1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
3DM3A 2VQFQ 3CPFA 1VQHA 2K5NA 2F4VL 4DV4Q 1N33L 3S17H 3S1QH 4APVA 4YCVA 3CW2C 2MQHA 3H3VH 4DV0Q 1N36L 1SLJA 3PCOB 4R1JA 4NXNL 3FKIH 5JEAG 1JE5A 3D0FA 2IHFA 1FL0A 4P75A 1PH9A 3M3YH 4K0KL 4BY1G 5AJ3L 4JI4Q 1I94Q 1Q1EA 4GLXA 5M3MH 2I5HA 4LUZA 4DV3L 1L1OC 3W5OA 1J5EQ 3HOZG 4DR6L 4DR1L 3HOWH 4JYAL 4X64Q 4DR1Q 4RG1A 1YJNA 3ULLA 5JJLA 1EQQA 3TEHB 1XPUA 3U4VA 1CUKA 3KF6A 3EIVA 3JAMc 2XGTA 3HOYG 3U4ZA 2VQEL 4BBSH 2OCEA 3S1RH 4BBRG 1XNRL 2I0QA 3G48A 2ZJRA 2AWNA 4DAMA 4QGUA 3ER0A 1VQJA 1W3SA 1X56A 3J81c 2UXDQ 4UP7A 1I3QH 4DUZQ 1K8AC 4DK3C 1VQ7A 3KLWA 2NZOA 1JJGA 1SR3A 2IX1A 4C3HH 2B63G 5IYBH 4A93H 2EQSA 4JBJA 1EYGA 3I2ZA 3PSIA 4R4CA 4BA1I 4YY3Q 1E22A 4QL5A 4A3EG 2F4VQ 3GTGH 4GN5A 4GLVB 5HGQA 3A5UA 3KJOA 2WB1G 3ERSX 2JA6G 1K0RA 2D0PA 4GNXA 3RZOH 2R93G 1V1QA 3G71A 4HIMA 1E3PA 4LWCA 5BR8Q 3UE1A 1B70B 3H0GH 3NELA 4YHHQ 3CC7A 4LF9Q 1KL9A 4KHPQ 1VQDA 4DR7L 4GS3A 4DV6Q 3JC66 1CKMA 1IBKL 2NVTH 1YEZA 1QZHA 2YTVA 3WWVA 4JI1L 3KFUA 2D62A 1VQLA 4DK6C 4O2DA 4NXNQ 1BKBA 4TQUS 4C3IH 4HJ7A 5IP9H 4BY7G 3CAMA 3NBHB 4R4IA 4B3TQ 4QQBX 1Z47A 2EIFA 4A3MG 1VQPA 4DPGA 1Q82C 3CMAA 1PV4A 4A3MH 2Q2TA 2UUAQ 5IWAL 4IPCA 4DV2L 1LM0A 1OXTA 4A3IH 2Z6KA 4OWWB 1YNXA 4JCVE 3M4QA 5FJ8H 2WB1E 1PH6A 1Q12A 4DR3L 2HQLA 1TWFH 5C0XG 2VS1A 4BXXH 3HOXH 1E1TA 4DR5L 4DV1Q 4JI0L 4P71A 3PF5A 2WAQE 5FLXc 5JEAJ 1WI5A 3G6EA 4X65L 1K9MC 4OWTB 2CFMA 1WCMH 3M4PA 1ASYA 2I5LX 1HNZQ 1TWCH 2N49A 4B3MQ 4A3DH 3U50C 4MTNA 4LF4Q 5C4XH 1A63A 2ZJQA 4A3IG 5E7NA 2LXJA 2XTIA 5LMUQ 4DV5Q 1N32Q 2AKWB 2F52A 2HHHQ 3I4OA 4JI1Q 5JJIA 2HHHL 2Q2IA 1R9TH 1BVSA 3HOXG 1PH1A 1VQ6A 1YHBA 3I4MH 4LW1A 4NPSA 1NMGA 3HKZE 3SGIA 1PVOA 4NXML 4K0KQ 2K5HA 4JG2A 4LUVA 1GVPA 2UUCL 2UUCQ 1KAWA 1X9NA 2VQFL 3RZDH 5M5XH 4A3FH 1TXYA 1G51A 3KOJA 1X55A 3LGJA 4DV7Q 1VQGA 4OWXB 3STBD 3GTOH 2FXQA 1KD1C 3HOYH 4JI3Q 2OWOA 1PH4A 1L2FA 2PQAB 1JJ2A 2ZJPA 2E5LQ 2VUMH 3S2DH 1QVCA 1UEBA 2Q2UA 4DR2L 3TRZA 2WAQG 3F1ZA 4HJ9A 4OX9Q 4ME3A 3A74A 1HNWQ 2IHEA 3S16H 1HZAA 2JE6I 4AIMA 4LF8Q 1FJGL 4A3LH 3HKSA 2QGQA 1Y1VG 4DV1L 3MXNB 3TREA 1GKHA 1GM5A 5FLMG 4XIGS 4YWMA 4LFAL 1VQAA 5C4JH 1CSQA 5C3EH 4DNIA 1IBLQ 5M3MG 1I50H 5IYCH 4LF4L 2KCTA 1PHJA 3CD6A 1SRUA 2N8NA 3S14H 3RLOA 4X6AH 1IXRA 1A8VA 5C4XG 2Q2HA 4YCWA 3HOUH 4WJ4A 1KRSA 2VZAA 4UPAA 2A19A 1C9OA 1XMQL 3GDEA 4DV0L 3FKIG 1P16A 1MKHA 4PZ6A 4NXMQ 4ALPA 3AFQA 3K7AH 1XNQQ 2R7ZH 1YHAA 3F8TA 4O0AA 4P74A 1E24A 3J80c 1Y1WG 4DAYB 5M5WH 4DR6Q 4JYAQ 1XTDA 1QUQA 2R92H 3Q8DA 1Y1WH 1X3EA 1RL2A 4JBWA 4A3JG 3F2DA 4L5SA 3FHWA 1JB7A 4B3RQ 2A8VA 4JOIA 3F2BA 4BBRH 5DLQE 4KHZA 2BA0A 3AQQA 2E8GA 3B6YA 3OYYA 2K75A 5J3BA 4X66Q 3H15A 4A3CG 4WJ3M 3M9BA 3I4MG 2R6GA 2UUAL 1HR0Q 3AEVA 2UXCL 3CXCA 3PIOA 1SMXA 2PI2A 5JJKA 2E2IH 1UE7A 2LSSA 4JI5L 3T1YL 2KENA 2OQ0A 4AH6A 3CCSA 2K5VA 4FDBA 1JMCA 3GTLH 1D7QA 4EQ5A 1DGSA 4GOPA 2I5MX 2KHJA 2YU9H 2UXBQ 1KIXA 2MNAA 2IT1A 4IJLA 4R4OA 1IYJB 1IBLL 2RF4A 3S2HH 2JA7H 4B3ML 2R7FA 4PG3A 2V1CC 1M1KC 2MO0A 2YV5A 1HZBA 1VQ5A 4A3EH 3S1MH 3GTPH 1XMOQ 3KDFA 3J81j 1N32L 3CF5A 4B3RL 4X64L 5FJ8G 1KC8C 4LF5L 1N36Q 5H1SE 3PV0A 4IFDJ 3K7UC 4QY7A 2KBNA 1BBUA 5FLMH 1VQMA 4A3LG 2OQKA 1VQOA 1VCIA 4X62L 4JI6L 1U5KA 4LFBQ 4C3JH 5GAHC 3J81i 2GN5A 2D0OA 2JA8G 3S1NH 4JV5L 2UXDL 1FVIA 5GROA 3J7A5 5LMNW 4A3JH 3T1YQ 4JI5Q 2ZM6Q 1Q8KA 2N3SA 3TS2A 3UDXA 1OXSC 1Y1VH 5IP7H 1J6QA 1QVFA 4OO1G 4AYBE 3H3VI 3FP9A 3F2CA 1CKNB 2ATWA 4B3SQ 4YHHL 4LF9L 5ELNA 1WYDA 2CWPA 2HIXA 3AYHB 4HIKA 4KLKA 1MJCA 1K83H 1HNWL 2JJQA 3RR5A 4DV6L 1IBKQ 2CWAA 3HFZB 3G4SA 2UUBQ 2UU9L 3KYHC 2K14A 4HIOA 2AHOB 4YCUA 4H02A 3CP0A 4Y7NH 1X6OA 1K73C 2AWOA 2JA5H 2UXBL 5IP9G 1LTLA 1JT8A 3EBEA 2NVYH 1JJCB 4OXPA 2E2JH 4A3KG 4JOIC 3CC2A 4GLAC 4POGA 4PMWA 1PA6A 3ICEA 4NB3A 3CQZH 4HJAA 1N34L 4HJ5A 1N8RC 3UDGA 4JV5Q 1K3RA 2PMZE 3TS0A 1CKNA 2L15A 2JEBI 4LF5Q 2BA1A 4DR5Q 4A3BG 4IFDG 1FGUA 1WFQA 2VQEQ 2Y0SE 1LYLA 3L2PA 2NN6G 3BZKA 4IPGA 3J7ZC 1L1OA 2F3IA 4LF6L 1VQ8A 4JI8L 4A4IA 2NN6I 2Z6KC 2JEAI 3RNUA 4GKJL 4QIWE 5IYBG 4J15A 1VQCA 5IT9c 3I55A 3T1HL 4IFDI 5LMUL 4AYBG 1P8LA 4POFA 2H5XA 2ZTCA 4A3FG 2DGYA 3NEMA 1MIUA 4GN3B 4MZ9A 4UP9A 3M7NA 1UWVA 3I56A 4UP8A 4X65Q 1VQFA 1PH5A 1TWGH 2HIVA 3PUVA 3GTJH 5C44G 1K8GA 1G6PA 1NMFA 1X65A 1YITA 1EWIA 1IL2A 4KHPL 1TWAH 1Q81C 1X3GA 1X54A 3KDFB 4OONA 5BR8L 1YJ9A 2HT1A 1PH7A 1E7ZA 1WJJA 5IY0A 4EX5A 4DUYQ 1KRTA 5GQOA 2VNUD 1NJIC 4LNQA 2VY3A 1XMQQ 4GNXC 2ZTEA 3RN5A 1G291 4B3TL 2C35B 1HH2P 4Y52H 3CC4A 4JI6Q 1WOCA 4DKAC 4LFBL 3HOVH 1HR0W 3RLFA 1PH3A 4YWKA 5EAYA 1YI2A 3HOVG 1LUZA 5K36G 3CCVA 1XMOL 2VW9A 1EUJA 3T1HQ 3CCJA 4DR2Q 3NENA 3A5ZB 2QA4A 2WFWA 5M3FG 1PH2A 4IO9A 3I4NH 4DR3Q 1PFSA 3HKZG 3CCLA 4L5TA 3HOUG 1O7IA 1YVCA 4BBSG 2RHQB 1CSPA 1EQRA 4P72A 4BY7H 4JI8Q 2RCNA 2ASBA 2ZTDA 3PF4A 1NY4A 4L5RC 4GKJQ 1HNZL 1AE2A 3GO5A 1S72A 5GAEC 2GVAA 3CMEA 3AFPA 4IOAA 4AQYQ 3BJUA 1QUQB 2WP8J 4GN4B 5HY6A 3ULJA 3EN2A 4DV4L 4BY1H 1N33Q 4OO1I 2Y0SG 1C0AA 3CPWA 3MEFA 1EFWA 2B29A 1A0IA 2NVXH 1PYSB 1NBWA 3STBC 5GAGC 4X62Q 2QEXA 1L1OB 2R92G 5C0XI 3PO2H 2OTLA 1V9PA 4DR4L 1VS0A 1A62A 2K50A 1SROA 1XPRA 1HNXQ 2VL6A 2B3GA 4DV7L 1EOVA 1NTGA 1NE3A 4PZ8A 4JI7L 1XNQL 3PO3G 1OXVA 1SE8A 3IRBA 1Y14B 1YZ6A 2KCMA 3E9IA 3U58A 3M4OH 1Q1BA 4L5QA 3S24A 1SN8A 2AMCB 3UDFA 3CCUA 5LMNQ 1PH8A 1J5EL 5IYDG 3A0JA 2NZHA 1HZ9A 3S15H 4QJFA 2YTYA 3M85A 2CCZA 3BU2A 1PYBA 2ZM6L 4MNOA 3J80i 2JK8A 3TQYA 4YY3L 1VQIA 2PQAA 4JI0Q 4KI0A 3D31A 1OXUA 4BXXG 1B7YB 3BZCA 2N78A 3KJPA 4LF7L 1VQNA 4LFAQ 1I6HH 3CCMA 1WCMG 4AQYL 1Q86C 4DR4Q 1U0LA 3W1GA 2PI2E 4PZ7A 1HZCA 4A93G 1VQ9A 2BH2A 2YTXA 2UU9Q 3RLNA 2UUBL 3PIPA 2JA5G 1C7YA 4A3BH 1S3OA 4JI3L 1QVGA 4A3CH 3K0XA 3VDYA 2R7DA 4R4QA 1UE5A 2JA9A 4DV3Q 3GD7A 3H0GG 4A3DG 1IZ6A 1I94L 5GADC 1BBWA 4BA2I 5IWAQ 4P73A 2ALYB 2OTJA 1X3FA 1YBYA 1D8LA 4C2MH 4A75A 4GKKQ 2YYZA 2Z0SA 3HOWG 1V43A 4XTCS 3PUWA 5IE8A 5IP7G 1IBML 4JI2Q 1UE6A 3CCRA 4JI2L 1TWHH 4JI7Q 1Q46A 4RMFA 1OTCA 5LMNL 2E2HH 4JC0A 3GTMH 1YIJA 4A3GH 3UE0A 2DUDA 1ASZA 1E1OA 2KHIA 3GTQH 4DUZL 4YWLA 2JA7G 4IPHA 3JAMi 4DR7Q 4JBMA 3PUZA 4GOPB 1KXLA 2BH8A 1AE3A 3I7FA 4UY8C 1OXXK 4LUOA 1FJGQ 4DV5L 3CCEA 5M5YH 4IJHA 1W2BA 2A1AA 1RIPA 3KF8B 3K80C 1VQEA 1YJWA 1M90C 5C44H 4LF7Q 4B3SL 2RHSB 4LFCQ 4LFCL 4R4TA 1EIYB 2JA8H 3HOZH 3PO2G 5AJ3Q 1GD7A 2ES2A 4JI4L 1Z9FA 2ID0A 4DV2Q 4DUYL 4HJ8A 3DLLA 1EIFA 3OW2A 2MFIA 1KHIA 2JA6H 2R93H 2MO1A 3PUYA 4IPDA 1L0WA 3W1BA 4GNXB 4IOCA 1IBMQ 3RN2A 3I4NG 2VUMG 3PO3H 3E0EA 3K81C 2PNHA 3ZJYC 1S40A 1XNRQ 4JBKA 1B8AA 2EXDA 1CKOA 1T9HA 3PGZA 2R7ZG 5ELOA 4GOPC 5IYCG 4A3GG 2CQOA 3CCQA 1MJEA 2CKZB 2LXKA 5C0XJ 3ULPA 1N34Q 4OX9L 5IYDH 1I5FA 1N9WA 1XJVA 2B63H 2UXCQ 1AH9A 1GO3E 2NVQH 1HNXL 2K4KA 2IX0A 4LF8L 4HIDA 2JQOA 3K8AA 4GKKL 1KQSA 3OTOQ 1VQ4A 1SFOH 4A76A 1UE1A 4X66L 3OTOL 1XPOA 3GTKH 1YHQA 3UDIA 2K52A 5M3FH 1QZGA 4LF6Q 2IY5B 4A3KH 1HJPA 1VQBA 1H95A 1VQKA 2GVBA 3KF6B 3PUXA 4TVAB 2E5LL 3L7ZC 1Q7YC 3L0OA 5C3EG 1HR0L 3E9HA
chains in the Genus database with same CATH superfamily
3CPFA 1PTOD 2F0TA 2F0OA 2K5NA 1MSGA 1N33L 1STHA 2W6PA 5I6WA 1PZKD 3S1QH 4YCVA 2MQHA 1N36L 1IYUA 3WDNA 3K3PA 3PCOB 2CW8A 1FKAH 5JEAG 4P75A 3M3YH 3C2PA 3S1MB 1AP0A 4K0KL 4BY1G 5AJ3L 1Q1EA 4UCUA 3HOZG 1L1OC 4DR6L 4DR1L 1A3VA 1BCPF 4X64Q 2QF7A 4O3QA 3TEHB 1GUOA 3K5HA 1CUKA 3KF6A 2EY2A 3EIVA 5EBDA 4QCLA 1EY5A 2AQ4A 1XNRL 2C2DA 2I0QA 4B3MH 2NTTA 2ZJRA 1E4EA 3GTKB 1TWAB 3ER0A 5D3DA 2UXDQ 5FPRA 1BDOA 1VQ7A 5KFDA 3VYUA 3MFHA 1EY9A 1SR3A 1Z7TA 2F0LA 2IX1A 2GPWA 4C3HH 4DUZH 1MGSA 1JWUD 2EQSA 1EYGA 3PSIA 3QIAA 5ELDA 4YY3Q 1E22A 2K6AA 2F4VQ 2WYOA 1M4VA 3NK9A 3RMHA 3Q8RB 2WB1G 4NDXA 3RZOH 5CA1F 1S5BD 4R8UB 4ED1A 5FKAC 2UXDH 1V1QA 3F2UA 3G71A 4A3DB 2KQ3A 3S1QB 1A2TA 3UE1A 3NELA 2AUJD 4DR7L 1TIID 2C22A 4JI8H 1T94A 2VB2X 3LWUA 2K33A 1JC7A 5FLXW 2I46A 4O2DA 4NXNQ 1BKBA 5CYUA 4TQUS 4A2BA 3NTHA 4C3IH 5IP9H 4BWSC 4L63B 3NBHB 4R4IA 4HCSA 2M2LA 4A3MG 4DAPA 4DN4M 1Q82C 4ZI7F 3CMAA 4DV6H 2Q2TA 1EIHA 5IWAL 2FB9A 2R7KA 4DV2L 4OWWB 2Z6KA 3TP8A 4UAIA 3M4QA 3Q8PB 2NVYA 4O4HF 4DR3L 1K83B 4BXXH 4OX9H 4JI0L 1E1TA 4WBNF 1KBLA 1HFNA 2WAQE 5FLXc 5KFLA 4ID6A 2W6MA 1S5ED 1SFOB 1BQQT 2LKVA 1K9MC 2CFMA 3NQTA 4FF1A 3PO2B 2CQAA 1DV1A 2W9AA 1TWCH 3PR4A 2YZMA 4A3DH 1NCVA 1M0WA 3NWTA 1A63A 1WCMA 5E7NA 1G8ZD 2XTIA 5LMUQ 1N32Q 4FXKC 4C5AA 3MXUA 5JJIA 1XMOH 4JI7H 4FO2A 2P5ZX 5CB4F 2HHHL 3KLRA 3OIPA 1GSOA 3HOXG 4I65A 3LWBA 4RAYA 2JEGA 1NMGA 3SGIA 2QW7A 4CGYB 4RAZA 1PVOA 4JI2H 4EEYA 4JG2A 2MPMA 2NU6B 2UUCL 3JAMW 5LMNH 3BDOA 4CDDC 1Y69U 3TINA 2VQFL 3RZDH 5JH7F 1I6VC 2VUMA 1DONA 4ECYA 1HUMA 4IZ8A 2K7VA 2FXQA 1FNUA 3HOWB 2CZGA 4JI6H 1CTMA 2KJXA 1L2FA 2ZT9C 2PQAB 3Q24A 2VUMH 2XSCA 4LMYA 4JK1C 1ZXTA 1SYFA 1LABA 3L9AX 4HJ9A 4OX9Q 1ENAA 5KFCA 2ZXOA 3A74A 2D5DA 1HZAA 4JW0A 4LF8Q 5G3LD 1FJGL 4A3LH 4GC7A 4KD3A 2V4RA 4DV1L 5DAUA 1EY6A 1RCVD 3L4KA 2FLNA 1GM5A 3BVGA 3DF7A 1NR4A 4YWMA 4LFAL 5C3EH 4LF4L 5M3MG 2MJ8A 5IGCA 4Y7NB 2N8NA 3JSLA 1A8VA 3SK6A 4XT3B 2ICIA 2A19A 3OWFA 2QDLA 1Y1VB 3GDEA 4DV0L 4NXMQ 2R7ZH 1EFID 2A6HC 3K7AH 1I4HA 1Y1WG 4F4WA 4JYAQ 5M5WH 3A8KE 1SYDA 4YJ3F 3H40A 3I90A 1X3EA 3OW7A 2XRQD 3GIQA 3D4WA 1D5MC 1BGWA 3PQIA 2A8VA 4IAJA 4F4XA 4ZQ3A 4N8FA 5C3WA 5DLQE 1RF2D 2F3WA 1E2VA 2K75A 1F77A 4K6LA 4NKLA 3G6VA 2N55A 3M9BA 4ZUJA 4RHRA 5JVLA 2R6GA 3AEVA 2EOTA 4DV7H 3FDSA 2CH4A 2PI2A 5L9XA 5JJKA 1RJPA 2LSSA 2WE6A 3MWYW 4RNMA 1D7QA 4FDBA 5KFKA 4B9XA 1CZGA 2AQ1B 1DGSA 4GOPA 2RBMA 4EFEA 2KHJA 3T5LA 4M1UB 5KFNA 3D4RA 3FPUB 4A3GB 1IYJB 4LH6A 4B3ML 3A56A 2ZM6H 2MO0A 2ZJTA 4N9TA 1XMOQ 4YAKB 3RJ0A 4IRKA 3KDFA 3G6YA 1E2ZA 3MEHA 4XYOA 4X64L 4EYHB 5DLFA 1N36Q 5KNDA 3RZDB 3HS0C 2CHBD 4A3LG 1TA8A 2OQKA 1HRJA 5JQWA 2XD4A 1VCIA 4FU0A 2BE5C 3DWPA 1DYQA 4C3JH 2UXDL 3I72A 4A3JH 4FF3A 1I7NA 1JOOA 2ZM6Q 2NU9B 4BY7B 3VYTA 1RYRA 3J7AK 4NMZA 2EPBA 2Y0SA 5IP7H 2JP1A 3F8NA 4BY1B 1TY2A 1SYXB 4CKBA 1CKNB 4KD4A 4YHHL 2VA3A 4R8NA 1WYDA 2HIXA 2JXMB 2B2WC 2OT2A 2EY6A 3R2IA 3RR5A 3G4SA 3HFZB 2UUBQ 2C28A 2CW0D 5BN3A 4HIOA 1PZJD 5IGEA 2UXBL 1TWFA 3N43B 2NB0A 1JT8A 5LP6F 4DL2A 2NVYH 1T5EA 4JOIC 4PMWA 2WIIB 4ZLTF 4NB3A 1N34L 1PRTC 5KG2A 4KMUC 2Z4HA 4CJ0B 5C5MA 2F0KA 3BDCA 1K28A 4DR5Q 4A3BG 2VQEQ 4A3JB 2Y0SE 2NN6G 3BZKA 5HV6A 2EY1A 3J7ZC 2WAQA 1L0XB 2F3IA 2G5DA 4B08A 3KK7A 5KIXA 5JEAH 2DWCA 4A4IA 3GV8B 1HTLD 1F9RA 1LTSD 2IWHA 4X65H 1ZQ7A 4J15A 3T1HL 2L9HA 5IT9c 4O3RA 1G91A 3GTOB 4AYBG 1EYZA 1EZ8A 1CFMA 1ZHSA 2R82A 3NEMA 5FD5A 4MZ9A 3M7NA 2C9OA 5EPLA 4RAUC 2HHHH 1VQFA 2UVUA 1BBXC 1K8GA 5C44G 5KFFA 5KFAA 2FPIB 1SJED 2F0JA 1NMFA 1X65A 1EWIA 2RDFA 5KFOA 4OONA 2F4VH 3FMCA 1PH7A 4EX5A 2EE1A 3FPPA 2VQFH 5GQOA 1W93A 4XYMB 1KABA 1XMQQ 4GNXC 2RGVA 3SE7A 1EYDA 1NAPA 4F50A 1LTID 1HQRD 1IW7D 4QIWB 4E6IA 4JV0A 4B3TL 3UQ8A 2DNCA 4Y52H 2A6ED 5J22A 5A35A 5KG0A 4Z9CB 2CW0C 3J81L 1PH3A 1SNCA 1YI2A 5J2UF 4RGTA 3CCVA 3T1HQ 3TZDA 3CCJA 1I6UA 4BBSB 2QA4A 4FM9A 5M3FG 1JCKB 3P20A 1PH2A 3I4NH 1AN7A 4NW2A 3HOUG 1ILQA 1ZYRD 2N88A 2BOSA 1VMCA 1GJXA 2RHQB 1SNPA 2A69D 4GKJQ 4EGVA 4XQQA 4L5RC 1GYFA 3R93A 3M3YB 1S72A 3A8IE 1WTWA 5HY6A 1QUQB 2WP8J 2W8LA 1N33Q 1PRTD 4U673 4OO1I 2J7ZA 2Y0SG 2ZDHA 1C0AA 1OWTA 4DR5H 3RUZA 4LSAA 1XMQH 2V5AA 2ZXPA 