1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
1HH2P 1IXRA 2HIVA 2A8VA 2ZTEA 4P74A 4JI8Q 1N9WA 4GNXA 2EXDA 3T1YQ 4A3LG 3PF5A 1DGSA 1Q82C 4QIWE 1XPUA 3MXNB 2I0QA 3LGJA 1PH5A 1H95A 4LUZA 1XNRQ 3L7ZC 4OO1G 1VQAA 2K5HA 3J7A5 2WAQG 3HOZH 4A3CH 1RIPA 2NVXH 2V1CC 1UE1A 5LMUL 5FLMH 3HOVH 4A93G 1Q7YC 3JAMi 3G48A 4JI2L 2XTIA 1CKOA 3FHWA 1MKHA 4A3KG 1KIXA 3S1MH 4X66L 4DK6C 4GOPA 2NZOA 1GM5A 4RG1A 3AQQA 1IBML 2JA7H 4BXXH 4PZ6A 4AQYQ 3GTPH 2UXCQ 1N33Q 1M1KC 4HIMA 1A0IA 2MFIA 3PIPA 4HJAA 1HR0Q 3H15A 2E5LL 5EAYA 5IYCH 1K73C 1IBLQ 4B3SQ 3TS2A 1YBYA 1EUJA 4DAYB 4X62L 3PCOB 1Y1VH 1Y1WG 2BH8A 3ULPA 2Q2UA 1X3FA 4A3DG 1HZ9A 4A3JH 1VQDA 3L0OA 1HZAA 2UU9Q 4B3TQ 4JBKA 2D0PA 3J81c 1KC8C 1WCMH 1IBKQ 1VQNA 2AKWB 3U50C 5FJ8G 1VQFA 3H0GG 1PH4A 1VQ5A 3IRBA 2ZJRA 1YJNA 4LF7L 1OXSC 1TWCH 1CUKA 4OX9Q 1HNWL 2YYZA 3CPFA 1G291 2YTVA 5IT9c 4DR3Q 1XMOL 1JMCA 4LF6L 3MEFA 4LW1A 1TWFH 4JCVE 4YCVA 3CCEA 5BR8Q 2MO0A 1S40A 2ALYB 4R1JA 2VQEL 4DV7Q 2ASBA 4JI1L 1XNQQ 4DUYL 2VQFL 1C0AA 5C4JH 4KHZA 3T1HL 2IX0A 3JAMc 4DV1L 4DV2L 2K75A 2MO1A 3FKIG 1HNZQ 1TWHH 3A5UA 2K5NA 2JA7G 4NXNL 4QL5A 1JJ2A 1VQ7A 2E8GA 2VNUD 4PZ8A 1K83H 3UDXA 1XJVA 2OQ0A 4TVAB 3I4NG 4YHHQ 4DR2Q 2A19A 4GKKL 1D8LA 2E2IH 4LF8L 4BY7G 2PI2E 3HKSA 4DV5Q 1Q46A 3CAMA 1IYJB 3BZKA 2K52A 2YV5A 1E22A 3I4OA 4IPDA 3F1ZA 2BA0A 1U0LA 4LF4Q 1EQRA 1KD1C 2PMZE 4JI7L 4DR5Q 1S72A 2PI2A 1PVOA 1PYSB 1EQQA 3CCUA 3PF4A 1OXVA 1S3OA 4A3FG 2IX1A 1I3QH 5C0XG 1HJPA 1N32L 3PUWA 2ZJPA 3STBC 3ULJA 2I5LX 5J3BA 1YITA 2MQHA 1VQ6A 1NBWA 2RHSB 4J15A 1X65A 2NN6G 3K8AA 5E7NA 4LFAQ 3CPWA 1N34L 3S17H 5C44H 4YCUA 4DR4L 1W3SA 2R6GA 1VQEA 3I7FA 2R93H 5LMNL 4DR6L 1OXXK 4IOAA 4B3RQ 4GKJQ 1Z9FA 4JG2A 3I4MH 3K0XA 4X65Q 4A4IA 3HOYH 4UY8C 2HT1A 1VQGA 1K9MC 1JJGA 1QVCA 5JEAJ 4JOIC 3ZJYC 1CKMA 1HZCA 3J7ZC 4A3EG 1V9PA 1QZHA 2E2JH 4WJ3M 1VQHA 2IHFA 1VQCA 1JB7A 3I2ZA 3PV0A 2HIXA 2I5HA 4GN3B 3G71A 3K80C 3HKZG 4DV0L 4LF9Q 4DV6Q 3PO3H 4KI0A 4R4TA 4DPGA 4HIKA 3HFZB 2EQSA 4GS3A 1SFOH 5JJIA 1OXTA 3AFPA 2AMCB 3STBD 2UUAQ 2AWOA 4HJ5A 1UE7A 2B3GA 2K50A 4P73A 4X6AH 3PIOA 4JYAQ 4A3IH 4C3JH 4JI4Q 1XPRA 4BBSH 1NTGA 1SN8A 4LUOA 4A3MH 2KCMA 1N36Q 2JA8G 1P8LA 4BBRH 2GVAA 2K4KA 1X54A 2GN5A 3T1YL 2KBNA 4O2DA 2Z6KC 2UUBQ 3M3YH 4EQ5A 1VQ4A 5IP9G 1WYDA 3HOXG 4Y52H 4YWKA 4AYBG 1V1QA 1KHIA 2JA6H 3CD6A 1KAWA 3DM3A 4BY1G 4LFCQ 2IY5B 1YVCA 3KYHC 3NEMA 1E7ZA 5C44G 1LTLA 2GVBA 1CSQA 1PH2A 2WB1G 1XMQQ 1IZ6A 2ZTDA 4RMFA 1NMFA 2H5XA 1HZBA 2CKZB 4IJLA 4A75A 2RF4A 1HNXQ 4QJFA 4LFBQ 3BU2A 4IPHA 4BA1I 3PUZA 1MJEA 1KRSA 1C9OA 1UE6A 3A0JA 3PSIA 3BJUA 2F3IA 4P75A 4IJHA 4EX5A 4IFDG 3RZDH 1PYBA 2EIFA 2UXDQ 4DV0Q 1VQKA 2JEBI 4AQYL 5M3FH 2UXCL 4OONA 1Q81C 2VUMG 3GTQH 5GROA 1HR0L 1IBLL 4B3SL 5IWAL 4JI6Q 2R7FA 4JI5L 5IP7H 4K0KQ 2UXBQ 1PH9A 3RZOH 3KF6B 2F52A 1WOCA 2N8NA 4DNIA 1N8RC 1VQBA 1A8VA 3CCJA 2UU9L 3M7NA 3FP9A 5LMUQ 1SRUA 3GTGH 4R4QA 3VDYA 1M90C 2B63H 1IBKL 4B3ML 1CKNB 2N78A 4GLAC 4X66Q 2OWOA 3E0EA 1BVSA 2JEAI 4JV5Q 3CC2A 3DLLA 4BBSG 4IPCA 3PUVA 2B63G 3M85A 4O0AA 1G51A 5HY6A 4BBRG 4DR3L 4OX9L 4JOIA 3RNUA 2BA1A 1K3RA 3K81C 3CW2C 5IYBH 1ASZA 5IYDH 1Q86C 4X62Q 2WAQE 4KHPL 1I5FA 4YWMA 2MNAA 3CP0A 4MTNA 3OTOQ 5M3MH 3HOZG 1X6OA 4A3CG 4DV7L 5C3EH 1X3EA 4OWWB 2Q2HA 3A5ZB 1XNQL 3M4QA 4P71A 5FLMG 3HOVG 1ASYA 1NE3A 1NY4A 1EYGA 1X9NA 3S1RH 4BA2I 5LMNW 1HNZL 1FJGQ 1JT8A 2R7ZH 4OWXB 4LF7Q 4DV4Q 5K36G 4JBMA 4BXXG 1X56A 1HNWQ 1QUQB 4YCWA 3L2PA 5M3FG 4LF6Q 4JI0L 4PG3A 4DR2L 1NMGA 4XTCS 1Q12A 3HOWH 2Z6KA 1X55A 1XTDA 5IYCG 4DV5L 1YHQA 3S16H 1I94L 1Y1VG 3ER0A 2HHHQ 4NPSA 1L1OB 4ME3A 4YY3L 4KLKA 4YWLA 3ULLA 4A3JG 2D0OA 3J80i 3F2DA 1PH7A 2JA9A 3KF6A 2QGQA 3KJPA 1WCMG 3CCLA 3U4VA 1FGUA 2LSSA 1AE3A 3CCMA 1PV4A 1Y14B 4NXNQ 3CF5A 1Q8KA 2JK8A 1CKNA 3TRZA 4DR7L 1YNXA 3H3VI 2AWNA 3RLNA 5AJ3L 1EIFA 2Y0SG 3S14H 1YEZA 5IYBG 5IYDG 2R92H 4LFAL 3K7AH 3U4ZA 4X64L 5GAEC 5JJLA 3CCRA 4A3GH 4JI3Q 3GD7A 2QEXA 3GTOH 4B3RL 1PH8A 2JA5H 3H3VH 2F4VQ 3HOUH 2I5MX 4GKJL 3I56A 1G6PA 4X65L 3A74A 1WI5A 2CWPA 3PUYA 4DAMA 3S24A 4OO1I 3GO5A 1SE8A 1GKHA 5GQOA 1D7QA 4A3LH 1OTCA 3S2HH 1KL9A 1VQOA 2LXJA 3W1GA 4QGUA 2NVYH 1VQIA 1UEBA 2KHJA 3NELA 4AH6A 1QUQA 1EWIA 4TQUS 1J5EQ 2BH2A 1J6QA 5LMNQ 1KXLA 4JBWA 4JC0A 3CCSA 3KLWA 1XPOA 4A93H 1PFSA 3S15H 1E1TA 3RLOA 1L1OA 4DK3C 3J80c 4LF5L 4NXMQ 3UDIA 4DV3Q 4HJ9A 3GTKH 1Q1EA 4JI4L 1BBWA 2UUCQ 1FVIA 1YJWA 1KQSA 3KFUA 3D31A 2ZM6Q 1VS0A 5IE8A 4JI8L 3KOJA 3B6YA 1V43A 3ICEA 3CC7A 2K14A 5DLQE 3CXCA 2DGYA 4OWTB 1Y1WH 2E2HH 5JEAG 4GLVB 1XNRL 3PO2H 4A3DH 4R4CA 3KF8B 1SROA 3CCQA 3CC4A 3J81i 1XMQL 2R93G 1VQ8A 2YTYA 1JJCB 2JA5G 4Y7NH 4A76A 4DUZQ 1HNXL 3HOUG 3I4MG 2AHOB 3H0GH 2WP8J 1JE5A 3W1BA 4DR1Q 4UPAA 3HOYG 2Q2TA 1BKBA 2UXDL 1TWGH 3G6EA 2VY3A 1W2BA 3GTLH 1N33L 3AYHB 5HGQA 2A1AA 1VQLA 4LUVA 3HKZE 4MNOA 1AH9A 3AEVA 4HIDA 1OXUA 4JI6L 4K0KL 2UXBL 4WJ4A 4QQBX 3PO3G 1SMXA 4B3MQ 4JBJA 3UDGA 3EN2A 5M5XH 4B3TL 3NENA 3KJOA 4JI2Q 1EOVA 4AIMA 3FKIH 3CMEA 1Z47A 4A3IG 5H1SE 2L15A 1IBMQ 4JV5L 4DKAC 5GADC 4A3MG 5ELOA 1YHBA 3I4NH 4C3HH 1E1OA 4AYBE 1UWVA 4L5TA 1NJIC 4BY7H 2CQOA 2E5LQ 5JJKA 4IO9A 3UDFA 5IWAQ 2VZAA 4JI5Q 3CMAA 1T9HA 3TQYA 2OCEA 2VW9A 4L5RC 2WB1E 2JA6G 4P72A 3UE1A 5C0XI 3PO2G 5BR8L 3OTOL 1QZGA 1K8GA 4UP8A 4POGA 1E3PA 1L1OC 1VCIA 1PH1A 1GD7A 3F2CA 4A3FH 2ID0A 1K0RA 1VQ9A 2NN6I 5C4XH 4A3BH 2OTLA 2K5VA 2VL6A 1FJGL 1LYLA 5GAGC 4DV4L 1C7YA 1FL0A 1XMOQ 1P16A 5IY0A 2ZTCA 2ES2A 4GN4B 4YHHL 1SR3A 2N3SA 3KDFB 3G4SA 1WJJA 3AFQA 4R4OA 4UP7A 4HJ8A 2QA4A 2ATWA 4KHPQ 4POFA 1QVFA 2LXKA 1U5KA 5IP7G 3OW2A 2HHHL 1O7IA 3RLFA 2VQEQ 2JQOA 2CWAA 2PNHA 4APVA 1GVPA 4JI1Q 4LF4L 5C0XJ 1IL2A 4DUYQ 1QVGA 2VQFQ 4DR5L 3W5OA 1YIJA 3OYYA 5GAHC 3T1HQ 4DV1Q 4DV2Q 4GN5A 2WFWA 3EBEA 5M5WH 3S1NH 2RHQB 2PQAB 4C3IH 4GNXC 4UP9A 4LNQA 2B29A 1SLJA 3M4PA 3WWVA 4A3EH 1VQMA 3F8TA 2NVTH 1L0WA 4JI0Q 4GKKQ 1CSPA 3UE0A 2DUDA 1RL2A 2KENA 2R7DA 3TS0A 4LF8Q 2OTJA 2ZJQA 3E9HA 3S2DH 2NZHA 2XGTA 3F2BA 1I94Q 1A63A 5FLXc 5M5YH 4YY3Q 2OQKA 2D62A 3TEHB 4JI3L 1AE2A 3CQZH 3M9BA 3SGIA 5M3MG 1BBUA 4JI7Q 4HIOA 5C3EG 3NBHB 4HJ7A 2F4VL 1B7YB 3BZCA 3U58A 1EIYB 4NB3A 4GOPC 1TXYA 4GNXB 2YU9H 3S1QH 1YI2A 4L5QA 3ERSX 2IHEA 1TWAH 5C4XG 4A3BG 4FDBA 2JA8H 2R7ZG 3GDEA 1MIUA 3Q8DA 4OXPA 2CCZA 4DR7Q 1N32Q 4R4IA 2IT1A 5IP9H 3HOXH 5AJ3Q 1WFQA 3HOWG 5ELNA 2YTXA 1YHAA 3CCVA 3M4OH 3TREA 4ALPA 4LF9L 4BY1H 4DV6L 4IFDI 1J5EL 1N34Q 3K7UC 4DR4Q 1B8AA 4X64Q 3KDFA 3JC66 1I6HH 1HR0W 2UUAL 3RR5A 4DR6Q 4GOPB 1LM0A 1A62A 4PZ7A 3J81j 1PHJA 2RCNA 1B70B 4QY7A 4A3KH 4NXML 4JYAL 4DV3L 4H02A 3GTMH 1I50H 3EIVA 4IPGA 2Q2IA 2Z0SA 1YZ6A 2N49A 1YJ9A 1EFWA 2UUCL 2VUMH 2KHIA 4GLXA 1GO3E 1N36L 1KRTA 2ZM6L 1K8AC 2Y0SE 3D0FA 2NVQH 1LUZA 2JJQA 3I55A 2UUBL 2PQAA 2FXQA 2JE6I 1E24A 3E9IA 2HQLA 3RN2A 1VQPA 2R92G 1X3GA 4LFCL 2VS1A 3GTJH 4IOCA 1L2FA 4L5SA 4IFDJ 4A3GG 1UE5A 4C2MH 3PUXA 3RN5A 5FJ8H 3PGZA 4LF5Q 4LFBL 4DUZL 4XIGS 1PH3A 2C35B 1Q1BA 1R9TH 4DR1L 4LWCA 4MZ9A 2CFMA 2KCTA 1PA6A 1MJCA 4PMWA 1PH6A 1VQJA
chains in the Genus database with same CATH superfamily
2A8VA 3KBXA 2ZDQA 5EKKA 5KFRA 5KT7A 4EQPA 2Q8IB 1U4LA 1KNEA 3GQCA 4OO1G 3TQTA 1VQAA 2K5HA 3HOZH 3G6VA 1RIPA 2E2IA 1UNNC 4QIWA 5KFXA 2V1CC 2NBFA 2IJ0A 3Q2OA 1Q7YC 2PCFB 1SNDA 5L9XA 2QDLA 4RCOA 2XTIA 4YJ2F 1KIXA 3S1MH 5C5LA 5KT4A 4A3IB 1GM5A 5KG5A 4RG1A 3W2DA 1IBML 1S0NA 4IRKA 3GTPH 1N33Q 4K5XA 2NTSA 1JWUD 1A3VA 2SNSA 1I7NA 1LT4D 3H15A 3FPUB 2E5LL 1IBLQ 4ZCKA 1C8CA 1EUJA 4DAYB 2O5IC 2JA6B 2WE6A 1N33H 1Y1VH 3AU7A 2DZDA 4O3SA 5LL6b 3PMFA 4DL5A 1IBLH 1HZ9A 1CA5A 4JBKA 1G2SA 2XD4A 3GIJA 1KC8C 1SJHD 1KEEA 3GP7A 2KOLA 5KG6A 4J9PA 4ME5A 1K3BC 4YR0A 2PBZA 1TWCH 3OOCA 3DM1A 3CPFA 5IT9c 3KLRA 5FLXW 1WR2A 5DG7A 4NP5A 1I4GA 3CCEA 1NUCA 4EQNA 2DNEA 2FJZA 1KC7A 2ALYB 4DL3A 2LS01 1WTHA 4DV7Q 4MV7A 3GIDA 1XNQQ 3GIKA 1C0AA 1EU4A 3SEBA 4IURA 4YQWA 2IX0A 3PW4A 1B1ZA 4DV7H 1XNQH 1I4QA 1JJ2A 5I9PA 3H40A 4RZQA 4O3NA 4PZ8A 4JPBW 2OQ0A 2A19A 4GKKL 4C5AA 4ZKCB 2PI2E 2VXWA 4U7CA 4QW9A 3Q24A 3BZKA 5KG0A 2KSWA 4DAYA 2JA6A 1ENCA 5C3EB 1GUOA 2EYJA 4C5BA 1TQOA 2BQRA 1WD1A 3S1RB 5C4XB 1I3QH 1SAPA 4A3BB 3KHGA 4ECRA 1K1SA 3P7JA 4FF3A 5KNCA 2RDFA 4TQSA 3KHLA 5D14A 1ZKOA 3HOWB 2KHSA 2RHSB 1AP0A 4DR7H 1Q90A 1SNCA 2F0QA 2AUJD 3K8AA 3MVVA 1O80A 1N34L 3S17H 1K1QA 4MAMA 4IR9A 1W3SA 2R6GA 2R93H 5EWFA 3N43B 4DR6L 1OXXK 4IOAA 3DWPA 2C00A 4FO2A 3I4MH 1D1IA 4X65Q 4A4IA 3C46A 3HOYH 4FBUA 1VQGA 1JJGA 4ZI7F 2Z6BA 4UCOA 1PRTF 2FINB 4X65H 1CKMA 4HAEA 2E74C 3RGZA 1R4QB 1VQCA 3PV0A 3G71A 3MXUA 4DV6Q 4HIKA 3K7AB 5M5YB 3AFPA 2UUAQ 2HGSA 2FLPA 4DV6H 5HBRB 1UE7A 2K50A 2M2LA 4P73A 5EBCA 4Q44A 4C3JH 1C3OA 1SE2A 1SN8A 3Q22A 1B3QA 4A3MH 1DM0B 3NWSA 4DFAA 3I91A 2JA8G 4OIKA 2K4KA 4N9TA 4O2DA 3M3YH 4MV4A 4WRDA 2EPBA 4U673 3HOXG 1KHIA 1TR5A 5C1PA 1CT1D 4J9OA 3BVZA 1YVCA 1E7ZA 5JQWA 4L8JA 3P75A 2H5XA 1HZBA 4RGMA 3N42B 1D2BA 1MHWC 1HNXQ 4IPHA 4BA1I 1MJEA 1KRSA 3U9TA 3PSIA 2CH4A 2HDMA 2UXDQ 1G6ZA 2QK4A 1VQKA 1HNXH 1SJED 5EKIA 3CRLC 1Q81C 2VUMG 1OO9B 1GUGA 1BDOA 4EYIB 4FP5D 5GROA 2UXDH 1KDBA 1Q3LA 1IBLL 5KFCA 1BXTA 2UXBQ 1U4PA 1TS3A 1ZHQA 2H1EA 2XRQD 4A3DB 1WOCA 4CJ1B 1N8RC 1LTSD 3V6JA 4OGQC 1DONA 4RB3C 1NR2A 2YCHA 2UXBH 1GJXA 2FE3A 1M90C 4ZUIA 2O03A 1VF7A 1CKNB 2FK1A 2OWOA 2NUAB 4IN3A 5BPHA 4C3JG 4F88A 3CC2A 2NVQB 4X3KA 1ENAA 4R8NA 1RDPD 2W6NA 3BDOA 5KFLA 3VYTA 1I5FA 5HURA 1RTOA 2F4IA 4U68A 5M3MH 4XQJA 4DV7L 3I12A 5DAUA 5I4DA 1EQTA 1XNQL 4P71A 1PTOH 1ASYA 3RFCA 1NE3A 1DJRD 1EYGA 5C4HA 3HP3A 4BA2I 2W9BB 3NUCA 2V4RA 3RB6A 1JE4A 4MHEA 4RGTA 4LF6Q 2C22A 3I4NB 3NGDA 4G7OC 3R5HA 2Z6KA 1XTDA 5CBAE 3OSOA 4LF6H 3BS1A 4ILWA 4PWQA 4ED2A 3RAXA 1L1OB 4ME3A 4ED0A 3PR5B 2W6QA 4KLKA 4YWLA 3ULLA 1Y8OB 2D0OA 4CDDC 1WCMG 2A6ED 4A3FB 1E2ZA 3CCLA 3SK5A 2LSSA 3U4VA 3X3NA 5CBEE 3I90A 4O3RA 1Y14B 1ZYRC 4NXNQ 1CKNA 3TRZA 4DR7L 1YNXA 4RAUC 4NXNH 3RLNA 3C2PA 3KUPA 2A68D 3S14H 1YEZA 2B2YA 4C5CA 2K6AA 3JRWA 2M05A 1JB3A 4YBZB 5GAEC 3HBLA 2SOBA 4ZYSA 2QEXA 1PH8A 2I5MX 1ESRA 1G6PA 4O42A 4KV6A 4X65L 3H3VC 3N8DA 3OMGA 3FDSA 4K5WA 3S24A 4OO1I 3G8CA 2RSOA 1S5CD 3BAAA 5KFTA 1D7QA 3V05A 4A3EB 2AGPA 2W9BA 3NQTA 3NQIA 1U9RA 2PN1A 3HKZB 1UEBA 2I46A 4H13C 3S2DB 1SMYD 1HFNA 1E0BA 3OMCA 3D6WA 1AUXA 1MSHA 3CQZB 2E76C 4A93H 3CCSA 3HRZC 1E1TA 4DK3C 1L1OA 4R7RA 3UDIA 4J9MA 4HJ9A 1D5MC 5KG4A 2Z8LA 2IMWP 1LTRD 3VR6A 3KFUA 1CQIB 4JI8L 3KOJA 1V43A 5KX5F 3N41B 1EEFD 4JV2A 5JEAG 2JEGA 4GLVB 5KFZA 1B53A 5L1JA 3OWFA 2K7VA 1X3QA 2WIIB 1HNXL 3MZ5A 3CVZA 2XSCA 3H0GH 1JE5A 5HGTA 4UPAA 5EPLA 1KTKA 2QYZA 4FU0A 4UCUA 1BKBA 1FNVA 2UXDL 2ZT9C 5A2QE 3GTLH 2BOSA 2Q8TA 4UCTA 1HRJA 4LUVA 2XCLA 3DEPA 1NCVA 2DNCA 3AEVA 2R7MA 2D9UA 2UXBL 1PTOF 4WJ4A 4TSSA 3PO3G 2FHTA 5KFAA 4B3MQ 3UDGA 3HKZA 1H9MA 4B3TL 3KJOA 3MXGA 1I4RA 4B3MH 1A3UA 2L12A 2EDGA 1R9TB 2VB2X 3L9AX 5KRUA 3CQZA 5H1SE 4DNTB 5LMUH 1VKZA 1CZGA 4RB1A 4BBRB 2K5DA 4C3HH 1IL8A 4BY7H 3LWEA 3PW0A 4OHJA 3UDFA 2W9CB 2VZAA 4JI5Q 5JH7F 2EJGC 4L5RC 4GZYC 2OCEA 3T16A 5JVG3 4F4ZA 3BYTB 1JQYD 4Q5VA 4JI5H 3HG9A 2XCPA 4EG0A 1L1OC 5IIFA 5C8YF 2FKLA 2HJWA 1STAA 1PH1A 2R86A 3R2TA 4FS2A 1K0RA 1JICA 2B8FA 1F2LA 2K5VA 2VL6A 5G3LF 2UVVA 5M3FB 1FL0A 1P16A 4BWSC 2ZTCA 4X3TA 4YHHL 1SR3A 5C3WA 4HJ8A 1QNKA 3AFQA 2QA4A 2ATWA 