1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
1VQ6A 1N36L 5C44H 2VUMH 2MO0A 3F2BA 2L15A 4JI6Q 3HOWH 3F2CA 3MXNB 2JA9A 4DV3Q 4HJ8A 4LF8Q 4Y52H 1Q46A 4YHHQ 3GDEA 1C7YA 4DNIA 1HH2P 3UDFA 3S2DH 3CP0A 3S17H 4DV2L 1X56A 4BY1H 2EQSA 4A3IG 1Q7YC 2MFIA 1IBLQ 2K52A 5LMNL 3H3VH 2VQEQ 1S3OA 4A3CG 1HZCA 3RNUA 1UE1A 2ALYB 1QZHA 5IT9c 2K50A 1VQLA 2OCEA 4DR3Q 2BH8A 2YTYA 4DR3L 3KDFA 1J5EQ 4P75A 4LF4L 1XPUA 4JI5Q 1SR3A 3CXCA 2N78A 2R7ZH 1AH9A 2CWAA 5JEAG 5C0XG 4AIMA 4RMFA 3BJUA 3RR5A 2E2JH 2UUCL 4LF9Q 4B3TQ 4JI1Q 3PUYA 1IYJB 3AQQA 4JI2Q 3IRBA 3PF5A 3Q8DA 1FVIA 4R1JA 2MNAA 2R7ZG 3KF6A 3K81C 4GNXC 1CKNA 4MNOA 3TEHB 3CCRA 2DUDA 1TWHH 1XJVA 5IP9G 1WCMG 5IYDH 3A0JA 1N8RC 4PZ7A 4TVAB 3TQYA 3S24A 3VDYA 3PV0A 4JBMA 3L0OA 5HGQA 1NY4A 1CKMA 1EYGA 4AYBE 2I0QA 2AMCB 4JI4L 4A3DH 4UPAA 4DKAC 3KF8B 1BBWA 4DUYL 4HIOA 3HOZH 2IT1A 5IY0A 5JJIA 2D62A 4A3EH 2OTJA 3U58A 1K0RA 2JA7G 4GLVB 5C4XH 2JQOA 4JV5Q 2WP8J 5JJLA 3DLLA 3F1ZA 5C3EG 4P73A 1OXTA 1QZGA 4JYAQ 2UXCQ 2A8VA 1KC8C 5ELNA 4LF4Q 3FKIH 2IX0A 4JI5L 5JEAJ 1YITA 2BH2A 2IY5B 2VZAA 4JI7Q 4HIMA 4J15A 1N33L 2I5LX 2ZJRA 4AQYQ 3HFZB 4BBSG 4AQYL 4C3HH 5AJ3L 4JOIC 4JI1L 4C2MH 5AJ3Q 4X66Q 2ZTCA 3NBHB 1YIJA 2PI2A 2HT1A 2PI2E 4YY3Q 3S2HH 4JI8Q 1DGSA 2YTVA 4OWWB 4GKJL 1K3RA 3J81c 4B3MQ 1E24A 3HOYH 1ASZA 1QVGA 3CCQA 3KLWA 4PZ6A 3CCVA 1I94Q 4DR1Q 1JMCA 1GM5A 1W3SA 1YHQA 4BA2I 1M1KC 4LFBQ 3K7UC 1JJ2A 2Z6KC 2CCZA 3I4MH 5C44G 1G6PA 1G291 2KHJA 3KF6B 4R4QA 1TWAH 1V9PA 1MKHA 4QY7A 3TREA 3S14H 3HOYG 3G48A 1XPRA 4OX9Q 1MJCA 2NN6I 3AYHB 1HR0W 2HIVA 5FLXc 4A3BH 1CSQA 1PV4A 3J80i 1HR0Q 3CAMA 1GD7A 1VQGA 3PO2G 1Q86C 4BY7H 3S1MH 4B3RL 4B3RQ 4DV1Q 2D0OA 2K75A 4EX5A 2E5LQ 4GKKL 3ICEA 4XIGS 2K5NA 2ZTEA 4P71A 3H0GH 3AEVA 4L5RC 1BKBA 1RIPA 1YI2A 4LFCL 2QEXA 1KIXA 1IBKQ 1N32Q 4KI0A 4QL5A 1E1TA 2JA7H 4IFDI 1N32L 2HIXA 2NVTH 2KHIA 1A8VA 3ULPA 3F2DA 3PUZA 4B3ML 4JI0L 1PH5A 1RL2A 4H02A 2JA6H 3M3YH 1VQJA 3S1QH 2PQAA 1KRTA 1EFWA 1VQCA 4JOIA 4B3SL 2UXBL 2AWNA 4XTCS 3RN5A 2VQEL 1HNZL 3CC4A 1VCIA 1YBYA 3I7FA 4YCWA 4GOPB 2I5HA 1VQ5A 2GN5A 4GN4B 4DR7L 2JA6G 1UEBA 4A3CH 1HNWL 5GROA 3CQZH 5GADC 2ATWA 1VQFA 2QGQA 3HOUG 1FGUA 4A93H 4A3FH 3A5UA 3I4NG 2IX1A 3I4MG 1LTLA 1TWFH 4DK3C 3UE1A 1PH2A 5IYCH 2PQAB 4A3MG 1Q12A 4JCVE 2ZJPA 3G4SA 5LMNQ 4HIKA 1SRUA 1V1QA 2A19A 4KLKA 1C0AA 1PFSA 1TXYA 3S1NH 2CWPA 3PSIA 4R4CA 1NBWA 1NTGA 3ERSX 1O7IA 2NVQH 2YTXA 3JAMc 1K83H 3K8AA 2UUBL 4X65Q 4KHPQ 2E8GA 4X65L 1YNXA 3AFQA 4KHPL 2K5VA 1L0WA 3T1YL 1JT8A 3M4QA 1B70B 4AH6A 3W5OA 3RLOA 3MEFA 1PH6A 1NMGA 1SE8A 4JI0Q 2F4VQ 1D7QA 3G71A 5C0XJ 3TS0A 3M7NA 4JI4Q 4IPDA 4DV5L 5J3BA 4DV5Q 5JJKA 2WB1E 3CCSA 3CCJA 2UUAL 2XGTA 2Q2HA 3SGIA 3OTOQ 1OXSC 1KL9A 2PMZE 3B6YA 1VQEA 3GD7A 4FDBA 3GTGH 1TWCH 2ZJQA 2RHQB 5M3MH 4QGUA 3KFUA 1XMOL 4A3GG 3GTKH 1N36Q 1VQHA 1VQBA 1KRSA 4JI6L 2N3SA 3K0XA 4X64Q 4LF7Q 1C9OA 4JBWA 4OWTB 4K0KL 4IO9A 4NXML 4K0KQ 4OO1I 2KCMA 2VY3A 4L5TA 2F52A 2JA8H 4DR6L 3PUWA 2UU9Q 2JJQA 4DR5Q 4LF6Q 1VQNA 4A3BG 3K80C 4LNQA 2LSSA 4X66L 1E3PA 3L7ZC 4GLXA 3K7AH 2PNHA 3PCOB 1YJ9A 2YYZA 1PH1A 1OXUA 5IYBH 3DM3A 1BBUA 3OW2A 1L1OB 1SN8A 1W2BA 1N34L 2Q2IA 4X6AH 3M85A 2JEAI 1IZ6A 5E7NA 2ASBA 3J81i 3L2PA 4HJ9A 1K8AC 2K5HA 4C3IH 1GO3E 4RG1A 5M5XH 1VQMA 2VNUD 2KBNA 2YU9H 4LUZA 4GN5A 1T9HA 3WWVA 1PA6A 4OWXB 1WOCA 1SFOH 3CC2A 1XNRQ 3CPFA 1P8LA 3STBC 2R92H 5EAYA 5IYBG 4JI3L 3JAMi 4LF8L 5GAGC 2HHHQ 3W1BA 3ULJA 2YV5A 3PGZA 1E1OA 2ZTDA 4YCVA 4BA1I 5IWAL 1KD1C 4HJ7A 2R7FA 4DV6L 4DK6C 2R92G 3FHWA 5IP7G 1PH4A 1PYBA 3J7ZC 2RCNA 1S40A 1IBLL 1PH7A 1WI5A 1QUQB 5HY6A 4PZ8A 4YCUA 1EOVA 4JG2A 4LW1A 4DR2L 5K36G 4DR2Q 2NZHA 2R6GA 2UUBQ 4DUYQ 4KHZA 5IYCG 4A93G 4APVA 3A5ZB 1H95A 1XPOA 3GO5A 4HJAA 3HOWG 3PIPA 2AHOB 4X62L 1HZBA 4A3KH 1Y1WH 4BY7G 2GVAA 4L5QA 1HZAA 4JBJA 2CQOA 1VQ7A 1NE3A 2NVYH 2CKZB 4HIDA 1SMXA 2MQHA 4A3DG 4IJHA 5IP9H 4O0AA 1VQPA 1HNZQ 4JBKA 3KJPA 4IPGA 4L5SA 1EUJA 4DV0L 1NJIC 1I94L 4GS3A 1XNQQ 1CKOA 1L1OA 3U50C 4IOCA 3J7A5 1Y1VH 3CCEA 4NXNL 4DAMA 5LMUQ 3M4OH 5GAEC 2N49A 3CMAA 3S16H 2B29A 1U0LA 1B8AA 1X9NA 3HOVG 1OXXK 2AKWB 4LWCA 1VS0A 3E9HA 5FLMG 4A3FG 4DR4Q 1CUKA 2JA5G 2NZOA 4NB3A 1VQ9A 4OX9L 1Z47A 4DV7Q 3BU2A 5BR8L 1NMFA 3OYYA 3F8TA 1KXLA 3PO2H 1HR0L 1PHJA 1L1OC 2CFMA 1N34Q 1UWVA 1HNWQ 2C35B 3EIVA 5M5WH 5IP7H 2WAQG 3GTMH 3M9BA 1SROA 3E9IA 4BBRG 3H15A 1X65A 4PG3A 2VQFL 2VQFQ 1VQ4A 1X3FA 2EIFA 3HKSA 3UDGA 1XMQL 1QVFA 1SLJA 4GLAC 1A0IA 1EQRA 1WCMH 1PVOA 4A3JG 1UE7A 1IBML 1ASYA 2A1AA 3CW2C 3KOJA 1D8LA 4EQ5A 4GNXB 3CCLA 4UP8A 2R93H 5C4XG 3UE0A 1V43A 2HHHL 1E7ZA 5H1SE 1B7YB 4IPHA 1YZ6A 2NVXH 2KENA 1GVPA 3I2ZA 3CMEA 3NEMA 2VUMG 4DPGA 1HNXQ 3I4NH 2R93G 3CF5A 2OTLA 1GKHA 1P16A 4DUZQ 1OTCA 4NXMQ 3I55A 4DV3L 2LXJA 4WJ4A 4DAYB 4OXPA 4NPSA 2V1CC 3PO3G 1EIYB 2WFWA 1BVSA 4BY1G 2KCTA 3NELA 1PYSB 2IHFA 4QQBX 5BR8Q 3PUXA 4LF5L 4LF5Q 2XTIA 1I6HH 1AE3A 4B3TL 1UE5A 4A3LH 4X64L 5FJ8G 1I3QH 4LF7L 2ZM6L 4GOPA 2B63G 4BXXG 1LYLA 4IJLA 1X3GA 3J81j 1N33Q 3HOVH 2E5LL 2EXDA 1I50H 4UY8C 2JK8A 4YWKA 1K73C 1I5FA 1X55A 5IE8A 1FL0A 3D31A 4JI2L 3RZOH 1VQAA 3EN2A 3CCUA 1VQKA 2GVBA 1YJWA 4GKJQ 1KQSA 3E0EA 2VL6A 2N8NA 1WYDA 4DV2Q 4BBRH 3S15H 4YWLA 4BBSH 1YEZA 3TS2A 2VS1A 2Z0SA 4QIWE 1G51A 5DLQE 4DUZL 1IL2A 3TRZA 3PUVA 3W1GA 3GTJH 4LFBL 3D0FA 2I5MX 1FJGL 3BZKA 5C0XI 1PH3A 2E2IH 1CKNB 5FLMH 1K8GA 1Y1VG 3PF4A 3STBD 3H0GG 4ALPA 4A3EG 1XMQQ 4X62Q 1X3EA 1E22A 4P72A 2Y0SG 4POGA 1VQOA 1QVCA 3HKZE 4MTNA 4TQUS 3AFPA 1IXRA 3ER0A 3HOXH 5ELOA 4A75A 1HJPA 3U4VA 3KJOA 3GTQH 4JI7L 4ME3A 2UU9L 1WFQA 2DGYA 3EBEA 4JC0A 4LUOA 3PIOA 4GNXA 3FKIG 2BA0A 3A74A 4UP7A 2RHSB 4MZ9A 3HKZG 4JI8L 4A3MH 2B63H 3FP9A 4QJFA 2VW9A 4A3LG 4LF9L 3U4ZA 2JEBI 5M3MG 4A3GH 5C4JH 4GOPC 2OWOA 3RLNA 1K9MC 4A4IA 4JI3Q 2UUAQ 1Q1EA 3ZJYC 4A76A 5M5YH 3OTOL 3RZDH 3CCMA 4LFAL 1OXVA 1Q8KA 4P74A 5M3FG 5GAHC 2F4VL 1X6OA 1KHIA 1VQ8A 3HOZG 1L2FA 1WJJA 5IWAQ 1XNRL 4DV6Q 1JJCB 2B3GA 2R7DA 3S1RH 1XNQL 1FJGQ 3JC66 1PH9A 2ZM6Q 4POFA 1EIFA 5GQOA 1N9WA 3NENA 4DV1L 2D0PA 1TWGH 3RLFA 1YJNA 2Q2TA 1X54A 1AE2A 4AYBG 3PO3H 1Y1WG 4IFDJ 1YVCA 2F3IA 1IBMQ 3I4OA 4DR4L 1IBKL 4LFCQ 2LXKA 1Y14B 5M3FH 5LMNW 4YY3L 3KDFB 4A3KG 3GTPH 2UXDQ 5C3EH 2UXDL 5FJ8H 3I56A 2QA4A 2K14A 2FXQA 2ES2A 4JV5L 3UDIA 4GKKQ 3T1HQ 4BXXH 2IHEA 1JE5A 2OQKA 3J80c 1XTDA 4B3SQ 2UXBQ 4DR1L 1S72A 4A3JH 3CD6A 2Q2UA 3G6EA 1HNXL 3T1YQ 1U5KA 4IPCA 4DR7Q 3UDXA 4DV4L 1Q81C 4DV4Q 1UE6A 3HOXG 4OONA 2MO1A 2BA1A 2JA8G 1Q1BA 1A63A 4NXNQ 1YHAA 4LFAQ 4YHHL 2E2HH 3GTOH 1VQIA 3LGJA 1XMOQ 2JA5H 2ID0A 3H3VI 2AWOA 3CPWA 4R4TA 4LUVA 2Z6KA 2JE6I 3ULLA 1YHBA 3BZCA 4IFDG 4IOAA 5LMUL 4Y7NH 4DR6Q 2HQLA 4GN3B 4DR5L 4LF6L 1JJGA 1CSPA 4OO1G 1PH8A 3CC7A 1J5EL 3HOUH 2RF4A 3M4PA 1EWIA 4DV7L 1A62A 5IYDG 1JB7A 3GTLH 2OQ0A 4HJ5A 2Y0SE 1KAWA 1R9TH 1Q82C 2UUCQ 4YWMA 3T1HL 4C3JH 1MJEA 1MIUA 3RN2A 1HZ9A 2K4KA 4JYAL 2UXCL 4UP9A 4R4OA 2NN6G 1LM0A 2WB1G 1QUQA 4PMWA 3KYHC 4O2DA 2WAQE 4A3IH 1LUZA 1VQDA 2H5XA 1EQQA 1M90C 4WJ3M 4R4IA 1Z9FA 1J6QA 4DV0Q
chains in the Genus database with same CATH superfamily
1VQ6A 1N36L 5C44H 3M4OB 1PTOC 4K8JA 5JQWA 2MO0A 2L15A 1JIHA 3MXNB 2ENBA 2X0SA 1R4PB 1B9NA 5IT9W 2JA9A 3MXPA 4DV3Q 4HJ8A 4LF8Q 4Y52H 1EEFD 3S2DH 3CP0A 3N43B 4B3TH 4DV2L 1UC8A 2UUCH 5CV7A 2XGPA 3Q22A 2V59A 2VQEQ 1S3OA 1SYCA 4A3CG 3DWQA 5DGAA 4ECWA 4LFBH 3D3RA 2MHVA 5DQIA 3DXJC 5L1LA 2I87A 1HA5A 2BH8A 4RUAA 4A3IB 2L5TA 1XPUA 3K7AB 2XSCA 4JI5Q 4RFBA 1WTVA 2N78A 1W96A 1SBBB 3PW0A 1O78A 1RJTA 1R9TB 2L0CA 3BJUA 2EJMA 1I50A 5EGTA 2NZ1D 4LF9Q 1SDFA 3PF5A 5K36H 4ETSA 3FMCA 3GTQB 2R6FA 1A9XA 4R1JA 1K8OA 1WTWA 2O2LD 4MNOA 4EEQA 3RB6A 2DUDA 5IP9G 1WCMG 2K05A 3QWNA 4GC6A 1VDZA 1DCZA 4PZ7A 4JBMA 3S24A 2BE5C 3PV0A 3TP7A 1K1QA 3MA2B 1EWHA 1SXTA 4A3DH 1A3TA 5D65A 5ELDA 1HR0H 2FMCA 2R7MA 4PWQA 2IT1A 5JJIA 3R93A 3U58A 1GUGA 1K0RA 2K6AA 4HCEA 4GLVB 4X3SA 2JQOA 1S0MA 1K83B 2NB0A 3A8JE 3F1ZA 3S1QB 4MV7A 2UU9H 4JYAQ 4ED8A 3MC0B 1HUMA 4JI5L 2A6HD 3IG0A 1L0YB 5KT2A 2UVRA 2VZAA 2I5LX 2WYOA 4MA0A 2ZJRA 4L63B 3HFZB 3T16A 1PRTD 4CJ0B 2HT1A 4JI3H 3VYSA 1YIJA 3PMFA 4YY3Q 1U9RA 5DQGA 3QB3A 2AUJD 1H9KA 1EUCB 1K3RA 4KJNA 3HP3A 1E24A 4B3MQ 2RDIA 1ASZA 2W9BB 4Q0FA 2DJGC 3CCQA 3NPPA 3GTJB 1KLUD 1SEIA 3FVQA 3P20A 3OUUA 3VA5A 5M5YB 1DV2A 1N34H 3K7UC 1JJ2A 3E3XA 1EZ1A 1V1OA 1TWAH 3PQIA 3OIQA 3TREA 2VUMB 2X6LA 4RKLA 3HOYG 1PDQA 4O3QA 5FLXc 1HR0Q 1E4GT 1VQGA 3PO2G 2YU9B 4K0KH 3J7AK 2B2UA 1TQOA 4B3RQ 4ECYA 2D0OA 2K75A 5KFLA 1KBLA 2MUYA 3ICEA 1GJXA 5KNCA 3MEHA 2ZTEA 2W6PA 1KIXA 4DLKA 5EPKA 2JA7H 4RU9A 1EFID 3TIIA 1BCPD 5IT9L 4B3ML 1UEAB 4XT1B 1HFNA 4KN7C 3D6WA 4XYOA 3M3YH 2PQAA 4N8X1 1KRTA 1EFWA 1A2TA 3MVVA 4B3SL 2L1BA 4ECRA 2W70A 2EOTA 1VCIA 5I6YA 1JXLA 3DEOA 4HR7B 4QF4A 4YCWA 4AYBB 1VQ5A 2R8HA 3K5LA 4DR7L 3R2IA 2BOSA 1HNWL 2CW8A 3L4JA 4DR6H 1IYVA 4HMJA 1VQFA 4DV6H 5E4WC 4JUZA 1XDNA 2YL2A 1PH2A 4G3IA 4O3PA 4JCVE 3G4SA 2A19A 2B2TA 2DY7A 4TSSA 3ERQA 4DN4M 5C4ZA 1TXYA 2PVPA 3ERSX 3BA9A 1O7IA 5DEHA 4HQ6A 3TINA 4FXKC 1JDBB 1LTTD 2JA8B 2F0DA 4MA5A 3RD4A 4DL3A 3GTQA 4X65L 4KHPL 3T1YL 3M4QA 1B70B 3FPPA 3W5OA 1PMRA 4Y7NB 1PH6A 1RK5A 4QWDA 1S0OA 1PRTF 3M7NA 4JI4Q 2F0OA 4HMIA 2N55A 1F77A 1SAPA 3GTGH 3V6KA 1NR4A 2F0MA 4LH7A 2N88A 4X3KA 3KFUA 1I4PA 1K28A 1VQHA 2F1MA 1VQBA 1RJPA 3N40P 2N3SA 4JBWA 1B3AA 1JDEA 3S9WA 2VY3A 4HEDA 3GIKA 4IUUA 4ABNA 4KHVA 4O2AF 5IODA 2W9CA 4DXGA 1PFBA 1SYGA 1E3PA 4X62H 2VQEH 4IRCA 1IKMA 3K7AH 2DLNA 5I9OA 4QW8A 2YYZA 1PH1A 2JEGA 5DLFA 2SNMA 1L1OB 4O3OA 3WO0A 2XCLA 2DN8A 2YS6A 4C3IH 4V190 3Q8PB 5ELCA 4J9LA 3J81W 3CC2A 1PA6A 1EY8A 3CPFA 2PMZB 1P8LA 3S2DB 4GKKH 3RFCA 5IYBG 3GV8B 3RUZA 3H4DA 1PTOB 5A35A 3JAMi 3N41B 3ULJA 3T4AC 3PGZA 3GTGB 1IBMH 2R7FA 1JOOA 3NK9A 1ICFB 1TA8A 2G9HD 1PH4A 4RCOA 2RCNA 2YYAA 1F9RA 2ZXPA 2J9GA 2PBZA 1PH7A 2R8IA 3Q1KA 2JEIA 4LF4H 4ZOLF 1GSAA 5BMVF 4DR3H 1HNZH 2ATLA 2YU9A 2UUBQ 4DUYQ 4A93G 4RZQA 3HOWG 5ELEA 4CDCC 4PNYA 4X62L 4LMQD 3Q8RB 4C5CA 3S1MB 1GHKA 1EQVA 2YRXA 3O13A 1NE3A 5JH7F 4RCNA 4HIDA 4A3DG 1ZYRC 4IJHA 3QO2A 3T51B 2J6TA 4HNVA 1F9PA 1RTOA 5HBRB 4BWGB 1EUJA 1KDCA 3J7YW 1NJIC 1EY5A 1QNUA 2F0UA 1BBXC 4GS3A 4DV0H 1D5XC 3N6RA 1CKOA 4IURA 4QMGA 4A3DB 2BE5D 5IYZF 3RJ0A 4S3SA 5JPMC 4RGNA 3CCEA 4NXNL 3M4OH 1GOZA 5I2XA 4O4LF 1BQQT 5KEEA 2CW0D 2F3VA 4A3FG 1CUKA 2JA5G 5KIXA 2NZOA 2FMMA 4OX9L 2NVXB 3BYTB 3BU2A 5BR8L 2PMZA 1NMFA 1N56A 3OYYA 4WORA 5EJWA 4DUYH 2RKSA 1PHJA 5LL6b 1J5EH 2F0NA 4V0BA 3T56B 2C35B 2WAQG 3MHBA 1V51A 5KG3A 1XMQQ 2A68D 4R7RA 3HKSA 2PZUA 4C2MA 3A56A 1EQRA 1FNVA 1VBGA 4A3JG 2KSWA 2VR1A 1Z7TA 1PZID 2F0IA 3KOJA 1STGA 5JUMA 3KF8A 1G8ZD 4EQ5A 5FPOA 2YZNA 4UP8A 3UE0A 1SSOA 1V43A 2HHHL 4O3RA 5DM63 3PIP3 3HOVB 2KENA 2A74C 4DR7H 3U9SA 2JA5B 4DPGA 3MWYW 1L2ZA 1HPCA 5KFHA 1RYSA 5CORA 4ECVA 1RD9D 4RA8A 4TQRA 3D4RA 1ILPA 1RF2D 1SFOB 3Q8SB 5C3WA 3NELA 1PYSB 2IHFA 2XN9C 5BR8Q 5CA0F 1Z2OX 2NU8B 2OF1A 4JV1A 4QCLA 4EVOA 1PXUA 1FR3A 4A3JB 1I6HH 1R4QB 1VMPA 1B33N 2XRQD 4X64L 1I3QH 3QZ8A 1VF7A 3X3NA 4GOPA 3KHLA 5KFNA 4IJLA 1TWHA 5JPNC 2E5LL 2JA7B 2LS01 1I50H 1C4QA 4RWSC 3KAJA 3HS0C 4IAJA 1X55A 5C8YF 5IE8A 4FS1A 1FL0A 1MHWC 3NQIA 4KY6A 4KMUC 1CQJB 1M0TA 4CKEA 1VQKA 2GVBA 4GKJQ 1FNUA 2PYKA 1YNJD 1NR2A 2H1EA 1GUWA 4TV8F 4Q43A 4JK1C 