1WCMG

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wcmG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1wcmG01
4R1JA 5LMNL 4X65Q 2VUMH 2NVXH 4GN4B 1OXSC 4GOPB 4UP7A 4ME3A 1Q46A 3Q8DA 2MFIA 3J80i 4JI1Q 2NVQH 4B3RQ 3BZCA 3HKSA 4QIWE 2Z6KA 4DR4Q 1FL0A 2K14A 3I4NG 1YNXA 4QJFA 3CCJA 1CKNB 4DV3Q 2N49A 1A62A 4AQYQ 1P8LA 3IRBA 3A5UA 1Y14B 1IBMQ 2I5LX 4UP8A 4JI4Q 2B3GA 3RLOA 2JQOA 4DV1Q 1ASYA 1HZ9A 4LFCQ 2K5VA 4JBJA 3KF8B 1EOVA 3ULPA 3FKIG 2KENA 4LNQA 5IYBG 4JI4L 4B3TQ 3K7AH 4DR6Q 2Z6KC 4O2DA 3I2ZA 4HJAA 5IYDH 1L1OA 2JA5H 2OWOA 1B70B 2N78A 4DV2Q 1XNQL 4GLVB 2YU9H 3GTJH 4GN5A 4O0AA 3T1YL 4EQ5A 3JC66 4FDBA 4X66L 3M3YH 1A63A 1Y1VH 3TREA 3RZDH 2UU9L 4BBSH 3NBHB 1EIFA 3HOWH 3B6YA 3CW2C 1PVOA 1KC8C 3CPWA 1UE7A 1KIXA 4P71A 4JG2A 4BBRG 2YTXA 5IWAL 1K73C 2K50A 2IHEA 3HOZG 4DR5L 2Y0SG 1P16A 4DR7L 2D0PA 1BKBA 3PUWA 4GNXC 2L15A 2AKWB 4DKAC 4A3IG 2JA7G 1VQ4A 3CP0A 1JJ2A 1HR0Q 3CC7A 3J80c 1A8VA 4C2MH 3ZJYC 3HOVH 1CKNA 4JI2Q 1N34Q 5M5YH 1N8RC 3S1NH 4BXXG 4GNXB 4DR3Q 3PO2H 4C3HH 3PUVA 4TVAB 3HKZG 2ZJPA 3PO3H 1L0WA 4LF8Q 1D7QA 4JI5L 4JOIC 2I5MX 4IJHA 3FHWA 4A3FH 2HT1A 1VQPA 5IWAQ 4H02A 4OO1I 1RIPA 4GKJQ 4KHPL 1E24A 3WWVA 3ULJA 4OX9Q 3TS0A 2IY5B 2YTYA 3S1QH 4DV3L 4EX5A 1PA6A 5M5XH 1IBLQ 5IYDG 3OYYA 3J81c 1VS0A 4C3IH 1Q86C 2VZAA 4IO9A 3S2DH 2Q2IA 4DUYQ 2ZTEA 3S16H 2JA8H 4UP9A 1X9NA 3S2HH 1V1QA 4X64L 1NJIC 4YCUA 1EYGA 1XPUA 4A3GG 4A3LH 3TQYA 3D0FA 2B63H 2ALYB 4LFCL 1WI5A 3STBC 5JEAJ 1QUQA 4JI5Q 2R92G 4LUVA 2BH2A 2B29A 4A75A 4IFDG 2R7FA 1WCMH 1VQAA 1FJGQ 3HOZH 1VQOA 3CQZH 4PZ8A 3HOYH 5H1SE 3AYHB 1E1OA 4DR1L 1Y1WH 4JV5Q 3GTQH 3L7ZC 2VNUD 4JI6L 4QQBX 4X6AH 1HR0W 3H0GG 5JEAG 1I50H 1OXTA 4A3GH 1WFQA 1HNWL 3RN5A 2GN5A 2VQEQ 4LF9L 5IYBH 1PH5A 3I4MG 2RHSB 5M3MH 4X64Q 4A3EH 4DV7L 4OONA 4LF7L 2NVTH 1X65A 1Z47A 4JOIA 1X6OA 3A0JA 5GAHC 2KCMA 3CCRA 4A3BG 4R4CA 4DR2L 4OWWB 4LWCA 2UXCQ 1EWIA 1OXXK 4DV4Q 3VDYA 4P72A 3U4VA 1Y1VG 4BBSG 4QL5A 4DV2L 2PI2A 2KBNA 1NMFA 1XMOQ 3J81i 1YJ9A 3OTOL 2F4VQ 1C0AA 3STBD 5LMUQ 4BBRH 4KHPQ 2ES2A 1Z9FA 3RLNA 2E8GA 1EQQA 4Y52H 3W1BA 5FLMH 3H3VI 1VQ6A 2YYZA 1N33L 1SR3A 4A3BH 1VCIA 2AWOA 3GTMH 3G48A 1K3RA 2GVAA 2R92H 4HJ5A 4GLXA 5C4XH 2XGTA 1YHAA 3KYHC 3J7ZC 4DV4L 4BXXH 2CFMA 1FVIA 4X66Q 3DM3A 1N36Q 1TXYA 1S72A 1VQLA 4DR5Q 4L5SA 3AFQA 3RN2A 5C44G 4C3JH 1ASZA 2F3IA 1K83H 4POGA 3K8AA 2NZOA 1MKHA 1I5FA 4LF4Q 1HJPA 3I4OA 4JI7Q 1H95A 1GKHA 3AFPA 3KDFA 3GTOH 2PQAB 3CPFA 1K0RA 3ERSX 2R7ZH 3CF5A 5JJIA 5FJ8G 1W2BA 4BA1I 2ZTDA 3ULLA 1SFOH 3UE0A 4AIMA 1J5EL 3I4NH 3F2BA 4A3JG 4NPSA 2OTJA 5J3BA 1CSQA 4JI0Q 1Q8KA 3D31A 1UE1A 3K0XA 1EQRA 1S3OA 1GO3E 3I7FA 2LXKA 4JI1L 1PH3A 1OXUA 2R6GA 2R7DA 4X62L 5C0XJ 1Q12A 1K8GA 2UUCQ 3J7A5 2IT1A 3S1MH 1M90C 1LUZA 5LMNQ 4DV7Q 1MJEA 1GM5A 3LGJA 1IBML 1E1TA 3FKIH 4LW1A 5BR8Q 3GTGH 3W1GA 1SE8A 4AQYL 5FLMG 2VQEL 4LF9Q 5EAYA 1LYLA 3S15H 4JBWA 2XTIA 1V9PA 4YHHL 2QA4A 4HIDA 1U0LA 3PGZA 3PUXA 1Y1WG 4B3ML 4JYAL 4A3JH 3FP9A 4L5TA 1TWCH 4YWLA 4DR4L 2EQSA 5HGQA 2JA9A 1VQ7A 1LTLA 1VQBA 3RLFA 1WYDA 4DNIA 1C7YA 4B3MQ 4L5RC 2UUAQ 3PSIA 5C3EH 2ASBA 4NXNQ 1VQ9A 3A74A 5IE8A 5IP7H 1NE3A 2MQHA 1N33Q 4PG3A 4KLKA 2Z0SA 4LUOA 4A3EG 4IPCA 2JA8G 5K36G 4DV1L 3KJOA 5LMNW 1UWVA 2A1AA 2NZHA 1SLJA 4BY1G 3M85A 4HJ9A 1VQMA 2CCZA 1Q7YC 1D8LA 3UDGA 5IP9H 1HNZL 1Q81C 2JEBI 1LM0A 2NN6I 2OCEA 3I55A 5IYCH 1HNZQ 1VQNA 4K0KQ 3PO3G 3S14H 5C3EG 2E2IH 4IPDA 4B3SL 5JJKA 3G71A 4A3KG 1MJCA 4LF6L 4L5QA 4GS3A 4LFAL 3HOYG 4DR7Q 4LFBL 3ER0A 1L1OC 1YEZA 4HIKA 5C0XG 2WFWA 3H0GH 3TS2A 1O7IA 1CUKA 2PI2E 3GTKH 3KFUA 1E22A 2K52A 2K5NA 1YBYA 4NXNL 3CCSA 2A19A 1JT8A 1GVPA 4A76A 1YZ6A 5C0XI 2K75A 3U58A 3OW2A 5C4XG 1L1OB 3G6EA 4LFAQ 2ZTCA 2CWPA 3AEVA 4GN3B 1SMXA 3U4ZA 1JB7A 1X3GA 3BU2A 2UU9Q 4WJ3M 5FLXc 1KAWA 1X3EA 1E3PA 4R4IA 1W3SA 2BA1A 3AQQA 4A3KH 4LF5L 2NN6G 4YCWA 4HIMA 1TWFH 2MO1A 3GO5A 4GKKQ 3KF6B 3S1RH 4A93H 4A3LG 2YTVA 2VQFQ 1KL9A 4DV0L 2LSSA 3GD7A 3W5OA 2YV5A 1XMQL 2VL6A 3I56A 2NVYH 1OXVA 3F2CA 2UXBQ 4HJ8A 1HH2P 3CCEA 3HOXH 3F8TA 5FJ8H 4PZ6A 4LF4L 3CXCA 2VW9A 1PH8A 1PH9A 2R7ZG 4A3CH 1PH6A 1QVFA 4A3DH 2RCNA 2C35B 4GOPA 2UUBL 4TQUS 1E7ZA 3CCMA 4DUYL 2HHHL 1IZ6A 3E9IA 3CMAA 3E9HA 4AYBG 1FGUA 1XPOA 2DUDA 3RNUA 3SGIA 3KJPA 1IBLL 1WOCA 1NTGA 4JI3Q 5M3FH 4YHHQ 1EUJA 3RZOH 3HOWG 2ID0A 2JK8A 4DK6C 1IXRA 2JA6H 3I4MH 1KD1C 1U5KA 2H5XA 4DAMA 4OX9L 4X65L 3HOUH 3L0OA 4JI7L 1UEBA 2PNHA 4LUZA 4YWKA 3TEHB 2E5LQ 4AH6A 1PH1A 4X62Q 1VQGA 4A3CG 4GOPC 2OTLA 2LXJA 3KOJA 2RF4A 4JI8L 4NXML 4IOCA 3GTLH 1IBKL 1K9MC 4A3IH 2JA7H 4IJLA 3UDFA 3UDIA 4POFA 3G4SA 1NY4A 4YWMA 4A3MG 4DR1Q 1PV4A 4JI6Q 3M7NA 5GQOA 4JBKA 1PYSB 3S17H 1G51A 2HIXA 1HZCA 4IPGA 5IP7G 3F2DA 1IBKQ 2D0OA 1X54A 1SRUA 4JI8Q 1S40A 4NXMQ 1JE5A 3HOUG 2KHJA 4KHZA 1YHQA 1QUQB 1BVSA 3CCVA 3PCOB 4OXPA 4A3FG 3RR5A 1AE3A 4QGUA 4GNXA 2F4VL 1RL2A 4KI0A 5GAGC 2CQOA 4BY7H 2AMCB 2FXQA 4R4OA 3NENA 2QEXA 3CCUA 3CCLA 1QZGA 4LFBQ 5IYCG 2ZJRA 4HIOA 3T1YQ 2JEAI 4PMWA 4UPAA 4GLAC 1Q82C 5C44H 2DGYA 4IPHA 1UE6A 4JC0A 3PV0A 4MNOA 1IL2A 2MNAA 1I3QH 1JMCA 2B63G 5BR8L 4IOAA 3UE1A 2E2JH 2VS1A 2WB1E 3HFZB 1XMQQ 3K80C 1YIJA 1I6HH 3PUZA 3L2PA 3S24A 1NMGA 1JJCB 4DV5Q 1AH9A 1BBWA 3EIVA 2K4KA 4QY7A 2VQFL 1I94L 1G6PA 1XJVA 1Q1BA 1HZBA 2ZM6L 1XNRL 4HJ7A 3M4OH 1J6QA 2OQKA 1NBWA 3CCQA 1VQFA 3KDFB 1HR0L 3F1ZA 4A93G 2UXDL 2PMZE 1YITA 1XTDA 5IY0A 1QVGA 3NEMA 5IP9G 1I94Q 1G291 1VQEA 2N8NA 2WP8J 1KXLA 1PFSA 1TWAH 4DV6Q 1N32Q 1EIYB 1VQCA 3T1HL 3BZKA 1UE5A 2AHOB 3H15A 2Q2HA 2HIVA 2JJQA 4GKJL 1V43A 3T1HQ 1YJWA 1PH4A 2Q2TA 2EXDA 2KCTA 2ATWA 1YI2A 2VY3A 3MXNB 3CMEA 4DUZQ 1VQJA 3EN2A 1N36L 4JI0L 2UXCL 4UY8C 2JA6G 2HHHQ 3H3VH 4PZ7A 5M3FG 4OWXB 4JCVE 3PF4A 2CWAA 2WAQG 1N9WA 4IFDI 1HNXQ 3ICEA 3PO2G 1A0IA 2WB1G 2BA0A 4NB3A 2UUCL 2F52A 3BJUA 3GTPH 2R93H 3PF5A 1HNXL 1QZHA 3TRZA 3PIPA 2HQLA 2UUAL 5C4JH 1AE2A 5DLQE 5AJ3Q 1WJJA 2IX1A 1HNWQ 4JI3L 2Y0SE 4JBMA 1HZAA 3M4QA 1TWGH 2EIFA 2I0QA 2CKZB 4DR2Q 4P74A 4WJ4A 4B3RL 2ZJQA 1XNQQ 4BA2I 1KRTA 4DK3C 1DGSA 1QVCA 2E5LL 4YY3L 2QGQA 5GAEC 1KQSA 4LF7Q 3K7UC 1PH2A 4R4TA 4B3TL 1EFWA 4BY7G 1CKMA 4OO1G 3E0EA 5JJLA 5ELOA 1VQ8A 1VQ5A 4LF6Q 4A4IA 3HOVG 4DV0Q 1PHJA 4K0KL 4JYAQ 3K81C 5ELNA 5AJ3L 1MIUA 1TWHH 2PQAA 2E2HH 4MZ9A 4AYBE 2ZM6Q 1FJGL 1XNRQ 4DR6L 4R4QA 1L2FA 4RG1A 3PIOA 1OTCA 4ALPA 4DV5L 3PUYA 1YJNA 2V1CC 1X3FA 2VUMG 4APVA 3MEFA 1B8AA 1VQDA 4P73A 1SN8A 3HOXG 2A8VA 2GVBA 4MTNA 3KF6A 4YY3Q 3CD6A 4GKKL 5GROA 1KHIA 3OTOQ 3JAMi 5GADC 1XMOL 1C9OA 5IT9c 4DV6L 2KHIA 1R9TH 2D62A 1VQKA 4A3DG 4DAYB 3CC4A 4B3SQ 3KLWA 4XTCS 5E7NA 5M5WH 4J15A 3NELA 4XIGS 2UUBQ 1PH7A 1KRSA 4JV5L 1VQHA 2MO0A 1B7YB 1Q1EA 1JJGA 2N3SA 3HKZE 2UXBL 3M4PA 2K5HA 2I5HA 2IHFA 3M9BA 1WCMG 1YVCA 4RMFA 3J81j 3DLLA 2JA5G 3CC2A 1N32L 4LF8L 3A5ZB 2Q2UA 5LMUL 1CSPA 4DR3L 4A3MH 2UXDQ 4BY1H 1N34L 4JI2L 5HY6A 1VQIA 3U50C 4LF5Q 1X56A 3UDXA 1K8AC 1J5EQ 1CKOA 1YHBA 2AWNA 1M1KC 1PYBA 4DUZL 2IX0A 3JAMc 4P75A 1GD7A 1IYJB 1SROA 2WAQE 3GDEA 4YCVA 5M3MG 3CAMA 1XPRA 4OWTB 2R93G 2OQ0A 4Y7NH 1X55A 2RHQB 4DPGA 1BBUA 2BH8A 4IFDJ 2JE6I 1T9HA 3EBEA
chains in the Genus database with same CATH superfamily
2CHBD 2DNCA 4X65Q 3FKIB 5DAUA 2NVXH 1TS4A 2A73B 1B53A 1E2WA 1OXSC 3M4IA 4GOPB 4UP7A 2G9HD 4ME3A 3Q8DA 5T1IA 4FF3A 4QIWE 3CCJA 2VPQA 4UCVA 3TSSA 2V59A 1P8LA 2ATLA 4RCNA 1IBMQ 4UCUA 1SE2A 5DGAA 3RLOA 4WJWA 5BN4A 5CR3A 4DV1Q 1HZ9A 3A56A 1ESFA 5JVH3 5CV7A 4JBJA 3KF8B 1JR0D 1ENAA 2HVQA 2N55A 3FPPA 3OHXC 5BPFA 1G6ZA 4NDXA 4O2DA 1L1OA 2JA5H 2OWOA 1B70B 1CTMA 2RDHA 2W9BB 1XNQL 3FKIA 1I50B 1B9MA 1A63A 1KBLA 2UU9L 5KNDA 1SEIA 4HR7A 4ECQA 2AUKA 3CW2C 1KC8C 1PDQA 3GQBA 1XNQH 5C3WA 1LLRD 4RB3C 4KK7A 2W8KA 4JG2A 2NYZD 4BBRG 3SVMA 4EFEA 2HDLA 3UQ8A 2IHEA 5KG1A 2D0PA 1A3TA 4DKAC 2LS01 3A7LA 2JA7G 1JC7A 2EDGA 2KECA 1JKJB 4ZQ3A 2LMCB 3CU7A 3D4RA 2B8FA 2IW3A 3NQIA 4ZCKA 4JI2Q 1PZJD 5M5YH 4GNXB 3S1NH 3PO3H 2QYZA 5LYJF 3FHWA 1E4EB 3J80E 3PO3B 1NNXA 4GKJQ 1SNOA 3ULJA 1IBMH 4WFN3 1ZHQA 3S1QH 3QFFA 4Y7NB 2K1BA 2YRXA 5FLXW 3P75A 4C3IH 1PK8A 2WV6D 3I70A 4IO9A 1FNWA 2EOTA 5JJZA 4DUYQ 3S2DH 3MA2B 2YZMA 4V190 2ZTEA 2R7LA 4WBNF 4DV2H 1HQMC 1X9NA 5FLXE 2DLNA 3RB0A 1IW7D 3TQYA 1F77A 4K8IA 2ALYB 2CVRA 3PZPA 4LFCL 1Q8IA 1BCPD 1C4QA 2PW7A 4CKEA 2B29A 4R8UB 4DN4M 3TMEA 3KLSX 1WTQA 2FE3A 1A9XA 2R7MA 2B63A 4JV5Q 3HOYH 2IJ0A 4DR1L 1MI2A 4QQBX 4F7XA 3JAME 2B2YC 1N32H 3BYYB 4XQNA 5JEAG 1I50H 4B08A 5CA1F 3QZ8A 2C00A 4PDBA 1TWHA 1WFQA 2VOBA 4ZHQF 1HPCA 3KHHA 5IYBH 2FP4B 1IBKH 3C3LA 1DOLA 4DV7L 2NVTH 1X65A 2YCHA 4X3UA 1FD7D 1QB5D 4DL7A 2OXPA 1QE6A 4A3BG 4R4CA 3OUUA 2C2RA 2WB1A 1DM0B 1KABA 3R3OA 3VDYA 5HBRB 4ZLTF 4A2AA 3J81i 1YJ9A 3OTOL 4C3IG 1C0AA 3STBD 5LMUQ 4M1UB 3L4KA 3OTOH 4DAVA 3RLNA 1IW7C 1EQQA 4QWDA 1S0NA 3K5LA 5CB4F 1S68A 5C0XH 4TV8F 4IUTA 3GTMH 3IG0A 1VAJA 2UUBH 1PTOF 1RDPD 3J7ZC 4CDDC 4Q5VA 4X66Q 1N36Q 2V58A 5D1OA 3AFQA 3NE5B 2FLPA 4L63B 5C44G 2DWCA 2JEJA 1XDNA 4JI3H 3K8AA 4LMYA 5K36H 1BNCA 1MKHA 1I5FA 1GXDC 3I4OA 4JI7Q 3SXHA 3I4MB 1GKHA 1EY5A 3RUPA 3KDFA 3GTOH 2PQAB 4ECTA 3NP8A 1RJQA 1JQYD 4O4LF 1K0RA 3WO0A 2WTFA 4A3JB 2UVRA 2DY8A 5KFNA 2ZTDA 3ULLA 3I4NH 4AIMA 1M7JA 5CAEB 3F2BA 2BQUA 3K7AB 4BWSC 1SJED 4A3KB 4JI0Q 1UE1A 1S3OA 5CV6A 1PH3A 2B2UC 5IWAH 2R7DA 3C1FA 2WAQA 5KFVA 2CQAA 1K8GA 3FVQA 1EOTA 3QWNA 1LUZA 4ILWA 4RAYA 4RUCA 3LGJA 3L3OC 4ID6A 3RJ0A 1LYLA 4YY3H 4HIDA 1HNWQ 4UFZA 1F2LA 5CORA 3PUXA 1Q3LA 5KFJA 3BVGA 1AN8A 1FNVA 3FP9A 2ICEC 2NUCA 5DM63 1KEEA 3J7YW 2UUAQ 3HOYB 5L1JA 1DCZA 2ASBA 2R7KA 2KA7A 1VQ9A 4DAYA 3SDZA 5IE8A 3G6XA 1NE3A 2MQHA 4RCOA 3OIPA 1PFNA 3CKIB 4LUOA 4A3EG 2HGSA 4HEDA 3VR2A 5K36G 5LMNW 1UWVA 3N40P 3DEOA 4OEMB 2A1AA 2NZHA 1VQMA 4Y8VB 1D8LA 3HKZB 4J9MA 1EIGA 4K5XA 4QIWB 1Q81C 4YAKB 3I55A 2QEJC 1TR5A 1HHVA 3CHBD 3LWUA 5C3EG 5LL6S 2E2IH 4B3SL 4DV6H 2FPGB 2CQYA 4EBCA 2F0FA 4LF6L 1I6UA 3ER0A 1PRTD 1L1OC 3GIQA 1LABA 1AUXA 3CRLC 1O7IA 5IYZF 3MFYA 5D65A 4NXNL 3CCSA 3NGDA 3ETHA 1YZ6A 3U58A 3OW2A 4DL4A 1L1OB 3G6EA 4LFAQ 4KTAA 1SMXA 3U4ZA 3U9TA 3HXLA 1GHJA 3BU2A 3KLRA 4X3KA 5FLXc 2J6UA 1KAWA 3GP7A 1RKNA 2KCCA 4PV1C 4DV7H 1X3EA 3S1QB 3AQQA 4CKBA 4DV4H 4JVZA 1D1IA 2F3WA 4A3EB 5E3FA 4GKKQ 3KF6B 4A93H 1KL9A 1F9PA 4UAIA 4ECYA 1HNWH 2LSSA 4RGMA 1IOVA 2YV5A 1XMQL 1GSAA 2R82A 3IKJA 1HH2P 3HOXH 5FJ8H 2FK3A 5KT6A 4C5AA 5IOCA 1AW7A 4O2BF 5KG5A 3M9NB 3CMAA 2NUAB 4DFAA 2DUDA 3KAJA 5CMDA 1IBLL 5KFHA 4YHHQ 1EUJA 5KT7A 1FJGH 2JA6H 4DK6C 4DV5H 1DXMA 2GA4B 4OX9L 1BR9A 3HOUH 3N42B 5KFYA 2C2DA 1B44D 1HA6A 1WTXA 1ESRA 2OTLA 2KHSA 4O3PA 4MTDA 1SBBB 2SNMA 3NPPA 4ED1A 3KOJA 1H9JA 1FGBD 4A3IH 1A2TA 4IJLA 1PV4A 4N9TA 4JI6Q 1V4YA 3M7NA 2FPIB 2BR0A 2L5TA 1AZQA 4XX0B 3GIIA 4V0BA 2HIXA 5ISRA 4IPGA 5IP7G 1IBKQ 2W8LA 1X54A 2HUGA 1SSOA 1JE5A 3W3AA 2QDBA 4TV9F 5JH7F 4RB2C 4KHZA 1Y69U 1GUSA 2ENBA 2KEEA 1LTTD 2I46A 1TWFA 4OXPA 1UUPA 4EQPA 1STGA 3GIPA 1EYCA 4ED3A 5EPJA 2K04A 1STYA 3GIMA 5IYCG 4HIOA 1IYUA 3T1YQ 4C1NK 4PMWA 3T13A 4MV7A 4GC7A 4CJ1B 4FF4A 4EBEA 4NXNH 5KFQA 4F4YA 3K0YA 2EJGC 4IN3A 4MN3A 2B63G 5JPMC 3IN5A 1Y8NB 2F0UA 3MXNA 3K80C 1EU4A 1HTLD 2K32A 5DNFA 3L2PA 5JPNC 5EPKA 3S24A 1JJCB 4DV5Q 4CC5A 2UVWA 3FDTA 4QY7A 3ITPA 3I72A 2VQFL 1E4GT 4PMCA 4RH6A 1HZBA 2VPSA 1J6QA 1NBWA 1VQFA 1HR0L 2PMZE 1EY8A 5IY0A 4KN4C 