4NG 4RZQA 5FLXW 4U6PA 3JSNA 4FM9A 2Y0SA 3L4JA 2NU8B 4EEYA 2W6NA 4PDBA 1I50A 4J9RA 3E5NA 2XCPA 3JRWA 2C22A 3JRXA 3HB9A 3OHAA 4UCTA 3DF7A 2XCLA 4RNNA 1EZ1A 2FLNA 3PW0A 4ZOLF 1WH2A 1ULZA 5KFLA 4O4LF 3WO1A 1EHIA 4LF6H 2JA6G 1VS0A 5C3EG 3PZPA 4QWAA 3I4MG 4ED1A 3VPBA 3MJFA 2OWOA 5EZYF 4DR4H 1DV1A 2BR0A 5KG4A 4IHJF 2AQ4A 3V4SA 1TWHA 3J7AK 2HJWA 5KT5A 2V4QA 1P8LA 3LP8A 2VA2A 2V5AA 3JAMW 3GV5B 2JA6A 4A3LG 4DV1H 4F4WA 2IP4A 2JEGA 1O75A 4YAJB 2AGOA 4DL6A 3UFXB 5LXTF 2XD4A 5KFCA 4A3CG 1GSOA 3QFFA 4ECWA 3OHBA 2UXDH 2GPWA 2FPGB 3GIKA 4TV9F 1AUVA 2W57A 3R23A 2JA8G 2WB1A 4UCRA 5JH7F 1XNRH 4HR7A 4M7EA 3KXYT 3GTQA 2J6UA 5JVLA 2X0SA 4U7CA 5L9XA 1N34H 2NUAB 2W70A 2RF4A 2CZGA 4LSXA 2XIGA 2R7MA 2QK4A 5KFFA 2XC9A 2W6QA 4FU0A 4J9NA 3J80W 4O3QA 2P0AA 1IOWA 5KFHA 4O2BF 4DV7H 2R85A 1UC8A 3VPCA 5IYCG 4Y8VB 1K83A 5L1LA 3HOXG 1V51A 3KAJA 4LF5H 4IAJA 2BQ3A 2VPSA 5F9LA 1KJJA 3MWMA 4YR2A 1SFOA 4IRKA 4QWEA 3HOUG 1W96A 3RBDA 4JV5H 4J9LA 1KEEA 5KFMA 5BR8H 4DV2H 4JV2A 1N33H 1JX4A 2FLLA 3HOWG 4CC5A 5KG1A 2AU0A 5C1PA 2FLPA 1HNWH 1CQIB 3GTLA 3KAKA 5D8DA 2W9CB 2RGVA 2R8HA 2UUBH 2UVWA 2Y0SE 5C44G 4MA0A 3RUPA 1S9FA 4O3OA 4LF7H 4JI6H 2R92G 4UCVA 4ECZA 1GSHA 3GIMA 3N44B 1Y1WG 2Q2TA 3HOZG 2YCHA 4BBRG 2PBZA 4ED2A 2R82A 4ECVA 1TWAA 3MR6A 1B6RA 1JIHA 3H4BA 4WD3A 1JXLA 3BAAA 4UCOA 4A3EG 1S0MA 2R92A 3RAXA 1KJ8A 1EUCB 2ASDA 1VBGA 3MWEA 4ED8A 4A3BG 2C35B 2V4RA 2YRXA 4RNMA 1ZETA 1S10A 4YHHH 3G6VA 1RK5A 2V59A 4YR0A 5L1KA 3TINA 3MR2A 2GPSA 4NXNH 3GILA 1UNNC 1R9TA 5KFTA 1Z2OX 4PWQA 3T5JA 2QYZA 3C0FB 4JI5H 2W6OA 2VUMG 3GTKA 1V4YA 4UCUA 5HBRB 1KJQA 2DZDA 4MV7A 3LMLA 3M9OB 3VPDA 4EYHB 4A3JG 3OTOH 1HNZH 3MR5A 4A3MG 1S0NA 3T1YH 2HGSA 5KFUA 3V6HA 5LYJF 4J9OA 3N6XA 2NVXA 3OSNA 3FKIG 1J5EH 4IWYA 5DLFA 3U9SA 2ALZA 4RB0A 4ETSA 4M9UA 4DLKA 3H40A 2VR1A 2ASJA 4HNVA 3U9TA 3TIIA 4JI1H 5DGAA 2NVYA 4Q45A 1VBHA 5KFOA 2UUAH 3V6KA 5KFDA 5KFIA 3JZIA 2V58A 3FKIA 3TIGA 5C5JA 3K5IA 4EBDA 4XZ3B 3EPGA 1W93A 3V4ZA 2CW7A 1GLVA 3Q1KA 5KG2A 5T14A 