1WCMG

Complete 12-subunit rna polymerase ii at 3.8 angstrom
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structures of Complete RNA Polymerase II and its Subcomplex,Rpb4/7
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1wcmG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1wcmG01
1AH9A 5M5XH 3K7UC 1HZBA 2N78A 1NMGA 3HOYH 1WFQA 2E2JH 4JI3Q 1C9OA 1RL2A 3D0FA 4AQYQ 4ALPA 3CMAA 2JEBI 2HHHL 1NBWA 3E9IA 4PG3A 4YWMA 4DUZQ 2AHOB 1GO3E 2R7FA 4X62Q 1PH7A 2JA7H 2H5XA 2I5MX 5IE8A 1SROA 4A3CH 4O2DA 2Q2IA 4JI4L 3CF5A 1PHJA 3CC4A 1AE2A 1E22A 1VQ7A 2JA6G 3GTLH 1HJPA 3EIVA 1YI2A 3F2BA 1K8AC 1VQLA 2R92H 2R7ZG 2JA7G 1JMCA 1B7YB 2Q2TA 4A3EH 2ZJQA 2HHHQ 4K0KQ 1GD7A 3HOWH 4GNXB 4A3KG 3FKIH 5GAGC 2WFWA 4IJHA 2VQEQ 1SLJA 4A3GH 4GN4B 1G51A 5DLQE 4IFDG 1WCMH 1YEZA 3JAMi 2VZAA 4BY1G 3UDIA 4A75A 1KQSA 4JI4Q 4YWKA 3BJUA 3PSIA 3M9BA 3PO3H 3UDXA 1XPRA 4GLVB 1KC8C 3T1HL 4LF6L 3NELA 1YZ6A 4QL5A 3PF4A 1QUQB 1AE3A 4JI8L 3CXCA 3CCMA 2JEAI 1VQEA 4OX9L 5FLXc 5C3EH 4R4IA 3CMEA 3ICEA 1WYDA 5IP9H 5FLMH 5M3FH 1T9HA 2PNHA 5ELNA 5IYBG 3TREA 3CCLA 3SGIA 4DR1L 3S16H 2OCEA 1QVCA 4X66Q 1K0RA 4A3JH 2JA5G 1V43A 2Q2HA 4A3DH 3GTPH 3T1HQ 4LF6Q 4IO9A 2AWOA 4JV5L 1GKHA 1C7YA 3PF5A 2CKZB 4JI2L 2GN5A 4OX9Q 3F2DA 4AH6A 3A5ZB 4BBRH 1A62A 2UUCL 5M5WH 5LMUL 1IBML 1Y1VG 4JI0L 3S1QH 4DAYB 1MKHA 3E0EA 2E8GA 4P75A 3RN2A 4DR1Q 4GOPB 3I55A 3AFPA 2JQOA 2PI2A 4BA1I 4XIGS 3S2HH 4GNXA 4JV5Q 3PUZA 3GD7A 4LUZA 3WWVA 3CC2A 4BXXH 2CWAA 3H0GG 4JI2Q 4NB3A 1JJ2A 2UUCQ 3ULJA 1I3QH 3A5UA 5LMUQ 1NJIC 1IBMQ 2WB1G 3CCEA 1SFOH 4JI0Q 2YYZA 2Y0SE 1XMQL 1SRUA 2KCTA 4LF8L 4X65L 1VS0A 1BVSA 1UE6A 3M4QA 3CCUA 3I4NH 1TWFH 1Q82C 1VQHA 3VDYA 1QUQA 5IYDG 2JE6I 3I7FA 3KF6B 4AYBE 5M3MH 2GVBA 4PZ7A 3K0XA 5IYCG 4A3MG 2JA6H 4C2MH 4DKAC 3JC66 2JA8G 2R7ZH 3PUYA 1S72A 1U5KA 3F8TA 4OWXB 5AJ3L 1XMQQ 4LF8Q 1Q86C 1X55A 5JEAG 3L2PA 4X65Q 1K73C 3IRBA 2VW9A 5GADC 3CP0A 4GN3B 4DV1L 4A3KH 4L5TA 4HJ8A 2JJQA 1XNQL 1KRSA 1VQ6A 1IBKQ 3PUWA 3RLOA 2Y0SG 1EWIA 1YITA 3TQYA 1N8RC 4HJ9A 3DM3A 5AJ3Q 1EOVA 3LGJA 4GOPA 5C3EG 5FLMG 4QJFA 4DR6L 5M3FG 1N33L 4AYBG 3HOZH 4C3IH 4DV1Q 3S14H 1WOCA 3UDFA 3J81i 1XNQQ 4A93G 4DV0L 2YTXA 1Y1WH 2VQFL 1J5EQ 1PV4A 4OXPA 3G71A 4DR6Q 4JG2A 1PFSA 1N33Q 1UE5A 4IFDJ 1W2BA 2XTIA 3KF6A 1O7IA 4X62L 4DNIA 1Q1EA 4H02A 5C0XG 3HOXG 2EIFA 4OWTB 3A0JA 4DUZL 1VQOA 2UU9L 1Y1VH 2K52A 1B70B 4DV0Q 4JI1L 1L0WA 1IYJB 3NENA 2LXKA 3S15H 2VQFQ 1P8LA 3UE0A 3KDFA 4BXXG 2F52A 1OXSC 3J80i 2K75A 2ZJPA 4ME3A 5ELOA 4JI7L 3PGZA 4R4TA 2E2HH 3H0GH 1PH6A 4DR5Q 1JB7A 4B3MQ 5IWAQ 5M5YH 2B3GA 4K0KL 3KOJA 1CKMA 3I4NG 1JJGA 1P16A 4EX5A 2UU9Q 2BA1A 4WJ3M 1EQRA 3G48A 4JI1Q 2VQEL 1Q46A 2PQAB 4QIWE 5M3MG 2I5LX 4A4IA 3KFUA 1XTDA 3KYHC 3RR5A 4NXNL 1HZAA 5IYDH 4O0AA 1Q81C 4JI7Q 2L15A 1N34L 1FGUA 4YY3L 2BH2A 1OXTA 3HFZB 5IYCH 2OQ0A 1OXVA 2D0PA 4A3MH 3CCVA 2ZTEA 4DK3C 3ULPA 2R6GA 3OTOL 2JA8H 1L1OC 3H15A 4QQBX 4X6AH 1H95A 1EIFA 1HNWL 2Z0SA 3S17H 4NXNQ 4OO1G 1VCIA 1FVIA 2MO1A 2YV5A 2QA4A 3KLWA 4X66L 1N34Q 4YY3Q 1TWCH 4LUOA 4DV7Q 2C35B 4GLAC 3CCSA 1X65A 3OTOQ 2NVXH 2ES2A 3HOZG 3RZOH 1L2FA 1CKOA 1KHIA 4Y7NH 1KAWA 1UE1A 4UY8C 3TRZA 2KHIA 1HNWQ 2UXDL 4GS3A 2KBNA 2CQOA 2IHEA 1Y1WG 2WB1E 1CUKA 2K5VA 4DPGA 4BA2I 4A93H 2AMCB 5C44G 2NZHA 2F4VL 5JEAJ 4A76A 3RNUA 2IX1A 1G6PA 3AQQA 2Z6KA 4IFDI 1VQDA 1EYGA 2PQAA 1HR0W 2Q2UA 1Z9FA 1Q8KA 3M4PA 4NXML 2UXDQ 2DUDA 3W5OA 4JI5L 3M7NA 1NE3A 1LYLA 4GLXA 3HOXH 2IX0A 2ID0A 2XGTA 5GROA 3G6EA 2D62A 5LMNW 4JOIA 3CW2C 1TWAH 2VUMH 3GTKH 2QGQA 5HY6A 2F4VQ 3EN2A 1C0AA 5JJKA 3G4SA 3W1GA 2AKWB 3TEHB 4L5SA 4MTNA 5H1SE 4QGUA 4LFCL 3FHWA 3PIPA 5K36G 4NXMQ 1S40A 1VQ8A 3PUVA 1FL0A 4JI5Q 3I56A 3ZJYC 4GKKQ 4PZ8A 3H3VH 4P73A 1A8VA 4WJ4A 4JCVE 5C4XG 1K8GA 3UE1A 1MJCA 3CPFA 1TWGH 1IBKL 2IT1A 1XNRL 4LFCQ 1X3GA 4B3RL 3I4OA 4IJLA 4L5RC 4DV4L 3U4ZA 5C0XJ 1HNZL 1TXYA 1HH2P 3K81C 3PO2H 5J3BA 4A3FG 2R93G 4YWLA 4YCVA 3GTMH 1CKNB 1VQKA 2A19A 1QZHA 5FJ8G 1Q7YC 1VQFA 4GNXC 2NVTH 4DR7Q 4UPAA 1XNRQ 1YJNA 4B3RQ 4DV3Q 4DK6C 2WAQE 4DV4Q 2UUAL 1J5EL 3NEMA 2MQHA 1HNZQ 1LUZA 4Y52H 1KXLA 4DR4L 1PVOA 4JBJA 1VQNA 1D8LA 3KJOA 1Z47A 4DV6L 1KRTA 4R4OA 4HIOA 2UUBL 4JI6L 1ASZA 2EXDA 1A63A 1E7ZA 5GQOA 5C4JH 2PMZE 2UUAQ 2I0QA 4IOAA 3U50C 5C44H 1KIXA 4GN5A 3CQZH 4LFAL 1N32L 2K5HA 2HIXA 3UDGA 4KHPL 4UP8A 1I6HH 4DR4Q 1VQ9A 3CCQA 1YJ9A 1QZGA 4DR5L 2FXQA 1X3FA 3AFQA 2MFIA 3K8AA 3PV0A 4POFA 4P72A 5IWAL 2I5HA 1R9TH 1PH1A 4DV6Q 3T1YL 1M1KC 1XPUA 4LF7L 4J15A 2UUBQ 3MXNB 5IT9c 2WAQG 5EAYA 4JI6Q 2VUMG 3JAMc 1DGSA 2D0OA 3DLLA 1VQMA 1K9MC 3CD6A 2A1AA 1UE7A 3GO5A 1PH2A 1IXRA 3EBEA 4GOPC 1N32Q 4JBWA 4LFAQ 2KENA 3CC7A 3CCJA 4KHPQ 2BA0A 4PZ6A 4LUVA 2PI2E 3ERSX 5IP7G 4XTCS 1SN8A 1VQ4A 4X64L 2YU9H 3GTOH 3J81j 3BZKA 3S24A 2LSSA 3T1YQ 1V9PA 1VQAA 4L5QA 4LF7Q 1E3PA 2JK8A 3J7ZC 1MJEA 5IY0A 3L0OA 4AIMA 1YIJA 1HZ9A 4C3HH 1EQQA 4LF5Q 1OXXK 4B3TQ 3HOUG 3S1MH 1OXUA 5C4XH 4B3SL 5C0XI 2RCNA 1Q12A 4OONA 4UP9A 4DV7L 4IPGA 2CWPA 3Q8DA 3TS2A 1YJWA 4DAMA 4X64Q 1VQGA 3PO2G 1S3OA 2ATWA 4RG1A 1X3EA 2A8VA 4DR2L 2K5NA 2DGYA 4HJ7A 2R93H 2MO0A 4A3FH 2HIVA 4TQUS 4TVAB 1X9NA 3RN5A 4MZ9A 3BU2A 2HQLA 2WP8J 5FJ8H 2RHQB 2GVAA 3CPWA 2ASBA 2B63G 3GTGH 4B3SQ 1M90C 1PYBA 2QEXA 3CCRA 3H3VI 3NBHB 4P74A 4YCWA 3STBC 1EFWA 3E9HA 4HIMA 2NZOA 2AWNA 3I2ZA 4KI0A 4EQ5A 2ZJRA 1E1OA 3AEVA 3KF8B 1YHQA 1VQCA 1BBUA 4DR2Q 2OWOA 3I4MG 4IPCA 3F1ZA 1MIUA 4LF4L 1YHBA 4A3BH 2NN6G 2MNAA 4LFBL 5JJLA 2KCMA 4IOCA 1VQPA 1CSPA 4POGA 1YVCA 1I5FA 3HKSA 1HZCA 2E5LL 3ULLA 4YHHL 1FJGL 1U0LA 4OO1I 1WI5A 2ZTCA 4HJ5A 2OTLA 4A3LG 1IZ6A 1SMXA 3BZCA 1YBYA 1EUJA 4DV2L 1JJCB 3HKZE 2UXCL 4LF4Q 4QY7A 4GKKL 4LFBQ 3D31A 4LW1A 4JBKA 1BBWA 1NMFA 1PYSB 2N8NA 1HR0L 4DUYL 1LTLA 2IY5B 1G291 1OTCA 3RLNA 3HOVG 2E5LQ 1D7QA 4YHHQ 1FJGQ 2NN6I 4R4CA 3K80C 5LMNL 5IP7H 4UP7A 3U4VA 4YCUA 4DV2Q 2UXCQ 1K3RA 2R7DA 4JI8Q 1YHAA 3OW2A 3W1BA 4BBSG 3J81c 1PH4A 1QVGA 1HR0Q 4DUYQ 4LNQA 4A3IG 4OWWB 2Z6KC 2ZM6L 3U58A 3PCOB 4DR7L 4PMWA 2B29A 3HOUH 5BR8L 3RZDH 4BY7H 1NTGA 4MNOA 1W3SA 2YTYA 3HKZG 4DV3L 2UXBL 1YNXA 1IBLL 4FDBA 5LMNQ 3HOYG 2N49A 3GTJH 1NY4A 3M4OH 4KLKA 3STBD 1XJVA 1V1QA 1X6OA 3CAMA 5HGQA 4RMFA 1E1TA 4JOIC 3MEFA 2NVQH 2V1CC 3RLFA 1VQ5A 5JJIA 1XPOA 2ZM6Q 1IL2A 3PUXA 4JYAL 1GVPA 5BR8Q 2RF4A 2B63H 2HT1A 1E24A 4A3CG 4GKJL 2UXBQ 4APVA 1SR3A 1IBLQ 1VQBA 3J80c 3S1NH 1Y14B 3GDEA 4R1JA 3AYHB 3J7A5 2LXJA 1HNXL 2R92G 3KJPA 2CFMA 4DV5L 3TS0A 2EQSA 4A3EG 1L1OB 2N3SA 2CCZA 1PH9A 3HOWG 4A3BG 3FKIG 3I4MH 4HIDA 3KDFB 4A3GG 4JYAQ 2ZTDA 2KHJA 2RHSB 3A74A 1WCMG 1PH3A 1EIYB 4B3ML 4HIKA 4GKJQ 2VNUD 2VY3A 1K83H 3PIOA 1GM5A 1VQJA 3B6YA 4LF9L 3PO3G 2VL6A 1KD1C 1HNXQ 4BY1H 2ALYB 1B8AA 4DV5Q 1TWHH 1JT8A 3OYYA 1UWVA 4A3LH 2K14A 2K50A 3ER0A 3F2CA 1I94L 1CSQA 4C3JH 1J6QA 2VS1A 5IP9G 1PA6A 1N9WA 5E7NA 2JA9A 1N36L 4NPSA 4JC0A 1XMOL 1VQIA 1JE5A 4DR3L 4LF5L 3L7ZC 2BH8A 4B3TL 4LF9Q 4IPHA 4A3JG 2IHFA 2NVYH 2F3IA 2K4KA 1CKNA 4IPDA 4P71A 5IYBH 1RIPA 5GAHC 2OQKA 4HJAA 3HOVH 1PH5A 2JA5H 1ASYA 3K7AH 1I94Q 1X56A 1X54A 1Q1BA 3S2DH 1I50H 4KHZA 4JI3L 4BBRG 3GTQH 1A0IA 4AQYL 2OTJA 4LWCA 1N36Q 2YTVA 1XMOQ 5GAEC 1PH8A 3M3YH 4BBSH 4R4QA 1UEBA 1BKBA 4DR3Q 2E2IH 4JBMA 4A3DG 3M85A 1QVFA 1KL9A 1WJJA 4A3IH 4BY7G 1SE8A 3S1RH 1LM0A 1L1OA 3FP9A
chains in the Genus database with same CATH superfamily
3DM1A 5COYA 1HZBA 4CDCC 1TWCA 1M0TA 4UCOA 4RB1A 4LF4H 5KG5A 2PMZB 4ZOLF 3D0FA 5C5JA 5KFFA 4ALPA 2RVLA 2R87A 2JEBI 1NBWA 3RZDB 1GGOA 2K01A 4PG3A 5C4HA 1M0WA 1B44D 1PH7A 1G2SA 4DK1A 3A8JE 2M00A 2I5MX 1EQVA 2OEOA 1O7LA 5IE8A 2Q2IA 3CC4A 1PHJA 1K8MA 2JA6G 3GTMB 2UXCH 2SDFA 4K2LA 1YI2A 3F2BA 1VQLA 1HR0H 1I4GA 2HHHQ 4GNXB 2W71A 1UC9A 2ATLA 2QCPX 3G7LA 2PO4A 2VQEQ 1SLJA 2B8FA 2MHVA 2XN9C 1WCMH 3BG5A 2VUMA 2P0AA 4QW9A 2FLLA 1RK5A 4GLVB 1TY2A 3RV3A 1E2ZA 3NELA 1YZ6A 1XTCD 4PNYA 2ZM6H 4DR7H 5C4JB 1ULZA 3SE7A 4RNNA 5FLXc 1AFPA 3CQZB 1IKLA 3X3NA 1WTHA 1O75A 1S0MA 3SGIA 5KFHA 1QVCA 5M9OA 3RB6A 4RKBA 3T1HQ 4IO9A 4JV5L 2C2RA 2CKZB 2EXZA 4ME5A 3NBHA 1PX2A 2YS6A 4CC5A 1A62A 4O4HF 2NVYB 1V8QA 1KDAA 3S1QH 4DAYB 2F0TA 1TS2A 4RCOA 3WOEA 4FBTA 1LT5D 5IGEA 4DR1Q 1RF2D 4GOPB 3JAME 4I55F 1GJXA 4DV5H 4V0BA 5HURA 3BVGA 2PQEA 4JI2Q 2D2CC 2MJ8A 3A5UA 5LMUQ 1HUMA 1O7ZA 5J39A 1SFOH 2YYZA 2Y0SE 5CB4F 4X65L 3M4QA 1BVSA 3WO1A 5JVDF 2A69C 5KX5F 1TWFH 2J6UA 3KF6B 2XCAA 2W8KA 3A7AB 2ZDHA 4L1KA 4G3IA 3GV8B 4N8FA 5FO7B 5D8DA 2JA8G 1D5MC 1S72A 5L9XA 3F8TA 2RQXA 1TWHA 4IALA 1XMQQ 3RAQA 1Q86C 1X55A 2VW9A 2W9BA 5GADC 4ECXA 2QKIC 2JJQA 1FYCA 1KRSA 3DXJC 2R92B 4J6HA 2M2LA 2E74C 4JI3H 2VA3A 5D1PA 3RMHA 3PUWA 3K58A 3HOWB 1YITA 3TQYA 1RJPA 4HJ9A 3DM3A 4XQQA 4A3GB 5KYLA 2YU9A 2NYZD 3C2PA 4DR6L 4B3SH 4C3IH 1AN8A 2G9DA 5A2QE 2XIWA 4K8JA 3GV6A 1A6XA 5FLXL 3WO0A 3BS1A 3SI8A 3PQIA 3KLSA 1J5EQ 1PV4A 4I7ZC 4B9XA 4IQZA 2D9UA 3HKZA 1SYBA 1PFSA 1N33Q 3BZDB 5L37A 1O7IA 1B3QA 1S0OA 4DNIA 1KDBA 5I6YA 3S16B 1LTBD 2PZUA 3HOXG 3S2HH 4JI4H 4HTHA 4FF4A 2K52A 1B70B 4A3DB 2FPGB 3K0YA 1I4HA 1GUTA 2DJGC 4CKEA 1BNZA 3MFHA 1WTPA 1EQTA 2VQFQ 2GPSA 3LX0A 1Y8PB 1OXSC 2XWBB 4ME3A 5ELOA 1WD0A 3BAAA 3PGZA 4DR5Q 1JB7A 1U4PA 3NTKA 1SNDA 1M7JA 4FF1A 4H0LC 1CKMA 5K36H 2L5TA 2UU9Q 4JI1Q 1HQRD 3J81E 2VQEL 3GTJB 4R8NA 3L4KA 4LF6H 3KYHC 3RR5A 1N34L 4LAAA 4M7EA 4A3MH 2D0PA 5CV9A 4IUNA 3CCVA 4DUYH 3ULPA 2R6GA 1X3PA 2SOBA 2FPPB 3H15A 2J4XA 5JEAH 3TBIB 1EIHA 2HDLA 1K8OA 4NXNQ 3PVXA 2F0QA 1FVIA 3SXHA 1ZYRC 4C2MB 1FNUA 2R7ZB 1LTID 3C1FA 4GLAC 3J80E 3K5IA 5KG7A 2WKCA 3MHBA 4IHJF 4JI0H 1K1QA 1JDEA 4C3IG 1KHIA 3DEPA 1F2YA 3TRZA 2UVRA 1EY4A 2NB0A 3W3AA 2AQ3B 4NKLA 3T56B 4ODGA 1BQQT 3MWEA 3RUZA 3K5NA 2K5VA 4G57A 4O42A 4EBCA 4E6IA 4DN4M 4C3JB 4YJ3F 2YZGA 4M8AA 1TA8A 5EGTA 3GV3A 1VQDA 4U68A 1IKMA 5DGBA 4DAVA 1AEXA 4LSXA 4X3UA 4CC6A 2W8LA 5T1IA 4JI5L 4ECZA 3M7NA 4GLXA 2RBMA 4PQXA 3VPBA 3G6EA 5LMNW 2XGTA 4R8UB 2D62A 2CQYA 4JOIA 3CW2C 3OHBA 1SJHD 4F50A 2QGQA 1IYVA 3EN2A 3TP8A 2FK3A 4I7AA 4L5SA 4O3QA 5CV4A 4QGUA 2VOBA 3FHWA 5DGAA 5K36G 1Y1VB 2I46A 2JA6A 1S40A 4MV6A 2PZWA 3PUVA 1MZBA 3ZJYC 3OSNA 4APMA 4P73A 2KEEA 4JCVE 4WJ4A 3M4IA 2XGPA 2A6ED 5DG8A 4O4LF 1TWGH 5C1PA 1B53A 4B3RL 4FM9A 3I4OA 2EY5A 5D65A 4Q5VA 1PZJD 1KJQA 5J3BA 1TVXA 2F0VA 4YWLA 4YCVA 3UI2A 5KFUA 4DV0H 1JE4A 2FLPA 1SSOA 4QMGA 1Q7YC 5D1OA 3N6XA 1XDNA 1E2WA 1XNRQ 4DK6C 4DV4Q 1L2ZA 1J5EL 1M4VA 1JWMD 2MQHA 3AMUA 3I12A 3LWUA 4DUZH 1W6JA 1VQNA 1D8LA 3TZUA 2FK1A 2RDGA 4XQNA 1ONLA 1CA5A 4R4OA 3EVQA 2EYMA 4JI7H 1E7ZA 4KN7C 1PFMA 3QJYA 1GSAA 2HIXA 3UDGA 5CGKA 3H94A 1J8IA 2WKDA 1ZKOA 1YJ9A 4DR5L 3AFQA 1LT3D 1WTXA 3RB3A 1RODA 3T1YL 1GHKA 2WAQG 4KY5A 3JAMc 2AGPA 1SE4A 2A1AA 3GO5A 5T1GA 2HDMA 5I2YA 3QIAA 4JBWA 4LFAQ 2KENA 3CC7A 2O5IC 4KHPQ 1N32Q 5J2UF 2YYAA 4PZ6A 3ITPA 4XTCS 2LY7A 4LJZC 1Z6HA 5CV8A 1ENAA 1VQ4A 2AUJD 3OMCA 3GTOH 1W93A 3PZPA 3BZKA 4IWYA 2LSSA 5CMDA 1VQAA 4L5QA 2I8CA 4AIMA 1STHA 3S1MH 3NQIA 1EQQA 4LF5Q 2R7LA 2W6QA 2F0OA 4XYQA 4B3SL 3SK6A 2RCNA 2LMCB 4OONA 4UP9A 5IYZF 3TP7A 3Q8DA 5DNFA 3TQTA 3I70A 4X64Q 1N56A 2XNAC 3KLSX 2WE6A 1VBGA 1B1ZA 1IOWA 4XZ3B 1B33N 2R93H 2PCFB 4TVAB 5DLFA 4BWSC 4J0MA 4P2CB 2PPBC 3BU2A 2WP8J 4HNTA 4ECTA 3CPWA 4MTKA 4RZQA 1DXMA 5KNBA 1K1SA 3NBHB 4EGQA 4YCWA 1EFWA 2UUCH 1GXDC 2AWNA 4NXMH 3EPGA 1E1OA 1SNPA 2K5WA 2ICIA 2XIGA 