1WCMG

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wcmG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1wcmG01
4JI3Q 1XNQQ 3CCEA 3RLOA 3TQYA 3H0GG 2R92H 1AE2A 4JYAL 3U4ZA 1NTGA 2K5HA 4OWXB 4DPGA 1HZBA 1IBMQ 3CCUA 2V1CC 2E5LQ 1SRUA 1QZHA 4JI7L 1OXUA 2K52A 3E9HA 4KHZA 4JI5Q 4A3JG 4DV0Q 4AQYQ 2ID0A 1X3FA 4QIWE 4DR1Q 1RIPA 2UUBL 2F4VL 4GNXA 3S17H 4TVAB 2WP8J 1YHQA 3M7NA 3G4SA 1A62A 1Q86C 4JI8Q 2UXCL 4BA1I 5IYDH 4GNXC 3UDFA 1Y14B 2UUBQ 3E9IA 4QJFA 2F4VQ 4BBSH 4JI6Q 2GVBA 5M5YH 4JI2Q 1TWFH 3L0OA 2K4KA 3CW2C 4BXXG 1FVIA 4DR5Q 1NY4A 3GTOH 2MFIA 4LUVA 3KFUA 1FGUA 1YHAA 5C3EG 4A3MG 1KRTA 2VQEQ 2VUMG 4LW1A 3FKIG 2EIFA 1KHIA 3HOXH 1Y1VH 4DUYL 1YJNA 1HR0Q 3TEHB 1VQIA 1TWCH 3CC4A 4DR5L 2N3SA 4LF5L 3S16H 4LFBL 2LXKA 3D0FA 1L1OB 4QGUA 1T9HA 4PG3A 1N33L 1X3EA 1A0IA 4YCVA 3CF5A 3J7A5 4ME3A 2NVYH 3M9BA 5IYDG 2PMZE 1IZ6A 1KD1C 1L1OA 1N36Q 4C2MH 3AEVA 4DR6L 2ALYB 4QL5A 1I94L 1ASYA 4BBRG 1QVFA 1R9TH 4BXXH 3IRBA 5C0XG 1D8LA 3RZDH 1IBLL 4LFCQ 3TS2A 1CKNB 1NMFA 1S3OA 2OQKA 4DNIA 4A3GG 2VUMH 2Z6KA 1VQJA 1X3GA 2IT1A 3FKIH 4A3EH 3EIVA 1OXVA 2JA6H 3RLFA 4DKAC 2UU9L 2Z0SA 4X64L 2JEAI 4JV5L 4RG1A 4XTCS 1IBLQ 1HR0W 4NXML 2XTIA 3S24A 4B3RL 2YTXA 3AYHB 1KIXA 2JA8G 4HJ7A 1E1OA 3CXCA 4IPHA 1XMQL 4DV6L 2UU9Q 4JBMA 2Y0SE 2ZTEA 1L1OC 1KRSA 5LMUQ 1A63A 1GVPA 1D7QA 4DV3Q 5ELNA 1PVOA 2MO1A 4LF6L 3J7ZC 3PUXA 4UP7A 1U0LA 3KJOA 3CC7A 1XMQQ 4NB3A 3A74A 1S40A 1UWVA 2NN6G 4YCUA 1W2BA 2EXDA 1WOCA 4JYAQ 2JE6I 5M3MG 4MZ9A 1PH3A 4JI0L 4A3GH 2B63H 5M5XH 4LF6Q 4Y52H 2BA1A 1KC8C 1XTDA 5GAEC 1EWIA 2YYZA 3T1YQ 3U50C 1P16A 5FJ8G 2E2HH 4A3BH 4JI0Q 5IWAQ 2K5VA 1Q8KA 2E8GA 3NENA 3ERSX 1FL0A 3F2BA 5M3FG 1SLJA 1X65A 3KDFB 4JI8L 2UXCQ 4C3HH 4JI3L 3TS0A 4O2DA 4AH6A 5LMNL 1X54A 2K75A 3U4VA 2A19A 2D0OA 4DAYB 3S1MH 5JEAG 3PIPA 1VQKA 4A3LH 1IBML 2E5LL 5GADC 3TRZA 4A3KG 4OWWB 4JI7Q 1C7YA 2CQOA 1X56A 2B3GA 1K8AC 4DV0L 3PGZA 3STBC 3PF5A 1GM5A 2GN5A 3CCVA 4DV1Q 2B63G 2AKWB 2I5MX 4DV5Q 2WAQE 2AWNA 4YWMA 1VQPA 4LF7L 3HOUH 5FJ8H 1Q81C 2R7ZH 4A3BG 1N32L 4LF9Q 2KBNA 1UE6A 4GN3B 4DV1L 1VQHA 4JI1Q 2JA7G 1Z9FA 1PH2A 4QQBX 4OONA 4LFAQ 1VQ6A 1WJJA 1UEBA 1YNXA 3UDIA 2VQEL 3K7UC 1N8RC 4POGA 1N32Q 3A5ZB 3B6YA 4R4QA 4BY1G 1X6OA 1J6QA 1Q46A 1TXYA 3EN2A 1YJ9A 4QY7A 2WB1E 4LNQA 2HHHL 2R7FA 1C9OA 3M3YH 4LUZA 1U5KA 1X55A 1PH5A 4EX5A 3CCLA 4X6AH 1K8GA 2KHJA 3HFZB 3H3VI 4NXMQ 5GROA 4JCVE 2HHHQ 1O7IA 1B70B 4OXPA 4JOIC 3G6EA 4X62L 3CCSA 1HNXQ 2DUDA 1KAWA 1QZGA 3KF6A 1VQ7A 1VQDA 1Q12A 2JA5H 2WFWA 2AMCB 1FJGL 4GN4B 1PYSB 1K83H 4DV3L 1BKBA 4R4IA 3ER0A 1VQOA 1HNXL 5IY0A 4X62Q 3CCJA 2N49A 2VZAA 3PV0A 1UE5A 2PQAA 3PIOA 1VQMA 1XMOL 3KF8B 4A93G 3MXNB 1XPUA 4JV5Q 3JAMc 4JBKA 1OXSC 2GVAA 2OWOA 1PH8A 4JG2A 1EIYB 2VW9A 4UPAA 2VQFQ 2R93G 1HNZL 3CD6A 1EQQA 4B3TL 4GKJL 2I5LX 1Z47A 3S2HH 5C4XH 1QVCA 1VS0A 1E3PA 4A4IA 3PUYA 3J81j 1WCMH 1GO3E 2VQFL 3ULPA 2A1AA 2D0PA 3FP9A 5LMNQ 4DV2Q 2JA5G 3HOWG 3DLLA 4FDBA 2K5NA 1VQNA 5IP9G 1HZCA 3HKZE 1XNQL 4A93H 3ICEA 4DK3C 3T1YL 1PFSA 2F52A 3W5OA 3BZKA 4PZ6A 5LMNW 4GLAC 2Y0SG 4KLKA 2I0QA 1VQBA 2I5HA 4OO1I 2RF4A 1H95A 4A3CG 2R93H 4IJLA 3GTPH 2IX1A 4L5TA 1CSQA 4DR1L 1YZ6A 5JEAJ 3K0XA 4LF9L 3M4QA 4O0AA 1PYBA 4GLVB 3F8TA 4DV4L 5C4XG 3PO2H 3M85A 2KENA 2NVTH 1WCMG 3HOWH 4YY3L 3ZJYC 5IE8A 2KHIA 1WYDA 3STBD 1MIUA 3HOVH 1CKNA 3H0GH 2R92G 3Q8DA 4DR3Q 1Q7YC 2UUAQ 2NZHA 5J3BA 4YY3Q 1TWHH 2QEXA 4R1JA 1G6PA 2QGQA 1YBYA 4Y7NH 3RNUA 4YWKA 3JAMi 1OXXK 1NBWA 1YHBA 1BBUA 4JI1L 4HIOA 1CUKA 4GOPA 3F2DA 2PI2A 1DGSA 3KDFA 2PI2E 1HZAA 2JQOA 4HJ8A 1N33Q 2JEBI 2YTVA 2JJQA 1VQGA 3CAMA 4P75A 2LXJA 1SE8A 1N36L 2MO0A 1SFOH 5IYBH 2AWOA 3RN2A 5GQOA 4HIDA 4IOAA 4TQUS 5C3EH 4YCWA 4A3MH 4LUOA 1SR3A 4LFCL 2OCEA 4HJ5A 4LFBQ 4WJ4A 2R7DA 3HOXG 4HJAA 1Y1VG 4NXNL 4B3ML 2UXBQ 3UE0A 2RCNA 3EBEA 4JI4L 2OTJA 4HIKA 1X9NA 3RLNA 1IL2A 2NZOA 2Q2HA 4IOCA 4LWCA 2VS1A 4IFDG 1HNZQ 4HJ9A 1AH9A 3JC66 4JBJA 4B3TQ 2ASBA 3H15A 1HNWL 4B3MQ 5C0XI 2NN6I 1NJIC 3KOJA 1MKHA 5IYCH 1L2FA 2ZM6L 3UDGA 3GTKH 4DV6Q 2YU9H 4AYBG 4DV2L 3I7FA 3TREA 3W1BA 4UP9A 5IYBG 3CP0A 3J81c 3NBHB 1VQLA 2KCTA 1P8LA 1BBWA 2YV5A 4UP8A 2JK8A 4L5QA 3J80i 4A3EG 1HZ9A 5BR8L 3S1RH 1ASZA 2A8VA 1YVCA 2JA6G 1M90C 5M5WH 5C44G 1VQ8A 4A3JH 4OO1G 3RZOH 1I6HH 1V1QA 3PCOB 1I5FA 1XNRL 4KHPQ 3GO5A 1JB7A 2PNHA 4C3IH 1YI2A 1LTLA 3G48A 4GOPC 4DV4Q 1Q1EA 2QA4A 5GAGC 4L5RC 4BBSG 4K0KL 3CCRA 4EQ5A 1Y1WH 3KLWA 4P71A 3GD7A 3OYYA 1S72A 4X66Q 4A3IG 3KJPA 3F1ZA 2AHOB 1V9PA 4A3FG 1JT8A 4K0KQ 4JI5L 2OQ0A 2N78A 3LGJA 3ULLA 4DV7Q 2ZJQA 1N34L 5C44H 4J15A 1A8VA 2JA9A 2K50A 2CWAA 2IHFA 3K8AA 4LF4L 4HIMA 3CMAA 4LF7Q 3HKZG 3KF6B 2HT1A 1VQCA 3A0JA 1G51A 2Q2IA 1OTCA 4DV7L 1QVGA 5IP7G 3U58A 1K3RA 1M1KC 3HOYH 1UE7A 1SMXA 4LFAL 1HH2P 1Y1WG 4GKJQ 4DR2Q 3E0EA 4BBRH 2IX0A 1CKMA 4A3KH 4DR4Q 3PUVA 5K36G 4X65Q 3PUZA 2UXDQ 4A3IH 4A3FH 5EAYA 1GKHA 5H1SE 2OTLA 3I4MH 1YEZA 2ZJRA 4YHHQ 2UUCL 3PO3G 2VNUD 4DR2L 4IPCA 3GTMH 4BY7H 1I50H 4DK6C 3W1GA 1HJPA 1B7YB 4MNOA 1XPRA 2LSSA 3HOUG 2R7ZG 1PHJA 1RL2A 5JJKA 1QUQA 2BH2A 2CFMA 1B8AA 1EQRA 4NPSA 2H5XA 5IP7H 1J5EL 4B3SQ 4DR7Q 1GD7A 3J80c 1BVSA 3HOYG 3AFQA 3ULJA 3K81C 1FJGQ 4JC0A 3GTGH 2UXBL 4BY1H 4NXNQ 4PZ8A 4JI4Q 2CKZB 2RHQB 1OXTA 3DM3A 5M3MH 5JJLA 3GTQH 2DGYA 3I4MG 4KI0A 1JJ2A 3PO3H 1HNWQ 2ZTCA 2FXQA 3D31A 4BY7G 2L15A 1W3SA 1PA6A 4B3RQ 1NE3A 2B29A 2EQSA 2ZM6Q 2BH8A 3GTJH 3L7ZC 5FLXc 3VDYA 4KHPL 1C0AA 1K0RA 4JOIA 5ELOA 5M3FH 2E2JH 3G71A 4A76A 3S1NH 4DUZL 1IBKL 3CCQA 3M4OH 1WFQA 1VQ5A 4A75A 4P74A 1E1TA 3I4OA 1VQ4A 1YITA 2E2IH 4A3LG 3K7AH 5BR8Q 1YIJA 1MJEA 4X66L 2K14A 3UE1A 3HKSA 3HOZH 4GKKL 1NMGA 3I4NH 3CQZH 1SROA 4UY8C 4IPGA 3F2CA 1XNRQ 3K80C 2ZJPA 2IY5B 1MJCA 4GLXA 1K73C 4PZ7A 3S2DH 1E22A 2WAQG 5IWAL 4GKKQ 3CPWA 1XPOA 4IPDA 5HY6A 3PSIA 1Q82C 1KQSA 4AQYL 3A5UA 1EOVA 2JA7H 4IO9A 1PV4A 2ATWA 5IT9c 4IFDJ 3RN5A 3L2PA 5AJ3Q 1TWAH 1L0WA 2Q2UA 4P73A 4LF8L 3OW2A 3S15H 4OWTB 3UDXA 4GNXB 2C35B 3AFPA 2D62A 1JJCB 2HIVA 4C3JH 5GAHC 1K9MC 4DR4L 3HOZG 4P72A 1VQEA 1N34Q 4IJHA 5HGQA 3I4NG 4DR3L 2UUAL 4JI2L 1JJGA 4LF4Q 1KL9A 4R4CA 4DV5L 2WB1G 1PH6A 3CMEA 4LF8Q 4YHHL 2UUCQ 3CPFA 5E7NA 1PH4A 1EIFA 4GS3A 4A3CH 3OTOQ 3S14H 4R4OA 3I2ZA 4JBWA 3SGIA 4DUYQ 2F3IA 1E24A 1I3QH 4YWLA 1HR0L 3H3VH 4A3DH 2BA0A 3M4PA 4WJ3M 1AE3A 3PO2G 4OX9L 3OTOL 4X65L 1VCIA 2KCMA 4B3SL 3I56A 4JI6L 2UXDL 2RHSB 3HOVG 1JMCA 4RMFA 2NVQH 3J81i 1YJWA 1G291 1XJVA 4OX9Q 1I94Q 4BA2I 4IFDI 1KXLA 2Q2TA 3WWVA 3S1QH 5C4JH 3AQQA 4LF5Q 2VY3A 1IXRA 2HQLA 3FHWA 5C0XJ 2NVXH 1EYGA 1LUZA 3CC2A 4MTNA 1PH7A 1VQ9A 1J5EQ 2CCZA 4ALPA 4DR7L 1Q1BA 2HIXA 4A3DG 1CKOA 5FLMG 1UE1A 3PF4A 2ES2A 4DR6Q 3BJUA 2CWPA 2MNAA 4GOPB 1E7ZA 2VL6A 4R4TA 1JE5A 3RR5A 2Z6KC 1LM0A 4PMWA 1XMOQ 1PH9A 3GDEA 5IP9H 3GTLH 2MQHA 3BU2A 2N8NA 4XIGS 3T1HL 4AIMA 3NEMA 5DLQE 4POFA 2JA8H 3PUWA 1LYLA 2YTYA 1WI5A 1EFWA 4X64Q 2PQAB 3CCMA 4L5SA 1CSPA 2XGTA 1EUJA 3I55A 3T1HQ 4DUZQ 1SN8A 1PH1A 2IHEA 1IBKQ 4GN5A 1QUQB 1IYJB 1N9WA 3KYHC 3BZCA 5FLMH 3MEFA 4DAMA 5LMUL 5IYCG 1VQFA 1V43A 2ZTDA 4H02A 4APVA 4AYBE 5JJIA 2R6GA 3NELA 5AJ3L 1VQAA 1TWGH
chains in the Genus database with same CATH superfamily
1XNQQ 1DV1A 4ODGA 3T1HH 3H0GG 4JYAL 2L0CA 1N32H 5ELDA 1NTGA 2K5HA 1FJGH 3I4MB 2E5LQ 1V1OA 1EY4A 1QZHA 4JI7L 1LABA 5EZYF 4O4IF 4AQYQ 2ID0A 4DL3A 2UUBL 4QIWE 4J9PA 1B9MA 1LT6D 2WP8J 4MV4A 3M7NA 4RAYA 4BA1I 5IYDH 5ISRA 3UDFA 1IKMA 4BBSH 2R84A 3E5SA 1A15A 2GVBA 5KYIA 3SE0A 1RODA 1NR2A 3L0OA 3CW2C 4DR5Q 2WAQA 4LUVA 2BR0A 1KRTA 3MXNA 2VUMG 5JAVA 4LW1A 1ICFB 5BR8H 1PMRA 4DUYL 1Y1VH 3TEHB 2A69C 1TS3A 1KEEA 3D0FA 2N55A 4J9QA 4QGUA 1T9HA 4PG3A 1N33L 3MWYW 3MFHA 2A68D 2NVYH 3M9BA 3VYTA 5D65A 4RGNA 1KD1C 1L1OA 3LMLA 2RDGA 2DWCA 2NYZD 2FKLA 4K0KH 2NUCA 1PRTC 1ASYA 2PQEA 4CKBA 2DJFC 1QVFA 1DOKA 2NUAB 4EG0A 1QWYA 3EQLC 2W6NA 1A2TA 1NMFA 2OQKA 4HR7B 4L6TB 2WB1B 2KUMA 3BYYB 2IT1A 3J7AV 4C2MB 2HDLA 4DKAC 2P0AA 4O4HF 2Z0SA 2JEAI 4JV5L 4RG1A 3J7AK 1HR0W 5E4WC 4NXML 3S24A 4B3RL 1RJPA 1K8MA 3HP3A 2JA8G 1E1OA 2XNAC 3TN2A 4IPHA 2NWGA 4N9TA 4DV6L 2BCOA 4IN3A 1CM9A 5LMUQ 2ZJTA 2R8HA 1KRSA 1A63A 1GVPA 1I7LA 3SK8A 3KLRA 2W9CA 2R8KA 1XMQQ 3Q8PB 1CHQD 2IJ0A 2I87A 1N48A 1WOCA 5M3MG 5DG9A 4MZ9A 1FNVA 4FU0A 5KT5A 3L4KA 1S5BD 3WO1A 5M5XH 4C1NK 2AGPA 4Y52H 3KLSA 3H20A 3MWDA 3BAAA 1C4QA 3U50C 4O3PA 1P16A 2CZGA 4LAAA 4OGQC 1H9RA 1PTOH 5M3FG 1ENFA 1X65A 3KDFB 4UAIA 1GGOA 4ZOLF 4C3HH 5JOBA 3TS0A 4O1NA 4UHVA 1X54A 4DAYB 2A19A 2D0OA 3GV7B 2C2RA 3Q1KA 1PRTD 4F7XA 2R7LA 4JI7Q 2EJGC 2Q8IB 1GM5A 1MD2D 3G6YA 3EA6A 3CCVA 4RZQA 3IN5A 1T94A 2AKWB 3M4OB 4YAJB 2I5MX 1QJOA 5CV6A 4YWMA 1EZ6A 1FNWA 4EVOA 4DV1L 1VQHA 4JI1Q 3Q6SA 4IWXA 4ZUIA 4LFAQ 1K1SA 1UEBA 1YNXA 3VR3A 2PYKA 1N32Q 4C3JG 2FLLA 2EY6A 1J6QA 1Q46A 2AU0A 4LF9H 5L37A 3I73A 4HNTA 1Q8IA 2WB1E 4LNQA 1S0OA 1IYVA 1ZHSA 5KFUA 2A5HA 2QEJC 3AB9A 2K5QA 2CH4A 1U5KA 5EQ0A 2P5ZX 4IRDA 5C44B 3I3CA 1A3UA 2KHJA 3CKIB 3H3VI 5GROA 3RUZA 5JH7F 1KABA 4CKEA 5CV8A 2ASLA 5KRUA 2HVSA 5FLXW 1TWCA 5AFWA 1A9XA 3TQ1A 2PNRC 3RB3A 5IY0A 4X62Q 4R8UB 3PV0A 1VQMA 1ICWA 3KF8B 4JV5Q 1XPUA 4PDBA 2GVAA 5I2XA 1PH8A 1CI3M 1D2BA 1BNCA 4XYLB 2VQFQ 2R93G 1HNZL 3Q8RB 1PZID 1O7YA 1EQQA 4B3TL 4FF3A 1EUDB 2I5LX 1FR3A 4I7HA 5C4XH 1QVCA 1STGA 3H09A 1WCMH 3ULPA 2FMAA 2A1AA 2R3ZA 2JA5G 2FK2A 4DV2Q 1G6ZA 3OMGA 4FDBA 2K5NA 3N41B 2F0QA 1EZ1A 3K5HA 1SYCA 1H9MA 4ECYA 3QZ8A 4A93H 2DNCA 3MAQA 3S2HB 2W9CB 2AQ3B 4DK3C 1JCKB 2L4NA 3KALA 3X3MA 1BCPB 3NUCA 3W5OA 2PO4A 4KLKA 4OELB 4WBNF 3H4BA 4OO1I 2I5HA 2RF4A 2QDBA 2PBZA 2YRXA 4HNVA 4IUVA 4DR1L 5KG2A 4HCSA 2ATLA 1FNUA 3M4QA 1PYBA 5CR3A 3P20A 4DV4L 4EFBA 3M85A 3HOWH 4YY3L 1EQTA 1LT4D 3NE5B 1ENCA 3QO2A 3STBD 1TWGA 5KG4A 3J80E 5CB4F 4N9PA 2R6FA 5CV9A 1SYDA 4DAPA 4DR3Q 1Q7YC 4E6IA 2NZHA 2UUAQ 4UFZA 5J3BA 1DONA 3A56A 5DQGA 1JXLA 5KNBA 3D4WA 2KEDA 1RTOA 1YHBA 2JA5B 1BBUA 2R82A 1B44D 2V4DA 1SNDA 3IKJA 1RJQA 1HZAA 1NR4A 3ND8A 5JPMC 2JEBI 1L0XB 2YTVA 1II3A 3SVMA 1I4XA 3BVGA 3PR4A 5KFRA 3BG5A 3KHLA 1SFOH 4LF4H 1XNQH 4HIDA 1I4QA 3MVVA 4LUOA 4O3OA 3ORRA 4ME5A 2B63B 2R7DA 4X3KA 1Y1VG 3UE0A 1HUMA 5KNCA 1IBMH 3CU7A 2IL8A 4HSPA 2FPIB 3CQZB 5K2MA 4IFDG 2VS1A 1LTBD 4R8UA 4JBJA 2ASBA 4KMUC 3HB9A 2EYJA 1A2UA 4DN4M 3EJIA 4DV2L 3FPUB 3TREA 5IYBG 4CGYB 5JJZA 3J81c 3NBHB 4U7CA 1PFNA 1SJED 2XSCA 1I50B 4ZRZA 3J80i 5IGGA 4MV6A 3S1RH 2VUMA 1VKZA 2J6UA 3U9OA 5C44G 4JVZA 3GV5B 2I46A 5KFMA 1I6HH 4PWQA 4MA5A 1I5FA 2I8CA 4CC6A 2PNHA 2A74C 3TP5A 5IGDA 4GOPC 1B3AA 4DNTB 1Q1EA 2IWHA 5GAGC 5CAEB 1E4EB 1S9FA 2D9UA 4MV1A 1WTVA 4P71A 3GD7A 4A93B 3OYYA 3M4IA 4TV8F 4X66Q 4A3IG 1I6VC 2VQDA 4L8JA 4ME6A 2FINB 1UEAB 2Z1CA 2PMZB 1DM0B 2XRSD 1JWSD 4DV7Q 1N34L 4J15A 5KFGA 2K50A 2CWAA 3HKZG 1TAEA 1E2VA 1SE4A 1VQCA 4C3HG 1OTCA 4DNRB 4CJ0B 3TP6A 1XMQH 1JLLB 2GLTA 1HH2P 1KNEA 5KT6A 2F0NA 4QW8A 4DV0H 4BBRH 2IX0A 3TZDA 5DAUA 5K36G 1MSGA 1Z2OX 4A3FH 4F88A 2YL2A 1GKHA 5HGTA 3I4MH 2O4XA 2UUCL 2WDTA 1SAPA 4IPCA 5C4HA 3GTKB 1Z2NX 5EWFA 1HJPA 1B7YB 2MJ8A 4NP5A 4ECWA 4G3IA 4DF7A 2ZDGA 4Q0YA 2F0GA 3H91A 4J6HA 4NPSA 1A6XA 1XTCD 5LHY1 3S9WA 3RJ0A 5IP7H 4DR7Q 1EFID 1GD7A 5LL6S 3J80c 1BVSA 3HOYG 3K81C 4DUZH 4JC0A 1A3TA 3GTGH 2UXBL 3KF8A 5JVLA 2RHQB 4I7ZC 4XQJA 4K5VA 3S1QB 3N43B 4C3HB 1MGSA 3R2TA 4BBRB 2R7MA 2YZMA 5DNFA 5EPJA 