2W9CA 4ECTA 1OWTA 2JA5G 2XCAA 5KFBA 1E4EA 2JA7G 4DR5H 5KFXA 3HBLA 1KJ9A 4Q8EA 2I8CA 3KHLA 2C00A 3TQTA 4IRDA 5IT9W 5EWFA 2E2IA 5DGBA 3OUZA 1Z2PX 4EGJA 2YS7A 1UC9A 2W6ZA 3PW7A 4IZOA 4DR6H 1V9PA 1T36A 3MWDA 5KFJA 4DV4H 3GTJA 5KFVA 2DWCA 2JA5A 5KT3A 4YBZB 4ZHQF 1BGWA 4Q0YA 5IYBG 2JA7A 4MV3A 4A3GG 5JVDF 3OSPA 5I47A 2FE3A 2WDTA 1C3OA 2WE6A 3HOVG 1IBMH 3GV7B 3RB4A 2XGQA 4MAMA 5C8YF 3HKZE 3N43B 5KFAA
chains in the Genus database with same CATH topology
3KAJA 1E4GT 1MZBA 4LF4H 4IAJA 4LF5H 4RB1A 2VPSA 4X66H 3T1HH 1X9NA 3MWMA 2HHHH 2F4VH 4LMYA 3JSLA 4GLXA 1XDNA 1E4FT 1IBKH 1I94H 1FJGH 4JV5H 5FD5A 2VQFH 1DGSA 4EEQA 3RJ0A 4DV2H 5BR8H 2VOBA 5LMUH 2MCTA 1N33H 4RAZA 4LH6A 4CC5A 3UQ8A 4RAYA 1HNWH 4JYAH 4B3TH 2UUCH 3RIZA 3J81W 4JI7H 3H20A 3KAKA 2RGVA 2ZJTA 4EFEA 4B3SH 4CC6A 2UUBH 4MV9A 1IBLH 2UXCH 1ZHQA 5D1OA 4RB3C 1M0WA 1XMQH 2UU9H 4EFBA 4MTDA 2RGRA 3BA9A 5LL6b 3RTXA 1N36H 4JI6H 4LF7H 4UCVA 2Q2TA 3N44B 1ZHSA 5EOYA 1SYXB 3BABA 2YCHA 4I7HA 3RGZA 4DUYH 4X62H 4DV5H 3PN1A 4AQYH 2VQEH 4OX9H 3BAAA 5FD6A 3BA8A 4UCOA 4R7RA 3N42B 4LF8H 4GKKH 1I6UA 4JI2H 1S03G 4DV3H 4UCSA 3N41B 2E5LH 4GKJH 1AN7A 3RF2A 4APMA 4X65H 4JI0H 4YHHH 4RZQA 5IWAH 5FLXW 4JI8H 3JSNA 4FM9A 4PDBA 3L4JA 1M0TA 4NXNH 5FPRA 1Z2OX 4NXMH 4LH7A 4BWSC 4UCTA 3DF7A 4DR7H 2VUGA 3L4KA 3C0FB 4A2BA 5A2QW 4JI5H 1WH2A 4UCUA 3N40P 4YY3H 4LF6H 4MV7A 1VS0A 3FMAA 3LMLA 1Z2NX 1HR0H 4LFBH 3OTOH 1HNZH 3F8NA 3T1YH 2HGSA 4RB2C 2OWOA 3KALA 4DR4H 3N6XA 2HVSA 3M4IA 1J5EH 4DR3H 2Q2UA 3J7AK 4DV6H 4JI3H 1P8LA 4RB0A 4ETSA 4B3MH 2UXBH 1GYFA 5D1OB 3JAMW 1A0IA 4JI1H 4DV1H 2HVRA 2ZM6H 1N32H 1O75A 2UUAH 1FKAH 1XMOH 3EYYA 4B3RH 4JI4H 4X64H 2CW7A 4DV0H 4MTEA 3IG0A 4DR5H 2UXDH 1L2ZA 2HVQA 2O03A 2W57A 5IT9W 1SEIA 5LMNH 1Z2PX 4UCRA 1TA8A 4J0MA 4DR6H 4KHPH 1V9PA 1XNRH 4DV4H 1S68A 4M7EA 4DR1H 3KXYT 4DUZH 4DR2H 5D1PA 1HNXH 1BGWA 4Q0YA 3K3VA 1N34H 4LF9H 4LSXA 2XIGA 2CW8A 3HXLA 2FE3A 1FVIA 2WDTA 4A2AA 4LFCH 4K0KH 1B04A 2WE6A 1BJTA 3J80W 1TAEA 3L2PA 3RGXA 4LSAA 1IBMH 4LFAH 2WYOA 4DV7H 1XNQH 3CVZA 2KSWA 5FPOA 4UFZA 3N43B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG0 A;  2ZJT A;  3M4I A; 