3WOFA 1WYDA 4DV2Q 3S15H 4BBSH 2AQ2B 4H13C 1YEZA 3TS2A 1ENFA 3EA6A 5CV6A 2Z0SA 5KNDA 5ELBA 2ICIA 3GTJH 1D6EC 3D0FA 1T5EA 2HDLA 5M3MB 3Q0AA 3EPGA 2IBKA 4UCSA 3BG3A 1PH3A 5CGKA 5C0XI 2E2IH 1CKNB 3JRXA 2EE1A 1PZJD 2C5CA 2FFKB 3NWTA 4IUTA 3SXHA 4A3EG 1G6ZA 1Z2PX 4GC7A 2Y0SG 3F2UA 3OPOA 2A6EC 3AFPA 2Q8RE 3ER0A 2KA7A 2KJXA 5FO9B 1D2BA 1WR2A 1LTSD 3U4VA 4DNRB 1AUXA 1AZPA 1RYRA 5ISRA 4JI7L 2IP4A 2UU9L 1T94A 2Y0SB 2DGYA 2RDJA 3PO2B 4RB2C 2XIGA 2SEBD 3HB9A 3GTMB 3A74A 2RHSB 4MZ9A 4QJFA 3QJYA 4A3LG 3U4ZA 3FDSA 5M3MG 2OWOA 3AU7A 1TWFA 3GTKB 2UXDH 4JI3Q 3CKIB 4J8QA 3OTOL 4LFAL 5J2UF 4RUCA 2W8KA 2UVWA 4LFCH 2NU6B 5IWAQ 1WJJA 1JJCB 2A69C 5C4HA 2B3GA 3S1RH 2K03A 1XNQL 2C2DA 2L55A 4E6IA 3RLFA 1AE2A 2EYFA 4AYBG 3PO3H 3QZ7A 4UCRA 3QOJA 1A15A 4I55F 4EBCA 4DR4L 2ASDA 1IBKL 1Y14B 4XYQA 4YY3L 4A3KG 3RBEA 1AZQA 3BA8A 2ES2A 5KG2A 1S68A 4J9SA 1XTDA 3J80E 1S72A 3CD6A 1JOKA 1PK8A 4A2BA 1HNXL 1C3OA 1U5KA 1EUDB 1ZKOA 3UDXA 4DV4L 5A2QW 1UE6A 5KFOA 2MO1A 4YR3A 2UVVA 1I4HA 1Q1BA 3HRZC 1A63A 4LMYA 2W9AA 4EFEA 2HHHH 4LFAQ 2E2HH 3GTOH 5CV5A 1MBYA 4C5BA 2PZWA 4R4TA 4LUVA 3PR4A 2YZMA 1FNWA 3VR4A 2K32A 3SHLA 5LMUL 4Y7NH 4DR6Q 2NUAB 4DR5L 4GN3B 2SDFA 4KKSA 3KHRA 1CSPA 1GUOA 2AQ4A 1J5EL 5KT5A 3HOUH 2PCFB 3I3CA 3KLRA 1A62A 5IYDG 1MD2D 4IUQA 2OQ0A 4HJ5A 1LT4D 1R9TH 3OOCA 1Q82C 3NQTA 3JZIA 1BXTA 2W9BA 2B2YA 1ZETA 1N32H 4JYAL 5DQHA 2EYPA 1IYUA 2WB1G 2F4VQ 5JJZA 1DOMA 3D8GA 2DJFC 1SE2A 4PV1C 3F2BA 3BS1A 3HOWH 3F2CA 1W6KA 3LWBA 4H7BA 3GDEA 3FDTA 2KUMA 1E0BA 4L6TB 4U7CA 4A3IG 1B9MA 1IBLQ 3H3VH 1PTOF 3HXLA 4N8FA 1QZHA 1K1SA 3TBIB 1TKWB 2K50A 1VQLA 4QW9A 3FRPB 3RV4A 2YTYA 2PQEA 2JP1A 3KDFA 4DR3L 1J5EQ 4P75A 3KLSX 4LF4L 3N6XA 1SR3A 1AH9A 4FM9A 5T1IA 1DIKA 2HCIA 2XWJB 2B2TC 3RR5A 4GKJH 4B3TQ 4JI1Q 2OH2A 4JI2Q 3NE5B 2DPJA 2PPBC 1FVIA 5DG7A 2MNAA 1KAAA 3KF6A 3K57A 2M2LA 1TWGA 2PNRC 3TEHB 4GNXC 2JXMB 2EPBA 3MXGA 3VPCA 1TWCB 1MGSA 3BDCA 4LAAA 1N8RC 4TVAB 4UHVA 3GTPA 3N52A 5LXTF 4JYAH 3AMUA 3L0OA 3OHBA 1EYGA 4JPBW 1F2MA 3SE0A 1GUSA 5LA6F 2MCTA 1BDOA 4EGQA 4HIOA 2EY2A 4DXFA 4MTEA 1D1KA 4KD3A 5KFYA 5C4XH 4JV5Q 4NLGA 3T13A 5IGFA 3DLLA 2KOLA 5C3EG 2R86A 4YBZB 3MFGA 4ID6A 4PMBA 1QZGA 3RF2A 5E1FA 4LF4Q 2F0FA 3NP8A 2IX0A 1YITA 1SE3A 2PO4A 2TMPA 4RAYA 1N33L 4J15A 5IGEA 1C30A 3P75A 2J7ZA 1KXLA 4MV9A 2NTSA 4C3HH 1Y1VA 4JI1L 5C3EB 5KKNB 4X66Q 4O3NA 5LOVF 3V6JA 2PI2A 3FMAA 2PI2E 3SR1A 3H20A 4JI8Q 5KFGA 4QWCA 3SK4A 2R7KA 5D1PA 3MR2A 4DNTB 2ZDHA 3T5JA 2MP1A 1I4GA 3K5OA 5JAVA 4DV4H 5C1PA 4F8MA 2FLPA 1GM5A 1W3SA 1M4VA 3LP8A 3NTIA 4O4HF 2EYOA 4DUZH 4YQWA 4X65H 1TWCA 4KHPH 4LFBQ 5F9NA 1X3QA 4UAIA 5C44G 3KF6B 2KHJA 4R4QA 1V9PA 2RDFA 1STAA 3JRWA 3S14H 3MTSA 5LMNH 3G48A 2C00A 1MJCA 2B63B 2HIVA 1TWAA 2QW7A 4DR4H 2R82A 1PX2A 3CAMA 1GD7A 2DY8A 3N8DA 4BY7H 4HNUA 2KCCA 3S1MH 1JICA 4B3RL 2AGQA 4JI6H 4DV1Q 4ECUA 2BCOA 3NXWA 1SNMA 5C0XH 4FS2A 1AW7A 1HNWH 1RIPA 5C3XA 2GA4B 4LFCL 1LTBD 2HDMA 1QE6A 4KI0A 4IFDI 1CI3M 2NVTH 2KHIA 4JI0L 1HCZA 4H02A 1HXYD 3S1QH 4Q44A 4H0LC 4OGQC 2UXBL 4DR2H 2QEJC 3PW2A 1IW7C 2UUBH 3I7FA 3H0GA 2I5HA 2GN5A 1G91A 2W6OA 1F9QA 3LNNA 3CQZH 4XDXA 1Q3LA 5GADC 5A2QE 3MAQA 4IHJF 3HOUG 2QF7A 4A3FH 3A5UA 1QNKA 3VA7A 4IUNA 3I4MG 1TWFH 1ULZA 4DK3C 1BNZA 3UE1A 2O5IC 5C6AA 1Q12A 5LMNQ 2A73B 4U68A 1SMYC 2JEJA 1C0AA 1WTXA 3CU7A 1E4EB 2ASLA 1PFSA 4R8UA 2J6UA 3PSIA 4R4CA 1NBWA 1NTGA 3OWEB 3V6HA 3HOXB 3CRLC 4J9RA 1SNOA 4G57A 2UUBL 4X65Q 4KHPQ 2BQUA 3P1HA 2K5VA 1L0WA 1JT8A 1VMCA 2R92A 4AH6A 1NNXA 5KFBA 4JI0Q 1RODA 3BDLA 3R8BA 3G71A 2WIIB 5C0XJ 3TS0A 4IPDA 3SDZA 4DV5Q 1UUPA 3CCSA 2UUAL 1AN7A 1PTOH 4UCUA 3TQTA 2BQ3A 1OXSC 1KABA 2PMZE 1VQEA 4FDBA 2QK4A 2R61A 5M3MH 3GTKH 4RNOA 4KK7A 5D14A 2C2EA 4JI6L 4F4YA 4B3RH 3K0XA 4ZYSA 4X64Q 1T3NA 4IO9A 4NXML 3IAYA 4K0KQ 4OO1I 3C2PA 5CV8A 3H6MA 5L1JA 5KG6A 3M3YB 4LF6Q 4A3BG 2AQ3B 4DF7A 2LSSA 4RAUC 4EQNA 3L7ZC 4DV5H 1YJ9A 2PNHA 4BS9A 4YIJA 1H9JA 3S1NB 3OW2A 1G2SA 2Q2IA 1QJOA 1ZEQX 3M85A 2JEAI 4A3BB 4XZ3B 4JI0H 2R7NA 2XIWA 2E2IA 5JVLA 3J81i 4A93B 1II3A 1K8AC 1B50A 4LH6A 4RG1A 1ET6A 1RJRA 2KBNA 3ORQA 2HGSA 2XC9A 5IGGA 3RB4A 1XNRQ 4R8UB 3H09A 4EBEA 2R92H 1Y1WA 2HD3A 1CZWA 5I2YA 4LF8L 3KALA 4ED3A 2HHHQ 4DFAA 5KNBA 1E1OA 4YCVA 1AUVA 4K2KA 2CW7A 4YJ2F 4FP5D 1L0XB 1TVXA 2KEDA 2R92G 3C0FB 3OHAA 2IL8A 3NBIA 2PW5A 5HY6A 5F9LA 1H9SA 3BAAA 1EOVA 4DR2Q 3TMEA 1B53A 5IYCG 1F2LA 3A5ZB 1C48A 1EY6A 5ELFA 2AHOB 5KFIA 2R93A 3VPDA 4L5QA 2W8LA 1B6RA 1SMXA 2W6MA 4NXNH 1HNZQ 4JBKA 3KJPA 4ED1A 4DV0L 5L9XA 1H9SB 4FNFA 1PRTB 4OL7A 1I94L 1N33H 1XNQQ 1N36H 2M00A 1LV9A 1L1OA 3U50C 4IOCA 2R92B 1SYBA 2E2HB 2NU7B 4DAMA 1JOQA 3S16H 1UNNC 2B29A 2L12A 1B8AA 3HOVG 1WCMA 4DR4Q 4KKTA 1X3PA 2D5DA 4DV7Q 2K1BA 4QUCA 4G7ZC 2F0KA 3R5HA 5IT9E 1V1PA 1N34Q 4IRDA 3GTMH 3K5NA 5IP7H 1SROA 4ULLA 3TZUA 2K7VA 1X65A 3VYUA 4K2LA 4WRDA 4BBRG 1X3FA 4I7ZC 2E75C 2VQFL 2IX1A 3GTLB 3G6VA 4DU9A 3SK5A 4FF4A 1PVOA 3GTJA 1PTOD 1CA6A 1IBML 1WTOA 1ASYA 4RHSA 2FLNA 2R93H 5C4XG 2MGSA 1U4LA 3OMGA 1RDPD 2ASJA 4ECSA 4C5AA 5H1SE 5JVG3 3CHBD 2RDHA 2NVXH 3E6ZX 1YNJC 3ZYYX 1GVPA 3I2ZA 4Q45A 2R93G 3I4NH 2WTFA 2OTLA 1GKHA 5I6WA 4DV3L 3I72A 2LXJA 1EY9A 1AFPA 4DAYB 1DOLA 3G6XA 4OXPA 2V1CC 2EZVA 1MSGA 4F4ZA 1EY4A 3GIJA 3W3AA 1ML0D 1SJED 2DIKA 4BBRB 4QQBX 2NTTA 3J81E 5KG1A 1AE3A 2ZJTA 1UE5A 2WKCA 1RCVD 4LSAA 4J9OA 3H40A 4QIWB 1DM0B 5C4XB 1ILQA 2VB3X 3J81j 1I3QA 4DAVA 3Q2OA 3BVGA 5KG4A 1N48A 3GTOB 3RUPA 2R93B 3CCUA 1BUVT 5FLXW 1KQSA 2CQYA 4DL4A 1TS2A 4GZYC 4HSPA 1A2UA 3LWUA 5DGBA 1D5MC 2L9HA 3QFFA 3I4NB 1G51A 3RV3A 4MAMA 1CQIB 1WVLA 1TY2A 3PUVA 3K5MA 3EPIA 3DUZA 3JAMW 3LMLA 4ED0A 2L4NA 1FJGL 2A6HC 5FLMH 4OIJA 1K8GA 4YJ3F 4P2CB 3STBD 2CH4W 3MR3A 4H44C 4O3SA 2EYJA 4P72A 2IWHA 2XCPA 3HKZE 4TQUS 4LF8H 3HOXH 5ELOA 1HJPA 1DD2A 4FU0A 1XNQH 1EHIA 2C22A 3GTQH 5HURA 4ME3A 1RTNA 1WFQA 1KJ8A 5CAEB 3I12A 3EBEA 4MV3A 4JC0A 4CJ1B 3ITPA 1W6JA 4LUOA 4A3KB 4PDBA 3FKIG 1HNXH 1AEXA 1Z6HA 4TV9F 3T1HH 4IN3A 2CQAA 4HCSA 3LX0A 4LF9L 2VB2X 2JEBI 2LFNA 3RB3A 3ORRA 1BNCA 3GTGA 4K5WA 4GOPC 4HNTA 3RLNA 1K9MC 4A4IA 2NVTB 2ALZA 3M4YA 5EPLA 4YY3H 3RZDH 2F4VL 4FF3A 2A69D 1Q8KA 1IBKH 5GAHC 1V4YA 1X6OA 1L2FA 4DV6Q 1IL8A 2R7DA 1FJGQ 3D4WA 3JC66 2ZM6Q 5M5XB 2R8KA 3MFYA 5GQOA 1N9WA 2FMAA 2D0PA 2Q2TA 1X54A 5DG8A 1YVCA 1E2WA 4Q5VA 3A7LA 2QYZA 4APMA 5KFMA 5M3FH 5LMNW 4LFAH 3Q6SA 5C3EH 2UXDL 5FJ8H 2QA4A 2K14A 3VMMA 3DM1A 3T1HQ 1WTPA 1CFMA 1Y1WB 4BXXH 4QWBA 1JE5A 3DWPA 4AYBA 2OQKA 3J7AF 1LT3D 4B3SQ 4ODGA 1I4XA 2F0JA 2Q2UA 3G6EA 3G8CA 5T14A 4ME6A 3S1RB 4DR7Q 1Q81C 5G3LF 3Q24A 2JA8G 3K6OA 1M8AA 4MHEA 3PW4A 1YHAA 3ETHA 1WTQA 1VQIA 2AUKA 4O42A 5KYIA 1XMOQ 3H3VI 2AWOA 3CPWA 3GV5B 2YS7A 3ULLA 1KNAA 4X64H 3BZCA 4JW0A 4M7EA 1XMQH 2VA3A 2RSNA 2HQLA 2JYOA 3AB9A 1JJGA 2F4VH 3K0YA 3DMUA 2NN6H 1Z2NX 2WAQA 1JB7A 3GTLH 2Y0SE 1KAWA 1LT5D 1TIID 1Y8OB 3T1HL 2UUCQ 4C3JH 1RK6A 2E2HA 2K4KA 3BVMA 2NN6G 4PMWA 4UCVA 1LUZA 4WJ3M 1M90C 1FKAH 3EROA 2EXZA 2O4XA 2ZXOA 2VUMH 1SYXB 3BVZA 3KBGA 3SK8A 2EY1A 1B2TA 3M9OB 2A5HA 2K01A 4RZRA 1TS5A 2B39A 4J9KA 1Q46A 3BQ0A 1HH2P 4FXDA 3N44B 4BY1H 2EQSA 1Q7YC 4K5VA 2K52A 2Z4HA 5LMNL 3WO1A 2JA7A 1HZCA 3H91A 3RNUA 5KFZA 4C3IB 2NVYA 2ALYB 2F0TA 2F03A 5IT9c 3OUZA 4XXEA 4DR3Q 2F0SA 3T5HA 2F0GA 3GILA 2MPMA 4JV5H 1EZ6A 2FK3A 3SI8A 5KFXA 5JEAG 5M9OA 4CKBA 5C0XG 1DZ1A 2UUCL 4YAKB 4DV2H 1BCPF 2V4DA 3K5IA 1QG7A 4ED7A 2F0HA 1BF4A 4ZCKA 1AP0A 4KY7A 5CV9A 2D2CC 1JKJB 1JR0D 2WB1A 1TT2A 3VR5A 1TWHH 1LTRD 2QDLA 5IYDH 1TWFB 4FBUA 3TQYA 4DL5A 2V58A 5L1KA 1NY4A 1CKMA 4JI4L 1M7JA 2AMCB 4UPAA 4DKAC 3N42B 4KN4C 3KF8B 5KG0A 1BBWA 4DUYL 3HOZH 1EYCA 1I4QA 2QCPX 5IY0A 5BR8H 2OTJA 1I6VC 4QUFA 3BG5A 3PN1A 2CHBD 5KFPA 2YCHA 5C44B 1LLRD 2WP8J 4IFDH 3T5KA 5CR3A 3K59A 4I65A 1NAPA 1OXTA 3M7GA 4M8AA 2A8VA 2UXCQ 1S9FA 3FKIH 5JEAJ 2BH2A 2XVSA 2IY5B 4ECXA 4EGJA 1IHZA 5M5WB 4HIMA 2B8GA 2IJ0A 4AQYL 5AJ3Q 3S2HH 3NBHB 1HFGA 2CW0C 1DGSA 4WJWA 4GKJL 5CYUA 2TSSA 3HOYH 4B08A 3KTMA 1QVGA 4PQXA 5BN5A 3EYYA 3KLWA 1HQMC 3W2DA 2FKLA 4XYLB 3OSNA 1JMCA 1Y1VB 5KFSA 2AGPA 5DNFA 1RHPA 3S16B 3RZDB 3DWAA 4IZOA 2XCAA 2Z6KC 5KFRA 1G291 1PZKD 4QY7A 5FD6A 3SE7A 1M6VA 4KV6A 2LKVA 4OX9Q 2DNEA 2NN6I 4I7HA 4ZAIA 2ZT9C 4A3BH 4C3HB 1CSQA 1XX8A 4JI2H 3J80i 2F0LA 1S97A 1KJQA 5J2TF 1PLFA 2HCCA 1SYDA 1XTCD 4AQYH 5D1OA 1K3BC 4EX5A 4GKKL 1D5ZC 4NMZA 1C8CA 2K5NA 2R8GA 4P71A 4DL6A 3WNZA 5JVDF 4L5RC 1YI2A 3TQ1A 1N32L 1E1TA 2OXPA 3ONAB 1TWGB 2FE3A 5JVH3 3ULPA 3F2DA 1TWAB 4JV2A 5C5LA 2B2UC 3PW5A 5JOBA 4JOIA 2B2WA 4R9WA 2AWNA 4XTCS 1SYEA 4C1NK 4EQPA 2VQEL 2R84A 4N9TA 1YBYA 4C3HG 2NBFA 4GN4B 3V05A 4CGYB 1E4FT 1UEBA 1EEID 2ATWA 1G2TA 4G7HC 3OMCA 5HV6A 2QGQA 4IR1A 1GYFA 3I4NG 2CH4A 1VBHA 5TSSA 2FPPB 3OHXC 5IOCA 4RH6A 1LTLA 3RAXA 4L8JA 4Z9CB 4FYDA 1BGWA 3F8NA 5IYCH 2PQAB 2KVMA 4XT3B 2B63A 1SEBD 2ZJPA 2G9DA 3HZXA 1SRUA 5IGCA 4KLKA 5FLXE 2RVLA 3S1NH 2NVQH 1D1IA 2YTXA 3I4LA 4J9QA 3P7JA 1K83H 1TS3A 3T1YH 2E8GA 3I8ZA 3AFQA 4MTDA 3MEFA 2Z6BA 3JAME 2FPIB 3BQ2A 5D1OB 2FK1A 4ZHQF 4DV5L 4TQSA 5J3BA 2J6SA 5JJKA 5BPHA 2WB1E 3CCJA 4U673 2XGTA 3SGIA 5EWFA 3KLSA 3WDNA 1BO0A 3GQCA 3B6YA 3GD7A 1JX4A 4KY5A 1CQVA 3Q23A 2RHQB 2ZJQA 4NXMH 1PRTC 4CC5A 3L9AX 1N36Q 3J80W 1E2VA 1KRSA 3D4DA 1C9OA 4OWTB 1QOHA 4K0KL 4F4WA 2KCMA 4L5TA 1GHJA 1CZGA 2EYMA 2JA8H 1UNSA 4DR6L 3PUWA 5LL6S 2UU9Q 2RGVA 2JJQA 4DR5Q 1CA5A 4IALA 5BPFA 4ZRZA 3OTOH 4LF5H 5I9PA 3PVXA 1I50B 5KFFA 1R9TA 4KD4A 3TZDA 3R5XA 3SVMA 3TIGA 2BQRA 3PCOB 1OXUA 4IUPA 5IYBH 3DM3A 1BBUA 1SN8A 1N34L 3CQZB 3BYYB 3GTPB 3NBHA 1IZ6A 4HN7A 1U4MA 3L2PA 5M5XH 1VQMA 1STNA 1JQYD 4GN5A 4OWXB 1WOCA 1SFOH 4F50A 5C4JB 1I7LA 3ND9A 4DL2A 3STBC 5L1IA 4JI3L 1EIHA 4HTHA 1I6HB 1KNEA 3W1BA 2Z8LA 2B2VC 2YV5A 2WACA 5EOYA 2ZTDA 3H94A 2E2JB 1ESFA 4BA1I 5IWAL 1KD1C 4HJ7A 4JI5H 5G3LD 1IBLL 3V96A 1S40A 3GIIA 1WI5A 1IOVA 1QUQB 5LP6F 3GIQA 1LTAD 4PZ8A 1ZQ7A 5EKIA 4DR2L 2UXBH 5K36G 1MZBA 2NZHA 4KHZA 1JB3A 4UCOA 1DV1A 3RIZA 2WB1B 1QB5D 3GO5A 1XPOA 4G7OC 4NW2A 5I4DA 4A3KH 1HZBA 1Y1WH 2GVAA 3EJIA 4A2AA 1HZAA 1VF5C 2AGOA 2NVYH 4XX0B 4CDFC 2MQHA 1KC7A 1H9MA 2EVBA 4O0AA 2E76C 1VQPA 1EY0A 3TP8A 5K5PA 5J22A 3RBDA 4C3JG 4IPGA 4L5SA 5EDWA 1AN8A 3UFXB 3PZPA 2YZGA 3GIPA 1SNCA 3J7A5 2FJZA 1Y1VH 5FLXL 3KHGA 5LMUQ 2NU9B 5GAEC 4O1NA 2W6NA 1OXXK 5FLMG 3E9HA 2W6QA 2WV6D 3BZDB 3URYA 3G7LA 2XD4A 1KDBA 5LHY1 3R23A 2W7OA 3C1EA 3PO2H 4O2BF 1HR0L 3PIO3 3V4SA 4RNMA 4Q8FA 1TU2B 3GV3A 2W6ZA 3EIVA 5M5WH 3M9BA 3E9IA 2VQFQ 1EWCA 1JCKB 1DONA 3UDGA 4GLAC 4C3JB 4RB1A 3BDOA 5COYA 4UDUC 5AFWA 5A2QL 5DAUA 4HR7A 4JI1H 1LTGD 1CHQD 2AU0A 1E7ZA 3J7AV 4IPHA 4R8NA 1YZ6A 4NP5A 4YB8B 3OW7A 3CMEA 2K5WA 1HNXQ 5KFKA 3CF5A 1YNND 2I80A 3I55A 2J0TD 1TWHB 1BCPC 3K3VA 1XYIA 3J80L 4OX9H 2KCTA 4F4XA 3TN2A 4F7XA 4C1NI 2XGQA 1O80A 3PUXA 4LF5Q 4MN3A 3CVZA 4B3TL 1KTKA 2LMCB 4LF7L 5F2DA 4C56C 5FJ8G 4EEYA 2HUGA 2ZM6L 3H0GB 3NTKA 4BXXG 1LYLA 4DV1H 3OSOA 1Y8PB 4DGZA 5KYLA 3HOVH 2F3WA 2W57A 1KJIA 1WH2A 2JK8A 4YWKA 4MV8A 2F4IA 3HG9A 1STBA 4JI2L 3RZOH 5BN3A 1VQAA 3EN2A 1EYAA 2O5JC 1PFMA 1A6XA 2VL6A 3MXUA 4EQOA 1KEEA 2P5ZX 1KDAA 4BBRH 3MXNA 4YWLA 1U4RA 5DLQE 2FJ2A 3TRZA 1S0NA 1Y69U 3MWEA 2W9CB 2KCNA 2I5MX 3RTXA 3K3PA 4A3MB 3V2TA 1JE4A 3BZKA 1F2YA 5J39A 1TAEA 4IWYA 4ZQ3A 3PF4A 