3M4IA

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 1.95 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
190
Chain Sequence
b'TDPRKSELYVVEGDSAGMFQAILPLRGRIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA gyrase subunit B
publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
total genus 60
structure length 190
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3m4iA02
3M4IA 2ZJTA 3IG0A
chains in the Genus database with same CATH superfamily
4M7EA 1P8LA 1E4EA 1ZQ7A 2DWCA 3J81W 1S0NA 2JA7G 4MV1A 1Y14B 3OUUA 3KTMA 2JEFA 4JI6H 2OH2A 4A3JG 2RF4A 2NVYA 4RB0A 5KG1A 2R7LA 2R7MA 2R92G 5IYZF 3KAKA 5DG8A 2GLTA 2RGRA 3HOXG 2BQUA 2YL2A 1I7NA 3F8NA 4M9UA 5KG6A 4X62H 3RB0A 4RUAA 2R8GA 2W71A 2DIKA 4EGQA 4ED6A 4RUCA 2FPIB 5LMUH 4FBUA 5L1LA 2HVSA 4QIWA 5KT3A 4JI2H 2J6UA 2FP4B 2FKLA 4YAKB 4A3KG 2DPJA 5LOVF 5HV6A 5FJ8G 3RBEA 5FD5A 5DQGA 4DLKA 4LF4H 3PW2A 1CS0A 1CE8A 3MR5A 1XNQH 5D1OB 4DV7H 1L2ZA 3U9SA 5KFNA 1M0TA 3RV4A 5KG7A 3LWBA 1Z2NX 3M4IA 2JA8G 2R93A 5KFSA 4B3RH 1V4YA 2JA6G 2V4RA 4NLGA 1RJQA 1VAJA 3Q2OA 5KFXA 4AQYH 2WAQE 4FU0A 4EEQA 1VKZA 4X65H 2JA7A 1FVIA 1Y1WG 3C0FB 4FS1A 4DV4H 4A93G 4QWEA 3HOYG 2W6NA 3K3PA 2R7ZG 5A2QW 3IG0A 4RNNA 3H4BA 3R5HA 2UXDH 3VPCA 4FM9A 3RAQA 4NXMH 1PK8A 4DV6H 5KFLA 2WB1E 3L4JA 3KHLA 4JYAH 2ASDA 4YQWA 2YU9A 4A2BA 4O2BF 1N32H 3TINA 4K0KH 3PW4A 4MV6A 5BPFA 2C35B 4RZRA 1TWAA 3KHGA 3JSNA 4TV8F 4J9OA 2YYAA 1K83A 2C28A 3Q8SB 2W6OA 4FS2A 1Y1VG 2Y0SA 4JV2A 5LA6F 4C5CA 1JDBB 2PMZA 2W6ZA 1S68A 4EFBA 2R8IA 2O03A 5BR8H 1BXRA 1KBLA 3UQ8A 3PW7A 4ED1A 4ED2A 4O3NA 3ORQA 3OHBA 3T5KA 4J9RA 4J9NA 1EUDB 4MAMA 2HGSA 2YZGA 4WD3A 5DLFA 2B63G 3JRWA 2WAQA 4DL6A 4A3IG 2JA6A 4IHJF 4ME6A 3FKIG 4J9SA 5EOYA 3QZ7A 2HHHH 3T1HH 2J6SA 2E2HA 5C4XG 3MR2A 1Y1WA 3KHHA 4I4TF 4AYBE 1KJQA 3GQCA 4JI0H 2MCTA 2VPQA 2W9BA 4YJ3F 4PWQA 5HBRB 3Q8RB 2R8HA 3OHAA 2ZM6H 3CQZA 4A2AA 4RB2C 3GV8B 4O3SA 3N43B 5FPRA 1CQJB 4EG0A 4Q45A 4EYIB 1CQIB 2VPSA 4ED3A 3GIKA 1FKAH 2JEGA 1M6VA 4JI1H 1UNNC 1XMQH 5JQWA 2JEJA 2IMWP 1XMOH 5C8YF 4LF9H 2NVXA 5KG2A 1KJ8A 2R6FA 3RFCA 5L9XA 1WCMG 4QIWE 1JXLA 2UVRA 2DLNA 3NGDA 4ED8A 4Q8FA 2W6PA 4RZQA 5CA1F 4DV2H 4R8UB 5KT2A 4MV3A 1GO3E 2ZDQA 5KT6A 5T14A 2C2RA 2B63A 2IP4A 3L4KA 1T94A 2I80A 3ETJA 4O4IF 2RDJA 4WBNF 3CVZA 3GIQA 4LF6H 4EBEA 5KFBA 5FPOA 1JIHA 3MFIA 1N56A 3GTKA 4MA0A 2FB9A 4TUYF 1JLLB 5LL6b 3H40A 4QW9A 4EBCA 1WH2A 4LFAH 5LYJF 2WTFA 4HNUA 4UCOA 4JI8H 1I7LA 3ETHA 5CA0F 2XGQA 4LF5H 3KALA 1GSAA 2NU9B 4F4XA 3RB6A 4CC6A 4ECYA 1ZHSA 4A3FG 1OWTA 