3TIIA 3I4MG 4J9MA 4IPCA 3F1ZA 2K03A 1C8CA 4A3BH 3HP3A 1LTAD 4LFBL 1C30A 5KFEA 4X3SA 4TUYF 3A54A 1S68A 4UFZA 5KFGA 4ZUJA 3ULLA 1WI5A 2ZTCA 4HJ5A 1SCUB 2CVRA 4A3LG 1NNXA 1YBYA 3HKZE 2QK4A 3C3LA 1EL0A 4ECVA 2W9AA 1SFOA 1PYSB 4DUYL 1IBKH 5F9NA 4EGJA 1TWFA 3HOVG 4WJWA 3JAML 3KTMA 1HNZH 4YHHQ 1EOTA 1ICWA 2K6AA 3U4VA 3GTPB 4IR1A 3JZIA 1S5CD 3J81c 2NUCA 2A5HA 2M9VA 3T51B 2X0SA 4OL7A 1GOZA 2UUAH 5CBEE 1SNQA 4LK1C 2VB3X 4O1NA 3KF8A 1SYFA 3H0GB 1XYIA 5CC4A 1NTGA 2YU9B 4MNOA 5DM63 1W3SA 3BVZA 3D4DA 3HOYG 5LMNQ 4RAUC 1YNND 2WB1B 2JYOA 1NY4A 3M4OH 2K5DA 4Q43A 4DV6H 1S4ZA 5HGQA 4C3HB 5I9PA 4JI6H 3MEFA 1LTTD 2B8GA 2V1CC 3RLFA 2DY7A 3EQLC 4QIWA 4YB8B 1E4EA 1IL2A 1GVPA 3OIQA 4JPBW 5BR8Q 4A3CG 1PLFA 4CJ0B 2UXBQ 4APVA 2C00A 1VQBA 1UNSA 3J80c 3AB9A 4B3MH 5IWAH 2LXJA 4A3FB 3QOLA 4IR9A 4QUCA 5BN3A 4A3BG 3GTGB 4QWDA 3GIMA 1IL8A 3E5SA 4XT1B 3Q8QB 3ORQA 4O3SA 1RJRA 5A2QL 4JYAQ 2ZTDA 2SNSA 4WBNF 1PH3A 1R4QB 1I4QA 4GKJQ 2L12A 4IUTA 3SK8A 1VQJA 4QW8A 4LF9L 4NP5A 2K33A 5ELCA 2K04A 4RZRA 1KD1C 4BY1H 2JEIA 1LTSD 1TWHH 2Z4HA 3IFTA 4S3SA 2K14A 1I94L 5FLXW 4A93B 2LFNA 1CSQA 1J6QA 2VS1A 1MSGA 4JC0A 1TU2B 4LF5L 4DV7H 1B4OA 3X3MA 4A3JG 2F3IA 2A8VA 1CKNA 1RIPA 2OQKA 1E4GT 1HNWH 4RHSA 3V2TA 1I50H 1S0NA 4GC6A 1TWAB 5JOBA 4AQYL 1IW7C 2OTJA 2J9GA 1PH8A 3M3YH 4U6PA 4R4QA 1UEBA 1BKBA 2F0KA 4DR3Q 2E2IH 4EYHB 1KL9A 4A3IH 2EY1A 1SE8A 3J81L 3S1RH 4QJFA 3D6CA 3FP9A 1EY5A 3VR4A 1A2TA 5M5XH 1EU3A 3BJYA 4MV9A 3T16A 1WFQA 3URYA 4J9KA 1C9OA 1A3UA 1RL2A 4EBDA 2Y0SA 3CMAA 2EDGA 3HRZC 3E9IA 4Q8EA 2F4VH 2E5LH 1FJGH 4OEMB 2F0GA 2H5XA 1FGBD 3PO2B 3CF5A 4DV2H 4RUAA 3J80L 2NVTB 1K8AC 1C3OA 1N48A 1DOMA 4JW0A 3I73A 2JA7G 1JMCA 5KFSA 4FO2A 5EPKA 2Q2TA 4K0KQ 3F8NA 4A3KG 5GAGC 2UVVA 2WFWA 4EEQA 4GN4B 4QUFA 4IFDG 2OT2A 1GUSA 2VZAA 4BY1G 3V4SA 4YWKA 1AP0A 2R8KA 3M9BA 2N88A 3UDXA 1PTOB 2H4OA 3PO3H 1XPRA 1UAPA 3E0JA 1SYEA 1SYGA 3QFFA 3RIZA 1QUQB 5TSSA 1AE3A 3CRKC 1CA6A 5C3EH 5C44B 3CMEA 1ENFA 5FLMH 1KEEA 5M3FH 2PNHA 4DV3H 4EVOA 4DFAA 2MP1A 1K0RA 2NTTA 1V43A 2Q2HA 5T14A 2NU6B 1TWGA 4XQJA 3M4YA 4K2KA 2YL2A 1NR2A 2EJFC 4BBRH 4ED0A 2A68C 2EYLA 2UUCL 2BE5C 2L11A 1IBML 1GSOA 3UFXB 4P75A 2E8GA 2FPIB 1F2ZA 3RN2A 3GV7B 5C1OA 5IT9E 3QR8A 1HNXH 1M8AA 4DR4H 1SMYD 1HA5A 2PI2A 4WORA 1R4PB 4K6DA 4BA1I 4RGNA 1D5XC 4JV5Q 3WWVA 3H0GG 1WVLA 4BBSB 2UUBH 4XX0B 4L63B 5KT7A 1F2MA 3ULJA 5BN5A 2F0IA 2PW7A 1WTVA 4FF3A 1CHPD 2WB1G 3CCEA 2XC9A 4FNFA 3I4NH 5JVH3 1CFMA 3PIO3 4YP3A 3VDYA 5IYDG 3FPPA 1S5ED 1GUNA 1I4PA 5KNDA 3Q1KA 2C9OA 3G6VA 2JA6H 1N36H 4V190 4DKAC 3JRWA 4RAZA 3I72A 1L0XB 4OWXB 2CH4A 3L2PA 4X65Q 1K73C 2ENBA 2KOLA 4FF2A 1STBA 1UC8A 2ZJTA 2DPJA 4NLGA 4O2AF 4DL3A 2F0NA 4HJ8A 1XNQL 1D5ZC 1EU4A 1KJJA 1HA6A 1I7LA 3MFGA 1EWIA 1PTOC 1HFNA 3GIQA 5KT3A 1KNAA 5KFIA 5C3EG 4FU0A 4KY7A 5FLMG 5M3FG 1WCMB 3VR3A 4AYBG 3HOZH 1B04A 2DLNA 3IKJA 5IGGA 2RSOA 4A93G 1QG7A 1Y1WH 3NGDA 2DPIA 1S9FA 5F2DA 1EY7A 1JC7A 2W6NA 2K5QA 1STAA 3FPUB 4DR6Q 4JG2A 4IFDJ 1SNOA 3I3CA 3FEWX 4RH6A 3E6ZX 4H02A 5C0XG 4OWTB 2A6HC 1VQOA 5GONF 2R93A 5KFZA 1AZPA 2FJZA 4YBZB 1P8LA 3MTSA 1ET9A 3UE0A 1DIKA 1AN7A 1EY8A 1X3QA 2MCTA 2E2HH 3K6OA 4I4TF 1PH6A 3GTLA 3HOUB 1D2BA 2B3GA 4K0KL 1ENCA 4YJ2F 3I4NG 1JJGA 1P16A 4F4ZA 3U9TA 5JVG3 1EQRA 2IP4A 3HB9A 5LYJF 2PQAB 4QIWE 1WTQA 2R7NA 4PWQA 4A4IA 1XTDA 4EBEA 3T1HH 2VPSA 3MFYA 5KG3A 1EHIA 3GIKA 2F3WA 1Q81C 4KD3A 1BXTA 2NVQB 5EWEA 4JI8H 1Y8NB 2YW2A 4HQ6A 5EKKA 4YY3L 3HFZB 2OQ0A 1OXVA 1LT4D 3OTOL 2B63B 2JA8H 1L1OC 2X6LA 3FMAA 4QQBX 4X6AH 1EIFA 1HNWL 2Z0SA 2BDNA 3S17H 4OO1G 1IOVA 2MO1A 4HR7A 5EOYA 4DNRB 1SYXB 1N34Q 2X6GA 3KHGA 3TDQA 2C35B 4O3OA 3EYYA 2NVXH 3HOZG 1LACA 1SE2A 1UE1A 4UY8C 5I9OA 3RB4A 3RBEA 2UXDL 1IBLH 3RFCA 1L0YB 1Y1WG 4DPGA 4DXFA 5C44G 2NZHA 4FS2A 2F4VL 4F87A 4A76A 3Q8SB 3AQQA 5KFWA 1DONA 2FMAA 5IIFA 1XMQH 4MV7A 1Z9FA 3M4PA 3PW2A 2R8JA 3JAMW 3K5LA 1DD2A 3I4LA 1LYLA 2JA5B 3HOXH 3K7AB 3HBLA 4J8QA 2ID0A 5GROA 2ASDA 2Z8LA 3GTKH 1SXTA 2Z9HA 4ILWA 2HGSA 5HY6A 3KUPA 4DL7A 3GTQB 1C0AA 1V4YA 4DL6A 2AKWB 3PW5A 3TEHB 4MTNA 5H1SE 4ED8A 3OHXC 4LFCL 3RV4A 2LKVA 1JIHA 4RKLA 4YAKB 4JI5Q 4J9OA 1S5FD 2JA7A 4G7ZC 2F0DA 4YR3A 1A8VA 3ONAB 4YR0A 1PRTD 2E2JB 5C4XG 3RGZA 1MJCA 2IJ0A 2B2VC 1F9PA 2W9CB 4C5AA 1N33H 5C0XJ 2WYOA 2L4NA 5DQIA 5KGUA 1RYSA 3RJ0A 2B2YC 3GTMH 1CKNB 1VQKA 2RDFA 1QZHA 2E75C 5FJ8G 1VQFA 5D3IB 4GNXC 5BMVF 3OWFA 1OO9B 4DR7Q 4UPAA 2FK2A 4A3EB 4B3RQ 4O4IF 1YNJD 1BOSA 2WAQE 3ETJA 3NEMA 3FKIB 1WTOA 1FKAH 4KKSA 4TV8F 5A2QW 1KXLA 4DR4L 1QCBD 4A2AA 4JBJA 2UU9H 1I50A 4JI1H 4X62H 3KJOA 3BDCA 1Z47A 2IL8A 4CDEC 2GLTA 4EFEA 5KFNA 1KRTA 4IUQA 1LABA 2UUBL 2E2IA 3WDNA 2NN6H 5C4JH 2Y0SB 2I0QA 3RUPA 3U50C 4GN5A 1UUPA 3CQZH 3OOCA 4DAPA 1MD2D 4UP8A 1GUOA 3NUCA 5EQ0A 3CCQA 2KVMA 3TMEA 1VQ8A 2HT1A 4HSPA 3PV0A 5KFKA 2J6SA 1PH1A 1ZHSA 2I5HA 2QDBA 4HSVA 4J15A 2O2LD 4NXNH 5IT9c 5EAYA 3C46A 5LL6S 3IFDA 2NU8B 3FRPB 1H9SB 5CV7A 2L0CA 4MN3A 4GOPC 3M9MB 1FD7D 4Q45A 2DZDA 2UVWA 3S9WA 5M5WB 4UCVA 2PI2E 3ERSX 5EKLA 4FXKC 5CA1F 1SN8A 3SDZA 4DF7A 3QB3A 1EIGA 1G91A 3J81j 1AUXA 5EZYF 3J81W 3T1YQ 3V6JA 3RB0A 1E3PA 1MJEA 4QWCA 5IY0A 2RGVA 4MHEA 4X66H 1YIJA 5CV6A 4EQNA 3HOUG 4L6TB 1EFID 1PRTF 2FMMA 5IOCA 4LSAA 1Q12A 4OX9H 4IPGA 4DGZA 1V1PA 1T94A 1YJWA 5KFQA 4DAMA 5CYUA 5LA6F 1MGSA 4DR2L 2K5NA 4TQRA 1EUCB 5M3MB 5KFLA 5KFMA 3KHRA 2ZXRA 2R86A 3ETHA 2QEJC 3RN5A 1TWGB 2L55A 2RHQB 2B63G 3NHHA 4B3SQ 1KDCA 1M90C 3J80W 2GA4B 1PYBA 2NTSA 1K28A 4P74A 4OGQC 3STBC 3E9HA 1HUNA 4KI0A 4EQ5A 2ZJRA 3AEVA 2KCNA 1VQCA 2EYFA 2EOTA 1MIUA 4LF4L 1YHBA 3N6RA 2NN6G 4J9QA 2PNRC 1CSPA 3NBIA 4POGA 1YVCA 1I5FA 3HKSA 1EZ6A 3VA7A 2HVQA 5KFRA 1U0LA 3ORRA 4GC7A 4LF8H 2MGSA 3S14B 3U9OA 2AUKA 1I4RA 3RAXA 2OF1A 4ECWA 1EUJA 2UXCL 3HZXA 1ZETA 2WACA 4LFBQ 4QWBA 5NUCA 2DWCA 2B2WC 1BBWA 2K1BA 1CE8A 4RHRA 1HR0L 1LTLA 1JX4A 1LTRD 1XNRH 2IY5B 3GIDA 4O3NA 4U673 1OTCA 4UCTA 3RLNA 4DV4H 5IT9L 5KT5A 3G8CA 2Q8IB 3OMGA 1O78A 2NN6I 3CVZA 4RA8A 4R4CA 3K80C 2F0LA 5FOBB 2ZXPA 4UP7A 4DV1H 2AGOA 1K3RA 1EYAA 1YHAA 2DY8A 1WSCA 3W1BA 3S15B 4LNQA 4DUYQ 3V6HA 2PBZA 3U58A 2ZM6L 4DR7L 3PCOB 1JLLB 2B29A 3T4AC 2WIIB 1U9RA 3GTOB 2KJXA 5I6WA 4JK1C 4DXGA 1IBLL 3GTJH 1XJVA 5DM73 1X6OA 3CAMA 3S1MB 1E1TA 4BS9A 2J6TA 1Z7TA 1SBBB 1VQ5A 2R7KA 2JXMB 2GPWA 2F0SA 1JICA 1N32H 3PUXA 1WTRA 4MTDA 4KHPH 2RF4A 1I7NA 1E24A 3Q2OA 5E4XA 3RTXA 5ISRA 1STYA 1Y14B 2KHSA 3GDEA 1Y1WA 2R93B 2R92G 2DNCA 1DM0B 5ELDA 4RAYA 4CJ1B 2CFMA 2RKSA 4DV5L 2EQSA 4A3EG 3VPCA 1PRTB 1PH9A 3HOWG 2VR1A 2R61A 3FKIG 3I4MH 4DNTB 1TWCB 2VB2X 4A3GG 2KHJA 2CHBD 5DEHA 3FDSA 1B9MA 3QZ8A 4HIKA 2VY3A 1K83H 1STGA 3RZOB 4X64H 1S5DD 1B8AA 1JT8A 3OYYA 1E0BA 1UWVA 1S03G 4A3LH 2K50A 1RJTA 5D14A 3F2CA 2E2HA 3KLRA 4C3JH 2IA6A 5IP9G 1N9WA 4IAJA 1VQIA 1JE5A 4EGVA 3L7ZC 4LF9Q 4IPHA 2K4KA 5IYBH 4IPDA 3HOVH 4A3DG 3QWNA 2YS7A 1S10A 1II3A 1PH5A 1Q3LA 3BQ0A 1I94Q 4J9NA 1Q1BA 3S2DH 4JI3L 1VF5C 3R93A 2VUMB 2KA7A 5KT2A 1B50A 4LWCA 4IURA 5GAEC 1KAAA 4RGMA 2F0MA 5KFYA 1LM0A 3K59A 1L1OA 1BXRA 4X62L 1EUDB 3VR6A 5KRUA 1AH9A 3EJIA 3MR2A 2N78A 1NMGA 4PMCA 3HOYH 3GILA 1SAPA 1RYRA 2JEGA 4AQYQ 2BQ3A 2NVXA 1EEFD 3MXUA 3QG1A 4YWMA 4DUZQ 4GZYC 3MVVA 2H1EA 2AHOB 1GO3E 4UDUC 3M4OB 3TZDA 1QILA 2F0HA 4A3CH 4JI4L 5LP6F 1W96A 1BCPD 4ULLA 3GTLH 1FNWA 2F1MA 1HJPA 1PDQA 3TQ1A 4GKKH 2R7ZG 2PZTA 3JSLA 3NWSA 5CBAE 3BDLA 2ZJQA 4ZCKA 4O2BF 1GD7A 2W6PA 4N8X1 3VYUA 2V4QA 3N42B 1BO0A 3JRXA 3PMFA 1B6SA 5DLQE 4B9WA 2A73B 5LMNH 4A75A 1NCVA 3GTKA 4CHTB 3BJUA 1ZEQX 4EQOA 3SE0A 2IBKA 4A2BA 3D4RA 1I4XA 4LF6L 2YRXA 5EDWA 4C3JG 3MXGA 4QL5A 3VR2A 2CW0D 3CXCA 1ET6A 3CCMA 2JEAI 4OX9L 3V4ZA 5BR8H 3ICEA 1WYDA 1QB5D 5H80A 1I6HB 5FPRA 5IYBG 4ECYA 3TREA 3CCLA 2PMZA 1TWHB 2OCEA 4PV1C 2Q8RE 1A15A 4A3JH 1QJOA 2W9BB 2JSOA 2AWOA 1GKHA 3MFIA 1ESRA 4AH6A 1V1OA 1B3AA 2B2VA 4ID6A 2DIKA 2FJ2A 4GKJH 2XCLA 1I6VC 3GTMA 1Y1VG 4JI0L 4HEDA 2R82A 3E0EA 2FLNA 2QYZA 4RU9A 1CQFA 1HTLD 3I55A 2B2YA 3AFPA 3J7YW 4MIUA 2XD4A 1I50B 4XIGS 4RB0A 2AQ2B 4GNXA 3E5NA 3PUZA 3GD7A 3CC2A 4BXXH 3PN1A 1A3TA 2CWAA 5EBDA 5KG4A 2UUCQ 2EY6A 4A3IB 1I3QH 1NJIC 1IBMQ 1KBLA 3KBGA 4IOAA 3S1RB 3ZYYX 5JPMC 4LF8L 1SRUA 2KCTA 4UCUA 1SE3A 1UE6A 1VS0A 5KNCA 4ED6A 3HKZB 3NPPA 1WR2A 2RDJA 5I2XA 1VQHA 4Z9CB 3I7FA 4CGYB 4AYBE 2ZDQA 5HGTA 2GVBA 4PZ7A 2V5AA 3K0XA 5IYCG 4LF7H 3CQZA 2EYHA 2ZT9C 4HNVA 1BCPF 2I80A 4XYLB 4UHVA 3PUYA 5AJ3L 2JA7H 3N43B 4B3TH 1TAEA 5KFDA 1LV9A 3GIJA 2HCIA 3IRBA 1SEBD 3CP0A 5LXTF 4GN3B 5DQHA 2ASLA 4DV1L 4A3KH 4L5TA 1JXLA 4ZHQF 1WH2A 5C4ZA 4IFDH 5KFCA 3NXWA 1IBKQ 3RLOA 4NMZA 4JV2A 2NU9B 4KY6A 3R2IA 5E3FA 4DAYA 1H9KA 4NW2A 1EOVA 3N52A 3LGJA 3K3PA 4GOPA 3LWEA 3A55A 4O3PA 1EZ1A 3T5KA 4G7OC 1V51A 3KXYT 3PO3B 2B39A 1XNQQ 1HTPA 3CKIB 2QF7A 4DV0L 3WNZA 3OUZA 1ZXTA 3QO2A 1C4QA 3SVMA 4ED3A 2CW7A 3G71A 1UE5A 5EKIA 1W2BA 2XTIA 3KF6A 1PYWD 1CK1A 1Q1EA 2I07B 2EIFA 3A0JA 4DUZL 1RJQA 2MPMA 2JN4A 3VYRA 1KJ8A 2EE1A 2L1BA 4M1UB 1IYJB 2HUGA 3NENA 4BXXG 3KDFA 2F52A 4BBRB 2ZJPA 4JI7L 5J1ZA 4EEYA 4R4TA 2RCFA 3H0GH 4B3MQ 5IWAQ 1QWYA 5M5YH 5KKNB 3OIPA 3KOJA 4BY7B 1E2VA 4K5WA 4WJ3M 3C1EA 3PW4A 3KHLA 3AU7A 2FP4B 3KFUA 1HHVA 3JSNA 1HZAA 5LL6b 5IYDH 1PXUA 2L15A 4F8MA 3QZ7A 3RF2A 3NE5B 4RNMA 2ZTEA 4DK3C 1MSHA 2EYJA 2R3ZA 3S1NB 5FD6A 2A6EC 5DG7A 4JV1A 4ZQIA 3DUZA 2Z4IA 3MC0B 2JA6B 2WAQA 1VCIA 2YV5A 4FXGC 4JV5H 4DL4A 1UEAB 4YY3Q 4DV7Q 3CCSA 3N44B 4LMQD 3OTOQ 3K5OA 3NSWA 1VMCA 1L2FA 2KUMA 2SEBD 1CKOA 2C2EA 4Y7NH 1KAWA 4JUZA 2KHIA 3U9SA 2MUYA 4GS3A 1HNWQ 1BCPB 2CQOA 2KBNA 2V9WA 1CQIB 1CUKA 3K3VA 4A93H 3EA6A 3VYSA 1RTOA 4B08A 2R8GA 3RNUA 2IX1A 5D1OB 4IFDI 4E4TA 1EYGA 1ILPA 5DG9A 1TR5A 2XSCA 3GTJA 1SEIA 1HR0W 4X65H 1Q8KA 4ZK9B 5FO9B 4NXML 5IT9W 2UXDQ 4ZKBB 2DUDA 3NQTA 5KG6A 3H91A 5C0XH 4OELB 3FMCA 2V4DA 5EWGA 4ME6A 2PW5A 4IZ8A 5KG0A 3SHLA 1TWAH 1STEA 4ZAIA 2F4VQ 2AGQA 5JJKA 1EYZA 2F4IA 5L1IA 2YZNA 4XDXA 4ZLTF 3DHQA 4ECQA 3PIPA 4PDBA 1FL0A 4C2MA 1LLRD 3I56A 2R7ZA 4C3HG 4PZ8A 1BBXC 4RCNA 4IUUA 5F9LA 1K8GA 3P7JA 1NUCA 1K83A 4WFN3 1IBKL 1QOHA 4LFCQ 1X3GA 1C48A 4R7RA 3V96A 4DR6H 1HRJA 1XMOH 1HNZL 3R5XA 5ELFA 4WRDA 1T5EA 3K81C 3PO2H 4A3FG 1Q90A 1A9XA 3RD4A 3CHBD 2NVTH 2IW3A 2ASJA 3LWBA 4OO1H 3OSPA 4MV8A 1YJNA 4DV3Q 4MA5A 2UUAL 4RB3C 5CV5A 2JA8B 4N9PA 4Y52H 5AFWA 4FVMA 4Q0FA 5J22A 2F0PA 1VDZA 3R2TA 3GV5B 2WINB 4R8UA 5LHY1 2A74C 2W6OA 2F0UA 1EWHA 1EWCA 1PTOH 4HAEA 4DV6L 2JEJA 4IRKA 4HIOA 4JI6L 1ASZA 1A63A 4ZRZA 5GQOA 3T13A 2PMZE 1O80A 2NVXB 4EQPA 3N41B 5C44H 1KIXA 3OUUA 2HHHH 5FO8B 2R85A 4DR4Q 5IODA 1VQ9A 5L1KA 4X3KA 1X3FA 3V05A 4CKBA 4POFA 5IWAL 1R9TH 1M1KC 4B3ML 5LL6X 2VQEH 3KK7A 2QDLA 1T3NA 4LF7L 2UUBQ 4IUPA 1BUVT 4QF4A 3DLLA 1K9MC 1N34H 2EZVA 5FPOA 1PH2A 2QW7A 2KSWA 2PN1A 2W7PA 3EBEA 3ND9A 4KHVA 2WV6D 2UVUA 4HN7A 2BA0A 2F3VA 5IP7G 2RDIA 3S1QB 3HOXB 1F2LA 5KG1A 3NTIA 1U4MA 5I47A 4L8JA 5EPLA 4OIKA 2BCOA 1HZ9A 4RGOS 1MI2A 1OXUA 5C4XH 4YR2A 5C0XI 4KJNA 3PW7A 3OPOA 4DV7L 1SFOB 1IYUA 3TS2A 3MXPA 3PO2G 1S3OA 3N8DA 1TWFB 3H4BA 2EJGC 1ILQA 4DR1H 2IWHA 5K5PA 3EFXD 3J7AV 3A7LA 2L9HA 2HIVA 4TQUS 1X9NA 4ZKCB 1STNA 5C8YF 1CI3M 1XX8A 5FJ8H 1EYDA 2GVAA 1SNCA 2B2UC 1E4FT 4F4XA 1YNNC 3CCRA 4JI2H 2XVSA 3D3RA 2NZOA 3TSSA 5DAUA 4HIMA 5LMUH 4XT3B 4JI5H 3T5HA 3KF8B 5KEEA 1YHQA 1BBUA 4DR2Q 4HNUA 4HMIA 1TQOA 