4OIKA 2J6SA 1I94Q 1VQEA 1H9SB 2N8NA 3MAQA 3OW7A 2F0MA 5C3XA 5I6YA 4DV6Q 4YR2A 1S03G 2C22A 1UE5A 2EYHA 1EUDB 3T1HH 3GTMB 2Q2HA 3RF2A 1HR0H 1V43A 1D2BA 3A54A 4Q44A 5BN3A 3GTGA 5EDWA 2VY3A 4YP3A 3MXNB 3N43B 4LFAH 2I80A 4RA8A 4FYDA 3TQTA 2CH4A 4DXGA 2XRSD 1AN7A 4UY8C 2WACA 4HCEA 1H9MA 3PF4A 4IFDI 5BN5A 4A3IB 5M9OA 3PQIA 4NB3A 3TP8A 2F52A 3GTPH 3GIDA 4FM9A 1BDOA 4ZI7F 2CZGA 2HQLA 1WTPA 2UUAL 5DLQE 5C4HA 1JICA 4ECRA 3NQTA 4JBMA 1HZAA 2EIFA 3KAKA 3C2PA 5E1FA 3ETJA 4B3RL 2Q8IB 2XWJB 1Z2NX 1CFMA 1KJ9A 3QIAA 3TINA 4LF4H 4G3IA 4IUUA 5GAEC 1KQSA 2F3VA 4XZ3B 2K5QA 4X3SA 1PH2A 1EFWA 3HOXB 2TSSA 4BY7G 2L0CA 1CKMA 1XXGA 4OO1G 1EUCB 3E0EA 5A2QL 3KLSA 4LF6Q 3HOVG 1SNDA 3OWEB 1PFMA 1CA6A 4DF7A 4DNRB 1EY6A 3N44B 2R8IA 5M5WB 3VYRA 1OTCA 2XWBB 1D5XC 4DV5L 4IUPA 1X3FA 3V96A 1B8AA 4P73A 2B8GA 2H4OA 1KHIA 3H91A 3JAMi 1JORA 1C9OA 1KLUD 2D62A 5LMUH 3H6MA 3K3PA 4KD4A 4J15A 5M5WH 2FINB 3NELA 2RDJA 4XIGS 4RB1A 1PH7A 3GTQB 1KRSA 5I9PA 1VQHA 4B3TH 4C3HG 1L0YB 4EQOA 2N3SA 1Y1WA 2UXBL 3M4PA 3OPOA 3GTLB 5KFXA 5ELCA 3NSWA 1N32L 1IOWA 1DYQA 1NUCA 4L6TB 4JV1A 3Q22A 4A3MH 2HQEA 3EJIA 5C8YF 4F50A 1I3QB 4LF5Q 5C4JB 1K8AC 3UDXA 4XYMB 4YB8B 1YHBA 3RUZA 1I7LA 3JAMc 1DIKA 3P7JA 2MHVA 3DUZA 3E6ZX 1EZ1A 5JVLA 4K5VA 2WIIB 1XPRA 2OQ0A 4DPGA 1BBUA 2BH8A 4IFDJ 2O5JC 4F88A 4IUVA 5LMNL 2R86A 4YAJB 2LY7A 1CA5A 1S5DD 4GN4B 1B6SA 1VDZA 1CQJB 3GTOA 2G9DA 4RAZA 1DOMA 4B3RQ 4I65A 4RKLA 3HKSA 5IGCA 3J7AF 3I4NG 1CKNB 2IP4A 5I4DA 1MHWC 1D6EC 2ZXRA 2N49A 1GUWA 3IRBA 2D2CC 4EQNA 3A5UA 5J22A 1Y14B 5DG8A 1EFID 4JI4Q 3G6VA 1PYWD 2B2TC 4A3GB 1EWCA 4LFCQ 4B3MH 5C1PA 3GV5B 2KENA 1ZYRD 2XC9A 3K7AH 4DR6Q 1ML0D 3CVZA 1W93A 1S97A 1ICFB 1EY4A 3MFIA 4O0AA 3T1YL 3M3YH 4X66L 5KFSA 5KFKA 1Y1VH 4BBSH 1MBYA 3RZDH 3NBHB 3HOWH 3GTJB 3B6YA 5KFLA 1UE7A 3IFTA 2NTSA 1J5EH 1Q90A 3VR5A 2YTXA 4RHSA 1EYDA 1TS2A 1F2YA 1K73C 2K50A 2E5LH 1KDAA 2YU9A 4FO2A 2Y0SG 1JDBB 1P16A 1LTGD 4ZKCB 4DR7L 4J9LA 1BKBA 3PUWA 3OHBA 5COYA 3KALA 4A3IG 1VQ4A 3GV3A 3ZJYC 2NU9B 5FK9C 1ONLA 4BXXG 4DR3Q 1EYAA 3PO2H 2R93B 1E4FT 2ZJPA 2F0KA 3G6JB 1BXRA 2CW8A 2VR1A 1L0WA 2YW2A 2UXCH 4JOIC 4WORA 5LL6X 5IWAQ 3J81E 1RIPA 5KNBA 3J7AV 4OO1I 4QWCA 4ED8A 3WWVA 3TS0A 2IY5B 2JEGA 2V4DA 4CGYB 4H44C 4HNUA 3J81L 5JQWA 1PA6A 4MV4A 4EEQA 3GIJA 4QB4A 3OYYA 4J9PA 1VS0A 3CRKC 4C3HB 2J6TA 2Q2IA 3ONAB 2FMMA 3SE0A 2YRWA 2NVTB 4UP9A 1JCKB 2ZT9C 4IQZA 2A6HC 5J1ZA 1ET9A 4YCUA 5IGGA 1NJIC 4EGVA 1EYGA 4ECWA 1RTOA 2B63H 2XSCA 4ETSA 4DR2H 3EPIA 2BH2A 3LWBA 3Q6SA 1K1QA 3NTHA 2F0GA 2Z4IA 2E2DC 2R7FA 1WCMH 1VQAA 4L8JA 1KTKA 2VB3X 2F0JA 3A55A 3Q23A 3V4ZA 1SMYC 5H1SE 3AYHB 1E1OA 1Y1WH 4EBDA 2RQXA 2MGSA 3D6WA 4X6AH 4RWSC 3S2DB 1WTWA 1WSCA 3Q8PB 2R8KA 4WRDA 5KRUA 5GONF 1TWCB 5D3IB 1IKMA 3HGBA 3V4SA 4CC6A 2R3ZA 5EWGA 2GN5A 2VQEQ 3I4MG 4KKUA 5L1IA 4HNVA 3R5XA 4APMA 3DXJC 3JAMW 4DR1H 2XCAA 2EY1A 4K6DA 1Z47A 4JOIA 2YZGA 1WTOA 5L9XA 2KVMA 3W2DA 3VA7A 4KY5A 1UNSA 4KY7A 3CCRA 1R9TA 4DR2L 4OWWB 2RSOA 4LWCA 4MIUA 1EWIA 1S5FD 4QL5A 4J1MA 2YL2A 2PI2A 1XMOQ 1NMFA 3T56B 2F4VQ 4ME6A 2YS7A 1VF5C 1XX8A 4BBRH 2ES2A 1Z9FA 1JIHA 2E8GA 3LNNA 1TAEA 3W1BA 4KJOA 3H3VI 3AMUA 5M5YB 1BO0A 1N33L 1TWCA 3VR6A 5EZYF 4A3BH 5I2YA 1WTHA 1BOSA 2XIWA 3MR5A 4DK1A 3GTPA 1EEID 4DV4L 5A2QW 2CFMA 3WDNA 3DM3A 1PTOB 1SAPA 1S72A 2WYOA 3TQ1A 1UAPA 1KNAA 1O7YA 2CW0D 2X6LA 2F0PA 3RN2A 2NZOA 5IT9L 4LF4Q 3QZ7A 4X3TA 2JA8B 1I4PA 3O13A 3H94A 1Y1VA 3AFPA 5KG7A 2EPBA 5I2XA 3I91A 4JUZA 4DR7H 5KG0A 4FF2A 5IT9E 1LTAD 1JWUD 2BE5D 2I07B 5FPOA 1CHQD 3CF5A 1W2BA 4BA1I 1JDEA 2F1MA 4LK1C 3PW7A 5KT5A 1J5EL 3MXGA 2ZDGA 4A3JG 2OTJA 1E2ZA 3IL8A 1CSQA 4E6IA 1Q8KA 3K0XA 4F4WA 1EQRA 2SNSA 3I73A 1QWYA 4JI1L 1C30A 4N9PA 4RZRA 3RAQA 2UUCH 3RFCA 4X62L 1Q12A 3J7A5 4QWBA 2UU9H 2EY6A 1M90C 1MJEA 1GM5A 1IBML 1E1TA 3FKIH 5EGTA 5BR8Q 2NVXB 3GTGH 3W1GA 4C1NI 4Q8FA 2VQEL 4QCLA 2L55A 4DK0A 4JYAL 2QA4A 2TMPA 1U0LA 1V8QA 4B3ML 1TQOA 5D1OB 5KFGA 4YR0A 3MR6A 4TQSA 3OSPA 4L5TA 5KFBA 5BMVF 4DV1H 1KJJA 2JA9A 1VQ7A 1LTLA 1R4QB 3URYA 1CHPD 4AYBB 1C7YA 3G8CA 4JV0A 1SE3A 1E2VA 1IHZA 4IUNA 4DXFA 1WD1A 1N33Q 1I50A 2BDNA 3TIGA 4DV1L 3SHLA 2MPMA 1LTRD 1SLJA 3FDSA 2CCZA 3V2TA 4JYAH 3UDGA 1HNZL 5KFCA 2JEBI 3MR3A 1LM0A 2NN6I 1U4MA 2OCEA 3UFXB 1T3NA 2M9VA 2W9AA 4K0KQ 2ZXPA 3ND8A 3OOCA 4JW0A 2FLLA 4IPDA 4K14A 2AU0A 4X62H 3HOYG 4DR7Q 3EA6A 1T5XD 4NMZA 1PZKD 2ASDA 5C0XG 3S1RB 1IL8A 4AYBA 4ABNA 2RDGA 2K5NA 4OO1H 2A19A 2PW5A 1GVPA 3K5MA 3TZUA 3K5OA 3HRZC 4DR3H 1SYEA 3DWPA 2UU9Q 3PW5A 2HVSA 3KTMA 3AU7A 2BA1A 1CM9A 4LF5L 4HIMA 2WKDA 4YCWA 1GHKA 2MO1A 3GO5A 4MV8A 4P2CB 5KFPA 4A3LG 5HGTA 1PX2A 4DV0L 3T51B 3OMGA 4IR1A 2KQ3A 3GD7A 3PR5B 4KY6A 2RVLA 2VL6A 1DZ1A 4QWAA 1OXVA 4HJ8A 3N41B 5KFWA 4PZ6A 2R7ZG 1PH6A 3H0GB 4RGNA 4DUYL 1IZ6A 4J9KA 4AYBG 1FGUA 1OO9B 1XPOA 1N33H 1KJQA 3RNUA 2PZWA 3SGIA 5CGKA 4R8UA 2FLNA 1NTGA 5M3FH 2PVPA 5LL6b 2KCNA 1CQIB 3HOWG 2JK8A 4IAJA 4FXDA 4JI7H 2H5XA 1EY7A 2PZUA 4DAMA 3T5KA 3L0OA 2V5AA 4CBVA 1UEBA 2PNHA 2JA6B 4C3JB 4X62Q 2AGQA 2LXJA 2RF4A 4NXML 3VYSA 3GTLH 2KSWA 2EVBA 4POFA 3UDIA 1NY4A 3GILA 5C3EB 5GQOA 3NK9A 1GJXA 1TWAA 1V1OA 1SYXB 2D0OA 4JI8Q 1SRUA 1S40A 5DG7A 3HOUG 2UVVA 4B3RH 4NXMH 2KHJA 1B3QA 3GTQA 3CQZA 1BVSA 3CCVA 2YS6A 4QGUA 4YJ3F 3NUCA 4BS9A 2F4VL 1N56A 1RL2A 2A69D 3M9OB 4IR9A 2QEXA 3CCUA 1YNJD 2FB9A 1EY0A 3T16A 2NVQB 2JEAI 1KC7A 2AGPA 3K6OA 1O80A 3S1NB 1A6XA 1UE6A 1IL2A 4MNOA 4DUYH 3RBEA 4C3JG 2E2IA 4PQXA 5TSSA 4QW8A 1SFOB 1JMCA 4IOAA 2VS1A 2WB1E 1TWAB 4IRDA 2XRQD 3GV6A 1I6HH 3PUZA 3ORQA 2J9GA 2QW7A 2K4KA 3AB9A 1IKLA 1Q1BA 2DJFC 3CQZB 4OIJA 4HJ7A 4PMBA 4XYOA 2EYOA 1QCBD 3CCQA 1AP0A 3KDFB 4TRDA 4LF5H 4A93G 2UXDL 1EYZA 3NEMA 1G291 4XQQA 2WP8J 1KXLA 1W6KA 1PFSA 1GSHA 1JXLA 1HA5A 2F0VA 1C3OA 1Z2PX 3KUPA 2ASLA 3H15A 4ECXA 1JB3A 2HIVA 4GKJL 1S5ED 3T1HQ 5KYIA 2IBKA 2JEIA 2Q2TA 1K8OA 2KCTA 3GTPB 2FK2A 2XCLA 4DR4H 1G91A 1GUOA 2K03A 3EN2A 4DUZQ 4JI0L 2K6AA 2JA6G 3A8IE 1NSNS 4HTHA 1ZQ7A 4I4TF 3R5FA 2WAQG 4RUAA 1HNXQ 2JA7B 1A0IA 4CKCA 4RFBA 3FPUB 1Z6HA 1STEA 2WB1G 3KF8A 1B50A 1HUNA 2BE5C 4FNFA 4R7RA 2Z9HA 3PF5A 2R84A 3KHRA 5M3MB 5C4JH 4HSPA 3DMUA 3QOJA 2IX1A 2Y0SE 1TT2A 2NWGA 2IA6A 1SCUB 3RZOB 2A69C 1I4RA 2I0QA 2ZJQA 1M6VA 1KRTA 3HKZA 1DGSA 3A8JE 3HP3A 4LF7Q 2SDFA 1RODA 2EZVA 4EYHB 1S9FA 4CJ2C 5EKLA 1PTOC 5JJLA 4ZUIA 4A4IA 1PHJA 1M8AA 2F0NA 2WAQB 1Y8PB 1GYFA 1MIUA 1TWHH 1S0OA 2SEBD 4AYBE 5ELDA 1FJGL 4DR6L 1JWSD 4IZ8A 1M4VA 2NVYB 4R4QA 1CS0A 4DUZH 2AGOA 2E74C 3VPCA 1S0MA 1YJNA 2VUMG 4M7EA 4APVA 2J7ZA 2RGRA 4RB0A 2I8CA 1JX4A 3S15B 2B39A 4MTNA 3KF6A 3CD6A 2GPWA 4JK1C 4YBZB 2HHHH 4O3RA 1R9TH 4DAYB 1LT5D 4ZRZA 3J80W 2K05A 4OELB 1LTBD 4ZQIA 2VUGA 4JV5L 2E2HB 5F9LA 2EY5A 2MO0A 1M0TA 3F8NA 3BVZA 2ZDHA 2C28A 4ULLA 4QIWA 2IHFA 2W7PA 4RMFA 1WVLA 3Q8RB 3CC2A 5LMUL 3LP8A 2UXDQ 3R2IA 5J2UF 3I3CA 3HOUB 2R92B 5C5JA 1X56A 2XNAC 3R93A 1R4PB 2A6HD 4J9NA 1PYBA 2LFNA 3PMFA 4DUZL 4LF6H 1IYJB 1SROA 2WAQE 3GDEA 4YCVA 3RB4A 4E4TA 1RK6A 5M3MG 4OWTB 1RF2D 1X55A 2JE6I 1U9RA 4O3NA 1T9HA 4ZYSA 2VUMH 4RZQA 5KG4A 5DLGA 1D5ZC 5KFIA 3BZCA 3RV3A 4RAUC 1FL0A 1XTCD 2K14A 1YNXA 3OSOA 1Z2OX 1LACA 3S17B 4IRKA 4RNNA 1A62A 4AQYQ 4GKJH 4IWYA 4OGQC 3S1MB 3OHAA 4UP8A 4GKKH 1ASYA 2JQOA 1TU2B 3ERQA 4MA5A 3GTLA 2HD3A 1EOVA 3FKIG 2K5WA 4LNQA 1TY2A 4JI4L 1V1PB 1KDCA 4HJAA 1EQVA 2HVRA 1B1ZA 2N78A 2UUAH 4DV2Q 4O4IF 2M00A 4GLVB 5IGBA 3GTJH 2YU9H 3JC66 2XN9C 4FDBA 3T5HA 3TREA 2JP1A 2R8HA 1T5EA 3MFGA 1KIXA 4P71A 2NB0A 4YIJA 1B6RA 1VBGA 1BNZA 3VA5A 2X6GA 1TIID 3LMLA 4NKLA 2WKCA 4H13C 1DJRD 1RYRA 2NVXA 5M5XB 1ZHSA 2AKWB 1TKWB 2Y0SB 3QR8A 3CP0A 5LXTF 1STBA 4JI2H 3J80c 4C2MH 3HOVH 3GTGB 3J81W 5KGUA 1CKNA 1RD9D 3J80L 3TP6A 4Q43A 1K83A 4JI5L 4UCOA 3L4JA 4IJHA 2PMZA 1CQFA 4OL7A 4H02A 3MFHA 2B2WA 2LKVA 1E24A 4KHPL 4LF9H 2OF1A 1EZ8A 3TP7A 5I6WA 3H40A 1FR3A 4AQYH 4EX5A 3I12A 1PMRA 5M5XH 3KHGA 1Q86C 1PRTF 3K58A 4I7ZC 3NBHA 4DAPA 2JA8H 3S16H 2Z6BA 3S2HH 4KKSA 1V1QA 4X64L 2RGVA 4KV6A 1XPUA 3HOZB 4A3GG 2HDMA 5J2TF 5L37A 2JYOA 2R92G 1BJTA 2NU6B 3E5NA 1RJPA 4A75A 1A2UA 3CQZH 4I7AA 4LF7H 1QNKA 5KFAA 3GTQH 2VNUD 4JV5H 3GTKA 4KD3A 1SYDA 2PO4A 2ZXOA 5CV8A 4CJ0B 1HR0W 3H0GG 1TWGB 1I94H 4TUYF 4ZUJA 3H20A 2K33A 3S2HB 3H4BA 5EBDA 4LF9L 5E4WC 1SYFA 4A3DB 4DV0H 3KBGA 2RHSB 4A3EH 3RGZA 1UNNC 4OONA 1SDFA 3X3NA 2EXZA 1X6OA 2F0LA 3A0JA 5GAHC 2KCMA 4UHVA 3N6XA 2H1EA 1PFBA 3BQ1A 1WR2A 4UCTA 2UXCQ 4B9WA 2K01A 1NAPA 1OXXK 4N8X1 4ZKBB 4P72A 3U4VA 3MVVA 1XMOH 4HSVA 4DV2L 2FK1A 2KBNA 1BCPF 1VBHA 1GGOA 5BPHA 4LFBH 2EYFA 4KHPQ 1E0BA 5KNCA 1X32A 3BVMA 3PIP3 1HCZA 4Y52H 2VA3A 1IBLH 4ME5A 2YYZA 5I47A 1SR3A 5D3DA 3C0FB 4J8QA 4U7CA 4DLKA 1VCIA 2AWOA 2UXBH 4QMGA 1K3RA 2R92H 4HJ5A 3GQCA 3BQ0A 2R7ZA 1EY9A 2PNRC 5C4XH 3EYYA 2O03A 1YHAA 1N36H 4BXXH 1EU3A 1J8IA 2X0SA 1FVIA 4UCRA 1VQLA 4DR5Q 4C3JH 4HR7B 1RJTA 2F3IA 1BF4A 1BGWA 3P1HA 2F0QA 3M4OB 5JOBA 5A2QE 1JWMD 5DGBA 3CPFA 4J0MA 2F0DA 1AUVA 3PVXA 1RYSA 1HFGA 1R9TB 2BDOA 2W6ZA 3UE0A 2ZM6H 1XNRH 1QNUA 2FPPB 4ZAIA 5J3BA 3D31A 1TA8A 1ZETA 5C44B 1EHIA 2FMAA 4JI0H 4C3IB 4ED0A 1WD0A 5K2MA 1OXUA 2R6GA 3D6CA 5C0XJ 4QUCA 4DV3H 4MHEA 1RHPA 2IT1A 5BR8H 3HB9A 4PNYA 1D5MC 4AQYL 4LF9Q 3S15H 3OSNA 2XTIA 1V9PA 1Y1WG 2KEDA 3T1YH 4A3JH 5CBEE 2NN6H 5KEEA 1S4ZA 4KHPH 2EQSA 3OIQA 5HGQA 1GSOA 1VQBA 4DNIA 2IL8A 3RLFA 3BA8A 4B3MQ 2M2LA 4L5RC 2JSOA 3BA9A 3Q0AA 5LA6F 3PW0A 4Z9CB 5EBCA 3A74A 3VYTA 3N52A 2W6MA 4KLKA 5FO7B 1B3AA 2W70A 4PWQA 1ZEQX 4IPCA 4DR5H 1Y1VB 4BBSB 3KJOA 3DM1A 1I4GA 5C6AA 2V4RA 4XQJA 5LP6F 4BY1G 5LHY1 1C8CA 4HJ9A 4WD3A 2G5DA 4C56C 2RBMA 1U4PA 1Q7YC 1EL0A 5IP9H 3RTXA 2F0HA 2EYJA 4BY1B 2M05A 3KXYT 5IYCH 3PO3G 2C9OA 2SCUB 3G71A 4A3KG 1MJCA 4LFBL 4L5QA 1WH2A 4LFAL 1D1KA 4MTEA 1YEZA 4HIKA 1OWTA 2RCFA 2WFWA 3TS2A 4FXGC 1CUKA 2PI2E 3GTKH 1JT8A 2JA7A 1YBYA 1F9QA 4HCSA 4A76A 3T5LA 5C0XI 2K75A 1B04A 3OUZA 1FYCA 2ZTCA 1LV9A 2J0TD 4GN3B 5FLXL 3AEVA 1JB7A 1X3GA 1ULZA 2OH2A 3GV8B 5KT3A 3PW2A 5AFWA 2F0SA 4XT1B 2NN6G 2FJZA 4EGQA 1TWFH 1JE4A 2RSNA 1TY0A 1GLVA 4FBTA 2YTVA 3TN2A 2KUMA 2NTTA 3VR4A 3W5OA 4DU9A 2GLTA 4GC6A 3I56A 1QJOA 4F4ZA 3F2CA 3CCEA 2W6QA 4GZYC 3F8TA 3MXPA 2VW9A 2A68C 1PH8A 4A3CH 1QVFA 1DD2A 1S5CD 5KFFA 2UUBL 3CCMA 1KAAA 4RHRA 2V9WA 3I8ZA 2CH4W 4JV2A 4IUQA 3KJPA 3OWFA 4JYAQ 2L1BA 3BDOA 4TKOB 1ENCA 1ET6A 1JOOA 2PMZB 1KD1C 2OEOA 5KFTA 2L11A 2Z8LA 4X65L 1GUNA 5FO8B 2NU8B 2R7NA 1I6VC 4LUZA 3TEHB 2F03A 4AH6A 1PH1A 1VQGA 4MV6A 2W7OA 1I6HB 1EIHA 2F0OA 3RV4A 2R8GA 2R93A 4IOCA 2C5CA 4O3OA 1B9NA 3UDFA 3G4SA 1EQTA 4A3MG 4YWMA 1II3A 4FF1A 4DR1Q 2NU7B 1LT6D 2X69A 2VB2X 4JBKA 1PYSB 3EFXD 3S17H 1G51A 3F2DA 2W9CA 1SYCA 4ODGA 1SJHD 2A74C 3IFDA 4M9UA 5KG2A 3RR5A 3H09A 3QG1A 1WCMA 1G2TA 4LAAA 2VUMB 4GNXA 1SE4A 1B4OA 1EEFD 2DNEA 2B2TA 2A5HA 2CQOA 2IX3A 4LFBQ 4G7ZC 2ZJRA 1HNXH 4GLAC 1Z7TA 5C44H 3A7AB 4IPHA 3ZYYX 4LFCH 5CA0F 4ED6A 2MNAA 4IWXA 3BDLA 3D8GA 2FHTA 3UE1A 2L12A 3Q2OA 2W9BA 1PZID 1BBWA 1I94L 1UC9A 1G6PA 3MHBA 4CDFC 2A6EC 1XJVA 2I87A 4Q8EA 4LH7A 2HCIA 3SR1A 3M4OH 2JA5B 2OQKA 4K2KA 4DA2A 5IGEA 1QVGA 3QB3A 1GUTA 1N48A 3BS1A 5K5PA 5KKNB 1KDBA 1N32Q 2EYMA 1BCPC 1EIYB 1O78A 1VQCA 3NTKA 2B63B 3T1HL 5C4XB 3BZKA 3GV7B 3V6JA 2DIKA 2AHOB 2VQEH 1CQVA 2JJQA 2DJGC 1YJWA 3K59A 1PH4A 4X64H 2EXDA 