4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
1SLJA 4BXXH 1GVPA 1A8VA 2F52A 4IPCA 4HJ7A 1I5FA 4IPDA 1N36Q 1G6PA 3ULLA 1IBML 3Q8DA 1HNXQ 4FDBA 4XIGS 4DKAC 1XMOQ 1VQ8A 3NENA 2ZTCA 3OW2A 1YBYA 4DK6C 3HKSA 1OTCA 1N32L 1AE3A 5M5WH 5K36G 1Z9FA 3BU2A 4P71A 2C35B 2JA5G 4OX9L 3KF6A 1V9PA 2WAQE 4L5RC 2OTLA 3K81C 1PH5A 3M3YH 3CXCA 3I4MH 3M9BA 1YNXA 1Y1VG 2PQAA 1D7QA 1Q1EA 4JI6Q 5C44H 2K75A 1E22A 3CQZH 2YYZA 4DR7Q 3HOZG 2OQ0A 2PNHA 5IP9G 1LTLA 2QA4A 4GKJQ 5C44G 3W5OA 2AMCB 5GADC 3CCRA 1SE8A 4HIMA 2R6GA 1PVOA 3CD6A 4GNXB 4JI0Q 2JA7G 4C3HH 1PH6A 1XNRL 4DR3L 1VQKA 5FJ8G 1XNRQ 4JI0L 3AFQA 1VQHA 1N34L 3L7ZC 2YTVA 2E8GA 4J15A 3HOXG 3PF4A 5IYDG 3M85A 4GLXA 3T1HQ 2IHEA 3A5UA 3PCOB 4GKJL 1GO3E 3GTQH 1MJCA 2E5LL 4A93H 1YI2A 1N34Q 1XMQQ 2MO1A 4YY3L 4A3CG 3CW2C 3PUVA 4JBMA 3JAMc 2NVYH 1OXUA 4OX9Q 2I5HA 2A8VA 2E2IH 1JE5A 1VQ5A 4PZ8A 4A75A 1LM0A 1HNZQ 1JMCA 1Y1VH 1L0WA 2UXBL 3W1BA 1PFSA 1V1QA 1N9WA 2YTYA 1FVIA 3S15H 2HIVA 3CAMA 1KXLA 5DLQE 1I94L 4JI3Q 1MKHA 1IBKL 2R93G 2E2JH 2Y0SE 1J5EQ 4JI5Q 4JBJA 3UE0A 2IY5B 4BA1I 3U50C 3FHWA 2GVAA 1XNQQ 4AH6A 4DR6L 2R7ZG 4LF8Q 1IL2A 4LUVA 1FGUA 2MO0A 4IPHA 5C4XH 1WOCA 3I56A 3G4SA 2V1CC 4JI7Q 4BA2I 3E0EA 3HOXH 2JA7H 4H02A 3U58A 4OWXB 1E24A 3JC66 3S1RH 4BY7G 2UXCL 4R4IA 4OWTB 3W1GA 2E2HH 2JA6G 1K8GA 1RIPA 2H5XA 4JI4L 3M4PA 3PO3G 2KHJA 4MNOA 1BBWA 3SGIA 4X62L 1W2BA 3PO3H 1N8RC 5FLXc 1KIXA 2UUBQ 4IJLA 2VUMH 4LFBL 2OQKA 3S2DH 1AH9A 2UU9L 1NMFA 4HJ9A 1L2FA 3I55A 1E1OA 2VUMG 2GVBA 1PHJA 3EBEA 4KHZA 1PH7A 2IX0A 2UXBQ 3LGJA 1QZHA 4GKKQ 3J80c 4DNIA 3RLFA 1Y1WG 1SN8A 2JA9A 4PZ7A 1VQLA 4GLVB 1HZCA 5IYBG 4OXPA 3GTPH 4Y7NH 2VQEL 4YY3Q 5M3MH 4LF4L 2KHIA 4P74A 1GM5A 1G51A 4C3IH 2ZM6Q 2HHHQ 4L5SA 4A3DG 2WFWA 4JOIA 1VQ6A 2JE6I 2HQLA 4WJ4A 3M7NA 3CMAA 4DR6Q 2LXKA 5J3BA 2K4KA 4A3DH 1YHQA 4QY7A 4LF4Q 2RHSB 3GTKH 1GD7A 4LF7L 4NXNQ 4A3EG 3S17H 1QVCA 5GAHC 2JJQA 4RG1A 4KHPL 4OO1G 5C0XJ 3IRBA 3STBD 4X65Q 2F4VL 3HOVG 4OO1I 3KFUA 4P73A 1YVCA 4DR5L 2AKWB 1U5KA 2VL6A 3KOJA 4DPGA 4A76A 1VQNA 2ZTEA 4LWCA 3HOVH 3KF8B 1G291 2WB1E 1VQPA 4A93G 4NXML 4UP8A 3CPWA 5JJKA 1IBLL 2KCMA 5M3FG 1YZ6A 2I5LX 4K0KQ 1HZBA 5IYBH 4AQYL 4LF9L 4B3SL 2RCNA 1I50H 2EQSA 1OXVA 5IWAL 1JJGA 3S24A 2IHFA 1MJEA 1HR0L 1YIJA 2F3IA 1JB7A 2Z6KA 4JI7L 1HR0W 1HH2P 5IWAQ 4EQ5A 5H1SE 4P72A 1KRSA 1PH8A 1EIFA 4UPAA 1KRTA 2VQFL 4AQYQ 4BBSH 1W3SA 4GN5A 3RN2A 1SR3A 1WJJA 2A19A 4HIDA 4A3MG 3RLNA 5FLMG 4A3FG 1VQFA 1X9NA 1S40A 2K50A 4R1JA 3CMEA 4GN3B 4OONA 1H95A 1TWHH 5FLMH 2VQFQ 1TWCH 3D0FA 1HNWL 1YJ9A 1YJNA 3CCJA 2LSSA 4DUZQ 4JV5L 4DV7L 2XGTA 1PV4A 2UUCQ 1N33L 4DR5Q 1VQBA 4A3LG 4YWKA 1VQCA 1LUZA 4LFAQ 1C0AA 2K5HA 3GTOH 3PGZA 2MNAA 2Y0SG 1PYBA 2R7FA 3MEFA 1EOVA 4KHPQ 1R9TH 1Q82C 5C3EG 1NY4A 3UDIA 4NXNL 4A3IG 3PF5A 4NPSA 4LF7Q 1WI5A 5LMNQ 1UE5A 3ULJA 4UY8C 1SMXA 4BXXG 2PI2E 4IO9A 1V43A 2N78A 4POFA 2EIFA 3CCLA 4QL5A 2KCTA 4R4TA 5BR8Q 4DR2Q 3H3VH 2HHHL 2MQHA 5GAEC 1NBWA 2N49A 4BBRH 1CKOA 5IYCH 5M3FH 1VS0A 5JEAJ 1Y14B 1Y1WH 4JYAQ 1NE3A 2CWAA 4R4QA 1KC8C 4A3BH 2YU9H 1QUQB 3E9IA 2JEAI 3KDFB 4A3FH 3HOYG 4IFDG 3G6EA 4QJFA 2CWPA 3UDFA 1VQMA 1KQSA 5JEAG 5C4JH 2BH8A 2NVQH 2VS1A 1TWGH 2R92G 2WB1G 5LMUL 2NN6G 2UU9Q 2Z6KC 3D31A 2RF4A 4JI3L 4HJ5A 3S14H 2ZM6L 3RZOH 1BVSA 1KD1C 1KL9A 4JI6L 2LXJA 4C3JH 4B3RL 2NVTH 1E1TA 5IP7H 3BJUA 1YHBA 2BA0A 4JI4Q 4YCWA 3I4NG 3J7A5 5IP7G 1CKNA 3CCMA 4GKKL 2K14A 2R7DA 3CPFA 4JI2L 4A3LH 2NZHA 3GDEA 1O7IA 2UUCL 3OTOQ 5IE8A 1EIYB 3F2BA 3B6YA 2Q2IA 2OCEA 5GAGC 3U4ZA 1EQQA 4POGA 4LFBQ 4OWWB 1HZAA 1X54A 5FJ8H 3RZDH 2RHQB 1XNQL 3AEVA 3KYHC 1FL0A 4IPGA 2IT1A 3J81i 4X66Q 2AHOB 1K3RA 4A4IA 4GOPB 2WP8J 4DV2Q 2JQOA 3CP0A 1I94Q 3K7UC 1CKNB 1HR0Q 1OXTA 3PUXA 4GNXA 3CC4A 2OWOA 3ERSX 4YCUA 4B3SQ 5HY6A 5C0XG 2K5NA 1BBUA 4GN4B 3CF5A 3I4MG 2WAQG 4JBWA 3TEHB 3ULPA 5C0XI 4LUZA 1Q7YC 4A3JH 2JA5H 4JI5L 4B3RQ 2ATWA 1J5EL 4NXMQ 3GO5A 4IJHA 4UP7A 4GNXC 1Z47A 2KBNA 4GLAC 1M1KC 1IBKQ 4AYBE 4LF6L 3CCSA 1EYGA 2UXDL 2ZJPA 4X64Q 3NBHB 2PMZE 4DV4L 4P75A 4GOPA 1J6QA 4R4OA 2NVXH 1XPUA 1Q8KA 1K83H 3ZJYC 3GTGH 4YWLA 4PMWA 1P16A 3RLOA 5AJ3Q 1Q1BA 1X6OA 2JA8H 3HOUG 3ICEA 3VDYA 3S1MH 2Q2TA 1VQAA 3G71A 1PYSB 1VQ9A 4LNQA 3K8AA 3RN5A 3BZKA 4R4CA 3HOUH 3GTMH 3TS2A 2JEBI 3HFZB 1PH3A 1S72A 2K5VA 4JI8Q 2AWNA 2K52A 4EX5A 3JAMi 2B3GA 4TQUS 3AQQA 1WCMG 2CQOA 4DV1L 4HJ8A 3T1HL 4UP9A 4B3ML 4JI8L 4HIKA 1YJWA 4DR7L 3T1YL 3STBC 3DM3A 3H3VI 1B7YB 2EXDA 3UDXA 3WWVA 1OXSC 4YHHL 1LYLA 4MTNA 4A3JG 2A1AA 1L1OB 1B70B 5AJ3L 1A62A 4DR4Q 3KJOA 1L1OC 5M3MG 4DV3L 4DV7Q 3TREA 2B29A 3GD7A 4X64L 3J81j 4DV4Q 1YHAA 1HNWQ 1Q81C 4X66L 4AIMA 5GROA 1SFOH 3F1ZA 1KAWA 2ZJQA 3CCVA 3OYYA 3S1QH 4L5QA 1VCIA 4A3EH 2HT1A 4Y52H 3EIVA 3PIOA 2I0QA 2UUAL 1DGSA 3EN2A 4ME3A 1CKMA 1X3FA 3S2HH 1RL2A 3OTOL 1M90C 2JA8G 2OTJA 1HNXL 2D0OA 1IYJB 1E7ZA 3CCQA 4LF9Q 2UUAQ 4DAYB 5C3EH 2YTXA 1SRUA 1PA6A 3PO2G 4LW1A 5IYDH 2ZTDA 3CCEA 3CC7A 3E9HA 1BKBA 3PO2H 2YV5A 4LFCL 4JG2A 2Q2HA 4NB3A 3A74A 1PH1A 1X56A 4KI0A 1JJCB 2XTIA 5LMNW 4DV3Q 1PH9A 4IOAA 1T9HA 3ER0A 1SROA 1X3EA 4DR4L 3PV0A 4JI2Q 1EQRA 4X6AH 2ID0A 4X65L 2VW9A 1HNZL 1P8LA 1PH2A 2JK8A 2B63H 5JJIA 4O0AA 1YEZA 5M5XH 3NELA 3AFPA 4YHHQ 2D62A 3GTJH 2R93H 5IY0A 3PUYA 5HGQA 1EWIA 1UWVA 4LUOA 1UE6A 2R92H 3HKZG 4DUYL 4LF5L 4ALPA 3HKZE 1ASYA 3TS0A 3K80C 3J81c 1VQGA 4DV1Q 1EFWA 5ELNA 1WFQA 3GTLH 4LF5Q 3KLWA 2QEXA 5LMNL 4A3MH 4DV5Q 1Q86C 2N8NA 4DR1Q 2HIXA 4PZ6A 2VQEQ 4GOPC 1VQ4A 2R7ZH 3RNUA 4DR3Q 2Q2UA 1ASZA 1E3PA 5C4XG 1EUJA 4JOIC 1AE2A 2BA1A 4C2MH 4PG3A 2NZOA 1X65A 2PQAB 3I4OA 5BR8L 4A3IH 1JJ2A 1XJVA 4GS3A 1XTDA 3KF6B 4O2DA 5EAYA 4LFCQ 2UUBL 1XPRA 2UXDQ 1VQDA 1NTGA 1A0IA 1X55A 3H15A 3H0GG 1UE7A 5GQOA 3MXNB 1NMGA 1GKHA 1IZ6A 2UXCQ 4B3TL 3F8TA 3F2CA 4HJAA 1NJIC 4AYBG 4LFAL 4JI1L 4A3BG 2N3SA 3HOYH 4DV0L 1FJGL 1N32Q 3PUZA 4XTCS 1XMOL 4BBSG 4DV0Q 4BBRG 1FJGQ 4JI1Q 4JV5Q 1IBMQ 4B3TQ 3G48A 4MZ9A 4K0KL 1UE1A 4DV6Q 1OXXK 1UEBA 4JBKA 3K0XA 4A3GH 3J7ZC 1IBLQ 4JCVE 2ASBA 3CC2A 1VQIA 3FKIH 2IX1A 1TWAH 4QQBX 4DAMA 4DV6L 2MFIA 3HOWH 3FKIG 2GN5A 2CCZA 2VY3A 3I4NH 1VQOA 1JT8A 1MIUA 3HOWG 2ALYB 3J80i 1KHIA 2D0PA 4IFDI 1X3GA 1QVFA 3TRZA 4A3KG 2PI2A 1VQ7A 5JJLA 1K73C 3M4OH 1A63A 2DUDA 4YWMA 1L1OA 3H0GH 4DR1L 1XMQL 2VNUD 3T1YQ 1IXRA 2VZAA 1CSPA 3F2DA 3M4QA 1QVGA 1WCMH 1C7YA 2E5LQ 3RR5A 5LMUQ 1CSQA 1C9OA 2FXQA 5IYCG 4B3MQ 3K7AH 2NN6I 4QIWE 1XPOA 4RMFA 3S16H 4DUYQ 3FP9A 4APVA 3UDGA 2F4VQ 4A3CH 1HJPA 3TQYA 2B63G 3A0JA 4DK3C 4JYAL 3PSIA 1VQJA 4IOCA 1D8LA 1HZ9A 1TXYA 1WYDA 4L5TA 4DV5L 4KLKA 3KDFA 1TWFH 4DR2L 1YITA 4IFDJ 1B8AA 3AYHB 2CFMA 5E7NA 2ZJRA 2Z0SA 2ES2A 4LF6Q 3L0OA 4A3GG 5ELOA 1I3QH 1VQEA 1I6HH 5M5YH 1S3OA 4YCVA 4JC0A 3L2PA 1K8AC 3CCUA 3KJPA 1QZGA 1Q12A 3DLLA 4A3KH 1K9MC 3S1NH 3HOZH 2DGYA 5IP9H 1Q46A 4BY1G 3PIPA 1N33Q 3A5ZB 4WJ3M 3PUWA 2AWOA 4BY1H 2L15A 4BY7H 4DUZL 1K0RA 3I2ZA 1U0LA 4DV2L 2BH2A 1N36L 2JA6H 5IT9c 2QGQA 2KENA 4X62Q 3BZCA 4LF8L 1CUKA 3I7FA 4TVAB 2I5MX 4QGUA 4HIOA 1QUQA 3U4VA 3NEMA 2CKZB 1PH4A 3UE1A
chains in the Genus database with same CATH superfamily
1GYFA 3OWFA 1A8VA 2Z9HA 2AUKA 1EYCA 3SI8A 1GGOA 1G6PA 1GUGA 2L5TA 2P0AA 4EFEA 1HNXQ 3PIO3 4IR1A 1VMCA 2K1BA 3RMHA 3T53B 5DNFA 1VQ8A 2V59A 5I47A 1ENCA 1OTCA 5KG5A 1B1ZA 4P71A 4CHTB 2JA5G 2R87A 2V4RA 3MFGA 1V9PA 4H13C 2WAQE 2NTSA 3K81C 1PH5A 2R93B 3UI2A 3CXCA 2WDTA 4J1MA 1Y1VG 5KG3A 2O5IC 1Q1EA 4JI6Q 3W3AA 3NPPA 5JPNC 2OQ0A 4GKJH 3H0GA 1ILQA 2RDFA 3OSNA 4Q8FA 4ZQIA 1KNEA 4N9PA 5KFDA 2JA7G 4C3HH 3SK6A 3FMCA 1VQKA 1AW7A 1ENFA 2YW2A 4JI0L 2PZUA 1VQHA 2YTVA 4RGMA 2IHEA 4DV2H 3PCOB 4GKJL 4DL7A 3PO3B 4L6TB 2W9BA 1N34Q 4YY3L 1HUMA 1SYXB 4MV6A 1G2SA 4ZOLF 3K6OA 3JAMc 4FF4A 2A8VA 3PW4A 1RTNA 1GUTA 1LLRD 4QF4A 5LA6F 1QCBD 2KCNA 1HNZQ 3RFCA 1JMCA 3PN1A 1N34H 1PFSA 3ND9A 2HIVA 3PMFA 2IX3A 1KXLA 1J9OA 1TT2A 4FS1A 4DK0A 3NXWA 1J5EQ 1RK5A 1H9RA 4BA1I 5KFPA 4RB2C 4XZ3B 1CE8A 1IL2A 4X3KA 4K6DA 2UU9H 1UNNC 5C4XH 1WOCA 2V1CC 2JN4A 1Q8IA 3E0EA 1LTRD 4TRDA 2IW3A 5DQIA 3FKIA 2BR0A 1E24A 2UXCL 3KHHA 4R4IA 5JPMC 2JA6G 5ELFA 1RIPA 4IHJF 4YBZB 1K3BC 3G6XA 3PO3G 5C4ZA 3FKIB 4KD3A 1PLFA 1WTVA 3J81W 3PO3H 1QE6A 5FLXc 5KFVA 4FXKC 1LT4D 1F9QA 1E4GT 3WO0A 2B2YC 1L2FA 1I50A 1E1OA 1RDPD 1HR0H 3EBEA 2IX0A 3RLFA 1BNCA 2FK1A 2JA9A 1PXUA 4X66H 3KLSA 4GLVB 4C3HB 5IYBG 4A3BB 1NR2A 2YZNA 4IR9A 2VQEL 2PN1A 5M3MH 1KTKA 4P74A 5KT5A 2HHHQ 4L5SA 3KHRA 4A2AA 2A6HC 2FJZA 1NAPA 5KNDA 3MXPA 1YHQA 3G8CA 5GONF 1KDCA 1GD7A 4ED1A 1QVCA 3PR4A 5GAHC 2A73B 2JJQA 4RG1A 5EWEA 3M9MB 2C2RA 1ICFB 3STBD 2ASJA 3HOVG 1UNSA 2EYJA 3KFUA 1U4MA 4LH6A 4FO2A 4HNVA 2VL6A 3M7GA 3KOJA 2O4XA 1VQNA 1O7YA 2ZTEA 4LWCA 3HOVH 5C3XA 1B3AA 2YS6A 5KGUA 1BR9A 1B9NA 1SJHD 1TS3A 3H0GB 4A93G 4NXML 5E1FA 2EYMA 3WOEA 3MA2B 1IBLL 2NVYB 5KG7A 1LTTD 4RWSC 2I5LX 2FLNA 4K0KQ 2KECA 2WKCA 4X3SA 1JJGA 1L2ZA 3GTGA 5M9OA 3T5KA 1NCVA 2F3IA 5T14A 1S0MA 1HH2P 4TUYF 3SE7A 2IA6A 4HCEA 3MC0B 2XD4A 1W3SA 2CW8A 5KFNA 4FXDA 4A3MG 2L55A 4A3FG 2K50A 1MI2A 1TWHB 4KJOA 4R1JA 4ECYA 4RB0A 1WTHA 5K5PA 5FLXE 1ET9A 4OO1H 1YJNA 1SNOA 3QOJA 5M5YB 1FYCA 3I70A 4N8X1 4KY7A 2YCHA 3V6KA 1CS0A 1PYBA 2R7FA 4ED7A 1EOVA 2DJGC 1G6ZA 3KXYT 2JYOA 1FD7D 3GV7B 2J9GA 2B2UC 3UDIA 3PF5A 2XRSD 4UY8C 1Y8PB 4RHSA 2NUCA 4BXXG 2NWGA 2PI2E 4IO9A 4XXEA 4POFA 4R4TA 2NU8B 1EIHA 3K58A 4ZCKA 2N49A 1CQIB 4ED2A 5JEAJ 3R2IA 5IODA 4R7RA 4K0KH 2F0OA 5COYA 2CWAA 1QUQB 3KDFB 1E4FT 3G6EA 1Z6HA 1TR5A 2B2VA 4QW8A 2CWPA 1VQMA 2W9CA 1KBLA 2NVQH 3V96A 3GTLB 2Y0SA 1I6UA 4HJ5A 4A3DB 1ESRA 4DA2A 1TWFA 3M9NB 4QWEA 2DPJA 1X3PA 1TWGA 2NVXA 2LXJA 4B3RL 2DJFC 1W96A 5IP7H 3G7LA 3BJUA 2F0FA 5IP7G 3CCMA 4GKKL 1NUCA 5M5XB 3GTJB 1G91A 4CKEA 3GTPA 3GDEA 2UUCL 3OTOQ 3F2BA 3B6YA 3QO2A 4DV1H 1SYFA 3SK4A 3RGZA 1EWCA 1EQQA 4POGA 3TIIA 2ZM6H 1X54A 3QOLA 5EDWA 1XNQL 2ASDA 2BE5C 2FMMA 4EBEA 2HDLA 1FL0A 5KFXA 5KFEA 1K3RA 1I6HB 4DV2Q 2W71A 2UVUA 1JOOA 3K7UC 1TU2B 5KEEA 1HR0Q 2DPIA 2XRQD 5FD6A 3CVZA 2OWOA 2CW0D 3LMLA 2WAQG 1F9PA 3ULPA 2F0MA 4RCNA 2XC9A 2J6TA 4B3RQ 1II3A 3OIPA 1J5EL 3S9WA 1IBKQ 3N40P 2KUMA 3MXNA 4RGTA 4X64Q 1VBHA 2PMZE 3S16B 1SYCA 4E4TA 5KT2A 1V1PA 2W57A 4JI6H 3GTGH 5AJ3Q 3C1EA 1Q1BA 1X6OA 3S1MH 3K5HA 4DU9A 1VQAA 5IGBA 2PVPA 4R4CA 4B3SH 1MGSA 2KQ3A 3CU7A 3HFZB 2PW5A 3TS2A 2HGSA 3SEBA 4ODGA 2AWNA 4WJWA 4HJ8A 4DV1L 4O4HF 4DV4H 4UP9A 5J2TF 3DHQA 1QNKA 3J7AV 5DLFA 4JI8L 1S9FA 3T13A 4IUUA 2W7PA 4QIWB 1RJRA 4MV7A 4MV9A 2NU6B 4TQRA 2VA2A 1B70B 5AJ3L 1A62A 3TP5A 1S68A 2X6LA 2XWBB 3KJOA 1L1OC 3RAXA 3BDCA 1CTMA 1JLLB 3T1HH 1KLGD 3CQZB 4FBTA 4JI8H 5GROA 1RKNA 1AEXA 4K14A 2CHBD 2QDLA 1KAWA 1JDEA 3OYYA 3S1QH 2W6OA 1PFBA 5BN4A 4RHRA 3JAMW 3OMGA 2C28A 4ZKCB 1SE2A 2KJXA 4RAZA 2VOBA 1SEBD 1PZID 1M90C 3BZDB 1JIHA 1HNXL 2JP1A 1IYJB 3CCQA 3VR5A 4C3IB 1SNCA 4DAYB 1KAAA 1I3QA 1J8IA 2YTXA 3PO2G 2WTFA 3RV4A 1AP0A 4JUZA 3LWEA 3CCEA 1CA5A 2W8LA 1CT1D 1LTBD 4PMBA 3PO2H 1BJTA 2FK2A 5LMUH 2JA5A 4KI0A 4O1NA 2XTIA 5C8YF 2XCPA 4F4WA 1PH9A 4MV1A 3CRKC 4IOAA 1X3EA 2EYOA 3PV0A 1EQRA 1P8LA 2JK8A 1QG7A 1N36H 5HBRB 1YEZA 2R93H 3VYRA 1Y1WB 4DAPA 4J9OA 3A55A 3IFDA 4DUYL 2Z6BA 4X3UA 5ELNA 1WFQA 4PDBA 1ZYRD 3KLWA 4KV6A 5LMNL 5EPJA 3G6YA 1Q86C 3FDTA 2WB1A 2FP4B 5D8DA 3PW7A 5CV4A 3RNUA 1E3PA 5C4XG 1GXDC 4JOIC 1AE2A 3RF2A 1TKWB 