1WSCA

Crystal structure of st0229, function unknown protein from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
225
Chain Sequence
b'QEQLVAVNELNENLGKVLIKIARDSIANKLGILKINLEDYLSSLNDPILNKKGLAFVTLETYYGNSTSLRGCIGYVEAVAPLKEIVSKAAIAAAFSDPRFPPLSKGEFDNIIIEVTVLTKPQEIDVENRWELPKKIKVGEDGLIVEYGILYSGLLLPQVPMEYCWDEETFLAETCIKAGLEPDCWLNNKVKIKKFQGIIFREEKPKSEKILIIKPSEVKCKKEEI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hypothetical protein ST0229
molecule tags Structural genomics, unknown function
source organism Sulfolobus tokodaii
publication title Crystal structure of ST0229, function unknown protein from Sulfolobus tokodaii
rcsb
total genus 61
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1wscA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1wscA02
1ZQ7A 1VAJA 1WSCA
chains in the Genus database with same CATH superfamily
2WE6A 5KT6A 2HJWA 3C0FB 5IWAH 3T5KA 4Q8FA 2YZGA 3MR6A 2W9CA 2HI2A 4YB8B 5BMVF 3OSPA 3I4MG 4JI1H 2W8KA 5GONF 4ECSA 4F4ZA 4EBEA 5KT5A 4JUZA 3GIJA 3EYYA 5JVDF 5IYZF 4FBUA 4BY1G 3GV8B 1CE8A 4C5CA 4B3MH 4ECZA 3V4ZA 4LF8H 4RAYA 5KT2A 2OH2A 1HNWH 3RJ0A 3U9TA 1I7LA 4FU0A 4Q43A 1FKAH 3T5HA 3KHHA 3VPDA 1IBMH 4ECYA 2ASJA 4YAKB 3BQ0A 1N36H 4TUYF 4ETSA 3LWBA 3PW2A 5JQWA 4GC6A 4BBSG 2R92G 3H0GG 4CC5A 1TWHA 4JI2H 3T1YH 4J0MA 1C30A 4MA0A 4ECVA 4JI3H 5CA0F 2PN1A 1PX2A 4O3SA 1N33H 1DIKA 2UVWA 1ZHSA 4EBCA 1S0MA 1I7NA 2DPJA 3UFXB 4OX9H 2JEIA 2UXDH 1BNCA 1Z2OX 5C44G 2VUGA 4QWEA 4A3IG 1N56A 4ME6A 4J9MA 4NXNH 2XD4A 2FPPB 3Q8RB 1K83A 3GIDA 4L1KA 5J2UF 3TINA 2VQFH 2DLNA 2FP4B 4DV3H 2JEJA 4A3DG 5C4XG 4M9UA 4IRCA 2SCUB 2XIGA 2W7OA 3Q8SB 1EUDB 4XYMB 3Q8QB 1S9FA 3DF7A 3EPIA 4X66H 5CB4F 2IMWP 1V9PA 3K5IA 3MWMA 2PMZE 3RGXA 5KFIA 3GIPA 4I4TF 4YR3A 2YRXA 5KFFA 1IBLH 1PK8A 1BXRA 1S0NA 3PW0A 4HR7A 4MV9A 5FJ8G 2IP4A 2XC9A 2R7LA 5T14A 5A2QW 4C5AA 5F9NA 3J80W 2W9BB 3ETHA 3VPBA 4QWDA 2R85A 5CAEB 3JSLA 1X6RA 5LOVF 3H0GA 1KEEA 4ECWA 2YZNA 3RB3A 4ECTA 2PILA 4EYIB 4IRDA 4MV8A 1S97A 4PDBA 2I87A 4YY3H 2R7KA 5LP6F 3TIIA 3R5XA 2PBZA 4QWBA 5IYDG 5EWGA 4ED7A 2JEFA 4ZHQF 3Q8PB 2J6UA 4RNNA 4Q0YA 3GLKA 2QYZA 1HNZH 1CQIB 3GQCA 