1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
1GD7A 2I0QA 2F4VQ 3I4NH 3WWVA 4B3RL 1N8RC 2Y0SE 1LTLA 3KDFA 2OTJA 4O0AA 2KENA 4KHPL 2A19A 4LFAQ 3UE1A 2N3SA 2NZOA 4DR1L 4LFBL 2I5LX 4DV3L 1BVSA 4IFDI 2NVXH 1E22A 1VQ7A 2BH8A 1JB7A 3STBC 3J80c 4HJ8A 2Q2HA 1E1TA 4BBRG 5C3EG 1VQ8A 2UXBQ 4LF6Q 4DV2L 4XIGS 1I50H 1HNWL 1A8VA 1Q12A 1I94Q 4A3JG 2B63G 1EQRA 3CXCA 2BA1A 2RHQB 3OYYA 1IL2A 3I4OA 4A3BH 2N8NA 3HOZG 2WB1E 3B6YA 5M3MH 2CKZB 4A3GH 3H3VI 4DR6L 3HOYG 4L5RC 4A3LG 4AYBE 4JI2L 2CWAA 1N33L 3H3VH 3F2DA 4BA2I 3D31A 2HHHQ 4JC0A 3AFQA 1L1OC 3I56A 4A3CH 2KHIA 1Y1WH 2MO1A 1YITA 2A8VA 1X3FA 3KYHC 4GLAC 4P71A 1FVIA 3PUXA 3CF5A 4IOCA 1IBLQ 1YHBA 2UXCL 1CSPA 5AJ3Q 1YIJA 3ULLA 4LUOA 1XMQQ 4A3EG 1XJVA 3HOXG 1EOVA 1K8GA 1JE5A 2B29A 4B3TQ 2R93G 3KF6A 1XNRQ 1D8LA 3F8TA 4BY7H 1Q1EA 2JQOA 1VS0A 3HFZB 4X65Q 1IBMQ 2JA6G 5IYBG 3RZDH 5FLMH 1K73C 1MKHA 3MXNB 4JBJA 5M3FH 4OWWB 1OXTA 4DV1Q 2AWOA 4A93G 4FDBA 4C3HH 3S1RH 2AHOB 1LYLA 3UE0A 4PZ7A 4YHHL 2PQAA 4GNXB 2K75A 1FJGL 3L0OA 4A4IA 1QVGA 2IX0A 2OQKA 5C0XI 2DGYA 4UY8C 4JI4Q 1HZAA 1IXRA 1UE1A 2ZTEA 3JAMi 4JI8Q 4DR7L 4A3DH 1GVPA 4L5TA 4BY1H 1UEBA 3CW2C 5IWAQ 2R7ZG 1L1OB 1XPUA 1B7YB 2A1AA 1PV4A 1G51A 1S3OA 1IBKQ 4TVAB 3ULPA 3PO3H 4QJFA 1SE8A 2AMCB 1Y1VG 1PH6A 2OQ0A 1C7YA 4DR4L 3CPFA 1TWGH 2V1CC 1C0AA 1V1QA 1N9WA 4IFDJ 4C3JH 2CWPA 5C4XH 4LF7L 4GN4B 4R4QA 1LM0A 1EUJA 1L2FA 4GN5A 2E2JH 4X66L 4B3SL 3I2ZA 5GADC 2QA4A 2ZTCA 3AEVA 1R9TH 1U0LA 4YY3L 3OW2A 3NEMA 3PUVA 1X6OA 3CMAA 2ZJQA 3S2DH 2QGQA 3PGZA 1BBWA 2UUAQ 1PYBA 4JV5Q 2UXDL 5M5YH 3CQZH 1I5FA 3PCOB 4L5QA 4MTNA 5IP9H 2ZJPA 4XTCS 5BR8L 3U58A 4KLKA 4AH6A 5JEAG 5EAYA 1QZGA 3HOWH 1VQGA 4BA1I 4DV4L 2R92H 1XMOL 2Q2UA 4IJHA 2JA7H 3GDEA 4OX9Q 2UUBL 1NJIC 1E7ZA 4OONA 3GTJH 4A3MG 1KIXA 1OXXK 1YI2A 3CCLA 1Q7YC 2JK8A 2LSSA 1W2BA 2MQHA 3HKZG 2JJQA 3K81C 1PH4A 4B3RQ 4GKJL 1VQDA 2EXDA 4IJLA 4YCWA 3PF5A 4Y7NH 4YWMA 2C35B 4KHPQ 3S1QH 3W1BA 1EFWA 2I5HA 3S14H 1EQQA 5LMUL 2R7DA 2I5MX 4APVA 4DR1Q 4JOIC 4LFBQ 4DV3Q 3FP9A 4NXML 1Q86C 3FHWA 4LFCL 2BA0A 1PH2A 3DM3A 1PH7A 2IHFA 2VW9A 3CCVA 2JA5G 4HJ5A 3K0XA 1WOCA 4DV2Q 1HNWQ 3TREA 3K80C 4PMWA 1E1OA 4P72A 2K4KA 1OXVA 1NTGA 2KHJA 4GS3A 4R4TA 4GOPB 4LNQA 4L5SA 5GROA 2Y0SG 5H1SE 5DLQE 4JI5L 3HKSA 3CCMA 2K50A 4PZ6A 4LF9L 1A0IA 4DR6Q 4B3ML 4OO1G 1N34L 1XNQL 1XPRA 3ICEA 4JI2Q 4EQ5A 1N33Q 3E9IA 1CKNA 2Z6KA 1W3SA 2K52A 4TQUS 4UP7A 3UDIA 4A3FG 4JI0L 2ES2A 2E5LL 2B3GA 4C2MH 2B63H 3M7NA 2YYZA 1GKHA 1SLJA 1Y14B 1PVOA 2FXQA 2HT1A 1RIPA 2PI2E 2VUMG 2OCEA 4UP9A 4A75A 1H95A 4QL5A 5IYDG 3J81c 2UXCQ 4LWCA 1GO3E 4GNXA 3DLLA 3FKIH 4OWXB 1GM5A 2JEBI 4H02A 1HR0L 1ASZA 4JI6L 4LF8L 1N32L 1TWCH 4DV5L 1S72A 1X54A 4BXXG 5LMNL 1JJGA 3NENA 2WB1G 2RHSB 3I4MG 3HOVH 2JE6I 4JI3L 1B8AA 1X56A 2UU9L 4AYBG 4DKAC 1CKOA 1KAWA 2GVAA 1UE7A 3HOXH 4R1JA 3TS0A 1J6QA 4PZ8A 4KI0A 2R93H 3F2BA 4YHHQ 1UWVA 3CC7A 1FJGQ 1JJCB 2OTLA 2JA6H 3PV0A 3I4NG 2IHEA 1EIYB 4YWKA 3G48A 5IP7G 1VQHA 4RG1A 3F2CA 1JMCA 2JA8H 4DR7Q 2IT1A 3PUZA 4A93H 4IPCA 2QEXA 4GKKL 3H0GH 4EX5A 4LF5L 1LUZA 1DGSA 3AQQA 3PUWA 1RL2A 1K9MC 5FJ8H 4P74A 1HZBA 2VQFL 1I6HH 3AFPA 1V43A 1C9OA 1HR0W 2CQOA 4JI7L 1X9NA 3JC66 4DR4Q 4IFDG 4JBKA 5IE8A 4DR3L 5JJIA 5LMNW 2ZTDA 4LF7Q 1K8AC 2R7ZH 4X64L 3Q8DA 4X66Q 3CPWA 3CCQA 2UUCL 4B3SQ 1YHAA 3SGIA 4K0KL 1VCIA 5GQOA 2WAQE 4DPGA 4BBSH 2NVYH 1Y1VH 4DK3C 1PH8A 2VZAA 2IY5B 1P16A 1VQBA 1HH2P 3H15A 1YJ9A 3U50C 5GAEC 2UXDQ 4LF4L 1X3GA 2NVQH 1I94L 5BR8Q 1X65A 1VQPA 1Y1WG 3CC2A 3KDFB 4J15A 1XMOQ 2NN6I 5ELOA 3TQYA 1I3QH 5ELNA 2N49A 4O2DA 2PNHA 3G71A 2UUBQ 3M4PA 1Q82C 