3H0GG 4MV1A 2UVUA 4X62Q 2ZDQA 4RB3C 2L11A 1VQOA 4MTNA 2X69A 1EQTA 5KFCA 1FD7D 1UC9A 3FKIB 2M05A 3HKZB 5L37A 1XNRH 3QIAA 1M0WA 4EG0A 1QCBD 3S2HB 4LSXA 3PIOA 4GNXA 1QWYA 2BA0A 4UP7A 4JI8L 3HKZG 2B63H 2XNAC 5KT7A 1IW7D 5KFVA 1BOSA 3GQBA 4IQZA 4A3GH 5C4JH 3GV7B 4ZLTF 2FP4B 2XWBB 2UUAQ 3HOUB 4I50F 3ZJYC 4DAYA 3VYTA 4DR5H 2VA2A 4X3UA 5JJLA 5LMUH 2KECA 4MTKA 1VQ8A 3V4ZA 4J6HA 1GUTA 4ECZA 1PH9A 1I94H 5FKAC 4POFA 4DV1L 1YJNA 3E5NA 1TWGH 4IFDJ 1HUNA 4OEMB 3KHHA 1B1ZA 1Y1WG 2F3IA 5DG9A 2R87A 3A8KE 4LFCQ 1HTPA 1CHPD 1K0SA 5C5JA 3GTPH 2UXDQ 4IR9A 4K5XA 3I56A 3UQ8A 4JV5L 1SJHD 1YNNC 4K6DA 4OHJA 5C5MA 4R8IA 3LWEA 2EDGA 3VR6A 2UXBQ 3GTOA 5EWGA 4A3JH 3BJYA 1MI2A 2V9WA 3A55A 3T1YQ 2GPWA 5CB4F 5D3IB 3OWFA 3HOXG 3KUPA 1V8QA 2Q8TA 5IGBA 1S5ED 3A8IE 4MIUA 2X6GA 4ZUIA 3SEBA 4NXNQ 2WDTA 3TP5A 4YHHL 4EYHB 3C3LA 3MJFA 2JA5H 1T36A 5LYJF 2Z6KA 2JE6I 2OEOA 3HOWB 1YHBA 2C2RA 4IFDG 4IOAA 4BY7B 4TKOB 3GP7A 1EU3A 4CBVA 4OO1G 4TRDA 2RF4A 3OSPA 2AQ1B 1DXMA 1A3UA 2NVQB 1W93A 3TP6A 3UI2A 1HA6A 1OWTA 2V4RA 5LL6X 4ZK9B 1H9RA 2V5AA 2R3ZA 2UXCL 4UP9A 4R4OA 2FLLA 3GIDA 3GTMA 3C46A 2RBMA 4A3IH 1EQQA 3KYHC 1IKLA 4JI7H 2H5XA 2HVRA 4R4IA 1Z9FA 4ECTA 5E3FA 4DV0Q 3MWDA 1PFNA 2VXWA 1I4RA 4ME5A 4JI6Q 3A54A 5KGUA 3DHQA 2XRSD 1Q8IA 1V1PB 1CT1D 4YHHQ 1C7YA 4DNIA 4ED6A 3UDFA 2WINB 3S17H 2IPKD 1X56A 3BQ1A 3JSLA 2MFIA 1ENCA 1S5BD 1UE1A 1E2ZA 5KFTA 3DEPA 1S10A 3OIPA 2OCEA 3VR3A 1B3QA 3X3MA 4CKCA 5GONF 3CXCA 3HKZA 2R7ZH 2CWAA 1CK1A 2K04A 4RGMA 1IBLH 4AIMA 4RMFA 5CA1F 2E2JH 2WAQB 3PUYA 1IYJB 3AQQA 5KX5F 3IRBA 4F88A 3Q8DA 2NVXA 2R7ZG 3MWMA 3K81C 4Q0YA 1U4PA 1CKNA 3CCRA 1XJVA 4A3FB 4XYMB 4HYKA 4QIWA 4DK1A 3RGXA 3A0JA 1KLGD 2EY6A 3C1FA 3I73A 3VDYA 4XQQA 1I7NA 3I70A 2UXCH 4BWSC 5HGQA 2I0QA 4AYBE 4KTAA 5KFAA 4LF9H 3EVQA 5D3DA 2BDNA 2D62A 1ICWA 4A3EH 4RGOS 2JA7G 5CMDA 2RCFA 3S15B 4BBSB 1I6UA 4P73A 1NUCA 1GSHA 1KC8C 5ELNA 4M9UA 1E4EA 2R7ZB 2O03A 4JI7Q 1O7YA 2EJFC 3GTKA 5FO8B 4AQYQ 4BBSG 5AJ3L 4JOIC 4C2MH 2E2IB 3M9NB 2ZTCA 1WCMB 3HEJA 4J1MA 2V4QA 1EZ8A 2YTVA 2B8FA 4OWWB 1A3VA 1NSNS 3J81c 3KK7A 4ED2A 1VKZA 2M9VA 4RAZA 4PZ6A 5KFWA 3IFDA 3CCVA 1I94Q 4DR1Q 1WTHA 4FVMA 2HVQA 5JEAH 4O4IF 4WFN3 1YHQA 2SCUB 4BA2I 1M1KC 2JA5A 2CCZA 2C28A 3A7AB 3I4MH 1G6PA 5KT6A 3FKIA 1MKHA 2Z1CA 1EYDA 1XPRA 3MR6A 3AYHB 1HR0W 1PV4A 2PN1A 1Q86C 3VPBA 1EY7A 3HOYB 3E5SA 2Z9HA 2CVRA 4YAJB 2E5LQ 4XIGS 3QOLA 5KFQA 3H0GH 1EL0A 5EKLA 4RNNA 1SNPA 4K14A 3AEVA 1BKBA 1TY0A 3GV6A 1IBKQ 2QEXA 2OT2A 1N32Q 4QL5A 3MFHA 2K28A 2HIXA 3VYRA 1A8VA 2DPIA 1WTRA 3PUZA 4ILWA 1PH5A 1RL2A 2JA6H 1VQJA 1STYA 2QKIC 1VQCA 2JSOA 4FBTA 2EJGC 5EBCA 3RN5A 1Y8NB 2Q8IB 1ONLA 1HNZL 3CC4A 4DV3H 5CC4A 4GOPB 1HTLD 1EIGA 2JA6G 4A3CH 1LT6D 5GROA 4OO1H 3KXYT 1SYFA 2H4OA 3MR5A 2HQEA 1FGUA 4A93H 1EU4A 1LACA 1F9SA 1BXRA 2NVYB 1EYZA 1SFOA 2BDOA 1XMOH 5H80A 4A3MG 4J9MA 2P0AA 2E2DC 4HIKA 1V1QA 2RQXA 2R7ZA 1CTMA 2CWPA 1BR9A 4X3TA 3JAMc 3K8AA 4ZUJA 3HGBA 1NCVA 2K5DA 4ZQIA 4CDEC 2R85A 4DR1H 1YNXA 2VQDA 2B2VA 3RLOA 1NMGA 1SE8A 1D7QA 1DJRD 1EOTA 1SNDA 2KEEA 4RGTA 5FO7B 5J1ZA 2JA6B 3T53B 2Q2HA 3OTOQ 1KL9A 2KQ3A 3IKJA 1TWCH 4K8IA 4QGUA 4A3GG 1XMOL 4CJ2C 1TR5A 3NSWA 4NDXA 4LF7Q 4UCTA 4DL7A 2ZM6H 2JN4A 2F52A 2RA4A 3HBLA 1K83A 1BJTA 1VQNA 2IX3A 4QWEA 3K80C 2B2YC 2B2WC 3CRKC 4LNQA 4OELB 4X66L 4GLXA 1DYQA 1S5DD 4JV0A 2K5QA 2JEFA 3S14B 4B9WA 1LTID 1W2BA 5CV4A 4X6AH 4RKBA 4XQJA 5E7NA 2ASBA 1KJ9A 4HJ9A 2K5HA 3FPUB 1GO3E 2NWGA 2VNUD 2YU9H 2VUGA 4LUZA 5KRUA 1T9HA 3WWVA 4CHTB 3J81L 3IFTA 2ZDGA 5EAYA 1O7ZA 4K6LA 3Q8QB 5GAGC 5EKKA 1FYCA 1WSCA 4QWAA 1O75A 3TSSA 4CC6A 4DV6L 4ECQA 4DK6C 4U6PA 1O7LA 3FHWA 5IP7G 1PYBA 3J7ZC 3K58A 5KG7A 4FXGC 4B9XA 4ZKBB 4YCUA 2HJWA 3I91A 1BCPB 3G6JB 4JG2A 3VR2A 4LW1A 3U9OA 4B3SH 2J4XA 2R7LA 2R6GA 2VPQA 3R2TA 1ET9A 4DA2A 4APVA 4EGVA 1X32A 1H95A 5EZYF 4ZKCB 4HJAA 3PIPA 3GIMA 4B3MH 2SOBA 4E4TA 4BY7G 4JBJA 2CQOA 1SNQA 2SNSA 1S4ZA 1VQ7A 5D8DA 2VOBA 5KFEA 2CKZB 2I46A 3DF7A 1PYWD 5IP9H 4WD3A 5DLGA 3QR8A 2QDBA 2JA6A 1ESRA 1XWEA 5EQ0A 5FPRA 4OIKA 1HQRD 3H3VC 4Q8EA 3RAQA 4C3IG 2GLTA 2N49A 3IL8A 3CMAA 2UUAH 3EQLC 1U0LA 5KFJA 1X9NA 2AKWB 4LWCA 4LJZC 1VS0A 4Y8VB 2ZXRA 4NB3A 1VQ9A 1Z47A 2F0VA 3WOEA 1F2ZA 2WKDA 3F8TA 1L1OC 2CFMA 1KJJA 3T5LA 1UWVA 1HNWQ 1GSOA 4EFBA 2G5DA 2FB9A 2VPSA 4I4TF 3H15A 4PG3A 1XMQL 1VQ4A 3FEWX 2EIFA 4FO2A 5KT4A 1QVFA 4KJOA 1SLJA 1A0IA 1WCMH 5NUCA 4YP3A 2GPSA 1UE7A 2MJ8A 5IWAH 2F0EA 2A1AA 3S17B 3CW2C 2FK2A 4UFZA 1JORA 1D8LA 2F0WA 4GNXB 3CCLA 3EFXD 2ICEC 2PW7A 4G4KA 4RHRA 3JSNA 2A6ED 5EBDA 1VAJA 1B7YB 2F0PA 2FPGB 2VUMG 3NTHA 3NEMA 1SMYD 2NYZD 5KFDA 1P16A 4DUZQ 3G6YA 1OTCA 5CBAE 4NXMQ 3L3OC 4WJ4A 2WE6A 4NPSA 5T1GA 3M9MB 3PO3G 1EIYB 3KAKA 4DK0A 1ZXTA 2WFWA 4J9PA 1BVSA 4BY1G 4LF5L 2YW2A 2XTIA 3JAML 2IMWP 3I90A 1UAPA 4EBDA 2A68C 4A3LH 2K33A 2B63G 2E5LH 1X3GA 4HSVA 1LO5D 1S5FD 2EXDA 1N33Q 1GLVA 4UY8C 1ZHSA 4RB0A 3RB0A 1S03G 2QILA 1K73C 1I5FA 1MSHA 3D31A 4EYIB 1YJWA 3SK6A 1S5CD 2KHSA 3E0EA 2C9OA 2DNCA 2N8NA 1JWSD 4YR0A 3PO3B 3RMHA 1CE8A 1RKNA 2R8JA 1IOWA 2VS1A 3R3OA 4QIWE 5HGTA 4BY1B 4DUZL 1IL2A 1STEA 4WBNF 1JC7A 3W1GA 3TDQA 4LFBL 2LY7A 2Y0SA 2EYLA 1LABA 1ZYRD 2RDGA 3R5FA 1Y1VG 3NHHA 4ALPA 4YR2A 3NUCA 2RGRA 1B4OA 2VUMA 2NUCA 1X3EA 1E22A 2FINB 4POGA 1QVCA 2PZTA 1IXRA 2RSOA 4YHHH 2BR0A 4A75A 4FF1A 3KJOA 4IRKA 5DM73 2HVSA 2IW3A 1RJQA 4IZ8A 1FJGH 5CBEE 1DOKA 2EY5A 4QB4A 1FGBD 5IGDA 1ENAA 4A3MH 5M3FB 1JLLB 4ZI7F 3FP9A 2D9UA 4DV7H 2VW9A 4FF2A 5E4XA 4JI8H 3K5HA 2DZDA 4X66H 2I8CA 1JWMD 1Q1EA 4A76A 5M5YH 4LF6H 3CCMA 1OXVA 2I07B 4P74A 5M3FG 3HOZG 4MV4A 1KHIA 3I4MB 4A3EB 5KG5A 4L1KA 5EPJA 1XNRL 3RGZA 3RZOB 5FD5A 1EIFA 3NENA 3CQZA 3MZ5A 1QILA 1TS4A 2YRWA 1CQFA 5EWEA 1OO9B 1GUNA 1IBMQ 3ETJA 3I4OA 4M1UB 4TUYF 2LXKA 4NKLA 3KDFB 3L4KA 4C2MB 5FOBB 3PR5B 2FXQA 1T5XD 3UDIA 4GKKQ 3KBXA 3GLKA 2IHEA 1CS0A 1J8IA 2DWCA 2F0QA 3J80c 5FK9C 4DR1L 3NWSA 1GXDC 4KKUA 1B6SA 1Q90A 2FHTA 4J0MA 4J9NA 4IPCA 1CM9A 4XQNA 3HOZB 1SE4A 4DV4Q 4OONA 2BA1A 4F87A 2E74C 3U9TA 5IIFA 2W7PA 3LGJA 3M4IA 1K8MA 2ID0A 4IUVA 1HRJA 4IWXA 3GTLA 5KFUA 2W71A 2CZGA 3IN5A 4LF7H 2IA6A 2VQFH 1XXGA 4I7AA 1WD1A 5C1OA 4LF6L 4MV6A 4A3GB 1J9OA 2EYHA 1WD0A 1PH8A 3CC7A 4LK1C 1SCUB 3MFIA 5I47A 3NGDA 2OLSA 3D6CA 3M4PA 3E0JA 1EWIA 4DV7L 3BABA 3QG1A 5KT3A 1I3QB 4YWMA 1MJEA 1ZHQA 1MIUA 3RN2A 4JI4H 1STHA 4JVZA 5K2MA 1HZ9A 1GGOA 4HAEA 3H4BA 1LM0A 1QUQA 5BN4A 1HHVA 4O2DA 2WAQE 4CDDC 1B04A 1VQDA 1B44D 1JWUD 4DAPA 4PMCA 4N9PA 3PW7A 1J6QA 2Z4IA 3ND8A
chains in the Genus database with same CATH topology
1VQ6A 1N36L 5C44H 2VUMH 2MO0A 3F2BA 2L15A 4JI6Q 3HOWH 3F2CA 3MXNB 2JA9A 4DV3Q 4HJ8A 4LF8Q 4Y52H 1Q46A 4YHHQ 3GDEA 1C7YA 4DNIA 1HH2P 3UDFA 3S2DH 3CP0A 3S17H 4DV2L 1X56A 4BY1H 2EQSA 4A3IG 1Q7YC 2MFIA 1IBLQ 2K52A 5LMNL 3H3VH 2VQEQ 1S3OA 4A3CG 1HZCA 3RNUA 1UE1A 2ALYB 1QZHA 5IT9c 2K50A 1VQLA 2OCEA 4DR3Q 2BH8A 2YTYA 4DR3L 3KDFA 1J5EQ 4P75A 4LF4L 1XPUA 4JI5Q 1SR3A 3CXCA 2N78A 2R7ZH 1AH9A 2CWAA 5JEAG 5C0XG 4AIMA 4RMFA 3BJUA 3RR5A 2E2JH 2UUCL 4LF9Q 4B3TQ 4JI1Q 3PUYA 1IYJB 3AQQA 4JI2Q 3IRBA 3PF5A 3Q8DA 1FVIA 4R1JA 2MNAA 2R7ZG 3KF6A 3K81C 4GNXC 1CKNA 4MNOA 3TEHB 3CCRA 2DUDA 1TWHH 1XJVA 5IP9G 1WCMG 5IYDH 3A0JA 1N8RC 4PZ7A 4TVAB 3TQYA 3S24A 3VDYA 3PV0A 4JBMA 3L0OA 5HGQA 1NY4A 1CKMA 1EYGA 4AYBE 2I0QA 2AMCB 4JI4L 4A3DH 4UPAA 4DKAC 3KF8B 1BBWA 4DUYL 4HIOA 3HOZH 2IT1A 5IY0A 5JJIA 2D62A 4A3EH 2OTJA 3U58A 1K0RA 2JA7G 4GLVB 5C4XH 2JQOA 4JV5Q 2WP8J 5JJLA 3DLLA 3F1ZA 5C3EG 4P73A 1OXTA 1QZGA 4JYAQ 2UXCQ 2A8VA 1KC8C 5ELNA 4LF4Q 3FKIH 2IX0A 4JI5L 5JEAJ 1YITA 2BH2A 2IY5B 2VZAA 4JI7Q 4HIMA 4J15A 1N33L 2I5LX 2ZJRA 4AQYQ 3HFZB 4BBSG 4AQYL 4C3HH 5AJ3L 4JOIC 4JI1L 4C2MH 5AJ3Q 4X66Q 2ZTCA 3NBHB 1YIJA 2PI2A 2HT1A 2PI2E 4YY3Q 3S2HH 4JI8Q 1DGSA 2YTVA 4OWWB 4GKJL 1K3RA 3J81c 4B3MQ 1E24A 3HOYH 1ASZA 1QVGA 3CCQA 3KLWA 4PZ6A 3CCVA 1I94Q 4DR1Q 1JMCA 1GM5A 1W3SA 1YHQA 4BA2I 1M1KC 4LFBQ 3K7UC 1JJ2A 2Z6KC 2CCZA 3I4MH 5C44G 1G6PA 1G291 2KHJA 3KF6B 4R4QA 1TWAH 1V9PA 1MKHA 4QY7A 3TREA 3S14H 3HOYG 3G48A 1XPRA 4OX9Q 1MJCA 2NN6I 3AYHB 1HR0W 2HIVA 5FLXc 4A3BH 1CSQA 1PV4A 3J80i 1HR0Q 3CAMA 1GD7A 1VQGA 3PO2G 1Q86C 4BY7H 3S1MH 4B3RL 4B3RQ 4DV1Q 2D0OA 2K75A 4EX5A 2E5LQ 4GKKL 3ICEA 4XIGS 2K5NA 2ZTEA 4P71A 3H0GH 3AEVA 4L5RC 1BKBA 1RIPA 1YI2A 4LFCL 2QEXA 1KIXA 1IBKQ 1N32Q 4KI0A 4QL5A 1E1TA 2JA7H 4IFDI 1N32L 2HIXA 2NVTH 2KHIA 1A8VA 3ULPA 3F2DA 3PUZA 4B3ML 4JI0L 1PH5A 1RL2A 4H02A 2JA6H 3M3YH 1VQJA 3S1QH 2PQAA 1KRTA 1EFWA 1VQCA 4JOIA 4B3SL 2UXBL 2AWNA 4XTCS 3RN5A 2VQEL 1HNZL 3CC4A 1VCIA 1YBYA 3I7FA 4YCWA 4GOPB 2I5HA 1VQ5A 2GN5A 4GN4B 4DR7L 2JA6G 1UEBA 4A3CH 1HNWL 5GROA 3CQZH 5GADC 2ATWA 1VQFA 2QGQA 3HOUG 1FGUA 4A93H 4A3FH 3A5UA 3I4NG 2IX1A 3I4MG 1LTLA 1TWFH 4DK3C 3UE1A 1PH2A 5IYCH 2PQAB 4A3MG 1Q12A 4JCVE 2ZJPA 3G4SA 5LMNQ 4HIKA 1SRUA 1V1QA 2A19A 4KLKA 1C0AA 1PFSA 1TXYA 3S1NH 2CWPA 3PSIA 4R4CA 1NBWA 1NTGA 3ERSX 1O7IA 2NVQH 2YTXA 3JAMc 1K83H 3K8AA 2UUBL 4X65Q 4KHPQ 2E8GA 4X65L 1YNXA 3AFQA 4KHPL 2K5VA 1L0WA 3T1YL 1JT8A 3M4QA 1B70B 4AH6A 3W5OA 3RLOA 3MEFA 1PH6A 1NMGA 1SE8A 4JI0Q 2F4VQ 1D7QA 3G71A 5C0XJ 3TS0A 3M7NA 4JI4Q 4IPDA 4DV5L 5J3BA 4DV5Q 5JJKA 2WB1E 3CCSA 3CCJA 2UUAL 2XGTA 2Q2HA 3SGIA 3OTOQ 1OXSC 1KL9A 2PMZE 3B6YA 1VQEA 3GD7A 4FDBA 3GTGH 1TWCH 2ZJQA 2RHQB 5M3MH 4QGUA 3KFUA 1XMOL 4A3GG 3GTKH 1N36Q 1VQHA 1VQBA 1KRSA 4JI6L 2N3SA 3K0XA 4X64Q 4LF7Q 1C9OA 4JBWA 4OWTB 4K0KL 4IO9A 4NXML 4K0KQ 4OO1I 2KCMA 2VY3A 4L5TA 2F52A 2JA8H 4DR6L 3PUWA 2UU9Q 2JJQA 4DR5Q 4LF6Q 1VQNA 4A3BG 3K80C 4LNQA 2LSSA 4X66L 1E3PA 3L7ZC 4GLXA 3K7AH 2PNHA 3PCOB 1YJ9A 2YYZA 1PH1A 1OXUA 5IYBH 3DM3A 1BBUA 3OW2A 1L1OB 1SN8A 1W2BA 1N34L 2Q2IA 4X6AH 3M85A 2JEAI 1IZ6A 5E7NA 2ASBA 3J81i 3L2PA 4HJ9A 1K8AC 2K5HA 4C3IH 1GO3E 4RG1A 5M5XH 1VQMA 2VNUD 2KBNA 2YU9H 4LUZA 4GN5A 1T9HA 3WWVA 1PA6A 4OWXB 1WOCA 1SFOH 3CC2A 1XNRQ 3CPFA 1P8LA 3STBC 2R92H 5EAYA 5IYBG 4JI3L 3JAMi 4LF8L 5GAGC 2HHHQ 3W1BA 3ULJA 2YV5A 3PGZA 1E1OA 2ZTDA 4YCVA 4BA1I 5IWAL 1KD1C 4HJ7A 2R7FA 4DV6L 4DK6C 2R92G 3FHWA 5IP7G 1PH4A 1PYBA 3J7ZC 2RCNA 1S40A 1IBLL 1PH7A 1WI5A 1QUQB 5HY6A 4PZ8A 4YCUA 1EOVA 4JG2A 4LW1A 4DR2L 5K36G 4DR2Q 2NZHA 2R6GA 2UUBQ 4DUYQ 4KHZA 5IYCG 4A93G 4APVA 3A5ZB 1H95A 1XPOA 3GO5A 4HJAA 3HOWG 3PIPA 2AHOB 4X62L 1HZBA 4A3KH 1Y1WH 4BY7G 2GVAA 4L5QA 1HZAA 4JBJA 2CQOA 1VQ7A 1NE3A 2NVYH 2CKZB 4HIDA 1SMXA 2MQHA 4A3DG 4IJHA 5IP9H 4O0AA 1VQPA 1HNZQ 4JBKA 3KJPA 4IPGA 4L5SA 1EUJA 4DV0L 1NJIC 1I94L 4GS3A 1XNQQ 1CKOA 1L1OA 3U50C 4IOCA 3J7A5 1Y1VH 3CCEA 4NXNL 4DAMA 5LMUQ 3M4OH 5GAEC 2N49A 3CMAA 3S16H 2B29A 1U0LA 1B8AA 1X9NA 3HOVG 1OXXK 2AKWB 4LWCA 1VS0A 3E9HA 5FLMG 4A3FG 4DR4Q 1CUKA 2JA5G 2NZOA 4NB3A 1VQ9A 4OX9L 1Z47A 4DV7Q 3BU2A 5BR8L 1NMFA 3OYYA 3F8TA 1KXLA 3PO2H 1HR0L 1PHJA 1L1OC 2CFMA 1N34Q 1UWVA 1HNWQ 2C35B 3EIVA 5M5WH 5IP7H 2WAQG 3GTMH 3M9BA 1SROA 3E9IA 4BBRG 3H15A 1X65A 4PG3A 2VQFL 2VQFQ 1VQ4A 1X3FA 2EIFA 3HKSA 3UDGA 1XMQL 1QVFA 1SLJA 4GLAC 1A0IA 1EQRA 1WCMH 1PVOA 4A3JG 1UE7A 1IBML 1ASYA 2A1AA 3CW2C 3KOJA 1D8LA 4EQ5A 4GNXB 3CCLA 4UP8A 2R93H 5C4XG 3UE0A 1V43A 2HHHL 1E7ZA 5H1SE 1B7YB 4IPHA 1YZ6A 2NVXH 2KENA 1GVPA 3I2ZA 3CMEA 3NEMA 2VUMG 4DPGA 1HNXQ 3I4NH 2R93G 3CF5A 2OTLA 1GKHA 1P16A 4DUZQ 1OTCA 4NXMQ 3I55A 4DV3L 