3BJYA 1IOVA 1JIHA 4RUAA 1XNQH 3PW7A 2UUBH 4DL6A 4JV1A 5KFPA 3M9NB 5LA6F 1DGSA 5DGAA 4A3BG 1N48A 4YJ2F 5C3EG 1A9XA 4HNUA 1QVEA 3H40A 2UUCH 3GTMA 5EOYA 4LMYA 5KG3A 4IRKA 5KFDA 3HOWG 4DV4H 2R8IA 2CW8A 4M7EA 2VA3A 5JUMA 4ECXA 2W9AA 4EEYA 3JRXA 2QK4A 2HVQA 3GTQA 1KC7A 3L2PA 2W9BA 4A93G 3V6KA 4AYBA 1EHIA 1UC8A 2XCAA 4Q44A 2WB1E 3J81W 2AGQA 3GTGA 4RB2C 5L1KA 1JKJB 2PVPA 5KKNB 4A3MG 3KXYT 3GTLA 3Q1KA 1Z2PX 2Q2TA 3HOVG 4EGQA 5JVLA 3RIZA 2AGOA 2UVUA 2CW7A 1XNRH 4DR2H 2FE3A 2ASDA 2JA5A 1UNNC 3N42B 3SOJA 2NU9B 3G6XA 4F4WA 3CVZA 3KALA 4ED6A 4DUYH 5H80A 2BQRA 3SOKA 1Z2NX 4J9QA 5D1OA 2JA7A 1CQJB 2VR1A 2DWCA 3J7AK 1CS0A 2AU0A 1E4GT 3PN1A 1E4EB 4CC6A 4RB3C 1KJ8A 5L1IA 2FB9A 1GSOA 4LSAA 4JI5H 1HPWA 2ZDGA 3ETJA 3RB6A 1JDBB 1O75A 3FKIA 1WH2A 1N32H 4Q45A 1B33N 2XGPA 1B6SA 3MFIA 1S68A 5KG7A 4RUCA 4DR3H 3RAQA 4IHJF 5FD5A 1TWFA 4GLXA 1FVIA 1HR0H 2V9WA 2UXCH 1I50A 4B3SH 4DL2A 4FM9A 5KFUA 5KFKA 3GV7B 4O3OA 4O2BF 5C8YF 3H4DA 2UU9H 4O4IF 5KG4A 1V4YA 5EWFA 2JA7G 5KFQA 4E4TA 4GKJH 4A2BA 1AN7A 1AUXA 3M9MB 4ZQIA 3PZPA 2V59A 4X64H 1XDNA 3HOZG 4ECUA 3HXLA 2XGQA 3TIGA 4A3LG 1XMOH 2YU9A 4EBDA 1MZBA 2VQDA 4LH7A 2UVVA 4YQWA 2Y0SA 2IA6A 1SEIA 3HBLA 4RB0A 4Y8VB 4DV1H 4LFBH 5BPHA 1Y1WA 4J9RA 3NGDA 3KAJA 3K3PA 5IP9G 2X0SA 4YP3A 3RB4A 3GV5B 3HKZE 4JYAH 4RB1A 4EGJA 2RGVA 5DQHA 3QFFA 4JV0A 1VBHA 1M6VA 2WAQE 5EDWA 3GIKA 3VMMA 4EYHB 5LYJF 3PW4A 2NVYA 4O4LF 4NXMH 1GYFA 3IN5A 1WSCA 2CQYA 2JA5G 2UXBH 4A3JG 3JSNA 4QJFA 5FD6A 3JZZA 2WAQA 4A2AA 4DV6H 3M4IA 4ZI7F 4O3NA 3RBEA 2W6NA 4J9NA 4MV4A 4ED0A 4IR1A 3HKZA 4V1JA 1X6XX 3R5FA 4AQYH 1FJGH 5DGBA 5LL6b 3PO3G 4DL3A 5KFTA 4G3IA 2MCTA 3LMLA 2WYOA 3E5NA 3CQZA 5KFGA 5KFWA 2FLPA 5K2MA 3RFCA 2XCPA 2B63A 3FKIG 3JAMW 4UCOA 2GPSA 1RYSA 5C1OA 2W70A 5LMUH 4BY7G 1X6QA 2ZJTA 1I6UA 2VQEH 4DUZH 2C22A 2R7NA 3WO1A 3N6RA 4ED3A 2BQ3A 2ALZA 1RYRA 1AY2A 5L1LA 4UCRA 4RU9A 4TQSA 4ED8A 3GIMA 3N44B 1BGWA 5F9LA 5KFYA 3OHAA 4A3KG 1T94A 1GSHA 3MFHA 1TWAA 2RDIA 5BPFA 4EFEA 1GGOA 3BA9A 3LP8A 4RNOA 3T5JA 1JDEA 2R84A 4O3PA 5D1OB 5L9XA 4LF6H 5KFNA 1X6ZA 1X6PA 4MAMA 3RBDA 4MTDA 4IWYA 4LW9A 1GLVA 2HGSA 4TQRA 4LH6A 2W8LA 4DV2H 4DL5A 1C3OA 2M05A 