3M4IA

Crystal structure of the second part of the mycobacterium tuberculosis dna gyrase reaction core: the toprim domain at 1.95 a resolution
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
207
structure length
190
Chain Sequence
TDPRKSELYVVEGDSAGMFQAILPLRGRIDRVLKNTEVQAIITALGTGIHDEFDIGKLRYHKIVLMADADVDGQHISTLLLTLLFRFMRPLIENGHVFLAQPPLYKLKWQRSDPEFAYSDRERDGLLEAGLKAGKKINKEDGIQRYKGLGEMDAKELWETTMDPSVRVLRQVTLDDAAAADELFSILMGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural insights into the quinolone resistance mechanism of Mycobacterium tuberculosis DNA gyrase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Isomerase
molecule keywords DNA gyrase subunit B
total genus 60
structure length 190
sequence length 207
ec nomenclature ec 5.99.1.3: Transferred entry: 5.6.2.3.
pdb deposition date 2010-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00986 DNA_gyraseB_C DNA gyrase B subunit, carboxyl terminus
A PF01751 Toprim Toprim domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.440 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Dna Ligase; domain 1 3m4iA02
3M4IA 3IG0A 2ZJTA
chains in the Genus database with same CATH superfamily
3M4IA 3WNZA 1TWAA 4BXXG 4EEQA 3FKIA 3VMMA 5KFAA 4I50F 1DIKA 5EWEA 1BNCA 3J7AK 4MV3A 1O75A 3M9OB 4J9SA 4DL5A 1TWCA 4JI3H 2YZMA 5KG4A 4A3FG 3PW0A 4A2AA 2R92G 5KFXA 3GV5B 1HNZH 5K2MA 2FB9A 3JRXA 1S10A 2J6UA 5C4XG 1DV2A 2XGPA 2AQ4A 2FPPB 3MWMA 3VPBA 4RZRA 2R7MA 3KHHA 3PVXA 3K3VA 5KFNA 4FBTA 3BQ0A 3WO1A 2JA7G 2R7ZG 2R7LA 2WE6A 3PR4A 4IWYA 3H20A 1ZETA 2B63A 4ETSA 1VS0A 5KFTA 2JA8G 3JSLA 4HNTA 4DV1H 1Y1VA 2PN1A 3RTXA 3LWBA 3RV4A 3V6HA 3RAQA 2OWOA 1KJQA 3Q8RB 4RNOA 2FMAA 3RBDA 2J6TA 1IOWA 4QIWE 4UCOA 2W57A 1GO3E 1DV1A 1M6VA 4O3SA 5J2TF 1WSCA 3BQ1A 4FBUA 5KT7A 3IN5A 4O3PA 1GSAA 4ED7A 3RUPA 3RV3A 1DGSA 2V4RA 1RJPA 2I87A 4O2BF 1J5EH 1N33H 1GLVA 4FM9A 3RB6A 2HJWA 1E4EA 1I94H 2IA6A 1I50A 3U9SA 3OHAA 3BJYA 1WH2A 4HNUA 2CQYA 4ED0A 2I80A 2O03A 3IG0A 2R8IA 5KFVA 4R8UB 5L1IA 2KSWA 5DG7A 4R7RA 5DQGA 1RJQA 4EGJA 3H4BA 2FPIB 2W6OA 3V4ZA 3H40A 4NLGA 5DGBA 2R8GA 4QIWA 5F9NA 2CW7A 4I4TF 2R86A 5KX5F 5CB4F 1XNRH 5LL6b 4B3RH 2AU0A 2CKZB 1TWHA 1T3NA 1V4YA 4ME6A 2R93G 4MV8A 2CW8A 3KHGA 4F4YA 5KT3A 5BMVF 3ORQA 4ZOLF 2AGPA 2YYAA 3EPGA 4LSXA 4LF4H 1KJ9A 1SYXB 1EYZA 4YJ2F 1SCUB 5FD5A 4MTEA 4ECUA 2F4VH 4YB8B 3CVZA 1S9FA 2JEIA 2BQUA 5DQIA 5JVLA 2R7NA 4C2MA 3HOZG 3FMAA 3LMLA 2HVRA 5L1KA 2X0SA 4XZ3B 1TAEA 3GIIA 1XMQH 4A3EG 5LA6F 2W8KA 3EPIA 4QWBA 4F50A 3QFFA 3RB4A 3HXLA 3OSPA 1GYFA 3L2PA 3DF7A 3PO2G 1E4GT 4IRKA 2JEFA 4Q8FA 2W8LA 4DL4A 