4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
3HKZE 5C44G 4BA1I 2VQEL 3BZKA 4YWMA 4HJ7A 3KYHC 4NXMQ 5IE8A 1XMOQ 4HIOA 1PH3A 1G6PA 3UDGA 3M4OH 3UE0A 1XTDA 1I50H 1E3PA 3S1QH 2UXBQ 3PUWA 5IP7H 1GO3E 2I5MX 1QUQB 2H5XA 2OCEA 3CW2C 1DGSA 1E22A 5E7NA 2AWOA 4JI8Q 4A3KH 1VQPA 4GNXC 4P74A 3EN2A 2QEXA 4UP8A 2PMZE 3HOXH 4LF5Q 4JBMA 1YJWA 1XNQL 1SN8A 3DM3A 4H02A 3PIPA 2VUMG 5BR8L 1PH8A 1TWFH 1Q1EA 1K83H 4HJ9A 1J5EQ 3F1ZA 4HJ8A 1K3RA 2UUCL 4BY1G 1PH1A 3PSIA 1S72A 3HOZH 2K75A 1EQRA 1HNZL 3PF4A 5JEAG 4B3RQ 4QY7A 1KRTA 4LFAL 1VCIA 2HT1A 4JI6Q 4A3EH 4WJ3M 1Q1BA 5AJ3Q 2N78A 4EX5A 3PF5A 4LNQA 4DR2Q 3U58A 2JA8H 2AKWB 4DV4L 2ZTDA 1CSPA 3I4NH 4AH6A 3U4VA 4DR3L 4GLVB 2MQHA 2K5HA 2RHSB 2VW9A 4GNXA 3CD6A 1GKHA 3HFZB 1JJCB 3HOYG 4X65L 4BY7G 4L5TA 2Q2IA 3OW2A 1R9TH 4AQYL 4ALPA 4R1JA 1VQKA 2MO0A 1HR0Q 4JI4Q 1RL2A 5IP9G 4IFDG 2ID0A 1YVCA 4JI1Q 4DUZL 4JI3L 4DNIA 2AHOB 5ELOA 2VQFQ 2NN6G 3UE1A 4DPGA 4GOPB 2PQAA 1VQDA 2HIVA 3G71A 1IBLQ 1X3EA 1OXXK 4DK3C 4NXML 5IYCG 1Y1VG 4LFBQ 4C3JH 4XIGS 1Z47A 2N49A 3BU2A 4O2DA 2R93G 3NEMA 4JI8L 5FJ8G 3VDYA 1I5FA 2GVAA 1BBWA 2WFWA 1BBUA 4LF5L 1EQQA 3I4MG 3J81i 4A75A 1EWIA 2UXDQ 1L0WA 1NTGA 2JK8A 2IHEA 1N36Q 1Q86C 4HIMA 1J5EL 1C7YA 4KHZA 2R7ZG 4OO1G 4A4IA 4B3RL 4BA2I 1X3FA 3I55A 2IX0A 1HZ9A 4JI6L 2K5NA 5AJ3L 1IYJB 2NVTH 4DR2L 4A3BG 3J80i 1HNXQ 1SRUA 4POFA 2BH8A 1B70B 4YY3L 3S17H 4A3FH 1VQ4A 1EUJA 3D0FA 1V9PA 1PH7A 1PHJA 2YV5A 3NENA 1GVPA 4DV5Q 4PZ7A 1Q46A 1UE6A 1VQFA 3H0GH 3K81C 5ELNA 3U50C 1N34L 3S2DH 4GKJL 5C3EH 2IT1A 4JI4L 3ULLA 4GNXB 3CC7A 1QUQA 1CUKA 1WCMG 4GS3A 1GM5A 4DR4Q 2DGYA 2OTJA 2D0OA 5FLMH 2AMCB 2VQFL 4EQ5A 4P73A 3F2CA 1C9OA 1IBLL 5GAGC 1EOVA 2YTYA 2K5VA 2YU9H 4LFBL 4IO9A 5IYDH 2E2JH 1KHIA 1K8GA 1YJ9A 3A5ZB 3BJUA 4BBRG 4GOPC 2GN5A 1YHQA 1M90C 2B29A 3ULJA 2NVQH 4A3JG 1KQSA 1K0RA 2JE6I 1B7YB 3W5OA 1PFSA 1HNZQ 4A3IG 3PUVA 1YI2A 5LMNQ 2B3GA 4LFAQ 4DV3Q 1KL9A 3BZCA 3RZDH 3S15H 4GN4B 2NVYH 3TS2A 4A3MG 3J7A5 4A93G 4AIMA 1N9WA 3TREA 3S14H 4R4CA 4GLXA 3T1HL 4DR3Q 3M4PA 1IBMQ 1H95A 2R7DA 3SGIA 1HNXL 1U5KA 4JBWA 4A3DH 1KD1C 2UU9Q 4GOPA 1E24A 2D0PA 4BXXH 1WOCA 2Q2TA 2JA5H 5C4JH 1JB7A 5FLXc 4A3GG 1X6OA 4LUOA 4DUZQ 4DV5L 5C4XH 1VQBA 1OXUA 1YJNA 4DV2Q 4LW1A 1K73C 4JI7L 1VQOA 3J81c 3RN2A 2MFIA 2WAQG 3I2ZA 4DR4L 1HJPA 5HGQA 2ZJRA 3CMEA 4DR7L 2JQOA 1TWGH 3E0EA 3W1GA 3K80C 4LF8Q 2PI2E 4FDBA 1ASZA 2IHFA 3FKIG 3FP9A 4MNOA 3A0JA 3HOWG 3PGZA 4B3ML 2YTVA 2VY3A 3J80c 4Y7NH 1HZCA 3HOVH 3HOUG 4DV7Q 2R92H 2NZHA 3S16H 5IYBH 4LF9L 3EBEA 3JAMc 2QA4A 1XMQQ 1D7QA 1EIFA 2EIFA 5LMNL 2ZM6Q 1X54A 4DV3L 2HHHQ 4A3CH 2JA6G 2E8GA 2B63H 2K50A 1Y1WH 1VQ7A 4DV1L 1UE7A 1YEZA 4YY3Q 4JI2Q 3F2BA 5M5YH 4GN5A 1IBML 2KHJA 3H3VI 2NN6I 1TXYA 4DR1Q 5K36G 3PO3G 1UWVA 1OXSC 3W1BA 1PA6A 2WAQE 1N34Q 2UU9L 4A3LG 4BBSH 3CAMA 4O0AA 3CMAA 2WB1G 4DV2L 3D31A 5IWAQ 1CKOA 3AYHB 1PV4A 3TQYA 4HJ5A 2ALYB 1TWHH 1KAWA 3GTGH 4OWXB 1K9MC 4AYBG 1X9NA 1RIPA 1VQHA 1EFWA 4OXPA 2YYZA 2KCTA 4LF8L 5M3FH 1QVFA 3PO2G 4OO1I 3GTKH 4ME3A 3IRBA 4DAMA 1YIJA 3GTQH 3CQZH 3A5UA 4JOIC 5M3MH 1MJCA 3J81j 3M85A 4DV7L 1Z9FA 1Q81C 2UUAQ 3PUXA 1QZHA 1HZBA 1VQAA 2FXQA 1JT8A 2HIXA 1V43A 5IT9c 4WJ4A 2GVBA 1XMQL 1LUZA 3AQQA 2VS1A 3K7AH 3M3YH 1VQ6A 2ZM6L 2OQ0A 2HHHL 4B3TQ 1VQCA 3T1HQ 4DV6Q 2UXCL 4NPSA 5IP7G 1VQ9A 2MO1A 1A0IA 1UE1A 5IYDG 2ZJPA 1PYBA 1CKNB 3KF8B 3RLOA 3CCVA 2PI2A 4A3KG 2BH2A 3HOXG 2VZAA 4JI2L 4KLKA 4PG3A 4A76A 3S1RH 1KC8C 3ER0A 2A1AA 2WB1E 2E5LQ 3GTLH 2BA1A 2KHIA 3I56A 4DR1L 2JA7H 2HQLA 4IPGA 3KDFA 4JOIA 3ULPA 4NXNQ 5IY0A 3HOZG 4BY1H 4JI7Q 3F8TA 1YITA 4AYBE 4JV5L 4UY8C 5C44H 2YTXA 4DR7Q 4A3EG 3A74A 5IWAL 4JG2A 3WWVA 4OWTB 2JA8G 4L5SA 1G291 3STBD 3CC4A 1VQNA 3PV0A 4LWCA 3RLNA 3CCMA 3I4NG 1TWCH 2K52A 4B3MQ 1XPUA 5EAYA 2I5HA 5J3BA 1XJVA 3DLLA 4YWLA 2IX1A 3KOJA 4JYAL 2ASBA 3AFPA 1TWAH 2VUMH 3B6YA 4LF9Q 4YHHQ 1XNRQ 5JJIA 1BKBA 1AE3A 4QIWE 3Q8DA 1A62A 1NMGA 2E2IH 3L2PA 2UUAL 1ASYA 1I6HH 1FGUA 3CCQA 1Q12A 1K8AC 1NMFA 4DV1Q 1HNWQ 4DKAC 3K8AA 3U4ZA 4R4IA 2N8NA 1T9HA 4JI5Q 4B3TL 5HY6A 4DV6L 3AFQA 4OONA 3ZJYC 4L5QA 4TVAB 1NBWA 4JC0A 4R4QA 3HOYH 1VQIA 1WFQA 1X56A 4BY7H 1N8RC 2E5LL 4PZ6A 4C2MH 3GTMH 1JMCA 3L0OA 3E9HA 5IP9H 1AH9A 1LM0A 5JJKA 3CXCA 4NXNL 4IPDA 1Y14B 1V1QA 5JEAJ 2I0QA 2V1CC 1WYDA 3NBHB 1VQJA 4HIDA 4QGUA 2BA0A 3KLWA 4GLAC 3H3VH 3M7NA 1E1TA 2CCZA 5C0XG 1OTCA 3NELA 3TEHB 3KDFB 2XGTA 1M1KC 4POGA 2Q2UA 2KENA 4R4TA 2IY5B 4J15A 1Y1VH 2ZTCA 5IYCH 3K7UC 2R93H 2QGQA 5FJ8H 2XTIA 3KF6A 1LYLA 4A3FG 4NB3A 3GDEA 4XTCS 3T1YQ 2UUBL 1KXLA 1SLJA 3I4MH 4IFDJ 2VL6A 3H0GG 1VQMA 3RLFA 4MZ9A 5GAHC 5C3EG 4YHHL 1XNRL 1G51A 1QVCA 4PZ8A 1CKNA 3CP0A 1N32L 2ZTEA 4MTNA 3CC2A 2R7ZH 3S1MH 2L15A 3PUYA 1N33Q 3PCOB 5FLMG 3MEFA 2UXCQ 1XPOA 1P16A 1HNWL 3S2HH 1WJJA 1X65A 4C3IH 4C3HH 1VQGA 5M5WH 4A3BH 1Q82C 4IFDI 4KHPQ 1L1OC 4JI5L 3UDXA 2LSSA 1O7IA 1I94Q 3M9BA 4X64L 1S40A 2C35B 1D8LA 1JE5A 1FJGQ 4DR6Q 1SFOH 3CCSA 2R7FA 1JJGA 1GD7A 3CPWA 3RNUA 2NVXH 1L2FA 3OYYA 4JBJA 1YHAA 3I4OA 3ERSX 3JC66 4JI0Q 4IOAA 4YCUA 4K0KQ 4JV5Q 3CCUA 1PH4A 1XPRA 1QZGA 4GKKQ 1S3OA 1IBKL 1WCMH 1NE3A 3HKSA 4GN3B 2MNAA 1A8VA 2CQOA 5GAEC 1IZ6A 1KRSA 1WI5A 1VQ5A 4OWWB 2EXDA 4P75A 4DUYQ 2LXJA 1UEBA 4X62L 3G6EA 4IOCA 3RN5A 2OTLA 1PH9A 4RG1A 3EIVA 2RCNA 1VQEA 3ICEA 1VQ8A 1L1OA 4JYAQ 4TQUS 1CKMA 4X66Q 4B3SQ 2VNUD 4IJLA 3OTOL 2ES2A 2Q2HA 4A3DG 1E1OA 3FHWA 4BBRH 3I7FA 3T1YL 1HR0W 3G48A 4BXXG 3K0XA 2JA5G 4IJHA 4A3JH 1PH2A 4OX9Q 1MIUA 5C4XG 2JA9A 2JEBI 5GQOA 4A3IH 3KF6B 4YCVA 2Z0SA 1BVSA 1YNXA 1KIXA 2EQSA 3CCJA 4KI0A 4LF4L 1SROA 4A3MH 1B8AA 1N33L 4A93H 2PNHA 1XMOL 2DUDA 3KFUA 2UXBL 2Z6KC 3CCRA 3TS0A 3KJOA 4LF6Q 4KHPL 4LF7Q 3GD7A 3CCLA 4LUVA 3S24A 1W3SA 3J7ZC 1I94L 2F4VQ 4DR6L 4UP9A 1FJGL 3HOVG 3UDIA 2R92G 3GTPH 1OXTA 4A3GH 4JCVE 5IYBG 1MKHA 4JBKA 2LXKA 1P8LA 4UP7A 1LTLA 3KJPA 4JI0L 4K0KL 1EYGA 2JEAI 4GKKL 1X3GA 3F2DA 5LMUQ 4A3CG 1EIYB 1J6QA 3CF5A 2Y0SG 2E2HH 3E9IA 4L5RC 2ATWA 1Y1WG 2OQKA 2B63G 1C0AA 1PVOA 4DUYL 1NJIC 1SMXA 3LGJA 1PH5A 1X55A 4LFCQ 2Z6KA 3FKIH 2RF4A 5H1SE 2UUBQ 4X66L 3HOWH 1IL2A 4B3SL 3JAMi 2RHQB 3GTJH 1PH6A 1JJ2A 2D62A 3HOUH 1YZ6A 3UDFA 4DR5Q 1PYSB 4DV0Q 4PMWA 4LF4Q 4BBSG 4UPAA 1L1OB 2K14A 4GKJQ 3STBC 4QL5A 1HR0L 4OX9L 1N32Q 1HZAA 2A19A 4LUZA 3TRZA 4DK6C 2KBNA 2VQEQ 1Q8KA 2OWOA 4JI1L 5C0XJ 2CWAA 3PUZA 2K4KA 2JA6H 2WP8J 2AWNA 1CSQA 5GROA 1FL0A 1U0LA 3H15A 4X6AH 5GADC 5JJLA 2CFMA 3HKZG 4X64Q 1UE5A 4QJFA 5M3FG 2PQAB 1HH2P 1XNQQ 4Y52H 2JJQA 3GO5A 3RR5A 1E7ZA 5BR8Q 5C0XI 4LF7L 4LF6L 3PO3H 4QQBX 2UUCQ 2KCMA 4YCWA 2CKZB 1AE2A 5DLQE 1W2BA 5M3MG 2F4VL 1YHBA 3PIOA 4HJAA 3GTOH 4A3LH 1I3QH 2Y0SE 4R4OA 5M5XH 5LMNW 1IBKQ 3RZOH 3AEVA 4IPHA 2UXDL 1N36L 1QVGA 4P72A 3CPFA 1SR3A 2F3IA 3M4QA 4X62Q 1FVIA 5LMUL 1A63A 4DV4Q 4DAYB 1NY4A 1OXVA 1Q7YC 4P71A 4RMFA 3S1NH 1MJEA 3OTOQ 2R6GA 3CCEA 1IXRA 4LFCL 4APVA 4X65Q 3G4SA 3PO2H 4YWKA 2CWPA 3L7ZC 4AQYQ 2ZJQA 2A8VA 2JA7G 3MXNB 2I5LX 4HIKA 2NZOA 1YBYA 4IPCA 1VS0A 4DR5L 4JI3Q 1SE8A 4DV0L 2F52A 2N3SA 1VQLA
chains in the Genus database with same CATH superfamily
4RWSC 1K1SA 1B50A 5C44G 2RSNA 4JK1C 4BA1I 2VQEL 1AFPA 3BZKA 1G8ZD 3KYHC 1G6PA 4ZLTF 3M3YB 3M4OH 4NXNH 3PN1A 1E3PA 2K1BA 4DA2A 1GO3E 2I5MX 1QUQB 4TKOB 4JI8Q 5IYDH 1DGSA 2V4QA 3TP5A 5K5PA 2QEXA 1D1KA 3HOXH 4LF5Q 2W9AA 4JBMA 2EYLA 1YJWA 1SN8A 1TWFH 1Q1EA 1ZHSA 2IL8A 1H9JA 1PTOB 4RGOS 3K58A 1S72A 2HVQA 2FLLA 1A9XA 5DM63 4FS2A 1HNZL 4LFAL 5DM73 4A3EH 3NP8A 3BQ0A 2N78A 3PF5A 4YHHH 4DR5H 5CV9A 2JA8H 3C1EA 1EIGA 2HVRA 1EZ6A 4XQQA 4CKBA 3RJ0A 1CSPA 3MFHA 5KFEA 4AH6A 4WFN3 2FK2A 1S68A 1TS4A 2RHSB 4GLVB 4JVZA 3J7AF 1CQJB 2XIGA 4IRKA 4X65L 5EWFA 5KFJA 1HNWH 4O42A 5JH7F 5JVLA 2VXWA 1HR0Q 4JI4Q 1GHJA 5L9XA 1RL2A 4KV6A 4XT3B 2JXMB 1WD1A 3P75A 2MHVA 4DFAA 3N41B 1DXMA 4DPGA 1VQDA 2VPSA 5KFRA 2HIVA 3RMHA 4ZAIA 4ECYA 3RZDB 4DK3C 2IMWP 4LFBQ 2J6SA 4O2DA 5EOYA 3NEMA 3MVVA 1NNXA 1RTNA 2KCNA 4X62H 3FPUB 4Q45A 1XX8A 2GPSA 1EQQA 3I4MG 1S97A 3OTOH 2IHEA 1F2MA 3GTMB 2NUAB 1S5DD 1TWHA 1SNCA 5JOBA 4HCSA 4OO1G 4YJ2F 5C0XH 1X3FA 1HZ9A 4QMGA 5I9OA 2K5NA 5AJ3L 4JW0A 1IYJB 4DR2L 1GUTA 1SRUA 2BH8A 4IZ8A 4TRDA 4FBTA 2B2WC 2A6HD 4OELB 4A3FH 1N33H 1V9PA 1XMOH 2YV5A 1VQFA 1AZPA 4ED2A 1N34L 2R92B 3I4MB 3T5KA 1EY7A 2B8FA 3CC7A 1QUQA 1TS5A 1WCMG 4GS3A 4DR6H 3MWMA 4J9MA 5IODA 1EWCA 1IBLL 3GLKA 2NBFA 5GAGC 5BPFA 2Y0SB 4K0KH 1YNJD 4K8JA 4HTHA 1L0YB 2YTYA 5M5WB 2QYZA 3N44B 1CQVA 5C8YF 1YJ9A 5M5YB 4RUCA 4FXGC 2EVBA 1SFOB 2GN5A 3ULJA 1G91A 4A3JG 3BQ1A 2R85A 5FK9C 4A3IG 2VOBA 4A2BA 1KL9A 3BZCA 5JVH3 1PTOF 1GLVA 3S15H 2HJWA 2FLNA 1UEAB 4I4TF 4XZ3B 5KFCA 4AIMA 1SMYD 3S14H 2RQXA 1B53A 3J7YW 4DR3Q 4JI1H 1GUGA 3TZDA 2R7DA 3ETHA 3HKZB 1U5KA 3PIP3 4A3DH 1LLRD 2UU9Q 4EBEA 4H13C 1WOCA 3GTQB 3I90A 5C4JH 1VAJA 1X6OA 3LNNA 1VQBA 1Z2PX 3QB3A 1M0TA 4DK1A 1VQOA 5C3WA 3J81c 2MFIA 2YW2A 4TV8F 1HJPA 2ZJRA 3CMEA 4DR7L 3VPBA 3K7AB 1N36H 3T5LA 2PI2E 4XQNA 4FDBA 1ASZA 1E2VA 3A0JA 2RGVA 2AGQA 3GTMA 3HOWG 1Q8IA 1J8IA 2YTVA 4C1NK 4UCRA 1G2SA 3K0YA 2M9VA 1HZCA 4Y7NH 3HOVH 3HOUG 4KY6A 3MA2B 4OGQC 1OO9B 4IQZA 4LF9L 4QUFA 1BUVT 5KFYA 1SNDA 1HHVA 1EQVA 4FM9A 4LFCH 3JAMc 2QA4A 1XMQQ 1D7QA 2B2UA 4LH6A 1C30A 3RF2A 2EIFA 3GIIA 2Z6BA 4M8AA 1XWEA 4LF4H 4EQNA 4DV1L 1Q3LA 1KC7A 1YEZA 1JDEA 2L4NA 1PRTF 5TSSA 2CQYA 1SE2A 4WORA 1I4GA 3PO3G 4MV8A 4M1UB 4RB2C 5ELEA 2B2YC 1OXSC 3EQLC 3W1BA 2F0DA 2B2VA 5COYA 2F03A 1MSGA 4R7RA 1I4HA 1XNQH 3DM1A 4DLKA 2C9OA 4DV2L 5IWAQ 2UUCH 3TQYA 4HJ5A 1KNEA 3N8DA 1SFOA 1K9MC 1EY4A 4AYBG 1VQHA 2C2RA 2KCTA 2E2DC 3IRBA 4DXFA 1DOLA 2DWCA 3CQZH 1WCMA 3A5UA 5GONF 3Q8PB 4DV4H 2W6MA 1DCZA 5D65A 1STYA 2PW5A 1O7LA 1SYEA 1EY5A 1Q81C 3GIQA 1VQAA 5M5XB 3RZOB 4FF1A 1Z7TA 4K5WA 1JIHA 3AQQA 2VS1A 3MEHA 3KHLA 2HHHL 4B3TQ 1S9FA 4DUZH 4JI3H 4NPSA 3EROA 3GP7A 3Q6SA 2MO1A 1A0IA 1UE1A 3DWQA 1PYBA 5IYDG 3RLOA 2FK3A 2I87A 2PI2A 4AYBB 4DAPA 1WR2A 4HR7A 3HOXG 5KT5A 3D3RA 3S1RH 3TP6A 1KC8C 1SCUB 3I56A 1CE8A 3OHBA 1EU4A 1IW7C 2Z8LA 2L9HA 1DYQA 3G7LA 3ULPA 4JI8H 1JOQA 2PYKA 4JI7Q 1YITA 4AYBE 5LA6F 4LF5H 4TV9F 3G6XA 2A6HC 4A3EG 4FBUA 2CW0D 3EJIA 2JA8G 3OSNA 1G291 3HZXA 3PV0A 2V4RA 4QIWB 5LOVF 3GILA 4O3SA 1TWCH 4C3IB 1R4QB 2I5HA 1XJVA 3V2TA 4YWLA 3J81L 3CKIB 2VUMH 4MTDA 4MV6A 4IALA 4ED1A 2HGSA 1AE3A 1TWFB 4QIWE 4R8UB 3VYUA 5FOBB 3L2PA 2NWGA 1VBGA 1FGUA 3CCQA 1Q12A 4G7OC 1K8AC 2ICEC 3K8AA 2Z1CA 4A3EB 4JI4H 4G4KA 3A7LA 2PZWA 4R4IA 4JI5Q 4ED3A 3T4AC 3A54A 2A68D 3JAML 3L4KA 3AFQA 4TVAB 4JC0A 3HOYH 1H9SA 3DXJC 4GC7A 1WFQA 4BY7H 1O7YA 1I6VC 2R7LA 5HBRB 4LFBH 3E5SA 3E9HA 5IP9H 1SMYC 4RH6A 1LM0A 3CXCA 1L2ZA 2I0QA 1Y14B 1V1QA 1PX2A 1ET6A 3NBHB 4HIDA 1ZYRC 4IAJA 1I4PA 3PR5B 2NN6H 4HYKA 5DQHA 5C0XG 1Y8PB 1OTCA 1PRTD 3TEHB 4POGA 2DY7A 2KENA 1GSOA 4A3MB 4IWYA 5KFQA 3K7UC 1PYWD 1U4PA 5IT9E 2R93H 4N8FA 2XTIA 3I8ZA 4R8NA 4YAKB 4A3FG 3SK8A 2RVLA 3T1YQ 4XYLB 2H4OA 1LV9A 2UUBL 3KBGA 4V190 1KXLA 3N43B 4K6LA 5KG2A 1VQMA 1G6ZA 4MZ9A 3KBXA 3IN5A 5EPLA 1G51A 1B6SA 4PZ8A 1CT1D 2ZTEA 2R7ZH 3S1MH 3K5LA 2PBZA 4JPBW 3PUYA 4AYBA 5HURA 1JWUD 4FVMA 2UXCQ 1XPOA 1P16A 1NR4A 4C3HH 4A3BH 4IFDI 2PQEA 2E2HB 4KHPQ 3MR3A 5CA0F 1GXDC 3UDXA 2LSSA 4EQOA 1O7IA 1S40A 1T5XD 4MA0A 3CCSA 4I50F 1CZGA 2KUMA 3CPWA 5ELBA 1JICA 2NVXH 3GTJB 3E0JA 4JI0Q 3QFFA 