1WCMG

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wcmG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1wcmG01
1VQOA 2ASBA 5IP9G 2ZTEA 3S14H 1GVPA 4LF7Q 4C3IH 3JAMc 3CW2C 4QGUA 4A3BH 2YU9H 1LUZA 1X3EA 3RZDH 1PYBA 1X9NA 2K5HA 3S2DH 4O2DA 2UXDQ 4JI1L 1Y1WG 3S1NH 2I5MX 4DV1Q 2D0PA 2UU9Q 1OXTA 4LUZA 5JEAJ 1XMQQ 4LFBQ 4OO1I 3K81C 2RHSB 3ZJYC 4A3MH 1TWFH 1UE6A 2ALYB 3GTLH 3S1QH 1JE5A 2XTIA 4A3CH 2Q2HA 3HKSA 4NB3A 2KCMA 4XTCS 2RHQB 4BXXG 1Y1VG 2A1AA 3PCOB 1E1OA 1NMGA 3K8AA 5IP9H 2HIXA 4DR5Q 4GKJL 1YJWA 4IFDG 2R92G 2OQ0A 4YCWA 4DV1L 2CWAA 1XMQL 2N8NA 1VQ5A 4DR4Q 1NTGA 4JBWA 5LMUL 4JI7L 3S24A 1I6HH 3E0EA 2WAQE 3GTQH 3BJUA 1FJGL 4X65L 5M3FG 4UY8C 4Y52H 4KHPL 4DR5L 4GN4B 1C7YA 3J7ZC 1IZ6A 1A63A 2Q2IA 4PZ6A 5LMNW 1T9HA 1Y1VH 3RLOA 2IX0A 4HIMA 3A5UA 4BXXH 4DR4L 3J81j 1CSQA 5DLQE 2R7DA 4LNQA 5IYBG 5EAYA 2F3IA 2CCZA 4JI4L 4OONA 1Z47A 3CCUA 2OCEA 4UP9A 1QUQB 4A3EH 1FGUA 1YHQA 3S17H 4POFA 4P75A 1W2BA 3CCJA 3JC66 4B3TQ 3HOWH 3S2HH 2ATWA 4GKKQ 1HZBA 1QVFA 3D0FA 3A5ZB 4EX5A 1HNWQ 5M3FH 4JI6L 4A93G 3VDYA 3H3VI 4A3GH 1EOVA 4BA1I 1Y14B 1TWHH 4JBKA 4X64Q 2A19A 4A3DG 3TQYA 4DV5L 5IYBH 3KJOA 5IYDG 4B3ML 4B3TL 2HQLA 2MNAA 2JA8H 1L1OA 3F8TA 1UWVA 4AQYQ 1IBKL 4LF6Q 3NBHB 2NZOA 2OQKA 3I56A 5K36G 1MKHA 4NXMQ 4DR2Q 5GAGC 1SFOH 2OTJA 3TS0A 4C2MH 4GLXA 4A3DH 2R6GA 1K83H 1BBWA 1K8GA 2F52A 1S72A 1JJGA 4JI0L 1WFQA 2R93G 2GN5A 1XTDA 4LFAQ 1N9WA 1SLJA 4IJLA 3H0GG 3UDXA 4DV3Q 4A3IG 2UUBQ 4POGA 3G71A 1UE5A 1PHJA 2RCNA 1BBUA 3FHWA 1NY4A 2JQOA 4MNOA 1A0IA 4L5RC 4NXML 4OWWB 1YEZA 1EQRA 1VQIA 4AYBG 5FLMG 4HIOA 2R7ZG 2LXKA 4DV0Q 1JB7A 2ZJPA 4GN5A 4OX9Q 4PZ8A 5ELOA 1XMOQ 2JEAI 4HJ7A 4LFAL 4ALPA 3HOUG 3E9IA 1GKHA 4DR1Q 4DV7Q 2R93H 4C3JH 5GADC 4R4OA 3UE0A 4A3IH 1P16A 3ER0A 1PH3A 4GNXA 4A3KH 1ASZA 1X54A 2YTYA 4OX9L 1YIJA 2E8GA 3KYHC 3RNUA 2E5LQ 3CXCA 4TQUS 5FLMH 3G6EA 3I7FA 4LF9L 1X3FA 5HGQA 4DR1L 5H1SE 5JEAG 2VY3A 3M9BA 2JA6G 1YHAA 3HOUH 3M4PA 4NXNQ 1PA6A 3GO5A 1D8LA 3F2BA 3PIOA 1E24A 1O7IA 4X66L 3HOXG 3H15A 1IBLL 3PF5A 3Q8DA 1VQ7A 1X56A 3PUWA 4H02A 2I0QA 3GTPH 4A3LH 1JT8A 1U5KA 2LSSA 3KLWA 4IO9A 4QQBX 5HY6A 3UDFA 2PQAB 2B63H 3CCSA 1NBWA 3EIVA 2JA6H 3TREA 4AYBE 1G6PA 3PSIA 4LF8L 4DK6C 1PH9A 1RIPA 2NN6I 3PUYA 2V1CC 3HOXH 1PH6A 2WB1G 1Q81C 4IPHA 1CKOA 1N34Q 4DR7L 5M3MG 1WYDA 2HIVA 1VQNA 1KAWA 1Q8KA 3FKIH 3WWVA 4RG1A 5IYCG 3UDIA 1VQ9A 3GTOH 1HNZQ 3BU2A 1VQJA 1G291 2K14A 4JOIC 5AJ3L 1J6QA 2VS1A 1QVGA 4UPAA 3A0JA 4NPSA 2CFMA 1PYSB 1N34L 1CSPA 4GKJQ 3I4MG 1TWGH 2Q2UA 4GOPC 2MO0A 3NELA 5GQOA 3TRZA 3L2PA 1PH1A 4RMFA 1HNZL 5LMUQ 1NE3A 4L5TA 4IJHA 1L1OB 4JI7Q 5C4XG 4OO1G 5IYCH 1FJGQ 5FJ8H 1Q7YC 4X65Q 1PFSA 2RF4A 2ZTCA 3AYHB 2Y0SE 4IPDA 3OW2A 2Z6KC 4KHPQ 3STBC 4KI0A 3RZOH 1GD7A 2I5LX 4YCVA 1C9OA 2B3GA 1Y1WH 3I4MH 2YTXA 2QEXA 4JI4Q 3FP9A 3HKZG 4HJAA 2JK8A 3CMEA 4DK3C 1EWIA 1SN8A 2NZHA 4UP8A 1YZ6A 1I50H 3OYYA 2OWOA 3CC4A 4R4CA 3W1BA 4JI6Q 4MZ9A 1IYJB 2K5NA 3GD7A 3GDEA 2CKZB 1DGSA 5C4JH 2R92H 1HZCA 5BR8L 4A3JG 2E2HH 2JJQA 1GO3E 2C35B 2WP8J 4DV5Q 1KL9A 4LF4L 1WI5A 4HIKA 3STBD 1VS0A 5E7NA 2JEBI 4B3MQ 2NVTH 1PH2A 5C3EG 1B7YB 3W5OA 1NMFA 1YNXA 4GNXB 3HOVG 2WFWA 1L2FA 2D62A 4OWTB 4A76A 1IBKQ 3HOYG 3S15H 1XNQL 4A3FG 4BBSG 4DUYQ 4BY7G 3PF4A 2ID0A 2I5HA 2NVYH 1N33Q 1A8VA 4JI0Q 4B3RL 1HJPA 5C3EH 1IL2A 2ES2A 4OWXB 5IP7G 4DPGA 1JJ2A 3HOVH 5IWAQ 1VQ8A 4DR3L 4DUYL 1PH7A 3HKZE 4JC0A 4JI2L 3T1HL 3HOYH 2ZTDA 3H3VH 4BBRG 1LYLA 1P8LA 1Q1EA 1SE8A 2JE6I 4P74A 4A3FH 3CCLA 1M1KC 2YYZA 3MXNB 1N33L 1HZ9A 4BBSH 4BY7H 5IYDH 1D7QA 3GTGH 1QZHA 1N32L 2K5VA 2KCTA 1KRTA 5FLXc 5IWAL 2F4VL 4AH6A 2MQHA 4LF5L 2JA7G 1S40A 4HIDA 4X62Q 2VQFQ 1QVCA 5C44G 4JV5L 4EQ5A 1CKMA 4R4IA 3TEHB 2GVBA 1TWCH 2KHIA 3RN2A 1PH8A 4LF9Q 1FVIA 2AMCB 3J81c 3KJPA 3BZKA 1Q86C 3AFPA 1VQLA 3CCRA 1H95A 1LTLA 4BY1G 1HR0Q 4KLKA 4DNIA 4X62L 3H0GH 2VQFL 3CAMA 1JMCA 2BA1A 4O0AA 3S1RH 3CD6A 4UP7A 2N78A 3F2CA 3EN2A 2FXQA 4QJFA 4X66Q 2JA7H 3LGJA 1IBLQ 3T1YL 1YITA 4PZ7A 4DAYB 1PH5A 3IRBA 5C44H 3S16H 2PI2A 4PG3A 1UE7A 1G51A 1HZAA 1HR0L 1SR3A 3EBEA 1GM5A 1VQ4A 4JBJA 1L0WA 1KD1C 3HOZG 1IBMQ 1RL2A 2DUDA 1VQGA 3K7UC 1J5EQ 5IT9c 1QUQA 2IX1A 3AEVA 4GLAC 4HJ5A 1VQFA 4LF8Q 4A93H 1WCMG 4LFCQ 4LUVA 1AH9A 1OXSC 1I94Q 4JI5L 4YWKA 3OTOL 3ULLA 2HHHL 2KHJA 4DR7Q 1C0AA 4DV2L 1U0LA 1IBML 3CC2A 1J5EL 1EIYB 2EIFA 4P71A 4K0KQ 3M3YH 2PNHA 4A4IA 1TXYA 3HOZH 1V1QA 2UXBQ 4LFCL 2K50A 5AJ3Q 1OXXK 2UUCQ 4L5SA 5C0XI 1I94L 4YY3Q 4C3HH 3GTMH 1XJVA 1WCMH 2NN6G 4YWLA 4APVA 4JG2A 1I5FA 3CCEA 3KF6A 4JI3L 4DV4Q 4K0KL 5GAHC 1CKNA 4DAMA 1KHIA 3J81i 2UXBL 3A74A 4YCUA 4A75A 4JOIA 2UUCL 3PIPA 3AFQA 4PMWA 4YY3L 3TS2A 4AIMA 4FDBA 3RR5A 1XPRA 3U4VA 4JYAL 4DV6Q 3M7NA 1OXUA 1E22A 3CCQA 4A3BG 4DV4L 4GOPA 3I4OA 1IXRA 1X3GA 5M3MH 3ICEA 1KXLA 1AE3A 1V43A 3CCVA 4P73A 3CC7A 1HH2P 4KHZA 3U58A 3CQZH 1EFWA 4TVAB 2KENA 4R1JA 3SGIA 2AWNA 4B3SQ 1VCIA 1W3SA 2Z6KA 3M85A 1XNRQ 4A3CG 2ZJRA 4DV6L 2CQOA 3CPFA 4GLVB 3J80c 3W1GA 4DR6L 1VQ6A 2UUAQ 1EUJA 3I55A 4LW1A 1PV4A 2IHFA 1Q46A 1EQQA 2LXJA 1Q82C 1VQBA 2AWOA 5BR8Q 3CPWA 1K9MC 3ULPA 4HJ8A 2BA0A 4LF4Q 2VQEQ 2MO1A 1HR0W 4B3SL 5M5WH 2JA5G 2WB1E 5C4XH 2N3SA 2XGTA 1XNRL 1MJCA 3U50C 3PGZA 2PMZE 3RLFA 2YTVA 3B6YA 4GN3B 2UUAL 1A62A 1EYGA 4IOCA 4LF7L 5C0XJ 4IFDI 1CUKA 1YVCA 3CF5A 5IE8A 1SROA 3CMAA 2D0OA 1XNQQ 1B70B 2UXCQ 2VQEL 1E3PA 2UXDL 3D31A 4DUZQ 1K73C 2UU9L 3DM3A 4LFBL 2Q2TA 1K0RA 4JCVE 4A3EG 2R7ZH 1V9PA 2JA5H 3HOWG 4B3RQ 5JJLA 4ME3A 4BA2I 3UDGA 2PQAA 1XPUA 1R9TH 2A8VA 2UXCL 4DR3Q 3PO2G 4A3GG 1VQMA 4JI2Q 3L7ZC 4DUZL 3T1HQ 3KOJA 4MTNA 4A3JH 2VZAA 5M5YH 3GTKH 3ERSX 1YJ9A 3PUZA 4QL5A 3PV0A 3GTJH 1PVOA 1N32Q 1K3RA 2JA8G 1KQSA 2F4VQ 1HNXQ 1WJJA 2K52A 3KDFA 3KF8B 3PUVA 4QIWE 4LF5Q 3S1MH 2R7FA 2IY5B 4DKAC 1B8AA 4JV5Q 3J80i 3PO2H 1AE2A 3K80C 3JAMi 5JJKA 3M4OH 3UE1A 1WOCA 1FL0A 2EXDA 3PUXA 4GKKL 1HNXL 1UEBA 2MFIA 1I3QH 1UE1A 5GROA 5IP7H 1HNWL 1L1OC 2HT1A 1SRUA 2IT1A 3KFUA 4XIGS 3MEFA 2QA4A 4IFDJ 3T1YQ 4J15A 1NJIC 1S3OA 4BBRH 3KF6B 4X64L 1OTCA 1CKNB 3E9HA 4L5QA 1TWAH 4GS3A 3I4NG 3M4QA 2E2JH 2CWPA 3K0XA 2VNUD 2B29A 2EQSA 2BH8A 4QY7A 1JJCB 3CP0A 1VQPA 3F1ZA 3G4SA 2IHEA 2N49A 4P72A 4AQYL 4LF6L 4IPGA 4A3KG 1Q1BA 4HJ9A 1XPOA 1SMXA 4GOPB 2YV5A 3K7AH 5IY0A 4IPCA 2ZJQA 3NEMA 4DR2L 4JI5Q 3OTOQ 2HHHQ 3L0OA 3G48A 1Z9FA 3AQQA 4DV2Q 4R4QA 1Q12A 1KIXA 3I4NH 4BY1H 1YJNA 1VQEA 4OXPA 1PH4A 2UUBL 5ELNA 3CCMA 1YBYA 4DV3L 3PO3G 2GVAA 1KRSA 1YHBA 2JA9A 1KC8C 5J3BA 4R4TA 3U4ZA 4GNXC 5M5XH 5LMNQ 3RN5A 4DV0L 4X6AH 1VQKA 4Y7NH 2VL6A 2VUMG 1MIUA 1BKBA 1XMOL 4A3LG 4JI3Q 4JI8Q 1MJEA 5JJIA 4DV7L 2NVXH 2B63G 3J7A5 2AHOB 4WJ4A 1E1TA 1VQAA 1N36Q 1K8AC 5LMNL 4LWCA 1M90C 4JBMA 2BH2A 3PO3H 4JYAQ 1X55A 5C0XG 3NENA 5GAEC 2E5LL 1BVSA 2Z0SA 2H5XA 2K4KA 4JI8L 1YI2A 1QZGA 2Y0SG 4YHHQ 3F2DA 3I2ZA 2OTLA 2VUMH 1EIFA 3FKIG 1VQCA 2L15A 2ZM6Q 3DLLA 1VQDA 4YWMA 1ASYA 2PI2E 4NXNL 1N36L 1X6OA 1OXVA 4LUOA 2K75A 4DR6Q 2AKWB 2WAQG 2DGYA 4YHHL 2NVQH 1E7ZA 4IOAA 1X65A 3ULJA 4WJ3M 2ZM6L 3HFZB 2KBNA 1LM0A 4A3MG 2E2IH 2QGQA 4JI1Q 1N8RC 2VW9A 1VQHA 3KDFB 3RLNA 3BZCA 5FJ8G
chains in the Genus database with same CATH superfamily
3QO2A 4WJWA 1VQOA 1XNQH 1BOSA 1KABA 4RWSC 3S14H 4XT3B 4C3IH 1II3A 3JAMc 1TWAB 4PQXA 3HZXA 1LUZA 3Q2OA 2EJGC 2ICEC 2K5HA 1KEEA 1ESFA 5IIFA 5CGKA 1RTNA 1EY9A 1K1QA 4OO1I 3PW0A 3S1QH 2R7KA 3VPDA 3BQ0A 1SYCA 5CAEB 4FS2A 3PCOB 4M9UA 4DR5Q 4YCWA 5T14A 3R2TA 3CKIB 3KHLA 1QNUA 1WTWA 4CJ2C 1BXTA 3HKZA 1GGOA 3BJUA 4Q5VA 1FJGL 2I80A 4UY8C 4JV5H 5KFOA 4G7HC 1WTOA 4KHPL 2VA2A 4GN4B 1C7YA 3J7ZC 1IZ6A 1A63A 5LMNW 4BXXH 3RLOA 3L9AX 3A5UA 1CSQA 5IYBG 5EAYA 4IFDH 4ME6A 2CCZA 1KJ9A 2OCEA 2R8GA 4HR7B 1BF4A 3S17H 4POFA 3HOWH 3PO3B 3CCJA 1ZHSA 2IA6A 2L5TA 5J2TF 3T1YH 5L9XA 3AU7A 5M3FH 3KAKA 3VDYA 4N8X1 4FF2A 4EGJA 2E74C 2AUJD 5IYDG 2NBFA 3MTSA 1CS0A 1L1OA 1PZID 3F8TA 3EA6A 3FRPB 2HHHH 4LF6Q 3I56A 2NZOA 2OQKA 4C5BA 1JKJB 4NXMQ 5GAGC 1SFOH 3TS0A 1ZETA 2CH4A 1S72A 1JJGA 5KFNA 1PTOD 4A3IG 1SLJA 3UDXA 2RDGA 2UUBQ 4BWSC 4EEQA 4POGA 3G71A 2F0LA 1UE5A 1PHJA 4XZ3B 3NBIA 2JQOA 2VB2X 2WKCA 3SE0A 4OWWB 2E5LH 5DGBA 4AYBG 4HIOA 5EJWA 4A3MB 5CV7A 5ELOA 3TQ1A 3H91A 2JEAI 5C1PA 4LFAL 1GKHA 4FXGC 1KDAA 3NGDA 5I6YA 4R4OA 1WTRA 1GYFA 1PH3A 1PK8A 1SAPA 2YTYA 4YHHH 4OX9L 5FPOA 3K5NA 5H80A 2PO4A 4NW2A 4FU0A 2ZXPA 1AUXA 5FLMH 3P75A 2BCOA 3DMUA 1K3BC 3JSLA 2R85A 4MA0A 3PR5B 1YNJC 1YHAA 2MGSA 1AP0A 3WNZA 5DM73 2EJFC 1ENCA 1SSOA 3GO5A 4Q8EA 2R92B 5ISRA 2W9CB 1IBLL 1IKLA 3GTMA 1IYUA 1W6JA 3PF5A 4ETSA 3MJFA 3KF8A 4JI1H 2UVRA 3PUWA 4CDDC 2KCCA 5I6WA 1JT8A 4O3OA 4HNVA 1GJXA 2F0TA 4R7RA 3GQBA 4QQBX 4MV8A 4QW8A 4EGQA 2W7OA 2B63H 5DQGA 4Q0YA 2VUGA 2B8FA 3M4YA 4XDXA 2SCUB 4X3UA 5F2DA 1Z6HA 2UXDH 2F0NA 2W6MA 1SNOA 2KEEA 1LTAD 2WB1A 4RB2C 1SMYD 4DV1H 3NPPA 5KGUA 1N34Q 2EYPA 2K6AA 2QILA 4KV6A 1SCUB 4XT1B 1Q8KA 3FKIH 4RB0A 2ICIA 1VQ9A 1D5MC 4MV1A 1HNZQ 3BU2A 2B2UC 3RTXA 1G291 2YRXA 1J6QA 5I9OA 3A0JA 1CA5A 1PLFA 4C2MB 1PYSB 4A3DB 2OH2A 4DR4H 1CSPA 1K83B 4IAJA 4JI4H 2Q2UA 2WV6D 3T56B 2BR0A 3QZ8A 3I91A 1CM9A 4L5TA 3CU7A 4IJHA 5C4XG 1ZEQX 4EFBA 4OO1G 4ED0A 4EEYA 1FJGQ 5FJ8H 3UI2A 2RF4A 2RA4A 2Y0SE 2Z6KC 4KHPQ 4HAEA 4ECTA 2FE3A 1GD7A 3WO1A 1C9OA 2F0GA 1E2VA 1Y1WH 3I4MH 1M0WA 2R93B 3HKZG 2QEJC 4CKCA 5CBAE 2V4RA 1EWIA 2V5AA 4O4HF 3Q23A 2FKLA 1B6SA 2CQAA 3V96A 2OWOA 2R8IA 1RHPA 4X64H 4MZ9A 4LMQD 2K5NA 2FK1A 1R9TA 2P0AA 4HSVA 4DK1A 4YR3A 1NAPA 2VPSA 2AQ4A 2F0IA 2PCFB 1AN7A 3GTLA 1MD2D 2WP8J 3HOUB 4F4XA 2QKIC 2EJMA 4HIKA 3D6WA 3GTJA 3T51B 4AQYH 1PH2A 5C3EG 1B6RA 1NMFA 2YZGA 1BDOA 2W6ZA 4DR2H 3MVVA 4A3FG 4BBSG 4DUYQ 5AFWA 2JA6B 3DWPA 4XQNA 4JV2A 3M3YB 3QFFA 4I7HA 3N6XA 1KLGD 1I3QA 4ZUIA 3HOXB 5J22A 2Q8IB 1PRTF 1DV2A 2XRSD 5D3DA 4RAUC 1EY6A 2GPSA 2YRWA 2Y0SB 3G6XA 1JICA 4JI2L 2QDBA 2ZTDA 3H3VH 1LYLA 4DR1H 4BY7H 1TWAA 3MXNB 1HZ9A 3P1HA 3TIGA 5D1OB 1S0MA 3GTGH 4OEMB 3PVXA 2KCTA 5IWAL 3M9OB 5C5LA 4KTAA 1TWGB 2BQ3A 4HIDA 4X62Q 1Z2NX 1Y8PB 1EY4A 1SBBB 3LWUA 4EQ5A 5M3MB 4RFBA 1MZBA 5L1IA 1CKMA 4R4IA 3TEHB 1PH8A 1TU2B 3RN2A 5KFCA 3A54A 3KJPA 4NXNH 3OOCA 4K5VA 4Q44A 1VQLA 3BYYB 2F0DA 4KLKA 3H0GH 2C28A 3EQLC 3F2CA 2N78A 2R86A 3EN2A 4QJFA 3LGJA 1IBLQ 4O3SA 4DAYB 4Z9CB 4DR7H 2K03A 3S16H 1A3UA 2PI2A 4ED8A 3T5HA 2ASJA 3A56A 4FF4A 4JBJA 1PFBA 1L0WA 1J5EQ 5C4JB 3OPOA 4HR7A 2XRQD 1VQFA 4IURA 4HJ5A 2E2HB 4DA2A 1AH9A 1EU4A 3ULLA 2KHJA 1TQOA 1ILPA 5CYUA 4ECWA 1U0LA 1EIYB 2EIFA 1HTLD 3MR3A 2UXBQ 4GKJH 1B04A 3BVGA 4QW9A 1I94L 4A3JB 4YAJB 4C3HH 1XJVA 2J4XA 4YWLA 3OWFA 3OIPA 3PIP3 4JI7H 3KF6A 4OELB 2RDJA 5JVLA 1STBA 4K6LA 4LH7A 3A74A 3FDTA 4YCUA 3S1MB 3PIPA 4PMWA 1EYDA 2XCPA 2J6UA 3RR5A 5IT9L 4ZRZA 1KAAA 4GC6A 4JYAL 4UCOA 3M7NA 1OXUA 3CCQA 1AEXA 3I4OA 4LK1C 1AE3A 1JC7A 4CDCC 4UHVA 2IL8A 3U58A 1EFWA 1HA6A 1VCIA 3H94A 3SDZA 5IGDA 2ZJRA 2CQOA 4FF1A 1AFPA 1VQ6A 1X32A 3I55A 1LV9A 1EQQA 1Q82C 1E4EB 4HMJA 4HJ8A 2JP1A 2QYZA 1PZJD 1JCKB 1G6PA 3C1FA 1JWMD 5M5WH 3S1RB 2N3SA 3U50C 2NWGA 4O4IF 3GV5B 4ECVA 2CW7A 3QR8A 5E1FA 3C3LA 5LP6F 3NQTA 2O5JC 3R8BA 2UUAL 1A62A 4LF7L 5IE8A 1BUVT 1SROA 3K0YA 3D31A 2EY2A 5CORA 2W9CA 2UU9L 1U4PA 3HG9A 4RGTA 4V0BA 4LFBL 3ORQA 4TV9F 4A3EG 2W8LA 4A93B 3GP7A 5JJLA 5EQ0A 3Q0AA 3A8JE 3BG5A 3KXYT 1A3VA 3R2IA 4FF3A 2O4XA 1XPUA 2A8VA 2UXCL 