3KF8A 1HPCA 3I4OA 5BR8L 3RD4A 3K5NA 2KEDA 1JJ2A 1XTDA 4RKBA 2UXDQ 2VXWA 1B4OA 2SCUB 4HSVA 2ZDHA 2F0PA 3MXNB 5F9NA 5H80A 1IZ6A 3GTQB 1CFMA 2UXCQ 1SCUB 1NJIC 5I2XA 4A3BG 4AYBG 4JI1L 1K83A 1U4PA 1I7LA 3M4IA 4BBSG 4DV0Q 4BBRG 3GIPA 5CV6A 1IBMQ 4KJNA 4I7AA 3I91A 4B3TQ 4CJ0B 2E5LH 1GSHA 1UE1A 2ASBA 2IX1A 1VQIA 3FKIH 4DR1H 1TWAH 3C3LA 3NWSA 5NUCA 5KFAA 3G6JB 4KHPH 1SE4A 2B2WA 3HOWH 3AMUA 5KFQA 3FKIG 4GZYC 2VY3A 3H4BA 1MIUA 3HOWG 2ALYB 3J80i 3H6MA 1G2TA 1FNVA 1X3GA 1QVFA 3T56B 2FHTA 4IURA 4ECTA 3EJIA 3TRZA 3V05A 2AQ4A 2B2UA 1K73C 1A63A 5FLXW 4QWDA 3KAKA 2YU9B 1IBLH 2VNUD 3H0GH 2KA7A 2F0LA 2VZAA 3F2DA 3JSLA 4AQYH 1F2YA 3S16H 1JWSD 2FXQA 4B3MQ 1DZ1A 3DMUA 4QIWE 4WD3A 3FP9A 4APVA 2L0CA 3R5XA 3VR3A 5CMDA 2OXPA 5C4XB 3TQYA 2B63G 2FE3A 3K57A 2GLTA 2W70A 4JYAL 1ZYRC 5CC4A 3MWDA 1HZ9A 1WYDA 3FPPA 4KKSA 4KLKA 3KDFA 1Z2PX 5I2YA 3PR5B 2X69A 2XCAA 2VB2X 1B8AA 4YR2A 2CFMA 4J0MA 4A3GG 4LF8H 5JVLA 1HA5A 1I6HH 4AYBA 3HEJA 3S1NB 1TWCA 4DR3H 1K9MC 4ED3A 4AYBB 5KG2A 2DGYA 4I50F 3KUPA 3BAAA 1MD2D 2WKDA 4LF4H 2JEIA 1SFOA 2X6GA 2FPGB 2R3ZA 2B63A 3TN2A 1K0RA 2PZWA 1KJIA 1A6XA 3RTXA 3K5IA 2QGQA 4LF8L 1N48A 3BZCA 1RJPA 1CHQD 2I5MX 3E6ZX 4YY3H 2CKZB 1SLJA 4BXXH 4MN3A 2E76C 2F52A 3Q8QB 4KKUA 1X3QA 1N36Q 2R7NA 4XYLB 4KN4C 3ULLA 3GIDA 3Q8DA 3S2HB 2UXBH 2YS7A 3OW2A 1YBYA 4IUTA 3HKSA 3U9SA 5BMVF 5K36G 5CORA 3BU2A 1XNRH 3MR2A 4DL2A 4OX9L 5CV5A 2OTLA 5C0XH 4ABNA 4DN4M 1EY7A 1FNUA 3I4MH 3M3YH 2PQAA 4IRCA 4EFBA 1WTQA 3NSWA 2YYZA 1BXRA 5DM63 5IP9G 4RGOS 2QA4A 5C1OA 4IWYA 2AMCB 2V4DA 5GADC 3SK8A 3CCRA 2K6AA 4HIMA 1PZJD 3OW7A 1G8ZD 1IW7C 4ZUIA 1BF4A 2YL2A 4DL3A 5T1GA 1PH6A 1XNRL 5FJ8G 1XNRQ 3AFQA 4OELB 2MPMA 2E8GA 4J15A 5LHY1 5IYDG 2EZVA 3T1HQ 3A5UA 1GUWA 3LX0A 5EPKA 1CK1A 2E5LL 1I4GA 1XMQQ 1Y69U 2R82A 3IL8A 1XWEA 3CW2C 2ZXRA 3ETHA 2F3WA 1OXUA 2NVYH 2I5HA 1VDZA 1LM0A 2F0VA 2ICIA 4CDDC 5LL6X 1GJXA 4UFZA 3CAMA 2E2IA 5L1KA 5C5LA 1Y1VA 2C22A 1JB3A 3ORQA 5CA1F 4JI4H 2Y0SE 5J2UF 4JBJA 4LJZC 2IY5B 3U50C 2DWCA 4EQPA 4RFBA 4LF8Q 1Y1WA 4LUVA 1FGUA 2EXZA 2MO0A 1VAJA 2Z1CA 3I56A 3G4SA 3TMEA 3J7AF 3HOUB 3D6CA 3U58A 2F0UA 2AGQA 4DFAA 4OWXB 4BY7G 5JAVA 4OWTB 1S4ZA 2EY1A 3W1GA 1K8GA 4RUCA 1B9MA 4K2LA 3M4PA 4JI4L 1IBKH 4HNTA 2R8KA 3JRWA 1R9TB 3JAME 1TWAB 4NXMH 4B3RH 2EVBA 4MNOA 3H4DA 1W2BA 4FF2A 1ZHSA 5BR8H 1I3QB 4IJLA 4HMIA 2L12A 2UU9L 2EOTA 3I55A 1STGA 3LGJA 1SNQA 3J80c 4DNIA 1Y1WG 1SN8A 2CW7A 2BCOA 1HZCA 2R84A 4OXPA 3RIZA 3GTPH 4Y7NH 1F2ZA 5C6AA 3GP7A 3HBLA 5EBCA 2OLSA 1TWAA 4RB3C 3F2UA 1GM5A 5IT9L 2ZM6Q 1T3NA 2R93A 4A3DG 4EYHB 1QWYA 3M7NA 5BPFA 1H9JA 4A3DH 5L9XA 1N33H 1VF7A 4KY5A 2EYLA 1PMRA 2F0WA 4HYKA 2XIWA 2Q8RE 4KHPL 4OO1G 5C0XJ 4MV3A 3LWBA 1O80A 1IBMH 1GHKA 1L0XB 3PZPA 3Q0AA 2AQ2B 4OIKA 4P73A 3MFYA 2WYOA 2AKWB 4FYDA 1EUDB 1Q3LA 1YNNC 3PW2A 1G291 2RGRA 1V4YA 1Q90A 4K8JA 2WB1E 1CA6A 3C46A 2BDNA 3SHLA 2C5CA 5I9PA 1XYIA 3GLKA 5E3FA 3T4AC 5IGGA 4HR7A 4IRDA 4H7BA 2J4XA 2CVRA 4Q43A 3R5FA 2RCNA 1IHZA 2HQEA 1MJEA 1JOQA 4JI7L 2Z6KA 2K03A 5IWAQ 2RDGA 4EQ5A 1PH8A 1EIFA 4UPAA 1KRTA 3VA5A 2VQFL 4FF1A 3RN2A 1X9NA 3T1YH 4HIDA 5KFOA 5BPHA 4WFN3 4NXNH 3CMEA 4GN3B 1H95A 1TWHH 2EYPA 3BVZA 1TWCH 4UAIA 1V1PB 4IZOA 2LSSA 4CKBA 4DUZQ 4HN7A 1SE3A 1PV4A 4TQSA 1N33L 2CH4A 1N56A 1VQBA 1O78A 4LFAQ 1C0AA 4C2MB 2MNAA 3GIKA 3MEFA 4NW2A 2VQFH 2PW7A 5C3EG 4NXNL 4LF7Q 1LT3D 4B9XA 2R86A 5LMNQ 2JSOA 3A7AB 3DWQA 3HZXA 2A74C 3CHBD 2L1BA 3CCLA 4QL5A 1Z7TA 3H3VH 1EYDA 4RGNA 5IT9E 1PRTD 1DV1A 5M3FH 4EGVA 2IBKA 1VS0A 1Y14B 4JYAQ 4A3BH 4IFDG 1RD9D 1K0SA 4JI7H 4O3NA 1TWGH 4LFCH 2WB1G 5LMUL 4Q0FA 3QWNA 2RF4A 3S14H 4ECSA 2ZM6L 3RZOH 1BVSA 1STYA 4XDXA 1KD1C 1EU3A 4C3JH 5CBAE 3J81L 2NVTH 2E74C 1YNND 3LP8A 5IOCA 2QW7A 1PFNA 2UVVA 1T36A 1CKNA 5IGEA 2K14A 1DOKA 1SNPA 3CPFA 4JI2L 4A3LH 4FNFA 2NZHA 3R93A 2R8HA 2EJGC 3P7JA 1CZWA 1DD2A 1GLVA 1RCVD 5DM73 4A2BA 1EYAA 1JR0D 1HTPA 1CZGA 4RZRA 2AGOA 1LTID 2IT1A 4X66Q 2AHOB 4EBCA 4ECQA 2PMZA 3L4KA 3SVMA 2WP8J 2JQOA 5M3FB 1I94Q 5KFKA 2JEFA 3OUZA 2QK4A 1OXTA 3TQTA 1I7NA 2NBFA 3CC4A 3NTKA 4YCUA 4B3SQ 2EYFA 4DGZA 3K3VA 2K5NA 2WB1B 1BBUA 4GN4B 3URYA 3K59A 4JBWA 3RB0A 3A54A 3BJYA 2BQ3A 2UUBH 4YP3A 4A93B 2JA5H 4MAMA 4JI5L 2FB9A 1BNZA 5TSSA 2UXDL 2UUAH 1BBXC 3MFIA 2ZJPA 4DV4L 4GOPA 4P75A 4M7EA 4J9QA 2NVXH 4HNUA 1K83H 2RDJA 3ZJYC 1P16A 3RLOA 2RSOA 3C1FA 2Z4IA 2QEJC 3OPOA 3HOUG 3ICEA 5D1OB 2Q2TA 1K1SA 3BVGA 5EWFA 1S03G 4EEYA 3G71A 1VQ9A 1EY6A 3HOUH 3BZKA 3WDNA 1PRTC 2JEBI 1TS4A 1J5EH 2MP1A 1AZQA 3AU7A 4EX5A 2K52A 3JAMi 2BOSA 1WR2A 1WCMG 3C2PA 3VPDA 3EPIA 4HIKA 2DIKA 3DXJC 3T1YL 1EEFD 1HNZH 1DOMA 4K5WA 1LYLA 4MTNA 3FRPB 5L37A 2HCCA 1K28A 2A1AA 1FKAH 5KFGA 4ZKBB 1DYQA 5LOVF 4NDXA 3OTOH 4O3QA 3SR1A 4DV3L 5EBDA 3J81j 2JEJA 1EIGA 1B2TA 1WCMB 4IUQA 1SFOH 5IGDA 5C5MA 5CBEE 3CCVA 1A3TA 1DCZA 3CQZA 4ED0A 4DF7A 2F0KA 2HT1A 4Y52H 5KRUA 2UUAL 1W93A 3KHLA 1HRJA 2W6MA 4ME3A 3EN2A 1CKMA 1X3FA 3SDZA 2GPSA 1RL2A 3OTOL 2JA8G 4C2MA 4L1KA 2D0OA 4A3KB 1DXMA 4UCVA 4MTEA 3J80W 1E7ZA 3K5OA 4LF9Q 1Y1VB 1Z2OX 1EU4A 5C3EH 2A68D 1PA6A 4C5CA 3Q8RB 5IYDH 2F0GA 3CC7A 4DUYH 1BKBA 2A6ED 1PH1A 1SYEA 2QCPX 3A74A 1BCPD 1JJCB 4R8NA 3L4JA 1UEAB 3PIP3 4DR4L 4JI2Q 4EVOA 1HNXH 3H40A 2ID0A 2H1EA 1HNZL 1OWTA 1PH2A 2FLPA 4PV1C 1BCPF 3AFPA 2D62A 3PUYA 3DUZA 4LUOA 3EFXD 2NVTB 3FPUB 4A3GB 4RZQA 1ASYA 3HKZE 3J81c 1VQGA 1EFWA 2HVQA 4LF5Q 5JUMA 4APMA 3LNNA 4C5BA 3BS1A 3NE5B 4IUVA 1SYDA 1ZXTA 1TY0A 3DEOA 4PZ6A 5CV8A 4GOPC 1VQ4A 1IKLA 3OSPA 1C8CA 1EQVA 3K5LA 4ECXA 2BA1A 1IL8A 1EEID 2N55A 3GTOB 1C4QA 4JI1H 1FJGH 2NZOA 2JA7A 1X65A 2PQAB 4A3IH 3HOVB 2W6PA 5EJWA 3J7AK 1JORA 2XVSA 3GTPB 3N44B 4FP5D 3Q2OA 3MWEA 2WINB 1X55A 5FLXL 5T1IA 5C3WA 2ENBA 3H0GG 5GQOA 4MTDA 3VPBA 3MWYW 4L8JA 4JYAH 3OOCA 2RA4A 4LMYA 3GTGB 4B3TL 3F8TA 1M0TA 1N32Q 4U7CA 1WTPA 4Q5VA 4DV0L 5KIXA 3PQIA 2NTTA 1FJGQ 4JI1Q 5J22A 3R8BA 3G48A 4K0KL 4QWAA 1IOVA 1STHA 4YIJA 4A3GH 3J7ZC 4LF7H 5J39A 4DAVA 1JOKA 4PWQA 4J9LA 4DR6H 4XX0B 2GN5A 1LV9A 2B2YA 2NN6H 4C3JB 3Q22A 4DR5H 3MJFA 1F9SA 1KHIA 2D0PA 1A15A 2I87A 2FK3A 2I8CA 5ISRA 1PK8A 4C3HG 5JVDF 4MTKA 2NVQB 2JXMB 1BCPC 5DAUA 2CQYA 4OHJA 5JJLA 2MHVA 1Y8NB 2DUDA 4DR1L 1XMQL 4J9RA 4XYQA 3T1YQ 5EKKA 1CSPA 4XT1B 1CHPD 3M4QA 1WCMH 5HURA 1QVGA 4DV3H 1S5CD 1C48A 4F50A 1C9OA 5IYCG 4ECZA 4OL7A 1XPOA 4QIWA 4O3RA 4DUYQ 1TIID 4ECRA 4C5AA 2L4NA 1A3UA 1AFPA 1W6JA 4DK3C 1B44D 1TXYA 2M00A 4L5TA 2EY6A 1SFOB 4KMUC 4O4IF 4S3SA 4UCUA 1M8AA 4U6PA 3MFHA 1YITA 4IFDJ 3AYHB 5ELDA 4OEMB 3D4WA 1TWCB 3L0OA 2F03A 3FMAA 1HQMC 2F0IA 1LTGD 1K8AC 3CCUA 3J80E 3KJPA 1SXTA 1S0OA 4A3KH 3H94A 3S1NH 3GV8B 1GOZA 5IP9H 1VMPA 3NQTA 1Q46A 4BY1G 5KNBA 4DV5H 4C1NI 3PIPA 5D3DA 4DR4H 4BY1H 2K05A 3N6RA 3Q8SB 3QFFA 2K32A 2FINB 4A3FB 2JA6H 1VBGA 4DL4A 3GTQA 4TVAB 4V190 4HIOA 1RJQA 5JOBA 2R7KA 2V58A 1WD1A 3NEMA 4UCTA 3UE1A 3S1QB 1GVPA 4ZUJA 3OSOA 3DWAA 4HJ7A 1I5FA 4IPDA 3P20A 1HXYD 4K5VA 2LFNA 4CC5A 4FDBA 4XIGS 1XMOQ 1X32A 5EGTA 4O3PA 4DK6C 1JWUD 1N32L 1AE3A 2R92B 3OHXC 1B53A 1JXLA 1GHJA 2I46A 2BQUA 2C35B 3M3YB 1RHPA 3NBHA 3M9BA 1YNXA 2H4OA 5C44H 1C3OA 4XYOA 3CQZH 4DR7Q 1TS5A 5DGBA 4GKJQ 3I4NB 3GV5B 5C44G 1SE8A 2R6GA 3BYYB 1IOWA 1S5FD 4YQWA 2KHSA 3VR4A 3CD6A 4GNXB 1WTWA 4JI0Q 4DR3L 3VA7A 5BN3A 3HKZB 3MR6A 4ZQ3A 2DNCA 2F4IA 3PF4A 1HNWH 3NHHA 3M85A 4GLXA 1SBBB 4MIUA 1MJCA 4A93H 4C56C 3H3VC 1K8OA 1YI2A 5DG7A 2MO1A 3PW5A 1SMYD 4A3CG 1QJOA 3ZYYX 3PUVA 4JBMA 2E2IH 1VQ5A 4CDEC 4A75A 4DK1A 2BQRA 4BBRB 4ED6A 1V1QA 1N9WA 2YTYA 3MHBA 4HR7B 5JVG3 4A3IB 3S15H 5DLQE 4QWCA 4FU0A 1MKHA 1BDOA 3HG9A 2EE1A 5C44B 1IBKL 2E2JH 3SXHA 4ID6A 4HEDA 1KJJA 3UE0A 3FHWA 2KCCA 2GVAA 1XNQQ 4K8IA 2R7ZG 1T5EA 1WTXA 4IZ8A 3OHAA 4ETSA 1Z2NX 4JI7Q 1S0NA 3HOXH 3MEHA 4H02A 1WSCA 4Q8EA 3JC66 3S1RH 4DR7H 1I4PA 4EYIB 2KHJA 2LKVA 1BBWA 2Q8TA 1N8RC 4LFBL 2B2TC 2R8GA 4PNYA 2VUMH 5I6WA 1RK6A 1T5XD 3S2DB 1NMFA 4HJ9A 1EYZA 2VUMG 3E3XA 2GVBA 1PHJA 4J9KA 2E75C 1I50B 4GKKQ 3ND8A 4PZ7A 2WE6A 1H9SB 2L11A 1HFNA 3P1HA 4C3IG 2SOBA 4YY3Q 5KG1A 4LF4L 4BBSB 5K2MA 1E2WA 2KHIA 3QG1A 3V4ZA 2L9HA 4C3IH 4F4YA 4LFBH 5D1OA 5EQ0A 5JQWA 1K83B 5J3BA 5KG0A 1DOLA 1GUNA 2K4KA 4KY6A 4A3EB 4FM9A 2WV6D 2K01A 5ELCA 2R7MA 4RUAA 4Q0YA 3TZUA 1KDAA 2NYZD 3MZ5A 4X65Q 4WORA 4OO1I 1CQFA 4DR5L 1YVCA 1C30A 4A76A 1U5KA 2QDBA 2EY2A 4DL5A 3QJYA 4ME5A 5I4DA 1BO0A 3KF8B 5KFFA 2PQEA 3MAQA 3E5NA 2DN8A 1VQPA 1KC7A 4UP8A 2XSCA 5KFZA 3H09A 1LO5D 1ZKOA 5M3FG 2MCTA 4RKLA 3OHBA 1HZBA 4AQYL 4UDUC 4B3SL 1I50H 4RAUC 2EQSA 3HOYB 3S24A 3TDQA 1YIJA 2EYHA 4J9MA 4B3MH 5KFIA 5KT6A 1HHVA 1STBA 3E0JA 4AQYQ 4BBSH 4GN5A 3GQCA 1A2TA 1SR3A 2A19A 3KTMA 3RLNA 1EQTA 1VQFA 2K5QA 2VQEH 2EY5A 4YAKB 2R92A 4DNTB 4OONA 1GUOA 3O13A 4XT3B 1GSOA 4Q44A 4CDCC 3D0FA 1HNWL 1YJ9A 3RV3A 4LMQD 5KFYA 3OIQA 4DV7L 2PNRC 4FBUA 3Q24A 2NZ1D 2Y0SB 4EGQA 3IFTA 3JAML 4DR5Q 4A3LG 2KVMA 1VQCA 2GPWA 5EWGA 2K5HA 3PGZA 4ZRZA 5KYLA 1TWFB 2R85A 1R9TH 4QUCA 1Q82C 1I4XA 4A3IG 2F0SA 3VR2A 4V0BA 4G57A 1UE5A 2Q8IB 3BQ1A 1SMXA 1V43A 3MR3A 4JI3H 2EIFA 2A5HA 4MA0A 2XWJB 2IP4A 1ICWA 5BR8Q 4RB1A 2HHHL 2MQHA 4WBNF 1NBWA 3HOWB 4BBRH 1SEIA 2ASLA 4UCSA 5LXTF 2K28A 1ZHQA 1I4HA 1NE3A 4R4QA 2O2LD 2DNEA 2YU9H 3E9IA 5LP6F 5A2QE 4JPBW 3UDFA 2M2LA 5C4JH 2BH8A 2UXDH 2EDGA 3D4RA 3DWPA 1JICA 5L1JA 2Z6KC 1E2VA 4JI3L 3BYTB 1ZQ7A 4CC6A 5KFBA 1XNQH 4RAYA 4F87A 5EKIA 3V6JA 5KG4A 4YCWA 1F2LA 5BN5A 3J7A5 2B63B 4NKLA 3N8DA 2JA8B 5KFWA 4O2BF 5CYUA 1QB5D 1JKJB 1S97A 2JA6A 2CH4W 1EIYB 3IKJA 2OCEA 4O4LF 5GAGC 1LTAD 2A6EC 4QB4A 3BA8A 4LFBQ 1HZAA 4ZI7F 3AEVA 3QB3A 4IPGA 4GOPB 1L0YB 2HD3A 1HTLD 1KJQA 4B9WA 3L3OC 4N8FA 3EROA 2XIGA 4JI2H 5JEAH 2E2HA 2HVRA 3GTKA 1S5ED 3PUXA 4GNXA 5CR3A 3ERSX 3I4LA 5HY6A 2A6HD 3TEHB 1UUPA 4A3JB 1XTCD 1EHIA 3MTSA 5C0XI 4Z9CB 1TVXA 4JV2A 2ATWA 2WACA 3QR8A 5D3IB 1M1KC 2KBNA 3RBDA 4O3OA 2YRWA 3NBHB 1DJRD 2AU0A 2MUYA 1AZPA 4R4OA 1M6VA 3RBEA 2OH2A 4YWLA 2QILA 2JA8H 3VDYA 5J1ZA 3W2DA 4NMZA 4LNQA 3K8AA 3RB6A 1AUXA 4C1NK 4JI5H 4LAAA 2VPQA 1I4QA 1B3QA 4JI8Q 4DR6L 5KFHA 2B3GA 4IUPA 4TQUS 3TSSA 2CQOA 2F0TA 5CGKA 4B3ML 2FMAA 4DLKA 5IT9W 4ECUA 1YJWA 4DR7L 2VR1A 1LT5D 5A2QL 5LYJF 3Q8PB 3STBC 1ESFA 1B7YB 2VUMB 3QIAA 4OX9H 4YHHL 5E4XA 4A3JG 1L1OB 4G7HC 5I9OA 4DR4Q 2F0HA 4F88A 3S15B 4DV7Q 2W6QA 3GD7A 3NQIA 4X64L 3HOXB 2K5DA 4BS9A 2OEOA 1YHAA 5M3MB 1HNWQ 1Q81C 3I73A 4X66L 2QF7A 3TP6A 3T5LA 3F1ZA 4CJ2C 4L5QA 1VCIA 2O5JC 2PBZA 4A3EH 3Q23A 3MWMA 3EIVA 2I0QA 4JI0H 2LY7A 2OF1A 4G3IA 3S2HH 5CA0F 1D5MC 1BGWA 2FJ2A 2E2IB 1CI3M 4O2AF 2UUAQ 3G6VA 4MV8A 4I4TF 4R8IA 1EL0A 3KLRA 3D3RA 1EOTA 1SRUA 4YR0A 4N9TA 4LH7A 1XX8A 1ULZA 2J0TD 3M9OB 4ED8A 2ZTDA 4EQNA 3E9HA 1IKMA 1M4VA 1E4EB 4LFCL 2Q2HA 3KALA 4F7XA 2VB3X 4DV3Q 4EEQA 2DY8A 3ER0A 3RAQA 1SROA 1I94H 4X65L 2NUAB 2B63H 1WD0A 5HV6A 1D2BA 4O0AA 4TV8F 3NK9A 4ZHQF 5M5XH 1H9MA 3GTJH 4R8UA 4LSXA 1EUCB 4J9NA 1HFGA 2K5WA 3H91A 1UWVA 5KFRA 5M5WB 1UE6A 1H9SA 2F0EA 3HKZG 2UUCH 4G7ZC 3K7AB 3DF7A 1TWGB 1OO9B 4IAJA 2FKLA 2SNSA 1TY2A 4A3MH 2N8NA 2TMPA 1VF5C 2HIXA 2VQEQ 4DR1Q 2R7ZH 4BWSC 1CQJB 5EOYA 5KFCA 3WO1A 2B8FA 3D8GA 3RB4A 3V6HA 4I7ZC 4DV0H 4PG3A 1HUNA 4Q45A 1XJVA 5EAYA 4LFCQ 1NTGA 1DONA 4R8UB 4KKTA 1LT6D 4DXGA 1STEA 4L63B 1EZ1A 2ZJTA 4RNOA 5D1PA 1NMGA 1SDFA 3A8JE 1GKHA 5AFWA 1RODA 