4A3MG

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid and soaked with ampcpp
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 29
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4a3mG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4a3mG01
4DKAC 5GROA 4IPDA 4NB3A 2RF4A 1QZHA 1X56A 4JOIA 2ALYB 4KHPL 3I4NH 2MO1A 2R93G 1PH4A 1UE5A 3S24A 1R9TH 4BA1I 1WCMG 4HJ5A 2K4KA 4HJ9A 5IP7G 4A3GG 1HR0L 2JA5G 1BBUA 1GKHA 2IHEA 4UY8C 2OTLA 4DV6Q 1H95A 3UE1A 4HIOA 4B3TL 3K7UC 1HZBA 1WFQA 1KIXA 4JI6L 3FHWA 4JI5Q 2R92H 4JV5Q 1V9PA 1IBMQ 2Z6KA 3HKSA 4BY7G 4GLAC 5C4XG 3L7ZC 3AFPA 3RZOH 4JI3L 3M4PA 1Y1WH 1K3RA 1X55A 1VQ4A 2CWPA 3TS2A 4DK3C 3J81i 3PO2H 1CUKA 1YI2A 1IXRA 1YJNA 3F8TA 1L1OB 2YV5A 3PGZA 1JJGA 1JJ2A 1BBWA 3J80c 2Y0SG 4PG3A 4DR3Q 4H02A 4X65Q 2D0OA 1SE8A 3RNUA 4A3KH 2JA6H 4B3RL 1X65A 1PYBA 3Q8DA 5IYBG 5IP9G 2UXCQ 1G6PA 2D62A 1HNZL 2JA7G 3CCQA 3OTOL 4QL5A 1PH7A 1XMOQ 2JEAI 4LF5L 1XNRQ 2WB1E 1PH8A 3I4OA 2E5LQ 3GTOH 3CPWA 2K14A 2KBNA 1E22A 4NXNQ 5JJIA 5BR8Q 1UEBA 2LSSA 4GN5A 3ULLA 1HJPA 1QUQA 4DR1Q 1ASZA 4L5SA 5LMUL 3GO5A 4PZ7A 2JA9A 4MTNA 3A5UA 4LNQA 4GS3A 5H1SE 1VQPA 1IZ6A 3K0XA 1TWAH 4B3TQ 3S1NH 4LFBL 4JC0A 5JJLA 3I4MG 3S1MH 4XTCS 3A0JA 4LF7L 4OWTB 1EQRA 5JEAG 5C3EH 1M90C 4OX9L 3I7FA 2UXBQ 4LW1A 4P71A 5ELOA 1N33Q 2EXDA 4IPCA 4DV2L 3PF5A 3F1ZA 3GD7A 5GQOA 2R7ZG 1KXLA 1LM0A 2VS1A 3KDFB 2UUCQ 2VZAA 3UDXA 1G291 4DV5L 4LF8L 4A3CG 1VQAA 1VQNA 2MNAA 4B3MQ 3A5ZB 1UWVA 4AH6A 2OCEA 4Y52H 4YHHL 2LXJA 3NEMA 2HHHL 2EIFA 2PI2E 3E9HA 3RZDH 4IPGA 4IOCA 4BY1G 3M3YH 5HGQA 3OTOQ 1VQGA 1QVGA 4POGA 2IX0A 4JI2L 4JCVE 2JEBI 3HOXG 4LF5Q 3J81c 4GNXC 1EOVA 3OW2A 1SRUA 1IBKQ 3L0OA 2IX1A 4GKKL 5LMNW 1VQMA 2F3IA 4A3LG 1BKBA 3CP0A 2PMZE 3W1GA 3HKZG 5M3MH 2B63G 1G51A 1VQIA 4A4IA 1TWHH 4LF4L 2A1AA 1RL2A 4LFAQ 4A75A 2ZTCA 2HT1A 4DV6L 1HZAA 3EN2A 5GADC 3CCRA 3E9IA 1HZ9A 4MNOA 3FP9A 4OXPA 1FL0A 3PUXA 4JI5L 4JV5L 4PZ6A 5C0XG 4OONA 3KOJA 1PFSA 1Z47A 1NJIC 4DV0Q 1VQKA 3TRZA 3GTGH 1E1OA 1PHJA 3S1RH 3PIPA 4OO1G 4NPSA 1XJVA 1W3SA 4A3JG 3S16H 3HOUG 4A3MG 2WP8J 4IJHA 3DLLA 1AE2A 1HR0W 3ULJA 1L1OC 3HOVH 2IHFA 4YHHQ 1C0AA 4DR3L 1WCMH 4IFDG 4X65L 3CCMA 3GTMH 2WAQE 2RHQB 4A3GH 5IYCH 5J3BA 3JAMi 3CCJA 4YWLA 3PO3G 3HOYG 4QQBX 5IE8A 2UXCL 4IO9A 1XPUA 3KFUA 3BJUA 2GVBA 4A3DH 2LXKA 1Q12A 3M7NA 4GKKQ 1XNRL 4O2DA 2E5LL 4BY7H 3CPFA 4A3BH 1B7YB 1WI5A 2ID0A 1SN8A 3CCLA 3J7A5 2UU9Q 4JI4Q 4NXNL 5C4XH 3PUZA 4JBWA 4UP7A 2UUBL 2IY5B 5M3FH 1X9NA 3HOWG 2BA1A 5BR8L 3G48A 1PH9A 4DR1L 4LF4Q 3H0GG 3A74A 1B70B 3ZJYC 4UP9A 3F2CA 3LGJA 3T1YQ 1CKOA 2OQ0A 3PV0A 1YJ9A 1X3GA 2CKZB 3HOZG 3M4QA 2YTXA 3K80C 3KF6B 4OO1I 1YITA 4QJFA 4TVAB 5HY6A 1VCIA 1P8LA 1HNWL 5M5YH 1PH1A 4DV3Q 4DV4Q 2GVAA 2ES2A 2HIXA 3M9BA 4TQUS 5AJ3Q 2JA7H 1J5EL 3AQQA 2UXBL 4KI0A 4IFDI 1N33L 2JA8G 2I5MX 5IYDH 3CC4A 1YHBA 2Q2HA 5GAHC 2N8NA 1WYDA 3PSIA 2NZOA 2NVTH 4DV7Q 2UUCL 3PUVA 2YTYA 4JBJA 1VQ6A 4APVA 4UP8A 4YY3Q 5GAGC 2NVXH 4B3ML 4HIDA 2JE6I 2N3SA 2RCNA 2L15A 4GN4B 2ZJQA 1YEZA 2HIVA 3PF4A 1O7IA 5C44G 1E24A 3F2DA 2Y0SE 4C3JH 1Q46A 3UDFA 5FLXc 4DR4Q 1N32Q 3I4MH 1AH9A 4X62Q 1A62A 4GNXA 1Y1VH 3D31A 1Z9FA 3U4ZA 2JQOA 3GTLH 4A93G 1IBKL 2R6GA 1N36Q 4FDBA 3S15H 3EIVA 4IPHA 2UUBQ 3EBEA 1GVPA 4R4IA 2MQHA 2AHOB 3FKIG 5JEAJ 2B29A 4AQYQ 3CW2C 1QVFA 3JAMc 1K9MC 1OXVA 2PQAB 4BBSH 4B3SQ 2VUMG 1RIPA 4DK6C 2R92G 1MKHA 4BXXG 2FXQA 4LFAL 4LWCA 4GOPB 2VQEQ 4JYAL 1U5KA 1HNWQ 4LF6Q 3CQZH 4KHZA 4POFA 3DM3A 1IL2A 1Y1WG 2Q2IA 4DNIA 4BY1H 3H15A 4X64Q 3IRBA 2AWNA 2AMCB 3PIOA 4DV0L 1J5EQ 3JC66 3KF8B 1UE1A 4EQ5A 1P16A 3KLWA 5DLQE 1Q7YC 2QGQA 3HOXH 3H3VI 4JOIC 3CF5A 2F4VQ 2AWOA 4DR2L 4DR6Q 1GO3E 4R4CA 2DUDA 5E7NA 2Q2TA 3S2HH 2B3GA 2NN6I 4IOAA 3B6YA 4A3LH 1Q1EA 1L1OA 2KENA 1LTLA 1AE3A 2KCTA 1KHIA 1U0LA 3CCSA 1CKNB 3U4VA 4AYBG 4ALPA 1S40A 1M1KC 2UUAQ 2OTJA 1S72A 1CSPA 3KJPA 1NMFA 3G6EA 4C2MH 2KHIA 3GTQH 4DV1Q 3RLFA 1PH3A 4DAYB 1VQBA 1MJEA 1MJCA 2D0PA 3G4SA 1KD1C 1Q86C 4JBMA 3I2ZA 2OQKA 1EIFA 1TWFH 2UU9L 1HNXQ 4JI4L 1N9WA 3GTKH 4PZ8A 5IT9c 4YWKA 3PCOB 3STBD 4AIMA 2Q2UA 4UPAA 2N78A 2R7FA 4A3IH 3RN5A 3T1YL 4A3JH 1QZGA 3CC2A 2ZJPA 1VQ9A 2ASBA 3HKZE 1OXTA 4IJLA 4A3MH 4LFCQ 1PYSB 5C3EG 2NVYH 4JYAQ 1YVCA 3TREA 5FLMH 4GKJQ 4DV3L 1ASYA 4DV4L 4X66Q 2XTIA 3PO3H 4HIMA 2Z0SA 2E2IH 4GLVB 3PUYA 2V1CC 2ZTDA 4A76A 4IFDJ 5AJ3L 4A3EH 1YJWA 1XMQQ 1FJGQ 3K7AH 2I0QA 1UE7A 4DR2Q 1V43A 1X3FA 1OXSC 1FVIA 4BBRG 1NMGA 5IWAQ 1Q82C 1Q1BA 1T9HA 4DV7L 3KDFA 2R93H 4NXMQ 3HFZB 4X6AH 1XNQQ 1VQDA 4YY3L 1A8VA 1V1QA 1WOCA 1N8RC 5IP7H 4YCUA 4LF9Q 1IBLQ 2JA5H 3S17H 5FJ8G 1TWGH 1D7QA 1CSQA 1TXYA 2K5HA 3CAMA 3ULPA 1EYGA 2K75A 4JI1Q 4DR4L 1N32L 5M5WH 1K83H 4X62L 2NVQH 4DR7Q 5K36G 2VW9A 2BA0A 4P72A 2EQSA 5M3MG 1XPOA 2E2HH 1N36L 2CQOA 4P75A 1I5FA 1YZ6A 3CXCA 1VQ5A 3W1BA 3CCEA 4A3FG 1VQ8A 4DUZQ 1I3QH 2R7DA 1EWIA 3F2BA 1X3EA 3CMAA 2DGYA 5C0XI 4DUYQ 4DR5Q 4AQYL 4JI8Q 2YU9H 3W5OA 3WWVA 1HZCA 5ELNA 1NBWA 1OXXK 4B3SL 4YWMA 3BU2A 4JI0L 1YIJA 1NTGA 2VQEL 4GOPC 2PI2A 2UXDQ 4LF6L 3H3VH 1YBYA 1JMCA 3MXNB 5C44H 1K8AC 1X6OA 5IYBH 1KRTA 3J81j 4JBKA 5IP9H 2GN5A 1LUZA 4X64L 3VDYA 4O0AA 4HJ7A 4R4QA 2NZHA 2PNHA 4R4TA 2JK8A 2CFMA 1K8GA 2F4VL 3S1QH 2CWAA 1QUQB 1N34Q 3D0FA 1I94Q 4QIWE 2KCMA 3HOVG 4A93H 4DR6L 4P73A 3KJOA 1PVOA 5IYCG 3UDIA 3FKIH 1XPRA 1K73C 2VNUD 4R1JA 1NY4A 1SR3A 2C35B 2HQLA 2UUAL 1D8LA 4LUZA 3RLNA 5EAYA 1SROA 3RN2A 4A3DG 2VUMH 4BXXH 1PH6A 1E1TA 4DV1L 4A3BG 2AKWB 3CD6A 3CC7A 1VQEA 4RMFA 3I4NG 3GTJH 2ZM6Q 5LMNQ 2E8GA 5M3FG 4L5RC 1BVSA 1LYLA 1EFWA 1VQCA 4K0KQ 1OTCA 3GDEA 3BZKA 2I5LX 4LUOA 5GAEC 1HNXL 1NE3A 1KL9A 1L2FA 1E7ZA 3T1HL 1FGUA 4OWWB 3K8AA 2R7ZH 4J15A 4JI0Q 4LFCL 4JG2A 2XGTA 3CCUA 4A3CH 1I6HH 2WB1G 2A8VA 2VY3A 3KF6A 3ERSX 4JI7Q 1KRSA 4GKJL 3U50C 2K50A 4KLKA 4X66L 1HH2P 5IYDG 1JT8A 2KHJA 3E0EA 1OXUA 3PO2G 1UE6A 1XMQL 4KHPQ 1FJGL 2BH8A 2QA4A 2WFWA 3AYHB 1YHQA 4BA2I 1VQJA 2H5XA 5IWAL 4YCWA 1HR0Q 1VQFA 1JE5A 2VL6A 4A3KG 2JA6G 1VQ7A 2B63H 4NXML 1XTDA 4YCVA 1XNQL 4DPGA 4Y7NH 2ZTEA 4RG1A 4C3HH 4LF9L 4QY7A 4JI6Q 2IT1A 1IBLL 1Y1VG 3AFQA 1WJJA 4MZ9A 2Z6KC 4GLXA 4AYBE 4JI1L 1PA6A 1EQQA 1YNXA 1PH5A 4JI3Q 4DR7L 3UE0A 1GD7A 3KYHC 1K0RA 1B8AA 2VQFL 3AEVA 2F52A 3GTPH 2K52A 3UDGA 2N49A 4HJ8A 4BBSG 4R4OA 3OYYA 5C0XJ 2MFIA 4C3IH 4DUZL 3T1HQ 1SLJA 3ER0A 2YTVA 4DUYL 4DR5L 4JI8L 1E3PA 3J7ZC 4BBRH 2PQAA 2ZJRA 1GM5A 3HOUH 3PUWA 1EIYB 2K5NA 2BH2A 4LUVA 4L5QA 3NBHB 3STBC 4B3RQ 1SFOH 4GOPA 1JB7A 1HNZQ 2UXDL 4WJ4A 4PMWA 2RHSB 1TWCH 3M4OH 5FJ8H 5C4JH 3HOYH 1YHAA 2ATWA 4EX5A 4QGUA 3G71A 3SGIA 4XIGS 2MO0A 1DGSA 4HJAA 1SMXA 1I94L 2OWOA 1N34L 3I56A 4ME3A 5LMUQ 1JJCB 2NN6G 4A3FH 3I55A 1J6QA 3HOWH 3TQYA 5M5XH 3M85A 3L2PA 2E2JH 3H0GH 2CCZA 4LFBQ 1CKNA 1XMOL 1A0IA 3TEHB 3J80i 1MIUA 4LF7Q 1PH2A 2QEXA 1VS0A 3HOZH 3S2DH 4L5TA 1IBML 1PV4A 3RR5A 1KQSA 1EUJA 4OX9Q 4DAMA 1VQLA 2I5HA 2A19A 1CKMA 1X54A 5JJKA 1Y14B 4GN3B 1L0WA 5IY0A 2ZM6L 2VQFQ 5LMNL 1VQHA 4K0KL 4DV2Q 1S3OA 3TS0A 4A3IG 4OWXB 3CCVA 1C9OA 2WAQG 4P74A 4DV5Q 1W2BA 1KAWA 1Q8KA 4LF8Q 2JA8H 1I50H 1QVCA 2HHHQ 3NELA 2YYZA 4WJ3M 5FLMG 1C7YA 2JJQA 3CMEA 3S14H 1VQOA 3RLOA 4JI7L 1A63A 3BZCA 4JI2Q 1KC8C 4A3EG 4HIKA 3MEFA 4GNXB 3U58A 1Q81C 3ICEA 3NENA 1IYJB 3K81C 2K5VA
chains in the Genus database with same CATH superfamily
3DXJC 4IPDA 4AYBA 4ZKBB 1QZHA 5FD5A 3KHHA 4F4ZA 5T1IA 2VA3A 2MO1A 4B9XA 1RDPD 2NBFA 4TV9F 1E4GT 4BA1I 1WCMG 2K4KA 4HJ9A 4A3GG 3VPCA 2JA5G 4UY8C 1GKHA 2IHEA 3NE5B 1TWHB 2A6ED 1S10A 3T13A 3K7UC 3KBGA 1HZBA 1WFQA 4UCVA 4BWSC 1Y8NB 1AP0A 3HKSA 4BY7G 4KKUA 2IA6A 4GLAC 3EQLC 1VAJA 1Q90A 4JI3L 3M4PA 2JEGA 4EQNA 4QB4A 2RGVA 4JW0A 4KY7A 4RCNA 3TS2A 4DK3C 1MSGA 3GTGB 1O7LA 4ZQ3A 1IXRA 1YJNA 1EQTA 1D5ZC 2I46A 3PGZA 2RVLA 4EVOA 3J80c 2Y0SG 1GSHA 1EU3A 4X65Q 2PN1A 5A2QW 1QCBD 3KBXA 4K2LA 1PYBA 2UXCQ 1WCMB 1ESFA 2R6FA 4YR0A 4NXNH 4A3GB 2JA7G 3CCQA 1ZXTA 2D9UA 3OMCA 2KSWA 3RB6A 5IT9W 4NXNQ 3HBLA 2C2RA 4BY7B 1ASZA 1ICWA 1QUQA 3ULLA 4DR1Q 4S3SA 1MBYA 4L5SA 1W93A 2JA9A 5G3LF 1I3QB 4R9WA 3S1NH 3NK9A 2B39A 3G6XA 4LF7L 4OWTB 1BO0A 3BVZA 1H9MA 3H0GA 3OPOA 1PFBA 2Y0SB 5KFCA 1RK5A 3ETJA 4LH7A 4OX9L 4F87A 1X32A 4LW1A 3BJYA 1ZHQA 2EXDA 5KX5F 3PW2A 5C3WA 2JA7B 2R7ZG 5GQOA 1A2TA 1HNZH 4DV5L 1VQAA 1VQNA 2MNAA 4O3OA 3A5ZB 3NEMA 2PI2E 3P1HA 2PQEA 4IPGA 3M3YH 2IL8A 5LHY1 2EYJA 5HGQA 2NVXB 1IOWA 5E3FA 1VQGA 3NTIA 4POGA 4JI2L 2NTTA 4NKLA 3HOXG 3J81c 5JVH3 3GIIA 1SRUA 3L0OA 4ULLA 1VQMA 4A3LG 3CP0A 5L1LA 2F0VA 1UC8A 3W1GA 5KFPA 2B63G 1G51A 1DOMA 1SYEA 2BQRA 3WO1A 2A1AA 3IAYA 1K28A 2FMAA 2E2DC 1HZAA 2CW0D 3EN2A 5GADC 3KAJA 2F0HA 4MNOA 4BBSB 4RUCA 4OXPA 3WDNA 3PUXA 2YRXA 2IWHA 1A2UA 1KDCA 4OONA 4QF4A 4TUYF 1PFSA 1WTOA 5I2XA 2X6GA 1C30A 4JPBW 2ZXPA 3PIPA 1LT6D 2XD4A 1W3SA 4A3JG 3S16H 1KJ8A 3HG9A 3HOXB 1SE4A 4IJHA 5KFMA 2IHFA 5KFBA 1IW7C 4GKKH 2RHQB 4O4IF 5ELBA 4I7HA 1RTOA 2B63B 1AZQA 3R5FA 3RTXA 3KFUA 2A5HA 1EZ8A 2LXKA 3GTQB 4GKKQ 1QJOA 2E5LL 3D6CA 3DUZA 4M7EA 3CCLA 3J7A5 4JI4Q 1JKJB 4JBWA 4UP7A 2N55A 4OGQC 5M3FH 1X9NA 5BPHA 3GTOA 4JI5H 3NWSA 1SEIA 3A74A 1LTTD 4OELB 1JDBB 3F2CA 2WE6A 3MR3A 1CKOA 2OQ0A 3GTKB 5KFQA 5IGBA 1B4OA 3TZDA 4A3IB 3K80C 4A3JB 2J6TA 1RKNA 3GV3A 2EYOA 4QJFA 4TVAB 1LO5D 3TZUA 3ND8A 5M5YH 4I55F 1UUPA 4RH6A 4DV3Q 1T36A 2NVYB 1GUGA 2I07B 1HHVA 1V1PA 2N88A 4RKLA 4O1NA 4I7ZC 1RJPA 1Z7TA 3M4IA 1N33L 4KY6A 1GUNA 2I5MX 5CA1F 5EDWA 3I8ZA 3C1EA 1WYDA 1O80A 2YTYA 4APVA 3BDOA 4B3ML 4DXGA 1Y69U 4YIJA 3PF4A 4CKBA 3F2DA 3VR4A 3KHLA 3UFXB 5FLXc 2NTSA 3I4MH 5BR8H 1DOKA 2B8FA 2JSOA 2R85A 1A62A 1Z9FA 4AQYH 2JQOA 4J9SA 3ERQA 3VYRA 1CZGA 1SNCA 1IBKL 2YZMA 4OL7A 4FDBA 3S15H 3FRPB 5KFKA 1EU4A 4HNVA 5JEAJ 5KFZA 4LF6H 4UCRA 4AQYQ 3CW2C 4QIWB 3VR3A 1EOTA 4B3SQ 4FF3A 4PWQA 1BCPB 1RIPA 4DK6C 4TRDA 1J5EH 1O7ZA 1U5KA 4F4YA 4LF6Q 3R23A 2BE5D 4DNIA 2RDJA 4GC6A 3IKJA 3IRBA 2AWNA 2K28A 4X64Q 2EDGA 3EPGA 1J5EQ 3RGZA 3L9AX 1Q7YC 3VR6A 4R4CA 5E7NA 2B3GA 4H13C 4ZQIA 3I4LA 4Q5VA 1FKAH 2HUGA 1L1OA 1EZ6A 5KKNB 1KHIA 3SK4A 5IGDA 2AQ4A 4G3IA 3V6JA 3MWYW 1VBGA 4OIKA 1K0SA 1XDNA 1C4QA 4EFBA 1HPCA 2R8GA 2R3ZA 4J9QA 3GTMA 2L5TA 5CC4A 1VQBA 4YQWA 3RBEA 2LFNA 2RCFA 5BPFA 5HGTA 4QW9A 4RAYA 1EIFA 1IYUA 2UU9L 3FDTA 5KG3A 1N9WA 4DL4A 2MHVA 2MPMA 3HEJA 4PZ8A 3VR5A 3STBD 2V4RA 2F0MA 1CS0A 3N40P 2R7FA 4JV2A 1QZGA 3T1YL 3M4YA 3BA8A 3K5HA 3SHLA 3VYTA 1VQ9A 2ASBA 2LKVA 5A35A 4A3MH 2NU8B 1S03G 2Z4IA 1AUXA 5E4WC 3RB3A 3JAME 4IFDH 1K8OA 4RWSC 2F0LA 3UI2A 1LTSD 4UCSA 2NU7B 4X66Q 1EIGA 5IWAH 5JVLA 2Z0SA 2E2IH 1JE4A 4GLVB 2V1CC 5DEHA 4A76A 1YJWA 1FNUA 2I0QA 3C46A 3GQBA 3G6YA 3BVMA 1NMGA 5IWAQ 4J9MA 2EYLA 2R93H 1LT5D 3BZDB 2B2WC 1DZ1A 1WR2A 4C1NI 3J7YW 1N8RC 4TKOB 2F0EA 3DHQA 2A69D 5NUCA 5FJ8G 1D7QA 1EYGA 1L0XB 1L2ZA 3ULPA 2NUCA 1M6VA 3U9SA 4UCOA 1Q8IA 2J0TD 4DR7Q 4RGNA 4DR5H 4JI8H 2EE1A 1XPOA 3HXLA 4B9WA 2E2HH 2AQ3B 2CQOA 4EBEA 4TQRA 1Y1VA 3CCEA 4A3FG 3RFCA 2AU0A 3GTLA 1CT1D 4ZRZA 1S5FD 3ETHA 3GIQA 1EWIA 1DXMA 4U6PA 3OSPA 2DGYA 4DR5Q 3T56B 4JI8Q 3WWVA 1I4RA 4C1NK 4EFEA 4YWMA 5KT4A 4RGTA 4RB1A 1BCPC 4JI0L 3LNNA 1YIJA 1PRTD 1NTGA 1PMRA 3WOFA 2Z8LA 3H3VH 2K1BA 2Q8TA 3G7LA 1JMCA 2AGPA 5C44H 4IHJF 4JBKA 5IP9H 1PTOH 2GN5A 1W96A 5CA0F 5I47A 2B2VC 2NZHA 3M4OB 1B3AA 2J9GA 5CV4A 5E4XA 2F4VL 3S1QH 2CWAA 4DR6L 1II3A 2KCMA 2F4IA 4P73A 