4DV5H 3JZIA 5FLMG 3N43B 2I8CA 2W6MA 4HYKA 2PY0A 2ZM6H 1RJRA 2W6OA 2W6PA 5KFSA 2YZMA 3GTKA 3K5HA 2J9GA 5C1PA 4O3QA 2YYAA 1Y14B 1KJJA 3RGZA 4AYBE 4J9KA 2AGPA 4LFCH 4R8UA 1R9TA 1Y1VA 4C2MA 4LF9H 4WD3A 2WTFA 4HQ6A 2Q2UA 2FKLA 2NU8B 4J9LA 4DR1H 1KBLA 3GN9A 1VKZA 1KJ9A 4MV3A 2KEPA 1A0IA 4IAJA 1S0OA 4J9OA 5KFCA 2FLLA 4J9PA 5KG6A 4UCVA 2V4QA 3R5HA 1SCUB 1VBGA 2FPGB 4A3GG 4JV2A 4UCSA 2R6FA 4DLKA 5KFHA 1L2ZA 1Y1WG 3GTJA 3V6HA 4LFAH 2R82A 4JI0H 5C5JA 5DG7A 4YJ3F 2WDTA 5KFVA 3G20A 1EYZA 2RGRA 4JI6H 3EPGA 5L1JA 3OSNA 3M9OB 4A3CG 4X65H 1I94H 3PR4A 2R8JA 3RB0A 2ZDHA 1V51A 3SE7A 5JH7F 4FBTA 4IR9A 3KHGA 2J6SA 3H20A 2R8HA 3PO2G 2VPSA 4APMA 3V4SA 4HNVA 2R8GA 2OLSA 4U7CA 5KX5F 2W57A 4BXXG 4BWSC 1T3NA 2JA6A 3KTMA 4DR6H 2FK2A 2J6TA 4RZQA 3HOYG 4KHPH 2E5LH 3HOUG 5DQGA 4R8UB 2V5AA 1TA8A 3MR5A 5KT7A 4WBNF 1WCMG 3IG0A 1T92A 3UQ8A 3OUZA 3MJFA 3QZ8A 4ED2A 2FJZA 4QIWA 1IBKH 5HBRB 5BR8H 4FS2A 5J2TF 4HNTA 2C2DA 2DIKA 4EFBA 2O03A 3ORQA 4X62H 1RK5A 4O2AF 1AUVA 4YBZB 1Y1VG 1VAJA 4DR5H 1VS0A 4QWAA 2M7GA 1SYXB 2YCHA 5DLGA 3BABA 3N41B 3KHLA 4LF7H 2W6ZA 1EUCB 3N40P 5IYBG 2F4VH 4GC7A 5JW8A 3I12A 4IWXA 4FS1A 2C35B 3RUPA 3TQ1A 1ZHQA 2WB1A 2UUAH 3T5LA 1XMQH 4DV0H 4QW8A 2I80A 5DG8A 3JYZA 4TV8F 4GKKH 2M3KA 4I55F 1TWCA 4RAZA 4ECRA 4DL7A 4ED1A 4EEQA 1OQWA 4IZOA 3VPCA 3G6VA 2ATLA 5FPRA 5CA1F 3PW5A 3RF2A 3MR2A 2P0AA 1ZETA 2W6QA 3MWEA 3HB9A 1P8LA 4C5BA 1RJQA 3V6JA 1WCMA 2CZGA 1BJTA 3MWDA 5LXTF 5KG5A 1W96A 4UCTA 4LSXA 4YR0A 1HNXH 1GO3E 2GPWA 2R7MA 1EZ1A 3F8NA 4DR7H 2E2IA 1WR2A 5KFAA 3WO0A 2R86A 3L4JA 4B3RH 4DR4H 2R93A 5KFLA 3BQ1A 2YRWA 4B3TH 3H3VH 2JA6G 1M0WA 4I50F 2YW2A 4BBRG 3K3VA 4MV1A 5IT9W 2VUMA 1RG0A 5EZYF 1OWTA 3BG5A 4MTEA 2BR0A 3BA8A 4O3RA 2C00A 5KFZA 3SI8A 3GIQA 1M7JA 1JXLA 4NLGA 2YL2A 3OUUA 3GIIA 2JEGA 3GILA 1N34H 4JV5H 2R92A 1KJIA 2BQUA 4YAJB 2NU6B 4QWCA 2CKZB 3PR5B 5KT3A 1ULZA 3U9SA 4K0KH 1DV2A 4YHHH 4LF5H 3MR3A 2PMZA 2FK1A 4EG0A 1JX4A 4R7RA 2UVRA 4QW9A 3RAXA 2AQ4A 2R87A 4XYLB 1DZOA 2R8KA 1S03G 2DZDA 4XX0B 2W9CB 2E2HA 1T36A 4F50A 2YS6A 4A3FG 1IOWA 4ECQA 5KT4A 3L4KA 4XZ3B 3RV3A 2HVSA 3N8DA 2C2RA 1GSAA 4F4XA 2RF4A 4QIWE 5KG2A 5KFBA 2FK3A 3R23A 