3TIGA 1T3NA 1WSCA 2ASJA 1N34H 1DV1A 4BY1G 3RUPA 1S10A 3VPDA 3RBDA 4NXNH 4BBSG 3N41B 1MZBA 1RJRA 4HR7A 3K5HA 3MWEA 2YW2A 3EYYA 2CW8A 3H0GG 4I7HA 1KJIA 1WCMA 1X9NA 4DR5H 1V9PA 2AU0A 4EEYA 5JVLA 3GTMA 1GLVA 4B3SH 1GSOA 5C44G 4DUYH 1GGOA 3T5LA 1HNXH 3BJYA 1ZHQA 4DV0H 4UCSA 2DPIA 1W93A 2Y0SE 4YY3H 4EBDA 2PMZE 5FLMG 5L1KA 5D1PA 3JZIA 3G8CA 3RJ0A 2YS6A 4YHHH 3HB9A 2XD4A 2R84A 2R87A 3GIIA 2Q2TA 1SEIA 2UUAH 1E4FT 4RU9A 3TQ1A 2W7OA 4DV1H 3RGXA 3PO2G 3K5IA 3GTGA 3PR4A 2R7KA 3GTJA 3HOZG 1S0MA 2AQ4A 5DQHA 5BPHA 4TQRA 2XGPA 4U6PA 1IOWA 5LP6F 2CQYA 4ECZA 3SI8A 4DR6H 3GTPA 2R92A 2PVPA 2FK3A 4Y8VB 2XIGA 4GC6A 4IWXA 5CAEB 4MV8A 4C2MA 1EUCB 4GKKH 3Q8PB 3RV3A 2BR0A 3TIIA 1S0OA 3Q8QB 1I50A 4UFZA 1B6SA 5DGAA 4DR7H 2V4QA 4ECUA 1TWGA 4LH7A 4J9MA 2BQ3A 4LFCH 1TWFA 4YB8B 4JV0A 3GLKA 2C2EA 3H20A 3E5NA 2WE6A 2W6MA 4JUZA 1K1SA 5DG9A 5LXTF 2VR1A 2R8JA 1KJJA 1XNRH 3PW5A 3T5HA 2W9AA 2HVRA 1RYSA 5KFTA 5IP7G 2NU7B 1A0IA 2DZDA 3SE7A 3RGZA 5F9LA 1RYRA 5DLGA 2ASLA 2PBZA 2W9CB 3L2PA 4L1KA 2ZJTA 3ORRA 4Q44A 1C3OA 5D8DA 2XCPA 3BQ0A 1B6RA 1GSHA 3IN5A 5I47A 3J80W 5LMNH 2F4VH 3GTQA 2YRXA 4JI5H 2WDTA 1DV2A 2YRWA 2KSWA 4IAJA 2R7ZA 2FLPA 2FJZA 5EDWA 3PZPA 2R93G 2WYOA 2W9BB 2W70A 2VQDA 2JEIA 2FMAA 5J2UF 2VQEH 3BQ1A 3PW0A 2PN1A 5KFIA 4FBTA 4ECQA 1JX4A 4QWAA 4O4HF 3BA9A 3MJFA 3T5JA 1S9FA 4B3TH 5EZYF 5KFEA 1AN7A 4JI3H 4XZ3B 4JI7H 2M05A 4JV1A 1GYFA 4DL3A 3GIJA 1AUVA 4I55F 4ETSA 1Z2PX 1ZETA 2AGOA 3GV5B 4JV5H 3TQTA 1W96A 1Y1VA 2UU9H 4A3GG 1JDEA 2GPSA 5KT4A 5C3EG 4Q43A 3MR3A 2OLSA 3BAAA 4DL2A 2QK4A 2SCUB 4J9PA 2IA6A 3GIMA 1UC9A 2UUCH 3EPGA 3LMLA 1N33H 4LF7H 2R85A 4TQSA 4DL5A 4A3MG 4Q8EA 3MWMA 1IBMH 2FK2A 3OSNA 4MV4A 2ALZA 5GONF 2IBKA 4YR2A 3M9MB 2VUMG 2I87A 2UVWA 3PO3G 2UXBH 2RGVA 2VA2A 4A3DG 3FKIA 4LSXA 4ECTA 4HNTA 4CC5A 3H3VH 4G3IA 5L1JA 3HBLA 3MR6A 3VPBA 3PR5B 2AGPA 5EWFA 3BG5A 3WO1A 2VOBA 2W7PA 2VUGA 1AUXA 4YR3A 4IRCA 2CKZB 2NU8B 4BY7G 1BJTA 1E4EB 3N8DA 2XC9A 3MFHA 2R7NA 4F4YA 2RDIA 2YZNA 4APMA 2UVUA 1SFOA 2C22A 4Q0YA 1HNWH 4R8UA 2VQFH 1BNCA 3PVXA 2FPGB 1SCUB 4ZQIA 1I6UA 4IR1A 2V9WA 3GIPA 4O2AF 5KG5A 1TWCA 2FLNA 5KFPA 2OWOA 4DV5H 2W57A 5C5JA 4UCUA 1IBKH 4XYLB 1M7JA 1PX2A 5DG7A 3KAJA 4MTDA 5KFVA 4QWCA 5KT7A 2UVVA 1VBGA 2HVQA 1B33N 5FD6A 5JVDF 5KFRA 4LMYA 2FK1A 4A3LG 4BXXG 1WR2A 4GKJH 3R23A 3JAMW 5DQIA 3V6KA 1E4GT 2FPPB 5H80A 2P0AA 1SYXB 2VUMA 2YZMA 1I94H 4EFEA 1VS0A 5IP9G 4ECSA 4GLXA 5KFFA 4KHPH 3FDSA 5CB4F 4IR9A 1TWHA 1O75A 2C2DA 4O3QA 2CW7A 5K2MA 3HOUG 3KHRA 2R8KA 5KFCA 5KFWA 4A3BG 5KFAA 3N42B 1R9TA 2E5LH 