2LXJA 4WJ4A 4DAYB 4OXPA 4NPSA 2V1CC 3PO3G 1EIYB 2WFWA 1BVSA 4BY1G 2KCTA 3NELA 1PYSB 2IHFA 4QQBX 5BR8Q 3PUXA 4LF5L 4LF5Q 2XTIA 1I6HH 1AE3A 4B3TL 1UE5A 4A3LH 4X64L 5FJ8G 1I3QH 4LF7L 2ZM6L 4GOPA 2B63G 4BXXG 1LYLA 4IJLA 1X3GA 3J81j 1N33Q 3HOVH 2E5LL 2EXDA 1I50H 4UY8C 2JK8A 4YWKA 1K73C 1I5FA 1X55A 5IE8A 1FL0A 3D31A 4JI2L 3RZOH 1VQAA 3EN2A 3CCUA 1VQKA 2GVBA 1YJWA 4GKJQ 1KQSA 3E0EA 2VL6A 2N8NA 1WYDA 4DV2Q 4BBRH 3S15H 4YWLA 4BBSH 1YEZA 3TS2A 2VS1A 2Z0SA 4QIWE 1G51A 5DLQE 4DUZL 1IL2A 3TRZA 3PUVA 3W1GA 3GTJH 4LFBL 3D0FA 2I5MX 1FJGL 3BZKA 5C0XI 1PH3A 2E2IH 1CKNB 5FLMH 1K8GA 1Y1VG 3PF4A 3STBD 3H0GG 4ALPA 4A3EG 1XMQQ 4X62Q 1X3EA 1E22A 4P72A 2Y0SG 4POGA 1VQOA 1QVCA 3HKZE 4MTNA 4TQUS 3AFPA 1IXRA 3ER0A 3HOXH 5ELOA 4A75A 1HJPA 3U4VA 3KJOA 3GTQH 4JI7L 4ME3A 2UU9L 1WFQA 2DGYA 3EBEA 4JC0A 4LUOA 3PIOA 4GNXA 3FKIG 2BA0A 3A74A 4UP7A 2RHSB 4MZ9A 3HKZG 4JI8L 4A3MH 2B63H 3FP9A 4QJFA 2VW9A 4A3LG 4LF9L 3U4ZA 2JEBI 5M3MG 4A3GH 5C4JH 4GOPC 2OWOA 3RLNA 1K9MC 4A4IA 4JI3Q 2UUAQ 1Q1EA 3ZJYC 4A76A 5M5YH 3OTOL 3RZDH 3CCMA 4LFAL 1OXVA 1Q8KA 4P74A 5M3FG 5GAHC 2F4VL 1X6OA 1KHIA 1VQ8A 3HOZG 1L2FA 1WJJA 5IWAQ 1XNRL 4DV6Q 1JJCB 2B3GA 2R7DA 3S1RH 1XNQL 1FJGQ 3JC66 1PH9A 2ZM6Q 4POFA 1EIFA 5GQOA 1N9WA 3NENA 4DV1L 2D0PA 1TWGH 3RLFA 1YJNA 2Q2TA 1X54A 1AE2A 4AYBG 3PO3H 1Y1WG 4IFDJ 1YVCA 2F3IA 1IBMQ 3I4OA 4DR4L 1IBKL 4LFCQ 2LXKA 1Y14B 5M3FH 5LMNW 4YY3L 3KDFB 4A3KG 3GTPH 2UXDQ 5C3EH 2UXDL 5FJ8H 3I56A 2QA4A 2K14A 2FXQA 2ES2A 4JV5L 3UDIA 4GKKQ 3T1HQ 4BXXH 2IHEA 1JE5A 2OQKA 3J80c 1XTDA 4B3SQ 2UXBQ 4DR1L 1S72A 4A3JH 3CD6A 2Q2UA 3G6EA 1HNXL 3T1YQ 1U5KA 4IPCA 4DR7Q 3UDXA 4DV4L 1Q81C 4DV4Q 1UE6A 3HOXG 4OONA 2MO1A 2BA1A 2JA8G 1Q1BA 1A63A 4NXNQ 1YHAA 4LFAQ 4YHHL 2E2HH 3GTOH 1VQIA 3LGJA 1XMOQ 2JA5H 2ID0A 3H3VI 2AWOA 3CPWA 4R4TA 4LUVA 2Z6KA 2JE6I 3ULLA 1YHBA 3BZCA 4IFDG 4IOAA 5LMUL 4Y7NH 4DR6Q 2HQLA 4GN3B 4DR5L 4LF6L 1JJGA 1CSPA 4OO1G 1PH8A 3CC7A 1J5EL 3HOUH 2RF4A 3M4PA 1EWIA 4DV7L 1A62A 5IYDG 1JB7A 3GTLH 2OQ0A 4HJ5A 2Y0SE 1KAWA 1R9TH 1Q82C 2UUCQ 4YWMA 3T1HL 4C3JH 1MJEA 1MIUA 3RN2A 1HZ9A 2K4KA 4JYAL 2UXCL 4UP9A 4R4OA 2NN6G 1LM0A 2WB1G 1QUQA 4PMWA 3KYHC 4O2DA 2WAQE 4A3IH 1LUZA 1VQDA 2H5XA 1EQQA 1M90C 4WJ3M 4R4IA 1Z9FA 1J6QA 4DV0Q
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQ6 A;  1N36 L;  5C44 H;  2VUM H;  2MO0 A;  3F2B A;  2L15 A;  4JI6 Q;  3HOW H;  3F2C A;  3MXN B;  2JA9 A;  4DV3 Q;  4HJ8 A;  4LF8 Q;  4Y52 H;  1Q46 A;  4YHH Q;  3GDE A;  1C7Y A;  4DNI A;  1HH2 P;  3UDF A;  3S2D H;  3CP0 A;  3S17 H;  4DV2 L;  1X56 A;  4BY1 H;  2EQS A;  4A3I G;  1Q7Y C;  2MFI A;  1IBL Q;  2K52 A;  5LMN L;  3H3V H;  2VQE Q;  1S3O A;  4A3C G;  1HZC A;  3RNU A;  1UE1 A;  2ALY B;  1QZH A;  5IT9 c;  2K50 A;  1VQL A;  2OCE A;  4DR3 Q;  2BH8 A;  2YTY A;  4DR3 L;  3KDF A;  1J5E Q;  4P75 A;  4LF4 L;  1XPU A;  4JI5 Q;  1SR3 A;  3CXC A;  2N78 A;  2R7Z H;  1AH9 A;  2CWA A;  5JEA G;  5C0X G;  4AIM A;  4RMF A;  3BJU A;  3RR5 A;  2E2J H;  2UUC L;  4LF9 Q;  4B3T Q;  4JI1 Q;  3PUY A;  1IYJ B;  3AQQ A;  4JI2 Q;  3IRB A;  3PF5 A;  3Q8D A;  1FVI A;  4R1J A;  2MNA A;  2R7Z G;  3KF6 A;  3K81 C;  4GNX C;  1CKN A;  4MNO A;  3TEH B;  3CCR A;  2DUD A;  1TWH H;  1XJV A;  5IP9 G;  1WCM G;  5IYD H;  3A0J A;  1N8R C;  4PZ7 A;  4TVA B;  3TQY A;  3S24 A;  3VDY A;  3PV0 A;  4JBM A;  3L0O A;  5HGQ A;  1NY4 A;  1CKM A;  1EYG A;  4AYB E;  2I0Q A;  2AMC B;  4JI4 L;  4A3D H;  4UPA A;  4DKA C;  3KF8 B;  1BBW A;  4DUY L;  4HIO A;  3HOZ H;  2IT1 A;  5IY0 A;  5JJI A;  2D62 A;  4A3E H;  2OTJ A;  3U58 A;  1K0R A;  2JA7 G;  4GLV B;  5C4X H;  2JQO A;  4JV5 Q;  2WP8 J;  5JJL A;  3DLL A;  3F1Z A;  5C3E G;  4P73 A;  1OXT A;  1QZG A;  4JYA Q;  2UXC Q;  2A8V A;  1KC8 C;  5ELN A;  4LF4 Q;  3FKI H;  2IX0 A;  4JI5 L;  5JEA J;  1YIT A;  2BH2 A;  2IY5 B;  2VZA A;  4JI7 Q;  4HIM A;  4J15 A;  1N33 L;  2I5L X;  2ZJR A;  4AQY Q;  3HFZ B;  4BBS G;  4AQY L;  4C3H H;  5AJ3 L;  4JOI C;  4JI1 L;  4C2M H;  5AJ3 Q;  4X66 Q;  2ZTC A;  3NBH B;  1YIJ A;  2PI2 A;  2HT1 A;  2PI2 E;  4YY3 Q;  3S2H H;  4JI8 Q;  1DGS A;  2YTV A;  4OWW B;  4GKJ L;  1K3R A;  3J81 c;  4B3M Q;  1E24 A;  3HOY H;  1ASZ A;  1QVG A;  3CCQ A;  3KLW A;  4PZ6 A;  3CCV A;  1I94 Q;  4DR1 Q;  1JMC A;  1GM5 A;  1W3S A;  1YHQ A;  4BA2 I;  1M1K C;  4LFB Q;  3K7U C;  1JJ2 A;  2Z6K C;  2CCZ A;  3I4M H;  5C44 G;  1G6P A;  1G29 1;  2KHJ A;  3KF6 B;  4R4Q A;  1TWA H;  1V9P A;  1MKH A;  4QY7 A;  3TRE A;  3S14 H;  3HOY G;  3G48 A;  1XPR A;  4OX9 Q;  1MJC A;  2NN6 I;  3AYH B;  1HR0 W;  2HIV A;  5FLX c;  4A3B H;  1CSQ A;  1PV4 A;  3J80 i;  1HR0 Q;  3CAM A;  1GD7 A;  1VQG A;  3PO2 G;  1Q86 C;  4BY7 H;  3S1M H;  4B3R L;  4B3R Q;  4DV1 Q;  2D0O A;  2K75 A;  4EX5 A;  2E5L Q;  4GKK L;  3ICE A;  4XIG S;  2K5N A;  2ZTE A;  4P71 A;  3H0G H;  3AEV A;  4L5R C;  1BKB A;  1RIP A;  1YI2 A;  4LFC L;  2QEX A;  1KIX A;  1IBK Q;  1N32 Q;  4KI0 A;  4QL5 A;  1E1T A;  2JA7 H;  4IFD I;  1N32 L;  2HIX A;  2NVT H;  2KHI A;  1A8V A;  3ULP A;  3F2D A;  3PUZ A;  4B3M L;  4JI0 L;  1PH5 A;  1RL2 A;  4H02 A;  2JA6 H;  3M3Y H;  1VQJ A;  3S1Q H;  2PQA A;  1KRT A;  1EFW A;  1VQC A;  4JOI A;  4B3S L;  2UXB L;  2AWN A;  4XTC S;  3RN5 A;  2VQE L;  1HNZ L;  3CC4 A;  1VCI A;  1YBY A;  3I7F A;  4YCW A;  4GOP B;  2I5H A;  1VQ5 A;  2GN5 A;  4GN4 B;  4DR7 L;  2JA6 G;  1UEB A;  4A3C H;  1HNW L;  5GRO A;  3CQZ H;  5GAD C;  2ATW A;  1VQF A;  2QGQ A;  3HOU G;  1FGU A;  4A93 H;  4A3F H;  3A5U A;  3I4N G;  2IX1 A;  3I4M G;  1LTL A;  1TWF H;  4DK3 C;  3UE1 A;  1PH2 A;  5IYC H;  2PQA B;  4A3M G;  1Q12 A;  4JCV E;  2ZJP A;  3G4S A;  5LMN Q;  4HIK A;  1SRU A;  1V1Q A;  2A19 A;  4KLK A;  1C0A A;  1PFS A;  1TXY A;  3S1N H;  2CWP A;  3PSI A;  4R4C A;  1NBW A;  1NTG A;  3ERS X;  1O7I A;  2NVQ H;  2YTX A;  3JAM c;  1K83 H;  3K8A A;  2UUB L;  4X65 Q;  4KHP Q;  2E8G A;  4X65 L;  1YNX A;  3AFQ A;  4KHP L;  2K5V A;  1L0W A;  3T1Y L;  1JT8 A;  3M4Q A;  1B70 B;  4AH6 A;  3W5O A;  3RLO A;  3MEF A;  1PH6 A;  1NMG A;  1SE8 A;  4JI0 Q;  2F4V Q;  1D7Q A;  3G71 A;  5C0X J;  3TS0 A;  3M7N A;  4JI4 Q;  4IPD A;  4DV5 L;  5J3B A;  4DV5 Q;  5JJK A;  2WB1 E;  3CCS A;  3CCJ A;  2UUA L;  2XGT A;  2Q2H A;  3SGI A;  3OTO Q;  1OXS C;  1KL9 A;  2PMZ E;  3B6Y A;  1VQE A;  3GD7 A;  4FDB A;  3GTG H;  1TWC H;  2ZJQ A;  2RHQ B;  5M3M H;  4QGU A;  3KFU A;  1XMO L;  4A3G G;  3GTK H;  1N36 Q;  1VQH A;  1VQB A;  1KRS A;  4JI6 L;  2N3S A;  3K0X A;  4X64 Q;  4LF7 Q;  1C9O A;  4JBW A;  4OWT B;  4K0K L;  4IO9 A;  4NXM L;  4K0K Q;  4OO1 I;  2KCM A;  2VY3 A;  4L5T A;  2F52 A;  2JA8 H;  4DR6 L;  3PUW A;  2UU9 Q;  2JJQ A;  4DR5 Q;  4LF6 Q;  1VQN A;  4A3B G;  3K80 C;  4LNQ A;  2LSS A;  4X66 L;  1E3P A;  3L7Z C;  4GLX A;  3K7A H;  2PNH A;  3PCO B;  1YJ9 A;  2YYZ A;  1PH1 A;  1OXU A;  5IYB H;  3DM3 A;  1BBU A;  3OW2 A;  1L1O B;  1SN8 A;  1W2B A;  1N34 L;  2Q2I A;  4X6A H;  3M85 A;  2JEA I;  1IZ6 A;  5E7N A;  2ASB A;  3J81 i;  3L2P A;  4HJ9 A;  1K8A C;  2K5H A;  4C3I H;  1GO3 E;  4RG1 A;  5M5X H;  1VQM A;  2VNU D;  2KBN A;  2YU9 H;  4LUZ A;  4GN5 A;  1T9H A;  3WWV A;  1PA6 A;  4OWX B;  1WOC A;  1SFO H;  3CC2 A;  1XNR Q;  3CPF A;  1P8L A;  3STB C;  2R92 H;  5EAY A;  5IYB G;  4JI3 L;  3JAM i;  4LF8 L;  5GAG C;  2HHH Q;  3W1B A;  3ULJ A;  2YV5 A;  3PGZ A;  1E1O A;  2ZTD A;  4YCV A;  4BA1 I;  5IWA L;  1KD1 C;  4HJ7 A;  2R7F A;  4DV6 L;  4DK6 C;  2R92 G;  3FHW A;  5IP7 G;  1PH4 A;  1PYB A;  3J7Z C;  2RCN A;  1S40 A;  1IBL L;  1PH7 A;  1WI5 A;  1QUQ B;  5HY6 A;  4PZ8 A;  4YCU A;  1EOV A;  4JG2 A;  4LW1 A;  4DR2 L;  5K36 G;  4DR2 Q;  2NZH A;  2R6G A;  2UUB Q;  4DUY Q;  4KHZ A;  5IYC G;  4A93 G;  4APV A;  3A5Z B;  1H95 A;  1XPO A;  3GO5 A;  4HJA A;  3HOW G;  3PIP A;  2AHO B;  4X62 L;  1HZB A;  4A3K H;  1Y1W H;  4BY7 G;  2GVA A;  4L5Q A;  1HZA A;  4JBJ A;  2CQO A;  1VQ7 A;  1NE3 A;  2NVY H;  2CKZ B;  4HID A;  1SMX A;  2MQH A;  4A3D G;  4IJH A;  5IP9 H;  4O0A A;  1VQP A;  1HNZ Q;  4JBK A;  3KJP A;  4IPG A;  4L5S A;  1EUJ A;  4DV0 L;  1NJI C;  1I94 L;  4GS3 A;  1XNQ Q;  1CKO A;  1L1O A;  3U50 C;  4IOC A;  3J7A 5;  1Y1V H;  3CCE A;  4NXN L;  4DAM A;  5LMU Q;  3M4O H;  5GAE C;  2N49 A;  3CMA A;  3S16 H;  2B29 A;  1U0L A;  1B8A A;  1X9N A;  3HOV G;  1OXX K;  2AKW B;  4LWC A;  1VS0 A;  3E9H A;  5FLM G;  4A3F G;  4DR4 Q;  1CUK A;  2JA5 G;  2NZO A;  4NB3 A;  1VQ9 A;  4OX9 L;  1Z47 A;  4DV7 Q;  3BU2 A;  5BR8 L;  1NMF A;  3OYY A;  3F8T A;  1KXL A;  3PO2 H;  1HR0 L;  1PHJ A;  1L1O C;  2CFM A;  1N34 Q;  1UWV A;  1HNW Q;  2C35 B;  3EIV A;  5M5W H;  5IP7 H;  2WAQ G;  3GTM H;  3M9B A;  1SRO A;  3E9I A;  4BBR G;  3H15 A;  1X65 A;  4PG3 A;  2VQF L;  2VQF Q;  1VQ4 A;  1X3F A;  2EIF A;  3HKS A;  3UDG A;  1XMQ L;  1QVF A;  1SLJ A;  4GLA C;  1A0I A;  1EQR A;  1WCM H;  1PVO A;  4A3J G;  1UE7 A;  1IBM L;  1ASY A;  2A1A A;  3CW2 C;  3KOJ A;  1D8L A;  4EQ5 A;  4GNX B;  3CCL A;  4UP8 A;  2R93 H;  5C4X G;  3UE0 A;  1V43 A;  2HHH L;  1E7Z A;  5H1S E;  1B7Y B;  4IPH A;  1YZ6 A;  2NVX H;  2KEN A;  1GVP A;  3I2Z A;  3CME A;  3NEM A;  2VUM G;  4DPG A;  1HNX Q;  3I4N H;  2R93 G;  3CF5 A;  2OTL A;  1GKH A;  1P16 A;  4DUZ Q;  1OTC A;  4NXM Q;  3I55 A;  4DV3 L;  2LXJ A;  4WJ4 A;  4DAY B;  4OXP A;  4NPS A;  2V1C C;  3PO3 G;  1EIY B;  2WFW A;  1BVS A;  4BY1 G;  2KCT A;  3NEL A;  1PYS B;  2IHF A;  4QQB X;  5BR8 Q;  3PUX A;  4LF5 L;  4LF5 Q;  2XTI A;  1I6H H;  1AE3 A;  4B3T L;  1UE5 A;  4A3L H;  4X64 L;  5FJ8 G;  1I3Q H;  4LF7 L;  2ZM6 L;  4GOP A;  2B63 G;  4BXX G;  1LYL A;  4IJL A;  1X3G A;  3J81 j;  1N33 Q;  3HOV H;  2E5L L;  2EXD A;  1I50 H;  4UY8 C;  2JK8 A;  4YWK A;  1K73 C;  1I5F A;  1X55 A;  5IE8 A;  1FL0 A;  3D31 A;  4JI2 L;  3RZO H;  1VQA A;  3EN2 A;  3CCU A;  1VQK A;  2GVB A;  1YJW A;  4GKJ Q;  1KQS A;  3E0E A;  2VL6 A;  2N8N A;  1WYD A;  4DV2 Q;  4BBR H;  3S15 H;  4YWL A;  4BBS H;  1YEZ A;  3TS2 A;  2VS1 A;  2Z0S A;  4QIW E;  1G51 A;  5DLQ E;  4DUZ L;  1IL2 A;  3TRZ A;  3PUV A;  3W1G A;  3GTJ H;  4LFB L;  3D0F A;  2I5M X;  1FJG L;  3BZK A;  5C0X I;  1PH3 A;  2E2I H;  1CKN B;  5FLM H;  1K8G A;  1Y1V G;  3PF4 A;  3STB D;  3H0G G;  4ALP A;  4A3E G;  1XMQ Q;  4X62 Q;  1X3E A;  1E22 A;  4P72 A;  2Y0S G;  4POG A;  1VQO A;  1QVC A;  3HKZ E;  4MTN A;  4TQU S;  3AFP A;  1IXR A;  3ER0 A;  3HOX H;  5ELO A;  4A75 A;  1HJP A;  3U4V A;  3KJO A;  3GTQ H;  4JI7 L;  4ME3 A;  2UU9 L;  1WFQ A;  2DGY A;  3EBE A;  4JC0 A;  4LUO A;  3PIO A;  4GNX A;  3FKI G;  2BA0 A;  3A74 A;  4UP7 A;  2RHS B;  4MZ9 A;  3HKZ G;  4JI8 L;  4A3M H;  2B63 H;  3FP9 A;  4QJF A;  2VW9 A;  4A3L G;  4LF9 L;  3U4Z A;  2JEB I;  5M3M G;  4A3G H;  5C4J H;  4GOP C;  2OWO A;  3RLN A;  1K9M C;  4A4I A;  4JI3 Q;  2UUA Q;  1Q1E A;  3ZJY C;  4A76 A;  5M5Y H;  3OTO L;  3RZD H;  3CCM A;  4LFA L;  1OXV A;  1Q8K A;  4P74 A;  5M3F G;  5GAH C;  2F4V L;  1X6O A;  1KHI A;  1VQ8 A;  3HOZ G;  1L2F A;  1WJJ A;  5IWA Q;  1XNR L;  4DV6 Q;  1JJC B;  2B3G A;  2R7D A;  3S1R H;  1XNQ L;  1FJG Q;  3JC6 6;  1PH9 A;  2ZM6 Q;  4POF A;  1EIF A;  5GQO A;  1N9W A;  3NEN A;  4DV1 L;  2D0P A;  1TWG H;  3RLF A;  1YJN A;  2Q2T A;  1X54 A;  1AE2 A;  4AYB G;  3PO3 H;  1Y1W G;  4IFD J;  1YVC A;  2F3I A;  1IBM Q;  3I4O A;  4DR4 L;  1IBK L;  4LFC Q;  2LXK A;  1Y14 B;  5M3F H;  5LMN W;  4YY3 L;  3KDF B;  4A3K G;  3GTP H;  2UXD Q;  5C3E H;  2UXD L;  5FJ8 H;  3I56 A;  2QA4 A;  2K14 A;  2FXQ A;  2ES2 A;  4JV5 L;  3UDI A;  4GKK Q;  3T1H Q;  4BXX H;  2IHE A;  1JE5 A;  2OQK A;  3J80 c;  1XTD A;  4B3S Q;  2UXB Q;  4DR1 L;  1S72 A;  4A3J H;  3CD6 A;  2Q2U A;  3G6E A;  1HNX L;  3T1Y Q;  1U5K A;  4IPC A;  4DR7 Q;  3UDX A;  4DV4 L;  1Q81 C;  4DV4 Q;  1UE6 A;  3HOX G;  4OON A;  2MO1 A;  2BA1 A;  2JA8 G;  1Q1B A;  1A63 A;  4NXN Q;  1YHA A;  4LFA Q;  4YHH L;  2E2H H;  3GTO H;  1VQI A;  3LGJ A;  1XMO Q;  2JA5 H;  2ID0 A;  3H3V I;  2AWO A;  3CPW A;  4R4T A;  4LUV A;  2Z6K A;  2JE6 I;  3ULL A;  1YHB A;  3BZC A;  4IFD G;  4IOA A;  5LMU L;  4Y7N H;  4DR6 Q;  2HQL A;  4GN3 B;  4DR5 L;  4LF6 L;  1JJG A;  1CSP A;  4OO1 G;  1PH8 A;  3CC7 A;  1J5E L;  3HOU H;  2RF4 A;  3M4P A;  1EWI A;  4DV7 L;  1A62 A;  5IYD G;  1JB7 A;  3GTL H;  2OQ0 A;  4HJ5 A;  2Y0S E;  1KAW A;  1R9T H;  1Q82 C;  2UUC Q;  4YWM A;  3T1H L;  4C3J H;  1MJE A;  1MIU A;  3RN2 A;  1HZ9 A;  2K4K A;  4JYA L;  2UXC L;  4UP9 A;  4R4O A;  2NN6 G;  1LM0 A;  2WB1 G;  1QUQ A;  4PMW A;  3KYH C;  4O2D A;  2WAQ E;  4A3I H;  1LUZ A;  1VQD A;  2H5X A;  1EQQ A;  1M90 C;  4WJ3 M;  4R4I A;  1Z9F A;  1J6Q A;  4DV0 Q; 