4YCUA 1BF4A 5DG8A 4JV5Q 4RNMA 5KFPA 1XPRA 4GKKQ 4QIWA 3SVMA 1NE3A 1LACA 3HKSA 1EEID 5DEHA 4GN3B 2MNAA 2UVVA 2CQOA 1KRSA 3G6VA 2EXDA 2ASDA 2OTLA 3G6EA 2JA6B 5KFAA 4QW9A 1PH9A 1ESFA 2VR1A 3I73A 1E4EA 4G7HC 1EWHA 2LY7A 4X66Q 1TWFA 5BMVF 3PW5A 4XYMB 2XRQD 2DNEA 1Z2NX 4A3DG 3QO2A 3I7FA 4X3UA 1ZEQX 1HXYD 3K0XA 5KFSA 4IJHA 1IOVA 4RAUC 2JA9A 2JEBI 3KF6B 4ABNA 5M9OA 2Z0SA 1BVSA 5JVG3 5KG4A 1TVXA 1DV1A 5EGTA 3H94A 2WB1B 3SXHA 5EZYF 2UU9H 2XNAC 2R87A 1HTLD 2L5TA 4E6IA 4A93H 4I7ZC 3S15B 2YZNA 3MAQA 3KFUA 2P0AA 2MUYA 2Z6KC 2Z4HA 1ZQ7A 4LUVA 1W3SA 2F4VQ 3SDZA 3GV5B 3HOVG 3GTPH 2NU7B 3KLRA 4JCVE 4IUUA 5C4JB 4H0LC 5FO8B 1X3GA 2E2IB 1MSHA 3RGXA 3CF5A 2QEJC 1C0AA 2W57A 3RB4A 3MXNA 3OWFA 2VB2X 1PTOC 1XMQH 3M9OB 5HV6A 3FKIH 2RF4A 1HUMA 2NU8B 1IL2A 1ESRA 2FMCA 2RHQB 5A2QL 2PZTA 5ELCA 1YZ6A 4DR5Q 2FLPA 3R5XA 2I07B 4Y7NB 2A6ED 4DV0Q 4UPAA 1L1OB 4GKJQ 2BQUA 1RYRA 1K83B 1HR0L 1DV2A 4OX9L 3TRZA 5KKNB 1QNUA 1Q8KA 2XC9A 2CWAA 3RB0A 3P7JA 1CSQA 1STHA 4NP5A 2J0TD 1FL0A 1U0LA 2HCCA 3KAKA 5GADC 3JRXA 1L0XB 2RDHA 2EPBA 5IWAH 1CQIB 5K36H 3GO5A 4K2LA 1E7ZA 5BR8Q 4LF7L 3TDQA 4DUYH 4YAJB 1AE2A 5DLQE 1YHBA 4XQJA 3GTOH 1I3QH 5LMNW 4JYAH 2K6AA 3AEVA 4IPHA 2XCLA 1EY9A 5I9PA 1MZBA 3VR6A 4K5XA 1QVGA 4KTAA 1SR3A 2F3IA 4X62Q 3Q2OA 1FVIA 4DAYB 2ATLA 4J9QA 1OXVA 5I2YA 3BDCA 3S1NH 2R7KA 1SYCA 4ID6A 1SYXB 3OTOQ 1WSCA 5KRUA 1EZ1A 3PO2H 3GV8B 1S0OA 2CWPA 5LHY1 4B3TH 1HA5A 4H7BA 3M4IA 3N6XA 2I5LX 2NZOA 1YBYA 2RBMA 4IPCA 2R3ZA 1SE8A 3OUUA 1KLUD 2MJ8A 1K1QA 4M9UA 4NXMQ 4MIUA 5T14A 1XMOQ 4HIOA 2DLNA 1XTDA 2FINB 4CDFC 5H80A 2XSCA 4HEDA 3WDNA 5IP7H 3CW2C 2VNUD 3KXYT 4ME6A 3RBEA 2NVTB 2PMZE 2SEBD 2W70A 2VUMG 3A8KE 1K3RA 5KX5F 1F2LA 1PH1A 4V0BA 2C5CA 3HOZH 2K75A 4FXKC 3S2DB 1MGSA 3PF4A 4B3RQ 4ILWA 4K6DA 2F0EA 4RGMA 1K8MA 4KJNA 1VCIA 2HT1A 1LT4D 4JI6Q 2D2CC 4CC6A 3U58A 4JV0A 5D14A 3I4NH 1AUVA 4DR3L 1RJPA 4GNXA 3HOYG 3HFZB 1TWCB 1JJCB 4BY7G 2E2JB 2Z4IA 2W6NA 4AQYL 4ED6A 4JI5H 4X64H 5IP9G 4FS1A 4WBNF 4JI1Q 1M7JA 4EYIB 2NZ1D 2NN6G 5FLXW 4GOPB 2F0IA 4HQ6A 1X3EA 2FJ2A 1PFMA 4O3OA 1JE4A 1IBKH 4DL6A 2R93G 1ET9A 4XYQA 1JORA 5FPRA 2F0OA 2GVAA 1BBWA 1S4ZA 2WFWA 2KA7A 1RJQA 3O13A 1EWIA 4A75A 4DAYA 1VMCA 2CW7A 1N36Q 1J5EL 4HIMA 3J80W 3D4RA 3T1YH 2EYHA 2R7ZG 4A4IA 1UC8A 3KALA 1HUNA 4QWDA 2IX0A 5FLXE 4FF3A 2YZGA 4DL3A 4C3HG 3H4BA 4A3BG 5EKKA 3R5HA 3CQZA 4POFA 2WTFA 1ENCA 3RB6A 3S17H 3OOCA 2YRXA 3D0FA 4IUQA 1T5EA 2PMZA 1PH7A 5KYIA 3NENA 3PIO3 2QF7A 1UE6A 5ELNA 3H0GH 4KHPH 3VYTA 4K14A 3S16B 1II3A 4HSPA 3RD4A 1CUKA 1S5FD 3TQ1A 2OTJA 2D0OA 2VQFL 4EQ5A 2JEJA 4DL5A 4RHRA 4QUCA 4B08A 2AQ2B 4JI0H 3T51B 4GKKH 4DF7A 2YU9H 2K5VA 4I55F 2CZGA 1DOMA 5KFHA 1V4YA 1K8GA 5JQWA 3BJUA 1H9KA 2B29A 1GGOA 3UQ8A 1B7YB 3W5OA 5D8DA 2RA4A 1JWMD 4X66H 4ED8A 5LMNQ 4DV3Q 1SSOA 3NWSA 2EYJA 2WINB 2F3VA 1TWCA 3BG5A 2NVYH 2AUJD 3TS2A 3EYYA 4A93G 2EY5A 2FJZA 2FPGB 4R4CA 3M4PA 1TWHB 1IBMQ 2W8LA 2VUMA 2JEFA 1V8QA 1HNXL 1E4GT 2O2LD 3KHHA 3K5HA 4GOPA 4Q0FA 2JA5H 2Q2TA 1HQMC 2OF1A 3I3CA 2F0KA 3I72A 5KNCA 4HNTA 4DUZQ 4DV5L 5M3MB 3UI2A 1OXUA 3NSWA 2UVWA 1GUOA 5C3XA 4JI7L 2F4VH 5ELDA 4DR4L 3I2ZA 1RK5A 2IBKA 2V5AA 1JOKA 2JQOA 1TWGH 4RU9A 3FEWX 4A93B 4GC6A 1RHPA 3FKIG 2KCCA 4MNOA 3W2DA 1KJ8A 2XD4A 1QOHA 2VY3A 1KDBA 2EJMA 4DV7Q 5KFFA 3TP7A 4NLGA 2FPPB 4F50A 3GTPB 1B04A 2VA2A 2CHBD 1PDQA 2R8JA 2IPKD 1TS3A 3RAXA 2ZM6Q 3GV3A 1SNMA 2HQEA 5C44B 2R93A 4OHJA 2MGSA 4RB3C 1Y1WH 1VQ7A 1KJJA 4DV0H 4GKJH 3I4LA 4FNFA 4JI2Q 3A56A 3F2BA 3H3VI 4G3IA 3D6WA 4DR1Q 5K36G 3FKIB 5KFWA 3IG0A 4IUNA 3VPDA 2R7ZA 4BBSH 4CDDC 4WJWA 3CAMA 4O0AA 3H4DA 2K5WA 1IHZA 3NBIA 3HBLA 4KN4C 5BR8H 2R8HA 2WV6D 3AYHB 3IFTA 3W3AA 3K5MA 3GIKA 1G2TA 2FK1A 3GTGH 1EYDA 4O3RA 1D2BA 1PLFA 1HFNA 2VPQA 4TQSA 2NVXA 5FO7B 2KECA 4LF8L 5M3FH 4OO1I 1YNNC 3PO2G 4KY7A 3IAYA 4ME3A 4DAMA 1YIJA 5DQGA 2F0PA 4YR3A 5KT2A 2SNMA 3IL8A 3GTOB 1HZBA 1RJRA 3D8GA 1V43A 4OL7A 5IT9c 4F87A 3H09A 3HP3A 1ENFA 4CKEA 1KBLA 1F9RA 3K5NA 1IW7D 1VQ6A 2ZDGA 2OH2A 3DWAA 4DL4A 4DV6Q 2NUCA 2UXCL 3SI8A 5IP7G 5NUCA 1VQ9A 3CCVA 2ZJPA 1W6JA 3TINA 2A74C 2PZUA 2WACA 1B2TA 5J2TF 4A76A 4NXMH 2E5LQ 2JA7H 3IFDA 3KDFA 4JOIA 3R8BA 3HOZG 2BCOA 4BY1H 3RUPA 2IJ0A 2ZT9C 4JV5L 2LS01 1UNNC 2SDFA 3NUCA 2DIKA 1BO0A 4JG2A 5EBCA 3MXUA 3WWVA 2AQ4A 3CC4A 1VQNA 1EOTA 4FF4A 3RLNA 4LWCA 4EEQA 1JXLA 3EA6A 3S2HB 3I4NG 4B3RH 1XPUA 1CA5A 1B4OA 3GTPA 3K3VA 2ZDHA 2IX1A 4JI6H 2ASBA 3C3LA 3AFPA 1TWAH 4QWCA 4UCTA 5CV4A 2K5DA 3BYYB 1XNRQ 5JJIA 4YY3H 4PMBA 2KJXA 1FNVA 1A62A 1NMGA 1O78A 2K32A 1ASYA 1KAAA 2UUAL 1I6HH 1LTGD 1WCMB 3KLSX 4C56C 1NMFA 3FKIA 4DKAC 5A35A 2E75C 3NTIA 1F9SA 3GIDA 3HS0C 4MV7A 2W9CA 3ZYYX 1CZWA 1ZYRD 4OONA 3SE0A 1NBWA 1VQIA 3I4NB 3V4ZA 1N8RC 1BNCA 2F0HA 4RB0A 2F0VA 1NCVA 4CHTB 4C2MH 5E4XA 1JMCA 5KG1A 5KG0A 5FKAC 4FXDA 2UVRA 4IFDH 4NXNL 4A3JB 4HR7B 4CDEC 2V1CC 5DAUA 1VQJA 2BA0A 4A3IB 4GLAC 1Y69U 3M7NA 2CCZA 1S0MA 3VYRA 3NELA 3KAJA 1RDPD 4EFBA 4R4TA 5IYCH 3C0FB 2ZTCA 1VKZA 4YP3A 2IA6A 5EWEA 1CHPD 1JB3A 2B2TC 1DONA 3LP8A 5FJ8H 3GTOA 2BOSA 3FDTA 3GDEA 4XTCS 5JAVA 4PWQA 2QCPX 1I3QA 4IWXA 3K5IA 2N88A 2F3WA 3R2IA 3T1HH 1HPCA 3VR3A 4IFDJ 4YQWA 3H0GG 4IURA 4YHHL 4LMYA 3LWUA 3V6KA 2L1BA 1QVCA 4N8X1 3PCOB 2B8GA 4BWSC 3NHHA 1HNWL 3FPPA 3MC0B 2LKVA 1L1OC 1ICFB 1I94Q 5IT9L 3M9BA 5F9NA 2C35B 1D8LA 5C4HA 1FJGQ 4KK7A 4IUVA 3S17B 4TQRA 1JJGA 3HOWB 3FRPB 4JBJA 3NWTA 1YHAA 3HOUB 3RV3A 3U9TA 1AN7A 3T5JA 2M2LA 4I7AA 3T56B 4B3MH 1QZGA 3MTSA 1H9SB 2WKCA 2F1MA 5E4WC 1BCPB 5GAEC 1ILPA 4ECTA 1S5CD 3DHQA 1VQ5A 5EBDA 4OWWB 4P75A 4DUYQ 4X62L 4IOCA 4RG1A 2RCNA 3ICEA 4JYAQ 1VQ8A 5LMNH 4DV3H 4TQUS 1CKMA 4XDXA 4B3SQ 1VF7A 3BZDB 3FMCA 4IJLA 4ME5A 3OTOL 2YU9B 2C2DA 4JV1A 1I4XA 1SJED 3FHWA 4BBRH 4J9KA 5KFBA 3PO3B 2AGOA 2JA5G 2W6ZA 1F2YA 1CQFA 1PH2A 1IBMH 4FU0A 4UCUA 5GQOA 3HGBA 3IKJA 3OHAA 2EQSA 1GUNA 1B8AA 1N33L 2PNHA 3L4JA 2NVYB 1XMOL 1B6RA 4B9XA 2EOTA 3CCRA 3OHXC 3TS0A 3KJOA 1KJQA 4LF6Q 3CCLA 5C4ZA 3MWDA 4DR6L 3UDIA 2EE1A 4ECXA 4A3GH 5KG5A 1PTOD 1MKHA 4UHVA 2LXKA 4UP7A 4LK1C 2ENBA 1LTLA 4K0KL 4ZOLF 1EYZA 5LMUQ 1EIYB 1J6QA 4DV7H 2RGRA 1Y1WG 1AW7A 4NW2A 1FKAH 3M9MB 1SMXA 5G3LF 3M4OB 3LGJA 1C3OA 2FMAA 2BE5C 4KHVA 3J7AK 2ZM6H 5KIXA 3JAMi 2F0NA 1PH6A 3HOXB 2W9BA 5L1LA 5CA1F 5LP6F 4LJZC 5JJZA 4BBSG 4PMWA 1E4EB 5CB4F 4JI2H 3H91A 2L11A 2V59A 4DK6C 2VQEQ 4JV2A 4DR1H 4JI1L 4F88A 3GIJA 2K4KA 5JUMA 2WP8J 1TIID 5CAEB 5KG3A 5GROA 2DJFC 5J1ZA 2DZDA 4KY5A 4X6AH 2EY6A 2JA8B 5KFGA 4X64Q 4IHJF 2KEDA 4ZYSA 3H0GA 4QWEA 5M3FG 2PQAB 4IZOA 5C0XI 3PR4A 4ZK9B 4QQBX 2BDOA 2CKZB 4ZUJA 1W2BA 3TBIB 4HAEA 4CC5A 5ISRA 2ICIA 1IBKQ 4BBSB 2JEGA 1N36L 3CPFA 1ONLA 3OW7A 4QCLA 2QKIC 2YU9A 4KN7C 4J9SA 4QW8A 5KFZA 2R8GA 3AU7A 2G5DA 3OWEB 4DU9A 5L1IA 4N9TA 3CCEA 2XVSA 4LFCL 4X65Q 4RZRA 4HCEA 4YWKA 1C8CA 2ZJQA 5F9LA 3A8JE 3V6JA 2JA7G 3MXNB 5EJWA 4ECQA 4DV6H 4HIKA 1PZJD 3QG1A 2NVYA 3C2PA 4BY1G 4LF4L 5C6AA 3TIGA 1O80A 5LYJF 1VQLA 3BA9A 3D4WA 1QB5D 2E5LH 1GSHA 2V4DA 3PW2A 1STGA 1PH3A 2I46A 4CDCC 5FPOA 3S1QH 3CRLC 1W6KA 3PUWA 5KFMA 1A3UA 5E7NA 3L9AX 1E22A 1VQPA 2JA5A 1V1PA 1BR9A 2YL2A 1AN8A 3HXLA 4A3FB 1XNQL 3PIPA 4WD3A 3N42B 2UUCL 2JA7B 3F1ZA 3S9WA 2JYOA 4PV1C 1S5ED 3QR8A 4KKUA 5C5LA 1EQRA 1TWGA 4QY7A 1Q1BA 3BVZA 4K2KA 1SAPA 5AJ3Q 2K04A 4DR2Q 1ILQA 1XNRH 1CS0A 2SNSA 2AKWB 1I4RA 4DV4L 4C5AA 1QE6A 4RGNA 1N32H 4H44C 1WVLA 3U4VA 3D4DA 1GKHA 4IRDA 4CGYB 4KKTA 3OW2A 4EGQA 4R1JA 1VQKA 3ETJA 4IFDG 2ID0A 3I91A 4DUZL 3VYSA 4JI3L 4DNIA 2AHOB 5ELOA 1WTPA 1Y1WA 5LL6S 1ML0D 5G3LD 2PQAA 1IBLQ 1B33N 2XGPA 1OXXK 5IYCG 2WDTA 1SDFA 1GUWA 1Z6HA 4C3JH 4O3PA 4XIGS 2MCTA 2N49A 3BU2A 3S14B 4JI8L 5FJ8G 4DXGA 2G9HD 1DIKA 3X3NA 3ND9A 4LF5L 2ZXOA 4A3DB 2F0WA 2F0FA 5IGDA 2TMPA 1T94A 2CVRA 1L0WA 3TQTA 1ENAA 2JK8A 1EU3A 4C2MB 1Q86C 1C7YA 5IYZF 5JPNC 3GTGA 4KHZA 2MP1A 3RTXA 3EPIA 3JAMW 5KYLA 1JCKB 3J80i 2UXBH 1IKMA 3A55A 1B70B 1V1OA 3T13A 1PHJA 1BGWA 3R93A 3VA5A 4QF4A 5KFNA 3HRZC 1PTOH 1GVPA 4J1MA 2Q8TA 4PZ7A 5KGUA 4U673 3BABA 4DN4M 2E76C 3HOVB 3F2UA 5C3EH 2IT1A 2N55A 4JI4L 3FVQA 4GNXB 1I94H 1K0SA 3DEPA 1FJGH 3RUZA 5IIFA 5FLMH 1E2ZA 2AMCB 1B9MA 3E3XA 2I80A 5FLXL 1EOVA 3DEOA 3T5HA 4YJ3F 1GOZA 2JA7A 5L1KA 1VDZA 3MXPA 4LFBL 4IO9A 2C00A 4F4WA 2B2WA 3GV6A 1WTVA 3GV7B 4RGTA 3NGDA 1T3NA 2O5IC 4BBRG 4C5CA 1CM9A 4C1NI 1YHQA 1M90C 2ASJA 4MV4A 4J9NA 1KQSA 2JE6I 4K8IA 5AFWA 4B3SH 1KABA 2B3GA 4ECZA 3MXGA 5C5JA 1UC9A 3RZDH 4RKBA 3WOFA 3J7A5 3WO0A 2W71A 1N9WA 3DMUA 4GLXA 1TWAA 3BVMA 1STAA 3FMAA 5I4DA 1H95A 3KHGA 4X3KA 4OIKA 2R61A 1C48A 1A3TA 4DNTB 1E24A 2D0PA 1GYFA 1CTMA 3SHLA 3H3VC 4A3GG 3CQZB 3P20A 4P2CB 1YJNA 2VUGA 3GIPA 1A3VA 4DV2Q 2B2UC 4LF6H 1STNA 1K73C 2PMZB 4KJOA 3PW0A 3RN2A 2WAQG 5L37A 4X3SA 3EVQA 3QZ7A 2UXDH 5KT6A 2HVSA 1BOSA 3BAAA 1I4QA 2WKDA 2IHFA 3FP9A 4C2MA 4HNUA 5LMUH 1PFBA 2EYPA 1LTID 3S1RB 2HUGA 2B2VC 2KOLA 3M4YA 2R92H 5DLFA 2J6UA 3M9NB 3EBEA 3C46A 4A3GB 1U4RA 1EIFA 2K28A 3KF8A 2HHHQ 1SYGA 4XX0B 5ELFA 2K50A 1TY0A 1UE7A 4YY3Q 5IGBA 2VQEH 5M5YH 2KHJA 2NN6I 1TXYA 1TKWB 1PA6A 2WAQE 2UU9L 3SR1A 2VUMB 4L6TB 1EYCA 2EJFC 3KHRA 3Q8SB 1YNND 4HMIA 4S3SA 5DG7A 3NE5B 5KG6A 2EY2A 2K01A 1JKJB 4RAZA 3V6HA 1KAWA 2FP4B 1HNZH 4OWXB 1X9NA 2OT2A 3SEBA 1B3AA 2C2EA 4LFAH 1EFWA 5A2QW 4OXPA 5DQIA 3GTKH 3GTQH 1NSNS 3HOYB 4QWAA 2B2YA 4BY7B 3GQCA 3MFGA 2E74C 3L3OC 1Z9FA 4EGJA 4BS9A 2FXQA 4X65H 1S0NA 2RCFA 1TU2B 2HIXA 3OUZA 4WJ4A 2GVBA 1XMQL 2W7OA 3K7AH 4ECRA 1SNOA 1STBA 1VQCA 4UCOA 3T1HQ 2AU0A 1K3BC 3VR5A 4LH7A 1CKNB 4C5BA 4DNRB 4KLKA 2R93B 3QOLA 3WOEA 3GTLH 3MR6A 3GIMA 1JLLB 4IPGA 1DD2A 1KTKA 5IY0A 1F9QA 2SCUB 4MTEA 5IOCA 1PZID 4YR0A 4UY8C 4ECWA 4QWBA 1ZKOA 1RF2D 3A74A 1RCVD 1DM0B 3J80E 4ZI7F 3S1MB 2R7ZB 5IWAL 5D3DA 1NR2A 3STBD 3RV4A 5HGTA 3A7AB 3Q24A 4UFZA 4C3HB 5CBAE 4A3BB 2K52A 3URYA 4B3MQ 5EAYA 5J3BA 1WTQA 4JYAL 2YYAA 4U7CA 5EDWA 3KOJA 1VF5C 4RNOA 4DR2H 3B6YA 1JQYD 4Z9CB 4A2AA 2NVXB 2WAQA 4ODGA 3QOJA 4TSSA 2DPJA 3AB9A 3Q8DA 3MJFA 2JN4A 4B9WA 5JEAH 2EYMA 5D3IB 4EGVA 2F0QA 3CRKC 4MTKA 3MFIA 1N34H 3U4ZA 4B3TL 1T36A 4J6HA 4C3JG 2XWBB 3R5FA 2C28A 1M6VA 1CA6A 3AMUA 1X56A 2DN8A 1IBLH 2HD3A 4PZ6A 3BQ2A 1QJOA 1M4VA 4ZKBB 5EKIA 2VB3X 1H9MA 3N6RA 4IPDA 5JEAJ 1EUCB 3SE7A 3RIZA 1JX4A 4QGUA 3KLWA 1A15A 1EY6A 3KDFB 4MV9A 2IY5B 5IGGA 5KFVA 4O1NA 1Y1VH 2PPBC 2BQ3A 2J6TA 2J9GA 2NU9B 1QILA 2QGQA 1GJXA 3CVZA 4C3JB 3VA7A 1LYLA 4F4YA 1LT3D 1SEBD 1S5BD 4NB3A 3U9SA 4F7XA 4J9RA 2KVMA 2RSOA 3Q22A 5DG9A 1I7LA 1FYCA 1Q90A 2XIWA 5CV8A 5C3EG 2FE3A 3FDSA 1CKNA 3CP0A 1HRJA 4MTNA 4EQPA 2L15A 4M7EA 4YR2A 5EPJA 5FLMG 2EZVA 5IGCA 4L8JA 4UAIA 2TSSA 4C3IH 2PNRC 3BVGA 1F9PA 2JSOA 4MHEA 4JI5L 4RCOA 3RB3A 2AQ1B 4X64L 1EL0A 1JE5A 4DR7H 2R7FA 1ICWA 2W9CB 3OYYA 4JUZA 4IOAA 3CCUA 1IBKL 5C3EB 1DOKA 1CHQD 2KSWA 3N40P 1IZ6A 1DJRD 4LF9H 3BA8A 2LXJA 3RN5A 4FO2A 1VBHA 1KDAA 4L1KA 3EIVA 5D1OB 3I12A 3WNZA 3BJYA 3PQIA 4F8MA 2Q2HA 4DV1H 1E1OA 3JSNA 3T1YL 3G48A 4OX9Q 5KT7A 2R84A 1A2UA 1I3QB 2B63A 1YNXA 1EFID 2QW7A 3CCJA 2LFNA 1AEXA 1EY0A 1HTPA 2A73B 1SROA 4A3MH 1RODA 5EPKA 2LMCB 2J4XA 1BXRA 4O2AF 4G7ZC 4YB8B 4DV2H 5E3FA 3S1NB 4KHPL 4LF7Q 1WTHA 3S24A 2JP1A 4UP9A 3PO2B 2R92G 1K8OA 5E1FA 5KFDA 4JBKA 2W6PA 5EQ0A 2BE5D 4YIJA 1HA6A 3NQTA 4JI0L 1EYGA 2QK4A 4ZUIA 1UNSA 4GKKL 