2DJFC 1WSCA 3G6JB 3T51B 3KJOA 3OSNA 1M0TA 4X62H 5GONF 4XQQA 1NCVA 4R1JA 3HGBA 2C35B 2UUAL 5EWEA 5COYA 2ASLA 4A3FB 1SROA 3Q23A 3R5HA 3CHBD 4XYMB 4DV1L 1WTXA 1KJIA 3RJ0A 1WTVA 5M3FG 1LT3D 1TIID 1BVSA 3N42B 5M9OA 3BZKA 2I5LX 1R4PB 1HNXL 2D5DA 3T1HL 2W9CA 4OWWB 4P2CB 4U673 3KHGA 1PYWD 2V9WA 4O4LF 4JV0A 3MR6A 2FMCA 3FPPA 4X3UA 2CVRA 3MWMA 3OHXC 4JI7Q 4RNOA 3KK7A 2VQDA 1D1KA 3ORQA 2QW7A 3OHBA 2HDMA 3E0EA 3SE0A 3TP8A 3AB9A 1FJGL 4RU9A 1YHQA 2H5XA 5KFOA 2O5IC 1KLGD 3MR5A 1ENFA 3BQ0A 1RF2D 2PW5A 4KJNA 5M3FB 2JA6G 5A2QL 4NXML 1XTDA 3NTHA 5T1GA 5EPLA 2XNAC 4KTAA 4MZ9A 4GLXA 4G7OC 5FO8B 1PA6A 1EQQA 3U9TA 1TWGA 5CV5A 4KKSA 1GD7A 1Z2OX 1STYA 5IT9L 1B8AA 3AEVA 3Q8PB 1K83A 4CGYB 2N49A 4B3RH 4R4OA 3OYYA 1KC7A 5C0XJ 2ENBA 2ASDA 1F9SA 5EKLA 4RUAA 4DUYL 2YTVA 4RB0A 2QCPX 1GM5A 4BBRH 4YP3A 3J7AV 4B3RQ 2YU9A 3I90A 4GOPA 4N9TA 5DAUA 4WJ4A 2JA6B 4UAIA 4ZKCB 1T5XD 4O3NA 4EX5A 1CM9A 1DOLA 1DGSA 1Y8PB 5JAVA 4HJAA 1F2MA 2TMPA 4KMUC 2OWOA 1N34L 3VA7A 3D4RA 1JJCB 1DIKA 3GV8B 2YL2A 4RFBA 3RV3A 3H0GH 4RHSA 1CKNA 3PIO3 2XGQA 3J80i 1EUDB 4YAJB 3FKIA 3HOZH 3S2DH 3LX0A 4L5TA 3VA5A 2VB3X 3K58A 1KQSA 1EUJA 1HFGA 5C1PA 4DK0A 3TQ1A 3MXGA 2JYOA 1VQHA 4DV2Q 2W57A 4OWXB 3DM1A 2WAQG 1S5BD 1W2BA 1KAWA 2UXDH 3M9NB 1FYCA 2KEDA 3V6HA 2BR0A 3NQTA 4HYKA 3S14H 2CH4A 3G6VA 5EZYF 2C2DA 1BDOA 3OW7A 3RZDB 3RLOA 1KNEA 1I94H 2FLPA 2A68D 2HGSA 4N8X1 1Q81C 3NENA 1S5ED 4JG2A 4DKAC 5GROA 2NU9B 1WVLA 2KJXA 3LWUA 4FBTA 4JOIA 1TT2A 4KHPL 3NXWA 2R93G 5C3XA 4BS9A 1IBMH 5M3MB 3SEBA 4DV6Q 1H95A 2F0WA 4HIOA 3TIGA 5D14A 2ZM6H 5CV8A 5LMNH 3SR1A 1KIXA 3NGDA 3D3RA 2WAQB 4C5AA 1IBMQ 4QWAA 2Z6KA 4XX0B 1HUMA 3KLSA 5LYJF 5KT5A 3P7JA 5L37A 5C4XG 1VBHA 3L7ZC 4J0MA 3TDQA 3AFPA 1ZKOA 1B6RA 5EPKA 4HCSA 2CWPA 4BWGB 1HFNA 3J81i 3FMCA 3S1RB 4E6IA 1JJGA 2B2TC 4DR3Q 4ILWA 1CK1A 4MV7A 3RF2A 4EYHB 1XMOH 5J2UF 1XNRH 1L0YB 5F9NA 3RNUA 4A3KH 5IP9G 4DN4M 1HNZL 5LXTF 1KJ9A 3KAKA 4Q8FA 2BQ3A 2FPPB 1XMOQ 3MXNA 1SYGA 1XNRQ 1HR0H 1PH8A 1F9RA 3GTOH 1QWYA 1BUVT 1TWCA 4B3TH 2W8KA 5JJIA 5DG8A 1UEBA 4A3BB 4JI6H 2RSOA 4DAVA 2QILA 5C4XB 1Z2NX 2PBZA 3A5UA 5KNCA 2L0CA 1ZYRD 4GS3A 4XDXA 1IZ6A 3K0XA 1ZHSA 2NUAB 4B3TQ 5JJLA 4LFBL 4JC0A 3A0JA 1X3QA 2CZGA 1UC9A 1PZJD 1NR2A 2K32A 1M90C 3OIQA 1KDAA 2UUCH 3I7FA 1J9OA 3QJYA 2UXBQ 1YNND 1SCUB 4WD3A 1PTOB 4IPCA 4FO2A 3PF5A 2R7MA 3GD7A 1WTRA 1KXLA 3T4AC 2VS1A 2UUCQ 3OTOH 1G6ZA 5I6YA 1PZKD 4AH6A 1EYZA 4LF5H 2XRQD 3ONAB 4IOCA 1S9FA 1I50A 1RYSA 1CA5A 3H40A 3KLRA 3OTOQ 2IX0A 4RNNA 3DEOA 4LF5Q 2EY1A 4FBUA 5LMUH 1X3PA 2IX1A 4GKKL 4R8UA 4KD4A 2AGQA 5LMNW 1JXLA 3GIKA 5K36H 1EUCB 3AU7A 3HKZG 3QFFA 4M8AA 2NYZD 1SMYD 4A4IA 2FKLA 4F4WA 5FOBB 3MXPA 3K3VA 4LFAQ 1BBXC 2HT1A 1BGWA 3N52A 3EFXD 1EHIA 1Z6HA 4KN4C 1BXTA 5LP6F 3N43B 5FK9C 4JI5L 5JUMA 4JV5L 2F0FA 5EPJA 2R86A 3KOJA 3GV6A 3QB3A 3CQZB 4DV0Q 1NJIC 4LF8H 1STEA 3TIIA 1E1OA 2R92A 1J8IA 4YHHH 2HHHH 1XJVA 4DLKA 1Y1WA 2A6HC 2WP8J 2QDBA 3DLLA 1HR0W 3HOVH 1C0AA 4YHHQ 3S2HB 2ZJTA 2XIWA 1MGSA 3BS1A 1GLVA 1WTQA 3GTMH 5IYCH 1U4LA 5J3BA 3HKZB 3DMUA 4YWLA 1HA6A 3NWTA 1XPUA 1B9NA 4A3DH 5KG2A 4QMGA 4C2MB 3QR8A 2FJ2A 1B7YB 1WI5A 1YNJD 5KFSA 5KIXA 2IY5B 4LSAA 1BXRA 2BA1A 5BR8L 3G48A 1GUOA 1TWFB 3H0GG 4O2AF 3PVXA 3ZJYC 4UP9A 1JIHA 3Q8QB 2CKZB 4KHVA 3HOZG 4HNTA 1LTRD 2YTXA 3KF6B 4FXGC 1YITA 4O42A 1P8LA 1G2TA 1PZID 2Z6BA 1TWAA 1SYDA 2JXMB 4DV4Q 5KFUA 2C00A 2F0IA 4KJOA 2GVAA 4IQZA 4UDUC 2HVQA 4ECVA 1EY5A 3AQQA 1J5EL 4KI0A 3H3VC 5LOVF 2R7KA 3Q0AA 4X65H 3BG3A 3CC4A 1YHBA 3A7LA 3OMGA 5D8DA 1BNCA 2N8NA 5IOCA 1PTOC 2NZOA 2NVTH 4DL3A 2UXCH 4DV7Q 3V4SA 5CV7A 1GSOA 1N32H 3MTSA 3H94A 1HQRD 2N3SA 4YR3A 1CQIB 4WJWA 1E24A 4K8IA 2Y0SE 4C3JH 2UUBH 2IW3A 1N32Q 3PQIA 2JA5B 4DR1H 3SI8A 1Y1VH 3GTLH 3HOZB 4A93G 5JEAH 4MAMA 5KFVA 2R6GA 5C4HA 4DA2A 5M5WB 4FYDA 1XX8A 2NVQB 4EG0A 3T5KA 4IPHA 2UUBQ 3EBEA 4MIUA 2FINB 4J8QA 1HNWH 1LV9A 1RODA 3JAMc 2PQAB 2F0TA 3MFHA 2VUMG 2WINB 1U4PA 1S0NA 1STBA 2FXQA 3R2TA 5D3IB 1TWHA 1GXDC 3A8IE 2VQEQ 1HNWQ 2ATLA 1XXGA 4POFA 4ZK9B 1PTOF 4BY1H 4H0LC 3PIOA 3JC66 2B2YA 2XCAA 3NPPA 4MN3A 5DLQE 1EWHA 1TS2A 3CF5A 1JOOA 5KT2A 1GO3E 4FS1A 2DUDA 3GTGA 2Q2TA 4IOAA 4A93B 1AE3A 1SNMA 1S40A 4V0BA 4ALPA 2VB2X 1S72A 4L63B 1E4EB 3MFYA 2KHIA 1WCMA 4Q44A 1SAPA 3NSWA 2VUMB 4DAYB 1WTPA 1A3VA 3LMLA 1MJCA 2D0PA 1AN8A 1Q86C 1FNWA 3I2ZA 5IGFA 1CFMA 1DONA 2KUMA 1JOQA 4JYAH 4YWKA 3PCOB 4OO1H 5KG0A 1EYCA 4UPAA 5H80A 1QOHA 3CC2A 2D2CC 4KY5A 4IJLA 1OXTA 2XVSA 4LFCQ 3VPDA 1TQOA 3EA6A 4JYAQ 4U7CA 2R7ZB 2EYMA 4APMA 3TREA 1ASYA 3JRWA 4H44C 4HEDA 3PO3H 1ZQ7A 4TQSA 4HIMA 2Y0SA 5AJ3L 1XMQQ 1AN7A 4M9UA 3GTOB 4LF9H 4K8JA 4G7ZC 2JA7A 2Q8IB 1T9HA 4JI1H 4HR7B 2B2UA 4YY3L 2EY2A 1A8VA 4LF9Q 4YCUA 4HMIA 1IBLQ 3S17H 3NBHA 3MXUA 4MV3A 1TWGH 2ZXRA 3CAMA 4JI4H 2NVXA 3BYYB 2FPGB 2K75A 3CRLC 4JI1Q 1A15A 4DR4L 4J1MA 4EBDA 1K83H 3M7GA 3H6MA 4X62L 2OF1A 5K36G 3Q2OA 3M9MB 2DPIA 4DNRB 3DWAA 1N36L 5A2QE 1I5FA 3J80W 3CXCA 2J6UA 3TSSA 4DUZQ 3KTMA 2Q2UA 2VPSA 3GTPB 2YU9H 3Q24A 1HZCA 1NSNS 2R7NA 4L8JA 3P75A 1JDEA 5IT9E 4IWYA 5KG5A 2PI2A 2X0SA 1RYRA 5ELDA 1YBYA 4ZUJA 5C5JA 4FU0A 1K8AC 4CKCA 1SFOB 4K5WA 1DV2A 1G8ZD 2F0UA 4CDEC 3UQ8A 1SDFA 4IUVA 2F0DA 4HSPA 1STAA 2PNHA 1E2VA 2JK8A 4R4TA 4QUFA 1K8GA 3HOVG 1GYFA 3PW5A 4QIWE 2P0AA 3RMHA 3K5NA 1V8QA 5IYCG 5DNFA 3FKIH 2YW2A 1LTGD 1SR3A 3SDZA 2HQLA 2RDFA 2MCTA 1D8LA 5G3LD 5EAYA 3RN2A 4A3DG 4ZI7F 2XCPA 4BXXH 2IX3A 2E2JB 2O03A 4CJ0B 5F9LA 4EBCA 4RA8A 3K59A 4RMFA 4QWEA 2E8GA 3GTQA 2DWCA 4B3SH 1GUSA 1SNPA 1VQCA 4K0KQ 1HCZA 4MV8A 3GDEA 4LUOA 2YZGA 5CMDA 3PR4A 4IUPA 2DNCA 1PX2A 3GQCA 2VUGA 2J6SA 1MI2A 1EIHA 1KJQA 4X64H 1PFNA 1AZPA 3GTKA 2XGTA 3HOVB 1I6HH 2WKDA 2WB1G 2H4OA 1AUVA 2FK3A 3J81W 2HVRA 3ERSX 1SYXB 3K57A 3GTMB 2YCHA 4GKJL 3NQIA 2OEOA 4KLKA 2NVYA 5DG7A 5I6WA 1UE6A 3GP7A 4A3DB 2IMWP 2BH8A 2QA4A 1T94A 4BA2I 2DJGC 1JE5A 1VQ7A 1XNQL 4C3JG 4Y7NH 2YZNA 2ZTEA 2EXZA 1SNOA 4C3HH 5KFHA 4QY7A 4R7RA 1Y1VG 3AFQA 2Z4HA 2WIIB 2J4XA 1YNXA 3IFDA 5EWFA 5KYIA 3K5LA 5IGGA 1PH5A 4JI3Q 2G9DA 3KYHC 5C0XH 2WB1B 3RAXA 4WORA 2OLSA 5J2TF 2I8CA 2K52A 4I7AA 5J39A 4HJ8A 5KFDA 1M7JA 4C3IH 1SLJA 1CHPD 2L12A 3ER0A 4QIWA 1E3PA 3J7ZC 2ZJRA 3HOUH 4X66H 2IJ0A 1EIYB 2BH2A 4LUVA 3FPUB 1RJQA 4EYIB 4RB2C 1JB7A 3HZXA 3KUPA 2UXDL 1TWCH 4HTHA 5EQ0A 5C4JH 3HOYH 2YS6A 3G71A 1TS3A 4XIGS 4IRCA 2MO0A 3V6KA 1SMXA 3A54A 1I94L 1D1IA 3H4BA 2K01A 1WTWA 4LMQD 3HOWH 3M85A 5M5XH 1WTHA 3L2PA 2CCZA 4DR7H 2XCLA 1A0IA 3E5NA 1KABA 1MIUA 3E6ZX 4LF7Q 5C6AA 2QEXA 3S1NB 1IBML 1PV4A 2CH4W 1TY2A 4IAJA 4OX9Q 4DV5H 3QOJA 4DAMA 2W6ZA 2I5HA 5FO7B 4A2AA 2ZM6L 4GN3B 2MUYA 5LMNL 4XZ3B 4DL6A 1S3OA 2Z1CA 3TS0A 4EEQA 1CQFA 1EZ1A 3GTJA 1IW7D 4P74A 4DV5Q 2NU6B 1Q8KA 1I50H 4JI2H 4WFN3 2R8HA 2YYZA 5FLXW 2JJQA 2R87A 4CDFC 2JP1A 4G57A 4FF4A 3BABA 1D2BA 1N48A 4JI2Q 3M3YB 1XWEA 4HIKA 4GNXB 3U58A 4IWXA 2ZDHA 1XMOL 2RF4A 1JCKB 1EWCA 3NTKA 3I4NH 4ED6A 2C22A 3ND9A 1PH4A 1UE5A 4I4TF 4HJ5A 2G9HD 1M4VA 1IOVA 5JQWA 2EYFA 1HR0L 3T5JA 1BBUA 1HRJA 4CHTB 1PDQA 5KFEA 2FPIB 3I12A 4B3TL 1STGA 2CHBD 4JI6L 2R92H 4RGOS 3SK5A 4ETSA 2YRWA 5KFIA 1KEEA 4CDDC 1TA8A 3QO2A 5CBEE 3PW0A 3TP6A 3RZOH 2W6PA 2O4XA 1Y1WH 1VQ4A 2L11A 2EJFC 4XYOA 5KFWA 3PO2H 1ONLA 3F8TA 4JI7H 2YV5A 3VR2A 1JJ2A 1BBWA 3S16B 4PG3A 4CDCC 4H02A 4J9PA 3MZ5A 2XC9A 3URYA 2D0OA 4J9NA 5HBRB 2E5LH 1VMPA 4K14A 4QWBA 3Q8DA 4YR2A 1BQQT 3OTOL 4FXKC 5K2MA 4IR9A 2JEAI 3QWNA 4LF5L 3QOLA 4CC5A 4UHVA 3I4OA 2E5LQ 3VPBA 1KAAA 2K14A 4YBZB 1E22A 1F77A 4PQXA 3LP8A 3K5IA 1SXTA 1TKWB 4ED7A 4GN5A 1HJPA 2UVUA 2C2EA 1KTKA 5LMUL 1I4PA 4LNQA 2E76C 5H1SE 1DYQA 1VQPA 4IURA 2WYOA 1TWAH 2W7OA 2W70A 2DNEA 2YU9B 3I4MG 3S1MH 3OWEB 4U68A 5EKKA 2C9OA 1EY9A 2J7ZA 1F2LA 5D3DA 1H9SB 3S9WA 5M5YB 4LAAA 2F0NA 1RTNA 2FE3A 4P71A 1N33Q 1CZWA 5ELOA 4UCTA 1AW7A 4XQNA 1T3NA 1I4GA 2WKCA 3RB4A 3HP3A 1PLFA 3F1ZA 3VYUA 1OO9B 1LM0A 3KDFB 2PZUA 2VZAA 4LF8L 2SEBD 4B3MQ 4FF2A 2OCEA 4ED2A 1A3UA 4ZUIA 4YHHL 2HHHL 2EIFA 1SSOA 5HV6A 2NN6H 4ID6A 4ED3A 1R4QB 2RQXA 4V190 5BN4A 2L9HA 4JCVE 1B6SA 4GNXC 1EOVA 3OW2A 1IBKQ 2G5DA 4IR1A 3I4MB 2ICEC 2H1EA 3KF8A 4LH6A 2F3IA 1BKBA 4XT3B 5KRUA 2PMZE 4OEMB 1VMCA 3S15B 2AQ1B 1TWHH 1U4MA 2F0OA 3ORRA 1EY6A 1K1QA 4A75A 2NZ1D 1R9TA 3CCRA 1HZ9A 1SEBD 1FL0A 1SE3A 4DV2H 2L4NA 5C0XG 4HSVA 2R84A 1I6UA 1Z47A 2XN9C 1MHWC 3GTGH 4C3IG 5KFTA 5BN5A 1ENCA 3HOUG 2PMZB 4A3MG 3R8BA 2ZDGA 2ZDQA 3D4WA 1AE2A 1ESRA 1SBBB 4OHJA 4IUTA 1WCMH 4IFDG 4X65L 3CCMA 4A3GH 2WAQE 3GIJA 2W9BA 2FLLA 3JAMi 3Q22A 3HOYG 4MTDA 5IE8A 2UXCL 5CYUA 1T5EA 1BOSA 2GVBA 3BDCA 1XYIA 4LF4H 2JA6A 5CAEB 2L55A 3M7NA 2LY7A 4O2DA 4BY7H 4RNMA 4DV6H 1O7YA 2EZVA 5CORA 2UU9Q 4NXNL 2HVSA 2UUBL 4CJ2C 3HOWG 1S5CD 1BCPD 4DR1L 4LF4Q 5BN3A 2V4QA 3GV5B 4I65A 3T1YQ 1QB5D 1K3BC 2R8IA 1UNSA 4C3IB 1NUCA 1PK8A 1EY8A 3HOUB 3K6OA 2O5JC 1VCIA 4A3MB 1HNWL 1PH1A 3Q1KA 2A6EC 2MJ8A 4OIJA 5HURA 3WO0A 2LS01 1VF7A 2ES2A 3RIZA 4TQUS 3PW4A 2JA7H 4KD3A 4DR3H 4IFDI 3HOYB 3J80L 2E2IB 5IYDH 4Q8EA 2IPKD 3CRKC 4EQOA 3OWFA 2K05A 4YAKB 5D65A 1VQ6A 4Q0YA 2JEIA 4UP8A 3FMAA 2NVXH 5GAGC 3O13A 2JE6I 4O3QA 3T5HA 2L15A 4GN4B 4J6HA 4B08A 3KXYT 3A7AB 2R93B 5C44G 3HOWB 1LABA 3UDFA 1B04A 5FPOA 4NLGA 3BAAA 3BG5A 1M8AA 4IZOA 2W8LA 4WRDA 1QILA 3L4KA 3QZ8A 3EIVA 1GHKA 3V05A 2E2HB 1WH2A 4O4HF 1CTMA 4H7BA 2RGRA 1K9MC 1OXVA 4BBSH 2KQ3A 3K5OA 4RAZA 2R92G 5CBAE 1I50B 4LWCA 2UXBH 2KCNA 3I72A 4JYAL 1A6XA 2R7LA 2WAQA 1Y1WG 2Q2IA 1WD1A 3H15A 2AMCB 2WACA 2EOTA 4EQ5A 2DPJA 3KHRA 1P16A 3KLWA 2Z9HA 5C44B 3HOXH 3H3VI 4JOIC 2F4VQ 2YYAA 3ITPA 2AWOA 4DR6Q 2RKSA 2SDFA 3IFTA 5D1OB 2HQEA 4PMCA 3B6YA 4A3LH 1RJRA 3S1QB 1Q1EA 1QNKA 5KFYA 4WBNF 4AYBG 5C5LA 3RUZA 5J1ZA 2UUAQ 3MWDA 1CSPA 5I4DA 3J81L 1NMFA 1I7LA 1D6EC 3GTQH 1HNXH 1TVXA 4DV1Q 3RLFA 4FXDA 5IODA 2BCOA 4Z9CB 5EKIA 5ISRA 1KD1C 4JBMA 3RD4A 4LFAH 4JI4L 1HNXQ 1Y1WB 1ET9A 3GTKH 4Q45A 3F2UA 5IT9c 4AIMA 1EY0A 2N78A 3OIPA 4A3IH 4A3JH 1I6VC 2SCUB 1KNAA 3HKZE 4DV0H 1PYSB 3N8DA 1JLLB 2NVYH 1FJGH 2QDLA 4DR2H 1EY4A 5FLMH 2R61A 2CW0C 4ZLTF 4DV3L 4FF1A 2CQAA 5I9PA 4AYBB 1RJTA 5T14A 4A3EH 4NXMH 1FJGQ 3E0JA 3K7AH 1C48A 1B9MA 3FDSA 1UE7A 2K7VA 4DR2Q 5C8YF 1V43A 1FVIA 4BBRG 1Q82C 1Q1BA 1JORA 1BR9A 4NXMQ 3HFZB 4X6AH 1VQDA 1F9QA 1WOCA 2XRSD 2FP4B 5IP7H 3NP8A 2BQUA 3OUZA 2PNRC 5L1JA 1TXYA 1S0MA 4MHEA 2KVMA 3KLSX 2F1MA 1KLUD 2V4DA 2SNMA 3EJIA 2BA0A 4DUYH 2EQSA 3TBIB 1S4ZA 2C28A 2PVPA 1ULZA 3H09A 1Y8OB 1YZ6A 2R8KA 3MFIA 5JJKA 1X3EA 4DUYQ 4AQYL 5J22A 3W5OA 4DV4H 1LLRD 1NBWA 1OXXK 4CBVA 4B3SL 3BU2A 4Q43A 4BBRB 5KGUA 2NB0A 1EQVA 4LF6L 2ASJA 4IRKA 1JICA 1X6OA 3W2DA 5IYBH 3J81j 4DV7H 4X64L 3VDYA 3CQZA 4O0AA 3D4DA 4HJ7A 3M9OB 3P20A 4F7XA 2K5QA 2CFMA 1QUQB 1N34Q 3D0FA 1DJRD 2W9AA 3DF7A 4XQJA 2VXWA 4F50A 2KA7A 1VF5C 1PVOA 2CW8A 2V59A 5FLXL 4Q0FA 1NY4A 3R2IA 1LTBD 4J9RA 4LUZA 3RLNA 2BOSA 3HKZA 1EFID 3H0GB 2AKWB 3CC7A 4IUNA 4YB8B 4CJ1B 3S2DB 3GTJH 4C2MA 4ED1A 5JVG3 1OTCA 4DL2A 2EY5A 3MJFA 5GAEC 1F9PA 5KFLA 1NE3A 5KFXA 1KL9A 2PO4A 1L2FA 2VQEH 4FS2A 4NW2A 1SNQA 1FGUA 1LT4D 1PXUA 1TWFA 4A2BA 5L9XA 4EGVA 1KDBA 2M00A 4A3CH 3V96A 4O2BF 1SNDA 2A8VA 4IUUA 2GPWA 2VY3A 3KF6A 4QWCA 4KHPH 1KRSA 1PRTB 2F0SA 3S14B 2WDTA 2K50A 4MTKA 4X66L 1HH2P 5IYDG 2KHJA 3BQ1A 1OXUA 5JPMC 3RV4A 2BE5C 1DCZA 4KHPQ 1ML0D 5KNBA 1OWTA 1IYVA 