4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
3M4QA 2OWOA 4JI4Q 1JJCB 4AIMA 1UE5A 4NXNL 1VQFA 5IP9H 4GN4B 4A76A 1HNZL 2JA5H 1LM0A 3PF4A 4YWKA 3AYHB 1SLJA 1VQHA 1IBKQ 2VUMG 4Y52H 1CKNB 3PIPA 2CCZA 4LF5L 4BY1H 4DR3L 3I7FA 5FJ8H 4GNXA 4DAMA 4DR2L 3HOVH 4P74A 1I94L 3CC2A 4GLAC 4DR7Q 2R93H 1T9HA 2GVBA 4JBWA 2K50A 3CPFA 3ERSX 1FJGL 5AJ3Q 4JI7Q 4HJ9A 2PI2A 5FLMH 1S72A 2YTVA 4DKAC 3HOYH 3TRZA 1NMFA 3J81i 3AFPA 1V1QA 1JJ2A 3CCJA 4GKKQ 3G48A 3CXCA 1K3RA 4KHPQ 3FHWA 4QL5A 1CKOA 3KOJA 4K0KL 3UDFA 4LFCQ 3PF5A 4LUZA 2BA0A 2OTLA 1P8LA 4JI0L 5M3FG 4B3MQ 3ER0A 3CD6A 1YZ6A 5JJKA 3KLWA 5IYCH 1Z47A 2Z0SA 1BBWA 2UU9L 3HKSA 1PH2A 1D8LA 2HT1A 3F2CA 2E5LL 1RIPA 1Q1EA 5JJIA 5J3BA 1KC8C 4QQBX 1JT8A 2ES2A 2OQKA 1Y1VH 4LF4L 2JA7G 3U50C 3E9HA 2PNHA 2HIXA 1VQJA 1V9PA 4GKJL 2WAQG 1YIJA 1K73C 2XTIA 1HNXL 4LFBQ 1PH6A 1HZBA 3S14H 4LFAL 3CPWA 2KBNA 1TWCH 3DM3A 4GOPB 3RR5A 2JA6G 4A3BH 2NVXH 2BA1A 3GTOH 3JAMi 2A1AA 4A3GH 2AHOB 1VQNA 1KL9A 3VDYA 4A3KH 4X65L 1HZ9A 2UUCQ 4RG1A 4JI3L 3ULJA 1XNQL 2EXDA 3PO2G 2JA8H 1PH1A 3CAMA 4DR4L 2AWNA 2N8NA 4YY3L 4OXPA 3J80i 3K0XA 2NVTH 5M3MG 2B63H 3S2DH 4A3LG 1JMCA 4WJ3M 1WCMH 1Q1BA 1AE3A 1CKNA 2OCEA 4R4OA 4DV4Q 3RZDH 2WB1E 2JA8G 1JB7A 4MNOA 2KHJA 1E1TA 4LNQA 2JQOA 1JE5A 4P71A 3RLNA 3A74A 5K36G 4LF8Q 1QVGA 1PH4A 4JG2A 3W1GA 3I4MG 3TS0A 1I3QH 2NVYH 3G6EA 3CCRA 1N34Q 4NXMQ 3CF5A 4QY7A 2UUBQ 4AYBE 2JK8A 3K7AH 4L5QA 3J7A5 2Q2IA 1Q82C 4DV2L 1XNRQ 4LUOA 4A3GG 3PV0A 4JOIA 2YTYA 3BU2A 1YJNA 1XMOQ 2N3SA 1XPRA 2CQOA 3CCSA 1EIFA 1WJJA 4DV7Q 2UXDL 2RCNA 4LF7L 2JEAI 2QGQA 4IO9A 1IBMQ 3UDGA 1C9OA 4JI8L 5IP7H 2PI2E 1S40A 1YJWA 1VQOA 4GNXC 2AMCB 1VQDA 3PUVA 4DV7L 4B3RL 4HIKA 4JBJA 1I50H 1BBUA 3H15A 1YBYA 3K8AA 3G71A 1PH5A 5IP7G 1W2BA 4X62Q 2I5MX 2LXJA 4YCWA 3OTOL 4LW1A 3MEFA 2GVAA 2YV5A 4IPDA 4NXML 4TQUS 1HR0L 2K5VA 5BR8Q 2ZTDA 3B6YA 3PGZA 3CCLA 4GOPC 2F3IA 2VL6A 4BA1I 4A3DH 3BZCA 1CKMA 1PH9A 4AYBG 5FLMG 1XPOA 3PO2H 5JEAJ 1HR0Q 3GTJH 4BBSG 4PMWA 4L5RC 1KRTA 1X9NA 3OTOQ 1VQIA 1X54A 1QVFA 4X62L 1FVIA 3I4NH 4AQYQ 2V1CC 4XTCS 3L7ZC 3U4VA 1H95A 3CMAA 3S1RH 1IYJB 4YY3Q 3U58A 2VUMH 4DR4Q 3T1YL 3GTGH 4HJ7A 3OYYA 3NBHB 2CWPA 4JI3Q 2NN6G 2ZTEA 1UE6A 2A8VA 5C3EG 2Q2HA 3J81j 3HOWH 5GAHC 1QZHA 1GO3E 2IT1A 4P73A 1IBML 4IOAA 1N8RC 1Y1VG 4YWLA 3K80C 4LF7Q 4A3FG 3DLLA 3GTKH 4MTNA 1PA6A 1YITA 1PH3A 3HOXH 2YU9H 3FKIH 1UE7A 2ZM6L 1XMOL 1C7YA 3GTMH 3PCOB 1PH7A 1D7QA 4DV2Q 1XNRL 3NELA 1VQPA 5IWAQ 1EIYB 1OXUA 1RL2A 4OO1G 4UP8A 3CCVA 1A62A 3HOUH 3RZOH 1A63A 1N34L 1NE3A 3GD7A 1B8AA 1VQBA 1PYBA 3S1NH 1TXYA 5FLXc 3A5ZB 3F2BA 1YNXA 3CMEA 3I4MH 1U5KA 1U0LA 1VS0A 4JYAL 4GOPA 1KRSA 2B3GA 4ME3A 2I0QA 1O7IA 4Y7NH 4B3ML 4B3SQ 2JA7H 2JA9A 3M4OH 1KD1C 3H3VH 2ATWA 1BKBA 1CSQA 3ZJYC 4IOCA 4LF9Q 4HJ8A 2R7ZH 1YVCA 1SMXA 3NENA 3RLOA 4X66L 1L2FA 5H1SE 3KJOA 4BXXG 1VQAA 3KF8B 5M3FH 1P16A 4IPGA 4C3HH 5FJ8G 2UUCL 1Q8KA 4IJLA 1Q81C 2LSSA 1FJGQ 3PO3G 1LYLA 3HKZG 3BZKA 2F4VL 1Q7YC 3I4NG 1PV4A 2F4VQ 3CC7A 3CCMA 4LF5Q 4HIDA 1EYGA 1ASZA 4HJ5A 4WJ4A 1L1OA 1IBKL 2UUAL 2VS1A 5C0XJ 2B29A 1CSPA 4X66Q 4IPCA 4DAYB 4LFBL 4R4IA 1QZGA 4LF9L 4JI4L 3I55A 1PH8A 3S24A 4GNXB 4LF4Q 1N33L 2BH2A 1OXSC 2E5LQ 2MO1A 4B3SL 1HZCA 3HOZH 1NBWA 2QA4A 3S2HH 1KXLA 5HY6A 1KQSA 1R9TH 3M3YH 1UWVA 2AWOA 5GROA 1YJ9A 4JI0Q 2IX1A 2AKWB 4UP9A 1N33Q 1Y14B 3E0EA 1Q46A 4KHPL 1B7YB 4C3IH 1I5FA 1A8VA 3W5OA 5IWAL 4GKKL 1V43A 3KF6B 1EOVA 1BVSA 3CQZH 1AH9A 2A19A 3CCQA 3UDIA 4UPAA 4A3EG 2UUAQ 2ID0A 3EN2A 4IFDG 2MQHA 5AJ3L 4JI7L 2VQEL 2JA5G 1PYSB 4UP7A 1HH2P 3J80c 3GTPH 1PFSA 3S17H 2E2HH 4OWXB 4DR2Q 2UXCQ 4R1JA 4BY1G 1ASYA 2GN5A 2WFWA 5GQOA 3M85A 2ZJRA 2R93G 1HJPA 1Y1WH 1E3PA 3PO3H 1E24A 1VQKA 3JAMc 4NXNQ 2MNAA 4AQYL 4OWWB 3KYHC 1A0IA 1EQQA 1VQ9A 3TS2A 5C0XG 5IE8A 4A75A 1IZ6A 4J15A 5IP9G 1CUKA 3I4OA 1KHIA 1J6QA 3PIOA 4R4CA 4B3TQ 4JYAQ 4X6AH 3M4PA 5GAGC 2YTXA 2VQFL 4A3MG 4JI5L 5LMNW 2FXQA 2R92G 1VQMA 2D0PA 2Z6KC 1EFWA 5LMUL 5IYBH 1M90C 4IFDI 4OX9Q 4DV5L 1MIUA 3GDEA 1TWGH 3GO5A 4TVAB 4A3MH 2F52A 1LTLA 3HKZE 5M5XH 4A3IG 4DPGA 1MJEA 3HOYG 1N32Q 2ZM6Q 1YHBA 3JC66 1X56A 3HOZG 4A3LH 3UDXA 2Y0SE 3UE0A 4B3RQ 3M7NA 4DR1Q 4KHZA 3H0GG 1XTDA 4POGA 4LUVA 4A93H 1SE8A 2NZOA 4MZ9A 4GN3B 4IFDJ 1NTGA 4JC0A 4A3FH 2Z6KA 3PUWA 1DGSA 2Q2UA 3HOWG 3PUXA 2UXDQ 4IJHA 3S15H 4DR6Q 3T1YQ 3G4SA 2WB1G 1PVOA 1HNWL 1XJVA 5LMNL 2K14A 1L1OC 2NN6I 2KENA 4RMFA 4DUYQ 4FDBA 3TEHB 5C44G 1X3EA 3TREA 1S3OA 2N78A 5C4JH 2HIVA 3NEMA 2ASBA 1SN8A 5ELOA 4NPSA 4DV1L 2ZJPA 1GM5A 2IHEA 1NMGA 3FP9A 3STBD 3RN2A 4JCVE 3STBC 1N36Q 2WAQE 1K83H 1E7ZA 2R7DA 2RHSB 5BR8L 3J81c 2CWAA 4A3DG 4JI6L 1SRUA 3F1ZA 4YHHL 4DUZL 1YEZA 3MXNB 2K4KA 2QEXA 3HOVG 1FL0A 1GKHA 3S1MH 3ULLA 1J5EL 2IHFA 2PQAB 3UE1A 4DV0Q 1EWIA 2C35B 1XMQQ 1VQ7A 3H3VI 1SFOH 1NJIC 1L1OB 2E8GA 1OTCA 3RNUA 3K7UC 1YI2A 4LF6L 2OTJA 1UE1A 2KCTA 3M9BA 3PUYA 4QGUA 4POFA 3ULPA 2R92H 1OXXK 1AE2A 1VQEA 2D0OA 4JI8Q 1X55A 4R4TA 4A3CH 2XGTA 1YHAA 4NB3A 1K0RA 3CC4A 1E1OA 4HIMA 4JV5Q 3CCUA 4LFAQ 3U4ZA 1L0WA 5M5YH 3F2DA 4PZ6A 4DK6C 2H5XA 5DLQE 4DNIA 4H02A 1GVPA 4GKJQ 4BXXH 3HFZB 4GLXA 4PZ8A 2UUBL 3PSIA 1IL2A 1G291 1QUQA 4KLKA 4LF8L 4DR5L 1VCIA 1VQ8A 2NVQH 3J7ZC 3A5UA 4JBMA 1B70B 3Q8DA 4HIOA 1KAWA 2OQ0A 4DV4L 3E9IA 4EQ5A 4LFCL 5IYDH 4BBSH 1TWFH 4R4QA 3TQYA 2EIFA 2K75A 2NZHA 2DUDA 4A3EH 1K9MC 4BBRG 3CP0A 5IYCG 1X6OA 1WI5A 2HHHL 4LF6Q 5C0XI 1IXRA 4DV3L 1PHJA 2CKZB 2WP8J 1FGUA 4JBKA 4DV3Q 2L15A 1XNQQ 2B63G 1XMQL 2HHHQ 3S1QH 1J5EQ 1WFQA 1MJCA 4X65Q 2KCMA 3KF6A 4HJAA 5M3MH 3RLFA 4YHHQ 4P75A 2R6GA 4DUZQ 3CCEA 5JEAG 2K52A 4EX5A 1QVCA 2VNUD 4LWCA 3W1BA 1N36L 1M1KC 4BA2I 2RF4A 3KFUA 4DR5Q 4A3JH 2R7FA 5GAEC 1HNXQ 1LUZA 2JEBI 2Q2TA 2ZTCA 2R7ZG 4UY8C 2E2JH 1K8AC 1VQ4A 1JJGA 1VQLA 1SROA 4O0AA 5ELNA 1GD7A 3SGIA 1SR3A 1KIXA 5LMNQ 2PQAA 2MFIA 2UU9Q 3EBEA 2KHIA 3KDFA 4JV5L 4DR6L 2I5LX 2MO0A 1HZAA 3GTLH 4JI1L 3A0JA 2IX0A 2BH8A 4K0KQ 1I6HH 1QUQB 4GS3A 4KI0A 1E22A 2EQSA 3WWVA 3T1HL 4QIWE 1OXTA 2CFMA 1X65A 4DR1L 3FKIG 3AQQA 2ZJQA 2UXBQ 4OWTB 2D62A 4AH6A 4GLVB 4DV6L 4OO1I 1N32L 1VQGA 4IPHA 4DV0L 3K81C 1IBLQ 1X3FA 4OONA 3IRBA 5GADC 1TWHH 1YHQA 1G51A 4OX9L 1I94Q 3S16H 4DR7L 1W3SA 4A4IA 4DR3Q 5C3EH 2K5NA 4JI6Q 4PZ7A 5M5WH 1WCMG 1MKHA 5HGQA 1Q86C 5EAYA 3BJUA 4JI2Q 3ICEA 2JA6H 2K5HA 2Y0SG 4A3BG 1HR0W 4JOIC 4C2MH 2VQFQ 5IT9c 2DGYA 4PG3A 4A3IH 1HNZQ 2E2IH 4L5TA 4DV1Q 1Y1WG 3HOXG 4A3KG 2HQLA 3OW2A 1G6PA 1EUJA 4DK3C 4QJFA 5C4XG 4X64L 3H0GH 1X3GA 2LXKA 4DUYL 4YCUA 2N49A 1VQCA 1WYDA 3PUZA 4A3JG 1VQ6A 4A3CG 1HNWQ 4ALPA 3D0FA 4JI2L 1EQRA 3D31A 4BY7G 2UXCL 4BBRH 3AFQA 3L2PA 3AEVA 5IY0A 5IYBG 3KDFB 4YWMA 1IBLL 2VQEQ 3KJPA 2PMZE 1K8GA 1NY4A 2YYZA 4XIGS 4DV6Q 2JE6I 2UXBL 2IY5B 4A93G 2I5HA 1Q12A 4L5SA 3T1HQ 1WOCA 1UEBA 2ALYB 3L0OA 3LGJA 1VQ5A 4DV5Q 4APVA 2RHQB 3RN5A 2VY3A 5LMUQ 5E7NA 4C3JH 3F8TA 4JI1Q 4YCVA 5IYDG 2VW9A 5C4XH 3HOUG 3I2ZA 1C0AA 5JJLA 4JI5Q 1N9WA 1TWAH 2VZAA 2JJQA 3EIVA 3GTQH 3I56A 4GN5A 4B3TL 5C44H 1XPUA 1OXVA 4O2DA 4P72A 1Z9FA 3CW2C 4X64Q 4BY7H
chains in the Genus database with same CATH superfamily
4JI4Q 1EY5A 5DEHA 3VA5A 1EIGA 5BPFA 5LYJF 2YRWA 2V4QA 3PF4A 3EROA 3AYHB 3GQBA 3IL8A 1SLJA 4YWKA 1IBKQ 1IBLH 2YU9A 4Y52H 2NUAB 2HD3A 3TZUA 4DR3L 4C3HG 4RAYA 2C2EA 4DAMA 3HOVH 4P74A 1I94L 4DR7Q 2VB2X 2R93H 4ECVA 3MWEA 4YR3A 2XWJB 3E6ZX 1MSGA 3CPFA 1S4ZA 1SXTA 5AJ3Q 1KJIA 3K5HA 1U4LA 4EVOA 5COYA 1TIID 3G6VA 1R9TB 1LT6D 3GTKB 1BCPC 1JJ2A 1S5CD 3D4RA 5KG3A 1S5FD 1K3RA 1TR5A 3CXCA 3FHWA 4H13C 4DAYA 4KHPQ 3UDFA 3OUZA 3PF5A 3PW5A 3Q1KA 2O4XA 3S1NB 3KLWA 4K5WA 1BBWA 1D8LA 4JI3H 5DGBA 4CDCC 1Q1EA 3D6CA 5J3BA 3GIIA 1ONLA 1Y1VH 2JA7G 2W9CB 3PW7A 3E9HA 2PNHA 2HIXA 4GKJL 2WAQG 1YIJA 2KHSA 5EGTA 1TWCH 3RR5A 2JA6G 1JKJB 2HHHH 1C3OA 2W6MA 3SE7A 3BJYA 1LV9A 2AHOB 1TWHA 3A7LA 4JI3L 1PZJD 3ULJA 2R82A 3D8GA 4DR4L 3CAMA 2SNMA 1J8IA 3K0XA 3BYTB 3S2DH 4KKUA 5M3MB 2QK4A 2YS6A 5KT5A 4O4LF 4OL7A 4XDXA 4RB1A 4U7CA 3ORQA 2JA8G 3BVGA 1JB7A 2EYMA 1VMCA 1STBA 2KHJA 3CRKC 5FO8B 1G2SA 1EHIA 4DV7H 2JN4A 1W96A 1PH4A 4MTDA 3W1GA 3G6EA 1I4HA 4QY7A 2UUBQ 2ICEC 1K1SA 5DQGA 1HA6A 4DV3H 3KAJA 2P5ZX 5IYZF 4A3GG 2F1MA 4DV2L 3I12A 3PV0A 1AFPA 1DCZA 3CCSA 1EIFA 1WJJA 4DV7Q 2N88A 2XIWA 2W70A 2RCNA 2VPQA 3MFYA 1TS4A 2XGPA 1H9SA 1SNMA 5IP7H 2WAQA 3AMUA 3RJ0A 2NU8B 2AU0A 1VQDA 1IW7C 4B3RL 1U4MA 3FKIB 1V51A 1I50H 3RV4A 2W8KA 1YBYA 3IKJA 3TQTA 5IP7G 1W2BA 1WD0A 1H9SB 3QZ8A 3OTOL 1L0XB 1HCZA 5C1PA 4CKEA 2BE5C 5L37A 3HOWB 5A2QW 5KG0A 3TMEA 2XRSD 3PW2A 3BAAA 1DOKA 1EWCA 2EVBA 4DLKA 4AYBG 5FLMG 4EGVA 4G7ZC 5JEAJ 5KFLA 3JAMW 4L5RC 3ITPA 1B9NA 4EQNA 5KG7A 1VQIA 4X62L 1H9RA 1EYDA 1E4GT 2V1CC 4H0LC 5C1OA 2V5AA 5LL6b 1IYJB 4YY3Q 1JDBB 4DR4Q 1PXUA 2DIKA 4HJ7A 2SNSA 4JI3Q 3Q22A 3U9TA 3Q8RB 1WSCA 1S5ED 1OO9B 2A8VA 2O03A 1GO3E 1EUCB 2NYZD 2FE3A 2RSOA 5KIXA 2I87A 1Y1VG 4LF7Q 4QIWA 4HMJA 1QCBD 5DM63 1PA6A 2GLTA 3OTOH 2NTSA 1XMOL 1A2TA 1C7YA 5KFCA 3GILA 1S68A 1PH7A 2NU7B 4IURA 2FK3A 4CKCA 3CCVA 1A62A 2JYOA 3TP7A 4ETSA 1HHVA 3D4WA 4ZUIA 5FLXc 4HMIA 3A5ZB 1YNXA 2E74C 5C4ZA 3CMEA 3I4MH 1U5KA 1VS0A 2L12A 4JYAL 4GOPA 2B3GA 4B3ML 2I0QA 1Z7TA 3MR5A 1SEIA 1KD1C 3Q2OA 4XYMB 1CSQA 4O4HF 5ELBA 1I4PA 4X66L 3L4JA 4NMZA 2F0LA 2NVXB 5M3FH 2EYLA 5KFQA 5I4DA 2FMCA 3EPGA 2HVSA 4X3KA 4ED2A 4QF4A 1LYLA 3I4NG 3TQ1A 1PDQA 4RB3C 5LMNH 2BQRA 4S3SA 3CCMA 4HIDA 1ASZA 2VXWA 3BABA 1H9KA 1TS2A 5M9OA 4WJ4A 4IUQA 1NUCA 3SVMA 2B29A 3A55A 1EY0A 4IPCA 1KNAA 1QZGA 2AQ4A 2AUJD 5EQ0A 4JI4L 4FS1A 4DR4H 2AQ3B 3S24A 4LF4Q 2FKLA 4Q8FA 5FLXL 2BH2A 2F03A 2J9GA 2TSSA 2KJXA 4KHVA 4B3SL 1GGOA 3V96A 5IODA 1KXLA 5JVG3 1KQSA 5IGDA 1EY7A 1ICWA 1K8OA 1J5EH 4JI0Q 1PTOB 1SYDA 4DFAA 2AKWB 4UP9A 1N33Q 1Y14B 3K7AB 1M6VA 4WRDA 1NNXA 5IWAL 5C3WA 2UUCH 4CDDC 4Q44A 4ZQ3A 2W6OA 5LL6X 2B2WA 2ASDA 2RVLA 4A3EB 4EQPA 4NKLA 5AJ3L 2VQEL 2JA5G 4HTHA 4J0MA 1PFSA 1BCPF 3S17H 4GZYC 3K3VA 1UC9A 4DR2Q 2L9HA 1ZETA 4BY1G 2GN5A 2W7PA 1UEAB 1HJPA 1E3PA 1E24A 3JAMc 3S1RB 4NXNQ 1EQQA 1A0IA 4DR1H 2KQ3A 4L63B 1VQ9A 1PYWD 3FMAA 1IZ6A 1BR9A 2I8CA 4U6PA 1B2TA 4X6AH 2W9BB 5JAVA 1AW7A 5CBAE 4X3TA 1EQVA 3GP7A 2F4VH 3TIGA 1J9OA 2MCTA 2AQ2B 3E3XA 2D0PA 1M90C 5KFPA 4OX9Q 4CC5A 5KGUA 1C30A 1HTLD 2K32A 4A3IG 3HS0C 4APMA 3HOZB 1X56A 1ZEQX 4A3LH 3UE0A 3H0GG 2B39A 4QCLA 4A2BA 5IOCA 3BDOA 4NP5A 4Y8VB 5FPRA 1VBGA 3DEOA 1NTGA 4A3FH 5DM73 1B44D 1MI2A 5KFUA 3G4SA 2WB1G 1EYCA 3TZDA 1HNWL 1U9RA 2F0IA 1UNNC 3ND8A 2W9AA 2C5CA 4RMFA 3R2TA 3TSSA 1JCKB 1O7ZA 2B2UA 3FVQA 2MUYA 5C44G 1XTCD 4C3HB 3WNZA 2N78A 5DQIA 1F2ZA 2J6SA 2HIVA 2B2UC 2ASBA 5KT3A 4DV1L 2ZJPA 3STBD 1N36Q 3STBC 2WAQE 1K83H 1E7ZA 2B63A 1SYGA 2B2VA 5CR3A 3F1ZA 4BY1B 5CA1F 1HPCA 1YEZA 5JVLA 4OO1H 2K4KA 2Y0SB 3S1MH 5EDWA 4O4IF 2X69A 1LACA 1I6HB 1EWIA 5M5XB 3H3VI 3GTGB 1B1ZA 4K6DA 1NJIC 3GIPA 2E8GA 4LMQD 4FXDA 5KFOA 3X3NA 2KCTA 4EGQA 3ULPA 3CRLC 1OXXK 2EJGC 1XMOH 5IIFA 4HSVA 4M8AA 4I4TF 4R4TA 5KT7A 4ME5A 2XGTA 1YHAA 3GV3A 4NB3A 4B9WA 3F2UA 3P20A 4TV8F 5FD5A 4JV5Q 3CCUA 1VAJA 4DK6C 4I7ZC 1I7NA 4FF2A 2F0KA 3GV6A 1BGWA 3M4IA 4O2BF 1JOQA 4JW0A 5D1OA 1I50B 4DR5L 5KFBA 3OSPA 2NVQH 3A5UA 1B70B 2V4DA 2JA6B 1PTOD 1BO0A 5IT9E 5IYDH 1SYXB 4PMBA 4LFCL 1TWFH 3N6RA 2GA4B 3GIMA 3NTHA 1K9MC 4EYHB 3CP0A 1GSAA 5FK9C 5J2TF 5KFJA 2BCOA 5LMUH 4DL6A 