3IG0A 2HCCA 5KYIA 2MNAA 1TS4A 4KKTA 2LS01 3MWMA 1H9MA 2KCMA 5EPJA 5A35A 3A8KE 3MR6A 2HD3A 2R8IA 4QIWB 2E5LL 1Z2OX 1HPCA 1SYCA 2N55A 2G9HD 4C3IB 1FJGL 4OO1I 1BGWA 1E4EB 4G4KA 2OTLA 1IZ6A 1SMXA 1S5BD 3ERQA 4DV2L 4LF4Q 1RHPA 1I3QA 4I7HA 2G5DA 4QY7A 3PR4A 3P75A 1NMFA 3G6JB 4B3RH 4CDFC 1D7QA 3PW0A 4K5XA 3S2HB 4FBUA 5G3LF 2UXCQ 4KN4C 3CU7A 4PMBA 2R7DA 5DLGA 4JI8Q 4TSSA 4ECUA 1EZ8A 3R23A 4Q0YA 3OW2A 4BBSG 2AQ4A 4KKUA 1HR0Q 1JQYD 1WTWA 2Z6KC 1TT2A 2FFKB 1J5EH 3HOUH 3RZDH 4DV3L 3DWQA 1YNXA 1GYFA 3MR3A 5KFJA 4QWAA 5JVLA 4KK7A 2AQ1B 4RMFA 2NVQH 2J7ZA 5C3XA 3MR5A 3GQCA 2ZM6Q 1Y8OB 2VQFH 5I4DA 2IPKD 4A3MB 2B63H 1FR3A 1VAJA 1PZKD 1IBLQ 4H7BA 4DR5H 4R1JA 3AYHB 1SYDA 2V59A 1HNXL 3T1YH 1CZGA 3TS0A 4QWEA 4HMJA 2N3SA 3BQ2A 3K57A 4HIDA 3KDFB 1VBHA 1F9SA 3A74A 1WCMG 1EIYB 4H44C 1GM5A 1PFNA 3PIOA 3O13A 3GTPA 3B6YA 2F0WA 1KLUD 2VL6A 2ZXOA 3Q22A 4DV5Q 3NK9A 4C1NI 2HJWA 3G6YA 3BDOA 2K32A 1Y69U 5BPHA 4ABNA 3H0GA 4F4YA 1TS3A 4I50F 2JA9A 1N36L 4NPSA 1XMOL 2WB1A 2XGQA 4RUCA 4U7CA 1TY0A 2BH8A 1NSNS 3MAQA 3BA9A 4LH6A 2IHFA 2NVYH 5GAHC 4P71A 5C3WA 2K28A 2C22A 2JA5H 3L4JA 1ASYA 3K7AH 5CORA 2NUAB 4KHZA 2WAQB 3GTQH 1DYQA 3I91A 4MA0A 3VYTA 4JBMA 4HCEA 1QVFA 1WJJA 3T53B 1EY0A 2SCUB 4ECRA 3GTGA 3K7UC 4C56C 2E2JH 4JI3Q 4F88A 2CH4W 4M9UA 4LFBH 5BPFA 1KTKA 2HHHL 3PR5B 1SMYC 2O4XA 3OWEB 1QNUA 4I65A 4AYBA 1GLVA 4RNOA 3W2DA 4ED1A 2R7FA 2Q8TA 4X62Q 3OHAA 3HG9A 4K8IA 1SROA 4O2DA 3MXNA 1AE2A 1E22A 1PFBA 1VQ7A 5E4WC 3SEBA 2FB9A 3EIVA 2DJFC 1JOKA 2R92H 2V58A 1B7YB 2D5DA 4H13C 4A3EH 3HOWH 4TV9F 2X69A 3FKIH 4IJHA 5FK9C 1ICFB 4IN3A 4A3GH 1G51A 2OXPA 1YEZA 3JAMi 3UDIA 1KQSA 4UAIA 4JI4Q 2W57A 1TWAA 3PSIA 1KABA 4IRCA 3N40P 3I4MB 1KC8C 1NR4A 3T1HL 3GLKA 5E1FA 3PF4A 4JI8L 1VQEA 2O03A 1K83B 3A56A 5JQWA 3T5JA 2YZMA 4R4IA 2BQRA 5IP9H 1T9HA 1IHZA 5ELNA 1IW7D 1U4LA 1F77A 3Q6SA 1JOQA 4DR1L 1HCZA 3S16H 3NWTA 4IRDA 4X66Q 2JA5G 4FYDA 3KBXA 4J9RA 1BDOA 4A3DH 1NAPA 3VR5A 4LF6Q 1Z2NX 5KT4A 3HEJA 1RTNA 3MJFA 3TN2A 4Y8VB 1C7YA 3R3OA 3PF5A 4EYIB 4JI2L 2GN5A 4OX9Q 3F2DA 3A5ZB 1RDPD 3J7AF 5M5WH 5LMUL 3BVMA 3BQ1A 1CT1D 1SNMA 4IZOA 1CHQD 3BYTB 3HOVB 1MKHA 1J9OA 3BYYB 4YAJB 1U4RA 2EY2A 2JQOA 3S2DB 1GUWA 2CZGA 2FINB 4LUZA 3SK4A 5BN4A 2RGRA 4NB3A 1JJ2A 2F0EA 3FDTA 4JI0Q 1JOOA 1XMQL 2I87A 4LF9H 3CCUA 4LFAH 1JB3A 3Q8PB 4DU9A 1Q82C 3HOYB 4JV0A 1QUQA 2JE6I 5M3MH 3T5LA 5IGDA 1I94H 4CDDC 3K5MA 5LOVF 1PZID 4A3MG 2W70A 2EPBA 4C2MH 1XXGA 3JC66 2R7ZH 1U5KA 5KIXA 4EG0A 4LF5H 4LF8Q 1R9TA 5JEAG 2HQEA 1A2UA 1GSHA 1CQJB 3SR1A 3GTLB 3SK5A 3UQ8A 5EBCA 1PMRA 4K14A 1VQ6A 4AQYH 4A3BB 2Y0SG 4R8IA 1N8RC 5KFPA 3D8GA 2HVRA 2RDHA 5AJ3Q 3F2UA 4ZI7F 2DNEA 3M9OB 3HS0C 4OIJA 1N33L 1KC7A 4DV1Q 1G8ZD 3TP6A 3S14H 1WOCA 2BDOA 3I90A 3UDFA 3J81i 4CBVA 2A68D 2BE5D 1D6EC 4YQWA 1HXYD 2YTXA 4BWGB 4YIJA 3LMLA 1G2TA 2VQFL 1WD1A 2E2DC 2EYOA 4OXPA 1VF7A 2KEDA 4HR7B 3J7AK 4DL2A 1TKWB 4DLKA 5JH7F 1ESFA 5CAEB 4A3JB 1JDBB 4RB2C 1W6KA 2UU9L 1Y1VH 3DWPA 4DV0Q 4JI1L 4UCSA 2FE3A 1L0WA 3S15H 2LXKA 1HFGA 3HGBA 3DF7A 5KFTA 3J80i 2K75A 1SJED 2B2UA 4TKOB 5JJZA 1VMPA 3FVQA 1EY9A 4EX5A 2BA1A 2W6MA 2EJMA 3G48A 5J2TF 4YHHH 1Q46A 5M3MG 4DA2A 1TIID 2I5LX 4NXNL 4KV6A 4ZYSA 2B2TC 4O0AA 3KAJA 4JI7Q 1WCMA 2DN8A 1I3QB 1FGUA 2VXWA 2BH2A 2KECA 1OXTA 5JAVA 5IYCH 2SNMA 1H9JA 1PRTC 3OSOA 1PTOD 5JPNC 2KQ3A 4HYKA 1H95A 1ZQ7A 3KAKA 4FXDA 2QA4A 3BG3A 3KLWA 1BR9A 1T5XD 2QILA 4X66L 4J9LA 1TWCH 4LUOA 2JA7B 1IBMH 1X65A 2FHTA 5D3DA 3RZOH 2ES2A 4A3KB 2R7MA 2NZ1D 2NU7B 2HVSA 2UXBH 1CTMA 4BY1B 3C0FB 1EEID 2IHEA 1Z2PX 1YNJC 2WB1E 4KMUC 4BA2I 2PVPA 2AMCB 3TP5A 2A6HD 4ZQ3A 1AW7A 3L9AX 5FKAC 3MWDA 1JCKB 5JEAJ 1B6RA 3M9NB 1G6PA 2Z6KA 5KFBA 1EYCA 1JKJB 1K0SA 2PQAA 2IMWP 2Q2UA 5L1LA 4QCLA 4G7HC 3PIP3 1B2TA 3GIPA 2VA2A 4JYAH 3W5OA 1NE3A 5KFAA 3MZ5A 3G6XA 5HV6A 2IX0A 2FMCA 2VUMH 4N9TA 4XYOA 2FKLA 2B63A 2C5CA 5KFVA 1QE6A 3G4SA 2VUGA 2Z1CA 3W1GA 4KTAA 3M3YB 2WDTA 2E2IB 3H09A 2F0FA 3ND8A 4RWSC 3H3VC 4NXMQ 1MBYA 5CA0F 1XNQH 5M5XB 4GKKQ 1S97A 1X32A 4NDXA 1HQMC 3H3VH 3I8ZA 3RBDA 3UE1A 3CPFA 4JVZA 5ELBA 2BOSA 3VA5A 2IT1A 5EJWA 1XNRL 5M5YB 4O3RA 4IJLA 4XXEA 4L5RC 4DV4L 3U4ZA 3TIGA 4Q8FA 4DR3H 1TXYA 1DOLA 1HH2P 2R93G 2CQAA 4HCSA 4J1MA 2A19A 4K6LA 1JWSD 1PTOF 1DZ1A 1KJ9A 1BNCA 4MTEA 3Q8RB 5IGFA 3BABA 2NVYA 3EROA 3P1HA 5DQGA 1HNZQ 1LUZA 2JA5A 2YCHA 5HBRB 2E76C 3A8IE 1BF4A 2VPQA 3GP7A 1PVOA 3H40A 3H4DA 3GTQA 1V1PB 2BQUA 1I6UA 4DL5A 2EXDA 1VKZA 2UUAQ 4RGTA 1N32L 4LFAL 1A3VA 2K5HA 5C3EB 4Y7NB 4KHPL 2KCCA 1I6HH 5KFXA 5IGBA 4K0KH 2PYKA 5M3FB 4KD4A 4AYBB 3H20A 1QZGA 2FXQA 3K8AA 2MFIA 2EYPA 4P72A 5FD5A 4DV6Q 1XPUA 4RFBA 1GHJA 2W9CA 4JI6Q 3MXNB 5JJIA 3GTPH 1RCVD 5FLXE 1DGSA 2D0OA 2VUMG 1VQMA 3CD6A 1AUVA 2R6FA 1UE7A 4YY3H 3Q24A 1IXRA 2A69D 1FNVA 3CCJA 1JR0D 2XRQD 3VMMA 4C5BA 4F4WA 3OTOH 4LUVA 1OWTA 4QB4A 2F0JA 3BA8A 1JORA 2VQDA 4X64L 2YU9H 3S24A 2R92A 1V9PA 4LF7Q 4DK0A 3GQBA 2JK8A 3J7ZC 3L0OA 1F9RA 3FKIA 1DV2A 4C3HH 2OH2A 1OXXK 4B3TQ 2XRSD 2V4RA 4Q44A 1ML0D 2F03A 2CWPA 4R9WA 1O7YA 1VQGA 3I4NB 2ATWA 2UXDH 4RG1A 4FP5D 1X3EA 2DGYA 4HJ7A 2MO0A 4A3FH 2TMPA 3R8BA 1H9RA 4MZ9A 2HQLA 3L3OC 2ASBA 5KFOA 3GTGH 2R8HA 1B9NA 2QEXA 3H3VI 1F9QA 1LO5D 2B2WA 1QNKA 2M05A 3I2ZA 3Q23A 2XCPA 4IUVA 1AZQA 4IWXA 4TQSA 1D1IA 1H9SA 3CRLC 5CR3A 2OWOA 1DV1A 3M7GA 2RA4A 4ED7A 2RSNA 1T36A 5JJLA 1VQPA 4IOCA 1DJRD 3KALA 4J9PA 4ETSA 4LFCH 1UNNC 3D4WA 2K05A 5C5MA 1HZCA 3HOZB 4YHHL 4OHJA 1MHWC 2ZDGA 1LTGD 5ELEA 3BZCA 3Q0AA 1JJCB 3V6KA 1M6VA 1Y1WB 4CJ2C 4GKKL 3D31A 4LW1A 4JBKA 3MA2B 2R84A 2N8NA 3HXLA 4K5VA 1G291 3IN5A 4FS1A 2E5LQ 2EVBA 1FJGQ 1DOKA 1R9TB 3DEOA 5LMNL 5IP7H 4YCUA 4DV2Q 4EFBA 3R5HA 1XWEA 1PH4A 1BJTA 2Z6BA 2J0TD 1QVGA 2BR0A 1JWUD 1GUGA 4A3IG 3H6MA 4OWWB 2OLSA 4PMWA 2E2HB 3DMUA 5C5LA 5BR8L 4BY7H 1ZHQA 2YRWA 2YTYA 3HKZG 2UXBL 4C1NK 5KG2A 4FDBA 2AU0A 1CQVA 1ZYRD 2N49A 2ICEC 1RKNA 4KLKA 3STBD 1V1QA 2JEFA 4JOIC 5JUMA 3P20A 2W7OA 3DWAA 1XPOA 5C4XB 1CZWA 3LP8A 4ED2A 4LH7A 1D1KA 3R5FA 4MV4A 4WD3A 4JYAL 1CS0A 4GKJL 1Q8IA 3TINA 3RGXA 1SR3A 3S1NH 1KNEA 4ZUIA 4MV3A 3KHHA 1EY6A 3J7A5 1PK8A 2XWJB 3KJPA 2W6ZA 4TRDA 2ALZA 1L1OB 3S17B 3QOJA 2CCZA 3EPIA 2P5ZX 1DCZA 1CM9A 3IL8A 5C6AA 2RHSB 1KJIA 1Y1VA 1BCPC 1RK6A 3PO3G 4C5CA 4KJOA 2O5JC 4MV1A 1HNXQ 3K5HA 1K3BC 2ALYB 5K2MA 2WTFA 4UCRA 3MWYW 3ER0A 4MAMA 2K7VA 5IGCA 1TS5A 3GTOA 3LNNA 3IAYA 1PA6A 5E7NA 4DR3L 2TSSA 3MEHA 4B3TL 4CKCA 1RD9D 2CW8A 4LMYA 3WOFA 2IX3A 2VNUD 4HJAA 5EWFA 5G3LD 3VPDA 1KLGD 2CW0C 5L1JA 4DR2H 3D6WA 1X56A 1X54A 3OW7A 4ECSA 3NTHA 4BBRG 4X3TA 1A0IA 1SDFA 2B2TA 2JP1A 2NWGA 4F7XA 3GTKB 1N36Q 2C2DA 2YTVA 1XMOQ 4BBSH 4XYMB 4J9SA 2C28A 3M85A 3NP8A 1G6ZA 1LT6D 4BY7G 2NBFA 5KT6A 3GIIA 3E3XA
chains in the Genus database with same CATH topology
1AH9A 5M5XH 3K7UC 1HZBA 2N78A 1NMGA 3HOYH 1WFQA 2E2JH 4JI3Q 1C9OA 1RL2A 3D0FA 4AQYQ 4ALPA 3CMAA 2JEBI 2HHHL 1NBWA 3E9IA 4PG3A 4YWMA 4DUZQ 2AHOB 1GO3E 2R7FA 4X62Q 1PH7A 2JA7H 2H5XA 2I5MX 5IE8A 1SROA 4A3CH 4O2DA 2Q2IA 4JI4L 3CF5A 1PHJA 3CC4A 1AE2A 1E22A 1VQ7A 2JA6G 3GTLH 1HJPA 3EIVA 1YI2A 3F2BA 1K8AC 1VQLA 2R92H 2R7ZG 2JA7G 1JMCA 1B7YB 2Q2TA 4A3EH 2ZJQA 2HHHQ 4K0KQ 1GD7A 3HOWH 4GNXB 4A3KG 3FKIH 5GAGC 2WFWA 4IJHA 2VQEQ 1SLJA 4A3GH 4GN4B 1G51A 5DLQE 4IFDG 1WCMH 1YEZA 3JAMi 2VZAA 4BY1G 3UDIA 4A75A 1KQSA 4JI4Q 4YWKA 3BJUA 3PSIA 3M9BA 3PO3H 3UDXA 1XPRA 4GLVB 1KC8C 3T1HL 4LF6L 3NELA 1YZ6A 4QL5A 3PF4A 1QUQB 1AE3A 4JI8L 3CXCA 3CCMA 2JEAI 1VQEA 4OX9L 5FLXc 5C3EH 4R4IA 3CMEA 3ICEA 1WYDA 5IP9H 5FLMH 5M3FH 1T9HA 2PNHA 5ELNA 5IYBG 3TREA 3CCLA 3SGIA 4DR1L 3S16H 2OCEA 1QVCA 4X66Q 1K0RA 4A3JH 2JA5G 1V43A 2Q2HA 4A3DH 3GTPH 3T1HQ 4LF6Q 4IO9A 2AWOA 4JV5L 1GKHA 1C7YA 3PF5A 2CKZB 4JI2L 2GN5A 4OX9Q 3F2DA 4AH6A 3A5ZB 4BBRH 1A62A 2UUCL 5M5WH 5LMUL 1IBML 1Y1VG 4JI0L 3S1QH 4DAYB 1MKHA 3E0EA 2E8GA 4P75A 3RN2A 4DR1Q 4GOPB 3I55A 3AFPA 2JQOA 2PI2A 4BA1I 4XIGS 3S2HH 4GNXA 4JV5Q 3PUZA 3GD7A 4LUZA 3WWVA 3CC2A 4BXXH 2CWAA 3H0GG 4JI2Q 4NB3A 1JJ2A 2UUCQ 3ULJA 1I3QH 3A5UA 5LMUQ 1NJIC 1IBMQ 2WB1G 3CCEA 1SFOH 4JI0Q 2YYZA 2Y0SE 1XMQL 1SRUA 2KCTA 4LF8L 4X65L 1VS0A 1BVSA 1UE6A 3M4QA 3CCUA 3I4NH 1TWFH 1Q82C 1VQHA 3VDYA 1QUQA 5IYDG 2JE6I 3I7FA 3KF6B 4AYBE 5M3MH 2GVBA 4PZ7A 3K0XA 5IYCG 4A3MG 2JA6H 4C2MH 4DKAC 3JC66 2JA8G 2R7ZH 3PUYA 1S72A 1U5KA 3F8TA 4OWXB 5AJ3L 1XMQQ 4LF8Q 1Q86C 1X55A 5JEAG 3L2PA 4X65Q 1K73C 3IRBA 2VW9A 5GADC 3CP0A 4GN3B 4DV1L 4A3KH 4L5TA 4HJ8A 2JJQA 1XNQL 1KRSA 1VQ6A 1IBKQ 3PUWA 3RLOA 2Y0SG 1EWIA 1YITA 3TQYA 1N8RC 4HJ9A 3DM3A 5AJ3Q 1EOVA 3LGJA 4GOPA 5C3EG 5FLMG 4QJFA 4DR6L 5M3FG 1N33L 4AYBG 3HOZH 4C3IH 4DV1Q 3S14H 1WOCA 3UDFA 3J81i 1XNQQ 4A93G 4DV0L 2YTXA 1Y1WH 2VQFL 1J5EQ 1PV4A 4OXPA 3G71A 4DR6Q 4JG2A 1PFSA 1N33Q 1UE5A 4IFDJ 1W2BA 2XTIA 3KF6A 1O7IA 4X62L 4DNIA 1Q1EA 4H02A 5C0XG 3HOXG 2EIFA 4OWTB 3A0JA 4DUZL 1VQOA 2UU9L 1Y1VH 2K52A 1B70B 4DV0Q 4JI1L 1L0WA 1IYJB 3NENA 2LXKA 3S15H 2VQFQ 1P8LA 3UE0A 3KDFA 4BXXG 2F52A 1OXSC 3J80i 2K75A 2ZJPA 4ME3A 5ELOA 4JI7L 3PGZA 4R4TA 2E2HH 3H0GH 1PH6A 4DR5Q 1JB7A 4B3MQ 5IWAQ 5M5YH 2B3GA 4K0KL 3KOJA 1CKMA 3I4NG 1JJGA 1P16A 4EX5A 2UU9Q 2BA1A 4WJ3M 1EQRA 3G48A 4JI1Q 2VQEL 1Q46A 2PQAB 4QIWE 5M3MG 2I5LX 4A4IA 3KFUA 1XTDA 3KYHC 3RR5A 4NXNL 1HZAA 5IYDH 4O0AA 1Q81C 4JI7Q 2L15A 1N34L 1FGUA 4YY3L 2BH2A 1OXTA 3HFZB 5IYCH 2OQ0A 1OXVA 2D0PA 4A3MH 3CCVA 2ZTEA 4DK3C 3ULPA 2R6GA 3OTOL 2JA8H 1L1OC 3H15A 4QQBX 4X6AH 1H95A 1EIFA 1HNWL 2Z0SA 3S17H 4NXNQ 4OO1G 1VCIA 1FVIA 2MO1A 2YV5A 2QA4A 3KLWA 4X66L 1N34Q 4YY3Q 1TWCH 4LUOA 4DV7Q 2C35B 4GLAC 3CCSA 1X65A 3OTOQ 2NVXH 2ES2A 3HOZG 3RZOH 1L2FA 1CKOA 1KHIA 4Y7NH 1KAWA 1UE1A 4UY8C 3TRZA 2KHIA 1HNWQ 2UXDL 4GS3A 2KBNA 2CQOA 2IHEA 1Y1WG 2WB1E 1CUKA 2K5VA 4DPGA 4BA2I 4A93H 2AMCB 5C44G 2NZHA 2F4VL 5JEAJ 4A76A 3RNUA 2IX1A 1G6PA 3AQQA 2Z6KA 4IFDI 1VQDA 1EYGA 2PQAA 1HR0W 2Q2UA 1Z9FA 1Q8KA 3M4PA 4NXML 2UXDQ 2DUDA 3W5OA 4JI5L 3M7NA 1NE3A 1LYLA 4GLXA 3HOXH 2IX0A 2ID0A 2XGTA 5GROA 3G6EA 2D62A 5LMNW 4JOIA 3CW2C 1TWAH 2VUMH 3GTKH 2QGQA 5HY6A 2F4VQ 3EN2A 1C0AA 5JJKA 3G4SA 3W1GA 2AKWB 3TEHB 4L5SA 4MTNA 5H1SE 4QGUA 4LFCL 3FHWA 3PIPA 5K36G 4NXMQ 1S40A 1VQ8A 3PUVA 1FL0A 4JI5Q 3I56A 3ZJYC 4GKKQ 4PZ8A 3H3VH 4P73A 1A8VA 4WJ4A 4JCVE 5C4XG 1K8GA 3UE1A 1MJCA 3CPFA 1TWGH 1IBKL 2IT1A 1XNRL 4LFCQ 1X3GA 4B3RL 3I4OA 4IJLA 4L5RC 4DV4L 3U4ZA 5C0XJ 1HNZL 1TXYA 1HH2P 3K81C 3PO2H 5J3BA 4A3FG 2R93G 4YWLA 4YCVA 3GTMH 1CKNB 1VQKA 2A19A 1QZHA 5FJ8G 1Q7YC 1VQFA 4GNXC 2NVTH 4DR7Q 4UPAA 1XNRQ 1YJNA 4B3RQ 4DV3Q 4DK6C 2WAQE 4DV4Q 2UUAL 1J5EL 3NEMA 2MQHA 1HNZQ 1LUZA 4Y52H 1KXLA 4DR4L 1PVOA 4JBJA 1VQNA 1D8LA 3KJOA 1Z47A 4DV6L 1KRTA 4R4OA 4HIOA 2UUBL 4JI6L 1ASZA 2EXDA 1A63A 1E7ZA 5GQOA 5C4JH 2PMZE 2UUAQ 2I0QA 4IOAA 3U50C 5C44H 1KIXA 4GN5A 3CQZH 4LFAL 1N32L 2K5HA 2HIXA 3UDGA 4KHPL 4UP8A 1I6HH 4DR4Q 1VQ9A 3CCQA 1YJ9A 1QZGA 4DR5L 2FXQA 1X3FA 3AFQA 2MFIA 3K8AA 3PV0A 4POFA 4P72A 5IWAL 2I5HA 1R9TH 1PH1A 4DV6Q 3T1YL 1M1KC 1XPUA 4LF7L 4J15A 2UUBQ 3MXNB 5IT9c 2WAQG 5EAYA 4JI6Q 2VUMG 3JAMc 1DGSA 2D0OA 3DLLA 1VQMA 1K9MC 3CD6A 2A1AA 1UE7A 3GO5A 1PH2A 1IXRA 3EBEA 4GOPC 1N32Q 4JBWA 4LFAQ 2KENA 3CC7A 3CCJA 4KHPQ 2BA0A 4PZ6A 4LUVA 2PI2E 3ERSX 5IP7G 4XTCS 1SN8A 1VQ4A 4X64L 2YU9H 3GTOH 3J81j 3BZKA 3S24A 2LSSA 3T1YQ 1V9PA 1VQAA 4L5QA 4LF7Q 1E3PA 2JK8A 3J7ZC 1MJEA 