1WSCA

Crystal structure of st0229, function unknown protein from sulfolobus tokodaii
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
225
structure length
225
Chain Sequence
QEQLVAVNELNENLGKVLIKIARDSIANKLGILKINLEDYLSSLNDPILNKKGLAFVTLETYYGNSTSLRGCIGYVEAVAPLKEIVSKAAIAAAFSDPRFPPLSKGEFDNIIIEVTVLTKPQEIDVENRWELPKKIKVGEDGLIVEYGILYSGLLLPQVPMEYCWDEETFLAETCIKAGLEPDCWLNNKVKIKKFQGIIFREEKPKSEKILIIKPSEVKCKKEEI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Hypothetical protein ST0229
publication title Crystal structure of ST0229, function unknown protein from Sulfolobus tokodaii
rcsb
source organism Sulfolobus tokodaii
total genus 61
structure length 225
sequence length 225
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01871 AMMECR1 AMMECR1
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.700.20 Alpha Beta 2-Layer Sandwich Glycoprotein, Type 4 Pilin Hypothetical protein ph0010; domain 1 1wscA01
3.30.1490.150 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 Hypothetical protein ph0010; domain 2 1wscA02
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH superfamily
4FBUA 1VAJA 1KEEA 5D8DA 1GLVA 5L1IA 3T1YH 5DGAA 3GIQA 3V4SA 1JDBB 5C1OA 2JA5A 2BQRA 2PMZE 4ZQIA 1X6YA 2W7OA 5F9LA 1PK8A 3TQTA 1N56A 1K1QA 1W96A 4E4TA 2WE6A 2VUGA 1GSAA 4O3NA 5KG3A 3M9MB 4WBNF 2UUCH 3MJFA 1T3NA 5IWAH 1ULZA 1BJTA 2E2IA 1BGWA 3N6RA 1S0MA 4APMA 5DQHA 4DV6H 4IAJA 5KT3A 5KFJA 2JA6A 4JI6H 5KFGA 5CA1F 5KT4A 4UCOA 3JRWA 4JI1H 3GIKA 4LF9H 1CE8A 5IP9G 4R8UB 2R92A 5KFPA 3T5LA 3R5XA 3L2PA 5FLXW 4MTDA 4LSAA 4J9MA 3H4DA 3RIZA 4DUZH 2J6UA 2R7NA 2VUMG 3RTXA 4YP3A 2NUAB 1Y14B 5KG7A 2AGPA 1TAEA 2CQYA 5LMUH 1SYXB 5LA6F 3Q8RB 3HOUG 4A3DG 3LWBA 1S03G 4FS2A 4Q43A 4QIWA 3QZ7A 4UCTA 4DLKA 5F9NA 4DV3H 1RJQA 4J9RA 3RB0A 4O3QA 1B6RA 5DQGA 4RZQA 3JZIA 2Y0SA 1FJGH 3U9SA 3GTMA 3PW4A 4MA0A 2HHHH 1V9PA 1K83A 1O75A 2PMZA 4B3SH 2UXDH 4ED2A 1DZOA 3QFFA 4XYMB 2RDIA 3VPCA 1V51A 5KX5F 1I94H 1X6PA 2FKLA 4A3LG 2R8JA 2ZDHA 2R7ZG 2YZGA 2W9BA 2UXBH 3RBEA 3TIIA 4RNMA 5KKNB 3BQ0A 1VS0A 2CZGA 4JUZA 3GIIA 2W9CB 2ALZA 2NU9B 1IBLH 1X6ZA 4JI5H 3OHAA 5D1PA 3RFCA 3KAJA 1SCUB 5KFIA 1FKAH 5DLGA 