4JBWA 2BH2A 2EQSA 1UE5A 2ZJRA 4DV0L 1WCMH 1AH9A 4IPGA 4DR2L 1KL9A 1N36L 2HHHL 4P75A 5GAGC 2AWNA 5JJLA 1HNXL 4GKJQ 1A63A 1CKMA 1OXUA 1VQMA 3TEHB 1E3PA 4OXPA 4GOPA 4A3KH 2D62A 3S1NH 1VQ6A 3K8AA 2OWOA 1EYGA 2E2IH 1KHIA 3S15H 5IY0A 1S40A 4AQYL 1JJ2A 1TWFH 1K83H 2YTXA 4LFCQ 5J3BA 3OTOL 1PH5A 1TWAH 1WFQA 3BU2A 3S1MH 4JYAL 1YEZA 3PO2H 3CCRA 1SR3A 4C3IH 1M1KC 1WYDA 5IT9c 5IYCH 2RF4A 1KRSA 5C44G 4A3IH 2NVTH 4BY1G 1HZCA 4JCVE 4DAYB 4JI5Q 3TRZA 2JA5H 4LF9Q 1CSQA 2KCTA 4B3MQ 1VQIA 1CUKA 1QVCA 1Z47A 3J7ZC 2VQEL 5FLXc 4DV7L 1N34Q 1XNQQ 3PO3G 1BBUA 3K7AH 4QIWE 3U4ZA 5HGQA 4X62L 1G291 2GN5A 3KF6B 4JI8L 1K0RA 3CCUA 2E5LQ 3BZKA 1WJJA 4R4OA 1T9HA 3PSIA 3NBHB 3HOUH 4NB3A 2ZM6L 1VQEA 4KHZA 3T1YL 4NPSA 1VQJA 1UE6A 3ULJA 2D0PA 3RZOH 3U4VA 1U5KA 3GTPH 1HR0Q 1YBYA 5M5XH 2L15A 4DV6L 4JI6Q 4LF8Q 2Z0SA 3EBEA 3NELA 4A76A 1SRUA 2PQAB 2MNAA 4DV5Q 1N32Q 3F1ZA 3M9BA 3J80i 5LMNQ 1G6PA 1A62A 1P8LA 2CFMA 4QGUA 4IPDA 5C0XJ 2VUMH 1X3EA 1QUQB 1IYJB 4JI3Q 3HOWG 2VNUD 4DK6C 2UU9Q 5IYDH 3ZJYC 4BBRH 2XTIA 5C3EH 1FGUA 4DUZL 4HJ9A 1KQSA 2JA7G 5JJKA 2H5XA 3T1HL 4NXNL 1OTCA 3TS2A 3EIVA 4A3JH 1TWHH 2ALYB 3L7ZC 3J81j 3KJPA 4HJ7A 5C4JH 3KOJA 4POFA 3RR5A 3AYHB 3HOZH 3RLNA 1KRTA 1HNZL 1QZHA 4JG2A 3HOYH 5HY6A 4A3LH 5K36G 4Y52H 3CAMA 4GKKQ 2DUDA 4DR5L 4LF5Q 2AKWB 3GTQH 1WI5A 2VQFQ 4YWLA 5IP7H 4JI1L 4JI7Q 2RCNA 3PUYA 1KXLA 1L1OA 2WFWA 4DR3Q 2KCMA 4A3EH 2D0OA 4X64Q 2WP8J 4HIOA 1SFOH 4JBMA 2UUCQ 1KC8C 3M4QA 4K0KQ 2HIVA 3KLWA 1VQCA 2K5HA 2Z6KC 5IYBH 4UPAA 2EIFA 1J5EL 4YCVA 3S2HH 4LF4Q 2PMZE 1L0WA 1YJWA 1Q1BA 4X6AH 4R4IA 4DUYL 1X55A 4POGA 2R6GA 4GLVB 4GNXC 1AE2A 1Q8KA 1YNXA 3LGJA 3CMEA 1SN8A 1Q81C 3A5ZB 1TXYA 1NY4A 3A74A 2N78A 3M85A 1PH9A 2K5VA 2F4VL 2CCZA 3M4OH 4DV0Q 2KBNA 1EWIA 2LXKA 3FKIG 3M3YH 3K7UC 1E24A 2XGTA 4DR2Q 4OWTB 4HJAA 1N36Q 4GLXA 2WAQG 4IPHA 1HNXQ 4LFAL 2LXJA 3CCEA 5GAHC 1NE3A 3E0EA 3UDGA 4YY3Q 3HOVG 4A3BG 3GTOH 3RLFA 5M3MG 1PYSB 4A3GG 2UXBL 2HIXA 3GD7A 1PFSA 4AQYQ 4LF6L 3A5UA 1PA6A 3E9HA 1FL0A 3OTOQ 2YV5A 2F52A 3G4SA 1PH1A 2YTYA 2Q2TA 4A3CG 4JYAQ 1CKNB 4DV4Q 1MIUA 3L2PA 2ATWA 1VQLA 2JA8G 2MFIA 1O7IA 1M90C 4WJ3M 3PIOA 3W1GA 3H0GG 2K5NA 3I7FA 4QQBX 4UP8A 3BJUA 4AIMA 1VQFA 4IO9A 4DV7Q 3PF4A 2VQEQ 5FJ8G 1HJPA 4BY7G 2YTVA 1QUQA 4X62Q 3D0FA 5FLMG 1ASYA 1OXSC 1VQOA 1IBLL 5C44H 5AJ3L 4A3MH 3CCSA 2E8GA 5M3FG 2ID0A 5LMUQ 1VQ4A 1XMQL 1Q46A 1V9PA 2ZM6Q 3W5OA 3T1YQ 4NXMQ 3S17H 3J7A5 1JT8A 4B3TL 4DNIA 4IOAA 1QVFA 1XNRL 4ALPA 1HZ9A 4BBSG 3KFUA 4DV6Q 4LW1A 1IBML 2GVBA 4X65L 3G6EA 2PI2A 1YJNA 4HIKA 3MEFA 4P73A 5C0XG 3KJOA 3KF8B 4DV1L 3I55A 3S24A 3RNUA 4A3DG 4JI0Q 1B70B 3CP0A 4MNOA 4HIDA 3JAMc 1Z9FA 2VL6A 3CCJA 3GTKH 4DUZQ 2ASBA 2NZHA 2R7FA 4JOIA 3CC4A 3T1HQ 4NXNQ 4HIMA 3RN2A 4JI4L 2K14A 2NN6G 1WCMG 4YCUA 4GOPC 4OO1I 4DAMA 1VQ5A 3GO5A 5C4XG 2HQLA 5IWAL 4LUVA 1PH3A 4MZ9A 1NBWA 5M5WH 1HNZQ 4A3KG 1IBKL 1D7QA 5E7NA 3VDYA 3RN5A 4DR5Q 4A3FH 1KD1C 1VQKA 4R4CA 3J81i 1VQ9A 1VQAA 1AE3A 1MJCA 3BZCA 5IP9G 4JI1Q 3UDXA 3STBD 2Q2IA 3CD6A 3A0JA 2E2HH 1XTDA 4PG3A 3PO2G 4LUZA 3PIPA 3HKZE 1SMXA 3ERSX 2YU9H 2R92G 1K3RA 3GTMH 2MO0A 5IYCG 1XPOA 3RLOA 1IZ6A 4BXXH 4A3IG 4RMFA 1PHJA 2UUAL 3GTLH 3I4MH 4JV5L 2VY3A 3S16H 2F3IA 2JEAI 1NMGA 1VQNA 1YHQA 2VS1A 2IX1A 3GTGH 5JEAJ 1J5EQ 1YVCA 3IRBA 2JA9A 3ER0A 4OX9L 1BKBA 1EIFA 3EN2A 4GN3B 4QY7A 4DUYQ 4ME3A 1MJEA 4WJ4A 1SROA 3UDFA 1NMFA 1YZ6A 3HOUG
chains in the Genus database with same CATH superfamily
