4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
4LFCQ 4LFCL 4A3CG 2QGQA 2LXKA 4OWXB 1PFSA 2PQAB 3PUYA 4GS3A 2R93G 1UE5A 2XTIA 5M3FG 3CCRA 4GNXB 3S17H 2JJQA 4UPAA 2JA7H 3CCQA 2QA4A 1C0AA 4P73A 4R4OA 1KIXA 2LSSA 2AKWB 4POGA 3HOVH 4KHZA 4DR5Q 4NXML 4NXMQ 4YCWA 2JA5H 4K0KQ 1YHAA 4XTCS 5M3MG 2VL6A 3GTKH 4K0KL 1HNXQ 1PH6A 1UWVA 3CMEA 3GTOH 3H3VI 3HFZB 3GTMH 3S1QH 4PZ6A 1KL9A 3M4PA 3M3YH 1HNWQ 3DM3A 2F4VQ 2F4VL 1CKNB 4JG2A 2K75A 3PO3G 1YBYA 4LUOA 3RR5A 4LF6Q 1IL2A 1RL2A 1A63A 1VQEA 3S2DH 2GVBA 3A5ZB 1N34Q 2OCEA 1N34L 4IPCA 1NE3A 5IY0A 2PI2A 4P71A 3K7AH 2VY3A 3BZKA 4QY7A 3CMAA 2VUMH 3CCUA 2HQLA 1Q1EA 1YITA 1CKOA 4HIKA 3KDFB 4APVA 3TS2A 4DR2Q 2GVAA 2VNUD 4ME3A 4X65Q 1MKHA 4X65L 5IP7H 4NB3A 1SLJA 1N8RC 3ULLA 1OXUA 3KLWA 4YWLA 1VS0A 4JI0Q 5JJKA 4DNIA 1NY4A 4R4CA 4GOPC 4LF7L 5FJ8H 1GM5A 3ERSX 3NELA 3HOXG 4FDBA 1D7QA 4HIDA 3HOWG 1HZCA 4DR7Q 2UXBQ 3CQZH 1HR0Q 4HJ5A 1HR0L 2WB1E 5C0XG 1CSPA 3PF4A 4OO1G 2ATWA 4LW1A 2GN5A 3PUWA 1HJPA 3H0GH 3K80C 3BZCA 1BKBA 4GNXC 4DK6C 1YI2A 5FLMG 3KF6A 4LNQA 1BVSA 5IYDH 5IE8A 3S14H 3STBC 4A3DH 4IFDG 1A8VA 5IP9H 2HIXA 1KQSA 3FP9A 1Z47A 4DPGA 4A3EG 2AMCB 1GO3E 5H1SE 4DV3L 2K50A 1DGSA 2UXDQ 1TWAH 3Q8DA 1WCMG 3HOZH 1PYSB 1OXSC 1NMFA 3B6YA 3T1YL 3ZJYC 4L5RC 3F2DA 1UE1A 1S40A 3E0EA 4DUZQ 4DUZL 2LXJA 4NPSA 4QQBX 1PV4A 4X64Q 2K52A 1T9HA 4X64L 5LMNL 1C9OA 5LMUQ 2DGYA 5LMUL 4GN5A 2KHJA 5C44H 3I55A 3J7A5 3S1NH 4A3CH 4A3FG 3I4NG 3FKIH 3K7UC 1XPRA 2BA1A 2YU9H 1PH3A 2JA6H 3I4MG 2VQFQ 1WJJA 3U4VA 1VQAA 5HGQA 1YHBA 4JI2Q 2NVXH 4R4TA 4UP8A 4AYBG 5JEAG 5GQOA 2KENA 1GVPA 2YYZA 1XNQQ 1PH1A 1XNQL 1IZ6A 3J81c 4LF5L 1XTDA 4A3BG 2VW9A 3SGIA 1Q12A 4IJLA 2JEAI 4YHHL 1VQ6A 1B70B 4BXXG 4DR1Q 1QZHA 4DR1L 2ES2A 4LF8Q 1WFQA 5GROA 4LF8L 3NEMA 4O2DA 1VQMA 2K5NA 2MNAA 4AQYQ 4AQYL 4GLVB 2ZJRA 2ASBA 4LUZA 2JEBI 1SFOH 5M5YH 1U0LA 3U50C 2D0PA 3PO3H 2EXDA 1E7ZA 5GAEC 1AH9A 4H02A 1KC8C 1I94L 2OQKA 1VQFA 1YNXA 2VZAA 1VQ7A 2R7DA 3JC66 3DLLA 4DV0Q 5C4JH 3TRZA 4B3ML 2UU9Q 1E3PA 4OWTB 1IBMQ 2UU9L 2R7ZG 4DV7Q 4DV7L 1N36Q 2NN6I 1E24A 1I3QH 5C0XI 3H15A 1N36L 4OO1I 4PMWA 4A93G 4KHPQ 4KHPL 2F3IA 3K81C 4OONA 3UDGA 1M1KC 2K5HA 1QVFA 3PO2H 1YJWA 4MZ9A 4JBKA 4HIMA 1VQOA 1L2FA 3EN2A 4BY7H 5BR8L 3EIVA 4A3JH 1HR0W 3A5UA 4OWWB 4IFDI 3RLOA 1E1TA 3KF6B 1VQGA 1Q1BA 4X66Q 4X66L 1JMCA 1X3GA 2BH2A 2KHIA 3HOYH 4JBJA 5ELNA 2JA8H 1XPOA 1B8AA 2PNHA 2YV5A 1AE3A 4P72A 1M90C 4LF9L 1PYBA 1XNRL 2VQEQ 2VQEL 2WAQE 4AH6A 5M5XH 3PIOA 3M4QA 2I5MX 3TS0A 3HKSA 4A76A 1PH9A 3M85A 1PH8A 1KRTA 1VQNA 2ZTCA 3HOUH 2R6GA 2RHQB 1QUQA 4TVAB 4GKJQ 2YTVA 4GN4B 3RZOH 3GTPH 4GKJL 3BU2A 4DKAC 2Q2TA 3RN2A 3U58A 4Y7NH 1I50H 1YJ9A 2PI2E 1G6PA 3S24A 3G4SA 3EBEA 3UDIA 4A4IA 3RZDH 4JOIA 3G71A 4BBRG 1Q46A 4DUYQ 5JJIA 4PG3A 4DUYL 1JB7A 1OTCA 2AHOB 1VQ9A 2F52A 1Y1VH 1OXXK 4DV6Q 1Y1WG 4DV6L 1ASZA 5IWAL 4IPDA 3UDXA 1P8LA 2Z0SA 2Z6KA 1XPUA 4C3JH 1XJVA 2K5VA 3GTLH 3S16H 1SMXA 3H3VH 1X55A 2VS1A 2EQSA 2E2JH 1KHIA 2Y0SG 1LM0A 4HIOA 2I5LX 4BA1I 1IXRA 1TWCH 4R4QA 2UUBL 2E2HH 3M9BA 3E9IA 2UUBQ 1X56A 2OQ0A 3CP0A 1W3SA 3L7ZC 4A3IH 4OX9L 4DK3C 2ZTEA 4LF7Q 1IBLL 2RHSB 1JE5A 1WOCA 3MXNB 3AFPA 4JI5Q 2UXCL 3PUVA 4JI5L 1L0WA 5C4XG 1BBWA 1VQIA 1PH7A 4A3LH 4BXXH 2IHEA 3LGJA 2DUDA 2NN6G 3MEFA 4JI3L 3J81j 1J5EL 2Q2UA 4BA2I 1JT8A 2Q2IA 2AWOA 1V9PA 2WFWA 3AYHB 4QIWE 1HZBA 5IYBG 2MO0A 1PA6A 3S2HH 2OTJA 1YEZA 4KI0A 1X6OA 1QVCA 1WI5A 2L15A 3S1RH 2R92G 3I4OA 2E5LQ 1B7YB 2E5LL 1X3EA 1K73C 4BY7G 1CKMA 4BY1H 4BBSG 2EIFA 3CC7A 2R7ZH 3CCEA 1L1OC 1N9WA 2RF4A 1NJIC 3BJUA 4DV3Q 3F2BA 1TWGH 3RN5A 2B63H 3OW2A 3T1YQ 1PH5A 3D31A 1G51A 1V1QA 4A3KH 3CW2C 2KBNA 1N33L 1L1OA 3CC4A 4JV5L 3HOVG 4A3MH 2D62A 3KFUA 1X54A 3J81i 4JI4Q 2IX1A 4JI4L 1TWFH 5LMNQ 1J6QA 2BA0A 1U5KA 2C35B 2JA5G 4A3BH 3G48A 3PV0A 4KLKA 4C3HH 4RMFA 3HKZG 1VQ4A 1QUQB 1XMOQ 1XMOL 1TWHH 3TREA 3WWVA 3UDFA 2R93H 4OXPA 3A0JA 2HIVA 3GD7A 5M3FH 4GLXA 1XMQL 1EIYB 1KRSA 1K0RA 4YCUA 2NVYH 1ASYA 4LF5Q 3D0FA 4YHHQ 1PH2A 3W1BA 4A75A 4JCVE 4JI8L 2BH8A 1R9TH 4AIMA 2QEXA 5M3MH 1GD7A 2CCZA 2IHFA 4UY8C 4PZ7A 4WJ4A 4JI6L 4R4IA 1VCIA 4B3RQ 1HNZL 4B3RL 2E8GA 4DV4L 1IBKL 4BBRH 1JJCB 5IP7G 1I94Q 2IX0A 1H95A 3KJPA 2ZM6L 2JK8A 1FL0A 1K83H 1SR3A 1Y1WH 4B3MQ 5FJ8G 2A1AA 2N78A 4P75A 1X65A 2WP8J 3CF5A 1LYLA 5GADC 3AFQA 4LFAL 2OTLA 4QJFA 1VQBA 3KYHC 1LTLA 4JBWA 3GTJH 5E7NA 2CWPA 4YWMA 3RLNA 3H0GG 1FGUA 4X6AH 5BR8Q 3M4OH 3JAMc 2AWNA 3KOJA 1QVGA 3ICEA 5IYDG 2CFMA 4P74A 5M5WH 1P16A 3G6EA 4RG1A 3HOXH 4JBMA 5IP9G 4L5QA 1TXYA 5C4XH 2UUAL 1SROA 3HOWH 2CQOA 5GAGC 3E9HA 4UP7A 1S3OA 1JJ2A 4LF9Q 1XNRQ 4IJHA 1CUKA 4AYBE 1N32L 3HOZG 2OWOA 2FXQA 3CC2A 4X62Q 3PIPA 4X62L 1Q7YC 4A3GG 4DR4L 4DR4Q 3CCLA 3CCJA 1Z9FA 5FLMH 4B3SL 4LFBQ 4LFBL 1L1OB 1UEBA 4JOIC 4XIGS 4YCVA 3I2ZA 1Q8KA 5C3EG 5JJLA 4L5TA 3UE1A 1YHQA 1MIUA 2JA9A 4BBSH 4JC0A 4QL5A 4LUVA 5C44G 4A3EH 4J15A 2E2IH 2HT1A 3M7NA 1I5FA 1OXTA 3FKIG 2WB1G 2JA6G 3AEVA 3GO5A 1X3FA 3U4ZA 1WCMH 4WJ3M 1UE7A 1IYJB 2Z6KC 1EIFA 4R1JA 2CKZB 3OTOQ 5LMNW 3OTOL 1YJNA 2N49A 1CSQA 5IWAQ 3T1HQ 3T1HL 2ID0A 4C3IH 2HHHQ 2HHHL 4DR5L 4DR3Q 3RLFA 4DR3L 1PVOA 3K8AA 2A19A 4A3FH 1HNXL 3I4NH 3W1GA 3IRBA 3TEHB 2XGTA 4DV1Q 5GAHC 4DV1L 2UUCQ 2UUCL 1C7YA 3I4MH 1VQCA 4IPGA 2K14A 2CWAA 2R7FA 1X9NA 1HNWL 4OX9Q 1IBLQ 3RNUA 4LF6L 1HZAA 2UXCQ 1K8AC 1EWIA 1GKHA 4YY3L 4YY3Q 5K36G 1PHJA 1KXLA 1Q82C 1W2BA 3F1ZA 2NZHA 2I5HA 4JI3Q 1J5EQ 2NZOA 5IYCG 1A62A 1VQJA 1G291 1OXVA 1O7IA 1EFWA 1Q86C 4C2MH 4NXNL 1Q81C 2ZJQA 4L5SA 4NXNQ 1E1OA 2YTXA 1YIJA 1NBWA 5EAYA 4DR2L 4LF4Q 4LF4L 3CCSA 3PO2G 4UP9A 4QGUA 3S1MH 1EYGA 3I56A 3F2CA 3PSIA 3S15H 2D0OA 4JI0L 4A3JG 2JQOA 3PCOB 2ALYB 2A8VA 4IPHA 1BBUA 4IOAA 1NTGA 3ULPA 1EQRA 1PH4A 3HOYG 2UXBL 2JA8G 4DR7L 3AQQA 1VQLA 3W5OA 4A93H 1E22A 1EQQA 4GOPA 4HJ8A 2I0QA 2JA7G 4POFA 1N33Q 2KCMA 4IOCA 3STBD 4JV5Q 1RIPA 1SRUA 2YTYA 1VQDA 4HJ9A 1D8LA 4MNOA 1MJEA 3HOUG 1QZGA 3PGZA 3NBHB 2PQAA 5IT9c 2K4KA 3I7FA 1YVCA 1YZ6A 4GKKQ 1V43A 2Y0SE 3F8TA 4GNXA 1AE2A 1SE8A 4EQ5A 3PUZA 1XMQQ 4GKKL 4JYAQ 4JI1Q 4JYAL 4JI1L 2UXDL 5DLQE 2IT1A 3KJOA 1I6HH 3CAMA 4A3GH 1KAWA 3PF5A 1Y1VG 1EUJA 4JI8Q 1WYDA 2PMZE 1K9MC 2NVTH 3GDEA 4Y52H 2VUMG 1K3RA 4GN3B 5C3EH 3FHWA 4JI6Q 3J80i 4DV5Q 4DV5L 3L2PA 1HNZQ 5C0XJ 1CKNA 4DV4Q 1IBKQ 4DR6Q 4DR6L 3A74A 1JJGA 1SN8A 2H5XA 3CCMA 3K0XA 2VQFL 1MJCA 2N3SA 4JI2L 3ER0A 2ZM6Q 4A3IG 4B3TL 4ALPA 4B3TQ 1KD1C 2WAQG 3JAMi 4IO9A 2B3GA 1K8GA 4IFDJ 3J80c 5FLXc 5J3BA 2JE6I 1S72A 3KDFA 4A3LG 3OYYA 3ULJA 3GTQH 1EOVA 4LFAQ 1A0IA 4DV2Q 1UE6A 4DV2L 1FVIA 4EX5A 2NVQH 3GTGH 4PZ8A 3CD6A 2MO1A 1LUZA 3UE0A 4DAMA 4MTNA 3CPWA 2ZTDA 2IY5B 4YWKA 2Q2HA 4HJ7A 2B29A 4A3DG 1Y14B 1VQ8A 2MQHA 2N8NA 1VQPA 1VQ5A 1NMGA 2UUAQ 3HKZE 4DV0L 4BY1G 4TQUS 3J7ZC 4JI7L 1HH2P 4JI7Q 3CCVA 1IBML 3L0OA 4O0AA 5IYCH 1HZ9A 4GLAC 4DAYB 1N32Q 4HJAA 2B63G 2RCNA 3CPFA 5IYBH 2KCTA 2ZJPA 4GOPB 4A3KG 3KF8B 1VQHA 5JEAJ 4B3SQ 2V1CC 2MFIA 3PUXA 5ELOA 3TQYA 1FJGL 1FJGQ 4A3MG 3VDYA 2R92H 4LWCA 3NENA 1VQKA 5AJ3Q 5AJ3L 5HY6A 3CXCA
chains in the Genus database with same CATH superfamily
4DR3H 3VR2A 2DNEA 4A3CG 1RKNA 2R7MA 4L6TB 4KY7A 2R93G 1UE5A 5IGCA 3CCRA 4GNXB 2UUCH 2JJQA 4UPAA 5KFEA 2QA4A 4P73A 1BF4A 4ZK9B 4DR5Q 1HUNA 5KT2A 2JN4A 1VBGA 1F9SA 4RUAA 1X32A 4G57A 2IPKD 2VL6A 1HNXQ 3AU7A 1PH6A 3GTOH 2DPIA 2WAQA 5KYLA 3GTMH 1XYIA 2E74C 1CKNB 4QUCA 3VR4A 2FPGB 3PO3G 1YBYA 2YS6A 1D5MC 4LF4H 2E2DC 3J80L 1STNA 1TS4A 5FLXL 1A63A 2DY7A 2MUYA 3NQTA 4IPCA 1NE3A 4RHRA 2PI2A 4DN4M 4TQSA 3BZKA 4C1NK 3KDFB 3TS2A 1BNCA 3VPDA 4DR2Q 2GVAA 5ELDA 3MHBA 2FKLA 3L4JA 2B2YC 5I2XA 1OXUA 4IRCA 2HVQA 2FMCA 4JI0Q 4YR3A 5DG9A 3PR4A 4DNIA 4LJZC 3MXGA 4R4CA 1Q3LA 4CKEA 2KHSA 1CQIB 3TMEA 1GM5A 2RCFA 3ERSX 1TWAA 3HOXG 2F0IA 3GIJA 1D7QA 2UXBQ 2A6ED 3MVVA 3HOWG 4DR7Q 3CQZH 4IR9A 5C0XG 1UEAB 5LL6X 2ATWA 3D4DA 4HMJA 3PUWA 1B3QA 2ZT9C 1WSCA 1GUOA 3K80C 3GTKB 3BZCA 1T3NA 4OL7A 3HKZB 4DK6C 3FKIA 2M9VA 3KF6A 2OXPA 3EVQA 3X3MA 3S14H 3S1QB 4A3DH 3M3YB 3RBDA 1A8VA 5IP9H 4R8UA 4LK1C 4JVZA 2AMCB 4TV8F 2FB9A 4DV3L 1DGSA 2UXDQ 3Q8DA 1WCMG 1KAAA 3ZJYC 4L5RC 2L0CA 4HSPA 2ZM6H 1JOKA 4KHVA 4QQBX 3Q6SA 3HBLA 4Y8VB 4BS9A 2K52A 1T9HA 1TQOA 5LMUQ 3N40P 5LMUL 4GN5A 1KJJA 3BVMA 3S1NH 4LFAH 1K83A 2WAQB 2VQFQ 1WJJA 4R4TA 2KENA 2YYZA 1I3QA 3A8JE 4H0LC 4OIJA 4LF5L 2B2WC 1F9PA 1Q12A 1SYDA 4IJLA 4J9PA 3Q22A 4DR1Q 2ES2A 4DR1L 1WTOA 1EIHA 2NU8B 2UUAH 1VQMA 3WNZA 1K28A 1ZEQX 2EXZA 4RAUC 2ASBA 5I47A 5JQWA 1U0LA 2IWHA 1EZ1A 2VB2X 2EXDA 3MXNA 3RV4A 1VMCA 4B3SH 4KD4A 2IA6A 1VQFA 4DV0Q 1XX8A 3NXWA 3JAMW 4B3ML 1RODA 1Y69U 3KTMA 1TWAB 3URYA 4A2BA 1A15A 3RD4A 4LFCH 3K3VA 4QMGA 2NN6I 1NCVA 2X69A 1RHPA 2JXMB 4PMWA 4A93G 4I7HA 2F3IA 2XIWA 4MN3A 3R93A 2K5HA 1QVFA 3PO2H 4A3BB 3OWFA 1VQOA 3ORRA 5CMDA 5BN5A 4MIUA 3FKIB 2ASLA 3KF6B 3Q1KA 4QWAA 5EPKA 4KN4C 1WCMA 2RGVA 3QOJA 1UC9A 3TN2A 1Y1VA 1KLGD 4JBJA 1K8MA 3ND9A 4R8UB 3A8IE 1B8AA 3A8KE 3QO2A 5E1FA 4DV1H 1M90C 2KUMA 4P72A 3LWEA 3DMUA 1PYBA 1QOHA 3BQ2A 3GTLA 2WAQE 3PIOA 5JJKA 1CHPD 2YZNA 4A76A 1KRTA 1VQNA 5FPRA 2ZTCA 4DAPA 1BCPD 4HTHA 4GN4B 4MHEA 3GTPH 4ED8A 2RQXA 4IUTA 3PO3B 3U58A 3OWEB 2PI2E 1G6PA 3S24A 1H9RA 3EBEA 3UDIA 1BCPC 4BBRG 4DUYQ 1LT3D 4DUYL 5JJIA 4U7CA 1LT5D 1K83B 2LKVA 2AHOB 1CS0A 3LNNA 1M7JA 4O4HF 1I3QB 2FJ2A 4IPDA 3KAKA 3U9SA 2Z0SA 1D1KA 2O5JC 2Z6KA 5DGBA 4C3JH 2K5VA 2EDGA 3S16H 1SMXA 3H3VH 1X55A 2EQSA 2E2JH 4A3JB 3E6ZX 4R4QA 3N6XA 2E2HH 4K5WA 4I65A 4XQJA 3L7ZC 4QUFA 3MXNB 1JE5A 3GV7B 1BUVT 3AFPA 1F9RA 1WTXA 2UXCL 2ATLA 3EROA 2SOBA 1PH7A 3RF2A 2PZUA 2CW7A 2Q2UA 4DLKA 4ILWA 2Q2IA 1O78A 2CW8A 1V9PA 4EG0A 1PA6A 4QIWE 2A69D 2MO0A 4JYAH 2ZDQA 1QVCA 3KLRA 5J1ZA 3S1RH 2R92G 5KG5A 1FNUA 1CK1A 2E5LQ 3RZDB 2E5LL 2A69C 2RBMA 5I9OA 4F4XA 2XC9A 3T4AC 5KKNB 4G7ZC 1WCMB 1L1OC 1N9WA 1NJIC 1Y1VB 3CVZA 1R9TA 1SNCA 1AZPA 3E3XA 4J0MA 3M9OB 1PH5A 3BZDB 3CW2C 2KBNA 4ZRZA 1L1OA 2D9UA 2LMCB 4JV5L 4A3MH 3GTLB 1C3OA 1X54A 2Z1CA 3J81i 1T36A 4RGTA 1DIKA 1TWFH 4A3BH 2JA5G 3RIZA 4KLKA 5IOCA 5KFPA 4HQ6A 1VQ4A 2PCFB 1C48A 3TREA 3WWVA 4B9XA 1JKJB 2W8LA 2R93H 4HSVA 4OXPA 1XMQL 5IODA 3TP5A 3M4IA 3NTIA 1DZ1A 4XQQA 4YCUA 4WRDA 1ASYA 3TP7A 4FVMA 2WTFA 4DL4A 1WR2A 4JCVE 4JI8L 2BH8A 3WOEA 1BCPB 3QJYA 4IQZA 3HZXA 3F2UA 2VR1A 4RUCA 2IHFA 3S2HB 1N48A 2UU9H 4WJ4A 4JI6L 4DV7H 4LMYA 4R4IA 4I7ZC 2Q8RE 3DM1A 1IBKL 5IP7G 3J80E 5FLXE 5J2UF 5KYIA 2DIKA 1RK6A 3D3RA 1D5ZC 2IX0A 1TT2A 1H95A 4EEYA 1AZQA 3GLKA 5EOYA 1K83H 5FJ8G 4FF1A 1EEID 2A1AA 4A93B 4F87A 2R7LA 2M2LA 3CF5A 5KG0A 5KNDA 5GADC 2R92A 4BWGB 2K5QA 5KEEA 1BJTA 1LTLA 3GTJH 4QB4A 3PIP3 2VQEH 1FGUA 5BR8Q 4V190 2AUKA 1AUXA 3KOJA 1TWHB 4FO2A 3ICEA 3K59A 2K33A 3KLSX 1P16A 3M9MB 1HA5A 4RG1A 3HOXH 4Q8EA 5DLGA 3HOWH 1PYWD 1SROA 4RKBA 3VYSA 5C0XH 4CJ2C 1T5XD 2EJFC 5JPNC 1ZQ7A 1CUKA 2AGOA 1N32L 1ZETA 1R9TB 3HOZG 4DR4Q 4X3KA 4DR4L 3CCLA 1Z9FA 4N8FA 1L1OB 3NBHA 2TSSA 4XIGS 1GSOA 1JICA 3I2ZA 5C3EG 3V4ZA 1MIUA 2PYKA 4BBRB 3K5NA 4BBSH 4YR2A 5C44G 2HT1A 4LUVA 1I6VC 2DWCA 3BVZA 1KABA 3J81L 4NDXA 2JA6G 1B04A 1X3FA 1WCMH 4XDXA 5LMNW 4R1JA 3OTOQ 3NP8A 3OTOL 1JDBB 3MWDA 2YS7A 2G9HD 5JAVA 4L63B 4DR3Q 1MSHA 4DR3L 1T94A 1PFNA 4H44C 3RBEA 4DXGA 2KOLA 1A2TA 2W6ZA 4RWSC 3IN5A 2EPBA 3PW5A 4Q0YA 2UUCQ 2IW3A 1XWEA 2UUCL 5CR3A 2K14A 1HNWL 