3GTOA 2KSWA 2NVXA 4JI8H 1KJQA 2VUMG 5KG1A 4TV9F 3GTPA 4O4HF 3RTXA 2FMAA 4JI4H 4PWQA 5KFRA 2V4RA 2HHHH 3ORRA 1I3QA 2ASLA 4YR2A 2GLTA 1TAEA 5DG9A 1X9NA 2V58A 3G6YA 1SFOA 2NU7B 3FU1A 3TQTA 5DQIA 3N6XA 1J5EH 3BAAA 5KFJA 3AYHB 2R7ZA 5KFEA 2VOBA 4U6PA 2NUAB 3I4NG 5FPOA 1K1QA 1M0TA 2XCLA 5KG0A 5KFXA 3PVXA 1JLLB 1B6RA 3KAKA 1DV1A 5D1PA 5KFOA 5IP7G 4RNMA 2IBKA 1ZQ7A 4F4YA 2HVRA 3OTOH 3JRWA 3HOXG 4DV7H 3FDSA 3T1HH 1K1SA 2RDJA 5D8DA 2FPIB 4MV6A 4UFZA 5IYCG 3H4BA 2OWOA 1B04A 5KFMA 3RV4A 1E4EA 1X6YA 1TWGA 5LMNH 3QZ7A 2W7PA 2VPQA 4I7HA 5I47A 4LF4H 2R93G 1W93A 4MA5A 4UCUA 4MV7A 5EWEA 3Q2OA 2R7ZG 2FLNA 2JA8G 3OHBA 1UC9A 4Q8EA 2Y0SE 1RK6A 3FMAA 3WNZA 2W71A 3BQ2A 4DL4A 4ZOLF 2YS7A 4J9SA 3KHRA 4JI7H 2C2EA 2VA2A 2DPIA 5DLFA 1E4FT 4A3EG 5HV6A 2ZDQA 1RJPA 4RZRA 2C28A 1S10A 2B63G 5FLXW 3G8CA
chains in the Genus database with same CATH topology
1ZQ7A 1VAJA 1WSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ7 A;  1VAJ A;  1WSC A; 
#chains in the Genus database with same CATH topology
 2WE6 A;  5KT6 A;  2HJW A;  3C0F B;  5IWA H;  3T5K A;  4Q8F A;  2YZG A;  3MR6 A;  2W9C A;  2HI2 A;  4YB8 B;  5BMV F;  3OSP A;  3I4M G;  4JI1 H;  2W8K A;  5GON F;  4ECS A;  4F4Z A;  4EBE A;  5KT5 A;  4JUZ A;  3GIJ A;  3EYY A;  5JVD F;  5IYZ F;  4FBU A;  4BY1 G;  3GV8 B;  1CE8 A;  4C5C A;  4B3M H;  4ECZ A;  3V4Z A;  4LF8 H;  4RAY A;  5KT2 A;  2OH2 A;  1HNW H;  3RJ0 A;  3U9T A;  1I7L A;  4FU0 A;  4Q43 A;  1FKA H;  3T5H A;  3KHH A;  3VPD A;  1IBM H;  4ECY A;  2ASJ A;  4YAK B;  3BQ0 A;  1N36 H;  4TUY F;  4ETS A;  3LWB A;  3PW2 A;  5JQW A;  4GC6 A;  4BBS G;  2R92 G;  3H0G G;  4CC5 A;  1TWH A;  4JI2 H;  3T1Y H;  4J0M A;  1C30 A;  4MA0 A;  4ECV A;  4JI3 H;  5CA0 F;  2PN1 A;  1PX2 A;  4O3S A;  1N33 H;  1DIK A;  2UVW A;  1ZHS A;  4EBC A;  1S0M A;  1I7N A;  2DPJ A;  3UFX B;  4OX9 H;  2JEI A;  2UXD H;  1BNC A;  1Z2O X;  5C44 G;  2VUG A;  4QWE A;  4A3I G;  1N56 A;  4ME6 A;  4J9M A;  4NXN H;  2XD4 A;  2FPP B;  3Q8R B;  1K83 A;  3GID A;  4L1K A;  5J2U F;  3TIN A;  2VQF H;  2DLN A;  2FP4 B;  4DV3 H;  2JEJ A;  4A3D G;  5C4X G;  4M9U A;  4IRC A;  2SCU B;  2XIG