3I3CA 2PW5A 4JI2Q 3T16A 2R8KA 1NR4A 5E4WC 3OMGA 2SDFA 3NTHA 5CV5A 1CQIB 3HOZB 3DEOA 3PUZA 1S0NA 4PDBA 1PVOA 1DJRD 3E0JA 2VQFH 2JA8G 2FPGB 1HNXQ 1BJTA 4RU9A 1U4RA 2XCAA 5IT9W 4DKAC 4LF9H 4XX0B 1B8AA 1STEA 2YZNA 5I4DA 2DZDA 4C2MA 5JJKA 3M4OH 2OF1A 1K83A 3UE1A 1NNXA 2EXDA 4GKKL 4X66H 4DNTB 5KFTA 4J9SA 5GROA 5IP7H 2WIIB 1HNWL 1WH2A 1L1OC 3BG3A 2HT1A 1SRUA 2ENBA 4XIGS 3MEFA 3VA5A 2O2LD 4JI5H 3OTOH 2M9VA 2EYHA 4IUTA 1J9OA 1S3OA 4BBRH 2LFNA 3QIAA 4DV2H 2BQRA 1CKNB 1IBMH 4ODGA 5BN4A 1I6VC 4ILWA 2VNUD 2R93A 4LFCH 1JJCB 3CP0A 3RB4A 4P72A 4MV9A 3GIQA 3BQ1A 1HUMA 3KHGA 1GUTA 5T1GA 2YV5A 5IY0A 2ZJQA 1S5DD 2VPQA 4RZQA 3BJYA 4K0KH 4DXGA 5KT4A 2FLLA 1Z9FA 3S1QB 1JDBB 2PZWA 4ZQIA 4BY1H 3IFDA 2C22A 2UUCH 4OXPA 5E4XA 4YY3H 2CVRA 5ELNA 4CJ0B 1KC7A 5ELBA 3PO3G 4DL4A 4RUAA 1M4VA 1IW7D 1EU3A 1YHBA 2JA9A 1L2ZA 1F2ZA 5J3BA 3U4ZA 1DM0B 3C46A 4DV0L 2R7ZB 2A74C 2A6ED 2VL6A 4Y7NH 1MIUA 4A3LG 1XMOL 4JI8Q 1A3TA 5JJIA 2RVLA 4DV7L 2NVXH 2JA6A 1XDNA 4DV6H 2AHOB 5F9LA 1N36Q 4JBMA 4JYAQ 5EGTA 4EFEA 2K4KA 4CC6A 2Y0SA 4B3SH 3W2DA 3S17B 3HOWB 2OTLA 1SYEA 3LNNA 2VUMH 3N43B 3L4JA 3MXNA 4RKLA 1BCPF 1S10A 3PO2B 2WTFA 2NTTA 2WAQA 4LSAA 1W93A 5IGFA 2VQEH 3TP6A 1TWGA 2DGYA 1MI2A 1QJOA 1S4ZA 4UCUA 3HFZB 4A3MG 2KJXA 1J8IA 3KDFB 5FO8B 1VBHA 2AU0A 4KJOA 4K5XA 3TDQA 5IP9G 1TA8A 5KFUA 1GVPA 4LF7Q 4DUZH 2FMCA 4A3BH 1UC9A 1X3EA 2PZTA 3S2DH 4B3RH 4DAYA 4O3PA 2UU9Q 2YS7A 1XMQQ 4LFBQ 4ZKCB 3BDLA 3D4WA 4CDEC 3RB0A 2RGRA 1JWUD 1UE6A 3K7AB 3T1HH 2Q2HA 3HKSA 4NB3A 2RHQB 4YBZB 3PZPA 2DJFC 3MFYA 1YJWA 2O03A 2R92G 1JX4A 3NP8A 1ILQA 2E2HA 1N32H 2N8NA 1NTGA 4R8UB 1XYIA 4LF5H 3S24A 1I6HH 2F3VA 3E0EA 3GTQH 5BPHA 4ZLTF 1KJQA 1LACA 4XQJA 4DR5L 5A35A 1GUSA 3L3OC 4RHSA 2AQ3B 2Q2IA 4RGOS 2EDGA 3RGZA 5L1LA 5DLQE 5IOCA 2G9DA 1OWTA 4OONA 3LP8A 2B2VA 1LT3D 3CCUA 2NVYA 1FGUA 4A2BA 3SK5A 4HCEA 3Q24A 1W2BA 4B3TQ 2I07B 3JC66 4GKKQ 3S2HH 2OTJA 3D0FA 4R8NA 4EX5A 1HNWQ 4JI6L 1H9SB 2QDLA 4A3GH 1EOVA 4JV0A 1PTOC 4EG0A 1TWHH 3KHHA 1LT5D 4A3DG 2C2EA 3G6VA 2FMAA 1EYAA 5IYBH 4B3ML 1G2TA 4X3KA 2B63B 4K5WA 2UUBH 1TKWB 2HD3A 5BPFA 2HQLA 5CV4A 2QCPX 3U9OA 3VPCA 1IBKL 1TS5A 5JUMA 2XGPA 3NBHB 1SNCA 3GIMA 2E2IB 1MKHA 1TWCA 5EKKA 1UNSA 2PQEA 4IUUA 3FKIB 4Q43A 4GLXA 2YS6A 2R6GA 3GIJA 3H4DA 1BBWA 1RK5A 3KK7A 1E4EA 2K7VA 4DL6A 4JI0L 2R93G 4L8JA 4IJLA 3BABA 5LMNH 5I2YA 3RZDB 4ZKBB 4L5RC 3FHWA 1NY4A 4MNOA 1ESRA 4ZAIA 1O7ZA 5FLXE 4NXML 2RBMA 1VQIA 5C6AA 1DONA 3JRXA 4DV0Q 1JB7A 4G7OC 1TWFB 3GTLB 1I7LA 4PZ8A 5COYA 1XMOQ 4PNYA 3HOUG 5L1JA 4IRKA 3QZ7A 5EOYA 3J81E 4DV7Q 3RFCA 4A3IH 1P16A 2R7NA 2QW7A 4GNXA 1ASZA 2RCFA 5GONF 1X54A 1G91A 1C3OA 1Y1WB 2IBKA 1EFID 3RNUA 4TQUS 2ZM6H 5KRUA 2SOBA 3G6EA 4KY6A 1X3FA 3PIO3 1E4GT 3MHBA 5CMDA 2WE6A 4QWBA 2FK2A 2GA4B 4IUQA 4EBEA 1SMYC 2JA6G 3V2TA 2VY3A 3HEJA 3GIDA 4DR6H 1Y1VB 2BOSA 3M4PA 2SNMA 1PA6A 3F2BA 3PIOA 2W9BB 2E2DC 2F0JA 4JPBW 3HOXG 5IT9E 4TSSA 1VQ7A 3Q8DA 2R8HA 3KBXA 3GTPH 3TZUA 1WD1A 3GV3A 3KLWA 3I90A 4IO9A 3N44B 2Z6BA 4QWEA 5D1PA 3CCSA 3MEHA 3EIVA 4DK6C 1PH9A 4MIUA 4U7CA 3PUYA 2AQ2B 2NN6I 1KNEA 1Q81C 4N9PA 3Q22A 1WVLA 1CKOA 1SNDA 5M3MG 5CC4A 1VQNA 3URYA 5JVDF 3WWVA 5IYCG 4OIJA 5M9OA 3UDIA 1RCVD 4DK0A 2BE5D 1VQJA 2R7LA 4O4LF 5AJ3L 1G6ZA 4QWDA 2K33A 1N34L 1GHJA 5KG7A 1CZGA 4RAZA 1TAEA 3NQIA 1PH1A 4RMFA 1FYCA 1HNZL 4ZI7F 1BR9A 4MN3A 2DIKA 2P5ZX 1HUNA 3H09A 4IPDA 2F0EA 3K5MA 3BVZA 3I8ZA 4YCVA 2I5LX 3RUZA 3TQTA 1S5BD 1S5ED 3CRKC 3D3RA 3BYTB 5F9NA 2QEXA 4C3JB 3FP9A 2JK8A 2R7ZA 3H0GB 1F77A 1SN8A 4UP8A 5DEHA 2A73B 4EGVA 1VMCA 3ONAB 4OO1H 3PW2A 1RK6A 4JI6Q 1IYJB 3GD7A 1I4RA 2R3ZA 4RHRA 2CKZB 1BNZA 1DGSA 3GTKA 5JJZA 5BR8L 4A3JG 2ZDHA 1GO3E 3SK6A 4TQRA 4C1NI 2JEFA 1WI5A 3VR6A 4B3MQ 2JEBI 1RJRA 1LTSD 4U673 1B7YB 3OUZA 3MFIA 2YZMA 3I4LA 4F4ZA 1YNXA 2D2CC 2WFWA 1L2FA 1LTRD 5KG2A 1IBKQ 3FDSA 3HBLA 3GIKA 1XNQL 1ZQ7A 2ZDGA 1IYVA 4J9OA 3PF4A 2L55A 5ELCA 1X3PA 4LFAH 4DV3H 2ID0A 5A2QE 2V58A 3UQ8A 1IOWA 2V4DA 3KLSX 1N33Q 1A8VA 4JI0Q 2PNRC 3KAJA 4WRDA 3KBGA 5C3EH 4OWXB 3I72A 4Q0FA 1JJ2A 4OX9H 1PH7A 4DUYL 1SYXB 2F03A 1SE8A 1Q1EA 4A3FH 3GTOB 3CCLA 4BBSH 1M1KC 3K3PA 4I50F 2F0MA 2IPKD 3A8IE 1GUWA 5ELEA 2W6QA 2QK4A 4MV4A 3MXGA 2K5VA 1EY0A 4F7XA 2RGVA 5EZYF 1C4QA 1HHVA 1SNMA 2EY6A 2DNEA 1QVCA 1STGA 4JV5L 4C1NK 5K36H 4G57A 2FP4B 3F2UA 1FKAH 4F4WA 1O75A 1Q86C 3U9SA 4DAPA 1H95A 3CCRA 5EKIA 1LTLA 5G3LF 1HR0Q 3RZOB 3RJ0A 1CQVA 4ECRA 2HQEA 4X62L 3CAMA 1LTID 4A93G 2VA3A 3QOLA 2KA7A 5IGGA 2FXQA 1PRTB 1BXRA 3T1YL 4PZ7A 3C0FB 3IRBA 3QOJA 2XGQA 1HZAA 3HS0C 4J9PA 1I50B 1GM5A 4EQOA 1VQ4A 1KD1C 3HOZG 4K8IA 2EYOA 2IX1A 1CQFA 3AEVA 5ELDA 3VR4A 1OXSC 2C00A 4X3SA 4ECSA 1KDCA 4YWKA 4QIWB 2HHHL 1H9SA 4MHEA 2CW8A 1T94A 1C0AA 4UCSA 3OSNA 2V59A 3CC2A 3BA9A 2MUYA 1J5EL 4P71A 3D6CA 5L37A 1IKMA 1F2MA 4A4IA 1V1QA 2KQ3A 5AJ3Q 5HGTA 5CV8A 4DN4M 2FLPA 2F1MA 2G9HD 2Q8RE 1IHZA 3GTMH 1SEIA 2NN6G 5LMUH 4YJ2F 5KFPA 3CCEA 3NBHA 5L1KA 2OXPA 4JI3L 4DV4Q 2E2IA 5GAHC 4L6TB 4DAMA 1KHIA 3MWDA 3HOVB 2UXBL 5KFGA 3O13A 4JOIA 2LY7A 3HOYB 3QB3A 3PW4A 3ND9A 4M8AA 5DM63 1XPRA 3U4VA 3PW5A 1EQTA 3NXWA 2L4NA 4UAIA 2YU9A 4GOPA 2WDTA 3H4BA 1IXRA 1HQMC 1LABA 3ICEA 1EZ8A 1U4LA 3FVQA 4P73A 1D5ZC 1RF2D 2LKVA 4JK1C 3SK4A 2EPBA 3CC7A 1TWFA 5KG3A 2KENA 3MXUA 4R1JA 3E5NA 1N56A 1XNRQ 5KFDA 3R5FA 3SE7A 4GLVB 4BBRB 3W1GA 2MPMA 2CQYA 3NTKA 1FNVA 1D5XC 1GUGA 4LW1A 1PV4A 3I12A 4OHJA 5BR8Q 2NU8B 1Y1WA 1EUDB 2MO1A 2R7ZG 1H9MA 2XGTA 2JA7B 1JXLA 4NKLA 2KECA 2PMZE 1WD0A 4ECZA 2YTVA 5C44B 1I4GA 2J6SA 4YP3A 1VF5C 4UCTA 5DG8A 1Y1VA 1CUKA 4RGMA 3CMAA 2D0OA 4BWGB 1XNQQ 2W9BA 2UXDL 1LLRD 5KG4A 3KHRA 1ZYRD 1PMRA 2K5QA 3DM3A 4KD4A 4XQQA 2Q2TA 5IWAH 3HOWG 3SK8A 4J9MA 4O3QA 1WTPA 3R5HA 1PRTD 3UDGA 3Q8SB 1R9TH 3PO2G 5KYIA 1VQMA 2XN9C 5BN5A 1K28A 5BMVF 2VZAA 4MTDA 3E6ZX 3ERSX 4MTEA 1EOTA 2ZDQA 4LAAA 2B2VC 3PV0A 1JOKA 3GTJH 1PFNA 4UFZA 4QMGA 3N40P 3GV8B 1K3RA 1WCMB 2IY5B 3PUVA 4A2AA 3DWAA 1PTOH 1WTHA 4JV5Q 3K80C 3ETJA 1QCBD 1TS4A 1GSHA 4L63B 1EZ1A 4PWQA 2WYOA 5JOBA 1HNXL 4O2AF 1B1ZA 4IN3A 1I3QH 1SNQA 1UE1A 3H6MA 4I7ZC 1STYA 2PMZB 2IT1A 3ORRA 4UCRA 3T1YQ 4J15A 1Q90A 4X64L 3CQZB 4L5QA 1IW7C 3GV7B 2R61A 1TWAH 3M4QA 2CWPA 3NHHA 5C3WA 2B29A 2EQSA 1VQPA 1ZHQA 2B2TA 2A6EC 3G4SA 2IHEA 1I94H 1F9RA 1XTCD 4AQYL 4IUNA 3CVZA 4EVOA 5KG1A 4A3BB 4F87A 1DOLA 4HJ9A 2K5WA 1SMXA 4XYQA 3S2DB 2ZXOA 4IPCA 3NEMA 4DXFA 3M4IA 4DR2L 3K58A 2HHHQ 1AW7A 5KG5A 3G48A 4J9RA 3IAYA 1CTMA 1KIXA 4PMCA 5FLXL 3TP7A 1YBYA 2EVBA 4KHVA 2WACA 4ZQ3A 4CGYB 3GQCA 2KVMA 2F0SA 1FGBD 5EPKA 5DAUA 1KC8C 4XYLB 2B2WA 2CW0D 4GNXC 2EYMA 4HYKA 2JA5B 3BQ2A 3J81L 4FP5D 4O3NA 3TMEA 4JI3Q 3GTQB 3KUPA 4FO2A 4APMA 4HQ6A 4RH6A 3IN5A 1JWSD 2B63G 2L0CA 3J7A5 1SYBA 5M5YB 1E1TA 1VQAA 3V05A 1M90C 3PO3H 4LWCA 1UUPA 1X55A 4UDUC 1STAA 5KX5F 1BVSA 2Z0SA 1ICWA 4JI8L 5KEEA 1QZGA 5JH7F 1CFMA 4YHHQ 1EIFA 3FKIG 3GTOA 1EYCA 2K1BA 5KFJA 2FPPB 3DLLA 1VQDA 5HV6A 3RAQA 3BZDB 4NXNL 1N36L 2UUAH 4YJ3F 3RMHA 4A3GB 4ULLA 3WO0A 5KNDA 2K75A 5EWFA 2AKWB 4RUCA 3AB9A 4XXEA 5KFLA 2F0KA 1VAJA 2RQXA 2R7MA 4JI1Q 1K1SA 3K8AA 1VQHA 5KG6A 3BZCA 5FJ8G 2UXCH 2ASBA 1BBXC 1JOOA 2ZTEA 3KLRA 2IWHA 2J9GA 1SXTA 3S9WA 4RNMA 4QGUA 4L1KA 2MCTA 2E2JB 1X9NA 1S68A 1H9JA 4O2DA 2XWJB 1Y1WG 2UXDQ 3S1NH 4ABNA 4DV1Q 4TV8F 1OXTA 5JEAJ 2ALZA 1QE6A 1S03G 2HCIA 2RHSB 3ZJYC 5J39A 4A3MH 3GIPA 1I50A 4HEDA 4DR3H 2XTIA 5FLXW 4A3CH 4ED7A 1L0XB 1BCPB 2KCMA 3MR2A 4XTCS 3WOFA 1Y1VG 3RBEA 2A1AA 1E1OA 5IP9H 1SE3A 4C56C 3MWYW 1EEID 4BS9A 4GKJL 4K14A 5KT3A 3NWTA 2R92A 3I4NB 1XMQL 1I6UA 1VQ5A 4DR4Q 3J81W 2F4VH 4JI7L 5KNBA 2JSOA 3MA2B 2CZGA 4X65L 5M5XB 4N8FA 1MGSA 1ET6A 2HJWA 2W6PA 4PZ6A 1T9HA 4J9KA 1T5XD 2IX0A 3JAML 2EZVA 5JPMC 3VYTA 2F3IA 1ZKOA 5JVG3 4HMIA 1YHQA 4P75A 3G7LA 2ATWA 1HZBA 1K0SA 1QVFA 3A5ZB 1XWEA 3L4KA 2BQUA 3GTPB 2PPBC 2N88A 5EBCA 3MAQA 4X64Q 2FPIB 3DXJC 4DV5L 4RB1A 1A6XA 3KJOA 4B3TL 1CK1A 3NTIA 2HDLA 4J8QA 2HUGA 2MHVA 4Q45A 2MNAA 1T3NA 1TT2A 1VDZA 4FM9A 1UWVA 2FJ2A 3T4AC 4AQYQ 2NVQB 1M7JA 1T36A 4EYHB 5A2QL 1HQRD 1F9PA 1TY0A 4IUVA 4DR2Q 1Z2OX 5FD5A 2MJ8A 1GOZA 2RDFA 1QOHA 4C2MH 4A3DH 1K83H 3S14B 2F52A 2X0SA 4C3JG 4C3IB 2BDOA 2GN5A 1XTDA 3OMCA 1N9WA 3H0GG 2JA7A 2W9AA 2RCNA 3RUPA 1BBUA 1A0IA 1YEZA 1EQRA 3HB9A 2M2LA 2LXKA 5DQIA 4FYDA 4GN5A 3M9NB 5DGAA 3IKJA 5I9PA 1STHA 5KFEA 2M00A 1PXUA 4ALPA 1FNWA 4DR1Q 2R93H 4I7AA 3UE0A 1SYFA 1S97A 3ER0A 4P2CB 4A3KH 2HCCA 5DLFA 1MHWC 3IL8A 1YIJA 3JAMW 3CXCA 4GZYC 3G8CA 4LF9L 2QF7A 1FR3A 4KY7A 1QG7A 4G3IA 5H1SE 5JEAG 3HOUH 2B2YA 4NXNQ 1BCPD 3J7AV 1D8LA 1CHQD 4I65A 4CJ1B 1D1IA 1O7IA 4TRDA 1W6KA 4X66L 3H15A 4C5CA 1WTXA 4C3HG 1WCMA 2BE5C 2YW2A 1X56A 2I0QA 4J1MA 3EPIA 1U5KA 2LSSA 1EZ6A 2EOTA 2NUCA 3KLSA 5M3FB 4CKEA 5J1ZA 1Y69U 5HY6A 5D1OA 1EY7A 1NBWA 2JA6H 3TREA 4J0MA 4LF8L 3PQIA 1RIPA 4DAVA 3HOXH 1PH6A 2DY8A 4F88A 2PMZA 5A2QW 5JVH3 2W7PA 2K04A 1WYDA 2HIVA 4RA8A 3MR5A 1KAWA 2X6LA 2GPWA 2VOBA 5EPJA 3Q8PB 1C8CA 2WINB 3CQZA 3SI8A 5C4ZA 4DR5H 4JOIC 4K2LA 1R4QB 2VS1A 1QVGA 2A6HD 1SFOB 5KFRA 4NPSA 1V4YA 1FNUA 3MFGA 3D4RA 1A2UA 4GKJQ 1TWGH 5C5JA 4NP5A 4GOPC 2MO0A 3VYRA 3TRZA 1XX8A 2K5DA 3MC0B 2XD4A 1NE3A 2K01A 4JI7Q 1L1OB 1EYZA 5KFBA 2K28A 5IYCH 1U9RA 4U68A 2B39A 3G6JB 1I4XA 4X65Q 2ZTCA 3OW2A 4V190 2SEBD 4N9TA 2ZXRA 3LMLA 3NWSA 3OHXC 3J80E 1TS3A 2B3GA 5JAVA 5D8DA 5KKNB 4HJAA 4MV3A 2JN4A 4DK3C 2JA5A 2NZHA 1SYDA 3A7AB 1OO9B 3TBIB 1CA6A 3OYYA 3K3VA 2DNCA 3W1BA 3PW7A 3EVQA 1DZ1A 5C4JH 4EQPA 3V6HA 2E2HH 3V4SA 1JQYD 2KOLA 2JYOA 1KL9A 4DV5Q 3A55A 4LF4L 3STBD 4CC5A 4JI0H 3A7LA 2NVTH 5IYZF 4LF6H 3DEPA 1EUCB 3W5OA 3P20A 1D6EC 2FHTA 3HOVG 2AQ1B 4FS1A 4NXMH 3VPBA 2D62A 4OWTB 3HOYG 3S15H 3X3MA 3V6KA 2Z1CA 2XSCA 5KFAA 5EWGA 2I5HA 5JPNC 5FO7B 2NVYH 2F0OA 4RB3C 1WSCA 4B3RL 3FPPA 1IL2A 4HNUA 4ED3A 5IP7G 4DPGA 4I55F 5D3IB 2YYAA 1VQ8A 5TSSA 4S3SA 1O80A 4JC0A 5FKAC 3T1HL 4BBRG 1M8AA 2JE6I 3GIIA 2J7ZA 3OW7A 4P74A 1N33L 5IYDH 1D7QA 5D65A 1ZXTA 5DNFA 1QZHA 1N32L 2D5DA 1KRTA 3P7JA 5FLXc 4AH6A 2MQHA 4ZK9B 4LF5L 2JA7G 2WB1B 1TY2A 2VQFQ 5C44G 4WBNF 4DL2A 4KY5A 4IRDA 2JXMB 5EBDA 4H0LC 2GVBA 4MAMA 1TWCH 4LF9Q 2AMCB 3J81c 1N48A 4KN4C 3BVMA 1W96A 4F8MA 1AUVA 4BY1G 1HFGA 1SE2A 4DNIA 2KSWA 5LL6X 1JMCA 2BA1A 3S1RH 4IQZA 5CR3A 3I4MB 4X66Q 1PH5A 2A69D 2NU9B 4MV7A 4RGNA 3GV6A 4PG3A 1UE7A 3RD4A 3RF2A 3E3XA 1HR0L 3EBEA 4ECUA 1KJ8A 4YIJA 1IBMQ 1RL2A 2DUDA 3K7UC 1VMPA 2RKSA 5IT9c 3JZIA 5DLGA 1M6VA 5LOVF 2K05A 4LF8Q 2PBZA 1N34H 4A93H 4RNNA 1WCMG 2L1BA 4LFCQ 2B2WC 1PDQA 5KFVA 2DWCA 2JEJA 1HNZH 2A68D 1UNNC 1MSGA 2Z4HA 1GUNA 4K0KQ 4QWAA 1HRJA 1F2YA 1TXYA 3HGBA 1R9TB 3HOZH 4DF7A 4MV6A 2UUCQ 4MTKA 5C0XI 4YY3Q 3R23A 1STNA 4JG2A 1S0OA 1FJGH 4J9QA 1CKNA 3J81i 4KHPH 2LMCB 3R93A 3AFQA 4AIMA 1U4MA 4FDBA 2ZT9C 4BY7B 1NR2A 4DV6Q 1E22A 3SXHA 4DV4L 3GTGB 4A3BG 1X3GA 4OGQC 3HRZC 1K8MA 2V4QA 5EWEA 4RZRA 4JV1A 2H4OA 1F9QA 3I73A 3U9TA 2DPJA 5CV6A 3SGIA 4B3SQ 2AWNA 1GLVA 3M85A 1ULZA 3VR5A 5KT5A 3VYSA 1ZYRC 4DR6L 1Y8NB 1F2LA 2EYFA 1Q46A 2IHFA 4FXKC 3JAME 1KTKA 5K5PA 1QWYA 1EWCA 1PRTC 4LF4Q 2VQEQ 1PYWD 1HR0W 2JA5G 5C4XH 3J7AK 1XNRL 1MJCA 3DWQA 3PGZA 3RGXA 4QWCA 1HXYD 1C48A 3S16B 1YNND 2C5CA 4GN3B 2LS01 5I2XA 3VMMA 3MFHA 4DUYH 4IR1A 5C0XJ 4IFDI 1RODA 3ETHA 2WKDA 4EBCA 1B9MA 2L11A 5KFSA 4DUZQ 2J0TD 4RKBA 1K73C 