5CR3A 3X3MA 3BA9A 5IWAL 2FK1A 3NBIA 4DXFA 2K6AA 2VL6A 4A3KG 1I4QA 1A3TA 4DNTB 5CGKA 4XT1B 3E3XA 2ICIA 1JC7A 2IT1A 5CV6A 2XGPA 1WJJA 2VR1A 4JV1A 1EYAA 2W7PA 2JA5A 4RAUC 1STNA 3UE0A 4R8IA 4DR7L 3RB0A 1K0RA 4CKEA 3Q8RB 4LFCH 1EY7A 4X3SA 2KEEA 1C3OA 4BBSG 5EGTA 2FJZA 4J9LA 5FD6A 5EOYA 2IBKA 4DR5L 4JI8L 4DF7A 4X3KA 2PQAA 3PUWA 2K5NA 1I3QA 3LWEA 3NBHB 3W3AA 3STBC 1MZBA 1XMQH 2F0JA 1FD7D 1HNZQ 5LL6S 2F0KA 2KOLA 4A3KB 3BQ2A 3M4OH 5FJ8H 1IL8A 2ATWA 1B50A 2V58A 5DGBA 4LFBH 3T53B 4C56C 3VMMA 1JWSD 1IBLH 3E5SA 3I56A 4K6DA 4ME5A 1UNNC 2DLNA 3IL8A 1RD9D 2RDGA 5KG4A 4A3FH 5FO9B 4LFBQ 1O75A 1GUTA 4DU9A 4N9PA 2VQFH 1DV1A 1E4EA 1PH2A 5KG1A 3NHHA 1WD0A 1V1PB 3RR5A 4DUZH 2EPBA 2A69C 4QWDA 2K5DA 2VUMA 4DAYA 2B2YC 1X54A 1Y14B 2A6HD 2KHSA 5IY0A 2VQFQ 1EEID 1E2WA 4UFZA 4A3IG 3CCVA 1AFPA 1C9OA 4J9OA 1DD2A 5KT3A 2JA8H 4JVZA 3DWQA 3QIAA 2ZT9C 1HA5A 3EROA 3NELA 4WJ3M 5KFRA 5FLMG 2MGSA 3QZ7A 3QG1A 2UVVA 1VQOA 3MA2B 4JI7L 1K8MA 1A63A 2R7ZA 1KC8C 4RZRA 4A3EG 3EPIA 2AUKA 3CU7A 5TSSA 1PRTC 3I70A 1IYJB 3K81C 2K5VA 3T16A 2DY8A 4NB3A 5CB4F 2K03A 3MAQA 1X56A 3MHBA 2ALYB 3JAMW 1S5DD 3TP5A 5DLFA 4EQPA 2O2LD 3S24A 4IALA 1R9TH 5IP7G 4JV5H 1I4HA 4HR7A 2OTLA 3UE1A 1F2YA 2W6NA 4HQ6A 4K0KH 1CI3M 3FHWA 4JI5Q 2B63A 4JV5Q 1V9PA 1E4FT 5DG9A 4XXEA 1IKMA 1PTOD 3LWBA 1VDZA 2AGOA 1K3RA 1X55A 2EJGC 1C8CA 1ICFB 2W71A 1CUKA 4A3EB 1YI2A 2DZDA 3K7AB 2X69A 3C0FB 3RUPA 4LK1C 1L1OB 3OHAA 4M1UB 3GTPA 4LMYA 4O3SA 2B2UC 1PRTF 1FGBD 3I73A 1GUWA 1SE8A 2X6LA 2JA6H 1BNZA 4B3RL 1X65A 5IYBG 4MV9A 1G6PA 2FB9A 1G91A 2D62A 3R3OA 2HJWA 2JEJA 4QL5A 1PH7A 3D6WA 1SFOA 2WB1E 2ALZA 2HDLA 3MR2A 3CPWA 5LA6F 2KBNA 1H9JA 2PYKA 2RSNA 4DL5A 1SYBA 4O3PA 3OUUA 5BR8Q 2LSSA 3K3PA 4E4TA 3GO5A 1QNUA 4PZ7A 4MTNA 2B2WA 4KV6A 4C5CA 4N8FA 4DFAA 5LL6X 4JI3H 4XTCS 1SJED 3U9OA 1H9KA 1QG7A 1EQRA 5KYLA 5JEAG 2F3WA 4PV1C 5C3EH 1ILQA 3IG0A 4MA5A 5KFJA 3H4DA 2JEFA 1JQYD 1QE6A 5KFAA 1S0OA 5I2YA 4FNFA 1DM0B 2DN8A 4DV2L 5C1OA 3RBDA 2RDIA 4I50F 3GLKA 1HXYD 3UDXA 1G291 4ECTA 4A3CG 5KFNA 2NVTB 1UWVA 4Y52H 2L1BA 2LXJA 3RZDH 3E9HA 1GOZA 3OSOA 1NNXA 4BY1G 1V51A 1IHZA 4F88A 1GHJA 3J80E 1QVGA 2JEBI 3BVGA 4K5VA 1B53A 4C3JB 4FP5D 2E74C 2B2VA 3AMUA 4MV4A 3BYTB 4KN7C 1ILPA 1Y1VB 5IIFA 3GTLB 3GTJB 2M05A 5M3MH 2QKIC 1E2ZA 4LF7H 1VQIA 1B1ZA 4LSXA 4LF4L 3Q6SA 3MVVA 2SNSA 2GA4B 1TS5A 3NUCA 1RL2A 4OX9H 2ZTCA 3MC0B 4DV6L 4L1KA 2FFKB 1S97A 3E9IA 5JVDF 3FVQA 3I3CA 1K1SA 2YS7A 1TY0A 3FP9A 4DK1A 5DM73 5DM63 2QEJC 1HUNA 4PZ6A 2M9VA 1PFMA 3G8CA 1GSAA 1VQKA 3TRZA 1M0WA 1ET6A 1PHJA 4BY1B 3S1RH 2VA2A 5KT7A 4F4XA 1F2ZA 4OO1G 2WB1A 4NPSA 4Y8VB 3I91A 2F0PA 5F2DA 4LJZC 3A8JE 3FEWX 4QCLA 2Q8RE 4K6LA 4XYQA 1V1OA 3ULJA 1L1OC 3KALA 4DR3L 1JWMD 1HQMC 3RGXA 3CCJA 5DQHA 3PO3G 5I9OA 4QQBX 4HNUA 4IO9A 3MFGA 2W6OA 3BJUA 2I87A 3VYSA 2DY7A 1Q12A 2V5AA 1XNRL 3JRXA 5KFFA 3CPFA 3A56A 2PZWA 4A3BH 5AFWA 2ID0A 1SN8A 2A68C 5C4ZA 4CC6A 3Q8SB 5C4XH 4DAPA 3PUZA 5ELFA 2EY6A 5FKAC 3J81E 3PW7A 2KECA 2W9CB 1PH9A 2A74C 1RK6A 1B70B 2K04A 3LGJA 2OXPA 3PV0A 1YJ9A 1X3GA 4ME6A 3H91A 3M4QA 1CQJB 3JZIA 4OO1I 5HY6A 5EBCA 2FMMA 2HIXA 3M9BA 3N41B 5AJ3Q 3HB9A 1GJXA 2UXBL 1Z2PX 4YY3H 3PO3B 2JA8G 5GAHC 2Q2HA 3PSIA 2E75C 3PN1A 2P5ZX 5K5PA 5EJWA 2UUCL 3PUVA 4JBJA 4DR4H 1E0BA 2EYPA 4YY3Q 5E1FA 2F03A 4HIDA 2RCNA 5KEEA 2BDNA 3L3OC 2ZJQA 1YEZA 2HIVA 4ZYSA 5D1PA 1N56A 2XSCA 1O7IA 1N36H 4ED8A 3R5XA 3F8NA 1Q46A 4DR4Q 1AH9A 5DGAA 1BF4A 1TU2B 4X62Q 3S17B 2AQ2B 1TWGB 2K5WA 4GNXA 3D31A 3U4ZA 4IRDA 2I80A 1N36Q 3JSLA 4RGMA 1K83B 1ENAA 1BCPF 2UVWA 4DL7A 1GVPA 4R4IA 2MQHA 2AHOB 2MP1A 3FKIG 3TMEA 2B29A 1QVFA 2FK2A 2W6MA 4DV3H 4HCEA 4BXXG 1MKHA 4X3TA 2JA8B 3ZYYX 4LFAL 5DQGA 4EGQA 4XYLB 4GOPB 5JOBA 4ECRA 1N33H 5L1IA 1ZYRC 3CQZH 4MV1A 4KHZA 3DM3A 1IL2A 4NDXA 4F8MA 3N6RA 4ZHQF 4DV0L 3KF8B 1W6KA 1UE1A 4B3MH 2QGQA 2F3VA 4DR2L 1MSHA 3MEHA 1EEFD 4RCOA 1YNNC 1LTID 4L6TB 3S2HH 4C5BA 1D5MC 5KG6A 2KENA 1LTLA 2IP4A 2F0QA 4G4KA 1U0LA 1LACA 2KCTA 2XWBB 3CCSA 1CKNB 3U4VA 1R9TB 1M1KC 4YJ3F 1IBKH 2OTJA 3KJPA 3FKIB 2A73B 3G6EA 1NAPA 4ECSA 3X3NA 2PW7A 4C2MH 5L1KA 4YJ2F 2JN4A 1PH3A 4ABNA 4HAEA 3G4SA 1MJEA 2BDOA 3CKIB 2OQKA 5FLXE 3MWEA 4FVMA 1TWFH 3WNZA 4UCUA 2ZXOA 4O3RA 2EJMA 2R82A 1B33N 1UEAB 4GKJH 1O78A 4C3HG 3RN5A 2UVRA 1SE2A 2ZJPA 1XTCD 1V4YA 1VKZA 2W9BB 2HD3A 1SMYC 5C3EG 4QUCA 1JX4A 1EL0A 1JOKA 5EWGA 4GC7A 1YVCA 2F0GA 4GKJQ 4ECQA 1I6HB 3DWPA 4DV4L 2C5CA 2XTIA 2QYZA 3PUYA 1H9RA 1H9SA 2ZTDA 4IFDJ 3GIPA 2SOBA 1XNQH 3EYYA 1X3FA 1OXSC 2PPBC 3V2TA 4RKBA 3J7AK 4DV7L 3KDFA 4ECZA 2B2TA 1XNQQ 1V1QA 3A8KE 1RHPA 5IGEA 2JA5H 1TAEA 1CSQA 4DGZA 2K5HA 2UU9H 4Y7NB 4C3HB 1CA6A 1N32L 5M5WH 3C2PA 2NVQH 3GILA 4JUZA 2VW9A 4P72A 3T1YH 5M3MG 2K33A 5C3EB 4P75A 3K5MA 5BMVF 1VQ5A 3W1BA 1VQ8A 4EEYA 1I3QH 2R7DA 3F2BA 3CMAA 4RZQA 4QW8A 1YNJC 5C0XI 1EYDA 5ELNA 4ZCKA 1Q3LA 3PR5B 5DQIA 5DLGA 1AEXA 2FLNA 1ZETA 2VQEL 4GOPC 2UXDQ 2OH2A 4ZOLF 3MXNB 3K0YA 1KRTA 1FR3A 1LUZA 4PNYA 3GIMA 4R4QA 1TWCB 1CHQD 5C4JB 5LL6b 4FM9A 4A93H 3DEPA 1I94Q 1NR4A 3GIDA 1STHA 3TQTA 2PCFB 2PMZA 3UDIA 4GZYC 3N44B 4ECXA 1XPRA 1K73C 2VNUD 4J9KA 1KJJA 5FPRA 2R8JA 1G2SA 1SYFA 1RCVD 5KT6A 2QF7A 2VUMH 5M5XB 2GPSA 3A55A 3PIP3 4MV6A 4HN7A 4TSSA 1PH6A 2QK4A 1A9XA 1E1TA 4A3BG 3CD6A 1VQEA 3I4NG 4L5RC 2ZM6Q 5LMNQ 2PZTA 1EFWA 1LYLA 3TN2A 3JAML 1JWUD 2FHTA 4JI0H 3C3LA 4NP5A 4RHRA 1ZEQX 4KKTA 1B3QA 2CW7A 5KG7A 3L4JA 3CVZA 1E7ZA 1FNVA 1KBLA 4IN3A 4K5XA 3K8AA 1U9RA 1HTPA 2EYHA 3SVMA 2R7ZH 4J15A 3JSNA 4JI0Q 4LFCL 3CCUA 3H20A 5EBDA 3PMFA 1LTAD 4HMJA 2F4VH 4DR6H 3SXHA 1TS4A 2OT2A 3U50C 3EVQA 1JT8A 4R8UB 1I4XA 3PO2G 2NWGA 1XMQL 2M2LA 2UUAH 3V4ZA 2WFWA 3OOCA 3AYHB 2RDHA 4ODGA 2E2IA 1VQJA 4TV8F 4YCWA 1HR0Q 1VQFA 3I4NB 1CE8A 4DV1H 3RAQA 3SK8A 2B63H 4YCVA 4ED0A 3TINA 4DPGA 4JK1C 4RG1A 2RA4A 4G7HC 4LF9L 1D5XC 3SK6A 4JI6Q 1IBLL 2R93A 2B8GA 3TP7A 2KCCA 4ECYA 2Z6KC 4AYBE 4JI1L 1SYCA 3T1HH 2R92B 3J7AF 5JH7F 5CV9A 3N6XA 2W6QA 1JR0D 2VQFL 2EVBA 2F52A 4K2KA 4ZAIA 3GTPH 3UDGA 3RZOB 1B2TA 1MD2D 5KFGA 2MFIA 4DUZL 3T1HQ 2E2HA 4MTEA 4IZ8A 3PO2B 3GV7B 1W6JA 2AUJD 4L5QA 5C5MA 3SE7A 1CQVA 1IKLA 1SFOH 5IYZF 3HRZC 1BJTA 4PMWA 1S68A 2RHSB 3HS0C 2HCIA 1YHAA 4QGUA 2DIKA 3SGIA 1GGOA 2XIGA 4ME3A 5D1OA 5LMUQ 1HTLD 2NN6G 4PDBA 5ELCA 1J6QA 3R93A 3I55A 3TQYA 2E2JH 2VPQA 4PMBA 1I7NA 3TEHB 4KK7A 1TWAB 2RBMA 2CQYA 1VS0A 3S1MB 1B44D 4IUQA 2WV6D 1VQLA 2A19A 5JPNC 2VOBA 1CKMA 1SJHD 1U4RA 3C1FA 3IN5A 1L0WA 3PZPA 4K0KL 2TSSA 3BDLA 4MA0A 1TR5A 4R8NA 1JB3A 5JJZA 4LF8Q 4RB3C 5KNDA 1QVCA 2XWJB 4EGJA 4ECUA 2HHHQ 2WTFA 2GLTA 1UAPA 1C7YA 2HCCA 3CMEA 5IGCA 5ELEA 3BZCA 3T5LA 4NMZA 3WOEA 3D8GA 1N34H 4ECWA 3MEFA 2LMCB 3ICEA 2NN6I
chains in the Genus database with same CATH topology
4DKAC 5GROA 4IPDA 4NB3A 2RF4A 1QZHA 1X56A 4JOIA 2ALYB 4KHPL 3I4NH 2MO1A 2R93G 1PH4A 1UE5A 3S24A 1R9TH 4BA1I 1WCMG 4HJ5A 2K4KA 4HJ9A 5IP7G 4A3GG 1HR0L 2JA5G 1BBUA 1GKHA 2IHEA 4UY8C 2OTLA 4DV6Q 1H95A 3UE1A 4HIOA 4B3TL 3K7UC 1HZBA 1WFQA 1KIXA 4JI6L 3FHWA 4JI5Q 2R92H 4JV5Q 1V9PA 1IBMQ 2Z6KA 3HKSA 4BY7G 4GLAC 5C4XG 3L7ZC 3AFPA 3RZOH 4JI3L 3M4PA 1Y1WH 1K3RA 1X55A 1VQ4A 2CWPA 3TS2A 4DK3C 3J81i 3PO2H 1CUKA 1YI2A 1IXRA 1YJNA 3F8TA 1L1OB 2YV5A 3PGZA 1JJGA 1JJ2A 1BBWA 3J80c 2Y0SG 4PG3A 4DR3Q 4H02A 4X65Q 2D0OA 1SE8A 3RNUA 4A3KH 2JA6H 4B3RL 1X65A 1PYBA 3Q8DA 5IYBG 5IP9G 2UXCQ 1G6PA 2D62A 1HNZL 2JA7G 3CCQA 3OTOL 4QL5A 1PH7A 1XMOQ 2JEAI 4LF5L 1XNRQ 2WB1E 1PH8A 3I4OA 2E5LQ 3GTOH 3CPWA 2K14A 2KBNA 1E22A 4NXNQ 5JJIA 5BR8Q 1UEBA 2LSSA 4GN5A 3ULLA 1HJPA 1QUQA 4DR1Q 1ASZA 4L5SA 5LMUL 3GO5A 4PZ7A 2JA9A 4MTNA 3A5UA 4LNQA 4GS3A 5H1SE 1VQPA 1IZ6A 3K0XA 1TWAH 4B3TQ 3S1NH 4LFBL 4JC0A 5JJLA 3I4MG 3S1MH 4XTCS 3A0JA 4LF7L 4OWTB 1EQRA 5JEAG 5C3EH 1M90C 4OX9L 3I7FA 2UXBQ 4LW1A 4P71A 5ELOA 1N33Q 2EXDA 4IPCA 4DV2L 3PF5A 3F1ZA 3GD7A 5GQOA 2R7ZG 1KXLA 1LM0A 2VS1A 3KDFB 2UUCQ 2VZAA 3UDXA 1G291 4DV5L 4LF8L 4A3CG 1VQAA 1VQNA 2MNAA 4B3MQ 3A5ZB 1UWVA 4AH6A 2OCEA 4Y52H 4YHHL 2LXJA 3NEMA 2HHHL 2EIFA 2PI2E 3E9HA 3RZDH 4IPGA 4IOCA 4BY1G 3M3YH 5HGQA 3OTOQ 1VQGA 1QVGA 4POGA 2IX0A 4JI2L 4JCVE 2JEBI 3HOXG 4LF5Q 3J81c 4GNXC 1EOVA 3OW2A 1SRUA 1IBKQ 3L0OA 2IX1A 4GKKL 5LMNW 1VQMA 2F3IA 4A3LG 1BKBA 3CP0A 2PMZE 3W1GA 3HKZG 5M3MH 2B63G 1G51A 1VQIA 4A4IA 1TWHH 4LF4L 2A1AA 1RL2A 4LFAQ 4A75A 2ZTCA 2HT1A 4DV6L 1HZAA 3EN2A 5GADC 3CCRA 3E9IA 1HZ9A 4MNOA 3FP9A 4OXPA 1FL0A 3PUXA 4JI5L 4JV5L 4PZ6A 5C0XG 4OONA 3KOJA 1PFSA 1Z47A 1NJIC 4DV0Q 1VQKA 3TRZA 3GTGH 1E1OA 1PHJA 3S1RH 3PIPA 4OO1G 4NPSA 1XJVA 1W3SA 4A3JG 3S16H 3HOUG 4A3MG 2WP8J 4IJHA 3DLLA 1AE2A 1HR0W 3ULJA 1L1OC 3HOVH 2IHFA 4YHHQ 1C0AA 4DR3L 1WCMH 4IFDG 4X65L 3CCMA 3GTMH 2WAQE 2RHQB 4A3GH 5IYCH 5J3BA 3JAMi 3CCJA 4YWLA 3PO3G 3HOYG 4QQBX 5IE8A 2UXCL 4IO9A 1XPUA 3KFUA 3BJUA 2GVBA 4A3DH 2LXKA 1Q12A 3M7NA 4GKKQ 1XNRL 4O2DA 2E5LL 4BY7H 3CPFA 4A3BH 1B7YB 1WI5A 2ID0A 1SN8A 3CCLA 3J7A5 2UU9Q 4JI4Q 4NXNL 5C4XH 3PUZA 4JBWA 4UP7A 2UUBL 2IY5B 5M3FH 1X9NA 3HOWG 2BA1A 5BR8L 3G48A 1PH9A 4DR1L 4LF4Q 3H0GG 3A74A 1B70B 3ZJYC 4UP9A 3F2CA 3LGJA 3T1YQ 1CKOA 2OQ0A 3PV0A 1YJ9A 1X3GA 2CKZB 3HOZG 3M4QA 2YTXA 3K80C 3KF6B 4OO1I 1YITA 4QJFA 4TVAB 5HY6A 1VCIA 1P8LA 1HNWL 5M5YH 1PH1A 4DV3Q 4DV4Q 2GVAA 2ES2A 2HIXA 3M9BA 4TQUS 5AJ3Q 2JA7H 1J5EL 3AQQA 2UXBL 4KI0A 4IFDI 1N33L 2JA8G 2I5MX 5IYDH 3CC4A 1YHBA 2Q2HA 5GAHC 2N8NA 1WYDA 3PSIA 2NZOA 2NVTH 4DV7Q 2UUCL 3PUVA 2YTYA 4JBJA 1VQ6A 4APVA 4UP8A 4YY3Q 5GAGC 2NVXH 4B3ML 4HIDA 2JE6I 2N3SA 2RCNA 2L15A 4GN4B 2ZJQA 1YEZA 2HIVA 3PF4A 1O7IA 5C44G 1E24A 3F2DA 2Y0SE 4C3JH 1Q46A 3UDFA 5FLXc 4DR4Q 1N32Q 3I4MH 1AH9A 4X62Q 1A62A 4GNXA 1Y1VH 3D31A 1Z9FA 3U4ZA 2JQOA 3GTLH 4A93G 1IBKL 2R6GA 1N36Q 4FDBA 3S15H 3EIVA 4IPHA 2UUBQ 3EBEA 1GVPA 4R4IA 2MQHA 2AHOB 3FKIG 5JEAJ 2B29A 4AQYQ 3CW2C 1QVFA 3JAMc 1K9MC 1OXVA 2PQAB 4BBSH 4B3SQ 2VUMG 1RIPA 4DK6C 2R92G 1MKHA 4BXXG 2FXQA 4LFAL 4LWCA 4GOPB 2VQEQ 4JYAL 1U5KA 1HNWQ 4LF6Q 3CQZH 4KHZA 4POFA 3DM3A 1IL2A 1Y1WG 2Q2IA 4DNIA 4BY1H 3H15A 4X64Q 3IRBA 2AWNA 2AMCB 3PIOA 4DV0L 1J5EQ 3JC66 3KF8B 1UE1A 4EQ5A 1P16A 3KLWA 5DLQE 1Q7YC 2QGQA 3HOXH 3H3VI 4JOIC 3CF5A 2F4VQ 2AWOA 4DR2L 4DR6Q 1GO3E 4R4CA 2DUDA 5E7NA 2Q2TA 3S2HH 2B3GA 2NN6I 4IOAA 3B6YA 4A3LH 1Q1EA 1L1OA 2KENA 1LTLA 1AE3A 2KCTA 1KHIA 1U0LA 3CCSA 1CKNB 3U4VA 4AYBG 4ALPA 1S40A 1M1KC 2UUAQ 2OTJA 1S72A 1CSPA 3KJPA 1NMFA 3G6EA 4C2MH 2KHIA 3GTQH 4DV1Q 3RLFA 1PH3A 4DAYB 1VQBA 1MJEA 1MJCA 2D0PA 3G4SA 1KD1C 1Q86C 4JBMA 3I2ZA 2OQKA 1EIFA 1TWFH 2UU9L 1HNXQ 4JI4L 1N9WA 3GTKH 4PZ8A 5IT9c 4YWKA 3PCOB 3STBD 4AIMA 2Q2UA 4UPAA 2N78A 2R7FA 4A3IH 3RN5A 3T1YL 4A3JH 1QZGA 3CC2A 2ZJPA 1VQ9A 2ASBA 3HKZE 1OXTA 4IJLA 4A3MH 4LFCQ 1PYSB 5C3EG 2NVYH 4JYAQ 1YVCA 3TREA 5FLMH 4GKJQ 4DV3L 1ASYA 4DV4L 4X66Q 2XTIA 3PO3H 4HIMA 2Z0SA 2E2IH 4GLVB 3PUYA 2V1CC 2ZTDA 4A76A 4IFDJ 5AJ3L 4A3EH 1YJWA 1XMQQ 1FJGQ 3K7AH 2I0QA 1UE7A 4DR2Q 1V43A 1X3FA 1OXSC 1FVIA 4BBRG 1NMGA 5IWAQ 1Q82C 1Q1BA 1T9HA 4DV7L 3KDFA 2R93H 4NXMQ 3HFZB 4X6AH 1XNQQ 1VQDA 4YY3L 1A8VA 1V1QA 1WOCA 1N8RC 5IP7H 4YCUA 4LF9Q 1IBLQ 2JA5H 3S17H 5FJ8G 1TWGH 1D7QA 1CSQA 1TXYA 2K5HA 3CAMA 3ULPA 1EYGA 2K75A 4JI1Q 4DR4L 1N32L 5M5WH 1K83H 4X62L 2NVQH 4DR7Q 5K36G 2VW9A 2BA0A 4P72A 2EQSA 5M3MG 1XPOA 2E2HH 1N36L 2CQOA 4P75A 1I5FA 1YZ6A 3CXCA 1VQ5A 3W1BA 3CCEA 4A3FG 