1A0IA 1SDFA 2NVXH 4ME5A 1MZBA 3MXGA 4KKUA 2FJZA 2B63A 5KFEA 4X3KA 3P7JA 3PO2H 4DR4L 1V9PA 3NTIA 4O3NA 2F0QA 1CA5A 1XPRA 2BQRA 1YNND 1SYEA 5FLXE 2F0DA 4Y8VB 1Y8NB 3MWMA 5A2QL 4DV7L 4PZ8A 1OXVA 4H7BA 3DHQA 3GTLB 4WORA 1YZ6A 3E9IA 4PDBA 4DNRB 3U58A 3M4OH 3SE0A 3UDFA 2B39A 4NLGA 2GLTA 1ZEQX 3IAYA 3O13A 4ED3A 2ICEC 4DA2A 4O2AF 1PYBA 4QWEA 3GTMB 3ZYYX 3T4AC 3TQYA 2YL2A 1H9MA 2DN8A 4G4KA 4TQRA 1HR0H 2N78A 3KJPA 1D5ZC 3JAME 1I6HH 2SOBA 3VMMA 3D4DA 5DEHA 4DR4Q 1Q86C 4FXGC 4WFN3 3Q0AA 4C3JB 1ML0D 3K6OA 1RD9D 3DM1A 2UU9Q 3RLNA 1V4YA 4TV9F 2CQYA 2B2TC 3NTKA 4UHVA 2IA6A 1C7YA 1S3OA 3OOCA 1SNMA 2C2EA 1ZYRC 1VDZA 3K0XA 4DR6H 5D8DA 3H94A 2A69C 1UE5A 4DV3Q 3H0GG 3K57A 3QG1A 1BBWA 2R8JA 1QJOA 3A8JE 4YR3A 4P73A 2OTJA 3BA8A 1XNRH 1D8LA 5C4XB 4GKKQ 3HOWG 4XTCS 3PUWA 1WVLA 2NZ1D 5T14A 4JI2Q 1UE6A 3EPIA 3RV3A 2ATLA 2PN1A 3LP8A 1K8MA 3GTMH 1GUSA 2L1BA 4RGMA 4K5XA 5ISRA 2XVSA 1AZPA 2KHIA 1IOVA 4DUZL 3P1HA 4ZHQF 4IPHA 4MAMA 3PUZA 3M4IA 2BH8A 2WTFA 2IW3A 4IR1A 4KKTA 4DV5L 3GV7B 4MV4A 4IR9A 2R93A 3I91A 4HMJA 2JA6A 4HAEA 1CQJB 3I12A 1W2BA 4BWGB 3TP6A 2UU9H 2LY7A 3IFDA 1M90C 2X0SA 4QWAA 3QOJA 2RHSB 1IKMA 1EIYB 2Z4IA 3PO2G 3PW4A 4RKLA 2D9UA 1KDBA 2NVXB 3M9MB 2MFIA 5KT5A 1DOLA 1KHIA 5C6AA 3JRWA 3LNNA 1DIKA 4GNXB 3GTJB 1XNRQ 1S40A 5FK9C 4ZKCB 2V58A 3RB3A 1WTPA 2UVRA 4LF9H 2NTSA 3ONAB 1B53A 3KLSA 2CQOA 2LXKA 5C0XJ 4OX9L 2UXCQ 3V4ZA 3G7LA 4LF8L 4HIDA 2O2LD 2JN4A 3M9OB 1VQ4A 4RFBA 3OTOL 4X66L 5KFMA 5M3FH 3R8BA 2Q8RE 2VQDA 1S10A 2RDIA 1HJPA 1VQBA 2EY5A 1H95A 3L0OA 2R7ZB 2X69A 4X62H 1VQHA 3KHGA 3DXJC 3VR3A 4DV4Q 4AQYH 4APVA 1WD0A 2ALZA 1V1OA 2FK2A 3URYA 4UCTA 1TWHB 4I7AA 4DV0Q 4IN3A 1U4LA 1SLJA 1QE6A 2W6NA 4I50F 2UUAH 3D0FA 4A2AA 1FL0A 4Q8FA 3MTSA 4HSPA 2WINB 4K6DA 3PZPA 2I5HA 4DV3L 3VPBA 1IHZA 3W5OA 4ED2A 2K1BA 4DR1Q 1FNWA 4L8JA 4RCNA 3ULLA 5LL6X 3GTGA 1XPUA 4DL5A 2E2IB 3TMEA 1S5DD 4DV4H 4BBRG 4K8IA 1O75A 1SSOA 2FMAA 3OSPA 4DAMA 4U7CA 1QG7A 1X56A 3J81c 4XYLB 4UFZA 4UP7A 1I3QH 4DUZQ 1SCUB 4DK3C 2NZOA 1S68A 2OEOA 3GIDA 2JA7A 5M3FB 4YP3A 4DV1H 2B63G 5IYBH 1EY0A 3BG5A 3VR2A 3I73A 2W6QA 4A3EG 4BA1I 4GLVB 4LFAH 3A5UA 4YR2A 3BYTB 3ERSX 4PQXA 2R86A 4HYKA 2UVWA 5JOBA 5BR8Q 1IKLA 2EYOA 5CBEE 2CH4W 1B70B 1WTHA 4LF9Q 4KHPQ 4JUZA 1VQDA 4GKJH 3TQTA 2F0GA 2PZUA 1LTRD 2D62A 2JA8B 4ME6A 1B9NA 2K03A 1PFMA 1D2BA 1DOKA 4HJ7A 5IODA 3CAMA 3I8ZA 1Z47A 1HCZA 4ED0A 1B3QA 2M9VA 1PFNA 1LM0A 5EWGA 2A68C 2ZXRA 1EHIA 4JCVE 5FJ8H 3SHLA 3MR5A 5C0XG 3HOXH 4DV1Q 1RYSA 3PF5A 4DXFA 1W96A 2X6LA 4YJ2F 3M4PA 1AFPA 4J9LA 1HNZQ 3U50C 1I6HB 1JDBB 4N9PA 1DM0B 4A3IG 3IG0A 1BO0A 2AKWB 4CDFC 2KSWA 1HA5A 3NHHA 1Z6HA 3HKZB 2F0VA 2UUBH 5JVG3 3I4MH 3RTXA 4A3BB 2NUAB 1STYA 2K5HA 4X64H 1GVPA 4MV6A 3A7LA 4DNTB 2UUCQ 1O7YA 1KAWA 4L6TB 2DY8A 3KHHA 4O42A 2W57A 4C1NK 3OUUA 4MA5A 1X55A 4QWBA 4KY7A 1VQGA 3GTOH 3GTGB 1JXLA 1KD1C 1CT1D 5CBAE 1UNNC 1STNA 2F0MA 5KG3A 4LFBH 1R4PB 1H9RA 1PMRA 1J8IA 4TRDA 1A15A 4OELB 4EGQA 2AQ2B 1SYBA 4ME3A 2AGQA 1TWHA 2IHEA 4IWXA 2JE6I 3T53B 2KOLA 5FD6A 4J9OA 4MV1A 2QGQA 4EQNA 4F87A 3QWNA 1G6ZA 3VPCA 4J9QA 1PLFA 2EYLA 4XIGS 1AN8A 2L0CA 3N42B 2L55A 1PHJA 1BCPB 4M9UA 4J6HA 4JI4H 1BNZA 4YCWA 1O7LA 4WJ4A 1KRSA 1C9OA 2J6TA 1QNUA 3I4NB 4PZ6A 4A3GG 1VF7A 1TVXA 4EBCA 1YHAA 3F8TA 4X66H 1FNVA 1E24A 1F9QA 4DAYB 4DR6Q 1Y1WA 3Q8DA 1Y1WH 3MFGA 3GTJA 4PNYA 4L5SA 3J7AV 3FHWA 4RHSA 2GA4B 3LMLA 1JICA 1C8CA 4LF6H 1CHQD 2QCPX 1RODA 4X66Q 5J3BA 5IGBA 3ND8A 3OTOH 4DR4H 4A3CG 1B9MA 4HR7A 5LYJF 1LTGD 1O80A 3W3AA 5D14A 3GLKA 3I4MG 3JSNA 1PZID 3SK4A 1HR0Q 2UUAL 1LACA 3T16A 3K5MA 2UXCL 5IT9W 1RKNA 3T5KA 3PIOA 3RV4A 1SMXA 4R7RA 4JI5L 2JA6B 2KENA 2R93B 3H4BA 5F9LA 4AH6A 3A54A 1JMCA 2KCCA 5HGTA 3NBIA 4EQ5A 1K0SA 2YU9H 2UXBQ 4ZRZA 4MV7A 2Z8LA 4DGZA 2MNAA 1S97A 2IT1A 3OMCA 1ESFA 1IBLL 3S2HH 4JVZA 1KDAA 3Q22A 1U4RA 3ERQA 3BYYB 5KG1A 4RB2C 4ABNA 3GTPH 5LOVF 3CF5A 3X3NA 2M05A 5H1SE 1VMPA 2RSOA 3K7UC 4QY7A 2KBNA 4WJWA 4CHTB 1EUCB 1KJIA 4IUTA 1TU2B 4Q5VA 2B8GA 2XC9A 2K5WA 2HGSA 3SEBA 5JPNC 1B6SA 5LHY1 4QMGA 5GAHC 3J81i 4CJ2C 3S1NH 4HNTA 3CKIB 1FR3A 3J7A5 4JI5Q 4JI3H 5ELFA 3ORQA 5EGTA 4A93B 3PO3B 2ENBA 2LMCB 2SNMA 2XNAC 3H3VI 3FP9A 2HJWA 1UNSA 4C5BA 5BPFA 3J81W 4HIKA 2CWPA 4KLKA 1CA6A 1MJCA 1K83H 1HNWL 2O5JC 2JJQA 2SNSA 3E5NA 5G3LF 1JE4A 2CWAA 3J81E 2BDOA 4TV8F 3GTMA 2E2HA 4YCUA 1C4QA 5EDWA 3RBEA 4HCEA 5DG8A 5IP9G 2R87A 3RIZA 2IMWP 2JYOA 1QCBD 5KNBA 2E2HB 3QOLA 1TQOA 4QB4A 1I7LA 4DUYH 4K5WA 4HJAA 5EZYF 1JQYD 1H9JA 2FMMA 4KKSA 4JV5Q 3OSNA 3TS0A 2L15A 1SE2A 5KRUA 2B8FA 1PTOH 2BA1A 4IFDG 1X3PA 1N33H 1WFQA 2LS01 3K0YA 1BCPD 4ZOLF 3V6KA 3N6RA 5T1IA 2B63B 3ETHA 4JI8L 4A3FB 1SEIA 2KUMA 2R85A 1FD7D 2W7PA 4FF2A 4IFDI 3I55A 5L1IA 3SI8A 4XYQA 1MBYA 1DJRD 4J1MA 2ZTCA 2K28A 5COYA 2DGYA 2KEDA 4GN3B 2J6SA 1HQMC 4DK1A 4IALA 1UWVA 5IGFA 3I56A 4UP8A 1PH5A 5EOYA 1Z2OX 1RTOA 4RUAA 2B2VA 3VR5A 2QILA 3VA7A 4FBTA 1X3GA 1X54A 3T51B 2HT1A 1QNKA 1NUCA 3J7AF 3JZIA 2AU0A 5IY0A 4DUYQ 4PWQA 5KFUA 1GSHA 1F2YA 5KFQA 2QYZA 3N41B 4KK7A 4J9RA 3U9TA 5DM63 2EYJA 1HR0W 4EQOA 5EAYA 3MR6A 4YBZB 1QB5D 4QIWA 2VW9A 1EUJA 2B2VC 1M6VA 1MD2D 4RWSC 4FNFA 4CKCA 3A5ZB 1ICFB 3H6MA 4MTDA 4NXNH 4HR7B 1CE8A 4XQJA 3CU7A 1HFGA 2EVBA 4L5TA 1O7IA 4BBSG 1GGOA 1CSPA 4P72A 5A2QE 2YW2A 2ASBA 4R9WA 2BE5D 2ZTDA 1NY4A 3GO5A 3GILA 2W8KA 5GAEC 3AFPA 2HCCA 1WD1A 5CV8A 4PMCA 4DV4L 5BMVF 4DAYA 1Y1WB 4Q45A 3X3MA 4MHEA 2A73B 4UCSA 3GTOA 4LFCH 3HOUB 2W6OA 1SJHD 1NBWA 3STBC 1TKWB 3IFTA 4HNUA 2R92G 5C0XI 2OTLA 3M9NB 2YRWA 1SAPA 2K50A 4K14A 4G7ZC 1STEA 4HEDA 5CGKA 1HNXQ 2UXCH 4CDCC 2X6GA 1O78A 1C48A 2V9WA 3Q1KA 2RA4A 1SE8A 4OHJA 3VYSA 2J0TD 1YNJD 2RDGA 5D3IB 3ETJA 1BXTA 5LMNQ 1SN8A 2AMCB 3CCUA 2F0UA 1J5EL 2ASLA 3CHBD 2R7NA 4DL3A 2ASDA 3K5IA 4GKKH 5KFZA 2EJMA 1IBLH 4X3TA 1GUNA 1F2LA 2IX3A 1ET9A 5BN5A 4C3IB 4UCVA 3J80i 3D8GA 4JI0Q 1K1QA 1VQIA 5ELBA 4BXXG 3HOYB 1EOTA 1OXUA 5LMUH 3V96A 1B7YB 3W2DA 5CV7A 3V4SA 5F9NA 1VQNA 4LFAQ 4FP5D 1X32A 3DEPA 4AQYL 1U0LA 4OIJA 1KNAA 4PZ7A 4EBEA 5IIFA 4A93G 3HEJA 1VQ9A 1N36H 2YTXA 2L11A 1WTXA 3PIPA 2JA5G 5T1GA 3HKZA 4JI3L 1QVGA 4A3CH 5IT9E 3H09A 2JA9A 3SDZA 2VUGA 5GADC 1B4OA 3MZ5A 4BA2I 1C3OA 3IN5A 1I4GA 2ALYB 4CC6A 1X3FA 5L1LA 1I4QA 1E4GT 2YYZA 3RGXA 2GPSA 1HA6A 1IBML 5J2TF 4JV2A 4JI7Q 1TWHH 1OTCA 2PBZA 1ZETA 2A6EC 3K5OA 4JC0A 5I6YA 4A3GH 4F4ZA 4DV0H 4DR2H 3GTQH 4YWLA 4OEMB 4ED8A 4A3EB 3JAMi 4YR0A 1JB3A 2PPBC 4JBMA 4DR7Q 1W6KA 4GOPB 1KXLA 2NU7B 1HNZH 4LF5H 2F0HA 3RZOB 3R23A 2KVMA 1FJGQ 3S9WA 5D65A 1TS3A 4WRDA 3DMUA 3GV3A 2A1AA 3K80C 1YJWA 4DR7H 1PRTB 5L1JA 4DK0A 4R4TA 4U68A 1JKJB 4QW8A 5AJ3Q 1EEFD 1GD7A 4KV6A 4DV2Q 5DQHA 3DLLA 1EIFA 3EQLC 4K2LA 3I4NG 3NSWA 4K2KA 3W1BA 1IBMQ 1JDEA 2EJFC 2QKIC 4IZOA 4HN7A 4OO1H 1B8AA 1T9HA 2B2YA 4IRCA 2YRXA 2R7ZG 2HUGA 4YHHH 2BQUA 4IUPA 4GOPC 2W6ZA 2J6UA 1U4PA 5IYDH 2JA7B 1N34Q 1D5XC 1U9RA 1AH9A 2QEJC 1GO3E 4KHPH 2IX0A 3T1HH 3BDLA 2JQOA 3GP7A 2YZGA 3BQ1A 3GIMA 1KQSA 1SFOH 4A76A 3EJIA 5FO9B 1S9FA 3UDIA 2K52A 4C3HB 1QZGA 2R7LA 1A2UA 4QF4A 1S5FD 1VQKA 2GVBA 4TVAB 2E5LL 1ONLA 2E2IA 3L7ZC 3VA5A 5C3EG 1EZ1A 3E9HA 5M5YB 3DM3A 2VQFQ 2WKDA 1RK5A 3RF2A 3L4JA 2F4VL 5K36H 3V6HA 2WDTA 4X3UA 3MR2A 3H3VH 4YAJB 4NXNL 5E4XA 1PH9A 3FDTA 4JI4Q 1I94Q 4GLXA 1J5EQ 4LUZA 1DXMA 3HOWH 3UFXB 4OIKA 4EG0A 4RG1A 3PW0A 3IL8A 1YJNA 3JRXA 5JJLA 1XDNA 5I47A 2R7ZA 3C3LA 3U4VA 1S0OA 4XZ3B 2VQEL 1K3BC 2FK3A 2OCEA 1K8OA 4Q44A 5KEEA 1CQIB 3G48A 2AWNA 4XXEA 2QK4A 3K59A 1VQJA 1W3SA 1LT6D 4JV5H 1K8AC 1JJGA 2UVVA 3KLWA 5K5PA 2EXZA 3A55A 3I2ZA 4QL5A 2BDNA 3GTGH 4GN5A 4TSSA 4FS2A 2RKSA 1IYVA 4GNXA 1M8AA 1E3PA 4LWCA 3LWEA 3JAML 4ZCKA 1NNXA 3CC7A 4YHHQ 4I7HA 2NVXA 1KL9A 3H20A 4B3SH 3JC66 2EYMA 5KFGA 4IUNA 1QZHA 4L1KA 4JI1L 3KFUA 3ITPA 3DWQA 2NVYB 2VXWA 3HRZC 4DK6C 1UC9A 3HB9A 3WO0A 4H44C 4O3OA 2C5CA 3J7YW 5KFRA 2BCOA 1S0MA 1ENCA 2EIFA 3PR5B 3KALA 3D3RA 3NBHA 1SE3A 3LX0A 4DPGA 4WD3A 1LV9A 2HQEA 4A3MH 3HP3A 2I87A 2B2UC 2PQEA 5EBCA 4A3IH 1TAEA 5BR8H 4RNNA 2WB1E 4O1NA 1Q12A 3TN2A 1TWFH 4DR5L 1DOMA 2IL8A 2YZNA 1WI5A 3MA2B 3G6EA 5GONF 5KKNB 4ECWA 4PMBA 1WCMH 1ASYA 3BA9A 2I5LX 5EPKA 4B3MQ 1JWMD 2IP4A 3K58A 2C2RA 4MTNA 4LF4Q 5C4XH 1KDCA 5CV6A 5I9PA 1DZ1A 1BUVT 1M7JA 4DV5Q 2LFNA 4QWDA 2F52A 3KHRA 4JI1Q 5C3EB 2BR0A 1XNQH 2FINB 2R61A 2FKLA 4MN3A 3Q2OA 1VQ6A 3T5JA 3C1FA 4LW1A 3C0FB 4NPSA 3HKZE 4NXML 1TWAA 5HBRB 1E4EB 1VBHA 3G8CA 5M5XH 3BVZA 4A3FH 4EYIB 2Q8TA 3KOJA 3LGJA 1S5CD 4DV7Q 1CZWA 4CKEA 1F9PA 4JI3Q 2OWOA 3Q8QB 5JAVA 5CAEB 4OGQC 1XWEA 2ZJPA 2I8CA 5EKIA 2E5LQ 2IJ0A 1II3A 2Q2UA 3N44B 5AFWA 1GSAA 3CVZA 2MUYA 1EIGA 3BABA 4B9WA 2ASJA 5KT7A 3HKSA 3ORRA 1I4XA 4ED6A 3TREA 3GTLA 4RB3C 1GKHA 2VB3X 2K5DA 4J0MA 4RGNA 1B2TA 5C4JH 3RD4A 5KNCA 2DJGC 3R3OA 5IYCH 5KFYA 4O2BF 3PN1A 1IXRA 2F0WA 2UXBH 2Q2HA 1U4MA 2FJ2A 2PVPA 2OH2A 3FKIG 3AFQA 2Z1CA 4P74A 1M0TA 2A5HA 2DJFC 3J80c 2CW7A 2FHTA 1XTDA 1QUQA 4CBVA 5C0XH 3T56B 3F2DA 1JB7A 4ECUA 3DWAA 1NSNS 1BR9A 1W6JA 1R9TB 2L4NA 2FP4B 3F2BA 2PZWA 3HZXA 1B33N 4KHZA 2DIKA 2BA0A 4I4TF 5C44B 2E8GA 3OYYA 3RFCA 4WJ3M 2R3ZA 3MWDA 3FRPB 3D6WA 3SXHA 1TT2A 2E2IH 4F8MA 3T1YL 3MJFA 2KA7A 3S1RB 3CCSA 3GTLH 1EWHA 1LTAD 2G9HD 4CDEC 1RJRA 5KFBA 1RJTA 1EU3A 1KIXA 4I7ZC 3T5HA 5C3XA 5JVH3 2PZTA 5CV5A 2SEBD 3NQIA 4R4OA 3CRLC 1XX8A 3FEWX 1UC8A 3V2TA 4AYBB 5KYIA 3VYRA 1VQ5A 2R84A 2YV5A 3S1MH 4GZYC 4A3EH 4LF8H 1EQTA 1TR5A 1Z2NX 4DV3H 1N32L 5M5WB 3GIPA 1KC8C 2EYPA 2DPIA 4IFDJ 3H4DA 1CQVA 3DUZA 4XT1B 5DG7A 1VQOA 3H0GB 4C3JG 4X62L 1U5KA 2PCFB 1T3NA 1TWCA 3FMAA 2W70A 2JA8G 2GN5A 4KY6A 5GROA 5LMNW 2NUCA 2PYKA 3T1YQ 2MGSA 4P2CB 1A9XA 2N3SA 5CC4A 2B2WA 2WAQB 1IBKH 1BF4A 1SYCA 2YS6A 3GIKA 1HPCA 5DNFA 1STGA 1LT3D 1QVFA 4OO1G 2NWGA 4KTAA 2Z6BA 3OIQA 1IL8A 5ELNA 3AYHB 2R8HA 1H9KA 4A3MB 2AUKA 4QUFA 2W9CB 4LF4H 2KECA 4RUCA 2K14A 5F2DA 2AHOB 3WOFA 1HNXH 1GUGA 4Y7NH 1T5XD 1TWFB 5EKKA 1TS5A 1LTLA 3UI2A 4MV3A 2JEJA 1VF5C 4OXPA 2E2JH 5CV9A 4POGA 4GLAC 2TSSA 1KJJA 4HMIA 2XIGA 4HJ5A 4RU9A 3V6JA 2F0PA 1CKNA 2CVRA 4C1NI 4LF5Q 3KHLA 3L2PA 3V05A 2Y0SB 4DL4A 1L1OA 4ECSA 4GKJL 2Z6KC 3RNUA 1KAAA 2E74C 1YNNC 5IYBG 1SNOA 1VQCA 1JX4A 4J9MA 2RVLA 5LMUL 5J39A 1P8LA 4POFA 1B1ZA 2WKCA 4ED7A 3PUVA 3TSSA 1EY7A 4LJZC 4KHPL 1TWAH 1Q81C 3KDFB 1TY0A 4S3SA 4RH6A 3TIIA 1WJJA 3K5LA 1LT5D 1SNDA 1DCZA 1NJIC 4LNQA 5A2QW 1B3AA 3TP5A 1Z2PX 2E5LH 4B3RH 3RN5A 5M3MB 2C35B 1HH2P 1SEBD 4PV1C 1HHVA 2E75C 4JI6Q 4LFBL 4DKAC 3HOVH 3BZDB 5C1PA 5DG9A 1KJ8A 1OO9B 4YWKA 4YB8B 2AGOA 1XMOL 4QW9A 2P0AA 3OUZA 4IO9A 4DR3Q 1PFSA 3HKZG 1JR0D 2WACA 4QWCA 1GUTA 5BPHA 3CCLA 4CJ1B 1F2ZA 1EQRA 4BY7H 2RCNA 5KT2A 5CORA 3RAQA 1HNZL 1AE2A 3N40P 2I07B 2B2TA 4O4LF 5KG7A 2GVAA 3CMEA 4IOAA 4DV5H 2FMCA 1Y8PB 4BY1H 3ULJA 4GN4B 1BJTA 1JOQA 1ULZA 4HNVA 4DV2H 4JV1A 3PIP3 5FPOA 5KFXA 5JPMC 1SMYC 1Y1VA 3H91A 2B29A 3QB3A 1KNEA 1PYSB 4X62Q 3MHBA 4LSXA 2O03A 1A62A 1SROA 3HOVB 2JEIA 2XGQA 4ODGA 2XWJB 2RDHA 2B3GA 1N34H 1EOVA 3PO3G 1NE3A 5I4DA 4JI7L 2VOBA 2HDMA 1A3TA 4RZRA 2KCMA 5EKLA 1T36A 3S2HB 1ILPA 4L5QA 5IWAH 4KN7C 2XCAA 1KTKA 5IYDG 2G9DA 3GTQA 2FPGB 5EWEA 2AQ3B 4DXGA 4QJFA 2YTYA 3M85A 5J1ZA 2CCZA 3BU2A 4MNOA 4V0BA 4JI5H 4YY3L 2PQAA 5LL6S 3D31A 2QDBA 3BZCA 5L1KA 5JUMA 4U6PA 3EA6A 1X3QA 3MVVA 2PO4A 2VUMB 3CCMA 2J4XA 