1LTAD 2R8GA 1FGUA 4K6LA 2HHHQ 4Q0YA 2JXMB 4DA2A 2B2TA 4X65Q 2KCMA 4P75A 3LP8A 2E5LH 5CV8A 1B04A 1QVCA 5KFVA 3W1BA 2QKIC 2N55A 4DGZA 3I8ZA 3NWSA 1HNXQ 4C5BA 3MR6A 1GHKA 3GTPA 1UC8A 1D1IA 3H0GB 3WO0A 2NVYA 4G4KA 1VQ4A 1ML0D 1WTWA 1VQLA 2E2JB 4OIJA 5D65A 1M0TA 3MXNA 3SGIA 2M2LA 1KIXA 2MFIA 2KHIA 1K28A 4X65H 1EFID 3I3CA 5E3FA 3GTLH 5L1IA 4ZYSA 1FR3A 4JI1L 3A0JA 3ERQA 4C3JG 1K0SA 2BH8A 1I6HH 4M9UA 1QUQB 4WBNF 1ILPA 5C44B 5BN5A 3T1HL 3I70A 3AQQA 2UXBQ 4OWTB 4DAVA 2D62A 4AH6A 4DV6L 1PTOC 2K1BA 1IBLQ 1X3FA 1TWHH 2JP1A 3R5FA 1I94Q 4DR7L 1W3SA 2BOSA 3KLRA 3HKZB 5J22A 2EYHA 2L5TA 4DR3Q 4PZ7A 5M5WH 2CQYA 2V59A 2JA6H 2Y0SG 1WTQA 1K8MA 3BDLA 5FO9B 5KYIA 1HNZQ 1Y8NB 1Y1WG 4A3DB 5C4JB 5CAEB 1E0BA 5IGCA 1Z6HA 4HNVA 1B3AA 1X3GA 1GUNA 2DNCA 3MWYW 1VF7A 2LS01 4J9RA 3G6YA 1WYDA 1VQ6A 4A3JG 4J9MA 4UDUC 3HP3A 1N34H 2I80A 1KNEA 2OH2A 1I4XA 3N44B 2QYZA 3TN2A 3AEVA 2G9HD 3KDFB 4AQYH 1B53A 2PMZE 1BXTA 2VB3X 1NY4A 4XIGS 4MV7A 4DV6Q 4PMCA 5JPNC 2IY5B 4ED1A 1SE2A 1JE4A 2K5QA 5DNFA 2K5WA 4QMGA 4DV5Q 4HR7A 1WVLA 2EYJA 2ZDHA 3RN5A 1AZPA 4MN3A 2F0QA 4YCVA 2VW9A 2H4OA 1SJHD 5G3LF 3SXHA 4IUUA 3T51B 1PLFA 1N9WA 2PBZA 1CQFA 2OEOA 3X3MA 5C44H 2R84A 1OXVA 3JZIA 3L4KA 3KHGA 2OWOA 1ET9A 1UE5A 3PR4A 2MPMA 1GHJA 4JPBW 4IHJF 1HNZL 1EEFD 3Q24A 1LM0A 1SFOA 3GTMA 2VUMG 1LT3D 2EY2A 1CKNB 1KBLA 2CCZA 5FJ8H 4GNXA 4B3RH 3RFCA 3CC2A 4LH6A 1F2LA 2GVBA 3G8CA 3GTQB 3PZPA 3ERSX 3I90A 1NCVA 2F0HA 3VYSA 4B3MH 2KOLA 5E4XA 4HJ9A 2JA6A 2PI2A 2YTVA 4LF5H 1DJRD 4DKAC 1EUDB 2CW0D 2D2CC 1NMFA 4GKKH 3AFPA 1V1QA 2NVYB 4UCVA 5KX5F 2A6HC 3G48A 5EZYF 3BYYB 1CKOA 3KOJA 3Q8PB 2L0CA 4LUZA 4QB4A 3DWAA 2BA0A 4A3JB 4B3MQ 3ER0A 3FMCA 5IYCH 1Y8OB 3HKSA 3F2CA 2E5LL 5C8YF 1RIPA 5JJIA 2FJZA 2ES2A 3WO1A 4QWAA 5DAUA 4HSPA 3KXYT 1TWFA 2F3WA 2FJ2A 1VQJA 5KFMA 1V9PA 3M4OB 4LFBQ 1SAPA 2RDGA 1HNXL 3K5LA 1PH6A 1HZBA 1PRTF 3CPWA 2O5IC 2NVXH 2B2YA 2BA1A 4G57A 3BDCA 3JAMi 4JV0A 4RNOA 4DR6H 1KL9A 2E76C 3BVMA 3VDYA 1D5MC 3MHBA 3SEBA 2HVRA 1HZ9A 1WD1A 3GIKA 3OOCA 2UUCQ 4XYQA 5EKKA 2EXDA 2N8NA 4YY3L 5JOBA 1RD9D 4JI0H 4A3LG 1JLLB 1WCMH 1Q90A 3SK5A 1IKMA 4DV6H 5C0XH 1TWCB 3EJIA 2VQEH 3AU7A 4L8JA 3T13A 2JQOA 1JE5A 2QDBA 3RLNA 2FMMA 2KEEA 4ID6A 1ZKOA 2VOBA 1PFMA 5FOBB 3HBLA 3TS0A 2NVYH 4PNYA 3J80L 3CCRA 2XD4A 3CF5A 3CHBD 4AYBE 4L5QA 3J7A5 1XNRQ 4FF1A 1XMOQ 3BU2A 1YJNA 5EPLA 1PX2A 1S03G 2N3SA 1BNZA 1TWAA 2UXDL 1RF2D 5M5YB 5EKLA 1TWGB 3UDGA 1YJWA 1CM9A 2JSOA 4ZKCB 1BUVT 1EIHA 3S16B 5EWGA 4X64H 4DR3H 2JEGA 5I9PA 4DXFA 4XXEA 3V4ZA 4RAZA 4JV2A 4X62Q 1JR0D 2DNEA 2I5MX 2HVQA 4LW1A 1SYCA 3MEFA 1WTRA 5CBEE 4IPDA 4NXML 1SNCA 4TQUS 3J80E 5C5LA 1RJQA 2ZTDA 1R4PB 2XRQD 4GOPC 1SBBB 2F3IA 4DL5A 4BA1I 3BZCA 2FMAA 1PH9A 3H20A 3PN1A 3T1HH 1HFGA 1SE4A 4PMWA 4IUNA 1IYUA 1SNOA 2HDLA 3OTOQ 1X54A 3HRZC 4RKLA 1QVFA 3GTLB 1KC7A 2P0AA 3CMAA 3S1RH 3RB4A 2OLSA 5D3DA 2ZDGA 3N8DA 3T1YL 4A3MB 2NN6G 4UCUA 1UE6A 4RZRA 5L1JA 1SYFA 4J1MA 3VPBA 3BQ2A 1F2YA 5DLFA 1GUGA 2F0FA 1TS5A 2IT1A 4EYIB 1IBML 4IOAA 1GUTA 3WDNA 4YWLA 3K80C 1F9QA 4MTNA 1YITA 2VUMA 3PQIA 3HOXH 3HOYB 5ELFA 1RODA 1D7QA 4RHRA 3NELA 3C3LA 1RYSA 4DNTB 5LA6F 3RZOH 1A63A 1I4GA 1N34L 4I55F 2FK1A 1PYBA 5E1FA 1T94A 4DXGA 2A69D 4F4ZA 1I94H 1U0LA 2BQ3A 1TWHB 4ME3A 5FPOA 4Y7NH 2JA9A 2EOTA 4PV1C 2UXBH 5EPKA 3H3VH 4IRCA 5M5WB 5KG2A 2R7ZH 1W6KA 4LF9Q 2B8FA 4XYOA 5EBDA 2UVRA 3OMGA 2ENBA 2EJMA 4PQXA 5HGTA 1VQAA 1WH2A 4IPGA 4C3HH 1RJPA 1Q8KA 4IJLA 1MD2D 2UUAH 3I4LA 1EL0A 3HKZG 3BZKA 4K2LA 2F4VQ 4V190 1QE6A 2VR1A 3T56B 1EYGA 2SCUB 1L1OA 2QF7A 2UUAL 1NAPA 4X3SA 1DV1A 3NGDA 4EBEA 2UUBH 1K83B 1CSPA 3C46A 3NE5B 4DAYB 4R4IA 4EG0A 1SYBA 3I55A 3KBXA 1PH8A 3BVZA 1SNQA 1N33L 4EBDA 1B3QA 1DOMA 1EZ6A 1OXSC 5M3FB 2E5LQ 2B2YC 2CH4A 2MO1A 3HOZH 1LTSD 3MXPA 3MZ5A 2F0EA 2QA4A 3S2HH 2NU6B 1R9TH 1HR0H 2KA7A 1UWVA 5HV6A 2DPIA 2E75C 2F0UA 4FF3A 4KHPL 4GKKL 2F0VA 2Z9HA 3C0FB 3ETJA 3SK4A 1BVSA 2QW7A 3CQZH 1AH9A 2WTFA 2KCCA 2YZGA 2AQ1B 3QO2A 4C2MB 2ID0A 4ZOLF 3GTJA 1JQYD 1TY0A 1KLGD 1QJOA 4LSXA 4YJ3F 1BCPB 1KJ8A 1CQJB 4MV8A 4XX0B 3DXJC 5KFRA 2NBFA 4RB0A 3KHHA 5J1ZA 2R93G 1B50A 5J2UF 2V9WA 3N43B 3OMCA 2AGQA 1Y1WH 3OHBA 5FKAC 1D6EC 2MNAA 4DAPA 3TS2A 5C0XG 5IE8A 4TQSA 1CUKA 4G3IA 3I4OA 2L4NA 4R4CA 3PO2B 2X6GA 2R3ZA 3M4PA 5IWAH 2YTXA 3VA7A 4FP5D 4KHPH 3FKIA 5LMNW 4FXGC 5CGKA 1VQMA 5K36H 3R5HA 1EY8A 2Z6KC 5LMUL 4B08A 3A8IE 1Y1VA 4JV1A 2WIIB 1DXMA 1MIUA 1TWGH 4TVAB 1DV2A 1LTLA 3HKZE 1JX4A 1N32Q 4H7BA 4L6TB 1YHBA 2R86A 3HOZG 3UDXA 3M7NA 3JSNA 4RUAA 3KHRA 4POGA 4LUVA 2XCAA 4TKOB 4GN3B 4IFDJ 5FLXE 2F0JA 2Z6KA 3PUWA 1DGSA 2M9VA 4FXKC 1E4FT 1PTOH 3QR8A 2JA5A 3T1YQ 1PVOA 1TWCA 4YR0A 4ED7A 2AGPA 5LMNL 2RDJA 3F8NA 2ATLA 1MHWC 4FDBA 2VUMB 1GUSA 1X3EA 1EY4A 1S3OA 1U4PA 4LSAA 4WFN3 2NZ1D 4IZ8A 1LTGD 5K5PA 1SN8A 4EQOA 4NPSA 1UUPA 1TKWB 3RD4A 3FP9A 2JEIA 4JCVE 1TA8A 3J81W 2R7DA 3J81c 3PO3B 4CC6A 2CWAA 4IWYA 5L9XA 3FPPA 4P2CB 1DIKA 4QW8A 1QG7A 1Q8IA 1FL0A 1GKHA 1R4QB 1J5EL 2E2DC 2IHFA 2PYKA 3UE1A 4DV0Q 1QNKA 5FD6A 4DK1A 1OTCA 4GKJH 1ENFA 1YI2A 1CI3M 1UE1A 4O3NA 3M9BA 2XWBB 1AE2A 2W6ZA 1VQEA 2K04A 4JI8Q 3KTMA 1V8QA 4R8IA 4YAJB 3RTXA 3OWFA 2F0TA 1E1OA 3TINA 3A8KE 2A68C 3U4ZA 4MAMA 5M5YH 4NXNH 1HTPA 4DNIA 4XQJA 3S1MB 3HFZB 2UUBL 5LHY1 1D5XC 5KNCA 4I50F 1QUQA 1LLRD 4LF8L 3M9NB 1VQ8A 3NWTA 4FU0A 1RTOA 3GTQA 3Q8DA 1KAWA 3DHQA 2K05A 4BBSH 3TQYA 1GUOA 2K28A 4OHJA 1WI5A 2HHHL 3MVVA 1IXRA 5C0XI 1PTOF 4JBKA 4DV3Q 2L15A 2B63G 2AGOA 1XMQL 4DUYH 3GQCA 2FLPA 3KUPA 1O80A 1WFQA 3RMHA 4XQNA 3T1YH 1MJCA 2UVVA 5M3MH 1CHPD 2F4IA 3I4NB 3GV5B 5E4WC 1RK6A 4ED3A 4DV0H 4LWCA 1M1KC 1JDEA 2RF4A 1YNJD 4A3JH 5GAEC 1HQRD 1LUZA 2Q2TA 2J6UA 3TDQA 1S97A 1S0MA 4UY8C 3V2TA 1JJGA 2Q8RE 2R93A 5ELNA 1GD7A 5KYLA 1Z2PX 4YY3H 3CQZA 1XXGA 1F9SA 5LMNQ 2UU9Q 1JWUD 5KFYA 4JV5L 3KDFA 3R93A 2I5LX 5I47A 3E5SA 4DV1H 2XCPA 2EYPA 2F0NA 2VQFH 4C3JB 2PCFB 1E22A 4HNTA 1KDBA 2EQSA 3WWVA 4KKTA 3Q8QB 4QIWE 4DR1L 1DYQA 4C1NI 2ZJQA 3JRXA 1RDPD 4OO1I 5NUCA 1MZBA 3K59A 4OX9L 2L55A 2PQEA 2I07B 3N41B 3ICEA 2R8HA 2UXCH 4JI2Q 2R6FA 4Q43A 4ME6A 1HR0W 3N40P 3PIP3 2PW5A 2VQFQ 4RCNA 4A3IH 4PG3A 2RDIA 3T4AC 2E2IH 4DV1Q 4A3KB 2JEFA 2XCLA 2HQLA 1G6PA 4IRKA 3GTLA 3PMFA 4DK3C 1XX8A 1IHZA 2DPJA 2RGRA 4X64L 1JORA 3S9WA 2CW7A 1Z2NX 1LTRD 1ET6A 3VYUA 4O2AF 2F0GA 4YCUA 2Q8IB 4JI7H 4YAKB 2B63B 1HNWQ 3G6JB 1M0WA 1V1OA 4ALPA 3D0FA 3T16A 4KKSA 3D31A 4N9TA 3K5OA 4ZI7F 3HZXA 4KK7A 5C5JA 1TY2A 2UXCL 4RNMA 2CW8A 2HUGA 4TUYF 1KJJA 2YZMA 2VQEQ 5TSSA 1STNA 4A3GB 4QWCA 5CMDA 4HN7A 4JI4H 1X32A 1Y69U 3T1HQ 1WOCA 3LGJA 3S14B 5JH7F 3P1HA 2RHQB 1HXYD 2MP1A 2K03A 5E7NA 4C3JH 4CGYB 3F8TA 4JI1Q 5C4XH 3U9SA 4JI5Q 4DNRB 2IMWP 4R9WA 3DUZA 2JJQA 1MSHA 3I72A 4X62H 3M4YA 4YBZB 2KECA 4ODGA 1ZQ7A 3K5NA 4P72A 2KVMA 1EQTA 3MC0B 4X64Q 2C00A 3R8BA 4MHEA 1JJCB 4AIMA 3N6XA 4NXNL 4QWDA 4IR9A 4JI6H 3VYRA 5IP9H 1BQQT 2F0DA 4GN4B 2JA5H 2F0MA 1VQHA 2KUMA 3PIPA 2K01A 4BY1H 1KEEA 3I7FA 3CQZB 4DR2L 1JICA 4GLAC 5I9OA 5HBRB 5BMVF 2R93B 1G2TA 3KHLA 2K50A 2NWGA 3S1QB 1A9XA 4DL7A 4F4YA 5FLMH 1S72A 2KSWA 3BA8A 3TRZA 1S9FA 3M3YB 4I65A 4ZRZA 3J81i 3S15B 1I3QB 4CJ1B 2CHBD 4GKKQ 4F4WA 4CKBA 4TRDA 1EU3A 2SDFA 4M7EA 2IA6A 1AN7A 4LFCQ 3FEWX 3N42B 5M3FG 4QWEA 2J4XA 4ZCKA 3CD6A 5JJKA 4ECXA 5HURA 1JOKA 3I91A 4LF9H 4DR7H 4WJWA 1Z47A 2UU9L 2HT1A 2UVUA 1QB5D 5GONF 1V1PB 1E4EA 2G5DA 4QQBX 2M00A 4RU9A 1JT8A 4LF4L 3U50C 3V6KA 3KF8A 4ZUJA 2XSCA 3QFFA 4Q8EA 1YNJC 2XTIA 3GTKA 4J8QA 3S14H 4LFAL 2QILA 2KBNA 3DM3A 4CHTB 3HGBA 4A3BH 1VDZA 3A8JE 2A1AA 4A3GH 3CU7A 1VQNA 2FLNA 1TT2A 1T5XD 4A3KH 4C1NK 5BR8H 5CV5A 1A3VA 4O3PA 1XNQL 2IX3A 3PO2G 1PH1A 1GJXA 2MHVA 2B63H 4XQQA 4ECWA 2JEJA 2BDNA 1N32H 1Q1BA 1AE3A 1CKNA 1SNPA 4DV4Q 3RZDH 2WB1E 2LKVA 1GLVA 4K5VA 1E1TA 4FYDA 4P71A 4Q5VA 3A74A 5K36G 4LF8Q 1QVGA 4YHHH 4DUZH 1LTTD 4JG2A 1I3QH 2OF1A 1N34Q 2R61A 3H6MA 4KMUC 1XNQH 2XC9A 3K7AH 2WDTA 2Q2IA 4LUOA 2FINB 1XPRA 1JWMD 1V4YA 4MTEA 2XNAC 4RKBA 1NR2A 5BN3A 2JEAI 1IBMQ 1STEA 4HYKA 3VR3A 3MWDA 2PI2E 4U673 1S40A 2IW3A 3E0JA 3MFGA 5D3IB 1I7LA 2PMZA 2VA2A 3QZ7A 2AMCB 4HQ6A 3VYTA 4DV7L 4HIKA 2F0WA 3FRPB 1STHA 1BBUA 4MV9A 4LK1C 5CYUA 3K8AA 3G71A 4DL3A 3U9OA 4RGNA 2JA5B 2Z8LA 1T36A 4YCWA 5DG7A 3RF2A 4BWSC 2BE5D 1WCMB 4RAUC 1HR0L 5BR8Q 2FK2A 3GIQA 3B6YA 2WACA 3PGZA 3RUZA 3CCLA 3MFHA 4M1UB 1Q3LA 2VL6A 4DV5H 1BBXC 1ZHSA 1CKMA 5JPMC 5KNBA 3PO2H 1XPOA 4MV1A 3MXUA 1HR0Q 1I4RA 3H94A 2NTTA 3BZDB 1KRTA 1RTNA 1X9NA 2W6QA 3LWUA 3K0YA 3I4NH 4AQYQ 4DK0A 3U4VA 1H95A 1WTHA 3QOLA 2W8LA 1ICFB 4K2KA 5KFKA 3U58A 3MTSA 3GTGH 3OYYA 3NBHB 1WTPA 2ZTEA 2RKSA 4F4XA 5A35A 3HOWH 2Q2HA 1T3NA 3PW0A 2R92A 5ELEA 1QZHA 1AZQA 1ESRA 1EZ1A 4MV4A 4ED0A 2VA3A 1CZWA 4P73A 2WV6D 2DJFC 2FP4B 5LOVF 4Q0FA 3OSOA 3NQIA 4A3FB 3DLLA 3GTKH 1STAA 1PH3A 5AFWA 3FKIH 1UE7A 2ZM6L 4DV2Q 5DGAA 5ISRA 1VQPA 4OO1G 1EIYB 3R23A 4C3IG 4UP8A 4HCSA 2E2IB 1MGSA 1NE3A 4CDEC 3GD7A 1TWGA 3S1NH 5FLXW 4ECSA 3G6XA 3F2BA 3NSWA 4J9SA 1KRSA 4B3SQ 2HCIA 2JA7H 1EOTA 1BKBA 5C4XB 3ZJYC 4IOCA 1V1PA 3P75A 2ZM6H 3NENA 3C2PA 1ZHQA 3RLOA 1L2FA 3DMUA 5H1SE 2L11A 4BXXG 5D8DA 3RB0A 1C8CA 3K5IA 5FJ8G 2UUCL 1VF5C 1FJGQ 1Q81C 2JA7A 2RQXA 4FO2A 4C56C 2ZJTA 2D9UA 1PV4A 2K6AA 2QDLA 3CC7A 4RNNA 4HJ5A 1IBKL 5A2QE 4LH7A 1YNNC 2VS1A 5C0XJ 1K83A 4F50A 3O13A 1F2MA 4LF9L 3J7AK 4IUTA 3WOFA 2KCNA 4KY6A 5IGBA 2WKDA 3DM1A 1HZCA 1NBWA 5KFXA 3UI2A 3J7AV 5HY6A 4DF7A 1I50A 1PRTC 5CV7A 1N48A 1ULZA 3IFTA 5GROA 4RGOS 1YJ9A 2IX1A 2C9OA 4Y7NB 3A7AB 2W6NA 1N36H 1EYAA 1B7YB 4C3IH 2C28A 3W5OA 1V43A 3KF6B 3OHXC 5EWEA 1EOVA 2A19A 3ND9A 3CCQA 4UPAA 1B6RA 3ETHA 2YCHA 4JI1H 1E2ZA 3NHHA 5KFGA 1IOVA 3EN2A 4FF4A 4IFDG 1FJGH 2MQHA 4F7XA 1PMRA 3ZYYX 4O3OA 5KG4A 1Y8PB 3SK8A 3J80c 5CV4A 2FFKB 3LMLA 2UXCQ 2R7ZA 2B2VC 4TV9F 1ASYA 3W2DA 3NTIA 5GQOA 2ZJRA 4KD4A 4AYBA 4TQRA 3PW4A 3NUCA 1RKNA 3PO3H 3RZDB 1VQKA 2NU9B 3EFXD 1EY6A 1CZGA 4OWWB 4AQYL 4WORA 4IUVA 4A75A 4RGTA 4J15A 4F8MA 1DOLA 3GIDA 4YP3A 1XNRH 2RDFA 1J6QA 4FS2A 4B3TQ 1EYZA 5KRUA 4K8JA 5GAGC 1L2ZA 2D5DA 4JI5L 2R92G 2F3VA 1CFMA 4OIKA 3KLSA 2ZDQA 4IFDI 3H4DA 4DV5L 4KJNA 3GDEA 3RBEA 4CJ2C 2F52A 1MJEA 4C5AA 1SJED 3C1FA 2R7KA 2Y0SE 4DR1Q 2PZWA 3NXWA 1KABA 2HJWA 4C5CA 4A93H 1SE8A 5ELCA 2QCPX 4F87A 1WTOA 3HKZA 2Q2UA 3PUXA 4L1KA 4IJHA 2B2WC 1PRTB 3S15H 1M8AA 1HQMC 2XVSA 3R2IA 1KTKA 1YNND 2K14A 2NN6I 4DUYQ 2KENA 3D3RA 3TEHB 4DV2H 5CV6A 3TP6A 4H44C 3V4SA 5C4JH 3OW7A 1CT1D 1JC7A 2PPBC 2UU9H 5ELOA 4ZKBB 1LTBD 1TU2B 3EYYA 4HNUA 5KFEA 1WR2A 1GM5A 3R5XA 1Y1WA 1B9MA 1HA5A 1N33H 3TBIB 2RHSB 2PZTA 4ECYA 3ONAB 4A3DG 3SI8A 4XT3B 4YHHL 4DUZL 3J7AF 1ENAA 1VBHA 3MXNB 3EPIA 4RWSC 3HOVG 1SDFA 2PQAB 2AUKA 1XMQQ 3JAME 5EPJA 3KBGA 2FLLA 3GTPB 1SFOH 4RHSA 1L1OB 3QJYA 5FO7B 2K5DA 2DY8A 5F2DA 1GUWA 2X6LA 2O5JC 1AUVA 4QGUA 4JV5H 2R92H 3C1EA 4X66H 1KDCA 2D0OA 2ZT9C 3FPUB 4A3CH 2F0SA 5BPHA 1F9PA 4JVZA 1K0RA 4RH6A 4NXMH 4HIMA 4LFAQ 1L0WA 4WD3A 2J6TA 3F2DA 1JIHA 4PZ6A 5T14A 5D14A 2H5XA 5DLQE 4GKJQ 4H02A 1GVPA 2A68D 3TP8A 1VKZA 2RDHA 4LMYA 3PSIA 2E2HA 1IL2A 2WAQB 4KLKA 4G7OC 1QOHA 1I6VC 4A93B 1VCIA 2BDOA 1D1KA 4JBMA 4O1NA 1HUNA 5LXTF 4HIOA 2XGQA 4GC7A 3H4BA 1ESFA 4EQ5A 5D1OB 2Z1CA 4YJ2F 2DUDA 1TWFB 4BBRG 4YR2A 1PRTD 1X6OA 4LF6Q 1PHJA 2IWHA 3LNNA 2A6EC 1XNQQ 4FBUA 