1VQ8A 4DUZQ 1I3QH 2R7DA 1EWIA 3F2BA 1X3EA 3CMAA 2DGYA 5C0XI 4DUYQ 4DR5Q 4AQYL 4JI8Q 2YU9H 3W5OA 3WWVA 1HZCA 5ELNA 1NBWA 1OXXK 4B3SL 4YWMA 3BU2A 4JI0L 1YIJA 1NTGA 2VQEL 4GOPC 2PI2A 2UXDQ 4LF6L 3H3VH 1YBYA 1JMCA 3MXNB 5C44H 1K8AC 1X6OA 5IYBH 1KRTA 3J81j 4JBKA 5IP9H 2GN5A 1LUZA 4X64L 3VDYA 4O0AA 4HJ7A 4R4QA 2NZHA 2PNHA 4R4TA 2JK8A 2CFMA 1K8GA 2F4VL 3S1QH 2CWAA 1QUQB 1N34Q 3D0FA 1I94Q 4QIWE 2KCMA 3HOVG 4A93H 4DR6L 4P73A 3KJOA 1PVOA 5IYCG 3UDIA 3FKIH 1XPRA 1K73C 2VNUD 4R1JA 1NY4A 1SR3A 2C35B 2HQLA 2UUAL 1D8LA 4LUZA 3RLNA 5EAYA 1SROA 3RN2A 4A3DG 2VUMH 4BXXH 1PH6A 1E1TA 4DV1L 4A3BG 2AKWB 3CD6A 3CC7A 1VQEA 4RMFA 3I4NG 3GTJH 2ZM6Q 5LMNQ 2E8GA 5M3FG 4L5RC 1BVSA 1LYLA 1EFWA 1VQCA 4K0KQ 1OTCA 3GDEA 3BZKA 2I5LX 4LUOA 5GAEC 1HNXL 1NE3A 1KL9A 1L2FA 1E7ZA 3T1HL 1FGUA 4OWWB 3K8AA 2R7ZH 4J15A 4JI0Q 4LFCL 4JG2A 2XGTA 3CCUA 4A3CH 1I6HH 2WB1G 2A8VA 2VY3A 3KF6A 3ERSX 4JI7Q 1KRSA 4GKJL 3U50C 2K50A 4KLKA 4X66L 1HH2P 5IYDG 1JT8A 2KHJA 3E0EA 1OXUA 3PO2G 1UE6A 1XMQL 4KHPQ 1FJGL 2BH8A 2QA4A 2WFWA 3AYHB 1YHQA 4BA2I 1VQJA 2H5XA 5IWAL 4YCWA 1HR0Q 1VQFA 1JE5A 2VL6A 4A3KG 2JA6G 1VQ7A 2B63H 4NXML 1XTDA 4YCVA 1XNQL 4DPGA 4Y7NH 2ZTEA 4RG1A 4C3HH 4LF9L 4QY7A 4JI6Q 2IT1A 1IBLL 1Y1VG 3AFQA 1WJJA 4MZ9A 2Z6KC 4GLXA 4AYBE 4JI1L 1PA6A 1EQQA 1YNXA 1PH5A 4JI3Q 4DR7L 3UE0A 1GD7A 3KYHC 1K0RA 1B8AA 2VQFL 3AEVA 2F52A 3GTPH 2K52A 3UDGA 2N49A 4HJ8A 4BBSG 4R4OA 3OYYA 5C0XJ 2MFIA 4C3IH 4DUZL 3T1HQ 1SLJA 3ER0A 2YTVA 4DUYL 4DR5L 4JI8L 1E3PA 3J7ZC 4BBRH 2PQAA 2ZJRA 1GM5A 3HOUH 3PUWA 1EIYB 2K5NA 2BH2A 4LUVA 4L5QA 3NBHB 3STBC 4B3RQ 1SFOH 4GOPA 1JB7A 1HNZQ 2UXDL 4WJ4A 4PMWA 2RHSB 1TWCH 3M4OH 5FJ8H 5C4JH 3HOYH 1YHAA 2ATWA 4EX5A 4QGUA 3G71A 3SGIA 4XIGS 2MO0A 1DGSA 4HJAA 1SMXA 1I94L 2OWOA 1N34L 3I56A 4ME3A 5LMUQ 1JJCB 2NN6G 4A3FH 3I55A 1J6QA 3HOWH 3TQYA 5M5XH 3M85A 3L2PA 2E2JH 3H0GH 2CCZA 4LFBQ 1CKNA 1XMOL 1A0IA 3TEHB 3J80i 1MIUA 4LF7Q 1PH2A 2QEXA 1VS0A 3HOZH 3S2DH 4L5TA 1IBML 1PV4A 3RR5A 1KQSA 1EUJA 4OX9Q 4DAMA 1VQLA 2I5HA 2A19A 1CKMA 1X54A 5JJKA 1Y14B 4GN3B 1L0WA 5IY0A 2ZM6L 2VQFQ 5LMNL 1VQHA 4K0KL 4DV2Q 1S3OA 3TS0A 4A3IG 4OWXB 3CCVA 1C9OA 2WAQG 4P74A 4DV5Q 1W2BA 1KAWA 1Q8KA 4LF8Q 2JA8H 1I50H 1QVCA 2HHHQ 3NELA 2YYZA 4WJ3M 5FLMG 1C7YA 2JJQA 3CMEA 3S14H 1VQOA 3RLOA 4JI7L 1A63A 3BZCA 4JI2Q 1KC8C 4A3EG 4HIKA 3MEFA 4GNXB 3U58A 1Q81C 3ICEA 3NENA 1IYJB 3K81C 2K5VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DKA C;  5GRO A;  4IPD A;  4NB3 A;  2RF4 A;  1QZH A;  1X56 A;  4JOI A;  2ALY B;  4KHP L;  3I4N H;  2MO1 A;  2R93 G;  1PH4 A;  1UE5 A;  3S24 A;  1R9T H;  4BA1 I;  1WCM G;  4HJ5 A;  2K4K A;  4HJ9 A;  5IP7 G;  4A3G G;  1HR0 L;  2JA5 G;  1BBU A;  1GKH A;  2IHE A;  4UY8 C;  2OTL A;  4DV6 Q;  1H95 A;  3UE1 A;  4HIO A;  4B3T L;  3K7U C;  1HZB A;  1WFQ A;  1KIX A;  4JI6 L;  3FHW A;  4JI5 Q;  2R92 H;  4JV5 Q;  1V9P A;  1IBM Q;  2Z6K A;  3HKS A;  4BY7 G;  4GLA C;  5C4X G;  3L7Z C;  3AFP A;  3RZO H;  4JI3 L;  3M4P A;  1Y1W H;  1K3R A;  1X55 A;  1VQ4 A;  2CWP A;  3TS2 A;  4DK3 C;  3J81 i;  3PO2 H;  1CUK A;  1YI2 A;  1IXR A;  1YJN A;  3F8T A;  1L1O B;  2YV5 A;  3PGZ A;  1JJG A;  1JJ2 A;  1BBW A;  3J80 c;  2Y0S G;  4PG3 A;  4DR3 Q;  4H02 A;  4X65 Q;  2D0O A;  1SE8 A;  3RNU A;  4A3K H;  2JA6 H;  4B3R L;  1X65 A;  1PYB A;  3Q8D A;  5IYB G;  5IP9 G;  2UXC Q;  1G6P A;  2D62 A;  1HNZ L;  2JA7 G;  3CCQ A;  3OTO L;  4QL5 A;  1PH7 A;  1XMO Q;  2JEA I;  4LF5 L;  1XNR Q;  2WB1 E;  1PH8 A;  3I4O A;  2E5L Q;  3GTO H;  3CPW A;  2K14 A;  2KBN A;  1E22 A;  4NXN Q;  5JJI A;  5BR8 Q;  1UEB A;  2LSS A;  4GN5 A;  3ULL A;  1HJP A;  1QUQ A;  4DR1 Q;  1ASZ A;  4L5S A;  5LMU L;  3GO5 A;  4PZ7 A;  2JA9 A;  4MTN A;  3A5U A;  4LNQ A;  4GS3 A;  5H1S E;  1VQP A;  1IZ6 A;  3K0X A;  1TWA H;  4B3T Q;  3S1N H;  4LFB L;  4JC0 A;  5JJL A;  3I4M G;  3S1M H;  4XTC S;  3A0J A;  4LF7 L;  4OWT B;  1EQR A;  5JEA G;  5C3E H;  1M90 C;  4OX9 L;  3I7F A;  2UXB Q;  4LW1 A;  4P71 A;  5ELO A;  1N33 Q;  2EXD A;  4IPC A;  4DV2 L;  3PF5 A;  3F1Z A;  3GD7 A;  5GQO A;  2R7Z G;  1KXL A;  1LM0 A;  2VS1 A;  3KDF B;  2UUC Q;  2VZA A;  3UDX A;  1G29 1;  4DV5 L;  4LF8 L;  4A3C G;  1VQA A;  1VQN A;  2MNA A;  4B3M Q;  3A5Z B;  1UWV A;  4AH6 A;  2OCE A;  4Y52 H;  4YHH L;  2LXJ A;  3NEM A;  2HHH L;  2EIF A;  2PI2 E;  3E9H A;  3RZD H;  4IPG A;  4IOC A;  4BY1 G;  3M3Y H;  5HGQ A;  3OTO Q;  1VQG A;  1QVG A;  4POG A;  2IX0 A;  4JI2 L;  4JCV E;  2JEB I;  3HOX G;  4LF5 Q;  3J81 c;  4GNX C;  1EOV A;  3OW2 A;  1SRU A;  1IBK Q;  3L0O A;  2IX1 A;  4GKK L;  5LMN W;  1VQM A;  2F3I A;  4A3L G;  1BKB A;  3CP0 A;  2PMZ E;  3W1G A;  3HKZ G;  5M3M H;  2B63 G;  1G51 A;  1VQI A;  4A4I A;  1TWH H;  4LF4 L;  2A1A A;  1RL2 A;  4LFA Q;  4A75 A;  2ZTC A;  2HT1 A;  4DV6 L;  1HZA A;  3EN2 A;  5GAD C;  3CCR A;  3E9I A;  1HZ9 A;  4MNO A;  3FP9 A;  4OXP A;  1FL0 A;  3PUX A;  4JI5 L;  4JV5 L;  4PZ6 A;  5C0X G;  4OON A;  3KOJ A;  1PFS A;  1Z47 A;  1NJI C;  4DV0 Q;  1VQK A;  3TRZ A;  3GTG H;  1E1O A;  1PHJ A;  3S1R H;  3PIP A;  4OO1 G;  4NPS A;  1XJV A;  1W3S A;  4A3J G;  3S16 H;  3HOU G;  4A3M G;  2WP8 J;  4IJH A;  3DLL A;  1AE2 A;  1HR0 W;  3ULJ A;  1L1O C;  3HOV H;  2IHF A;  4YHH Q;  1C0A A;  4DR3 L;  1WCM H;  4IFD G;  4X65 L;  3CCM A;  3GTM H;  2WAQ E;  2RHQ B;  4A3G H;  5IYC H;  5J3B A;  3JAM i;  3CCJ A;  4YWL A;  3PO3 G;  3HOY G;  4QQB X;  5IE8 A;  2UXC L;  4IO9 A;  1XPU A;  3KFU A;  3BJU A;  2GVB A;  4A3D H;  2LXK A;  1Q12 A;  3M7N A;  4GKK Q;  1XNR L;  4O2D A;  2E5L L;  4BY7 H;  3CPF A;  4A3B H;  1B7Y B;  1WI5 A;  2ID0 A;  1SN8 A;  3CCL A;  3J7A 5;  2UU9 Q;  4JI4 Q;  4NXN L;  5C4X H;  3PUZ A;  4JBW A;  4UP7 A;  2UUB L;  2IY5 B;  5M3F H;  1X9N A;  3HOW G;  2BA1 A;  5BR8 L;  3G48 A;  1PH9 A;  4DR1 L;  4LF4 Q;  3H0G G;  3A74 A;  1B70 B;  3ZJY C;  4UP9 A;  3F2C A;  3LGJ A;  3T1Y Q;  1CKO A;  2OQ0 A;  3PV0 A;  1YJ9 A;  1X3G A;  2CKZ B;  3HOZ G;  3M4Q A;  2YTX A;  3K80 C;  3KF6 B;  4OO1 I;  1YIT A;  4QJF A;  4TVA B;  5HY6 A;  1VCI A;  1P8L A;  1HNW L;  5M5Y H;  1PH1 A;  4DV3 Q;  4DV4 Q;  2GVA A;  2ES2 A;  2HIX A;  3M9B A;  4TQU S;  5AJ3 Q;  2JA7 H;  1J5E L;  3AQQ A;  2UXB L;  4KI0 A;  4IFD I;  1N33 L;  2JA8 G;  2I5M X;  5IYD H;  3CC4 A;  1YHB A;  2Q2H A;  5GAH C;  2N8N A;  1WYD A;  3PSI A;  2NZO A;  2NVT H;  4DV7 Q;  2UUC L;  3PUV A;  2YTY A;  4JBJ A;  1VQ6 A;  4APV A;  4UP8 A;  4YY3 Q;  5GAG C;  2NVX H;  4B3M L;  4HID A;  2JE6 I;  2N3S A;  2RCN A;  2L15 A;  4GN4 B;  2ZJQ A;  1YEZ A;  2HIV A;  3PF4 A;  1O7I A;  5C44 G;  1E24 A;  3F2D A;  2Y0S E;  4C3J H;  1Q46 A;  3UDF A;  5FLX c;  4DR4 Q;  1N32 Q;  3I4M H;  1AH9 A;  4X62 Q;  1A62 A;  4GNX A;  1Y1V H;  3D31 A;  1Z9F A;  3U4Z A;  2JQO A;  3GTL H;  4A93 G;  1IBK L;  2R6G A;  1N36 Q;  4FDB A;  3S15 H;  3EIV A;  4IPH A;  2UUB Q;  3EBE A;  1GVP A;  4R4I A;  2MQH A;  2AHO B;  3FKI G;  5JEA J;  2B29 A;  4AQY Q;  3CW2 C;  1QVF A;  3JAM c;  1K9M C;  1OXV A;  2PQA B;  4BBS H;  4B3S Q;  2VUM G;  1RIP A;  4DK6 C;  2R92 G;  1MKH A;  4BXX G;  2FXQ A;  4LFA L;  4LWC A;  4GOP B;  2VQE Q;  4JYA L;  1U5K A;  1HNW Q;  4LF6 Q;  3CQZ H;  4KHZ A;  4POF A;  3DM3 A;  1IL2 A;  1Y1W G;  2Q2I A;  4DNI A;  4BY1 H;  3H15 A;  4X64 Q;  3IRB A;  2AWN A;  2AMC B;  3PIO A;  4DV0 L;  1J5E Q;  3JC6 6;  3KF8 B;  1UE1 A;  4EQ5 A;  1P16 A;  3KLW A;  5DLQ E;  1Q7Y C;  2QGQ A;  3HOX H;  3H3V I;  4JOI C;  3CF5 A;  2F4V Q;  2AWO A;  4DR2 L;  4DR6 Q;  1GO3 E;  4R4C A;  2DUD A;  5E7N A;  2Q2T A;  3S2H H;  2B3G A;  2NN6 I;  4IOA A;  3B6Y A;  4A3L H;  1Q1E A;  1L1O A;  2KEN A;  1LTL A;  1AE3 A;  2KCT A;  1KHI A;  1U0L A;  3CCS A;  1CKN B;  3U4V A;  4AYB G;  4ALP A;  1S40 A;  1M1K C;  2UUA Q;  2OTJ A;  1S72 A;  1CSP A;  3KJP A;  1NMF A;  3G6E A;  4C2M H;  2KHI A;  3GTQ H;  4DV1 Q;  3RLF A;  1PH3 A;  4DAY B;  1VQB A;  1MJE A;  1MJC A;  2D0P A;  3G4S A;  1KD1 C;  1Q86 C;  4JBM A;  3I2Z A;  2OQK A;  1EIF A;  1TWF H;  2UU9 L;  1HNX Q;  4JI4 L;  1N9W A;  3GTK H;  4PZ8 A;  5IT9 c;  4YWK A;  3PCO B;  3STB D;  4AIM A;  2Q2U A;  4UPA A;  2N78 A;  2R7F A;  4A3I H;  3RN5 A;  3T1Y L;  4A3J H;  1QZG A;  3CC2 A;  2ZJP A;  1VQ9 A;  2ASB A;  3HKZ E;  1OXT A;  4IJL A;  4A3M H;  4LFC Q;  1PYS B;  5C3E G;  2NVY H;  4JYA Q;  1YVC A;  3TRE A;  5FLM H;  4GKJ Q;  4DV3 L;  1ASY A;  4DV4 L;  4X66 Q;  2XTI A;  3PO3 H;  4HIM A;  2Z0S A;  2E2I H;  4GLV B;  3PUY A;  2V1C C;  2ZTD A;  4A76 A;  4IFD J;  5AJ3 L;  4A3E H;  1YJW A;  1XMQ Q;  1FJG Q;  3K7A H;  2I0Q A;  1UE7 A;  4DR2 Q;  1V43 A;  1X3F A;  1OXS C;  1FVI A;  4BBR G;  1NMG A;  5IWA Q;  1Q82 C;  1Q1B A;  1T9H A;  4DV7 L;  3KDF A;  2R93 H;  4NXM Q;  3HFZ B;  4X6A H;  1XNQ Q;  1VQD A;  4YY3 L;  1A8V A;  1V1Q A;  1WOC A;  1N8R C;  5IP7 H;  4YCU A;  4LF9 Q;  1IBL Q;  2JA5 H;  3S17 H;  5FJ8 G;  1TWG H;  1D7Q A;  1CSQ A;  1TXY A;  2K5H A;  3CAM A;  3ULP A;  1EYG A;  2K75 A;  4JI1 Q;  4DR4 L;  1N32 L;  5M5W H;  1K83 H;  4X62 L;  2NVQ H;  4DR7 Q;  5K36 G;  2VW9 A;  2BA0 A;  4P72 A;  2EQS A;  5M3M G;  1XPO A;  2E2H H;  1N36 L;  2CQO A;  4P75 A;  1I5F A;  1YZ6 A;  3CXC A;  1VQ5 A;  3W1B A;  3CCE A;  4A3F G;  1VQ8 A;  4DUZ Q;  1I3Q H;  2R7D A;  1EWI A;  3F2B A;  1X3E A;  3CMA A;  2DGY A;  5C0X I;  4DUY Q;  4DR5 Q;  4AQY L;  4JI8 Q;  2YU9 H;  3W5O A;  3WWV A;  1HZC A;  5ELN A;  1NBW A;  1OXX K;  4B3S L;  4YWM A;  3BU2 A;  4JI0 L;  1YIJ A;  1NTG A;  2VQE L;  4GOP C;  2PI2 A;  2UXD Q;  4LF6 L;  3H3V H;  1YBY A;  1JMC A;  3MXN B;  5C44 H;  1K8A C;  1X6O A;  5IYB H;  1KRT A;  3J81 j;  4JBK A;  5IP9 H;  2GN5 A;  1LUZ A;  4X64 L;  3VDY A;  4O0A A;  4HJ7 A;  4R4Q A;  2NZH A;  2PNH A;  4R4T A;  2JK8 A;  2CFM A;  1K8G A;  2F4V L;  3S1Q H;  2CWA A;  1QUQ B;  1N34 Q;  3D0F A;  1I94 Q;  4QIW E;  2KCM A;  3HOV G;  4A93 H;  4DR6 L;  4P73 A;  3KJO A;  1PVO A;  5IYC G;  3UDI A;  3FKI H;  1XPR A;  1K73 C;  2VNU D;  4R1J A;  1NY4 A;  1SR3 A;  2C35 B;  2HQL A;  2UUA L;  1D8L A;  4LUZ A;  3RLN A;  5EAY A;  1SRO A;  3RN2 A;  4A3D G;  2VUM H;  4BXX H;  1PH6 A;  1E1T A;  4DV1 L;  4A3B G;  2AKW B;  3CD6 A;  3CC7 A;  1VQE A;  4RMF A;  3I4N G;  3GTJ H;  2ZM6 Q;  5LMN Q;  2E8G A;  5M3F G;  4L5R C;  1BVS A;  1LYL A;  1EFW A;  1VQC A;  4K0K Q;  1OTC A;  3GDE A;  3BZK A;  2I5L X;  4LUO A;  5GAE C;  1HNX L;  1NE3 A;  1KL9 A;  1L2F A;  1E7Z A;  3T1H L;  1FGU A;  4OWW B;  3K8A A;  2R7Z H;  4J15 A;  4JI0 Q;  4LFC L;  4JG2 A;  2XGT A;  3CCU A;  4A3C H;  1I6H H;  2WB1 G;  2A8V A;  2VY3 A;  3KF6 A;  3ERS X;  4JI7 Q;  1KRS A;  4GKJ L;  3U50 C;  2K50 A;  4KLK A;  4X66 L;  1HH2 P;  5IYD G;  1JT8 A;  2KHJ A;  3E0E A;  1OXU A;  3PO2 G;  1UE6 A;  1XMQ L;  4KHP Q;  1FJG L;  2BH8 A;  2QA4 A;  2WFW A;  3AYH B;  1YHQ A;  4BA2 I;  1VQJ A;  2H5X A;  5IWA L;  4YCW A;  1HR0 Q;  1VQF A;  1JE5 A;  2VL6 A;  4A3K G;  2JA6 G;  1VQ7 A;  2B63 H;  4NXM L;  1XTD A;  4YCV A;  1XNQ L;  4DPG A;  4Y7N H;  2ZTE A;  4RG1 A;  4C3H H;  4LF9 L;  4QY7 A;  4JI6 Q;  2IT1 A;  1IBL L;  1Y1V G;  3AFQ A;  1WJJ A;  4MZ9 A;  2Z6K C;  4GLX A;  4AYB E;  4JI1 L;  1PA6 A;  1EQQ A;  1YNX A;  1PH5 A;  4JI3 Q;  4DR7 L;  3UE0 A;  1GD7 A;  3KYH C;  1K0R A;  1B8A A;  2VQF L;  3AEV A;  2F52 A;  3GTP H;  2K52 A;  3UDG A;  2N49 A;  4HJ8 A;  4BBS G;  4R4O A;  3OYY A;  5C0X J;  2MFI A;  4C3I H;  4DUZ L;  3T1H Q;  1SLJ A;  3ER0 A;  2YTV A;  4DUY L;  4DR5 L;  4JI8 L;  1E3P A;  3J7Z C;  4BBR H;  2PQA A;  2ZJR A;  1GM5 A;  3HOU H;  3PUW A;  1EIY B;  2K5N A;  2BH2 A;  4LUV A;  4L5Q A;  3NBH B;  3STB C;  4B3R Q;  1SFO H;  4GOP A;  1JB7 A;  1HNZ Q;  2UXD L;  4WJ4 A;  4PMW A;  2RHS B;  1TWC H;  3M4O H;  5FJ8 H;  5C4J H;  3HOY H;  1YHA A;  2ATW A;  4EX5 A;  4QGU A;  3G71 A;  3SGI A;  4XIG S;  2MO0 A;  1DGS A;  4HJA A;  1SMX A;  1I94 L;  2OWO A;  1N34 L;  3I56 A;  4ME3 A;  5LMU Q;  1JJC B;  2NN6 G;  4A3F H;  3I55 A;  1J6Q A;  3HOW H;  3TQY A;  5M5X H;  3M85 A;  3L2P A;  2E2J H;  3H0G H;  2CCZ A;  4LFB Q;  1CKN A;  1XMO L;  1A0I A;  3TEH B;  3J80 i;  1MIU A;  4LF7 Q;  1PH2 A;  2QEX A;  1VS0 A;  3HOZ H;  3S2D H;  4L5T A;  1IBM L;  1PV4 A;  3RR5 A;  1KQS A;  1EUJ A;  4OX9 Q;  4DAM A;  1VQL A;  2I5H A;  2A19 A;  1CKM A;  1X54 A;  5JJK A;  1Y14 B;  4GN3 B;  1L0W A;  5IY0 A;  2ZM6 L;  2VQF Q;  5LMN L;  1VQH A;  4K0K L;  4DV2 Q;  1S3O A;  3TS0 A;  4A3I G;  4OWX B;  3CCV A;  1C9O A;  2WAQ G;  4P74 A;  4DV5 Q;  1W2B A;  1KAW A;  1Q8K A;  4LF8 Q;  2JA8 H;  1I50 H;  1QVC A;  2HHH Q;  3NEL A;  2YYZ A;  4WJ3 M;  5FLM G;  1C7Y A;  2JJQ A;  3CME A;  3S14 H;  1VQO A;  3RLO A;  4JI7 L;  1A63 A;  3BZC A;  4JI2 Q;  1KC8 C;  4A3E G;  4HIK A;  3MEF A;  4GNX B;  3U58 A;  1Q81 C;  3ICE A;  3NEN A;  1IYJ B;  3K81 C;  2K5V A; 