3ERQA 3K5MA 3E5SA 1BOSA 3C0FB 3HB9A 4HJAA 4P2CB 3HOYH 1FJGL 2K7VA 3J81E 1B04A 5KFTA 1GUSA 1UC8A 2AQ3B 5D14A 3DEPA 1WTOA 5D65A 3IAYA 1A3VA 4ECVA 1D1KA 4KD4A 4DV6Q 1PTOH 3K0XA 1EY8A 3CC2A 4QQBX 2I80A 3TQ1A 2MFIA 1PZKD 4TV9F 2NU7B 2RGVA 4LF5H 2R61A 2PO4A 5ELBA 3I4NH 1MHWC 1E0BA 4IFDI 1R9TA 2YYAA 3R3OA 4DUZH 2EJFC 3OMCA 1O7LA 4A3KG 2PI2A 1VQ7A 5FO9B 2ZDQA 3GILA 4IRKA 4GKKH 4YWMA 2B39A 3I90A 4DV6H 1IXRA 1NSNS 1SMYC 2E2JB 1RJTA 1SNDA 3GV6A 3RB3A 2F0DA 3TZDA 5LMUQ 1VKZA 3HP3A 5F9LA 3K7AH 2NN6I 5KNCA 4RMFA 3EYYA 1Y8OB 4IUNA 5FO7B 4I65A 3L9AX 2XGPA 3A0JA 3BABA 2OT2A 3PSIA 1VQJA 3D6WA 3TP7A 1B33N 1D8LA 1JX4A 4DV5L 4DR2L 2EJMA 2MGSA 2IJ0A 5E7NA 2ES2A 5ELOA 2AUJD 1I3QH 1NNXA 1VQEA 5M5YH 1LACA 1PRTB 5CV7A 1S3OA 4O42A 3L2PA 4CGYB 1D5XC 5C1PA 1QZGA 1E2ZA 1Q12A 4ILWA 3DLLA 3HOZB 4C3JG 2D2CC 2NVXB 4M1UB 2N88A 2AQ1B 1N33Q 2JEGA 1JC7A 1D6EC 4WJ3M 2NB0A 3S14B 4BY7H 4DUZL 3I2ZA 4DV2L 1R4QB 3LWUA 1PDQA 3MVVA 2KENA 3OWEB 2HHHH 1CUKA 3I7FA 4QGUA 3A8IE 1QUQA 1ENAA 2M9VA 2PCFB 1PH4A 1KJ9A 2WIIB 4IPCA 3GTKB 2ZT9C 3GTLA 2R8JA 1IBML 1V8QA 4DKAC 3ETJA 3NENA 2ZTCA 4F4XA 5M5WH 5C4JB 1Z9FA 4HTHA 2ICEC 2UVWA 1U4LA 1MZBA 2YZMA 3BQ2A 5DLGA 3KF6A 5IYZF 5HGTA 4HAEA 4L5RC 3FEWX 1D7QA 1D1IA 1V1OA 5L1LA 4RCOA 4A3MB 1JWMD 2K75A 1E22A 4NLGA 2RVLA 3NWTA 3HOZG 2PNHA 3BG3A 1LTLA 4X64H 4I7HA 3W5OA 5DG8A 4YB8B 1YNJC 5DEHA 3VYTA 2DY7A 3PW0A 1PVOA 3PVXA 4FF3A 4DXFA 5FPRA 1F2MA 1RF2D 3S1MB 1DV2A 1AN8A 4HSPA 4RU9A 3HGBA 1N34L 3L7ZC 3NUCA 2XCLA 3TBIB 4KHVA 3GQBA 3HOXG 2A69D 2YU9A 4GC6A 4XQNA 2W9BB 2C00A 3ONAB 3Q6SA 1GO3E 4DV7H 3GTQH 3M4YA 3GIMA 2BDOA 1I4RA 1MBYA 1B6RA 1W6KA 2QKIC 3I8ZA 5KKNB 4HMJA 4OX9Q 4B08A 3GTMB 1JE5A 4PZ8A 3N6XA 1UC9A 1Y1VH 1L0WA 5KFSA 2VUGA 2UXBL 3W1BA 4QW9A 2NVYA 1FVIA 2J7ZA 4G7OC 3A8KE 1I94L 2R93G 3T5HA 4I55F 1XXGA 3P75A 4PMCA 4JI5Q 4IWXA 1BCPB 5DQGA 4AH6A 2KSWA 1SYGA 3WNZA 4EQOA 3GIQA 4IPHA 3N41B 4BY1B 4BA2I 2DLNA 2JA7H 3I72A 2K33A 2LMCB 2E2HH 3EA6A 3GIJA 1PTOB 3R2TA 2D9UA 2H5XA 4X3TA 1EZ6A 2IWHA 1E4EA 2IL8A 2ZXOA 4UHVA 3RJ0A 2Z4HA 3SGIA 3SE0A 4X62L 2SEBD 5I6YA 1KIXA 2UUBQ 1EZ8A 2D5DA 2OQKA 3S2DH 3RZDB 1AH9A 3GTOA 3BDLA 4CKCA 2IPKD 1SYBA 2RSNA 3RGXA 3GTJA 2B2WC 2UXBQ 4KHZA 1PH7A 1T94A 2HDMA 1AN7A 1QZHA 2R8IA 4MHEA 5KFUA 4QWBA 5C3EB 2PPBC 3R23A 2G5DA 1YNJD 1VQLA 1UAPA 3MR5A 4KTAA 4LSAA 4NP5A 4LFAH 1JE4A 3ORRA 2V5AA 3K0YA 1G51A 2WAQA 4X62H 5KT3A 5ELEA 3VR6A 2WFWA 4JOIA 1VQ6A 2J6SA 2HQLA 2JE6I 4WJ4A 5L1IA 2R7ZA 2PYKA 2TSSA 2LXKA 4ULLA 3CMAA 3CRLC 3KBGA 4DR6Q 2W9CB 4QY7A 3N43B 4LF4Q 2RHSB 3GTKH 4LF7L 4K5XA 4NXNQ 4A3EG 2R7ZB 3S17H 5CB4F 2M05A 4DNRB 3TIGA 3IRBA 1KJ8A 2FFKB 2F4VL 1CQVA 5IWAH 4CDFC 4JV1A 1U4RA 5KT4A 4RNMA 4DPGA 4MA5A 2WAQB 1O7ZA 2VPSA 5JH7F 3CKIB 4RNNA 3CPWA 5JJKA 5KX5F 1TS2A 5KFJA 2KCMA 2FPIB 2VUMA 1YZ6A 2W9AA 5IYBH 4LF9L 1KNAA 1OXVA 5IWAL 2F4VH 2IHFA 2I07B 3A56A 1HR0L 1JB7A 5CAEB 1HR0W 4YR3A 5H1SE 4P72A 1KRSA 1STNA 1TWHA 5DG9A 5LMNH 1WJJA 1S40A 2R6FA 5FLMG 1ZETA 1PYWD 2GA4B 1IW7D 5FKAC 2KEEA 3RZOB 2E2DC 5FLMH 2VQFQ 4J6HA 4JV0A 1MSHA 3CCJA 4JV5L 3K3PA 4CBVA 2A68C 2XGTA 1H9KA 2B2TA 5KYIA 1PTOD 2UUCQ 5LL6b 3T5JA 3KK7A 4YWKA 1LUZA 3GTOH 2Y0SG 4KHPQ 3M4OB 3I4MB 1NY4A 1PTOF 1S5DD 2YRXA 4XQJA 4NPSA 1WI5A 3ULJA 4ECWA 4B3TH 4ME6A 4H44C 4JV5H 2N78A 4J8QA 2KCTA 3RUZA 4DR2Q 3VYUA 5GAEC 3A7LA 4QUFA 1CKOA 5IYCH 4J9SA 3GTMA 4GC7A 1EFID 1F9RA 1TAEA 1BUVT 1Y1WH 4J9PA 3S17B 5EKLA 4TKOB 1KC8C 3X3MA 2JEAI 3HOYG 4A3FH 2JA6B 3QZ8A 3F8NA 3FDSA 4LF9H 4QJFA 1KQSA 2YZGA 5JEAG 2W8KA 2R92G 2VS1A 3AB9A 5KFMA 4DL6A 2CZGA 2NN6G 2RQXA 2UU9Q 3D31A 4HCSA 3PO2B 1KL9A 4JI6L 1RYRA 3VYSA 5IGFA 1E1TA 2PMZB 1YHBA 2BA0A 2F1MA 4JI4Q 1TA8A 4RA8A 3I4NG 2RCFA 3GIIA 2V4QA 4F4ZA 2R7DA 2PZTA 3I12A 4R9WA 1O7IA 5IE8A 2Q2IA 3NBIA 1FR3A 3U4ZA 2HCIA 1WVLA 4OWWB 4ZK9B 3HRZC 5FJ8H 3RUPA 3RZDH 2RHQB 1M0WA 2X0SA 3V4SA 2G9DA 2KOLA 3T16A 3KYHC 4FVMA 1XDNA 3OUUA 3BQ0A 2J6UA 5F2DA 1U9RA 1I6VC 5E4WC 3J81i 1S5BD 4A4IA 4YHHH 1SAPA 4MV4A 3CP0A 3KHGA 5K36H 1CKNB 2C2DA 3NTHA 5C0XG 3CF5A 3I4MG 3QZ7A 5LL6S 1ET6A 1EY4A 4QMGA 4EG0A 1PTOC 4LUZA 5EZYF 4WRDA 4A3JH 1Q7YC 5DQHA 4NXMQ 3GO5A 4IJHA 4UP7A 5G3LD 1Z47A 4GNXC 4GLAC 3IG0A 2AGPA 4AYBE 4LF6L 3CCSA 1EYGA 4H0LC 2XGQA 1J6QA 2UVRA 1BXTA 2K04A 1XPUA 1Q8KA 5FK9C 4PMWA 1QOHA 5G3LF 2ATLA 2V9WA 4KN7C 2P5ZX 3NTIA 1PYSB 2EPBA 4IN3A 4F8MA 1TQOA 4Y7NB 3RN5A 2JA7B 3GTMH 2LS01 1JDBB 2W7OA 2CQAA 1PH3A 1S72A 2K5VA 3D4DA 1EY0A 1LABA 1A2UA 3H20A 3AQQA 3T1HL 5KFLA 4M8AA 3MXGA 4FXGC 5JVH3 1AUVA 4PQXA 2G9HD 2SNMA 1STAA 1SSOA 3V2TA 3KAJA 3DM3A 3H3VI 5DGAA 2EXDA 1FGBD 3UDXA 1B6SA 3WWVA 1NR4A 1OXSC 2QYZA 1HA6A 1PRTF 3S1RB 3BA9A 5EPLA 5FPOA 1XMQH 2DZDA 3U9TA 5M3MG 3TREA 2B29A 1EWHA 1R4PB 2XNAC 3X3NA 4DV4Q 1MSGA 2B2VC 5KT7A 3EPGA 2HUGA 3N52A 5IGCA 3FVQA 4LK1C 4AIMA 1JQYD 4JK1C 4K2KA 2ZJQA 1GSAA 5C4HA 1JCKB 3PIOA 4LF6H 2RDIA 2ALZA 4YAJB 2VA3A 3EVQA 1DGSA 2F0NA 4KK7A 4DAYA 2W6ZA 5FD5A 2OTJA 1CM9A 3JRXA 1O75A 2F0JA 2XN9C 1WH2A 1FNWA 5KG6A 3JZIA 1ML0D 4LW1A 2R7LA 4OIJA 4U673 4CJ1B 3N42B 2YV5A 4JG2A 1HQRD 4NB3A 4JI3Q 3WOFA 1X56A 5LMNW 4XYMB 1M7JA 1D5ZC 2FLLA 1T9HA 2BE5D 1K1QA 2FPPB 1XMOH 5IIFA 4X6AH 2VW9A 2F3VA 5FO8B 1A9XA 5JJIA 1KEEA 4YHHQ 3NELA 1SJED 5IY0A 5HGQA 1EWIA 4IALA 4ZAIA 2RDHA 2R92H 2B8GA 1S10A 4LF5L 2CW0C 4ALPA 3I3CA 3TS0A 3K80C 2O03A 2SDFA 4DV1Q 3GTLH 1F77A 5CV9A 4JW0A 1K8MA 3SK5A 1EY5A 1KLUD 5JJZA 2QEXA 3HXLA 4DV5Q 1SNMA 3VMMA 2Z8LA 4DR3Q 2Q2UA 1ASZA 1ZEQX 1EUJA 2E2HB 2C2EA 3EQLC 4G4KA 4C2MH 1EY9A 2W6NA 3J7YW 1V51A 4GS3A 3KF6B 4O2DA 3T51B 2UUBL 1XPRA 1VQDA 1A0IA 5A2QW 3U9OA 1HCZA 3H15A 2VQDA 3UFXB 3TINA 1UE7A 4YJ3F 1KABA 3HS0C 3KBXA 1ILPA 3F2CA 4LFAL 1BQQT 4M9UA 1PFMA 2N3SA 3J80L 3PUZA 4XTCS 1XMOL 4DR2H 4HQ6A 4JV5Q 4X65H 1RTOA 4MZ9A 3VPCA 5C5JA 3HKZA 4IFDH 1OXXK 1UEBA 4JBKA 2MJ8A 1IBLQ 4JCVE 2C9OA 3KLSX 2FMCA 2HVSA 1QILA 3NP8A 4O3SA 4DAMA 4DV6L 2ZDGA 3R5HA 3IN5A 1IYVA 4YJ2F 2CCZA 1JT8A 1VQOA 1B50A 3BDOA 4BWGB 1WTRA 4QCLA 4ZLTF 3JSNA 2A69C 2IMWP 3M4OH 1WCMA 2JA5B 1L1OA 2HJWA 4IQZA 4ZYSA 4K6LA 3DM1A 2E5LQ 4U68A 1C7YA 1DIKA 2ZXPA 1PX2A 4E6IA 3MXUA 3RR5A 4EBDA 1CSQA 1IYUA 3UDGA 2F4VQ 4A3CH 5A35A 1N32H 3Q1KA 1HJPA 4FS2A 2UXCH 1QNUA 2NU9B 1KDBA 3ITPA 5FOBB 4IOCA 3BG5A 1TWFH 1LTSD 2ZJRA 2Z0SA 3GV3A 3TP8A 4LF6Q 4XQQA 4YCVA 4JC0A 4Y8VB 3UQ8A 3NGDA 1DM0B 2RKSA 1ONLA 2F0QA 3HOZH 2RBMA 4UCRA 4OGQC 4TSSA 1RYSA 3A5ZB 3BVMA 4BY7B 4UCOA 3PUWA 2AWOA 2L15A 1U0LA 2BH2A 1N36L 5IT9c 4X62Q 4EGJA 3U4VA 4RH6A 4JVZA
chains in the Genus database with same CATH topology
1SLJA 4BXXH 1GVPA 1A8VA 2F52A 4IPCA 4HJ7A 1I5FA 4IPDA 1N36Q 1G6PA 3ULLA 1IBML 3Q8DA 1HNXQ 4FDBA 4XIGS 4DKAC 1XMOQ 1VQ8A 3NENA 2ZTCA 3OW2A 1YBYA 4DK6C 3HKSA 1OTCA 1N32L 1AE3A 5M5WH 5K36G 1Z9FA 3BU2A 4P71A 2C35B 2JA5G 4OX9L 3KF6A 1V9PA 2WAQE 4L5RC 2OTLA 3K81C 1PH5A 3M3YH 3CXCA 3I4MH 3M9BA 1YNXA 1Y1VG 2PQAA 1D7QA 1Q1EA 4JI6Q 5C44H 2K75A 1E22A 3CQZH 2YYZA 4DR7Q 3HOZG 2OQ0A 2PNHA 5IP9G 1LTLA 2QA4A 4GKJQ 5C44G 3W5OA 2AMCB 5GADC 3CCRA 1SE8A 4HIMA 2R6GA 1PVOA 3CD6A 4GNXB 4JI0Q 2JA7G 4C3HH 1PH6A 1XNRL 4DR3L 1VQKA 5FJ8G 1XNRQ 4JI0L 3AFQA 1VQHA 1N34L 3L7ZC 2YTVA 2E8GA 4J15A 3HOXG 3PF4A 5IYDG 3M85A 4GLXA 3T1HQ 2IHEA 3A5UA 3PCOB 4GKJL 1GO3E 3GTQH 1MJCA 2E5LL 4A93H 1YI2A 1N34Q 1XMQQ 2MO1A 4YY3L 4A3CG 3CW2C 3PUVA 4JBMA 3JAMc 2NVYH 1OXUA 4OX9Q 2I5HA 2A8VA 2E2IH 1JE5A 1VQ5A 4PZ8A 4A75A 1LM0A 1HNZQ 1JMCA 1Y1VH 1L0WA 2UXBL 3W1BA 1PFSA 1V1QA 1N9WA 2YTYA 1FVIA 3S15H 2HIVA 3CAMA 1KXLA 5DLQE 1I94L 4JI3Q 1MKHA 1IBKL 2R93G 2E2JH 2Y0SE 1J5EQ 4JI5Q 4JBJA 3UE0A 2IY5B 4BA1I 3U50C 3FHWA 2GVAA 1XNQQ 4AH6A 4DR6L 2R7ZG 4LF8Q 1IL2A 4LUVA 1FGUA 2MO0A 4IPHA 5C4XH 1WOCA 3I56A 3G4SA 2V1CC 4JI7Q 4BA2I 3E0EA 3HOXH 2JA7H 4H02A 3U58A 4OWXB 1E24A 3JC66 3S1RH 4BY7G 2UXCL 4R4IA 4OWTB 3W1GA 2E2HH 2JA6G 1K8GA 1RIPA 2H5XA 4JI4L 3M4PA 3PO3G 2KHJA 4MNOA 1BBWA 3SGIA 4X62L 1W2BA 3PO3H 1N8RC 5FLXc 1KIXA 2UUBQ 4IJLA 2VUMH 4LFBL 2OQKA 3S2DH 1AH9A 2UU9L 1NMFA 4HJ9A 1L2FA 3I55A 1E1OA 2VUMG 2GVBA 1PHJA 3EBEA 4KHZA 1PH7A 2IX0A 2UXBQ 3LGJA 1QZHA 4GKKQ 3J80c 4DNIA 3RLFA 1Y1WG 1SN8A 2JA9A 4PZ7A 1VQLA 4GLVB 1HZCA 5IYBG 4OXPA 3GTPH 4Y7NH 2VQEL 4YY3Q 5M3MH 4LF4L 2KHIA 4P74A 1GM5A 1G51A 4C3IH 2ZM6Q 2HHHQ 4L5SA 4A3DG 2WFWA 4JOIA 1VQ6A 2JE6I 2HQLA 4WJ4A 3M7NA 3CMAA 4DR6Q 2LXKA 5J3BA 2K4KA 4A3DH 1YHQA 4QY7A 4LF4Q 2RHSB 3GTKH 1GD7A 4LF7L 4NXNQ 4A3EG 3S17H 1QVCA 5GAHC 2JJQA 4RG1A 4KHPL 4OO1G 5C0XJ 3IRBA 3STBD 4X65Q 2F4VL 3HOVG 4OO1I 3KFUA 4P73A 1YVCA 4DR5L 2AKWB 1U5KA 2VL6A 3KOJA 4DPGA 4A76A 1VQNA 2ZTEA 4LWCA 3HOVH 3KF8B 1G291 2WB1E 1VQPA 4A93G 4NXML 4UP8A 3CPWA 5JJKA 1IBLL 2KCMA 5M3FG 1YZ6A 2I5LX 4K0KQ 1HZBA 5IYBH 4AQYL 4LF9L 4B3SL 2RCNA 1I50H 2EQSA 1OXVA 5IWAL 1JJGA 3S24A 2IHFA 1MJEA 1HR0L 1YIJA 2F3IA 1JB7A 2Z6KA 4JI7L 1HR0W 1HH2P 5IWAQ 4EQ5A 5H1SE 4P72A 1KRSA 1PH8A 1EIFA 4UPAA 1KRTA 2VQFL 4AQYQ 4BBSH 1W3SA 4GN5A 3RN2A 1SR3A 1WJJA 2A19A 4HIDA 4A3MG 3RLNA 5FLMG 4A3FG 1VQFA 1X9NA 1S40A 2K50A 4R1JA 3CMEA 4GN3B 4OONA 1H95A 1TWHH 5FLMH 2VQFQ 1TWCH 3D0FA 1HNWL 1YJ9A 1YJNA 3CCJA 2LSSA 4DUZQ 4JV5L 4DV7L 2XGTA 1PV4A 2UUCQ 1N33L 4DR5Q 1VQBA 4A3LG 4YWKA 1VQCA 1LUZA 4LFAQ 1C0AA 2K5HA 3GTOH 3PGZA 2MNAA 2Y0SG 1PYBA 2R7FA 3MEFA 1EOVA 4KHPQ 1R9TH 1Q82C 5C3EG 1NY4A 3UDIA 4NXNL 4A3IG 3PF5A 4NPSA 4LF7Q 1WI5A 5LMNQ 1UE5A 3ULJA 4UY8C 1SMXA 4BXXG 2PI2E 4IO9A 1V43A 2N78A 4POFA 2EIFA 3CCLA 4QL5A 2KCTA 4R4TA 5BR8Q 4DR2Q 3H3VH 2HHHL 2MQHA 5GAEC 1NBWA 2N49A 4BBRH 1CKOA 5IYCH 5M3FH 1VS0A 5JEAJ 1Y14B 1Y1WH 4JYAQ 1NE3A 2CWAA 4R4QA 1KC8C 4A3BH 2YU9H 1QUQB 3E9IA 2JEAI 3KDFB 4A3FH 3HOYG 4IFDG 3G6EA 4QJFA 2CWPA 3UDFA 1VQMA 1KQSA 5JEAG 5C4JH 2BH8A 2NVQH 2VS1A 1TWGH 2R92G 2WB1G 5LMUL 2NN6G 2UU9Q 2Z6KC 3D31A 2RF4A 4JI3L 4HJ5A 3S14H 2ZM6L 3RZOH 1BVSA 1KD1C 1KL9A 4JI6L 2LXJA 4C3JH 4B3RL 2NVTH 1E1TA 5IP7H 3BJUA 1YHBA 2BA0A 4JI4Q 4YCWA 3I4NG 3J7A5 5IP7G 1CKNA 3CCMA 4GKKL 2K14A 2R7DA 3CPFA 4JI2L 4A3LH 2NZHA 3GDEA 1O7IA 2UUCL 3OTOQ 5IE8A 1EIYB 3F2BA 3B6YA 2Q2IA 2OCEA 5GAGC 3U4ZA 1EQQA 4POGA 4LFBQ 4OWWB 1HZAA 1X54A 5FJ8H 3RZDH 2RHQB 1XNQL 3AEVA 3KYHC 1FL0A 4IPGA 2IT1A 3J81i 4X66Q 2AHOB 1K3RA 4A4IA 4GOPB 2WP8J 4DV2Q 2JQOA 3CP0A 1I94Q 3K7UC 1CKNB 1HR0Q 1OXTA 3PUXA 4GNXA 3CC4A 2OWOA 3ERSX 4YCUA 4B3SQ 5HY6A 5C0XG 2K5NA 1BBUA 4GN4B 3CF5A 3I4MG 2WAQG 4JBWA 3TEHB 3ULPA 5C0XI 4LUZA 1Q7YC 4A3JH 2JA5H 4JI5L 4B3RQ 2ATWA 1J5EL 4NXMQ 3GO5A 4IJHA 4UP7A 4GNXC 1Z47A 2KBNA 4GLAC 1M1KC 1IBKQ 4AYBE 4LF6L 3CCSA 1EYGA 2UXDL 2ZJPA 4X64Q 3NBHB 2PMZE 4DV4L 4P75A 4GOPA 1J6QA 4R4OA 2NVXH 1XPUA 1Q8KA 1K83H 3ZJYC 3GTGH 4YWLA 4PMWA 1P16A 3RLOA 5AJ3Q 1Q1BA 1X6OA 2JA8H 3HOUG 3ICEA 3VDYA 3S1MH 2Q2TA 1VQAA 3G71A 1PYSB 1VQ9A 4LNQA 3K8AA 3RN5A 3BZKA 4R4CA 3HOUH 3GTMH 3TS2A 2JEBI 3HFZB 1PH3A 1S72A 2K5VA 4JI8Q 2AWNA 2K52A 4EX5A 3JAMi 2B3GA 4TQUS 3AQQA 1WCMG 2CQOA 4DV1L 4HJ8A 3T1HL 4UP9A 4B3ML 4JI8L 4HIKA 1YJWA 4DR7L 3T1YL 3STBC 3DM3A 3H3VI 1B7YB 2EXDA 3UDXA 3WWVA 1OXSC 4YHHL 1LYLA 4MTNA 4A3JG 2A1AA 1L1OB 1B70B 5AJ3L 1A62A 4DR4Q 3KJOA 1L1OC 5M3MG 4DV3L 4DV7Q 3TREA 2B29A 3GD7A 4X64L 3J81j 4DV4Q 1YHAA 1HNWQ 1Q81C 4X66L 4AIMA 5GROA 1SFOH 3F1ZA 1KAWA 2ZJQA 3CCVA 3OYYA 3S1QH 4L5QA 1VCIA 4A3EH 2HT1A 4Y52H 3EIVA 3PIOA 2I0QA 2UUAL 1DGSA 