3F2DA 1UAPA 1SNQA 4Q0YA 3JZIA 1PRTB 2Y0SG 2E2HH 3E9IA 3CU7A 1PVOA 1NJIC 1TY2A 2RDGA 1X55A 3N52A 2Z6KA 1PZKD 5H1SE 3BDOA 2AGPA 1D1IA 4X66L 1N56A 2HHHH 3GTJH 3WO1A 3E6ZX 3UDFA 2IW3A 3ORRA 2K14A 3STBC 2L55A 3NQIA 4QL5A 1N32Q 1HZAA 2A19A 4LUZA 3PW7A 5K2MA 4CKCA 3BG3A 2OWOA 5C0XJ 3HOZB 5CV5A 3H6MA 2JA6H 5CV7A 2QILA 4MAMA 1IYVA 5JJLA 2CFMA 4LMQD 3HKZG 2AQ3B 3Q23A 1UE5A 4R9WA 4QJFA 1IL8A 4OEMB 1AZQA 4Y52H 2JJQA 3RR5A 3OIQA 4RAYA 2EYOA 2KCMA 2F4VL 1KJ9A 1WH2A 3PIOA 4HJAA 4A3LH 5KFUA 1ZXTA 2Y0SE 4R4OA 5I47A 2V9WA 4O4LF 5D1OA 4APMA 1FNUA 3M4QA 2CH4W 1I6UA 4J8QA 1NY4A 4P71A 4MA5A 1MJEA 1HFGA 1D5XC 1RKNA 3SK5A 5IGEA 2KEEA 1IXRA 3T16A 4APVA 2D5DA 1O7ZA 3L7ZC 4AQYQ 2A8VA 3GTKB 1TS2A 1SNPA 1SE4A 3P1HA 3KTMA 1LO5D 4DR5L 4DV0L 2N3SA 2E2IH 4GKJL 1LTSD 3HKZE 4I65A 1CK1A 2W9BB 4YWMA 4HJ7A 1RYSA 5IE8A 4KD4A 2W6OA 4MV3A 2KHSA 3UDGA 3UE0A 2UXBQ 1I50H 1SJHD 1HQRD 2H5XA 2OCEA 2F4IA 1LTBD 1Q82C 3MZ5A 4A3KH 2AWOA 2FPIB 2MPMA 3KUPA 4P74A 4GNXC 3EN2A 1MHWC 4UP8A 4FYDA 3K6OA 5JVDF 3OPOA 1AUXA 3DM3A 4H02A 5BR8L 3GTLB 1PH8A 1K83H 4O3NA 4HJ9A 1J5EQ 4HJ8A 3EPGA 3PSIA 4F4XA 2G9DA 3H0GB 1V51A 2FB9A 1EY8A 4RKLA 3ORQA 2UUBH 5JEAG 1KRTA 1JR0D 4WJ3M 3SK6A 2K33A 4LNQA 4EX5A 3K59A 2YRWA 1QWYA 3NPPA 2FKLA 2FFKB 1TR5A 1KEEA 2ZTDA 3PVXA 4IUTA 4MN3A 2R92A 1N48A 2MQHA 2K5HA 2VW9A 3TMEA 3CD6A 2X69A 2J7ZA 4L5TA 2Q2IA 4XT1B 1R9TH 4ALPA 2QDLA 1PXUA 2MO0A 2O4XA 3Q1KA 4ETSA 1YVCA 1RK6A 2O5JC 2Y0SA 1PMRA 2VQFQ 2RDFA 3UE1A 1WTOA 3G71A 1BNZA 3TSSA 4NXML 1QG7A 1Y1VG 2PN1A 2RDIA 1Z47A 3GQBA 2BQRA 2R7MA 1Z2OX 3VDYA 2D9UA 1I5FA 1BBUA 1NUCA 1SBBB 3J81i 2UXDQ 1SXTA 1NTGA 1B1ZA 1U9RA 2JA5B 4K5VA 1V1PB 1RD9D 2R86A 3HKZA 3TP8A 4B3RL 1SEIA 4PNYA 3J7AV 4BA2I 5KFKA 1O75A 3I55A 4WRDA 4JI6L 3ND8A 1EHIA 3RGZA 3GTKA 4C3IG 2NVTH 3GTQA 3HEJA 4FF2A 1STEA 1HNXQ 1TWGB 2CH4A 1Y1VB 1AP0A 4YY3L 4ZHQF 1C4QA 5D1PA 4O4HF 1VQ4A 1EUJA 1CFMA 4HSVA 4PQXA 3ERQA 4YBZB 4DV5Q 5BN5A 1Q46A 2F0TA 3K81C 3U50C 3S2DH 4O3QA 5J2UF 4J9OA 4Q8EA 2ALZA 3ULLA 1W93A 1GM5A 1JOOA 3QJYA 4DR4Q 3RFCA 4RCNA 3V4SA 2DGYA 2H1EA 1EEFD 4J0MA 4P73A 4ULLA 1C9OA 5CR3A 3F2CA 4J9PA 3GTLA 1MI2A 1Y1WB 2OEOA 2E2JH 1KHIA 3EFXD 3ITPA 1MD2D 3A5ZB 2O03A 4GOPC 2RKSA 1JC7A 2NVQH 2F0MA 5EWGA 3Q8QB 1K0RA 1HNZQ 1PFSA 5LL6b 3PUVA 1YNJC 1YI2A 4LFAQ 2A69D 4RHSA 4U68A 4GN4B 3C1FA 4A3MG 2HCIA 1D5MC 4EG0A 1HR0H 5DGBA 3X3MA 4OX9H 5IT9W 2XRSD 1BBXC 4N9PA 2X6GA 3TREA 2PVPA 3T1HL 1BCPF 1OWTA 1H9RA 3GTGB 5LXTF 3SGIA 5BN3A 5KFOA 5KFXA 3MR2A 3MR5A 4JBWA 5C1OA 5M3FB 1KD1C 4BXXH 4GZYC 1D5ZC 1GUSA 1JB7A 3I70A 5FLXc 2AUKA 4LUOA 2DNCA 5I6YA 4L63B 1FGBD 5C4XH 5L1JA 4IUPA 4LF7H 4LW1A 2NU6B 1FNWA 1LTAD 1RTOA 4ED0A 1KNAA 2BDNA 3PZPA 5HGQA 3BYTB 3E0EA 3W1GA 1S03G 3M7GA 1NAPA 3K80C 3MWYW 4F4ZA 4LF8Q 2ZDQA 3PGZA 1FR3A 4B3ML 1ULZA 3U9OA 2YS6A 3J80c 5KNBA 2NTTA 3K57A 2NZHA 3NTKA 5IYBH 3S16H 5FD6A 1BQQT 3G6YA 1Y1VA 2SOBA 5T1GA 3SK4A 5CBEE 4BY1B 5LMNL 3H40A 4DV3L 1X54A 4A3CH 2JA6G 1M0WA 1WTXA 2YS7A 1EQTA 2E8GA 2FHTA 1E0BA 3DWPA 5CORA 2B63H 1EUDB 2VA3A 5CGKA 4GN5A 4NMZA 1IBML 4Q44A 1LTTD 1UWVA 1BDOA 5DNFA 1N34Q 5FD5A 4A3LG 1TWAB 4ZRZA 3NXWA 2A5HA 2M05A 3CMAA 2WB1G 4ZKCB 3A8IE 3D31A 3E5NA 1CKOA 4UDUC 1PV4A 4DL7A 1I6HB 2ALYB 2B39A 3NTHA 1TWHH 4HN7A 2R7NA 1IKLA 3J81W 1A2TA 1RIPA 2IX3A 3R3OA 4R8UA 2YYZA 1QVFA 1XXGA 4JOIC 5M3MH 1MJCA 3BDLA 3MFYA 3J81j 4DR3H 3M85A 4DV7L 2UUAQ 3PUXA 1QZHA 2K7VA 3VR4A 1JT8A 1SYFA 2YZMA 4ECSA 1LUZA 4AQYH 4FP5D 3M3YH 1LTRD 2ZM6L 2OQ0A 2Q8IB 4DL2A 5CC4A 1EIHA 4NKLA 5IGFA 4KKSA 5EKLA 2L12A 3KF8B 4HMJA 4LAAA 4A3KG 2BH2A 2CW8A 4Q8FA 1KDCA 4DAVA 4JI2L 2VZAA 3J81E 2F0SA 3NBHA 4PG3A 3ER0A 2A1AA 2WB1E 2BA1A 2KHIA 4DR1L 1RJTA 1LT5D 2HQLA 2PO4A 4KMUC 2V58A 4LSXA 4NXNQ 1S10A 3R23A 5KT3A 3F8TA 5C44H 2YTXA 1BCPD 4DR7Q 2DY8A 5DLGA 1J5EH 3OMCA 4OWTB 4CJ2C 4L5SA 3BS1A 5DGAA 1U4LA 4UCSA 3CCMA 3JAME 1I50B 4ZQIA 1ZETA 3DLLA 4A3KB 1B44D 4ZQ3A 2XCPA 4PMCA 3JRWA 2L0CA 4LF9Q 4YHHQ 2KQ3A 2CW0C 2OLSA 4O4IF 1BKBA 1TQOA 2E2HA 3H20A 1Y8NB 2XWJB 2XGQA 3VMMA 1QCBD 4DV1Q 3J80L 2HDMA 1HNWQ 2N8NA 1T9HA 1SYDA 4CJ0B 3K3PA 1JWSD 3GTJA 4LSAA 1HCZA 5HY6A 4DV6L 3ZJYC 4L5QA 2VQFH 2K03A 4R4QA 2W8KA 4ECUA 2A69C 4EYHB 1QNKA 2ZXPA 5C5MA 5KFIA 2E5LL 2P5ZX 4Y8VB 4BBRB 2EDGA 3GTMH 1LT6D 1R9TB 3L0OA 1AH9A 2JA6A 5JJKA 3PMFA 1WTWA 2A68C 1WYDA 2R8IA 3H3VH 3OSOA 4DK0A 2BR0A 1E1TA 2HDLA 1D6EC 3KLSA 1TAEA 4OIJA 1M1KC 2XGTA 2RDJA 4EEYA 2Q2UA 4J15A 4HNVA 1SE3A 4RZQA 1UUPA 4QB4A 4X3TA 3OMGA 3TN2A 2FMMA 3KF6A 2IWHA 2X0SA 1WTRA 3DF7A 2NYZD 4I7HA 4IR9A 4RFBA 1SLJA 3MHBA 2WB1A 5F2DA 4Q43A 3I4MH 1PRTC 4RB1A 2VL6A 4U6PA 1HNXH 3RLFA 5GAHC 1XNRL 4TUYF 2W6QA 1DZ1A 1N32L 1XTCD 3CC2A 4OO1H 3DUZA 1N33Q 3MEFA 4DV5H 2WAQB 4BWGB 3S2HH 1WJJA 1X65A 4CBVA 5M5WH 1SYBA 1VQGA 2DPIA 3MWEA 4IR1A 4JI7H 2B2TA 2EYFA 2YCHA 4DR4H 4Q5VA 2Z9HA 2EY1A 4DR6Q 3K5OA 1I7NA 1ZHQA 3TIIA 1SFOH 2E2IA 5CYUA 1GD7A 3RNUA 1B9NA 1MBYA 1L2FA 1EYAA 2UVUA 3I4OA 3ERSX 3JC66 4K0KQ 1GSAA 2ZJTA 1PH4A 1S3OA 1WCMH 1I50A 4IN3A 5KNDA 1A8VA 1WD0A 3UFXB 1WI5A 1M8AA 1A6XA 2R6FA 2W7PA 3RBDA 3PW4A 2JEIA 1UEBA 2F0JA 3VR2A 1VQEA 1X3QA 1CI3M 1L1OA 4ZCKA 4XXEA 1XYIA 5JPMC 1K83A 4XYOA 4PDBA 1X32A 2ES2A 5I6WA 3QIAA 3LX0A 4ECVA 3RAQA 2GPWA 3CHBD 1HR0W 4BXXG 4ED7A 2F0LA 1JDBB 4A3JH 1MIUA 4RA8A 2NVQB 5C4XG 2WYOA 2QDBA 4KD3A 1E4FT 4A3IH 4YCVA 1KIXA 4KI0A 1TT2A 2ZXRA 2NB0A 1XDNA 1B3QA 3D6CA 2DUDA 4O2BF 4EFEA 5CV6A 4MV1A 1TA8A 2XN9C 2UXBL 2I8CA 3OSPA 1R9TA 1FD7D 4EVOA 2GA4B 3GD7A 1PFNA 1I94L 3J7ZC 5A2QE 1VMPA 1FJGL 2XCAA 5CMDA 2DJGC 2GLTA 2ASLA 1OXTA 1F77A 5IYBG 4LF8H 3OIPA 4EBCA 1P8LA 5KFTA 2EXZA 3KJPA 2JEAI 5C4XB 4NDXA 3R2TA 3LWEA 5KT4A 1PK8A 4E4TA 4A3CG 3G6JB 1F2ZA 2ATWA 4L5RC 2B63G 4EBDA 2OQKA 2PW7A 5KEEA 1X3PA 4DUYL 1EZ8A 4J9LA 4LFCQ 3T53B 1PH5A 3NK9A 3S1QB 2K05A 3TZUA 1KLGD 1KJIA 2WE6A 2UUBQ 2M00A 3HOWH 4B3SL 4G57A 2Q8RE 5LL6X 1W96A 1JJ2A 1BCPC 2D62A 3HOUH 2UXCH 1IOWA 2R82A 1PYSB 1R4PB 4LF4Q 2NTSA 2C22A 2CQAA 1IYUA 2KBNA 1U4MA 3V96A 3KK7A 1K28A 1BXTA 3PUZA 3LMLA 2AWNA 3H15A 2IP4A 2B63B 4JV5H 5FO9B 3F8NA 2A6EC 3ONAB 1HH2P 1XNQQ 2EJGC 4UCVA 3PO3H 4LF6L 3V05A 3JSLA 2UUCQ 4YCWA 3G8CA 2F0UA 5M3MG 3Q0AA 2WIIB 5M5XH 3RZOH 2UXDL 3HG9A 2VQDA 1Y8OB 3VPCA 5J22A 5J39A 4P72A 5BPHA 3LWBA 5C1PA 5BN4A 4CJ1B 4DGZA 5LMUL 1A63A 5KG7A 4DV4Q 2X6LA 1BJTA 1Q7YC 4RMFA 2UUAH 4RNNA 1GHKA 2R6GA 1LABA 3G4SA 5I2XA 4R8IA 3QZ8A 2F0GA 3Q8RB 1E2WA 2PCFB 3QWNA 1J9OA 2OXPA 3HB9A 5T1IA 1VS0A 4IRCA 2R8KA 4JI3Q 4RUAA 5KFLA 2K5QA 2F52A
chains in the Genus database with same CATH topology
3HKZE 5C44G 4BA1I 2VQEL 3BZKA 4YWMA 4HJ7A 3KYHC 4NXMQ 5IE8A 1XMOQ 4HIOA 1PH3A 1G6PA 3UDGA 3M4OH 3UE0A 1XTDA 1I50H 1E3PA 3S1QH 2UXBQ 3PUWA 5IP7H 1GO3E 2I5MX 1QUQB 2H5XA 2OCEA 3CW2C 1DGSA 1E22A 5E7NA 2AWOA 4JI8Q 4A3KH 1VQPA 4GNXC 4P74A 3EN2A 2QEXA 4UP8A 2PMZE 3HOXH 4LF5Q 4JBMA 1YJWA 1XNQL 1SN8A 3DM3A 4H02A 3PIPA 2VUMG 5BR8L 1PH8A 1TWFH 1Q1EA 1K83H 4HJ9A 1J5EQ 3F1ZA 4HJ8A 1K3RA 2UUCL 4BY1G 1PH1A 3PSIA 1S72A 3HOZH 2K75A 1EQRA 1HNZL 3PF4A 5JEAG 4B3RQ 4QY7A 1KRTA 4LFAL 1VCIA 2HT1A 4JI6Q 4A3EH 4WJ3M 1Q1BA 5AJ3Q 2N78A 4EX5A 3PF5A 4LNQA 4DR2Q 3U58A 2JA8H 2AKWB 4DV4L 2ZTDA 1CSPA 3I4NH 4AH6A 3U4VA 4DR3L 4GLVB 2MQHA 2K5HA 2RHSB 2VW9A 4GNXA 3CD6A 1GKHA 3HFZB 1JJCB 3HOYG 4X65L 4BY7G 4L5TA 2Q2IA 3OW2A 1R9TH 4AQYL 4ALPA 4R1JA 1VQKA 2MO0A 1HR0Q 4JI4Q 1RL2A 5IP9G 4IFDG 2ID0A 1YVCA 4JI1Q 4DUZL 4JI3L 4DNIA 2AHOB 5ELOA 2VQFQ 2NN6G 3UE1A 4DPGA 4GOPB 2PQAA 1VQDA 2HIVA 3G71A 1IBLQ 1X3EA 1OXXK 4DK3C 4NXML 5IYCG 1Y1VG 4LFBQ 4C3JH 4XIGS 1Z47A 2N49A 3BU2A 4O2DA 2R93G 3NEMA 4JI8L 5FJ8G 3VDYA 1I5FA 2GVAA 1BBWA 2WFWA 1BBUA 4LF5L 1EQQA 3I4MG 3J81i 4A75A 1EWIA 2UXDQ 1L0WA 1NTGA 2JK8A 2IHEA 1N36Q 1Q86C 4HIMA 1J5EL 1C7YA 4KHZA 2R7ZG 4OO1G 4A4IA 4B3RL 4BA2I 1X3FA 3I55A 2IX0A 1HZ9A 4JI6L 2K5NA 5AJ3L 1IYJB 2NVTH 4DR2L 4A3BG 3J80i 1HNXQ 1SRUA 4POFA 2BH8A 1B70B 4YY3L 3S17H 4A3FH 1VQ4A 1EUJA 3D0FA 1V9PA 1PH7A 1PHJA 2YV5A 3NENA 1GVPA 4DV5Q 4PZ7A 1Q46A 1UE6A 1VQFA 3H0GH 3K81C 5ELNA 3U50C 1N34L 3S2DH 4GKJL 5C3EH 2IT1A 4JI4L 3ULLA 4GNXB 3CC7A 1QUQA 1CUKA 1WCMG 4GS3A 1GM5A 4DR4Q 2DGYA 2OTJA 2D0OA 5FLMH 2AMCB 2VQFL 4EQ5A 4P73A 3F2CA 1C9OA 1IBLL 5GAGC 1EOVA 2YTYA 2K5VA 2YU9H 4LFBL 4IO9A 5IYDH 2E2JH 1KHIA 1K8GA 1YJ9A 3A5ZB 3BJUA 4BBRG 4GOPC 2GN5A 1YHQA 1M90C 2B29A 3ULJA 2NVQH 4A3JG 1KQSA 1K0RA 2JE6I 1B7YB 3W5OA 1PFSA 1HNZQ 4A3IG 3PUVA 1YI2A 5LMNQ 2B3GA 4LFAQ 4DV3Q 1KL9A 3BZCA 3RZDH 3S15H 4GN4B 2NVYH 3TS2A 4A3MG 3J7A5 4A93G 4AIMA 1N9WA 3TREA 3S14H 4R4CA 4GLXA 3T1HL 4DR3Q 3M4PA 1IBMQ 1H95A 2R7DA 3SGIA 1HNXL 1U5KA 4JBWA 4A3DH 1KD1C 2UU9Q 4GOPA 1E24A 2D0PA 4BXXH 1WOCA 2Q2TA 2JA5H 5C4JH 1JB7A 5FLXc 4A3GG 1X6OA 4LUOA 4DUZQ 4DV5L 5C4XH 1VQBA 1OXUA 1YJNA 4DV2Q 4LW1A 1K73C 4JI7L 1VQOA 3J81c 3RN2A 2MFIA 2WAQG 3I2ZA 4DR4L 1HJPA 5HGQA 2ZJRA 3CMEA 4DR7L 2JQOA 1TWGH 3E0EA 3W1GA 3K80C 4LF8Q 2PI2E 4FDBA 1ASZA 2IHFA 3FKIG 3FP9A 4MNOA 3A0JA 3HOWG 3PGZA 4B3ML 2YTVA 2VY3A 3J80c 4Y7NH 1HZCA 3HOVH 3HOUG 4DV7Q 2R92H 2NZHA 3S16H 5IYBH 4LF9L 3EBEA 3JAMc 2QA4A 1XMQQ 1D7QA 1EIFA 2EIFA 5LMNL 2ZM6Q 1X54A 4DV3L 2HHHQ 4A3CH 2JA6G 2E8GA 2B63H 2K50A 1Y1WH 1VQ7A 4DV1L 1UE7A 1YEZA 4YY3Q 4JI2Q 3F2BA 5M5YH 4GN5A 1IBML 2KHJA 3H3VI 2NN6I 1TXYA 4DR1Q 5K36G 3PO3G 1UWVA 1OXSC 3W1BA 1PA6A 2WAQE 1N34Q 2UU9L 4A3LG 4BBSH 3CAMA 4O0AA 3CMAA 2WB1G 4DV2L 3D31A 5IWAQ 1CKOA 3AYHB 1PV4A 3TQYA 4HJ5A 2ALYB 1TWHH 1KAWA 3GTGH 4OWXB 1K9MC 4AYBG 1X9NA 1RIPA 1VQHA 1EFWA 4OXPA 2YYZA 2KCTA 4LF8L 5M3FH 1QVFA 3PO2G 4OO1I 3GTKH 4ME3A 3IRBA 4DAMA 1YIJA 3GTQH 3CQZH 3A5UA 4JOIC 5M3MH 1MJCA 3J81j 3M85A 4DV7L 1Z9FA 1Q81C 2UUAQ 3PUXA 1QZHA 1HZBA 1VQAA 2FXQA 1JT8A 2HIXA 1V43A 5IT9c 4WJ4A 2GVBA 1XMQL 1LUZA 3AQQA 2VS1A 3K7AH 3M3YH 1VQ6A 2ZM6L 2OQ0A 2HHHL 4B3TQ 1VQCA 3T1HQ 4DV6Q 2UXCL 4NPSA 5IP7G 1VQ9A 2MO1A 1A0IA 1UE1A 5IYDG 2ZJPA 1PYBA 1CKNB 3KF8B 3RLOA 3CCVA 2PI2A 4A3KG 2BH2A 3HOXG 2VZAA 4JI2L 4KLKA 4PG3A 4A76A 3S1RH 1KC8C 3ER0A 2A1AA 2WB1E 2E5LQ 3GTLH 2BA1A 2KHIA 3I56A 4DR1L 2JA7H 2HQLA 4IPGA 3KDFA 4JOIA 3ULPA 4NXNQ 5IY0A 3HOZG 4BY1H 4JI7Q 3F8TA 1YITA 4AYBE 4JV5L 4UY8C 5C44H 2YTXA 4DR7Q 4A3EG 3A74A 5IWAL 4JG2A 3WWVA 4OWTB 2JA8G 4L5SA 1G291 3STBD 3CC4A 1VQNA 3PV0A 4LWCA 3RLNA 3CCMA 3I4NG 1TWCH 2K52A 4B3MQ 1XPUA 5EAYA 2I5HA 5J3BA 1XJVA 3DLLA 4YWLA 2IX1A 3KOJA 4JYAL 2ASBA 3AFPA 1TWAH 2VUMH 3B6YA 4LF9Q 4YHHQ 1XNRQ 5JJIA 1BKBA 1AE3A 4QIWE 3Q8DA 1A62A 1NMGA 2E2IH 3L2PA 2UUAL 1ASYA 1I6HH 1FGUA 3CCQA 1Q12A 1K8AC 1NMFA 4DV1Q 1HNWQ 4DKAC 3K8AA 3U4ZA 4R4IA 2N8NA 1T9HA 4JI5Q 4B3TL 5HY6A 4DV6L 3AFQA 4OONA 3ZJYC 4L5QA 4TVAB 1NBWA 4JC0A 4R4QA 3HOYH 1VQIA 1WFQA 1X56A 4BY7H 1N8RC 2E5LL 4PZ6A 4C2MH 3GTMH 1JMCA 3L0OA 3E9HA 5IP9H 1AH9A 1LM0A 5JJKA 3CXCA 4NXNL 4IPDA 1Y14B 1V1QA 5JEAJ 2I0QA 2V1CC 1WYDA 3NBHB 1VQJA 4HIDA 4QGUA 2BA0A 3KLWA 4GLAC 3H3VH 3M7NA 1E1TA 2CCZA 5C0XG 1OTCA 3NELA 3TEHB 3KDFB 2XGTA 1M1KC 4POGA 2Q2UA 2KENA 4R4TA 2IY5B 4J15A 1Y1VH 2ZTCA 5IYCH 3K7UC 2R93H 2QGQA 5FJ8H 2XTIA 3KF6A 1LYLA 4A3FG 4NB3A 3GDEA 4XTCS 3T1YQ 2UUBL 1KXLA 1SLJA 3I4MH 4IFDJ 2VL6A 3H0GG 1VQMA 3RLFA 4MZ9A 5GAHC 5C3EG 4YHHL 1XNRL 1G51A 1QVCA 4PZ8A 1CKNA 3CP0A 1N32L 2ZTEA 4MTNA 3CC2A 2R7ZH 3S1MH 2L15A 3PUYA 1N33Q 3PCOB 5FLMG 3MEFA 2UXCQ 