2E2DC 1HZCA 1GXDC 2BH2A 1VKZA 4BBRB 3J80L 4A3BH 1DV2A 1L2ZA 3VDYA 2UUCH 2R7DA 4R4QA 3GD7A 4A3DG 5IT9L 1IZ6A 1I94L 4B3TH 5LL6b 4YQWA 1WCMB 5EPJA 5IWAQ 2FFKB 3KBGA 2DLNA 3HG9A 4C2MH 3SR1A 4A75A 1SFOA 5IE8A 5IP7G 5KG4A 3CCRA 5FO8B 5KYLA 4DLKA 2E2HH 1YIJA 1CQFA 1K83A 3QO2A 1ASZA 2JA7G 4N8X1 5HURA 3S16B 4FYDA 2F1MA 4ECRA 1AE3A 4UY8C 1OXXK 4ECVA 1HNWH 3J80E 3CCEA 1XTCD 1WSCA 1QOHA 4IJHA 4IWYA 1RIPA 3KF8B 5E1FA 1D1IA 3QZ7A 5C44H 2RQXA 2EYHA 4LF7Q 3OPOA 1SE4A 4LFCQ 4IHJF 4O3SA 2JA8H 3S1NB 4HSVA 1G2TA 3G6JB 2O5IC 1Q8IA 4DUYL 4IRDA 1V1PA 4KN4C 1LTBD 4XX0B 1L0WA 1ET6A 3PO3H 4IOCA 4R8UA 3RN2A 5KFVA 2VUMG 2HCIA 2PNHA 3KBXA 5CV4A 5DLGA 5ELOA 1HXYD 4IUVA 2CKZB 4R8IA 2HD3A 3G6XA 4GC6A 1N9WA 3MFYA 1LLRD 2PMZA 1EQVA 2K4KA 1PRTF 2W7OA 4V190 3GTKA 3MWEA 1UEAB 4ECTA 4DF7A 2JA5A 2IY5B 2R8GA 2XCPA 5IOCA 3KF6B 3EYYA 1Q7YC 4G57A 1XXGA 1HR0L 3PW5A 4G7HC 3IKJA 2V4DA 2YU9B 3S17H 1LT4D 3GQBA 1LO5D 5JVDF 3CW2C 1CI3M 1NR2A 5KG5A 4NXMH 1BXRA 4ECZA 4R1JA 3R5XA 3FKIH 1JE5A 3NPPA 2IHFA 2ZDGA 3PMFA 5I2YA 3NE5B 4H0LC 5KFPA 5M3MH 4JYAL 2W71A 4ZK9B 3OMGA 3GV6A 3NWSA 1EQQA 1JLLB 3JAMc 3WOEA 2XGTA 3VR6A 3U4ZA 3HOYG 5I2XA 4BBSH 3S1RH 3SVMA 1I4RA 5IGGA 5IGDA 2NU8B 2VPQA 1GOZA 3T13A 1D1KA 4QGUA 4J9NA 1I50A 4RA8A 2XWBB 5EWFA 3AMUA 3RGZA 2F0FA 4KJNA 4A93H 4JBJA 1H9SB 3TBIB 4R4CA 3GQCA 3GV5B 2IBKA 5HGQA 4J9KA 3KJOA 2JA6G 2R93G 1K0RA 2D0PA 3KAJA 1O7ZA 2A6HD 5D1OA 4HIMA 1A3UA 4KJOA 1Q90A 5KFSA 3H0GH 1B50A 3I4MB 2FK1A 4ECXA 3MFIA 4K5VA 4GS3A 1ICWA 4DV6Q 1CKMA 1IBKL 2NVTH 1YEZA 4C3HG 3FKIB 4RGOS 2YTVA 3WWVA 1VQLA 3KUPA 1JIHA 4YIJA 3RB0A 1YNJC 4BY7G 4B3TQ 4QQBX 1I4PA 1QILA 2F4IA 1VQPA 1CHPD 1EYCA 2I80A 3CQZA 5C4JB 1PV4A 2UUAQ 5EJWA 4QUCA 1KC7A 5I9OA 4IPCA 1RDPD 1KEEA 1OXTA 4LF7H 1YNXA 3MXPA 3RB4A 1PH6A 2HQLA 3SK8A 2VS1A 3FKIA 1HTPA 2OF1A 4P71A 1N48A 2K5QA 4YY3H 5JEAJ 4ZUIA 4X65L 1AW7A 4Q0YA 4OWTB 1WTRA 5D1OB 2KCNA 5KFWA 2N49A 2SCUB 3DEOA 1HUNA 2A74C 3BAAA 2MP1A 2ZJQA 4DL6A 1CS0A 2LXJA 2HHHQ 3I4OA 2K01A 2Q2IA 4LK1C 3TDQA 1R9TH 4RB0A 2R8IA 1BVSA 4C2MB 1PH1A 5DGBA 1YHBA 1EUDB 4APMA 5DGAA 1I50B 3MAQA 5JJZA 4K0KQ 4LUVA 3S14B 4M7EA 1TWGA 1X9NA 1GHKA 3WNZA 4C5CA 1I94H 1EEID 1TXYA 3I3CA 5KX5F 4G7OC 1G51A 2XN9C 3TQ1A 4EGJA 4OWXB 3STBD 3HOYH 2V59A 3E6ZX 1PH4A 3TZUA 1JJ2A 4CC5A 4E4TA 2K32A 1EL0A 2R7MA 3R2TA 3S2DH 1QVCA 3R5FA 1UEBA 5KT6A 4DR2L 3TRZA 2WAQG 3F1ZA 2JEFA 4RCOA 2HVQA 2OLSA 1HNWQ 3S16H 4DAVA 4MIUA 4AIMA 3OHBA 2YU9A 2HDLA 1E4FT 1Y1VG 3MXNB 5C8YF 1KJQA 4FBUA 2DNEA 5H80A 5FLMG 4FS1A 3TIGA 4ILWA 1VQAA 1CSQA 4DNIA 1IBLQ 1I50H 2KCTA 3CD6A 2JA5B 1SRUA 1J5EH 3S14H 2EZVA 3RLOA 4X6AH 4EBDA 1STAA 5C4XG 2A68D 3HOUH 3A7AB 5D1PA 2VZAA 4IUUA 4UPAA 2PMZB 1XMQL 4O3PA 4LMQD 4MA0A 2F0SA 1P16A 1MKHA 1AEXA 5E3FA 4ALPA 1XNQQ 1TS2A 1RK6A 2BQ3A 4O0AA 3EVQA 4Q8EA 1RTNA 3FVQA 2VA2A 3L3OC 1EWCA 3K3VA 1WTQA 1AUVA 2R92H 3M7GA 4EVOA 1RL2A 4JBWA 4A3JG 4FXDA 4UDUC 4B3RQ 4F4YA 4KHVA 4JOIA 1V1PB 4MTKA 5CA0F 3BQ2A 3KXYT 3CRKC 4BBRH 2K05A 4F88A 3AQQA 4HTHA 3H15A 4JI0H 1PDQA 2E2JB 4H13C 2SDFA 3S15B 3HOXB 3EPGA 4NP5A 5KFTA 2XIWA 3CXCA 2DZDA 3KF8A 5M5XB 3NUCA 4O4IF 5C4HA 1PTOC 1UE7A 5DM73 1EU4A 2OQ0A 2K5VA 4IURA 3KTMA 3BQ0A 4DR1H 1J9OA 4ECQA 1SXTA 1RJQA 2O4XA 2I5MX 1IBMH 1BOSA 4IJLA 3RUPA 2RF4A 3M4OB 2JSOA 2JA7H 2R7FA 4PG3A 2V1CC 1M1KC 1HZBA 2NVQB 2PW7A 3EROA 5BN4A 3E0JA 3J81j 4B3RL 3PW7A 4ZYSA 5FJ8G 1ZKOA 3P75A 4LF5L 2R92B 3PVXA 5FLXL 3PW2A 4J9SA 5TSSA 3PV0A 2YYAA 1BBUA 1K1SA 5FLMH 1VQMA 4A3KB 1A6XA 2E76C 1PTOB 4JI6L 1KLGD 3E3XA 4LFBQ 4UCRA 1LTTD 2WB1B 4JV5L 2D0OA 1WH2A 1FVIA 3Q23A 1AUXA 1I3QB 3KLSX 1Q8KA 3TS2A 2W9BB 3UDXA 5FO7B 2RGRA 1OXSC 3Q6SA 1Y1VH 2RCFA 5LA6F 1J6QA 1L0YB 3N8DA 3MR3A 3M4YA 5K2MA 4AYBE 4FF4A 4EQPA 1B44D 3F2CA 2ATWA 4B3SQ 1MSHA 1UAPA 4LF9L 1UUPA 2B2YC 2PW5A 3VR4A 1VAJA 2FPPB 4ZKBB 1VBGA 4DV6L 2VQEH 1PXUA 4TKOB 1IBKQ 1PK8A 2UU9L 3KYHC 3GTPB 3OHXC 4H02A 3CP0A 3J80W 2R8KA 1K73C 1X6OA 2JA5H 2AWOA 4JI1H 4ULLA 3I4LA 3HOZB 3GTQB 2L12A 3EBEA 1KJ9A 1ZHQA 1JJCB 2H4OA 3U9OA 3GTPA 4A3KG 1FGBD 2XRSD 5KFIA 3CC2A 2J9GA 2F0IA 1PA6A 3ICEA 4K8JA 2B2UA 3CQZH 4Q0FA 1N8RC 3UDGA 2YS7A 5CMDA 1K3RA 2PMZE 3AU7A 2NYZD 2F0NA 2JEBI 3BJYA 4MV8A 1FGUA 1PFBA 4OL7A 4C56C 5KG6A 1LYLA 4RNOA 3I70A 4IPGA 1BCPC 4LF6L 2KEEA 2W9BA 4TQSA 1I3QA 1VQ8A 2NN6I 2JEAI 3BG3A 1B04A 4QIWE 1F9SA 2WB1A 1JOKA 4UCOA 1WR2A 4A3FG 2H5XA 5FOBB 1E0BA 1ENFA 2VR1A 4UP9A 1MIUA 4Q43A 1EYAA 4G3IA 4X65Q 1TWGH 2HIVA 2K04A 3GTJH 1G6PA 1GHJA 5KT4A 2R92A 1YITA 1IL2A 1SBBB 5BR8L 1YJ9A 4A3IB 3MC0B 1E7ZA 3OSOA 1F2MA 5C1OA 1KRTA 2VNUD 2VY3A 1DD2A 2ZTEA 4TUYF 1FJGH 2D2CC 1G291 3EFXD 3CC4A 5L37A 1WOCA 3RLFA 2MHVA 4JPBW 1EZ6A 3HOVG 1LUZA 5K36G 1WTOA 4DR2Q 4LAAA 3QZ8A 5E4WC 3NENA 2WFWA 1N56A 3NXWA 2PNRC 4ZAIA 3S17B 3K7AB 4K0KH 1YVCA 4M8AA 1S4ZA 2ZDQA 3N6XA 3QR8A 4JI8Q 4MTEA 3PF4A 5C4ZA 1MI2A 1EY4A 1JORA 1GLVA 4AQYQ 1MHWC 3BJUA 3D6CA 4IUQA 3EN2A 1G2SA 2Z9HA 3CPWA 4J9PA 2F03A 1KLUD 3BVMA 3MEFA 4DU9A 1EFWA 2XGPA 2AGPA 3GIIA 3NGDA 2QEXA 5GAGC 3HXLA 5EQ0A 2NN6H 1L1OB 1WTVA 1VS0A 1ESRA 2OXPA 3QFFA 1C30A 2WV6D 2V4QA 1IOWA 4RB1A 2VL6A 4DL7A 1NTGA 2IPKD 1XNQL 5ELCA 1Y8OB 3IRBA 5M9OA 2DPJA 1Y14B 3MXNA 4X3SA 4F7XA 1Q1BA 1E2WA 3S24A 2M00A 1PH8A 2YCHA 3SK5A 5KGUA 3A0JA 3C46A 2NZHA 1HZ9A 3S15H 4DR3H 3TP7A 3NP8A 1Q3LA 1EY8A 2H1EA 2ZM6L 2NVTB 4LH7A 2W9CA 3T1YH 1CK1A 2JK8A 4KI0A 1PX2A 1SYGA 4LF7L 5KFHA 1V51A 1D6EC 1SMYD 2HVRA 3C1EA 1WCMG 4RZQA 3W1GA 2PI2E 1TWGB 2F3VA 1JWSD 5CR3A 4XQNA 3VPDA 2UUBL 2RDJA 2HVSA 3K5NA 2FLLA 4IFDH 2RSNA 4KY5A 2FLPA 4DFAA 4C2MA 2FE3A 4JYAH 1TWCB 4HQ6A 3H0GA 1STBA 3RBDA 5NUCA 2XCLA 2MCTA 2DY7A 4EFBA 5DQIA 5LXTF 3OHAA 1YBYA 2Z0SA 1V43A 4JI2L 3E5SA 1IW7C 1Q46A 4RMFA 4XDXA 1AZQA 5LMNL 4ETSA 3H3VC 1V8QA 3UE0A 2DUDA 4AYBA 1E1OA 3U9SA 1BNCA 3RB6A 2NBFA 2EYFA 2KHSA 3PIO3 3CQZB 3I7FA 4LUOA 3OWEB 2VPSA 5M5YH 3QJYA 3BS1A 1B6RA 1VQEA 3HBLA 4B3SL 1PTOF 3R5HA 1PYWD 2R6FA 4MV9A 2EDGA 4LFCL 3HOZH 1FYCA 4JI4L 4RKBA 2ES2A 3S2DB 2C00A 1Z9FA 1S0NA 2ID0A 4I55F 4HJ8A 5IYZF 3OW2A 1SNQA 5C5JA 3ND9A 1R9TA 2JA6H 2R93H 3N52A 5KFJA 3GIJA 2MO1A 3PUYA 4IPDA 5C5LA 3Q8SB 1TS4A 3E0EA 3K81C 3ZJYC 4JBKA 2EXDA 1CKOA 2L5TA 3PGZA 1XYIA 5IYCG 1H9SA 5DQGA 3CCQA 3WO1A 1MJEA 3ULPA 1RHPA 1I5FA 1QWYA 1XJVA 2B63H 4EEQA 2NVQH 1HNXL 4J8QA 3K8AA 4FVMA 4GKKL 1N32H 3OTOQ 3KAKA 1UE1A 4BS9A 1XPOA 3GTKH 2Q8IB 4ZQIA 5ELEA 1S03G 1YHQA 2TMPA 4LF6Q 2EJGC 1CM9A 4A3KH 3PUXA 4C3IG 1GUWA 3RAXA 5KT3A 4IQZA 2F0EA 3HGBA 3AB9A 3B6YA 1R4QB
chains in the Genus database with same CATH topology
3DM3A 2VQFQ 3CPFA 1VQHA 2K5NA 2F4VL 4DV4Q 1N33L 3S17H 3S1QH 4APVA 4YCVA 3CW2C 2MQHA 3H3VH 4DV0Q 1N36L 1SLJA 3PCOB 4R1JA 4NXNL 3FKIH 5JEAG 1JE5A 3D0FA 2IHFA 1FL0A 4P75A 1PH9A 3M3YH 4K0KL 4BY1G 5AJ3L 4JI4Q 1I94Q 1Q1EA 4GLXA 5M3MH 2I5HA 4LUZA 4DV3L 1L1OC 3W5OA 1J5EQ 3HOZG 4DR6L 4DR1L 3HOWH 4JYAL 4X64Q 4DR1Q 4RG1A 1YJNA 3ULLA 5JJLA 1EQQA 3TEHB 1XPUA 3U4VA 1CUKA 3KF6A 3EIVA 3JAMc 2XGTA 3HOYG 3U4ZA 2VQEL 4BBSH 2OCEA 3S1RH 4BBRG 1XNRL 2I0QA 3G48A 2ZJRA 2AWNA 4DAMA 4QGUA 3ER0A 1VQJA 1W3SA 1X56A 3J81c 2UXDQ 4UP7A 1I3QH 4DUZQ 1K8AC 4DK3C 1VQ7A 3KLWA 2NZOA 1JJGA 1SR3A 2IX1A 4C3HH 2B63G 5IYBH 4A93H 2EQSA 4JBJA 1EYGA 3I2ZA 3PSIA 4R4CA 4BA1I 4YY3Q 1E22A 4QL5A 4A3EG 2F4VQ 3GTGH 4GN5A 4GLVB 5HGQA 3A5UA 3KJOA 2WB1G 3ERSX 2JA6G 1K0RA 2D0PA 4GNXA 3RZOH 2R93G 1V1QA 3G71A 4HIMA 1E3PA 4LWCA 5BR8Q 3UE1A 1B70B 3H0GH 3NELA 4YHHQ 3CC7A 4LF9Q 1KL9A 4KHPQ 1VQDA 4DR7L 4GS3A 4DV6Q 3JC66 1CKMA 1IBKL 2NVTH 1YEZA 1QZHA 2YTVA 3WWVA 4JI1L 3KFUA 2D62A 1VQLA 4DK6C 4O2DA 4NXNQ 1BKBA 4TQUS 4C3IH 4HJ7A 5IP9H 4BY7G 3CAMA 3NBHB 4R4IA 4B3TQ 4QQBX 1Z47A 2EIFA 4A3MG 1VQPA 4DPGA 1Q82C 3CMAA 1PV4A 4A3MH 2Q2TA 2UUAQ 5IWAL 4IPCA 4DV2L 1LM0A 1OXTA 4A3IH 2Z6KA 4OWWB 1YNXA 4JCVE 3M4QA 5FJ8H 2WB1E 1PH6A 1Q12A 4DR3L 2HQLA 1TWFH 5C0XG 2VS1A 4BXXH 3HOXH 1E1TA 4DR5L 4DV1Q 4JI0L 4P71A 3PF5A 2WAQE 5FLXc 5JEAJ 1WI5A 3G6EA 4X65L 1K9MC 4OWTB 2CFMA 1WCMH 3M4PA 1ASYA 2I5LX 1HNZQ 1TWCH 2N49A 4B3MQ 4A3DH 3U50C 4MTNA 4LF4Q 5C4XH 1A63A 2ZJQA 4A3IG 5E7NA 2LXJA 2XTIA 5LMUQ 4DV5Q 1N32Q 2AKWB 2F52A 2HHHQ 3I4OA 4JI1Q 5JJIA 2HHHL 2Q2IA 1R9TH 1BVSA 3HOXG 1PH1A 1VQ6A 1YHBA 3I4MH 4LW1A 4NPSA 1NMGA 3HKZE 3SGIA 1PVOA 4NXML 4K0KQ 2K5HA 4JG2A 4LUVA 1GVPA 2UUCL 2UUCQ 1KAWA 1X9NA 2VQFL 3RZDH 5M5XH 4A3FH 1TXYA 1G51A 3KOJA 1X55A 3LGJA 4DV7Q 1VQGA 4OWXB 3STBD 3GTOH 2FXQA 1KD1C 3HOYH 4JI3Q 2OWOA 1PH4A 1L2FA 2PQAB 1JJ2A 2ZJPA 2E5LQ 2VUMH 3S2DH 1QVCA 1UEBA 2Q2UA 4DR2L 3TRZA 2WAQG 3F1ZA 4HJ9A 4OX9Q 4ME3A 3A74A 1HNWQ 2IHEA 3S16H 1HZAA 2JE6I 4AIMA 4LF8Q 1FJGL 4A3LH 3HKSA 2QGQA 1Y1VG 4DV1L 3MXNB 3TREA 1GKHA 1GM5A 5FLMG 4XIGS 4YWMA 4LFAL 1VQAA 5C4JH 1CSQA 5C3EH 4DNIA 1IBLQ 5M3MG 1I50H 5IYCH 4LF4L 2KCTA 1PHJA 3CD6A 1SRUA 2N8NA 3S14H 3RLOA 4X6AH 1IXRA 1A8VA 5C4XG 2Q2HA 4YCWA 3HOUH 4WJ4A 1KRSA 2VZAA 4UPAA 2A19A 1C9OA 1XMQL 3GDEA 4DV0L 3FKIG 1P16A 1MKHA 4PZ6A 4NXMQ 4ALPA 3AFQA 3K7AH 1XNQQ 2R7ZH 1YHAA 3F8TA 4O0AA 4P74A 1E24A 3J80c 1Y1WG 4DAYB 5M5WH 4DR6Q 4JYAQ 1XTDA 1QUQA 2R92H 3Q8DA 1Y1WH 1X3EA 1RL2A 4JBWA 4A3JG 3F2DA 4L5SA 3FHWA 1JB7A 4B3RQ 2A8VA 4JOIA 3F2BA 4BBRH 5DLQE 4KHZA 2BA0A 3AQQA 2E8GA 3B6YA 3OYYA 2K75A 5J3BA 4X66Q 3H15A 4A3CG 4WJ3M 3M9BA 3I4MG 2R6GA 2UUAL 1HR0Q 3AEVA 2UXCL 3CXCA 3PIOA 1SMXA 2PI2A 5JJKA 2E2IH 1UE7A 2LSSA 4JI5L 3T1YL 2KENA 2OQ0A 4AH6A 3CCSA 2K5VA 4FDBA 1JMCA 3GTLH 1D7QA 4EQ5A 1DGSA 4GOPA 2I5MX 2KHJA 2YU9H 2UXBQ 1KIXA 2MNAA 2IT1A 4IJLA 4R4OA 1IYJB 1IBLL 2RF4A 3S2HH 2JA7H 4B3ML 2R7FA 4PG3A 2V1CC 1M1KC 2MO0A 2YV5A 1HZBA 1VQ5A 4A3EH 3S1MH 3GTPH 1XMOQ 3KDFA 3J81j 1N32L 3CF5A 4B3RL 4X64L 5FJ8G 1KC8C 4LF5L 1N36Q 5H1SE 3PV0A 4IFDJ 3K7UC 4QY7A 2KBNA 1BBUA 5FLMH 1VQMA 4A3LG 2OQKA 1VQOA 1VCIA 4X62L 4JI6L 1U5KA 4LFBQ 4C3JH 5GAHC 3J81i 2GN5A 2D0OA 2JA8G 3S1NH 4JV5L 2UXDL 1FVIA 5GROA 3J7A5 5LMNW 4A3JH 3T1YQ 4JI5Q 2ZM6Q 1Q8KA 2N3SA 3TS2A 3UDXA 1OXSC 1Y1VH 5IP7H 1J6QA 1QVFA 4OO1G 4AYBE 3H3VI 3FP9A 3F2CA 1CKNB 2ATWA 4B3SQ 4YHHL 4LF9L 5ELNA 1WYDA 2CWPA 2HIXA 3AYHB 4HIKA 4KLKA 1MJCA 1K83H 1HNWL 2JJQA 3RR5A 4DV6L 1IBKQ 2CWAA 3HFZB 3G4SA 2UUBQ 2UU9L 3KYHC 2K14A 4HIOA 2AHOB 4YCUA 4H02A 3CP0A 4Y7NH 1X6OA 1K73C 2AWOA 2JA5H 2UXBL 5IP9G 1LTLA 1JT8A 3EBEA 2NVYH 1JJCB 4OXPA 2E2JH 4A3KG 4JOIC 3CC2A 4GLAC 4POGA 4PMWA 1PA6A 3ICEA 4NB3A 3CQZH 4HJAA 1N34L 4HJ5A 1N8RC 3UDGA 4JV5Q 1K3RA 2PMZE 3TS0A 1CKNA 2L15A 2JEBI 4LF5Q 2BA1A 4DR5Q 4A3BG 4IFDG 1FGUA 1WFQA 2VQEQ 2Y0SE 1LYLA 3L2PA 2NN6G 3BZKA 4IPGA 3J7ZC 1L1OA 2F3IA 4LF6L 1VQ8A 4JI8L 4A4IA 2NN6I 2Z6KC 2JEAI 3RNUA 4GKJL 4QIWE 5IYBG 4J15A 1VQCA 5IT9c 3I55A 3T1HL 4IFDI 5LMUL 4AYBG 1P8LA 4POFA 2H5XA 2ZTCA 4A3FG 2DGYA 3NEMA 1MIUA 4GN3B 4MZ9A 4UP9A 3M7NA 1UWVA 3I56A 4UP8A 4X65Q 1VQFA 1PH5A 1TWGH 2HIVA 3PUVA 3GTJH 5C44G 1K8GA 1G6PA 1NMFA 1X65A 1YITA 1EWIA 1IL2A 4KHPL 1TWAH 1Q81C 1X3GA 1X54A 3KDFB 4OONA 5BR8L 1YJ9A 2HT1A 1PH7A 1E7ZA 1WJJA 5IY0A 4EX5A 4DUYQ 1KRTA 5GQOA 2VNUD 1NJIC 4LNQA 2VY3A 1XMQQ 4GNXC 2ZTEA 3RN5A 1G291 4B3TL 2C35B 1HH2P 4Y52H 3CC4A 4JI6Q 1WOCA 4DKAC 4LFBL 3HOVH 1HR0W 3RLFA 1PH3A 4YWKA 5EAYA 1YI2A 3HOVG 1LUZA 5K36G 3CCVA 1XMOL 2VW9A 1EUJA 3T1HQ 3CCJA 4DR2Q 3NENA 3A5ZB 2QA4A 2WFWA 5M3FG 1PH2A 4IO9A 3I4NH 4DR3Q 1PFSA 3HKZG 3CCLA 