2ZM6Q 5A2QL 2BH8A 1AUVA 3L7ZC 4H0LC 5FLXc 5KFFA 1K0RA 1LT5D 1PRTF 3V6HA 2N88A 4QWEA 4H7BA 1IBKL 3CCQA 2ENBA 3MWMA 4A75A 3PW7A 3KLSX 1YITA 2SNMA 4A3LG 2F4VH 1XXGA 4X66L 2K14A 3KAJA 1E4FT 5DEHA 5FPOA 3SK4A 2V58A 1F2ZA 4IPGA 4XXEA 5KFVA 2ASDA 1MJCA 3J7AF 1I6HB 3GTKA 3S15B 2FMCA 1XPOA 3S1RB 4KD4A 1SYEA 1STHA 1EWCA 1KQSA 4IURA 4NW2A 1O7ZA 2NBFA 4KY5A 4AYBB 1PV4A 2ATWA 3GIIA 3L2PA 4LFCH 4JK1C 1TWAH 1MI2A 2Q2UA 3IFTA 5KFDA 4B3SH 3OW2A 4OWTB 4F87A 1RJTA 4GNXB 2D62A 1JJCB 4KN4C 4DR4L 1LACA 4J9NA 1N34Q 2XCPA 2O2LD 4CC5A 4IJHA 1N33H 3I4NG 3E6ZX 3FRPB 2QCPX 4DV5L 2UUCQ 2HGSA 4DL5A 1Y1WA 1TWCB 3G7LA 4ED3A 4DUYQ 2F3IA 4A3DH 5D1OA 1GUTA 1AE3A 1ZXTA 2ZT9C 1K0SA 1GSOA 1D5XC 4X65L 2UXDL 1J9OA 1AFPA 1RYRA 1QG7A 3J81i 4A3FB 2DLNA 1G291 2NVYA 4WJWA 3G6JB 4OX9Q 4IFDI 4B9XA 4RZRA 4IRCA 5C4JH 2O5JC 4F50A 3AQQA 1U4MA 5CV4A 4V0BA 1IXRA 2HQLA 3FHWA 4LMYA 3CC2A 1VQ9A 2FJ2A 3DWAA 4ALPA 1Q1BA 1B50A 2RGVA 3MHBA 1UE1A 3NBHA 2RDFA 2E2JB 2B2UC 4Z9CB 4DR6Q 5C6AA 5GONF 4ECTA 3PZPA 4K14A 2LS01 3NTIA 2VL6A 4FVMA 1JE5A 3RR5A 2Z6KC 3M9OB 3GDEA 3GTLH 4C5CA 5KT4A 5KFZA 4MTEA 3GV3A 3GIKA 3OSPA 4DGZA 3NEMA 4POFA 2YTYA 1KJQA 4EEQA 2V4QA 2M2LA 3CCMA 4QWBA 1EUJA 1IBKQ 2IHEA 2CHBD 5KG5A 2W7PA 4RGMA 3KUPA 3SHLA 4FS1A 2K01A 1PYWD 1GXDC 4IHJF 4DV5H 4XT3B 5JVG3 4AYBE 1V43A 4H02A 2NTSA 4RB2C 3RBDA 1EWHA 2EVBA 1VQAA 3E3XA 1HUNA 2NU7B 4FS2A 4FXGC 1T5EA 2ASJA 1WTHA 2CW7A 4OWXB 3EROA 4DPGA 1I4PA 2V5AA 2BE5C 1EHIA 3JSLA 1OXUA 2K52A 4JI5Q 2JA5A 1J5EH 1X3FA 1I4GA 3ONAB 4GNXA 1K3BC 4K5WA 4TVAB 1LLRD 5FO8B 4BWSC 3PMFA 3G4SA 5LMUH 3UI2A 2H4OA 2UUBQ 3E9IA 2F0VA 2UVVA 4JI6Q 4ED1A 4JI2Q 4KKUA 4C5BA 4BXXG 2RGRA 2M00A 3GTOH 3C3LA 3HOUB 5C3EG 4RNNA 4ECRA 4GKJH 3OUZA 1SE2A 2JEFA 3FKIG 2EIFA 5FD5A 1VQIA 3LWEA 1TWCH 1B3QA 2WAQB 1L1OB 1X3EA 1HRJA 1A0IA 1M0TA 3DF7A 4C5AA 5KFEA 2OF1A 3AEVA 1RD9D 1SEBD 2ALYB 3KBXA 1TWFA 2MCTA 4BBRG 1EY6A 1VMPA 2KQ3A 1R9TH 4EFEA 5C0XG 1D8LA 1KJ9A 5DQHA 1ZETA 1CKNB 2TMPA 3V6KA 1S97A 4A3GG 3RV4A 4E4TA 1ZYRD 2B2WC 1OXVA 5DG8A 2JA6H 5EBCA 1CQJB 4XTCS 1IBLQ 5FK9C 3GIMA 2YTXA 3RB0A 4C3IG 4HJ7A 3RD4A 2V9WA 1XNRH 2UU9Q 3JRXA 4ZQIA 5KFCA 2ZTEA 1L1OC 3GIDA 1PTOF 1D7QA 3JZIA 4DV3Q 1D6EC 5ELNA 2NVXA 2MO1A 2J0TD 3D3RA 2G9DA 2PMZA 3PUXA 4UP7A 4HSVA 2LKVA 3CC7A 4NB3A 3A74A 1S40A 4JYAQ 1VBHA 1W2BA 2EXDA 3T56B 2JE6I 1IOWA 1PH3A 3Q0AA 2X0SA 2B63H 4JV2A 5FO7B 2EJMA 2BA1A 2XVSA 4FBUA 1S03G 3C46A 2QYZA 4IR9A 4RUAA 5FJ8G 4ED0A 3UFXB 4DAYA 5F9LA 5IWAQ 3NENA 3ERSX 4DK1A 3F2BA 5BN4A 1SLJA 1K28A 2KCCA 4XYMB 5LMNL 5EBDA 4DV7H 4CDEC 5HURA 5J39A 4IUPA 5JEAG 3PIPA 1TY2A 1VQKA 1IBML 5GADC 3TRZA 4A3KG 3MTSA 4OWWB 1C7YA 2YZGA 2CQOA 2B3GA 2NN6H 4EBEA 1Q90A 3PGZA 3STBC 3K59A 5EDWA 2WIIB 3T4AC 2K04A 5C5LA 3CQZA 3S1NB 1T3NA 1I50A 1JX4A 2WAQE 2AWNA 5A2QE 1SYXB 4LF7L 3N42B 3HOUH 5KG3A 2RDJA 2KBNA 1EUCB 4NMZA 1Z9FA 4DK0A 2AUKA 1PH2A 4OONA 5C4ZA 3VR4A 3NXWA 5FO9B 3TQTA 4PMCA 2K32A 4L63B 3UDIA 1SNCA 3ND9A 1LV9A 3K7UC 3MEHA 4ZUJA 3RB6A 4TKOB 3B6YA 4R4QA 5I9PA 4BY1G 1JORA 1X6OA 4MIUA 2WTFA 3VR5A 2MPMA 4GC6A 5T1GA 5JVH3 1GLVA 4J1MA 3ORQA 4X6AH 1K8GA 4NXMQ 1EY9A 5FPRA 2HHHQ 3VYUA 3OSOA 4C1NI 4JOIC 3G6EA 2BDOA 1HNXQ 1V51A 3GV8B 3Q22A 2B8FA 4CDDC 1VQDA 1Q12A 3G6XA 2AMCB 3QR8A 3FKIA 1PYSB 2EPBA 4DV3L 1DV2A 4R4IA 5C4JB 1ZYRC 1STAA 3PIOA 1UE5A 4Q8EA 1XMOL 3U9SA 1OXSC 1I6UA 4K6DA 1QB5D 4G4KA 2D2CC 5J1ZA 3HOYB 5M5XB 4UPAA 4ED8A 4TV9F 3GLKA 3BA8A 1QNUA 1ULZA 4GKJL 1Z47A 1JWMD 1T5XD 5LA6F 4FF2A 1K1QA 4UCVA 2EYFA 1B33N 1E3PA 4A4IA 3BA9A 4UCRA 5CBAE 5LMNQ 4X64H 3DLLA 3PW2A 1HA5A 1KJ8A 1STNA 1VQNA 1DJRD 3HKZE 3A7LA 2E2HA 3JAML 2B2VC 1PFSA 2F52A 2K1BA 4ZKCB 2Y0SG 1LO5D 2ICEC 1UNSA 2EY5A 2I0QA 1VQBA 2VQEH 2VA3A 1QOHA 2EJFC 2R93H 2IX1A 3PW5A 2XC9A 1YZ6A 5D3IB 4U673 3D4DA 4O0AA 3TP8A 1JE4A 3R8BA 1WTOA 3PO2H 1HFNA 4G7HC 2UVRA 2JP1A 3ZJYC 5IE8A 1G2TA 2JA7B 3HOVH 1UNNC 4U68A 2QDLA 4KTAA 3H0GH 2C00A 2A6EC 4ZAIA 3WDNA 1CS0A 4YY3Q 4K8JA 3BYTB 1Q3LA 1UUPA 3OOCA 1CQIB 5CBEE 1NBWA 4RU9A 3NPPA 1RTNA 2CQYA 2NTTA 4BY7B 1CUKA 3HOZB 1F9QA 2LMCB 2YS7A 4HJ8A 4MV3A 1N33Q 5KG1A 2FPGB 1EY0A 5TSSA 1VQGA 5IYZF 5IWAH 1SE8A 2Z9HA 1KAAA 4A3KB 2F0IA 4XQNA 1TVXA 4EGVA 5GQOA 4IOAA 2X6GA 5C3EH 5KFXA 3L4JA 1SR3A 4LFCL 2OCEA 2HVRA 2UXBQ 4B3ML 4BBSB 3N8DA 3RLNA 1IL2A 5FKAC 4DXGA 4IOCA 3NQIA 4J9LA 5DGAA 5D14A 1HNZQ 1KJIA 3JC66 4B3TQ 1AW7A 2WV6D 2OLSA 2W9AA 3FDSA 2A6HD 1EIHA 2NN6I 3BDLA 4OL7A 3T1YH 1WH2A 2ALZA 1TKWB 3FVQA 5K5PA 1L2FA 5IYCH 2ZM6L 3GTKH 1EYZA 3U9TA 4LF7H 4YJ3F 4F4WA 1CA5A 2EOTA 4FNFA 1JKJB 3RFCA 3HKZB 3CP0A 1WD0A 2YCHA 1QE6A 3KBGA 5IT9E 4J9MA 1BBXC 1S5FD 1D5MC 4L5QA 4GKJQ 1HHVA 1HZ9A 5BR8L 4HMIA 4YB8B 4NXMH 5KFIA 4DR5H 4A3JH 4MTDA 4RB0A 1IHZA 3RZOH 3PCOB 4C56C 3FMAA 4F4ZA 4C3IH 4QCLA 1XDNA 3K5LA 1M4VA 5KG0A 3WOFA 4DV4Q 1RHPA 2YU9A 2QA4A 4I65A 3W2DA 5KFTA 4ABNA 5C3WA 1WD1A 2WKDA 1Y1WH 3GP7A 3GV6A 1GUWA 3GTLB 2AHOB 4LJZC 1TS4A 2OXPA 2RSOA 3OHBA 4K0KQ 4RHSA 4NXNH 2R92B 1WVLA 3NQTA 4RB1A 3LGJA 2YYAA 2E2IB 5C44H 2C2DA 5KG7A 1SSOA 1A8VA 2JA9A 3KHRA 5DM73 3CMAA 1B6RA 4TSSA 1G51A 1BUVT 2Q2IA 3VA7A 4DV7L 3U58A 4B3MH 1K3RA 1GHKA 1Y8PB 2JA6B 1SMXA 4O42A 4LFAL 5KG6A 4DV2H 2K33A 2LFNA 4DR2Q 5EKKA 2XWBB 4DR1H 2SCUB 4X65Q 2UXDQ 4A3IH 4KJOA 2HCIA 3N40P 3PR5B 1VF7A 2OTLA 1PLFA 5DQIA 2L55A 3PO3G 2R7KA 2W6PA 3TDQA 3GTMH 5E1FA 4IUNA 5LP6F 4X3TA 4DK6C 3GTLA 3HS0C 4MNOA 1XPRA 2LSSA 2L5TA 4IQZA 2XCAA 4JV5H 1KNAA 4XYQA 4I50F 3SXHA 3RV3A 2CFMA 1B8AA 1EQRA 2GPSA 1X3QA 5D8DA 2H5XA 1ESRA 4B3SQ 1TY0A 2G5DA 1FJGQ 1M8AA 3PVXA 2CKZB 4DV4H 3A8IE 3DM3A 3GTOB 4EBDA 4V190 5JJLA 3GTQH 2DGYA 3ITPA 4RHRA 3RGXA 1BDOA 2WB1A 2B2YC 4A3DB 3D31A 4BY7G 2L15A 1W3SA 4B3RQ 3KXYT 5C8YF 3PN1A 4F8MA 1NE3A 3HKZA 3GTJH 3VDYA 1YNNC 2F0DA 4YJ2F 2E2JH 3I90A 4X3SA 4DFAA 1U4PA 4JI5H 4U6PA 1AN8A 3MWEA 3SR1A 1E1TA 3I4OA 1NSNS 4ZHQF 4EEYA 5BR8Q 1YIJA 1NCVA 4HNUA 4LFBH 3HKSA 4GKKL 4ULLA 1SROA 1ZEQX 2ZM6H 1B6SA 1HNZH 2IY5B 5KFJA 3S2DH 2AGOA 1LTID 2F0SA 5COYA 1E22A 5KFAA 3GTOA 2YRWA 1TIID 4IPDA 1PTOC 1WTQA 5KFKA 3J80W 1NNXA 1BCPD 2JA7H 3I12A 2JA7A 4IFDJ 1SYBA 3J81E 1L0WA 1JOKA 3K58A 2E2IA 4P73A 4LF8L 1RK6A 5KFWA 3IFDA 1K9MC 3AFPA 3OPOA 2SNSA 5HGQA 3GTGB 3NTKA 4DR3L 5EKIA 2UUAL 4JI2L 2RQXA 4J9KA 1KL9A 4F4YA 2WB1G 1TA8A 3VMMA 4GS3A 3OTOQ 2NU6B 3S14H 2EZVA 4JBWA 1HR0L 4YWLA 1SCUB 2W71A 3K3PA 4FXKC 1S68A 3M9MB 4M8AA 4LF8H 1O78A 5T1IA 5LL6b 3HOVG 1SE3A 1JMCA 4RMFA 1KC7A 3QOJA 2RSNA 3J80L 4EBCA 2K6AA 1XJVA 2QILA 4BA2I 2Q2TA 2K05A 1TT2A 3S1QH 1XMOH 3NBIA 4JI8H 2F4IA 3QB3A 5EGTA 3H94A 2VY3A 3BDOA 4ZK9B 4LFBQ 2NVXH 1PH7A 1RF2D 2JYOA 2XIWA 4S3SA 4CHTB 1TWGB 2W9BB 3A8KE 4A3DG 5NUCA 4GKKH 3OWEB 1EYDA 2QF7A 1WCMA 1EL0A 5KT2A 4B08A 1IOVA 4I55F 2JN4A 3K5OA 5D1PA 1E7ZA 3MFIA 2W8LA 1SNOA 1S10A 4R4TA 4PMWA 3W3AA 1Z6HA 5JVDF 2MQHA 2EYPA 1Y8OB 3BU2A 4ZLTF 3N52A 1IL8A 3PO3B 4AIMA 2D5DA 1B04A 3PUWA 2F1MA 4QIWA 4R8IA 4J9OA 2JA8B 4X64Q 2PZWA 4L5SA 3I4LA 2F3VA 1CSPA 2XGTA 3T1HQ 3H4DA 1SN8A 4A3MB 4QUCA 1W93A 3NWTA 3T16A 1N9WA 4DAVA 5FLMH 1CK1A 5IYCG 1H9SA 2ZTDA 5KIXA 1AUXA 4G7OC 3NELA 1XWEA 1TWGH 3PW0A 4IUUA 3I8ZA 3RLOA 2R92H 1AE2A 5HBRB 3U4ZA 4L1KA 3RIZA 3C0FB 2R92A 1WR2A 3D6CA 2VPQA 3J7YW 1JDEA 3L3OC 1HZBA 1IBMQ 1SRUA 4X65H 2UXDH 3HEJA 4EYIB 3PW4A 4A3JG 4DV0Q 1JOQA 2F4VL 2E76C 3S17H 5IIFA 4IZ8A 2Q8RE 3BVMA 1Q86C 1A62A 4JI8Q 2UXCL 1R4PB 2DPIA 4QJFA 5M5YH 1TWFH 1GOZA 2FP4B 4UCUA 2K4KA 1SNQA 3KHHA 2MFIA 3KFUA 4A3MG 1LTSD 2R7ZB 2NVYB 4J0MA 3H40A 2IW3A 1YJNA 3HOXH 1A3VA 1MHWC 1STEA 2RKSA 1HR0Q 3KAKA 2M9VA 5IOCA 3CC4A 4DR5L 2N3SA 3DHQA 5D3DA 5I4DA 3LNNA 4O3NA 4YCVA 2ZXRA 3CF5A 3J7A5 1FYCA 5IYDG 5KFBA 4EQOA 1IZ6A 4DR6L 1N36Q 4C2MH 2K5WA 4Y7NB 2NVTB 2AGQA 4A3JB 1JICA 2LY7A 3DUZA 3IRBA 1F9PA 2B2TA 1S3OA 2E2HB 3P1HA 4DNIA 2EYHA 2VUMH 2Z6KA 1VQJA 1X3GA 3FKIH 1H9KA 3CRLC 3ZYYX 4A3EH 1DD2A 2B63A 1WTXA 3K7AB 4FF4A 2B2UA 1DXMA 3AYHB 1KIXA 1ML0D 4GC7A 2J6SA 2OT2A 3CXCA 1XMQL 5KNDA 2Y0SE 1V1PB 2XRQD 4QWDA 3TIIA 4K2KA 4LF6L 2WACA 3J7ZC 3TIGA 3KJOA 2XGPA 1UWVA 2FPPB 4YCUA 3R5HA 2NVXB 3WOEA 4JI0L 2EY1A 4A3GH 1TWAB 2UUCH 2ICIA 4NLGA 4YR0A 3MXPA 5KT7A 1HTLD 4BY1B 2BQ3A 4HCEA 5EWEA 2E2HH 1VF5C 3V05A 4A3BH 3DXJC 1D1IA 2E8GA 2K5VA 2JA8H 4X62H 1FGBD 2F0FA 2F0OA 4JI3L 1BOSA 4O2DA 3RB4A 3MR2A 1W6KA 1EEFD 3U4VA 3S1MH 4JI4H 4JV1A 4A3LH 1C3OA 1KBLA 4YIJA 1PFBA 5LXTF 5J2UF 1K8AC 4DV0L 1GUOA 2GN5A 1G91A 4KD3A 4PQXA 4M7EA 2B63G 1NAPA 4DV5Q 1SJHD 2ZXOA 4I4TF 3OHXC 2NU8B 1Q81C 2R7ZH 5IGEA 1N32L 4LF9Q 4GN3B 4O2BF 1S4ZA 4R7RA 3JRWA 4HYKA 5DG7A 1SFOB 4QQBX 5IGCA 1WJJA 2VQEL 1N8RC 3A7AB 4POGA 3GTPB 5L1LA 1YJ9A 2R8GA 4BWGB 4QY7A 3Q8SB 5KGUA 5JUMA 4FO2A 3QZ7A 4EQNA 5DLGA 1YNJC 4LUZA 5KFHA 3TINA 2SOBA 4UDUC 1ENAA 2XWJB 3VYSA 2YU9B 4OXPA 1O7IA 1B70B 2MP1A 3BVZA 4K5XA 4CJ1B 4X62L 3CCSA 1QZGA 2FK1A 1I3QA 3KF6A 2A68C 4QF4A 2Y0SB 1JDBB 4GN4B 2QKIC 2B2YA 1K83H 3ETJA 1BKBA 3ER0A 1HNXL 3K6OA 3CCJA 4DR4H 4ETSA 2VZAA 1KDBA 2PQAA 4A93G 3AU7A 2VUMB 4G57A 3JAMc 4H13C 5C4XB 2L12A 4KY7A 4JG2A 4KY6A 1EIYB 2ZDHA 4F4XA 5DLFA 3CD6A 3E5NA 3S2HH 4LK1C 4OEMB 4XYOA 4RH6A 4ECVA 4ZI7F 3DM1A 2DNEA 2J4XA 1JR0D 2B8GA 3J81j 2VQFL 1TWAA 5T14A 3D8GA 2WYOA 3VPCA 2FLPA 2DJGC 1AEXA 5I6YA 4ECUA 1HZCA 2J6TA 4B3RH 5C1OA 4HAEA 3QIAA 1XNQL 3RAQA 1HNWH 3ICEA 3A55A 1PZJD 4PZ6A 5LMNW 4GLAC 5ELBA 2VOBA 3DEPA 1H95A 4A3CG 4IJLA 4C3IB 2HUGA 4DR7H 1CSQA 3K0XA 2DZDA 4GLVB 3F8TA 4YP3A 5C4XG 1TWFB 3GTMA 4IRKA 2KENA 3P75A 1WCMG 5M5WB 1DCZA 4A3BB 3BQ1A 2R8JA 5L9XA 5EKLA 2VA2A 4AYBA 1MIUA 1CKNA 1GHJA 3RZDB 3R5FA 3FMCA 1ILPA 4KHPH 2RDHA 2Q8TA 1SYFA 2QGQA 2I07B 4UCOA 3JAMi 1OXXK 4HIOA 4FBTA 2EDGA 4GOPA 2SEBD 5M3FB 2PI2A 2WKCA 2JQOA 1RDPD 5CGKA 1Y1WB 3MZ5A 4EQPA 5L1KA 3T5LA 4P75A 3MC0B 4QIWB 1YNJD 2AWOA 4P2CB 3RN2A 4MTKA 4A3MH 4YCWA 4IAJA 3GTJA 1D1KA 4ZYSA 2R61A 4NXNL 2Y0SA 4EGQA 3TP7A 2RCNA 1EYCA 1I4RA 4JI4L 4HIKA 4EGJA 2E5LH 2Q2HA 2IPKD 4LWCA 2C22A 1AH9A 5E4XA 1XX8A 1HNWL 4B3MQ 5C0XI 2W57A 3KOJA 5C3XA 4Q43A 1MKHA 1ET9A 1ET6A 3UDGA 1CQVA 4DV6Q 1DOMA 2YU9H 4DA2A 3S14B 1EY5A 1IBLH 4RAUC 1HQMC 5KYLA 2VXWA 4O3SA 1VQLA 1L0YB 3T53B 3TZUA 2KCTA 3OIQA 3NK9A 1BBWA 1Y1VA 3MXGA 3RUPA 2YV5A 4UP8A 2JK8A 5I6WA 3EPIA 2X6LA 2NZ1D 2A8VA 2JA6G 4O2AF 1M90C 3OSNA 5M5YB 4OO1G 4IFDH 1E2ZA 1V1QA 4KHPQ 3GO5A 1EOTA 1YI2A 3T51B 5CA0F 1LTLA 5EJWA 3GQBA 2BDNA 3JAME 1W6JA 4LF6H 1PTOD 4M1UB 2IX3A 4YAKB 2IBKA 3CCRA 4EQ5A 4RWSC 3KLWA 3OW7A 2Z4HA 4G7ZC 5IT9L 3NGDA 1JC7A 5DM63 3KJPA 1R9TA 4KJNA 4O4LF 4JI5L 1IW7C 2OQ0A 5EPLA 2KOLA 5KT3A 3K3VA 1WTPA 3ULLA 2ZJQA 3EVQA 2XGQA 4BS9A 2YS6A 4HIMA 2RA4A 1U9RA 4LF7Q 5CORA 3X3NA 3A0JA 4QWAA 3BQ2A 2DY8A 3LX0A 5CV7A 1M1KC 3HOYH 3BJYA 5JEAH 1Y1WG 4DR6H 2B2VA 4A3KH 4LSAA 3T5JA 3PUVA 3NHHA 3GIJA 2OEOA 3PUZA 2L11A 2AQ4A 2BQRA 1Y8NB 2E74C 5H1SE 2DN8A 3MR5A 1V1PA 1EY8A 1YEZA 4YHHQ 3QFFA 4J8QA 3G6VA 1S5CD 3SEBA 2FK3A 3W1GA 3HOUG 1GJXA 1RL2A 2FFKB 3ERQA 1SNPA 1QUQA 5A2QW 3NP8A 1S0MA 1VBGA 1TWHA 2KHSA 2R87A 3P7JA 4WFN3 5G3LF 4IZOA 3ULJA 1BXTA 4OIKA 2NVQB 5I9OA 4CDCC 4BY1H 4NXNQ 4ECSA 4JI4Q 4APMA 1RYSA 2HHHH 5K36H 1JOOA 1C48A 1BGWA 3GIQA 4YY3H 4ZQ3A 3I4MG 1JJ2A 3J81W 1IW7D 1HNWQ 3A8JE 4MV7A 3N6RA 3V4SA 1PA6A 1DIKA 5HV6A 4FF1A 2EQSA 5M9OA 4RFBA 1OO9B 4JOIA 2KJXA 3VR2A 1B2TA 4ILWA 1KTKA 