3EN2A 4ME3A 1CKMA 1X3FA 3S2HH 1RL2A 3OTOL 1M90C 2JA8G 2OTJA 1HNXL 2D0OA 1IYJB 1E7ZA 3CCQA 4LF9Q 2UUAQ 4DAYB 5C3EH 2YTXA 1SRUA 1PA6A 3PO2G 4LW1A 5IYDH 2ZTDA 3CCEA 3CC7A 3E9HA 1BKBA 3PO2H 2YV5A 4LFCL 4JG2A 2Q2HA 4NB3A 3A74A 1PH1A 1X56A 4KI0A 1JJCB 2XTIA 5LMNW 4DV3Q 1PH9A 4IOAA 1T9HA 3ER0A 1SROA 1X3EA 4DR4L 3PV0A 4JI2Q 1EQRA 4X6AH 2ID0A 4X65L 2VW9A 1HNZL 1P8LA 1PH2A 2JK8A 2B63H 5JJIA 4O0AA 1YEZA 5M5XH 3NELA 3AFPA 4YHHQ 2D62A 3GTJH 2R93H 5IY0A 3PUYA 5HGQA 1EWIA 1UWVA 4LUOA 1UE6A 2R92H 3HKZG 4DUYL 4LF5L 4ALPA 3HKZE 1ASYA 3TS0A 3K80C 3J81c 1VQGA 4DV1Q 1EFWA 5ELNA 1WFQA 3GTLH 4LF5Q 3KLWA 2QEXA 5LMNL 4A3MH 4DV5Q 1Q86C 2N8NA 4DR1Q 2HIXA 4PZ6A 2VQEQ 4GOPC 1VQ4A 2R7ZH 3RNUA 4DR3Q 2Q2UA 1ASZA 1E3PA 5C4XG 1EUJA 4JOIC 1AE2A 2BA1A 4C2MH 4PG3A 2NZOA 1X65A 2PQAB 3I4OA 5BR8L 4A3IH 1JJ2A 1XJVA 4GS3A 1XTDA 3KF6B 4O2DA 5EAYA 4LFCQ 2UUBL 1XPRA 2UXDQ 1VQDA 1NTGA 1A0IA 1X55A 3H15A 3H0GG 1UE7A 5GQOA 3MXNB 1NMGA 1GKHA 1IZ6A 2UXCQ 4B3TL 3F8TA 3F2CA 4HJAA 1NJIC 4AYBG 4LFAL 4JI1L 4A3BG 2N3SA 3HOYH 4DV0L 1FJGL 1N32Q 3PUZA 4XTCS 1XMOL 4BBSG 4DV0Q 4BBRG 1FJGQ 4JI1Q 4JV5Q 1IBMQ 4B3TQ 3G48A 4MZ9A 4K0KL 1UE1A 4DV6Q 1OXXK 1UEBA 4JBKA 3K0XA 4A3GH 3J7ZC 1IBLQ 4JCVE 2ASBA 3CC2A 1VQIA 3FKIH 2IX1A 1TWAH 4QQBX 4DAMA 4DV6L 2MFIA 3HOWH 3FKIG 2GN5A 2CCZA 2VY3A 3I4NH 1VQOA 1JT8A 1MIUA 3HOWG 2ALYB 3J80i 1KHIA 2D0PA 4IFDI 1X3GA 1QVFA 3TRZA 4A3KG 2PI2A 1VQ7A 5JJLA 1K73C 3M4OH 1A63A 2DUDA 4YWMA 1L1OA 3H0GH 4DR1L 1XMQL 2VNUD 3T1YQ 1IXRA 2VZAA 1CSPA 3F2DA 3M4QA 1QVGA 1WCMH 1C7YA 2E5LQ 3RR5A 5LMUQ 1CSQA 1C9OA 2FXQA 5IYCG 4B3MQ 3K7AH 2NN6I 4QIWE 1XPOA 4RMFA 3S16H 4DUYQ 3FP9A 4APVA 3UDGA 2F4VQ 4A3CH 1HJPA 3TQYA 2B63G 3A0JA 4DK3C 4JYAL 3PSIA 1VQJA 4IOCA 1D8LA 1HZ9A 1TXYA 1WYDA 4L5TA 4DV5L 4KLKA 3KDFA 1TWFH 4DR2L 1YITA 4IFDJ 1B8AA 3AYHB 2CFMA 5E7NA 2ZJRA 2Z0SA 2ES2A 4LF6Q 3L0OA 4A3GG 5ELOA 1I3QH 1VQEA 1I6HH 5M5YH 1S3OA 4YCVA 4JC0A 3L2PA 1K8AC 3CCUA 3KJPA 1QZGA 1Q12A 3DLLA 4A3KH 1K9MC 3S1NH 3HOZH 2DGYA 5IP9H 1Q46A 4BY1G 3PIPA 1N33Q 3A5ZB 4WJ3M 3PUWA 2AWOA 4BY1H 2L15A 4BY7H 4DUZL 1K0RA 3I2ZA 1U0LA 4DV2L 2BH2A 1N36L 2JA6H 5IT9c 2QGQA 2KENA 4X62Q 3BZCA 4LF8L 1CUKA 3I7FA 4TVAB 2I5MX 4QGUA 4HIOA 1QUQA 3U4VA 3NEMA 2CKZB 1PH4A 3UE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SLJ A;  4BXX H;  1GVP A;  1A8V A;  2F52 A;  4IPC A;  4HJ7 A;  1I5F A;  4IPD A;  1N36 Q;  1G6P A;  3ULL A;  1IBM L;  3Q8D A;  1HNX Q;  4FDB A;  4XIG S;  4DKA C;  1XMO Q;  1VQ8 A;  3NEN A;  2ZTC A;  3OW2 A;  1YBY A;  4DK6 C;  3HKS A;  1OTC A;  1N32 L;  1AE3 A;  5M5W H;  5K36 G;  1Z9F A;  3BU2 A;  4P71 A;  2C35 B;  2JA5 G;  4OX9 L;  3KF6 A;  1V9P A;  2WAQ E;  4L5R C;  2OTL A;  3K81 C;  1PH5 A;  3M3Y H;  3CXC A;  3I4M H;  3M9B A;  1YNX A;  1Y1V G;  2PQA A;  1D7Q A;  1Q1E A;  4JI6 Q;  5C44 H;  2K75 A;  1E22 A;  3CQZ H;  2YYZ A;  4DR7 Q;  3HOZ G;  2OQ0 A;  2PNH A;  5IP9 G;  1LTL A;  2QA4 A;  4GKJ Q;  5C44 G;  3W5O A;  2AMC B;  5GAD C;  3CCR A;  1SE8 A;  4HIM A;  2R6G A;  1PVO A;  3CD6 A;  4GNX B;  4JI0 Q;  2JA7 G;  4C3H H;  1PH6 A;  1XNR L;  4DR3 L;  1VQK A;  5FJ8 G;  1XNR Q;  4JI0 L;  3AFQ A;  1VQH A;  1N34 L;  3L7Z C;  2YTV A;  2E8G A;  4J15 A;  3HOX G;  3PF4 A;  5IYD G;  3M85 A;  4GLX A;  3T1H Q;  2IHE A;  3A5U A;  3PCO B;  4GKJ L;  1GO3 E;  3GTQ H;  1MJC A;  2E5L L;  4A93 H;  1YI2 A;  1N34 Q;  1XMQ Q;  2MO1 A;  4YY3 L;  4A3C G;  3CW2 C;  3PUV A;  4JBM A;  3JAM c;  2NVY H;  1OXU A;  4OX9 Q;  2I5H A;  2A8V A;  2E2I H;  1JE5 A;  1VQ5 A;  4PZ8 A;  4A75 A;  1LM0 A;  1HNZ Q;  1JMC A;  1Y1V H;  1L0W A;  2UXB L;  3W1B A;  1PFS A;  1V1Q A;  1N9W A;  2YTY A;  1FVI A;  3S15 H;  2HIV A;  3CAM A;  1KXL A;  5DLQ E;  1I94 L;  4JI3 Q;  1MKH A;  1IBK L;  2R93 G;  2E2J H;  2Y0S E;  1J5E Q;  4JI5 Q;  4JBJ A;  3UE0 A;  2IY5 B;  4BA1 I;  3U50 C;  3FHW A;  2GVA A;  1XNQ Q;  4AH6 A;  4DR6 L;  2R7Z G;  4LF8 Q;  1IL2 A;  4LUV A;  1FGU A;  2MO0 A;  4IPH A;  5C4X H;  1WOC A;  3I56 A;  3G4S A;  2V1C C;  4JI7 Q;  4BA2 I;  3E0E A;  3HOX H;  2JA7 H;  4H02 A;  3U58 A;  4OWX B;  1E24 A;  3JC6 6;  3S1R H;  4BY7 G;  2UXC L;  4R4I A;  4OWT B;  3W1G A;  2E2H H;  2JA6 G;  1K8G A;  1RIP A;  2H5X A;  4JI4 L;  3M4P A;  3PO3 G;  2KHJ A;  4MNO A;  1BBW A;  3SGI A;  4X62 L;  1W2B A;  3PO3 H;  1N8R C;  5FLX c;  1KIX A;  2UUB Q;  4IJL A;  2VUM H;  4LFB L;  2OQK A;  3S2D H;  1AH9 A;  2UU9 L;  1NMF A;  4HJ9 A;  1L2F A;  3I55 A;  1E1O A;  2VUM G;  2GVB A;  1PHJ A;  3EBE A;  4KHZ A;  1PH7 A;  2IX0 A;  2UXB Q;  3LGJ A;  1QZH A;  4GKK Q;  3J80 c;  4DNI A;  3RLF A;  1Y1W G;  1SN8 A;  2JA9 A;  4PZ7 A;  1VQL A;  4GLV B;  1HZC A;  5IYB G;  4OXP A;  3GTP H;  4Y7N H;  2VQE L;  4YY3 Q;  5M3M H;  4LF4 L;  2KHI A;  4P74 A;  1GM5 A;  1G51 A;  4C3I H;  2ZM6 Q;  2HHH Q;  4L5S A;  4A3D G;  2WFW A;  4JOI A;  1VQ6 A;  2JE6 I;  2HQL A;  4WJ4 A;  3M7N A;  3CMA A;  4DR6 Q;  2LXK A;  5J3B A;  2K4K A;  4A3D H;  1YHQ A;  4QY7 A;  4LF4 Q;  2RHS B;  3GTK H;  1GD7 A;  4LF7 L;  4NXN Q;  4A3E G;  3S17 H;  1QVC A;  5GAH C;  2JJQ A;  4RG1 A;  4KHP L;  4OO1 G;  5C0X J;  3IRB A;  3STB D;  4X65 Q;  2F4V L;  3HOV G;  4OO1 I;  3KFU A;  4P73 A;  1YVC A;  4DR5 L;  2AKW B;  1U5K A;  2VL6 A;  3KOJ A;  4DPG A;  4A76 A;  1VQN A;  2ZTE A;  4LWC A;  3HOV H;  3KF8 B;  1G29 1;  2WB1 E;  1VQP A;  4A93 G;  4NXM L;  4UP8 A;  3CPW A;  5JJK A;  1IBL L;  2KCM A;  5M3F G;  1YZ6 A;  2I5L X;  4K0K Q;  1HZB A;  5IYB H;  4AQY L;  4LF9 L;  4B3S L;  2RCN A;  1I50 H;  2EQS A;  1OXV A;  5IWA L;  1JJG A;  3S24 A;  2IHF A;  1MJE A;  1HR0 L;  1YIJ A;  2F3I A;  1JB7 A;  2Z6K A;  4JI7 L;  1HR0 W;  1HH2 P;  5IWA Q;  4EQ5 A;  5H1S E;  4P72 A;  1KRS A;  1PH8 A;  1EIF A;  4UPA A;  1KRT A;  2VQF L;  4AQY Q;  4BBS H;  1W3S A;  4GN5 A;  3RN2 A;  1SR3 A;  1WJJ A;  2A19 A;  4HID A;  4A3M G;  3RLN A;  5FLM G;  4A3F G;  1VQF A;  1X9N A;  1S40 A;  2K50 A;  4R1J A;  3CME A;  4GN3 B;  4OON A;  1H95 A;  1TWH H;  5FLM H;  2VQF Q;  1TWC H;  3D0F A;  1HNW L;  1YJ9 A;  1YJN A;  3CCJ A;  2LSS A;  4DUZ Q;  4JV5 L;  4DV7 L;  2XGT A;  1PV4 A;  2UUC Q;  1N33 L;  4DR5 Q;  1VQB A;  4A3L G;  4YWK A;  1VQC A;  1LUZ A;  4LFA Q;  1C0A A;  2K5H A;  3GTO H;  3PGZ A;  2MNA A;  2Y0S G;  1PYB A;  2R7F A;  3MEF A;  1EOV A;  4KHP Q;  1R9T H;  1Q82 C;  5C3E G;  1NY4 A;  3UDI A;  4NXN L;  4A3I G;  3PF5 A;  4NPS A;  4LF7 Q;  1WI5 A;  5LMN Q;  1UE5 A;  3ULJ A;  4UY8 C;  1SMX A;  4BXX G;  2PI2 E;  4IO9 A;  1V43 A;  2N78 A;  4POF A;  2EIF A;  3CCL A;  4QL5 A;  2KCT A;  4R4T A;  5BR8 Q;  4DR2 Q;  3H3V H;  2HHH L;  2MQH A;  5GAE C;  1NBW A;  2N49 A;  4BBR H;  1CKO A;  5IYC H;  5M3F H;  1VS0 A;  5JEA J;  1Y14 B;  1Y1W H;  4JYA Q;  1NE3 A;  2CWA A;  4R4Q A;  1KC8 C;  4A3B H;  2YU9 H;  1QUQ B;  3E9I A;  2JEA I;  3KDF B;  4A3F H;  3HOY G;  4IFD G;  3G6E A;  4QJF A;  2CWP A;  3UDF A;  1VQM A;  1KQS A;  5JEA G;  5C4J H;  2BH8 A;  2NVQ H;  2VS1 A;  1TWG H;  2R92 G;  2WB1 G;  5LMU L;  2NN6 G;  2UU9 Q;  2Z6K C;  3D31 A;  2RF4 A;  4JI3 L;  4HJ5 A;  3S14 H;  2ZM6 L;  3RZO H;  1BVS A;  1KD1 C;  1KL9 A;  4JI6 L;  2LXJ A;  4C3J H;  4B3R L;  2NVT H;  1E1T A;  5IP7 H;  3BJU A;  1YHB A;  2BA0 A;  4JI4 Q;  4YCW A;  3I4N G;  3J7A 5;  5IP7 G;  1CKN A;  3CCM A;  4GKK L;  2K14 A;  2R7D A;  3CPF A;  4JI2 L;  4A3L H;  2NZH A;  3GDE A;  1O7I A;  2UUC L;  3OTO Q;  5IE8 A;  1EIY B;  3F2B A;  3B6Y A;  2Q2I A;  2OCE A;  5GAG C;  3U4Z A;  1EQQ A;  4POG A;  4LFB Q;  4OWW B;  1HZA A;  1X54 A;  5FJ8 H;  3RZD H;  2RHQ B;  1XNQ L;  3AEV A;  3KYH C;  1FL0 A;  4IPG A;  2IT1 A;  3J81 i;  4X66 Q;  2AHO B;  1K3R A;  4A4I A;  4GOP B;  2WP8 J;  4DV2 Q;  2JQO A;  3CP0 A;  1I94 Q;  3K7U C;  1CKN B;  1HR0 Q;  1OXT A;  3PUX A;  4GNX A;  3CC4 A;  2OWO A;  3ERS X;  4YCU A;  4B3S Q;  5HY6 A;  5C0X G;  2K5N A;  1BBU A;  4GN4 B;  3CF5 A;  3I4M G;  2WAQ G;  4JBW A;  3TEH B;  3ULP A;  5C0X I;  4LUZ A;  1Q7Y C;  4A3J H;  2JA5 H;  4JI5 L;  4B3R Q;  2ATW A;  1J5E L;  4NXM Q;  3GO5 A;  4IJH A;  4UP7 A;  4GNX C;  1Z47 A;  2KBN A;  4GLA C;  1M1K C;  1IBK Q;  4AYB E;  4LF6 L;  3CCS A;  1EYG A;  2UXD L;  2ZJP A;  4X64 Q;  3NBH B;  2PMZ E;  4DV4 L;  4P75 A;  4GOP A;  1J6Q A;  4R4O A;  2NVX H;  1XPU A;  1Q8K A;  1K83 H;  3ZJY C;  3GTG H;  4YWL A;  4PMW A;  1P16 A;  3RLO A;  5AJ3 Q;  1Q1B A;  1X6O A;  2JA8 H;  3HOU G;  3ICE A;  3VDY A;  3S1M H;  2Q2T A;  1VQA A;  3G71 A;  1PYS B;  1VQ9 A;  4LNQ A;  3K8A A;  3RN5 A;  3BZK A;  4R4C A;  3HOU H;  3GTM H;  3TS2 A;  2JEB I;  3HFZ B;  1PH3 A;  1S72 A;  2K5V A;  4JI8 Q;  2AWN A;  2K52 A;  4EX5 A;  3JAM i;  2B3G A;  4TQU S;  3AQQ A;  1WCM G;  2CQO A;  4DV1 L;  4HJ8 A;  3T1H L;  4UP9 A;  4B3M L;  4JI8 L;  4HIK A;  1YJW A;  4DR7 L;  3T1Y L;  3STB C;  3DM3 A;  3H3V I;  1B7Y B;  2EXD A;  3UDX A;  3WWV A;  1OXS C;  4YHH L;  1LYL A;  4MTN A;  4A3J G;  2A1A A;  1L1O B;  1B70 B;  5AJ3 L;  1A62 A;  4DR4 Q;  3KJO A;  1L1O C;  5M3M G;  4DV3 L;  4DV7 Q;  3TRE A;  2B29 A;  3GD7 A;  4X64 L;  3J81 j;  4DV4 Q;  1YHA A;  1HNW Q;  1Q81 C;  4X66 L;  4AIM A;  5GRO A;  1SFO H;  3F1Z A;  1KAW A;  2ZJQ A;  3CCV A;  3OYY A;  3S1Q H;  4L5Q A;  1VCI A;  4A3E H;  2HT1 A;  4Y52 H;  3EIV A;  3PIO A;  2I0Q A;  2UUA L;  1DGS A;  3EN2 A;  4ME3 A;  1CKM A;  1X3F A;  3S2H H;  1RL2 A;  3OTO L;  1M90 C;  2JA8 G;  2OTJ A;  1HNX L;  2D0O A;  1IYJ B;  1E7Z A;  3CCQ A;  4LF9 Q;  2UUA Q;  4DAY B;  5C3E H;  2YTX A;  1SRU A;  1PA6 A;  3PO2 G;  4LW1 A;  5IYD H;  2ZTD A;  3CCE A;  3CC7 A;  3E9H A;  1BKB A;  3PO2 H;  2YV5 A;  4LFC L;  4JG2 A;  2Q2H A;  4NB3 A;  3A74 A;  1PH1 A;  1X56 A;  4KI0 A;  1JJC B;  2XTI A;  5LMN W;  4DV3 Q;  1PH9 A;  4IOA A;  1T9H A;  3ER0 A;  1SRO A;  1X3E A;  4DR4 L;  3PV0 A;  4JI2 Q;  1EQR A;  4X6A H;  2ID0 A;  4X65 L;  2VW9 A;  1HNZ L;  1P8L A;  1PH2 A;  2JK8 A;  2B63 H;  5JJI A;  4O0A A;  1YEZ A;  5M5X H;  3NEL A;  3AFP A;  4YHH Q;  2D62 A;  3GTJ H;  2R93 H;  5IY0 A;  3PUY A;  5HGQ A;  1EWI A;  1UWV A;  4LUO A;  1UE6 A;  2R92 H;  3HKZ G;  4DUY L;  4LF5 L;  4ALP A;  3HKZ E;  1ASY A;  3TS0 A;  3K80 C;  3J81 c;  1VQG A;  4DV1 Q;  1EFW A;  5ELN A;  1WFQ A;  3GTL H;  4LF5 Q;  3KLW A;  2QEX A;  5LMN L;  4A3M H;  4DV5 Q;  1Q86 C;  2N8N A;  4DR1 Q;  2HIX A;  4PZ6 A;  2VQE Q;  4GOP C;  1VQ4 A;  2R7Z H;  3RNU A;  4DR3 Q;  2Q2U A;  1ASZ A;  1E3P A;  5C4X G;  1EUJ A;  4JOI C;  1AE2 A;  2BA1 A;  4C2M H;  4PG3 A;  2NZO A;  1X65 A;  2PQA B;  3I4O A;  5BR8 L;  4A3I H;  1JJ2 A;  1XJV A;  4GS3 A;  1XTD A;  3KF6 B;  4O2D A;  5EAY A;  4LFC Q;  2UUB L;  1XPR A;  2UXD Q;  1VQD A;  1NTG A;  1A0I A;  1X55 A;  3H15 A;  3H0G G;  1UE7 A;  5GQO A;  3MXN B;  1NMG A;  1GKH A;  1IZ6 A;  2UXC Q;  4B3T L;  3F8T A;  3F2C A;  4HJA A;  1NJI C;  4AYB G;  4LFA L;  4JI1 L;  4A3B G;  2N3S A;  3HOY H;  4DV0 L;  1FJG L;  1N32 Q;  3PUZ A;  4XTC S;  1XMO L;  4BBS G;  4DV0 Q;  4BBR G;  1FJG Q;  4JI1 Q;  4JV5 Q;  1IBM Q;  4B3T Q;  3G48 A;  4MZ9 A;  4K0K L;  1UE1 A;  4DV6 Q;  1OXX K;  1UEB A;  4JBK A;  3K0X A;  4A3G H;  3J7Z C;  1IBL Q;  4JCV E;  2ASB A;  3CC2 A;  1VQI A;  3FKI H;  2IX1 A;  1TWA H;  4QQB X;  4DAM A;  4DV6 L;  2MFI A;  3HOW H;  3FKI G;  2GN5 A;  2CCZ A;  2VY3 A;  3I4N H;  1VQO A;  1JT8 A;  1MIU A;  3HOW G;  2ALY B;  3J80 i;  1KHI A;  2D0P A;  4IFD I;  1X3G A;  1QVF A;  3TRZ A;  4A3K G;  2PI2 A;  1VQ7 A;  5JJL A;  1K73 C;  3M4O H;  1A63 A;  2DUD A;  4YWM A;  1L1O A;  3H0G H;  4DR1 L;  1XMQ L;  2VNU D;  3T1Y Q;  1IXR A;  2VZA A;  1CSP A;  3F2D A;  3M4Q A;  1QVG A;  1WCM H;  1C7Y A;  2E5L Q;  3RR5 A;  5LMU Q;  1CSQ A;  1C9O A;  2FXQ A;  5IYC G;  4B3M Q;  3K7A H;  2NN6 I;  4QIW E;  1XPO A;  4RMF A;  3S16 H;  4DUY Q;  3FP9 A;  4APV A;  3UDG A;  2F4V Q;  4A3C H;  1HJP A;  3TQY A;  2B63 G;  3A0J A;  4DK3 C;  4JYA L;  3PSI A;  1VQJ A;  4IOC A;  1D8L A;  1HZ9 A;  1TXY A;  1WYD A;  4L5T A;  4DV5 L;  4KLK A;  3KDF A;  1TWF H;  4DR2 L;  1YIT A;  4IFD J;  1B8A A;  3AYH B;  2CFM A;  5E7N A;  2ZJR A;  2Z0S A;  2ES2 A;  4LF6 Q;  3L0O A;  4A3G G;  5ELO A;  1I3Q H;  1VQE A;  1I6H H;  5M5Y H;  1S3O A;  4YCV A;  4JC0 A;  3L2P A;  1K8A C;  3CCU A;  3KJP A;  1QZG A;  1Q12 A;  3DLL A;  4A3K H;  1K9M C;  3S1N H;  3HOZ H;  2DGY A;  5IP9 H;  1Q46 A;  4BY1 G;  3PIP A;  1N33 Q;  3A5Z B;  4WJ3 M;  3PUW A;  2AWO A;  4BY1 H;  2L15 A;  4BY7 H;  4DUZ L;  1K0R A;  3I2Z A;  1U0L A;  4DV2 L;  2BH2 A;  1N36 L;  2JA6 H;  5IT9 c;  2QGQ A;  2KEN A;  4X62 Q;  3BZC A;  4LF8 L;  1CUK A;  3I7F A;  4TVA B;  2I5M X;  4QGU A;  4HIO A;  1QUQ A;  3U4V A;  3NEM A;  2CKZ B;  1PH4 A;  3UE1 A; 
