3M4IA

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 1.95 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
190
Chain Sequence
b'TDPRKSELYVVEGDSAGMFQAILPLRGRIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
molecule tags Isomerase
source organism Mycobacterium tuberculosis
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
total genus 60
structure length 190
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3m4iA02
2ZJTA 3M4IA 3IG0A
chains in the Genus database with same CATH superfamily
1CS0A 2RGVA 1R9TA 2FK3A 2C2EA 2XCLA 3HOYG 3PO2G 2ZDHA 4J9LA 1Y14B 3K5IA 3OUZA 5FLXW 4ED3A 2IBKA 2UVWA 2WAQA 2W9CB 1Y1WG 3GILA 2YZNA 1K83A 3HOVG 5KFMA 4C5AA 5KFTA 5IYZF 4ECTA 3HKZA 4MA5A 1SYXB 4ED6A 5C4XG 3GIPA 3FKIG 1FJGH 4LF8H 3V4SA 4B3RH 1ZHSA 4YR2A 4ED7A 1MZBA 2V4RA 4DR7H 4E4TA 4Q0YA 4BY7G 3J7AK 3BG5A 2ASDA 4IWYA 4JV5H 4RNOA 5L1LA 4IR1A 4IRKA 1IOVA 3M9NB 3PZPA 4DR4H 2C22A 4F4YA 3EPGA 2R84A 3H0GG 4A93G 3G6VA 4EFBA 4QWEA 4A3BG 5KG0A 2FJZA 4F50A 3BAAA 4J9KA 3BQ2A 1UC8A 1VKZA 3ETHA 1IBLH 4RZRA 5JQWA 2YW2A 3MWEA 3N44B 4MV6A 3Q8RB 4ECUA 4DR1H 3WNZA 4OX9H 1IOWA 2UVRA 5KFYA 5KFHA 4ED8A 2WB1E 2MCTA 3TQ1A 3OHBA 4R8UA 4YB8B 3QFFA 4BY1G 3RUPA 4XZ3B 4DV5H 4O3NA 4B3SH 2W9BB 4DV6H 4RZQA 5F9LA 3R5FA 2R7LA 5IP7G 3JSLA 5CB4F 4DR5H 2NU9B 4ZI7F 3N6XA 4UCSA 3E5NA 1W96A 4O3RA 4JI8H 3IN5A 3KHLA 2V58A 4EEYA 4LFCH 2HVSA 2DIKA 1BXRA 4NXMH 3GTLA 4DUYH 4RUAA 5J2UF 5KKNB 2YRXA 3V6HA 1M0WA 4F4ZA 2IMWP 4JI0H 1DGSA 3K3VA 4EYHB 2R92G 2YS7A 2XD4A 5I47A 4MTEA 2PMZE 4RB2C 4UCTA 5HBRB 3QZ8A 1PX2A 4Q8EA 2FK2A 2PMZA 4JI1H 2UXDH 2W57A 3OHAA 3PO3G 5KT6A 4DV1H 4A3IG 1TA8A 2R6FA 4IRCA 1EZ1A 1SCUB 4ME6A 3Q1KA 2V5AA 2VPSA 5CAEB 5LMUH 3PW4A 3V6KA 1V4YA 4HNTA 2W6MA 3QZ7A 1K1QA 4O2AF 3GIJA 2R8KA 4A3CG 4Q43A 2UXBH 2ZJTA 4JI5H 4YAJB 3GQCA 2R7ZA 2XIGA 5KG3A 4EGQA 1CQIB 5IYDG 2W9BA 5DQGA 3RBEA 2VA2A 5BMVF 4QWDA 3GV8B 4Q44A 2J6UA 5IYCG 5C1PA 5FLMG 1C3OA 1UNNC 4YJ3F 2HHHH 3RF2A 2WDTA 4F4XA 4UCRA 5CA0F 5KFOA 5IYBG 5T14A 3HOZG 4MV1A 3GTGA 3M4IA 3PN1A 2IA6A 4X66H 1N32H 5C8YF 2CZGA 3MFIA 1TWAA 2GPSA 2C2DA 4HQ6A 4UCOA 3T5JA 4DL6A 2R92A 4FS2A 2I87A 3RGXA 1TWCA 5KG2A 4ECRA 4LF9H 4TV8F 1GSOA 5HV6A 3H4DA 5D1PA 2JEFA 4EBEA 1JXLA 1EHIA 5KFZA 4ETSA 4LSAA 2JA6A 2JEGA 3TQTA 2KSWA 1T3NA 4JV2A 4YAKB 3L4KA 2R86A 2XGPA 2ZM6H 4JI2H 4YQWA 5EZYF 4A3MG 4BWSC 1IBKH 3F8NA 4CC5A 2CW8A 4QWBA 3KAKA 4RAYA 4EYIB 3T5LA 1PK8A 5KFWA 2Q2UA 1E4GT 4FBUA 2FKLA 2VUGA 3WO0A 5DLGA 5KFJA 4TQRA 2W9AA 5FJ8G 5EDWA 2C28A 4JYAH 2W6OA 4M7EA 3R5XA 5IWAH 