4KHPQ 3TSSA 4POFA 4HCSA 2IX3A 1A2UA 5IP7G 1QVFA 5JVDF 1ET9A 4KHPH 3K3VA 2VQFQ 4FNFA 1STBA 1PFNA 4JV0A 4DV1Q 4DV2Q 4RGNA 1HTPA 3M9MB 2FPGB 2VQFH 3IAYA 4UP9A 3IKJA 3M4IA 4FF4A 3WNZA 2B29A 3M4PA 4DV1H 4DV2H 2F03A 1R9TA 4FXDA 3VPCA 1AN8A 3MEHA 2FK3A 3UE0A 2KENA 2OTJA 3TS0A 1NSNS 2ZJQA 3SK6A 4ZRZA 2XGQA 1S9FA 4LAAA 5KFUA 3J80W 2R8KA 4CKEA 2W9CA 3M9BA 1BBUA 1QB5D 5ELCA 1B7YB 5C4JB 1EIYB 2FFKB 5FLXL 4L5QA 5DNFA 2IHEA 4JW0A 1TWHB 3K59A 1BF4A 1O7ZA 5BN5A 3K58A 3JRXA 2R6FA 3A7LA 4LMYA 4J9RA 4OL7A 1QOHA 5IP9H 1WTWA 1YHAA 1HQMC 3TREA 4ALPA 4LF9L 4BY1H 2HVQA 5KNDA 2QW7A 4DR4Q 4XYQA 1I6HH 2RKSA 4GOPB 1A62A 4PZ7A 1ZHSA 4DR4H 3QOJA 5KG1A 2KECA 2RDHA 5DM73 4JYAL 1I50H 1PZKD 1EQVA 1SEBD 1EFWA 1YZ6A 4V190 4QMGA 3F8NA 1CE8A 2UUBL 4K5VA 1ML0D 2JE6I 5JPNC 3KLSA 3RN2A 3NWTA 1VQPA 1TA8A 1S5BD 1X3GA 4LFCL 2L9HA 3HZXA 4A3GG 4TV9F 4J6HA 3G6JB 1TT2A 3PGZA 5FJ8H 4LF5Q 4XIGS 4HSPA 4LWCA 1WTXA 4EBEA 1DZ1A 3RJ0A 1VQJA 1HH2P 2ZXPA 1TU2B 2J4XA 3KK7A 4QUCA 4DV0L 2B63H 2UVUA 2KCNA 3T1YQ 2AQ2B 1Q82C 2XWJB 1TWHA 4EFBA 3LGJA 2CW7A 4LUZA 1KABA 3T1YH 1XNRQ 4KKUA 3V4SA 1SFOB 2NVXH 3K6OA 1UE1A 5LMUL 3HOVH 4HR7B 1XNRH 3GIPA 3S15B 3GIQA 3G48A 4CDEC 1MKHA 4X66L 4GOPA 3FEWX 2JA7H 5K36H 4BXXH 4AQYQ 1M1KC 1K28A 2IBKA 2MFIA 1GSHA 3RAQA 3OUUA 4HJAA 4L63B 5I47A 2QEJC 5EAYA 5IYCH 1K73C 3N44B 4AQYH 2FP4B 5JAVA 1Y1WG 3PO2B 3PW5A 1PFBA 1RKNA 1X3FA 1F77A 5D3DA 4A3JH 5IWAH 1VQDA 3L0OA 1HZAA 2D0PA 2R8GA 2DPJA 2VPQA 3U50C 5FJ8G 5EGTA 3VYSA 2FPIB 1ESFA 2P5ZX 4XXEA 1PH4A 4RHSA 2CQYA 5FLXE 1OXSC 1R4PB 2W9AA 4OX9Q 1HNWL 1JMCA 1G291 4K8JA 3GTQB 2B2WC 2YS7A 3RBDA 3MEFA 1CK1A 2V5AA 1W93A 3Q8SB 4DL7A 4OX9H 1TWFH 2KA7A 5BR8Q 5CA1F 1A15A 2MO0A 2ASBA 4R1JA 4RUAA 2EVBA 4DA2A 3GTGB 2VQFL 2ATLA 2W8KA 2OEOA 4HQ6A 1BNCA 1SFOA 5KFDA 4YB8B 4DV1L 4DV2L 2K75A 3FKIG 5KIXA 1D5ZC 1F2MA 2K5NA 2JA7G 4HR7A 4QL5A 2VNUD 1KNAA 5CGKA 2Q8RE 4TVAB 1PMRA 2MHVA 4QWEA 4EBCA 2E2IH 1CQFA 3UFXB 5ISRA 3CAMA 1IYJB 2K52A 4IPDA 2J9GA 5CAEB 3A56A 2R7KA 2FMCA 4LF4Q 1EQRA 1KD1C 2PMZE 1S72A 2PI2A 1AW7A 3V96A 1HPCA 5JOBA 3TINA 1HXYD 3PF4A 1OXVA 1E2WA 3Q8PB 2EYHA 1HCZA 5BN3A 1Y8NB 4F87A 2R7ZB 4EBDA 1K0SA 1HJPA 1ZEQX 2SCUB 2I5LX 3W3AA 1CI3M 3U9OA 1VQ6A 1NBWA 2PZWA 1WTPA 1ICFB 5E7NA 4LFAQ 3CPWA 3S16B 4DLKA 3GTQA 4C1NK 4DR4L 1MD2D 1VQEA 2F0MA 4LFAH 4K14A 2DPIA 3K0XA 2JSOA 2ASDA 4QB4A 1F9SA 3MR5A 3GTGA 5JEAJ 3H91A 3J7ZC 5FKAC 2L0CA 1QZHA 2UVWA 1S68A 2HIXA 2R92B 3G6XA 2JEJA 2J7ZA 3HFZB 2EQSA 1K8MA 2F3VA 3IFDA 1CHPD 1OXTA 4GS3A 2AMCB 4B08A 2FMAA 1A2TA 3RIZA 4HJ5A 1Z6HA 5KG7A 1T5EA 3T4AC 1O75A 5L1LA 2VOBA 2ICEC 4CC5A 4A3IH 4JI4Q 1XPRA 5FO7B 4BBSH 3K0YA 2PZTA 4DGZA 1PXUA 2R3ZA 1N36Q 4CKBA 3M9OB 2GN5A 3T1YL 2KBNA 4JI4H 4EQ5A 2YRWA 3RV4A 3DEOA 2R7ZA 1WYDA 4OIJA 4YWKA 5D8DA 3OW7A 2JA6H 4KKSA 3CD6A 3J81W 1KAWA 3IFTA 1GSAA 1FKAH 4WORA 2GVBA 1CSQA 2WB1G 1XMQQ 1BBXC 4RMFA 3RB4A 4IJLA 2W7OA 4ODGA 1CZWA 4YR2A 1HUNA 3QFFA 1XMQH 1UE6A 4KD3A 4ECWA 2EYMA 3A0JA 3BJUA 4P75A 2K04A 1PYBA 1KJJA 1EYAA 2JEBI 4AQYL 4J9SA 1EZ6A 1VMPA 5IWAL 2R7FA 3C0FB 2E2HB 2AQ3B 1PH9A 3D4WA 3TP5A 4DXFA 2X69A 2VQDA 4MV1A 1A8VA 5CV8A 3M7NA 2R92A 5T14A 1SRUA 2HUGA 5BN4A 3VDYA 2K32A 4Y7NB 1EOTA 2V59A 5CV6A 3T51B 4Q8FA 2N78A 3S9WA 4EVOA 2JEAI 4HN7A 1Z2NX 4BBSG 1TWGB 3RF2A 3VPDA 1B04A 4OX9L 3BG3A 1K3RA 5F2DA 5IYDH 1ASZA 4X62Q 4EEQA 4YWMA 3TDQA 1A9XA 3CP0A 3HOZG 1X6OA 5M5XB 4X62H 2PO4A 5C3EH 1X3EA 2Q2HA 2BDOA 3NTIA 3K5MA 1NY4A 1H9RA 1TIID 1B9NA 3S1RH 3S1MB 2WDTA 2MPMA 1CQVA 1JT8A 1XX8A 4OWXB 4LF7Q 5C6AA 3QB3A 1RYSA 1PYWD 4O3QA 4KY5A 3LP8A 5DQGA 4ZLTF 1SYCA 3HOWH 4LF7H 4XTCS 3V6HA 2F0VA 3R23A 1Y1VG 3ER0A 5J22A 2O5JC 1BGWA 2E2HA 1V4YA 2JA9A 1N56A 2QGQA 3D3RA 1FGUA 1M0TA 1AE3A 4IQZA 1IYUA 3JZIA 5EKLA 1AEXA 2F0IA 1I6VC 3CF5A 3WO1A 1Q8KA 5L1KA 3DWAA 2AWNA 4JV1A 2ZDGA 5AJ3L 1H9JA 1TWGA 2KQ3A 3VMMA 5KFFA 5IYDG 4PV1C 3HGBA 4LFAL 3KXYT 3K7AH 2J6UA 1D5XC 2JYOA 3BZDB 4X64L 2ZJTA 4MV3A 3DF7A 4M1UB 4ZOLF 4TKOB 2EYLA 2RA4A 3GTOH 3H3VH 2F4VQ 3HOUH 3IG0A 4HMJA 4ECXA 2C5CA 2V58A 3ONAB 4H0LC 2XC9A 1G2TA 3PUYA 2B2UC 3P20A 3S1NB 2F4VH 3GO5A 5DM63 1SE8A 4A3LH 2A74C 3W1GA 4AH6A 2RGRA 3FMCA 4HSVA 3SXHA 2YZGA 2BH2A 3QJYA 3MWEA 5LMNQ 1UC8A 2VA2A 3VA7A 4KD4A 3RLOA 3BDLA 2UUAH 2KUMA 2H4OA 1RHPA 1EY6A 4DV3Q 3TZUA 2YU9B 4QWAA 3E3XA 1Q1EA 4JI4L 1I3QB 1TWAB 1W96A 4ABNA 3A55A 2JA8B 3L4KA 5KT3A 4DV3H 3TP6A 3J80L 1ZETA 4CDCC 3HOXB 3CC7A 3OSNA 5J39A 3M4OB 4OWTB 3KAJA 5JVLA 2WKDA 4A3DH 4R4CA 3KF8B 2ASJA 3CC4A 3JSNA 3J81i 1IW7C 1XMQL 2R93G 1JIHA 1AZQA 1F9RA 3HOUG 2NU8B 3I4MG 3FRPB 3MHBA 1JORA 4QWBA 3W1BA 3LWUA 3HOYG 3GTMB 4F4XA 2KJXA 4IUNA 2VY3A 2QCPX 1W2BA 1RTNA 1N33L 2VUMB 4QW8A 3AYHB 2A1AA 4MNOA 2R8HA 5IGDA 5ELDA 1JX4A 3R8BA 1GUWA 4QQBX 1F2ZA 2MP1A 5CC4A 2VR1A 1SMXA 1PRTC 3NTHA 4XZ3B 3EN2A 5DG9A 1MI2A 3EYYA 1GOZA 5BMVF 4O2BF 2E2DC 1EOVA 2QILA 1AZPA 2DJFC 4C3JB 5KFQA 1LTID 1ICWA 4A3MG 3RUZA 1S0OA 5ELOA 1YHBA 3I4NH 1LLRD 3J7AK 2YU9A 2C28A 5IGCA 1SE4A 1UWVA 5K5PA 1I3QA 1TWAA 2CQOA 3EJIA 5JJKA 4IO9A 4UFZA 1FNWA 2WB1E 3KBGA 2LMCB 2XN9C 2X6GA 3N40P 3QOLA 4MTDA 2K05A 5H80A 1QZGA 1JC7A 1SNMA 1JWSD 4POGA 1E3PA 1VCIA 1HHVA 1KJIA 3KF8A 4LF5H 3V4ZA 4A3FH 5CV4A 2F0UA 2F0SA 4M8AA 2OTLA 1PRTD 3FVQA 1LYLA 5GAGC 1C7YA 4ZHQF 1IYVA 1IKMA 1X3PA 3GTMA 2ES2A 1ZQ7A 2JP1A 2NN6H 3TZDA 2VUMA 1B6SA 4E4TA 1EYDA 3OW2A 3H94A 3J7AV 4PQXA 2CWAA 2F1MA 2JQOA 2PNHA 3OIQA 1ILQA 4JI1Q 3VPBA 2NWGA 4DUYQ 3RD4A 2HDLA 1WCMB 1YIJA 1DOKA 3OYYA 2AQ1B 3T1HQ 2WFWA 4JI1H 2TMPA 2O2LD 4DUYH 4C3IH 5CR3A 4GNXC 2YYAA 2EYFA 1VQMA 5CV9A 5C5MA 5DEHA 4A3EH 3T1HH 4JI0Q 4M9UA 3KAKA 3SK8A 3J80E 3E9HA 3S2DH 2NZHA 2XGTA 3F2BA 1I94Q 1JDBB 5FLXc 2EXZA 2WKCA 2N88A 4YY3Q 2OQKA 5M3MG 3CQZH 4JI7Q 2F4VL 4C1NI 1I94H 2NU7B 5DLGA 3U58A 1PTOB 4YY3H 1TXYA 4FXGC 1WTVA 3ERSX 1SNPA 4JI7H 1CA6A 1MIUA 2CCZA 1N32Q 1CQJB 1K83B 4R4IA 4O1NA 2IT1A 3OWEB 3KLSX 1H9SB 1WFQA 5CA0F 5ELNA 3GV7B 1N32H 1ZYRD 4DV6L 4E6IA 3ND8A 4KKTA 4HYKA 5COYA 2UUAL 1LV9A 2RGVA 5LOVF 4FBTA 3FMAA 3UQ8A 3J81j 4IHJF 3ND9A 4A3KH 1TY2A 1L2ZA 3A8IE 4DV3L 4KJNA 4H02A 2RQXA 5DQIA 5FO9B 1WCMA 4C3IG 1K8AC 4NW2A 1KRTA 4ZAIA 5EPJA 4CKCA 2C2EA 2JJQA 1O78A 1EFID 2FXQA 1E24A 3S14B 2HQLA 4PNYA 3VR5A 3T5LA 4EGVA 3J7AF 1PFMA 1SXTA 1V1PB 2D2CC 4IOCA 1L2FA 1MGSA 4IUVA 1UE5A 5D3IB 5DGAA 3RN5A 2OLSA 1PX2A 4RU9A 1R9TH 4PDBA 2CFMA 1PA6A 4V0BA 3P1HA 1PHJA 4Q0YA 4ECVA 1RJQA 2HIVA 2ZTEA 4P74A 3ORQA 2EXDA 4CJ2C 3I72A 2E2JB 2FPPB 1L0YB 3E5NA 1XPUA 1PH5A 2MGSA 1EWHA 3K5NA 2CW8A 3ETHA 3ORRA 3PO3B 3L7ZC 3H4DA 1Q8IA 4KN7C 2F0GA 1K83A 3J7A5 2WAQG 4A3CH 1H9SA 3H4BA 4ECZA 4CBVA 3BVMA 5FLMH 2ZDHA 4A93G 2BE5C 1HUMA 1E4GT 3PW2A 1CKOA 1JR0D 3FHWA 4A3KG 2W6PA 1MBYA 4DK6C 3G6YA 3AQQA 2L55A 2RCFA 2CZGA 4HIMA 3SE0A 3PIPA 1QNUA 5KFIA 2ENBA 2YZMA 2PYKA 5IGEA 3MFIA 2L5TA 3NBIA 4B3SQ 4F4WA 5KKNB 2PQEA 1YBYA 5DG8A 3PCOB 1TS4A 3VR2A 2Q2UA 5CMDA 5IGBA 4B3SH 5JPMC 1D1KA 3C1FA 2AU0A 3D4DA 1WVLA 1SE3A 1V1PA 1VQNA 4HNVA 2PMZB 1VQFA 3H0GG 1B44D 3NE5B 1I6UA 1SNQA 4X3SA 5C0XH 1VQ5A 2EJMA 3RZDB 1YJNA 1L0XB 2F0WA 1EWCA 3J81L 1RJRA 3T56B 4MA0A 2YYZA 1ET6A 2YTVA 5JJZA 4LF6L 5EWGA 4XYLB 4HCEA 4JCVE 3RZOB 1J9OA 1DYQA 4IZOA 4YCVA 1S40A 4JI1L 5FO8B 3T13A 4DUYL 3I70A 5C4JH 5KFWA 3GV5B 2AGOA 3T1HL 3SK4A 4DNRB 1PTOC 1TWHH 2OF1A 5KFYA 4NXNL 2E8GA 2LY7A 4XT1B 1KDCA 1XJVA 4C3HG 5KYIA 4DR2Q 2A73B 3JAML 4XQQA 4BY7G 1IHZA 3HKSA 5LL6S 2UVRA 2DWCA 4MV9A 2YW2A 1Q46A 1AUVA 2QDBA 4J9NA 3I4OA 2YV5A 1E22A 4DR2H 4XYOA 3F1ZA 1EL0A 4EGJA 5M9OA 5F9LA 1EUCB 3D6CA 1F9PA 4JI7L 4DR5Q 1EUDB 1HQRD 1PYSB 1EQQA 4G7HC 2JXMB 2F0TA 1EZ1A 4DR5H 3L4JA 5C0XG 2V4QA 3V2TA 1SYXB 2PMZA 1N32L 3PUWA 3ULJA 5KFMA 4DL6A 5E3FA 1SNOA 2MQHA 4ETSA 1PTOD 4J15A 4ECUA 4K2LA 5IGFA 5C44H 1WTOA 2VUGA 1EHIA 1GUSA 1KLGD 3FDTA 2OXPA 3R2IA 4RWSC 3WOEA 4B3RQ 3VA5A 2PW5A 3WOFA 4GKJQ 4RNOA 1Z9FA 1DV2A 1HFGA 5KNBA 4G3IA 5KT2A 3I8ZA 1M6VA 3GV8B 4UY8C 2HT1A 4B3RH 1K9MC 4GKJH 4LH7A 4KMUC 1QVCA 3R5XA 5EPKA 4RKBA 4JOIC 3N6XA 3A54A 2AUKA 1V9PA 2PPBC 1VQHA 2IHFA 1CHQD 2B2WA 3VR3A 1JB7A 4GN3B 4BS9A 3K80C 1XDNA 1BCPF 4KI0A 5JJIA 4N8X1 4XT3B 2B2VA 1H9KA 1SFOH 4ZUJA 5KFNA 4A3GB 4YAKB 2JA5B 2B3GA 2CW0C 3OSPA 3BQ0A 3K57A 4YIJA 1C4QA 5G3LD 3MJFA 4RB0A 4MN3A 2W6ZA 4Q45A 2BQUA 1P8LA 3SR1A 1VAJA 3QZ7A 2GVAA 2WACA 3BVGA 3S2HB 2M9VA 4FF1A 4MIUA 3J81E 1LT6D 4IALA 5IP9G 2NVYB 4FS1A 4AYBG 2R61A 1FYCA 1RJPA 1B33N 3MWDA 2FLLA 3DM3A 3H09A 4BY1G 3KYHC 3NEMA 5C44G 1PH2A 4B3ML 2IA6A 1IZ6A 2NZ1D 4A75A 2CKZB 3G7LA 2RF4A 4R9WA 1XWEA 4LFBQ 1KAAA 2CH4W 3BU2A 4RZRA 4K6LA 1C9OA 5IT9W 3GTKB 2W70A 1S10A 1HA5A 1I50B 4IJHA 1RYRA 2JEFA 4LFBH 4IUTA 5E4WC 4OONA 2CW0D 3GTQH 1A3TA 1G8ZD 4B3SL 5KFKA 4RH6A 4JI5L 4JI6Q 4K0KQ 3NPPA 3OUZA 1Y1WB 3JAME 1PLFA 3KF6B 3MFHA 4DNIA 4JI6H 1CTMA 3CCJA 3URYA 2GPSA 4K0KH 3GTGH 4R4QA 4JK1C 1NR4A 1WTRA 3BA8A 3ETJA 3PVXA 5LL6X 1VMCA 2HD3A 1BCPC 4LSAA 1BVSA 1J8IA 2X0SA 3MR6A 2JA5A 3PQIA 3DLLA 1OWTA 4IPCA 4ZQ3A 2J6TA 2B63G 2EYPA 4O0AA 1G51A 5IGGA 4DL4A 4CJ0B 3MWMA 3RNUA 2BA1A 5EZYF 3QG1A 2CVRA 2JN4A 1RK6A 5F9NA 5IYBH 1Q86C 3I4LA 2WAQE 4KHPL 4Q0FA 2B2VC 5EBDA 2EYOA 5KFHA 2SNMA 4WFN3 5CV5A 2NVYA 1YNJC 4FYDA 4OWWB 2FB9A 3A5ZB 3HOVG 2PVPA 2IL8A 3CRKC 1X9NA 5BR8H 3FKIB 3RMHA 2EZVA 5LMNW 1FJGQ 2JA7B 2R7ZH 3PW7A 1LTAD 4DV4Q 5K36G 1S5DD 4BXXG 1QUQB 3L2PA 4EYHB 4IUPA 2W71A 3GTKA 4PG3A 2A6HC 1FJGH 1I50A 2L11A 4DR2L 4DV4H 1Q12A 2F0HA 3QO2A 5IYCG 1YHQA 3S16H 5JVH3 4NPSA 5FPRA 4PMCA 4J9QA 2D5DA 1E4FT 3BYYB 5E1FA 2VPSA 1F2YA 4A3JG 1STYA 4IZ8A 1Y1WA 3J80i 4I7AA 3KF6A 3V6KA 3KJPA 1S4ZA 1QILA 4YP3A 3HS0C 2XVSA 4DAPA 4H7BA 3WDNA 2XCAA 4LF4H 3CCMA 4LH6A 4Z9CB 2W57A 4UCRA 5ELBA 1QWYA 1KDAA 1KJ8A 3M9NB 2AQ4A 1RJTA 3QZ8A 1EIFA 2Y0SG 1SYFA 5IYBG 2R92H 3I73A 2B2TA 3SE7A 1TWFB 3U4ZA 5DQHA 4WJWA 1SBBB 3GV3A 5EJWA 4B9XA 5JJLA 3GV6A 4B3RL 1GUTA 1TVXA 4GKJL 5FOBB 3N52A 2X6LA 1WI5A 1BR9A 3NTKA 5M5WB 5DLFA 4I50F 1JOOA 1LABA 2NVTB 3FKIA 3MFYA 1KL9A 1VQOA 2JA7A 4QGUA 4N8FA 1TKWB 2F0EA 3EQLC 1QUQA 4OO1H 4TQUS 4KHVA 2R84A 2GPWA 3HXLA 1B3AA 1HTLD 4NLGA 4H44C 3KLWA 5LP6F 4UDUC 4LF5L 1RK5A 3J80c 5D1OB 1GHKA 1Y8PB 2F0OA 1I4PA 4HMIA 2F0FA 3S1QB 4IRCA 4PMBA 2UUCQ 3A8KE 1SYDA 2J0TD 3MWYW 2DIKA 1VS0A 1DOMA 1JWMD 3CU7A 3B6YA 5C1OA 2UUCH 1F9QA 1KLUD 2K14A 5A35A 1N36H 2E2HH 2AGQA 1XNRL 4QWDA 2RDGA 3CCQA 1SROA 1PDQA 2WB1B 4G7ZC 5KFSA 1LTGD 4DK0A 1JJCB 1TWFA 4Y7NH 4A76A 4DUZQ 3GLKA 1LTTD 2AHOB 3TBIB 1EEID 1TS2A 4EFEA 1I4HA 2ZXRA 1N48A 3F2UA 1TWGH 3G6EA 4DUZH 5KFOA 3SHLA 5HGQA 1AN7A 4C56C 4UAIA 1AH9A 3TQ1A 2B2TC 2W7PA 5CYUA 1OXUA 4HIDA 4JI6L 4K0KL 5IYZF 5KFVA 1NNXA 1Z7TA 4JBJA 3GTJB 5M5XH 3JAMW 2R7LA 1ENFA 1S5FD 4RAZA 4C2MB 3VYRA 1C30A 3NENA 4JI2Q 3EROA 3MA2B 1I7LA 1GLVA 1Z47A 4A3IG 1JCKB 4BBSB 4QF4A 3MTSA 3TP8A 4DKAC 2B2UA 5GADC 1IOWA 4DU9A 4JI2H 1I4XA 5D1OA 4RCNA 1E1OA 1II3A 4AYBE 4UCSA 5CV7A 1S5ED 3TQYA 1PRTB 2JA6G 3MFGA 2MCTA 2Z1CA 5C0XI 3HOZB 4FM9A 1SYBA 5BR8L 1K8GA 2V4DA 3AB9A 2WTFA 5I2XA 1G91A 2EJFC 3F2CA 2WB1A 2ID0A 5E4XA 2GA4B 5C4XH 4A3BH 2TSSA 3GQBA 1FJGL 4MV8A 4DV4L 1FR3A 3GTPB 1UC9A 3RUPA 2M00A 1QE6A 4XDXA 1XMOQ 1EIGA 5IY0A 4TRDA 3G4SA 2N3SA 3TIIA 2EY1A 1WJJA 4R4OA 3MXPA 5D1PA 1XMOH 3OPOA 1Y1VB 2K03A 4X3UA 2L4NA 2VQEQ 4LF4L 3E5SA 5C0XJ 