1WSCA

Crystal structure of st0229, function unknown protein from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
225
Chain Sequence
QEQLVAVNELNENLGKVLIKIARDSIANKLGILKINLEDYLSSLNDPILNKKGLAFVTLETYYGNSTSLRGCIGYVEAVAPLKEIVSKAAIAAAFSDPRFPPLSKGEFDNIIIEVTVLTKPQEIDVENRWELPKKIKVGEDGLIVEYGILYSGLLLPQVPMEYCWDEETFLAETCIKAGLEPDCWLNNKVKIKKFQGIIFREEKPKSEKILIIKPSEVKCKKEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ST0229
publication title Crystal structure of ST0229, function unknown protein from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
molecule tags Structural genomics, unknown function
total genus 61
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1wscA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1wscA02
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH superfamily
5J2UF 3CQZA 5FJ8G 1AN7A 4A3GG 3GILA 1GYFA 4JI0H 3BA9A 2HGSA 2W7PA 1ZHSA 4QWAA 2E5LH 4NLGA 3GTLA 1SFOA 3TQTA 2YL2A 4ZHQF 3KHRA 4U7CA 4JUZA 1I94H 4B3RH 2JEIA 1ZQ7A 5KG0A 5IYCG 3OTOH 4O3PA 2DWCA 4A3CG 4RZQA 2YU9A 4RB2C 3Q8SB 5IT9W 2YYAA 4C5CA 3RB0A 3OSNA 4LF8H 3MR5A 3RV3A 2VUMG 4M7EA 4I55F 1Y1VG 2W6OA 3RBDA 4GKJH 4JYAH 3BQ2A 5EZYF 2FK1A 5KFAA 4UCTA 4XYMB 1V51A 5KG3A 4EBDA 4J9OA 3K3VA 4JI8H 5KT6A 2WE6A 4JV5H 1B33N 5KFEA 4EFEA 4NXNH 2F4VH 1X6QA 3K5HA 5FLXW 2JEFA 1W96A 4EEYA 4RNMA 1HR0H 1E4EB 2O03A 3N40P 2JA7G 2YS7A 4RUCA 4YR2A 4DV2H 1S68A 1L2ZA 4LF4H 4ECVA 3ORRA 3JAMW 2HVQA 5C1OA 1DZOA 2PVPA 2DLNA 1RK5A 4QW9A 4DR6H 2VA2A 3N6XA 4A3JG 3RAXA 3R23A 5KFHA 4BBSG 4JI6H 4ED3A 5F9LA 3JZZA 2NU7B 2PBZA 3V6JA 5KG7A 2AGPA 4RB1A 2R8IA 2AGOA 3EYYA 2R7ZA 2ZDGA 4YJ2F 2R85A 2Y0SE 3GIMA 4LH6A 3GV5B 2NVXA 3JRWA 2XGPA 4LSXA 5KFBA 4YAKB 4Y8VB 1O75A 3EPIA 1DGSA 2IMWP 5IWAH 4J9KA 1JKJB 1TWAA 3RB3A 1JDEA 2E2IA 2KEPA 2OLSA 3BG5A 4ECRA 3KAJA 1PK8A 1TWCA 3N8DA 5BPFA 2Y0SA 3U9TA 1IOVA 1M7JA 3ORQA 5D1OA 4QIWE 4X64H 4ZI7F 1I7NA 1OWTA 3UQ8A 5BMVF 2XC9A 2SCUB 5KT7A 4J9SA 4O2BF 4DV4H 2VR1A 1BGWA 2BQRA 3OHAA 3RIZA 3JZIA 5DQIA 3G8CA 5C3EG 3KTMA 5I47A 2R7NA 5FPOA 4DV6H 5JUMA 3LWBA 4ECQA 2C28A 2PILA 4LF9H 2FMAA 1K1SA 1KJQA 3GLKA 5KT2A 3EPGA 2PMZA 2W9CA 