1WCMG

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wcmG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1wcmG01
3K8AA 3HOUH 4DR7L 4A3LG 1D8LA 4ME3A 3KOJA 5GQOA 4YY3L 1HNXL 1H95A 1L2FA 1HZBA 4LF7L 4GOPC 3I4MH 5JJKA 1Y1WG 2UU9L 3TQYA 3L2PA 4JI2L 2DUDA 3UE0A 1GVPA 4OO1G 1SE8A 2B29A 2RHQB 1Q8KA 2PQAB 1Y1VG 2K4KA 4JI8L 4PZ8A 4DR3Q 4DUZL 5C0XG 1VQOA 1PH2A 4BY1H 1A8VA 2Z6KC 3UDXA 4HJ9A 3PO3G 3AFPA 3T1YQ 3HOWH 3ICEA 1HZCA 1Q12A 4C3IH 2Q2HA 4LF6L 4DV1Q 2OQKA 1KD1C 4WJ4A 4DV4Q 3FKIG 3OW2A 1L1OA 1W3SA 2EIFA 2YYZA 3ERSX 1LTLA 2CKZB 3ZJYC 3J80c 1PH8A 4K0KQ 5JJLA 4GKKQ 4WJ3M 1PVOA 1AE3A 2AKWB 2IHFA 1YJ9A 5C44G 1SMXA 2A19A 4LFCQ 1IBLQ 3RLOA 4C3JH 4GNXA 4A3GH 2K5HA 5IWAL 2JE6I 1FJGL 1IBKQ 1N9WA 4LUOA 2IX1A 2WB1G 4LF4Q 1WCMG 3FP9A 3RZDH 5FLMH 2K14A 3CC7A 2MO0A 3L7ZC 4BA1I 2NN6I 4MZ9A 3U50C 3W1GA 4LF8L 4QL5A 2C35B 1B7YB 3GTGH 2E8GA 5M3FH 1VQEA 1K8GA 1Q1EA 2K5NA 4DR3L 1OXUA 1YVCA 2BH2A 2JA7H 2VUMH 1PH7A 3CCUA 2K50A 3E0EA 4R4IA 4DV1L 1E7ZA 2BA0A 2NVTH 4MTNA 4OO1I 2IY5B 4DV4L 1X9NA 1NE3A 3IRBA 4A3FG 2B63G 4A3MH 4K0KL 1SR3A 5C0XI 1EIFA 2QA4A 2R7DA 2NVXH 4GKKL 3U4VA 2WB1E 4YWKA 4HJ8A 2ASBA 2JA5G 1BBUA 4LFCL 1IBLL 3AFQA 2KHIA 3KJPA 4AYBG 1E1TA 3CW2C 1PV4A 1C7YA 3CQZH 3BU2A 1IBKL 1FGUA 3KF6B 3GTJH 1X3EA 3CCQA 3ER0A 3PSIA 4LF4L 3K7UC 5LMNQ 1FL0A 4DK6C 3G71A 3GTPH 4JOIA 4DR4Q 1YEZA 4R4CA 1VQPA 4BBRH 4OXPA 5GROA 4IPDA 2VQFQ 3HOYH 2ZM6Q 3PF5A 1EYGA 3CC2A 4OX9Q 3K7AH 2R6GA 1Y14B 4A93G 4DKAC 4HIMA 4B3TQ 4A3LH 1G6PA 1I3QH 5H1SE 3PO2G 1YZ6A 2JA6G 1Y1WH 4JI0Q 1O7IA 4DAYB 5HGQA 2WP8J 4JCVE 4P75A 2ZJQA 1XTDA 2EXDA 1XMQL 1IL2A 5C4JH 2CFMA 3MXNB 4A3BH 4AYBE 2R93G 5C0XJ 3AEVA 3PO3H 3A74A 3PGZA 4R1JA 2PNHA 3BZCA 4QJFA 1E22A 1P8LA 1JJGA 3CCRA 5FJ8H 2JK8A 2WFWA 2DGYA 4R4OA 4A3KG 2KENA 2V1CC 3NEMA 4LUVA 4KLKA 1EUJA 5E7NA 4A3JG 2I5HA 4DR4L 4JI2Q 1PH3A 4B3SQ 1YBYA 2N49A 5C44H 3KF8B 4LNQA 4B3MQ 2I5MX 2ZTDA 2VQFL 4JI5Q 3TS2A 4BBSG 4QY7A 1WFQA 2ZM6L 4OX9L 4MNOA 4GN3B 3K80C 3CMEA 4B3TL 2KBNA 1WCMH 5C4XG 2R7ZG 3PUXA 4IOAA 3I7FA 4HIKA 1QVFA 3DM3A 1A0IA 2D62A 3HOVG 4JI0L 5GAEC 5AJ3Q 2GVBA 3Q8DA 5IT9c 5GAGC 2LXJA 2MQHA 3CP0A 3T1HQ 4BXXG 4IFDG 4A75A 1HNWL 1JJ2A 2B3GA 1LUZA 1Q7YC 1XPOA 1QVGA 1NTGA 1LM0A 4JBMA 3H3VI 3I4OA 5IWAQ 4GOPB 1OXTA 4LF5Q 1JJCB 1Q82C 3NBHB 4A3FH 2B63H 2K75A 1E3PA 3M4QA 1HJPA 4LUZA 3G4SA 4DV6Q 4DR2Q 4J15A 4B3SL 4LF8Q 2NVYH 1PYBA 2JA5H 4X66Q 1W2BA 1BBWA 3F1ZA 4DR1Q 4B3ML 1N32Q 4JI5L 4P72A 3CCSA 1ASYA 3W1BA 2UUBQ 3JAMc 3HOZG 1NBWA 1L1OC 3CPFA 2L15A 2H5XA 2RHSB 3I2ZA 3G6EA 3J81c 3M3YH 3F8TA 1Q81C 5IYDG 5IYBG 2R92G 4LFAQ 1X6OA 2KCTA 2BH8A 5GADC 3TS0A 4R4TA 1D7QA 1JT8A 5AJ3L 3M85A 4JV5Q 2ALYB 1AE2A 1G51A 3T1HL 1KXLA 4JI3Q 4YWLA 1KRTA 3H15A 3TEHB 2QGQA 4A93H 1X56A 1BKBA 4L5RC 2UXDQ 2ZTEA 1QUQB 3GTMH 1TWFH 4PZ6A 2CQOA 3EBEA 4IPHA 4C3HH 5HY6A 1VQ8A 2A8VA 5C3EH 2F4VQ 1S40A 1VQ9A 4LF5L 2CCZA 4IOCA 1RIPA 3GTKH 4RG1A 1YNXA 3H3VH 2F52A 4DV7Q 4KI0A 4L5SA 2D0OA 4IFDI 2R93H 3B6YA 3PUWA 1VQ4A 3D0FA 3L0OA 4DV0L 3LGJA 2VQEQ 4DV6L 4DR2L 2QEXA 3BZKA 2VZAA 3HFZB 4X66L 4A3IH 1NJIC 4DR1L 1PYSB 1N32L 4P74A 5IYCG 4EX5A 2UUBL 3PUVA 1B70B 3KFUA 1T9HA 1EQQA 4A3KH 2E2JH 1I50H 2YTYA 2PQAA 2WAQG 3PUZA 2VW9A 4A3JH 1WYDA 4LFAL 2I0QA 3J81j 3J80i 1HZAA 3CPWA 4DUYQ 1XMQQ 4Y52H 5IP7G 4JV5L 1PFSA 5ELOA 4BBSH 3UDGA 2OCEA 1VS0A 1XNRL 4JI3L 2ID0A 1HZ9A 4JI4Q 1EOVA 3RN5A 4FDBA 3TRZA 2AHOB 1E24A 5C4XH 4JOIC 3I55A 2UXDL 1PA6A 1I94Q 2YTXA 4NXNQ 2IX0A 2KHJA 4JBKA 2F4VL 1MIUA 3HOVH 4LFBL 3E9HA 5K36G 1RL2A 4BXXH 4DV3Q 4DV7L 1G291 1PH9A 4DPGA 4JI1Q 2N8NA 5M5WH 1KC8C 2VQEL 4IFDJ 1A62A 3CXCA 4HJ5A 1KIXA 1CKMA 2Y0SG 2WAQE 5IE8A 1GD7A 1M90C 4O0AA 3M4OH 3TREA 2N3SA 1HH2P 3U58A 1PH4A 4JI6Q 3S14H 1J6QA 5FLXc 1YITA 4UP8A 1EIYB 1GKHA 2BA1A 4A3EG 4DUYL 5JJIA 2UUAQ 2ES2A 1U0LA 4KHPQ 3SGIA 2RCNA 2ZTCA 1Y1VH 1PH6A 3HOZH 1FVIA 1KQSA 1HNWQ 4JI4L 1JMCA 4IJHA 1N34Q 1VQIA 5IYDH 3S1QH 2R92H 4X6AH 4LF9Q 4A3CG 1I94L 1U5KA 4GLVB 3KDFB 4NXNL 3GD7A 3CCJA 4DV5Q 1XPRA 1PHJA 4EQ5A 1UWVA 2Y0SE 1K73C 4PMWA 1N36Q 3FKIH 1XPUA 1XNQQ 4DV3L 2ATWA 4JI1L 1VQ7A 1AH9A 3CCMA 3KF6A 1GO3E 1IYJB 1KHIA 3PIPA 1S3OA 3S1RH 3UDIA 1VQFA 5BR8Q 2CWPA 3I4NG 1VQLA 2CWAA 3JC66 2HIVA 4B3RQ 4JC0A 1CKNB 4JI6L 4L5QA 2K5VA 1V1QA 4A3DG 4GLXA 5JEAG 1PH5A 2PI2E 1I5FA 1V9PA 1VQBA 3S15H 3S17H 3S2HH 2HHHQ 4OWWB 4IPCA 1VQAA 1VQGA 1EWIA 3GTLH 3I56A 2LSSA 2UUAL 4UP9A 1IZ6A 3EIVA 4UP7A 4KHPL 2JA7G 2VUMG 2Q2UA 5IYCH 3KJOA 3M4PA 1QZHA 3GTOH 2VS1A 1N34L 3GDEA 4HIOA 4NXML 3RLNA 1X55A 4LF9L 1XMOQ 4HJ7A 3F2CA 3CCVA 1MJEA 4DV5L 1OXXK 1VQJA 1WOCA 1N36L 5IP7H 1Z47A 3NELA 4DNIA 1XNQL 3CF5A 3PF4A 3HKZG 1IBMQ 2NZHA 5M5YH 1S72A 4DV0Q 3RN2A 1X54A 1PH1A 1L1OB 4GS3A 1HNZQ 1CUKA 1R9TH 4GLAC 3F2DA 5BR8L 1E1OA 4OONA 3S1NH 4QQBX 1KRSA 3E9IA 2E2HH 2IT1A 5IY0A 4JYAL 1OXSC 4B3RL 4GKJQ 3MEFA 4GNXB 4BY7G 4YCWA 1Q1BA 3M9BA 1N8RC 3RR5A 4YCUA 3CCLA 4XTCS 4OWXB 1SRUA 5ELNA 3ULJA 3W5OA 4OWTB 2YV5A 2HHHL 2N78A 1C9OA 4UPAA 4GNXC 2JQOA 2OTJA 4IJLA 1YI2A 4POGA 1XNRQ 2F3IA 1VQ6A 5LMUQ 2HT1A 4JBWA 2OTLA 3NENA 2D0PA 4APVA 2MO1A 1YHAA 1SN8A 3HKZE 3PO2H 1XMOL 4DR6Q 1KL9A 2JA6H 4LFBQ 4A3BG 4NPSA 1VQMA 3CAMA 4HIDA 4HJAA 4A3EH 1C0AA 3S16H 1BVSA 2A1AA 1LYLA 2Q2IA 3K0XA 4L5TA 4RMFA 3UE1A 1TXYA 1VQHA 4GOPA 1IBML 1EFWA 3JAMi 2XGTA 1HNZL 1K83H 4X62Q 5LMNW 2ZJRA 2AWNA 4A3CH 1JE5A 3J81i 5FJ8G 1P16A 1TWHH 1NMGA 2UXCQ 4DAMA 4YWMA 3G48A 3S1MH 1EQRA 4AQYL 4GKJL 3PCOB 2Z6KA 1IXRA 3U4ZA 1KAWA 1K8AC 3J7ZC 2VNUD 1QVCA 1DGSA 1SROA 5DLQE 3S2DH 1K9MC 3I4NH 3STBC 5IP9G 3WWVA 5LMUL 3J7A5 1ASZA 1XJVA 1X3GA 1NY4A 2R7ZH 2GN5A 4A3DH 2Z0SA 2MNAA 1YJWA 3KLWA 4JG2A 1VCIA 4DR6L 5JEAJ 1HNXQ 2PMZE 1GM5A 1QUQA 4A76A 3ULPA 1VQKA 3H0GG 1HR0W 4TVAB 2K52A 2OWOA 1UE5A 2PI2A 1SLJA 1UEBA 5M3MG 3T1YL 2JJQA 1B8AA 1V43A 3HOXG 2JA8G 3CD6A 1VQCA 3RZOH 4X62L 2R7FA 4LW1A 1QZGA 1WJJA 3HOUG 3CCEA 2ZJPA 4JI7Q 2NZOA 1OXVA 4ALPA 4IO9A 3GTQH 3M7NA 2UXCL 4DV2Q 3I4MG 1YJNA 1K0RA 4YCVA 1TWAH 1UE7A 1WI5A 4DR5Q 2AMCB 4POFA 3CC4A 3RLFA 3BJUA 4GN4B 3HKSA 2MFIA 4XIGS 4DK3C 4BY1G 2IHEA 2OQ0A 4QGUA 3PV0A 3CMAA 2E2IH 2GVAA 4X65Q 3HOWG 4AH6A 1TWCH 4BY7H 3PUYA 4NXMQ 4QIWE 2JA9A 2HQLA 2YTVA 4GN5A 5IYBH 4X64Q 3A5UA 4BA2I 2UXBQ 1K3RA 3S24A 2HIXA 3EN2A 3OTOQ 3A0JA 4PG3A 2E5LQ 2YU9H 4O2DA 3VDYA 1Z9FA 1Q46A 1L0WA 1MJCA 4TQUS 4AIMA 1J5EQ 2RF4A 5C3EG 3F2BA 1TWGH 4A3GG 4R4QA 1JB7A 3A5ZB 3RNUA 4JBJA 1X65A 1Q86C 4JI7L 2VL6A 4YHHQ 4JYAQ 5FLMG 1CSQA 4P73A 4DV2L 1VQDA 1M1KC 1I6HH 1CKOA 4UY8C 4A3IG 1X3FA 2JEBI 4DR5L 1N33Q 1HR0Q 5M3FG 4P71A 2UUCQ 2I5LX 5EAYA 3AQQA 4DR7Q 3FHWA 3AYHB 1YHQA 1SFOH 3PIOA 2KCMA 4YY3Q 5LMNL 2LXKA 4X65L 4LF7Q 5J3BA 2UU9Q 4X64L 2UXBL 1MKHA 1UE6A 4A3MG 3OYYA 3OTOL 4JI8Q 2E5LL 4LWCA 4A4IA 4DUZQ 3ULLA 5IP9H 1VQ5A 2XTIA 3KDFA 1A63A 2Q2TA 2NVQH 1UE1A 2VY3A 4LF6Q 1J5EL 3D31A 4NB3A 3GO5A 2JEAI 1YHBA 3UDFA 5GAHC 1VQNA 1NMFA 4YHHL 4AQYQ 3KYHC 1OTCA 3H0GH 4IPGA 1YIJA 2NN6G 2AWOA 4H02A 2FXQA 4Y7NH 2EQSA 4KHZA 4BBRG 4PZ7A 4C2MH 3STBD 3K81C 5M3MH 5M5XH 1CKNA 3HOXH 3DLLA 1HR0L 1N33L 2JA8H 3HOYG 1FJGQ 2UUCL 1CSPA
chains in the Genus database with same CATH superfamily
3HOUH 4DR7L 4RNMA 4A3LG 4B9XA 1SFOA 1SNDA 4HTHA 3EVQA 4QW8A 3GQCA 4N9TA 1L2FA 4LF7L 1ILQA 4GOPC 4N8FA 4JI2L 3L2PA 3UE0A 4OO1G 1KDAA 2XC9A 4J9RA 1FR3A 1I94H 4NXNH 5KFUA 1U4MA 4J9OA 1B50A 2NU7B 2I8CA 1B3AA 4DV3H 3R5HA 2L9HA 3ICEA 4DR4H 1HZCA 1QJOA 5F2DA 4LF6L 3T16A 2FPGB 1KD1C 3SDZA 1AZQA 2KHSA 4A93B 3U9TA 4FYDA 1WTVA 2B8GA 2L1BA 4PV1C 1PH8A 1JQYD 2HVRA 3KHHA 3BAAA 3GTKB 1YJ9A 2J6UA 3L4KA 2R8GA 5EZYF 4GNXA 4RB1A 1SEIA 3GIKA 1DV1A 1LACA 2F0VA 2L5TA 1FJGL 3SE7A 1KBLA 1AFPA 4J9PA 2Z4HA 2WB1G 4XDXA 4LF4Q 1WCMG 3FP9A 4O2BF 4ECQA 4BA1I 2NN6I 1K3BC 1RCVD 4EGJA 3U50C 3W1GA 5JEAH 4LF8L 1NUCA 5BPHA 4KN7C 3RB6A 4PMCA 1H9KA 2VOBA 4O4IF 2B2UC 2V58A 1Q1EA 2K5NA 3D6WA 5KFLA 4FBUA 2JA7H 1KDBA 3N6XA 5L9XA 3MXGA 1JDEA 2K04A 4WJWA 5KFRA 5KFBA 4BBSB 1A3VA 5ELCA 2NVTH 4OO1I 3K5NA 1RJRA 3J7YW 1X9NA 3IRBA 2B63G 2C2EA 5CV6A 2VB3X 2WB1E 4YWKA 2R85A 5DLFA 1RF2D 3AFQA 2X0SA 1E1TA 5IYZF 1FGUA 1I4QA 1X3EA 3ER0A 3MFIA 4LF4L 3K7UC 4QF4A 4DK6C 1V1PB 3TINA 4JOIA 4DR4Q 1VQPA 2W6NA 1GJXA 1NNXA 4BBRH 3SXHA 5GROA 5CORA 4LF5H 2CH4W 1H9MA 4A93G 5KFFA 4DKAC 3GV8B 5EPJA 5E1FA 4IR9A 5H1SE 4DV0H 3EYYA 1DZ1A 2EY5A 5CMDA 1HFNA 4FF2A 4DR2H 4XQNA 2WP8J 2W9AA 2QK4A 2ZJQA 2EXDA 5KFPA 3OWEB 3C3LA 2LMCB 2IJ0A 2IP4A 2F0SA 1BDOA 4O42A 5C0XJ 2W8LA 2D2CC 3AEVA 3PO3H 2PNHA 2R87A 1ESFA 3V6HA 3E5SA 2DN8A 2WFWA 3I8ZA 2VPQA 3QG1A 3BQ2A 4DR4L 1K8OA 2W9BA 1B6RA 2DJFC 1STGA 3GIJA 1CK1A 2CH4A 4ETSA 3KF8B 1WTWA 3VR3A 4BBSG 3S2HB 4MNOA 3QWNA 3K80C 2CW7A 1SNQA 3PUXA 4IOAA 4U68A 2NUCA 4KMUC 1A0IA 2D62A 1N48A 3GTOB 5IT9c 4BXXG 5GAGC 1I7LA 4MV9A 2UXCH 1B04A 1PTOH 3OMCA 2QILA 4DGZA 4NDXA 2K32A 2VR1A 1NTGA 5EOYA 4JBMA 2B2VC 4GOPB 4LF5Q 3MHBA 1JJCB 2K75A 1E3PA 3M4QA 1BCPF 2B2TC 1KNAA 2YZMA 4DK0A 1RK6A 5E4XA 4DXGA 4DR2Q 3C2PA 4FS2A 1YNJD 1ZHQA 1H9SB 3HRZC 1NBWA 3CPFA 2PZUA 2L15A 3V6JA 4HAEA 2OF1A 1EEFD 5KG0A 5GADC 3IAYA 1CHPD 1RDPD 1AUXA 5L1KA 3M85A 3OOCA 2QEJC 1BNZA 1G51A 1KXLA 2BQUA 5I9PA 3Q24A 1KRTA 3H15A 3TEHB 2JA6B 2I87A 1X56A 4YJ2F 1A9XA 2WACA 2ZTEA 3GTMH 2W9CB 1TWFH 2DJGC 2CQOA 3EBEA 2DY8A 1W96A 3LWBA 3KK7A 4RFBA 2X6GA 1LV9A 4ZAIA 3H3VH 4LF5L 2CCZA 4MA0A 1RIPA 4R7RA 3P75A 1YNXA 5KFHA 4J9SA 4F4ZA 4KHPH 5JVH3 1K83B 1FNWA 1BF4A 2R93H 3FPUB 3KLRA 1HTPA 4QUFA 5KFAA 3RD4A 4DV0L 4GZYC 2HVQA 1UEAB 2X6LA 4DR2L 4NXMH 1O80A 2VZAA 2F1MA 4A3IH 4YQWA 2HQEA 1S0MA 1PYSB 4DL5A 4AYBA 4P74A 4EX5A 3I4LA 3C1EA 2E5LH 2FMAA 4WFN3 1HQRD 3MXUA 1YNJC 2E2JH 4KHVA 4F88A 2YTYA 1B44D 5JJZA 1STYA 2I0QA 3J80i 2OH2A 2FMCA 2L12A 1ET6A 2OCEA 5EBCA 4I50F 3GTGB 5BPFA 4JYAH 2LS01 1IW7D 1HZ9A 4HR7B 2PQEA 1W93A 5C4XH 3GTMA 2PW7A 1ZHSA 1DXMA 1TWFA 4HQ6A 1A3UA 3HOVH 4M8AA 4XYOA 4Q8FA 1K8MA 4DAPA 5IODA 5ELEA 4XT1B 1G291 2R93A 3Q8QB 2F0UA 4U673 3OIQA 1M0TA 4IFDJ 1S9FA 2PO4A 4HJ5A 2PPBC 1KIXA 4UFZA 5IGDA 1XTCD 1FNUA 3Q1KA 2NBFA 4XYLB 1HH2P 3S14H 1J6QA 2QCPX 5IT9W 2EXZA 1ONLA 5DLGA 2EYLA 4UP8A 5H80A 1KEEA 1EWHA 3T5LA 2E2IB 4JUZA 3TQ1A 3K58A 5J2UF 4KHPQ 2RCNA 1D5XC 1KQSA 1HNWQ 4AQYH 5C0XH 2EYMA 3PR5B 1JMCA 3FRPB 3S1QH 2R92H 3K7AB 4A3CG 1JIHA 4DV5Q 3GD7A 3R8BA 1PXUA 5JOBA 4IWXA 4EFEA 1UWVA 3FKIH 1E2WA 4LAAA 1EFID 3RAQA 3KF6A 4DK1A 1GO3E 2RCFA 1KHIA 2EYFA 3UDIA 4Q43A 3JZIA 4KJOA 1VQLA 1I6HB 5KG5A 1GUWA 1CKNB 2FINB 3TP8A 4GLXA 1PH5A 2WKCA 1VQBA 3MA2B 4IPCA 3T51B 1VQGA 5FLXE 4DV1H 4X62H 4F4YA 2F0IA 2F0MA 1IZ6A 4KHPL 5IYCH 1SDFA 3DMUA 4GKKH 2VS1A 5NUCA 4MAMA 4NXML 3MXNA 2R92A 4ZI7F 4HJ7A 5DNFA 3F2CA 4DV5L 3MZ5A 1CTMA 3NELA 3NP8A 3EJIA 4ECZA 2QW7A 4ZQIA 1R9TH 4MV8A 1CT1D 4A2AA 3S1NH 1Z2PX 1EY4A 3E9IA 2E2HH 5IY0A 4JYAL 1BBXC 1CI3M 2EE1A 2AGOA 2JA8B 1N8RC 4IUQA 4YCUA 3CCLA 3A8IE 4XTCS 3P7JA 5EGTA 2N88A 4CJ0B 5KNCA 4UPAA 3I4MB 1JOKA 2BE5D 2F3IA 3IG0A 4JBWA 2IWHA 2OTLA 4IHJF 2D0PA 5LOVF 5FD6A 1RK5A 3PO2H 4X3TA 3U9SA 4CKEA 5IT9L 1VQMA 4HJAA 4C3IB 1TKWB 2KEEA 3S16H 3KUPA 2F0NA 5KYLA 3V4ZA 4IURA 1R9TA 4X62Q 4X64H 2AWNA 4LSXA 1P16A 2SNMA 1TS3A 2E2HA 4YWMA 4ABNA 1HFGA 4AQYL 4XQQA 3PCOB 1ULZA 2KA7A 3N52A 3N44B 4HCEA 1DGSA 2W57A 5DLQE 1AN8A 4BWSC 4ED8A 4JI0H 3I4NH 1HUMA 5JH7F 3EPIA 5DQIA 