4L5TA 3HOUG 1O7IA 1YVCA 4BBSG 2RHQB 1CSPA 1EQRA 4P72A 4BY7H 4JI8Q 2RCNA 2ASBA 2ZTDA 3PF4A 1NY4A 4L5RC 4GKJQ 1HNZL 1AE2A 3GO5A 1S72A 5GAEC 2GVAA 3CMEA 3AFPA 4IOAA 4AQYQ 3BJUA 1QUQB 2WP8J 4GN4B 5HY6A 3ULJA 3EN2A 4DV4L 4BY1H 1N33Q 4OO1I 2Y0SG 1C0AA 3CPWA 3MEFA 1EFWA 2B29A 1A0IA 2NVXH 1PYSB 1NBWA 3STBC 5GAGC 4X62Q 2QEXA 1L1OB 2R92G 5C0XI 3PO2H 2OTLA 1V9PA 4DR4L 1VS0A 1A62A 2K50A 1SROA 1XPRA 1HNXQ 2VL6A 2B3GA 4DV7L 1EOVA 1NTGA 1NE3A 4PZ8A 4JI7L 1XNQL 3PO3G 1OXVA 1SE8A 3IRBA 1Y14B 1YZ6A 2KCMA 3E9IA 3U58A 3M4OH 1Q1BA 4L5QA 3S24A 1SN8A 2AMCB 3UDFA 3CCUA 5LMNQ 1PH8A 1J5EL 5IYDG 3A0JA 2NZHA 1HZ9A 3S15H 4QJFA 2YTYA 3M85A 2CCZA 3BU2A 1PYBA 2ZM6L 4MNOA 3J80i 2JK8A 3TQYA 4YY3L 1VQIA 2PQAA 4JI0Q 4KI0A 3D31A 1OXUA 4BXXG 1B7YB 3BZCA 2N78A 3KJPA 4LF7L 1VQNA 4LFAQ 1I6HH 3CCMA 1WCMG 4AQYL 1Q86C 4DR4Q 1U0LA 3W1GA 2PI2E 4PZ7A 1HZCA 4A93G 1VQ9A 2BH2A 2YTXA 2UU9Q 3RLNA 2UUBL 3PIPA 2JA5G 1C7YA 4A3BH 1S3OA 4JI3L 1QVGA 4A3CH 3K0XA 3VDYA 2R7DA 4R4QA 1UE5A 2JA9A 4DV3Q 3GD7A 3H0GG 4A3DG 1IZ6A 1I94L 5GADC 1BBWA 4BA2I 5IWAQ 4P73A 2ALYB 2OTJA 1X3FA 1YBYA 1D8LA 4C2MH 4A75A 4GKKQ 2YYZA 2Z0SA 3HOWG 1V43A 4XTCS 3PUWA 5IE8A 5IP7G 1IBML 4JI2Q 1UE6A 3CCRA 4JI2L 1TWHH 4JI7Q 1Q46A 4RMFA 1OTCA 5LMNL 2E2HH 4JC0A 3GTMH 1YIJA 4A3GH 3UE0A 2DUDA 1ASZA 1E1OA 2KHIA 3GTQH 4DUZL 4YWLA 2JA7G 4IPHA 3JAMi 4DR7Q 4JBMA 3PUZA 4GOPB 1KXLA 2BH8A 1AE3A 3I7FA 4UY8C 1OXXK 4LUOA 1FJGQ 4DV5L 3CCEA 5M5YH 4IJHA 1W2BA 2A1AA 1RIPA 3KF8B 3K80C 1VQEA 1YJWA 1M90C 5C44H 4LF7Q 4B3SL 2RHSB 4LFCQ 4LFCL 4R4TA 1EIYB 2JA8H 3HOZH 3PO2G 5AJ3Q 1GD7A 2ES2A 4JI4L 1Z9FA 2ID0A 4DV2Q 4DUYL 4HJ8A 3DLLA 1EIFA 3OW2A 2MFIA 1KHIA 2JA6H 2R93H 2MO1A 3PUYA 4IPDA 1L0WA 3W1BA 4GNXB 4IOCA 1IBMQ 3RN2A 3I4NG 2VUMG 3PO3H 3E0EA 3K81C 2PNHA 3ZJYC 1S40A 1XNRQ 4JBKA 1B8AA 2EXDA 1CKOA 1T9HA 3PGZA 2R7ZG 5ELOA 4GOPC 5IYCG 4A3GG 2CQOA 3CCQA 1MJEA 2CKZB 2LXKA 5C0XJ 3ULPA 1N34Q 4OX9L 5IYDH 1I5FA 1N9WA 1XJVA 2B63H 2UXCQ 1AH9A 1GO3E 2NVQH 1HNXL 2K4KA 2IX0A 4LF8L 4HIDA 2JQOA 3K8AA 4GKKL 1KQSA 3OTOQ 1VQ4A 1SFOH 4A76A 1UE1A 4X66L 3OTOL 1XPOA 3GTKH 1YHQA 3UDIA 2K52A 5M3FH 1QZGA 4LF6Q 2IY5B 4A3KH 1HJPA 1VQBA 1H95A 1VQKA 2GVBA 3KF6B 3PUXA 4TVAB 2E5LL 3L7ZC 1Q7YC 3L0OA 5C3EG 1HR0L 3E9HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3DM3 A;  2VQF Q;  3CPF A;  1VQH A;  2K5N A;  2F4V L;  4DV4 Q;  1N33 L;  3S17 H;  3S1Q H;  4APV A;  4YCV A;  3CW2 C;  2MQH A;  3H3V H;  4DV0 Q;  1N36 L;  1SLJ A;  3PCO B;  4R1J A;  4NXN L;  3FKI H;  5JEA G;  1JE5 A;  3D0F A;  2IHF A;  1FL0 A;  4P75 A;  1PH9 A;  3M3Y H;  4K0K L;  4BY1 G;  5AJ3 L;  4JI4 Q;  1I94 Q;  1Q1E A;  4GLX A;  5M3M H;  2I5H A;  4LUZ A;  4DV3 L;  1L1O C;  3W5O A;  1J5E Q;  3HOZ G;  4DR6 L;  4DR1 L;  3HOW H;  4JYA L;  4X64 Q;  4DR1 Q;  4RG1 A;  1YJN A;  3ULL A;  5JJL A;  1EQQ A;  3TEH B;  1XPU A;  3U4V A;  1CUK A;  3KF6 A;  3EIV A;  3JAM c;  2XGT A;  3HOY G;  3U4Z A;  2VQE L;  4BBS H;  2OCE A;  3S1R H;  4BBR G;  1XNR L;  2I0Q A;  3G48 A;  2ZJR A;  2AWN A;  4DAM A;  4QGU A;  3ER0 A;  1VQJ A;  1W3S A;  1X56 A;  3J81 c;  2UXD Q;  4UP7 A;  1I3Q H;  4DUZ Q;  1K8A C;  4DK3 C;  1VQ7 A;  3KLW A;  2NZO A;  1JJG A;  1SR3 A;  2IX1 A;  4C3H H;  2B63 G;  5IYB H;  4A93 H;  2EQS A;  4JBJ A;  1EYG A;  3I2Z A;  3PSI A;  4R4C A;  4BA1 I;  4YY3 Q;  1E22 A;  4QL5 A;  4A3E G;  2F4V Q;  3GTG H;  4GN5 A;  4GLV B;  5HGQ A;  3A5U A;  3KJO A;  2WB1 G;  3ERS X;  2JA6 G;  1K0R A;  2D0P A;  4GNX A;  3RZO H;  2R93 G;  1V1Q A;  3G71 A;  4HIM A;  1E3P A;  4LWC A;  5BR8 Q;  3UE1 A;  1B70 B;  3H0G H;  3NEL A;  4YHH Q;  3CC7 A;  4LF9 Q;  1KL9 A;  4KHP Q;  1VQD A;  4DR7 L;  4GS3 A;  4DV6 Q;  3JC6 6;  1CKM A;  1IBK L;  2NVT H;  1YEZ A;  1QZH A;  2YTV A;  3WWV A;  4JI1 L;  3KFU A;  2D62 A;  1VQL A;  4DK6 C;  4O2D A;  4NXN Q;  1BKB A;  4TQU S;  4C3I H;  4HJ7 A;  5IP9 H;  4BY7 G;  3CAM A;  3NBH B;  4R4I A;  4B3T Q;  4QQB X;  1Z47 A;  2EIF A;  4A3M G;  1VQP A;  4DPG A;  1Q82 C;  3CMA A;  1PV4 A;  4A3M H;  2Q2T A;  2UUA Q;  5IWA L;  4IPC A;  4DV2 L;  1LM0 A;  1OXT A;  4A3I H;  2Z6K A;  4OWW B;  1YNX A;  4JCV E;  3M4Q A;  5FJ8 H;  2WB1 E;  1PH6 A;  1Q12 A;  4DR3 L;  2HQL A;  1TWF H;  5C0X G;  2VS1 A;  4BXX H;  3HOX H;  1E1T A;  4DR5 L;  4DV1 Q;  4JI0 L;  4P71 A;  3PF5 A;  2WAQ E;  5FLX c;  5JEA J;  1WI5 A;  3G6E A;  4X65 L;  1K9M C;  4OWT B;  2CFM A;  1WCM H;  3M4P A;  1ASY A;  2I5L X;  1HNZ Q;  1TWC H;  2N49 A;  4B3M Q;  4A3D H;  3U50 C;  4MTN A;  4LF4 Q;  5C4X H;  1A63 A;  2ZJQ A;  4A3I G;  5E7N A;  2LXJ A;  2XTI A;  5LMU Q;  4DV5 Q;  1N32 Q;  2AKW B;  2F52 A;  2HHH Q;  3I4O A;  4JI1 Q;  5JJI A;  2HHH L;  2Q2I A;  1R9T H;  1BVS A;  3HOX G;  1PH1 A;  1VQ6 A;  1YHB A;  3I4M H;  4LW1 A;  4NPS A;  1NMG A;  3HKZ E;  3SGI A;  1PVO A;  4NXM L;  4K0K Q;  2K5H A;  4JG2 A;  4LUV A;  1GVP A;  2UUC L;  2UUC Q;  1KAW A;  1X9N A;  2VQF L;  3RZD H;  5M5X H;  4A3F H;  1TXY A;  1G51 A;  3KOJ A;  1X55 A;  3LGJ A;  4DV7 Q;  1VQG A;  4OWX B;  3STB D;  3GTO H;  2FXQ A;  1KD1 C;  3HOY H;  4JI3 Q;  2OWO A;  1PH4 A;  1L2F A;  2PQA B;  1JJ2 A;  2ZJP A;  2E5L Q;  2VUM H;  3S2D H;  1QVC A;  1UEB A;  2Q2U A;  4DR2 L;  3TRZ A;  2WAQ G;  3F1Z A;  4HJ9 A;  4OX9 Q;  4ME3 A;  3A74 A;  1HNW Q;  2IHE A;  3S16 H;  1HZA A;  2JE6 I;  4AIM A;  4LF8 Q;  1FJG L;  4A3L H;  3HKS A;  2QGQ A;  1Y1V G;  4DV1 L;  3MXN B;  3TRE A;  1GKH A;  1GM5 A;  5FLM G;  4XIG S;  4YWM A;  4LFA L;  1VQA A;  5C4J H;  1CSQ A;  5C3E H;  4DNI A;  1IBL Q;  5M3M G;  1I50 H;  5IYC H;  4LF4 L;  2KCT A;  1PHJ A;  3CD6 A;  1SRU A;  2N8N A;  3S14 H;  3RLO A;  4X6A H;  1IXR A;  1A8V A;  5C4X G;  2Q2H A;  4YCW A;  3HOU H;  4WJ4 A;  1KRS A;  2VZA A;  4UPA A;  2A19 A;  1C9O A;  1XMQ L;  3GDE A;  4DV0 L;  3FKI G;  1P16 A;  1MKH A;  4PZ6 A;  4NXM Q;  4ALP A;  3AFQ A;  3K7A H;  1XNQ Q;  2R7Z H;  1YHA A;  3F8T A;  4O0A A;  4P74 A;  1E24 A;  3J80 c;  1Y1W G;  4DAY B;  5M5W H;  4DR6 Q;  4JYA Q;  1XTD A;  1QUQ A;  2R92 H;  3Q8D A;  1Y1W H;  1X3E A;  1RL2 A;  4JBW A;  4A3J G;  3F2D A;  4L5S A;  3FHW A;  1JB7 A;  4B3R Q;  2A8V A;  4JOI A;  3F2B A;  4BBR H;  5DLQ E;  4KHZ A;  2BA0 A;  3AQQ A;  2E8G A;  3B6Y A;  3OYY A;  2K75 A;  5J3B A;  4X66 Q;  3H15 A;  4A3C G;  4WJ3 M;  3M9B A;  3I4M G;  2R6G A;  2UUA L;  1HR0 Q;  3AEV A;  2UXC L;  3CXC A;  3PIO A;  1SMX A;  2PI2 A;  5JJK A;  2E2I H;  1UE7 A;  2LSS A;  4JI5 L;  3T1Y L;  2KEN A;  2OQ0 A;  4AH6 A;  3CCS A;  2K5V A;  4FDB A;  1JMC A;  3GTL H;  1D7Q A;  4EQ5 A;  1DGS A;  4GOP A;  2I5M X;  2KHJ A;  2YU9 H;  2UXB Q;  1KIX A;  2MNA A;  2IT1 A;  4IJL A;  4R4O A;  1IYJ B;  1IBL L;  2RF4 A;  3S2H H;  2JA7 H;  4B3M L;  2R7F A;  4PG3 A;  2V1C C;  1M1K C;  2MO0 A;  2YV5 A;  1HZB A;  1VQ5 A;  4A3E H;  3S1M H;  3GTP H;  1XMO Q;  3KDF A;  3J81 j;  1N32 L;  3CF5 A;  4B3R L;  4X64 L;  5FJ8 G;  1KC8 C;  4LF5 L;  1N36 Q;  5H1S E;  3PV0 A;  4IFD J;  3K7U C;  4QY7 A;  2KBN A;  1BBU A;  5FLM H;  1VQM A;  4A3L G;  2OQK A;  1VQO A;  1VCI A;  4X62 L;  4JI6 L;  1U5K A;  4LFB Q;  4C3J H;  5GAH C;  3J81 i;  2GN5 A;  2D0O A;  2JA8 G;  3S1N H;  4JV5 L;  2UXD L;  1FVI A;  5GRO A;  3J7A 5;  5LMN W;  4A3J H;  3T1Y Q;  4JI5 Q;  2ZM6 Q;  1Q8K A;  2N3S A;  3TS2 A;  3UDX A;  1OXS C;  1Y1V H;  5IP7 H;  1J6Q A;  1QVF A;  4OO1 G;  4AYB E;  3H3V I;  3FP9 A;  3F2C A;  1CKN B;  2ATW A;  4B3S Q;  4YHH L;  4LF9 L;  5ELN A;  1WYD A;  2CWP A;  2HIX A;  3AYH B;  4HIK A;  4KLK A;  1MJC A;  1K83 H;  1HNW L;  2JJQ A;  3RR5 A;  4DV6 L;  1IBK Q;  2CWA A;  3HFZ B;  3G4S A;  2UUB Q;  2UU9 L;  3KYH C;  2K14 A;  4HIO A;  2AHO B;  4YCU A;  4H02 A;  3CP0 A;  4Y7N H;  1X6O A;  1K73 C;  2AWO A;  2JA5 H;  2UXB L;  5IP9 G;  1LTL A;  1JT8 A;  3EBE A;  2NVY H;  1JJC B;  4OXP A;  2E2J H;  4A3K G;  4JOI C;  3CC2 A;  4GLA C;  4POG A;  4PMW A;  1PA6 A;  3ICE A;  4NB3 A;  3CQZ H;  4HJA A;  1N34 L;  4HJ5 A;  1N8R C;  3UDG A;  4JV5 Q;  1K3R A;  2PMZ E;  3TS0 A;  1CKN A;  2L15 A;  2JEB I;  4LF5 Q;  2BA1 A;  4DR5 Q;  4A3B G;  4IFD G;  1FGU A;  1WFQ A;  2VQE Q;  2Y0S E;  1LYL A;  3L2P A;  2NN6 G;  3BZK A;  4IPG A;  3J7Z C;  1L1O A;  2F3I A;  4LF6 L;  1VQ8 A;  4JI8 L;  4A4I A;  2NN6 I;  2Z6K C;  2JEA I;  3RNU A;  4GKJ L;  4QIW E;  5IYB G;  4J15 A;  1VQC A;  5IT9 c;  3I55 A;  3T1H L;  4IFD I;  5LMU L;  4AYB G;  1P8L A;  4POF A;  2H5X A;  2ZTC A;  4A3F G;  2DGY A;  3NEM A;  1MIU A;  4GN3 B;  4MZ9 A;  4UP9 A;  3M7N A;  1UWV A;  3I56 A;  4UP8 A;  4X65 Q;  1VQF A;  1PH5 A;  1TWG H;  2HIV A;  3PUV A;  3GTJ H;  5C44 G;  1K8G A;  1G6P A;  1NMF A;  1X65 A;  1YIT A;  1EWI A;  1IL2 A;  4KHP L;  1TWA H;  1Q81 C;  1X3G A;  1X54 A;  3KDF B;  4OON A;  5BR8 L;  1YJ9 A;  2HT1 A;  1PH7 A;  1E7Z A;  1WJJ A;  5IY0 A;  4EX5 A;  4DUY Q;  1KRT A;  5GQO A;  2VNU D;  1NJI C;  4LNQ A;  2VY3 A;  1XMQ Q;  4GNX C;  2ZTE A;  3RN5 A;  1G29 1;  4B3T L;  2C35 B;  1HH2 P;  4Y52 H;  3CC4 A;  4JI6 Q;  1WOC A;  4DKA C;  4LFB L;  3HOV H;  1HR0 W;  3RLF A;  1PH3 A;  4YWK A;  5EAY A;  1YI2 A;  3HOV G;  1LUZ A;  5K36 G;  3CCV A;  1XMO L;  2VW9 A;  1EUJ A;  3T1H Q;  3CCJ A;  4DR2 Q;  3NEN A;  3A5Z B;  2QA4 A;  2WFW A;  5M3F G;  1PH2 A;  4IO9 A;  3I4N H;  4DR3 Q;  1PFS A;  3HKZ G;  3CCL A;  4L5T A;  3HOU G;  1O7I A;  1YVC A;  4BBS G;  2RHQ B;  1CSP A;  1EQR A;  4P72 A;  4BY7 H;  4JI8 Q;  2RCN A;  2ASB A;  2ZTD A;  3PF4 A;  1NY4 A;  4L5R C;  4GKJ Q;  1HNZ L;  1AE2 A;  3GO5 A;  1S72 A;  5GAE C;  2GVA A;  3CME A;  3AFP A;  4IOA A;  4AQY Q;  3BJU A;  1QUQ B;  2WP8 J;  4GN4 B;  5HY6 A;  3ULJ A;  3EN2 A;  4DV4 L;  4BY1 H;  1N33 Q;  4OO1 I;  2Y0S G;  1C0A A;  3CPW A;  3MEF A;  1EFW A;  2B29 A;  1A0I A;  2NVX H;  1PYS B;  1NBW A;  3STB C;  5GAG C;  4X62 Q;  2QEX A;  1L1O B;  2R92 G;  5C0X I;  3PO2 H;  2OTL A;  1V9P A;  4DR4 L;  1VS0 A;  1A62 A;  2K50 A;  1SRO A;  1XPR A;  1HNX Q;  2VL6 A;  2B3G A;  4DV7 L;  1EOV A;  1NTG A;  1NE3 A;  4PZ8 A;  4JI7 L;  1XNQ L;  3PO3 G;  1OXV A;  1SE8 A;  3IRB A;  1Y14 B;  1YZ6 A;  2KCM A;  3E9I A;  3U58 A;  3M4O H;  1Q1B A;  4L5Q A;  3S24 A;  1SN8 A;  2AMC B;  3UDF A;  3CCU A;  5LMN Q;  1PH8 A;  1J5E L;  5IYD G;  3A0J A;  2NZH A;  1HZ9 A;  3S15 H;  4QJF A;  2YTY A;  3M85 A;  2CCZ A;  3BU2 A;  1PYB A;  2ZM6 L;  4MNO A;  3J80 i;  2JK8 A;  3TQY A;  4YY3 L;  1VQI A;  2PQA A;  4JI0 Q;  4KI0 A;  3D31 A;  1OXU A;  4BXX G;  1B7Y B;  3BZC A;  2N78 A;  3KJP A;  4LF7 L;  1VQN A;  4LFA Q;  1I6H H;  3CCM A;  1WCM G;  4AQY L;  1Q86 C;  4DR4 Q;  1U0L A;  3W1G A;  2PI2 E;  4PZ7 A;  1HZC A;  4A93 G;  1VQ9 A;  2BH2 A;  2YTX A;  2UU9 Q;  3RLN A;  2UUB L;  3PIP A;  2JA5 G;  1C7Y A;  4A3B H;  1S3O A;  4JI3 L;  1QVG A;  4A3C H;  3K0X A;  3VDY A;  2R7D A;  4R4Q A;  1UE5 A;  2JA9 A;  4DV3 Q;  3GD7 A;  3H0G G;  4A3D G;  1IZ6 A;  1I94 L;  5GAD C;  1BBW A;  4BA2 I;  5IWA Q;  4P73 A;  2ALY B;  2OTJ A;  1X3F A;  1YBY A;  1D8L A;  4C2M H;  4A75 A;  4GKK Q;  2YYZ A;  2Z0S A;  3HOW G;  1V43 A;  4XTC S;  3PUW A;  5IE8 A;  5IP7 G;  1IBM L;  4JI2 Q;  1UE6 A;  3CCR A;  4JI2 L;  1TWH H;  4JI7 Q;  1Q46 A;  4RMF A;  1OTC A;  5LMN L;  2E2H H;  4JC0 A;  3GTM H;  1YIJ A;  4A3G H;  3UE0 A;  2DUD A;  1ASZ A;  1E1O A;  2KHI A;  3GTQ H;  4DUZ L;  4YWL A;  2JA7 G;  4IPH A;  3JAM i;  4DR7 Q;  4JBM A;  3PUZ A;  4GOP B;  1KXL A;  2BH8 A;  1AE3 A;  3I7F A;  4UY8 C;  1OXX K;  4LUO A;  1FJG Q;  4DV5 L;  3CCE A;  5M5Y H;  4IJH A;  1W2B A;  2A1A A;  1RIP A;  3KF8 B;  3K80 C;  1VQE A;  1YJW A;  1M90 C;  5C44 H;  4LF7 Q;  4B3S L;  2RHS B;  4LFC Q;  4LFC L;  4R4T A;  1EIY B;  2JA8 H;  3HOZ H;  3PO2 G;  5AJ3 Q;  1GD7 A;  2ES2 A;  4JI4 L;  1Z9F A;  2ID0 A;  4DV2 Q;  4DUY L;  4HJ8 A;  3DLL A;  1EIF A;  3OW2 A;  2MFI A;  1KHI A;  2JA6 H;  2R93 H;  2MO1 A;  3PUY A;  4IPD A;  1L0W A;  3W1B A;  4GNX B;  4IOC A;  1IBM Q;  3RN2 A;  3I4N G;  2VUM G;  3PO3 H;  3E0E A;  3K81 C;  2PNH A;  3ZJY C;  1S40 A;  1XNR Q;  4JBK A;  1B8A A;  2EXD A;  1CKO A;  1T9H A;  3PGZ A;  2R7Z G;  5ELO A;  4GOP C;  5IYC G;  4A3G G;  2CQO A;  3CCQ A;  1MJE A;  2CKZ B;  2LXK A;  5C0X J;  3ULP A;  1N34 Q;  4OX9 L;  5IYD H;  1I5F A;  1N9W A;  1XJV A;  2B63 H;  2UXC Q;  1AH9 A;  1GO3 E;  2NVQ H;  1HNX L;  2K4K A;  2IX0 A;  4LF8 L;  4HID A;  2JQO A;  3K8A A;  4GKK L;  1KQS A;  3OTO Q;  1VQ4 A;  1SFO H;  4A76 A;  1UE1 A;  4X66 L;  3OTO L;  1XPO A;  3GTK H;  1YHQ A;  3UDI A;  2K52 A;  5M3F H;  1QZG A;  4LF6 Q;  2IY5 B;  4A3K H;  1HJP A;  1VQB A;  1H95 A;  1VQK A;  2GVB A;  3KF6 B;  3PUX A;  4TVA B;  2E5L L;  3L7Z C;  1Q7Y C;  3L0O A;  5C3E G;  1HR0 L;  3E9H A; 