1XPOA 1P16A 1HNWL 3S2HH 1WJJA 1X65A 4C3IH 4C3HH 1VQGA 5M5WH 4A3BH 1Q82C 4IFDI 4KHPQ 1L1OC 4JI5L 3UDXA 2LSSA 1O7IA 1I94Q 3M9BA 4X64L 1S40A 2C35B 1D8LA 1JE5A 1FJGQ 4DR6Q 1SFOH 3CCSA 2R7FA 1JJGA 1GD7A 3CPWA 3RNUA 2NVXH 1L2FA 3OYYA 4JBJA 1YHAA 3I4OA 3ERSX 3JC66 4JI0Q 4IOAA 4YCUA 4K0KQ 4JV5Q 3CCUA 1PH4A 1XPRA 1QZGA 4GKKQ 1S3OA 1IBKL 1WCMH 1NE3A 3HKSA 4GN3B 2MNAA 1A8VA 2CQOA 5GAEC 1IZ6A 1KRSA 1WI5A 1VQ5A 4OWWB 2EXDA 4P75A 4DUYQ 2LXJA 1UEBA 4X62L 3G6EA 4IOCA 3RN5A 2OTLA 1PH9A 4RG1A 3EIVA 2RCNA 1VQEA 3ICEA 1VQ8A 1L1OA 4JYAQ 4TQUS 1CKMA 4X66Q 4B3SQ 2VNUD 4IJLA 3OTOL 2ES2A 2Q2HA 4A3DG 1E1OA 3FHWA 4BBRH 3I7FA 3T1YL 1HR0W 3G48A 4BXXG 3K0XA 2JA5G 4IJHA 4A3JH 1PH2A 4OX9Q 1MIUA 5C4XG 2JA9A 2JEBI 5GQOA 4A3IH 3KF6B 4YCVA 2Z0SA 1BVSA 1YNXA 1KIXA 2EQSA 3CCJA 4KI0A 4LF4L 1SROA 4A3MH 1B8AA 1N33L 4A93H 2PNHA 1XMOL 2DUDA 3KFUA 2UXBL 2Z6KC 3CCRA 3TS0A 3KJOA 4LF6Q 4KHPL 4LF7Q 3GD7A 3CCLA 4LUVA 3S24A 1W3SA 3J7ZC 1I94L 2F4VQ 4DR6L 4UP9A 1FJGL 3HOVG 3UDIA 2R92G 3GTPH 1OXTA 4A3GH 4JCVE 5IYBG 1MKHA 4JBKA 2LXKA 1P8LA 4UP7A 1LTLA 3KJPA 4JI0L 4K0KL 1EYGA 2JEAI 4GKKL 1X3GA 3F2DA 5LMUQ 4A3CG 1EIYB 1J6QA 3CF5A 2Y0SG 2E2HH 3E9IA 4L5RC 2ATWA 1Y1WG 2OQKA 2B63G 1C0AA 1PVOA 4DUYL 1NJIC 1SMXA 3LGJA 1PH5A 1X55A 4LFCQ 2Z6KA 3FKIH 2RF4A 5H1SE 2UUBQ 4X66L 3HOWH 1IL2A 4B3SL 3JAMi 2RHQB 3GTJH 1PH6A 1JJ2A 2D62A 3HOUH 1YZ6A 3UDFA 4DR5Q 1PYSB 4DV0Q 4PMWA 4LF4Q 4BBSG 4UPAA 1L1OB 2K14A 4GKJQ 3STBC 4QL5A 1HR0L 4OX9L 1N32Q 1HZAA 2A19A 4LUZA 3TRZA 4DK6C 2KBNA 2VQEQ 1Q8KA 2OWOA 4JI1L 5C0XJ 2CWAA 3PUZA 2K4KA 2JA6H 2WP8J 2AWNA 1CSQA 5GROA 1FL0A 1U0LA 3H15A 4X6AH 5GADC 5JJLA 2CFMA 3HKZG 4X64Q 1UE5A 4QJFA 5M3FG 2PQAB 1HH2P 1XNQQ 4Y52H 2JJQA 3GO5A 3RR5A 1E7ZA 5BR8Q 5C0XI 4LF7L 4LF6L 3PO3H 4QQBX 2UUCQ 2KCMA 4YCWA 2CKZB 1AE2A 5DLQE 1W2BA 5M3MG 2F4VL 1YHBA 3PIOA 4HJAA 3GTOH 4A3LH 1I3QH 2Y0SE 4R4OA 5M5XH 5LMNW 1IBKQ 3RZOH 3AEVA 4IPHA 2UXDL 1N36L 1QVGA 4P72A 3CPFA 1SR3A 2F3IA 3M4QA 4X62Q 1FVIA 5LMUL 1A63A 4DV4Q 4DAYB 1NY4A 1OXVA 1Q7YC 4P71A 4RMFA 3S1NH 1MJEA 3OTOQ 2R6GA 3CCEA 1IXRA 4LFCL 4APVA 4X65Q 3G4SA 3PO2H 4YWKA 2CWPA 3L7ZC 4AQYQ 2ZJQA 2A8VA 2JA7G 3MXNB 2I5LX 4HIKA 2NZOA 1YBYA 4IPCA 1VS0A 4DR5L 4JI3Q 1SE8A 4DV0L 2F52A 2N3SA 1VQLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HKZ E;  5C44 G;  4BA1 I;  2VQE L;  3BZK A;  4YWM A;  4HJ7 A;  3KYH C;  4NXM Q;  5IE8 A;  1XMO Q;  4HIO A;  1PH3 A;  1G6P A;  3UDG A;  3M4O H;  3UE0 A;  1XTD A;  1I50 H;  1E3P A;  3S1Q H;  2UXB Q;  3PUW A;  5IP7 H;  1GO3 E;  2I5M X;  1QUQ B;  2H5X A;  2OCE A;  3CW2 C;  1DGS A;  1E22 A;  5E7N A;  2AWO A;  4JI8 Q;  4A3K H;  1VQP A;  4GNX C;  4P74 A;  3EN2 A;  2QEX A;  4UP8 A;  2PMZ E;  3HOX H;  4LF5 Q;  4JBM A;  1YJW A;  1XNQ L;  1SN8 A;  3DM3 A;  4H02 A;  3PIP A;  2VUM G;  5BR8 L;  1PH8 A;  1TWF H;  1Q1E A;  1K83 H;  4HJ9 A;  1J5E Q;  3F1Z A;  4HJ8 A;  1K3R A;  2UUC L;  4BY1 G;  1PH1 A;  3PSI A;  1S72 A;  3HOZ H;  2K75 A;  1EQR A;  1HNZ L;  3PF4 A;  5JEA G;  4B3R Q;  4QY7 A;  1KRT A;  4LFA L;  1VCI A;  2HT1 A;  4JI6 Q;  4A3E H;  4WJ3 M;  1Q1B A;  5AJ3 Q;  2N78 A;  4EX5 A;  3PF5 A;  4LNQ A;  4DR2 Q;  3U58 A;  2JA8 H;  2AKW B;  4DV4 L;  2ZTD A;  1CSP A;  3I4N H;  4AH6 A;  3U4V A;  4DR3 L;  4GLV B;  2MQH A;  2K5H A;  2RHS B;  2VW9 A;  4GNX A;  3CD6 A;  1GKH A;  3HFZ B;  1JJC B;  3HOY G;  4X65 L;  4BY7 G;  4L5T A;  2Q2I A;  3OW2 A;  1R9T H;  4AQY L;  4ALP A;  4R1J A;  1VQK A;  2MO0 A;  1HR0 Q;  4JI4 Q;  1RL2 A;  5IP9 G;  4IFD G;  2ID0 A;  1YVC A;  4JI1 Q;  4DUZ L;  4JI3 L;  4DNI A;  2AHO B;  5ELO A;  2VQF Q;  2NN6 G;  3UE1 A;  4DPG A;  4GOP B;  2PQA A;  1VQD A;  2HIV A;  3G71 A;  1IBL Q;  1X3E A;  1OXX K;  4DK3 C;  4NXM L;  5IYC G;  1Y1V G;  4LFB Q;  4C3J H;  4XIG S;  1Z47 A;  2N49 A;  3BU2 A;  4O2D A;  2R93 G;  3NEM A;  4JI8 L;  5FJ8 G;  3VDY A;  1I5F A;  2GVA A;  1BBW A;  2WFW A;  1BBU A;  4LF5 L;  1EQQ A;  3I4M G;  3J81 i;  4A75 A;  1EWI A;  2UXD Q;  1L0W A;  1NTG A;  2JK8 A;  2IHE A;  1N36 Q;  1Q86 C;  4HIM A;  1J5E L;  1C7Y A;  4KHZ A;  2R7Z G;  4OO1 G;  4A4I A;  4B3R L;  4BA2 I;  1X3F A;  3I55 A;  2IX0 A;  1HZ9 A;  4JI6 L;  2K5N A;  5AJ3 L;  1IYJ B;  2NVT H;  4DR2 L;  4A3B G;  3J80 i;  1HNX Q;  1SRU A;  4POF A;  2BH8 A;  1B70 B;  4YY3 L;  3S17 H;  4A3F H;  1VQ4 A;  1EUJ A;  3D0F A;  1V9P A;  1PH7 A;  1PHJ A;  2YV5 A;  3NEN A;  1GVP A;  4DV5 Q;  4PZ7 A;  1Q46 A;  1UE6 A;  1VQF A;  3H0G H;  3K81 C;  5ELN A;  3U50 C;  1N34 L;  3S2D H;  4GKJ L;  5C3E H;  2IT1 A;  4JI4 L;  3ULL A;  4GNX B;  3CC7 A;  1QUQ A;  1CUK A;  1WCM G;  4GS3 A;  1GM5 A;  4DR4 Q;  2DGY A;  2OTJ A;  2D0O A;  5FLM H;  2AMC B;  2VQF L;  4EQ5 A;  4P73 A;  3F2C A;  1C9O A;  1IBL L;  5GAG C;  1EOV A;  2YTY A;  2K5V A;  2YU9 H;  4LFB L;  4IO9 A;  5IYD H;  2E2J H;  1KHI A;  1K8G A;  1YJ9 A;  3A5Z B;  3BJU A;  4BBR G;  4GOP C;  2GN5 A;  1YHQ A;  1M90 C;  2B29 A;  3ULJ A;  2NVQ H;  4A3J G;  1KQS A;  1K0R A;  2JE6 I;  1B7Y B;  3W5O A;  1PFS A;  1HNZ Q;  4A3I G;  3PUV A;  1YI2 A;  5LMN Q;  2B3G A;  4LFA Q;  4DV3 Q;  1KL9 A;  3BZC A;  3RZD H;  3S15 H;  4GN4 B;  2NVY H;  3TS2 A;  4A3M G;  3J7A 5;  4A93 G;  4AIM A;  1N9W A;  3TRE A;  3S14 H;  4R4C A;  4GLX A;  3T1H L;  4DR3 Q;  3M4P A;  1IBM Q;  1H95 A;  2R7D A;  3SGI A;  1HNX L;  1U5K A;  4JBW A;  4A3D H;  1KD1 C;  2UU9 Q;  4GOP A;  1E24 A;  2D0P A;  4BXX H;  1WOC A;  2Q2T A;  2JA5 H;  5C4J H;  1JB7 A;  5FLX c;  4A3G G;  1X6O A;  4LUO A;  4DUZ Q;  4DV5 L;  5C4X H;  1VQB A;  1OXU A;  1YJN A;  4DV2 Q;  4LW1 A;  1K73 C;  4JI7 L;  1VQO A;  3J81 c;  3RN2 A;  2MFI A;  2WAQ G;  3I2Z A;  4DR4 L;  1HJP A;  5HGQ A;  2ZJR A;  3CME A;  4DR7 L;  2JQO A;  1TWG H;  3E0E A;  3W1G A;  3K80 C;  4LF8 Q;  2PI2 E;  4FDB A;  1ASZ A;  2IHF A;  3FKI G;  3FP9 A;  4MNO A;  3A0J A;  3HOW G;  3PGZ A;  4B3M L;  2YTV A;  2VY3 A;  3J80 c;  4Y7N H;  1HZC A;  3HOV H;  3HOU G;  4DV7 Q;  2R92 H;  2NZH A;  3S16 H;  5IYB H;  4LF9 L;  3EBE A;  3JAM c;  2QA4 A;  1XMQ Q;  1D7Q A;  1EIF A;  2EIF A;  5LMN L;  2ZM6 Q;  1X54 A;  4DV3 L;  2HHH Q;  4A3C H;  2JA6 G;  2E8G A;  2B63 H;  2K50 A;  1Y1W H;  1VQ7 A;  4DV1 L;  1UE7 A;  1YEZ A;  4YY3 Q;  4JI2 Q;  3F2B A;  5M5Y H;  4GN5 A;  1IBM L;  2KHJ A;  3H3V I;  2NN6 I;  1TXY A;  4DR1 Q;  5K36 G;  3PO3 G;  1UWV A;  1OXS C;  3W1B A;  1PA6 A;  2WAQ E;  1N34 Q;  2UU9 L;  4A3L G;  4BBS H;  3CAM A;  4O0A A;  3CMA A;  2WB1 G;  4DV2 L;  3D31 A;  5IWA Q;  1CKO A;  3AYH B;  1PV4 A;  3TQY A;  4HJ5 A;  2ALY B;  1TWH H;  1KAW A;  3GTG H;  4OWX B;  1K9M C;  4AYB G;  1X9N A;  1RIP A;  1VQH A;  1EFW A;  4OXP A;  2YYZ A;  2KCT A;  4LF8 L;  5M3F H;  1QVF A;  3PO2 G;  4OO1 I;  3GTK H;  4ME3 A;  3IRB A;  4DAM A;  1YIJ A;  3GTQ H;  3CQZ H;  3A5U A;  4JOI C;  5M3M H;  1MJC A;  3J81 j;  3M85 A;  4DV7 L;  1Z9F A;  1Q81 C;  2UUA Q;  3PUX A;  1QZH A;  1HZB A;  1VQA A;  2FXQ A;  1JT8 A;  2HIX A;  1V43 A;  5IT9 c;  4WJ4 A;  2GVB A;  1XMQ L;  1LUZ A;  3AQQ A;  2VS1 A;  3K7A H;  3M3Y H;  1VQ6 A;  2ZM6 L;  2OQ0 A;  2HHH L;  4B3T Q;  1VQC A;  3T1H Q;  4DV6 Q;  2UXC L;  4NPS A;  5IP7 G;  1VQ9 A;  2MO1 A;  1A0I A;  1UE1 A;  5IYD G;  2ZJP A;  1PYB A;  1CKN B;  3KF8 B;  3RLO A;  3CCV A;  2PI2 A;  4A3K G;  2BH2 A;  3HOX G;  2VZA A;  4JI2 L;  4KLK A;  4PG3 A;  4A76 A;  3S1R H;  1KC8 C;  3ER0 A;  2A1A A;  2WB1 E;  2E5L Q;  3GTL H;  2BA1 A;  2KHI A;  3I56 A;  4DR1 L;  2JA7 H;  2HQL A;  4IPG A;  3KDF A;  4JOI A;  3ULP A;  4NXN Q;  5IY0 A;  3HOZ G;  4BY1 H;  4JI7 Q;  3F8T A;  1YIT A;  4AYB E;  4JV5 L;  4UY8 C;  5C44 H;  2YTX A;  4DR7 Q;  4A3E G;  3A74 A;  5IWA L;  4JG2 A;  3WWV A;  4OWT B;  2JA8 G;  4L5S A;  1G29 1;  3STB D;  3CC4 A;  1VQN A;  3PV0 A;  4LWC A;  3RLN A;  3CCM A;  3I4N G;  1TWC H;  2K52 A;  4B3M Q;  1XPU A;  5EAY A;  2I5H A;  5J3B A;  1XJV A;  3DLL A;  4YWL A;  2IX1 A;  3KOJ A;  4JYA L;  2ASB A;  3AFP A;  1TWA H;  2VUM H;  3B6Y A;  4LF9 Q;  4YHH Q;  1XNR Q;  5JJI A;  1BKB A;  1AE3 A;  4QIW E;  3Q8D A;  1A62 A;  1NMG A;  2E2I H;  3L2P A;  2UUA L;  1ASY A;  1I6H H;  1FGU A;  3CCQ A;  1Q12 A;  1K8A C;  1NMF A;  4DV1 Q;  1HNW Q;  4DKA C;  3K8A A;  3U4Z A;  4R4I A;  2N8N A;  1T9H A;  4JI5 Q;  4B3T L;  5HY6 A;  4DV6 L;  3AFQ A;  4OON A;  3ZJY C;  4L5Q A;  4TVA B;  1NBW A;  4JC0 A;  4R4Q A;  3HOY H;  1VQI A;  1WFQ A;  1X56 A;  4BY7 H;  1N8R C;  2E5L L;  4PZ6 A;  4C2M H;  3GTM H;  1JMC A;  3L0O A;  3E9H A;  5IP9 H;  1AH9 A;  1LM0 A;  5JJK A;  3CXC A;  4NXN L;  4IPD A;  1Y14 B;  1V1Q A;  5JEA J;  2I0Q A;  2V1C C;  1WYD A;  3NBH B;  1VQJ A;  4HID A;  4QGU A;  2BA0 A;  3KLW A;  4GLA C;  3H3V H;  3M7N A;  1E1T A;  2CCZ A;  5C0X G;  1OTC A;  3NEL A;  3TEH B;  3KDF B;  2XGT A;  1M1K C;  4POG A;  2Q2U A;  2KEN A;  4R4T A;  2IY5 B;  4J15 A;  1Y1V H;  2ZTC A;  5IYC H;  3K7U C;  2R93 H;  2QGQ A;  5FJ8 H;  2XTI A;  3KF6 A;  1LYL A;  4A3F G;  4NB3 A;  3GDE A;  4XTC S;  3T1Y Q;  2UUB L;  1KXL A;  1SLJ A;  3I4M H;  4IFD J;  2VL6 A;  3H0G G;  1VQM A;  3RLF A;  4MZ9 A;  5GAH C;  5C3E G;  4YHH L;  1XNR L;  1G51 A;  1QVC A;  4PZ8 A;  1CKN A;  3CP0 A;  1N32 L;  2ZTE A;  4MTN A;  3CC2 A;  2R7Z H;  3S1M H;  2L15 A;  3PUY A;  1N33 Q;  3PCO B;  5FLM G;  3MEF A;  2UXC Q;  1XPO A;  1P16 A;  1HNW L;  3S2H H;  1WJJ A;  1X65 A;  4C3I H;  4C3H H;  1VQG A;  5M5W H;  4A3B H;  1Q82 C;  4IFD I;  4KHP Q;  1L1O C;  4JI5 L;  3UDX A;  2LSS A;  1O7I A;  1I94 Q;  3M9B A;  4X64 L;  1S40 A;  2C35 B;  1D8L A;  1JE5 A;  1FJG Q;  4DR6 Q;  1SFO H;  3CCS A;  2R7F A;  1JJG A;  1GD7 A;  3CPW A;  3RNU A;  2NVX H;  1L2F A;  3OYY A;  4JBJ A;  1YHA A;  3I4O A;  3ERS X;  3JC6 6;  4JI0 Q;  4IOA A;  4YCU A;  4K0K Q;  4JV5 Q;  3CCU A;  1PH4 A;  1XPR A;  1QZG A;  4GKK Q;  1S3O A;  1IBK L;  1WCM H;  1NE3 A;  3HKS A;  4GN3 B;  2MNA A;  1A8V A;  2CQO A;  5GAE C;  1IZ6 A;  1KRS A;  1WI5 A;  1VQ5 A;  4OWW B;  2EXD A;  4P75 A;  4DUY Q;  2LXJ A;  1UEB A;  4X62 L;  3G6E A;  4IOC A;  3RN5 A;  2OTL A;  1PH9 A;  4RG1 A;  3EIV A;  2RCN A;  1VQE A;  3ICE A;  1VQ8 A;  1L1O A;  4JYA Q;  4TQU S;  1CKM A;  4X66 Q;  4B3S Q;  2VNU D;  4IJL A;  3OTO L;  2ES2 A;  2Q2H A;  4A3D G;  1E1O A;  3FHW A;  4BBR H;  3I7F A;  3T1Y L;  1HR0 W;  3G48 A;  4BXX G;  3K0X A;  2JA5 G;  4IJH A;  4A3J H;  1PH2 A;  4OX9 Q;  1MIU A;  5C4X G;  2JA9 A;  2JEB I;  5GQO A;  4A3I H;  3KF6 B;  4YCV A;  2Z0S A;  1BVS A;  1YNX A;  1KIX A;  2EQS A;  3CCJ A;  4KI0 A;  4LF4 L;  1SRO A;  4A3M H;  1B8A A;  1N33 L;  4A93 H;  2PNH A;  1XMO L;  2DUD A;  3KFU A;  2UXB L;  2Z6K C;  3CCR A;  3TS0 A;  3KJO A;  4LF6 Q;  4KHP L;  4LF7 Q;  3GD7 A;  3CCL A;  4LUV A;  3S24 A;  1W3S A;  3J7Z C;  1I94 L;  2F4V Q;  4DR6 L;  4UP9 A;  1FJG L;  3HOV G;  3UDI A;  2R92 G;  3GTP H;  1OXT A;  4A3G H;  4JCV E;  5IYB G;  1MKH A;  4JBK A;  2LXK A;  1P8L A;  4UP7 A;  1LTL A;  3KJP A;  4JI0 L;  4K0K L;  1EYG A;  2JEA I;  4GKK L;  1X3G A;  3F2D A;  5LMU Q;  4A3C G;  1EIY B;  1J6Q A;  3CF5 A;  2Y0S G;  2E2H H;  3E9I A;  4L5R C;  2ATW A;  1Y1W G;  2OQK A;  2B63 G;  1C0A A;  1PVO A;  4DUY L;  1NJI C;  1SMX A;  3LGJ A;  1PH5 A;  1X55 A;  4LFC Q;  2Z6K A;  3FKI H;  2RF4 A;  5H1S E;  2UUB Q;  4X66 L;  3HOW H;  1IL2 A;  4B3S L;  3JAM i;  2RHQ B;  3GTJ H;  1PH6 A;  1JJ2 A;  2D62 A;  3HOU H;  1YZ6 A;  3UDF A;  4DR5 Q;  1PYS B;  4DV0 Q;  4PMW A;  4LF4 Q;  4BBS G;  4UPA A;  1L1O B;  2K14 A;  4GKJ Q;  3STB C;  4QL5 A;  1HR0 L;  4OX9 L;  1N32 Q;  1HZA A;  2A19 A;  4LUZ A;  3TRZ A;  4DK6 C;  2KBN A;  2VQE Q;  1Q8K A;  2OWO A;  4JI1 L;  5C0X J;  2CWA A;  3PUZ A;  2K4K A;  2JA6 H;  2WP8 J;  2AWN A;  1CSQ A;  5GRO A;  1FL0 A;  1U0L A;  3H15 A;  4X6A H;  5GAD C;  5JJL A;  2CFM A;  3HKZ G;  4X64 Q;  1UE5 A;  4QJF A;  5M3F G;  2PQA B;  1HH2 P;  1XNQ Q;  4Y52 H;  2JJQ A;  3GO5 A;  3RR5 A;  1E7Z A;  5BR8 Q;  5C0X I;  4LF7 L;  4LF6 L;  3PO3 H;  4QQB X;  2UUC Q;  2KCM A;  4YCW A;  2CKZ B;  1AE2 A;  5DLQ E;  1W2B A;  5M3M G;  2F4V L;  1YHB A;  3PIO A;  4HJA A;  3GTO H;  4A3L H;  1I3Q H;  2Y0S E;  4R4O A;  5M5X H;  5LMN W;  1IBK Q;  3RZO H;  3AEV A;  4IPH A;  2UXD L;  1N36 L;  1QVG A;  4P72 A;  3CPF A;  1SR3 A;  2F3I A;  3M4Q A;  4X62 Q;  1FVI A;  5LMU L;  1A63 A;  4DV4 Q;  4DAY B;  1NY4 A;  1OXV A;  1Q7Y C;  4P71 A;  4RMF A;  3S1N H;  1MJE A;  3OTO Q;  2R6G A;  3CCE A;  1IXR A;  4LFC L;  4APV A;  4X65 Q;  3G4S A;  3PO2 H;  4YWK A;  2CWP A;  3L7Z C;  4AQY Q;  2ZJQ A;  2A8V A;  2JA7 G;  3MXN B;  2I5L X;  4HIK A;  2NZO A;  1YBY A;  4IPC A;  1VS0 A;  4DR5 L;  4JI3 Q;  1SE8 A;  4DV0 L;  2F52 A;  2N3S A;  1VQL A; 