4LH6A 2R7ZH 4ZHQF 3K5IA 1LO5D 4B3RQ 2H1EA 2Z8LA 3ZYYX 1CHPD 4A3GG 3T1HQ 3KOJA 1XXGA 3GTKH 1TIID 2G5DA 4ZUJA 1YJ9A 1B50A 5ELFA 4X62H 5DG7A 1E2WA 1LTGD 1X3QA 4C3HB 1N32Q 4EYIB 1UAPA 4O3RA 1KQSA 3KDFA 4LF5Q 4QIWE 2R7FA 3MWEA 1SDFA 5CV9A 1LTBD 3RV3A 3CRLC 3K5HA 3PO2H 4RCOA 1SFOA 4ED2A 3Q6SA 1H9RA 3JAMi 1EY5A 1WOCA 4NDXA 5CA1F 3Q8RB 3PUXA 3BA8A 5G3LD 2IX3A 1IBLH 2W71A 4CHTB 4ECXA 1I4HA 3KFUA 2QA4A 3N6RA 4IFDJ 3TINA 1EIGA 2NTSA 1NJIC 3KF6B 2XCLA 3W3AA 1KJJA 1QB5D 1S5FD 1B33N 1Z7TA 5KNCA 1J5EH 3I4NG 3SHLA 4KN7C 2CW0C 3QJYA 2FB9A 4R8UA 2FINB 3K0XA 2XIWA 5J2UF 3F1ZA 2N49A 4IPGA 4IHJF 1I4QA 3T53B 3K7AH 5M5WB 3S1NB 3RIZA 4JI3H 2W6OA 3L0OA 3NUCA 3EPGA 3Q8QB 2UXBH 4H44C 5T1IA 2JEGA 1Q12A 3FMCA 1VF7A 4IZ8A 3WDNA 1YJNA 1PTOF 2DY7A 3N8DA 3CCMA 4DV3L 1SE4A 1EEFD 4EQNA 2UVUA 5IGBA 4R4TA 4ECYA 3G6YA 5LMNQ 1GUOA 1TVXA 4X6AH 1VQKA 2W6NA 1BKBA 4PMBA 1MJEA 4E4TA 4DL7A 2B63A 3SVMA 1SJHD 2RDIA 3UFXB 3EYYA 1JB3A 2B2YC 4WJ4A 1QILA 1V1PB 1KLUD 2I46A 1K8AC 3FEWX 2BH2A 3SEBA 5C0XG 5GAEC 2IW3A 2E5LL 1NSNS 2H5XA 3RB6A 1YI2A 5EDWA 4DU9A 3FKIA 5C8YF 1LT4D 3NSWA 2NYZD 1R4PB 2L15A 2ZM6Q 1BGWA 4YWMA 1X6OA 1DOMA 4C3IG 1JDEA 2UVWA 1EL0A 2Q8TA 4DR6Q 3M4OB 3PR4A 2HDMA 4WD3A 2I8CA 1PFMA 5KFXA 4YHHL 1E7ZA 1Q8IA 3LWEA 3M7GA 1X65A 3K5LA 2HVSA 2KBNA 2E2IH 2QGQA 4PV1C 1N8RC 1RJPA 2FFKB 3RLNA 2VQDA 2XC9A 3CW2C 4DFAA 4ECQA 3VYUA 2YU9H 3RZDH 3E5SA 2V9WA 1PYBA 1GXDC 2HVRA 4JI1L 4XYOA 2I5MX 4JUZA 2VR1A 2D0PA 1DCZA 4LUZA 3K81C 5FPRA 1TWFH 2ALYB 4HCSA 3GTLH 4XYMB 1RD9D 1JE5A 1L0YB 4JI2H 3V6JA 2RDHA 4IWYA 2F4IA 5LL6b 4BXXG 2F0QA 1NMGA 3I70A 4C5AA 1IOVA 2HIXA 1RYRA 4IFDG 4JW0A 2OQ0A 4DV1L 2CWAA 4BY1B 2BDNA 1WR2A 4JVZA 1CZWA 5LYJF 5KYLA 3VR2A 4JBWA 5LMUL 4ED6A 3VA7A 3N41B 5KFMA 1HNXH 2WAQE 3Q1KA 2CHBD 3T5KA 4A3KB 5M3FG 4QUCA 5IGCA 4LSXA 4Y52H 2ASDA 1E4FT 3C1EA 3SR1A 3TP5A 3J80L 4Y7NB 4HIMA 1Y1VH 2XWBB 1MSHA 1NUCA 1JR0D 2PN1A 4DR4L 3J81j 4LNQA 2R7DA 1SEBD 2NVXB 4JI4L 3FPUB 1Z47A 4UP9A 1QUQB 4RCNA 4A3EH 2ZJTA 4LMYA 5FOBB 5LXTF 4YR2A 5LHY1 3D4DA 3H3VI 2CH4W 4DL3A 4B08A 3H20A 4OIKA 4BA1I 2VUMB 1Y14B 5E3FA 1TS2A 4JBKA 2A19A 2KUMA 4KD3A 4KKUA 1IL8A 3TQYA 4UCVA 1SJED 3EROA 3GTGA 2W8KA 2J6TA 3RBDA 1T5EA 2JA8H 4K6DA 1AZQA 2EYJA 3K57A 3HP3A 3TP8A 4U6PA 5K36G 5JQWA 5KT7A 2GLTA 3T5JA 1UEAB 4NMZA 1K8GA 4ID6A 1WFQA 3RAXA 3H0GA 1ONLA 4LFAQ 4DV3Q 2WAQB 1PX2A 3N52A 3LWBA 2YCHA 1HFNA 4JI8H 5FLMG 4TUYF 1Z2PX 1BCPC 2ZJPA 4OX9Q 5D14A 3DHQA 4TQSA 4HJ7A 4YAKB 3E9IA 1N36H 2L9HA 4JYAH 4C3JH 5GADC 3J80W 5EKLA 4ME5A 5KFKA 1F9SA 2E8GA 3KYHC 2E5LQ 1I6HB 2W70A 2F0WA 3I7FA 4HTHA 5HGQA 3AMUA 3ERQA 4DR1L 2XIGA 4ZYSA 2K32A 3V4ZA 3M9BA 2RSOA 3DM1A 3ND8A 4YQWA 1E24A 1LT6D 3MR6A 5KFZA 1Y8OB 1SYGA 2TSSA 4CBVA 2N55A 4H02A 5CB4F 4GC7A 4A3LH 2NVTB 3S2HB 4FBTA 2A6HC 1B3QA 2MP1A 3OSOA 1A9XA 4IRCA 3UDFA 4LF7H 2PQAB 5JEAH 4AYBE 3PSIA 3S15B 1RKNA 1TWHB 1UC8A 5I47A 1E0BA 2E75C 1JLLB 2V1CC 2UU9H 2WB1G 1XMQH 4LFBH 4IPHA 1YNJD 2NU6B 4DR7L 2OLSA 3GLKA 2NVYB 1TR5A 4RG1A 4YB8B 5KG0A 4X65H 3GTOH 2M05A 2NU7B 2K14A 3KTMA 4RAYA 4UPAA 2CFMA 4OL7A 3I4MG 3FMAA 5GQOA 3NELA 2VXWA 3L2PA 2C9OA 4J9NA 2IP4A 5LMUQ 1Q7YC 1WTQA 1DYQA 1PFSA 2PZUA 3AYHB 1RDPD 1D2BA 3PMFA 3STBC 2F0HA 4ZOLF 3OSPA 5DG9A 4KI0A 4KK7A 3RZOH 1TWCB 4DV5H 4CKBA 2PYKA 4B3TH 4GKKH 3GILA 2YTXA 4QIWA 4JI4Q 1EWHA 2UVVA 2FLNA 4A3IB 1HNWH 3CMEA 3MXPA 1EIHA 1YZ6A 1I50H 1O78A 1G2SA 5CA0F 3DUZA 3CC4A 4R4CA 1WTVA 4AYBB 5HURA 3GDEA 1V51A 4I4TF 1V1PA 2R92H 1HZCA 4DLKA 3KALA 2JJQA 2C35B 1CT1D 1VS0A 5E7NA 3T13A 4IWXA 1K8OA 1AN8A 4GNXB 4EBDA 2C2RA 4A76A 3X3NA 4O2BF 3K59A 1BO0A 5KT6A 2OEOA 1S9FA 4HSPA 4BY7G 1KBLA 4Q8FA 2FJZA 1V1OA 4HNTA 4KJNA 1GSOA 2DLNA 3K6OA 3OHBA 1HJPA 2F0FA 3HXLA 2ES2A 3BS1A 5KFQA 1RJQA 4DV0H 3HOVH 5IWAQ 1VKZA 1E2ZA 5C3XA 4DR3L 1CI3M 3HKZE 1HTPA 1XMOH 3HOYH 3BDCA 3N42B 1P8LA 2DN8A 2XVSA 3BDOA 4DV7H 1B44D 2YYZA 3MZ5A 2A69C 3JSNA 2F4VL 1O7LA 3R3OA 4TKOB 1NCVA 1S40A 5FD6A 1C30A 1RTOA 3EFXD 1B2TA 2KHIA 1B3AA 2DJGC 2NUAB 2KCNA 1FVIA 3F8NA 3BZKA 4IUPA 3AFPA 3RB3A 4LF8H 2VQFL 4O0AA 3CD6A 2A68C 4UP7A 2JA7H 4G7ZC 1YITA 1RJTA 4M7EA 2AGOA 5C44H 4DGZA 4ZCKA 2L12A 4M1UB 1G51A 4IR9A 4QB4A 5C4XB 1SR3A 2NB0A 2NVXA 3ITPA 1VQGA 4R8IA 1QUQA 1JE4A 3A8KE 4HN7A 4GLAC 4FBUA 4LUVA 3TZDA 1Q3LA 4DNRB 4O1NA 1I94Q 4JI5L 3DF7A 1DXMA 3OTOL 3HKZB 3J7YW 2O5IC 3QWNA 2DPIA 4DR7Q 5K2MA 1KNAA 2VUMA 4DV2L 1IBML 1EQVA 2HGSA 3M3YH 2PNHA 3PN1A 4IALA 3TSSA 4LFCL 2K50A 1OXXK 2X6GA 4L5SA 2KHSA 5IODA 3GTKB 1WCMH 2KEDA 4APVA 1H9KA 2ATLA 4K2KA 1I5FA 2JEIA 2HVQA 1O7YA 5C3EB 1CE8A 5DQHA 4K0KL 3EJIA 2F3WA 5CBEE 2B2UA 3D8GA 1AZPA 4A75A 2UUCL 4YY3L 4MA5A 2EY5A 2Z4IA 3TS2A 4A3FB 4BBSB 4Y8VB 5NUCA 4LF4H 1YNNC 5M3MH 1KXLA 3MWMA 5KFIA 1V43A 1MBYA 1ICFB 3CCVA 2E76C 4JI6H 1HH2P 4KHZA 5EPLA 1ML0D 3CQZH 4TVAB 4WORA 1W3SA 1B53A 2Z6KA 3OIQA 4A3CG 4DV6L 3JRWA 1V8QA 3CPFA 1FD7D 2R82A 2Z9HA 3J80c 1HA5A 2UUAQ 1GHKA 2I87A 1EUJA 4B3MH 2LXJA 4B9XA 1VQBA 1G8ZD 2AWOA 3CPWA 5BN3A 3ULPA 1K9MC 2BA0A 1S5CD 4B3SL 1RYSA 2WB1E 1M0TA 2PW7A 3GTQA 1IBKH 4FXDA 3RLFA 3T5LA 3B6YA 1EYGA 4IOCA 1YVCA 1DOKA 3CF5A 2UXCQ 3TIIA 1B70B 1N33H 2VQEL 1E3PA 1JORA 4O42A 4H7BA 1K0RA 4JCVE 3BAAA 1V9PA 1ENFA 2JA5H 1CQJB 3J7AF 4ME3A 3TN2A 3R5XA 4BA2I 1EY8A 4YR0A 2PQAA 3QG1A 4DR3Q 2FK3A 1HPCA 2F0VA 3L7ZC 4FNFA 4MTNA 5LL6S 4DUZL 4A3JH 1TWHA 5M5YH 2IMWP 2X69A 3LX0A 4R9WA 5KT2A 3WOEA 4QL5A 4CDFC 5KIXA 4H13C 3GTMB 2EE1A 2F4VQ 1WJJA 2K52A 3KF8B 3S1MH 1DD2A 5C4HA 1DIKA 3OWEB 5C1OA 3J80i 1AE2A 1B9NA 3H3VC 1HR0H 1B4OA 4DL5A 3OUUA 2D9UA 1FL0A 1BQQT 2R87A 4G4KA 1A2TA 1UEBA 2MFIA 2EY1A 4F50A 1D1KA 5LA6F 2IJ0A 1A15A 4KKTA 5KFHA 1HCZA 1KJIA 4WFN3 2F0UA 3K5OA 4J6HA 1ET9A 2EYLA 4ED1A 4E6IA 1OTCA 2AGQA 3E9HA 3RV4A 2R84A 4GS3A 2AUKA 3CHBD 2E2JH 1LTTD 4J9LA 4X3TA 4RNOA 1JIHA 4QY7A 2BH8A 2B2TC 2R8JA 1QNKA 1BNCA 2VB3X 5HBRB 4LF6L 4A3KG 1Q1BA 1SNPA 1XPOA 2YU9B 4GOPB 2NZ1D 4KKSA 5KFFA 4FVMA 2XNAC 4JI5Q 4AYBA 3OTOQ 3AQQA 2W57A 5KFYA 4K8JA 4DV2Q 4R4QA 2TMPA 3I4NH 4LJZC 1VQEA 1PH4A 2UUBL 1JOQA 2GVAA 2SNSA 1KRSA 2PVPA 1EHIA 3M9MB 4DV4H 5IGEA 5M5XH 3GTPA 3RN5A 4B9WA 5KFWA 5FK9C 2VUMG 2OT2A 1I4PA 3IG0A 1DV1A 3H40A 5LMNL 1GSAA 2YL2A 2A5HA 3VR3A 4F4YA 3NENA 1I7NA 2R6FA 2AGPA 3GTJB 1ENAA 1KDBA 2C2DA 3NE5B 4A3EB 5C5MA 2Y0SG 1XNRH 3F2DA 3I2ZA 2F0PA 1PZKD 2B8GA 5FO9B 4QF4A 1VQCA 1ASYA 2PI2E 4QCLA 1PTOB 1VBGA 3OHAA 2ASLA 5BR8H 1OXVA 4LUOA 2FMMA 3C2PA 3NK9A 2WAQG 4IZOA 4QUFA 2NN6H 2RSNA 3IFTA 5C0XH 2NVQH 4IOAA 1I3QB 3ULJA 4WJ3M 2ZM6L 1LM0A 2JA8B 4KMUC 4NLGA 2VW9A 2EXZA
chains in the Genus database with same CATH topology
1VQOA 2ASBA 5IP9G 2ZTEA 3S14H 1GVPA 4LF7Q 4C3IH 3JAMc 3CW2C 4QGUA 4A3BH 2YU9H 1LUZA 1X3EA 3RZDH 1PYBA 1X9NA 2K5HA 3S2DH 4O2DA 2UXDQ 4JI1L 1Y1WG 3S1NH 2I5MX 4DV1Q 2D0PA 2UU9Q 1OXTA 4LUZA 5JEAJ 1XMQQ 4LFBQ 4OO1I 3K81C 2RHSB 3ZJYC 4A3MH 1TWFH 1UE6A 2ALYB 3GTLH 3S1QH 1JE5A 2XTIA 4A3CH 2Q2HA 3HKSA 4NB3A 2KCMA 4XTCS 2RHQB 4BXXG 1Y1VG 2A1AA 3PCOB 1E1OA 1NMGA 3K8AA 5IP9H 2HIXA 4DR5Q 4GKJL 1YJWA 4IFDG 2R92G 2OQ0A 4YCWA 4DV1L 2CWAA 1XMQL 2N8NA 1VQ5A 4DR4Q 1NTGA 4JBWA 5LMUL 4JI7L 3S24A 1I6HH 3E0EA 2WAQE 3GTQH 3BJUA 1FJGL 4X65L 5M3FG 4UY8C 4Y52H 4KHPL 4DR5L 4GN4B 1C7YA 3J7ZC 1IZ6A 1A63A 2Q2IA 4PZ6A 5LMNW 1T9HA 1Y1VH 3RLOA 2IX0A 4HIMA 3A5UA 4BXXH 4DR4L 3J81j 1CSQA 5DLQE 2R7DA 4LNQA 5IYBG 5EAYA 2F3IA 2CCZA 4JI4L 4OONA 1Z47A 3CCUA 2OCEA 4UP9A 1QUQB 4A3EH 1FGUA 1YHQA 3S17H 4POFA 4P75A 1W2BA 3CCJA 3JC66 4B3TQ 3HOWH 3S2HH 2ATWA 4GKKQ 1HZBA 1QVFA 3D0FA 3A5ZB 4EX5A 1HNWQ 5M3FH 4JI6L 4A93G 3VDYA 3H3VI 4A3GH 1EOVA 4BA1I 1Y14B 1TWHH 4JBKA 4X64Q 2A19A 4A3DG 3TQYA 4DV5L 5IYBH 3KJOA 5IYDG 4B3ML 4B3TL 2HQLA 2MNAA 2JA8H 1L1OA 3F8TA 1UWVA 4AQYQ 1IBKL 4LF6Q 3NBHB 2NZOA 2OQKA 3I56A 5K36G 1MKHA 4NXMQ 4DR2Q 5GAGC 1SFOH 2OTJA 3TS0A 4C2MH 4GLXA 4A3DH 2R6GA 1K83H 1BBWA 1K8GA 2F52A 1S72A 1JJGA 4JI0L 1WFQA 2R93G 2GN5A 1XTDA 4LFAQ 1N9WA 1SLJA 4IJLA 3H0GG 3UDXA 4DV3Q 4A3IG 2UUBQ 4POGA 3G71A 1UE5A 1PHJA 2RCNA 1BBUA 3FHWA 1NY4A 2JQOA 4MNOA 1A0IA 4L5RC 4NXML 4OWWB 1YEZA 1EQRA 1VQIA 4AYBG 5FLMG 4HIOA 2R7ZG 2LXKA 4DV0Q 1JB7A 2ZJPA 4GN5A 4OX9Q 4PZ8A 5ELOA 1XMOQ 2JEAI 4HJ7A 4LFAL 4ALPA 3HOUG 3E9IA 1GKHA 4DR1Q 4DV7Q 2R93H 4C3JH 5GADC 4R4OA 3UE0A 4A3IH 1P16A 3ER0A 1PH3A 4GNXA 4A3KH 1ASZA 1X54A 2YTYA 4OX9L 1YIJA 2E8GA 3KYHC 3RNUA 2E5LQ 3CXCA 4TQUS 5FLMH 3G6EA 3I7FA 4LF9L 1X3FA 5HGQA 4DR1L 5H1SE 5JEAG 2VY3A 3M9BA 2JA6G 1YHAA 3HOUH 3M4PA 4NXNQ 1PA6A 3GO5A 1D8LA 3F2BA 3PIOA 1E24A 1O7IA 4X66L 3HOXG 3H15A 1IBLL 3PF5A 3Q8DA 1VQ7A 1X56A 3PUWA 4H02A 2I0QA 3GTPH 4A3LH 1JT8A 1U5KA 2LSSA 3KLWA 4IO9A 4QQBX 5HY6A 3UDFA 2PQAB 2B63H 3CCSA 1NBWA 3EIVA 2JA6H 3TREA 4AYBE 1G6PA 3PSIA 4LF8L 4DK6C 1PH9A 1RIPA 2NN6I 3PUYA 2V1CC 3HOXH 1PH6A 2WB1G 1Q81C 4IPHA 1CKOA 1N34Q 4DR7L 5M3MG 1WYDA 2HIVA 1VQNA 1KAWA 1Q8KA 3FKIH 3WWVA 4RG1A 5IYCG 3UDIA 1VQ9A 3GTOH 1HNZQ 3BU2A 1VQJA 1G291 2K14A 4JOIC 5AJ3L 1J6QA 2VS1A 1QVGA 4UPAA 3A0JA 4NPSA 2CFMA 1PYSB 1N34L 1CSPA 4GKJQ 3I4MG 1TWGH 2Q2UA 4GOPC 2MO0A 3NELA 5GQOA 3TRZA 3L2PA 1PH1A 4RMFA 1HNZL 5LMUQ 1NE3A 4L5TA 4IJHA 1L1OB 4JI7Q 5C4XG 4OO1G 5IYCH 1FJGQ 5FJ8H 1Q7YC 4X65Q 1PFSA 2RF4A 2ZTCA 3AYHB 2Y0SE 4IPDA 3OW2A 2Z6KC 4KHPQ 3STBC 4KI0A 3RZOH 1GD7A 2I5LX 4YCVA 1C9OA 2B3GA 1Y1WH 3I4MH 2YTXA 2QEXA 4JI4Q 3FP9A 3HKZG 4HJAA 2JK8A 3CMEA 4DK3C 1EWIA 1SN8A 2NZHA 4UP8A 1YZ6A 1I50H 3OYYA 2OWOA 3CC4A 4R4CA 3W1BA 4JI6Q 4MZ9A 1IYJB 2K5NA 3GD7A 3GDEA 2CKZB 1DGSA 5C4JH 2R92H 1HZCA 5BR8L 4A3JG 2E2HH 2JJQA 1GO3E 2C35B 2WP8J 4DV5Q 1KL9A 4LF4L 1WI5A 4HIKA 3STBD 1VS0A 5E7NA 2JEBI 4B3MQ 2NVTH 1PH2A 5C3EG 1B7YB 3W5OA 1NMFA 1YNXA 4GNXB 3HOVG 2WFWA 1L2FA 2D62A 4OWTB 4A76A 1IBKQ 3HOYG 3S15H 1XNQL 4A3FG 4BBSG 4DUYQ 4BY7G 3PF4A 2ID0A 2I5HA 2NVYH 1N33Q 1A8VA 4JI0Q 4B3RL 1HJPA 5C3EH 1IL2A 2ES2A 4OWXB 5IP7G 4DPGA 1JJ2A 3HOVH 5IWAQ 1VQ8A 4DR3L 4DUYL 1PH7A 3HKZE 4JC0A 4JI2L 3T1HL 3HOYH 2ZTDA 3H3VH 4BBRG 1LYLA 1P8LA 1Q1EA 1SE8A 2JE6I 4P74A 4A3FH 3CCLA 1M1KC 2YYZA 3MXNB 1N33L 1HZ9A 4BBSH 4BY7H 5IYDH 1D7QA 3GTGH 1QZHA 1N32L 2K5VA 2KCTA 1KRTA 5FLXc 5IWAL 2F4VL 4AH6A 2MQHA 4LF5L 2JA7G 1S40A 4HIDA 4X62Q 2VQFQ 1QVCA 5C44G 4JV5L 4EQ5A 1CKMA 4R4IA 3TEHB 2GVBA 1TWCH 2KHIA 3RN2A 1PH8A 4LF9Q 1FVIA 2AMCB 3J81c 3KJPA 3BZKA 1Q86C 3AFPA 1VQLA 3CCRA 1H95A 1LTLA 4BY1G 1HR0Q 4KLKA 4DNIA 4X62L 3H0GH 2VQFL 3CAMA 1JMCA 2BA1A 4O0AA 3S1RH 3CD6A 4UP7A 2N78A 3F2CA 3EN2A 2FXQA 4QJFA 4X66Q 2JA7H 3LGJA 1IBLQ 3T1YL 1YITA 4PZ7A 4DAYB 1PH5A 3IRBA 5C44H 3S16H 2PI2A 4PG3A 1UE7A 1G51A 1HZAA 1HR0L 1SR3A 3EBEA 1GM5A 1VQ4A 4JBJA 1L0WA 1KD1C 3HOZG 1IBMQ 1RL2A 2DUDA 1VQGA 3K7UC 1J5EQ 5IT9c 1QUQA 2IX1A 3AEVA 4GLAC 4HJ5A 1VQFA 4LF8Q 4A93H 1WCMG 4LFCQ 4LUVA 1AH9A 1OXSC 1I94Q 4JI5L 4YWKA 3OTOL 3ULLA 2HHHL 2KHJA 4DR7Q 1C0AA 4DV2L 1U0LA 1IBML 3CC2A 1J5EL 1EIYB 2EIFA 4P71A 4K0KQ 3M3YH 2PNHA 4A4IA 1TXYA 3HOZH 1V1QA 2UXBQ 4LFCL 2K50A 5AJ3Q 1OXXK 2UUCQ 4L5SA 5C0XI 1I94L 4YY3Q 4C3HH 3GTMH 1XJVA 1WCMH 2NN6G 4YWLA 4APVA 4JG2A 1I5FA 3CCEA 3KF6A 4JI3L 4DV4Q 4K0KL 5GAHC 1CKNA 4DAMA 1KHIA 3J81i 2UXBL 3A74A 4YCUA 4A75A 4JOIA 2UUCL 3PIPA 3AFQA 4PMWA 4YY3L 3TS2A 4AIMA 4FDBA 3RR5A 1XPRA 3U4VA 4JYAL 4DV6Q 3M7NA 1OXUA 1E22A 3CCQA 4A3BG 4DV4L 4GOPA 3I4OA 1IXRA 1X3GA 5M3MH 