4A76A 3C1EA 2UXBH 3M4OH 3K0YA 4M9UA 1VQ4A 2E2IH 2UUBH 1S0NA 3K7AH 3OUUA 1MJEA 3PQIA 5C5MA 3NWSA 3UE1A 3HOZH 3I4NH 3HOXB 4XX0B 3CQZH 4CJ2C 4UY8C 1M7JA 4HR7A 2ZJPA 4GLXA 4PMBA 1SFOA 4FYDA 1AZPA 4GKKQ 3CPWA 4MHEA 1DZ1A 1CTMA 1I7NA 5HY6A 1J8IA 3CRKC 1Q82C 1EOVA 4IO9A 1H9SB 2SDFA 2F03A 5IT9c 3VA5A 1C30A 5AJ3Q 2JA6A 5BPFA 3S15H 3UDXA 1SBBB 2C35B 4C3JH 5KFYA 4DV6H 1VQEA 1O80A 4LF4Q 1PH6A 1RJRA 4YHHL 3CPFA 5E7NA 4RNMA 4C2MA 1E2WA 1TQOA 4R4OA 3SGIA 3Q8QB 3H3VH 1E24A 3M4PA 2FB9A 2DPJA 3PO2G 3TSSA 3OTOL 1VCIA 2KCMA 4TRDA 4B3SL 5J2TF 4O3QA 2UU9H 1LTRD 3S17B 2EE1A 1HCZA 1PTOB 1YJWA 1X32A 1TR5A 4Q45A 1QNKA 2MUYA 4FXDA 1KXLA 4JV0A 3WWVA 5M3MB 1GSAA 5BPHA 2KEEA 1G8ZD 4LF5Q 1FKAH 5C0XJ 1HPCA 4FP5D 1EYGA 1LUZA 4MTNA 2K5DA 1J5EQ 1SNMA 4QMGA 2CCZA 2QW7A 2R93A 5IGFA 2HIXA 5ELEA 1BO0A 1CKOA 2HD3A 3DWPA 5KKNB 4OX9H 3PF4A 2B39A 1S5DD 1EEID 1SXTA 4JI0H 4B9WA 3BJUA 1RK5A 2RDIA 4LF5H 3MXUA 2B2WA 1XMOQ 1PH9A 2PW5A 5IP9H 3MFYA 1N34H 2N8NA 4XQQA 4XIGS 3H0GA 3DEOA 3D6WA 5EPKA 5DLQE 4UCTA 2I80A 1JQYD 1LYLA 5CA1F 1WI5A 3R3OA 2E2DC 4H44C 1EFWA 2W70A 3SK5A 4KHVA 1ZQ7A 2XCLA 4JI7H 4ZCKA 2ZDQA 5E3FA 3L9AX 3K5MA 4CKCA 5C3EB 2W6ZA 1IYJB 1AZQA 3KYHC 3BZCA 3MEFA 4DAMA 5LMUL 4RB3C 2F0PA 2KA7A 5F2DA 1VQFA 5JJIA 1NUCA 2HJWA 3BDCA 4LH7A 2R6GA 3M4YA 3MR3A 2C9OA 5CMDA 4KN7C 3CCEA 1M0WA 5IT9W 3TQYA 2PZTA 3HRZC 4QUFA 1CT1D 2L1BA 4KKTA 1CFMA 1LTGD 3CCUA 2V1CC 3QJYA 3E9HA 4KHZA 2F0WA 4OO1H 2JXMB 4ID6A 4RKBA 1RIPA 4DR1Q 2Z6BA 1YHQA 1VDZA 4GNXC 4MV8A 1Y14B 2F4VQ 4DLKA 3GTQB 3R2IA 2JEJA 1STYA 3PO2B 1EU4A 4KV6A 2C2EA 1R4QB 1FVIA 1NY4A 1WTWA 1FGUA 1YHAA 5CV5A 2VQEQ 4QB4A 2OH2A 1KHIA 5BN5A 2CQAA 4WD3A 5KFOA 5BN3A 4LF5L 3S16H 1TWHB 5L1JA 1SMYD 4LFBL 2LXKA 1KLUD 4MN3A 4DL2A 2RBMA 1TS2A 4DR3H 2UUAH 3O13A 1F77A 2RVLA 4HN7A 1EU3A 2F0LA 4ME3A 3URYA 3C2PA 2UVUA 3R23A 2PMZE 2J7ZA 3RBEA 4QL5A 3HOWB 2EXZA 3BS1A 1I94L 1AN7A 1GSHA 2VUGA 3KTMA 1GUNA 4XZ3B 4BXXH 3TS2A 3RZDH 1IBLL 4LFCQ 4LSXA 1PX2A 1B1ZA 2EYMA 2XIGA 3RAXA 3EIVA 4O3RA 3RLFA 2UU9L 2O03A 4X64L 3K5IA 1E4GT 4CBVA 2EYLA 2KECA 2B2TC 2HDMA 2XTIA 3KHGA 1R9TB 1EZ8A 3H6MA 2KSWA 4JBMA 4DU9A 2K03A 3SK6A 3S16B 1KJJA 2W7OA 4YQWA 4IWYA 1PVOA 4YHHH 1U0LA 1F9RA 1FD7D 2NB0A 5A35A 1JJGA 1K8OA 1CA6A 2V59A 4DL6A 2NN6G 3MJFA 1ESFA 4J9SA 4JI6H 4DR2H 4LF6Q 3H0GB 2C5CA 4Q5VA 1KC8C 1ZKOA 4DV3H 1XTDA 3E0JA 5GAEC 1EWIA 2YYZA 3T1YQ 2FE3A 2KVMA 2WINB 2G9HD 3JSNA 2EYOA 4JI0Q 1Q8KA 1CQFA 5FD6A 1FL0A 4LMQD 3T5HA 2K7VA 4JI8L 2F0HA 2UXCQ 3OIPA 2A69D 4AH6A 2J9GA 2K75A 2F3WA 2HCCA 2A6ED 2E5LL 4Y8VB 1X56A 3SDZA 3PF5A 1RKNA 4DV1Q 2R7NA 2VQFH 1G2SA 4N8X1 1Y1VB 2DIKA 3GTQA 1VQPA 1HQRD 3Q24A 1HTPA 1MBYA 1C8CA 1STBA 2RCFA 5FJ8H 3KK7A 1WCMB 4A3BG 3RTXA 2AQ2B 1UE6A 2JA7G 1CE8A 1JB3A 1MSHA 2F0TA 1HA6A 3M3YB 3BABA 3S2DB 1VQ6A 2W6MA 5G3LD 1HXYD 5KFSA 2W8KA 2CH4W 2ZXPA 2R85A 3A5ZB 1EIGA 5H80A 4N8FA 1TXYA 1HNXH 3EN2A 2FLNA 4KK7A 1SMYC 2CW0C 2HHHL 1QCBD 1IKLA 2R7FA 3N6XA 1C9OA 4HQ6A 3M3YH 1UC9A 1PH5A 1X55A 1V8QA 4EX5A 3CCLA 1KDCA 4QWCA 4JYAH 3HFZB 3LWUA 2A6HC 3BG3A 4JCVE 4PNYA 1L2ZA 4IUTA 3RMHA 2DUDA 1KAWA 1VQ7A 3GIPA 2X69A 2JA5H 2WFWA 1FJGL 3LWBA 1VQOA 1ILQA 4RKLA 2EY2A 2BOSA 2E75C 4LH6A 4MAMA 4YBZB 2N49A 4DL4A 1PRTB 3MXNB 3V4ZA 4JBKA 4R9WA 1AP0A 2OWOA 5LMNH 1SEIA 2VW9A 1F2MA 4PV1C 1VS0A 3M7GA 4JI3Q 3OMCA 3PUYA 2CW8A 1GO3E 3HOWG 2D0PA 2AUJD 3FP9A 4HTHA 3H3VC 2PPBC 5IP9G 3CVZA 4IR1A 2JSOA 3BZDB 4EYHB 3T1YL 1CZGA 2CVRA 3HGBA 4WRDA 3BZKA 3SI8A 1PZKD 4HMJA 3IG0A 3GTPA 4ED7A 3GTPH 3K57A 4L5TA 1JIHA 5JEAJ 5JQWA 3FDTA 4LF9L 2VPSA 2F0JA 3LP8A 3WO0A 2NU9B 1HR0H 2Z4IA 1B4OA 2NVTH 3FKIB 5KFLA 2KHIA 1WYDA 5KX5F 5DGBA 2R93B 4RA8A 2R92G 2JEGA 3Q8DA 4A2BA 3UQ8A 2AQ1B 1TWHH 2QEXA 3MR6A 4R1JA 5CC4A 1G6PA 1YBYA 4Y7NH 3Q23A 3RNUA 4YWKA 2YW2A 4JI1L 2XD4A 3F2DA 5I47A 3IL8A 2MHVA 1DGSA 3KDFA 2PI2E 4RUCA 3MA2B 4A3EB 1EYAA 2JJQA 3EFXD 3CAMA 4ECXA 2LXJA 4RAZA 4YR2A 2CW0D 2MO0A 1N36L 3AMUA 4KKSA 3T13A 5IYBH 1BNZA 4TQUS 1LTTD 4JUZA 4JI3H 1CZWA 1QILA 2PW7A 2L9HA 4WJ4A 4HJ5A 4HJAA 1LT3D 3HOXG 1PFMA 2F0UA 3EBEA 2OTJA 2TSSA 1HFGA 4AQYH 1X9NA 4WORA 4LFAH 2NZOA 2F0KA 5F9NA 1XYIA 4HJ9A 5KEEA 3H15A 1T36A 1NJIC 5LL6X 3OWFA 5J22A 1UC8A 3PIP3 4AYBG 1D5ZC 3I7FA 5CYUA 3W1BA 4C3JB 2JEIA 1U4LA 4UP9A 5KFNA 2K28A 4RNOA 1W96A 1M6VA 1P8LA 1B53A 4XDXA 4A3EG 5I2YA 1BQQT 1BF4A 1ASZA 3A54A 1YVCA 2PCFB 2VB3X 1PXUA 1PDQA 3V96A 5JPNC 5M5WH 1VQ8A 1BJTA 1YNND 4R8NA 1E4EA 1XNRL 1EY7A 1JB7A 3G48A 1VMCA 3CHBD 4K2LA 1I3QB 4L5RC 4BBSG 1JWUD 4K0KL 3Q2OA 1B9NA 3I70A 1CHPD 1RCVD 1S72A 3RGZA 4A3FG 3F1ZA 1V9PA 1JT8A 2QK4A 2GPWA 2UVWA 5FOBB 4CDFC 3HG9A 2N78A 2IA6A 5FLXE 3VPBA 3NTHA 1BCPF 2IHFA 3K8AA 4LF4L 2HT1A 3KF6B 3F2UA 1KDAA 4GZYC 3FPPA 5IP7G 1QVGA 1Z7TA 2Z8LA 1UE7A 4B3TH 1DYQA 3E0EA 4DR4Q 1CKMA 3GQCA 5IGBA 1SYGA 5C0XH 4X3UA 4ECQA 1F2YA 5EAYA 4TUYF 2MGSA 2ZJRA 2VNUD 1K83B 4DR2L 3C1FA 4BY7H 1I50H 1GUSA 1H9JA 1UAPA 2R7ZG 1PHJA 4UCSA 5D1OB 1ZHQA 5JJKA 3IAYA 2BH2A 2BQUA 1J5EL 1BR9A 1I4HA 3RF2A 3AFQA 2R86A 4TQRA 1IBKH 2F0MA 4PZ8A 1X3PA 4Q8FA 1TS5A 4DL7A 1OXTA 1KLGD 3EPGA 3I72A 5M3MH 4X66H 4A2AA 5ELFA 1WTRA 2F0EA 3PO3H 4KI0A 3N44B 1ONLA 2FXQA 2ZTCA 4J9RA 1F2LA 3D4RA 4TQSA 2B29A 1PK8A 1C0AA 5LYJF 4KHPL 4A3GB 3V2TA 5ELOA 5M3FH 3G71A 4XT1B 3MFGA 1IYUA 4NDXA 3PIO3 3FEWX 4JW0A 4NKLA 2WE6A 3S1NH 4DUZL 3WNZA 1WFQA 3OHAA 1VQ5A 1DOLA 3I91A 4P74A 2W6OA 3QWNA 1MZBA 3GTJB 2VB2X 3VYRA 1NMGA 3TMEA 1I94H 3F2CA 1XNRQ 3V6JA 3S1MB 3K80C 4JI2H 3F8NA 1K73C 4PZ7A 3RZOB 2WAQG 2H1EA 5IWAL 2KCNA 2DY7A 5IODA 4K6LA 3PSIA 4AQYL 3A5UA 3VR6A 2HVQA 5C5JA 3RN5A 3SE7A 2M05A 2PVPA 3R5XA 1SDFA 1N56A 3QG1A 2A73B 2XN9C 1BCPC 5GAHC 2HIVA 5C1PA 1V4YA 3HOZG 4P72A 4R4CA 2FHTA 1F9SA 1S5ED 3CMEA 4LF8Q 2C28A 1EQVA 1PH4A 3JAMW 1EIFA 4A3CH 2IP4A 3G8CA 1Y69U 3I2ZA 5L1IA 4RGOS 1I3QH 2BA0A 4HEDA 4WJ3M 2GA4B 2FJZA 1VAJA 2YZNA 3GTMB 4OX9L 3J81L 2R8IA 1K83A 3I56A 4JI6L 2O5IC 4ZKBB 2RHSB 1BXRA 4MV9A 4RCOA 2NVQH 4A3IB 3HBLA 2V4RA 3DMUA 4I7AA 1I94Q 4ECZA 4ED2A 4RGTA 4MA0A 3BQ0A 5KFQA 5KFPA 3VPDA 3HZXA 3QOLA 3ETHA 4DR7L 4OHJA 3GTGA 4Q0FA 4IALA 1Z2PX 2UXCH 3TBIB 5FLMG 5BMVF 1OWTA 2ES2A 3I4NB 5EOYA 2IMWP 1E0BA 2CWPA 4RCNA 3DWQA 4JPBW 5FLXL 2MNAA 1LTAD 4GOPB 4FM9A 2BE5D 1LM0A 4K8IA 4ED6A 2R7ZA 1TU2B 3T1HL 5EWGA 1GYFA 3NSWA 4QW9A 4DV1H 4DUYH 1O75A 4DXFA 1O7LA 4YR3A 5ELCA 1U4RA 2PQAB 3HOVB 4JI1H 2W6QA 4IUQA 3I55A 2PZUA 1PH1A 4DUZQ 3M9NB 2HQEA 3EYYA 4Q44A 4GN5A 1QUQB 2PN1A 1GUGA 5LOVF 3R93A 4OIJA 2FMMA 2VR1A 1N36H 3T5KA 3HXLA 4APVA 3OTOH 1WSCA 5AJ3L 2W9BA 3GILA 3K5NA
chains in the Genus database with same CATH topology
4JI3Q 1XNQQ 3CCEA 3RLOA 3TQYA 3H0GG 2R92H 1AE2A 4JYAL 3U4ZA 1NTGA 2K5HA 4OWXB 4DPGA 1HZBA 1IBMQ 3CCUA 2V1CC 2E5LQ 1SRUA 1QZHA 4JI7L 1OXUA 2K52A 3E9HA 4KHZA 4JI5Q 4A3JG 4DV0Q 4AQYQ 2ID0A 1X3FA 4QIWE 4DR1Q 1RIPA 2UUBL 2F4VL 4GNXA 3S17H 4TVAB 2WP8J 1YHQA 3M7NA 3G4SA 1A62A 1Q86C 4JI8Q 2UXCL 4BA1I 5IYDH 4GNXC 3UDFA 1Y14B 2UUBQ 3E9IA 4QJFA 2F4VQ 4BBSH 4JI6Q 2GVBA 5M5YH 4JI2Q 1TWFH 3L0OA 2K4KA 3CW2C 4BXXG 1FVIA 4DR5Q 1NY4A 3GTOH 2MFIA 4LUVA 3KFUA 1FGUA 1YHAA 5C3EG 4A3MG 1KRTA 2VQEQ 2VUMG 4LW1A 3FKIG 2EIFA 1KHIA 3HOXH 1Y1VH 4DUYL 1YJNA 1HR0Q 3TEHB 1VQIA 1TWCH 3CC4A 4DR5L 2N3SA 4LF5L 3S16H 4LFBL 2LXKA 3D0FA 1L1OB 4QGUA 1T9HA 4PG3A 1N33L 1X3EA 1A0IA 4YCVA 3CF5A 3J7A5 4ME3A 2NVYH 3M9BA 5IYDG 2PMZE 1IZ6A 1KD1C 1L1OA 1N36Q 4C2MH 3AEVA 4DR6L 2ALYB 4QL5A 1I94L 1ASYA 4BBRG 1QVFA 1R9TH 4BXXH 3IRBA 5C0XG 1D8LA 3RZDH 1IBLL 4LFCQ 3TS2A 1CKNB 1NMFA 1S3OA 2OQKA 4DNIA 4A3GG 2VUMH 2Z6KA 1VQJA 1X3GA 2IT1A 3FKIH 4A3EH 3EIVA 1OXVA 2JA6H 3RLFA 4DKAC 2UU9L 2Z0SA 4X64L 2JEAI 4JV5L 4RG1A 4XTCS 1IBLQ 1HR0W 4NXML 2XTIA 3S24A 4B3RL 2YTXA 3AYHB 1KIXA 2JA8G 4HJ7A 1E1OA 3CXCA 4IPHA 1XMQL 4DV6L 2UU9Q 4JBMA 2Y0SE 2ZTEA 1L1OC 1KRSA 5LMUQ 1A63A 1GVPA 1D7QA 4DV3Q 5ELNA 1PVOA 2MO1A 4LF6L 3J7ZC 3PUXA 4UP7A 1U0LA 3KJOA 3CC7A 1XMQQ 4NB3A 3A74A 1S40A 1UWVA 2NN6G 4YCUA 1W2BA 2EXDA 1WOCA 4JYAQ 2JE6I 5M3MG 4MZ9A 1PH3A 4JI0L 4A3GH 2B63H 5M5XH 4LF6Q 4Y52H 2BA1A 1KC8C 1XTDA 5GAEC 1EWIA 2YYZA 3T1YQ 3U50C 1P16A 5FJ8G 2E2HH 4A3BH 4JI0Q 5IWAQ 2K5VA 1Q8KA 2E8GA 3NENA 3ERSX 1FL0A 3F2BA 5M3FG 1SLJA 1X65A 3KDFB 4JI8L 2UXCQ 4C3HH 4JI3L 3TS0A 4O2DA 4AH6A 5LMNL 1X54A 2K75A 3U4VA 2A19A 2D0OA 4DAYB 3S1MH 5JEAG 3PIPA 1VQKA 4A3LH 1IBML 2E5LL 5GADC 3TRZA 4A3KG 4OWWB 4JI7Q 1C7YA 2CQOA 1X56A 2B3GA 1K8AC 4DV0L 3PGZA 3STBC 3PF5A 1GM5A 2GN5A 3CCVA 4DV1Q 2B63G 2AKWB 2I5MX 4DV5Q 2WAQE 2AWNA 4YWMA 1VQPA 4LF7L 3HOUH 5FJ8H 1Q81C 2R7ZH 4A3BG 1N32L 4LF9Q 2KBNA 1UE6A 4GN3B 4DV1L 1VQHA 4JI1Q 2JA7G 1Z9FA 1PH2A 4QQBX 4OONA 4LFAQ 1VQ6A 1WJJA 1UEBA 1YNXA 3UDIA 2VQEL 3K7UC 1N8RC 4POGA 1N32Q 3A5ZB 3B6YA 4R4QA 4BY1G 1X6OA 1J6QA 1Q46A 1TXYA 3EN2A 1YJ9A 4QY7A 2WB1E 4LNQA 2HHHL 2R7FA 1C9OA 3M3YH 4LUZA 1U5KA 1X55A 1PH5A 4EX5A 3CCLA 4X6AH 1K8GA 2KHJA 3HFZB 3H3VI 4NXMQ 5GROA 4JCVE 2HHHQ 1O7IA 1B70B 4OXPA 4JOIC 3G6EA 4X62L 3CCSA 1HNXQ 2DUDA 1KAWA 1QZGA 3KF6A 1VQ7A 1VQDA 1Q12A 2JA5H 2WFWA 2AMCB 1FJGL 4GN4B 1PYSB 1K83H 4DV3L 1BKBA 4R4IA 3ER0A 1VQOA 1HNXL 5IY0A 4X62Q 3CCJA 2N49A 2VZAA 3PV0A 1UE5A 2PQAA 3PIOA 1VQMA 1XMOL 3KF8B 4A93G 3MXNB 1XPUA 4JV5Q 3JAMc 4JBKA 1OXSC 2GVAA 2OWOA 1PH8A 4JG2A 1EIYB 2VW9A 4UPAA 2VQFQ 2R93G 1HNZL 3CD6A 1EQQA 4B3TL 4GKJL 2I5LX 1Z47A 3S2HH 5C4XH 1QVCA 1VS0A 1E3PA 4A4IA 3PUYA 3J81j 1WCMH 1GO3E 2VQFL 3ULPA 2A1AA 2D0PA 3FP9A 5LMNQ 4DV2Q 2JA5G 3HOWG 3DLLA 4FDBA 2K5NA 1VQNA 5IP9G 1HZCA 3HKZE 1XNQL 4A93H 3ICEA 4DK3C 3T1YL 1PFSA 2F52A 3W5OA 3BZKA 4PZ6A 5LMNW 4GLAC 2Y0SG 4KLKA 2I0QA 1VQBA 2I5HA 4OO1I 2RF4A 1H95A 4A3CG 2R93H 4IJLA 3GTPH 2IX1A 4L5TA 1CSQA 4DR1L 1YZ6A 5JEAJ 3K0XA 4LF9L 3M4QA 4O0AA 1PYBA 4GLVB 3F8TA 4DV4L 5C4XG 3PO2H 3M85A 2KENA 2NVTH 1WCMG 3HOWH 4YY3L 3ZJYC 5IE8A 2KHIA 1WYDA 3STBD 1MIUA 3HOVH 1CKNA 3H0GH 2R92G 3Q8DA 4DR3Q 1Q7YC 2UUAQ 2NZHA 5J3BA 4YY3Q 1TWHH 2QEXA 4R1JA 1G6PA 2QGQA 1YBYA 4Y7NH 3RNUA 4YWKA 3JAMi 1OXXK 1NBWA 1YHBA 1BBUA 4JI1L 4HIOA 1CUKA 4GOPA 3F2DA 2PI2A 1DGSA 3KDFA 2PI2E 1HZAA 2JQOA 4HJ8A 1N33Q 2JEBI 2YTVA 2JJQA 1VQGA 3CAMA 4P75A 2LXJA 1SE8A 1N36L 2MO0A 1SFOH 5IYBH 2AWOA 3RN2A 5GQOA 4HIDA 4IOAA 4TQUS 5C3EH 4YCWA 4A3MH 4LUOA 1SR3A 4LFCL 2OCEA 4HJ5A 4LFBQ 4WJ4A 2R7DA 3HOXG 4HJAA 1Y1VG 4NXNL 4B3ML 2UXBQ 3UE0A 2RCNA 3EBEA 4JI4L 2OTJA 4HIKA 1X9NA 3RLNA 1IL2A 2NZOA 2Q2HA 4IOCA 4LWCA 2VS1A 4IFDG 1HNZQ 4HJ9A 1AH9A 3JC66 4JBJA 4B3TQ 2ASBA 3H15A 1HNWL 4B3MQ 5C0XI 2NN6I 1NJIC 3KOJA 1MKHA 5IYCH 1L2FA 2ZM6L 3UDGA 3GTKH 4DV6Q 2YU9H 4AYBG 4DV2L 3I7FA 3TREA 3W1BA 4UP9A 5IYBG 3CP0A 3J81c 3NBHB 1VQLA 2KCTA 1P8LA 1BBWA 2YV5A 4UP8A 2JK8A 4L5QA 3J80i 4A3EG 1HZ9A 5BR8L 3S1RH 1ASZA 2A8VA 1YVCA 2JA6G 1M90C 5M5WH 5C44G 1VQ8A 4A3JH 4OO1G 3RZOH 1I6HH 1V1QA 3PCOB 1I5FA 1XNRL 4KHPQ 3GO5A 1JB7A 2PNHA 4C3IH 1YI2A 1LTLA 3G48A 4GOPC 4DV4Q 1Q1EA 2QA4A 5GAGC 4L5RC 4BBSG 4K0KL 3CCRA 4EQ5A 1Y1WH 3KLWA 4P71A 3GD7A 3OYYA 1S72A 4X66Q 4A3IG 3KJPA 3F1ZA 2AHOB 1V9PA 4A3FG 1JT8A 4K0KQ 4JI5L 2OQ0A 2N78A 3LGJA 3ULLA 4DV7Q 2ZJQA 1N34L 5C44H 4J15A 1A8VA 2JA9A 2K50A 2CWAA 2IHFA 3K8AA 4LF4L 4HIMA 3CMAA 4LF7Q 3HKZG 3KF6B 2HT1A 1VQCA 3A0JA 1G51A 2Q2IA 1OTCA 4DV7L 1QVGA 5IP7G 3U58A 1K3RA 1M1KC 3HOYH 1UE7A 1SMXA 4LFAL 1HH2P 1Y1WG 4GKJQ 4DR2Q 