5KFVA 5JPMC 2B2WA 1PYWD 5C1OA 3DEOA 5C3WA 1ASZA 5M3FB 2MJ8A 4RNNA 2MNAA 1YJWA 3KLWA 4LK1C 1VCIA 1JKJB 1N33H 1EZ6A 1QUQA 4ZKCB 4G3IA 1VQKA 4YIJA 1HNXH 1UEBA 1V43A 4M9UA 1ZEQX 4A3MB 2JA8G 3CD6A 1EY8A 4X62L 2RKSA 4LW1A 5C8YF 1CS0A 3M7NA 2DPIA 4JI8H 1BCPD 4DV2Q 3I4MG 1YJNA 4YCVA 2M05A 1TWAH 1I6VC 3L9AX 3GTJB 5I6WA 2KJXA 4Q45A 2AMCB 4GN4B 3HKSA 2MFIA 5KFWA 3OSOA 5KGUA 3T1HH 3PV0A 3CMAA 4AH6A 2UVRA 4C3IG 1DOMA 3HOYB 4I7ZC 3RUZA 2JA9A 1K1SA 1AEXA 4X64Q 4BA2I 2UXBQ 5BMVF 3R2IA 3T53B 4ZK9B 5IWAH 5KYIA 2YU9H 3VA7A 3VDYA 1Z9FA 1Q46A 1MJCA 3IL8A 3MC0B 4OEMB 2ASJA 1FNVA 5C3EG 1DV2A 1TWGH 2B2YA 2ZXPA 3J81W 5KRUA 1N32H 5D3IB 4FS1A 1CZWA 1PLFA 1S0OA 4DV2L 5JVLA 4DR3H 1HA6A 2NVXA 3TZUA 2DZDA 4ZKBB 3HKZA 3M9NB 1TWAA 1AUVA 2AQ2B 2WIIB 1X3FA 1N33Q 5M3FG 4CGYB 4DL7A 2MP1A 3R3OA 4XYQA 1EIGA 4I4TF 2KCMA 2C22A 1M8AA 4X64L 2UXBL 4RZRA 2K28A 1DJRD 4A3MG 2PW5A 1JOQA 4JI8Q 2YU9A 2EVBA 1EEID 3NXWA 1KJIA 3ULLA 3S9WA 1VQ5A 1LTBD 2V4DA 2XTIA 4DV7H 3CRKC 2NVQH 4KD4A 1U4LA 4YR0A 3D31A 4KD3A 1TWGA 1IYUA 2WDTA 3UDFA 2A74C 4EGVA 5K36H 3GIDA 4IPGA 1F77A 1STHA 3RB0A 2AWOA 4PZ7A 5M3MH 4ZUIA 3K81C 5M5XH 3K5MA 3DLLA 1N33L 3HOYG 3KHLA 2PMZA 4J9NA 2N55A 1CSPA 4DUYH 2P0AA 1EY7A 1D1KA 1XMQH 1XXGA 1H95A 2NVYB 1W6JA 3KOJA 1JE4A 1HNXL 2JA5B 1PK8A 5KX5F 5EWEA 1SE3A 3J7AK 2DUDA 1LT3D 3SHLA 3ORQA 5E3FA 2NTSA 1Y1VG 2PYKA 4JI8L 4PZ8A 4DR3Q 1PH2A 4BY1H 4G7OC 2Z6KC 1T5XD 3A55A 3SVMA 2OQKA 4WJ4A 2VQDA 3RBEA 2VQFH 3OW2A 1L1OA 1W3SA 2ZM6H 1HA5A 3ZJYC 4OX9H 4C3HB 3KHGA 1AE3A 2AKWB 5E4WC 4IRCA 1S4ZA 1SMXA 4C3JH 3EPGA 2K5HA 4XT3B 5IWAL 3MFGA 1IBKQ 1N9WA 3JAML 4DAVA 4JPBW 4JK1C 1KJ9A 3J81L 5KG3A 4HMIA 2WKDA 2IMWP 2UVWA 4QL5A 4H13C 5KT4A 2E8GA 5A2QL 1GUSA 4A3KB 1I50B 3P1HA 1WR2A 4DR3L 1ICWA 1OXUA 3D4WA 2VUMH 3S2DB 3CCUA 1KDCA 1G6ZA 1C30A 5KFEA 5KG2A 3BDOA 3OHAA 2YRWA 3F8NA 4EQOA 2R7ZB 2QA4A 2R7DA 2CW0C 4KTAA 4C56C 4RNOA 2B8FA 2JA5G 1BBUA 2CQYA 4O4LF 5EWFA 4ZHQF 1C7YA 1PV4A 4DA2A 2RDIA 3CQZH 5L1JA 1IBKL 4K8JA 4KKTA 3CCQA 3PSIA 4EYHB 1KAAA 1O7ZA 2ZXRA 1V51A 1Y8PB 1SNOA 5A35A 1YEZA 4R4CA 4QUCA 3M4OB 3VMMA 1E4EB 2VQFQ 4UCVA 2ASLA 2ZM6Q 3PF5A 1S5ED 4OX9Q 3GIIA 1Y14B 2IX3A 3DWPA 4HIMA 4A3LH 3MR6A 4CHTB 4IALA 1YZ6A 4C3HG 5DGBA 5FPRA 4DAYB 4JCVE 4G7ZC 4P75A 5IGCA 1XTDA 1XMQL 1IL2A 4OO1H 4A3BH 2LFNA 3ND8A 3G7LA 4FO2A 3VPCA 5TSSA 1T94A 1GUTA 3DHQA 4R1JA 4LFAH 1SNMA 3BZCA 4MIUA 3CQZA 4MV7A 1JOOA 3MFYA 5ELBA 2JK8A 5M5YB 4A3KG 1XNRH 1VF5C 1VBGA 4EBDA 1EUJA 4JI2Q 2N49A 4R8UA 4LNQA 4B3MQ 1G91A 2I5MX 2VQFL 1WFQA 2ZM6L 3S17B 4LSAA 1VMCA 4OX9L 1C3OA 2CHBD 1WCMH 2EYPA 4QMGA 3GTLB 2R7ZG 1KABA 4IUNA 2GPWA 4HIKA 1ZETA 4WORA 2W71A 1BOSA 1MGSA 1SNPA 2F0DA 3BG5A 5FO8B 3V05A 2LXJA 3CP0A 2KCCA 3G8CA 3PQIA 4A75A 2B3GA 3BS1A 1Q7YC 2XIGA 1VDZA 1TS2A 1NSNS 2E76C 4ZOLF 1Q82C 2B63H 3RB3A 3DUZA 3LNNA 4CC6A 2J4XA 3LP8A 3M4IA 3F2UA 4LF8Q 4X66Q 5KFIA 1JC7A 1CZGA 4B3ML 4RCOA 1TA8A 3BVMA 4FF3A 2WYOA 4P72A 3X3MA 4HNUA 4FP5D 1RKNA 3I2ZA 2H5XA 4RGMA 3G6EA 3SI8A 2WB1A 3PW5A 3F8TA 1WCMA 2O03A 4MTDA 4B08A 5IYBG 4LFAQ 2KCTA 3TS0A 1IYVA 4R4TA 4CBVA 1D7QA 1F9PA 1EYCA 4OGQC 4CDDC 1Y69U 2FKLA 3OW7A 1PZJD 4X3UA 4RUCA 5DG9A 5IGGA 4A93H 2YS7A 2ZT9C 4L5RC 2AQ1B 2H1EA 4A3EB 2K01A 2A8VA 2VUGA 4UCUA 1LABA 4KY5A 1S40A 3GTKH 4KV6A 2AQ4A 4XX0B 2B63A 4L5SA 2D0OA 2MCTA 1JB3A 2OT2A 2DPJA 3FEWX 3PUWA 1VQ4A 1N34H 3MJFA 3BZKA 3MR2A 2W7OA 3E0JA 4X66L 4LF9H 2R61A 1B2TA 2AGQA 4CC5A 2ZJTA 1B33N 2C00A 2RBMA 3PUVA 5CA1F 3HEJA 1T9HA 5KFNA 4TQRA 2J6TA 2R86A 4LFAL 1U9RA 1HRJA 4Y52H 5IP7G 4BBSH 3MFHA 1B9NA 3UDGA 1XNRL 4A3DB 2ID0A 3RN5A 4FDBA 2AUJD 1I94Q 3SK4A 4TSSA 1IHZA 3H94A 4NXNQ 2IX0A 3ND9A 2JA7B 2L4NA 1MIUA 2NWGA 5CV9A 5C5JA 3GTKA 3E9HA 1WTQA 2F0GA 4BXXH 5C5MA 4DV3Q 4FVMA 4DPGA 1SYXB 3GTQB 4FNFA 2RGVA 2UU9H 4UCRA 3UI2A 1XMOH 1GD7A 1M90C 5D3DA 1Q3LA 1BXTA 4RH6A 3TREA 1WTRA 4ED7A 2N3SA 1LTTD 4ECYA 2XSCA 5FLXc 3D8GA 2V4QA 1DOKA 2WINB 4A3EG 5JJIA 3QJYA 1ICFB 2F0PA 3SGIA 4TV9F 3Q8RB 2ZTCA 4KJNA 3RBDA 2JEGA 1FVIA 2FP4B 2DWCA 1N34Q 4LF9Q 3CU7A 1I94L 3PR4A 3KDFB 4NXNL 4KKSA 1K73C 4G4KA 3R2TA 4DV3L 2A6EC 2ATWA 1AH9A 2YL2A 3CCMA 2W6OA 1F9SA 1S3OA 1WTXA 1V1PA 1EU4A 2CWPA 5KT3A 3NWSA 4DR6H 3JC66 1SYGA 2RDJA 4F4WA 4JW0A 4MV1A 4L5QA 2K5VA 3GIMA 1V1QA 1Y8OB 4X3KA 5JEAG 4A3DG 2PI2E 3S15H 3S2HH 3T1YH 4TQSA 2XRSD 1EY6A 3I56A 2LSSA 4PWQA 4UP9A 3EIVA 1RODA 3FPPA 2JA7G 2HGSA 3RIZA 3KJOA 3M4PA 4ECUA 3GTOH 2G9HD 4J9MA 2XNAC 1N34L 3RLNA 1X55A 4DL3A 4LF9L 1XMOQ 4LFCH 3CCVA 5DG7A 5LYJF 5JQWA 3NPPA 1DCZA 1Z47A 1JORA 3CF5A 2XRQD 2NZHA 1ZYRD 4ZUJA 4DV0Q 4HYKA 1RTOA 1PH1A 1K0SA 5HBRB 3PVXA 5DEHA 4ED1A 4Y8VB 1E1OA 4OONA 3H0GB 3RV3A 4QIWB 4YAKB 5EKLA 5EWGA 2NU8B 3OIPA 4C2MB 3V4SA 3KF8A 3MEFA 2R7NA 1Q1BA 1JXLA 1I7NA 3L4JA 3BYYB 3RR5A 4Q0YA 3RJ0A 1SE4A 4OWXB 5DM63 3SK5A 2O5JC 3CRLC 2YV5A 1JWUD 3VR4A 5KFQA 4IJLA 4EGQA 3G6VA 1VQ6A 3GTOA 1KJQA 3NENA 2W7PA 1YHAA 4FF1A 1FKAH 1XMOL 4DR6Q 2JA6H 1F2MA 2PBZA 3KALA 3URYA 1EIHA 1I6UA 1UUPA 3HOWB 4HNTA 1LYLA 4GOPA 5LMNH 4CKBA 1BXRA 1BJTA 3JAMi 2W70A 3OPOA 1K83H 1EOTA 5LMNW 1I4PA 1ZYRC 4A3CH 1JE5A 5J22A 3J81i 2HCCA 3OMGA 2J9GA 2YZGA 5FKAC 1NMGA 2UXCQ 5FLXW 2EY6A 3S1MH 1IXRA 3U4ZA 1KAWA 3WDNA 4A3GB 2VNUD 4B3TH 3TP5A 1H9SA 1QVCA 5CC4A 1C48A 2EZVA 1SROA 2F0WA 1J5EH 5ELDA 3RZDB 2D9UA 2NTTA 5EKKA 2FHTA 3STBC 5IP9G 4N8X1 4A3IB 4DL2A 1EY5A 1LT4D 1MD2D 5I2XA 1F9RA 1X3GA 2W6MA 3C46A 3MR5A 4DR6L 2JA6A 1D6EC 3QZ7A 1HR0H 5JPNC 1BGWA 5KEEA 3DXJC 2W9CA 4A76A 3ULPA 2PVPA 3H0GG 5D14A 2Z4IA 4TVAB 1HR0W 4YY3H 1F2LA 3T1YL 5KT2A 1B8AA 1K83A 3MWDA 2B2UA 5JAVA 1QZGA 3ETJA 1Q90A 2ZJPA 2NZOA 2UXCL 2TSSA 2NU9B 4M7EA 1M4VA 1K0RA 2ASDA 4G57A 4IZ8A 1GLVA 2X69A 5C3XA 3BDLA 1I4RA 1DONA 3GTPB 2H4OA 4DK3C 1BUVT 3GV6A 2E2IH 2GVAA 3HOWG 5J2TF 1SEBD 4NXMQ 1STNA 4QIWE 3A5UA 4GN5A 3GTGA 4XZ3B 4RAZA 1K3RA 4HR7A 2HIXA 3EN2A 1I3QB 2E5LQ 1L2ZA 2QF7A 4IUVA 3MWYW 1S03G 1Y1WB 1ZXTA 1V4YA 3E6ZX 1L0WA 4ZRZA 4ECXA 1RJQA 5C4JB 1J5EQ 4A3GG 3QB3A 4HEDA 4R4QA 1JB7A 1PDQA 1JDBB 2O2LD 2WTFA 1GYFA 4JYAQ 5FLMG 4P73A 1F2YA 1TS5A 5CV8A 1VMPA 1G2TA 1I6HH 1SNCA 4RAUC 4A3IG 5I4DA 3FKIB 3IFTA 1HR0Q 3JRWA 4F50A 4P71A 5IIFA 4L6TB 1D5MC 5EAYA 2O4XA 4DV4H 4G7HC 2W8KA 3AYHB 1YHQA 4YY3Q 5C44B 5LMNL 4K0KH 2E2IA 1EY9A 2EY2A 2LXKA 2F0EA 2MHVA 4ODGA 3H20A 5F9NA 1A2UA 3I3CA 3OSNA 1LTSD 1UE6A 3OYYA 2E5LL 1CQFA 4A4IA 3GV7B 1ZKOA 2K05A 2A6HD 2HD3A 4TUYF 2Z8LA 4O3PA 1J5EL 1E2VA 3GO5A 2JN4A 4Q8EA 2JXMB 2F03A 1VQNA 1NMFA 1S10A 1JX4A 4AQYQ 3KYHC 1HCZA 1K1QA 2I46A 2R84A 4FXDA 4H02A 2MPMA 3PF4A 2TMPA 1JICA 1CKNA 2M2LA 4A3FB 4E6IA 1AZPA 1HR0L 2JA8H 3GILA 3UQ8A 4J9LA 3K8AA 3ORRA 4MTEA 1VKZA 2BR0A 4YY3L 3GIPA 5FK9C 5D8DA 1EWCA 3N6RA 3I4MH 3S1NB 1Y1WG 3T5HA 2B2VA 1DOLA 2JEFA 1SE8A 2B29A 3M3YB 3DF7A 5DG8A 1Q8KA 2PQAB 1EUCB 3WO1A 3G6JB 2BOSA 5C0XG 1VF7A 3TN2A 1A8VA 2B2TA 4YBZB 4EQPA 4PQXA 2XD4A 3AFPA 2EDGA 3BA8A 4JV0A 1D5ZC 4C3IH 4FF4A 4DV1Q 5D1OB 2A6HC 2O5IC 4DV4Q 3FKIG 2ENBA 3DWAA 1IKMA 1G2SA 2EIFA 2YYZA 4K0KQ 3J80c 2CKZB 1QE6A 1SJHD 5JJLA 1CQIB 4QWEA 4GKKQ 5C3EB 4WJ3M 2E74C 3EFXD 4JI6H 1Y8NB 2FLNA 5C44G 2A19A 1X3PA 2NU6B 3ETHA 4LUOA 5LA6F 2WV6D 2IX1A 4U7CA 2UUAH 1C4QA 1DD2A 4L63B 1PTOF 3Q22A 2EJFC 3LX0A 3CC7A 5EDWA 2MO0A 4NW2A 3L7ZC 4MZ9A 3VPBA 2C35B 3QOJA 4UAIA 2IW3A 3W2DA 2C2DA 5M3FH 1PFMA 4UCOA 3A8KE 4A3JB 3N42B 2Q8IB 1YVCA 4X3SA 1PH7A 1QB5D 4UCSA 1CHQD 5I2YA 4DV1L 2BA0A 4WBNF 4DV4L 5T1IA 2A69D 3H6MA 1NE3A 4A3FG 3GP7A 4C5BA 4A3MH 2K5DA 4K0KL 5C0XI 1EIFA 5GONF 3H91A 2NVXH 4GKKL 2MUYA 2ASBA 4HJ8A 4QB4A 4O3RA 4MV6A 5KFZA 3KJPA 4FXKC 2C28A 2BQ3A 3GTJH 5M5WB 2F0FA 2RQXA 2Q8RE 3N43B 1FL0A 3G71A 5FD5A 3K5OA 1TIID 4OXPA 4IPDA 3H4DA 3HOYH 3Q6SA 5CBEE 1EYGA 1B53A 3CC2A 2R7MA 2RSOA 1RD9D 4M1UB 1SYEA 3PO2G 1WSCA 1WTHA 2DLNA 1W6KA 4DV6H 1Y1VB 4JI0Q 4ZYSA 3HOZB 4RAYA 5KFGA 4DLKA 4DR1H 3M9OB 3K59A 2UUBH 4GKJH 2A69C 5JUMA 5KFCA 2KUMA 4DL6A 5L1IA 2R7KA 4QJFA 3K3VA 1RJPA 1JJGA 3V6KA 4RGNA 1JLLB 3CCRA 5JVDF 4RU9A 3GTJA 5FJ8H 1I4GA 5FOBB 4IRKA 4R4OA 1HNXQ 2V1CC 3S1RB 3NEMA 4LUVA 1SXTA 4KLKA 4A3JG 3R5XA 5LMUH 1IOVA 1PH3A 3PW4A 2UXDH 1CA5A 1T5EA 2ZTDA 3TS2A 5KFXA 4QY7A 4LFBH 1KLGD 2XWJB 3CMEA 3C0FB 4WD3A 3LMLA 4ILWA 3I7FA 1QVFA 3DM3A 4J1MA 2VQEH 3ERQA 4JI0L 3J7AF 2GVBA 5KFYA 5IGEA 3T1HQ 5K2MA 2WAQB 4HNVA 4IFDG 2OXPA 1RTNA 1LUZA 2FPPB 1XPOA 1QVGA 1EZ8A 1LM0A 1Z7TA 3KAKA 4U6PA 5IWAQ 4IR1A 5HURA 2F0LA 1STBA 3NBHB 3QO2A 1UNNC 4C1NI 4LMYA 2F3VA 2F0KA 1NR2A 4ED2A 3G4SA 3TP7A 4DV6Q 1Z2OX 4PNYA 2NVYH 3RUPA 2JA5H 1J9OA 3F1ZA 3K57A 4DR1Q 1N32Q 2R8IA 4RHSA 1ASYA 2UUBQ 3HOZG 1KLUD 4ME5A 2RHSB 2XWBB 5IYDG 3CKIB 2Y0SB 4KY7A 3BVGA 2XCAA 2BH8A 4HSPA 2R6FA 1MZBA 3AB9A 1HXYD 5KFDA 2CW0D 2OLSA 2L55A 1QNKA 2ALYB 3T1HL 4JI7H 1TS4A 1Z2NX 2QGQA 3GV5B 2BCOA 2UXDQ 3KTMA 4MN3A 4IPHA 4C3HH 1HPCA 3NTKA 4IOCA 3E5NA 3T4AC 3BVZA 4DV7Q 1XYIA 4IFDI 5G3LF 3B6YA 3D4RA 3LGJA 2VQEQ 1TWHB 3NQTA 4DV6L 2QEXA 2NVYA 2JA5A 3M4YA 1HQMC 1NJIC 4DR1L 1N32L 1WD0A 2UVVA 2UUBL 3N8DA 4O4HF 5CV4A 1B70B 1N36H 3JAME 4RUAA 4A3KH 2F0JA 1I50H 4UHVA 2K6AA 2WAQG 3PUZA 4RKLA 1WYDA 2HDLA 3J81j 2HVSA 1B4OA 3TP6A 3CPWA 4DUYQ 1XMQQ 2A68D 1PFSA 3Q23A 5ELOA 1VS0A 2K7VA 4NP5A 3J80E 1E24A 3I55A 4JOIC 2UXDL 2FE3A 1PA6A 2YTXA 1GGOA 1HTLD 2SDFA 2VUMB 4RB2C 2HHHH 4LFBL 3N40P 3FDSA 2UUCH 3SK8A 5K36G 4DR7H 4DV7L 1XX8A 3RZOB 2FJZA 2IL8A 3IFDA 2VQEL 1WH2A 1A62A 3CXCA 2NN6H 3K6OA 1CKMA 3MWMA 2Y0SG 2WAQE 3LWEA 2PZWA 3RV4A 5IE8A 1TY2A 5KNBA 3M4OH 2W6QA 4KN4C 3PN1A 3KLSA 4IQZA 3NE5B 3U58A 5D1PA 4ZCKA 1I50A 1JWSD 4DFAA 2MGSA 1EIYB 1HNZH 2BA1A 4DUYL 1TWCB 4BY7B 4K5VA 1U0LA 2ES2A 4J9KA 3MEHA 4I7AA 1K28A 2LKVA 4ECSA 2A68C 1PRTF 2R7ZA 3VPDA 4X6AH 3UFXB 1EQTA 1U5KA 3JRXA 4EQ5A 4ECWA 2Y0SE 3K3PA 3A7LA 1N36Q 1XPUA 1B6SA 3JSLA 1HHVA 1DIKA 2DNCA 2KVMA 3RMHA 3SEBA 4A3BB 1EZ1A 5KKNB 4QWDA 3PIPA 3K5IA 1O78A 2CWAA 4H44C 1PTOD 1YNND 1E4EA 4JC0A 2FMMA 4HCSA 3S17H 1SFOB 2HHHQ 4OWWB 1VQAA 1EWIA 3GTLH 5KT6A 4UP7A 3I12A 2VUMG 2Q2UA 4CJ2C 4DAYA 1QZHA 2DY7A 4ED3A 3GDEA 4HIOA 1STAA 3ZYYX 3TIIA 1UNSA 3ITPA 1MJEA 4EG0A 5KG7A 1OXXK 1VQJA 3T13A 3W3AA 1N36L 5IP7H 3IKJA 4QCLA 1CFMA 3HBLA 4IN3A 4ULLA 5M5YH 4LMQD 4GS3A 2PN1A 4OIKA 3KBXA 1HNZQ 5J1ZA 4GLAC 2K1BA 1D1IA 3F2DA 3T5KA 4QQBX 1KRSA 1O7YA 1LT6D 4Y7NB 2FPIB 4GNXB 4BY7G 3HOXB 4HN7A 2EPBA 2SCUB 1PTOC 1YNNC 1LO5D 3ULJA 3HOUB 3W5OA 2C5CA 2HHHL 2YZNA 5KFMA 3H4BA 2JQOA 3GTLA 4POGA 1YI2A 1XNRQ 3G6XA 2HT1A 4APVA 2EY1A 1SN8A 3BA9A 3HS0C 1R4PB 1KL9A 5KFSA 4EFBA 4DR5H 4A3BG 2FK1A 1EUDB 4HIDA 4A3EH 2D5DA 5C1PA 3RFCA 2A1AA 4R9WA 4RMFA 3VYTA 4L5TA 3N41B 4H0LC 1SE2A 4X65H 2JYOA 2XGTA 2XVSA 3VR5A 1PFNA 3Q0AA 2PNRC 1HNZL 4YP3A 4FU0A 2NUAB 3G48A 4F7XA 1LTGD 2Z6KA 3WO0A 1K8AC 5EPLA 1F2ZA 3D6CA 3HP3A 1CM9A 4QWCA 1K9MC 3PIP3 4RCNA 3H3VC 2BQRA 2VA3A 4GC7A 3WOEA 2RDHA 4YHHH 3J7A5 1A15A 3EA6A 1XJVA 5CBAE 3NTIA 1NY4A 4A3DH 4RB0A 2IBKA 2IPKD 1KJJA 2A6ED 3V96A 3Q2OA 4JV1A 3HZXA 3OWFA 2OWOA 2Z6BA 2NVTB 2PI2A 4YJ3F 3WNZA 4NKLA 3HOXG 1LTID 3HB9A 2R7FA 1WJJA 3HOUG 3NSWA 4ALPA 3GTQH 4IO9A 3NTHA 4DUZH 2K5QA 1V8QA 4F87A 5KG1A 4I7HA 1UE7A 4TV8F 4EEYA 1GHKA 2R8KA 1LTAD 2M00A 4DR5Q 3CC4A 1OO9B 1EL0A 3RLFA 3BJUA 2JP1A 5BN5A 2W9BB 1PZID 2IHEA 4H7BA 5IGBA 4QGUA 4QW9A 5IGFA 4BBRB 1V1OA 4X65Q 