2I0QA 1W93A 3SDZA 1DV1A 4DV6H 4B3RL 1N8RC 1LTLA 2HGSA 4ABNA 5M5WB 5A35A 1H9JA 3VYUA 2W9BB 3A8IE 3H91A 5KNDA 2JA6A 3QZ7A 3UE1A 1NSNS 3D4RA 4LFBL 3MR2A 2NVXH 2BH8A 4LK1C 3D3RA 1PFNA 2O2LD 2UXBQ 5EDWA 4LF6Q 1QJOA 1HNWL 4Q8EA 2AQ4A 2I8CA 5ELEA 4JPBW 1A8VA 3BABA 2MHVA 1QCBD 1WD0A 3KHHA 3GTMB 3PQIA 3T51B 2FFKB 2RHQB 5A2QL 3I4MB 4ZLTF 4A3BH 2N8NA 5M3MH 4KKUA 2DPIA 3EA6A 3H3VI 2VA3A 2R7ZA 3FDTA 4K8IA 4L5RC 2AQ3B 2EVBA 1IW7D 1KDCA 4JC0A 3TP6A 4M1UB 4A3CH 3GTOA 1QB5D 1WTXA 5JOBA 3KYHC 1JIHA 1K28A 3GV5B 3PUXA 5KIXA 3I4NB 4YBZB 1YIJA 1XMQQ 4A3EG 1XJVA 1GSAA 3BDOA 1TY0A 1K8GA 1JE5A 2KCCA 1CZGA 4X65Q 4O2AF 2JA6G 3Q8QB 3J7AV 1EY0A 1DOMA 3MXNB 3VA7A 4JBJA 3OHBA 4DV1Q 1SJHD 1SMYD 4A93G 1ZETA 2K01A 2RA4A 4Q43A 1QOHA 1MI2A 1MZBA 4HAEA 2PQAA 2J6SA 4A4IA 2OQKA 5KG4A 2DGYA 1WVLA 4JI4Q 2XVSA 1TWFA 3X3NA 1AFPA 2ICEC 2NTTA 4JI8Q 5C0XH 3BQ2A 1GVPA 3SR1A 4A3GB 1FD7D 4DL6A 4X64H 4L5TA 5LXTF 3U9TA 1UEBA 1O78A 3CW2C 2DY8A 2R7ZG 1L1OB 1T36A 2A6HD 4XT1B 2A1AA 1IBKQ 2UXBH 1ZXTA 1AUVA 2OQ0A 1S5BD 5KFBA 4YR2A 4EYIB 1C0AA 2F0UA 2V1CC 2FINB 4FM9A 2BR0A 4C3JH 2CWPA 4E4TA 2BQRA 1EUJA 2E2JH 1TR5A 4X66L 2R8IA 5GADC 2ZTCA 3FRPB 1U4LA 3AEVA 1U0LA 4YY3L 4BY7B 1KLGD 2EDGA 1SYFA 2FHTA 1H9RA 2CH4W 1PFBA 1KJ8A 1SNOA 5M3FB 5KFSA 3GTPA 3U58A 1UAPA 1ET9A 2XRSD 1VQGA 4BA1I 3GQCA 3NP8A 2R92H 3PW2A 1XMOL 2Q2UA 4QWAA 3GDEA 2UUBL 4FS1A 1XMQH 4A3MG 1OXXK 3BS1A 3M4IA 4A3DB 1I4XA 1W6JA 2W57A 2JK8A 4TQSA 1F9PA 1W2BA 2MQHA 1SSOA 1T5EA 2JJQA 3K81C 4X65H 4IAJA 4JV2A 1EY9A 2HVSA 5K36H 4YCWA 3PF5A 1CI3M 2C35B 4C3IG 4DV1H 2J6UA 2OH2A 2I80A 1DD2A 1EFWA 4UCUA 1S4ZA 4APVA 4DR1Q 3TQTA 4DV3Q 2D9UA 3FHWA 4LFCL 2MGSA 5C4XB 2MCTA 1PH7A 3CCVA 4JI4H 2EXZA 1B3AA 3TREA 1E0BA 1R9TB 4JI8H 1E1OA 4P72A 5HURA 4O3PA 5IT9L 2R82A 3R23A 2B2UC 3KAKA 1OXVA 1NTGA 5L1KA 2IA6A 1G6ZA 5GROA 5M5YB 4YQWA 1IBKH 2KSWA 1XNQL 4RB1A 5KEEA 1GHJA 3E9IA 2Z6KA 4TQUS 2BOSA 2PBZA 1CQJB 2W6OA 2YYZA 1GKHA 1SLJA 1Y14B 1PVOA 4UAIA 3PW4A 2PI2E 3T4AC 2Z8LA 4ECZA 3N44B 2UXCQ 2OF1A 4LWCA 4GNXA 1LTRD 3FKIH 1ASZA 1PLFA 4LF8L 1TWCH 2HJWA 3JZIA 3HP3A 2K04A 3V4ZA 5E3FA 5LMNL 3C46A 3RB4A 3NENA 4RHRA 2WB1G 2RHSB 4C5AA 1RTOA 4HMIA 2JE6I 1B8AA 2UU9L 1RK6A 2XIWA 1CKOA 1KJQA 5KX5F 2E2IA 3QR8A 4JVZA 1UWVA 3TSSA 1FJGQ 3F2CA 1LT3D 2Q8RE 3RTXA 4DR7Q 2PMZB 4FVMA 4IRDA 5CV4A 4GZYC 2PQEA 1UC8A 4DR1H 1RYRA 4LF5L 3PUWA 4DV3H 2VPQA 2B63B 1DONA 1PMRA 3TBIB 4P74A 1HQRD 1HZBA 2VQFL 3AFPA 1V43A 1X9NA 5D3IB 3K3VA 4O2BF 4DR4Q 1CTMA 5HBRB 4JBKA 5IE8A 2AQ1B 2QKIC 5JJIA 4X3TA 4LF7Q 3P1HA 1C3OA 2BQUA 1A2UA 2UUCL 4B3SQ 3J7AF 3MXUA 5GQOA 5L37A 3K5IA 1TIID 2OXPA 5D3DA 1PH8A 2VZAA 4ZQIA 3R5HA 5TSSA 1P16A 5ELBA 3VPDA 1GUTA 5DGAA 4PNYA 5ELFA 2R84A 4LF4L 4PWQA 1X3GA 4DF7A 3HOXB 4C1NI 2GPWA 1IW7C 3GV3A 1VQPA 2R93B 1BBXC 3CC2A 4APMA 3TQYA 1I3QH 4O2DA 1JWUD 3J81W 2UXCH 1PYWD 1Q82C 2M00A 2NN6H 3K57A 3N42B 4H0LC 3QIAA 5JJLA 3D4DA 2RGRA 3W3AA 4DL7A 1E3PA 1SXTA 4GOPA 3S1NH 2XN9C 1VQ6A 5FO7B 4IUNA 1FYCA 1EYGA 3S15H 5EWFA 1DM0B 2XIGA 3OHXC 2EYPA 4HMJA 3QB3A 4CDDC 5J3BA 3OTOL 2W9BA 4F7XA 1TWAH 1WFQA 2R61A 1RF2D 4CC6A 1YEZA 4DGZA 1ET6A 4BBSB 4IUUA 4DR7H 1BF4A 1WYDA 2NVYB 5IT9c 2ZDGA 4ME6A 1KBLA 1KRSA 3VYSA 2NVTH 2MUYA 3N52A 1E2ZA 3TRZA 4LF9Q 2KCTA 2F3VA 2WV6D 4B3MQ 1VQIA 1QVCA 4MV8A 5I2YA 2A6HC 1IL2A 3CCUA 1K0RA 2E5LQ 4O3SA 4LF7H 2C00A 1C30A 3PW7A 4NB3A 5BPFA 4B3SH 4EFEA 4NPSA 5IGDA 5KFWA 3ULJA 3U4VA 4RAUC 4DV6L 4A3KB 3QOJA 2MNAA 4DV5Q 2R8HA 2E2IB 3F1ZA 3M9BA 3J80i 1BO0A 1A62A 1P8LA 2CFMA 4FXKC 5C0XJ 1NCVA 5IYDH 1IL8A 5L1JA 4RHSA 1SE3A 2XTIA 2L55A 5JJKA 1BCPD 2K03A 3PO2B 2NUAB 1M0TA 5FLXL 4FF3A 3N6RA 3PZPA 4Q44A 4F4XA 2W9AA 3J81j 2ALYB 3L7ZC 3MXNA 1J9OA 3FKIA 4ME5A 3RR5A 3HOZH 2H4OA 4NW2A 4G7HC 3DEPA 