4J0MA 5KG7A 3OSNA 5EWFA 2W6QA 1Z2OX 1KJIA 5IT9W 3EYYA 3JAMW 3ETJA 3GV7B 2WYOA 4O3QA 2HJWA 2JA7A 2YYAA 2OH2A 2C35B 3RJ0A 4O2BF 3RIZA 4HYKA 4UFZA 5C3EG 3MWMA 1GLVA 4F4WA 3GIDA 4FBTA 2AGOA 2JA5G 2F4VH 1N33H 4EFEA 5KFAA 5FPOA 5DLFA 1HNXH 2W9CA 4MV3A 4JUZA 2W7OA 1S9FA 5KFEA 2I8CA 5DQIA 4DL5A 5LOVF 3N40P 3MR3A 4ECVA 2FPIB 3J80W 3PVXA 1GSHA 3HXLA 3JSNA 3OUUA 2CW7A 1AN7A 1K1SA 3FDSA 5JVLA 4MAMA 3GTMA 5KFDA 4GKJH 5F9NA 3L4JA 2JA6G 4YR3A 1TWHA 3T5HA 5LXTF 2UUAH 3GTPA 1TWFA 3LWBA 3GIQA 5DG9A 3NGDA 3KHGA 4LH6A 2R8JA 2ASLA 5KT3A 5KFGA 4A3EG 3VPBA 1ZETA 5L1IA 4DV4H 3ORQA 5LP6F 2AGPA 1BNCA 4I55F 2AGQA 2W7PA 3SI8A 4I7HA 5KFVA 4AYBE 2NVXA 4A2BA 5FD6A 3RAXA 1V51A 3FMAA 4O3OA 4J9OA 2HGSA 4C5CA 2C00A 5J2TF 3JZIA 2FP4B 3RB6A 4IR9A 2R93A 2WTFA 1CE8A 3BJYA 1N36H 4QIWA 3PW2A 3GTQA 4HNUA 1OWTA 2BQRA 2J6TA 4MTDA 3PW5A 2V9WA 1FKAH 4MV7A 1RYRA 4EBDA 5KFLA 3CQZA 3MR6A 2WB1A 2NU8B 1S0MA 5D1OB 3VPCA 5KX5F 2SCUB 4RB1A 5FPRA 2UVVA 1S0NA 3PR4A 1KJQA 2WAQE 5KFNA 5EOYA 3Q8QB 1JIHA 4BBSG 5EWGA 2AQ4A 2QYZA 3UFXB 3MR5A 1IBMH 3HB9A 3ORRA 1WH2A 3GIKA 3SE7A 4RU9A 1AUXA 2W70A 1I7LA 3K3PA 4ECYA 1Y1WA 4J9SA 3PW7A 4EEQA 3IG0A 2YL2A 1J5EH 4RAZA 1KJ8A 1FVIA 1V9PA 2R8GA 5KFBA 4LF6H 1GO3E 2FMAA 1WR2A 2YZGA 4C5BA 1DIKA 4YP3A 3N43B 3M9OB 1RK6A 2XGQA 2VOBA 4M9UA 1JKJB 4EG0A 2WE6A 2O03A 1M6VA 2E2IA 4YR0A 3KXYT 4KHPH 2R85A 3TIGA 5LA6F 5KT7A 2UU9H 4DR2H 3H3VH 5LYJF 4ZQIA 1B04A 4PWQA 4JV0A 2GLTA 5KFRA 5CA1F 1S97A 4DV3H 3MWDA 5LMNH 2ATLA 1BGWA 3GTJA 5DQHA 5JUMA 5KFCA 4RNMA 2R7MA 2R93G 5KFXA 1ZQ7A 4DR6H 2HVQA 2W6ZA 3HKZE 3R23A 4QJFA 4LH7A 1T94A 4J9NA 2YZMA 2UXCH 3GIMA 3VPDA 4Q8FA 3FKIA 4X62H 3WO1A 2JEIA 4LF4H 2CKZB 4FU0A 1JLLB 3KHRA 3T1YH 4MV9A 1B6RA 3I12A 3RB0A 4GLXA 2DZDA 2FPGB 2FK1A 1BJTA 2CQYA 4I50F 3H40A 5KFQA 1KEEA 3U9SA 1A9XA 4ECWA 2RGRA 2M05A 2JA8G 5DG7A 3T5KA 1RJQA 1JDBB 1A0IA 3Q2OA 3RAQA 3HBLA 5FD5A 3TIIA 1C30A 1GSAA 3G6XA 4A3JG 4K0KH 1KJ9A 1S68A 2IP4A 4C2MA 2OLSA 2FE3A 2XCPA 2PN1A 5H80A 2YS6A 4DL2A 4DR3H 4JI6H 4EGJA 4LF5H 5BR8H 2PVPA 4QWCA 1JX4A 1I7NA 2J9GA 1X9NA 1HNZH 4TQSA 2UUCH 2DWCA 5KT4A 3MR2A 2V4QA 4O4IF 4RB3C 4A3DG 4MA0A 2VUMA 2RDJA 2JA7G 1VBHA 2RDIA 4DL4A 5KT5A 2B63A 1I50A 5DGAA 2P0AA 4RUCA 3M9MB 1AUVA 4HNVA 3N41B 2E2HA 4YJ2F 4PDBA 2NU7B 5KFPA 4YY3H 1S03G 4DL7A 3V4ZA 1P8LA 2R7NA 2JA5A 4YBZB 1N56A 2VQDA 1SFOA 2FLPA 2NU6B 1I3QA 4U7CA 2DPIA 4LF7H 1I94H 1CQJB 5KFSA 3GTKA 1S10A 2ZDGA 4JI7H 3RB3A 1Z2PX 1T36A 5JH7F 4ZOLF 5LL6b 2E5LH 2GPWA 3KAJA 3MJFA 3OSPA 2FPPB 4XYMB 4ECSA 3BABA 2VR1A 4ZHQF 5IP9G 5DGBA 4J9RA 