4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
1YZ6A 5IP7G 2D62A 3CQZH 1TWCH 3KOJA 1NJIC 1N36Q 3CW2C 4DAMA 4DUZQ 2JK8A 3H0GH 1BBUA 4DR5L 3I4NH 3HOZH 5M5YH 2UU9Q 3M4PA 4OWXB 1GM5A 4JI6L 1A63A 1WFQA 5ELNA 4MNOA 4BA1I 4JI7L 3ICEA 3J7A5 1XNRL 4UP7A 2K5VA 4DR7L 2BH2A 4JOIA 1AH9A 4KHZA 4A3IH 1X54A 4X62Q 4DV1Q 1JB7A 1VQDA 4Y7NH 5GAGC 4IOCA 1PH9A 4AYBG 2XTIA 3PSIA 3EN2A 2HT1A 4UPAA 5AJ3L 3GTGH 3J81c 1PH7A 2A8VA 4GN4B 1Y1WG 5FLMH 1K9MC 4JBMA 1YHAA 2Z0SA 3PUYA 3KF6A 4B3SL 4JBWA 2UUCQ 1HNXL 4BXXG 4JCVE 1GKHA 1C0AA 4DK6C 1SN8A 1TWFH 1WYDA 4QQBX 1VQLA 4LFBQ 1UWVA 2UXBL 4DR4Q 3UDGA 2UUAL 1K8AC 4JC0A 3PUXA 1S72A 3FP9A 2NZOA 1HNZQ 1UEBA 1QVFA 1PYBA 1K3RA 3SGIA 3NBHB 1HZCA 1SE8A 2Z6KC 3JAMi 3RN2A 1Q7YC 2E5LL 1N32L 1DGSA 4BY1G 1YJNA 3CAMA 4BBRG 4C2MH 4C3JH 3F1ZA 1PH6A 2KHIA 3AFQA 3KF6B 1PHJA 4DR2Q 4H02A 5M3FG 4DV0Q 3RLFA 4LF9Q 3MXNB 5J3BA 5C0XJ 3NELA 4A3MG 1OXSC 3S14H 4DR6Q 5FLXc 1EQRA 1SROA 2F52A 3CF5A 1QUQA 2VQEL 4RG1A 5LMNL 4LF7Q 3AFPA 5IYCG 2UXCL 4DR1Q 1EOVA 4PMWA 4LF6Q 4DV3L 4A3FG 2VL6A 3PIOA 1J5EL 1C7YA 1VQ9A 2OTJA 1G6PA 3A5ZB 4LUVA 5IYBG 4JBKA 2ATWA 1PH5A 4DNIA 3S1MH 4JI5L 5M3MH 1CKMA 3I55A 2OWOA 3E9HA 4YCVA 1HR0L 3HOXH 3E9IA 2VUMG 3ERSX 2AHOB 1N34L 1Y1VG 2UUBQ 1VQGA 4A93H 2IT1A 1YVCA 4OONA 2E8GA 3UDXA 1LYLA 3BU2A 5IWAQ 1AE3A 4P72A 3HOZG 1VQKA 3CPFA 5C0XI 3L7ZC 2ZTEA 3GD7A 4QIWE 1WI5A 3UE1A 3KJPA 1NMFA 4YCWA 1QZHA 2AMCB 3S15H 1LM0A 4IPHA 3TS0A 1FJGQ 4A3IG 4KHPL 1I5FA 3PCOB 4JI1Q 2VQFQ 4TVAB 1KL9A 3F8TA 3OYYA 3S1NH 1Q8KA 4K0KQ 3STBC 4P74A 4BBSH 2B29A 1X55A 5FLMG 5BR8Q 2KENA 1KHIA 5C44G 4Y52H 2Z6KA 1JE5A 4O0AA 2F4VQ 1P16A 2B3GA 4LF4L 1RIPA 2LSSA 1YITA 4GKJQ 3L2PA 1Q81C 3GTJH 3U58A 1N8RC 3RNUA 3PUVA 4B3TQ 2MO1A 4IPCA 5C4JH 2JA9A 1EWIA 5EAYA 1Z9FA 2JQOA 3GTKH 4DV6Q 1T9HA 2A1AA 1VQBA 3F2BA 1KC8C 4DV5Q 2K4KA 4PZ8A 1UE6A 1UE5A 3G48A 5JJIA 1FVIA 1XNQL 1Q82C 4A3BG 4FDBA 4R4TA 1M90C 1VQ7A 1NY4A 4LUOA 5LMNW 3T1HQ 1XMQQ 4A76A 4X64Q 2JEAI 3GTPH 4YHHL 3T1YQ 1PA6A 1CUKA 2GVAA 4LF8Q 1PH3A 3DM3A 5C3EG 2I5MX 4YWMA 3RLOA 3Q8DA 4L5TA 5C4XH 4DPGA 5IYDG 4B3ML 4HIKA 4GN5A 3A0JA 4OXPA 4A75A 4EQ5A 5M5XH 4O2DA 1ASZA 3I4OA 3FHWA 2WB1E 2CWAA 3MEFA 2Q2UA 1VQNA 4B3RL 1I50H 2ID0A 1N33L 4IFDG 1E7ZA 1X3FA 3J80c 3HOVH 4DR3Q 1JJ2A 3JC66 3HOXG 4GOPB 1VQOA 2FXQA 4GNXB 4DR4L 4NXML 3U50C 4DUYQ 5IP9H 2OQ0A 3TEHB 4TQUS 4X65L 4A4IA 3HOUG 2UXDQ 1CKNB 4DV7Q 4OX9L 2Q2IA 1AE2A 4DV4Q 1PH8A 4L5RC 4KI0A 4WJ4A 3W5OA 1X6OA 4AQYL 3H15A 2JA5H 4YWKA 2JEBI 3I2ZA 4XIGS 4DKAC 1YJ9A 2JA7H 4A3EH 4JI8L 4X66Q 3DLLA 4JI0Q 2OTLA 2R92H 2JJQA 1VQ4A 5GROA 1LUZA 3M4QA 3RLNA 1PFSA 2ZM6Q 1IBLL 1VQ5A 3S1RH 1VQJA 3NEMA 4L5QA 1Q86C 3M9BA 4BBSG 2DGYA 3CMEA 4LF7L 2ALYB 3OTOL 4YY3L 3CCVA 1U5KA 4DK3C 4LF5Q 2YTVA 2KBNA 1IBML 2CKZB 4A3GG 3F2CA 1CSPA 1IXRA 4LW1A 3UDIA 2HIXA 1XMOQ 4NXNQ 4LFCL 1R9TH 4MZ9A 2ZJPA 1GD7A 5IT9c 1D7QA 5LMUQ 1HNWL 1PH2A 2IX1A 4X6AH 1O7IA 1XTDA 2HIVA 1OXUA 2YYZA 1EQQA 1FL0A 4A3LH 4DR5Q 2JA6H 3I4MH 2ZTCA 4PZ7A 1KRTA 1YJWA 3CCLA 2AWNA 3CC4A 3RZDH 2RF4A 2EQSA 2WAQG 1MJCA 1BKBA 3PO3H 4JI6Q 2B63H 5IWAL 4HIOA 4JI7Q 5FJ8G 4QL5A 3CCSA 1XNRQ 4DR7Q 1K73C 5GADC 3UE0A 3ER0A 2PNHA 3OW2A 4JV5L 1IYJB 1K83H 3KYHC 1HZBA 4RMFA 4GOPC 4BY7G 4R4QA 2BA0A 2EXDA 4GNXC 1MJEA 4JI4Q 4A3KG 5AJ3Q 3UDFA 1L0WA 2Q2HA 2Y0SE 3LGJA 4LFAL 1QZGA 4A3DH 3FKIH 1OTCA 1EUJA 3PV0A 2I5LX 4B3SQ 3HKZG 4A3JH 1HNXQ 2R7ZH 1E24A 1V1QA 1SR3A 2KHJA 2UXBQ 1RL2A 4GKKL 5GQOA 3PO2H 2QEXA 1PVOA 2UUAQ 5JJKA 3PUWA 3H0GG 3STBD 4JYAL 2MNAA 1YIJA 1YEZA 3AEVA 1NTGA 1Z47A 3I4NG 1JT8A 5GAHC 1V9PA 4EX5A 1I94L 3RR5A 4R4IA 5IP9G 5IP7H 1N32Q 2E5LQ 2H5XA 4WJ3M 4JI3L 2RHSB 2JA8G 4DV2L 2MFIA 2NN6I 3A5UA 2I5HA 2YTXA 4AYBE 2F3IA 4APVA 1VQ6A 4OWTB 1WCMH 4JBJA 2JA7G 1VQFA 4JG2A 2PQAB 4YWLA 3EIVA 2AWOA 1IL2A 3S1QH 4A3EG 1JMCA 2EIFA 1VQHA 3G4SA 1KRSA 3CP0A 3J81i 3KDFB 3L0OA 1LTLA 2LXJA 3TREA 2QGQA 2VQEQ 4JI2L 5LMNQ 3EBEA 3S2DH 3GTMH 1SMXA 2UXCQ 1IBKL 4DV3Q 1J5EQ 4C3IH 2VS1A 5JEAJ 1QVCA 1Y14B 1Y1WH 1KIXA 1YBYA 3GO5A 3ULLA 1KAWA 2RHQB 4JI5Q 3KF8B 1PV4A 1NE3A 1GVPA 2CQOA 1TWHH 2VW9A 4BXXH 1EIFA 1Q1BA 3PF5A 1WJJA 1GO3E 3D31A 2NVQH 1HR0Q 4BA2I 2HQLA 1N36L 1PH4A 3CCMA 1N34Q 4DUZL 3S17H 3RZOH 2UU9L 2R7FA 3JAMc 4GOPA 2YU9H 2E2HH 4GNXA 2JA6G 3GTQH 1CKOA 5HGQA 2ES2A 1V43A 3AQQA 1CKNA 3H3VI 1VQ8A 3IRBA 3PO3G 4BY1H 2R93H 2K52A 4X62L 4DV1L 4BBRH 2B63G 4P73A 4QJFA 2R6GA 1VS0A 1VQEA 1WOCA 1L1OB 4KHPQ 1BBWA 3TQYA 3U4VA 3KLWA 5M3FH 3H3VH 1UE7A 1Q46A 4JI0L 1B8AA 2D0PA 4A3MH 2K5NA 5M3MG 3GDEA 1SFOH 1EFWA 2D0OA 1XJVA 2UUCL 2OQKA 2ZJQA 3CC2A 3HOYH 4MTNA 4LFBL 2R7ZG 4A3FH 4LF4Q 2IX0A 4P75A 4A93G 4LF5L 3K0XA 3KFUA 1SRUA 1HNZL 1KQSA 5E7NA 3PO2G 1H95A 1X3GA 1MIUA 1VCIA 3CCQA 2CCZA 3D0FA 1JJCB 2DUDA 1I3QH 4GN3B 1Q1EA 5DLQE 4IJLA 1XPOA 2CFMA 1E1TA 4YCUA 2VY3A 3U4ZA 2VUMH 1CSQA 1Y1VH 1E3PA 1TWGH 3I56A 3CPWA 1XNQQ 4OO1I 2IY5B 2HHHQ 1KXLA 4DAYB 3G71A 4PZ6A 4DR2L 4HJAA 4YHHQ 5C0XG 4A3CH 2BA1A 1UE1A 4DV0L 1WCMG 2JE6I 4GLXA 1YI2A 4LF9L 4QGUA 4DR6L 2E2JH 3B6YA 2KCMA 5HY6A 1P8LA 1HH2P 2RCNA 3I7FA 5K36G 2N78A 2NN6G 4DR1L 1Q12A 4LF6L 1X65A 4UP8A 4B3MQ 4HJ7A 3CC7A 4L5SA 3CCRA 3GTLH 1G51A 4IJHA 1E22A 1K8GA 3E0EA 3F2DA 4JI4L 4LNQA 2WFWA 2YV5A 3PIPA 4AIMA 2OCEA 1S3OA 5C44H 4IOAA 3RN5A 1OXXK 2NZHA 3CCUA 3M85A 4B3RQ 1N33Q 1I6HH 1XPUA 1PH1A 2UUBL 3ZJYC 4IFDJ 1L1OC 1HZ9A 3K7AH 3S24A 4POGA 4NXMQ 4OWWB 2PI2A 4R4OA 4X65Q 2IHEA 3HFZB 2Q2TA 4IPDA 4KLKA 4OX9Q 5ELOA 1NBWA 1OXTA 3W1GA 4AQYQ 2N49A 4A3BH 3M4OH 2NVTH 1FGUA 1VQMA 1SLJA 4P71A 1FJGL 2R93G 3TS2A 4UP9A 5C4XG 5M5WH 3GTOH 2GN5A 3J81j 4JI1L 2VQFL 4JI8Q 4AH6A 4POFA 5IE8A 2PQAA 4GLAC 4K0KL 5JJLA 2QA4A 5C3EH 3PGZA 1IBLQ 5GAEC 5BR8L 2PMZE 4HJ5A 2MO0A 3KDFA 2F4VL 3HOWH 4LWCA 5IYDH 2GVBA 1W3SA 1VQPA 3OTOQ 4IFDI 4YY3Q 4GKJL 1ASYA 3HOVG 4HIMA 3HOYG 1YNXA 2MQHA 5JEAG 1IBMQ 2JA8H 2CWPA 1A8VA 4B3TL 1TWAH 1YHBA 3J80i 4GS3A 4LFCQ 3A74A 1QVGA 2WB1G 3BZCA 4DV6L 1HNWQ 1NMGA 4DV5L 3HKSA 1JJGA 4UY8C 4HIDA 1K0RA 2JA5G 1D8LA 2K50A 3T1HL 1XMQL 4X64L 2VZAA 4C3HH 4ALPA 1L2FA 3T1YL 2K14A 3HOUH 3VDYA 1C9OA 1X9NA 2R92G 4LF8L 2ZTDA 2E2IH 3S2HH 4J15A 2AKWB 3W1BA 3AYHB 2V1CC 2N3SA 1QUQB 4A3CG 1A0IA 4LUZA 3BJUA 3ULJA 3NENA 2IHFA 4IO9A 2YTYA 2BH8A 3S16H 4IPGA 4JV5Q 4OO1G 3CD6A 1TXYA 1L1OA 3PUZA 4R1JA 1HZAA 3ULPA 1XPRA 1PYSB 4LFAQ 4NB3A 3J7ZC 1X3EA 4JOIC 4GLVB 1VQIA 1B7YB 1HJPA 1VQCA 4XTCS 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1MKHA 4A3GH 3K81C 4QY7A 4GKKQ 4A3LG 2WP8J 1VQAA 3I4MG 4DUYL 4NPSA 4JYAQ 4PG3A 3M3YH 2WAQE 2UXDL 1X56A 2KCTA 4DV7L 2ASBA 4R4CA 1J6QA 1I94Q 4DV4L 2PI2E 4JI3Q 5IY0A 4DV2Q 1N9WA 3CCJA 3K7UC 1BVSA 3K80C 2L15A 1EYGA 4X66L 2HHHL 3TRZA 2R7DA 3G6EA 3CCEA 2ZM6L 3WWVA 4HJ8A 3CMAA 1B70B 5FJ8H 1YHQA 3FKIG 3M7NA 2K5HA 4A3DG 2VNUD 5IYCH 1E1OA 2A19A 3HKZE 1EIYB 1OXVA 2N8NA 2ZJRA 4A3JG 3KJOA 1G291 2XGTA 1S40A 4JI2Q 2LXKA 2K75A 5IYBH 4BY7H 2NVYH 1W2BA 1M1KC 1IBKQ 4HJ9A 4A3KH 3HOWG 1KD1C 2NVXH 4NXNL 1IZ6A 2Y0SG 3BZKA 1XMOL 3K8AA 1HR0W 3PF4A 3CXCA 5LMUL 1U0LA 1A62A
chains in the Genus database with same CATH superfamily
3Q8SB 2NVTB 1F2YA 1X3PA 5LOVF 5JUMA 1BJTA 1AP0A 1QNKA 5C5JA 1S5ED 5KKNB 2I46A 4G57A 3DWAA 3FKIB 3HOZH 1WCMA 1E4GT 5D1PA 1LTTD 3QR8A 1SAPA 5ELNA 4JI7L 3BZDB 5FOBB 2BH2A 1B33N 3J7AF 1X54A 5DNFA 2UUAH 2C2DA 1VQDA 3VYUA 4IOCA 3GTJA 1EIGA 3SE0A 2ICIA 2QDBA 1SNMA 1STHA 1B3QA 1Y1WG 2DJFC 5FLMH 1B3AA 4IRCA 1N32H 1YHAA 3PUYA 3V6HA 3PW2A 1KDAA 1TWHA 4JBWA 3MA2B 1K0SA 4K6DA 4JCVE 4QB4A 1O75A 2L4NA 4U68A 5L9XA 1TWFH 4QQBX 3GTPA 4WJWA 1UWVA 4RAYA 2UUAL 4IN3A 2W6OA 4JC0A 4M8AA 2G5DA 2NZOA 3GTQA 1ZYRC 3S2DB 3DUZA 1WTXA 1SE8A 1N32L 3MAQA 5T14A 1EQTA 4DV3H 4K5WA 4C3IB 5KFQA 3H40A 2VXWA 4ODGA 1BR9A 1EZ6A 2K01A 4NMZA 3W2DA 4JI5H 3KF6B 1PHJA 4DR2Q 2XGQA 3RLFA 4LF9Q 4ME5A 3S14H 1BBXC 3PN1A 2B2WC 3CF5A 1QUQA 2FLNA 4OHJA 3RZOB 2FMMA 3AFPA 4RNMA 3V6KA 1EOVA 4F4ZA 4DV3L 3Q8PB 1T5XD 3LWBA 1C7YA 2VL6A 3PIOA 2OTJA 3A5ZB 3KHRA 2ATWA 3BS1A 1PH5A 4DNIA 1DM0B 1E0BA 1EY9A 4JI5L 4XYOA 3C1FA 2K6AA 3QO2A 4KHPH 4NLGA 1EYCA 1SNDA 1Y1VG 3KHHA 1VQGA 3R5XA 2DY7A 4A3MB 1HHVA 3OPOA 3BU2A 2ICEC 1X3QA 2RDGA 3K59A 5CBEE 4G7ZC 2ZXOA 5C0XI 2WE6A 4A3FB 3GD7A 3UE1A 4ECRA 4YCWA 2AMCB 3GQCA 2MCTA 4HNTA 4IPHA 4KHPL 3PCOB 2ENBA 4EFEA 1H9KA 4O1NA 4S3SA 3OYYA 2OXPA 4K0KQ 3M9MB 4I55F 1NR2A 4BBSH 2B29A 1LLRD 3PMFA 1XNQH 3ETHA 2Q8RE 5A2QE 4MN3A 4TQRA 2B3GA 1K1QA 1RIPA 1YITA 4JV0A 4ZHQF 3DHQA 1AZPA 4YHHH 3L2PA 3GTJH 5KNDA 1N8RC 4ECTA 1VKZA 3OSPA 3LWUA 5FO7B 4FF4A 2Q8IB 1Z9FA 2JQOA 5DG7A 2J7ZA 2A1AA 4A3IB 5KFWA 1SEBD 1LV9A 3SK8A 2K4KA 4DV5Q 4GZYC 4PZ8A 4Y7NB 4IUQA 3VPCA 1D5MC 1XNQL 1DJRD 3MC0B 1I4HA 2L5TA 3T1HQ 1XMQQ 3GTPH 2JEAI 4EQNA 3K0YA 4OELB 4YHHL 1KDCA 4FF1A 1V1PB 2RSOA 2J6SA 1ENCA 3RV4A 1I6HB 1B6RA 1DD2A 4DL7A 4L5TA 2G9HD 1E2WA 2PYKA 4B3ML 4HIKA 4QF4A 4GN5A 2RSNA 1F77A 3S9WA 4X65H 4KD3A 4EQ5A 2MPMA 1JDEA 3JZIA 2WB1E 2D2CC 3MEFA 3QOLA 3M4OB 4A3BB 4AQYH 5IT9W 4FS1A 2XWBB 3MHBA 2B2UA 2E76C 3ZYYX 5M5WB 4IFDG 2FLPA 1H9JA 1X3FA 4JUZA 2R61A 3J80c 1DYQA 2ZT9C 1XWEA 1UUPA 3LNNA 1VQOA 4DR2H 1IBLH 2OF1A 4C3HG 1Y8OB 2W70A 4X65L 2UXDQ 2E2IA 1CKNB 2F0QA 2Q2IA 3X3NA 4DV4Q 1PH8A 3W5OA 3C0FB 4AQYL 5FK9C 4L6TB 3D8GA 2JEBI 3H09A 4XIGS 3U9OA 4DKAC 1YJ9A 1Y1WA 2NYZD 2EYPA 1ZYRD 2OTLA 3S1MB 1VQ4A 5GROA 4Y8VB 3M4QA 1WTVA 3RLNA 1IBLL 1KNEA 5LYJF 4C56C 2EDGA 3NEMA 3IG0A 1PX2A 3HOUB 4DK3C 4IUVA 5KFSA 1GJXA 3NXWA 2JXMB 5ELCA 2R7MA 2HIXA 5FD6A 4QWBA 2A6HD 4MZ9A 1GD7A 5LMUQ 1ILQA 3TP7A 1S0MA 2A6EC 1EU3A 2IX1A 3K5OA 4M9UA 4F50A 2B39A 1TVXA 5HV6A 2L55A 3EQLC 4ZI7F 1DOKA 3MR2A 3G6XA 1PTOF 2AWNA 4N8FA 2RF4A 3RZDH 1WH2A 3GV7B 1MJCA 4Q0YA 1II3A 3A54A 2V58A 3R2IA 4L1KA 5FJ8G 3CCSA 3T5LA 3BYYB 4NKLA 3OIQA 1AEXA 1K73C 4GC7A 1XX8A 5E3FA 1HZBA 4RMFA 4J9PA 1BNCA 2NVXA 3A8IE 3EROA 3EJIA 3H4DA 2JYOA 3WDNA 1SYGA 2B2YC 5J1ZA 4RZQA 3R23A 5KFNA 3BA9A 4DV2H 2I5LX 1EFID 2R8HA 2R7ZH 2R85A 5CV7A 1L0YB 4RGMA 4I50F 1TWCA 2WAQB 2R8JA 2FHTA 2RDHA 1PVOA 4ULLA 2F03A 3U9SA 1U4PA 3G6VA 4JI2H 4J0MA 3RR5A 5IP9G 5J2UF 2E5LQ 2NVYB 1IBKH 1KC7A 2RHSB 4DV2L 2YTXA 1ZXTA 3NHHA 4GC6A 5M5XB 1VQFA 2AGOA 2PQAB 1JMCA 3G4SA 3T4AC 1BGWA 3UFXB 3TREA 2QGQA 3T16A 2VQEQ 4JI2L 4IWXA 3GTMH 4CBVA 1G91A 5C1PA 4KHVA 1IBKL 4EYIB 5DAUA 2VS1A 1Y1WH 3R93A 1YBYA 1O78A 3PVXA 4EG0A 1GVPA 2CQOA 3RF2A 1WJJA 2JA7B 1SYXB 1HR0Q 4J8QA 2HQLA 4O2BF 4A3EB 1PH4A 5E4WC 3PW0A 3URYA 4GOPA 1EZ8A 1MHWC 1HCZA 5JPNC 1V51A 1CKOA 1EEFD 2WKCA 5COYA 3S1RB 2ES2A 2YS7A 4XZ3B 1CZWA 2UVRA 1TAEA 3PO3G 1FNVA 5JVH3 2F0FA 1S5DD 3RAQA 1VQEA 1JR0D 4J9SA 1BBWA 5KFJA 3KLWA 2K28A 4QUFA 3H3VH 1SEIA 1Q46A 5BN4A 2I87A 3GDEA 5D1OA 1XJVA 4PQXA 2DPJA 3HOYH 4MTNA 5KFLA 4LFBL 2KA7A 5KG4A 3JSNA 1TY0A 4DV0H 1YNNC 3S14B 5LA6F 3PO2G 3T56B 1EY6A 2Z4IA 5F9LA 4GN3B 1I3QH 2F0LA 1ULZA 1PXUA 3J7AV 5KG3A 5DLQE 4LF6H 3V4ZA 4IJLA 1ET9A 1ICWA 1XPOA 3S15H 2VY3A 3Q2OA 1Y1VH 2IY5B 4OO1I 1CA5A 4ED2A 1KXLA 2B2VC 4MTDA 5EPLA 5C0XG 2A6ED 1NR4A 4R8UB 1PLFA 3VR5A 4DV0L 1M6VA 5BN5A 4GLXA 1YI2A 2UVWA 3GV5B 5CMDA 1KEEA 2UUBH 5K36G 2FB9A 5T1IA 4LF6L 1GHKA 3KXYT 4UP8A 3GTLH 3CCRA 2MHVA 4FP5D 4DGZA 4RKLA 3E0EA 5G3LD 2WFWA 2YV5A 4AIMA 3GP7A 3K6OA 1EU4A 2B2TA 2OCEA 4L63B 5KEEA 2PN1A 3E5SA 1EYDA 2NZHA 3RD4A 1N33Q 3PR4A 3GV8B 4JI1H 