#chains in the Genus database with same CATH topology
 3R5X A;  4ME6 A;  4A3K G;  1EUD B;  4BXX G;  1K1S A;  5KFW A;  2RDI A;  1X9N A;  4EG0 A;  2W6M A;  5CAE B;  4RU9 A;  3PVX A;  2C28 A;  2W9B A;  2FPP B;  4LMY A;  4HNU A;  4RZR A;  2F4V H;  4GLX A;  1RJP A;  1DIK A;  1E4F T;  3QZ8 A;  4FBU A;  1KJI A;  1I94 H;  1FJG H;  4O2A F;  5KT4 A;  4XX0 B;  2VA3 A;  2W7O A;  3K3P A;  3BQ2 A;  2DPJ A;  2CKZ B;  5FJ8 G;  5EWE A;  5KFN A;  5F9N A;  4B3T H;  3K5H A;  4MV8 A;  5DQI A;  4DL7 A;  5KG7 A;  3H20 A;  4DL2 A;  2FB9 A;  4EFE A;  1I3Q A;  2UXC H;  4NLG A;  3ORQ A;  1M0W A;  5KG5 A;  4EBE A;  2RGR A;  2R8G A;  1GSA A;  5LL6 b;  4C5B A;  2YL2 A;  2IMW P;  2YW2 A;  4HQ6 A;  2R87 A;  4J9M A;  4ZI7 F;  1T3N A;  4HNT A;  3BAB A;  1B33 N;  4I7H A;  3Q8R B;  4EYI B;  3H0G G;  2YU9 A;  4DV5 H;  3GTG A;  3PW5 A;  4O3R A;  1JDE A;  4RUA A;  1GGO A;  4AQY H;  5C4X G;  3MFH A;  5DG9 A;  4OX9 H;  2V9W A;  5H80 A;  4IR1 A;  2W71 A;  3N8D A;  3M9N B;  1IOV A;  3GTO A;  5C1O A;  2R7Z G;  4DV3 H;  5EDW A;  3H0G A;  3H3V H;  4ED3 A;  3M9M B;  1AN7 A;  3RF2 A;  4APM A;  4O3P A;  5IWA H;  4YJ2 F;  1I7L A;  2YZG A;  2BQU A;  1WSC A;  2R7N A;  4O4H F;  3T5L A;  5J2T F;  3HKZ A;  4BY7 G;  4DR7 H;  2R7Z A;  2VUG A;  3L4K A;  4A2B A;  4F50 A;  1ZQ7 A;  2XGP A;  4YY3 H;  5JUM A;  4FBT A;  2I87 A;  1Z2N X;  4Q8F A;  2AGQ A;  4XYM B;  1Y14 B;  4MV1 A;  3F8N A;  4IRC A;  1TWG A;  4I4T F;  5FLM G;  4FS1 A;  2FPI B;  4MV6 A;  4L1K A;  2WTF A;  1JDB B;  1T94 A;  4YQW A;  2UXB H;  1Y1W A;  1KBL A;  5KX5 F;  5D1O B;  1M7J A;  4WBN F;  4ZQI A;  2HVR A;  2ZM6 H;  1N32 H;  3LWB A;  2ZDQ A;  3EYY A;  3RV3 A;  4B3R H;  4X64 H;  1PX2 A;  2B63 G;  2C2R A;  4DV0 H;  4MTE A;  3IG0 A;  2W7P A;  4ECS A;  4GC7 A;  4QJF A;  2HVQ A;  2O03 A;  3BG5 A;  2J9G A;  4XYL B;  5KFY A;  1BNC