3E0EA 4BBRH 2IX0A 1CKMA 4A3KH 4DR4Q 3PUVA 5K36G 4X65Q 3PUZA 2UXDQ 4A3IH 4A3FH 5EAYA 1GKHA 5H1SE 2OTLA 3I4MH 1YEZA 2ZJRA 4YHHQ 2UUCL 3PO3G 2VNUD 4DR2L 4IPCA 3GTMH 4BY7H 1I50H 4DK6C 3W1GA 1HJPA 1B7YB 4MNOA 1XPRA 2LSSA 3HOUG 2R7ZG 1PHJA 1RL2A 5JJKA 1QUQA 2BH2A 2CFMA 1B8AA 1EQRA 4NPSA 2H5XA 5IP7H 1J5EL 4B3SQ 4DR7Q 1GD7A 3J80c 1BVSA 3HOYG 3AFQA 3ULJA 3K81C 1FJGQ 4JC0A 3GTGH 2UXBL 4BY1H 4NXNQ 4PZ8A 4JI4Q 2CKZB 2RHQB 1OXTA 3DM3A 5M3MH 5JJLA 3GTQH 2DGYA 3I4MG 4KI0A 1JJ2A 3PO3H 1HNWQ 2ZTCA 2FXQA 3D31A 4BY7G 2L15A 1W3SA 1PA6A 4B3RQ 1NE3A 2B29A 2EQSA 2ZM6Q 2BH8A 3GTJH 3L7ZC 5FLXc 3VDYA 4KHPL 1C0AA 1K0RA 4JOIA 5ELOA 5M3FH 2E2JH 3G71A 4A76A 3S1NH 4DUZL 1IBKL 3CCQA 3M4OH 1WFQA 1VQ5A 4A75A 4P74A 1E1TA 3I4OA 1VQ4A 1YITA 2E2IH 4A3LG 3K7AH 5BR8Q 1YIJA 1MJEA 4X66L 2K14A 3UE1A 3HKSA 3HOZH 4GKKL 1NMGA 3I4NH 3CQZH 1SROA 4UY8C 4IPGA 3F2CA 1XNRQ 3K80C 2ZJPA 2IY5B 1MJCA 4GLXA 1K73C 4PZ7A 3S2DH 1E22A 2WAQG 5IWAL 4GKKQ 3CPWA 1XPOA 4IPDA 5HY6A 3PSIA 1Q82C 1KQSA 4AQYL 3A5UA 1EOVA 2JA7H 4IO9A 1PV4A 2ATWA 5IT9c 4IFDJ 3RN5A 3L2PA 5AJ3Q 1TWAH 1L0WA 2Q2UA 4P73A 4LF8L 3OW2A 3S15H 4OWTB 3UDXA 4GNXB 2C35B 3AFPA 2D62A 1JJCB 2HIVA 4C3JH 5GAHC 1K9MC 4DR4L 3HOZG 4P72A 1VQEA 1N34Q 4IJHA 5HGQA 3I4NG 4DR3L 2UUAL 4JI2L 1JJGA 4LF4Q 1KL9A 4R4CA 4DV5L 2WB1G 1PH6A 3CMEA 4LF8Q 4YHHL 2UUCQ 3CPFA 5E7NA 1PH4A 1EIFA 4GS3A 4A3CH 3OTOQ 3S14H 4R4OA 3I2ZA 4JBWA 3SGIA 4DUYQ 2F3IA 1E24A 1I3QH 4YWLA 1HR0L 3H3VH 4A3DH 2BA0A 3M4PA 4WJ3M 1AE3A 3PO2G 4OX9L 3OTOL 4X65L 1VCIA 2KCMA 4B3SL 3I56A 4JI6L 2UXDL 2RHSB 3HOVG 1JMCA 4RMFA 2NVQH 3J81i 1YJWA 1G291 1XJVA 4OX9Q 1I94Q 4BA2I 4IFDI 1KXLA 2Q2TA 3WWVA 3S1QH 5C4JH 3AQQA 4LF5Q 2VY3A 1IXRA 2HQLA 3FHWA 5C0XJ 2NVXH 1EYGA 1LUZA 3CC2A 4MTNA 1PH7A 1VQ9A 1J5EQ 2CCZA 4ALPA 4DR7L 1Q1BA 2HIXA 4A3DG 1CKOA 5FLMG 1UE1A 3PF4A 2ES2A 4DR6Q 3BJUA 2CWPA 2MNAA 4GOPB 1E7ZA 2VL6A 4R4TA 1JE5A 3RR5A 2Z6KC 1LM0A 4PMWA 1XMOQ 1PH9A 3GDEA 5IP9H 3GTLH 2MQHA 3BU2A 2N8NA 4XIGS 3T1HL 4AIMA 3NEMA 5DLQE 4POFA 2JA8H 3PUWA 1LYLA 2YTYA 1WI5A 1EFWA 4X64Q 2PQAB 3CCMA 4L5SA 1CSPA 2XGTA 1EUJA 3I55A 3T1HQ 4DUZQ 1SN8A 1PH1A 2IHEA 1IBKQ 4GN5A 1QUQB 1IYJB 1N9WA 3KYHC 3BZCA 5FLMH 3MEFA 4DAMA 5LMUL 5IYCG 1VQFA 1V43A 2ZTDA 4H02A 4APVA 4AYBE 5JJIA 2R6GA 3NELA 5AJ3L 1VQAA 1TWGH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI3 Q;  1XNQ Q;  3CCE A;  3RLO A;  3TQY A;  3H0G G;  2R92 H;  1AE2 A;  4JYA L;  3U4Z A;  1NTG A;  2K5H A;  4OWX B;  4DPG A;  1HZB A;  1IBM Q;  3CCU A;  2V1C C;  2E5L Q;  1SRU A;  1QZH A;  4JI7 L;  1OXU A;  2K52 A;  3E9H A;  4KHZ A;  4JI5 Q;  4A3J G;  4DV0 Q;  4AQY Q;  2ID0 A;  1X3F A;  4QIW E;  4DR1 Q;  1RIP A;  2UUB L;  2F4V L;  4GNX A;  3S17 H;  4TVA B;  2WP8 J;  1YHQ A;  3M7N A;  3G4S A;  1A62 A;  1Q86 C;  4JI8 Q;  2UXC L;  4BA1 I;  5IYD H;  4GNX C;  3UDF A;  1Y14 B;  2UUB Q;  3E9I A;  4QJF A;  2F4V Q;  4BBS H;  4JI6 Q;  2GVB A;  5M5Y H;  4JI2 Q;  1TWF H;  3L0O A;  2K4K A;  3CW2 C;  4BXX G;  1FVI A;  4DR5 Q;  1NY4 A;  3GTO H;  2MFI A;  4LUV A;  3KFU A;  1FGU A;  1YHA A;  5C3E G;  4A3M G;  1KRT A;  2VQE Q;  2VUM G;  4LW1 A;  3FKI G;  2EIF A;  1KHI A;  3HOX H;  1Y1V H;  4DUY L;  1YJN A;  1HR0 Q;  3TEH B;  1VQI A;  1TWC H;  3CC4 A;  4DR5 L;  2N3S A;  4LF5 L;  3S16 H;  4LFB L;  2LXK A;  3D0F A;  1L1O B;  4QGU A;  1T9H A;  4PG3 A;  1N33 L;  1X3E A;  1A0I A;  4YCV A;  3CF5 A;  3J7A 5;  4ME3 A;  2NVY H;  3M9B A;  5IYD G;  2PMZ E;  1IZ6 A;  1KD1 C;  1L1O A;  1N36 Q;  4C2M H;  3AEV A;  4DR6 L;  2ALY B;  4QL5 A;  1I94 L;  1ASY A;  4BBR G;  1QVF A;  1R9T H;  4BXX H;  3IRB A;  5C0X G;  1D8L A;  3RZD H;  1IBL L;  4LFC Q;  3TS2 A;  1CKN B;  1NMF A;  1S3O A;  2OQK A;  4DNI A;  4A3G G;  2VUM H;  2Z6K A;  1VQJ A;  1X3G A;  2IT1 A;  3FKI H;  4A3E H;  3EIV A;  1OXV A;  2JA6 H;  3RLF A;  4DKA C;  2UU9 L;  2Z0S A;  4X64 L;  2JEA I;  4JV5 L;  4RG1 A;  4XTC S;  1IBL Q;  1HR0 W;  4NXM L;  2XTI A;  3S24 A;  4B3R L;  2YTX A;  3AYH B;  1KIX A;  2JA8 G;  4HJ7 A;  1E1O A;  3CXC A;  4IPH A;  1XMQ L;  4DV6 L;  2UU9 Q;  4JBM A;  2Y0S E;  2ZTE A;  1L1O C;  1KRS A;  5LMU Q;  1A63 A;  1GVP A;  1D7Q A;  4DV3 Q;  5ELN A;  1PVO A;  2MO1 A;  4LF6 L;  3J7Z C;  3PUX A;  4UP7 A;  1U0L A;  3KJO A;  3CC7 A;  1XMQ Q;  4NB3 A;  3A74 A;  1S40 A;  1UWV A;  2NN6 G;  4YCU A;  1W2B A;  2EXD A;  1WOC A;  4JYA Q;  2JE6 I;  5M3M G;  4MZ9 A;  1PH3 A;  4JI0 L;  4A3G H;  2B63 H;  5M5X H;  4LF6 Q;  4Y52 H;  2BA1 A;  1KC8 C;  1XTD A;  5GAE C;  1EWI A;  2YYZ A;  3T1Y Q;  3U50 C;  1P16 A;  5FJ8 G;  2E2H H;  4A3B H;  4JI0 Q;  5IWA Q;  2K5V A;  1Q8K A;  2E8G A;  3NEN A;  3ERS X;  1FL0 A;  3F2B A;  5M3F G;  1SLJ A;  1X65 A;  3KDF B;  4JI8 L;  2UXC Q;  4C3H H;  4JI3 L;  3TS0 A;  4O2D A;  4AH6 A;  5LMN L;  1X54 A;  2K75 A;  3U4V A;  2A19 A;  2D0O A;  4DAY B;  3S1M H;  5JEA G;  3PIP A;  1VQK A;  4A3L H;  1IBM L;  2E5L L;  5GAD C;  3TRZ A;  4A3K G;  4OWW B;  4JI7 Q;  1C7Y A;  2CQO A;  1X56 A;  2B3G A;  1K8A C;  4DV0 L;  3PGZ A;  3STB C;  3PF5 A;  1GM5 A;  2GN5 A;  3CCV A;  4DV1 Q;  2B63 G;  2AKW B;  2I5M X;  4DV5 Q;  2WAQ E;  2AWN A;  4YWM A;  1VQP A;  4LF7 L;  3HOU H;  5FJ8 H;  1Q81 C;  2R7Z H;  4A3B G;  1N32 L;  4LF9 Q;  2KBN A;  1UE6 A;  4GN3 B;  4DV1 L;  1VQH A;  4JI1 Q;  2JA7 G;  1Z9F A;  1PH2 A;  4QQB X;  4OON A;  4LFA Q;  1VQ6 A;  1WJJ A;  1UEB A;  1YNX A;  3UDI A;  2VQE L;  3K7U C;  1N8R C;  4POG A;  1N32 Q;  3A5Z B;  3B6Y A;  4R4Q A;  4BY1 G;  1X6O A;  1J6Q A;  1Q46 A;  1TXY A;  3EN2 A;  1YJ9 A;  4QY7 A;  2WB1 E;  4LNQ A;  2HHH L;  2R7F A;  1C9O A;  3M3Y H;  4LUZ A;  1U5K A;  1X55 A;  1PH5 A;  4EX5 A;  3CCL A;  4X6A H;  1K8G A;  2KHJ A;  3HFZ B;  3H3V I;  4NXM Q;  5GRO A;  4JCV E;  2HHH Q;  1O7I A;  1B70 B;  4OXP A;  4JOI C;  3G6E A;  4X62 L;  3CCS A;  1HNX Q;  2DUD A;  1KAW A;  1QZG A;  3KF6 A;  1VQ7 A;  1VQD A;  1Q12 A;  2JA5 H;  2WFW A;  2AMC B;  1FJG L;  4GN4 B;  1PYS B;  1K83 H;  4DV3 L;  1BKB A;  4R4I A;  3ER0 A;  1VQO A;  1HNX L;  5IY0 A;  4X62 Q;  3CCJ A;  2N49 A;  2VZA A;  3PV0 A;  1UE5 A;  2PQA A;  3PIO A;  1VQM A;  1XMO L;  3KF8 B;  4A93 G;  3MXN B;  1XPU A;  4JV5 Q;  3JAM c;  4JBK A;  1OXS C;  2GVA A;  2OWO A;  1PH8 A;  4JG2 A;  1EIY B;  2VW9 A;  4UPA A;  2VQF Q;  2R93 G;  1HNZ L;  3CD6 A;  1EQQ A;  4B3T L;  4GKJ L;  2I5L X;  1Z47 A;  3S2H H;  5C4X H;  1QVC A;  1VS0 A;  1E3P A;  4A4I A;  3PUY A;  3J81 j;  1WCM H;  1GO3 E;  2VQF L;  3ULP A;  2A1A A;  2D0P A;  3FP9 A;  5LMN Q;  4DV2 Q;  2JA5 G;  3HOW G;  3DLL A;  4FDB A;  2K5N A;  1VQN A;  5IP9 G;  1HZC A;  3HKZ E;  1XNQ L;  4A93 H;  3ICE A;  4DK3 C;  3T1Y L;  1PFS A;  2F52 A;  3W5O A;  3BZK A;  4PZ6 A;  5LMN W;  4GLA C;  2Y0S G;  4KLK A;  2I0Q A;  1VQB A;  2I5H A;  4OO1 I;  2RF4 A;  1H95 A;  4A3C G;  2R93 H;  4IJL A;  3GTP H;  2IX1 A;  4L5T A;  1CSQ A;  4DR1 L;  1YZ6 A;  5JEA J;  3K0X A;  4LF9 L;  3M4Q A;  4O0A A;  1PYB A;  4GLV B;  3F8T A;  4DV4 L;  5C4X G;  3PO2 H;  3M85 A;  2KEN A;  2NVT H;  1WCM G;  3HOW H;  4YY3 L;  3ZJY C;  5IE8 A;  2KHI A;  1WYD A;  3STB D;  1MIU A;  3HOV H;  1CKN A;  3H0G H;  2R92 G;  3Q8D A;  4DR3 Q;  1Q7Y C;  2UUA Q;  2NZH A;  5J3B A;  4YY3 Q;  1TWH H;  2QEX A;  4R1J A;  1G6P A;  2QGQ A;  1YBY A;  4Y7N H;  3RNU A;  4YWK A;  3JAM i;  1OXX K;  1NBW A;  1YHB A;  1BBU A;  4JI1 L;  4HIO A;  1CUK A;  4GOP A;  3F2D A;  2PI2 A;  1DGS A;  3KDF A;  2PI2 E;  1HZA A;  2JQO A;  4HJ8 A;  1N33 Q;  2JEB I;  2YTV A;  2JJQ A;  1VQG A;  3CAM A;  4P75 A;  2LXJ A;  1SE8 A;  1N36 L;  2MO0 A;  1SFO H;  5IYB H;  2AWO A;  3RN2 A;  5GQO A;  4HID A;  4IOA A;  4TQU S;  5C3E H;  4YCW A;  4A3M H;  4LUO A;  1SR3 A;  4LFC L;  2OCE A;  4HJ5 A;  4LFB Q;  4WJ4 A;  2R7D A;  3HOX G;  4HJA A;  1Y1V G;  4NXN L;  4B3M L;  2UXB Q;  3UE0 A;  2RCN A;  3EBE A;  4JI4 L;  2OTJ A;  4HIK A;  1X9N A;  3RLN A;  1IL2 A;  2NZO A;  2Q2H A;  4IOC A;  4LWC A;  2VS1 A;  4IFD G;  1HNZ Q;  4HJ9 A;  1AH9 A;  3JC6 6;  4JBJ A;  4B3T Q;  2ASB A;  3H15 A;  1HNW L;  4B3M Q;  5C0X I;  2NN6 I;  1NJI C;  3KOJ A;  1MKH A;  5IYC H;  1L2F A;  2ZM6 L;  3UDG A;  3GTK H;  4DV6 Q;  2YU9 H;  4AYB G;  4DV2 L;  3I7F A;  3TRE A;  3W1B A;  4UP9 A;  5IYB G;  3CP0 A;  3J81 c;  3NBH B;  1VQL A;  2KCT A;  1P8L A;  1BBW A;  2YV5 A;  4UP8 A;  2JK8 A;  4L5Q A;  3J80 i;  4A3E G;  1HZ9 A;  5BR8 L;  3S1R H;  1ASZ A;  2A8V A;  1YVC A;  2JA6 G;  1M90 C;  5M5W H;  5C44 G;  1VQ8 A;  4A3J H;  4OO1 G;  3RZO H;  1I6H H;  1V1Q A;  3PCO B;  1I5F A;  1XNR L;  4KHP Q;  3GO5 A;  1JB7 A;  2PNH A;  4C3I H;  1YI2 A;  1LTL A;  3G48 A;  4GOP C;  4DV4 Q;  1Q1E A;  2QA4 A;  5GAG C;  4L5R C;  4BBS G;  4K0K L;  3CCR A;  4EQ5 A;  1Y1W H;  3KLW A;  4P71 A;  3GD7 A;  3OYY A;  1S72 A;  4X66 Q;  4A3I G;  3KJP A;  3F1Z A;  2AHO B;  1V9P A;  4A3F G;  1JT8 A;  4K0K Q;  4JI5 L;  2OQ0 A;  2N78 A;  3LGJ A;  3ULL A;  4DV7 Q;  2ZJQ A;  1N34 L;  5C44 H;  4J15 A;  1A8V A;  2JA9 A;  2K50 A;  2CWA A;  2IHF A;  3K8A A;  4LF4 L;  4HIM A;  3CMA A;  4LF7 Q;  3HKZ G;  3KF6 B;  2HT1 A;  1VQC A;  3A0J A;  1G51 A;  2Q2I A;  1OTC A;  4DV7 L;  1QVG A;  5IP7 G;  3U58 A;  1K3R A;  1M1K C;  3HOY H;  1UE7 A;  1SMX A;  4LFA L;  1HH2 P;  1Y1W G;  4GKJ Q;  4DR2 Q;  3E0E A;  4BBR H;  2IX0 A;  1CKM A;  4A3K H;  4DR4 Q;  3PUV A;  5K36 G;  4X65 Q;  3PUZ A;  2UXD Q;  4A3I H;  4A3F H;  5EAY A;  1GKH A;  5H1S E;  2OTL A;  3I4M H;  1YEZ A;  2ZJR A;  4YHH Q;  2UUC L;  3PO3 G;  2VNU D;  4DR2 L;  4IPC A;  3GTM H;  4BY7 H;  1I50 H;  4DK6 C;  3W1G A;  1HJP A;  1B7Y B;  4MNO A;  1XPR A;  2LSS A;  3HOU G;  2R7Z G;  1PHJ A;  1RL2 A;  5JJK A;  1QUQ A;  2BH2 A;  2CFM A;  1B8A A;  1EQR A;  4NPS A;  2H5X A;  5IP7 H;  1J5E L;  4B3S Q;  4DR7 Q;  1GD7 A;  3J80 c;  1BVS A;  3HOY G;  3AFQ A;  3ULJ A;  3K81 C;  1FJG Q;  4JC0 A;  3GTG H;  2UXB L;  4BY1 H;  4NXN Q;  4PZ8 A;  4JI4 Q;  2CKZ B;  2RHQ B;  1OXT A;  3DM3 A;  5M3M H;  5JJL A;  3GTQ H;  2DGY A;  3I4M G;  4KI0 A;  1JJ2 A;  3PO3 H;  1HNW Q;  2ZTC A;  2FXQ A;  3D31 A;  4BY7 G;  2L15 A;  1W3S A;  1PA6 A;  4B3R Q;  1NE3 A;  2B29 A;  2EQS A;  2ZM6 Q;  2BH8 A;  3GTJ H;  3L7Z C;  5FLX c;  3VDY A;  4KHP L;  1C0A A;  1K0R A;  4JOI A;  5ELO A;  5M3F H;  2E2J H;  3G71 A;  4A76 A;  3S1N H;  4DUZ L;  1IBK L;  3CCQ A;  3M4O H;  1WFQ A;  1VQ5 A;  4A75 A;  4P74 A;  1E1T A;  3I4O A;  1VQ4 A;  1YIT A;  2E2I H;  4A3L G;  3K7A H;  5BR8 Q;  1YIJ A;  1MJE A;  4X66 L;  2K14 A;  3UE1 A;  3HKS A;  3HOZ H;  4GKK L;  1NMG A;  3I4N H;  3CQZ H;  1SRO A;  4UY8 C;  4IPG A;  3F2C A;  1XNR Q;  3K80 C;  2ZJP A;  2IY5 B;  1MJC A;  4GLX A;  1K73 C;  4PZ7 A;  3S2D H;  1E22 A;  2WAQ G;  5IWA L;  4GKK Q;  3CPW A;  1XPO A;  4IPD A;  5HY6 A;  3PSI A;  1Q82 C;  1KQS A;  4AQY L;  3A5U A;  1EOV A;  2JA7 H;  4IO9 A;  1PV4 A;  2ATW A;  5IT9 c;  4IFD J;  3RN5 A;  3L2P A;  5AJ3 Q;  1TWA H;  1L0W A;  2Q2U A;  4P73 A;  4LF8 L;  3OW2 A;  3S15 H;  4OWT B;  3UDX A;  4GNX B;  2C35 B;  3AFP A;  2D62 A;  1JJC B;  2HIV A;  4C3J H;  5GAH C;  1K9M C;  4DR4 L;  3HOZ G;  4P72 A;  1VQE A;  1N34 Q;  4IJH A;  5HGQ A;  3I4N G;  4DR3 L;  2UUA L;  4JI2 L;  1JJG A;  4LF4 Q;  1KL9 A;  4R4C A;  4DV5 L;  2WB1 G;  1PH6 A;  3CME A;  4LF8 Q;  4YHH L;  2UUC Q;  3CPF A;  5E7N A;  1PH4 A;  1EIF A;  4GS3 A;  4A3C H;  3OTO Q;  3S14 H;  4R4O A;  3I2Z A;  4JBW A;  3SGI A;  4DUY Q;  2F3I A;  1E24 A;  1I3Q H;  4YWL A;  1HR0 L;  3H3V H;  4A3D H;  2BA0 A;  3M4P A;  4WJ3 M;  1AE3 A;  3PO2 G;  4OX9 L;  3OTO L;  4X65 L;  1VCI A;  2KCM A;  4B3S L;  3I56 A;  4JI6 L;  2UXD L;  2RHS B;  3HOV G;  1JMC A;  4RMF A;  2NVQ H;  3J81 i;  1YJW A;  1G29 1;  1XJV A;  4OX9 Q;  1I94 Q;  4BA2 I;  4IFD I;  1KXL A;  2Q2T A;  3WWV A;  3S1Q H;  5C4J H;  3AQQ A;  4LF5 Q;  2VY3 A;  1IXR A;  2HQL A;  3FHW A;  5C0X J;  2NVX H;  1EYG A;  1LUZ A;  3CC2 A;  4MTN A;  1PH7 A;  1VQ9 A;  1J5E Q;  2CCZ A;  4ALP A;  4DR7 L;  1Q1B A;  2HIX A;  4A3D G;  1CKO A;  5FLM G;  1UE1 A;  3PF4 A;  2ES2 A;  4DR6 Q;  3BJU A;  2CWP A;  2MNA A;  4GOP B;  1E7Z A;  2VL6 A;  4R4T A;  1JE5 A;  3RR5 A;  2Z6K C;  1LM0 A;  4PMW A;  1XMO Q;  1PH9 A;  3GDE A;  5IP9 H;  3GTL H;  2MQH A;  3BU2 A;  2N8N A;  4XIG S;  3T1H L;  4AIM A;  3NEM A;  5DLQ E;  4POF A;  2JA8 H;  3PUW A;  1LYL A;  2YTY A;  1WI5 A;  1EFW A;  4X64 Q;  2PQA B;  3CCM A;  4L5S A;  1CSP A;  2XGT A;  1EUJ A;  3I55 A;  3T1H Q;  4DUZ Q;  1SN8 A;  1PH1 A;  2IHE A;  1IBK Q;  4GN5 A;  1QUQ B;  1IYJ B;  1N9W A;  3KYH C;  3BZC A;  5FLM H;  3MEF A;  4DAM A;  5LMU L;  5IYC G;  1VQF A;  1V43 A;  2ZTD A;  4H02 A;  4APV A;  4AYB E;  5JJI A;  2R6G A;  3NEL A;  5AJ3 L;  1VQA A;  1TWG H; 