1GUGA 3KLSX 2XWJB 4J9NA 2UUBL 1WCMB 1RJRA 4LMYA 1PZID 4R9WA 3K7AH 3X3MA 1ICFB 3OWEB 4MA5A 1Q8IA 5BR8H 2F4VH 3A7AB 1DOLA 4IPDA 4OX9Q 2R8GA 2L1BA 5JQWA 5C4ZA 2IBKA 3GTJB 1KNAA 4LMQD 2NVTH 1FGUA 1VQMA 1SLJA 5C4XG 4B3TH 3J81j 4JI1L 2VA2A 1NAPA 2F1MA 4AH6A 5EKIA 1PZKD 4POFA 1FNUA 1K3BC 1TWHB 5L37A 3QZ8A 5I2YA 5GAEC 4FVMA 5BR8L 2FK2A 4MTEA 2PZTA 2KJXA 2MO0A 3KDFA 2F4VL 4LWCA 3GTPB 3N41B 3SDZA 4X64H 1W3SA 4FF2A 3S17B 1QE6A 3J81L 3HOVG 1YNXA 3OSOA 1TU2B 2W6ZA 2CWPA 3BJYA 4B3TL 2RGVA 1BCPF 5FLXE 4DU9A 4LFCQ 2WB1G 1KLGD 2FE3A 1JQYD 1LT5D 2ZDGA 4IFDH 3HKSA 5D65A 5CV4A 3GTGA 1WD0A 2JA5G 2IL8A 1FKAH 3NWSA 4X64L 2VZAA 4C3HH 4DAPA 4ALPA 3KUPA 1L2FA 5BMVF 2R92A 4RGNA 4K8JA 2ZTDA 2NWGA 4J15A 3W1BA 4Q8EA 2N3SA 1BUVT 1QUQB 1A0IA 1SNOA 1VBGA 2SNMA 4IO9A 2YTYA 4CDFC 3S16H 3CD6A 1L1OA 1HZAA 2H4OA 1PYSB 4LFAQ 4NB3A 1JORA 5KFAA 1X3EA 4GLVB 2RVLA 1VQIA 5J22A 2HCCA 1I7LA 1PFBA 3BG5A 3KBGA 2XCLA 2M00A 2IA6A 5EWEA 4GKKQ 1BQQT 2YZNA 2ZM6H 3I4MG 3FPPA 4NPSA 4PG3A 3E6ZX 1X56A 2KCTA 5HBRB 1AZQA 1A2TA 2IX3A 2OT2A 1PDQA 1KAAA 1M4VA 4HCSA 5IY0A 2PBZA 4ECQA 1N9WA 1YNND 3K7UC 3I73A 1EYAA 3CCJA 3J7AK 2EJGC 4Q0FA 1EYGA 4CKCA 2ZM6L 3QG1A 5FJ8H 1YHQA 4A3DG 3RIZA 1E1OA 2A19A 2L9HA 3HKZE 5DQGA 4DL4A 2NB0A 4DR5H 1G291 2W57A 2UVVA 3RMHA 2K75A 1BO0A 3RZDB 1S5FD 2Z9HA 1W2BA 1M1KC 4IQZA 3HOWG 1TIID 4JI6H 3L9AX 4FXGC 3BZKA 4RU9A 3K8AA 3PF4A 1XNRH 4DR7H 5DM73 2JA8G 1GM5A 1B04A 1YZ6A 3K3PA 4I7AA 4IRKA 2WTFA 2D62A 3HP3A 1F9PA 1S68A 1CQVA 1NJIC 1N36Q 4CDCC 4DAMA 4DUZQ 4DR5L 2JK8A 2C5CA 2BQUA 3GIJA 3H6MA 4OWXB 1BDOA 1L2ZA 1RYRA 4JI6L 1B2TA 2DNEA 4QWEA 2K5WA 1WFQA 4MNOA 2CH4A 1XNRL 4UP7A 4DR7L 1JJGA 1FNWA 4JOIA 4A3IH 4DV1Q 3P7JA 4Y7NH 2EE1A 1NSNS 3MZ5A 1PTOH 3KHLA 3EN2A 4RCOA 5FKAC 3BDOA 2HT1A 2K32A 3JAML 3GTGH 2A8VA 3GTKA 2LKVA 2Z0SA 3Q23A 2UUCQ 2JEGA 1GKHA 1C0AA 1B50A 1VQLA 3GLKA 3R3OA 2J6TA 1BNZA 2YU9A 3FP9A 4K8IA 1HNZQ 4A2BA 2E2IB 1PYBA 4MIUA 1STNA 5LMNH 5FPRA 3JAMi 2NBFA 1Q7YC 2UXCH 5DLFA 4BY1G 1J5EH 3CAMA 1Y1WB 2EY2A 1RYSA 3N6RA 1PH6A 3ETJA 3GV3A 5IT9E 3OHBA 1E2ZA 3D4DA 1U4LA 4H02A 5M3FG 4IWYA 4KTAA 1SFOA 3NELA 1OXSC 1EQRA 1GUNA 2PQEA 4LF7Q 3GIDA 5LMNL 5IYCG 2UXCL 4DR1Q 5KFMA 1J5EL 1G6PA 4V0BA 4YQWA 1Z6HA 3CHBD 4U6PA 3VPBA 4ZOLF 3S1MH 2PW7A 5DG8A 3E9HA 2IW3A 2RQXA 4ME6A 3KHGA 2JA5A 4K6LA 2V4QA 2TSSA 1BOSA 1TS3A 2AHOB 1TWGA 3PW7A 3RTXA 1YVCA 4IUUA 5G3LF 2E8GA 4FS2A 5IWAQ 1AE3A 3NE5B 4P72A 2AQ3B 1VQKA 2W6MA 2EVBA 2ZTEA 4I4TF 1LTRD 4QIWE 1IW7C 4ZCKA 3KJPA 1Y69U 4QWCA 2RDIA 2WIIB 3BYTB 3KAJA 4B9WA 1QZHA 2IP4A 1JICA 1LM0A 2AGQA 2C28A 3TS0A 2NVXB 2CW8A 5KGUA 1TS4A 2VQFQ 1I3QB 5C0XH 3IAYA 1Q8KA 4IZOA 4O3QA 3K58A 4P74A 3BVMA 4DA2A 5KNBA 3S15B 1X55A 1Y1VB 5E4XA 5K36H 3RUPA 1HTPA 1P16A 4RH6A 4GKJQ 3MWMA 5M5YB 2AUKA 4Z9CB 2F0IA 1Q90A 4QWDA 1STBA 4XYMB 1DCZA 2CVRA 5DQIA 1EWIA 5EAYA 3GTKH 1PZJD 4ABNA 4DV6Q 1KC8C 5KT3A 3GTLB 1K83A 2B2WA 3OMGA 1MD2D 1JIHA 2BR0A 3CU7A 1M90C 2M05A 1NY4A 4C3JG 3P20A 3PR5B 3NWTA 3T1YQ 2R8IA 5KNCA 1PA6A 2GVAA 4LF8Q 3UI2A 3DM3A 3Q8DA 3K7AB 5C4XH 4N9PA 2CHBD 4NXMH 3SXHA 3A0JA 4HR7A 3HBLA 3W3AA 2QW7A 5M5XH 1TWAA 2KQ3A 2Q2UA 1VQNA 2F0EA 1E7ZA 4J9OA 3TQ1A 2PVPA 2E74C 4DR3Q 3HOVH 3K5IA 1JKJB 3C2PA 3HOXG 4GOPB 1BXRA 2FXQA 1I4RA 4NXML 4RNNA 3K3VA 4A4IA 1JOKA 4LF7H 4YY3H 5J2TF 1IBMH 3BVZA 3H15A 2JA5H 2JA7H 4YR3A 2VB2X 4A3EH 4Q45A 1PRTC 1TKWB 1CHPD 1Y8PB 3D3RA 4X66Q 1ONLA 2JJQA 1LUZA 1U4MA 2FKLA 1VQ5A 5D1OB 3S1RH 2O2LD 2QF7A 3MXNA 4J9MA 3RAXA 1SE2A 4C3HB 4N9TA 2ZJTA 4LF7L 1SYBA 1UAPA 4YY3L 4HNUA 2E2HA 1IBML 3VA5A 4LW1A 2X6GA 4KJNA 5CV6A 1JCKB 5IWAH 1MZBA 5A35A 3K57A 1UC8A 2QYZA 4DNTB 3N8DA 1W6KA 3BQ0A 3S16B 1O7IA 1EQQA 1OXUA 3IKJA 2K33A 4KJOA 3I4MH 2ZTCA 1KRTA 1YJWA 3CCLA 4EBEA 1NCVA 2EQSA 3KALA 4DL2A 1BKBA 5IWAL 4HIOA 4EBCA 1W96A 4QL5A 4UAIA 5I9OA 2JSOA 4DN4M 5DEHA 3UE0A 1GSAA 1K8MA 3ER0A 3OW2A 1K83H 3KYHC 1C8CA 4WD3A 4BY7G 2J9GA 4R4QA 2BA0A 4GNXC 4JI4Q 4A3KG 5AJ3Q 3UDFA 3EPIA 2Y0SE 3TBIB 1QZGA 4A3DH 1IW7D 1H9RA 3PV0A 3TP8A 4B3SQ 3HKZG 1HNXQ 1A3UA 3CQZA 2CW7A 1CI3M 1V1QA 2UXBQ 5F9NA 3PUWA 5ISRA 1Z47A 2CQYA 1ET6A 3R8BA 2GLTA 3I70A 2VPQA 4PMCA 4IRDA 4WJ3M 3OUZA 2R8KA 2MFIA 4WRDA 3MR6A 4AYBE 1AN8A 1B6SA 2FK1A 5EJWA 1WCMH 5D14A 2V59A 1IL2A 2HDLA 3EIVA 3S1QH 4JVZA 2BDOA 2EIFA 3SR1A 1YNJC 1KRSA 3ERQA 3DM1A 2FJZA 1RKNA 1CT1D 3KDFB 2LXJA 1GUOA 4C1NI 2QCPX 1RHPA 3EBEA 4JV2A 4R8IA 3VYSA 5JEAJ 3Q6SA 5CAEB 3TZDA 3GO5A 3VR6A 4Q44A 1TQOA 1NE3A 3MEHA 2VW9A 1TWHH 5CA1F 3GIKA 3R5HA 1Q1BA 4LK1C 3TIIA 3GV6A 1JDBB 1PTOB 3D6WA 3D31A 2NVQH 3GTGB 3PW4A 4C2MA 3GTOA 1N34Q 5CA0F 3S17H 2R7FA 3I90A 2E2HH 2H1EA 2JA6G 3GTQH 5HGQA 4HQ6A 3TP6A 2B2YA 3TSSA 1VQ8A 3IRBA 4BY1H 1EOTA 2RDFA 2W6QA 4ECSA 1EWCA 2B63G 2AU0A 1HA5A 3GIMA 4RCNA 1VS0A 1AUVA 1TS5A 1XYIA 5I47A 5I6WA 4HYKA 1L1OB 2D5DA 2BCOA 5DQHA 5JPMC 4ECUA 2R87A 5M3FH 4R7RA 2W9CA 2F0KA 5JH7F 2SOBA 4HSVA 5M3MG 3J81W 4MV8A 3ITPA 4TV9F 2C9OA 3Q8RB 1PRTD 2O5IC 1JOQA 4LF4Q 4RWSC 1PMRA 4EFBA 4P75A 4EQPA 4LF9H 5IODA 3PO3B 4RA8A 5E7NA 1KQSA 1X3GA 1ZEQX 1VCIA 3D0FA 2CQAA 1OWTA 4HN7A 1TA8A 1CTMA 5DGAA 4H7BA 3SK5A 2CFMA 3U4ZA 5KFZA 1E3PA 3I56A 3GILA 4JI4H 2HHHQ 2PNRC 3G71A 3IL8A 4DR2L 4RB3C 4HJAA 2BA1A 2PZWA 4QMGA 1PK8A 2IJ0A 2JE6I 3PIP3 4LF9L 5HY6A 4OO1H 3T13A 2RCNA 3HG9A 2QEJC 2N78A 3PO2B 3N6XA 4RUAA 1X65A 1H9SA 4XYLB 4YAJB 1G51A 4IJHA 1K8GA 4JI4L 4LNQA 5E1FA 1S3OA 5EWGA 5LHY1 1DOMA 3M85A 4B3RQ 1B9MA 2SCUB 3TIGA 2XRSD 1XPUA 4DF7A 4K0KH 4PWQA 1HZ9A 2ZDHA 2YRXA 1RJTA 4POGA 4UCUA 1J8IA 1KLUD 2XRQD 1HQMC 2Q2TA 1K8OA 1IOWA 1C3OA 4ECYA 5I2XA 4ED3A 2PO4A 1OXTA 2FFKB 4RB2C 2R93G 3JSLA 4DFAA 3GTOH 3N42B 3AU7A 4HSPA 1WTPA 4JI8Q 4XYQA 3GTKB 4YBZB 3HKZA 3PIO3 1A2UA 5IE8A 4K0KL 3ND9A 5KFDA 4DV5H 2QA4A 4E6IA 2AQ1B 2X6LA 3PGZA 3L4JA 2PMZE 2MP1A 3BA8A 2NTSA 1E4EA 3VPDA 2KCCA 1EHIA 5KFRA 3T1HH 1XMQH 3OTOQ 4ZUJA 2ATLA 1ASYA 1JOOA 3MXUA 5JEAG 1UEAB 1CHQD 2B2VA 4ZQIA 3J80i 5IGEA 1I7NA 4U673 3A74A 4CGYB 5C4XB 4CJ0B 4NW2A 3KF8A 5JOBA 3EYYA 1HNWQ 1NMGA 4DV5L 3DWQA 4YR2A 4DL6A 3NSWA 4X3KA 5KIXA 4HIDA 4TSSA 4KD4A 2K50A 3T1HL 1XMQL 4OIKA 2QDLA 2F3WA 1SE3A 1E2VA 2DIKA 3VDYA 1C9OA 4ZUIA 2R92G 3EPGA 1SFOB 3HXLA 5KRUA 2E2IH 1JXLA 3S2HH 2AKWB 2V4DA 3AYHB 2V1CC 3HOVB 4A3CG 5KFOA 3WO1A 2B2UC 1PYWD 5KG5A 4JV5Q 4IPGA 2K05A 2WB1B 2UXDH 2HJWA 2EOTA 4R1JA 2BQ3A 1XPRA 1R9TA 4DV4H 4KKUA 5FLXL 2JA5B 4F8MA 3DMUA 1SCUB 1EEID 5LL6X 2KHSA 2EY1A 2HHHH 3A55A 4QY7A 2JA6A 4A3LG 2WP8J 2L12A 2J6UA 4JYAQ 3OOCA 2NUCA 5EPJA 2UXDL 4QCLA 2B63A 2ASBA 4R4CA 4UCTA 1I94Q 4DV4L 5KT2A 4JI3Q 1I4GA 4FNFA 3M4IA 1S0NA 1FD7D 3RB6A 1BVSA 5LMUH 1JLLB 2HHHL 3TZUA 5KT5A 2R7DA 2I07B 3H94A 3CCEA 1DIKA 1GGOA 3QWNA 3WWVA 2R7KA 4ED8A 2MUYA 3CMAA 1OXVA 4A3JG 1I4XA 3L3OC 2J0TD 3I4MB 1ZETA 1BCPB 2E75C 4BY7H 4A3KH 1KJQA 2NVXH 2IPKD 3H3VC 1HXYD 4CJ2C 1IZ6A 2Y0SG 3FMCA 1VDZA 3CXCA 5LMUL 1H95A 3HRZC 1U0LA 1A62A 1K83B 2PPBC 1GUWA 2MGSA 3TMEA 1RTNA 1TWCH 5D8DA 4RB1A 4A3DB 1BBUA 5M5YH 2UU9Q 3M4PA 1Z2PX 3L4KA 4TRDA 2KEDA 4QIWA 1KDBA 2M2LA 1QJOA 1A63A 3V2TA 4BA1I 1D2BA 2EXZA 3J80E 1AH9A 4X62Q 5DM63 1CM9A 5GAGC 1IOVA 4AYBG 5KFGA 2JA8B 5ELDA 4HR7B 4UPAA 2I8CA 3J81c 1TWAB 2E5LH 2DNCA 2FLLA 3KF6A 2VA3A 3T53B 4BXXG 4DK6C 1SN8A 1S5BD 4CKBA 4A2AA 1WYDA 1D5ZC 3S1QB 2LMCB 4DR4Q 4MA0A 1QILA 4M7EA 4PV1C 1O7LA 1K8AC 3A8JE 3G7LA 1QVFA 1UEBA 1GHJA 2VR1A 3SGIA 2VQEH 3GQBA 1D6EC 2Z6KC 3RN2A 2E5LL 2R93A 3ORRA 1ZHSA 1DZ1A 1YJNA 1NUCA 4BBRG 1GUSA 3F1ZA 1I4QA 5I9PA 5L1LA 2NZ1D 4LJZC 3VMMA 2NVQB 2CZGA 1HR0H 3MXNB 5J3BA 4DR6Q 3M4YA 4IUTA 2F52A 2Z4HA 2VQEL 1DXMA 4B9XA 5CBAE 1I6UA 2E2HB 4PMWA 2A68C 4J6HA 1CS0A 3GTQB 1V1OA 1VQ9A 4X3TA 1T5EA 5IYBG 5KFUA 1XTCD 3PQIA 4BY1B 1Z7TA 5M3MH 5T1GA 1RJPA 2R7NA 5ELEA 1S0OA 4YCVA 3FRPB 2JEJA 5EQ0A 1HR0L 2ZXRA 3E9IA 2VUMG 5J39A 5M3FB 4LSXA 3JRXA 2V4RA 3N40P 1A9XA 1F2MA 4I7ZC 4OONA 1KJ9A 2YL2A 1IYUA 5IT9L 5AFWA 3OHAA 1IHZA 2HVQA 3HOZG 2EJMA 3WNZA 3R2TA 4XQNA 1SJED 4ETSA 1NMFA 2RKSA 2SDFA 3F2UA 1FJGQ 3LMLA 4K5VA 4TVAB 2W6PA 3F8TA 3S1NH 1HTLD 3O13A 1N48A 4BWSC 2R7LA 3RBDA 5FLMG 2Q8TA 3CQZB 5KFPA 5C44G 1KHIA 1SNCA 4Y52H 1JE5A 4O0AA 1IYVA 4MV1A 1W93A 3AMUA 5EBCA 1Q81C 1VBHA 2HVRA 4TV8F 1KTKA 3U58A 3RNUA 2PW5A 2JA9A 1VQBA 4X62H 1UE5A 3G48A 1FVIA 2O5JC 1CK1A 1Y8NB 4A76A 1MSHA 1CUKA 2YCHA 4DL3A 1PH3A 4LH7A 3KK7A 1N33H 5C3EG 1AN7A 2I5MX 2HUGA 2F0WA 3J7YW 4ZKBB 1Q3LA 4DR4H 1EZ1A 5IYDG 2Y0SA 4J9KA 2EY5A 4JW0A 1V4YA 4A75A 1J9OA 3N52A 3FDSA 3IFTA 4OX9H 3OWFA 3I4OA 2RA4A 3FHWA 3KTMA 3P1HA 5IYZF 5FO8B 4C2MB 1N33L 4DK0A 4C3JB 4WFN3 3GTOB 2O03A 4FYDA 2RBMA 2X0SA 1QWYA 2RCFA 2XN9C 4IZ8A 3R5FA 2HDMA 1T36A 4IR1A 1S03G 1JJ2A 4O4HF 4DR4L 4J9QA 2D9UA 3U50C 5IP9H 4DUYQ 2P0AA 2FINB 1LACA 1BXTA 2R86A 2W9AA 1EY0A 4DV7Q 4O4IF 2M9VA 4OX9L 1AE2A 3NBHA 4L5RC 4F87A 4KI0A 4WJ4A 1ILPA 3OUUA 4AYBA 4OGQC 4KKSA 4LFCH 3RB3A 1MBYA 3I91A 3EVQA 4JI0Q 2W9CB 2R92H 4CDEC 2NU7B 2K5DA 4DNRB 3K5NA 4DXGA 4QW8A 1VQJA 3QFFA 4L5QA 4DL5A 3HOXB 2XIWA 1Q86C 5FD5A 4F4XA 4ED1A 4BBSG 4O2AF 2FP4B 3CMEA 3RUZA 2ALYB 1U5KA 4LF5Q 4A3GG 2KBNA 2CKZB 3F2CA 1IXRA 1SJHD 1W6JA 3UDIA 1XMOQ 4NXNQ 3S2HB 3V4SA 4LFCL 2K03A 3M9NB 3PZPA 4OL7A 1D7QA 4QW9A 1JWSD 5D3DA 4X6AH 2A68D 1F2ZA 1VMCA 3NK9A 1F2LA 2F0NA 4A3LH 1TY2A 4ZLTF 4LFAH 4PZ7A 3SHLA 1ESFA 2WAQA 5KFIA 3PO3H 3VYTA 4RB0A 2KUMA 4JI7Q 4PDBA 4B3MH 4I65A 4EGJA 1WTRA 3Q8QB 5KFEA 4KV6A 3K5LA 4GKKH 5JAVA 5GADC 4ED6A 3N44B 1IYJB 5IGBA 2NVYA 1H9SB 2R3ZA 1MJEA 1B4OA 3EA6A 3GIIA 4ZK9B 3LGJA 4LFAL 1OTCA 1S5CD 2EJFC 3FMAA 2VUMA 4A3JH 2K1BA 4IR9A 3MWDA 2O4XA 1LTSD 1RL2A 4OEMB 5GQOA 3PO2H 2QEXA 4GKKL 2UUAQ 1HFNA 4UCVA 3H0GG 5CV5A 3I4NG 1YIJA 1YEZA 2GPSA 1NTGA 5IOCA 1JT8A 4RAZA 3U9TA 1HA6A 1Z2NX 5KFCA 5EPKA 4R4IA 4XQQA 1N32Q 4BY7B 3A56A 3C3LA 4A3KB 1G2SA 1KJJA 2V5AA 3G8CA 3ND8A 1JWMD 2F3IA 4EGQA 2F0PA 3BQ2A 5KYLA 4XDXA 4JBJA 3HKZB 2AWOA 2SNSA 2L11A 1HPCA 1TWCB 3CP0A 3L0OA 1LTLA 2W8KA 4HMJA 1E4EB 2XIGA 4TKOB 4DUZH 1N36H 1TWFA 4DV3Q 4ZYSA 2QK4A 5CV9A 1KAWA 2RHQB 4JI5Q 3KF8B 4DV1H 1PV4A 5CV8A 4Q5VA 4BXXH 5DGBA 1EIFA 3PF5A 4HAEA 4BA2I 1A15A 5KT4A 4C5BA 3E5NA 1N36L 3CCMA 3F8NA 4DUZL 1FR3A 4JI0H 1B53A 2YU9H 4GNXA 2UUCH 1KJ8A 1MSGA 2DJGC 3AQQA 4CDDC 2BOSA 2NU9B 1SE4A 5A2QL 2K52A 4JV1A 3BDLA 4DV1L 4BBRH 1QCBD 1O80A 4IAJA 1X32A 4P73A 4FXDA 1ML0D 1ZQ7A 4LF5H 2R6GA 1GLVA 1HNZH 5BN3A 5ELFA 1WOCA 4KHPQ 5JVG3 1CA6A 3FEWX 5KG0A 5FO9B 2PMZA 4JI0L 1B8AA 2D0PA 1S4ZA 2K5NA 1SFOH 2UUCL 2ZJQA 2D0OA 2Z1CA 5LXTF 2A74C 3CC2A 1I4PA 1SYDA 2JA6B 2R7ZG 1RK5A 3C46A 1ESRA 2IWHA 1V8QA 1F9RA 4A93G 4LF5L 3RGXA 1SRUA 1HNZL 1LTAD 2B63B 4CKEA 2NU6B 1MIUA 4MV6A 2CCZA 4APMA 4X66H 4JI7H 1JJCB 1U9RA 4DR1H 2EYJA 2NTTA 5EKLA 2TMPA 2VUMH 3T5KA 1CSQA 1XNQQ 1TWGH 2VOBA 5M3MB 4UCRA 4ECWA 4YHHQ 2JP1A 1D1IA 2YW2A 2C00A 4QGUA 3MR3A 3B6YA 1HH2P 2K7VA 2ZDQA 4I7HA 3N43B 2NN6G 4DR1L 4B3MQ 5FLXW 4HJ7A 3CC7A 3TQTA 2F0DA 1TR5A 3DF7A 1E22A 5KFXA 3PIPA 5KX5F 5C44H 3RN5A 1KABA 3NBIA 1OXXK 4RKBA 1XDNA 4H44C 2VQFH 5DG9A 4Q43A 4IFDJ 1PH1A 1LABA 3ZJYC 3S1NB 3LP8A 2W9BA 3MR5A 3RB4A 4QIWB 4OWWB 5L1JA 4R4OA 3NTKA 4ECXA 1FYCA 4X65Q 3HFZB 1F9QA 3QIAA 1HQRD 3NTHA 5KFHA 2OEOA 4GKJH 5C3XA 5ELOA 1NBWA 4AQYQ 5JVDF 3P75A 1BCPC 4P71A 4JPBW 2KSWA 4UP9A 4MAMA 1NNXA 2GN5A 2VQFL 2E2DC 4EEQA 4R8NA 4DV6H 