5BMVF 2AGQA 3T1YH 3GTOA 1ULZA 4UCTA 4O3RA 1RK5A 3M9OB 5KFHA 5KFZA 1BGWA 4B3MH 4ED0A 5JUMA 2W6QA 4ZI7F 2R82A 5D1OA 3I4NG 4UCRA 4HQ6A 4YBZB 4DL7A 3U9TA 3HKZA 1A9XA 1C30A 2ATLA 3BA8A 4MV7A 3RTXA 2V5AA 3I4MG 2C00A 3G6VA 3EPIA 4DUZH 3V6JA 5KFJA 3H0GA 4U7CA 5EWEA 4QJFA 2UUBH 1KJ9A 4E4TA 4LH6A 4J9KA 3GV7B 2QYZA 4MTEA 2V58A 3V4SA 1S03G 4ZHQF 1K1QA 3N44B 1M0WA 3V4ZA 4RNMA 3QZ8A 3BQ2A 4DR3H 4RAYA 2GPWA 3JRXA 1I3QA 3RAXA 1HR0H 4QWDA 4ECVA 1RJPA 2FE3A 4IRDA 4C5BA 5IYCG 5KFMA 4EGJA 1B04A 4F4ZA 4XYMB 3OTOH 4IRKA 2E2IA 5L1IA 3HOVG 4ZOLF 4HNVA 5C1PA 3LP8A 1KC7A 3KXYT 4O3OA 4XX0B 2FLLA 1RK6A 3J7AK 3R5FA 1JKJB 4R7RA 3JSLA 1KEEA 4JI4H 3GILA 2I8CA 4QWBA 3RB3A 3RB4A 5IYDG 1J5EH 5KG4A 4C5AA 4YP3A 1TAEA 1DIKA 4ECWA 2J6TA 3OUZA 1TA8A 4MA5A 3WO0A 2XCAA 5KFUA 5KFQA 5C1OA 4LSAA 5J2TF 4F50A 3N40P 4O3PA 4RAZA 3RF2A 5KG3A 1XDNA 4QW8A 4DR4H 1Z2OX 5JH7F 2JA5G 4TV9F 1DGSA 3HXLA 5KFKA 3G6XA 4DR2H 1FJGH 4A3CG 2W9CA 2UXCH 1EZ1A 4RNOA 3V6HA 2CZGA 5KT5A 4PDBA 1VBHA 3BABA 5KX5F 4I50F 4EYHB 4ECXA 1N48A 2NU6B 4IWYA 4GC7A 1IBLH 4BWSC 4YR0A 4J0MA 4MV9A 2Q2UA 3M9NB 3AYHB 1N36H 3UFXB 5IYBG 4LFBH 4YAJB 3HOWG 3QFFA 2WB1A 3OSPA 5KFDA 1V51A 4J9LA 4X64H 4A3EG 5IWAH 3DF7A 1EYZA 4DV3H 4BBRG 3G6YA 3RIZA 3WNZA 2ZDHA 3PN1A 3GTLA 2BQRA 4RB3C 3N6XA 2W8LA 3I12A 3R5XA 3VMMA 2XCLA 2YS7A 2VA3A 1EHIA 2R86A 4OX9H 2HJWA 1IOVA 5FLXW 4RB1A 4O4LF 2NUAB 5KG0A 5DGBA 4YJ2F 4J9QA 5IT9W 2J9GA 3GIDA 4LF8H 4HYKA 2JA5A 2ZDGA 3Q1KA 5F9NA 4F4WA 4DR1H 2YCHA 5KFYA 2V59A 4IZOA 3H4DA 5KKNB 1T36A 4ED7A 1UC8A 4X66H 4ECRA 3MWDA 4DL4A 4AYBA 5EWGA 3FMAA 2X0SA 1HNZH 3K3VA 5KFOA 4UCVA 5KFGA 3HKZE 2W8KA 1S97A
chains in the Genus database with same CATH topology
4M7EA 4K0KH 2VPSA 1P8LA 3T1YH 1A0IA 3RGZA 1BGWA 1FKAH 4B3MH 3J81W 4JI1H 1XMQH 5D1OA 3L2PA 4UCRA 2ZJTA 4JI6H 4LF9H 1XMOH 4RB0A 3BA8A 4MV7A 3RTXA 3KAKA 3J80W 5LMNH 4DUZH 2F4VH 4JI5H 2WDTA 2KSWA 4IAJA 4RZQA 2RGRA 4DV2H 3F8NA 2WYOA 4X62H 2HVRA 2UUBH 3L4KA 4LH6A 2VQEH 5LMUH 4MTEA 1S03G 3CVZA 2HVSA 4LF6H 3BA9A 4JI2H 4B3TH 3N44B 1M0WA 5FPOA 4DR3H 4JI3H 1AN7A 1HR0H 4RAYA 4JI7H 2FE3A 5FD5A 1GYFA 1B04A 5LL6b 3OTOH 4ETSA 1WH2A 4LFAH 1Z2PX 4JI8H 4JV5H 4LF4H 3KXYT 4UCOA 1XNQH 5D1OB 4LF5H 4DV7H 2UU9H 1L2ZA 3KALA 3J7AK 1M0TA 4R7RA 3JSLA 4JI4H 1Z2NX 3BAAA 3M4IA 4CC6A 1ZHSA 2UUCH 1J5EH 3LMLA 1N33H 4LF7H 1TAEA 4B3RH 4AQYH 3MWMA 1N34H 1TA8A 1IBMH 4NXNH 4EEQA 4X65H 1FVIA 3N41B 1MZBA 3C0FB 4LSAA 2UXBH 3N40P 3RF2A 4RAZA 4DV4H 2RGVA 1XDNA 4LSXA 1Z2OX 4DR4H 1DGSA 3HXLA 4CC5A 3EYYA 5A2QW 2CW8A 4DR2H 4I7HA 3IG0A 