4A3LG 3C0FB 4ECZA 3N42B 2XC9A 3GV5B 4TV9F 1EUDB 4LFBH 4HR7A 1E4FT 4IAJA 2ZDQA 4IWXA 5D8DA 2AU0A 1GYFA 3RFCA 2QK4A 1GGOA 2R7ZG 1L2ZA 1TAEA 4AYBA 3HOUG 4J9MA 4O3SA 5BPFA 3RGZA 3BQ0A 4QIWE 4DUZH 3RBDA 2YCHA 5KFFA 1EUCB 4QW9A 5L9XA 3BA8A 5KFKA 3I4MG 2W8LA 4WD3A 2NUAB 1TWGA 5DG8A 1B33N 2VA3A 4MV4A 4RB0A 5C1OA 4YHHH 3GIIA 1N34H 3RV3A 4ECXA 3V6JA 1WCMA 2R87A 1WSCA 3MFHA 4IRDA 4A3GG 3HOXG 4GKKH 1ULZA 1Z2NX 4O4LF 1W93A 4XYLB 4DV0H 3TINA 2Q2TA 2YRWA 2DLNA 3KTMA 4B3TH 4I4TF 2R7KA 4UCUA 1VBGA 3GLKA 3RB4A 4O3PA 1VS0A 1ZHQA 2BR0A 1XNQH 3OTOH 2Y0SA 3UQ8A 3PR5B 5K2MA 5A2QW 5L1JA 1RJRA 4DL3A 4A3FG 3RV4A 2Y0SE 3JRWA 4CC6A 4RNNA 4DV7H 2NVYA 4ECQA 4BXXG 4ED0A 4GC6A 4NXNH 3DF7A 5EWEA 2ALZA 1EYZA 3PW0A 2OWOA 2R82A 1XDNA 3H20A 3U9TA 1RJPA 4NLGA 4B3MH 3BA9A 4IZOA 2VPQA 2BQUA 3KHHA 3KALA 3EPIA 3K5HA 2UVUA 1WCMG 4IHJF 2RF4A 4A3KG 1I6UA 4JI4H 4LFAH 2UUBH 4X65H 1HNWH 1RK5A 2V59A 2W8KA 1VAJA 1Y1VG 1SEIA 4MV8A 4R8UB 4LSXA 4Y8VB 3RTXA 4JI3H 1UC9A 4BBRG 4ED1A 1E4EB 3J81W 3LMLA 2JEJA 1S0OA 1XNRH 2ASJA 1JDEA 2PBZA 4J9PA 2XCAA 4J9QA 2YU9A 4O4HF 3R5HA 3T1HH 4DLKA 1KBLA 4FM9A 2J6SA 3VMMA 4DV2H 2VQEH 3AYHB 2DPJA 5BPHA 1M7JA 1O75A 1DV1A 5KG5A 2R8IA 2FLNA 4Q45A 1B6SA 3BQ1A 5D1OA 4G3IA 2B63G 4GC7A 1DV2A 2W71A 4QW8A 1KC7A 2W6PA 3Q8SB 4JV1A 1E4EA 4U6PA 2C2RA 3LP8A 5GONF 5KFIA 3N8DA 4R7RA 4TUYF 5KG6A 4A2AA 2FLLA 5KG1A 5C5JA 3Q8PB 4XX0B 4FS1A 1HR0H 2BQ3A 4APMA 5KG4A 3H0GA 4WBNF 4X64H 5L1KA 1XMOH 2X0SA 4QWAA 4LMYA 5KT2A 1N48A 5C44G 2VUMG 3I4NG 1XMQH 2R8HA 2FB9A 5JVDF 4EBCA 4ED2A 4UCVA 4L1KA 1M0TA 2I80A 3CVZA 3L2PA 5KFUA 3JRXA 3HOWG 4AQYH 2VQFH 3GTOA 3G8CA 3H4BA 1KJJA 2W6NA 1Y1VA 2HVRA 1RYSA 3G6YA
chains in the Genus database with same CATH topology
4X66H 4RAZA 2RGVA 3BA8A 1N32H 1FVIA 1V9PA 4LF6H 3N43B 4RB0A 5FLXW 4YHHH 2VOBA 1N34H 2WE6A 2O03A 4UCOA 3KXYT 4KHPH 3RGXA 2UU9H 4DR2H 4LF9H 1SYXB 1B04A 4GKKH 5D1PA 1FJGH 4LF8H 4DV3H 1Z2NX 5LMNH 1BGWA 4B3RH 4ETSA 4LSAA 4DV0H 1ZHSA 4DR6H 2HVQA 2UXCH 2KSWA 1MZBA 4LH7A 2Q2TA 4DR7H 4Q0YA 3L4KA 4X62H 2ZM6H 4B3TH 3J7AK 4JI2H 1IBKH 4JV5H 4BWSC 4LF4H 3F8NA 3T1YH 4UCUA 4CC5A 2CW8A 4DR4H 3KAKA 4MV9A 4RAYA 1VS0A 1ZHQA 1XNQH 3OTOH 4GLXA 3UQ8A 1BJTA 4EFBA 5A2QW 2Q2UA 1E4GT 2VUGA 3BAAA 2RGRA 4JYAH 4CC6A 4M7EA 4DV7H 1A0IA 4J0MA 5IWAH 1IBLH 1Z2OX 5FD5A 5IT9W 3EYYA 4NXNH 3JAMW 4K0KH 2WYOA 3DF7A 3N44B 1S68A 2OWOA 2FE3A 4DR1H 4OX9H 1XDNA 3RJ0A 3H20A 3RIZA 4UFZA 4B3MH 3BA9A 4JI6H 4DR3H 2MCTA 3MWMA 5BR8H 4DV5H 4LF5H 1N33H 2F4VH 4EFEA 1X9NA 4DV6H 1HNZH 3KALA 4RZQA 2UUCH 5FPOA 1HNXH 4B3SH 