2ATWA 3HBLA 1F2MA 2PBZA 4R8IA 1KNEA 3CMEA 1G2SA 4JI1H 3RBDA 1V51A 5KX5F 2P0AA 3H3VH 4PZ7A 5LMNH 3Q8QB 4OWXB 3I4NB 5G3LD 2CWAA 1N9WA 3PO2G 3MXUA 1SFOA 4HYKA 4F87A 2IMWP 2KJXA 4Q0FA 3JAML 5JVDF 3PO2B 3KK7A 2R93H 2R61A 2SOBA 1HNXL 2OLSA 3PIPA 1S10A 3VMMA 1AE2A 5AJ3Q 2ICIA 4U673 1YNJC 2N88A 5FO9B 2E76C 5HV6A 2XD4A 1TWGH 5KT2A 1LT3D 1GUGA 3RZDB 2CKZB 4WJ4A 4P74A 3JRXA 2AQ4A 4ECVA 4ED7A 4BA2I 1I4HA 4DK3C 4YY3L 3K7UC 1K83B 4B3TL 3DF7A 5L1KA 1AFPA 3T4AC 3HS0C 3Q1KA 1PTOD 3JSLA 3DWAA 4O3SA 4C5BA 1TVXA 3NWTA 5DQIA 4JI6H 1WTVA 2E2JB 4K0KL 4YQWA 1MSHA 3MC0B 5ELNA 2PQAA 1S5BD 1L2FA 3WOFA 2V1CC 4FS2A 1VQDA 1SN8A 4HNTA 3HOXG 2A8VA 1BXTA 2GVBA 1MD2D 1STNA 1O7LA 4BY7B 1NR4A 4GKKL 2XIGA 5JUMA 1XMOL 1SXTA 3NTIA 2F4VH 5IT9c 1VQKA 2KHIA 4A3DG 5KIXA 4FBUA 1EWHA 2MCTA 3CC4A 3MTSA 3KLWA 4XTCS 5E7NA 3ND9A 2B2UA 2AUJD 3H0GA 3D4DA 4XYQA 4B9XA 1B7YB 5DM73 1Q1EA 5T14A 3HKZE 3PN1A 4LH6A 4RU9A 2ALZA 2BCOA 3M9BA 1YVCA 4LJZC 3J81j 3DLLA 1L0XB 3VR3A 4LF8L 3A5ZB 2AQ2B 2Q2UA 1CZWA 4FXKC 3DEPA 5IIFA 1CSPA 1CK1A 3Q8SB 4BY1H 1STHA 1N34L 4J9SA 1YNNC 4CDCC 5FKAC 2HCCA 4EFBA 1J5EQ 1CKOA 1M1KC 1HFNA 3E5SA 5IODA 1PTOH 1HTPA 2EJFC 4K0KH 3CAMA 5KYLA 3JZIA 5KFRA 3MWYW 4Y7NH 2RHQB 4BBRB 2RA4A 3S9WA 2A6ED 4R1JA 4G7HC 2HJWA 4J9QA 5KG6A 3TP5A 2AQ3B 3JRWA 3NWSA 1Q46A 3J80i 2MFIA 3SEBA 2L4NA 4JI1Q 2NZ1D 2NVQH 5DLFA 4DR4Q 2Z6KA 4QJFA 4DV3Q 4MTKA 2RDFA 4F8MA 3V6KA 4DGZA 5KFUA 1ILPA 1JOQA 3MEHA 1B33N 2I5LX 1RCVD 2B3GA 2PQEA 3BABA 1F9SA 2O2LD 2DPIA 1KJ8A 2K5VA 3BAAA 2Q8RE 4U68A 3ULPA 2R92A 5IYBG 4B3TQ 3SE7A 2Z6KC 5IYDH 3I2ZA 3H3VC 3K3VA 5D14A 1E4EA 4DR6H 2BQ3A 3ORRA 1GOZA 3MWDA 2FJ2A 4GN5A 4EQ5A 1X3PA 2W9CB 2JA6A 2D9UA 3S14B 3K57A 3K5HA 1EIFA 4X66H 1PVOA 4KJNA 1BBXC 3CPWA 1NR2A 3EVQA 3BYTB 3DWQA 1WCMB 2EYPA 5IWAL 3IAYA 1K0SA 4YJ2F 5H80A 1HNZH 1HUMA 3I4LA 2DN8A 4LSAA 2PZTA 3HOZG 4DR5L 3EROA 2ZJTA 3M4YA 4GNXC 2L15A 5CV9A 1DONA 1HR0Q 1JJ2A 4I7HA 3CC7A 1N34H 1A8VA 3V05A 1UEAB 3FMCA 1N34Q 2GPSA 1N8RC 2O4XA 4C3HH 3PUVA 1ZXTA 3HKZG 4TVAB 5C5MA 4LF8Q 1D7QA 3F2UA 5F9NA 2I5MX 4A3FH 2HT1A 4QWEA 1VQPA 3RD4A 2PYKA 2QK4A 2CW0C 4OX9Q 2VQFH 4J9OA 3NHHA 5CV4A 2YTYA 4DV3L 2RKSA 1IBLQ 4ED2A 5IYDG 3J81c 4MAMA 2K7VA 3M7GA 2FMCA 2VZAA 3PR4A 3RGXA 1EZ6A 2YZNA 3BDCA 4C5CA 3H4DA 2QKIC 2UVUA 2B2WC 5JEAH 4A3LH 3D0FA 3K5NA 5FPRA 1U4LA 1WI5A 3STBC 5JEAJ 1QUQA 1ZKOA 4DL3A 4HQ6A 4JI5Q 4LUVA 3KHLA 3JSNA 5C1OA 4ZOLF 4IFDG 5L1LA 2WDTA 2EJMA 1FJGQ 3HOZH 4FS1A 1VQOA 4PZ8A 4ECUA 1FKAH 3L7ZC 4JI6L 2BQRA 3U9OA 4A3GH 1OXTA 2JEFA 2VA2A 4IRCA 1HNWL 3RN5A 5A35A 2CW7A 2W6PA 5IGFA 4C2MA 4K5WA 1PH5A 1K28A 4G4KA 1XWEA 4XXEA 5M3MH 4X64Q 4LF7L 1CE8A 3V6HA 4G7OC 1T36A 3BZDB 4YR3A 5J39A 3RB3A 2VXWA 4EYIB 4DV4Q 4OX9H 2FKLA 1Y1VG 4BBSG 1W6JA 1I4XA 1TWFB 4I50F 1MGSA 5FD5A 3HZXA 5I9OA 1C48A 4QUFA 1DV1A 5FLMH 3MWMA 3TIIA 1VQ6A 2E2HA 1MSGA 2YYAA 1KLGD 4QF4A 2R87A 1U4RA 3G48A 3GTKB 3X3MA 2GVAA 2QDLA 3R2TA 5EKKA 5F2DA 4GLXA 4IZOA 4DL5A 1XMQH 5KT4A 2C2EA 1HXYD 2XGTA 4FVMA 2WINB 3KYHC 5NUCA 1TXYA 4L5SA 5EJWA 1RK5A 1ASZA 1K83H 3TDQA 3WOEA 4POGA 1TWGA 2VQDA 3GTJA 1H95A 1HJPA 4A3BB 5E4XA 5EKIA 2XGPA 5KFMA 5KFZA 4RGOS 2NVYA 3ERSX 2R7ZH 2VUMA 5JJIA 2K5DA 5FJ8G 2EY2A 1SFOH 4EGJA 1TS5A 4J9RA 4NPSA 4K2LA 2JN4A 1K3BC 1GO3E 3I7FA 2LXKA 1LO5D 5JVG3 4ZK9B 2V4QA 2IPKD 2UUCQ 2D5DA 3S1MH 2O5IC 4UCSA 5LMNQ 4DV7Q 2W6NA 4LW1A 2QF7A 1SNMA 1SE8A 1A3VA 3FRPB 5FLMG 2OT2A 1F2ZA 5EAYA 4EG0A 4JBWA 3NXWA 4YHHL 1JLLB 3PGZA 2QILA 4Q45A 2R7ZB 2Z1CA 3PW4A 4J6HA 4JI4H 4DR4L 1TWCH 4K8JA 4FP5D 4YWLA 3SK8A 2E2IB 5EQ0A 1WYDA 4G57A 1BUVT 3PSIA 5C3EH 3N8DA 4NXNQ 2W57A 5IP7H 4PG3A 1MZBA 2Z0SA 3GIKA 2F0TA 1SNCA 5M3FB 2JA8G 1O75A 3MR2A 4KN7C 2R85A 1IYVA 2UXDH 4HMIA 3M85A 1Y1WB 4YHHH 1HRJA 1STAA 4UDUC 1VQNA 1HNZQ 1KJIA 4DL2A 2ZDQA 2F0IA 4CDEC 2RDIA 3VPDA 3C1EA 2PPBC 3S14H 5JJKA 3BG5A 3L9AX 1VMPA 3D3RA 4GS3A 1H9KA 1SYGA 3EQLC 1I3QA 2XVSA 1J9OA 3H0GH 3KFUA 1E22A 2K52A 3KBXA 3BG3A 1O7ZA 4U6PA 5C4XG 3BJYA 4LF8H 2CWPA 3J7AK 3R5HA 2MUYA 1ENFA 4L1KA 2MP1A 1Y8OB 4WJ3M 4IALA 1K8MA 3P20A 1E3PA 4R4IA 3MJFA 1DOKA 1W3SA 5ELFA 4A3KH 1TWHB 1RTNA 4M8AA 3FEWX 3S1RH 2VQFQ 2QCPX 4MV1A 3C46A 5JAVA 5D1PA 3T53B 2NVYH 2UXBQ 4QW9A 1PXUA 1B2TA 4N8FA 2WB1B 4LF4L 1TS3A 5ELBA 3CXCA 1UC8A 1PH9A 2BOSA 3Q24A 2RCNA 1X3QA 2C35B 4GOPA 4TQUS 1E7ZA 2HHHL 4A3DH 3E9IA 3E9HA 3U9SA 3RB6A 1CT1D 2KOLA 3HOWB 3BQ2A 1M0WA 1RJRA 1I4QA 1WOCA 5FOBB 4JI3Q 5IT9W 3RZOH 2ID0A 3QO2A 1IXRA 3I4MH 1U5KA 4H0LC 4O42A 2PN1A 5CYUA 3SK4A 4OHJA 4XT3B 2F0WA 4JI7L 2DZDA 3NBIA 3G7LA 3WNZA 4YWKA 1A3UA 2E5LQ 5FD6A 4A3CG 4GOPC 1XYIA 3SI8A 5DQHA 4JI8L 1IBKL 4FU0A 2A68D 4NP5A 1K9MC 2JA7H 1ICWA 4RNOA 2FFKB 2E75C 2Z4HA 3LX0A 4TSSA 3R8BA 4IHJF 2B2VC 1HZCA 2UXCL 5C4ZA 4NXMQ 1SMYD 4A3FB 2EYLA 4JI8H 5EOYA 4EEYA 2JXMB 4ECSA 1YHQA 1QUQB 4O3QA 2P5ZX 4A3FG 3PCOB 1H9SA 1AE3A 2AQ1B 1ZYRC 5CV5A 3MWEA 1ILQA 4KI0A 5GAGC 4BY7H 2AMCB 2FXQA 4R4OA 3NENA 3CCLA 1QZGA 4RNMA 3E0JA 4RKBA 1K1SA 3GTMA 1Q82C 4UPAA 2DGYA 4B3SH 4HN7A 4JC0A 3PV0A 3EPGA 4CHTB 4C2MB 3HOVB 1I3QH 2PCFB 5C5LA 5BR8L 2E2JH 4LMQD 3HFZB 1XMQQ 3M9MB 2L9HA 1YIJA 1T94A 1NMGA 1AH9A 3EIVA 4EVOA 4JI5H 3VPBA 2ZM6L 1XNRL 1AEXA 1SNQA 3HEJA 4A3MB 3F1ZA 3DHQA 5HURA 1YITA 1XTDA 2R6FA 1W96A 4KMUC 5IP9G 1CI3M 4LSXA 2W71A 1TWAH 2YU9B 5EPLA 1I7NA 1JOKA 2B2VA 2IWHA 1QOHA 2NBFA 2WE6A 3G6YA 3SK6A 1YI2A 1VQJA 1N36L 2B2YA 3QJYA 4O4HF 4I55F 4A93B 2HHHQ 5M3FG 1LTID 5CBAE 4JCVE 4XDXA 4NLGA 2MJ8A 4RGTA 3ICEA 3LWEA 2EE1A 2ASJA 2BA0A 2UUCL 2Q8TA 3BJUA 1LTSD 1V1PA 2JA5A 1DV2A 1VMCA 1VF7A 4R9WA 1QZHA 3TRZA 1WJJA 4MA0A 2J4XA 4JI3L 3M4QA 4KKTA 2DY7A 1L2ZA 4MV3A 3K5IA 4R8NA 4DR2Q 4DL6A 1XNQQ 4BWGB 1VKZA 1QVCA 2E5LL 5CC4A 3A8KE 2QGQA 1A15A 2XGQA 1F9RA 4R4TA 1H9RA 1AZPA 3HG9A 3RAXA 5LOVF 4O2AF 1QG7A 1BQQT 3MZ5A 3I90A 4JPBW 4K6LA 5ELOA 1VQ5A 1VQ8A 4IFDH 5T1GA 4DV0Q 1SYBA 2Y0SA 4MV9A 4H7BA 5DEHA 2F0EA 5ELEA 3SK5A 1QILA 3K81C 4XYLB 4X65H 4ECZA 3N6RA 2XCPA 5AJ3L 1CZGA 3GLKA 2E2HH 4MZ9A 2ZM6Q 1BCPB 1XNRQ 1SNPA 1HQRD 4RG1A 3PIOA 5G3LF 4ALPA 2DPJA 1PLFA 3PUYA 2K28A 5KFOA 1SEBD 3MEFA 3D4WA 5IGDA 4S3SA 5DG9A 3QOLA 3OMCA 4YY3Q 5GROA 3OTOQ 5KG3A 3RMHA 5EWFA 5GADC 4A2BA 4DV6L 1WTRA 4F4XA 2F4IA 4O1NA 4B3SQ 1G8ZD 3T5JA 3GTOB 1NCVA 3UI2A 2UUBQ 4TQRA 4KHVA 2R8JA 1JJGA 4HAEA 1LT4D 2K5HA 2I5HA 5D8DA 1WCMG 3FMAA 3R23A 2JA5G 3M3YB 3WO1A 3TBIB 3E3XA 1FNUA 4DR3L 5EWEA 1PRTB 4JI2L 4Q0YA 5HY6A 3VYUA 1VQIA 3U50C 1YNND 4DNTB 5KFEA 4HMJA 2AWNA 3TZDA 2IX0A 4P75A 1GD7A 2W6OA 5KFDA 4NW2A 3PIO3 4IURA 5DQGA 2R93G 3RIZA 1PRTC 3S16B 3EBEA
chains in the Genus database with same CATH topology
4R1JA 5LMNL 4X65Q 2VUMH 2NVXH 4GN4B 1OXSC 4GOPB 4UP7A 4ME3A 1Q46A 3Q8DA 2MFIA 3J80i 4JI1Q 2NVQH 4B3RQ 3BZCA 3HKSA 4QIWE 2Z6KA 4DR4Q 1FL0A 2K14A 3I4NG 1YNXA 4QJFA 3CCJA 1CKNB 4DV3Q 2N49A 1A62A 4AQYQ 1P8LA 3IRBA 3A5UA 1Y14B 1IBMQ 2I5LX 4UP8A 4JI4Q 2B3GA 3RLOA 2JQOA 4DV1Q 1ASYA 1HZ9A 4LFCQ 2K5VA 4JBJA 3KF8B 1EOVA 3ULPA 3FKIG 2KENA 4LNQA 5IYBG 4JI4L 4B3TQ 3K7AH 4DR6Q 2Z6KC 4O2DA 3I2ZA 4HJAA 5IYDH 1L1OA 2JA5H 2OWOA 1B70B 2N78A 4DV2Q 1XNQL 4GLVB 2YU9H 3GTJH 4GN5A 4O0AA 3T1YL 4EQ5A 3JC66 4FDBA 4X66L 3M3YH 1A63A 1Y1VH 3TREA 3RZDH 2UU9L 4BBSH 3NBHB 1EIFA 3HOWH 3B6YA 3CW2C 1PVOA 1KC8C 3CPWA 1UE7A 1KIXA 4P71A 4JG2A 4BBRG 2YTXA 5IWAL 1K73C 2K50A 2IHEA 3HOZG 4DR5L 2Y0SG 1P16A 4DR7L 2D0PA 1BKBA 3PUWA 4GNXC 2L15A 2AKWB 4DKAC 4A3IG 2JA7G 1VQ4A 3CP0A 1JJ2A 1HR0Q 3CC7A 3J80c 1A8VA 4C2MH 3ZJYC 3HOVH 1CKNA 4JI2Q 1N34Q 5M5YH 1N8RC 3S1NH 4BXXG 4GNXB 4DR3Q 3PO2H 4C3HH 3PUVA 4TVAB 3HKZG 2ZJPA 3PO3H 1L0WA 4LF8Q 1D7QA 4JI5L 4JOIC 2I5MX 4IJHA 3FHWA 4A3FH 2HT1A 1VQPA 5IWAQ 4H02A 4OO1I 1RIPA 4GKJQ 4KHPL 1E24A 3WWVA 3ULJA 4OX9Q 3TS0A 2IY5B 2YTYA 3S1QH 4DV3L 4EX5A 1PA6A 5M5XH 1IBLQ 5IYDG 3OYYA 3J81c 1VS0A 4C3IH 1Q86C 2VZAA 4IO9A 3S2DH 2Q2IA 4DUYQ 2ZTEA 3S16H 2JA8H 4UP9A 1X9NA 3S2HH 1V1QA 4X64L 1NJIC 4YCUA 1EYGA 1XPUA 4A3GG 4A3LH 3TQYA 3D0FA 2B63H 2ALYB 4LFCL 1WI5A 3STBC 5JEAJ 1QUQA 4JI5Q 2R92G 4LUVA 2BH2A 2B29A 4A75A 4IFDG 2R7FA 1WCMH 1VQAA 1FJGQ 3HOZH 1VQOA 3CQZH 4PZ8A 3HOYH 5H1SE 3AYHB 1E1OA 4DR1L 1Y1WH 4JV5Q 3GTQH 3L7ZC 2VNUD 4JI6L 4QQBX 4X6AH 1HR0W 3H0GG 5JEAG 1I50H 1OXTA 4A3GH 1WFQA 1HNWL 3RN5A 2GN5A 2VQEQ 4LF9L 5IYBH 1PH5A 3I4MG 2RHSB 5M3MH 4X64Q 4A3EH 4DV7L 4OONA 4LF7L 2NVTH 1X65A 1Z47A 4JOIA 1X6OA 3A0JA 5GAHC 2KCMA 3CCRA 4A3BG 4R4CA 4DR2L 4OWWB 4LWCA 2UXCQ 1EWIA 1OXXK 4DV4Q 3VDYA 4P72A 3U4VA 1Y1VG 4BBSG 4QL5A 4DV2L 2PI2A 2KBNA 1NMFA 1XMOQ 3J81i 1YJ9A 3OTOL 2F4VQ 1C0AA 3STBD 5LMUQ 4BBRH 4KHPQ 2ES2A 1Z9FA 3RLNA 2E8GA 1EQQA 4Y52H 3W1BA 5FLMH 3H3VI 1VQ6A 2YYZA 1N33L 1SR3A 4A3BH 1VCIA 2AWOA 3GTMH 3G48A 1K3RA 2GVAA 2R92H 4HJ5A 4GLXA 5C4XH 2XGTA 1YHAA 3KYHC 3J7ZC 4DV4L 4BXXH 2CFMA 1FVIA 4X66Q 3DM3A 1N36Q 1TXYA 1S72A 1VQLA 4DR5Q 4L5SA 3AFQA 3RN2A 5C44G 4C3JH 1ASZA 2F3IA 1K83H 4POGA 3K8AA 2NZOA 1MKHA 1I5FA 4LF4Q 1HJPA 3I4OA 4JI7Q 1H95A 1GKHA 3AFPA 3KDFA 3GTOH 2PQAB 3CPFA 1K0RA 3ERSX 2R7ZH 3CF5A 5JJIA 5FJ8G 1W2BA 4BA1I 2ZTDA 3ULLA 1SFOH 3UE0A 4AIMA 1J5EL 3I4NH 3F2BA 4A3JG 4NPSA 2OTJA 5J3BA 1CSQA 4JI0Q 1Q8KA 3D31A 1UE1A 3K0XA 1EQRA 1S3OA 1GO3E 3I7FA 2LXKA 4JI1L 1PH3A 1OXUA 2R6GA 2R7DA 4X62L 5C0XJ 1Q12A 1K8GA 2UUCQ 3J7A5 2IT1A 3S1MH 1M90C 1LUZA 5LMNQ 4DV7Q 1MJEA 1GM5A 3LGJA 1IBML 1E1TA 3FKIH 4LW1A 5BR8Q 3GTGH 3W1GA 1SE8A 4AQYL 5FLMG 2VQEL 4LF9Q 5EAYA 1LYLA 3S15H 4JBWA 2XTIA 1V9PA 4YHHL 2QA4A 4HIDA 1U0LA 3PGZA 3PUXA 1Y1WG 4B3ML 4JYAL 4A3JH 3FP9A 4L5TA 1TWCH 4YWLA 4DR4L 2EQSA 5HGQA 2JA9A 1VQ7A 1LTLA 1VQBA 3RLFA 1WYDA 4DNIA 1C7YA 4B3MQ 4L5RC 2UUAQ 3PSIA 5C3EH 2ASBA 4NXNQ 1VQ9A 3A74A 5IE8A 5IP7H 1NE3A 2MQHA 1N33Q 4PG3A 4KLKA 2Z0SA 4LUOA 4A3EG 4IPCA 2JA8G 5K36G 4DV1L 3KJOA 5LMNW 1UWVA 2A1AA 2NZHA 1SLJA 4BY1G 3M85A 4HJ9A 1VQMA 2CCZA 1Q7YC 1D8LA 3UDGA 5IP9H 1HNZL 1Q81C 2JEBI 1LM0A 2NN6I 2OCEA 3I55A 5IYCH 1HNZQ 1VQNA 4K0KQ 3PO3G 3S14H 5C3EG 2E2IH 4IPDA 4B3SL 5JJKA 3G71A 4A3KG 1MJCA 4LF6L 4L5QA 4GS3A 4LFAL 3HOYG 4DR7Q 4LFBL 3ER0A 1L1OC 1YEZA 4HIKA 5C0XG 2WFWA 3H0GH 3TS2A 1O7IA 1CUKA 2PI2E 3GTKH 3KFUA 1E22A 2K52A 2K5NA 1YBYA 4NXNL 3CCSA 2A19A 1JT8A 1GVPA 4A76A 1YZ6A 5C0XI 2K75A 3U58A 3OW2A 5C4XG 1L1OB 3G6EA 4LFAQ 2ZTCA 2CWPA 3AEVA 4GN3B 1SMXA 3U4ZA 1JB7A 1X3GA 3BU2A 2UU9Q 4WJ3M 5FLXc 1KAWA 1X3EA 1E3PA 4R4IA 1W3SA 2BA1A 3AQQA 4A3KH 4LF5L 2NN6G 4YCWA 4HIMA 1TWFH 2MO1A 3GO5A 4GKKQ 3KF6B 3S1RH 4A93H 4A3LG 2YTVA 2VQFQ 1KL9A 4DV0L 2LSSA 3GD7A 3W5OA 2YV5A 1XMQL 2VL6A 3I56A 2NVYH 1OXVA 3F2CA 2UXBQ 4HJ8A 1HH2P 3CCEA 3HOXH 3F8TA 5FJ8H 4PZ6A 4LF4L 3CXCA 2VW9A 1PH8A 1PH9A 2R7ZG 4A3CH 1PH6A 1QVFA 4A3DH 2RCNA 2C35B 4GOPA 2UUBL 4TQUS 1E7ZA 3CCMA 4DUYL 2HHHL 1IZ6A 3E9IA 3CMAA 3E9HA 4AYBG 1FGUA 1XPOA 2DUDA 3RNUA 3SGIA 3KJPA 1IBLL 1WOCA 1NTGA 4JI3Q 5M3FH 4YHHQ 1EUJA 3RZOH 3HOWG 2ID0A 2JK8A 4DK6C 1IXRA 2JA6H 3I4MH 1KD1C 1U5KA 2H5XA 4DAMA 4OX9L 4X65L 3HOUH 3L0OA 4JI7L 1UEBA 2PNHA 4LUZA 4YWKA 3TEHB 2E5LQ 4AH6A 1PH1A 4X62Q 1VQGA 4A3CG 4GOPC 2OTLA 2LXJA 3KOJA 2RF4A 4JI8L 4NXML 4IOCA 3GTLH 1IBKL 1K9MC 4A3IH 2JA7H 4IJLA 3UDFA 3UDIA 4POFA 3G4SA 1NY4A 4YWMA 4A3MG 4DR1Q 1PV4A 4JI6Q 3M7NA 5GQOA 4JBKA 1PYSB 3S17H 1G51A 2HIXA 1HZCA 4IPGA 5IP7G 3F2DA 1IBKQ 2D0OA 1X54A 1SRUA 4JI8Q 1S40A 4NXMQ 1JE5A 3HOUG 2KHJA 