#chains in the Genus database with same CATH topology
 1GYF A;  3OWF A;  1A8V A;  2Z9H A;  2AUK A;  1EYC A;  3SI8 A;  1GGO A;  1G6P A;  1GUG A;  2L5T A;  2P0A A;  4EFE A;  1HNX Q;  3PIO 3;  4IR1 A;  1VMC A;  2K1B A;  3RMH A;  3T53 B;  5DNF A;  1VQ8 A;  2V59 A;  5I47 A;  1ENC A;  1OTC A;  5KG5 A;  1B1Z A;  4P71 A;  4CHT B;  2JA5 G;  2R87 A;  2V4R A;  3MFG A;  1V9P A;  4H13 C;  2WAQ E;  2NTS A;  3K81 C;  1PH5 A;  2R93 B;  3UI2 A;  3CXC A;  2WDT A;  4J1M A;  1Y1V G;  5KG3 A;  2O5I C;  1Q1E A;  4JI6 Q;  3W3A A;  3NPP A;  5JPN C;  2OQ0 A;  4GKJ H;  3H0G A;  1ILQ A;  2RDF A;  3OSN A;  4Q8F A;  4ZQI A;  1KNE A;  4N9P A;  5KFD A;  2JA7 G;  4C3H H;  3SK6 A;  3FMC A;  1VQK A;  1AW7 A;  1ENF A;  2YW2 A;  4JI0 L;  2PZU A;  1VQH A;  2YTV A;  4RGM A;  2IHE A;  4DV2 H;  3PCO B;  4GKJ L;  4DL7 A;  3PO3 B;  4L6T B;  2W9B A;  1N34 Q;  4YY3 L;  1HUM A;  1SYX B;  4MV6 A;  1G2S A;  4ZOL F;  3K6O A;  3JAM c;  4FF4 A;  2A8V A;  3PW4 A;  1RTN A;  1GUT A;  1LLR D;  4QF4 A;  5LA6 F;  1QCB D;  2KCN A;  1HNZ Q;  3RFC A;  1JMC A;  3PN1 A;  1N34 H;  1PFS A;  3ND9 A;  2HIV A;  3PMF A;  2IX3 A;  1KXL A;  1J9O A;  1TT2 A;  4FS1 A;  4DK0 A;  3NXW A;  1J5E Q;  1RK5 A;  1H9R A;  4BA1 I;  5KFP A;  4RB2 C;  4XZ3 B;  1CE8 A;  1IL2 A;  4X3K A;  4K6D A;  2UU9 H;  1UNN C;  5C4X H;  1WOC A;  2V1C C;  2JN4 A;  1Q8I A;  3E0E A;  1LTR D;  4TRD A;  2IW3 A;  5DQI A;  3FKI A;  2BR0 A;  1E24 A;  2UXC L;  3KHH A;  4R4I A;  5JPM C;  2JA6 G;  5ELF A;  1RIP A;  4IHJ F;  4YBZ B;  1K3B C;  3G6X A;  3PO3 G;  5C4Z A;  3FKI B;  4KD3 A;  1PLF A;  1WTV A;  3J81 W;  3PO3 H;  1QE6 A;  5FLX c;  5KFV A;  4FXK C;  1LT4 D;  1F9Q A;  1E4G T;  3WO0 A;  2B2Y C;  1L2F A;  1I50 A;  1E1O A;  1RDP D;  1HR0 H;  3EBE A;  2IX0 A;  3RLF A;  1BNC A;  2FK1 A;  2JA9 A;  1PXU A;  4X66 H;  3KLS A;  4GLV B;  4C3H B;  5IYB G;  4A3B B;  1NR2 A;  2YZN A;  4IR9 A;  2VQE L;  2PN1 A;  5M3M H;  1KTK A;  4P74 A;  5KT5 A;  2HHH Q;  4L5S A;  3KHR A;  4A2A A;  2A6H C;  2FJZ A;  1NAP A;  5KND A;  3MXP A;  1YHQ A;  3G8C A;  5GON F;  1KDC A;  1GD7 A;  4ED1 A;  1QVC A;  3PR4 A;  5GAH C;  2A73 B;  2JJQ A;  4RG1 A;  5EWE A;  3M9M B;  2C2R A;  1ICF B;  3STB D;  2ASJ A;  3HOV G;  1UNS A;  2EYJ A;  3KFU A;  1U4M A;  4LH6 A;  4FO2 A;  4HNV A;  2VL6 A;  3M7G A;  3KOJ A;  2O4X A;  1VQN A;  1O7Y A;  2ZTE A;  4LWC A;  3HOV H;  5C3X A;  1B3A A;  2YS6 A;  5KGU A;  1BR9 A;  1B9N A;  1SJH D;  1TS3 A;  3H0G B;  4A93 G;  4NXM L;  5E1F A;  2EYM A;  3WOE A;  3MA2 B;  1IBL L;  2NVY B;  5KG7 A;  1LTT D;  4RWS C;  2I5L X;  2FLN A;  4K0K Q;  2KEC A;  2WKC A;  4X3S A;  1JJG A;  1L2Z A;  3GTG A;  5M9O A;  3T5K A;  1NCV A;  2F3I A;  5T14 A;  1S0M A;  1HH2 P;  4TUY F;  3SE7 A;  2IA6 A;  4HCE A;  3MC0 B;  2XD4 A;  1W3S A;  2CW8 A;  5KFN A;  4FXD A;  4A3M G;  2L55 A;  4A3F G;  2K50 A;  1MI2 A;  1TWH B;  4KJO A;  4R1J A;  4ECY A;  4RB0 A;  1WTH A;  5K5P A;  5FLX E;  1ET9 A;  4OO1 H;  1YJN A;  1SNO A;  3QOJ A;  5M5Y B;  1FYC A;  3I70 A;  4N8X 1;  4KY7 A;  2YCH A;  3V6K A;  1CS0 A;  1PYB A;  2R7F A;  4ED7 A;  1EOV A;  2DJG C;  1G6Z A;  3KXY T;  2JYO A;  1FD7 D;  3GV7 B;  2J9G A;  2B2U C;  3UDI A;  3PF5 A;  2XRS D;  4UY8 C;  1Y8P B;  4RHS A;  2NUC A;  4BXX G;  2NWG A;  2PI2 E;  4IO9 A;  4XXE A;  4POF A;  4R4T A;  2NU8 B;  1EIH A;  3K58 A;  4ZCK A;  2N49 A;  1CQI B;  4ED2 A;  5JEA J;  3R2I A;  5IOD A;  4R7R A;  4K0K H;  2F0O A;  5COY A;  2CWA A;  1QUQ B;  3KDF B;  1E4F T;  3G6E A;  1Z6H A;  1TR5 A;  2B2V A;  4QW8 A;  2CWP A;  1VQM A;  2W9C A;  1KBL A;  2NVQ H;  3V96 A;  3GTL B;  2Y0S A;  1I6U A;  4HJ5 A;  4A3D B;  1ESR A;  4DA2 A;  1TWF A;  3M9N B;  4QWE A;  2DPJ A;  1X3P A;  1TWG A;  2NVX A;  2LXJ A;  4B3R L;  2DJF C;  1W96 A;  5IP7 H;  3G7L A;  3BJU A;  2F0F A;  5IP7 G;  3CCM A;  4GKK L;  1NUC A;  5M5X B;  3GTJ B;  1G91 A;  4CKE A;  3GTP A;  3GDE A;  2UUC L;  3OTO Q;  3F2B A;  3B6Y A;  3QO2 A;  4DV1 H;  1SYF A;  3SK4 A;  3RGZ A;  1EWC A;  1EQQ A;  4POG A;  3TII A;  2ZM6 H;  1X54 A;  3QOL A;  5EDW A;  1XNQ L;  2ASD A;  2BE5 C;  2FMM A;  4EBE A;  2HDL A;  1FL0 A;  5KFX A;  5KFE A;  1K3R A;  1I6H B;  4DV2 Q;  2W71 A;  2UVU A;  1JOO A;  3K7U C;  1TU2 B;  5KEE A;  1HR0 Q;  2DPI A;  2XRQ D;  5FD6 A;  3CVZ A;  2OWO A;  2CW0 D;  3LML A;  2WAQ G;  1F9P A;  3ULP A;  2F0M A;  4RCN A;  2XC9 A;  2J6T A;  4B3R Q;  1II3 A;  3OIP A;  1J5E L;  3S9W A;  1IBK Q;  3N40 P;  2KUM A;  3MXN A;  4RGT A;  4X64 Q;  1VBH A;  2PMZ E;  3S16 B;  1SYC A;  4E4T A;  5KT2 A;  1V1P A;  2W57 A;  4JI6 H;  3GTG H;  5AJ3 Q;  3C1E A;  1Q1B A;  1X6O A;  3S1M H;  3K5H A;  4DU9 A;  1VQA A;  5IGB A;  2PVP A;  4R4C A;  4B3S H;  1MGS A;  2KQ3 A;  3CU7 A;  3HFZ B;  2PW5 A;  3TS2 A;  2HGS A;  3SEB A;  4ODG A;  2AWN A;  4WJW A;  4HJ8 A;  4DV1 L;  4O4H F;  4DV4 H;  4UP9 A;  5J2T F;  3DHQ A;  1QNK A;  3J7A V;  5DLF A;  4JI8 L;  1S9F A;  3T13 A;  4IUU A;  2W7P A;  4QIW B;  1RJR A;  4MV7 A;  4MV9 A;  2NU6 B;  4TQR A;  2VA2 A;  1B70 B;  5AJ3 L;  1A62 A;  3TP5 A;  1S68 A;  2X6L A;  2XWB B;  3KJO A;  1L1O C;  3RAX A;  3BDC A;  1CTM A;  1JLL B;  3T1H H;  1KLG D;  3CQZ B;  4FBT A;  4JI8 H;  5GRO A;  1RKN A;  1AEX A;  4K14 A;  2CHB D;  2QDL A;  1KAW A;  1JDE A;  3OYY A;  3S1Q H;  2W6O A;  1PFB A;  5BN4 A;  4RHR A;  3JAM W;  3OMG A;  2C28 A;  4ZKC B;  1SE2 A;  2KJX A;  4RAZ A;  2VOB A;  1SEB D;  1PZI D;  1M90 C;  3BZD B;  1JIH A;  1HNX L;  2JP1 A;  1IYJ B;  3CCQ A;  3VR5 A;  4C3I B;  1SNC A;  4DAY B;  1KAA A;  1I3Q A;  1J8I A;  2YTX A;  3PO2 G;  2WTF A;  3RV4 A;  1AP0 A;  4JUZ A;  3LWE A;  3CCE A;  1CA5 A;  2W8L A;  1CT1 D;  1LTB D;  4PMB A;  3PO2 H;  1BJT A;  2FK2 A;  5LMU H;  2JA5 A;  4KI0 A;  4O1N A;  2XTI A;  5C8Y F;  2XCP A;  4F4W A;  1PH9 A;  4MV1 A;  3CRK C;  4IOA A;  1X3E A;  2EYO A;  3PV0 A;  1EQR A;  1P8L A;  2JK8 A;  1QG7 A;  1N36 H;  5HBR B;  1YEZ A;  2R93 H;  3VYR A;  1Y1W B;  4DAP A;  4J9O A;  3A55 A;  3IFD A;  4DUY L;  2Z6B A;  4X3U A;  5ELN A;  1WFQ A;  4PDB A;  1ZYR D;  3KLW A;  4KV6 A;  5LMN L;  5EPJ A;  3G6Y A;  1Q86 C;  3FDT A;  2WB1 A;  2FP4 B;  5D8D A;  3PW7 A;  5CV4 A;  3RNU A;  1E3P A;  5C4X G;  1GXD C;  4JOI C;  1AE2 A;  3RF2 A;  1TKW B;  3KF8 A;  1HPC A;  3I4O A;  5BR8 L;  3RD4 A;  3K5N A;  2KED A;  1JJ2 A;  1XTD A;  4RKB A;  2UXD Q;  2VXW A;  1B4O A;  2SCU B;  4HSV A;  2ZDH A;  2F0P A;  3MXN B;  5F9N A;  5H80 A;  1IZ6 A;  3GTQ B;  1CFM A;  2UXC Q;  1SCU B;  1NJI C;  5I2X A;  4A3B G;  4AYB G;  4JI1 L;  1K83 A;  1U4P A;  1I7L A;  3M4I A;  4BBS G;  4DV0 Q;  4BBR G;  3GIP A;  5CV6 A;  1IBM Q;  4KJN A;  4I7A A;  3I91 A;  4B3T Q;  4CJ0 B;  2E5L H;  1GSH A;  1UE1 A;  2ASB A;  2IX1 A;  1VQI A;  3FKI H;  4DR1 H;  1TWA H;  3C3L A;  3NWS A;  5NUC A;  5KFA A;  3G6J B;  4KHP H;  1SE4 A;  2B2W A;  3HOW H;  3AMU A;  5KFQ A;  3FKI G;  4GZY C;  2VY3 A;  3H4B A;  1MIU A;  3HOW G;  2ALY B;  3J80 i;  3H6M A;  1G2T A;  1FNV A;  1X3G A;  1QVF A;  3T56 B;  2FHT A;  4IUR A;  4ECT A;  3EJI A;  3TRZ A;  3V05 A;  2AQ4 A;  2B2U A;  1K73 C;  1A63 A;  5FLX W;  4QWD A;  3KAK A;  2YU9 B;  1IBL H;  2VNU D;  3H0G H;  2KA7 A;  2F0L A;  2VZA A;  3F2D A;  3JSL A;  4AQY H;  1F2Y A;  3S16 H;  1JWS D;  2FXQ A;  4B3M Q;  1DZ1 A;  3DMU A;  4QIW E;  4WD3 A;  3FP9 A;  4APV A;  2L0C A;  3R5X A;  3VR3 A;  5CMD A;  2OXP A;  5C4X B;  3TQY A;  2B63 G;  2FE3 A;  3K57 A;  2GLT A;  2W70 A;  4JYA L;  1ZYR C;  5CC4 A;  3MWD A;  1HZ9 A;  1WYD A;  3FPP A;  4KKS A;  4KLK A;  3KDF A;  1Z2P X;  5I2Y A;  3PR5 B;  2X69 A;  2XCA A;  2VB2 X;  1B8A A;  4YR2 A;  2CFM A;  4J0M A;  4A3G G;  4LF8 H;  5JVL A;  1HA5 A;  1I6H H;  4AYB A;  3HEJ A;  3S1N B;  1TWC A;  4DR3 H;  1K9M C;  4ED3 A;  4AYB B;  5KG2 A;  2DGY A;  4I50 F;  3KUP A;  3BAA A;  1MD2 D;  2WKD A;  4LF4 H;  2JEI A;  1SFO A;  2X6G A;  2FPG B;  2R3Z A;  2B63 A;  3TN2 A;  1K0R A;  2PZW A;  1KJI A;  1A6X A;  3RTX A;  3K5I A;  2QGQ A;  4LF8 L;  1N48 A;  3BZC A;  1RJP A;  1CHQ D;  2I5M X;  3E6Z X;  4YY3 H;  2CKZ B;  1SLJ A;  4BXX H;  4MN3 A;  2E76 C;  2F52 A;  3Q8Q B;  4KKU A;  1X3Q A;  1N36 Q;  2R7N A;  4XYL B;  4KN4 C;  3ULL A;  3GID A;  3Q8D A;  3S2H B;  2UXB H;  2YS7 A;  3OW2 A;  1YBY A;  4IUT A;  3HKS A;  3U9S A;  5BMV F;  5K36 G;  5COR A;  3BU2 A;  1XNR H;  3MR2 A;  4DL2 A;  4OX9 L;  5CV5 A;  2OTL A;  5C0X H;  4ABN A;  4DN4 M;  1EY7 A;  1FNU A;  3I4M H;  3M3Y H;  2PQA A;  4IRC A;  4EFB A;  1WTQ A;  3NSW A;  2YYZ A;  1BXR A;  5DM6 3;  5IP9 G;  4RGO S;  2QA4 A;  5C1O A;  4IWY A;  2AMC B;  2V4D A;  5GAD C;  3SK8 A;  3CCR A;  2K6A A;  4HIM A;  1PZJ D;  3OW7 A;  1G8Z D;  1IW7 C;  4ZUI A;  1BF4 A;  2YL2 A;  4DL3 A;  5T1G A;  1PH6 A;  1XNR L;  5FJ8 G;  1XNR Q;  3AFQ A;  4OEL B;  2MPM A;  2E8G A;  4J15 A;  5LHY 1;  5IYD G;  2EZV A;  3T1H Q;  3A5U A;  1GUW A;  3LX0 A;  5EPK A;  1CK1 A;  2E5L L;  1I4G A;  1XMQ Q;  1Y69 U;  2R82 A;  3IL8 A;  1XWE A;  3CW2 C;  2ZXR A;  3ETH A;  2F3W A;  1OXU A;  2NVY H;  2I5H A;  1VDZ A;  1LM0 A;  2F0V A;  2ICI A;  4CDD C;  5LL6 X;  1GJX A;  4UFZ A;  3CAM A;  2E2I A;  5L1K A;  5C5L A;  1Y1V A;  2C22 A;  1JB3 A;  3ORQ A;  5CA1 F;  4JI4 H;  2Y0S E;  5J2U F;  4JBJ A;  4LJZ C;  2IY5 B;  3U50 C;  2DWC A;  4EQP A;  4RFB A;  4LF8 Q;  1Y1W A;  4LUV A;  1FGU A;  2EXZ A;  2MO0 A;  1VAJ A;  2Z1C A;  3I56 A;  3G4S A;  3TME A;  3J7A F;  3HOU B;  3D6C A;  3U58 A;  2F0U A;  2AGQ A;  4DFA A;  4OWX B;  4BY7 G;  5JAV A;  4OWT B;  1S4Z A;  2EY1 A;  3W1G A;  1K8G A;  4RUC A;  1B9M A;  4K2L A;  3M4P A;  4JI4 L;  1IBK H;  4HNT A;  2R8K A;  3JRW A;  1R9T B;  3JAM E;  