3Q8PB 1B6SA 2FP4B 3HOVG 5HV6A 3FMAA 4YB8B 3I4NG 5IYCG 3RB6A 2V9WA 3N41B 4JV0A 4MAMA 5JUMA 5LOVF 4J9LA 2DPIA 1HPWA 3OUZA 4DR3H 4CC6A 5JVLA 2DIKA 2AU0A 1WSCA 2IA6A 1DGSA 3RF2A 1SEIA 4M7EA 2WAQE 2OWOA 4F4ZA 4WD3A 4MV3A 4JI4H 4RNNA 4O3RA 1XNQH 3PR4A 4J9PA 2FPGB 4JI0H 5IT9W 4UCVA 1X6RA 2YYAA 2UU9H 3PW0A 2UVWA 5CB4F 4DV4H 1HNWH 3M9NB 4NLGA 3BQ2A 3BAAA 2C2RA 1WCMG 1S68A 2W7PA 4JI7H 4RB0A 2KEPA 3BABA 3BA9A 5DG8A 4GC7A 3GIJA 5L1LA 1N34H 2XC9A 3RJ0A 4ECXA 4OX9H 4DV2H 1OQWA 2O03A 5KFOA 4ZOLF 5KT6A 2WTFA 4LF6H 4ZI7F 2FE3A 3PVXA 2PN1A 2KSWA 3GTKA 3VPDA 5KFXA 5J2UF 5KG5A 5JH7F 4MV6A 4LH7A 3J7AK 4YQWA 2XCLA 3KAKA 3MFHA 2VUMA 2R8GA 2UVRA 3RV4A 5EWGA 5KG0A 1IOVA 4DL4A 2FLLA 2RGRA 1ZHQA 4U7CA 4FS1A 3MWMA 1E4FT 4A3FG 2XIGA 3V4ZA 1PX2A 1JXLA 4A3BG 4MV7A 2YRXA 5FD6A 4X65H 2W9CA 1S0NA 1TWAA 3AYHB 3GV5B 2NVXA 2GPSA 5L1JA 5C5JA 3U9TA 3BJYA 3OTOH 2WAQA 3WO0A 2OLSA 3HOZG 4DR4H 1FVIA 5C3EG 2VPQA 3VMMA 4V1JA 3TQ1A 1GYFA 4I55F 2W9BB 4EBDA 2PBZA 3JSNA 1RJPA 4J9KA 2R7ZA 3LP8A 3MWDA 3CVZA 4O2AF 4YJ2F 3RGZA 2W6OA 2MCTA 5DG9A 4X64H 2YZMA 4TQSA 2J6TA 4IWYA 4EFBA 2PILA 3PW5A 1AUXA 3GIPA 1P8LA 2W8LA 4DR2H 4ED3A 3SI8A 5C8YF 5L1KA 2HVSA 3HKZE 5K2MA 4JI2H 4A2BA 5KFQA 4J9QA 1X9NA 5LMNH 2DLNA 1TWFA 3Q1KA 1I7LA 4FU0A 3OSNA 3GTPA 3G8CA 1RK5A 4A93G 2R84A 2CW7A 4QJFA 5KFSA 4IRCA 4O3OA 2RGVA 4HNUA 5IP7G 1E4GT 2IMWP 4B3TH 1EUDB 3GTGA 4YR0A 3KHLA 3ORQA 5A2QW 2R8IA 2VQEH 4JV2A 5D1OA 4ED0A 1S0OA 5KFEA 4O2BF 1E4EB 4RB1A 5CAEB 4GLXA 1IBMH 1I7NA 1JX4A 1W93A 1CQIB 4DV7H 4YHHH 3H0GG 5H80A 4HR7A 5BMVF 4ECVA 3DF7A 1V4YA 4A3JG 4HYKA 3GTJA 4EEYA 3K5IA 5FLMG 4TQRA 2R86A 4MTEA 2R7LA 4F4WA 3GV8B 2CKZB 4J9OA 4C5CA 3GLKA 2DWCA 2M05A 5FPRA 4MA5A 4XYLB 5HBRB 5KFKA 1WCMA 2UVVA 4DR6H 4LF5H 2UXCH 2JEGA 2GLTA 5KG4A 4I7HA 5DGBA 5KFAA 1Y1WG 1RYRA 1HR0H 4YR2A 1KC7A 2W70A 5KFBA 3Q8SB 1TA8A 3GV7B 1XNRH 4YAKB 4QWAA 5KFMA 2YS6A 2W6PA 2VOBA 1I3QA 4TUYF 4YR3A 1Z2OX 4ECZA 4JV1A 4IWXA 2R7KA 4O3PA 1M7JA 3TINA 1KJ9A 1RK6A 1Y1VG 2WYOA 5KT7A 3KXYT 3R5HA 2XGQA 3MR6A 4QWBA 4ED1A 2BR0A 1SFOA 3HKZA 3SE7A 5CA0F 4ZHQF 3V6HA 4UFZA 2ASJA 3OHBA 4K0KH 3HBLA 4IRDA 3OSPA 1KJJA 3IG0A 5BPHA 3L4JA 4DL5A 1CQJB 1C30A 1BXRA 2XCAA 2C28A 