3H6MA 1QVGA 3IN5A 3W5OA 1EYCA 1QJOA 3PIO3 3GTJA 4NMZA 2VQEH 1FD7D 2LKVA 4APMA 3S1NH 3H20A 4C2MA 1LT5D 3T5KA 1TWCB 2WINB 5CORA 1CSPA 1GSOA 2DUDA 4LF8Q 1A63A 1C48A 1Z2PX 5M5YH 1JXLA 5HV6A 4CDFC 2P0AA 5KFBA 3OHAA 4LF8H 2D62A 2EE1A 4HIOA 5C3EG 3NBHB 1XYIA 3BZCA 2BQ3A 1UAPA 1SYEA 4NB3A 2YU9H 4GNXB 5I6YA 1YI2A 1TWAH 5C4XG 2A5HA 4A3BG 4FDBA 5C3XA 4I55F 2JA8H 4CC6A 3NK9A 3Q8DA 4OXPA 4DR7Q 2EY2A 3EPIA 1LO5D 3PIP3 2EOTA 2K1BA 3K5IA 1DD2A 5J2TF 3HOXH 4QWCA 3OHBA 4J9KA 3HOWG 2YTXA 3M4OH 3GTPA 3O13A 3K7UC 2LFNA 3JC66 4YJ3F 5BPFA 4ED1A 4L6TB 3RR5A 1V8QA 1Y1VA 2R87A 3WO0A 1B70B 4QY7A 1JOQA 5LMNH 3GTMH 5J2UF 1T5XD 2Q2IA 2UUCL 2ASLA 2HCIA 2VUMH 1N36L 4GLXA 2YS6A 2WYOA 2Y0SE 3D0FA 3I55A 1EU3A 4BWGB 1M8AA 4J9LA 2BDNA 3E9IA 1TWCA 2DN8A 4WBNF 3S17B 1GHJA 4A2BA 2VS1A 4L5SA 2R93B 3QR8A 1SSOA 3GTOB 2F0NA 3PUXA 3HOUB 5K2MA 3X3MA 3I4MB 2EY5A 4DUZL 2C35B 1Q1BA 3HOYB 1RODA 4MTEA 2KCTA 2NVQH 3NBHA 1W6JA 1M7JA 2Z4IA 1IXRA 1EIHA 4I7HA 4A3LG 4JI8Q 1N9WA 4GNXA 2J6SA 4QUFA 3PF5A 1DGSA 1RF2D 4QIWE 2FK2A 3MXNB 2I0QA 1H95A 4JI8H 3EVQA 4G57A 2ALZA 5GONF 4K8IA 1PK8A 3RBEA 1PZID 2C9OA 4MA5A 3JAMi 1Z2OX 4JI2L 2R82A 1B50A 1UNSA 2K5QA 2NZOA 5T1GA 3QWNA 3GIIA 1IW7D 4A3MB 4PZ6A 2UXCQ 3T53B 3LNNA 1A0IA 3SDZA 3M3YB 4JVZA 3VYUA 1HR0Q 3TS2A 2UXCH 5KYLA 4X62L 5C5JA 1GUNA 1V1OA 1JKJB 2BH8A 3ULPA 1HR0H 4A3DG 4XX0B 2UU9Q 4B3TQ 3J81c 3LX0A 1WCMH 1IBKQ 2AKWB 1ZXTA 4DXGA 2R93A 2NB0A 2UU9H 4ED7A 4B3TH 3GTOA 2PNRC 3IRBA 4DAVA 3U9SA 2ZJRA 4LF7L 1IBKH 1CM9A 1EY8A 5EWEA 1CUKA 4DR3Q 1XMOL 3TP7A 4ECYA 1VDZA 1LTBD 4K2KA 5CB4F 2VB3X 4ZKBB 3VR4A 2XRSD 2A6EC 4LW1A 3ZYYX 4DR3H 1D6EC 1SCUB 1MSGA 1S0MA 4KN4C 5IT9L 3AMUA 3MXNA 4TV8F 2ICIA 2VQEL 1AFPA 2I87A 3FPPA 5FPOA 4KHZA 4DN4M 3JAMc 2MO1A 5A2QL 1HNZQ 2A68C 2NU9B 3BA9A 3A5UA 1VQ7A 2IPKD 1T36A 2C2DA 1U4RA 1K83H 3UDXA 3I4NG 1HNZH 1GYFA 1STEA 2F0JA 4YHHQ 1JLLB 1D8LA 4LF8L 3LMLA 5KG2A 4DV5Q 2ZXOA 5D65A 4DK1A 1VBHA 4JI0H 1STNA 2B39A 4YHHH 2DY8A 3RTXA 2BA0A 1U0LA 5M3MB 4DV5H 4ECQA 4CHTB 1XTCD 4KY6A 1E4EB 4IUUA 3DXJC 1PVOA 2YRXA 3LWBA 5LXTF 2FLNA 3CHBD 3CCUA 4RKLA 1S3OA 2MJ8A 4A3FG 2IX1A 1DCZA 3L3OC 4U6PA 1B9MA 3EPGA 1SMYC 1BNZA 1BXRA 2ZJPA 3NHHA 3STBC 4Q8EA 5J3BA 2QF7A 1YITA 5KGUA 1DXMA 5I6WA 2R85A 4O4LF 1CS0A 5JEAH 1X65A 2NN6G 4YCUA 3I7FA 3TIGA 3PN1A 4ED3A 5LMNL 4F50A 4O3PA 3ERQA 4JG2A 1EZ8A 2QKIC 3Q0AA 4IFDH 4I65A 3KALA 4ECTA 4C3IB 1BUVT 1B2TA 3ZJYC 1HZCA 4A3EG 2K01A 2E2JH 4WJ3M 1BJTA 5KG3A 2XWBB 3I2ZA 2I5HA 3HKZG 4LF9Q 1UUPA 4RFBA 3PO3H 1ILPA 4R4TA 4DPGA 2OH2A 1EY0A 3STBD 1BQQT 2AWOA 2F0DA 4LF9H 1WD0A 4ZK9B 1HA6A 4DL2A 5FK9C 4X6AH 4G4KA 3PIOA 4JYAQ 4RB2C 2BCOA 1E4EA 2RSNA 1NTGA 4GC6A 4LUOA 2KCMA 5J1ZA 3PZPA 4JYAH 1X32A 4BBRH 5L1IA 5TSSA 1X54A 2R8IA 2UUBQ 2Z6KC 1VQ4A 2R8JA 4Y52H 4NKLA 4O3OA 1V1QA 2IY5B 4LFCQ 2UUBH 2V9WA 2WAQB 5ELFA 1UEAB 3Q1KA 4IR1A 1S03G 1LTLA 2ZTDA 1NMFA 5IT9E 4A93B 2NU6B 4LFCH 4QJFA 1SDFA 3TN2A 1T94A 2VA3A 3PUZA 4A3KB 4ULLA 3KTMA 3A7AB 2KEDA 2F3IA 4EX5A 4IFDG 5EOYA 3RZDH 2EIFA 1M4VA 4DV0Q 4FXKC 5M3FH 4OEMB 2UXCL 4LMQD 1T3NA 4WD3A 3Q8RB 2B2YC 3M7GA 1HR0L 4DV0H 3ITPA 3T5JA 1EY5A 5IP7H 4I7ZC 3RZOH 4RUCA 2F52A 3BABA 2N8NA 2NYZD 1VQBA 1Y69U 4I4TF 5AFWA 2UU9L 3FP9A 5LMUQ 5LHY1 1IBKL 2A69C 2N55A 5JUMA 4GLAC 3H0GB 4X66Q 2WV6D 3E0EA 1FGBD 4JV5Q 1DOLA 3PUVA 5ELEA 3GTLB 3M85A 5HY6A 4DR3L 4BBRG 1DIKA 4X66H 2BE5D 4JOIA 1M0WA 4J0MA 4JV5H 5DGBA 1EY4A 3K81C 3CW2C 1NAPA 1BO0A 4ECSA 3C3LA 3DMUA 4MTNA 5T1IA 2MNAA 3OTOQ 4A3CG 3RB3A 1O7LA 5KFJA 1BCPB 3K5OA 3M4QA 5FLMG 2SDFA 2WAQA 3RB0A 3OTOH 3DUZA 1HNZL 3BG5A 2B8GA 1B6RA 3RV3A 4JBMA 1X56A 1HNWQ 4YCWA 5M3FG 1EYZA 2A69D 4C3HB 2GLTA 4JI0L 3KHRA 1NMGA 4BY7B 1E2VA 1X55A 3IL8A 4DV5L 2RDJA 1HNWH 5I9OA 1I94L 2HHHQ 4O4HF 4K6DA 2W6OA 4YY3L 4R8IA 2I8CA 3F2DA 1PH7A 4GC7A 2HHHH 2F0KA 4ME6A 4FVMA 1DV1A 1PV4A 3GILA 4B9WA 3R3OA 2PW7A 2JK8A 5IODA 3H0GA 3H3VI 4KY7A 2YL2A 3J7YW 3C1EA 3EA6A 5FD6A 3GTLA 1O7YA 2DLNA 3NXWA 3CCRA 4A3GH 4JI3Q 3GD7A 5KEEA 2JA5H 5KFPA 3E0JA 4O2AF 1SYGA 3I56A 4MTKA 4TQRA 3A74A 4JI3H 2CWPA 2K5WA 4J8QA 4DAMA 2W6MA 4LK1C 1GKHA 5GQOA 5I2YA 4L1KA 1OTCA 3S2HH 1WSCA 4ZQIA 2LXJA 2NTTA 2NVYH 2DY7A 3NELA 1VQIA 2KHJA 3R5FA 4A2AA 4EEYA 1EWIA 4J1MA 4RNNA 1J5EQ 2F0LA 1LACA 4HTHA 1J6QA 2G9HD 1KXLA 4JBWA 5L37A 4JC0A 1J5EH 1XPOA 1PFSA 3S15H 4NXMQ 4LSXA 1VBGA 3GTKH 1GGOA 1BBWA 3I3CA 4ED8A 3SI8A 1FVIA 2HCCA 1YJWA 1KQSA 4IUQA 4UCVA 5KFGA 3D31A 2ZM6Q 4IRDA 5IE8A 4NXMH 1VF5C 1W6KA 4KK7A 3ICEA 3BQ1A 4AYBB 1U4MA 5DLQE 5KFEA 3CXCA 2DGYA 2ZM6H 5IOCA 1Y1WH 5KT5A 5LA6F 4BY1B 2HVSA 1SEIA 3PO2H 5C44B 1KJ9A 4YAJB 1XXGA 2XNAC 1I6HB 2Z4HA 1VQ8A 2YTYA 3JSLA 2JA5G 1EY7A 2XGPA 1S97A 3R93A 2WP8J 4DR1Q 1B4OA 2Q2TA 1RD9D 3HEJA 4XQNA 4MV6A 2E75C 3MAQA 3RGXA 4DR1H 1VQLA 1ONLA 3HKZE 5A2QW 3MC0B 3N6RA 5KT6A 2DJGC 3DHQA 3K3PA 2R7NA 4CGYB 3SVMA 2XIGA 5C4ZA 4EGQA 4AIMA 3BQ2A 2RDIA 3FKIH 4RHRA 3K5HA 3CMEA 4O4IF 3T5HA 4Y8VB 1V51A 2L15A 3DWQA 1IBMQ 4JV5L 2RBMA 4RNMA 2B63B 1RCVD 2SEBD 4L5TA 3E6ZX 3OIPA 1NJIC 2E5LQ 1K8OA 1IBMH 5IWAQ 2MUYA 3CMAA 1T9HA 2VW9A 2HQEA 4P72A 4RGOS 5LYJF 1BOSA 2L1BA 3UE1A 3PO2G 2E5LH 3OTOL 4FF2A 4AYBA 4UP8A 4EQOA 1WTQA 3EFXD 2NVXB 3HOVB 2FMMA 4IAJA 3OHXC 1GD7A 3D4RA 4R8UB 4KTAA 1VQ9A 3GIMA 4UHVA 2BR0A 2NN6I 2G5DA 2KEEA 4RA8A 4RAYA 1GXDC 2C2RA 1CFMA 4JUZA 4GN4B 3KDFB 3D8GA 1BCPD 4UP7A 4IWYA 2LXKA 1U5KA 3NSWA 2Z9HA 1EY9A 2HHHL 1O7IA 3RLFA 4A3JB 2PZUA 1A6XA 4APVA 1GVPA 4F8MA 3K5LA 1IL2A 2IW3A 1FNUA 4DR5L 2FJ2A 2K28A 2NUCA 2RVLA 3Q6SA 5GAHC 4QCLA 2IWHA 1JDEA 3HB9A 3PR4A 4GN5A 3EBEA 2W8LA 5M5WH 5EDWA 2RHQB 4HNUA 2PQAB 1YNJD 4LNQA 3WWVA 1SLJA 3Q23A 1QG7A 2NVTH 3F8TA 2I80A 4HNTA 1L0WA 4GKKQ 2Y0SB 1RL2A 2R7DA 2B63A 4N9PA 4S3SA 2F3WA 4GKKH 3TEHB 4JI3L 2A6HD 1AE2A 2G9DA 3SGIA 2KCCA 5FD5A 4HJ7A 1TS5A 4LJZC 4IWXA 1IOVA 4NDXA 1YNNC 4GOPC 1JOKA 1QCBD 3S1QH 3CKIB 2NVXA 1TAEA 2R7ZG 3GDEA 2YZNA 2I07B 4R8UA 2IP4A 4YR3A 4F7XA 4DF7A 3KHHA 1WH2A 4KJOA 5AJ3Q 2CQAA 2E2IB 3M4YA 4QIWB 3CCVA 3MR3A 2JEIA 4IFDI 3UI2A 1N34Q 5EQ0A 1J5EL 1B8AA 4P2CB 4X64Q 3KDFA 1HR0W 4XYMB 4DR6Q 1TY0A 1LM0A 1N34H 2CHBD 4X64H 2K33A 2RCNA 4NXML 1STHA 2OT2A 4DR6H 3A8JE 1KJQA 3EIVA 4IPGA 2Z0SA 1YJ9A 2N49A 2F0PA 3Q8QB 1STGA 2KHIA 4ED6A 1GO3E 5NUCA 2ZM6L 1LUZA 4OELB 1YNND 1MZBA 2EY6A 2PQAA 2XIWA 3BJYA 2KVMA 1KBLA 2R92G 3QIAA 4ID6A 3MR2A 3GTJH 2Y0SA 1IKLA 1PZJD 4IFDJ 2O4XA 4C2MH 3BDCA 4LFBL 4TUYF 2HVRA 1PH3A 4Q43A 1ULZA 3TMEA 4F4YA 4DR1L 4MZ9A 4M7EA 1LT3D 3NP8A 1MJCA 4PMWA 1PH6A 4HEDA
chains in the Genus database with same CATH topology
1HH2P 1IXRA 2HIVA 2A8VA 2ZTEA 4P74A 4JI8Q 1N9WA 4GNXA 2EXDA 3T1YQ 4A3LG 3PF5A 1DGSA 1Q82C 4QIWE 1XPUA 3MXNB 2I0QA 3LGJA 1PH5A 1H95A 4LUZA 1XNRQ 3L7ZC 4OO1G 1VQAA 2K5HA 3J7A5 2WAQG 3HOZH 4A3CH 1RIPA 2NVXH 2V1CC 1UE1A 5LMUL 5FLMH 3HOVH 4A93G 1Q7YC 3JAMi 3G48A 4JI2L 2XTIA 1CKOA 3FHWA 1MKHA 4A3KG 1KIXA 3S1MH 4X66L 4DK6C 4GOPA 2NZOA 1GM5A 4RG1A 3AQQA 1IBML 2JA7H 4BXXH 4PZ6A 4AQYQ 3GTPH 2UXCQ 1N33Q 1M1KC 4HIMA 1A0IA 2MFIA 3PIPA 4HJAA 1HR0Q 3H15A 2E5LL 5EAYA 5IYCH 1K73C 1IBLQ 4B3SQ 3TS2A 1YBYA 1EUJA 4DAYB 4X62L 3PCOB 1Y1VH 1Y1WG 2BH8A 3ULPA 2Q2UA 1X3FA 4A3DG 1HZ9A 4A3JH 1VQDA 3L0OA 1HZAA 2UU9Q 4B3TQ 4JBKA 2D0PA 3J81c 1KC8C 1WCMH 1IBKQ 1VQNA 2AKWB 3U50C 5FJ8G 1VQFA 3H0GG 1PH4A 1VQ5A 3IRBA 2ZJRA 1YJNA 4LF7L 1OXSC 1TWCH 1CUKA 4OX9Q 1HNWL 2YYZA 3CPFA 1G291 2YTVA 5IT9c 4DR3Q 1XMOL 1JMCA 4LF6L 3MEFA 4LW1A 1TWFH 4JCVE 4YCVA 3CCEA 5BR8Q 2MO0A 1S40A 2ALYB 4R1JA 2VQEL 4DV7Q 2ASBA 4JI1L 1XNQQ 4DUYL 2VQFL 1C0AA 5C4JH 4KHZA 3T1HL 2IX0A 3JAMc 4DV1L 4DV2L 2K75A 2MO1A 3FKIG 1HNZQ 1TWHH 3A5UA 2K5NA 2JA7G 4NXNL 4QL5A 1JJ2A 1VQ7A 2E8GA 2VNUD 4PZ8A 1K83H 3UDXA 1XJVA 2OQ0A 4TVAB 3I4NG 4YHHQ 4DR2Q 2A19A 4GKKL 1D8LA 2E2IH 4LF8L 4BY7G 2PI2E 3HKSA 4DV5Q 1Q46A 3CAMA 1IYJB 3BZKA 2K52A 2YV5A 1E22A 3I4OA 4IPDA 3F1ZA 2BA0A 1U0LA 4LF4Q 1EQRA 1KD1C 2PMZE 4JI7L 4DR5Q 1S72A 2PI2A 1PVOA 1PYSB 1EQQA 3CCUA 3PF4A 1OXVA 1S3OA 4A3FG 2IX1A 1I3QH 5C0XG 1HJPA 1N32L 3PUWA 2ZJPA 3STBC 3ULJA 2I5LX 5J3BA 1YITA 2MQHA 1VQ6A 1NBWA 2RHSB 4J15A 1X65A 2NN6G 3K8AA 5E7NA 4LFAQ 3CPWA 1N34L 3S17H 5C44H 4YCUA 4DR4L 1W3SA 2R6GA 1VQEA 3I7FA 2R93H 5LMNL 4DR6L 1OXXK 4IOAA 4B3RQ 4GKJQ 1Z9FA 4JG2A 3I4MH 3K0XA 4X65Q 4A4IA 3HOYH 4UY8C 2HT1A 1VQGA 1K9MC 1JJGA 1QVCA 5JEAJ 4JOIC 3ZJYC 1CKMA 1HZCA 3J7ZC 4A3EG 1V9PA 1QZHA 2E2JH 4WJ3M 1VQHA 2IHFA 1VQCA 1JB7A 3I2ZA 3PV0A 2HIXA 2I5HA 4GN3B 3G71A 3K80C 3HKZG 4DV0L 4LF9Q 4DV6Q 3PO3H 4KI0A 4R4TA 4DPGA 4HIKA 3HFZB 2EQSA 4GS3A 1SFOH 5JJIA 1OXTA 3AFPA 2AMCB 3STBD 2UUAQ 2AWOA 4HJ5A 1UE7A 2B3GA 2K50A 4P73A 4X6AH 3PIOA 4JYAQ 4A3IH 4C3JH 4JI4Q 1XPRA 4BBSH 1NTGA 1SN8A 4LUOA 4A3MH 2KCMA 1N36Q 2JA8G 1P8LA 4BBRH 2GVAA 2K4KA 1X54A 2GN5A 3T1YL 2KBNA 4O2DA 2Z6KC 2UUBQ 3M3YH 4EQ5A 1VQ4A 5IP9G 1WYDA 3HOXG 4Y52H 4YWKA 4AYBG 1V1QA 1KHIA 2JA6H 3CD6A 1KAWA 3DM3A 4BY1G 4LFCQ 2IY5B 1YVCA 3KYHC 3NEMA 1E7ZA 5C44G 1LTLA 2GVBA 1CSQA 1PH2A 2WB1G 1XMQQ 1IZ6A 2ZTDA 4RMFA 1NMFA 2H5XA 1HZBA 2CKZB 4IJLA 4A75A 2RF4A 1HNXQ 4QJFA 4LFBQ 3BU2A 4IPHA 4BA1I 3PUZA 1MJEA 1KRSA 1C9OA 1UE6A 3A0JA 3PSIA 3BJUA 2F3IA 4P75A 4IJHA 4EX5A 4IFDG 3RZDH 1PYBA 2EIFA 2UXDQ 4DV0Q 1VQKA 2JEBI 4AQYL 5M3FH 2UXCL 4OONA 1Q81C 2VUMG 3GTQH 5GROA 1HR0L 1IBLL 4B3SL 5IWAL 4JI6Q 2R7FA 4JI5L 5IP7H 4K0KQ 2UXBQ 1PH9A 3RZOH 3KF6B 2F52A 1WOCA 2N8NA 4DNIA 1N8RC 1VQBA 1A8VA 3CCJA 2UU9L 3M7NA 3FP9A 5LMUQ 1SRUA 3GTGH 4R4QA 3VDYA 1M90C 2B63H 1IBKL 4B3ML 1CKNB 2N78A 4GLAC 4X66Q 2OWOA 3E0EA 1BVSA 2JEAI 4JV5Q 3CC2A 3DLLA 4BBSG 4IPCA 3PUVA 2B63G 3M85A 4O0AA 1G51A 5HY6A 4BBRG 4DR3L 4OX9L 4JOIA 3RNUA 2BA1A 1K3RA 3K81C 3CW2C 5IYBH 1ASZA 5IYDH 1Q86C 4X62Q 2WAQE 4KHPL 1I5FA 4YWMA 2MNAA 3CP0A 4MTNA 3OTOQ 5M3MH 3HOZG 1X6OA 4A3CG 4DV7L 5C3EH 1X3EA 4OWWB 2Q2HA 3A5ZB 1XNQL 3M4QA 4P71A 5FLMG 3HOVG 1ASYA 1NE3A 1NY4A 1EYGA 1X9NA 3S1RH 4BA2I 5LMNW 1HNZL 1FJGQ 1JT8A 2R7ZH 4OWXB 4LF7Q 4DV4Q 5K36G 4JBMA 4BXXG 1X56A 1HNWQ 1QUQB 4YCWA 3L2PA 5M3FG 4LF6Q 4JI0L 4PG3A 4DR2L 1NMGA 4XTCS 1Q12A 3HOWH 2Z6KA 1X55A 1XTDA 5IYCG 4DV5L 1YHQA 3S16H 1I94L 1Y1VG 3ER0A 2HHHQ 4NPSA 1L1OB 4ME3A 4YY3L 4KLKA 4YWLA 3ULLA 4A3JG 2D0OA 3J80i 3F2DA 1PH7A 2JA9A 3KF6A 2QGQA 3KJPA 1WCMG 3CCLA 3U4VA 1FGUA 2LSSA 1AE3A 3CCMA 1PV4A 1Y14B 4NXNQ 3CF5A 1Q8KA 2JK8A 1CKNA 3TRZA 4DR7L 1YNXA 3H3VI 2AWNA 3RLNA 5AJ3L 1EIFA 2Y0SG 3S14H 1YEZA 5IYBG 5IYDG 2R92H 4LFAL 3K7AH 3U4ZA 4X64L 5GAEC 5JJLA 3CCRA 4A3GH 4JI3Q 3GD7A 2QEXA 3GTOH 4B3RL 1PH8A 2JA5H 3H3VH 2F4VQ 3HOUH 2I5MX 4GKJL 3I56A 1G6PA 4X65L 3A74A 1WI5A 2CWPA 3PUYA 4DAMA 3S24A 4OO1I 3GO5A 1SE8A 1GKHA 5GQOA 1D7QA 4A3LH 1OTCA 3S2HH 1KL9A 1VQOA 2LXJA 3W1GA 4QGUA 2NVYH 1VQIA 1UEBA 2KHJA 3NELA 4AH6A 1QUQA 1EWIA 4TQUS 1J5EQ 2BH2A 1J6QA 5LMNQ 1KXLA 4JBWA 4JC0A 3CCSA 3KLWA 1XPOA 4A93H 1PFSA 3S15H 1E1TA 3RLOA 1L1OA 4DK3C 3J80c 4LF5L 4NXMQ 3UDIA 4DV3Q 4HJ9A 3GTKH 1Q1EA 4JI4L 1BBWA 2UUCQ 1FVIA 1YJWA 1KQSA 3KFUA 3D31A 2ZM6Q 1VS0A 5IE8A 4JI8L 3KOJA 3B6YA 1V43A 3ICEA 3CC7A 2K14A 5DLQE 3CXCA 2DGYA 4OWTB 1Y1WH 2E2HH 5JEAG 4GLVB 1XNRL 3PO2H 4A3DH 4R4CA 3KF8B 1SROA 3CCQA 3CC4A 3J81i 1XMQL 2R93G 1VQ8A 2YTYA 1JJCB 2JA5G 4Y7NH 4A76A 4DUZQ 1HNXL 3HOUG 3I4MG 2AHOB 3H0GH 2WP8J 1JE5A 3W1BA 4DR1Q 4UPAA 3HOYG 2Q2TA 1BKBA 2UXDL 