#chains in the Genus database with same CATH topology
 1VQ6 A;  1N36 L;  5C44 H;  3M4O B;  1PTO C;  4K8J A;  5JQW A;  2MO0 A;  2L15 A;  1JIH A;  3MXN B;  2ENB A;  2X0S A;  1R4P B;  1B9N A;  5IT9 W;  2JA9 A;  3MXP A;  4DV3 Q;  4HJ8 A;  4LF8 Q;  4Y52 H;  1EEF D;  3S2D H;  3CP0 A;  3N43 B;  4B3T H;  4DV2 L;  1UC8 A;  2UUC H;  5CV7 A;  2XGP A;  3Q22 A;  2V59 A;  2VQE Q;  1S3O A;  1SYC A;  4A3C G;  3DWQ A;  5DGA A;  4ECW A;  4LFB H;  3D3R A;  2MHV A;  5DQI A;  3DXJ C;  5L1L A;  2I87 A;  1HA5 A;  2BH8 A;  4RUA A;  4A3I B;  2L5T A;  1XPU A;  3K7A B;  2XSC A;  4JI5 Q;  4RFB A;  1WTV A;  2N78 A;  1W96 A;  1SBB B;  3PW0 A;  1O78 A;  1RJT A;  1R9T B;  2L0C A;  3BJU A;  2EJM A;  1I50 A;  5EGT A;  2NZ1 D;  4LF9 Q;  1SDF A;  3PF5 A;  5K36 H;  4ETS A;  3FMC A;  3GTQ B;  2R6F A;  1A9X A;  4R1J A;  1K8O A;  1WTW A;  2O2L D;  4MNO A;  4EEQ A;  3RB6 A;  2DUD A;  5IP9 G;  1WCM G;  2K05 A;  3QWN A;  4GC6 A;  1VDZ A;  1DCZ A;  4PZ7 A;  4JBM A;  3S24 A;  2BE5 C;  3PV0 A;  3TP7 A;  1K1Q A;  3MA2 B;  1EWH A;  1SXT A;  4A3D H;  1A3T A;  5D65 A;  5ELD A;  1HR0 H;  2FMC A;  2R7M A;  4PWQ A;  2IT1 A;  5JJI A;  3R93 A;  3U58 A;  1GUG A;  1K0R A;  2K6A A;  4HCE A;  4GLV B;  4X3S A;  2JQO A;  1S0M A;  1K83 B;  2NB0 A;  3A8J E;  3F1Z A;  3S1Q B;  4MV7 A;  2UU9 H;  4JYA Q;  4ED8 A;  3MC0 B;  1HUM A;  4JI5 L;  2A6H D;  3IG0 A;  1L0Y B;  5KT2 A;  2UVR A;  2VZA A;  2I5L X;  2WYO A;  4MA0 A;  2ZJR A;  4L63 B;  3HFZ B;  3T16 A;  1PRT D;  4CJ0 B;  2HT1 A;  4JI3 H;  3VYS A;  1YIJ A;  3PMF A;  4YY3 Q;  1U9R A;  5DQG A;  3QB3 A;  2AUJ D;  1H9K A;  1EUC B;  1K3R A;  4KJN A;  3HP3 A;  1E24 A;  4B3M Q;  2RDI A;  1ASZ A;  2W9B B;  4Q0F A;  2DJG C;  3CCQ A;  3NPP A;  3GTJ B;  1KLU D;  1SEI A;  3FVQ A;  3P20 A;  3OUU A;  3VA5 A;  5M5Y B;  1DV2 A;  1N34 H;  3K7U C;  1JJ2 A;  3E3X A;  1EZ1 A;  1V1O A;  1TWA H;  3PQI A;  3OIQ A;  3TRE A;  2VUM B;  2X6L A;  4RKL A;  3HOY G;  1PDQ A;  4O3Q A;  5FLX c;  1HR0 Q;  1E4G T;  1VQG A;  3PO2 G;  2YU9 B;  4K0K H;  3J7A K;  2B2U A;  1TQO A;  4B3R Q;  4ECY A;  2D0O A;  2K75 A;  5KFL A;  1KBL A;  2MUY A;  3ICE A;  1GJX A;  5KNC A;  3MEH A;  2ZTE A;  2W6P A;  1KIX A;  4DLK A;  5EPK A;  2JA7 H;  4RU9 A;  1EFI D;  3TII A;  1BCP D;  5IT9 L;  4B3M L;  1UEA B;  4XT1 B;  1HFN A;  4KN7 C;  3D6W A;  4XYO A;  3M3Y H;  2PQA A;  4N8X 1;  1KRT A;  1EFW A;  1A2T A;  3MVV A;  4B3S L;  2L1B A;  4ECR A;  2W70 A;  2EOT A;  1VCI A;  5I6Y A;  1JXL A;  3DEO A;  4HR7 B;  4QF4 A;  4YCW A;  4AYB B;  1VQ5 A;  2R8H A;  3K5L A;  4DR7 L;  3R2I A;  2BOS A;  1HNW L;  2CW8 A;  3L4J A;  4DR6 H;  1IYV A;  4HMJ A;  1VQF A;  4DV6 H;  5E4W C;  4JUZ A;  1XDN A;  2YL2 A;  1PH2 A;  4G3I A;  4O3P A;  4JCV E;  3G4S A;  2A19 A;  2B2T A;  2DY7 A;  4TSS A;  3ERQ A;  4DN4 M;  5C4Z A;  1TXY A;  2PVP A;  3ERS X;  3BA9 A;  1O7I A;  5DEH A;  4HQ6 A;  3TIN A;  4FXK C;  1JDB B;  1LTT D;  2JA8 B;  2F0D A;  4MA5 A;  3RD4 A;  4DL3 A;  3GTQ A;  4X65 L;  4KHP L;  3T1Y L;  3M4Q A;  1B70 B;  3FPP A;  3W5O A;  1PMR A;  4Y7N B;  1PH6 A;  1RK5 A;  4QWD A;  1S0O A;  1PRT F;  3M7N A;  4JI4 Q;  2F0O A;  4HMI A;  2N55 A;  1F77 A;  1SAP A;  3GTG H;  3V6K A;  1NR4 A;  2F0M A;  4LH7 A;  2N88 A;  4X3K A;  3KFU A;  1I4P A;  1K28 A;  1VQH A;  2F1M A;  1VQB A;  1RJP A;  3N40 P;  2N3S A;  4JBW A;  1B3A A;  1JDE A;  3S9W A;  2VY3 A;  4HED A;  3GIK A;  4IUU A;  4ABN A;  4KHV A;  4O2A F;  5IOD A;  2W9C A;  4DXG A;  1PFB A;  1SYG A;  1E3P A;  4X62 H;  2VQE H;  4IRC A;  1IKM A;  3K7A H;  2DLN A;  5I9O A;  4QW8 A;  2YYZ A;  1PH1 A;  2JEG A;  5DLF A;  2SNM A;  1L1O B;  4O3O A;  3WO0 A;  2XCL A;  2DN8 A;  2YS6 A;  4C3I H;  4V19 0;  3Q8P B;  5ELC A;  4J9L A;  3J81 W;  3CC2 A;  1PA6 A;  1EY8 A;  3CPF A;  2PMZ B;  1P8L A;  3S2D B;  4GKK H;  3RFC A;  5IYB G;  3GV8 B;  3RUZ A;  3H4D A;  1PTO B;  5A35 A;  3JAM i;  3N41 B;  3ULJ A;  3T4A C;  3PGZ A;  3GTG B;  1IBM H;  2R7F A;  1JOO A;  3NK9 A;  1ICF B;  1TA8 A;  2G9H D;  1PH4 A;  4RCO A;  2RCN A;  2YYA A;  1F9R A;  2ZXP A;  2J9G A;  2PBZ A;  1PH7 A;  2R8I A;  3Q1K A;  2JEI A;  4LF4 H;  4ZOL F;  1GSA A;  5BMV F;  4DR3 H;  1HNZ H;  2ATL A;  2YU9 A;  2UUB Q;  4DUY Q;  4A93 G;  4RZQ A;  3HOW G;  5ELE A;  4CDC C;  4PNY A;  4X62 L;  4LMQ D;  3Q8R B;  4C5C A;  3S1M B;  1GHK A;  1EQV A;  2YRX A;  3O13 A;  1NE3 A;  5JH7 F;  4RCN A;  4HID A;  4A3D G;  1ZYR C;  4IJH A;  3QO2 A;  3T51 B;  2J6T A;  4HNV A;  1F9P A;  1RTO A;  5HBR B;  4BWG B;  1EUJ A;  1KDC A;  3J7Y W;  1NJI C;  1EY5 A;  1QNU A;  2F0U A;  1BBX C;  4GS3 A;  4DV0 H;  1D5X C;  3N6R A;  1CKO A;  4IUR A;  4QMG A;  4A3D B;  2BE5 D;  5IYZ F;  3RJ0 A;  4S3S A;  5JPM C;  4RGN A;  3CCE A;  4NXN L;  3M4O H;  1GOZ A;  5I2X A;  4O4L F;  1BQQ T;  5KEE A;  2CW0 D;  2F3V A;  4A3F G;  1CUK A;  2JA5 G;  5KIX A;  2NZO A;  2FMM A;  4OX9 L;  2NVX B;  3BYT B;  3BU2 A;  5BR8 L;  2PMZ A;  1NMF A;  1N56 A;  3OYY A;  4WOR A;  5EJW A;  4DUY H;  2RKS A;  1PHJ A;  5LL6 b;  1J5E H;  2F0N A;  4V0B A;  3T56 B;  2C35 B;  2WAQ G;  3MHB A;  1V51 A;  5KG3 A;  1XMQ Q;  2A68 D;  4R7R A;  3HKS A;  2PZU A;  4C2M A;  3A56 A;  1EQR A;  1FNV A;  1VBG A;  4A3J G;  2KSW A;  2VR1 A;  1Z7T A;  1PZI D;  2F0I A;  3KOJ A;  1STG A;  5JUM A;  3KF8 A;  1G8Z D;  4EQ5 A;  5FPO A;  2YZN A;  4UP8 A;  3UE0 A;  1SSO A;  1V43 A;  2HHH L;  4O3R A;  5DM6 3;  3PIP 3;  3HOV B;  2KEN A;  2A74 C;  4DR7 H;  3U9S A;  2JA5 B;  4DPG A;  3MWY W;  1L2Z A;  1HPC A;  5KFH A;  1RYS A;  5COR A;  4ECV A;  1RD9 D;  4RA8 A;  4TQR A;  3D4R A;  1ILP A;  1RF2 D;  1SFO B;  3Q8S B;  5C3W A;  3NEL A;  1PYS B;  2IHF A;  2XN9 C;  5BR8 Q;  5CA0 F;  1Z2O X;  2NU8 B;  2OF1 A;  4JV1 A;  4QCL A;  4EVO A;  1PXU A;  1FR3 A;  4A3J B;  1I6H H;  1R4Q B;  1VMP A;  1B33 N;  2XRQ D;  4X64 L;  1I3Q H;  3QZ8 A;  1VF7 A;  3X3N A;  4GOP A;  3KHL A;  5KFN A;  4IJL A;  1TWH A;  5JPN C;  2E5L L;  2JA7 B;  2LS0 1;  1I50 H;  1C4Q A;  4RWS C;  3KAJ A;  3HS0 C;  4IAJ A;  1X55 A;  5C8Y F;  5IE8 A;  4FS1 A;  1FL0 A;  1MHW C;  3NQI A;  4KY6 A;  4KMU C;  1CQJ B;  1M0T A;  4CKE A;  1VQK A;  2GVB A;  4GKJ Q;  1FNU A;  2PYK A;  1YNJ D;  1NR2 A;  2H1E A;  1GUW A;  4TV8 F;  4Q43 A;  4JK1 C;  3WOF A;  1WYD A;  4DV2 Q;  3S15 H;  4BBS H;  2AQ2 B;  4H13 C;  1YEZ A;  3TS2 A;  1ENF A;  3EA6 A;  5CV6 A;  2Z0S A;  5KND A;  5ELB A;  2ICI A;  3GTJ H;  1D6E C;  3D0F A;  1T5E A;  2HDL A;  5M3M B;  3Q0A A;  3EPG A;  2IBK A;  4UCS A;  3BG3 A;  1PH3 A;  5CGK A;  5C0X I;  2E2I H;  1CKN B;  3JRX A;  2EE1 A;  1PZJ D;  2C5C A;  2FFK B;  3NWT A;  4IUT A;  3SXH A;  4A3E G;  1G6Z A;  1Z2P X;  4GC7 A;  2Y0S G;  3F2U A;  3OPO A;  2A6E C;  3AFP A;  2Q8R E;  3ER0 A;  2KA7 A;  2KJX A;  5FO9 B;  1D2B A;  1WR2 A;  1LTS D;  3U4V A;  4DNR B;  1AUX A;  1AZP A;  1RYR A;  5ISR A;  4JI7 L;  2IP4 A;  2UU9 L;  1T94 A;  2Y0S B;  2DGY A;  2RDJ A;  3PO2 B;  4RB2 C;  2XIG A;  2SEB D;  3HB9 A;  3GTM B;  3A74 A;  2RHS B;  4MZ9 A;  4QJF A;  3QJY A;  4A3L G;  3U4Z A;  3FDS A;  5M3M G;  2OWO A;  3AU7 A;  1TWF A;  3GTK B;  2UXD H;  4JI3 Q;  3CKI B;  4J8Q A;  3OTO L;  4LFA L;  5J2U F;  4RUC A;  2W8K A;  2UVW A;  4LFC H;  2NU6 B;  5IWA Q;  1WJJ A;  1JJC B;  2A69 C;  5C4H A;  2B3G A;  3S1R H;  2K03 A;  1XNQ L;  2C2D A;  2L55 A;  4E6I A;  3RLF A;  1AE2 A;  2EYF A;  4AYB G;  3PO3 H;  3QZ7 A;  4UCR A;  3QOJ A;  1A15 A;  4I55 F;  4EBC A;  4DR4 L;  2ASD A;  1IBK L;  1Y14 B;  4XYQ A;  4YY3 L;  4A3K G;  3RBE A;  1AZQ A;  3BA8 A;  2ES2 A;  5KG2 A;  1S68 A;  4J9S A;  1XTD A;  3J80 E;  1S72 A;  3CD6 A;  1JOK A;  1PK8 A;  4A2B A;  1HNX L;  1C3O A;  1U5K A;  1EUD B;  1ZKO A;  3UDX A;  4DV4 L;  5A2Q W;  1UE6 A;  5KFO A;  2MO1 A;  4YR3 A;  2UVV A;  1I4H A;  1Q1B A;  3HRZ C;  1A63 A;  4LMY A;  2W9A A;  4EFE A;  2HHH H;  4LFA Q;  2E2H H;  3GTO H;  5CV5 A;  1MBY A;  4C5B A;  2PZW A;  4R4T A;  4LUV A;  3PR4 A;  2YZM A;  1FNW A;  3VR4 A;  2K32 A;  3SHL A;  5LMU L;  4Y7N H;  4DR6 Q;  2NUA B;  4DR5 L;  4GN3 B;  2SDF A;  4KKS A;  3KHR A;  1CSP A;  1GUO A;  2AQ4 A;  1J5E L;  5KT5 A;  3HOU H;  2PCF B;  3I3C A;  3KLR A;  1A62 A;  5IYD G;  1MD2 D;  4IUQ A;  2OQ0 A;  4HJ5 A;  1LT4 D;  1R9T H;  3OOC A;  1Q82 C;  3NQT A;  3JZI A;  1BXT A;  2W9B A;  2B2Y A;  1ZET A;  1N32 H;  4JYA L;  5DQH A;  2EYP A;  1IYU A;  2WB1 G;  2F4V Q;  5JJZ A;  1DOM A;  3D8G A;  2DJF C;  1SE2 A;  4PV1 C;  3F2B A;  3BS1 A;  3HOW H;  3F2C A;  1W6K A;  3LWB A;  4H7B A;  3GDE A;  3FDT A;  2KUM A;  1E0B A;  4L6T B;  4U7C A;  4A3I G;  1B9M A;  1IBL Q;  3H3V H;  1PTO F;  3HXL A;  4N8F A;  1QZH A;  1K1S A;  3TBI B;  1TKW B;  2K50 A;  1VQL A;  4QW9 A;  3FRP B;  3RV4 A;  2YTY A;  2PQE A;  2JP1 A;  3KDF A;  4DR3 L;  1J5E Q;  4P75 A;  3KLS X;  4LF4 L;  3N6X A;  1SR3 A;  1AH9 A;  4FM9 A;  5T1I A;  1DIK A;  2HCI A;  2XWJ B;  2B2T C;  3RR5 A;  4GKJ H;  4B3T Q;  4JI1 Q;  2OH2 A;  4JI2 Q;  3NE5 B;  2DPJ A;  2PPB C;  1FVI A;  5DG7 A;  2MNA A;  1KAA A;  3KF6 A;  3K57 A;  2M2L A;  1TWG A;  2PNR C;  3TEH B;  4GNX C;  2JXM B;  2EPB A;  3MXG A;  3VPC A;  1TWC B;  1MGS A;  3BDC A;  4LAA A;  1N8R C;  4TVA B;  4UHV A;  3GTP A;  3N52 A;  5LXT F;  4JYA H;  3AMU A;  3L0O A;  3OHB A;  1EYG A;  4JPB W;  1F2M A;  3SE0 A;  1GUS A;  5LA6 F;  2MCT A;  1BDO A;  4EGQ A;  4HIO A;  2EY2 A;  4DXF A;  4MTE A;  1D1K A;  4KD3 A;  5KFY A;  5C4X H;  4JV5 Q;  4NLG A;  3T13 A;  5IGF A;  3DLL A;  2KOL A;  5C3E G;  2R86 A;  4YBZ B;  3MFG A;  4ID6 A;  4PMB A;  1QZG A;  3RF2 A;  5E1F A;  4LF4 Q;  2F0F A;  3NP8 A;  2IX0 A;  1YIT A;  1SE3 A;  2PO4 A;  2TMP A;  4RAY A;  