#chains in the Genus database with same CATH topology
 4RWS C;  1K1S A;  1B50 A;  5C44 G;  2RSN A;  4JK1 C;  4BA1 I;  2VQE L;  1AFP A;  3BZK A;  1G8Z D;  3KYH C;  1G6P A;  4ZLT F;  3M3Y B;  3M4O H;  4NXN H;  3PN1 A;  1E3P A;  2K1B A;  4DA2 A;  1GO3 E;  2I5M X;  1QUQ B;  4TKO B;  4JI8 Q;  5IYD H;  1DGS A;  2V4Q A;  3TP5 A;  5K5P A;  2QEX A;  1D1K A;  3HOX H;  4LF5 Q;  2W9A A;  4JBM A;  2EYL A;  1YJW A;  1SN8 A;  1TWF H;  1Q1E A;  1ZHS A;  2IL8 A;  1H9J A;  1PTO B;  4RGO S;  3K58 A;  1S72 A;  2HVQ A;  2FLL A;  1A9X A;  5DM6 3;  4FS2 A;  1HNZ L;  4LFA L;  5DM7 3;  4A3E H;  3NP8 A;  3BQ0 A;  2N78 A;  3PF5 A;  4YHH H;  4DR5 H;  5CV9 A;  2JA8 H;  3C1E A;  1EIG A;  2HVR A;  1EZ6 A;  4XQQ A;  4CKB A;  3RJ0 A;  1CSP A;  3MFH A;  5KFE A;  4AH6 A;  4WFN 3;  2FK2 A;  1S68 A;  1TS4 A;  2RHS B;  4GLV B;  4JVZ A;  3J7A F;  1CQJ B;  2XIG A;  4IRK A;  4X65 L;  5EWF A;  5KFJ A;  1HNW H;  4O42 A;  5JH7 F;  5JVL A;  2VXW A;  1HR0 Q;  4JI4 Q;  1GHJ A;  5L9X A;  1RL2 A;  4KV6 A;  4XT3 B;  2JXM B;  1WD1 A;  3P75 A;  2MHV A;  4DFA A;  3N41 B;  1DXM A;  4DPG A;  1VQD A;  2VPS A;  5KFR A;  2HIV A;  3RMH A;  4ZAI A;  4ECY A;  3RZD B;  4DK3 C;  2IMW P;  4LFB Q;  2J6S A;  4O2D A;  5EOY A;  3NEM A;  3MVV A;  1NNX A;  1RTN A;  2KCN A;  4X62 H;  3FPU B;  4Q45 A;  1XX8 A;  2GPS A;  1EQQ A;  3I4M G;  1S97 A;  3OTO H;  2IHE A;  1F2M A;  3GTM B;  2NUA B;  1S5D D;  1TWH A;  1SNC A;  5JOB A;  4HCS A;  4OO1 G;  4YJ2 F;  5C0X H;  1X3F A;  1HZ9 A;  4QMG A;  5I9O A;  2K5N A;  5AJ3 L;  4JW0 A;  1IYJ B;  4DR2 L;  1GUT A;  1SRU A;  2BH8 A;  4IZ8 A;  4TRD A;  4FBT A;  2B2W C;  2A6H D;  4OEL B;  4A3F H;  1N33 H;  1V9P A;  1XMO H;  2YV5 A;  1VQF A;  1AZP A;  4ED2 A;  1N34 L;  2R92 B;  3I4M B;  3T5K A;  1EY7 A;  2B8F A;  3CC7 A;  1QUQ A;  1TS5 A;  1WCM G;  4GS3 A;  4DR6 H;  3MWM A;  4J9M A;  5IOD A;  1EWC A;  1IBL L;  3GLK A;  2NBF A;  5GAG C;  5BPF A;  2Y0S B;  4K0K H;  1YNJ D;  4K8J A;  4HTH A;  1L0Y B;  2YTY A;  5M5W B;  2QYZ A;  3N44 B;  1CQV A;  5C8Y F;  1YJ9 A;  5M5Y B;  4RUC A;  4FXG C;  2EVB A;  1SFO B;  2GN5 A;  3ULJ A;  1G91 A;  4A3J G;  3BQ1 A;  2R85 A;  5FK9 C;  4A3I G;  2VOB A;  4A2B A;  1KL9 A;  3BZC A;  5JVH 3;  1PTO F;  1GLV A;  3S15 H;  2HJW A;  2FLN A;  1UEA B;  4I4T F;  4XZ3 B;  5KFC A;  4AIM A;  1SMY D;  3S14 H;  2RQX A;  1B53 A;  3J7Y W;  4DR3 Q;  4JI1 H;  1GUG A;  3TZD A;  2R7D A;  3ETH A;  3HKZ B;  1U5K A;  3PIP 3;  4A3D H;  1LLR D;  2UU9 Q;  4EBE A;  4H13 C;  1WOC A;  3GTQ B;  3I90 A;  5C4J H;  1VAJ A;  1X6O A;  3LNN A;  1VQB A;  1Z2P X;  3QB3 A;  1M0T A;  4DK1 A;  1VQO A;  5C3W A;  3J81 c;  2MFI A;  2YW2 A;  4TV8 F;  1HJP A;  2ZJR A;  3CME A;  4DR7 L;  3VPB A;  3K7A B;  1N36 H;  3T5L A;  2PI2 E;  4XQN A;  4FDB A;  1ASZ A;  1E2V A;  3A0J A;  2RGV A;  2AGQ A;  3GTM A;  3HOW G;  1Q8I A;  1J8I A;  2YTV A;  4C1N K;  4UCR A;  1G2S A;  3K0Y A;  2M9V A;  1HZC A;  4Y7N H;  3HOV H;  3HOU G;  4KY6 A;  3MA2 B;  4OGQ C;  1OO9 B;  4IQZ A;  4LF9 L;  4QUF A;  1BUV T;  5KFY A;  1SND A;  1HHV A;  1EQV A;  4FM9 A;  4LFC H;  3JAM c;  2QA4 A;  1XMQ Q;  1D7Q A;  2B2U A;  4LH6 A;  1C30 A;  3RF2 A;  2EIF A;  3GII A;  2Z6B A;  4M8A A;  1XWE A;  4LF4 H;  4EQN A;  4DV1 L;  1Q3L A;  1KC7 A;  1YEZ A;  1JDE A;  2L4N A;  1PRT F;  5TSS A;  2CQY A;  1SE2 A;  4WOR A;  1I4G A;  3PO3 G;  4MV8 A;  4M1U B;  4RB2 C;  5ELE A;  2B2Y C;  1OXS C;  3EQL C;  3W1B A;  2F0D A;  2B2V A;  5COY A;  2F03 A;  1MSG A;  4R7R A;  1I4H A;  1XNQ H;  3DM1 A;  4DLK A;  2C9O A;  4DV2 L;  5IWA Q;  2UUC H;  3TQY A;  4HJ5 A;  1KNE A;  3N8D A;  1SFO A;  1K9M C;  1EY4 A;  4AYB G;  1VQH A;  2C2R A;  2KCT A;  2E2D C;  3IRB A;  4DXF A;  1DOL A;  2DWC A;  3CQZ H;  1WCM A;  3A5U A;  5GON F;  3Q8P B;  4DV4 H;  2W6M A;  1DCZ A;  5D65 A;  1STY A;  2PW5 A;  1O7L A;  1SYE A;  1EY5 A;  1Q81 C;  3GIQ A;  1VQA A;  5M5X B;  3RZO B;  4FF1 A;  1Z7T A;  4K5W A;  1JIH A;  3AQQ A;  2VS1 A;  3MEH A;  3KHL A;  2HHH L;  4B3T Q;  1S9F A;  4DUZ H;  4JI3 H;  4NPS A;  3ERO A;  3GP7 A;  3Q6S A;  2MO1 A;  1A0I A;  1UE1 A;  3DWQ A;  1PYB A;  5IYD G;  3RLO A;  2FK3 A;  2I87 A;  2PI2 A;  4AYB B;  4DAP A;  1WR2 A;  4HR7 A;  3HOX G;  5KT5 A;  3D3R A;  3S1R H;  3TP6 A;  1KC8 C;  1SCU B;  3I56 A;  1CE8 A;  3OHB A;  1EU4 A;  1IW7 C;  2Z8L A;  2L9H A;  1DYQ A;  3G7L A;  3ULP A;  4JI8 H;  1JOQ A;  2PYK A;  4JI7 Q;  1YIT A;  4AYB E;  5LA6 F;  4LF5 H;  4TV9 F;  3G6X A;  2A6H C;  4A3E G;  4FBU A;  2CW0 D;  3EJI A;  2JA8 G;  3OSN A;  1G29 1;  3HZX A;  3PV0 A;  2V4R A;  4QIW B;  5LOV F;  3GIL A;  4O3S A;  1TWC H;  4C3I B;  1R4Q B;  2I5H A;  1XJV A;  3V2T A;  4YWL A;  3J81 L;  3CKI B;  2VUM H;  4MTD A;  4MV6 A;  4IAL A;  4ED1 A;  2HGS A;  1AE3 A;  1TWF B;  4QIW E;  4R8U B;  3VYU A;  5FOB B;  3L2P A;  2NWG A;  1VBG A;  1FGU A;  3CCQ A;  1Q12 A;  4G7O C;  1K8A C;  2ICE C;  3K8A A;  2Z1C A;  4A3E B;  4JI4 H;  4G4K A;  3A7L A;  2PZW A;  4R4I A;  4JI5 Q;  4ED3 A;  3T4A C;  3A54 A;  2A68 D;  3JAM L;  3L4K A;  3AFQ A;  4TVA B;  4JC0 A;  3HOY H;  1H9S A;  3DXJ C;  4GC7 A;  1WFQ A;  4BY7 H;  1O7Y A;  1I6V C;  2R7L A;  5HBR B;  4LFB H;  3E5S A;  3E9H A;  5IP9 H;  1SMY C;  4RH6 A;  1LM0 A;  3CXC A;  1L2Z A;  2I0Q A;  1Y14 B;  1V1Q A;  1PX2 A;  1ET6 A;  3NBH B;  4HID A;  1ZYR C;  4IAJ A;  1I4P A;  3PR5 B;  2NN6 H;  4HYK A;  5DQH A;  5C0X G;  1Y8P B;  1OTC A;  1PRT D;  3TEH B;  4POG A;  2DY7 A;  2KEN A;  1GSO A;  4A3M B;  4IWY A;  5KFQ A;  3K7U C;  1PYW D;  1U4P A;  5IT9 E;  2R93 H;  4N8F A;  2XTI A;  3I8Z A;  4R8N A;  4YAK B;  4A3F G;  3SK8 A;  2RVL A;  3T1Y Q;  4XYL B;  2H4O A;  1LV9 A;  2UUB L;  3KBG A;  4V19 0;  1KXL A;  3N43 B;  4K6L A;  5KG2 A;  1VQM A;  1G6Z A;  4MZ9 A;  3KBX A;  3IN5 A;  5EPL A;  1G51 A;  1B6S A;  4PZ8 A;  1CT1 D;  2ZTE A;  2R7Z H;  3S1M H;  3K5L A;  2PBZ A;  4JPB W;  3PUY A;  4AYB A;  5HUR A;  1JWU D;  4FVM A;  2UXC Q;  1XPO A;  1P16 A;  1NR4 A;  4C3H H;  4A3B H;  4IFD I;  2PQE A;  2E2H B;  4KHP Q;  3MR3 A;  5CA0 F;  1GXD C;  3UDX A;  2LSS A;  4EQO A;  1O7I A;  1S40 A;  1T5X D;  4MA0 A;  3CCS A;  4I50 F;  1CZG A;  2KUM A;  3CPW A;  5ELB A;  1JIC A;  2NVX H;  3GTJ B;  3E0J A;  4JI0 Q;  3QFF A;  4YCU A;  1BF4 A;  5DG8 A;  4JV5 Q;  4RNM A;  5KFP A;  1XPR A;  4GKK Q;  4QIW A;  3SVM A;  1NE3 A;  1LAC A;  3HKS A;  1EEI D;  5DEH A;  4GN3 B;  2MNA A;  2UVV A;  2CQO A;  1KRS A;  3G6V A;  2EXD A;  2ASD A;  2OTL A;  3G6E A;  2JA6 B;  5KFA A;  4QW9 A;  1PH9 A;  1ESF A;  2VR1 A;  3I73 A;  1E4E A;  4G7H C;  1EWH A;  2LY7 A;  4X66 Q;  1TWF A;  5BMV F;  3PW5 A;  4XYM B;  2XRQ D;  2DNE A;  1Z2N X;  4A3D G;  3QO2 A;  3I7F A;  4X3U A;  1ZEQ X;  1HXY D;  3K0X A;  5KFS A;  4IJH A;  1IOV A;  4RAU C;  2JA9 A;  2JEB I;  3KF6 B;  4ABN A;  5M9O A;  2Z0S A;  1BVS A;  5JVG 3;  5KG4 A;  1TVX A;  1DV1 A;  5EGT A;  3H94 A;  2WB1 B;  3SXH A;  5EZY F;  2UU9 H;  2XNA C;  2R87 A;  1HTL D;  2L5T A;  4E6I A;  4A93 H;  4I7Z C;  3S15 B;  2YZN A;  3MAQ A;  3KFU A;  2P0A A;  2MUY A;  2Z6K C;  2Z4H A;  1ZQ7 A;  4LUV A;  1W3S A;  2F4V Q;  3SDZ A;  3GV5 B;  3HOV G;  3GTP H;  2NU7 B;  3KLR A;  4JCV E;  4IUU A;  5C4J B;  4H0L C;  5FO8 B;  1X3G A;  2E2I B;  1MSH A;  3RGX A;  3CF5 A;  2QEJ C;  1C0A A;  2W57 A;  3RB4 A;  3MXN A;  3OWF A;  2VB2 X;  1PTO C;  1XMQ H;  3M9O B;  5HV6 A;  3FKI H;  2RF4 A;  1HUM A;  2NU8 B;  1IL2 A;  1ESR A;  2FMC A;  2RHQ B;  5A2Q L;  2PZT A;  5ELC A;  1YZ6 A;  4DR5 Q;  2FLP A;  3R5X A;  2I07 B;  4Y7N B;  2A6E D;  4DV0 Q;  4UPA A;  1L1O B;  4GKJ Q;  2BQU A;  1RYR A;  1K83 B;  1HR0 L;  1DV2 A;  4OX9 L;  3TRZ A;  5KKN B;  1QNU A;  1Q8K A;  2XC9 A;  2CWA A;  3RB0 A;  3P7J A;  1CSQ A;  1STH A;  4NP5 A;  2J0T D;  1FL0 A;  1U0L A;  2HCC A;  3KAK A;  5GAD C;  3JRX A;  1L0X B;  2RDH A;  2EPB A;  5IWA H;  1CQI B;  5K36 H;  3GO5 A;  4K2L A;  1E7Z A;  5BR8 Q;  4LF7 L;  3TDQ A;  4DUY H;  4YAJ B;  1AE2 A;  5DLQ E;  1YHB A;  4XQJ A;  3GTO H;  1I3Q H;  5LMN W;  4JYA H;  2K6A A;  3AEV A;  4IPH A;  2XCL A;  1EY9 A;  5I9P A;  1MZB A;  3VR6 A;  4K5X A;  1QVG A;  4KTA A;  1SR3 A;  2F3I A;  4X62 Q;  3Q2O A;  1FVI A;  4DAY B;  2ATL A;  4J9Q A;  1OXV A;  5I2Y A;  3BDC A;  3S1N H;  2R7K A;  1SYC A;  4ID6 A;  1SYX B;  3OTO Q;  1WSC A;  5KRU A;  1EZ1 A;  3PO2 H;  3GV8 B;  1S0O A;  2CWP A;  5LHY 1;  4B3T H;  1HA5 A;  4H7B A;  3M4I A;  3N6X A;  2I5L X;  2NZO A;  1YBY A;  2RBM A;  4IPC A;  2R3Z A;  1SE8 A;  3OUU A;  1KLU D;  2MJ8 A;  1K1Q A;  4M9U A;  4NXM Q;  4MIU A;  5T14 A;  1XMO Q;  4HIO A;  2DLN A;  1XTD A;  2FIN B;  4CDF C;  5H80 A;  2XSC A;  4HED A;  3WDN A;  5IP7 H;  3CW2 C;  2VNU D;  3KXY T;  4ME6 A;  3RBE A;  2NVT B;  2PMZ E;  2SEB D;  2W70 A;  2VUM G;  3A8K E;  1K3R A;  5KX5 F;  1F2L A;  1PH1 A;  4V0B A;  2C5C A;  3HOZ H;  2K75 A;  4FXK C;  3S2D B;  1MGS A;  3PF4 A;  4B3R Q;  4ILW A;  4K6D A;  2F0E A;  4RGM A;  1K8M A;  4KJN A;  1VCI A;  2HT1 A;  1LT4 D;  4JI6 Q;  2D2C C;  4CC6 A;  3U58 A;  4JV0 A;  5D14 A;  3I4N H;  1AUV A;  4DR3 L;  1RJP A;  4GNX A;  3HOY G;  3HFZ B;  1TWC B;  1JJC B;  4BY7 G;  2E2J B;  2Z4I A;  2W6N A;  4AQY L;  4ED6 A;  4JI5 H;  4X64 H;  5IP9 G;  4FS1 A;  4WBN F;  4JI1 Q;  1M7J A;  4EYI B;  2NZ1 D;  2NN6 G;  5FLX W;  4GOP B;  2F0I A;  4HQ6 A;  1X3E A;  2FJ2 A;  1PFM A;  4O3O A;  1JE4 A;  1IBK H;  4DL6 A;  2R93 G;  1ET9 A;  4XYQ A;  1JOR A;  5FPR A;  2F0O A;  2GVA A;  1BBW A;  1S4Z A;  2WFW A;  2KA7 A;  1RJQ A;  3O13 A;  1EWI A;  4A75 A;  4DAY A;  1VMC A;  2CW7 A;  1N36 Q;  1J5E L;  4HIM A;  3J80 W;  3D4R A;  3T1Y H;  2EYH A;  2R7Z G;  