4LFAH 3JSLA 3N40P 4RB3C 4DR5H 1I6UA 1J5EH 4JI4H 3J80W 3N6XA 3HXLA 3JSNA 2UUBH 4UCSA 4X65H 1HNWH 2CW7A 1AN7A 1SEIA 4JI8H 4LSXA 4LFCH 2HVSA 3RTXA 4JI3H 4GKJH 3L4JA 4NXMH 2UUAH 3N41B 3LMLA 3J81W 4DUYH 4LH6A 1XNRH 4PDBA 4YY3H 1S03G 4JI0H 1M0WA 1P8LA 1DGSA 3K3VA 4DV4H 3T1HH 4FM9A 4MTEA 4RB2C 4UCTA 4I7HA 4LF7H 4A2BA 5FD6A 4DV2H 1I94H 3FMAA 4JI1H 2UXDH 2W57A 2VQEH 2HVRA 2HGSA 4DV1H 1O75A 4JI7H 1TA8A 5D1OA 1Z2PX 2VPSA 5LMUH 5LL6b 2E5LH 1N36H 3KAJA 4MTDA 1FKAH 4R7RA 4MV7A 4A2AA 2UXBH 2ZJTA 3BABA 4JI5H 2XIGA 3C0FB 5D1OB 1HR0H 3N42B 4APMA 4X64H 4RB1A 1XMOH 5FPRA 4LMYA 4LFBH 1E4FT 4IAJA 1XMQH 1L2ZA 1GYFA 1TAEA 5EOYA 4UCVA 3RF2A 2HHHH 2WDTA 4UCRA 3RGZA 1M0TA 3CVZA 3L2PA 1IBMH 4DUZH 1WH2A 2VQFH 4AQYH 2YCHA 3M4IA 3PN1A 4EEQA 3IG0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJT A;  3M4I A;  3IG0 A; 
#chains in the Genus database with same CATH topology
 1CS0 A;  2RGV A;  1R9T A;  2FK3 A;  2C2E A;  2XCL A;  3HOY G;  3PO2 G;  2ZDH A;  4J9L A;  1Y14 B;  3K5I A;  3OUZ A;  5FLX W;  4ED3 A;  2IBK A;  2UVW A;  2WAQ A;  2W9C B;  1Y1W G;  3GIL A;  2YZN A;  1K83 A;  3HOV G;  5KFM A;  4C5A A;  5KFT A;  5IYZ F;  4ECT A;  3HKZ A;  4MA5 A;  1SYX B;  4ED6 A;  5C4X G;  3GIP A;  3FKI G;  1FJG H;  4LF8 H;  3V4S A;  4B3R H;  1ZHS A;  4YR2 A;  4ED7 A;  1MZB A;  2V4R A;  4DR7 H;  4E4T A;  4Q0Y A;  4BY7 G;  3J7A K;  3BG5 A;  2ASD A;  4IWY A;  4JV5 H;  4RNO A;  5L1L A;  4IR1 A;  4IRK A;  1IOV A;  3M9N B;  3PZP A;  4DR4 H;  2C22 A;  4F4Y A;  3EPG A;  2R84 A;  3H0G G;  4A93 G;  3G6V A;  4EFB A;  4QWE A;  4A3B G;  5KG0 A;  2FJZ A;  4F50 A;  3BAA A;  4J9K A;  3BQ2 A;  1UC8 A;  1VKZ A;  3ETH A;  1IBL H;  4RZR A;  5JQW A;  2YW2 A;  3MWE A;  3N44 B;  4MV6 A;  3Q8R B;  4ECU A;  4DR1 H;  3WNZ A;  4OX9 H;  1IOW A;  2UVR A;  5KFY A;  5KFH A;  4ED8 A;  2WB1 E;  2MCT A;  3TQ1 A;  3OHB A;  4R8U A;  4YB8 B;  3QFF A;  4BY1 G;  3RUP A;  4XZ3 B;  4DV5 H;  4O3N A;  4B3S H;  2W9B B;  4DV6 H;  4RZQ A;  5F9L A;  3R5F A;  2R7L A;  5IP7 G;  3JSL A;  5CB4 F;  4DR5 H;  2NU9 B;  4ZI7 F;  3N6X A;  4UCS A;  3E5N A;  1W96 A;  4O3R A;  4JI8 H;  3IN5 A;  3KHL A;  2V58 A;  4EEY A;  4LFC H;  2HVS A;  2DIK A;  1BXR A;  4NXM H;  3GTL A;  4DUY H;  4RUA A;  5J2U F;  5KKN B;  2YRX A;  3V6H A;  1M0W A;  4F4Z A;  2IMW P;  4JI0 H;  1DGS A;  3K3V A;  4EYH B;  2R92 G;  2YS7 A;  2XD4 A;  5I47 A;  4MTE A;  2PMZ E;  4RB2 C;  4UCT A;  5HBR B;  3QZ8 A;  1PX2 A;  4Q8E A;  2FK2 A;  2PMZ A;  4JI1 H;  2UXD H;  2W57 A;  3OHA A;  3PO3 G;  5KT6 A;  