4KHZA 1YHQA 1QUQB 1BVSA 3CCVA 3PCOB 4OXPA 4A3FG 3RR5A 1AE3A 4QGUA 4GNXA 2F4VL 1RL2A 4KI0A 5GAGC 2CQOA 4BY7H 2AMCB 2FXQA 4R4OA 3NENA 2QEXA 3CCUA 3CCLA 1QZGA 4LFBQ 5IYCG 2ZJRA 4HIOA 3T1YQ 2JEAI 4PMWA 4UPAA 4GLAC 1Q82C 5C44H 2DGYA 4IPHA 1UE6A 4JC0A 3PV0A 4MNOA 1IL2A 2MNAA 1I3QH 1JMCA 2B63G 5BR8L 4IOAA 3UE1A 2E2JH 2VS1A 2WB1E 3HFZB 1XMQQ 3K80C 1YIJA 1I6HH 3PUZA 3L2PA 3S24A 1NMGA 1JJCB 4DV5Q 1AH9A 1BBWA 3EIVA 2K4KA 4QY7A 2VQFL 1I94L 1G6PA 1XJVA 1Q1BA 1HZBA 2ZM6L 1XNRL 4HJ7A 3M4OH 1J6QA 2OQKA 1NBWA 3CCQA 1VQFA 3KDFB 1HR0L 3F1ZA 4A93G 2UXDL 2PMZE 1YITA 1XTDA 5IY0A 1QVGA 3NEMA 5IP9G 1I94Q 1G291 1VQEA 2N8NA 2WP8J 1KXLA 1PFSA 1TWAH 4DV6Q 1N32Q 1EIYB 1VQCA 3T1HL 3BZKA 1UE5A 2AHOB 3H15A 2Q2HA 2HIVA 2JJQA 4GKJL 1V43A 3T1HQ 1YJWA 1PH4A 2Q2TA 2EXDA 2KCTA 2ATWA 1YI2A 2VY3A 3MXNB 3CMEA 4DUZQ 1VQJA 3EN2A 1N36L 4JI0L 2UXCL 4UY8C 2JA6G 2HHHQ 3H3VH 4PZ7A 5M3FG 4OWXB 4JCVE 3PF4A 2CWAA 2WAQG 1N9WA 4IFDI 1HNXQ 3ICEA 3PO2G 1A0IA 2WB1G 2BA0A 4NB3A 2UUCL 2F52A 3BJUA 3GTPH 2R93H 3PF5A 1HNXL 1QZHA 3TRZA 3PIPA 2HQLA 2UUAL 5C4JH 1AE2A 5DLQE 5AJ3Q 1WJJA 2IX1A 1HNWQ 4JI3L 2Y0SE 4JBMA 1HZAA 3M4QA 1TWGH 2EIFA 2I0QA 2CKZB 4DR2Q 4P74A 4WJ4A 4B3RL 2ZJQA 1XNQQ 4BA2I 1KRTA 4DK3C 1DGSA 1QVCA 2E5LL 4YY3L 2QGQA 5GAEC 1KQSA 4LF7Q 3K7UC 1PH2A 4R4TA 4B3TL 1EFWA 4BY7G 1CKMA 4OO1G 3E0EA 5JJLA 5ELOA 1VQ8A 1VQ5A 4LF6Q 4A4IA 3HOVG 4DV0Q 1PHJA 4K0KL 4JYAQ 3K81C 5ELNA 5AJ3L 1MIUA 1TWHH 2PQAA 2E2HH 4MZ9A 4AYBE 2ZM6Q 1FJGL 1XNRQ 4DR6L 4R4QA 1L2FA 4RG1A 3PIOA 1OTCA 4ALPA 4DV5L 3PUYA 1YJNA 2V1CC 1X3FA 2VUMG 4APVA 3MEFA 1B8AA 1VQDA 4P73A 1SN8A 3HOXG 2A8VA 2GVBA 4MTNA 3KF6A 4YY3Q 3CD6A 4GKKL 5GROA 1KHIA 3OTOQ 3JAMi 5GADC 1XMOL 1C9OA 5IT9c 4DV6L 2KHIA 1R9TH 2D62A 1VQKA 4A3DG 4DAYB 3CC4A 4B3SQ 3KLWA 4XTCS 5E7NA 5M5WH 4J15A 3NELA 4XIGS 2UUBQ 1PH7A 1KRSA 4JV5L 1VQHA 2MO0A 1B7YB 1Q1EA 1JJGA 2N3SA 3HKZE 2UXBL 3M4PA 2K5HA 2I5HA 2IHFA 3M9BA 1WCMG 1YVCA 4RMFA 3J81j 3DLLA 2JA5G 3CC2A 1N32L 4LF8L 3A5ZB 2Q2UA 5LMUL 1CSPA 4DR3L 4A3MH 2UXDQ 4BY1H 1N34L 4JI2L 5HY6A 1VQIA 3U50C 4LF5Q 1X56A 3UDXA 1K8AC 1J5EQ 1CKOA 1YHBA 2AWNA 1M1KC 1PYBA 4DUZL 2IX0A 3JAMc 4P75A 1GD7A 1IYJB 1SROA 2WAQE 3GDEA 4YCVA 5M3MG 3CAMA 1XPRA 4OWTB 2R93G 2OQ0A 4Y7NH 1X55A 2RHQB 4DPGA 1BBUA 2BH8A 4IFDJ 2JE6I 1T9HA 3EBEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R1J A;  5LMN L;  4X65 Q;  2VUM H;  2NVX H;  4GN4 B;  1OXS C;  4GOP B;  4UP7 A;  4ME3 A;  1Q46 A;  3Q8D A;  2MFI A;  3J80 i;  4JI1 Q;  2NVQ H;  4B3R Q;  3BZC A;  3HKS A;  4QIW E;  2Z6K A;  4DR4 Q;  1FL0 A;  2K14 A;  3I4N G;  1YNX A;  4QJF A;  3CCJ A;  1CKN B;  4DV3 Q;  2N49 A;  1A62 A;  4AQY Q;  1P8L A;  3IRB A;  3A5U A;  1Y14 B;  1IBM Q;  2I5L X;  4UP8 A;  4JI4 Q;  2B3G A;  3RLO A;  2JQO A;  4DV1 Q;  1ASY A;  1HZ9 A;  4LFC Q;  2K5V A;  4JBJ A;  3KF8 B;  1EOV A;  3ULP A;  3FKI G;  2KEN A;  4LNQ A;  5IYB G;  4JI4 L;  4B3T Q;  3K7A H;  4DR6 Q;  2Z6K C;  4O2D A;  3I2Z A;  4HJA A;  5IYD H;  1L1O A;  2JA5 H;  2OWO A;  1B70 B;  2N78 A;  4DV2 Q;  1XNQ L;  4GLV B;  2YU9 H;  3GTJ H;  4GN5 A;  4O0A A;  3T1Y L;  4EQ5 A;  3JC6 6;  4FDB A;  4X66 L;  3M3Y H;  1A63 A;  1Y1V H;  3TRE A;  3RZD H;  2UU9 L;  4BBS H;  3NBH B;  1EIF A;  3HOW H;  3B6Y A;  3CW2 C;  1PVO A;  1KC8 C;  3CPW A;  1UE7 A;  1KIX A;  4P71 A;  4JG2 A;  4BBR G;  2YTX A;  5IWA L;  1K73 C;  2K50 A;  2IHE A;  3HOZ G;  4DR5 L;  2Y0S G;  1P16 A;  4DR7 L;  2D0P A;  1BKB A;  3PUW A;  4GNX C;  2L15 A;  2AKW B;  4DKA C;  4A3I G;  2JA7 G;  1VQ4 A;  3CP0 A;  1JJ2 A;  1HR0 Q;  3CC7 A;  3J80 c;  1A8V A;  4C2M H;  3ZJY C;  3HOV H;  1CKN A;  4JI2 Q;  1N34 Q;  5M5Y H;  1N8R C;  3S1N H;  4BXX G;  4GNX B;  4DR3 Q;  3PO2 H;  4C3H H;  3PUV A;  4TVA B;  3HKZ G;  2ZJP A;  3PO3 H;  1L0W A;  4LF8 Q;  1D7Q A;  4JI5 L;  4JOI C;  2I5M X;  4IJH A;  3FHW A;  4A3F H;  2HT1 A;  1VQP A;  5IWA Q;  4H02 A;  4OO1 I;  1RIP A;  4GKJ Q;  4KHP L;  1E24 A;  3WWV A;  3ULJ A;  4OX9 Q;  3TS0 A;  2IY5 B;  2YTY A;  3S1Q H;  4DV3 L;  4EX5 A;  1PA6 A;  5M5X H;  1IBL Q;  5IYD G;  3OYY A;  3J81 c;  1VS0 A;  4C3I H;  1Q86 C;  2VZA A;  4IO9 A;  3S2D H;  2Q2I A;  4DUY Q;  2ZTE A;  3S16 H;  2JA8 H;  4UP9 A;  1X9N A;  3S2H H;  1V1Q A;  4X64 L;  1NJI C;  4YCU A;  1EYG A;  1XPU A;  4A3G G;  4A3L H;  3TQY A;  3D0F A;  2B63 H;  2ALY B;  4LFC L;  1WI5 A;  3STB C;  5JEA J;  1QUQ A;  4JI5 Q;  2R92 G;  4LUV A;  2BH2 A;  2B29 A;  4A75 A;  4IFD G;  2R7F A;  1WCM H;  1VQA A;  1FJG Q;  3HOZ H;  1VQO A;  3CQZ H;  4PZ8 A;  3HOY H;  5H1S E;  3AYH B;  1E1O A;  4DR1 L;  1Y1W H;  4JV5 Q;  3GTQ H;  3L7Z C;  2VNU D;  4JI6 L;  4QQB X;  4X6A H;  1HR0 W;  3H0G G;  5JEA G;  1I50 H;  1OXT A;  4A3G H;  1WFQ A;  1HNW L;  3RN5 A;  2GN5 A;  2VQE Q;  4LF9 L;  5IYB H;  1PH5 A;  3I4M G;  2RHS B;  5M3M H;  4X64 Q;  4A3E H;  4DV7 L;  4OON A;  4LF7 L;  2NVT H;  1X65 A;  1Z47 A;  4JOI A;  1X6O A;  3A0J A;  5GAH C;  2KCM A;  3CCR A;  4A3B G;  4R4C A;  4DR2 L;  4OWW B;  4LWC A;  2UXC Q;  1EWI A;  1OXX K;  4DV4 Q;  3VDY A;  4P72 A;  3U4V A;  1Y1V G;  4BBS G;  4QL5 A;  4DV2 L;  2PI2 A;  2KBN A;  1NMF A;  1XMO Q;  3J81 i;  1YJ9 A;  3OTO L;  2F4V Q;  1C0A A;  3STB D;  5LMU Q;  4BBR H;  4KHP Q;  2ES2 A;  1Z9F A;  3RLN A;  2E8G A;  1EQQ A;  4Y52 H;  3W1B A;  5FLM H;  3H3V I;  1VQ6 A;  2YYZ A;  1N33 L;  1SR3 A;  4A3B H;  1VCI A;  2AWO A;  3GTM H;  3G48 A;  1K3R A;  2GVA A;  2R92 H;  4HJ5 A;  4GLX A;  5C4X H;  2XGT A;  1YHA A;  3KYH C;  3J7Z C;  4DV4 L;  4BXX H;  2CFM A;  1FVI A;  4X66 Q;  3DM3 A;  1N36 Q;  1TXY A;  1S72 A;  1VQL A;  4DR5 Q;  4L5S A;  3AFQ A;  3RN2 A;  5C44 G;  4C3J H;  1ASZ A;  2F3I A;  1K83 H;  4POG A;  3K8A A;  2NZO A;  1MKH A;  1I5F A;  4LF4 Q;  1HJP A;  3I4O A;  4JI7 Q;  1H95 A;  1GKH A;  3AFP A;  3KDF A;  3GTO H;  2PQA B;  3CPF A;  1K0R A;  3ERS X;  2R7Z H;  3CF5 A;  5JJI A;  5FJ8 G;  1W2B A;  4BA1 I;  2ZTD A;  3ULL A;  1SFO H;  3UE0 A;  4AIM A;  1J5E L;  3I4N H;  3F2B A;  4A3J G;  4NPS A;  2OTJ A;  5J3B A;  1CSQ A;  4JI0 Q;  1Q8K A;  3D31 A;  1UE1 A;  3K0X A;  1EQR A;  1S3O A;  1GO3 E;  3I7F A;  2LXK A;  4JI1 L;  1PH3 A;  1OXU A;  2R6G A;  2R7D A;  4X62 L;  5C0X J;  1Q12 A;  1K8G A;  2UUC Q;  3J7A 5;  2IT1 A;  3S1M H;  1M90 C;  1LUZ A;  5LMN Q;  4DV7 Q;  1MJE A;  1GM5 A;  3LGJ A;  1IBM L;  1E1T A;  3FKI H;  4LW1 A;  5BR8 Q;  3GTG H;  3W1G A;  1SE8 A;  4AQY L;  5FLM G;  2VQE L;  4LF9 Q;  5EAY A;  1LYL A;  3S15 H;  4JBW A;  2XTI A;  1V9P A;  4YHH L;  2QA4 A;  4HID A;  1U0L A;  3PGZ A;  3PUX A;  1Y1W G;  4B3M L;  4JYA L;  4A3J H;  3FP9 A;  4L5T A;  1TWC H;  4YWL A;  4DR4 L;  2EQS A;  5HGQ A;  2JA9 A;  1VQ7 A;  1LTL A;  1VQB A;  3RLF A;  1WYD A;  4DNI A;  1C7Y A;  4B3M Q;  4L5R C;  2UUA Q;  3PSI A;  5C3E H;  2ASB A;  4NXN Q;  1VQ9 A;  3A74 A;  5IE8 A;  5IP7 H;  1NE3 A;  2MQH A;  1N33 Q;  4PG3 A;  4KLK A;  2Z0S A;  4LUO A;  4A3E G;  4IPC A;  2JA8 G;  5K36 G;  4DV1 L;  3KJO A;  5LMN W;  1UWV A;  2A1A A;  2NZH A;  1SLJ A;  4BY1 G;  3M85 A;  4HJ9 A;  1VQM A;  2CCZ A;  1Q7Y C;  1D8L A;  3UDG A;  5IP9 H;  1HNZ L;  1Q81 C;  2JEB I;  1LM0 A;  2NN6 I;  2OCE A;  3I55 A;  5IYC H;  1HNZ Q;  1VQN A;  4K0K Q;  3PO3 G;  3S14 H;  5C3E G;  2E2I H;  4IPD A;  4B3S L;  5JJK A;  3G71 A;  4A3K G;  1MJC A;  4LF6 L;  4L5Q A;  4GS3 A;  4LFA L;  3HOY G;  4DR7 Q;  4LFB L;  3ER0 A;  1L1O C;  1YEZ A;  4HIK A;  5C0X G;  2WFW A;  3H0G H;  3TS2 A;  1O7I A;  1CUK A;  2PI2 E;  3GTK H;  3KFU A;  1E22 A;  2K52 A;  2K5N A;  1YBY A;  4NXN L;  3CCS A;  2A19 A;  1JT8 A;  1GVP A;  4A76 A;  1YZ6 A;  5C0X I;  2K75 A;  3U58 A;  3OW2 A;  5C4X G;  1L1O B;  3G6E A;  4LFA Q;  2ZTC A;  2CWP A;  3AEV A;  4GN3 B;  1SMX A;  3U4Z A;  1JB7 A;  1X3G A;  3BU2 A;  2UU9 Q;  4WJ3 M;  5FLX c;  1KAW A;  1X3E A;  1E3P A;  4R4I A;  1W3S A;  2BA1 A;  3AQQ A;  4A3K H;  4LF5 L;  2NN6 G;  4YCW A;  4HIM A;  1TWF H;  2MO1 A;  3GO5 A;  4GKK Q;  3KF6 B;  3S1R H;  4A93 H;  4A3L G;  2YTV A;  2VQF Q;  1KL9 A;  4DV0 L;  2LSS A;  3GD7 A;  3W5O A;  2YV5 A;  1XMQ L;  2VL6 A;  3I56 A;  2NVY H;  1OXV A;  3F2C A;  2UXB Q;  4HJ8 A;  1HH2 P;  3CCE A;  3HOX H;  3F8T A;  5FJ8 H;  4PZ6 A;  4LF4 L;  3CXC A;  2VW9 A;  1PH8 A;  1PH9 A;  2R7Z G;  4A3C H;  1PH6 A;  1QVF A;  4A3D H;  2RCN A;  2C35 B;  4GOP A;  2UUB L;  4TQU S;  1E7Z A;  3CCM A;  4DUY L;  2HHH L;  1IZ6 A;  3E9I A;  3CMA A;  3E9H A;  4AYB G;  1FGU A;  1XPO A;  2DUD A;  3RNU A;  3SGI A;  3KJP A;  1IBL L;  1WOC A;  1NTG A;  4JI3 Q;  5M3F H;  4YHH Q;  1EUJ A;  3RZO H;  3HOW G;  2ID0 A;  2JK8 A;  4DK6 C;  1IXR A;  2JA6 H;  3I4M H;  1KD1 C;  1U5K A;  2H5X A;  4DAM A;  4OX9 L;  4X65 L;  3HOU H;  3L0O A;  4JI7 L;  1UEB A;  2PNH A;  4LUZ A;  4YWK A;  3TEH B;  2E5L Q;  4AH6 A;  1PH1 A;  4X62 Q;  1VQG A;  4A3C G;  4GOP C;  2OTL A;  2LXJ A;  3KOJ A;  2RF4 A;  4JI8 L;  4NXM L;  4IOC A;  3GTL H;  1IBK L;  1K9M C;  4A3I H;  2JA7 H;  4IJL A;  3UDF A;  3UDI A;  4POF A;  3G4S A;  1NY4 A;  4YWM A;  4A3M G;  4DR1 Q;  1PV4 A;  4JI6 Q;  3M7N A;  5GQO A;  4JBK A;  1PYS B;  3S17 H;  1G51 A;  2HIX A;  1HZC A;  4IPG A;  5IP7 G;  3F2D A;  1IBK Q;  2D0O A;  1X54 A;  1SRU A;  4JI8 Q;  1S40 A;  4NXM Q;  1JE5 A;  3HOU G;  2KHJ A;  4KHZ A;  1YHQ A;  1QUQ B;  1BVS A;  3CCV A;  3PCO B;  4OXP A;  4A3F G;  3RR5 A;  1AE3 A;  4QGU A;  4GNX A;  2F4V L;  1RL2 A;  4KI0 A;  5GAG C;  2CQO A;  4BY7 H;  2AMC B;  2FXQ A;  4R4O A;  3NEN A;  2QEX A;  3CCU A;  3CCL A;  1QZG A;  4LFB Q;  5IYC G;  2ZJR A;  4HIO A;  3T1Y Q;  2JEA I;  4PMW A;  4UPA A;  4GLA C;  1Q82 C;  5C44 H;  2DGY A;  4IPH A;  1UE6 A;  4JC0 A;  3PV0 A;  4MNO A;  1IL2 A;  2MNA A;  1I3Q H;  1JMC A;  2B63 G;  5BR8 L;  4IOA A;  3UE1 A;  2E2J H;  2VS1 A;  2WB1 E;  3HFZ B;  1XMQ Q;  3K80 C;  1YIJ A;  1I6H H;  3PUZ A;  3L2P A;  3S24 A;  1NMG A;  1JJC B;  4DV5 Q;  1AH9 A;  1BBW A;  3EIV A;  2K4K A;  4QY7 A;  2VQF L;  1I94 L;  1G6P A;  1XJV A;  1Q1B A;  1HZB A;  2ZM6 L;  1XNR L;  4HJ7 A;  3M4O H;  1J6Q A;  2OQK A;  1NBW A;  3CCQ A;  1VQF A;  3KDF B;  1HR0 L;  3F1Z A;  4A93 G;  2UXD L;  2PMZ E;  1YIT A;  1XTD A;  5IY0 A;  1QVG A;  3NEM A;  5IP9 G;  1I94 Q;  1G29 1;  1VQE A;  2N8N A;  2WP8 J;  1KXL A;  1PFS A;  1TWA H;  4DV6 Q;  1N32 Q;  1EIY B;  1VQC A;  3T1H L;  3BZK A;  1UE5 A;  2AHO B;  3H15 A;  2Q2H A;  2HIV A;  2JJQ A;  4GKJ L;  1V43 A;  3T1H Q;  1YJW A;  1PH4 A;  2Q2T A;  2EXD A;  2KCT A;  2ATW A;  1YI2 A;  2VY3 A;  3MXN B;  3CME A;  4DUZ Q;  1VQJ A;  3EN2 A;  1N36 L;  4JI0 L;  2UXC L;  4UY8 C;  2JA6 G;  2HHH Q;  3H3V H;  4PZ7 A;  5M3F G;  4OWX B;  4JCV E;  3PF4 A;  2CWA A;  2WAQ G;  1N9W A;  4IFD I;  1HNX Q;  3ICE A;  3PO2 G;  1A0I A;  2WB1 G;  2BA0 A;  4NB3 A;  2UUC L;  2F52 A;  3BJU A;  3GTP H;  2R93 H;  3PF5 A;  1HNX L;  1QZH A;  3TRZ A;  3PIP A;  2HQL A;  2UUA L;  5C4J H;  1AE2 A;  5DLQ E;  5AJ3 Q;  1WJJ A;  2IX1 A;  1HNW Q;  4JI3 L;  2Y0S E;  4JBM A;  1HZA A;  3M4Q A;  1TWG H;  2EIF A;  2I0Q A;  2CKZ B;  4DR2 Q;  4P74 A;  4WJ4 A;  4B3R L;  2ZJQ A;  1XNQ Q;  4BA2 I;  1KRT A;  4DK3 C;  1DGS A;  1QVC A;  2E5L L;  4YY3 L;  2QGQ A;  5GAE C;  1KQS A;  4LF7 Q;  3K7U C;  1PH2 A;  4R4T A;  4B3T L;  1EFW A;  4BY7 G;  1CKM A;  4OO1 G;  3E0E A;  5JJL A;  5ELO A;  1VQ8 A;  1VQ5 A;  4LF6 Q;  4A4I A;  3HOV G;  4DV0 Q;  1PHJ A;  4K0K L;  4JYA Q;  3K81 C;  5ELN A;  5AJ3 L;  1MIU A;  1TWH H;  2PQA A;  2E2H H;  4MZ9 A;  4AYB E;  2ZM6 Q;  1FJG L;  1XNR Q;  4DR6 L;  4R4Q A;  1L2F A;  4RG1 A;  3PIO A;  1OTC A;  4ALP A;  4DV5 L;  3PUY A;  1YJN A;  2V1C C;  1X3F A;  2VUM G;  4APV A;  3MEF A;  1B8A A;  1VQD A;  4P73 A;  1SN8 A;  3HOX G;  2A8V A;  2GVB A;  4MTN A;  3KF6 A;  4YY3 Q;  3CD6 A;  4GKK L;  5GRO A;  1KHI A;  3OTO Q;  3JAM i;  5GAD C;  1XMO L;  1C9O A;  5IT9 c;  4DV6 L;  2KHI A;  1R9T H;  2D62 A;  1VQK A;  4A3D G;  4DAY B;  3CC4 A;  4B3S Q;  3KLW A;  4XTC S;  5E7N A;  5M5W H;  4J15 A;  3NEL A;  4XIG S;  2UUB Q;  1PH7 A;  1KRS A;  4JV5 L;  1VQH A;  2MO0 A;  1B7Y B;  1Q1E A;  1JJG A;  2N3S A;  3HKZ E;  2UXB L;  3M4P A;  2K5H A;  2I5H A;  2IHF A;  3M9B A;  1WCM G;  1YVC A;  4RMF A;  3J81 j;  3DLL A;  2JA5 G;  3CC2 A;  1N32 L;  4LF8 L;  3A5Z B;  2Q2U A;  5LMU L;  1CSP A;  4DR3 L;  4A3M H;  2UXD Q;  4BY1 H;  1N34 L;  4JI2 L;  5HY6 A;  1VQI A;  3U50 C;  4LF5 Q;  1X56 A;  3UDX A;  1K8A C;  1J5E Q;  1CKO A;  1YHB A;  2AWN A;  1M1K C;  1PYB A;  4DUZ L;  2IX0 A;  3JAM c;  4P75 A;  1GD7 A;  1IYJ B;  1SRO A;  2WAQ E;  3GDE A;  4YCV A;  5M3M G;  3CAM A;  1XPR A;  4OWT B;  2R93 G;  2OQ0 A;  4Y7N H;  1X55 A;  2RHQ B;  4DPG A;  1BBU A;  2BH8 A;  4IFD J;  2JE6 I;  1T9H A;  3EBE A; 