3ICEA 1KXLA 1AE3A 1V43A 3CCVA 4P73A 3CC7A 1HH2P 4KHZA 3U58A 3CQZH 1EFWA 4TVAB 2KENA 4R1JA 3SGIA 2AWNA 4B3SQ 1VCIA 1W3SA 2Z6KA 3M85A 1XNRQ 4A3CG 2ZJRA 4DV6L 2CQOA 3CPFA 4GLVB 3J80c 3W1GA 4DR6L 1VQ6A 2UUAQ 1EUJA 3I55A 4LW1A 1PV4A 2IHFA 1Q46A 1EQQA 2LXJA 1Q82C 1VQBA 2AWOA 5BR8Q 3CPWA 1K9MC 3ULPA 4HJ8A 2BA0A 4LF4Q 2VQEQ 2MO1A 1HR0W 4B3SL 5M5WH 2JA5G 2WB1E 5C4XH 2N3SA 2XGTA 1XNRL 1MJCA 3U50C 3PGZA 2PMZE 3RLFA 2YTVA 3B6YA 4GN3B 2UUAL 1A62A 1EYGA 4IOCA 4LF7L 5C0XJ 4IFDI 1CUKA 1YVCA 3CF5A 5IE8A 1SROA 3CMAA 2D0OA 1XNQQ 1B70B 2UXCQ 2VQEL 1E3PA 2UXDL 3D31A 4DUZQ 1K73C 2UU9L 3DM3A 4LFBL 2Q2TA 1K0RA 4JCVE 4A3EG 2R7ZH 1V9PA 2JA5H 3HOWG 4B3RQ 5JJLA 4ME3A 4BA2I 3UDGA 2PQAA 1XPUA 1R9TH 2A8VA 2UXCL 4DR3Q 3PO2G 4A3GG 1VQMA 4JI2Q 3L7ZC 4DUZL 3T1HQ 3KOJA 4MTNA 4A3JH 2VZAA 5M5YH 3GTKH 3ERSX 1YJ9A 3PUZA 4QL5A 3PV0A 3GTJH 1PVOA 1N32Q 1K3RA 2JA8G 1KQSA 2F4VQ 1HNXQ 1WJJA 2K52A 3KDFA 3KF8B 3PUVA 4QIWE 4LF5Q 3S1MH 2R7FA 2IY5B 4DKAC 1B8AA 4JV5Q 3J80i 3PO2H 1AE2A 3K80C 3JAMi 5JJKA 3M4OH 3UE1A 1WOCA 1FL0A 2EXDA 3PUXA 4GKKL 1HNXL 1UEBA 2MFIA 1I3QH 1UE1A 5GROA 5IP7H 1HNWL 1L1OC 2HT1A 1SRUA 2IT1A 3KFUA 4XIGS 3MEFA 2QA4A 4IFDJ 3T1YQ 4J15A 1NJIC 1S3OA 4BBRH 3KF6B 4X64L 1OTCA 1CKNB 3E9HA 4L5QA 1TWAH 4GS3A 3I4NG 3M4QA 2E2JH 2CWPA 3K0XA 2VNUD 2B29A 2EQSA 2BH8A 4QY7A 1JJCB 3CP0A 1VQPA 3F1ZA 3G4SA 2IHEA 2N49A 4P72A 4AQYL 4LF6L 4IPGA 4A3KG 1Q1BA 4HJ9A 1XPOA 1SMXA 4GOPB 2YV5A 3K7AH 5IY0A 4IPCA 2ZJQA 3NEMA 4DR2L 4JI5Q 3OTOQ 2HHHQ 3L0OA 3G48A 1Z9FA 3AQQA 4DV2Q 4R4QA 1Q12A 1KIXA 3I4NH 4BY1H 1YJNA 1VQEA 4OXPA 1PH4A 2UUBL 5ELNA 3CCMA 1YBYA 4DV3L 3PO3G 2GVAA 1KRSA 1YHBA 2JA9A 1KC8C 5J3BA 4R4TA 3U4ZA 4GNXC 5M5XH 5LMNQ 3RN5A 4DV0L 4X6AH 1VQKA 4Y7NH 2VL6A 2VUMG 1MIUA 1BKBA 1XMOL 4A3LG 4JI3Q 4JI8Q 1MJEA 5JJIA 4DV7L 2NVXH 2B63G 3J7A5 2AHOB 4WJ4A 1E1TA 1VQAA 1N36Q 1K8AC 5LMNL 4LWCA 1M90C 4JBMA 2BH2A 3PO3H 4JYAQ 1X55A 5C0XG 3NENA 5GAEC 2E5LL 1BVSA 2Z0SA 2H5XA 2K4KA 4JI8L 1YI2A 1QZGA 2Y0SG 4YHHQ 3F2DA 3I2ZA 2OTLA 2VUMH 1EIFA 3FKIG 1VQCA 2L15A 2ZM6Q 3DLLA 1VQDA 4YWMA 1ASYA 2PI2E 4NXNL 1N36L 1X6OA 1OXVA 4LUOA 2K75A 4DR6Q 2AKWB 2WAQG 2DGYA 4YHHL 2NVQH 1E7ZA 4IOAA 1X65A 3ULJA 4WJ3M 2ZM6L 3HFZB 2KBNA 1LM0A 4A3MG 2E2IH 2QGQA 4JI1Q 1N8RC 2VW9A 1VQHA 3KDFB 3RLNA 3BZCA 5FJ8G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQO A;  2ASB A;  5IP9 G;  2ZTE A;  3S14 H;  1GVP A;  4LF7 Q;  4C3I H;  3JAM c;  3CW2 C;  4QGU A;  4A3B H;  2YU9 H;  1LUZ A;  1X3E A;  3RZD H;  1PYB A;  1X9N A;  2K5H A;  3S2D H;  4O2D A;  2UXD Q;  4JI1 L;  1Y1W G;  3S1N H;  2I5M X;  4DV1 Q;  2D0P A;  2UU9 Q;  1OXT A;  4LUZ A;  5JEA J;  1XMQ Q;  4LFB Q;  4OO1 I;  3K81 C;  2RHS B;  3ZJY C;  4A3M H;  1TWF H;  1UE6 A;  2ALY B;  3GTL H;  3S1Q H;  1JE5 A;  2XTI A;  4A3C H;  2Q2H A;  3HKS A;  4NB3 A;  2KCM A;  4XTC S;  2RHQ B;  4BXX G;  1Y1V G;  2A1A A;  3PCO B;  1E1O A;  1NMG A;  3K8A A;  5IP9 H;  2HIX A;  4DR5 Q;  4GKJ L;  1YJW A;  4IFD G;  2R92 G;  2OQ0 A;  4YCW A;  4DV1 L;  2CWA A;  1XMQ L;  2N8N A;  1VQ5 A;  4DR4 Q;  1NTG A;  4JBW A;  5LMU L;  4JI7 L;  3S24 A;  1I6H H;  3E0E A;  2WAQ E;  3GTQ H;  3BJU A;  1FJG L;  4X65 L;  5M3F G;  4UY8 C;  4Y52 H;  4KHP L;  4DR5 L;  4GN4 B;  1C7Y A;  3J7Z C;  1IZ6 A;  1A63 A;  2Q2I A;  4PZ6 A;  5LMN W;  1T9H A;  1Y1V H;  3RLO A;  2IX0 A;  4HIM A;  3A5U A;  4BXX H;  4DR4 L;  3J81 j;  1CSQ A;  5DLQ E;  2R7D A;  4LNQ A;  5IYB G;  5EAY A;  2F3I A;  2CCZ A;  4JI4 L;  4OON A;  1Z47 A;  3CCU A;  2OCE A;  4UP9 A;  1QUQ B;  4A3E H;  1FGU A;  1YHQ A;  3S17 H;  4POF A;  4P75 A;  1W2B A;  3CCJ A;  3JC6 6;  4B3T Q;  3HOW H;  3S2H H;  2ATW A;  4GKK Q;  1HZB A;  1QVF A;  3D0F A;  3A5Z B;  4EX5 A;  1HNW Q;  5M3F H;  4JI6 L;  4A93 G;  3VDY A;  3H3V I;  4A3G H;  1EOV A;  4BA1 I;  1Y14 B;  1TWH H;  4JBK A;  4X64 Q;  2A19 A;  4A3D G;  3TQY A;  4DV5 L;  5IYB H;  3KJO A;  5IYD G;  4B3M L;  4B3T L;  2HQL A;  2MNA A;  2JA8 H;  1L1O A;  3F8T A;  1UWV A;  4AQY Q;  1IBK L;  4LF6 Q;  3NBH B;  2NZO A;  2OQK A;  3I56 A;  5K36 G;  1MKH A;  4NXM Q;  4DR2 Q;  5GAG C;  1SFO H;  2OTJ A;  3TS0 A;  4C2M H;  4GLX A;  4A3D H;  2R6G A;  1K83 H;  1BBW A;  1K8G A;  2F52 A;  1S72 A;  1JJG A;  4JI0 L;  1WFQ A;  2R93 G;  2GN5 A;  1XTD A;  4LFA Q;  1N9W A;  1SLJ A;  4IJL A;  3H0G G;  3UDX A;  4DV3 Q;  4A3I G;  2UUB Q;  4POG A;  3G71 A;  1UE5 A;  1PHJ A;  2RCN A;  1BBU A;  3FHW A;  1NY4 A;  2JQO A;  4MNO A;  1A0I A;  4L5R C;  4NXM L;  4OWW B;  1YEZ A;  1EQR A;  1VQI A;  4AYB G;  5FLM G;  4HIO A;  2R7Z G;  2LXK A;  4DV0 Q;  1JB7 A;  2ZJP A;  4GN5 A;  4OX9 Q;  4PZ8 A;  5ELO A;  1XMO Q;  2JEA I;  4HJ7 A;  4LFA L;  4ALP A;  3HOU G;  3E9I A;  1GKH A;  4DR1 Q;  4DV7 Q;  2R93 H;  4C3J H;  5GAD C;  4R4O A;  3UE0 A;  4A3I H;  1P16 A;  3ER0 A;  1PH3 A;  4GNX A;  4A3K H;  1ASZ A;  1X54 A;  2YTY A;  4OX9 L;  1YIJ A;  2E8G A;  3KYH C;  3RNU A;  2E5L Q;  3CXC A;  4TQU S;  5FLM H;  3G6E A;  3I7F A;  4LF9 L;  1X3F A;  5HGQ A;  4DR1 L;  5H1S E;  5JEA G;  2VY3 A;  3M9B A;  2JA6 G;  1YHA A;  3HOU H;  3M4P A;  4NXN Q;  1PA6 A;  3GO5 A;  1D8L A;  3F2B A;  3PIO A;  1E24 A;  1O7I A;  4X66 L;  3HOX G;  3H15 A;  1IBL L;  3PF5 A;  3Q8D A;  1VQ7 A;  1X56 A;  3PUW A;  4H02 A;  2I0Q A;  3GTP H;  4A3L H;  1JT8 A;  1U5K A;  2LSS A;  3KLW A;  4IO9 A;  4QQB X;  5HY6 A;  3UDF A;  2PQA B;  2B63 H;  3CCS A;  1NBW A;  3EIV A;  2JA6 H;  3TRE A;  4AYB E;  1G6P A;  3PSI A;  4LF8 L;  4DK6 C;  1PH9 A;  1RIP A;  2NN6 I;  3PUY A;  2V1C C;  3HOX H;  1PH6 A;  2WB1 G;  1Q81 C;  4IPH A;  1CKO A;  1N34 Q;  4DR7 L;  5M3M G;  1WYD A;  2HIV A;  1VQN A;  1KAW A;  1Q8K A;  3FKI H;  3WWV A;  4RG1 A;  5IYC G;  3UDI A;  1VQ9 A;  3GTO H;  1HNZ Q;  3BU2 A;  1VQJ A;  1G29 1;  2K14 A;  4JOI C;  5AJ3 L;  1J6Q A;  2VS1 A;  1QVG A;  4UPA A;  3A0J A;  4NPS A;  2CFM A;  1PYS B;  1N34 L;  1CSP A;  4GKJ Q;  3I4M G;  1TWG H;  2Q2U A;  4GOP C;  2MO0 A;  3NEL A;  5GQO A;  3TRZ A;  3L2P A;  1PH1 A;  4RMF A;  1HNZ L;  5LMU Q;  1NE3 A;  4L5T A;  4IJH A;  1L1O B;  4JI7 Q;  5C4X G;  4OO1 G;  5IYC H;  1FJG Q;  5FJ8 H;  1Q7Y C;  4X65 Q;  1PFS A;  2RF4 A;  2ZTC A;  3AYH B;  2Y0S E;  4IPD A;  3OW2 A;  2Z6K C;  4KHP Q;  3STB C;  4KI0 A;  3RZO H;  1GD7 A;  2I5L X;  4YCV A;  1C9O A;  2B3G A;  1Y1W H;  3I4M H;  2YTX A;  2QEX A;  4JI4 Q;  3FP9 A;  3HKZ G;  4HJA A;  2JK8 A;  3CME A;  4DK3 C;  1EWI A;  1SN8 A;  2NZH A;  4UP8 A;  1YZ6 A;  1I50 H;  3OYY A;  2OWO A;  3CC4 A;  4R4C A;  3W1B A;  4JI6 Q;  4MZ9 A;  1IYJ B;  2K5N A;  3GD7 A;  3GDE A;  2CKZ B;  1DGS A;  5C4J H;  2R92 H;  1HZC A;  5BR8 L;  4A3J G;  2E2H H;  2JJQ A;  1GO3 E;  2C35 B;  2WP8 J;  4DV5 Q;  1KL9 A;  4LF4 L;  1WI5 A;  4HIK A;  3STB D;  1VS0 A;  5E7N A;  2JEB I;  4B3M Q;  2NVT H;  1PH2 A;  5C3E G;  1B7Y B;  3W5O A;  1NMF A;  1YNX A;  4GNX B;  3HOV G;  2WFW A;  1L2F A;  2D62 A;  4OWT B;  4A76 A;  1IBK Q;  3HOY G;  3S15 H;  1XNQ L;  4A3F G;  4BBS G;  4DUY Q;  4BY7 G;  3PF4 A;  2ID0 A;  2I5H A;  2NVY H;  1N33 Q;  1A8V A;  4JI0 Q;  4B3R L;  1HJP A;  5C3E H;  1IL2 A;  2ES2 A;  4OWX B;  5IP7 G;  4DPG A;  1JJ2 A;  3HOV H;  5IWA Q;  1VQ8 A;  4DR3 L;  4DUY L;  1PH7 A;  3HKZ E;  4JC0 A;  4JI2 L;  3T1H L;  3HOY H;  2ZTD A;  3H3V H;  4BBR G;  1LYL A;  1P8L A;  1Q1E A;  1SE8 A;  2JE6 I;  4P74 A;  4A3F H;  3CCL A;  1M1K C;  2YYZ A;  3MXN B;  1N33 L;  1HZ9 A;  4BBS H;  4BY7 H;  5IYD H;  1D7Q A;  3GTG H;  1QZH A;  1N32 L;  2K5V A;  2KCT A;  1KRT A;  5FLX c;  5IWA L;  2F4V L;  4AH6 A;  2MQH A;  4LF5 L;  2JA7 G;  1S40 A;  4HID A;  4X62 Q;  2VQF Q;  1QVC A;  5C44 G;  4JV5 L;  4EQ5 A;  1CKM A;  4R4I A;  3TEH B;  2GVB A;  1TWC H;  2KHI A;  3RN2 A;  1PH8 A;  4LF9 Q;  1FVI A;  2AMC B;  3J81 c;  3KJP A;  3BZK A;  1Q86 C;  3AFP A;  1VQL A;  3CCR A;  1H95 A;  1LTL A;  4BY1 G;  1HR0 Q;  4KLK A;  4DNI A;  4X62 L;  3H0G H;  2VQF L;  3CAM A;  1JMC A;  2BA1 A;  4O0A A;  3S1R H;  3CD6 A;  4UP7 A;  2N78 A;  3F2C A;  3EN2 A;  2FXQ A;  4QJF A;  4X66 Q;  2JA7 H;  3LGJ A;  1IBL Q;  3T1Y L;  1YIT A;  4PZ7 A;  4DAY B;  1PH5 A;  3IRB A;  5C44 H;  3S16 H;  2PI2 A;  4PG3 A;  1UE7 A;  1G51 A;  1HZA A;  1HR0 L;  1SR3 A;  3EBE A;  1GM5 A;  1VQ4 A;  4JBJ A;  1L0W A;  1KD1 C;  3HOZ G;  1IBM Q;  1RL2 A;  2DUD A;  1VQG A;  3K7U C;  1J5E Q;  5IT9 c;  1QUQ A;  2IX1 A;  3AEV A;  4GLA C;  4HJ5 A;  1VQF A;  4LF8 Q;  4A93 H;  1WCM G;  4LFC Q;  4LUV A;  1AH9 A;  1OXS C;  1I94 Q;  4JI5 L;  4YWK A;  3OTO L;  3ULL A;  2HHH L;  2KHJ A;  4DR7 Q;  1C0A A;  4DV2 L;  1U0L A;  1IBM L;  3CC2 A;  1J5E L;  1EIY B;  2EIF A;  4P71 A;  4K0K Q;  3M3Y H;  2PNH A;  4A4I A;  1TXY A;  3HOZ H;  1V1Q A;  2UXB Q;  4LFC L;  2K50 A;  5AJ3 Q;  1OXX K;  2UUC Q;  4L5S A;  5C0X I;  1I94 L;  4YY3 Q;  4C3H H;  3GTM H;  1XJV A;  1WCM H;  2NN6 G;  4YWL A;  4APV A;  4JG2 A;  1I5F A;  3CCE A;  3KF6 A;  4JI3 L;  4DV4 Q;  4K0K L;  5GAH C;  1CKN A;  4DAM A;  1KHI A;  3J81 i;  2UXB L;  3A74 A;  4YCU A;  4A75 A;  4JOI A;  2UUC L;  3PIP A;  3AFQ A;  4PMW A;  4YY3 L;  3TS2 A;  4AIM A;  4FDB A;  3RR5 A;  1XPR A;  3U4V A;  4JYA L;  4DV6 Q;  3M7N A;  1OXU A;  1E22 A;  3CCQ A;  4A3B G;  4DV4 L;  4GOP A;  3I4O A;  1IXR A;  1X3G A;  5M3M H;  3ICE A;  1KXL A;  1AE3 A;  1V43 A;  3CCV A;  4P73 A;  3CC7 A;  1HH2 P;  4KHZ A;  3U58 A;  3CQZ H;  1EFW A;  4TVA B;  2KEN A;  4R1J A;  3SGI A;  2AWN A;  4B3S Q;  1VCI A;  1W3S A;  2Z6K A;  3M85 A;  1XNR Q;  4A3C G;  2ZJR A;  4DV6 L;  2CQO A;  3CPF A;  4GLV B;  3J80 c;  3W1G A;  4DR6 L;  1VQ6 A;  2UUA Q;  1EUJ A;  3I55 A;  4LW1 A;  1PV4 A;  2IHF A;  1Q46 A;  1EQQ A;  2LXJ A;  1Q82 C;  1VQB A;  2AWO A;  5BR8 Q;  3CPW A;  1K9M C;  3ULP A;  4HJ8 A;  2BA0 A;  4LF4 Q;  2VQE Q;  2MO1 A;  1HR0 W;  4B3S L;  5M5W H;  2JA5 G;  2WB1 E;  5C4X H;  2N3S A;  2XGT A;  1XNR L;  1MJC A;  3U50 C;  3PGZ A;  2PMZ E;  3RLF A;  2YTV A;  3B6Y A;  4GN3 B;  2UUA L;  1A62 A;  1EYG A;  4IOC A;  4LF7 L;  5C0X J;  4IFD I;  1CUK A;  1YVC A;  3CF5 A;  5IE8 A;  1SRO A;  3CMA A;  2D0O A;  1XNQ Q;  1B70 B;  2UXC Q;  2VQE L;  1E3P A;  2UXD L;  3D31 A;  4DUZ Q;  1K73 C;  2UU9 L;  3DM3 A;  4LFB L;  2Q2T A;  1K0R A;  4JCV E;  4A3E G;  2R7Z H;  1V9P A;  2JA5 H;  3HOW G;  4B3R Q;  5JJL A;  4ME3 A;  4BA2 I;  3UDG A;  2PQA A;  1XPU A;  1R9T H;  2A8V A;  2UXC L;  4DR3 Q;  3PO2 G;  4A3G G;  1VQM A;  4JI2 Q;  3L7Z C;  4DUZ L;  3T1H Q;  3KOJ A;  4MTN A;  4A3J H;  2VZA A;  5M5Y H;  3GTK H;  3ERS X;  1YJ9 A;  3PUZ A;  4QL5 A;  3PV0 A;  3GTJ H;  1PVO A;  1N32 Q;  1K3R A;  2JA8 G;  1KQS A;  2F4V Q;  1HNX Q;  1WJJ A;  2K52 A;  3KDF A;  3KF8 B;  3PUV A;  4QIW E;  4LF5 Q;  3S1M H;  2R7F A;  2IY5 B;  4DKA C;  1B8A A;  4JV5 Q;  3J80 i;  3PO2 H;  1AE2 A;  3K80 C;  3JAM i;  5JJK A;  3M4O H;  3UE1 A;  1WOC A;  1FL0 A;  2EXD A;  3PUX A;  4GKK L;  1HNX L;  1UEB A;  2MFI A;  1I3Q H;  1UE1 A;  5GRO A;  5IP7 H;  1HNW L;  1L1O C;  2HT1 A;  1SRU A;  2IT1 A;  3KFU A;  4XIG S;  3MEF A;  2QA4 A;  4IFD J;  3T1Y Q;  4J15 A;  1NJI C;  1S3O A;  4BBR H;  3KF6 B;  4X64 L;  1OTC A;  1CKN B;  3E9H A;  4L5Q A;  1TWA H;  4GS3 A;  3I4N G;  3M4Q A;  2E2J H;  2CWP A;  3K0X A;  2VNU D;  2B29 A;  2EQS A;  2BH8 A;  4QY7 A;  1JJC B;  3CP0 A;  1VQP A;  3F1Z A;  3G4S A;  2IHE A;  2N49 A;  4P72 A;  4AQY L;  4LF6 L;  4IPG A;  4A3K G;  1Q1B A;  4HJ9 A;  1XPO A;  1SMX A;  4GOP B;  2YV5 A;  3K7A H;  5IY0 A;  4IPC A;  2ZJQ A;  3NEM A;  4DR2 L;  4JI5 Q;  3OTO Q;  2HHH Q;  3L0O A;  3G48 A;  1Z9F A;  3AQQ A;  4DV2 Q;  4R4Q A;  1Q12 A;  1KIX A;  3I4N H;  4BY1 H;  1YJN A;  1VQE A;  4OXP A;  1PH4 A;  2UUB L;  5ELN A;  3CCM A;  1YBY A;  4DV3 L;  3PO3 G;  2GVA A;  1KRS A;  1YHB A;  2JA9 A;  1KC8 C;  5J3B A;  4R4T A;  3U4Z A;  4GNX C;  5M5X H;  5LMN Q;  3RN5 A;  4DV0 L;  4X6A H;  1VQK A;  4Y7N H;  2VL6 A;  2VUM G;  1MIU A;  1BKB A;  1XMO L;  4A3L G;  4JI3 Q;  4JI8 Q;  1MJE A;  5JJI A;  4DV7 L;  2NVX H;  2B63 G;  3J7A 5;  2AHO B;  4WJ4 A;  1E1T A;  1VQA A;  1N36 Q;  1K8A C;  5LMN L;  4LWC A;  1M90 C;  4JBM A;  2BH2 A;  3PO3 H;  4JYA Q;  1X55 A;  5C0X G;  3NEN A;  5GAE C;  2E5L L;  1BVS A;  2Z0S A;  2H5X A;  2K4K A;  4JI8 L;  1YI2 A;  1QZG A;  2Y0S G;  4YHH Q;  3F2D A;  3I2Z A;  2OTL A;  2VUM H;  1EIF A;  3FKI G;  1VQC A;  2L15 A;  2ZM6 Q;  3DLL A;  1VQD A;  4YWM A;  1ASY A;  2PI2 E;  4NXN L;  1N36 L;  1X6O A;  1OXV A;  4LUO A;  2K75 A;  4DR6 Q;  2AKW B;  2WAQ G;  2DGY A;  4YHH L;  2NVQ H;  1E7Z A;  4IOA A;  1X65 A;  3ULJ A;  4WJ3 M;  2ZM6 L;  3HFZ B;  2KBN A;  1LM0 A;  4A3M G;  2E2I H;  2QGQ A;  4JI1 Q;  1N8R C;  2VW9 A;  1VQH A;  3KDF B;  3RLN A;  3BZC A;  5FJ8 G; 