1J5EQ 3S17B 4HJAA 3KF6A 1IL8A 3J7YW 3RLFA 2IL8A 5C3EB 3T5JA 4R8UB 2DWCA 1W93A 3RBDA 2HQEA 5JEAG 5T1IA 2EY1A 4EX5A 1SCUB 3MWMA 1E4EB 1VMPA 4I7AA 3K57A 3KFUA 1GSHA 4MV3A 4DR5Q 4Z9CB 2R7FA 1FNVA 1AP0A 2EYFA 3S2HB 2EZVA 5KG5A 3V6HA 5KG6A 2E2JH 1K8AC 4V0BA 3D6WA 2BQUA 1SROA 3OPOA 3LX0A 5EKIA 1SR3A 1W6JA 3QOJA 5KFFA 2PQAA 4DR6L 2MO0A 3LWBA 2Z4HA 1O7YA 3GTMB 2X0SA 2BR0A 1AUXA 2IX0A 3HEJA 4GS3A 4O3RA 3KK7A 4JI2H 4LF6H 2IPKD 1OXTA 3H91A 3FKIG 2WB1B 2ASLA 3GLKA 4GLVB 1L0YB 2CH4W 3D4DA 4IPHA 4DV0L 4GC6A 3K81C 4RZQA 5GADC 1KJ9A 1G51A 1RJTA 3MFIA 5C6AA 1H9MA 2K5NA 3HOWG 4HCEA 1WCMG 1MKHA 1Q86C 5EAYA 1KJQA 4A3BG 2K5HA 1TWAB 4N9PA 3HOVB 3J81E 4JOIC 4C2MH 3VR2A 3GTGA 5IT9W 5IT9c 1R9TA 3IG0A 3MR3A 2ZXPA 3HOXG 4A3KG 4QJFA 5C4XG 1A3UA 4ILWA 3H0GH 4F88A 4LFAH 4UFZA 2Z4IA 2LXKA 4LF7H 4DUYL 4EFBA 4O3SA 4A3CG 4JI8H 2FPPB 4R7RA 2V4RA 2YU9B 4JI2L 2A69C 4RA8A 1CS0A 3L2PA 5IY0A 4MV6A 1RHPA 2EXZA 5IYBG 1WTVA 5KG1A 2RBMA 4YWMA 1IBLL 5DQHA 1XMQH 1K8GA 3GV8B 4ECTA 1I6UA 2J7ZA 3TP5A 3SDZA 2JE6I 4QUFA 2UXBL 2F0OA 4A93G 3J81L 3I4MB 3IN5A 1VQ5A 4E4TA 1UEBA 3L0OA 4BWGB 5CB4F 4DL4A 1FD7D 1HNWH 4XT1B 3K3PA 1EU4A 2VY3A 4OELB 4BS9A 5LMUQ 1CA6A 3RGZA 1TQOA 3HOUG 5IT9L 1C0AA 3I2ZA 4MA5A 4JI5H 2FHTA 1A3TA 3GTQH 2NB0A 3MJFA 3I56A 4GN5A 4B3TL 1XPUA 2R87A 3HB9A 2VQDA 4O2DA 1BJTA 5KT2A 4MTKA 2FPGB 4LAAA 2R8JA 1WCMA 4BY7H 3M4QA 1VQFA 1K1QA 5JEAH 4A76A 1BXRA 4O3QA 5KFZA 4ULLA 3L9AX 4LF5L 4DU9A 2PMZB 1EWHA 3BG5A 4RB2C 1PK8A 2DJGC 1IW7D 1T9HA 4TSSA 4JBWA 1FJGL 3EVQA 4JI7Q 2PVPA 1G91A 2ZXRA 3WOEA 1FKAH 3HOXB 3HOYH 3RV3A 1C4QA 1DD2A 5K2MA 4R8NA 5J39A 3CCJA 1OWTA 5DLGA 4ECQA 1STGA 4QL5A 4K0KL 2OTLA 1P8LA 4JI0L 2YRXA 3H09A 3OIPA 2W57A 1YZ6A 2EPBA 1KDAA 1GYFA 3NBIA 2Z0SA 5KT6A 1PH2A 4DR5H 5C4HA 3E5NA 1KC8C 3GV7B 2W9CA 1IBKH 2OQKA 1A15A 3RB6A 1RYRA 1IYVA 2C2RA 4KD3A 1K73C 5KKNB 2KEDA 2GPWA 2PNRC 1GXDC 4A3BB 4GOPB 1FYCA 3GTOH 4OGQC 3VPDA 2A73B 3LWEA 1A6XA 4HR7B 4X65L 2RA4A 3OIQA 4IAJA 4RG1A 1AN8A 1CQVA 2EE1A 1RCVD 4XZ3B 2JA8H 1FGBD 2AWNA 3BG3A 1Y1WB 4OXPA 3J80i 2E2IA 2NVTH 1TVXA 5M3MG 4NDXA 3T5LA 4ECZA 1JMCA 4WJ3M 1BOSA 1S0OA 2HGSA 4QIWB 2OCEA 4PWQA 4R4OA 3JRWA 4EFEA 5LL6S 4MNOA 2W6PA 4UCTA 4LNQA 2R85A 1DM0B 5EJWA 2J0TD 5CV9A 1IOWA 3I4MG 5IGGA 4NXMQ 4RGMA 3MR2A 2Y0SA 2JK8A 3MEHA 1Q82C 2A6ED 3Q8SB 5KFTA 4JOIA 2YTYA 5I6YA 2CQOA 3BQ1A 2PW7A 4LF7L 2QGQA 4IO9A 1JB3A 1SEBD 1C9OA 4JI8L 4UCSA 2YL2A 4ZAIA 1VQOA 3NK9A 2F0PA 4GNXC 4KY5A 3PUVA 4DR2H 3K5MA 1T5EA 4JBJA 1STYA 2DN8A 4IR1A 3H15A 1AEXA 1D2BA 1PH5A 2EDGA 2RCFA 3T53B 1DONA 2LXJA 3RAQA 2A6HD 2GVAA 1PZKD 1SSOA 1BCPD 2YV5A 2Q8TA 5F9LA 2K5VA 2TMPA 5ELDA 3PR5B 4QW9A 1U4RA 3K58A 1RJRA 3CVZA 3Q23A 4A3DH 4AYBB 1BF4A 3GTJH 4BBSG 2EYOA 1QNUA 4ZLTF 1JOOA 3H0GA 2R7ZB 2A74C 2CVRA 3DEPA 1FVIA 1WTXA 4XTCS 3L7ZC 2C2DA 3PIO3 4LF4H 2VUMH 1UAPA 4ZK9B 3MAQA 2SOBA 2CWPA 4UHVA 3Q0AA 3QIAA 4IWXA 4ECUA 5EBCA 4G7HC 5C3EG 4KN4C 3J81j 2WINB 3H3VC 5GAHC 2LFNA 2NUCA 4IRDA 4QWBA 3OSNA 1Y1VB 2HDMA 1N8RC 2ALZA 4A3FG 2NVTB 3A56A 2YU9H 3GTMH 5CORA 3PCOB 4J9QA 5IGFA 4Q45A 1XNRL 1LT5D 5IWAQ 1OXUA 1RL2A 2G9DA 1ZYRD 3RZOB 2RGVA 4IQZA 4UAIA 4C3IB 3HOUH 2YYAA 1B8AA 1VQBA 5JUMA 1EEID 2EY5A 3RUPA 2WKCA 4XYLB 1TXYA 5C5MA 1IKLA 4J6HA 4N8FA 3M9OB 2WYOA 1O7IA 1LTID 1M7JA 3M4OH 4R8UA 3K6OA 2ATWA 2DZDA 4HJ8A 1DZ1A 1S0NA 1ENCA 1SMXA 1YVCA 4BBRB 1SMYC 1PFNA 3KJOA 3NQTA 3KF8B 1P16A 5KEEA 3AB9A 1IBMH 2LSSA 3PO3G 5L1KA 3KALA 2F4VL 3VR6A 1HUMA 1Q7YC 1BNCA 5JQWA 4LF5Q 2MGSA 4EBCA 4B3TH 3QG1A 5A2QL 2C22A 4X66Q 4BBSB 2QEJC 5CC4A 4LFBL 1B6SA 2RSNA 4I7HA 1JWSD 5KFIA 1XDNA 4GNXB 4N8X1 2EY6A 4IZOA 1MBYA 1II3A 4OEMB 2H1EA 3SHLA 1SFOB 3NP8A 4RFBA 1S5BD 1JXLA 2UVWA 3M3YH 1Z2OX 4J9NA 1I4QA 2NVXA 1SE3A 2AWOA 1S10A 1GSOA 3GIJA 4J9KA 2JA7B 3E0EA 1Q46A 1A8VA 1I5FA 2FB9A 1FNUA 2CQAA 3BS1A 4ECRA 3SR1A 1GOZA 3UDIA 2CW0C 4A3EG 3NBHA 2UUAQ 2L1BA 3V6JA 4JI7L 3OUUA 1PYSB 4UP7A 1HH2P 3GTPH 4IN3A 2EJFC 1TAEA 3OWEB 4OWXB 2E2HH 1KAAA 4R1JA 2UXDH 2WFWA 4LFBH 3VMMA 3M85A 5KFAA 5DG8A 2LMCB 3Q6SA 4B3SH 5JVDF 3RB3A 1N56A 5EOYA 1KLUD 3KYHC 4QUCA 1BDOA 2Z6BA 4ED6A 5IP9G 1KHIA 3PIOA 2WB1A 4JYAQ 3H40A 3BQ0A 2SEBD 3RAXA 2O2LD 2VQFL 4A3MG 3EQLC 4EEQA 2W9BA 3NTKA 4X3UA 5KFDA 2FXQA 3J80W 5KFHA 1E2WA 2R92B 1EFWA 5IYBH 3KLSX 2FPIB 5F9NA 1HNZH 4K8IA 3GTOB 1X3PA 3GO5A 4A3MH 4U68A 5M5XH 4JYAH 4DPGA 3HOUB 3HOYG 2ZM6Q 5KFNA 3JC66 5G3LD 2OXPA 4B3RQ 1HNXH 2LY7A 3FDTA 4KHZA 4IUPA 1XTDA 3M7GA 1RK5A 4K14A 3RIZA 2NZOA 3CKIB 4HAEA 4MZ9A 3I73A 3RGXA 4JC0A 4PDBA 4EGJA 2ZXOA 3FDSA 1LABA 2V58A 4O42A 1NSNS 4FNFA 2UXDQ 3DWQA 4DR6Q 1O78A 4EEYA 1XJVA 1D5ZC 1L1OC 1QILA 1PFBA 3GTOA 3TREA 1B33N 2WE6A 3NEMA 4FVMA 1TS3A 4E6IA 1X3QA 2JA8B 5IGEA 2IHEA 1NMGA 3RN2A 1CK1A 5I2XA 5BR8L 3A54A 2K7VA 4YIJA 4JI6L 3PVXA 1SRUA 5DG9A 4ZQIA 4A2AA 2QEXA 3ULLA 3HG9A 2C35B 1VQ7A 5I6WA 1EZ8A 2DY7A 3RNUA 3K7UC 2OTJA 4NW2A 4LF6L 2E2HB 4B9XA 1O75A 4UCOA 4YQWA 4FBTA 4NLGA 3PUYA 4POFA 2CZGA 3TIIA 3MXGA 1LT4D 1X55A 1CHQD 2W71A 2R7LA 4UCRA 1LO5D 3CC4A 1SNDA 5JVH3 3VR4A 4KTAA 4BXXH 3DWPA 4GLXA 4PZ8A 1ZYRC 4KY7A 2W7OA 4DV4H 2GPSA 3R3OA 1G291 4JK1C 1NR4A 5T1GA 3VPCA 1S5DD 2R7MA 3J7ZC 1H9JA 2NVQB 1ZXTA 2B8GA 2OQ0A 4DV4L 3E9IA 5KFSA 4YB8B 1K3BC 4R4QA 1O7LA 3OHAA 2EIFA 2K75A 2NZHA 4A3EH 2PN1A 4J9LA 5IYCG 4CDFC 3NPPA 3P7JA 4DV3L 5D1PA 2CKZB 1SMYD 2WP8J 4C2MA 1HRJA 2IBKA 2XN9C 3S1QH 1XYIA 3SK6A 1F77A 4BY7B 4KJOA 4YHHQ 4DUZQ 4LF8H 2R6GA 3N52A 4MIUA 3CCEA 3UQ8A 1CE8A 1F9RA 3QWNA 2K52A 5H80A 3UFXB 5KT4A 2A5HA 2K33A 4HEDA 4KN7C 1N36L 4BA2I 2VNUD 4J9PA 1CA5A 2JEBI 2OT2A 4CJ0B 1M4VA 2ZTCA 2R7ZG 1I3QA 2VUGA 3MA2B 4O0AA 4LFCH 2YZNA 5LP6F 3M9MB 5BN4A 3EBEA 3HXLA 3W3AA 1HZAA 4MA0A 5KNDA 4K0KQ 1G8ZD 4KI0A 1EY9A 2ICIA 2B2TC 2CFMA 1X65A 4RCOA 4IFDH 1A2UA 1N32L 1G6ZA 1VQGA 4OONA 2R7NA 3IRBA 3SE0A 1YHQA 1HFNA 3S16H 1PZID 1CTMA 4K5XA 4A4IA 5C3XA 5C3EH 4JI6Q 4ZHQF 5HGQA 2YW2A 3BJUA 2XIGA 1UNSA 3ORRA 3G7LA 2ASJA 4K0KH 3KAKA 3JAML 2DGYA 2YS7A 4DL2A 4OX9H 4LJZC 5JJZA 4L5TA 3OW2A 1EUJA 2IP4A 1ILQA 1QWYA 3EA6A 1XWEA 4ABNA 4FM9A 2N49A 1C48A 1VQCA 3PUZA 3S2DB 3L3OC 4ED8A 3URYA 3QB3A 2M05A 2R8KA 1EQRA 4BY7G 3JSLA 1SYEA 2I46A 2NN6H 4BBRH 3AFQA 4RUCA 4CBVA 2PZUA 2IJ0A 4KV6A 4A3IB 4JUZA 2VPSA 5L1LA 2HCCA 3DF7A 3KJPA 2YYZA 3IAYA 5I2YA 2I5HA 1Q12A 4L5SA 2ALYB 2DLNA 3IFDA 2MJ8A 4APVA 5IYDG 5KFWA 1E2VA 1FNWA 5JJLA 3T5KA 1B4OA 3T5HA 4DN4M 4IALA 3BA9A 2R8IA 1TWAH 2PO4A 2VZAA 3EIVA 4J9OA 1CQIB 1Z9FA 3CW2C 3V05A 3VR5A 3GTJB 5CA0F 5EWFA
chains in the Genus database with same CATH topology
3M4QA 2OWOA 4JI4Q 1JJCB 4AIMA 1UE5A 4NXNL 1VQFA 5IP9H 4GN4B 4A76A 1HNZL 2JA5H 1LM0A 3PF4A 4YWKA 3AYHB 1SLJA 1VQHA 1IBKQ 2VUMG 4Y52H 1CKNB 3PIPA 2CCZA 4LF5L 4BY1H 4DR3L 3I7FA 5FJ8H 4GNXA 4DAMA 4DR2L 3HOVH 4P74A 1I94L 3CC2A 4GLAC 4DR7Q 2R93H 1T9HA 2GVBA 4JBWA 2K50A 3CPFA 3ERSX 1FJGL 5AJ3Q 4JI7Q 4HJ9A 2PI2A 5FLMH 1S72A 2YTVA 4DKAC 3HOYH 3TRZA 1NMFA 3J81i 3AFPA 1V1QA 1JJ2A 3CCJA 4GKKQ 3G48A 3CXCA 1K3RA 4KHPQ 3FHWA 4QL5A 1CKOA 3KOJA 4K0KL 3UDFA 4LFCQ 3PF5A 4LUZA 2BA0A 2OTLA 1P8LA 4JI0L 5M3FG 4B3MQ 3ER0A 3CD6A 1YZ6A 5JJKA 3KLWA 5IYCH 1Z47A 2Z0SA 1BBWA 2UU9L 3HKSA 1PH2A 1D8LA 2HT1A 3F2CA 2E5LL 1RIPA 1Q1EA 5JJIA 5J3BA 1KC8C 4QQBX 1JT8A 2ES2A 2OQKA 1Y1VH 4LF4L 2JA7G 3U50C 3E9HA 2PNHA 2HIXA 1VQJA 1V9PA 4GKJL 2WAQG 1YIJA 1K73C 2XTIA 1HNXL 4LFBQ 1PH6A 1HZBA 3S14H 4LFAL 3CPWA 2KBNA 1TWCH 3DM3A 4GOPB 3RR5A 2JA6G 4A3BH 2NVXH 2BA1A 3GTOH 3JAMi 2A1AA 4A3GH 2AHOB 1VQNA 1KL9A 3VDYA 4A3KH 4X65L 1HZ9A 2UUCQ 4RG1A 4JI3L 3ULJA 1XNQL 2EXDA 3PO2G 2JA8H 1PH1A 3CAMA 4DR4L 2AWNA 2N8NA 4YY3L 4OXPA 3J80i 3K0XA 2NVTH 5M3MG 2B63H 3S2DH 4A3LG 1JMCA 4WJ3M 1WCMH 1Q1BA 1AE3A 1CKNA 2OCEA 4R4OA 4DV4Q 3RZDH 2WB1E 2JA8G 1JB7A 4MNOA 2KHJA 1E1TA 4LNQA 2JQOA 1JE5A 4P71A 3RLNA 3A74A 5K36G 4LF8Q 1QVGA 1PH4A 4JG2A 3W1GA 3I4MG 3TS0A 1I3QH 2NVYH 3G6EA 3CCRA 1N34Q 4NXMQ 3CF5A 4QY7A 2UUBQ 4AYBE 2JK8A 3K7AH 4L5QA 3J7A5 2Q2IA 1Q82C 4DV2L 1XNRQ 4LUOA 4A3GG 3PV0A 4JOIA 2YTYA 3BU2A 1YJNA 1XMOQ 2N3SA 1XPRA 2CQOA 3CCSA 1EIFA 1WJJA 4DV7Q 2UXDL 2RCNA 4LF7L 2JEAI 2QGQA 4IO9A 1IBMQ 3UDGA 1C9OA 4JI8L 5IP7H 2PI2E 1S40A 1YJWA 1VQOA 4GNXC 2AMCB 1VQDA 3PUVA 4DV7L 4B3RL 4HIKA 4JBJA 1I50H 1BBUA 3H15A 1YBYA 3K8AA 3G71A 1PH5A 5IP7G 1W2BA 4X62Q 2I5MX 2LXJA 4YCWA 3OTOL 4LW1A 3MEFA 2GVAA 2YV5A 4IPDA 4NXML 4TQUS 1HR0L 2K5VA 5BR8Q 2ZTDA 3B6YA 3PGZA 3CCLA 4GOPC 2F3IA 2VL6A 4BA1I 4A3DH 3BZCA 1CKMA 1PH9A 4AYBG 5FLMG 1XPOA 3PO2H 5JEAJ 1HR0Q 3GTJH 4BBSG 4PMWA 4L5RC 1KRTA 1X9NA 3OTOQ 1VQIA 1X54A 1QVFA 4X62L 1FVIA 3I4NH 4AQYQ 2V1CC 4XTCS 3L7ZC 3U4VA 1H95A 3CMAA 3S1RH 1IYJB 4YY3Q 3U58A 2VUMH 4DR4Q 3T1YL 3GTGH 4HJ7A 3OYYA 3NBHB 2CWPA 4JI3Q 2NN6G 2ZTEA 1UE6A 2A8VA 5C3EG 2Q2HA 3J81j 3HOWH 5GAHC 1QZHA 1GO3E 2IT1A 4P73A 1IBML 4IOAA 1N8RC 1Y1VG 4YWLA 3K80C 4LF7Q 4A3FG 3DLLA 3GTKH 4MTNA 1PA6A 1YITA 1PH3A 3HOXH 2YU9H 3FKIH 1UE7A 2ZM6L 1XMOL 1C7YA 3GTMH 3PCOB 1PH7A 1D7QA 4DV2Q 1XNRL 3NELA 1VQPA 5IWAQ 1EIYB 1OXUA 1RL2A 4OO1G 4UP8A 3CCVA 1A62A 3HOUH 3RZOH 1A63A 1N34L 1NE3A 3GD7A 1B8AA 1VQBA 1PYBA 3S1NH 1TXYA 5FLXc 3A5ZB 3F2BA 1YNXA 3CMEA 3I4MH 1U5KA 1U0LA 1VS0A 4JYAL 4GOPA 1KRSA 2B3GA 4ME3A 2I0QA 1O7IA 4Y7NH 4B3ML 4B3SQ 2JA7H 2JA9A 3M4OH 1KD1C 3H3VH 2ATWA 1BKBA 1CSQA 3ZJYC 4IOCA 4LF9Q 4HJ8A 2R7ZH 1YVCA 1SMXA 3NENA 3RLOA 4X66L 1L2FA 5H1SE 3KJOA 4BXXG 1VQAA 3KF8B 5M3FH 1P16A 4IPGA 4C3HH 5FJ8G 2UUCL 1Q8KA 4IJLA 1Q81C 2LSSA 1FJGQ 3PO3G 1LYLA 3HKZG 3BZKA 2F4VL 1Q7YC 3I4NG 1PV4A 2F4VQ 3CC7A 3CCMA 4LF5Q 4HIDA 1EYGA 1ASZA 4HJ5A 4WJ4A 1L1OA 1IBKL 2UUAL 2VS1A 5C0XJ 2B29A 1CSPA 4X66Q 4IPCA 4DAYB 4LFBL 4R4IA 1QZGA 4LF9L 4JI4L 3I55A 1PH8A 3S24A 4GNXB 4LF4Q 1N33L 2BH2A 1OXSC 2E5LQ 2MO1A 4B3SL 1HZCA 3HOZH 1NBWA 2QA4A 3S2HH 1KXLA 5HY6A 1KQSA 1R9TH 3M3YH 1UWVA 2AWOA 5GROA 1YJ9A 4JI0Q 2IX1A 2AKWB 4UP9A 1N33Q 1Y14B 3E0EA 1Q46A 4KHPL 1B7YB 4C3IH 1I5FA 1A8VA 3W5OA 5IWAL 4GKKL 1V43A 3KF6B 1EOVA 1BVSA 3CQZH 1AH9A 2A19A 3CCQA 3UDIA 4UPAA 4A3EG 2UUAQ 2ID0A 3EN2A 4IFDG 2MQHA 5AJ3L 4JI7L 2VQEL 2JA5G 1PYSB 4UP7A 1HH2P 3J80c 3GTPH 1PFSA 3S17H 2E2HH 4OWXB 4DR2Q 2UXCQ 4R1JA 4BY1G 1ASYA 2GN5A 2WFWA 5GQOA 3M85A 2ZJRA 2R93G 1HJPA 1Y1WH 1E3PA 3PO3H 1E24A 1VQKA 3JAMc 4NXNQ 2MNAA 4AQYL 4OWWB 3KYHC 1A0IA 1EQQA 1VQ9A 3TS2A 5C0XG 5IE8A 4A75A 1IZ6A 4J15A 5IP9G 1CUKA 3I4OA 1KHIA 1J6QA 3PIOA 4R4CA 4B3TQ 4JYAQ 4X6AH 3M4PA 5GAGC 2YTXA 2VQFL 4A3MG 4JI5L 5LMNW 2FXQA 2R92G 1VQMA 2D0PA 2Z6KC 1EFWA 5LMUL 5IYBH 1M90C 4IFDI 4OX9Q 4DV5L 1MIUA 3GDEA 1TWGH 3GO5A 4TVAB 4A3MH 2F52A 1LTLA 3HKZE 5M5XH 4A3IG 4DPGA 1MJEA 3HOYG 1N32Q 2ZM6Q 1YHBA 3JC66 1X56A 3HOZG 4A3LH 3UDXA 2Y0SE 3UE0A 4B3RQ 3M7NA 4DR1Q 4KHZA 3H0GG 1XTDA 4POGA 4LUVA 4A93H 1SE8A 2NZOA 4MZ9A 4GN3B 4IFDJ 1NTGA 4JC0A 4A3FH 2Z6KA 3PUWA 1DGSA 2Q2UA 3HOWG 3PUXA 2UXDQ 4IJHA 3S15H 4DR6Q 3T1YQ 3G4SA 2WB1G 1PVOA 1HNWL 1XJVA 5LMNL 2K14A 1L1OC 2NN6I 2KENA 4RMFA 4DUYQ 4FDBA 3TEHB 5C44G 1X3EA 3TREA 1S3OA 2N78A 5C4JH 2HIVA 3NEMA 2ASBA 1SN8A 5ELOA 4NPSA 4DV1L 2ZJPA 1GM5A 2IHEA 1NMGA 3FP9A 3STBD 3RN2A 4JCVE 3STBC 1N36Q 2WAQE 1K83H 1E7ZA 2R7DA 2RHSB 5BR8L 3J81c 2CWAA 4A3DG 4JI6L 1SRUA 3F1ZA 4YHHL 4DUZL 1YEZA 3MXNB 2K4KA 2QEXA 3HOVG 1FL0A 1GKHA 3S1MH 3ULLA 1J5EL 2IHFA 2PQAB 3UE1A 4DV0Q 