5IY0A 3L0OA 4AIMA 1YIJA 1HZ9A 4C3HH 1EQQA 4LF5Q 1OXXK 4B3TQ 3HOUG 3S1MH 1OXUA 5C4XH 4B3SL 5C0XI 2RCNA 1Q12A 4OONA 4UP9A 4DV7L 4IPGA 2CWPA 3Q8DA 3TS2A 1YJWA 4DAMA 4X64Q 1VQGA 3PO2G 1S3OA 2ATWA 4RG1A 1X3EA 2A8VA 4DR2L 2K5NA 2DGYA 4HJ7A 2R93H 2MO0A 4A3FH 2HIVA 4TQUS 4TVAB 1X9NA 3RN5A 4MZ9A 3BU2A 2HQLA 2WP8J 5FJ8H 2RHQB 2GVAA 3CPWA 2ASBA 2B63G 3GTGH 4B3SQ 1M90C 1PYBA 2QEXA 3CCRA 3H3VI 3NBHB 4P74A 4YCWA 3STBC 1EFWA 3E9HA 4HIMA 2NZOA 2AWNA 3I2ZA 4KI0A 4EQ5A 2ZJRA 1E1OA 3AEVA 3KF8B 1YHQA 1VQCA 1BBUA 4DR2Q 2OWOA 3I4MG 4IPCA 3F1ZA 1MIUA 4LF4L 1YHBA 4A3BH 2NN6G 2MNAA 4LFBL 5JJLA 2KCMA 4IOCA 1VQPA 1CSPA 4POGA 1YVCA 1I5FA 3HKSA 1HZCA 2E5LL 3ULLA 4YHHL 1FJGL 1U0LA 4OO1I 1WI5A 2ZTCA 4HJ5A 2OTLA 4A3LG 1IZ6A 1SMXA 3BZCA 1YBYA 1EUJA 4DV2L 1JJCB 3HKZE 2UXCL 4LF4Q 4QY7A 4GKKL 4LFBQ 3D31A 4LW1A 4JBKA 1BBWA 1NMFA 1PYSB 2N8NA 1HR0L 4DUYL 1LTLA 2IY5B 1G291 1OTCA 3RLNA 3HOVG 2E5LQ 1D7QA 4YHHQ 1FJGQ 2NN6I 4R4CA 3K80C 5LMNL 5IP7H 4UP7A 3U4VA 4YCUA 4DV2Q 2UXCQ 1K3RA 2R7DA 4JI8Q 1YHAA 3OW2A 3W1BA 4BBSG 3J81c 1PH4A 1QVGA 1HR0Q 4DUYQ 4LNQA 4A3IG 4OWWB 2Z6KC 2ZM6L 3U58A 3PCOB 4DR7L 4PMWA 2B29A 3HOUH 5BR8L 3RZDH 4BY7H 1NTGA 4MNOA 1W3SA 2YTYA 3HKZG 4DV3L 2UXBL 1YNXA 1IBLL 4FDBA 5LMNQ 3HOYG 2N49A 3GTJH 1NY4A 3M4OH 4KLKA 3STBD 1XJVA 1V1QA 1X6OA 3CAMA 5HGQA 4RMFA 1E1TA 4JOIC 3MEFA 2NVQH 2V1CC 3RLFA 1VQ5A 5JJIA 1XPOA 2ZM6Q 1IL2A 3PUXA 4JYAL 1GVPA 5BR8Q 2RF4A 2B63H 2HT1A 1E24A 4A3CG 4GKJL 2UXBQ 4APVA 1SR3A 1IBLQ 1VQBA 3J80c 3S1NH 1Y14B 3GDEA 4R1JA 3AYHB 3J7A5 2LXJA 1HNXL 2R92G 3KJPA 2CFMA 4DV5L 3TS0A 2EQSA 4A3EG 1L1OB 2N3SA 2CCZA 1PH9A 3HOWG 4A3BG 3FKIG 3I4MH 4HIDA 3KDFB 4A3GG 4JYAQ 2ZTDA 2KHJA 2RHSB 3A74A 1WCMG 1PH3A 1EIYB 4B3ML 4HIKA 4GKJQ 2VNUD 2VY3A 1K83H 3PIOA 1GM5A 1VQJA 3B6YA 4LF9L 3PO3G 2VL6A 1KD1C 1HNXQ 4BY1H 2ALYB 1B8AA 4DV5Q 1TWHH 1JT8A 3OYYA 1UWVA 4A3LH 2K14A 2K50A 3ER0A 3F2CA 1I94L 1CSQA 4C3JH 1J6QA 2VS1A 5IP9G 1PA6A 1N9WA 5E7NA 2JA9A 1N36L 4NPSA 4JC0A 1XMOL 1VQIA 1JE5A 4DR3L 4LF5L 3L7ZC 2BH8A 4B3TL 4LF9Q 4IPHA 4A3JG 2IHFA 2NVYH 2F3IA 2K4KA 1CKNA 4IPDA 4P71A 5IYBH 1RIPA 5GAHC 2OQKA 4HJAA 3HOVH 1PH5A 2JA5H 1ASYA 3K7AH 1I94Q 1X56A 1X54A 1Q1BA 3S2DH 1I50H 4KHZA 4JI3L 4BBRG 3GTQH 1A0IA 4AQYL 2OTJA 4LWCA 1N36Q 2YTVA 1XMOQ 5GAEC 1PH8A 3M3YH 4BBSH 4R4QA 1UEBA 1BKBA 4DR3Q 2E2IH 4JBMA 4A3DG 3M85A 1QVFA 1KL9A 1WJJA 4A3IH 4BY7G 1SE8A 3S1RH 1LM0A 1L1OA 3FP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AH9 A;  5M5X H;  3K7U C;  1HZB A;  2N78 A;  1NMG A;  3HOY H;  1WFQ A;  2E2J H;  4JI3 Q;  1C9O A;  1RL2 A;  3D0F A;  4AQY Q;  4ALP A;  3CMA A;  2JEB I;  2HHH L;  1NBW A;  3E9I A;  4PG3 A;  4YWM A;  4DUZ Q;  2AHO B;  1GO3 E;  2R7F A;  4X62 Q;  1PH7 A;  2JA7 H;  2H5X A;  2I5M X;  5IE8 A;  1SRO A;  4A3C H;  4O2D A;  2Q2I A;  4JI4 L;  3CF5 A;  1PHJ A;  3CC4 A;  1AE2 A;  1E22 A;  1VQ7 A;  2JA6 G;  3GTL H;  1HJP A;  3EIV A;  1YI2 A;  3F2B A;  1K8A C;  1VQL A;  2R92 H;  2R7Z G;  2JA7 G;  1JMC A;  1B7Y B;  2Q2T A;  4A3E H;  2ZJQ A;  2HHH Q;  4K0K Q;  1GD7 A;  3HOW H;  4GNX B;  4A3K G;  3FKI H;  5GAG C;  2WFW A;  4IJH A;  2VQE Q;  1SLJ A;  4A3G H;  4GN4 B;  1G51 A;  5DLQ E;  4IFD G;  1WCM H;  1YEZ A;  3JAM i;  2VZA A;  4BY1 G;  3UDI A;  4A75 A;  1KQS A;  4JI4 Q;  4YWK A;  3BJU A;  3PSI A;  3M9B A;  3PO3 H;  3UDX A;  1XPR A;  4GLV B;  1KC8 C;  3T1H L;  4LF6 L;  3NEL A;  1YZ6 A;  4QL5 A;  3PF4 A;  1QUQ B;  1AE3 A;  4JI8 L;  3CXC A;  3CCM A;  2JEA I;  1VQE A;  4OX9 L;  5FLX c;  5C3E H;  4R4I A;  3CME A;  3ICE A;  1WYD A;  5IP9 H;  5FLM H;  5M3F H;  1T9H A;  2PNH A;  5ELN A;  5IYB G;  3TRE A;  3CCL A;  3SGI A;  4DR1 L;  3S16 H;  2OCE A;  1QVC A;  4X66 Q;  1K0R A;  4A3J H;  2JA5 G;  1V43 A;  2Q2H A;  4A3D H;  3GTP H;  3T1H Q;  4LF6 Q;  4IO9 A;  2AWO A;  4JV5 L;  1GKH A;  1C7Y A;  3PF5 A;  2CKZ B;  4JI2 L;  2GN5 A;  4OX9 Q;  3F2D A;  4AH6 A;  3A5Z B;  4BBR H;  1A62 A;  2UUC L;  5M5W H;  5LMU L;  1IBM L;  1Y1V G;  4JI0 L;  3S1Q H;  4DAY B;  1MKH A;  3E0E A;  2E8G A;  4P75 A;  3RN2 A;  4DR1 Q;  4GOP B;  3I55 A;  3AFP A;  2JQO A;  2PI2 A;  4BA1 I;  4XIG S;  3S2H H;  4GNX A;  4JV5 Q;  3PUZ A;  3GD7 A;  4LUZ A;  3WWV A;  3CC2 A;  4BXX H;  2CWA A;  3H0G G;  4JI2 Q;  4NB3 A;  1JJ2 A;  2UUC Q;  3ULJ A;  1I3Q H;  3A5U A;  5LMU Q;  1NJI C;  1IBM Q;  2WB1 G;  3CCE A;  1SFO H;  4JI0 Q;  2YYZ A;  2Y0S E;  1XMQ L;  1SRU A;  2KCT A;  4LF8 L;  4X65 L;  1VS0 A;  1BVS A;  1UE6 A;  3M4Q A;  3CCU A;  3I4N H;  1TWF H;  1Q82 C;  1VQH A;  3VDY A;  1QUQ A;  5IYD G;  2JE6 I;  3I7F A;  3KF6 B;  4AYB E;  5M3M H;  2GVB A;  4PZ7 A;  3K0X A;  5IYC G;  4A3M G;  2JA6 H;  4C2M H;  4DKA C;  3JC6 6;  2JA8 G;  2R7Z H;  3PUY A;  1S72 A;  1U5K A;  3F8T A;  4OWX B;  5AJ3 L;  1XMQ Q;  4LF8 Q;  1Q86 C;  1X55 A;  5JEA G;  3L2P A;  4X65 Q;  1K73 C;  3IRB A;  2VW9 A;  5GAD C;  3CP0 A;  4GN3 B;  4DV1 L;  4A3K H;  4L5T A;  4HJ8 A;  2JJQ A;  1XNQ L;  1KRS A;  1VQ6 A;  1IBK Q;  3PUW A;  3RLO A;  2Y0S G;  1EWI A;  1YIT A;  3TQY A;  1N8R C;  4HJ9 A;  3DM3 A;  5AJ3 Q;  1EOV A;  3LGJ A;  4GOP A;  5C3E G;  5FLM G;  4QJF A;  4DR6 L;  5M3F G;  1N33 L;  4AYB G;  3HOZ H;  4C3I H;  4DV1 Q;  3S14 H;  1WOC A;  3UDF A;  3J81 i;  1XNQ Q;  4A93 G;  4DV0 L;  2YTX A;  1Y1W H;  2VQF L;  1J5E Q;  1PV4 A;  4OXP A;  3G71 A;  4DR6 Q;  4JG2 A;  1PFS A;  1N33 Q;  1UE5 A;  4IFD J;  1W2B A;  2XTI A;  3KF6 A;  1O7I A;  4X62 L;  4DNI A;  1Q1E A;  4H02 A;  5C0X G;  3HOX G;  2EIF A;  4OWT B;  3A0J A;  4DUZ L;  1VQO A;  2UU9 L;  1Y1V H;  2K52 A;  1B70 B;  4DV0 Q;  4JI1 L;  1L0W A;  1IYJ B;  3NEN A;  2LXK A;  3S15 H;  2VQF Q;  1P8L A;  3UE0 A;  3KDF A;  4BXX G;  2F52 A;  1OXS C;  3J80 i;  2K75 A;  2ZJP A;  4ME3 A;  5ELO A;  4JI7 L;  3PGZ A;  4R4T A;  2E2H H;  3H0G H;  1PH6 A;  4DR5 Q;  1JB7 A;  4B3M Q;  5IWA Q;  5M5Y H;  2B3G A;  4K0K L;  3KOJ A;  1CKM A;  3I4N G;  1JJG A;  1P16 A;  4EX5 A;  2UU9 Q;  2BA1 A;  4WJ3 M;  1EQR A;  3G48 A;  4JI1 Q;  2VQE L;  1Q46 A;  2PQA B;  4QIW E;  5M3M G;  2I5L X;  4A4I A;  3KFU A;  1XTD A;  3KYH C;  3RR5 A;  4NXN L;  1HZA A;  5IYD H;  4O0A A;  1Q81 C;  4JI7 Q;  2L15 A;  1N34 L;  1FGU A;  4YY3 L;  2BH2 A;  1OXT A;  3HFZ B;  5IYC H;  2OQ0 A;  1OXV A;  2D0P A;  4A3M H;  3CCV A;  2ZTE A;  4DK3 C;  3ULP A;  2R6G A;  3OTO L;  2JA8 H;  1L1O C;  3H15 A;  4QQB X;  4X6A H;  1H95 A;  1EIF A;  1HNW L;  2Z0S A;  3S17 H;  4NXN Q;  4OO1 G;  1VCI A;  1FVI A;  2MO1 A;  2YV5 A;  2QA4 A;  3KLW A;  4X66 L;  1N34 Q;  4YY3 Q;  1TWC H;  4LUO A;  4DV7 Q;  2C35 B;  4GLA C;  3CCS A;  1X65 A;  3OTO Q;  2NVX H;  2ES2 A;  3HOZ G;  3RZO H;  1L2F A;  1CKO A;  1KHI A;  4Y7N H;  1KAW A;  1UE1 A;  4UY8 C;  3TRZ A;  2KHI A;  1HNW Q;  2UXD L;  4GS3 A;  2KBN A;  2CQO A;  2IHE A;  1Y1W G;  2WB1 E;  1CUK A;  2K5V A;  4DPG A;  4BA2 I;  4A93 H;  2AMC B;  5C44 G;  2NZH A;  2F4V L;  5JEA J;  4A76 A;  3RNU A;  2IX1 A;  1G6P A;  3AQQ A;  2Z6K A;  4IFD I;  1VQD A;  1EYG A;  2PQA A;  1HR0 W;  2Q2U A;  1Z9F A;  1Q8K A;  3M4P A;  4NXM L;  2UXD Q;  2DUD A;  3W5O A;  4JI5 L;  3M7N A;  1NE3 A;  1LYL A;  4GLX A;  3HOX H;  2IX0 A;  2ID0 A;  2XGT A;  5GRO A;  3G6E A;  2D62 A;  5LMN W;  4JOI A;  3CW2 C;  1TWA H;  2VUM H;  3GTK H;  2QGQ A;  5HY6 A;  2F4V Q;  3EN2 A;  1C0A A;  5JJK A;  3G4S A;  3W1G A;  2AKW B;  3TEH B;  4L5S A;  4MTN A;  5H1S E;  4QGU A;  4LFC L;  3FHW A;  3PIP A;  5K36 G;  4NXM Q;  1S40 A;  1VQ8 A;  3PUV A;  1FL0 A;  4JI5 Q;  3I56 A;  3ZJY C;  4GKK Q;  4PZ8 A;  3H3V H;  4P73 A;  1A8V A;  4WJ4 A;  4JCV E;  5C4X G;  1K8G A;  3UE1 A;  1MJC A;  3CPF A;  1TWG H;  1IBK L;  2IT1 A;  1XNR L;  4LFC Q;  1X3G A;  4B3R L;  3I4O A;  4IJL A;  4L5R C;  4DV4 L;  3U4Z A;  5C0X J;  1HNZ L;  1TXY A;  1HH2 P;  3K81 C;  3PO2 H;  5J3B A;  4A3F G;  2R93 G;  4YWL A;  4YCV A;  3GTM H;  1CKN B;  1VQK A;  2A19 A;  1QZH A;  5FJ8 G;  1Q7Y C;  1VQF A;  4GNX C;  2NVT H;  4DR7 Q;  4UPA A;  1XNR Q;  1YJN A;  4B3R Q;  4DV3 Q;  4DK6 C;  2WAQ E;  4DV4 Q;  2UUA L;  1J5E L;  3NEM A;  2MQH A;  1HNZ Q;  1LUZ A;  4Y52 H;  1KXL A;  4DR4 L;  1PVO A;  4JBJ A;  1VQN A;  1D8L A;  3KJO A;  1Z47 A;  4DV6 L;  1KRT A;  4R4O A;  4HIO A;  2UUB L;  4JI6 L;  1ASZ A;  2EXD A;  1A63 A;  1E7Z A;  5GQO A;  5C4J H;  2PMZ E;  2UUA Q;  2I0Q A;  4IOA A;  3U50 C;  5C44 H;  1KIX A;  4GN5 A;  3CQZ H;  4LFA L;  1N32 L;  2K5H A;  2HIX A;  3UDG A;  4KHP L;  4UP8 A;  1I6H H;  4DR4 Q;  1VQ9 A;  3CCQ A;  1YJ9 A;  1QZG A;  4DR5 L;  2FXQ A;  1X3F A;  3AFQ A;  2MFI A;  3K8A A;  3PV0 A;  4POF A;  4P72 A;  5IWA L;  2I5H A;  1R9T H;  1PH1 A;  4DV6 Q;  3T1Y L;  1M1K C;  1XPU A;  4LF7 L;  4J15 A;  2UUB Q;  3MXN B;  5IT9 c;  2WAQ G;  5EAY A;  4JI6 Q;  2VUM G;  3JAM c;  1DGS A;  2D0O A;  3DLL A;  1VQM A;  1K9M C;  3CD6 A;  2A1A A;  1UE7 A;  3GO5 A;  1PH2 A;  1IXR A;  3EBE A;  4GOP C;  1N32 Q;  4JBW A;  4LFA Q;  2KEN A;  3CC7 A;  3CCJ A;  4KHP Q;  2BA0 A;  4PZ6 A;  4LUV A;  2PI2 E;  3ERS X;  5IP7 G;  4XTC S;  1SN8 A;  1VQ4 A;  4X64 L;  2YU9 H;  3GTO H;  3J81 j;  3BZK A;  3S24 A;  2LSS A;  3T1Y Q;  1V9P A;  1VQA A;  4L5Q A;  4LF7 Q;  1E3P A;  2JK8 A;  3J7Z C;  1MJE A;  5IY0 A;  3L0O A;  4AIM A;  1YIJ A;  1HZ9 A;  4C3H H;  1EQQ A;  4LF5 Q;  1OXX K;  4B3T Q;  3HOU G;  3S1M H;  1OXU A;  5C4X H;  4B3S L;  5C0X I;  2RCN A;  1Q12 A;  4OON A;  4UP9 A;  4DV7 L;  4IPG A;  2CWP A;  3Q8D A;  3TS2 A;  1YJW A;  4DAM A;  4X64 Q;  1VQG A;  3PO2 G;  1S3O A;  2ATW A;  4RG1 A;  1X3E A;  2A8V A;  4DR2 L;  2K5N A;  2DGY A;  4HJ7 A;  2R93 H;  2MO0 A;  4A3F H;  2HIV A;  4TQU S;  4TVA B;  1X9N A;  3RN5 A;  4MZ9 A;  3BU2 A;  2HQL A;  2WP8 J;  5FJ8 H;  2RHQ B;  2GVA A;  3CPW A;  2ASB A;  2B63 G;  3GTG H;  4B3S Q;  1M90 C;  1PYB A;  2QEX A;  3CCR A;  3H3V I;  3NBH B;  4P74 A;  4YCW A;  3STB C;  1EFW A;  3E9H A;  4HIM A;  2NZO A;  2AWN A;  3I2Z A;  4KI0 A;  4EQ5 A;  2ZJR A;  1E1O A;  3AEV A;  3KF8 B;  1YHQ A;  1VQC A;  1BBU A;  4DR2 Q;  2OWO A;  3I4M G;  4IPC A;  3F1Z A;  1MIU A;  4LF4 L;  1YHB A;  4A3B H;  2NN6 G;  2MNA A;  4LFB L;  5JJL A;  2KCM A;  4IOC A;  1VQP A;  1CSP A;  4POG A;  1YVC A;  1I5F A;  3HKS A;  1HZC A;  2E5L L;  3ULL A;  4YHH L;  1FJG L;  1U0L A;  4OO1 I;  1WI5 A;  2ZTC A;  4HJ5 A;  2OTL A;  4A3L G;  1IZ6 A;  1SMX A;  3BZC A;  1YBY A;  1EUJ A;  4DV2 L;  1JJC B;  3HKZ E;  2UXC L;  4LF4 Q;  4QY7 A;  4GKK L;  4LFB Q;  3D31 A;  4LW1 A;  4JBK A;  1BBW A;  1NMF A;  1PYS B;  2N8N A;  1HR0 L;  4DUY L;  1LTL A;  2IY5 B;  1G29 1;  1OTC A;  3RLN A;  3HOV G;  2E5L Q;  1D7Q A;  4YHH Q;  1FJG Q;  2NN6 I;  4R4C A;  3K80 C;  5LMN L;  5IP7 H;  4UP7 A;  3U4V A;  4YCU A;  4DV2 Q;  2UXC Q;  1K3R A;  2R7D A;  4JI8 Q;  1YHA A;  3OW2 A;  3W1B A;  4BBS G;  3J81 c;  1PH4 A;  1QVG A;  1HR0 Q;  4DUY Q;  4LNQ A;  4A3I G;  4OWW B;  2Z6K C;  2ZM6 L;  3U58 A;  3PCO B;  4DR7 L;  4PMW A;  2B29 A;  3HOU H;  5BR8 L;  3RZD H;  4BY7 H;  1NTG A;  4MNO A;  1W3S A;  2YTY A;  3HKZ G;  4DV3 L;  2UXB L;  1YNX A;  1IBL L;  4FDB A;  5LMN Q;  3HOY G;  2N49 A;  3GTJ H;  1NY4 A;  3M4O H;  4KLK A;  3STB D;  1XJV A;  1V1Q A;  1X6O A;  3CAM A;  5HGQ A;  4RMF A;  1E1T A;  4JOI C;  3MEF A;  2NVQ H;  2V1C C;  3RLF A;  1VQ5 A;  5JJI A;  1XPO A;  2ZM6 Q;  1IL2 A;  3PUX A;  4JYA L;  1GVP A;  5BR8 Q;  2RF4 A;  2B63 H;  2HT1 A;  1E24 A;  4A3C G;  4GKJ L;  2UXB Q;  4APV A;  1SR3 A;  1IBL Q;  1VQB A;  3J80 c;  3S1N H;  1Y14 B;  3GDE A;  4R1J A;  3AYH B;  3J7A 5;  2LXJ A;  1HNX L;  2R92 G;  3KJP A;  2CFM A;  4DV5 L;  3TS0 A;  2EQS A;  4A3E G;  1L1O B;  2N3S A;  2CCZ A;  1PH9 A;  3HOW G;  4A3B G;  3FKI G;  3I4M H;  4HID A;  3KDF B;  4A3G G;  4JYA Q;  2ZTD A;  2KHJ A;  2RHS B;  3A74 A;  1WCM G;  1PH3 A;  1EIY B;  4B3M L;  4HIK A;  4GKJ Q;  2VNU D;  2VY3 A;  1K83 H;  3PIO A;  1GM5 A;  1VQJ A;  3B6Y A;  4LF9 L;  3PO3 G;  2VL6 A;  1KD1 C;  1HNX Q;  4BY1 H;  2ALY B;  1B8A A;  4DV5 Q;  1TWH H;  1JT8 A;  3OYY A;  1UWV A;  4A3L H;  2K14 A;  2K50 A;  3ER0 A;  3F2C A;  1I94 L;  1CSQ A;  4C3J H;  1J6Q A;  2VS1 A;  5IP9 G;  1PA6 A;  1N9W A;  5E7N A;  2JA9 A;  1N36 L;  4NPS A;  4JC0 A;  1XMO L;  1VQI A;  1JE5 A;  4DR3 L;  4LF5 L;  3L7Z C;  2BH8 A;  4B3T L;  4LF9 Q;  4IPH A;  4A3J G;  2IHF A;  2NVY H;  2F3I A;  2K4K A;  1CKN A;  4IPD A;  4P71 A;  5IYB H;  1RIP A;  5GAH C;  2OQK A;  4HJA A;  3HOV H;  1PH5 A;  2JA5 H;  1ASY A;  3K7A H;  1I94 Q;  1X56 A;  1X54 A;  1Q1B A;  3S2D H;  1I50 H;  4KHZ A;  4JI3 L;  4BBR G;  3GTQ H;  1A0I A;  4AQY L;  2OTJ A;  4LWC A;  1N36 Q;  2YTV A;  1XMO Q;  5GAE C;  1PH8 A;  3M3Y H;  4BBS H;  4R4Q A;  1UEB A;  1BKB A;  4DR3 Q;  2E2I H;  4JBM A;  4A3D G;  3M85 A;  1QVF A;  1KL9 A;  1WJJ A;  4A3I H;  4BY7 G;  1SE8 A;  3S1R H;  1LM0 A;  1L1O A;  3FP9 A; 