#chains in the Genus database with same CATH topology
 1XNQ Q;  1DV1 A;  4ODG A;  3T1H H;  3H0G G;  4JYA L;  2L0C A;  1N32 H;  5ELD A;  1NTG A;  2K5H A;  1FJG H;  3I4M B;  2E5L Q;  1V1O A;  1EY4 A;  1QZH A;  4JI7 L;  1LAB A;  5EZY F;  4O4I F;  4AQY Q;  2ID0 A;  4DL3 A;  2UUB L;  4QIW E;  4J9P A;  1B9M A;  1LT6 D;  2WP8 J;  4MV4 A;  3M7N A;  4RAY A;  4BA1 I;  5IYD H;  5ISR A;  3UDF A;  1IKM A;  4BBS H;  2R84 A;  3E5S A;  1A15 A;  2GVB A;  5KYI A;  3SE0 A;  1ROD A;  1NR2 A;  3L0O A;  3CW2 C;  4DR5 Q;  2WAQ A;  4LUV A;  2BR0 A;  1KRT A;  3MXN A;  2VUM G;  5JAV A;  4LW1 A;  1ICF B;  5BR8 H;  1PMR A;  4DUY L;  1Y1V H;  3TEH B;  2A69 C;  1TS3 A;  1KEE A;  3D0F A;  2N55 A;  4J9Q A;  4QGU A;  1T9H A;  4PG3 A;  1N33 L;  3MWY W;  3MFH A;  2A68 D;  2NVY H;  3M9B A;  3VYT A;  5D65 A;  4RGN A;  1KD1 C;  1L1O A;  3LML A;  2RDG A;  2DWC A;  2NYZ D;  2FKL A;  4K0K H;  2NUC A;  1PRT C;  1ASY A;  2PQE A;  4CKB A;  2DJF C;  1QVF A;  1DOK A;  2NUA B;  4EG0 A;  1QWY A;  3EQL C;  2W6N A;  1A2T A;  1NMF A;  2OQK A;  4HR7 B;  4L6T B;  2WB1 B;  2KUM A;  3BYY B;  2IT1 A;  3J7A V;  4C2M B;  2HDL A;  4DKA C;  2P0A A;  4O4H F;  2Z0S A;  2JEA I;  4JV5 L;  4RG1 A;  3J7A K;  1HR0 W;  5E4W C;  4NXM L;  3S24 A;  4B3R L;  1RJP A;  1K8M A;  3HP3 A;  2JA8 G;  1E1O A;  2XNA C;  3TN2 A;  4IPH A;  2NWG A;  4N9T A;  4DV6 L;  2BCO A;  4IN3 A;  1CM9 A;  5LMU Q;  2ZJT A;  2R8H A;  1KRS A;  1A63 A;  1GVP A;  1I7L A;  3SK8 A;  3KLR A;  2W9C A;  2R8K A;  1XMQ Q;  3Q8P B;  1CHQ D;  2IJ0 A;  2I87 A;  1N48 A;  1WOC A;  5M3M G;  5DG9 A;  4MZ9 A;  1FNV A;  4FU0 A;  5KT5 A;  3L4K A;  1S5B D;  3WO1 A;  5M5X H;  4C1N K;  2AGP A;  4Y52 H;  3KLS A;  3H20 A;  3MWD A;  3BAA A;  1C4Q A;  3U50 C;  4O3P A;  1P16 A;  2CZG A;  4LAA A;  4OGQ C;  1H9R A;  1PTO H;  5M3F G;  1ENF A;  1X65 A;  3KDF B;  4UAI A;  1GGO A;  4ZOL F;  4C3H H;  5JOB A;  3TS0 A;  4O1N A;  4UHV A;  1X54 A;  4DAY B;  2A19 A;  2D0O A;  3GV7 B;  2C2R A;  3Q1K A;  1PRT D;  4F7X A;  2R7L A;  4JI7 Q;  2EJG C;  2Q8I B;  1GM5 A;  1MD2 D;  3G6Y A;  3EA6 A;  3CCV A;  4RZQ A;  3IN5 A;  1T94 A;  2AKW B;  3M4O B;  4YAJ B;  2I5M X;  1QJO A;  5CV6 A;  4YWM A;  1EZ6 A;  1FNW A;  4EVO A;  4DV1 L;  1VQH A;  4JI1 Q;  3Q6S A;  4IWX A;  4ZUI A;  4LFA Q;  1K1S A;  1UEB A;  1YNX A;  3VR3 A;  2PYK A;  1N32 Q;  4C3J G;  2FLL A;  2EY6 A;  1J6Q A;  1Q46 A;  2AU0 A;  4LF9 H;  5L37 A;  3I73 A;  4HNT A;  1Q8I A;  2WB1 E;  4LNQ A;  1S0O A;  1IYV A;  1ZHS A;  5KFU A;  2A5H A;  2QEJ C;  3AB9 A;  2K5Q A;  2CH4 A;  1U5K A;  5EQ0 A;  2P5Z X;  4IRD A;  5C44 B;  3I3C A;  1A3U A;  2KHJ A;  3CKI B;  3H3V I;  5GRO A;  3RUZ A;  5JH7 F;  1KAB A;  4CKE A;  5CV8 A;  2ASL A;  5KRU A;  2HVS A;  5FLX W;  1TWC A;  5AFW A;  1A9X A;  3TQ1 A;  2PNR C;  3RB3 A;  5IY0 A;  4X62 Q;  4R8U B;  3PV0 A;  1VQM A;  1ICW A;  3KF8 B;  4JV5 Q;  1XPU A;  4PDB A;  2GVA A;  5I2X A;  1PH8 A;  1CI3 M;  1D2B A;  1BNC A;  4XYL B;  2VQF Q;  2R93 G;  1HNZ L;  3Q8R B;  1PZI D;  1O7Y A;  1EQQ A;  4B3T L;  4FF3 A;  1EUD B;  2I5L X;  1FR3 A;  4I7H A;  5C4X H;  1QVC A;  1STG A;  3H09 A;  1WCM H;  3ULP A;  2FMA A;  2A1A A;  2R3Z A;  2JA5 G;  2FK2 A;  4DV2 Q;  1G6Z A;  3OMG A;  4FDB A;  2K5N A;  3N41 B;  2F0Q A;  1EZ1 A;  3K5H A;  1SYC A;  1H9M A;  4ECY A;  3QZ8 A;  4A93 H;  2DNC A;  3MAQ A;  3S2H B;  2W9C B;  2AQ3 B;  4DK3 C;  1JCK B;  2L4N A;  3KAL A;  3X3M A;  1BCP B;  3NUC A;  3W5O A;  2PO4 A;  4KLK A;  4OEL B;  4WBN F;  3H4B A;  4OO1 I;  2I5H A;  2RF4 A;  2QDB A;  2PBZ A;  2YRX A;  4HNV A;  4IUV A;  4DR1 L;  5KG2 A;  4HCS A;  2ATL A;  1FNU A;  3M4Q A;  1PYB A;  5CR3 A;  3P20 A;  4DV4 L;  4EFB A;  3M85 A;  3HOW H;  4YY3 L;  1EQT A;  1LT4 D;  3NE5 B;  1ENC A;  3QO2 A;  3STB D;  1TWG A;  5KG4 A;  3J80 E;  5CB4 F;  4N9P A;  2R6F A;  5CV9 A;  1SYD A;  4DAP A;  4DR3 Q;  1Q7Y C;  4E6I A;  2NZH A;  2UUA Q;  4UFZ A;  5J3B A;  1DON A;  3A56 A;  5DQG A;  1JXL A;  5KNB A;  3D4W A;  2KED A;  1RTO A;  1YHB A;  2JA5 B;  1BBU A;  2R82 A;  1B44 D;  2V4D A;  1SND A;  3IKJ A;  1RJQ A;  1HZA A;  1NR4 A;  3ND8 A;  5JPM C;  2JEB I;  1L0X B;  2YTV A;  1II3 A;  3SVM A;  1I4X A;  3BVG A;  3PR4 A;  5KFR A;  3BG5 A;  3KHL A;  1SFO H;  4LF4 H;  1XNQ H;  4HID A;  1I4Q A;  3MVV A;  4LUO A;  4O3O A;  3ORR A;  4ME5 A;  2B63 B;  2R7D A;  4X3K A;  1Y1V G;  3UE0 A;  1HUM A;  5KNC A;  1IBM H;  3CU7 A;  2IL8 A;  4HSP A;  2FPI B;  3CQZ B;  5K2M A;  4IFD G;  2VS1 A;  1LTB D;  4R8U A;  4JBJ A;  2ASB A;  4KMU C;  3HB9 A;  2EYJ A;  1A2U A;  4DN4 M;  3EJI A;  4DV2 L;  3FPU B;  3TRE A;  5IYB G;  4CGY B;  5JJZ A;  3J81 c;  3NBH B;  4U7C A;  1PFN A;  1SJE D;  2XSC A;  1I50 B;  4ZRZ A;  3J80 i;  5IGG A;  4MV6 A;  3S1R H;  2VUM A;  1VKZ A;  2J6U A;  3U9O A;  5C44 G;  4JVZ A;  3GV5 B;  2I46 A;  5KFM A;  1I6H H;  4PWQ A;  4MA5 A;  1I5F A;  2I8C A;  4CC6 A;  2PNH A;  2A74 C;  3TP5 A;  5IGD A;  4GOP C;  1B3A A;  4DNT B;  1Q1E A;  2IWH A;  5GAG C;  5CAE B;  1E4E B;  1S9F A;  2D9U A;  4MV1 A;  1WTV A;  4P71 A;  3GD7 A;  4A93 B;  3OYY A;  3M4I A;  4TV8 F;  4X66 Q;  4A3I G;  1I6V C;  2VQD A;  4L8J A;  4ME6 A;  2FIN B;  1UEA B;  2Z1C A;  2PMZ B;  1DM0 B;  2XRS D;  1JWS D;  4DV7 Q;  1N34 L;  4J15 A;  5KFG A;  2K50 A;  2CWA A;  3HKZ G;  1TAE A;  1E2V A;  1SE4 A;  1VQC A;  4C3H G;  1OTC A;  4DNR B;  4CJ0 B;  3TP6 A;  1XMQ H;  1JLL B;  2GLT A;  1HH2 P;  1KNE A;  5KT6 A;  2F0N A;  4QW8 A;  4DV0 H;  4BBR H;  2IX0 A;  3TZD A;  5DAU A;  5K36 G;  1MSG A;  1Z2O X;  4A3F H;  4F88 A;  2YL2 A;  1GKH A;  5HGT A;  3I4M H;  2O4X A;  2UUC L;  2WDT A;  1SAP A;  4IPC A;  5C4H A;  3GTK B;  1Z2N X;  5EWF A;  1HJP A;  1B7Y B;  2MJ8 A;  4NP5 A;  4ECW A;  4G3I A;  4DF7 A;  2ZDG A;  4Q0Y A;  2F0G A;  3H91 A;  4J6H A;  4NPS A;  1A6X A;  1XTC D;  5LHY 1;  3S9W A;  3RJ0 A;  5IP7 H;  4DR7 Q;  1EFI D;  1GD7 A;  5LL6 S;  3J80 c;  1BVS A;  3HOY G;  3K81 C;  4DUZ H;  4JC0 A;  1A3T A;  3GTG H;  2UXB L;  3KF8 A;  5JVL A;  2RHQ B;  4I7Z C;  4XQJ A;  4K5V A;  3S1Q B;  3N43 B;  4C3H B;  1MGS A;  3R2T A;  4BBR B;  2R7M A;  2YZM A;  5DNF A;  5EPJ A;  2ZM6 Q;  5A2Q L;  2BH8 A;  1AUV A;  3L7Z C;  4H0L C;  5FLX c;  5KFF A;  1K0R A;  1LT5 D;  1PRT F;  3V6H A;  2N88 A;  4QWE A;  4H7B A;  1IBK L;  3CCQ A;  2ENB A;  3MWM A;  4A75 A;  3PW7 A;  3KLS X;  1YIT A;  2SNM A;  4A3L G;  2F4V H;  1XXG A;  4X66 L;  2K14 A;  3KAJ A;  1E4F T;  5DEH A;  5FPO A;  3SK4 A;  2V58 A;  1F2Z A;  4IPG A;  4XXE A;  5KFV A;  2ASD A;  1MJC A;  3J7A F;  1I6H B;  3GTK A;  3S15 B;  2FMC A;  1XPO A;  3S1R B;  4KD4 A;  1SYE A;  1STH A;  1EWC A;  1KQS A;  4IUR A;  4NW2 A;  1O7Z A;  2NBF A;  4KY5 A;  4AYB B;  1PV4 A;  2ATW A;  3GII A;  3L2P A;  4LFC H;  4JK1 C;  1TWA H;  1MI2 A;  2Q2U A;  3IFT A;  5KFD A;  4B3S H;  3OW2 A;  4OWT B;  4F87 A;  1RJT A;  4GNX B;  2D62 A;  1JJC B;  4KN4 C;  4DR4 L;  1LAC A;  4J9N A;  1N34 Q;  2XCP A;  2O2L D;  4CC5 A;  4IJH A;  1N33 H;  3I4N G;  3E6Z X;  3FRP B;  2QCP X;  4DV5 L;  2UUC Q;  2HGS A;  4DL5 A;  1Y1W A;  1TWC B;  3G7L A;  4ED3 A;  4DUY Q;  2F3I A;  4A3D H;  5D1O A;  1GUT A;  1AE3 A;  1ZXT A;  2ZT9 C;  1K0S A;  1GSO A;  1D5X C;  4X65 L;  2UXD L;  1J9O A;  1AFP A;  1RYR A;  1QG7 A;  3J81 i;  4A3F B;  2DLN A;  1G29 1;  2NVY A;  4WJW A;  3G6J B;  4OX9 Q;  4IFD I;  4B9X A;  4RZR A;  4IRC A;  5C4J H;  2O5J C;  4F50 A;  3AQQ A;  1U4M A;  5CV4 A;  4V0B A;  1IXR A;  2HQL A;  3FHW A;  4LMY A;  3CC2 A;  1VQ9 A;  2FJ2 A;  3DWA A;  4ALP A;  1Q1B A;  1B50 A;  2RGV A;  3MHB A;  1UE1 A;  3NBH A;  2RDF A;  2E2J B;  2B2U C;  4Z9C B;  4DR6 Q;  5C6A A;  5GON F;  4ECT A;  3PZP A;  4K14 A;  2LS0 1;  3NTI A;  2VL6 A;  4FVM A;  1JE5 A;  3RR5 A;  2Z6K C;  3M9O B;  3GDE A;  3GTL H;  4C5C A;  5KT4 A;  5KFZ A;  4MTE A;  3GV3 A;  3GIK A;  3OSP A;  4DGZ A;  3NEM A;  4POF A;  2YTY A;  1KJQ A;  4EEQ A;  2V4Q A;  2M2L A;  3CCM A;  4QWB A;  1EUJ A;  1IBK Q;  2IHE A;  2CHB D;  5KG5 A;  2W7P A;  4RGM A;  3KUP A;  3SHL A;  4FS1 A;  2K01 A;  1PYW D;  1GXD C;  4IHJ F;  4DV5 H;  4XT3 B;  5JVG 3;  4AYB E;  1V43 A;  4H02 A;  2NTS A;  4RB2 C;  3RBD A;  1EWH A;  2EVB A;  1VQA A;  3E3X A;  1HUN A;  2NU7 B;  4FS2 A;  4FXG C;  1T5E A;  2ASJ A;  1WTH A;  2CW7 A;  4OWX B;  3ERO A;  4DPG A;  1I4P A;  2V5A A;  2BE5 C;  1EHI A;  3JSL A;  1OXU A;  2K52 A;  4JI5 Q;  2JA5 A;  1J5E H;  1X3F A;  1I4G A;  3ONA B;  4GNX A;  1K3B C;  4K5W A;  4TVA B;  1LLR D;  5FO8 B;  4BWS C;  3PMF A;  3G4S A;  5LMU H;  3UI2 A;  2H4O A;  2UUB Q;  3E9I A;  2F0V A;  2UVV A;  4JI6 Q;  4ED1 A;  4JI2 Q;  4KKU A;  4C5B A;  4BXX G;  2RGR A;  2M00 A;  3GTO H;  3C3L A;  3HOU B;  5C3E G;  4RNN A;  4ECR A;  4GKJ H;  3OUZ A;  1SE2 A;  2JEF A;  3FKI G;  2EIF A;  5FD5 A;  1VQI A;  3LWE A;  1TWC H;  1B3Q A;  2WAQ B;  1L1O B;  1X3E A;  1HRJ A;  1A0I A;  1M0T A;  3DF7 A;  4C5A A;  5KFE A;  2OF1 A;  3AEV A;  1RD9 D;  1SEB D;  2ALY B;  3KBX A;  1TWF A;  2MCT A;  4BBR G;  1EY6 A;  1VMP A;  2KQ3 A;  1R9T H;  4EFE A;  5C0X G;  1D8L A;  1KJ9 A;  5DQH A;  1ZET A;  1CKN B;  2TMP A;  3V6K A;  1S97 A;  4A3G G;  3RV4 A;  4E4T A;  1ZYR D;  2B2W C;  1OXV A;  5DG8 A;  2JA6 H;  5EBC A;  1CQJ B;  4XTC S;  1IBL Q;  5FK9 C;  3GIM A;  2YTX A;  3RB0 A;  4C3I G;  4HJ7 A;  3RD4 A;  2V9W A;  1XNR H;  2UU9 Q;  3JRX A;  4ZQI A;  5KFC A;  2ZTE A;  1L1O C;  3GID A;  1PTO F;  1D7Q A;  3JZI A;  4DV3 Q;  1D6E C;  5ELN A;  2NVX A;  2MO1 A;  2J0T D;  3D3R A;  2G9D A;  2PMZ A;  3PUX A;  4UP7 A;  4HSV A;  2LKV A;  3CC7 A;  4NB3 A;  3A74 A;  1S40 A;  4JYA Q;  