2UXCH 1X9NA 4DR5H 1V9PA 2UXDH 2VOBA 4PDBA 2VUGA 3BABA 4B3SH 4FM9A 4NXMH 4DUYH 4DV6H 1BJTA 1HNXH 3L4JA 1ZHQA 4DV0H 4UCSA 4JYAH 4YY3H 1IBLH 5D1PA 4A2BA 4APMA 4BWSC 4J0MA 4MV9A 4Q0YA 1HNWH 1N32H 3RJ0A 2VQFH 2Q2UA 1N36H 4YHHH 4LFBH 2Q2TA 3JSNA 1SEIA 2UUAH 1E4FT 1I6UA 4X64H 5IWAH 3DF7A 4DV1H 4EFBA 1S68A 3RGXA 4DV3H 2O03A 3RIZA 5BR8H 2OWOA 4DV5H 3PN1A 2W57A 3UQ8A 4RB3C 4UCUA 1IBKH 3N6XA 4DR6H 2HGSA 3KAJA 4MTDA 2HVQA 5FD6A 4GKJH 2XIGA 4LMYA 4OX9H 3JAMW 5EOYA 2HHHH 1E4GT 3T1HH 4GKKH 5FLXW 1SYXB 4RB1A 1I94H 4UFZA 4JI0H 5IT9W 4EFEA 4DR7H 1VS0A 2MCTA 4LF8H 4LH7A 4GLXA 4KHPH 4LFCH 1O75A 4DR1H 2CW7A 3H20A 2YCHA 2WE6A 2ZM6H 4A2AA 1FJGH 3N42B 4X66H 4RB2C 2E5LH 3FMAA 3N43B 5FPRA 1HNZH 3K3VA 1XNRH 4UCVA 4UCTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  2ZJT A;  3IG0 A; 
#chains in the Genus database with same CATH topology
 4M7E A;  1P8L A;  1E4E A;  1ZQ7 A;  2DWC A;  3J81 W;  1S0N A;  2JA7 G;  4MV1 A;  1Y14 B;  3OUU A;  3KTM A;  2JEF A;  4JI6 H;  2OH2 A;  4A3J G;  2RF4 A;  2NVY A;  4RB0 A;  5KG1 A;  2R7L A;  2R7M A;  2R92 G;  5IYZ F;  3KAK A;  5DG8 A;  2GLT A;  2RGR A;  3HOX G;  2BQU A;  2YL2 A;  1I7N A;  3F8N A;  4M9U A;  5KG6 A;  4X62 H;  3RB0 A;  4RUA A;  2R8G A;  2W71 A;  2DIK A;  4EGQ A;  4ED6 A;  4RUC A;  2FPI B;  5LMU H;  4FBU A;  5L1L A;  2HVS A;  4QIW A;  5KT3 A;  4JI2 H;  2J6U A;  2FP4 B;  2FKL A;  4YAK B;  4A3K G;  2DPJ A;  5LOV F;  5HV6 A;  5FJ8 G;  3RBE A;  5FD5 A;  5DQG A;  4DLK A;  4LF4 H;  3PW2 A;  1CS0 A;  1CE8 A;  3MR5 A;  1XNQ H;  5D1O B;  4DV7 H;  1L2Z A;  3U9S A;  5KFN A;  1M0T A;  3RV4 A;  5KG7 A;  3LWB A;  1Z2N X;  3M4I A;  2JA8 G;  2R93 A;  5KFS A;  4B3R H;  1V4Y A;  2JA6 G;  2V4R A;  4NLG A;  1RJQ A;  1VAJ A;  3Q2O A;  5KFX A;  4AQY H;  2WAQ E;  4FU0 A;  4EEQ A;  1VKZ A;  4X65 H;  2JA7 A;  1FVI A;  1Y1W G;  3C0F B;  4FS1 A;  4DV4 H;  4A93 G;  4QWE A;  3HOY G;  2W6N A;  3K3P A;  2R7Z G;  5A2Q W;  3IG0 A;  4RNN A;  3H4B A;  3R5H A;  2UXD H;  3VPC A;  4FM9 A;  3RAQ A;  4NXM H;  1PK8 A;  4DV6 H;  5KFL A;  2WB1 E;  3L4J A;  3KHL A;  4JYA H;  2ASD A;  4YQW A;  2YU9 A;  4A2B A;  4O2B F;  1N32 H;  3TIN A;  4K0K H;  3PW4 A;  4MV6 A;  5BPF A;  2C35 B;  4RZR A;  1TWA A;  3KHG A;  3JSN A;  4TV8 F;  4J9O A;  2YYA A;  1K83 A;  2C28 A;  3Q8S B;  2W6O A;  4FS2 A;  1Y1V G;  2Y0S A;  4JV2 A;  5LA6 F;  4C5C A;  1JDB B;  2PMZ A;  2W6Z A;  1S68 A;  4EFB A;  2R8I A;  2O03 A;  5BR8 H;  1BXR A;  1KBL A;  3UQ8 A;  3PW7 A;  4ED1 A;  4ED2 A;  4O3N A;  3ORQ A;  3OHB