1TWGH 3G6EA 2VY3A 1W2BA 3GTLH 1N33L 3AYHB 5HGQA 2A1AA 1VQLA 4LUVA 3HKZE 4MNOA 1AH9A 3AEVA 4HIDA 1OXUA 4JI6L 4K0KL 2UXBL 4WJ4A 4QQBX 3PO3G 1SMXA 4B3MQ 4JBJA 3UDGA 3EN2A 5M5XH 4B3TL 3NENA 3KJOA 4JI2Q 1EOVA 4AIMA 3FKIH 3CMEA 1Z47A 4A3IG 5H1SE 2L15A 1IBMQ 4JV5L 4DKAC 5GADC 4A3MG 5ELOA 1YHBA 3I4NH 4C3HH 1E1OA 4AYBE 1UWVA 4L5TA 1NJIC 4BY7H 2CQOA 2E5LQ 5JJKA 4IO9A 3UDFA 5IWAQ 2VZAA 4JI5Q 3CMAA 1T9HA 3TQYA 2OCEA 2VW9A 4L5RC 2WB1E 2JA6G 4P72A 3UE1A 5C0XI 3PO2G 5BR8L 3OTOL 1QZGA 1K8GA 4UP8A 4POGA 1E3PA 1L1OC 1VCIA 1PH1A 1GD7A 3F2CA 4A3FH 2ID0A 1K0RA 1VQ9A 2NN6I 5C4XH 4A3BH 2OTLA 2K5VA 2VL6A 1FJGL 1LYLA 5GAGC 4DV4L 1C7YA 1FL0A 1XMOQ 1P16A 5IY0A 2ZTCA 2ES2A 4GN4B 4YHHL 1SR3A 2N3SA 3KDFB 3G4SA 1WJJA 3AFQA 4R4OA 4UP7A 4HJ8A 2QA4A 2ATWA 4KHPQ 4POFA 1QVFA 2LXKA 1U5KA 5IP7G 3OW2A 2HHHL 1O7IA 3RLFA 2VQEQ 2JQOA 2CWAA 2PNHA 4APVA 1GVPA 4JI1Q 4LF4L 5C0XJ 1IL2A 4DUYQ 1QVGA 2VQFQ 4DR5L 3W5OA 1YIJA 3OYYA 5GAHC 3T1HQ 4DV1Q 4DV2Q 4GN5A 2WFWA 3EBEA 5M5WH 3S1NH 2RHQB 2PQAB 4C3IH 4GNXC 4UP9A 4LNQA 2B29A 1SLJA 3M4PA 3WWVA 4A3EH 1VQMA 3F8TA 2NVTH 1L0WA 4JI0Q 4GKKQ 1CSPA 3UE0A 2DUDA 1RL2A 2KENA 2R7DA 3TS0A 4LF8Q 2OTJA 2ZJQA 3E9HA 3S2DH 2NZHA 2XGTA 3F2BA 1I94Q 1A63A 5FLXc 5M5YH 4YY3Q 2OQKA 2D62A 3TEHB 4JI3L 1AE2A 3CQZH 3M9BA 3SGIA 5M3MG 1BBUA 4JI7Q 4HIOA 5C3EG 3NBHB 4HJ7A 2F4VL 1B7YB 3BZCA 3U58A 1EIYB 4NB3A 4GOPC 1TXYA 4GNXB 2YU9H 3S1QH 1YI2A 4L5QA 3ERSX 2IHEA 1TWAH 5C4XG 4A3BG 4FDBA 2JA8H 2R7ZG 3GDEA 1MIUA 3Q8DA 4OXPA 2CCZA 4DR7Q 1N32Q 4R4IA 2IT1A 5IP9H 3HOXH 5AJ3Q 1WFQA 3HOWG 5ELNA 2YTXA 1YHAA 3CCVA 3M4OH 3TREA 4ALPA 4LF9L 4BY1H 4DV6L 4IFDI 1J5EL 1N34Q 3K7UC 4DR4Q 1B8AA 4X64Q 3KDFA 3JC66 1I6HH 1HR0W 2UUAL 3RR5A 4DR6Q 4GOPB 1LM0A 1A62A 4PZ7A 3J81j 1PHJA 2RCNA 1B70B 4QY7A 4A3KH 4NXML 4JYAL 4DV3L 4H02A 3GTMH 1I50H 3EIVA 4IPGA 2Q2IA 2Z0SA 1YZ6A 2N49A 1YJ9A 1EFWA 2UUCL 2VUMH 2KHIA 4GLXA 1GO3E 1N36L 1KRTA 2ZM6L 1K8AC 2Y0SE 3D0FA 2NVQH 1LUZA 2JJQA 3I55A 2UUBL 2PQAA 2FXQA 2JE6I 1E24A 3E9IA 2HQLA 3RN2A 1VQPA 2R92G 1X3GA 4LFCL 2VS1A 3GTJH 4IOCA 1L2FA 4L5SA 4IFDJ 4A3GG 1UE5A 4C2MH 3PUXA 3RN5A 5FJ8H 3PGZA 4LF5Q 4LFBL 4DUZL 4XIGS 1PH3A 2C35B 1Q1BA 1R9TH 4DR1L 4LWCA 4MZ9A 2CFMA 2KCTA 1PA6A 1MJCA 4PMWA 1PH6A 1VQJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HH2 P;  1IXR A;  2HIV A;  2A8V A;  2ZTE A;  4P74 A;  4JI8 Q;  1N9W A;  4GNX A;  2EXD A;  3T1Y Q;  4A3L G;  3PF5 A;  1DGS A;  1Q82 C;  4QIW E;  1XPU A;  3MXN B;  2I0Q A;  3LGJ A;  1PH5 A;  1H95 A;  4LUZ A;  1XNR Q;  3L7Z C;  4OO1 G;  1VQA A;  2K5H A;  3J7A 5;  2WAQ G;  3HOZ H;  4A3C H;  1RIP A;  2NVX H;  2V1C C;  1UE1 A;  5LMU L;  5FLM H;  3HOV H;  4A93 G;  1Q7Y C;  3JAM i;  3G48 A;  4JI2 L;  2XTI A;  1CKO A;  3FHW A;  1MKH A;  4A3K G;  1KIX A;  3S1M H;  4X66 L;  4DK6 C;  4GOP A;  2NZO A;  1GM5 A;  4RG1 A;  3AQQ A;  1IBM L;  2JA7 H;  4BXX H;  4PZ6 A;  4AQY Q;  3GTP H;  2UXC Q;  1N33 Q;  1M1K C;  4HIM A;  1A0I A;  2MFI A;  3PIP A;  4HJA A;  1HR0 Q;  3H15 A;  2E5L L;  5EAY A;  5IYC H;  1K73 C;  1IBL Q;  4B3S Q;  3TS2 A;  1YBY A;  1EUJ A;  4DAY B;  4X62 L;  3PCO B;  1Y1V H;  1Y1W G;  2BH8 A;  3ULP A;  2Q2U A;  1X3F A;  4A3D G;  1HZ9 A;  4A3J H;  1VQD A;  3L0O A;  1HZA A;  2UU9 Q;  4B3T Q;  4JBK A;  2D0P A;  3J81 c;  1KC8 C;  1WCM H;  1IBK Q;  1VQN A;  2AKW B;  3U50 C;  5FJ8 G;  1VQF A;  3H0G G;  1PH4 A;  1VQ5 A;  3IRB A;  2ZJR A;  1YJN A;  4LF7 L;  1OXS C;  1TWC H;  1CUK A;  4OX9 Q;  1HNW L;  2YYZ A;  3CPF A;  1G29 1;  2YTV A;  5IT9 c;  4DR3 Q;  1XMO L;  1JMC A;  4LF6 L;  3MEF A;  4LW1 A;  1TWF H;  4JCV E;  4YCV A;  3CCE A;  5BR8 Q;  2MO0 A;  1S40 A;  2ALY B;  4R1J A;  2VQE L;  4DV7 Q;  2ASB A;  4JI1 L;  1XNQ Q;  4DUY L;  2VQF L;  1C0A A;  5C4J H;  4KHZ A;  3T1H L;  2IX0 A;  3JAM c;  4DV1 L;  4DV2 L;  2K75 A;  2MO1 A;  3FKI G;  1HNZ Q;  1TWH H;  3A5U A;  2K5N A;  2JA7 G;  4NXN L;  4QL5 A;  1JJ2 A;  1VQ7 A;  2E8G A;  2VNU D;  4PZ8 A;  1K83 H;  3UDX A;  1XJV A;  2OQ0 A;  4TVA B;  3I4N G;  4YHH Q;  4DR2 Q;  2A19 A;  4GKK L;  1D8L A;  2E2I H;  4LF8 L;  4BY7 G;  2PI2 E;  3HKS A;  4DV5 Q;  1Q46 A;  3CAM A;  1IYJ B;  3BZK A;  2K52 A;  2YV5 A;  1E22 A;  3I4O A;  4IPD A;  3F1Z A;  2BA0 A;  1U0L A;  4LF4 Q;  1EQR A;  1KD1 C;  2PMZ E;  4JI7 L;  4DR5 Q;  1S72 A;  2PI2 A;  1PVO A;  1PYS B;  1EQQ A;  3CCU A;  3PF4 A;  1OXV A;  1S3O A;  4A3F G;  2IX1 A;  1I3Q H;  5C0X G;  1HJP A;  1N32 L;  3PUW A;  2ZJP A;  3STB C;  3ULJ A;  2I5L X;  5J3B A;  1YIT A;  2MQH A;  1VQ6 A;  1NBW A;  2RHS B;  4J15 A;  1X65 A;  2NN6 G;  3K8A A;  5E7N A;  4LFA Q;  3CPW A;  1N34 L;  3S17 H;  5C44 H;  4YCU A;  4DR4 L;  1W3S A;  2R6G A;  1VQE A;  3I7F A;  2R93 H;  5LMN L;  4DR6 L;  1OXX K;  4IOA A;  4B3R Q;  4GKJ Q;  1Z9F A;  4JG2 A;  3I4M H;  3K0X A;  4X65 Q;  4A4I A;  3HOY H;  4UY8 C;  2HT1 A;  1VQG A;  1K9M C;  1JJG A;  1QVC A;  5JEA J;  4JOI C;  3ZJY C;  1CKM A;  1HZC A;  3J7Z C;  4A3E G;  1V9P A;  1QZH A;  2E2J H;  4WJ3 M;  1VQH A;  2IHF A;  1VQC A;  1JB7 A;  3I2Z A;  3PV0 A;  2HIX A;  2I5H A;  4GN3 B;  3G71 A;  3K80 C;  3HKZ G;  4DV0 L;  4LF9 Q;  4DV6 Q;  3PO3 H;  4KI0 A;  4R4T A;  4DPG A;  4HIK A;  3HFZ B;  2EQS A;  4GS3 A;  1SFO H;  5JJI A;  1OXT A;  3AFP A;  2AMC B;  3STB D;  2UUA Q;  2AWO A;  4HJ5 A;  1UE7 A;  2B3G A;  2K50 A;  4P73 A;  4X6A H;  3PIO A;  4JYA Q;  4A3I H;  4C3J H;  4JI4 Q;  1XPR A;  4BBS H;  1NTG A;  1SN8 A;  4LUO A;  4A3M H;  2KCM A;  1N36 Q;  2JA8 G;  1P8L A;  4BBR H;  2GVA A;  2K4K A;  1X54 A;  2GN5 A;  3T1Y L;  2KBN A;  4O2D A;  2Z6K C;  2UUB Q;  3M3Y H;  4EQ5 A;  1VQ4 A;  5IP9 G;  1WYD A;  3HOX G;  4Y52 H;  4YWK A;  4AYB G;  1V1Q A;  1KHI A;  2JA6 H;  3CD6 A;  1KAW A;  3DM3 A;  4BY1 G;  4LFC Q;  2IY5 B;  1YVC A;  3KYH C;  3NEM A;  1E7Z A;  5C44 G;  1LTL A;  2GVB A;  1CSQ A;  1PH2 A;  2WB1 G;  1XMQ Q;  1IZ6 A;  2ZTD A;  4RMF A;  1NMF A;  2H5X A;  1HZB A;  2CKZ B;  4IJL A;  4A75 A;  2RF4 A;  1HNX Q;  4QJF A;  4LFB Q;  3BU2 A;  4IPH A;  4BA1 I;  3PUZ A;  1MJE A;  1KRS A;  1C9O A;  1UE6 A;  3A0J A;  3PSI A;  3BJU A;  2F3I A;  4P75 A;  4IJH A;  4EX5 A;  4IFD G;  3RZD H;  1PYB A;  2EIF A;  2UXD Q;  4DV0 Q;  1VQK A;  2JEB I;  4AQY L;  5M3F H;  2UXC L;  4OON A;  1Q81 C;  2VUM G;  3GTQ H;  5GRO A;  1HR0 L;  1IBL L;  4B3S L;  5IWA L;  4JI6 Q;  2R7F A;  4JI5 L;  5IP7 H;  4K0K Q;  2UXB Q;  1PH9 A;  3RZO H;  3KF6 B;  2F52 A;  1WOC A;  2N8N A;  4DNI A;  1N8R C;  1VQB A;  1A8V A;  3CCJ A;  2UU9 L;  3M7N A;  3FP9 A;  5LMU Q;  1SRU A;  3GTG H;  4R4Q A;  3VDY A;  1M90 C;  2B63 H;  1IBK L;  4B3M L;  1CKN B;  2N78 A;  4GLA C;  4X66 Q;  2OWO A;  3E0E A;  1BVS A;  2JEA I;  4JV5 Q;  3CC2 A;  3DLL A;  4BBS G;  4IPC A;  3PUV A;  2B63 G;  3M85 A;  4O0A A;  1G51 A;  5HY6 A;  4BBR G;  4DR3 L;  4OX9 L;  4JOI A;  3RNU A;  2BA1 A;  1K3R A;  3K81 C;  3CW2 C;  5IYB H;  1ASZ A;  5IYD H;  1Q86 C;  4X62 Q;  2WAQ E;  4KHP L;  1I5F A;  4YWM A;  2MNA A;  3CP0 A;  4MTN A;  3OTO Q;  5M3M H;  3HOZ G;  1X6O A;  4A3C G;  4DV7 L;  5C3E H;  1X3E A;  4OWW B;  2Q2H A;  3A5Z B;  1XNQ L;  3M4Q A;  4P71 A;  5FLM G;  3HOV G;  1ASY A;  1NE3 A;  1NY4 A;  1EYG A;  1X9N A;  3S1R H;  4BA2 I;  5LMN W;  1HNZ L;  1FJG Q;  1JT8 A;  2R7Z H;  4OWX B;  4LF7 Q;  4DV4 Q;  5K36 G;  4JBM A;  4BXX G;  1X56 A;  1HNW Q;  1QUQ B;  4YCW A;  3L2P A;  5M3F G;  4LF6 Q;  4JI0 L;  4PG3 A;  4DR2 L;  1NMG A;  4XTC S;  1Q12 A;  3HOW H;  2Z6K A;  1X55 A;  1XTD A;  5IYC G;  4DV5 L;  1YHQ A;  3S16 H;  1I94 L;  1Y1V G;  3ER0 A;  2HHH Q;  4NPS A;  1L1O B;  4ME3 A;  4YY3 L;  4KLK A;  4YWL A;  3ULL A;  4A3J G;  2D0O A;  3J80 i;  3F2D A;  1PH7 A;  2JA9 A;  3KF6 A;  2QGQ A;  3KJP A;  1WCM G;  3CCL A;  3U4V A;  1FGU A;  2LSS A;  1AE3 A;  3CCM A;  1PV4 A;  1Y14 B;  4NXN Q;  3CF5 A;  1Q8K A;  2JK8 A;  1CKN A;  3TRZ A;  4DR7 L;  1YNX A;  3H3V I;  2AWN A;  3RLN A;  5AJ3 L;  1EIF A;  2Y0S G;  3S14 H;  1YEZ A;  5IYB G;  5IYD G;  2R92 H;  4LFA L;  3K7A H;  3U4Z A;  4X64 L;  5GAE C;  5JJL A;  3CCR A;  4A3G H;  4JI3 Q;  3GD7 A;  2QEX A;  3GTO H;  4B3R L;  1PH8 A;  2JA5 H;  3H3V H;  2F4V Q;  3HOU H;  2I5M X;  4GKJ L;  3I56 A;  1G6P A;  4X65 L;  3A74 A;  1WI5 A;  2CWP A;  3PUY A;  4DAM A;  3S24 A;  4OO1 I;  3GO5 A;  1SE8 A;  1GKH A;  5GQO A;  1D7Q A;  4A3L H;  1OTC A;  3S2H H;  1KL9 A;  1VQO A;  2LXJ A;  3W1G A;  4QGU A;  2NVY H;  1VQI A;  1UEB A;  2KHJ A;  3NEL A;  4AH6 A;  1QUQ A;  1EWI A;  4TQU S;  1J5E Q;  2BH2 A;  1J6Q A;  5LMN Q;  1KXL A;  4JBW A;  4JC0 A;  3CCS A;  3KLW A;  1XPO A;  4A93 H;  1PFS A;  3S15 H;  1E1T A;  3RLO A;  1L1O A;  4DK3 C;  3J80 c;  4LF5 L;  4NXM Q;  3UDI A;  4DV3 Q;  4HJ9 A;  3GTK H;  1Q1E A;  4JI4 L;  1BBW A;  2UUC Q;  1FVI A;  1YJW A;  1KQS A;  3KFU A;  3D31 A;  2ZM6 Q;  1VS0 A;  5IE8 A;  4JI8 L;  3KOJ A;  3B6Y A;  1V43 A;  3ICE A;  3CC7 A;  2K14 A;  5DLQ E;  3CXC A;  2DGY A;  4OWT B;  1Y1W H;  2E2H H;  5JEA G;  4GLV B;  1XNR L;  3PO2 H;  4A3D H;  4R4C A;  3KF8 B;  1SRO A;  3CCQ A;  3CC4 A;  3J81 i;  1XMQ L;  2R93 G;  1VQ8 A;  2YTY A;  1JJC B;  2JA5 G;  4Y7N H;  4A76 A;  4DUZ Q;  1HNX L;  3HOU G;  3I4M G;  2AHO B;  3H0G H;  2WP8 J;  1JE5 A;  3W1B A;  4DR1 Q;  4UPA A;  3HOY G;  2Q2T A;  1BKB A;  2UXD L;  1TWG H;  3G6E A;  2VY3 A;  1W2B A;  3GTL H;  1N33 L;  3AYH B;  5HGQ A;  2A1A A;  1VQL A;  4LUV A;  3HKZ E;  4MNO A;  1AH9 A;  3AEV A;  4HID A;  1OXU A;  4JI6 L;  4K0K L;  2UXB L;  4WJ4 A;  4QQB X;  3PO3 G;  1SMX A;  4B3M Q;  4JBJ A;  3UDG A;  3EN2 A;  5M5X H;  4B3T L;  3NEN A;  3KJO A;  4JI2 Q;  1EOV A;  4AIM A;  3FKI H;  3CME A;  1Z47 A;  4A3I G;  5H1S E;  2L15 A;  1IBM Q;  4JV5 L;  4DKA C;  5GAD C;  4A3M G;  5ELO A;  1YHB A;  3I4N H;  4C3H H;  1E1O A;  4AYB E;  1UWV A;  4L5T A;  1NJI C;  4BY7 H;  2CQO A;  2E5L Q;  5JJK A;  4IO9 A;  3UDF A;  5IWA Q;  2VZA A;  4JI5 Q;  3CMA A;  1T9H A;  3TQY A;  2OCE A;  2VW9 A;  4L5R C;  2WB1 E;  2JA6 G;  4P72 A;  3UE1 A;  5C0X I;  3PO2 G;  5BR8 L;  3OTO L;  1QZG A;  1K8G A;  4UP8 A;  4POG A;  1E3P A;  1L1O C;  1VCI A;  1PH1 A;  1GD7 A;  3F2C A;  4A3F H;  2ID0 A;  1K0R A;  1VQ9 A;  2NN6 I;  5C4X H;  4A3B H;  2OTL A;  2K5V A;  2VL6 A;  1FJG L;  1LYL A;  5GAG C;  4DV4 L;  1C7Y A;  1FL0 A;  1XMO Q;  1P16 A;  5IY0 A;  2ZTC A;  2ES2 A;  4GN4 B;  4YHH L;  1SR3 A;  2N3S A;  3KDF B;  3G4S A;  1WJJ A;  3AFQ A;  4R4O A;  4UP7 A;  4HJ8 A;  2QA4 A;  2ATW A;  4KHP Q;  4POF A;  1QVF A;  2LXK A;  1U5K A;  5IP7 G;  3OW2 A;  2HHH L;  1O7I A;  3RLF A;  2VQE Q;  2JQO A;  2CWA A;  2PNH A;  4APV A;  1GVP A;  4JI1 Q;  4LF4 L;  5C0X J;  1IL2 A;  4DUY Q;  1QVG A;  2VQF Q;  4DR5 L;  3W5O A;  1YIJ A;  3OYY A;  5GAH C;  3T1H Q;  4DV1 Q;  4DV2 Q;  4GN5 A;  2WFW A;  3EBE A;  5M5W H;  3S1N H;  2RHQ B;  2PQA B;  4C3I H;  4GNX C;  4UP9 A;  4LNQ A;  2B29 A;  1SLJ A;  3M4P A;  3WWV A;  4A3E H;  1VQM A;  3F8T A;  2NVT H;  1L0W A;  4JI0 Q;  4GKK Q;  1CSP A;  3UE0 A;  2DUD A;  1RL2 A;  2KEN A;  2R7D A;  3TS0 A;  4LF8 Q;  2OTJ A;  2ZJQ A;  3E9H A;  3S2D H;  2NZH A;  2XGT A;  3F2B A;  1I94 Q;  1A63 A;  5FLX c;  5M5Y H;  4YY3 Q;  2OQK A;  2D62 A;  3TEH B;  4JI3 L;  1AE2 A;  3CQZ H;  3M9B A;  3SGI A;  5M3M G;  1BBU A;  4JI7 Q;  4HIO A;  5C3E G;  3NBH B;  4HJ7 A;  2F4V L;  1B7Y B;  3BZC A;  3U58 A;  1EIY B;  4NB3 A;  4GOP C;  1TXY A;  4GNX B;  2YU9 H;  3S1Q H;  1YI2 A;  4L5Q A;  3ERS X;  2IHE A;  1TWA H;  5C4X G;  4A3B G;  4FDB A;  2JA8 H;  2R7Z G;  3GDE A;  1MIU A;  3Q8D A;  4OXP A;  2CCZ A;  4DR7 Q;  1N32 Q;  4R4I A;  2IT1 A;  5IP9 H;  3HOX H;  5AJ3 Q;  1WFQ A;  3HOW G;  5ELN A;  2YTX A;  1YHA A;  3CCV A;  3M4O H;  3TRE A;  4ALP A;  4LF9 L;  4BY1 H;  4DV6 L;  4IFD I;  1J5E L;  1N34 Q;  3K7U C;  4DR4 Q;  1B8A A;  4X64 Q;  3KDF A;  3JC6 6;  1I6H H;  1HR0 W;  2UUA L;  3RR5 A;  4DR6 Q;  4GOP B;  1LM0 A;  1A62 A;  4PZ7 A;  3J81 j;  1PHJ A;  2RCN A;  1B70 B;  4QY7 A;  4A3K H;  4NXM L;  4JYA L;  4DV3 L;  4H02 A;  3GTM H;  1I50 H;  3EIV A;  4IPG A;  2Q2I A;  2Z0S A;  1YZ6 A;  2N49 A;  1YJ9 A;  1EFW A;  2UUC L;  2VUM H;  2KHI A;  4GLX A;  1GO3 E;  1N36 L;  1KRT A;  2ZM6 L;  1K8A C;  2Y0S E;  3D0F A;  2NVQ H;  1LUZ A;  2JJQ A;  3I55 A;  2UUB L;  2PQA A;  2FXQ A;  2JE6 I;  1E24 A;  3E9I A;  2HQL A;  3RN2 A;  1VQP A;  2R92 G;  1X3G A;  4LFC L;  2VS1 A;  3GTJ H;  4IOC A;  1L2F A;  4L5S A;  4IFD J;  4A3G G;  1UE5 A;  4C2M H;  3PUX A;  3RN5 A;  5FJ8 H;  3PGZ A;  4LF5 Q;  4LFB L;  4DUZ L;  4XIG S;  1PH3 A;  2C35 B;  1Q1B A;  1R9T H;  4DR1 L;  4LWC A;  4MZ9 A;  2CFM A;  2KCT A;  1PA6 A;  1MJC A;  4PMW A;  1PH6 A;  1VQJ A; 