5M5WB 3R3OA 1TU2B 3T5LA 5I2YA 4LF6L 1HZAA 1K8AC 1KXLA 4F88A 1W2BA 1JQYD 3F1ZA 3DEOA 1RJRA 1CI3M 4O42A 3GIKA 1EFWA 1G291 1OXVA 2W9CA 2HQEA 2V4DA 4DV3H 1ZYRD 5EAYA 4LF4Q 4ED3A 4LF4L 2R92B 4ODGA 3GV3A 5C5LA 4UP9A 3V05A 3PSIA 1S03G 1TY0A 4H13C 1I4QA 1ZYRC 1C4QA 3Q8RB 4ZQ3A 2UVWA 4HN7A 5LMUH 1PH4A 2JA8G 1C8CA 1YNNC 4TSSA 2CZGA 4A93H 1E22A 5I9PA 1EQQA 2N55A 1EY5A 4L1KA 2KCMA 4ETSA 2MHVA 1SRUA 1SNPA 2PW5A 4LF5H 5T1IA 1D8LA 1PFBA 1DONA 4JV0A 4EQNA 1MJEA 2JA6A 1HCZA 4G4KA 1O75A 2VA2A 2PW7A 3NBHB 5JVLA 2NVXA 5IT9c 2K4KA 3KAJA 1AN8A 3I7FA 4R8NA 1LTTD 1I4PA 5KG7A 3K0YA 4IR1A 1FNVA 1PZJD 2KCNA 4JI1L 4JI1Q 4N9PA 1JOQA 5DQIA 1I6HH 5ISRA 2YRWA 3GIPA 1ET9A 2J7ZA 4TRDA 3KALA 4Y52H 4B3MH 4K14A 4O2AF 4PQXA 1G2TA 3L2PA 1STHA 4F8MA 5C0XJ 1AFPA 2H5XA 1BGWA 3CCMA 4QW9A 3PN1A 5LL6S 4JI2L 2ZM6Q 2PO4A 4J9KA 1NNXA 2F0HA 3BG5A 3HGBA 5J3BA 3NTKA 1DOMA 1WVLA 1DJRD 2UVRA 3OYYA 4X3SA 3GTQH 2B2TC 2J9GA 4LFAQ 2NU6B 1UE6A 4ECWA 3SEBA 2W9CB 2NVQH 3GTGH 1LUZA 4K2KA 4DAMA 2B2TA 2C2DA 4YWKA 3K6OA 3MR3A 2Q2HA 4HJ7A 2CH4A 4A3DG 1VQ8A 3EA6A 4LFBH 2UUAQ 2CQAA 1SE4A 4K6LA 2V4RA 5DM63 4EFEA 2GA4B 3CCVA 1IBML 3T13A 3HOZB 4GLAC 4UDUC 5KFDA 1B2TA 3Q2OA 2C2EA 1IYVA 4UCSA 4M8AA 2EYPA 4QF4A 4DUYH 4K5XA 3MXUA 5A35A 5C3EB 4EFBA 1VQHA 3H6MA 4B3SQ 3EPIA 1E2WA 3FEWX 3GTMA 2R92H 1B6RA 5D1PA 5C44B 4LWCA 5AJ3Q 5AJ3L 1VBHA 1BDOA 2AQ3B 4LFCQ 4LFCL 2JA6B 1TAEA 1TR5A 2F0OA 1HHVA 2Q8IB 5EWEA 4KTAA 2XTIA 5M3FG 2JA7H 1DCZA 2NZ1D 2O03A 5KG6A 1GUGA 2XRQD 4R4OA 5ELCA 4POGA 4G7OC 1UC8A 4KHZA 3R5HA 4CJ1B 2LY7A 2WKDA 2UXCH 2JA5H 5HBRB 4LSXA 5M3MG 3MFGA 1K8OA 3S9WA 1UWVA 1EQTA 2J4XA 3HP3A 3C1FA 2R8GA 2HCCA 1EU4A 3X3NA 4M9UA 2XCLA 5DLFA 4JG2A 2K75A 4LUOA 4PMBA 2AU0A 5C4JB 4HNTA 1VQEA 3S2DH 2OCEA 4IZOA 3BS1A 5IY0A 3BG3A 5KG1A 2R87A 4P71A 3OMGA 2VY3A 1CQFA 4DL3A 5BMVF 3VYTA 4APVA 1MKHA 5IP7H 4NB3A 1Z2OX 1IHZA 3KLWA 4JV5H 1VS0A 2FINB 4ED7A 1EZ6A 4GOPC 4LF7L 4RNOA 2V4QA 5FJ8H 1TWGA 5KFMA 2SCUB 1A3UA 3TZUA 3H4DA 4F4WA 4RHSA 4ECTA 2AGQA 1XMQH 5IGEA 2F0KA 4OO1G 1LV9A 1H9KA 2GN5A 4S3SA 1HJPA 4ZKCB 1DOKA 4GNXC 1YI2A 4ME5A 3RUZA 4J9QA 3GTMB 3PVXA 4O3NA 4JI8H 1KQSA 4JK1C 3FP9A 2M05A 2NVYA 1MSGA 4JI6H 3N41B 4DV5H 4A3EG 5KRUA 1GO3E 3MTSA 5H1SE 3NQIA 1IBKH 2R8JA 3HOZH 2P5ZX 1QE6A 5M9OA 3JZIA 2F0DA 4J8QA 3IFDA 3P7JA 5EKKA 1GGOA 4YB8B 4JUZA 1S40A 4B3TH 4QCLA 5L37A 2LXJA 4NPSA 5D65A 1FYCA 1PV4A 1VDZA 1C9OA 4ABNA 4C3JG 1PMRA 4IUPA 5C44H 3I55A 3TP8A 4A3FG 1XPRA 3C0FB 2JA6H 2KA7A 3TIGA 5HGQA 1M0TA 1PZID 2NVXH 1CFMA 4AYBG 5JEAG 1GJXA 4C5CA 4U68A 3J81c 2B8GA 2VW9A 3SGIA 1EUDB 2JEAI 1SE3A 2R7NA 1VQ6A 5C3XA 1KTKA 1QZHA 3Q24A 2W71A 5GROA 1D6EC 1EIGA 1O7ZA 2MNAA 3VPCA 2G5DA 2W6QA 5KFVA 3J80W 2OLSA 1GSAA 3QG1A 5M5YH 3S14B 3DWPA 4A3DB 1N32H 1B9NA 2R7KA 3BDLA 5GAEC 4C56C 2ZXOA 2R6FA 3V6KA 4JV2A 5EWFA 3F8NA 1VQ7A 2R7DA 4MA0A 3DLLA 5C4JH 2UU9Q 2UU9L 4YP3A 1LTID 1TWGB 1EY4A 2NBFA 3AB9A 4DV7Q 4DV7L 1KJQA 3H15A 4ED0A 3VR3A 1HQRD 3K81C 3GTPA 1RJPA 3FDSA 3PIO3 1E2VA 4JBKA 3OTOH 3EIVA 3S1NB 3MFIA 1EY8A 4IFDI 3NBIA 3RLOA 3BQ1A 1F2LA 1Q1BA 1VF5C 1JMCA 4GZYC 2L5TA 2JA8H 3RMHA 3H3VC 2YV5A 3LP8A 1HNWH 3G7LA 1XNRL 5CV5A 2VQEQ 2VQEL 3P1HA 4I55F 4LAAA 4AH6A 3M4QA 4LF6H 2VPQA 2IJ0A 1RD9D 4R9WA 2E2HA 2R6GA 2YTVA 4EEQA 4B9WA 1EOTA 4FU0A 3ZYYX 1I50H 1YJ9A 1PFMA 3H20A 4NMZA 5NUCA 4PG3A 1OTCA 4TUYF 2NUAB 1VQ9A 2F52A 4DK0A 4RZQA 1OXXK 4DV6Q 4DV6L 3PW0A 3UDXA 4O4IF 3OHXC 4EYHB 3DXJC 5KT4A 4J6HA 1XPUA 3PO2B 2KSWA 2VS1A 1SJHD 1HR0H 2KEEA 4RNNA 2CVRA 2I5LX 1IXRA 2UUBQ 2UUBL 3HEJA 3M9BA 2K1BA 1MBYA 4DK3C 2ZTEA 1IYUA 1IBLL 5FO8B 4JI5Q 4JI5L 1L0WA 3BYTB 4DA2A 4CDEC 4O3OA 2IX3A 4BXXH 1U9RA 4XX0B 2IHEA 2DN8A 2DUDA 4JI3L 4BA2I 1V4YA 3M7GA 1TWFA 1PXUA 1TKWB 2VQDA 2ZJTA 2A6EC 4ECUA 2OTJA 4JI1H 1ILQA 2QK4A 3K5MA 3GTPB 1STBA 2R93A 3NTHA 5CV9A 4FS1A 3I4OA 4A3EB 4QWCA 1K73C 4QIWA 2HDLA 4BY7G 4HNVA 1I4HA 2EIFA 4BBSG 4X64H 3KHLA 3CCEA 4DAYA 2RF4A 1GYFA 4DV3Q 3KBXA 2IP4A 5IT9W 3F2BA 1TWGH 5C8YF 4O2BF 1DOLA 4ZQIA 1KJIA 4JI2H 2A74C 3CC4A 2K04A 3HOVG 4C3JB 3KFUA 3S16B 2IX1A 2AUJD 2E2JB 5ELBA 1J6QA 1EYDA 1LACA 1PTOD 3G6JB 3PV0A 2E2HB 4LF8H 3BYYB 1XMOQ 1XMOL 2RVLA 4R8IA 4IWYA 4U6PA 5KFNA 3UDFA 3G6YA 3A0JA 2HIVA 1O80A 2B8FA 3GD7A 5M3FH 4AQYH 4EGVA 3MR5A 1KRSA 3J7YW 2JEFA 2NVYH 5EJWA 4LF5Q 2P0AA 3T53B 3DEPA 5L1JA 1IOWA 3I8ZA 1PH2A 4A75A 3GTJA 4PNYA 5M3MH 2RDHA 1IBMH 5C1PA 4V0BA 2DJGC 5FO9B 3S1RB 4DV4L 3IG0A 1JJCB 1G91A 3NSWA 1E4FT 1SR3A 1Y1WH 1O7LA 4B3MQ 4HR7A 1PZKD 1VKZA 1RJTA 2F0MA 2N78A 4RA8A 1X65A 1EWCA 4XYMB 3PW2A 2FHTA 3Q8PB 2QDLA 2D2CC 4A3MB 3T56B 1G6ZA 4QJFA 1TWFB 1ZHQA 5E7NA 3H0GG 3FPUB 2R86A 2UVUA 3TINA 1QVGA 3H4BA 1QB5D 2CFMA 2R93B 1XXGA 2QF7A 3VA5A 3NPPA 5D14A 1CT1D 4JBMA 5C4XH 4XYLB 4QIWB 5GAGC 4GKJH 1L2ZA 3E9HA 3I90A 2K5WA 4UP7A 4RB1A 4OO1H 3M4YA 1U4PA 4AYBE 3EJIA 2OWOA 1Q7YC 1BXRA 4G7HC 3CCJA 2FLNA 4PDBA 4LFBQ 4LFBL 1UEBA 3K5OA 2KCCA 5JJLA 3UE1A 1GLVA 3JRXA 1DYQA 2JA9A 4A3EH 3M7NA 1I5FA 3FVQA 2WB1G 2VUGA 1MI2A 2K28A 4ZCKA 3D4WA 2B2VA 4WJ3M 1UE7A 2EYLA 2Z6KC 4BWSC 1V8QA 1G2SA 3K5HA 2ID0A 4LF7H 3UFXB 1X3QA 3CKIB 2F3WA 1JC7A 1PTOB 3GTJB 1CQJB 4A3FH 3GV8B 2B2UC 3IRBA 3ERQA 4RB3C 2Q8TA 1C7YA 4IPGA 2R7FA 2CWAA 2J6SA 2L1BA 5EGTA 3HOXB 5JEAH 2HD3A 3HOWB 3RNUA 1J9OA 2B2UA 2UXCQ 3JSNA 2J0TD 3J7AF 1Q82C 3GQCA 1I6UA 5J39A 4HR7B 2I5HA 3AMUA 3N6RA 5KX5F 3H0GA 1VQJA 2IMWP 4NXNQ 5KFAA 4NXNL 3QWNA 1Q81C 3WO0A 1JR0D 2MPMA 2WDTA 2YTXA 3RB0A 4IRDA 1I4GA 1NBWA 1YIJA 4FYDA 3R5FA 5A2QW 1SE2A 2R85A 4CKBA 4PV1C 2WYOA 1KDCA 2F0EA 1EYGA 3S15H 4BBSB 5KFHA 3SDZA 3ORQA 1EL0A 1IOVA 3QR8A 2A8VA 4IPHA 3ULPA 4RKLA 3S17B 2IL8A 1Q8IA 3L9AX 3HOYG 1EYZA 2OH2A 1HQMC 1VQLA 2F0NA 5J22A 3HOVB 4HJ8A 2I0QA 2JA7G 4J9NA 5KGUA 1LLRD 2X6GA 3STBD 4JV5Q 3RB6A 2KVMA 2UVVA 4XXEA 4HJ9A 3I73A 1WTVA 1SYGA 2WB1A 2X6LA 3HOUG 2PZTA 2L55A 5EBCA 1MZBA 2PQAA 4MTDA 2WACA 3RGZA 1XMQQ 1SE8A 1JWUD 3PUZA 1HA6A 2MGSA 2F4IA 1W6JA 3GTQA 5DLQE 1A6XA 3KJOA 1EYAA 3CAMA 3KK7A 1KAWA 3PF5A 4A3GH 1SNOA 1EUJA 4JI8Q 3N43B 5KFGA 1M8AA 2NVTH 3GTGA 1LO5D 1K3RA 2FK2A 3J81W 4ED1A 1SFOA 2CW0D 4JI6Q 4DV5Q 2I8CA 4DV5L 4NLGA 1STAA 2NU9B 4EVOA 2NWGA 1IBKQ 2F0QA 4DR6L 1HTLD 4DR6Q 1SN8A 3OSNA 4HYKA 2NB0A 2CW0C 3K0XA 2ENBA 4K6DA 1MJCA 2N3SA 5FK9C 4B3TQ 4B3TL 4ALPA 5EBDA 3SHLA 3J80c 5FLXc 3CRKC 2DPJA 4A3LG 4FF4A 3LWBA 5C1OA 3LX0A 3H0GB 5KT7A 3K5IA 1FVIA 4EX5A 1PTOH 1XNRH 2BR0A 3SE7A 3UE0A 5LYJF 4Q8FA 4MV1A 3CPWA 2ZTDA 5EPLA 1JE4A 2FMMA 2YL2A 4R7RA 1E0BA 2N8NA 3K3PA 1STGA 2JA7A 1VQ5A 3J7ZC 2HDMA 1S5CD 1TVXA 5IYCH 3GV6A 1I6HB 3KLSA 1AEXA 3D4RA 2JA5A 1N32Q 4HJAA 3CRLC 2J6UA 4A3KG 5JEAJ 3TQYA 5K5PA 5ELOA 4YR0A 2BQRA 4DV6H 5HURA 3BJYA 3T51B 4ED2A 4LH7A 5HY6A 4BY7H 2WB1B 1EHIA 4E4TA 5HV6A 2LXKA 1BO0A 1ENAA 2PQAB 2BDNA 4WD3A 4GS3A 1IKLA 1QNUA 5KT6A 3S17H 4OGQC 2UUBH 2F0TA 3HRZC 4KV6A 4NW2A 1LABA 2LSSA 2AKWB 3HOVH 2FE3A 5LA6F 1IBLH 3GTQB 5D1OA 4K2LA 4CGYB 1BBXC 4JI5H 4TV9F 3QIAA 5KFSA 1YHAA 4XTCS 3HG9A 2NVQB 3GTGB 3R2TA 1K1SA 3DUZA 2W57A 4JI3H 1S9FA 4MV9A 1STEA 3H3VI 5EQ0A 1HNWQ 3M4PA 2EE1A 3RGXA 4EGQA 4LF6Q 3DWQA 5E3FA 2I46A 2VOBA 3A5ZB 1RYSA 4XYQA 1EY7A 1TIID 2HCIA 4O3SA 3VR5A 3K7AH 4QY7A 3SK5A 3CMAA 2VUMH 4EBCA 3SE0A 4C5AA 1Q1EA 3MWMA 1QCBD 2OF1A 4RCOA 3BDOA 5D3IB 4HIKA 1U4LA 4ME3A 2F0GA 3OUZA 1N8RC 3H09A 1JX4A 3OHAA 2F0FA 1NY4A 1KBLA 1H9SA 2R8HA 3Q23A 1PX2A 3MA2B 3NELA 2JA7B 1HZCA 3T5HA 4OEMB 1HR0Q 4HJ5A 1QNKA 1HR0L 2WB1E 3SI8A 5KFTA 3RAXA 1XMOH 2VA3A 1VMPA 4LW1A 5KT5A 4Q44A 2EVBA 2JA5B 5EZYF 2QEJC 3H0GH 3HOUB 5KG2A 1BKBA 2ZXPA 2LFNA 1PRTD 3VPBA 2W6PA 1Z7TA 4U673 1BXTA 5FLMG 4LNQA 1CTMA 4MTKA 4HNUA 1AUVA 5IGFA 2HIXA 1RTNA 2LS01 1Z47A 1GUSA 1SMYD 4RFBA 3S2DB 4DV4H 2K50A 1BOSA 4ID6A 3MR6A 1NMFA 3B6YA 3T1YL 3F2DA 5J2TF 2TMPA 5D3DA 1SMYC 1UE1A 3E0EA 4KY6A 2EY2A 2KJXA 3WO1A 4K8IA 4X64Q 4X64L 2X0SA 5LMNL 4J9SA 3DWAA 3NGDA 5CBEE 4RGMA 1TY2A 2BA1A 4ECXA 1PH3A 1VQAA 4JI2Q 5CV7A 4DNRB 4WJWA 1GVPA 4FP5D 4XT1B 1PH1A 5ELEA 1Q90A 1XTDA 1U4MA 5KFOA 1D5XC 4YHHL 4BXXG 2ICIA 4LF8Q 1WFQA 4LF8L 3A54A 2BQ3A 3NEMA 5JOBA 2QILA 4AQYQ 4AQYL 4IRKA 2XNAC 1RTOA 1B6SA 1SFOH 1C30A 4HCEA 3U50C 1E7ZA 3O13A 1AH9A 1I94L 2OQKA 1MGSA 1VF7A 3HB9A 3R5XA 1FJGH 2VZAA 3I70A 3RV3A 2E75C 3N52A 3TRZA 1H9SB 1SAPA 2MJ8A 4OWTB 1IBMQ 2RDGA 4ZUIA 2VXWA 4MAMA 4A3KB 3KHHA 5C0XI 5KFFA 3JAME 2H1EA 3TZDA 3R2IA 3Q8QB 4FNFA 3UDGA 3PR5B 1EY0A 2Z4IA 3BAAA 1YJWA 4MZ9A 1Z2NX 1S0OA 1I7LA 1I50A 2E2IA 2RKSA 4IAJA 2W6NA 5KFKA 4OWWB 3MFYA 5E4WC 4UCRA 5BPHA 4NXMH 5BN3A 4K0KH 2BH2A 2NVXB 2KHIA 3HOYH 5ELNA 5FD6A 1XPOA 2PNHA 4IN3A 1AE3A 2C9OA 4LF9L 4OELB 4ZHQF 2F4VH 5F9NA 1WD0A 1B53A 5M5XH 3EPGA 3TS0A 2ALZA 3HKSA 5LL6b 1PRTB 3VR6A 1PH8A 3MEHA 1N34H 1EU3A 3OHBA 3HOUH 2HVSA 1TS2A 4TVAB 4GKJQ 4GKJL 3RZOH 5M5YB 4DKAC 3RN2A 4NXNH 2EY6A 3G4SA 4A4IA 2C28A 4JOIA 4L8JA 1Q46A 1S97A 1PTOF 1ET6A 5IGGA 5DAUA 2V59A 2FK3A 4FBUA 4MV7A 3PW7A 2PPBC 1HFNA 1Y1WG 5IWAL 1PK8A 3NWSA 2EYFA 4DK1A 3DF7A 1XJVA 3QZ7A 5L1IA 4HIOA 3KXYT 2Z9HA 4BA1I 1TWCH 1CA6A 3CP0A 1W3SA 4OX9L 4KD3A 4LF7Q 3WDNA 2K05A 2O5IC 2JA8B 5KG4A 1IKMA 4XT3B 1B3AA 5C4XG 1VQIA 4A3LH 4O3RA 2XWJB 3LGJA 4UHVA 1J5EL 1ULZA 2GPSA 3MR2A 2W70A 3H91A 4TKOB 1HZBA 2XCAA 4DL5A 1YEZA 3D6CA 1JXLA 2IBKA 1I50B 1B7YB 1X3EA 1DV1A 1CKMA 3CC7A 2I87A 2R7ZH 1QWYA 4KJOA 2DLNA 3BJUA 4K8JA 3OUUA 4DR6H 2JEIA 3RN5A 1EQVA 4RB2C 3D31A 1G51A 5EPJA 5C4ZA 4A3KH 4F4YA 1EEFD 1N33L 3I91A 1ZHSA 2MCTA 4JI4Q 4JI4L 5KT3A 3NK9A 1U5KA 2K01A 4RH6A 3HKZG 3OIQA 1Y1WA 1B44D 1EIYB 2EY5A 3GV5B 2JEJA 1K0RA 3KBGA 4M1UB 4UFZA 3SK6A 4CKCA 1A3VA 5GONF 1B9MA 3IFTA 4KKTA 1DM0B 3W1BA 2VPSA 3EYYA 2QEXA 2CCZA 1GD7A 3R8BA 4UY8C 5FLXW 1B1ZA 1VCIA 2PN1A 2B39A 5H80A 1N36H 1SSOA 3S1MB 2EJGC 2NUCA 1HNZL 2PMZA 4YJ2F 4J1MA 5DG7A 3IKJA 3KJPA 2OT2A 2NU7B 2JK8A 1SXTA 5LHY1 4MV6A 4JV1A 5CV8A 3IL8A 4P75A 4X66H 2WP8J 2PBZA 3LWUA 1IW7D 2DY8A 3P20A 2FPIB 3T5KA 2OTLA 4MV4A 1VQBA 5JJZA 1F2MA 4X6AH 3M4OH 1UAPA 1IW7C 1EWHA 5KFRA 2K6AA 4CDDC 5IYDG 3GP7A 3G6EA 5M3FB 3RUPA 2JEGA 4L5QA 1TXYA 2R82A 2RSOA 4M7EA 1E4GT 2NVYB 2BOSA 5C3WA 4MV8A 1S3OA 1JJ2A 4KN7C 1XNRQ 5LXTF 2RDJA 2R84A 3I3CA 4IJHA 3MFHA 3ETHA 3GTKA 1X3PA 2FXQA 5M3MB 4A3GG 3HKZA 2AQ1B 4RCNA 5FLMH 2XVSA 2JSOA 1Q8KA 4ZUJA 1YHQA 4AYBA 2FLPA 2F0JA 5KG3A 2C5CA 4JC0A 4QL5A 4UAIA 2E2IH 4MTEA 1OXTA 3FKIG 3CHBD 3AEVA 1Y1WB 3QB3A 3OSPA 1IYJB 5KFJA 1LTAD 1U4RA 1KC7A 4F7XA 2A6HD 5JVG3 4C3IH 4KKUA 4DR5L 5JPMC 1PVOA 1W6KA 2XIGA 1WTWA 5DQHA 4IUNA 2A6HC 1HNXL 5T1GA 2WV6D 3TEHB 5FKAC 1S4ZA 1VQCA 5CV6A 2F3VA 1X9NA 3G6XA 2F0UA 2K5DA 2A73B 2R8IA 2PMZB 1IBLQ 5C4XB 1Y8PB 1EWIA 5L1LA 2K32A 2W8KA 4G3IA 3G6VA 2EJMA 4IUUA 1FGBD 2K7VA 4JI3Q 3MXPA 5IYCG 5I6YA 1ILPA 3A56A 1Q86C 4C2MH 5LP6F 4L5SA 5KFYA 2WINB 2M00A 4DR2L 1CZGA 3CCSA 3C46A 3U9TA 3T1YH 2F0VA 2W7PA 3S1MH 3I56A 3IAYA 1UNSA 2D0OA 4A3JG 5I6WA 4JI0L 4EGJA 2AQ4A 3MZ5A 2JQOA 3ONAB 2ALYB 2H4OA 2FK1A 1BBUA 4IOAA 5LMNH 2B2YA 1NTGA 3DHQA 1L0XB 1SYXB 1GHKA 4EYIB 2UXBL 4DR7L 1S0NA 1ZKOA 3GIDA 3TSSA 1BR9A 4IOCA 1K1QA 1RIPA 2YTYA 3I4LA 3UQ8A 1HRJA 1ICWA 4A3FB 3KUPA 4MNOA 4YHHH 3PMFA 2YU9A 1N56A 3PGZA 3T16A 1KJ9A 4AYBB 1YVCA 4P2CB 5CORA 4GKKQ 4GKKL 3BQ0A 1SJED 1PTOC 1A2UA 4B3RH 5EKLA 2MP1A 1RK5A 5CA1F 2UXDL 3JSLA 2SDFA 