3JSLA 1DV2A 3KALA 4DR1H 1A0IA 2V4QA 4ECTA 4MV4A 1QVEA 2PVPA 4RAZA 2FB9A 3N40P 4J0MA 4ECWA 3T5HA 2J9GA 5DLFA 5IYDG 4LH6A 1AY2A 2HJWA 4DR5H 2ZDGA 3G20A 4ED8A 3J81W 3V6JA 3T1HH 5I47A 3R5FA 4LMYA 4LFCH 1VKZA 3Q2OA 5KG6A 4A2AA 2JA7G 4ECQA 3RB4A 3GTLA 2IBKA 3BA8A 2QYZA 3SOKA 1VBGA 2NVYA 1MZBA 5LP6F 1Z2NX 1S10A 1E4EA 4XZ3B 2RF4A 4RB3C 3PZPA 2WB1E 5JVDF 2NU7B 5KFTA 3RAXA 3T5KA 3KHHA 3T5JA 4DL7A 4MV8A 4QW9A 3PW2A 2R93G 1M6VA 2YZNA 1RG0A 1ZHSA 5KFWA 4Q0YA 2HGSA 2DZDA 5C1PA 1IBKH 4PWQA 5BPFA 4DV0H 1M0TA 1RJRA 4EGJA 5D1OB 5DG7A 4BBSG 4IHJF 2Q2UA 5FD5A 2FPPB 2FPIB 2OH2A 1C3OA 5LYJF 2ZM6H 4BY7G 2E2HA 2FJZA 2R7MA 4EYIB 3H0GA 5FPOA 3M4IA 3PO3G 2AQ4A 4YAJB 4RUCA 2I87A 4RZRA 4FM9A 5T14A 3GTOA 4A3MG 4JV5H 4CC5A 1BNCA 2VPSA 3MR2A 5KG1A 2ZDQA 4IZOA 3LMLA 1JKJB 4O4HF 4EFEA 4RU9A 2E5LH 3OUUA 1Y1WA 4LFAH 4PDBA 3I12A 3WO1A 3Q8QB 5GONF 4EBEA 3MFIA 1N48A 2FK2A 3PN1A 1KJ8A 2FMAA 3HOWG 5JQWA 4J9SA 4GKKH 1M0WA 3VPBA 1TWGA 2NU6B 3G6YA 4A3EG 1Y1VA 4I4TF 2UUBH 2HVQA 2W6NA 2P0AA 2YCHA 4EG0A 4F50A 1EYZA 4QW8A 4BBRG 1EZ1A 2JEJA 2AGOA 4QWCA 2VR1A 4X66H 4MV1A 3RAQA 1T36A 1EUCB 3K3PA 4IR1A 4C5BA 5EWEA 3MWEA 4TV8F 4A3KG 1K1SA 3FKIG 3HB9A 5KFZA 5BR8H 4AYBE 3MR3A 2R8HA 2J6SA 1I6UA 5IYBG 4ED6A 3G6VA 2B63G 3GN9A 3JRXA 2UUAH 4DL3A 2FK3A 4HNTA 3UQ8A 3HXLA 5EDWA 4I50F 4XX0B 2Y0SE 2JA7A 3PO2G 1WR2A 4EBCA 5C4XG 1VBHA 3FU1A 2YS7A 3E5NA 2IP4A 4ECSA 1OWTA 3KHGA 4A3GG 4ETSA 2W57A 3V6KA 3PW7A 2BQ3A 5IYZF 3GILA 1R9TA 2BQUA 2RDJA 4L1KA 3GQCA 4A3CG 3N42B 2R93A 3H40A 2C00A 4ECYA 5KG2A 2JEFA 4HQ6A 3EPIA 2C22A 3EYYA 1UC9A 2GPWA 4LW9A 1JDEA 3CQZA 3QZ8A 5KFYA 4RB2C 3EPGA 1J5EH 4RUAA 2YW2A 4JI3H 4DR7H 1XMOH 3H4BA 4DL6A 2JA8G 2ATLA 1N33H 4LF8H 1KJIA 3H20A 4QWEA 4EGQA 3RBDA 4ECRA 1TWHA 2F4VH 3ORRA 2R87A 2VQDA 1T94A 4JI8H 2CW8A 4F4YA 1B33N 5DQIA 4A3IG 4NXNH 2M7GA 3JZZA 4AYBA 3C0FB 2FLNA 1XDNA 3ETJA 3IN5A 4G3IA 4JYAH 2I8CA 3BQ1A 2VA3A 2R6FA 2YU9A 4GKJH 3L4KA 2V4RA 1UNNC 3K3VA 1UC8A 2M3KA 2W8KA 4RNOA 4QWDA 3N43B 1HNZH 1RYSA 1EHIA 4C2MA 1XMQH 2QK4A 3RV3A 3H3VH 2PY0A 2YRWA 1L2ZA 2W9AA 3BG5A 4F4XA 3RB3A 2DPJA 4MV9A 2Q2TA 1N36H 2HVRA 2XD4A 4ECUA 2JA5G 4YJ3F 2AGQA 3RUPA 2C2EA 4Y8VB 4TV9F 5C44G 1GSOA 2R8KA 2V58A 