#chains in the Genus database with same CATH topology
 2A8V A;  3KBX A;  2ZDQ A;  5EKK A;  5KFR A;  5KT7 A;  4EQP A;  2Q8I B;  1U4L A;  1KNE A;  3GQC A;  4OO1 G;  3TQT A;  1VQA A;  2K5H A;  3HOZ H;  3G6V A;  1RIP A;  2E2I A;  1UNN C;  4QIW A;  5KFX A;  2V1C C;  2NBF A;  2IJ0 A;  3Q2O A;  1Q7Y C;  2PCF B;  1SND A;  5L9X A;  2QDL A;  4RCO A;  2XTI A;  4YJ2 F;  1KIX A;  3S1M H;  5C5L A;  5KT4 A;  4A3I B;  1GM5 A;  5KG5 A;  4RG1 A;  3W2D A;  1IBM L;  1S0N A;  4IRK A;  3GTP H;  1N33 Q;  4K5X A;  2NTS A;  1JWU D;  1A3V A;  2SNS A;  1I7N A;  1LT4 D;  3H15 A;  3FPU B;  2E5L L;  1IBL Q;  4ZCK A;  1C8C A;  1EUJ A;  4DAY B;  2O5I C;  2JA6 B;  2WE6 A;  1N33 H;  1Y1V H;  3AU7 A;  2DZD A;  4O3S A;  5LL6 b;  3PMF A;  4DL5 A;  1IBL H;  1HZ9 A;  1CA5 A;  4JBK A;  1G2S A;  2XD4 A;  3GIJ A;  1KC8 C;  1SJH D;  1KEE A;  3GP7 A;  2KOL A;  5KG6 A;  4J9P A;  4ME5 A;  1K3B C;  4YR0 A;  2PBZ A;  1TWC H;  3OOC A;  3DM1 A;  3CPF A;  5IT9 c;  3KLR A;  5FLX W;  1WR2 A;  5DG7 A;  4NP5 A;  1I4G A;  3CCE A;  1NUC A;  4EQN A;  2DNE A;  2FJZ A;  1KC7 A;  2ALY B;  4DL3 A;  2LS0 1;  1WTH A;  4DV7 Q;  4MV7 A;  3GID A;  1XNQ Q;  3GIK A;  1C0A A;  1EU4 A;  3SEB A;  4IUR A;  4YQW A;  2IX0 A;  3PW4 A;  1B1Z A;  4DV7 H;  1XNQ H;  1I4Q A;  1JJ2 A;  5I9P A;  3H40 A;  4RZQ A;  4O3N A;  4PZ8 A;  4JPB W;  2OQ0 A;  2A19 A;  4GKK L;  4C5A A;  4ZKC B;  2PI2 E;  2VXW A;  4U7C A;  4QW9 A;  3Q24 A;  3BZK A;  5KG0 A;  2KSW A;  4DAY A;  2JA6 A;  1ENC A;  5C3E B;  1GUO A;  2EYJ A;  4C5B A;  1TQO A;  2BQR A;  1WD1 A;  3S1R B;  5C4X B;  1I3Q H;  1SAP A;  4A3B B;  3KHG A;  4ECR A;  1K1S A;  3P7J A;  4FF3 A;  5KNC A;  2RDF A;  4TQS A;  3KHL A;  5D14 A;  1ZKO A;  3HOW B;  2KHS A;  2RHS B;  1AP0 A;  4DR7 H;  1Q90 A;  1SNC A;  2F0Q A;  2AUJ D;  3K8A A;  3MVV A;  1O80 A;  1N34 L;  3S17 H;  1K1Q A;  4MAM A;  4IR9 A;  1W3S A;  2R6G A;  2R93 H;  5EWF A;  3N43 B;  4DR6 L;  1OXX K;  4IOA A;  3DWP A;  2C00 A;  4FO2 A;  3I4M H;  1D1I A;  4X65 Q;  4A4I A;  3C46 A;  3HOY H;  4FBU A;  1VQG A;  1JJG A;  4ZI7 F;  2Z6B A;  4UCO A;  1PRT F;  2FIN B;  4X65 H;  1CKM A;  4HAE A;  2E74 C;  3RGZ A;  1R4Q B;  1VQC A;  3PV0 A;  3G71 A;  3MXU A;  4DV6 Q;  4HIK A;  3K7A B;  5M5Y B;  3AFP A;  2UUA Q;  2HGS A;  2FLP A;  4DV6 H;  5HBR B;  1UE7 A;  2K50 A;  2M2L A;  4P73 A;  5EBC A;  4Q44 A;  4C3J H;  1C3O A;  1SE2 A;  1SN8 A;  3Q22 A;  1B3Q A;  4A3M H;  1DM0 B;  3NWS A;  4DFA A;  3I91 A;  2JA8 G;  4OIK A;  2K4K A;  4N9T A;  4O2D A;  3M3Y H;  4MV4 A;  4WRD A;  2EPB A;  4U67 3;  3HOX G;  1KHI A;  1TR5 A;  5C1P A;  1CT1 D;  4J9O A;  3BVZ A;  1YVC A;  1E7Z A;  5JQW A;  4L8J A;  3P75 A;  2H5X A;  1HZB A;  4RGM A;  3N42 B;  1D2B A;  1MHW C;  1HNX Q;  4IPH A;  4BA1 I;  1MJE A;  1KRS A;  3U9T A;  3PSI A;  2CH4 A;  2HDM A;  2UXD Q;  1G6Z A;  2QK4 A;  1VQK A;  1HNX H;  1SJE D;  5EKI A;  3CRL C;  1Q81 C;  2VUM G;  1OO9 B;  1GUG A;  1BDO A;  4EYI B;  4FP5 D;  5GRO A;  2UXD H;  1KDB A;  1Q3L A;  1IBL L;  5KFC A;  1BXT A;  2UXB Q;  1U4P A;  1TS3 A;  1ZHQ A;  2H1E A;  2XRQ D;  4A3D B;  1WOC A;  4CJ1 B;  1N8R C;  1LTS D;  3V6J A;  4OGQ C;  1DON A;  4RB3 C;  1NR2 A;  2YCH A;  2UXB H;  1GJX A;  2FE3 A;  1M90 C;  4ZUI A;  2O03 A;  1VF7 A;  1CKN B;  2FK1 A;  2OWO A;  2NUA B;  4IN3 A;  5BPH A;  4C3J G;  4F88 A;  3CC2 A;  2NVQ B;  4X3K A;  1ENA A;  4R8N A;  1RDP D;  2W6N A;  3BDO A;  5KFL A;  3VYT A;  1I5F A;  5HUR A;  1RTO A;  2F4I A;  4U68 A;  5M3M H;  4XQJ A;  4DV7 L;  3I12 A;  5DAU A;  5I4D A;  1EQT A;  1XNQ L;  4P71 A;  1PTO H;  1ASY A;  3RFC A;  1NE3 A;  1DJR D;  1EYG A;  5C4H A;  3HP3 A;  4BA2 I;  2W9B B;  3NUC A;  2V4R A;  3RB6 A;  1JE4 A;  4MHE A;  4RGT A;  4LF6 Q;  2C22 A;  3I4N B;  3NGD A;  4G7O C;  3R5H A;  2Z6K A;  1XTD A;  5CBA E;  3OSO A;  4LF6 H;  3BS1 A;  4ILW A;  4PWQ A;  4ED2 A;  3RAX A;  1L1O B;  4ME3 A;  4ED0 A;  3PR5 B;  2W6Q A;  4KLK A;  4YWL A;  3ULL A;  1Y8O B;  2D0O A;  4CDD C;  1WCM G;  2A6E D;  4A3F B;  1E2Z A;  3CCL A;  3SK5 A;  2LSS A;  3U4V A;  3X3N A;  5CBE E;  3I90 A;  4O3R A;  1Y14 B;  1ZYR C;  4NXN Q;  1CKN A;  3TRZ A;  4DR7 L;  1YNX A;  4RAU C;  4NXN H;  3RLN A;  3C2P A;  3KUP A;  2A68 D;  3S14 H;  1YEZ A;  2B2Y A;  4C5C A;  2K6A A;  3JRW A;  2M05 A;  1JB3 A;  4YBZ B;  5GAE C;  3HBL A;  2SOB A;  4ZYS A;  2QEX A;  1PH8 A;  2I5M X;  1ESR A;  1G6P A;  4O42 A;  4KV6 A;  4X65 L;  3H3V C;  3N8D A;  3OMG A;  3FDS A;  4K5W A;  3S24 A;  4OO1 I;  3G8C A;  2RSO A;  1S5C D;  3BAA A;  5KFT A;  1D7Q A;  3V05 A;  4A3E B;  2AGP A;  2W9B A;  3NQT A;  3NQI A;  1U9R A;  2PN1 A;  3HKZ B;  1UEB A;  2I46 A;  4H13 C;  3S2D B;  1SMY D;  1HFN A;  1E0B A;  3OMC A;  3D6W A;  1AUX A;  1MSH A;  3CQZ B;  2E76 C;  4A93 H;  3CCS A;  3HRZ C;  1E1T A;  4DK3 C;  1L1O A;  4R7R A;  3UDI A;  4J9M A;  4HJ9 A;  1D5M C;  5KG4 A;  2Z8L A;  2IMW P;  1LTR D;  3VR6 A;  3KFU A;  1CQI B;  4JI8 L;  3KOJ A;  1V43 A;  5KX5 F;  3N41 B;  1EEF D;  4JV2 A;  5JEA G;  2JEG A;  4GLV B;  5KFZ A;  1B53 A;  5L1J A;  3OWF A;  2K7V A;  1X3Q A;  2WII B;  1HNX L;  3MZ5 A;  3CVZ A;  2XSC A;  3H0G H;  1JE5 A;  5HGT A;  4UPA A;  5EPL A;  1KTK A;  2QYZ A;  4FU0 A;  4UCU A;  1BKB A;  1FNV A;  2UXD L;  2ZT9 C;  5A2Q E;  3GTL H;  2BOS A;  2Q8T A;  4UCT A;  1HRJ A;  4LUV A;  2XCL A;  3DEP A;  1NCV A;  2DNC A;  3AEV A;  2R7M A;  2D9U A;  2UXB L;  1PTO F;  4WJ4 A;  4TSS A;  3PO3 G;  2FHT A;  5KFA A;  4B3M Q;  3UDG A;  3HKZ A;  1H9M A;  4B3T L;  3KJO A;  3MXG A;  1I4R A;  4B3M H;  1A3U A;  2L12 A;  2EDG A;  1R9T B;  2VB2 X;  3L9A X;  5KRU A;  3CQZ A;  5H1S E;  4DNT B;  5LMU H;  1VKZ A;  1CZG A;  4RB1 A;  4BBR B;  2K5D A;  4C3H H;  1IL8 A;  4BY7 H;  3LWE A;  3PW0 A;  4OHJ A;  3UDF A;  2W9C B;  2VZA A;  4JI5 Q;  5JH7 F;  2EJG C;  4L5R C;  4GZY C;  2OCE A;  3T16 A;  5JVG 3;  4F4Z A;  3BYT B;  1JQY D;  4Q5V A;  4JI5 H;  3HG9 A;  2XCP A;  4EG0 A;  1L1O C;  5IIF A;  5C8Y F;  2FKL A;  2HJW A;  1STA A;  1PH1 A;  2R86 A;  3R2T A;  4FS2 A;  1K0R A;  1JIC A;  2B8F A;  1F2L A;  2K5V A;  2VL6 A;  5G3L F;  2UVV A;  5M3F B;  1FL0 A;  1P16 A;  4BWS C;  2ZTC A;  4X3T A;  4YHH L;  1SR3 A;  5C3W A;  4HJ8 A;  1QNK A;  3AFQ A;  2QA4 A;  2ATW A;  4KHP Q;  3TSS A;  4POF A;  4HCS A;  2IX3 A;  1A2U A;  5IP7 G;  1QVF A;  5JVD F;  1ET9 A;  4KHP H;  3K3V A;  2VQF Q;  4FNF A;  1STB A;  1PFN A;  4JV0 A;  4DV1 Q;  4DV2 Q;  4RGN A;  1HTP A;  3M9M B;  2FPG B;  2VQF H;  3IAY A;  4UP9 A;  3IKJ A;  3M4I A;  4FF4 A;  3WNZ A;  2B29 A;  3M4P A;  4DV1 H;  4DV2 H;  2F03 A;  1R9T A;  4FXD A;  3VPC A;  1AN8 A;  3MEH A;  2FK3 A;  3UE0 A;  2KEN A;  2OTJ A;  3TS0 A;  1NSN S;  2ZJQ A;  3SK6 A;  4ZRZ A;  2XGQ A;  1S9F A;  4LAA A;  5KFU A;  3J80 W;  2R8K A;  4CKE A;  2W9C A;  3M9B A;  1BBU A;  1QB5 D;  5ELC A;  1B7Y B;  5C4J B;  1EIY B;  2FFK B;  5FLX L;  4L5Q A;  5DNF A;  2IHE A;  4JW0 A;  1TWH B;  3K59 A;  1BF4 A;  1O7Z A;  5BN5 A;  3K58 A;  3JRX A;  2R6F A;  3A7L A;  4LMY A;  4J9R A;  4OL7 A;  1QOH A;  5IP9 H;  1WTW A;  1YHA A;  1HQM C;  3TRE A;  4ALP A;  4LF9 L;  4BY1 H;  2HVQ A;  5KND A;  2QW7 A;  4DR4 Q;  4XYQ A;  1I6H H;  2RKS A;  4GOP B;  1A62 A;  4PZ7 A;  1ZHS A;  4DR4 H;  3QOJ A;  5KG1 A;  2KEC A;  2RDH A;  5DM7 3;  4JYA L;  1I50 H;  1PZK D;  1EQV A;  1SEB D;  1EFW A;  1YZ6 A;  4V19 0;  4QMG A;  3F8N A;  1CE8 A;  2UUB L;  4K5V A;  1ML0 D;  2JE6 I;  5JPN C;  3KLS A;  3RN2 A;  3NWT A;  1VQP A;  1TA8 A;  1S5B D;  1X3G A;  4LFC L;  2L9H A;  3HZX A;  4A3G G;  4TV9 F;  4J6H A;  3G6J B;  1TT2 A;  3PGZ A;  5FJ8 H;  4LF5 Q;  4XIG S;  4HSP A;  4LWC A;  1WTX A;  4EBE A;  1DZ1 A;  3RJ0 A;  1VQJ A;  1HH2 P;  2ZXP A;  1TU2 B;  2J4X A;  3KK7 A;  4QUC A;  4DV0 L;  2B63 H;  2UVU A;  2KCN A;  3T1Y Q;  2AQ2 B;  1Q82 C;  2XWJ B;  1TWH A;  4EFB A;  3LGJ A;  2CW7 A;  4LUZ A;  1KAB A;  3T1Y H;  1XNR Q;  4KKU A;  3V4S A;  1SFO B;  2NVX H;  3K6O A;  1UE1 A;  5LMU L;  3HOV H;  4HR7 B;  1XNR H;  3GIP A;  3S15 B;  3GIQ A;  3G48 A;  4CDE C;  1MKH A;  4X66 L;  4GOP A;  3FEW X;  2JA7 H;  5K36 H;  4BXX H;  4AQY Q;  1M1K C;  1K28 A;  2IBK A;  2MFI A;  1GSH A;  3RAQ A;  3OUU A;  4HJA A;  4L63 B;  5I47 A;  2QEJ C;  5EAY A;  5IYC H;  1K73 C;  3N44 B;  4AQY H;  2FP4 B;  5JAV A;  1Y1W G;  3PO2 B;  3PW5 A;  1PFB A;  1RKN A;  1X3F A;  1F77 A;  5D3D A;  4A3J H;  5IWA H;  1VQD A;  3L0O A;  1HZA A;  2D0P A;  2R8G A;  2DPJ A;  2VPQ A;  3U50 C;  5FJ8 G;  5EGT A;  3VYS A;  2FPI B;  1ESF A;  2P5Z X;  4XXE A;  1PH4 A;  4RHS A;  2CQY A;  5FLX E;  1OXS C;  1R4P B;  2W9A A;  4OX9 Q;  1HNW L;  1JMC A;  1G29 1;  4K8J A;  3GTQ B;  2B2W C;  2YS7 A;  3RBD A;  3MEF A;  1CK1 A;  2V5A A;  1W93 A;  3Q8S B;  4DL7 A;  4OX9 H;  1TWF H;  2KA7 A;  5BR8 Q;  5CA1 F;  1A15 A;  2MO0 A;  2ASB A;  4R1J A;  4RUA A;  2EVB A;  4DA2 A;  3GTG B;  2VQF L;  2ATL A;  2W8K A;  2OEO A;  4HQ6 A;  1BNC A;  1SFO A;  5KFD A;  4YB8 B;  4DV1 L;  4DV2 L;  2K75 A;  3FKI G;  5KIX A;  1D5Z C;  1F2M A;  2K5N A;  2JA7 G;  4HR7 A;  4QL5 A;  2VNU D;  1KNA A;  5CGK A;  2Q8R E;  4TVA B;  1PMR A;  2MHV A;  4QWE A;  4EBC A;  2E2I H;  1CQF A;  3UFX B;  5ISR A;  3CAM A;  1IYJ B;  2K52 A;  4IPD A;  2J9G A;  5CAE B;  3A56 A;  2R7K A;  2FMC A;  4LF4 Q;  1EQR A;  1KD1 C;  2PMZ E;  1S72 A;  2PI2 A;  1AW7 A;  3V96 A;  1HPC A;  5JOB A;  3TIN A;  1HXY D;  3PF4 A;  1OXV A;  1E2W A;  3Q8P B;  2EYH A;  1HCZ A;  5BN3 A;  1Y8N B;  4F87 A;  2R7Z B;  4EBD A;  1K0S A;  1HJP A;  1ZEQ X;  2SCU B;  2I5L X;  3W3A A;  1CI3 M;  3U9O A;  1VQ6 A;  1NBW A;  2PZW A;  1WTP A;  1ICF B;  5E7N A;  4LFA Q;  3CPW A;  