1TWA B;  4NXM H;  4B3R H;  2EVB A;  4MNO A;  3H4D A;  1W2B A;  4FF2 A;  1ZHS A;  5BR8 H;  1I3Q B;  4IJL A;  4HMI A;  2L12 A;  2UU9 L;  2EOT A;  3I55 A;  1STG A;  3LGJ A;  1SNQ A;  3J80 c;  4DNI A;  1Y1W G;  1SN8 A;  2CW7 A;  2BCO A;  1HZC A;  2R84 A;  4OXP A;  3RIZ A;  3GTP H;  4Y7N H;  1F2Z A;  5C6A A;  3GP7 A;  3HBL A;  5EBC A;  2OLS A;  1TWA A;  4RB3 C;  3F2U A;  1GM5 A;  5IT9 L;  2ZM6 Q;  1T3N A;  2R93 A;  4A3D G;  4EYH B;  1QWY A;  3M7N A;  5BPF A;  1H9J A;  4A3D H;  5L9X A;  1N33 H;  1VF7 A;  4KY5 A;  2EYL A;  1PMR A;  2F0W A;  4HYK A;  2XIW A;  2Q8R E;  4KHP L;  4OO1 G;  5C0X J;  4MV3 A;  3LWB A;  1O80 A;  1IBM H;  1GHK A;  1L0X B;  3PZP A;  3Q0A A;  2AQ2 B;  4OIK A;  4P73 A;  3MFY A;  2WYO A;  2AKW B;  4FYD A;  1EUD B;  1Q3L A;  1YNN C;  3PW2 A;  1G29 1;  2RGR A;  1V4Y A;  1Q90 A;  4K8J A;  2WB1 E;  1CA6 A;  3C46 A;  2BDN A;  3SHL A;  2C5C A;  5I9P A;  1XYI A;  3GLK A;  5E3F A;  3T4A C;  5IGG A;  4HR7 A;  4IRD A;  4H7B A;  2J4X A;  2CVR A;  4Q43 A;  3R5F A;  2RCN A;  1IHZ A;  2HQE A;  1MJE A;  1JOQ A;  4JI7 L;  2Z6K A;  2K03 A;  5IWA Q;  2RDG A;  4EQ5 A;  1PH8 A;  1EIF A;  4UPA A;  1KRT A;  3VA5 A;  2VQF L;  4FF1 A;  3RN2 A;  1X9N A;  3T1Y H;  4HID A;  5KFO A;  5BPH A;  4WFN 3;  4NXN H;  3CME A;  4GN3 B;  1H95 A;  1TWH H;  2EYP A;  3BVZ A;  1TWC H;  4UAI A;  1V1P B;  4IZO A;  2LSS A;  4CKB A;  4DUZ Q;  4HN7 A;  1SE3 A;  1PV4 A;  4TQS A;  1N33 L;  2CH4 A;  1N56 A;  1VQB A;  1O78 A;  4LFA Q;  1C0A A;  4C2M B;  2MNA A;  3GIK A;  3MEF A;  4NW2 A;  2VQF H;  2PW7 A;  5C3E G;  4NXN L;  4LF7 Q;  1LT3 D;  4B9X A;  2R86 A;  5LMN Q;  2JSO A;  3A7A B;  3DWQ A;  3HZX A;  2A74 C;  3CHB D;  2L1B A;  3CCL A;  4QL5 A;  1Z7T A;  3H3V H;  1EYD A;  4RGN A;  5IT9 E;  1PRT D;  1DV1 A;  5M3F H;  4EGV A;  2IBK A;  1VS0 A;  1Y14 B;  4JYA Q;  4A3B H;  4IFD G;  1RD9 D;  1K0S A;  4JI7 H;  4O3N A;  1TWG H;  4LFC H;  2WB1 G;  5LMU L;  4Q0F A;  3QWN A;  2RF4 A;  3S14 H;  4ECS A;  2ZM6 L;  3RZO H;  1BVS A;  1STY A;  4XDX A;  1KD1 C;  1EU3 A;  4C3J H;  5CBA E;  3J81 L;  2NVT H;  2E74 C;  1YNN D;  3LP8 A;  5IOC A;  2QW7 A;  1PFN A;  2UVV A;  1T36 A;  1CKN A;  5IGE A;  2K14 A;  1DOK A;  1SNP A;  3CPF A;  4JI2 L;  4A3L H;  4FNF A;  2NZH A;  3R93 A;  2R8H A;  2EJG C;  3P7J A;  1CZW A;  1DD2 A;  1GLV A;  1RCV D;  5DM7 3;  4A2B A;  1EYA A;  1JR0 D;  1HTP A;  1CZG A;  4RZR A;  2AGO A;  1LTI D;  2IT1 A;  4X66 Q;  2AHO B;  4EBC A;  4ECQ A;  2PMZ A;  3L4K A;  3SVM A;  2WP8 J;  2JQO A;  5M3F B;  1I94 Q;  5KFK A;  2JEF A;  3OUZ A;  2QK4 A;  1OXT A;  3TQT A;  1I7N A;  2NBF A;  3CC4 A;  3NTK A;  4YCU A;  4B3S Q;  2EYF A;  4DGZ A;  3K3V A;  2K5N A;  2WB1 B;  1BBU A;  4GN4 B;  3URY A;  3K59 A;  4JBW A;  3RB0 A;  3A54 A;  3BJY A;  2BQ3 A;  2UUB H;  4YP3 A;  4A93 B;  2JA5 H;  4MAM A;  4JI5 L;  2FB9 A;  1BNZ A;  5TSS A;  2UXD L;  2UUA H;  1BBX C;  3MFI A;  2ZJP A;  4DV4 L;  4GOP A;  4P75 A;  4M7E A;  4J9Q A;  2NVX H;  4HNU A;  1K83 H;  2RDJ A;  3ZJY C;  1P16 A;  3RLO A;  2RSO A;  3C1F A;  2Z4I A;  2QEJ C;  3OPO A;  3HOU G;  3ICE A;  5D1O B;  2Q2T A;  1K1S A;  3BVG A;  5EWF A;  1S03 G;  4EEY A;  3G71 A;  1VQ9 A;  1EY6 A;  3HOU H;  3BZK A;  3WDN A;  1PRT C;  2JEB I;  1TS4 A;  1J5E H;  2MP1 A;  1AZQ A;  3AU7 A;  4EX5 A;  2K52 A;  3JAM i;  2BOS A;  1WR2 A;  1WCM G;  3C2P A;  3VPD A;  3EPI A;  4HIK A;  2DIK A;  3DXJ C;  3T1Y L;  1EEF D;  1HNZ H;  1DOM A;  4K5W A;  1LYL A;  4MTN A;  3FRP B;  5L37 A;  2HCC A;  1K28 A;  2A1A A;  1FKA H;  5KFG A;  4ZKB B;  1DYQ A;  5LOV F;  4NDX A;  3OTO H;  4O3Q A;  3SR1 A;  4DV3 L;  5EBD A;  3J81 j;  2JEJ A;  1EIG A;  1B2T A;  1WCM B;  4IUQ A;  1SFO H;  5IGD A;  5C5M A;  5CBE E;  3CCV A;  1A3T A;  1DCZ A;  3CQZ A;  4ED0 A;  4DF7 A;  2F0K A;  2HT1 A;  4Y52 H;  5KRU A;  2UUA L;  1W93 A;  3KHL A;  1HRJ A;  2W6M A;  4ME3 A;  3EN2 A;  1CKM A;  1X3F A;  3SDZ A;  2GPS A;  1RL2 A;  3OTO L;  2JA8 G;  4C2M A;  4L1K A;  2D0O A;  4A3K B;  1DXM A;  4UCV A;  4MTE A;  3J80 W;  1E7Z A;  3K5O A;  4LF9 Q;  1Y1V B;  1Z2O X;  1EU4 A;  5C3E H;  2A68 D;  1PA6 A;  4C5C A;  3Q8R B;  5IYD H;  2F0G A;  3CC7 A;  4DUY H;  1BKB A;  2A6E D;  1PH1 A;  1SYE A;  2QCP X;  3A74 A;  1BCP D;  1JJC B;  4R8N A;  3L4J A;  1UEA B;  3PIP 3;  4DR4 L;  4JI2 Q;  4EVO A;  1HNX H;  3H40 A;  2ID0 A;  2H1E A;  1HNZ L;  1OWT A;  1PH2 A;  2FLP A;  4PV1 C;  1BCP F;  3AFP A;  2D62 A;  3PUY A;  3DUZ A;  4LUO A;  3EFX D;  2NVT B;  3FPU B;  4A3G B;  4RZQ A;  1ASY A;  3HKZ E;  3J81 c;  1VQG A;  1EFW A;  2HVQ A;  4LF5 Q;  5JUM A;  4APM A;  3LNN A;  4C5B A;  3BS1 A;  3NE5 B;  4IUV A;  1SYD A;  1ZXT A;  1TY0 A;  3DEO A;  4PZ6 A;  5CV8 A;  4GOP C;  1VQ4 A;  1IKL A;  3OSP A;  1C8C A;  1EQV A;  3K5L A;  4ECX A;  2BA1 A;  1IL8 A;  1EEI D;  2N55 A;  3GTO B;  1C4Q A;  4JI1 H;  1FJG H;  2NZO A;  2JA7 A;  1X65 A;  2PQA B;  4A3I H;  3HOV B;  2W6P A;  5EJW A;  3J7A K;  1JOR A;  2XVS A;  3GTP B;  3N44 B;  4FP5 D;  3Q2O A;  3MWE A;  2WIN B;  1X55 A;  5FLX L;  5T1I A;  5C3W A;  2ENB A;  3H0G G;  5GQO A;  4MTD A;  3VPB A;  3MWY W;  4L8J A;  4JYA H;  3OOC A;  2RA4 A;  4LMY A;  3GTG B;  4B3T L;  3F8T A;  1M0T A;  1N32 Q;  4U7C A;  1WTP A;  4Q5V A;  4DV0 L;  5KIX A;  3PQI A;  2NTT A;  1FJG Q;  4JI1 Q;  5J22 A;  3R8B A;  3G48 A;  4K0K L;  4QWA A;  1IOV A;  1STH A;  4YIJ A;  4A3G H;  3J7Z C;  4LF7 H;  5J39 A;  4DAV A;  1JOK A;  4PWQ A;  4J9L A;  4DR6 H;  4XX0 B;  2GN5 A;  1LV9 A;  2B2Y A;  2NN6 H;  4C3J B;  3Q22 A;  4DR5 H;  3MJF A;  1F9S A;  1KHI A;  2D0P A;  1A15 A;  2I87 A;  2FK3 A;  2I8C A;  5ISR A;  1PK8 A;  4C3H G;  5JVD F;  4MTK A;  2NVQ B;  2JXM B;  1BCP C;  5DAU A;  2CQY A;  4OHJ A;  5JJL A;  2MHV A;  1Y8N B;  2DUD A;  4DR1 L;  1XMQ L;  4J9R A;  4XYQ A;  3T1Y Q;  5EKK A;  1CSP A;  4XT1 B;  1CHP D;  3M4Q A;  1WCM H;  5HUR A;  1QVG A;  4DV3 H;  1S5C D;  1C48 A;  4F50 A;  1C9O A;  5IYC G;  4ECZ A;  4OL7 A;  1XPO A;  4QIW A;  4O3R A;  4DUY Q;  1TII D;  4ECR A;  4C5A A;  2L4N A;  1A3U A;  1AFP A;  1W6J A;  4DK3 C;  1B44 D;  1TXY A;  2M00 A;  4L5T A;  2EY6 A;  1SFO B;  4KMU C;  4O4I F;  4S3S A;  4UCU A;  1M8A A;  4U6P A;  3MFH A;  1YIT A;  4IFD J;  3AYH B;  5ELD A;  4OEM B;  3D4W A;  1TWC B;  3L0O A;  2F03 A;  3FMA A;  1HQM C;  2F0I A;  1LTG D;  1K8A C;  3CCU A;  3J80 E;  3KJP A;  1SXT A;  1S0O A;  4A3K H;  3H94 A;  3S1N H;  3GV8 B;  1GOZ A;  5IP9 H;  1VMP A;  3NQT A;  1Q46 A;  4BY1 G;  5KNB A;  4DV5 H;  4C1N I;  3PIP A;  5D3D A;  4DR4 H;  4BY1 H;  2K05 A;  3N6R A;  3Q8S B;  3QFF A;  2K32 A;  2FIN B;  4A3F B;  2JA6 H;  1VBG A;  4DL4 A;  3GTQ A;  4TVA B;  4V19 0;  4HIO A;  1RJQ A;  5JOB A;  2R7K A;  2V58 A;  1WD1 A;  3NEM A;  4UCT A;  3UE1 A;  3S1Q B;  1GVP A;  4ZUJ A;  3OSO A;  3DWA A;  4HJ7 A;  1I5F A;  4IPD A;  3P20 A;  1HXY D;  4K5V A;  2LFN A;  4CC5 A;  4FDB A;  4XIG S;  1XMO Q;  1X32 A;  5EGT A;  4O3P A;  4DK6 C;  1JWU D;  1N32 L;  1AE3 A;  2R92 B;  3OHX C;  1B53 A;  1JXL A;  1GHJ A;  2I46 A;  2BQU A;  2C35 B;  3M3Y B;  1RHP A;  3NBH A;  3M9B A;  1YNX A;  2H4O A;  5C44 H;  1C3O A;  4XYO A;  3CQZ H;  4DR7 Q;  1TS5 A;  5DGB A;  4GKJ Q;  3I4N B;  3GV5 B;  5C44 G;  1SE8 A;  2R6G A;  3BYY B;  1IOW A;  1S5F D;  4YQW A;  2KHS A;  3VR4 A;  3CD6 A;  4GNX B;  1WTW A;  4JI0 Q;  4DR3 L;  3VA7 A;  5BN3 A;  3HKZ B;  3MR6 A;  4ZQ3 A;  2DNC A;  2F4I A;  3PF4 A;  1HNW H;  3NHH A;  3M85 A;  4GLX A;  1SBB B;  4MIU A;  1MJC A;  4A93 H;  4C56 C;  3H3V C;  1K8O A;  1YI2 A;  5DG7 A;  2MO1 A;  3PW5 A;  1SMY D;  4A3C G;  1QJO A;  3ZYY X;  3PUV A;  4JBM A;  2E2I H;  1VQ5 A;  4CDE C;  4A75 A;  4DK1 A;  2BQR A;  4BBR B;  4ED6 A;  1V1Q A;  1N9W A;  2YTY A;  3MHB A;  4HR7 B;  5JVG 3;  4A3I B;  3S15 H;  5DLQ E;  4QWC A;  4FU0 A;  1MKH A;  1BDO A;  3HG9 A;  2EE1 A;  5C44 B;  1IBK L;  2E2J H;  3SXH A;  4ID6 A;  4HED A;  1KJJ A;  3UE0 A;  3FHW A;  2KCC A;  2GVA A;  1XNQ Q;  4K8I A;  2R7Z G;  1T5E A;  1WTX A;  4IZ8 A;  3OHA A;  4ETS A;  1Z2N X;  4JI7 Q;  1S0N A;  3HOX H;  3MEH A;  4H02 A;  1WSC A;  4Q8E A;  3JC6 6;  3S1R H;  4DR7 H;  1I4P A;  4EYI B;  2KHJ A;  2LKV A;  1BBW A;  2Q8T A;  1N8R C;  4LFB L;  2B2T C;  2R8G A;  4PNY A;  2VUM H;  5I6W A;  1RK6 A;  1T5X D;  3S2D B;  1NMF A;  4HJ9 A;  1EYZ A;  2VUM G;  3E3X A;  2GVB A;  1PHJ A;  4J9K A;  2E75 C;  1I50 B;  4GKK Q;  3ND8 A;  4PZ7 A;  2WE6 A;  1H9S B;  2L11 A;  1HFN A;  3P1H A;  4C3I G;  2SOB A;  4YY3 Q;  5KG1 A;  4LF4 L;  4BBS B;  5K2M A;  1E2W A;  2KHI A;  3QG1 A;  3V4Z A;  2L9H A;  4C3I H;  4F4Y A;  4LFB H;  5D1O A;  5EQ0 A;  5JQW A;  1K83 B;  5J3B A;  5KG0 A;  1DOL A;  1GUN A;  2K4K A;  4KY6 A;  4A3E B;  4FM9 A;  2WV6 D;  2K01 A;  5ELC A;  2R7M A;  4RUA A;  4Q0Y A;  3TZU A;  1KDA A;  2NYZ D;  3MZ5 A;  4X65 Q;  4WOR A;  4OO1 I;  1CQF A;  4DR5 L;  1YVC A;  1C30 A;  4A76 A;  1U5K A;  2QDB A;  2EY2 A;  4DL5 A;  3QJY A;  4ME5 A;  5I4D A;  1BO0 A;  3KF8 B;  5KFF A;  2PQE A;  3MAQ A;  3E5N A;  2DN8 A;  1VQP A;  1KC7 A;  4UP8 A;  2XSC A;  5KFZ A;  3H09 A;  1LO5 D;  1ZKO A;  5M3F G;  2MCT A;  4RKL A;  3OHB A;  1HZB A;  4AQY L;  4UDU C;  4B3S L;  1I50 H;  4RAU C;  2EQS A;  3HOY B;  3S24 A;  3TDQ A;  1YIJ A;  2EYH A;  4J9M A;  4B3M H;  5KFI A;  5KT6 A;  1HHV A;  1STB A;  3E0J A;  4AQY Q;  4BBS H;  4GN5 A;  3GQC A;  1A2T A;  1SR3 A;  2A19 A;  3KTM A;  3RLN A;  1EQT A;  1VQF A;  2K5Q A;  2VQE H;  2EY5 A;  4YAK B;  2R92 A;  4DNT B;  4OON A;  1GUO A;  3O13 A;  4XT3 B;  1GSO A;  4Q44 A;  4CDC C;  3D0F A;  1HNW L;  1YJ9 A;  3RV3 A;  4LMQ D;  5KFY A;  3OIQ A;  4DV7 L;  2PNR C;  4FBU A;  3Q24 A;  2NZ1 D;  2Y0S B;  4EGQ A;  3IFT A;  3JAM L;  4DR5 Q;  4A3L G;  2KVM A;  1VQC A;  2GPW A;  5EWG A;  2K5H A;  3PGZ A;  4ZRZ A;  5KYL A;  1TWF B;  2R85 A;  1R9T H;  4QUC A;  1Q82 C;  1I4X A;  4A3I G;  2F0S A;  3VR2 A;  4V0B A;  4G57 A;  1UE5 A;  2Q8I B;  3BQ1 A;  1SMX A;  1V43 A;  3MR3 A;  4JI3 H;  2EIF A;  2A5H A;  4MA0 A;  2XWJ B;  2IP4 A;  1ICW A;  5BR8 Q;  4RB1 A;  2HHH L;  2MQH A;  4WBN F;  1NBW A;  3HOW B;  4BBR H;  1SEI A;  2ASL A;  4UCS A;  5LXT F;  2K28 A;  1ZHQ A;  1I4H A;  1NE3 A;  4R4Q A;  2O2L D;  2DNE A;  2YU9 H;  3E9I A;  5LP6 F;  5A2Q E;  4JPB W;  3UDF A;  2M2L A;  5C4J H;  2BH8 A;  2UXD H;  2EDG A;  3D4R A;  3DWP A;  1JIC A;  5L1J A;  2Z6K C;  1E2V A;  4JI3 L;  3BYT B;  1ZQ7 A;  4CC6 A;  5KFB A;  1XNQ H;  4RAY A;  4F87 A;  5EKI A;  3V6J A;  5KG4 A;  4YCW A;  1F2L A;  5BN5 A;  3J7A 5;  2B63 B;  4NKL A;  3N8D A;  2JA8 B;  5KFW A;  4O2B F;  5CYU A;  1QB5 D;  1JKJ B;  1S97 A;  2JA6 A;  2CH4 W;  1EIY B;  3IKJ A;  2OCE A;  4O4L F;  5GAG C;  1LTA D;  2A6E C;  4QB4 A;  3BA8 A;  4LFB Q;  1HZA A;  4ZI7 F;  3AEV A;  3QB3 A;  4IPG A;  4GOP B;  1L0Y B;  2HD3 A;  1HTL D;  1KJQ A;  4B9W A;  3L3O C;  4N8F A;  3ERO A;  2XIG A;  4JI2 H;  5JEA H;  2E2H A;  2HVR A;  3GTK A;  1S5E D;  3PUX A;  4GNX A;  5CR3 A;  3ERS X;  3I4L A;  5HY6 A;  2A6H D;  3TEH B;  1UUP A;  4A3J B;  1XTC D;  1EHI A;  3MTS A;  5C0X I;  4Z9C B;  1TVX A;  4JV2 A;  2ATW A;  2WAC A;  3QR8 A;  