5EZYF 1RYSA 3JAMW 3F8NA 3RB0A 2V58A 5IYCG 5JH7F 2W9BB 4KHPH 2WB1E 5KFUA 5HBRB 4JV2A 3PN1A 2ZDQA 4DR4H 4ECQA 4X66H 3AYHB 4XX0B 3RJ0A 3KXYT 4LFBH 2HHHH 2JEGA 4QJFA 5DGAA 2JA5A 3KAKA 4DL3A 1WCMA 4A3LG 2J9GA 2W6QA 4IZOA 3KAJA 4RNMA 2W9AA 5LMUH 2YRWA 2ASLA 4DUYH 2C2DA 2E5LH 2YU9A 4BY7G 5KFMA 4RB0A 1WR2A 4B3TH 4MV6A 4LMYA 3MFIA 4IR9A 4LFAH 3HKZE 3UQ8A 4RB3C 2NU9B 4DV5H 4X64H 3TINA 4J9LA 2UVWA 3HOWG 3RFCA 5HV6A 2FK2A 4J0MA 1JDBB 4E4TA 3HOUG 3Q2OA 3V6KA 3Q1KA 3G6YA 2NVXA 5KFOA 3R5HA 3U9TA 1T36A 4GKKH 1EUCB 2BQ3A 2R87A 2XIGA 3VPCA 1KBLA 2R8HA 5F9LA 1TA8A 4WD3A 4YR3A 3Q8SB 2YL2A 4CC6A 2UUCH 4M9UA 2YS6A 4DV7H 2WAQE 3I4NG 4ECRA 1N34H 3K5HA 4ZHQF 2W9BA 1B6RA 3HBLA 3HKZA 4UCTA 4M7EA 3L4JA 4A3CG 1S03G 2ASDA 2FLNA 5KFFA 3GIMA 2BQRA 2W70A 5KT4A 4PWQA 2ZDHA 4RNNA 4JI1H 5JQWA 2CZGA 3GIDA 4LH7A 5KFQA 5KFCA 3RAXA 1S0MA 1UNNC 1S0NA 1FKAH 1FJGH 5GONF 4MAMA 4EYIB 4DR2H 4QWCA 4ZI7F 3Q8PB 2VQFH 3RGZA 3J80W 4GC7A 2C28A 1C30A 5KFGA 2P0AA 3JSNA 2V5AA 3HB9A 3MWDA 1RJRA 1UC9A 4ECXA 2ALZA 3GIQA 1E4FT 2XCAA 4YAKB 5L1LA 4A93G 3N42B 3PZPA 4DR1H 3HOVG 1M0WA 3N8DA 4RAZA 1N56A 4FS1A 3QZ8A 2I8CA 2FP4B 5CA1F 1JX4A 2UUAH 4TV9F 2FJZA 4ZQIA 3MR2A 2RGRA 4C5BA 1N48A 3GQCA 2DZDA 4JI7H 2YZGA 3I12A 4RB2C 4LF7H 2JA6G 4A3BG 3R5FA 2IMWP 3WO0A 2B63G 3GTQA 3M9NB 4DV0H 1S97A 4YP3A 2R7ZA 2JA7A 5KFRA 4LSAA 1Z2PX 4I7HA 2W9CB 3PW2A 4J9KA 3TIGA 1VKZA 1GGOA 3UFXB 3C0FB 4UCSA 1IOVA 3RB3A 4HNVA 2RDIA 5CAEB 5FLXW 4A3DG 4J9NA 2VPSA 3HOYG 2OH2A 2HVSA 5BR8H 2E2HA 5IYBG 2JA6A 3TQTA 3GTMA 4JI8H 4AYBE 2ZDGA 4YR2A 2VQEH 5A2QW 2R92A 4HYKA 1AN7A 4EFBA 4QWAA 3GTPA 5DLFA 5LOVF 2DLNA 2NU7B 3GILA 2ZM6H 2C2RA 3BA9A 3GV8B 5KFBA 5I47A 5KFJA 1KC7A 4ECSA 4Q8EA 3MR5A 3OUUA 1B04A 1OWTA 4IRCA 2Q2UA 2W71A 3QZ7A 4JV5H 4A3IG 4J9MA 2GPWA 1Y1WA 1VBHA 4A3JG 5JUMA 1HNXH 1JLLB 3N40P 3HOXG 2FK1A 2HVQA 2ATLA 4B3MH 4ED1A 4JI0H 1XNQH 2UXBH 4LFCH 2XCLA 1HR0H 1L2ZA 2BR0A 4XYMB 3GIPA 1K83A 4UCRA 1IBKH 2NUAB 5D1OA 3OSNA 5FPOA 1CQJB 2HGSA 1BGWA 1V51A 3BAAA 3K5IA 3OHBA 1XMOH 4CC5A 3V4SA 2VUMA 1W96A 5IYDG 4GC6A 2WYOA 5KKNB 4O4LF 4RZQA 1EHIA 4XYLB 4O3RA 2VA3A 5L9XA 1M7JA 4ECZA 2VOBA 1KJ8A 1I7NA 4X65H 4Q43A 2R7KA 2ZJTA 3MJFA 4F4WA 4ECWA 4JI5H 4U6PA 4YY3H 4O2AF 1A0IA 1XDNA 2R8KA 2VR1A 3ORRA 2NU6B 5FD6A 2XCPA 2IBKA 3PR5B 4OX9H 2W6MA 5KG3A 4LF5H 2QK4A 4MV1A 2PVPA 4EG0A 5FJ8G 2R82A 3J81W 4EFEA 4RUAA 1VBGA 5IYZF 4BBSG 1HNWH 2WDTA 5KG7A 1BXRA 3RGXA 1IBMH 3N44B 1S0OA 5KFKA 3MWEA 1WCMG 5KG2A 2JA5G 3KTMA 4ED8A 1JKJB 1TWGA 4L1KA 1AUXA 3GLKA 2AGQA 2PBZA 3G8CA 2DIKA 5BPFA 4ED2A 1KJJA 2GLTA 5KFZA 4HR7A 1CE8A 5C1PA 5EWGA 5C44G 2UVVA 2VPQA 4ECVA 2OLSA 4DV3H 