#chains in the Genus database with same CATH topology
 3QO2 A;  4WJW A;  1VQO A;  1XNQ H;  1BOS A;  1KAB A;  4RWS C;  3S14 H;  4XT3 B;  4C3I H;  1II3 A;  3JAM c;  1TWA B;  4PQX A;  3HZX A;  1LUZ A;  3Q2O A;  2EJG C;  2ICE C;  2K5H A;  1KEE A;  1ESF A;  5IIF A;  5CGK A;  1RTN A;  1EY9 A;  1K1Q A;  4OO1 I;  3PW0 A;  3S1Q H;  2R7K A;  3VPD A;  3BQ0 A;  1SYC A;  5CAE B;  4FS2 A;  3PCO B;  4M9U A;  4DR5 Q;  4YCW A;  5T14 A;  3R2T A;  3CKI B;  3KHL A;  1QNU A;  1WTW A;  4CJ2 C;  1BXT A;  3HKZ A;  1GGO A;  3BJU A;  4Q5V A;  1FJG L;  2I80 A;  4UY8 C;  4JV5 H;  5KFO A;  4G7H C;  1WTO A;  4KHP L;  2VA2 A;  4GN4 B;  1C7Y A;  3J7Z C;  1IZ6 A;  1A63 A;  5LMN W;  4BXX H;  3RLO A;  3L9A X;  3A5U A;  1CSQ A;  5IYB G;  5EAY A;  4IFD H;  4ME6 A;  2CCZ A;  1KJ9 A;  2OCE A;  2R8G A;  4HR7 B;  1BF4 A;  3S17 H;  4POF A;  3HOW H;  3PO3 B;  3CCJ A;  1ZHS A;  2IA6 A;  2L5T A;  5J2T F;  3T1Y H;  5L9X A;  3AU7 A;  5M3F H;  3KAK A;  3VDY A;  4N8X 1;  4FF2 A;  4EGJ A;  2E74 C;  2AUJ D;  5IYD G;  2NBF A;  3MTS A;  1CS0 A;  1L1O A;  1PZI D;  3F8T A;  3EA6 A;  3FRP B;  2HHH H;  4LF6 Q;  3I56 A;  2NZO A;  2OQK A;  4C5B A;  1JKJ B;  4NXM Q;  5GAG C;  1SFO H;  3TS0 A;  1ZET A;  2CH4 A;  1S72 A;  1JJG A;  5KFN A;  1PTO D;  4A3I G;  1SLJ A;  3UDX A;  2RDG A;  2UUB Q;  4BWS C;  4EEQ A;  4POG A;  3G71 A;  2F0L A;  1UE5 A;  1PHJ A;  4XZ3 B;  3NBI A;  2JQO A;  2VB2 X;  2WKC A;  3SE0 A;  4OWW B;  2E5L H;  5DGB A;  4AYB G;  4HIO A;  5EJW A;  4A3M B;  5CV7 A;  5ELO A;  3TQ1 A;  3H91 A;  2JEA I;  5C1P A;  4LFA L;  1GKH A;  4FXG C;  1KDA A;  3NGD A;  5I6Y A;  4R4O A;  1WTR A;  1GYF A;  1PH3 A;  1PK8 A;  1SAP A;  2YTY A;  4YHH H;  4OX9 L;  5FPO A;  3K5N A;  5H80 A;  2PO4 A;  4NW2 A;  4FU0 A;  2ZXP A;  1AUX A;  5FLM H;  3P75 A;  2BCO A;  3DMU A;  1K3B C;  3JSL A;  2R85 A;  4MA0 A;  3PR5 B;  1YNJ C;  1YHA A;  2MGS A;  1AP0 A;  3WNZ A;  5DM7 3;  2EJF C;  1ENC A;  1SSO A;  3GO5 A;  4Q8E A;  2R92 B;  5ISR A;  2W9C B;  1IBL L;  1IKL A;  3GTM A;  1IYU A;  1W6J A;  3PF5 A;  4ETS A;  3MJF A;  3KF8 A;  4JI1 H;  2UVR A;  3PUW A;  4CDD C;  2KCC A;  5I6W A;  1JT8 A;  4O3O A;  4HNV A;  1GJX A;  2F0T A;  4R7R A;  3GQB A;  4QQB X;  4MV8 A;  4QW8 A;  4EGQ A;  2W7O A;  2B63 H;  5DQG A;  4Q0Y A;  2VUG A;  2B8F A;  3M4Y A;  4XDX A;  2SCU B;  4X3U A;  5F2D A;  1Z6H A;  2UXD H;  2F0N A;  2W6M A;  1SNO A;  2KEE A;  1LTA D;  2WB1 A;  4RB2 C;  1SMY D;  4DV1 H;  3NPP A;  5KGU A;  1N34 Q;  2EYP A;  2K6A A;  2QIL A;  4KV6 A;  1SCU B;  4XT1 B;  1Q8K A;  3FKI H;  4RB0 A;  2ICI A;  1VQ9 A;  1D5M C;  4MV1 A;  1HNZ Q;  3BU2 A;  2B2U C;  3RTX A;  1G29 1;  2YRX A;  1J6Q A;  5I9O A;  3A0J A;  1CA5 A;  1PLF A;  4C2M B;  1PYS B;  4A3D B;  2OH2 A;  4DR4 H;  1CSP A;  1K83 B;  4IAJ A;  4JI4 H;  2Q2U A;  2WV6 D;  3T56 B;  2BR0 A;  3QZ8 A;  3I91 A;  1CM9 A;  4L5T A;  3CU7 A;  4IJH A;  5C4X G;  1ZEQ X;  4EFB A;  4OO1 G;  4ED0 A;  4EEY A;  1FJG Q;  5FJ8 H;  3UI2 A;  2RF4 A;  2RA4 A;  2Y0S E;  2Z6K C;  4KHP Q;  4HAE A;  4ECT A;  2FE3 A;  1GD7 A;  3WO1 A;  1C9O A;  2F0G A;  1E2V A;  1Y1W H;  3I4M H;  1M0W A;  2R93 B;  3HKZ G;  2QEJ C;  4CKC A;  5CBA E;  2V4R A;  1EWI A;  2V5A A;  4O4H F;  3Q23 A;  2FKL A;  1B6S A;  2CQA A;  3V96 A;  2OWO A;  2R8I A;  1RHP A;  4X64 H;  4MZ9 A;  4LMQ D;  2K5N A;  2FK1 A;  1R9T A;  2P0A A;  4HSV A;  4DK1 A;  4YR3 A;  1NAP A;  2VPS A;  2AQ4 A;  2F0I A;  2PCF B;  1AN7 A;  3GTL A;  1MD2 D;  2WP8 J;  3HOU B;  4F4X A;  2QKI C;  2EJM A;  4HIK A;  3D6W A;  3GTJ A;  3T51 B;  4AQY H;  1PH2 A;  5C3E G;  1B6R A;  1NMF A;  2YZG A;  1BDO A;  2W6Z A;  4DR2 H;  3MVV A;  4A3F G;  4BBS G;  4DUY Q;  5AFW A;  2JA6 B;  3DWP A;  4XQN A;  4JV2 A;  3M3Y B;  3QFF A;  4I7H A;  3N6X A;  1KLG D;  1I3Q A;  4ZUI A;  3HOX B;  5J22 A;  2Q8I B;  1PRT F;  1DV2 A;  2XRS D;  5D3D A;  4RAU C;  1EY6 A;  2GPS A;  2YRW A;  2Y0S B;  3G6X A;  1JIC A;  4JI2 L;  2QDB A;  2ZTD A;  3H3V H;  1LYL A;  4DR1 H;  4BY7 H;  1TWA A;  3MXN B;  1HZ9 A;  3P1H A;  3TIG A;  5D1O B;  1S0M A;  3GTG H;  4OEM B;  3PVX A;  2KCT A;  5IWA L;  3M9O B;  5C5L A;  4KTA A;  1TWG B;  2BQ3 A;  4HID A;  4X62 Q;  1Z2N X;  1Y8P B;  1EY4 A;  1SBB B;  3LWU A;  4EQ5 A;  5M3M B;  4RFB A;  1MZB A;  5L1I A;  1CKM A;  4R4I A;  3TEH B;  1PH8 A;  1TU2 B;  3RN2 A;  5KFC A;  3A54 A;  3KJP A;  4NXN H;  3OOC A;  4K5V A;  4Q44 A;  1VQL A;  3BYY B;  2F0D A;  4KLK A;  3H0G H;  2C28 A;  3EQL C;  3F2C A;  2N78 A;  2R86 A;  3EN2 A;  4QJF A;  3LGJ A;  1IBL Q;  4O3S A;  4DAY B;  4Z9C B;  4DR7 H;  2K03 A;  3S16 H;  1A3U A;  2PI2 A;  4ED8 A;  3T5H A;  2ASJ A;  3A56 A;  4FF4 A;  4JBJ A;  1PFB A;  1L0W A;  1J5E Q;  5C4J B;  3OPO A;  4HR7 A;  2XRQ D;  1VQF A;  4IUR A;  4HJ5 A;  2E2H B;  4DA2 A;  1AH9 A;  1EU4 A;  3ULL A;  2KHJ A;  1TQO A;  1ILP A;  5CYU A;  4ECW A;  1U0L A;  1EIY B;  2EIF A;  1HTL D;  3MR3 A;  2UXB Q;  4GKJ H;  1B04 A;  3BVG A;  4QW9 A;  1I94 L;  4A3J B;  4YAJ B;  4C3H H;  1XJV A;  2J4X A;  4YWL A;  3OWF A;  3OIP A;  3PIP 3;  4JI7 H;  3KF6 A;  4OEL B;  2RDJ A;  5JVL A;  1STB A;  4K6L A;  4LH7 A;  3A74 A;  3FDT A;  4YCU A;  3S1M B;  3PIP A;  4PMW A;  1EYD A;  2XCP A;  2J6U A;  3RR5 A;  5IT9 L;  4ZRZ A;  1KAA A;  4GC6 A;  4JYA L;  4UCO A;  3M7N A;  1OXU A;  3CCQ A;  1AEX A;  3I4O A;  4LK1 C;  1AE3 A;  1JC7 A;  4CDC C;  4UHV A;  2IL8 A;  3U58 A;  1EFW A;  1HA6 A;  1VCI A;  3H94 A;  3SDZ A;  5IGD A;  2ZJR A;  2CQO A;  4FF1 A;  1AFP A;  1VQ6 A;  1X32 A;  3I55 A;  1LV9 A;  1EQQ A;  1Q82 C;  1E4E B;  4HMJ A;  4HJ8 A;  2JP1 A;  2QYZ A;  1PZJ D;  1JCK B;  1G6P A;  3C1F A;  1JWM D;  5M5W H;  3S1R B;  2N3S A;  3U50 C;  2NWG A;  4O4I F;  3GV5 B;  4ECV A;  2CW7 A;  3QR8 A;  5E1F A;  3C3L A;  5LP6 F;  3NQT A;  2O5J C;  3R8B A;  2UUA L;  1A62 A;  4LF7 L;  5IE8 A;  1BUV T;  1SRO A;  3K0Y A;  3D31 A;  2EY2 A;  5COR A;  2W9C A;  2UU9 L;  1U4P A;  3HG9 A;  4RGT A;  4V0B A;  4LFB L;  3ORQ A;  4TV9 F;  4A3E G;  2W8L A;  4A93 B;  3GP7 A;  5JJL A;  5EQ0 A;  3Q0A A;  3A8J E;  3BG5 A;  3KXY T;  1A3V A;  3R2I A;  4FF3 A;  2O4X A;  1XPU A;  2A8V A;  2UXC L;  3I3C A;  2PW5 A;  4JI2 Q;  3T16 A;  2R8K A;  1NR4 A;  5E4W C;  3OMG A;  2SDF A;  3NTH A;  5CV5 A;  1CQI B;  3HOZ B;  3DEO A;  3PUZ A;  1S0N A;  4PDB A;  1PVO A;  1DJR D;  3E0J A;  2VQF H;  2JA8 G;  2FPG B;  1HNX Q;  1BJT A;  4RU9 A;  1U4R A;  2XCA A;  5IT9 W;  4DKA C;  4LF9 H;  4XX0 B;  1B8A A;  1STE A;  2YZN A;  5I4D A;  2DZD A;  4C2M A;  5JJK A;  3M4O H;  2OF1 A;  1K83 A;  3UE1 A;  1NNX A;  2EXD A;  4GKK L;  4X66 H;  4DNT B;  5KFT A;  4J9S A;  5GRO A;  5IP7 H;  2WII B;  1HNW L;  1WH2 A;  1L1O C;  3BG3 A;  2HT1 A;  1SRU A;  2ENB A;  4XIG S;  3MEF A;  3VA5 A;  2O2L D;  4JI5 H;  3OTO H;  2M9V A;  2EYH A;  4IUT A;  1J9O A;  1S3O A;  4BBR H;  2LFN A;  3QIA A;  4DV2 H;  2BQR A;  1CKN B;  1IBM H;  4ODG A;  5BN4 A;  1I6V C;  4ILW A;  2VNU D;  2R93 A;  4LFC H;  1JJC B;  3CP0 A;  3RB4 A;  4P72 A;  4MV9 A;  3GIQ A;  3BQ1 A;  1HUM A;  3KHG A;  1GUT A;  5T1G A;  2YV5 A;  5IY0 A;  2ZJQ A;  1S5D D;  2VPQ A;  4RZQ A;  3BJY A;  4K0K H;  4DXG A;  5KT4 A;  2FLL A;  1Z9F A;  3S1Q B;  1JDB B;  2PZW A;  4ZQI A;  4BY1 H;  3IFD A;  2C22 A;  2UUC H;  4OXP A;  5E4X A;  4YY3 H;  2CVR A;  5ELN A;  4CJ0 B;  1KC7 A;  5ELB A;  3PO3 G;  4DL4 A;  4RUA A;  1M4V A;  1IW7 D;  1EU3 A;  1YHB A;  2JA9 A;  1L2Z A;  1F2Z A;  5J3B A;  3U4Z A;  1DM0 B;  3C46 A;  4DV0 L;  2R7Z B;  2A74 C;  2A6E D;  2VL6 A;  4Y7N H;  1MIU A;  4A3L G;  1XMO L;  4JI8 Q;  1A3T A;  5JJI A;  2RVL A;  4DV7 L;  2NVX H;  2JA6 A;  1XDN A;  4DV6 H;  2AHO B;  5F9L A;  1N36 Q;  4JBM A;  4JYA Q;  5EGT A;  4EFE A;  2K4K A;  4CC6 A;  2Y0S A;  4B3S H;  3W2D A;  3S17 B;  3HOW B;  2OTL A;  1SYE A;  3LNN A;  2VUM H;  3N43 B;  3L4J A;  3MXN A;  4RKL A;  1BCP F;  1S10 A;  3PO2 B;  2WTF A;  2NTT A;  2WAQ A;  4LSA A;  1W93 A;  5IGF A;  2VQE H;  3TP6 A;  1TWG A;  2DGY A;  1MI2 A;  1QJO A;  1S4Z A;  4UCU A;  3HFZ B;  4A3M G;  2KJX A;  1J8I A;  3KDF B;  5FO8 B;  1VBH A;  2AU0 A;  4KJO A;  4K5X A;  3TDQ A;  5IP9 G;  1TA8 A;  5KFU A;  1GVP A;  4LF7 Q;  4DUZ H;  2FMC A;  4A3B H;  1UC9 A;  1X3E A;  2PZT A;  3S2D H;  4B3R H;  4DAY A;  4O3P A;  2UU9 Q;  2YS7 A;  1XMQ Q;  4LFB Q;  4ZKC B;  3BDL A;  3D4W A;  4CDE C;  3RB0 A;  2RGR A;  1JWU D;  1UE6 A;  3K7A B;  3T1H H;  2Q2H A;  3HKS A;  4NB3 A;  2RHQ B;  4YBZ B;  3PZP A;  2DJF C;  3MFY A;  1YJW A;  2O03 A;  2R92 G;  1JX4 A;  3NP8 A;  1ILQ A;  2E2H A;  1N32 H;  2N8N A;  1NTG A;  4R8U B;  1XYI A;  4LF5 H;  3S24 A;  1I6H H;  2F3V A;  3E0E A;  3GTQ H;  5BPH A;  4ZLT F;  1KJQ A;  1LAC A;  4XQJ A;  4DR5 L;  5A35 A;  1GUS A;  3L3O C;  4RHS A;  2AQ3 B;  2Q2I A;  4RGO S;  2EDG A;  3RGZ A;  5L1L A;  5DLQ E;  5IOC A;  2G9D A;  1OWT A;  4OON A;  3LP8 A;  2B2V A;  1LT3 D;  3CCU A;  2NVY A;  1FGU A;  4A2B A;  3SK5 A;  4HCE A;  3Q24 A;  1W2B A;  4B3T Q;  2I07 B;  3JC6 6;  4GKK Q;  3S2H H;  2OTJ A;  3D0F A;  4R8N A;  4EX5 A;  1HNW Q;  4JI6 L;  1H9S B;  2QDL A;  4A3G H;  1EOV A;  4JV0 A;  1PTO C;  4EG0 A;  1TWH H;  3KHH A;  1LT5 D;  4A3D G;  2C2E A;  3G6V A;  2FMA A;  1EYA A;  5IYB H;  4B3M L;  1G2T A;  4X3K A;  2B63 B;  4K5W A;  2UUB H;  1TKW B;  2HD3 A;  5BPF A;  2HQL A;  5CV4 A;  2QCP X;  3U9O A;  3VPC A;  1IBK L;  1TS5 A;  5JUM A;  2XGP A;  3NBH B;  1SNC A;  3GIM A;  2E2I B;  1MKH A;  1TWC A;  5EKK A;  1UNS A;  2PQE A;  4IUU A;  3FKI B;  4Q43 A;  4GLX A;  2YS6 A;  2R6G A;  3GIJ A;  3H4D A;  1BBW A;  1RK5 A;  3KK7 A;  1E4E A;  2K7V A;  4DL6 A;  