3M4IA

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 1.95 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
190
Chain Sequence
TDPRKSELYVVEGDSAGMFQAILPLRGRIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 60
structure length 190
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3m4iA02
3IG0A 2ZJTA 3M4IA
chains in the Genus database with same CATH superfamily
5BR8H 1UC8A 4ED3A 5KG6A 3I4NG 4MA0A 2Y0SA 3V4SA 5KFBA 5KT7A 3L4JA 2AGPA 2IMWP 4UCUA 2IBKA 5FD6A 5KT3A 5L1JA 3KAKA 5FPOA 4C2MA 3BJYA 1S97A 2Q2TA 1HR0H 3VPCA 5J2TF 1I3QA 1TA8A 1T36A 2J6UA 5KFMA 5BPFA 4J9KA 4JV0A 4APMA 3HBLA 2I87A 5FJ8G 2R92A 5JVDF 5KG2A 2JA6G 1TWGA 3MWEA 1K1SA 5KFQA 2J6SA 4GKKH 4A3IG 3MFIA 4Q8FA 1UNNC 1Y14B 2W9CB 3G6XA 1KJ9A 2NVYA 1IBKH 2VQDA 4FBUA 5KFDA 1R9TA 3GTGA 3ORQA 3M4IA 5C8YF 3C0FB 4GC7A 1IOWA 4HNTA 2P0AA 3OTOH 4A3FG 1B6RA 2V58A 3V4ZA 4JI3H 5C4XG 5EWEA 3SI8A 2R82A 3RB6A 4X65H 5KG1A 2WB1A 2R8JA 1KJQA 2C00A 4RB1A 3LP8A 1JXLA 4O2AF 3JZIA 4LSAA 4RZRA 5KFAA 4RNNA 2R7LA 5DG7A 4L1KA 2J9GA 5F9NA 5FD5A 3F8NA 1O75A 2O03A 1EZ1A 2FPGB 3LMLA 5KFHA 1RYSA 1ZHQA 2ZJTA 2FP4B 4J9RA 3HB9A 3PR5B 1JIHA 4ME6A 2V4RA 4YBZB 4AYBA 2XCAA 4J9OA 2ASDA 5IP9G 4LF9H 4DR6H 2C2EA 3VPBA 1XMOH 4A3GG 1V51A 3RV3A 3PZPA 2OWOA 1BGWA 1JX4A 2DPJA 5HV6A 3JSLA 4F4WA 3EYYA 5H80A 2FK1A 2HJWA 4DR4H 1M7JA 3GIJA 4IRKA 5FPRA 4I4TF 4YR0A 2QK4A 3KXYT 2E2IA 5DQHA 1A0IA 4C5BA 5IYBG 5T14A 4DLKA 4U7CA 4O3OA 3KAJA 3RIZA 2XD4A 3HOYG 2R6FA 2J6TA 2FPIB 4MAMA 2R93G 4RAZA 4BBRG 3UQ8A 2W9BB 2FKLA 4NXMH 5KFYA 3H40A 2PN1A 2CQYA 5K2MA 3RB4A 2JEFA 4G3IA 1E4EA 1RK5A 2HVQA 4A2BA 3RJ0A 2VPQA 1SFOA 3H4DA 5EWFA 2RF4A 3RGZA 1I6UA 2YRXA 3NGDA 3BG5A 3M9NB 2NVXA 4LSXA 4DV6H 4ED0A 4UCTA 2UVWA 2WDTA 5CA1F 4CC5A 1GSOA 2MCTA 5KFUA 2ZM6H 4DL4A 4F4ZA 4JV2A 4BY7G 2W6ZA 1N56A 4FU0A 4UCSA 1S10A 5KG4A 4RB2C 5LL6b 4QWCA 4XYLB 3KHGA 2FK2A 2VQFH 2F4VH 2W9CA 3WO1A 5IYZF 1CS0A 4DR2H 2CW7A 4A3EG 5KFIA 3TIGA 5LP6F 4LFBH 1JDBB 4QWBA 1T3NA 5CB4F 2JA7A 3HKZE 5DLGA 2DZDA 3KHRA 4J9MA 4ECRA 4GKJH 2NU7B 3GTJA 1AUXA 4EBDA 2UUBH 5JUMA 4IR9A 3ETJA 1S0OA 4A3DG 1AUVA 2HGSA 4E4TA 4RZQA 5C5JA 5EDWA 3GIMA 4LFAH 1BXRA 1WH2A 4RUCA 2R87A 1C30A 4BY1G 1KEEA 3GILA 3G6YA 4JI7H 3UFXB 1B33N 2SCUB 3J80W 5EWGA 2R8GA 4LF5H 3VPDA 5L9XA 2PVPA 3CVZA 3RBDA 4LH6A 4O3QA 2YZNA 1SEIA 2OLSA 2JA7G 1IBLH 4RNOA 2UXCH 3N40P 4MTDA 4XZ3B 4HNUA 4A3JG 4MV7A 4O4IF 5DG8A 5L1IA 1BNCA 2NU8B 4EG0A 3OSNA 3PVXA 4R8UB 3FMAA 2Q2UA 3SE7A 3H3VH 3J7AK 4JI8H 2WAQE 4GC6A 2GLTA 3T1YH 4UFZA 5KFFA 3QZ8A 