#chains in the Genus database with same CATH topology
 3CPF A;  1PTO D;  2F0T A;  2F0O A;  2K5N A;  1MSG A;  1N33 L;  1STH A;  2W6P A;  5I6W A;  1PZK D;  3S1Q H;  4YCV A;  2MQH A;  1N36 L;  1IYU A;  3WDN A;  3K3P A;  3PCO B;  2CW8 A;  1FKA H;  5JEA G;  4P75 A;  3M3Y H;  3C2P A;  3S1M B;  1AP0 A;  4K0K L;  4BY1 G;  5AJ3 L;  1Q1E A;  4UCU A;  3HOZ G;  1L1O C;  4DR6 L;  4DR1 L;  1A3V A;  1BCP F;  4X64 Q;  2QF7 A;  4O3Q A;  3TEH B;  1GUO A;  3K5H A;  1CUK A;  3KF6 A;  2EY2 A;  3EIV A;  5EBD A;  4QCL A;  1EY5 A;  2AQ4 A;  1XNR L;  2C2D A;  2I0Q A;  4B3M H;  2NTT A;  2ZJR A;  1E4E A;  3GTK B;  1TWA B;  3ER0 A;  5D3D A;  2UXD Q;  5FPR A;  1BDO A;  1VQ7 A;  5KFD A;  3VYU A;  3MFH A;  1EY9 A;  1SR3 A;  1Z7T A;  2F0L A;  2IX1 A;  2GPW A;  4C3H H;  4DUZ H;  1MGS A;  1JWU D;  2EQS A;  1EYG A;  3PSI A;  3QIA A;  5ELD A;  4YY3 Q;  1E22 A;  2K6A A;  2F4V Q;  2WYO A;  1M4V A;  3NK9 A;  3RMH A;  3Q8R B;  2WB1 G;  4NDX A;  3RZO H;  5CA1 F;  1S5B D;  4R8U B;  4ED1 A;  5FKA C;  2UXD H;  1V1Q A;  3F2U A;  3G71 A;  4A3D B;  2KQ3 A;  3S1Q B;  1A2T A;  3UE1 A;  3NEL A;  2AUJ D;  4DR7 L;  1TII D;  2C22 A;  4JI8 H;  1T94 A;  2VB2 X;  3LWU A;  2K33 A;  1JC7 A;  5FLX W;  2I46 A;  4O2D A;  4NXN Q;  1BKB A;  5CYU A;  4TQU S;  4A2B A;  3NTH A;  4C3I H;  5IP9 H;  4BWS C;  4L63 B;  3NBH B;  4R4I A;  4HCS A;  2M2L A;  4A3M G;  4DAP A;  4DN4 M;  1Q82 C;  4ZI7 F;  3CMA A;  4DV6 H;  2Q2T A;  1EIH A;  5IWA L;  2FB9 A;  2R7K A;  4DV2 L;  4OWW B;  2Z6K A;  3TP8 A;  4UAI A;  3M4Q A;  3Q8P B;  2NVY A;  4O4H F;  4DR3 L;  1K83 B;  4BXX H;  4OX9 H;  4JI0 L;  1E1T A;  4WBN F;  1KBL A;  1HFN A;  2WAQ E;  5FLX c;  5KFL A;  4ID6 A;  2W6M A;  1S5E D;  1SFO B;  1BQQ T;  2LKV A;  1K9M C;  2CFM A;  3NQT A;  4FF1 A;  3PO2 B;  2CQA A;  1DV1 A;  2W9A A;  1TWC H;  3PR4 A;  2YZM A;  4A3D H;  1NCV A;  1M0W A;  3NWT A;  1A63 A;  1WCM A;  5E7N A;  1G8Z D;  2XTI A;  5LMU Q;  1N32 Q;  4FXK C;  4C5A A;  3MXU A;  5JJI A;  1XMO H;  4JI7 H;  4FO2 A;  2P5Z X;  5CB4 F;  2HHH L;  3KLR A;  3OIP A;  1GSO A;  3HOX G;  4I65 A;  3LWB A;  4RAY A;  2JEG A;  1NMG A;  3SGI A;  2QW7 A;  4CGY B;  4RAZ A;  1PVO A;  4JI2 H;  4EEY A;  4JG2 A;  2MPM A;  2NU6 B;  2UUC L;  3JAM W;  5LMN H;  3BDO A;  4CDD C;  1Y69 U;  3TIN A;  2VQF L;  3RZD H;  5JH7 F;  1I6V C;  2VUM A;  1DON A;  4ECY A;  1HUM A;  4IZ8 A;  2K7V A;  2FXQ A;  1FNU A;  3HOW B;  2CZG A;  4JI6 H;  1CTM A;  2KJX A;  1L2F A;  2ZT9 C;  2PQA B;  3Q24 A;  2VUM H;  2XSC A;  4LMY A;  4JK1 C;  1ZXT A;  1SYF A;  1LAB A;  3L9A X;  4HJ9 A;  4OX9 Q;  1ENA A;  5KFC A;  2ZXO A;  3A74 A;  2D5D A;  1HZA A;  4JW0 A;  4LF8 Q;  5G3L D;  1FJG L;  4A3L H;  4GC7 A;  4KD3 A;  2V4R A;  4DV1 L;  5DAU A;  1EY6 A;  1RCV D;  3L4K A;  2FLN A;  1GM5 A;  3BVG A;  3DF7 A;  1NR4 A;  4YWM A;  4LFA L;  5C3E H;  4LF4 L;  5M3M G;  2MJ8 A;  5IGC A;  4Y7N B;  2N8N A;  3JSL A;  1A8V A;  3SK6 A;  4XT3 B;  2ICI A;  2A19 A;  3OWF A;  2QDL A;  1Y1V B;  3GDE A;  4DV0 L;  4NXM Q;  2R7Z H;  1EFI D;  2A6H C;  3K7A H;  1I4H A;  1Y1W G;  4F4W A;  4JYA Q;  5M5W H;  3A8K E;  1SYD A;  4YJ3 F;  3H40 A;  3I90 A;  1X3E A;  3OW7 A;  2XRQ D;  3GIQ A;  3D4W A;  1D5M C;  1BGW A;  3PQI A;  2A8V A;  4IAJ A;  4F4X A;  4ZQ3 A;  4N8F A;  5C3W A;  5DLQ E;  1RF2 D;  2F3W A;  1E2V A;  2K75 A;  1F77 A;  4K6L A;  4NKL A;  3G6V A;  2N55 A;  3M9B A;  4ZUJ A;  4RHR A;  5JVL A;  2R6G A;  3AEV A;  2EOT A;  4DV7 H;  3FDS A;  2CH4 A;  2PI2 A;  5L9X A;  5JJK A;  1RJP A;  2LSS A;  2WE6 A;  3MWY W;  4RNM A;  1D7Q A;  4FDB A;  5KFK A;  4B9X A;  1CZG A;  2AQ1 B;  1DGS A;  4GOP A;  2RBM A;  4EFE A;  2KHJ A;  3T5L A;  4M1U B;  5KFN A;  3D4R A;  3FPU B;  4A3G B;  1IYJ B;  4LH6 A;  4B3M L;  3A56 A;  2ZM6 H;  2MO0 A;  2ZJT A;  4N9T A;  1XMO Q;  4YAK B;  3RJ0 A;  4IRK A;  3KDF A;  3G6Y A;  1E2Z A;  3MEH A;  4XYO A;  4X64 L;  4EYH B;  5DLF A;  1N36 Q;  5KND A;  3RZD B;  3HS0 C;  2CHB D;  4A3L G;  1TA8 A;  2OQK A;  1HRJ A;  5JQW A;  2XD4 A;  1VCI A;  4FU0 A;  2BE5 C;  3DWP A;  1DYQ A;  4C3J H;  2UXD L;  3I72 A;  4A3J H;  4FF3 A;  1I7N A;  1JOO A;  2ZM6 Q;  2NU9 B;  4BY7 B;  3VYT A;  1RYR A;  3J7A K;  4NMZ A;  2EPB A;  2Y0S A;  5IP7 H;  2JP1 A;  3F8N A;  4BY1 B;  1TY2 A;  1SYX B;  4CKB A;  1CKN B;  4KD4 A;  4YHH L;  2VA3 A;  4R8N A;  1WYD A;  2HIX A;  2JXM B;  2B2W C;  2OT2 A;  2EY6 A;  3R2I A;  3RR5 A;  3G4S A;  3HFZ B;  2UUB Q;  2C28 A;  2CW0 D;  5BN3 A;  4HIO A;  1PZJ D;  5IGE A;  2UXB L;  1TWF A;  3N43 B;  2NB0 A;  1JT8 A;  5LP6 F;  4DL2 A;  2NVY H;  1T5E A;  4JOI C;  4PMW A;  2WII B;  4ZLT F;  4NB3 A;  1N34 L;  1PRT C;  5KG2 A;  4KMU C;  2Z4H A;  4CJ0 B;  5C5M A;  2F0K A;  3BDC A;  1K28 A;  4DR5 Q;  4A3B G;  2VQE Q;  4A3J B;  2Y0S E;  2NN6 G;  3BZK A;  5HV6 A;  2EY1 A;  3J7Z C;  2WAQ A;  1L0X B;  2F3I A;  2G5D A;  4B08 A;  3KK7 A;  5KIX A;  5JEA H;  2DWC A;  4A4I A;  3GV8 B;  1HTL D;  1F9R A;  1LTS D;  2IWH A;  4X65 H;  1ZQ7 A;  4J15 A;  3T1H L;  2L9H A;  5IT9 c;  4O3R A;  1G91 A;  3GTO B;  4AYB G;  1EYZ A;  1EZ8 A;  1CFM A;  1ZHS A;  2R82 A;  3NEM A;  5FD5 A;  4MZ9 A;  3M7N A;  2C9O A;  5EPL A;  4RAU C;  2HHH H;  1VQF A;  2UVU A;  1BBX C;  1K8G A;  5C44 G;  5KFF A;  5KFA A;  2FPI B;  1SJE D;  2F0J A;  1NMF A;  1X65 A;  1EWI A;  2RDF A;  5KFO A;  4OON A;  2F4V H;  3FMC A;  1PH7 A;  4EX5 A;  2EE1 A;  3FPP A;  2VQF H;  5GQO A;  1W93 A;  4XYM B;  1KAB A;  1XMQ Q;  4GNX C;  2RGV A;  3SE7 A;  1EYD A;  1NAP A;  4F50 A;  1LTI D;  1HQR D;  1IW7 D;  4QIW B;  4E6I A;  4JV0 A;  4B3T L;  3UQ8 A;  2DNC A;  4Y52 H;  2A6E D;  5J22 A;  5A35 A;  5KG0 A;  4Z9C B;  2CW0 C;  3J81 L;  1PH3 A;  1SNC A;  1YI2 A;  5J2U F;  4RGT A;  3CCV A;  3T1H Q;  3TZD A;  3CCJ A;  1I6U A;  4BBS B;  2QA4 A;  4FM9 A;  5M3F G;  1JCK B;  3P20 A;  1PH2 A;  3I4N H;  1AN7 A;  4NW2 A;  3HOU G;  1ILQ A;  1ZYR D;  2N88 A;  2BOS A;  1VMC A;  1GJX A;  2RHQ B;  1SNP A;  2A69 D;  4GKJ Q;  4EGV A;  4XQQ A;  4L5R C;  1GYF A;  3R93 A;  3M3Y B;  1S72 A;  3A8I E;  1WTW A;  5HY6 A;  1QUQ B;  2WP8 J;  2W8L A;  1N33 Q;  1PRT D;  4U67 3;  4OO1 I;  2J7Z A;  2Y0S G;  2ZDH A;  1C0A A;  1OWT A;  4DR5 H;  3RUZ A;  4LSA A;  1XMQ H;  2V5A A;  2ZXP A;  1A0I A;  1SDF A;  2NVX H;  4ME5 A;  1MZB A;  3MXG A;  4KKU A;  2FJZ A;  2B63 A;  5KFE A;  4X3K A;  3P7J A;  3PO2 H;  4DR4 L;  1V9P A;  3NTI A;  4O3N A;  2F0Q A;  1CA5 A;  1XPR A;  2BQR A;  1YNN D;  1SYE A;  5FLX E;  2F0D A;  4Y8V B;  1Y8N B;  3MWM A;  5A2Q L;  4DV7 L;  4PZ8 A;  1OXV A;  4H7B A;  3DHQ A;  3GTL B;  4WOR A;  1YZ6 A;  3E9I A;  4PDB A;  4DNR B;  3U58 A;  3M4O H;  3SE0 A;  3UDF A;  2B39 A;  4NLG A;  2GLT A;  1ZEQ X;  3IAY A;  3O13 A;  4ED3 A;  2ICE C;  4DA2 A;  4O2A F;  1PYB A;  4QWE A;  3GTM B;  3ZYY X;  3T4A C;  3TQY A;  2YL2 A;  1H9M A;  2DN8 A;  4G4K A;  4TQR A;  1HR0 H;  2N78 A;  3KJP A;  1D5Z C;  3JAM E;  1I6H H;  2SOB A;  3VMM A;  3D4D A;  5DEH A;  4DR4 Q;  1Q86 C;  4FXG C;  4WFN 3;  3Q0A A;  4C3J B;  1ML0 D;  3K6O A;  1RD9 D;  3DM1 A;  2UU9 Q;  3RLN A;  1V4Y A;  4TV9 F;  2CQY A;  2B2T C;  3NTK A;  4UHV A;  2IA6 A;  1C7Y A;  1S3O A;  3OOC A;  1SNM A;  2C2E A;  1ZYR C;  1VDZ A;  3K0X A;  4DR6 H;  5D8D A;  3H94 A;  2A69 C;  1UE5 A;  4DV3 Q;  3H0G G;  3K57 A;  3QG1 A;  1BBW A;  2R8J A;  1QJO A;  3A8J E;  4YR3 A;  4P73 A;  2OTJ A;  3BA8 A;  1XNR H;  1D8L A;  5C4X B;  4GKK Q;  3HOW G;  4XTC S;  3PUW A;  1WVL A;  2NZ1 D;  5T14 A;  4JI2 Q;  1UE6 A;  3EPI A;  3RV3 A;  2ATL A;  2PN1 A;  3LP8 A;  1K8M A;  3GTM H;  1GUS A;  2L1B A;  4RGM A;  4K5X A;  5ISR A;  2XVS A;  1AZP A;  2KHI A;  1IOV A;  4DUZ L;  3P1H A;  4ZHQ F;  4IPH A;  4MAM A;  3PUZ A;  3M4I A;  2BH8 A;  2WTF A;  2IW3 A;  4IR1 A;  4KKT A;  4DV5 L;  3GV7 B;  4MV4 A;  4IR9 A;  2R93 A;  3I91 A;  4HMJ A;  2JA6 A;  4HAE A;  1CQJ B;  3I12 A;  1W2B A;  4BWG B;  3TP6 A;  2UU9 H;  2LY7 A;  3IFD A;  1M90 C;  2X0S A;  4QWA A;  3QOJ A;  2RHS B;  1IKM A;  1EIY B;  2Z4I A;  3PO2 G;  3PW4 A;  4RKL A;  2D9U A;  1KDB A;  2NVX B;  3M9M B;  2MFI A;  5KT5 A;  1DOL A;  1KHI A;  5C6A A;  3JRW A;  3LNN A;  1DIK A;  4GNX B;  3GTJ B;  1XNR Q;  1S40 A;  5FK9 C;  4ZKC B;  2V58 A;  3RB3 A;  1WTP A;  2UVR A;  4LF9 H;  2NTS A;  3ONA B;  1B53 A;  3KLS A;  2CQO A;  2LXK A;  5C0X J;  4OX9 L;  2UXC Q;  3V4Z A;  3G7L A;  4LF8 L;  4HID A;  2O2L D;  2JN4 A;  3M9O B;  1VQ4 A;  4RFB A;  3OTO L;  4X66 L;  5KFM A;  5M3F H;  3R8B A;  2Q8R E;  2VQD A;  1S10 A;  2RDI A;  1HJP A;  1VQB A;  2EY5 A;  1H95 A;  3L0O A;  2R7Z B;  2X69 A;  4X62 H;  1VQH A;  3KHG A;  3DXJ C;  3VR3 A;  4DV4 Q;  4AQY H;  4APV A;  1WD0 A;  2ALZ A;  1V1O A;  2FK2 A;  3URY A;  4UCT A;  1TWH B;  4I7A A;  4DV0 Q;  4IN3 A;  1U4L A;  1SLJ A;  1QE6 A;  2W6N A;  4I50 F;  2UUA H;  3D0F A;  4A2A A;  1FL0 A;  4Q8F A;  3MTS A;  4HSP A;  2WIN B;  4K6D A;  3PZP A;  2I5H A;  4DV3 L;  3VPB A;  1IHZ A;  3W5O A;  4ED2 A;  2K1B A;  4DR1 Q;  1FNW A;  4L8J A;  4RCN A;  3ULL A;  5LL6 X;  3GTG A;  1XPU A;  4DL5 A;  2E2I B;  3TME A;  1S5D D;  4DV4 H;  4BBR G;  4K8I A;  1O75 A;  1SSO A;  2FMA A;  3OSP A;  4DAM A;  4U7C A;  1QG7 A;  1X56 A;  3J81 c;  4XYL B;  4UFZ A;  4UP7 A;  1I3Q H;  4DUZ Q;  1SCU B;  4DK3 C;  2NZO A;  1S68 A;  2OEO A;  3GID A;  2JA7 A;  5M3F B;  4YP3 A;  4DV1 H;  2B63 G;  5IYB H;  1EY0 A;  3BG5 A;  3VR2 A;  3I73 A;  2W6Q A;  4A3E G;  4BA1 I;  4GLV B;  4LFA H;  3A5U A;  4YR2 A;  3BYT B;  3ERS X;  4PQX A;  2R86 A;  4HYK A;  2UVW A;  5JOB A;  5BR8 Q;  1IKL A;  2EYO A;  5CBE E;  2CH4 W;  1B70 B;  1WTH A;  4LF9 Q;  4KHP Q;  4JUZ A;  1VQD A;  