1N33 L;  4J15 A;  5IGE A;  1C30 A;  3P75 A;  2J7Z A;  1KXL A;  4MV9 A;  2NTS A;  4C3H H;  1Y1V A;  4JI1 L;  5C3E B;  5KKN B;  4X66 Q;  4O3N A;  5LOV F;  3V6J A;  2PI2 A;  3FMA A;  2PI2 E;  3SR1 A;  3H20 A;  4JI8 Q;  5KFG A;  4QWC A;  3SK4 A;  2R7K A;  5D1P A;  3MR2 A;  4DNT B;  2ZDH A;  3T5J A;  2MP1 A;  1I4G A;  3K5O A;  5JAV A;  4DV4 H;  5C1P A;  4F8M A;  2FLP A;  1GM5 A;  1W3S A;  1M4V A;  3LP8 A;  3NTI A;  4O4H F;  2EYO A;  4DUZ H;  4YQW A;  4X65 H;  1TWC A;  4KHP H;  4LFB Q;  5F9N A;  1X3Q A;  4UAI A;  5C44 G;  3KF6 B;  2KHJ A;  4R4Q A;  1V9P A;  2RDF A;  1STA A;  3JRW A;  3S14 H;  3MTS A;  5LMN H;  3G48 A;  2C00 A;  1MJC A;  2B63 B;  2HIV A;  1TWA A;  2QW7 A;  4DR4 H;  2R82 A;  1PX2 A;  3CAM A;  1GD7 A;  2DY8 A;  3N8D A;  4BY7 H;  4HNU A;  2KCC A;  3S1M H;  1JIC A;  4B3R L;  2AGQ A;  4JI6 H;  4DV1 Q;  4ECU A;  2BCO A;  3NXW A;  1SNM A;  5C0X H;  4FS2 A;  1AW7 A;  1HNW H;  1RIP A;  5C3X A;  2GA4 B;  4LFC L;  1LTB D;  2HDM A;  1QE6 A;  4KI0 A;  4IFD I;  1CI3 M;  2NVT H;  2KHI A;  4JI0 L;  1HCZ A;  4H02 A;  1HXY D;  3S1Q H;  4Q44 A;  4H0L C;  4OGQ C;  2UXB L;  4DR2 H;  2QEJ C;  3PW2 A;  1IW7 C;  2UUB H;  3I7F A;  3H0G A;  2I5H A;  2GN5 A;  1G91 A;  2W6O A;  1F9Q A;  3LNN A;  3CQZ H;  4XDX A;  1Q3L A;  5GAD C;  5A2Q E;  3MAQ A;  4IHJ F;  3HOU G;  2QF7 A;  4A3F H;  3A5U A;  1QNK A;  3VA7 A;  4IUN A;  3I4M G;  1TWF H;  1ULZ A;  4DK3 C;  1BNZ A;  3UE1 A;  2O5I C;  5C6A A;  1Q12 A;  5LMN Q;  2A73 B;  4U68 A;  1SMY C;  2JEJ A;  1C0A A;  1WTX A;  3CU7 A;  1E4E B;  2ASL A;  1PFS A;  4R8U A;  2J6U A;  3PSI A;  4R4C A;  1NBW A;  1NTG A;  3OWE B;  3V6H A;  3HOX B;  3CRL C;  4J9R A;  1SNO A;  4G57 A;  2UUB L;  4X65 Q;  4KHP Q;  2BQU A;  3P1H A;  2K5V A;  1L0W A;  1JT8 A;  1VMC A;  2R92 A;  4AH6 A;  1NNX A;  5KFB A;  4JI0 Q;  1ROD A;  3BDL A;  3R8B A;  3G71 A;  2WII B;  5C0X J;  3TS0 A;  4IPD A;  3SDZ A;  4DV5 Q;  1UUP A;  3CCS A;  2UUA L;  1AN7 A;  1PTO H;  4UCU A;  3TQT A;  2BQ3 A;  1OXS C;  1KAB A;  2PMZ E;  1VQE A;  4FDB A;  2QK4 A;  2R61 A;  5M3M H;  3GTK H;  4RNO A;  4KK7 A;  5D14 A;  2C2E A;  4JI6 L;  4F4Y A;  4B3R H;  3K0X A;  4ZYS A;  4X64 Q;  1T3N A;  4IO9 A;  4NXM L;  3IAY A;  4K0K Q;  4OO1 I;  3C2P A;  5CV8 A;  3H6M A;  5L1J A;  5KG6 A;  3M3Y B;  4LF6 Q;  4A3B G;  2AQ3 B;  4DF7 A;  2LSS A;  4RAU C;  4EQN A;  3L7Z C;  4DV5 H;  1YJ9 A;  2PNH A;  4BS9 A;  4YIJ A;  1H9J A;  3S1N B;  3OW2 A;  1G2S A;  2Q2I A;  1QJO A;  1ZEQ X;  3M85 A;  2JEA I;  4A3B B;  4XZ3 B;  4JI0 H;  2R7N A;  2XIW A;  2E2I A;  5JVL A;  3J81 i;  4A93 B;  1II3 A;  1K8A C;  1B50 A;  4LH6 A;  4RG1 A;  1ET6 A;  1RJR A;  2KBN A;  3ORQ A;  2HGS A;  2XC9 A;  5IGG A;  3RB4 A;  1XNR Q;  4R8U B;  3H09 A;  4EBE A;  2R92 H;  1Y1W A;  2HD3 A;  1CZW A;  5I2Y A;  4LF8 L;  3KAL A;  4ED3 A;  2HHH Q;  4DFA A;  5KNB A;  1E1O A;  4YCV A;  1AUV A;  4K2K A;  2CW7 A;  4YJ2 F;  4FP5 D;  1L0X B;  1TVX A;  2KED A;  2R92 G;  3C0F B;  3OHA A;  2IL8 A;  3NBI A;  2PW5 A;  5HY6 A;  5F9L A;  1H9S A;  3BAA A;  1EOV A;  4DR2 Q;  3TME A;  1B53 A;  5IYC G;  1F2L A;  3A5Z B;  1C48 A;  1EY6 A;  5ELF A;  2AHO B;  5KFI A;  2R93 A;  3VPD A;  4L5Q A;  2W8L A;  1B6R A;  1SMX A;  2W6M A;  4NXN H;  1HNZ Q;  4JBK A;  3KJP A;  4ED1 A;  4DV0 L;  5L9X A;  1H9S B;  4FNF A;  1PRT B;  4OL7 A;  1I94 L;  1N33 H;  1XNQ Q;  1N36 H;  2M00 A;  1LV9 A;  1L1O A;  3U50 C;  4IOC A;  2R92 B;  1SYB A;  2E2H B;  2NU7 B;  4DAM A;  1JOQ A;  3S16 H;  1UNN C;  2B29 A;  2L12 A;  1B8A A;  3HOV G;  1WCM A;  4DR4 Q;  4KKT A;  1X3P A;  2D5D A;  4DV7 Q;  2K1B A;  4QUC A;  4G7Z C;  2F0K A;  3R5H A;  5IT9 E;  1V1P A;  1N34 Q;  4IRD A;  3GTM H;  3K5N A;  5IP7 H;  1SRO A;  4ULL A;  3TZU A;  2K7V A;  1X65 A;  3VYU A;  4K2L A;  4WRD A;  4BBR G;  1X3F A;  4I7Z C;  2E75 C;  2VQF L;  2IX1 A;  3GTL B;  3G6V A;  4DU9 A;  3SK5 A;  4FF4 A;  1PVO A;  3GTJ A;  1PTO D;  1CA6 A;  1IBM L;  1WTO A;  1ASY A;  4RHS A;  2FLN A;  2R93 H;  5C4X G;  2MGS A;  1U4L A;  3OMG A;  1RDP D;  2ASJ A;  4ECS A;  4C5A A;  5H1S E;  5JVG 3;  3CHB D;  2RDH A;  2NVX H;  3E6Z X;  1YNJ C;  3ZYY X;  1GVP A;  3I2Z A;  4Q45 A;  2R93 G;  3I4N H;  2WTF A;  2OTL A;  1GKH A;  5I6W A;  4DV3 L;  3I72 A;  2LXJ A;  1EY9 A;  1AFP A;  4DAY B;  1DOL A;  3G6X A;  4OXP A;  2V1C C;  2EZV A;  1MSG A;  4F4Z A;  1EY4 A;  3GIJ A;  3W3A A;  1ML0 D;  1SJE D;  2DIK A;  4BBR B;  4QQB X;  2NTT A;  3J81 E;  5KG1 A;  1AE3 A;  2ZJT A;  1UE5 A;  2WKC A;  1RCV D;  4LSA A;  4J9O A;  3H40 A;  4QIW B;  1DM0 B;  5C4X B;  1ILQ A;  2VB3 X;  3J81 j;  1I3Q A;  4DAV A;  3Q2O A;  3BVG A;  5KG4 A;  1N48 A;  3GTO B;  3RUP A;  2R93 B;  3CCU A;  1BUV T;  5FLX W;  1KQS A;  2CQY A;  4DL4 A;  1TS2 A;  4GZY C;  4HSP A;  1A2U A;  3LWU A;  5DGB A;  1D5M C;  2L9H A;  3QFF A;  3I4N B;  1G51 A;  3RV3 A;  4MAM A;  1CQI B;  1WVL A;  1TY2 A;  3PUV A;  3K5M A;  3EPI A;  3DUZ A;  3JAM W;  3LML A;  4ED0 A;  2L4N A;  1FJG L;  2A6H C;  5FLM H;  4OIJ A;  1K8G A;  4YJ3 F;  4P2C B;  3STB D;  2CH4 W;  3MR3 A;  4H44 C;  4O3S A;  2EYJ A;  4P72 A;  2IWH A;  2XCP A;  3HKZ E;  4TQU S;  4LF8 H;  3HOX H;  5ELO A;  1HJP A;  1DD2 A;  4FU0 A;  1XNQ H;  1EHI A;  2C22 A;  3GTQ H;  5HUR A;  4ME3 A;  1RTN A;  1WFQ A;  1KJ8 A;  5CAE B;  3I12 A;  3EBE A;  4MV3 A;  4JC0 A;  4CJ1 B;  3ITP A;  1W6J A;  4LUO A;  4A3K B;  4PDB A;  3FKI G;  1HNX H;  1AEX A;  1Z6H A;  4TV9 F;  3T1H H;  4IN3 A;  2CQA A;  4HCS A;  3LX0 A;  4LF9 L;  2VB2 X;  2JEB I;  2LFN A;  3RB3 A;  3ORR A;  1BNC A;  3GTG A;  4K5W A;  4GOP C;  4HNT A;  3RLN A;  1K9M C;  4A4I A;  2NVT B;  2ALZ A;  3M4Y A;  5EPL A;  4YY3 H;  3RZD H;  2F4V L;  4FF3 A;  2A69 D;  1Q8K A;  1IBK H;  5GAH C;  1V4Y A;  1X6O A;  1L2F A;  4DV6 Q;  1IL8 A;  2R7D A;  1FJG Q;  3D4W A;  3JC6 6;  2ZM6 Q;  5M5X B;  2R8K A;  3MFY A;  5GQO A;  1N9W A;  2FMA A;  2D0P A;  2Q2T A;  1X54 A;  5DG8 A;  1YVC A;  1E2W A;  4Q5V A;  3A7L A;  2QYZ A;  4APM A;  5KFM A;  5M3F H;  5LMN W;  4LFA H;  3Q6S A;  5C3E H;  2UXD L;  5FJ8 H;  2QA4 A;  2K14 A;  3VMM A;  3DM1 A;  3T1H Q;  1WTP A;  1CFM A;  1Y1W B;  4BXX H;  4QWB A;  1JE5 A;  3DWP A;  4AYB A;  2OQK A;  3J7A F;  1LT3 D;  4B3S Q;  4ODG A;  1I4X A;  2F0J A;  2Q2U A;  3G6E A;  3G8C A;  5T14 A;  4ME6 A;  3S1R B;  4DR7 Q;  1Q81 C;  5G3L F;  3Q24 A;  2JA8 G;  3K6O A;  1M8A A;  4MHE A;  3PW4 A;  1YHA A;  3ETH A;  1WTQ A;  1VQI A;  2AUK A;  4O42 A;  5KYI A;  1XMO Q;  3H3V I;  2AWO A;  3CPW A;  3GV5 B;  2YS7 A;  3ULL A;  1KNA A;  4X64 H;  3BZC A;  4JW0 A;  4M7E A;  1XMQ H;  2VA3 A;  2RSN A;  2HQL A;  2JYO A;  3AB9 A;  1JJG A;  2F4V H;  3K0Y A;  3DMU A;  2NN6 H;  1Z2N X;  2WAQ A;  1JB7 A;  3GTL H;  2Y0S E;  1KAW A;  1LT5 D;  1TII D;  1Y8O B;  3T1H L;  2UUC Q;  4C3J H;  1RK6 A;  2E2H A;  2K4K A;  3BVM A;  2NN6 G;  4PMW A;  4UCV A;  1LUZ A;  4WJ3 M;  1M90 C;  1FKA H;  3ERO A;  2EXZ A;  2O4X A;  2ZXO A;  2VUM H;  1SYX B;  3BVZ A;  3KBG A;  3SK8 A;  2EY1 A;  1B2T A;  3M9O B;  2A5H A;  2K01 A;  4RZR A;  1TS5 A;  2B39 A;  4J9K A;  1Q46 A;  3BQ0 A;  1HH2 P;  4FXD A;  3N44 B;  4BY1 H;  2EQS A;  1Q7Y C;  4K5V A;  2K52 A;  2Z4H A;  5LMN L;  3WO1 A;  2JA7 A;  1HZC A;  3H91 A;  3RNU A;  5KFZ A;  4C3I B;  2NVY A;  2ALY B;  2F0T A;  2F03 A;  5IT9 c;  3OUZ A;  4XXE A;  4DR3 Q;  2F0S A;  3T5H A;  2F0G A;  3GIL A;  2MPM A;  4JV5 H;  1EZ6 A;  2FK3 A;  3SI8 A;  5KFX A;  5JEA G;  5M9O A;  4CKB A;  5C0X G;  1DZ1 A;  2UUC L;  4YAK B;  4DV2 H;  1BCP F;  2V4D A;  3K5I A;  1QG7 A;  4ED7 A;  2F0H A;  1BF4 A;  4ZCK A;  1AP0 A;  4KY7 A;  5CV9 A;  2D2C C;  1JKJ B;  1JR0 D;  2WB1 A;  1TT2 A;  3VR5 A;  1TWH H;  1LTR D;  2QDL A;  5IYD H;  1TWF B;  4FBU A;  3TQY A;  4DL5 A;  2V58 A;  5L1K A;  1NY4 A;  1CKM A;  4JI4 L;  1M7J A;  2AMC B;  4UPA A;  4DKA C;  3N42 B;  4KN4 C;  3KF8 B;  5KG0 A;  1BBW A;  4DUY L;  3HOZ H;  1EYC A;  1I4Q A;  2QCP X;  5IY0 A;  5BR8 H;  2OTJ A;  1I6V C;  4QUF A;  3BG5 A;  3PN1 A;  2CHB D;  5KFP A;  2YCH A;  5C44 B;  1LLR D;  2WP8 J;  4IFD H;  3T5K A;  5CR3 A;  3K59 A;  4I65 A;  1NAP A;  1OXT A;  3M7G A;  4M8A A;  2A8V A;  2UXC Q;  1S9F A;  3FKI H;  5JEA J;  2BH2 A;  2XVS A;  2IY5 B;  4ECX A;  4EGJ A;  1IHZ A;  5M5W B;  4HIM A;  2B8G A;  2IJ0 A;  4AQY L;  5AJ3 Q;  3S2H H;  3NBH B;  1HFG A;  2CW0 C;  1DGS A;  4WJW A;  4GKJ L;  5CYU A;  2TSS A;  3HOY H;  4B08 A;  3KTM A;  1QVG A;  4PQX A;  5BN5 A;  3EYY A;  3KLW A;  1HQM C;  3W2D A;  2FKL A;  4XYL B;  3OSN A;  1JMC A;  1Y1V B;  5KFS A;  2AGP A;  5DNF A;  1RHP A;  3S16 B;  3RZD B;  3DWA A;  4IZO A;  2XCA A;  2Z6K C;  5KFR A;  1G29 1;  1PZK D;  4QY7 A;  5FD6 A;  3SE7 A;  1M6V A;  4KV6 A;  2LKV A;  4OX9 Q;  2DNE A;  2NN6 I;  4I7H A;  4ZAI A;  2ZT9 C;  4A3B H;  4C3H B;  1CSQ A;  1XX8 A;  4JI2 H;  3J80 i;  2F0L A;  1S97 A;  1KJQ A;  5J2T F;  1PLF A;  2HCC A;  1SYD A;  1XTC D;  4AQY H;  5D1O A;  1K3B C;  4EX5 A;  4GKK L;  1D5Z C;  4NMZ A;  1C8C A;  2K5N A;  2R8G A;  4P71 A;  4DL6 A;  3WNZ A;  5JVD F;  4L5R C;  1YI2 A;  3TQ1 A;  1N32 L;  1E1T A;  2OXP A;  3ONA B;  1TWG B;  2FE3 A;  5JVH 3;  3ULP A;  3F2D A;  1TWA B;  4JV2 A;  5C5L A;  2B2U C;  3PW5 A;  5JOB A;  4JOI A;  2B2W A;  4R9W A;  2AWN A;  4XTC S;  1SYE A;  4C1N K;  4EQP A;  2VQE L;  2R84 A;  4N9T A;  1YBY A;  4C3H G;  2NBF A;  4GN4 B;  3V05 A;  4CGY B;  1E4F T;  1UEB A;  1EEI D;  2ATW A;  1G2T A;  4G7H C;  3OMC A;  5HV6 A;  2QGQ A;  4IR1 A;  1GYF A;  3I4N G;  2CH4 A;  1VBH A;  5TSS A;  2FPP B;  3OHX C;  5IOC A;  4RH6 A;  1LTL A;  3RAX A;  4L8J A;  4Z9C B;  4FYD A;  1BGW A;  3F8N A;  5IYC H;  2PQA B;  2KVM A;  4XT3 B;  2B63 A;  1SEB D;  2ZJP A;  2G9D A;  3HZX A;  1SRU A;  5IGC A;  4KLK A;  5FLX E;  2RVL A;  3S1N H;  2NVQ H;  1D1I A;  2YTX A;  3I4L A;  4J9Q A;  3P7J A;  1K83 H;  1TS3 A;  3T1Y H;  2E8G A;  3I8Z A;  3AFQ A;  4MTD A;  3MEF A;  2Z6B A;  3JAM E;  2FPI B;  3BQ2 A;  5D1O B;  2FK1 A;  4ZHQ F;  4DV5 L;  4TQS A;  5J3B A;  2J6S A;  5JJK A;  5BPH A;  2WB1 E;  3CCJ A;  4U67 3;  2XGT A;  3SGI A;  5EWF A;  3KLS A;  3WDN A;  1BO0 A;  3GQC A;  3B6Y A;  3GD7 A;  1JX4 A;  4KY5 A;  1CQV A;  3Q23 A;  2RHQ B;  2ZJQ A;  4NXM H;  1PRT C;  4CC5 A;  3L9A X;  1N36 Q;  3J80 W;  1E2V A;  1KRS A;  3D4D A;  1C9O A;  4OWT B;  1QOH A;  4K0K L;  4F4W A;  2KCM A;  4L5T A;  1GHJ A;  1CZG A;  2EYM A;  2JA8 H;  1UNS A;  4DR6 L;  3PUW A;  5LL6 S;  2UU9 Q;  2RGV A;  2JJQ A;  4DR5 Q;  1CA5 A;  4IAL A;  5BPF A;  4ZRZ A;  3OTO H;  4LF5 H;  5I9P A;  3PVX A;  1I50 B;  5KFF A;  1R9T A;  4KD4 A;  3TZD A;  3R5X A;  3SVM A;  3TIG A;  2BQR A;  3PCO B;  1OXU A;  4IUP A;  5IYB H;  3DM3 A;  1BBU A;  1SN8 A;  1N34 L;  3CQZ B;  3BYY B;  3GTP B;  3NBH A;  1IZ6 A;  4HN7 A;  1U4M A;  3L2P A;  5M5X H;  1VQM A;  1STN A;  1JQY D;  4GN5 A;  4OWX B;  1WOC A;  1SFO H;  4F50 A;  5C4J B;  1I7L A;  3ND9 A;  4DL2 A;  3STB C;  5L1I A;  4JI3 L;  1EIH A;  4HTH A;  1I6H B;  1KNE A;  3W1B A;  2Z8L A;  2B2V C;  2YV5 A;  2WAC A;  5EOY A;  2ZTD A;  3H94 A;  2E2J B;  1ESF A;  4BA1 I;  5IWA L;  1KD1 C;  4HJ7 A;  