#chains in the Genus database with same CATH topology
 3DM1 A;  5COY A;  1HZB A;  4CDC C;  1TWC A;  1M0T A;  4UCO A;  4RB1 A;  4LF4 H;  5KG5 A;  2PMZ B;  4ZOL F;  3D0F A;  5C5J A;  5KFF A;  4ALP A;  2RVL A;  2R87 A;  2JEB I;  1NBW A;  3RZD B;  1GGO A;  2K01 A;  4PG3 A;  5C4H A;  1M0W A;  1B44 D;  1PH7 A;  1G2S A;  4DK1 A;  3A8J E;  2M00 A;  2I5M X;  1EQV A;  2OEO A;  1O7L A;  5IE8 A;  2Q2I A;  3CC4 A;  1PHJ A;  1K8M A;  2JA6 G;  3GTM B;  2UXC H;  2SDF A;  4K2L A;  1YI2 A;  3F2B A;  1VQL A;  1HR0 H;  1I4G A;  2HHH Q;  4GNX B;  2W71 A;  1UC9 A;  2ATL A;  2QCP X;  3G7L A;  2PO4 A;  2VQE Q;  1SLJ A;  2B8F A;  2MHV A;  2XN9 C;  1WCM H;  3BG5 A;  2VUM A;  2P0A A;  4QW9 A;  2FLL A;  1RK5 A;  4GLV B;  1TY2 A;  3RV3 A;  1E2Z A;  3NEL A;  1YZ6 A;  1XTC D;  4PNY A;  2ZM6 H;  4DR7 H;  5C4J B;  1ULZ A;  3SE7 A;  4RNN A;  5FLX c;  1AFP A;  3CQZ B;  1IKL A;  3X3N A;  1WTH A;  1O75 A;  1S0M A;  3SGI A;  5KFH A;  1QVC A;  5M9O A;  3RB6 A;  4RKB A;  3T1H Q;  4IO9 A;  4JV5 L;  2C2R A;  2CKZ B;  2EXZ A;  4ME5 A;  3NBH A;  1PX2 A;  2YS6 A;  4CC5 A;  1A62 A;  4O4H F;  2NVY B;  1V8Q A;  1KDA A;  3S1Q H;  4DAY B;  2F0T A;  1TS2 A;  4RCO A;  3WOE A;  4FBT A;  1LT5 D;  5IGE A;  4DR1 Q;  1RF2 D;  4GOP B;  3JAM E;  4I55 F;  1GJX A;  4DV5 H;  4V0B A;  5HUR A;  3BVG A;  2PQE A;  4JI2 Q;  2D2C C;  2MJ8 A;  3A5U A;  5LMU Q;  1HUM A;  1O7Z A;  5J39 A;  1SFO H;  2YYZ A;  2Y0S E;  5CB4 F;  4X65 L;  3M4Q A;  1BVS A;  3WO1 A;  5JVD F;  2A69 C;  5KX5 F;  1TWF H;  2J6U A;  3KF6 B;  2XCA A;  2W8K A;  3A7A B;  2ZDH A;  4L1K A;  4G3I A;  3GV8 B;  4N8F A;  5FO7 B;  5D8D A;  2JA8 G;  1D5M C;  1S72 A;  5L9X A;  3F8T A;  2RQX A;  1TWH A;  4IAL A;  1XMQ Q;  3RAQ A;  1Q86 C;  1X55 A;  2VW9 A;  2W9B A;  5GAD C;  4ECX A;  2QKI C;  2JJQ A;  1FYC A;  1KRS A;  3DXJ C;  2R92 B;  4J6H A;  2M2L A;  2E74 C;  4JI3 H;  2VA3 A;  5D1P A;  3RMH A;  3PUW A;  3K58 A;  3HOW B;  1YIT A;  3TQY A;  1RJP A;  4HJ9 A;  3DM3 A;  4XQQ A;  4A3G B;  5KYL A;  2YU9 A;  2NYZ D;  3C2P A;  4DR6 L;  4B3S H;  4C3I H;  1AN8 A;  2G9D A;  5A2Q E;  2XIW A;  4K8J A;  3GV6 A;  1A6X A;  5FLX L;  3WO0 A;  3BS1 A;  3SI8 A;  3PQI A;  3KLS A;  1J5E Q;  1PV4 A;  4I7Z C;  4B9X A;  4IQZ A;  2D9U A;  3HKZ A;  1SYB A;  1PFS A;  1N33 Q;  3BZD B;  5L37 A;  1O7I A;  1B3Q A;  1S0O A;  4DNI A;  1KDB A;  5I6Y A;  3S16 B;  1LTB D;  2PZU A;  3HOX G;  3S2H H;  4JI4 H;  4HTH A;  4FF4 A;  2K52 A;  1B70 B;  4A3D B;  2FPG B;  3K0Y A;  1I4H A;  1GUT A;  2DJG C;  4CKE A;  1BNZ A;  3MFH A;  1WTP A;  1EQT A;  2VQF Q;  2GPS A;  3LX0 A;  1Y8P B;  1OXS C;  2XWB B;  4ME3 A;  5ELO A;  1WD0 A;  3BAA A;  3PGZ A;  4DR5 Q;  1JB7 A;  1U4P A;  3NTK A;  1SND A;  1M7J A;  4FF1 A;  4H0L C;  1CKM A;  5K36 H;  2L5T A;  2UU9 Q;  4JI1 Q;  1HQR D;  3J81 E;  2VQE L;  3GTJ B;  4R8N A;  3L4K A;  4LF6 H;  3KYH C;  3RR5 A;  1N34 L;  4LAA A;  4M7E A;  4A3M H;  2D0P A;  5CV9 A;  4IUN A;  3CCV A;  4DUY H;  3ULP A;  2R6G A;  1X3P A;  2SOB A;  2FPP B;  3H15 A;  2J4X A;  5JEA H;  3TBI B;  1EIH A;  2HDL A;  1K8O A;  4NXN Q;  3PVX A;  2F0Q A;  1FVI A;  3SXH A;  1ZYR C;  4C2M B;  1FNU A;  2R7Z B;  1LTI D;  3C1F A;  4GLA C;  3J80 E;  3K5I A;  5KG7 A;  2WKC A;  3MHB A;  4IHJ F;  4JI0 H;  1K1Q A;  1JDE A;  4C3I G;  1KHI A;  3DEP A;  1F2Y A;  3TRZ A;  2UVR A;  1EY4 A;  2NB0 A;  3W3A A;  2AQ3 B;  4NKL A;  3T56 B;  4ODG A;  1BQQ T;  3MWE A;  3RUZ A;  3K5N A;  2K5V A;  4G57 A;  4O42 A;  4EBC A;  4E6I A;  4DN4 M;  4C3J B;  4YJ3 F;  2YZG A;  4M8A A;  1TA8 A;  5EGT A;  3GV3 A;  1VQD A;  4U68 A;  1IKM A;  5DGB A;  4DAV A;  1AEX A;  4LSX A;  4X3U A;  4CC6 A;  2W8L A;  5T1I A;  4JI5 L;  4ECZ A;  3M7N A;  4GLX A;  2RBM A;  4PQX A;  3VPB A;  3G6E A;  5LMN W;  2XGT A;  4R8U B;  2D62 A;  2CQY A;  4JOI A;  3CW2 C;  3OHB A;  1SJH D;  4F50 A;  2QGQ A;  1IYV A;  3EN2 A;  3TP8 A;  2FK3 A;  4I7A A;  4L5S A;  4O3Q A;  5CV4 A;  4QGU A;  2VOB A;  3FHW A;  5DGA A;  5K36 G;  1Y1V B;  2I46 A;  2JA6 A;  1S40 A;  4MV6 A;  2PZW A;  3PUV A;  1MZB A;  3ZJY C;  3OSN A;  4APM A;  4P73 A;  2KEE A;  4JCV E;  4WJ4 A;  3M4I A;  2XGP A;  2A6E D;  5DG8 A;  4O4L F;  1TWG H;  5C1P A;  1B53 A;  4B3R L;  4FM9 A;  3I4O A;  2EY5 A;  5D65 A;  4Q5V A;  1PZJ D;  1KJQ A;  5J3B A;  1TVX A;  2F0V A;  4YWL A;  4YCV A;  3UI2 A;  5KFU A;  4DV0 H;  1JE4 A;  2FLP A;  1SSO A;  4QMG A;  1Q7Y C;  5D1O A;  3N6X A;  1XDN A;  1E2W A;  1XNR Q;  4DK6 C;  4DV4 Q;  1L2Z A;  1J5E L;  1M4V A;  1JWM D;  2MQH A;  3AMU A;  3I12 A;  3LWU A;  4DUZ H;  1W6J A;  1VQN A;  1D8L A;  3TZU A;  2FK1 A;  2RDG A;  4XQN A;  1ONL A;  1CA5 A;  4R4O A;  3EVQ A;  2EYM A;  4JI7 H;  1E7Z A;  4KN7 C;  1PFM A;  3QJY A;  1GSA A;  2HIX A;  3UDG A;  5CGK A;  3H94 A;  1J8I A;  2WKD A;  1ZKO A;  1YJ9 A;  4DR5 L;  3AFQ A;  1LT3 D;  1WTX A;  3RB3 A;  1ROD A;  3T1Y L;  1GHK A;  2WAQ G;  4KY5 A;  3JAM c;  2AGP A;  1SE4 A;  2A1A A;  3GO5 A;  5T1G A;  2HDM A;  5I2Y A;  3QIA A;  4JBW A;  4LFA Q;  2KEN A;  3CC7 A;  2O5I C;  4KHP Q;  1N32 Q;  5J2U F;  2YYA A;  4PZ6 A;  3ITP A;  4XTC S;  2LY7 A;  4LJZ C;  1Z6H A;  5CV8 A;  1ENA A;  1VQ4 A;  2AUJ D;  3OMC A;  3GTO H;  1W93 A;  3PZP A;  3BZK A;  4IWY A;  2LSS A;  5CMD A;  1VQA A;  4L5Q A;  2I8C A;  4AIM A;  1STH A;  3S1M H;  3NQI A;  1EQQ A;  4LF5 Q;  2R7L A;  2W6Q A;  2F0O A;  4XYQ A;  4B3S L;  3SK6 A;  2RCN A;  2LMC B;  4OON A;  4UP9 A;  5IYZ F;  3TP7 A;  3Q8D A;  5DNF A;  3TQT A;  3I70 A;  4X64 Q;  1N56 A;  2XNA C;  3KLS X;  2WE6 A;  1VBG A;  1B1Z A;  1IOW A;  4XZ3 B;  1B33 N;  2R93 H;  2PCF B;  4TVA B;  5DLF A;  4BWS C;  4J0M A;  4P2C B;  2PPB C;  3BU2 A;  2WP8 J;  4HNT A;  4ECT A;  3CPW A;  4MTK A;  4RZQ A;  1DXM A;  5KNB A;  1K1S A;  3NBH B;  4EGQ A;  4YCW A;  1EFW A;  2UUC H;  1GXD C;  2AWN A;  4NXM H;  3EPG A;  1E1O A;  1SNP A;  2K5W A;  2ICI A;  2XIG A;  3TII A;  3I4M G;  4J9M A;  4IPC A;  3F1Z A;  2K03 A;  1C8C A;  4A3B H;  3HP3 A;  1LTA D;  4LFB L;  1C30 A;  5KFE A;  4X3S A;  4TUY F;  3A54 A;  1S68 A;  4UFZ A;  5KFG A;  4ZUJ A;  3ULL A;  1WI5 A;  2ZTC A;  4HJ5 A;  1SCU B;  2CVR A;  4A3L G;  1NNX A;  1YBY A;  3HKZ E;  2QK4 A;  3C3L A;  1EL0 A;  4ECV A;  2W9A A;  1SFO A;  1PYS B;  4DUY L;  1IBK H;  5F9N A;  4EGJ A;  1TWF A;  3HOV G;  4WJW A;  3JAM L;  3KTM A;  1HNZ H;  4YHH Q;  1EOT A;  1ICW A;  2K6A A;  3U4V A;  3GTP B;  4IR1 A;  3JZI A;  1S5C D;  3J81 c;  2NUC A;  2A5H A;  2M9V A;  3T51 B;  2X0S A;  4OL7 A;  1GOZ A;  2UUA H;  5CBE E;  1SNQ A;  4LK1 C;  2VB3 X;  4O1N A;  3KF8 A;  1SYF A;  3H0G B;  1XYI A;  5CC4 A;  1NTG A;  2YU9 B;  4MNO A;  5DM6 3;  1W3S A;  3BVZ A;  3D4D A;  3HOY G;  5LMN Q;  4RAU C;  1YNN D;  2WB1 B;  2JYO A;  1NY4 A;  3M4O H;  2K5D A;  4Q43 A;  4DV6 H;  1S4Z A;  5HGQ A;  4C3H B;  5I9P A;  4JI6 H;  3MEF A;  1LTT D;  2B8G A;  2V1C C;  3RLF A;  2DY7 A;  3EQL C;  4QIW A;  4YB8 B;  1E4E A;  1IL2 A;  1GVP A;  3OIQ A;  4JPB W;  5BR8 Q;  4A3C G;  1PLF A;  4CJ0 B;  2UXB Q;  4APV A;  2C00 A;  1VQB A;  1UNS A;  3J80 c;  3AB9 A;  4B3M H;  5IWA H;  2LXJ A;  4A3F B;  3QOL A;  4IR9 A;  4QUC A;  5BN3 A;  4A3B G;  3GTG B;  4QWD A;  3GIM A;  1IL8 A;  3E5S A;  4XT1 B;  3Q8Q B;  3ORQ A;  4O3S A;  1RJR A;  5A2Q L;  4JYA Q;  2ZTD A;  2SNS A;  4WBN F;  1PH3 A;  1R4Q B;  1I4Q A;  4GKJ Q;  2L12 A;  4IUT A;  3SK8 A;  1VQJ A;  4QW8 A;  4LF9 L;  4NP5 A;  2K33 A;  5ELC A;  2K04 A;  4RZR A;  1KD1 C;  4BY1 H;  2JEI A;  1LTS D;  1TWH H;  2Z4H A;  3IFT A;  4S3S A;  2K14 A;  1I94 L;  5FLX W;  4A93 B;  2LFN A;  1CSQ A;  1J6Q A;  2VS1 A;  1MSG A;  4JC0 A;  1TU2 B;  4LF5 L;  4DV7 H;  1B4O A;  3X3M A;  4A3J G;  2F3I A;  2A8V A;  1CKN A;  1RIP A;  2OQK A;  1E4G T;  1HNW H;  4RHS A;  3V2T A;  1I50 H;  1S0N A;  4GC6 A;  1TWA B;  5JOB A;  4AQY L;  1IW7 C;  2OTJ A;  2J9G A;  1PH8 A;  3M3Y H;  4U6P A;  4R4Q A;  1UEB A;  1BKB A;  2F0K A;  4DR3 Q;  2E2I H;  4EYH B;  1KL9 A;  4A3I H;  2EY1 A;  1SE8 A;  3J81 L;  3S1R H;  4QJF A;  3D6C A;  3FP9 A;  1EY5 A;  3VR4 A;  1A2T A;  5M5X H;  1EU3 A;  3BJY A;  4MV9 A;  3T16 A;  1WFQ A;  3URY A;  4J9K A;  1C9O A;  1A3U A;  1RL2 A;  4EBD A;  2Y0S A;  3CMA A;  2EDG A;  3HRZ C;  3E9I A;  4Q8E A;  2F4V H;  2E5L H;  1FJG H;  4OEM B;  2F0G A;  2H5X A;  1FGB D;  3PO2 B;  3CF5 A;  4DV2 H;  4RUA A;  3J80 L;  2NVT B;  1K8A C;  1C3O A;  1N48 A;  1DOM A;  4JW0 A;  3I73 A;  2JA7 G;  1JMC A;  5KFS A;  4FO2 A;  5EPK A;  2Q2T A;  4K0K Q;  3F8N A;  4A3K G;  5GAG C;  2UVV A;  2WFW A;  4EEQ A;  4GN4 B;  4QUF A;  4IFD G;  2OT2 A;  1GUS A;  2VZA A;  4BY1 G;  3V4S A;  4YWK A;  1AP0 A;  2R8K A;  3M9B A;  2N88 A;  3UDX A;  1PTO B;  2H4O A;  3PO3 H;  1XPR A;  1UAP A;  3E0J A;  1SYE A;  1SYG A;  3QFF A;  3RIZ A;  1QUQ B;  5TSS A;  1AE3 A;  3CRK C;  1CA6 A;  5C3E H;  5C44 B;  3CME A;  1ENF A;  5FLM H;  1KEE A;  5M3F H;  2PNH A;  4DV3 H;  4EVO A;  4DFA A;  2MP1 A;  1K0R A;  2NTT A;  1V43 A;  2Q2H A;  5T14 A;  2NU6 B;  1TWG A;  4XQJ A;  3M4Y A;  4K2K A;  2YL2 A;  1NR2 A;  2EJF C;  4BBR H;  4ED0 A;  2A68 C;  2EYL A;  2UUC L;  2BE5 C;  2L11 A;  1IBM L;  1GSO A;  3UFX B;  4P75 A;  2E8G A;  2FPI B;  1F2Z A;  3RN2 A;  3GV7 B;  5C1O A;  5IT9 E;  3QR8 A;  1HNX H;  1M8A A;  4DR4 H;  1SMY D;  1HA5 A;  2PI2 A;  4WOR A;  1R4P B;  4K6D A;  4BA1 I;  4RGN A;  1D5X C;  4JV5 Q;  3WWV A;  3H0G G;  1WVL A;  4BBS B;  2UUB H;  4XX0 B;  4L63 B;  5KT7 A;  1F2M A;  3ULJ A;  5BN5 A;  2F0I A;  2PW7 A;  1WTV A;  4FF3 A;  1CHP D;  2WB1 G;  3CCE A;  