A;  2RDJ A;  4A3I G;  3CQZ A;  4I55 F;  1TA8 A;  4ECR A;  4QWD A;  1SCU B;  3PR5 B;  4ECX A;  3ETJ A;  3GIJ A;  4DL5 A;  4DR1 H;  4A3F G;  4DR2 H;  2C2D A;  5IYD G;  4AYB E;  3BQ0 A;  3K3V A;  2R7L A;  2VUM A;  2R84 A;  4ECQ A;  2FK3 A;  3HXL A;  1FVI A;  3ORR A;  4EGQ A;  3Q8S B;  4TQR A;  3IN5 A;  1B04 A;  4LFC H;  1BJT A;  1C30 A;  1TAE A;  3L2P A;  4K0K H;  5KFG A;  3EPI A;  4QW8 A;  2WYO A;  3CVZ A;  2R7K A;  2C2E A;  5FPO A;  3GII A;  3RFC A;  4F4X A;  4TQS A;  3GID A;  4UFZ A;  2W6P A;  2VPQ A;  1K1Q A;  1E4G T;  4R8U B;  1MZB A;  5DQG A;  1RK6 A;  3KHR A;  2R8I A;  2VQD A;  4ECU A;  3RBE A;  1BXR A;  4X66 H;  3T1H H;  1S0O A;  2IA6 A;  3RV4 A;  5KT6 A;  3RAQ A;  1TWC A;  2FK2 A;  3RB0 A;  2R93 G;  1XDN A;  4YP3 A;  4JI4 H;  2R8J A;  2JEI A;  1IBK H;  3GQC A;  3TQ1 A;  4J9S A;  2BQR A;  4EEQ A;  2VOB A;  5LMU H;  2MCT A;  5KFR A;  2W8K A;  4QIW E;  4LH6 A;  3UQ8 A;  4J9K A;  4RAY A;  4RUC A;  1I7N A;  4JYA H;  3MFI A;  1Y1V G;  4JI7 H;  5L1I A;  4JV1 A;  5LOV F;  3T5K A;  2R93 A;  4Q44 A;  4MA5 A;  3WO0 A;  1ZHQ A;  5D1O A;  1JLL B;  5KKN B;  5DLG A;  5KT2 A;  4ED7 A;  4EFB A;  4MTD A;  5DG7 A;  1WR2 A;  2FK1 A;  1B6S A;  3BA9 A;  3RTX A;  1N36 H;  2PMZ E;  4TUY F;  1ZHS A;  5EOY A;  1SYX B;  1TWF A;  3WNZ A;  1Y1V A;  4DUY H;  5L1J A;  3PN1 A;  2YZN A;  2DPI A;  1RJQ A;  4Q43 A;  2PVP A;  2R6F A;  5FD6 A;  3BA8 A;  5K2M A;  3N42 B;  1N48 A;  2W9A A;  4LF8 H;  3RB3 A;  2NU7 B;  4GKK H;  2ZDG A;  4AYB A;  1S03 G;  1VKZ A;  3N41 B;  3R5H A;  2YZM A;  4X65 H;  5KFQ A;  4JI8 H;  1M0T A;  4O4I F;  1CS0 A;  5DG8 A;  2JEJ A;  2FKL A;  2YRW A;  1M6V A;  5FPR A;  4NXM H;  4LH7 A;  4BWS C;  5KFP A;  3H4D A;  5A2Q W;  3N40 P;  3MR3 A;  1RJR A;  3FMA A;  5KFE A;  4YAK B;  1HR0 H;  1DV2 A;  2FP4 B;  4LFB H;  2J6S A;  2ATL A;  4RB2 C;  3KAL A;  4R8U A;  2HVS A;  5EWG A;  3M4I A;  4DR3 H;  2ASL A;  2Q2U A;  4DV6 H;  4JI3 H;  4QIW A;  2UVU A;  4B3M H;  3AYH B;  2W8L