4JI5 H;  5G3L D;  1IBL L;  3V96 A;  1S40 A;  3GII A;  1WI5 A;  1IOV A;  1QUQ B;  5LP6 F;  3GIQ A;  1LTA D;  4PZ8 A;  1ZQ7 A;  5EKI A;  4DR2 L;  2UXB H;  5K36 G;  1MZB A;  2NZH A;  4KHZ A;  1JB3 A;  4UCO A;  1DV1 A;  3RIZ A;  2WB1 B;  1QB5 D;  3GO5 A;  1XPO A;  4G7O C;  4NW2 A;  5I4D A;  4A3K H;  1HZB A;  1Y1W H;  2GVA A;  3EJI A;  4A2A A;  1HZA A;  1VF5 C;  2AGO A;  2NVY H;  4XX0 B;  4CDF C;  2MQH A;  1KC7 A;  1H9M A;  2EVB A;  4O0A A;  2E76 C;  1VQP A;  1EY0 A;  3TP8 A;  5K5P A;  5J22 A;  3RBD A;  4C3J G;  4IPG A;  4L5S A;  5EDW A;  1AN8 A;  3UFX B;  3PZP A;  2YZG A;  3GIP A;  1SNC A;  3J7A 5;  2FJZ A;  1Y1V H;  5FLX L;  3KHG A;  5LMU Q;  2NU9 B;  5GAE C;  4O1N A;  2W6N A;  1OXX K;  5FLM G;  3E9H A;  2W6Q A;  2WV6 D;  3BZD B;  3URY A;  3G7L A;  2XD4 A;  1KDB A;  5LHY 1;  3R23 A;  2W7O A;  3C1E A;  3PO2 H;  4O2B F;  1HR0 L;  3PIO 3;  3V4S A;  4RNM A;  4Q8F A;  1TU2 B;  3GV3 A;  2W6Z A;  3EIV A;  5M5W H;  3M9B A;  3E9I A;  2VQF Q;  1EWC A;  1JCK B;  1DON A;  3UDG A;  4GLA C;  4C3J B;  4RB1 A;  3BDO A;  5COY A;  4UDU C;  5AFW A;  5A2Q L;  5DAU A;  4HR7 A;  4JI1 H;  1LTG D;  1CHQ D;  2AU0 A;  1E7Z A;  3J7A V;  4IPH A;  4R8N A;  1YZ6 A;  4NP5 A;  4YB8 B;  3OW7 A;  3CME A;  2K5W A;  1HNX Q;  5KFK A;  3CF5 A;  1YNN D;  2I80 A;  3I55 A;  2J0T D;  1TWH B;  1BCP C;  3K3V A;  1XYI A;  3J80 L;  4OX9 H;  2KCT A;  4F4X A;  3TN2 A;  4F7X A;  4C1N I;  2XGQ A;  1O80 A;  3PUX A;  4LF5 Q;  4MN3 A;  3CVZ A;  4B3T L;  1KTK A;  2LMC B;  4LF7 L;  5F2D A;  4C56 C;  5FJ8 G;  4EEY A;  2HUG A;  2ZM6 L;  3H0G B;  3NTK A;  4BXX G;  1LYL A;  4DV1 H;  3OSO A;  1Y8P B;  4DGZ A;  5KYL A;  3HOV H;  2F3W A;  2W57 A;  1KJI A;  1WH2 A;  2JK8 A;  4YWK A;  4MV8 A;  2F4I A;  3HG9 A;  1STB A;  4JI2 L;  3RZO H;  5BN3 A;  1VQA A;  3EN2 A;  1EYA A;  2O5J C;  1PFM A;  1A6X A;  2VL6 A;  3MXU A;  4EQO A;  1KEE A;  2P5Z X;  1KDA A;  4BBR H;  3MXN A;  4YWL A;  1U4R A;  5DLQ E;  2FJ2 A;  3TRZ A;  1S0N A;  1Y69 U;  3MWE A;  2W9C B;  2KCN A;  2I5M X;  3RTX A;  3K3P A;  4A3M B;  3V2T A;  1JE4 A;  3BZK A;  1F2Y A;  5J39 A;  1TAE A;  4IWY A;  4ZQ3 A;  3PF4 A;  3H0G G;  4MV1 A;  2UVU A;  4X62 Q;  2ZDQ A;  4RB3 C;  2L11 A;  1VQO A;  4MTN A;  2X69 A;  1EQT A;  5KFC A;  1FD7 D;  1UC9 A;  3FKI B;  2M05 A;  3HKZ B;  5L37 A;  1XNR H;  3QIA A;  1M0W A;  4EG0 A;  1QCB D;  3S2H B;  4LSX A;  3PIO A;  4GNX A;  1QWY A;  2BA0 A;  4UP7 A;  4JI8 L;  3HKZ G;  2B63 H;  2XNA C;  5KT7 A;  1IW7 D;  5KFV A;  1BOS A;  3GQB A;  4IQZ A;  4A3G H;  5C4J H;  3GV7 B;  4ZLT F;  2FP4 B;  2XWB B;  2UUA Q;  3HOU B;  4I50 F;  3ZJY C;  4DAY A;  3VYT A;  4DR5 H;  2VA2 A;  4X3U A;  5JJL A;  5LMU H;  2KEC A;  4MTK A;  1VQ8 A;  3V4Z A;  4J6H A;  1GUT A;  4ECZ A;  1PH9 A;  1I94 H;  5FKA C;  4POF A;  4DV1 L;  1YJN A;  3E5N A;  1TWG H;  4IFD J;  1HUN A;  4OEM B;  3KHH A;  1B1Z A;  1Y1W G;  2F3I A;  5DG9 A;  2R87 A;  3A8K E;  4LFC Q;  1HTP A;  1CHP D;  1K0S A;  5C5J A;  3GTP H;  2UXD Q;  4IR9 A;  4K5X A;  3I56 A;  3UQ8 A;  4JV5 L;  1SJH D;  1YNN C;  4K6D A;  4OHJ A;  5C5M A;  4R8I A;  3LWE A;  2EDG A;  3VR6 A;  2UXB Q;  3GTO A;  5EWG A;  4A3J H;  3BJY A;  1MI2 A;  2V9W A;  3A55 A;  3T1Y Q;  2GPW A;  5CB4 F;  5D3I B;  3OWF A;  3HOX G;  3KUP A;  1V8Q A;  2Q8T A;  5IGB A;  1S5E D;  3A8I E;  4MIU A;  2X6G A;  4ZUI A;  3SEB A;  4NXN Q;  2WDT A;  3TP5 A;  4YHH L;  4EYH B;  3C3L A;  3MJF A;  2JA5 H;  1T36 A;  5LYJ F;  2Z6K A;  2JE6 I;  2OEO A;  3HOW B;  1YHB A;  2C2R A;  4IFD G;  4IOA A;  4BY7 B;  4TKO B;  3GP7 A;  1EU3 A;  4CBV A;  4OO1 G;  4TRD A;  2RF4 A;  3OSP A;  2AQ1 B;  1DXM A;  1A3U A;  2NVQ B;  1W93 A;  3TP6 A;  3UI2 A;  1HA6 A;  1OWT A;  2V4R A;  5LL6 X;  4ZK9 B;  1H9R A;  2V5A A;  2R3Z A;  2UXC L;  4UP9 A;  4R4O A;  2FLL A;  3GID A;  3GTM A;  3C46 A;  2RBM A;  4A3I H;  1EQQ A;  3KYH C;  1IKL A;  4JI7 H;  2H5X A;  2HVR A;  4R4I A;  1Z9F A;  4ECT A;  5E3F A;  4DV0 Q;  3MWD A;  1PFN A;  2VXW A;  1I4R A;  4ME5 A;  4JI6 Q;  3A54 A;  5KGU A;  3DHQ A;  2XRS D;  1Q8I A;  1V1P B;  1CT1 D;  4YHH Q;  1C7Y A;  4DNI A;  4ED6 A;  3UDF A;  2WIN B;  3S17 H;  2IPK D;  1X56 A;  3BQ1 A;  3JSL A;  2MFI A;  1ENC A;  1S5B D;  1UE1 A;  1E2Z A;  5KFT A;  3DEP A;  1S10 A;  3OIP A;  2OCE A;  3VR3 A;  1B3Q A;  3X3M A;  4CKC A;  5GON F;  3CXC A;  3HKZ A;  2R7Z H;  2CWA A;  1CK1 A;  2K04 A;  4RGM A;  1IBL H;  4AIM A;  4RMF A;  5CA1 F;  2E2J H;  2WAQ B;  3PUY A;  1IYJ B;  3AQQ A;  5KX5 F;  3IRB A;  4F88 A;  3Q8D A;  2NVX A;  2R7Z G;  3MWM A;  3K81 C;  4Q0Y A;  1U4P A;  1CKN A;  3CCR A;  1XJV A;  4A3F B;  4XYM B;  4HYK A;  4QIW A;  4DK1 A;  3RGX A;  3A0J A;  1KLG D;  2EY6 A;  3C1F A;  3I73 A;  3VDY A;  4XQQ A;  1I7N A;  3I70 A;  2UXC H;  4BWS C;  5HGQ A;  2I0Q A;  4AYB E;  4KTA A;  5KFA A;  4LF9 H;  3EVQ A;  5D3D A;  2BDN A;  2D62 A;  1ICW A;  4A3E H;  4RGO S;  2JA7 G;  5CMD A;  2RCF A;  3S15 B;  4BBS B;  1I6U A;  4P73 A;  1NUC A;  1GSH A;  1KC8 C;  5ELN A;  4M9U A;  1E4E A;  2R7Z B;  2O03 A;  4JI7 Q;  1O7Y A;  2EJF C;  3GTK A;  5FO8 B;  4AQY Q;  4BBS G;  5AJ3 L;  4JOI C;  4C2M H;  2E2I B;  3M9N B;  2ZTC A;  1WCM B;  3HEJ A;  4J1M A;  2V4Q A;  1EZ8 A;  2YTV A;  2B8F A;  4OWW B;  1A3V A;  1NSN S;  3J81 c;  3KK7 A;  4ED2 A;  1VKZ A;  2M9V A;  4RAZ A;  4PZ6 A;  5KFW A;  3IFD A;  3CCV A;  1I94 Q;  4DR1 Q;  1WTH A;  4FVM A;  2HVQ A;  5JEA H;  4O4I F;  4WFN 3;  1YHQ A;  2SCU B;  4BA2 I;  1M1K C;  2JA5 A;  2CCZ A;  2C28 A;  3A7A B;  3I4M H;  1G6P A;  5KT6 A;  3FKI A;  1MKH A;  2Z1C A;  1EYD A;  1XPR A;  3MR6 A;  3AYH B;  1HR0 W;  1PV4 A;  2PN1 A;  1Q86 C;  3VPB A;  1EY7 A;  3HOY B;  3E5S A;  2Z9H A;  2CVR A;  4YAJ B;  2E5L Q;  4XIG S;  3QOL A;  5KFQ A;  3H0G H;  1EL0 A;  5EKL A;  4RNN A;  1SNP A;  4K14 A;  3AEV A;  1BKB A;  1TY0 A;  3GV6 A;  1IBK Q;  2QEX A;  2OT2 A;  1N32 Q;  4QL5 A;  3MFH A;  2K28 A;  2HIX A;  3VYR A;  1A8V A;  2DPI A;  1WTR A;  3PUZ A;  4ILW A;  1PH5 A;  1RL2 A;  2JA6 H;  1VQJ A;  1STY A;  2QKI C;  1VQC A;  2JSO A;  4FBT A;  2EJG C;  5EBC A;  3RN5 A;  1Y8N B;  2Q8I B;  1ONL A;  1HNZ L;  3CC4 A;  4DV3 H;  5CC4 A;  4GOP B;  1HTL D;  1EIG A;  2JA6 G;  4A3C H;  1LT6 D;  5GRO A;  4OO1 H;  3KXY T;  1SYF A;  2H4O A;  3MR5 A;  2HQE A;  1FGU A;  4A93 H;  1EU4 A;  1LAC A;  1F9S A;  1BXR A;  2NVY B;  1EYZ A;  1SFO A;  2BDO A;  1XMO H;  5H80 A;  4A3M G;  4J9M A;  2P0A A;  2E2D C;  4HIK A;  1V1Q A;  2RQX A;  2R7Z A;  1CTM A;  2CWP A;  1BR9 A;  4X3T A;  3JAM c;  3K8A A;  4ZUJ A;  3HGB A;  1NCV A;  2K5D A;  4ZQI A;  4CDE C;  2R85 A;  4DR1 H;  1YNX A;  2VQD A;  2B2V A;  3RLO A;  1NMG A;  1SE8 A;  1D7Q A;  1DJR D;  1EOT A;  1SND A;  2KEE A;  4RGT A;  5FO7 B;  5J1Z A;  2JA6 B;  3T53 B;  2Q2H A;  3OTO Q;  1KL9 A;  2KQ3 A;  3IKJ A;  1TWC H;  4K8I A;  4QGU A;  4A3G G;  1XMO L;  4CJ2 C;  1TR5 A;  3NSW A;  4NDX A;  4LF7 Q;  4UCT A;  4DL7 A;  2ZM6 H;  2JN4 A;  2F52 A;  2RA4 A;  3HBL A;  1K83 A;  1BJT A;  1VQN A;  2IX3 A;  4QWE A;  3K80 C;  2B2Y C;  2B2W C;  3CRK C;  4LNQ A;  4OEL B;  4X66 L;  4GLX A;  1DYQ A;  1S5D D;  4JV0 A;  2K5Q A;  2JEF A;  3S14 B;  4B9W A;  1LTI D;  1W2B A;  5CV4 A;  4X6A H;  4RKB A;  4XQJ A;  5E7N A;  2ASB A;  1KJ9 A;  4HJ9 A;  2K5H A;  3FPU B;  1GO3 E;  2NWG A;  2VNU D;  2YU9 H;  2VUG A;  4LUZ A;  5KRU A;  1T9H A;  3WWV A;  4CHT B;  3J81 L;  3IFT A;  2ZDG A;  5EAY A;  1O7Z A;  4K6L A;  3Q8Q B;  5GAG C;  5EKK A;  1FYC A;  1WSC A;  4QWA A;  1O75 A;  3TSS A;  4CC6 A;  4DV6 L;  4ECQ A;  4DK6 C;  4U6P A;  1O7L A;  3FHW A;  5IP7 G;  1PYB A;  3J7Z C;  3K58 A;  5KG7 A;  4FXG C;  4B9X A;  4ZKB B;  4YCU A;  2HJW A;  3I91 A;  1BCP B;  3G6J B;  4JG2 A;  3VR2 A;  4LW1 A;  3U9O A;  4B3S H;  2J4X A;  2R7L A;  2R6G A;  2VPQ A;  3R2T A;  1ET9 A;  4DA2 A;  4APV A;  4EGV A;  1X32 A;  1H95 A;  5EZY F;  4ZKC B;  4HJA A;  3PIP A;  3GIM A;  4B3M H;  2SOB A;  4E4T A;  4BY7 G;  4JBJ A;  2CQO A;  1SNQ A;  2SNS A;  1S4Z A;  1VQ7 A;  5D8D A;  2VOB A;  5KFE A;  2CKZ B;  2I46 A;  3DF7 A;  1PYW D;  5IP9 H;  4WD3 A;  5DLG A;  3QR8 A;  2QDB A;  2JA6 A;  1ESR A;  1XWE A;  5EQ0 A;  5FPR A;  4OIK A;  1HQR D;  3H3V C;  4Q8E A;  3RAQ A;  4C3I G;  2GLT A;  2N49 A;  3IL8 A;  3CMA A;  2UUA H;  3EQL C;  1U0L A;  5KFJ A;  1X9N A;  2AKW B;  4LWC A;  4LJZ C;  1VS0 A;  4Y8V B;  2ZXR A;  4NB3 A;  1VQ9 A;  1Z47 A;  2F0V A;  3WOE A;  1F2Z A;  2WKD A;  3F8T A;  1L1O C;  2CFM A;  1KJJ A;  3T5L A;  1UWV A;  1HNW Q;  1GSO A;  4EFB A;  2G5D A;  2FB9 A;  2VPS A;  4I4T F;  3H15 A;  4PG3 A;  1XMQ L;  1VQ4 A;  3FEW X;  2EIF A;  4FO2 A;  5KT4 A;  1QVF A;  4KJO A;  1SLJ A;  1A0I A;  1WCM H;  5NUC A;  4YP3 A;  2GPS A;  1UE7 A;  2MJ8 A;  5IWA H;  2F0E A;  2A1A A;  3S17 B;  3CW2 C;  2FK2 A;  4UFZ A;  1JOR A;  1D8L A;  2F0W A;  4GNX B;  3CCL A;  3EFX D;  2ICE C;  2PW7 A;  4G4K A;  4RHR A;  3JSN A;  2A6E D;  5EBD A;  1VAJ A;  1B7Y B;  2F0P A;  2FPG B;  2VUM G;  3NTH A;  3NEM A;  1SMY D;  2NYZ D;  5KFD A;  1P16 A;  4DUZ Q;  3G6Y A;  1OTC A;  5CBA E;  4NXM Q;  3L3O C;  4WJ4 A;  2WE6 A;  4NPS A;  5T1G A;  3M9M B;  3PO3 G;  1EIY B;  3KAK A;  4DK0 A;  1ZXT A;  2WFW A;  4J9P A;  1BVS A;  4BY1 G;  4LF5 L;  2YW2 A;  2XTI A;  3JAM L;  2IMW P;  3I90 A;  1UAP A;  4EBD A;  2A68 C;  4A3L H;  2K33 A;  2B63 G;  2E5L H;  1X3G A;  4HSV A;  1LO5 D;  1S5F D;  2EXD A;  1N33 Q;  1GLV A;  4UY8 C;  1ZHS A;  4RB0 A;  3RB0 A;  1S03 G;  2QIL A;  1K73 C;  1I5F A;  1MSH A;  3D31 A;  4EYI B;  1YJW A;  3SK6 A;  1S5C D;  2KHS A;  3E0E A;  2C9O A;  2DNC A;  2N8N A;  1JWS D;  4YR0 A;  3PO3 B;  3RMH A;  1CE8 A;  1RKN A;  2R8J A;  1IOW A;  2VS1 A;  3R3O A;  4QIW E;  5HGT A;  4BY1 B;  4DUZ L;  1IL2 A;  1STE A;  4WBN F;  1JC7 A;  3W1G A;  3TDQ A;  4LFB L;  2LY7 A;  2Y0S A;  2EYL A;  1LAB A;  1ZYR D;  2RDG A;  3R5F A;  1Y1V G;  3NHH A;  4ALP A;  4YR2 A;  3NUC A;  2RGR A;  1B4O A;  2VUM A;  2NUC A;  1X3E A;  1E22 A;  2FIN B;  4POG A;  1QVC A;  2PZT A;  1IXR A;  2RSO A;  4YHH H;  2BR0 A;  4A75 A;  4FF1 A;  3KJO A;  4IRK A;  5DM7 3;  2HVS A;  2IW3 A;  1RJQ A;  4IZ8 A;  1FJG H;  5CBE E;  1DOK A;  2EY5 A;  4QB4 A;  1FGB D;  5IGD A;  1ENA A;  4A3M H;  5M3F B;  1JLL B;  4ZI7 F;  3FP9 A;  2D9U A;  4DV7 H;  2VW9 A;  4FF2 A;  5E4X A;  4JI8 H;  3K5H A;  2DZD A;  4X66 H;  2I8C A;  1JWM D;  1Q1E A;  4A76 A;  5M5Y H;  4LF6 H;  3CCM A;  1OXV A;  2I07 B;  4P74 A;  5M3F G;  3HOZ G;  4MV4 A;  1KHI A;  3I4M B;  4A3E B;  5KG5 A;  4L1K A;  5EPJ A;  1XNR L;  3RGZ A;  3RZO B;  5FD5 A;  1EIF A;  3NEN A;  3CQZ A;  3MZ5 A;  1QIL A;  1TS4 A;  2YRW A;  1CQF A;  5EWE A;  1OO9 B;  1GUN A;  1IBM Q;  3ETJ A;  3I4O A;  4M1U B;  4TUY F;  2LXK A;  4NKL A;  3KDF B;  3L4K A;  4C2M B;  5FOB B;  3PR5 B;  2FXQ A;  1T5X D;  3UDI A;  4GKK Q;  3KBX A;  3GLK A;  2IHE A;  1CS0 A;  1J8I A;  2DWC A;  2F0Q A;  3J80 c;  5FK9 C;  4DR1 L;  3NWS A;  1GXD C;  4KKU A;  1B6S A;  1Q90 A;  2FHT A;  4J0M A;  4J9N A;  4IPC A;  1CM9 A;  4XQN A;  3HOZ B;  1SE4 A;  4DV4 Q;  4OON A;  2BA1 A;  4F87 A;  2E74 C;  3U9T A;  5IIF A;  2W7P A;  3LGJ A;  3M4I A;  1K8M A;  2ID0 A;  4IUV A;  1HRJ A;  4IWX A;  3GTL A;  5KFU A;  2W71 A;  2CZG A;  3IN5 A;  4LF7 H;  2IA6 A;  2VQF H;  1XXG A;  4I7A A;  1WD1 A;  5C1O A;  4LF6 L;  4MV6 A;  4A3G B;  1J9O A;  2EYH A;  1WD0 A;  1PH8 A;  3CC7 A;  4LK1 C;  1SCU B;  3MFI A;  5I47 A;  3NGD A;  2OLS A;  3D6C A;  3M4P A;  3E0J A;  1EWI A;  4DV7 L;  3BAB A;  3QG1 A;  5KT3 A;  1I3Q B;  4YWM A;  1MJE A;  1ZHQ A;  1MIU A;  3RN2 A;  4JI4 H;  1STH A;  4JVZ A;  5K2M A;  1HZ9 A;  1GGO A;  4HAE A;  3H4B A;  1LM0 A;  1QUQ A;  5BN4 A;  1HHV A;  4O2D A;  2WAQ E;  4CDD C;  1B04 A;  1VQD A;  1B44 D;  1JWU D;  4DAP A;  4PMC A;  4N9P A;  3PW7 A;  1J6Q A;  2Z4I A;  3ND8 A; 