3SE7A 4EFBA 4DUZH 1WSCA 2YS6A 2XGQA 1IBMH 2R84A 3Q8RB 4KHPH 2FK2A 4HNTA 5DQGA 4A3BG 2WB1E 5D8DA 4LF5H 4MV4A 4DV1H 1N36H 3WO0A 4YB8B 1QVEA 4YBZB 2IBKA 5LMNH 1N32H 4IR1A 3CVZA 2FE3A 3WO1A 5KX5F 5DQHA 5KT4A 2XIGA 4X65H 4O4IF 4QWCA 4WD3A 4F50A 2DPJA 4QWBA 4LFCH 3AYHB 3IG0A 2ZDQA 4Q0YA 2PN1A 4EGJA 3G6VA 3JRXA 4BBRG 4EG0A 5JW8A 4J9MA 1HNWH 1DV2A 4ECSA 5GONF 3MFIA 3R5FA 3GTJA 3GV8B 4IRKA 4MV8A 1KJIA 4GLXA 3F8NA 4MA5A 3KHGA 4B3SH 2ZJTA 4MTEA 1XNRH 2W9BA 1I3QA 4Q8FA 1EUDB 2PY0A 4FS1A 4O3QA 3GIDA 1S0OA 2HHHH 1IBKH 3H3VH 1EYZA 3PW5A 1B6SA 2C2DA 4A3EG 5EDWA 2GLTA 1S10A 4DL6A 1W93A 1J5EH 3GTOA 2P0AA 1SEIA 4RNOA 1WCMA 3H20A 3MWDA 1VBHA 4IWXA 1X6YA 4J9QA 4HNUA 4DV7H 3Q2OA 1JXLA 2B63A 3L2PA 5BPHA 2RF4A 4ED8A 5IYDG 2IA6A 3L4KA 5KFRA 4DV3H 3V6KA 3T1HH 1RK6A 2DIKA 4F4YA 4LH7A 2AGQA 4R7RA 2YCHA 1HNXH 3RGXA 2C2EA 5EWFA 1AUXA 3FMAA 1VAJA 3HXLA 1SCUB 2C22A 4TQSA 4DR3H 4DR4H 3FKIA 2UVUA 3BA8A 5LL6b 1K83A 5KKNB 4YHHH 4DR1H 2JA6A 2XD4A 2W6NA 2XCPA 3JYZA 2FPPB 1ULZA 1M0WA 1FVIA 2R92A 2YRXA 1N48A 4LFBH 3FU1A 1TWHA 4GC6A 5FD6A 3RTXA 4J9LA 3PW4A 5KFZA 2R6FA 3PZPA 4DR5H 3C0FB 5C1PA 5EWGA 1WCMG 4O4LF 5KFDA 5DGAA 2UVVA 2CZGA 3N41B 4A3KG 2B63G 1GSHA 4V1JA 3HOXG 4A3DG 4HQ6A 4UCVA 4O3SA 3ETJA 2W57A 4I50F 4LF7H 3FDSA 2CW7A 4A3MG 2RGVA 2GPSA 3Q8QB 3JSLA 4L1KA 3R5HA 2WDTA 5KFQA 1T36A 2C00A 4O3NA 4ETSA 4CC5A 3HOVG 3FKIG 4BY1G 2CQYA 4O4HF 4QWEA 2WTFA 3G6YA 2VA3A 2JA6G 2W6MA 1RYRA 3N44B 4YQWA 1X6ZA 1M6VA 1Y1WA 4IWYA 5FD5A 4C5BA 4JI5H 2FPIB 4DR2H 2R8KA 3KAKA 3PN1A 4CC6A 4JI1H 4XYLB 4LFAH 2FK3A 3OUUA 2R92G 3HOUG 3HOZG 4A3LG 3VPCA 1S97A 5FPRA 2NU9B 2Q2TA 4TQRA 3K5IA 1CQJB 4JI4H 2UUBH 1X6RA 1DIKA 1BNCA 1EHIA 5KFJA 3SOJA 3QFFA 4QWDA 5KFMA 2R8HA 5KFTA 2W7OA 4ED7A 2DPIA 4IR9A 5L1JA 3PW7A 2UVRA 2NUAB 2OWOA 1T92A 3WNZA 1S0MA 4F4XA 4B3MH 4K0KH 1TWFA 3BABA 4QJFA 5DG9A 1KC7A 4B3TH 3KXYT 1Z2OX 5LA6F 4AQYH 4DL4A 3RB4A 4EYIB 4MV7A 2FB9A 2R7ZG 3PO2G 1N56A 1KJ9A 5KT3A 2OH2A 4DLKA 2PMZE 2VQEH 2BR0A 2HVSA 2JEJA 2ASJA 5KT5A 1IBLH 4YJ3F 1WR2A 3GQCA 1C3OA 3TIIA 3NGDA 3VPDA 4G3IA 2FLPA 1Y14B 1Y1WG 4JI3H 4LF6H 4GKKH 2FP4B 1S03G 5IP9G 1XNQH 4IRCA 4IHJF 5K2MA 3VPBA 