4NXNH 5JH7F 5IP7G 5KFXA 1WCMA 2W9BA 1N48A 4JV5H 2VA3A 4J0MA 5KFGA 1CQJB 1KJIA 2W8KA 3RTXA 4TV8F 2WYOA 5I47A 4QWEA 4DL6A 4IAJA 3FKIA 1TWCA 1S68A 2CW8A 3M9MB 1VKZA 4JI2H 1C3OA 2C28A 3L2PA 2AGQA 4LF8H 5J2UF 4DR3H 4A3CG 2UVVA 3GIQA 1GO3E 4QWAA 2RDIA 4QJFA 1KJJA 4M9UA 3HOUG 5KFLA 1Z2PX 4ECYA 2ALZA 1XNRH 4YQWA 3RF2A 1V4YA 4F4XA 2VPSA 3OSPA 5D8DA 3N44B 5C1PA 1S0NA 1HNZH 4A3BG 3H20A 2YZGA 3TIIA 1WCMG 2M05A 2UVRA 3T5HA 3L4KA 1GYFA 2R93A 2KSWA 4RAYA 2VQEH 4LFCH 2PMZA 3FKIG 3MR2A 4EEYA 3HXLA 1JKJB 4PDBA 3R5HA 2FK3A 3QFFA 5FLMG 3EPIA 4DV1H 2DIKA 2HHHH 4A2AA 3OUUA 4J9SA 3ETHA 1M0TA 5DQIA 1VS0A 1W93A 2XGQA 4B3MH 2IP4A 2YS7A 4DV4H 2FLPA 3GIIA 1DV2A 4IRDA 1M0WA 3CQZA 3MJFA 4DL3A 2OH2A 1FVIA 5L1KA 3G6VA 5KFWA 2FMAA 4IWXA 4DV2H 3GV8B 1X9NA 4J9QA 2WTFA 2R84A 2R8IA 4ED1A 1M6VA 2C35B 4ECXA 2NU6B 2W7OA 2BQRA 2JA5G 2W6NA 5C1OA 1JLLB 1P8LA 4DR7H 3PR4A 2W9AA 4MA5A 5GONF 2Y0SE 1B6SA 5CAEB 5KFZA 3KHHA 1I7LA 1FJGH 1S03G 3WO0A 5KFKA 1SYXB 4HR7A 4ZOLF 5D1PA 1DGSA 3K5HA 4R8UA 5KFNA 1Y1VA 4YJ3F 4DV7H 4FM9A 2W6PA 4B3TH 1T94A 3GIPA 2UVUA 3T5LA 3PW5A 1PK8A 2ZDGA 4M7EA 4DV0H 1BJTA 1CQIB 5CA0F 1A9XA 4GLXA 4JI5H 3MR5A 1I50A 4J9NA 1WSCA 5KFJA 4IHJF 2R86A 1N34H 4O3SA 2FPPB 5BMVF 1CE8A 2JEJA 3K5IA 1GSAA 4DR5H 3GQCA 2QYZA 3MWDA 2WB1E 4ED6A 4YR3A 1RK6A 2WE6A 5KT5A 3RAQA 1L2ZA 1RJQA 2JA8G 1UC9A 4HYKA 3JSNA 4DR1H 2GPWA 1ZHSA 4ECVA 2R8KA 4LH7A 1IBMH 1Y1VG 3N41B 1I94H 2RDJA 2YYAA 2HVRA 3Q8SB 2YRWA 4AYBE 3BABA 4TUYF 2BR0A 1RJRA 5FLXW 4O3RA 2CZGA 3PW4A 2W7PA 4O3NA 4RU9A 2ASLA 5F9LA 4BXXG 3R5FA 3H0GA 1E4FT 5A2QW 2R7MA 4X64H 4ECUA 4YAKB 4U6PA 1TWAA 4RB3C 3V6HA 3RB0A 2W71A 4NLGA 4A3MG 3N43B 2C2DA 1S0MA 4JV1A 2V59A 2RGVA 2V5AA 1HNWH 3OUZA 3BQ2A 2VA2A 2VUGA 5LYJF 5LA6F 1XDNA 3JAMW 4ED2A 2YU9A 3KTMA 4O4HF 4A3KG 3JRWA 1XMQH 4FBTA 4YAJB 1N33H 1E4GT 2JEGA 2NUAB 4B3SH 2FJZA 1ULZA 5KFRA 4TV9F 2V9WA 2ZDQA 1GGOA 3N42B 4JUZA 4TQRA 4B3RH 4MV6A 4IZOA 1Y1WA 4ED8A 4JYAH 1SCUB 2R7ZA 3BA9A 3N8DA 3H0GG 4FS1A 2AGOA 4YP3A 2UUAH 4J9LA 2XGPA 4QW8A 2AU0A 5EOYA 3MR6A 5KKNB 2DWCA 1JDEA 2X0SA 5D1OB 3HOXG 4QWDA 2W8LA 1PX2A 5JQWA 3U9SA 1V9PA 5KG7A 4EYHB 2E5LH 3GTKA 1N32H 2JEIA 1J5EH 5KFTA 4XYMB 1FKAH 1ZETA 2UU9H 3V6JA 4A93G 5IYDG 3AYHB 3HOVG 5DG9A 4YHHH 1GLVA 1B04A 3MWMA 4TQSA 4ED7A 2I80A 4QIWE 4Q43A 4IWYA 3OHBA 4IR1A 5KG3A 2YS6A 4LF6H 4ZI7F 1VBGA 3FDSA 2UUCH 5LXTF 4ECTA 4ECWA 2R7NA 3IG0A 3K3VA 5KT2A 3T5KA 4DL7A 1Y1WG 2R7ZG 4MV1A 4BWSC 4YJ2F 3N6XA 2JA5A 3KALA 2B63G 4Q8EA 4WBNF 3Q8PB 4FS2A 3HOZG 4Q0YA 3HOWG 5KG0A 3WNZA 4HQ6A 