#chains in the Genus database with same CATH topology
 2CHB D;  2DNC A;  4X65 Q;  3FKI B;  5DAU A;  2NVX H;  1TS4 A;  2A73 B;  1B53 A;  1E2W A;  1OXS C;  3M4I A;  4GOP B;  4UP7 A;  2G9H D;  4ME3 A;  3Q8D A;  5T1I A;  4FF3 A;  4QIW E;  3CCJ A;  2VPQ A;  4UCV A;  3TSS A;  2V59 A;  1P8L A;  2ATL A;  4RCN A;  1IBM Q;  4UCU A;  1SE2 A;  5DGA A;  3RLO A;  4WJW A;  5BN4 A;  5CR3 A;  4DV1 Q;  1HZ9 A;  3A56 A;  1ESF A;  5JVH 3;  5CV7 A;  4JBJ A;  3KF8 B;  1JR0 D;  1ENA A;  2HVQ A;  2N55 A;  3FPP A;  3OHX C;  5BPF A;  1G6Z A;  4NDX A;  4O2D A;  1L1O A;  2JA5 H;  2OWO A;  1B70 B;  1CTM A;  2RDH A;  2W9B B;  1XNQ L;  3FKI A;  1I50 B;  1B9M A;  1A63 A;  1KBL A;  2UU9 L;  5KND A;  1SEI A;  4HR7 A;  4ECQ A;  2AUK A;  3CW2 C;  1KC8 C;  1PDQ A;  3GQB A;  1XNQ H;  5C3W A;  1LLR D;  4RB3 C;  4KK7 A;  2W8K A;  4JG2 A;  2NYZ D;  4BBR G;  3SVM A;  4EFE A;  2HDL A;  3UQ8 A;  2IHE A;  5KG1 A;  2D0P A;  1A3T A;  4DKA C;  2LS0 1;  3A7L A;  2JA7 G;  1JC7 A;  2EDG A;  2KEC A;  1JKJ B;  4ZQ3 A;  2LMC B;  3CU7 A;  3D4R A;  2B8F A;  2IW3 A;  3NQI A;  4ZCK A;  4JI2 Q;  1PZJ D;  5M5Y H;  4GNX B;  3S1N H;  3PO3 H;  2QYZ A;  5LYJ F;  3FHW A;  1E4E B;  3J80 E;  3PO3 B;  1NNX A;  4GKJ Q;  1SNO A;  3ULJ A;  1IBM H;  4WFN 3;  1ZHQ A;  3S1Q H;  3QFF A;  4Y7N B;  2K1B A;  2YRX A;  5FLX W;  3P75 A;  4C3I H;  1PK8 A;  2WV6 D;  3I70 A;  4IO9 A;  1FNW A;  2EOT A;  5JJZ A;  4DUY Q;  3S2D H;  3MA2 B;  2YZM A;  4V19 0;  2ZTE A;  2R7L A;  4WBN F;  4DV2 H;  1HQM C;  1X9N A;  5FLX E;  2DLN A;  3RB0 A;  1IW7 D;  3TQY A;  1F77 A;  4K8I A;  2ALY B;  2CVR A;  3PZP A;  4LFC L;  1Q8I A;  1BCP D;  1C4Q A;  2PW7 A;  4CKE A;  2B29 A;  4R8U B;  4DN4 M;  3TME A;  3KLS X;  1WTQ A;  2FE3 A;  1A9X A;  2R7M A;  2B63 A;  4JV5 Q;  3HOY H;  2IJ0 A;  4DR1 L;  1MI2 A;  4QQB X;  4F7X A;  3JAM E;  2B2Y C;  1N32 H;  3BYY B;  4XQN A;  5JEA G;  1I50 H;  4B08 A;  5CA1 F;  3QZ8 A;  2C00 A;  4PDB A;  1TWH A;  1WFQ A;  2VOB A;  4ZHQ F;  1HPC A;  3KHH A;  5IYB H;  2FP4 B;  1IBK H;  3C3L A;  1DOL A;  4DV7 L;  2NVT H;  1X65 A;  2YCH A;  4X3U A;  1FD7 D;  1QB5 D;  4DL7 A;  2OXP A;  1QE6 A;  4A3B G;  4R4C A;  3OUU A;  2C2R A;  2WB1 A;  1DM0 B;  1KAB A;  3R3O A;  3VDY A;  5HBR B;  4ZLT F;  4A2A A;  3J81 i;  1YJ9 A;  3OTO L;  4C3I G;  1C0A A;  3STB D;  5LMU Q;  4M1U B;  3L4K A;  3OTO H;  4DAV A;  3RLN A;  1IW7 C;  1EQQ A;  4QWD A;  1S0N A;  3K5L A;  5CB4 F;  1S68 A;  5C0X H;  4TV8 F;  4IUT A;  3GTM H;  3IG0 A;  1VAJ A;  2UUB H;  1PTO F;  1RDP D;  3J7Z C;  4CDD C;  4Q5V A;  4X66 Q;  1N36 Q;  2V58 A;  5D1O A;  3AFQ A;  3NE5 B;  2FLP A;  4L63 B;  5C44 G;  2DWC A;  2JEJ A;  1XDN A;  4JI3 H;  3K8A A;  4LMY A;  5K36 H;  1BNC A;  1MKH A;  1I5F A;  1GXD C;  3I4O A;  4JI7 Q;  3SXH A;  3I4M B;  1GKH A;  1EY5 A;  3RUP A;  3KDF A;  3GTO H;  2PQA B;  4ECT A;  3NP8 A;  1RJQ A;  1JQY D;  4O4L F;  1K0R A;  3WO0 A;  2WTF A;  4A3J B;  2UVR A;  2DY8 A;  5KFN A;  2ZTD A;  3ULL A;  3I4N H;  4AIM A;  1M7J A;  5CAE B;  3F2B A;  2BQU A;  3K7A B;  4BWS C;  1SJE D;  4A3K B;  4JI0 Q;  1UE1 A;  1S3O A;  5CV6 A;  1PH3 A;  2B2U C;  5IWA H;  2R7D A;  3C1F A;  2WAQ A;  5KFV A;  2CQA A;  1K8G A;  3FVQ A;  1EOT A;  3QWN A;  1LUZ A;  4ILW A;  4RAY A;  4RUC A;  3LGJ A;  3L3O C;  4ID6 A;  3RJ0 A;  1LYL A;  4YY3 H;  4HID A;  1HNW Q;  4UFZ A;  1F2L A;  5COR A;  3PUX A;  1Q3L A;  5KFJ A;  3BVG A;  1AN8 A;  1FNV A;  3FP9 A;  2ICE C;  2NUC A;  5DM6 3;  1KEE A;  3J7Y W;  2UUA Q;  3HOY B;  5L1J A;  1DCZ A;  2ASB A;  2R7K A;  2KA7 A;  1VQ9 A;  4DAY A;  3SDZ A;  5IE8 A;  3G6X A;  1NE3 A;  2MQH A;  4RCO A;  3OIP A;  1PFN A;  3CKI B;  4LUO A;  4A3E G;  2HGS A;  4HED A;  3VR2 A;  5K36 G;  5LMN W;  1UWV A;  3N40 P;  3DEO A;  4OEM B;  2A1A A;  2NZH A;  1VQM A;  4Y8V B;  1D8L A;  3HKZ B;  4J9M A;  1EIG A;  4K5X A;  4QIW B;  1Q81 C;  4YAK B;  3I55 A;  2QEJ C;  1TR5 A;  1HHV A;  3CHB D;  3LWU A;  5C3E G;  5LL6 S;  2E2I H;  4B3S L;  4DV6 H;  2FPG B;  2CQY A;  4EBC A;  2F0F A;  4LF6 L;  1I6U A;  3ER0 A;  1PRT D;  1L1O C;  3GIQ A;  1LAB A;  1AUX A;  3CRL C;  1O7I A;  5IYZ F;  3MFY A;  5D65 A;  4NXN L;  3CCS A;  3NGD A;  3ETH A;  1YZ6 A;  3U58 A;  3OW2 A;  4DL4 A;  1L1O B;  3G6E A;  4LFA Q;  4KTA A;  1SMX A;  3U4Z A;  3U9T A;  3HXL A;  1GHJ A;  3BU2 A;  3KLR A;  4X3K A;  5FLX c;  2J6U A;  1KAW A;  3GP7 A;  1RKN A;  2KCC A;  4PV1 C;  4DV7 H;  1X3E A;  3S1Q B;  3AQQ A;  4CKB A;  4DV4 H;  4JVZ A;  1D1I A;  2F3W A;  4A3E B;  5E3F A;  4GKK Q;  3KF6 B;  4A93 H;  1KL9 A;  1F9P A;  4UAI A;  4ECY A;  1HNW H;  2LSS A;  4RGM A;  1IOV A;  2YV5 A;  1XMQ L;  1GSA A;  2R82 A;  3IKJ A;  1HH2 P;  3HOX H;  5FJ8 H;  2FK3 A;  5KT6 A;  4C5A A;  5IOC A;  1AW7 A;  4O2B F;  5KG5 A;  3M9N B;  3CMA A;  2NUA B;  4DFA A;  2DUD A;  3KAJ A;  5CMD A;  1IBL L;  5KFH A;  4YHH Q;  1EUJ A;  5KT7 A;  1FJG H;  2JA6 H;  4DK6 C;  4DV5 H;  1DXM A;  2GA4 B;  4OX9 L;  1BR9 A;  3HOU H;  3N42 B;  5KFY A;  2C2D A;  1B44 D;  1HA6 A;  1WTX A;  1ESR A;  2OTL A;  2KHS A;  4O3P A;  4MTD A;  1SBB B;  2SNM A;  3NPP A;  4ED1 A;  3KOJ A;  1H9J A;  1FGB D;  4A3I H;  1A2T A;  4IJL A;  1PV4 A;  4N9T A;  4JI6 Q;  1V4Y A;  3M7N A;  2FPI B;  2BR0 A;  2L5T A;  1AZQ A;  4XX0 B;  3GII A;  4V0B A;  2HIX A;  5ISR A;  4IPG A;  5IP7 G;  1IBK Q;  2W8L A;  1X54 A;  2HUG A;  1SSO A;  1JE5 A;  3W3A A;  2QDB A;  4TV9 F;  5JH7 F;  4RB2 C;  4KHZ A;  1Y69 U;  1GUS A;  2ENB A;  2KEE A;  1LTT D;  2I46 A;  1TWF A;  4OXP A;  1UUP A;  4EQP A;  1STG A;  3GIP A;  1EYC A;  4ED3 A;  5EPJ A;  2K04 A;  1STY A;  3GIM A;  5IYC G;  4HIO A;  1IYU A;  3T1Y Q;  4C1N K;  4PMW A;  3T13 A;  4MV7 A;  4GC7 A;  4CJ1 B;  4FF4 A;  4EBE A;  4NXN H;  5KFQ A;  4F4Y A;  3K0Y A;  2EJG C;  4IN3 A;  4MN3 A;  2B63 G;  5JPM C;  3IN5 A;  1Y8N B;  2F0U A;  3MXN A;  3K80 C;  1EU4 A;  1HTL D;  2K32 A;  5DNF A;  3L2P A;  5JPN C;  5EPK A;  3S24 A;  1JJC B;  4DV5 Q;  4CC5 A;  2UVW A;  3FDT A;  4QY7 A;  3ITP A;  3I72 A;  2VQF L;  1E4G T;  4PMC A;  4RH6 A;  1HZB A;  2VPS A;  1J6Q A;  1NBW A;  1VQF A;  1HR0 L;  2PMZ E;  1EY8 A;  5IY0 A;  4KN4 C;  4OIK A;  2J6S A;  1I94 Q;  1VQE A;  1H9S B;  2N8N A;  3MAQ A;  3OW7 A;  2F0M A;  5C3X A;  5I6Y A;  4DV6 Q;  4YR2 A;  1S03 G;  2C22 A;  1UE5 A;  2EYH A;  1EUD B;  3T1H H;  3GTM B;  2Q2H A;  3RF2 A;  1HR0 H;  1V43 A;  1D2B A;  3A54 A;  4Q44 A;  5BN3 A;  3GTG A;  5EDW A;  2VY3 A;  4YP3 A;  3MXN B;  3N43 B;  4LFA H;  2I80 A;  4RA8 A;  4FYD A;  3TQT A;  2CH4 A;  4DXG A;  2XRS D;  1AN7 A;  4UY8 C;  2WAC A;  4HCE A;  1H9M A;  3PF4 A;  4IFD I;  5BN5 A;  4A3I B;  5M9O A;  3PQI A;  4NB3 A;  3TP8 A;  2F52 A;  3GTP H;  3GID A;  4FM9 A;  1BDO A;  4ZI7 F;  2CZG A;  2HQL A;  1WTP A;  2UUA L;  5DLQ E;  5C4H A;  1JIC A;  4ECR A;  3NQT A;  4JBM A;  1HZA A;  2EIF A;  3KAK A;  3C2P A;  5E1F A;  3ETJ A;  4B3R L;  2Q8I B;  2XWJ B;  1Z2N X;  1CFM A;  1KJ9 A;  3QIA A;  3TIN A;  4LF4 H;  4G3I A;  4IUU A;  5GAE C;  1KQS A;  2F3V A;  4XZ3 B;  2K5Q A;  4X3S A;  1PH2 A;  1EFW A;  3HOX B;  2TSS A;  4BY7 G;  2L0C A;  1CKM A;  1XXG A;  4OO1 G;  1EUC B;  3E0E A;  5A2Q L;  3KLS A;  4LF6 Q;  3HOV G;  1SND A;  3OWE B;  1PFM A;  1CA6 A;  4DF7 A;  4DNR B;  1EY6 A;  3N44 B;  2R8I A;  5M5W B;  3VYR A;  1OTC A;  2XWB B;  1D5X C;  4DV5 L;  4IUP A;  1X3F A;  3V96 A;  1B8A A;  4P73 A;  2B8G A;  2H4O A;  1KHI A;  3H91 A;  3JAM i;  1JOR A;  1C9O A;  1KLU D;  2D62 A;  5LMU H;  3H6M A;  3K3P A;  4KD4 A;  4J15 A;  5M5W H;  2FIN B;  3NEL A;  2RDJ A;  4XIG S;  4RB1 A;  1PH7 A;  3GTQ B;  1KRS A;  5I9P A;  1VQH A;  4B3T H;  4C3H G;  1L0Y B;  4EQO A;  2N3S A;  1Y1W A;  2UXB L;  3M4P A;  3OPO A;  3GTL B;  5KFX A;  5ELC A;  3NSW A;  1N32 L;  1IOW A;  1DYQ A;  1NUC A;  4L6T B;  4JV1 A;  3Q22 A;  4A3M H;  2HQE A;  3EJI A;  5C8Y F;  4F50 A;  1I3Q B;  4LF5 Q;  5C4J B;  1K8A C;  3UDX A;  4XYM B;  4YB8 B;  1YHB A;  3RUZ A;  1I7L A;  3JAM c;  1DIK A;  3P7J A;  2MHV A;  3DUZ A;  3E6Z X;  1EZ1 A;  5JVL A;  4K5V A;  2WII B;  1XPR A;  2OQ0 A;  4DPG A;  1BBU A;  2BH8 A;  4IFD J;  2O5J C;  4F88 A;  4IUV A;  5LMN L;  2R86 A;  4YAJ B;  2LY7 A;  1CA5 A;  1S5D D;  4GN4 B;  1B6S A;  1VDZ A;  1CQJ B;  3GTO A;  2G9D A;  4RAZ A;  1DOM A;  4B3R Q;  4I65 A;  4RKL A;  3HKS A;  5IGC A;  3J7A F;  3I4N G;  1CKN B;  2IP4 A;  5I4D A;  1MHW C;  1D6E C;  2ZXR A;  2N49 A;  1GUW A;  3IRB A;  2D2C C;  4EQN A;  3A5U A;  5J22 A;  1Y14 B;  5DG8 A;  1EFI D;  4JI4 Q;  3G6V A;  1PYW D;  2B2T C;  4A3G B;  1EWC A;  4LFC Q;  4B3M H;  5C1P A;  3GV5 B;  2KEN A;  1ZYR D;  2XC9 A;  3K7A H;  4DR6 Q;  1ML0 D;  3CVZ A;  1W93 A;  1S97 A;  1ICF B;  1EY4 A;  3MFI A;  4O0A A;  3T1Y L;  3M3Y H;  4X66 L;  5KFS A;  5KFK A;  1Y1V H;  4BBS H;  1MBY A;  3RZD H;  3NBH B;  3HOW H;  3GTJ B;  3B6Y A;  5KFL A;  1UE7 A;  3IFT A;  2NTS A;  1J5E H;  1Q90 A;  3VR5 A;  2YTX A;  4RHS A;  1EYD A;  1TS2 A;  1F2Y A;  1K73 C;  2K50 A;  2E5L H;  1KDA A;  2YU9 A;  4FO2 A;  2Y0S G;  1JDB B;  1P16 A;  1LTG D;  4ZKC B;  4DR7 L;  4J9L A;  1BKB A;  3PUW A;  3OHB A;  5COY A;  3KAL A;  4A3I G;  1VQ4 A;  3GV3 A;  3ZJY C;  2NU9 B;  5FK9 C;  1ONL A;  4BXX G;  4DR3 Q;  1EYA A;  3PO2 H;  2R93 B;  1E4F T;  2ZJP A;  2F0K A;  3G6J B;  1BXR A;  2CW8 A;  2VR1 A;  1L0W A;  2YW2 A;  2UXC H;  4JOI C;  4WOR A;  5LL6 X;  5IWA Q;  3J81 E;  1RIP A;  5KNB A;  3J7A V;  4OO1 I;  4QWC A;  4ED8 A;  3WWV A;  3TS0 A;  2IY5 B;  2JEG A;  2V4D A;  4CGY B;  4H44 C;  4HNU A;  3J81 L;  5JQW A;  1PA6 A;  4MV4 A;  4EEQ A;  3GIJ A;  4QB4 A;  3OYY A;  4J9P A;  