1VBH A;  1W2B A;  2EXD A;  3T56 B;  2JE6 I;  1IOW A;  1PH3 A;  3Q0A A;  2X0S A;  2B63 H;  4JV2 A;  5FO7 B;  2EJM A;  2BA1 A;  2XVS A;  4FBU A;  1S03 G;  3C46 A;  2QYZ A;  4IR9 A;  4RUA A;  5FJ8 G;  4ED0 A;  3UFX B;  4DAY A;  5F9L A;  5IWA Q;  3NEN A;  3ERS X;  4DK1 A;  3F2B A;  5BN4 A;  1SLJ A;  1K28 A;  2KCC A;  4XYM B;  5LMN L;  5EBD A;  4DV7 H;  4CDE C;  5HUR A;  5J39 A;  4IUP A;  5JEA G;  3PIP A;  1TY2 A;  1VQK A;  1IBM L;  5GAD C;  3TRZ A;  4A3K G;  3MTS A;  4OWW B;  1C7Y A;  2YZG A;  2CQO A;  2B3G A;  2NN6 H;  4EBE A;  1Q90 A;  3PGZ A;  3STB C;  3K59 A;  5EDW A;  2WII B;  3T4A C;  2K04 A;  5C5L A;  3CQZ A;  3S1N B;  1T3N A;  1I50 A;  1JX4 A;  2WAQ E;  2AWN A;  5A2Q E;  1SYX B;  4LF7 L;  3N42 B;  3HOU H;  5KG3 A;  2RDJ A;  2KBN A;  1EUC B;  4NMZ A;  1Z9F A;  4DK0 A;  2AUK A;  1PH2 A;  4OON A;  5C4Z A;  3VR4 A;  3NXW A;  5FO9 B;  3TQT A;  4PMC A;  2K32 A;  4L63 B;  3UDI A;  1SNC A;  3ND9 A;  1LV9 A;  3K7U C;  3MEH A;  4ZUJ A;  3RB6 A;  4TKO B;  3B6Y A;  4R4Q A;  5I9P A;  4BY1 G;  1JOR A;  1X6O A;  4MIU A;  2WTF A;  3VR5 A;  2MPM A;  4GC6 A;  5T1G A;  5JVH 3;  1GLV A;  4J1M A;  3ORQ A;  4X6A H;  1K8G A;  4NXM Q;  1EY9 A;  5FPR A;  2HHH Q;  3VYU A;  3OSO A;  4C1N I;  4JOI C;  3G6E A;  2BDO A;  1HNX Q;  1V51 A;  3GV8 B;  3Q22 A;  2B8F A;  4CDD C;  1VQD A;  1Q12 A;  3G6X A;  2AMC B;  3QR8 A;  3FKI A;  1PYS B;  2EPB A;  4DV3 L;  1DV2 A;  4R4I A;  5C4J B;  1ZYR C;  1STA A;  3PIO A;  1UE5 A;  4Q8E A;  1XMO L;  3U9S A;  1OXS C;  1I6U A;  4K6D A;  1QB5 D;  4G4K A;  2D2C C;  5J1Z A;  3HOY B;  5M5X B;  4UPA A;  4ED8 A;  4TV9 F;  3GLK A;  3BA8 A;  1QNU A;  1ULZ A;  4GKJ L;  1Z47 A;  1JWM D;  1T5X D;  5LA6 F;  4FF2 A;  1K1Q A;  4UCV A;  2EYF A;  1B33 N;  1E3P A;  4A4I A;  3BA9 A;  4UCR A;  5CBA E;  5LMN Q;  4X64 H;  3DLL A;  3PW2 A;  1HA5 A;  1KJ8 A;  1STN A;  1VQN A;  1DJR D;  3HKZ E;  3A7L A;  2E2H A;  3JAM L;  2B2V C;  1PFS A;  2F52 A;  2K1B A;  4ZKC B;  2Y0S G;  1LO5 D;  2ICE C;  1UNS A;  2EY5 A;  2I0Q A;  1VQB A;  2VQE H;  2VA3 A;  1QOH A;  2EJF C;  2R93 H;  2IX1 A;  3PW5 A;  2XC9 A;  1YZ6 A;  5D3I B;  4U67 3;  3D4D A;  4O0A A;  3TP8 A;  1JE4 A;  3R8B A;  1WTO A;  3PO2 H;  1HFN A;  4G7H C;  2UVR A;  2JP1 A;  3ZJY C;  5IE8 A;  1G2T A;  2JA7 B;  3HOV H;  1UNN C;  4U68 A;  2QDL A;  4KTA A;  3H0G H;  2C00 A;  2A6E C;  4ZAI A;  3WDN A;  1CS0 A;  4YY3 Q;  4K8J A;  3BYT B;  1Q3L A;  1UUP A;  3OOC A;  1CQI B;  5CBE E;  1NBW A;  4RU9 A;  3NPP A;  1RTN A;  2CQY A;  2NTT A;  4BY7 B;  1CUK A;  3HOZ B;  1F9Q A;  2LMC B;  2YS7 A;  4HJ8 A;  4MV3 A;  1N33 Q;  5KG1 A;  2FPG B;  1EY0 A;  5TSS A;  1VQG A;  5IYZ F;  5IWA H;  1SE8 A;  2Z9H A;  1KAA A;  4A3K B;  2F0I A;  4XQN A;  1TVX A;  4EGV A;  5GQO A;  4IOA A;  2X6G A;  5C3E H;  5KFX A;  3L4J A;  1SR3 A;  4LFC L;  2OCE A;  2HVR A;  2UXB Q;  4B3M L;  4BBS B;  3N8D A;  3RLN A;  1IL2 A;  5FKA C;  4DXG A;  4IOC A;  3NQI A;  4J9L A;  5DGA A;  5D14 A;  1HNZ Q;  1KJI A;  3JC6 6;  4B3T Q;  1AW7 A;  2WV6 D;  2OLS A;  2W9A A;  3FDS A;  2A6H D;  1EIH A;  2NN6 I;  3BDL A;  4OL7 A;  3T1Y H;  1WH2 A;  2ALZ A;  1TKW B;  3FVQ A;  5K5P A;  1L2F A;  5IYC H;  2ZM6 L;  3GTK H;  1EYZ A;  3U9T A;  4LF7 H;  4YJ3 F;  4F4W A;  1CA5 A;  2EOT A;  4FNF A;  1JKJ B;  3RFC A;  3HKZ B;  3CP0 A;  1WD0 A;  2YCH A;  1QE6 A;  3KBG A;  5IT9 E;  4J9M A;  1BBX C;  1S5F D;  1D5M C;  4L5Q A;  4GKJ Q;  1HHV A;  1HZ9 A;  5BR8 L;  4HMI A;  4YB8 B;  4NXM H;  5KFI A;  4DR5 H;  4A3J H;  4MTD A;  4RB0 A;  1IHZ A;  3RZO H;  3PCO B;  4C56 C;  3FMA A;  4F4Z A;  4C3I H;  4QCL A;  1XDN A;  3K5L A;  1M4V A;  5KG0 A;  3WOF A;  4DV4 Q;  1RHP A;  2YU9 A;  2QA4 A;  4I65 A;  3W2D A;  5KFT A;  4ABN A;  5C3W A;  1WD1 A;  2WKD A;  1Y1W H;  3GP7 A;  3GV6 A;  1GUW A;  3GTL B;  2AHO B;  4LJZ C;  1TS4 A;  2OXP A;  2RSO A;  3OHB A;  4K0K Q;  4RHS A;  4NXN H;  2R92 B;  1WVL A;  3NQT A;  4RB1 A;  3LGJ A;  2YYA A;  2E2I B;  5C44 H;  2C2D A;  5KG7 A;  1SSO A;  1A8V A;  2JA9 A;  3KHR A;  5DM7 3;  3CMA A;  1B6R A;  4TSS A;  1G51 A;  1BUV T;  2Q2I A;  3VA7 A;  4DV7 L;  3U58 A;  4B3M H;  1K3R A;  1GHK A;  1Y8P B;  2JA6 B;  1SMX A;  4O42 A;  4LFA L;  5KG6 A;  4DV2 H;  2K33 A;  2LFN A;  4DR2 Q;  5EKK A;  2XWB B;  4DR1 H;  2SCU B;  4X65 Q;  2UXD Q;  4A3I H;  4KJO A;  2HCI A;  3N40 P;  3PR5 B;  1VF7 A;  2OTL A;  1PLF A;  5DQI A;  2L55 A;  3PO3 G;  2R7K A;  2W6P A;  3TDQ A;  3GTM H;  5E1F A;  4IUN A;  5LP6 F;  4X3T A;  4DK6 C;  3GTL A;  3HS0 C;  4MNO A;  1XPR A;  2LSS A;  2L5T A;  4IQZ A;  2XCA A;  4JV5 H;  1KNA A;  4XYQ A;  4I50 F;  3SXH A;  3RV3 A;  2CFM A;  1B8A A;  1EQR A;  2GPS A;  1X3Q A;  5D8D A;  2H5X A;  1ESR A;  4B3S Q;  1TY0 A;  2G5D A;  1FJG Q;  1M8A A;  3PVX A;  2CKZ B;  4DV4 H;  3A8I E;  3DM3 A;  3GTO B;  4EBD A;  4V19 0;  5JJL A;  3GTQ H;  2DGY A;  3ITP A;  4RHR A;  3RGX A;  1BDO A;  2WB1 A;  2B2Y C;  4A3D B;  3D31 A;  4BY7 G;  2L15 A;  1W3S A;  4B3R Q;  3KXY T;  5C8Y F;  3PN1 A;  4F8M A;  1NE3 A;  3HKZ A;  3GTJ H;  3VDY A;  1YNN C;  2F0D A;  4YJ2 F;  2E2J H;  3I90 A;  4X3S A;  4DFA A;  1U4P A;  4JI5 H;  4U6P A;  1AN8 A;  3MWE A;  3SR1 A;  1E1T A;  3I4O A;  1NSN S;  4ZHQ F;  4EEY A;  5BR8 Q;  1YIJ A;  1NCV A;  4HNU A;  4LFB H;  3HKS A;  4GKK L;  4ULL A;  1SRO A;  1ZEQ X;  2ZM6 H;  1B6S A;  1HNZ H;  2IY5 B;  5KFJ A;  3S2D H;  2AGO A;  1LTI D;  2F0S A;  5COY A;  1E22 A;  5KFA A;  3GTO A;  2YRW A;  1TII D;  4IPD A;  1PTO C;  1WTQ A;  5KFK A;  3J80 W;  1NNX A;  1BCP D;  2JA7 H;  3I12 A;  2JA7 A;  4IFD J;  1SYB A;  3J81 E;  1L0W A;  1JOK A;  3K58 A;  2E2I A;  4P73 A;  4LF8 L;  1RK6 A;  5KFW A;  3IFD A;  1K9M C;  3AFP A;  3OPO A;  2SNS A;  5HGQ A;  3GTG B;  3NTK A;  4DR3 L;  5EKI A;  2UUA L;  4JI2 L;  2RQX A;  4J9K A;  1KL9 A;  4F4Y A;  2WB1 G;  1TA8 A;  3VMM A;  4GS3 A;  3OTO Q;  2NU6 B;  3S14 H;  2EZV A;  4JBW A;  1HR0 L;  4YWL A;  1SCU B;  2W71 A;  3K3P A;  4FXK C;  1S68 A;  3M9M B;  4M8A A;  4LF8 H;  1O78 A;  5T1I A;  5LL6 b;  3HOV G;  1SE3 A;  1JMC A;  4RMF A;  1KC7 A;  3QOJ A;  2RSN A;  3J80 L;  4EBC A;  2K6A A;  1XJV A;  2QIL A;  4BA2 I;  2Q2T A;  2K05 A;  1TT2 A;  3S1Q H;  1XMO H;  3NBI A;  4JI8 H;  2F4I A;  3QB3 A;  5EGT A;  3H94 A;  2VY3 A;  3BDO A;  4ZK9 B;  4LFB Q;  2NVX H;  1PH7 A;  1RF2 D;  2JYO A;  2XIW A;  4S3S A;  4CHT B;  1TWG B;  2W9B B;  3A8K E;  4A3D G;  5NUC A;  4GKK H;  3OWE B;  1EYD A;  2QF7 A;  1WCM A;  1EL0 A;  5KT2 A;  4B08 A;  1IOV A;  4I55 F;  2JN4 A;  3K5O A;  5D1P A;  1E7Z A;  3MFI A;  2W8L A;  1SNO A;  1S10 A;  4R4T A;  4PMW A;  3W3A A;  1Z6H A;  5JVD F;  2MQH A;  2EYP A;  1Y8O B;  3BU2 A;  4ZLT F;  3N52 A;  1IL8 A;  3PO3 B;  4AIM A;  2D5D A;  1B04 A;  3PUW A;  2F1M A;  4QIW A;  4R8I A;  4J9O A;  2JA8 B;  4X64 Q;  2PZW A;  4L5S A;  3I4L A;  2F3V A;  1CSP A;  2XGT A;  3T1H Q;  3H4D A;  1SN8 A;  4A3M B;  4QUC A;  1W93 A;  3NWT A;  3T16 A;  1N9W A;  4DAV A;  5FLM H;  1CK1 A;  5IYC G;  1H9S A;  2ZTD A;  5KIX A;  1AUX A;  4G7O C;  3NEL A;  1XWE A;  1TWG H;  3PW0 A;  4IUU A;  3I8Z A;  3RLO A;  2R92 H;  1AE2 A;  5HBR B;  3U4Z A;  4L1K A;  3RIZ A;  3C0F B;  2R92 A;  1WR2 A;  3D6C A;  2VPQ A;  3J7Y W;  1JDE A;  3L3O C;  1HZB A;  1IBM Q;  1SRU A;  4X65 H;  2UXD H;  3HEJ A;  4EYI B;  3PW4 A;  4A3J G;  4DV0 Q;  1JOQ A;  2F4V L;  2E76 C;  3S17 H;  5IIF A;  4IZ8 A;  2Q8R E;  3BVM A;  1Q86 C;  1A62 A;  4JI8 Q;  2UXC L;  1R4P B;  2DPI A;  4QJF A;  5M5Y H;  1TWF H;  1GOZ A;  2FP4 B;  4UCU A;  2K4K A;  1SNQ A;  3KHH A;  2MFI A;  3KFU A;  4A3M G;  1LTS D;  2R7Z B;  2NVY B;  4J0M A;  3H40 A;  2IW3 A;  1YJN A;  3HOX H;  1A3V A;  1MHW C;  1STE A;  2RKS A;  1HR0 Q;  3KAK A;  2M9V A;  5IOC A;  3CC4 A;  4DR5 L;  2N3S A;  3DHQ A;  5D3D A;  5I4D A;  3LNN A;  4O3N A;  4YCV A;  2ZXR A;  3CF5 A;  3J7A 5;  1FYC A;  5IYD G;  5KFB A;  4EQO A;  1IZ6 A;  4DR6 L;  1N36 Q;  4C2M H;  2K5W A;  4Y7N B;  2NVT B;  2AGQ A;  4A3J B;  1JIC A;  2LY7 A;  3DUZ A;  3IRB A;  1F9P A;  2B2T A;  1S3O A;  2E2H B;  3P1H A;  4DNI A;  2EYH A;  2VUM H;  2Z6K A;  1VQJ A;  1X3G A;  3FKI H;  1H9K A;  3CRL C;  3ZYY X;  4A3E H;  1DD2 A;  2B63 A;  1WTX A;  3K7A B;  4FF4 A;  2B2U A;  1DXM A;  3AYH B;  1KIX A;  1ML0 D;  4GC7 A;  2J6S A;  2OT2 A;  3CXC A;  1XMQ L;  5KND A;  2Y0S E;  1V1P B;  2XRQ D;  4QWD A;  3TII A;  4K2K A;  4LF6 L;  2WAC A;  3J7Z C;  3TIG A;  3KJO A;  2XGP A;  1UWV A;  2FPP B;  4YCU A;  3R5H A;  2NVX B;  3WOE A;  4JI0 L;  2EY1 A;  4A3G H;  1TWA B;  2UUC H;  2ICI A;  4NLG A;  4YR0 A;  3MXP A;  5KT7 A;  1HTL D;  4BY1 B;  2BQ3 A;  4HCE A;  5EWE A;  2E2H H;  1VF5 C;  3V05 A;  4A3B H;  3DXJ C;  1D1I A;  2E8G A;  2K5V A;  2JA8 H;  4X62 H;  1FGB D;  2F0F A;  2F0O A;  4JI3 L;  1BOS A;  4O2D A;  3RB4 A;  3MR2 A;  1W6K A;  1EEF D;  3U4V A;  3S1M H;  4JI4 H;  4JV1 A;  4A3L H;  1C3O A;  1KBL A;  4YIJ A;  1PFB A;  5LXT F;  5J2U F;  1K8A C;  4DV0 L;  1GUO A;  2GN5 A;  1G91 A;  4KD3 A;  4PQX A;  4M7E A;  2B63 G;  1NAP A;  4DV5 Q;  1SJH D;  2ZXO A;  4I4T F;  3OHX C;  2NU8 B;  1Q81 C;  2R7Z H;  5IGE A;  1N32 L;  4LF9 Q;  4GN3 B;  4O2B F;  1S4Z A;  4R7R A;  3JRW A;  4HYK A;  5DG7 A;  1SFO B;  4QQB X;  5IGC A;  1WJJ A;  2VQE L;  1N8R C;  3A7A B;  4POG A;  3GTP B;  5L1L A;  1YJ9 A;  2R8G A;  4BWG B;  4QY7 A;  3Q8S B;  5KGU A;  5JUM A;  4FO2 A;  3QZ7 A;  4EQN A;  5DLG A;  1YNJ C;  4LUZ A;  5KFH A;  3TIN A;  2SOB A;  4UDU C;  1ENA A;  2XWJ B;  3VYS A;  2YU9 B;  4OXP A;  1O7I A;  1B70 B;  2MP1 A;  3BVZ A;  4K5X A;  4CJ1 B;  4X62 L;  3CCS A;  1QZG A;  2FK1 A;  1I3Q A;  3KF6 A;  2A68 C;  4QF4 A;  2Y0S B;  1JDB B;  4GN4 B;  2QKI C;  2B2Y A;  1K83 H;  3ETJ A;  1BKB A;  3ER0 A;  1HNX L;  3K6O A;  3CCJ A;  4DR4 H;  4ETS A;  2VZA A;  1KDB A;  2PQA A;  4A93 G;  3AU7 A;  2VUM B;  4G57 A;  3JAM c;  4H13 C;  5C4X B;  2L12 A;  4KY7 A;  4JG2 A;  4KY6 A;  1EIY B;  2ZDH A;  4F4X A;  5DLF A;  3CD6 A;  3E5N A;  3S2H H;  4LK1 C;  4OEM B;  4XYO A;  4RH6 A;  4ECV A;  4ZI7 F;  3DM1 A;  2DNE A;  2J4X A;  1JR0 D;  2B8G A;  3J81 j;  2VQF L;  1TWA A;  5T14 A;  3D8G A;  2WYO A;  3VPC A;  2FLP A;  2DJG C;  1AEX A;  5I6Y A;  4ECU A;  1HZC A;  2J6T A;  4B3R H;  5C1O A;  4HAE A;  3QIA A;  1XNQ L;  3RAQ A;  1HNW H;  3ICE A;  3A55 A;  1PZJ D;  4PZ6 A;  5LMN W;  4GLA C;  5ELB A;  2VOB A;  3DEP A;  1H95 A;  4A3C G;  4IJL A;  4C3I B;  2HUG A;  4DR7 H;  1CSQ A;  3K0X A;  2DZD A;  4GLV B;  3F8T A;  4YP3 A;  5C4X G;  1TWF B;  3GTM A;  4IRK A;  2KEN A;  3P75 A;  1WCM G;  5M5W B;  1DCZ A;  4A3B B;  3BQ1 A;  2R8J A;  5L9X A;  5EKL A;  2VA2 A;  4AYB A;  1MIU A;  1CKN A;  1GHJ A;  3RZD B;  3R5F A;  3FMC A;  1ILP A;  4KHP H;  2RDH A;  2Q8T A;  1SYF A;  2QGQ A;  2I07 B;  4UCO A;  3JAM i;  1OXX K;  4HIO A;  4FBT A;  2EDG A;  4GOP A;  2SEB D;  5M3F B;  2PI2 A;  2WKC A;  2JQO A;  1RDP D;  5CGK A;  1Y1W B;  3MZ5 A;  4EQP A;  5L1K A;  3T5L A;  4P75 A;  3MC0 B;  4QIW B;  1YNJ D;  2AWO A;  4P2C B;  3RN2 A;  4MTK A;  4A3M H;  4YCW A;  4IAJ A;  3GTJ A;  1D1K A;  4ZYS A;  2R61 A;  4NXN L;  2Y0S A;  4EGQ A;  