1FYCA 4J8QA 4EQNA 5M9OA 5DM73 3PUYA 5CGKA 2YS6A 1RYSA 3KHRA 4PMBA 3S24A 5LP6F 1E4FT 5DAUA 4O2DA 5C4HA 4R8IA 1S5CD 2JA7A 2ZDGA 2F0HA 4APMA 4AIMA 4O3QA 1CQVA 4OHJA 3QIAA 3A5ZB 1QNUA 3RNUA 4JBJA 1Q86C 3GTQA 2VL6A 4S3SA 5G3LD 1S5FD 4YHHQ 3PO3B 1M6VA 2GPSA 1BO0A 1VQDA 5EJWA 4CDCC 1CKOA 4UY8C 1S5BD 5KNDA 4DR5L 4MA5A 3RTXA 5KT5A 2Z9HA 4IUPA 2NZ1D 2I5LX 3A54A 3FHWA 2VPSA 3MTSA 3PIOA 1CQJB 4X65L 3MAQA 5J3BA 1TT2A 2UU9Q 2EYHA 3PW0A 2IA6A 1IBLH 2A5HA 4LWCA 4DUZQ 3S15B 1KJ8A 3KAJA 5IP9H 3KDFA 1A63A 5KFTA 1UE1A 1NR4A 2V9WA 2RDGA 1EYAA 2W6ZA 3M7GA 1S5DD 3BJYA 1E2ZA 2UVUA 2JEAI 1IKLA 4ED0A 2CZGA 1PTOB 1S97A 5COYA 4EBCA 5DGAA 4YHHL 1OTCA 3PW2A 3H0GH 4IUTA 4O2AF 1YIJA 1DM0B 4BBRG 4C2MH 3Q8SB 2XCLA 3STBD 2XGQA 4EVOA 4ECRA 3PMFA 3EROA 4C5AA 3FVQA 1D8LA 4ME3A 5GQOA 3DM1A 4Z9CB 1HZBA 5JJKA 4AYBB 2UU9L 3TQYA 2Z1CA 5CYUA 4I55F 1GVPA 4K8IA 2RHQB 4HSVA 4ZQ3A 2K4KA 3GV3A 1R4QB 4DUZL 1VQOA 1PRTD 3MVVA 3UDXA 4HJ9A 2V59A 3PO3G 3T1YQ 5CAEB 3HOWH 1GOZA 5CV5A 1Q12A 1PZKD 2Q2HA 4UDUC 2Q8TA 1XWEA 3GIQA 4RHRA 3M9MB 3ERSX 3TSSA 1LTLA 1TWFB 3GTMB 1SBBB 2B2WC 1PVOA 3H0GA 3KXYT 4QIWA 2IHFA 1JWMD 4LFCQ 4C2MA 1IBLQ 1LTRD 3RLOA 4MTKA 5AFWA 4DNRB 4A3GH 2R93B 1X3QA 5FO9B 2JE6I 1JR0D 1SAPA 4KK7A 1SYDA 3H09A 3RZDH 4FM9A 4DL4A 5FLMH 2K14A 1HNWH 1STEA 2R8JA 4CDFC 3GTGH 3S1MB 1B7YB 1ESRA 3I91A 4K5WA 2E2JB 4DV5H 2HDMA 1TVXA 3RGXA 1VQEA 1K8GA 4MHEA 4MV3A 2BH2A 5EQ0A 4EBEA 3PIO3 4RGTA 2K50A 3A56A 3E0EA 2FK3A 2C9OA 1PRTC 4R4IA 4B3SH 4Q5VA 1E7ZA 1GSHA 4MTNA 2IY5B 4JV2A 4JI5H 5C4XB 2C2RA 5EBDA 1SR3A 2EJMA 3HOVB 3C1FA 3K0YA 3U4VA 4CKCA 4LFCL 1H9JA 1IBLL 1TQOA 2KHIA 3E3XA 1QCBD 2ICEC 3CW2C 5D65A 1EU3A 4AYBG 1BNCA 1TAEA 4IWYA 2VXWA 3BU2A 4K2LA 3KF6B 3L3OC 3VYUA 5KFJA 2YYAA 1M0WA 5LMNQ 3GTPH 4BS9A 1ENFA 3LWUA 1JCKB 4OIJA 3U9OA 2B2YC 2AU0A 3AU7A 3S14B 1PFBA 2F3WA 2FLPA 3K7AH 2R6GA 5C4ZA 1GHJA 4B3TQ 2NYZD 1G6PA 5L37A 1I3QH 2JA6G 5T1GA 1Y1WH 1O7IA 3QOLA 2DNEA 5HGQA 5C4JH 2CFMA 3MXNB 3S1QB 4AYBE 2R93G 1XDNA 1NCVA 2R92B 1QOHA 5ELFA 1MI2A 2K5WA 3OUUA 2R3ZA 1ET9A 2E75C 3A74A 3PGZA 1IW7C 4FXGC 1E22A 1ML0D 1P8LA 3X3NA 4Q0FA 4MV4A 4JV5H 1N56A 3BDCA 4IRDA 2DGYA 2KENA 5E7NA 4JI3H 4JVZA 2ZDQA 5LXTF 2I5HA 1H9RA 3GTPA 4FBTA 5CR3A 5FLXL 1I4XA 4B3SQ 1YBYA 2EOTA 5C44H 2HUGA 2R8HA 4JI5Q 4L1KA 2F4VH 2YRXA 1A2TA 2B39A 4GN3B 5L1LA 4B3TL 2KBNA 4K6DA 5C4XG 1B9MA 1I3QA 3PW7A 3R93A 3HOVG 1Y1WA 3O13A 3JSNA 3HGBA 5GAEC 5AJ3Q 2L0CA 2CW8A 4YR2A 1T3NA 3Q8DA 4ECVA 2MQHA 1HNWL 1JJ2A 1EYDA 4YR3A 3MXPA 2F0OA 3WOFA 2I80A 3H3VI 3I4OA 2EYJA 3OHXC 1OXTA 2R7LA 3NGDA 4RKBA 1D2BA 1M7JA 3FKIA 5EPKA 4A3FH 5I9OA 1R9TB 2YW2A 4DU9A 1HJPA 4JI4H 4LUZA 3RGZA 2W6PA 1FD7D 2VA2A 4J15A 4B3SL 2E2HB 1PYBA 1W2BA 1BBWA 4JI5L 1L0YB 3CCSA 3W1BA 3JAMc 1L1OC 5CV7A 2NB0A 5EKIA 4GC6A 3J81c 3M3YH 1Q81C 2RGRA 2R92G 4JI1H 1X6OA 4F8MA 3I73A 1JT8A 1EQVA 5AJ3L 4TKOB 3DWQA 4XQJA 4CDEC 1WD1A 4JV5Q 1AE2A 1UC9A 1SSOA 4JI3Q 4KKUA 3PO2B 5IT9E 2F4IA 4YWLA 4DV2H 1GSOA 1BKBA 1QUQB 1VQ8A 4PZ6A 4TRDA 3S16B 5HY6A 5C3EH 1VBHA 2F4VQ 1VQ9A 3KBGA 3TIGA 4RG1A 2F52A 1TR5A 5K5PA 1EYZA 1E4GT 5KFOA 4KI0A 4BWGB 2HCIA 2SOBA 3D0FA 3L0OA 4WRDA 3MR3A 3OUZA 4J6HA 5HGTA 3HFZB 5KFKA 1CA6A 2WE6A 3V2TA 4K5XA 2UXBH 2AQ3B 5IYCG 1PRTB 4RZQA 3HG9A 3KFUA 1EQQA 1XNQH 2PQAA 3MWEA 2VW9A 1Z6HA 4A3JH 3I4NB 2FB9A 1HZAA 1ENCA 3G6YA 5BR8H 2L11A 4JV5L 5HV6A 5KT7A 2RVLA 3EQLC 5KG6A 4JI3L 4B3RH 5D1OA 4JI4Q 1EOVA 3TRZA 1SYFA 1TY0A 1AW7A 1O75A 2AHOB 2BE5C 5ISRA 4IUUA 4YAJB 3SR1A 3TMEA 2KHJA 4JBKA 2F4VL 4O1NA 2JEIA 5IOCA 3KLSX 2OEOA 2XIWA 3K5LA 4N9PA 4UCTA 1RL2A 4NLGA 4I65A 5CB4F 1PH9A 4E4TA 4JI1Q 4K6LA 2BDOA 4IFDH 2N8NA 5M5WH 1KC8C 4F4XA 5LL6S 1J8IA 3TBIB 1SMYD 2I07B 2NVXB 3BG3A 3BABA 5LL6X 2ZDHA 3HKZB 4O0AA 1TWAB 4J9QA 2FLLA 4P2CB 4V190 2J6SA 5LHY1 1PH4A 2V5AA 4JI6Q 1MSGA 2EJGC 4RGOS 1WVLA 3QFFA 1IBMH 2ALZA 2AGPA 1YITA 5BN3A 1LLRD 1GKHA 1WTPA 2QDBA 2UUAQ 4RA8A 1Y1VH 2F0TA 1PH6A 3HOZH 4JI4L 4RB3C 4IJHA 1VQIA 1AP0A 5IYDH 2YU9B 1GUGA 4GLVB 1XPRA 1U4RA 1PHJA 3CCJA 1IOWA 3OHBA 2JEJA 4PMWA 1TWGB 1XNQQ 1OWTA 3NWTA 4JI1L 1VQ7A 1PX2A 3JAMW 4ECTA 1IYJB 1A6XA 3QZ8A 3S1RH 1HUNA 1VQFA 5BR8Q 3I4NG 2R82A 2KSWA 2HIVA 2BDNA 2QDLA 4B3RQ 1SMYC 2PMZB 4JI6L 5A2QW 1I5FA 1BCPC 1V9PA 3J80W 1TU2B 1GUNA 1KC7A 2J0TD 3FDTA 2SNSA 3CHBD 2UUAL 1Y1VA 2RDFA 3AMUA 1S68A 2G5DA 3I90A 4CJ1B 1EY0A 4OELB 1SCUB 3VR6A 4LH7A 2NVQB 1WOCA 4OL7A 1S0NA 1IBKH 2E2DC 4DNIA 1XNQL 3R23A 4IZOA 3HKZG 1IBMQ 2ZXOA 1S72A 3RN2A 1X54A 2AUKA 4DXFA 3SK6A 2QYZA 4A2BA 1L1OB 2P5ZX 1CUKA 1DYQA 4DF7A 5BR8L 4ME6A 5LL6b 1SYBA 3TZDA 3PZPA 1U4PA 2IT1A 3QR8A 1OXSC 4B3RL 2F0QA 5M3MB 4GKJQ 1G8ZD 3TDQA 5M5XB 4YCWA 3M9BA 1KNEA 1SRUA 5ELNA 1MSHA 2GLTA 4OWTB 2N78A 2LY7A 1C9OA 4GNXC 2XCPA 3SE0A 2OTJA 2CQAA 1A3TA 5LMUQ 1BQQT 1O7LA 3A7AB 2MO1A 3HKZE 2A73B 2RA4A 2WAQA 3BQ1A 2ICIA 3T5JA 4BY1B 3D4DA 4LFBQ 4XYMB 4NPSA 4L8JA 3CAMA 1C0AA 1UC8A 1NAPA 1BVSA 3GLKA 4Q44A 2Q2IA 3K0XA 3UE1A 1IBML 1TXYA 1II3A 1VQHA 5C6AA 5KG4A 1FGBD 4DN4M 3NBHA 1EFWA 2YCHA 5FO7B 2ZJRA 2RSNA 5BN4A 5FJ8G 1Q8IA 1TWHH 3P20A 4DAMA 3OTOH 3RAXA 1EQRA 1QILA 4C3JB 4GKJL 2FK2A 3J7ZC 4RWSC 1SYCA 3J81E 2V4RA 3FMAA 4K2KA 3S2DH 1GSAA 2GA4B 2KECA 2Y0SA 4C5CA 5A2QE 3WWVA 1AN7A 5LMUL 2QKIC 2FJ2A 2R7ZH 5DQHA 2GN5A 2Z0SA 3NUCA 4JG2A 4ZLTF 5JEAJ 3J7AV 2PMZE 1GM5A 5JVG3 3J80L 4KY6A 1ZQ7A 3I70A 2XN9C 4EYIB 2KCNA 1F9QA 1L0XB 2K52A 2KEDA 1UE5A 1SLJA 4B9WA 5M3MG 4LF7H 2JJQA 3VYRA 4JI2H 1ENAA 1VQCA 1X32A 3RZOH 3K5HA 4O3SA 3BQ0A 4B3MH 3CCEA 3NK9A 5CA0F 4JI7Q 1TWHA 1OXVA 3CVZA 1GUOA 3CQZB 1WI5A 1QG7A 1WTOA 4POFA 4LF6H 2K03A 3I72A 4V0BA 4XIGS 4J0MA 3VR2A 3RF2A 1I4HA 1QWYA 4BY1G 2OQ0A 5DQGA 4R8UB 4O3OA 3A8JE 4BY7H 1B1ZA 1TWCH 3D3RA 1MBYA 5IYBH 2HQLA 2YTVA 4YB8B 3TQTA 3Q8PB 4R8NA 3BZDB 1SJED 2M9VA 3OTOQ 3A0JA 3VYSA 2VB2X 4PG3A 1FJGH 4DNTB 2VUMA 2PCFB 1BR9A 4TQUS 4C3JG 2DIKA 2RF4A 3F2BA 2XGPA 2FFKB 4XXEA 4LF8H 4X66H 1E0BA 2HJWA 1BCPB 2CVRA 1X65A 4JI7L 5I47A 1RYRA 4LJZC 1CSQA 1M1KC 2KOLA 3VA5A 3RB4A 5I6YA 1LT5D 4PDBA 2PZTA 3NBIA 2KQ3A 2JEBI 5J39A 2K33A 2JSOA 3NQIA 4IAJA 4EEQA 2UUCQ 4K14A 4C1NK 4DR7Q 1PMRA 3AQQA 5T14A 1SFOH 4QWBA 3FMCA 3OSPA 4ED6A 1RJTA 4LF7Q 3DEPA 4HMJA 1TWCA 4LH6A 1KTKA 1VAJA 1IL8A 2SEBD 3BYTB 3HXLA 2J7ZA 2WB1B 4ID6A 1C8CA 1WCMB 1MKHA 5F9LA 4QWAA 3H40A 3OTOL 5FPOA 1ILPA 3R5FA 4LF4H 2Q2TA 2VY3A 3IN5A 4LF6Q 4NMZA 4NB3A 3GQBA 1RHPA 4O3NA 1YHBA 3T56B 5KIXA 5GAHC 2ATLA 2EYOA 1T36A 5C5LA 3NHHA 1GXDC 1UAPA 2NN6G 4Y7NH 2FXQA 3ONAB 1MHWC 2EQSA 4KHZA 1B3QA 1CE8A 2B63B 3HOXH 2G9DA 1FJGQ 2UUCL 1EHIA
chains in the Genus database with same CATH topology
3K8AA 3HOUH 4DR7L 4A3LG 1D8LA 4ME3A 3KOJA 5GQOA 4YY3L 1HNXL 1H95A 1L2FA 1HZBA 4LF7L 4GOPC 3I4MH 5JJKA 1Y1WG 2UU9L 3TQYA 3L2PA 4JI2L 2DUDA 3UE0A 1GVPA 4OO1G 1SE8A 2B29A 2RHQB 1Q8KA 2PQAB 1Y1VG 2K4KA 4JI8L 4PZ8A 4DR3Q 4DUZL 5C0XG 1VQOA 1PH2A 4BY1H 1A8VA 2Z6KC 3UDXA 4HJ9A 3PO3G 3AFPA 3T1YQ 3HOWH 3ICEA 1HZCA 1Q12A 4C3IH 2Q2HA 4LF6L 4DV1Q 2OQKA 1KD1C 4WJ4A 4DV4Q 3FKIG 3OW2A 1L1OA 1W3SA 2EIFA 2YYZA 3ERSX 1LTLA 2CKZB 3ZJYC 3J80c 1PH8A 4K0KQ 5JJLA 4GKKQ 4WJ3M 1PVOA 1AE3A 2AKWB 2IHFA 1YJ9A 5C44G 1SMXA 2A19A 4LFCQ 1IBLQ 3RLOA 4C3JH 4GNXA 4A3GH 2K5HA 5IWAL 2JE6I 1FJGL 1IBKQ 1N9WA 4LUOA 2IX1A 2WB1G 4LF4Q 1WCMG 3FP9A 3RZDH 5FLMH 2K14A 3CC7A 2MO0A 3L7ZC 4BA1I 2NN6I 4MZ9A 3U50C 3W1GA 4LF8L 4QL5A 2C35B 1B7YB 3GTGH 2E8GA 5M3FH 1VQEA 1K8GA 1Q1EA 2K5NA 4DR3L 1OXUA 1YVCA 2BH2A 2JA7H 2VUMH 1PH7A 3CCUA 2K50A 3E0EA 4R4IA 4DV1L 1E7ZA 2BA0A 2NVTH 4MTNA 4OO1I 2IY5B 4DV4L 1X9NA 1NE3A 3IRBA 4A3FG 2B63G 4A3MH 4K0KL 1SR3A 5C0XI 1EIFA 2QA4A 2R7DA 2NVXH 4GKKL 3U4VA 2WB1E 4YWKA 4HJ8A 2ASBA 2JA5G 1BBUA 4LFCL 1IBLL 3AFQA 2KHIA 3KJPA 4AYBG 1E1TA 3CW2C 1PV4A 1C7YA 3CQZH 3BU2A 1IBKL 1FGUA 3KF6B 3GTJH 1X3EA 3CCQA 3ER0A 3PSIA 4LF4L 3K7UC 5LMNQ 1FL0A 4DK6C 3G71A 3GTPH 4JOIA 4DR4Q 1YEZA 4R4CA 1VQPA 4BBRH 4OXPA 5GROA 4IPDA 2VQFQ 3HOYH 2ZM6Q 3PF5A 1EYGA 3CC2A 4OX9Q 3K7AH 2R6GA 1Y14B 4A93G 4DKAC 4HIMA 4B3TQ 4A3LH 1G6PA 1I3QH 5H1SE 3PO2G 1YZ6A 2JA6G 1Y1WH 4JI0Q 1O7IA 4DAYB 5HGQA 2WP8J 4JCVE 4P75A 2ZJQA 1XTDA 2EXDA 1XMQL 1IL2A 5C4JH 2CFMA 3MXNB 4A3BH 4AYBE 2R93G 5C0XJ 3AEVA 3PO3H 3A74A 3PGZA 4R1JA 2PNHA 3BZCA 4QJFA 1E22A 1P8LA 1JJGA 3CCRA 5FJ8H 2JK8A 2WFWA 2DGYA 4R4OA 4A3KG 2KENA 2V1CC 3NEMA 4LUVA 4KLKA 1EUJA 5E7NA 4A3JG 2I5HA 4DR4L 4JI2Q 1PH3A 4B3SQ 1YBYA 2N49A 5C44H 3KF8B 4LNQA 4B3MQ 2I5MX 2ZTDA 2VQFL 4JI5Q 3TS2A 4BBSG 4QY7A 1WFQA 2ZM6L 4OX9L 4MNOA 4GN3B 3K80C 3CMEA 4B3TL 2KBNA 1WCMH 5C4XG 2R7ZG 3PUXA 4IOAA 3I7FA 4HIKA 1QVFA 3DM3A 1A0IA 2D62A 3HOVG 4JI0L 5GAEC 5AJ3Q 2GVBA 3Q8DA 5IT9c 5GAGC 2LXJA 2MQHA 3CP0A 3T1HQ 4BXXG 4IFDG 4A75A 1HNWL 1JJ2A 2B3GA 1LUZA 1Q7YC 1XPOA 1QVGA 1NTGA 1LM0A 4JBMA 3H3VI 3I4OA 5IWAQ 4GOPB 1OXTA 4LF5Q 1JJCB 1Q82C 3NBHB 4A3FH 2B63H 2K75A 1E3PA 3M4QA 1HJPA 4LUZA 3G4SA 4DV6Q 4DR2Q 4J15A 4B3SL 4LF8Q 2NVYH 1PYBA 2JA5H 4X66Q 1W2BA 1BBWA 3F1ZA 4DR1Q 4B3ML 1N32Q 4JI5L 4P72A 3CCSA 1ASYA 3W1BA 2UUBQ 3JAMc 3HOZG 1NBWA 1L1OC 3CPFA 2L15A 2H5XA 2RHSB 3I2ZA 3G6EA 3J81c 3M3YH 3F8TA 1Q81C 5IYDG 5IYBG 2R92G 4LFAQ 1X6OA 2KCTA 2BH8A 5GADC 3TS0A 4R4TA 1D7QA 1JT8A 5AJ3L 3M85A 4JV5Q 2ALYB 1AE2A 1G51A 3T1HL 1KXLA 4JI3Q 4YWLA 1KRTA 3H15A 3TEHB 2QGQA 4A93H 1X56A 1BKBA 4L5RC 2UXDQ 2ZTEA 1QUQB 3GTMH 1TWFH 4PZ6A 2CQOA 3EBEA 4IPHA 4C3HH 5HY6A 1VQ8A 2A8VA 5C3EH 2F4VQ 1S40A 1VQ9A 4LF5L 2CCZA 4IOCA 1RIPA 3GTKH 4RG1A 1YNXA 3H3VH 2F52A 4DV7Q 4KI0A 4L5SA 2D0OA 4IFDI 2R93H 3B6YA 3PUWA 1VQ4A 3D0FA 3L0OA 4DV0L 3LGJA 2VQEQ 4DV6L 4DR2L 2QEXA 3BZKA 2VZAA 3HFZB 4X66L 4A3IH 1NJIC 4DR1L 1PYSB 1N32L 4P74A 5IYCG 4EX5A 2UUBL 3PUVA 1B70B 3KFUA 1T9HA 1EQQA 4A3KH 2E2JH 1I50H 2YTYA 2PQAA 2WAQG 3PUZA 2VW9A 4A3JH 1WYDA 4LFAL 2I0QA 3J81j 3J80i 1HZAA 3CPWA 4DUYQ 1XMQQ 4Y52H 5IP7G 4JV5L 1PFSA 5ELOA 4BBSH 3UDGA 2OCEA 1VS0A 1XNRL 4JI3L 2ID0A 1HZ9A 4JI4Q 1EOVA 3RN5A 4FDBA 3TRZA 2AHOB 1E24A 5C4XH 4JOIC 3I55A 2UXDL 1PA6A 1I94Q 2YTXA 4NXNQ 2IX0A 2KHJA 4JBKA 2F4VL 1MIUA 3HOVH 4LFBL 3E9HA 5K36G 1RL2A 4BXXH 4DV3Q 4DV7L 1G291 1PH9A 4DPGA 4JI1Q 2N8NA 5M5WH 1KC8C 2VQEL 4IFDJ 1A62A 3CXCA 4HJ5A 1KIXA 1CKMA 2Y0SG 2WAQE 5IE8A 1GD7A 1M90C 4O0AA 3M4OH 3TREA 2N3SA 1HH2P 3U58A 1PH4A 4JI6Q 3S14H 1J6QA 5FLXc 1YITA 4UP8A 1EIYB 1GKHA 2BA1A 4A3EG 4DUYL 5JJIA 2UUAQ 2ES2A 1U0LA 4KHPQ 3SGIA 2RCNA 2ZTCA 1Y1VH 1PH6A 3HOZH 1FVIA 1KQSA 1HNWQ 4JI4L 1JMCA 4IJHA 1N34Q 1VQIA 5IYDH 3S1QH 2R92H 4X6AH 4LF9Q 4A3CG 1I94L 1U5KA 4GLVB 3KDFB 4NXNL 3GD7A 3CCJA 4DV5Q 1XPRA 1PHJA 4EQ5A 1UWVA 2Y0SE 1K73C 4PMWA 1N36Q 3FKIH 1XPUA 1XNQQ 4DV3L 2ATWA 4JI1L 1VQ7A 1AH9A 3CCMA 3KF6A 1GO3E 1IYJB 1KHIA 3PIPA 1S3OA 3S1RH 3UDIA 1VQFA 5BR8Q 2CWPA 3I4NG 1VQLA 2CWAA 3JC66 2HIVA 4B3RQ 4JC0A 1CKNB 4JI6L 4L5QA 2K5VA 1V1QA 4A3DG 4GLXA 5JEAG 1PH5A 2PI2E 1I5FA 1V9PA 1VQBA 3S15H 3S17H 3S2HH 2HHHQ 4OWWB 4IPCA 1VQAA 1VQGA 1EWIA 3GTLH 3I56A 2LSSA 2UUAL 4UP9A 1IZ6A 3EIVA 4UP7A 4KHPL 2JA7G 2VUMG 2Q2UA 5IYCH 3KJOA 3M4PA 1QZHA 3GTOH 2VS1A 1N34L 3GDEA 4HIOA 4NXML 3RLNA 1X55A 4LF9L 1XMOQ 4HJ7A 3F2CA 3CCVA 1MJEA 4DV5L 1OXXK 1VQJA 1WOCA 1N36L 5IP7H 1Z47A 3NELA 4DNIA 1XNQL 3CF5A 3PF4A 3HKZG 1IBMQ 2NZHA 5M5YH 1S72A 4DV0Q 3RN2A 1X54A 1PH1A 1L1OB 4GS3A 1HNZQ 1CUKA 1R9TH 4GLAC 3F2DA 5BR8L 1E1OA 