1EWIA 2C35B 1XMQQ 1VQ7A 3H3VI 1SFOH 1NJIC 1L1OB 2E8GA 1OTCA 3RNUA 3K7UC 1YI2A 4LF6L 2OTJA 1UE1A 2KCTA 3M9BA 3PUYA 4QGUA 4POFA 3ULPA 2R92H 1OXXK 1AE2A 1VQEA 2D0OA 4JI8Q 1X55A 4R4TA 4A3CH 2XGTA 1YHAA 4NB3A 1K0RA 3CC4A 1E1OA 4HIMA 4JV5Q 3CCUA 4LFAQ 3U4ZA 1L0WA 5M5YH 3F2DA 4PZ6A 4DK6C 2H5XA 5DLQE 4DNIA 4H02A 1GVPA 4GKJQ 4BXXH 3HFZB 4GLXA 4PZ8A 2UUBL 3PSIA 1IL2A 1G291 1QUQA 4KLKA 4LF8L 4DR5L 1VCIA 1VQ8A 2NVQH 3J7ZC 3A5UA 4JBMA 1B70B 3Q8DA 4HIOA 1KAWA 2OQ0A 4DV4L 3E9IA 4EQ5A 4LFCL 5IYDH 4BBSH 1TWFH 4R4QA 3TQYA 2EIFA 2K75A 2NZHA 2DUDA 4A3EH 1K9MC 4BBRG 3CP0A 5IYCG 1X6OA 1WI5A 2HHHL 4LF6Q 5C0XI 1IXRA 4DV3L 1PHJA 2CKZB 2WP8J 1FGUA 4JBKA 4DV3Q 2L15A 1XNQQ 2B63G 1XMQL 2HHHQ 3S1QH 1J5EQ 1WFQA 1MJCA 4X65Q 2KCMA 3KF6A 4HJAA 5M3MH 3RLFA 4YHHQ 4P75A 2R6GA 4DUZQ 3CCEA 5JEAG 2K52A 4EX5A 1QVCA 2VNUD 4LWCA 3W1BA 1N36L 1M1KC 4BA2I 2RF4A 3KFUA 4DR5Q 4A3JH 2R7FA 5GAEC 1HNXQ 1LUZA 2JEBI 2Q2TA 2ZTCA 2R7ZG 4UY8C 2E2JH 1K8AC 1VQ4A 1JJGA 1VQLA 1SROA 4O0AA 5ELNA 1GD7A 3SGIA 1SR3A 1KIXA 5LMNQ 2PQAA 2MFIA 2UU9Q 3EBEA 2KHIA 3KDFA 4JV5L 4DR6L 2I5LX 2MO0A 1HZAA 3GTLH 4JI1L 3A0JA 2IX0A 2BH8A 4K0KQ 1I6HH 1QUQB 4GS3A 4KI0A 1E22A 2EQSA 3WWVA 3T1HL 4QIWE 1OXTA 2CFMA 1X65A 4DR1L 3FKIG 3AQQA 2ZJQA 2UXBQ 4OWTB 2D62A 4AH6A 4GLVB 4DV6L 4OO1I 1N32L 1VQGA 4IPHA 4DV0L 3K81C 1IBLQ 1X3FA 4OONA 3IRBA 5GADC 1TWHH 1YHQA 1G51A 4OX9L 1I94Q 3S16H 4DR7L 1W3SA 4A4IA 4DR3Q 5C3EH 2K5NA 4JI6Q 4PZ7A 5M5WH 1WCMG 1MKHA 5HGQA 1Q86C 5EAYA 3BJUA 4JI2Q 3ICEA 2JA6H 2K5HA 2Y0SG 4A3BG 1HR0W 4JOIC 4C2MH 2VQFQ 5IT9c 2DGYA 4PG3A 4A3IH 1HNZQ 2E2IH 4L5TA 4DV1Q 1Y1WG 3HOXG 4A3KG 2HQLA 3OW2A 1G6PA 1EUJA 4DK3C 4QJFA 5C4XG 4X64L 3H0GH 1X3GA 2LXKA 4DUYL 4YCUA 2N49A 1VQCA 1WYDA 3PUZA 4A3JG 1VQ6A 4A3CG 1HNWQ 4ALPA 3D0FA 4JI2L 1EQRA 3D31A 4BY7G 2UXCL 4BBRH 3AFQA 3L2PA 3AEVA 5IY0A 5IYBG 3KDFB 4YWMA 1IBLL 2VQEQ 3KJPA 2PMZE 1K8GA 1NY4A 2YYZA 4XIGS 4DV6Q 2JE6I 2UXBL 2IY5B 4A93G 2I5HA 1Q12A 4L5SA 3T1HQ 1WOCA 1UEBA 2ALYB 3L0OA 3LGJA 1VQ5A 4DV5Q 4APVA 2RHQB 3RN5A 2VY3A 5LMUQ 5E7NA 4C3JH 3F8TA 4JI1Q 4YCVA 5IYDG 2VW9A 5C4XH 3HOUG 3I2ZA 1C0AA 5JJLA 4JI5Q 1N9WA 1TWAH 2VZAA 2JJQA 3EIVA 3GTQH 3I56A 4GN5A 4B3TL 5C44H 1XPUA 1OXVA 4O2DA 4P72A 1Z9FA 3CW2C 4X64Q 4BY7H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M4Q A;  2OWO A;  4JI4 Q;  1JJC B;  4AIM A;  1UE5 A;  4NXN L;  1VQF A;  5IP9 H;  4GN4 B;  4A76 A;  1HNZ L;  2JA5 H;  1LM0 A;  3PF4 A;  4YWK A;  3AYH B;  1SLJ A;  1VQH A;  1IBK Q;  2VUM G;  4Y52 H;  1CKN B;  3PIP A;  2CCZ A;  4LF5 L;  4BY1 H;  4DR3 L;  3I7F A;  5FJ8 H;  4GNX A;  4DAM A;  4DR2 L;  3HOV H;  4P74 A;  1I94 L;  3CC2 A;  4GLA C;  4DR7 Q;  2R93 H;  1T9H A;  2GVB A;  4JBW A;  2K50 A;  3CPF A;  3ERS X;  1FJG L;  5AJ3 Q;  4JI7 Q;  4HJ9 A;  2PI2 A;  5FLM H;  1S72 A;  2YTV A;  4DKA C;  3HOY H;  3TRZ A;  1NMF A;  3J81 i;  3AFP A;  1V1Q A;  1JJ2 A;  3CCJ A;  4GKK Q;  3G48 A;  3CXC A;  1K3R A;  4KHP Q;  3FHW A;  4QL5 A;  1CKO A;  3KOJ A;  4K0K L;  3UDF A;  4LFC Q;  3PF5 A;  4LUZ A;  2BA0 A;  2OTL A;  1P8L A;  4JI0 L;  5M3F G;  4B3M Q;  3ER0 A;  3CD6 A;  1YZ6 A;  5JJK A;  3KLW A;  5IYC H;  1Z47 A;  2Z0S A;  1BBW A;  2UU9 L;  3HKS A;  1PH2 A;  1D8L A;  2HT1 A;  3F2C A;  2E5L L;  1RIP A;  1Q1E A;  5JJI A;  5J3B A;  1KC8 C;  4QQB X;  1JT8 A;  2ES2 A;  2OQK A;  1Y1V H;  4LF4 L;  2JA7 G;  3U50 C;  3E9H A;  2PNH A;  2HIX A;  1VQJ A;  1V9P A;  4GKJ L;  2WAQ G;  1YIJ A;  1K73 C;  2XTI A;  1HNX L;  4LFB Q;  1PH6 A;  1HZB A;  3S14 H;  4LFA L;  3CPW A;  2KBN A;  1TWC H;  3DM3 A;  4GOP B;  3RR5 A;  2JA6 G;  4A3B H;  2NVX H;  2BA1 A;  3GTO H;  3JAM i;  2A1A A;  4A3G H;  2AHO B;  1VQN A;  1KL9 A;  3VDY A;  4A3K H;  4X65 L;  1HZ9 A;  2UUC Q;  4RG1 A;  4JI3 L;  3ULJ A;  1XNQ L;  2EXD A;  3PO2 G;  2JA8 H;  1PH1 A;  3CAM A;  4DR4 L;  2AWN A;  2N8N A;  4YY3 L;  4OXP A;  3J80 i;  3K0X A;  2NVT H;  5M3M G;  2B63 H;  3S2D H;  4A3L G;  1JMC A;  4WJ3 M;  1WCM H;  1Q1B A;  1AE3 A;  1CKN A;  2OCE A;  4R4O A;  4DV4 Q;  3RZD H;  2WB1 E;  2JA8 G;  1JB7 A;  4MNO A;  2KHJ A;  1E1T A;  4LNQ A;  2JQO A;  1JE5 A;  4P71 A;  3RLN A;  3A74 A;  5K36 G;  4LF8 Q;  1QVG A;  1PH4 A;  4JG2 A;  3W1G A;  3I4M G;  3TS0 A;  1I3Q H;  2NVY H;  3G6E A;  3CCR A;  1N34 Q;  4NXM Q;  3CF5 A;  4QY7 A;  2UUB Q;  4AYB E;  2JK8 A;  3K7A H;  4L5Q A;  3J7A 5;  2Q2I A;  1Q82 C;  4DV2 L;  1XNR Q;  4LUO A;  4A3G G;  3PV0 A;  4JOI A;  2YTY A;  3BU2 A;  1YJN A;  1XMO Q;  2N3S A;  1XPR A;  2CQO A;  3CCS A;  1EIF A;  1WJJ A;  4DV7 Q;  2UXD L;  2RCN A;  4LF7 L;  2JEA I;  2QGQ A;  4IO9 A;  1IBM Q;  3UDG A;  1C9O A;  4JI8 L;  5IP7 H;  2PI2 E;  1S40 A;  1YJW A;  1VQO A;  4GNX C;  2AMC B;  1VQD A;  3PUV A;  4DV7 L;  4B3R L;  4HIK A;  4JBJ A;  1I50 H;  1BBU A;  3H15 A;  1YBY A;  3K8A A;  3G71 A;  1PH5 A;  5IP7 G;  1W2B A;  4X62 Q;  2I5M X;  2LXJ A;  4YCW A;  3OTO L;  4LW1 A;  3MEF A;  2GVA A;  2YV5 A;  4IPD A;  4NXM L;  4TQU S;  1HR0 L;  2K5V A;  5BR8 Q;  2ZTD A;  3B6Y A;  3PGZ A;  3CCL A;  4GOP C;  2F3I A;  2VL6 A;  4BA1 I;  4A3D H;  3BZC A;  1CKM A;  1PH9 A;  4AYB G;  5FLM G;  1XPO A;  3PO2 H;  5JEA J;  1HR0 Q;  3GTJ H;  4BBS G;  4PMW A;  4L5R C;  1KRT A;  1X9N A;  3OTO Q;  1VQI A;  1X54 A;  1QVF A;  4X62 L;  1FVI A;  3I4N H;  4AQY Q;  2V1C C;  4XTC S;  3L7Z C;  3U4V A;  1H95 A;  3CMA A;  3S1R H;  1IYJ B;  4YY3 Q;  3U58 A;  2VUM H;  4DR4 Q;  3T1Y L;  3GTG H;  4HJ7 A;  3OYY A;  3NBH B;  2CWP A;  4JI3 Q;  2NN6 G;  2ZTE A;  1UE6 A;  2A8V A;  5C3E G;  2Q2H A;  3J81 j;  3HOW H;  5GAH C;  1QZH A;  1GO3 E;  2IT1 A;  4P73 A;  1IBM L;  4IOA A;  1N8R C;  1Y1V G;  4YWL A;  3K80 C;  4LF7 Q;  4A3F G;  3DLL A;  3GTK H;  4MTN A;  1PA6 A;  1YIT A;  1PH3 A;  3HOX H;  2YU9 H;  3FKI H;  1UE7 A;  2ZM6 L;  1XMO L;  1C7Y A;  3GTM H;  3PCO B;  1PH7 A;  1D7Q A;  4DV2 Q;  1XNR L;  3NEL A;  1VQP A;  5IWA Q;  1EIY B;  1OXU A;  1RL2 A;  4OO1 G;  4UP8 A;  3CCV A;  1A62 A;  3HOU H;  3RZO H;  1A63 A;  1N34 L;  1NE3 A;  3GD7 A;  1B8A A;  1VQB A;  1PYB A;  3S1N H;  1TXY A;  5FLX c;  3A5Z B;  3F2B A;  1YNX A;  3CME A;  3I4M H;  1U5K A;  1U0L A;  1VS0 A;  4JYA L;  4GOP A;  1KRS A;  2B3G A;  4ME3 A;  2I0Q A;  1O7I A;  4Y7N H;  4B3M L;  4B3S Q;  2JA7 H;  2JA9 A;  3M4O H;  1KD1 C;  3H3V H;  2ATW A;  1BKB A;  1CSQ A;  3ZJY C;  4IOC A;  4LF9 Q;  4HJ8 A;  2R7Z H;  1YVC A;  1SMX A;  3NEN A;  3RLO A;  4X66 L;  1L2F A;  5H1S E;  3KJO A;  4BXX G;  1VQA A;  3KF8 B;  5M3F H;  1P16 A;  4IPG A;  4C3H H;  5FJ8 G;  2UUC L;  1Q8K A;  4IJL A;  1Q81 C;  2LSS A;  1FJG Q;  3PO3 G;  1LYL A;  3HKZ G;  3BZK A;  2F4V L;  1Q7Y C;  3I4N G;  1PV4 A;  2F4V Q;  3CC7 A;  3CCM A;  4LF5 Q;  4HID A;  1EYG A;  1ASZ A;  4HJ5 A;  4WJ4 A;  1L1O A;  1IBK L;  2UUA L;  2VS1 A;  5C0X J;  2B29 A;  1CSP A;  4X66 Q;  4IPC A;  4DAY B;  4LFB L;  4R4I A;  1QZG A;  4LF9 L;  4JI4 L;  3I55 A;  1PH8 A;  3S24 A;  4GNX B;  4LF4 Q;  1N33 L;  2BH2 A;  1OXS C;  2E5L Q;  2MO1 A;  4B3S L;  1HZC A;  3HOZ H;  1NBW A;  2QA4 A;  3S2H H;  1KXL A;  5HY6 A;  1KQS A;  1R9T H;  3M3Y H;  1UWV A;  2AWO A;  5GRO A;  1YJ9 A;  4JI0 Q;  2IX1 A;  2AKW B;  4UP9 A;  1N33 Q;  1Y14 B;  3E0E A;  1Q46 A;  4KHP L;  1B7Y B;  4C3I H;  1I5F A;  1A8V A;  3W5O A;  5IWA L;  4GKK L;  1V43 A;  3KF6 B;  1EOV A;  1BVS A;  3CQZ H;  1AH9 A;  2A19 A;  3CCQ A;  3UDI A;  4UPA A;  4A3E G;  2UUA Q;  2ID0 A;  3EN2 A;  4IFD G;  2MQH A;  5AJ3 L;  4JI7 L;  2VQE L;  2JA5 G;  1PYS B;  4UP7 A;  1HH2 P;  3J80 c;  3GTP H;  1PFS A;  3S17 H;  2E2H H;  4OWX B;  4DR2 Q;  2UXC Q;  4R1J A;  4BY1 G;  1ASY A;  2GN5 A;  2WFW A;  5GQO A;  3M85 A;  2ZJR A;  2R93 G;  1HJP A;  1Y1W H;  1E3P A;  3PO3 H;  1E24 A;  1VQK A;  3JAM c;  4NXN Q;  2MNA A;  4AQY L;  4OWW B;  3KYH C;  1A0I A;  1EQQ A;  1VQ9 A;  3TS2 A;  5C0X G;  5IE8 A;  4A75 A;  1IZ6 A;  4J15 A;  5IP9 G;  1CUK A;  3I4O A;  1KHI A;  1J6Q A;  3PIO A;  4R4C A;  4B3T Q;  4JYA Q;  4X6A H;  3M4P A;  5GAG C;  2YTX A;  2VQF L;  4A3M G;  4JI5 L;  5LMN W;  2FXQ A;  2R92 G;  1VQM A;  2D0P A;  2Z6K C;  1EFW A;  5LMU L;  5IYB H;  1M90 C;  4IFD I;  4OX9 Q;  4DV5 L;  1MIU A;  3GDE A;  1TWG H;  3GO5 A;  4TVA B;  4A3M H;  2F52 A;  1LTL A;  3HKZ E;  5M5X H;  4A3I G;  4DPG A;  1MJE A;  3HOY G;  1N32 Q;  2ZM6 Q;  1YHB A;  3JC6 6;  1X56 A;  3HOZ G;  4A3L H;  3UDX A;  2Y0S E;  3UE0 A;  4B3R Q;  3M7N A;  4DR1 Q;  4KHZ A;  3H0G G;  1XTD A;  4POG A;  4LUV A;  4A93 H;  1SE8 A;  2NZO A;  4MZ9 A;  4GN3 B;  4IFD J;  1NTG A;  4JC0 A;  4A3F H;  2Z6K A;  3PUW A;  1DGS A;  2Q2U A;  3HOW G;  3PUX A;  2UXD Q;  4IJH A;  3S15 H;  4DR6 Q;  3T1Y Q;  3G4S A;  2WB1 G;  1PVO A;  1HNW L;  1XJV A;  5LMN L;  2K14 A;  1L1O C;  2NN6 I;  2KEN A;  4RMF A;  4DUY Q;  4FDB A;  3TEH B;  5C44 G;  1X3E A;  3TRE A;  1S3O A;  2N78 A;  5C4J H;  2HIV A;  3NEM A;  2ASB A;  1SN8 A;  5ELO A;  4NPS A;  4DV1 L;  2ZJP A;  1GM5 A;  2IHE A;  1NMG A;  3FP9 A;  3STB D;  3RN2 A;  4JCV E;  3STB C;  1N36 Q;  2WAQ E;  1K83 H;  1E7Z A;  2R7D A;  2RHS B;  5BR8 L;  3J81 c;  2CWA A;  4A3D G;  4JI6 L;  1SRU A;  3F1Z A;  4YHH L;  4DUZ L;  1YEZ A;  3MXN B;  2K4K A;  2QEX A;  3HOV G;  1FL0 A;  1GKH A;  3S1M H;  3ULL A;  1J5E L;  2IHF A;  2PQA B;  3UE1 A;  4DV0 Q;  1EWI A;  2C35 B;  1XMQ Q;  1VQ7 A;  3H3V I;  1SFO H;  1NJI C;  1L1O B;  2E8G A;  1OTC A;  3RNU A;  3K7U C;  1YI2 A;  4LF6 L;  2OTJ A;  1UE1 A;  2KCT A;  3M9B A;  3PUY A;  4QGU A;  4POF A;  3ULP A;  2R92 H;  1OXX K;  1AE2 A;  1VQE A;  2D0O A;  4JI8 Q;  1X55 A;  4R4T A;  4A3C H;  2XGT A;  1YHA A;  4NB3 A;  1K0R A;  3CC4 A;  1E1O A;  4HIM A;  4JV5 Q;  3CCU A;  4LFA Q;  3U4Z A;  1L0W A;  5M5Y H;  3F2D A;  4PZ6 A;  4DK6 C;  2H5X A;  5DLQ E;  4DNI A;  4H02 A;  1GVP A;  4GKJ Q;  4BXX H;  3HFZ B;  4GLX A;  4PZ8 A;  2UUB L;  3PSI A;  1IL2 A;  1G29 1;  1QUQ A;  4KLK A;  4LF8 L;  4DR5 L;  1VCI A;  1VQ8 A;  2NVQ H;  3J7Z C;  3A5U A;  4JBM A;  1B70 B;  3Q8D A;  4HIO A;  1KAW A;  2OQ0 A;  4DV4 L;  3E9I A;  4EQ5 A;  4LFC L;  5IYD H;  4BBS H;  1TWF H;  4R4Q A;  3TQY A;  2EIF A;  2K75 A;  2NZH A;  2DUD A;  4A3E H;  1K9M C;  4BBR G;  3CP0 A;  5IYC G;  1X6O A;  1WI5 A;  2HHH L;  4LF6 Q;  5C0X I;  1IXR A;  4DV3 L;  1PHJ A;  2CKZ B;  2WP8 J;  1FGU A;  4JBK A;  4DV3 Q;  2L15 A;  1XNQ Q;  2B63 G;  1XMQ L;  2HHH Q;  3S1Q H;  1J5E Q;  1WFQ A;  1MJC A;  4X65 Q;  2KCM A;  3KF6 A;  4HJA A;  5M3M H;  3RLF A;  4YHH Q;  4P75 A;  2R6G A;  4DUZ Q;  3CCE A;  5JEA G;  2K52 A;  4EX5 A;  1QVC A;  2VNU D;  4LWC A;  3W1B A;  1N36 L;  1M1K C;  4BA2 I;  2RF4 A;  3KFU A;  4DR5 Q;  4A3J H;  2R7F A;  5GAE C;  1HNX Q;  1LUZ A;  2JEB I;  2Q2T A;  2ZTC A;  2R7Z G;  4UY8 C;  2E2J H;  1K8A C;  1VQ4 A;  1JJG A;  1VQL A;  1SRO A;  4O0A A;  5ELN A;  1GD7 A;  3SGI A;  1SR3 A;  1KIX A;  5LMN Q;  2PQA A;  2MFI A;  2UU9 Q;  3EBE A;  2KHI A;  3KDF A;  4JV5 L;  4DR6 L;  2I5L X;  2MO0 A;  1HZA A;  3GTL H;  4JI1 L;  3A0J A;  2IX0 A;  2BH8 A;  4K0K Q;  1I6H H;  1QUQ B;  4GS3 A;  4KI0 A;  1E22 A;  2EQS A;  3WWV A;  3T1H L;  4QIW E;  1OXT A;  2CFM A;  1X65 A;  4DR1 L;  3FKI G;  3AQQ A;  2ZJQ A;  2UXB Q;  4OWT B;  2D62 A;  4AH6 A;  4GLV B;  4DV6 L;  4OO1 I;  1N32 L;  1VQG A;  4IPH A;  4DV0 L;  3K81 C;  1IBL Q;  1X3F A;  4OON A;  3IRB A;  5GAD C;  1TWH H;  1YHQ A;  1G51 A;  4OX9 L;  1I94 Q;  3S16 H;  4DR7 L;  1W3S A;  4A4I A;  4DR3 Q;  5C3E H;  2K5N A;  4JI6 Q;  4PZ7 A;  5M5W H;  1WCM G;  1MKH A;  5HGQ A;  1Q86 C;  5EAY A;  3BJU A;  4JI2 Q;  3ICE A;  2JA6 H;  2K5H A;  2Y0S G;  4A3B G;  1HR0 W;  4JOI C;  4C2M H;  2VQF Q;  5IT9 c;  2DGY A;  4PG3 A;  4A3I H;  1HNZ Q;  2E2I H;  4L5T A;  4DV1 Q;  1Y1W G;  3HOX G;  4A3K G;  2HQL A;  3OW2 A;  1G6P A;  1EUJ A;  4DK3 C;  4QJF A;  5C4X G;  4X64 L;  3H0G H;  1X3G A;  2LXK A;  4DUY L;  4YCU A;  2N49 A;  1VQC A;  1WYD A;  3PUZ A;  4A3J G;  1VQ6 A;  4A3C G;  1HNW Q;  4ALP A;  3D0F A;  4JI2 L;  1EQR A;  3D31 A;  4BY7 G;  2UXC L;  4BBR H;  3AFQ A;  3L2P A;  3AEV A;  5IY0 A;  5IYB G;  3KDF B;  4YWM A;  1IBL L;  2VQE Q;  3KJP A;  2PMZ E;  1K8G A;  1NY4 A;  2YYZ A;  4XIG S;  4DV6 Q;  2JE6 I;  2UXB L;  2IY5 B;  4A93 G;  2I5H A;  1Q12 A;  4L5S A;  3T1H Q;  1WOC A;  1UEB A;  2ALY B;  3L0O A;  3LGJ A;  1VQ5 A;  4DV5 Q;  4APV A;  2RHQ B;  3RN5 A;  2VY3 A;  5LMU Q;  5E7N A;  4C3J H;  3F8T A;  4JI1 Q;  4YCV A;  5IYD G;  2VW9 A;  5C4X H;  3HOU G;  3I2Z A;  1C0A A;  5JJL A;  4JI5 Q;  1N9W A;  1TWA H;  2VZA A;  2JJQ A;  3EIV A;  3GTQ H;  3I56 A;  4GN5 A;  4B3T L;  5C44 H;  1XPU A;  1OXV A;  4O2D A;  4P72 A;  1Z9F A;  3CW2 C;  4X64 Q;  4BY7 H; 
#chains in the Genus database with same CATH topology
 4JI4 Q;  1EY5 A;  5DEH A;  3VA5 A;  1EIG A;  5BPF A;  5LYJ F;  2YRW A;  2V4Q A;  3PF4 A;  3ERO A;  3AYH B;  3GQB A;  3IL8 A;  1SLJ A;  4YWK A;  1IBK Q;  1IBL H;  2YU9 A;  4Y52 H;  2NUA B;  2HD3 A;  3TZU A;  4DR3 L;  4C3H G;  4RAY A;  2C2E A;  4DAM A;  3HOV H;  4P74 A;  1I94 L;  4DR7 Q;  2VB2 X;  2R93 H;  4ECV A;  3MWE A;  4YR3 A;  2XWJ B;  3E6Z X;  1MSG A;  3CPF A;  1S4Z A;  1SXT A;  5AJ3 Q;  1KJI A;  3K5H A;  1U4L A;  4EVO A;  5COY A;  1TII D;  3G6V A;  1R9T B;  1LT6 D;  3GTK B;  1BCP C;  1JJ2 A;  1S5C D;  3D4R A;  5KG3 A;  1S5F D;  1K3R A;  1TR5 A;  3CXC A;  3FHW A;  4H13 C;  4DAY A;  4KHP Q;  3UDF A;  3OUZ A;  3PF5 A;  3PW5 A;  3Q1K A;  2O4X A;  3S1N B;  3KLW A;  4K5W A;  1BBW A;  1D8L A;  4JI3 H;  5DGB A;  4CDC C;  1Q1E A;  3D6C A;  5J3B A;  3GII A;  1ONL A;  1Y1V H;  2JA7 G;  2W9C B;  3PW7 A;  3E9H A;  2PNH A;  2HIX A;  4GKJ L;  2WAQ G;  1YIJ A;  2KHS A;  5EGT A;  1TWC H;  3RR5 A;  2JA6 G;  1JKJ B;  2HHH H;  1C3O A;  2W6M A;  3SE7 A;  3BJY A;  1LV9 A;  2AHO B;  1TWH A;  3A7L A;  4JI3 L;  1PZJ D;  3ULJ A;  2R82 A;  3D8G A;  4DR4 L;  3CAM A;  2SNM A;  1J8I A;  3K0X A;  3BYT B;  3S2D H;  4KKU A;  5M3M B;  2QK4 A;  2YS6 A;  5KT5 A;  4O4L F;  4OL7 A;  4XDX A;  4RB1 A;  4U7C A;  3ORQ A;  2JA8 G;  3BVG A;  1JB7 A;  2EYM A;  1VMC A;  1STB A;  2KHJ A;  3CRK C;  5FO8 B;  1G2S A;  1EHI A;  4DV7 H;  2JN4 A;  1W96 A;  1PH4 A;  4MTD A;  3W1G A;  3G6E A;  1I4H A;  4QY7 A;  2UUB Q;  2ICE C;  1K1S A;  5DQG A;  1HA6 A;  4DV3 H;  3KAJ A;  2P5Z X;  5IYZ F;  4A3G G;  2F1M A;  4DV2 L;  3I12 A;  3PV0 A;  1AFP A;  1DCZ A;  3CCS A;  1EIF A;  1WJJ A;  4DV7 Q;  2N88 A;  2XIW A;  2W70 A;  2RCN A;  2VPQ A;  3MFY A;  1TS4 A;  2XGP A;  1H9S A;  1SNM A;  5IP7 H;  2WAQ A;  3AMU A;  3RJ0 A;  2NU8 B;  2AU0 A;  1VQD A;  1IW7 C;  4B3R L;  1U4M A;  3FKI B;  1V51 A;  1I50 H;  3RV4 A;  2W8K A;  1YBY A;  3IKJ A;  3TQT A;  5IP7 G;  1W2B A;  1WD0 A;  1H9S B;  3QZ8 A;  3OTO L;  1L0X B;  1HCZ A;  5C1P A;  4CKE A;  2BE5 C;  5L37 A;  3HOW B;  5A2Q W;  5KG0 A;  3TME A;  2XRS D;  3PW2 A;  3BAA A;  1DOK A;  1EWC A;  2EVB A;  4DLK A;  4AYB G;  5FLM G;  4EGV A;  4G7Z C;  5JEA J;  5KFL A;  3JAM W;  4L5R C;  3ITP A;  1B9N A;  4EQN A;  5KG7 A;  1VQI A;  4X62 L;  1H9R A;  1EYD A;  1E4G T;  2V1C C;  4H0L C;  5C1O A;  2V5A A;  5LL6 b;  1IYJ B;  4YY3 Q;  1JDB B;  4DR4 Q;  1PXU A;  2DIK A;  4HJ7 A;  2SNS A;  4JI3 Q;  3Q22 A;  3U9T A;  3Q8R B;  1WSC A;  1S5E D;  1OO9 B;  2A8V A;  2O03 A;  1GO3 E;  1EUC B;  2NYZ D;  2FE3 A;  2RSO A;  5KIX A;  2I87 A;  1Y1V G;  4LF7 Q;  4QIW A;  4HMJ A;  1QCB D;  5DM6 3;  1PA6 A;  2GLT A;  3OTO H;  2NTS A;  1XMO L;  1A2T A;  1C7Y A;  5KFC A;  3GIL A;  1S68 A;  1PH7 A;  2NU7 B;  4IUR A;  2FK3 A;  4CKC A;  3CCV A;  1A62 A;  2JYO A;  3TP7 A;  4ETS A;  1HHV A;  3D4W A;  4ZUI A;  5FLX c;  4HMI A;  3A5Z B;  1YNX A;  2E74 C;  5C4Z A;  3CME A;  3I4M H;  1U5K A;  1VS0 A;  2L12 A;  4JYA L;  4GOP A;  2B3G A;  4B3M L;  2I0Q A;  1Z7T A;  3MR5 A;  1SEI A;  1KD1 C;  3Q2O A;  4XYM B;  1CSQ A;  4O4H F;  5ELB A;  1I4P A;  4X66 L;  3L4J A;  4NMZ A;  2F0L A;  2NVX B;  5M3F H;  2EYL A;  5KFQ A;  5I4D A;  2FMC A;  3EPG A;  2HVS A;  4X3K A;  4ED2 A;  4QF4 A;  1LYL A;  3I4N G;  3TQ1 A;  1PDQ A;  4RB3 C;  5LMN H;  2BQR A;  4S3S A;  3CCM A;  4HID A;  1ASZ A;  2VXW A;  3BAB A;  1H9K A;  1TS2 A;  5M9O A;  4WJ4 A;  4IUQ A;  1NUC A;  3SVM A;  2B29 A;  3A55 A;  1EY0 A;  4IPC A;  1KNA A;  1QZG A;  2AQ4 A;  2AUJ D;  5EQ0 A;  4JI4 L;  4FS1 A;  4DR4 H;  2AQ3 B;  3S24 A;  4LF4 Q;  2FKL A;  4Q8F A;  5FLX L;  2BH2 A;  2F03 A;  2J9G A;  2TSS A;  2KJX A;  4KHV A;  4B3S L;  1GGO A;  3V96 A;  5IOD A;  1KXL A;  5JVG 3;  1KQS A;  5IGD A;  1EY7 A;  1ICW A;  1K8O A;  1J5E H;  4JI0 Q;  1PTO B;  1SYD A;  4DFA A;  2AKW B;  4UP9 A;  1N33 Q;  1Y14 B;  3K7A B;  1M6V A;  4WRD A;  1NNX A;  5IWA L;  5C3W A;  2UUC H;  4CDD C;  4Q44 A;  4ZQ3 A;  2W6O A;  5LL6 X;  2B2W A;  2ASD A;  2RVL A;  4A3E B;  4EQP A;  4NKL A;  5AJ3 L;  2VQE L;  2JA5 G;  4HTH A;  4J0M A;  1PFS A;  1BCP F;  3S17 H;  4GZY C;  3K3V A;  1UC9 A;  4DR2 Q;  2L9H A;  1ZET A;  4BY1 G;  2GN5 A;  2W7P A;  1UEA B;  1HJP A;  1E3P A;  1E24 A;  3JAM c;  3S1R B;  4NXN Q;  1EQQ A;  1A0I A;  4DR1 H;  2KQ3 A;  4L63 B;  1VQ9 A;  1PYW D;  3FMA A;  1IZ6 A;  1BR9 A;  2I8C A;  4U6P A;  1B2T A;  4X6A H;  2W9B B;  5JAV A;  1AW7 A;  5CBA E;  4X3T A;  1EQV A;  3GP7 A;  2F4V H;  3TIG A;  1J9O A;  2MCT A;  2AQ2 B;  3E3X A;  2D0P A;  1M90 C;  5KFP A;  4OX9 Q;  4CC5 A;  5KGU A;  1C30 A;  1HTL D;  2K32 A;  4A3I G;  3HS0 C;  4APM A;  3HOZ B;  1X56 A;  1ZEQ X;  4A3L H;  3UE0 A;  3H0G G;  2B39 A;  4QCL A;  4A2B A;  5IOC A;  3BDO A;  4NP5 A;  4Y8V B;  5FPR A;  1VBG A;  3DEO A;  1NTG A;  4A3F H;  5DM7 3;  1B44 D;  1MI2 A;  5KFU A;  3G4S A;  2WB1 G;  1EYC A;  3TZD A;  1HNW L;  1U9R A;  2F0I A;  1UNN C;  3ND8 A;  2W9A A;  2C5C A;  4RMF A;  3R2T A;  3TSS A;  1JCK B;  1O7Z A;  2B2U A;  3FVQ A;  2MUY A;  5C44 G;  1XTC D;  4C3H B;  3WNZ A;  2N78 A;  5DQI A;  1F2Z A;  2J6S A;  2HIV A;  2B2U C;  2ASB A;  5KT3 A;  4DV1 L;  2ZJP A;  3STB D;  1N36 Q;  3STB C;  2WAQ E;  1K83 H;  1E7Z A;  2B63 A;  1SYG A;  2B2V A;  5CR3 A;  3F1Z A;  4BY1 B;  5CA1 F;  1HPC A;  1YEZ A;  5JVL A;  4OO1 H;  2K4K A;  2Y0S B;  3S1M H;  5EDW A;  4O4I F;  2X69 A;  1LAC A;  1I6H B;  1EWI A;  5M5X B;  3H3V I;  3GTG B;  1B1Z A;  4K6D A;  1NJI C;  3GIP A;  2E8G A;  4LMQ D;  4FXD A;  5KFO A;  3X3N A;  2KCT A;  4EGQ A;  3ULP A;  3CRL C;  1OXX K;  2EJG C;  1XMO H;  5IIF A;  4HSV A;  4M8A A;  4I4T F;  4R4T A;  5KT7 A;  4ME5 A;  2XGT A;  1YHA A;  3GV3 A;  4NB3 A;  4B9W A;  3F2U A;  3P20 A;  4TV8 F;  5FD5 A;  4JV5 Q;  3CCU A;  1VAJ A;  4DK6 C;  4I7Z C;  1I7N A;  4FF2 A;  2F0K A;  3GV6 A;  1BGW A;  3M4I A;  4O2B F;  1JOQ A;  4JW0 A;  5D1O A;  1I50 B;  4DR5 L;  5KFB A;  3OSP A;  2NVQ H;  3A5U A;  1B70 B;  2V4D A;  2JA6 B;  1PTO D;  1BO0 A;  5IT9 E;  5IYD H;  1SYX B;  4PMB A;  4LFC L;  1TWF H;  3N6R A;  2GA4 B;  3GIM A;  3NTH A;  1K9M C;  4EYH B;  3CP0 A;  1GSA A;  5FK9 C;  5J2T F;  5KFJ A;  2BCO A;  5LMU H;  4DL6 A;  1LTA D;  2R8G A;  1FGU A;  4K6L A;  2HHH Q;  4Q0Y A;  2JXM B;  4DA2 A;  2B2T A;  4X65 Q;  2KCM A;  4P75 A;  3LP8 A;  2E5L H;  5CV8 A;  1B04 A;  1QVC A;  5KFV A;  3W1B A;  2QKI C;  2N55 A;  4DGZ A;  3I8Z A;  3NWS A;  1HNX Q;  4C5B A;  3MR6 A;  1GHK A;  3GTP A;  1UC8 A;  1D1I A;  3H0G B;  3WO0 A;  2NVY A;  4G4K A;  1VQ4 A;  1ML0 D;  1WTW A;  1VQL A;  2E2J B;  4OIJ A;  5D65 A;  1M0T A;  3MXN A;  3SGI A;  2M2L A;  1KIX A;  2MFI A;  2KHI A;  1K28 A;  4X65 H;  1EFI D;  3I3C A;  5E3F A;  3GTL H;  5L1I A;  4ZYS A;  1FR3 A;  4JI1 L;  3A0J A;  3ERQ A;  4C3J G;  1K0S A;  2BH8 A;  1I6H H;  4M9U A;  1QUQ B;  4WBN F;  1ILP A;  5C44 B;  5BN5 A;  3T1H L;  3I70 A;  3AQQ A;  2UXB Q;  4OWT B;  4DAV A;  2D62 A;  4AH6 A;  4DV6 L;  1PTO C;  2K1B A;  1IBL Q;  1X3F A;  1TWH H;  2JP1 A;  3R5F A;  1I94 Q;  4DR7 L;  1W3S A;  2BOS A;  3KLR A;  3HKZ B;  5J22 A;  2EYH A;  2L5T A;  4DR3 Q;  4PZ7 A;  5M5W H;  2CQY A;  2V59 A;  2JA6 H;  2Y0S G;  1WTQ A;  1K8M A;  3BDL A;  5FO9 B;  5KYI A;  1HNZ Q;  1Y8N B;  1Y1W G;  4A3D B;  5C4J B;  5CAE B;  1E0B A;  5IGC A;  1Z6H A;  4HNV A;  1B3A A;  1X3G A;  1GUN A;  2DNC A;  3MWY W;  1VF7 A;  2LS0 1;  4J9R A;  3G6Y A;  1WYD A;  1VQ6 A;  4A3J G;  4J9M A;  4UDU C;  3HP3 A;  1N34 H;  2I80 A;  1KNE A;  2OH2 A;  1I4X A;  3N44 B;  2QYZ A;  3TN2 A;  3AEV A;  2G9H D;  3KDF B;  4AQY H;  1B53 A;  2PMZ E;  1BXT A;  2VB3 X;  1NY4 A;  4XIG S;  4MV7 A;  4DV6 Q;  4PMC A;  5JPN C;  2IY5 B;  4ED1 A;  1SE2 A;  1JE4 A;  2K5Q A;  5DNF A;  2K5W A;  4QMG A;  4DV5 Q;  4HR7 A;  1WVL A;  2EYJ A;  2ZDH A;  3RN5 A;  1AZP A;  4MN3 A;  2F0Q A;  4YCV A;  2VW9 A;  2H4O A;  1SJH D;  5G3L F;  3SXH A;  4IUU A;  3T51 B;  1PLF A;  1N9W A;  2PBZ A;  1CQF A;  2OEO A;  3X3M A;  5C44 H;  2R84 A;  1OXV A;  3JZI A;  3L4K A;  3KHG A;  2OWO A;  1ET9 A;  1UE5 A;  3PR4 A;  2MPM A;  1GHJ A;  4JPB W;  4IHJ F;  1HNZ L;  1EEF D;  3Q24 A;  1LM0 A;  1SFO A;  3GTM A;  2VUM G;  1LT3 D;  2EY2 A;  1CKN B;  1KBL A;  2CCZ A;  5FJ8 H;  4GNX A;  4B3R H;  3RFC A;  3CC2 A;  4LH6 A;  1F2L A;  2GVB A;  3G8C A;  3GTQ B;  3PZP A;  3ERS X;  3I90 A;  1NCV A;  2F0H A;  3VYS A;  4B3M H;  2KOL A;  5E4X A;  4HJ9 A;  2JA6 A;  2PI2 A;  2YTV A;  4LF5 H;  1DJR D;  4DKA C;  1EUD B;  2CW0 D;  2D2C C;  1NMF A;  4GKK H;  3AFP A;  1V1Q A;  2NVY B;  4UCV A;  5KX5 F;  2A6H C;  3G48 A;  5EZY F;  3BYY B;  1CKO A;  3KOJ A;  3Q8P B;  2L0C A;  4LUZ A;  4QB4 A;  3DWA A;  2BA0 A;  4A3J B;  4B3M Q;  3ER0 A;  3FMC A;  5IYC H;  1Y8O B;  3HKS A;  3F2C A;  2E5L L;  5C8Y F;  1RIP A;  5JJI A;  2FJZ A;  2ES2 A;  3WO1 A;  4QWA A;  5DAU A;  4HSP A;  3KXY T;  1TWF A;  2F3W A;  2FJ2 A;  1VQJ A;  5KFM A;  1V9P A;  3M4O B;  4LFB Q;  1SAP A;  2RDG A;  1HNX L;  3K5L A;  1PH6 A;  1HZB A;  1PRT F;  3CPW A;  2O5I C;  2NVX H;  2B2Y A;  2BA1 A;  4G57 A;  3BDC A;  3JAM i;  4JV0 A;  4RNO A;  4DR6 H;  1KL9 A;  2E76 C;  3BVM A;  3VDY A;  1D5M C;  3MHB A;  3SEB A;  2HVR A;  1HZ9 A;  1WD1 A;  3GIK A;  3OOC A;  2UUC Q;  4XYQ A;  5EKK A;  2EXD A;  2N8N A;  4YY3 L;  5JOB A;  1RD9 D;  4JI0 H;  4A3L G;  1JLL B;  1WCM H;  1Q90 A;  3SK5 A;  1IKM A;  4DV6 H;  5C0X H;  1TWC B;  3EJI A;  2VQE H;  3AU7 A;  4L8J A;  3T13 A;  2JQO A;  1JE5 A;  2QDB A;  3RLN A;  2FMM A;  2KEE A;  4ID6 A;  1ZKO A;  2VOB A;  1PFM A;  5FOB B;  3HBL A;  3TS0 A;  2NVY H;  