3S16 B;  4DLK A;  3GTQ A;  4C1N K;  4DR4 L;  1MD2 D;  1VQE A;  2F0M A;  4LFA H;  4K14 A;  2DPI A;  3K0X A;  2JSO A;  2ASD A;  4QB4 A;  1F9S A;  3MR5 A;  3GTG A;  5JEA J;  3H91 A;  3J7Z C;  5FKA C;  2L0C A;  1QZH A;  2UVW A;  1S68 A;  2HIX A;  2R92 B;  3G6X A;  2JEJ A;  2J7Z A;  3HFZ B;  2EQS A;  1K8M A;  2F3V A;  3IFD A;  1CHP D;  1OXT A;  4GS3 A;  2AMC B;  4B08 A;  2FMA A;  1A2T A;  3RIZ A;  4HJ5 A;  1Z6H A;  5KG7 A;  1T5E A;  3T4A C;  1O75 A;  5L1L A;  2VOB A;  2ICE C;  4CC5 A;  4A3I H;  4JI4 Q;  1XPR A;  5FO7 B;  4BBS H;  3K0Y A;  2PZT A;  4DGZ A;  1PXU A;  2R3Z A;  1N36 Q;  4CKB A;  3M9O B;  2GN5 A;  3T1Y L;  2KBN A;  4JI4 H;  4EQ5 A;  2YRW A;  3RV4 A;  3DEO A;  2R7Z A;  1WYD A;  4OIJ A;  4YWK A;  5D8D A;  3OW7 A;  2JA6 H;  4KKS A;  3CD6 A;  3J81 W;  1KAW A;  3IFT A;  1GSA A;  1FKA H;  4WOR A;  2GVB A;  1CSQ A;  2WB1 G;  1XMQ Q;  1BBX C;  4RMF A;  3RB4 A;  4IJL A;  2W7O A;  4ODG A;  1CZW A;  4YR2 A;  1HUN A;  3QFF A;  1XMQ H;  1UE6 A;  4KD3 A;  4ECW A;  2EYM A;  3A0J A;  3BJU A;  4P75 A;  2K04 A;  1PYB A;  1KJJ A;  1EYA A;  2JEB I;  4AQY L;  4J9S A;  1EZ6 A;  1VMP A;  5IWA L;  2R7F A;  3C0F B;  2E2H B;  2AQ3 B;  1PH9 A;  3D4W A;  3TP5 A;  4DXF A;  2X69 A;  2VQD A;  4MV1 A;  1A8V A;  5CV8 A;  3M7N A;  2R92 A;  5T14 A;  1SRU A;  2HUG A;  5BN4 A;  3VDY A;  2K32 A;  4Y7N B;  1EOT A;  2V59 A;  5CV6 A;  3T51 B;  4Q8F A;  2N78 A;  3S9W A;  4EVO A;  2JEA I;  4HN7 A;  1Z2N X;  4BBS G;  1TWG B;  3RF2 A;  3VPD A;  1B04 A;  4OX9 L;  3BG3 A;  1K3R A;  5F2D A;  5IYD H;  1ASZ A;  4X62 Q;  4EEQ A;  4YWM A;  3TDQ A;  1A9X A;  3CP0 A;  3HOZ G;  1X6O A;  5M5X B;  4X62 H;  2PO4 A;  5C3E H;  1X3E A;  2Q2H A;  2BDO A;  3NTI A;  3K5M A;  1NY4 A;  1H9R A;  1TII D;  1B9N A;  3S1R H;  3S1M B;  2WDT A;  2MPM A;  1CQV A;  1JT8 A;  1XX8 A;  4OWX B;  4LF7 Q;  5C6A A;  3QB3 A;  1RYS A;  1PYW D;  4O3Q A;  4KY5 A;  3LP8 A;  5DQG A;  4ZLT F;  1SYC A;  3HOW H;  4LF7 H;  4XTC S;  3V6H A;  2F0V A;  3R23 A;  1Y1V G;  3ER0 A;  5J22 A;  2O5J C;  1BGW A;  2E2H A;  1V4Y A;  2JA9 A;  1N56 A;  2QGQ A;  3D3R A;  1FGU A;  1M0T A;  1AE3 A;  4IQZ A;  1IYU A;  3JZI A;  5EKL A;  1AEX A;  2F0I A;  1I6V C;  3CF5 A;  3WO1 A;  1Q8K A;  5L1K A;  3DWA A;  2AWN A;  4JV1 A;  2ZDG A;  5AJ3 L;  1H9J A;  1TWG A;  2KQ3 A;  3VMM A;  5KFF A;  5IYD G;  4PV1 C;  3HGB A;  4LFA L;  3KXY T;  3K7A H;  2J6U A;  1D5X C;  2JYO A;  3BZD B;  4X64 L;  2ZJT A;  4MV3 A;  3DF7 A;  4M1U B;  4ZOL F;  4TKO B;  2EYL A;  2RA4 A;  3GTO H;  3H3V H;  2F4V Q;  3HOU H;  3IG0 A;  4HMJ A;  4ECX A;  2C5C A;  2V58 A;  3ONA B;  4H0L C;  2XC9 A;  1G2T A;  3PUY A;  2B2U C;  3P20 A;  3S1N B;  2F4V H;  3GO5 A;  5DM6 3;  1SE8 A;  4A3L H;  2A74 C;  3W1G A;  4AH6 A;  2RGR A;  3FMC A;  4HSV A;  3SXH A;  2YZG A;  2BH2 A;  3QJY A;  3MWE A;  5LMN Q;  1UC8 A;  2VA2 A;  3VA7 A;  4KD4 A;  3RLO A;  3BDL A;  2UUA H;  2KUM A;  2H4O A;  1RHP A;  1EY6 A;  4DV3 Q;  3TZU A;  2YU9 B;  4QWA A;  3E3X A;  1Q1E A;  4JI4 L;  1I3Q B;  1TWA B;  1W96 A;  4ABN A;  3A55 A;  2JA8 B;  3L4K A;  5KT3 A;  4DV3 H;  3TP6 A;  3J80 L;  1ZET A;  4CDC C;  3HOX B;  3CC7 A;  3OSN A;  5J39 A;  3M4O B;  4OWT B;  3KAJ A;  5JVL A;  2WKD A;  4A3D H;  4R4C A;  3KF8 B;  2ASJ A;  3CC4 A;  3JSN A;  3J81 i;  1IW7 C;  1XMQ L;  2R93 G;  1JIH A;  1AZQ A;  1F9R A;  3HOU G;  2NU8 B;  3I4M G;  3FRP B;  3MHB A;  1JOR A;  4QWB A;  3W1B A;  3LWU A;  3HOY G;  3GTM B;  4F4X A;  2KJX A;  4IUN A;  2VY3 A;  2QCP X;  1W2B A;  1RTN A;  1N33 L;  2VUM B;  4QW8 A;  3AYH B;  2A1A A;  4MNO A;  2R8H A;  5IGD A;  5ELD A;  1JX4 A;  3R8B A;  1GUW A;  4QQB X;  1F2Z A;  2MP1 A;  5CC4 A;  2VR1 A;  1SMX A;  1PRT C;  3NTH A;  4XZ3 B;  3EN2 A;  5DG9 A;  1MI2 A;  3EYY A;  1GOZ A;  5BMV F;  4O2B F;  2E2D C;  1EOV A;  2QIL A;  1AZP A;  2DJF C;  4C3J B;  5KFQ A;  1LTI D;  1ICW A;  4A3M G;  3RUZ A;  1S0O A;  5ELO A;  1YHB A;  3I4N H;  1LLR D;  3J7A K;  2YU9 A;  2C28 A;  5IGC A;  1SE4 A;  1UWV A;  5K5P A;  1I3Q A;  1TWA A;  2CQO A;  3EJI A;  5JJK A;  4IO9 A;  4UFZ A;  1FNW A;  2WB1 E;  3KBG A;  2LMC B;  2XN9 C;  2X6G A;  3N40 P;  3QOL A;  4MTD A;  2K05 A;  5H80 A;  1QZG A;  1JC7 A;  1SNM A;  1JWS D;  4POG A;  1E3P A;  1VCI A;  1HHV A;  1KJI A;  3KF8 A;  4LF5 H;  3V4Z A;  4A3F H;  5CV4 A;  2F0U A;  2F0S A;  4M8A A;  2OTL A;  1PRT D;  3FVQ A;  1LYL A;  5GAG C;  1C7Y A;  4ZHQ F;  1IYV A;  1IKM A;  1X3P A;  3GTM A;  2ES2 A;  1ZQ7 A;  2JP1 A;  2NN6 H;  3TZD A;  2VUM A;  1B6S A;  4E4T A;  1EYD A;  3OW2 A;  3H94 A;  3J7A V;  4PQX A;  2CWA A;  2F1M A;  2JQO A;  2PNH A;  3OIQ A;  1ILQ A;  4JI1 Q;  3VPB A;  2NWG A;  4DUY Q;  3RD4 A;  2HDL A;  1WCM B;  1YIJ A;  1DOK A;  3OYY A;  2AQ1 B;  3T1H Q;  2WFW A;  4JI1 H;  2TMP A;  2O2L D;  4DUY H;  4C3I H;  5CR3 A;  4GNX C;  2YYA A;  2EYF A;  1VQM A;  5CV9 A;  5C5M A;  5DEH A;  4A3E H;  3T1H H;  4JI0 Q;  4M9U A;  3KAK A;  3SK8 A;  3J80 E;  3E9H A;  3S2D H;  2NZH A;  2XGT A;  3F2B A;  1I94 Q;  1JDB B;  5FLX c;  2EXZ A;  2WKC A;  2N88 A;  4YY3 Q;  2OQK A;  5M3M G;  3CQZ H;  4JI7 Q;  2F4V L;  4C1N I;  1I94 H;  2NU7 B;  5DLG A;  3U58 A;  1PTO B;  4YY3 H;  1TXY A;  4FXG C;  1WTV A;  3ERS X;  1SNP A;  4JI7 H;  1CA6 A;  1MIU A;  2CCZ A;  1N32 Q;  1CQJ B;  1K83 B;  4R4I A;  4O1N A;  2IT1 A;  3OWE B;  3KLS X;  1H9S B;  1WFQ A;  5CA0 F;  5ELN A;  3GV7 B;  1N32 H;  1ZYR D;  4DV6 L;  4E6I A;  3ND8 A;  4KKT A;  4HYK A;  5COY A;  2UUA L;  1LV9 A;  2RGV A;  5LOV F;  4FBT A;  3FMA A;  3UQ8 A;  3J81 j;  4IHJ F;  3ND9 A;  4A3K H;  1TY2 A;  1L2Z A;  3A8I E;  4DV3 L;  4KJN A;  4H02 A;  2RQX A;  5DQI A;  5FO9 B;  1WCM A;  4C3I G;  1K8A C;  4NW2 A;  1KRT A;  4ZAI A;  5EPJ A;  4CKC A;  2C2E A;  2JJQ A;  1O78 A;  1EFI D;  2FXQ A;  1E24 A;  3S14 B;  2HQL A;  4PNY A;  3VR5 A;  3T5L A;  4EGV A;  3J7A F;  1PFM A;  1SXT A;  1V1P B;  2D2C C;  4IOC A;  1L2F A;  1MGS A;  4IUV A;  1UE5 A;  5D3I B;  5DGA A;  3RN5 A;  2OLS A;  1PX2 A;  4RU9 A;  1R9T H;  4PDB A;  2CFM A;  1PA6 A;  4V0B A;  3P1H A;  1PHJ A;  4Q0Y A;  4ECV A;  1RJQ A;  2HIV A;  2ZTE A;  4P74 A;  3ORQ A;  2EXD A;  4CJ2 C;  3I72 A;  2E2J B;  2FPP B;  1L0Y B;  3E5N A;  1XPU A;  1PH5 A;  2MGS A;  1EWH A;  3K5N A;  2CW8 A;  3ETH A;  3ORR A;  3PO3 B;  3L7Z C;  3H4D A;  1Q8I A;  4KN7 C;  2F0G A;  1K83 A;  3J7A 5;  2WAQ G;  4A3C H;  1H9S A;  3H4B A;  4ECZ A;  4CBV A;  3BVM A;  5FLM H;  2ZDH A;  4A93 G;  2BE5 C;  1HUM A;  1E4G T;  3PW2 A;  1CKO A;  1JR0 D;  3FHW A;  4A3K G;  2W6P A;  1MBY A;  4DK6 C;  3G6Y A;  3AQQ A;  2L55 A;  2RCF A;  2CZG A;  4HIM A;  3SE0 A;  3PIP A;  1QNU A;  5KFI A;  2ENB A;  2YZM A;  2PYK A;  5IGE A;  3MFI A;  2L5T A;  3NBI A;  4B3S Q;  4F4W A;  5KKN B;  2PQE A;  1YBY A;  5DG8 A;  3PCO B;  1TS4 A;  3VR2 A;  2Q2U A;  5CMD A;  5IGB A;  4B3S H;  5JPM C;  1D1K A;  3C1F A;  2AU0 A;  3D4D A;  1WVL A;  1SE3 A;  1V1P A;  1VQN A;  4HNV A;  2PMZ B;  1VQF A;  3H0G G;  1B44 D;  3NE5 B;  1I6U A;  1SNQ A;  4X3S A;  5C0X H;  1VQ5 A;  2EJM A;  3RZD B;  1YJN A;  1L0X B;  2F0W A;  1EWC A;  3J81 L;  1RJR A;  3T56 B;  4MA0 A;  2YYZ A;  1ET6 A;  2YTV A;  5JJZ A;  4LF6 L;  5EWG A;  4XYL B;  4HCE A;  4JCV E;  3RZO B;  1J9O A;  1DYQ A;  4IZO A;  4YCV A;  1S40 A;  4JI1 L;  5FO8 B;  3T13 A;  4DUY L;  3I70 A;  5C4J H;  5KFW A;  3GV5 B;  2AGO A;  3T1H L;  3SK4 A;  4DNR B;  1PTO C;  1TWH H;  2OF1 A;  5KFY A;  4NXN L;  2E8G A;  2LY7 A;  4XT1 B;  1KDC A;  1XJV A;  4C3H G;  5KYI A;  4DR2 Q;  2A73 B;  3JAM L;  4XQQ A;  4BY7 G;  1IHZ A;  3HKS A;  5LL6 S;  2UVR A;  2DWC A;  4MV9 A;  2YW2 A;  1Q46 A;  1AUV A;  2QDB A;  4J9N A;  3I4O A;  2YV5 A;  1E22 A;  4DR2 H;  4XYO A;  3F1Z A;  1EL0 A;  4EGJ A;  5M9O A;  5F9L A;  1EUC B;  3D6C A;  1F9P A;  4JI7 L;  4DR5 Q;  1EUD B;  1HQR D;  1PYS B;  1EQQ A;  4G7H C;  2JXM B;  2F0T A;  1EZ1 A;  4DR5 H;  3L4J A;  5C0X G;  2V4Q A;  3V2T A;  1SYX B;  2PMZ A;  1N32 L;  3PUW A;  3ULJ A;  5KFM A;  4DL6 A;  5E3F A;  1SNO A;  2MQH A;  4ETS A;  1PTO D;  4J15 A;  4ECU A;  4K2L A;  5IGF A;  5C44 H;  1WTO A;  2VUG A;  1EHI A;  1GUS A;  1KLG D;  3FDT A;  2OXP A;  3R2I A;  4RWS C;  3WOE A;  4B3R Q;  3VA5 A;  2PW5 A;  3WOF A;  4GKJ Q;  4RNO A;  1Z9F A;  1DV2 A;  1HFG A;  5KNB A;  4G3I A;  5KT2 A;  3I8Z A;  1M6V A;  3GV8 B;  4UY8 C;  2HT1 A;  4B3R H;  1K9M C;  4GKJ H;  4LH7 A;  4KMU C;  1QVC A;  3R5X A;  5EPK A;  4RKB A;  4JOI C;  3N6X A;  3A54 A;  2AUK A;  1V9P A;  2PPB C;  1VQH A;  2IHF A;  1CHQ D;  2B2W A;  3VR3 A;  1JB7 A;  4GN3 B;  4BS9 A;  3K80 C;  1XDN A;  1BCP F;  4KI0 A;  5JJI A;  4N8X 1;  4XT3 B;  2B2V A;  1H9K A;  1SFO H;  4ZUJ A;  5KFN A;  4A3G B;  4YAK B;  2JA5 B;  2B3G A;  2CW0 C;  3OSP A;  3BQ0 A;  3K57 A;  4YIJ A;  1C4Q A;  5G3L D;  3MJF A;  4RB0 A;  4MN3 A;  2W6Z A;  4Q45 A;  2BQU A;  1P8L A;  3SR1 A;  1VAJ A;  3QZ7 A;  2GVA A;  2WAC A;  3BVG A;  3S2H B;  2M9V A;  4FF1 A;  4MIU A;  3J81 E;  1LT6 D;  4IAL A;  5IP9 G;  2NVY B;  4FS1 A;  4AYB G;  2R61 A;  1FYC A;  1RJP A;  1B33 N;  3MWD A;  2FLL A;  3DM3 A;  3H09 A;  4BY1 G;  3KYH C;  3NEM A;  5C44 G;  1PH2 A;  4B3M L;  2IA6 A;  1IZ6 A;  2NZ1 D;  4A75 A;  2CKZ B;  3G7L A;  2RF4 A;  4R9W A;  1XWE A;  4LFB Q;  1KAA A;  2CH4 W;  3BU2 A;  4RZR A;  4K6L A;  1C9O A;  5IT9 W;  3GTK B;  2W70 A;  1S10 A;  1HA5 A;  1I50 B;  4IJH A;  1RYR A;  2JEF A;  4LFB H;  4IUT A;  5E4W C;  4OON A;  2CW0 D;  3GTQ H;  1A3T A;  1G8Z D;  4B3S L;  5KFK A;  4RH6 A;  4JI5 L;  4JI6 Q;  4K0K Q;  3NPP A;  3OUZ A;  1Y1W B;  3JAM E;  1PLF A;  3KF6 B;  3MFH A;  4DNI A;  4JI6 H;  1CTM A;  3CCJ A;  3URY A;  2GPS A;  4K0K H;  3GTG H;  4R4Q A;  4JK1 C;  1NR4 A;  1WTR A;  3BA8 A;  3ETJ A;  3PVX A;  5LL6 X;  1VMC A;  2HD3 A;  1BCP C;  4LSA A;  1BVS A;  1J8I A;  2X0S A;  3MR6 A;  2JA5 A;  3PQI A;  3DLL A;  1OWT A;  4IPC A;  4ZQ3 A;  2J6T A;  2B63 G;  2EYP A;  4O0A A;  1G51 A;  5IGG A;  4DL4 A;  4CJ0 B;  3MWM A;  3RNU A;  2BA1 A;  5EZY F;  3QG1 A;  2CVR A;  2JN4 A;  1RK6 A;  5F9N A;  5IYB H;  1Q86 C;  3I4L A;  2WAQ E;  4KHP L;  4Q0F A;  2B2V C;  5EBD A;  2EYO A;  5KFH A;  2SNM A;  4WFN 3;  5CV5 A;  2NVY A;  1YNJ C;  4FYD A;  4OWW B;  2FB9 A;  3A5Z B;  3HOV G;  2PVP A;  2IL8 A;  3CRK C;  1X9N A;  5BR8 H;  3FKI B;  3RMH A;  2EZV A;  5LMN W;  1FJG Q;  2JA7 B;  2R7Z H;  3PW7 A;  1LTA D;  4DV4 Q;  5K36 G;  1S5D D;  4BXX G;  1QUQ B;  3L2P A;  4EYH B;  4IUP A;  2W71 A;  3GTK A;  4PG3 A;  2A6H C;  1FJG H;  1I50 A;  2L11 A;  4DR2 L;  4DV4 H;  1Q12 A;  2F0H A;  3QO2 A;  5IYC G;  1YHQ A;  3S16 H;  5JVH 3;  4NPS A;  5FPR A;  4PMC A;  4J9Q A;  2D5D A;  1E4F T;  3BYY B;  5E1F A;  2VPS A;  1F2Y A;  4A3J G;  1STY A;  4IZ8 A;  1Y1W A;  3J80 i;  4I7A A;  3KF6 A;  3V6K A;  3KJP A;  1S4Z A;  1QIL A;  4YP3 A;  3HS0 C;  2XVS A;  4DAP A;  4H7B A;  3WDN A;  2XCA A;  4LF4 H;  3CCM A;  4LH6 A;  4Z9C B;  2W57 A;  4UCR A;  5ELB A;  1QWY A;  1KDA A;  1KJ8 A;  3M9N B;  2AQ4 A;  1RJT A;  3QZ8 A;  1EIF A;  2Y0S G;  1SYF A;  5IYB G;  2R92 H;  3I73 A;  2B2T A;  3SE7 A;  1TWF B;  3U4Z A;  5DQH A;  