3N44B 4EEQA 3GIDA 4HNVA 4LSXA 3KTMA 3FKIA 4BWSC 4Q8EA 2JEIA 2WDTA 1I50A 4Q45A 1KJQA 2B63A 1TWCA 1WH2A 5KFDA 4GC6A 4Q8FA 2YL2A 3KHRA 5FJ8G 4NXMH 2W71A 2I80A 3UFXB 2R82A 3HOXG 3F8NA 3JAMW 1AUVA 1Z2PX 1DIKA 4B3MH 1KBLA 2JA6G 2X0SA 3J80W 5KFCA 2FLPA 2ASLA 4UCUA 2R92G 4BXXG 4ME6A 2C2DA 2W6ZA 4R8UA 4IR9A 4LF7H 2VQFH 4AQYH 1HNXH 2XCPA 4UCRA 4IRKA 2ZJTA 2ASDA 5LXTF 3G6XA 1IOWA 3TIGA 4LFBH 4C5AA 5KFLA 4J9NA 5L9XA 2V5AA 3HOYG 3NGDA 3N6XA 3M9OB 3GIMA 4KHPH 5KT2A 5KFRA 2FK1A 4RAYA 1DV1A 1AN7A 1X6QA 4M9UA 5KFNA 5KFUA 1T92A 3GTQA 3R23A 2XGPA 1JLLB 1GO3E 2C35B 2SCUB 5KFHA 5KT5A 1X6XX 5EWFA 1GGOA 5KFVA 2V59A 4FBTA 5EOYA 2NU8B 1A9XA 1ZETA 1S9FA 4O3SA 4DUYH 1N32H 3SOJA 5EZYF 5LL6b 2WB1A 5KFFA 4ED7A 3I4MG 2R85A 3N8DA 4BY1G 4B3RH 3WNZA 1S97A 4Q44A 5JW8A 3JYZA 2W6QA 4DV5H 3RGXA 3FDSA 3PR5B 1JIHA 4EYHB 2VA2A 4R7RA 1B04A 2HI2A 4O4LF 4YY3H 1ZQ7A 3ETHA 3K5HA 4O4IF 5J2TF 1CS0A 3MR5A 2UVUA 4LF4H 4DV1H 4QIWE 2W6MA 4YBZB 4UCSA 1GSHA 4X62H 4U6PA 4DL2A
chains in the Genus database with same CATH topology
1ZQ7A 1WSCA 1VAJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZQ7 A;  1WSC A;  1VAJ A; 
#chains in the Genus database with same CATH topology
 4FBU A;  1VAJ A;  1KEE A;  5D8D A;  1GLV A;  5L1I A;  3T1Y H;  5DGA A;  3GIQ A;  3V4S A;  1JDB B;  5C1O A;  2JA5 A;  2BQR A;  2PMZ E;  4ZQI A;  1X6Y A;  2W7O A;  5F9L A;  1PK8 A;  3TQT A;  1N56 A;  1K1Q A;  1W96 A;  4E4T A;  2WE6 A;  2VUG A;  1GSA A;  4O3N A;  5KG3 A;  3M9M B;  4WBN F;  2UUC H;  3MJF A;  1T3N A;  5IWA H;  1ULZ A;  1BJT A;  2E2I A;  1BGW A;  3N6R A;  1S0M A;  4APM A;  5DQH A;  4DV6 H;  4IAJ A;  5KT3 A;  5KFJ A;  2JA6 A;  4JI6 H;  5KFG A;  5CA1 F;  5KT4 A;  4UCO A;  3JRW A;  4JI1 H;  3GIK A;  4LF9 H;  1CE8 A;  5IP9 G;  4R8U B;  2R92 A;  5KFP A;  3T5L A;  3R5X A;  3L2P A;  5FLX W;  4MTD A;  4LSA A;  4J9M A;  3H4D A;  3RIZ A;  4DUZ H;  2J6U A;  2R7N A;  2VUM G;  3RTX A;  4YP3 A;  2NUA B;  1Y14 B;  5KG7 A;  2AGP A;  1TAE A;  2CQY A;  5LMU H;  1SYX B;  5LA6 F;  3Q8R B;  3HOU G;  4A3D G;  3LWB A;  1S03 G;  4FS2 A;  4Q43 A;  4QIW A;  3QZ7 A;  4UCT A;  4DLK A;  5F9N A;  4DV3 H;  1RJQ A;  4J9R A;  3RB0 A;  