1I94H 2BQUA 4ZI7F 1HPCA 1Y1VG 4DAVA 1WYDA 2PMZE 3GDEA 1NR4A 2VUMG 4GN3B 4PWQA 4XQNA 3FHWA 1ENCA 4DV4Q 3S15B 3A74A 1JJGA 4CJ0B 1DXMA 3VYRA 2VQFL 4A3IG 4ZAIA 2D5DA 1I7NA 3JAMi 5KFBA 2B3GA 1K8GA 2JE6I 1S5DD 2SNMA 4YAKB 2ICEC 3ULJA 2EY1A 1GUNA 1A0IA 1FNWA 1SBBB 1SYEA 2B2WA 4HEDA 4LF9H 5C5MA 4PZ8A 1NSNS 2MO1A 2VB3X 4MTNA 1JDEA 1ONLA 4X62H 1R4QB 1WTHA 5K36H 1Y14B 1K3BC 2L11A 3EFXD 4CDFC 1NMGA 4JW0A 3HKZE 3W2DA 4DV0L 1CE8A 4BY1G 4JI7Q 2JP1A 5KNBA 1HH2P 4JI7L 4XYOA 1EY9A 2Z6BA 4DAYB 4A3GB 3MWEA 2N88A 3MWYW 2B63G 1JOOA 3CPFA 2ZJPA 2NVTB 1I4XA 2ZXRA 2L12A 5DQGA 1FJGQ 1FJGL 5LOVF 4K5VA 5IT9L 2XN9C 5IWAH 1VQKA 1T5EA 3T1HH 4KMUC 5I4DA 2B2VC 1CZWA 3MAQA 2HHHH 3SR1A 2YU9B 4C3HG 1SYBA 2QGQA 4OWXB 1PRTF 2A68D 1PFSA 2PQEA 3PUYA 2FMAA 2HVRA 3PW4A 2VUMA 3CCQA 1C0AA 4OX9H 2A68C 5CA0F 1KIXA 1LT6D 4NXMQ 4NXML 3SK4A 4FS2A 4YCWA 4YY3H 4K0KQ 3GTKH 4K0KL 1DV2A 4IUQA 2YYAA 4WORA 3CMEA 1J5EH 3HFZB 3S1QH 4PZ6A 2GPWA 1KL9A 3M3YH 3DM3A 2F4VQ 2F4VL 2C2RA 4CDCC 1CQVA 2EYMA 3RR5A 1IL2A 1RL2A 5CC4A 4JPBW 2AQ2B 4ECRA 1R4PB 2GVBA 1N34Q 1N34L 2EOTA 5KFWA 1HUMA 4I50F 2WIIB 3OMCA 3RB4A 3CCUA 2HQLA 1S5BD 1YITA 1CKOA 3JAML 2VNUD 4CBVA 4X65Q 4X65L 1FR3A 2NTTA 4UCUA 5BPFA 1SLJA 1N33H 3ULLA 4BY7B 2BDOA 4YWLA 2RDFA 4JI4H 1W96A 1JWMD 4YJ3F 2B63A 1EZ8A 5DM73 5CB4F 4YQWA 4I7AA 4FDBA 3TP6A 4HIDA 2XGPA 3U9OA 2JYOA 1CSPA 3PF4A 3QOLA 5CBAE 5C6AA 3OSOA 5G3LF 3L3OC 2W6OA 3A7LA 3D6WA 1D1IA 1TWHA 1V1OA 4A2AA 1BVSA 2BCOA 2E76C 3FPPA 5IE8A 3STBC 4IFDG 5IYDH 2F03A 4Y7NB 1KNEA 2WKCA 2QYZA 5KFQA 2RA4A 4DPGA 3FMAA 2GLTA 1LTRD 1LT4D 1HNZH 4KY5A 1LTGD 1TWAH 3K5LA 1PYSB 1OXSC 3K7AB 2VUMB 3KHRA 4YAJB 1UUPA 1NUCA 4DUZQ 3TBIB 4DUZL 2CQYA 4EQPA 4IALA 3VMMA 2DGYA 2CHBD 2KHJA 4N8X1 3J7A5 3E0JA 4A3CH 1UNNC 3I4NG 1O7YA 2QDBA 3FKIH 3K7UC 4A3IB 3I4MG 2YU9H 4DV2H 1ESRA 4ECQA 3U4VA 1D2BA 1YHBA 4ED6A 3Q0AA 4YIJA 4UP8A 5GQOA 1SEBD 4DF7A 1XNQQ 1XNQL 1IZ6A 3RAQA 2CH4W 3H40A 2HGSA 1SCUB 1B70B 1SNDA 1SYCA 4FXDA 4HAEA 1RF2D 4O2DA 3W3AA 2K5NA 4J9LA 2AGPA 2DNCA 2EZVA 1GOZA 4GLVB 2ZJRA 4LUZA 4UCTA 2JEBI 1JWSD 4C1NI 1WH2A 3G8CA 1F2YA 5COYA 2D0PA 3PO3H 4PMCA 4H02A 2OEOA 1KC8C 4J9RA 1ZXTA 4BY1B 2NTSA 4FF2A 1YNXA 3JC66 3TDQA 4H7BA 5A2QL 1E3PA 2B63B 3CU7A 2R7ZG 2XSCA 3GIQA 1N36Q 4FBTA 1N36L 1E24A 1I3QH 1A9XA 5F9LA 4J9OA 4OO1I 4KHPQ 4FXGC 4KHPL 4OONA 1M1KC 4HMIA 4ZOLF 4HIMA 1L2FA 1RCVD 3E5NA 3EN2A 4C3HB 5BR8L 3V4SA 4A3JH 1HR0W 3A5UA 4DR5H 2FP4B 1E1TA 2XCPA 1VQGA 5CYUA 4X66Q 4X66L 1X3GA 2HUGA 2F0WA 1HNXH 1JORA 4KK7A 5KFUA 4IUVA 1H9MA 1PLFA 1GUWA 4O3QA 1Y8OB 4GC7A 1CA5A 5KIXA 4FM9A 2I5MX 5FO7B 1PH9A 3M85A 1ML0D 1SNQA 1TWCA 2W9AA 1BQQT 3FMCA 1CM9A 2PNRC 2RHQB 1QUQA 1SFOB 5JUMA 1SNMA 2EYJA 2XWBB 3BU2A 2Q2TA 4CC6A 1YNJD 4Y7NH 3RZDH 1HXYD 3SVMA 3G71A 4DR2H 2WE6A 1JB7A 4DL2A 1AN7A 1ESFA 1YNJC 4QWEA 1ENFA 1Y1VH 1ASZA 1RJQA 4JI0H 1JIHA 3KHGA 5IGBA 2ZDGA 1P8LA 2Z8LA 2O2LD 1M6VA 1S5ED 3GTLH 2UXBH 4DR7H 2FJZA 1KHIA 3V2TA 2Y0SG 1LM0A 1J8IA 3E9IA 1MD2D 1B4OA 3HS0C 2R7ZA 1X56A 2OQ0A 2RDIA 4A3IH 3HOYB 2L9HA 3RJ0A 1WOCA 2RHSB 2FLLA 3PUVA 1QJOA 1F9QA 3JRWA 1BBWA 4DL6A 1F2ZA 2F1MA 3K57A 4WFN3 3J81j 3MEFA 2NN6G 4XZ3B 4GKKH 5M5XB 3Q8SB 1E4EA 4DNTB 1JT8A 1FKAH 2AWOA 4ME6A 3QZ8A 2WFWA 2QKIC 3A55A 3AYHB 5IYBG 3S2HH 3PZPA 4C5BA 4KI0A 2UXDH 1X6OA 1G8ZD 5JH7F 2YW2A 3OPOA 4DXFA 2V58A 3RZOB 2YRXA 4FXKC 1E2ZA 1WI5A 2L15A 4QW8A 3ITPA 4X3UA 1YNND 2I80A 4APMA 1PRTC 4EQOA 4BY1H 1XDNA 1M4VA 4DU9A 5L9XA 2YZGA 4TQRA 1WD1A 1WTRA 1EFID 4YBZB 2R8KA 4CHTB 1WTPA 2B63H 3OW2A 4LH6A 1HTPA 2ASDA 3T1YQ 1CHQD 1V1QA 2VQFH 2G9DA 4ULLA 5IT9E 4X3TA 2D62A 2XRSD 4C3IG 4RU9A 3BDCA 5D1OB 5F2DA 5LMNQ 2BA0A 2C35B 3E5SA 2K03A 3I4NB 1EY6A 3G48A 3I4MB 1TWCB 4C3HH 4RGNA 1GUTA 4RMFA 3GILA 4UCVA 4DR1H 4O1NA 5DGAA 1QUQB 1TWHH 3UI2A 4RB0A 1FD7D 4EBDA 5KNCA 4GLXA 5C5JA 3I72A 5DNFA 2A5HA 2ASJA 1B50A 2XD4A 5D8DA 3D0FA 2KQ3A 4YHHQ 3P75A 3WOFA 2Y0SA 1IL8A 1TS3A 1R9TH 4AIMA 5TSSA 4DV0H 5ELFA 4QWDA 4JI7H 1V51A 4PZ7A 2EYOA 1QG7A 4IZ8A 2V9WA 2SNSA 1V1PA 4B3RQ 2E8GA 4B3RL 1VAJA 4LSAA 1NAPA 4BBRH 4RAZA 1I94Q 1NR2A 3PQIA 1SYFA 4F50A 2R7ZB 2ZM6L 1FL0A 2NYZD 2YCHA 4FF3A 5G3LD 1HFGA 5JVDF 3V96A 1LYLA 3OIPA 1RYRA 5C4HA 3AFQA 4LFAL 1E4EB 4IURA 3KYHC 1RDPD 4JBWA 2CWPA 4LMQD 4YWMA 3RLNA 4Q43A 1S5FD 3FRPB 3JAMc 5EWGA 2F0SA 2AWNA 2ZDHA 5M5WH 4P74A 2O4XA 5IP9G 2SEBD 2UUAL 3MC0B 2CQOA 1KDAA 2F0LA 1KEEA 4RGOS 4LF9Q 2PZWA 1W93A 4DFAA 3CC2A 4X62Q 3PIPA 4X62L 1KNAA 5DEHA 4E6IA 3GTOA 1OO9B 4B3SL 5DG8A 1KDBA 4JOIC 4IFDH 1KLUD 4YCVA 4RNMA 5FOBB 4L5TA 2C22A 2W6MA 4J15A 1ICFB 4DL7A 4X65H 3GO5A 1JB3A 3U4ZA 4ECZA 1EIFA 1YJNA 2CKZB 3OOCA 4C2MA 2N49A 1CSQA 5IWAQ 3T1HQ 2FPPB 3T1HL 4HCSA 5EKIA 2HHHQ 3N42B 2HHHL 4ECSA 3BVGA 1WTQA 3RLFA 1GHJA 2Y0SB 4J9MA 3K8AA 2A19A 3M4OB 3I4NH 3W1GA 3NUCA 2XGTA 3VYUA 5GAHC 1I4RA 4DV1L 4DV1Q 1BNZA 3I4MH 3SXHA 4RAYA 5K2MA 4KJNA 3RTXA 4OX9Q 1V1PB 5KFXA 3GIIA 4NP5A 3V6HA 1SEIA 3CQZA 3T5JA 1Z6HA 5K36G 1GKHA 4YY3Q 4YY3L 5CAEB 1MHWC 1EYCA 3GQBA 1PHJA 1OWTA 1PDQA 3C1EA 2NZHA 5BN4A 2E5LH 1A3TA 2NZOA 1J5EQ 4B08A 1A62A 1O7IA 2V5AA 2Z4HA 4ECVA 2ZJQA 3J7AK 1E1OA 1STYA 5IGDA 3QFFA 3PO2G 1S10A 4IWXA 4QGUA 3N8DA 4MV3A 3F2CA 2RGRA 4F4ZA 2DJFC 4Q0FA 2E2IB 3EQLC 3NWTA 3H94A 2W9BA 5A2QE 1M0WA 1Z2PX 4DUZH 3RB3A 1TS5A 4IHJF 3PCOB 4I4TF 1EQRA 5IYZF 3RFCA 3AQQA 1GSHA 1QILA 5KFLA 3W5OA 4GOPA 4C3IB 3J7AV 3KF8A 4POFA 1N33Q 4ECYA 2RSNA 2J6TA 1KJ8A 4ZYSA 4ZLTF 2DZDA 1VQDA 3TIIA 3BA9A 1XNQH 2I07B 3FDTA 1TA8A 1LTBD 4UCOA 3GTOB 3BABA 3LMLA 4Z9CB 1QZGA 3C3LA 3TQTA 3NE5B 2KECA 1YZ6A 5JVH3 1V43A 2Y0SE 3F8TA 4OHJA 1AE2A 3OW7A 4OIKA 4EQ5A 4ZKBB 4GNXA 5AFWA 5KFCA 4GC6A 4JYAQ 1F77A 5E4XA 1H9JA 4JYAL 5HGTA 3M9NB 2IT1A 5FPOA 3N44B 5T14A 1S68A 2C00A 4C2MB 1K9MC 2HJWA 4CC5A 1B33N 3HXLA 1JLLB 3TQ1A 5C3EH 2QW7A 3J80i 1HNZQ 1CKNA 2L4NA 3J81E 3GIMA 2R61A 4Q5VA 5KFZA 4KHPH 1XTCD 2FFKB 5KFIA 2XGQA 1BCPF 3I12A 4O4LF 2YZMA 3ER0A 1SDFA 5CGKA 2WAQG 1KD1C 5BR8H 4IO9A 5FD5A 3CQZB 3D8GA 4IFDJ 2W7OA 3ND8A 3VA7A 1S72A 3KDFA 4KKSA 3A7AB 1EOVA 4DGZA 4DV2Q 1LTSD 4DV2L 5EDWA 3CD6A 1EUCB 3V6JA 1JCKB 2BE5D 2IY5B 3ETJA 4DR4H 4EBEA 2B29A 3NHHA 4NKLA 2MQHA 1VQPA 1K0SA 5CV4A 5L1KA 2W9BB 2BE5C 4TQUS 2NN6H 3L0OA 2F0PA 2KEDA 4O0AA 1HZ9A 3R23A 4WBNF 1L0YB 1GXDC 1DD2A 3K58A 2EYHA 2RCNA 5IYBH 2KCTA 4RZRA 3C2PA 3SK8A 4GOPB 3MJFA 3KF8B 4QWBA 4N9TA 1S0MA 2V1CC 2MFIA 1Y8NB 3PUXA 1II3A 4O3PA 1AW7A 4A3MG 3VDYA 2R3ZA 2QCPX 4Q45A 3BA8A 3NENA 4MA5A 1AP0A 4A3BG 2PVPA 5IIFA 3CXCA 3L4KA
chains in the Genus database with same CATH topology
4LFCQ 4LFCL 4A3CG 2QGQA 2LXKA 4OWXB 1PFSA 2PQAB 3PUYA 4GS3A 2R93G 1UE5A 2XTIA 5M3FG 3CCRA 4GNXB 3S17H 2JJQA 4UPAA 2JA7H 3CCQA 2QA4A 1C0AA 4P73A 4R4OA 1KIXA 2LSSA 2AKWB 4POGA 3HOVH 4KHZA 4DR5Q 4NXML 4NXMQ 4YCWA 2JA5H 4K0KQ 1YHAA 4XTCS 5M3MG 2VL6A 3GTKH 4K0KL 1HNXQ 1PH6A 1UWVA 3CMEA 3GTOH 3H3VI 3HFZB 3GTMH 3S1QH 4PZ6A 1KL9A 3M4PA 3M3YH 1HNWQ 3DM3A 2F4VQ 2F4VL 1CKNB 4JG2A 2K75A 3PO3G 1YBYA 4LUOA 3RR5A 4LF6Q 1IL2A 1RL2A 1A63A 1VQEA 3S2DH 2GVBA 3A5ZB 1N34Q 2OCEA 1N34L 4IPCA 1NE3A 5IY0A 2PI2A 4P71A 3K7AH 2VY3A 3BZKA 4QY7A 3CMAA 2VUMH 3CCUA 2HQLA 1Q1EA 1YITA 1CKOA 4HIKA 3KDFB 4APVA 3TS2A 4DR2Q 2GVAA 2VNUD 4ME3A 4X65Q 1MKHA 4X65L 5IP7H 4NB3A 1SLJA 1N8RC 3ULLA 1OXUA 3KLWA 4YWLA 1VS0A 4JI0Q 5JJKA 4DNIA 1NY4A 4R4CA 4GOPC 4LF7L 5FJ8H 1GM5A 3ERSX 3NELA 3HOXG 4FDBA 1D7QA 4HIDA 3HOWG 1HZCA 4DR7Q 2UXBQ 3CQZH 1HR0Q 4HJ5A 1HR0L 2WB1E 5C0XG 1CSPA 3PF4A 4OO1G 2ATWA 4LW1A 2GN5A 3PUWA 1HJPA 3H0GH 3K80C 3BZCA 1BKBA 4GNXC 4DK6C 1YI2A 5FLMG 3KF6A 4LNQA 1BVSA 5IYDH 5IE8A 3S14H 3STBC 4A3DH 4IFDG 1A8VA 5IP9H 2HIXA 1KQSA 3FP9A 1Z47A 4DPGA 4A3EG 2AMCB 1GO3E 5H1SE 4DV3L 2K50A 1DGSA 2UXDQ 1TWAH 3Q8DA 1WCMG 3HOZH 1PYSB 1OXSC 1NMFA 3B6YA 3T1YL 3ZJYC 4L5RC 3F2DA 1UE1A 1S40A 3E0EA 4DUZQ 4DUZL 2LXJA 4NPSA 4QQBX 1PV4A 4X64Q 2K52A 1T9HA 4X64L 5LMNL 1C9OA 5LMUQ 2DGYA 5LMUL 4GN5A 2KHJA 5C44H 3I55A 3J7A5 3S1NH 4A3CH 4A3FG 3I4NG 3FKIH 3K7UC 1XPRA 2BA1A 2YU9H 1PH3A 2JA6H 3I4MG 2VQFQ 1WJJA 3U4VA 1VQAA 5HGQA 1YHBA 4JI2Q 2NVXH 4R4TA 4UP8A 4AYBG 5JEAG 5GQOA 2KENA 1GVPA 2YYZA 1XNQQ 1PH1A 1XNQL 1IZ6A 3J81c 4LF5L 1XTDA 4A3BG 2VW9A 3SGIA 1Q12A 4IJLA 2JEAI 4YHHL 1VQ6A 1B70B 4BXXG 4DR1Q 1QZHA 4DR1L 2ES2A 4LF8Q 1WFQA 5GROA 4LF8L 3NEMA 4O2DA 1VQMA 2K5NA 2MNAA 4AQYQ 4AQYL 4GLVB 2ZJRA 2ASBA 4LUZA 2JEBI 1SFOH 5M5YH 1U0LA 3U50C 2D0PA 3PO3H 2EXDA 1E7ZA 5GAEC 1AH9A 4H02A 1KC8C 1I94L 2OQKA 1VQFA 1YNXA 2VZAA 1VQ7A 2R7DA 3JC66 3DLLA 4DV0Q 5C4JH 3TRZA 4B3ML 2UU9Q 1E3PA 4OWTB 1IBMQ 2UU9L 2R7ZG 4DV7Q 4DV7L 1N36Q 2NN6I 1E24A 1I3QH 5C0XI 3H15A 1N36L 4OO1I 4PMWA 4A93G 4KHPQ 4KHPL 2F3IA 3K81C 4OONA 3UDGA 1M1KC 2K5HA 1QVFA 3PO2H 1YJWA 4MZ9A 4JBKA 4HIMA 1VQOA 1L2FA 3EN2A 4BY7H 5BR8L 3EIVA 4A3JH 1HR0W 3A5UA 4OWWB 4IFDI 3RLOA 1E1TA 3KF6B 1VQGA 1Q1BA 4X66Q 4X66L 1JMCA 1X3GA 2BH2A 2KHIA 3HOYH 4JBJA 5ELNA 2JA8H 1XPOA 1B8AA 2PNHA 2YV5A 1AE3A 4P72A 1M90C 4LF9L 1PYBA 1XNRL 2VQEQ 2VQEL 2WAQE 4AH6A 5M5XH 3PIOA 3M4QA 2I5MX 3TS0A 3HKSA 4A76A 1PH9A 3M85A 1PH8A 1KRTA 1VQNA 2ZTCA 3HOUH 2R6GA 2RHQB 1QUQA 4TVAB 4GKJQ 2YTVA 4GN4B 3RZOH 3GTPH 4GKJL 3BU2A 4DKAC 2Q2TA 3RN2A 3U58A 4Y7NH 1I50H 1YJ9A 2PI2E 1G6PA 3S24A 3G4SA 3EBEA 3UDIA 4A4IA 3RZDH 4JOIA 3G71A 4BBRG 1Q46A 4DUYQ 5JJIA 4PG3A 4DUYL 1JB7A 1OTCA 2AHOB 1VQ9A 2F52A 1Y1VH 1OXXK 4DV6Q 1Y1WG 4DV6L 1ASZA 5IWAL 4IPDA 3UDXA 1P8LA 2Z0SA 2Z6KA 1XPUA 4C3JH 1XJVA 2K5VA 3GTLH 3S16H 1SMXA 3H3VH 1X55A 2VS1A 2EQSA 2E2JH 1KHIA 2Y0SG 1LM0A 4HIOA 2I5LX 4BA1I 1IXRA 1TWCH 4R4QA 2UUBL 2E2HH 3M9BA 3E9IA 2UUBQ 1X56A 2OQ0A 3CP0A 1W3SA 3L7ZC 4A3IH 4OX9L 4DK3C 2ZTEA 4LF7Q 1IBLL 2RHSB 1JE5A 1WOCA 3MXNB 3AFPA 4JI5Q 2UXCL 3PUVA 4JI5L 1L0WA 5C4XG 1BBWA 1VQIA 1PH7A 4A3LH 4BXXH 2IHEA 3LGJA 2DUDA 2NN6G 3MEFA 4JI3L 3J81j 1J5EL 2Q2UA 4BA2I 1JT8A 2Q2IA 2AWOA 1V9PA 2WFWA 3AYHB 4QIWE 1HZBA 5IYBG 2MO0A 1PA6A 3S2HH 2OTJA 1YEZA 4KI0A 1X6OA 1QVCA 1WI5A 2L15A 3S1RH 2R92G 3I4OA 2E5LQ 1B7YB 2E5LL 1X3EA 1K73C 4BY7G 1CKMA 4BY1H 4BBSG 2EIFA 3CC7A 2R7ZH 3CCEA 1L1OC 1N9WA 2RF4A 1NJIC 3BJUA 4DV3Q 3F2BA 1TWGH 3RN5A 2B63H 3OW2A 3T1YQ 1PH5A 3D31A 1G51A 1V1QA 4A3KH 3CW2C 2KBNA 1N33L 1L1OA 3CC4A 4JV5L 3HOVG 4A3MH 2D62A 3KFUA 1X54A 3J81i 4JI4Q 2IX1A 4JI4L 1TWFH 5LMNQ 1J6QA 2BA0A 1U5KA 2C35B 2JA5G 4A3BH 3G48A 3PV0A 4KLKA 4C3HH 4RMFA 3HKZG 1VQ4A 1QUQB 1XMOQ 1XMOL 1TWHH 3TREA 3WWVA 3UDFA 2R93H 4OXPA 3A0JA 2HIVA 3GD7A 5M3FH 4GLXA 1XMQL 1EIYB 1KRSA 1K0RA 4YCUA 2NVYH 1ASYA 4LF5Q 3D0FA 4YHHQ 1PH2A 3W1BA 4A75A 4JCVE 4JI8L 2BH8A 1R9TH 4AIMA 2QEXA 5M3MH 1GD7A 2CCZA 2IHFA 4UY8C 4PZ7A 4WJ4A 4JI6L 4R4IA 1VCIA 4B3RQ 1HNZL 4B3RL 2E8GA 4DV4L 1IBKL 4BBRH 1JJCB 5IP7G 1I94Q 2IX0A 1H95A 3KJPA 2ZM6L 2JK8A 1FL0A 1K83H 1SR3A 1Y1WH 4B3MQ 5FJ8G 2A1AA 2N78A 4P75A 1X65A 2WP8J 3CF5A 1LYLA 5GADC 3AFQA 4LFAL 2OTLA 4QJFA 1VQBA 3KYHC 1LTLA 4JBWA 3GTJH 5E7NA 2CWPA 4YWMA 3RLNA 3H0GG 1FGUA 4X6AH 5BR8Q 3M4OH 3JAMc 2AWNA 3KOJA 1QVGA 3ICEA 5IYDG 2CFMA 4P74A 5M5WH 1P16A 3G6EA 4RG1A 3HOXH 4JBMA 5IP9G 4L5QA 1TXYA 5C4XH 2UUAL 1SROA 3HOWH 2CQOA 5GAGC 3E9HA 4UP7A 1S3OA 1JJ2A 4LF9Q 1XNRQ 4IJHA 1CUKA 4AYBE 1N32L 3HOZG 2OWOA 2FXQA 3CC2A 4X62Q 3PIPA 4X62L 1Q7YC 4A3GG 4DR4L 4DR4Q 3CCLA 3CCJA 1Z9FA 5FLMH 4B3SL 4LFBQ 4LFBL 