A;  2W7O A;  3Q8S B;  1EUD B;  4XYM B;  3Q8Q B;  1S9F A;  3DF7 A;  3EPI A;  4X66 H;  5CB4 F;  2IMW P;  1V9P A;  3K5I A;  3MWM A;  2PMZ E;  3RGX A;  5KFI A;  3GIP A;  4I4T F;  4YR3 A;  2YRX A;  5KFF A;  1IBL H;  1PK8 A;  1BXR A;  1S0N A;  3PW0 A;  4HR7 A;  4MV9 A;  5FJ8 G;  2IP4 A;  2XC9 A;  2R7L A;  5T14 A;  5A2Q W;  4C5A A;  5F9N A;  3J80 W;  2W9B B;  3ETH A;  3VPB A;  4QWD A;  2R85 A;  5CAE B;  3JSL A;  1X6R A;  5LOV F;  3H0G A;  1KEE A;  4ECW A;  2YZN A;  3RB3 A;  4ECT A;  2PIL A;  4EYI B;  4IRD A;  4MV8 A;  1S97 A;  4PDB A;  2I87 A;  4YY3 H;  2R7K A;  5LP6 F;  3TII A;  3R5X A;  2PBZ A;  4QWB A;  5IYD G;  5EWG A;  4ED7 A;  2JEF A;  4ZHQ F;  3Q8P B;  2J6U A;  4RNN A;  4Q0Y A;  3GLK A;  2QYZ A;  1HNZ H;  1CQI B;  3GQC A;  3BJY A;  1IOV A;  1JIH A;  4RUA A;  1XNQ H;  3PW7 A;  2UUB H;  4DL6 A;  4JV1 A;  5KFP A;  3M9N B;  5LA6 F;  1DGS A;  5DGA A;  4A3B G;  1N48 A;  4YJ2 F;  5C3E G;  1A9X A;  4HNU A;  1QVE A;  3H40 A;  2UUC H;  3GTM A;  5EOY A;  4LMY A;  5KG3 A;  4IRK A;  5KFD A;  3HOW G;  4DV4 H;  2R8I A;  2CW8 A;  4M7E A;  2VA3 A;  5JUM A;  4ECX A;  2W9A A;  4EEY A;  3JRX A;  2QK4 A;  2HVQ A;  3GTQ A;  1KC7 A;  3L2P A;  2W9B A;  4A93 G;  3V6K A;  4AYB A;  1EHI A;  1UC8 A;  2XCA A;  4Q44 A;  2WB1 E;  3J81 W;  2AGQ A;  3GTG A;  4RB2 C;  5L1K A;  1JKJ B;  2PVP A;  5KKN B;  4A3M G;  3KXY T;  3GTL A;  3Q1K A;  1Z2P X;  2Q2T A;  3HOV G;  4EGQ A;  5JVL A;  3RIZ A;  2AGO A;  2UVU A;  2CW7 A;  1XNR H;  4DR2 H;  2FE3 A;  2ASD A;  2JA5 A;  1UNN C;  3N42 B;  3SOJ A;  2NU9 B;  3G6X A;  4F4W A;  3CVZ A;  3KAL A;  4ED6 A;  4DUY H;  5H80 A;  2BQR A;  3SOK A;  1Z2N X;  4J9Q A;  5D1O A;  2JA7 A;  1CQJ B;  2VR1 A;  2DWC A;  3J7A K;  1CS0 A;  2AU0 A;  1E4G T;  3PN1 A;  1E4E B;  4CC6 A;  4RB3 C;  1KJ8 A;  5L1I A;  2FB9 A;  1GSO A;  4LSA A;  4JI5 H;  1HPW A;  2ZDG A;  3ETJ A;  3RB6 A;  1JDB B;  1O75 A;  3FKI A;  1WH2 A;  1N32 H;  4Q45 A;  1B33 N;  2XGP A;  1B6S A;  3MFI A;  1S68 A;  5KG7 A;  4RUC A;  4DR3 H;  3RAQ A;  4IHJ F;  5FD5 A;  1TWF A;  4GLX A;  1FVI A;  1HR0 H;  2V9W A;  2UXC H;  1I50 A;  4B3S H;  4DL2 A;  4FM9 A;  