#chains in the Genus database with same CATH topology
 3DXJ C;  4IPD A;  4AYB A;  4ZKB B;  1QZH A;  5FD5 A;  3KHH A;  4F4Z A;  5T1I A;  2VA3 A;  2MO1 A;  4B9X A;  1RDP D;  2NBF A;  4TV9 F;  1E4G T;  4BA1 I;  1WCM G;  2K4K A;  4HJ9 A;  4A3G G;  3VPC A;  2JA5 G;  4UY8 C;  1GKH A;  2IHE A;  3NE5 B;  1TWH B;  2A6E D;  1S10 A;  3T13 A;  3K7U C;  3KBG A;  1HZB A;  1WFQ A;  4UCV A;  4BWS C;  1Y8N B;  1AP0 A;  3HKS A;  4BY7 G;  4KKU A;  2IA6 A;  4GLA C;  3EQL C;  1VAJ A;  1Q90 A;  4JI3 L;  3M4P A;  2JEG A;  4EQN A;  4QB4 A;  2RGV A;  4JW0 A;  4KY7 A;  4RCN A;  3TS2 A;  4DK3 C;  1MSG A;  3GTG B;  1O7L A;  4ZQ3 A;  1IXR A;  1YJN A;  1EQT A;  1D5Z C;  2I46 A;  3PGZ A;  2RVL A;  4EVO A;  3J80 c;  2Y0S G;  1GSH A;  1EU3 A;  4X65 Q;  2PN1 A;  5A2Q W;  1QCB D;  3KBX A;  4K2L A;  1PYB A;  2UXC Q;  1WCM B;  1ESF A;  2R6F A;  4YR0 A;  4NXN H;  4A3G B;  2JA7 G;  3CCQ A;  1ZXT A;  2D9U A;  3OMC A;  2KSW A;  3RB6 A;  5IT9 W;  4NXN Q;  3HBL A;  2C2R A;  4BY7 B;  1ASZ A;  1ICW A;  1QUQ A;  3ULL A;  4DR1 Q;  4S3S A;  1MBY A;  4L5S A;  1W93 A;  2JA9 A;  5G3L F;  1I3Q B;  4R9W A;  3S1N H;  3NK9 A;  2B39 A;  3G6X A;  4LF7 L;  4OWT B;  1BO0 A;  3BVZ A;  1H9M A;  3H0G A;  3OPO A;  1PFB A;  2Y0S B;  5KFC A;  1RK5 A;  3ETJ A;  4LH7 A;  4OX9 L;  4F87 A;  1X32 A;  4LW1 A;  3BJY A;  1ZHQ A;  2EXD A;  5KX5 F;  3PW2 A;  5C3W A;  2JA7 B;  2R7Z G;  5GQO A;  1A2T A;  1HNZ H;  4DV5 L;  1VQA A;  1VQN A;  2MNA A;  4O3O A;  3A5Z B;  3NEM A;  2PI2 E;  3P1H A;  2PQE A;  4IPG A;  3M3Y H;  2IL8 A;  5LHY 1;  2EYJ A;  5HGQ A;  2NVX B;  1IOW A;  5E3F A;  1VQG A;  3NTI A;  4POG A;  4JI2 L;  2NTT A;  4NKL A;  3HOX G;  3J81 c;  5JVH 3;  3GII A;  1SRU A;  3L0O A;  4ULL A;  1VQM A;  4A3L G;  3CP0 A;  5L1L A;  2F0V A;  1UC8 A;  3W1G A;  5KFP A;  2B63 G;  1G51 A;  1DOM A;  1SYE A;  2BQR A;  3WO1 A;  2A1A A;  3IAY A;  1K28 A;  2FMA A;  2E2D C;  1HZA A;  2CW0 D;  3EN2 A;  5GAD C;  3KAJ A;  2F0H A;  4MNO A;  4BBS B;  4RUC A;  4OXP A;  3WDN A;  3PUX A;  2YRX A;  2IWH A;  1A2U A;  1KDC A;  4OON A;  4QF4 A;  4TUY F;  1PFS A;  1WTO A;  5I2X A;  2X6G A;  1C30 A;  4JPB W;  2ZXP A;  3PIP A;  1LT6 D;  2XD4 A;  1W3S A;  4A3J G;  3S16 H;  1KJ8 A;  3HG9 A;  3HOX B;  1SE4 A;  4IJH A;  5KFM A;  2IHF A;  5KFB A;  1IW7 C;  4GKK H;  2RHQ B;  4O4I F;  5ELB A;  4I7H A;  1RTO A;  2B63 B;  1AZQ A;  3R5F A;  3RTX A;  3KFU A;  2A5H A;  1EZ8 A;  2LXK A;  3GTQ B;  4GKK Q;  1QJO A;  2E5L L;  3D6C A;  3DUZ A;  4M7E A;  3CCL A;  3J7A 5;  4JI4 Q;  1JKJ B;  4JBW A;  4UP7 A;  2N55 A;  4OGQ C;  5M3F H;  1X9N A;  5BPH A;  3GTO A;  4JI5 H;  3NWS A;  1SEI A;  3A74 A;  1LTT D;  4OEL B;  1JDB B;  3F2C A;  2WE6 A;  3MR3 A;  1CKO A;  2OQ0 A;  3GTK B;  5KFQ A;  5IGB A;  1B4O A;  3TZD A;  4A3I B;  3K80 C;  4A3J B;  2J6T A;  1RKN A;  3GV3 A;  2EYO A;  4QJF A;  4TVA B;  1LO5 D;  3TZU A;  3ND8 A;  5M5Y H;  4I55 F;  1UUP A;  4RH6 A;  4DV3 Q;  1T36 A;  2NVY B;  1GUG A;  2I07 B;  1HHV A;  1V1P A;  2N88 A;  4RKL A;  4O1N A;  4I7Z C;  1RJP A;  1Z7T A;  3M4I A;  1N33 L;  4KY6 A;  1GUN A;  2I5M X;  5CA1 F;  5EDW A;  3I8Z A;  3C1E A;  1WYD A;  1O80 A;  2YTY A;  4APV A;  3BDO A;  4B3M L;  4DXG A;  1Y69 U;  4YIJ A;  3PF4 A;  4CKB A;  3F2D A;  3VR4 A;  3KHL A;  3UFX B;  5FLX c;  2NTS A;  3I4M H;  5BR8 H;  1DOK A;  2B8F A;  2JSO A;  2R85 A;  1A62 A;  1Z9F A;  4AQY H;  2JQO A;  4J9S A;  3ERQ A;  3VYR A;  1CZG A;  1SNC A;  1IBK L;  2YZM A;  4OL7 A;  4FDB A;  3S15 H;  3FRP B;  5KFK A;  1EU4 A;  4HNV A;  5JEA J;  5KFZ A;  4LF6 H;  4UCR A;  4AQY Q;  3CW2 C;  4QIW B;  3VR3 A;  1EOT A;  4B3S Q;  4FF3 A;  4PWQ A;  1BCP B;  1RIP A;  4DK6 C;  4TRD A;  1J5E H;  1O7Z A;  1U5K A;  4F4Y A;  4LF6 Q;  3R23 A;  2BE5 D;  4DNI A;  2RDJ A;  4GC6 A;  3IKJ A;  3IRB A;  2AWN A;  2K28 A;  4X64 Q;  2EDG A;  3EPG A;  1J5E Q;  3RGZ A;  3L9A X;  1Q7Y C;  3VR6 A;  4R4C A;  5E7N A;  2B3G A;  4H13 C;  4ZQI A;  3I4L A;  4Q5V A;  1FKA H;  2HUG A;  1L1O A;  1EZ6 A;  5KKN B;  1KHI A;  3SK4 A;  5IGD A;  2AQ4 A;  4G3I A;  3V6J A;  3MWY W;  1VBG A;  4OIK A;  1K0S A;  1XDN A;  1C4Q A;  4EFB A;  1HPC A;  2R8G A;  2R3Z A;  4J9Q A;  3GTM A;  2L5T A;  5CC4 A;  1VQB A;  4YQW A;  3RBE A;  2LFN A;  2RCF A;  5BPF A;  5HGT A;  4QW9 A;  4RAY A;  1EIF A;  1IYU A;  2UU9 L;  3FDT A;  5KG3 A;  1N9W A;  4DL4 A;  2MHV A;  2MPM A;  3HEJ A;  4PZ8 A;  3VR5 A;  3STB D;  2V4R A;  2F0M A;  1CS0 A;  3N40 P;  2R7F A;  4JV2 A;  1QZG A;  3T1Y L;  3M4Y A;  3BA8 A;  3K5H A;  3SHL A;  3VYT A;  1VQ9 A;  2ASB A;  2LKV A;  5A35 A;  4A3M H;  2NU8 B;  1S03 G;  2Z4I A;  1AUX A;  5E4W C;  3RB3 A;  3JAM E;  4IFD H;  1K8O A;  4RWS C;  2F0L A;  3UI2 A;  1LTS D;  4UCS A;  2NU7 B;  4X66 Q;  1EIG A;  5IWA H;  5JVL A;  2Z0S A;  2E2I H;  1JE4 A;  4GLV B;  2V1C C;  5DEH A;  4A76 A;  1YJW A;  1FNU A;  2I0Q A;  3C46 A;  3GQB A;  3G6Y A;  3BVM A;  1NMG A;  5IWA Q;  4J9M A;  2EYL A;  2R93 H;  1LT5 D;  3BZD B;  2B2W C;  1DZ1 A;  1WR2 A;  4C1N I;  3J7Y W;  1N8R C;  4TKO B;  2F0E A;  3DHQ A;  2A69 D;  5NUC A;  5FJ8 G;  1D7Q A;  1EYG A;  1L0X B;  1L2Z A;  3ULP A;  2NUC A;  1M6V A;  3U9S A;  4UCO A;  1Q8I A;  2J0T D;  4DR7 Q;  4RGN A;  4DR5 H;  4JI8 H;  2EE1 A;  1XPO A;  3HXL A;  4B9W A;  2E2H H;  2AQ3 B;  2CQO A;  4EBE A;  4TQR A;  1Y1V A;  3CCE A;  4A3F G;  3RFC A;  2AU0 A;  3GTL A;  1CT1 D;  4ZRZ A;  1S5F D;  3ETH A;  3GIQ A;  1EWI A;  1DXM A;  4U6P A;  3OSP A;  2DGY A;  4DR5 Q;  3T56 B;  4JI8 Q;  3WWV A;  1I4R A;  4C1N K;  4EFE A;  4YWM A;  5KT4 A;  4RGT A;  4RB1 A;  1BCP C;  4JI0 L;  3LNN A;  1YIJ A;  1PRT D;  1NTG A;  1PMR A;  3WOF A;  2Z8L A;  3H3V H;  2K1B A;  2Q8T A;  3G7L A;  1JMC A;  2AGP A;  5C44 H;  4IHJ F;  4JBK A;  5IP9 H;  1PTO H;  2GN5 A;  1W96 A;  5CA0 F;  5I47 A;  2B2V C;  2NZH A;  3M4O B;  1B3A A;  2J9G A;  5CV4 A;  5E4X A;  2F4V L;  3S1Q H;  2CWA A;  4DR6 L;  1II3 A;  2KCM A;  2F4I A;  4P73 A;  2DJF C;  1WSC A;  3G6J B;  3T51 B;  3KJO A;  3OSN A;  1M0T A;  4X62 H;  5GON F;  4XQQ A;  1NCV A;  4R1J A;  3HGB A;  2C35 B;  2UUA L;  5EWE A;  5COY A;  2ASL A;  4A3F B;  1SRO A;  3Q23 A;  3R5H A;  3CHB D;  4XYM B;  4DV1 L;  1WTX A;  1KJI A;  3RJ0 A;  1WTV A;  5M3F G;  1LT3 D;  1TII D;  1BVS A;  3N42 B;  5M9O A;  3BZK A;  2I5L X;  1R4P B;  1HNX L;  2D5D A;  3T1H L;  2W9C A;  4OWW B;  4P2C B;  4U67 3;  3KHG A;  1PYW D;  2V9W A;  4O4L F;  4JV0 A;  3MR6 A;  2FMC A;  3FPP A;  4X3U A;  2CVR A;  3MWM A;  3OHX C;  4JI7 Q;  4RNO A;  3KK7 A;  2VQD A;  1D1K A;  3ORQ A;  2QW7 A;  3OHB A;  2HDM A;  3E0E A;  3SE0 A;  3TP8 A;  3AB9 A;  1FJG L;  4RU9 A;  1YHQ A;  2H5X A;  5KFO A;  2O5I C;  1KLG D;  3MR5 A;  1ENF A;  3BQ0 A;  1RF2 D;  2PW5 A;  4KJN A;  5M3F B;  2JA6 G;  5A2Q L;  4NXM L;  1XTD A;  3NTH A;  5T1G A;  5EPL A;  2XNA C;  4KTA A;  4MZ9 A;  4GLX A;  4G7O C;  5FO8 B;  1PA6 A;  1EQQ A;  3U9T A;  1TWG A;  5CV5 A;  4KKS A;  1GD7 A;  1Z2O X;  1STY A;  5IT9 L;  1B8A A;  3AEV A;  3Q8P B;  1K83 A;  4CGY B;  2N49 A;  4B3R H;  4R4O A;  3OYY A;  1KC7 A;  5C0X J;  2ENB A;  2ASD A;  1F9S A;  5EKL A;  4RUA A;  4DUY L;  2YTV A;  4RB0 A;  2QCP X;  1GM5 A;  4BBR H;  4YP3 A;  3J7A V;  4B3R Q;  2YU9 A;  3I90 A;  4GOP A;  4N9T A;  5DAU A;  4WJ4 A;  2JA6 B;  4UAI A;  4ZKC B;  1T5X D;  4O3N A;  4EX5 A;  1CM9 A;  1DOL A;  1DGS A;  1Y8P B;  5JAV A;  4HJA A;  1F2M A;  2TMP A;  4KMU C;  2OWO A;  1N34 L;  3VA7 A;  3D4R A;  1JJC B;  1DIK A;  3GV8 B;  2YL2 A;  4RFB A;  3RV3 A;  3H0G H;  4RHS A;  1CKN A;  3PIO 3;  2XGQ A;  3J80 i;  1EUD B;  4YAJ B;  3FKI A;  3HOZ H;  3S2D H;  3LX0 A;  4L5T A;  3VA5 A;  2VB3 X;  3K58 A;  1KQS A;  1EUJ A;  1HFG A;  5C1P A;  4DK0 A;  3TQ1 A;  3MXG A;  2JYO A;  1VQH A;  4DV2 Q;  2W57 A;  4OWX B;  3DM1 A;  2WAQ G;  1S5B D;  1W2B A;  1KAW A;  2UXD H;  3M9N B;  1FYC A;  2KED A;  3V6H A;  2BR0 A;  3NQT A;  4HYK A;  3S14 H;  2CH4 A;  3G6V A;  5EZY F;  2C2D A;  1BDO A;  3OW7 A;  3RZD B;  3RLO A;  1KNE A;  1I94 H;  2FLP A;  2A68 D;  2HGS A;  4N8X 1;  1Q81 C;  3NEN A;  1S5E D;  4JG2 A;  4DKA C;  5GRO A;  2NU9 B;  1WVL A;  2KJX A;  3LWU A;  4FBT A;  4JOI A;  1TT2 A;  4KHP L;  3NXW A;  2R93 G;  5C3X A;  4BS9 A;  1IBM H;  5M3M B;  3SEB A;  4DV6 Q;  1H95 A;  2F0W A;  4HIO A;  3TIG A;  5D14 A;  2ZM6 H;  5CV8 A;  5LMN H;  3SR1 A;  1KIX A;  3NGD A;  3D3R A;  2WAQ B;  4C5A A;  1IBM Q;  4QWA A;  2Z6K A;  4XX0 B;  1HUM A;  3KLS A;  5LYJ F;  5KT5 A;  3P7J A;  5L37 A;  5C4X G;  1VBH A;  3L7Z C;  4J0M A;  3TDQ A;  3AFP A;  1ZKO A;  1B6R A;  5EPK A;  4HCS A;  2CWP A;  4BWG B;  1HFN A;  3J81 i;  3FMC A;  3S1R B;  4E6I A;  1JJG A;  2B2T C;  4DR3 Q;  4ILW A;  1CK1 A;  4MV7 A;  3RF2 A;  4EYH B;  1XMO H;  5J2U F;  1XNR H;  1L0Y B;  5F9N A;  3RNU A;  4A3K H;  5IP9 G;  4DN4 M;  1HNZ L;  5LXT F;  1KJ9 A;  3KAK A;  4Q8F A;  2BQ3 A;  2FPP B;  1XMO Q;  3MXN A;  1SYG A;  1XNR Q;  1HR0 H;  1PH8 A;  1F9R A;  3GTO H;  1QWY A;  1BUV T;  1TWC A;  4B3T H;  2W8K A;  5JJI A;  5DG8 A;  1UEB A;  4A3B B;  4JI6 H;  2RSO A;  4DAV A;  2QIL A;  5C4X B;  1Z2N X;  2PBZ A;  3A5U A;  5KNC A;  2L0C A;  1ZYR D;  4GS3 A;  4XDX A;  1IZ6 A;  3K0X A;  1ZHS A;  2NUA B;  4B3T Q;  5JJL A;  4LFB L;  4JC0 A;  3A0J A;  1X3Q A;  2CZG A;  1UC9 A;  1PZJ D;  1NR2 A;  2K32 A;  1M90 C;  3OIQ A;  1KDA A;  2UUC H;  3I7F A;  1J9O A;  3QJY A;  2UXB Q;  1YNN D;  1SCU B;  4WD3 A;  1PTO B;  4IPC A;  4FO2 A;  3PF5 A;  2R7M A;  3GD7 A;  1WTR A;  1KXL A;  3T4A C;  2VS1 A;  2UUC Q;  3OTO H;  1G6Z A;  5I6Y