3TP7 A;  2RCN A;  1EYC A;  1I4R A;  4JI4 L;  4HIK A;  4EGJ A;  2E5L H;  2Q2H A;  2IPK D;  4LWC A;  2C22 A;  1AH9 A;  5E4X A;  1XX8 A;  1HNW L;  4B3M Q;  5C0X I;  2W57 A;  3KOJ A;  5C3X A;  4Q43 A;  1MKH A;  1ET9 A;  1ET6 A;  3UDG A;  1CQV A;  4DV6 Q;  1DOM A;  2YU9 H;  4DA2 A;  3S14 B;  1EY5 A;  1IBL H;  4RAU C;  1HQM C;  5KYL A;  2VXW A;  4O3S A;  1VQL A;  1L0Y B;  3T53 B;  3TZU A;  2KCT A;  3OIQ A;  3NK9 A;  1BBW A;  1Y1V A;  3MXG A;  3RUP A;  2YV5 A;  4UP8 A;  2JK8 A;  5I6W A;  3EPI A;  2X6L A;  2NZ1 D;  2A8V A;  2JA6 G;  4O2A F;  1M90 C;  3OSN A;  5M5Y B;  4OO1 G;  4IFD H;  1E2Z A;  1V1Q A;  4KHP Q;  3GO5 A;  1EOT A;  1YI2 A;  3T51 B;  5CA0 F;  1LTL A;  5EJW A;  3GQB A;  2BDN A;  3JAM E;  1W6J A;  4LF6 H;  1PTO D;  4M1U B;  2IX3 A;  4YAK B;  2IBK A;  3CCR A;  4EQ5 A;  4RWS C;  3KLW A;  3OW7 A;  2Z4H A;  4G7Z C;  5IT9 L;  3NGD A;  1JC7 A;  5DM6 3;  3KJP A;  1R9T A;  4KJN A;  4O4L F;  4JI5 L;  1IW7 C;  2OQ0 A;  5EPL A;  2KOL A;  5KT3 A;  3K3V A;  1WTP A;  3ULL A;  2ZJQ A;  3EVQ A;  2XGQ A;  4BS9 A;  2YS6 A;  4HIM A;  2RA4 A;  1U9R A;  4LF7 Q;  5COR A;  3X3N A;  3A0J A;  4QWA A;  3BQ2 A;  2DY8 A;  3LX0 A;  5CV7 A;  1M1K C;  3HOY H;  3BJY A;  5JEA H;  1Y1W G;  4DR6 H;  2B2V A;  4A3K H;  4LSA A;  3T5J A;  3PUV A;  3NHH A;  3GIJ A;  2OEO A;  3PUZ A;  2L11 A;  2AQ4 A;  2BQR A;  1Y8N B;  2E74 C;  5H1S E;  2DN8 A;  3MR5 A;  1V1P A;  1EY8 A;  1YEZ A;  4YHH Q;  3QFF A;  4J8Q A;  3G6V A;  1S5C D;  3SEB A;  2FK3 A;  3W1G A;  3HOU G;  1GJX A;  1RL2 A;  2FFK B;  3ERQ A;  1SNP A;  1QUQ A;  5A2Q W;  3NP8 A;  1S0M A;  1VBG A;  1TWH A;  2KHS A;  2R87 A;  3P7J A;  4WFN 3;  5G3L F;  4IZO A;  3ULJ A;  1BXT A;  4OIK A;  2NVQ B;  5I9O A;  4CDC C;  4BY1 H;  4NXN Q;  4ECS A;  4JI4 Q;  4APM A;  1RYS A;  2HHH H;  5K36 H;  1JOO A;  1C48 A;  1BGW A;  3GIQ A;  4YY3 H;  4ZQ3 A;  3I4M G;  1JJ2 A;  3J81 W;  1IW7 D;  1HNW Q;  3A8J E;  4MV7 A;  3N6R A;  3V4S A;  1PA6 A;  1DIK A;  5HV6 A;  4FF1 A;  2EQS A;  5M9O A;  4RFB A;  1OO9 B;  4JOI A;  2KJX A;  3VR2 A;  1B2T A;  4ILW A;  1KTK A;  4A76 A;  3C1E A;  2UXB H;  3M4O H;  3K0Y A;  4M9U A;  1VQ4 A;  2E2I H;  2UUB H;  1S0N A;  3K7A H;  3OUU A;  1MJE A;  3PQI A;  5C5M A;  3NWS A;  3UE1 A;  3HOZ H;  3I4N H;  3HOX B;  4XX0 B;  3CQZ H;  4CJ2 C;  4UY8 C;  1M7J A;  4HR7 A;  2ZJP A;  4GLX A;  4PMB A;  1SFO A;  4FYD A;  1AZP A;  4GKK Q;  3CPW A;  4MHE A;  1DZ1 A;  1CTM A;  1I7N A;  5HY6 A;  1J8I A;  3CRK C;  1Q82 C;  1EOV A;  4IO9 A;  1H9S B;  2SDF A;  2F03 A;  5IT9 c;  3VA5 A;  1C30 A;  5AJ3 Q;  2JA6 A;  5BPF A;  3S15 H;  3UDX A;  1SBB B;  2C35 B;  4C3J H;  5KFY A;  4DV6 H;  1VQE A;  1O80 A;  4LF4 Q;  1PH6 A;  1RJR A;  4YHH L;  3CPF A;  5E7N A;  4RNM A;  4C2M A;  1E2W A;  1TQO A;  4R4O A;  3SGI A;  3Q8Q B;  3H3V H;  1E24 A;  3M4P A;  2FB9 A;  2DPJ A;  3PO2 G;  3TSS A;  3OTO L;  1VCI A;  2KCM A;  4TRD A;  4B3S L;  5J2T F;  4O3Q A;  2UU9 H;  1LTR D;  3S17 B;  2EE1 A;  1HCZ A;  1PTO B;  1YJW A;  1X32 A;  1TR5 A;  4Q45 A;  1QNK A;  2MUY A;  4FXD A;  1KXL A;  4JV0 A;  3WWV A;  5M3M B;  1GSA A;  5BPH A;  2KEE A;  1G8Z D;  4LF5 Q;  1FKA H;  5C0X J;  1HPC A;  4FP5 D;  1EYG A;  1LUZ A;  4MTN A;  2K5D A;  1J5E Q;  1SNM A;  4QMG A;  2CCZ A;  2QW7 A;  2R93 A;  5IGF A;  2HIX A;  5ELE A;  1BO0 A;  1CKO A;  2HD3 A;  3DWP A;  5KKN B;  4OX9 H;  3PF4 A;  2B39 A;  1S5D D;  1EEI D;  1SXT A;  4JI0 H;  4B9W A;  3BJU A;  1RK5 A;  2RDI A;  4LF5 H;  3MXU A;  2B2W A;  1XMO Q;  1PH9 A;  2PW5 A;  5IP9 H;  3MFY A;  1N34 H;  2N8N A;  4XQQ A;  4XIG S;  3H0G A;  3DEO A;  3D6W A;  5EPK A;  5DLQ E;  4UCT A;  2I80 A;  1JQY D;  1LYL A;  5CA1 F;  1WI5 A;  3R3O A;  2E2D C;  4H44 C;  1EFW A;  2W70 A;  3SK5 A;  4KHV A;  1ZQ7 A;  2XCL A;  4JI7 H;  4ZCK A;  2ZDQ A;  5E3F A;  3L9A X;  3K5M A;  4CKC A;  5C3E B;  2W6Z A;  1IYJ B;  1AZQ A;  3KYH C;  3BZC A;  3MEF A;  4DAM A;  5LMU L;  4RB3 C;  2F0P A;  2KA7 A;  5F2D A;  1VQF A;  5JJI A;  1NUC A;  2HJW A;  3BDC A;  4LH7 A;  2R6G A;  3M4Y A;  3MR3 A;  2C9O A;  5CMD A;  4KN7 C;  3CCE A;  1M0W A;  5IT9 W;  3TQY A;  2PZT A;  3HRZ C;  4QUF A;  1CT1 D;  2L1B A;  4KKT A;  1CFM A;  1LTG D;  3CCU A;  2V1C C;  3QJY A;  3E9H A;  4KHZ A;  2F0W A;  4OO1 H;  2JXM B;  4ID6 A;  4RKB A;  1RIP A;  4DR1 Q;  2Z6B A;  1YHQ A;  1VDZ A;  4GNX C;  4MV8 A;  1Y14 B;  2F4V Q;  4DLK A;  3GTQ B;  3R2I A;  2JEJ A;  1STY A;  3PO2 B;  1EU4 A;  4KV6 A;  2C2E A;  1R4Q B;  1FVI A;  1NY4 A;  1WTW A;  1FGU A;  1YHA A;  5CV5 A;  2VQE Q;  4QB4 A;  2OH2 A;  1KHI A;  5BN5 A;  2CQA A;  4WD3 A;  5KFO A;  5BN3 A;  4LF5 L;  3S16 H;  1TWH B;  5L1J A;  1SMY D;  4LFB L;  2LXK A;  1KLU D;  4MN3 A;  4DL2 A;  2RBM A;  1TS2 A;  4DR3 H;  2UUA H;  3O13 A;  1F77 A;  2RVL A;  4HN7 A;  1EU3 A;  2F0L A;  4ME3 A;  3URY A;  3C2P A;  2UVU A;  3R23 A;  2PMZ E;  2J7Z A;  3RBE A;  4QL5 A;  3HOW B;  2EXZ A;  3BS1 A;  1I94 L;  1AN7 A;  1GSH A;  2VUG A;  3KTM A;  1GUN A;  4XZ3 B;  4BXX H;  3TS2 A;  3RZD H;  1IBL L;  4LFC Q;  4LSX A;  1PX2 A;  1B1Z A;  2EYM A;  2XIG A;  3RAX A;  3EIV A;  4O3R A;  3RLF A;  2UU9 L;  2O03 A;  4X64 L;  3K5I A;  1E4G T;  4CBV A;  2EYL A;  2KEC A;  2B2T C;  2HDM A;  2XTI A;  3KHG A;  1R9T B;  1EZ8 A;  3H6M A;  2KSW A;  4JBM A;  4DU9 A;  2K03 A;  3SK6 A;  3S16 B;  1KJJ A;  2W7O A;  4YQW A;  4IWY A;  1PVO A;  4YHH H;  1U0L A;  1F9R A;  1FD7 D;  2NB0 A;  5A35 A;  1JJG A;  1K8O A;  1CA6 A;  2V59 A;  4DL6 A;  2NN6 G;  3MJF A;  1ESF A;  4J9S A;  4JI6 H;  4DR2 H;  4LF6 Q;  3H0G B;  2C5C A;  4Q5V A;  1KC8 C;  1ZKO A;  4DV3 H;  1XTD A;  3E0J A;  5GAE C;  1EWI A;  2YYZ A;  3T1Y Q;  2FE3 A;  2KVM A;  2WIN B;  2G9H D;  3JSN A;  2EYO A;  4JI0 Q;  1Q8K A;  1CQF A;  5FD6 A;  1FL0 A;  4LMQ D;  3T5H A;  2K7V A;  4JI8 L;  2F0H A;  2UXC Q;  3OIP A;  2A69 D;  4AH6 A;  2J9G A;  2K75 A;  2F3W A;  2HCC A;  2A6E D;  2E5L L;  4Y8V B;  1X56 A;  3SDZ A;  3PF5 A;  1RKN A;  4DV1 Q;  2R7N A;  2VQF H;  1G2S A;  4N8X 1;  1Y1V B;  2DIK A;  3GTQ A;  1VQP A;  1HQR D;  3Q24 A;  1HTP A;  1MBY A;  1C8C A;  1STB A;  2RCF A;  5FJ8 H;  3KK7 A;  1WCM B;  4A3B G;  3RTX A;  2AQ2 B;  1UE6 A;  2JA7 G;  1CE8 A;  1JB3 A;  1MSH A;  2F0T A;  1HA6 A;  3M3Y B;  3BAB A;  3S2D B;  1VQ6 A;  2W6M A;  5G3L D;  1HXY D;  5KFS A;  2W8K A;  2CH4 W;  2ZXP A;  2R85 A;  3A5Z B;  1EIG A;  5H80 A;  4N8F A;  1TXY A;  1HNX H;  3EN2 A;  2FLN A;  4KK7 A;  1SMY C;  2CW0 C;  2HHH L;  1QCB D;  1IKL A;  2R7F A;  3N6X A;  1C9O A;  4HQ6 A;  3M3Y H;  1UC9 A;  1PH5 A;  1X55 A;  1V8Q A;  4EX5 A;  3CCL A;  1KDC A;  4QWC A;  4JYA H;  3HFZ B;  3LWU A;  2A6H C;  3BG3 A;  4JCV E;  4PNY A;  1L2Z A;  4IUT A;  3RMH A;  2DUD A;  1KAW A;  1VQ7 A;  3GIP A;  2X69 A;  2JA5 H;  2WFW A;  1FJG L;  3LWB A;  1VQO A;  1ILQ A;  4RKL A;  2EY2 A;  2BOS A;  2E75 C;  4LH6 A;  4MAM A;  4YBZ B;  2N49 A;  4DL4 A;  1PRT B;  3MXN B;  3V4Z A;  4JBK A;  4R9W A;  1AP0 A;  2OWO A;  5LMN H;  1SEI A;  2VW9 A;  1F2M A;  4PV1 C;  1VS0 A;  3M7G A;  4JI3 Q;  3OMC A;  3PUY A;  2CW8 A;  1GO3 E;  3HOW G;  2D0P A;  2AUJ D;  3FP9 A;  4HTH A;  3H3V C;  2PPB C;  5IP9 G;  3CVZ A;  4IR1 A;  2JSO A;  3BZD B;  4EYH B;  3T1Y L;  1CZG A;  2CVR A;  3HGB A;  4WRD A;  3BZK A;  3SI8 A;  1PZK D;  4HMJ A;  3IG0 A;  3GTP A;  4ED7 A;  3GTP H;  3K57 A;  4L5T A;  1JIH A;  5JEA J;  5JQW A;  3FDT A;  4LF9 L;  2VPS A;  2F0J A;  3LP8 A;  3WO0 A;  2NU9 B;  1HR0 H;  2Z4I A;  1B4O A;  2NVT H;  3FKI B;  5KFL A;  2KHI A;  1WYD A;  5KX5 F;  5DGB A;  2R93 B;  4RA8 A;  2R92 G;  2JEG A;  3Q8D A;  4A2B A;  3UQ8 A;  2AQ1 B;  1TWH H;  2QEX A;  3MR6 A;  4R1J A;  5CC4 A;  1G6P A;  1YBY A;  4Y7N H;  3Q23 A;  3RNU A;  4YWK A;  2YW2 A;  4JI1 L;  2XD4 A;  3F2D A;  5I47 A;  3IL8 A;  2MHV A;  1DGS A;  3KDF A;  2PI2 E;  4RUC A;  3MA2 B;  4A3E B;  1EYA A;  2JJQ A;  3EFX D;  3CAM A;  4ECX A;  2LXJ A;  4RAZ A;  4YR2 A;  2CW0 D;  2MO0 A;  1N36 L;  3AMU A;  4KKS A;  3T13 A;  5IYB H;  1BNZ A;  4TQU S;  1LTT D;  4JUZ A;  4JI3 H;  1CZW A;  1QIL A;  2PW7 A;  2L9H A;  4WJ4 A;  4HJ5 A;  4HJA A;  1LT3 D;  3HOX G;  1PFM A;  2F0U A;  3EBE A;  2OTJ A;  2TSS A;  1HFG A;  4AQY H;  1X9N A;  4WOR A;  4LFA H;  2NZO A;  2F0K A;  5F9N A;  1XYI A;  4HJ9 A;  5KEE A;  3H15 A;  1T36 A;  1NJI C;  5LL6 X;  3OWF A;  5J22 A;  1UC8 A;  3PIP 3;  4AYB G;  1D5Z C;  3I7F A;  5CYU A;  3W1B A;  4C3J B;  2JEI A;  1U4L A;  4UP9 A;  5KFN A;  2K28 A;  4RNO A;  1W96 A;  1M6V A;  1P8L A;  1B53 A;  4XDX A;  4A3E G;  5I2Y A;  1BQQ T;  1BF4 A;  1ASZ A;  3A54 A;  1YVC A;  2PCF B;  2VB3 X;  1PXU A;  1PDQ A;  3V96 A;  5JPN C;  5M5W H;  1VQ8 A;  1BJT A;  1YNN D;  4R8N A;  1E4E A;  1XNR L;  1EY7 A;  1JB7 A;  3G48 A;  1VMC A;  3CHB D;  4K2L A;  1I3Q B;  4L5R C;  4BBS G;  1JWU D;  4K0K L;  3Q2O A;  1B9N A;  3I70 A;  1CHP D;  1RCV D;  1S72 A;  3RGZ A;  4A3F G;  3F1Z A;  1V9P A;  1JT8 A;  2QK4 A;  2GPW A;  2UVW A;  5FOB B;  4CDF C;  3HG9 A;  2N78 A;  2IA6 A;  5FLX E;  3VPB A;  3NTH A;  1BCP F;  2IHF A;  3K8A A;  4LF4 L;  2HT1 A;  3KF6 B;  3F2U A;  1KDA A;  4GZY C;  3FPP A;  5IP7 G;  1QVG A;  1Z7T A;  2Z8L A;  1UE7 A;  4B3T H;  1DYQ A;  3E0E A;  4DR4 Q;  1CKM A;  3GQC A;  5IGB A;  1SYG A;  5C0X H;  4X3U A;  4ECQ A;  1F2Y A;  5EAY A;  4TUY F;  2MGS A;  2ZJR A;  2VNU D;  1K83 B;  4DR2 L;  3C1F A;  4BY7 H;  1I50 H;  1GUS A;  1H9J A;  1UAP A;  2R7Z G;  1PHJ A;  4UCS A;  5D1O B;  1ZHQ A;  5JJK A;  3IAY A;  2BH2 A;  2BQU A;  1J5E L;  1BR9 A;  1I4H A;  3RF2 A;  3AFQ A;  2R86 A;  4TQR A;  1IBK H;  2F0M A;  4PZ8 A;  1X3P A;  4Q8F A;  1TS5 A;  4DL7 A;  1OXT A;  1KLG D;  3EPG A;  3I72 A;  5M3M H;  4X66 H;  4A2A A;  5ELF A;  1WTR A;  2F0E A;  3PO3 H;  4KI0 A;  3N44 B;  1ONL A;  2FXQ A;  2ZTC A;  4J9R A;  1F2L A;  3D4R A;  4TQS A;  2B29 A;  1PK8 A;  1C0A A;  5LYJ F;  4KHP L;  4A3G B;  3V2T A;  5ELO A;  5M3F H;  3G71 A;  4XT1 B;  3MFG A;  1IYU A;  4NDX A;  3PIO 3;  3FEW X;  4JW0 A;  4NKL A;  2WE6 A;  3S1N H;  4DUZ L;  3WNZ A;  1WFQ A;  3OHA A;  1VQ5 A;  1DOL A;  3I91 A;  4P74 A;  2W6O A;  3QWN A;  1MZB A;  3GTJ B;  2VB2 X;  3VYR A;  1NMG A;  3TME A;  1I94 H;  3F2C A;  1XNR Q;  3V6J A;  3S1M B;  3K80 C;  4JI2 H;  3F8N A;  1K73 C;  4PZ7 A;  3RZO B;  2WAQ G;  2H1E A;  5IWA L;  2KCN A;  2DY7 A;  5IOD A;  4K6L A;  3PSI A;  4AQY L;  3A5U A;  3VR6 A;  2HVQ A;  5C5J A;  3RN5 A;  3SE7 A;  2M05 A;  2PVP A;  3R5X A;  1SDF A;  1N56 A;  3QG1 A;  2A73 B;  2XN9 C;  1BCP C;  5GAH C;  2HIV A;  5C1P A;  1V4Y A;  3HOZ G;  4P72 A;  4R4C A;  2FHT A;  1F9S A;  1S5E D;  3CME A;  4LF8 Q;  2C28 A;  1EQV A;  1PH4 A;  3JAM W;  1EIF A;  4A3C H;  2IP4 A;  3G8C A;  1Y69 U;  3I2Z A;  5L1I A;  4RGO S;  1I3Q H;  2BA0 A;  4HED A;  4WJ3 M;  2GA4 B;  2FJZ A;  1VAJ A;  2YZN A;  3GTM B;  4OX9 L;  3J81 L;  2R8I A;  1K83 A;  3I56 A;  4JI6 L;  2O5I C;  4ZKB B;  2RHS B;  1BXR A;  4MV9 A;  4RCO A;  2NVQ H;  4A3I B;  3HBL A;  2V4R A;  3DMU A;  4I7A A;  1I94 Q;  4ECZ A;  4ED2 A;  4RGT A;  4MA0 A;  3BQ0 A;  5KFQ A;  5KFP A;  3VPD A;  3HZX A;  3QOL A;  3ETH A;  4DR7 L;  4OHJ A;  3GTG A;  4Q0F A;  4IAL A;  1Z2P X;  2UXC H;  3TBI B;  5FLM G;  5BMV F;  1OWT A;  2ES2 A;  3I4N B;  5EOY A;  2IMW P;  1E0B A;  2CWP A;  4RCN A;  3DWQ A;  4JPB W;  5FLX L;  2MNA A;  1LTA D;  4GOP B;  4FM9 A;  2BE5 D;  1LM0 A;  4K8I A;  4ED6 A;  2R7Z A;  1TU2 B;  3T1H L;  5EWG A;  1GYF A;  3NSW A;  4QW9 A;  4DV1 H;  4DUY H;  1O75 A;  4DXF A;  1O7L A;  4YR3 A;  5ELC A;  1U4R A;  2PQA B;  3HOV B;  4JI1 H;  2W6Q A;  4IUQ A;  3I55 A;  2PZU A;  1PH1 A;  4DUZ Q;  3M9N B;  2HQE A;  3EYY A;  4Q44 A;  4GN5 A;  1QUQ B;  2PN1 A;  1GUG A;  5LOV F;  3R93 A;  4OIJ A;  2FMM A;  2VR1 A;  1N36 H;  3T5K A;  3HXL A;  4APV A;  3OTO H;  1WSC A;  5AJ3 L;  2W9B A;  3GIL A;  3K5N A; 