4OONA 3S1NH 4QQBX 1KRSA 3E9IA 2E2HH 2IT1A 5IY0A 4JYAL 1OXSC 4B3RL 4GKJQ 3MEFA 4GNXB 4BY7G 4YCWA 1Q1BA 3M9BA 1N8RC 3RR5A 4YCUA 3CCLA 4XTCS 4OWXB 1SRUA 5ELNA 3ULJA 3W5OA 4OWTB 2YV5A 2HHHL 2N78A 1C9OA 4UPAA 4GNXC 2JQOA 2OTJA 4IJLA 1YI2A 4POGA 1XNRQ 2F3IA 1VQ6A 5LMUQ 2HT1A 4JBWA 2OTLA 3NENA 2D0PA 4APVA 2MO1A 1YHAA 1SN8A 3HKZE 3PO2H 1XMOL 4DR6Q 1KL9A 2JA6H 4LFBQ 4A3BG 4NPSA 1VQMA 3CAMA 4HIDA 4HJAA 4A3EH 1C0AA 3S16H 1BVSA 2A1AA 1LYLA 2Q2IA 3K0XA 4L5TA 4RMFA 3UE1A 1TXYA 1VQHA 4GOPA 1IBML 1EFWA 3JAMi 2XGTA 1HNZL 1K83H 4X62Q 5LMNW 2ZJRA 2AWNA 4A3CH 1JE5A 3J81i 5FJ8G 1P16A 1TWHH 1NMGA 2UXCQ 4DAMA 4YWMA 3G48A 3S1MH 1EQRA 4AQYL 4GKJL 3PCOB 2Z6KA 1IXRA 3U4ZA 1KAWA 1K8AC 3J7ZC 2VNUD 1QVCA 1DGSA 1SROA 5DLQE 3S2DH 1K9MC 3I4NH 3STBC 5IP9G 3WWVA 5LMUL 3J7A5 1ASZA 1XJVA 1X3GA 1NY4A 2R7ZH 2GN5A 4A3DH 2Z0SA 2MNAA 1YJWA 3KLWA 4JG2A 1VCIA 4DR6L 5JEAJ 1HNXQ 2PMZE 1GM5A 1QUQA 4A76A 3ULPA 1VQKA 3H0GG 1HR0W 4TVAB 2K52A 2OWOA 1UE5A 2PI2A 1SLJA 1UEBA 5M3MG 3T1YL 2JJQA 1B8AA 1V43A 3HOXG 2JA8G 3CD6A 1VQCA 3RZOH 4X62L 2R7FA 4LW1A 1QZGA 1WJJA 3HOUG 3CCEA 2ZJPA 4JI7Q 2NZOA 1OXVA 4ALPA 4IO9A 3GTQH 3M7NA 2UXCL 4DV2Q 3I4MG 1YJNA 1K0RA 4YCVA 1TWAH 1UE7A 1WI5A 4DR5Q 2AMCB 4POFA 3CC4A 3RLFA 3BJUA 4GN4B 3HKSA 2MFIA 4XIGS 4DK3C 4BY1G 2IHEA 2OQ0A 4QGUA 3PV0A 3CMAA 2E2IH 2GVAA 4X65Q 3HOWG 4AH6A 1TWCH 4BY7H 3PUYA 4NXMQ 4QIWE 2JA9A 2HQLA 2YTVA 4GN5A 5IYBH 4X64Q 3A5UA 4BA2I 2UXBQ 1K3RA 3S24A 2HIXA 3EN2A 3OTOQ 3A0JA 4PG3A 2E5LQ 2YU9H 4O2DA 3VDYA 1Z9FA 1Q46A 1L0WA 1MJCA 4TQUS 4AIMA 1J5EQ 2RF4A 5C3EG 3F2BA 1TWGH 4A3GG 4R4QA 1JB7A 3A5ZB 3RNUA 4JBJA 1X65A 1Q86C 4JI7L 2VL6A 4YHHQ 4JYAQ 5FLMG 1CSQA 4P73A 4DV2L 1VQDA 1M1KC 1I6HH 1CKOA 4UY8C 4A3IG 1X3FA 2JEBI 4DR5L 1N33Q 1HR0Q 5M3FG 4P71A 2UUCQ 2I5LX 5EAYA 3AQQA 4DR7Q 3FHWA 3AYHB 1YHQA 1SFOH 3PIOA 2KCMA 4YY3Q 5LMNL 2LXKA 4X65L 4LF7Q 5J3BA 2UU9Q 4X64L 2UXBL 1MKHA 1UE6A 4A3MG 3OYYA 3OTOL 4JI8Q 2E5LL 4LWCA 4A4IA 4DUZQ 3ULLA 5IP9H 1VQ5A 2XTIA 3KDFA 1A63A 2Q2TA 2NVQH 1UE1A 2VY3A 4LF6Q 1J5EL 3D31A 4NB3A 3GO5A 2JEAI 1YHBA 3UDFA 5GAHC 1VQNA 1NMFA 4YHHL 4AQYQ 3KYHC 1OTCA 3H0GH 4IPGA 1YIJA 2NN6G 2AWOA 4H02A 2FXQA 4Y7NH 2EQSA 4KHZA 4BBRG 4PZ7A 4C2MH 3STBD 3K81C 5M3MH 5M5XH 1CKNA 3HOXH 3DLLA 1HR0L 1N33L 2JA8H 3HOYG 1FJGQ 2UUCL 1CSPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K8A A;  3HOU H;  4DR7 L;  4A3L G;  1D8L A;  4ME3 A;  3KOJ A;  5GQO A;  4YY3 L;  1HNX L;  1H95 A;  1L2F A;  1HZB A;  4LF7 L;  4GOP C;  3I4M H;  5JJK A;  1Y1W G;  2UU9 L;  3TQY A;  3L2P A;  4JI2 L;  2DUD A;  3UE0 A;  1GVP A;  4OO1 G;  1SE8 A;  2B29 A;  2RHQ B;  1Q8K A;  2PQA B;  1Y1V G;  2K4K A;  4JI8 L;  4PZ8 A;  4DR3 Q;  4DUZ L;  5C0X G;  1VQO A;  1PH2 A;  4BY1 H;  1A8V A;  2Z6K C;  3UDX A;  4HJ9 A;  3PO3 G;  3AFP A;  3T1Y Q;  3HOW H;  3ICE A;  1HZC A;  1Q12 A;  4C3I H;  2Q2H A;  4LF6 L;  4DV1 Q;  2OQK A;  1KD1 C;  4WJ4 A;  4DV4 Q;  3FKI G;  3OW2 A;  1L1O A;  1W3S A;  2EIF A;  2YYZ A;  3ERS X;  1LTL A;  2CKZ B;  3ZJY C;  3J80 c;  1PH8 A;  4K0K Q;  5JJL A;  4GKK Q;  4WJ3 M;  1PVO A;  1AE3 A;  2AKW B;  2IHF A;  1YJ9 A;  5C44 G;  1SMX A;  2A19 A;  4LFC Q;  1IBL Q;  3RLO A;  4C3J H;  4GNX A;  4A3G H;  2K5H A;  5IWA L;  2JE6 I;  1FJG L;  1IBK Q;  1N9W A;  4LUO A;  2IX1 A;  2WB1 G;  4LF4 Q;  1WCM G;  3FP9 A;  3RZD H;  5FLM H;  2K14 A;  3CC7 A;  2MO0 A;  3L7Z C;  4BA1 I;  2NN6 I;  4MZ9 A;  3U50 C;  3W1G A;  4LF8 L;  4QL5 A;  2C35 B;  1B7Y B;  3GTG H;  2E8G A;  5M3F H;  1VQE A;  1K8G A;  1Q1E A;  2K5N A;  4DR3 L;  1OXU A;  1YVC A;  2BH2 A;  2JA7 H;  2VUM H;  1PH7 A;  3CCU A;  2K50 A;  3E0E A;  4R4I A;  4DV1 L;  1E7Z A;  2BA0 A;  2NVT H;  4MTN A;  4OO1 I;  2IY5 B;  4DV4 L;  1X9N A;  1NE3 A;  3IRB A;  4A3F G;  2B63 G;  4A3M H;  4K0K L;  1SR3 A;  5C0X I;  1EIF A;  2QA4 A;  2R7D A;  2NVX H;  4GKK L;  3U4V A;  2WB1 E;  4YWK A;  4HJ8 A;  2ASB A;  2JA5 G;  1BBU A;  4LFC L;  1IBL L;  3AFQ A;  2KHI A;  3KJP A;  4AYB G;  1E1T A;  3CW2 C;  1PV4 A;  1C7Y A;  3CQZ H;  3BU2 A;  1IBK L;  1FGU A;  3KF6 B;  3GTJ H;  1X3E A;  3CCQ A;  3ER0 A;  3PSI A;  4LF4 L;  3K7U C;  5LMN Q;  1FL0 A;  4DK6 C;  3G71 A;  3GTP H;  4JOI A;  4DR4 Q;  1YEZ A;  4R4C A;  1VQP A;  4BBR H;  4OXP A;  5GRO A;  4IPD A;  2VQF Q;  3HOY H;  2ZM6 Q;  3PF5 A;  1EYG A;  3CC2 A;  4OX9 Q;  3K7A H;  2R6G A;  1Y14 B;  4A93 G;  4DKA C;  4HIM A;  4B3T Q;  4A3L H;  1G6P A;  1I3Q H;  5H1S E;  3PO2 G;  1YZ6 A;  2JA6 G;  1Y1W H;  4JI0 Q;  1O7I A;  4DAY B;  5HGQ A;  2WP8 J;  4JCV E;  4P75 A;  2ZJQ A;  1XTD A;  2EXD A;  1XMQ L;  1IL2 A;  5C4J H;  2CFM A;  3MXN B;  4A3B H;  4AYB E;  2R93 G;  5C0X J;  3AEV A;  3PO3 H;  3A74 A;  3PGZ A;  4R1J A;  2PNH A;  3BZC A;  4QJF A;  1E22 A;  1P8L A;  1JJG A;  3CCR A;  5FJ8 H;  2JK8 A;  2WFW A;  2DGY A;  4R4O A;  4A3K G;  2KEN A;  2V1C C;  3NEM A;  4LUV A;  4KLK A;  1EUJ A;  5E7N A;  4A3J G;  2I5H A;  4DR4 L;  4JI2 Q;  1PH3 A;  4B3S Q;  1YBY A;  2N49 A;  5C44 H;  3KF8 B;  4LNQ A;  4B3M Q;  2I5M X;  2ZTD A;  2VQF L;  4JI5 Q;  3TS2 A;  4BBS G;  4QY7 A;  1WFQ A;  2ZM6 L;  4OX9 L;  4MNO A;  4GN3 B;  3K80 C;  3CME A;  4B3T L;  2KBN A;  1WCM H;  5C4X G;  2R7Z G;  3PUX A;  4IOA A;  3I7F A;  4HIK A;  1QVF A;  3DM3 A;  1A0I A;  2D62 A;  3HOV G;  4JI0 L;  5GAE C;  5AJ3 Q;  2GVB A;  3Q8D A;  5IT9 c;  5GAG C;  2LXJ A;  2MQH A;  3CP0 A;  3T1H Q;  4BXX G;  4IFD G;  4A75 A;  1HNW L;  1JJ2 A;  2B3G A;  1LUZ A;  1Q7Y C;  1XPO A;  1QVG A;  1NTG A;  1LM0 A;  4JBM A;  3H3V I;  3I4O A;  5IWA Q;  4GOP B;  1OXT A;  4LF5 Q;  1JJC B;  1Q82 C;  3NBH B;  4A3F H;  2B63 H;  2K75 A;  1E3P A;  3M4Q A;  1HJP A;  4LUZ A;  3G4S A;  4DV6 Q;  4DR2 Q;  4J15 A;  4B3S L;  4LF8 Q;  2NVY H;  1PYB A;  2JA5 H;  4X66 Q;  1W2B A;  1BBW A;  3F1Z A;  4DR1 Q;  4B3M L;  1N32 Q;  4JI5 L;  4P72 A;  3CCS A;  1ASY A;  3W1B A;  2UUB Q;  3JAM c;  3HOZ G;  1NBW A;  1L1O C;  3CPF A;  2L15 A;  2H5X A;  2RHS B;  3I2Z A;  3G6E A;  3J81 c;  3M3Y H;  3F8T A;  1Q81 C;  5IYD G;  5IYB G;  2R92 G;  4LFA Q;  1X6O A;  2KCT A;  2BH8 A;  5GAD C;  3TS0 A;  4R4T A;  1D7Q A;  1JT8 A;  5AJ3 L;  3M85 A;  4JV5 Q;  2ALY B;  1AE2 A;  1G51 A;  3T1H L;  1KXL A;  4JI3 Q;  4YWL A;  1KRT A;  3H15 A;  3TEH B;  2QGQ A;  4A93 H;  1X56 A;  1BKB A;  4L5R C;  2UXD Q;  2ZTE A;  1QUQ B;  3GTM H;  1TWF H;  4PZ6 A;  2CQO A;  3EBE A;  4IPH A;  4C3H H;  5HY6 A;  1VQ8 A;  2A8V A;  5C3E H;  2F4V Q;  1S40 A;  1VQ9 A;  4LF5 L;  2CCZ A;  4IOC A;  1RIP A;  3GTK H;  4RG1 A;  1YNX A;  3H3V H;  2F52 A;  4DV7 Q;  4KI0 A;  4L5S A;  2D0O A;  4IFD I;  2R93 H;  3B6Y A;  3PUW A;  1VQ4 A;  3D0F A;  3L0O A;  4DV0 L;  3LGJ A;  2VQE Q;  4DV6 L;  4DR2 L;  2QEX A;  3BZK A;  2VZA A;  3HFZ B;  4X66 L;  4A3I H;  1NJI C;  4DR1 L;  1PYS B;  1N32 L;  4P74 A;  5IYC G;  4EX5 A;  2UUB L;  3PUV A;  1B70 B;  3KFU A;  1T9H A;  1EQQ A;  4A3K H;  2E2J H;  1I50 H;  2YTY A;  2PQA A;  2WAQ G;  3PUZ A;  2VW9 A;  4A3J H;  1WYD A;  4LFA L;  2I0Q A;  3J81 j;  3J80 i;  1HZA A;  3CPW A;  4DUY Q;  1XMQ Q;  4Y52 H;  5IP7 G;  4JV5 L;  1PFS A;  5ELO A;  4BBS H;  3UDG A;  2OCE A;  1VS0 A;  1XNR L;  4JI3 L;  2ID0 A;  1HZ9 A;  4JI4 Q;  1EOV A;  3RN5 A;  4FDB A;  3TRZ A;  2AHO B;  1E24 A;  5C4X H;  4JOI C;  3I55 A;  2UXD L;  1PA6 A;  1I94 Q;  2YTX A;  4NXN Q;  2IX0 A;  2KHJ A;  4JBK A;  2F4V L;  1MIU A;  3HOV H;  4LFB L;  3E9H A;  5K36 G;  1RL2 A;  4BXX H;  4DV3 Q;  4DV7 L;  1G29 1;  1PH9 A;  4DPG A;  4JI1 Q;  2N8N A;  5M5W H;  1KC8 C;  2VQE L;  4IFD J;  1A62 A;  3CXC A;  4HJ5 A;  1KIX A;  1CKM A;  2Y0S G;  2WAQ E;  5IE8 A;  1GD7 A;  1M90 C;  4O0A A;  3M4O H;  3TRE A;  2N3S A;  1HH2 P;  3U58 A;  1PH4 A;  4JI6 Q;  3S14 H;  1J6Q A;  5FLX c;  1YIT A;  4UP8 A;  1EIY B;  1GKH A;  2BA1 A;  4A3E G;  4DUY L;  5JJI A;  2UUA Q;  2ES2 A;  1U0L A;  4KHP Q;  3SGI A;  2RCN A;  2ZTC A;  1Y1V H;  1PH6 A;  3HOZ H;  1FVI A;  1KQS A;  1HNW Q;  4JI4 L;  1JMC A;  4IJH A;  1N34 Q;  1VQI A;  5IYD H;  3S1Q H;  2R92 H;  4X6A H;  4LF9 Q;  4A3C G;  1I94 L;  1U5K A;  4GLV B;  3KDF B;  4NXN L;  3GD7 A;  3CCJ A;  4DV5 Q;  1XPR A;  1PHJ A;  4EQ5 A;  1UWV A;  2Y0S E;  1K73 C;  4PMW A;  1N36 Q;  3FKI H;  1XPU A;  1XNQ Q;  4DV3 L;  2ATW A;  4JI1 L;  1VQ7 A;  1AH9 A;  3CCM A;  3KF6 A;  1GO3 E;  1IYJ B;  1KHI A;  3PIP A;  1S3O A;  3S1R H;  3UDI A;  1VQF A;  5BR8 Q;  2CWP A;  3I4N G;  1VQL A;  2CWA A;  3JC6 6;  2HIV A;  4B3R Q;  4JC0 A;  1CKN B;  4JI6 L;  4L5Q A;  2K5V A;  1V1Q A;  4A3D G;  4GLX A;  5JEA G;  1PH5 A;  2PI2 E;  1I5F A;  1V9P A;  1VQB A;  3S15 H;  3S17 H;  3S2H H;  2HHH Q;  4OWW B;  4IPC A;  1VQA A;  1VQG A;  1EWI A;  3GTL H;  3I56 A;  2LSS A;  2UUA L;  4UP9 A;  1IZ6 A;  3EIV A;  4UP7 A;  4KHP L;  2JA7 G;  2VUM G;  2Q2U A;  5IYC H;  3KJO A;  3M4P A;  1QZH A;  3GTO H;  2VS1 A;  1N34 L;  3GDE A;  4HIO A;  4NXM L;  3RLN A;  1X55 A;  4LF9 L;  1XMO Q;  4HJ7 A;  3F2C A;  3CCV A;  1MJE A;  4DV5 L;  1OXX K;  1VQJ A;  1WOC A;  1N36 L;  5IP7 H;  1Z47 A;  3NEL A;  4DNI A;  1XNQ L;  3CF5 A;  3PF4 A;  3HKZ G;  1IBM Q;  2NZH A;  5M5Y H;  1S72 A;  4DV0 Q;  3RN2 A;  1X54 A;  1PH1 A;  1L1O B;  4GS3 A;  1HNZ Q;  1CUK A;  1R9T H;  4GLA C;  3F2D A;  5BR8 L;  1E1O A;  4OON A;  3S1N H;  4QQB X;  1KRS A;  3E9I A;  2E2H H;  2IT1 A;  5IY0 A;  4JYA L;  1OXS C;  4B3R L;  4GKJ Q;  3MEF A;  4GNX B;  4BY7 G;  4YCW A;  1Q1B A;  3M9B A;  1N8R C;  3RR5 A;  4YCU A;  3CCL A;  4XTC S;  4OWX B;  1SRU A;  5ELN A;  3ULJ A;  3W5O A;  4OWT B;  2YV5 A;  2HHH L;  2N78 A;  1C9O A;  4UPA A;  4GNX C;  2JQO A;  2OTJ A;  4IJL A;  1YI2 A;  4POG A;  1XNR Q;  2F3I A;  1VQ6 A;  5LMU Q;  2HT1 A;  4JBW A;  2OTL A;  3NEN A;  2D0P A;  4APV A;  2MO1 A;  1YHA A;  1SN8 A;  3HKZ E;  3PO2 H;  1XMO L;  4DR6 Q;  1KL9 A;  2JA6 H;  4LFB Q;  4A3B G;  4NPS A;  1VQM A;  3CAM A;  4HID A;  4HJA A;  4A3E H;  1C0A A;  3S16 H;  1BVS A;  2A1A A;  1LYL A;  2Q2I A;  3K0X A;  4L5T A;  4RMF A;  3UE1 A;  1TXY A;  1VQH A;  4GOP A;  1IBM L;  1EFW A;  3JAM i;  2XGT A;  1HNZ L;  1K83 H;  4X62 Q;  5LMN W;  2ZJR A;  2AWN A;  4A3C H;  1JE5 A;  3J81 i;  5FJ8 G;  1P16 A;  1TWH H;  1NMG A;  2UXC Q;  4DAM A;  4YWM A;  3G48 A;  3S1M H;  1EQR A;  4AQY L;  4GKJ L;  3PCO B;  2Z6K A;  1IXR A;  3U4Z A;  1KAW A;  1K8A C;  3J7Z C;  2VNU D;  1QVC A;  1DGS A;  1SRO A;  5DLQ E;  3S2D H;  1K9M C;  3I4N H;  3STB C;  5IP9 G;  3WWV A;  5LMU L;  3J7A 5;  1ASZ A;  1XJV A;  1X3G A;  1NY4 A;  2R7Z H;  2GN5 A;  4A3D H;  2Z0S A;  2MNA A;  1YJW A;  3KLW A;  4JG2 A;  1VCI A;  4DR6 L;  5JEA J;  1HNX Q;  2PMZ E;  1GM5 A;  1QUQ A;  4A76 A;  3ULP A;  1VQK A;  3H0G G;  1HR0 W;  4TVA B;  2K52 A;  2OWO A;  1UE5 A;  2PI2 A;  1SLJ A;  1UEB A;  5M3M G;  3T1Y L;  2JJQ A;  1B8A A;  1V43 A;  3HOX G;  2JA8 G;  3CD6 A;  1VQC A;  3RZO H;  4X62 L;  2R7F A;  4LW1 A;  1QZG A;  1WJJ A;  3HOU G;  3CCE A;  2ZJP A;  4JI7 Q;  2NZO A;  1OXV A;  4ALP A;  4IO9 A;  3GTQ H;  3M7N A;  2UXC L;  4DV2 Q;  3I4M G;  1YJN A;  1K0R A;  4YCV A;  1TWA H;  1UE7 A;  1WI5 A;  4DR5 Q;  2AMC B;  4POF A;  3CC4 A;  3RLF A;  3BJU A;  4GN4 B;  3HKS A;  2MFI A;  4XIG S;  4DK3 C;  4BY1 G;  2IHE A;  2OQ0 A;  4QGU A;  3PV0 A;  3CMA A;  2E2I H;  2GVA A;  4X65 Q;  3HOW G;  4AH6 A;  1TWC H;  4BY7 H;  3PUY A;  4NXM Q;  4QIW E;  2JA9 A;  2HQL A;  2YTV A;  4GN5 A;  5IYB H;  4X64 Q;  3A5U A;  4BA2 I;  2UXB Q;  1K3R A;  3S24 A;  2HIX A;  3EN2 A;  3OTO Q;  3A0J A;  4PG3 A;  2E5L Q;  2YU9 H;  4O2D A;  3VDY A;  1Z9F A;  1Q46 A;  1L0W A;  1MJC A;  4TQU S;  4AIM A;  1J5E Q;  2RF4 A;  5C3E G;  3F2B A;  1TWG H;  4A3G G;  4R4Q A;  1JB7 A;  3A5Z B;  3RNU A;  4JBJ A;  1X65 A;  1Q86 C;  4JI7 L;  2VL6 A;  4YHH Q;  4JYA Q;  5FLM G;  1CSQ A;  4P73 A;  4DV2 L;  1VQD A;  1M1K C;  1I6H H;  1CKO A;  4UY8 C;  4A3I G;  1X3F A;  2JEB I;  4DR5 L;  1N33 Q;  1HR0 Q;  5M3F G;  4P71 A;  2UUC Q;  2I5L X;  5EAY A;  3AQQ A;  4DR7 Q;  3FHW A;  3AYH B;  1YHQ A;  1SFO H;  3PIO A;  2KCM A;  4YY3 Q;  5LMN L;  2LXK A;  4X65 L;  4LF7 Q;  5J3B A;  2UU9 Q;  4X64 L;  2UXB L;  1MKH A;  1UE6 A;  4A3M G;  3OYY A;  3OTO L;  4JI8 Q;  2E5L L;  4LWC A;  4A4I A;  4DUZ Q;  3ULL A;  5IP9 H;  1VQ5 A;  2XTI A;  3KDF A;  1A63 A;  2Q2T A;  2NVQ H;  1UE1 A;  2VY3 A;  4LF6 Q;  1J5E L;  3D31 A;  4NB3 A;  3GO5 A;  2JEA I;  1YHB A;  3UDF A;  5GAH C;  1VQN A;  1NMF A;  4YHH L;  4AQY Q;  3KYH C;  1OTC A;  3H0G H;  4IPG A;  1YIJ A;  2NN6 G;  2AWO A;  4H02 A;  2FXQ A;  4Y7N H;  2EQS A;  4KHZ A;  4BBR G;  4PZ7 A;  4C2M H;  3STB D;  3K81 C;  5M3M H;  5M5X H;  1CKN A;  3HOX H;  3DLL A;  1HR0 L;  1N33 L;  2JA8 H;  3HOY G;  1FJG Q;  2UUC L;  1CSP A; 