2PBZA 4JI0H 4O2BF 1EYZA 4MTEA 4QW9A 1MZBA 4UCRA 4MV3A 2V4QA 2BQ3A 4MV9A 2FLNA 3U9TA 2R85A 4X62H 4EEQA 4EBCA 3BAAA 3RUPA 2DLNA 4LMYA 2C22A 3PO2G 5KFPA 4Y8VB 4O4LF 4Q45A 3GTOA 3HKZA 2RGRA 3Q2OA 2XIGA 3GLKA 4MV4A 3DF7A 3ORRA 1AN7A 2CKZB 3VMMA 1TAEA 2R92G 2UXBH 3T5JA 2AQ4A 4ECSA 4ECZA 3QZ7A 4EBEA 3I12A 4R7RA 4DUZH 2ASJA 1S9FA 1OWTA 2FLLA 4JI1H 4EGJA 3IN5A 3PN1A 3Q8QB 5KFEA 4UCOA 4ECQA 4XX0B 4EFEA 4J9PA 5DQGA 3G8CA 3TQ1A 3RAXA 4JI4H 3BQ0A 5DLFA 2R7KA 2VUMA 4KHPH 4RB0A 3MR3A 3MFHA 3H4BA 3GV5B 3T1HH 1RYRA 1EUDB 4RUAA 3TQTA 1ZQ7A 2XCLA 2ZDHA 4X66H 2W6OA 4ZHQF 1VAJA 4Q44A 2W6QA 5DGAA 2YL2A 5IWAH 3RV4A 2C2RA 3JRXA 4LF7H 2FE3A 5IYCG 5D1OA 3BQ1A 3GIKA 3LWBA 2ATLA 2VR1A 3PW7A 2UXDH 3GTLA 1K83A 2WAQA 4C5CA 1KC7A 3RGXA 3TINA 5IT9W 5C44G 4YB8B 5LMNH 1KBLA 4WD3A 5KT6A 4I7HA 4F4YA 1KJ8A 2I8CA 3E5NA 3RB3A 4OX9H 2VUMG 3PW0A 2IA6A 4MV8A 1EHIA 2YW2A 4F50A 2PMZE 3R23A 1N36H 5KFCA 2FB9A 4RNMA 3GIDA 5KFVA 4O3PA 4I55F 1TWHA 3V6KA 4DL5A 2YCHA 1Z2OX 5EZYF 1IOVA 4DV3H 4K0KH 4ETSA 3GTPA 1DIKA 2W6MA 3RBEA 1I7NA 4PWQA 4QIWA 3Q8RB 1GSHA 4BBSG 5BPHA 2HVSA 3PO3G 3R5XA 3RFCA 3I4MG 5KT4A 5LMUH 4DUYH 2W57A 2W70A 4DL2A 1Z2NX 4C5AA 1VBHA 1HNXH 4JI6H 1DV1A 4AQYH 2VOBA 4LF4H 3BA8A 4EGQA 4EFBA 1RJPA 5KX5F 3J81W 3M9OB 5DGBA 4HNVA 3KHLA 3EPGA 2E2HA 3OHAA 1WR2A 1K1QA 2XCPA 3GV7B 3GTMA 5KFOA 2GPSA 4DV5H 3Q1KA 5KFSA 2YZMA 4ZQIA 2JA6A 5JVLA 4YY3H 4EYIB 2NU9B 2DPIA 4A3LG 3K3PA 4I50F 2B63A 2XC9A 3PW2A 5LOVF 3GTQA 4CC6A 5KG5A 4IRCA 2BQUA 1TWFA 2R8HA 5C3EG 1EUCB 4YR2A 1W96A 1XNQH 5HBRB 4UCVA 1E4EB 5L1LA
chains in the Genus database with same CATH topology
5BR8H 1DGSA 1MZBA 4UCRA 4MV9A 2UUBH 4X62H 4EEQA 3BAAA 3L4JA 2HGSA 4LMYA 4RZQA 4DV7H 4FM9A 4UCUA 5FD6A 4B3TH 3KAKA 5FPOA 2RGRA 4LFAH 2Q2TA 2XIGA 4M7EA 1HR0H 4DV0H 3DF7A 1BJTA 1WH2A 1TA8A 1AN7A 4GLXA 4JI5H 1TAEA 4APMA 4JI7H 2UXBH 3J80W 4LF5H 1N34H 4R7RA 4DUZH 4GKKH 4DR5H 3CVZA 4JI1H 1IBKH 3PN1A 4LH6A 4UCOA 1SEIA 4EFEA 1IBLH 3M4IA 3C0FB 4JI4H 2WE6A 2UXCH 1L2ZA 3OTOH 3N40P 4MTDA 3JSNA 4RB0A 4DR1H 4KHPH 1ZHSA 3T1HH 4MV7A 4JI3H 4LH7A 1IBMH 3N41B 1I94H 3J7AK 3FMAA 2Q2UA 4X65H 4X66H 2HVRA 4JI8H 3T1YH 3BABA 4UFZA 4RB1A 5FLXW 4NXNH 4LSAA 5IWAH 4JV5H 4LF7H 1E4FT 5A2QW 4J0MA 4X64H 2FE3A 5FD5A 3RTXA 3F8NA 1O75A 2O03A 2WYOA 3LMLA 5D1OA 4IAJA 1S68A 2CW8A 1ZHQA 2ZJTA 4RB3C 2UXDH 4JI2H 3RGXA 3N43B 3L2PA 5IT9W 5LMNH 2RGVA 1HNWH 4I7HA 4LF9H 2VUGA 4DR6H 4LF8H 1XDNA 3JAMW 1XMOH 4DR3H 2OWOA 1BGWA 4OX9H 1XMQH 3JSLA 1N33H 3EYYA 1Z2PX 1E4GT 1N36H 1XNRH 4DR4H 4B3SH 5FPRA 