A;  1PZK D;  4AH6 A;  1EYZ A;  4LF5 H;  2XRQ D;  3ONA B;  4IOC A;  1S9F A;  1I50 A;  1RYS A;  1CA5 A;  3H40 A;  3KLR A;  3OTO Q;  2IX0 A;  4RNN A;  3DEO A;  4LF5 Q;  2EY1 A;  4FBU A;  5LMU H;  1X3P A;  2IX1 A;  4GKK L;  4R8U A;  4KD4 A;  2AGQ A;  5LMN W;  1JXL A;  3GIK A;  5K36 H;  1EUC B;  3AU7 A;  3HKZ G;  3QFF A;  4M8A A;  2NYZ D;  1SMY D;  4A4I A;  2FKL A;  4F4W A;  5FOB B;  3MXP A;  3K3V A;  4LFA Q;  1BBX C;  2HT1 A;  1BGW A;  3N52 A;  3EFX D;  1EHI A;  1Z6H A;  4KN4 C;  1BXT A;  5LP6 F;  3N43 B;  5FK9 C;  4JI5 L;  5JUM A;  4JV5 L;  2F0F A;  5EPJ A;  2R86 A;  3KOJ A;  3GV6 A;  3QB3 A;  3CQZ B;  4DV0 Q;  1NJI C;  4LF8 H;  1STE A;  3TII A;  1E1O A;  2R92 A;  1J8I A;  4YHH H;  2HHH H;  1XJV A;  4DLK A;  1Y1W A;  2A6H C;  2WP8 J;  2QDB A;  3DLL A;  1HR0 W;  3HOV H;  1C0A A;  4YHH Q;  3S2H B;  2ZJT A;  2XIW A;  1MGS A;  3BS1 A;  1GLV A;  1WTQ A;  3GTM H;  5IYC H;  1U4L A;  5J3B A;  3HKZ B;  3DMU A;  4YWL A;  1HA6 A;  3NWT A;  1XPU A;  1B9N A;  4A3D H;  5KG2 A;  4QMG A;  4C2M B;  3QR8 A;  2FJ2 A;  1B7Y B;  1WI5 A;  1YNJ D;  5KFS A;  5KIX A;  2IY5 B;  4LSA A;  1BXR A;  2BA1 A;  5BR8 L;  3G48 A;  1GUO A;  1TWF B;  3H0G G;  4O2A F;  3PVX A;  3ZJY C;  4UP9 A;  1JIH A;  3Q8Q B;  2CKZ B;  4KHV A;  3HOZ G;  4HNT A;  1LTR D;  2YTX A;  3KF6 B;  4FXG C;  1YIT A;  4O42 A;  1P8L A;  1G2T A;  1PZI D;  2Z6B A;  1TWA A;  1SYD A;  2JXM B;  4DV4 Q;  5KFU A;  2C00 A;  2F0I A;  4KJO A;  2GVA A;  4IQZ A;  4UDU C;  2HVQ A;  4ECV A;  1EY5 A;  3AQQ A;  1J5E L;  4KI0 A;  3H3V C;  5LOV F;  2R7K A;  3Q0A A;  4X65 H;  3BG3 A;  3CC4 A;  1YHB A;  3A7L A;  3OMG A;  5D8D A;  1BNC A;  2N8N A;  5IOC A;  1PTO C;  2NZO A;  2NVT H;  4DL3 A;  2UXC H;  4DV7 Q;  3V4S A;  5CV7 A;  1GSO A;  1N32 H;  3MTS A;  3H94 A;  1HQR D;  2N3S A;  4YR3 A;  1CQI B;  4WJW A;  1E24 A;  4K8I A;  2Y0S E;  4C3J H;  2UUB H;  2IW3 A;  1N32 Q;  3PQI A;  2JA5 B;  4DR1 H;  3SI8 A;  1Y1V H;  3GTL H;  3HOZ B;  4A93 G;  5JEA H;  4MAM A;  5KFV A;  2R6G A;  5C4H A;  4DA2 A;  5M5W B;  4FYD A;  1XX8 A;  2NVQ B;  4EG0 A;  3T5K A;  4IPH A;  2UUB Q;  3EBE A;  4MIU A;  2FIN B;  4J8Q A;  1HNW H;  1LV9 A;  1ROD A;  3JAM c;  2PQA B;  2F0T A;  3MFH A;  2VUM G;  2WIN B;  1U4P A;  1S0N A;  1STB A;  2FXQ A;  3R2T A;  5D3I B;  1TWH A;  1GXD C;  3A8I E;  2VQE Q;  1HNW Q;  2ATL A;  1XXG A;  4POF A;  4ZK9 B;  1PTO F;  4BY1 H;  4H0L C;  3PIO A;  3JC6 6;  2B2Y A;  2XCA A;  3NPP A;  4MN3 A;  5DLQ E;  1EWH A;  1TS2 A;  3CF5 A;  1JOO A;  5KT2 A;  1GO3 E;  4FS1 A;  2DUD A;  3GTG A;  2Q2T A;  4IOA A;  4A93 B;  1AE3 A;  1SNM A;  1S40 A;  4V0B A;  4ALP A;  2VB2 X;  1S72 A;  4L63 B;  1E4E B;  3MFY A;  2KHI A;  1WCM A;  4Q44 A;  1SAP A;  3NSW A;  2VUM B;  4DAY B;  1WTP A;  1A3V A;  3LML A;  1MJC A;  2D0P A;  1AN8 A;  1Q86 C;  1FNW A;  3I2Z A;  5IGF A;  1CFM A;  1DON A;  2KUM A;  1JOQ A;  4JYA H;  4YWK A;  3PCO B;  4OO1 H;  5KG0 A;  1EYC A;  4UPA A;  5H80 A;  1QOH A;  3CC2 A;  2D2C C;  4KY5 A;  4IJL A;  1OXT A;  2XVS A;  4LFC Q;  3VPD A;  1TQO A;  3EA6 A;  4JYA Q;  4U7C A;  2R7Z B;  2EYM A;  4APM A;  3TRE A;  1ASY A;  3JRW A;  4H44 C;  4HED A;  3PO3 H;  1ZQ7 A;  4TQS A;  4HIM A;  2Y0S A;  5AJ3 L;  1XMQ Q;  1AN7 A;  4M9U A;  3GTO B;  4LF9 H;  4K8J A;  4G7Z C;  2JA7 A;  2Q8I B;  1T9H A;  4JI1 H;  4HR7 B;  2B2U A;  4YY3 L;  2EY2 A;  1A8V A;  4LF9 Q;  4YCU A;  4HMI A;  1IBL Q;  3S17 H;  3NBH A;  3MXU A;  4MV3 A;  1TWG H;  2ZXR A;  3CAM A;  4JI4 H;  2NVX A;  3BYY B;  2FPG B;  2K75 A;  3CRL C;  4JI1 Q;  1A15 A;  4DR4 L;  4J1M A;  4EBD A;  1K83 H;  3M7G A;  3H6M A;  4X62 L;  2OF1 A;  5K36 G;  3Q2O A;  3M9M B;  2DPI A;  4DNR B;  3DWA A;  1N36 L;  5A2Q E;  1I5F A;  3J80 W;  3CXC A;  2J6U A;  3TSS A;  4DUZ Q;  3KTM A;  2Q2U A;  2VPS A;  3GTP B;  2YU9 H;  3Q24 A;  1HZC A;  1NSN S;  2R7N A;  4L8J A;  3P75 A;  1JDE A;  5IT9 E;  4IWY A;  5KG5 A;  2PI2 A;  2X0S A;  1RYR A;  5ELD A;  1YBY A;  4ZUJ A;  5C5J A;  4FU0 A;  1K8A C;  4CKC A;  1SFO B;  4K5W A;  1DV2 A;  1G8Z D;  2F0U A;  4CDE C;  3UQ8 A;  1SDF A;  4IUV A;  2F0D A;  4HSP A;  1STA A;  2PNH A;  1E2V A;  2JK8 A;  4R4T A;  4QUF A;  1K8G A;  3HOV G;  1GYF A;  3PW5 A;  4QIW E;  2P0A A;  3RMH A;  3K5N A;  1V8Q A;  5IYC G;  5DNF A;  3FKI H;  2YW2 A;  1LTG D;  1SR3 A;  3SDZ A;  2HQL A;  2RDF A;  2MCT A;  1D8L A;  5G3L D;  5EAY A;  3RN2 A;  4A3D G;  4ZI7 F;  2XCP A;  4BXX H;  2IX3 A;  2E2J B;  2O03 A;  4CJ0 B;  5F9L A;  4EBC A;  4RA8 A;  3K59 A;  4RMF A;  4QWE A;  2E8G A;  3GTQ A;  2DWC A;  4B3S H;  1GUS A;  1SNP A;  1VQC A;  4K0K Q;  1HCZ A;  4MV8 A;  3GDE A;  4LUO A;  2YZG A;  5CMD A;  3PR4 A;  4IUP A;  2DNC A;  1PX2 A;  3GQC A;  2VUG A;  2J6S A;  1MI2 A;  1EIH A;  1KJQ A;  4X64 H;  1PFN A;  1AZP A;  3GTK A;  2XGT A;  3HOV B;  1I6H H;  2WKD A;  2WB1 G;  2H4O A;  1AUV A;  2FK3 A;  3J81 W;  2HVR A;  3ERS X;  1SYX B;  3K57 A;  3GTM B;  2YCH A;  4GKJ L;  3NQI A;  2OEO A;  4KLK A;  2NVY A;  5DG7 A;  5I6W A;  1UE6 A;  3GP7 A;  4A3D B;  2IMW P;  2BH8 A;  2QA4 A;  1T94 A;  4BA2 I;  2DJG C;  1JE5 A;  1VQ7 A;  1XNQ L;  4C3J G;  4Y7N H;  2YZN A;  2ZTE A;  2EXZ A;  1SNO A;  4C3H H;  5KFH A;  4QY7 A;  4R7R A;  1Y1V G;  3AFQ A;  2Z4H A;  2WII B;  2J4X A;  1YNX A;  3IFD A;  5EWF A;  5KYI A;  3K5L A;  5IGG A;  1PH5 A;  4JI3 Q;  2G9D A;  3KYH C;  5C0X H;  2WB1 B;  3RAX A;  4WOR A;  2OLS A;  5J2T F;  2I8C A;  2K52 A;  4I7A A;  5J39 A;  4HJ8 A;  5KFD A;  1M7J A;  4C3I H;  1SLJ A;  1CHP D;  2L12 A;  3ER0 A;  4QIW A;  1E3P A;  3J7Z C;  2ZJR A;  3HOU H;  4X66 H;  2IJ0 A;  1EIY B;  2BH2 A;  4LUV A;  3FPU B;  1RJQ A;  4EYI B;  4RB2 C;  1JB7 A;  3HZX A;  3KUP A;  2UXD L;  1TWC H;  4HTH A;  5EQ0 A;  5C4J H;  3HOY H;  2YS6 A;  3G71 A;  1TS3 A;  4XIG S;  4IRC A;  2MO0 A;  3V6K A;  1SMX A;  3A54 A;  1I94 L;  1D1I A;  3H4B A;  2K01 A;  1WTW A;  4LMQ D;  3HOW H;  3M85 A;  5M5X H;  1WTH A;  3L2P A;  2CCZ A;  4DR7 H;  2XCL A;  1A0I A;  3E5N A;  1KAB A;  1MIU A;  3E6Z X;  4LF7 Q;  5C6A A;  2QEX A;  3S1N B;  1IBM L;  1PV4 A;  2CH4 W;  1TY2 A;  4IAJ A;  4OX9 Q;  4DV5 H;  3QOJ A;  4DAM A;  2W6Z A;  2I5H A;  5FO7 B;  4A2A A;  2ZM6 L;  4GN3 B;  2MUY A;  5LMN L;  4XZ3 B;  4DL6 A;  1S3O A;  2Z1C A;  3TS0 A;  4EEQ A;  1CQF A;  1EZ1 A;  3GTJ A;  1IW7 D;  4P74 A;  4DV5 Q;  2NU6 B;  1Q8K A;  1I50 H;  4JI2 H;  4WFN 3;  2R8H A;  2YYZ A;  5FLX W;  2JJQ A;  2R87 A;  4CDF C;  2JP1 A;  4G57 A;  4FF4 A;  3BAB A;  1D2B A;  1N48 A;  4JI2 Q;  3M3Y B;  1XWE A;  4HIK A;  4GNX B;  3U58 A;  4IWX A;  2ZDH A;  1XMO L;  2RF4 A;  1JCK B;  1EWC A;  3NTK A;  3I4N H;  4ED6 A;  2C22 A;  3ND9 A;  1PH4 A;  1UE5 A;  4I4T F;  4HJ5 A;  2G9H D;  1M4V A;  1IOV A;  5JQW A;  2EYF A;  1HR0 L;  3T5J A;  1BBU A;  1HRJ A;  4CHT B;  1PDQ A;  5KFE A;  2FPI B;  3I12 A;  4B3T L;  1STG A;  2CHB D;  4JI6 L;  2R92 H;  4RGO S;  3SK5 A;  4ETS A;  2YRW A;  5KFI A;  1KEE A;  4CDD C;  1TA8 A;  3QO2 A;  5CBE E;  3PW0 A;  3TP6 A;  3RZO H;  2W6P A;  2O4X A;  1Y1W H;  1VQ4 A;  2L11 A;  2EJF C;  4XYO A;  5KFW A;  3PO2 H;  1ONL A;  3F8T A;  4JI7 H;  2YV5 A;  3VR2 A;  1JJ2 A;  1BBW A;  3S16 B;  4PG3 A;  4CDC C;  4H02 A;  4J9P A;  3MZ5 A;  2XC9 A;  3URY A;  2D0O A;  4J9N A;  5HBR B;  2E5L H;  1VMP A;  4K14 A;  4QWB A;  3Q8D A;  4YR2 A;  1BQQ T;  3OTO L;  4FXK C;  5K2M A;  4IR9 A;  2JEA I;  3QWN A;  4LF5 L;  3QOL A;  4CC5 A;  4UHV A;  3I4O A;  2E5L Q;  3VPB A;  1KAA A;  2K14 A;  4YBZ B;  1E22 A;  1F77 A;  4PQX A;  3LP8 A;  3K5I A;  1SXT A;  1TKW B;  4ED7 A;  4GN5 A;  1HJP A;  2UVU A;  2C2E A;  1KTK A;  5LMU L;  1I4P A;  4LNQ A;  2E76 C;  5H1S E;  1DYQ A;  1VQP A;  4IUR A;  2WYO A;  1TWA H;  2W7O A;  2W70 A;  2DNE A;  2YU9 B;  3I4M G;  3S1M H;  3OWE B;  4U68 A;  5EKK A;  2C9O A;  1EY9 A;  2J7Z A;  1F2L A;  5D3D A;  1H9S B;  3S9W A;  5M5Y B;  4LAA A;  2F0N A;  1RTN A;  2FE3 A;  4P71 A;  1N33 Q;  1CZW A;  5ELO A;  4UCT A;  1AW7 A;  4XQN A;  1T3N A;  1I4G A;  2WKC A;  3RB4 A;  3HP3 A;  1PLF A;  3F1Z A;  3VYU A;  1OO9 B;  1LM0 A;  3KDF B;  2PZU A;  2VZA A;  4LF8 L;  2SEB D;  4B3M Q;  4FF2 A;  2OCE A;  4ED2 A;  1A3U A;  4ZUI A;  4YHH L;  2HHH L;  2EIF A;  1SSO A;  5HV6 A;  2NN6 H;  4ID6 A;  4ED3 A;  1R4Q B;  2RQX A;  4V19 0;  5BN4 A;  2L9H A;  4JCV E;  1B6S A;  4GNX C;  1EOV A;  3OW2 A;  1IBK Q;  2G5D A;  4IR1 A;  3I4M B;  2ICE C;  2H1E A;  3KF8 A;  4LH6 A;  2F3I A;  1BKB A;  4XT3 B;  5KRU A;  2PMZ E;  4OEM B;  1VMC A;  3S15 B;  2AQ1 B;  1TWH H;  1U4M A;  2F0O A;  3ORR A;  1EY6 A;  1K1Q A;  4A75 A;  2NZ1 D;  1R9T A;  3CCR A;  1HZ9 A;  1SEB D;  1FL0 A;  1SE3 A;  4DV2 H;  2L4N A;  5C0X G;  4HSV A;  2R84 A;  1I6U A;  1Z47 A;  2XN9 C;  1MHW C;  3GTG H;  4C3I G;  5KFT A;  5BN5 A;  1ENC A;  3HOU G;  2PMZ B;  4A3M G;  3R8B A;  2ZDG A;  2ZDQ A;  3D4W A;  1AE2 A;  1ESR A;  1SBB B;  4OHJ A;  4IUT A;  1WCM H;  4IFD G;  4X65 L;  3CCM A;  4A3G H;  2WAQ E;  3GIJ A;  2W9B A;  2FLL A;  3JAM i;  3Q22 A;  3HOY G;  4MTD A;  5IE8 A;  2UXC L;  5CYU A;  1T5E A;  1BOS A;  2GVB A;  3BDC A;  1XYI A;  4LF4 H;  2JA6 A;  5CAE B;  2L55 A;  3M7N A;  2LY7 A;  4O2D A;  4BY7 H;  4RNM A;  4DV6 H;  1O7Y A;  2EZV A;  5COR A;  2UU9 Q;  4NXN L;  2HVS A;  2UUB L;  4CJ2 C;  3HOW G;  1S5C D;  1BCP D;  4DR1 L;  4LF4 Q;  5BN3 A;  2V4Q A;  3GV5 B;  4I65 A;  3T1Y Q;  1QB5 D;  1K3B C;  2R8I A;  1UNS A;  4C3I B;  1NUC A;  1PK8 A;  1EY8 A;  3HOU B;  3K6O A;  2O5J C;  1VCI A;  4A3M B;  1HNW L;  1PH1 A;  3Q1K A;  2A6E C;  2MJ8 A;  4OIJ A;  5HUR A;  3WO0 A;  2LS0 1;  1VF7 A;  2ES2 A;  3RIZ A;  4TQU S;  3PW4 A;  2JA7 H;  4KD3 A;  4DR3 H;  4IFD I;  3HOY B;  3J80 L;  2E2I B;  5IYD H;  4Q8E A;  2IPK D;  3CRK C;  4EQO A;  3OWF A;  2K05 A;  4YAK B;  5D65 A;  1VQ6 A;  4Q0Y A;  2JEI A;  4UP8 A;  3FMA A;  2NVX H;  5GAG C;  3O13 A;  2JE6 I;  4O3Q A;  3T5H A;  2L15 A;  4GN4 B;  4J6H A;  4B08 A;  3KXY T;  3A7A B;  2R93 B;  5C44 G;  3HOW B;  1LAB A;  3UDF A;  1B04 A;  5FPO A;  4NLG A;  3BAA A;  3BG5 A;  1M8A A;  4IZO A;  2W8L A;  4WRD A;  1QIL A;  3L4K A;  3QZ8 A;  3EIV A;  1GHK A;  3V05 A;  2E2H B;  1WH2 A;  4O4H F;  1CTM A;  4H7B A;  2RGR A;  1K9M C;  1OXV A;  4BBS H;  2KQ3 A;  3K5O A;  4RAZ A;  2R92 G;  5CBA E;  1I50 B;  4LWC A;  2UXB H;  2KCN A;  3I72 A;  4JYA L;  1A6X A;  2R7L A;  2WAQ A;  1Y1W G;  2Q2I A;  1WD1 A;  3H15 A;  2AMC B;  2WAC A;  2EOT A;  4EQ5 A;  2DPJ A;  3KHR A;  1P16 A;  3KLW A;  2Z9H A;  5C44 B;  3HOX H;  3H3V I;  4JOI C;  2F4V Q;  2YYA A;  3ITP A;  2AWO A;  4DR6 Q;  2RKS A;  2SDF A;  3IFT A;  5D1O B;  2HQE A;  4PMC A;  3B6Y A;  4A3L H;  1RJR A;  3S1Q B;  1Q1E A;  1QNK A;  5KFY A;  4WBN F;  4AYB G;  5C5L A;  3RUZ A;  5J1Z A;  2UUA Q;  3MWD A;  1CSP A;  5I4D A;  3J81 L;  1NMF A;  1I7L A;  1D6E C;  3GTQ H;  1HNX H;  1TVX A;  4DV1 Q;  3RLF A;  4FXD A;  5IOD A;  2BCO A;  4Z9C B;  5EKI A;  5ISR A;  1KD1 C;  4JBM A;  3RD4 A;  4LFA H;  4JI4 L;  1HNX Q;  1Y1W B;  1ET9 A;  3GTK H;  4Q45 A;  3F2U A;  5IT9 c;  4AIM A;  1EY0 A;  2N78 A;  3OIP A;  4A3I H;  4A3J H;  1I6V C;  2SCU B;  1KNA A;  3HKZ E;  4DV0 H;  