4E4TA 2RDJA 3T1YH 3RAQA 4A2AA 3HOYG 1V4YA 1JDBB 5A2QW 3RJ0A 2FLLA 3GTMA 1GLVA 5FLMG 4O2AF 4J0MA 1FJGH 1ZHQA 2NVYA 4UCRA 2ASLA 4YAJB 3V4ZA 2V9WA 2V5AA 2ATLA 1I6UA 2MCTA 3OUZA 4BXXG 5D1OB 5J2TF 4X62H 4R8UA 5KFSA 4LMYA 2HVRA 3PR4A 4IRDA 3M9NB 1CE8A 2VOBA 3H4DA 4ME6A 2M7GA 4JV0A 5H80A 2FKLA 3H0GA 3SOKA 4O3RA 4F4ZA 5KFFA 2VQDA 5CA1F 3H4BA 4ED2A 3PW0A 2UU9H 5BR8H 2XCLA 2R82A 2W8KA 3PO3G 3GTGA 2JEGA 5D1PA 5L1LA 2IP4A 3G20A 5L9XA 1ZETA 3PR5B 4RB0A 2CW8A 1CS0A 5CAEB 2AQ4A 5DGBA 3I4NG 4MV1A 1X6XX 5LYJF 3BJYA 3JSNA 1Z2NX 4QW8A 3V6HA 2FLNA 2W9CB 1SYXB 2HI2A 2YZNA 4FBUA 1JIHA 4APMA 1BJTA 4YY3H 4RU9A 4JV1A 4EBCA 4RAZA 2RGRA 1PX2A 3V4SA 4MTDA 5KFKA 4RNNA 2ZM6H 3LP8A 4UFZA 1UC8A 3I12A 1K1QA 3M9OB 1S9FA 4YP3A 1JX4A 4O3OA 5C8YF 2VUGA 1E4GT 3N43B 5EOYA 2C35B 3J80W 2J6UA 4DR7H 3H0GG 1Y1VA 2R7LA 1RJQA 3E5NA 2XCAA 3RUPA 3GV7B 2R93A 1Z2PX 1XDNA 5F9NA 1KJJA 1B04A 1GGOA 1EUCB 4HNVA 2YZMA 1B6RA 4DUYH 4DL2A 3GTKA 3L4JA 4YR3A 3N6RA 1HNZH 4FS2A 4MAMA 1GSOA 2R86A 2W9BB 5L1IA 4DV5H 4A3FG 1XMOH 2CKZB 4J9PA 4ECYA 4JI2H 1OQWA 4ED1A 1E4EA 2HJWA 3GTQA 3T5JA 1BXRA 3M9MB 2ALZA 2I87A 2R8JA 1KEEA 3RV4A 5KFOA 2V4QA 5T14A 1N33H 1CQIB 4YR0A 4ECZA 3OHBA 2RDIA 4TV9F 2I8CA 5KFVA 5KG4A 2ASDA 3MWMA 5LOVF 5KFXA 4Q45A 1X9NA 3QZ7A 4MV9A 5JVLA 1TAEA 2M3KA 4LW9A 3MR2A 3HKZE 1I50A 3N42B 3T5LA 2E2HA 3RF2A 2R93G 2R87A 3GN9A 5DG8A 4BY7G 3T5HA 2UUCH 1GSAA 5IYBG 2R7KA 3PW2A 3KALA 5KFCA 3HKZA 2WYOA 1AUVA 5EWEA 2BQUA 2YW2A 2UUAH 4DL7A 2W71A 3M4IA 3J7AK 4J9NA 5L1KA 2NU6B 4M9UA 3I4MG 4UCUA 4MV3A 4DV0H 1XMQH 4JI7H 3TIGA 4MA0A 1DV1A 4RZRA 4XX0B 4C2MA 2JA5A 1RJPA 1V9PA 1P8LA 4BWSC 2C2RA 1VS0A 4DL3A 2R8GA 2FJZA 2J9GA 4IAJA 3R5XA 5DLGA 5KG2A 2W8LA 3MR6A 1WH2A 4I7HA 3RBEA 3RGZA 3KHLA 2BQ3A 5IYZF 4UCOA 3VMMA 4RUAA 3G6XA 2VPSA 3HBLA 3K3PA 2W6ZA 3UFXB 3TQ1A 5DLFA 3Q1KA 1RG0A 4TV8F 4EGQA 5JVDF 2FPGB 4A3IG 4OX9H 4ZQIA 4IZOA 4RAYA 4ED0A 2DZDA 4ECWA 5C4XG 4UCSA 2JA8G 2KSWA 5KFPA 5IP7G 3KHHA 3BQ0A 3U9SA 4HYKA 5HV6A 1TWGA 2YZGA 4A2BA 2X0SA 1KBLA 3OSPA 3PVXA 3GIQA 3LMLA 1N34H 4ECXA 5KFWA 2I80A 4AYBE 1EZ1A 5LXTF 5C5JA 3BAAA 1FKAH 4FU0A 5KG5A 2JA5G 1C30A 3GIKA 3GTPA 5CB4F 4FBTA 