4A4I A;  1UC8 A;  3KAL A;  1HUN A;  4QWD A;  2IX0 A;  5FLX E;  4FF3 A;  2YZG A;  4DL3 A;  4C3H G;  3H4B A;  4A3B G;  5EKK A;  3R5H A;  3CQZ A;  4POF A;  2WTF A;  1ENC A;  3RB6 A;  3S17 H;  3OOC A;  2YRX A;  3D0F A;  4IUQ A;  1T5E A;  2PMZ A;  1PH7 A;  5KYI A;  3NEN A;  3PIO 3;  2QF7 A;  1UE6 A;  5ELN A;  3H0G H;  4KHP H;  3VYT A;  4K14 A;  3S16 B;  1II3 A;  4HSP A;  3RD4 A;  1CUK A;  1S5F D;  3TQ1 A;  2OTJ A;  2D0O A;  2VQF L;  4EQ5 A;  2JEJ A;  4DL5 A;  4RHR A;  4QUC A;  4B08 A;  2AQ2 B;  4JI0 H;  3T51 B;  4GKK H;  4DF7 A;  2YU9 H;  2K5V A;  4I55 F;  2CZG A;  1DOM A;  5KFH A;  1V4Y A;  1K8G A;  5JQW A;  3BJU A;  1H9K A;  2B29 A;  1GGO A;  3UQ8 A;  1B7Y B;  3W5O A;  5D8D A;  2RA4 A;  1JWM D;  4X66 H;  4ED8 A;  5LMN Q;  4DV3 Q;  1SSO A;  3NWS A;  2EYJ A;  2WIN B;  2F3V A;  1TWC A;  3BG5 A;  2NVY H;  2AUJ D;  3TS2 A;  3EYY A;  4A93 G;  2EY5 A;  2FJZ A;  2FPG B;  4R4C A;  3M4P A;  1TWH B;  1IBM Q;  2W8L A;  2VUM A;  2JEF A;  1V8Q A;  1HNX L;  1E4G T;  2O2L D;  3KHH A;  3K5H A;  4GOP A;  4Q0F A;  2JA5 H;  2Q2T A;  1HQM C;  2OF1 A;  3I3C A;  2F0K A;  3I72 A;  5KNC A;  4HNT A;  4DUZ Q;  4DV5 L;  5M3M B;  3UI2 A;  1OXU A;  3NSW A;  2UVW A;  1GUO A;  5C3X A;  4JI7 L;  2F4V H;  5ELD A;  4DR4 L;  3I2Z A;  1RK5 A;  2IBK A;  2V5A A;  1JOK A;  2JQO A;  1TWG H;  4RU9 A;  3FEW X;  4A93 B;  4GC6 A;  1RHP A;  3FKI G;  2KCC A;  4MNO A;  3W2D A;  1KJ8 A;  2XD4 A;  1QOH A;  2VY3 A;  1KDB A;  2EJM A;  4DV7 Q;  5KFF A;  3TP7 A;  4NLG A;  2FPP B;  4F50 A;  3GTP B;  1B04 A;  2VA2 A;  2CHB D;  1PDQ A;  2R8J A;  2IPK D;  1TS3 A;  3RAX A;  2ZM6 Q;  3GV3 A;  1SNM A;  2HQE A;  5C44 B;  2R93 A;  4OHJ A;  2MGS A;  4RB3 C;  1Y1W H;  1VQ7 A;  1KJJ A;  4DV0 H;  4GKJ H;  3I4L A;  4FNF A;  4JI2 Q;  3A56 A;  3F2B A;  3H3V I;  4G3I A;  3D6W A;  4DR1 Q;  5K36 G;  3FKI B;  5KFW A;  3IG0 A;  4IUN A;  3VPD A;  2R7Z A;  4BBS H;  4CDD C;  4WJW A;  3CAM A;  4O0A A;  3H4D A;  2K5W A;  1IHZ A;  3NBI A;  3HBL A;  4KN4 C;  5BR8 H;  2R8H A;  2WV6 D;  3AYH B;  3IFT A;  3W3A A;  3K5M A;  3GIK A;  1G2T A;  2FK1 A;  3GTG H;  1EYD A;  4O3R A;  1D2B A;  1PLF A;  1HFN A;  2VPQ A;  4TQS A;  2NVX A;  5FO7 B;  2KEC A;  4LF8 L;  5M3F H;  4OO1 I;  1YNN C;  3PO2 G;  4KY7 A;  3IAY A;  4ME3 A;  4DAM A;  1YIJ A;  5DQG A;  2F0P A;  4YR3 A;  5KT2 A;  2SNM A;  3IL8 A;  3GTO B;  1HZB A;  1RJR A;  3D8G A;  1V43 A;  4OL7 A;  5IT9 c;  4F87 A;  3H09 A;  3HP3 A;  1ENF A;  4CKE A;  1KBL A;  1F9R A;  3K5N A;  1IW7 D;  1VQ6 A;  2ZDG A;  2OH2 A;  3DWA A;  4DL4 A;  4DV6 Q;  2NUC A;  2UXC L;  3SI8 A;  5IP7 G;  5NUC A;  1VQ9 A;  3CCV A;  2ZJP A;  1W6J A;  3TIN A;  2A74 C;  2PZU A;  2WAC A;  1B2T A;  5J2T F;  4A76 A;  4NXM H;  2E5L Q;  2JA7 H;  3IFD A;  3KDF A;  4JOI A;  3R8B A;  3HOZ G;  2BCO A;  4BY1 H;  3RUP A;  2IJ0 A;  2ZT9 C;  4JV5 L;  2LS0 1;  1UNN C;  2SDF A;  3NUC A;  2DIK A;  1BO0 A;  4JG2 A;  5EBC A;  3MXU A;  3WWV A;  2AQ4 A;  3CC4 A;  1VQN A;  1EOT A;  4FF4 A;  3RLN A;  4LWC A;  4EEQ A;  1JXL A;  3EA6 A;  3S2H B;  3I4N G;  4B3R H;  1XPU A;  1CA5 A;  1B4O A;  3GTP A;  3K3V A;  2ZDH A;  2IX1 A;  4JI6 H;  2ASB A;  3C3L A;  3AFP A;  1TWA H;  4QWC A;  4UCT A;  5CV4 A;  2K5D A;  3BYY B;  1XNR Q;  5JJI A;  4YY3 H;  4PMB A;  2KJX A;  1FNV A;  1A62 A;  1NMG A;  1O78 A;  2K32 A;  1ASY A;  1KAA A;  2UUA L;  1I6H H;  1LTG D;  1WCM B;  3KLS X;  4C56 C;  1NMF A;  3FKI A;  4DKA C;  5A35 A;  2E75 C;  3NTI A;  1F9S A;  3GID A;  3HS0 C;  4MV7 A;  2W9C A;  3ZYY X;  1CZW A;  1ZYR D;  4OON A;  3SE0 A;  1NBW A;  1VQI A;  3I4N B;  3V4Z A;  1N8R C;  1BNC A;  2F0H A;  4RB0 A;  2F0V A;  1NCV A;  4CHT B;  4C2M H;  5E4X A;  1JMC A;  5KG1 A;  5KG0 A;  5FKA C;  4FXD A;  2UVR A;  4IFD H;  4NXN L;  4A3J B;  4HR7 B;  4CDE C;  2V1C C;  5DAU A;  1VQJ A;  2BA0 A;  4A3I B;  4GLA C;  1Y69 U;  3M7N A;  2CCZ A;  1S0M A;  3VYR A;  3NEL A;  3KAJ A;  1RDP D;  4EFB A;  4R4T A;  5IYC H;  3C0F B;  2ZTC A;  1VKZ A;  4YP3 A;  2IA6 A;  5EWE A;  1CHP D;  1JB3 A;  2B2T C;  1DON A;  3LP8 A;  5FJ8 H;  3GTO A;  2BOS A;  3FDT A;  3GDE A;  4XTC S;  5JAV A;  4PWQ A;  2QCP X;  1I3Q A;  4IWX A;  3K5I A;  2N88 A;  2F3W A;  3R2I A;  3T1H H;  1HPC A;  3VR3 A;  4IFD J;  4YQW A;  3H0G G;  4IUR A;  4YHH L;  4LMY A;  3LWU A;  3V6K A;  2L1B A;  1QVC A;  4N8X 1;  3PCO B;  2B8G A;  4BWS C;  3NHH A;  1HNW L;  3FPP A;  3MC0 B;  2LKV A;  1L1O C;  1ICF B;  1I94 Q;  5IT9 L;  3M9B A;  5F9N A;  2C35 B;  1D8L A;  5C4H A;  1FJG Q;  4KK7 A;  4IUV A;  3S17 B;  4TQR A;  1JJG A;  3HOW B;  3FRP B;  4JBJ A;  3NWT A;  1YHA A;  3HOU B;  3RV3 A;  3U9T A;  1AN7 A;  3T5J A;  2M2L A;  4I7A A;  3T56 B;  4B3M H;  1QZG A;  3MTS A;  1H9S B;  2WKC A;  2F1M A;  5E4W C;  1BCP B;  5GAE C;  1ILP A;  4ECT A;  1S5C D;  3DHQ A;  1VQ5 A;  5EBD A;  4OWW B;  4P75 A;  4DUY Q;  4X62 L;  4IOC A;  4RG1 A;  2RCN A;  3ICE A;  4JYA Q;  1VQ8 A;  5LMN H;  4DV3 H;  4TQU S;  1CKM A;  4XDX A;  4B3S Q;  1VF7 A;  3BZD B;  3FMC A;  4IJL A;  4ME5 A;  3OTO L;  2YU9 B;  2C2D A;  4JV1 A;  1I4X A;  1SJE D;  3FHW A;  4BBR H;  4J9K A;  5KFB A;  3PO3 B;  2AGO A;  2JA5 G;  2W6Z A;  1F2Y A;  1CQF A;  1PH2 A;  1IBM H;  4FU0 A;  4UCU A;  5GQO A;  3HGB A;  3IKJ A;  3OHA A;  2EQS A;  1GUN A;  1B8A A;  1N33 L;  2PNH A;  3L4J A;  2NVY B;  1XMO L;  1B6R A;  4B9X A;  2EOT A;  3CCR A;  3OHX C;  3TS0 A;  3KJO A;  1KJQ A;  4LF6 Q;  3CCL A;  5C4Z A;  3MWD A;  4DR6 L;  3UDI A;  2EE1 A;  4ECX A;  4A3G H;  5KG5 A;  1PTO D;  1MKH A;  4UHV A;  2LXK A;  4UP7 A;  4LK1 C;  2ENB A;  1LTL A;  4K0K L;  4ZOL F;  1EYZ A;  5LMU Q;  1EIY B;  1J6Q A;  4DV7 H;  2RGR A;  1Y1W G;  1AW7 A;  4NW2 A;  1FKA H;  3M9M B;  1SMX A;  5G3L F;  3M4O B;  3LGJ A;  1C3O A;  2FMA A;  2BE5 C;  4KHV A;  3J7A K;  2ZM6 H;  5KIX A;  3JAM i;  2F0N A;  1PH6 A;  3HOX B;  2W9B A;  5L1L A;  5CA1 F;  5LP6 F;  4LJZ C;  5JJZ A;  4BBS G;  4PMW A;  1E4E B;  5CB4 F;  4JI2 H;  3H91 A;  2L11 A;  2V59 A;  4DK6 C;  2VQE Q;  4JV2 A;  4DR1 H;  4JI1 L;  4F88 A;  3GIJ A;  2K4K A;  5JUM A;  2WP8 J;  1TII D;  5CAE B;  5KG3 A;  5GRO A;  2DJF C;  5J1Z A;  2DZD A;  4KY5 A;  4X6A H;  2EY6 A;  2JA8 B;  5KFG A;  4X64 Q;  4IHJ F;  2KED A;  4ZYS A;  3H0G A;  4QWE A;  5M3F G;  2PQA B;  4IZO A;  5C0X I;  3PR4 A;  4ZK9 B;  4QQB X;  2BDO A;  2CKZ B;  4ZUJ A;  1W2B A;  3TBI B;  4HAE A;  4CC5 A;  5ISR A;  2ICI A;  1IBK Q;  4BBS B;  2JEG A;  1N36 L;  3CPF A;  1ONL A;  3OW7 A;  4QCL A;  2QKI C;  2YU9 A;  4KN7 C;  4J9S A;  4QW8 A;  5KFZ A;  2R8G A;  3AU7 A;  2G5D A;  3OWE B;  4DU9 A;  5L1I A;  4N9T A;  3CCE A;  2XVS A;  4LFC L;  4X65 Q;  4RZR A;  4HCE A;  4YWK A;  1C8C A;  2ZJQ A;  5F9L A;  3A8J E;  3V6J A;  2JA7 G;  3MXN B;  5EJW A;  4ECQ A;  4DV6 H;  4HIK A;  1PZJ D;  3QG1 A;  2NVY A;  3C2P A;  4BY1 G;  4LF4 L;  5C6A A;  3TIG A;  1O80 A;  5LYJ F;  1VQL A;  3BA9 A;  3D4W A;  1QB5 D;  2E5L H;  1GSH A;  2V4D A;  3PW2 A;  1STG A;  1PH3 A;  2I46 A;  4CDC C;  5FPO A;  3S1Q H;  3CRL C;  1W6K A;  3PUW A;  5KFM A;  1A3U A;  5E7N A;  3L9A X;  1E22 A;  1VQP A;  2JA5 A;  1V1P A;  1BR9 A;  2YL2 A;  1AN8 A;  3HXL A;  4A3F B;  1XNQ L;  3PIP A;  4WD3 A;  3N42 B;  2UUC L;  2JA7 B;  3F1Z A;  3S9W A;  2JYO A;  4PV1 C;  1S5E D;  3QR8 A;  4KKU A;  5C5L A;  1EQR A;  1TWG A;  4QY7 A;  1Q1B A;  3BVZ A;  4K2K A;  1SAP A;  5AJ3 Q;  2K04 A;  4DR2 Q;  1ILQ A;  1XNR H;  1CS0 A;  2SNS A;  2AKW B;  1I4R A;  4DV4 L;  4C5A A;  1QE6 A;  4RGN A;  1N32 H;  4H44 C;  1WVL A;  3U4V A;  3D4D A;  1GKH A;  4IRD A;  4CGY B;  4KKT A;  3OW2 A;  4EGQ A;  4R1J A;  1VQK A;  3ETJ A;  4IFD G;  2ID0 A;  3I91 A;  4DUZ L;  3VYS A;  4JI3 L;  4DNI A;  2AHO B;  5ELO A;  1WTP A;  1Y1W A;  5LL6 S;  1ML0 D;  5G3L D;  2PQA A;  1IBL Q;  1B33 N;  2XGP A;  1OXX K;  5IYC G;  2WDT A;  1SDF A;  1GUW A;  1Z6H A;  4C3J H;  4O3P A;  4XIG S;  2MCT A;  2N49 A;  3BU2 A;  3S14 B;  4JI8 L;  5FJ8 G;  4DXG A;  2G9H D;  1DIK A;  3X3N A;  3ND9 A;  4LF5 L;  2ZXO A;  4A3D B;  2F0W A;  2F0F A;  5IGD A;  2TMP A;  1T94 A;  2CVR A;  1L0W A;  3TQT A;  1ENA A;  2JK8 A;  1EU3 A;  4C2M B;  1Q86 C;  1C7Y A;  5IYZ F;  5JPN C;  3GTG A;  4KHZ A;  2MP1 A;  3RTX A;  3EPI A;  3JAM W;  5KYL A;  1JCK B;  3J80 i;  2UXB H;  1IKM A;  3A55 A;  1B70 B;  1V1O A;  3T13 A;  1PHJ A;  1BGW A;  3R93 A;  3VA5 A;  4QF4 A;  5KFN A;  3HRZ C;  1PTO H;  1GVP A;  4J1M A;  2Q8T A;  4PZ7 A;  5KGU A;  4U67 3;  3BAB A;  4DN4 M;  2E76 C;  3HOV B;  3F2U A;  5C3E H;  2IT1 A;  2N55 A;  4JI4 L;  3FVQ A;  4GNX B;  1I94 H;  1K0S A;  3DEP A;  1FJG H;  3RUZ A;  5IIF A;  5FLM H;  1E2Z A;  2AMC B;  1B9M A;  3E3X A;  2I80 A;  5FLX L;  1EOV A;  3DEO A;  3T5H A;  4YJ3 F;  1GOZ A;  2JA7 A;  5L1K A;  1VDZ A;  3MXP A;  4LFB L;  4IO9 A;  2C00 A;  4F4W A;  2B2W A;  3GV6 A;  1WTV A;  3GV7 B;  4RGT A;  3NGD A;  1T3N A;  2O5I C;  4BBR G;  4C5C A;  1CM9 A;  4C1N I;  1YHQ A;  1M90 C;  2ASJ A;  4MV4 A;  4J9N A;  1KQS A;  2JE6 I;  4K8I A;  5AFW A;  4B3S H;  1KAB A;  2B3G A;  4ECZ A;  3MXG A;  5C5J A;  1UC9 A;  3RZD H;  4RKB A;  3WOF A;  3J7A 5;  3WO0 A;  2W71 A;  1N9W A;  3DMU A;  4GLX A;  1TWA A;  3BVM A;  1STA A;  3FMA A;  5I4D A;  1H95 A;  3KHG A;  4X3K A;  4OIK A;  2R61 A;  1C48 A;  1A3T A;  4DNT B;  1E24 A;  2D0P A;  1GYF A;  1CTM A;  3SHL A;  3H3V C;  4A3G G;  3CQZ B;  3P20 A;  4P2C B;  1YJN A;  2VUG A;  3GIP A;  1A3V A;  4DV2 Q;  2B2U C;  4LF6 H;  1STN A;  1K73 C;  2PMZ B;  4KJO A;  3PW0 A;  3RN2 A;  2WAQ G;  5L37 A;  4X3S A;  3EVQ A;  3QZ7 A;  2UXD H;  5KT6 A;  2HVS A;  1BOS A;  3BAA A;  1I4Q A;  2WKD A;  2IHF A;  3FP9 A;  4C2M A;  4HNU A;  5LMU H;  1PFB A;  2EYP A;  1LTI D;  3S1R B;  2HUG A;  2B2V C;  2KOL A;  3M4Y A;  2R92 H;  5DLF A;  2J6U A;  3M9N B;  3EBE A;  3C46 A;  4A3G B;  1U4R A;  1EIF A;  2K28 A;  3KF8 A;  2HHH Q;  1SYG A;  4XX0 B;  5ELF A;  2K50 A;  1TY0 A;  1UE7 A;  4YY3 Q;  5IGB A;  2VQE H;  5M5Y H;  2KHJ A;  2NN6 I;  1TXY A;  1TKW B;  1PA6 A;  2WAQ E;  2UU9 L;  3SR1 A;  2VUM B;  4L6T B;  1EYC A;  2EJF C;  3KHR A;  3Q8S B;  1YNN D;  4HMI A;  4S3S A;  5DG7 A;  3NE5 B;  5KG6 A;  2EY2 A;  2K01 A;  1JKJ B;  4RAZ A;  3V6H A;  1KAW A;  2FP4 B;  1HNZ H;  4OWX B;  1X9N A;  2OT2 A;  3SEB A;  1B3A A;  2C2E A;  4LFA H;  1EFW A;  5A2Q W;  4OXP A;  5DQI A;  3GTK H;  3GTQ H;  1NSN S;  3HOY B;  4QWA A;  2B2Y A;  4BY7 B;  3GQC A;  3MFG A;  2E74 C;  3L3O C;  1Z9F A;  4EGJ A;  4BS9 A;  2FXQ A;  4X65 H;  1S0N A;  2RCF A;  1TU2 B;  2HIX A;  3OUZ A;  4WJ4 A;  2GVB A;  1XMQ L;  2W7O A;  3K7A H;  4ECR A;  1SNO A;  1STB A;  1VQC A;  4UCO A;  3T1H Q;  2AU0 A;  1K3B C;  3VR5 A;  4LH7 A;  1CKN B;  4C5B A;  4DNR B;  4KLK A;  2R93 B;  3QOL A;  3WOE A;  3GTL H;  3MR6 A;  3GIM A;  1JLL B;  4IPG A;  1DD2 A;  1KTK A;  5IY0 A;  1F9Q A;  2SCU B;  4MTE A;  5IOC A;  1PZI D;  4YR0 A;  4UY8 C;  4ECW A;  4QWB A;  1ZKO A;  1RF2 D;  3A74 A;  1RCV D;  1DM0 B;  3J80 E;  4ZI7 F;  3S1M B;  2R7Z B;  5IWA L;  5D3D A;  1NR2 A;  3STB D;  3RV4 A;  5HGT A;  3A7A B;  3Q24 A;  4UFZ A;  4C3H B;  5CBA E;  4A3B B;  2K52 A;  