1VS0 A;  3CRK C;  4C3H B;  2J6T A;  2Q2I A;  3ONA B;  2FMM A;  3SE0 A;  2YRW A;  2NVT B;  4UP9 A;  1JCK B;  2ZT9 C;  4IQZ A;  2A6H C;  5J1Z A;  1ET9 A;  4YCU A;  5IGG A;  1NJI C;  4EGV A;  1EYG A;  4ECW A;  1RTO A;  2B63 H;  2XSC A;  4ETS A;  4DR2 H;  3EPI A;  2BH2 A;  3LWB A;  3Q6S A;  1K1Q A;  3NTH A;  2F0G A;  2Z4I A;  2E2D C;  2R7F A;  1WCM H;  1VQA A;  4L8J A;  1KTK A;  2VB3 X;  2F0J A;  3A55 A;  3Q23 A;  3V4Z A;  1SMY C;  5H1S E;  3AYH B;  1E1O A;  1Y1W H;  4EBD A;  2RQX A;  2MGS A;  3D6W A;  4X6A H;  4RWS C;  3S2D B;  1WTW A;  1WSC A;  3Q8P B;  2R8K A;  4WRD A;  5KRU A;  5GON F;  1TWC B;  5D3I B;  1IKM A;  3HGB A;  3V4S A;  4CC6 A;  2R3Z A;  5EWG A;  2GN5 A;  2VQE Q;  3I4M G;  4KKU A;  5L1I A;  4HNV A;  3R5X A;  4APM A;  3DXJ C;  3JAM W;  4DR1 H;  2XCA A;  2EY1 A;  4K6D A;  1Z47 A;  4JOI A;  2YZG A;  1WTO A;  5L9X A;  2KVM A;  3W2D A;  3VA7 A;  4KY5 A;  1UNS A;  4KY7 A;  3CCR A;  1R9T A;  4DR2 L;  4OWW B;  2RSO A;  4LWC A;  4MIU A;  1EWI A;  1S5F D;  4QL5 A;  4J1M A;  2YL2 A;  2PI2 A;  1XMO Q;  1NMF A;  3T56 B;  2F4V Q;  4ME6 A;  2YS7 A;  1VF5 C;  1XX8 A;  4BBR H;  2ES2 A;  1Z9F A;  1JIH A;  2E8G A;  3LNN A;  1TAE A;  3W1B A;  4KJO A;  3H3V I;  3AMU A;  5M5Y B;  1BO0 A;  1N33 L;  1TWC A;  3VR6 A;  5EZY F;  4A3B H;  5I2Y A;  1WTH A;  1BOS A;  2XIW A;  3MR5 A;  4DK1 A;  3GTP A;  1EEI D;  4DV4 L;  5A2Q W;  2CFM A;  3WDN A;  3DM3 A;  1PTO B;  1SAP A;  1S72 A;  2WYO A;  3TQ1 A;  1UAP A;  1KNA A;  1O7Y A;  2CW0 D;  2X6L A;  2F0P A;  3RN2 A;  2NZO A;  5IT9 L;  4LF4 Q;  3QZ7 A;  4X3T A;  2JA8 B;  1I4P A;  3O13 A;  3H94 A;  1Y1V A;  3AFP A;  5KG7 A;  2EPB A;  5I2X A;  3I91 A;  4JUZ A;  4DR7 H;  5KG0 A;  4FF2 A;  5IT9 E;  1LTA D;  1JWU D;  2BE5 D;  2I07 B;  5FPO A;  1CHQ D;  3CF5 A;  1W2B A;  4BA1 I;  1JDE A;  2F1M A;  4LK1 C;  3PW7 A;  5KT5 A;  1J5E L;  3MXG A;  2ZDG A;  4A3J G;  2OTJ A;  1E2Z A;  3IL8 A;  1CSQ A;  4E6I A;  1Q8K A;  3K0X A;  4F4W A;  1EQR A;  2SNS A;  3I73 A;  1QWY A;  4JI1 L;  1C30 A;  4N9P A;  4RZR A;  3RAQ A;  2UUC H;  3RFC A;  4X62 L;  1Q12 A;  3J7A 5;  4QWB A;  2UU9 H;  2EY6 A;  1M90 C;  1MJE A;  1GM5 A;  1IBM L;  1E1T A;  3FKI H;  5EGT A;  5BR8 Q;  2NVX B;  3GTG H;  3W1G A;  4C1N I;  4Q8F A;  2VQE L;  4QCL A;  2L55 A;  4DK0 A;  4JYA L;  2QA4 A;  2TMP A;  1U0L A;  1V8Q A;  4B3M L;  1TQO A;  5D1O B;  5KFG A;  4YR0 A;  3MR6 A;  4TQS A;  3OSP A;  4L5T A;  5KFB A;  5BMV F;  4DV1 H;  1KJJ A;  2JA9 A;  1VQ7 A;  1LTL A;  1R4Q B;  3URY A;  1CHP D;  4AYB B;  1C7Y A;  3G8C A;  4JV0 A;  1SE3 A;  1E2V A;  1IHZ A;  4IUN A;  4DXF A;  1WD1 A;  1N33 Q;  1I50 A;  2BDN A;  3TIG A;  4DV1 L;  3SHL A;  2MPM A;  1LTR D;  1SLJ A;  3FDS A;  2CCZ A;  3V2T A;  4JYA H;  3UDG A;  1HNZ L;  5KFC A;  2JEB I;  3MR3 A;  1LM0 A;  2NN6 I;  1U4M A;  2OCE A;  3UFX B;  1T3N A;  2M9V A;  2W9A A;  4K0K Q;  2ZXP A;  3ND8 A;  3OOC A;  4JW0 A;  2FLL A;  4IPD A;  4K14 A;  2AU0 A;  4X62 H;  3HOY G;  4DR7 Q;  3EA6 A;  1T5X D;  4NMZ A;  1PZK D;  2ASD A;  5C0X G;  3S1R B;  1IL8 A;  4AYB A;  4ABN A;  2RDG A;  2K5N A;  4OO1 H;  2A19 A;  2PW5 A;  1GVP A;  3K5M A;  3TZU A;  3K5O A;  3HRZ C;  4DR3 H;  1SYE A;  3DWP A;  2UU9 Q;  3PW5 A;  2HVS A;  3KTM A;  3AU7 A;  2BA1 A;  1CM9 A;  4LF5 L;  4HIM A;  2WKD A;  4YCW A;  1GHK A;  2MO1 A;  3GO5 A;  4MV8 A;  4P2C B;  5KFP A;  4A3L G;  5HGT A;  1PX2 A;  4DV0 L;  3T51 B;  3OMG A;  4IR1 A;  2KQ3 A;  3GD7 A;  3PR5 B;  4KY6 A;  2RVL A;  2VL6 A;  1DZ1 A;  4QWA A;  1OXV A;  4HJ8 A;  3N41 B;  5KFW A;  4PZ6 A;  2R7Z G;  1PH6 A;  3H0G B;  4RGN A;  4DUY L;  1IZ6 A;  4J9K A;  4AYB G;  1FGU A;  1OO9 B;  1XPO A;  1N33 H;  1KJQ A;  3RNU A;  2PZW A;  3SGI A;  5CGK A;  4R8U A;  2FLN A;  1NTG A;  5M3F H;  2PVP A;  5LL6 b;  2KCN A;  1CQI B;  3HOW G;  2JK8 A;  4IAJ A;  4FXD A;  4JI7 H;  2H5X A;  1EY7 A;  2PZU A;  4DAM A;  3T5K A;  3L0O A;  2V5A A;  4CBV A;  1UEB A;  2PNH A;  2JA6 B;  4C3J B;  4X62 Q;  2AGQ A;  2LXJ A;  2RF4 A;  4NXM L;  3VYS A;  3GTL H;  2KSW A;  2EVB A;  4POF A;  3UDI A;  1NY4 A;  3GIL A;  5C3E B;  5GQO A;  3NK9 A;  1GJX A;  1TWA A;  1V1O A;  1SYX B;  2D0O A;  4JI8 Q;  1SRU A;  1S40 A;  5DG7 A;  3HOU G;  2UVV A;  4B3R H;  4NXM H;  2KHJ A;  1B3Q A;  3GTQ A;  3CQZ A;  1BVS A;  3CCV A;  2YS6 A;  4QGU A;  4YJ3 F;  3NUC A;  4BS9 A;  2F4V L;  1N56 A;  1RL2 A;  2A69 D;  3M9O B;  4IR9 A;  2QEX A;  3CCU A;  1YNJ D;  2FB9 A;  1EY0 A;  3T16 A;  2NVQ B;  2JEA I;  1KC7 A;  2AGP A;  3K6O A;  1O80 A;  3S1N B;  1A6X A;  1UE6 A;  1IL2 A;  4MNO A;  4DUY H;  3RBE A;  4C3J G;  2E2I A;  4PQX A;  5TSS A;  4QW8 A;  1SFO B;  1JMC A;  4IOA A;  2VS1 A;  2WB1 E;  1TWA B;  4IRD A;  2XRQ D;  3GV6 A;  1I6H H;  3PUZ A;  3ORQ A;  2J9G A;  2QW7 A;  2K4K A;  3AB9 A;  1IKL A;  1Q1B A;  2DJF C;  3CQZ B;  4OIJ A;  4HJ7 A;  4PMB A;  4XYO A;  2EYO A;  1QCB D;  3CCQ A;  1AP0 A;  3KDF B;  4TRD A;  4LF5 H;  4A93 G;  2UXD L;  1EYZ A;  3NEM A;  1G29 1;  4XQQ A;  2WP8 J;  1KXL A;  1W6K A;  1PFS A;  1GSH A;  1JXL A;  1HA5 A;  2F0V A;  1C3O A;  1Z2P X;  3KUP A;  2ASL A;  3H15 A;  4ECX A;  1JB3 A;  2HIV A;  4GKJ L;  1S5E D;  3T1H Q;  5KYI A;  2IBK A;  2JEI A;  2Q2T A;  1K8O A;  2KCT A;  3GTP B;  2FK2 A;  2XCL A;  4DR4 H;  1G91 A;  1GUO A;  2K03 A;  3EN2 A;  4DUZ Q;  4JI0 L;  2K6A A;  2JA6 G;  3A8I E;  1NSN S;  4HTH A;  1ZQ7 A;  4I4T F;  3R5F A;  2WAQ G;  4RUA A;  1HNX Q;  2JA7 B;  1A0I A;  4CKC A;  4RFB A;  3FPU B;  1Z6H A;  1STE A;  2WB1 G;  3KF8 A;  1B50 A;  1HUN A;  2BE5 C;  4FNF A;  4R7R A;  2Z9H A;  3PF5 A;  2R84 A;  3KHR A;  5M3M B;  5C4J H;  4HSP A;  3DMU A;  3QOJ A;  2IX1 A;  2Y0S E;  1TT2 A;  2NWG A;  2IA6 A;  1SCU B;  3RZO B;  2A69 C;  1I4R A;  2I0Q A;  2ZJQ A;  1M6V A;  1KRT A;  3HKZ A;  1DGS A;  3A8J E;  3HP3 A;  4LF7 Q;  2SDF A;  1ROD A;  2EZV A;  4EYH B;  1S9F A;  4CJ2 C;  5EKL A;  1PTO C;  5JJL A;  4ZUI A;  4A4I A;  1PHJ A;  1M8A A;  2F0N A;  2WAQ B;  1Y8P B;  1GYF A;  1MIU A;  1TWH H;  1S0O A;  2SEB D;  4AYB E;  5ELD A;  1FJG L;  4DR6 L;  1JWS D;  4IZ8 A;  1M4V A;  2NVY B;  4R4Q A;  1CS0 A;  4DUZ H;  2AGO A;  2E74 C;  3VPC A;  1S0M A;  1YJN A;  2VUM G;  4M7E A;  4APV A;  2J7Z A;  2RGR A;  4RB0 A;  2I8C A;  1JX4 A;  3S15 B;  2B39 A;  4MTN A;  3KF6 A;  3CD6 A;  2GPW A;  4JK1 C;  4YBZ B;  2HHH H;  4O3R A;  1R9T H;  4DAY B;  1LT5 D;  4ZRZ A;  3J80 W;  2K05 A;  4OEL B;  1LTB D;  4ZQI A;  2VUG A;  4JV5 L;  2E2H B;  5F9L A;  2EY5 A;  2MO0 A;  1M0T A;  3F8N A;  3BVZ A;  2ZDH A;  2C28 A;  4ULL A;  4QIW A;  2IHF A;  2W7P A;  4RMF A;  1WVL A;  3Q8R B;  3CC2 A;  5LMU L;  3LP8 A;  2UXD Q;  3R2I A;  5J2U F;  3I3C A;  3HOU B;  2R92 B;  5C5J A;  1X56 A;  2XNA C;  3R93 A;  1R4P B;  2A6H D;  4J9N A;  1PYB A;  2LFN A;  3PMF A;  4DUZ L;  4LF6 H;  1IYJ B;  1SRO A;  2WAQ E;  3GDE A;  4YCV A;  3RB4 A;  4E4T A;  1RK6 A;  5M3M G;  4OWT B;  1RF2 D;  1X55 A;  2JE6 I;  1U9R A;  4O3N A;  1T9H A;  4ZYS A;  2VUM H;  4RZQ A;  5KG4 A;  5DLG A;  1D5Z C;  5KFI A;  3BZC A;  3RV3 A;  4RAU C;  1FL0 A;  1XTC D;  2K14 A;  1YNX A;  3OSO A;  1Z2O X;  1LAC A;  3S17 B;  4IRK A;  4RNN A;  1A62 A;  4AQY Q;  4GKJ H;  4IWY A;  4OGQ C;  3S1M B;  3OHA A;  4UP8 A;  4GKK H;  1ASY A;  2JQO A;  1TU2 B;  3ERQ A;  4MA5 A;  3GTL A;  2HD3 A;  1EOV A;  3FKI G;  2K5W A;  4LNQ A;  1TY2 A;  4JI4 L;  1V1P B;  1KDC A;  4HJA A;  1EQV A;  2HVR A;  1B1Z A;  2N78 A;  2UUA H;  4DV2 Q;  4O4I F;  2M00 A;  4GLV B;  5IGB A;  3GTJ H;  2YU9 H;  3JC6 6;  2XN9 C;  4FDB A;  3T5H A;  3TRE A;  2JP1 A;  2R8H A;  1T5E A;  3MFG A;  1KIX A;  4P71 A;  2NB0 A;  4YIJ A;  1B6R A;  1VBG A;  1BNZ A;  3VA5 A;  2X6G A;  1TII D;  3LML A;  4NKL A;  2WKC A;  4H13 C;  1DJR D;  1RYR A;  2NVX A;  5M5X B;  1ZHS A;  2AKW B;  1TKW B;  2Y0S B;  3QR8 A;  3CP0 A;  5LXT F;  1STB A;  4JI2 H;  3J80 c;  4C2M H;  3HOV H;  3GTG B;  3J81 W;  5KGU A;  1CKN A;  1RD9 D;  3J80 L;  3TP6 A;  4Q43 A;  1K83 A;  4JI5 L;  4UCO A;  3L4J A;  4IJH A;  2PMZ A;  1CQF A;  4OL7 A;  4H02 A;  3MFH A;  2B2W A;  2LKV A;  1E24 A;  4KHP L;  4LF9 H;  2OF1 A;  1EZ8 A;  3TP7 A;  5I6W A;  3H40 A;  1FR3 A;  4AQY H;  4EX5 A;  3I12 A;  1PMR A;  5M5X H;  3KHG A;  1Q86 C;  1PRT F;  3K58 A;  4I7Z C;  3NBH A;  4DAP A;  2JA8 H;  3S16 H;  2Z6B A;  3S2H H;  4KKS A;  1V1Q A;  4X64 L;  2RGV A;  4KV6 A;  1XPU A;  3HOZ B;  4A3G G;  2HDM A;  5J2T F;  5L37 A;  2JYO A;  2R92 G;  1BJT A;  2NU6 B;  3E5N A;  1RJP A;  4A75 A;  1A2U A;  3CQZ H;  4I7A A;  4LF7 H;  1QNK A;  5KFA A;  3GTQ H;  2VNU D;  4JV5 H;  3GTK A;  4KD3 A;  1SYD A;  2PO4 A;  2ZXO A;  5CV8 A;  4CJ0 B;  1HR0 W;  3H0G G;  1TWG B;  1I94 H;  4TUY F;  4ZUJ A;  3H20 A;  2K33 A;  3S2H B;  3H4B A;  5EBD A;  4LF9 L;  5E4W C;  1SYF A;  4A3D B;  4DV0 H;  3KBG A;  2RHS B;  4A3E H;  3RGZ A;  1UNN C;  4OON A;  1SDF A;  3X3N A;  2EXZ A;  1X6O A;  2F0L A;  3A0J A;  5GAH C;  2KCM A;  4UHV A;  3N6X A;  2H1E A;  1PFB A;  3BQ1 A;  1WR2 A;  4UCT A;  2UXC Q;  4B9W A;  2K01 A;  1NAP A;  1OXX K;  4N8X 1;  4ZKB B;  4P72 A;  3U4V A;  3MVV A;  1XMO H;  4HSV A;  4DV2 L;  2FK1 A;  2KBN A;  1BCP F;  1VBH A;  1GGO A;  5BPH A;  4LFB H;  2EYF A;  4KHP Q;  1E0B A;  5KNC A;  1X32 A;  3BVM A;  3PIP 3;  1HCZ A;  4Y52 H;  2VA3 A;  1IBL H;  4ME5 A;  2YYZ A;  5I47 A;  1SR3 A;  5D3D A;  3C0F B;  4J8Q A;  4U7C A;  4DLK A;  1VCI A;  2AWO A;  2UXB H;  4QMG A;  1K3R A;  2R92 H;  4HJ5 A;  3GQC A;  3BQ0 A;  2R7Z A;  1EY9 A;  2PNR C;  5C4X H;  3EYY A;  2O03 A;  1YHA A;  1N36 H;  4BXX H;  1EU3 A;  1J8I A;  2X0S A;  1FVI A;  4UCR A;  1VQL A;  4DR5 Q;  4C3J H;  4HR7 B;  1RJT A;  2F3I A;  1BF4 A;  1BGW A;  3P1H A;  2F0Q A;  3M4O B;  5JOB A;  5A2Q E;  1JWM D;  5DGB A;  3CPF A;  4J0M A;  2F0D A;  1AUV A;  3PVX A;  1RYS A;  1HFG A;  1R9T B;  2BDO A;  2W6Z A;  3UE0 A;  2ZM6 H;  1XNR H;  1QNU A;  2FPP B;  4ZAI A;  5J3B A;  3D31 A;  1TA8 A;  1ZET A;  5C44 B;  1EHI A;  2FMA A;  4JI0 H;  4C3I B;  4ED0 A;  1WD0 A;  5K2M A;  1OXU A;  2R6G A;  3D6C A;  5C0X J;  4QUC A;  4DV3 H;  4MHE A;  1RHP A;  2IT1 A;  5BR8 H;  3HB9 A;  4PNY A;  1D5M C;  4AQY L;  4LF9 Q;  3S15 H;  3OSN A;  2XTI A;  1V9P A;  1Y1W G;  2KED A;  3T1Y H;  4A3J H;  5CBE E;  2NN6 H;  5KEE A;  1S4Z A;  4KHP H;  2EQS A;  3OIQ A;  5HGQ A;  1GSO A;  1VQB A;  4DNI A;  2IL8 A;  3RLF A;  3BA8 A;  4B3M Q;  2M2L A;  4L5R C;  2JSO A;  3BA9 A;  3Q0A A;  5LA6 F;  3PW0 A;  4Z9C B;  5EBC A;  3A74 A;  3VYT A;  3N52 A;  2W6M A;  4KLK A;  5FO7 B;  1B3A A;  2W70 A;  4PWQ A;  1ZEQ X;  4IPC A;  4DR5 H;  1Y1V B;  4BBS B;  3KJO A;  3DM1 A;  1I4G A;  5C6A A;  2V4R A;  4XQJ A;  5LP6 F;  4BY1 G;  5LHY 1;  1C8C A;  4HJ9 A;  4WD3 A;  2G5D A;  4C56 C;  2RBM A;  1U4P A;  1Q7Y C;  1EL0 A;  5IP9 H;  3RTX A;  2F0H A;  2EYJ A;  4BY1 B;  2M05 A;  3KXY T;  5IYC H;  3PO3 G;  2C9O A;  2SCU B;  3G71 A;  4A3K G;  1MJC A;  4LFB L;  4L5Q A;  1WH2 A;  4LFA L;  1D1K A;  4MTE A;  1YEZ A;  4HIK A;  1OWT A;  2RCF A;  2WFW A;  3TS2 A;  4FXG C;  1CUK A;  2PI2 E;  3GTK H;  1JT8 A;  2JA7 A;  1YBY A;  1F9Q A;  4HCS A;  4A76 A;  3T5L A;  