4JI0 L;  2R93 G;  4L8J A;  4IJL A;  3BAB A;  5LMN H;  5I2Y A;  3RZD B;  4ZKB B;  4L5R C;  3FHW A;  1NY4 A;  4MNO A;  1ESR A;  4ZAI A;  1O7Z A;  5FLX E;  4NXM L;  2RBM A;  1VQI A;  5C6A A;  1DON A;  3JRX A;  4DV0 Q;  1JB7 A;  4G7O C;  1TWF B;  3GTL B;  1I7L A;  4PZ8 A;  5COY A;  1XMO Q;  4PNY A;  3HOU G;  5L1J A;  4IRK A;  3QZ7 A;  5EOY A;  3J81 E;  4DV7 Q;  3RFC A;  4A3I H;  1P16 A;  2R7N A;  2QW7 A;  4GNX A;  1ASZ A;  2RCF A;  5GON F;  1X54 A;  1G91 A;  1C3O A;  1Y1W B;  2IBK A;  1EFI D;  3RNU A;  4TQU S;  2ZM6 H;  5KRU A;  2SOB A;  3G6E A;  4KY6 A;  1X3F A;  3PIO 3;  1E4G T;  3MHB A;  5CMD A;  2WE6 A;  4QWB A;  2FK2 A;  2GA4 B;  4IUQ A;  4EBE A;  1SMY C;  2JA6 G;  3V2T A;  2VY3 A;  3HEJ A;  3GID A;  4DR6 H;  1Y1V B;  2BOS A;  3M4P A;  2SNM A;  1PA6 A;  3F2B A;  3PIO A;  2W9B B;  2E2D C;  2F0J A;  4JPB W;  3HOX G;  5IT9 E;  4TSS A;  1VQ7 A;  3Q8D A;  2R8H A;  3KBX A;  3GTP H;  3TZU A;  1WD1 A;  3GV3 A;  3KLW A;  3I90 A;  4IO9 A;  3N44 B;  2Z6B A;  4QWE A;  5D1P A;  3CCS A;  3MEH A;  3EIV A;  4DK6 C;  1PH9 A;  4MIU A;  4U7C A;  3PUY A;  2AQ2 B;  2NN6 I;  1KNE A;  1Q81 C;  4N9P A;  3Q22 A;  1WVL A;  1CKO A;  1SND A;  5M3M G;  5CC4 A;  1VQN A;  3URY A;  5JVD F;  3WWV A;  5IYC G;  4OIJ A;  5M9O A;  3UDI A;  1RCV D;  4DK0 A;  2BE5 D;  1VQJ A;  2R7L A;  4O4L F;  5AJ3 L;  1G6Z A;  4QWD A;  2K33 A;  1N34 L;  1GHJ A;  5KG7 A;  1CZG A;  4RAZ A;  1TAE A;  3NQI A;  1PH1 A;  4RMF A;  1FYC A;  1HNZ L;  4ZI7 F;  1BR9 A;  4MN3 A;  2DIK A;  2P5Z X;  1HUN A;  3H09 A;  4IPD A;  2F0E A;  3K5M A;  3BVZ A;  3I8Z A;  4YCV A;  2I5L X;  3RUZ A;  3TQT A;  1S5B D;  1S5E D;  3CRK C;  3D3R A;  3BYT B;  5F9N A;  2QEX A;  4C3J B;  3FP9 A;  2JK8 A;  2R7Z A;  3H0G B;  1F77 A;  1SN8 A;  4UP8 A;  5DEH A;  2A73 B;  4EGV A;  1VMC A;  3ONA B;  4OO1 H;  3PW2 A;  1RK6 A;  4JI6 Q;  1IYJ B;  3GD7 A;  1I4R A;  2R3Z A;  4RHR A;  2CKZ B;  1BNZ A;  1DGS A;  3GTK A;  5JJZ A;  5BR8 L;  4A3J G;  2ZDH A;  1GO3 E;  3SK6 A;  4TQR A;  4C1N I;  2JEF A;  1WI5 A;  3VR6 A;  4B3M Q;  2JEB I;  1RJR A;  1LTS D;  4U67 3;  1B7Y B;  3OUZ A;  3MFI A;  2YZM A;  3I4L A;  4F4Z A;  1YNX A;  2D2C C;  2WFW A;  1L2F A;  1LTR D;  5KG2 A;  1IBK Q;  3FDS A;  3HBL A;  3GIK A;  1XNQ L;  1ZQ7 A;  2ZDG A;  1IYV A;  4J9O A;  3PF4 A;  2L55 A;  5ELC A;  1X3P A;  4LFA H;  4DV3 H;  2ID0 A;  5A2Q E;  2V58 A;  3UQ8 A;  1IOW A;  2V4D A;  3KLS X;  1N33 Q;  1A8V A;  4JI0 Q;  2PNR C;  3KAJ A;  4WRD A;  3KBG A;  5C3E H;  4OWX B;  3I72 A;  4Q0F A;  1JJ2 A;  4OX9 H;  1PH7 A;  4DUY L;  1SYX B;  2F03 A;  1SE8 A;  1Q1E A;  4A3F H;  3GTO B;  3CCL A;  4BBS H;  1M1K C;  3K3P A;  4I50 F;  2F0M A;  2IPK D;  3A8I E;  1GUW A;  5ELE A;  2W6Q A;  2QK4 A;  4MV4 A;  3MXG A;  2K5V A;  1EY0 A;  4F7X A;  2RGV A;  5EZY F;  1C4Q A;  1HHV A;  1SNM A;  2EY6 A;  2DNE A;  1QVC A;  1STG A;  4JV5 L;  4C1N K;  5K36 H;  4G57 A;  2FP4 B;  3F2U A;  1FKA H;  4F4W A;  1O75 A;  1Q86 C;  3U9S A;  4DAP A;  1H95 A;  3CCR A;  5EKI A;  1LTL A;  5G3L F;  1HR0 Q;  3RZO B;  3RJ0 A;  1CQV A;  4ECR A;  2HQE A;  4X62 L;  3CAM A;  1LTI D;  4A93 G;  2VA3 A;  3QOL A;  2KA7 A;  5IGG A;  2FXQ A;  1PRT B;  1BXR A;  3T1Y L;  4PZ7 A;  3C0F B;  3IRB A;  3QOJ A;  2XGQ A;  1HZA A;  3HS0 C;  4J9P A;  1I50 B;  1GM5 A;  4EQO A;  1VQ4 A;  1KD1 C;  3HOZ G;  4K8I A;  2EYO A;  2IX1 A;  1CQF A;  3AEV A;  5ELD A;  3VR4 A;  1OXS C;  2C00 A;  4X3S A;  4ECS A;  1KDC A;  4YWK A;  4QIW B;  2HHH L;  1H9S A;  4MHE A;  2CW8 A;  1T94 A;  1C0A A;  4UCS A;  3OSN A;  2V59 A;  3CC2 A;  3BA9 A;  2MUY A;  1J5E L;  4P71 A;  3D6C A;  5L37 A;  1IKM A;  1F2M A;  4A4I A;  1V1Q A;  2KQ3 A;  5AJ3 Q;  5HGT A;  5CV8 A;  4DN4 M;  2FLP A;  2F1M A;  2G9H D;  2Q8R E;  1IHZ A;  3GTM H;  1SEI A;  2NN6 G;  5LMU H;  4YJ2 F;  5KFP A;  3CCE A;  3NBH A;  5L1K A;  2OXP A;  4JI3 L;  4DV4 Q;  2E2I A;  5GAH C;  4L6T B;  4DAM A;  1KHI A;  3MWD A;  3HOV B;  2UXB L;  5KFG A;  3O13 A;  4JOI A;  2LY7 A;  3HOY B;  3QB3 A;  3PW4 A;  3ND9 A;  4M8A A;  5DM6 3;  1XPR A;  3U4V A;  3PW5 A;  1EQT A;  3NXW A;  2L4N A;  4UAI A;  2YU9 A;  4GOP A;  2WDT A;  3H4B A;  1IXR A;  1HQM C;  1LAB A;  3ICE A;  1EZ8 A;  1U4L A;  3FVQ A;  4P73 A;  1D5Z C;  1RF2 D;  2LKV A;  4JK1 C;  3SK4 A;  2EPB A;  3CC7 A;  1TWF A;  5KG3 A;  2KEN A;  3MXU A;  4R1J A;  3E5N A;  1N56 A;  1XNR Q;  5KFD A;  3R5F A;  3SE7 A;  4GLV B;  4BBR B;  3W1G A;  2MPM A;  2CQY A;  3NTK A;  1FNV A;  1D5X C;  1GUG A;  4LW1 A;  1PV4 A;  3I12 A;  4OHJ A;  5BR8 Q;  2NU8 B;  1Y1W A;  1EUD B;  2MO1 A;  2R7Z G;  1H9M A;  2XGT A;  2JA7 B;  1JXL A;  4NKL A;  2KEC A;  2PMZ E;  1WD0 A;  4ECZ A;  2YTV A;  5C44 B;  1I4G A;  2J6S A;  4YP3 A;  1VF5 C;  4UCT A;  5DG8 A;  1Y1V A;  1CUK A;  4RGM A;  3CMA A;  2D0O A;  4BWG B;  1XNQ Q;  2W9B A;  2UXD L;  1LLR D;  5KG4 A;  3KHR A;  1ZYR D;  1PMR A;  2K5Q A;  3DM3 A;  4KD4 A;  4XQQ A;  2Q2T A;  5IWA H;  3HOW G;  3SK8 A;  4J9M A;  4O3Q A;  1WTP A;  3R5H A;  1PRT D;  3UDG A;  3Q8S B;  1R9T H;  3PO2 G;  5KYI A;  1VQM A;  2XN9 C;  5BN5 A;  1K28 A;  5BMV F;  2VZA A;  4MTD A;  3E6Z X;  3ERS X;  4MTE A;  1EOT A;  2ZDQ A;  4LAA A;  2B2V C;  3PV0 A;  1JOK A;  3GTJ H;  1PFN A;  4UFZ A;  4QMG A;  3N40 P;  3GV8 B;  1K3R A;  1WCM B;  2IY5 B;  3PUV A;  4A2A A;  3DWA A;  1PTO H;  1WTH A;  4JV5 Q;  3K80 C;  3ETJ A;  1QCB D;  1TS4 A;  1GSH A;  4L63 B;  1EZ1 A;  4PWQ A;  2WYO A;  5JOB A;  1HNX L;  4O2A F;  1B1Z A;  4IN3 A;  1I3Q H;  1SNQ A;  1UE1 A;  3H6M A;  4I7Z C;  1STY A;  2PMZ B;  2IT1 A;  3ORR A;  4UCR A;  3T1Y Q;  4J15 A;  1Q90 A;  4X64 L;  3CQZ B;  4L5Q A;  1IW7 C;  3GV7 B;  2R61 A;  1TWA H;  3M4Q A;  2CWP A;  3NHH A;  5C3W A;  2B29 A;  2EQS A;  1VQP A;  1ZHQ A;  2B2T A;  2A6E C;  3G4S A;  2IHE A;  1I94 H;  1F9R A;  1XTC D;  4AQY L;  4IUN A;  3CVZ A;  4EVO A;  5KG1 A;  4A3B B;  4F87 A;  1DOL A;  4HJ9 A;  2K5W A;  1SMX A;  4XYQ A;  3S2D B;  2ZXO A;  4IPC A;  3NEM A;  4DXF A;  3M4I A;  4DR2 L;  3K58 A;  2HHH Q;  1AW7 A;  5KG5 A;  3G48 A;  4J9R A;  3IAY A;  1CTM A;  1KIX A;  4PMC A;  5FLX L;  3TP7 A;  1YBY A;  2EVB A;  4KHV A;  2WAC A;  4ZQ3 A;  4CGY B;  3GQC A;  2KVM A;  2F0S A;  1FGB D;  5EPK A;  5DAU A;  1KC8 C;  4XYL B;  2B2W A;  2CW0 D;  4GNX C;  2EYM A;  4HYK A;  2JA5 B;  3BQ2 A;  3J81 L;  4FP5 D;  4O3N A;  3TME A;  4JI3 Q;  3GTQ B;  3KUP A;  4FO2 A;  4APM A;  4HQ6 A;  4RH6 A;  3IN5 A;  1JWS D;  2B63 G;  2L0C A;  3J7A 5;  1SYB A;  5M5Y B;  1E1T A;  1VQA A;  3V05 A;  1M90 C;  3PO3 H;  4LWC A;  1UUP A;  1X55 A;  4UDU C;  1STA A;  5KX5 F;  1BVS A;  2Z0S A;  1ICW A;  4JI8 L;  5KEE A;  1QZG A;  5JH7 F;  1CFM A;  4YHH Q;  1EIF A;  3FKI G;  3GTO A;  1EYC A;  2K1B A;  5KFJ A;  2FPP B;  3DLL A;  1VQD A;  5HV6 A;  3RAQ A;  3BZD B;  4NXN L;  1N36 L;  2UUA H;  4YJ3 F;  3RMH A;  4A3G B;  4ULL A;  3WO0 A;  5KND A;  2K75 A;  5EWF A;  2AKW B;  4RUC A;  3AB9 A;  4XXE A;  5KFL A;  2F0K A;  1VAJ A;  2RQX A;  2R7M A;  4JI1 Q;  1K1S A;  3K8A A;  1VQH A;  5KG6 A;  3BZC A;  5FJ8 G;  2UXC H;  2ASB A;  1BBX C;  1JOO A;  2ZTE A;  3KLR A;  2IWH A;  2J9G A;  1SXT A;  3S9W A;  4RNM A;  4QGU A;  4L1K A;  2MCT A;  2E2J B;  1X9N A;  1S68 A;  1H9J A;  4O2D A;  2XWJ B;  1Y1W G;  2UXD Q;  3S1N H;  4ABN A;  4DV1 Q;  4TV8 F;  1OXT A;  5JEA J;  2ALZ A;  1QE6 A;  1S03 G;  2HCI A;  2RHS B;  3ZJY C;  5J39 A;  4A3M H;  3GIP A;  1I50 A;  4HED A;  4DR3 H;  2XTI A;  5FLX W;  4A3C H;  4ED7 A;  1L0X B;  1BCP B;  2KCM A;  3MR2 A;  4XTC S;  3WOF A;  1Y1V G;  3RBE A;  2A1A A;  1E1O A;  5IP9 H;  1SE3 A;  4C56 C;  3MWY W;  1EEI D;  4BS9 A;  4GKJ L;  4K14 A;  5KT3 A;  3NWT A;  2R92 A;  3I4N B;  1XMQ L;  1I6U A;  1VQ5 A;  4DR4 Q;  3J81 W;  2F4V H;  4JI7 L;  5KNB A;  2JSO A;  3MA2 B;  2CZG A;  4X65 L;  5M5X B;  4N8F A;  1MGS A;  1ET6 A;  2HJW A;  2W6P A;  4PZ6 A;  1T9H A;  4J9K A;  1T5X D;  2IX0 A;  3JAM L;  2EZV A;  5JPM C;  3VYT A;  2F3I A;  1ZKO A;  5JVG 3;  4HMI A;  1YHQ A;  4P75 A;  3G7L A;  2ATW A;  1HZB A;  1K0S A;  1QVF A;  3A5Z B;  1XWE A;  3L4K A;  2BQU A;  3GTP B;  2PPB C;  2N88 A;  5EBC A;  3MAQ A;  4X64 Q;  2FPI B;  3DXJ C;  4DV5 L;  4RB1 A;  1A6X A;  3KJO A;  4B3T L;  1CK1 A;  3NTI A;  2HDL A;  4J8Q A;  2HUG A;  2MHV A;  4Q45 A;  2MNA A;  1T3N A;  1TT2 A;  1VDZ A;  4FM9 A;  1UWV A;  2FJ2 A;  3T4A C;  4AQY Q;  2NVQ B;  1M7J A;  1T36 A;  4EYH B;  5A2Q L;  1HQR D;  1F9P A;  1TY0 A;  4IUV A;  4DR2 Q;  1Z2O X;  5FD5 A;  2MJ8 A;  1GOZ A;  2RDF A;  1QOH A;  4C2M H;  4A3D H;  1K83 H;  3S14 B;  2F52 A;  2X0S A;  4C3J G;  4C3I B;  2BDO A;  2GN5 A;  1XTD A;  3OMC A;  1N9W A;  3H0G G;  2JA7 A;  2W9A A;  2RCN A;  3RUP A;  1BBU A;  1A0I A;  1YEZ A;  1EQR A;  3HB9 A;  2M2L A;  2LXK A;  5DQI A;  4FYD A;  4GN5 A;  3M9N B;  5DGA A;  3IKJ A;  5I9P A;  1STH A;  5KFE A;  2M00 A;  1PXU A;  4ALP A;  1FNW A;  4DR1 Q;  2R93 H;  4I7A A;  3UE0 A;  1SYF A;  1S97 A;  3ER0 A;  4P2C B;  4A3K H;  2HCC A;  5DLF A;  1MHW C;  3IL8 A;  1YIJ A;  3JAM W;  3CXC A;  4GZY C;  3G8C A;  4LF9 L;  2QF7 A;  1FR3 A;  4KY7 A;  1QG7 A;  4G3I A;  5H1S E;  5JEA G;  3HOU H;  2B2Y A;  4NXN Q;  1BCP D;  3J7A V;  1D8L A;  1CHQ D;  4I65 A;  4CJ1 B;  1D1I A;  1O7I A;  4TRD A;  1W6K A;  4X66 L;  3H15 A;  4C5C A;  1WTX A;  4C3H G;  1WCM A;  2BE5 C;  2YW2 A;  1X56 A;  2I0Q A;  4J1M A;  3EPI A;  1U5K A;  2LSS A;  1EZ6 A;  2EOT A;  2NUC A;  3KLS A;  5M3F B;  4CKE A;  5J1Z A;  1Y69 U;  5HY6 A;  5D1O A;  1EY7 A;  1NBW A;  2JA6 H;  3TRE A;  4J0M A;  4LF8 L;  3PQI A;  1RIP A;  4DAV A;  3HOX H;  1PH6 A;  2DY8 A;  4F88 A;  2PMZ A;  5A2Q W;  5JVH 3;  2W7P A;  2K04 A;  1WYD A;  2HIV A;  4RA8 A;  3MR5 A;  1KAW A;  2X6L A;  2GPW A;  2VOB A;  5EPJ A;  3Q8P B;  1C8C A;  2WIN B;  3CQZ A;  3SI8 A;  5C4Z A;  4DR5 H;  4JOI C;  4K2L A;  1R4Q B;  2VS1 A;  1QVG A;  2A6H D;  1SFO B;  5KFR A;  4NPS A;  1V4Y A;  1FNU A;  3MFG A;  3D4R A;  1A2U A;  4GKJ Q;  1TWG H;  5C5J A;  4NP5 A;  4GOP C;  2MO0 A;  3VYR A;  3TRZ A;  1XX8 A;  2K5D A;  3MC0 B;  2XD4 A;  1NE3 A;  2K01 A;  4JI7 Q;  1L1O B;  1EYZ A;  5KFB A;  2K28 A;  5IYC H;  1U9R A;  4U68 A;  2B39 A;  3G6J B;  1I4X A;  4X65 Q;  2ZTC A;  3OW2 A;  4V19 0;  2SEB D;  4N9T A;  2ZXR A;  3LML A;  3NWS A;  3OHX C;  3J80 E;  1TS3 A;  2B3G A;  5JAV A;  5D8D A;  5KKN B;  4HJA A;  4MV3 A;  2JN4 A;  4DK3 C;  2JA5 A;  2NZH A;  1SYD A;  3A7A B;  1OO9 B;  3TBI B;  1CA6 A;  3OYY A;  3K3V A;  2DNC A;  3W1B A;  3PW7 A;  3EVQ A;  1DZ1 A;  5C4J H;  4EQP A;  3V6H A;  2E2H H;  3V4S A;  1JQY D;  2KOL A;  2JYO A;  1KL9 A;  4DV5 Q;  3A55 A;  4LF4 L;  3STB D;  4CC5 A;  4JI0 H;  3A7L A;  2NVT H;  5IYZ F;  4LF6 H;  3DEP A;  1EUC B;  3W5O A;  3P20 A;  1D6E C;  2FHT A;  3HOV G;  2AQ1 B;  4FS1 A;  4NXM H;  3VPB A;  2D62 A;  4OWT B;  3HOY G;  3S15 H;  3X3M A;  3V6K A;  2Z1C A;  2XSC A;  5KFA A;  5EWG A;  2I5H A;  5JPN C;  5FO7 B;  2NVY H;  2F0O A;  4RB3 C;  1WSC A;  4B3R L;  3FPP A;  1IL2 A;  4HNU A;  4ED3 A;  5IP7 G;  4DPG A;  4I55 F;  5D3I B;  2YYA A;  1VQ8 A;  5TSS A;  4S3S A;  1O80 A;  4JC0 A;  5FKA C;  