4O3Q A;  1B6R A;  5DQG A;  4RZQ A;  3JZI A;  2Y0S A;  1FJG H;  3U9S A;  3GTM A;  3PW4 A;  4MA0 A;  2HHH H;  1V9P A;  1K83 A;  1O75 A;  2PMZ A;  4B3S H;  2UXD H;  4ED2 A;  1DZO A;  3QFF A;  4XYM B;  2RDI A;  3VPC A;  1V51 A;  5KX5 F;  1I94 H;  1X6P A;  2FKL A;  4A3L G;  2R8J A;  2ZDH A;  2R7Z G;  2YZG A;  2W9B A;  2UXB H;  3RBE A;  3TII A;  4RNM A;  5KKN B;  3BQ0 A;  1VS0 A;  2CZG A;  4JUZ A;  3GII A;  2W9C B;  2ALZ A;  2NU9 B;  1IBL H;  1X6Z A;  4JI5 H;  3OHA A;  5D1P A;  3RFC A;  3KAJ A;  1SCU B;  5KFI A;  1FKA H;  5DLG A;  3Q8P B;  1B6S A;  2FP4 B;  3HOV G;  5HV6 A;  3FMA A;  4YB8 B;  3I4N G;  5IYC G;  3RB6 A;  2V9W A;  3N41 B;  4JV0 A;  4MAM A;  5JUM A;  5LOV F;  4J9L A;  2DPI A;  1HPW A;  3OUZ A;  4DR3 H;  4CC6 A;  5JVL A;  2DIK A;  2AU0 A;  1WSC A;  2IA6 A;  1DGS A;  3RF2 A;  1SEI A;  4M7E A;  2WAQ E;  2OWO A;  4F4Z A;  4WD3 A;  4MV3 A;  4JI4 H;  4RNN A;  4O3R A;  1XNQ H;  3PR4 A;  4J9P A;  2FPG B;  4JI0 H;  5IT9 W;  4UCV A;  1X6R A;  2YYA A;  2UU9 H;  3PW0 A;  2UVW A;  5CB4 F;  4DV4 H;  1HNW H;  3M9N B;  4NLG A;  3BQ2 A;  3BAA A;  2C2R A;  1WCM G;  1S68 A;  2W7P A;  4JI7 H;  4RB0 A;  2KEP A;  3BAB A;  3BA9 A;  5DG8 A;  4GC7 A;  3GIJ A;  5L1L A;  1N34 H;  2XC9 A;  3RJ0 A;  4ECX A;  4OX9 H;  4DV2 H;  1OQW A;  2O03 A;  5KFO A;  4ZOL F;  5KT6 A;  2WTF A;  4LF6 H;  4ZI7 F;  2FE3 A;  3PVX A;  2PN1 A;  2KSW A;  3GTK A;  3VPD A;  5KFX A;  5J2U F;  5KG5 A;  5JH7 F;  4MV6 A;  4LH7 A;  3J7A K;  4YQW A;  2XCL A;  3KAK A;  3MFH A;  2VUM A;  2R8G A;  2UVR A;  3RV4 A;  5EWG A;  5KG0 A;  1IOV A;  4DL4 A;  2FLL A;  2RGR A;  1ZHQ A;  4U7C A;  4FS1 A;  3MWM A;  1E4F T;  4A3F G;  2XIG A;  3V4Z A;  1PX2 A;  1JXL A;  4A3B G;  4MV7 A;  2YRX A;  5FD6 A;  4X65 H;  2W9C A;  1S0N A;  1TWA A;  3AYH B;  3GV5 B;  2NVX A;  2GPS A;  5L1J A;  5C5J A;  3U9T A;  3BJY A;  3OTO H;  2WAQ A;  3WO0 A;  2OLS A;  3HOZ G;  4DR4 H;  1FVI A;  5C3E G;  2VPQ A;  3VMM A;  4V1J A;  3TQ1 A;  1GYF A;  4I55 F;  2W9B B;  4EBD A;  2PBZ A;  3JSN A;  1RJP A;  4J9K A;  2R7Z A;  3LP8 A;  3MWD A;  3CVZ A;  4O2A F;  4YJ2 F;  3RGZ A;  2W6O A;  2MCT A;  5DG9 A;  4X64 H;  2YZM A;  4TQS A;  2J6T