4GKJ H;  3TQT A;  2F0G A;  2PZU A;  1LTR D;  2D62 A;  2JA8 B;  4ME6 A;  1B9N A;  2K03 A;  1PFM A;  1D2B A;  1DOK A;  4HJ7 A;  5IOD A;  3CAM A;  3I8Z A;  1Z47 A;  1HCZ A;  4ED0 A;  1B3Q A;  2M9V A;  1PFN A;  1LM0 A;  5EWG A;  2A68 C;  2ZXR A;  1EHI A;  4JCV E;  5FJ8 H;  3SHL A;  3MR5 A;  5C0X G;  3HOX H;  4DV1 Q;  1RYS A;  3PF5 A;  4DXF A;  1W96 A;  2X6L A;  4YJ2 F;  3M4P A;  1AFP A;  4J9L A;  1HNZ Q;  3U50 C;  1I6H B;  1JDB B;  4N9P A;  1DM0 B;  4A3I G;  3IG0 A;  1BO0 A;  2AKW B;  4CDF C;  2KSW A;  1HA5 A;  3NHH A;  1Z6H A;  3HKZ B;  2F0V A;  2UUB H;  5JVG 3;  3I4M H;  3RTX A;  4A3B B;  2NUA B;  1STY A;  2K5H A;  4X64 H;  1GVP A;  4MV6 A;  3A7L A;  4DNT B;  2UUC Q;  1O7Y A;  1KAW A;  4L6T B;  2DY8 A;  3KHH A;  4O42 A;  2W57 A;  4C1N K;  3OUU A;  4MA5 A;  1X55 A;  4QWB A;  4KY7 A;  1VQG A;  3GTO H;  3GTG B;  1JXL A;  1KD1 C;  1CT1 D;  5CBA E;  1UNN C;  1STN A;  2F0M A;  5KG3 A;  4LFB H;  1R4P B;  1H9R A;  1PMR A;  1J8I A;  4TRD A;  1A15 A;  4OEL B;  4EGQ A;  2AQ2 B;  1SYB A;  4ME3 A;  2AGQ A;  1TWH A;  2IHE A;  4IWX A;  2JE6 I;  3T53 B;  2KOL A;  5FD6 A;  4J9O A;  4MV1 A;  2QGQ A;  4EQN A;  4F87 A;  3QWN A;  1G6Z A;  3VPC A;  4J9Q A;  1PLF A;  2EYL A;  4XIG S;  1AN8 A;  2L0C A;  3N42 B;  2L55 A;  1PHJ A;  1BCP B;  4M9U A;  4J6H A;  4JI4 H;  1BNZ A;  4YCW A;  1O7L A;  4WJ4 A;  1KRS A;  1C9O A;  2J6T A;  1QNU A;  3I4N B;  4PZ6 A;  4A3G G;  1VF7 A;  1TVX A;  4EBC A;  1YHA A;  3F8T A;  4X66 H;  1FNV A;  1E24 A;  1F9Q A;  4DAY B;  4DR6 Q;  1Y1W A;  3Q8D A;  1Y1W H;  3MFG A;  3GTJ A;  4PNY A;  4L5S A;  3J7A V;  3FHW A;  4RHS A;  2GA4 B;  3LML A;  1JIC A;  1C8C A;  4LF6 H;  1CHQ D;  2QCP X;  1ROD A;  4X66 Q;  5J3B A;  5IGB A;  3ND8 A;  3OTO H;  4DR4 H;  4A3C G;  1B9M A;  4HR7 A;  5LYJ F;  1LTG D;  1O80 A;  3W3A A;  5D14 A;  3GLK A;  3I4M G;  3JSN A;  1PZI D;  3SK4 A;  1HR0 Q;  2UUA L;  1LAC A;  3T16 A;  3K5M A;  2UXC L;  5IT9 W;  1RKN A;  3T5K A;  3PIO A;  3RV4 A;  1SMX A;  4R7R A;  4JI5 L;  2JA6 B;  2KEN A;  2R93 B;  3H4B A;  5F9L A;  4AH6 A;  3A54 A;  1JMC A;  2KCC A;  5HGT A;  3NBI A;  4EQ5 A;  1K0S A;  2YU9 H;  2UXB Q;  4ZRZ A;  4MV7 A;  2Z8L A;  4DGZ A;  2MNA A;  1S97 A;  2IT1 A;  3OMC A;  1ESF A;  1IBL L;  3S2H H;  4JVZ A;  1KDA A;  3Q22 A;  1U4R A;  3ERQ A;  3BYY B;  5KG1 A;  4RB2 C;  4ABN A;  3GTP H;  5LOV F;  3CF5 A;  3X3N A;  2M05 A;  5H1S E;  1VMP A;  2RSO A;  3K7U C;  4QY7 A;  2KBN A;  4WJW A;  4CHT B;  1EUC B;  1KJI A;  4IUT A;  1TU2 B;  4Q5V A;  2B8G A;  2XC9 A;  2K5W A;  2HGS A;  3SEB A;  5JPN C;  1B6S A;  5LHY 1;  4QMG A;  5GAH C;  3J81 i;  4CJ2 C;  3S1N H;  4HNT A;  3CKI B;  1FR3 A;  3J7A 5;  4JI5 Q;  4JI3 H;  5ELF A;  3ORQ A;  5EGT A;  4A93 B;  3PO3 B;  2ENB A;  2LMC B;  2SNM A;  2XNA C;  3H3V I;  3FP9 A;  2HJW A;  1UNS A;  4C5B A;  5BPF A;  3J81 W;  4HIK A;  2CWP A;  4KLK A;  1CA6 A;  1MJC A;  1K83 H;  1HNW L;  2O5J C;  2JJQ A;  2SNS A;  3E5N A;  5G3L F;  1JE4 A;  2CWA A;  3J81 E;  2BDO A;  4TV8 F;  3GTM A;  2E2H A;  4YCU A;  1C4Q A;  5EDW A;  3RBE A;  4HCE A;  5DG8 A;  5IP9 G;  2R87 A;  3RIZ A;  2IMW P;  2JYO A;  1QCB D;  5KNB A;  2E2H B;  3QOL A;  1TQO A;  4QB4 A;  1I7L A;  4DUY H;  4K5W A;  4HJA A;  5EZY F;  1JQY D;  1H9J A;  2FMM A;  4KKS A;  4JV5 Q;  3OSN A;  3TS0 A;  2L15 A;  1SE2 A;  5KRU A;  2B8F A;  1PTO H;  2BA1 A;  4IFD G;  1X3P A;  1N33 H;  1WFQ A;  2LS0 1;  3K0Y A;  1BCP D;  4ZOL F;  3V6K A;  3N6R A;  5T1I A;  2B63 B;  3ETH A;  4JI8 L;  4A3F B;  1SEI A;  2KUM A;  2R85 A;  1FD7 D;  2W7P A;  4FF2 A;  4IFD I;  3I55 A;  5L1I A;  3SI8 A;  4XYQ A;  1MBY A;  1DJR D;  4J1M A;  2ZTC A;  2K28 A;  5COY A;  2DGY A;  2KED A;  4GN3 B;  2J6S A;  1HQM C;  4DK1 A;  4IAL A;  1UWV A;  5IGF A;  3I56 A;  4UP8 A;  1PH5 A;  5EOY A;  1Z2O X;  1RTO A;  4RUA A;  2B2V A;  3VR5 A;  2QIL A;  3VA7 A;  4FBT A;  1X3G A;  1X54 A;  3T51 B;  2HT1 A;  1QNK A;  1NUC A;  3J7A F;  3JZI A;  2AU0 A;  5IY0 A;  4DUY Q;  4PWQ A;  5KFU A;  1GSH A;  1F2Y A;  5KFQ A;  2QYZ A;  3N41 B;  4KK7 A;  4J9R A;  3U9T A;  5DM6 3;  2EYJ A;  1HR0 W;  4EQO A;  5EAY A;  3MR6 A;  4YBZ B;  1QB5 D;  4QIW A;  2VW9 A;  1EUJ A;  2B2V C;  1M6V A;  1MD2 D;  4RWS C;  4FNF A;  4CKC A;  3A5Z B;  1ICF B;  3H6M A;  4MTD A;  4NXN H;  4HR7 B;  1CE8 A;  4XQJ A;  3CU7 A;  1HFG A;  2EVB A;  4L5T A;  1O7I A;  4BBS G;  1GGO A;  1CSP A;  4P72 A;  5A2Q E;  2YW2 A;  2ASB A;  4R9W A;  2BE5 D;  2ZTD A;  1NY4 A;  3GO5 A;  3GIL A;  2W8K A;  5GAE C;  3AFP A;  2HCC A;  1WD1 A;  5CV8 A;  4PMC A;  4DV4 L;  5BMV F;  4DAY A;  1Y1W B;  4Q45 A;  3X3M A;  4MHE A;  2A73 B;  4UCS A;  3GTO A;  4LFC H;  3HOU B;  2W6O A;  1SJH D;  1NBW A;  3STB C;  1TKW B;  3IFT A;  4HNU A;  2R92 G;  5C0X I;  2OTL A;  3M9N B;  2YRW A;  1SAP A;  2K50 A;  4K14 A;  4G7Z C;  1STE A;  4HED A;  5CGK A;  1HNX Q;  2UXC H;  4CDC C;  2X6G A;  1O78 A;  1C48 A;  2V9W A;  3Q1K A;  2RA4 A;  1SE8 A;  4OHJ A;  3VYS A;  2J0T D;  1YNJ D;  2RDG A;  5D3I B;  3ETJ A;  1BXT A;  5LMN Q;  1SN8 A;  2AMC B;  3CCU A;  2F0U A;  1J5E L;  2ASL A;  3CHB D;  2R7N A;  4DL3 A;  2ASD A;  3K5I A;  4GKK H;  5KFZ A;  2EJM A;  1IBL H;  4X3T A;  1GUN A;  1F2L A;  2IX3 A;  1ET9 A;  5BN5 A;  4C3I B;  4UCV A;  3J80 i;  3D8G A;  4JI0 Q;  1K1Q A;  1VQI A;  5ELB A;  4BXX G;  3HOY B;  1EOT A;  1OXU A;  5LMU H;  3V96 A;  1B7Y B;  3W2D A;  5CV7 A;  3V4S A;  5F9N A;  1VQN A;  4LFA Q;  4FP5 D;  1X32 A;  3DEP A;  4AQY L;  1U0L A;  4OIJ A;  1KNA A;  4PZ7 A;  4EBE A;  5IIF A;  4A93 G;  3HEJ A;  1VQ9 A;  1N36 H;  2YTX A;  2L11 A;  1WTX A;  3PIP A;  2JA5 G;  5T1G A;  3HKZ A;  4JI3 L;  1QVG A;  4A3C H;  5IT9 E;  3H09 A;  2JA9 A;  3SDZ A;  2VUG A;  5GAD C;  1B4O A;  3MZ5 A;  4BA2 I;  1C3O A;  3IN5 A;  1I4G A;  2ALY B;  4CC6 A;  1X3F A;  5L1L A;  1I4Q A;  1E4G T;  2YYZ A;  3RGX A;  2GPS A;  1HA6 A;  1IBM L;  5J2T F;  4JV2 A;  4JI7 Q;  1TWH H;  1OTC A;  2PBZ A;  1ZET A;  2A6E C;  3K5O A;  4JC0 A;  5I6Y A;  4A3G H;  4F4Z A;  4DV0 H;  4DR2 H;  3GTQ H;  4YWL A;  4OEM B;  4ED8 A;  4A3E B;  3JAM i;  4YR0 A;  1JB3 A;  2PPB C;  4JBM A;  4DR7 Q;  1W6K A;  4GOP B;  1KXL A;  2NU7 B;  1HNZ H;  4LF5 H;  2F0H A;  3RZO B;  3R23 A;  2KVM A;  1FJG Q;  3S9W A;  5D65 A;  1TS3 A;  4WRD A;  3DMU A;  3GV3 A;  2A1A A;  3K80 C;  1YJW A;  4DR7 H;  1PRT B;  5L1J A;  4DK0 A;  4R4T A;  4U68 A;  1JKJ B;  4QW8 A;  5AJ3 Q;  1EEF D;  1GD7 A;  4KV6 A;  4DV2 Q;  5DQH A;  3DLL A;  1EIF A;  3EQL C;  4K2L A;  3I4N G;  3NSW A;  4K2K A;  3W1B A;  1IBM Q;  1JDE A;  2EJF C;  2QKI C;  4IZO A;  4HN7 A;  4OO1 H;  1B8A A;  1T9H A;  2B2Y A;  4IRC A;  2YRX A;  2R7Z G;  2HUG A;  4YHH H;  2BQU A;  4IUP A;  4GOP C;  2W6Z A;  2J6U A;  1U4P A;  5IYD H;  2JA7 B;  1N34 Q;  1D5X C;  1U9R A;  1AH9 A;  2QEJ C;  1GO3 E;  4KHP H;  2IX0 A;  3T1H H;  3BDL A;  2JQO A;  3GP7 A;  2YZG A;  3BQ1 A;  3GIM A;  1KQS A;  1SFO H;  4A76 A;  3EJI A;  5FO9 B;  1S9F A;  3UDI A;  2K52 A;  4C3H B;  1QZG A;  2R7L A;  1A2U A;  4QF4 A;  1S5F D;  1VQK A;  2GVB A;  4TVA B;  2E5L L;  1ONL A;  2E2I A;  3L7Z C;  3VA5 A;  5C3E G;  1EZ1 A;  3E9H A;  5M5Y B;  3DM3 A;  2VQF Q;  2WKD A;  1RK5 A;  3RF2 A;  3L4J A;  2F4V L;  5K36 H;  3V6H A;  2WDT A;  4X3U A;  3MR2 A;  3H3V H;  4YAJ B;  4NXN L;  5E4X A;  1PH9 A;  3FDT A;  4JI4 Q;  1I94 Q;  4GLX A;  1J5E Q;  4LUZ A;  1DXM A;  3HOW H;  3UFX B;  4OIK A;  4EG0 A;  4RG1 A;  3PW0 A;  3IL8 A;  1YJN A;  3JRX A;  5JJL A;  1XDN A;  5I47 A;  2R7Z A;  3C3L A;  3U4V A;  1S0O A;  4XZ3 B;  2VQE L;  1K3B C;  2FK3 A;  2OCE A;  1K8O A;  4Q44 A;  5KEE A;  1CQI B;  3G48 A;  2AWN A;  4XXE A;  2QK4 A;  3K59 A;  1VQJ A;  1W3S A;  1LT6 D;  4JV5 H;  1K8A C;  1JJG A;  2UVV A;  3KLW A;  5K5P A;  2EXZ A;  3A55 A;  3I2Z A;  4QL5 A;  2BDN A;  3GTG H;  4GN5 A;  4TSS A;  4FS2 A;  2RKS A;  1IYV A;  4GNX A;  1M8A A;  1E3P A;  4LWC A;  3LWE A;  3JAM L;  4ZCK A;  1NNX A;  3CC7 A;  4YHH Q;  4I7H A;  2NVX A;  1KL9 A;  3H20 A;  4B3S H;  3JC6 6;  2EYM A;  5KFG A;  4IUN A;  1QZH A;  4L1K A;  4JI1 L;  3KFU A;  3ITP A;  3DWQ A;  2NVY B;  2VXW A;  3HRZ C;  4DK6 C;  1UC9 A;  3HB9 A;  3WO0 A;  4H44 C;  4O3O A;  2C5C A;  3J7Y W;  5KFR A;  2BCO A;  1S0M A;  1ENC A;  2EIF A;  3PR5 B;  3KAL A;  3D3R A;  3NBH A;  1SE3 A;  3LX0 A;  4DPG A;  4WD3 A;  1LV9 A;  2HQE A;  4A3M H;  3HP3 A;  2I87 A;  2B2U C;  2PQE A;  5EBC A;  4A3I H;  1TAE A;  5BR8 H;  4RNN A;  2WB1 E;  4O1N A;  1Q12 A;  3TN2 A;  1TWF H;  4DR5 L;  1DOM A;  2IL8 A;  2YZN A;  1WI5 A;  3MA2 B;  3G6E A;  5GON F;  5KKN B;  4ECW A;  4PMB A;  1WCM H;  1ASY A;  3BA9 A;  2I5L X;  5EPK A;  4B3M Q;  1JWM D;  2IP4 A;  3K58 A;  2C2R A;  4MTN A;  4LF4 Q;  5C4X H;  1KDC A;  5CV6 A;  5I9P A;  1DZ1 A;  1BUV T;  1M7J A;  4DV5 Q;  2LFN A;  4QWD A;  2F52 A;  3KHR A;  4JI1 Q;  5C3E B;  2BR0 A;  1XNQ H;  2FIN B;  2R61 A;  2FKL A;  4MN3 A;  3Q2O A;  1VQ6 A;  3T5J A;  3C1F A;  4LW1 A;  3C0F B;  4NPS A;  3HKZ E;  4NXM L;  1TWA A;  5HBR B;  1E4E B;  1VBH A;  3G8C A;  5M5X H;  3BVZ A;  4A3F H;  4EYI B;  2Q8T A;  3KOJ A;  3LGJ A;  1S5C D;  4DV7 Q;  1CZW A;  4CKE A;  1F9P A;  4JI3 Q;  2OWO A;  3Q8Q B;  5JAV A;  5CAE B;  4OGQ C;  1XWE A;  2ZJP A;  2I8C A;  5EKI A;  2E5L Q;  2IJ0 A;  1II3 A;  2Q2U A;  3N44 B;  5AFW A;  1GSA A;  3CVZ A;  2MUY A;  1EIG A;  3BAB A;  4B9W A;  2ASJ A;  5KT7 A;  3HKS A;  3ORR A;  1I4X A;  4ED6 A;  3TRE A;  3GTL A;  4RB3 C;  1GKH A;  2VB3 X;  2K5D A;  4J0M A;  4RGN A;  1B2T A;  5C4J H;  3RD4 A;  5KNC A;  2DJG C;  3R3O A;  5IYC H;  5KFY A;  4O2B F;  3PN1 A;  1IXR A;  2F0W A;  2UXB H;  2Q2H A;  1U4M A;  2FJ2 A;  2PVP A;  2OH2 A;  3FKI G;  3AFQ A;  2Z1C A;  4P74 A;  1M0T A;  2A5H A;  2DJF C;  3J80 c;  2CW7 A;  2FHT A;  1XTD A;  1QUQ A;  4CBV A;  5C0X H;  3T56 B;  3F2D A;  1JB7 A;  4ECU A;  3DWA A;  1NSN S;  1BR9 A;  1W6J A;  1R9T B;  2L4N A;  2FP4 B;  3F2B A;  2PZW A;  3HZX A;  1B33 N;  4KHZ A;  2DIK A;  2BA0 A;  4I4T F;  5C44 B;  2E8G A;  3OYY A;  3RFC A;  4WJ3 M;  2R3Z A;  3MWD A;  3FRP B;  3D6W A;  3SXH A;  1TT2 A;  2E2I H;  4F8M A;  3T1Y L;  3MJF A;  2KA7 A;  3S1R B;  3CCS A;  3GTL H;  1EWH A;  1LTA D;  2G9H D;  4CDE C;  1RJR A;  5KFB A;  1RJT A;  1EU3 A;  1KIX A;  4I7Z C;  3T5H A;  5C3X A;  5JVH 3;  2PZT A;  5CV5 A;  2SEB D;  3NQI A;  4R4O A;  3CRL C;  1XX8 A;  3FEW X;  1UC8 A;  3V2T A;  4AYB B;  5KYI A;  3VYR A;  1VQ5 A;  2R84 A;  2YV5 A;  3S1M H;  4GZY C;  4A3E H;  4LF8 H;  1EQT A;  1TR5 A;  1Z2N X;  4DV3 H;  1N32 L;  5M5W B;  3GIP A;  1KC8 C;  2EYP A;  2DPI A;  4IFD J;  3H4D A;  1CQV A;  3DUZ A;  4XT1 B;  5DG7 A;  1VQO A;  3H0G B;  4C3J G;  4X62 L;  1U5K A;  2PCF B;  1T3N A;  1TWC A;  3FMA A;  2W70 A;  2JA8 G;  2GN5 A;  4KY6 A;  5GRO A;  5LMN W;  2NUC A;  2PYK A;  3T1Y Q;  2MGS A;  4P2C B;  1A9X A;  2N3S A;  5CC4 A;  2B2W A;  2WAQ B;  1IBK H;  1BF4 A;  1SYC A;  2YS6 A;  3GIK A;  1HPC A;  5DNF A;  1STG A;  1LT3 D;  1QVF A;  4OO1 G;  2NWG A;  4KTA A;  2Z6B A;  3OIQ A;  1IL8 A;  5ELN A;  3AYH B;  2R8H A;  1H9K A;  4A3M B;  2AUK A;  4QUF A;  2W9C B;  