1PYS B;  3N8D A;  1JLL B;  2NVY H;  1FJG H;  2QDL A;  4DR2 H;  1EY4 A;  5FLM H;  2R61 A;  2CW0 C;  4ZLT F;  4DV3 L;  4FF1 A;  2CQA A;  5I9P A;  4AYB B;  1RJT A;  5T14 A;  4A3E H;  4NXM H;  1FJG Q;  3E0J A;  3K7A H;  1C48 A;  1B9M A;  3FDS A;  1UE7 A;  2K7V A;  4DR2 Q;  5C8Y F;  1V43 A;  1FVI A;  4BBR G;  1Q82 C;  1Q1B A;  1JOR A;  1BR9 A;  4NXM Q;  3HFZ B;  4X6A H;  1VQD A;  1F9Q A;  1WOC A;  2XRS D;  2FP4 B;  5IP7 H;  3NP8 A;  2BQU A;  3OUZ A;  2PNR C;  5L1J A;  1TXY A;  1S0M A;  4MHE A;  2KVM A;  3KLS X;  2F1M A;  1KLU D;  2V4D A;  2SNM A;  3EJI A;  2BA0 A;  4DUY H;  2EQS A;  3TBI B;  1S4Z A;  2C28 A;  2PVP A;  1ULZ A;  3H09 A;  1Y8O B;  1YZ6 A;  2R8K A;  3MFI A;  5JJK A;  1X3E A;  4DUY Q;  4AQY L;  5J22 A;  3W5O A;  4DV4 H;  1LLR D;  1NBW A;  1OXX K;  4CBV A;  4B3S L;  3BU2 A;  4Q43 A;  4BBR B;  5KGU A;  2NB0 A;  1EQV A;  4LF6 L;  2ASJ A;  4IRK A;  1JIC A;  1X6O A;  3W2D A;  5IYB H;  3J81 j;  4DV7 H;  4X64 L;  3VDY A;  3CQZ A;  4O0A A;  3D4D A;  4HJ7 A;  3M9O B;  3P20 A;  4F7X A;  2K5Q A;  2CFM A;  1QUQ B;  1N34 Q;  3D0F A;  1DJR D;  2W9A A;  3DF7 A;  4XQJ A;  2VXW A;  4F50 A;  2KA7 A;  1VF5 C;  1PVO A;  2CW8 A;  2V59 A;  5FLX L;  4Q0F A;  1NY4 A;  3R2I A;  1LTB D;  4J9R A;  4LUZ A;  3RLN A;  2BOS A;  3HKZ A;  1EFI D;  3H0G B;  2AKW B;  3CC7 A;  4IUN A;  4YB8 B;  4CJ1 B;  3S2D B;  3GTJ H;  4C2M A;  4ED1 A;  5JVG 3;  1OTC A;  4DL2 A;  2EY5 A;  3MJF A;  5GAE C;  1F9P A;  5KFL A;  1NE3 A;  5KFX A;  1KL9 A;  2PO4 A;  1L2F A;  2VQE H;  4FS2 A;  4NW2 A;  1SNQ A;  1FGU A;  1LT4 D;  1PXU A;  1TWF A;  4A2B A;  5L9X A;  4EGV A;  1KDB A;  2M00 A;  4A3C H;  3V96 A;  4O2B F;  1SND A;  2A8V A;  4IUU A;  2GPW A;  2VY3 A;  3KF6 A;  4QWC A;  4KHP H;  1KRS A;  1PRT B;  2F0S A;  3S14 B;  2WDT A;  2K50 A;  4MTK A;  4X66 L;  1HH2 P;  5IYD G;  2KHJ A;  3BQ1 A;  1OXU A;  5JPM C;  3RV4 A;  2BE5 C;  1DCZ A;  4KHP Q;  1ML0 D;  5KNB A;  1OWT A;  1IYV A;  5CR3 A;  3X3M A;  3BA9 A;  5IWA L;  2FK1 A;  3NBI A;  4DXF A;  2K6A A;  2VL6 A;  4A3K G;  1I4Q A;  1A3T A;  4DNT B;  5CGK A;  4XT1 B;  3E3X A;  2ICI A;  1JC7 A;  2IT1 A;  5CV6 A;  2XGP A;  1WJJ A;  2VR1 A;  4JV1 A;  1EYA A;  2W7P A;  2JA5 A;  4RAU C;  1STN A;  3UE0 A;  4R8I A;  4DR7 L;  3RB0 A;  1K0R A;  4CKE A;  3Q8R B;  4LFC H;  1EY7 A;  4X3S A;  2KEE A;  1C3O A;  4BBS G;  5EGT A;  2FJZ A;  4J9L A;  5FD6 A;  5EOY A;  2IBK A;  4DR5 L;  4JI8 L;  4DF7 A;  4X3K A;  2PQA A;  3PUW A;  2K5N A;  1I3Q A;  3LWE A;  3NBH B;  3W3A A;  3STB C;  1MZB A;  1XMQ H;  2F0J A;  1FD7 D;  1HNZ Q;  5LL6 S;  2F0K A;  2KOL A;  4A3K B;  3BQ2 A;  3M4O H;  5FJ8 H;  1IL8 A;  2ATW A;  1B50 A;  2V58 A;  5DGB A;  4LFB H;  3T53 B;  4C56 C;  3VMM A;  1JWS D;  1IBL H;  3E5S A;  3I56 A;  4K6D A;  4ME5 A;  1UNN C;  2DLN A;  3IL8 A;  1RD9 D;  2RDG A;  5KG4 A;  4A3F H;  5FO9 B;  4LFB Q;  1O75 A;  1GUT A;  4DU9 A;  4N9P A;  2VQF H;  1DV1 A;  1E4E A;  1PH2 A;  5KG1 A;  3NHH A;  1WD0 A;  1V1P B;  3RR5 A;  4DUZ H;  2EPB A;  2A69 C;  4QWD A;  2K5D A;  2VUM A;  4DAY A;  2B2Y C;  1X54 A;  1Y14 B;  2A6H D;  2KHS A;  5IY0 A;  2VQF Q;  1EEI D;  1E2W A;  4UFZ A;  4A3I G;  3CCV A;  1AFP A;  1C9O A;  4J9O A;  1DD2 A;  5KT3 A;  2JA8 H;  4JVZ A;  3DWQ A;  3QIA A;  2ZT9 C;  1HA5 A;  3ERO A;  3NEL A;  4WJ3 M;  5KFR A;  5FLM G;  2MGS A;  3QZ7 A;  3QG1 A;  2UVV A;  1VQO A;  3MA2 B;  4JI7 L;  1K8M A;  1A63 A;  2R7Z A;  1KC8 C;  4RZR A;  4A3E G;  3EPI A;  2AUK A;  3CU7 A;  5TSS A;  1PRT C;  3I70 A;  1IYJ B;  3K81 C;  2K5V A;  3T16 A;  2DY8 A;  4NB3 A;  5CB4 F;  2K03 A;  3MAQ A;  1X56 A;  3MHB A;  2ALY B;  3JAM W;  1S5D D;  3TP5 A;  5DLF A;  4EQP A;  2O2L D;  3S24 A;  4IAL A;  1R9T H;  5IP7 G;  4JV5 H;  1I4H A;  4HR7 A;  2OTL A;  3UE1 A;  1F2Y A;  2W6N A;  4HQ6 A;  4K0K H;  1CI3 M;  3FHW A;  4JI5 Q;  2B63 A;  4JV5 Q;  1V9P A;  1E4F T;  5DG9 A;  4XXE A;  1IKM A;  1PTO D;  3LWB A;  1VDZ A;  2AGO A;  1K3R A;  1X55 A;  2EJG C;  1C8C A;  1ICF B;  2W71 A;  1CUK A;  4A3E B;  1YI2 A;  2DZD A;  3K7A B;  2X69 A;  3C0F B;  3RUP A;  4LK1 C;  1L1O B;  3OHA A;  4M1U B;  3GTP A;  4LMY A;  4O3S A;  2B2U C;  1PRT F;  1FGB D;  3I73 A;  1GUW A;  1SE8 A;  2X6L A;  2JA6 H;  1BNZ A;  4B3R L;  1X65 A;  5IYB G;  4MV9 A;  1G6P A;  2FB9 A;  1G91 A;  2D62 A;  3R3O A;  2HJW A;  2JEJ A;  4QL5 A;  1PH7 A;  3D6W A;  1SFO A;  2WB1 E;  2ALZ A;  2HDL A;  3MR2 A;  3CPW A;  5LA6 F;  2KBN A;  1H9J A;  2PYK A;  2RSN A;  4DL5 A;  1SYB A;  4O3P A;  3OUU A;  5BR8 Q;  2LSS A;  3K3P A;  4E4T A;  3GO5 A;  1QNU A;  4PZ7 A;  4MTN A;  2B2W A;  4KV6 A;  4C5C A;  4N8F A;  4DFA A;  5LL6 X;  4JI3 H;  4XTC S;  1SJE D;  3U9O A;  1H9K A;  1QG7 A;  1EQR A;  5KYL A;  5JEA G;  2F3W A;  4PV1 C;  5C3E H;  1ILQ A;  3IG0 A;  4MA5 A;  5KFJ A;  3H4D A;  2JEF A;  1JQY D;  1QE6 A;  5KFA A;  1S0O A;  5I2Y A;  4FNF A;  1DM0 B;  2DN8 A;  4DV2 L;  5C1O A;  3RBD A;  2RDI A;  4I50 F;  3GLK A;  1HXY D;  3UDX A;  1G29 1;  4ECT A;  4A3C G;  5KFN A;  2NVT B;  1UWV A;  4Y52 H;  2L1B A;  2LXJ A;  3RZD H;  3E9H A;  1GOZ A;  3OSO A;  1NNX A;  4BY1 G;  1V51 A;  1IHZ A;  4F88 A;  1GHJ A;  3J80 E;  1QVG A;  2JEB I;  3BVG A;  4K5V A;  1B53 A;  4C3J B;  4FP5 D;  2E74 C;  2B2V A;  3AMU A;  4MV4 A;  3BYT B;  4KN7 C;  1ILP A;  1Y1V B;  5IIF A;  3GTL B;  3GTJ B;  2M05 A;  5M3M H;  2QKI C;  1E2Z A;  4LF7 H;  1VQI A;  1B1Z A;  4LSX A;  4LF4 L;  3Q6S A;  3MVV A;  2SNS A;  2GA4 B;  1TS5 A;  3NUC A;  1RL2 A;  4OX9 H;  2ZTC A;  3MC0 B;  4DV6 L;  4L1K A;  2FFK B;  1S97 A;  3E9I A;  5JVD F;  3FVQ A;  3I3C A;  1K1S A;  2YS7 A;  1TY0 A;  3FP9 A;  4DK1 A;  5DM7 3;  5DM6 3;  2QEJ C;  1HUN A;  4PZ6 A;  2M9V A;  1PFM A;  3G8C A;  1GSA A;  1VQK A;  3TRZ A;  1M0W A;  1ET6 A;  1PHJ A;  4BY1 B;  3S1R H;  2VA2 A;  5KT7 A;  4F4X A;  1F2Z A;  4OO1 G;  2WB1 A;  4NPS A;  4Y8V B;  3I91 A;  2F0P A;  5F2D A;  4LJZ C;  3A8J E;  3FEW X;  4QCL A;  2Q8R E;  4K6L A;  4XYQ A;  1V1O A;  3ULJ A;  1L1O C;  3KAL A;  4DR3 L;  1JWM D;  1HQM C;  3RGX A;  3CCJ A;  5DQH A;  3PO3 G;  5I9O A;  4QQB X;  4HNU A;  4IO9 A;  3MFG A;  2W6O A;  3BJU A;  2I87 A;  3VYS A;  2DY7 A;  1Q12 A;  2V5A A;  1XNR L;  3JRX A;  5KFF A;  3CPF A;  3A56 A;  2PZW A;  4A3B H;  5AFW A;  2ID0 A;  1SN8 A;  2A68 C;  5C4Z A;  4CC6 A;  3Q8S B;  5C4X H;  4DAP A;  3PUZ A;  5ELF A;  2EY6 A;  5FKA C;  3J81 E;  3PW7 A;  2KEC A;  2W9C B;  1PH9 A;  2A74 C;  1RK6 A;  1B70 B;  2K04 A;  3LGJ A;  2OXP A;  3PV0 A;  1YJ9 A;  1X3G A;  4ME6 A;  3H91 A;  3M4Q A;  1CQJ B;  3JZI A;  4OO1 I;  5HY6 A;  5EBC A;  2FMM A;  2HIX A;  3M9B A;  3N41 B;  5AJ3 Q;  3HB9 A;  1GJX A;  2UXB L;  1Z2P X;  4YY3 H;  3PO3 B;  2JA8 G;  5GAH C;  2Q2H A;  3PSI A;  2E75 C;  3PN1 A;  2P5Z X;  5K5P A;  5EJW A;  2UUC L;  3PUV A;  4JBJ A;  4DR4 H;  1E0B A;  2EYP A;  4YY3 Q;  5E1F A;  2F03 A;  4HID A;  2RCN A;  5KEE A;  2BDN A;  3L3O C;  2ZJQ A;  1YEZ A;  2HIV A;  4ZYS A;  5D1P A;  1N56 A;  2XSC A;  1O7I A;  1N36 H;  4ED8 A;  3R5X A;  3F8N A;  1Q46 A;  4DR4 Q;  1AH9 A;  5DGA A;  1BF4 A;  1TU2 B;  4X62 Q;  3S17 B;  2AQ2 B;  1TWG B;  2K5W A;  4GNX A;  3D31 A;  3U4Z A;  4IRD A;  2I80 A;  1N36 Q;  3JSL A;  4RGM A;  1K83 B;  1ENA A;  1BCP F;  2UVW A;  4DL7 A;  1GVP A;  4R4I A;  2MQH A;  2AHO B;  2MP1 A;  3FKI G;  3TME A;  2B29 A;  1QVF A;  2FK2 A;  2W6M A;  4DV3 H;  4HCE A;  4BXX G;  1MKH A;  4X3T A;  2JA8 B;  3ZYY X;  4LFA L;  5DQG A;  4EGQ A;  4XYL B;  4GOP B;  5JOB A;  4ECR A;  1N33 H;  5L1I A;  1ZYR C;  3CQZ H;  4MV1 A;  4KHZ A;  3DM3 A;  1IL2 A;  4NDX A;  4F8M A;  3N6R A;  4ZHQ F;  4DV0 L;  3KF8 B;  1W6K A;  1UE1 A;  4B3M H;  2QGQ A;  2F3V A;  4DR2 L;  1MSH A;  3MEH A;  1EEF D;  4RCO A;  1YNN C;  1LTI D;  4L6T B;  3S2H H;  4C5B A;  1D5M C;  5KG6 A;  2KEN A;  1LTL A;  2IP4 A;  2F0Q A;  4G4K A;  1U0L A;  1LAC A;  2KCT A;  2XWB B;  3CCS A;  1CKN B;  3U4V A;  1R9T B;  1M1K C;  4YJ3 F;  1IBK H;  2OTJ A;  3KJP A;  3FKI B;  2A73 B;  3G6E A;  1NAP A;  4ECS A;  3X3N A;  2PW7 A;  4C2M H;  5L1K A;  4YJ2 F;  2JN4 A;  1PH3 A;  4ABN A;  4HAE A;  3G4S A;  1MJE A;  2BDO A;  3CKI B;  2OQK A;  5FLX E;  3MWE A;  4FVM A;  1TWF H;  3WNZ A;  4UCU A;  2ZXO A;  4O3R A;  2EJM A;  2R82 A;  1B33 N;  1UEA B;  4GKJ H;  1O78 A;  4C3H G;  3RN5 A;  2UVR A;  1SE2 A;  2ZJP A;  1XTC D;  1V4Y A;  1VKZ A;  2W9B B;  2HD3 A;  1SMY C;  5C3E G;  4QUC A;  1JX4 A;  1EL0 A;  1JOK A;  5EWG A;  4GC7 A;  1YVC A;  2F0G A;  4GKJ Q;  4ECQ A;  1I6H B;  3DWP A;  4DV4 L;  2C5C A;  2XTI A;  2QYZ A;  3PUY A;  1H9R A;  1H9S A;  2ZTD A;  4IFD J;  3GIP A;  2SOB A;  1XNQ H;  3EYY A;  1X3F A;  1OXS C;  2PPB C;  3V2T A;  4RKB A;  3J7A K;  4DV7 L;  3KDF A;  4ECZ A;  2B2T A;  1XNQ Q;  1V1Q A;  3A8K E;  1RHP A;  5IGE A;  2JA5 H;  1TAE A;  1CSQ A;  4DGZ A;  2K5H A;  2UU9 H;  4Y7N B;  4C3H B;  1CA6 A;  1N32 L;  5M5W H;  3C2P A;  2NVQ H;  3GIL A;  4JUZ A;  2VW9 A;  4P72 A;  3T1Y H;  5M3M G;  2K33 A;  5C3E B;  4P75 A;  3K5M A;  5BMV F;  1VQ5 A;  3W1B A;  1VQ8 A;  4EEY A;  1I3Q H;  2R7D A;  3F2B A;  3CMA A;  4RZQ A;  4QW8 A;  1YNJ C;  5C0X I;  1EYD A;  5ELN A;  4ZCK A;  1Q3L A;  3PR5 B;  5DQI A;  5DLG A;  1AEX A;  2FLN A;  1ZET A;  2VQE L;  4GOP C;  2UXD Q;  2OH2 A;  4ZOL F;  3MXN B;  3K0Y A;  1KRT A;  1FR3 A;  1LUZ A;  4PNY A;  3GIM A;  4R4Q A;  1TWC B;  1CHQ D;  5C4J B;  5LL6 b;  4FM9 A;  4A93 H;  3DEP A;  1I94 Q;  1NR4 A;  3GID A;  1STH A;  3TQT A;  2PCF B;  2PMZ A;  3UDI A;  4GZY C;  3N44 B;  4ECX A;  1XPR A;  1K73 C;  2VNU D;  4J9K A;  1KJJ A;  5FPR A;  2R8J A;  1G2S A;  1SYF A;  1RCV D;  5KT6 A;  2QF7 A;  2VUM H;  5M5X B;  2GPS A;  3A55 A;  3PIP 3;  4MV6 A;  4HN7 A;  4TSS A;  1PH6 A;  2QK4 A;  1A9X A;  1E1T A;  4A3B G;  3CD6 A;  1VQE A;  3I4N G;  4L5R C;  2ZM6 Q;  5LMN Q;  2PZT A;  1EFW A;  1LYL A;  3TN2 A;  3JAM L;  1JWU D;  2FHT A;  4JI0 H;  3C3L A;  4NP5 A;  4RHR A;  1ZEQ X;  4KKT A;  1B3Q A;  2CW7 A;  5KG7 A;  3L4J A;  3CVZ A;  1E7Z A;  1FNV A;  1KBL A;  4IN3 A;  4K5X A;  3K8A A;  1U9R A;  1HTP A;  2EYH A;  3SVM A;  2R7Z H;  4J15 A;  3JSN A;  4JI0 Q;  4LFC L;  3CCU A;  3H20 A;  5EBD A;  3PMF A;  1LTA D;  4HMJ A;  2F4V H;  4DR6 H;  3SXH A;  1TS4 A;  2OT2 A;  3U50 C;  3EVQ A;  1JT8 A;  4R8U B;  1I4X A;  3PO2 G;  2NWG A;  1XMQ L;  2M2L A;  2UUA H;  3V4Z A;  2WFW A;  3OOC A;  3AYH B;  2RDH A;  4ODG A;  2E2I A;  1VQJ A;  4TV8 F;  4YCW A;  1HR0 Q;  1VQF A;  3I4N B;  1CE8 A;  4DV1 H;  3RAQ A;  3SK8 A;  2B63 H;  4YCV A;  4ED0 A;  3TIN A;  4DPG A;  4JK1 C;  4RG1 A;  2RA4 A;  4G7H C;  4LF9 L;  1D5X C;  3SK6 A;  4JI6 Q;  1IBL L;  2R93 A;  2B8G A;  3TP7 A;  2KCC A;  4ECY A;  2Z6K C;  4AYB E;  4JI1 L;  1SYC A;  3T1H H;  2R92 B;  3J7A F;  5JH7 F;  5CV9 A;  3N6X A;  2W6Q A;  1JR0 D;  2VQF L;  2EVB A;  2F52 A;  4K2K A;  4ZAI A;  3GTP H;  3UDG A;  3RZO B;  1B2T A;  1MD2 D;  5KFG A;  2MFI A;  4DUZ L;  3T1H Q;  2E2H A;  4MTE A;  4IZ8 A;  3PO2 B;  3GV7 B;  1W6J A;  2AUJ D;  4L5Q A;  5C5M A;  3SE7 A;  1CQV A;  1IKL A;  1SFO H;  5IYZ F;  3HRZ C;  1BJT A;  4PMW A;  1S68 A;  2RHS B;  3HS0 C;  2HCI A;  1YHA A;  4QGU A;  2DIK A;  3SGI A;  1GGO A;  2XIG A;  4ME3 A;  5D1O A;  5LMU Q;  1HTL D;  2NN6 G;  4PDB A;  5ELC A;  1J6Q A;  3R93 A;  3I55 A;  3TQY A;  2E2J H;  2VPQ A;  4PMB A;  1I7N A;  3TEH B;  4KK7 A;  1TWA B;  2RBM A;  2CQY A;  1VS0 A;  3S1M B;  1B44 D;  4IUQ A;  2WV6 D;  1VQL A;  2A19 A;  5JPN C;  2VOB A;  1CKM A;  1SJH D;  1U4R A;  3C1F A;  3IN5 A;  1L0W A;  3PZP A;  4K0K L;  2TSS A;  3BDL A;  4MA0 A;  1TR5 A;  4R8N A;  1JB3 A;  5JJZ A;  4LF8 Q;  4RB3 C;  5KND A;  1QVC A;  2XWJ B;  4EGJ A;  4ECU A;  2HHH Q;  2WTF A;  2GLT A;  1UAP A;  1C7Y A;  2HCC A;  3CME A;  5IGC A;  5ELE A;  3BZC A;  3T5L A;  4NMZ A;  3WOE A;  3D8G A;  1N34 H;  4ECW A;  3MEF A;  2LMC B;  3ICE A;  2NN6 I; 