1E4FT 4A93G 1UC9A 5JH7F 4ED6A 5KFGA 4ZOLF 2W9AA 5KFUA 3MR3A 4AYBA 1X6PA 4I4TF 2AU0A 4QIWA 4TUYF 2W70A 2V58A 4RB3C 3QZ8A 1UNNC 4J9RA 3Q8PB 2W6QA 3T5KA 4EBEA 2R7MA 3RFCA 2M05A 5KFYA 2GPWA 3H40A 4Q8EA 4U6PA 1S0NA 4Q44A 4EYHB 2UXBH 4WBNF 1A9XA 4LSAA 3IN5A 2NU8B 4XZ3B 2VQFH 3J81W 4HR7A 5KG6A 4X66H 4ECTA 3SI8A 1HPWA 5LP6F 4PWQA 3GIJA 2QYZA 1RYSA 2Q2UA 1I7LA 4Q43A 1VKZA 2VPQA 3TINA 3HOWG 2QK4A 1KJ8A 4FM9A 2J6SA 2WB1A 5KFIA 5KG1A 2W6PA 3GIIA 2ZDHA 3DF7A 2V59A 4R8UB 5DG7A 1MZBA 1T94A 5HBRB 2V4RA 3GIPA 4JV2A 1IOWA 1JLLB 1M0TA 2J6TA 4GC7A 2VUMA 3HB9A 1RJRA 3BQ1A 4DL5A 4ECUA 4PDBA 1TA8A 3MFHA 5C44G 5JQWA 4C5AA 5KFLA 4F4WA 2WAQE 5CA0F 3MJFA 4MV6A 1VBGA 4EEQA 2UXCH 5KFNA 1AY2A 5LMUH 1T3NA 4NXMH 1A0IA 2UVWA 1R9TA 3RB6A 2UXDH 3MWEA 2JA7A 1GO3E 3ETHA 2YRWA 2WAQA
chains in the Genus database with same CATH topology
1VAJA 1ZQ7A 1WSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VAJ A;  1ZQ7 A;  1WSC A; 
#chains in the Genus database with same CATH topology
 5J2U F;  3CQZ A;  5FJ8 G;  1AN7 A;  4A3G G;  3GIL A;  1GYF A;  4JI0 H;  3BA9 A;  2HGS A;  2W7P A;  1ZHS A;  4QWA A;  2E5L H;  4NLG A;  3GTL A;  1SFO A;  3TQT A;  2YL2 A;  4ZHQ F;  3KHR A;  4U7C A;  4JUZ A;  1I94 H;  4B3R H;  2JEI A;  1ZQ7 A;  5KG0 A;  5IYC G;  3OTO H;  4O3P A;  2DWC A;  4A3C G;  4RZQ A;  2YU9 A;  4RB2 C;  3Q8S B;  5IT9 W;  2YYA A;  4C5C A;  3RB0 A;  3OSN A;  4LF8 H;  3MR5 A;  3RV3 A;  2VUM G;  4M7E A;  4I55 F;  1Y1V G;  2W6O A;  3RBD A;  4GKJ H;  4JYA H;  3BQ2 A;  5EZY F;  2FK1 A;  5KFA A;  4UCT A;  4XYM B;  1V51 A;  5KG3 A;  4EBD A;  4J9O A;  3K3V A;  4JI8 H;  5KT6 A;  2WE6 A;  4JV5 H;  1B33 N;  5KFE A;  4EFE A;  4NXN H;  2F4V H;  1X6Q A;  3K5H A;  5FLX W;  2JEF A;  1W96 A;  4EEY A;  4RNM A;  1HR0 H;  1E4E B;  2O03 A;  3N40 P;  2JA7 G;  2YS7 A;  4RUC A;  4YR2 A;  4DV2 H;  1S68 A;  1L2Z A;  4LF4 H;  4ECV A;  3ORR A;  3JAM W;  2HVQ A;  5C1O A;  1DZO A;  2PVP A;  2DLN A;  1RK5 A;  4QW9 A;  4DR6 H;  2VA2 A;  3N6X A;  4A3J G;  3RAX A;  3R23 A;  5KFH A;  4BBS G;  4JI6 H;  4ED3 A;  5F9L A;  3JZZ A;  2NU7 B;  2PBZ A;  3V6J A;  5KG7 A;  2AGP A;  4RB1 