4LF4 H;  2KEC A;  4RUC A;  2K14 A;  5F2D A;  2AHO B;  3WOF A;  1HNX H;  1GUG A;  4Y7N H;  1T5X D;  1TWF B;  5EKK A;  1TS5 A;  1LTL A;  3UI2 A;  4MV3 A;  2JEJ A;  1VF5 C;  4OXP A;  2E2J H;  5CV9 A;  4POG A;  4GLA C;  2TSS A;  1KJJ A;  4HMI A;  2XIG A;  4HJ5 A;  4RU9 A;  3V6J A;  2F0P A;  1CKN A;  2CVR A;  4C1N I;  4LF5 Q;  3KHL A;  3L2P A;  3V05 A;  2Y0S B;  4DL4 A;  1L1O A;  4ECS A;  4GKJ L;  2Z6K C;  3RNU A;  1KAA A;  2E74 C;  1YNN C;  5IYB G;  1SNO A;  1VQC A;  1JX4 A;  4J9M A;  2RVL A;  5LMU L;  5J39 A;  1P8L A;  4POF A;  1B1Z A;  2WKC A;  4ED7 A;  3PUV A;  3TSS A;  1EY7 A;  4LJZ C;  4KHP L;  1TWA H;  1Q81 C;  3KDF B;  1TY0 A;  4S3S A;  4RH6 A;  3TII A;  1WJJ A;  3K5L A;  1LT5 D;  1SND A;  1DCZ A;  1NJI C;  4LNQ A;  5A2Q W;  1B3A A;  3TP5 A;  1Z2P X;  2E5L H;  4B3R H;  3RN5 A;  5M3M B;  2C35 B;  1HH2 P;  1SEB D;  4PV1 C;  1HHV A;  2E75 C;  4JI6 Q;  4LFB L;  4DKA C;  3HOV H;  3BZD B;  5C1P A;  5DG9 A;  1KJ8 A;  1OO9 B;  4YWK A;  4YB8 B;  2AGO A;  1XMO L;  4QW9 A;  2P0A A;  3OUZ A;  4IO9 A;  4DR3 Q;  1PFS A;  3HKZ G;  1JR0 D;  2WAC A;  4QWC A;  1GUT A;  5BPH A;  3CCL A;  4CJ1 B;  1F2Z A;  1EQR A;  4BY7 H;  2RCN A;  5KT2 A;  5COR A;  3RAQ A;  1HNZ L;  1AE2 A;  3N40 P;  2I07 B;  2B2T A;  4O4L F;  5KG7 A;  2GVA A;  3CME A;  4IOA A;  4DV5 H;  2FMC A;  1Y8P B;  4BY1 H;  3ULJ A;  4GN4 B;  1BJT A;  1JOQ A;  1ULZ A;  4HNV A;  4DV2 H;  4JV1 A;  3PIP 3;  5FPO A;  5KFX A;  5JPM C;  1SMY C;  1Y1V A;  3H91 A;  2B29 A;  3QB3 A;  1KNE A;  1PYS B;  4X62 Q;  3MHB A;  4LSX A;  2O03 A;  1A62 A;  1SRO A;  3HOV B;  2JEI A;  2XGQ A;  4ODG A;  2XWJ B;  2RDH A;  2B3G A;  1N34 H;  1EOV A;  3PO3 G;  1NE3 A;  5I4D A;  4JI7 L;  2VOB A;  2HDM A;  1A3T A;  4RZR A;  2KCM A;  5EKL A;  1T36 A;  3S2H B;  1ILP A;  4L5Q A;  5IWA H;  4KN7 C;  2XCA A;  1KTK A;  5IYD G;  2G9D A;  3GTQ A;  2FPG B;  5EWE A;  2AQ3 B;  4DXG A;  4QJF A;  2YTY A;  3M85 A;  5J1Z A;  2CCZ A;  3BU2 A;  4MNO A;  4V0B A;  4JI5 H;  4YY3 L;  2PQA A;  5LL6 S;  3D31 A;  2QDB A;  3BZC A;  5L1K A;  5JUM A;  4U6P A;  3EA6 A;  1X3Q A;  3MVV A;  2PO4 A;  2VUM B;  3CCM A;  2J4X A;  2E2D C;  1HZC A;  1GXD C;  2BH2 A;  1VKZ A;  4BBR B;  3J80 L;  4A3B H;  1DV2 A;  1L2Z A;  3VDY A;  2UUC H;  2R7D A;  4R4Q A;  3GD7 A;  4A3D G;  5IT9 L;  1IZ6 A;  1I94 L;  4B3T H;  5LL6 b;  4YQW A;  1WCM B;  5EPJ A;  5IWA Q;  2FFK B;  3KBG A;  2DLN A;  3HG9 A;  4C2M H;  3SR1 A;  4A75 A;  1SFO A;  5IE8 A;  5IP7 G;  5KG4 A;  3CCR A;  5FO8 B;  5KYL A;  4DLK A;  2E2H H;  1YIJ A;  1CQF A;  1K83 A;  3QO2 A;  1ASZ A;  2JA7 G;  4N8X 1;  5HUR A;  3S16 B;  4FYD A;  2F1M A;  4ECR A;  1AE3 A;  4UY8 C;  1OXX K;  4ECV A;  1HNW H;  3J80 E;  3CCE A;  1XTC D;  1WSC A;  1QOH A;  4IJH A;  4IWY A;  1RIP A;  3KF8 B;  5E1F A;  1D1I A;  3QZ7 A;  5C44 H;  2RQX A;  2EYH A;  4LF7 Q;  3OPO A;  1SE4 A;  4LFC Q;  4IHJ F;  4O3S A;  2JA8 H;  3S1N B;  4HSV A;  1G2T A;  3G6J B;  2O5I C;  1Q8I A;  4DUY L;  4IRD A;  1V1P A;  4KN4 C;  1LTB D;  4XX0 B;  1L0W A;  1ET6 A;  3PO3 H;  4IOC A;  4R8U A;  3RN2 A;  5KFV A;  2VUM G;  2HCI A;  2PNH A;  3KBX A;  5CV4 A;  5DLG A;  5ELO A;  1HXY D;  4IUV A;  2CKZ B;  4R8I A;  2HD3 A;  3G6X A;  4GC6 A;  1N9W A;  3MFY A;  1LLR D;  2PMZ A;  1EQV A;  2K4K A;  1PRT F;  2W7O A;  4V19 0;  3GTK A;  3MWE A;  1UEA B;  4ECT A;  4DF7 A;  2JA5 A;  2IY5 B;  2R8G A;  2XCP A;  5IOC A;  3KF6 B;  3EYY A;  1Q7Y C;  4G57 A;  1XXG A;  1HR0 L;  3PW5 A;  4G7H C;  3IKJ A;  2V4D A;  2YU9 B;  3S17 H;  1LT4 D;  3GQB A;  1LO5 D;  5JVD F;  3CW2 C;  1CI3 M;  1NR2 A;  5KG5 A;  4NXM H;  1BXR A;  4ECZ A;  4R1J A;  3R5X A;  3FKI H;  1JE5 A;  3NPP A;  2IHF A;  2ZDG A;  3PMF A;  5I2Y A;  3NE5 B;  4H0L C;  5KFP A;  5M3M H;  4JYA L;  2W71 A;  4ZK9 B;  3OMG A;  3GV6 A;  3NWS A;  1EQQ A;  1JLL B;  3JAM c;  3WOE A;  2XGT A;  3VR6 A;  3U4Z A;  3HOY G;  5I2X A;  4BBS H;  3S1R H;  3SVM A;  1I4R A;  5IGG A;  5IGD A;  2NU8 B;  2VPQ A;  1GOZ A;  3T13 A;  1D1K A;  4QGU A;  4J9N A;  1I50 A;  4RA8 A;  2XWB B;  5EWF A;  3AMU A;  3RGZ A;  2F0F A;  4KJN A;  4A93 H;  4JBJ A;  1H9S B;  3TBI B;  4R4C A;  3GQC A;  3GV5 B;  2IBK A;  5HGQ A;  4J9K A;  3KJO A;  2JA6 G;  2R93 G;  1K0R A;  2D0P A;  3KAJ A;  1O7Z A;  2A6H D;  5D1O A;  4HIM A;  1A3U A;  4KJO A;  1Q90 A;  5KFS A;  3H0G H;  1B50 A;  3I4M B;  2FK1 A;  4ECX A;  3MFI A;  4K5V A;  4GS3 A;  1ICW A;  4DV6 Q;  1CKM A;  1IBK L;  2NVT H;  1YEZ A;  4C3H G;  3FKI B;  4RGO S;  2YTV A;  3WWV A;  1VQL A;  3KUP A;  1JIH A;  4YIJ A;  3RB0 A;  1YNJ C;  4BY7 G;  4B3T Q;  4QQB X;  1I4P A;  1QIL A;  2F4I A;  1VQP A;  1CHP D;  1EYC A;  2I80 A;  3CQZ A;  5C4J B;  1PV4 A;  2UUA Q;  5EJW A;  4QUC A;  1KC7 A;  5I9O A;  4IPC A;  1RDP D;  1KEE A;  1OXT A;  4LF7 H;  1YNX A;  3MXP A;  3RB4 A;  1PH6 A;  2HQL A;  3SK8 A;  2VS1 A;  3FKI A;  1HTP A;  2OF1 A;  4P71 A;  1N48 A;  2K5Q A;  4YY3 H;  5JEA J;  4ZUI A;  4X65 L;  1AW7 A;  4Q0Y A;  4OWT B;  1WTR A;  5D1O B;  2KCN A;  5KFW A;  2N49 A;  2SCU B;  3DEO A;  1HUN A;  2A74 C;  3BAA A;  2MP1 A;  2ZJQ A;  4DL6 A;  1CS0 A;  2LXJ A;  2HHH Q;  3I4O A;  2K01 A;  2Q2I A;  4LK1 C;  3TDQ A;  1R9T H;  4RB0 A;  2R8I A;  1BVS A;  4C2M B;  1PH1 A;  5DGB A;  1YHB A;  1EUD B;  4APM A;  5DGA A;  1I50 B;  3MAQ A;  5JJZ A;  4K0K Q;  4LUV A;  3S14 B;  4M7E A;  1TWG A;  1X9N A;  1GHK A;  3WNZ A;  4C5C A;  1I94 H;  1EEI D;  1TXY A;  3I3C A;  5KX5 F;  4G7O C;  1G51 A;  2XN9 C;  3TQ1 A;  4EGJ A;  4OWX B;  3STB D;  3HOY H;  2V59 A;  3E6Z X;  1PH4 A;  3TZU A;  1JJ2 A;  4CC5 A;  4E4T A;  2K32 A;  1EL0 A;  2R7M A;  3R2T A;  3S2D H;  1QVC A;  3R5F A;  1UEB A;  5KT6 A;  4DR2 L;  3TRZ A;  2WAQ G;  3F1Z A;  2JEF A;  4RCO A;  2HVQ A;  2OLS A;  1HNW Q;  3S16 H;  4DAV A;  4MIU A;  4AIM A;  3OHB A;  2YU9 A;  2HDL A;  1E4F T;  1Y1V G;  3MXN B;  5C8Y F;  1KJQ A;  4FBU A;  2DNE A;  5H80 A;  5FLM G;  4FS1 A;  3TIG A;  4ILW A;  1VQA A;  1CSQ A;  4DNI A;  1IBL Q;  1I50 H;  2KCT A;  3CD6 A;  2JA5 B;  1SRU A;  1J5E H;  3S14 H;  2EZV A;  3RLO A;  4X6A H;  4EBD A;  1STA A;  5C4X G;  2A68 D;  3HOU H;  3A7A B;  5D1P A;  2VZA A;  4IUU A;  4UPA A;  2PMZ B;  1XMQ L;  4O3P A;  4LMQ D;  4MA0 A;  2F0S A;  1P16 A;  1MKH A;  1AEX A;  5E3F A;  4ALP A;  1XNQ Q;  1TS2 A;  1RK6 A;  2BQ3 A;  4O0A A;  3EVQ A;  4Q8E A;  1RTN A;  3FVQ A;  2VA2 A;  3L3O C;  1EWC A;  3K3V A;  1WTQ A;  1AUV A;  2R92 H;  3M7G A;  4EVO A;  1RL2 A;  4JBW A;  4A3J G;  4FXD A;  4UDU C;  4B3R Q;  4F4Y A;  4KHV A;  4JOI A;  1V1P B;  4MTK A;  5CA0 F;  3BQ2 A;  3KXY T;  3CRK C;  4BBR H;  2K05 A;  4F88 A;  3AQQ A;  4HTH A;  3H15 A;  4JI0 H;  1PDQ A;  2E2J B;  4H13 C;  2SDF A;  3S15 B;  3HOX B;  3EPG A;  4NP5 A;  5KFT A;  2XIW A;  3CXC A;  2DZD A;  3KF8 A;  5M5X B;  3NUC A;  4O4I F;  5C4H A;  1PTO C;  1UE7 A;  5DM7 3;  1EU4 A;  2OQ0 A;  2K5V A;  4IUR A;  3KTM A;  3BQ0 A;  4DR1 H;  1J9O A;  4ECQ A;  1SXT A;  1RJQ A;  2O4X A;  2I5M X;  1IBM H;  1BOS A;  4IJL A;  3RUP A;  2RF4 A;  3M4O B;  2JSO A;  2JA7 H;  2R7F A;  4PG3 A;  2V1C C;  1M1K C;  1HZB A;  2NVQ B;  2PW7 A;  3ERO A;  5BN4 A;  3E0J A;  3J81 j;  4B3R L;  3PW7 A;  4ZYS A;  5FJ8 G;  1ZKO A;  3P75 A;  4LF5 L;  2R92 B;  3PVX A;  5FLX L;  3PW2 A;  4J9S A;  5TSS A;  3PV0 A;  2YYA A;  1BBU A;  1K1S A;  5FLM H;  1VQM A;  4A3K B;  1A6X A;  2E76 C;  1PTO B;  4JI6 L;  1KLG D;  3E3X A;  4LFB Q;  4UCR A;  1LTT D;  2WB1 B;  4JV5 L;  2D0O A;  1WH2 A;  1FVI A;  3Q23 A;  1AUX A;  1I3Q B;  3KLS X;  1Q8K A;  3TS2 A;  2W9B B;  3UDX A;  5FO7 B;  2RGR A;  1OXS C;  3Q6S A;  1Y1V H;  2RCF A;  5LA6 F;  1J6Q A;  1L0Y B;  3N8D A;  3MR3 A;  3M4Y A;  5K2M A;  4AYB E;  4FF4 A;  4EQP A;  1B44 D;  3F2C A;  2ATW A;  4B3S Q;  1MSH A;  1UAP A;  4LF9 L;  1UUP A;  2B2Y C;  2PW5 A;  3VR4 A;  1VAJ A;  2FPP B;  4ZKB B;  1VBG A;  4DV6 L;  2VQE H;  1PXU A;  4TKO B;  1IBK Q;  1PK8 A;  2UU9 L;  3KYH C;  3GTP B;  3OHX C;  4H02 A;  3CP0 A;  3J80 W;  2R8K A;  1K73 C;  1X6O A;  2JA5 H;  2AWO A;  4JI1 H;  4ULL A;  3I4L A;  3HOZ B;  3GTQ B;  2L12 A;  3EBE A;  1KJ9 A;  1ZHQ A;  1JJC B;  2H4O A;  3U9O A;  3GTP A;  4A3K G;  1FGB D;  2XRS D;  5KFI A;  3CC2 A;  2J9G A;  2F0I A;  1PA6 A;  3ICE A;  4K8J A;  2B2U A;  3CQZ H;  4Q0F A;  1N8R C;  3UDG A;  2YS7 A;  5CMD A;  1K3R A;  2PMZ E;  3AU7 A;  2NYZ D;  2F0N A;  2JEB I;  3BJY A;  4MV8 A;  1FGU A;  1PFB A;  4OL7 A;  4C56 C;  5KG6 A;  1LYL A;  4RNO A;  3I70 A;  4IPG A;  1BCP C;  4LF6 L;  2KEE A;  2W9B A;  4TQS A;  1I3Q A;  1VQ8 A;  2NN6 I;  2JEA I;  3BG3 A;  1B04 A;  4QIW E;  1F9S A;  2WB1 A;  1JOK A;  4UCO A;  1WR2 A;  4A3F G;  2H5X A;  5FOB B;  1E0B A;  1ENF A;  2VR1 A;  4UP9 A;  1MIU A;  4Q43 A;  1EYA A;  4G3I A;  4X65 Q;  1TWG H;  2HIV A;  2K04 A;  3GTJ H;  1G6P A;  1GHJ A;  5KT4 A;  2R92 A;  1YIT A;  1IL2 A;  1SBB B;  5BR8 L;  1YJ9 A;  4A3I B;  3MC0 B;  1E7Z A;  3OSO A;  1F2M A;  5C1O A;  1KRT A;  2VNU D;  2VY3 A;  1DD2 A;  2ZTE A;  4TUY F;  1FJG H;  2D2C C;  1G29 1;  3EFX D;  3CC4 A;  5L37 A;  1WOC A;  3RLF A;  2MHV A;  4JPB W;  1EZ6 A;  3HOV G;  1LUZ A;  5K36 G;  1WTO A;  4DR2 Q;  4LAA A;  3QZ8 A;  5E4W C;  3NEN A;  2WFW A;  1N56 A;  3NXW A;  2PNR C;  4ZAI A;  3S17 B;  3K7A B;  4K0K H;  1YVC A;  4M8A A;  1S4Z A;  2ZDQ A;  3N6X A;  3QR8 A;  4JI8 Q;  4MTE A;  3PF4 A;  5C4Z A;  1MI2 A;  1EY4 A;  1JOR A;  1GLV A;  4AQY Q;  1MHW C;  3BJU A;  3D6C A;  4IUQ A;  3EN2 A;  1G2S A;  2Z9H A;  3CPW A;  4J9P A;  2F03 A;  1KLU D;  3BVM A;  3MEF A;  4DU9 A;  1EFW A;  2XGP A;  2AGP A;  3GII A;  3NGD A;  2QEX A;  5GAG C;  3HXL A;  5EQ0 A;  2NN6 H;  1L1O B;  1WTV A;  1VS0 A;  1ESR A;  2OXP A;  3QFF A;  1C30 A;  2WV6 D;  2V4Q A;  1IOW A;  4RB1 A;  2VL6 A;  4DL7 A;  1NTG A;  2IPK D;  1XNQ L;  5ELC A;  1Y8O B;  3IRB A;  5M9O A;  2DPJ A;  1Y14 B;  3MXN A;  4X3S A;  4F7X A;  1Q1B A;  1E2W A;  3S24 A;  2M00 A;  1PH8 A;  2YCH A;  3SK5 A;  5KGU A;  3A0J A;  3C46 A;  2NZH A;  1HZ9 A;  3S15 H;  4DR3 H;  3TP7 A;  3NP8 A;  1Q3L A;  1EY8 A;  2H1E A;  2ZM6 L;  2NVT B;  4LH7 A;  2W9C A;  3T1Y H;  1CK1 A;  2JK8 A;  4KI0 A;  1PX2 A;  1SYG A;  4LF7 L;  5KFH A;  1V51 A;  1D6E C;  1SMY D;  2HVR A;  3C1E A;  1WCM G;  4RZQ A;  3W1G A;  2PI2 E;  1TWG B;  2F3V A;  1JWS D;  5CR3 A;  4XQN A;  3VPD A;  2UUB L;  2RDJ A;  2HVS A;  3K5N A;  2FLL A;  4IFD H;  2RSN A;  4KY5 A;  2FLP A;  4DFA A;  4C2M A;  2FE3 A;  4JYA H;  1TWC B;  4HQ6 A;  3H0G A;  1STB A;  3RBD A;  5NUC A;  2XCL A;  2MCT A;  2DY7 A;  4EFB A;  5DQI A;  5LXT F;  3OHA A;  1YBY A;  2Z0S A;  1V43 A;  4JI2 L;  3E5S A;  1IW7 C;  1Q46 A;  4RMF A;  4XDX A;  1AZQ A;  5LMN L;  4ETS A;  3H3V C;  1V8Q A;  3UE0 A;  2DUD A;  4AYB A;  1E1O A;  3U9S A;  1BNC A;  3RB6 A;  2NBF A;  2EYF A;  2KHS A;  3PIO 3;  3CQZ B;  3I7F A;  4LUO A;  3OWE B;  2VPS A;  5M5Y H;  3QJY A;  3BS1 A;  1B6R A;  1VQE A;  3HBL A;  4B3S L;  1PTO F;  3R5H A;  1PYW D;  2R6F A;  4MV9 A;  2EDG A;  4LFC L;  3HOZ H;  1FYC A;  4JI4 L;  4RKB A;  2ES2 A;  3S2D B;  2C00 A;  1Z9F A;  1S0N A;  2ID0 A;  4I55 F;  4HJ8 A;  5IYZ F;  3OW2 A;  1SNQ A;  5C5J A;  3ND9 A;  1R9T A;  2JA6 H;  2R93 H;  3N52 A;  5KFJ A;  3GIJ A;  2MO1 A;  3PUY A;  4IPD A;  5C5L A;  3Q8S B;  1TS4 A;  3E0E A;  3K81 C;  3ZJY C;  4JBK A;  2EXD A;  1CKO A;  2L5T A;  3PGZ A;  1XYI A;  5IYC G;  1H9S A;  5DQG A;  3CCQ A;  3WO1 A;  1MJE A;  3ULP A;  1RHP A;  1I5F A;  1QWY A;  1XJV A;  2B63 H;  4EEQ A;  2NVQ H;  1HNX L;  4J8Q A;  3K8A A;  4FVM A;  4GKK L;  1N32 H;  3OTO Q;  3KAK A;  1UE1 A;  4BS9 A;  1XPO A;  3GTK H;  2Q8I B;  4ZQI A;  5ELE A;  1S03 G;  1YHQ A;  2TMP A;  4LF6 Q;  2EJG C;  1CM9 A;  4A3K H;  3PUX A;  4C3I G;  1GUW A;  3RAX A;  5KT3 A;  4IQZ A;  2F0E A;  3HGB A;  3AB9 A;  3B6Y A;  1R4Q B; 