5KFU A;  5KFK A;  3GV7 B;  4O3O A;  4O2B F;  5C8Y F;  3H4D A;  2UU9 H;  4O4I F;  5KG4 A;  1V4Y A;  5EWF A;  2JA7 G;  5KFQ A;  4E4T A;  4GKJ H;  4A2B A;  1AN7 A;  1AUX A;  3M9M B;  4ZQI A;  3PZP A;  2V59 A;  4X64 H;  1XDN A;  3HOZ G;  4ECU A;  3HXL A;  2XGQ A;  3TIG A;  4A3L G;  1XMO H;  2YU9 A;  4EBD A;  1MZB A;  2VQD A;  4LH7 A;  2UVV A;  4YQW A;  2Y0S A;  2IA6 A;  1SEI A;  3HBL A;  4RB0 A;  4Y8V B;  4DV1 H;  4LFB H;  5BPH A;  1Y1W A;  4J9R A;  3NGD A;  3KAJ A;  3K3P A;  5IP9 G;  2X0S A;  4YP3 A;  3RB4 A;  3GV5 B;  3HKZ E;  4JYA H;  4RB1 A;  4EGJ A;  2RGV A;  5DQH A;  3QFF A;  4JV0 A;  1VBH A;  1M6V A;  2WAQ E;  5EDW A;  3GIK A;  3VMM A;  4EYH B;  5LYJ F;  3PW4 A;  2NVY A;  4O4L F;  4NXM H;  1GYF A;  3IN5 A;  1WSC A;  2CQY A;  2JA5 G;  2UXB H;  4A3J G;  3JSN A;  4QJF A;  5FD6 A;  3JZZ A;  2WAQ A;  4A2A A;  4DV6 H;  3M4I A;  4ZI7 F;  4O3N A;  3RBE A;  2W6N A;  4J9N A;  4MV4 A;  4ED0 A;  4IR1 A;  3HKZ A;  4V1J A;  1X6X X;  3R5F A;  4AQY H;  1FJG H;  5DGB A;  5LL6 b;  3PO3 G;  4DL3 A;  5KFT A;  4G3I A;  2MCT A;  3LML A;  2WYO A;  3E5N A;  3CQZ A;  5KFG A;  5KFW A;  2FLP A;  5K2M A;  3RFC A;  2XCP A;  2B63 A;  3FKI G;  3JAM W;  4UCO A;  2GPS A;  1RYS A;  5C1O A;  2W70 A;  5LMU H;  4BY7 G;  1X6Q A;  2ZJT A;  1I6U A;  2VQE H;  4DUZ H;  2C22 A;  2R7N A;  3WO1 A;  3N6R A;  4ED3 A;  2BQ3 A;  2ALZ A;  1RYR A;  1AY2 A;  5L1L A;  4UCR A;  4RU9 A;  4TQS A;  4ED8 A;  3GIM A;  3N44 B;  1BGW A;  5F9L A;  5KFY A;  3OHA A;  4A3K G;  1T94 A;  1GSH A;  3MFH A;  1TWA A;  2RDI A;  5BPF A;  4EFE A;  1GGO A;  3BA9 A;  3LP8 A;  4RNO A;  3T5J A;  1JDE A;  2R84 A;  4O3P A;  5D1O B;  5L9X A;  4LF6 H;  5KFN A;  1X6Z A;  1X6P A;  4MAM A;  3RBD A;  4MTD A;  4IWY A;  4LW9 A;  1GLV A;  2HGS A;  4TQR A;  4LH6 A;  2W8L A;  4DV2 H;  4DL5 A;  1C3O A;  2M05 A;  4DV5 H;  3JZI A;  5FLM G;  3N43 B;  2I8C A;  2W6M A;  4HYK A;  2PY0 A;  2ZM6 H;  1RJR A;  2W6O A;  2W6P A;  5KFS A;  2YZM A;  3GTK A;  3K5H A;  2J9G A;  5C1P A;  4O3Q A;  2YYA A;  1Y14 B;  1KJJ A;  3RGZ A;  4AYB E;  4J9K A;  2AGP A;  4LFC H;  4R8U A;  1R9T A;  1Y1V A;  4C2M A;  4LF9 