1L1OB 1UEBA 4JOIC 4XIGS 4YCVA 3I2ZA 1Q8KA 5C3EG 5JJLA 4L5TA 3UE1A 1YHQA 1MIUA 2JA9A 4BBSH 4JC0A 4QL5A 4LUVA 5C44G 4A3EH 4J15A 2E2IH 2HT1A 3M7NA 1I5FA 1OXTA 3FKIG 2WB1G 2JA6G 3AEVA 3GO5A 1X3FA 3U4ZA 1WCMH 4WJ3M 1UE7A 1IYJB 2Z6KC 1EIFA 4R1JA 2CKZB 3OTOQ 5LMNW 3OTOL 1YJNA 2N49A 1CSQA 5IWAQ 3T1HQ 3T1HL 2ID0A 4C3IH 2HHHQ 2HHHL 4DR5L 4DR3Q 3RLFA 4DR3L 1PVOA 3K8AA 2A19A 4A3FH 1HNXL 3I4NH 3W1GA 3IRBA 3TEHB 2XGTA 4DV1Q 5GAHC 4DV1L 2UUCQ 2UUCL 1C7YA 3I4MH 1VQCA 4IPGA 2K14A 2CWAA 2R7FA 1X9NA 1HNWL 4OX9Q 1IBLQ 3RNUA 4LF6L 1HZAA 2UXCQ 1K8AC 1EWIA 1GKHA 4YY3L 4YY3Q 5K36G 1PHJA 1KXLA 1Q82C 1W2BA 3F1ZA 2NZHA 2I5HA 4JI3Q 1J5EQ 2NZOA 5IYCG 1A62A 1VQJA 1G291 1OXVA 1O7IA 1EFWA 1Q86C 4C2MH 4NXNL 1Q81C 2ZJQA 4L5SA 4NXNQ 1E1OA 2YTXA 1YIJA 1NBWA 5EAYA 4DR2L 4LF4Q 4LF4L 3CCSA 3PO2G 4UP9A 4QGUA 3S1MH 1EYGA 3I56A 3F2CA 3PSIA 3S15H 2D0OA 4JI0L 4A3JG 2JQOA 3PCOB 2ALYB 2A8VA 4IPHA 1BBUA 4IOAA 1NTGA 3ULPA 1EQRA 1PH4A 3HOYG 2UXBL 2JA8G 4DR7L 3AQQA 1VQLA 3W5OA 4A93H 1E22A 1EQQA 4GOPA 4HJ8A 2I0QA 2JA7G 4POFA 1N33Q 2KCMA 4IOCA 3STBD 4JV5Q 1RIPA 1SRUA 2YTYA 1VQDA 4HJ9A 1D8LA 4MNOA 1MJEA 3HOUG 1QZGA 3PGZA 3NBHB 2PQAA 5IT9c 2K4KA 3I7FA 1YVCA 1YZ6A 4GKKQ 1V43A 2Y0SE 3F8TA 4GNXA 1AE2A 1SE8A 4EQ5A 3PUZA 1XMQQ 4GKKL 4JYAQ 4JI1Q 4JYAL 4JI1L 2UXDL 5DLQE 2IT1A 3KJOA 1I6HH 3CAMA 4A3GH 1KAWA 3PF5A 1Y1VG 1EUJA 4JI8Q 1WYDA 2PMZE 1K9MC 2NVTH 3GDEA 4Y52H 2VUMG 1K3RA 4GN3B 5C3EH 3FHWA 4JI6Q 3J80i 4DV5Q 4DV5L 3L2PA 1HNZQ 5C0XJ 1CKNA 4DV4Q 1IBKQ 4DR6Q 4DR6L 3A74A 1JJGA 1SN8A 2H5XA 3CCMA 3K0XA 2VQFL 1MJCA 2N3SA 4JI2L 3ER0A 2ZM6Q 4A3IG 4B3TL 4ALPA 4B3TQ 1KD1C 2WAQG 3JAMi 4IO9A 2B3GA 1K8GA 4IFDJ 3J80c 5FLXc 5J3BA 2JE6I 1S72A 3KDFA 4A3LG 3OYYA 3ULJA 3GTQH 1EOVA 4LFAQ 1A0IA 4DV2Q 1UE6A 4DV2L 1FVIA 4EX5A 2NVQH 3GTGH 4PZ8A 3CD6A 2MO1A 1LUZA 3UE0A 4DAMA 4MTNA 3CPWA 2ZTDA 2IY5B 4YWKA 2Q2HA 4HJ7A 2B29A 4A3DG 1Y14B 1VQ8A 2MQHA 2N8NA 1VQPA 1VQ5A 1NMGA 2UUAQ 3HKZE 4DV0L 4BY1G 4TQUS 3J7ZC 4JI7L 1HH2P 4JI7Q 3CCVA 1IBML 3L0OA 4O0AA 5IYCH 1HZ9A 4GLAC 4DAYB 1N32Q 4HJAA 2B63G 2RCNA 3CPFA 5IYBH 2KCTA 2ZJPA 4GOPB 4A3KG 3KF8B 1VQHA 5JEAJ 4B3SQ 2V1CC 2MFIA 3PUXA 5ELOA 3TQYA 1FJGL 1FJGQ 4A3MG 3VDYA 2R92H 4LWCA 3NENA 1VQKA 5AJ3Q 5AJ3L 5HY6A 3CXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LFC Q;  4LFC L;  4A3C G;  2QGQ A;  2LXK A;  4OWX B;  1PFS A;  2PQA B;  3PUY A;  4GS3 A;  2R93 G;  1UE5 A;  2XTI A;  5M3F G;  3CCR A;  4GNX B;  3S17 H;  2JJQ A;  4UPA A;  2JA7 H;  3CCQ A;  2QA4 A;  1C0A A;  4P73 A;  4R4O A;  1KIX A;  2LSS A;  2AKW B;  4POG A;  3HOV H;  4KHZ A;  4DR5 Q;  4NXM L;  4NXM Q;  4YCW A;  2JA5 H;  4K0K Q;  1YHA A;  4XTC S;  5M3M G;  2VL6 A;  3GTK H;  4K0K L;  1HNX Q;  1PH6 A;  1UWV A;  3CME A;  3GTO H;  3H3V I;  3HFZ B;  3GTM H;  3S1Q H;  4PZ6 A;  1KL9 A;  3M4P A;  3M3Y H;  1HNW Q;  3DM3 A;  2F4V Q;  2F4V L;  1CKN B;  4JG2 A;  2K75 A;  3PO3 G;  1YBY A;  4LUO A;  3RR5 A;  4LF6 Q;  1IL2 A;  1RL2 A;  1A63 A;  1VQE A;  3S2D H;  2GVB A;  3A5Z B;  1N34 Q;  2OCE A;  1N34 L;  4IPC A;  1NE3 A;  5IY0 A;  2PI2 A;  4P71 A;  3K7A H;  2VY3 A;  3BZK A;  4QY7 A;  3CMA A;  2VUM H;  3CCU A;  2HQL A;  1Q1E A;  1YIT A;  1CKO A;  4HIK A;  3KDF B;  4APV A;  3TS2 A;  4DR2 Q;  2GVA A;  2VNU D;  4ME3 A;  4X65 Q;  1MKH A;  4X65 L;  5IP7 H;  4NB3 A;  1SLJ A;  1N8R C;  3ULL A;  1OXU A;  3KLW A;  4YWL A;  1VS0 A;  4JI0 Q;  5JJK A;  4DNI A;  1NY4 A;  4R4C A;  4GOP C;  4LF7 L;  5FJ8 H;  1GM5 A;  3ERS X;  3NEL A;  3HOX G;  4FDB A;  1D7Q A;  4HID A;  3HOW G;  1HZC A;  4DR7 Q;  2UXB Q;  3CQZ H;  1HR0 Q;  4HJ5 A;  1HR0 L;  2WB1 E;  5C0X G;  1CSP A;  3PF4 A;  4OO1 G;  2ATW A;  4LW1 A;  2GN5 A;  3PUW A;  1HJP A;  3H0G H;  3K80 C;  3BZC A;  1BKB A;  4GNX C;  4DK6 C;  1YI2 A;  5FLM G;  3KF6 A;  4LNQ A;  1BVS A;  5IYD H;  5IE8 A;  3S14 H;  3STB C;  4A3D H;  4IFD G;  1A8V A;  5IP9 H;  2HIX A;  1KQS A;  3FP9 A;  1Z47 A;  4DPG A;  4A3E G;  2AMC B;  1GO3 E;  5H1S E;  4DV3 L;  2K50 A;  1DGS A;  2UXD Q;  1TWA H;  3Q8D A;  1WCM G;  3HOZ H;  1PYS B;  1OXS C;  1NMF A;  3B6Y A;  3T1Y L;  3ZJY C;  4L5R C;  3F2D A;  1UE1 A;  1S40 A;  3E0E A;  4DUZ Q;  4DUZ L;  2LXJ A;  4NPS A;  4QQB X;  1PV4 A;  4X64 Q;  2K52 A;  1T9H A;  4X64 L;  5LMN L;  1C9O A;  5LMU Q;  2DGY A;  5LMU L;  4GN5 A;  2KHJ A;  5C44 H;  3I55 A;  3J7A 5;  3S1N H;  4A3C H;  4A3F G;  3I4N G;  3FKI H;  3K7U C;  1XPR A;  2BA1 A;  2YU9 H;  1PH3 A;  2JA6 H;  3I4M G;  2VQF Q;  1WJJ A;  3U4V A;  1VQA A;  5HGQ A;  1YHB A;  4JI2 Q;  2NVX H;  4R4T A;  4UP8 A;  4AYB G;  5JEA G;  5GQO A;  2KEN A;  1GVP A;  2YYZ A;  1XNQ Q;  1PH1 A;  1XNQ L;  1IZ6 A;  3J81 c;  4LF5 L;  1XTD A;  4A3B G;  2VW9 A;  3SGI A;  1Q12 A;  4IJL A;  2JEA I;  4YHH L;  1VQ6 A;  1B70 B;  4BXX G;  4DR1 Q;  1QZH A;  4DR1 L;  2ES2 A;  4LF8 Q;  1WFQ A;  5GRO A;  4LF8 L;  3NEM A;  4O2D A;  1VQM A;  2K5N A;  2MNA A;  4AQY Q;  4AQY L;  4GLV B;  2ZJR A;  2ASB A;  4LUZ A;  2JEB I;  1SFO H;  5M5Y H;  1U0L A;  3U50 C;  2D0P A;  3PO3 H;  2EXD A;  1E7Z A;  5GAE C;  1AH9 A;  4H02 A;  1KC8 C;  1I94 L;  2OQK A;  1VQF A;  1YNX A;  2VZA A;  1VQ7 A;  2R7D A;  3JC6 6;  3DLL A;  4DV0 Q;  5C4J H;  3TRZ A;  4B3M L;  2UU9 Q;  1E3P A;  4OWT B;  1IBM Q;  2UU9 L;  2R7Z G;  4DV7 Q;  4DV7 L;  1N36 Q;  2NN6 I;  1E24 A;  1I3Q H;  5C0X I;  3H15 A;  1N36 L;  4OO1 I;  4PMW A;  4A93 G;  4KHP Q;  4KHP L;  2F3I A;  3K81 C;  4OON A;  3UDG A;  1M1K C;  2K5H A;  1QVF A;  3PO2 H;  1YJW A;  4MZ9 A;  4JBK A;  4HIM A;  1VQO A;  1L2F A;  3EN2 A;  4BY7 H;  5BR8 L;  3EIV A;  4A3J H;  1HR0 W;  3A5U A;  4OWW B;  4IFD I;  3RLO A;  1E1T A;  3KF6 B;  1VQG A;  1Q1B A;  4X66 Q;  4X66 L;  1JMC A;  1X3G A;  2BH2 A;  2KHI A;  3HOY H;  4JBJ A;  5ELN A;  2JA8 H;  1XPO A;  1B8A A;  2PNH A;  2YV5 A;  1AE3 A;  4P72 A;  1M90 C;  4LF9 L;  1PYB A;  1XNR L;  2VQE Q;  2VQE L;  2WAQ E;  4AH6 A;  5M5X H;  3PIO A;  3M4Q A;  2I5M X;  3TS0 A;  3HKS A;  4A76 A;  1PH9 A;  3M85 A;  1PH8 A;  1KRT A;  1VQN A;  2ZTC A;  3HOU H;  2R6G A;  2RHQ B;  1QUQ A;  4TVA B;  4GKJ Q;  2YTV A;  4GN4 B;  3RZO H;  3GTP H;  4GKJ L;  3BU2 A;  4DKA C;  2Q2T A;  3RN2 A;  3U58 A;  4Y7N H;  1I50 H;  1YJ9 A;  2PI2 E;  1G6P A;  3S24 A;  3G4S A;  3EBE A;  3UDI A;  4A4I A;  3RZD H;  4JOI A;  3G71 A;  4BBR G;  1Q46 A;  4DUY Q;  5JJI A;  4PG3 A;  4DUY L;  1JB7 A;  1OTC A;  2AHO B;  1VQ9 A;  2F52 A;  1Y1V H;  1OXX K;  4DV6 Q;  1Y1W G;  4DV6 L;  1ASZ A;  5IWA L;  4IPD A;  3UDX A;  1P8L A;  2Z0S A;  2Z6K A;  1XPU A;  4C3J H;  1XJV A;  2K5V A;  3GTL H;  3S16 H;  1SMX A;  3H3V H;  1X55 A;  2VS1 A;  2EQS A;  2E2J H;  1KHI A;  2Y0S G;  1LM0 A;  4HIO A;  2I5L X;  4BA1 I;  1IXR A;  1TWC H;  4R4Q A;  2UUB L;  2E2H H;  3M9B A;  3E9I A;  2UUB Q;  1X56 A;  2OQ0 A;  3CP0 A;  1W3S A;  3L7Z C;  4A3I H;  4OX9 L;  4DK3 C;  2ZTE A;  4LF7 Q;  1IBL L;  2RHS B;  1JE5 A;  1WOC A;  3MXN B;  3AFP A;  4JI5 Q;  2UXC L;  3PUV A;  4JI5 L;  1L0W A;  5C4X G;  1BBW A;  1VQI A;  1PH7 A;  4A3L H;  4BXX H;  2IHE A;  3LGJ A;  2DUD A;  2NN6 G;  3MEF A;  4JI3 L;  3J81 j;  1J5E L;  2Q2U A;  4BA2 I;  1JT8 A;  2Q2I A;  2AWO A;  1V9P A;  2WFW A;  3AYH B;  4QIW E;  1HZB A;  5IYB G;  2MO0 A;  1PA6 A;  3S2H H;  2OTJ A;  1YEZ A;  4KI0 A;  1X6O A;  1QVC A;  1WI5 A;  2L15 A;  3S1R H;  2R92 G;  3I4O A;  2E5L Q;  1B7Y B;  2E5L L;  1X3E A;  1K73 C;  4BY7 G;  1CKM A;  4BY1 H;  4BBS G;  2EIF A;  3CC7 A;  2R7Z H;  3CCE A;  1L1O C;  1N9W A;  2RF4 A;  1NJI C;  3BJU A;  4DV3 Q;  3F2B A;  1TWG H;  3RN5 A;  2B63 H;  3OW2 A;  3T1Y Q;  1PH5 A;  3D31 A;  1G51 A;  1V1Q A;  4A3K H;  3CW2 C;  2KBN A;  1N33 L;  1L1O A;  3CC4 A;  4JV5 L;  3HOV G;  4A3M H;  2D62 A;  3KFU A;  1X54 A;  3J81 i;  4JI4 Q;  2IX1 A;  4JI4 L;  1TWF H;  5LMN Q;  1J6Q A;  2BA0 A;  1U5K A;  2C35 B;  2JA5 G;  4A3B H;  3G48 A;  3PV0 A;  4KLK A;  4C3H H;  4RMF A;  3HKZ G;  1VQ4 A;  1QUQ B;  1XMO Q;  1XMO L;  1TWH H;  3TRE A;  3WWV A;  3UDF A;  2R93 H;  4OXP A;  3A0J A;  2HIV A;  3GD7 A;  5M3F H;  4GLX A;  1XMQ L;  1EIY B;  1KRS A;  1K0R A;  4YCU A;  2NVY H;  1ASY A;  4LF5 Q;  3D0F A;  4YHH Q;  1PH2 A;  3W1B A;  4A75 A;  4JCV E;  4JI8 L;  2BH8 A;  1R9T H;  4AIM A;  2QEX A;  5M3M H;  1GD7 A;  2CCZ A;  2IHF A;  4UY8 C;  4PZ7 A;  4WJ4 A;  4JI6 L;  4R4I A;  1VCI A;  4B3R Q;  1HNZ L;  4B3R L;  2E8G A;  4DV4 L;  1IBK L;  4BBR H;  1JJC B;  5IP7 G;  1I94 Q;  2IX0 A;  1H95 A;  3KJP A;  2ZM6 L;  2JK8 A;  1FL0 A;  1K83 H;  1SR3 A;  1Y1W H;  4B3M Q;  5FJ8 G;  2A1A A;  2N78 A;  4P75 A;  1X65 A;  2WP8 J;  3CF5 A;  1LYL A;  5GAD C;  3AFQ A;  4LFA L;  2OTL A;  4QJF A;  1VQB A;  3KYH C;  1LTL A;  4JBW A;  3GTJ H;  5E7N A;  2CWP A;  4YWM A;  3RLN A;  3H0G G;  1FGU A;  4X6A H;  5BR8 Q;  3M4O H;  3JAM c;  2AWN A;  3KOJ A;  1QVG A;  3ICE A;  5IYD G;  2CFM A;  4P74 A;  5M5W H;  1P16 A;  3G6E A;  4RG1 A;  3HOX H;  4JBM A;  5IP9 G;  4L5Q A;  1TXY A;  5C4X H;  2UUA L;  1SRO A;  3HOW H;  2CQO A;  5GAG C;  3E9H A;  4UP7 A;  1S3O A;  1JJ2 A;  4LF9 Q;  1XNR Q;  4IJH A;  1CUK A;  4AYB E;  1N32 L;  3HOZ G;  2OWO A;  2FXQ A;  3CC2 A;  4X62 Q;  3PIP A;  4X62 L;  1Q7Y C;  4A3G G;  4DR4 L;  4DR4 Q;  3CCL A;  3CCJ A;  1Z9F A;  5FLM H;  4B3S L;  4LFB Q;  4LFB L;  1L1O B;  1UEB A;  4JOI C;  4XIG S;  4YCV A;  3I2Z A;  1Q8K A;  5C3E G;  5JJL A;  4L5T A;  3UE1 A;  1YHQ A;  1MIU A;  2JA9 A;  4BBS H;  4JC0 A;  4QL5 A;  4LUV A;  5C44 G;  4A3E H;  4J15 A;  2E2I H;  2HT1 A;  3M7N A;  1I5F A;  1OXT A;  3FKI G;  2WB1 G;  2JA6 G;  3AEV A;  3GO5 A;  1X3F A;  3U4Z A;  1WCM H;  4WJ3 M;  1UE7 A;  1IYJ B;  2Z6K C;  1EIF A;  4R1J A;  2CKZ B;  3OTO Q;  5LMN W;  3OTO L;  1YJN A;  2N49 A;  1CSQ A;  5IWA Q;  3T1H Q;  3T1H L;  2ID0 A;  4C3I H;  2HHH Q;  2HHH L;  4DR5 L;  4DR3 Q;  3RLF A;  4DR3 L;  1PVO A;  3K8A A;  2A19 A;  4A3F H;  1HNX L;  3I4N H;  3W1G A;  3IRB A;  3TEH B;  2XGT A;  4DV1 Q;  5GAH C;  4DV1 L;  2UUC Q;  2UUC L;  1C7Y A;  3I4M H;  1VQC A;  4IPG A;  2K14 A;  2CWA A;  2R7F A;  1X9N A;  1HNW L;  4OX9 Q;  1IBL Q;  3RNU A;  4LF6 L;  1HZA A;  2UXC Q;  1K8A C;  1EWI A;  1GKH A;  4YY3 L;  4YY3 Q;  5K36 G;  1PHJ A;  1KXL A;  1Q82 C;  1W2B A;  3F1Z A;  2NZH A;  2I5H A;  4JI3 Q;  1J5E Q;  2NZO A;  5IYC G;  1A62 A;  1VQJ A;  1G29 1;  1OXV A;  1O7I A;  1EFW A;  1Q86 C;  4C2M H;  4NXN L;  1Q81 C;  2ZJQ A;  4L5S A;  4NXN Q;  1E1O A;  2YTX A;  1YIJ A;  1NBW A;  5EAY A;  4DR2 L;  4LF4 Q;  4LF4 L;  3CCS A;  3PO2 G;  4UP9 A;  4QGU A;  3S1M H;  1EYG A;  3I56 A;  3F2C A;  3PSI A;  3S15 H;  2D0O A;  4JI0 L;  4A3J G;  2JQO A;  3PCO B;  2ALY B;  2A8V A;  4IPH A;  1BBU A;  4IOA A;  1NTG A;  3ULP A;  1EQR A;  1PH4 A;  3HOY G;  2UXB L;  2JA8 G;  4DR7 L;  3AQQ A;  1VQL A;  3W5O A;  4A93 H;  1E22 A;  1EQQ A;  4GOP A;  4HJ8 A;  2I0Q A;  2JA7 G;  4POF A;  1N33 Q;  2KCM A;  4IOC A;  3STB D;  4JV5 Q;  1RIP A;  1SRU A;  2YTY A;  1VQD A;  4HJ9 A;  1D8L A;  4MNO A;  1MJE A;  3HOU G;  1QZG A;  3PGZ A;  3NBH B;  2PQA A;  5IT9 c;  2K4K A;  3I7F A;  1YVC A;  1YZ6 A;  4GKK Q;  1V43 A;  2Y0S E;  3F8T A;  4GNX A;  1AE2 A;  1SE8 A;  4EQ5 A;  3PUZ A;  1XMQ Q;  4GKK L;  4JYA Q;  4JI1 Q;  4JYA L;  4JI1 L;  2UXD L;  5DLQ E;  2IT1 A;  3KJO A;  1I6H H;  3CAM A;  4A3G H;  1KAW A;  3PF5 A;  1Y1V G;  1EUJ A;  4JI8 Q;  1WYD A;  2PMZ E;  1K9M C;  2NVT H;  3GDE A;  4Y52 H;  2VUM G;  1K3R A;  4GN3 B;  5C3E H;  3FHW A;  4JI6 Q;  3J80 i;  4DV5 Q;  4DV5 L;  3L2P A;  1HNZ Q;  5C0X J;  1CKN A;  4DV4 Q;  1IBK Q;  4DR6 Q;  4DR6 L;  3A74 A;  1JJG A;  1SN8 A;  2H5X A;  3CCM A;  3K0X A;  2VQF L;  1MJC A;  2N3S A;  4JI2 L;  3ER0 A;  2ZM6 Q;  4A3I G;  4B3T L;  4ALP A;  4B3T Q;  1KD1 C;  2WAQ G;  3JAM i;  4IO9 A;  2B3G A;  1K8G A;  4IFD J;  3J80 c;  5FLX c;  5J3B A;  2JE6 I;  1S72 A;  3KDF A;  4A3L G;  3OYY A;  3ULJ A;  3GTQ H;  1EOV A;  4LFA Q;  1A0I A;  4DV2 Q;  1UE6 A;  4DV2 L;  1FVI A;  4EX5 A;  2NVQ H;  3GTG H;  4PZ8 A;  3CD6 A;  2MO1 A;  1LUZ A;  3UE0 A;  4DAM A;  4MTN A;  3CPW A;  2ZTD A;  2IY5 B;  4YWK A;  2Q2H A;  4HJ7 A;  2B29 A;  4A3D G;  1Y14 B;  1VQ8 A;  2MQH A;  2N8N A;  1VQP A;  1VQ5 A;  1NMG A;  2UUA Q;  3HKZ E;  4DV0 L;  4BY1 G;  4TQU S;  3J7Z C;  4JI7 L;  1HH2 P;  4JI7 Q;  3CCV A;  1IBM L;  3L0O A;  4O0A A;  5IYC H;  1HZ9 A;  4GLA C;  4DAY B;  1N32 Q;  4HJA A;  2B63 G;  2RCN A;  3CPF A;  5IYB H;  2KCT A;  2ZJP A;  4GOP B;  4A3K G;  3KF8 B;  1VQH A;  5JEA J;  4B3S Q;  2V1C C;  2MFI A;  3PUX A;  5ELO A;  3TQY A;  1FJG L;  1FJG Q;  4A3M G;  3VDY A;  2R92 H;  4LWC A;  3NEN A;  1VQK A;  5AJ3 Q;  5AJ3 L;  5HY6 A;  3CXC A; 