A;  1GYF A;  3G8C A;  2DIK A;  1A0I A;  3KHH A;  3SE7 A;  1RYR A;  4YB8 B;  1JKJ B;  5DQH A;  3Q8Q B;  2DLN A;  3Q8P B;  4F4Y A;  2R86 A;  5CB4 F;  4YR3 A;  1FKA H;  4G3I A;  4F4Z A;  1XMO H;  4BBS G;  4ED6 A;  5CA1 F;  2PMZ A;  3GLK A;  4GC6 A;  1L2Z A;  3PO2 G;  1SEI A;  1A9X A;  5LMN H;  5BMV F;  3KHG A;  4C2M A;  2PN1 A;  4J0M A;  3G6Y A;  3T5H A;  2R8K A;  4KHP H;  2FJZ A;  4IR9 A;  2OH2 A;  1S68 A;  2J6T A;  4DUZ H;  4ECY A;  5D1P A;  5GON F;  1HNX H;  4O3N A;  2WAQ E;  5IYZ F;  1EYZ A;  5CA0 F;  1N56 A;  4LF9 H;  3RB6 A;  2CW8 A;  4J9P A;  4A2A A;  4A3D G;  5LP6 F;  3PO3 G;  1E4E B;  1AUX A;  2M05 A;  4BY1 G;  4EBC A;  3RGX A;  4LSA A;  4LFA H;  5BPH A;  5HV6 A;  1CE8 A;  5KFK A;  1XNQ H;  4MV4 A;  2KSW A;  4E4T A;  3PR4 A;  5KG0 A;  4HYK A;  2OLS A;  3VMM A;  4YJ3 F;  2AGP A;  3GV8 B;  4JV0 A;  5KFZ A;  2IBK A;  4C5C A;  3HOY G;  3BQ1 A;  2NU6 B;  4RB1 A;  3BJY A;  2HHH H;  5JQW A;  2JEF A;  3JSL A;  5J2U F;  1WCM G;  2UVR A;  3GTP A;  1PK8 A;  2UVV A;  3NGD A;  5FD5 A;  4QWC A;  4JUZ A;  5IP9 G;  1DGS A;  3RJ0 A;  2VQF H;  5BPF A;  1CQJ B;  2FMA A;  2B63 A;  4RAZ A;  2GLT A;  3OUU A;  4C5A A;  4RNO A;  3PW2 A;  3I12 A;  4DL4 A;  2UUC H;  4O3S A;  3RIZ A;  3J81 W;  1RYS A;  3FDS A;  2SCU B;  2YS6 A;  2ZJT A;  3GIQ A;  1WCM A;  4CC6 A;  4B3S H;  2E2H A;  4TV8 F;  4MV9 A;  4ED0 A;  1IBL H;  4RB3 C;  3QZ7 A;  1XMQ H;  2UU9 H;  3GTM A;  4QWB A;  5KG6 A;  5IP7 G;  2W9B B;  2I80 A;  1S97 A;  4LF4 H;  4A93 G;  4QW9 A;  3G6X A;  4IWX A;  3ETH A;  1VAJ A;  3RGZ A;  3KTM A;  4DL3 A;  4X62 H;  3GIP A;  2NU9 B;  1KC7 A;  5LA6 F;  2WB1 E;  2VQE H;  3SI8 A;  5KFS A;  3V6J A;  3Q2O A;  2ZDH A;  4R7R A;  5KT7 A;  3PW4 A;  1I6U A;  2CQY A;  4JI2 H;  4FS2 A;  4I50 F;  2WAQ A;  2YYA A;  3R5F A;  4UCS A;  5KG3 A;  4J9Q A;  2E5L H;  4GKJ H;  1GO3 E;  4JI0 H;  3I4N G;  4RZQ A;  5FLX W;  4U6P A;  3JSN A;  4FM9 A;  2Y0S A;  3L4J A;  2NU8 B;  4EEY A;  2W6N A;  4PDB A;  1I50 A;  