A;  3T5K A;  4J9R A;  4J9N A;  1EUD B;  4MAM A;  2HGS A;  2YZG A;  4WD3 A;  5DLF A;  2B63 G;  3JRW A;  2WAQ A;  4DL6 A;  4A3I G;  2JA6 A;  4IHJ F;  4ME6 A;  3FKI G;  4J9S A;  5EOY A;  3QZ7 A;  2HHH H;  3T1H H;  2J6S A;  2E2H A;  5C4X G;  3MR2 A;  1Y1W A;  3KHH A;  4I4T F;  4AYB E;  1KJQ A;  3GQC A;  4JI0 H;  2MCT A;  2VPQ A;  2W9B A;  4YJ3 F;  4PWQ A;  5HBR B;  3Q8R B;  2R8H A;  3OHA A;  2ZM6 H;  3CQZ A;  4A2A A;  4RB2 C;  3GV8 B;  4O3S A;  3N43 B;  5FPR A;  1CQJ B;  4EG0 A;  4Q45 A;  4EYI B;  1CQI B;  2VPS A;  4ED3 A;  3GIK A;  1FKA H;  2JEG A;  1M6V A;  4JI1 H;  1UNN C;  1XMQ H;  5JQW A;  2JEJ A;  2IMW P;  1XMO H;  5C8Y F;  4LF9 H;  2NVX A;  5KG2 A;  1KJ8 A;  2R6F A;  3RFC A;  5L9X A;  1WCM G;  4QIW E;  1JXL A;  2UVR A;  2DLN A;  3NGD A;  4ED8 A;  4Q8F A;  2W6P A;  4RZQ A;  5CA1 F;  4DV2 H;  4R8U B;  5KT2 A;  4MV3 A;  1GO3 E;  2ZDQ A;  5KT6 A;  5T14 A;  2C2R A;  2B63 A;  2IP4 A;  3L4K A;  1T94 A;  2I80 A;  3ETJ A;  4O4I F;  2RDJ A;  4WBN F;  3CVZ A;  3GIQ A;  4LF6 H;  4EBE A;  5KFB A;  5FPO A;  1JIH A;  3MFI A;  1N56 A;  3GTK A;  4MA0 A;  2FB9 A;  4TUY F;  1JLL B;  5LL6 b;  3H40 A;  4QW9 A;  4EBC A;  1WH2 A;  4LFA H;  5LYJ F;  2WTF A;  4HNU A;  4UCO A;  4JI8 H;  1I7L A;  3ETH A;  5CA0 F;  2XGQ A;  4LF5 H;  3KAL A;  1GSA A;  2NU9 B;  4F4X A;  3RB6 A;  4CC6 A;  4ECY A;  1ZHS A;  4A3F G;  1OWT A;  3TIG A;  1T3N A;  1WSC A;  2ASJ A;  1N34 H;  1DV1 A;  4BY1 G;  3RUP A;  1S10 A;  3VPD A;  3RBD A;  4NXN H;  4BBS G;  3N41 B;  1MZB A;  1RJR A;  4HR7 A;  3K5H A;  3MWE A;  2YW2 A;  3EYY A;  2CW8 A;  3H0G G;  4I7H A;  1KJI A;  1WCM A;  1X9N A;  4DR5 H;  1V9P A;  2AU0 A;  4EEY A;  5JVL A;  3GTM A;  1GLV A;  4B3S H;  1GSO A;  5C44 G;  4DUY H;  1GGO A;  3T5L A;  1HNX H;  3BJY A;  1ZHQ A;  4DV0 H;  4UCS A;  2DPI A;  1W93 A;  2Y0S E;  4YY3 H;  4EBD A;  2PMZ E;  5FLM G;  5L1K A;  5D1P A;  3JZI A;  3G8C A;  3RJ0 A;  2YS6 A;  4YHH H;  3HB9 A;  2XD4 A;  2R84 A;  2R87 A;  3GII A;  2Q2T A;  1SEI A;  2UUA H;  1E4F T;  4RU9 A;  3TQ1 A;  2W7O A;  4DV1 H;  3RGX A;  3PO2 G;  3K5I A;  3GTG A;  3PR4 A;  2R7K A;  3GTJ A;  3HOZ G;  1S0M A;  2AQ4 A;  5DQH A;  5BPH A;  4TQR A;  2XGP A;  4U6P A;  1IOW A;  5LP6 F;  2CQY A;  4ECZ A;  3SI8 A;  4DR6 H;  3GTP A;  2R92 A;  2PVP A;  2FK3 A;  4Y8V B;  2XIG A;  4GC6 A;  4IWX A;  5CAE B;  4MV8 A;  4C2M A;  1EUC B;  4GKK H;  3Q8P B;  3RV3 A;  2BR0 A;  3TII A;  1S0O A;  3Q8Q B;  1I50 A;  4UFZ A;  1B6S A;  5DGA A;  4DR7 H;  2V4Q A;  4ECU A;  1TWG A;  