2XC9 A;  4FNF A;  3I4N H;  5JVH 3;  1CFM A;  3PIO 3;  4YP3 A;  3VDY A;  5IYD G;  3FPP A;  1S5E D;  1GUN A;  1I4P A;  5KND A;  3Q1K A;  2C9O A;  3G6V A;  2JA6 H;  1N36 H;  4V19 0;  4DKA C;  3JRW A;  4RAZ A;  3I72 A;  1L0X B;  4OWX B;  2CH4 A;  3L2P A;  4X65 Q;  1K73 C;  2ENB A;  2KOL A;  4FF2 A;  1STB A;  1UC8 A;  2ZJT A;  2DPJ A;  4NLG A;  4O2A F;  4DL3 A;  2F0N A;  4HJ8 A;  1XNQ L;  1D5Z C;  1EU4 A;  1KJJ A;  1HA6 A;  1I7L A;  3MFG A;  1EWI A;  1PTO C;  1HFN A;  3GIQ A;  5KT3 A;  1KNA A;  5KFI A;  5C3E G;  4FU0 A;  4KY7 A;  5FLM G;  5M3F G;  1WCM B;  3VR3 A;  4AYB G;  3HOZ H;  1B04 A;  2DLN A;  3IKJ A;  5IGG A;  2RSO A;  4A93 G;  1QG7 A;  1Y1W H;  3NGD A;  2DPI A;  1S9F A;  5F2D A;  1EY7 A;  1JC7 A;  2W6N A;  2K5Q A;  1STA A;  3FPU B;  4DR6 Q;  4JG2 A;  4IFD J;  1SNO A;  3I3C A;  3FEW X;  4RH6 A;  3E6Z X;  4H02 A;  5C0X G;  4OWT B;  2A6H C;  1VQO A;  5GON F;  2R93 A;  5KFZ A;  1AZP A;  2FJZ A;  4YBZ B;  1P8L A;  3MTS A;  1ET9 A;  3UE0 A;  1DIK A;  1AN7 A;  1EY8 A;  1X3Q A;  2MCT A;  2E2H H;  3K6O A;  4I4T F;  1PH6 A;  3GTL A;  3HOU B;  1D2B A;  2B3G A;  4K0K L;  1ENC A;  4YJ2 F;  3I4N G;  1JJG A;  1P16 A;  4F4Z A;  3U9T A;  5JVG 3;  1EQR A;  2IP4 A;  3HB9 A;  5LYJ F;  2PQA B;  4QIW E;  1WTQ A;  2R7N A;  4PWQ A;  4A4I A;  1XTD A;  4EBE A;  3T1H H;  2VPS A;  3MFY A;  5KG3 A;  1EHI A;  3GIK A;  2F3W A;  1Q81 C;  4KD3 A;  1BXT A;  2NVQ B;  5EWE A;  4JI8 H;  1Y8N B;  2YW2 A;  4HQ6 A;  5EKK A;  4YY3 L;  3HFZ B;  2OQ0 A;  1OXV A;  1LT4 D;  3OTO L;  2B63 B;  2JA8 H;  1L1O C;  2X6L A;  3FMA A;  4QQB X;  4X6A H;  1EIF A;  1HNW L;  2Z0S A;  2BDN A;  3S17 H;  4OO1 G;  1IOV A;  2MO1 A;  4HR7 A;  5EOY A;  4DNR B;  1SYX B;  1N34 Q;  2X6G A;  3KHG A;  3TDQ A;  2C35 B;  4O3O A;  3EYY A;  2NVX H;  3HOZ G;  1LAC A;  1SE2 A;  1UE1 A;  4UY8 C;  5I9O A;  3RB4 A;  3RBE A;  2UXD L;  1IBL H;  3RFC A;  1L0Y B;  1Y1W G;  4DPG A;  4DXF A;  5C44 G;  2NZH A;  4FS2 A;  2F4V L;  4F87 A;  4A76 A;  3Q8S B;  3AQQ A;  5KFW A;  1DON A;  2FMA A;  5IIF A;  1XMQ H;  4MV7 A;  1Z9F A;  3M4P A;  3PW2 A;  2R8J A;  3JAM W;  3K5L A;  1DD2 A;  3I4L A;  1LYL A;  2JA5 B;  3HOX H;  3K7A B;  3HBL A;  4J8Q A;  2ID0 A;  5GRO A;  2ASD A;  2Z8L A;  3GTK H;  1SXT A;  2Z9H A;  4ILW A;  2HGS A;  5HY6 A;  3KUP A;  4DL7 A;  3GTQ B;  1C0A A;  1V4Y A;  4DL6 A;  2AKW B;  3PW5 A;  3TEH B;  4MTN A;  5H1S E;  4ED8 A;  3OHX C;  4LFC L;  3RV4 A;  2LKV A;  1JIH A;  4RKL A;  4YAK B;  4JI5 Q;  4J9O A;  1S5F D;  2JA7 A;  4G7Z C;  2F0D A;  4YR3 A;  1A8V A;  3ONA B;  4YR0 A;  1PRT D;  2E2J B;  5C4X G;  3RGZ A;  1MJC A;  2IJ0 A;  2B2V C;  1F9P A;  2W9C B;  4C5A A;  1N33 H;  5C0X J;  2WYO A;  2L4N A;  5DQI A;  5KGU A;  1RYS A;  3RJ0 A;  2B2Y C;  3GTM H;  1CKN B;  1VQK A;  2RDF A;  1QZH A;  2E75 C;  5FJ8 G;  1VQF A;  5D3I B;  4GNX C;  5BMV F;  3OWF A;  1OO9 B;  4DR7 Q;  4UPA A;  2FK2 A;  4A3E B;  4B3R Q;  4O4I F;  1YNJ D;  1BOS A;  2WAQ E;  3ETJ A;  3NEM A;  3FKI B;  1WTO A;  1FKA H;  4KKS A;  4TV8 F;  5A2Q W;  1KXL A;  4DR4 L;  1QCB D;  4A2A A;  4JBJ A;  2UU9 H;  1I50 A;  4JI1 H;  4X62 H;  3KJO A;  3BDC A;  1Z47 A;  2IL8 A;  4CDE C;  2GLT A;  4EFE A;  5KFN A;  1KRT A;  4IUQ A;  1LAB A;  2UUB L;  2E2I A;  3WDN A;  2NN6 H;  5C4J H;  2Y0S B;  2I0Q A;  3RUP A;  3U50 C;  4GN5 A;  1UUP A;  3CQZ H;  3OOC A;  4DAP A;  1MD2 D;  4UP8 A;  1GUO A;  3NUC A;  5EQ0 A;  3CCQ A;  2KVM A;  3TME A;  1VQ8 A;  2HT1 A;  4HSP A;  3PV0 A;  5KFK A;  2J6S A;  1PH1 A;  1ZHS A;  2I5H A;  2QDB A;  4HSV A;  4J15 A;  2O2L D;  4NXN H;  5IT9 c;  5EAY A;  3C46 A;  5LL6 S;  3IFD A;  2NU8 B;  3FRP B;  1H9S B;  5CV7 A;  2L0C A;  4MN3 A;  4GOP C;  3M9M B;  1FD7 D;  4Q45 A;  2DZD A;  2UVW A;  3S9W A;  5M5W B;  4UCV A;  2PI2 E;  3ERS X;  5EKL A;  4FXK C;  5CA1 F;  1SN8 A;  3SDZ A;  4DF7 A;  3QB3 A;  1EIG A;  1G91 A;  3J81 j;  1AUX A;  5EZY F;  3J81 W;  3T1Y Q;  3V6J A;  3RB0 A;  1E3P A;  1MJE A;  4QWC A;  5IY0 A;  2RGV A;  4MHE A;  4X66 H;  1YIJ A;  5CV6 A;  4EQN A;  3HOU G;  4L6T B;  1EFI D;  1PRT F;  2FMM A;  5IOC A;  4LSA A;  1Q12 A;  4OX9 H;  4IPG A;  4DGZ A;  1V1P A;  1T94 A;  1YJW A;  5KFQ A;  4DAM A;  5CYU A;  5LA6 F;  1MGS A;  4DR2 L;  2K5N A;  4TQR A;  1EUC B;  5M3M B;  5KFL A;  5KFM A;  3KHR A;  2ZXR A;  2R86 A;  3ETH A;  2QEJ C;  3RN5 A;  1TWG B;  2L55 A;  2RHQ B;  2B63 G;  3NHH A;  4B3S Q;  1KDC A;  1M90 C;  3J80 W;  2GA4 B;  1PYB A;  2NTS A;  1K28 A;  4P74 A;  4OGQ C;  3STB C;  3E9H A;  1HUN A;  4KI0 A;  4EQ5 A;  2ZJR A;  3AEV A;  2KCN A;  1VQC A;  2EYF A;  2EOT A;  1MIU A;  4LF4 L;  1YHB A;  3N6R A;  2NN6 G;  4J9Q A;  2PNR C;  1CSP A;  3NBI A;  4POG A;  1YVC A;  1I5F A;  3HKS A;  1EZ6 A;  3VA7 A;  2HVQ A;  5KFR A;  1U0L A;  3ORR A;  4GC7 A;  4LF8 H;  2MGS A;  3S14 B;  3U9O A;  2AUK A;  1I4R A;  3RAX A;  2OF1 A;  4ECW A;  1EUJ A;  2UXC L;  3HZX A;  1ZET A;  2WAC A;  4LFB Q;  4QWB A;  5NUC A;  2DWC A;  2B2W C;  1BBW A;  2K1B A;  1CE8 A;  4RHR A;  1HR0 L;  1LTL A;  1JX4 A;  1LTR D;  1XNR H;  2IY5 B;  3GID A;  4O3N A;  4U67 3;  1OTC A;  4UCT A;  3RLN A;  4DV4 H;  5IT9 L;  5KT5 A;  3G8C A;  2Q8I B;  3OMG A;  1O78 A;  2NN6 I;  3CVZ A;  4RA8 A;  4R4C A;  3K80 C;  2F0L A;  5FOB B;  2ZXP A;  4UP7 A;  4DV1 H;  2AGO A;  1K3R A;  1EYA A;  1YHA A;  2DY8 A;  1WSC A;  3W1B A;  3S15 B;  4LNQ A;  4DUY Q;  3V6H A;  2PBZ A;  3U58 A;  2ZM6 L;  4DR7 L;  3PCO B;  1JLL B;  2B29 A;  3T4A C;  2WII B;  1U9R A;  3GTO B;  2KJX A;  5I6W A;  4JK1 C;  4DXG A;  1IBL L;  3GTJ H;  1XJV A;  5DM7 3;  1X6O A;  3CAM A;  3S1M B;  1E1T A;  4BS9 A;  2J6T A;  1Z7T A;  1SBB B;  1VQ5 A;  2R7K A;  2JXM B;  2GPW A;  2F0S A;  1JIC A;  1N32 H;  3PUX A;  1WTR A;  4MTD A;  4KHP H;  2RF4 A;  1I7N A;  1E24 A;  3Q2O A;  5E4X A;  3RTX A;  5ISR A;  1STY A;  1Y14 B;  2KHS A;  3GDE A;  1Y1W A;  2R93 B;  2R92 G;  2DNC A;  1DM0 B;  5ELD A;  4RAY A;  4CJ1 B;  2CFM A;  2RKS A;  4DV5 L;  2EQS A;  4A3E G;  3VPC A;  1PRT B;  1PH9 A;  3HOW G;  2VR1 A;  2R61 A;  3FKI G;  3I4M H;  4DNT B;  1TWC B;  2VB2 X;  4A3G G;  2KHJ A;  2CHB D;  5DEH A;  3FDS A;  1B9M A;  3QZ8 A;  4HIK A;  2VY3 A;  1K83 H;  1STG A;  3RZO B;  4X64 H;  1S5D D;  1B8A A;  1JT8 A;  3OYY A;  1E0B A;  1UWV A;  1S03 G;  4A3L H;  2K50 A;  1RJT A;  5D14 A;  3F2C A;  2E2H A;  3KLR A;  4C3J H;  2IA6 A;  5IP9 G;  1N9W A;  4IAJ A;  1VQI A;  1JE5 A;  4EGV A;  3L7Z C;  4LF9 Q;  4IPH A;  2K4K A;  5IYB H;  4IPD A;  3HOV H;  4A3D G;  3QWN A;  2YS7 A;  1S10 A;  1II3 A;  1PH5 A;  1Q3L A;  3BQ0 A;  1I94 Q;  4J9N A;  1Q1B A;  3S2D H;  4JI3 L;  1VF5 C;  3R93 A;  2VUM B;  2KA7 A;  5KT2 A;  1B50 A;  4LWC A;  4IUR A;  5GAE C;  1KAA A;  4RGM A;  2F0M A;  5KFY A;  1LM0 A;  3K59 A;  1L1O A;  1BXR A;  4X62 L;  1EUD B;  3VR6 A;  5KRU A;  1AH9 A;  3EJI A;  3MR2 A;  2N78 A;  1NMG A;  4PMC A;  3HOY H;  3GIL A;  1SAP A;  1RYR A;  2JEG A;  4AQY Q;  2BQ3 A;  2NVX A;  1EEF D;  3MXU A;  3QG1 A;  4YWM A;  4DUZ Q;  4GZY C;  3MVV A;  2H1E A;  2AHO B;  1GO3 E;  4UDU C;  3M4O B;  3TZD A;  1QIL A;  2F0H A;  4A3C H;  4JI4 L;  5LP6 F;  1W96 A;  1BCP D;  4ULL A;  3GTL H;  1FNW A;  2F1M A;  1HJP A;  1PDQ A;  3TQ1 A;  4GKK H;  2R7Z G;  2PZT A;  3JSL A;  3NWS A;  5CBA E;  3BDL A;  2ZJQ A;  4ZCK A;  4O2B F;  1GD7 A;  2W6P A;  4N8X 1;  3VYU A;  2V4Q A;  3N42 B;  1BO0 A;  3JRX A;  3PMF A;  1B6S A;  5DLQ E;  4B9W A;  2A73 B;  5LMN H;  4A75 A;  1NCV A;  3GTK A;  4CHT B;  3BJU A;  1ZEQ X;  4EQO A;  3SE0 A;  2IBK A;  4A2B A;  3D4R A;  1I4X A;  4LF6 L;  2YRX A;  5EDW A;  4C3J G;  3MXG A;  4QL5 A;  3VR2 A;  2CW0 D;  3CXC A;  1ET6 A;  3CCM A;  2JEA I;  4OX9 L;  3V4Z A;  5BR8 H;  3ICE A;  1WYD A;  1QB5 D;  5H80 A;  1I6H B;  5FPR A;  5IYB G;  4ECY A;  3TRE A;  3CCL A;  2PMZ A;  1TWH B;  2OCE A;  4PV1 C;  2Q8R E;  1A15 A;  4A3J H;  1QJO A;  2W9B B;  2JSO A;  2AWO A;  1GKH A;  3MFI A;  1ESR A;  4AH6 A;  1V1O A;  1B3A A;  2B2V A;  4ID6 A;  2DIK A;  2FJ2 A;  4GKJ H;  2XCL A;  1I6V C;  3GTM A;  1Y1V G;  4JI0 L;  4HED A;  2R82 A;  3E0E A;  2FLN A;  2QYZ A;  4RU9 A;  1CQF A;  1HTL D;  3I55 A;  2B2Y A;  3AFP A;  3J7Y W;  4MIU A;  2XD4 A;  1I50 B;  4XIG S;  4RB0 A;  2AQ2 B;  4GNX A;  3E5N A;  3PUZ A;  3GD7 A;  3CC2 A;  4BXX H;  3PN1 A;  1A3T A;  2CWA A;  5EBD A;  5KG4 A;  2UUC Q;  2EY6 A;  4A3I B;  1I3Q H;  1NJI C;  1IBM Q;  1KBL A;  3KBG A;  4IOA A;  3S1R B;  3ZYY X;  5JPM C;  4LF8 L;  1SRU A;  2KCT A;  4UCU A;  1SE3 A;  1UE6 A;  1VS0 A;  5KNC A;  4ED6 A;  3HKZ B;  3NPP A;  1WR2 A;  2RDJ A;  5I2X A;  1VQH A;  4Z9C B;  3I7F A;  4CGY B;  4AYB E;  2ZDQ A;  5HGT A;  2GVB A;  4PZ7 A;  2V5A A;  3K0X A;  5IYC G;  4LF7 H;  3CQZ A;  2EYH A;  2ZT9 C;  4HNV A;  1BCP F;  2I80 A;  4XYL B;  4UHV A;  3PUY A;  5AJ3 L;  2JA7 H;  3N43 B;  4B3T H;  1TAE A;  5KFD A;  1LV9 A;  3GIJ A;  2HCI A;  3IRB A;  1SEB D;  3CP0 A;  5LXT F;  4GN3 B;  5DQH A;  2ASL A;  4DV1 L;  4A3K H;  4L5T A;  1JXL A;  4ZHQ F;  1WH2 A;  5C4Z A;  4IFD H;  5KFC A;  3NXW A;  1IBK Q;  3RLO A;  4NMZ A;  4JV2 A;  2NU9 B;  4KY6 A;  3R2I A;  5E3F A;  4DAY A;  1H9K A;  4NW2 A;  1EOV A;  3N52 A;  3LGJ A;  3K3P A;  4GOP A;  3LWE A;  3A55 A;  4O3P A;  1EZ1 A;  3T5K A;  4G7O C;  1V51 A;  3KXY T;  3PO3 B;  2B39 A;  1XNQ Q;  1HTP A;  3CKI B;  2QF7 A;  4DV0 L;  3WNZ A;  3OUZ A;  1ZXT A;  3QO2 A;  1C4Q A;  3SVM A;  4ED3 A;  2CW7 A;  3G71 A;  1UE5 A;  5EKI A;  1W2B A;  2XTI A;  3KF6 A;  1PYW D;  1CK1 A;  1Q1E A;  2I07 B;  2EIF A;  3A0J A;  4DUZ L;  1RJQ A;  2MPM A;  2JN4 A;  3VYR A;  1KJ8 A;  2EE1 A;  2L1B A;  4M1U B;  1IYJ B;  2HUG A;  3NEN A;  4BXX G;  3KDF A;  2F52 A;  4BBR B;  2ZJP A;  4JI7 L;  5J1Z A;  4EEY A;  4R4T A;  2RCF A;  3H0G H;  4B3M Q;  5IWA Q;  1QWY A;  5M5Y H;  5KKN B;  3OIP A;  3KOJ A;  4BY7 B;  1E2V A;  4K5W A;  4WJ3 M;  3C1E A;  3PW4 A;  3KHL A;  3AU7 A;  2FP4 B;  3KFU A;  1HHV A;  3JSN A;  1HZA A;  5LL6 b;  5IYD H;  1PXU A;  2L15 A;  4F8M A;  3QZ7 A;  3RF2 A;  3NE5 B;  4RNM A;  2ZTE A;  4DK3 C;  1MSH A;  2EYJ A;  2R3Z A;  3S1N B;  5FD6 A;  2A6E C;  5DG7 A;  4JV1 A;  4ZQI A;  3DUZ A;  2Z4I A;  3MC0 B;  2JA6 B;  2WAQ A;  1VCI A;  2YV5 A;  4FXG C;  4JV5 H;  4DL4 A;  1UEA B;  4YY3 Q;  4DV7 Q;  3CCS A;  3N44 B;  4LMQ D;  3OTO Q;  3K5O A;  3NSW A;  1VMC A;  1L2F A;  2KUM A;  2SEB D;  1CKO A;  2C2E A;  4Y7N H;  1KAW A;  4JUZ A;  2KHI A;  3U9S A;  2MUY A;  4GS3 A;  1HNW Q;  1BCP B;  2CQO A;  2KBN A;  2V9W A;  1CQI B;  1CUK A;  3K3V A;  4A93 H;  3EA6 A;  3VYS A;  1RTO A;  4B08 A;  2R8G A;  3RNU A;  2IX1 A;  5D1O B;  4IFD I;  4E4T A;  1EYG A;  1ILP A;  5DG9 A;  1TR5 A;  2XSC A;  3GTJ A;  1SEI A;  1HR0 W;  4X65 H;  1Q8K A;  4ZK9 B;  5FO9 B;  4NXM L;  5IT9 W;  2UXD Q;  4ZKB B;  2DUD A;  3NQT A;  5KG6 A;  3H91 A;  5C0X H;  4OEL B;  3FMC A;  2V4D A;  5EWG A;  4ME6 A;  2PW5 A;  4IZ8 A;  5KG0 A;  3SHL A;  1TWA H;  1STE A;  4ZAI A;  2F4V Q;  2AGQ A;  5JJK A;  1EYZ A;  2F4I A;  5L1I A;  2YZN A;  4XDX A;  4ZLT F;  3DHQ A;  4ECQ A;  3PIP A;  4PDB A;  1FL0 A;  4C2M A;  1LLR D;  3I56 A;  2R7Z A;  4C3H G;  4PZ8 A;  1BBX C;  