4DV1 H;  4A3I G;  1TA8 A;  2R6F A;  4IRC A;  1EZ1 A;  1SCU B;  4ME6 A;  3Q1K A;  2V5A A;  2VPS A;  5CAE B;  5LMU H;  3PW4 A;  3V6K A;  1V4Y A;  4HNT A;  2W6M A;  3QZ7 A;  1K1Q A;  4O2A F;  3GIJ A;  2R8K A;  4A3C G;  4Q43 A;  2UXB H;  2ZJT A;  4JI5 H;  4YAJ B;  3GQC A;  2R7Z A;  2XIG A;  5KG3 A;  4EGQ A;  1CQI B;  5IYD G;  2W9B A;  5DQG A;  3RBE A;  2VA2 A;  5BMV F;  4QWD A;  3GV8 B;  4Q44 A;  2J6U A;  5IYC G;  5C1P A;  5FLM G;  1C3O A;  1UNN C;  4YJ3 F;  2HHH H;  3RF2 A;  2WDT A;  4F4X A;  4UCR A;  5CA0 F;  5KFO A;  5IYB G;  5T14 A;  3HOZ G;  4MV1 A;  3GTG A;  3M4I A;  3PN1 A;  2IA6 A;  4X66 H;  1N32 H;  5C8Y F;  2CZG A;  3MFI A;  1TWA A;  2GPS A;  2C2D A;  4HQ6 A;  4UCO A;  3T5J A;  4DL6 A;  2R92 A;  4FS2 A;  2I87 A;  3RGX A;  1TWC A;  5KG2 A;  4ECR A;  4LF9 H;  4TV8 F;  1GSO A;  5HV6 A;  3H4D A;  5D1P A;  2JEF A;  4EBE A;  1JXL A;  1EHI A;  5KFZ A;  4ETS A;  4LSA A;  2JA6 A;  2JEG A;  3TQT A;  2KSW A;  1T3N A;  4JV2 A;  4YAK B;  3L4K A;  2R86 A;  2XGP A;  2ZM6 H;  4JI2 H;  4YQW A;  5EZY F;  4A3M G;  4BWS C;  1IBK H;  3F8N A;  4CC5 A;  2CW8 A;  4QWB A;  3KAK A;  4RAY A;  4EYI B;  3T5L A;  1PK8 A;  5KFW A;  2Q2U A;  1E4G T;  4FBU A;  2FKL A;  2VUG A;  3WO0 A;  5DLG A;  5KFJ A;  4TQR A;  2W9A A;  5FJ8 G;  5EDW A;  2C28 A;  4JYA H;  2W6O A;  4M7E A;  3R5X A;  5IWA H;  4J0M A;  5KG7 A;  3OSN A;  5EWF A;  2W6Q A;  1Z2O X;  1KJI A;  5IT9 W;  3EYY A;  3JAM W;  3ETJ A;  3GV7 B;  2WYO A;  4O3Q A;  2HJW A;  2JA7 A;  2YYA A;  2OH2 A;  2C35 B;  3RJ0 A;  4O2B F;  3RIZ A;  4HYK A;  4UFZ A;  5C3E G;  3MWM A;  1GLV A;  4F4W A;  3GID A;  4FBT A;  2AGO A;  2JA5 G;  2F4V H;  1N33 H;  4EFE A;  5KFA A;  5FPO A;  5DLF A;  1HNX H;  2W9C A;  4MV3 A;  4JUZ A;  2W7O A;  1S9F A;  5KFE A;  2I8C A;  5DQI A;  4DL5 A;  5LOV F;  3N40 P;  3MR3 A;  4ECV A;  2FPI B;  3J80 W;  3PVX A;  1GSH A;  3HXL A;  3JSN A;  3OUU A;  2CW7 A;  1AN7 A;  1K1S A;  3FDS A;  5JVL A;  4MAM A;  3GTM A;  5KFD A;  4GKJ H;  5F9N A;  3L4J A;  2JA6 G;  4YR3 A;  1TWH A;  3T5H A;  5LXT F;  2UUA H;  3GTP A;  1TWF A;  3LWB A;  3GIQ A;  5DG9 A;  3NGD A;  3KHG A;  4LH6 A;  2R8J A;  2ASL A;  5KT3 A;  5KFG A;  4A3E G;  3VPB A;  1ZET A;  5L1I A;  4DV4 H;  3ORQ A;  5LP6 F;  2AGP A;  1BNC A;  4I55 F;  2AGQ A;  2W7P A;  3SI8 A;  4I7H A;  5KFV A;  4AYB E;  2NVX A;  4A2B A;  5FD6 A;  3RAX A;  1V51 A;  3FMA A;  4O3O A;  4J9O A;  2HGS A;  4C5C A;  2C00 A;  5J2T F;  3JZI A;  2FP4 B;  3RB6 A;  4IR9 A;  2R93 A;  2WTF A;  1CE8 A;  3BJY A;  