4IRDA 5DQHA 5LXTF 2FKLA 5LMNH 4A3GG 1ZHSA 1ZQ7A 2RF4A 3G6XA 2YCHA 4RU9A 5KFHA 3PW5A 4YQWA 1R9TA 4DL2A 2FLPA 3R23A 5KG5A 4Q44A 4JV0A 2ASJA 1B33N 1JXLA 2VA2A 1RYRA 4DR5H 3I4MG 4BBRG 2C35B 3N43B 4Y8VB 3T5KA 4J9RA 3N6XA 4JI6H 2NU8B 2E2IA 4YHHH 2Y0SA 3G6VA 2DPIA 4O3NA 2QYZA 2Q2TA 3GTJA 4QW8A 2V9WA 5BPHA 1Y14B 5D1OB 3M9MB 3LP8A 2YRXA 2W6PA 4O3QA 4GKJH 5C5JA 2R84A 3RBEA 3ETJA 4A2BA 1B6SA 3KHLA 4QW9A 2R93A 1T94A 3L4KA 3VPDA 5IP9G 1N36H 1P8LA 4APMA 3MFHA 4RAYA 4TQRA 1GSOA 4J9OA 3OUZA 4NXNH 1CS0A 4DR6H 3KALA 5C1OA 5C8YF 4YR0A 2YZNA 4O4HF 4QWEA 5T14A 3TQ1A 2W6ZA 1W93A 5KFEA 3TIIA 3H0GA 5KFWA 3BG5A 2GPSA 4FS2A 4JI2H 1IBLH 2DPJA 1K1SA 1RK6A 4MTDA 3E5NA 2PMZE 2AGOA 3BQ2A 4IHJF 2FPGB 3H0GG 4JV1A 5CA0F 2VQDA 5FPRA 2FE3A 5DLGA 1Z2OX 4G3IA 1I6UA 5IT9W 2J6SA 5KG0A 1ULZA 5DG9A 2W7OA 4EBCA 2JEJA 5KG6A 5D1PA 2UVRA 1X9NA 4MV7A 4DV6H 2NVYA 3EYYA 1Y1VG 4WBNF 4IWXA 3FDSA 1UC8A 4TUYF 3GIKA 4ECTA 5KT6A 5EWFA 3ETHA 4J9QA 4JYAH 2M05A 4TV8F 1I3QA 3RIZA 2V4QA 2R85A 3OTOH 4J9PA 4DL7A 1CQIB 3Q8QB 5IWAH 5IP7G 3GV7B 3PO3G 4EGQA 2UXCH 2UVUA 3K3PA 3T5LA 4DV4H 4NXMH 4FU0A 3BA8A 4O3OA 4ED3A 3PW4A 2WTFA 1C3OA 2UUBH 3V6JA 4IAJA 4F4XA 3GTLA 1M0TA 3T1HH 2MCTA 4BY1G 2XGQA 3H3VH 5L1JA 1S68A 1RK5A 4B3SH 5DG8A 4LH6A 4HQ6A 4LF9H 3SE7A 4I55F 3KHRA 3GTOA 4K0KH 3T5JA 3R5XA 4ECYA 3FKIG 2W6NA 2R6FA 1ZHQA 4EEYA 5KFSA 4X62H 1JIHA 1MZBA 2W7PA 5KG1A 2PMZA 2C22A 3GTKA 1FVIA 4RB1A 4QWDA 4GLXA 4Q0YA 1SFOA 4MV9A 1BJTA 3JZIA 4UCUA 3N41B 4A3MG 3BABA 2VUGA 5LP6F 1PX2A 2R8JA 2C00A 2FLLA 5KFDA 4LF6H 2YS7A 2XD4A 5J2UF 2RDJA 4EBDA 1E4EB 4DL6A 4UCVA 4MA0A 4C5AA 5KFYA 1N32H 5JVDF 1I7LA 4AYBA 4YAJB 2RGVA 4EBEA 4MV4A 2WAQA 4DLKA 4C5CA 5H80A 4BWSC 5D8DA 5C3EG 4IR1A 1SEIA 3H4DA 5EOYA 4YJ3F 3MR6A 1PK8A 1AUVA 2SCUB 4EYHB 3NGDA 4DV2H 1K1QA 2UU9H 5KT2A 4A3KG 2IP4A 2Y0SE 1TWFA 2DWCA 5KFLA 4DR7H 4MA5A 3T1YH 4U7CA 1GSHA 2V59A 1JDEA 4ED6A 4YBZB 2W9CA 5FLMG 2UXDH 2VUMG 4JUZA 3GIJA 3T5HA 3JRWA 2FK3A 3RF2A 1VAJA 4RUCA 1EUDB 5KT5A 4JI4H 2XC9A 2YW2A 4R8UA 3MR3A 4DUZH 1Z2NX 5KFIA 2C2EA 4UFZA 1A9XA 5LYJF 1V9PA 1KEEA 4DR3H 3GTGA 5KFPA 1Y1WG 4PDBA 4F4ZA 4AQYH 4LF8H 3SI8A 1EZ1A 2WB1A 3PW7A 1KJIA 4Q45A 4O4IF 5EDWA 3CQZA 4TQSA
chains in the Genus database with same CATH topology