4G3IA 5JJLA 3V96A 2HQEA 5C3EH 1IBLQ 1SBBB 2UVUA 4V190 3SI8A 3HOWH 2A6HC 5IYDH 3T5JA 3H0GA 4GKJL 3T1YH 3KLRA 3NGDA 4HIMA 3HOYG 4LF8H 2JA8H 1A8VA 1TT2A 1TWAH 1YHBA 4GS3A 1SYCA 3BZCA 4BWGB 4DV6L 2R93B 5KFBA 2AGPA 1SSOA 4WBNF 3CRKC 4UY8C 2WACA 3MTSA 2F0HA 4FO2A 1C48A 4H13C 4ZKCB 3T1YL 3MFHA 1X9NA 4LF8L 2X69A 4IUPA 2F0OA 2G9DA 1R4PB 2FPPB 4DR3H 3ULJA 3BJUA 1GOZA 3RV3A 4LSAA 2IHFA 4C1NK 1S97A 2DPIA 4EYHB 1QNUA 4HCEA 1TXYA 3WOEA 2F0JA 2N55A 3PUZA 3TN2A 4ID6A 2WYOA 2PZUA 4DXFA 2XC9A 3J7ZC 2C2RA 1RF2D 2K5QA 3QOJA 1VQCA 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1O7ZA 4NP5A 5IGGA 4A3GH 3K81C 2R92B 3MJFA 3ONAB 3RJ0A 2N88A 4DAVA 4MHEA 3V05A 3M3YH 5KT6A 2WAQE 3I72A 2E2JB 4TQSA 1J6QA 1UNSA 2PI2E 3OMCA 2W71A 4DV2Q 3M7GA 2AQ4A 4RGTA 4DLKA 2DY8A 4X66L 4M1UB 4DAYA 5HURA 3TRZA 1SYFA 3KLSA 2AQ2B 4K14A 3QJYA 3FKIG 2VNUD 5IYCH 4YB8B 2R7ZA 5IGDA 2XGTA 1S40A 4JI2Q 4LAAA 2LXKA 5TSSA 3ORQA 5NUCA 1T3NA 1RTOA 1IBKQ 4XQJA 3LWEA 1HR0W 4XT3B 2FPIB 5EDWA 4HJ8A 2OLSA 3OW7A 5IP7G 2F0GA 5KG1A 3CQZH 1AFPA 5CORA 3G6YA 3KOJA 4HEDA 1E4FT 3CW2C 2XCPA 5CGKA 5C4HA 3H0GH 3VR3A 4CC5A 3I4NH 5CYUA 4B3SH 1STGA 4A3JB 1HNXH 3FDTA 3MXPA 1IKLA 3J7A5 3ICEA 3NQTA 1D5XC 1SMYC 2FJ2A 2K5VA 2HCIA 2UXBH 4KHZA 4YP3A 3BG3A 1JB7A 2Y0SB 3GTMA 4K5XA 1WTQA 1PH9A 2XTIA 2I80A 3PSIA 1OO9B 3RBEA 5AJ3L 1PH7A 4C3IG 3MFIA 4GN4B 1K9MC 4JBMA 5KFVA 4B3SL 1HNXL 4FU0A 1BCPD 3QB3A 4LFBQ 2UXBL 1AW7A 1LTID 4DK1A 3UDGA 4EBDA 5GONF 3PUXA 1S72A 1A6XA 1ENFA 5KG2A 1QOHA 1K3RA 5C6AA 3NBHB 1HZCA 4AYBB 2SEBD 3EFXD 1DGSA 3J80L 3RGZA 1PFNA 4C2MH 1SDFA 1LT6D 4C3JH 1WTHA 2KHIA 3AFQA 3PW5A 1EIHA 1T94A 2VQDA 1WVLA 2R82A 2MJ8A 4G4KA 4DV0Q 1JWUD 1I50A 5C0XJ 4A3MG 5FLXc 1N34H 1SROA 4TUYF 3SE7A 5IGFA 4RG1A 4EGVA 1CE8A 4ZQ3A 2YU9B 4MV3A 4KY6A 4LF6Q 1HRJA 1YNJD 4RGOS 2FPGB 4A3FG 4QWAA 4RHRA 1R4QB 4LUVA 1U4RA 2EYMA 3SVMA 1HUMA 4JBKA 5IGCA 5EOYA 1D1KA 4BBRB 5LP6F 3NPPA 1CKMA 3I55A 1I3QA 4IALA 2OWOA 3HOXH 1BF4A 1Y1VA 3ERSX 5JVLA 1N34L 3DXJC 2UUBQ 2KEEA 1JC7A 4A93H 2IT1A 3UDXA 2ASDA 1LYLA 4CJ1B 2CW0C 1LTGD 2Z8LA 2YZMA 3CPFA 3JAMW 3L7ZC 1SXTA 1M0TA 3MWYW 2DWCA 1QB5D 1WI5A 3QZ7A 4LF4H 5M9OA 4YAKB 3CRLC 3GTLA 4A3IG 4XT1B 1I5FA 1RCVD 4JI1Q 2HGSA 4XX0B 5KFYA 1G2TA 1KL9A 4U7CA 3STBC 2VUMB 4KN7C 1TWGB 5BR8Q 5K2MA 2KENA 5LL6b 2Z6KA 1GXDC 2NN6H 2F4VQ 4KN4C 4FM9A 4UDUC 5KT7A 4LF4L 2LSSA 3HOZB 1PRTB 2BDNA 3E0JA 3IN5A 3PUVA 4B3TQ 2MO1A 4IPCA 1WTOA 5EWFA 5C4JH 1CZGA 2JEFA 1T9HA 3F2BA 1UE6A 3NP8A 5JJIA 3V6JA 4RZRA 1DV2A 1Q82C 4A3BG 3FVQA 1C30A 4FDBA 4R4TA 1VQ7A 2YRWA 4LUOA 5LMNW 5BPFA 1G8ZD 4E4TA 4X64Q 2ASLA 3FKIA 5C44B 2EYLA 3VR4A 4B3RH 1EYZA 2VUGA 3OHXC 4YWMA 5I4DA 1STEA 3RLOA 1TWFB 4LFBH 4DPGA 1ENAA 2A5HA 2VB3X 4OXPA 2JN4A 3WO0A 4O2DA 1ASZA 1SMYD 4KK7A 2FMAA 2CWAA 2F4IA 1EY7A 3K5MA 1I6VC 4J1MA 3SK6A 4EVOA 2NUAB 4B3RL 1I50H 2ID0A 4EQOA 1B9NA 4ED7A 4JI8H 3I3CA 1PFMA 2FMCA 3BABA 3JC66 5C3EB 2IMWP 4GNXB 4ZAIA 4L8JA 2OQ0A 2WDTA 3TEHB 4TQUS 2K04A 5KFFA 4FF3A 3HOUG 3HOWB 4J9LA 3G6JB 2EYOA 3OTOH 2F0SA 2NU8B 1X6OA 4YWKA 3I2ZA 4F7XA 3TDQA 4YJ3F 2JEIA 4JI8L 2L0CA 4ECZA 3DLLA 4LH6A 2GPWA 2PMZB 1LTBD 2DZDA 1HNWH 5D3IB 1PFSA 2ZM6Q 2C22A 3FPUB 3CKIB 5JJZA 4YIJA 5F2DA 1XXGA 1LT3D 4CC6A 3M9BA 3GIQA 3VYRA 5CB4F 2DGYA 2ZXPA 2B8FA 4ZRZA 3SK4A 1A3VA 3OTOL 1A3TA 4ILWA 3CCVA 4CHTB 2EYHA 2YTVA 3NTIA 2XGPA 1CSPA 5EZYF 1R9TH 2WV6D 2CH4W 2ZJPA 5IT9c 4IHJF 1PRTF 4G7HC 3K5HA 2HD3A 1DONA 1HNWL 2HVSA 4JV5H 1EWHA 1PH2A 1JX4A 1XTDA 1VF5C 4F88A 2HIVA 2YYZA 1JE4A 1FL0A 4DR5Q 2JA6H 3BDCA 1L0XB 5A2QW 3CC4A 4QUCA 2RGRA 2WAQG 4BBSB 4YJ2F 4JI6Q 2EYFA 2B63H 1GSOA 4O3NA 3A8KE 4A3GB 1XNRQ 4DR7Q 2C2EA 5C5MA 2PNHA 4JV5L 4JYAH 3M3YB 4GOPC 3KAKA 2EXDA 2CW0D 4KKTA 2Q2HA 2Z6BA 1L0WA 2F0VA 1I94H 2KECA 3FKIH 5KG7A 4JI3H 1EUJA 4UCOA 1MGSA 1E24A 2PCFB 4O3SA 3I4LA 4H0LC 1N56A 1SR3A 2KHJA 3I12A 2W9BB 1LT4D 4F4YA 3Q24A 5JJKA 3STBD 4JYAL 2LS01 2MNAA 3AEVA 1WR2A 5GAHC 1V9PA 4EX5A 3BQ1A 3M9OB 1I94L 3Q1KA 5IP7H 5HGTA 2H5XA 4PMBA 1H9MA 4JI3L 2NN6I 3HGBA 2I5HA 3A5UA 4APVA 1RD9D 1VQ6A 4OWTB 2W7OA 2JA7G 5C8YF 4JG2A 4YWLA 4A3EG 1G6ZA 5ELBA 1VQHA 1V1PA 3HEJA 2V9WA 3J81i 4B08A 1STYA 1GSHA 3H0GB 3S2DH 5LMNQ 3I4NB 2B8GA 1HFGA 1SMXA 2UU9H 2UXCQ 5KG6A 2XSCA 3KBXA 1J5EQ 4C3IH 1QVCA 1Y14B 4J9RA 1KIXA 3ULLA 3T5HA 4OIJA 1GO3E 2YS6A 3JRWA 3NQIA 2VPSA 4IUNA 2EY6A 2BE5C 2UU9L 3RZOH 3JAMc 3H91A 2ASJA 2XD4A 1F9SA 1M0WA 2B2TC 5C5LA 2KOLA 1V43A 1CKNA 3H3VI 4NDXA 2R93H 4X62L 3E3XA 3CVZA 4QJFA 2YZGA 3AB9A 5CR3A 2W6NA 3Q0AA 2FK3A 3HS0C 3MXGA 3TQYA 3U4VA 1UE7A 1WD1A 4A3MH 1EUDB 1SNPA 1EFWA 2OQKA 4WORA 2BQRA 5FPOA 4N8X1 1B1ZA 5JEAH 4ECVA 1HUNA 4HNVA 1WTWA 4A3FH 2IX0A 2J4XA 2KVMA 1EUCB 3K0XA 3KFUA 4DR6H 4F4WA 5L1IA 2P5ZX 3CCQA 2DUDA 2R84A 1CQJB 2EZVA 1K28A 1Q1EA 1VMPA 2F0UA 2W8LA 1E1TA 4YCUA 2A69C 4RHSA 3VR2A 2A73B 3CPWA 5EGTA 1GUTA 4RAUC 4DAYB 5I6YA 1C4QA 4RNOA 2OH2A 4O3RA 5BPHA 4PZ6A 5DLGA 4RFBA 3H4BA 5IIFA 4A3CH 1UE1A 1B44D 1STAA 1WCMG 2KCNA 4DR6L 4C5AA 4P2CB 2E2JH 2KCMA 2QILA 1P8LA 4FXKC 2R7ZB 5H80A 1PTOC 3HB9A 3I7FA 4A93B 3GIPA 3MFYA 1O7YA 1FGBD 5C1OA 1Q12A 4L5SA 1UNNC 2R6FA 3H20A 2ALZA 1M8AA 4X3UA 3WOFA 5KYIA 4KMUC 3F2DA 3DEPA 1Z2OX 4IOAA 1JB3A 3RB0A 3CCUA 1FJGH 5EKKA 1UC9A 3J81E 4KY5A 3TP5A 1I6HH 3D6CA 1L1OC 2LFNA 3S24A 1EQVA 3C1EA 2DN8A 4NXMQ 4IURA 2PI2A 3A7LA 1EY4A 2F0MA 2IHEA 4O42A 5C3WA 4KLKA 1GYFA 2WINB 5K5PA 4K2LA 3MVVA 3GTMB 3W1GA 1DV1A 2N49A 4A3BH 3M4OH 4O3OA 1FJGL 4PNYA 4G7OC 2LY7A 3TS2A 1SNQA 5M5WH 4RUCA 5C4JB 1S9FA 4O4LF 3UQ8A 3BVGA 1CFMA 5KFTA 2PQAA 4GLAC 5EBDA 5KFKA 2AUJD 3DWPA 4C5CA 4MTKA 4HJ5A 2GVBA 1AUXA 4EEYA 1VQPA 4IFDI 4YY3Q 2MQHA 3HZXA 1IBMQ 1M7JA 4X3SA 1RJQA 4HTHA 5LL6S 2RDJA 4JK1C 1CQFA 1KBLA 1EY5A 2WB1A 1QVGA 2WKDA 1TS2A 3LX0A 3MFGA 2JA7A 1ZKOA 1K0RA 1D8LA 3D4RA 1RODA 1ZHQA 2K14A 3VA7A 3HOUH 1QG7A 3D4WA 1I50B 4MV9A 1MI2A 3MWEA 1EL0A 2EPBA 3T51B 3HOYB 1IL8A 4LUZA 1LO5D 3NENA 3Q22A 1WSCA 2BE5D 2BH8A 4FBUA 4OO1G 2XCAA 4DUYH 5L1KA 3ULPA 4DV7H 4O3PA 1CQIB 4HMIA 4JOIC 4BS9A 1B7YB 1HJPA 4XTCS 1RDPD 1MKHA 4UFZA 3I8ZA 1VQAA 2F0TA 2F3VA 1IKMA 4DUYL 3J80W 4UCSA 4MV7A 4DV7L 3DEOA 4K2KA 1SYEA 2GA4B 4YR0A 2W7PA 4NXNH 1XMOH 1R9TB 1VAJA 3TINA 1EY8A 4XXEA 2XNAC 2L15A 3K80C 3SEBA 1K1SA 1VF7A 2YYAA 4ED0A 4KY7A 3G6EA 5CC4A 4R8UA 1B70B 3OIPA 3M7NA 3OSNA 2K5HA 2A69D 1EIYB 2QKIC 2N8NA 2ZJRA 3IFDA 3KJOA 4FBTA 1S10A 3NUCA 4MV4A 5IYBH 4Q8FA 2NVYH 3JAME 3RFCA 4HJ9A 1KD1C 4NXNL 4UHVA 2XVSA 1XMOL 2DLNA 1KJIA 3BAAA 1PTOD 1RK6A
chains in the Genus database with same CATH topology
1YZ6A 5IP7G 2D62A 3CQZH 1TWCH 3KOJA 1NJIC 1N36Q 3CW2C 4DAMA 4DUZQ 2JK8A 3H0GH 1BBUA 4DR5L 3I4NH 3HOZH 5M5YH 2UU9Q 3M4PA 4OWXB 1GM5A 4JI6L 1A63A 1WFQA 5ELNA 4MNOA 4BA1I 4JI7L 3ICEA 3J7A5 1XNRL 4UP7A 2K5VA 4DR7L 2BH2A 4JOIA 1AH9A 4KHZA 4A3IH 1X54A 4X62Q 4DV1Q 1JB7A 1VQDA 4Y7NH 5GAGC 4IOCA 1PH9A 4AYBG 2XTIA 3PSIA 3EN2A 2HT1A 4UPAA 5AJ3L 3GTGH 3J81c 1PH7A 2A8VA 4GN4B 1Y1WG 5FLMH 1K9MC 4JBMA 1YHAA 2Z0SA 3PUYA 3KF6A 4B3SL 4JBWA 2UUCQ 1HNXL 4BXXG 4JCVE 1GKHA 1C0AA 4DK6C 1SN8A 1TWFH 1WYDA 4QQBX 1VQLA 4LFBQ 1UWVA 2UXBL 4DR4Q 3UDGA 2UUAL 1K8AC 4JC0A 3PUXA 1S72A 3FP9A 2NZOA 1HNZQ 1UEBA 1QVFA 1PYBA 1K3RA 3SGIA 3NBHB 1HZCA 1SE8A 2Z6KC 3JAMi 3RN2A 1Q7YC 2E5LL 1N32L 1DGSA 4BY1G 1YJNA 3CAMA 4BBRG 4C2MH 4C3JH 3F1ZA 1PH6A 2KHIA 3AFQA 3KF6B 1PHJA 4DR2Q 4H02A 5M3FG 4DV0Q 3RLFA 4LF9Q 3MXNB 5J3BA 5C0XJ 3NELA 4A3MG 1OXSC 3S14H 4DR6Q 5FLXc 1EQRA 1SROA 2F52A 3CF5A 1QUQA 2VQEL 4RG1A 5LMNL 4LF7Q 3AFPA 5IYCG 2UXCL 4DR1Q 1EOVA 4PMWA 4LF6Q 4DV3L 4A3FG 2VL6A 3PIOA 1J5EL 1C7YA 1VQ9A 2OTJA 1G6PA 3A5ZB 4LUVA 5IYBG 4JBKA 2ATWA 1PH5A 4DNIA 3S1MH 4JI5L 5M3MH 1CKMA 3I55A 2OWOA 3E9HA 4YCVA 1HR0L 3HOXH 3E9IA 2VUMG 3ERSX 2AHOB 1N34L 1Y1VG 2UUBQ 1VQGA 4A93H 2IT1A 1YVCA 4OONA 2E8GA 3UDXA 1LYLA 3BU2A 5IWAQ 1AE3A 4P72A 3HOZG 1VQKA 3CPFA 5C0XI 3L7ZC 2ZTEA 3GD7A 4QIWE 1WI5A 3UE1A 3KJPA 1NMFA 4YCWA 1QZHA 2AMCB 3S15H 1LM0A 4IPHA 3TS0A 1FJGQ 4A3IG 4KHPL 1I5FA 3PCOB 4JI1Q 2VQFQ 4TVAB 1KL9A 3F8TA 3OYYA 3S1NH 1Q8KA 4K0KQ 3STBC 4P74A 4BBSH 2B29A 1X55A 5FLMG 5BR8Q 2KENA 1KHIA 5C44G 4Y52H 2Z6KA 1JE5A 4O0AA 2F4VQ 1P16A 2B3GA 4LF4L 1RIPA 2LSSA 1YITA 4GKJQ 3L2PA 1Q81C 3GTJH 3U58A 1N8RC 3RNUA 3PUVA 4B3TQ 2MO1A 4IPCA 5C4JH 2JA9A 1EWIA 5EAYA 1Z9FA 2JQOA 3GTKH 4DV6Q 1T9HA 2A1AA 1VQBA 3F2BA 1KC8C 4DV5Q 2K4KA 4PZ8A 1UE6A 1UE5A 3G48A 5JJIA 1FVIA 1XNQL 1Q82C 4A3BG 4FDBA 4R4TA 1M90C 1VQ7A 1NY4A 4LUOA 5LMNW 3T1HQ 1XMQQ 4A76A 4X64Q 2JEAI 3GTPH 4YHHL 3T1YQ 1PA6A 1CUKA 2GVAA 4LF8Q 1PH3A 3DM3A 5C3EG 2I5MX 4YWMA 3RLOA 3Q8DA 4L5TA 5C4XH 4DPGA 5IYDG 4B3ML 4HIKA 4GN5A 3A0JA 4OXPA 4A75A 4EQ5A 5M5XH 4O2DA 1ASZA 3I4OA 3FHWA 2WB1E 2CWAA 3MEFA 2Q2UA 1VQNA 4B3RL 1I50H 2ID0A 1N33L 4IFDG 1E7ZA 1X3FA 3J80c 3HOVH 4DR3Q 1JJ2A 3JC66 3HOXG 4GOPB 1VQOA 2FXQA 4GNXB 4DR4L 4NXML 3U50C 4DUYQ 5IP9H 2OQ0A 3TEHB 4TQUS 4X65L 4A4IA 3HOUG 2UXDQ 1CKNB 4DV7Q 4OX9L 2Q2IA 1AE2A 4DV4Q 1PH8A 4L5RC 4KI0A 4WJ4A 3W5OA 1X6OA 4AQYL 3H15A 2JA5H 4YWKA 2JEBI 3I2ZA 4XIGS 4DKAC 1YJ9A 2JA7H 4A3EH 4JI8L 4X66Q 3DLLA 4JI0Q 2OTLA 2R92H 2JJQA 1VQ4A 5GROA 1LUZA 3M4QA 3RLNA 1PFSA 2ZM6Q 1IBLL 1VQ5A 3S1RH 1VQJA 3NEMA 4L5QA 1Q86C 3M9BA 4BBSG 2DGYA 3CMEA 4LF7L 2ALYB 3OTOL 4YY3L 3CCVA 1U5KA 4DK3C 4LF5Q 2YTVA 2KBNA 1IBML 2CKZB 4A3GG 3F2CA 1CSPA 1IXRA 4LW1A 3UDIA 2HIXA 1XMOQ 4NXNQ 4LFCL 1R9TH 4MZ9A 2ZJPA 1GD7A 5IT9c 1D7QA 5LMUQ 1HNWL 1PH2A 2IX1A 4X6AH 1O7IA 1XTDA 2HIVA 1OXUA 2YYZA 1EQQA 1FL0A 4A3LH 4DR5Q 2JA6H 3I4MH 2ZTCA 4PZ7A 1KRTA 1YJWA 3CCLA 2AWNA 3CC4A 3RZDH 2RF4A 2EQSA 2WAQG 1MJCA 1BKBA 3PO3H 4JI6Q 2B63H 5IWAL 4HIOA 4JI7Q 5FJ8G 4QL5A 3CCSA 1XNRQ 4DR7Q 1K73C 5GADC 3UE0A 3ER0A 2PNHA 3OW2A 4JV5L 1IYJB 1K83H 3KYHC 1HZBA 4RMFA 4GOPC 4BY7G 4R4QA 2BA0A 2EXDA 4GNXC 1MJEA 4JI4Q 4A3KG 5AJ3Q 3UDFA 1L0WA 2Q2HA 2Y0SE 3LGJA 4LFAL 1QZGA 4A3DH 3FKIH 1OTCA 1EUJA 3PV0A 2I5LX 4B3SQ 3HKZG 4A3JH 1HNXQ 2R7ZH 1E24A 1V1QA 1SR3A 2KHJA 2UXBQ 1RL2A 4GKKL 5GQOA 3PO2H 2QEXA 1PVOA 2UUAQ 5JJKA 3PUWA 3H0GG 3STBD 4JYAL 2MNAA 1YIJA 1YEZA 3AEVA 1NTGA 1Z47A 3I4NG 1JT8A 5GAHC 1V9PA 4EX5A 1I94L 3RR5A 4R4IA 5IP9G 5IP7H 1N32Q 2E5LQ 2H5XA 4WJ3M 4JI3L 2RHSB 2JA8G 4DV2L 2MFIA 2NN6I 3A5UA 2I5HA 2YTXA 4AYBE 2F3IA 4APVA 1VQ6A 4OWTB 1WCMH 4JBJA 2JA7G 1VQFA 4JG2A 2PQAB 4YWLA 3EIVA 2AWOA 1IL2A 3S1QH 4A3EG 1JMCA 2EIFA 1VQHA 3G4SA 1KRSA 3CP0A 3J81i 3KDFB 3L0OA 1LTLA 2LXJA 3TREA 2QGQA 2VQEQ 4JI2L 5LMNQ 3EBEA 3S2DH 3GTMH 1SMXA 2UXCQ 1IBKL 4DV3Q 1J5EQ 4C3IH 2VS1A 5JEAJ 1QVCA 1Y14B 1Y1WH 1KIXA 1YBYA 3GO5A 3ULLA 1KAWA 2RHQB 4JI5Q 3KF8B 1PV4A 1NE3A 1GVPA 2CQOA 1TWHH 2VW9A 4BXXH 1EIFA 1Q1BA 3PF5A 1WJJA 1GO3E 3D31A 2NVQH 1HR0Q 4BA2I 2HQLA 1N36L 1PH4A 3CCMA 1N34Q 4DUZL 3S17H 3RZOH 2UU9L 2R7FA 3JAMc 4GOPA 2YU9H 2E2HH 4GNXA 2JA6G 3GTQH 1CKOA 5HGQA 2ES2A 1V43A 3AQQA 1CKNA 3H3VI 1VQ8A 3IRBA 3PO3G 4BY1H 2R93H 2K52A 4X62L 4DV1L 4BBRH 2B63G 4P73A 4QJFA 2R6GA 1VS0A 1VQEA 1WOCA 1L1OB 4KHPQ 1BBWA 3TQYA 3U4VA 3KLWA 5M3FH 3H3VH 1UE7A 1Q46A 4JI0L 1B8AA 2D0PA 4A3MH 2K5NA 5M3MG 3GDEA 1SFOH 1EFWA 2D0OA 1XJVA 2UUCL 2OQKA 2ZJQA 3CC2A 3HOYH 4MTNA 4LFBL 2R7ZG 4A3FH 4LF4Q 2IX0A 4P75A 4A93G 4LF5L 3K0XA 3KFUA 1SRUA 1HNZL 1KQSA 5E7NA 3PO2G 1H95A 1X3GA 1MIUA 1VCIA 3CCQA 2CCZA 3D0FA 1JJCB 2DUDA 1I3QH 4GN3B 1Q1EA 