4WJW A;  1SBB B;  3GV3 A;  5EJW A;  4B9X A;  5JJL A;  3GV6 A;  4B3R L;  1GUT A;  1TVX A;  4GKJ L;  5FOB B;  3N52 A;  2X6L A;  1WI5 A;  1BR9 A;  3NTK A;  5M5W B;  5DLF A;  4I50 F;  1JOO A;  1LAB A;  2NVT B;  3FKI A;  3MFY A;  1KL9 A;  1VQO A;  2JA7 A;  4QGU A;  4N8F A;  1TKW B;  2F0E A;  3EQL C;  1QUQ A;  4OO1 H;  4TQU S;  4KHV A;  2R84 A;  2GPW A;  3HXL A;  1B3A A;  1HTL D;  4NLG A;  4H44 C;  3KLW A;  5LP6 F;  4UDU C;  4LF5 L;  1RK5 A;  3J80 c;  5D1O B;  1GHK A;  1Y8P B;  2F0O A;  1I4P A;  4HMI A;  2F0F A;  3S1Q B;  4IRC A;  4PMB A;  2UUC Q;  3A8K E;  1SYD A;  2J0T D;  3MWY W;  2DIK A;  1VS0 A;  1DOM A;  1JWM D;  3CU7 A;  3B6Y A;  5C1O A;  2UUC H;  1F9Q A;  1KLU D;  2K14 A;  5A35 A;  1N36 H;  2E2H H;  2AGQ A;  1XNR L;  4QWD A;  2RDG A;  3CCQ A;  1SRO A;  1PDQ A;  2WB1 B;  4G7Z C;  5KFS A;  1LTG D;  4DK0 A;  1JJC B;  1TWF A;  4Y7N H;  4A76 A;  4DUZ Q;  3GLK A;  1LTT D;  2AHO B;  3TBI B;  1EEI D;  1TS2 A;  4EFE A;  1I4H A;  2ZXR A;  1N48 A;  3F2U A;  1TWG H;  3G6E A;  4DUZ H;  5KFO A;  3SHL A;  5HGQ A;  1AN7 A;  4C56 C;  4UAI A;  1AH9 A;  3TQ1 A;  2B2T C;  2W7P A;  5CYU A;  1OXU A;  4HID A;  4JI6 L;  4K0K L;  5IYZ F;  5KFV A;  1NNX A;  1Z7T A;  4JBJ A;  3GTJ B;  5M5X H;  3JAM W;  2R7L A;  1ENF A;  1S5F D;  4RAZ A;  4C2M B;  3VYR A;  1C30 A;  3NEN A;  4JI2 Q;  3ERO A;  3MA2 B;  1I7L A;  1GLV A;  1Z47 A;  4A3I G;  1JCK B;  4BBS B;  4QF4 A;  3MTS A;  3TP8 A;  4DKA C;  2B2U A;  5GAD C;  1IOW A;  4DU9 A;  4JI2 H;  1I4X A;  5D1O A;  4RCN A;  1E1O A;  1II3 A;  4AYB E;  4UCS A;  5CV7 A;  1S5E D;  3TQY A;  1PRT B;  2JA6 G;  3MFG A;  2MCT A;  2Z1C A;  5C0X I;  3HOZ B;  4FM9 A;  1SYB A;  5BR8 L;  1K8G A;  2V4D A;  3AB9 A;  2WTF A;  5I2X A;  1G91 A;  2EJF C;  3F2C A;  2WB1 A;  2ID0 A;  5E4X A;  2GA4 B;  5C4X H;  4A3B H;  2TSS A;  3GQB A;  1FJG L;  4MV8 A;  4DV4 L;  1FR3 A;  3GTP B;  1UC9 A;  3RUP A;  2M00 A;  1QE6 A;  4XDX A;  1XMO Q;  1EIG A;  5IY0 A;  4TRD A;  3G4S A;  2N3S A;  3TII A;  2EY1 A;  1WJJ A;  4R4O A;  3MXP A;  5D1P A;  1XMO H;  3OPO A;  1Y1V B;  2K03 A;  4X3U A;  2L4N A;  2VQE Q;  4LF4 L;  3E5S A;  5C0X J;  3H6M A;  1QVG A;  3IN5 A;  3W5O A;  1EYC A;  1QJO A;  3PIO 3;  3GTJ A;  4NMZ A;  2VQE H;  1FD7 D;  2LKV A;  4APM A;  3S1N H;  3H20 A;  4C2M A;  1LT5 D;  3T5K A;  1TWC B;  2WIN B;  5COR A;  1CSP A;  1GSO A;  2DUD A;  4LF8 Q;  1A63 A;  1C48 A;  1Z2P X;  5M5Y H;  1JXL A;  5HV6 A;  4CDF C;  2P0A A;  5KFB A;  3OHA A;  4LF8 H;  2D62 A;  2EE1 A;  4HIO A;  5C3E G;  3NBH B;  1XYI A;  3BZC A;  2BQ3 A;  1UAP A;  1SYE A;  4NB3 A;  2YU9 H;  4GNX B;  5I6Y A;  1YI2 A;  1TWA H;  5C4X G;  2A5H A;  4A3B G;  4FDB A;  5C3X A;  4I55 F;  2JA8 H;  4CC6 A;  3NK9 A;  3Q8D A;  4OXP A;  4DR7 Q;  2EY2 A;  3EPI A;  1LO5 D;  3PIP 3;  2EOT A;  2K1B A;  3K5I A;  1DD2 A;  5J2T F;  3HOX H;  4QWC A;  3OHB A;  4J9K A;  3HOW G;  2YTX A;  3M4O H;  3GTP A;  3O13 A;  3K7U C;  2LFN A;  3JC6 6;  4YJ3 F;  5BPF A;  4ED1 A;  4L6T B;  3RR5 A;  1V8Q A;  1Y1V A;  2R87 A;  3WO0 A;  1B70 B;  4QY7 A;  1JOQ A;  5LMN H;  3GTM H;  5J2U F;  1T5X D;  2Q2I A;  2UUC L;  2ASL A;  2HCI A;  2VUM H;  1N36 L;  4GLX A;  2YS6 A;  2WYO A;  2Y0S E;  3D0F A;  3I55 A;  1EU3 A;  4BWG B;  1M8A A;  4J9L A;  2BDN A;  3E9I A;  1TWC A;  2DN8 A;  4WBN F;  3S17 B;  1GHJ A;  4A2B A;  2VS1 A;  4L5S A;  2R93 B;  3QR8 A;  1SSO A;  3GTO B;  2F0N A;  3PUX A;  3HOU B;  5K2M A;  3X3M A;  3I4M B;  2EY5 A;  4DUZ L;  2C35 B;  1Q1B A;  3HOY B;  1ROD A;  4MTE A;  2KCT A;  2NVQ H;  3NBH A;  1W6J A;  1M7J A;  2Z4I A;  1IXR A;  1EIH A;  4I7H A;  4A3L G;  4JI8 Q;  1N9W A;  4GNX A;  2J6S A;  4QUF A;  3PF5 A;  1DGS A;  1RF2 D;  4QIW E;  2FK2 A;  3MXN B;  2I0Q A;  1H95 A;  4JI8 H;  3EVQ A;  4G57 A;  2ALZ A;  5GON F;  4K8I A;  1PK8 A;  3RBE A;  1PZI D;  2C9O A;  4MA5 A;  3JAM i;  1Z2O X;  4JI2 L;  2R82 A;  1B50 A;  1UNS A;  2K5Q A;  2NZO A;  5T1G A;  3QWN A;  3GII A;  1IW7 D;  4A3M B;  4PZ6 A;  2UXC Q;  3T53 B;  3LNN A;  1A0I A;  3SDZ A;  3M3Y B;  4JVZ A;  3VYU A;  1HR0 Q;  3TS2 A;  2UXC H;  5KYL A;  4X62 L;  5C5J A;  1GUN A;  1V1O A;  1JKJ B;  2BH8 A;  3ULP A;  1HR0 H;  4A3D G;  4XX0 B;  2UU9 Q;  4B3T Q;  3J81 c;  3LX0 A;  1WCM H;  1IBK Q;  2AKW B;  1ZXT A;  4DXG A;  2R93 A;  2NB0 A;  2UU9 H;  4ED7 A;  4B3T H;  3GTO A;  2PNR C;  3IRB A;  4DAV A;  3U9S A;  2ZJR A;  4LF7 L;  1IBK H;  1CM9 A;  1EY8 A;  5EWE A;  1CUK A;  4DR3 Q;  1XMO L;  3TP7 A;  4ECY A;  1VDZ A;  1LTB D;  4K2K A;  5CB4 F;  2VB3 X;  4ZKB B;  3VR4 A;  2XRS D;  2A6E C;  4LW1 A;  3ZYY X;  4DR3 H;  1D6E C;  1SCU B;  1MSG A;  1S0M A;  4KN4 C;  5IT9 L;  3AMU A;  3MXN A;  4TV8 F;  2ICI A;  2VQE L;  1AFP A;  2I87 A;  3FPP A;  5FPO A;  4KHZ A;  4DN4 M;  3JAM c;  2MO1 A;  5A2Q L;  1HNZ Q;  2A68 C;  2NU9 B;  3BA9 A;  3A5U A;  1VQ7 A;  2IPK D;  1T36 A;  2C2D A;  1U4R A;  1K83 H;  3UDX A;  3I4N G;  1HNZ H;  1GYF A;  1STE A;  2F0J A;  4YHH Q;  1JLL B;  1D8L A;  4LF8 L;  3LML A;  5KG2 A;  4DV5 Q;  2ZXO A;  5D65 A;  4DK1 A;  1VBH A;  4JI0 H;  1STN A;  2B39 A;  4YHH H;  2DY8 A;  3RTX A;  2BA0 A;  1U0L A;  5M3M B;  4DV5 H;  4ECQ A;  4CHT B;  1XTC D;  4KY6 A;  1E4E B;  4IUU A;  3DXJ C;  1PVO A;  2YRX A;  3LWB A;  5LXT F;  2FLN A;  3CHB D;  3CCU A;  4RKL A;  1S3O A;  2MJ8 A;  4A3F G;  2IX1 A;  1DCZ A;  3L3O C;  4U6P A;  1B9M A;  3EPG A;  1SMY C;  1BNZ A;  1BXR A;  2ZJP A;  3NHH A;  3STB C;  4Q8E A;  5J3B A;  2QF7 A;  1YIT A;  5KGU A;  1DXM A;  5I6W A;  2R85 A;  4O4L F;  1CS0 A;  5JEA H;  1X65 A;  2NN6 G;  4YCU A;  3I7F A;  3TIG A;  3PN1 A;  4ED3 A;  5LMN L;  4F50 A;  4O3P A;  3ERQ A;  4JG2 A;  1EZ8 A;  2QKI C;  3Q0A A;  4IFD H;  4I65 A;  3KAL A;  4ECT A;  4C3I B;  1BUV T;  1B2T A;  3ZJY C;  1HZC A;  4A3E G;  2K01 A;  2E2J H;  4WJ3 M;  1BJT A;  5KG3 A;  2XWB B;  3I2Z A;  2I5H A;  3HKZ G;  4LF9 Q;  1UUP A;  4RFB A;  3PO3 H;  1ILP A;  4R4T A;  4DPG A;  2OH2 A;  1EY0 A;  3STB D;  1BQQ T;  2AWO A;  2F0D A;  4LF9 H;  1WD0 A;  4ZK9 B;  1HA6 A;  4DL2 A;  5FK9 C;  4X6A H;  4G4K A;  3PIO A;  4JYA Q;  4RB2 C;  2BCO A;  1E4E A;  2RSN A;  1NTG A;  4GC6 A;  4LUO A;  2KCM A;  5J1Z A;  3PZP A;  4JYA H;  1X32 A;  4BBR H;  5L1I A;  5TSS A;  1X54 A;  2R8I A;  2UUB Q;  2Z6K C;  1VQ4 A;  2R8J A;  4Y52 H;  4NKL A;  4O3O A;  1V1Q A;  2IY5 B;  4LFC Q;  2UUB H;  2V9W A;  2WAQ B;  5ELF A;  1UEA B;  3Q1K A;  4IR1 A;  1S03 G;  1LTL A;  2ZTD A;  1NMF A;  5IT9 E;  4A93 B;  2NU6 B;  4LFC H;  4QJF A;  1SDF A;  3TN2 A;  1T94 A;  2VA3 A;  3PUZ A;  4A3K B;  4ULL A;  3KTM A;  3A7A B;  2KED A;  2F3I A;  4EX5 A;  4IFD G;  5EOY A;  3RZD H;  2EIF A;  1M4V A;  4DV0 Q;  4FXK C;  5M3F H;  4OEM B;  2UXC L;  4LMQ D;  1T3N A;  4WD3 A;  3Q8R B;  2B2Y C;  3M7G A;  1HR0 L;  4DV0 H;  3ITP A;  3T5J A;  1EY5 A;  5IP7 H;  4I7Z C;  3RZO H;  4RUC A;  2F52 A;  3BAB A;  2N8N A;  2NYZ D;  1VQB A;  1Y69 U;  4I4T F;  5AFW A;  2UU9 L;  3FP9 A;  5LMU Q;  5LHY 1;  1IBK L;  2A69 C;  2N55 A;  5JUM A;  4GLA C;  3H0G B;  4X66 Q;  2WV6 D;  3E0E A;  1FGB D;  4JV5 Q;  1DOL A;  3PUV A;  5ELE A;  3GTL B;  3M85 A;  5HY6 A;  4DR3 L;  4BBR G;  1DIK A;  4X66 H;  2BE5 D;  4JOI A;  1M0W A;  4J0M A;  4JV5 H;  5DGB A;  1EY4 A;  3K81 C;  3CW2 C;  1NAP A;  1BO0 A;  4ECS A;  3C3L A;  3DMU A;  4MTN A;  5T1I A;  2MNA A;  3OTO Q;  4A3C G;  3RB3 A;  1O7L A;  5KFJ A;  1BCP B;  3K5O A;  3M4Q A;  5FLM G;  2SDF A;  2WAQ A;  3RB0 A;  3OTO H;  3DUZ A;  1HNZ L;  3BG5 A;  2B8G A;  1B6R A;  3RV3 A;  4JBM A;  1X56 A;  1HNW Q;  4YCW A;  5M3F G;  1EYZ A;  2A69 D;  4C3H B;  2GLT A;  4JI0 L;  3KHR A;  1NMG A;  4BY7 B;  1E2V A;  1X55 A;  3IL8 A;  4DV5 L;  2RDJ A;  1HNW H;  5I9O A;  1I94 L;  2HHH Q;  4O4H F;  4K6D A;  2W6O A;  4YY3 L;  4R8I A;  2I8C A;  3F2D A;  1PH7 A;  4GC7 A;  2HHH H;  2F0K A;  4ME6 A;  4FVM A;  1DV1 A;  1PV4 A;  3GIL A;  4B9W A;  3R3O A;  2PW7 A;  2JK8 A;  5IOD A;  3H0G A;  3H3V I;  4KY7 A;  2YL2 A;  3J7Y W;  3C1E A;  3EA6 A;  5FD6 A;  3GTL A;  1O7Y A;  2DLN A;  3NXW A;  3CCR A;  4A3G H;  4JI3 Q;  3GD7 A;  5KEE A;  2JA5 H;  5KFP A;  3E0J A;  4O2A F;  1SYG A;  3I56 A;  4MTK A;  4TQR A;  3A74 A;  4JI3 H;  2CWP A;  2K5W A;  4J8Q A;  4DAM A;  2W6M A;  4LK1 C;  1GKH A;  5GQO A;  5I2Y A;  4L1K A;  1OTC A;  3S2H H;  1WSC A;  4ZQI A;  2LXJ A;  2NTT A;  2NVY H;  2DY7 A;  3NEL A;  1VQI A;  2KHJ A;  3R5F A;  4A2A A;  4EEY A;  1EWI A;  4J1M A;  4RNN A;  1J5E Q;  2F0L A;  1LAC A;  4HTH A;  1J6Q A;  2G9H D;  1KXL A;  4JBW A;  5L37 A;  4JC0 A;  1J5E H;  1XPO A;  1PFS A;  3S15 H;  4NXM Q;  4LSX A;  1VBG A;  3GTK H;  1GGO A;  1BBW A;  3I3C A;  4ED8 A;  3SI8 A;  1FVI A;  2HCC A;  1YJW A;  1KQS A;  4IUQ A;  4UCV A;  5KFG A;  3D31 A;  2ZM6 Q;  4IRD A;  5IE8 A;  4NXM H;  1VF5 C;  1W6K A;  4KK7 A;  3ICE A;  3BQ1 A;  4AYB B;  1U4M A;  5DLQ E;  5KFE A;  3CXC A;  2DGY A;  2ZM6 H;  5IOC A;  1Y1W H;  5KT5 A;  5LA6 F;  4BY1 B;  2HVS A;  1SEI A;  3PO2 H;  5C44 B;  1KJ9 A;  4YAJ B;  1XXG A;  2XNA C;  1I6H B;  2Z4H A;  1VQ8 A;  2YTY A;  3JSL A;  2JA5 G;  1EY7 A;  2XGP A;  1S97 A;  3R93 A;  2WP8 J;  4DR1 Q;  1B4O A;  2Q2T A;  1RD9 D;  3HEJ A;  4XQN A;  4MV6 A;  2E75 C;  3MAQ A;  3RGX A;  4DR1 H;  1VQL A;  1ONL A;  3HKZ E;  5A2Q W;  3MC0 B;  3N6R A;  5KT6 A;  2DJG C;  3DHQ A;  3K3P A;  2R7N A;  4CGY B;  3SVM A;  2XIG A;  5C4Z A;  4EGQ A;  4AIM A;  3BQ2 A;  2RDI A;  3FKI H;  4RHR A;  3K5H A;  3CME A;  4O4I F;  3T5H A;  4Y8V B;  1V51 A;  2L15 A;  3DWQ A;  1IBM Q;  4JV5 L;  2RBM A;  4RNM A;  2B63 B;  1RCV D;  2SEB D;  4L5T A;  3E6Z X;  3OIP A;  1NJI C;  2E5L Q;  1K8O A;  1IBM H;  5IWA Q;  2MUY A;  3CMA A;  1T9H A;  2VW9 A;  2HQE A;  4P72 A;  4RGO S;  5LYJ F;  1BOS A;  2L1B A;  3UE1 A;  3PO2 G;  2E5L H;  3OTO L;  4FF2 A;  4AYB A;  4UP8 A;  4EQO A;  1WTQ A;  3EFX D;  2NVX B;  3HOV B;  2FMM A;  4IAJ A;  3OHX C;  1GD7 A;  3D4R A;  4R8U B;  4KTA A;  1VQ9 A;  3GIM A;  4UHV A;  2BR0 A;  2NN6 I;  2G5D A;  2KEE A;  4RA8 A;  4RAY A;  1GXD C;  2C2R A;  1CFM A;  4JUZ A;  4GN4 B;  3KDF B;  3D8G A;  1BCP D;  4UP7 A;  4IWY A;  2LXK A;  1U5K A;  3NSW A;  2Z9H A;  1EY9 A;  2HHH L;  1O7I A;  3RLF A;  4A3J B;  2PZU A;  1A6X A;  4APV A;  1GVP A;  4F8M A;  3K5L A;  1IL2 A;  2IW3 A;  1FNU A;  4DR5 L;  2FJ2 A;  2K28 A;  2NUC A;  2RVL A;  3Q6S A;  5GAH C;  4QCL A;  2IWH A;  1JDE A;  3HB9 A;  3PR4 A;  4GN5 A;  3EBE A;  2W8L A;  5M5W H;  5EDW A;  2RHQ B;  4HNU A;  2PQA B;  1YNJ D;  4LNQ A;  3WWV A;  1SLJ A;  3Q23 A;  1QG7 A;  2NVT H;  3F8T A;  2I80 A;  4HNT A;  1L0W A;  4GKK Q;  2Y0S B;  1RL2 A;  2R7D A;  2B63 A;  4N9P A;  4S3S A;  2F3W A;  4GKK H;  3TEH B;  4JI3 L;  2A6H D;  1AE2 A;  2G9D A;  3SGI A;  2KCC A;  5FD5 A;  4HJ7 A;  1TS5 A;  4LJZ C;  4IWX A;  1IOV A;  4NDX A;  1YNN C;  4GOP C;  1JOK A;  1QCB D;  3S1Q H;  3CKI B;  2NVX A;  1TAE A;  2R7Z G;  3GDE A;  2YZN A;  2I07 B;  4R8U A;  2IP4 A;  4YR3 A;  4F7X A;  4DF7 A;  3KHH A;  1WH2 A;  4KJO A;  5AJ3 Q;  2CQA A;  2E2I B;  3M4Y A;  4QIW B;  3CCV A;  3MR3 A;  2JEI A;  4IFD I;  3UI2 A;  1N34 Q;  5EQ0 A;  1J5E L;  1B8A A;  4P2C B;  4X64 Q;  3KDF A;  1HR0 W;  4XYM B;  4DR6 Q;  1TY0 A;  1LM0 A;  1N34 H;  2CHB D;  4X64 H;  2K33 A;  2RCN A;  4NXM L;  1STH A;  2OT2 A;  4DR6 H;  3A8J E;  1KJQ A;  3EIV A;  4IPG A;  2Z0S A;  1YJ9 A;  2N49 A;  2F0P A;  3Q8Q B;  1STG A;  2KHI A;  4ED6 A;  1GO3 E;  5NUC A;  2ZM6 L;  1LUZ A;  4OEL B;  1YNN D;  1MZB A;  2EY6 A;  2PQA A;  2XIW A;  3BJY A;  2KVM A;  1KBL A;  2R92 G;  3QIA A;  4ID6 A;  3MR2 A;  3GTJ H;  2Y0S A;  1IKL A;  1PZJ D;  4IFD J;  2O4X A;  4C2M H;  3BDC A;  4LFB L;  4TUY F;  2HVR A;  1PH3 A;  4Q43 A;  1ULZ A;  3TME A;  4F4Y A;  4DR1 L;  4MZ9 A;  4M7E A;  1LT3 D;  3NP8 A;  1MJC A;  4PMW A;  1PH6 A;  4HED A; 