4J9R A;  3E5N A;  2XCP A;  3JRW A;  2C22 A;  3JRX A;  3HB9 A;  3OHA A;  4UCT A;  3DF7 A;  2XCL A;  4RNN A;  1EZ1 A;  2FLN A;  3PW0 A;  4ZOL F;  1WH2 A;  1ULZ A;  5KFL A;  4O4L F;  3WO1 A;  1EHI A;  4LF6 H;  2JA6 G;  1VS0 A;  5C3E G;  3PZP A;  4QWA A;  3I4M G;  4ED1 A;  3VPB A;  3MJF A;  2OWO A;  5EZY F;  4DR4 H;  1DV1 A;  2BR0 A;  5KG4 A;  4IHJ F;  2AQ4 A;  3V4S A;  1TWH A;  3J7A K;  2HJW A;  5KT5 A;  2V4Q A;  1P8L A;  3LP8 A;  2VA2 A;  2V5A A;  3JAM W;  3GV5 B;  2JA6 A;  4A3L G;  4DV1 H;  4F4W A;  2IP4 A;  2JEG A;  1O75 A;  4YAJ B;  2AGO A;  4DL6 A;  3UFX B;  5LXT F;  2XD4 A;  5KFC A;  4A3C G;  1GSO A;  3QFF A;  4ECW A;  3OHB A;  2UXD H;  2GPW A;  2FPG B;  3GIK A;  4TV9 F;  1AUV A;  2W57 A;  3R23 A;  2JA8 G;  2WB1 A;  4UCR A;  5JH7 F;  1XNR H;  4HR7 A;  4M7E A;  3KXY T;  3GTQ A;  2J6U A;  5JVL A;  2X0S A;  4U7C A;  5L9X A;  1N34 H;  2NUA B;  2W70 A;  2RF4 A;  2CZG A;  4LSX A;  2XIG A;  2R7M A;  2QK4 A;  5KFF A;  2XC9 A;  2W6Q A;  4FU0 A;  4J9N A;  3J80 W;  4O3Q A;  2P0A A;  1IOW A;  5KFH A;  4O2B F;  4DV7 H;  2R85 A;  1UC8 A;  3VPC A;  5IYC G;  4Y8V B;  1K83 A;  5L1L A;  3HOX G;  1V51 A;  3KAJ A;  4LF5 H;  4IAJ A;  2BQ3 A;  2VPS A;  5F9L A;  1KJJ A;  3MWM A;  4YR2 A;  1SFO A;  4IRK A;  4QWE A;  3HOU G;  1W96 A;  3RBD A;  4JV5 H;  4J9L A;  1KEE A;  5KFM A;  5BR8 H;  4DV2 H;  4JV2 A;  1N33 H;  1JX4 A;  2FLL A;  3HOW G;  4CC5 A;  5KG1 A;  2AU0 A;  5C1P A;  2FLP A;  1HNW H;  1CQI B;  3GTL A;  3KAK A;  5D8D A;  2W9C B;  2RGV A;  2R8H A;  2UUB H;  2UVW A;  2Y0S E;  5C44 G;  4MA0 A;  3RUP A;  1S9F A;  4O3O A;  4LF7 H;  4JI6 H;  2R92 G;  4UCV A;  4ECZ A;  1GSH A;  3GIM A;  3N44 B;  1Y1W G;  2Q2T A;  3HOZ G;  2YCH A;  4BBR G;  2PBZ A;  4ED2 A;  2R82 A;  4ECV A;  1TWA A;  3MR6 A;  1B6R A;  1JIH A;  3H4B A;  4WD3 A;  1JXL A;  3BAA A;  4UCO A;  4A3E G;  1S0M A;  2R92 A;  3RAX A;  1KJ8 A;  1EUC B;  2ASD A;  1VBG A;  3MWE A;  4ED8 A;  4A3B G;  2C35 B;  2V4R A;  2YRX A;  