1TWCA 5HY6A 4A3LH 5K36G 3E5NA 3CAMA 4GKKQ 5EOYA 1JWMD 4C56C 4WBNF 3HOUB 2Y0SB 4JI7Q 5E1FA 3PUYA 2W7OA 4EQPA 1L1OA 1PK8A 5KFHA 5CORA 4X3SA 3I90A 3V96A 3LX0A 2V9WA 4JBMA 2YYAA 4K0KQ 5FPOA 4LF9H 1VQCA 4YAKB 5CBEE 4B3MH 2VUMB 1ML0D 3LWBA 2EIFA 3SVMA 4IFDH 3JRXA 4YCVA 4QCLA 2E5LH 2QEJC 1IYUA 4RFBA 4R4IA 2UVUA 1X55A 2B2TC 4GLVB 3RGXA 3LGJA 1AZPA 3A5ZB 2DPJA 2N78A 2L1BA 3M4OH 1EQVA 1AEXA 4AYBB 2LXKA 3NWTA 5IYZF 3FKIG 5C4HA 4DAPA 1EL0A 1RD9D 4GLXA 3PW0A 3GV8B 2A74C 3GTQB 1EWCA 4M7EA 5EWGA 4YY3Q 1V8QA 2XGPA 2YZMA 3RLFA 2XWBB 4A3GG 2UXBL 4AQYQ 2R8JA 4LF6L 4R9WA 2HVRA 5C5LA 1PA6A 3OWEB 3GIPA 4A3EB 5IT9E 3IN5A 4J9RA 2F52A 5EQ0A 1GUNA 4Y8VB 1EY4A 1CKNB 1E4GT 5CAEB 3L2PA 1UUPA 2BE5D 1VQLA 3GIKA 3RAXA 3BG5A 4K6LA 2HQEA 1TY2A 3BDLA 1O7IA 4WJ3M 5KFXA 4GKKH 1B9MA 2SDFA 2AQ2B 2X6GA 1RYSA 1R9TA 5JEAH 4AIMA 3MVVA 5JUMA 3E5SA 2VQEQ 4GC6A 4JI7H 2V4QA 1F2MA 2EY1A 4BY7G 1KNAA 5EPKA 3D0FA 5FLMG 1ASYA 1OXSC 3HS0C 5IGGA 3RUPA 5M3FG 3FPPA 2ID0A 1XMQL 2B2VC 1Q46A 1V9PA 2FB9A 3M3YB 3T1YQ 1STNA 3S17H 4K0KH 3TMEA 4IOAA 3MHBA 1O7YA 1EHIA 4OEMB 4X65L 3G6EA 2PI2A 2E75C 1BXRA 5C5JA 2V4RA 1V1PA 3MEFA 3GTOB 2KVMA 1K8MA 1I6VC 1LT5D 4DV1L 3I55A 4A3DG 1YNND 1ICFB 4HR7B 3GTKH 4DUZQ 4MV4A 3TN2A 4JOIA 1O75A 4NXNQ 3RN2A 4JI4L 1F2YA 2NN6G 4MTEA 2KOLA 3HGBA 1E2VA 5KYIA 5C4XG 2KECA 1PH3A 4YY3H 3Q8RB 2C22A 1IBKL 1D7QA 1FR3A 5E7NA 5EZYF 4AQYH 1D1IA 4EVOA 1TS5A 2PMZA 4A3MB 3G6VA 1VQAA 1RHPA 4JI1Q 2LFNA 2Q2IA 2Z1CA 2SNSA 1KABA 3PIPA 2YU9H 2B63A 3ERSX 5DNFA 1K3RA 3Q0AA 5KG1A 3TQ1A 3OIPA 1PHJA 4S3SA 1I4GA 3GTLH 3PR4A 2VY3A 3S16H 2OLSA 1MBYA 1VQNA 2VQEH 3GTGH 4FBUA 2N55A 3IRBA 3KTMA 4K14A 2KA7A 2UVRA 1BKBA 3MWDA 1PRTC 4ME3A 1V51A 1SROA 3T1YH 1JXLA 1YZ6A 1F9QA 2HCIA 2F4VQ 1WSCA 4R8IA 1ULZA 2R93A 2OTJA 3C1FA 2Q8IB 1EZ1A 3E6ZX 2LMCB 1M8AA 3DWAA 4DR1L 4K2LA 1GUOA 3JAMW 4DV3L 1EFID 1E22A 1VQ7A 3A7LA 4XQNA 3RGZA 4KJOA 4DUZH 1VQ8A 2Q2HA 4NXNH 3K5MA 4CDCC 4XIGS 1I50H 3CU7A 4CJ0B 1ZHSA 5C1OA 4L8JA 1BCPC 1T94A 4UFZA 3RFCA 5BN4A 4PQXA 3MXPA 2B63G 3M9NB 1EQRA 4KY7A 3OYYA 2WB1B 3I4OA 4XQQA 3HOZG 2WB1E 3B6YA 1STBA 1TS4A 4CC5A 4DN4M 2R3ZA 1TT2A 4A3LG 2CWAA 2UVWA 3I56A 2KHIA 1Y1WH 4JI1H 2MO1A 3KF8A 4O3QA 1X3FA 2FMCA 3LWEA 4GLAC 4ED2A 1YHBA 2UXCL 1CSPA 3J81L 3ULLA 3HOXG 2CW7A 3EJIA 4XX0B 5NUCA 2R93G 1CHQD 3DF7A 3CKIB 3F8TA 1Q1EA 1IBMQ 3ETJA 3HFZB 3ONAB 1XDNA 1OO9B 1K73C 2NVXB 4WRDA 2OT2A 4OWWB 3MA2B 5K2MA 5FLXE 3S1RH 1LYLA 4GNXB 1BNZA 2F4VH 1FJGL 1BDOA 3L0OA 2B2VA 4I65A 5EKIA 3T13A 3M7GA 3BVMA 5C0XI 3JRWA 4UY8C 4L6TB 2FPGB 4A3BB 1FKAH 4DR7L 5M3MB 1GLVA 5KFIA 3RB0A 3QZ8A 1DV2A 2C9OA 4G57A 1PTOD 3MWYW 2V58A 3NWSA 3HG9A 3KBGA 3GP7A 5I9OA 1G51A 5JJZA 3PO3H 4TVAB 3ULPA 3J80W 3N8DA 2HD3A 3CHBD 2AMCB 5KKNB 4YIJA 1PH6A 3S9WA 1MSGA 3DWPA 4OIJA 4DR4L 3CPFA 2IW3A 4IFDJ 1ZEQX 4LF7L 3BDCA 1LM0A 4KKSA 2AU0A 1VDZA 4B3SL 3PN1A 3I2ZA 4C1NK 3VR4A 3I8ZA 4F88A 3NEMA 2G9HD 2J9GA 5KFTA 4ECWA 1X6OA 3S2DH 2Y0SA 3MTSA 2FPIB 1PYBA 3CQZH 2ICIA 4MTNA 1F9SA 4XTCS 3HOWH 4O4LF 5JEAG 5EAYA 2W6ZA 4DV4L 3KAJA 1AW7A 4IJHA 1NJIC 1E7ZA 5KFDA 2VUMA 2F0JA 4OONA 4QMGA 1YI2A 1HCZA 1Q7YC 2LSSA 3D6CA 3VMMA 3K6OA 5BMVF 1IBMH 1L0XB 1VQDA 1JOOA 4EQOA 4DLKA 3HZXA 3WO0A 2NUCA 3I12A 3S14H 2I5HA 2I5MX 4DL2A 4AYBA 3GTGA 4GC7A 4FF2A 4NXML 1Q86C 1YNNC 2BA0A 4C3JB 1CE8A 3K5LA 2IHFA 4QWEA 4RKLA 4XYQA 5I2XA 3K0XA 2E2JB 3K80C 3ERQA 4CDFC 3GTQA 2K4KA 1Q8IA 5E4WC 5KFGA 1WTQA 4R4TA 2NYZD 4DNTB 4XDXA 4GOPB 2K32A 5G3LD 4UCTA 2Y0SG 2EYHA 4PMCA 3HKSA 1JLLB 2K50A 4PZ6A 4LF9L 2L4NA 4MAMA 5KFRA 4B3ML 5KFKA 3OSNA 4JI2Q 1N33Q 3H09A 2R92B 