4LH7 A;  4J9M A;  2BQ3 A;  4LFC H;  1TWF A;  4YB8 B;  4JV0 A;  3GLK A;  2C2E A;  3H20 A;  3E5N A;  2WE6 A;  2W6M A;  4JUZ A;  1K1S A;  5DG9 A;  5LXT F;  2VR1 A;  2R8J A;  1KJJ A;  1XNR H;  3PW5 A;  3T5H A;  2W9A A;  2HVR A;  1RYS A;  5KFT A;  5IP7 G;  2NU7 B;  1A0I A;  2DZD A;  3SE7 A;  3RGZ A;  5F9L A;  1RYR A;  5DLG A;  2ASL A;  2PBZ A;  2W9C B;  3L2P A;  4L1K A;  2ZJT A;  3ORR A;  4Q44 A;  1C3O A;  5D8D A;  2XCP A;  3BQ0 A;  1B6R A;  1GSH A;  3IN5 A;  5I47 A;  3J80 W;  5LMN H;  2F4V H;  3GTQ A;  2YRX A;  4JI5 H;  2WDT A;  1DV2 A;  2YRW A;  2KSW A;  4IAJ A;  2R7Z A;  2FLP A;  2FJZ A;  5EDW A;  3PZP A;  2R93 G;  2WYO A;  2W9B B;  2W70 A;  2VQD A;  2JEI A;  2FMA A;  5J2U F;  2VQE H;  3BQ1 A;  3PW0 A;  2PN1 A;  5KFI A;  4FBT A;  4ECQ A;  1JX4 A;  4QWA A;  4O4H F;  3BA9 A;  3MJF A;  3T5J A;  1S9F A;  4B3T H;  5EZY F;  5KFE A;  1AN7 A;  4JI3 H;  4XZ3 B;  4JI7 H;  2M05 A;  4JV1 A;  1GYF A;  4DL3 A;  3GIJ A;  1AUV A;  4I55 F;  4ETS A;  1Z2P X;  1ZET A;  2AGO A;  3GV5 B;  4JV5 H;  3TQT A;  1W96 A;  1Y1V A;  2UU9 H;  4A3G G;  1JDE A;  2GPS A;  5KT4 A;  5C3E G;  4Q43 A;  3MR3 A;  2OLS A;  3BAA A;  4DL2 A;  2QK4 A;  2SCU B;  4J9P A;  2IA6 A;  3GIM A;  1UC9 A;  2UUC H;  3EPG A;  3LML A;  1N33 H;  4LF7 H;  2R85 A;  4TQS A;  4DL5 A;  4A3M G;  4Q8E A;  3MWM A;  1IBM H;  2FK2 A;  3OSN A;  4MV4 A;  2ALZ A;  5GON F;  2IBK A;  4YR2 A;  3M9M B;  2VUM G;  2I87 A;  2UVW A;  3PO3 G;  2UXB H;  2RGV A;  2VA2 A;  4A3D G;  3FKI A;  4LSX A;  4ECT A;  4HNT A;  4CC5 A;  3H3V H;  4G3I A;  5L1J A;  3HBL A;  3MR6 A;  3VPB A;  3PR5 B;  2AGP A;  5EWF A;  3BG5 A;  3WO1 A;  2VOB A;  2W7P A;  2VUG A;  1AUX A;  4YR3 A;  4IRC A;  2CKZ B;  2NU8 B;  4BY7 G;  1BJT A;  1E4E B;  3N8D A;  2XC9 A;  3MFH A;  2R7N A;  4F4Y A;  2RDI A;  2YZN A;  4APM A;  2UVU A;  1SFO A;  2C22 A;  4Q0Y A;  1HNW H;  4R8U A;  2VQF H;  1BNC A;  3PVX A;  2FPG B;  1SCU B;  4ZQI A;  1I6U A;  4IR1 A;  2V9W A;  3GIP A;  4O2A F;  5KG5 A;  1TWC A;  2FLN A;  5KFP A;  2OWO A;  4DV5 H;  2W57 A;  5C5J A;  4UCU A;  1IBK H;  4XYL B;  1M7J A;  1PX2 A;  5DG7 A;  3KAJ A;  4MTD A;  5KFV A;  4QWC A;  5KT7 A;  2UVV A;  1VBG A;  2HVQ A;  1B33 N;  5FD6 A;  5JVD F;  5KFR A;  4LMY A;  2FK1 A;  4A3L G;  4BXX G;  1WR2 A;  4GKJ H;  3R23 A;  3JAM W;  5DQI A;  3V6K A;  1E4G T;  2FPP B;  5H80 A;  2P0A A;  1SYX B;  2VUM A;  2YZM A;  1I94 H;  4EFE A;  1VS0 A;  5IP9 G;  4ECS A;  4GLX A;  5KFF A;  4KHP H;  3FDS A;  5CB4 F;  4IR9 A;  1TWH A;  1O75 A;  2C2D