5DLQE 4IJLA 1XPOA 2CFMA 1E1TA 4YCUA 2VY3A 3U4ZA 2VUMH 1CSQA 1Y1VH 1E3PA 1TWGH 3I56A 3CPWA 1XNQQ 4OO1I 2IY5B 2HHHQ 1KXLA 4DAYB 3G71A 4PZ6A 4DR2L 4HJAA 4YHHQ 5C0XG 4A3CH 2BA1A 1UE1A 4DV0L 1WCMG 2JE6I 4GLXA 1YI2A 4LF9L 4QGUA 4DR6L 2E2JH 3B6YA 2KCMA 5HY6A 1P8LA 1HH2P 2RCNA 3I7FA 5K36G 2N78A 2NN6G 4DR1L 1Q12A 4LF6L 1X65A 4UP8A 4B3MQ 4HJ7A 3CC7A 4L5SA 3CCRA 3GTLH 1G51A 4IJHA 1E22A 1K8GA 3E0EA 3F2DA 4JI4L 4LNQA 2WFWA 2YV5A 3PIPA 4AIMA 2OCEA 1S3OA 5C44H 4IOAA 3RN5A 1OXXK 2NZHA 3CCUA 3M85A 4B3RQ 1N33Q 1I6HH 1XPUA 1PH1A 2UUBL 3ZJYC 4IFDJ 1L1OC 1HZ9A 3K7AH 3S24A 4POGA 4NXMQ 4OWWB 2PI2A 4R4OA 4X65Q 2IHEA 3HFZB 2Q2TA 4IPDA 4KLKA 4OX9Q 5ELOA 1NBWA 1OXTA 3W1GA 4AQYQ 2N49A 4A3BH 3M4OH 2NVTH 1FGUA 1VQMA 1SLJA 4P71A 1FJGL 2R93G 3TS2A 4UP9A 5C4XG 5M5WH 3GTOH 2GN5A 3J81j 4JI1L 2VQFL 4JI8Q 4AH6A 4POFA 5IE8A 2PQAA 4GLAC 4K0KL 5JJLA 2QA4A 5C3EH 3PGZA 1IBLQ 5GAEC 5BR8L 2PMZE 4HJ5A 2MO0A 3KDFA 2F4VL 3HOWH 4LWCA 5IYDH 2GVBA 1W3SA 1VQPA 3OTOQ 4IFDI 4YY3Q 4GKJL 1ASYA 3HOVG 4HIMA 3HOYG 1YNXA 2MQHA 5JEAG 1IBMQ 2JA8H 2CWPA 1A8VA 4B3TL 1TWAH 1YHBA 3J80i 4GS3A 4LFCQ 3A74A 1QVGA 2WB1G 3BZCA 4DV6L 1HNWQ 1NMGA 4DV5L 3HKSA 1JJGA 4UY8C 4HIDA 1K0RA 2JA5G 1D8LA 2K50A 3T1HL 1XMQL 4X64L 2VZAA 4C3HH 4ALPA 1L2FA 3T1YL 2K14A 3HOUH 3VDYA 1C9OA 1X9NA 2R92G 4LF8L 2ZTDA 2E2IH 3S2HH 4J15A 2AKWB 3W1BA 3AYHB 2V1CC 2N3SA 1QUQB 4A3CG 1A0IA 4LUZA 3BJUA 3ULJA 3NENA 2IHFA 4IO9A 2YTYA 2BH8A 3S16H 4IPGA 4JV5Q 4OO1G 3CD6A 1TXYA 1L1OA 3PUZA 4R1JA 1HZAA 3ULPA 1XPRA 1PYSB 4LFAQ 4NB3A 3J7ZC 1X3EA 4JOIC 4GLVB 1VQIA 1B7YB 1HJPA 1VQCA 4XTCS 2C35B 4ME3A 5H1SE 2I0QA 4DR3L 1MKHA 4A3GH 3K81C 4QY7A 4GKKQ 4A3LG 2WP8J 1VQAA 3I4MG 4DUYL 4NPSA 4JYAQ 4PG3A 3M3YH 2WAQE 2UXDL 1X56A 2KCTA 4DV7L 2ASBA 4R4CA 1J6QA 1I94Q 4DV4L 2PI2E 4JI3Q 5IY0A 4DV2Q 1N9WA 3CCJA 3K7UC 1BVSA 3K80C 2L15A 1EYGA 4X66L 2HHHL 3TRZA 2R7DA 3G6EA 3CCEA 2ZM6L 3WWVA 4HJ8A 3CMAA 1B70B 5FJ8H 1YHQA 3FKIG 3M7NA 2K5HA 4A3DG 2VNUD 5IYCH 1E1OA 2A19A 3HKZE 1EIYB 1OXVA 2N8NA 2ZJRA 4A3JG 3KJOA 1G291 2XGTA 1S40A 4JI2Q 2LXKA 2K75A 5IYBH 4BY7H 2NVYH 1W2BA 1M1KC 1IBKQ 4HJ9A 4A3KH 3HOWG 1KD1C 2NVXH 4NXNL 1IZ6A 2Y0SG 3BZKA 1XMOL 3K8AA 1HR0W 3PF4A 3CXCA 5LMUL 1U0LA 1A62A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YZ6 A;  5IP7 G;  2D62 A;  3CQZ H;  1TWC H;  3KOJ A;  1NJI C;  1N36 Q;  3CW2 C;  4DAM A;  4DUZ Q;  2JK8 A;  3H0G H;  1BBU A;  4DR5 L;  3I4N H;  3HOZ H;  5M5Y H;  2UU9 Q;  3M4P A;  4OWX B;  1GM5 A;  4JI6 L;  1A63 A;  1WFQ A;  5ELN A;  4MNO A;  4BA1 I;  4JI7 L;  3ICE A;  3J7A 5;  1XNR L;  4UP7 A;  2K5V A;  4DR7 L;  2BH2 A;  4JOI A;  1AH9 A;  4KHZ A;  4A3I H;  1X54 A;  4X62 Q;  4DV1 Q;  1JB7 A;  1VQD A;  4Y7N H;  5GAG C;  4IOC A;  1PH9 A;  4AYB G;  2XTI A;  3PSI A;  3EN2 A;  2HT1 A;  4UPA A;  5AJ3 L;  3GTG H;  3J81 c;  1PH7 A;  2A8V A;  4GN4 B;  1Y1W G;  5FLM H;  1K9M C;  4JBM A;  1YHA A;  2Z0S A;  3PUY A;  3KF6 A;  4B3S L;  4JBW A;  2UUC Q;  1HNX L;  4BXX G;  4JCV E;  1GKH A;  1C0A A;  4DK6 C;  1SN8 A;  1TWF H;  1WYD A;  4QQB X;  1VQL A;  4LFB Q;  1UWV A;  2UXB L;  4DR4 Q;  3UDG A;  2UUA L;  1K8A C;  4JC0 A;  3PUX A;  1S72 A;  3FP9 A;  2NZO A;  1HNZ Q;  1UEB A;  1QVF A;  1PYB A;  1K3R A;  3SGI A;  3NBH B;  1HZC A;  1SE8 A;  2Z6K C;  3JAM i;  3RN2 A;  1Q7Y C;  2E5L L;  1N32 L;  1DGS A;  4BY1 G;  1YJN A;  3CAM A;  4BBR G;  4C2M H;  4C3J H;  3F1Z A;  1PH6 A;  2KHI A;  3AFQ A;  3KF6 B;  1PHJ A;  4DR2 Q;  4H02 A;  5M3F G;  4DV0 Q;  3RLF A;  4LF9 Q;  3MXN B;  5J3B A;  5C0X J;  3NEL A;  4A3M G;  1OXS C;  3S14 H;  4DR6 Q;  5FLX c;  1EQR A;  1SRO A;  2F52 A;  3CF5 A;  1QUQ A;  2VQE L;  4RG1 A;  5LMN L;  4LF7 Q;  3AFP A;  5IYC G;  2UXC L;  4DR1 Q;  1EOV A;  4PMW A;  4LF6 Q;  4DV3 L;  4A3F G;  2VL6 A;  3PIO A;  1J5E L;  1C7Y A;  1VQ9 A;  2OTJ A;  1G6P A;  3A5Z B;  4LUV A;  5IYB G;  4JBK A;  2ATW A;  1PH5 A;  4DNI A;  3S1M H;  4JI5 L;  5M3M H;  1CKM A;  3I55 A;  2OWO A;  3E9H A;  4YCV A;  1HR0 L;  3HOX H;  3E9I A;  2VUM G;  3ERS X;  2AHO B;  1N34 L;  1Y1V G;  2UUB Q;  1VQG A;  4A93 H;  2IT1 A;  1YVC A;  4OON A;  2E8G A;  3UDX A;  1LYL A;  3BU2 A;  5IWA Q;  1AE3 A;  4P72 A;  3HOZ G;  1VQK A;  3CPF A;  5C0X I;  3L7Z C;  2ZTE A;  3GD7 A;  4QIW E;  1WI5 A;  3UE1 A;  3KJP A;  1NMF A;  4YCW A;  1QZH A;  2AMC B;  3S15 H;  1LM0 A;  4IPH A;  3TS0 A;  1FJG Q;  4A3I G;  4KHP L;  1I5F A;  3PCO B;  4JI1 Q;  2VQF Q;  4TVA B;  1KL9 A;  3F8T A;  3OYY A;  3S1N H;  1Q8K A;  4K0K Q;  3STB C;  4P74 A;  4BBS H;  2B29 A;  1X55 A;  5FLM G;  5BR8 Q;  2KEN A;  1KHI A;  5C44 G;  4Y52 H;  2Z6K A;  1JE5 A;  4O0A A;  2F4V Q;  1P16 A;  2B3G A;  4LF4 L;  1RIP A;  2LSS A;  1YIT A;  4GKJ Q;  3L2P A;  1Q81 C;  3GTJ H;  3U58 A;  1N8R C;  3RNU A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  5C4J H;  2JA9 A;  1EWI A;  5EAY A;  1Z9F A;  2JQO A;  3GTK H;  4DV6 Q;  1T9H A;  2A1A A;  1VQB A;  3F2B A;  1KC8 C;  4DV5 Q;  2K4K A;  4PZ8 A;  1UE6 A;  1UE5 A;  3G48 A;  5JJI A;  1FVI A;  1XNQ L;  1Q82 C;  4A3B G;  4FDB A;  4R4T A;  1M90 C;  1VQ7 A;  1NY4 A;  4LUO A;  5LMN W;  3T1H Q;  1XMQ Q;  4A76 A;  4X64 Q;  2JEA I;  3GTP H;  4YHH L;  3T1Y Q;  1PA6 A;  1CUK A;  2GVA A;  4LF8 Q;  1PH3 A;  3DM3 A;  5C3E G;  2I5M X;  4YWM A;  3RLO A;  3Q8D A;  4L5T A;  5C4X H;  4DPG A;  5IYD G;  4B3M L;  4HIK A;  4GN5 A;  3A0J A;  4OXP A;  4A75 A;  4EQ5 A;  5M5X H;  4O2D A;  1ASZ A;  3I4O A;  3FHW A;  2WB1 E;  2CWA A;  3MEF A;  2Q2U A;  1VQN A;  4B3R L;  1I50 H;  2ID0 A;  1N33 L;  4IFD G;  1E7Z A;  1X3F A;  3J80 c;  3HOV H;  4DR3 Q;  1JJ2 A;  3JC6 6;  3HOX G;  4GOP B;  1VQO A;  2FXQ A;  4GNX B;  4DR4 L;  4NXM L;  3U50 C;  4DUY Q;  5IP9 H;  2OQ0 A;  3TEH B;  4TQU S;  4X65 L;  4A4I A;  3HOU G;  2UXD Q;  1CKN B;  4DV7 Q;  4OX9 L;  2Q2I A;  1AE2 A;  4DV4 Q;  1PH8 A;  4L5R C;  4KI0 A;  4WJ4 A;  3W5O A;  1X6O A;  4AQY L;  3H15 A;  2JA5 H;  4YWK A;  2JEB I;  3I2Z A;  4XIG S;  4DKA C;  1YJ9 A;  2JA7 H;  4A3E H;  4JI8 L;  4X66 Q;  3DLL A;  4JI0 Q;  2OTL A;  2R92 H;  2JJQ A;  1VQ4 A;  5GRO A;  1LUZ A;  3M4Q A;  3RLN A;  1PFS A;  2ZM6 Q;  1IBL L;  1VQ5 A;  3S1R H;  1VQJ A;  3NEM A;  4L5Q A;  1Q86 C;  3M9B A;  4BBS G;  2DGY A;  3CME A;  4LF7 L;  2ALY B;  3OTO L;  4YY3 L;  3CCV A;  1U5K A;  4DK3 C;  4LF5 Q;  2YTV A;  2KBN A;  1IBM L;  2CKZ B;  4A3G G;  3F2C A;  1CSP A;  1IXR A;  4LW1 A;  3UDI A;  2HIX A;  1XMO Q;  4NXN Q;  4LFC L;  1R9T H;  4MZ9 A;  2ZJP A;  1GD7 A;  5IT9 c;  1D7Q A;  5LMU Q;  1HNW L;  1PH2 A;  2IX1 A;  4X6A H;  1O7I A;  1XTD A;  2HIV A;  1OXU A;  2YYZ A;  1EQQ A;  1FL0 A;  4A3L H;  4DR5 Q;  2JA6 H;  3I4M H;  2ZTC A;  4PZ7 A;  1KRT A;  1YJW A;  3CCL A;  2AWN A;  3CC4 A;  3RZD H;  2RF4 A;  2EQS A;  2WAQ G;  1MJC A;  1BKB A;  3PO3 H;  4JI6 Q;  2B63 H;  5IWA L;  4HIO A;  4JI7 Q;  5FJ8 G;  4QL5 A;  3CCS A;  1XNR Q;  4DR7 Q;  1K73 C;  5GAD C;  3UE0 A;  3ER0 A;  2PNH A;  3OW2 A;  4JV5 L;  1IYJ B;  1K83 H;  3KYH C;  1HZB A;  4RMF A;  4GOP C;  4BY7 G;  4R4Q A;  2BA0 A;  2EXD A;  4GNX C;  1MJE A;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  1L0W A;  2Q2H A;  2Y0S E;  3LGJ A;  4LFA L;  1QZG A;  4A3D H;  3FKI H;  1OTC A;  1EUJ A;  3PV0 A;  2I5L X;  4B3S Q;  3HKZ G;  4A3J H;  1HNX Q;  2R7Z H;  1E24 A;  1V1Q A;  1SR3 A;  2KHJ A;  2UXB Q;  1RL2 A;  4GKK L;  5GQO A;  3PO2 H;  2QEX A;  1PVO A;  2UUA Q;  5JJK A;  3PUW A;  3H0G G;  3STB D;  4JYA L;  2MNA A;  1YIJ A;  1YEZ A;  3AEV A;  1NTG A;  1Z47 A;  3I4N G;  1JT8 A;  5GAH C;  1V9P A;  4EX5 A;  1I94 L;  3RR5 A;  4R4I A;  5IP9 G;  5IP7 H;  1N32 Q;  2E5L Q;  2H5X A;  4WJ3 M;  4JI3 L;  2RHS B;  2JA8 G;  4DV2 L;  2MFI A;  2NN6 I;  3A5U A;  2I5H A;  2YTX A;  4AYB E;  2F3I A;  4APV A;  1VQ6 A;  4OWT B;  1WCM H;  4JBJ A;  2JA7 G;  1VQF A;  4JG2 A;  2PQA B;  4YWL A;  3EIV A;  2AWO A;  1IL2 A;  3S1Q H;  4A3E G;  1JMC A;  2EIF A;  1VQH A;  3G4S A;  1KRS A;  3CP0 A;  3J81 i;  3KDF B;  3L0O A;  1LTL A;  2LXJ A;  3TRE A;  2QGQ A;  2VQE Q;  4JI2 L;  5LMN Q;  3EBE A;  3S2D H;  3GTM H;  1SMX A;  2UXC Q;  1IBK L;  4DV3 Q;  1J5E Q;  4C3I H;  2VS1 A;  5JEA J;  1QVC A;  1Y14 B;  1Y1W H;  1KIX A;  1YBY A;  3GO5 A;  3ULL A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  1PV4 A;  1NE3 A;  1GVP A;  2CQO A;  1TWH H;  2VW9 A;  4BXX H;  1EIF A;  1Q1B A;  3PF5 A;  1WJJ A;  1GO3 E;  3D31 A;  2NVQ H;  1HR0 Q;  4BA2 I;  2HQL A;  1N36 L;  1PH4 A;  3CCM A;  1N34 Q;  4DUZ L;  3S17 H;  3RZO H;  2UU9 L;  2R7F A;  3JAM c;  4GOP A;  2YU9 H;  2E2H H;  4GNX A;  2JA6 G;  3GTQ H;  1CKO A;  5HGQ A;  2ES2 A;  1V43 A;  3AQQ A;  1CKN A;  3H3V I;  1VQ8 A;  3IRB A;  3PO3 G;  4BY1 H;  2R93 H;  2K52 A;  4X62 L;  4DV1 L;  4BBR H;  2B63 G;  4P73 A;  4QJF A;  2R6G A;  1VS0 A;  1VQE A;  1WOC A;  1L1O B;  4KHP Q;  1BBW A;  3TQY A;  3U4V A;  3KLW A;  5M3F H;  3H3V H;  1UE7 A;  1Q46 A;  4JI0 L;  1B8A A;  2D0P A;  4A3M H;  2K5N A;  5M3M G;  3GDE A;  1SFO H;  1EFW A;  2D0O A;  1XJV A;  2UUC L;  2OQK A;  2ZJQ A;  3CC2 A;  3HOY H;  4MTN A;  4LFB L;  2R7Z G;  4A3F H;  4LF4 Q;  2IX0 A;  4P75 A;  4A93 G;  4LF5 L;  3K0X A;  3KFU A;  1SRU A;  1HNZ L;  1KQS A;  5E7N A;  3PO2 G;  1H95 A;  1X3G A;  1MIU A;  1VCI A;  3CCQ A;  2CCZ A;  3D0F A;  1JJC B;  2DUD A;  1I3Q H;  4GN3 B;  1Q1E A;  5DLQ E;  4IJL A;  1XPO A;  2CFM A;  1E1T A;  4YCU A;  2VY3 A;  3U4Z A;  2VUM H;  1CSQ A;  1Y1V H;  1E3P A;  1TWG H;  3I56 A;  3CPW A;  1XNQ Q;  4OO1 I;  2IY5 B;  2HHH Q;  1KXL A;  4DAY B;  3G71 A;  4PZ6 A;  4DR2 L;  4HJA A;  4YHH Q;  5C0X G;  4A3C H;  2BA1 A;  1UE1 A;  4DV0 L;  1WCM G;  2JE6 I;  4GLX A;  1YI2 A;  4LF9 L;  4QGU A;  4DR6 L;  2E2J H;  3B6Y A;  2KCM A;  5HY6 A;  1P8L A;  1HH2 P;  2RCN A;  3I7F A;  5K36 G;  2N78 A;  2NN6 G;  4DR1 L;  1Q12 A;  4LF6 L;  1X65 A;  4UP8 A;  4B3M Q;  4HJ7 A;  3CC7 A;  4L5S A;  3CCR A;  3GTL H;  1G51 A;  4IJH A;  1E22 A;  1K8G A;  3E0E A;  3F2D A;  4JI4 L;  4LNQ A;  2WFW A;  2YV5 A;  3PIP A;  4AIM A;  2OCE A;  1S3O A;  5C44 H;  4IOA A;  3RN5 A;  1OXX K;  2NZH A;  3CCU A;  3M85 A;  4B3R Q;  1N33 Q;  1I6H H;  1XPU A;  1PH1 A;  2UUB L;  3ZJY C;  4IFD J;  1L1O C;  1HZ9 A;  3K7A H;  3S24 A;  4POG A;  4NXM Q;  4OWW B;  2PI2 A;  4R4O A;  4X65 Q;  2IHE A;  3HFZ B;  2Q2T A;  4IPD A;  4KLK A;  4OX9 Q;  5ELO A;  1NBW A;  1OXT A;  3W1G A;  4AQY Q;  2N49 A;  4A3B H;  3M4O H;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  4P71 A;  1FJG L;  2R93 G;  3TS2 A;  4UP9 A;  5C4X G;  5M5W H;  3GTO H;  2GN5 A;  3J81 j;  4JI1 L;  2VQF L;  4JI8 Q;  4AH6 A;  4POF A;  5IE8 A;  2PQA A;  4GLA C;  4K0K L;  5JJL A;  2QA4 A;  5C3E H;  3PGZ A;  1IBL Q;  5GAE C;  5BR8 L;  2PMZ E;  4HJ5 A;  2MO0 A;  3KDF A;  2F4V L;  3HOW H;  4LWC A;  5IYD H;  2GVB A;  1W3S A;  1VQP A;  3OTO Q;  4IFD I;  4YY3 Q;  4GKJ L;  1ASY A;  3HOV G;  4HIM A;  3HOY G;  1YNX A;  2MQH A;  5JEA G;  1IBM Q;  2JA8 H;  2CWP A;  1A8V A;  4B3T L;  1TWA H;  1YHB A;  3J80 i;  4GS3 A;  4LFC Q;  3A74 A;  1QVG A;  2WB1 G;  3BZC A;  4DV6 L;  1HNW Q;  1NMG A;  4DV5 L;  3HKS A;  1JJG A;  4UY8 C;  4HID A;  1K0R A;  2JA5 G;  1D8L A;  2K50 A;  3T1H L;  1XMQ L;  4X64 L;  2VZA A;  4C3H H;  4ALP A;  1L2F A;  3T1Y L;  2K14 A;  3HOU H;  3VDY A;  1C9O A;  1X9N A;  2R92 G;  4LF8 L;  2ZTD A;  2E2I H;  3S2H H;  4J15 A;  2AKW B;  3W1B A;  3AYH B;  2V1C C;  2N3S A;  1QUQ B;  4A3C G;  1A0I A;  4LUZ A;  3BJU A;  3ULJ A;  3NEN A;  2IHF A;  4IO9 A;  2YTY A;  2BH8 A;  3S16 H;  4IPG A;  4JV5 Q;  4OO1 G;  3CD6 A;  1TXY A;  1L1O A;  3PUZ A;  4R1J A;  1HZA A;  3ULP A;  1XPR A;  1PYS B;  4LFA Q;  4NB3 A;  3J7Z C;  1X3E A;  4JOI C;  4GLV B;  1VQI A;  1B7Y B;  1HJP A;  1VQC A;  4XTC S;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1MKH A;  4A3G H;  3K81 C;  4QY7 A;  4GKK Q;  4A3L G;  2WP8 J;  1VQA A;  3I4M G;  4DUY L;  4NPS A;  4JYA Q;  4PG3 A;  3M3Y H;  2WAQ E;  2UXD L;  1X56 A;  2KCT A;  4DV7 L;  2ASB A;  4R4C A;  1J6Q A;  1I94 Q;  4DV4 L;  2PI2 E;  4JI3 Q;  5IY0 A;  4DV2 Q;  1N9W A;  3CCJ A;  3K7U C;  1BVS A;  3K80 C;  2L15 A;  1EYG A;  4X66 L;  2HHH L;  3TRZ A;  2R7D A;  3G6E A;  3CCE A;  2ZM6 L;  3WWV A;  4HJ8 A;  3CMA A;  1B70 B;  5FJ8 H;  1YHQ A;  3FKI G;  3M7N A;  2K5H A;  4A3D G;  2VNU D;  5IYC H;  1E1O A;  2A19 A;  3HKZ E;  1EIY B;  1OXV A;  2N8N A;  2ZJR A;  4A3J G;  3KJO A;  1G29 1;  2XGT A;  1S40 A;  4JI2 Q;  2LXK A;  2K75 A;  5IYB H;  4BY7 H;  2NVY H;  1W2B A;  1M1K C;  1IBK Q;  4HJ9 A;  4A3K H;  3HOW G;  1KD1 C;  2NVX H;  4NXN L;  1IZ6 A;  2Y0S G;  3BZK A;  1XMO L;  3K8A A;  1HR0 W;  3PF4 A;  3CXC A;  5LMU L;  1U0L A;  1A62 A; 