A;  2R8I A;  2AGO A;  3EYY A;  2R7Z A;  2ZDG A;  4YJ2 F;  2R85 A;  2Y0S E;  3GIM A;  4LH6 A;  3GV5 B;  2NVX A;  3JRW A;  2XGP A;  4LSX A;  5KFB A;  4YAK B;  4Y8V B;  1O75 A;  3EPI A;  1DGS A;  2IMW P;  5IWA H;  4J9K A;  1JKJ B;  1TWA A;  3RB3 A;  1JDE A;  2E2I A;  2KEP A;  2OLS A;  3BG5 A;  4ECR A;  3KAJ A;  1PK8 A;  1TWC A;  3N8D A;  5BPF A;  2Y0S A;  3U9T A;  1IOV A;  1M7J A;  3ORQ A;  5D1O A;  4QIW E;  4X64 H;  4ZI7 F;  1I7N A;  1OWT A;  3UQ8 A;  5BMV F;  2XC9 A;  2SCU B;  5KT7 A;  4J9S A;  4O2B F;  4DV4 H;  2VR1 A;  1BGW A;  2BQR A;  3OHA A;  3RIZ A;  3JZI A;  5DQI A;  3G8C A;  5C3E G;  3KTM A;  5I47 A;  2R7N A;  5FPO A;  4DV6 H;  5JUM A;  3LWB A;  4ECQ A;  2C28 A;  2PIL A;  4LF9 H;  2FMA A;  1K1S A;  1KJQ A;  3GLK A;  5KT2 A;  3EPG A;  2PMZ A;  2W9C A;  3SE7 A;  4EFB A;  4DUZ H;  1WSC A;  2YS6 A;  2XGQ A;  1IBM H;  2R84 A;  3Q8R B;  4KHP H;  2FK2 A;  4HNT A;  5DQG A;  4A3B G;  2WB1 E;  5D8D A;  4LF5 H;  4MV4 A;  4DV1 H;  1N36 H;  3WO0 A;  4YB8 B;  1QVE A;  4YBZ B;  2IBK A;  5LMN H;  1N32 H;  4IR1 A;  3CVZ A;  2FE3 A;  3WO1 A;  5KX5 F;  5DQH A;  5KT4 A;  2XIG A;  4X65 H;  4O4I F;  4QWC A;  4WD3 A;  4F50 A;  2DPJ A;  4QWB A;  4LFC H;  3AYH B;  3IG0 A;  2ZDQ A;  4Q0Y A;  2PN1 A;  4EGJ A;  3G6V A;  3JRX A;  4BBR G;  4EG0 A;  5JW8 A;  4J9M A;  1HNW H;  1DV2 A;  4ECS A;  5GON F;  3MFI A;  3R5F A;  3GTJ A;  3GV8 B;  4IRK A;  4MV8 A;  1KJI A;  4GLX A;  3F8N A;  4MA5 A;  3KHG A;  4B3S H;  2ZJT A;  4MTE A;  1XNR H;  2W9B A;  1I3Q A;  4Q8F A;  1EUD B;  2PY0 A;  4FS1 A;  4O3Q A;  3GID A;  1S0O A;  2HHH H;  1IBK H;  3H3V H;  1EYZ A;  3PW5 A;  1B6S A;  2C2D A;  4A3E G;  5EDW A;  2GLT A;  1S10 A;  4DL6 A;  1W93 A;  1J5E H;  3GTO A;  2P0A A;  1SEI A;  4RNO A;  1WCM A;  3H20 A;  3MWD A;  1VBH A;  4IWX A;  1X6Y A;  4J9Q A;  4HNU A;  4DV7 H;  3Q2O A;  1JXL A;  2B63 A;  3L2P A;  5BPH A;  2RF4 A;  4ED8 A;  5IYD G;  2IA6 A;  3L4K A;  5KFR A;  4DV3 H;  3V6K A;  3T1H H;  1RK6 A;  2DIK A;  4F4Y A;  4LH7 A;  2AGQ A;  4R7R A;  2YCH A;  1HNX H;  3RGX A;  2C2E A;  5EWF A;  1AUX A;  3FMA A;  1VAJ A;  3HXL A;  1SCU B;  2C22 