#chains in the Genus database with same CATH homology
 3DM3 A;  2VQF Q;  3CPF A;  1VQH A;  2K5N A;  2F4V L;  4DV4 Q;  1N33 L;  3S17 H;  3S1Q H;  4APV A;  4YCV A;  3CW2 C;  2MQH A;  3H3V H;  4DV0 Q;  1N36 L;  1SLJ A;  3PCO B;  4R1J A;  4NXN L;  3FKI H;  5JEA G;  1JE5 A;  3D0F A;  2IHF A;  1FL0 A;  4P75 A;  1PH9 A;  3M3Y H;  4K0K L;  4BY1 G;  5AJ3 L;  4JI4 Q;  1I94 Q;  1Q1E A;  4GLX A;  5M3M H;  2I5H A;  4LUZ A;  4DV3 L;  1L1O C;  3W5O A;  1J5E Q;  3HOZ G;  4DR6 L;  4DR1 L;  3HOW H;  4JYA L;  4X64 Q;  4DR1 Q;  4RG1 A;  1YJN A;  3ULL A;  5JJL A;  1EQQ A;  3TEH B;  1XPU A;  3U4V A;  1CUK A;  3KF6 A;  3EIV A;  3JAM c;  2XGT A;  3HOY G;  3U4Z A;  2VQE L;  4BBS H;  2OCE A;  3S1R H;  4BBR G;  1XNR L;  2I0Q A;  3G48 A;  2ZJR A;  2AWN A;  4DAM A;  4QGU A;  3ER0 A;  1VQJ A;  1W3S A;  1X56 A;  3J81 c;  2UXD Q;  4UP7 A;  1I3Q H;  4DUZ Q;  1K8A C;  4DK3 C;  1VQ7 A;  3KLW A;  2NZO A;  1JJG A;  1SR3 A;  2IX1 A;  4C3H H;  2B63 G;  5IYB H;  4A93 H;  2EQS A;  4JBJ A;  1EYG A;  3I2Z A;  3PSI A;  4R4C A;  4BA1 I;  4YY3 Q;  1E22 A;  4QL5 A;  4A3E G;  2F4V Q;  3GTG H;  4GN5 A;  4GLV B;  5HGQ A;  3A5U A;  3KJO A;  2WB1 G;  3ERS X;  2JA6 G;  1K0R A;  2D0P A;  4GNX A;  3RZO H;  2R93 G;  1V1Q A;  3G71 A;  4HIM A;  1E3P A;  4LWC A;  5BR8 Q;  3UE1 A;  1B70 B;  3H0G H;  3NEL A;  4YHH Q;  3CC7 A;  4LF9 Q;  1KL9 A;  4KHP Q;  1VQD A;  4DR7 L;  4GS3 A;  4DV6 Q;  3JC6 6;  1CKM A;  1IBK L;  2NVT H;  1YEZ A;  1QZH A;  2YTV A;  3WWV A;  4JI1 L;  3KFU A;  2D62 A;  1VQL A;  4DK6 C;  4O2D A;  4NXN Q;  1BKB A;  4TQU S;  4C3I H;  4HJ7 A;  5IP9 H;  4BY7 G;  3CAM A;  3NBH B;  4R4I A;  4B3T Q;  4QQB X;  1Z47 A;  2EIF A;  4A3M G;  1VQP A;  4DPG A;  1Q82 C;  3CMA A;  1PV4 A;  4A3M H;  2Q2T A;  2UUA Q;  5IWA L;  4IPC A;  4DV2 L;  1LM0 A;  1OXT A;  4A3I H;  2Z6K A;  4OWW B;  1YNX A;  4JCV E;  3M4Q A;  5FJ8 H;  2WB1 E;  1PH6 A;  1Q12 A;  4DR3 L;  2HQL A;  1TWF H;  5C0X G;  2VS1 A;  4BXX H;  3HOX H;  1E1T A;  4DR5 L;  4DV1 Q;  4JI0 L;  4P71 A;  3PF5 A;  2WAQ E;  5FLX c;  5JEA J;  1WI5 A;  3G6E A;  4X65 L;  1K9M C;  4OWT B;  2CFM A;  1WCM H;  3M4P A;  1ASY A;  2I5L X;  1HNZ Q;  1TWC H;  2N49 A;  4B3M Q;  4A3D H;  3U50 C;  4MTN A;  4LF4 Q;  5C4X H;  1A63 A;  2ZJQ A;  4A3I G;  5E7N A;  2LXJ A;  2XTI A;  5LMU Q;  4DV5 Q;  1N32 Q;  2AKW B;  2F52 A;  2HHH Q;  3I4O A;  4JI1 Q;  5JJI A;  2HHH L;  2Q2I A;  1R9T H;  1BVS A;  3HOX G;  1PH1 A;  1VQ6 A;  1YHB A;  3I4M H;  4LW1 A;  4NPS A;  1NMG A;  3HKZ E;  3SGI A;  1PVO A;  4NXM L;  4K0K Q;  2K5H A;  4JG2 A;  4LUV A;  1GVP A;  2UUC L;  2UUC Q;  1KAW A;  1X9N A;  2VQF L;  3RZD H;  5M5X H;  4A3F H;  1TXY A;  1G51 A;  3KOJ A;  1X55 A;  3LGJ A;  4DV7 Q;  1VQG A;  4OWX B;  3STB D;  3GTO H;  2FXQ A;  1KD1 C;  3HOY H;  4JI3 Q;  2OWO A;  1PH4 A;  1L2F A;  2PQA B;  1JJ2 A;  2ZJP A;  2E5L Q;  2VUM H;  3S2D H;  1QVC A;  1UEB A;  2Q2U A;  4DR2 L;  3TRZ A;  2WAQ G;  3F1Z A;  4HJ9 A;  4OX9 Q;  4ME3 A;  3A74 A;  1HNW Q;  2IHE A;  3S16 H;  1HZA A;  2JE6 I;  4AIM A;  4LF8 Q;  1FJG L;  4A3L H;  3HKS A;  2QGQ A;  1Y1V G;  4DV1 L;  3MXN B;  3TRE A;  1GKH A;  1GM5 A;  5FLM G;  4XIG S;  4YWM A;  4LFA L;  1VQA A;  5C4J H;  1CSQ A;  5C3E H;  4DNI A;  1IBL Q;  5M3M G;  1I50 H;  5IYC H;  4LF4 L;  2KCT A;  1PHJ A;  3CD6 A;  1SRU A;  2N8N A;  3S14 H;  3RLO A;  4X6A H;  1IXR A;  1A8V A;  5C4X G;  2Q2H A;  4YCW A;  3HOU H;  4WJ4 A;  1KRS A;  2VZA A;  4UPA A;  2A19 A;  1C9O A;  1XMQ L;  3GDE A;  4DV0 L;  3FKI G;  1P16 A;  1MKH A;  4PZ6 A;  4NXM Q;  4ALP A;  3AFQ A;  3K7A H;  1XNQ Q;  2R7Z H;  1YHA A;  3F8T A;  4O0A A;  4P74 A;  1E24 A;  3J80 c;  1Y1W G;  4DAY B;  5M5W H;  4DR6 Q;  4JYA Q;  1XTD A;  1QUQ A;  2R92 H;  3Q8D A;  1Y1W H;  1X3E A;  1RL2 A;  4JBW A;  4A3J G;  3F2D A;  4L5S A;  3FHW A;  1JB7 A;  4B3R Q;  2A8V A;  4JOI A;  3F2B A;  4BBR H;  5DLQ E;  4KHZ A;  2BA0 A;  3AQQ A;  2E8G A;  3B6Y A;  3OYY A;  2K75 A;  5J3B A;  4X66 Q;  3H15 A;  4A3C G;  4WJ3 M;  3M9B A;  3I4M G;  2R6G A;  2UUA L;  1HR0 Q;  3AEV A;  2UXC L;  3CXC A;  3PIO A;  1SMX A;  2PI2 A;  5JJK A;  2E2I H;  1UE7 A;  2LSS A;  4JI5 L;  3T1Y L;  2KEN A;  2OQ0 A;  4AH6 A;  3CCS A;  2K5V A;  4FDB A;  1JMC A;  3GTL H;  1D7Q A;  4EQ5 A;  1DGS A;  4GOP A;  2I5M X;  2KHJ A;  2YU9 H;  2UXB Q;  1KIX A;  2MNA A;  2IT1 A;  4IJL A;  4R4O A;  1IYJ B;  1IBL L;  2RF4 A;  3S2H H;  2JA7 H;  4B3M L;  2R7F A;  4PG3 A;  2V1C C;  1M1K C;  2MO0 A;  2YV5 A;  1HZB A;  1VQ5 A;  4A3E H;  3S1M H;  3GTP H;  1XMO Q;  3KDF A;  3J81 j;  1N32 L;  3CF5 A;  4B3R L;  4X64 L;  5FJ8 G;  1KC8 C;  4LF5 L;  1N36 Q;  5H1S E;  3PV0 A;  4IFD J;  3K7U C;  4QY7 A;  2KBN A;  1BBU A;  5FLM H;  1VQM A;  4A3L G;  2OQK A;  1VQO A;  1VCI A;  4X62 L;  4JI6 L;  1U5K A;  4LFB Q;  4C3J H;  5GAH C;  3J81 i;  2GN5 A;  2D0O A;  2JA8 G;  3S1N H;  4JV5 L;  2UXD L;  1FVI A;  5GRO A;  3J7A 5;  5LMN W;  4A3J H;  3T1Y Q;  4JI5 Q;  2ZM6 Q;  1Q8K A;  2N3S A;  3TS2 A;  3UDX A;  1OXS C;  1Y1V H;  5IP7 H;  1J6Q A;  1QVF A;  4OO1 G;  4AYB E;  3H3V I;  3FP9 A;  3F2C A;  1CKN B;  2ATW A;  4B3S Q;  4YHH L;  4LF9 L;  5ELN A;  1WYD A;  2CWP A;  2HIX A;  3AYH B;  4HIK A;  4KLK A;  1MJC A;  1K83 H;  1HNW L;  2JJQ A;  3RR5 A;  4DV6 L;  1IBK Q;  2CWA A;  3HFZ B;  3G4S A;  2UUB Q;  2UU9 L;  3KYH C;  2K14 A;  4HIO A;  2AHO B;  4YCU A;  4H02 A;  3CP0 A;  4Y7N H;  1X6O A;  1K73 C;  2AWO A;  2JA5 H;  2UXB L;  5IP9 G;  1LTL A;  1JT8 A;  3EBE A;  2NVY H;  1JJC B;  4OXP A;  2E2J H;  4A3K G;  4JOI C;  3CC2 A;  4GLA C;  4POG A;  4PMW A;  1PA6 A;  3ICE A;  4NB3 A;  3CQZ H;  4HJA A;  1N34 L;  4HJ5 A;  1N8R C;  3UDG A;  4JV5 Q;  1K3R A;  2PMZ E;  3TS0 A;  1CKN A;  2L15 A;  2JEB I;  4LF5 Q;  2BA1 A;  4DR5 Q;  4A3B G;  4IFD G;  1FGU A;  1WFQ A;  2VQE Q;  2Y0S E;  1LYL A;  3L2P A;  2NN6 G;  3BZK A;  4IPG A;  3J7Z C;  1L1O A;  2F3I A;  4LF6 L;  1VQ8 A;  4JI8 L;  4A4I A;  2NN6 I;  2Z6K C;  2JEA I;  3RNU A;  4GKJ L;  4QIW E;  5IYB G;  4J15 A;  1VQC A;  5IT9 c;  3I55 A;  3T1H L;  4IFD I;  5LMU L;  4AYB G;  1P8L A;  4POF A;  2H5X A;  2ZTC A;  4A3F G;  2DGY A;  3NEM A;  1MIU A;  4GN3 B;  4MZ9 A;  4UP9 A;  3M7N A;  1UWV A;  3I56 A;  4UP8 A;  4X65 Q;  1VQF A;  1PH5 A;  1TWG H;  2HIV A;  3PUV A;  3GTJ H;  5C44 G;  1K8G A;  1G6P A;  1NMF A;  1X65 A;  1YIT A;  1EWI A;  1IL2 A;  4KHP L;  1TWA H;  1Q81 C;  1X3G A;  1X54 A;  3KDF B;  4OON A;  5BR8 L;  1YJ9 A;  2HT1 A;  1PH7 A;  1E7Z A;  1WJJ A;  5IY0 A;  4EX5 A;  4DUY Q;  1KRT A;  5GQO A;  2VNU D;  1NJI C;  4LNQ A;  2VY3 A;  1XMQ Q;  4GNX C;  2ZTE A;  3RN5 A;  1G29 1;  4B3T L;  2C35 B;  1HH2 P;  4Y52 H;  3CC4 A;  4JI6 Q;  1WOC A;  4DKA C;  4LFB L;  3HOV H;  1HR0 W;  3RLF A;  1PH3 A;  4YWK A;  5EAY A;  1YI2 A;  3HOV G;  1LUZ A;  5K36 G;  3CCV A;  1XMO L;  2VW9 A;  1EUJ A;  3T1H Q;  3CCJ A;  4DR2 Q;  3NEN A;  3A5Z B;  2QA4 A;  2WFW A;  5M3F G;  1PH2 A;  4IO9 A;  3I4N H;  4DR3 Q;  1PFS A;  3HKZ G;  3CCL A;  4L5T A;  3HOU G;  1O7I A;  1YVC A;  4BBS G;  2RHQ B;  1CSP A;  1EQR A;  4P72 A;  4BY7 H;  4JI8 Q;  2RCN A;  2ASB A;  2ZTD A;  3PF4 A;  1NY4 A;  4L5R C;  4GKJ Q;  1HNZ L;  1AE2 A;  3GO5 A;  1S72 A;  5GAE C;  2GVA A;  3CME A;  3AFP A;  4IOA A;  4AQY Q;  3BJU A;  1QUQ B;  2WP8 J;  4GN4 B;  5HY6 A;  3ULJ A;  3EN2 A;  4DV4 L;  4BY1 H;  1N33 Q;  4OO1 I;  2Y0S G;  1C0A A;  3CPW A;  3MEF A;  1EFW A;  2B29 A;  1A0I A;  2NVX H;  1PYS B;  1NBW A;  3STB C;  5GAG C;  4X62 Q;  2QEX A;  1L1O B;  2R92 G;  5C0X I;  3PO2 H;  2OTL A;  1V9P A;  4DR4 L;  1VS0 A;  1A62 A;  2K50 A;  1SRO A;  1XPR A;  1HNX Q;  2VL6 A;  2B3G A;  4DV7 L;  1EOV A;  1NTG A;  1NE3 A;  4PZ8 A;  4JI7 L;  1XNQ L;  3PO3 G;  1OXV A;  1SE8 A;  3IRB A;  1Y14 B;  1YZ6 A;  2KCM A;  3E9I A;  3U58 A;  3M4O H;  1Q1B A;  4L5Q A;  3S24 A;  1SN8 A;  2AMC B;  3UDF A;  3CCU A;  5LMN Q;  1PH8 A;  1J5E L;  5IYD G;  3A0J A;  2NZH A;  1HZ9 A;  3S15 H;  4QJF A;  2YTY A;  3M85 A;  2CCZ A;  3BU2 A;  1PYB A;  2ZM6 L;  4MNO A;  3J80 i;  2JK8 A;  3TQY A;  4YY3 L;  1VQI A;  2PQA A;  4JI0 Q;  4KI0 A;  3D31 A;  1OXU A;  4BXX G;  1B7Y B;  3BZC A;  2N78 A;  3KJP A;  4LF7 L;  1VQN A;  4LFA Q;  1I6H H;  3CCM A;  1WCM G;  4AQY L;  1Q86 C;  4DR4 Q;  1U0L A;  3W1G A;  2PI2 E;  4PZ7 A;  1HZC A;  4A93 G;  1VQ9 A;  2BH2 A;  2YTX A;  2UU9 Q;  3RLN A;  2UUB L;  3PIP A;  2JA5 G;  1C7Y A;  4A3B H;  1S3O A;  4JI3 L;  1QVG A;  4A3C H;  3K0X A;  3VDY A;  2R7D A;  4R4Q A;  1UE5 A;  2JA9 A;  4DV3 Q;  3GD7 A;  3H0G G;  4A3D G;  1IZ6 A;  1I94 L;  5GAD C;  1BBW A;  4BA2 I;  5IWA Q;  4P73 A;  2ALY B;  2OTJ A;  1X3F A;  1YBY A;  1D8L A;  4C2M H;  4A75 A;  4GKK Q;  2YYZ A;  2Z0S A;  3HOW G;  1V43 A;  4XTC S;  3PUW A;  5IE8 A;  5IP7 G;  1IBM L;  4JI2 Q;  1UE6 A;  3CCR A;  4JI2 L;  1TWH H;  4JI7 Q;  1Q46 A;  4RMF A;  1OTC A;  5LMN L;  2E2H H;  4JC0 A;  3GTM H;  1YIJ A;  4A3G H;  3UE0 A;  2DUD A;  1ASZ A;  1E1O A;  2KHI A;  3GTQ H;  4DUZ L;  4YWL A;  2JA7 G;  4IPH A;  3JAM i;  4DR7 Q;  4JBM A;  3PUZ A;  4GOP B;  1KXL A;  2BH8 A;  1AE3 A;  3I7F A;  4UY8 C;  1OXX K;  4LUO A;  1FJG Q;  4DV5 L;  3CCE A;  5M5Y H;  4IJH A;  1W2B A;  2A1A A;  1RIP A;  3KF8 B;  3K80 C;  1VQE A;  1YJW A;  1M90 C;  5C44 H;  4LF7 Q;  4B3S L;  2RHS B;  4LFC Q;  4LFC L;  4R4T A;  1EIY B;  2JA8 H;  3HOZ H;  3PO2 G;  5AJ3 Q;  1GD7 A;  2ES2 A;  4JI4 L;  1Z9F A;  2ID0 A;  4DV2 Q;  4DUY L;  4HJ8 A;  3DLL A;  1EIF A;  3OW2 A;  2MFI A;  1KHI A;  2JA6 H;  2R93 H;  2MO1 A;  3PUY A;  4IPD A;  1L0W A;  3W1B A;  4GNX B;  4IOC A;  1IBM Q;  3RN2 A;  3I4N G;  2VUM G;  3PO3 H;  3E0E A;  3K81 C;  2PNH A;  3ZJY C;  1S40 A;  1XNR Q;  4JBK A;  1B8A A;  2EXD A;  1CKO A;  1T9H A;  3PGZ A;  2R7Z G;  5ELO A;  4GOP C;  5IYC G;  4A3G G;  2CQO A;  3CCQ A;  1MJE A;  2CKZ B;  2LXK A;  5C0X J;  3ULP A;  1N34 Q;  4OX9 L;  5IYD H;  1I5F A;  1N9W A;  1XJV A;  2B63 H;  2UXC Q;  1AH9 A;  1GO3 E;  2NVQ H;  1HNX L;  2K4K A;  2IX0 A;  4LF8 L;  4HID A;  2JQO A;  3K8A A;  4GKK L;  1KQS A;  3OTO Q;  1VQ4 A;  1SFO H;  4A76 A;  1UE1 A;  4X66 L;  3OTO L;  1XPO A;  3GTK H;  1YHQ A;  3UDI A;  2K52 A;  5M3F H;  1QZG A;  4LF6 Q;  2IY5 B;  4A3K H;  1HJP A;  1VQB A;  1H95 A;  1VQK A;  2GVB A;  3KF6 B;  3PUX A;  4TVA B;  2E5L L;  3L7Z C;  1Q7Y C;  3L0O A;  5C3E G;  1HR0 L;  3E9H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...