4RNM A;  1ZET A;  1S10 A;  4YHH H;  3G6V A;  1RK5 A;  2V59 A;  4YR0 A;  5L1K A;  3TIN A;  3MR2 A;  2GPS A;  4NXN H;  3GIL A;  1UNN C;  1R9T A;  5KFT A;  1Z2O X;  4PWQ A;  3T5J A;  2QYZ A;  3C0F B;  4JI5 H;  2W6O A;  2VUM G;  3GTK A;  1V4Y A;  4UCU A;  5HBR B;  1KJQ A;  2DZD A;  4MV7 A;  3LML A;  3M9O B;  3VPD A;  4EYH B;  4A3J G;  3OTO H;  1HNZ H;  3MR5 A;  4A3M G;  1S0N A;  3T1Y H;  2HGS A;  5KFU A;  3V6H A;  5LYJ F;  4J9O A;  3N6X A;  2NVX A;  3OSN A;  3FKI G;  1J5E H;  4IWY A;  5DLF A;  3U9S A;  2ALZ A;  4RB0 A;  4ETS A;  4M9U A;  4DLK A;  3H40 A;  2VR1 A;  2ASJ A;  4HNV A;  3U9T A;  3TII A;  4JI1 H;  5DGA A;  2NVY A;  4Q45 A;  1VBH A;  5KFO A;  2UUA H;  3V6K A;  5KFD A;  5KFI A;  3JZI A;  2V58 A;  3FKI A;  3TIG A;  5C5J A;  3K5I A;  4EBD A;  4XZ3 B;  3EPG A;  1W93 A;  3V4Z A;  2CW7 A;  1GLV A;  3Q1K A;  5KG2 A;  5T14 A;  2W9C A;  4ECT A;  1OWT A;  2JA5 G;  2XCA A;  5KFB A;  1E4E A;  2JA7 G;  4DR5 H;  5KFX A;  3HBL A;  1KJ9 A;  4Q8E A;  2I8C A;  3KHL A;  2C00 A;  3TQT A;  4IRD A;  5IT9 W;  5EWF A;  2E2I A;  5DGB A;  3OUZ A;  1Z2P X;  4EGJ A;  2YS7 A;  1UC9 A;  2W6Z A;  3PW7 A;  4IZO A;  4DR6 H;  1V9P A;  1T36 A;  3MWD A;  5KFJ A;  4DV4 H;  3GTJ A;  5KFV A;  2DWC A;  2JA5 A;  5KT3 A;  4YBZ B;  4ZHQ F;  1BGW A;  4Q0Y A;  5IYB G;  2JA7 A;  4MV3 A;  4A3G G;  5JVD F;  3OSP A;  5I47 A;  2FE3 A;  2WDT A;  1C3O A;  2WE6 A;  3HOV G;  1IBM H;  3GV7 B;  3RB4 A;  2XGQ A;  4MAM A;  5C8Y F;  3HKZ E;  3N43 B;  5KFA A; 
#chains in the Genus database with same CATH homology
 3KAJ A;  1E4G T;  1MZB A;  4LF4 H;  4IAJ A;  4LF5 H;  4RB1 A;  2VPS A;  4X66 H;  3T1H H;  1X9N A;  3MWM A;  2HHH H;  2F4V H;  4LMY A;  3JSL A;  4GLX A;  1XDN A;  1E4F T;  1IBK H;  1I94 H;  1FJG H;  4JV5 H;  5FD5 A;  2VQF H;  1DGS A;  4EEQ A;  3RJ0 A;  4DV2 H;  5BR8 H;  2VOB A;  5LMU H;  2MCT A;  1N33 H;  4RAZ A;  4LH6 A;  4CC5 A;  3UQ8 A;  4RAY A;  1HNW H;  4JYA H;  4B3T H;  2UUC H;  3RIZ A;  3J81 W;  4JI7 