3KXYT 3M4IA 3N40P 1XNQH 2HVQA 4JI0H 4LFBH 2HHHH 4EEQA 2UXBH 4LFCH 3KAKA 1L2ZA 5FPRA 1HR0H 2FE3A 1Z2OX 5IT9W 1I6UA 3KAJA 4UCRA 5LMUH 1IBKH 3J7AK 5D1OA 1O75A 5FPOA 4DUYH 2E5LH 4JI3H 2HGSA 1BGWA 3BAAA 4RB0A 5D1PA 1XMOH 1X9NA 4MV7A 4LMYA 4CC5A 4DV6H 4B3TH 3EYYA 4A2AA 4LFAH 3UQ8A 4RB3C 4DV5H 2WYOA 4X64H 1HNZH 4RZQA 4JYAH 2VOBA 4J0MA 3RIZA 3OTOH 1HNXH 4X65H 2ZJTA 4JI5H 5IWAH 4YY3H 3MWMA 1A0IA 1XDNA 4GKKH 2UXCH 2XIGA 3K3VA 5FD6A 4DV4H 1TA8A 4NXMH 4OX9H 2WE6A 3BA8A 4LF5H 4CC6A 3H20A 4DV7H 2UUBH 4ETSA 1N34H 1VS0A 4IAJA 3L4JA 3JSLA 4UCTA 4M7EA 1M0TA 4EFEA 3J81W 4DV1H 3RTXA 3T1HH 2MCTA 1S03G 1S68A 1HNWH 2OWOA 2WDTA 4B3SH 4LH6A 4JI1H 3RGXA 1IBMH 4LF9H 3N44B 4UCOA 2W57A 4LH7A 4K0KH 1FKAH 1FJGH 1ZHQA 4DR2H 4X62H 2VQFH 1MZBA 1DGSA 3RGZA 3J80W 1J5EH 1N33H 4FM9A 1I94H 1FVIA 3JSNA 4RB1A 4GLXA 4Q0YA 1WH2A 4MV9A 1E4FT 2O03A 1BJTA 3IG0A 3N42B 4UCUA 3N41B 3BABA 2KSWA 2VUGA 4R7RA 4DV3H 2UUCH 4DR1H 4LF6H 1M0WA 5LMNH 4RAZA 1ZHSA 2CW7A 2YCHA 2UUAH 4UCVA 2RGRA 1XNRH 1N32H 5LL6b 4JI7H 4B3RH 4RB2C 4LF7H 2RGVA 4DR5H 3N43B 2CW8A 4BWSC 4DV0H 3N6XA 1SEIA 4JI6H 5EOYA 4B3MH 4LSAA 4YHHH 1Z2PX 4I7HA 2Q2TA 4DV2H 2UU9H 3C0FB 4UCSA 4LSXA 5D1OB 4LF4H 4DR7H 1SYXB 2F4VH 5FD5A 4MTEA 5FLXW 3T1YH 4GKJH 3CVZA 4A2BA 2VPSA 2HVSA 5BR8H 3L4KA 3FMAA 3LMLA 2HVRA 4JI8H 2UXDH 2VQEH 1XMQH 1TAEA 1P8LA 4APMA 5A2QW 1N36H 3RF2A 1AN7A 4EFBA 4RAYA 4JI4H 4DR6H 4NXNH 3HXLA 3KALA 3L2PA 2ZM6H 3DF7A 4DUZH 1Z2NX 1GYFA 3BA9A 1E4GT 4UFZA 4DR3H 1V9PA 3JAMW 3F8NA 4JI2H 4PDBA 4KHPH 1B04A 4AQYH 1IBLH 2Q2UA 4LF8H 4JV5H 4MTDA 3PN1A 4DR4H 4X66H 3RJ0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4I A;  3IG0 A;  2ZJT A; 
#chains in the Genus database with same CATH topology
 3M4I A;  3WNZ A;  1TWA A;  4BXX G;  4EEQ A;  3FKI A;  3VMM A;  5KFA A;  4I50 F;  1DIK A;  5EWE A;  1BNC A;  3J7A K;  4MV3 A;  1O75 A;  3M9O B;  4J9S A;  4DL5 A;  1TWC A;  4JI3 H;  2YZM A;  5KG4 A;  4A3F G;  3PW0 A;  4A2A A;  2R92 G;  5KFX A;  3GV5 B;  1HNZ H;  5K2M A;  2FB9 A;  3JRX A;  1S10 A;  2J6U A;  5C4X G;  1DV2 A;  2XGP A;  2AQ4 A;  2FPP B;  3MWM A;  3VPB A;  4RZR A;  2R7M A;  3KHH A;  3PVX A;  3K3V A;  5KFN A;  4FBT A;  3BQ0 A;  3WO1 A;  2JA7 G;  2R7Z G;  2R7L A;  2WE6 A;  3PR4 A;  4IWY A;  3H20 A;  1ZET A;  2B63 A;  4ETS A;  1VS0 A;  5KFT A;  2JA8 G;  3JSL A;  4HNT A;  4DV1 H;  1Y1V A;  2PN1 A;  3RTX A;  3LWB A;  3RV4 A;  3V6H A;  3RAQ A;  2OWO A;  1KJQ A;  3Q8R B;  4RNO A;  2FMA A;  3RBD A;  2J6T A;  1IOW A;  4QIW E;  4UCO A;  2W57 A;  1GO3 E;  1DV1 A;  1M6V A;  4O3S A;  5J2T F;  1WSC A;  3BQ1 A;  4FBU A;  5KT7 A;  3IN5 A;  4O3P A;  1GSA A;  4ED7 A;  3RUP A;  3RV3 A;  1DGS A;  2V4R A;  1RJP A;  2I87 A;  4O2B F;  1J5E H;  1N33 H;  1GLV A;  4FM9 A;  3RB6 A;  2HJW A;  1E4E A;  1I94 H;  2IA6 A;  1I50 A;  3U9S A;  3OHA A;  3BJY A;  1WH2 A;  4HNU A;  2CQY A;  4ED0 A;  2I80 A;  2O03 A;  3IG0 A;  2R8I A;  5KFV A;  4R8U B;  5L1I A;  2KSW A;  5DG7 A;  4R7R A;  5DQG A;  1RJQ A;  4EGJ A;  3H4B A;  2FPI