3RF2A 3N42B 2VPSA 1HNZH 3N44B 3KXYT 2YCHA 4B3RH 1Z2OX 3H20A 1A0IA 4DV3H 3KAJA 4ETSA 3RIZA 4JYAH 3BA9A 3L4KA 4K0KH 1GYFA 2UUAH 4RAZA 3UQ8A 4NXMH 2KSWA 4RAYA 2VQEH 4LFCH 2HVSA 5EOYA 3HXLA 5LMUH 5D1OB 4DUYH 2E5LH 2W57A 4PDBA 2HVQA 4A2BA 1V9PA 1Z2NX 4DV1H 1N32H 3RJ0A 1J5EH 4A2AA 1FKAH 1HNXH 2HHHH 2UU9H 4JI6H 4GKJH 1M0TA 4AQYH 1VS0A 4B3MH 2VOBA 3RGZA 3BA8A 4LF4H 4EFBA 4DV4H 1I6UA 4YHHH 1B04A 3MWMA 1M0WA 3J81W 4LSXA 4DV6H 4UCTA 2WDTA 4CC5A 4LF6H 1FVIA 2MCTA 2ZM6H 2UUCH 4UCSA 4DV2H 4DV5H 1X9NA 3IG0A 3K3VA 4RB2C 5LL6b 4BWSC 2VQFH 2F4VH 4DR7H 3N6XA 1P8LA 3KALA 4DR2H 4YY3H 2CW7A 4LFBH 4CC6A 4Q0YA 1FJGH 1S03G 1SYXB 5D1PA 4JI0H 1XNQH 4UCVA 4MTEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG0 A;  2ZJT A;  3M4I A; 
#chains in the Genus database with same CATH topology
 5BR8 H;  1UC8 A;  4ED3 A;  5KG6 A;  3I4N G;  4MA0 A;  2Y0S A;  3V4S A;  5KFB A;  5KT7 A;  3L4J A;  2AGP A;  2IMW P;  4UCU A;  2IBK A;  5FD6 A;  5KT3 A;  5L1J A;  3KAK A;  5FPO A;  4C2M A;  3BJY A;  1S97 A;  2Q2T A;  1HR0 H;  3VPC A;  5J2T F;  1I3Q A;  1TA8 A;  1T36 A;  2J6U A;  5KFM A;  5BPF A;  4J9K A;  4JV0 A;  4APM A;  3HBL A;  2I87 A;  5FJ8 G;  2R92 A;  5JVD F;  5KG2 A;  2JA6 G;  1TWG A;  3MWE A;  1K1S A;  5KFQ A;  2J6S A;  4GKK H;  4A3I G;  3MFI A;  4Q8F A;  1UNN C;  1Y14 B;  2W9C B;  3G6X A;  1KJ9 A;  2NVY A;  1IBK H;  2VQD A;  4FBU A;  5KFD A;  1R9T A;  3GTG A;  3ORQ A;  3M4I A;  5C8Y F;  3C0F B;  4GC7 A;  1IOW A;  4HNT A;  2P0A A;  3OTO H;  4A3F G;  1B6R A;  2V58 A;  3V4Z A;  4JI3 H;  5C4X G;  5EWE A;  3SI8 A;  2R82 A;  3RB6 A;  4X65 H;  5KG1 A;  2WB1 A;  2R8J A;  1KJQ A;  2C00 A;  4RB1 A;  3LP8 A;  1JXL A;  4O2A F;  3JZI A;  4LSA A;  4RZR A;  5KFA A;  4RNN A;  2R7L A;  5DG7 A;  4L1K A;  2J9G A;  5F9N A;  5FD5 A;  3F8N A;  1O75 A;  2O03 A;  1EZ1 A;  2FPG B;  3LML A;  5KFH A;  1RYS A;  1ZHQ A;  2ZJT A;  2FP4 B;  4J9R A;  3HB9 A;  3PR5 B;  1JIH A;  4ME6 A;  2V4R A;  4YBZ B;  4AYB A;  2XCA A;  4J9O A;  2ASD A;  5IP9 G;  4LF9 H;  4DR6 H;  2C2E A;  3VPB A;  1XMO H;  4A3G G;  1V51 A;  3RV3 A;  3PZP A;  2OWO A;  1BGW A;  1JX4 A;  2DPJ A;  5HV6 A;  3JSL A;  4F4W A;  3EYY A;  5H80 A;  2FK1 A;  2HJW A;  4DR4 H;  1M7J A;  3GIJ A;  4IRK A;  5FPR A;  4I4T F;  4YR0 A;  2QK4 A;  3KXY T;  2E2I A;  5DQH A;  1A0I A;  4C5B A;  5IYB G;  5T14 A;  4DLK A;  4U7C A;  4O3O A;  3KAJ A;  3RIZ A;  2XD4 A;  3HOY G;  2R6F A;  2J6T A;  2FPI B;  4MAM A;  2R93 G;  4RAZ A;  4BBR G;  3UQ8 A;  2W9B B;  2FKL A;  4NXM