4PNY A;  3J80 L;  3CCR A;  2XD4 A;  3CF5 A;  3CHB D;  4AYB E;  4L5Q A;  3J7A 5;  1XNR Q;  4FF1 A;  1XMO Q;  3BU2 A;  1YJN A;  5EPL A;  1PX2 A;  1S03 G;  2N3S A;  1BNZ A;  1TWA A;  2UXD L;  1RF2 D;  5M5Y B;  5EKL A;  1TWG B;  3UDG A;  1YJW A;  1CM9 A;  2JSO A;  4ZKC B;  1BUV T;  1EIH A;  3S16 B;  5EWG A;  4X64 H;  4DR3 H;  2JEG A;  5I9P A;  4DXF A;  4XXE A;  3V4Z A;  4RAZ A;  4JV2 A;  4X62 Q;  1JR0 D;  2DNE A;  2I5M X;  2HVQ A;  4LW1 A;  1SYC A;  3MEF A;  1WTR A;  5CBE E;  4IPD A;  4NXM L;  1SNC A;  4TQU S;  3J80 E;  5C5L A;  1RJQ A;  2ZTD A;  1R4P B;  2XRQ D;  4GOP C;  1SBB B;  2F3I A;  4DL5 A;  4BA1 I;  3BZC A;  2FMA A;  1PH9 A;  3H20 A;  3PN1 A;  3T1H H;  1HFG A;  1SE4 A;  4PMW A;  4IUN A;  1IYU A;  1SNO A;  2HDL A;  3OTO Q;  1X54 A;  3HRZ C;  4RKL A;  1QVF A;  3GTL B;  1KC7 A;  2P0A A;  3CMA A;  3S1R H;  3RB4 A;  2OLS A;  5D3D A;  2ZDG A;  3N8D A;  3T1Y L;  4A3M B;  2NN6 G;  4UCU A;  1UE6 A;  4RZR A;  5L1J A;  1SYF A;  4J1M A;  3VPB A;  3BQ2 A;  1F2Y A;  5DLF A;  1GUG A;  2F0F A;  1TS5 A;  2IT1 A;  4EYI B;  1IBM L;  4IOA A;  1GUT A;  3WDN A;  4YWL A;  3K80 C;  1F9Q A;  4MTN A;  1YIT A;  2VUM A;  3PQI A;  3HOX H;  3HOY B;  5ELF A;  1ROD A;  1D7Q A;  4RHR A;  3NEL A;  3C3L A;  1RYS A;  4DNT B;  5LA6 F;  3RZO H;  1A63 A;  1I4G A;  1N34 L;  4I55 F;  2FK1 A;  1PYB A;  5E1F A;  1T94 A;  4DXG A;  2A69 D;  4F4Z A;  1I94 H;  1U0L A;  2BQ3 A;  1TWH B;  4ME3 A;  5FPO A;  4Y7N H;  2JA9 A;  2EOT A;  4PV1 C;  2UXB H;  5EPK A;  3H3V H;  4IRC A;  5M5W B;  5KG2 A;  2R7Z H;  1W6K A;  4LF9 Q;  2B8F A;  4XYO A;  5EBD A;  2UVR A;  3OMG A;  2ENB A;  2EJM A;  4PQX A;  5HGT A;  1VQA A;  1WH2 A;  4IPG A;  4C3H H;  1RJP A;  1Q8K A;  4IJL A;  1MD2 D;  2UUA H;  3I4L A;  1EL0 A;  3HKZ G;  3BZK A;  4K2L A;  2F4V Q;  4V19 0;  1QE6 A;  2VR1 A;  3T56 B;  1EYG A;  2SCU B;  1L1O A;  2QF7 A;  2UUA L;  1NAP A;  4X3S A;  1DV1 A;  3NGD A;  4EBE A;  2UUB H;  1K83 B;  1CSP A;  3C46 A;  3NE5 B;  4DAY B;  4R4I A;  4EG0 A;  1SYB A;  3I55 A;  3KBX A;  1PH8 A;  3BVZ A;  1SNQ A;  1N33 L;  4EBD A;  1B3Q A;  1DOM A;  1EZ6 A;  1OXS C;  5M3F B;  2E5L Q;  2B2Y C;  2CH4 A;  2MO1 A;  3HOZ H;  1LTS D;  3MXP A;  3MZ5 A;  2F0E A;  2QA4 A;  3S2H H;  2NU6 B;  1R9T H;  1HR0 H;  2KA7 A;  1UWV A;  5HV6 A;  2DPI A;  2E75 C;  2F0U A;  4FF3 A;  4KHP L;  4GKK L;  2F0V A;  2Z9H A;  3C0F B;  3ETJ A;  3SK4 A;  1BVS A;  2QW7 A;  3CQZ H;  1AH9 A;  2WTF A;  2KCC A;  2YZG A;  2AQ1 B;  3QO2 A;  4C2M B;  2ID0 A;  4ZOL F;  3GTJ A;  1JQY D;  1TY0 A;  1KLG D;  1QJO A;  4LSX A;  4YJ3 F;  1BCP B;  1KJ8 A;  1CQJ B;  4MV8 A;  4XX0 B;  3DXJ C;  5KFR A;  2NBF A;  4RB0 A;  3KHH A;  5J1Z A;  2R93 G;  1B50 A;  5J2U F;  2V9W A;  3N43 B;  3OMC A;  2AGQ A;  1Y1W H;  3OHB A;  5FKA C;  1D6E C;  2MNA A;  4DAP A;  3TS2 A;  5C0X G;  5IE8 A;  4TQS A;  1CUK A;  4G3I A;  3I4O A;  2L4N A;  4R4C A;  3PO2 B;  2X6G A;  2R3Z A;  3M4P A;  5IWA H;  2YTX A;  3VA7 A;  4FP5 D;  4KHP H;  3FKI A;  5LMN W;  4FXG C;  5CGK A;  1VQM A;  5K36 H;  3R5H A;  1EY8 A;  2Z6K C;  5LMU L;  4B08 A;  3A8I E;  1Y1V A;  4JV1 A;  2WII B;  1DXM A;  1MIU A;  1TWG H;  4TVA B;  1DV2 A;  1LTL A;  3HKZ E;  1JX4 A;  1N32 Q;  4H7B A;  4L6T B;  1YHB A;  2R86 A;  3HOZ G;  3UDX A;  3M7N A;  3JSN A;  4RUA A;  3KHR A;  4POG A;  4LUV A;  2XCA A;  4TKO B;  4GN3 B;  4IFD J;  5FLX E;  2F0J A;  2Z6K A;  3PUW A;  1DGS A;  2M9V A;  4FXK C;  1E4F T;  1PTO H;  3QR8 A;  2JA5 A;  3T1Y Q;  1PVO A;  1TWC A;  4YR0 A;  4ED7 A;  2AGP A;  5LMN L;  2RDJ A;  3F8N A;  2ATL A;  1MHW C;  4FDB A;  2VUM B;  1GUS A;  1X3E A;  1EY4 A;  1S3O A;  1U4P A;  4LSA A;  4WFN 3;  2NZ1 D;  4IZ8 A;  1LTG D;  5K5P A;  1SN8 A;  4EQO A;  4NPS A;  1UUP A;  1TKW B;  3RD4 A;  3FP9 A;  2JEI A;  4JCV E;  1TA8 A;  3J81 W;  2R7D A;  3J81 c;  3PO3 B;  4CC6 A;  2CWA A;  4IWY A;  5L9X A;  3FPP A;  4P2C B;  1DIK A;  4QW8 A;  1QG7 A;  1Q8I A;  1FL0 A;  1GKH A;  1R4Q B;  1J5E L;  2E2D C;  2IHF A;  2PYK A;  3UE1 A;  4DV0 Q;  1QNK A;  5FD6 A;  4DK1 A;  1OTC A;  4GKJ H;  1ENF A;  1YI2 A;  1CI3 M;  1UE1 A;  4O3N A;  3M9B A;  2XWB B;  1AE2 A;  2W6Z A;  1VQE A;  2K04 A;  4JI8 Q;  3KTM A;  1V8Q A;  4R8I A;  4YAJ B;  3RTX A;  3OWF A;  2F0T A;  1E1O A;  3TIN A;  3A8K E;  2A68 C;  3U4Z A;  4MAM A;  5M5Y H;  4NXN H;  1HTP A;  4DNI A;  4XQJ A;  3S1M B;  3HFZ B;  2UUB L;  5LHY 1;  1D5X C;  5KNC A;  4I50 F;  1QUQ A;  1LLR D;  4LF8 L;  3M9N B;  1VQ8 A;  3NWT A;  4FU0 A;  1RTO A;  3GTQ A;  3Q8D A;  1KAW A;  3DHQ A;  2K05 A;  4BBS H;  3TQY A;  1GUO A;  2K28 A;  4OHJ A;  1WI5 A;  2HHH L;  3MVV A;  1IXR A;  5C0X I;  1PTO F;  4JBK A;  4DV3 Q;  2L15 A;  2B63 G;  2AGO A;  1XMQ L;  4DUY H;  3GQC A;  2FLP A;  3KUP A;  1O80 A;  1WFQ A;  3RMH A;  4XQN A;  3T1Y H;  1MJC A;  2UVV A;  5M3M H;  1CHP D;  2F4I A;  3I4N B;  3GV5 B;  5E4W C;  1RK6 A;  4ED3 A;  4DV0 H;  4LWC A;  1M1K C;  1JDE A;  2RF4 A;  1YNJ D;  4A3J H;  5GAE C;  1HQR D;  1LUZ A;  2Q2T A;  2J6U A;  3TDQ A;  1S97 A;  1S0M A;  4UY8 C;  3V2T A;  1JJG A;  2Q8R E;  2R93 A;  5ELN A;  1GD7 A;  5KYL A;  1Z2P X;  4YY3 H;  3CQZ A;  1XXG A;  1F9S A;  5LMN Q;  2UU9 Q;  1JWU D;  5KFY A;  4JV5 L;  3KDF A;  3R93 A;  2I5L X;  5I47 A;  3E5S A;  4DV1 H;  2XCP A;  2EYP A;  2F0N A;  2VQF H;  4C3J B;  2PCF B;  1E22 A;  4HNT A;  1KDB A;  2EQS A;  3WWV A;  4KKT A;  3Q8Q B;  4QIW E;  4DR1 L;  1DYQ A;  4C1N I;  2ZJQ A;  3JRX A;  1RDP D;  4OO1 I;  5NUC A;  1MZB A;  3K59 A;  4OX9 L;  2L55 A;  2PQE A;  2I07 B;  3N41 B;  3ICE A;  2R8H A;  2UXC H;  4JI2 Q;  2R6F A;  4Q43 A;  4ME6 A;  1HR0 W;  3N40 P;  3PIP 3;  2PW5 A;  2VQF Q;  4RCN A;  4A3I H;  4PG3 A;  2RDI A;  3T4A C;  2E2I H;  4DV1 Q;  4A3K B;  2JEF A;  2XCL A;  2HQL A;  1G6P A;  4IRK A;  3GTL A;  3PMF A;  4DK3 C;  1XX8 A;  1IHZ A;  2DPJ A;  2RGR A;  4X64 L;  1JOR A;  3S9W A;  2CW7 A;  1Z2N X;  1LTR D;  1ET6 A;  3VYU A;  4O2A F;  2F0G A;  4YCU A;  2Q8I B;  4JI7 H;  4YAK B;  2B63 B;  1HNW Q;  3G6J B;  1M0W A;  1V1O A;  4ALP A;  3D0F A;  3T16 A;  4KKS A;  3D31 A;  4N9T A;  3K5O A;  4ZI7 F;  3HZX A;  4KK7 A;  5C5J A;  1TY2 A;  2UXC L;  4RNM A;  2CW8 A;  2HUG A;  4TUY F;  1KJJ A;  2YZM A;  2VQE Q;  5TSS A;  1STN A;  4A3G B;  4QWC A;  5CMD A;  4HN7 A;  4JI4 H;  1X32 A;  1Y69 U;  3T1H Q;  1WOC A;  3LGJ A;  3S14 B;  5JH7 F;  3P1H A;  2RHQ B;  1HXY D;  2MP1 A;  2K03 A;  5E7N A;  4C3J H;  4CGY B;  3F8T A;  4JI1 Q;  5C4X H;  3U9S A;  4JI5 Q;  4DNR B;  2IMW P;  4R9W A;  3DUZ A;  2JJQ A;  1MSH A;  3I72 A;  4X62 H;  3M4Y A;  4YBZ B;  2KEC A;  4ODG A;  1ZQ7 A;  3K5N A;  4P72 A;  2KVM A;  1EQT A;  3MC0 B;  4X64 Q;  2C00 A;  3R8B A;  4MHE A;  1JJC B;  4AIM A;  3N6X A;  4NXN L;  4QWD A;  4IR9 A;  4JI6 H;  3VYR A;  5IP9 H;  1BQQ T;  2F0D A;  4GN4 B;  2JA5 H;  2F0M A;  1VQH A;  2KUM A;  3PIP A;  2K01 A;  4BY1 H;  1KEE A;  3I7F A;  3CQZ B;  4DR2 L;  1JIC A;  4GLA C;  5I9O A;  5HBR B;  5BMV F;  2R93 B;  1G2T A;  3KHL A;  2K50 A;  2NWG A;  3S1Q B;  1A9X A;  4DL7 A;  4F4Y A;  5FLM H;  1S72 A;  2KSW A;  3BA8 A;  3TRZ A;  1S9F A;  3M3Y B;  4I65 A;  4ZRZ A;  3J81 i;  3S15 B;  1I3Q B;  4CJ1 B;  2CHB D;  4GKK Q;  4F4W A;  4CKB A;  4TRD A;  1EU3 A;  2SDF A;  4M7E A;  2IA6 A;  1AN7 A;  4LFC Q;  3FEW X;  3N42 B;  5M3F G;  4QWE A;  2J4X A;  4ZCK A;  3CD6 A;  5JJK A;  4ECX A;  5HUR A;  1JOK A;  3I91 A;  4LF9 H;  4DR7 H;  4WJW A;  1Z47 A;  2UU9 L;  2HT1 A;  2UVU A;  1QB5 D;  5GON F;  1V1P B;  1E4E A;  2G5D A;  4QQB X;  2M00 A;  4RU9 A;  1JT8 A;  4LF4 L;  3U50 C;  3V6K A;  3KF8 A;  4ZUJ A;  2XSC A;  3QFF A;  4Q8E A;  1YNJ C;  2XTI A;  3GTK A;  4J8Q A;  3S14 H;  4LFA L;  2QIL A;  2KBN A;  3DM3 A;  4CHT B;  3HGB A;  4A3B H;  1VDZ A;  3A8J E;  2A1A A;  4A3G H;  3CU7 A;  1VQN A;  2FLN A;  1TT2 A;  1T5X D;  4A3K H;  4C1N K;  5BR8 H;  5CV5 A;  1A3V A;  4O3P A;  1XNQ L;  2IX3 A;  3PO2 G;  1PH1 A;  1GJX A;  2MHV A;  2B63 H;  4XQQ A;  4ECW A;  2JEJ A;  2BDN A;  1N32 H;  1Q1B A;  1AE3 A;  1CKN A;  1SNP A;  4DV4 Q;  3RZD H;  2WB1 E;  2LKV A;  1GLV A;  4K5V A;  1E1T A;  4FYD A;  4P71 A;  4Q5V A;  3A74 A;  5K36 G;  4LF8 Q;  1QVG A;  4YHH H;  4DUZ H;  1LTT D;  4JG2 A;  1I3Q H;  2OF1 A;  1N34 Q;  2R61 A;  3H6M A;  4KMU C;  1XNQ H;  2XC9 A;  3K7A H;  2WDT A;  2Q2I A;  4LUO A;  2FIN B;  1XPR A;  1JWM D;  1V4Y A;  4MTE A;  2XNA C;  4RKB A;  1NR2 A;  5BN3 A;  2JEA I;  1IBM Q;  1STE A;  4HYK A;  3VR3 A;  3MWD A;  2PI2 E;  4U67 3;  1S40 A;  2IW3 A;  3E0J A;  3MFG A;  5D3I B;  1I7L A;  2PMZ A;  2VA2 A;  3QZ7 A;  2AMC B;  4HQ6 A;  3VYT A;  4DV7 L;  4HIK A;  2F0W A;  3FRP B;  1STH A;  1BBU A;  4MV9 A;  4LK1 C;  5CYU A;  3K8A A;  3G71 A;  4DL3 A;  3U9O A;  4RGN A;  2JA5 B;  2Z8L A;  1T36 A;  4YCW A;  5DG7 A;  3RF2 A;  4BWS C;  2BE5 D;  1WCM B;  4RAU C;  1HR0 L;  5BR8 Q;  2FK2 A;  3GIQ A;  3B6Y A;  2WAC A;  3PGZ A;  3RUZ A;  3CCL A;  3MFH A;  4M1U B;  1Q3L A;  2VL6 A;  4DV5 H;  1BBX C;  1ZHS A;  1CKM A;  5JPM C;  5KNB A;  3PO2 H;  1XPO A;  4MV1 A;  3MXU A;  1HR0 Q;  1I4R A;  3H94 A;  2NTT A;  3BZD B;  1KRT A;  1RTN A;  1X9N A;  2W6Q A;  3LWU A;  3K0Y A;  3I4N H;  4AQY Q;  4DK0 A;  3U4V A;  1H95 A;  1WTH A;  3QOL A;  2W8L A;  1ICF B;  4K2K A;  5KFK A;  3U58 A;  3MTS A;  3GTG H;  3OYY A;  3NBH B;  1WTP A;  2ZTE A;  2RKS A;  4F4X A;  5A35 A;  3HOW H;  2Q2H A;  1T3N A;  3PW0 A;  2R92 A;  5ELE A;  1QZH A;  1AZQ A;  1ESR A;  1EZ1 A;  4MV4 A;  4ED0 A;  2VA3 A;  1CZW A;  4P73 A;  2WV6 D;  2DJF C;  2FP4 B;  5LOV F;  4Q0F A;  3OSO A;  3NQI A;  4A3F B;  3DLL A;  3GTK H;  1STA A;  1PH3 A;  5AFW A;  3FKI H;  1UE7 A;  2ZM6 L;  4DV2 Q;  5DGA A;  5ISR A;  1VQP A;  4OO1 G;  1EIY B;  3R23 A;  4C3I G;  4UP8 A;  4HCS A;  2E2I B;  1MGS A;  1NE3 A;  4CDE C;  3GD7 A;  1TWG A;  3S1N H;  5FLX W;  4ECS A;  3G6X A;  3F2B A;  3NSW A;  4J9S A;  1KRS A;  4B3S Q;  2HCI A;  2JA7 H;  1EOT A;  1BKB A;  5C4X B;  3ZJY C;  4IOC A;  1V1P A;  3P75 A;  2ZM6 H;  3NEN A;  3C2P A;  1ZHQ A;  3RLO A;  1L2F A;  3DMU A;  5H1S E;  2L11 A;  4BXX G;  5D8D A;  3RB0 A;  1C8C A;  3K5I A;  5FJ8 G;  2UUC L;  1VF5 C;  1FJG Q;  1Q81 C;  2JA7 A;  2RQX A;  4FO2 A;  4C56 C;  2ZJT A;  2D9U A;  1PV4 A;  2K6A A;  2QDL A;  3CC7 A;  4RNN A;  4HJ5 A;  1IBK L;  5A2Q E;  4LH7 A;  1YNN C;  2VS1 A;  5C0X J;  1K83 A;  4F50 A;  3O13 A;  1F2M A;  4LF9 L;  3J7A K;  4IUT A;  3WOF A;  2KCN A;  4KY6 A;  5IGB A;  2WKD A;  3DM1 A;  1HZC A;  1NBW A;  5KFX A;  3UI2 A;  3J7A V;  5HY6 A;  4DF7 A;  1I50 A;  1PRT C;  5CV7 A;  1N48 A;  1ULZ A;  3IFT A;  5GRO A;  4RGO S;  1YJ9 A;  2IX1 A;  2C9O A;  4Y7N B;  3A7A B;  2W6N A;  1N36 H;  1EYA A;  1B7Y B;  4C3I H;  2C28 A;  3W5O A;  1V43 A;  3KF6 B;  3OHX C;  5EWE A;  1EOV A;  2A19 A;  3ND9 A;  3CCQ A;  4UPA A;  1B6R A;  3ETH A;  2YCH A;  4JI1 H;  1E2Z A;  3NHH A;  5KFG A;  1IOV A;  3EN2 A;  4FF4 A;  4IFD G;  1FJG H;  2MQH A;  4F7X A;  1PMR A;  3ZYY X;  4O3O A;  5KG4 A;  1Y8P B;  3SK8 A;  3J80 c;  5CV4 A;  2FFK B;  3LML A;  2UXC Q;  2R7Z A;  2B2V C;  4TV9 F;  1ASY A;  3W2D A;  3NTI A;  5GQO A;  