#chains in the Genus database with same CATH topology
 4DR3 H;  3VR2 A;  2DNE A;  4A3C G;  1RKN A;  2R7M A;  4L6T B;  4KY7 A;  2R93 G;  1UE5 A;  5IGC A;  3CCR A;  4GNX B;  2UUC H;  2JJQ A;  4UPA A;  5KFE A;  2QA4 A;  4P73 A;  1BF4 A;  4ZK9 B;  4DR5 Q;  1HUN A;  5KT2 A;  2JN4 A;  1VBG A;  1F9S A;  4RUA A;  1X32 A;  4G57 A;  2IPK D;  2VL6 A;  1HNX Q;  3AU7 A;  1PH6 A;  3GTO H;  2DPI A;  2WAQ A;  5KYL A;  3GTM H;  1XYI A;  2E74 C;  1CKN B;  4QUC A;  3VR4 A;  2FPG B;  3PO3 G;  1YBY A;  2YS6 A;  1D5M C;  4LF4 H;  2E2D C;  3J80 L;  1STN A;  1TS4 A;  5FLX L;  1A63 A;  2DY7 A;  2MUY A;  3NQT A;  4IPC A;  1NE3 A;  4RHR A;  2PI2 A;  4DN4 M;  4TQS A;  3BZK A;  4C1N K;  3KDF B;  3TS2 A;  1BNC A;  3VPD A;  4DR2 Q;  2GVA A;  5ELD A;  3MHB A;  2FKL A;  3L4J A;  2B2Y C;  5I2X A;  1OXU A;  4IRC A;  2HVQ A;  2FMC A;  4JI0 Q;  4YR3 A;  5DG9 A;  3PR4 A;  4DNI A;  4LJZ C;  3MXG A;  4R4C A;  1Q3L A;  4CKE A;  2KHS A;  1CQI B;  3TME A;  1GM5 A;  2RCF A;  3ERS X;  1TWA A;  3HOX G;  2F0I A;  3GIJ A;  1D7Q A;  2UXB Q;  2A6E D;  3MVV A;  3HOW G;  4DR7 Q;  3CQZ H;  4IR9 A;  5C0X G;  1UEA B;  5LL6 X;  2ATW A;  3D4D A;  4HMJ A;  3PUW A;  1B3Q A;  2ZT9 C;  1WSC A;  1GUO A;  3K80 C;  3GTK B;  3BZC A;  1T3N A;  4OL7 A;  3HKZ B;  4DK6 C;  3FKI A;  2M9V A;  3KF6 A;  2OXP A;  3EVQ A;  3X3M A;  3S14 H;  3S1Q B;  4A3D H;  3M3Y B;  3RBD A;  1A8V A;  5IP9 H;  4R8U A;  4LK1 C;  4JVZ A;  2AMC B;  4TV8 F;  2FB9 A;  4DV3 L;  1DGS A;  2UXD Q;  3Q8D A;  1WCM G;  1KAA A;  3ZJY C;  4L5R C;  2L0C A;  4HSP A;  2ZM6 H;  1JOK A;  4KHV A;  4QQB X;  3Q6S A;  3HBL A;  4Y8V B;  4BS9 A;  2K52 A;  1T9H A;  1TQO A;  5LMU Q;  3N40 P;  5LMU L;  4GN5 A;  1KJJ A;  3BVM A;  3S1N H;  4LFA H;  1K83 A;  2WAQ B;  2VQF Q;  1WJJ A;  4R4T A;  2KEN A;  2YYZ A;  1I3Q A;  3A8J E;  4H0L C;  4OIJ A;  4LF5 L;  2B2W C;  1F9P A;  1Q12 A;  1SYD A;  4IJL A;  4J9P A;  3Q22 A;  4DR1 Q;  2ES2 A;  4DR1 L;  1WTO A;  1EIH A;  2NU8 B;  2UUA H;  1VQM A;  3WNZ A;  1K28 A;  1ZEQ X;  2EXZ A;  4RAU C;  2ASB A;  5I47 A;  5JQW A;  1U0L A;  2IWH A;  1EZ1 A;  2VB2 X;  2EXD A;  3MXN A;  3RV4 A;  1VMC A;  4B3S H;  4KD4 A;  2IA6 A;  1VQF A;  4DV0 Q;  1XX8 A;  3NXW A;  3JAM W;  4B3M L;  1ROD A;  1Y69 U;  3KTM A;  1TWA B;  3URY A;  4A2B A;  1A15 A;  3RD4 A;  4LFC H;  3K3V A;  4QMG A;  2NN6 I;  1NCV A;  2X69 A;  1RHP A;  2JXM B;  4PMW A;  4A93 G;  4I7H A;  2F3I A;  2XIW A;  4MN3 A;  3R93 A;  2K5H A;  1QVF A;  3PO2 H;  4A3B B;  3OWF A;  1VQO A;  3ORR A;  5CMD A;  5BN5 A;  4MIU A;  3FKI B;  2ASL A;  3KF6 B;  3Q1K A;  4QWA A;  5EPK A;  4KN4 C;  1WCM A;  2RGV A;  3QOJ A;  1UC9 A;  3TN2 A;  1Y1V A;  1KLG D;  4JBJ A;  1K8M A;  3ND9 A;  4R8U B;  3A8I E;  1B8A A;  3A8K E;  3QO2 A;  5E1F A;  4DV1 H;  1M90 C;  2KUM A;  4P72 A;  3LWE A;  3DMU A;  1PYB A;  1QOH A;  3BQ2 A;  3GTL A;  2WAQ E;  3PIO A;  5JJK A;  1CHP D;  2YZN A;  4A76 A;  1KRT A;  1VQN A;  5FPR A;  2ZTC A;  4DAP A;  1BCP D;  4HTH A;  4GN4 B;  4MHE A;  3GTP H;  4ED8 A;  2RQX A;  4IUT A;  3PO3 B;  3U58 A;  3OWE B;  2PI2 E;  1G6P A;  3S24 A;  1H9R A;  3EBE A;  3UDI A;  1BCP C;  4BBR G;  4DUY Q;  1LT3 D;  4DUY L;  5JJI A;  4U7C A;  1LT5 D;  1K83 B;  2LKV A;  2AHO B;  1CS0 A;  3LNN A;  1M7J A;  4O4H F;  1I3Q B;  2FJ2 A;  4IPD A;  3KAK A;  3U9S A;  2Z0S A;  1D1K A;  2O5J C;  2Z6K A;  5DGB A;  4C3J H;  2K5V A;  2EDG A;  3S16 H;  1SMX A;  3H3V H;  1X55 A;  2EQS A;  2E2J H;  4A3J B;  3E6Z X;  4R4Q A;  3N6X A;  2E2H H;  4K5W A;  4I65 A;  4XQJ A;  3L7Z C;  4QUF A;  3MXN B;  1JE5 A;  3GV7 B;  1BUV T;  3AFP A;  1F9R A;  1WTX A;  2UXC L;  2ATL A;  3ERO A;  2SOB A;  1PH7 A;  3RF2 A;  2PZU A;  2CW7 A;  2Q2U A;  4DLK A;  4ILW A;  2Q2I A;  1O78 A;  2CW8 A;  1V9P A;  4EG0 A;  1PA6 A;  4QIW E;  2A69 D;  2MO0 A;  4JYA H;  2ZDQ A;  1QVC A;  3KLR A;  5J1Z A;  3S1R H;  2R92 G;  5KG5 A;  1FNU A;  1CK1 A;  2E5L Q;  3RZD B;  2E5L L;  2A69 C;  2RBM A;  5I9O A;  4F4X A;  2XC9 A;  3T4A C;  5KKN B;  4G7Z C;  1WCM B;  1L1O C;  1N9W A;  1NJI C;  1Y1V B;  3CVZ A;  1R9T A;  1SNC A;  1AZP A;  3E3X A;  4J0M A;  3M9O B;  1PH5 A;  3BZD B;  3CW2 C;  2KBN A;  4ZRZ A;  1L1O A;  2D9U A;  2LMC B;  4JV5 L;  4A3M H;  3GTL B;  1C3O A;  1X54 A;  2Z1C A;  3J81 i;  1T36 A;  4RGT A;  1DIK A;  1TWF H;  4A3B H;  2JA5 G;  3RIZ A;  4KLK A;  5IOC A;  5KFP A;  4HQ6 A;  1VQ4 A;  2PCF B;  1C48 A;  3TRE A;  3WWV A;  4B9X A;  1JKJ B;  2W8L A;  2R93 H;  4HSV A;  4OXP A;  1XMQ L;  5IOD A;  3TP5 A;  3M4I A;  3NTI A;  1DZ1 A;  4XQQ A;  4YCU A;  4WRD A;  1ASY A;  3TP7 A;  4FVM A;  2WTF A;  4DL4 A;  1WR2 A;  4JCV E;  4JI8 L;  2BH8 A;  3WOE A;  1BCP B;  3QJY A;  4IQZ A;  3HZX A;  3F2U A;  2VR1 A;  4RUC A;  2IHF A;  3S2H B;  1N48 A;  2UU9 H;  4WJ4 A;  4JI6 L;  4DV7 H;  4LMY A;  4R4I A;  4I7Z C;  2Q8R E;  3DM1 A;  1IBK L;  5IP7 G;  3J80 E;  5FLX E;  5J2U F;  5KYI A;  2DIK A;  1RK6 A;  3D3R A;  1D5Z C;  2IX0 A;  1TT2 A;  1H95 A;  4EEY A;  1AZQ A;  3GLK A;  5EOY A;  1K83 H;  5FJ8 G;  4FF1 A;  1EEI D;  2A1A A;  4A93 B;  4F87 A;  2R7L A;  2M2L A;  3CF5 A;  5KG0 A;  5KND A;  5GAD C;  2R92 A;  4BWG B;  2K5Q A;  5KEE A;  1BJT A;  1LTL A;  3GTJ H;  4QB4 A;  3PIP 3;  2VQE H;  1FGU A;  5BR8 Q;  4V19 0;  2AUK A;  1AUX A;  3KOJ A;  1TWH B;  4FO2 A;  3ICE A;  3K59 A;  2K33 A;  3KLS X;  1P16 A;  3M9M B;  1HA5 A;  4RG1 A;  3HOX H;  4Q8E A;  5DLG A;  3HOW H;  1PYW D;  1SRO A;  4RKB A;  3VYS A;  5C0X H;  4CJ2 C;  1T5X D;  2EJF C;  5JPN C;  1ZQ7 A;  1CUK A;  2AGO A;  1N32 L;  1ZET A;  1R9T B;  3HOZ G;  4DR4 Q;  4X3K A;  4DR4 L;  3CCL A;  1Z9F A;  4N8F A;  1L1O B;  3NBH A;  2TSS A;  4XIG S;  1GSO A;  1JIC A;  3I2Z A;  5C3E G;  3V4Z A;  1MIU A;  2PYK A;  4BBR B;  3K5N A;  4BBS H;  4YR2 A;  5C44 G;  2HT1 A;  4LUV A;  1I6V C;  2DWC A;  3BVZ A;  1KAB A;  3J81 L;  4NDX A;  2JA6 G;  1B04 A;  1X3F A;  1WCM H;  4XDX A;  5LMN W;  4R1J A;  3OTO Q;  3NP8 A;  3OTO L;  1JDB B;  3MWD A;  2YS7 A;  2G9H D;  5JAV A;  4L63 B;  4DR3 Q;  1MSH A;  4DR3 L;  1T94 A;  1PFN A;  4H44 C;  3RBE A;  4DXG A;  2KOL A;  1A2T A;  2W6Z A;  4RWS C;  3IN5 A;  2EPB A;  3PW5 A;  4Q0Y A;  2UUC Q;  2IW3 A;  1XWE A;  2UUC L;  5CR3 A;  2K14 A;  1HNW L;  5M5W B;  3R3O A;  1TU2 B;  3T5L A;  5I2Y A;  4LF6 L;  1HZA A;  1K8A C;  1KXL A;  4F88 A;  1W2B A;  1JQY D;  3F1Z A;  3DEO A;  1RJR A;  1CI3 M;  4O42 A;  3GIK A;  1EFW A;  1G29 1;  1OXV A;  2W9C A;  2HQE A;  2V4D A;  4DV3 H;  1ZYR D;  5EAY A;  4LF4 Q;  4ED3 A;  4LF4 L;  2R92 B;  4ODG A;  3GV3 A;  5C5L A;  4UP9 A;  3V05 A;  3PSI A;  1S03 G;  1TY0 A;  4H13 C;  1I4Q A;  1ZYR C;  1C4Q A;  3Q8R B;  4ZQ3 A;  2UVW A;  4HN7 A;  5LMU H;  1PH4 A;  2JA8 G;  1C8C A;  1YNN C;  4TSS A;  2CZG A;  4A93 H;  1E22 A;  5I9P A;  1EQQ A;  2N55 A;  1EY5 A;  4L1K A;  2KCM A;  4ETS A;  2MHV A;  1SRU A;  1SNP A;  2PW5 A;  4LF5 H;  5T1I A;  1D8L A;  1PFB A;  1DON A;  4JV0 A;  4EQN A;  1MJE A;  2JA6 A;  1HCZ A;  4G4K A;  1O75 A;  2VA2 A;  2PW7 A;  3NBH B;  5JVL A;  2NVX A;  5IT9 c;  2K4K A;  3KAJ A;  1AN8 A;  3I7F A;  4R8N A;  1LTT D;  1I4P A;  5KG7 A;  3K0Y A;  4IR1 A;  1FNV A;  1PZJ D;  2KCN A;  4JI1 L;  4JI1 Q;  4N9P A;  1JOQ A;  5DQI A;  1I6H H;  5ISR A;  2YRW A;  3GIP A;  1ET9 A;  2J7Z A;  4TRD A;  3KAL A;  4Y52 H;  4B3M H;  4K14 A;  4O2A F;  4PQX A;  1G2T A;  3L2P A;  1STH A;  4F8M A;  5C0X J;  1AFP A;  2H5X A;  1BGW A;  3CCM A;  4QW9 A;  3PN1 A;  5LL6 S;  4JI2 L;  2ZM6 Q;  2PO4 A;  4J9K A;  1NNX A;  2F0H A;  3BG5 A;  3HGB A;  5J3B A;  3NTK A;  1DOM A;  1WVL A;  1DJR D;  2UVR A;  3OYY A;  4X3S A;  3GTQ H;  2B2T C;  2J9G A;  4LFA Q;  2NU6 B;  1UE6 A;  4ECW A;  3SEB A;  2W9C B;  2NVQ H;  3GTG H;  1LUZ A;  4K2K A;  4DAM A;  2B2T A;  2C2D A;  4YWK A;  3K6O A;  3MR3 A;  2Q2H A;  4HJ7 A;  2CH4 A;  4A3D G;  1VQ8 A;  3EA6 A;  4LFB H;  2UUA Q;  2CQA A;  1SE4 A;  4K6L A;  2V4R A;  5DM6 3;  4EFE A;  2GA4 B;  3CCV A;  1IBM L;  3T13 A;  3HOZ B;  4GLA C;  4UDU C;  5KFD A;  1B2T A;  3Q2O A;  2C2E A;  1IYV A;  4UCS A;  4M8A A;  2EYP A;  4QF4 A;  4DUY H;  4K5X A;  3MXU A;  5A35 A;  5C3E B;  4EFB A;  1VQH A;  3H6M A;  4B3S Q;  3EPI A;  1E2W A;  3FEW X;  3GTM A;  2R92 H;  1B6R A;  5D1P A;  5C44 B;  4LWC A;  5AJ3 Q;  5AJ3 L;  1VBH A;  1BDO A;  2AQ3 B;  4LFC Q;  4LFC L;  2JA6 B;  1TAE A;  1TR5 A;  2F0O A;  1HHV A;  2Q8I B;  5EWE A;  4KTA A;  2XTI A;  5M3F G;  2JA7 H;  1DCZ A;  2NZ1 D;  2O03 A;  5KG6 A;  1GUG A;  2XRQ D;  4R4O A;  5ELC A;  4POG A;  4G7O C;  1UC8 A;  4KHZ A;  3R5H A;  4CJ1 B;  2LY7 A;  2WKD A;  2UXC H;  2JA5 H;  5HBR B;  4LSX A;  5M3M G;  3MFG A;  1K8O A;  3S9W A;  1UWV A;  1EQT A;  2J4X A;  3HP3 A;  3C1F A;  2R8G A;  2HCC A;  1EU4 A;  3X3N A;  4M9U A;  2XCL A;  5DLF A;  4JG2 A;  2K75 A;  4LUO A;  4PMB A;  2AU0 A;  5C4J B;  4HNT A;  1VQE A;  3S2D H;  2OCE A;  4IZO A;  3BS1 A;  5IY0 A;  3BG3 A;  5KG1 A;  2R87 A;  4P71 A;  3OMG A;  2VY3 A;  1CQF A;  4DL3 A;  5BMV F;  3VYT A;  4APV A;  1MKH A;  5IP7 H;  4NB3 A;  1Z2O X;  1IHZ A;  3KLW A;  4JV5 H;  1VS0 A;  2FIN B;  4ED7 A;  1EZ6 A;  4GOP C;  4LF7 L;  4RNO A;  2V4Q A;  5FJ8 H;  1TWG A;  5KFM A;  2SCU B;  1A3U A;  3TZU A;  3H4D A;  4F4W A;  4RHS A;  4ECT A;  2AGQ A;  1XMQ H;  5IGE A;  2F0K A;  4OO1 G;  1LV9 A;  1H9K A;  2GN5 A;  4S3S A;  1HJP A;  4ZKC B;  1DOK A;  4GNX C;  1YI2 A;  4ME5 A;  3RUZ A;  4J9Q A;  3GTM B;  3PVX A;  4O3N A;  4JI8 H;  1KQS A;  4JK1 C;  3FP9 A;  2M05 A;  2NVY A;  1MSG A;  4JI6 H;  3N41 B;  4DV5 H;  4A3E G;  5KRU A;  1GO3 E;  3MTS A;  5H1S E;  3NQI A;  1IBK H;  2R8J A;  3HOZ H;  2P5Z X;  