3URY A;  4B3M Q;  5EAY A;  5J3B A;  1WTQ A;  4JYA L;  2YYA A;  4U7C A;  5EDW A;  3KOJ A;  1VF5 C;  4RNO A;  4DR2 H;  3B6Y A;  1JQY D;  4Z9C B;  4A2A A;  2NVX B;  2WAQ A;  4ODG A;  3QOJ A;  4TSS A;  2DPJ A;  3AB9 A;  3Q8D A;  3MJF A;  2JN4 A;  4B9W A;  5JEA H;  2EYM A;  5D3I B;  4EGV A;  2F0Q A;  3CRK C;  4MTK A;  3MFI A;  1N34 H;  3U4Z A;  4B3T L;  1T36 A;  4J6H A;  4C3J G;  2XWB B;  3R5F A;  2C28 A;  1M6V A;  1CA6 A;  3AMU A;  1X56 A;  2DN8 A;  1IBL H;  2HD3 A;  4PZ6 A;  3BQ2 A;  1QJO A;  1M4V A;  4ZKB B;  5EKI A;  2VB3 X;  1H9M A;  3N6R A;  4IPD A;  5JEA J;  1EUC B;  3SE7 A;  3RIZ A;  1JX4 A;  4QGU A;  3KLW A;  1A15 A;  1EY6 A;  3KDF B;  4MV9 A;  2IY5 B;  5IGG A;  5KFV A;  4O1N A;  1Y1V H;  2PPB C;  2BQ3 A;  2J6T A;  2J9G A;  2NU9 B;  1QIL A;  2QGQ A;  1GJX A;  3CVZ A;  4C3J B;  3VA7 A;  1LYL A;  4F4Y A;  1LT3 D;  1SEB D;  1S5B D;  4NB3 A;  3U9S A;  4F7X A;  4J9R A;  2KVM A;  2RSO A;  3Q22 A;  5DG9 A;  1I7L A;  1FYC A;  1Q90 A;  2XIW A;  5CV8 A;  5C3E G;  2FE3 A;  3FDS A;  1CKN A;  3CP0 A;  1HRJ A;  4MTN A;  4EQP A;  2L15 A;  4M7E A;  4YR2 A;  5EPJ A;  5FLM G;  2EZV A;  5IGC A;  4L8J A;  4UAI A;  2TSS A;  4C3I H;  2PNR C;  3BVG A;  1F9P A;  2JSO A;  4MHE A;  4JI5 L;  4RCO A;  3RB3 A;  2AQ1 B;  4X64 L;  1EL0 A;  1JE5 A;  4DR7 H;  2R7F A;  1ICW A;  2W9C B;  3OYY A;  4JUZ A;  4IOA A;  3CCU A;  1IBK L;  5C3E B;  1DOK A;  1CHQ D;  2KSW A;  3N40 P;  1IZ6 A;  1DJR D;  4LF9 H;  3BA8 A;  2LXJ A;  3RN5 A;  4FO2 A;  1VBH A;  1KDA A;  4L1K A;  3EIV A;  5D1O B;  3I12 A;  3WNZ A;  3BJY A;  3PQI A;  4F8M A;  2Q2H A;  4DV1 H;  1E1O A;  3JSN A;  3T1Y L;  3G48 A;  4OX9 Q;  5KT7 A;  2R84 A;  1A2U A;  1I3Q B;  2B63 A;  1YNX A;  1EFI D;  2QW7 A;  3CCJ A;  2LFN A;  1AEX A;  1EY0 A;  1HTP A;  2A73 B;  1SRO A;  4A3M H;  1ROD A;  5EPK A;  2LMC B;  2J4X A;  1BXR A;  4O2A F;  4G7Z C;  4YB8 B;  4DV2 H;  5E3F A;  3S1N B;  4KHP L;  4LF7 Q;  1WTH A;  3S24 A;  2JP1 A;  4UP9 A;  3PO2 B;  2R92 G;  1K8O A;  5E1F A;  5KFD A;  4JBK A;  2W6P A;  5EQ0 A;  2BE5 D;  4YIJ A;  1HA6 A;  3NQT A;  4JI0 L;  1EYG A;  2QK4 A;  4ZUI A;  1UNS A;  4GKK L;  3F2D A;  1UAP A;  1SNQ A;  4Q0Y A;  3JZI A;  1PRT B;  2Y0S G;  2E2H H;  3E9I A;  3CU7 A;  1PVO A;  1NJI C;  1TY2 A;  2RDG A;  1X55 A;  3N52 A;  2Z6K A;  1PZK D;  5H1S E;  3BDO A;  2AGP A;  1D1I A;  4X66 L;  1N56 A;  2HHH H;  3GTJ H;  3WO1 A;  3E6Z X;  3UDF A;  2IW3 A;  3ORR A;  2K14 A;  3STB C;  2L55 A;  3NQI A;  4QL5 A;  1N32 Q;  1HZA A;  2A19 A;  4LUZ A;  3PW7 A;  5K2M A;  4CKC A;  3BG3 A;  2OWO A;  5C0X J;  3HOZ B;  5CV5 A;  3H6M A;  2JA6 H;  5CV7 A;  2QIL A;  4MAM A;  1IYV A;  5JJL A;  2CFM A;  4LMQ D;  3HKZ G;  2AQ3 B;  3Q23 A;  1UE5 A;  4R9W A;  4QJF A;  1IL8 A;  4OEM B;  1AZQ A;  4Y52 H;  2JJQ A;  3RR5 A;  3OIQ A;  4RAY A;  2EYO A;  2KCM A;  2F4V L;  1KJ9 A;  1WH2 A;  3PIO A;  4HJA A;  4A3L H;  5KFU A;  1ZXT A;  2Y0S E;  4R4O A;  5I47 A;  2V9W A;  4O4L F;  5D1O A;  4APM A;  1FNU A;  3M4Q A;  2CH4 W;  1I6U A;  4J8Q A;  1NY4 A;  4P71 A;  4MA5 A;  1MJE A;  1HFG A;  1D5X C;  1RKN A;  3SK5 A;  5IGE A;  2KEE A;  1IXR A;  3T16 A;  4APV A;  2D5D A;  1O7Z A;  3L7Z C;  4AQY Q;  2A8V A;  3GTK B;  1TS2 A;  1SNP A;  1SE4 A;  3P1H A;  3KTM A;  1LO5 D;  4DR5 L;  4DV0 L;  2N3S A;  2E2I H;  4GKJ L;  1LTS D;  3HKZ E;  4I65 A;  1CK1 A;  2W9B B;  4YWM A;  4HJ7 A;  1RYS A;  5IE8 A;  4KD4 A;  2W6O A;  4MV3 A;  2KHS A;  3UDG A;  3UE0 A;  2UXB Q;  1I50 H;  1SJH D;  1HQR D;  2H5X A;  2OCE A;  2F4I A;  1LTB D;  1Q82 C;  3MZ5 A;  4A3K H;  2AWO A;  2FPI B;  2MPM A;  3KUP A;  4P74 A;  4GNX C;  3EN2 A;  1MHW C;  4UP8 A;  4FYD A;  3K6O A;  5JVD F;  3OPO A;  1AUX A;  3DM3 A;  4H02 A;  5BR8 L;  3GTL B;  1PH8 A;  1K83 H;  4O3N A;  4HJ9 A;  1J5E Q;  4HJ8 A;  3EPG A;  3PSI A;  4F4X A;  2G9D A;  3H0G B;  1V51 A;  2FB9 A;  1EY8 A;  4RKL A;  3ORQ A;  2UUB H;  5JEA G;  1KRT A;  1JR0 D;  4WJ3 M;  3SK6 A;  2K33 A;  4LNQ A;  4EX5 A;  3K59 A;  2YRW A;  1QWY A;  3NPP A;  2FKL A;  2FFK B;  1TR5 A;  1KEE A;  2ZTD A;  3PVX A;  4IUT A;  4MN3 A;  2R92 A;  1N48 A;  2MQH A;  2K5H A;  2VW9 A;  3TME A;  3CD6 A;  2X69 A;  2J7Z A;  4L5T A;  2Q2I A;  4XT1 B;  1R9T H;  4ALP A;  2QDL A;  1PXU A;  2MO0 A;  2O4X A;  3Q1K A;  4ETS A;  1YVC A;  1RK6 A;  2O5J C;  2Y0S A;  1PMR A;  2VQF Q;  2RDF A;  3UE1 A;  1WTO A;  3G71 A;  1BNZ A;  3TSS A;  4NXM L;  1QG7 A;  1Y1V G;  2PN1 A;  2RDI A;  1Z47 A;  3GQB A;  2BQR A;  2R7M A;  1Z2O X;  3VDY A;  2D9U A;  1I5F A;  1BBU A;  1NUC A;  1SBB B;  3J81 i;  2UXD Q;  1SXT A;  1NTG A;  1B1Z A;  1U9R A;  2JA5 B;  4K5V A;  1V1P B;  1RD9 D;  2R86 A;  3HKZ A;  3TP8 A;  4B3R L;  1SEI A;  4PNY A;  3J7A V;  4BA2 I;  5KFK A;  1O75 A;  3I55 A;  4WRD A;  4JI6 L;  3ND8 A;  1EHI A;  3RGZ A;  3GTK A;  4C3I G;  2NVT H;  3GTQ A;  3HEJ A;  4FF2 A;  1STE A;  1HNX Q;  1TWG B;  2CH4 A;  1Y1V B;  1AP0 A;  4YY3 L;  4ZHQ F;  1C4Q A;  5D1P A;  4O4H F;  1VQ4 A;  1EUJ A;  1CFM A;  4HSV A;  4PQX A;  3ERQ A;  4YBZ B;  4DV5 Q;  5BN5 A;  1Q46 A;  2F0T A;  3K81 C;  3U50 C;  3S2D H;  4O3Q A;  5J2U F;  4J9O A;  4Q8E A;  2ALZ A;  3ULL A;  1W93 A;  1GM5 A;  1JOO A;  3QJY A;  4DR4 Q;  3RFC A;  4RCN A;  3V4S A;  2DGY A;  2H1E A;  1EEF D;  4J0M A;  4P73 A;  4ULL A;  1C9O A;  5CR3 A;  3F2C A;  4J9P A;  3GTL A;  1MI2 A;  1Y1W B;  2OEO A;  2E2J H;  1KHI A;  3EFX D;  3ITP A;  1MD2 D;  3A5Z B;  2O03 A;  4GOP C;  2RKS A;  1JC7 A;  2NVQ H;  2F0M A;  5EWG A;  3Q8Q B;  1K0R A;  1HNZ Q;  1PFS A;  5LL6 b;  3PUV A;  1YNJ C;  1YI2 A;  4LFA Q;  2A69 D;  4RHS A;  4U68 A;  4GN4 B;  3C1F A;  4A3M G;  2HCI A;  1D5M C;  4EG0 A;  1HR0 H;  5DGB A;  3X3M A;  4OX9 H;  5IT9 W;  2XRS D;  1BBX C;  4N9P A;  2X6G A;  3TRE A;  2PVP A;  3T1H L;  1BCP F;  1OWT A;  1H9R A;  3GTG B;  5LXT F;  3SGI A;  5BN3 A;  5KFO A;  5KFX A;  3MR2 A;  3MR5 A;  4JBW A;  5C1O A;  5M3F B;  1KD1 C;  4BXX H;  4GZY C;  1D5Z C;  1GUS A;  1JB7 A;  3I70 A;  5FLX c;  2AUK A;  4LUO A;  2DNC A;  5I6Y A;  4L63 B;  1FGB D;  5C4X H;  5L1J A;  4IUP A;  4LF7 H;  4LW1 A;  2NU6 B;  1FNW A;  1LTA D;  1RTO A;  4ED0 A;  1KNA A;  2BDN A;  3PZP A;  5HGQ A;  3BYT B;  3E0E A;  3W1G A;  1S03 G;  3M7G A;  1NAP A;  3K80 C;  3MWY W;  4F4Z A;  4LF8 Q;  2ZDQ A;  3PGZ A;  1FR3 A;  4B3M L;  1ULZ A;  3U9O A;  2YS6 A;  3J80 c;  5KNB A;  2NTT A;  3K57 A;  2NZH A;  3NTK A;  5IYB H;  3S16 H;  5FD6 A;  1BQQ T;  3G6Y A;  1Y1V A;  2SOB A;  5T1G A;  3SK4 A;  5CBE E;  4BY1 B;  5LMN L;  3H40 A;  4DV3 L;  1X54 A;  4A3C H;  2JA6 G;  1M0W A;  1WTX A;  2YS7 A;  1EQT A;  2E8G A;  2FHT A;  1E0B A;  3DWP A;  5COR A;  2B63 H;  1EUD B;  2VA3 A;  5CGK A;  4GN5 A;  4NMZ A;  1IBM L;  4Q44 A;  1LTT D;  1UWV A;  1BDO A;  5DNF A;  1N34 Q;  5FD5 A;  4A3L G;  1TWA B;  4ZRZ A;  3NXW A;  2A5H A;  2M05 A;  3CMA A;  2WB1 G;  4ZKC B;  3A8I E;  3D31 A;  3E5N A;  1CKO A;  4UDU C;  1PV4 A;  4DL7 A;  1I6H B;  2ALY B;  2B39 A;  3NTH A;  1TWH H;  4HN7 A;  2R7N A;  1IKL A;  3J81 W;  1A2T A;  1RIP A;  2IX3 A;  3R3O A;  4R8U A;  2YYZ A;  1QVF A;  1XXG A;  4JOI C;  5M3M H;  1MJC A;  3BDL A;  3MFY A;  3J81 j;  4DR3 H;  3M85 A;  4DV7 L;  2UUA Q;  3PUX A;  1QZH A;  2K7V A;  3VR4 A;  1JT8 A;  1SYF A;  2YZM A;  4ECS A;  1LUZ A;  4AQY H;  4FP5 D;  3M3Y H;  1LTR D;  2ZM6 L;  2OQ0 A;  2Q8I B;  4DL2 A;  5CC4 A;  1EIH A;  4NKL A;  5IGF A;  4KKS A;  5EKL A;  2L12 A;  3KF8 B;  4HMJ A;  4LAA A;  4A3K G;  2BH2 A;  2CW8 A;  4Q8F A;  1KDC A;  4DAV A;  4JI2 L;  2VZA A;  3J81 E;  2F0S A;  3NBH A;  4PG3 A;  3ER0 A;  2A1A A;  2WB1 E;  2BA1 A;  2KHI A;  4DR1 L;  1RJT A;  1LT5 D;  2HQL A;  2PO4 A;  4KMU C;  2V58 A;  4LSX A;  4NXN Q;  1S10 A;  3R23 A;  5KT3 A;  3F8T A;  5C44 H;  2YTX A;  1BCP D;  4DR7 Q;  2DY8 A;  5DLG A;  1J5E H;  3OMC A;  4OWT B;  4CJ2 C;  4L5S A;  3BS1 A;  5DGA A;  1U4L A;  4UCS A;  3CCM A;  3JAM E;  1I50 B;  4ZQI A;  1ZET A;  3DLL A;  4A3K B;  1B44 D;  4ZQ3 A;  2XCP A;  4PMC A;  3JRW A;  2L0C A;  4LF9 Q;  4YHH Q;  2KQ3 A;  2CW0 C;  2OLS A;  4O4I F;  1BKB A;  1TQO A;  2E2H A;  3H20 A;  1Y8N B;  2XWJ B;  2XGQ A;  3VMM A;  1QCB D;  4DV1 Q;  3J80 L;  2HDM A;  1HNW Q;  2N8N A;  1T9H A;  1SYD A;  4CJ0 B;  3K3P A;  1JWS D;  3GTJ A;  4LSA A;  1HCZ A;  5HY6 A;  4DV6 L;  3ZJY C;  4L5Q A;  2VQF H;  2K03 A;  4R4Q A;  2W8K A;  4ECU A;  2A69 C;  4EYH B;  1QNK A;  2ZXP A;  5C5M A;  5KFI A;  2E5L L;  2P5Z X;  4Y8V B;  4BBR B;  2EDG A;  3GTM H;  1LT6 D;  1R9T B;  3L0O A;  1AH9 A;  2JA6 A;  5JJK A;  3PMF A;  1WTW A;  2A68 C;  1WYD A;  2R8I A;  3H3V H;  3OSO A;  4DK0 A;  2BR0 A;  1E1T A;  2HDL A;  1D6E C;  3KLS A;  1TAE A;  4OIJ A;  1M1K C;  2XGT A;  2RDJ A;  4EEY A;  2Q2U A;  4J15 A;  4HNV A;  1SE3 A;  4RZQ A;  1UUP A;  4QB4 A;  4X3T A;  3OMG A;  3TN2 A;  2FMM A;  3KF6 A;  2IWH A;  2X0S A;  1WTR A;  3DF7 A;  2NYZ D;  4I7H A;  4IR9 A;  4RFB A;  1SLJ A;  3MHB A;  2WB1 A;  5F2D A;  4Q43 A;  3I4M H;  1PRT C;  4RB1 A;  2VL6 A;  4U6P A;  1HNX H;  3RLF A;  5GAH C;  1XNR L;  4TUY F;  2W6Q A;  1DZ1 A;  1N32 L;  1XTC D;  3CC2 A;  4OO1 H;  3DUZ A;  1N33 Q;  3MEF A;  4DV5 H;  2WAQ B;  4BWG B;  3S2H H;  1WJJ A;  1X65 A;  4CBV A;  5M5W H;  1SYB A;  1VQG A;  2DPI A;  3MWE A;  4IR1 A;  4JI7 H;  2B2T A;  2EYF A;  2YCH A;  4DR4 H;  4Q5V A;  2Z9H A;  2EY1 A;  4DR6 Q;  3K5O A;  1I7N A;  1ZHQ A;  3TII A;  1SFO H;  2E2I A;  5CYU A;  1GD7 A;  3RNU A;  1B9N A;  1MBY A;  1L2F A;  1EYA A;  2UVU A;  3I4O A;  3ERS X;  3JC6 6;  4K0K Q;  1GSA A;  2ZJT A;  1PH4 A;  1S3O A;  1WCM H;  1I50 A;  4IN3 A;  5KND A;  1A8V A;  1WD0 A;  3UFX B;  1WI5 A;  1M8A A;  1A6X A;  2R6F A;  2W7P A;  3RBD A;  3PW4 A;  2JEI A;  1UEB A;  2F0J A;  3VR2 A;  1VQE A;  1X3Q A;  1CI3 M;  1L1O A;  4ZCK A;  4XXE A;  1XYI A;  5JPM C;  1K83 A;  4XYO A;  4PDB A;  1X32 A;  2ES2 A;  5I6W A;  3QIA A;  3LX0 A;  4ECV A;  3RAQ A;  2GPW A;  3CHB D;  1HR0 W;  4BXX G;  4ED7 A;  2F0L A;  1JDB B;  4A3J H;  1MIU A;  4RA8 A;  2NVQ B;  5C4X G;  2WYO A;  2QDB A;  4KD3 A;  1E4F T;  4A3I H;  4YCV A;  1KIX A;  4KI0 A;  1TT2 A;  2ZXR A;  2NB0 A;  1XDN A;  1B3Q A;  3D6C A;  2DUD A;  4O2B F;  4EFE A;  5CV6 A;  4MV1 A;  1TA8 A;  2XN9 C;  2UXB L;  2I8C A;  3OSP A;  1R9T A;  1FD7 D;  4EVO A;  2GA4 B;  3GD7 A;  1PFN A;  1I94 L;  3J7Z C;  5A2Q E;  1VMP A;  1FJG L;  2XCA A;  5CMD A;  2DJG C;  2GLT A;  2ASL A;  1OXT A;  1F77 A;  5IYB G;  4LF8 H;  3OIP A;  4EBC A;  1P8L A;  5KFT A;  2EXZ A;  3KJP A;  2JEA I;  5C4X B;  4NDX A;  3R2T A;  3LWE A;  5KT4 A;  1PK8 A;  4E4T A;  4A3C G;  3G6J B;  1F2Z A;  2ATW A;  4L5R C;  2B63 G;  4EBD A;  2OQK A;  2PW7 A;  5KEE A;  1X3P A;  4DUY L;  1EZ8 A;  4J9L A;  4LFC Q;  3T53 B;  1PH5 A;  3NK9 A;  3S1Q B;  2K05 A;  3TZU A;  1KLG D;  1KJI A;  2WE6 A;  2UUB Q;  2M00 A;  3HOW H;  4B3S L;  4G57 A;  2Q8R E;  5LL6 X;  1W96 A;  1JJ2 A;  1BCP C;  2D62 A;  3HOU H;  2UXC H;  1IOW A;  2R82 A;  1PYS B;  1R4P B;  4LF4 Q;  2NTS A;  2C22 A;  2CQA A;  1IYU A;  2KBN A;  1U4M A;  3V96 A;  3KK7 A;  1K28 A;  1BXT A;  3PUZ A;  3LML A;  2AWN A;  3H15 A;  2IP4 A;  2B63 B;  4JV5 H;  5FO9 B;  3F8N A;  2A6E C;  3ONA B;  1HH2 P;  1XNQ Q;  2EJG C;  4UCV A;  3PO3 H;  4LF6 L;  3V05 A;  3JSL A;  2UUC Q;  4YCW A;  3G8C A;  2F0U A;  5M3M G;  3Q0A A;  2WII B;  5M5X H;  3RZO H;  2UXD L;  3HG9 A;  2VQD A;  1Y8O B;  3VPC A;  5J22 A;  5J39 A;  4P72 A;  5BPH A;  3LWB A;  5C1P A;  5BN4 A;  4CJ1 B;  4DGZ A;  5LMU L;  1A63 A;  5KG7 A;  4DV4 Q;  2X6L A;  1BJT A;  1Q7Y C;  4RMF A;  2UUA H;  4RNN A;  1GHK A;  2R6G A;  1LAB A;  3G4S A;  5I2X A;  4R8I A;  3QZ8 A;  2F0G A;  3Q8R B;  1E2W A;  2PCF B;  3QWN A;  1J9O A;  2OXP A;  3HB9 A;  5T1I A;  1VS0 A;  4IRC A;  2R8K A;  4JI3 Q;  4RUA A;  5KFL A;  2K5Q A;  2F52 A; 