#chains in the Genus database with same CATH topology
 3HOU H;  4DR7 L;  4RNM A;  4A3L G;  4B9X A;  1SFO A;  1SND A;  4HTH A;  3EVQ A;  4QW8 A;  3GQC A;  4N9T A;  1L2F A;  4LF7 L;  1ILQ A;  4GOP C;  4N8F A;  4JI2 L;  3L2P A;  3UE0 A;  4OO1 G;  1KDA A;  2XC9 A;  4J9R A;  1FR3 A;  1I94 H;  4NXN H;  5KFU A;  1U4M A;  4J9O A;  1B50 A;  2NU7 B;  2I8C A;  1B3A A;  4DV3 H;  3R5H A;  2L9H A;  3ICE A;  4DR4 H;  1HZC A;  1QJO A;  5F2D A;  4LF6 L;  3T16 A;  2FPG B;  1KD1 C;  3SDZ A;  1AZQ A;  2KHS A;  4A93 B;  3U9T A;  4FYD A;  1WTV A;  2B8G A;  2L1B A;  4PV1 C;  1PH8 A;  1JQY D;  2HVR A;  3KHH A;  3BAA A;  3GTK B;  1YJ9 A;  2J6U A;  3L4K A;  2R8G A;  5EZY F;  4GNX A;  4RB1 A;  1SEI A;  3GIK A;  1DV1 A;  1LAC A;  2F0V A;  2L5T A;  1FJG L;  3SE7 A;  1KBL A;  1AFP A;  4J9P A;  2Z4H A;  2WB1 G;  4XDX A;  4LF4 Q;  1WCM G;  3FP9 A;  4O2B F;  4ECQ A;  4BA1 I;  2NN6 I;  1K3B C;  1RCV D;  4EGJ A;  3U50 C;  3W1G A;  5JEA H;  4LF8 L;  1NUC A;  5BPH A;  4KN7 C;  3RB6 A;  4PMC A;  1H9K A;  2VOB A;  4O4I F;  2B2U C;  2V58 A;  1Q1E A;  2K5N A;  3D6W A;  5KFL A;  4FBU A;  2JA7 H;  1KDB A;  3N6X A;  5L9X A;  3MXG A;  1JDE A;  2K04 A;  4WJW A;  5KFR A;  5KFB A;  4BBS B;  1A3V A;  5ELC A;  2NVT H;  4OO1 I;  3K5N A;  1RJR A;  3J7Y W;  1X9N A;  3IRB A;  2B63 G;  2C2E A;  5CV6 A;  2VB3 X;  2WB1 E;  4YWK A;  2R85 A;  5DLF A;  1RF2 D;  3AFQ A;  2X0S A;  1E1T A;  5IYZ F;  1FGU A;  1I4Q A;  1X3E A;  3ER0 A;  3MFI A;  4LF4 L;  3K7U C;  4QF4 A;  4DK6 C;  1V1P B;  3TIN A;  4JOI A;  4DR4 Q;  1VQP A;  2W6N A;  1GJX A;  1NNX A;  4BBR H;  3SXH A;  5GRO A;  5COR A;  4LF5 H;  2CH4 W;  1H9M A;  4A93 G;  5KFF A;  4DKA C;  3GV8 B;  5EPJ A;  5E1F A;  4IR9 A;  5H1S E;  4DV0 H;  3EYY A;  1DZ1 A;  2EY5 A;  5CMD A;  1HFN A;  4FF2 A;  4DR2 H;  4XQN A;  2WP8 J;  2W9A A;  2QK4 A;  2ZJQ A;  2EXD A;  5KFP A;  3OWE B;  3C3L A;  2LMC B;  2IJ0 A;  2IP4 A;  2F0S A;  1BDO A;  4O42 A;  5C0X J;  2W8L A;  2D2C C;  3AEV A;  3PO3 H;  2PNH A;  2R87 A;  1ESF A;  3V6H A;  3E5S A;  2DN8 A;  2WFW A;  3I8Z A;  2VPQ A;  3QG1 A;  3BQ2 A;  4DR4 L;  1K8O A;  2W9B A;  1B6R A;  2DJF C;  1STG A;  3GIJ A;  1CK1 A;  2CH4 A;  4ETS A;  3KF8 B;  1WTW A;  3VR3 A;  4BBS G;  3S2H B;  4MNO A;  3QWN A;  3K80 C;  2CW7 A;  1SNQ A;  3PUX A;  4IOA A;  4U68 A;  2NUC A;  4KMU C;  1A0I A;  2D62 A;  1N48 A;  3GTO B;  5IT9 c;  4BXX G;  5GAG C;  1I7L A;  4MV9 A;  2UXC H;  1B04 A;  1PTO H;  3OMC A;  2QIL A;  4DGZ A;  4NDX A;  2K32 A;  2VR1 A;  1NTG A;  5EOY A;  4JBM A;  2B2V C;  4GOP B;  4LF5 Q;  3MHB A;  1JJC B;  2K75 A;  1E3P A;  3M4Q A;  1BCP F;  2B2T C;  1KNA A;  2YZM A;  4DK0 A;  1RK6 A;  5E4X A;  4DXG A;  4DR2 Q;  3C2P A;  4FS2 A;  1YNJ D;  1ZHQ A;  1H9S B;  3HRZ C;  1NBW A;  3CPF A;  2PZU A;  2L15 A;  3V6J A;  4HAE A;  2OF1 A;  1EEF D;  5KG0 A;  5GAD C;  3IAY A;  1CHP D;  1RDP D;  1AUX A;  5L1K A;  3M85 A;  3OOC A;  2QEJ C;  1BNZ A;  1G51 A;  1KXL A;  2BQU A;  5I9P A;  3Q24 A;  1KRT A;  3H15 A;  3TEH B;  2JA6 B;  2I87 A;  1X56 A;  4YJ2 F;  1A9X A;  2WAC A;  2ZTE A;  3GTM H;  2W9C B;  1TWF H;  2DJG C;  2CQO A;  3EBE A;  2DY8 A;  1W96 A;  3LWB A;  3KK7 A;  4RFB A;  2X6G A;  1LV9 A;  4ZAI A;  3H3V H;  4LF5 L;  2CCZ A;  4MA0 A;  1RIP A;  4R7R A;  3P75 A;  1YNX A;  5KFH A;  4J9S A;  4F4Z A;  4KHP H;  5JVH 3;  1K83 B;  1FNW A;  1BF4 A;  2R93 H;  3FPU B;  3KLR A;  1HTP A;  4QUF A;  5KFA A;  3RD4 A;  4DV0 L;  4GZY C;  2HVQ A;  1UEA B;  2X6L A;  4DR2 L;  4NXM H;  1O80 A;  2VZA A;  2F1M A;  4A3I H;  4YQW A;  2HQE A;  1S0M A;  1PYS B;  4DL5 A;  4AYB A;  4P74 A;  4EX5 A;  3I4L A;  3C1E A;  2E5L H;  2FMA A;  4WFN 3;  1HQR D;  3MXU A;  1YNJ C;  2E2J H;  4KHV A;  4F88 A;  2YTY A;  1B44 D;  5JJZ A;  1STY A;  2I0Q A;  3J80 i;  2OH2 A;  2FMC A;  2L12 A;  1ET6 A;  2OCE A;  5EBC A;  4I50 F;  3GTG B;  5BPF A;  4JYA H;  2LS0 1;  1IW7 D;  1HZ9 A;  4HR7 B;  2PQE A;  1W93 A;  5C4X H;  3GTM A;  2PW7 A;  1ZHS A;  1DXM A;  1TWF A;  4HQ6 A;  1A3U A;  3HOV H;  4M8A A;  4XYO A;  4Q8F A;  1K8M A;  4DAP A;  5IOD A;  5ELE A;  4XT1 B;  1G29 1;  2R93 A;  3Q8Q B;  2F0U A;  4U67 3;  3OIQ A;  1M0T A;  4IFD J;  1S9F A;  2PO4 A;  4HJ5 A;  2PPB C;  1KIX A;  4UFZ A;  5IGD A;  1XTC D;  1FNU A;  3Q1K A;  2NBF A;  4XYL B;  1HH2 P;  3S14 H;  1J6Q A;  2QCP X;  5IT9 W;  2EXZ A;  1ONL A;  5DLG A;  2EYL A;  4UP8 A;  5H80 A;  1KEE A;  1EWH A;  3T5L A;  2E2I B;  4JUZ A;  3TQ1 A;  3K58 A;  5J2U F;  4KHP Q;  2RCN A;  1D5X C;  1KQS A;  1HNW Q;  4AQY H;  5C0X H;  2EYM A;  3PR5 B;  1JMC A;  3FRP B;  3S1Q H;  2R92 H;  3K7A B;  4A3C G;  1JIH A;  4DV5 Q;  3GD7 A;  3R8B A;  1PXU A;  5JOB A;  4IWX A;  4EFE A;  1UWV A;  3FKI H;  1E2W A;  4LAA A;  1EFI D;  3RAQ A;  3KF6 A;  4DK1 A;  1GO3 E;  2RCF A;  1KHI A;  2EYF A;  3UDI A;  4Q43 A;  3JZI A;  4KJO A;  1VQL A;  1I6H B;  5KG5 A;  1GUW A;  1CKN B;  2FIN B;  3TP8 A;  4GLX A;  1PH5 A;  2WKC A;  1VQB A;  3MA2 B;  4IPC A;  3T51 B;  1VQG A;  5FLX E;  4DV1 H;  4X62 H;  4F4Y A;  2F0I A;  2F0M A;  1IZ6 A;  4KHP L;  5IYC H;  1SDF A;  3DMU A;  4GKK H;  2VS1 A;  5NUC A;  4MAM A;  4NXM L;  3MXN A;  2R92 A;  4ZI7 F;  4HJ7 A;  5DNF A;  3F2C A;  4DV5 L;  3MZ5 A;  1CTM A;  3NEL A;  3NP8 A;  3EJI A;  4ECZ A;  2QW7 A;  4ZQI A;  1R9T H;  4MV8 A;  1CT1 D;  4A2A A;  3S1N H;  1Z2P X;  1EY4 A;  3E9I A;  2E2H H;  5IY0 A;  4JYA L;  1BBX C;  1CI3 M;  2EE1 A;  2AGO A;  2JA8 B;  1N8R C;  4IUQ A;  4YCU A;  3CCL A;  3A8I E;  4XTC S;  3P7J A;  5EGT A;  2N88 A;  4CJ0 B;  5KNC A;  4UPA A;  3I4M B;  1JOK A;  2BE5 D;  2F3I A;  3IG0 A;  4JBW A;  2IWH A;  2OTL A;  4IHJ F;  2D0P A;  5LOV F;  5FD6 A;  1RK5 A;  3PO2 H;  4X3T A;  3U9S A;  4CKE A;  5IT9 L;  1VQM A;  4HJA A;  4C3I B;  1TKW B;  2KEE A;  3S16 H;  3KUP A;  2F0N A;  5KYL A;  3V4Z A;  4IUR A;  1R9T A;  4X62 Q;  4X64 H;  2AWN A;  4LSX A;  1P16 A;  2SNM A;  1TS3 A;  2E2H A;  4YWM A;  4ABN A;  1HFG A;  4AQY L;  4XQQ A;  3PCO B;  1ULZ A;  2KA7 A;  3N52 A;  3N44 B;  4HCE A;  1DGS A;  2W57 A;  5DLQ E;  1AN8 A;  4BWS C;  4ED8 A;  4JI0 H;  3I4N H;  1HUM A;  5JH7 F;  3EPI A;  5DQI A;  5KFV A;  5JPM C;  2B2W A;  1PYW D;  5C1O A;  3DEO A;  5C3W A;  1ASZ A;  5M3F B;  2MJ8 A;  4RNN A;  2MNA A;  1YJW A;  3KLW A;  4LK1 C;  1VCI A;  1JKJ B;  1N33 H;  1EZ6 A;  1QUQ A;  4ZKC B;  4G3I A;  1VQK A;  4YIJ A;  1HNX H;  1UEB A;  1V43 A;  4M9U A;  1ZEQ X;  4A3M B;  2JA8 G;  3CD6 A;  1EY8 A;  4X62 L;  2RKS A;  4LW1 A;  5C8Y F;  1CS0 A;  3M7N A;  2DPI A;  4JI8 H;  1BCP D;  4DV2 Q;  3I4M G;  1YJN A;  4YCV A;  2M05 A;  1TWA H;  1I6V C;  3L9A X;  3GTJ B;  5I6W A;  2KJX A;  4Q45 A;  2AMC B;  4GN4 B;  3HKS A;  2MFI A;  5KFW A;  3OSO A;  5KGU A;  3T1H H;  3PV0 A;  3CMA A;  4AH6 A;  2UVR A;  4C3I G;  1DOM A;  3HOY B;  4I7Z C;  3RUZ A;  2JA9 A;  1K1S A;  1AEX A;  4X64 Q;  4BA2 I;  2UXB Q;  5BMV F;  3R2I A;  3T53 B;  4ZK9 B;  5IWA H;  5KYI A;  2YU9 H;  3VA7 A;  3VDY A;  1Z9F A;  1Q46 A;  1MJC A;  3IL8 A;  3MC0 B;  4OEM B;  2ASJ A;  1FNV A;  5C3E G;  1DV2 A;  1TWG H;  2B2Y A;  2ZXP A;  3J81 W;  5KRU A;  1N32 H;  5D3I B;  4FS1 A;  1CZW A;  1PLF A;  1S0O A;  4DV2 L;  5JVL A;  4DR3 H;  1HA6 A;  2NVX A;  3TZU A;  2DZD A;  4ZKB B;  3HKZ A;  3M9N B;  1TWA A;  1AUV A;  2AQ2 B;  2WII B;  1X3F A;  1N33 Q;  5M3F G;  4CGY B;  4DL7 A;  2MP1 A;  3R3O A;  4XYQ A;  1EIG A;  4I4T F;  2KCM A;  2C22 A;  1M8A A;  4X64 L;  2UXB L;  4RZR A;  2K28 A;  1DJR D;  4A3M G;  2PW5 A;  1JOQ A;  4JI8 Q;  2YU9 A;  2EVB A;  1EEI D;  3NXW A;  1KJI A;  3ULL A;  3S9W A;  1VQ5 A;  1LTB D;  2V4D A;  2XTI A;  4DV7 H;  3CRK C;  2NVQ H;  4KD4 A;  1U4L A;  4YR0 A;  3D31 A;  4KD3 A;  1TWG A;  1IYU A;  2WDT A;  3UDF A;  2A74 C;  4EGV A;  5K36 H;  3GID A;  4IPG A;  1F77 A;  1STH A;  3RB0 A;  2AWO A;  4PZ7 A;  5M3M H;  4ZUI A;  3K81 C;  5M5X H;  3K5M A;  3DLL A;  1N33 L;  3HOY G;  3KHL A;  2PMZ A;  4J9N A;  2N55 A;  1CSP A;  4DUY H;  2P0A A;  1EY7 A;  1D1K A;  1XMQ H;  1XXG A;  1H95 A;  2NVY B;  1W6J A;  3KOJ A;  1JE4 A;  1HNX L;  2JA5 B;  1PK8 A;  5KX5 F;  5EWE A;  1SE3 A;  3J7A K;  2DUD A;  1LT3 D;  3SHL A;  3ORQ A;  5E3F A;  2NTS A;  1Y1V G;  2PYK A;  4JI8 L;  4PZ8 A;  4DR3 Q;  1PH2 A;  4BY1 H;  4G7O C;  2Z6K C;  1T5X D;  3A55 A;  3SVM A;  2OQK A;  4WJ4 A;  2VQD A;  3RBE A;  2VQF H;  3OW2 A;  1L1O A;  1W3S A;  2ZM6 H;  1HA5 A;  3ZJY C;  4OX9 H;  4C3H B;  3KHG A;  1AE3 A;  2AKW B;  5E4W C;  4IRC A;  1S4Z A;  1SMX A;  4C3J H;  3EPG A;  2K5H A;  4XT3 B;  5IWA L;  3MFG A;  1IBK Q;  1N9W A;  3JAM L;  4DAV A;  4JPB W;  4JK1 C;  1KJ9 A;  3J81 L;  5KG3 A;  4HMI A;  2WKD A;  2IMW P;  2UVW A;  4QL5 A;  4H13 C;  5KT4 A;  2E8G A;  5A2Q L;  1GUS A;  4A3K B;  1I50 B;  3P1H A;  1WR2 A;  4DR3 L;  1ICW A;  1OXU A;  3D4W A;  2VUM H;  3S2D B;  3CCU A;  1KDC A;  1G6Z A;  1C30 A;  5KFE A;  5KG2 A;  3BDO A;  3OHA A;  2YRW A;  3F8N A;  4EQO A;  2R7Z B;  2QA4 A;  2R7D A;  2CW0 C;  4KTA A;  4C56 C;  4RNO A;  2B8F A;  2JA5 G;  1BBU A;  2CQY A;  4O4L F;  5EWF A;  4ZHQ F;  1C7Y A;  1PV4 A;  4DA2 A;  2RDI A;  3CQZ H;  5L1J A;  1IBK L;  4K8J A;  4KKT A;  3CCQ A;  3PSI A;  4EYH B;  1KAA A;  1O7Z A;  2ZXR A;  1V51 A;  1Y8P B;  1SNO A;  5A35 A;  1YEZ A;  4R4C A;  4QUC A;  3M4O B;  3VMM A;  1E4E B;  2VQF Q;  4UCV A;  2ASL A;  2ZM6 Q;  3PF5 A;  1S5E D;  4OX9 Q;  3GII A;  1Y14 B;  2IX3 A;  3DWP A;  4HIM A;  4A3L H;  3MR6 A;  4CHT B;  4IAL A;  1YZ6 A;  4C3H G;  5DGB A;  5FPR A;  4DAY B;  4JCV E;  4G7Z C;  4P75 A;  5IGC A;  1XTD A;  1XMQ L;  1IL2 A;  4OO1 H;  4A3B H;  2LFN A;  