2ZJR A;  4KD4 A;  4AYB A;  4TQR A;  3PW4 A;  3NUC A;  1RKN A;  3PO3 H;  3RZD B;  1VQK A;  2NU9 B;  3EFX D;  1EY6 A;  1CZG A;  4OWW B;  4AQY L;  4WOR A;  4IUV A;  4A75 A;  4RGT A;  4J15 A;  4F8M A;  1DOL A;  3GID A;  4YP3 A;  1XNR H;  2RDF A;  1J6Q A;  4FS2 A;  4B3T Q;  1EYZ A;  5KRU A;  4K8J A;  5GAG C;  1L2Z A;  2D5D A;  4JI5 L;  2R92 G;  2F3V A;  1CFM A;  4OIK A;  3KLS A;  2ZDQ A;  4IFD I;  3H4D A;  4DV5 L;  4KJN A;  3GDE A;  3RBE A;  4CJ2 C;  2F52 A;  1MJE A;  4C5A A;  1SJE D;  3C1F A;  2R7K A;  2Y0S E;  4DR1 Q;  2PZW A;  3NXW A;  1KAB A;  2HJW A;  4C5C A;  4A93 H;  1SE8 A;  5ELC A;  2QCP X;  4F87 A;  1WTO A;  3HKZ A;  2Q2U A;  3PUX A;  4L1K A;  4IJH A;  2B2W C;  1PRT B;  3S15 H;  1M8A A;  1HQM C;  2XVS A;  3R2I A;  1KTK A;  1YNN D;  2K14 A;  2NN6 I;  4DUY Q;  2KEN A;  3D3R A;  3TEH B;  4DV2 H;  5CV6 A;  3TP6 A;  4H44 C;  3V4S A;  5C4J H;  3OW7 A;  1CT1 D;  1JC7 A;  2PPB C;  2UU9 H;  5ELO A;  4ZKB B;  1LTB D;  1TU2 B;  3EYY A;  4HNU A;  5KFE A;  1WR2 A;  1GM5 A;  3R5X A;  1Y1W A;  1B9M A;  1HA5 A;  1N33 H;  3TBI B;  2RHS B;  2PZT A;  4ECY A;  3ONA B;  4A3D G;  3SI8 A;  4XT3 B;  4YHH L;  4DUZ L;  3J7A F;  1ENA A;  1VBH A;  3MXN B;  3EPI A;  4RWS C;  3HOV G;  1SDF A;  2PQA B;  2AUK A;  1XMQ Q;  3JAM E;  5EPJ A;  3KBG A;  2FLL A;  3GTP B;  1SFO H;  4RHS A;  1L1O B;  3QJY A;  5FO7 B;  2K5D A;  2DY8 A;  5F2D A;  1GUW A;  2X6L A;  2O5J C;  1AUV A;  4QGU A;  4JV5 H;  2R92 H;  3C1E A;  4X66 H;  1KDC A;  2D0O A;  2ZT9 C;  3FPU B;  4A3C H;  2F0S A;  5BPH A;  1F9P A;  4JVZ A;  1K0R A;  4RH6 A;  4NXM H;  4HIM A;  4LFA Q;  1L0W A;  4WD3 A;  2J6T A;  3F2D A;  1JIH A;  4PZ6 A;  5T14 A;  5D14 A;  2H5X A;  5DLQ E;  4GKJ Q;  4H02 A;  1GVP A;  2A68 D;  3TP8 A;  1VKZ A;  2RDH A;  4LMY A;  3PSI A;  2E2H A;  1IL2 A;  2WAQ B;  4KLK A;  4G7O C;  1QOH A;  1I6V C;  4A93 B;  1VCI A;  2BDO A;  1D1K A;  4JBM A;  4O1N A;  1HUN A;  5LXT F;  4HIO A;  2XGQ A;  4GC7 A;  3H4B A;  1ESF A;  4EQ5 A;  5D1O B;  2Z1C A;  4YJ2 F;  2DUD A;  1TWF B;  4BBR G;  4YR2 A;  1PRT D;  1X6O A;  4LF6 Q;  1PHJ A;  2IWH A;  3LNN A;  2A6E C;  1XNQ Q;  4FBU A;  1J5E Q;  3S17 B;  4HJA A;  3KF6 A;  1IL8 A;  3J7Y W;  3RLF A;  2IL8 A;  5C3E B;  3T5J A;  4R8U B;  2DWC A;  1W93 A;  3RBD A;  2HQE A;  5JEA G;  5T1I A;  2EY1 A;  4EX5 A;  1SCU B;  3MWM A;  1E4E B;  1VMP A;  4I7A A;  3K57 A;  3KFU A;  1GSH A;  4MV3 A;  4DR5 Q;  4Z9C B;  2R7F A;  1FNV A;  1AP0 A;  2EYF A;  3S2H B;  2EZV A;  5KG5 A;  3V6H A;  5KG6 A;  2E2J H;  1K8A C;  4V0B A;  3D6W A;  2BQU A;  1SRO A;  3OPO A;  3LX0 A;  5EKI A;  1SR3 A;  1W6J A;  3QOJ A;  5KFF A;  2PQA A;  4DR6 L;  2MO0 A;  3LWB A;  2Z4H A;  1O7Y A;  3GTM B;  2X0S A;  2BR0 A;  1AUX A;  2IX0 A;  3HEJ A;  4GS3 A;  4O3R A;  3KK7 A;  4JI2 H;  4LF6 H;  2IPK D;  1OXT A;  3H91 A;  3FKI G;  2WB1 B;  2ASL A;  3GLK A;  4GLV B;  1L0Y B;  2CH4 W;  3D4D A;  4IPH A;  4DV0 L;  4GC6 A;  3K81 C;  4RZQ A;  5GAD C;  1KJ9 A;  1G51 A;  1RJT A;  3MFI A;  5C6A A;  1H9M A;  2K5N A;  3HOW G;  4HCE A;  1WCM G;  1MKH A;  1Q86 C;  5EAY A;  1KJQ A;  4A3B G;  2K5H A;  1TWA B;  4N9P A;  3HOV B;  3J81 E;  4JOI C;  4C2M H;  3VR2 A;  3GTG A;  5IT9 W;  5IT9 c;  1R9T A;  3IG0 A;  3MR3 A;  2ZXP A;  3HOX G;  4A3K G;  4QJF A;  5C4X G;  1A3U A;  4ILW A;  3H0G H;  4F88 A;  4LFA H;  4UFZ A;  2Z4I A;  2LXK A;  4LF7 H;  4DUY L;  4EFB A;  4O3S A;  4A3C G;  4JI8 H;  2FPP B;  4R7R A;  2V4R A;  2YU9 B;  4JI2 L;  2A69 C;  4RA8 A;  1CS0 A;  3L2P A;  5IY0 A;  4MV6 A;  1RHP A;  2EXZ A;  5IYB G;  1WTV A;  5KG1 A;  2RBM A;  4YWM A;  1IBL L;  5DQH A;  1XMQ H;  1K8G A;  3GV8 B;  4ECT A;  1I6U A;  2J7Z A;  3TP5 A;  3SDZ A;  2JE6 I;  4QUF A;  2UXB L;  2F0O A;  4A93 G;  3J81 L;  3I4M B;  3IN5 A;  1VQ5 A;  4E4T A;  1UEB A;  3L0O A;  4BWG B;  5CB4 F;  4DL4 A;  1FD7 D;  1HNW H;  4XT1 B;  3K3P A;  1EU4 A;  2VY3 A;  4OEL B;  4BS9 A;  5LMU Q;  1CA6 A;  3RGZ A;  1TQO A;  3HOU G;  5IT9 L;  1C0A A;  3I2Z A;  4MA5 A;  4JI5 H;  2FHT A;  1A3T A;  3GTQ H;  2NB0 A;  3MJF A;  3I56 A;  4GN5 A;  4B3T L;  1XPU A;  2R87 A;  3HB9 A;  2VQD A;  4O2D A;  1BJT A;  5KT2 A;  4MTK A;  2FPG B;  4LAA A;  2R8J A;  1WCM A;  4BY7 H;  3M4Q A;  1VQF A;  1K1Q A;  5JEA H;  4A76 A;  1BXR A;  4O3Q A;  5KFZ A;  4ULL A;  3L9A X;  4LF5 L;  4DU9 A;  2PMZ B;  1EWH A;  3BG5 A;  4RB2 C;  1PK8 A;  2DJG C;  1IW7 D;  1T9H A;  4TSS A;  4JBW A;  1FJG L;  3EVQ A;  4JI7 Q;  2PVP A;  1G91 A;  2ZXR A;  3WOE A;  1FKA H;  3HOX B;  3HOY H;  3RV3 A;  1C4Q A;  1DD2 A;  5K2M A;  4R8N A;  5J39 A;  3CCJ A;  1OWT A;  5DLG A;  4ECQ A;  1STG A;  4QL5 A;  4K0K L;  2OTL A;  1P8L A;  4JI0 L;  2YRX A;  3H09 A;  3OIP A;  2W57 A;  1YZ6 A;  2EPB A;  1KDA A;  1GYF A;  3NBI A;  2Z0S A;  5KT6 A;  1PH2 A;  4DR5 H;  5C4H A;  3E5N A;  1KC8 C;  3GV7 B;  2W9C A;  1IBK H;  2OQK A;  1A15 A;  3RB6 A;  1RYR A;  1IYV A;  2C2R A;  4KD3 A;  1K73 C;  5KKN B;  2KED A;  2GPW A;  2PNR C;  1GXD C;  4A3B B;  4GOP B;  1FYC A;  3GTO H;  4OGQ C;  3VPD A;  2A73 B;  3LWE A;  1A6X A;  4HR7 B;  4X65 L;  2RA4 A;  3OIQ A;  4IAJ A;  4RG1 A;  1AN8 A;  1CQV A;  2EE1 A;  1RCV D;  4XZ3 B;  2JA8 H;  1FGB D;  2AWN A;  3BG3 A;  1Y1W B;  4OXP A;  3J80 i;  2E2I A;  2NVT H;  1TVX A;  5M3M G;  4NDX A;  3T5L A;  4ECZ A;  1JMC A;  4WJ3 M;  1BOS A;  1S0O A;  2HGS A;  4QIW B;  2OCE A;  4PWQ A;  4R4O A;  3JRW A;  4EFE A;  5LL6 S;  4MNO A;  2W6P A;  4UCT A;  4LNQ A;  2R85 A;  1DM0 B;  5EJW A;  2J0T D;  5CV9 A;  1IOW A;  3I4M G;  5IGG A;  4NXM Q;  4RGM A;  3MR2 A;  2Y0S A;  2JK8 A;  3MEH A;  1Q82 C;  2A6E D;  3Q8S B;  5KFT A;  4JOI A;  2YTY A;  5I6Y A;  2CQO A;  3BQ1 A;  2PW7 A;  4LF7 L;  2QGQ A;  4IO9 A;  1JB3 A;  1SEB D;  1C9O A;  4JI8 L;  4UCS A;  2YL2 A;  4ZAI A;  1VQO A;  3NK9 A;  2F0P A;  4GNX C;  4KY5 A;  3PUV A;  4DR2 H;  3K5M A;  1T5E A;  4JBJ A;  1STY A;  2DN8 A;  4IR1 A;  3H15 A;  1AEX A;  1D2B A;  1PH5 A;  2EDG A;  2RCF A;  3T53 B;  1DON A;  2LXJ A;  3RAQ A;  2A6H D;  2GVA A;  1PZK D;  1SSO A;  1BCP D;  2YV5 A;  2Q8T A;  5F9L A;  2K5V A;  2TMP A;  5ELD A;  3PR5 B;  4QW9 A;  1U4R A;  3K58 A;  1RJR A;  3CVZ A;  3Q23 A;  4A3D H;  4AYB B;  1BF4 A;  3GTJ H;  4BBS G;  2EYO A;  1QNU A;  4ZLT F;  1JOO A;  3H0G A;  2R7Z B;  2A74 C;  2CVR A;  3DEP A;  1FVI A;  1WTX A;  4XTC S;  3L7Z C;  2C2D A;  3PIO 3;  4LF4 H;  2VUM H;  1UAP A;  4ZK9 B;  3MAQ A;  2SOB A;  2CWP A;  4UHV A;  3Q0A A;  3QIA A;  4IWX A;  4ECU A;  5EBC A;  4G7H C;  5C3E G;  4KN4 C;  3J81 j;  2WIN B;  3H3V C;  5GAH C;  2LFN A;  2NUC A;  4IRD A;  4QWB A;  3OSN A;  1Y1V B;  2HDM A;  1N8R C;  2ALZ A;  4A3F G;  2NVT B;  3A56 A;  2YU9 H;  3GTM H;  5COR A;  3PCO B;  4J9Q A;  5IGF A;  4Q45 A;  1XNR L;  1LT5 D;  5IWA Q;  1OXU A;  1RL2 A;  2G9D A;  1ZYR D;  3RZO B;  2RGV A;  4IQZ A;  4UAI A;  4C3I B;  3HOU H;  2YYA A;  1B8A A;  1VQB A;  5JUM A;  1EEI D;  2EY5 A;  3RUP A;  2WKC A;  4XYL B;  1TXY A;  5C5M A;  1IKL A;  4J6H A;  4N8F A;  3M9O B;  2WYO A;  1O7I A;  1LTI D;  1M7J A;  3M4O H;  4R8U A;  3K6O A;  2ATW A;  2DZD A;  4HJ8 A;  1DZ1 A;  1S0N A;  1ENC A;  1SMX A;  1YVC A;  4BBR B;  1SMY C;  1PFN A;  3KJO A;  3NQT A;  3KF8 B;  1P16 A;  5KEE A;  3AB9 A;  1IBM H;  2LSS A;  3PO3 G;  5L1K A;  3KAL A;  2F4V L;  3VR6 A;  1HUM A;  1Q7Y C;  1BNC A;  5JQW A;  4LF5 Q;  2MGS A;  4EBC A;  4B3T H;  3QG1 A;  5A2Q L;  2C22 A;  4X66 Q;  4BBS B;  2QEJ C;  5CC4 A;  4LFB L;  1B6S A;  2RSN A;  4I7H A;  1JWS D;  5KFI A;  1XDN A;  4GNX B;  4N8X 1;  2EY6 A;  4IZO A;  1MBY A;  1II3 A;  4OEM B;  2H1E A;  3SHL A;  1SFO B;  3NP8 A;  4RFB A;  1S5B D;  1JXL A;  2UVW A;  3M3Y H;  1Z2O X;  4J9N A;  1I4Q A;  2NVX A;  1SE3 A;  2AWO A;  1S10 A;  1GSO A;  3GIJ A;  4J9K A;  2JA7 B;  3E0E A;  1Q46 A;  1A8V A;  1I5F A;  2FB9 A;  1FNU A;  2CQA A;  3BS1 A;  4ECR A;  3SR1 A;  1GOZ A;  3UDI A;  2CW0 C;  4A3E G;  3NBH A;  2UUA Q;  2L1B A;  3V6J A;  4JI7 L;  3OUU A;  1PYS B;  4UP7 A;  1HH2 P;  3GTP H;  4IN3 A;  2EJF C;  1TAE A;  3OWE B;  4OWX B;  2E2H H;  1KAA A;  4R1J A;  2UXD H;  2WFW A;  4LFB H;  3VMM A;  3M85 A;  5KFA A;  5DG8 A;  2LMC B;  3Q6S A;  4B3S H;  5JVD F;  3RB3 A;  1N56 A;  5EOY A;  1KLU D;  3KYH C;  4QUC A;  1BDO A;  2Z6B A;  4ED6 A;  5IP9 G;  1KHI A;  3PIO A;  2WB1 A;  4JYA Q;  3H40 A;  3BQ0 A;  2SEB D;  3RAX A;  2O2L D;  2VQF L;  4A3M G;  3EQL C;  4EEQ A;  2W9B A;  3NTK A;  4X3U A;  5KFD A;  2FXQ A;  3J80 W;  5KFH A;  1E2W A;  2R92 B;  1EFW A;  5IYB H;  3KLS X;  2FPI B;  5F9N A;  1HNZ H;  4K8I A;  3GTO B;  1X3P A;  3GO5 A;  4A3M H;  4U68 A;  5M5X H;  4JYA H;  4DPG A;  3HOU B;  3HOY G;  2ZM6 Q;  5KFN A;  3JC6 6;  5G3L D;  2OXP A;  4B3R Q;  1HNX H;  2LY7 A;  3FDT A;  4KHZ A;  4IUP A;  1XTD A;  3M7G A;  1RK5 A;  4K14 A;  3RIZ A;  2NZO A;  3CKI B;  4HAE A;  4MZ9 A;  3I73 A;  3RGX A;  4JC0 A;  4PDB A;  4EGJ A;  2ZXO A;  3FDS A;  1LAB A;  2V58 A;  4O42 A;  1NSN S;  4FNF A;  2UXD Q;  3DWQ A;  4DR6 Q;  1O78 A;  4EEY A;  1XJV A;  1D5Z C;  1L1O C;  1QIL A;  1PFB A;  3GTO A;  3TRE A;  1B33 N;  2WE6 A;  3NEM A;  4FVM A;  1TS3 A;  4E6I A;  1X3Q A;  2JA8 B;  5IGE A;  2IHE A;  1NMG A;  3RN2 A;  1CK1 A;  5I2X A;  5BR8 L;  3A54 A;  2K7V A;  4YIJ A;  4JI6 L;  3PVX A;  1SRU A;  5DG9 A;  4ZQI A;  4A2A A;  2QEX A;  3ULL A;  3HG9 A;  2C35 B;  1VQ7 A;  5I6W A;  1EZ8 A;  2DY7 A;  3RNU A;  3K7U C;  2OTJ A;  4NW2 A;  4LF6 L;  2E2H B;  4B9X A;  1O75 A;  4UCO A;  4YQW A;  4FBT A;  4NLG A;  3PUY A;  4POF A;  2CZG A;  3TII A;  3MXG A;  1LT4 D;  1X55 A;  1CHQ D;  2W71 A;  2R7L A;  4UCR A;  1LO5 D;  3CC4 A;  1SND A;  5JVH 3;  3VR4 A;  4KTA A;  4BXX H;  3DWP A;  4GLX A;  4PZ8 A;  1ZYR C;  4KY7 A;  2W7O A;  4DV4 H;  2GPS A;  3R3O A;  1G29 1;  4JK1 C;  1NR4 A;  5T1G A;  3VPC A;  1S5D D;  2R7M A;  3J7Z C;  1H9J A;  2NVQ B;  1ZXT A;  2B8G A;  2OQ0 A;  4DV4 L;  3E9I A;  5KFS A;  4YB8 B;  1K3B C;  4R4Q A;  1O7L A;  3OHA A;  2EIF A;  2K75 A;  2NZH A;  4A3E H;  2PN1 A;  4J9L A;  5IYC G;  4CDF C;  3NPP A;  3P7J A;  4DV3 L;  5D1P A;  2CKZ B;  1SMY D;  2WP8 J;  4C2M A;  1HRJ A;  2IBK A;  2XN9 C;  3S1Q H;  1XYI A;  3SK6 A;  1F77 A;  4BY7 B;  4KJO A;  4YHH Q;  4DUZ Q;  4LF8 H;  2R6G A;  3N52 A;  4MIU A;  3CCE A;  3UQ8 A;  1CE8 A;  1F9R A;  3QWN A;  2K52 A;  5H80 A;  3UFX B;  5KT4 A;  2A5H A;  2K33 A;  4HED A;  4KN7 C;  1N36 L;  4BA2 I;  2VNU D;  4J9P A;  1CA5 A;  2JEB I;  2OT2 A;  4CJ0 B;  1M4V A;  2ZTC A;  2R7Z G;  1I3Q A;  2VUG A;  3MA2 B;  4O0A A;  4LFC H;  2YZN A;  5LP6 F;  3M9M B;  5BN4 A;  3EBE A;  3HXL A;  3W3A A;  1HZA A;  4MA0 A;  5KND A;  4K0K Q;  1G8Z D;  4KI0 A;  1EY9 A;  2ICI A;  2B2T C;  2CFM A;  1X65 A;  4RCO A;  4IFD H;  1A2U A;  1N32 L;  1G6Z A;  1VQG A;  4OON A;  2R7N A;  3IRB A;  3SE0 A;  1YHQ A;  1HFN A;  3S16 H;  1PZI D;  1CTM A;  4K5X A;  4A4I A;  5C3X A;  5C3E H;  4JI6 Q;  4ZHQ F;  5HGQ A;  2YW2 A;  3BJU A;  2XIG A;  1UNS A;  3ORR A;  3G7L A;  2ASJ A;  4K0K H;  3KAK A;  3JAM L;  2DGY A;  2YS7 A;  4DL2 A;  4OX9 H;  4LJZ C;  5JJZ A;  4L5T A;  3OW2 A;  1EUJ A;  2IP4 A;  1ILQ A;  1QWY A;  3EA6 A;  1XWE A;  4ABN A;  4FM9 A;  2N49 A;  1C48 A;  1VQC A;  3PUZ A;  3S2D B;  3L3O C;  4ED8 A;  3URY A;  3QB3 A;  2M05 A;  2R8K A;  1EQR A;  4BY7 G;  3JSL A;  1SYE A;  2I46 A;  2NN6 H;  4BBR H;  3AFQ A;  4RUC A;  4CBV A;  2PZU A;  2IJ0 A;  4KV6 A;  4A3I B;  4JUZ A;  2VPS A;  5L1L A;  2HCC A;  3DF7 A;  3KJP A;  2YYZ A;  3IAY A;  5I2Y A;  2I5H A;  1Q12 A;  4L5S A;  2ALY B;  2DLN A;  3IFD A;  2MJ8 A;  4APV A;  5IYD G;  5KFW A;  1E2V A;  1FNW A;  5JJL A;  3T5K A;  1B4O A;  3T5H A;  4DN4 M;  4IAL A;  3BA9 A;  2R8I A;  1TWA H;  2PO4 A;  2VZA A;  3EIV A;  4J9O A;  1CQI B;  1Z9F A;  3CW2 C;  3V05 A;  3VR5 A;  3GTJ B;  5CA0 F;  5EWF A; 