1CKNA 1H9KA 4UDUC 2IMWP 2E5LL 2B3GA 4C2MH 1RJRA 1LO5D 5KFVA 2B2YC 2VUMG 4A75A 4UP9A 1H95A 4QL5A 3J81c 5C1PA 1EEFD 4HNUA 4H02A 3EQLC 1JICA 5JPNC 2I87A 2YZGA 1RODA 4DV5L 1S72A 3G7LA 1LV9A 4KTAA 4YB8B 5F9NA 3EROA 1I7LA 3HOVH 1TAEA 5T1GA 4AYBG 4DKAC 2GVAA 3FVQA 1EY5A 1J8IA 1JX4A 4PZ8A 5DEHA 4ETSA 5EBCA 4Q0YA 1HQMC 3CC7A 3BYTB 2FKLA 4HNVA 4ZRZA 4EFBA 3PV0A 3G48A 1VQHA 4HR7A 1JMCA 3PUZA 3T5LA 3KK7A 5T14A 4GKKL 3H0GH 5KT6A 4EX5A 2SEBD 2PZUA 3AQQA 1RL2A 2BDNA 5D14A 5FJ8H 1K9MC 1I6HH 4YJ3F 5LA6F 5LL6S 1T3NA 1HR0W 2K5WA 2CQOA 4JI7L 3BZDB 2K5DA 3P20A 3SK5A 3FKIB 3RD4A 1K8AC 4RCOA 4RU9A 2DNEA 1Y8NB 3CCQA 5BN3A 1TWCB 4K0KL 5CB4F 5F2DA 5EKLA 1BR9A 3TZDA 3VR3A 1GGOA 1Y1VH 1N33H 1KTKA 1FGBD 3H15A 4J9KA 1S97A 2UXDQ 4JV1A 1I94L 2TMPA 5BR8Q 2E74C 1Y1WG 3KDFB 2NN6I 5ELOA 2JSOA 2W9CB 5CR3A 2IP4A 3VR5A 2EQSA 3EPIA 2RKSA 2ZJRA 4LF6H 4RB0A 5JVH3 1KL9A 3ORRA 4DXFA 5GAGC 2CZGA 1HTLD 1CKMA 3ZYYX 1VQMA 3QFFA 4J8QA 4K5WA 3H6MA 3TP8A 1ONLA 2D62A 2O03A 3UQ8A 4Q0FA 2IJ0A 4AQYL 1JJ2A 1HA5A 5HV6A 3MWEA 3SHLA 1K83H 5EBDA 4CGYB 1GSHA 1S0MA 2CW0D 2B8GA 3FEWX 1PH5A 3BU2A 4F50A 1TVXA 3KXYT 1Z6HA 3H94A 1SR3A 3K59A 3ND8A 1EIGA 5IYCH 5M9OA 4F87A 4TUYF 3J7AK 1PTOH 4JCVE 4F4YA 2JA5H 3N43B 4I4TF 1PTOC 1WTHA 1N34Q 1CUKA 4MTKA 5C8YF 2VQEL 1UC9A 3PO3G 1V4YA 1I3QB 3U4ZA 5JH7F 2GN5A 3KF6B 2WB1A 3ORQA 3BZKA 1C8CA 3D4WA 3KALA 5EPLA 1QE6A 3T1YL 1VQJA 1B04A 3RZOH 4BWSC 3UI2A 5I4DA 3T53B 5M5XH 2L15A 4JI6Q 3S1NB 2KHSA 1N32Q 4A2AA 2UXDH 4RWSC 3R2TA 3S15B 5BR8H 2EYOA 1DZ1A 5LOVF 1KC7A 3UFXB 1IYJB 4JI3Q 3HOWG 2VNUD 4KJNA 1BNCA 4MV9A 3JAML 4BBRH 5C3EH 4HJ9A 1FGUA 4DUZL 5I47A 1TWAB 1KQSA 3NK9A 4NXNL 1EY7A 1OTCA 1RKNA 4JW0A 3TS2A 4QW9A 1EU4A 3EIVA 4A3JH 2OEOA 1D1KA 5KG0A 1G8ZD 1TWHH 5KFQA 3F2UA 2NVXA 3KLSA 5C4JH 4WJWA 2NVTB 1V1PB 1JOKA 4ODGA 3A8JE 2YZNA 5JVLA 2IBKA 2J0TD 5I6WA 2DUDA 2AKWB 5L1LA 4RAYA 3VR2A 4U68A 1WI5A 2Z9HA 5KFCA 1LACA 5IP7H 4JI1L 2RCNA 1KXLA 2G9DA 3R5FA 2QF7A 2F0DA 2KCMA 2M2LA 2AUKA 2D0OA 2EYJA 2WP8J 1JDBB 5FKAC 4HNTA 4J9PA 1KJ9A 3M4QA 2CQAA 4RUAA 4OIKA 5DM63 4FF4A 2NWGA 5IYBH 1N34H 4UPAA 1SNPA 3J7YW 3H0GA 2GA4B 3S2HH 2PMZE 1Q1BA 1PZKD 3GIJA 2BQ3A 1AE2A 3RF2A 1YNXA 3CMEA 1SN8A 4QWDA 4JV0A 1TXYA 1GYFA 2F4VL 2C2DA 2K5VA 4DV0Q 1N48A 3HOZB 4JI6H 4CDEC 5KFFA 4DR2Q 1N32H 1N36Q 4IPHA 1SBBB 4DK1A 4JI3H 3E0EA 2XWJB 3IG0A 1TKWB 3HOVG 2K28A 3MFYA 3V6KA 4CJ2C 4A3BG 1W96A 5M3MG 3J80L 2RSOA 3HB9A 4HYKA 5C5MA 1V1OA 3NGDA 3A5UA 1AUXA 1SCUB 4QIWA 1ILPA 4RZRA 4LSAA 1FL0A 2ZT9C 2YV5A 4MA0A 4TQRA 1PH1A 2YTYA 4JYAQ 4A3CG 2XCLA 1DOLA 4DV4Q 1MIUA 3NBHA 2F0IA 2KUMA 1M90C 2X69A 2C5CA 3LWUA 3DHQA 3H0GG 4QUCA 2K5NA 1JORA 3FDSA 1VQFA 4IO9A 2C2EA 5FJ8G 3I73A 1HJPA 2RQXA 2YTVA 1QUQA 1A2TA 2F0GA 4X62Q 1K83A 2ATLA 3WDNA 3M4OB 5C44H 1VQ4A 2YRXA 3CCSA 2ZM6Q 4NXMQ 3WNZA 2YW2A 1NR4A 4EYHB 4ED6A 1FJGH 2R92A 5D65A 4U7CA 3KFUA 1Z7TA 4LW1A 4JK1C 1IBML 4K2KA 4ECUA 2GPSA 5A2QE 4EBEA 3PVXA 2E76C 5C0XG 3KJOA 3KF8B 1B3QA 2F0PA 1SYCA 1B70B 4HIDA 3JAMc 2F0NA 3CCJA 2PN1A 2Z4IA 4DV0H 3CC4A 2R87A 3D6WA 4HIMA 4DR4H 1HXYD 1PRTD 4DR2H 4NLGA 4ZI7F 1N36H 1R4QB 1EYDA 4C3JG 4TV8F 2B2UA 4OO1H 1XX8A 3VPBA 4FS2A 3EVQA 2JEIA 2WKDA 2WACA 4MIUA 3H20A 3RN5A 4DR5Q 2BCOA 4A3FH 3DEOA 1WTOA 4I55F 4R4CA 3Q8PB 2I46A 4JYAH 1MGSA 3CD6A 3S17B 2XCPA 4DV4H 2E2HH 2CW0C 1WTPA 1EYCA 1YNJD 2R92G 3NTKA 1TWHA 4MV7A 1D5MC 5IYCG 1XPOA 5LYJF 4EGQA 4IUQA 1YHQA 4ZYSA 2IX1A 3T5HA 3M4YA 1EY8A 3GTKB 2F1MA 3ER0A 2L5TA 4E6IA 4QY7A 3BQ0A 2ZM6H 2EPBA 4NXMH 5JAVA 1Z2PX 2HVQA 5KG7A 3SK4A 1JB3A 2Y0SE 4ID6A 4LH7A 4KY5A 5IGFA 3KDFA 4O0AA 3GIDA 