3ND8 A;  3G7L A;  4FO2 A;  3VPC A;  5TSS A;  1T94 A;  1GUT A;  3DHQ A;  4R1J A;  4LFA H;  1SNM A;  3BZC A;  4MIU A;  3CQZ A;  4MV7 A;  1JOO A;  3MFY A;  5ELB A;  2JK8 A;  5M5Y B;  4A3K G;  1XNR H;  1VF5 C;  1VBG A;  4EBD A;  1EUJ A;  4JI2 Q;  2N49 A;  4R8U A;  4LNQ A;  4B3M Q;  1G91 A;  2I5M X;  2VQF L;  1WFQ A;  2ZM6 L;  3S17 B;  4LSA A;  1VMC A;  4OX9 L;  1C3O A;  2CHB D;  1WCM H;  2EYP A;  4QMG A;  3GTL B;  2R7Z G;  1KAB A;  4IUN A;  2GPW A;  4HIK A;  1ZET A;  4WOR A;  2W71 A;  1BOS A;  1MGS A;  1SNP A;  2F0D A;  3BG5 A;  5FO8 B;  3V05 A;  2LXJ A;  3CP0 A;  2KCC A;  3G8C A;  3PQI A;  4A75 A;  2B3G A;  3BS1 A;  1Q7Y C;  2XIG A;  1VDZ A;  1TS2 A;  1NSN S;  2E76 C;  4ZOL F;  1Q82 C;  2B63 H;  3RB3 A;  3DUZ A;  3LNN A;  4CC6 A;  2J4X A;  3LP8 A;  3M4I A;  3F2U A;  4LF8 Q;  4X66 Q;  5KFI A;  1JC7 A;  1CZG A;  4B3M L;  4RCO A;  1TA8 A;  3BVM A;  4FF3 A;  2WYO A;  4P72 A;  3X3M A;  4HNU A;  4FP5 D;  1RKN A;  3I2Z A;  2H5X A;  4RGM A;  3G6E A;  3SI8 A;  2WB1 A;  3PW5 A;  3F8T A;  1WCM A;  2O03 A;  4MTD A;  4B08 A;  5IYB G;  4LFA Q;  2KCT A;  3TS0 A;  1IYV A;  4R4T A;  4CBV A;  1D7Q A;  1F9P A;  1EYC A;  4OGQ C;  4CDD C;  1Y69 U;  2FKL A;  3OW7 A;  1PZJ D;  4X3U A;  4RUC A;  5DG9 A;  5IGG A;  4A93 H;  2YS7 A;  2ZT9 C;  4L5R C;  2AQ1 B;  2H1E A;  4A3E B;  2K01 A;  2A8V A;  2VUG A;  4UCU A;  1LAB A;  4KY5 A;  1S40 A;  3GTK H;  4KV6 A;  2AQ4 A;  4XX0 B;  2B63 A;  4L5S A;  2D0O A;  2MCT A;  1JB3 A;  2OT2 A;  2DPJ A;  3FEW X;  3PUW A;  1VQ4 A;  1N34 H;  3MJF A;  3BZK A;  3MR2 A;  2W7O A;  3E0J A;  4X66 L;  4LF9 H;  2R61 A;  1B2T A;  2AGQ A;  4CC5 A;  2ZJT A;  1B33 N;  2C00 A;  2RBM A;  3PUV A;  5CA1 F;  3HEJ A;  1T9H A;  5KFN A;  4TQR A;  2J6T A;  2R86 A;  4LFA L;  1U9R A;  1HRJ A;  4Y52 H;  5IP7 G;  4BBS H;  3MFH A;  1B9N A;  3UDG A;  1XNR L;  4A3D B;  2ID0 A;  3RN5 A;  4FDB A;  2AUJ D;  1I94 Q;  3SK4 A;  4TSS A;  1IHZ A;  3H94 A;  4NXN Q;  2IX0 A;  3ND9 A;  2JA7 B;  2L4N A;  1MIU A;  2NWG A;  5CV9 A;  5C5J A;  3GTK A;  3E9H A;  1WTQ A;  2F0G A;  4BXX H;  5C5M A;  4DV3 Q;  4FVM A;  4DPG A;  1SYX B;  3GTQ B;  4FNF A;  2RGV A;  2UU9 H;  4UCR A;  3UI2 A;  1XMO H;  1GD7 A;  1M90 C;  5D3D A;  1Q3L A;  1BXT A;  4RH6 A;  3TRE A;  1WTR A;  4ED7 A;  2N3S A;  1LTT D;  4ECY A;  2XSC A;  5FLX c;  3D8G A;  2V4Q A;  1DOK A;  2WIN B;  4A3E G;  5JJI A;  3QJY A;  1ICF B;  2F0P A;  3SGI A;  4TV9 F;  3Q8R B;  2ZTC A;  4KJN A;  3RBD A;  2JEG A;  1FVI A;  2FP4 B;  2DWC A;  1N34 Q;  4LF9 Q;  3CU7 A;  1I94 L;  3PR4 A;  3KDF B;  4NXN L;  4KKS A;  1K73 C;  4G4K A;  3R2T A;  4DV3 L;  2A6E C;  2ATW A;  1AH9 A;  2YL2 A;  3CCM A;  2W6O A;  1F9S A;  1S3O A;  1WTX A;  1V1P A;  1EU4 A;  2CWP A;  5KT3 A;  3NWS A;  4DR6 H;  3JC6 6;  1SYG A;  2RDJ A;  4F4W A;  4JW0 A;  4MV1 A;  4L5Q A;  2K5V A;  3GIM A;  1V1Q A;  1Y8O B;  4X3K A;  5JEA G;  4A3D G;  2PI2 E;  3S15 H;  3S2H H;  3T1Y H;  4TQS A;  2XRS D;  1EY6 A;  3I56 A;  2LSS A;  4PWQ A;  4UP9 A;  3EIV A;  1ROD A;  3FPP A;  2JA7 G;  2HGS A;  3RIZ A;  3KJO A;  3M4P A;  4ECU A;  3GTO H;  2G9H D;  4J9M A;  2XNA C;  1N34 L;  3RLN A;  1X55 A;  4DL3 A;  4LF9 L;  1XMO Q;  4LFC H;  3CCV A;  5DG7 A;  5LYJ F;  5JQW A;  3NPP A;  1DCZ A;  1Z47 A;  1JOR A;  3CF5 A;  2XRQ D;  2NZH A;  1ZYR D;  4ZUJ A;  4DV0 Q;  4HYK A;  1RTO A;  1PH1 A;  1K0S A;  5HBR B;  3PVX A;  5DEH A;  4ED1 A;  4Y8V B;  1E1O A;  4OON A;  3H0G B;  3RV3 A;  4QIW B;  4YAK B;  5EKL A;  5EWG A;  2NU8 B;  3OIP A;  4C2M B;  3V4S A;  3KF8 A;  3MEF A;  2R7N A;  1Q1B A;  1JXL A;  1I7N A;  3L4J A;  3BYY B;  3RR5 A;  4Q0Y A;  3RJ0 A;  1SE4 A;  4OWX B;  5DM6 3;  3SK5 A;  2O5J C;  3CRL C;  2YV5 A;  1JWU D;  3VR4 A;  5KFQ A;  4IJL A;  4EGQ A;  3G6V A;  1VQ6 A;  3GTO A;  1KJQ A;  3NEN A;  2W7P A;  1YHA A;  4FF1 A;  1FKA H;  1XMO L;  4DR6 Q;  2JA6 H;  1F2M A;  2PBZ A;  3KAL A;  3URY A;  1EIH A;  1I6U A;  1UUP A;  3HOW B;  4HNT A;  1LYL A;  4GOP A;  5LMN H;  4CKB A;  1BXR A;  1BJT A;  3JAM i;  2W70 A;  3OPO A;  1K83 H;  1EOT A;  5LMN W;  1I4P A;  1ZYR C;  4A3C H;  1JE5 A;  5J22 A;  3J81 i;  2HCC A;  3OMG A;  2J9G A;  2YZG A;  5FKA C;  1NMG A;  2UXC Q;  5FLX W;  2EY6 A;  3S1M H;  1IXR A;  3U4Z A;  1KAW A;  3WDN A;  4A3G B;  2VNU D;  4B3T H;  3TP5 A;  1H9S A;  1QVC A;  5CC4 A;  1C48 A;  2EZV A;  1SRO A;  2F0W A;  1J5E H;  5ELD A;  3RZD B;  2D9U A;  2NTT A;  5EKK A;  2FHT A;  3STB C;  5IP9 G;  4N8X 1;  4A3I B;  4DL2 A;  1EY5 A;  1LT4 D;  1MD2 D;  5I2X A;  1F9R A;  1X3G A;  2W6M A;  3C46 A;  3MR5 A;  4DR6 L;  2JA6 A;  1D6E C;  3QZ7 A;  1HR0 H;  5JPN C;  1BGW A;  5KEE A;  3DXJ C;  2W9C A;  4A76 A;  3ULP A;  2PVP A;  3H0G G;  5D14 A;  2Z4I A;  4TVA B;  1HR0 W;  4YY3 H;  1F2L A;  3T1Y L;  5KT2 A;  1B8A A;  1K83 A;  3MWD A;  2B2U A;  5JAV A;  1QZG A;  3ETJ A;  1Q90 A;  2ZJP A;  2NZO A;  2UXC L;  2TSS A;  2NU9 B;  4M7E A;  1M4V A;  1K0R A;  2ASD A;  4G57 A;  4IZ8 A;  1GLV A;  2X69 A;  5C3X A;  3BDL A;  1I4R A;  1DON A;  3GTP B;  2H4O A;  4DK3 C;  1BUV T;  3GV6 A;  2E2I H;  2GVA A;  3HOW G;  5J2T F;  1SEB D;  4NXM Q;  1STN A;  4QIW E;  3A5U A;  4GN5 A;  3GTG A;  4XZ3 B;  4RAZ A;  1K3R A;  4HR7 A;  2HIX A;  3EN2 A;  1I3Q B;  2E5L Q;  1L2Z A;  2QF7 A;  4IUV A;  3MWY W;  1S03 G;  1Y1W B;  1ZXT A;  1V4Y A;  3E6Z X;  1L0W A;  4ZRZ A;  4ECX A;  1RJQ A;  5C4J B;  1J5E Q;  4A3G G;  3QB3 A;  4HED A;  4R4Q A;  1JB7 A;  1PDQ A;  1JDB B;  2O2L D;  2WTF A;  1GYF A;  4JYA Q;  5FLM G;  4P73 A;  1F2Y A;  1TS5 A;  5CV8 A;  1VMP A;  1G2T A;  1I6H H;  1SNC A;  4RAU C;  4A3I G;  5I4D A;  3FKI B;  3IFT A;  1HR0 Q;  3JRW A;  4F50 A;  4P71 A;  5IIF A;  4L6T B;  1D5M C;  5EAY A;  2O4X A;  4DV4 H;  4G7H C;  2W8K A;  3AYH B;  1YHQ A;  4YY3 Q;  5C44 B;  5LMN L;  4K0K H;  2E2I A;  1EY9 A;  2EY2 A;  2LXK A;  2F0E A;  2MHV A;  4ODG A;  3H20 A;  5F9N A;  1A2U A;  3I3C A;  3OSN A;  1LTS D;  1UE6 A;  3OYY A;  2E5L L;  1CQF A;  4A4I A;  3GV7 B;  1ZKO A;  2K05 A;  2A6H D;  2HD3 A;  4TUY F;  2Z8L A;  4O3P A;  1J5E L;  1E2V A;  3GO5 A;  2JN4 A;  4Q8E A;  2JXM B;  2F03 A;  1VQN A;  1NMF A;  1S10 A;  1JX4 A;  4AQY Q;  3KYH C;  1HCZ A;  1K1Q A;  2I46 A;  2R84 A;  4FXD A;  4H02 A;  2MPM A;  3PF4 A;  2TMP A;  1JIC A;  1CKN A;  2M2L A;  4A3F B;  4E6I A;  1AZP A;  1HR0 L;  2JA8 H;  3GIL A;  3UQ8 A;  4J9L A;  3K8A A;  3ORR A;  4MTE A;  1VKZ A;  2BR0 A;  4YY3 L;  3GIP A;  5FK9 C;  5D8D A;  1EWC A;  3N6R A;  3I4M H;  3S1N B;  1Y1W G;  3T5H A;  2B2V A;  1DOL A;  2JEF A;  1SE8 A;  2B29 A;  3M3Y B;  3DF7 A;  5DG8 A;  1Q8K A;  2PQA B;  1EUC B;  3WO1 A;  3G6J B;  2BOS A;  5C0X G;  1VF7 A;  3TN2 A;  1A8V A;  2B2T A;  4YBZ B;  4EQP A;  4PQX A;  2XD4 A;  3AFP A;  2EDG A;  3BA8 A;  4JV0 A;  1D5Z C;  4C3I H;  4FF4 A;  4DV1 Q;  5D1O B;  2A6H C;  2O5I C;  4DV4 Q;  3FKI G;  2ENB A;  3DWA A;  1IKM A;  1G2S A;  2EIF A;  2YYZ A;  4K0K Q;  3J80 c;  2CKZ B;  1QE6 A;  1SJH D;  5JJL A;  1CQI B;  4QWE A;  4GKK Q;  5C3E B;  4WJ3 M;  2E74 C;  3EFX D;  4JI6 H;  1Y8N B;  2FLN A;  5C44 G;  2A19 A;  1X3P A;  2NU6 B;  3ETH A;  4LUO A;  5LA6 F;  2WV6 D;  2IX1 A;  4U7C A;  2UUA H;  1C4Q A;  1DD2 A;  4L63 B;  1PTO F;  3Q22 A;  2EJF C;  3LX0 A;  3CC7 A;  5EDW A;  2MO0 A;  4NW2 A;  3L7Z C;  4MZ9 A;  3VPB A;  2C35 B;  3QOJ A;  4UAI A;  2IW3 A;  3W2D A;  2C2D A;  5M3F H;  1PFM A;  4UCO A;  3A8K E;  4A3J B;  3N42 B;  2Q8I B;  1YVC A;  4X3S A;  1PH7 A;  1QB5 D;  4UCS A;  1CHQ D;  5I2Y A;  4DV1 L;  2BA0 A;  4WBN F;  4DV4 L;  5T1I A;  2A69 D;  3H6M A;  1NE3 A;  4A3F G;  3GP7 A;  4C5B A;  4A3M H;  2K5D A;  4K0K L;  5C0X I;  1EIF A;  5GON F;  3H91 A;  2NVX H;  4GKK L;  2MUY A;  2ASB A;  4HJ8 A;  4QB4 A;  4O3R A;  4MV6 A;  5KFZ A;  3KJP A;  4FXK C;  2C28 A;  2BQ3 A;  3GTJ H;  5M5W B;  2F0F A;  2RQX A;  2Q8R E;  3N43 B;  1FL0 A;  3G71 A;  5FD5 A;  3K5O A;  1TII D;  4OXP A;  4IPD A;  3H4D A;  3HOY H;  3Q6S A;  5CBE E;  1EYG A;  1B53 A;  3CC2 A;  2R7M A;  2RSO A;  1RD9 D;  4M1U B;  1SYE A;  3PO2 G;  1WSC A;  1WTH A;  2DLN A;  1W6K A;  4DV6 H;  1Y1V B;  4JI0 Q;  4ZYS A;  3HOZ B;  4RAY A;  5KFG A;  4DLK A;  4DR1 H;  3M9O B;  3K59 A;  2UUB H;  4GKJ H;  2A69 C;  5JUM A;  5KFC A;  2KUM A;  4DL6 A;  5L1I A;  2R7K A;  4QJF A;  3K3V A;  1RJP A;  1JJG A;  3V6K A;  4RGN A;  1JLL B;  3CCR A;  5JVD F;  4RU9 A;  3GTJ A;  5FJ8 H;  1I4G A;  5FOB B;  4IRK A;  4R4O A;  1HNX Q;  2V1C C;  3S1R B;  3NEM A;  4LUV A;  1SXT A;  4KLK A;  4A3J G;  3R5X A;  5LMU H;  1IOV A;  1PH3 A;  3PW4 A;  2UXD H;  1CA5 A;  1T5E A;  2ZTD A;  3TS2 A;  5KFX A;  4QY7 A;  4LFB H;  1KLG D;  2XWJ B;  3CME A;  3C0F B;  4WD3 A;  3LML A;  4ILW A;  3I7F A;  1QVF A;  3DM3 A;  4J1M A;  2VQE H;  3ERQ A;  4JI0 L;  3J7A F;  2GVB A;  5KFY A;  5IGE A;  3T1H Q;  5K2M A;  2WAQ B;  4HNV A;  4IFD G;  2OXP A;  1RTN A;  1LUZ A;  2FPP B;  1XPO A;  1QVG A;  1EZ8 A;  1LM0 A;  1Z7T A;  3KAK A;  4U6P A;  5IWA Q;  4IR1 A;  5HUR A;  2F0L A;  1STB A;  3NBH B;  3QO2 A;  1UNN C;  4C1N I;  4LMY A;  2F3V A;  2F0K A;  1NR2 A;  4ED2 A;  3G4S A;  3TP7 A;  4DV6 Q;  1Z2O X;  4PNY A;  2NVY H;  3RUP A;  2JA5 H;  1J9O A;  3F1Z A;  3K57 A;  4DR1 Q;  1N32 Q;  2R8I A;  4RHS A;  1ASY A;  2UUB Q;  3HOZ G;  1KLU D;  4ME5 A;  2RHS B;  2XWB B;  5IYD G;  3CKI B;  2Y0S B;  4KY7 A;  3BVG A;  2XCA A;  2BH8 A;  4HSP A;  2R6F A;  1MZB A;  3AB9 A;  1HXY D;  5KFD A;  2CW0 D;  2OLS A;  2L55 A;  1QNK A;  2ALY B;  3T1H L;  4JI7 H;  1TS4 A;  1Z2N X;  2QGQ A;  3GV5 B;  2BCO A;  2UXD Q;  3KTM A;  4MN3 A;  4IPH A;  4C3H H;  1HPC A;  3NTK A;  4IOC A;  3E5N A;  3T4A C;  3BVZ A;  4DV7 Q;  1XYI A;  4IFD I;  5G3L F;  3B6Y A;  3D4R A;  3LGJ A;  2VQE Q;  1TWH B;  3NQT A;  4DV6 L;  2QEX A;  2NVY A;  2JA5 A;  3M4Y A;  1HQM C;  1NJI C;  4DR1 L;  1N32 L;  1WD0 A;  2UVV A;  2UUB L;  3N8D A;  4O4H F;  5CV4 A;  1B70 B;  1N36 H;  3JAM E;  4RUA A;  4A3K H;  2F0J A;  1I50 H;  4UHV A;  2K6A A;  2WAQ G;  3PUZ A;  4RKL A;  1WYD A;  2HDL A;  3J81 j;  2HVS A;  1B4O A;  3TP6 A;  3CPW A;  4DUY Q;  1XMQ Q;  2A68 D;  1PFS A;  3Q23 A;  5ELO A;  1VS0 A;  2K7V A;  4NP5 A;  3J80 E;  1E24 A;  3I55 A;  4JOI C;  2UXD L;  2FE3 A;  1PA6 A;  2YTX A;  1GGO A;  1HTL D;  2SDF A;  2VUM B;  4RB2 C;  2HHH H;  4LFB L;  3N40 P;  3FDS A;  2UUC H;  3SK8 A;  5K36 G;  4DR7 H;  4DV7 L;  1XX8 A;  3RZO B;  2FJZ A;  2IL8 A;  3IFD A;  2VQE L;  1WH2 A;  1A62 A;  3CXC A;  2NN6 H;  3K6O A;  1CKM A;  3MWM A;  2Y0S G;  2WAQ E;  3LWE A;  2PZW A;  3RV4 A;  5IE8 A;  1TY2 A;  5KNB A;  3M4O H;  2W6Q A;  4KN4 C;  3PN1 A;  3KLS A;  4IQZ A;  3NE5 B;  3U58 A;  5D1P A;  4ZCK A;  1I50 A;  1JWS D;  4DFA A;  2MGS A;  1EIY B;  1HNZ H;  2BA1 A;  4DUY L;  1TWC B;  4BY7 B;  4K5V A;  1U0L A;  2ES2 A;  4J9K A;  3MEH A;  4I7A A;  1K28 A;  2LKV A;  4ECS A;  2A68 C;  1PRT F;  2R7Z A;  3VPD A;  4X6A H;  3UFX B;  1EQT A;  1U5K A;  3JRX A;  4EQ5 A;  4ECW A;  2Y0S E;  3K3P A;  3A7L A;  1N36 Q;  1XPU A;  1B6S A;  3JSL A;  1HHV A;  1DIK A;  2DNC A;  2KVM A;  3RMH A;  3SEB A;  4A3B B;  1EZ1 A;  5KKN B;  4QWD A;  3PIP A;  