#chains in the Genus database with same CATH homology
 3HKZ E;  5C44 G;  4BA1 I;  2VQE L;  3BZK A;  4YWM A;  4HJ7 A;  3KYH C;  4NXM Q;  5IE8 A;  1XMO Q;  4HIO A;  1PH3 A;  1G6P A;  3UDG A;  3M4O H;  3UE0 A;  1XTD A;  1I50 H;  1E3P A;  3S1Q H;  2UXB Q;  3PUW A;  5IP7 H;  1GO3 E;  2I5M X;  1QUQ B;  2H5X A;  2OCE A;  3CW2 C;  1DGS A;  1E22 A;  5E7N A;  2AWO A;  4JI8 Q;  4A3K H;  1VQP A;  4GNX C;  4P74 A;  3EN2 A;  2QEX A;  4UP8 A;  2PMZ E;  3HOX H;  4LF5 Q;  4JBM A;  1YJW A;  1XNQ L;  1SN8 A;  3DM3 A;  4H02 A;  3PIP A;  2VUM G;  5BR8 L;  1PH8 A;  1TWF H;  1Q1E A;  1K83 H;  4HJ9 A;  1J5E Q;  3F1Z A;  4HJ8 A;  1K3R A;  2UUC L;  4BY1 G;  1PH1 A;  3PSI A;  1S72 A;  3HOZ H;  2K75 A;  1EQR A;  1HNZ L;  3PF4 A;  5JEA G;  4B3R Q;  4QY7 A;  1KRT A;  4LFA L;  1VCI A;  2HT1 A;  4JI6 Q;  4A3E H;  4WJ3 M;  1Q1B A;  5AJ3 Q;  2N78 A;  4EX5 A;  3PF5 A;  4LNQ A;  4DR2 Q;  3U58 A;  2JA8 H;  2AKW B;  4DV4 L;  2ZTD A;  1CSP A;  3I4N H;  4AH6 A;  3U4V A;  4DR3 L;  4GLV B;  2MQH A;  2K5H A;  2RHS B;  2VW9 A;  4GNX A;  3CD6 A;  1GKH A;  3HFZ B;  1JJC B;  3HOY G;  4X65 L;  4BY7 G;  4L5T A;  2Q2I A;  3OW2 A;  1R9T H;  4AQY L;  4ALP A;  4R1J A;  1VQK A;  2MO0 A;  1HR0 Q;  4JI4 Q;  1RL2 A;  5IP9 G;  4IFD G;  2ID0 A;  1YVC A;  4JI1 Q;  4DUZ L;  4JI3 L;  4DNI A;  2AHO B;  5ELO A;  2VQF Q;  2NN6 G;  3UE1 A;  4DPG A;  4GOP B;  2PQA A;  1VQD A;  2HIV A;  3G71 A;  1IBL Q;  1X3E A;  1OXX K;  4DK3 C;  4NXM L;  5IYC G;  1Y1V G;  4LFB Q;  4C3J H;  4XIG S;  1Z47 A;  2N49 A;  3BU2 A;  4O2D A;  2R93 G;  3NEM A;  4JI8 L;  5FJ8 G;  3VDY A;  1I5F A;  2GVA A;  1BBW A;  2WFW A;  1BBU A;  4LF5 L;  1EQQ A;  3I4M G;  3J81 i;  4A75 A;  1EWI A;  2UXD Q;  1L0W A;  1NTG A;  2JK8 A;  2IHE A;  1N36 Q;  1Q86 C;  4HIM A;  1J5E L;  1C7Y A;  4KHZ A;  2R7Z G;  4OO1 G;  4A4I A;  4B3R L;  4BA2 I;  1X3F A;  3I55 A;  2IX0 A;  1HZ9 A;  4JI6 L;  2K5N A;  5AJ3 L;  1IYJ B;  2NVT H;  4DR2 L;  4A3B G;  3J80 i;  1HNX Q;  1SRU A;  4POF A;  2BH8 A;  1B70 B;  4YY3 L;  3S17 H;  4A3F H;  1VQ4 A;  1EUJ A;  3D0F A;  1V9P A;  1PH7 A;  1PHJ A;  2YV5 A;  3NEN A;  1GVP A;  4DV5 Q;  4PZ7 A;  1Q46 A;  1UE6 A;  1VQF A;  3H0G H;  3K81 C;  5ELN A;  3U50 C;  1N34 L;  3S2D H;  4GKJ L;  5C3E H;  2IT1 A;  4JI4 L;  3ULL A;  4GNX B;  3CC7 A;  1QUQ A;  1CUK A;  1WCM G;  4GS3 A;  1GM5 A;  4DR4 Q;  2DGY A;  2OTJ A;  2D0O A;  5FLM H;  2AMC B;  2VQF L;  4EQ5 A;  4P73 A;  3F2C A;  1C9O A;  1IBL L;  5GAG C;  1EOV A;  2YTY A;  2K5V A;  2YU9 H;  4LFB L;  4IO9 A;  5IYD H;  2E2J H;  1KHI A;  1K8G A;  1YJ9 A;  3A5Z B;  3BJU A;  4BBR G;  4GOP C;  2GN5 A;  1YHQ A;  1M90 C;  2B29 A;  3ULJ A;  2NVQ H;  4A3J G;  1KQS A;  1K0R A;  2JE6 I;  1B7Y B;  3W5O A;  1PFS A;  1HNZ Q;  4A3I G;  3PUV A;  1YI2 A;  5LMN Q;  2B3G A;  4LFA Q;  4DV3 Q;  1KL9 A;  3BZC A;  3RZD H;  3S15 H;  4GN4 B;  2NVY H;  3TS2 A;  4A3M G;  3J7A 5;  4A93 G;  4AIM A;  1N9W A;  3TRE A;  3S14 H;  4R4C A;  4GLX A;  3T1H L;  4DR3 Q;  3M4P A;  1IBM Q;  1H95 A;  2R7D A;  3SGI A;  1HNX L;  1U5K A;  4JBW A;  4A3D H;  1KD1 C;  2UU9 Q;  4GOP A;  1E24 A;  2D0P A;  4BXX H;  1WOC A;  2Q2T A;  2JA5 H;  5C4J H;  1JB7 A;  5FLX c;  4A3G G;  1X6O A;  4LUO A;  4DUZ Q;  4DV5 L;  5C4X H;  1VQB A;  1OXU A;  1YJN A;  4DV2 Q;  4LW1 A;  1K73 C;  4JI7 L;  1VQO A;  3J81 c;  3RN2 A;  2MFI A;  2WAQ G;  3I2Z A;  4DR4 L;  1HJP A;  5HGQ A;  2ZJR A;  3CME A;  4DR7 L;  2JQO A;  1TWG H;  3E0E A;  3W1G A;  3K80 C;  4LF8 Q;  2PI2 E;  4FDB A;  1ASZ A;  2IHF A;  3FKI G;  3FP9 A;  4MNO A;  3A0J A;  3HOW G;  3PGZ A;  4B3M L;  2YTV A;  2VY3 A;  3J80 c;  4Y7N H;  1HZC A;  3HOV H;  3HOU G;  4DV7 Q;  2R92 H;  2NZH A;  3S16 H;  5IYB H;  4LF9 L;  3EBE A;  3JAM c;  2QA4 A;  1XMQ Q;  1D7Q A;  1EIF A;  2EIF A;  5LMN L;  2ZM6 Q;  1X54 A;  4DV3 L;  2HHH Q;  4A3C H;  2JA6 G;  2E8G A;  2B63 H;  2K50 A;  1Y1W H;  1VQ7 A;  4DV1 L;  1UE7 A;  1YEZ A;  4YY3 Q;  4JI2 Q;  3F2B A;  5M5Y H;  4GN5 A;  1IBM L;  2KHJ A;  3H3V I;  2NN6 I;  1TXY A;  4DR1 Q;  5K36 G;  3PO3 G;  1UWV A;  1OXS C;  3W1B A;  1PA6 A;  2WAQ E;  1N34 Q;  2UU9 L;  4A3L G;  4BBS H;  3CAM A;  4O0A A;  3CMA A;  2WB1 G;  4DV2 L;  3D31 A;  5IWA Q;  1CKO A;  3AYH B;  1PV4 A;  3TQY A;  4HJ5 A;  2ALY B;  1TWH H;  1KAW A;  3GTG H;  4OWX B;  1K9M C;  4AYB G;  1X9N A;  1RIP A;  1VQH A;  1EFW A;  4OXP A;  2YYZ A;  2KCT A;  4LF8 L;  5M3F H;  1QVF A;  3PO2 G;  4OO1 I;  3GTK H;  4ME3 A;  3IRB A;  4DAM A;  1YIJ A;  3GTQ H;  3CQZ H;  3A5U A;  4JOI C;  5M3M H;  1MJC A;  3J81 j;  3M85 A;  4DV7 L;  1Z9F A;  1Q81 C;  2UUA Q;  3PUX A;  1QZH A;  1HZB A;  1VQA A;  2FXQ A;  1JT8 A;  2HIX A;  1V43 A;  5IT9 c;  4WJ4 A;  2GVB A;  1XMQ L;  1LUZ A;  3AQQ A;  2VS1 A;  3K7A H;  3M3Y H;  1VQ6 A;  2ZM6 L;  2OQ0 A;  2HHH L;  4B3T Q;  1VQC A;  3T1H Q;  4DV6 Q;  2UXC L;  4NPS A;  5IP7 G;  1VQ9 A;  2MO1 A;  1A0I A;  1UE1 A;  5IYD G;  2ZJP A;  1PYB A;  1CKN B;  3KF8 B;  3RLO A;  3CCV A;  2PI2 A;  4A3K G;  2BH2 A;  3HOX G;  2VZA A;  4JI2 L;  4KLK A;  4PG3 A;  4A76 A;  3S1R H;  1KC8 C;  3ER0 A;  2A1A A;  2WB1 E;  2E5L Q;  3GTL H;  2BA1 A;  2KHI A;  3I56 A;  4DR1 L;  2JA7 H;  2HQL A;  4IPG A;  3KDF A;  4JOI A;  3ULP A;  4NXN Q;  5IY0 A;  3HOZ G;  4BY1 H;  4JI7 Q;  3F8T A;  1YIT A;  4AYB E;  4JV5 L;  4UY8 C;  5C44 H;  2YTX A;  4DR7 Q;  4A3E G;  3A74 A;  5IWA L;  4JG2 A;  3WWV A;  4OWT B;  2JA8 G;  4L5S A;  1G29 1;  3STB D;  3CC4 A;  1VQN A;  3PV0 A;  4LWC A;  3RLN A;  3CCM A;  3I4N G;  1TWC H;  2K52 A;  4B3M Q;  1XPU A;  5EAY A;  2I5H A;  5J3B A;  1XJV A;  3DLL A;  4YWL A;  2IX1 A;  3KOJ A;  4JYA L;  2ASB A;  3AFP A;  1TWA H;  2VUM H;  3B6Y A;  4LF9 Q;  4YHH Q;  1XNR Q;  5JJI A;  1BKB A;  1AE3 A;  4QIW E;  3Q8D A;  1A62 A;  1NMG A;  2E2I H;  3L2P A;  2UUA L;  1ASY A;  1I6H H;  1FGU A;  3CCQ A;  1Q12 A;  1K8A C;  1NMF A;  4DV1 Q;  1HNW Q;  4DKA C;  3K8A A;  3U4Z A;  4R4I A;  2N8N A;  1T9H A;  4JI5 Q;  4B3T L;  5HY6 A;  4DV6 L;  3AFQ A;  4OON A;  3ZJY C;  4L5Q A;  4TVA B;  1NBW A;  4JC0 A;  4R4Q A;  3HOY H;  1VQI A;  1WFQ A;  1X56 A;  4BY7 H;  1N8R C;  2E5L L;  4PZ6 A;  4C2M H;  3GTM H;  1JMC A;  3L0O A;  3E9H A;  5IP9 H;  1AH9 A;  1LM0 A;  5JJK A;  3CXC A;  4NXN L;  4IPD A;  1Y14 B;  1V1Q A;  5JEA J;  2I0Q A;  2V1C C;  1WYD A;  3NBH B;  1VQJ A;  4HID A;  4QGU A;  2BA0 A;  3KLW A;  4GLA C;  3H3V H;  3M7N A;  1E1T A;  2CCZ A;  5C0X G;  1OTC A;  3NEL A;  3TEH B;  3KDF B;  2XGT A;  1M1K C;  4POG A;  2Q2U A;  2KEN A;  4R4T A;  2IY5 B;  4J15 A;  1Y1V H;  2ZTC A;  5IYC H;  3K7U C;  2R93 H;  2QGQ A;  5FJ8 H;  2XTI A;  3KF6 A;  1LYL A;  4A3F G;  4NB3 A;  3GDE A;  4XTC S;  3T1Y Q;  2UUB L;  1KXL A;  1SLJ A;  3I4M H;  4IFD J;  2VL6 A;  3H0G G;  1VQM A;  3RLF A;  4MZ9 A;  5GAH C;  5C3E G;  4YHH L;  1XNR L;  1G51 A;  1QVC A;  4PZ8 A;  1CKN A;  3CP0 A;  1N32 L;  2ZTE A;  4MTN A;  3CC2 A;  2R7Z H;  3S1M H;  2L15 A;  3PUY A;  1N33 Q;  3PCO B;  5FLM G;  3MEF A;  2UXC Q;  1XPO A;  1P16 A;  1HNW L;  3S2H H;  1WJJ A;  1X65 A;  4C3I H;  4C3H H;  1VQG A;  5M5W H;  4A3B H;  1Q82 C;  4IFD I;  4KHP Q;  1L1O C;  4JI5 L;  3UDX A;  2LSS A;  1O7I A;  1I94 Q;  3M9B A;  4X64 L;  1S40 A;  2C35 B;  1D8L A;  1JE5 A;  1FJG Q;  4DR6 Q;  1SFO H;  3CCS A;  2R7F A;  1JJG A;  1GD7 A;  3CPW A;  3RNU A;  2NVX H;  1L2F A;  3OYY A;  4JBJ A;  1YHA A;  3I4O A;  3ERS X;  3JC6 6;  4JI0 Q;  4IOA A;  4YCU A;  4K0K Q;  4JV5 Q;  3CCU A;  1PH4 A;  1XPR A;  1QZG A;  4GKK Q;  1S3O A;  1IBK L;  1WCM H;  1NE3 A;  3HKS A;  4GN3 B;  2MNA A;  1A8V A;  2CQO A;  5GAE C;  1IZ6 A;  1KRS A;  1WI5 A;  1VQ5 A;  4OWW B;  2EXD A;  4P75 A;  4DUY Q;  2LXJ A;  1UEB A;  4X62 L;  3G6E A;  4IOC A;  3RN5 A;  2OTL A;  1PH9 A;  4RG1 A;  3EIV A;  2RCN A;  1VQE A;  3ICE A;  1VQ8 A;  1L1O A;  4JYA Q;  4TQU S;  1CKM A;  4X66 Q;  4B3S Q;  2VNU D;  4IJL A;  3OTO L;  2ES2 A;  2Q2H A;  4A3D G;  1E1O A;  3FHW A;  4BBR H;  3I7F A;  3T1Y L;  1HR0 W;  3G48 A;  4BXX G;  3K0X A;  2JA5 G;  4IJH A;  4A3J H;  1PH2 A;  4OX9 Q;  1MIU A;  5C4X G;  2JA9 A;  2JEB I;  5GQO A;  4A3I H;  3KF6 B;  4YCV A;  2Z0S A;  1BVS A;  1YNX A;  1KIX A;  2EQS A;  3CCJ A;  4KI0 A;  4LF4 L;  1SRO A;  4A3M H;  1B8A A;  1N33 L;  4A93 H;  2PNH A;  1XMO L;  2DUD A;  3KFU A;  2UXB L;  2Z6K C;  3CCR A;  3TS0 A;  3KJO A;  4LF6 Q;  4KHP L;  4LF7 Q;  3GD7 A;  3CCL A;  4LUV A;  3S24 A;  1W3S A;  3J7Z C;  1I94 L;  2F4V Q;  4DR6 L;  4UP9 A;  1FJG L;  3HOV G;  3UDI A;  2R92 G;  3GTP H;  1OXT A;  4A3G H;  4JCV E;  5IYB G;  1MKH A;  4JBK A;  2LXK A;  1P8L A;  4UP7 A;  1LTL A;  3KJP A;  4JI0 L;  4K0K L;  1EYG A;  2JEA I;  4GKK L;  1X3G A;  3F2D A;  5LMU Q;  4A3C G;  1EIY B;  1J6Q A;  3CF5 A;  2Y0S G;  2E2H H;  3E9I A;  4L5R C;  2ATW A;  1Y1W G;  2OQK A;  2B63 G;  1C0A A;  1PVO A;  4DUY L;  1NJI C;  1SMX A;  3LGJ A;  1PH5 A;  1X55 A;  4LFC Q;  2Z6K A;  3FKI H;  2RF4 A;  5H1S E;  2UUB Q;  4X66 L;  3HOW H;  1IL2 A;  4B3S L;  3JAM i;  2RHQ B;  3GTJ H;  1PH6 A;  1JJ2 A;  2D62 A;  3HOU H;  1YZ6 A;  3UDF A;  4DR5 Q;  1PYS B;  4DV0 Q;  4PMW A;  4LF4 Q;  4BBS G;  4UPA A;  1L1O B;  2K14 A;  4GKJ Q;  3STB C;  4QL5 A;  1HR0 L;  4OX9 L;  1N32 Q;  1HZA A;  2A19 A;  4LUZ A;  3TRZ A;  4DK6 C;  2KBN A;  2VQE Q;  1Q8K A;  2OWO A;  4JI1 L;  5C0X J;  2CWA A;  3PUZ A;  2K4K A;  2JA6 H;  2WP8 J;  2AWN A;  1CSQ A;  5GRO A;  1FL0 A;  1U0L A;  3H15 A;  4X6A H;  5GAD C;  5JJL A;  2CFM A;  3HKZ G;  4X64 Q;  1UE5 A;  4QJF A;  5M3F G;  2PQA B;  1HH2 P;  1XNQ Q;  4Y52 H;  2JJQ A;  3GO5 A;  3RR5 A;  1E7Z A;  5BR8 Q;  5C0X I;  4LF7 L;  4LF6 L;  3PO3 H;  4QQB X;  2UUC Q;  2KCM A;  4YCW A;  2CKZ B;  1AE2 A;  5DLQ E;  1W2B A;  5M3M G;  2F4V L;  1YHB A;  3PIO A;  4HJA A;  3GTO H;  4A3L H;  1I3Q H;  2Y0S E;  4R4O A;  5M5X H;  5LMN W;  1IBK Q;  3RZO H;  3AEV A;  4IPH A;  2UXD L;  1N36 L;  1QVG A;  4P72 A;  3CPF A;  1SR3 A;  2F3I A;  3M4Q A;  4X62 Q;  1FVI A;  5LMU L;  1A63 A;  4DV4 Q;  4DAY B;  1NY4 A;  1OXV A;  1Q7Y C;  4P71 A;  4RMF A;  3S1N H;  1MJE A;  3OTO Q;  2R6G A;  3CCE A;  1IXR A;  4LFC L;  4APV A;  4X65 Q;  3G4S A;  3PO2 H;  4YWK A;  2CWP A;  3L7Z C;  4AQY Q;  2ZJQ A;  2A8V A;  2JA7 G;  3MXN B;  2I5L X;  4HIK A;  2NZO A;  1YBY A;  4IPC A;  1VS0 A;  4DR5 L;  4JI3 Q;  1SE8 A;  4DV0 L;  2F52 A;  2N3S A;  1VQL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...