2KENA 1HUMA 2W9CA 2N3SA 2NZOA 3IL8A 1RJQA 1S5ED 2F0QA 1BVSA 1AP0A 2CHBD 1JB7A 3STBC 3J80c 4U6PA 1E1TA 4BBRG 5C3EG 1SNCA 3L4JA 4ED8A 3R2IA 1IOVA 2YU9B 5J2TF 1I94Q 1SDFA 4A3JG 1JKJB 2B39A 2Q8TA 5CV7A 5KT5A 4DL3A 3GTLB 3R3OA 3S16B 1EOTA 2CKZB 3CRLC 4RGMA 1XXGA 3GTGB 4DR5H 4AYBE 4JI2L 1N33L 4ECXA 4DV5H 1A3VA 3F2DA 3D31A 4BA2I 3AFQA 2QW7A 2KEEA 3V05A 5EPJA 4YR3A 4BS9A 2MPMA 3BA9A 4P71A 4IUTA 1CS0A 1FVIA 4F4ZA 4IOCA 1IBLQ 5AJ3Q 2DIKA 4UCSA 5KFNA 4EBDA 1EOVA 3LMLA 4DNRB 1I3QA 2O5JC 4L1KA 3KF6A 1D8LA 1U9RA 2JQOA 1VS0A 2FMAA 2EYLA 5IYBG 3RZDH 4O3OA 1IHZA 4RB3C 3IAYA 5IGEA 1MKHA 2A73B 4FDBA 1BCPB 1I50B 4C3HH 1EU3A 1ZKOA 4ECYA 4DK0A 3UE0A 4PZ7A 5KG5A 4MHEA 2WKCA 2IX0A 2JEFA 1HZAA 1KDAA 4UCOA 3G6JB 5DG7A 4LSXA 2QYZA 3BQ1A 1TWAA 3TDQA 4BY1H 3NSWA 1SAPA 2X0SA 4EEQA 3NPPA 5IWAQ 4KMUC 1B7YB 1PV4A 1S3OA 2XRQD 3T56B 1Y1WB 1F77A 2A5HA 2F0SA 4QUFA 4HEDA 2FK2A 1HHVA 1TWGH 1I94H 5T1IA 1N9WA 1QNUA 3K5NA 4GN4B 1L2FA 1VF7A 4G3IA 4J9SA 4RB2C 3OW2A 4LH6A 3CMAA 3PGZA 1BBWA 2UUAQ 1PZJD 2FE3A 2UXDL 2QK4A 1I5FA 4FNFA 4L5QA 5IP9H 5KNCA 5BR8L 1QZGA 3S1RB 1HPCA 1EZ6A 5J39A 2JA7H 5KFUA 4OX9Q 1IBLH 1GJXA 2YL2A 3GTJH 1B50A 1UEAB 4ED3A 3U9SA 3CCLA 2HUGA 2NU7B 5FPRA 4FU0A 2J4XA 4XQJA 3RV4A 4M8AA 2PZWA 2WE6A 3T16A 2VPSA 5EKKA 4IJLA 3PO3B 4Y7NH 4KHPQ 3S1QH 3W1BA 5LMUL 2R7DA 5EJWA 3FP9A 3JSLA 5DGBA 4DAVA 5DQIA 3SEBA 3TP5A 2VW9A 4HJ5A 4WD3A 1WOCA 4DV2Q 1ILQA 2VUGA 2WDTA 4TSSA 1QILA 4PMWA 1Z2NX 5CA1F 1K8OA 3V6HA 5IIFA 4ECTA 2KHJA 3S2DB 4L5SA 5IWAH 3KHGA 3CQZB 4RNOA 4KY6A 3HOWB 4DR6Q 4OO1G 3A55A 4DU9A 1N34L 4ZUJA 2W70A 1W3SA 2K52A 1K0SA 4A3FG 2CVRA 3NXWA 1FNVA 4B9XA 2FXQA 2W6QA 1RIPA 3MR6A 2OCEA 3H40A 5IYDG 3K0YA 2B2TA 1GO3E 4EQNA 4IUPA 3DLLA 3GILA 1YNJC 4JI6L 3Q1KA 1S0OA 2UUAH 1N32L 3V6JA 1JJGA 3S14B 4JI3L 2A69C 1X56A 4JUZA 1NAPA 2PW7A 5KG3A 4XYLB 1KAWA 3WOFA 5HGTA 4OX9H 1S10A 5IT9W 1J6QA 2RDJA 3F2BA 4YHHQ 1O80A 1UNNC 1JJCB 5KT4A 2OTLA 2JA6H 2AUJD 4J9QA 4YWKA 4K5VA 4NKLA 4RG1A 2JA8H 2JXMB 2IT1A 2RVLA 4A93H 1VAJA 1STHA 4KHPH 2YS6A 2RDGA 4ED0A 5BPHA 4HN7A 1LUZA 1DGSA 4MN3A 4C2MB 2F4IA 4DV2H 5KFYA 1MD2D 4IFDG 3NBIA 5LMNW 2W8KA 4IZ8A 3RB3A 2ZJTA 2R7ZH 3Q8DA 2X6LA 1D5XC 2M05A 2RSNA 5CV8A 1VCIA 5DLGA 1EY6A 4M9UA 4V0BA 4DR6H 1C4QA 3HOVB 4DK3C 4P2CB 4ECQA 1HH2P 1UNSA 3U50C 1GOZA 1LTBD 1VMPA 2NVQH 1HA6A 1K1QA 4IRKA 1X65A 1GHKA 1DYQA 4ZCKA 4J15A 5E4XA 1TWGA 2EY5A 4DFAA 3M4PA 2BH2A 4JBWA 2UVVA 4DV0L 1A9XA 3KLSX 1WCMH 5JPMC 4DR2L 3VPCA 1N36L 3GTKA 2HHHL 4P75A 2PW5A 4GKJQ 3H0GB 1OXUA 3TEHB 1SNDA 3BYYB 2F3WA 2ZXRA 4KK7A 2VOBA 3A8KE 1I6HB 5IY0A 1S40A 1TWFH 2YTXA 4C3HG 1DIKA 4YHHH 1BXTA 1LLRD 1SYEA 4LMQD 4ECVA 2JA7A 2ZXOA 3L9AX 2F0TA 2L11A 3S1MH 4JYAL 3CCRA 1KNEA 3OSOA 4K6DA 1GSOA 2AGPA 4C3IH 1M1KC 3WO1A 1Y1VB 3G6XA 2N88A 4A3IH 2XNAC 4HCSA 4BY1G 4RNMA 2H1EA 4JI5Q 1S5FD 4DAYB 2YU9A 1CSQA 1K1SA 3L3OC 3OUUA 4YJ2F 4QIWB 2C28A 1BBUA 3K7AH 4QIWE 4RCNA 4JI0Q 4X62L 5KT7A 2KEDA 5ELDA 2J7ZA 1ZYRD 3SI8A 3GTLA 2FLLA 3NQTA 5C3XA 3PSIA 3NBHB 2ZM6L 1A6XA 1MSHA 2D0PA 1HFNA 1U5KA 3GTPH 4O3NA 3DM1A 5KFJA 1HR0Q 1YBYA 3FPUB 3OW7A 4NDXA 2Z0SA 4A76A 3E0JA 4ZUIA 2F03A 5LP6F 2VR1A 4B08A 3RJ0A 3MR3A 5LL6b 1QUQB 2KJXA 1K83B 3GV7B 3ZJYC 2F0KA 1IOWA 3CVZA 3OSPA 5L9XA 1H9SB 1M4VA 2JA7G 4H13C 2WTFA 2RCFA 3MFGA 3DWQA 2DY7A 1RDPD 2IWHA 2WINB 4GKJH 4POFA 4N8FA 1I50A 3AYHB 5CC4A 1PTOB 5IOCA 1EUCB 1KRTA 2JA5B 3HBLA 2WAQA 4JG2A 3HOYH 4Y52H 1F2ZA 2DWCA 4ZQ3A 2V4DA 4DR5L 4QWBA 1STAA 4C5BA 2WYOA 4J9NA 1QWYA 1QNKA 1EYAA 3QJYA 5DLFA 2F0VA 2L9HA 1F2LA 3RZOB 2WFWA 4J6HA 1BUVT 1CK1A 4DR3Q 4O3RA 1AN7A 