1N36 H;  4QIW A;  3PW2 A;  3GTQ A;  4HNU A;  1OWT A;  2BQR A;  2J6T A;  4MTD A;  3PW5 A;  2V9W A;  1FKA H;  4MV7 A;  1RYR A;  4EBD A;  5KFL A;  3CQZ A;  3MR6 A;  2WB1 A;  2NU8 B;  1S0M A;  5D1O B;  3VPC A;  5KX5 F;  2SCU B;  4RB1 A;  5FPR A;  2UVV A;  1S0N A;  3PR4 A;  1KJQ A;  2WAQ E;  5KFN A;  5EOY A;  3Q8Q B;  1JIH A;  4BBS G;  5EWG A;  2AQ4 A;  2QYZ A;  3UFX B;  3MR5 A;  1IBM H;  3HB9 A;  3ORR A;  1WH2 A;  3GIK A;  3SE7 A;  4RU9 A;  1AUX A;  2W70 A;  1I7L A;  3K3P A;  4ECY A;  1Y1W A;  4J9S A;  3PW7 A;  4EEQ A;  3IG0 A;  2YL2 A;  1J5E H;  4RAZ A;  1KJ8 A;  1FVI A;  1V9P A;  2R8G A;  5KFB A;  4LF6 H;  1GO3 E;  2FMA A;  1WR2 A;  2YZG A;  4C5B A;  1DIK A;  4YP3 A;  3N43 B;  3M9O B;  1RK6 A;  2XGQ A;  2VOB A;  4M9U A;  1JKJ B;  4EG0 A;  2WE6 A;  2O03 A;  1M6V A;  2E2I A;  4YR0 A;  3KXY T;  4KHP H;  2R85 A;  3TIG A;  5LA6 F;  5KT7 A;  2UU9 H;  4DR2 H;  3H3V H;  5LYJ F;  4ZQI A;  1B04 A;  4PWQ A;  4JV0 A;  2GLT A;  5KFR A;  5CA1 F;  1S97 A;  4DV3 H;  3MWD A;  5LMN H;  2ATL A;  1BGW A;  3GTJ A;  5DQH A;  5JUM A;  5KFC A;  4RNM A;  2R7M A;  2R93 G;  5KFX A;  1ZQ7 A;  4DR6 H;  2HVQ A;  2W6Z A;  3HKZ E;  3R23 A;  4QJF A;  4LH7 A;  1T94 A;  4J9N A;  2YZM A;  2UXC H;  3GIM A;  3VPD A;  4Q8F A;  3FKI A;  4X62 H;  3WO1 A;  2JEI A;  4LF4 H;  2CKZ B;  4FU0 A;  1JLL B;  3KHR A;  3T1Y H;  4MV9 A;  1B6R A;  3I12 A;  3RB0 A;  4GLX A;  2DZD A;  2FPG B;  2FK1 A;  1BJT A;  2CQY A;  4I50 F;  3H40 A;  5KFQ A;  1KEE A;  3U9S A;  1A9X A;  4ECW A;  2RGR A;  2M05 A;  2JA8 G;  5DG7 A;  3T5K A;  1RJQ A;  1JDB B;  1A0I A;  3Q2O A;  3RAQ A;  3HBL A;  5FD5 A;  3TII A;  1C30 A;  1GSA A;  3G6X A;  4A3J G;  4K0K H;  1KJ9 A;  1S68 A;  2IP4 A;  4C2M A;  2OLS A;  2FE3 A;  2XCP A;  2PN1 A;  5H80 A;  2YS6 A;  4DL2 A;  4DR3 H;  4JI6 H;  4EGJ A;  4LF5 H;  5BR8 H;  2PVP A;  4QWC A;  1JX4 A;  1I7N A;  2J9G A;  1X9N A;  1HNZ H;  4TQS A;  2UUC H;  2DWC A;  5KT4 A;  3MR2 A;  2V4Q A;  4O4I F;  4RB3 C;  4A3D G;  4MA0 A;  2VUM A;  2RDJ A;  2JA7 G;  1VBH A;  2RDI A;  4DL4 A;  5KT5 A;  2B63 A;  1I50 A;  5DGA A;  2P0A A;  4RUC A;  3M9M B;  1AUV A;  4HNV A;  3N41 B;  2E2H A;  4YJ2 F;  4PDB A;  2NU7 B;  5KFP A;  4YY3 H;  1S03 G;  4DL7 A;  3V4Z A;  1P8L A;  2R7N A;  2JA5 A;  4YBZ B;  1N56 A;  2VQD A;  1SFO A;  2FLP A;  2NU6 B;  1I3Q A;  4U7C A;  2DPI A;  4LF7 H;  1I94 H;  1CQJ B;  5KFS A;  3GTK A;  1S10 A;  2ZDG A;  4JI7 H;  3RB3 A;  1Z2P X;  1T36 A;  5JH7 F;  4ZOL F;  5LL6 b;  2E5L H;  2GPW A;  3KAJ A;  3MJF A;  3OSP