4RCN A;  4IUU A;  5F9L A;  1K8G A;  3P7J A;  1NUC A;  1K83 A;  4WFN 3;  1IBK L;  1QOH A;  4LFC Q;  1X3G A;  1C48 A;  4R7R A;  3V96 A;  4DR6 H;  1HRJ A;  1XMO H;  1HNZ L;  3R5X A;  5ELF A;  4WRD A;  1T5E A;  3K81 C;  3PO2 H;  4A3F G;  1Q90 A;  1A9X A;  3RD4 A;  3CHB D;  2NVT H;  2IW3 A;  2ASJ A;  3LWB A;  4OO1 H;  3OSP A;  4MV8 A;  1YJN A;  4DV3 Q;  4MA5 A;  2UUA L;  4RB3 C;  5CV5 A;  2JA8 B;  4N9P A;  4Y52 H;  5AFW A;  4FVM A;  4Q0F A;  5J22 A;  2F0P A;  1VDZ A;  3R2T A;  3GV5 B;  2WIN B;  4R8U A;  5LHY 1;  2A74 C;  2W6O A;  2F0U A;  1EWH A;  1EWC A;  1PTO H;  4HAE A;  4DV6 L;  2JEJ A;  4IRK A;  4HIO A;  4JI6 L;  1ASZ A;  1A63 A;  4ZRZ A;  5GQO A;  3T13 A;  2PMZ E;  1O80 A;  2NVX B;  4EQP A;  3N41 B;  5C44 H;  1KIX A;  3OUU A;  2HHH H;  5FO8 B;  2R85 A;  4DR4 Q;  5IOD A;  1VQ9 A;  5L1K A;  4X3K A;  1X3F A;  3V05 A;  4CKB A;  4POF A;  5IWA L;  1R9T H;  1M1K C;  4B3M L;  5LL6 X;  2VQE H;  3KK7 A;  2QDL A;  1T3N A;  4LF7 L;  2UUB Q;  4IUP A;  1BUV T;  4QF4 A;  3DLL A;  1K9M C;  1N34 H;  2EZV A;  5FPO A;  1PH2 A;  2QW7 A;  2KSW A;  2PN1 A;  2W7P A;  3EBE A;  3ND9 A;  4KHV A;  2WV6 D;  2UVU A;  4HN7 A;  2BA0 A;  2F3V A;  5IP7 G;  2RDI A;  3S1Q B;  3HOX B;  1F2L A;  5KG1 A;  3NTI A;  1U4M A;  5I47 A;  4L8J A;  5EPL A;  4OIK A;  2BCO A;  1HZ9 A;  4RGO S;  1MI2 A;  1OXU A;  5C4X H;  4YR2 A;  5C0X I;  4KJN A;  3PW7 A;  3OPO A;  4DV7 L;  1SFO B;  1IYU A;  3TS2 A;  3MXP A;  3PO2 G;  1S3O A;  3N8D A;  1TWF B;  3H4B A;  2EJG C;  1ILQ A;  4DR1 H;  2IWH A;  5K5P A;  3EFX D;  3J7A V;  3A7L A;  2L9H A;  2HIV A;  4TQU S;  1X9N A;  4ZKC B;  1STN A;  5C8Y F;  1CI3 M;  1XX8 A;  5FJ8 H;  1EYD A;  2GVA A;  1SNC A;  2B2U C;  1E4F T;  4F4X A;  1YNN C;  3CCR A;  4JI2 H;  2XVS A;  3D3R A;  2NZO A;  3TSS A;  5DAU A;  4HIM A;  5LMU H;  4XT3 B;  4JI5 H;  3T5H A;  3KF8 B;  5KEE A;  1YHQ A;  1BBU A;  4DR2 Q;  4HNU A;  4HMI A;  1TQO A;  3IG0 A;  2HCC A;  5KYI A;  2MNA A;  1TS4 A;  4KKT A;  2LS0 1;  3MWM A;  1H9M A;  2KCM A;  5EPJ A;  5A35 A;  3A8K E;  3MR6 A;  2HD3 A;  2R8I A;  4QIW B;  2E5L L;  1Z2O X;  1HPC A;  1SYC A;  2N55 A;  2G9H D;  4C3I B;  1FJG L;  4OO1 I;  1BGW A;  1E4E B;  4G4K A;  2OTL A;  1IZ6 A;  1SMX A;  1S5B D;  3ERQ A;  4DV2 L;  4LF4 Q;  1RHP A;  1I3Q A;  4I7H A;  2G5D A;  4QY7 A;  3PR4 A;  3P75 A;  1NMF A;  3G6J B;  4B3R H;  4CDF C;  1D7Q A;  3PW0 A;  4K5X A;  3S2H B;  4FBU A;  5G3L F;  2UXC Q;  4KN4 C;  3CU7 A;  4PMB A;  2R7D A;  5DLG A;  4JI8 Q;  4TSS A;  4ECU A;  1EZ8 A;  3R23 A;  4Q0Y A;  3OW2 A;  4BBS G;  2AQ4 A;  4KKU A;  1HR0 Q;  1JQY D;  1WTW A;  2Z6K C;  1TT2 A;  2FFK B;  1J5E H;  3HOU H;  3RZD H;  4DV3 L;  3DWQ A;  1YNX A;  1GYF A;  3MR3 A;  5KFJ A;  4QWA A;  5JVL A;  4KK7 A;  2AQ1 B;  4RMF A;  2NVQ H;  2J7Z A;  5C3X A;  3MR5 A;  3GQC A;  2ZM6 Q;  1Y8O B;  2VQF H;  5I4D A;  2IPK D;  4A3M B;  2B63 H;  1FR3 A;  1VAJ A;  1PZK D;  1IBL Q;  4H7B A;  4DR5 H;  4R1J A;  3AYH B;  1SYD A;  2V59 A;  1HNX L;  3T1Y H;  1CZG A;  3TS0 A;  4QWE A;  4HMJ A;  2N3S A;  3BQ2 A;  3K57 A;  4HID A;  3KDF B;  1VBH A;  1F9S A;  3A74 A;  1WCM G;  1EIY B;  4H44 C;  1GM5 A;  1PFN A;  3PIO A;  3O13 A;  3GTP A;  3B6Y A;  2F0W A;  1KLU D;  2VL6 A;  2ZXO A;  3Q22 A;  4DV5 Q;  3NK9 A;  4C1N I;  2HJW A;  3G6Y A;  3BDO A;  2K32 A;  1Y69 U;  5BPH A;  4ABN A;  3H0G A;  4F4Y A;  1TS3 A;  4I50 F;  2JA9 A;  1N36 L;  4NPS A;  1XMO L;  2WB1 A;  2XGQ A;  4RUC A;  4U7C A;  1TY0 A;  2BH8 A;  1NSN S;  3MAQ A;  3BA9 A;  4LH6 A;  2IHF A;  2NVY H;  5GAH C;  4P71 A;  5C3W A;  2K28 A;  2C22 A;  2JA5 H;  3L4J A;  1ASY A;  3K7A H;  5COR A;  2NUA B;  4KHZ A;  2WAQ B;  3GTQ H;  1DYQ A;  3I91 A;  4MA0 A;  3VYT A;  4JBM A;  4HCE A;  1QVF A;  1WJJ A;  3T53 B;  1EY0 A;  2SCU B;  4ECR A;  3GTG A;  3K7U C;  4C56 C;  2E2J H;  4JI3 Q;  4F88 A;  2CH4 W;  4M9U A;  4LFB H;  5BPF A;  1KTK A;  2HHH L;  3PR5 B;  1SMY C;  2O4X A;  3OWE B;  1QNU A;  4I65 A;  4AYB A;  1GLV A;  4RNO A;  3W2D A;  4ED1 A;  2R7F A;  2Q8T A;  4X62 Q;  3OHA A;  3HG9 A;  4K8I A;  1SRO A;  4O2D A;  3MXN A;  1AE2 A;  1E22 A;  1PFB A;  1VQ7 A;  5E4W C;  3SEB A;  2FB9 A;  3EIV A;  2DJF C;  1JOK A;  2R92 H;  2V58 A;  1B7Y B;  2D5D A;  4H13 C;  4A3E H;  3HOW H;  4TV9 F;  2X69 A;  3FKI H;  4IJH A;  5FK9 C;  1ICF B;  4IN3 A;  4A3G H;  1G51 A;  2OXP A;  1YEZ A;  3JAM i;  3UDI A;  1KQS A;  4UAI A;  4JI4 Q;  2W57 A;  1TWA A;  3PSI A;  1KAB A;  4IRC A;  3N40 P;  3I4M B;  1KC8 C;  1NR4 A;  3T1H L;  3GLK A;  5E1F A;  3PF4 A;  4JI8 L;  1VQE A;  2O03 A;  1K83 B;  3A56 A;  5JQW A;  3T5J A;  2YZM A;  4R4I A;  2BQR A;  5IP9 H;  1T9H A;  1IHZ A;  5ELN A;  1IW7 D;  1U4L A;  1F77 A;  3Q6S A;  1JOQ A;  4DR1 L;  1HCZ A;  3S16 H;  3NWT A;  4IRD A;  4X66 Q;  2JA5 G;  4FYD A;  3KBX A;  4J9R A;  1BDO A;  4A3D H;  1NAP A;  3VR5 A;  4LF6 Q;  1Z2N X;  5KT4 A;  3HEJ A;  1RTN A;  3MJF A;  3TN2 A;  4Y8V B;  1C7Y A;  3R3O A;  3PF5 A;  4EYI B;  4JI2 L;  2GN5 A;  4OX9 Q;  3F2D A;  3A5Z B;  1RDP D;  3J7A F;  5M5W H;  5LMU L;  3BVM A;  3BQ1 A;  1CT1 D;  1SNM A;  4IZO A;  1CHQ D;  3BYT B;  3HOV B;  1MKH A;  1J9O A;  3BYY B;  4YAJ B;  1U4R A;  2EY2 A;  2JQO A;  3S2D B;  1GUW A;  2CZG A;  2FIN B;  4LUZ A;  3SK4 A;  5BN4 A;  2RGR A;  4NB3 A;  1JJ2 A;  2F0E A;  3FDT A;  4JI0 Q;  1JOO A;  1XMQ L;  2I87 A;  4LF9 H;  3CCU A;  4LFA H;  1JB3 A;  3Q8P B;  4DU9 A;  1Q82 C;  3HOY B;  4JV0 A;  1QUQ A;  2JE6 I;  5M3M H;  3T5L A;  5IGD A;  1I94 H;  4CDD C;  3K5M A;  5LOV F;  1PZI D;  4A3M G;  2W70 A;  2EPB A;  4C2M H;  1XXG A;  3JC6 6;  2R7Z H;  1U5K A;  5KIX A;  4EG0 A;  4LF5 H;  4LF8 Q;  1R9T A;  5JEA G;  2HQE A;  1A2U A;  1GSH A;  1CQJ B;  3SR1 A;  3GTL B;  3SK5 A;  3UQ8 A;  5EBC A;  1PMR A;  4K14 A;  1VQ6 A;  4AQY H;  4A3B B;  2Y0S G;  4R8I A;  1N8R C;  5KFP A;  3D8G A;  2HVR A;  2RDH A;  5AJ3 Q;  3F2U A;  4ZI7 F;  2DNE A;  3M9O B;  3HS0 C;  4OIJ A;  1N33 L;  1KC7 A;  4DV1 Q;  1G8Z D;  3TP6 A;  3S14 H;  1WOC A;  2BDO A;  3I90 A;  3UDF A;  3J81 i;  4CBV A;  2A68 D;  2BE5 D;  1D6E C;  4YQW A;  1HXY D;  2YTX A;  4BWG B;  4YIJ A;  3LML A;  1G2T A;  2VQF L;  1WD1 A;  2E2D C;  2EYO A;  4OXP A;  1VF7 A;  2KED A;  4HR7 B;  3J7A K;  4DL2 A;  1TKW B;  4DLK A;  5JH7 F;  1ESF A;  5CAE B;  4A3J B;  1JDB B;  4RB2 C;  1W6K A;  2UU9 L;  1Y1V H;  3DWP A;  4DV0 Q;  4JI1 L;  4UCS A;  2FE3 A;  1L0W A;  3S15 H;  2LXK A;  1HFG A;  3HGB A;  3DF7 A;  5KFT A;  3J80 i;  2K75 A;  1SJE D;  2B2U A;  4TKO B;  5JJZ A;  1VMP A;  3FVQ A;  1EY9 A;  4EX5 A;  2BA1 A;  2W6M A;  2EJM A;  3G48 A;  5J2T F;  4YHH H;  1Q46 A;  5M3M G;  4DA2 A;  1TII D;  2I5L X;  4NXN L;  4KV6 A;  4ZYS A;  2B2T C;  4O0A A;  3KAJ A;  4JI7 Q;  1WCM A;  2DN8 A;  1I3Q B;  1FGU A;  2VXW A;  2BH2 A;  2KEC A;  1OXT A;  5JAV A;  5IYC H;  2SNM A;  1H9J A;  1PRT C;  3OSO A;  1PTO D;  5JPN C;  2KQ3 A;  4HYK A;  1H95 A;  1ZQ7 A;  3KAK A;  4FXD A;  2QA4 A;  3BG3 A;  3KLW A;  1BR9 A;  1T5X D;  2QIL A;  4X66 L;  4J9L A;  1TWC H;  4LUO A;  2JA7 B;  1IBM H;  1X65 A;  2FHT A;  5D3D A;  3RZO H;  2ES2 A;  4A3K B;  2R7M A;  2NZ1 D;  2NU7 B;  2HVS A;  2UXB H;  1CTM A;  4BY1 B;  3C0F B;  1EEI D;  2IHE A;  1Z2P X;  1YNJ C;  2WB1 E;  4KMU C;  4BA2 I;  2PVP A;  2AMC B;  3TP5 A;  2A6H D;  4ZQ3 A;  1AW7 A;  3L9A X;  5FKA C;  3MWD A;  1JCK B;  5JEA J;  1B6R A;  3M9N B;  1G6P A;  2Z6K A;  5KFB A;  1EYC A;  1JKJ B;  1K0S A;  2PQA A;  2IMW P;  2Q2U A;  5L1L A;  4QCL A;  4G7H C;  3PIP 3;  1B2T A;  3GIP A;  2VA2 A;  4JYA H;  3W5O A;  1NE3 A;  5KFA A;  3MZ5 A;  3G6X A;  5HV6 A;  2IX0 A;  2FMC A;  2VUM H;  4N9T A;  4XYO A;  2FKL A;  2B63 A;  2C5C A;  5KFV A;  1QE6 A;  3G4S A;  2VUG A;  2Z1C A;  3W1G A;  4KTA A;  3M3Y B;  2WDT A;  2E2I B;  3H09 A;  2F0F A;  3ND8 A;  4RWS C;  3H3V C;  4NXM Q;  1MBY A;  5CA0 F;  1XNQ H;  5M5X B;  4GKK Q;  1S97 A;  1X32 A;  4NDX A;  1HQM C;  3H3V H;  3I8Z A;  3RBD A;  3UE1 A;  3CPF A;  4JVZ A;  5ELB A;  2BOS A;  3VA5 A;  2IT1 A;  5EJW A;  1XNR L;  5M5Y B;  4O3R A;  4IJL A;  4XXE A;  4L5R C;  4DV4 L;  3U4Z A;  3TIG A;  4Q8F A;  4DR3 H;  1TXY A;  1DOL A;  1HH2 P;  2R93 G;  2CQA A;  4HCS A;  4J1M A;  2A19 A;  4K6L A;  1JWS D;  1PTO F;  1DZ1 A;  1KJ9 A;  1BNC A;  4MTE A;  3Q8R B;  5IGF A;  3BAB A;  2NVY A;  3ERO A;  3P1H A;  5DQG A;  1HNZ Q;  1LUZ A;  2JA5 A;  2YCH A;  5HBR B;  2E76 C;  3A8I E;  1BF4 A;  2VPQ A;  3GP7 A;  1PVO A;  3H40 A;  3H4D A;  3GTQ A;  1V1P B;  2BQU A;  1I6U A;  4DL5 A;  2EXD A;  1VKZ A;  2UUA Q;  4RGT A;  1N32 L;  4LFA L;  1A3V A;  2K5H A;  5C3E B;  4Y7N B;  4KHP L;  2KCC A;  1I6H H;  5KFX A;  5IGB A;  4K0K H;  2PYK A;  5M3F B;  4KD4 A;  4AYB B;  3H20 A;  1QZG A;  2FXQ A;  3K8A A;  2MFI A;  2EYP A;  4P72 A;  5FD5 A;  4DV6 Q;  1XPU A;  4RFB A;  1GHJ A;  2W9C A;  4JI6 Q;  3MXN B;  5JJI A;  3GTP H;  1RCV D;  5FLX E;  1DGS A;  2D0O A;  2VUM G;  1VQM A;  3CD6 A;  1AUV A;  2R6F A;  1UE7 A;  4YY3 H;  3Q24 A;  1IXR A;  2A69 D;  1FNV A;  3CCJ A;  1JR0 D;  2XRQ D;  3VMM A;  4C5B A;  4F4W A;  3OTO H;  4LUV A;  1OWT A;  4QB4 A;  2F0J A;  3BA8 A;  1JOR A;  2VQD A;  4X64 L;  2YU9 H;  3S24 A;  2R92 A;  1V9P A;  4LF7 Q;  4DK0 A;  3GQB A;  2JK8 A;  3J7Z C;  3L0O A;  1F9R A;  3FKI A;  1DV2 A;  4C3H H;  2OH2 A;  1OXX K;  4B3T Q;  2XRS D;  2V4R A;  4Q44 A;  1ML0 D;  2F03 A;  2CWP A;  4R9W A;  1O7Y A;  1VQG A;  3I4N B;  2ATW A;  2UXD H;  4RG1 A;  4FP5 D;  1X3E A;  2DGY A;  4HJ7 A;  2MO0 A;  4A3F H;  2TMP A;  3R8B A;  1H9R A;  4MZ9 A;  2HQL A;  3L3O C;  2ASB A;  5KFO A;  3GTG H;  2R8H A;  1B9N A;  2QEX A;  3H3V I;  1F9Q A;  1LO5 D;  2B2W A;  1QNK A;  2M05 A;  3I2Z A;  3Q23 A;  2XCP A;  4IUV A;  1AZQ A;  4IWX A;  4TQS A;  1D1I A;  1H9S A;  3CRL C;  5CR3 A;  2OWO A;  1DV1 A;  3M7G A;  2RA4 A;  4ED7 A;  2RSN A;  1T36 A;  5JJL A;  1VQP A;  4IOC A;  1DJR D;  3KAL A;  4J9P A;  4ETS A;  4LFC H;  1UNN C;  3D4W A;  2K05 A;  5C5M A;  1HZC A;  3HOZ B;  4YHH L;  4OHJ A;  1MHW C;  2ZDG A;  1LTG D;  5ELE A;  3BZC A;  3Q0A A;  1JJC B;  3V6K A;  1M6V A;  1Y1W B;  4CJ2 C;  4GKK L;  3D31 A;  4LW1 A;  4JBK A;  3MA2 B;  2R84 A;  2N8N A;  3HXL A;  4K5V A;  1G29 1;  3IN5 A;  4FS1 A;  2E5L Q;  2EVB A;  1FJG Q;  1DOK A;  1R9T B;  3DEO A;  5LMN L;  5IP7 H;  4YCU A;  4DV2 Q;  4EFB A;  3R5H A;  1XWE A;  1PH4 A;  1BJT A;  2Z6B A;  2J0T D;  1QVG A;  2BR0 A;  1JWU D;  1GUG A;  4A3I G;  3H6M A;  4OWW B;  2OLS A;  4PMW A;  2E2H B;  3DMU A;  5C5L A;  5BR8 L;  4BY7 H;  1ZHQ A;  2YRW A;  2YTY A;  3HKZ G;  2UXB L;  4C1N K;  5KG2 A;  4FDB A;  2AU0 A;  1CQV A;  1ZYR D;  2N49 A;  2ICE C;  1RKN A;  4KLK A;  3STB D;  1V1Q A;  2JEF A;  4JOI C;  5JUM A;  3P20 A;  2W7O A;  3DWA A;  1XPO A;  5C4X B;  1CZW A;  3LP8 A;  4ED2 A;  4LH7 A;  1D1K A;  3R5F A;  4MV4 A;  4WD3 A;  4JYA L;  1CS0 A;  4GKJ L;  1Q8I A;  3TIN A;  3RGX A;  1SR3 A;  3S1N H;  1KNE A;  4ZUI A;  4MV3 A;  3KHH A;  1EY6 A;  3J7A 5;  1PK8 A;  2XWJ B;  3KJP A;  2W6Z A;  4TRD A;  2ALZ A;  1L1O B;  3S17 B;  3QOJ A;  2CCZ A;  3EPI A;  2P5Z X;  1DCZ A;  1CM9 A;  3IL8 A;  5C6A A;  2RHS B;  1KJI A;  1Y1V A;  1BCP C;  1RK6 A;  3PO3 G;  4C5C A;  4KJO A;  2O5J C;  4MV1 A;  1HNX Q;  3K5H A;  1K3B C;  2ALY B;  5K2M A;  2WTF A;  4UCR A;  3MWY W;  3ER0 A;  4MAM A;  2K7V A;  5IGC A;  1TS5 A;  3GTO A;  3LNN A;  3IAY A;  1PA6 A;  5E7N A;  4DR3 L;  2TSS A;  3MEH A;  4B3T L;  4CKC A;  1RD9 D;  2CW8 A;  4LMY A;  3WOF A;  2IX3 A;  2VNU D;  4HJA A;  5EWF A;  5G3L D;  3VPD A;  1KLG D;  2CW0 C;  5L1J A;  4DR2 H;  3D6W A;  1X56 A;  1X54 A;  3OW7 A;  4ECS A;  3NTH A;  4BBR G;  4X3T A;  1A0I A;  1SDF A;  2B2T A;  2JP1 A;  2NWG A;  4F7X A;  3GTK B;  1N36 Q;  2C2D A;  2YTV A;  1XMO Q;  4BBS H;  4XYM B;  4J9S A;  2C28 A;  3M85 A;  3NP8 A;  1G6Z A;  1LT6 D;  4BY7 G;  2NBF A;  5KT6 A;  3GII A;  3E3X A; 