B;  2W6O A;  3V4Z A;  3H40 A;  4NLG A;  5DGB A;  2R8G A;  4QIW A;  5F9N A;  2CW7 A;  4I4T F;  2R86 A;  5KX5 F;  5CB4 F;  1XNR H;  5LL6 b;  4B3R H;  2AU0 A;  2CKZ B;  1TWH A;  1T3N A;  1V4Y A;  4ME6 A;  2R93 G;  4MV8 A;  2CW8 A;  3KHG A;  4F4Y A;  5KT3 A;  5BMV F;  3ORQ A;  4ZOL F;  2AGP A;  2YYA A;  3EPG A;  4LSX A;  4LF4 H;  1KJ9 A;  1SYX B;  1EYZ A;  4YJ2 F;  1SCU B;  5FD5 A;  4MTE A;  4ECU A;  2F4V H;  4YB8 B;  3CVZ A;  1S9F A;  2JEI A;  2BQU A;  5DQI A;  5JVL A;  2R7N A;  4C2M A;  3HOZ G;  3FMA A;  3LML A;  2HVR A;  5L1K A;  2X0S A;  4XZ3 B;  1TAE A;  3GII A;  1XMQ H;  4A3E G;  5LA6 F;  2W8K A;  3EPI A;  4QWB A;  4F50 A;  3QFF A;  3RB4 A;  3HXL A;  3OSP A;  1GYF A;  3L2P A;  3DF7 A;  3PO2 G;  1E4G T;  4IRK A;  2JEF A;  4Q8F A;  2W8L A;  4DL4 A;  5EZY F;  1RYS A;  3JAM W;  3F8N A;  3RB0 A;  2V58 A;  5IYC G;  5JH7 F;  2W9B B;  4KHP H;  2WB1 E;  5KFU A;  5HBR B;  4JV2 A;  3PN1 A;  2ZDQ A;  4DR4 H;  4ECQ A;  4X66 H;  3AYH B;  4XX0 B;  3RJ0 A;  3KXY T;  4LFB H;  2HHH H;  2JEG A;  4QJF A;  5DGA A;  2JA5 A;  3KAK A;  4DL3 A;  1WCM A;  4A3L G;  2J9G A;  2W6Q A;  4IZO A;  3KAJ A;  4RNM A;  2W9A A;  5LMU H;  2YRW A;  2ASL A;  4DUY H;  2C2D A;  2E5L H;  2YU9 A;  4BY7 G;  5KFM A;  4RB0 A;  1WR2 A;  4B3T H;  4MV6 A;  4LMY A;  3MFI A;  4IR9 A;  4LFA H;  3HKZ E;  3UQ8 A;  4RB3 C;  2NU9 B;  4DV5 H;  4X64 H;  3TIN A;  4J9L A;  2UVW A;  3HOW G;  3RFC A;  5HV6 A;  2FK2 A;  4J0M A;  1JDB B;  4E4T A;  3HOU G;  3Q2O A;  3V6K A;  3Q1K A;  3G6Y A;  2NVX A;  5KFO A;  3R5H A;  3U9T A;  1T36 A;  4GKK H;  1EUC B;  2BQ3 A;  2R87 A;  2XIG A;  3VPC A;  1KBL A;  2R8H A;  5F9L A;  1TA8 A;  4WD3 A;  4YR3 A;  3Q8S B;  2YL2 A;  4CC6 A;  2UUC H;  4M9U A;  2YS6 A;  4DV7 H;  2WAQ E;  3I4N G;  4ECR A;  1N34 H;  3K5H A;  4ZHQ F;  2W9B A;  1B6R A;  3HBL A;  3HKZ A;  4UCT A;  4M7E A;  3L4J A;  4A3C G;  1S03 G;  2ASD A;  2FLN A;  5KFF A;  3GIM A;  2BQR A;  2W70 A;  5KT4 A;  4PWQ A;  2ZDH A;  4RNN A;  4JI1 H;  5JQW A;  2CZG A;  3GID A;  4LH7 A;  5KFQ A;  5KFC A;  3RAX A;  1S0M A;  1UNN C;  1S0N A;  1FKA H;  1FJG H;  5GON F;  4MAM A;  4EYI B;  4DR2 H;  4QWC A;  4ZI7 F;  3Q8P B;  2VQF H;  3RGZ A;  3J80 W;  4GC7 A;  2C28 A;  1C30 A;  5KFG A;  2P0A A;  3JSN A;  2V5A A;  3HB9 A;  3MWD A;  1RJR A;  1UC9 A;  4ECX A;  2ALZ A;  3GIQ A;  1E4F T;  2XCA A;  4YAK B;  5L1L A;  4A93 G;  3N42 B;  3PZP A;  4DR1 H;  3HOV G;  1M0W A;  3N8D A;  4RAZ A;  1N56 A;  4FS1 A;  3QZ8 A;  2I8C A;  2FP4 B;  5CA1 F;  1JX4 A;  2UUA H;  4TV9 F;  2FJZ A;  4ZQI A;  3MR2 A;  2RGR A;  4C5B A;  1N48 A;  3GQC A;  2DZD A;  