1QE6 A;  5M9O A;  3JZI A;  2F0D A;  4J8Q A;  3IFD A;  3P7J A;  5EKK A;  1GGO A;  4YB8 B;  4JUZ A;  1S40 A;  4B3T H;  4QCL A;  5L37 A;  2LXJ A;  4NPS A;  5D65 A;  1FYC A;  1PV4 A;  1VDZ A;  1C9O A;  4ABN A;  4C3J G;  1PMR A;  4IUP A;  5C44 H;  3I55 A;  3TP8 A;  4A3F G;  1XPR A;  3C0F B;  2JA6 H;  2KA7 A;  3TIG A;  5HGQ A;  1M0T A;  1PZI D;  2NVX H;  1CFM A;  4AYB G;  5JEA G;  1GJX A;  4C5C A;  4U68 A;  3J81 c;  2B8G A;  2VW9 A;  3SGI A;  1EUD B;  2JEA I;  1SE3 A;  2R7N A;  1VQ6 A;  5C3X A;  1KTK A;  1QZH A;  3Q24 A;  2W71 A;  5GRO A;  1D6E C;  1EIG A;  1O7Z A;  2MNA A;  3VPC A;  2G5D A;  2W6Q A;  5KFV A;  3J80 W;  2OLS A;  1GSA A;  3QG1 A;  5M5Y H;  3S14 B;  3DWP A;  4A3D B;  1N32 H;  1B9N A;  2R7K A;  3BDL A;  5GAE C;  4C56 C;  2ZXO A;  2R6F A;  3V6K A;  4JV2 A;  5EWF A;  3F8N A;  1VQ7 A;  2R7D A;  4MA0 A;  3DLL A;  5C4J H;  2UU9 Q;  2UU9 L;  4YP3 A;  1LTI D;  1TWG B;  1EY4 A;  2NBF A;  3AB9 A;  4DV7 Q;  4DV7 L;  1KJQ A;  3H15 A;  4ED0 A;  3VR3 A;  1HQR D;  3K81 C;  3GTP A;  1RJP A;  3FDS A;  3PIO 3;  1E2V A;  4JBK A;  3OTO H;  3EIV A;  3S1N B;  3MFI A;  1EY8 A;  4IFD I;  3NBI A;  3RLO A;  3BQ1 A;  1F2L A;  1Q1B A;  1VF5 C;  1JMC A;  4GZY C;  2L5T A;  2JA8 H;  3RMH A;  3H3V C;  2YV5 A;  3LP8 A;  1HNW H;  3G7L A;  1XNR L;  5CV5 A;  2VQE Q;  2VQE L;  3P1H A;  4I55 F;  4LAA A;  4AH6 A;  3M4Q A;  4LF6 H;  2VPQ A;  2IJ0 A;  1RD9 D;  4R9W A;  2E2H A;  2R6G A;  2YTV A;  4EEQ A;  4B9W A;  1EOT A;  4FU0 A;  3ZYY X;  1I50 H;  1YJ9 A;  1PFM A;  3H20 A;  4NMZ A;  5NUC A;  4PG3 A;  1OTC A;  4TUY F;  2NUA B;  1VQ9 A;  2F52 A;  4DK0 A;  4RZQ A;  1OXX K;  4DV6 Q;  4DV6 L;  3PW0 A;  3UDX A;  4O4I F;  3OHX C;  4EYH B;  3DXJ C;  5KT4 A;  4J6H A;  1XPU A;  3PO2 B;  2KSW A;  2VS1 A;  1SJH D;  1HR0 H;  2KEE A;  4RNN A;  2CVR A;  2I5L X;  1IXR A;  2UUB Q;  2UUB L;  3HEJ A;  3M9B A;  2K1B A;  1MBY A;  4DK3 C;  2ZTE A;  1IYU A;  1IBL L;  5FO8 B;  4JI5 Q;  4JI5 L;  1L0W A;  3BYT B;  4DA2 A;  4CDE C;  4O3O A;  2IX3 A;  4BXX H;  1U9R A;  4XX0 B;  2IHE A;  2DN8 A;  2DUD A;  4JI3 L;  4BA2 I;  1V4Y A;  3M7G A;  1TWF A;  1PXU A;  1TKW B;  2VQD A;  2ZJT A;  2A6E C;  4ECU A;  2OTJ A;  4JI1 H;  1ILQ A;  2QK4 A;  3K5M A;  3GTP B;  1STB A;  2R93 A;  3NTH A;  5CV9 A;  4FS1 A;  3I4O A;  4A3E B;  4QWC A;  1K73 C;  4QIW A;  2HDL A;  4BY7 G;  4HNV A;  1I4H A;  2EIF A;  4BBS G;  4X64 H;  3KHL A;  3CCE A;  4DAY A;  2RF4 A;  1GYF A;  4DV3 Q;  3KBX A;  2IP4 A;  5IT9 W;  3F2B A;  1TWG H;  5C8Y F;  4O2B F;  1DOL A;  4ZQI A;  1KJI A;  4JI2 H;  2A74 C;  3CC4 A;  2K04 A;  3HOV G;  4C3J B;  3KFU A;  3S16 B;  2IX1 A;  2AUJ D;  2E2J B;  5ELB A;  1J6Q A;  1EYD A;  1LAC A;  1PTO D;  3G6J B;  3PV0 A;  2E2H B;  4LF8 H;  3BYY B;  1XMO Q;  1XMO L;  2RVL A;  4R8I A;  4IWY A;  4U6P A;  5KFN A;  3UDF A;  3G6Y A;  3A0J A;  2HIV A;  1O80 A;  2B8F A;  3GD7 A;  5M3F H;  4AQY H;  4EGV A;  3MR5 A;  1KRS A;  3J7Y W;  2JEF A;  2NVY H;  5EJW A;  4LF5 Q;  2P0A A;  3T53 B;  3DEP A;  5L1J A;  1IOW A;  3I8Z A;  1PH2 A;  4A75 A;  3GTJ A;  4PNY A;  5M3M H;  2RDH A;  1IBM H;  5C1P A;  4V0B A;  2DJG C;  5FO9 B;  3S1R B;  4DV4 L;  3IG0 A;  1JJC B;  1G91 A;  3NSW A;  1E4F T;  1SR3 A;  1Y1W H;  1O7L A;  4B3M Q;  4HR7 A;  1PZK D;  1VKZ A;  1RJT A;  2F0M A;  2N78 A;  4RA8 A;  1X65 A;  1EWC A;  4XYM B;  3PW2 A;  2FHT A;  3Q8P B;  2QDL A;  2D2C C;  4A3M B;  3T56 B;  1G6Z A;  4QJF A;  1TWF B;  1ZHQ A;  5E7N A;  3H0G G;  3FPU B;  2R86 A;  2UVU A;  3TIN A;  1QVG A;  3H4B A;  1QB5 D;  2CFM A;  2R93 B;  1XXG A;  2QF7 A;  3VA5 A;  3NPP A;  5D14 A;  1CT1 D;  4JBM A;  5C4X H;  4XYL B;  4QIW B;  5GAG C;  4GKJ H;  1L2Z A;  3E9H A;  3I90 A;  2K5W A;  4UP7 A;  4RB1 A;  4OO1 H;  3M4Y A;  1U4P A;  4AYB E;  3EJI A;  2OWO A;  1Q7Y C;  1BXR A;  4G7H C;  3CCJ A;  2FLN A;  4PDB A;  4LFB Q;  4LFB L;  1UEB A;  3K5O A;  2KCC A;  5JJL A;  3UE1 A;  1GLV A;  3JRX A;  1DYQ A;  2JA9 A;  4A3E H;  3M7N A;  1I5F A;  3FVQ A;  2WB1 G;  2VUG A;  1MI2 A;  2K28 A;  4ZCK A;  3D4W A;  2B2V A;  4WJ3 M;  1UE7 A;  2EYL A;  2Z6K C;  4BWS C;  1V8Q A;  1G2S A;  3K5H A;  2ID0 A;  4LF7 H;  3UFX B;  1X3Q A;  3CKI B;  2F3W A;  1JC7 A;  1PTO B;  3GTJ B;  1CQJ B;  4A3F H;  3GV8 B;  2B2U C;  3IRB A;  3ERQ A;  4RB3 C;  2Q8T A;  1C7Y A;  4IPG A;  2R7F A;  2CWA A;  2J6S A;  2L1B A;  5EGT A;  3HOX B;  5JEA H;  2HD3 A;  3HOW B;  3RNU A;  1J9O A;  2B2U A;  2UXC Q;  3JSN A;  2J0T D;  3J7A F;  1Q82 C;  3GQC A;  1I6U A;  5J39 A;  4HR7 B;  2I5H A;  3AMU A;  3N6R A;  5KX5 F;  3H0G A;  1VQJ A;  2IMW P;  4NXN Q;  5KFA A;  4NXN L;  3QWN A;  1Q81 C;  3WO0 A;  1JR0 D;  2MPM A;  2WDT A;  2YTX A;  3RB0 A;  4IRD A;  1I4G A;  1NBW A;  1YIJ A;  4FYD A;  3R5F A;  5A2Q W;  1SE2 A;  2R85 A;  4CKB A;  4PV1 C;  2WYO A;  1KDC A;  2F0E A;  1EYG A;  3S15 H;  4BBS B;  5KFH A;  3SDZ A;  3ORQ A;  1EL0 A;  1IOV A;  3QR8 A;  2A8V A;  4IPH A;  3ULP A;  4RKL A;  3S17 B;  2IL8 A;  1Q8I A;  3L9A X;  3HOY G;  1EYZ A;  2OH2 A;  1HQM C;  1VQL A;  2F0N A;  5J22 A;  3HOV B;  4HJ8 A;  2I0Q A;  2JA7 G;  4J9N A;  5KGU A;  1LLR D;  2X6G A;  3STB D;  4JV5 Q;  3RB6 A;  2KVM A;  2UVV A;  4XXE A;  4HJ9 A;  3I73 A;  1WTV A;  1SYG A;  2WB1 A;  2X6L A;  3HOU G;  2PZT A;  2L55 A;  5EBC A;  1MZB A;  2PQA A;  4MTD A;  2WAC A;  3RGZ A;  1XMQ Q;  1SE8 A;  1JWU D;  3PUZ A;  1HA6 A;  2MGS A;  2F4I A;  1W6J A;  3GTQ A;  5DLQ E;  1A6X A;  3KJO A;  1EYA A;  3CAM A;  3KK7 A;  1KAW A;  3PF5 A;  4A3G H;  1SNO A;  1EUJ A;  4JI8 Q;  3N43 B;  5KFG A;  1M8A A;  2NVT H;  3GTG A;  1LO5 D;  1K3R A;  2FK2 A;  3J81 W;  4ED1 A;  1SFO A;  2CW0 D;  4JI6 Q;  4DV5 Q;  2I8C A;  4DV5 L;  4NLG A;  1STA A;  2NU9 B;  4EVO A;  2NWG A;  1IBK Q;  2F0Q A;  4DR6 L;  1HTL D;  4DR6 Q;  1SN8 A;  3OSN A;  4HYK A;  2NB0 A;  2CW0 C;  3K0X A;  2ENB A;  4K6D A;  1MJC A;  2N3S A;  5FK9 C;  4B3T Q;  4B3T L;  4ALP A;  5EBD A;  3SHL A;  3J80 c;  5FLX c;  3CRK C;  2DPJ A;  4A3L G;  4FF4 A;  3LWB A;  5C1O A;  3LX0 A;  3H0G B;  5KT7 A;  3K5I A;  1FVI A;  4EX5 A;  1PTO H;  1XNR H;  2BR0 A;  3SE7 A;  3UE0 A;  5LYJ F;  4Q8F A;  4MV1 A;  3CPW A;  2ZTD A;  5EPL A;  1JE4 A;  2FMM A;  2YL2 A;  4R7R A;  1E0B A;  2N8N A;  3K3P A;  1STG A;  2JA7 A;  1VQ5 A;  3J7Z C;  2HDM A;  1S5C D;  1TVX A;  5IYC H;  3GV6 A;  1I6H B;  3KLS A;  1AEX A;  3D4R A;  2JA5 A;  1N32 Q;  4HJA A;  3CRL C;  2J6U A;  4A3K G;  5JEA J;  3TQY A;  5K5P A;  5ELO A;  4YR0 A;  2BQR A;  4DV6 H;  5HUR A;  3BJY A;  3T51 B;  4ED2 A;  4LH7 A;  5HY6 A;  4BY7 H;  2WB1 B;  1EHI A;  4E4T A;  5HV6 A;  2LXK A;  1BO0 A;  1ENA A;  2PQA B;  2BDN A;  4WD3 A;  4GS3 A;  1IKL A;  1QNU A;  5KT6 A;  3S17 H;  4OGQ C;  2UUB H;  2F0T A;  3HRZ C;  4KV6 A;  4NW2 A;  1LAB A;  2LSS A;  2AKW B;  3HOV H;  2FE3 A;  5LA6 F;  1IBL H;  3GTQ B;  5D1O A;  4K2L A;  4CGY B;  1BBX C;  4JI5 H;  4TV9 F;  3QIA A;  5KFS A;  1YHA A;  4XTC S;  3HG9 A;  2NVQ B;  3GTG B;  3R2T A;  1K1S A;  3DUZ A;  2W57 A;  4JI3 H;  1S9F A;  4MV9 A;  1STE A;  3H3V I;  5EQ0 A;  1HNW Q;  3M4P A;  2EE1 A;  3RGX A;  4EGQ A;  4LF6 Q;  3DWQ A;  5E3F A;  2I46 A;  2VOB A;  3A5Z B;  1RYS A;  4XYQ A;  1EY7 A;  1TII D;  2HCI A;  4O3S A;  3VR5 A;  3K7A H;  4QY7 A;  3SK5 A;  3CMA A;  2VUM H;  4EBC A;  3SE0 A;  4C5A A;  1Q1E A;  3MWM A;  1QCB D;  2OF1 A;  4RCO A;  3BDO A;  5D3I B;  4HIK A;  1U4L A;  4ME3 A;  2F0G A;  3OUZ A;  1N8R C;  3H09 A;  1JX4 A;  3OHA A;  2F0F A;  1NY4 A;  1KBL A;  1H9S A;  2R8H A;  3Q23 A;  1PX2 A;  3MA2 B;  3NEL A;  2JA7 B;  1HZC A;  3T5H A;  4OEM B;  1HR0 Q;  4HJ5 A;  1QNK A;  1HR0 L;  2WB1 E;  3SI8 A;  5KFT A;  3RAX A;  1XMO H;  2VA3 A;  1VMP A;  4LW1 A;  5KT5 A;  4Q44 A;  2EVB A;  2JA5 B;  5EZY F;  2QEJ C;  3H0G H;  3HOU B;  5KG2 A;  1BKB A;  2ZXP A;  2LFN A;  1PRT D;  3VPB A;  2W6P A;  1Z7T A;  4U67 3;  1BXT A;  5FLM G;  4LNQ A;  1CTM A;  4MTK A;  4HNU A;  1AUV A;  5IGF A;  2HIX A;  1RTN A;  2LS0 1;  1Z47 A;  1GUS A;  1SMY D;  4RFB A;  3S2D B;  4DV4 H;  2K50 A;  1BOS A;  4ID6 A;  3MR6 A;  1NMF A;  3B6Y A;  3T1Y L;  3F2D A;  5J2T F;  2TMP A;  5D3D A;  1SMY C;  1UE1 A;  3E0E A;  4KY6 A;  2EY2 A;  2KJX A;  3WO1 A;  4K8I A;  4X64 Q;  4X64 L;  2X0S A;  5LMN L;  4J9S A;  3DWA A;  3NGD A;  5CBE E;  4RGM A;  1TY2 A;  2BA1 A;  4ECX A;  1PH3 A;  1VQA A;  4JI2 Q;  5CV7 A;  4DNR B;  4WJW A;  1GVP A;  4FP5 D;  4XT1 B;  1PH1 A;  5ELE A;  1Q90 A;  1XTD A;  1U4M A;  5KFO A;  1D5X C;  4YHH L;  4BXX G;  2ICI A;  4LF8 Q;  1WFQ A;  4LF8 L;  3A54 A;  2BQ3 A;  3NEM A;  5JOB A;  2QIL A;  4AQY Q;  4AQY L;  4IRK A;  2XNA C;  1RTO A;  1B6S A;  1SFO H;  1C30 A;  4HCE A;  3U50 C;  1E7Z A;  3O13 A;  1AH9 A;  1I94 L;  2OQK A;  1MGS A;  1VF7 A;  3HB9 A;  3R5X A;  1FJG H;  2VZA A;  3I70 A;  3RV3 A;  2E75 C;  3N52 A;  3TRZ A;  1H9S B;  1SAP A;  2MJ8 A;  4OWT B;  1IBM Q;  2RDG A;  4ZUI A;  2VXW A;  4MAM A;  4A3K B;  3KHH A;  5C0X I;  5KFF A;  3JAM E;  2H1E A;  3TZD A;  3R2I A;  3Q8Q B;  4FNF A;  3UDG A;  3PR5 B;  1EY0 A;  2Z4I A;  3BAA A;  1YJW A;  4MZ9 A;  1Z2N X;  1S0O A;  1I7L A;  1I50 A;  2E2I A;  2RKS A;  4IAJ A;  2W6N A;  5KFK A;  4OWW B;  3MFY A;  5E4W C;  4UCR A;  5BPH A;  4NXM H;  5BN3 A;  4K0K H;  2BH2 A;  2NVX B;  2KHI A;  3HOY H;  5ELN A;  5FD6 A;  1XPO A;  2PNH A;  4IN3 A;  1AE3 A;  2C9O A;  4LF9 L;  4OEL B;  4ZHQ F;  2F4V H;  5F9N A;  1WD0 A;  1B53 A;  5M5X H;  3EPG A;  3TS0 A;  2ALZ A;  3HKS A;  5LL6 b;  1PRT B;  3VR6 A;  1PH8 A;  3MEH A;  1N34 H;  1EU3 A;  3OHB A;  3HOU H;  2HVS A;  1TS2 A;  4TVA B;  4GKJ Q;  4GKJ L;  3RZO H;  5M5Y B;  4DKA C;  3RN2 A;  4NXN H;  2EY6 A;  3G4S A;  4A4I A;  2C28 A;  4JOI A;  4L8J A;  1Q46 A;  1S97 A;  1PTO F;  1ET6 A;  5IGG A;  5DAU A;  2V59 A;  2FK3 A;  4FBU A;  4MV7 A;  3PW7 A;  2PPB C;  1HFN A;  1Y1W G;  5IWA L;  1PK8 A;  3NWS A;  2EYF A;  4DK1 A;  3DF7 A;  1XJV A;  3QZ7 A;  5L1I A;  4HIO A;  3KXY T;  2Z9H A;  4BA1 I;  1TWC H;  1CA6 A;  3CP0 A;  1W3S A;  4OX9 L;  4KD3 A;  4LF7 Q;  3WDN A;  2K05 A;  2O5I C;  2JA8 B;  5KG4 A;  1IKM A;  4XT3 B;  1B3A A;  5C4X G;  1VQI A;  4A3L H;  4O3R A;  2XWJ B;  3LGJ A;  4UHV A;  1J5E L;  1ULZ A;  2GPS A;  3MR2 A;  2W70 A;  3H91 A;  4TKO B;  1HZB A;  2XCA A;  4DL5 A;  1YEZ A;  3D6C A;  1JXL A;  2IBK A;  1I50 B;  1B7Y B;  1X3E A;  1DV1 A;  1CKM A;  3CC7 A;  2I87 A;  2R7Z H;  1QWY A;  4KJO A;  2DLN A;  3BJU A;  4K8J A;  3OUU A;  4DR6 H;  2JEI A;  3RN5 A;  1EQV A;  4RB2 C;  3D31 A;  1G51 A;  5EPJ A;  5C4Z A;  4A3K H;  4F4Y A;  1EEF D;  1N33 L;  3I91 A;  1ZHS A;  2MCT A;  4JI4 Q;  4JI4 L;  5KT3 A;  3NK9 A;  1U5K A;  2K01 A;  4RH6 A;  3HKZ G;  3OIQ A;  1Y1W A;  1B44 D;  1EIY B;  2EY5 A;  3GV5 B;  2JEJ A;  1K0R A;  3KBG A;  4M1U B;  4UFZ A;  3SK6 A;  4CKC A;  1A3V A;  5GON F;  1B9M A;  3IFT A;  4KKT A;  1DM0 B;  3W1B A;  2VPS A;  3EYY A;  2QEX A;  2CCZ A;  1GD7 A;  3R8B A;  4UY8 C;  5FLX W;  1B1Z A;  1VCI A;  2PN1 A;  2B39 A;  5H80 A;  1N36 H;  1SSO A;  3S1M B;  2EJG C;  2NUC A;  1HNZ L;  2PMZ A;  4YJ2 F;  4J1M A;  5DG7 A;  3IKJ A;  3KJP A;  2OT2 A;  