2R7LA 5M5XB 4X64Q 1Y1WA 5KYLA 1ENCA 1SFOH 3KBXA 5CV6A 3C1EA 2HIVA 5GONF 2EZVA 4JI5H 1TA8A 2K5HA 2Z6KC 3OIQA 1B1ZA 2ALZA 4KN7C 5FLXW 2R8KA 2QDLA 4JI0H 4BBRB 5C3EB 3ND9A 3ITPA 1YJWA 3PR5B 4X6AH 1I4QA 2R6GA 4GNXC 4EGVA 4A3JB 1Q81C 1TWHB 4DA2A 5KFMA 1HUNA 3M85A 5C4JB 2DJFC 2EJGC 2KBNA 5DQGA 1HR0H 1EWIA 2ENBA 1XWEA 4RKBA 2L12A 2XGTA 3T5KA 2EOTA 2WAQG 4XT3B 1HNXQ 2FP4B 1BOSA 4EBCA 1SNMA 5KFPA 2LXJA 1CFMA 2NZ1D 2KCNA 1VF5C 3QOLA 2R8GA 5KT3A 4WFN3 1S9FA 4FXDA 4X3UA 2HIXA 4JI2H 1PFSA 1U4MA 1B2TA 2NBFA 3E9HA 1EWHA 3RMHA 1BGWA 4KN4C 2F0MA 2JN4A 3G4SA 2Q2TA 5JQWA 3Q6SA 1XTCD 2ZXPA 1WCMA 1CQVA 4YP3A 2F0WA 2JA8G 2ASLA 2MFIA 3NTHA 3SE7A 2A68D 3PIOA 1A3UA 3A54A 4HTHA 3W1GA 3S2HB 2NU9B 4QQBX 4FYDA 4UP8A 3BJUA 4DV7Q 1I4RA 3PF4A 1ENFA 4FP5D 4QB4A 2VB3X 4DR3H 3CQZA 5JVDF 1VQOA 1IBLL 3M9OB 5AJ3L 2NU6B 2E8GA 2R7KA 5LMUQ 2A6EC 1SYBA 1KAAA 3W5OA 2W7PA 4MV3A 3RV3A 4DNIA 3LNNA 1SYGA 4LMYA 1HZ9A 1STGA 2GVBA 3BG3A 3PIP3 4XXEA 2YCHA 1CQFA 5KFAA 5DQHA 1STEA 4P73A 3RNUA 1SYXB 3CP0A 1PFMA 2VL6A 4DXGA 1STYA 4KHVA 3I91A 2NZHA 2R7FA 4HCEA 3T1HQ 1SJED 2K14A 5I6YA 1PRTF 3I70A 4RH6A 4FBTA 1WCMG 4GOPC 3J81E 1HNXH 4OO1I 3R93A 3DMUA 3GO5A 3RAQA 1B53A 1T5XD 5IWAL 1S03G 4ECSA 4MZ9A 1NBWA 5M5WH 1HNZQ 3VA5A 3N6XA 4R8UA 4Z9CB 2FK1A 3IFTA 4J1MA 2G5DA 5C44B 4I7HA 1Y8OB 3STBD 1B33N 3C3LA 1D2BA 3FMCA 3A0JA 1XTDA 4PG3A 3EYYA 4LUZA 4C2MA 5ELCA 2PO4A 2B2YA 1X3QA 1BCPF 3KLRA 3GTMH 1RK5A 3X3MA 4BXXH 3R5XA 1CT1D 4A3IG 2UUAL 1W6KA 3I4MH 2EYMA 4RZQA 2QDBA 1GUSA 4OL7A 2JEAI 4DV7H 1PDQA 3GV6A 3P7JA 1J5EQ 2PCFB 1YVCA 4H44C 4OX9L 4HSVA 1HTPA 1EIFA 4DUYQ 5LMUH 3DXJC 3UDFA 1QG7A 1ZYRC 3OUZA 1I6UA 1BJTA 1SNQA 1GD7A 3Q23A 3I4NH 3HXLA 3WWVA 1SFOA 1E4EB 4IR9A 2R86A 4KHPL 2HCCA 2A19A 3DUZA 4LFAQ 2K33A 4A3FB 3U9OA 4K5XA 2TSSA 2KQ3A 4N9TA 2I5LX 3A56A 4IFDI 4HJ8A 3BA8A 5L1IA 3T1HH 4DV2L 2E2HB 3WOEA 1Q12A 2JEGA 1ICWA 2C2RA 2K5QA 3CXCA 3E3XA 3RBEA 2BA1A 1HNZH 5BN5A 2E2DC 4A3GH 3QG1A 4DR6L 3HOYG 1XYIA 1B6RA 4RGTA 4CHTB 3H3VH 5EGTA 2HHHQ 2EJFC 3C0FB 1L1OC 3H3VC 1Y1VA 2IL8A 1YITA 2A8VA 3M9MB 2PYKA 1HRJA 3CF5A 4DAYA 3OMGA 1DCZA 3K5OA 5COYA 4LUOA 5FD6A 1CHPD 2B29A 2ZDQA 4ZK9B 4B3TQ 1LTAD 1LT4D 5CMDA 1XNRQ 2PZTA 4BY7H 2R85A 1KLUD 1J5EH 1WR2A 5FLMH 4O42A 4ZAIA 3I72A 5M3FH 2R6FA 1OXTA 1WTWA 4DUYH 2AWOA 2O5IC 1WTRA 4MA5A 2AHOB 3K5HA 4YHHL 2K75A 1LT6D 1QVGA 1GUWA 5CBAE 4RUCA 3OHAA 1G2SA 2PPBC 3C2PA 5K5PA 2CH4A 1IXRA 1UE1A 2ZTEA 3JAMi 4A3DH 4ILWA 1CZWA 3HKZA 2SCUB 3OPOA 4LFAH 1H9SA 2F0OA 1XPUA 2O4XA 4LJZC 4IALA 1EUDB 1VKZA 3GIQA 4QW8A 1A3TA 3QWNA 1SE8A 2K7VA 4QJFA 1OWTA 1Y1VG 2PNRC 3EPGA 4F8MA 1KDBA 1C7YA 4C5CA 3SK6A 1V1QA 2JA5A 5J2UF 5C4XH 4XYOA 2RGVA 4R4QA 4GN5A 5CV5A 2QA4A 2WIIB 1R9TH 4NMZA 3BVGA 4CKEA 1LTTD 3MAQA 3PUVA 2ZJQA 3RZDB 2QGQA 1LTSD 4JV5Q 4FO2A 1IYVA 1SMYC 5C4ZA 5M5YH 3PCOB 3K3PA 2ZJPA 3IKJA 2A68C 2HHHH 1WD1A 4C3HB 4A2BA 4KLKA 4AH6A 1EYZA 3T5JA 2HDMA 3A7AB 4G4KA 1VMCA 4MV6A 1PX2A 1JC7A 1KIXA 4KD3A 4B3TH 2VB2X 4ULLA 4RGOS 1XNRH 4BY1B 1JR0D 2SNMA 3HKZG 5D8DA 4B3RQ 1PH4A 4GKJL 2VXWA 3KHLA 3GTMA 5FOBB 2EXDA 4RGNA 3MFIA 2IPKD 4YWMA 3K58A 3GIMA 4EG0A 5IODA 1EQQA 2B2WC 2FLNA 1TWGB 4JOIC 4V190 4LFBQ 1II3A 2A69D 1PH2A 3DM3A 2JA5G 1FNUA 3MWMA 4OGQC 1HNWQ 2LKVA 4X62H 1TQOA 4PDBA 1LTGD 4G7OC 4TV9F 1JWSD 2MP1A 4LNQA 4GS3A 4N9PA 3TIGA 1B9NA 5H1SE 5DLQE 4JI5L 3CCMA 2RBMA 1A0IA 4CJ1B 3G6YA 4TKOB 2FJZA 3H4DA 1XPRA 3ICEA 4EQ5A 4ZKBB 3Q2OA 4J0MA 1C48A 3UDIA 4UP7A 4JI0L 3M7NA 2JA7B 3AB9A 2ES2A 2B63H 4XYMB 4F4WA 2VA2A 2HDLA 5AFWA 3GTJB 1PZID 2HT1A 1S5CD 1PXUA 3NTIA 1U4PA 1SE4A 2FK3A 4R8NA 