A;  4IWY A;  4EFB A;  2PIL A;  3PW5 A;  1AUX A;  3GIP A;  1P8L A;  2W8L A;  4DR2 H;  4ED3 A;  3SI8 A;  5C8Y F;  5L1K A;  2HVS A;  3HKZ E;  5K2M A;  4JI2 H;  4A2B A;  5KFQ A;  4J9Q A;  1X9N A;  5LMN H;  2DLN A;  1TWF A;  3Q1K A;  1I7L A;  4FU0 A;  3OSN A;  3GTP A;  3G8C A;  1RK5 A;  4A93 G;  2R84 A;  2CW7 A;  4QJF A;  5KFS A;  4IRC A;  4O3O A;  2RGV A;  4HNU A;  5IP7 G;  1E4G T;  2IMW P;  4B3T H;  1EUD B;  3GTG A;  4YR0 A;  3KHL A;  3ORQ A;  5A2Q W;  2R8I A;  2VQE H;  4JV2 A;  5D1O A;  4ED0 A;  1S0O A;  5KFE A;  4O2B F;  1E4E B;  4RB1 A;  5CAE B;  4GLX A;  1IBM H;  1I7N A;  1JX4 A;  1W93 A;  1CQI B;  4DV7 H;  4YHH H;  3H0G G;  5H80 A;  4HR7 A;  5BMV F;  4ECV A;  3DF7 A;  1V4Y A;  4A3J G;  4HYK A;  3GTJ A;  4EEY A;  3K5I A;  5FLM G;  4TQR A;  2R86 A;  4MTE A;  2R7L A;  4F4W A;  3GV8 B;  2CKZ B;  4J9O A;  4C5C A;  3GLK A;  2DWC A;  2M05 A;  5FPR A;  4MA5 A;  4XYL B;  5HBR B;  5KFK A;  1WCM A;  2UVV A;  4DR6 H;  4LF5 H;  2UXC H;  2JEG A;  2GLT A;  5KG4 A;  4I7H A;  5DGB A;  5KFA A;  1Y1W G;  1RYR A;  1HR0 H;  4YR2 A;  1KC7 A;  2W70 A;  5KFB A;  3Q8S B;  1TA8 A;  3GV7 B;  1XNR H;  4YAK B;  4QWA A;  5KFM A;  2YS6 A;  2W6P A;  2VOB A;  1I3Q A;  4TUY F;  4YR3 A;  1Z2O X;  4ECZ A;  4JV1 A;  4IWX A;  2R7K A;  4O3P A;  1M7J A;  3TIN A;  1KJ9 A;  1RK6 A;  1Y1V G;  2WYO A;  5KT7 A;  3KXY T;  3R5H A;  2XGQ A;  3MR6 A;  4QWB A;  4ED1 A;  2BR0 A;  1SFO A;  3HKZ A;  3SE7 A;  5CA0 F;  4ZHQ F;  3V6H A;  4UFZ A;  2ASJ A;  3OHB A;  4K0K H;  3HBL A;  4IRD A;  3OSP A;  1KJJ A;  3IG0 A;  5BPH A;  3L4J A;  4DL5 A;  1CQJ B;  1C30 A;  1BXR A;  2XCA A;  2C28 A;  3JSL A;  1DV2 A;  3KAL A;  4DR1 H;  1A0I A;  2V4Q A;  4ECT A;  4MV4 A;  1QVE A;  2PVP A;  4RAZ A;  2FB9 A;  3N40 P;  4J0M A;  4ECW A;  3T5H A;  2J9G A;  5DLF A;  5IYD G;  4LH6 A;  1AY2 A;  2HJW A;  4DR5 H;  2ZDG A;  3G20 A;  4ED8 A;  3J81 W;  3V6J A;  3T1H H;  5I47 A;  3R5F A;  4LMY A;  4LFC H;  1VKZ A;  3Q2O A;  5KG6 A;  4A2A A;  2JA7 G;  4ECQ A;  3RB4 A;  3GTL A;  2IBK A;  3BA8 A;  2QYZ A;  3SOK A;  1VBG A;  2NVY A;  1MZB A;  5LP6 F;  1Z2N X;  1S10 A;  1E4E A;  4XZ3 B;  2RF4 A;  4RB3 C;  3PZP A;  2WB1 