#chains in the Genus database with same CATH homology
 3M4Q A;  2OWO A;  4JI4 Q;  1JJC B;  4AIM A;  1UE5 A;  4NXN L;  1VQF A;  5IP9 H;  4GN4 B;  4A76 A;  1HNZ L;  2JA5 H;  1LM0 A;  3PF4 A;  4YWK A;  3AYH B;  1SLJ A;  1VQH A;  1IBK Q;  2VUM G;  4Y52 H;  1CKN B;  3PIP A;  2CCZ A;  4LF5 L;  4BY1 H;  4DR3 L;  3I7F A;  5FJ8 H;  4GNX A;  4DAM A;  4DR2 L;  3HOV H;  4P74 A;  1I94 L;  3CC2 A;  4GLA C;  4DR7 Q;  2R93 H;  1T9H A;  2GVB A;  4JBW A;  2K50 A;  3CPF A;  3ERS X;  1FJG L;  5AJ3 Q;  4JI7 Q;  4HJ9 A;  2PI2 A;  5FLM H;  1S72 A;  2YTV A;  4DKA C;  3HOY H;  3TRZ A;  1NMF A;  3J81 i;  3AFP A;  1V1Q A;  1JJ2 A;  3CCJ A;  4GKK Q;  3G48 A;  3CXC A;  1K3R A;  4KHP Q;  3FHW A;  4QL5 A;  1CKO A;  3KOJ A;  4K0K L;  3UDF A;  4LFC Q;  3PF5 A;  4LUZ A;  2BA0 A;  2OTL A;  1P8L A;  4JI0 L;  5M3F G;  4B3M Q;  3ER0 A;  3CD6 A;  1YZ6 A;  5JJK A;  3KLW A;  5IYC H;  1Z47 A;  2Z0S A;  1BBW A;  2UU9 L;  3HKS A;  1PH2 A;  1D8L A;  2HT1 A;  3F2C A;  2E5L L;  1RIP A;  1Q1E A;  5JJI A;  5J3B A;  1KC8 C;  4QQB X;  1JT8 A;  2ES2 A;  2OQK A;  1Y1V H;  4LF4 L;  2JA7 G;  3U50 C;  3E9H A;  2PNH A;  2HIX A;  1VQJ A;  1V9P A;  4GKJ L;  2WAQ G;  1YIJ A;  1K73 C;  2XTI A;  1HNX L;  4LFB Q;  1PH6 A;  1HZB A;  3S14 H;  4LFA L;  3CPW A;  2KBN A;  1TWC H;  3DM3 A;  4GOP B;  3RR5 A;  2JA6 G;  4A3B H;  2NVX H;  2BA1 A;  3GTO H;  3JAM i;  2A1A A;  4A3G H;  2AHO B;  1VQN A;  1KL9 A;  3VDY A;  4A3K H;  4X65 L;  1HZ9 A;  2UUC Q;  4RG1 A;  4JI3 L;  3ULJ A;  1XNQ L;  2EXD A;  3PO2 G;  2JA8 H;  1PH1 A;  3CAM A;  4DR4 L;  2AWN A;  2N8N A;  4YY3 L;  4OXP A;  3J80 i;  3K0X A;  2NVT H;  5M3M G;  2B63 H;  3S2D H;  4A3L G;  1JMC A;  4WJ3 M;  1WCM H;  1Q1B A;  1AE3 A;  1CKN A;  2OCE A;  4R4O A;  4DV4 Q;  3RZD H;  2WB1 E;  2JA8 G;  1JB7 A;  4MNO A;  2KHJ A;  1E1T A;  4LNQ A;  2JQO A;  1JE5 A;  4P71 A;  3RLN A;  3A74 A;  5K36 G;  4LF8 Q;  1QVG A;  1PH4 A;  4JG2 A;  3W1G A;  3I4M G;  3TS0 A;  1I3Q H;  2NVY H;  3G6E A;  3CCR A;  1N34 Q;  4NXM Q;  3CF5 A;  4QY7 A;  2UUB Q;  4AYB E;  2JK8 A;  3K7A H;  4L5Q A;  3J7A 5;  2Q2I A;  1Q82 C;  4DV2 L;  1XNR Q;  4LUO A;  4A3G G;  3PV0 A;  4JOI A;  2YTY A;  3BU2 A;  1YJN A;  1XMO Q;  2N3S A;  1XPR A;  2CQO A;  3CCS A;  1EIF A;  1WJJ A;  4DV7 Q;  2UXD L;  2RCN A;  4LF7 L;  2JEA I;  2QGQ A;  4IO9 A;  1IBM Q;  3UDG A;  1C9O A;  4JI8 L;  5IP7 H;  2PI2 E;  1S40 A;  1YJW A;  1VQO A;  4GNX C;  2AMC B;  1VQD A;  3PUV A;  4DV7 L;  4B3R L;  4HIK A;  4JBJ A;  1I50 H;  1BBU A;  3H15 A;  1YBY A;  3K8A A;  3G71 A;  1PH5 A;  5IP7 G;  1W2B A;  4X62 Q;  2I5M X;  2LXJ A;  4YCW A;  3OTO L;  4LW1 A;  3MEF A;  2GVA A;  2YV5 A;  4IPD A;  4NXM L;  4TQU S;  1HR0 L;  2K5V A;  5BR8 Q;  2ZTD A;  3B6Y A;  3PGZ A;  3CCL A;  4GOP C;  2F3I A;  2VL6 A;  4BA1 I;  4A3D H;  3BZC A;  1CKM A;  1PH9 A;  4AYB G;  5FLM G;  1XPO A;  3PO2 H;  5JEA J;  1HR0 Q;  3GTJ H;  4BBS G;  4PMW A;  4L5R C;  1KRT A;  1X9N A;  3OTO Q;  1VQI A;  1X54 A;  1QVF A;  4X62 L;  1FVI A;  3I4N H;  4AQY Q;  2V1C C;  4XTC S;  3L7Z C;  3U4V A;  1H95 A;  3CMA A;  3S1R H;  1IYJ B;  4YY3 Q;  3U58 A;  2VUM H;  4DR4 Q;  3T1Y L;  3GTG H;  4HJ7 A;  3OYY A;  3NBH B;  2CWP A;  4JI3 Q;  2NN6 G;  2ZTE A;  1UE6 A;  2A8V A;  5C3E G;  2Q2H A;  3J81 j;  3HOW H;  5GAH C;  1QZH A;  1GO3 E;  2IT1 A;  4P73 A;  1IBM L;  4IOA A;  1N8R C;  1Y1V G;  4YWL A;  3K80 C;  4LF7 Q;  4A3F G;  3DLL A;  3GTK H;  4MTN A;  1PA6 A;  1YIT A;  1PH3 A;  3HOX H;  2YU9 H;  3FKI H;  1UE7 A;  2ZM6 L;  1XMO L;  1C7Y A;  3GTM H;  3PCO B;  1PH7 A;  1D7Q A;  4DV2 Q;  1XNR L;  3NEL A;  1VQP A;  5IWA Q;  1EIY B;  1OXU A;  1RL2 A;  4OO1 G;  4UP8 A;  3CCV A;  1A62 A;  3HOU H;  3RZO H;  1A63 A;  1N34 L;  1NE3 A;  3GD7 A;  1B8A A;  1VQB A;  1PYB A;  3S1N H;  1TXY A;  5FLX c;  3A5Z B;  3F2B A;  1YNX A;  3CME A;  3I4M H;  1U5K A;  1U0L A;  1VS0 A;  4JYA L;  4GOP A;  1KRS A;  2B3G A;  4ME3 A;  2I0Q A;  1O7I A;  4Y7N H;  4B3M L;  4B3S Q;  2JA7 H;  2JA9 A;  3M4O H;  1KD1 C;  3H3V H;  2ATW A;  1BKB A;  1CSQ A;  3ZJY C;  4IOC A;  4LF9 Q;  4HJ8 A;  2R7Z H;  1YVC A;  1SMX A;  3NEN A;  3RLO A;  4X66 L;  1L2F A;  5H1S E;  3KJO A;  4BXX G;  1VQA A;  3KF8 B;  5M3F H;  1P16 A;  4IPG A;  4C3H H;  5FJ8 G;  2UUC L;  1Q8K A;  4IJL A;  1Q81 C;  2LSS A;  1FJG Q;  3PO3 G;  1LYL A;  3HKZ G;  3BZK A;  2F4V L;  1Q7Y C;  3I4N G;  1PV4 A;  2F4V Q;  3CC7 A;  3CCM A;  4LF5 Q;  4HID A;  1EYG A;  1ASZ A;  4HJ5 A;  4WJ4 A;  1L1O A;  1IBK L;  2UUA L;  2VS1 A;  5C0X J;  2B29 A;  1CSP A;  4X66 Q;  4IPC A;  4DAY B;  4LFB L;  4R4I A;  1QZG A;  4LF9 L;  4JI4 L;  3I55 A;  1PH8 A;  3S24 A;  4GNX B;  4LF4 Q;  1N33 L;  2BH2 A;  1OXS C;  2E5L Q;  2MO1 A;  4B3S L;  1HZC A;  3HOZ H;  1NBW A;  2QA4 A;  3S2H H;  1KXL A;  5HY6 A;  1KQS A;  1R9T H;  3M3Y H;  1UWV A;  2AWO A;  5GRO A;  1YJ9 A;  4JI0 Q;  2IX1 A;  2AKW B;  4UP9 A;  1N33 Q;  1Y14 B;  3E0E A;  1Q46 A;  4KHP L;  1B7Y B;  4C3I H;  1I5F A;  1A8V A;  3W5O A;  5IWA L;  4GKK L;  1V43 A;  3KF6 B;  1EOV A;  1BVS A;  3CQZ H;  1AH9 A;  2A19 A;  3CCQ A;  3UDI A;  4UPA A;  4A3E G;  2UUA Q;  2ID0 A;  3EN2 A;  4IFD G;  2MQH A;  5AJ3 L;  4JI7 L;  2VQE L;  2JA5 G;  1PYS B;  4UP7 A;  1HH2 P;  3J80 c;  3GTP H;  1PFS A;  3S17 H;  2E2H H;  4OWX B;  4DR2 Q;  2UXC Q;  4R1J A;  4BY1 G;  1ASY A;  2GN5 A;  2WFW A;  5GQO A;  3M85 A;  2ZJR A;  2R93 G;  1HJP A;  1Y1W H;  1E3P A;  3PO3 H;  1E24 A;  1VQK A;  3JAM c;  4NXN Q;  2MNA A;  4AQY L;  4OWW B;  3KYH C;  1A0I A;  1EQQ A;  1VQ9 A;  3TS2 A;  5C0X G;  5IE8 A;  4A75 A;  1IZ6 A;  4J15 A;  5IP9 G;  1CUK A;  3I4O A;  1KHI A;  1J6Q A;  3PIO A;  4R4C A;  4B3T Q;  4JYA Q;  4X6A H;  3M4P A;  5GAG C;  2YTX A;  2VQF L;  4A3M G;  4JI5 L;  5LMN W;  2FXQ A;  2R92 G;  1VQM A;  2D0P A;  2Z6K C;  1EFW A;  5LMU L;  5IYB H;  1M90 C;  4IFD I;  4OX9 Q;  4DV5 L;  1MIU A;  3GDE A;  1TWG H;  3GO5 A;  4TVA B;  4A3M H;  2F52 A;  1LTL A;  3HKZ E;  5M5X H;  4A3I G;  4DPG A;  1MJE A;  3HOY G;  1N32 Q;  2ZM6 Q;  1YHB A;  3JC6 6;  1X56 A;  3HOZ G;  4A3L H;  3UDX A;  2Y0S E;  3UE0 A;  4B3R Q;  3M7N A;  4DR1 Q;  4KHZ A;  3H0G G;  1XTD A;  4POG A;  4LUV A;  4A93 H;  1SE8 A;  2NZO A;  4MZ9 A;  4GN3 B;  4IFD J;  1NTG A;  4JC0 A;  4A3F H;  2Z6K A;  3PUW A;  1DGS A;  2Q2U A;  3HOW G;  3PUX A;  2UXD Q;  4IJH A;  3S15 H;  4DR6 Q;  3T1Y Q;  3G4S A;  2WB1 G;  1PVO A;  1HNW L;  1XJV A;  5LMN L;  2K14 A;  1L1O C;  2NN6 I;  2KEN A;  4RMF A;  4DUY Q;  4FDB A;  3TEH B;  5C44 G;  1X3E A;  3TRE A;  1S3O A;  2N78 A;  5C4J H;  2HIV A;  3NEM A;  2ASB A;  1SN8 A;  5ELO A;  4NPS A;  4DV1 L;  2ZJP A;  1GM5 A;  2IHE A;  1NMG A;  3FP9 A;  3STB D;  3RN2 A;  4JCV E;  3STB C;  1N36 Q;  2WAQ E;  1K83 H;  1E7Z A;  2R7D A;  2RHS B;  5BR8 L;  3J81 c;  2CWA A;  4A3D G;  4JI6 L;  1SRU A;  3F1Z A;  4YHH L;  4DUZ L;  1YEZ A;  3MXN B;  2K4K A;  2QEX A;  3HOV G;  1FL0 A;  1GKH A;  3S1M H;  3ULL A;  1J5E L;  2IHF A;  2PQA B;  3UE1 A;  4DV0 Q;  1EWI A;  2C35 B;  1XMQ Q;  1VQ7 A;  3H3V I;  1SFO H;  1NJI C;  1L1O B;  2E8G A;  1OTC A;  3RNU A;  3K7U C;  1YI2 A;  4LF6 L;  2OTJ A;  1UE1 A;  2KCT A;  3M9B A;  3PUY A;  4QGU A;  4POF A;  3ULP A;  2R92 H;  1OXX K;  1AE2 A;  1VQE A;  2D0O A;  4JI8 Q;  1X55 A;  4R4T A;  4A3C H;  2XGT A;  1YHA A;  4NB3 A;  1K0R A;  3CC4 A;  1E1O A;  4HIM A;  4JV5 Q;  3CCU A;  4LFA Q;  3U4Z A;  1L0W A;  5M5Y H;  3F2D A;  4PZ6 A;  4DK6 C;  2H5X A;  5DLQ E;  4DNI A;  4H02 A;  1GVP A;  4GKJ Q;  4BXX H;  3HFZ B;  4GLX A;  4PZ8 A;  2UUB L;  3PSI A;  1IL2 A;  1G29 1;  1QUQ A;  4KLK A;  4LF8 L;  4DR5 L;  1VCI A;  1VQ8 A;  2NVQ H;  3J7Z C;  3A5U A;  4JBM A;  1B70 B;  3Q8D A;  4HIO A;  1KAW A;  2OQ0 A;  4DV4 L;  3E9I A;  4EQ5 A;  4LFC L;  5IYD H;  4BBS H;  1TWF H;  4R4Q A;  3TQY A;  2EIF A;  2K75 A;  2NZH A;  2DUD A;  4A3E H;  1K9M C;  4BBR G;  3CP0 A;  5IYC G;  1X6O A;  1WI5 A;  2HHH L;  4LF6 Q;  5C0X I;  1IXR A;  4DV3 L;  1PHJ A;  2CKZ B;  2WP8 J;  1FGU A;  4JBK A;  4DV3 Q;  2L15 A;  1XNQ Q;  2B63 G;  1XMQ L;  2HHH Q;  3S1Q H;  1J5E Q;  1WFQ A;  1MJC A;  4X65 Q;  2KCM A;  3KF6 A;  4HJA A;  5M3M H;  3RLF A;  4YHH Q;  4P75 A;  2R6G A;  4DUZ Q;  3CCE A;  5JEA G;  2K52 A;  4EX5 A;  1QVC A;  2VNU D;  4LWC A;  3W1B A;  1N36 L;  1M1K C;  4BA2 I;  2RF4 A;  3KFU A;  4DR5 Q;  4A3J H;  2R7F A;  5GAE C;  1HNX Q;  1LUZ A;  2JEB I;  2Q2T A;  2ZTC A;  2R7Z G;  4UY8 C;  2E2J H;  1K8A C;  1VQ4 A;  1JJG A;  1VQL A;  1SRO A;  4O0A A;  5ELN A;  1GD7 A;  3SGI A;  1SR3 A;  1KIX A;  5LMN Q;  2PQA A;  2MFI A;  2UU9 Q;  3EBE A;  2KHI A;  3KDF A;  4JV5 L;  4DR6 L;  2I5L X;  2MO0 A;  1HZA A;  3GTL H;  4JI1 L;  3A0J A;  2IX0 A;  2BH8 A;  4K0K Q;  1I6H H;  1QUQ B;  4GS3 A;  4KI0 A;  1E22 A;  2EQS A;  3WWV A;  3T1H L;  4QIW E;  1OXT A;  2CFM A;  1X65 A;  4DR1 L;  3FKI G;  3AQQ A;  2ZJQ A;  2UXB Q;  4OWT B;  2D62 A;  4AH6 A;  4GLV B;  4DV6 L;  4OO1 I;  1N32 L;  1VQG A;  4IPH A;  4DV0 L;  3K81 C;  1IBL Q;  1X3F A;  4OON A;  3IRB A;  5GAD C;  1TWH H;  1YHQ A;  1G51 A;  4OX9 L;  1I94 Q;  3S16 H;  4DR7 L;  1W3S A;  4A4I A;  4DR3 Q;  5C3E H;  2K5N A;  4JI6 Q;  4PZ7 A;  5M5W H;  1WCM G;  1MKH A;  5HGQ A;  1Q86 C;  5EAY A;  3BJU A;  4JI2 Q;  3ICE A;  2JA6 H;  2K5H A;  2Y0S G;  4A3B G;  1HR0 W;  4JOI C;  4C2M H;  2VQF Q;  5IT9 c;  2DGY A;  4PG3 A;  4A3I H;  1HNZ Q;  2E2I H;  4L5T A;  4DV1 Q;  1Y1W G;  3HOX G;  4A3K G;  2HQL A;  3OW2 A;  1G6P A;  1EUJ A;  4DK3 C;  4QJF A;  5C4X G;  4X64 L;  3H0G H;  1X3G A;  2LXK A;  4DUY L;  4YCU A;  2N49 A;  1VQC A;  1WYD A;  3PUZ A;  4A3J G;  1VQ6 A;  4A3C G;  1HNW Q;  4ALP A;  3D0F A;  4JI2 L;  1EQR A;  3D31 A;  4BY7 G;  2UXC L;  4BBR H;  3AFQ A;  3L2P A;  3AEV A;  5IY0 A;  5IYB G;  3KDF B;  4YWM A;  1IBL L;  2VQE Q;  3KJP A;  2PMZ E;  1K8G A;  1NY4 A;  2YYZ A;  4XIG S;  4DV6 Q;  2JE6 I;  2UXB L;  2IY5 B;  4A93 G;  2I5H A;  1Q12 A;  4L5S A;  3T1H Q;  1WOC A;  1UEB A;  2ALY B;  3L0O A;  3LGJ A;  1VQ5 A;  4DV5 Q;  4APV A;  2RHQ B;  3RN5 A;  2VY3 A;  5LMU Q;  5E7N A;  4C3J H;  3F8T A;  4JI1 Q;  4YCV A;  5IYD G;  2VW9 A;  5C4X H;  3HOU G;  3I2Z A;  1C0A A;  5JJL A;  4JI5 Q;  1N9W A;  1TWA H;  2VZA A;  2JJQ A;  3EIV A;  3GTQ H;  3I56 A;  4GN5 A;  4B3T L;  5C44 H;  1XPU A;  1OXV A;  4O2D A;  4P72 A;  1Z9F A;  3CW2 C;  4X64 Q;  4BY7 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...