5C0X I;  2K75 A;  1B04 A;  3OUZ A;  1FYC A;  2ZTC A;  1LV9 A;  2J0T D;  4GN3 B;  5FLX L;  3AEV A;  1JB7 A;  1X3G A;  1ULZ A;  2OH2 A;  3GV8 B;  5KT3 A;  3PW2 A;  5AFW A;  2F0S A;  4XT1 B;  2NN6 G;  2FJZ A;  4EGQ A;  1TWF H;  1JE4 A;  2RSN A;  1TY0 A;  1GLV A;  4FBT A;  2YTV A;  3TN2 A;  2KUM A;  2NTT A;  3VR4 A;  3W5O A;  4DU9 A;  2GLT A;  4GC6 A;  3I56 A;  1QJO A;  4F4Z A;  3F2C A;  3CCE A;  2W6Q A;  4GZY C;  3F8T A;  3MXP A;  2VW9 A;  2A68 C;  1PH8 A;  4A3C H;  1QVF A;  1DD2 A;  1S5C D;  5KFF A;  2UUB L;  3CCM A;  1KAA A;  4RHR A;  2V9W A;  3I8Z A;  2CH4 W;  4JV2 A;  4IUQ A;  3KJP A;  3OWF A;  4JYA Q;  2L1B A;  3BDO A;  4TKO B;  1ENC A;  1ET6 A;  1JOO A;  2PMZ B;  1KD1 C;  2OEO A;  5KFT A;  2L11 A;  2Z8L A;  4X65 L;  1GUN A;  5FO8 B;  2NU8 B;  2R7N A;  1I6V C;  4LUZ A;  3TEH B;  2F03 A;  4AH6 A;  1PH1 A;  1VQG A;  4MV6 A;  2W7O A;  1I6H B;  1EIH A;  2F0O A;  3RV4 A;  2R8G A;  2R93 A;  4IOC A;  2C5C A;  4O3O A;  1B9N A;  3UDF A;  3G4S A;  1EQT A;  4A3M G;  4YWM A;  1II3 A;  4FF1 A;  4DR1 Q;  2NU7 B;  1LT6 D;  2X69 A;  2VB2 X;  4JBK A;  1PYS B;  3EFX D;  3S17 H;  1G51 A;  3F2D A;  2W9C A;  1SYC A;  4ODG A;  1SJH D;  2A74 C;  3IFD A;  4M9U A;  5KG2 A;  3RR5 A;  3H09 A;  3QG1 A;  1WCM A;  1G2T A;  4LAA A;  2VUM B;  4GNX A;  1SE4 A;  1B4O A;  1EEF D;  2DNE A;  2B2T A;  2A5H A;  2CQO A;  2IX3 A;  4LFB Q;  4G7Z C;  2ZJR A;  1HNX H;  4GLA C;  1Z7T A;  5C44 H;  3A7A B;  4IPH A;  3ZYY X;  4LFC H;  5CA0 F;  4ED6 A;  2MNA A;  4IWX A;  3BDL A;  3D8G A;  2FHT A;  3UE1 A;  2L12 A;  3Q2O A;  2W9B A;  1PZI D;  1BBW A;  1I94 L;  1UC9 A;  1G6P A;  3MHB A;  4CDF C;  2A6E C;  1XJV A;  2I87 A;  4Q8E A;  4LH7 A;  2HCI A;  3SR1 A;  3M4O H;  2JA5 B;  2OQK A;  4K2K A;  4DA2 A;  5IGE A;  1QVG A;  3QB3 A;  1GUT A;  1N48 A;  3BS1 A;  5K5P A;  5KKN B;  1KDB A;  1N32 Q;  2EYM A;  1BCP C;  1EIY B;  1O78 A;  1VQC A;  3NTK A;  2B63 B;  3T1H L;  5C4X B;  3BZK A;  3GV7 B;  3V6J A;  2DIK A;  2AHO B;  2VQE H;  1CQV A;  2JJQ A;  2DJG C;  1YJW A;  3K59 A;  1PH4 A;  4X64 H;  2EXD A;  2ATW A;  3HBL A;  1F2M A;  2PBZ A;  4R8I A;  1KNE A;  3CME A;  1G2S A;  4JI1 H;  3RBD A;  1V51 A;  5KX5 F;  2P0A A;  3H3V H;  4PZ7 A;  5LMN H;  3Q8Q B;  4OWX B;  3I4N B;  5G3L D;  2CWA A;  1N9W A;  3PO2 G;  3MXU A;  1SFO A;  4HYK A;  4F87 A;  2IMW P;  2KJX A;  4Q0F A;  3JAM L;  5JVD F;  3PO2 B;  3KK7 A;  2R93 H;  2R61 A;  2SOB A;  1HNX L;  2OLS A;  3PIP A;  1S10 A;  3VMM A;  1AE2 A;  5AJ3 Q;  2ICI A;  4U67 3;  1YNJ C;  2N88 A;  5FO9 B;  2E76 C;  5HV6 A;  2XD4 A;  1TWG H;  5KT2 A;  1LT3 D;  1GUG A;  3RZD B;  2CKZ B;  4WJ4 A;  4P74 A;  3JRX A;  2AQ4 A;  4ECV A;  4ED7 A;  4BA2 I;  1I4H A;  4DK3 C;  4YY3 L;  3K7U C;  1K83 B;  4B3T L;  3DF7 A;  5L1K A;  1AFP A;  3T4A C;  3HS0 C;  3Q1K A;  1PTO D;  3JSL A;  3DWA A;  4O3S A;  4C5B A;  1TVX A;  3NWT A;  5DQI A;  4JI6 H;  1WTV A;  2E2J B;  4K0K L;  4YQW A;  1MSH A;  3MC0 B;  5ELN A;  2PQA A;  1S5B D;  1L2F A;  3WOF A;  2V1C C;  4FS2 A;  1VQD A;  1SN8 A;  4HNT A;  3HOX G;  2A8V A;  1BXT A;  2GVB A;  1MD2 D;  1STN A;  1O7L A;  4BY7 B;  1NR4 A;  4GKK L;  2XIG A;  5JUM A;  1XMO L;  1SXT A;  3NTI A;  2F4V H;  5IT9 c;  1VQK A;  2KHI A;  4A3D G;  5KIX A;  4FBU A;  1EWH A;  2MCT A;  3CC4 A;  3MTS A;  3KLW A;  4XTC S;  5E7N A;  3ND9 A;  2B2U A;  2AUJ D;  3H0G A;  3D4D A;  4XYQ A;  4B9X A;  1B7Y B;  5DM7 3;  1Q1E A;  5T14 A;  3HKZ E;  3PN1 A;  4LH6 A;  4RU9 A;  2ALZ A;  2BCO A;  3M9B A;  1YVC A;  4LJZ C;  3J81 j;  3DLL A;  1L0X B;  3VR3 A;  4LF8 L;  3A5Z B;  2AQ2 B;  2Q2U A;  1CZW A;  4FXK C;  3DEP A;  5IIF A;  1CSP A;  1CK1 A;  3Q8S B;  4BY1 H;  1STH A;  1N34 L;  4J9S A;  1YNN C;  4CDC C;  5FKA C;  2HCC A;  4EFB A;  1J5E Q;  1CKO A;  1M1K C;  1HFN A;  3E5S A;  5IOD A;  1PTO H;  1HTP A;  2EJF C;  4K0K H;  3CAM A;  5KYL A;  3JZI A;  5KFR A;  3MWY W;  4Y7N H;  2RHQ B;  4BBR B;  2RA4 A;  3S9W A;  2A6E D;  4R1J A;  4G7H C;  2HJW A;  4J9Q A;  5KG6 A;  3TP5 A;  2AQ3 B;  3JRW A;  3NWS A;  1Q46 A;  3J80 i;  2MFI A;  3SEB A;  2L4N A;  4JI1 Q;  2NZ1 D;  2NVQ H;  5DLF A;  4DR4 Q;  2Z6K A;  4QJF A;  4DV3 Q;  4MTK A;  2RDF A;  4F8M A;  3V6K A;  4DGZ A;  5KFU A;  1ILP A;  1JOQ A;  3MEH A;  1B33 N;  2I5L X;  1RCV D;  2B3G A;  2PQE A;  3BAB A;  1F9S A;  2O2L D;  2DPI A;  1KJ8 A;  2K5V A;  3BAA A;  2Q8R E;  4U68 A;  3ULP A;  2R92 A;  5IYB G;  4B3T Q;  3SE7 A;  2Z6K C;  5IYD H;  3I2Z A;  3H3V C;  3K3V A;  5D14 A;  1E4E A;  4DR6 H;  2BQ3 A;  3ORR A;  1GOZ A;  3MWD A;  2FJ2 A;  4GN5 A;  4EQ5 A;  1X3P A;  2W9C B;  2JA6 A;  2D9U A;  3S14 B;  3K57 A;  3K5H A;  1EIF A;  4X66 H;  1PVO A;  4KJN A;  1BBX C;  3CPW A;  1NR2 A;  3EVQ A;  3BYT B;  3DWQ A;  1WCM B;  2EYP A;  5IWA L;  3IAY A;  1K0S A;  4YJ2 F;  5H80 A;  1HNZ H;  1HUM A;  3I4L A;  2DN8 A;  4LSA A;  2PZT A;  3HOZ G;  4DR5 L;  3ERO A;  2ZJT A;  3M4Y A;  4GNX C;  2L15 A;  5CV9 A;  1DON A;  1HR0 Q;  1JJ2 A;  4I7H A;  3CC7 A;  1N34 H;  1A8V A;  3V05 A;  1UEA B;  3FMC A;  1N34 Q;  2GPS A;  1N8R C;  2O4X A;  4C3H H;  3PUV A;  1ZXT A;  3HKZ G;  4TVA B;  5C5M A;  4LF8 Q;  1D7Q A;  3F2U A;  5F9N A;  2I5M X;  4A3F H;  2HT1 A;  4QWE A;  1VQP A;  3RD4 A;  2PYK A;  2QK4 A;  2CW0 C;  4OX9 Q;  2VQF H;  4J9O A;  3NHH A;  5CV4 A;  2YTY A;  4DV3 L;  2RKS A;  1IBL Q;  4ED2 A;  5IYD G;  3J81 c;  4MAM A;  2K7V A;  3M7G A;  2FMC A;  2VZA A;  3PR4 A;  3RGX A;  1EZ6 A;  2YZN A;  3BDC A;  4C5C A;  3H4D A;  2QKI C;  2UVU A;  2B2W C;  5JEA H;  4A3L H;  3D0F A;  3K5N A;  5FPR A;  1U4L A;  1WI5 A;  3STB C;  5JEA J;  1QUQ A;  1ZKO A;  4DL3 A;  4HQ6 A;  4JI5 Q;  4LUV A;  3KHL A;  3JSN A;  5C1O A;  4ZOL F;  4IFD G;  5L1L A;  2WDT A;  2EJM A;  1FJG Q;  3HOZ H;  4FS1 A;  1VQO A;  4PZ8 A;  4ECU A;  1FKA H;  3L7Z C;  4JI6 L;  2BQR A;  3U9O A;  4A3G H;  1OXT A;  2JEF A;  2VA2 A;  4IRC A;  1HNW L;  3RN5 A;  5A35 A;  2CW7 A;  2W6P A;  5IGF A;  4C2M A;  4K5W A;  1PH5 A;  1K28 A;  4G4K A;  1XWE A;  4XXE A;  5M3M H;  4X64 Q;  4LF7 L;  1CE8 A;  3V6H A;  4G7O C;  1T36 A;  3BZD B;  4YR3 A;  5J39 A;  3RB3 A;  2VXW A;  4EYI B;  4DV4 Q;  4OX9 H;  2FKL A;  1Y1V G;  4BBS G;  1W6J A;  1I4X A;  1TWF B;  4I50 F;  1MGS A;  5FD5 A;  3HZX A;  5I9O A;  1C48 A;  4QUF A;  1DV1 A;  5FLM H;  3MWM A;  3TII A;  1VQ6 A;  2E2H A;  1MSG A;  2YYA A;  1KLG D;  4QF4 A;  2R87 A;  1U4R A;  3G48 A;  3GTK B;  3X3M A;  2GVA A;  2QDL A;  3R2T A;  5EKK A;  5F2D A;  4GLX A;  4IZO A;  4DL5 A;  1XMQ H;  5KT4 A;  2C2E A;  1HXY D;  2XGT A;  4FVM A;  2WIN B;  3KYH C;  5NUC A;  1TXY A;  4L5S A;  5EJW A;  1RK5 A;  1ASZ A;  1K83 H;  3TDQ A;  3WOE A;  4POG A;  1TWG A;  2VQD A;  3GTJ A;  1H95 A;  1HJP A;  4A3B B;  5E4X A;  5EKI A;  2XGP A;  5KFM A;  5KFZ A;  4RGO S;  2NVY A;  3ERS X;  2R7Z H;  2VUM A;  5JJI A;  2K5D A;  5FJ8 G;  2EY2 A;  1SFO H;  4EGJ A;  1TS5 A;  4J9R A;  4NPS A;  4K2L A;  2JN4 A;  1K3B C;  1GO3 E;  3I7F A;  2LXK A;  1LO5 D;  5JVG 3;  4ZK9 B;  2V4Q A;  2IPK D;  2UUC Q;  2D5D A;  3S1M H;  2O5I C;  4UCS A;  5LMN Q;  4DV7 Q;  2W6N A;  4LW1 A;  2QF7 A;  1SNM A;  1SE8 A;  1A3V A;  3FRP B;  5FLM G;  2OT2 A;  1F2Z A;  5EAY A;  4EG0 A;  4JBW A;  3NXW A;  4YHH L;  1JLL B;  3PGZ A;  2QIL A;  4Q45 A;  2R7Z B;  2Z1C A;  3PW4 A;  4J6H A;  4JI4 H;  4DR4 L;  1TWC H;  4K8J A;  4FP5 D;  4YWL A;  3SK8 A;  2E2I B;  5EQ0 A;  1WYD A;  4G57 A;  1BUV T;  3PSI A;  5C3E H;  3N8D A;  4NXN Q;  2W57 A;  5IP7 H;  4PG3 A;  1MZB A;  2Z0S A;  3GIK A;  2F0T A;  1SNC A;  5M3F B;  2JA8 G;  1O75 A;  3MR2 A;  4KN7 C;  2R85 A;  1IYV A;  2UXD H;  4HMI A;  3M85 A;  1Y1W B;  4YHH H;  1HRJ A;  1STA A;  4UDU C;  1VQN A;  1HNZ Q;  1KJI A;  4DL2 A;  2ZDQ A;  2F0I A;  4CDE C;  2RDI A;  3VPD A;  3C1E A;  2PPB C;  3S14 H;  5JJK A;  3BG5 A;  3L9A X;  1VMP A;  3D3R A;  4GS3 A;  1H9K A;  1SYG A;  3EQL C;  1I3Q A;  2XVS A;  1J9O A;  3H0G H;  3KFU A;  1E22 A;  2K52 A;  3KBX A;  3BG3 A;  1O7Z A;  4U6P A;  5C4X G;  3BJY A;  4LF8 H;  2CWP A;  3J7A K;  3R5H A;  2MUY A;  1ENF A;  4L1K A;  2MP1 A;  1Y8O B;  4WJ3 M;  4IAL A;  1K8M A;  3P20 A;  1E3P A;  4R4I A;  3MJF A;  1DOK A;  1W3S A;  5ELF A;  4A3K H;  1TWH B;  1RTN A;  4M8A A;  3FEW X;  3S1R H;  2VQF Q;  2QCP X;  4MV1 A;  3C46 A;  5JAV A;  5D1P A;  3T53 B;  2NVY H;  2UXB Q;  4QW9 A;  1PXU A;  1B2T A;  4N8F A;  2WB1 B;  4LF4 L;  1TS3 A;  5ELB A;  3CXC A;  1UC8 A;  1PH9 A;  2BOS A;  3Q24 A;  2RCN A;  1X3Q A;  2C35 B;  4GOP A;  4TQU S;  1E7Z A;  2HHH L;  4A3D H;  3E9I A;  3E9H A;  3U9S A;  3RB6 A;  1CT1 D;  2KOL A;  3HOW B;  3BQ2 A;  1M0W A;  1RJR A;  1I4Q A;  1WOC A;  5FOB B;  4JI3 Q;  5IT9 W;  3RZO H;  2ID0 A;  3QO2 A;  1IXR A;  3I4M H;  1U5K A;  4H0L C;  4O42 A;  2PN1 A;  5CYU A;  3SK4 A;  4OHJ A;  4XT3 B;  2F0W A;  4JI7 L;  2DZD A;  3NBI A;  3G7L A;  3WNZ A;  4YWK A;  1A3U A;  2E5L Q;  5FD6 A;  4A3C G;  4GOP C;  1XYI A;  3SI8 A;  5DQH A;  4JI8 L;  1IBK L;  4FU0 A;  2A68 D;  4NP5 A;  1K9M C;  2JA7 H;  1ICW A;  4RNO A;  2FFK B;  2E75 C;  2Z4H A;  3LX0 A;  4TSS A;  3R8B A;  4IHJ F;  2B2V C;  1HZC A;  2UXC L;  5C4Z A;  4NXM Q;  1SMY D;  4A3F B;  2EYL A;  4JI8 H;  5EOY A;  4EEY A;  2JXM B;  4ECS A;  1YHQ A;  1QUQ B;  4O3Q A;  2P5Z X;  4A3F G;  3PCO B;  1H9S A;  1AE3 A;  2AQ1 B;  1ZYR C;  5CV5 A;  3MWE A;  1ILQ A;  4KI0 A;  5GAG C;  4BY7 H;  2AMC B;  2FXQ A;  4R4O A;  3NEN A;  3CCL A;  1QZG A;  4RNM A;  3E0J A;  4RKB A;  1K1S A;  3GTM A;  1Q82 C;  4UPA A;  2DGY A;  4B3S H;  4HN7 A;  4JC0 A;  3PV0 A;  3EPG A;  4CHT B;  4C2M B;  3HOV B;  1I3Q H;  2PCF B;  5C5L A;  5BR8 L;  2E2J H;  4LMQ D;  3HFZ B;  1XMQ Q;  3M9M B;  2L9H A;  1YIJ A;  1T94 A;  1NMG A;  1AH9 A;  3EIV A;  4EVO A;  4JI5 H;  3VPB A;  2ZM6 L;  1XNR L;  1AEX A;  1SNQ A;  3HEJ A;  4A3M B;  3F1Z A;  3DHQ A;  5HUR A;  1YIT A;  1XTD A;  2R6F A;  1W96 A;  4KMU C;  5IP9 G;  1CI3 M;  4LSX A;  2W71 A;  1TWA H;  2YU9 B;  5EPL A;  1I7N A;  1JOK A;  2B2V A;  2IWH A;  1QOH A;  2NBF A;  2WE6 A;  3G6Y A;  3SK6 A;  1YI2 A;  1VQJ A;  1N36 L;  2B2Y A;  3QJY A;  4O4H F;  4I55 F;  4A93 B;  2HHH Q;  5M3F G;  1LTI D;  5CBA E;  4JCV E;  4XDX A;  4NLG A;  2MJ8 A;  4RGT A;  3ICE A;  3LWE A;  2EE1 A;  2ASJ A;  2BA0 A;  2UUC L;  2Q8T A;  3BJU A;  1LTS D;  1V1P A;  2JA5 A;  1DV2 A;  1VMC A;  1VF7 A;  4R9W A;  1QZH A;  3TRZ A;  1WJJ A;  4MA0 A;  2J4X A;  4JI3 L;  3M4Q A;  4KKT A;  2DY7 A;  1L2Z A;  4MV3 A;  3K5I A;  4R8N A;  4DR2 Q;  4DL6 A;  1XNQ Q;  4BWG B;  1VKZ A;  1QVC A;  2E5L L;  5CC4 A;  3A8K E;  2QGQ A;  1A15 A;  2XGQ A;  1F9R A;  4R4T A;  1H9R A;  1AZP A;  3HG9 A;  3RAX A;  5LOV F;  4O2A F;  1QG7 A;  1BQQ T;  3MZ5 A;  3I90 A;  4JPB W;  4K6L A;  5ELO A;  1VQ5 A;  1VQ8 A;  4IFD H;  5T1G A;  4DV0 Q;  1SYB A;  2Y0S A;  4MV9 A;  4H7B A;  5DEH A;  2F0E A;  5ELE A;  3SK5 A;  1QIL A;  3K81 C;  4XYL B;  4X65 H;  4ECZ A;  3N6R A;  2XCP A;  5AJ3 L;  1CZG A;  3GLK A;  2E2H H;  4MZ9 A;  2ZM6 Q;  1BCP B;  1XNR Q;  1SNP A;  1HQR D;  4RG1 A;  3PIO A;  5G3L F;  4ALP A;  2DPJ A;  1PLF A;  3PUY A;  2K28 A;  5KFO A;  1SEB D;  3MEF A;  3D4W A;  5IGD A;  4S3S A;  5DG9 A;  3QOL A;  3OMC A;  4YY3 Q;  5GRO A;  3OTO Q;  5KG3 A;  3RMH A;  5EWF A;  5GAD C;  4A2B A;  4DV6 L;  1WTR A;  4F4X A;  2F4I A;  4O1N A;  4B3S Q;  1G8Z D;  3T5J A;  3GTO B;  1NCV A;  3UI2 A;  2UUB Q;  4TQR A;  4KHV A;  2R8J A;  1JJG A;  4HAE A;  1LT4 D;  2K5H A;  2I5H A;  5D8D A;  1WCM G;  3FMA A;  3R23 A;  2JA5 G;  3M3Y B;  3WO1 A;  3TBI B;  3E3X A;  1FNU A;  4DR3 L;  5EWE A;  1PRT B;  4JI2 L;  4Q0Y A;  5HY6 A;  3VYU A;  1VQI A;  3U50 C;  1YNN D;  4DNT B;  5KFE A;  4HMJ A;  2AWN A;  3TZD A;  2IX0 A;  4P75 A;  1GD7 A;  2W6O A;  5KFD A;  4NW2 A;  3PIO 3;  4IUR A;  5DQG A;  2R93 G;  3RIZ A;  1PRT C;  3S16 B;  3EBE A; 