E;  5JVD F;  2NU7 B;  5KFT A;  3RAX A;  3T5K A;  3KHH A;  3T5J A;  4DL7 A;  4MV8 A;  4QW9 A;  3PW2 A;  2R93 G;  1M6V A;  2YZN A;  1RG0 A;  1ZHS A;  5KFW A;  4Q0Y A;  2HGS A;  2DZD A;  5C1P A;  1IBK H;  4PWQ A;  5BPF A;  4DV0 H;  1M0T A;  1RJR A;  4EGJ A;  5D1O B;  5DG7 A;  4BBS G;  4IHJ F;  2Q2U A;  5FD5 A;  2FPP B;  2FPI B;  2OH2 A;  1C3O A;  5LYJ F;  2ZM6 H;  4BY7 G;  2E2H A;  2FJZ A;  2R7M A;  4EYI B;  3H0G A;  5FPO A;  3M4I A;  3PO3 G;  2AQ4 A;  4YAJ B;  4RUC A;  2I87 A;  4RZR A;  4FM9 A;  5T14 A;  3GTO A;  4A3M G;  4JV5 H;  4CC5 A;  1BNC A;  2VPS A;  3MR2 A;  5KG1 A;  2ZDQ A;  4IZO A;  3LML A;  1JKJ B;  4O4H F;  4EFE A;  4RU9 A;  2E5L H;  3OUU A;  1Y1W A;  4LFA H;  4PDB A;  3I12 A;  3WO1 A;  3Q8Q B;  5GON F;  4EBE A;  3MFI A;  1N48 A;  2FK2 A;  3PN1 A;  1KJ8 A;  2FMA A;  3HOW G;  5JQW A;  4J9S A;  4GKK H;  1M0W A;  3VPB A;  1TWG A;  2NU6 B;  3G6Y A;  4A3E G;  1Y1V A;  4I4T F;  2UUB H;  2HVQ A;  2W6N A;  2P0A A;  2YCH A;  4EG0 A;  4F50 A;  1EYZ A;  4QW8 A;  4BBR G;  1EZ1 A;  2JEJ A;  2AGO A;  4QWC A;  2VR1 A;  4X66 H;  4MV1 A;  3RAQ A;  1T36 A;  1EUC B;  3K3P A;  4IR1 A;  4C5B A;  5EWE A;  3MWE A;  4TV8 F;  4A3K G;  1K1S A;  3FKI G;  3HB9 A;  5KFZ A;  5BR8 H;  4AYB E;  3MR3 A;  2R8H A;  2J6S A;  1I6U A;  5IYB G;  4ED6 A;  3G6V A;  2B63 G;  3GN9 A;  3JRX A;  2UUA H;  4DL3 A;  2FK3 A;  4HNT A;  3UQ8 A;  3HXL A;  5EDW A;  4I50 F;  4XX0 B;  2Y0S E;  2JA7 A;  3PO2 G;  1WR2 A;  4EBC A;  5C4X G;  1VBH A;  3FU1 A;  2YS7 A;  3E5N A;  2IP4 A;  4ECS A;  1OWT A;  3KHG A;  4A3G G;  4ETS A;  2W57 A;  3V6K A;  3PW7 A;  2BQ3 A;  5IYZ F;  3GIL A;  1R9T A;  2BQU A;  2RDJ A;  4L1K A;  3GQC A;  4A3C G;  3N42 B;  2R93 A;  3H40 A;  2C00 A;  4ECY A;  5KG2 A;  2JEF A;  4HQ6 A;  3EPI A;  2C22 A;  3EYY A;  1UC9 A;  2GPW A;  4LW9 A;  1JDE A;  3CQZ A;  3QZ8 A;  5KFY A;  4RB2 C;  3EPG A;  1J5E H;  4RUA A;  2YW2 A;  4JI3 H;  4DR7 H;  1XMO H;  3H4B A;  4DL6 A;  2JA8 G;  2ATL A;  1N33 H;  4LF8 H;  1KJI A;  3H20 A;  4QWE A;  4EGQ A;  3RBD A;  4ECR A;  1TWH A;  2F4V H;  3ORR A;  2R87 A;  2VQD A;  1T94 A;  4JI8 H;  2CW8 A;  4F4Y A;  1B33 N;  5DQI A;  4A3I G;  4NXN