#chains in the Genus database with same CATH homology
 4JI3 Q;  1XNQ Q;  3CCE A;  3RLO A;  3TQY A;  3H0G G;  2R92 H;  1AE2 A;  4JYA L;  3U4Z A;  1NTG A;  2K5H A;  4OWX B;  4DPG A;  1HZB A;  1IBM Q;  3CCU A;  2V1C C;  2E5L Q;  1SRU A;  1QZH A;  4JI7 L;  1OXU A;  2K52 A;  3E9H A;  4KHZ A;  4JI5 Q;  4A3J G;  4DV0 Q;  4AQY Q;  2ID0 A;  1X3F A;  4QIW E;  4DR1 Q;  1RIP A;  2UUB L;  2F4V L;  4GNX A;  3S17 H;  4TVA B;  2WP8 J;  1YHQ A;  3M7N A;  3G4S A;  1A62 A;  1Q86 C;  4JI8 Q;  2UXC L;  4BA1 I;  5IYD H;  4GNX C;  3UDF A;  1Y14 B;  2UUB Q;  3E9I A;  4QJF A;  2F4V Q;  4BBS H;  4JI6 Q;  2GVB A;  5M5Y H;  4JI2 Q;  1TWF H;  3L0O A;  2K4K A;  3CW2 C;  4BXX G;  1FVI A;  4DR5 Q;  1NY4 A;  3GTO H;  2MFI A;  4LUV A;  3KFU A;  1FGU A;  1YHA A;  5C3E G;  4A3M G;  1KRT A;  2VQE Q;  2VUM G;  4LW1 A;  3FKI G;  2EIF A;  1KHI A;  3HOX H;  1Y1V H;  4DUY L;  1YJN A;  1HR0 Q;  3TEH B;  1VQI A;  1TWC H;  3CC4 A;  4DR5 L;  2N3S A;  4LF5 L;  3S16 H;  4LFB L;  2LXK A;  3D0F A;  1L1O B;  4QGU A;  1T9H A;  4PG3 A;  1N33 L;  1X3E A;  1A0I A;  4YCV A;  3CF5 A;  3J7A 5;  4ME3 A;  2NVY H;  3M9B A;  5IYD G;  2PMZ E;  1IZ6 A;  1KD1 C;  1L1O A;  1N36 Q;  4C2M H;  3AEV A;  4DR6 L;  2ALY B;  4QL5 A;  1I94 L;  1ASY A;  4BBR G;  1QVF A;  1R9T H;  4BXX H;  3IRB A;  5C0X G;  1D8L A;  3RZD H;  1IBL L;  4LFC Q;  3TS2 A;  1CKN B;  1NMF A;  1S3O A;  2OQK A;  4DNI A;  4A3G G;  2VUM H;  2Z6K A;  1VQJ A;  1X3G A;  2IT1 A;  3FKI H;  4A3E H;  3EIV A;  1OXV A;  2JA6 H;  3RLF A;  4DKA C;  2UU9 L;  2Z0S A;  4X64 L;  2JEA I;  4JV5 L;  4RG1 A;  4XTC S;  1IBL Q;  1HR0 W;  4NXM L;  2XTI A;  3S24 A;  4B3R L;  2YTX A;  3AYH B;  1KIX A;  2JA8 G;  4HJ7 A;  1E1O A;  3CXC A;  4IPH A;  1XMQ L;  4DV6 L;  2UU9 Q;  4JBM A;  2Y0S E;  2ZTE A;  1L1O C;  1KRS A;  5LMU Q;  1A63 A;  1GVP A;  1D7Q A;  4DV3 Q;  5ELN A;  1PVO A;  2MO1 A;  4LF6 L;  3J7Z C;  3PUX A;  4UP7 A;  1U0L A;  3KJO A;  3CC7 A;  1XMQ Q;  4NB3 A;  3A74 A;  1S40 A;  1UWV A;  2NN6 G;  4YCU A;  1W2B A;  2EXD A;  1WOC A;  4JYA Q;  2JE6 I;  5M3M G;  4MZ9 A;  1PH3 A;  4JI0 L;  4A3G H;  2B63 H;  5M5X H;  4LF6 Q;  4Y52 H;  2BA1 A;  1KC8 C;  1XTD A;  5GAE C;  1EWI A;  2YYZ A;  3T1Y Q;  3U50 C;  1P16 A;  5FJ8 G;  2E2H H;  4A3B H;  4JI0 Q;  5IWA Q;  2K5V A;  1Q8K A;  2E8G A;  3NEN A;  3ERS X;  1FL0 A;  3F2B A;  5M3F G;  1SLJ A;  1X65 A;  3KDF B;  4JI8 L;  2UXC Q;  4C3H H;  4JI3 L;  3TS0 A;  4O2D A;  4AH6 A;  5LMN L;  1X54 A;  2K75 A;  3U4V A;  2A19 A;  2D0O A;  4DAY B;  3S1M H;  5JEA G;  3PIP A;  1VQK A;  4A3L H;  1IBM L;  2E5L L;  5GAD C;  3TRZ A;  4A3K G;  4OWW B;  4JI7 Q;  1C7Y A;  2CQO A;  1X56 A;  2B3G A;  1K8A C;  4DV0 L;  3PGZ A;  3STB C;  3PF5 A;  1GM5 A;  2GN5 A;  3CCV A;  4DV1 Q;  2B63 G;  2AKW B;  2I5M X;  4DV5 Q;  2WAQ E;  2AWN A;  4YWM A;  1VQP A;  4LF7 L;  3HOU H;  5FJ8 H;  1Q81 C;  2R7Z H;  4A3B G;  1N32 L;  4LF9 Q;  2KBN A;  1UE6 A;  4GN3 B;  4DV1 L;  1VQH A;  4JI1 Q;  2JA7 G;  1Z9F A;  1PH2 A;  4QQB X;  4OON A;  4LFA Q;  1VQ6 A;  1WJJ A;  1UEB A;  1YNX A;  3UDI A;  2VQE L;  3K7U C;  1N8R C;  4POG A;  1N32 Q;  3A5Z B;  3B6Y A;  4R4Q A;  4BY1 G;  1X6O A;  1J6Q A;  1Q46 A;  1TXY A;  3EN2 A;  1YJ9 A;  4QY7 A;  2WB1 E;  4LNQ A;  2HHH L;  2R7F A;  1C9O A;  3M3Y H;  4LUZ A;  1U5K A;  1X55 A;  1PH5 A;  4EX5 A;  3CCL A;  4X6A H;  1K8G A;  2KHJ A;  3HFZ B;  3H3V I;  4NXM Q;  5GRO A;  4JCV E;  2HHH Q;  1O7I A;  1B70 B;  4OXP A;  4JOI C;  3G6E A;  4X62 L;  3CCS A;  1HNX Q;  2DUD A;  1KAW A;  1QZG A;  3KF6 A;  1VQ7 A;  1VQD A;  1Q12 A;  2JA5 H;  2WFW A;  2AMC B;  1FJG L;  4GN4 B;  1PYS B;  1K83 H;  4DV3 L;  1BKB A;  4R4I A;  3ER0 A;  1VQO A;  1HNX L;  5IY0 A;  4X62 Q;  3CCJ A;  2N49 A;  2VZA A;  3PV0 A;  1UE5 A;  2PQA A;  3PIO A;  1VQM A;  1XMO L;  3KF8 B;  4A93 G;  3MXN B;  1XPU A;  4JV5 Q;  3JAM c;  4JBK A;  1OXS C;  2GVA A;  2OWO A;  1PH8 A;  4JG2 A;  1EIY B;  2VW9 A;  4UPA A;  2VQF Q;  2R93 G;  1HNZ L;  3CD6 A;  1EQQ A;  4B3T L;  4GKJ L;  2I5L X;  1Z47 A;  3S2H H;  5C4X H;  1QVC A;  1VS0 A;  1E3P A;  4A4I A;  3PUY A;  3J81 j;  1WCM H;  1GO3 E;  2VQF L;  3ULP A;  2A1A A;  2D0P A;  3FP9 A;  5LMN Q;  4DV2 Q;  2JA5 G;  3HOW G;  3DLL A;  4FDB A;  2K5N A;  1VQN A;  5IP9 G;  1HZC A;  3HKZ E;  1XNQ L;  4A93 H;  3ICE A;  4DK3 C;  3T1Y L;  1PFS A;  2F52 A;  3W5O A;  3BZK A;  4PZ6 A;  5LMN W;  4GLA C;  2Y0S G;  4KLK A;  2I0Q A;  1VQB A;  2I5H A;  4OO1 I;  2RF4 A;  1H95 A;  4A3C G;  2R93 H;  4IJL A;  3GTP H;  2IX1 A;  4L5T A;  1CSQ A;  4DR1 L;  1YZ6 A;  5JEA J;  3K0X A;  4LF9 L;  3M4Q A;  4O0A A;  1PYB A;  4GLV B;  3F8T A;  4DV4 L;  5C4X G;  3PO2 H;  3M85 A;  2KEN A;  2NVT H;  1WCM G;  3HOW H;  4YY3 L;  3ZJY C;  5IE8 A;  2KHI A;  1WYD A;  3STB D;  1MIU A;  3HOV H;  1CKN A;  3H0G H;  2R92 G;  3Q8D A;  4DR3 Q;  1Q7Y C;  2UUA Q;  2NZH A;  5J3B A;  4YY3 Q;  1TWH H;  2QEX A;  4R1J A;  1G6P A;  2QGQ A;  1YBY A;  4Y7N H;  3RNU A;  4YWK A;  3JAM i;  1OXX K;  1NBW A;  1YHB A;  1BBU A;  4JI1 L;  4HIO A;  1CUK A;  4GOP A;  3F2D A;  2PI2 A;  1DGS A;  3KDF A;  2PI2 E;  1HZA A;  2JQO A;  4HJ8 A;  1N33 Q;  2JEB I;  2YTV A;  2JJQ A;  1VQG A;  3CAM A;  4P75 A;  2LXJ A;  1SE8 A;  1N36 L;  2MO0 A;  1SFO H;  5IYB H;  2AWO A;  3RN2 A;  5GQO A;  4HID A;  4IOA A;  4TQU S;  5C3E H;  4YCW A;  4A3M H;  4LUO A;  1SR3 A;  4LFC L;  2OCE A;  4HJ5 A;  4LFB Q;  4WJ4 A;  2R7D A;  3HOX G;  4HJA A;  1Y1V G;  4NXN L;  4B3M L;  2UXB Q;  3UE0 A;  2RCN A;  3EBE A;  4JI4 L;  2OTJ A;  4HIK A;  1X9N A;  3RLN A;  1IL2 A;  2NZO A;  2Q2H A;  4IOC A;  4LWC A;  2VS1 A;  4IFD G;  1HNZ Q;  4HJ9 A;  1AH9 A;  3JC6 6;  4JBJ A;  4B3T Q;  2ASB A;  3H15 A;  1HNW L;  4B3M Q;  5C0X I;  2NN6 I;  1NJI C;  3KOJ A;  1MKH A;  5IYC H;  1L2F A;  2ZM6 L;  3UDG A;  3GTK H;  4DV6 Q;  2YU9 H;  4AYB G;  4DV2 L;  3I7F A;  3TRE A;  3W1B A;  4UP9 A;  5IYB G;  3CP0 A;  3J81 c;  3NBH B;  1VQL A;  2KCT A;  1P8L A;  1BBW A;  2YV5 A;  4UP8 A;  2JK8 A;  4L5Q A;  3J80 i;  4A3E G;  1HZ9 A;  5BR8 L;  3S1R H;  1ASZ A;  2A8V A;  1YVC A;  2JA6 G;  1M90 C;  5M5W H;  5C44 G;  1VQ8 A;  4A3J H;  4OO1 G;  3RZO H;  1I6H H;  1V1Q A;  3PCO B;  1I5F A;  1XNR L;  4KHP Q;  3GO5 A;  1JB7 A;  2PNH A;  4C3I H;  1YI2 A;  1LTL A;  3G48 A;  4GOP C;  4DV4 Q;  1Q1E A;  2QA4 A;  5GAG C;  4L5R C;  4BBS G;  4K0K L;  3CCR A;  4EQ5 A;  1Y1W H;  3KLW A;  4P71 A;  3GD7 A;  3OYY A;  1S72 A;  4X66 Q;  4A3I G;  3KJP A;  3F1Z A;  2AHO B;  1V9P A;  4A3F G;  1JT8 A;  4K0K Q;  4JI5 L;  2OQ0 A;  2N78 A;  3LGJ A;  3ULL A;  4DV7 Q;  2ZJQ A;  1N34 L;  5C44 H;  4J15 A;  1A8V A;  2JA9 A;  2K50 A;  2CWA A;  2IHF A;  3K8A A;  4LF4 L;  4HIM A;  3CMA A;  4LF7 Q;  3HKZ G;  3KF6 B;  2HT1 A;  1VQC A;  3A0J A;  1G51 A;  2Q2I A;  1OTC A;  4DV7 L;  1QVG A;  5IP7 G;  3U58 A;  1K3R A;  1M1K C;  3HOY H;  1UE7 A;  1SMX A;  4LFA L;  1HH2 P;  1Y1W G;  4GKJ Q;  4DR2 Q;  3E0E A;  4BBR H;  2IX0 A;  1CKM A;  4A3K H;  4DR4 Q;  3PUV A;  5K36 G;  4X65 Q;  3PUZ A;  2UXD Q;  4A3I H;  4A3F H;  5EAY A;  1GKH A;  5H1S E;  2OTL A;  3I4M H;  1YEZ A;  2ZJR A;  4YHH Q;  2UUC L;  3PO3 G;  2VNU D;  4DR2 L;  4IPC A;  3GTM H;  4BY7 H;  1I50 H;  4DK6 C;  3W1G A;  1HJP A;  1B7Y B;  4MNO A;  1XPR A;  2LSS A;  3HOU G;  2R7Z G;  1PHJ A;  1RL2 A;  5JJK A;  1QUQ A;  2BH2 A;  2CFM A;  1B8A A;  1EQR A;  4NPS A;  2H5X A;  5IP7 H;  1J5E L;  4B3S Q;  4DR7 Q;  1GD7 A;  3J80 c;  1BVS A;  3HOY G;  3AFQ A;  3ULJ A;  3K81 C;  1FJG Q;  4JC0 A;  3GTG H;  2UXB L;  4BY1 H;  4NXN Q;  4PZ8 A;  4JI4 Q;  2CKZ B;  2RHQ B;  1OXT A;  3DM3 A;  5M3M H;  5JJL A;  3GTQ H;  2DGY A;  3I4M G;  4KI0 A;  1JJ2 A;  3PO3 H;  1HNW Q;  2ZTC A;  2FXQ A;  3D31 A;  4BY7 G;  2L15 A;  1W3S A;  1PA6 A;  4B3R Q;  1NE3 A;  2B29 A;  2EQS A;  2ZM6 Q;  2BH8 A;  3GTJ H;  3L7Z C;  5FLX c;  3VDY A;  4KHP L;  1C0A A;  1K0R A;  4JOI A;  5ELO A;  5M3F H;  2E2J H;  3G71 A;  4A76 A;  3S1N H;  4DUZ L;  1IBK L;  3CCQ A;  3M4O H;  1WFQ A;  1VQ5 A;  4A75 A;  4P74 A;  1E1T A;  3I4O A;  1VQ4 A;  1YIT A;  2E2I H;  4A3L G;  3K7A H;  5BR8 Q;  1YIJ A;  1MJE A;  4X66 L;  2K14 A;  3UE1 A;  3HKS A;  3HOZ H;  4GKK L;  1NMG A;  3I4N H;  3CQZ H;  1SRO A;  4UY8 C;  4IPG A;  3F2C A;  1XNR Q;  3K80 C;  2ZJP A;  2IY5 B;  1MJC A;  4GLX A;  1K73 C;  4PZ7 A;  3S2D H;  1E22 A;  2WAQ G;  5IWA L;  4GKK Q;  3CPW A;  1XPO A;  4IPD A;  5HY6 A;  3PSI A;  1Q82 C;  1KQS A;  4AQY L;  3A5U A;  1EOV A;  2JA7 H;  4IO9 A;  1PV4 A;  2ATW A;  5IT9 c;  4IFD J;  3RN5 A;  3L2P A;  5AJ3 Q;  1TWA H;  1L0W A;  2Q2U A;  4P73 A;  4LF8 L;  3OW2 A;  3S15 H;  4OWT B;  3UDX A;  4GNX B;  2C35 B;  3AFP A;  2D62 A;  1JJC B;  2HIV A;  4C3J H;  5GAH C;  1K9M C;  4DR4 L;  3HOZ G;  4P72 A;  1VQE A;  1N34 Q;  4IJH A;  5HGQ A;  3I4N G;  4DR3 L;  2UUA L;  4JI2 L;  1JJG A;  4LF4 Q;  1KL9 A;  4R4C A;  4DV5 L;  2WB1 G;  1PH6 A;  3CME A;  4LF8 Q;  4YHH L;  2UUC Q;  3CPF A;  5E7N A;  1PH4 A;  1EIF A;  4GS3 A;  4A3C H;  3OTO Q;  3S14 H;  4R4O A;  3I2Z A;  4JBW A;  3SGI A;  4DUY Q;  2F3I A;  1E24 A;  1I3Q H;  4YWL A;  1HR0 L;  3H3V H;  4A3D H;  2BA0 A;  3M4P A;  4WJ3 M;  1AE3 A;  3PO2 G;  4OX9 L;  3OTO L;  4X65 L;  1VCI A;  2KCM A;  4B3S L;  3I56 A;  4JI6 L;  2UXD L;  2RHS B;  3HOV G;  1JMC A;  4RMF A;  2NVQ H;  3J81 i;  1YJW A;  1G29 1;  1XJV A;  4OX9 Q;  1I94 Q;  4BA2 I;  4IFD I;  1KXL A;  2Q2T A;  3WWV A;  3S1Q H;  5C4J H;  3AQQ A;  4LF5 Q;  2VY3 A;  1IXR A;  2HQL A;  3FHW A;  5C0X J;  2NVX H;  1EYG A;  1LUZ A;  3CC2 A;  4MTN A;  1PH7 A;  1VQ9 A;  1J5E Q;  2CCZ A;  4ALP A;  4DR7 L;  1Q1B A;  2HIX A;  4A3D G;  1CKO A;  5FLM G;  1UE1 A;  3PF4 A;  2ES2 A;  4DR6 Q;  3BJU A;  2CWP A;  2MNA A;  4GOP B;  1E7Z A;  2VL6 A;  4R4T A;  1JE5 A;  3RR5 A;  2Z6K C;  1LM0 A;  4PMW A;  1XMO Q;  1PH9 A;  3GDE A;  5IP9 H;  3GTL H;  2MQH A;  3BU2 A;  2N8N A;  4XIG S;  3T1H L;  4AIM A;  3NEM A;  5DLQ E;  4POF A;  2JA8 H;  3PUW A;  1LYL A;  2YTY A;  1WI5 A;  1EFW A;  4X64 Q;  2PQA B;  3CCM A;  4L5S A;  1CSP A;  2XGT A;  1EUJ A;  3I55 A;  3T1H Q;  4DUZ Q;  1SN8 A;  1PH1 A;  2IHE A;  1IBK Q;  4GN5 A;  1QUQ B;  1IYJ B;  1N9W A;  3KYH C;  3BZC A;  5FLM H;  3MEF A;  4DAM A;  5LMU L;  5IYC G;  1VQF A;  1V43 A;  2ZTD A;  4H02 A;  4APV A;  4AYB E;  5JJI A;  2R6G A;  3NEL A;  5AJ3 L;  1VQA A;  1TWG H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...