#chains in the Genus database with same CATH homology
 4DKA C;  5GRO A;  4IPD A;  4NB3 A;  2RF4 A;  1QZH A;  1X56 A;  4JOI A;  2ALY B;  4KHP L;  3I4N H;  2MO1 A;  2R93 G;  1PH4 A;  1UE5 A;  3S24 A;  1R9T H;  4BA1 I;  1WCM G;  4HJ5 A;  2K4K A;  4HJ9 A;  5IP7 G;  4A3G G;  1HR0 L;  2JA5 G;  1BBU A;  1GKH A;  2IHE A;  4UY8 C;  2OTL A;  4DV6 Q;  1H95 A;  3UE1 A;  4HIO A;  4B3T L;  3K7U C;  1HZB A;  1WFQ A;  1KIX A;  4JI6 L;  3FHW A;  4JI5 Q;  2R92 H;  4JV5 Q;  1V9P A;  1IBM Q;  2Z6K A;  3HKS A;  4BY7 G;  4GLA C;  5C4X G;  3L7Z C;  3AFP A;  3RZO H;  4JI3 L;  3M4P A;  1Y1W H;  1K3R A;  1X55 A;  1VQ4 A;  2CWP A;  3TS2 A;  4DK3 C;  3J81 i;  3PO2 H;  1CUK A;  1YI2 A;  1IXR A;  1YJN A;  3F8T A;  1L1O B;  2YV5 A;  3PGZ A;  1JJG A;  1JJ2 A;  1BBW A;  3J80 c;  2Y0S G;  4PG3 A;  4DR3 Q;  4H02 A;  4X65 Q;  2D0O A;  1SE8 A;  3RNU A;  4A3K H;  2JA6 H;  4B3R L;  1X65 A;  1PYB A;  3Q8D A;  5IYB G;  5IP9 G;  2UXC Q;  1G6P A;  2D62 A;  1HNZ L;  2JA7 G;  3CCQ A;  3OTO L;  4QL5 A;  1PH7 A;  1XMO Q;  2JEA I;  4LF5 L;  1XNR Q;  2WB1 E;  1PH8 A;  3I4O A;  2E5L Q;  3GTO H;  3CPW A;  2K14 A;  2KBN A;  1E22 A;  4NXN Q;  5JJI A;  5BR8 Q;  1UEB A;  2LSS A;  4GN5 A;  3ULL A;  1HJP A;  1QUQ A;  4DR1 Q;  1ASZ A;  4L5S A;  5LMU L;  3GO5 A;  4PZ7 A;  2JA9 A;  4MTN A;  3A5U A;  4LNQ A;  4GS3 A;  5H1S E;  1VQP A;  1IZ6 A;  3K0X A;  1TWA H;  4B3T Q;  3S1N H;  4LFB L;  4JC0 A;  5JJL A;  3I4M G;  3S1M H;  4XTC S;  3A0J A;  4LF7 L;  4OWT B;  1EQR A;  5JEA G;  5C3E H;  1M90 C;  4OX9 L;  3I7F A;  2UXB Q;  4LW1 A;  4P71 A;  5ELO A;  1N33 Q;  2EXD A;  4IPC A;  4DV2 L;  3PF5 A;  3F1Z A;  3GD7 A;  5GQO A;  2R7Z G;  1KXL A;  1LM0 A;  2VS1 A;  3KDF B;  2UUC Q;  2VZA A;  3UDX A;  1G29 1;  4DV5 L;  4LF8 L;  4A3C G;  1VQA A;  1VQN A;  2MNA A;  4B3M Q;  3A5Z B;  1UWV A;  4AH6 A;  2OCE A;  4Y52 H;  4YHH L;  2LXJ A;  3NEM A;  2HHH L;  2EIF A;  2PI2 E;  3E9H A;  3RZD H;  4IPG A;  4IOC A;  4BY1 G;  3M3Y H;  5HGQ A;  3OTO Q;  1VQG A;  1QVG A;  4POG A;  2IX0 A;  4JI2 L;  4JCV E;  2JEB I;  3HOX G;  4LF5 Q;  3J81 c;  4GNX C;  1EOV A;  3OW2 A;  1SRU A;  1IBK Q;  3L0O A;  2IX1 A;  4GKK L;  5LMN W;  1VQM A;  2F3I A;  4A3L G;  1BKB A;  3CP0 A;  2PMZ E;  3W1G A;  3HKZ G;  5M3M H;  2B63 G;  1G51 A;  1VQI A;  4A4I A;  1TWH H;  4LF4 L;  2A1A A;  1RL2 A;  4LFA Q;  4A75 A;  2ZTC A;  2HT1 A;  4DV6 L;  1HZA A;  3EN2 A;  5GAD C;  3CCR A;  3E9I A;  1HZ9 A;  4MNO A;  3FP9 A;  4OXP A;  1FL0 A;  3PUX A;  4JI5 L;  4JV5 L;  4PZ6 A;  5C0X G;  4OON A;  3KOJ A;  1PFS A;  1Z47 A;  1NJI C;  4DV0 Q;  1VQK A;  3TRZ A;  3GTG H;  1E1O A;  1PHJ A;  3S1R H;  3PIP A;  4OO1 G;  4NPS A;  1XJV A;  1W3S A;  4A3J G;  3S16 H;  3HOU G;  4A3M G;  2WP8 J;  4IJH A;  3DLL A;  1AE2 A;  1HR0 W;  3ULJ A;  1L1O C;  3HOV H;  2IHF A;  4YHH Q;  1C0A A;  4DR3 L;  1WCM H;  4IFD G;  4X65 L;  3CCM A;  3GTM H;  2WAQ E;  2RHQ B;  4A3G H;  5IYC H;  5J3B A;  3JAM i;  3CCJ A;  4YWL A;  3PO3 G;  3HOY G;  4QQB X;  5IE8 A;  2UXC L;  4IO9 A;  1XPU A;  3KFU A;  3BJU A;  2GVB A;  4A3D H;  2LXK A;  1Q12 A;  3M7N A;  4GKK Q;  1XNR L;  4O2D A;  2E5L L;  4BY7 H;  3CPF A;  4A3B H;  1B7Y B;  1WI5 A;  2ID0 A;  1SN8 A;  3CCL A;  3J7A 5;  2UU9 Q;  4JI4 Q;  4NXN L;  5C4X H;  3PUZ A;  4JBW A;  4UP7 A;  2UUB L;  2IY5 B;  5M3F H;  1X9N A;  3HOW G;  2BA1 A;  5BR8 L;  3G48 A;  1PH9 A;  4DR1 L;  4LF4 Q;  3H0G G;  3A74 A;  1B70 B;  3ZJY C;  4UP9 A;  3F2C A;  3LGJ A;  3T1Y Q;  1CKO A;  2OQ0 A;  3PV0 A;  1YJ9 A;  1X3G A;  2CKZ B;  3HOZ G;  3M4Q A;  2YTX A;  3K80 C;  3KF6 B;  4OO1 I;  1YIT A;  4QJF A;  4TVA B;  5HY6 A;  1VCI A;  1P8L A;  1HNW L;  5M5Y H;  1PH1 A;  4DV3 Q;  4DV4 Q;  2GVA A;  2ES2 A;  2HIX A;  3M9B A;  4TQU S;  5AJ3 Q;  2JA7 H;  1J5E L;  3AQQ A;  2UXB L;  4KI0 A;  4IFD I;  1N33 L;  2JA8 G;  2I5M X;  5IYD H;  3CC4 A;  1YHB A;  2Q2H A;  5GAH C;  2N8N A;  1WYD A;  3PSI A;  2NZO A;  2NVT H;  4DV7 Q;  2UUC L;  3PUV A;  2YTY A;  4JBJ A;  1VQ6 A;  4APV A;  4UP8 A;  4YY3 Q;  5GAG C;  2NVX H;  4B3M L;  4HID A;  2JE6 I;  2N3S A;  2RCN A;  2L15 A;  4GN4 B;  2ZJQ A;  1YEZ A;  2HIV A;  3PF4 A;  1O7I A;  5C44 G;  1E24 A;  3F2D A;  2Y0S E;  4C3J H;  1Q46 A;  3UDF A;  5FLX c;  4DR4 Q;  1N32 Q;  3I4M H;  1AH9 A;  4X62 Q;  1A62 A;  4GNX A;  1Y1V H;  3D31 A;  1Z9F A;  3U4Z A;  2JQO A;  3GTL H;  4A93 G;  1IBK L;  2R6G A;  1N36 Q;  4FDB A;  3S15 H;  3EIV A;  4IPH A;  2UUB Q;  3EBE A;  1GVP A;  4R4I A;  2MQH A;  2AHO B;  3FKI G;  5JEA J;  2B29 A;  4AQY Q;  3CW2 C;  1QVF A;  3JAM c;  1K9M C;  1OXV A;  2PQA B;  4BBS H;  4B3S Q;  2VUM G;  1RIP A;  4DK6 C;  2R92 G;  1MKH A;  4BXX G;  2FXQ A;  4LFA L;  4LWC A;  4GOP B;  2VQE Q;  4JYA L;  1U5K A;  1HNW Q;  4LF6 Q;  3CQZ H;  4KHZ A;  4POF A;  3DM3 A;  1IL2 A;  1Y1W G;  2Q2I A;  4DNI A;  4BY1 H;  3H15 A;  4X64 Q;  3IRB A;  2AWN A;  2AMC B;  3PIO A;  4DV0 L;  1J5E Q;  3JC6 6;  3KF8 B;  1UE1 A;  4EQ5 A;  1P16 A;  3KLW A;  5DLQ E;  1Q7Y C;  2QGQ A;  3HOX H;  3H3V I;  4JOI C;  3CF5 A;  2F4V Q;  2AWO A;  4DR2 L;  4DR6 Q;  1GO3 E;  4R4C A;  2DUD A;  5E7N A;  2Q2T A;  3S2H H;  2B3G A;  2NN6 I;  4IOA A;  3B6Y A;  4A3L H;  1Q1E A;  1L1O A;  2KEN A;  1LTL A;  1AE3 A;  2KCT A;  1KHI A;  1U0L A;  3CCS A;  1CKN B;  3U4V A;  4AYB G;  4ALP A;  1S40 A;  1M1K C;  2UUA Q;  2OTJ A;  1S72 A;  1CSP A;  3KJP A;  1NMF A;  3G6E A;  4C2M H;  2KHI A;  3GTQ H;  4DV1 Q;  3RLF A;  1PH3 A;  4DAY B;  1VQB A;  1MJE A;  1MJC A;  2D0P A;  3G4S A;  1KD1 C;  1Q86 C;  4JBM A;  3I2Z A;  2OQK A;  1EIF A;  1TWF H;  2UU9 L;  1HNX Q;  4JI4 L;  1N9W A;  3GTK H;  4PZ8 A;  5IT9 c;  4YWK A;  3PCO B;  3STB D;  4AIM A;  2Q2U A;  4UPA A;  2N78 A;  2R7F A;  4A3I H;  3RN5 A;  3T1Y L;  4A3J H;  1QZG A;  3CC2 A;  2ZJP A;  1VQ9 A;  2ASB A;  3HKZ E;  1OXT A;  4IJL A;  4A3M H;  4LFC Q;  1PYS B;  5C3E G;  2NVY H;  4JYA Q;  1YVC A;  3TRE A;  5FLM H;  4GKJ Q;  4DV3 L;  1ASY A;  4DV4 L;  4X66 Q;  2XTI A;  3PO3 H;  4HIM A;  2Z0S A;  2E2I H;  4GLV B;  3PUY A;  2V1C C;  2ZTD A;  4A76 A;  4IFD J;  5AJ3 L;  4A3E H;  1YJW A;  1XMQ Q;  1FJG Q;  3K7A H;  2I0Q A;  1UE7 A;  4DR2 Q;  1V43 A;  1X3F A;  1OXS C;  1FVI A;  4BBR G;  1NMG A;  5IWA Q;  1Q82 C;  1Q1B A;  1T9H A;  4DV7 L;  3KDF A;  2R93 H;  4NXM Q;  3HFZ B;  4X6A H;  1XNQ Q;  1VQD A;  4YY3 L;  1A8V A;  1V1Q A;  1WOC A;  1N8R C;  5IP7 H;  4YCU A;  4LF9 Q;  1IBL Q;  2JA5 H;  3S17 H;  5FJ8 G;  1TWG H;  1D7Q A;  1CSQ A;  1TXY A;  2K5H A;  3CAM A;  3ULP A;  1EYG A;  2K75 A;  4JI1 Q;  4DR4 L;  1N32 L;  5M5W H;  1K83 H;  4X62 L;  2NVQ H;  4DR7 Q;  5K36 G;  2VW9 A;  2BA0 A;  4P72 A;  2EQS A;  5M3M G;  1XPO A;  2E2H H;  1N36 L;  2CQO A;  4P75 A;  1I5F A;  1YZ6 A;  3CXC A;  1VQ5 A;  3W1B A;  3CCE A;  4A3F G;  1VQ8 A;  4DUZ Q;  1I3Q H;  2R7D A;  1EWI A;  3F2B A;  1X3E A;  3CMA A;  2DGY A;  5C0X I;  4DUY Q;  4DR5 Q;  4AQY L;  4JI8 Q;  2YU9 H;  3W5O A;  3WWV A;  1HZC A;  5ELN A;  1NBW A;  1OXX K;  4B3S L;  4YWM A;  3BU2 A;  4JI0 L;  1YIJ A;  1NTG A;  2VQE L;  4GOP C;  2PI2 A;  2UXD Q;  4LF6 L;  3H3V H;  1YBY A;  1JMC A;  3MXN B;  5C44 H;  1K8A C;  1X6O A;  5IYB H;  1KRT A;  3J81 j;  4JBK A;  5IP9 H;  2GN5 A;  1LUZ A;  4X64 L;  3VDY A;  4O0A A;  4HJ7 A;  4R4Q A;  2NZH A;  2PNH A;  4R4T A;  2JK8 A;  2CFM A;  1K8G A;  2F4V L;  3S1Q H;  2CWA A;  1QUQ B;  1N34 Q;  3D0F A;  1I94 Q;  4QIW E;  2KCM A;  3HOV G;  4A93 H;  4DR6 L;  4P73 A;  3KJO A;  1PVO A;  5IYC G;  3UDI A;  3FKI H;  1XPR A;  1K73 C;  2VNU D;  4R1J A;  1NY4 A;  1SR3 A;  2C35 B;  2HQL A;  2UUA L;  1D8L A;  4LUZ A;  3RLN A;  5EAY A;  1SRO A;  3RN2 A;  4A3D G;  2VUM H;  4BXX H;  1PH6 A;  1E1T A;  4DV1 L;  4A3B G;  2AKW B;  3CD6 A;  3CC7 A;  1VQE A;  4RMF A;  3I4N G;  3GTJ H;  2ZM6 Q;  5LMN Q;  2E8G A;  5M3F G;  4L5R C;  1BVS A;  1LYL A;  1EFW A;  1VQC A;  4K0K Q;  1OTC A;  3GDE A;  3BZK A;  2I5L X;  4LUO A;  5GAE C;  1HNX L;  1NE3 A;  1KL9 A;  1L2F A;  1E7Z A;  3T1H L;  1FGU A;  4OWW B;  3K8A A;  2R7Z H;  4J15 A;  4JI0 Q;  4LFC L;  4JG2 A;  2XGT A;  3CCU A;  4A3C H;  1I6H H;  2WB1 G;  2A8V A;  2VY3 A;  3KF6 A;  3ERS X;  4JI7 Q;  1KRS A;  4GKJ L;  3U50 C;  2K50 A;  4KLK A;  4X66 L;  1HH2 P;  5IYD G;  1JT8 A;  2KHJ A;  3E0E A;  1OXU A;  3PO2 G;  1UE6 A;  1XMQ L;  4KHP Q;  1FJG L;  2BH8 A;  2QA4 A;  2WFW A;  3AYH B;  1YHQ A;  4BA2 I;  1VQJ A;  2H5X A;  5IWA L;  4YCW A;  1HR0 Q;  1VQF A;  1JE5 A;  2VL6 A;  4A3K G;  2JA6 G;  1VQ7 A;  2B63 H;  4NXM L;  1XTD A;  4YCV A;  1XNQ L;  4DPG A;  4Y7N H;  2ZTE A;  4RG1 A;  4C3H H;  4LF9 L;  4QY7 A;  4JI6 Q;  2IT1 A;  1IBL L;  1Y1V G;  3AFQ A;  1WJJ A;  4MZ9 A;  2Z6K C;  4GLX A;  4AYB E;  4JI1 L;  1PA6 A;  1EQQ A;  1YNX A;  1PH5 A;  4JI3 Q;  4DR7 L;  3UE0 A;  1GD7 A;  3KYH C;  1K0R A;  1B8A A;  2VQF L;  3AEV A;  2F52 A;  3GTP H;  2K52 A;  3UDG A;  2N49 A;  4HJ8 A;  4BBS G;  4R4O A;  3OYY A;  5C0X J;  2MFI A;  4C3I H;  4DUZ L;  3T1H Q;  1SLJ A;  3ER0 A;  2YTV A;  4DUY L;  4DR5 L;  4JI8 L;  1E3P A;  3J7Z C;  4BBR H;  2PQA A;  2ZJR A;  1GM5 A;  3HOU H;  3PUW A;  1EIY B;  2K5N A;  2BH2 A;  4LUV A;  4L5Q A;  3NBH B;  3STB C;  4B3R Q;  1SFO H;  4GOP A;  1JB7 A;  1HNZ Q;  2UXD L;  4WJ4 A;  4PMW A;  2RHS B;  1TWC H;  3M4O H;  5FJ8 H;  5C4J H;  3HOY H;  1YHA A;  2ATW A;  4EX5 A;  4QGU A;  3G71 A;  3SGI A;  4XIG S;  2MO0 A;  1DGS A;  4HJA A;  1SMX A;  1I94 L;  2OWO A;  1N34 L;  3I56 A;  4ME3 A;  5LMU Q;  1JJC B;  2NN6 G;  4A3F H;  3I55 A;  1J6Q A;  3HOW H;  3TQY A;  5M5X H;  3M85 A;  3L2P A;  2E2J H;  3H0G H;  2CCZ A;  4LFB Q;  1CKN A;  1XMO L;  1A0I A;  3TEH B;  3J80 i;  1MIU A;  4LF7 Q;  1PH2 A;  2QEX A;  1VS0 A;  3HOZ H;  3S2D H;  4L5T A;  1IBM L;  1PV4 A;  3RR5 A;  1KQS A;  1EUJ A;  4OX9 Q;  4DAM A;  1VQL A;  2I5H A;  2A19 A;  1CKM A;  1X54 A;  5JJK A;  1Y14 B;  4GN3 B;  1L0W A;  5IY0 A;  2ZM6 L;  2VQF Q;  5LMN L;  1VQH A;  4K0K L;  4DV2 Q;  1S3O A;  3TS0 A;  4A3I G;  4OWX B;  3CCV A;  1C9O A;  2WAQ G;  4P74 A;  4DV5 Q;  1W2B A;  1KAW A;  1Q8K A;  4LF8 Q;  2JA8 H;  1I50 H;  1QVC A;  2HHH Q;  3NEL A;  2YYZ A;  4WJ3 M;  5FLM G;  1C7Y A;  2JJQ A;  3CME A;  3S14 H;  1VQO A;  3RLO A;  4JI7 L;  1A63 A;  3BZC A;  4JI2 Q;  1KC8 C;  4A3E G;  4HIK A;  3MEF A;  4GNX B;  3U58 A;  1Q81 C;  3ICE A;  3NEN A;  1IYJ B;  3K81 C;  2K5V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...