#chains in the Genus database with same CATH topology
 3Q8S B;  2NVT B;  1F2Y A;  1X3P A;  5LOV F;  5JUM A;  1BJT A;  1AP0 A;  1QNK A;  5C5J A;  1S5E D;  5KKN B;  2I46 A;  4G57 A;  3DWA A;  3FKI B;  3HOZ H;  1WCM A;  1E4G T;  5D1P A;  1LTT D;  3QR8 A;  1SAP A;  5ELN A;  4JI7 L;  3BZD B;  5FOB B;  2BH2 A;  1B33 N;  3J7A F;  1X54 A;  5DNF A;  2UUA H;  2C2D A;  1VQD A;  3VYU A;  4IOC A;  3GTJ A;  1EIG A;  3SE0 A;  2ICI A;  2QDB A;  1SNM A;  1STH A;  1B3Q A;  1Y1W G;  2DJF C;  5FLM H;  1B3A A;  4IRC A;  1N32 H;  1YHA A;  3PUY A;  3V6H A;  3PW2 A;  1KDA A;  1TWH A;  4JBW A;  3MA2 B;  1K0S A;  4K6D A;  4JCV E;  4QB4 A;  1O75 A;  2L4N A;  4U68 A;  5L9X A;  1TWF H;  4QQB X;  3GTP A;  4WJW A;  1UWV A;  4RAY A;  2UUA L;  4IN3 A;  2W6O A;  4JC0 A;  4M8A A;  2G5D A;  2NZO A;  3GTQ A;  1ZYR C;  3S2D B;  3DUZ A;  1WTX A;  1SE8 A;  1N32 L;  3MAQ A;  5T14 A;  1EQT A;  4DV3 H;  4K5W A;  4C3I B;  5KFQ A;  3H40 A;  2VXW A;  4ODG A;  1BR9 A;  1EZ6 A;  2K01 A;  4NMZ A;  3W2D A;  4JI5 H;  3KF6 B;  1PHJ A;  4DR2 Q;  2XGQ A;  3RLF A;  4LF9 Q;  4ME5 A;  3S14 H;  1BBX C;  3PN1 A;  2B2W C;  3CF5 A;  1QUQ A;  2FLN A;  4OHJ A;  3RZO B;  2FMM A;  3AFP A;  4RNM A;  3V6K A;  1EOV A;  4F4Z A;  4DV3 L;  3Q8P B;  1T5X D;  3LWB A;  1C7Y A;  2VL6 A;  3PIO A;  2OTJ A;  3A5Z B;  3KHR A;  2ATW A;  3BS1 A;  1PH5 A;  4DNI A;  1DM0 B;  1E0B A;  1EY9 A;  4JI5 L;  4XYO A;  3C1F A;  2K6A A;  3QO2 A;  4KHP H;  4NLG A;  1EYC A;  1SND A;  1Y1V G;  3KHH A;  1VQG A;  3R5X A;  2DY7 A;  4A3M B;  1HHV A;  3OPO A;  3BU2 A;  2ICE C;  1X3Q A;  2RDG A;  3K59 A;  5CBE E;  4G7Z C;  2ZXO A;  5C0X I;  2WE6 A;  4A3F B;  3GD7 A;  3UE1 A;  4ECR A;  4YCW A;  2AMC B;  3GQC A;  2MCT A;  4HNT A;  4IPH A;  4KHP L;  3PCO B;  2ENB A;  4EFE A;  1H9K A;  4O1N A;  4S3S A;  3OYY A;  2OXP A;  4K0K Q;  3M9M B;  4I55 F;  1NR2 A;  4BBS H;  2B29 A;  1LLR D;  3PMF A;  1XNQ H;  3ETH A;  2Q8R E;  5A2Q E;  4MN3 A;  4TQR A;  2B3G A;  1K1Q A;  1RIP A;  1YIT A;  4JV0 A;  4ZHQ F;  3DHQ A;  1AZP A;  4YHH H;  3L2P A;  3GTJ H;  5KND A;  1N8R C;  4ECT A;  1VKZ A;  3OSP A;  3LWU A;  5FO7 B;  4FF4 A;  2Q8I B;  1Z9F A;  2JQO A;  5DG7 A;  2J7Z A;  2A1A A;  4A3I B;  5KFW A;  1SEB D;  1LV9 A;  3SK8 A;  2K4K A;  4DV5 Q;  4GZY C;  4PZ8 A;  4Y7N B;  4IUQ A;  3VPC A;  1D5M C;  1XNQ L;  1DJR D;  3MC0 B;  1I4H A;  2L5T A;  3T1H Q;  1XMQ Q;  3GTP H;  2JEA I;  4EQN A;  3K0Y A;  4OEL B;  4YHH L;  1KDC A;  4FF1 A;  1V1P B;  2RSO A;  2J6S A;  1ENC A;  3RV4 A;  1I6H B;  1B6R A;  1DD2 A;  4DL7 A;  4L5T A;  2G9H D;  1E2W A;  2PYK A;  4B3M L;  4HIK A;  4QF4 A;  4GN5 A;  2RSN A;  1F77 A;  3S9W A;  4X65 H;  4KD3 A;  4EQ5 A;  2MPM A;  1JDE A;  3JZI A;  2WB1 E;  2D2C C;  3MEF A;  3QOL A;  3M4O B;  4A3B B;  4AQY H;  5IT9 W;  4FS1 A;  2XWB B;  3MHB A;  2B2U A;  2E76 C;  3ZYY X;  5M5W B;  4IFD G;  2FLP A;  1H9J A;  1X3F A;  4JUZ A;  2R61 A;  3J80 c;  1DYQ A;  2ZT9 C;  1XWE A;  1UUP A;  3LNN A;  1VQO A;  4DR2 H;  1IBL H;  2OF1 A;  4C3H G;  1Y8O B;  2W70 A;  4X65 L;  2UXD Q;  2E2I A;  1CKN B;  2F0Q A;  2Q2I A;  3X3N A;  4DV4 Q;  1PH8 A;  3W5O A;  3C0F B;  4AQY L;  5FK9 C;  4L6T B;  3D8G A;  2JEB I;  3H09 A;  4XIG S;  3U9O A;  4DKA C;  1YJ9 A;  1Y1W A;  2NYZ D;  2EYP A;  1ZYR D;  2OTL A;  3S1M B;  1VQ4 A;  5GRO A;  4Y8V B;  3M4Q A;  1WTV A;  3RLN A;  1IBL L;  1KNE A;  5LYJ F;  4C56 C;  2EDG A;  3NEM A;  3IG0 A;  1PX2 A;  3HOU B;  4DK3 C;  4IUV A;  5KFS A;  1GJX A;  3NXW A;  2JXM B;  5ELC A;  2R7M A;  2HIX A;  5FD6 A;  4QWB A;  2A6H D;  4MZ9 A;  1GD7 A;  5LMU Q;  1ILQ A;  3TP7 A;  1S0M A;  2A6E C;  1EU3 A;  2IX1 A;  3K5O A;  4M9U A;  4F50 A;  2B39 A;  1TVX A;  5HV6 A;  2L55 A;  3EQL C;  4ZI7 F;  1DOK A;  3MR2 A;  3G6X A;  1PTO F;  2AWN A;  4N8F A;  2RF4 A;  3RZD H;  1WH2 A;  3GV7 B;  1MJC A;  4Q0Y A;  1II3 A;  3A54 A;  2V58 A;  3R2I A;  4L1K A;  5FJ8 G;  3CCS A;  3T5L A;  3BYY B;  4NKL A;  3OIQ A;  1AEX A;  1K73 C;  4GC7 A;  1XX8 A;  5E3F A;  1HZB A;  4RMF A;  4J9P A;  1BNC A;  2NVX A;  3A8I E;  3ERO A;  3EJI A;  3H4D A;  2JYO A;  3WDN A;  1SYG A;  2B2Y C;  5J1Z A;  4RZQ A;  3R23 A;  5KFN A;  3BA9 A;  4DV2 H;  2I5L X;  1EFI D;  2R8H A;  2R7Z H;  2R85 A;  5CV7 A;  1L0Y B;  4RGM A;  4I50 F;  1TWC A;  2WAQ B;  2R8J A;  2FHT A;  2RDH A;  1PVO A;  4ULL A;  2F03 A;  3U9S A;  1U4P A;  3G6V A;  4JI2 H;  4J0M A;  3RR5 A;  5IP9 G;  5J2U F;  2E5L Q;  2NVY B;  1IBK H;  1KC7 A;  2RHS B;  4DV2 L;  2YTX A;  1ZXT A;  3NHH A;  4GC6 A;  5M5X B;  1VQF A;  2AGO A;  2PQA B;  1JMC A;  3G4S A;  3T4A C;  1BGW A;  3UFX B;  3TRE A;  2QGQ A;  3T16 A;  2VQE Q;  4JI2 L;  4IWX A;  3GTM H;  4CBV A;  1G91 A;  5C1P A;  4KHV A;  1IBK L;  4EYI B;  5DAU A;  2VS1 A;  1Y1W H;  3R93 A;  1YBY A;  1O78 A;  3PVX A;  4EG0 A;  1GVP A;  2CQO A;  3RF2 A;  1WJJ A;  2JA7 B;  1SYX B;  1HR0 Q;  4J8Q A;  2HQL A;  4O2B F;  4A3E B;  1PH4 A;  5E4W C;  3PW0 A;  3URY A;  4GOP A;  1EZ8 A;  1MHW C;  1HCZ A;  5JPN C;  1V51 A;  1CKO A;  1EEF D;  2WKC A;  5COY A;  3S1R B;  2ES2 A;  2YS7 A;  4XZ3 B;  1CZW A;  2UVR A;  1TAE A;  3PO3 G;  1FNV A;  5JVH 3;  2F0F A;  1S5D D;  3RAQ A;  1VQE A;  1JR0 D;  4J9S A;  1BBW A;  5KFJ A;  3KLW A;  2K28 A;  4QUF A;  3H3V H;  1SEI A;  1Q46 A;  5BN4 A;  2I87 A;  3GDE A;  5D1O A;  1XJV A;  4PQX A;  2DPJ A;  3HOY H;  4MTN A;  5KFL A;  4LFB L;  2KA7 A;  5KG4 A;  3JSN A;  1TY0 A;  4DV0 H;  1YNN C;  3S14 B;  5LA6 F;  3PO2 G;  3T56 B;  1EY6 A;  2Z4I A;  5F9L A;  4GN3 B;  1I3Q H;  2F0L A;  1ULZ A;  1PXU A;  3J7A V;  5KG3 A;  5DLQ E;  4LF6 H;  3V4Z A;  4IJL A;  1ET9 A;  1ICW A;  1XPO A;  3S15 H;  2VY3 A;  3Q2O A;  1Y1V H;  2IY5 B;  4OO1 I;  1CA5 A;  4ED2 A;  1KXL A;  2B2V C;  4MTD A;  5EPL A;  5C0X G;  2A6E D;  1NR4 A;  4R8U B;  1PLF A;  3VR5 A;  4DV0 L;  1M6V A;  5BN5 A;  4GLX A;  1YI2 A;  2UVW A;  3GV5 B;  5CMD A;  1KEE A;  2UUB H;  5K36 G;  2FB9 A;  5T1I A;  4LF6 L;  1GHK A;  3KXY T;  4UP8 A;  3GTL H;  3CCR A;  2MHV A;  4FP5 D;  4DGZ A;  4RKL A;  3E0E A;  5G3L D;  2WFW A;  2YV5 A;  4AIM A;  3GP7 A;  3K6O A;  1EU4 A;  2B2T A;  2OCE A;  4L63 B;  5KEE A;  2PN1 A;  3E5S A;  1EYD A;  2NZH A;  3RD4 A;  1N33 Q;  3PR4 A;  3GV8 B;  4JI1 H;  1GUG A;  3KLS X;  2XWJ B;  4J9N A;  2UUB L;  1WCM B;  1RJR A;  4LMY A;  1PZI D;  4R9W A;  3K7A H;  3X3M A;  1ICF B;  3OWE B;  4MA5 A;  1Q8I A;  5BR8 H;  2F4V H;  3A7A B;  1DOL A;  4IPD A;  4OX9 Q;  2R8G A;  2L1B A;  5JQW A;  5C4Z A;  2IBK A;  3GTJ B;  1KNA A;  4LMQ D;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  5C4X G;  4B3T H;  3J81 j;  4JI1 L;  2VA2 A;  1NAP A;  2F1M A;  4AH6 A;  5EKI A;  1PZK D;  4POF A;  1FNU A;  1K3B C;  1TWH B;  5L37 A;  3QZ8 A;  5I2Y A;  5GAE C;  4FVM A;  5BR8 L;  2FK2 A;  4MTE A;  2PZT A;  2KJX A;  2MO0 A;  3KDF A;  2F4V L;  4LWC A;  3GTP B;  3N41 B;  3SDZ A;  4X64 H;  1W3S A;  4FF2 A;  3S17 B;  1QE6 A;  3J81 L;  3HOV G;  1YNX A;  3OSO A;  1TU2 B;  2W6Z A;  2CWP A;  3BJY A;  4B3T L;  2RGV A;  1BCP F;  5FLX E;  4DU9 A;  4LFC Q;  2WB1 G;  1KLG D;  2FE3 A;  1JQY D;  1LT5 D;  2ZDG A;  4IFD H;  3HKS A;  5D65 A;  5CV4 A;  3GTG A;  1WD0 A;  2JA5 G;  2IL8 A;  1FKA H;  3NWS A;  4X64 L;  2VZA A;  4C3H H;  4DAP A;  4ALP A;  3KUP A;  1L2F A;  5BMV F;  2R92 A;  4RGN A;  4K8J A;  2ZTD A;  2NWG A;  4J15 A;  3W1B A;  4Q8E A;  2N3S A;  1BUV T;  1QUQ B;  1A0I A;  1SNO A;  1VBG A;  2SNM A;  4IO9 A;  2YTY A;  4CDF C;  3S16 H;  3CD6 A;  1L1O A;  1HZA A;  2H4O A;  1PYS B;  4LFA Q;  4NB3 A;  1JOR A;  5KFA A;  1X3E A;  4GLV B;  2RVL A;  1VQI A;  5J22 A;  2HCC A;  1I7L A;  1PFB A;  3BG5 A;  3KBG A;  2XCL A;  2M00 A;  2IA6 A;  5EWE A;  4GKK Q;  1BQQ T;  2YZN A;  2ZM6 H;  3I4M G;  3FPP A;  4NPS A;  4PG3 A;  3E6Z X;  1X56 A;  2KCT A;  5HBR B;  1AZQ A;  1A2T A;  2IX3 A;  2OT2 A;  1PDQ A;  1KAA A;  1M4V A;  4HCS A;  5IY0 A;  2PBZ A;  4ECQ A;  1N9W A;  1YNN D;  3K7U C;  3I73 A;  1EYA A;  3CCJ A;  3J7A K;  2EJG C;  4Q0F A;  1EYG A;  4CKC A;  2ZM6 L;  3QG1 A;  5FJ8 H;  1YHQ A;  4A3D G;  3RIZ A;  1E1O A;  2A19 A;  2L9H A;  3HKZ E;  5DQG A;  4DL4 A;  2NB0 A;  4DR5 H;  1G29 1;  2W57 A;  2UVV A;  3RMH A;  2K75 A;  1BO0 A;  3RZD B;  1S5F D;  2Z9H A;  1W2B A;  1M1K C;  4IQZ A;  3HOW G;  1TII D;  4JI6 H;  3L9A X;  4FXG C;  3BZK A;  4RU9 A;  3K8A A;  3PF4 A;  1XNR H;  4DR7 H;  5DM7 3;  2JA8 G;  1GM5 A;  1B04 A;  1YZ6 A;  3K3P A;  4I7A A;  4IRK A;  2WTF A;  2D62 A;  3HP3 A;  1F9P A;  1S68 A;  1CQV A;  1NJI C;  1N36 Q;  4CDC C;  4DAM A;  4DUZ Q;  4DR5 L;  2JK8 A;  2C5C A;  2BQU A;  3GIJ A;  3H6M A;  4OWX B;  1BDO A;  1L2Z A;  1RYR A;  4JI6 L;  1B2T A;  2DNE A;  4QWE A;  2K5W A;  1WFQ A;  4MNO A;  2CH4 A;  1XNR L;  4UP7 A;  4DR7 L;  1JJG A;  1FNW A;  4JOI A;  4A3I H;  4DV1 Q;  3P7J A;  4Y7N H;  2EE1 A;  1NSN S;  3MZ5 A;  1PTO H;  3KHL A;  3EN2 A;  4RCO A;  5FKA C;  3BDO A;  2HT1 A;  2K32 A;  3JAM L;  3GTG H;  2A8V A;  3GTK A;  2LKV A;  2Z0S A;  3Q23 A;  2UUC Q;  2JEG A;  1GKH A;  1C0A A;  1B50 A;  1VQL A;  3GLK A;  3R3O A;  2J6T A;  1BNZ A;  2YU9 A;  3FP9 A;  4K8I A;  1HNZ Q;  4A2B A;  2E2I B;  1PYB A;  4MIU A;  1STN A;  5LMN H;  5FPR A;  3JAM i;  2NBF A;  1Q7Y C;  2UXC H;  5DLF A;  4BY1 G;  1J5E H;  3CAM A;  1Y1W B;  2EY2 A;  1RYS A;  3N6R A;  1PH6 A;  3ETJ A;  3GV3 A;  5IT9 E;  3OHB A;  1E2Z A;  3D4D A;  1U4L A;  4H02 A;  5M3F G;  4IWY A;  4KTA A;  1SFO A;  3NEL A;  1OXS C;  1EQR A;  1GUN A;  2PQE A;  4LF7 Q;  3GID A;  5LMN L;  5IYC G;  2UXC L;  4DR1 Q;  5KFM A;  1J5E L;  1G6P A;  4V0B A;  4YQW A;  1Z6H A;  3CHB D;  4U6P A;  3VPB A;  