#chains in the Genus database with same CATH homology
 1HH2 P;  1IXR A;  2HIV A;  2A8V A;  2ZTE A;  4P74 A;  4JI8 Q;  1N9W A;  4GNX A;  2EXD A;  3T1Y Q;  4A3L G;  3PF5 A;  1DGS A;  1Q82 C;  4QIW E;  1XPU A;  3MXN B;  2I0Q A;  3LGJ A;  1PH5 A;  1H95 A;  4LUZ A;  1XNR Q;  3L7Z C;  4OO1 G;  1VQA A;  2K5H A;  3J7A 5;  2WAQ G;  3HOZ H;  4A3C H;  1RIP A;  2NVX H;  2V1C C;  1UE1 A;  5LMU L;  5FLM H;  3HOV H;  4A93 G;  1Q7Y C;  3JAM i;  3G48 A;  4JI2 L;  2XTI A;  1CKO A;  3FHW A;  1MKH A;  4A3K G;  1KIX A;  3S1M H;  4X66 L;  4DK6 C;  4GOP A;  2NZO A;  1GM5 A;  4RG1 A;  3AQQ A;  1IBM L;  2JA7 H;  4BXX H;  4PZ6 A;  4AQY Q;  3GTP H;  2UXC Q;  1N33 Q;  1M1K C;  4HIM A;  1A0I A;  2MFI A;  3PIP A;  4HJA A;  1HR0 Q;  3H15 A;  2E5L L;  5EAY A;  5IYC H;  1K73 C;  1IBL Q;  4B3S Q;  3TS2 A;  1YBY A;  1EUJ A;  4DAY B;  4X62 L;  3PCO B;  1Y1V H;  1Y1W G;  2BH8 A;  3ULP A;  2Q2U A;  1X3F A;  4A3D G;  1HZ9 A;  4A3J H;  1VQD A;  3L0O A;  1HZA A;  2UU9 Q;  4B3T Q;  4JBK A;  2D0P A;  3J81 c;  1KC8 C;  1WCM H;  1IBK Q;  1VQN A;  2AKW B;  3U50 C;  5FJ8 G;  1VQF A;  3H0G G;  1PH4 A;  1VQ5 A;  3IRB A;  2ZJR A;  1YJN A;  4LF7 L;  1OXS C;  1TWC H;  1CUK A;  4OX9 Q;  1HNW L;  2YYZ A;  3CPF A;  1G29 1;  2YTV A;  5IT9 c;  4DR3 Q;  1XMO L;  1JMC A;  4LF6 L;  3MEF A;  4LW1 A;  1TWF H;  4JCV E;  4YCV A;  3CCE A;  5BR8 Q;  2MO0 A;  1S40 A;  2ALY B;  4R1J A;  2VQE L;  4DV7 Q;  2ASB A;  4JI1 L;  1XNQ Q;  4DUY L;  2VQF L;  1C0A A;  5C4J H;  4KHZ A;  3T1H L;  2IX0 A;  3JAM c;  4DV1 L;  4DV2 L;  2K75 A;  2MO1 A;  3FKI G;  1HNZ Q;  1TWH H;  3A5U A;  2K5N A;  2JA7 G;  4NXN L;  4QL5 A;  1JJ2 A;  1VQ7 A;  2E8G A;  2VNU D;  4PZ8 A;  1K83 H;  3UDX A;  1XJV A;  2OQ0 A;  4TVA B;  3I4N G;  4YHH Q;  4DR2 Q;  2A19 A;  4GKK L;  1D8L A;  2E2I H;  4LF8 L;  4BY7 G;  2PI2 E;  3HKS A;  4DV5 Q;  1Q46 A;  3CAM A;  1IYJ B;  3BZK A;  2K52 A;  2YV5 A;  1E22 A;  3I4O A;  4IPD A;  3F1Z A;  2BA0 A;  1U0L A;  4LF4 Q;  1EQR A;  1KD1 C;  2PMZ E;  4JI7 L;  4DR5 Q;  1S72 A;  2PI2 A;  1PVO A;  1PYS B;  1EQQ A;  3CCU A;  3PF4 A;  1OXV A;  1S3O A;  4A3F G;  2IX1 A;  1I3Q H;  5C0X G;  1HJP A;  1N32 L;  3PUW A;  2ZJP A;  3STB C;  3ULJ A;  2I5L X;  5J3B A;  1YIT A;  2MQH A;  1VQ6 A;  1NBW A;  2RHS B;  4J15 A;  1X65 A;  2NN6 G;  3K8A A;  5E7N A;  4LFA Q;  3CPW A;  1N34 L;  3S17 H;  5C44 H;  4YCU A;  4DR4 L;  1W3S A;  2R6G A;  1VQE A;  3I7F A;  2R93 H;  5LMN L;  4DR6 L;  1OXX K;  4IOA A;  4B3R Q;  4GKJ Q;  1Z9F A;  4JG2 A;  3I4M H;  3K0X A;  4X65 Q;  4A4I A;  3HOY H;  4UY8 C;  2HT1 A;  1VQG A;  1K9M C;  1JJG A;  1QVC A;  5JEA J;  4JOI C;  3ZJY C;  1CKM A;  1HZC A;  3J7Z C;  4A3E G;  1V9P A;  1QZH A;  2E2J H;  4WJ3 M;  1VQH A;  2IHF A;  1VQC A;  1JB7 A;  3I2Z A;  3PV0 A;  2HIX A;  2I5H A;  4GN3 B;  3G71 A;  3K80 C;  3HKZ G;  4DV0 L;  4LF9 Q;  4DV6 Q;  3PO3 H;  4KI0 A;  4R4T A;  4DPG A;  4HIK A;  3HFZ B;  2EQS A;  4GS3 A;  1SFO H;  5JJI A;  1OXT A;  3AFP A;  2AMC B;  3STB D;  2UUA Q;  2AWO A;  4HJ5 A;  1UE7 A;  2B3G A;  2K50 A;  4P73 A;  4X6A H;  3PIO A;  4JYA Q;  4A3I H;  4C3J H;  4JI4 Q;  1XPR A;  4BBS H;  1NTG A;  1SN8 A;  4LUO A;  4A3M H;  2KCM A;  1N36 Q;  2JA8 G;  1P8L A;  4BBR H;  2GVA A;  2K4K A;  1X54 A;  2GN5 A;  3T1Y L;  2KBN A;  4O2D A;  2Z6K C;  2UUB Q;  3M3Y H;  4EQ5 A;  1VQ4 A;  5IP9 G;  1WYD A;  3HOX G;  4Y52 H;  4YWK A;  4AYB G;  1V1Q A;  1KHI A;  2JA6 H;  3CD6 A;  1KAW A;  3DM3 A;  4BY1 G;  4LFC Q;  2IY5 B;  1YVC A;  3KYH C;  3NEM A;  1E7Z A;  5C44 G;  1LTL A;  2GVB A;  1CSQ A;  1PH2 A;  2WB1 G;  1XMQ Q;  1IZ6 A;  2ZTD A;  4RMF A;  1NMF A;  2H5X A;  1HZB A;  2CKZ B;  4IJL A;  4A75 A;  2RF4 A;  1HNX Q;  4QJF A;  4LFB Q;  3BU2 A;  4IPH A;  4BA1 I;  3PUZ A;  1MJE A;  1KRS A;  1C9O A;  1UE6 A;  3A0J A;  3PSI A;  3BJU A;  2F3I A;  4P75 A;  4IJH A;  4EX5 A;  4IFD G;  3RZD H;  1PYB A;  2EIF A;  2UXD Q;  4DV0 Q;  1VQK A;  2JEB I;  4AQY L;  5M3F H;  2UXC L;  4OON A;  1Q81 C;  2VUM G;  3GTQ H;  5GRO A;  1HR0 L;  1IBL L;  4B3S L;  5IWA L;  4JI6 Q;  2R7F A;  4JI5 L;  5IP7 H;  4K0K Q;  2UXB Q;  1PH9 A;  3RZO H;  3KF6 B;  2F52 A;  1WOC A;  2N8N A;  4DNI A;  1N8R C;  1VQB A;  1A8V A;  3CCJ A;  2UU9 L;  3M7N A;  3FP9 A;  5LMU Q;  1SRU A;  3GTG H;  4R4Q A;  3VDY A;  1M90 C;  2B63 H;  1IBK L;  4B3M L;  1CKN B;  2N78 A;  4GLA C;  4X66 Q;  2OWO A;  3E0E A;  1BVS A;  2JEA I;  4JV5 Q;  3CC2 A;  3DLL A;  4BBS G;  4IPC A;  3PUV A;  2B63 G;  3M85 A;  4O0A A;  1G51 A;  5HY6 A;  4BBR G;  4DR3 L;  4OX9 L;  4JOI A;  3RNU A;  2BA1 A;  1K3R A;  3K81 C;  3CW2 C;  5IYB H;  1ASZ A;  5IYD H;  1Q86 C;  4X62 Q;  2WAQ E;  4KHP L;  1I5F A;  4YWM A;  2MNA A;  3CP0 A;  4MTN A;  3OTO Q;  5M3M H;  3HOZ G;  1X6O A;  4A3C G;  4DV7 L;  5C3E H;  1X3E A;  4OWW B;  2Q2H A;  3A5Z B;  1XNQ L;  3M4Q A;  4P71 A;  5FLM G;  3HOV G;  1ASY A;  1NE3 A;  1NY4 A;  1EYG A;  1X9N A;  3S1R H;  4BA2 I;  5LMN W;  1HNZ L;  1FJG Q;  1JT8 A;  2R7Z H;  4OWX B;  4LF7 Q;  4DV4 Q;  5K36 G;  4JBM A;  4BXX G;  1X56 A;  1HNW Q;  1QUQ B;  4YCW A;  3L2P A;  5M3F G;  4LF6 Q;  4JI0 L;  4PG3 A;  4DR2 L;  1NMG A;  4XTC S;  1Q12 A;  3HOW H;  2Z6K A;  1X55 A;  1XTD A;  5IYC G;  4DV5 L;  1YHQ A;  3S16 H;  1I94 L;  1Y1V G;  3ER0 A;  2HHH Q;  4NPS A;  1L1O B;  4ME3 A;  4YY3 L;  4KLK A;  4YWL A;  3ULL A;  4A3J G;  2D0O A;  3J80 i;  3F2D A;  1PH7 A;  2JA9 A;  3KF6 A;  2QGQ A;  3KJP A;  1WCM G;  3CCL A;  3U4V A;  1FGU A;  2LSS A;  1AE3 A;  3CCM A;  1PV4 A;  1Y14 B;  4NXN Q;  3CF5 A;  1Q8K A;  2JK8 A;  1CKN A;  3TRZ A;  4DR7 L;  1YNX A;  3H3V I;  2AWN A;  3RLN A;  5AJ3 L;  1EIF A;  2Y0S G;  3S14 H;  1YEZ A;  5IYB G;  5IYD G;  2R92 H;  4LFA L;  3K7A H;  3U4Z A;  4X64 L;  5GAE C;  5JJL A;  3CCR A;  4A3G H;  4JI3 Q;  3GD7 A;  2QEX A;  3GTO H;  4B3R L;  1PH8 A;  2JA5 H;  3H3V H;  2F4V Q;  3HOU H;  2I5M X;  4GKJ L;  3I56 A;  1G6P A;  4X65 L;  3A74 A;  1WI5 A;  2CWP A;  3PUY A;  4DAM A;  3S24 A;  4OO1 I;  3GO5 A;  1SE8 A;  1GKH A;  5GQO A;  1D7Q A;  4A3L H;  1OTC A;  3S2H H;  1KL9 A;  1VQO A;  2LXJ A;  3W1G A;  4QGU A;  2NVY H;  1VQI A;  1UEB A;  2KHJ A;  3NEL A;  4AH6 A;  1QUQ A;  1EWI A;  4TQU S;  1J5E Q;  2BH2 A;  1J6Q A;  5LMN Q;  1KXL A;  4JBW A;  4JC0 A;  3CCS A;  3KLW A;  1XPO A;  4A93 H;  1PFS A;  3S15 H;  1E1T A;  3RLO A;  1L1O A;  4DK3 C;  3J80 c;  4LF5 L;  4NXM Q;  3UDI A;  4DV3 Q;  4HJ9 A;  3GTK H;  1Q1E A;  4JI4 L;  1BBW A;  2UUC Q;  1FVI A;  1YJW A;  1KQS A;  3KFU A;  3D31 A;  2ZM6 Q;  1VS0 A;  5IE8 A;  4JI8 L;  3KOJ A;  3B6Y A;  1V43 A;  3ICE A;  3CC7 A;  2K14 A;  5DLQ E;  3CXC A;  2DGY A;  4OWT B;  1Y1W H;  2E2H H;  5JEA G;  4GLV B;  1XNR L;  3PO2 H;  4A3D H;  4R4C A;  3KF8 B;  1SRO A;  3CCQ A;  3CC4 A;  3J81 i;  1XMQ L;  2R93 G;  1VQ8 A;  2YTY A;  1JJC B;  2JA5 G;  4Y7N H;  4A76 A;  4DUZ Q;  1HNX L;  3HOU G;  3I4M G;  2AHO B;  3H0G H;  2WP8 J;  1JE5 A;  3W1B A;  4DR1 Q;  4UPA A;  3HOY G;  2Q2T A;  1BKB A;  2UXD L;  1TWG H;  3G6E A;  2VY3 A;  1W2B A;  3GTL H;  1N33 L;  3AYH B;  5HGQ A;  2A1A A;  1VQL A;  4LUV A;  3HKZ E;  4MNO A;  1AH9 A;  3AEV A;  4HID A;  1OXU A;  4JI6 L;  4K0K L;  2UXB L;  4WJ4 A;  4QQB X;  3PO3 G;  1SMX A;  4B3M Q;  4JBJ A;  3UDG A;  3EN2 A;  5M5X H;  4B3T L;  3NEN A;  3KJO A;  4JI2 Q;  1EOV A;  4AIM A;  3FKI H;  3CME A;  1Z47 A;  4A3I G;  5H1S E;  2L15 A;  1IBM Q;  4JV5 L;  4DKA C;  5GAD C;  4A3M G;  5ELO A;  1YHB A;  3I4N H;  4C3H H;  1E1O A;  4AYB E;  1UWV A;  4L5T A;  1NJI C;  4BY7 H;  2CQO A;  2E5L Q;  5JJK A;  4IO9 A;  3UDF A;  5IWA Q;  2VZA A;  4JI5 Q;  3CMA A;  1T9H A;  3TQY A;  2OCE A;  2VW9 A;  4L5R C;  2WB1 E;  2JA6 G;  4P72 A;  3UE1 A;  5C0X I;  3PO2 G;  5BR8 L;  3OTO L;  1QZG A;  1K8G A;  4UP8 A;  4POG A;  1E3P A;  1L1O C;  1VCI A;  1PH1 A;  1GD7 A;  3F2C A;  4A3F H;  2ID0 A;  1K0R A;  1VQ9 A;  2NN6 I;  5C4X H;  4A3B H;  2OTL A;  2K5V A;  2VL6 A;  1FJG L;  1LYL A;  5GAG C;  4DV4 L;  1C7Y A;  1FL0 A;  1XMO Q;  1P16 A;  5IY0 A;  2ZTC A;  2ES2 A;  4GN4 B;  4YHH L;  1SR3 A;  2N3S A;  3KDF B;  3G4S A;  1WJJ A;  3AFQ A;  4R4O A;  4UP7 A;  4HJ8 A;  2QA4 A;  2ATW A;  4KHP Q;  4POF A;  1QVF A;  2LXK A;  1U5K A;  5IP7 G;  3OW2 A;  2HHH L;  1O7I A;  3RLF A;  2VQE Q;  2JQO A;  2CWA A;  2PNH A;  4APV A;  1GVP A;  4JI1 Q;  4LF4 L;  5C0X J;  1IL2 A;  4DUY Q;  1QVG A;  2VQF Q;  4DR5 L;  3W5O A;  1YIJ A;  3OYY A;  5GAH C;  3T1H Q;  4DV1 Q;  4DV2 Q;  4GN5 A;  2WFW A;  3EBE A;  5M5W H;  3S1N H;  2RHQ B;  2PQA B;  4C3I H;  4GNX C;  4UP9 A;  4LNQ A;  2B29 A;  1SLJ A;  3M4P A;  3WWV A;  4A3E H;  1VQM A;  3F8T A;  2NVT H;  1L0W A;  4JI0 Q;  4GKK Q;  1CSP A;  3UE0 A;  2DUD A;  1RL2 A;  2KEN A;  2R7D A;  3TS0 A;  4LF8 Q;  2OTJ A;  2ZJQ A;  3E9H A;  3S2D H;  2NZH A;  2XGT A;  3F2B A;  1I94 Q;  1A63 A;  5FLX c;  5M5Y H;  4YY3 Q;  2OQK A;  2D62 A;  3TEH B;  4JI3 L;  1AE2 A;  3CQZ H;  3M9B A;  3SGI A;  5M3M G;  1BBU A;  4JI7 Q;  4HIO A;  5C3E G;  3NBH B;  4HJ7 A;  2F4V L;  1B7Y B;  3BZC A;  3U58 A;  1EIY B;  4NB3 A;  4GOP C;  1TXY A;  4GNX B;  2YU9 H;  3S1Q H;  1YI2 A;  4L5Q A;  3ERS X;  2IHE A;  1TWA H;  5C4X G;  4A3B G;  4FDB A;  2JA8 H;  2R7Z G;  3GDE A;  1MIU A;  3Q8D A;  4OXP A;  2CCZ A;  4DR7 Q;  1N32 Q;  4R4I A;  2IT1 A;  5IP9 H;  3HOX H;  5AJ3 Q;  1WFQ A;  3HOW G;  5ELN A;  2YTX A;  1YHA A;  3CCV A;  3M4O H;  3TRE A;  4ALP A;  4LF9 L;  4BY1 H;  4DV6 L;  4IFD I;  1J5E L;  1N34 Q;  3K7U C;  4DR4 Q;  1B8A A;  4X64 Q;  3KDF A;  3JC6 6;  1I6H H;  1HR0 W;  2UUA L;  3RR5 A;  4DR6 Q;  4GOP B;  1LM0 A;  1A62 A;  4PZ7 A;  3J81 j;  1PHJ A;  2RCN A;  1B70 B;  4QY7 A;  4A3K H;  4NXM L;  4JYA L;  4DV3 L;  4H02 A;  3GTM H;  1I50 H;  3EIV A;  4IPG A;  2Q2I A;  2Z0S A;  1YZ6 A;  2N49 A;  1YJ9 A;  1EFW A;  2UUC L;  2VUM H;  2KHI A;  4GLX A;  1GO3 E;  1N36 L;  1KRT A;  2ZM6 L;  1K8A C;  2Y0S E;  3D0F A;  2NVQ H;  1LUZ A;  2JJQ A;  3I55 A;  2UUB L;  2PQA A;  2FXQ A;  2JE6 I;  1E24 A;  3E9I A;  2HQL A;  3RN2 A;  1VQP A;  2R92 G;  1X3G A;  4LFC L;  2VS1 A;  3GTJ H;  4IOC A;  1L2F A;  4L5S A;  4IFD J;  4A3G G;  1UE5 A;  4C2M H;  3PUX A;  3RN5 A;  5FJ8 H;  3PGZ A;  4LF5 Q;  4LFB L;  4DUZ L;  4XIG S;  1PH3 A;  2C35 B;  1Q1B A;  1R9T H;  4DR1 L;  4LWC A;  4MZ9 A;  2CFM A;  2KCT A;  1PA6 A;  1MJC A;  4PMW A;  1PH6 A;  1VQJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...