3T1H L;  4BBR G;  1M8A A;  2JE6 I;  3GII A;  2J7Z A;  3OW7 A;  4P74 A;  1N33 L;  5IYD H;  1D7Q A;  5D65 A;  1ZXT A;  5DNF A;  1QZH A;  1N32 L;  2D5D A;  1KRT A;  3P7J A;  5FLX c;  4AH6 A;  2MQH A;  4ZK9 B;  4LF5 L;  2JA7 G;  2WB1 B;  1TY2 A;  2VQF Q;  5C44 G;  4WBN F;  4DL2 A;  4KY5 A;  4IRD A;  2JXM B;  5EBD A;  4H0L C;  2GVB A;  4MAM A;  1TWC H;  4LF9 Q;  2AMC B;  3J81 c;  1N48 A;  4KN4 C;  3BVM A;  1W96 A;  4F8M A;  1AUV A;  4BY1 G;  1HFG A;  1SE2 A;  4DNI A;  2KSW A;  5LL6 X;  1JMC A;  2BA1 A;  3S1R H;  4IQZ A;  5CR3 A;  3I4M B;  4X66 Q;  1PH5 A;  2A69 D;  2NU9 B;  4MV7 A;  4RGN A;  3GV6 A;  4PG3 A;  1UE7 A;  3RD4 A;  3RF2 A;  3E3X A;  1HR0 L;  3EBE A;  4ECU A;  1KJ8 A;  4YIJ A;  1IBM Q;  1RL2 A;  2DUD A;  3K7U C;  1VMP A;  2RKS A;  5IT9 c;  3JZI A;  5DLG A;  1M6V A;  5LOV F;  2K05 A;  4LF8 Q;  2PBZ A;  1N34 H;  4A93 H;  4RNN A;  1WCM G;  2L1B A;  4LFC Q;  2B2W C;  1PDQ A;  5KFV A;  2DWC A;  2JEJ A;  1HNZ H;  2A68 D;  1UNN C;  1MSG A;  2Z4H A;  1GUN A;  4K0K Q;  4QWA A;  1HRJ A;  1F2Y A;  1TXY A;  3HGB A;  1R9T B;  3HOZ H;  4DF7 A;  4MV6 A;  2UUC Q;  4MTK A;  5C0X I;  4YY3 Q;  3R23 A;  1STN A;  4JG2 A;  1S0O A;  1FJG H;  4J9Q A;  1CKN A;  3J81 i;  4KHP H;  2LMC B;  3R93 A;  3AFQ A;  4AIM A;  1U4M A;  4FDB A;  2ZT9 C;  4BY7 B;  1NR2 A;  4DV6 Q;  1E22 A;  3SXH A;  4DV4 L;  3GTG B;  4A3B G;  1X3G A;  4OGQ C;  3HRZ C;  1K8M A;  2V4Q A;  5EWE A;  4RZR A;  4JV1 A;  2H4O A;  1F9Q A;  3I73 A;  3U9T A;  2DPJ A;  5CV6 A;  3SGI A;  4B3S Q;  2AWN A;  1GLV A;  3M85 A;  1ULZ A;  3VR5 A;  5KT5 A;  3VYS A;  1ZYR C;  4DR6 L;  1Y8N B;  1F2L A;  2EYF A;  1Q46 A;  2IHF A;  4FXK C;  3JAM E;  1KTK A;  5K5P A;  1QWY A;  1EWC A;  1PRT C;  4LF4 Q;  2VQE Q;  1PYW D;  1HR0 W;  2JA5 G;  5C4X H;  3J7A K;  1XNR L;  1MJC A;  3DWQ A;  3PGZ A;  3RGX A;  4QWC A;  1HXY D;  1C48 A;  3S16 B;  1YNN D;  2C5C A;  4GN3 B;  2LS0 1;  5I2X A;  3VMM A;  3MFH A;  4DUY H;  4IR1 A;  5C0X J;  4IFD I;  1ROD A;  3ETH A;  2WKD A;  4EBC A;  1B9M A;  2L11 A;  5KFS A;  4DUZ Q;  2J0T D;  4RKB A;  1K73 C;  4LH6 A;  2R7Z H;  4ZHQ F;  3K5I A;  1LO5 D;  4B3R Q;  2H1E A;  2Z8L A;  3ZYY X;  1CHP D;  4A3G G;  3T1H Q;  3KOJ A;  1XXG A;  3GTK H;  1TII D;  2G5D A;  4ZUJ A;  1YJ9 A;  1B50 A;  5ELF A;  4X62 H;  5DG7 A;  1E2W A;  1LTG D;  1X3Q A;  4C3H B;  1N32 Q;  4EYI B;  1UAP A;  4O3R A;  1KQS A;  3KDF A;  4LF5 Q;  4QIW E;  2R7F A;  3MWE A;  1SDF A;  5CV9 A;  1LTB D;  3RV3 A;  3CRL C;  3K5H A;  3PO2 H;  4RCO A;  1SFO A;  4ED2 A;  3Q6S A;  1H9R A;  3JAM i;  1EY5 A;  1WOC A;  4NDX A;  5CA1 F;  3Q8R B;  3PUX A;  3BA8 A;  5G3L D;  2IX3 A;  1IBL H;  2W71 A;  4CHT B;  4ECX A;  1I4H A;  3KFU A;  2QA4 A;  3N6R A;  4IFD J;  3TIN A;  1EIG A;  2NTS A;  1NJI C;  3KF6 B;  2XCL A;  3W3A A;  1KJJ A;  1QB5 D;  1S5F D;  1B33 N;  1Z7T A;  5KNC A;  1J5E H;  3I4N G;  3SHL A;  4KN7 C;  2CW0 C;  3QJY A;  2FB9 A;  4R8U A;  2FIN B;  3K0X A;  2XIW A;  5J2U F;  3F1Z A;  2N49 A;  4IPG A;  4IHJ F;  1I4Q A;  3T53 B;  3K7A H;  5M5W B;  3S1N B;  3RIZ A;  4JI3 H;  2W6O A;  3L0O A;  3NUC A;  3EPG A;  3Q8Q B;  2UXB H;  4H44 C;  5T1I A;  2JEG A;  1Q12 A;  3FMC A;  1VF7 A;  4IZ8 A;  3WDN A;  1YJN A;  1PTO F;  2DY7 A;  3N8D A;  3CCM A;  4DV3 L;  1SE4 A;  1EEF D;  4EQN A;  2UVU A;  5IGB A;  4R4T A;  4ECY A;  3G6Y A;  5LMN Q;  1GUO A;  1TVX A;  4X6A H;  1VQK A;  2W6N A;  1BKB A;  4PMB A;  1MJE A;  4E4T A;  4DL7 A;  2B63 A;  3SVM A;  1SJH D;  2RDI A;  3UFX B;  3EYY A;  1JB3 A;  2B2Y C;  4WJ4 A;  1QIL A;  1V1P B;  1KLU D;  2I46 A;  1K8A C;  3FEW X;  2BH2 A;  3SEB A;  5C0X G;  5GAE C;  2IW3 A;  2E5L L;  1NSN S;  2H5X A;  3RB6 A;  1YI2 A;  5EDW A;  4DU9 A;  3FKI A;  5C8Y F;  1LT4 D;  3NSW A;  2NYZ D;  1R4P B;  2L15 A;  2ZM6 Q;  1BGW A;  4YWM A;  1X6O A;  1DOM A;  4C3I G;  1JDE A;  2UVW A;  1EL0 A;  2Q8T A;  4DR6 Q;  3M4O B;  3PR4 A;  2HDM A;  4WD3 A;  2I8C A;  1PFM A;  5KFX A;  4YHH L;  1E7Z A;  1Q8I A;  3LWE A;  3M7G A;  1X65 A;  3K5L A;  2HVS A;  2KBN A;  2E2I H;  2QGQ A;  4PV1 C;  1N8R C;  1RJP A;  2FFK B;  3RLN A;  2VQD A;  2XC9 A;  3CW2 C;  4DFA A;  4ECQ A;  3VYU A;  2YU9 H;  3RZD H;  3E5S A;  2V9W A;  1PYB A;  1GXD C;  2HVR A;  4JI1 L;  4XYO A;  2I5M X;  4JUZ A;  2VR1 A;  2D0P A;  1DCZ A;  4LUZ A;  3K81 C;  5FPR A;  1TWF H;  2ALY B;  4HCS A;  3GTL H;  4XYM B;  1RD9 D;  1JE5 A;  1L0Y B;  4JI2 H;  3V6J A;  2RDH A;  4IWY A;  2F4I A;  5LL6 b;  4BXX G;  2F0Q A;  1NMG A;  3I70 A;  4C5A A;  1IOV A;  2HIX A;  1RYR A;  4IFD G;  4JW0 A;  2OQ0 A;  4DV1 L;  2CWA A;  4BY1 B;  2BDN A;  1WR2 A;  4JVZ A;  1CZW A;  5LYJ F;  5KYL A;  3VR2 A;  4JBW A;  5LMU L;  4ED6 A;  3VA7 A;  3N41 B;  5KFM A;  1HNX H;  2WAQ E;  3Q1K A;  2CHB D;  3T5K A;  4A3K B;  5M3F G;  4QUC A;  5IGC A;  4LSX A;  4Y52 H;  2ASD A;  1E4F T;  3C1E A;  3SR1 A;  3TP5 A;  3J80 L;  4Y7N B;  4HIM A;  1Y1V H;  2XWB B;  1MSH A;  1NUC A;  1JR0 D;  2PN1 A;  4DR4 L;  3J81 j;  4LNQ A;  2R7D A;  1SEB D;  2NVX B;  4JI4 L;  3FPU B;  1Z47 A;  4UP9 A;  1QUQ B;  4RCN A;  4A3E H;  2ZJT A;  4LMY A;  5FOB B;  5LXT F;  4YR2 A;  5LHY 1;  3D4D A;  3H3V I;  2CH4 W;  4DL3 A;  4B08 A;  3H20 A;  4OIK A;  4BA1 I;  2VUM B;  1Y14 B;  5E3F A;  1TS2 A;  4JBK A;  2A19 A;  2KUM A;  4KD3 A;  4KKU A;  1IL8 A;  3TQY A;  4UCV A;  1SJE D;  3ERO A;  3GTG A;  2W8K A;  2J6T A;  3RBD A;  1T5E A;  2JA8 H;  4K6D A;  1AZQ A;  2EYJ A;  3K57 A;  3HP3 A;  3TP8 A;  4U6P A;  5K36 G;  5JQW A;  5KT7 A;  2GLT A;  3T5J A;  1UEA B;  4NMZ A;  1K8G A;  4ID6 A;  1WFQ A;  3RAX A;  3H0G A;  1ONL A;  4LFA Q;  4DV3 Q;  2WAQ B;  1PX2 A;  3N52 A;  3LWB A;  2YCH A;  1HFN A;  4JI8 H;  5FLM G;  4TUY F;  1Z2P X;  1BCP C;  2ZJP A;  4OX9 Q;  5D14 A;  3DHQ A;  4TQS A;  4HJ7 A;  4YAK B;  3E9I A;  1N36 H;  2L9H A;  4JYA H;  4C3J H;  5GAD C;  3J80 W;  5EKL A;  4ME5 A;  5KFK A;  1F9S A;  2E8G A;  3KYH C;  2E5L Q;  1I6H B;  2W70 A;  2F0W A;  3I7F A;  4HTH A;  5HGQ A;  3AMU A;  3ERQ A;  4DR1 L;  2XIG A;  4ZYS A;  2K32 A;  3V4Z A;  3M9B A;  2RSO A;  3DM1 A;  3ND8 A;  4YQW A;  1E24 A;  1LT6 D;  3MR6 A;  5KFZ A;  1Y8O B;  1SYG A;  2TSS A;  4CBV A;  2N55 A;  4H02 A;  5CB4 F;  4GC7 A;  4A3L H;  2NVT B;  3S2H B;  4FBT A;  2A6H C;  1B3Q A;  2MP1 A;  3OSO A;  1A9X A;  4IRC A;  3UDF A;  4LF7 H;  2PQA B;  5JEA H;  4AYB E;  3PSI A;  3S15 B;  1RKN A;  1TWH B;  1UC8 A;  5I47 A;  1E0B A;  2E75 C;  1JLL B;  2V1C C;  2UU9 H;  2WB1 G;  1XMQ H;  4LFB H;  4IPH A;  1YNJ D;  2NU6 B;  4DR7 L;  2OLS A;  3GLK A;  2NVY B;  1TR5 A;  4RG1 A;  4YB8 B;  5KG0 A;  4X65 H;  3GTO H;  2M05 A;  2NU7 B;  2K14 A;  3KTM A;  4RAY A;  4UPA A;  2CFM A;  4OL7 A;  3I4M G;  3FMA A;  5GQO A;  3NEL A;  2VXW A;  3L2P A;  2C9O A;  4J9N A;  2IP4 A;  5LMU Q;  1Q7Y C;  1WTQ A;  1DYQ A;  1PFS A;  2PZU A;  3AYH B;  1RDP D;  1D2B A;  3PMF A;  3STB C;  2F0H A;  4ZOL F;  3OSP A;  5DG9 A;  4KI0 A;  4KK7 A;  3RZO H;  1TWC B;  4DV5 H;  4CKB A;  2PYK A;  4B3T H;  4GKK H;  3GIL A;  2YTX A;  4QIW A;  4JI4 Q;  1EWH A;  2UVV A;  2FLN A;  4A3I B;  1HNW H;  3CME A;  3MXP A;  1EIH A;  1YZ6 A;  1I50 H;  1O78 A;  1G2S A;  5CA0 F;  3DUZ A;  3CC4 A;  4R4C A;  1WTV A;  4AYB B;  5HUR A;  3GDE A;  1V51 A;  4I4T F;  1V1P A;  2R92 H;  1HZC A;  4DLK A;  3KAL A;  2JJQ A;  2C35 B;  1CT1 D;  1VS0 A;  5E7N A;  3T13 A;  4IWX A;  1K8O A;  1AN8 A;  4GNX B;  4EBD A;  2C2R A;  4A76 A;  3X3N A;  4O2B F;  3K59 A;  1BO0 A;  5KT6 A;  2OEO A;  1S9F A;  4HSP A;  4BY7 G;  1KBL A;  4Q8F A;  2FJZ A;  1V1O A;  4HNT A;  4KJN A;  1GSO A;  2DLN A;  3K6O A;  3OHB A;  1HJP A;  2F0F A;  3HXL A;  2ES2 A;  3BS1 A;  5KFQ A;  1RJQ A;  4DV0 H;  3HOV H;  5IWA Q;  1VKZ A;  1E2Z A;  5C3X A;  4DR3 L;  1CI3 M;  3HKZ E;  1HTP A;  1XMO H;  3HOY H;  3BDC A;  3N42 B;  1P8L A;  2DN8 A;  2XVS A;  3BDO A;  4DV7 H;  1B44 D;  2YYZ A;  3MZ5 A;  2A69 C;  3JSN A;  2F4V L;  1O7L A;  3R3O A;  4TKO B;  1NCV A;  1S40 A;  5FD6 A;  1C30 A;  1RTO A;  3EFX D;  1B2T A;  2KHI A;  1B3A A;  2DJG C;  2NUA B;  2KCN A;  1FVI A;  3F8N A;  3BZK A;  4IUP A;  3AFP A;  3RB3 A;  4LF8 H;  2VQF L;  4O0A A;  3CD6 A;  2A68 C;  4UP7 A;  2JA7 H;  4G7Z C;  1YIT A;  1RJT A;  4M7E A;  2AGO A;  5C44 H;  4DGZ A;  4ZCK A;  2L12 A;  4M1U B;  1G51 A;  4IR9 A;  4QB4 A;  5C4X B;  1SR3 A;  2NB0 A;  2NVX A;  3ITP A;  1VQG A;  4R8I A;  1QUQ A;  1JE4 A;  3A8K E;  4HN7 A;  4GLA C;  4FBU A;  4LUV A;  3TZD A;  1Q3L A;  4DNR B;  4O1N A;  1I94 Q;  4JI5 L;  3DF7 A;  1DXM A;  3OTO L;  3HKZ B;  3J7Y W;  2O5I C;  3QWN A;  2DPI A;  4DR7 Q;  5K2M A;  1KNA A;  2VUM A;  4DV2 L;  1IBM L;  1EQV A;  2HGS A;  3M3Y H;  2PNH A;  3PN1 A;  4IAL A;  3TSS A;  4LFC L;  2K50 A;  1OXX K;  2X6G A;  4L5S A;  2KHS A;  5IOD A;  3GTK B;  1WCM H;  2KED A;  4APV A;  1H9K A;  2ATL A;  4K2K A;  1I5F A;  2JEI A;  2HVQ A;  1O7Y A;  5C3E B;  1CE8 A;  5DQH A;  4K0K L;  3EJI A;  2F3W A;  5CBE E;  2B2U A;  3D8G A;  1AZP A;  4A75 A;  2UUC L;  4YY3 L;  4MA5 A;  2EY5 A;  2Z4I A;  3TS2 A;  4A3F B;  4BBS B;  4Y8V B;  5NUC A;  4LF4 H;  1YNN C;  5M3M H;  1KXL A;  3MWM A;  5KFI A;  1V43 A;  1MBY A;  1ICF B;  3CCV A;  2E76 C;  4JI6 H;  1HH2 P;  4KHZ A;  5EPL A;  1ML0 D;  3CQZ H;  4TVA B;  4WOR A;  1W3S A;  1B53 A;  2Z6K A;  3OIQ A;  4A3C G;  4DV6 L;  3JRW A;  1V8Q A;  3CPF A;  1FD7 D;  2R82 A;  2Z9H A;  3J80 c;  1HA5 A;  2UUA Q;  1GHK A;  2I87 A;  1EUJ A;  4B3M H;  2LXJ A;  4B9X A;  1VQB A;  1G8Z D;  2AWO A;  3CPW A;  5BN3 A;  3ULP A;  1K9M C;  2BA0 A;  1S5C D;  4B3S L;  1RYS A;  2WB1 E;  1M0T A;  2PW7 A;  3GTQ A;  1IBK H;  4FXD A;  3RLF A;  3T5L A;  3B6Y A;  1EYG A;  4IOC A;  1YVC A;  1DOK A;  3CF5 A;  2UXC Q;  3TII A;  1B70 B;  1N33 H;  2VQE L;  1E3P A;  1JOR A;  4O42 A;  4H7B A;  1K0R A;  4JCV E;  3BAA A;  1V9P A;  1ENF A;  2JA5 H;  1CQJ B;  3J7A F;  4ME3 A;  3TN2 A;  3R5X A;  4BA2 I;  1EY8 A;  4YR0 A;  2PQA A;  3QG1 A;  4DR3 Q;  2FK3 A;  1HPC A;  2F0V A;  3L7Z C;  4FNF A;  4MTN A;  5LL6 S;  4DUZ L;  4A3J H;  1TWH A;  5M5Y H;  2IMW P;  2X69 A;  3LX0 A;  4R9W A;  5KT2 A;  3WOE A;  4QL5 A;  4CDF C;  5KIX A;  4H13 C;  3GTM B;  2EE1 A;  2F4V Q;  1WJJ A;  2K52 A;  3KF8 B;  3S1M H;  1DD2 A;  5C4H A;  1DIK A;  3OWE B;  5C1O A;  3J80 i;  1AE2 A;  1B9N A;  3H3V C;  1HR0 H;  1B4O A;  4DL5 A;  3OUU A;  2D9U A;  1FL0 A;  1BQQ T;  2R87 A;  4G4K A;  1A2T A;  1UEB A;  2MFI A;  2EY1 A;  4F50 A;  1D1K A;  5LA6 F;  2IJ0 A;  1A15 A;  4KKT A;  5KFH A;  1HCZ A;  1KJI A;  4WFN 3;  2F0U A;  3K5O A;  4J6H A;  1ET9 A;  2EYL A;  4ED1 A;  4E6I A;  1OTC A;  2AGQ A;  3E9H A;  3RV4 A;  2R84 A;  4GS3 A;  2AUK A;  3CHB D;  2E2J H;  1LTT D;  4J9L A;  4X3T A;  4RNO A;  1JIH A;  4QY7 A;  2BH8 A;  2B2T C;  2R8J A;  1QNK A;  1BNC A;  2VB3 X;  5HBR B;  4LF6 L;  4A3K G;  1Q1B A;  1SNP A;  1XPO A;  2YU9 B;  4GOP B;  2NZ1 D;  4KKS A;  5KFF A;  4FVM A;  2XNA C;  4JI5 Q;  4AYB A;  3OTO Q;  3AQQ A;  2W57 A;  5KFY A;  4K8J A;  4DV2 Q;  4R4Q A;  2TMP A;  3I4N H;  4LJZ C;  1VQE A;  1PH4 A;  2UUB L;  1JOQ A;  2GVA A;  2SNS A;  1KRS A;  2PVP A;  1EHI A;  3M9M B;  4DV4 H;  5IGE A;  5M5X H;  3GTP A;  3RN5 A;  4B9W A;  5KFW A;  5FK9 C;  2VUM G;  2OT2 A;  1I4P A;  3IG0 A;  1DV1 A;  3H40 A;  5LMN L;  1GSA A;  2YL2 A;  2A5H A;  3VR3 A;  4F4Y A;  3NEN A;  1I7N A;  2R6F A;  2AGP A;  3GTJ B;  1ENA A;  1KDB A;  2C2D A;  3NE5 B;  4A3E B;  5C5M A;  2Y0S G;  1XNR H;  3F2D A;  3I2Z A;  2F0P A;  1PZK D;  2B8G A;  5FO9 B;  4QF4 A;  1VQC A;  1ASY A;  2PI2 E;  4QCL A;  1PTO B;  1VBG A;  3OHA A;  2ASL A;  5BR8 H;  1OXV A;  4LUO A;  2FMM A;  3C2P A;  3NK9 A;  2WAQ G;  4IZO A;  4QUF A;  2NN6 H;  2RSN A;  3IFT A;  5C0X H;  2NVQ H;  4IOA A;  1I3Q B;  3ULJ A;  4WJ3 M;  2ZM6 L;  1LM0 A;  2JA8 B;  4KMU C;  4NLG A;  2VW9 A;  2EXZ A; 