H;  5KFY A;  3H40 A;  2PN1 A;  2CQY A;  5K2M A;  3RB4 A;  2JEF A;  4G3I A;  1E4E A;  1RK5 A;  2HVQ A;  4A2B A;  3RJ0 A;  2VPQ A;  1SFO A;  3H4D A;  5EWF A;  2RF4 A;  3RGZ A;  1I6U A;  2YRX A;  3NGD A;  3BG5 A;  3M9N B;  2NVX A;  4LSX A;  4DV6 H;  4ED0 A;  4UCT A;  2UVW A;  2WDT A;  5CA1 F;  4CC5 A;  1GSO A;  2MCT A;  5KFU A;  2ZM6 H;  4DL4 A;  4F4Z A;  4JV2 A;  4BY7 G;  2W6Z A;  1N56 A;  4FU0 A;  4UCS A;  1S10 A;  5KG4 A;  4RB2 C;  5LL6 b;  4QWC A;  4XYL B;  3KHG A;  2FK2 A;  2VQF H;  2F4V H;  2W9C A;  3WO1 A;  5IYZ F;  1CS0 A;  4DR2 H;  2CW7 A;  4A3E G;  5KFI A;  3TIG A;  5LP6 F;  4LFB H;  1JDB B;  4QWB A;  1T3N A;  5CB4 F;  2JA7 A;  3HKZ E;  5DLG A;  2DZD A;  3KHR A;  4J9M A;  4ECR A;  4GKJ H;  2NU7 B;  3GTJ A;  1AUX A;  4EBD A;  2UUB H;  5JUM A;  4IR9 A;  3ETJ A;  1S0O A;  4A3D G;  1AUV A;  2HGS A;  4E4T A;  4RZQ A;  5C5J A;  5EDW A;  3GIM A;  4LFA H;  1BXR A;  1WH2 A;  4RUC A;  2R87 A;  1C30 A;  4BY1 G;  1KEE A;  3GIL A;  3G6Y A;  4JI7 H;  3UFX B;  1B33 N;  2SCU B;  3J80 W;  5EWG A;  2R8G A;  4LF5 H;  3VPD A;  5L9X A;  2PVP A;  3CVZ A;  3RBD A;  4LH6 A;  4O3Q A;  2YZN A;  1SEI A;  2OLS A;  2JA7 G;  1IBL H;  4RNO A;  2UXC H;  3N40 P;  4MTD A;  4XZ3 B;  4HNU A;  4A3J G;  4MV7 A;  4O4I F;  5DG8 A;  5L1I A;  1BNC A;  2NU8 B;  4EG0 A;  3OSN A;  3PVX A;  4R8U B;  3FMA A;  2Q2U A;  3SE7 A;  3H3V H;  3J7A K;  4JI8 H;  2WAQ E;  4GC6 A;  2GLT A;  3T1Y H;  4UFZ A;  5KFF A;  3QZ8 A;  4NXN H;  5JH7 F;  5IP7 G;  5KFX A;  1WCM A;  2W9B A;  1N48 A;  4JV5 H;  2VA3 A;  4J0M A;  5KFG A;  1CQJ B;  1KJI A;  2W8K A;  3RTX A;  4TV8 F;  2WYO A;  5I47 A;  4QWE A;  4DL6 A;  4IAJ A;  3FKI A;  1TWC A;  1S68 A;  2CW8 A;  3M9M B;  1VKZ A;  4JI2 H;  1C3O A;  2C28 A;  3L2P A;  2AGQ A;  4LF8 H;  5J2U F;  4DR3 H;  4A3C G;  2UVV A;  3GIQ A;  1GO3 E;  4QWA A;  2RDI A;  4QJF A;  1KJJ A;  4M9U A;  3HOU G;  5KFL A;  1Z2P X;  4ECY A;  2ALZ A;  1XNR H;  4YQW A;  3RF2 A;  1V4Y A;  4F4X A;  2VPS A;  3OSP A;  5D8D A;  3N44 B;  5C1P A;  1S0N A;  1HNZ H;  4A3B G;  3H20 A;  2YZG A;  3TII A;  1WCM G;  2M05 A;  2UVR A;  3T5H A;  3L4K A;  1GYF A;  2R93 A;  2KSW A;  4RAY A;  2VQE H;  4LFC H;  2PMZ A;  3FKI G;  3MR2 A;  4EEY A;  3HXL A;  1JKJ B;  4PDB A;  3R5H A;  2FK3 A;  3QFF A;  5FLM G;  3EPI A;  4DV1 H;  2DIK A;  2HHH H;  4A2A A;  3OUU A;  4J9S A;  3ETH A;  1M0T A;  5DQI A;  1VS0 A;  1W93 A;  2XGQ A;  4B3M H;  2IP4 A;  2YS7 A;  4DV4 H;  2FLP A;  3GII A;  1DV2 A;  4IRD A;  1M0W A;  3CQZ A;  3MJF A;  4DL3 A;  2OH2 A;  1FVI A;  5L1K A;  3G6V A;  5KFW A;  2FMA A;  4IWX A;  4DV2 H;  3GV8 B;  1X9N A;  4J9Q A;  2WTF A;  2R84 A;  2R8I A;  4ED1 A;  1M6V A;  2C35 B;  4ECX A;  2NU6 B;  2W7O A;  2BQR A;  2JA5 G;  2W6N A;  5C1O A;  1JLL B;  1P8L A;  4DR7 H;  3PR4 A;  2W9A A;  4MA5 A;  5GON F;  2Y0S E;  1B6S A;  5CAE B;  5KFZ A;  3KHH A;  1I7L A;  1FJG H;  1S03 G;  3WO0 A;  5KFK A;  1SYX B;  4HR7 A;  4ZOL F;  5D1P A;  1DGS A;  3K5H A;  4R8U A;  5KFN A;  1Y1V A;  4YJ3 F;  4DV7 H;  4FM9 A;  2W6P A;  4B3T H;  1T94 A;  3GIP A;  2UVU A;  3T5L A;  3PW5 A;  1PK8 A;  2ZDG A;  4M7E A;  4DV0 H;  1BJT A;  1CQI B;  5CA0 F;  1A9X A;  4GLX A;  4JI5 H;  3MR5 A;  1I50 A;  4J9N A;  1WSC A;  5KFJ A;  4IHJ F;  2R86 A;  1N34 H;  4O3S A;  2FPP B;  5BMV F;  1CE8 A;  2JEJ A;  3K5I A;  1GSA A;  4DR5 H;  3GQC A;  2QYZ A;  3MWD A;  2WB1 E;  4ED6 A;  4YR3 A;  1RK6 A;  2WE6 A;  5KT5 A;  3RAQ A;  1L2Z A;  1RJQ A;  2JA8 G;  1UC9 A;  4HYK A;  3JSN A;  4DR1 H;  2GPW A;  1ZHS A;  4ECV A;  2R8K A;  4LH7 A;  1IBM H;  1Y1V G;  3N41 B;  1I94 H;  2RDJ A;  2YYA A;  2HVR A;  3Q8S B;  2YRW A;  4AYB E;  3BAB A;  4TUY F;  2BR0 A;  1RJR A;  5FLX W;  4O3R A;  2CZG A;  3PW4 A;  2W7P A;  4O3N A;  4RU9 A;  2ASL A;  5F9L A;  4BXX G;  3R5F A;  3H0G A;  1E4F T;  5A2Q W;  2R7M A;  4X64 H;  4ECU A;  4YAK B;  4U6P A;  1TWA A;  4RB3 C;  3V6H A;  3RB0 A;  2W71 A;  4NLG A;  4A3M G;  3N43 B;  2C2D A;  1S0M A;  4JV1 A;  2V59 A;  2RGV A;  2V5A A;  1HNW H;  3OUZ A;  3BQ2 A;  2VA2 A;  2VUG A;  5LYJ F;  5LA6 F;  1XDN A;  3JAM W;  4ED2 A;  2YU9 A;  3KTM A;  4O4H F;  4A3K G;  3JRW A;  1XMQ H;  4FBT A;  4YAJ B;  1N33 H;  1E4G T;  2JEG A;  2NUA B;  4B3S H;  2FJZ A;  1ULZ A;  5KFR A;  4TV9 F;  2V9W A;  2ZDQ A;  1GGO A;  3N42 B;  4JUZ A;  4TQR A;  4B3R H;  4MV6 A;  4IZO A;  1Y1W A;  4ED8 A;  4JYA H;  1SCU B;  2R7Z A;  3BA9 A;  3N8D A;  3H0G G;  4FS1 A;  2AGO A;  4YP3 A;  2UUA H;  4J9L A;  2XGP A;  4QW8 A;  2AU0 A;  5EOY A;  3MR6 A;  5KKN B;  2DWC A;  1JDE A;  2X0S A;  5D1O B;  3HOX G;  4QWD A;  2W8L A;  1PX2 A;  5JQW A;  3U9S A;  1V9P A;  5KG7 A;  4EYH B;  2E5L H;  3GTK A;  1N32 H;  2JEI A;  1J5E H;  5KFT A;  4XYM B;  1FKA H;  1ZET A;  2UU9 H;  3V6J A;  4A93 G;  5IYD G;  3AYH B;  3HOV G;  5DG9 A;  4YHH H;  1GLV A;  1B04 A;  3MWM A;  4TQS A;  4ED7 A;  2I80 A;  4QIW E;  4Q43 A;  4IWY A;  3OHB A;  4IR1 A;  5KG3 A;  2YS6 A;  4LF6 H;  4ZI7 F;  1VBG A;  3FDS A;  2UUC H;  5LXT F;  4ECT A;  4ECW A;  2R7N A;  3IG0 A;  