5D3I B;  1M1K C;  2KBN A;  3RBD A;  4O3O A;  2YRW A;  3NBH B;  1DJR D;  2AU0 A;  2MUY A;  1AZP A;  4R4O A;  1M6V A;  3RBE A;  2OH2 A;  4YWL A;  2QIL A;  2JA8 H;  3VDY A;  5J1Z A;  3W2D A;  4NMZ A;  4LNQ A;  3K8A A;  3RB6 A;  1AUX A;  4C1N K;  4JI5 H;  4LAA A;  2VPQ A;  1I4Q A;  1B3Q A;  4JI8 Q;  4DR6 L;  5KFH A;  2B3G A;  4IUP A;  4TQU S;  3TSS A;  2CQO A;  2F0T A;  5CGK A;  4B3M L;  2FMA A;  4DLK A;  5IT9 W;  4ECU A;  1YJW A;  4DR7 L;  2VR1 A;  1LT5 D;  5A2Q L;  5LYJ F;  3Q8P B;  3STB C;  1ESF A;  1B7Y B;  2VUM B;  3QIA A;  4OX9 H;  4YHH L;  5E4X A;  4A3J G;  1L1O B;  4G7H C;  5I9O A;  4DR4 Q;  2F0H A;  4F88 A;  3S15 B;  4DV7 Q;  2W6Q A;  3GD7 A;  3NQI A;  4X64 L;  3HOX B;  2K5D A;  4BS9 A;  2OEO A;  1YHA A;  5M3M B;  1HNW Q;  1Q81 C;  3I73 A;  4X66 L;  2QF7 A;  3TP6 A;  3T5L A;  3F1Z A;  4CJ2 C;  4L5Q A;  1VCI A;  2O5J C;  2PBZ A;  4A3E H;  3Q23 A;  3MWM A;  3EIV A;  2I0Q A;  4JI0 H;  2LY7 A;  2OF1 A;  4G3I A;  3S2H H;  5CA0 F;  1D5M C;  1BGW A;  2FJ2 A;  2E2I B;  1CI3 M;  4O2A F;  2UUA Q;  3G6V A;  4MV8 A;  4I4T F;  4R8I A;  1EL0 A;  3KLR A;  3D3R A;  1EOT A;  1SRU A;  4YR0 A;  4N9T A;  4LH7 A;  1XX8 A;  1ULZ A;  2J0T D;  3M9O B;  4ED8 A;  2ZTD A;  4EQN A;  3E9H A;  1IKM A;  1M4V A;  1E4E B;  4LFC L;  2Q2H A;  3KAL A;  4F7X A;  2VB3 X;  4DV3 Q;  4EEQ A;  2DY8 A;  3ER0 A;  3RAQ A;  1SRO A;  1I94 H;  4X65 L;  2NUA B;  2B63 H;  1WD0 A;  5HV6 A;  1D2B A;  4O0A A;  4TV8 F;  3NK9 A;  4ZHQ F;  5M5X H;  1H9M A;  3GTJ H;  4R8U A;  4LSX A;  1EUC B;  4J9N A;  1HFG A;  2K5W A;  3H91 A;  1UWV A;  5KFR A;  5M5W B;  1UE6 A;  1H9S A;  2F0E A;  3HKZ G;  2UUC H;  4G7Z C;  3K7A B;  3DF7 A;  1TWG B;  1OO9 B;  4IAJ A;  2FKL A;  2SNS A;  1TY2 A;  4A3M H;  2N8N A;  2TMP A;  1VF5 C;  2HIX A;  2VQE Q;  4DR1 Q;  2R7Z H;  4BWS C;  1CQJ B;  5EOY A;  5KFC A;  3WO1 A;  2B8F A;  3D8G A;  3RB4 A;  3V6H A;  4I7Z C;  4DV0 H;  4PG3 A;  1HUN A;  4Q45 A;  1XJV A;  5EAY A;  4LFC Q;  1NTG A;  1DON A;  4R8U B;  4KKT A;  1LT6 D;  4DXG A;  1STE A;  4L63 B;  1EZ1 A;  2ZJT A;  4RNO A;  5D1P A;  1NMG A;  1SDF A;  3A8J E;  1GKH A;  5AFW A;  1ROD A;  3ERQ A;  3K5M A;  3E5S A;  1BOS A;  3C0F B;  3HB9 A;  4HJA A;  4P2C B;  3HOY H;  1FJG L;  2K7V A;  3J81 E;  1B04 A;  5KFT A;  1GUS A;  1UC8 A;  2AQ3 B;  5D14 A;  3DEP A;  1WTO A;  5D65 A;  3IAY A;  1A3V A;  4ECV A;  1D1K A;  4KD4 A;  4DV6 Q;  1PTO H;  3K0X A;  1EY8 A;  3CC2 A;  4QQB X;  2I80 A;  3TQ1 A;  2MFI A;  1PZK D;  4TV9 F;  2NU7 B;  2RGV A;  4LF5 H;  2R61 A;  2PO4 A;  5ELB A;  3I4N H;  1MHW C;  1E0B A;  4IFD I;  1R9T A;  2YYA A;  3R3O A;  4DUZ H;  2EJF C;  3OMC A;  1O7L A;  4A3K G;  2PI2 A;  1VQ7 A;  5FO9 B;  2ZDQ A;  3GIL A;  4IRK A;  4GKK H;  4YWM A;  2B39 A;  3I90 A;  4DV6 H;  1IXR A;  1NSN S;  1SMY C;  2E2J B;  1RJT A;  1SND A;  3GV6 A;  3RB3 A;  2F0D A;  3TZD A;  5LMU Q;  1VKZ A;  3HP3 A;  5F9L A;  3K7A H;  2NN6 I;  5KNC A;  4RMF A;  3EYY A;  1Y8O B;  4IUN A;  5FO7 B;  4I65 A;  3L9A X;  2XGP A;  3A0J A;  3BAB A;  2OT2 A;  3PSI A;  1VQJ A;  3D6W A;  3TP7 A;  1B33 N;  1D8L A;  1JX4 A;  4DV5 L;  4DR2 L;  2EJM A;  2MGS A;  2IJ0 A;  5E7N A;  2ES2 A;  5ELO A;  2AUJ D;  1I3Q H;  1NNX A;  1VQE A;  5M5Y H;  1LAC A;  1PRT B;  5CV7 A;  1S3O A;  4O42 A;  3L2P A;  4CGY B;  1D5X C;  5C1P A;  1QZG A;  1E2Z A;  1Q12 A;  4ILW A;  3DLL A;  3HOZ B;  4C3J G;  2D2C C;  2NVX B;  4M1U B;  2N88 A;  2AQ1 B;  1N33 Q;  2JEG A;  1JC7 A;  1D6E C;  4WJ3 M;  2NB0 A;  3S14 B;  4BY7 H;  4DUZ L;  3I2Z A;  4DV2 L;  1R4Q B;  3LWU A;  1PDQ A;  3MVV A;  2KEN A;  3OWE B;  2HHH H;  1CUK A;  3I7F A;  4QGU A;  3A8I E;  1QUQ A;  1ENA A;  2M9V A;  2PCF B;  1PH4 A;  1KJ9 A;  2WII B;  4IPC A;  3GTK B;  2ZT9 C;  3GTL A;  2R8J A;  1IBM L;  1V8Q A;  4DKA C;  3ETJ A;  3NEN A;  2ZTC A;  4F4X A;  5M5W H;  5C4J B;  1Z9F A;  4HTH A;  2ICE C;  2UVW A;  1U4L A;  1MZB A;  2YZM A;  3BQ2 A;  5DLG A;  3KF6 A;  5IYZ F;  5HGT A;  4HAE A;  4L5R C;  3FEW X;  1D7Q A;  1D1I A;  1V1O A;  5L1L A;  4RCO A;  4A3M B;  1JWM D;  2K75 A;  1E22 A;  4NLG A;  2RVL A;  3NWT A;  3HOZ G;  2PNH A;  3BG3 A;  1LTL A;  4X64 H;  4I7H A;  3W5O A;  5DG8 A;  4YB8 B;  1YNJ C;  5DEH A;  3VYT A;  2DY7 A;  3PW0 A;  1PVO A;  3PVX A;  4FF3 A;  4DXF A;  5FPR A;  1F2M A;  1RF2 D;  3S1M B;  1DV2 A;  1AN8 A;  4HSP A;  4RU9 A;  3HGB A;  1N34 L;  3L7Z C;  3NUC A;  2XCL A;  3TBI B;  4KHV A;  3GQB A;  3HOX G;  2A69 D;  2YU9 A;  4GC6 A;  4XQN A;  2W9B B;  2C00 A;  3ONA B;  3Q6S A;  1GO3 E;  4DV7 H;  3GTQ H;  3M4Y A;  3GIM A;  2BDO A;  1I4R A;  1MBY A;  1B6R A;  1W6K A;  2QKI C;  3I8Z A;  5KKN B;  4HMJ A;  4OX9 Q;  4B08 A;  3GTM B;  1JE5 A;  4PZ8 A;  3N6X A;  1UC9 A;  1Y1V H;  1L0W A;  5KFS A;  2VUG A;  2UXB L;  3W1B A;  4QW9 A;  2NVY A;  1FVI A;  2J7Z A;  4G7O C;  3A8K E;  1I94 L;  2R93 G;  3T5H A;  4I55 F;  1XXG A;  3P75 A;  4PMC A;  4JI5 Q;  4IWX A;  1BCP B;  5DQG A;  4AH6 A;  2KSW A;  1SYG A;  3WNZ A;  4EQO A;  3GIQ A;  4IPH A;  3N41 B;  4BY1 B;  4BA2 I;  2DLN A;  2JA7 H;  3I72 A;  2K33 A;  2LMC B;  2E2H H;  3EA6 A;  3GIJ A;  1PTO B;  3R2T A;  2D9U A;  2H5X A;  4X3T A;  1EZ6 A;  2IWH A;  1E4E A;  2IL8 A;  2ZXO A;  4UHV A;  3RJ0 A;  2Z4H A;  3SGI A;  3SE0 A;  4X62 L;  2SEB D;  5I6Y A;  1KIX A;  2UUB Q;  1EZ8 A;  2D5D A;  2OQK A;  3S2D H;  3RZD B;  1AH9 A;  3GTO A;  3BDL A;  4CKC A;  2IPK D;  1SYB A;  2RSN A;  3RGX A;  3GTJ A;  2B2W C;  2UXB Q;  4KHZ A;  1PH7 A;  1T94 A;  2HDM A;  1AN7 A;  1QZH A;  2R8I A;  4MHE A;  5KFU A;  4QWB A;  5C3E B;  2PPB C;  3R23 A;  2G5D A;  1YNJ D;  1VQL A;  1UAP A;  3MR5 A;  4KTA A;  4LSA A;  4NP5 A;  4LFA H;  1JE4 A;  3ORR A;  2V5A A;  3K0Y A;  1G51 A;  2WAQ A;  4X62 H;  5KT3 A;  5ELE A;  3VR6 A;  2WFW A;  4JOI A;  1VQ6 A;  2J6S A;  2HQL A;  2JE6 I;  4WJ4 A;  5L1I A;  2R7Z A;  2PYK A;  2TSS A;  2LXK A;  4ULL A;  3CMA A;  3CRL C;  3KBG A;  4DR6 Q;  2W9C B;  4QY7 A;  3N43 B;  4LF4 Q;  2RHS B;  3GTK H;  4LF7 L;  4K5X A;  4NXN Q;  4A3E G;  2R7Z B;  3S17 H;  5CB4 F;  2M05 A;  4DNR B;  3TIG A;  3IRB A;  1KJ8 A;  2FFK B;  2F4V L;  1CQV A;  5IWA H;  4CDF C;  4JV1 A;  1U4R A;  5KT4 A;  4RNM A;  4DPG A;  4MA5 A;  2WAQ B;  1O7Z A;  2VPS A;  5JH7 F;  3CKI B;  4RNN A;  3CPW A;  5JJK A;  5KX5 F;  1TS2 A;  5KFJ A;  2KCM A;  2FPI B;  2VUM A;  1YZ6 A;  2W9A A;  5IYB H;  4LF9 L;  1KNA A;  1OXV A;  5IWA L;  2F4V H;  2IHF A;  2I07 B;  3A56 A;  1HR0 L;  1JB7 A;  5CAE B;  1HR0 W;  4YR3 A;  5H1S E;  4P72 A;  1KRS A;  1STN A;  1TWH A;  5DG9 A;  5LMN H;  1WJJ A;  1S40 A;  2R6F A;  5FLM G;  1ZET A;  1PYW D;  2GA4 B;  1IW7 D;  5FKA C;  2KEE A;  3RZO B;  2E2D C;  5FLM H;  2VQF Q;  4J6H A;  4JV0 A;  1MSH A;  3CCJ A;  4JV5 L;  3K3P A;  4CBV A;  2A68 C;  2XGT A;  1H9K A;  2B2T A;  5KYI A;  1PTO D;  2UUC Q;  5LL6 b;  3T5J A;  3KK7 A;  4YWK A;  1LUZ A;  3GTO H;  2Y0S G;  4KHP Q;  3M4O B;  3I4M B;  1NY4 A;  1PTO F;  1S5D D;  2YRX A;  4XQJ A;  4NPS A;  1WI5 A;  3ULJ A;  4ECW A;  4B3T H;  4ME6 A;  4H44 C;  4JV5 H;  2N78 A;  4J8Q A;  2KCT A;  3RUZ A;  4DR2 Q;  3VYU A;  5GAE C;  3A7L A;  4QUF A;  1CKO A;  5IYC H;  4J9S A;  3GTM A;  4GC7 A;  1EFI D;  1F9R A;  1TAE A;  1BUV T;  1Y1W H;  4J9P A;  3S17 B;  5EKL A;  4TKO B;  1KC8 C;  3X3M A;  2JEA I;  3HOY G;  4A3F H;  2JA6 B;  3QZ8 A;  3F8N A;  3FDS A;  4LF9 H;  4QJF A;  1KQS A;  2YZG A;  5JEA G;  2W8K A;  2R92 G;  2VS1 A;  3AB9 A;  5KFM A;  4DL6 A;  2CZG A;  2NN6 G;  2RQX A;  2UU9 Q;  3D31 A;  4HCS A;  3PO2 B;  1KL9 A;  4JI6 L;  1RYR A;  3VYS A;  5IGF A;  1E1T A;  2PMZ B;  1YHB A;  2BA0 A;  2F1M A;  4JI4 Q;  1TA8 A;  4RA8 A;  3I4N G;  2RCF A;  3GII A;  2V4Q A;  4F4Z A;  2R7D A;  2PZT A;  3I12 A;  4R9W A;  1O7I A;  5IE8 A;  2Q2I A;  3NBI A;  1FR3 A;  3U4Z A;  2HCI A;  1WVL A;  4OWW B;  4ZK9 B;  3HRZ C;  5FJ8 H;  3RUP A;  3RZD H;  2RHQ B;  1M0W A;  2X0S A;  3V4S A;  2G9D A;  2KOL A;  3T16 A;  3KYH C;  4FVM A;  1XDN A;  3OUU A;  3BQ0 A;  2J6U A;  5F2D A;  1U9R A;  1I6V C;  5E4W C;  3J81 i;  1S5B D;  4A4I A;  4YHH H;  1SAP A;  4MV4 A;  3CP0 A;  3KHG A;  5K36 H;  1CKN B;  2C2D A;  3NTH A;  5C0X G;  3CF5 A;  3I4M G;  3QZ7 A;  5LL6 S;  1ET6 A;  1EY4 A;  4QMG A;  4EG0 A;  1PTO C;  4LUZ A;  5EZY F;  4WRD A;  4A3J H;  1Q7Y C;  5DQH A;  4NXM Q;  3GO5 A;  4IJH A;  4UP7 A;  5G3L D;  1Z47 A;  4GNX C;  4GLA C;  3IG0 A;  2AGP A;  4AYB E;  4LF6 L;  3CCS A;  1EYG A;  4H0L C;  2XGQ A;  1J6Q A;  2UVR A;  1BXT A;  2K04 A;  1XPU A;  1Q8K A;  5FK9 C;  4PMW A;  1QOH A;  5G3L F;  2ATL A;  2V9W A;  4KN7 C;  2P5Z X;  3NTI A;  1PYS B;  2EPB A;  4IN3 A;  4F8M A;  1TQO A;  4Y7N B;  3RN5 A;  2JA7 B;  3GTM H;  2LS0 1;  1JDB B;  2W7O A;  2CQA A;  1PH3 A;  1S72 A;  2K5V A;  3D4D A;  1EY0 A;  1LAB A;  1A2U A;  3H20 A;  3AQQ A;  3T1H L;  5KFL A;  4M8A A;  3MXG A;  4FXG C;  5JVH 3;  1AUV A;  4PQX A;  2G9H D;  2SNM A;  1STA A;  1SSO A;  3V2T A;  3KAJ A;  3DM3 A;  3H3V I;  5DGA A;  2EXD A;  1FGB D;  3UDX A;  1B6S A;  3WWV A;  1NR4 A;  1OXS C;  2QYZ A;  1HA6 A;  1PRT F;  3S1R B;  3BA9 A;  5EPL A;  5FPO A;  1XMQ H;  2DZD A;  3U9T A;  5M3M G;  3TRE A;  2B29 A;  1EWH A;  1R4P B;  2XNA C;  3X3N A;  4DV4 Q;  1MSG A;  2B2V C;  5KT7 A;  3EPG A;  2HUG A;  3N52 A;  5IGC A;  3FVQ A;  4LK1 C;  4AIM A;  1JQY D;  4JK1 C;  4K2K A;  2ZJQ A;  1GSA A;  5C4H A;  1JCK B;  3PIO A;  4LF6 H;  2RDI A;  2ALZ A;  4YAJ B;  2VA3 A;  3EVQ A;  1DGS A;  2F0N A;  4KK7 A;  4DAY A;  2W6Z A;  5FD5 A;  2OTJ A;  1CM9 A;  3JRX A;  1O75 A;  2F0J A;  2XN9 C;  1WH2 A;  1FNW A;  5KG6 A;  3JZI A;  1ML0 D;  4LW1 A;  2R7L A;  4OIJ A;  4U67 3;  4CJ1 B;  3N42 B;  2YV5 A;  4JG2 A;  1HQR D;  4NB3 A;  4JI3 Q;  3WOF A;  1X56 A;  5LMN W;  4XYM B;  1M7J A;  1D5Z C;  2FLL A;  1T9H A;  2BE5 D;  1K1Q A;  2FPP B;  1XMO H;  5IIF A;  4X6A H;  2VW9 A;  2F3V A;  5FO8 B;  1A9X A;  5JJI A;  1KEE A;  4YHH Q;  3NEL A;  1SJE D;  5IY0 A;  5HGQ A;  1EWI A;  4IAL A;  4ZAI A;  2RDH A;  2R92 H;  2B8G A;  1S10 A;  4LF5 L;  2CW0 C;  4ALP A;  3I3C A;  3TS0 A;  3K80 C;  2O03 A;  2SDF A;  4DV1 Q;  3GTL H;  1F77 A;  5CV9 A;  4JW0 A;  1K8M A;  3SK5 A;  1EY5 A;  1KLU D;  5JJZ A;  2QEX A;  3HXL A;  4DV5 Q;  1SNM A;  3VMM A;  2Z8L A;  4DR3 Q;  2Q2U A;  1ASZ A;  1ZEQ X;  1EUJ A;  2E2H B;  2C2E A;  3EQL C;  4G4K A;  4C2M H;  1EY9 A;  2W6N A;  3J7Y W;  1V51 A;  4GS3 A;  3KF6 B;  4O2D A;  3T51 B;  2UUB L;  1XPR A;  1VQD A;  1A0I A;  5A2Q W;  3U9O A;  1HCZ A;  3H15 A;  2VQD A;  3UFX B;  3TIN A;  1UE7 A;  4YJ3 F;  1KAB A;  3HS0 C;  3KBX A;  1ILP A;  3F2C A;  4LFA L;  1BQQ T;  4M9U A;  1PFM A;  2N3S A;  3J80 L;  3PUZ A;  4XTC S;  1XMO L;  4DR2 H;  4HQ6 A;  4JV5 Q;  4X65 H;  1RTO A;  4MZ9 A;  3VPC A;  5C5J A;  3HKZ A;  4IFD H;  1OXX K;  1UEB A;  4JBK A;  2MJ8 A;  1IBL Q;  4JCV E;  2C9O A;  3KLS X;  2FMC A;  2HVS A;  1QIL A;  3NP8 A;  4O3S A;  4DAM A;  4DV6 L;  2ZDG A;  3R5H A;  3IN5 A;  1IYV A;  4YJ2 F;  2CCZ A;  1JT8 A;  1VQO A;  1B50 A;  3BDO A;  4BWG B;  1WTR A;  4QCL A;  4ZLT F;  3JSN A;  2A69 C;  2IMW P;  3M4O H;  1WCM A;  2JA5 B;  1L1O A;  2HJW A;  4IQZ A;  4ZYS A;  4K6L A;  3DM1 A;  2E5L Q;  4U68 A;  1C7Y A;  1DIK A;  2ZXP A;  1PX2 A;  4E6I A;  3MXU A;  3RR5 A;  4EBD A;  1CSQ A;  1IYU A;  3UDG A;  2F4V Q;  4A3C H;  5A35 A;  1N32 H;  3Q1K A;  1HJP A;  4FS2 A;  2UXC H;  1QNU A;  2NU9 B;  1KDB A;  3ITP A;  5FOB B;  4IOC A;  3BG5 A;  1TWF H;  1LTS D;  2ZJR A;  2Z0S A;  3GV3 A;  3TP8 A;  4LF6 Q;  4XQQ A;  4YCV A;  4JC0 A;  4Y8V B;  3UQ8 A;  3NGD A;  1DM0 B;  2RKS A;  1ONL A;  2F0Q A;  3HOZ H;  2RBM A;  4UCR A;  4OGQ C;  4TSS A;  1RYS A;  3A5Z B;  3BVM A;  4BY7 B;  4UCO A;  3PUW A;  2AWO A;  2L15 A;  1U0L A;  2BH2 A;  1N36 L;  5IT9 c;  4X62 Q;  4EGJ A;  3U4V A;  4RH6 A;  4JVZ A; 