A;  2FPP B;  4XYM B;  4ECS A;  3BAB A;  2VR1 A;  4ZHQ F;  5IP9 G;  5DGB A;  4J9R A;  4A3L G;  3C0F B;  4ECZ A;  3N42 B;  2XC9 A;  3GV5 B;  4TV9 F;  1EUD B;  4LFB H;  4HR7 A;  1E4F T;  4IAJ A;  2ZDQ A;  4IWX A;  5D8D A;  2AU0 A;  1GYF A;  3RFC A;  2QK4 A;  1GGO A;  2R7Z G;  1L2Z A;  1TAE A;  4AYB A;  3HOU G;  4J9M A;  4O3S A;  5BPF A;  3RGZ A;  3BQ0 A;  4QIW E;  4DUZ H;  3RBD A;  2YCH A;  5KFF A;  1EUC B;  4QW9 A;  5L9X A;  3BA8 A;  5KFK A;  3I4M G;  2W8L A;  4WD3 A;  2NUA B;  1TWG A;  5DG8 A;  1B33 N;  2VA3 A;  4MV4 A;  4RB0 A;  5C1O A;  4YHH H;  3GII A;  1N34 H;  3RV3 A;  4ECX A;  3V6J A;  1WCM A;  2R87 A;  1WSC A;  3MFH A;  4IRD A;  4A3G G;  3HOX G;  4GKK H;  1ULZ A;  1Z2N X;  4O4L F;  1W93 A;  4XYL B;  4DV0 H;  3TIN A;  2Q2T A;  2YRW A;  2DLN A;  3KTM A;  4B3T H;  4I4T F;  2R7K A;  4UCU A;  1VBG A;  3GLK A;  3RB4 A;  4O3P A;  1VS0 A;  1ZHQ A;  2BR0 A;  1XNQ H;  3OTO H;  2Y0S A;  3UQ8 A;  3PR5 B;  5K2M A;  5A2Q W;  5L1J A;  1RJR A;  4DL3 A;  4A3F G;  3RV4 A;  2Y0S E;  3JRW A;  4CC6 A;  4RNN A;  4DV7 H;  2NVY A;  4ECQ A;  4BXX G;  4ED0 A;  4GC6 A;  4NXN H;  3DF7 A;  5EWE A;  2ALZ A;  1EYZ A;  3PW0 A;  2OWO A;  2R82 A;  1XDN A;  3H20 A;  3U9T A;  1RJP A;  4NLG A;  4B3M H;  3BA9 A;  4IZO A;  2VPQ A;  2BQU A;  3KHH A;  3KAL A;  3EPI A;  3K5H A;  2UVU A;  1WCM G;  4IHJ F;  2RF4 A;  4A3K G;  1I6U A;  4JI4 H;  4LFA H;  2UUB H;  4X65 H;  1HNW H;  1RK5 A;  2V59 A;  2W8K A;  1VAJ A;  1Y1V G;  1SEI A;  4MV8 A;  4R8U B;  4LSX A;  4Y8V B;  3RTX A;  4JI3 H;  1UC9 A;  4BBR G;  4ED1 A;  1E4E B;  3J81 W;  3LML A;  2JEJ A;  1S0O A;  1XNR H;  2ASJ A;  1JDE A;  2PBZ A;  4J9P A;  2XCA A;  4J9Q A;  2YU9 A;  4O4H F;  3R5H A;  3T1H H;  4DLK A;  1KBL A;  4FM9 A;  2J6S A;  3VMM A;  4DV2 H;  2VQE H;  3AYH B;  2DPJ A;  5BPH A;  1M7J A;  1O75 A;  1DV1 A;  5KG5 A;  2R8I A;  2FLN A;  4Q45 A;  1B6S A;  3BQ1 A;  5D1O A;  4G3I A;  2B63 G;  4GC7 A;  1DV2 A;  2W71 A;  4QW8 A;  1KC7 A;  2W6P A;  3Q8S B;  4JV1 A;  1E4E A;  4U6P A;  2C2R A;  3LP8 A;  5GON F;  5KFI A;  3N8D A;  4R7R A;  4TUY F;  5KG6 A;  4A2A A;  2FLL A;  5KG1 A;  5C5J A;  3Q8P B;  4XX0 B;  4FS1 A;  1HR0 H;  2BQ3 A;  4APM A;  5KG4 A;  3H0G A;  4WBN F;  4X64 H;  5L1K A;  1XMO H;  2X0S A;  4QWA A;  4LMY A;  5KT2 A;  1N48 A;  5C44 G;  2VUM G;  3I4N G;  1XMQ H;  2R8H A;  2FB9 A;  5JVD F;  4EBC A;  4ED2 A;  4UCV A;  4L1K A;  1M0T A;  2I80 A;  3CVZ A;  3L2P A;  5KFU A;  3JRX A;  3HOW G;  4AQY H;  2VQF H;  3GTO A;  3G8C A;  3H4B A;  1KJJ A;  2W6N A;  1Y1V A;  2HVR A;  1RYS A;  3G6Y A; 