3K3V A;  5KT2 A;  3T5K A;  4DL7 A;  1Y1W G;  2R7Z G;  4MV1 A;  4BWS C;  4YJ2 F;  3N6X A;  2JA5 A;  3KAL A;  2B63 G;  4Q8E A;  4WBN F;  3Q8P B;  4FS2 A;  3HOZ G;  4Q0Y A;  3HOW G;  5KG0 A;  3WNZ A;  4HQ6 A;  2PBZ A;  4JI0 H;  4O2B F;  1EYZ A;  4MTE A;  4QW9 A;  1MZB A;  4UCR A;  4MV3 A;  2V4Q A;  2BQ3 A;  4MV9 A;  2FLN A;  3U9T A;  2R85 A;  4X62 H;  4EEQ A;  4EBC A;  3BAA A;  3RUP A;  2DLN A;  4LMY A;  2C22 A;  3PO2 G;  5KFP A;  4Y8V B;  4O4L F;  4Q45 A;  3GTO A;  3HKZ A;  2RGR A;  3Q2O A;  2XIG A;  3GLK A;  4MV4 A;  3DF7 A;  3ORR A;  1AN7 A;  2CKZ B;  3VMM A;  1TAE A;  2R92 G;  2UXB H;  3T5J A;  2AQ4 A;  4ECS A;  4ECZ A;  3QZ7 A;  4EBE A;  3I12 A;  4R7R A;  4DUZ H;  2ASJ A;  1S9F A;  1OWT A;  2FLL A;  4JI1 H;  4EGJ A;  3IN5 A;  3PN1 A;  3Q8Q B;  5KFE A;  4UCO A;  4ECQ A;  4XX0 B;  4EFE A;  4J9P A;  5DQG A;  3G8C A;  3TQ1 A;  3RAX A;  4JI4 H;  3BQ0 A;  5DLF A;  2R7K A;  2VUM A;  4KHP H;  4RB0 A;  3MR3 A;  3MFH A;  3H4B A;  3GV5 B;  3T1H H;  1RYR A;  1EUD B;  4RUA A;  3TQT A;  1ZQ7 A;  2XCL A;  2ZDH A;  4X66 H;  2W6O A;  4ZHQ F;  1VAJ A;  4Q44 A;  2W6Q A;  5DGA A;  2YL2 A;  5IWA H;  3RV4 A;  2C2R A;  3JRX A;  4LF7 H;  2FE3 A;  5IYC G;  5D1O A;  3BQ1 A;  3GIK A;  3LWB A;  2ATL A;  2VR1 A;  3PW7 A;  2UXD H;  3GTL A;  1K83 A;  2WAQ A;  4C5C A;  1KC7 A;  3RGX A;  3TIN A;  5IT9 W;  5C44 G;  4YB8 B;  5LMN H;  1KBL A;  4WD3 A;  5KT6 A;  4I7H A;  4F4Y A;  1KJ8 A;  2I8C A;  3E5N A;  3RB3 A;  4OX9 H;  2VUM G;  3PW0 A;  2IA6 A;  4MV8 A;  1EHI A;  2YW2 A;  4F50 A;  2PMZ E;  3R23 A;  1N36 H;  5KFC A;  2FB9 A;  4RNM A;  3GID A;  5KFV A;  4O3P A;  4I55 F;  1TWH A;  3V6K A;  4DL5 A;  2YCH A;  1Z2O X;  5EZY F;  1IOV A;  4DV3 H;  4K0K H;  4ETS A;  3GTP A;  1DIK A;  2W6M A;  3RBE A;  1I7N A;  4PWQ A;  4QIW A;  3Q8R B;  1GSH A;  4BBS G;  5BPH A;  2HVS A;  3PO3 G;  3R5X A;  3RFC A;  3I4M G;  5KT4 A;  5LMU H;  4DUY H;  2W57 A;  2W70 A;  4DL2 A;  1Z2N X;  4C5A A;  1VBH A;  1HNX H;  4JI6 H;  1DV1 A;  4AQY H;  2VOB A;  4LF4 H;  3BA8 A;  4EGQ A;  4EFB A;  1RJP A;  5KX5 F;  3J81 W;  3M9O B;  5DGB A;  4HNV A;  3KHL A;  3EPG A;  2E2H A;  3OHA A;  1WR2 A;  1K1Q A;  2XCP A;  3GV7 B;  3GTM A;  5KFO A;  2GPS A;  4DV5 H;  3Q1K A;  5KFS A;  2YZM A;  4ZQI A;  2JA6 A;  5JVL A;  4YY3 H;  4EYI B;  2NU9 B;  2DPI A;  4A3L G;  3K3P A;  4I50 F;  2B63 A;  2XC9 A;  3PW2 A;  5LOV F;  3GTQ A;  4CC6 A;  5KG5 A;  4IRC A;  2BQU A;  1TWF A;  2R8H A;  5C3E G;  1EUC B;  4YR2 A;  1W96 A;  1XNQ H;  5HBR B;  4UCV A;  1E4E B;  5L1L A; 