H;  3H20 A;  3KAK A;  2RGV A;  2ZJT A;  4EFE A;  4B3S H;  4CC6 A;  2UUB H;  4MV9 A;  1IBL H;  2UXC H;  1ZHQ A;  5D1O A;  4RB3 C;  1M0W A;  1XMQ H;  2UU9 H;  4EFB A;  4MTD A;  2RGR A;  3BA9 A;  5LL6 b;  3RTX A;  1N36 H;  4JI6 H;  4LF7 H;  4UCV A;  2Q2T A;  3N44 B;  1ZHS A;  5EOY A;  1SYX B;  3BAB A;  2YCH A;  4I7H A;  3RGZ A;  4DUY H;  4X62 H;  4DV5 H;  3PN1 A;  4AQY H;  2VQE H;  4OX9 H;  3BAA A;  5FD6 A;  3BA8 A;  4UCO A;  4R7R A;  3N42 B;  4LF8 H;  4GKK H;  1I6U A;  4JI2 H;  1S03 G;  4DV3 H;  4UCS A;  3N41 B;  2E5L H;  4GKJ H;  1AN7 A;  3RF2 A;  4APM A;  4X65 H;  4JI0 H;  4YHH H;  4RZQ A;  5IWA H;  5FLX W;  4JI8 H;  3JSN A;  4FM9 A;  4PDB A;  3L4J A;  1M0T A;  4NXN H;  5FPR A;  1Z2O X;  4NXM H;  4LH7 A;  4BWS C;  4UCT A;  3DF7 A;  4DR7 H;  2VUG A;  3L4K A;  3C0F B;  4A2B A;  5A2Q W;  4JI5 H;  1WH2 A;  4UCU A;  3N40 P;  4YY3 H;  4LF6 H;  4MV7 A;  1VS0 A;  3FMA A;  3LML A;  1Z2N X;  1HR0 H;  4LFB H;  3OTO H;  1HNZ H;  3F8N A;  3T1Y H;  2HGS A;  4RB2 C;  2OWO A;  3KAL A;  4DR4 H;  3N6X A;  2HVS A;  3M4I A;  1J5E H;  4DR3 H;  2Q2U A;  3J7A K;  4DV6 H;  4JI3 H;  1P8L A;  4RB0 A;  4ETS A;  4B3M H;  2UXB H;  1GYF A;  5D1O B;  3JAM W;  1A0I A;  4JI1 H;  4DV1 H;  2HVR A;  2ZM6 H;  1N32 H;  1O75 A;  2UUA H;  1FKA H;  1XMO H;  3EYY A;  4B3R H;  4JI4 H;  4X64 H;  2CW7 A;  4DV0 H;  4MTE A;  3IG0 A;  4DR5 H;  2UXD H;  1L2Z A;  2HVQ A;  2O03 A;  2W57 A;  5IT9 W;  1SEI A;  5LMN H;  1Z2P X;  4UCR A;  1TA8 A;  4J0M A;  4DR6 H;  4KHP H;  1V9P A;  1XNR H;  4DV4 H;  1S68 A;  4M7E A;  4DR1 H;  3KXY T;  4DUZ H;  4DR2 H;  5D1P A;  1HNX H;  1BGW A;  4Q0Y A;  3K3V A;  1N34 H;  4LF9 H;  4LSX A;  2XIG A;  2CW8 A;  3HXL A;  2FE3 A;  1FVI A;  2WDT A;  4A2A A;  4LFC H;  4K0K H;  1B04 A;  2WE6 A;  1BJT A;  3J80 W;  1TAE A;  3L2P A;  3RGX A;  4LSA A;  1IBM H;  4LFA H;  2WYO A;  4DV7 H;  1XNQ H;  3CVZ A;  2KSW A;  5FPO A;  4UFZ A;  3N43 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...