2NU7 B;  2JK8 A;  1SXT A;  5LHY 1;  4MV6 A;  4JV1 A;  5CV8 A;  3IL8 A;  4P75 A;  4X66 H;  2WP8 J;  2PBZ A;  3LWU A;  1IW7 D;  2DY8 A;  3P20 A;  2FPI B;  3T5K A;  2OTL A;  4MV4 A;  1VQB A;  5JJZ A;  1F2M A;  4X6A H;  3M4O H;  1UAP A;  1IW7 C;  1EWH A;  5KFR A;  2K6A A;  4CDD C;  5IYD G;  3GP7 A;  3G6E A;  5M3F B;  3RUP A;  2JEG A;  4L5Q A;  1TXY A;  2R82 A;  2RSO A;  4M7E A;  1E4G T;  2NVY B;  2BOS A;  5C3W A;  4MV8 A;  1S3O A;  1JJ2 A;  4KN7 C;  1XNR Q;  5LXT F;  2RDJ A;  2R84 A;  3I3C A;  4IJH A;  3MFH A;  3ETH A;  3GTK A;  1X3P A;  2FXQ A;  5M3M B;  4A3G G;  3HKZ A;  2AQ1 B;  4RCN A;  5FLM H;  2XVS A;  2JSO A;  1Q8K A;  4ZUJ A;  1YHQ A;  4AYB A;  2FLP A;  2F0J A;  5KG3 A;  2C5C A;  4JC0 A;  4QL5 A;  4UAI A;  2E2I H;  4MTE A;  1OXT A;  3FKI G;  3CHB D;  3AEV A;  1Y1W B;  3QB3 A;  3OSP A;  1IYJ B;  5KFJ A;  1LTA D;  1U4R A;  1KC7 A;  4F7X A;  2A6H D;  5JVG 3;  4C3I H;  4KKU A;  4DR5 L;  5JPM C;  1PVO A;  1W6K A;  2XIG A;  1WTW A;  5DQH A;  4IUN A;  2A6H C;  1HNX L;  5T1G A;  2WV6 D;  3TEH B;  5FKA C;  1S4Z A;  1VQC A;  5CV6 A;  2F3V A;  1X9N A;  3G6X A;  2F0U A;  2K5D A;  2A73 B;  2R8I A;  2PMZ B;  1IBL Q;  5C4X B;  1Y8P B;  1EWI A;  5L1L A;  2K32 A;  2W8K A;  4G3I A;  3G6V A;  2EJM A;  4IUU A;  1FGB D;  2K7V A;  4JI3 Q;  3MXP A;  5IYC G;  5I6Y A;  1ILP A;  3A56 A;  1Q86 C;  4C2M H;  5LP6 F;  4L5S A;  5KFY A;  2WIN B;  2M00 A;  4DR2 L;  1CZG A;  3CCS A;  3C46 A;  3U9T A;  3T1Y H;  2F0V A;  2W7P A;  3S1M H;  3I56 A;  3IAY A;  1UNS A;  2D0O A;  4A3J G;  5I6W A;  4JI0 L;  4EGJ A;  2AQ4 A;  3MZ5 A;  2JQO A;  3ONA B;  2ALY B;  2H4O A;  2FK1 A;  1BBU A;  4IOA A;  5LMN H;  2B2Y A;  1NTG A;  3DHQ A;  1L0X B;  1SYX B;  1GHK A;  4EYI B;  2UXB L;  4DR7 L;  1S0N A;  1ZKO A;  3GID A;  3TSS A;  1BR9 A;  4IOC A;  1K1Q A;  1RIP A;  2YTY A;  3I4L A;  3UQ8 A;  1HRJ A;  1ICW A;  4A3F B;  3KUP A;  4MNO A;  4YHH H;  3PMF A;  2YU9 A;  1N56 A;  3PGZ A;  3T16 A;  1KJ9 A;  4AYB B;  1YVC A;  4P2C B;  5COR A;  4GKK Q;  4GKK L;  3BQ0 A;  1SJE D;  1PTO C;  1A2U A;  4B3R H;  5EKL A;  2MP1 A;  1RK5 A;  5CA1 F;  2UXD L;  3JSL A;  2SDF A;  1I94 H;  2BQU A;  4ZI7 F;  1HPC A;  1Y1V G;  4DAV A;  1WYD A;  2PMZ E;  3GDE A;  1NR4 A;  2VUM G;  4GN3 B;  4PWQ A;  4XQN A;  3FHW A;  1ENC A;  4DV4 Q;  3S15 B;  3A74 A;  1JJG A;  4CJ0 B;  1DXM A;  3VYR A;  2VQF L;  4A3I G;  4ZAI A;  2D5D A;  1I7N A;  3JAM i;  5KFB A;  2B3G A;  1K8G A;  2JE6 I;  1S5D D;  2SNM A;  4YAK B;  2ICE C;  3ULJ A;  2EY1 A;  1GUN A;  1A0I A;  1FNW A;  1SBB B;  1SYE A;  2B2W A;  4HED A;  4LF9 H;  5C5M A;  4PZ8 A;  1NSN S;  2MO1 A;  2VB3 X;  4MTN A;  1JDE A;  1ONL A;  4X62 H;  1R4Q B;  1WTH A;  5K36 H;  1Y14 B;  1K3B C;  2L11 A;  3EFX D;  4CDF C;  1NMG A;  4JW0 A;  3HKZ E;  3W2D A;  4DV0 L;  1CE8 A;  4BY1 G;  4JI7 Q;  2JP1 A;  5KNB A;  1HH2 P;  4JI7 L;  4XYO A;  1EY9 A;  2Z6B A;  4DAY B;  4A3G B;  3MWE A;  2N88 A;  3MWY W;  2B63 G;  1JOO A;  3CPF A;  2ZJP A;  2NVT B;  1I4X A;  2ZXR A;  2L12 A;  5DQG A;  1FJG Q;  1FJG L;  5LOV F;  4K5V A;  5IT9 L;  2XN9 C;  5IWA H;  1VQK A;  1T5E A;  3T1H H;  4KMU C;  5I4D A;  2B2V C;  1CZW A;  3MAQ A;  2HHH H;  3SR1 A;  2YU9 B;  4C3H G;  1SYB A;  2QGQ A;  4OWX B;  1PRT F;  2A68 D;  1PFS A;  2PQE A;  3PUY A;  2FMA A;  2HVR A;  3PW4 A;  2VUM A;  3CCQ A;  1C0A A;  4OX9 H;  2A68 C;  5CA0 F;  1KIX A;  1LT6 D;  4NXM Q;  4NXM L;  3SK4 A;  4FS2 A;  4YCW A;  4YY3 H;  4K0K Q;  3GTK H;  4K0K L;  1DV2 A;  4IUQ A;  2YYA A;  4WOR A;  3CME A;  1J5E H;  3HFZ B;  3S1Q H;  4PZ6 A;  2GPW A;  1KL9 A;  3M3Y H;  3DM3 A;  2F4V Q;  2F4V L;  2C2R A;  4CDC C;  1CQV A;  2EYM A;  3RR5 A;  1IL2 A;  1RL2 A;  5CC4 A;  4JPB W;  2AQ2 B;  4ECR A;  1R4P B;  2GVB A;  1N34 Q;  1N34 L;  2EOT A;  5KFW A;  1HUM A;  4I50 F;  2WII B;  3OMC A;  3RB4 A;  3CCU A;  2HQL A;  1S5B D;  1YIT A;  1CKO A;  3JAM L;  2VNU D;  4CBV A;  4X65 Q;  4X65 L;  1FR3 A;  2NTT A;  4UCU A;  5BPF A;  1SLJ A;  1N33 H;  3ULL A;  4BY7 B;  2BDO A;  4YWL A;  2RDF A;  4JI4 H;  1W96 A;  1JWM D;  4YJ3 F;  2B63 A;  1EZ8 A;  5DM7 3;  5CB4 F;  4YQW A;  4I7A A;  4FDB A;  3TP6 A;  4HID A;  2XGP A;  3U9O A;  2JYO A;  1CSP A;  3PF4 A;  3QOL A;  5CBA E;  5C6A A;  3OSO A;  5G3L F;  3L3O C;  2W6O A;  3A7L A;  3D6W A;  1D1I A;  1TWH A;  1V1O A;  4A2A A;  1BVS A;  2BCO A;  2E76 C;  3FPP A;  5IE8 A;  3STB C;  4IFD G;  5IYD H;  2F03 A;  4Y7N B;  1KNE A;  2WKC A;  2QYZ A;  5KFQ A;  2RA4 A;  4DPG A;  3FMA A;  2GLT A;  1LTR D;  1LT4 D;  1HNZ H;  4KY5 A;  1LTG D;  1TWA H;  3K5L A;  1PYS B;  1OXS C;  3K7A B;  2VUM B;  3KHR A;  4YAJ B;  1UUP A;  1NUC A;  4DUZ Q;  3TBI B;  4DUZ L;  2CQY A;  4EQP A;  4IAL A;  3VMM A;  2DGY A;  2CHB D;  2KHJ A;  4N8X 1;  3J7A 5;  3E0J A;  4A3C H;  1UNN C;  3I4N G;  1O7Y A;  2QDB A;  3FKI H;  3K7U C;  4A3I B;  3I4M G;  2YU9 H;  4DV2 H;  1ESR A;  4ECQ A;  3U4V A;  1D2B A;  1YHB A;  4ED6 A;  3Q0A A;  4YIJ A;  4UP8 A;  5GQO A;  1SEB D;  4DF7 A;  1XNQ Q;  1XNQ L;  1IZ6 A;  3RAQ A;  2CH4 W;  3H40 A;  2HGS A;  1SCU B;  1B70 B;  1SND A;  1SYC A;  4FXD A;  4HAE A;  1RF2 D;  4O2D A;  3W3A A;  2K5N A;  4J9L A;  2AGP A;  2DNC A;  2EZV A;  1GOZ A;  4GLV B;  2ZJR A;  4LUZ A;  4UCT A;  2JEB I;  1JWS D;  4C1N I;  1WH2 A;  3G8C A;  1F2Y A;  5COY A;  2D0P A;  3PO3 H;  4PMC A;  4H02 A;  2OEO A;  1KC8 C;  4J9R A;  1ZXT A;  4BY1 B;  2NTS A;  4FF2 A;  1YNX A;  3JC6 6;  3TDQ A;  4H7B A;  5A2Q L;  1E3P A;  2B63 B;  3CU7 A;  2R7Z G;  2XSC A;  3GIQ A;  1N36 Q;  4FBT A;  1N36 L;  1E24 A;  1I3Q H;  1A9X A;  5F9L A;  4J9O A;  4OO1 I;  4KHP Q;  4FXG C;  4KHP L;  4OON A;  1M1K C;  4HMI A;  4ZOL F;  4HIM A;  1L2F A;  1RCV D;  3E5N A;  3EN2 A;  4C3H B;  5BR8 L;  3V4S A;  4A3J H;  1HR0 W;  3A5U A;  4DR5 H;  2FP4 B;  1E1T A;  2XCP A;  1VQG A;  5CYU A;  4X66 Q;  4X66 L;  1X3G A;  2HUG A;  2F0W A;  1HNX H;  1JOR A;  4KK7 A;  5KFU A;  4IUV A;  1H9M A;  1PLF A;  1GUW A;  4O3Q A;  1Y8O B;  4GC7 A;  1CA5 A;  5KIX A;  4FM9 A;  2I5M X;  5FO7 B;  1PH9 A;  3M85 A;  1ML0 D;  1SNQ A;  1TWC A;  2W9A A;  1BQQ T;  3FMC A;  1CM9 A;  2PNR C;  2RHQ B;  1QUQ A;  1SFO B;  5JUM A;  1SNM A;  2EYJ A;  2XWB B;  3BU2 A;  2Q2T A;  4CC6 A;  1YNJ D;  4Y7N H;  3RZD H;  1HXY D;  3SVM A;  3G71 A;  4DR2 H;  2WE6 A;  1JB7 A;  4DL2 A;  1AN7 A;  1ESF A;  1YNJ C;  4QWE A;  1ENF A;  1Y1V H;  1ASZ A;  1RJQ A;  4JI0 H;  1JIH A;  3KHG A;  5IGB A;  2ZDG A;  1P8L A;  2Z8L A;  2O2L D;  1M6V A;  1S5E D;  3GTL H;  2UXB H;  4DR7 H;  2FJZ A;  1KHI A;  3V2T A;  2Y0S G;  1LM0 A;  1J8I A;  3E9I A;  1MD2 D;  1B4O A;  3HS0 C;  2R7Z A;  1X56 A;  2OQ0 A;  2RDI A;  4A3I H;  3HOY B;  2L9H A;  3RJ0 A;  1WOC A;  2RHS B;  2FLL A;  3PUV A;  1QJO A;  1F9Q A;  3JRW A;  1BBW A;  4DL6 A;  1F2Z A;  2F1M A;  3K57 A;  4WFN 3;  3J81 j;  3MEF A;  2NN6 G;  4XZ3 B;  4GKK H;  5M5X B;  3Q8S B;  1E4E A;  4DNT B;  1JT8 A;  1FKA H;  2AWO A;  4ME6 A;  3QZ8 A;  2WFW A;  2QKI C;  3A55 A;  3AYH B;  5IYB G;  3S2H H;  3PZP A;  4C5B A;  4KI0 A;  2UXD H;  1X6O A;  1G8Z D;  5JH7 F;  2YW2 A;  3OPO A;  4DXF A;  2V58 A;  3RZO B;  2YRX A;  4FXK C;  1E2Z A;  1WI5 A;  2L15 A;  4QW8 A;  3ITP A;  4X3U A;  1YNN D;  2I80 A;  4APM A;  1PRT C;  4EQO A;  4BY1 H;  1XDN A;  1M4V A;  4DU9 A;  5L9X A;  2YZG A;  4TQR A;  1WD1 A;  1WTR A;  1EFI D;  4YBZ B;  2R8K A;  4CHT B;  1WTP A;  2B63 H;  3OW2 A;  4LH6 A;  1HTP A;  2ASD A;  3T1Y Q;  1CHQ D;  1V1Q A;  2VQF H;  2G9D A;  4ULL A;  5IT9 E;  4X3T A;  2D62 A;  2XRS D;  4C3I G;  4RU9 A;  3BDC A;  5D1O B;  5F2D A;  5LMN Q;  2BA0 A;  2C35 B;  3E5S A;  2K03 A;  3I4N B;  1EY6 A;  3G48 A;  3I4M B;  1TWC B;  4C3H H;  4RGN A;  1GUT A;  4RMF A;  3GIL A;  4UCV A;  4DR1 H;  4O1N A;  5DGA A;  1QUQ B;  1TWH H;  3UI2 A;  4RB0 A;  1FD7 D;  4EBD A;  5KNC A;  4GLX A;  5C5J A;  3I72 A;  5DNF A;  2A5H A;  2ASJ A;  1B50 A;  2XD4 A;  5D8D A;  3D0F A;  2KQ3 A;  4YHH Q;  3P75 A;  3WOF A;  2Y0S A;  1IL8 A;  1TS3 A;  1R9T H;  4AIM A;  5TSS A;  4DV0 H;  5ELF A;  4QWD A;  4JI7 H;  1V51 A;  4PZ7 A;  2EYO A;  1QG7 A;  4IZ8 A;  2V9W A;  2SNS A;  1V1P A;  4B3R Q;  2E8G A;  4B3R L;  1VAJ A;  4LSA A;  1NAP A;  4BBR H;  4RAZ A;  1I94 Q;  1NR2 A;  3PQI A;  1SYF A;  4F50 A;  2R7Z B;  2ZM6 L;  1FL0 A;  2NYZ D;  2YCH A;  4FF3 A;  5G3L D;  1HFG A;  5JVD F;  3V96 A;  1LYL A;  3OIP A;  1RYR A;  5C4H A;  3AFQ A;  4LFA L;  1E4E B;  4IUR A;  3KYH C;  1RDP D;  4JBW A;  2CWP A;  4LMQ D;  4YWM A;  3RLN A;  4Q43 A;  1S5F D;  3FRP B;  3JAM c;  5EWG A;  2F0S A;  2AWN A;  2ZDH A;  5M5W H;  4P74 A;  2O4X A;  5IP9 G;  2SEB D;  2UUA L;  3MC0 B;  2CQO A;  1KDA A;  2F0L A;  1KEE A;  4RGO S;  4LF9 Q;  2PZW A;  1W93 A;  4DFA A;  3CC2 A;  4X62 Q;  3PIP A;  4X62 L;  1KNA A;  5DEH A;  4E6I A;  3GTO A;  1OO9 B;  4B3S L;  5DG8 A;  1KDB A;  4JOI C;  4IFD H;  1KLU D;  4YCV A;  4RNM A;  5FOB B;  4L5T A;  2C22 A;  2W6M A;  4J15 A;  1ICF B;  4DL7 A;  4X65 H;  3GO5 A;  1JB3 A;  3U4Z A;  4ECZ A;  1EIF A;  1YJN A;  2CKZ B;  3OOC A;  4C2M A;  2N49 A;  1CSQ A;  5IWA Q;  3T1H Q;  2FPP B;  3T1H L;  4HCS A;  5EKI A;  2HHH Q;  3N42 B;  2HHH L;  4ECS A;  3BVG A;  1WTQ A;  3RLF A;  1GHJ A;  2Y0S B;  4J9M A;  3K8A A;  2A19 A;  3M4O B;  3I4N H;  3W1G A;  3NUC A;  2XGT A;  3VYU A;  5GAH C;  1I4R A;  4DV1 L;  4DV1 Q;  1BNZ A;  3I4M H;  3SXH A;  4RAY A;  5K2M A;  4KJN A;  3RTX A;  4OX9 Q;  1V1P B;  5KFX A;  3GII A;  4NP5 A;  3V6H A;  1SEI A;  3CQZ A;  3T5J A;  1Z6H A;  5K36 G;  1GKH A;  4YY3 Q;  4YY3 L;  5CAE B;  1MHW C;  1EYC A;  3GQB A;  1PHJ A;  1OWT A;  1PDQ A;  3C1E A;  2NZH A;  5BN4 A;  2E5L H;  1A3T A;  2NZO A;  1J5E Q;  4B08 A;  1A62 A;  1O7I A;  2V5A A;  2Z4H A;  4ECV A;  2ZJQ A;  3J7A K;  1E1O A;  1STY A;  5IGD A;  3QFF A;  3PO2 G;  1S10 A;  4IWX A;  4QGU A;  3N8D A;  4MV3 A;  3F2C A;  2RGR A;  4F4Z A;  2DJF C;  4Q0F A;  2E2I B;  3EQL C;  3NWT A;  3H94 A;  2W9B A;  5A2Q E;  1M0W A;  1Z2P X;  4DUZ H;  3RB3 A;  1TS5 A;  4IHJ F;  3PCO B;  4I4T F;  1EQR A;  5IYZ F;  3RFC A;  3AQQ A;  1GSH A;  1QIL A;  5KFL A;  3W5O A;  4GOP A;  4C3I B;  3J7A V;  3KF8 A;  4POF A;  1N33 Q;  4ECY A;  2RSN A;  2J6T A;  1KJ8 A;  4ZYS A;  4ZLT F;  2DZD A;  1VQD A;  3TII A;  3BA9 A;  1XNQ H;  2I07 B;  3FDT A;  1TA8 A;  1LTB D;  4UCO A;  3GTO B;  3BAB A;  3LML A;  4Z9C B;  1QZG A;  3C3L A;  3TQT A;  3NE5 B;  2KEC A;  1YZ6 A;  5JVH 3;  1V43 A;  2Y0S E;  3F8T A;  4OHJ A;  1AE2 A;  3OW7 A;  4OIK A;  4EQ5 A;  4ZKB B;  4GNX A;  5AFW A;  5KFC A;  4GC6 A;  4JYA Q;  1F77 A;  5E4X A;  1H9J A;  4JYA L;  5HGT A;  3M9N B;  2IT1 A;  5FPO A;  3N44 B;  5T14 A;  1S68 A;  2C00 A;  4C2M B;  1K9M C;  2HJW A;  4CC5 A;  1B33 N;  3HXL A;  1JLL B;  3TQ1 A;  5C3E H;  2QW7 A;  3J80 i;  1HNZ Q;  1CKN A;  2L4N A;  3J81 E;  3GIM A;  2R61 A;  4Q5V A;  5KFZ A;  4KHP H;  1XTC D;  2FFK B;  5KFI A;  2XGQ A;  1BCP F;  3I12 A;  4O4L F;  2YZM A;  3ER0 A;  1SDF A;  5CGK A;  2WAQ G;  1KD1 C;  5BR8 H;  4IO9 A;  5FD5 A;  3CQZ B;  3D8G A;  4IFD J;  2W7O A;  3ND8 A;  3VA7 A;  1S72 A;  3KDF A;  4KKS A;  3A7A B;  1EOV A;  4DGZ A;  4DV2 Q;  1LTS D;  4DV2 L;  5EDW A;  3CD6 A;  1EUC B;  3V6J A;  1JCK B;  2BE5 D;  2IY5 B;  3ETJ A;  4DR4 H;  4EBE A;  2B29 A;  3NHH A;  4NKL A;  2MQH A;  1VQP A;  1K0S A;  5CV4 A;  5L1K A;  2W9B B;  2BE5 C;  4TQU S;  2NN6 H;  3L0O A;  2F0P A;  2KED A;  4O0A A;  1HZ9 A;  3R23 A;  4WBN F;  1L0Y B;  1GXD C;  1DD2 A;  3K58 A;  2EYH A;  2RCN A;  5IYB H;  2KCT A;  4RZR A;  3C2P A;  3SK8 A;  4GOP B;  3MJF A;  3KF8 B;  4QWB A;  4N9T A;  1S0M A;  2V1C C;  2MFI A;  1Y8N B;  3PUX A;  1II3 A;  4O3P A;  1AW7 A;  4A3M G;  3VDY A;  2R3Z A;  2QCP X;  4Q45 A;  3BA8 A;  3NEN A;  4MA5 A;  1AP0 A;  4A3B G;  2PVP A;  5IIF A;  3CXC A;  3L4K A; 