A;  4O3Q A;  2CW7 A;  5K2M A;  3HOU G;  3KHR A;  2R8K A;  5KFC A;  5KFW A;  4A3B G;  5KFA A;  3N42 B;  1R9T A;  2E5L H;  5BMV F;  2AGQ A;  3T1Y H;  3GTO A;  1ULZ A;  4UCT A;  4O3R A;  1RK5 A;  3M9O B;  5KFH A;  5KFZ A;  1BGW A;  4B3M H;  4ED0 A;  5JUM A;  2W6Q A;  4ZI7 F;  2R82 A;  5D1O A;  3I4N G;  4UCR A;  4HQ6 A;  4YBZ B;  4DL7 A;  3U9T A;  3HKZ A;  1A9X A;  1C30 A;  2ATL A;  3BA8 A;  4MV7 A;  3RTX A;  2V5A A;  3I4M G;  2C00 A;  3G6V A;  3EPI A;  4DUZ H;  3V6J A;  5KFJ A;  3H0G A;  4U7C A;  5EWE A;  4QJF A;  2UUB H;  1KJ9 A;  4E4T A;  4LH6 A;  4J9K A;  3GV7 B;  2QYZ A;  4MTE A;  2V58 A;  3V4S A;  1S03 G;  4ZHQ F;  1K1Q A;  3N44 B;  1M0W A;  3V4Z A;  4RNM A;  3QZ8 A;  3BQ2 A;  4DR3 H;  4RAY A;  2GPW A;  3JRX A;  1I3Q A;  3RAX A;  1HR0 H;  4QWD A;  4ECV A;  1RJP A;  2FE3 A;  4IRD A;  4C5B A;  5IYC G;  5KFM A;  4EGJ A;  1B04 A;  4F4Z A;  4XYM B;  3OTO H;  4IRK A;  2E2I A;  5L1I A;  3HOV G;  4ZOL F;  4HNV A;  5C1P A;  3LP8 A;  1KC7 A;  3KXY T;  4O3O A;  4XX0 B;  2FLL A;  1RK6 A;  3J7A K;  3R5F A;  1JKJ B;  4R7R A;  3JSL A;  1KEE A;  4JI4 H;  3GIL A;  2I8C A;  4QWB A;  3RB3 A;  3RB4 A;  5IYD G;  1J5E H;  5KG4 A;  4C5A A;  4YP3 A;  1TAE A;  1DIK A;  4ECW A;  2J6T A;  3OUZ A;  1TA8 A;  4MA5 A;  3WO0 A;  2XCA A;  5KFU A;  5KFQ A;  5C1O A;  4LSA A;  5J2T F;  4F50 A;  3N40 P;  4O3P A;  4RAZ A;  3RF2 A;  5KG3 A;  1XDN A;  4QW8 A;  4DR4 H;  1Z2O X;  5JH7 F;  2JA5 G;  4TV9 F;  1DGS A;  3HXL A;  5KFK A;  3G6X A;  4DR2 H;  1FJG H;  4A3C G;  2W9C A;  2UXC H;  1EZ1 A;  4RNO A;  3V6H A;  2CZG A;  5KT5 A;  4PDB A;  1VBH A;  3BAB A;  5KX5 F;  4I50 F;  4EYH B;  4ECX A;  1N48 A;  2NU6 B;  4IWY A;  4GC7 A;  1IBL H;  4BWS C;  4YR0 A;  4J0M A;  4MV9 A;  2Q2U A;  3M9N B;  3AYH B;  1N36 H;  3UFX B;  5IYB G;  4LFB H;  4YAJ B;  3HOW G;  3QFF A;  2WB1 A;  3OSP A;  5KFD A;  1V51 A;  4J9L A;  4X64 H;  4A3E G;  5IWA H;  3DF7 A;  1EYZ A;  4DV3 H;  4BBR G;  3G6Y A;  3RIZ A;  3WNZ A;  2ZDH A;  3PN1 A;  3GTL A;  2BQR A;  4RB3 C;  3N6X A;  2W8L A;  3I12 A;  3R5X A;  3VMM A;  2XCL A;  2YS7 A;  2VA3 A;  1EHI A;  2R86 A;  4OX9 H;  2HJW A;  1IOV A;  5FLX W;  4RB1 A;  4O4L F;  2NUA B;  5KG0 A;  5DGB A;  4YJ2 F;  4J9Q A;  5IT9 W;  2J9G A;  3GID A;  4LF8 H;  4HYK A;  2JA5 A;  2ZDG A;  3Q1K A;  5F9N A;  4F4W A;  4DR1 H;  2YCH A;  5KFY A;  2V59 A;  4IZO A;  3H4D A;  5KKN B;  1T36 A;  4ED7 A;  1UC8 A;  4X66 H;  4ECR A;  3MWD A;  4DL4 A;  4AYB A;  5EWG A;  3FMA A;  2X0S A;  1HNZ H;  3K3V A;  5KFO A;  4UCV A;  5KFG A;  3HKZ E;  2W8K A;  1S97 A; 