A;  4TQS A;  4DR3 H;  4DR4 H;  3FKI A;  2UVU A;  3BA8 A;  5LL6 b;  1K83 A;  5KKN B;  4YHH H;  4DR1 H;  2JA6 A;  2XD4 A;  2W6N A;  2XCP A;  3JYZ A;  2FPP B;  1ULZ A;  1M0W A;  1FVI A;  2R92 A;  2YRX A;  1N48 A;  4LFB H;  3FU1 A;  1TWH A;  4GC6 A;  5FD6 A;  3RTX A;  4J9L A;  3PW4 A;  5KFZ A;  2R6F A;  3PZP A;  4DR5 H;  3C0F B;  5C1P A;  5EWG A;  1WCM G;  4O4L F;  5KFD A;  5DGA A;  2UVV A;  2CZG A;  3N41 B;  4A3K G;  2B63 G;  1GSH A;  4V1J A;  3HOX G;  4A3D G;  4HQ6 A;  4UCV A;  4O3S A;  3ETJ A;  2W57 A;  4I50 F;  4LF7 H;  3FDS A;  2CW7 A;  4A3M G;  2RGV A;  2GPS A;  3Q8Q B;  3JSL A;  4L1K A;  3R5H A;  2WDT A;  5KFQ A;  1T36 A;  2C00 A;  4O3N A;  4ETS A;  4CC5 A;  3HOV G;  3FKI G;  4BY1 G;  2CQY A;  4O4H F;  4QWE A;  2WTF A;  3G6Y A;  2VA3 A;  2JA6 G;  2W6M A;  1RYR A;  3N44 B;  4YQW A;  1X6Z A;  1M6V A;  1Y1W A;  4IWY A;  5FD5 A;  4C5B A;  4JI5 H;  2FPI B;  4DR2 H;  2R8K A;  3KAK A;  3PN1 A;  4CC6 A;  4JI1 H;  4XYL B;  4LFA H;  2FK3 A;  3OUU A;  2R92 G;  3HOU G;  3HOZ G;  4A3L G;  3VPC A;  1S97 A;  5FPR A;  2NU9 B;  2Q2T A;  4TQR A;  3K5I A;  1CQJ B;  4JI4 H;  2UUB H;  1X6R A;  1DIK A;  1BNC A;  1EHI A;  5KFJ A;  3SOJ A;  3QFF A;  4QWD A;  5KFM A;  2R8H A;  5KFT A;  2W7O A;  4ED7 A;  2DPI A;  4IR9 A;  5L1J A;  3PW7 A;  2UVR A;  2NUA B;  2OWO A;  1T92 A;  3WNZ A;  1S0M A;  4F4X A;  4B3M H;  4K0K H;  1TWF A;  3BAB A;  4QJF A;  5DG9 A;  1KC7 A;  4B3T H;  3KXY T;  1Z2O X;  5LA6 F;  4AQY H;  4DL4 A;  3RB4 A;  4EYI B;  4MV7 A;  2FB9 A;  2R7Z G;  3PO2 G;  1N56 A;  1KJ9 A;  5KT3 A;  2OH2 A;  4DLK A;  2PMZ E;  2VQE H;  2BR0 A;  2HVS A;  2JEJ A;  2ASJ A;  5KT5 A;  1IBL H;  4YJ3 F;  1WR2 A;  3GQC A;  1C3O A;  3TII A;  3NGD A;  3VPD A;  4G3I A;  2FLP A;  1Y14 B;  1Y1W G;  4JI3 H;  4LF6 H;  4GKK H;  2FP4 B;  1S03 G;  5IP9 G;  1XNQ H;  4IRC A;  4IHJ F;  5K2M A;  3VPB A;  4E4T A;  2RDJ A;  3T1Y H;  3RAQ A;  4A2A A;  3HOY G;  1V4Y A;  1JDB B;  5A2Q W;  3RJ0 A;  2FLL A;  3GTM A;  1GLV A;  5FLM G;  4O2A F;  4J0M A;  1FJG H;  1ZHQ A;  2NVY A;  4UCR A;  2ASL A;  4YAJ B;  3V4Z A;  2V9W A;  2V5A A;  2ATL A;  1I6U A;  2MCT