#chains in the Genus database with same CATH homology
 1VQ6 A;  1N36 L;  5C44 H;  2VUM H;  2MO0 A;  3F2B A;  2L15 A;  4JI6 Q;  3HOW H;  3F2C A;  3MXN B;  2JA9 A;  4DV3 Q;  4HJ8 A;  4LF8 Q;  4Y52 H;  1Q46 A;  4YHH Q;  3GDE A;  1C7Y A;  4DNI A;  1HH2 P;  3UDF A;  3S2D H;  3CP0 A;  3S17 H;  4DV2 L;  1X56 A;  4BY1 H;  2EQS A;  4A3I G;  1Q7Y C;  2MFI A;  1IBL Q;  2K52 A;  5LMN L;  3H3V H;  2VQE Q;  1S3O A;  4A3C G;  1HZC A;  3RNU A;  1UE1 A;  2ALY B;  1QZH A;  5IT9 c;  2K50 A;  1VQL A;  2OCE A;  4DR3 Q;  2BH8 A;  2YTY A;  4DR3 L;  3KDF A;  1J5E Q;  4P75 A;  4LF4 L;  1XPU A;  4JI5 Q;  1SR3 A;  3CXC A;  2N78 A;  2R7Z H;  1AH9 A;  2CWA A;  5JEA G;  5C0X G;  4AIM A;  4RMF A;  3BJU A;  3RR5 A;  2E2J H;  2UUC L;  4LF9 Q;  4B3T Q;  4JI1 Q;  3PUY A;  1IYJ B;  3AQQ A;  4JI2 Q;  3IRB A;  3PF5 A;  3Q8D A;  1FVI A;  4R1J A;  2MNA A;  2R7Z G;  3KF6 A;  3K81 C;  4GNX C;  1CKN A;  4MNO A;  3TEH B;  3CCR A;  2DUD A;  1TWH H;  1XJV A;  5IP9 G;  1WCM G;  5IYD H;  3A0J A;  1N8R C;  4PZ7 A;  4TVA B;  3TQY A;  3S24 A;  3VDY A;  3PV0 A;  4JBM A;  3L0O A;  5HGQ A;  1NY4 A;  1CKM A;  1EYG A;  4AYB E;  2I0Q A;  2AMC B;  4JI4 L;  4A3D H;  4UPA A;  4DKA C;  3KF8 B;  1BBW A;  4DUY L;  4HIO A;  3HOZ H;  2IT1 A;  5IY0 A;  5JJI A;  2D62 A;  4A3E H;  2OTJ A;  3U58 A;  1K0R A;  2JA7 G;  4GLV B;  5C4X H;  2JQO A;  4JV5 Q;  2WP8 J;  5JJL A;  3DLL A;  3F1Z A;  5C3E G;  4P73 A;  1OXT A;  1QZG A;  4JYA Q;  2UXC Q;  2A8V A;  1KC8 C;  5ELN A;  4LF4 Q;  3FKI H;  2IX0 A;  4JI5 L;  5JEA J;  1YIT A;  2BH2 A;  2IY5 B;  2VZA A;  4JI7 Q;  4HIM A;  4J15 A;  1N33 L;  2I5L X;  2ZJR A;  4AQY Q;  3HFZ B;  4BBS G;  4AQY L;  4C3H H;  5AJ3 L;  4JOI C;  4JI1 L;  4C2M H;  5AJ3 Q;  4X66 Q;  2ZTC A;  3NBH B;  1YIJ A;  2PI2 A;  2HT1 A;  2PI2 E;  4YY3 Q;  3S2H H;  4JI8 Q;  1DGS A;  2YTV A;  4OWW B;  4GKJ L;  1K3R A;  3J81 c;  4B3M Q;  1E24 A;  3HOY H;  1ASZ A;  1QVG A;  3CCQ A;  3KLW A;  4PZ6 A;  3CCV A;  1I94 Q;  4DR1 Q;  1JMC A;  1GM5 A;  1W3S A;  1YHQ A;  4BA2 I;  1M1K C;  4LFB Q;  3K7U C;  1JJ2 A;  2Z6K C;  2CCZ A;  3I4M H;  5C44 G;  1G6P A;  1G29 1;  2KHJ A;  3KF6 B;  4R4Q A;  1TWA H;  1V9P A;  1MKH A;  4QY7 A;  3TRE A;  3S14 H;  3HOY G;  3G48 A;  1XPR A;  4OX9 Q;  1MJC A;  2NN6 I;  3AYH B;  1HR0 W;  2HIV A;  5FLX c;  4A3B H;  1CSQ A;  1PV4 A;  3J80 i;  1HR0 Q;  3CAM A;  1GD7 A;  1VQG A;  3PO2 G;  1Q86 C;  4BY7 H;  3S1M H;  4B3R L;  4B3R Q;  4DV1 Q;  2D0O A;  2K75 A;  4EX5 A;  2E5L Q;  4GKK L;  3ICE A;  4XIG S;  2K5N A;  2ZTE A;  4P71 A;  3H0G H;  3AEV A;  4L5R C;  1BKB A;  1RIP A;  1YI2 A;  4LFC L;  2QEX A;  1KIX A;  1IBK Q;  1N32 Q;  4KI0 A;  4QL5 A;  1E1T A;  2JA7 H;  4IFD I;  1N32 L;  2HIX A;  2NVT H;  2KHI A;  1A8V A;  3ULP A;  3F2D A;  3PUZ A;  4B3M L;  4JI0 L;  1PH5 A;  1RL2 A;  4H02 A;  2JA6 H;  3M3Y H;  1VQJ A;  3S1Q H;  2PQA A;  1KRT A;  1EFW A;  1VQC A;  4JOI A;  4B3S L;  2UXB L;  2AWN A;  4XTC S;  3RN5 A;  2VQE L;  1HNZ L;  3CC4 A;  1VCI A;  1YBY A;  3I7F A;  4YCW A;  4GOP B;  2I5H A;  1VQ5 A;  2GN5 A;  4GN4 B;  4DR7 L;  2JA6 G;  1UEB A;  4A3C H;  1HNW L;  5GRO A;  3CQZ H;  5GAD C;  2ATW A;  1VQF A;  2QGQ A;  3HOU G;  1FGU A;  4A93 H;  4A3F H;  3A5U A;  3I4N G;  2IX1 A;  3I4M G;  1LTL A;  1TWF H;  4DK3 C;  3UE1 A;  1PH2 A;  5IYC H;  2PQA B;  4A3M G;  1Q12 A;  4JCV E;  2ZJP A;  3G4S A;  5LMN Q;  4HIK A;  1SRU A;  1V1Q A;  2A19 A;  4KLK A;  1C0A A;  1PFS A;  1TXY A;  3S1N H;  2CWP A;  3PSI A;  4R4C A;  1NBW A;  1NTG A;  3ERS X;  1O7I A;  2NVQ H;  2YTX A;  3JAM c;  1K83 H;  3K8A A;  2UUB L;  4X65 Q;  4KHP Q;  2E8G A;  4X65 L;  1YNX A;  3AFQ A;  4KHP L;  2K5V A;  1L0W A;  3T1Y L;  1JT8 A;  3M4Q A;  1B70 B;  4AH6 A;  3W5O A;  3RLO A;  3MEF A;  1PH6 A;  1NMG A;  1SE8 A;  4JI0 Q;  2F4V Q;  1D7Q A;  3G71 A;  5C0X J;  3TS0 A;  3M7N A;  4JI4 Q;  4IPD A;  4DV5 L;  5J3B A;  4DV5 Q;  5JJK A;  2WB1 E;  3CCS A;  3CCJ A;  2UUA L;  2XGT A;  2Q2H A;  3SGI A;  3OTO Q;  1OXS C;  1KL9 A;  2PMZ E;  3B6Y A;  1VQE A;  3GD7 A;  4FDB A;  3GTG H;  1TWC H;  2ZJQ A;  2RHQ B;  5M3M H;  4QGU A;  3KFU A;  1XMO L;  4A3G G;  3GTK H;  1N36 Q;  1VQH A;  1VQB A;  1KRS A;  4JI6 L;  2N3S A;  3K0X A;  4X64 Q;  4LF7 Q;  1C9O A;  4JBW A;  4OWT B;  4K0K L;  4IO9 A;  4NXM L;  4K0K Q;  4OO1 I;  2KCM A;  2VY3 A;  4L5T A;  2F52 A;  2JA8 H;  4DR6 L;  3PUW A;  2UU9 Q;  2JJQ A;  4DR5 Q;  4LF6 Q;  1VQN A;  4A3B G;  3K80 C;  4LNQ A;  2LSS A;  4X66 L;  1E3P A;  3L7Z C;  4GLX A;  3K7A H;  2PNH A;  3PCO B;  1YJ9 A;  2YYZ A;  1PH1 A;  1OXU A;  5IYB H;  3DM3 A;  1BBU A;  3OW2 A;  1L1O B;  1SN8 A;  1W2B A;  1N34 L;  2Q2I A;  4X6A H;  3M85 A;  2JEA I;  1IZ6 A;  5E7N A;  2ASB A;  3J81 i;  3L2P A;  4HJ9 A;  1K8A C;  2K5H A;  4C3I H;  1GO3 E;  4RG1 A;  5M5X H;  1VQM A;  2VNU D;  2KBN A;  2YU9 H;  4LUZ A;  4GN5 A;  1T9H A;  3WWV A;  1PA6 A;  4OWX B;  1WOC A;  1SFO H;  3CC2 A;  1XNR Q;  3CPF A;  1P8L A;  3STB C;  2R92 H;  5EAY A;  5IYB G;  4JI3 L;  3JAM i;  4LF8 L;  5GAG C;  2HHH Q;  3W1B A;  3ULJ A;  2YV5 A;  3PGZ A;  1E1O A;  2ZTD A;  4YCV A;  4BA1 I;  5IWA L;  1KD1 C;  4HJ7 A;  2R7F A;  4DV6 L;  4DK6 C;  2R92 G;  3FHW A;  5IP7 G;  1PH4 A;  1PYB A;  3J7Z C;  2RCN A;  1S40 A;  1IBL L;  1PH7 A;  1WI5 A;  1QUQ B;  5HY6 A;  4PZ8 A;  4YCU A;  1EOV A;  4JG2 A;  4LW1 A;  4DR2 L;  5K36 G;  4DR2 Q;  2NZH A;  2R6G A;  2UUB Q;  4DUY Q;  4KHZ A;  5IYC G;  4A93 G;  4APV A;  3A5Z B;  1H95 A;  1XPO A;  3GO5 A;  4HJA A;  3HOW G;  3PIP A;  2AHO B;  4X62 L;  1HZB A;  4A3K H;  1Y1W H;  4BY7 G;  2GVA A;  4L5Q A;  1HZA A;  4JBJ A;  2CQO A;  1VQ7 A;  1NE3 A;  2NVY H;  2CKZ B;  4HID A;  1SMX A;  2MQH A;  4A3D G;  4IJH A;  5IP9 H;  4O0A A;  1VQP A;  1HNZ Q;  4JBK A;  3KJP A;  4IPG A;  4L5S A;  1EUJ A;  4DV0 L;  1NJI C;  1I94 L;  4GS3 A;  1XNQ Q;  1CKO A;  1L1O A;  3U50 C;  4IOC A;  3J7A 5;  1Y1V H;  3CCE A;  4NXN L;  4DAM A;  5LMU Q;  3M4O H;  5GAE C;  2N49 A;  3CMA A;  3S16 H;  2B29 A;  1U0L A;  1B8A A;  1X9N A;  3HOV G;  1OXX K;  2AKW B;  4LWC A;  1VS0 A;  3E9H A;  5FLM G;  4A3F G;  4DR4 Q;  1CUK A;  2JA5 G;  2NZO A;  4NB3 A;  1VQ9 A;  4OX9 L;  1Z47 A;  4DV7 Q;  3BU2 A;  5BR8 L;  1NMF A;  3OYY A;  3F8T A;  1KXL A;  3PO2 H;  1HR0 L;  1PHJ A;  1L1O C;  2CFM A;  1N34 Q;  1UWV A;  1HNW Q;  2C35 B;  3EIV A;  5M5W H;  5IP7 H;  2WAQ G;  3GTM H;  3M9B A;  1SRO A;  3E9I A;  4BBR G;  3H15 A;  1X65 A;  4PG3 A;  2VQF L;  2VQF Q;  1VQ4 A;  1X3F A;  2EIF A;  3HKS A;  3UDG A;  1XMQ L;  1QVF A;  1SLJ A;  4GLA C;  1A0I A;  1EQR A;  1WCM H;  1PVO A;  4A3J G;  1UE7 A;  1IBM L;  1ASY A;  2A1A A;  3CW2 C;  3KOJ A;  1D8L A;  4EQ5 A;  4GNX B;  3CCL A;  4UP8 A;  2R93 H;  5C4X G;  3UE0 A;  1V43 A;  2HHH L;  1E7Z A;  5H1S E;  1B7Y B;  4IPH A;  1YZ6 A;  2NVX H;  2KEN A;  1GVP A;  3I2Z A;  3CME A;  3NEM A;  2VUM G;  4DPG A;  1HNX Q;  3I4N H;  2R93 G;  3CF5 A;  2OTL A;  1GKH A;  1P16 A;  4DUZ Q;  1OTC A;  4NXM Q;  3I55 A;  4DV3 L;  2LXJ A;  4WJ4 A;  4DAY B;  4OXP A;  4NPS A;  2V1C C;  3PO3 G;  1EIY B;  2WFW A;  1BVS A;  4BY1 G;  2KCT A;  3NEL A;  1PYS B;  2IHF A;  4QQB X;  5BR8 Q;  3PUX A;  4LF5 L;  4LF5 Q;  2XTI A;  1I6H H;  1AE3 A;  4B3T L;  1UE5 A;  4A3L H;  4X64 L;  5FJ8 G;  1I3Q H;  4LF7 L;  2ZM6 L;  4GOP A;  2B63 G;  4BXX G;  1LYL A;  4IJL A;  1X3G A;  3J81 j;  1N33 Q;  3HOV H;  2E5L L;  2EXD A;  1I50 H;  4UY8 C;  2JK8 A;  4YWK A;  1K73 C;  1I5F A;  1X55 A;  5IE8 A;  1FL0 A;  3D31 A;  4JI2 L;  3RZO H;  1VQA A;  3EN2 A;  3CCU A;  1VQK A;  2GVB A;  1YJW A;  4GKJ Q;  1KQS A;  3E0E A;  2VL6 A;  2N8N A;  1WYD A;  4DV2 Q;  4BBR H;  3S15 H;  4YWL A;  4BBS H;  1YEZ A;  3TS2 A;  2VS1 A;  2Z0S A;  4QIW E;  1G51 A;  5DLQ E;  4DUZ L;  1IL2 A;  3TRZ A;  3PUV A;  3W1G A;  3GTJ H;  4LFB L;  3D0F A;  2I5M X;  1FJG L;  3BZK A;  5C0X I;  1PH3 A;  2E2I H;  1CKN B;  5FLM H;  1K8G A;  1Y1V G;  3PF4 A;  3STB D;  3H0G G;  4ALP A;  4A3E G;  1XMQ Q;  4X62 Q;  1X3E A;  1E22 A;  4P72 A;  2Y0S G;  4POG A;  1VQO A;  1QVC A;  3HKZ E;  4MTN A;  4TQU S;  3AFP A;  1IXR A;  3ER0 A;  3HOX H;  5ELO A;  4A75 A;  1HJP A;  3U4V A;  3KJO A;  3GTQ H;  4JI7 L;  4ME3 A;  2UU9 L;  1WFQ A;  2DGY A;  3EBE A;  4JC0 A;  4LUO A;  3PIO A;  4GNX A;  3FKI G;  2BA0 A;  3A74 A;  4UP7 A;  2RHS B;  4MZ9 A;  3HKZ G;  4JI8 L;  4A3M H;  2B63 H;  3FP9 A;  4QJF A;  2VW9 A;  4A3L G;  4LF9 L;  3U4Z A;  2JEB I;  5M3M G;  4A3G H;  5C4J H;  4GOP C;  2OWO A;  3RLN A;  1K9M C;  4A4I A;  4JI3 Q;  2UUA Q;  1Q1E A;  3ZJY C;  4A76 A;  5M5Y H;  3OTO L;  3RZD H;  3CCM A;  4LFA L;  1OXV A;  1Q8K A;  4P74 A;  5M3F G;  5GAH C;  2F4V L;  1X6O A;  1KHI A;  1VQ8 A;  3HOZ G;  1L2F A;  1WJJ A;  5IWA Q;  1XNR L;  4DV6 Q;  1JJC B;  2B3G A;  2R7D A;  3S1R H;  1XNQ L;  1FJG Q;  3JC6 6;  1PH9 A;  2ZM6 Q;  4POF A;  1EIF A;  5GQO A;  1N9W A;  3NEN A;  4DV1 L;  2D0P A;  1TWG H;  3RLF A;  1YJN A;  2Q2T A;  1X54 A;  1AE2 A;  4AYB G;  3PO3 H;  1Y1W G;  4IFD J;  1YVC A;  2F3I A;  1IBM Q;  3I4O A;  4DR4 L;  1IBK L;  4LFC Q;  2LXK A;  1Y14 B;  5M3F H;  5LMN W;  4YY3 L;  3KDF B;  4A3K G;  3GTP H;  2UXD Q;  5C3E H;  2UXD L;  5FJ8 H;  3I56 A;  2QA4 A;  2K14 A;  2FXQ A;  2ES2 A;  4JV5 L;  3UDI A;  4GKK Q;  3T1H Q;  4BXX H;  2IHE A;  1JE5 A;  2OQK A;  3J80 c;  1XTD A;  4B3S Q;  2UXB Q;  4DR1 L;  1S72 A;  4A3J H;  3CD6 A;  2Q2U A;  3G6E A;  1HNX L;  3T1Y Q;  1U5K A;  4IPC A;  4DR7 Q;  3UDX A;  4DV4 L;  1Q81 C;  4DV4 Q;  1UE6 A;  3HOX G;  4OON A;  2MO1 A;  2BA1 A;  2JA8 G;  1Q1B A;  1A63 A;  4NXN Q;  1YHA A;  4LFA Q;  4YHH L;  2E2H H;  3GTO H;  1VQI A;  3LGJ A;  1XMO Q;  2JA5 H;  2ID0 A;  3H3V I;  2AWO A;  3CPW A;  4R4T A;  4LUV A;  2Z6K A;  2JE6 I;  3ULL A;  1YHB A;  3BZC A;  4IFD G;  4IOA A;  5LMU L;  4Y7N H;  4DR6 Q;  2HQL A;  4GN3 B;  4DR5 L;  4LF6 L;  1JJG A;  1CSP A;  4OO1 G;  1PH8 A;  3CC7 A;  1J5E L;  3HOU H;  2RF4 A;  3M4P A;  1EWI A;  4DV7 L;  1A62 A;  5IYD G;  1JB7 A;  3GTL H;  2OQ0 A;  4HJ5 A;  2Y0S E;  1KAW A;  1R9T H;  1Q82 C;  2UUC Q;  4YWM A;  3T1H L;  4C3J H;  1MJE A;  1MIU A;  3RN2 A;  1HZ9 A;  2K4K A;  4JYA L;  2UXC L;  4UP9 A;  4R4O A;  2NN6 G;  1LM0 A;  2WB1 G;  1QUQ A;  4PMW A;  3KYH C;  4O2D A;  2WAQ E;  4A3I H;  1LUZ A;  1VQD A;  2H5X A;  1EQQ A;  1M90 C;  4WJ3 M;  4R4I A;  1Z9F A;  1J6Q A;  4DV0 Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...