4ZOL F;  3S1M H;  2PW7 A;  5DG8 A;  3E9H A;  2IW3 A;  2RQX A;  4ME6 A;  3KHG A;  2JA5 A;  4K6L A;  2V4Q A;  2TSS A;  1BOS A;  1TS3 A;  2AHO B;  1TWG A;  3PW7 A;  3RTX A;  1YVC A;  4IUU A;  5G3L F;  2E8G A;  4FS2 A;  5IWA Q;  1AE3 A;  3NE5 B;  4P72 A;  2AQ3 B;  1VQK A;  2W6M A;  2EVB A;  2ZTE A;  4I4T F;  1LTR D;  4QIW E;  1IW7 C;  4ZCK A;  3KJP A;  1Y69 U;  4QWC A;  2RDI A;  2WII B;  3BYT B;  3KAJ A;  4B9W A;  1QZH A;  2IP4 A;  1JIC A;  1LM0 A;  2AGQ A;  2C28 A;  3TS0 A;  2NVX B;  2CW8 A;  5KGU A;  1TS4 A;  2VQF Q;  1I3Q B;  5C0X H;  3IAY A;  1Q8K A;  4IZO A;  4O3Q A;  3K58 A;  4P74 A;  3BVM A;  4DA2 A;  5KNB A;  3S15 B;  1X55 A;  1Y1V B;  5E4X A;  5K36 H;  3RUP A;  1HTP A;  1P16 A;  4RH6 A;  4GKJ Q;  3MWM A;  5M5Y B;  2AUK A;  4Z9C B;  2F0I A;  1Q90 A;  4QWD A;  1STB A;  4XYM B;  1DCZ A;  2CVR A;  5DQI A;  1EWI A;  5EAY A;  3GTK H;  1PZJ D;  4ABN A;  4DV6 Q;  1KC8 C;  5KT3 A;  3GTL B;  1K83 A;  2B2W A;  3OMG A;  1MD2 D;  1JIH A;  2BR0 A;  3CU7 A;  1M90 C;  2M05 A;  1NY4 A;  4C3J G;  3P20 A;  3PR5 B;  3NWT A;  3T1Y Q;  2R8I A;  5KNC A;  1PA6 A;  2GVA A;  4LF8 Q;  3UI2 A;  3DM3 A;  3Q8D A;  3K7A B;  5C4X H;  4N9P A;  2CHB D;  4NXM H;  3SXH A;  3A0J A;  4HR7 A;  3HBL A;  3W3A A;  2QW7 A;  5M5X H;  1TWA A;  2KQ3 A;  2Q2U A;  1VQN A;  2F0E A;  1E7Z A;  4J9O A;  3TQ1 A;  2PVP A;  2E74 C;  4DR3 Q;  3HOV H;  3K5I A;  1JKJ B;  3C2P A;  3HOX G;  4GOP B;  1BXR A;  2FXQ A;  1I4R A;  4NXM L;  4RNN A;  3K3V A;  4A4I A;  1JOK A;  4LF7 H;  4YY3 H;  5J2T F;  1IBM H;  3BVZ A;  3H15 A;  2JA5 H;  2JA7 H;  4YR3 A;  2VB2 X;  4A3E H;  4Q45 A;  1PRT C;  1TKW B;  1CHP D;  1Y8P B;  3D3R A;  4X66 Q;  1ONL A;  2JJQ A;  1LUZ A;  1U4M A;  2FKL A;  1VQ5 A;  5D1O B;  3S1R H;  2O2L D;  2QF7 A;  3MXN A;  4J9M A;  3RAX A;  1SE2 A;  4C3H B;  4N9T A;  2ZJT A;  4LF7 L;  1SYB A;  1UAP A;  4YY3 L;  4HNU A;  2E2H A;  1IBM L;  3VA5 A;  4LW1 A;  2X6G A;  4KJN A;  5CV6 A;  1JCK B;  5IWA H;  1MZB A;  5A35 A;  3K57 A;  1UC8 A;  2QYZ A;  4DNT B;  3N8D A;  1W6K A;  3BQ0 A;  3S16 B;  1O7I A;  1EQQ A;  1OXU A;  3IKJ A;  2K33 A;  4KJO A;  3I4M H;  2ZTC A;  1KRT A;  1YJW A;  3CCL A;  4EBE A;  1NCV A;  2EQS A;  3KAL A;  4DL2 A;  1BKB A;  5IWA L;  4HIO A;  4EBC A;  1W96 A;  4QL5 A;  4UAI A;  5I9O A;  2JSO A;  4DN4 M;  5DEH A;  3UE0 A;  1GSA A;  1K8M A;  3ER0 A;  3OW2 A;  1K83 H;  3KYH C;  1C8C A;  4WD3 A;  4BY7 G;  2J9G A;  4R4Q A;  2BA0 A;  4GNX C;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  3EPI A;  2Y0S E;  3TBI B;  1QZG A;  4A3D H;  1IW7 D;  1H9R A;  3PV0 A;  3TP8 A;  4B3S Q;  3HKZ G;  1HNX Q;  1A3U A;  3CQZ A;  2CW7 A;  1CI3 M;  1V1Q A;  2UXB Q;  5F9N A;  3PUW A;  5ISR A;  1Z47 A;  2CQY A;  1ET6 A;  3R8B A;  2GLT A;  3I70 A;  2VPQ A;  4PMC A;  4IRD A;  4WJ3 M;  3OUZ A;  2R8K A;  2MFI A;  4WRD A;  3MR6 A;  4AYB E;  1AN8 A;  1B6S A;  2FK1 A;  5EJW A;  1WCM H;  5D14 A;  2V59 A;  1IL2 A;  2HDL A;  3EIV A;  3S1Q H;  4JVZ A;  2BDO A;  2EIF A;  3SR1 A;  1YNJ C;  1KRS A;  3ERQ A;  3DM1 A;  2FJZ A;  1RKN A;  1CT1 D;  3KDF B;  2LXJ A;  1GUO A;  4C1N I;  2QCP X;  1RHP A;  3EBE A;  4JV2 A;  4R8I A;  3VYS A;  5JEA J;  3Q6S A;  5CAE B;  3TZD A;  3GO5 A;  3VR6 A;  4Q44 A;  1TQO A;  1NE3 A;  3MEH A;  2VW9 A;  1TWH H;  5CA1 F;  3GIK A;  3R5H A;  1Q1B A;  4LK1 C;  3TII A;  3GV6 A;  1JDB B;  1PTO B;  3D6W A;  3D31 A;  2NVQ H;  3GTG B;  3PW4 A;  4C2M A;  3GTO A;  1N34 Q;  5CA0 F;  3S17 H;  2R7F A;  3I90 A;  2E2H H;  2H1E A;  2JA6 G;  3GTQ H;  5HGQ A;  4HQ6 A;  3TP6 A;  2B2Y A;  3TSS A;  1VQ8 A;  3IRB A;  4BY1 H;  1EOT A;  2RDF A;  2W6Q A;  4ECS A;  1EWC A;  2B63 G;  2AU0 A;  1HA5 A;  3GIM A;  4RCN A;  1VS0 A;  1AUV A;  1TS5 A;  1XYI A;  5I47 A;  5I6W A;  4HYK A;  1L1O B;  2D5D A;  2BCO A;  5DQH A;  5JPM C;  4ECU A;  2R87 A;  5M3F H;  4R7R A;  2W9C A;  2F0K A;  5JH7 F;  2SOB A;  4HSV A;  5M3M G;  3J81 W;  4MV8 A;  3ITP A;  4TV9 F;  2C9O A;  3Q8R B;  1PRT D;  2O5I C;  1JOQ A;  4LF4 Q;  4RWS C;  1PMR A;  4EFB A;  4P75 A;  4EQP A;  4LF9 H;  5IOD A;  3PO3 B;  4RA8 A;  5E7N A;  1KQS A;  1X3G A;  1ZEQ X;  1VCI A;  3D0F A;  2CQA A;  1OWT A;  4HN7 A;  1TA8 A;  1CTM A;  5DGA A;  4H7B A;  3SK5 A;  2CFM A;  3U4Z A;  5KFZ A;  1E3P A;  3I56 A;  3GIL A;  4JI4 H;  2HHH Q;  2PNR C;  3G71 A;  3IL8 A;  4DR2 L;  4RB3 C;  4HJA A;  2BA1 A;  2PZW A;  4QMG A;  1PK8 A;  2IJ0 A;  2JE6 I;  3PIP 3;  4LF9 L;  5HY6 A;  4OO1 H;  3T13 A;  2RCN A;  3HG9 A;  2QEJ C;  2N78 A;  3PO2 B;  3N6X A;  4RUA A;  1X65 A;  1H9S A;  4XYL B;  4YAJ B;  1G51 A;  4IJH A;  1K8G A;  4JI4 L;  4LNQ A;  5E1F A;  1S3O A;  5EWG A;  5LHY 1;  1DOM A;  3M85 A;  4B3R Q;  1B9M A;  2SCU B;  3TIG A;  2XRS D;  1XPU A;  4DF7 A;  4K0K H;  4PWQ A;  1HZ9 A;  2ZDH A;  2YRX A;  1RJT A;  4POG A;  4UCU A;  1J8I A;  1KLU D;  2XRQ D;  1HQM C;  2Q2T A;  1K8O A;  1IOW A;  1C3O A;  4ECY A;  5I2X A;  4ED3 A;  2PO4 A;  1OXT A;  2FFK B;  4RB2 C;  2R93 G;  3JSL A;  4DFA A;  3GTO H;  3N42 B;  3AU7 A;  4HSP A;  1WTP A;  4JI8 Q;  4XYQ A;  3GTK B;  4YBZ B;  3HKZ A;  3PIO 3;  1A2U A;  5IE8 A;  4K0K L;  3ND9 A;  5KFD A;  4DV5 H;  2QA4 A;  4E6I A;  2AQ1 B;  2X6L A;  3PGZ A;  3L4J A;  2PMZ E;  2MP1 A;  3BA8 A;  2NTS A;  1E4E A;  3VPD A;  2KCC A;  1EHI A;  5KFR A;  3T1H H;  1XMQ H;  3OTO Q;  4ZUJ A;  2ATL A;  1ASY A;  1JOO A;  3MXU A;  5JEA G;  1UEA B;  1CHQ D;  2B2V A;  4ZQI A;  3J80 i;  5IGE A;  1I7N A;  4U67 3;  3A74 A;  4CGY B;  5C4X B;  4CJ0 B;  4NW2 A;  3KF8 A;  5JOB A;  3EYY A;  1HNW Q;  1NMG A;  4DV5 L;  3DWQ A;  4YR2 A;  4DL6 A;  3NSW A;  4X3K A;  5KIX A;  4HID A;  4TSS A;  4KD4 A;  2K50 A;  3T1H L;  1XMQ L;  4OIK A;  2QDL A;  2F3W A;  1SE3 A;  1E2V A;  2DIK A;  3VDY A;  1C9O A;  4ZUI A;  2R92 G;  3EPG A;  1SFO B;  3HXL A;  5KRU A;  2E2I H;  1JXL A;  3S2H H;  2AKW B;  2V4D A;  3AYH B;  2V1C C;  3HOV B;  4A3C G;  5KFO A;  3WO1 A;  2B2U C;  1PYW D;  5KG5 A;  4JV5 Q;  4IPG A;  2K05 A;  2WB1 B;  2UXD H;  2HJW A;  2EOT A;  4R1J A;  2BQ3 A;  1XPR A;  1R9T A;  4DV4 H;  4KKU A;  5FLX L;  2JA5 B;  4F8M A;  3DMU A;  1SCU B;  1EEI D;  5LL6 X;  2KHS A;  2EY1 A;  2HHH H;  3A55 A;  4QY7 A;  2JA6 A;  4A3L G;  2WP8 J;  2L12 A;  2J6U A;  4JYA Q;  3OOC A;  2NUC A;  5EPJ A;  2UXD L;  4QCL A;  2B63 A;  2ASB A;  4R4C A;  4UCT A;  1I94 Q;  4DV4 L;  5KT2 A;  4JI3 Q;  1I4G A;  4FNF A;  3M4I A;  1S0N A;  1FD7 D;  3RB6 A;  1BVS A;  5LMU H;  1JLL B;  2HHH L;  3TZU A;  5KT5 A;  2R7D A;  2I07 B;  3H94 A;  3CCE A;  1DIK A;  1GGO A;  3QWN A;  3WWV A;  2R7K A;  4ED8 A;  2MUY A;  3CMA A;  1OXV A;  4A3J G;  1I4X A;  3L3O C;  2J0T D;  3I4M B;  1ZET A;  1BCP B;  2E75 C;  4BY7 H;  4A3K H;  1KJQ A;  2NVX H;  2IPK D;  3H3V C;  1HXY D;  4CJ2 C;  1IZ6 A;  2Y0S G;  3FMC A;  1VDZ A;  3CXC A;  5LMU L;  1H95 A;  3HRZ C;  1U0L A;  1A62 A;  1K83 B;  2PPB C;  1GUW A;  2MGS A;  3TME A;  1RTN A;  1TWC H;  5D8D A;  4RB1 A;  4A3D B;  1BBU A;  5M5Y H;  2UU9 Q;  3M4P A;  1Z2P X;  3L4K A;  4TRD A;  2KED A;  4QIW A;  1KDB A;  2M2L A;  1QJO A;  1A63 A;  3V2T A;  4BA1 I;  1D2B A;  2EXZ A;  3J80 E;  1AH9 A;  4X62 Q;  5DM6 3;  1CM9 A;  5GAG C;  1IOV A;  4AYB G;  5KFG A;  2JA8 B;  5ELD A;  4HR7 B;  4UPA A;  2I8C A;  3J81 c;  1TWA B;  2E5L H;  2DNC A;  2FLL A;  3KF6 A;  2VA3 A;  3T53 B;  4BXX G;  4DK6 C;  1SN8 A;  1S5B D;  4CKB A;  4A2A A;  1WYD A;  1D5Z C;  3S1Q B;  2LMC B;  4DR4 Q;  4MA0 A;  1QIL A;  4M7E A;  4PV1 C;  1O7L A;  1K8A C;  3A8J E;  3G7L A;  1QVF A;  1UEB A;  1GHJ A;  2VR1 A;  3SGI A;  2VQE H;  3GQB A;  1D6E C;  2Z6K C;  3RN2 A;  2E5L L;  2R93 A;  3ORR A;  1ZHS A;  1DZ1 A;  1YJN A;  1NUC A;  4BBR G;  1GUS A;  3F1Z A;  1I4Q A;  5I9P A;  5L1L A;  2NZ1 D;  4LJZ C;  3VMM A;  2NVQ B;  2CZG A;  1HR0 H;  3MXN B;  5J3B A;  4DR6 Q;  3M4Y A;  4IUT A;  2F52 A;  2Z4H A;  2VQE L;  1DXM A;  4B9X A;  5CBA E;  1I6U A;  2E2H B;  4PMW A;  2A68 C;  4J6H A;  1CS0 A;  3GTQ B;  1V1O A;  1VQ9 A;  4X3T A;  1T5E A;  5IYB G;  5KFU A;  1XTC D;  3PQI A;  4BY1 B;  1Z7T A;  5M3M H;  5T1G A;  1RJP A;  2R7N A;  5ELE A;  1S0O A;  4YCV A;  3FRP B;  2JEJ A;  5EQ0 A;  1HR0 L;  2ZXR A;  3E9I A;  2VUM G;  5J39 A;  5M3F B;  4LSX A;  3JRX A;  2V4R A;  3N40 P;  1A9X A;  1F2M A;  4I7Z C;  4OON A;  1KJ9 A;  2YL2 A;  1IYU A;  5IT9 L;  5AFW A;  3OHA A;  1IHZ A;  2HVQ A;  3HOZ G;  2EJM A;  3WNZ A;  3R2T A;  4XQN A;  1SJE D;  4ETS A;  1NMF A;  2RKS A;  2SDF A;  3F2U A;  1FJG Q;  3LML A;  4K5V A;  4TVA B;  2W6P A;  3F8T A;  3S1N H;  1HTL D;  3O13 A;  1N48 A;  4BWS C;  2R7L A;  3RBD A;  5FLM G;  2Q8T A;  3CQZ B;  5KFP A;  5C44 G;  1KHI A;  1SNC A;  4Y52 H;  1JE5 A;  4O0A A;  1IYV A;  4MV1 A;  1W93 A;  3AMU A;  5EBC A;  1Q81 C;  1VBH A;  2HVR A;  4TV8 F;  1KTK A;  3U58 A;  3RNU A;  2PW5 A;  2JA9 A;  1VQB A;  4X62 H;  1UE5 A;  3G48 A;  1FVI A;  2O5J C;  1CK1 A;  1Y8N B;  4A76 A;  1MSH A;  1CUK A;  2YCH A;  4DL3 A;  1PH3 A;  4LH7 A;  3KK7 A;  1N33 H;  5C3E G;  1AN7 A;  2I5M X;  2HUG A;  2F0W A;  3J7Y W;  4ZKB B;  1Q3L A;  4DR4 H;  1EZ1 A;  5IYD G;  2Y0S A;  4J9K A;  2EY5 A;  4JW0 A;  1V4Y A;  4A75 A;  1J9O A;  3N52 A;  3FDS A;  3IFT A;  4OX9 H;  3OWF A;  3I4O A;  2RA4 A;  3FHW A;  3KTM A;  3P1H A;  5IYZ F;  5FO8 B;  4C2M B;  1N33 L;  4DK0 A;  4C3J B;  4WFN 3;  3GTO B;  2O03 A;  4FYD A;  2RBM A;  2X0S A;  1QWY A;  2RCF A;  2XN9 C;  4IZ8 A;  3R5F A;  2HDM A;  1T36 A;  4IR1 A;  1S03 G;  1JJ2 A;  4O4H F;  4DR4 L;  4J9Q A;  2D9U A;  3U50 C;  5IP9 H;  4DUY Q;  2P0A A;  2FIN B;  1LAC A;  1BXT A;  2R86 A;  2W9A A;  1EY0 A;  4DV7 Q;  4O4I F;  2M9V A;  4OX9 L;  1AE2 A;  3NBH A;  4L5R C;  4F87 A;  4KI0 A;  4WJ4 A;  1ILP A;  3OUU A;  4AYB A;  4OGQ C;  4KKS A;  4LFC H;  3RB3 A;  1MBY A;  3I91 A;  3EVQ A;  4JI0 Q;  2W9C B;  2R92 H;  4CDE C;  2NU7 B;  2K5D A;  4DNR B;  3K5N A;  4DXG A;  4QW8 A;  1VQJ A;  3QFF A;  4L5Q A;  4DL5 A;  3HOX B;  2XIW A;  1Q86 C;  5FD5 A;  4F4X A;  4ED1 A;  4BBS G;  4O2A F;  2FP4 B;  3CME A;  3RUZ A;  2ALY B;  1U5K A;  4LF5 Q;  4A3G G;  2KBN A;  2CKZ B;  3F2C A;  1IXR A;  1SJH D;  1W6J A;  3UDI A;  1XMO Q;  4NXN Q;  3S2H B;  3V4S A;  4LFC L;  2K03 A;  3M9N B;  3PZP A;  4OL7 A;  1D7Q A;  4QW9 A;  1JWS D;  5D3D A;  4X6A H;  2A68 D;  1F2Z A;  1VMC A;  3NK9 A;  1F2L A;  2F0N A;  4A3L H;  1TY2 A;  4ZLT F;  4LFA H;  4PZ7 A;  3SHL A;  1ESF A;  2WAQ A;  5KFI A;  3PO3 H;  3VYT A;  4RB0 A;  2KUM A;  4JI7 Q;  4PDB A;  4B3M H;  4I65 A;  4EGJ A;  1WTR A;  3Q8Q B;  5KFE A;  4KV6 A;  3K5L A;  4GKK H;  5JAV A;  5GAD C;  4ED6 A;  3N44 B;  1IYJ B;  5IGB A;  2NVY A;  1H9S B;  2R3Z A;  1MJE A;  1B4O A;  3EA6 A;  3GII A;  4ZK9 B;  3LGJ A;  4LFA L;  1OTC A;  1S5C D;  2EJF C;  3FMA A;  2VUM A;  4A3J H;  2K1B A;  4IR9 A;  3MWD A;  2O4X A;  1LTS D;  1RL2 A;  4OEM B;  5GQO A;  3PO2 H;  2QEX A;  4GKK L;  2UUA Q;  1HFN A;  4UCV A;  3H0G G;  5CV5 A;  3I4N G;  1YIJ A;  1YEZ A;  2GPS A;  1NTG A;  5IOC A;  1JT8 A;  4RAZ A;  3U9T A;  1HA6 A;  1Z2N X;  5KFC A;  5EPK A;  4R4I A;  4XQQ A;  1N32 Q;  4BY7 B;  3A56 A;  3C3L A;  4A3K B;  1G2S A;  1KJJ A;  