A;  3OUZ A;  4BXX G;  5D1O B;  5J2T F;  4X62 H;  4R8U A;  5KFS A;  4LMY A;  2HVR A;  3PR4 A;  4IRD A;  3M9N B;  1CE8 A;  2VOB A;  3H4D A;  4ME6 A;  2M7G A;  4JV0 A;  5H80 A;  2FKL A;  3H0G A;  3SOK A;  4O3R A;  4F4Z A;  5KFF A;  2VQD A;  5CA1 F;  3H4B A;  4ED2 A;  3PW0 A;  2UU9 H;  5BR8 H;  2XCL A;  2R82 A;  2W8K A;  3PO3 G;  3GTG A;  2JEG A;  5D1P A;  5L1L A;  2IP4 A;  3G20 A;  5L9X A;  1ZET A;  3PR5 B;  4RB0 A;  2CW8 A;  1CS0 A;  5CAE B;  2AQ4 A;  5DGB A;  3I4N G;  4MV1 A;  1X6X X;  5LYJ F;  3BJY A;  3JSN A;  1Z2N X;  4QW8 A;  3V6H A;  2FLN A;  2W9C B;  1SYX B;  2HI2 A;  2YZN A;  4FBU A;  1JIH A;  4APM A;  1BJT A;  4YY3 H;  4RU9 A;  4JV1 A;  4EBC A;  4RAZ A;  2RGR A;  1PX2 A;  3V4S A;  4MTD A;  5KFK A;  4RNN A;  2ZM6 H;  3LP8 A;  4UFZ A;  1UC8 A;  3I12 A;  1K1Q A;  3M9O B;  1S9F A;  4YP3 A;  1JX4 A;  4O3O A;  5C8Y F;  2VUG A;  1E4G T;  3N43 B;  5EOY A;  2C35 B;  3J80 W;  2J6U A;  4DR7 H;  3H0G G;  1Y1V A;  2R7L A;  1RJQ A;  3E5N A;  2XCA A;  3RUP A;  3GV7 B;  2R93 A;  1Z2P X;  1XDN A;  5F9N A;  1KJJ A;  1B04 A;  1GGO A;  1EUC B;  4HNV A;  2YZM A;  1B6R A;  4DUY H;  4DL2 A;  3GTK A;  3L4J A;  4YR3 A;  3N6R A;  1HNZ H;  4FS2 A;  4MAM A;  1GSO A;  2R86 A;  2W9B B;  5L1I A;  4DV5 H;  4A3F G;  1XMO H;  2CKZ B;  4J9P A;  4ECY A;  4JI2 H;  1OQW A;  4ED1 A;  1E4E A;  2HJW A;  3GTQ A;  3T5J A;  1BXR A;  3M9M B;  2ALZ A;  2I87 A;  2R8J A;  1KEE A;  3RV4 A;  5KFO A;  2V4Q A;  5T14 A;  1N33 H;  1CQI B;  4YR0 A;  4ECZ A;  3OHB A;  2RDI A;  4TV9 F;  2I8C A;  5KFV A;  5KG4 A;  2ASD A;  3MWM A;  5LOV F;  5KFX A;  4Q45 A;  1X9N A;  3QZ7 A;  4MV9 A;  5JVL A;  1TAE A;  2M3K A;  4LW9 A;  3MR2 A;  3HKZ E;  1I50 A;  3N42 B;  3T5L A;  2E2H A;  3RF2 A;  2R93 G;  2R87 A;  3GN9 A;  5DG8 A;  4BY7 G;  3T5H A;  2UUC H;  1GSA A;  5IYB G;  2R7K A;  3PW2 A;  3KAL A;  5KFC A;  3HKZ A;  2WYO A;  1AUV A;  5EWE A;  2BQU A;  2YW2 A;  2UUA H;  4DL7 A;  2W71 A;  3M4I A;  3J7A K;  4J9N A;  5L1K A;  2NU6 B;  4M9U A;  3I4M G;  4UCU A;  4MV3 A;  4DV0 H;  1XMQ H;  4JI7 H;  3TIG A;  4MA0 A;  1DV1 A;  4RZR A;  4XX0 B;  4C2M A;  2JA5 A;  1RJP