3K5I A;  1O78 A;  2CWA A;  4H44 C;  1PTO D;  1YNN D;  1E4E A;  4JC0 A;  2FMM A;  4HCS A;  3S17 H;  1SFO B;  2HHH Q;  4OWW B;  1VQA A;  1EWI A;  3GTL H;  5KT6 A;  4UP7 A;  3I12 A;  2VUM G;  2Q2U A;  4CJ2 C;  4DAY A;  1QZH A;  2DY7 A;  4ED3 A;  3GDE A;  4HIO A;  1STA A;  3ZYY X;  3TII A;  1UNS A;  3ITP A;  1MJE A;  4EG0 A;  5KG7 A;  1OXX K;  1VQJ A;  3T13 A;  3W3A A;  1N36 L;  5IP7 H;  3IKJ A;  4QCL A;  1CFM A;  3HBL A;  4IN3 A;  4ULL A;  5M5Y H;  4LMQ D;  4GS3 A;  2PN1 A;  4OIK A;  3KBX A;  1HNZ Q;  5J1Z A;  4GLA C;  2K1B A;  1D1I A;  3F2D A;  3T5K A;  4QQB X;  1KRS A;  1O7Y A;  1LT6 D;  4Y7N B;  2FPI B;  4GNX B;  4BY7 G;  3HOX B;  4HN7 A;  2EPB A;  2SCU B;  1PTO C;  1YNN C;  1LO5 D;  3ULJ A;  3HOU B;  3W5O A;  2C5C A;  2HHH L;  2YZN A;  5KFM A;  3H4B A;  2JQO A;  3GTL A;  4POG A;  1YI2 A;  1XNR Q;  3G6X A;  2HT1 A;  4APV A;  2EY1 A;  1SN8 A;  3BA9 A;  3HS0 C;  1R4P B;  1KL9 A;  5KFS A;  4EFB A;  4DR5 H;  4A3B G;  2FK1 A;  1EUD B;  4HID A;  4A3E H;  2D5D A;  5C1P A;  3RFC A;  2A1A A;  4R9W A;  4RMF A;  3VYT A;  4L5T A;  3N41 B;  4H0L C;  1SE2 A;  4X65 H;  2JYO A;  2XGT A;  2XVS A;  3VR5 A;  1PFN A;  3Q0A A;  2PNR C;  1HNZ L;  4YP3 A;  4FU0 A;  2NUA B;  3G48 A;  4F7X A;  1LTG D;  2Z6K A;  3WO0 A;  1K8A C;  5EPL A;  1F2Z A;  3D6C A;  3HP3 A;  1CM9 A;  4QWC A;  1K9M C;  3PIP 3;  4RCN A;  3H3V C;  2BQR A;  2VA3 A;  4GC7 A;  3WOE A;  2RDH A;  4YHH H;  3J7A 5;  1A15 A;  3EA6 A;  1XJV A;  5CBA E;  3NTI A;  1NY4 A;  4A3D H;  4RB0 A;  2IBK A;  2IPK D;  1KJJ A;  2A6E D;  3V96 A;  3Q2O A;  4JV1 A;  3HZX A;  3OWF A;  2OWO A;  2Z6B A;  2NVT B;  2PI2 A;  4YJ3 F;  3WNZ A;  4NKL A;  3HOX G;  1LTI D;  3HB9 A;  2R7F A;  1WJJ A;  3HOU G;  3NSW A;  4ALP A;  3GTQ H;  4IO9 A;  3NTH A;  4DUZ H;  2K5Q A;  1V8Q A;  4F87 A;  5KG1 A;  4I7H A;  1UE7 A;  4TV8 F;  4EEY A;  1GHK A;  2R8K A;  1LTA D;  2M00 A;  4DR5 Q;  3CC4 A;  1OO9 B;  1EL0 A;  3RLF A;  3BJU A;  2JP1 A;  5BN5 A;  2W9B B;  1PZI D;  2IHE A;  4H7B A;  5IGB A;  4QGU A;  4QW9 A;  5IGF A;  4BBR B;  1V1O A;  4X65 Q;  1FYC A;  4J8Q A;  4EQN A;  5M9O A;  5DM7 3;  3PUY A;  5CGK A;  2YS6 A;  1RYS A;  3KHR A;  4PMB A;  3S24 A;  5LP6 F;  1E4F T;  5DAU A;  4O2D A;  5C4H A;  4R8I A;  1S5C D;  2JA7 A;  2ZDG A;  2F0H A;  4APM A;  4AIM A;  4O3Q A;  1CQV A;  4OHJ A;  3QIA A;  3A5Z B;  1QNU A;  3RNU A;  4JBJ A;  1Q86 C;  3GTQ A;  2VL6 A;  4S3S A;  5G3L D;  1S5F D;  4YHH Q;  3PO3 B;  1M6V A;  2GPS A;  1BO0 A;  1VQD A;  5EJW A;  4CDC C;  1CKO A;  4UY8 C;  1S5B D;  5KND A;  4DR5 L;  4MA5 A;  3RTX A;  5KT5 A;  2Z9H A;  4IUP A;  2NZ1 D;  2I5L X;  3A54 A;  3FHW A;  2VPS A;  3MTS A;  3PIO A;  1CQJ B;  4X65 L;  3MAQ A;  5J3B A;  1TT2 A;  2UU9 Q;  2EYH A;  3PW0 A;  2IA6 A;  1IBL H;  2A5H A;  4LWC A;  4DUZ Q;  3S15 B;  1KJ8 A;  3KAJ A;  5IP9 H;  3KDF A;  1A63 A;  5KFT A;  1UE1 A;  1NR4 A;  2V9W A;  2RDG A;  1EYA A;  2W6Z A;  3M7G A;  1S5D D;  3BJY A;  1E2Z A;  2UVU A;  2JEA I;  1IKL A;  4ED0 A;  2CZG A;  1PTO B;  1S97 A;  5COY A;  4EBC A;  5DGA A;  4YHH L;  1OTC A;  3PW2 A;  3H0G H;  4IUT A;  4O2A F;  1YIJ A;  1DM0 B;  4BBR G;  4C2M H;  3Q8S B;  2XCL A;  3STB D;  2XGQ A;  4EVO A;  4ECR A;  3PMF A;  3ERO A;  4C5A A;  3FVQ A;  1D8L A;  4ME3 A;  5GQO A;  3DM1 A;  4Z9C B;  1HZB A;  5JJK A;  4AYB B;  2UU9 L;  3TQY A;  2Z1C A;  5CYU A;  4I55 F;  1GVP A;  4K8I A;  2RHQ B;  4HSV A;  4ZQ3 A;  2K4K A;  3GV3 A;  1R4Q B;  4DUZ L;  1VQO A;  1PRT D;  3MVV A;  3UDX A;  4HJ9 A;  2V59 A;  3PO3 G;  3T1Y Q;  5CAE B;  3HOW H;  1GOZ A;  5CV5 A;  1Q12 A;  1PZK D;  2Q2H A;  4UDU C;  2Q8T A;  1XWE A;  3GIQ A;  4RHR A;  3M9M B;  3ERS X;  3TSS A;  1LTL A;  1TWF B;  3GTM B;  1SBB B;  2B2W C;  1PVO A;  3H0G A;  3KXY T;  4QIW A;  2IHF A;  1JWM D;  4LFC Q;  4C2M A;  1IBL Q;  1LTR D;  3RLO A;  4MTK A;  5AFW A;  4DNR B;  4A3G H;  2R93 B;  1X3Q A;  5FO9 B;  2JE6 I;  1JR0 D;  1SAP A;  4KK7 A;  1SYD A;  3H09 A;  3RZD H;  4FM9 A;  4DL4 A;  5FLM H;  2K14 A;  1HNW H;  1STE A;  2R8J A;  4CDF C;  3GTG H;  3S1M B;  1B7Y B;  1ESR A;  3I91 A;  4K5W A;  2E2J B;  4DV5 H;  2HDM A;  1TVX A;  3RGX A;  1VQE A;  1K8G A;  4MHE A;  4MV3 A;  2BH2 A;  5EQ0 A;  4EBE A;  3PIO 3;  4RGT A;  2K50 A;  3A56 A;  3E0E A;  2FK3 A;  2C9O A;  1PRT C;  4R4I A;  4B3S H;  4Q5V A;  1E7Z A;  1GSH A;  4MTN A;  2IY5 B;  4JV2 A;  4JI5 H;  5C4X B;  2C2R A;  5EBD A;  1SR3 A;  2EJM A;  3HOV B;  3C1F A;  3K0Y A;  3U4V A;  4CKC A;  4LFC L;  1H9J A;  1IBL L;  1TQO A;  2KHI A;  3E3X A;  1QCB D;  2ICE C;  3CW2 C;  5D65 A;  1EU3 A;  4AYB G;  1BNC A;  1TAE A;  4IWY A;  2VXW A;  3BU2 A;  4K2L A;  3KF6 B;  3L3O C;  3VYU A;  5KFJ A;  2YYA A;  1M0W A;  5LMN Q;  3GTP H;  4BS9 A;  1ENF A;  3LWU A;  1JCK B;  4OIJ A;  3U9O A;  2B2Y C;  2AU0 A;  3AU7 A;  3S14 B;  1PFB A;  2F3W A;  2FLP A;  3K7A H;  2R6G A;  5C4Z A;  1GHJ A;  4B3T Q;  2NYZ D;  1G6P A;  5L37 A;  1I3Q H;  2JA6 G;  5T1G A;  1Y1W H;  1O7I A;  3QOL A;  2DNE A;  5HGQ A;  5C4J H;  2CFM A;  3MXN B;  3S1Q B;  4AYB E;  2R93 G;  1XDN A;  1NCV A;  2R92 B;  1QOH A;  5ELF A;  1MI2 A;  2K5W A;  3OUU A;  2R3Z A;  1ET9 A;  2E75 C;  3A74 A;  3PGZ A;  1IW7 C;  4FXG C;  1E22 A;  1ML0 D;  1P8L A;  3X3N A;  4Q0F A;  4MV4 A;  4JV5 H;  1N56 A;  3BDC A;  4IRD A;  2DGY A;  2KEN A;  5E7N A;  4JI3 H;  4JVZ A;  2ZDQ A;  5LXT F;  2I5H A;  1H9R A;  3GTP A;  4FBT A;  5CR3 A;  5FLX L;  1I4X A;  4B3S Q;  1YBY A;  2EOT A;  5C44 H;  2HUG A;  2R8H A;  4JI5 Q;  4L1K A;  2F4V H;  2YRX A;  1A2T A;  2B39 A;  4GN3 B;  5L1L A;  4B3T L;  2KBN A;  4K6D A;  5C4X G;  1B9M A;  1I3Q A;  3PW7 A;  3R93 A;  3HOV G;  1Y1W A;  3O13 A;  3JSN A;  3HGB A;  5GAE C;  5AJ3 Q;  2L0C A;  2CW8 A;  4YR2 A;  1T3N A;  3Q8D A;  4ECV A;  2MQH A;  1HNW L;  1JJ2 A;  1EYD A;  4YR3 A;  3MXP A;  2F0O A;  3WOF A;  2I80 A;  3H3V I;  3I4O A;  2EYJ A;  3OHX C;  1OXT A;  2R7L A;  3NGD A;  4RKB A;  1D2B A;  1M7J A;  3FKI A;  5EPK A;  4A3F H;  5I9O A;  1R9T B;  2YW2 A;  4DU9 A;  1HJP A;  4JI4 H;  4LUZ A;  3RGZ A;  2W6P A;  1FD7 D;  2VA2 A;  4J15 A;  4B3S L;  2E2H B;  1PYB A;  1W2B A;  1BBW A;  4JI5 L;  1L0Y B;  3CCS A;  3W1B A;  3JAM c;  1L1O C;  5CV7 A;  2NB0 A;  5EKI A;  4GC6 A;  3J81 c;  3M3Y H;  1Q81 C;  2RGR A;  2R92 G;  4JI1 H;  1X6O A;  4F8M A;  3I73 A;  1JT8 A;  1EQV A;  5AJ3 L;  4TKO B;  3DWQ A;  4XQJ A;  4CDE C;  1WD1 A;  4JV5 Q;  1AE2 A;  1UC9 A;  1SSO A;  4JI3 Q;  4KKU A;  3PO2 B;  5IT9 E;  2F4I A;  4YWL A;  4DV2 H;  1GSO A;  1BKB A;  1QUQ B;  1VQ8 A;  4PZ6 A;  4TRD A;  3S16 B;  5HY6 A;  5C3E H;  1VBH A;  2F4V Q;  1VQ9 A;  3KBG A;  3TIG A;  4RG1 A;  2F52 A;  1TR5 A;  5K5P A;  1EYZ A;  1E4G T;  5KFO A;  4KI0 A;  4BWG B;  2HCI A;  2SOB A;  3D0F A;  3L0O A;  4WRD A;  3MR3 A;  3OUZ A;  4J6H A;  5HGT A;  3HFZ B;  5KFK A;  1CA6 A;  2WE6 A;  3V2T A;  4K5X A;  2UXB H;  2AQ3 B;  5IYC G;  1PRT B;  4RZQ A;  3HG9 A;  3KFU A;  1EQQ A;  1XNQ H;  2PQA A;  3MWE A;  2VW9 A;  1Z6H A;  4A3J H;  3I4N B;  2FB9 A;  1HZA A;  1ENC A;  3G6Y A;  5BR8 H;  2L11 A;  4JV5 L;  5HV6 A;  5KT7 A;  2RVL A;  3EQL C;  5KG6 A;  4JI3 L;  4B3R H;  5D1O A;  4JI4 Q;  1EOV A;  3TRZ A;  1SYF A;  1TY0 A;  1AW7 A;  1O75 A;  2AHO B;  2BE5 C;  5ISR A;  4IUU A;  4YAJ B;  3SR1 A;  3TME A;  2KHJ A;  4JBK A;  2F4V L;  4O1N A;  2JEI A;  5IOC A;  3KLS X;  2OEO A;  2XIW A;  3K5L A;  4N9P A;  4UCT A;  1RL2 A;  4NLG A;  4I65 A;  5CB4 F;  1PH9 A;  4E4T A;  4JI1 Q;  4K6L A;  2BDO A;  4IFD H;  2N8N A;  5M5W H;  1KC8 C;  4F4X A;  5LL6 S;  1J8I A;  3TBI B;  1SMY D;  2I07 B;  2NVX B;  3BG3 A;  3BAB A;  5LL6 X;  2ZDH A;  3HKZ B;  4O0A A;  1TWA B;  4J9Q A;  2FLL A;  4P2C B;  4V19 0;  2J6S A;  5LHY 1;  1PH4 A;  2V5A A;  4JI6 Q;  1MSG A;  2EJG C;  4RGO S;  1WVL A;  3QFF A;  1IBM H;  2ALZ A;  2AGP A;  1YIT A;  5BN3 A;  1LLR D;  1GKH A;  1WTP A;  2QDB A;  2UUA Q;  4RA8 A;  1Y1V H;  2F0T A;  1PH6 A;  3HOZ H;  4JI4 L;  4RB3 C;  4IJH A;  1VQI A;  1AP0 A;  5IYD H;  2YU9 B;  1GUG A;  4GLV B;  1XPR A;  1U4R A;  1PHJ A;  3CCJ A;  1IOW A;  3OHB A;  2JEJ A;  4PMW A;  1TWG B;  1XNQ Q;  1OWT A;  3NWT A;  4JI1 L;  1VQ7 A;  1PX2 A;  3JAM W;  4ECT A;  1IYJ B;  1A6X A;  3QZ8 A;  3S1R H;  1HUN A;  1VQF A;  5BR8 Q;  3I4N G;  2R82 A;  2KSW A;  2HIV A;  2BDN A;  2QDL A;  4B3R Q;  1SMY C;  2PMZ B;  4JI6 L;  5A2Q W;  1I5F A;  1BCP C;  1V9P A;  3J80 W;  1TU2 B;  1GUN A;  1KC7 A;  2J0T D;  3FDT A;  2SNS A;  3CHB D;  2UUA L;  1Y1V A;  2RDF A;  3AMU A;  1S68 A;  2G5D A;  3I90 A;  4CJ1 B;  1EY0 A;  4OEL B;  1SCU B;  3VR6 A;  4LH7 A;  2NVQ B;  1WOC A;  4OL7 A;  1S0N A;  1IBK H;  2E2D C;  4DNI A;  1XNQ L;  3R23 A;  4IZO A;  3HKZ G;  1IBM Q;  2ZXO A;  1S72 A;  3RN2 A;  1X54 A;  2AUK A;  4DXF A;  3SK6 A;  2QYZ A;  4A2B A;  1L1O B;  2P5Z X;  1CUK A;  1DYQ A;  4DF7 A;  5BR8 L;  4ME6 A;  5LL6 b;  1SYB A;  3TZD A;  3PZP A;  1U4P A;  2IT1 A;  3QR8 A;  1OXS C;  4B3R L;  2F0Q A;  5M3M B;  4GKJ Q;  1G8Z D;  3TDQ A;  5M5X B;  4YCW A;  3M9B A;  1KNE A;  1SRU A;  5ELN A;  1MSH A;  2GLT A;  4OWT B;  2N78 A;  2LY7 A;  1C9O A;  4GNX C;  2XCP A;  3SE0 A;  2OTJ A;  2CQA A;  1A3T A;  5LMU Q;  1BQQ T;  1O7L A;  3A7A B;  2MO1 A;  3HKZ E;  2A73 B;  2RA4 A;  2WAQ A;  3BQ1 A;  2ICI A;  3T5J A;  4BY1 B;  3D4D A;  4LFB Q;  4XYM B;  4NPS A;  4L8J A;  3CAM A;  1C0A A;  1UC8 A;  1NAP A;  1BVS A;  3GLK A;  4Q44 A;  2Q2I A;  3K0X A;  3UE1 A;  1IBM L;  1TXY A;  1II3 A;  1VQH A;  5C6A A;  5KG4 A;  1FGB D;  4DN4 M;  3NBH A;  1EFW A;  2YCH A;  5FO7 B;  2ZJR A;  2RSN A;  5BN4 A;  5FJ8 G;  1Q8I A;  1TWH H;  3P20 A;  4DAM A;  3OTO H;  3RAX A;  1EQR A;  1QIL A;  4C3J B;  4GKJ L;  2FK2 A;  3J7Z C;  4RWS C;  1SYC A;  3J81 E;  2V4R A;  3FMA A;  4K2K A;  3S2D H;  1GSA A;  2GA4 B;  2KEC A;  2Y0S A;  4C5C A;  5A2Q E;  3WWV A;  1AN7 A;  5LMU L;  2QKI C;  2FJ2 A;  2R7Z H;  5DQH A;  2GN5 A;  2Z0S A;  3NUC A;  4JG2 A;  4ZLT F;  5JEA J;  3J7A V;  2PMZ E;  1GM5 A;  5JVG 3;  3J80 L;  4KY6 A;  1ZQ7 A;  3I70 A;  2XN9 C;  4EYI B;  2KCN A;  1F9Q A;  1L0X B;  2K52 A;  2KED A;  1UE5 A;  1SLJ A;  4B9W A;  5M3M G;  4LF7 H;  2JJQ A;  3VYR A;  4JI2 H;  1ENA A;  1VQC A;  1X32 A;  3RZO H;  3K5H A;  4O3S A;  3BQ0 A;  4B3M H;  3CCE A;  3NK9 A;  5CA0 F;  4JI7 Q;  1TWH A;  1OXV A;  3CVZ A;  1GUO A;  3CQZ B;  1WI5 A;  1QG7 A;  1WTO A;  4POF A;  4LF6 H;  2K03 A;  3I72 A;  4V0B A;  4XIG S;  4J0M A;  3VR2 A;  3RF2 A;  1I4H A;  1QWY A;  4BY1 G;  2OQ0 A;  5DQG A;  4R8U B;  4O3O A;  3A8J E;  4BY7 H;  1B1Z A;  1TWC H;  3D3R A;  1MBY A;  5IYB H;  2HQL A;  2YTV A;  4YB8 B;  3TQT A;  3Q8P B;  4R8N A;  3BZD B;  1SJE D;  2M9V A;  3OTO Q;  3A0J A;  3VYS A;  2VB2 X;  4PG3 A;  1FJG H;  4DNT B;  2VUM A;  2PCF B;  1BR9 A;  4TQU S;  4C3J G;  2DIK A;  2RF4 A;  3F2B A;  2XGP A;  2FFK B;  4XXE A;  4LF8 H;  4X66 H;  1E0B A;  2HJW A;  1BCP B;  2CVR A;  1X65 A;  4JI7 L;  5I47 A;  1RYR A;  4LJZ C;  1CSQ A;  1M1K C;  2KOL A;  3VA5 A;  3RB4 A;  5I6Y A;  1LT5 D;  4PDB A;  2PZT A;  3NBI A;  2KQ3 A;  2JEB I;  5J39 A;  2K33 A;  2JSO A;  3NQI A;  4IAJ A;  4EEQ A;  2UUC Q;  4K14 A;  4C1N K;  4DR7 Q;  1PMR A;  3AQQ A;  5T14 A;  1SFO H;  4QWB A;  3FMC A;  3OSP A;  4ED6 A;  1RJT A;  4LF7 Q;  3DEP A;  4HMJ A;  1TWC A;  4LH6 A;  1KTK A;  1VAJ A;  1IL8 A;  2SEB D;  3BYT B;  3HXL A;  2J7Z A;  2WB1 B;  4ID6 A;  1C8C A;  1WCM B;  1MKH A;  5F9L A;  4QWA A;  3H40 A;  3OTO L;  5FPO A;  1ILP A;  3R5F A;  4LF4 H;  2Q2T A;  2VY3 A;  3IN5 A;  4LF6 Q;  4NMZ A;  4NB3 A;  3GQB A;  1RHP A;  4O3N A;  1YHB A;  3T56 B;  5KIX A;  5GAH C;  2ATL A;  2EYO A;  1T36 A;  5C5L A;  3NHH A;  1GXD C;  1UAP A;  2NN6 G;  4Y7N H;  2FXQ A;  3ONA B;  1MHW C;  2EQS A;  4KHZ A;  1B3Q A;  1CE8 A;  2B63 B;  3HOX H;  2G9D A;  1FJG Q;  2UUC L;  1EHI A; 