#chains in the Genus database with same CATH homology
 1SLJ A;  4BXX H;  1GVP A;  1A8V A;  2F52 A;  4IPC A;  4HJ7 A;  1I5F A;  4IPD A;  1N36 Q;  1G6P A;  3ULL A;  1IBM L;  3Q8D A;  1HNX Q;  4FDB A;  4XIG S;  4DKA C;  1XMO Q;  1VQ8 A;  3NEN A;  2ZTC A;  3OW2 A;  1YBY A;  4DK6 C;  3HKS A;  1OTC A;  1N32 L;  1AE3 A;  5M5W H;  5K36 G;  1Z9F A;  3BU2 A;  4P71 A;  2C35 B;  2JA5 G;  4OX9 L;  3KF6 A;  1V9P A;  2WAQ E;  4L5R C;  2OTL A;  3K81 C;  1PH5 A;  3M3Y H;  3CXC A;  3I4M H;  3M9B A;  1YNX A;  1Y1V G;  2PQA A;  1D7Q A;  1Q1E A;  4JI6 Q;  5C44 H;  2K75 A;  1E22 A;  3CQZ H;  2YYZ A;  4DR7 Q;  3HOZ G;  2OQ0 A;  2PNH A;  5IP9 G;  1LTL A;  2QA4 A;  4GKJ Q;  5C44 G;  3W5O A;  2AMC B;  5GAD C;  3CCR A;  1SE8 A;  4HIM A;  2R6G A;  1PVO A;  3CD6 A;  4GNX B;  4JI0 Q;  2JA7 G;  4C3H H;  1PH6 A;  1XNR L;  4DR3 L;  1VQK A;  5FJ8 G;  1XNR Q;  4JI0 L;  3AFQ A;  1VQH A;  1N34 L;  3L7Z C;  2YTV A;  2E8G A;  4J15 A;  3HOX G;  3PF4 A;  5IYD G;  3M85 A;  4GLX A;  3T1H Q;  2IHE A;  3A5U A;  3PCO B;  4GKJ L;  1GO3 E;  3GTQ H;  1MJC A;  2E5L L;  4A93 H;  1YI2 A;  1N34 Q;  1XMQ Q;  2MO1 A;  4YY3 L;  4A3C G;  3CW2 C;  3PUV A;  4JBM A;  3JAM c;  2NVY H;  1OXU A;  4OX9 Q;  2I5H A;  2A8V A;  2E2I H;  1JE5 A;  1VQ5 A;  4PZ8 A;  4A75 A;  1LM0 A;  1HNZ Q;  1JMC A;  1Y1V H;  1L0W A;  2UXB L;  3W1B A;  1PFS A;  1V1Q A;  1N9W A;  2YTY A;  1FVI A;  3S15 H;  2HIV A;  3CAM A;  1KXL A;  5DLQ E;  1I94 L;  4JI3 Q;  1MKH A;  1IBK L;  2R93 G;  2E2J H;  2Y0S E;  1J5E Q;  4JI5 Q;  4JBJ A;  3UE0 A;  2IY5 B;  4BA1 I;  3U50 C;  3FHW A;  2GVA A;  1XNQ Q;  4AH6 A;  4DR6 L;  2R7Z G;  4LF8 Q;  1IL2 A;  4LUV A;  1FGU A;  2MO0 A;  4IPH A;  5C4X H;  1WOC A;  3I56 A;  3G4S A;  2V1C C;  4JI7 Q;  4BA2 I;  3E0E A;  3HOX H;  2JA7 H;  4H02 A;  3U58 A;  4OWX B;  1E24 A;  3JC6 6;  3S1R H;  4BY7 G;  2UXC L;  4R4I A;  4OWT B;  3W1G A;  2E2H H;  2JA6 G;  1K8G A;  1RIP A;  2H5X A;  4JI4 L;  3M4P A;  3PO3 G;  2KHJ A;  4MNO A;  1BBW A;  3SGI A;  4X62 L;  1W2B A;  3PO3 H;  1N8R C;  5FLX c;  1KIX A;  2UUB Q;  4IJL A;  2VUM H;  4LFB L;  2OQK A;  3S2D H;  1AH9 A;  2UU9 L;  1NMF A;  4HJ9 A;  1L2F A;  3I55 A;  1E1O A;  2VUM G;  2GVB A;  1PHJ A;  3EBE A;  4KHZ A;  1PH7 A;  2IX0 A;  2UXB Q;  3LGJ A;  1QZH A;  4GKK Q;  3J80 c;  4DNI A;  3RLF A;  1Y1W G;  1SN8 A;  2JA9 A;  4PZ7 A;  1VQL A;  4GLV B;  1HZC A;  5IYB G;  4OXP A;  3GTP H;  4Y7N H;  2VQE L;  4YY3 Q;  5M3M H;  4LF4 L;  2KHI A;  4P74 A;  1GM5 A;  1G51 A;  4C3I H;  2ZM6 Q;  2HHH Q;  4L5S A;  4A3D G;  2WFW A;  4JOI A;  1VQ6 A;  2JE6 I;  2HQL A;  4WJ4 A;  3M7N A;  3CMA A;  4DR6 Q;  2LXK A;  5J3B A;  2K4K A;  4A3D H;  1YHQ A;  4QY7 A;  4LF4 Q;  2RHS B;  3GTK H;  1GD7 A;  4LF7 L;  4NXN Q;  4A3E G;  3S17 H;  1QVC A;  5GAH C;  2JJQ A;  4RG1 A;  4KHP L;  4OO1 G;  5C0X J;  3IRB A;  3STB D;  4X65 Q;  2F4V L;  3HOV G;  4OO1 I;  3KFU A;  4P73 A;  1YVC A;  4DR5 L;  2AKW B;  1U5K A;  2VL6 A;  3KOJ A;  4DPG A;  4A76 A;  1VQN A;  2ZTE A;  4LWC A;  3HOV H;  3KF8 B;  1G29 1;  2WB1 E;  1VQP A;  4A93 G;  4NXM L;  4UP8 A;  3CPW A;  5JJK A;  1IBL L;  2KCM A;  5M3F G;  1YZ6 A;  2I5L X;  4K0K Q;  1HZB A;  5IYB H;  4AQY L;  4LF9 L;  4B3S L;  2RCN A;  1I50 H;  2EQS A;  1OXV A;  5IWA L;  1JJG A;  3S24 A;  2IHF A;  1MJE A;  1HR0 L;  1YIJ A;  2F3I A;  1JB7 A;  2Z6K A;  4JI7 L;  1HR0 W;  1HH2 P;  5IWA Q;  4EQ5 A;  5H1S E;  4P72 A;  1KRS A;  1PH8 A;  1EIF A;  4UPA A;  1KRT A;  2VQF L;  4AQY Q;  4BBS H;  1W3S A;  4GN5 A;  3RN2 A;  1SR3 A;  1WJJ A;  2A19 A;  4HID A;  4A3M G;  3RLN A;  5FLM G;  4A3F G;  1VQF A;  1X9N A;  1S40 A;  2K50 A;  4R1J A;  3CME A;  4GN3 B;  4OON A;  1H95 A;  1TWH H;  5FLM H;  2VQF Q;  1TWC H;  3D0F A;  1HNW L;  1YJ9 A;  1YJN A;  3CCJ A;  2LSS A;  4DUZ Q;  4JV5 L;  4DV7 L;  2XGT A;  1PV4 A;  2UUC Q;  1N33 L;  4DR5 Q;  1VQB A;  4A3L G;  4YWK A;  1VQC A;  1LUZ A;  4LFA Q;  1C0A A;  2K5H A;  3GTO H;  3PGZ A;  2MNA A;  2Y0S G;  1PYB A;  2R7F A;  3MEF A;  1EOV A;  4KHP Q;  1R9T H;  1Q82 C;  5C3E G;  1NY4 A;  3UDI A;  4NXN L;  4A3I G;  3PF5 A;  4NPS A;  4LF7 Q;  1WI5 A;  5LMN Q;  1UE5 A;  3ULJ A;  4UY8 C;  1SMX A;  4BXX G;  2PI2 E;  4IO9 A;  1V43 A;  2N78 A;  4POF A;  2EIF A;  3CCL A;  4QL5 A;  2KCT A;  4R4T A;  5BR8 Q;  4DR2 Q;  3H3V H;  2HHH L;  2MQH A;  5GAE C;  1NBW A;  2N49 A;  4BBR H;  1CKO A;  5IYC H;  5M3F H;  1VS0 A;  5JEA J;  1Y14 B;  1Y1W H;  4JYA Q;  1NE3 A;  2CWA A;  4R4Q A;  1KC8 C;  4A3B H;  2YU9 H;  1QUQ B;  3E9I A;  2JEA I;  3KDF B;  4A3F H;  3HOY G;  4IFD G;  3G6E A;  4QJF A;  2CWP A;  3UDF A;  1VQM A;  1KQS A;  5JEA G;  5C4J H;  2BH8 A;  2NVQ H;  2VS1 A;  1TWG H;  2R92 G;  2WB1 G;  5LMU L;  2NN6 G;  2UU9 Q;  2Z6K C;  3D31 A;  2RF4 A;  4JI3 L;  4HJ5 A;  3S14 H;  2ZM6 L;  3RZO H;  1BVS A;  1KD1 C;  1KL9 A;  4JI6 L;  2LXJ A;  4C3J H;  4B3R L;  2NVT H;  1E1T A;  5IP7 H;  3BJU A;  1YHB A;  2BA0 A;  4JI4 Q;  4YCW A;  3I4N G;  3J7A 5;  5IP7 G;  1CKN A;  3CCM A;  4GKK L;  2K14 A;  2R7D A;  3CPF A;  4JI2 L;  4A3L H;  2NZH A;  3GDE A;  1O7I A;  2UUC L;  3OTO Q;  5IE8 A;  1EIY B;  3F2B A;  3B6Y A;  2Q2I A;  2OCE A;  5GAG C;  3U4Z A;  1EQQ A;  4POG A;  4LFB Q;  4OWW B;  1HZA A;  1X54 A;  5FJ8 H;  3RZD H;  2RHQ B;  1XNQ L;  3AEV A;  3KYH C;  1FL0 A;  4IPG A;  2IT1 A;  3J81 i;  4X66 Q;  2AHO B;  1K3R A;  4A4I A;  4GOP B;  2WP8 J;  4DV2 Q;  2JQO A;  3CP0 A;  1I94 Q;  3K7U C;  1CKN B;  1HR0 Q;  1OXT A;  3PUX A;  4GNX A;  3CC4 A;  2OWO A;  3ERS X;  4YCU A;  4B3S Q;  5HY6 A;  5C0X G;  2K5N A;  1BBU A;  4GN4 B;  3CF5 A;  3I4M G;  2WAQ G;  4JBW A;  3TEH B;  3ULP A;  5C0X I;  4LUZ A;  1Q7Y C;  4A3J H;  2JA5 H;  4JI5 L;  4B3R Q;  2ATW A;  1J5E L;  4NXM Q;  3GO5 A;  4IJH A;  4UP7 A;  4GNX C;  1Z47 A;  2KBN A;  4GLA C;  1M1K C;  1IBK Q;  4AYB E;  4LF6 L;  3CCS A;  1EYG A;  2UXD L;  2ZJP A;  4X64 Q;  3NBH B;  2PMZ E;  4DV4 L;  4P75 A;  4GOP A;  1J6Q A;  4R4O A;  2NVX H;  1XPU A;  1Q8K A;  1K83 H;  3ZJY C;  3GTG H;  4YWL A;  4PMW A;  1P16 A;  3RLO A;  5AJ3 Q;  1Q1B A;  1X6O A;  2JA8 H;  3HOU G;  3ICE A;  3VDY A;  3S1M H;  2Q2T A;  1VQA A;  3G71 A;  1PYS B;  1VQ9 A;  4LNQ A;  3K8A A;  3RN5 A;  3BZK A;  4R4C A;  3HOU H;  3GTM H;  3TS2 A;  2JEB I;  3HFZ B;  1PH3 A;  1S72 A;  2K5V A;  4JI8 Q;  2AWN A;  2K52 A;  4EX5 A;  3JAM i;  2B3G A;  4TQU S;  3AQQ A;  1WCM G;  2CQO A;  4DV1 L;  4HJ8 A;  3T1H L;  4UP9 A;  4B3M L;  4JI8 L;  4HIK A;  1YJW A;  4DR7 L;  3T1Y L;  3STB C;  3DM3 A;  3H3V I;  1B7Y B;  2EXD A;  3UDX A;  3WWV A;  1OXS C;  4YHH L;  1LYL A;  4MTN A;  4A3J G;  2A1A A;  1L1O B;  1B70 B;  5AJ3 L;  1A62 A;  4DR4 Q;  3KJO A;  1L1O C;  5M3M G;  4DV3 L;  4DV7 Q;  3TRE A;  2B29 A;  3GD7 A;  4X64 L;  3J81 j;  4DV4 Q;  1YHA A;  1HNW Q;  1Q81 C;  4X66 L;  4AIM A;  5GRO A;  1SFO H;  3F1Z A;  1KAW A;  2ZJQ A;  3CCV A;  3OYY A;  3S1Q H;  4L5Q A;  1VCI A;  4A3E H;  2HT1 A;  4Y52 H;  3EIV A;  3PIO A;  2I0Q A;  2UUA L;  1DGS A;  3EN2 A;  4ME3 A;  1CKM A;  1X3F A;  3S2H H;  1RL2 A;  3OTO L;  1M90 C;  2JA8 G;  2OTJ A;  1HNX L;  2D0O A;  1IYJ B;  1E7Z A;  3CCQ A;  4LF9 Q;  2UUA Q;  4DAY B;  5C3E H;  2YTX A;  1SRU A;  1PA6 A;  3PO2 G;  4LW1 A;  5IYD H;  2ZTD A;  3CCE A;  3CC7 A;  3E9H A;  1BKB A;  3PO2 H;  2YV5 A;  4LFC L;  4JG2 A;  2Q2H A;  4NB3 A;  3A74 A;  1PH1 A;  1X56 A;  4KI0 A;  1JJC B;  2XTI A;  5LMN W;  4DV3 Q;  1PH9 A;  4IOA A;  1T9H A;  3ER0 A;  1SRO A;  1X3E A;  4DR4 L;  3PV0 A;  4JI2 Q;  1EQR A;  4X6A H;  2ID0 A;  4X65 L;  2VW9 A;  1HNZ L;  1P8L A;  1PH2 A;  2JK8 A;  2B63 H;  5JJI A;  4O0A A;  1YEZ A;  5M5X H;  3NEL A;  3AFP A;  4YHH Q;  2D62 A;  3GTJ H;  2R93 H;  5IY0 A;  3PUY A;  5HGQ A;  1EWI A;  1UWV A;  4LUO A;  1UE6 A;  2R92 H;  3HKZ G;  4DUY L;  4LF5 L;  4ALP A;  3HKZ E;  1ASY A;  3TS0 A;  3K80 C;  3J81 c;  1VQG A;  4DV1 Q;  1EFW A;  5ELN A;  1WFQ A;  3GTL H;  4LF5 Q;  3KLW A;  2QEX A;  5LMN L;  4A3M H;  4DV5 Q;  1Q86 C;  2N8N A;  4DR1 Q;  2HIX A;  4PZ6 A;  2VQE Q;  4GOP C;  1VQ4 A;  2R7Z H;  3RNU A;  4DR3 Q;  2Q2U A;  1ASZ A;  1E3P A;  5C4X G;  1EUJ A;  4JOI C;  1AE2 A;  2BA1 A;  4C2M H;  4PG3 A;  2NZO A;  1X65 A;  2PQA B;  3I4O A;  5BR8 L;  4A3I H;  1JJ2 A;  1XJV A;  4GS3 A;  1XTD A;  3KF6 B;  4O2D A;  5EAY A;  4LFC Q;  2UUB L;  1XPR A;  2UXD Q;  1VQD A;  1NTG A;  1A0I A;  1X55 A;  3H15 A;  3H0G G;  1UE7 A;  5GQO A;  3MXN B;  1NMG A;  1GKH A;  1IZ6 A;  2UXC Q;  4B3T L;  3F8T A;  3F2C A;  4HJA A;  1NJI C;  4AYB G;  4LFA L;  4JI1 L;  4A3B G;  2N3S A;  3HOY H;  4DV0 L;  1FJG L;  1N32 Q;  3PUZ A;  4XTC S;  1XMO L;  4BBS G;  4DV0 Q;  4BBR G;  1FJG Q;  4JI1 Q;  4JV5 Q;  1IBM Q;  4B3T Q;  3G48 A;  4MZ9 A;  4K0K L;  1UE1 A;  4DV6 Q;  1OXX K;  1UEB A;  4JBK A;  3K0X A;  4A3G H;  3J7Z C;  1IBL Q;  4JCV E;  2ASB A;  3CC2 A;  1VQI A;  3FKI H;  2IX1 A;  1TWA H;  4QQB X;  4DAM A;  4DV6 L;  2MFI A;  3HOW H;  3FKI G;  2GN5 A;  2CCZ A;  2VY3 A;  3I4N H;  1VQO A;  1JT8 A;  1MIU A;  3HOW G;  2ALY B;  3J80 i;  1KHI A;  2D0P A;  4IFD I;  1X3G A;  1QVF A;  3TRZ A;  4A3K G;  2PI2 A;  1VQ7 A;  5JJL A;  1K73 C;  3M4O H;  1A63 A;  2DUD A;  4YWM A;  1L1O A;  3H0G H;  4DR1 L;  1XMQ L;  2VNU D;  3T1Y Q;  1IXR A;  2VZA A;  1CSP A;  3F2D A;  3M4Q A;  1QVG A;  1WCM H;  1C7Y A;  2E5L Q;  3RR5 A;  5LMU Q;  1CSQ A;  1C9O A;  2FXQ A;  5IYC G;  4B3M Q;  3K7A H;  2NN6 I;  4QIW E;  1XPO A;  4RMF A;  3S16 H;  4DUY Q;  3FP9 A;  4APV A;  3UDG A;  2F4V Q;  4A3C H;  1HJP A;  3TQY A;  2B63 G;  3A0J A;  4DK3 C;  4JYA L;  3PSI A;  1VQJ A;  4IOC A;  1D8L A;  1HZ9 A;  1TXY A;  1WYD A;  4L5T A;  4DV5 L;  4KLK A;  3KDF A;  1TWF H;  4DR2 L;  1YIT A;  4IFD J;  1B8A A;  3AYH B;  2CFM A;  5E7N A;  2ZJR A;  2Z0S A;  2ES2 A;  4LF6 Q;  3L0O A;  4A3G G;  5ELO A;  1I3Q H;  1VQE A;  1I6H H;  5M5Y H;  1S3O A;  4YCV A;  4JC0 A;  3L2P A;  1K8A C;  3CCU A;  3KJP A;  1QZG A;  1Q12 A;  3DLL A;  4A3K H;  1K9M C;  3S1N H;  3HOZ H;  2DGY A;  5IP9 H;  1Q46 A;  4BY1 G;  3PIP A;  1N33 Q;  3A5Z B;  4WJ3 M;  3PUW A;  2AWO A;  4BY1 H;  2L15 A;  4BY7 H;  4DUZ L;  1K0R A;  3I2Z A;  1U0L A;  4DV2 L;  2BH2 A;  1N36 L;  2JA6 H;  5IT9 c;  2QGQ A;  2KEN A;  4X62 Q;  3BZC A;  4LF8 L;  1CUK A;  3I7F A;  4TVA B;  2I5M X;  4QGU A;  4HIO A;  1QUQ A;  3U4V A;  3NEM A;  2CKZ B;  1PH4 A;  3UE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...