H;  4WD3 A;  2WTF A;  4HQ6 A;  2Q2U A;  2FKL A;  2NU8 B;  4J9L A;  4DR1 H;  1KBL A;  3GN9 A;  1VKZ A;  1KJ9 A;  4MV3 A;  2KEP A;  1A0I A;  4IAJ A;  1S0O A;  4J9O A;  5KFC A;  2FLL A;  4J9P A;  5KG6 A;  4UCV A;  2V4Q A;  3R5H A;  1SCU B;  1VBG A;  2FPG B;  4A3G G;  4JV2 A;  4UCS A;  2R6F A;  4DLK A;  5KFH A;  1L2Z A;  1Y1W G;  3GTJ A;  3V6H A;  4LFA H;  2R82 A;  4JI0 H;  5C5J A;  5DG7 A;  4YJ3 F;  2WDT A;  5KFV A;  3G20 A;  1EYZ A;  2RGR A;  4JI6 H;  3EPG A;  5L1J A;  3OSN A;  3M9O B;  4A3C G;  4X65 H;  1I94 H;  3PR4 A;  2R8J A;  3RB0 A;  2ZDH A;  1V51 A;  3SE7 A;  5JH7 F;  4FBT A;  4IR9 A;  3KHG A;  2J6S A;  3H20 A;  2R8H A;  3PO2 G;  2VPS A;  4APM A;  3V4S A;  4HNV A;  2R8G A;  2OLS A;  4U7C A;  5KX5 F;  2W57 A;  4BXX G;  4BWS C;  1T3N A;  2JA6 A;  3KTM A;  4DR6 H;  2FK2 A;  2J6T A;  4RZQ A;  3HOY G;  4KHP H;  2E5L H;  3HOU G;  5DQG A;  4R8U B;  2V5A A;  1TA8 A;  3MR5 A;  5KT7 A;  4WBN F;  1WCM G;  3IG0 A;  1T92 A;  3UQ8 A;  3OUZ A;  3MJF A;  3QZ8 A;  4ED2 A;  2FJZ A;  4QIW A;  1IBK H;  5HBR B;  5BR8 H;  4FS2 A;  5J2T F;  4HNT A;  2C2D A;  2DIK A;  4EFB A;  2O03 A;  3ORQ A;  4X62 H;  1RK5 A;  4O2A F;  1AUV A;  4YBZ B;  1Y1V G;  1VAJ A;  4DR5 H;  1VS0 A;  4QWA A;  2M7G A;  1SYX B;  2YCH A;  5DLG A;  3BAB A;  3N41 B;  3KHL A;  4LF7 H;  2W6Z A;  1EUC B;  3N40 P;  5IYB G;  2F4V H;  4GC7 A;  5JW8 A;  3I12 A;  4IWX A;  4FS1 A;  2C35 B;  3RUP A;  3TQ1 A;  1ZHQ A;  2WB1 A;  2UUA H;  3T5L A;  1XMQ H;  4DV0 H;  4QW8 A;  2I80 A;  5DG8 A;  3JYZ A;  4TV8 F;  4GKK H;  2M3K A;  4I55 F;  1TWC A;  4RAZ A;  4ECR A;  4DL7 A;  4ED1 A;  4EEQ A;  1OQW A;  4IZO A;  3VPC A;  3G6V A;  2ATL A;  5FPR A;  5CA1 F;  3PW5 A;  3RF2 A;  3MR2 A;  2P0A A;  1ZET A;  2W6Q A;  3MWE A;  3HB9 A;  1P8L A;  4C5B A;  1RJQ A;  3V6J A;  1WCM A;  2CZG A;  1BJT A;  3MWD A;  5LXT F;  5KG5 A;  1W96 A;  4UCT A;  4LSX A;  4YR0 A;  1HNX H;  1GO3 E;  2GPW A;  2R7M A;  1EZ1 A;  3F8N A;  4DR7 H;  2E2I A;  1WR2 A;  5KFA A;  3WO0 A;  2R86 A;  3L4J A;  4B3R H;  4DR4 H;  2R93 A;  5KFL A;  3BQ1 A;  2YRW A;  4B3T H;  3H3V H;  2JA6 G;  1M0W A;  4I50 F;  2YW2 A;  