#chains in the Genus database with same CATH homology
 1AH9 A;  5M5X H;  3K7U C;  1HZB A;  2N78 A;  1NMG A;  3HOY H;  1WFQ A;  2E2J H;  4JI3 Q;  1C9O A;  1RL2 A;  3D0F A;  4AQY Q;  4ALP A;  3CMA A;  2JEB I;  2HHH L;  1NBW A;  3E9I A;  4PG3 A;  4YWM A;  4DUZ Q;  2AHO B;  1GO3 E;  2R7F A;  4X62 Q;  1PH7 A;  2JA7 H;  2H5X A;  2I5M X;  5IE8 A;  1SRO A;  4A3C H;  4O2D A;  2Q2I A;  4JI4 L;  3CF5 A;  1PHJ A;  3CC4 A;  1AE2 A;  1E22 A;  1VQ7 A;  2JA6 G;  3GTL H;  1HJP A;  3EIV A;  1YI2 A;  3F2B A;  1K8A C;  1VQL A;  2R92 H;  2R7Z G;  2JA7 G;  1JMC A;  1B7Y B;  2Q2T A;  4A3E H;  2ZJQ A;  2HHH Q;  4K0K Q;  1GD7 A;  3HOW H;  4GNX B;  4A3K G;  3FKI H;  5GAG C;  2WFW A;  4IJH A;  2VQE Q;  1SLJ A;  4A3G H;  4GN4 B;  1G51 A;  5DLQ E;  4IFD G;  1WCM H;  1YEZ A;  3JAM i;  2VZA A;  4BY1 G;  3UDI A;  4A75 A;  1KQS A;  4JI4 Q;  4YWK A;  3BJU A;  3PSI A;  3M9B A;  3PO3 H;  3UDX A;  1XPR A;  4GLV B;  1KC8 C;  3T1H L;  4LF6 L;  3NEL A;  1YZ6 A;  4QL5 A;  3PF4 A;  1QUQ B;  1AE3 A;  4JI8 L;  3CXC A;  3CCM A;  2JEA I;  1VQE A;  4OX9 L;  5FLX c;  5C3E H;  4R4I A;  3CME A;  3ICE A;  1WYD A;  5IP9 H;  5FLM H;  5M3F H;  1T9H A;  2PNH A;  5ELN A;  5IYB G;  3TRE A;  3CCL A;  3SGI A;  4DR1 L;  3S16 H;  2OCE A;  1QVC A;  4X66 Q;  1K0R A;  4A3J H;  2JA5 G;  1V43 A;  2Q2H A;  4A3D H;  3GTP H;  3T1H Q;  4LF6 Q;  4IO9 A;  2AWO A;  4JV5 L;  1GKH A;  1C7Y A;  3PF5 A;  2CKZ B;  4JI2 L;  2GN5 A;  4OX9 Q;  3F2D A;  4AH6 A;  3A5Z B;  4BBR H;  1A62 A;  2UUC L;  5M5W H;  5LMU L;  1IBM L;  1Y1V G;  4JI0 L;  3S1Q H;  4DAY B;  1MKH A;  3E0E A;  2E8G A;  4P75 A;  3RN2 A;  4DR1 Q;  4GOP B;  3I55 A;  3AFP A;  2JQO A;  2PI2 A;  4BA1 I;  4XIG S;  3S2H H;  4GNX A;  4JV5 Q;  3PUZ A;  3GD7 A;  4LUZ A;  3WWV A;  3CC2 A;  4BXX H;  2CWA A;  3H0G G;  4JI2 Q;  4NB3 A;  1JJ2 A;  2UUC Q;  3ULJ A;  1I3Q H;  3A5U A;  5LMU Q;  1NJI C;  1IBM Q;  2WB1 G;  3CCE A;  1SFO H;  4JI0 Q;  2YYZ A;  2Y0S E;  1XMQ L;  1SRU A;  2KCT A;  4LF8 L;  4X65 L;  1VS0 A;  1BVS A;  1UE6 A;  3M4Q A;  3CCU A;  3I4N H;  1TWF H;  1Q82 C;  1VQH A;  3VDY A;  1QUQ A;  5IYD G;  2JE6 I;  3I7F A;  3KF6 B;  4AYB E;  5M3M H;  2GVB A;  4PZ7 A;  3K0X A;  5IYC G;  4A3M G;  2JA6 H;  4C2M H;  4DKA C;  3JC6 6;  2JA8 G;  2R7Z H;  3PUY A;  1S72 A;  1U5K A;  3F8T A;  4OWX B;  5AJ3 L;  1XMQ Q;  4LF8 Q;  1Q86 C;  1X55 A;  5JEA G;  3L2P A;  4X65 Q;  1K73 C;  3IRB A;  2VW9 A;  5GAD C;  3CP0 A;  4GN3 B;  4DV1 L;  4A3K H;  4L5T A;  4HJ8 A;  2JJQ A;  1XNQ L;  1KRS A;  1VQ6 A;  1IBK Q;  3PUW A;  3RLO A;  2Y0S G;  1EWI A;  1YIT A;  3TQY A;  1N8R C;  4HJ9 A;  3DM3 A;  5AJ3 Q;  1EOV A;  3LGJ A;  4GOP A;  5C3E G;  5FLM G;  4QJF A;  4DR6 L;  5M3F G;  1N33 L;  4AYB G;  3HOZ H;  4C3I H;  4DV1 Q;  3S14 H;  1WOC A;  3UDF A;  3J81 i;  1XNQ Q;  4A93 G;  4DV0 L;  2YTX A;  1Y1W H;  2VQF L;  1J5E Q;  1PV4 A;  4OXP A;  3G71 A;  4DR6 Q;  4JG2 A;  1PFS A;  1N33 Q;  1UE5 A;  4IFD J;  1W2B A;  2XTI A;  3KF6 A;  1O7I A;  4X62 L;  4DNI A;  1Q1E A;  4H02 A;  5C0X G;  3HOX G;  2EIF A;  4OWT B;  3A0J A;  4DUZ L;  1VQO A;  2UU9 L;  1Y1V H;  2K52 A;  1B70 B;  4DV0 Q;  4JI1 L;  1L0W A;  1IYJ B;  3NEN A;  2LXK A;  3S15 H;  2VQF Q;  1P8L A;  3UE0 A;  3KDF A;  4BXX G;  2F52 A;  1OXS C;  3J80 i;  2K75 A;  2ZJP A;  4ME3 A;  5ELO A;  4JI7 L;  3PGZ A;  4R4T A;  2E2H H;  3H0G H;  1PH6 A;  4DR5 Q;  1JB7 A;  4B3M Q;  5IWA Q;  5M5Y H;  2B3G A;  4K0K L;  3KOJ A;  1CKM A;  3I4N G;  1JJG A;  1P16 A;  4EX5 A;  2UU9 Q;  2BA1 A;  4WJ3 M;  1EQR A;  3G48 A;  4JI1 Q;  2VQE L;  1Q46 A;  2PQA B;  4QIW E;  5M3M G;  2I5L X;  4A4I A;  3KFU A;  1XTD A;  3KYH C;  3RR5 A;  4NXN L;  1HZA A;  5IYD H;  4O0A A;  1Q81 C;  4JI7 Q;  2L15 A;  1N34 L;  1FGU A;  4YY3 L;  2BH2 A;  1OXT A;  3HFZ B;  5IYC H;  2OQ0 A;  1OXV A;  2D0P A;  4A3M H;  3CCV A;  2ZTE A;  4DK3 C;  3ULP A;  2R6G A;  3OTO L;  2JA8 H;  1L1O C;  3H15 A;  4QQB X;  4X6A H;  1H95 A;  1EIF A;  1HNW L;  2Z0S A;  3S17 H;  4NXN Q;  4OO1 G;  1VCI A;  1FVI A;  2MO1 A;  2YV5 A;  2QA4 A;  3KLW A;  4X66 L;  1N34 Q;  4YY3 Q;  1TWC H;  4LUO A;  4DV7 Q;  2C35 B;  4GLA C;  3CCS A;  1X65 A;  3OTO Q;  2NVX H;  2ES2 A;  3HOZ G;  3RZO H;  1L2F A;  1CKO A;  1KHI A;  4Y7N H;  1KAW A;  1UE1 A;  4UY8 C;  3TRZ A;  2KHI A;  1HNW Q;  2UXD L;  4GS3 A;  2KBN A;  2CQO A;  2IHE A;  1Y1W G;  2WB1 E;  1CUK A;  2K5V A;  4DPG A;  4BA2 I;  4A93 H;  2AMC B;  5C44 G;  2NZH A;  2F4V L;  5JEA J;  4A76 A;  3RNU A;  2IX1 A;  1G6P A;  3AQQ A;  2Z6K A;  4IFD I;  1VQD A;  1EYG A;  2PQA A;  1HR0 W;  2Q2U A;  1Z9F A;  1Q8K A;  3M4P A;  4NXM L;  2UXD Q;  2DUD A;  3W5O A;  4JI5 L;  3M7N A;  1NE3 A;  1LYL A;  4GLX A;  3HOX H;  2IX0 A;  2ID0 A;  2XGT A;  5GRO A;  3G6E A;  2D62 A;  5LMN W;  4JOI A;  3CW2 C;  1TWA H;  2VUM H;  3GTK H;  2QGQ A;  5HY6 A;  2F4V Q;  3EN2 A;  1C0A A;  5JJK A;  3G4S A;  3W1G A;  2AKW B;  3TEH B;  4L5S A;  4MTN A;  5H1S E;  4QGU A;  4LFC L;  3FHW A;  3PIP A;  5K36 G;  4NXM Q;  1S40 A;  1VQ8 A;  3PUV A;  1FL0 A;  4JI5 Q;  3I56 A;  3ZJY C;  4GKK Q;  4PZ8 A;  3H3V H;  4P73 A;  1A8V A;  4WJ4 A;  4JCV E;  5C4X G;  1K8G A;  3UE1 A;  1MJC A;  3CPF A;  1TWG H;  1IBK L;  2IT1 A;  1XNR L;  4LFC Q;  1X3G A;  4B3R L;  3I4O A;  4IJL A;  4L5R C;  4DV4 L;  3U4Z A;  5C0X J;  1HNZ L;  1TXY A;  1HH2 P;  3K81 C;  3PO2 H;  5J3B A;  4A3F G;  2R93 G;  4YWL A;  4YCV A;  3GTM H;  1CKN B;  1VQK A;  2A19 A;  1QZH A;  5FJ8 G;  1Q7Y C;  1VQF A;  4GNX C;  2NVT H;  4DR7 Q;  4UPA A;  1XNR Q;  1YJN A;  4B3R Q;  4DV3 Q;  4DK6 C;  2WAQ E;  4DV4 Q;  2UUA L;  1J5E L;  3NEM A;  2MQH A;  1HNZ Q;  1LUZ A;  4Y52 H;  1KXL A;  4DR4 L;  1PVO A;  4JBJ A;  1VQN A;  1D8L A;  3KJO A;  1Z47 A;  4DV6 L;  1KRT A;  4R4O A;  4HIO A;  2UUB L;  4JI6 L;  1ASZ A;  2EXD A;  1A63 A;  1E7Z A;  5GQO A;  5C4J H;  2PMZ E;  2UUA Q;  2I0Q A;  4IOA A;  3U50 C;  5C44 H;  1KIX A;  4GN5 A;  3CQZ H;  4LFA L;  1N32 L;  2K5H A;  2HIX A;  3UDG A;  4KHP L;  4UP8 A;  1I6H H;  4DR4 Q;  1VQ9 A;  3CCQ A;  1YJ9 A;  1QZG A;  4DR5 L;  2FXQ A;  1X3F A;  3AFQ A;  2MFI A;  3K8A A;  3PV0 A;  4POF A;  4P72 A;  5IWA L;  2I5H A;  1R9T H;  1PH1 A;  4DV6 Q;  3T1Y L;  1M1K C;  1XPU A;  4LF7 L;  4J15 A;  2UUB Q;  3MXN B;  5IT9 c;  2WAQ G;  5EAY A;  4JI6 Q;  2VUM G;  3JAM c;  1DGS A;  2D0O A;  3DLL A;  1VQM A;  1K9M C;  3CD6 A;  2A1A A;  1UE7 A;  3GO5 A;  1PH2 A;  1IXR A;  3EBE A;  4GOP C;  1N32 Q;  4JBW A;  4LFA Q;  2KEN A;  3CC7 A;  3CCJ A;  4KHP Q;  2BA0 A;  4PZ6 A;  4LUV A;  2PI2 E;  3ERS X;  5IP7 G;  4XTC S;  1SN8 A;  1VQ4 A;  4X64 L;  2YU9 H;  3GTO H;  3J81 j;  3BZK A;  3S24 A;  2LSS A;  3T1Y Q;  1V9P A;  1VQA A;  4L5Q A;  4LF7 Q;  1E3P A;  2JK8 A;  3J7Z C;  1MJE A;  5IY0 A;  3L0O A;  4AIM A;  1YIJ A;  1HZ9 A;  4C3H H;  1EQQ A;  4LF5 Q;  1OXX K;  4B3T Q;  3HOU G;  3S1M H;  1OXU A;  5C4X H;  4B3S L;  5C0X I;  2RCN A;  1Q12 A;  4OON A;  4UP9 A;  4DV7 L;  4IPG A;  2CWP A;  3Q8D A;  3TS2 A;  1YJW A;  4DAM A;  4X64 Q;  1VQG A;  3PO2 G;  1S3O A;  2ATW A;  4RG1 A;  1X3E A;  2A8V A;  4DR2 L;  2K5N A;  2DGY A;  4HJ7 A;  2R93 H;  2MO0 A;  4A3F H;  2HIV A;  4TQU S;  4TVA B;  1X9N A;  3RN5 A;  4MZ9 A;  3BU2 A;  2HQL A;  2WP8 J;  5FJ8 H;  2RHQ B;  2GVA A;  3CPW A;  2ASB A;  2B63 G;  3GTG H;  4B3S Q;  1M90 C;  1PYB A;  2QEX A;  3CCR A;  3H3V I;  3NBH B;  4P74 A;  4YCW A;  3STB C;  1EFW A;  3E9H A;  4HIM A;  2NZO A;  2AWN A;  3I2Z A;  4KI0 A;  4EQ5 A;  2ZJR A;  1E1O A;  3AEV A;  3KF8 B;  1YHQ A;  1VQC A;  1BBU A;  4DR2 Q;  2OWO A;  3I4M G;  4IPC A;  3F1Z A;  1MIU A;  4LF4 L;  1YHB A;  4A3B H;  2NN6 G;  2MNA A;  4LFB L;  5JJL A;  2KCM A;  4IOC A;  1VQP A;  1CSP A;  4POG A;  1YVC A;  1I5F A;  3HKS A;  1HZC A;  2E5L L;  3ULL A;  4YHH L;  1FJG L;  1U0L A;  4OO1 I;  1WI5 A;  2ZTC A;  4HJ5 A;  2OTL A;  4A3L G;  1IZ6 A;  1SMX A;  3BZC A;  1YBY A;  1EUJ A;  4DV2 L;  1JJC B;  3HKZ E;  2UXC L;  4LF4 Q;  4QY7 A;  4GKK L;  4LFB Q;  3D31 A;  4LW1 A;  4JBK A;  1BBW A;  1NMF A;  1PYS B;  2N8N A;  1HR0 L;  4DUY L;  1LTL A;  2IY5 B;  1G29 1;  1OTC A;  3RLN A;  3HOV G;  2E5L Q;  1D7Q A;  4YHH Q;  1FJG Q;  2NN6 I;  4R4C A;  3K80 C;  5LMN L;  5IP7 H;  4UP7 A;  3U4V A;  4YCU A;  4DV2 Q;  2UXC Q;  1K3R A;  2R7D A;  4JI8 Q;  1YHA A;  3OW2 A;  3W1B A;  4BBS G;  3J81 c;  1PH4 A;  1QVG A;  1HR0 Q;  4DUY Q;  4LNQ A;  4A3I G;  4OWW B;  2Z6K C;  2ZM6 L;  3U58 A;  3PCO B;  4DR7 L;  4PMW A;  2B29 A;  3HOU H;  5BR8 L;  3RZD H;  4BY7 H;  1NTG A;  4MNO A;  1W3S A;  2YTY A;  3HKZ G;  4DV3 L;  2UXB L;  1YNX A;  1IBL L;  4FDB A;  5LMN Q;  3HOY G;  2N49 A;  3GTJ H;  1NY4 A;  3M4O H;  4KLK A;  3STB D;  1XJV A;  1V1Q A;  1X6O A;  3CAM A;  5HGQ A;  4RMF A;  1E1T A;  4JOI C;  3MEF A;  2NVQ H;  2V1C C;  3RLF A;  1VQ5 A;  5JJI A;  1XPO A;  2ZM6 Q;  1IL2 A;  3PUX A;  4JYA L;  1GVP A;  5BR8 Q;  2RF4 A;  2B63 H;  2HT1 A;  1E24 A;  4A3C G;  4GKJ L;  2UXB Q;  4APV A;  1SR3 A;  1IBL Q;  1VQB A;  3J80 c;  3S1N H;  1Y14 B;  3GDE A;  4R1J A;  3AYH B;  3J7A 5;  2LXJ A;  1HNX L;  2R92 G;  3KJP A;  2CFM A;  4DV5 L;  3TS0 A;  2EQS A;  4A3E G;  1L1O B;  2N3S A;  2CCZ A;  1PH9 A;  3HOW G;  4A3B G;  3FKI G;  3I4M H;  4HID A;  3KDF B;  4A3G G;  4JYA Q;  2ZTD A;  2KHJ A;  2RHS B;  3A74 A;  1WCM G;  1PH3 A;  1EIY B;  4B3M L;  4HIK A;  4GKJ Q;  2VNU D;  2VY3 A;  1K83 H;  3PIO A;  1GM5 A;  1VQJ A;  3B6Y A;  4LF9 L;  3PO3 G;  2VL6 A;  1KD1 C;  1HNX Q;  4BY1 H;  2ALY B;  1B8A A;  4DV5 Q;  1TWH H;  1JT8 A;  3OYY A;  1UWV A;  4A3L H;  2K14 A;  2K50 A;  3ER0 A;  3F2C A;  1I94 L;  1CSQ A;  4C3J H;  1J6Q A;  2VS1 A;  5IP9 G;  1PA6 A;  1N9W A;  5E7N A;  2JA9 A;  1N36 L;  4NPS A;  4JC0 A;  1XMO L;  1VQI A;  1JE5 A;  4DR3 L;  4LF5 L;  3L7Z C;  2BH8 A;  4B3T L;  4LF9 Q;  4IPH A;  4A3J G;  2IHF A;  2NVY H;  2F3I A;  2K4K A;  1CKN A;  4IPD A;  4P71 A;  5IYB H;  1RIP A;  5GAH C;  2OQK A;  4HJA A;  3HOV H;  1PH5 A;  2JA5 H;  1ASY A;  3K7A H;  1I94 Q;  1X56 A;  1X54 A;  1Q1B A;  3S2D H;  1I50 H;  4KHZ A;  4JI3 L;  4BBR G;  3GTQ H;  1A0I A;  4AQY L;  2OTJ A;  4LWC A;  1N36 Q;  2YTV A;  1XMO Q;  5GAE C;  1PH8 A;  3M3Y H;  4BBS H;  4R4Q A;  1UEB A;  1BKB A;  4DR3 Q;  2E2I H;  4JBM A;  4A3D G;  3M85 A;  1QVF A;  1KL9 A;  1WJJ A;  4A3I H;  4BY7 G;  1SE8 A;  3S1R H;  1LM0 A;  1L1O A;  3FP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...