#chains in the Genus database with same CATH homology
 4M7E A;  4K0K H;  2VPS A;  1P8L A;  3T1Y H;  1A0I A;  3RGZ A;  1BGW A;  1FKA H;  4B3M H;  3J81 W;  4JI1 H;  1XMQ H;  5D1O A;  3L2P A;  4UCR A;  2ZJT A;  4JI6 H;  4LF9 H;  1XMO H;  4RB0 A;  3BA8 A;  4MV7 A;  3RTX A;  3KAK A;  3J80 W;  5LMN H;  4DUZ H;  2F4V H;  4JI5 H;  2WDT A;  2KSW A;  4IAJ A;  4RZQ A;  2RGR A;  4DV2 H;  3F8N A;  2WYO A;  4X62 H;  2HVR A;  2UUB H;  3L4K A;  4LH6 A;  2VQE H;  5LMU H;  4MTE A;  1S03 G;  3CVZ A;  2HVS A;  4LF6 H;  3BA9 A;  4JI2 H;  4B3T H;  3N44 B;  1M0W A;  5FPO A;  4DR3 H;  4JI3 H;  1AN7 A;  1HR0 H;  4RAY A;  4JI7 H;  2FE3 A;  5FD5 A;  1GYF A;  1B04 A;  5LL6 b;  3OTO H;  4ETS A;  1WH2 A;  4LFA H;  1Z2P X;  4JI8 H;  4JV5 H;  4LF4 H;  3KXY T;  4UCO A;  1XNQ H;  5D1O B;  4LF5 H;  4DV7 H;  2UU9 H;  1L2Z A;  3KAL A;  3J7A K;  1M0T A;  4R7R A;  3JSL A;  4JI4 H;  1Z2N X;  3BAA A;  3M4I A;  4CC6 A;  1ZHS A;  2UUC H;  1J5E H;  3LML A;  1N33 H;  4LF7 H;  1TAE A;  4B3R H;  4AQY H;  3MWM A;  1N34 H;  1TA8 A;  1IBM H;  4NXN H;  4EEQ A;  4X65 H;  1FVI A;  3N41 B;  1MZB A;  3C0F B;  4LSA A;  2UXB H;  3N40 P;  3RF2 A;  4RAZ A;  4DV4 H;  2RGV A;  1XDN A;  4LSX A;  1Z2O X;  4DR4 H;  1DGS A;  3HXL A;  4CC5 A;  3EYY A;  5A2Q W;  2CW8 A;  4DR2 H;  4I7H A;  3IG0 A;  2UXC H;  1X9N A;  4DR5 H;  1V9P A;  2UXD H;  2VOB A;  4PDB A;  2VUG A;  3BAB A;  4B3S H;  4FM9 A;  4NXM H;  4DUY H;  4DV6 H;  1BJT A;  1HNX H;  3L4J A;  1ZHQ A;  4DV0 H;  4UCS A;  4JYA H;  4YY3 H;  1IBL H;  5D1P A;  4A2B A;  4APM A;  4BWS C;  4J0M A;  4MV9 A;  4Q0Y A;  1HNW H;  1N32 H;  3RJ0 A;  2VQF H;  2Q2U A;  1N36 H;  4YHH H;  4LFB H;  2Q2T A;  3JSN A;  1SEI A;  2UUA H;  1E4F T;  1I6U A;  4X64 H;  5IWA H;  3DF7 A;  4DV1 H;  4EFB A;  1S68 A;  3RGX A;  4DV3 H;  2O03 A;  3RIZ A;  5BR8 H;  2OWO A;  4DV5 H;  3PN1 A;  2W57 A;  3UQ8 A;  4RB3 C;  4UCU A;  1IBK H;  3N6X A;  4DR6 H;  2HGS A;  3KAJ A;  4MTD A;  2HVQ A;  5FD6 A;  4GKJ H;  2XIG A;  4LMY A;  4OX9 H;  3JAM W;  5EOY A;  2HHH H;  1E4G T;  3T1H H;  4GKK H;  5FLX W;  1SYX B;  4RB1 A;  1I94 H;  4UFZ A;  4JI0 H;  5IT9 W;  4EFE A;  4DR7 H;  1VS0 A;  2MCT A;  4LF8 H;  4LH7 A;  4GLX A;  4KHP H;  4LFC H;  1O75 A;  4DR1 H;  2CW7 A;  3H20 A;  2YCH A;  2WE6 A;  2ZM6 H;  4A2A A;  1FJG H;  3N42 B;  4X66 H;  4RB2 C;  2E5L H;  3FMA A;  3N43 B;  5FPR A;  1HNZ H;  3K3V A;  1XNR H;  4UCV A;  4UCT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...