H;  2M7G A;  3JZZ A;  4AYB A;  3C0F B;  2FLN A;  1XDN A;  3ETJ A;  3IN5 A;  4G3I A;  4JYA H;  2I8C A;  3BQ1 A;  2VA3 A;  2R6F A;  2YU9 A;  4GKJ H;  3L4K A;  2V4R A;  1UNN C;  3K3V A;  1UC8 A;  2M3K A;  2W8K A;  4RNO A;  4QWD A;  3N43 B;  1HNZ H;  1RYS A;  1EHI A;  4C2M A;  1XMQ H;  2QK4 A;  3RV3 A;  3H3V H;  2PY0 A;  2YRW A;  1L2Z A;  2W9A A;  3BG5 A;  4F4X A;  3RB3 A;  2DPJ A;  4MV9 A;  2Q2T A;  1N36 H;  2HVR A;  2XD4 A;  4ECU A;  2JA5 G;  4YJ3 F;  2AGQ A;  3RUP A;  2C2E A;  4Y8V B;  4TV9 F;  5C44 G;  1GSO A;  2R8K A;  2V58 A;  3N44 B;  4EEQ A;  3GID A;  4HNV A;  4LSX A;  3KTM A;  3FKI A;  4BWS C;  4Q8E A;  2JEI A;  2WDT A;  1I50 A;  4Q45 A;  1KJQ A;  2B63 A;  1TWC A;  1WH2 A;  5KFD A;  4GC6 A;  4Q8F A;  2YL2 A;  3KHR A;  5FJ8 G;  4NXM H;  2W71 A;  2I80 A;  3UFX B;  2R82 A;  3HOX G;  3F8N A;  3JAM W;  1AUV A;  1Z2P X;  1DIK A;  4B3M H;  1KBL A;  2JA6 G;  2X0S A;  3J80 W;  5KFC A;  2FLP A;  2ASL A;  4UCU A;  2R92 G;  4BXX G;  4ME6 A;  2C2D A;  2W6Z A;  4R8U A;  4IR9 A;  4LF7 H;  2VQF H;  4AQY H;  1HNX H;  2XCP A;  4UCR A;  4IRK A;  2ZJT A;  2ASD A;  5LXT F;  3G6X A;  1IOW A;  3TIG A;  4LFB H;  4C5A A;  5KFL A;  4J9N A;  5L9X A;  2V5A A;  3HOY G;  3NGD A;  3N6X A;  3M9O B;  3GIM A;  4KHP H;  5KT2 A;  5KFR A;  2FK1 A;  4RAY A;  1DV1 A;  1AN7 A;  1X6Q A;  4M9U A;  5KFN A;  5KFU A;  1T92 A;  3GTQ A;  3R23 A;  2XGP A;  1JLL B;  1GO3 E;  2C35 B;  2SCU B;  5KFH A;  5KT5 A;  1X6X X;  5EWF A;  1GGO A;  5KFV A;  2V59 A;  4FBT A;  5EOY A;  2NU8 B;  1A9X A;  1ZET A;  1S9F A;  4O3S A;  4DUY H;  1N32 H;  3SOJ A;  5EZY F;  5LL6 b;  2WB1 A;  5KFF A;  4ED7 A;  3I4M G;  2R85 A;  3N8D A;  4BY1 G;  4B3R H;  3WNZ A;  1S97 A;  4Q44 A;  5JW8 A;  3JYZ A;  2W6Q A;  4DV5 H;  3RGX A;  3FDS A;  3PR5 B;  1JIH A;  4EYH B;  2VA2 A;  4R7R A;  1B04 A;  2HI2 A;  4O4L F;  4YY3 H;  1ZQ7 A;  3ETH A;  3K5H A;  4O4I F;  5J2T F;  1CS0 A;  3MR5 A;  2UVU A;  4LF4 H;  4DV1 H;  4QIW E;  2W6M A;  4YBZ B;  4UCS A;  1GSH A;  4X62 H;  4U6P A;  4DL2 A; 
#chains in the Genus database with same CATH homology
 1ZQ7 A;  1WSC A;  1VAJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...