2V5A A;  3G8C A;  3ND8 A;  1JWM D;  2F3I A;  4EGQ A;  2F0P A;  3BQ2 A;  5KYL A;  4XDX A;  4JBJ A;  3HKZ B;  2AWO A;  2SNS A;  2L11 A;  1HPC A;  1TWC B;  3CP0 A;  3L0O A;  1LTL A;  2W8K A;  4HMJ A;  1E4E B;  2XIG A;  4TKO B;  4DUZ H;  1N36 H;  1TWF A;  4DV3 Q;  4ZYS A;  2QK4 A;  5CV9 A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  4DV1 H;  1PV4 A;  5CV8 A;  4Q5V A;  4BXX H;  5DGB A;  1EIF A;  3PF5 A;  4HAE A;  4BA2 I;  1A15 A;  5KT4 A;  4C5B A;  3E5N A;  1N36 L;  3CCM A;  3F8N A;  4DUZ L;  1FR3 A;  4JI0 H;  1B53 A;  2YU9 H;  4GNX A;  2UUC H;  1KJ8 A;  1MSG A;  2DJG C;  3AQQ A;  4CDD C;  2BOS A;  2NU9 B;  1SE4 A;  5A2Q L;  2K52 A;  4JV1 A;  3BDL A;  4DV1 L;  4BBR H;  1QCB D;  1O80 A;  4IAJ A;  1X32 A;  4P73 A;  4FXD A;  1ML0 D;  1ZQ7 A;  4LF5 H;  2R6G A;  1GLV A;  1HNZ H;  5BN3 A;  5ELF A;  1WOC A;  4KHP Q;  5JVG 3;  1CA6 A;  3FEW X;  5KG0 A;  5FO9 B;  2PMZ A;  4JI0 L;  1B8A A;  2D0P A;  1S4Z A;  2K5N A;  1SFO H;  2UUC L;  2ZJQ A;  2D0O A;  2Z1C A;  5LXT F;  2A74 C;  3CC2 A;  1I4P A;  1SYD A;  2JA6 B;  2R7Z G;  1RK5 A;  3C46 A;  1ESR A;  2IWH A;  1V8Q A;  1F9R A;  4A93 G;  4LF5 L;  3RGX A;  1SRU A;  1HNZ L;  1LTA D;  2B63 B;  4CKE A;  2NU6 B;  1MIU A;  4MV6 A;  2CCZ A;  4APM A;  4X66 H;  4JI7 H;  1JJC B;  1U9R A;  4DR1 H;  2EYJ A;  2NTT A;  5EKL A;  2TMP A;  2VUM H;  3T5K A;  1CSQ A;  1XNQ Q;  1TWG H;  2VOB A;  5M3M B;  4UCR A;  4ECW A;  4YHH Q;  2JP1 A;  1D1I A;  2YW2 A;  2C00 A;  4QGU A;  3MR3 A;  3B6Y A;  1HH2 P;  2K7V A;  2ZDQ A;  4I7H A;  3N43 B;  2NN6 G;  4DR1 L;  4B3M Q;  5FLX W;  4HJ7 A;  3CC7 A;  3TQT A;  2F0D A;  1TR5 A;  3DF7 A;  1E22 A;  5KFX A;  3PIP A;  5KX5 F;  5C44 H;  3RN5 A;  1KAB A;  3NBI A;  1OXX K;  4RKB A;  1XDN A;  4H44 C;  2VQF H;  5DG9 A;  4Q43 A;  4IFD J;  1PH1 A;  1LAB A;  3ZJY C;  3S1N B;  3LP8 A;  2W9B A;  3MR5 A;  3RB4 A;  4QIW B;  4OWW B;  5L1J A;  4R4O A;  3NTK A;  4ECX A;  1FYC A;  4X65 Q;  3HFZ B;  1F9Q A;  3QIA A;  1HQR D;  3NTH A;  5KFH A;  2OEO A;  4GKJ H;  5C3X A;  5ELO A;  1NBW A;  4AQY Q;  5JVD F;  3P75 A;  1BCP C;  4P71 A;  4JPB W;  2KSW A;  4UP9 A;  4MAM A;  1NNX A;  2GN5 A;  2VQF L;  2E2D C;  4EEQ A;  4R8N A;  4DV6 H;  4G3I A;  5JJL A;  3V96 A;  2HQE A;  5C3E H;  1IBL Q;  1SBB B;  2UVU A;  4V19 0;  3SI8 A;  3HOW H;  2A6H C;  5IYD H;  3T5J A;  3H0G A;  4GKJ L;  3T1Y H;  3KLR A;  3NGD A;  4HIM A;  3HOY G;  4LF8 H;  2JA8 H;  1A8V A;  1TT2 A;  1TWA H;  1YHB A;  4GS3 A;  1SYC A;  3BZC A;  4BWG B;  4DV6 L;  2R93 B;  5KFB A;  2AGP A;  1SSO A;  4WBN F;  3CRK C;  4UY8 C;  2WAC A;  3MTS A;  2F0H A;  4FO2 A;  1C48 A;  4H13 C;  4ZKC B;  3T1Y L;  3MFH A;  1X9N A;  4LF8 L;  2X69 A;  4IUP A;  2F0O A;  2G9D A;  1R4P B;  2FPP B;  4DR3 H;  3ULJ A;  3BJU A;  1GOZ A;  3RV3 A;  4LSA A;  2IHF A;  4C1N K;  1S97 A;  2DPI A;  4EYH B;  1QNU A;  4HCE A;  1TXY A;  3WOE A;  2F0J A;  2N55 A;  3PUZ A;  3TN2 A;  4ID6 A;  2WYO A;  2PZU A;  4DXF A;  2XC9 A;  3J7Z C;  2C2R A;  1RF2 D;  2K5Q A;  3QOJ A;  1VQC A;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1O7Z A;  4NP5 A;  5IGG A;  4A3G H;  3K81 C;  2R92 B;  3MJF A;  3ONA B;  3RJ0 A;  2N88 A;  4DAV A;  4MHE A;  3V05 A;  3M3Y H;  5KT6 A;  2WAQ E;  3I72 A;  2E2J B;  4TQS A;  1J6Q A;  1UNS A;  2PI2 E;  3OMC A;  2W71 A;  4DV2 Q;  3M7G A;  2AQ4 A;  4RGT A;  4DLK A;  2DY8 A;  4X66 L;  4M1U B;  4DAY A;  5HUR A;  3TRZ A;  1SYF A;  3KLS A;  2AQ2 B;  4K14 A;  3QJY A;  3FKI G;  2VNU D;  5IYC H;  4YB8 B;  2R7Z A;  5IGD A;  2XGT A;  1S40 A;  4JI2 Q;  4LAA A;  2LXK A;  5TSS A;  3ORQ A;  5NUC A;  1T3N A;  1RTO A;  1IBK Q;  4XQJ A;  3LWE A;  1HR0 W;  4XT3 B;  2FPI B;  5EDW A;  4HJ8 A;  2OLS A;  3OW7 A;  5IP7 G;  2F0G A;  5KG1 A;  3CQZ H;  1AFP A;  5COR A;  3G6Y A;  3KOJ A;  4HED A;  1E4F T;  3CW2 C;  2XCP A;  5CGK A;  5C4H A;  3H0G H;  3VR3 A;  4CC5 A;  3I4N H;  5CYU A;  4B3S H;  1STG A;  4A3J B;  1HNX H;  3FDT A;  3MXP A;  1IKL A;  3J7A 5;  3ICE A;  3NQT A;  1D5X C;  1SMY C;  2FJ2 A;  2K5V A;  2HCI A;  2UXB H;  4KHZ A;  4YP3 A;  3BG3 A;  1JB7 A;  2Y0S B;  3GTM A;  4K5X A;  1WTQ A;  1PH9 A;  2XTI A;  2I80 A;  3PSI A;  1OO9 B;  3RBE A;  5AJ3 L;  1PH7 A;  4C3I G;  3MFI A;  4GN4 B;  1K9M C;  4JBM A;  5KFV A;  4B3S L;  1HNX L;  4FU0 A;  1BCP D;  3QB3 A;  4LFB Q;  2UXB L;  1AW7 A;  1LTI D;  4DK1 A;  3UDG A;  4EBD A;  5GON F;  3PUX A;  1S72 A;  1A6X A;  1ENF A;  5KG2 A;  1QOH A;  1K3R A;  5C6A A;  3NBH B;  1HZC A;  4AYB B;  2SEB D;  3EFX D;  1DGS A;  3J80 L;  3RGZ A;  1PFN A;  4C2M H;  1SDF A;  1LT6 D;  4C3J H;  1WTH A;  2KHI A;  3AFQ A;  3PW5 A;  1EIH A;  1T94 A;  2VQD A;  1WVL A;  2R82 A;  2MJ8 A;  4G4K A;  4DV0 Q;  1JWU D;  1I50 A;  5C0X J;  4A3M G;  5FLX c;  1N34 H;  1SRO A;  4TUY F;  3SE7 A;  5IGF A;  4RG1 A;  4EGV A;  1CE8 A;  4ZQ3 A;  2YU9 B;  4MV3 A;  4KY6 A;  4LF6 Q;  1HRJ A;  1YNJ D;  4RGO S;  2FPG B;  4A3F G;  4QWA A;  4RHR A;  1R4Q B;  4LUV A;  1U4R A;  2EYM A;  3SVM A;  1HUM A;  4JBK A;  5IGC A;  5EOY A;  1D1K A;  4BBR B;  5LP6 F;  3NPP A;  1CKM A;  3I55 A;  1I3Q A;  4IAL A;  2OWO A;  3HOX H;  1BF4 A;  1Y1V A;  3ERS X;  5JVL A;  1N34 L;  3DXJ C;  2UUB Q;  2KEE A;  1JC7 A;  4A93 H;  2IT1 A;  3UDX A;  2ASD A;  1LYL A;  4CJ1 B;  2CW0 C;  1LTG D;  2Z8L A;  2YZM A;  3CPF A;  3JAM W;  3L7Z C;  1SXT A;  1M0T A;  3MWY W;  2DWC A;  1QB5 D;  1WI5 A;  3QZ7 A;  4LF4 H;  5M9O A;  4YAK B;  3CRL C;  3GTL A;  4A3I G;  4XT1 B;  1I5F A;  1RCV D;  4JI1 Q;  2HGS A;  4XX0 B;  5KFY A;  1G2T A;  1KL9 A;  4U7C A;  3STB C;  2VUM B;  4KN7 C;  1TWG B;  5BR8 Q;  5K2M A;  2KEN A;  5LL6 b;  2Z6K A;  1GXD C;  2NN6 H;  2F4V Q;  4KN4 C;  4FM9 A;  4UDU C;  5KT7 A;  4LF4 L;  2LSS A;  3HOZ B;  1PRT B;  2BDN A;  3E0J A;  3IN5 A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  1WTO A;  5EWF A;  5C4J H;  1CZG A;  2JEF A;  1T9H A;  3F2B A;  1UE6 A;  3NP8 A;  5JJI A;  3V6J A;  4RZR A;  1DV2 A;  1Q82 C;  4A3B G;  3FVQ A;  1C30 A;  4FDB A;  4R4T A;  1VQ7 A;  2YRW A;  4LUO A;  5LMN W;  5BPF A;  1G8Z D;  4E4T A;  4X64 Q;  2ASL A;  3FKI A;  5C44 B;  2EYL A;  3VR4 A;  4B3R H;  1EYZ A;  2VUG A;  3OHX C;  4YWM A;  5I4D A;  1STE A;  3RLO A;  1TWF B;  4LFB H;  4DPG A;  1ENA A;  2A5H A;  2VB3 X;  4OXP A;  2JN4 A;  3WO0 A;  4O2D A;  1ASZ A;  1SMY D;  4KK7 A;  2FMA A;  2CWA A;  2F4I A;  1EY7 A;  3K5M A;  1I6V C;  4J1M A;  3SK6 A;  4EVO A;  2NUA B;  4B3R L;  1I50 H;  2ID0 A;  4EQO A;  1B9N A;  4ED7 A;  4JI8 H;  3I3C A;  1PFM A;  2FMC A;  3BAB A;  3JC6 6;  5C3E B;  2IMW P;  4GNX B;  4ZAI A;  4L8J A;  2OQ0 A;  2WDT A;  3TEH B;  4TQU S;  2K04 A;  5KFF A;  4FF3 A;  3HOU G;  3HOW B;  4J9L A;  3G6J B;  2EYO A;  3OTO H;  2F0S A;  2NU8 B;  1X6O A;  4YWK A;  3I2Z A;  4F7X A;  3TDQ A;  4YJ3 F;  2JEI A;  4JI8 L;  2L0C A;  4ECZ A;  3DLL A;  4LH6 A;  2GPW A;  2PMZ B;  1LTB D;  2DZD A;  1HNW H;  5D3I B;  1PFS A;  2ZM6 Q;  2C22 A;  3FPU B;  3CKI B;  5JJZ A;  4YIJ A;  5F2D A;  1XXG A;  1LT3 D;  4CC6 A;  3M9B A;  3GIQ A;  3VYR A;  5CB4 F;  2DGY A;  2ZXP A;  2B8F A;  4ZRZ A;  3SK4 A;  1A3V A;  3OTO L;  1A3T A;  4ILW A;  3CCV A;  4CHT B;  2EYH A;  2YTV A;  3NTI A;  2XGP A;  1CSP A;  5EZY F;  1R9T H;  2WV6 D;  2CH4 W;  2ZJP A;  5IT9 c;  4IHJ F;  1PRT F;  4G7H C;  3K5H A;  2HD3 A;  1DON A;  1HNW L;  2HVS A;  4JV5 H;  1EWH A;  1PH2 A;  1JX4 A;  1XTD A;  1VF5 C;  4F88 A;  2HIV A;  2YYZ A;  1JE4 A;  1FL0 A;  4DR5 Q;  2JA6 H;  3BDC A;  1L0X B;  5A2Q W;  3CC4 A;  4QUC A;  2RGR A;  2WAQ G;  4BBS B;  4YJ2 F;  4JI6 Q;  2EYF A;  2B63 H;  1GSO A;  4O3N A;  3A8K E;  4A3G B;  1XNR Q;  4DR7 Q;  2C2E A;  5C5M A;  2PNH A;  4JV5 L;  4JYA H;  3M3Y B;  4GOP C;  3KAK A;  2EXD A;  2CW0 D;  4KKT A;  2Q2H A;  2Z6B A;  1L0W A;  2F0V A;  1I94 H;  2KEC A;  3FKI H;  5KG7 A;  4JI3 H;  1EUJ A;  4UCO A;  1MGS A;  1E24 A;  2PCF B;  4O3S A;  3I4L A;  4H0L C;  1N56 A;  1SR3 A;  2KHJ A;  3I12 A;  2W9B B;  1LT4 D;  4F4Y A;  3Q24 A;  5JJK A;  3STB D;  4JYA L;  2LS0 1;  2MNA A;  3AEV A;  1WR2 A;  5GAH C;  1V9P A;  4EX5 A;  3BQ1 A;  3M9O B;  1I94 L;  3Q1K A;  5IP7 H;  5HGT A;  2H5X A;  4PMB A;  1H9M A;  4JI3 L;  2NN6 I;  3HGB A;  2I5H A;  3A5U A;  4APV A;  1RD9 D;  1VQ6 A;  4OWT B;  2W7O A;  2JA7 G;  5C8Y F;  4JG2 A;  4YWL A;  4A3E G;  1G6Z A;  5ELB A;  1VQH A;  1V1P A;  3HEJ A;  2V9W A;  3J81 i;  4B08 A;  1STY A;  1GSH A;  3H0G B;  3S2D H;  5LMN Q;  3I4N B;  2B8G A;  1HFG A;  1SMX A;  2UU9 H;  2UXC Q;  5KG6 A;  2XSC A;  3KBX A;  1J5E Q;  4C3I H;  1QVC A;  1Y14 B;  4J9R A;  1KIX A;  3ULL A;  3T5H A;  4OIJ A;  1GO3 E;  2YS6 A;  3JRW A;  3NQI A;  2VPS A;  4IUN A;  2EY6 A;  2BE5 C;  2UU9 L;  3RZO H;  3JAM c;  3H91 A;  2ASJ A;  2XD4 A;  1F9S A;  1M0W A;  2B2T C;  5C5L A;  2KOL A;  1V43 A;  1CKN A;  3H3V I;  4NDX A;  2R93 H;  4X62 L;  3E3X A;  3CVZ A;  4QJF A;  2YZG A;  3AB9 A;  5CR3 A;  2W6N A;  3Q0A A;  2FK3 A;  3HS0 C;  3MXG A;  3TQY A;  3U4V A;  1UE7 A;  1WD1 A;  4A3M H;  1EUD B;  1SNP A;  1EFW A;  2OQK A;  4WOR A;  2BQR A;  5FPO A;  4N8X 1;  1B1Z A;  5JEA H;  4ECV A;  1HUN A;  4HNV A;  1WTW A;  4A3F H;  2IX0 A;  2J4X A;  2KVM A;  1EUC B;  3K0X A;  3KFU A;  4DR6 H;  4F4W A;  5L1I A;  2P5Z X;  3CCQ A;  2DUD A;  2R84 A;  1CQJ B;  2EZV A;  1K28 A;  1Q1E A;  1VMP A;  2F0U A;  2W8L A;  1E1T A;  4YCU A;  2A69 C;  4RHS A;  3VR2 A;  2A73 B;  3CPW A;  5EGT A;  1GUT A;  4RAU C;  4DAY B;  5I6Y A;  1C4Q A;  4RNO A;  2OH2 A;  4O3R A;  5BPH A;  4PZ6 A;  5DLG A;  4RFB A;  3H4B A;  5IIF A;  4A3C H;  1UE1 A;  1B44 D;  1STA A;  1WCM G;  2KCN A;  4DR6 L;  4C5A A;  4P2C B;  2E2J H;  2KCM A;  2QIL A;  1P8L A;  4FXK C;  2R7Z B;  5H80 A;  1PTO C;  3HB9 A;  3I7F A;  4A93 B;  3GIP A;  3MFY A;  1O7Y A;  1FGB D;  5C1O A;  1Q12 A;  4L5S A;  1UNN C;  2R6F A;  3H20 A;  2ALZ A;  1M8A A;  4X3U A;  3WOF A;  5KYI A;  4KMU C;  3F2D A;  3DEP A;  1Z2O X;  4IOA A;  1JB3 A;  3RB0 A;  3CCU A;  1FJG H;  5EKK A;  1UC9 A;  3J81 E;  4KY5 A;  3TP5 A;  1I6H H;  3D6C A;  1L1O C;  2LFN A;  3S24 A;  1EQV A;  3C1E A;  2DN8 A;  4NXM Q;  4IUR A;  2PI2 A;  3A7L A;  1EY4 A;  2F0M A;  2IHE A;  4O42 A;  5C3W A;  4KLK A;  1GYF A;  2WIN B;  5K5P A;  4K2L A;  3MVV A;  3GTM B;  3W1G A;  1DV1 A;  2N49 A;  4A3B H;  3M4O H;  4O3O A;  1FJG L;  4PNY A;  4G7O C;  2LY7 A;  3TS2 A;  1SNQ A;  5M5W H;  4RUC A;  5C4J B;  1S9F A;  4O4L F;  3UQ8 A;  3BVG A;  1CFM A;  5KFT A;  2PQA A;  4GLA C;  5EBD A;  5KFK A;  2AUJ D;  3DWP A;  4C5C A;  4MTK A;  4HJ5 A;  2GVB A;  1AUX A;  4EEY A;  1VQP A;  4IFD I;  4YY3 Q;  2MQH A;  3HZX A;  1IBM Q;  1M7J A;  4X3S A;  1RJQ A;  4HTH A;  5LL6 S;  2RDJ A;  4JK1 C;  1CQF A;  1KBL A;  1EY5 A;  2WB1 A;  1QVG A;  2WKD A;  1TS2 A;  3LX0 A;  3MFG A;  2JA7 A;  1ZKO A;  1K0R A;  1D8L A;  3D4R A;  1ROD A;  1ZHQ A;  2K14 A;  3VA7 A;  3HOU H;  1QG7 A;  3D4W A;  1I50 B;  4MV9 A;  1MI2 A;  3MWE A;  1EL0 A;  2EPB A;  3T51 B;  3HOY B;  1IL8 A;  4LUZ A;  1LO5 D;  3NEN A;  3Q22 A;  1WSC A;  2BE5 D;  2BH8 A;  4FBU A;  4OO1 G;  2XCA A;  4DUY H;  5L1K A;  3ULP A;  4DV7 H;  4O3P A;  1CQI B;  4HMI A;  4JOI C;  4BS9 A;  1B7Y B;  1HJP A;  4XTC S;  1RDP D;  1MKH A;  4UFZ A;  3I8Z A;  1VQA A;  2F0T A;  2F3V A;  1IKM A;  4DUY L;  3J80 W;  4UCS A;  4MV7 A;  4DV7 L;  3DEO A;  4K2K A;  1SYE A;  2GA4 B;  4YR0 A;  2W7P A;  4NXN H;  1XMO H;  1R9T B;  1VAJ A;  3TIN A;  1EY8 A;  4XXE A;  2XNA C;  2L15 A;  3K80 C;  3SEB A;  1K1S A;  1VF7 A;  2YYA A;  4ED0 A;  4KY7 A;  3G6E A;  5CC4 A;  4R8U A;  1B70 B;  3OIP A;  3M7N A;  3OSN A;  2K5H A;  2A69 D;  1EIY B;  2QKI C;  2N8N A;  2ZJR A;  3IFD A;  3KJO A;  4FBT A;  1S10 A;  3NUC A;  4MV4 A;  5IYB H;  4Q8F A;  2NVY H;  3JAM E;  3RFC A;  4HJ9 A;  1KD1 C;  4NXN L;  4UHV A;  2XVS A;  1XMO L;  2DLN A;  1KJI A;  3BAA A;  1PTO D;  1RK6 A; 