4JI7 H;  2YZG A;  3I12 A;  4RB2 C;  4LF7 H;  2JA6 G;  4A3B G;  3R5F A;  2IMW P;  3WO0 A;  2B63 G;  3GTQ A;  3M9N B;  4DV0 H;  1S97 A;  4YP3 A;  2R7Z A;  2JA7 A;  5KFR A;  4LSA A;  1Z2P X;  4I7H A;  2W9C B;  3PW2 A;  4J9K A;  3TIG A;  1VKZ A;  1GGO A;  3UFX B;  3C0F B;  4UCS A;  1IOV A;  3RB3 A;  4HNV A;  2RDI A;  5CAE B;  5FLX W;  4A3D G;  4J9N A;  2VPS A;  3HOY G;  2OH2 A;  2HVS A;  5BR8 H;  2E2H A;  5IYB G;  2JA6 A;  3TQT A;  3GTM A;  4JI8 H;  4AYB E;  2ZDG A;  4YR2 A;  2VQE H;  5A2Q W;  2R92 A;  4HYK A;  1AN7 A;  4EFB A;  4QWA A;  3GTP A;  5DLF A;  5LOV F;  2DLN A;  2NU7 B;  3GIL A;  2ZM6 H;  2C2R A;  3BA9 A;  3GV8 B;  5KFB A;  5I47 A;  5KFJ A;  1KC7 A;  4ECS A;  4Q8E A;  3MR5 A;  3OUU A;  1B04 A;  1OWT A;  4IRC A;  2Q2U A;  2W71 A;  3QZ7 A;  4JV5 H;  4A3I G;  4J9M A;  2GPW A;  1Y1W A;  1VBH A;  4A3J G;  5JUM A;  1HNX H;  1JLL B;  3N40 P;  3HOX G;  2FK1 A;  2HVQ A;  2ATL A;  4B3M H;  4ED1 A;  4JI0 H;  1XNQ H;  2UXB H;  4LFC H;  2XCL A;  1HR0 H;  1L2Z A;  2BR0 A;  4XYM B;  3GIP A;  1K83 A;  4UCR A;  1IBK H;  2NUA B;  5D1O A;  3OSN A;  5FPO A;  1CQJ B;  2HGS A;  1BGW A;  1V51 A;  3BAA A;  3K5I A;  3OHB A;  1XMO H;  4CC5 A;  3V4S A;  2VUM A;  1W96 A;  5IYD G;  4GC6 A;  2WYO A;  5KKN B;  4O4L F;  4RZQ A;  1EHI A;  4XYL B;  4O3R A;  2VA3 A;  5L9X A;  1M7J A;  4ECZ A;  2VOB A;  1KJ8 A;  1I7N A;  4X65 H;  4Q43 A;  2R7K A;  2ZJT A;  3MJF A;  4F4W A;  4ECW A;  4JI5 H;  4U6P A;  4YY3 H;  4O2A F;  1A0I A;  1XDN A;  2R8K A;  2VR1 A;  3ORR A;  2NU6 B;  5FD6 A;  2XCP A;  2IBK A;  3PR5 B;  4OX9 H;  2W6M A;  5KG3 A;  4LF5 H;  2QK4 A;  4MV1 A;  2PVP A;  4EG0 A;  5FJ8 G;  2R82 A;  3J81 W;  4EFE A;  4RUA A;  1VBG A;  5IYZ F;  4BBS G;  1HNW H;  2WDT A;  5KG7 A;  1BXR A;  3RGX A;  1IBM H;  3N44 B;  1S0O A;  5KFK A;  3MWE A;  1WCM G;  5KG2 A;  2JA5 G;  3KTM A;  4ED8 A;  1JKJ B;  1TWG A;  4L1K A;  1AUX A;  3GLK A;  2AGQ A;  2PBZ A;  3G8C A;  2DIK A;  5BPF A;  4ED2 A;  1KJJ A;  2GLT A;  5KFZ A;  4HR7 A;  1CE8 A;  5C1P A;  5EWG A;  5C44 G;  2UVV A;  2VPQ A;  4ECV A;  2OLS A;  4DV3 H;  4IRD A;  5DQH A;  5LXT F;  2FKL A;  5LMN H;  4A3G G;  1ZHS A;  1ZQ7 A;  2RF4 A;  3G6X A;  2YCH A;  4RU9 A;  5KFH A;  3PW5 A;  4YQW A;  1R9T A;  4DL2 A;  2FLP A;  3R23 A;  5KG5 A;  4Q44 A;  4JV0 A;  2ASJ A;  1B33 N;  1JXL A;  2VA2 A;  1RYR A;  4DR5 H;  3I4M G;  4BBR G;  2C35 B;  3N43 B;  4Y8V B;  3T5K A;  4J9R A;  3N6X A;  4JI6 H;  2NU8 B;  2E2I A;  4YHH H;  2Y0S A;  3G6V A;  2DPI A;  4O3N A;  2QYZ A;  2Q2T A;  3GTJ A;  4QW8 A;  2V9W A;  5BPH A;  1Y14 B;  5D1O B;  3M9M B;  3LP8 A;  