4BBR G;  3K3V A;  4MV1 A;  5IT9 W;  2VUM A;  1RG0 A;  5EZY F;  1OWT A;  3BG5 A;  4MTE A;  2BR0 A;  3BA8 A;  4O3R A;  2C00 A;  5KFZ A;  3SI8 A;  3GIQ A;  1M7J A;  1JXL A;  4NLG A;  2YL2 A;  3OUU A;  3GII A;  2JEG A;  3GIL A;  1N34 H;  4JV5 H;  2R92 A;  1KJI A;  2BQU A;  4YAJ B;  2NU6 B;  4QWC A;  2CKZ B;  3PR5 B;  5KT3 A;  1ULZ A;  3U9S A;  4K0K H;  1DV2 A;  4YHH H;  4LF5 H;  3MR3 A;  2PMZ A;  2FK1 A;  4EG0 A;  1JX4 A;  4R7R A;  2UVR A;  4QW9 A;  3RAX A;  2AQ4 A;  2R87 A;  4XYL B;  1DZO A;  2R8K A;  1S03 G;  2DZD A;  4XX0 B;  2W9C B;  2E2H A;  1T36 A;  4F50 A;  2YS6 A;  4A3F G;  1IOW A;  4ECQ A;  5KT4 A;  3L4K A;  4XZ3 B;  3RV3 A;  2HVS A;  3N8D A;  2C2R A;  1GSA A;  4F4X A;  2RF4 A;  4QIW E;  5KG2 A;  5KFB A;  2FK3 A;  3R23 A;  3GTO A;  2KSW A;  2NVX A;  4JI8 H;  1KJQ A;  2VUM G;  5KG1 A;  4TV9 F;  3GTP A;  4O4H F;  3RTX A;  2FMA A;  4JI4 H;  4PWQ A;  5KFR A;  2V4R A;  2HHH H;  3ORR A;  1I3Q A;  2ASL A;  4YR2 A;  2GLT A;  1TAE A;  5DG9 A;  1X9N A;  2V58 A;  3G6Y A;  1SFO A;  2NU7 B;  3FU1 A;  3TQT A;  5DQI A;  3N6X A;  1J5E H;  3BAA A;  5KFJ A;  3AYH B;  2R7Z A;  5KFE A;  2VOB A;  4U6P A;  2NUA B;  3I4N G;  5FPO A;  1K1Q A;  1M0T A;  2XCL A;  5KG0 A;  5KFX A;  3PVX A;  1JLL B;  1B6R A;  3KAK A;  1DV1 A;  5D1P A;  5KFO A;  5IP7 G;  4RNM A;  2IBK A;  1ZQ7 A;  4F4Y A;  2HVR A;  3OTO H;  3JRW A;  3HOX G;  4DV7 H;  3FDS A;  3T1H H;  1K1S A;  2RDJ A;  5D8D A;  2FPI B;  4MV6 A;  4UFZ A;  5IYC G;  3H4B A;  2OWO A;  1B04 A;  5KFM A;  3RV4 A;  1E4E A;  1X6Y A;  1TWG A;  5LMN H;  3QZ7 A;  2W7P A;  2VPQ A;  4I7H A;  5I47 A;  4LF4 H;  2R93 G;  1W93 A;  4MA5 A;  4UCU A;  4MV7 A;  5EWE A;  3Q2O A;  2R7Z G;  2FLN A;  2JA8 G;  3OHB A;  1UC9 A;  4Q8E A;  2Y0S E;  1RK6 A;  3FMA A;  3WNZ A;  2W71 A;  3BQ2 A;  4DL4 A;  4ZOL F;  2YS7 A;  4J9S A;  3KHR A;  4JI7 H;  2C2E A;  2VA2 A;  2DPI A;  5DLF A;  1E4F T;  4A3E G;  5HV6 A;  2ZDQ A;  1RJP A;  4RZR A;  2C28 A;  1S10 A;  2B63 G;  5FLX W;  3G8C A; 
#chains in the Genus database with same CATH homology
 1ZQ7 A;  1VAJ A;  1WSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...