#chains in the Genus database with same CATH homology
 4R1J A;  5LMN L;  4X65 Q;  2VUM H;  2NVX H;  4GN4 B;  1OXS C;  4GOP B;  4UP7 A;  4ME3 A;  1Q46 A;  3Q8D A;  2MFI A;  3J80 i;  4JI1 Q;  2NVQ H;  4B3R Q;  3BZC A;  3HKS A;  4QIW E;  2Z6K A;  4DR4 Q;  1FL0 A;  2K14 A;  3I4N G;  1YNX A;  4QJF A;  3CCJ A;  1CKN B;  4DV3 Q;  2N49 A;  1A62 A;  4AQY Q;  1P8L A;  3IRB A;  3A5U A;  1Y14 B;  1IBM Q;  2I5L X;  4UP8 A;  4JI4 Q;  2B3G A;  3RLO A;  2JQO A;  4DV1 Q;  1ASY A;  1HZ9 A;  4LFC Q;  2K5V A;  4JBJ A;  3KF8 B;  1EOV A;  3ULP A;  3FKI G;  2KEN A;  4LNQ A;  5IYB G;  4JI4 L;  4B3T Q;  3K7A H;  4DR6 Q;  2Z6K C;  4O2D A;  3I2Z A;  4HJA A;  5IYD H;  1L1O A;  2JA5 H;  2OWO A;  1B70 B;  2N78 A;  4DV2 Q;  1XNQ L;  4GLV B;  2YU9 H;  3GTJ H;  4GN5 A;  4O0A A;  3T1Y L;  4EQ5 A;  3JC6 6;  4FDB A;  4X66 L;  3M3Y H;  1A63 A;  1Y1V H;  3TRE A;  3RZD H;  2UU9 L;  4BBS H;  3NBH B;  1EIF A;  3HOW H;  3B6Y A;  3CW2 C;  1PVO A;  1KC8 C;  3CPW A;  1UE7 A;  1KIX A;  4P71 A;  4JG2 A;  4BBR G;  2YTX A;  5IWA L;  1K73 C;  2K50 A;  2IHE A;  3HOZ G;  4DR5 L;  2Y0S G;  1P16 A;  4DR7 L;  2D0P A;  1BKB A;  3PUW A;  4GNX C;  2L15 A;  2AKW B;  4DKA C;  4A3I G;  2JA7 G;  1VQ4 A;  3CP0 A;  1JJ2 A;  1HR0 Q;  3CC7 A;  3J80 c;  1A8V A;  4C2M H;  3ZJY C;  3HOV H;  1CKN A;  4JI2 Q;  1N34 Q;  5M5Y H;  1N8R C;  3S1N H;  4BXX G;  4GNX B;  4DR3 Q;  3PO2 H;  4C3H H;  3PUV A;  4TVA B;  3HKZ G;  2ZJP A;  3PO3 H;  1L0W A;  4LF8 Q;  1D7Q A;  4JI5 L;  4JOI C;  2I5M X;  4IJH A;  3FHW A;  4A3F H;  2HT1 A;  1VQP A;  5IWA Q;  4H02 A;  4OO1 I;  1RIP A;  4GKJ Q;  4KHP L;  1E24 A;  3WWV A;  3ULJ A;  4OX9 Q;  3TS0 A;  2IY5 B;  2YTY A;  3S1Q H;  4DV3 L;  4EX5 A;  1PA6 A;  5M5X H;  1IBL Q;  5IYD G;  3OYY A;  3J81 c;  1VS0 A;  4C3I H;  1Q86 C;  2VZA A;  4IO9 A;  3S2D H;  2Q2I A;  4DUY Q;  2ZTE A;  3S16 H;  2JA8 H;  4UP9 A;  1X9N A;  3S2H H;  1V1Q A;  4X64 L;  1NJI C;  4YCU A;  1EYG A;  1XPU A;  4A3G G;  4A3L H;  3TQY A;  3D0F A;  2B63 H;  2ALY B;  4LFC L;  1WI5 A;  3STB C;  5JEA J;  1QUQ A;  4JI5 Q;  2R92 G;  4LUV A;  2BH2 A;  2B29 A;  4A75 A;  4IFD G;  2R7F A;  1WCM H;  1VQA A;  1FJG Q;  3HOZ H;  1VQO A;  3CQZ H;  4PZ8 A;  3HOY H;  5H1S E;  3AYH B;  1E1O A;  4DR1 L;  1Y1W H;  4JV5 Q;  3GTQ H;  3L7Z C;  2VNU D;  4JI6 L;  4QQB X;  4X6A H;  1HR0 W;  3H0G G;  5JEA G;  1I50 H;  1OXT A;  4A3G H;  1WFQ A;  1HNW L;  3RN5 A;  2GN5 A;  2VQE Q;  4LF9 L;  5IYB H;  1PH5 A;  3I4M G;  2RHS B;  5M3M H;  4X64 Q;  4A3E H;  4DV7 L;  4OON A;  4LF7 L;  2NVT H;  1X65 A;  1Z47 A;  4JOI A;  1X6O A;  3A0J A;  5GAH C;  2KCM A;  3CCR A;  4A3B G;  4R4C A;  4DR2 L;  4OWW B;  4LWC A;  2UXC Q;  1EWI A;  1OXX K;  4DV4 Q;  3VDY A;  4P72 A;  3U4V A;  1Y1V G;  4BBS G;  4QL5 A;  4DV2 L;  2PI2 A;  2KBN A;  1NMF A;  1XMO Q;  3J81 i;  1YJ9 A;  3OTO L;  2F4V Q;  1C0A A;  3STB D;  5LMU Q;  4BBR H;  4KHP Q;  2ES2 A;  1Z9F A;  3RLN A;  2E8G A;  1EQQ A;  4Y52 H;  3W1B A;  5FLM H;  3H3V I;  1VQ6 A;  2YYZ A;  1N33 L;  1SR3 A;  4A3B H;  1VCI A;  2AWO A;  3GTM H;  3G48 A;  1K3R A;  2GVA A;  2R92 H;  4HJ5 A;  4GLX A;  5C4X H;  2XGT A;  1YHA A;  3KYH C;  3J7Z C;  4DV4 L;  4BXX H;  2CFM A;  1FVI A;  4X66 Q;  3DM3 A;  1N36 Q;  1TXY A;  1S72 A;  1VQL A;  4DR5 Q;  4L5S A;  3AFQ A;  3RN2 A;  5C44 G;  4C3J H;  1ASZ A;  2F3I A;  1K83 H;  4POG A;  3K8A A;  2NZO A;  1MKH A;  1I5F A;  4LF4 Q;  1HJP A;  3I4O A;  4JI7 Q;  1H95 A;  1GKH A;  3AFP A;  3KDF A;  3GTO H;  2PQA B;  3CPF A;  1K0R A;  3ERS X;  2R7Z H;  3CF5 A;  5JJI A;  5FJ8 G;  1W2B A;  4BA1 I;  2ZTD A;  3ULL A;  1SFO H;  3UE0 A;  4AIM A;  1J5E L;  3I4N H;  3F2B A;  4A3J G;  4NPS A;  2OTJ A;  5J3B A;  1CSQ A;  4JI0 Q;  1Q8K A;  3D31 A;  1UE1 A;  3K0X A;  1EQR A;  1S3O A;  1GO3 E;  3I7F A;  2LXK A;  4JI1 L;  1PH3 A;  1OXU A;  2R6G A;  2R7D A;  4X62 L;  5C0X J;  1Q12 A;  1K8G A;  2UUC Q;  3J7A 5;  2IT1 A;  3S1M H;  1M90 C;  1LUZ A;  5LMN Q;  4DV7 Q;  1MJE A;  1GM5 A;  3LGJ A;  1IBM L;  1E1T A;  3FKI H;  4LW1 A;  5BR8 Q;  3GTG H;  3W1G A;  1SE8 A;  4AQY L;  5FLM G;  2VQE L;  4LF9 Q;  5EAY A;  1LYL A;  3S15 H;  4JBW A;  2XTI A;  1V9P A;  4YHH L;  2QA4 A;  4HID A;  1U0L A;  3PGZ A;  3PUX A;  1Y1W G;  4B3M L;  4JYA L;  4A3J H;  3FP9 A;  4L5T A;  1TWC H;  4YWL A;  4DR4 L;  2EQS A;  5HGQ A;  2JA9 A;  1VQ7 A;  1LTL A;  1VQB A;  3RLF A;  1WYD A;  4DNI A;  1C7Y A;  4B3M Q;  4L5R C;  2UUA Q;  3PSI A;  5C3E H;  2ASB A;  4NXN Q;  1VQ9 A;  3A74 A;  5IE8 A;  5IP7 H;  1NE3 A;  2MQH A;  1N33 Q;  4PG3 A;  4KLK A;  2Z0S A;  4LUO A;  4A3E G;  4IPC A;  2JA8 G;  5K36 G;  4DV1 L;  3KJO A;  5LMN W;  1UWV A;  2A1A A;  2NZH A;  1SLJ A;  4BY1 G;  3M85 A;  4HJ9 A;  1VQM A;  2CCZ A;  1Q7Y C;  1D8L A;  3UDG A;  5IP9 H;  1HNZ L;  1Q81 C;  2JEB I;  1LM0 A;  2NN6 I;  2OCE A;  3I55 A;  5IYC H;  1HNZ Q;  1VQN A;  4K0K Q;  3PO3 G;  3S14 H;  5C3E G;  2E2I H;  4IPD A;  4B3S L;  5JJK A;  3G71 A;  4A3K G;  1MJC A;  4LF6 L;  4L5Q A;  4GS3 A;  4LFA L;  3HOY G;  4DR7 Q;  4LFB L;  3ER0 A;  1L1O C;  1YEZ A;  4HIK A;  5C0X G;  2WFW A;  3H0G H;  3TS2 A;  1O7I A;  1CUK A;  2PI2 E;  3GTK H;  3KFU A;  1E22 A;  2K52 A;  2K5N A;  1YBY A;  4NXN L;  3CCS A;  2A19 A;  1JT8 A;  1GVP A;  4A76 A;  1YZ6 A;  5C0X I;  2K75 A;  3U58 A;  3OW2 A;  5C4X G;  1L1O B;  3G6E A;  4LFA Q;  2ZTC A;  2CWP A;  3AEV A;  4GN3 B;  1SMX A;  3U4Z A;  1JB7 A;  1X3G A;  3BU2 A;  2UU9 Q;  4WJ3 M;  5FLX c;  1KAW A;  1X3E A;  1E3P A;  4R4I A;  1W3S A;  2BA1 A;  3AQQ A;  4A3K H;  4LF5 L;  2NN6 G;  4YCW A;  4HIM A;  1TWF H;  2MO1 A;  3GO5 A;  4GKK Q;  3KF6 B;  3S1R H;  4A93 H;  4A3L G;  2YTV A;  2VQF Q;  1KL9 A;  4DV0 L;  2LSS A;  3GD7 A;  3W5O A;  2YV5 A;  1XMQ L;  2VL6 A;  3I56 A;  2NVY H;  1OXV A;  3F2C A;  2UXB Q;  4HJ8 A;  1HH2 P;  3CCE A;  3HOX H;  3F8T A;  5FJ8 H;  4PZ6 A;  4LF4 L;  3CXC A;  2VW9 A;  1PH8 A;  1PH9 A;  2R7Z G;  4A3C H;  1PH6 A;  1QVF A;  4A3D H;  2RCN A;  2C35 B;  4GOP A;  2UUB L;  4TQU S;  1E7Z A;  3CCM A;  4DUY L;  2HHH L;  1IZ6 A;  3E9I A;  3CMA A;  3E9H A;  4AYB G;  1FGU A;  1XPO A;  2DUD A;  3RNU A;  3SGI A;  3KJP A;  1IBL L;  1WOC A;  1NTG A;  4JI3 Q;  5M3F H;  4YHH Q;  1EUJ A;  3RZO H;  3HOW G;  2ID0 A;  2JK8 A;  4DK6 C;  1IXR A;  2JA6 H;  3I4M H;  1KD1 C;  1U5K A;  2H5X A;  4DAM A;  4OX9 L;  4X65 L;  3HOU H;  3L0O A;  4JI7 L;  1UEB A;  2PNH A;  4LUZ A;  4YWK A;  3TEH B;  2E5L Q;  4AH6 A;  1PH1 A;  4X62 Q;  1VQG A;  4A3C G;  4GOP C;  2OTL A;  2LXJ A;  3KOJ A;  2RF4 A;  4JI8 L;  4NXM L;  4IOC A;  3GTL H;  1IBK L;  1K9M C;  4A3I H;  2JA7 H;  4IJL A;  3UDF A;  3UDI A;  4POF A;  3G4S A;  1NY4 A;  4YWM A;  4A3M G;  4DR1 Q;  1PV4 A;  4JI6 Q;  3M7N A;  5GQO A;  4JBK A;  1PYS B;  3S17 H;  1G51 A;  2HIX A;  1HZC A;  4IPG A;  5IP7 G;  3F2D A;  1IBK Q;  2D0O A;  1X54 A;  1SRU A;  4JI8 Q;  1S40 A;  4NXM Q;  1JE5 A;  3HOU G;  2KHJ A;  4KHZ A;  1YHQ A;  1QUQ B;  1BVS A;  3CCV A;  3PCO B;  4OXP A;  4A3F G;  3RR5 A;  1AE3 A;  4QGU A;  4GNX A;  2F4V L;  1RL2 A;  4KI0 A;  5GAG C;  2CQO A;  4BY7 H;  2AMC B;  2FXQ A;  4R4O A;  3NEN A;  2QEX A;  3CCU A;  3CCL A;  1QZG A;  4LFB Q;  5IYC G;  2ZJR A;  4HIO A;  3T1Y Q;  2JEA I;  4PMW A;  4UPA A;  4GLA C;  1Q82 C;  5C44 H;  2DGY A;  4IPH A;  1UE6 A;  4JC0 A;  3PV0 A;  4MNO A;  1IL2 A;  2MNA A;  1I3Q H;  1JMC A;  2B63 G;  5BR8 L;  4IOA A;  3UE1 A;  2E2J H;  2VS1 A;  2WB1 E;  3HFZ B;  1XMQ Q;  3K80 C;  1YIJ A;  1I6H H;  3PUZ A;  3L2P A;  3S24 A;  1NMG A;  1JJC B;  4DV5 Q;  1AH9 A;  1BBW A;  3EIV A;  2K4K A;  4QY7 A;  2VQF L;  1I94 L;  1G6P A;  1XJV A;  1Q1B A;  1HZB A;  2ZM6 L;  1XNR L;  4HJ7 A;  3M4O H;  1J6Q A;  2OQK A;  1NBW A;  3CCQ A;  1VQF A;  3KDF B;  1HR0 L;  3F1Z A;  4A93 G;  2UXD L;  2PMZ E;  1YIT A;  1XTD A;  5IY0 A;  1QVG A;  3NEM A;  5IP9 G;  1I94 Q;  1G29 1;  1VQE A;  2N8N A;  2WP8 J;  1KXL A;  1PFS A;  1TWA H;  4DV6 Q;  1N32 Q;  1EIY B;  1VQC A;  3T1H L;  3BZK A;  1UE5 A;  2AHO B;  3H15 A;  2Q2H A;  2HIV A;  2JJQ A;  4GKJ L;  1V43 A;  3T1H Q;  1YJW A;  1PH4 A;  2Q2T A;  2EXD A;  2KCT A;  2ATW A;  1YI2 A;  2VY3 A;  3MXN B;  3CME A;  4DUZ Q;  1VQJ A;  3EN2 A;  1N36 L;  4JI0 L;  2UXC L;  4UY8 C;  2JA6 G;  2HHH Q;  3H3V H;  4PZ7 A;  5M3F G;  4OWX B;  4JCV E;  3PF4 A;  2CWA A;  2WAQ G;  1N9W A;  4IFD I;  1HNX Q;  3ICE A;  3PO2 G;  1A0I A;  2WB1 G;  2BA0 A;  4NB3 A;  2UUC L;  2F52 A;  3BJU A;  3GTP H;  2R93 H;  3PF5 A;  1HNX L;  1QZH A;  3TRZ A;  3PIP A;  2HQL A;  2UUA L;  5C4J H;  1AE2 A;  5DLQ E;  5AJ3 Q;  1WJJ A;  2IX1 A;  1HNW Q;  4JI3 L;  2Y0S E;  4JBM A;  1HZA A;  3M4Q A;  1TWG H;  2EIF A;  2I0Q A;  2CKZ B;  4DR2 Q;  4P74 A;  4WJ4 A;  4B3R L;  2ZJQ A;  1XNQ Q;  4BA2 I;  1KRT A;  4DK3 C;  1DGS A;  1QVC A;  2E5L L;  4YY3 L;  2QGQ A;  5GAE C;  1KQS A;  4LF7 Q;  3K7U C;  1PH2 A;  4R4T A;  4B3T L;  1EFW A;  4BY7 G;  1CKM A;  4OO1 G;  3E0E A;  5JJL A;  5ELO A;  1VQ8 A;  1VQ5 A;  4LF6 Q;  4A4I A;  3HOV G;  4DV0 Q;  1PHJ A;  4K0K L;  4JYA Q;  3K81 C;  5ELN A;  5AJ3 L;  1MIU A;  1TWH H;  2PQA A;  2E2H H;  4MZ9 A;  4AYB E;  2ZM6 Q;  1FJG L;  1XNR Q;  4DR6 L;  4R4Q A;  1L2F A;  4RG1 A;  3PIO A;  1OTC A;  4ALP A;  4DV5 L;  3PUY A;  1YJN A;  2V1C C;  1X3F A;  2VUM G;  4APV A;  3MEF A;  1B8A A;  1VQD A;  4P73 A;  1SN8 A;  3HOX G;  2A8V A;  2GVB A;  4MTN A;  3KF6 A;  4YY3 Q;  3CD6 A;  4GKK L;  5GRO A;  1KHI A;  3OTO Q;  3JAM i;  5GAD C;  1XMO L;  1C9O A;  5IT9 c;  4DV6 L;  2KHI A;  1R9T H;  2D62 A;  1VQK A;  4A3D G;  4DAY B;  3CC4 A;  4B3S Q;  3KLW A;  4XTC S;  5E7N A;  5M5W H;  4J15 A;  3NEL A;  4XIG S;  2UUB Q;  1PH7 A;  1KRS A;  4JV5 L;  1VQH A;  2MO0 A;  1B7Y B;  1Q1E A;  1JJG A;  2N3S A;  3HKZ E;  2UXB L;  3M4P A;  2K5H A;  2I5H A;  2IHF A;  3M9B A;  1WCM G;  1YVC A;  4RMF A;  3J81 j;  3DLL A;  2JA5 G;  3CC2 A;  1N32 L;  4LF8 L;  3A5Z B;  2Q2U A;  5LMU L;  1CSP A;  4DR3 L;  4A3M H;  2UXD Q;  4BY1 H;  1N34 L;  4JI2 L;  5HY6 A;  1VQI A;  3U50 C;  4LF5 Q;  1X56 A;  3UDX A;  1K8A C;  1J5E Q;  1CKO A;  1YHB A;  2AWN A;  1M1K C;  1PYB A;  4DUZ L;  2IX0 A;  3JAM c;  4P75 A;  1GD7 A;  1IYJ B;  1SRO A;  2WAQ E;  3GDE A;  4YCV A;  5M3M G;  3CAM A;  1XPR A;  4OWT B;  2R93 G;  2OQ0 A;  4Y7N H;  1X55 A;  2RHQ B;  4DPG A;  1BBU A;  2BH8 A;  4IFD J;  2JE6 I;  1T9H A;  3EBE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...