2YRX A;  2W6P A;  4O3Q A;  4GKJ H;  5C5J A;  2R84 A;  3RBE A;  3ETJ A;  4A2B A;  1B6S A;  3KHL A;  4QW9 A;  2R93 A;  1T94 A;  3L4K A;  3VPD A;  5IP9 G;  1N36 H;  1P8L A;  4APM A;  3MFH A;  4RAY A;  4TQR A;  1GSO A;  4J9O A;  3OUZ A;  4NXN H;  1CS0 A;  4DR6 H;  3KAL A;  5C1O A;  5C8Y F;  4YR0 A;  2YZN A;  4O4H F;  4QWE A;  5T14 A;  3TQ1 A;  2W6Z A;  1W93 A;  5KFE A;  3TII A;  3H0G A;  5KFW A;  3BG5 A;  2GPS A;  4FS2 A;  4JI2 H;  1IBL H;  2DPJ A;  1K1S A;  1RK6 A;  4MTD A;  3E5N A;  2PMZ E;  2AGO A;  3BQ2 A;  4IHJ F;  2FPG B;  3H0G G;  4JV1 A;  5CA0 F;  2VQD A;  5FPR A;  2FE3 A;  5DLG A;  1Z2O X;  4G3I A;  1I6U A;  5IT9 W;  2J6S A;  5KG0 A;  1ULZ A;  5DG9 A;  2W7O A;  4EBC A;  2JEJ A;  5KG6 A;  5D1P A;  2UVR A;  1X9N A;  4MV7 A;  4DV6 H;  2NVY A;  3EYY A;  1Y1V G;  4WBN F;  4IWX A;  3FDS A;  1UC8 A;  4TUY F;  3GIK A;  4ECT A;  5KT6 A;  5EWF A;  3ETH A;  4J9Q A;  4JYA H;  2M05 A;  4TV8 F;  1I3Q A;  3RIZ A;  2V4Q A;  2R85 A;  3OTO H;  4J9P A;  4DL7 A;  1CQI B;  3Q8Q B;  5IWA H;  5IP7 G;  3GV7 B;  3PO3 G;  4EGQ A;  2UXC H;  2UVU A;  3K3P A;  3T5L A;  4DV4 H;  4NXM H;  4FU0 A;  3BA8 A;  4O3O A;  4ED3 A;  3PW4 A;  2WTF A;  1C3O A;  2UUB H;  3V6J A;  4IAJ A;  4F4X A;  3GTL A;  1M0T A;  3T1H H;  2MCT A;  4BY1 G;  2XGQ A;  3H3V H;  5L1J A;  1S68 A;  1RK5 A;  4B3S H;  5DG8 A;  4LH6 A;  4HQ6 A;  4LF9 H;  3SE7 A;  4I55 F;  3KHR A;  3GTO A;  4K0K H;  3T5J A;  3R5X A;  4ECY A;  3FKI G;  2W6N A;  2R6F A;  1ZHQ A;  4EEY A;  5KFS A;  4X62 H;  1JIH A;  1MZB A;  2W7P A;  5KG1 A;  2PMZ A;  2C22 A;  3GTK A;  1FVI A;  4RB1 A;  4QWD A;  4GLX A;  4Q0Y A;  1SFO A;  4MV9 A;  1BJT A;  3JZI A;  4UCU A;  3N41 B;  4A3M G;  3BAB A;  2VUG A;  5LP6 F;  1PX2 A;  2R8J A;  2C00 A;  2FLL A;  5KFD A;  4LF6 H;  2YS7 A;  2XD4 A;  5J2U F;  2RDJ A;  4EBD A;  1E4E B;  4DL6 A;  4UCV A;  4MA0 A;  4C5A A;  5KFY A;  1N32 H;  5JVD F;  1I7L A;  4AYB A;  4YAJ B;  2RGV A;  4EBE A;  4MV4 A;  2WAQ A;  4DLK A;  4C5C A;  5H80 A;  4BWS C;  5D8D A;  5C3E G;  4IR1 A;  1SEI A;  3H4D A;  5EOY A;  4YJ3 F;  3MR6 A;  1PK8 A;  1AUV A;  2SCU B;  4EYH B;  3NGD A;  4DV2 H;  1K1Q A;  2UU9 H;  5KT2 A;  4A3K G;  2IP4 A;  2Y0S E;  1TWF A;  2DWC A;  5KFL A;  4DR7 H;  4MA5 A;  3T1Y H;  4U7C A;  1GSH A;  2V59 A;  1JDE A;  4ED6 A;  4YBZ B;  2W9C A;  5FLM G;  2UXD H;  2VUM G;  4JUZ A;  3GIJ A;  3T5H A;  3JRW A;  2FK3 A;  3RF2 A;  1VAJ A;  4RUC A;  1EUD B;  5KT5 A;  4JI4 H;  2XC9 A;  2YW2 A;  4R8U A;  3MR3 A;  4DUZ H;  1Z2N X;  5KFI A;  2C2E A;  4UFZ A;  1A9X A;  5LYJ F;  1V9P A;  1KEE A;  4DR3 H;  3GTG A;  5KFP A;  1Y1W G;  4PDB A;  4F4Z A;  4AQY H;  4LF8 H;  3SI8 A;  1EZ1 A;  2WB1 A;  3PW7 A;  1KJI A;  4Q45 A;  4O4I F;  5EDW A;  3CQZ A;  4TQS A; 