#chains in the Genus database with same CATH homology
 3K8A A;  3HOU H;  4DR7 L;  4A3L G;  1D8L A;  4ME3 A;  3KOJ A;  5GQO A;  4YY3 L;  1HNX L;  1H95 A;  1L2F A;  1HZB A;  4LF7 L;  4GOP C;  3I4M H;  5JJK A;  1Y1W G;  2UU9 L;  3TQY A;  3L2P A;  4JI2 L;  2DUD A;  3UE0 A;  1GVP A;  4OO1 G;  1SE8 A;  2B29 A;  2RHQ B;  1Q8K A;  2PQA B;  1Y1V G;  2K4K A;  4JI8 L;  4PZ8 A;  4DR3 Q;  4DUZ L;  5C0X G;  1VQO A;  1PH2 A;  4BY1 H;  1A8V A;  2Z6K C;  3UDX A;  4HJ9 A;  3PO3 G;  3AFP A;  3T1Y Q;  3HOW H;  3ICE A;  1HZC A;  1Q12 A;  4C3I H;  2Q2H A;  4LF6 L;  4DV1 Q;  2OQK A;  1KD1 C;  4WJ4 A;  4DV4 Q;  3FKI G;  3OW2 A;  1L1O A;  1W3S A;  2EIF A;  2YYZ A;  3ERS X;  1LTL A;  2CKZ B;  3ZJY C;  3J80 c;  1PH8 A;  4K0K Q;  5JJL A;  4GKK Q;  4WJ3 M;  1PVO A;  1AE3 A;  2AKW B;  2IHF A;  1YJ9 A;  5C44 G;  1SMX A;  2A19 A;  4LFC Q;  1IBL Q;  3RLO A;  4C3J H;  4GNX A;  4A3G H;  2K5H A;  5IWA L;  2JE6 I;  1FJG L;  1IBK Q;  1N9W A;  4LUO A;  2IX1 A;  2WB1 G;  4LF4 Q;  1WCM G;  3FP9 A;  3RZD H;  5FLM H;  2K14 A;  3CC7 A;  2MO0 A;  3L7Z C;  4BA1 I;  2NN6 I;  4MZ9 A;  3U50 C;  3W1G A;  4LF8 L;  4QL5 A;  2C35 B;  1B7Y B;  3GTG H;  2E8G A;  5M3F H;  1VQE A;  1K8G A;  1Q1E A;  2K5N A;  4DR3 L;  1OXU A;  1YVC A;  2BH2 A;  2JA7 H;  2VUM H;  1PH7 A;  3CCU A;  2K50 A;  3E0E A;  4R4I A;  4DV1 L;  1E7Z A;  2BA0 A;  2NVT H;  4MTN A;  4OO1 I;  2IY5 B;  4DV4 L;  1X9N A;  1NE3 A;  3IRB A;  4A3F G;  2B63 G;  4A3M H;  4K0K L;  1SR3 A;  5C0X I;  1EIF A;  2QA4 A;  2R7D A;  2NVX H;  4GKK L;  3U4V A;  2WB1 E;  4YWK A;  4HJ8 A;  2ASB A;  2JA5 G;  1BBU A;  4LFC L;  1IBL L;  3AFQ A;  2KHI A;  3KJP A;  4AYB G;  1E1T A;  3CW2 C;  1PV4 A;  1C7Y A;  3CQZ H;  3BU2 A;  1IBK L;  1FGU A;  3KF6 B;  3GTJ H;  1X3E A;  3CCQ A;  3ER0 A;  3PSI A;  4LF4 L;  3K7U C;  5LMN Q;  1FL0 A;  4DK6 C;  3G71 A;  3GTP H;  4JOI A;  4DR4 Q;  1YEZ A;  4R4C A;  1VQP A;  4BBR H;  4OXP A;  5GRO A;  4IPD A;  2VQF Q;  3HOY H;  2ZM6 Q;  3PF5 A;  1EYG A;  3CC2 A;  4OX9 Q;  3K7A H;  2R6G A;  1Y14 B;  4A93 G;  4DKA C;  4HIM A;  4B3T Q;  4A3L H;  1G6P A;  1I3Q H;  5H1S E;  3PO2 G;  1YZ6 A;  2JA6 G;  1Y1W H;  4JI0 Q;  1O7I A;  4DAY B;  5HGQ A;  2WP8 J;  4JCV E;  4P75 A;  2ZJQ A;  1XTD A;  2EXD A;  1XMQ L;  1IL2 A;  5C4J H;  2CFM A;  3MXN B;  4A3B H;  4AYB E;  2R93 G;  5C0X J;  3AEV A;  3PO3 H;  3A74 A;  3PGZ A;  4R1J A;  2PNH A;  3BZC A;  4QJF A;  1E22 A;  1P8L A;  1JJG A;  3CCR A;  5FJ8 H;  2JK8 A;  2WFW A;  2DGY A;  4R4O A;  4A3K G;  2KEN A;  2V1C C;  3NEM A;  4LUV A;  4KLK A;  1EUJ A;  5E7N A;  4A3J G;  2I5H A;  4DR4 L;  4JI2 Q;  1PH3 A;  4B3S Q;  1YBY A;  2N49 A;  5C44 H;  3KF8 B;  4LNQ A;  4B3M Q;  2I5M X;  2ZTD A;  2VQF L;  4JI5 Q;  3TS2 A;  4BBS G;  4QY7 A;  1WFQ A;  2ZM6 L;  4OX9 L;  4MNO A;  4GN3 B;  3K80 C;  3CME A;  4B3T L;  2KBN A;  1WCM H;  5C4X G;  2R7Z G;  3PUX A;  4IOA A;  3I7F A;  4HIK A;  1QVF A;  3DM3 A;  1A0I A;  2D62 A;  3HOV G;  4JI0 L;  5GAE C;  5AJ3 Q;  2GVB A;  3Q8D A;  5IT9 c;  5GAG C;  2LXJ A;  2MQH A;  3CP0 A;  3T1H Q;  4BXX G;  4IFD G;  4A75 A;  1HNW L;  1JJ2 A;  2B3G A;  1LUZ A;  1Q7Y C;  1XPO A;  1QVG A;  1NTG A;  1LM0 A;  4JBM A;  3H3V I;  3I4O A;  5IWA Q;  4GOP B;  1OXT A;  4LF5 Q;  1JJC B;  1Q82 C;  3NBH B;  4A3F H;  2B63 H;  2K75 A;  1E3P A;  3M4Q A;  1HJP A;  4LUZ A;  3G4S A;  4DV6 Q;  4DR2 Q;  4J15 A;  4B3S L;  4LF8 Q;  2NVY H;  1PYB A;  2JA5 H;  4X66 Q;  1W2B A;  1BBW A;  3F1Z A;  4DR1 Q;  4B3M L;  1N32 Q;  4JI5 L;  4P72 A;  3CCS A;  1ASY A;  3W1B A;  2UUB Q;  3JAM c;  3HOZ G;  1NBW A;  1L1O C;  3CPF A;  2L15 A;  2H5X A;  2RHS B;  3I2Z A;  3G6E A;  3J81 c;  3M3Y H;  3F8T A;  1Q81 C;  5IYD G;  5IYB G;  2R92 G;  4LFA Q;  1X6O A;  2KCT A;  2BH8 A;  5GAD C;  3TS0 A;  4R4T A;  1D7Q A;  1JT8 A;  5AJ3 L;  3M85 A;  4JV5 Q;  2ALY B;  1AE2 A;  1G51 A;  3T1H L;  1KXL A;  4JI3 Q;  4YWL A;  1KRT A;  3H15 A;  3TEH B;  2QGQ A;  4A93 H;  1X56 A;  1BKB A;  4L5R C;  2UXD Q;  2ZTE A;  1QUQ B;  3GTM H;  1TWF H;  4PZ6 A;  2CQO A;  3EBE A;  4IPH A;  4C3H H;  5HY6 A;  1VQ8 A;  2A8V A;  5C3E H;  2F4V Q;  1S40 A;  1VQ9 A;  4LF5 L;  2CCZ A;  4IOC A;  1RIP A;  3GTK H;  4RG1 A;  1YNX A;  3H3V H;  2F52 A;  4DV7 Q;  4KI0 A;  4L5S A;  2D0O A;  4IFD I;  2R93 H;  3B6Y A;  3PUW A;  1VQ4 A;  3D0F A;  3L0O A;  4DV0 L;  3LGJ A;  2VQE Q;  4DV6 L;  4DR2 L;  2QEX A;  3BZK A;  2VZA A;  3HFZ B;  4X66 L;  4A3I H;  1NJI C;  4DR1 L;  1PYS B;  1N32 L;  4P74 A;  5IYC G;  4EX5 A;  2UUB L;  3PUV A;  1B70 B;  3KFU A;  1T9H A;  1EQQ A;  4A3K H;  2E2J H;  1I50 H;  2YTY A;  2PQA A;  2WAQ G;  3PUZ A;  2VW9 A;  4A3J H;  1WYD A;  4LFA L;  2I0Q A;  3J81 j;  3J80 i;  1HZA A;  3CPW A;  4DUY Q;  1XMQ Q;  4Y52 H;  5IP7 G;  4JV5 L;  1PFS A;  5ELO A;  4BBS H;  3UDG A;  2OCE A;  1VS0 A;  1XNR L;  4JI3 L;  2ID0 A;  1HZ9 A;  4JI4 Q;  1EOV A;  3RN5 A;  4FDB A;  3TRZ A;  2AHO B;  1E24 A;  5C4X H;  4JOI C;  3I55 A;  2UXD L;  1PA6 A;  1I94 Q;  2YTX A;  4NXN Q;  2IX0 A;  2KHJ A;  4JBK A;  2F4V L;  1MIU A;  3HOV H;  4LFB L;  3E9H A;  5K36 G;  1RL2 A;  4BXX H;  4DV3 Q;  4DV7 L;  1G29 1;  1PH9 A;  4DPG A;  4JI1 Q;  2N8N A;  5M5W H;  1KC8 C;  2VQE L;  4IFD J;  1A62 A;  3CXC A;  4HJ5 A;  1KIX A;  1CKM A;  2Y0S G;  2WAQ E;  5IE8 A;  1GD7 A;  1M90 C;  4O0A A;  3M4O H;  3TRE A;  2N3S A;  1HH2 P;  3U58 A;  1PH4 A;  4JI6 Q;  3S14 H;  1J6Q A;  5FLX c;  1YIT A;  4UP8 A;  1EIY B;  1GKH A;  2BA1 A;  4A3E G;  4DUY L;  5JJI A;  2UUA Q;  2ES2 A;  1U0L A;  4KHP Q;  3SGI A;  2RCN A;  2ZTC A;  1Y1V H;  1PH6 A;  3HOZ H;  1FVI A;  1KQS A;  1HNW Q;  4JI4 L;  1JMC A;  4IJH A;  1N34 Q;  1VQI A;  5IYD H;  3S1Q H;  2R92 H;  4X6A H;  4LF9 Q;  4A3C G;  1I94 L;  1U5K A;  4GLV B;  3KDF B;  4NXN L;  3GD7 A;  3CCJ A;  4DV5 Q;  1XPR A;  1PHJ A;  4EQ5 A;  1UWV A;  2Y0S E;  1K73 C;  4PMW A;  1N36 Q;  3FKI H;  1XPU A;  1XNQ Q;  4DV3 L;  2ATW A;  4JI1 L;  1VQ7 A;  1AH9 A;  3CCM A;  3KF6 A;  1GO3 E;  1IYJ B;  1KHI A;  3PIP A;  1S3O A;  3S1R H;  3UDI A;  1VQF A;  5BR8 Q;  2CWP A;  3I4N G;  1VQL A;  2CWA A;  3JC6 6;  2HIV A;  4B3R Q;  4JC0 A;  1CKN B;  4JI6 L;  4L5Q A;  2K5V A;  1V1Q A;  4A3D G;  4GLX A;  5JEA G;  1PH5 A;  2PI2 E;  1I5F A;  1V9P A;  1VQB A;  3S15 H;  3S17 H;  3S2H H;  2HHH Q;  4OWW B;  4IPC A;  1VQA A;  1VQG A;  1EWI A;  3GTL H;  3I56 A;  2LSS A;  2UUA L;  4UP9 A;  1IZ6 A;  3EIV A;  4UP7 A;  4KHP L;  2JA7 G;  2VUM G;  2Q2U A;  5IYC H;  3KJO A;  3M4P A;  1QZH A;  3GTO H;  2VS1 A;  1N34 L;  3GDE A;  4HIO A;  4NXM L;  3RLN A;  1X55 A;  4LF9 L;  1XMO Q;  4HJ7 A;  3F2C A;  3CCV A;  1MJE A;  4DV5 L;  1OXX K;  1VQJ A;  1WOC A;  1N36 L;  5IP7 H;  1Z47 A;  3NEL A;  4DNI A;  1XNQ L;  3CF5 A;  3PF4 A;  3HKZ G;  1IBM Q;  2NZH A;  5M5Y H;  1S72 A;  4DV0 Q;  3RN2 A;  1X54 A;  1PH1 A;  1L1O B;  4GS3 A;  1HNZ Q;  1CUK A;  1R9T H;  4GLA C;  3F2D A;  5BR8 L;  1E1O A;  4OON A;  3S1N H;  4QQB X;  1KRS A;  3E9I A;  2E2H H;  2IT1 A;  5IY0 A;  4JYA L;  1OXS C;  4B3R L;  4GKJ Q;  3MEF A;  4GNX B;  4BY7 G;  4YCW A;  1Q1B A;  3M9B A;  1N8R C;  3RR5 A;  4YCU A;  3CCL A;  4XTC S;  4OWX B;  1SRU A;  5ELN A;  3ULJ A;  3W5O A;  4OWT B;  2YV5 A;  2HHH L;  2N78 A;  1C9O A;  4UPA A;  4GNX C;  2JQO A;  2OTJ A;  4IJL A;  1YI2 A;  4POG A;  1XNR Q;  2F3I A;  1VQ6 A;  5LMU Q;  2HT1 A;  4JBW A;  2OTL A;  3NEN A;  2D0P A;  4APV A;  2MO1 A;  1YHA A;  1SN8 A;  3HKZ E;  3PO2 H;  1XMO L;  4DR6 Q;  1KL9 A;  2JA6 H;  4LFB Q;  4A3B G;  4NPS A;  1VQM A;  3CAM A;  4HID A;  4HJA A;  4A3E H;  1C0A A;  3S16 H;  1BVS A;  2A1A A;  1LYL A;  2Q2I A;  3K0X A;  4L5T A;  4RMF A;  3UE1 A;  1TXY A;  1VQH A;  4GOP A;  1IBM L;  1EFW A;  3JAM i;  2XGT A;  1HNZ L;  1K83 H;  4X62 Q;  5LMN W;  2ZJR A;  2AWN A;  4A3C H;  1JE5 A;  3J81 i;  5FJ8 G;  1P16 A;  1TWH H;  1NMG A;  2UXC Q;  4DAM A;  4YWM A;  3G48 A;  3S1M H;  1EQR A;  4AQY L;  4GKJ L;  3PCO B;  2Z6K A;  1IXR A;  3U4Z A;  1KAW A;  1K8A C;  3J7Z C;  2VNU D;  1QVC A;  1DGS A;  1SRO A;  5DLQ E;  3S2D H;  1K9M C;  3I4N H;  3STB C;  5IP9 G;  3WWV A;  5LMU L;  3J7A 5;  1ASZ A;  1XJV A;  1X3G A;  1NY4 A;  2R7Z H;  2GN5 A;  4A3D H;  2Z0S A;  2MNA A;  1YJW A;  3KLW A;  4JG2 A;  1VCI A;  4DR6 L;  5JEA J;  1HNX Q;  2PMZ E;  1GM5 A;  1QUQ A;  4A76 A;  3ULP A;  1VQK A;  3H0G G;  1HR0 W;  4TVA B;  2K52 A;  2OWO A;  1UE5 A;  2PI2 A;  1SLJ A;  1UEB A;  5M3M G;  3T1Y L;  2JJQ A;  1B8A A;  1V43 A;  3HOX G;  2JA8 G;  3CD6 A;  1VQC A;  3RZO H;  4X62 L;  2R7F A;  4LW1 A;  1QZG A;  1WJJ A;  3HOU G;  3CCE A;  2ZJP A;  4JI7 Q;  2NZO A;  1OXV A;  4ALP A;  4IO9 A;  3GTQ H;  3M7N A;  2UXC L;  4DV2 Q;  3I4M G;  1YJN A;  1K0R A;  4YCV A;  1TWA H;  1UE7 A;  1WI5 A;  4DR5 Q;  2AMC B;  4POF A;  3CC4 A;  3RLF A;  3BJU A;  4GN4 B;  3HKS A;  2MFI A;  4XIG S;  4DK3 C;  4BY1 G;  2IHE A;  2OQ0 A;  4QGU A;  3PV0 A;  3CMA A;  2E2I H;  2GVA A;  4X65 Q;  3HOW G;  4AH6 A;  1TWC H;  4BY7 H;  3PUY A;  4NXM Q;  4QIW E;  2JA9 A;  2HQL A;  2YTV A;  4GN5 A;  5IYB H;  4X64 Q;  3A5U A;  4BA2 I;  2UXB Q;  1K3R A;  3S24 A;  2HIX A;  3EN2 A;  3OTO Q;  3A0J A;  4PG3 A;  2E5L Q;  2YU9 H;  4O2D A;  3VDY A;  1Z9F A;  1Q46 A;  1L0W A;  1MJC A;  4TQU S;  4AIM A;  1J5E Q;  2RF4 A;  5C3E G;  3F2B A;  1TWG H;  4A3G G;  4R4Q A;  1JB7 A;  3A5Z B;  3RNU A;  4JBJ A;  1X65 A;  1Q86 C;  4JI7 L;  2VL6 A;  4YHH Q;  4JYA Q;  5FLM G;  1CSQ A;  4P73 A;  4DV2 L;  1VQD A;  1M1K C;  1I6H H;  1CKO A;  4UY8 C;  4A3I G;  1X3F A;  2JEB I;  4DR5 L;  1N33 Q;  1HR0 Q;  5M3F G;  4P71 A;  2UUC Q;  2I5L X;  5EAY A;  3AQQ A;  4DR7 Q;  3FHW A;  3AYH B;  1YHQ A;  1SFO H;  3PIO A;  2KCM A;  4YY3 Q;  5LMN L;  2LXK A;  4X65 L;  4LF7 Q;  5J3B A;  2UU9 Q;  4X64 L;  2UXB L;  1MKH A;  1UE6 A;  4A3M G;  3OYY A;  3OTO L;  4JI8 Q;  2E5L L;  4LWC A;  4A4I A;  4DUZ Q;  3ULL A;  5IP9 H;  1VQ5 A;  2XTI A;  3KDF A;  1A63 A;  2Q2T A;  2NVQ H;  1UE1 A;  2VY3 A;  4LF6 Q;  1J5E L;  3D31 A;  4NB3 A;  3GO5 A;  2JEA I;  1YHB A;  3UDF A;  5GAH C;  1VQN A;  1NMF A;  4YHH L;  4AQY Q;  3KYH C;  1OTC A;  3H0G H;  4IPG A;  1YIJ A;  2NN6 G;  2AWO A;  4H02 A;  2FXQ A;  4Y7N H;  2EQS A;  4KHZ A;  4BBR G;  4PZ7 A;  4C2M H;  3STB D;  3K81 C;  5M3M H;  5M5X H;  1CKN A;  3HOX H;  3DLL A;  1HR0 L;  1N33 L;  2JA8 H;  3HOY G;  1FJG Q;  2UUC L;  1CSP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...