#chains in the Genus database with same CATH homology
 1YZ6 A;  5IP7 G;  2D62 A;  3CQZ H;  1TWC H;  3KOJ A;  1NJI C;  1N36 Q;  3CW2 C;  4DAM A;  4DUZ Q;  2JK8 A;  3H0G H;  1BBU A;  4DR5 L;  3I4N H;  3HOZ H;  5M5Y H;  2UU9 Q;  3M4P A;  4OWX B;  1GM5 A;  4JI6 L;  1A63 A;  1WFQ A;  5ELN A;  4MNO A;  4BA1 I;  4JI7 L;  3ICE A;  3J7A 5;  1XNR L;  4UP7 A;  2K5V A;  4DR7 L;  2BH2 A;  4JOI A;  1AH9 A;  4KHZ A;  4A3I H;  1X54 A;  4X62 Q;  4DV1 Q;  1JB7 A;  1VQD A;  4Y7N H;  5GAG C;  4IOC A;  1PH9 A;  4AYB G;  2XTI A;  3PSI A;  3EN2 A;  2HT1 A;  4UPA A;  5AJ3 L;  3GTG H;  3J81 c;  1PH7 A;  2A8V A;  4GN4 B;  1Y1W G;  5FLM H;  1K9M C;  4JBM A;  1YHA A;  2Z0S A;  3PUY A;  3KF6 A;  4B3S L;  4JBW A;  2UUC Q;  1HNX L;  4BXX G;  4JCV E;  1GKH A;  1C0A A;  4DK6 C;  1SN8 A;  1TWF H;  1WYD A;  4QQB X;  1VQL A;  4LFB Q;  1UWV A;  2UXB L;  4DR4 Q;  3UDG A;  2UUA L;  1K8A C;  4JC0 A;  3PUX A;  1S72 A;  3FP9 A;  2NZO A;  1HNZ Q;  1UEB A;  1QVF A;  1PYB A;  1K3R A;  3SGI A;  3NBH B;  1HZC A;  1SE8 A;  2Z6K C;  3JAM i;  3RN2 A;  1Q7Y C;  2E5L L;  1N32 L;  1DGS A;  4BY1 G;  1YJN A;  3CAM A;  4BBR G;  4C2M H;  4C3J H;  3F1Z A;  1PH6 A;  2KHI A;  3AFQ A;  3KF6 B;  1PHJ A;  4DR2 Q;  4H02 A;  5M3F G;  4DV0 Q;  3RLF A;  4LF9 Q;  3MXN B;  5J3B A;  5C0X J;  3NEL A;  4A3M G;  1OXS C;  3S14 H;  4DR6 Q;  5FLX c;  1EQR A;  1SRO A;  2F52 A;  3CF5 A;  1QUQ A;  2VQE L;  4RG1 A;  5LMN L;  4LF7 Q;  3AFP A;  5IYC G;  2UXC L;  4DR1 Q;  1EOV A;  4PMW A;  4LF6 Q;  4DV3 L;  4A3F G;  2VL6 A;  3PIO A;  1J5E L;  1C7Y A;  1VQ9 A;  2OTJ A;  1G6P A;  3A5Z B;  4LUV A;  5IYB G;  4JBK A;  2ATW A;  1PH5 A;  4DNI A;  3S1M H;  4JI5 L;  5M3M H;  1CKM A;  3I55 A;  2OWO A;  3E9H A;  4YCV A;  1HR0 L;  3HOX H;  3E9I A;  2VUM G;  3ERS X;  2AHO B;  1N34 L;  1Y1V G;  2UUB Q;  1VQG A;  4A93 H;  2IT1 A;  1YVC A;  4OON A;  2E8G A;  3UDX A;  1LYL A;  3BU2 A;  5IWA Q;  1AE3 A;  4P72 A;  3HOZ G;  1VQK A;  3CPF A;  5C0X I;  3L7Z C;  2ZTE A;  3GD7 A;  4QIW E;  1WI5 A;  3UE1 A;  3KJP A;  1NMF A;  4YCW A;  1QZH A;  2AMC B;  3S15 H;  1LM0 A;  4IPH A;  3TS0 A;  1FJG Q;  4A3I G;  4KHP L;  1I5F A;  3PCO B;  4JI1 Q;  2VQF Q;  4TVA B;  1KL9 A;  3F8T A;  3OYY A;  3S1N H;  1Q8K A;  4K0K Q;  3STB C;  4P74 A;  4BBS H;  2B29 A;  1X55 A;  5FLM G;  5BR8 Q;  2KEN A;  1KHI A;  5C44 G;  4Y52 H;  2Z6K A;  1JE5 A;  4O0A A;  2F4V Q;  1P16 A;  2B3G A;  4LF4 L;  1RIP A;  2LSS A;  1YIT A;  4GKJ Q;  3L2P A;  1Q81 C;  3GTJ H;  3U58 A;  1N8R C;  3RNU A;  3PUV A;  4B3T Q;  2MO1 A;  4IPC A;  5C4J H;  2JA9 A;  1EWI A;  5EAY A;  1Z9F A;  2JQO A;  3GTK H;  4DV6 Q;  1T9H A;  2A1A A;  1VQB A;  3F2B A;  1KC8 C;  4DV5 Q;  2K4K A;  4PZ8 A;  1UE6 A;  1UE5 A;  3G48 A;  5JJI A;  1FVI A;  1XNQ L;  1Q82 C;  4A3B G;  4FDB A;  4R4T A;  1M90 C;  1VQ7 A;  1NY4 A;  4LUO A;  5LMN W;  3T1H Q;  1XMQ Q;  4A76 A;  4X64 Q;  2JEA I;  3GTP H;  4YHH L;  3T1Y Q;  1PA6 A;  1CUK A;  2GVA A;  4LF8 Q;  1PH3 A;  3DM3 A;  5C3E G;  2I5M X;  4YWM A;  3RLO A;  3Q8D A;  4L5T A;  5C4X H;  4DPG A;  5IYD G;  4B3M L;  4HIK A;  4GN5 A;  3A0J A;  4OXP A;  4A75 A;  4EQ5 A;  5M5X H;  4O2D A;  1ASZ A;  3I4O A;  3FHW A;  2WB1 E;  2CWA A;  3MEF A;  2Q2U A;  1VQN A;  4B3R L;  1I50 H;  2ID0 A;  1N33 L;  4IFD G;  1E7Z A;  1X3F A;  3J80 c;  3HOV H;  4DR3 Q;  1JJ2 A;  3JC6 6;  3HOX G;  4GOP B;  1VQO A;  2FXQ A;  4GNX B;  4DR4 L;  4NXM L;  3U50 C;  4DUY Q;  5IP9 H;  2OQ0 A;  3TEH B;  4TQU S;  4X65 L;  4A4I A;  3HOU G;  2UXD Q;  1CKN B;  4DV7 Q;  4OX9 L;  2Q2I A;  1AE2 A;  4DV4 Q;  1PH8 A;  4L5R C;  4KI0 A;  4WJ4 A;  3W5O A;  1X6O A;  4AQY L;  3H15 A;  2JA5 H;  4YWK A;  2JEB I;  3I2Z A;  4XIG S;  4DKA C;  1YJ9 A;  2JA7 H;  4A3E H;  4JI8 L;  4X66 Q;  3DLL A;  4JI0 Q;  2OTL A;  2R92 H;  2JJQ A;  1VQ4 A;  5GRO A;  1LUZ A;  3M4Q A;  3RLN A;  1PFS A;  2ZM6 Q;  1IBL L;  1VQ5 A;  3S1R H;  1VQJ A;  3NEM A;  4L5Q A;  1Q86 C;  3M9B A;  4BBS G;  2DGY A;  3CME A;  4LF7 L;  2ALY B;  3OTO L;  4YY3 L;  3CCV A;  1U5K A;  4DK3 C;  4LF5 Q;  2YTV A;  2KBN A;  1IBM L;  2CKZ B;  4A3G G;  3F2C A;  1CSP A;  1IXR A;  4LW1 A;  3UDI A;  2HIX A;  1XMO Q;  4NXN Q;  4LFC L;  1R9T H;  4MZ9 A;  2ZJP A;  1GD7 A;  5IT9 c;  1D7Q A;  5LMU Q;  1HNW L;  1PH2 A;  2IX1 A;  4X6A H;  1O7I A;  1XTD A;  2HIV A;  1OXU A;  2YYZ A;  1EQQ A;  1FL0 A;  4A3L H;  4DR5 Q;  2JA6 H;  3I4M H;  2ZTC A;  4PZ7 A;  1KRT A;  1YJW A;  3CCL A;  2AWN A;  3CC4 A;  3RZD H;  2RF4 A;  2EQS A;  2WAQ G;  1MJC A;  1BKB A;  3PO3 H;  4JI6 Q;  2B63 H;  5IWA L;  4HIO A;  4JI7 Q;  5FJ8 G;  4QL5 A;  3CCS A;  1XNR Q;  4DR7 Q;  1K73 C;  5GAD C;  3UE0 A;  3ER0 A;  2PNH A;  3OW2 A;  4JV5 L;  1IYJ B;  1K83 H;  3KYH C;  1HZB A;  4RMF A;  4GOP C;  4BY7 G;  4R4Q A;  2BA0 A;  2EXD A;  4GNX C;  1MJE A;  4JI4 Q;  4A3K G;  5AJ3 Q;  3UDF A;  1L0W A;  2Q2H A;  2Y0S E;  3LGJ A;  4LFA L;  1QZG A;  4A3D H;  3FKI H;  1OTC A;  1EUJ A;  3PV0 A;  2I5L X;  4B3S Q;  3HKZ G;  4A3J H;  1HNX Q;  2R7Z H;  1E24 A;  1V1Q A;  1SR3 A;  2KHJ A;  2UXB Q;  1RL2 A;  4GKK L;  5GQO A;  3PO2 H;  2QEX A;  1PVO A;  2UUA Q;  5JJK A;  3PUW A;  3H0G G;  3STB D;  4JYA L;  2MNA A;  1YIJ A;  1YEZ A;  3AEV A;  1NTG A;  1Z47 A;  3I4N G;  1JT8 A;  5GAH C;  1V9P A;  4EX5 A;  1I94 L;  3RR5 A;  4R4I A;  5IP9 G;  5IP7 H;  1N32 Q;  2E5L Q;  2H5X A;  4WJ3 M;  4JI3 L;  2RHS B;  2JA8 G;  4DV2 L;  2MFI A;  2NN6 I;  3A5U A;  2I5H A;  2YTX A;  4AYB E;  2F3I A;  4APV A;  1VQ6 A;  4OWT B;  1WCM H;  4JBJ A;  2JA7 G;  1VQF A;  4JG2 A;  2PQA B;  4YWL A;  3EIV A;  2AWO A;  1IL2 A;  3S1Q H;  4A3E G;  1JMC A;  2EIF A;  1VQH A;  3G4S A;  1KRS A;  3CP0 A;  3J81 i;  3KDF B;  3L0O A;  1LTL A;  2LXJ A;  3TRE A;  2QGQ A;  2VQE Q;  4JI2 L;  5LMN Q;  3EBE A;  3S2D H;  3GTM H;  1SMX A;  2UXC Q;  1IBK L;  4DV3 Q;  1J5E Q;  4C3I H;  2VS1 A;  5JEA J;  1QVC A;  1Y14 B;  1Y1W H;  1KIX A;  1YBY A;  3GO5 A;  3ULL A;  1KAW A;  2RHQ B;  4JI5 Q;  3KF8 B;  1PV4 A;  1NE3 A;  1GVP A;  2CQO A;  1TWH H;  2VW9 A;  4BXX H;  1EIF A;  1Q1B A;  3PF5 A;  1WJJ A;  1GO3 E;  3D31 A;  2NVQ H;  1HR0 Q;  4BA2 I;  2HQL A;  1N36 L;  1PH4 A;  3CCM A;  1N34 Q;  4DUZ L;  3S17 H;  3RZO H;  2UU9 L;  2R7F A;  3JAM c;  4GOP A;  2YU9 H;  2E2H H;  4GNX A;  2JA6 G;  3GTQ H;  1CKO A;  5HGQ A;  2ES2 A;  1V43 A;  3AQQ A;  1CKN A;  3H3V I;  1VQ8 A;  3IRB A;  3PO3 G;  4BY1 H;  2R93 H;  2K52 A;  4X62 L;  4DV1 L;  4BBR H;  2B63 G;  4P73 A;  4QJF A;  2R6G A;  1VS0 A;  1VQE A;  1WOC A;  1L1O B;  4KHP Q;  1BBW A;  3TQY A;  3U4V A;  3KLW A;  5M3F H;  3H3V H;  1UE7 A;  1Q46 A;  4JI0 L;  1B8A A;  2D0P A;  4A3M H;  2K5N A;  5M3M G;  3GDE A;  1SFO H;  1EFW A;  2D0O A;  1XJV A;  2UUC L;  2OQK A;  2ZJQ A;  3CC2 A;  3HOY H;  4MTN A;  4LFB L;  2R7Z G;  4A3F H;  4LF4 Q;  2IX0 A;  4P75 A;  4A93 G;  4LF5 L;  3K0X A;  3KFU A;  1SRU A;  1HNZ L;  1KQS A;  5E7N A;  3PO2 G;  1H95 A;  1X3G A;  1MIU A;  1VCI A;  3CCQ A;  2CCZ A;  3D0F A;  1JJC B;  2DUD A;  1I3Q H;  4GN3 B;  1Q1E A;  5DLQ E;  4IJL A;  1XPO A;  2CFM A;  1E1T A;  4YCU A;  2VY3 A;  3U4Z A;  2VUM H;  1CSQ A;  1Y1V H;  1E3P A;  1TWG H;  3I56 A;  3CPW A;  1XNQ Q;  4OO1 I;  2IY5 B;  2HHH Q;  1KXL A;  4DAY B;  3G71 A;  4PZ6 A;  4DR2 L;  4HJA A;  4YHH Q;  5C0X G;  4A3C H;  2BA1 A;  1UE1 A;  4DV0 L;  1WCM G;  2JE6 I;  4GLX A;  1YI2 A;  4LF9 L;  4QGU A;  4DR6 L;  2E2J H;  3B6Y A;  2KCM A;  5HY6 A;  1P8L A;  1HH2 P;  2RCN A;  3I7F A;  5K36 G;  2N78 A;  2NN6 G;  4DR1 L;  1Q12 A;  4LF6 L;  1X65 A;  4UP8 A;  4B3M Q;  4HJ7 A;  3CC7 A;  4L5S A;  3CCR A;  3GTL H;  1G51 A;  4IJH A;  1E22 A;  1K8G A;  3E0E A;  3F2D A;  4JI4 L;  4LNQ A;  2WFW A;  2YV5 A;  3PIP A;  4AIM A;  2OCE A;  1S3O A;  5C44 H;  4IOA A;  3RN5 A;  1OXX K;  2NZH A;  3CCU A;  3M85 A;  4B3R Q;  1N33 Q;  1I6H H;  1XPU A;  1PH1 A;  2UUB L;  3ZJY C;  4IFD J;  1L1O C;  1HZ9 A;  3K7A H;  3S24 A;  4POG A;  4NXM Q;  4OWW B;  2PI2 A;  4R4O A;  4X65 Q;  2IHE A;  3HFZ B;  2Q2T A;  4IPD A;  4KLK A;  4OX9 Q;  5ELO A;  1NBW A;  1OXT A;  3W1G A;  4AQY Q;  2N49 A;  4A3B H;  3M4O H;  2NVT H;  1FGU A;  1VQM A;  1SLJ A;  4P71 A;  1FJG L;  2R93 G;  3TS2 A;  4UP9 A;  5C4X G;  5M5W H;  3GTO H;  2GN5 A;  3J81 j;  4JI1 L;  2VQF L;  4JI8 Q;  4AH6 A;  4POF A;  5IE8 A;  2PQA A;  4GLA C;  4K0K L;  5JJL A;  2QA4 A;  5C3E H;  3PGZ A;  1IBL Q;  5GAE C;  5BR8 L;  2PMZ E;  4HJ5 A;  2MO0 A;  3KDF A;  2F4V L;  3HOW H;  4LWC A;  5IYD H;  2GVB A;  1W3S A;  1VQP A;  3OTO Q;  4IFD I;  4YY3 Q;  4GKJ L;  1ASY A;  3HOV G;  4HIM A;  3HOY G;  1YNX A;  2MQH A;  5JEA G;  1IBM Q;  2JA8 H;  2CWP A;  1A8V A;  4B3T L;  1TWA H;  1YHB A;  3J80 i;  4GS3 A;  4LFC Q;  3A74 A;  1QVG A;  2WB1 G;  3BZC A;  4DV6 L;  1HNW Q;  1NMG A;  4DV5 L;  3HKS A;  1JJG A;  4UY8 C;  4HID A;  1K0R A;  2JA5 G;  1D8L A;  2K50 A;  3T1H L;  1XMQ L;  4X64 L;  2VZA A;  4C3H H;  4ALP A;  1L2F A;  3T1Y L;  2K14 A;  3HOU H;  3VDY A;  1C9O A;  1X9N A;  2R92 G;  4LF8 L;  2ZTD A;  2E2I H;  3S2H H;  4J15 A;  2AKW B;  3W1B A;  3AYH B;  2V1C C;  2N3S A;  1QUQ B;  4A3C G;  1A0I A;  4LUZ A;  3BJU A;  3ULJ A;  3NEN A;  2IHF A;  4IO9 A;  2YTY A;  2BH8 A;  3S16 H;  4IPG A;  4JV5 Q;  4OO1 G;  3CD6 A;  1TXY A;  1L1O A;  3PUZ A;  4R1J A;  1HZA A;  3ULP A;  1XPR A;  1PYS B;  4LFA Q;  4NB3 A;  3J7Z C;  1X3E A;  4JOI C;  4GLV B;  1VQI A;  1B7Y B;  1HJP A;  1VQC A;  4XTC S;  2C35 B;  4ME3 A;  5H1S E;  2I0Q A;  4DR3 L;  1MKH A;  4A3G H;  3K81 C;  4QY7 A;  4GKK Q;  4A3L G;  2WP8 J;  1VQA A;  3I4M G;  4DUY L;  4NPS A;  4JYA Q;  4PG3 A;  3M3Y H;  2WAQ E;  2UXD L;  1X56 A;  2KCT A;  4DV7 L;  2ASB A;  4R4C A;  1J6Q A;  1I94 Q;  4DV4 L;  2PI2 E;  4JI3 Q;  5IY0 A;  4DV2 Q;  1N9W A;  3CCJ A;  3K7U C;  1BVS A;  3K80 C;  2L15 A;  1EYG A;  4X66 L;  2HHH L;  3TRZ A;  2R7D A;  3G6E A;  3CCE A;  2ZM6 L;  3WWV A;  4HJ8 A;  3CMA A;  1B70 B;  5FJ8 H;  1YHQ A;  3FKI G;  3M7N A;  2K5H A;  4A3D G;  2VNU D;  5IYC H;  1E1O A;  2A19 A;  3HKZ E;  1EIY B;  1OXV A;  2N8N A;  2ZJR A;  4A3J G;  3KJO A;  1G29 1;  2XGT A;  1S40 A;  4JI2 Q;  2LXK A;  2K75 A;  5IYB H;  4BY7 H;  2NVY H;  1W2B A;  1M1K C;  1IBK Q;  4HJ9 A;  4A3K H;  3HOW G;  1KD1 C;  2NVX H;  4NXN L;  1IZ6 A;  2Y0S G;  3BZK A;  1XMO L;  3K8A A;  1HR0 W;  3PF4 A;  3CXC A;  5LMU L;  1U0L A;  1A62 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...