#chains in the Genus database with same CATH homology
 3KXY T;  3M4I A;  3N40 P;  1XNQ H;  2HVQ A;  4JI0 H;  4LFB H;  2HHH H;  4EEQ A;  2UXB H;  4LFC H;  3KAK A;  1L2Z A;  5FPR A;  1HR0 H;  2FE3 A;  1Z2O X;  5IT9 W;  1I6U A;  3KAJ A;  4UCR A;  5LMU H;  1IBK H;  3J7A K;  5D1O A;  1O75 A;  5FPO A;  4DUY H;  2E5L H;  4JI3 H;  2HGS A;  1BGW A;  3BAA A;  4RB0 A;  5D1P A;  1XMO H;  1X9N A;  4MV7 A;  4LMY A;  4CC5 A;  4DV6 H;  4B3T H;  3EYY A;  4A2A A;  4LFA H;  3UQ8 A;  4RB3 C;  4DV5 H;  2WYO A;  4X64 H;  1HNZ H;  4RZQ A;  4JYA H;  2VOB A;  4J0M A;  3RIZ A;  3OTO H;  1HNX H;  4X65 H;  2ZJT A;  4JI5 H;  5IWA H;  4YY3 H;  3MWM A;  1A0I A;  1XDN A;  4GKK H;  2UXC H;  2XIG A;  3K3V A;  5FD6 A;  4DV4 H;  1TA8 A;  4NXM H;  4OX9 H;  2WE6 A;  3BA8 A;  4LF5 H;  4CC6 A;  3H20 A;  4DV7 H;  2UUB H;  4ETS A;  1N34 H;  1VS0 A;  4IAJ A;  3L4J A;  3JSL A;  4UCT A;  4M7E A;  1M0T A;  4EFE A;  3J81 W;  4DV1 H;  3RTX A;  3T1H H;  2MCT A;  1S03 G;  1S68 A;  1HNW H;  2OWO A;  2WDT A;  4B3S H;  4LH6 A;  4JI1 H;  3RGX A;  1IBM H;  4LF9 H;  3N44 B;  4UCO A;  2W57 A;  4LH7 A;  4K0K H;  1FKA H;  1FJG H;  1ZHQ A;  4DR2 H;  4X62 H;  2VQF H;  1MZB A;  1DGS A;  3RGZ A;  3J80 W;  1J5E H;  1N33 H;  4FM9 A;  1I94 H;  1FVI A;  3JSN A;  4RB1 A;  4GLX A;  4Q0Y A;  1WH2 A;  4MV9 A;  1E4F T;  2O03 A;  1BJT A;  3IG0 A;  3N42 B;  4UCU A;  3N41 B;  3BAB A;  2KSW A;  2VUG A;  4R7R A;  4DV3 H;  2UUC H;  4DR1 H;  4LF6 H;  1M0W A;  5LMN H;  4RAZ A;  1ZHS A;  2CW7 A;  2YCH A;  2UUA H;  4UCV A;  2RGR A;  1XNR H;  1N32 H;  5LL6 b;  4JI7 H;  4B3R H;  4RB2 C;  4LF7 H;  2RGV A;  4DR5 H;  3N43 B;  2CW8 A;  4BWS C;  4DV0 H;  3N6X A;  1SEI A;  4JI6 H;  5EOY A;  4B3M H;  4LSA A;  4YHH H;  1Z2P X;  4I7H A;  2Q2T A;  4DV2 H;  2UU9 H;  3C0F B;  4UCS A;  4LSX A;  5D1O B;  4LF4 H;  4DR7 H;  1SYX B;  2F4V H;  5FD5 A;  4MTE A;  5FLX W;  3T1Y H;  4GKJ H;  3CVZ A;  4A2B A;  2VPS A;  2HVS A;  5BR8 H;  3L4K A;  3FMA A;  3LML A;  2HVR A;  4JI8 H;  2UXD H;  2VQE H;  1XMQ H;  1TAE A;  1P8L A;  4APM A;  5A2Q W;  1N36 H;  3RF2 A;  1AN7 A;  4EFB A;  4RAY A;  4JI4 H;  4DR6 H;  4NXN H;  3HXL A;  3KAL A;  3L2P A;  2ZM6 H;  3DF7 A;  4DUZ H;  1Z2N X;  1GYF A;  3BA9 A;  1E4G T;  4UFZ A;  4DR3 H;  1V9P A;  3JAM W;  3F8N A;  4JI2 H;  4PDB A;  4KHP H;  1B04 A;  4AQY H;  1IBL H;  2Q2U A;  4LF8 H;  4JV5 H;  4MTD A;  3PN1 A;  4DR4 H;  4X66 H;  3RJ0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...