#chains in the Genus database with same CATH homology
 4LFC Q;  4LFC L;  4A3C G;  2QGQ A;  2LXK A;  4OWX B;  1PFS A;  2PQA B;  3PUY A;  4GS3 A;  2R93 G;  1UE5 A;  2XTI A;  5M3F G;  3CCR A;  4GNX B;  3S17 H;  2JJQ A;  4UPA A;  2JA7 H;  3CCQ A;  2QA4 A;  1C0A A;  4P73 A;  4R4O A;  1KIX A;  2LSS A;  2AKW B;  4POG A;  3HOV H;  4KHZ A;  4DR5 Q;  4NXM L;  4NXM Q;  4YCW A;  2JA5 H;  4K0K Q;  1YHA A;  4XTC S;  5M3M G;  2VL6 A;  3GTK H;  4K0K L;  1HNX Q;  1PH6 A;  1UWV A;  3CME A;  3GTO H;  3H3V I;  3HFZ B;  3GTM H;  3S1Q H;  4PZ6 A;  1KL9 A;  3M4P A;  3M3Y H;  1HNW Q;  3DM3 A;  2F4V Q;  2F4V L;  1CKN B;  4JG2 A;  2K75 A;  3PO3 G;  1YBY A;  4LUO A;  3RR5 A;  4LF6 Q;  1IL2 A;  1RL2 A;  1A63 A;  1VQE A;  3S2D H;  2GVB A;  3A5Z B;  1N34 Q;  2OCE A;  1N34 L;  4IPC A;  1NE3 A;  5IY0 A;  2PI2 A;  4P71 A;  3K7A H;  2VY3 A;  3BZK A;  4QY7 A;  3CMA A;  2VUM H;  3CCU A;  2HQL A;  1Q1E A;  1YIT A;  1CKO A;  4HIK A;  3KDF B;  4APV A;  3TS2 A;  4DR2 Q;  2GVA A;  2VNU D;  4ME3 A;  4X65 Q;  1MKH A;  4X65 L;  5IP7 H;  4NB3 A;  1SLJ A;  1N8R C;  3ULL A;  1OXU A;  3KLW A;  4YWL A;  1VS0 A;  4JI0 Q;  5JJK A;  4DNI A;  1NY4 A;  4R4C A;  4GOP C;  4LF7 L;  5FJ8 H;  1GM5 A;  3ERS X;  3NEL A;  3HOX G;  4FDB A;  1D7Q A;  4HID A;  3HOW G;  1HZC A;  4DR7 Q;  2UXB Q;  3CQZ H;  1HR0 Q;  4HJ5 A;  1HR0 L;  2WB1 E;  5C0X G;  1CSP A;  3PF4 A;  4OO1 G;  2ATW A;  4LW1 A;  2GN5 A;  3PUW A;  1HJP A;  3H0G H;  3K80 C;  3BZC A;  1BKB A;  4GNX C;  4DK6 C;  1YI2 A;  5FLM G;  3KF6 A;  4LNQ A;  1BVS A;  5IYD H;  5IE8 A;  3S14 H;  3STB C;  4A3D H;  4IFD G;  1A8V A;  5IP9 H;  2HIX A;  1KQS A;  3FP9 A;  1Z47 A;  4DPG A;  4A3E G;  2AMC B;  1GO3 E;  5H1S E;  4DV3 L;  2K50 A;  1DGS A;  2UXD Q;  1TWA H;  3Q8D A;  1WCM G;  3HOZ H;  1PYS B;  1OXS C;  1NMF A;  3B6Y A;  3T1Y L;  3ZJY C;  4L5R C;  3F2D A;  1UE1 A;  1S40 A;  3E0E A;  4DUZ Q;  4DUZ L;  2LXJ A;  4NPS A;  4QQB X;  1PV4 A;  4X64 Q;  2K52 A;  1T9H A;  4X64 L;  5LMN L;  1C9O A;  5LMU Q;  2DGY A;  5LMU L;  4GN5 A;  2KHJ A;  5C44 H;  3I55 A;  3J7A 5;  3S1N H;  4A3C H;  4A3F G;  3I4N G;  3FKI H;  3K7U C;  1XPR A;  2BA1 A;  2YU9 H;  1PH3 A;  2JA6 H;  3I4M G;  2VQF Q;  1WJJ A;  3U4V A;  1VQA A;  5HGQ A;  1YHB A;  4JI2 Q;  2NVX H;  4R4T A;  4UP8 A;  4AYB G;  5JEA G;  5GQO A;  2KEN A;  1GVP A;  2YYZ A;  1XNQ Q;  1PH1 A;  1XNQ L;  1IZ6 A;  3J81 c;  4LF5 L;  1XTD A;  4A3B G;  2VW9 A;  3SGI A;  1Q12 A;  4IJL A;  2JEA I;  4YHH L;  1VQ6 A;  1B70 B;  4BXX G;  4DR1 Q;  1QZH A;  4DR1 L;  2ES2 A;  4LF8 Q;  1WFQ A;  5GRO A;  4LF8 L;  3NEM A;  4O2D A;  1VQM A;  2K5N A;  2MNA A;  4AQY Q;  4AQY L;  4GLV B;  2ZJR A;  2ASB A;  4LUZ A;  2JEB I;  1SFO H;  5M5Y H;  1U0L A;  3U50 C;  2D0P A;  3PO3 H;  2EXD A;  1E7Z A;  5GAE C;  1AH9 A;  4H02 A;  1KC8 C;  1I94 L;  2OQK A;  1VQF A;  1YNX A;  2VZA A;  1VQ7 A;  2R7D A;  3JC6 6;  3DLL A;  4DV0 Q;  5C4J H;  3TRZ A;  4B3M L;  2UU9 Q;  1E3P A;  4OWT B;  1IBM Q;  2UU9 L;  2R7Z G;  4DV7 Q;  4DV7 L;  1N36 Q;  2NN6 I;  1E24 A;  1I3Q H;  5C0X I;  3H15 A;  1N36 L;  4OO1 I;  4PMW A;  4A93 G;  4KHP Q;  4KHP L;  2F3I A;  3K81 C;  4OON A;  3UDG A;  1M1K C;  2K5H A;  1QVF A;  3PO2 H;  1YJW A;  4MZ9 A;  4JBK A;  4HIM A;  1VQO A;  1L2F A;  3EN2 A;  4BY7 H;  5BR8 L;  3EIV A;  4A3J H;  1HR0 W;  3A5U A;  4OWW B;  4IFD I;  3RLO A;  1E1T A;  3KF6 B;  1VQG A;  1Q1B A;  4X66 Q;  4X66 L;  1JMC A;  1X3G A;  2BH2 A;  2KHI A;  3HOY H;  4JBJ A;  5ELN A;  2JA8 H;  1XPO A;  1B8A A;  2PNH A;  2YV5 A;  1AE3 A;  4P72 A;  1M90 C;  4LF9 L;  1PYB A;  1XNR L;  2VQE Q;  2VQE L;  2WAQ E;  4AH6 A;  5M5X H;  3PIO A;  3M4Q A;  2I5M X;  3TS0 A;  3HKS A;  4A76 A;  1PH9 A;  3M85 A;  1PH8 A;  1KRT A;  1VQN A;  2ZTC A;  3HOU H;  2R6G A;  2RHQ B;  1QUQ A;  4TVA B;  4GKJ Q;  2YTV A;  4GN4 B;  3RZO H;  3GTP H;  4GKJ L;  3BU2 A;  4DKA C;  2Q2T A;  3RN2 A;  3U58 A;  4Y7N H;  1I50 H;  1YJ9 A;  2PI2 E;  1G6P A;  3S24 A;  3G4S A;  3EBE A;  3UDI A;  4A4I A;  3RZD H;  4JOI A;  3G71 A;  4BBR G;  1Q46 A;  4DUY Q;  5JJI A;  4PG3 A;  4DUY L;  1JB7 A;  1OTC A;  2AHO B;  1VQ9 A;  2F52 A;  1Y1V H;  1OXX K;  4DV6 Q;  1Y1W G;  4DV6 L;  1ASZ A;  5IWA L;  4IPD A;  3UDX A;  1P8L A;  2Z0S A;  2Z6K A;  1XPU A;  4C3J H;  1XJV A;  2K5V A;  3GTL H;  3S16 H;  1SMX A;  3H3V H;  1X55 A;  2VS1 A;  2EQS A;  2E2J H;  1KHI A;  2Y0S G;  1LM0 A;  4HIO A;  2I5L X;  4BA1 I;  1IXR A;  1TWC H;  4R4Q A;  2UUB L;  2E2H H;  3M9B A;  3E9I A;  2UUB Q;  1X56 A;  2OQ0 A;  3CP0 A;  1W3S A;  3L7Z C;  4A3I H;  4OX9 L;  4DK3 C;  2ZTE A;  4LF7 Q;  1IBL L;  2RHS B;  1JE5 A;  1WOC A;  3MXN B;  3AFP A;  4JI5 Q;  2UXC L;  3PUV A;  4JI5 L;  1L0W A;  5C4X G;  1BBW A;  1VQI A;  1PH7 A;  4A3L H;  4BXX H;  2IHE A;  3LGJ A;  2DUD A;  2NN6 G;  3MEF A;  4JI3 L;  3J81 j;  1J5E L;  2Q2U A;  4BA2 I;  1JT8 A;  2Q2I A;  2AWO A;  1V9P A;  2WFW A;  3AYH B;  4QIW E;  1HZB A;  5IYB G;  2MO0 A;  1PA6 A;  3S2H H;  2OTJ A;  1YEZ A;  4KI0 A;  1X6O A;  1QVC A;  1WI5 A;  2L15 A;  3S1R H;  2R92 G;  3I4O A;  2E5L Q;  1B7Y B;  2E5L L;  1X3E A;  1K73 C;  4BY7 G;  1CKM A;  4BY1 H;  4BBS G;  2EIF A;  3CC7 A;  2R7Z H;  3CCE A;  1L1O C;  1N9W A;  2RF4 A;  1NJI C;  3BJU A;  4DV3 Q;  3F2B A;  1TWG H;  3RN5 A;  2B63 H;  3OW2 A;  3T1Y Q;  1PH5 A;  3D31 A;  1G51 A;  1V1Q A;  4A3K H;  3CW2 C;  2KBN A;  1N33 L;  1L1O A;  3CC4 A;  4JV5 L;  3HOV G;  4A3M H;  2D62 A;  3KFU A;  1X54 A;  3J81 i;  4JI4 Q;  2IX1 A;  4JI4 L;  1TWF H;  5LMN Q;  1J6Q A;  2BA0 A;  1U5K A;  2C35 B;  2JA5 G;  4A3B H;  3G48 A;  3PV0 A;  4KLK A;  4C3H H;  4RMF A;  3HKZ G;  1VQ4 A;  1QUQ B;  1XMO Q;  1XMO L;  1TWH H;  3TRE A;  3WWV A;  3UDF A;  2R93 H;  4OXP A;  3A0J A;  2HIV A;  3GD7 A;  5M3F H;  4GLX A;  1XMQ L;  1EIY B;  1KRS A;  1K0R A;  4YCU A;  2NVY H;  1ASY A;  4LF5 Q;  3D0F A;  4YHH Q;  1PH2 A;  3W1B A;  4A75 A;  4JCV E;  4JI8 L;  2BH8 A;  1R9T H;  4AIM A;  2QEX A;  5M3M H;  1GD7 A;  2CCZ A;  2IHF A;  4UY8 C;  4PZ7 A;  4WJ4 A;  4JI6 L;  4R4I A;  1VCI A;  4B3R Q;  1HNZ L;  4B3R L;  2E8G A;  4DV4 L;  1IBK L;  4BBR H;  1JJC B;  5IP7 G;  1I94 Q;  2IX0 A;  1H95 A;  3KJP A;  2ZM6 L;  2JK8 A;  1FL0 A;  1K83 H;  1SR3 A;  1Y1W H;  4B3M Q;  5FJ8 G;  2A1A A;  2N78 A;  4P75 A;  1X65 A;  2WP8 J;  3CF5 A;  1LYL A;  5GAD C;  3AFQ A;  4LFA L;  2OTL A;  4QJF A;  1VQB A;  3KYH C;  1LTL A;  4JBW A;  3GTJ H;  5E7N A;  2CWP A;  4YWM A;  3RLN A;  3H0G G;  1FGU A;  4X6A H;  5BR8 Q;  3M4O H;  3JAM c;  2AWN A;  3KOJ A;  1QVG A;  3ICE A;  5IYD G;  2CFM A;  4P74 A;  5M5W H;  1P16 A;  3G6E A;  4RG1 A;  3HOX H;  4JBM A;  5IP9 G;  4L5Q A;  1TXY A;  5C4X H;  2UUA L;  1SRO A;  3HOW H;  2CQO A;  5GAG C;  3E9H A;  4UP7 A;  1S3O A;  1JJ2 A;  4LF9 Q;  1XNR Q;  4IJH A;  1CUK A;  4AYB E;  1N32 L;  3HOZ G;  2OWO A;  2FXQ A;  3CC2 A;  4X62 Q;  3PIP A;  4X62 L;  1Q7Y C;  4A3G G;  4DR4 L;  4DR4 Q;  3CCL A;  3CCJ A;  1Z9F A;  5FLM H;  4B3S L;  4LFB Q;  4LFB L;  1L1O B;  1UEB A;  4JOI C;  4XIG S;  4YCV A;  3I2Z A;  1Q8K A;  5C3E G;  5JJL A;  4L5T A;  3UE1 A;  1YHQ A;  1MIU A;  2JA9 A;  4BBS H;  4JC0 A;  4QL5 A;  4LUV A;  5C44 G;  4A3E H;  4J15 A;  2E2I H;  2HT1 A;  3M7N A;  1I5F A;  1OXT A;  3FKI G;  2WB1 G;  2JA6 G;  3AEV A;  3GO5 A;  1X3F A;  3U4Z A;  1WCM H;  4WJ3 M;  1UE7 A;  1IYJ B;  2Z6K C;  1EIF A;  4R1J A;  2CKZ B;  3OTO Q;  5LMN W;  3OTO L;  1YJN A;  2N49 A;  1CSQ A;  5IWA Q;  3T1H Q;  3T1H L;  2ID0 A;  4C3I H;  2HHH Q;  2HHH L;  4DR5 L;  4DR3 Q;  3RLF A;  4DR3 L;  1PVO A;  3K8A A;  2A19 A;  4A3F H;  1HNX L;  3I4N H;  3W1G A;  3IRB A;  3TEH B;  2XGT A;  4DV1 Q;  5GAH C;  4DV1 L;  2UUC Q;  2UUC L;  1C7Y A;  3I4M H;  1VQC A;  4IPG A;  2K14 A;  2CWA A;  2R7F A;  1X9N A;  1HNW L;  4OX9 Q;  1IBL Q;  3RNU A;  4LF6 L;  1HZA A;  2UXC Q;  1K8A C;  1EWI A;  1GKH A;  4YY3 L;  4YY3 Q;  5K36 G;  1PHJ A;  1KXL A;  1Q82 C;  1W2B A;  3F1Z A;  2NZH A;  2I5H A;  4JI3 Q;  1J5E Q;  2NZO A;  5IYC G;  1A62 A;  1VQJ A;  1G29 1;  1OXV A;  1O7I A;  1EFW A;  1Q86 C;  4C2M H;  4NXN L;  1Q81 C;  2ZJQ A;  4L5S A;  4NXN Q;  1E1O A;  2YTX A;  1YIJ A;  1NBW A;  5EAY A;  4DR2 L;  4LF4 Q;  4LF4 L;  3CCS A;  3PO2 G;  4UP9 A;  4QGU A;  3S1M H;  1EYG A;  3I56 A;  3F2C A;  3PSI A;  3S15 H;  2D0O A;  4JI0 L;  4A3J G;  2JQO A;  3PCO B;  2ALY B;  2A8V A;  4IPH A;  1BBU A;  4IOA A;  1NTG A;  3ULP A;  1EQR A;  1PH4 A;  3HOY G;  2UXB L;  2JA8 G;  4DR7 L;  3AQQ A;  1VQL A;  3W5O A;  4A93 H;  1E22 A;  1EQQ A;  4GOP A;  4HJ8 A;  2I0Q A;  2JA7 G;  4POF A;  1N33 Q;  2KCM A;  4IOC A;  3STB D;  4JV5 Q;  1RIP A;  1SRU A;  2YTY A;  1VQD A;  4HJ9 A;  1D8L A;  4MNO A;  1MJE A;  3HOU G;  1QZG A;  3PGZ A;  3NBH B;  2PQA A;  5IT9 c;  2K4K A;  3I7F A;  1YVC A;  1YZ6 A;  4GKK Q;  1V43 A;  2Y0S E;  3F8T A;  4GNX A;  1AE2 A;  1SE8 A;  4EQ5 A;  3PUZ A;  1XMQ Q;  4GKK L;  4JYA Q;  4JI1 Q;  4JYA L;  4JI1 L;  2UXD L;  5DLQ E;  2IT1 A;  3KJO A;  1I6H H;  3CAM A;  4A3G H;  1KAW A;  3PF5 A;  1Y1V G;  1EUJ A;  4JI8 Q;  1WYD A;  2PMZ E;  1K9M C;  2NVT H;  3GDE A;  4Y52 H;  2VUM G;  1K3R A;  4GN3 B;  5C3E H;  3FHW A;  4JI6 Q;  3J80 i;  4DV5 Q;  4DV5 L;  3L2P A;  1HNZ Q;  5C0X J;  1CKN A;  4DV4 Q;  1IBK Q;  4DR6 Q;  4DR6 L;  3A74 A;  1JJG A;  1SN8 A;  2H5X A;  3CCM A;  3K0X A;  2VQF L;  1MJC A;  2N3S A;  4JI2 L;  3ER0 A;  2ZM6 Q;  4A3I G;  4B3T L;  4ALP A;  4B3T Q;  1KD1 C;  2WAQ G;  3JAM i;  4IO9 A;  2B3G A;  1K8G A;  4IFD J;  3J80 c;  5FLX c;  5J3B A;  2JE6 I;  1S72 A;  3KDF A;  4A3L G;  3OYY A;  3ULJ A;  3GTQ H;  1EOV A;  4LFA Q;  1A0I A;  4DV2 Q;  1UE6 A;  4DV2 L;  1FVI A;  4EX5 A;  2NVQ H;  3GTG H;  4PZ8 A;  3CD6 A;  2MO1 A;  1LUZ A;  3UE0 A;  4DAM A;  4MTN A;  3CPW A;  2ZTD A;  2IY5 B;  4YWK A;  2Q2H A;  4HJ7 A;  2B29 A;  4A3D G;  1Y14 B;  1VQ8 A;  2MQH A;  2N8N A;  1VQP A;  1VQ5 A;  1NMG A;  2UUA Q;  3HKZ E;  4DV0 L;  4BY1 G;  4TQU S;  3J7Z C;  4JI7 L;  1HH2 P;  4JI7 Q;  3CCV A;  1IBM L;  3L0O A;  4O0A A;  5IYC H;  1HZ9 A;  4GLA C;  4DAY B;  1N32 Q;  4HJA A;  2B63 G;  2RCN A;  3CPF A;  5IYB H;  2KCT A;  2ZJP A;  4GOP B;  4A3K G;  3KF8 B;  1VQH A;  5JEA J;  4B3S Q;  2V1C C;  2MFI A;  3PUX A;  5ELO A;  3TQY A;  1FJG L;  1FJG Q;  4A3M G;  3VDY A;  2R92 H;  4LWC A;  3NEN A;  1VQK A;  5AJ3 Q;  5AJ3 L;  5HY6 A;  3CXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...