A;  1V9P A;  1P8L A;  4BWS C;  2C2R A;  1VS0 A;  4DL3 A;  2R8G A;  2FJZ A;  2J9G A;  4IAJ A;  3R5X A;  5DLG A;  5KG2 A;  2W8L A;  3MR6 A;  1WH2 A;  4I7H A;  3RBE A;  3RGZ A;  3KHL A;  2BQ3 A;  5IYZ F;  4UCO A;  3VMM A;  4RUA A;  3G6X A;  2VPS A;  3HBL A;  3K3P A;  2W6Z A;  3UFX B;  3TQ1 A;  5DLF A;  3Q1K A;  1RG0 A;  4TV8 F;  4EGQ A;  5JVD F;  2FPG B;  4A3I G;  4OX9 H;  4ZQI A;  4IZO A;  4RAY A;  4ED0 A;  2DZD A;  4ECW A;  5C4X G;  4UCS A;  2JA8 G;  2KSW A;  5KFP A;  5IP7 G;  3KHH A;  3BQ0 A;  3U9S A;  4HYK A;  5HV6 A;  1TWG A;  2YZG A;  4A2B A;  2X0S A;  1KBL A;  3OSP A;  3PVX A;  3GIQ A;  3LML A;  1N34 H;  4ECX A;  5KFW A;  2I80 A;  4AYB E;  1EZ1 A;  5LXT F;  5C5J A;  3BAA A;  1FKA H;  4FU0 A;  5KG5 A;  2JA5 G;  1C30 A;  3GIK A;  3GTP A;  5CB4 F;  4FBT A;  1E4F T;  4A93 G;  1UC9 A;  5JH7 F;  4ED6 A;  5KFG A;  4ZOL F;  2W9A A;  5KFU A;  3MR3 A;  4AYB A;  1X6P A;  4I4T F;  2AU0 A;  4QIW A;  4TUY F;  2W70 A;  2V58 A;  4RB3 C;  3QZ8 A;  1UNN C;  4J9R A;  3Q8P B;  2W6Q A;  3T5K A;  4EBE A;  2R7M A;  3RFC A;  2M05 A;  5KFY A;  2GPW A;  3H40 A;  4Q8E A;  4U6P A;  1S0N A;  4Q44 A;  4EYH B;  2UXB H;  4WBN F;  1A9X A;  4LSA A;  3IN5 A;  2NU8 B;  4XZ3 B;  2VQF H;  3J81 W;  4HR7 A;  5KG6 A;  4X66 H;  4ECT A;  3SI8 A;  1HPW A;  5LP6 F;  4PWQ A;  3GIJ A;  2QYZ A;  1RYS A;  2Q2U A;  1I7L A;  4Q43 A;  1VKZ A;  2VPQ A;  3TIN A;  3HOW G;  2QK4 A;  1KJ8 A;  4FM9 A;  2J6S A;  2WB1 A;  5KFI A;  5KG1 A;  2W6P A;  3GII A;  2ZDH A;  3DF7 A;  2V59 A;  4R8U B;  5DG7 A;  1MZB A;  1T94 A;  5HBR B;  2V4R A;  3GIP A;  4JV2 A;  1IOW A;  1JLL B;  1M0T A;  2J6T A;  4GC7 A;  2VUM A;  3HB9 A;  1RJR A;  3BQ1 A;  4DL5 A;  4ECU A;  4PDB A;  1TA8 A;  3MFH A;  5C44 G;  5JQW A;  4C5A A;  5KFL A;  4F4W A;  2WAQ E;  5CA0 F;  3MJF A;  4MV6 A;  1VBG A;  4EEQ A;  2UXC H;  5KFN A;  1AY2 A;  5LMU H;  1T3N A;  4NXM H;  1A0I A;  2UVW A;  1R9T A;  3RB6 A;  2UXD H;  3MWE A;  2JA7 A;  1GO3 E;  3ETH A;  2YRW A;  2WAQ A; 
#chains in the Genus database with same CATH homology
 1VAJ A;  1ZQ7 A;  1WSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...