#chains in the Genus database with same CATH homology
 5BR8 H;  1DGS A;  1MZB A;  4UCR A;  4MV9 A;  2UUB H;  4X62 H;  4EEQ A;  3BAA A;  3L4J A;  2HGS A;  4LMY A;  4RZQ A;  4DV7 H;  4FM9 A;  4UCU A;  5FD6 A;  4B3T H;  3KAK A;  5FPO A;  2RGR A;  4LFA H;  2Q2T A;  2XIG A;  4M7E A;  1HR0 H;  4DV0 H;  3DF7 A;  1BJT A;  1WH2 A;  1TA8 A;  1AN7 A;  4GLX A;  4JI5 H;  1TAE A;  4APM A;  4JI7 H;  2UXB H;  3J80 W;  4LF5 H;  1N34 H;  4R7R A;  4DUZ H;  4GKK H;  4DR5 H;  3CVZ A;  4JI1 H;  1IBK H;  3PN1 A;  4LH6 A;  4UCO A;  1SEI A;  4EFE A;  1IBL H;  3M4I A;  3C0F B;  4JI4 H;  2WE6 A;  2UXC H;  1L2Z A;  3OTO H;  3N40 P;  4MTD A;  3JSN A;  4RB0 A;  4DR1 H;  4KHP H;  1ZHS A;  3T1H H;  4MV7 A;  4JI3 H;  4LH7 A;  1IBM H;  3N41 B;  1I94 H;  3J7A K;  3FMA A;  2Q2U A;  4X65 H;  4X66 H;  2HVR A;  4JI8 H;  3T1Y H;  3BAB A;  4UFZ A;  4RB1 A;  5FLX W;  4NXN H;  4LSA A;  5IWA H;  4JV5 H;  4LF7 H;  1E4F T;  5A2Q W;  4J0M A;  4X64 H;  2FE3 A;  5FD5 A;  3RTX A;  3F8N A;  1O75 A;  2O03 A;  2WYO A;  3LML A;  5D1O A;  4IAJ A;  1S68 A;  2CW8 A;  1ZHQ A;  2ZJT A;  4RB3 C;  2UXD H;  4JI2 H;  3RGX A;  3N43 B;  3L2P A;  5IT9 W;  5LMN H;  2RGV A;  1HNW H;  4I7H A;  4LF9 H;  2VUG A;  4DR6 H;  4LF8 H;  1XDN A;  3JAM W;  1XMO H;  4DR3 H;  2OWO A;  1BGW A;  4OX9 H;  1XMQ H;  3JSL A;  1N33 H;  3EYY A;  1Z2P X;  1E4G T;  1N36 H;  1XNR H;  4DR4 H;  4B3S H;  5FPR A;  3RF2 A;  3N42 B;  2VPS A;  1HNZ H;  3N44 B;  3KXY T;  2YCH A;  4B3R H;  1Z2O X;  3H20 A;  1A0I A;  4DV3 H;  3KAJ A;  4ETS A;  3RIZ A;  4JYA H;  3BA9 A;  3L4K A;  4K0K H;  1GYF A;  2UUA H;  4RAZ A;  3UQ8 A;  4NXM H;  2KSW A;  4RAY A;  2VQE H;  4LFC H;  2HVS A;  5EOY A;  3HXL A;  5LMU H;  5D1O B;  4DUY H;  2E5L H;  2W57 A;  4PDB A;  2HVQ A;  4A2B A;  1V9P A;  1Z2N X;  4DV1 H;  1N32 H;  3RJ0 A;  1J5E H;  4A2A A;  1FKA H;  1HNX H;  2HHH H;  2UU9 H;  4JI6 H;  4GKJ H;  1M0T A;  4AQY H;  1VS0 A;  4B3M H;  2VOB A;  3RGZ A;  3BA8 A;  4LF4 H;  4EFB A;  4DV4 H;  1I6U A;  4YHH H;  1B04 A;  3MWM A;  1M0W A;  3J81 W;  4LSX A;  4DV6 H;  4UCT A;  2WDT A;  4CC5 A;  4LF6 H;  1FVI A;  2MCT A;  2ZM6 H;  2UUC H;  4UCS A;  4DV2 H;  4DV5 H;  1X9N A;  3IG0 A;  3K3V A;  4RB2 C;  5LL6 b;  4BWS C;  2VQF H;  2F4V H;  4DR7 H;  3N6X A;  1P8L A;  3KAL A;  4DR2 H;  4YY3 H;  2CW7 A;  4LFB H;  4CC6 A;  4Q0Y A;  1FJG H;  1S03 G;  1SYX B;  5D1P A;  4JI0 H;  1XNQ H;  4UCV A;  4MTE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...