#chains in the Genus database with same CATH homology
 4X66 H;  4RAZ A;  2RGV A;  3BA8 A;  1N32 H;  1FVI A;  1V9P A;  4LF6 H;  3N43 B;  4RB0 A;  5FLX W;  4YHH H;  2VOB A;  1N34 H;  2WE6 A;  2O03 A;  4UCO A;  3KXY T;  4KHP H;  3RGX A;  2UU9 H;  4DR2 H;  4LF9 H;  1SYX B;  1B04 A;  4GKK H;  5D1P A;  1FJG H;  4LF8 H;  4DV3 H;  1Z2N X;  5LMN H;  1BGW A;  4B3R H;  4ETS A;  4LSA A;  4DV0 H;  1ZHS A;  4DR6 H;  2HVQ A;  2UXC H;  2KSW A;  1MZB A;  4LH7 A;  2Q2T A;  4DR7 H;  4Q0Y A;  3L4K A;  4X62 H;  2ZM6 H;  4B3T H;  3J7A K;  4JI2 H;  1IBK H;  4JV5 H;  4BWS C;  4LF4 H;  3F8N A;  3T1Y H;  4UCU A;  4CC5 A;  2CW8 A;  4DR4 H;  3KAK A;  4MV9 A;  4RAY A;  1VS0 A;  1ZHQ A;  1XNQ H;  3OTO H;  4GLX A;  3UQ8 A;  1BJT A;  4EFB A;  5A2Q W;  2Q2U A;  1E4G T;  2VUG A;  3BAA A;  2RGR A;  4JYA H;  4CC6 A;  4M7E A;  4DV7 H;  1A0I A;  4J0M A;  5IWA H;  1IBL H;  1Z2O X;  5FD5 A;  5IT9 W;  3EYY A;  4NXN H;  3JAM W;  4K0K H;  2WYO A;  3DF7 A;  3N44 B;  1S68 A;  2OWO A;  2FE3 A;  4DR1 H;  4OX9 H;  1XDN A;  3RJ0 A;  3H20 A;  3RIZ A;  4UFZ A;  4B3M H;  3BA9 A;  4JI6 H;  4DR3 H;  2MCT A;  3MWM A;  5BR8 H;  4DV5 H;  4LF5 H;  1N33 H;  2F4V H;  4EFE A;  1X9N A;  4DV6 H;  1HNZ H;  3KAL A;  4RZQ A;  2UUC H;  5FPO A;  1HNX H;  4B3S H;  4LFA H;  3JSL A;  3N40 P;  4RB3 C;  4DR5 H;  1I6U A;  1J5E H;  4JI4 H;  3J80 W;  3N6X A;  3HXL A;  3JSN A;  2UUB H;  4UCS A;  4X65 H;  1HNW H;  2CW7 A;  1AN7 A;  1SEI A;  4JI8 H;  4LSX A;  4LFC H;  2HVS A;  3RTX A;  4JI3 H;  4GKJ H;  3L4J A;  4NXM H;  2UUA H;  3N41 B;  3LML A;  3J81 W;  4DUY H;  4LH6 A;  1XNR H;  4PDB A;  4YY3 H;  1S03 G;  4JI0 H;  1M0W A;  1P8L A;  1DGS A;  3K3V A;  4DV4 H;  3T1H H;  4FM9 A;  4MTE A;  4RB2 C;  4UCT A;  4I7H A;  4LF7 H;  4A2B A;  5FD6 A;  4DV2 H;  1I94 H;  3FMA A;  4JI1 H;  2UXD H;  2W57 A;  2VQE H;  2HVR A;  2HGS A;  4DV1 H;  1O75 A;  4JI7 H;  1TA8 A;  5D1O A;  1Z2P X;  2VPS A;  5LMU H;  5LL6 b;  2E5L H;  1N36 H;  3KAJ A;  4MTD A;  1FKA H;  4R7R A;  4MV7 A;  4A2A A;  2UXB H;  2ZJT A;  3BAB A;  4JI5 H;  2XIG A;  3C0F B;  5D1O B;  1HR0 H;  3N42 B;  4APM A;  4X64 H;  4RB1 A;  1XMO H;  5FPR A;  4LMY A;  4LFB H;  1E4F T;  4IAJ A;  1XMQ H;  1L2Z A;  1GYF A;  1TAE A;  5EOY A;  4UCV A;  3RF2 A;  2HHH H;  2WDT A;  4UCR A;  3RGZ A;  1M0T A;  3CVZ A;  3L2P A;  1IBM H;  4DUZ H;  1WH2 A;  2VQF H;  4AQY H;  2YCH A;  3M4I A;  3PN1 A;  4EEQ A;  3IG0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...