#chains in the Genus database with same CATH homology
 1VQO A;  2ASB A;  5IP9 G;  2ZTE A;  3S14 H;  1GVP A;  4LF7 Q;  4C3I H;  3JAM c;  3CW2 C;  4QGU A;  4A3B H;  2YU9 H;  1LUZ A;  1X3E A;  3RZD H;  1PYB A;  1X9N A;  2K5H A;  3S2D H;  4O2D A;  2UXD Q;  4JI1 L;  1Y1W G;  3S1N H;  2I5M X;  4DV1 Q;  2D0P A;  2UU9 Q;  1OXT A;  4LUZ A;  5JEA J;  1XMQ Q;  4LFB Q;  4OO1 I;  3K81 C;  2RHS B;  3ZJY C;  4A3M H;  1TWF H;  1UE6 A;  2ALY B;  3GTL H;  3S1Q H;  1JE5 A;  2XTI A;  4A3C H;  2Q2H A;  3HKS A;  4NB3 A;  2KCM A;  4XTC S;  2RHQ B;  4BXX G;  1Y1V G;  2A1A A;  3PCO B;  1E1O A;  1NMG A;  3K8A A;  5IP9 H;  2HIX A;  4DR5 Q;  4GKJ L;  1YJW A;  4IFD G;  2R92 G;  2OQ0 A;  4YCW A;  4DV1 L;  2CWA A;  1XMQ L;  2N8N A;  1VQ5 A;  4DR4 Q;  1NTG A;  4JBW A;  5LMU L;  4JI7 L;  3S24 A;  1I6H H;  3E0E A;  2WAQ E;  3GTQ H;  3BJU A;  1FJG L;  4X65 L;  5M3F G;  4UY8 C;  4Y52 H;  4KHP L;  4DR5 L;  4GN4 B;  1C7Y A;  3J7Z C;  1IZ6 A;  1A63 A;  2Q2I A;  4PZ6 A;  5LMN W;  1T9H A;  1Y1V H;  3RLO A;  2IX0 A;  4HIM A;  3A5U A;  4BXX H;  4DR4 L;  3J81 j;  1CSQ A;  5DLQ E;  2R7D A;  4LNQ A;  5IYB G;  5EAY A;  2F3I A;  2CCZ A;  4JI4 L;  4OON A;  1Z47 A;  3CCU A;  2OCE A;  4UP9 A;  1QUQ B;  4A3E H;  1FGU A;  1YHQ A;  3S17 H;  4POF A;  4P75 A;  1W2B A;  3CCJ A;  3JC6 6;  4B3T Q;  3HOW H;  3S2H H;  2ATW A;  4GKK Q;  1HZB A;  1QVF A;  3D0F A;  3A5Z B;  4EX5 A;  1HNW Q;  5M3F H;  4JI6 L;  4A93 G;  3VDY A;  3H3V I;  4A3G H;  1EOV A;  4BA1 I;  1Y14 B;  1TWH H;  4JBK A;  4X64 Q;  2A19 A;  4A3D G;  3TQY A;  4DV5 L;  5IYB H;  3KJO A;  5IYD G;  4B3M L;  4B3T L;  2HQL A;  2MNA A;  2JA8 H;  1L1O A;  3F8T A;  1UWV A;  4AQY Q;  1IBK L;  4LF6 Q;  3NBH B;  2NZO A;  2OQK A;  3I56 A;  5K36 G;  1MKH A;  4NXM Q;  4DR2 Q;  5GAG C;  1SFO H;  2OTJ A;  3TS0 A;  4C2M H;  4GLX A;  4A3D H;  2R6G A;  1K83 H;  1BBW A;  1K8G A;  2F52 A;  1S72 A;  1JJG A;  4JI0 L;  1WFQ A;  2R93 G;  2GN5 A;  1XTD A;  4LFA Q;  1N9W A;  1SLJ A;  4IJL A;  3H0G G;  3UDX A;  4DV3 Q;  4A3I G;  2UUB Q;  4POG A;  3G71 A;  1UE5 A;  1PHJ A;  2RCN A;  1BBU A;  3FHW A;  1NY4 A;  2JQO A;  4MNO A;  1A0I A;  4L5R C;  4NXM L;  4OWW B;  1YEZ A;  1EQR A;  1VQI A;  4AYB G;  5FLM G;  4HIO A;  2R7Z G;  2LXK A;  4DV0 Q;  1JB7 A;  2ZJP A;  4GN5 A;  4OX9 Q;  4PZ8 A;  5ELO A;  1XMO Q;  2JEA I;  4HJ7 A;  4LFA L;  4ALP A;  3HOU G;  3E9I A;  1GKH A;  4DR1 Q;  4DV7 Q;  2R93 H;  4C3J H;  5GAD C;  4R4O A;  3UE0 A;  4A3I H;  1P16 A;  3ER0 A;  1PH3 A;  4GNX A;  4A3K H;  1ASZ A;  1X54 A;  2YTY A;  4OX9 L;  1YIJ A;  2E8G A;  3KYH C;  3RNU A;  2E5L Q;  3CXC A;  4TQU S;  5FLM H;  3G6E A;  3I7F A;  4LF9 L;  1X3F A;  5HGQ A;  4DR1 L;  5H1S E;  5JEA G;  2VY3 A;  3M9B A;  2JA6 G;  1YHA A;  3HOU H;  3M4P A;  4NXN Q;  1PA6 A;  3GO5 A;  1D8L A;  3F2B A;  3PIO A;  1E24 A;  1O7I A;  4X66 L;  3HOX G;  3H15 A;  1IBL L;  3PF5 A;  3Q8D A;  1VQ7 A;  1X56 A;  3PUW A;  4H02 A;  2I0Q A;  3GTP H;  4A3L H;  1JT8 A;  1U5K A;  2LSS A;  3KLW A;  4IO9 A;  4QQB X;  5HY6 A;  3UDF A;  2PQA B;  2B63 H;  3CCS A;  1NBW A;  3EIV A;  2JA6 H;  3TRE A;  4AYB E;  1G6P A;  3PSI A;  4LF8 L;  4DK6 C;  1PH9 A;  1RIP A;  2NN6 I;  3PUY A;  2V1C C;  3HOX H;  1PH6 A;  2WB1 G;  1Q81 C;  4IPH A;  1CKO A;  1N34 Q;  4DR7 L;  5M3M G;  1WYD A;  2HIV A;  1VQN A;  1KAW A;  1Q8K A;  3FKI H;  3WWV A;  4RG1 A;  5IYC G;  3UDI A;  1VQ9 A;  3GTO H;  1HNZ Q;  3BU2 A;  1VQJ A;  1G29 1;  2K14 A;  4JOI C;  5AJ3 L;  1J6Q A;  2VS1 A;  1QVG A;  4UPA A;  3A0J A;  4NPS A;  2CFM A;  1PYS B;  1N34 L;  1CSP A;  4GKJ Q;  3I4M G;  1TWG H;  2Q2U A;  4GOP C;  2MO0 A;  3NEL A;  5GQO A;  3TRZ A;  3L2P A;  1PH1 A;  4RMF A;  1HNZ L;  5LMU Q;  1NE3 A;  4L5T A;  4IJH A;  1L1O B;  4JI7 Q;  5C4X G;  4OO1 G;  5IYC H;  1FJG Q;  5FJ8 H;  1Q7Y C;  4X65 Q;  1PFS A;  2RF4 A;  2ZTC A;  3AYH B;  2Y0S E;  4IPD A;  3OW2 A;  2Z6K C;  4KHP Q;  3STB C;  4KI0 A;  3RZO H;  1GD7 A;  2I5L X;  4YCV A;  1C9O A;  2B3G A;  1Y1W H;  3I4M H;  2YTX A;  2QEX A;  4JI4 Q;  3FP9 A;  3HKZ G;  4HJA A;  2JK8 A;  3CME A;  4DK3 C;  1EWI A;  1SN8 A;  2NZH A;  4UP8 A;  1YZ6 A;  1I50 H;  3OYY A;  2OWO A;  3CC4 A;  4R4C A;  3W1B A;  4JI6 Q;  4MZ9 A;  1IYJ B;  2K5N A;  3GD7 A;  3GDE A;  2CKZ B;  1DGS A;  5C4J H;  2R92 H;  1HZC A;  5BR8 L;  4A3J G;  2E2H H;  2JJQ A;  1GO3 E;  2C35 B;  2WP8 J;  4DV5 Q;  1KL9 A;  4LF4 L;  1WI5 A;  4HIK A;  3STB D;  1VS0 A;  5E7N A;  2JEB I;  4B3M Q;  2NVT H;  1PH2 A;  5C3E G;  1B7Y B;  3W5O A;  1NMF A;  1YNX A;  4GNX B;  3HOV G;  2WFW A;  1L2F A;  2D62 A;  4OWT B;  4A76 A;  1IBK Q;  3HOY G;  3S15 H;  1XNQ L;  4A3F G;  4BBS G;  4DUY Q;  4BY7 G;  3PF4 A;  2ID0 A;  2I5H A;  2NVY H;  1N33 Q;  1A8V A;  4JI0 Q;  4B3R L;  1HJP A;  5C3E H;  1IL2 A;  2ES2 A;  4OWX B;  5IP7 G;  4DPG A;  1JJ2 A;  3HOV H;  5IWA Q;  1VQ8 A;  4DR3 L;  4DUY L;  1PH7 A;  3HKZ E;  4JC0 A;  4JI2 L;  3T1H L;  3HOY H;  2ZTD A;  3H3V H;  4BBR G;  1LYL A;  1P8L A;  1Q1E A;  1SE8 A;  2JE6 I;  4P74 A;  4A3F H;  3CCL A;  1M1K C;  2YYZ A;  3MXN B;  1N33 L;  1HZ9 A;  4BBS H;  4BY7 H;  5IYD H;  1D7Q A;  3GTG H;  1QZH A;  1N32 L;  2K5V A;  2KCT A;  1KRT A;  5FLX c;  5IWA L;  2F4V L;  4AH6 A;  2MQH A;  4LF5 L;  2JA7 G;  1S40 A;  4HID A;  4X62 Q;  2VQF Q;  1QVC A;  5C44 G;  4JV5 L;  4EQ5 A;  1CKM A;  4R4I A;  3TEH B;  2GVB A;  1TWC H;  2KHI A;  3RN2 A;  1PH8 A;  4LF9 Q;  1FVI A;  2AMC B;  3J81 c;  3KJP A;  3BZK A;  1Q86 C;  3AFP A;  1VQL A;  3CCR A;  1H95 A;  1LTL A;  4BY1 G;  1HR0 Q;  4KLK A;  4DNI A;  4X62 L;  3H0G H;  2VQF L;  3CAM A;  1JMC A;  2BA1 A;  4O0A A;  3S1R H;  3CD6 A;  4UP7 A;  2N78 A;  3F2C A;  3EN2 A;  2FXQ A;  4QJF A;  4X66 Q;  2JA7 H;  3LGJ A;  1IBL Q;  3T1Y L;  1YIT A;  4PZ7 A;  4DAY B;  1PH5 A;  3IRB A;  5C44 H;  3S16 H;  2PI2 A;  4PG3 A;  1UE7 A;  1G51 A;  1HZA A;  1HR0 L;  1SR3 A;  3EBE A;  1GM5 A;  1VQ4 A;  4JBJ A;  1L0W A;  1KD1 C;  3HOZ G;  1IBM Q;  1RL2 A;  2DUD A;  1VQG A;  3K7U C;  1J5E Q;  5IT9 c;  1QUQ A;  2IX1 A;  3AEV A;  4GLA C;  4HJ5 A;  1VQF A;  4LF8 Q;  4A93 H;  1WCM G;  4LFC Q;  4LUV A;  1AH9 A;  1OXS C;  1I94 Q;  4JI5 L;  4YWK A;  3OTO L;  3ULL A;  2HHH L;  2KHJ A;  4DR7 Q;  1C0A A;  4DV2 L;  1U0L A;  1IBM L;  3CC2 A;  1J5E L;  1EIY B;  2EIF A;  4P71 A;  4K0K Q;  3M3Y H;  2PNH A;  4A4I A;  1TXY A;  3HOZ H;  1V1Q A;  2UXB Q;  4LFC L;  2K50 A;  5AJ3 Q;  1OXX K;  2UUC Q;  4L5S A;  5C0X I;  1I94 L;  4YY3 Q;  4C3H H;  3GTM H;  1XJV A;  1WCM H;  2NN6 G;  4YWL A;  4APV A;  4JG2 A;  1I5F A;  3CCE A;  3KF6 A;  4JI3 L;  4DV4 Q;  4K0K L;  5GAH C;  1CKN A;  4DAM A;  1KHI A;  3J81 i;  2UXB L;  3A74 A;  4YCU A;  4A75 A;  4JOI A;  2UUC L;  3PIP A;  3AFQ A;  4PMW A;  4YY3 L;  3TS2 A;  4AIM A;  4FDB A;  3RR5 A;  1XPR A;  3U4V A;  4JYA L;  4DV6 Q;  3M7N A;  1OXU A;  1E22 A;  3CCQ A;  4A3B G;  4DV4 L;  4GOP A;  3I4O A;  1IXR A;  1X3G A;  5M3M H;  3ICE A;  1KXL A;  1AE3 A;  1V43 A;  3CCV A;  4P73 A;  3CC7 A;  1HH2 P;  4KHZ A;  3U58 A;  3CQZ H;  1EFW A;  4TVA B;  2KEN A;  4R1J A;  3SGI A;  2AWN A;  4B3S Q;  1VCI A;  1W3S A;  2Z6K A;  3M85 A;  1XNR Q;  4A3C G;  2ZJR A;  4DV6 L;  2CQO A;  3CPF A;  4GLV B;  3J80 c;  3W1G A;  4DR6 L;  1VQ6 A;  2UUA Q;  1EUJ A;  3I55 A;  4LW1 A;  1PV4 A;  2IHF A;  1Q46 A;  1EQQ A;  2LXJ A;  1Q82 C;  1VQB A;  2AWO A;  5BR8 Q;  3CPW A;  1K9M C;  3ULP A;  4HJ8 A;  2BA0 A;  4LF4 Q;  2VQE Q;  2MO1 A;  1HR0 W;  4B3S L;  5M5W H;  2JA5 G;  2WB1 E;  5C4X H;  2N3S A;  2XGT A;  1XNR L;  1MJC A;  3U50 C;  3PGZ A;  2PMZ E;  3RLF A;  2YTV A;  3B6Y A;  4GN3 B;  2UUA L;  1A62 A;  1EYG A;  4IOC A;  4LF7 L;  5C0X J;  4IFD I;  1CUK A;  1YVC A;  3CF5 A;  5IE8 A;  1SRO A;  3CMA A;  2D0O A;  1XNQ Q;  1B70 B;  2UXC Q;  2VQE L;  1E3P A;  2UXD L;  3D31 A;  4DUZ Q;  1K73 C;  2UU9 L;  3DM3 A;  4LFB L;  2Q2T A;  1K0R A;  4JCV E;  4A3E G;  2R7Z H;  1V9P A;  2JA5 H;  3HOW G;  4B3R Q;  5JJL A;  4ME3 A;  4BA2 I;  3UDG A;  2PQA A;  1XPU A;  1R9T H;  2A8V A;  2UXC L;  4DR3 Q;  3PO2 G;  4A3G G;  1VQM A;  4JI2 Q;  3L7Z C;  4DUZ L;  3T1H Q;  3KOJ A;  4MTN A;  4A3J H;  2VZA A;  5M5Y H;  3GTK H;  3ERS X;  1YJ9 A;  3PUZ A;  4QL5 A;  3PV0 A;  3GTJ H;  1PVO A;  1N32 Q;  1K3R A;  2JA8 G;  1KQS A;  2F4V Q;  1HNX Q;  1WJJ A;  2K52 A;  3KDF A;  3KF8 B;  3PUV A;  4QIW E;  4LF5 Q;  3S1M H;  2R7F A;  2IY5 B;  4DKA C;  1B8A A;  4JV5 Q;  3J80 i;  3PO2 H;  1AE2 A;  3K80 C;  3JAM i;  5JJK A;  3M4O H;  3UE1 A;  1WOC A;  1FL0 A;  2EXD A;  3PUX A;  4GKK L;  1HNX L;  1UEB A;  2MFI A;  1I3Q H;  1UE1 A;  5GRO A;  5IP7 H;  1HNW L;  1L1O C;  2HT1 A;  1SRU A;  2IT1 A;  3KFU A;  4XIG S;  3MEF A;  2QA4 A;  4IFD J;  3T1Y Q;  4J15 A;  1NJI C;  1S3O A;  4BBR H;  3KF6 B;  4X64 L;  1OTC A;  1CKN B;  3E9H A;  4L5Q A;  1TWA H;  4GS3 A;  3I4N G;  3M4Q A;  2E2J H;  2CWP A;  3K0X A;  2VNU D;  2B29 A;  2EQS A;  2BH8 A;  4QY7 A;  1JJC B;  3CP0 A;  1VQP A;  3F1Z A;  3G4S A;  2IHE A;  2N49 A;  4P72 A;  4AQY L;  4LF6 L;  4IPG A;  4A3K G;  1Q1B A;  4HJ9 A;  1XPO A;  1SMX A;  4GOP B;  2YV5 A;  3K7A H;  5IY0 A;  4IPC A;  2ZJQ A;  3NEM A;  4DR2 L;  4JI5 Q;  3OTO Q;  2HHH Q;  3L0O A;  3G48 A;  1Z9F A;  3AQQ A;  4DV2 Q;  4R4Q A;  1Q12 A;  1KIX A;  3I4N H;  4BY1 H;  1YJN A;  1VQE A;  4OXP A;  1PH4 A;  2UUB L;  5ELN A;  3CCM A;  1YBY A;  4DV3 L;  3PO3 G;  2GVA A;  1KRS A;  1YHB A;  2JA9 A;  1KC8 C;  5J3B A;  4R4T A;  3U4Z A;  4GNX C;  5M5X H;  5LMN Q;  3RN5 A;  4DV0 L;  4X6A H;  1VQK A;  4Y7N H;  2VL6 A;  2VUM G;  1MIU A;  1BKB A;  1XMO L;  4A3L G;  4JI3 Q;  4JI8 Q;  1MJE A;  5JJI A;  4DV7 L;  2NVX H;  2B63 G;  3J7A 5;  2AHO B;  4WJ4 A;  1E1T A;  1VQA A;  1N36 Q;  1K8A C;  5LMN L;  4LWC A;  1M90 C;  4JBM A;  2BH2 A;  3PO3 H;  4JYA Q;  1X55 A;  5C0X G;  3NEN A;  5GAE C;  2E5L L;  1BVS A;  2Z0S A;  2H5X A;  2K4K A;  4JI8 L;  1YI2 A;  1QZG A;  2Y0S G;  4YHH Q;  3F2D A;  3I2Z A;  2OTL A;  2VUM H;  1EIF A;  3FKI G;  1VQC A;  2L15 A;  2ZM6 Q;  3DLL A;  1VQD A;  4YWM A;  1ASY A;  2PI2 E;  4NXN L;  1N36 L;  1X6O A;  1OXV A;  4LUO A;  2K75 A;  4DR6 Q;  2AKW B;  2WAQ G;  2DGY A;  4YHH L;  2NVQ H;  1E7Z A;  4IOA A;  1X65 A;  3ULJ A;  4WJ3 M;  2ZM6 L;  3HFZ B;  2KBN A;  1LM0 A;  4A3M G;  2E2I H;  2QGQ A;  4JI1 Q;  1N8R C;  2VW9 A;  1VQH A;  3KDF B;  3RLN A;  3BZC A;  5FJ8 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...