4OWXB 1GM5A 2JEBI 1HR0L 2EYFA 1M6VA 3N40P 1BQQT 3VYRA 4JV5H 2RDFA 3TIIA 4Y7NB 1GXDC 1X54A 4BXXG 3S1QB 4QWCA 2F0FA 3I4MG 2DZDA 4IRCA 3RUZA 2V5AA 1D6EC 1UE7A 5D1OB 3CRKC 4R1JA 5CV9A 3HOXH 3TS0A 3NQIA 3JSNA 4KI0A 2R93H 1PRTB 2RDHA 4IR1A 2D2CC 4B3RH 3I4NG 2IHEA 1EIYB 5IP7G 3EFXD 5EWEA 3PIO3 4IPCA 2QEXA 1CA6A 4IWYA 3MC0B 4LFBH 1LABA 1SYDA 2Z4HA 4I50F 1C9OA 1CA5A 1HNWH 2W6PA 5KFOA 4ZHQF 3JC66 3JAME 3Q24A 4DR3L 4X3KA 1RCVD 5KFZA 2JYOA 2ZTDA 1M0WA 3N41B 4HQ6A 4OELB 4X64L 3TINA 4X66Q 3CPWA 2NB0A 2WAQB 1LTID 1YHAA 3SGIA 5FO8B 4DPGA 2WAQE 4BBSH 2W71A 5A2QW 2ASDA 5FO9B 2NVYH 1CM9A 1L0YB 4J9MA 2IY5B 1VQBA 1YJ9A 4L63B 5GAEC 5KG2A 5CGKA 1ZQ7A 4Q45A 3MFHA 2AGQA 1PTOF 2FMMA 1XMOQ 5ELNA 2N49A 3G71A 2PNHA 5F9LA 2EY6A 2UUBQ 2JA6B 5DAUA 1UE5A 2EE1A 1EEID 2JA8B 1AH9A 1E2WA 4IPGA 1ESRA 2R7MA 4A93B 2XD4A 4KKTA 2AWNA 1HNXL 2R7NA 2K6AA 5FK9C 1A63A 3IFDA 4IZOA 2F0EA 4OXPA 4A3KH 3KUPA 1I4PA 1E4FT 3K8AA 2OWOA 2E2IH 1KHIA 5DG8A 2J6TA 3D8GA 4N8X1 1U4RA 1G2TA 5LHY1 4IHJF 5CYUA 1NR2A 4LFCQ 1E4EA 2XCAA 2R7ZB 1Y69U 3OWFA 3PO2H 5ISRA 2BDOA 3NE5B 2RF4A 1K3BC 3MJFA 3NUCA 5C44G 1G91A 2Z6BA 1B44D 1F9RA 1HZCA 2E2HA 2NVQB 1DXMA 4G7ZC 5KNBA 4IWXA 2B2WA 1Z47A 3J7ZC 4DV7L 1XNQQ 4R7RA 1TS2A 5FLXc 3URYA 5JVG3 4ECRA 5J1ZA 5HGQA 2YS7A 1G291 4JI8L 1WJJA 4R4OA 2M9VA 3J80E 2XGQA 1WCMB 1T9HA 3HOUH 4X66H 1VQEA 4KHZA 4LAAA 1UE6A 4CKBA 4U673 3GLKA 1RTNA 1Q3LA 4LF8Q 5KFEA 3EBEA 3NELA 3OMCA 1D5ZC 1SRUA 2PQAB 1KJJA 4RAZA 5H80A 5LMNQ 1G6PA 3FMAA 3W2DA 4IURA 4IPDA 4QGUA 3Q8SB 2VUMH 1X3EA 1TWFB 5G3LF 4ZKCB 4DK6C 2UU9Q 1WTVA 3RB6A 1XMOH 4KD4A 2UUBH 3V2TA 3S1MB 1SEIA 1JOQA 2H5XA 3T1HL 2CQYA 1DOKA 5DM73 2GLTA 2V59A 4C3IB 5C3WA 4FXGC 3KJPA 3MZ5A 4HJ7A 4H7BA 1JCKB 4A3IB 2K05A 3KOJA 1SE2A 3SK8A 2RDIA 3RLNA 3QO2A 1NNXA 1HNZL 1QZHA 5CA0F 3G8CA 3K7AB 4K8JA 4LF5Q 3GTQH 1N56A 4LFCH 1FNWA 2QCPX 2VQFQ 1H9MA 1I7NA 1JE4A 4YWLA 4NP5A 4OHJA 2VQDA 4MV1A 5IGCA 4MTDA 4O4IF 3H4BA 4PV1C 3TP7A 3V4SA 3GTPB 3NHHA 4A3EH 4FF1A 1JDEA 2FJ2A 4HIOA 3F8NA 2UUCQ 1KC8C 1L2ZA 1ESFA 2EY2A 3KLWA 4R8UB 1IKLA 1TU2B 4WORA 1XNQH 2F0LA 2W6MA 4UHVA 1J5EL 3GIIA 4LF4Q 2DNCA 1L0WA 2FLPA 5I9PA 5KRUA 4DUYL 3SXHA 4HSPA 2NTSA 4POGA 1CQIB 2YRWA 1Q8KA 2P0AA 3ETHA 1X32A 1NY4A 3A74A 1PH9A 4O4HF 2W6NA 2CCZA 1M7JA 2PVPA 5IGBA 4LF8H 3M3YH 2A6ED 1E24A 3K7UC 5C6AA 4OWTB 2JP1A 4HJAA 3HOYB 1DJRD 5LMNH 4CKCA 2ASJA 2NVYA 3I3CA 4LFAL 4J9LA 4Q5VA 3CCEA 2SOBA 5GAHC 1NE3A 3BAAA 2FPPB 2UU9H 3UDGA 3I4LA 1B4OA 3GTOH 1PYSB 3GD7A 1TS3A 5D1PA 4ED1A 2D5DA 3OTOQ 4IN3A 1SFOB 2EJMA 2CW8A 1R4PB 3PMFA 1MHWC 4DL5A 2ATWA 1I4HA 2I07B 4BWGB 3RBDA 3VYTA 2W8LA 1HFGA 4YR0A 4LF5H 3KHRA 1A15A 4YAJB 1KJIA 3I7FA 1GUGA 4CBVA 3AMUA 2VQFH 1Y8PB 1Q90A 1S0NA 5KG6A 3R8BA 2IX3A 3VR6A 2DN8A 4O1NA 5DG9A 4A3MH 2UUCH 1RJTA 1S5DD 3J7A5 1JT8A 3OOCA 4B3TL 1QVFA 1XNRL 4ALPA 1JQYD 4BBSG 4DV6Q 5LL6X 1KEEA 3GTJA 3BVZA 2LY7A 1YJNA 1VBHA 1VBGA 4HIKA 4LF4H 2DJGC 3MXGA 3S24A 1ZHQA 1EZ8A 4I7ZC 4MNOA 4RA8A 3HEJA 4IQZA 1O7ZA 1Z9FA 2LS01 4QF4A 2ASBA 3BJYA 1EQTA 2BE5C 2DLNA 3PW5A 1ENAA 4UCRA 5KFLA 2XSCA 4YCUA 4XZ3B 3MR5A 4DAMA 1X3PA 1VQ5A 5D1OA 5FD5A 2HQLA 3MEHA 4KV6A 1IKMA 1O7LA 2ZDHA 4LUVA 1AN8A 2MJ8A 1RJPA 4A3KG 1NUCA 4TRDA 2QILA 4IUVA 1EIHA 5KGUA 3AU7A 3VDYA 3RIZA 1KD1C 2JEJA 2AGOA 1VQKA 3J81i 3OTOH 4Q8FA 2F0HA 1VQ9A 1AE3A 3TZUA 1MJCA 3BZCA 5IP9G 5J22A 3UDXA 4B9WA 3Q22A 3LP8A 3HRZC 3L4KA 3HKZB 3PO2G 4ZOLF 2K1BA 3HKZE 1SMXA 1B6SA 4EGJA 3GQBA 4RNNA 4EEYA 2B8FA 2MO0A 1WH2A 3RLOA 1AZQA 1IZ6A 1Z2OX 2NU8B 4ED7A 2L0CA 4JV5L 4RMFA 3P75A 2XC9A 4PMBA 1SEBD 2F3IA 4J9OA 1NMGA 2VS1A 4I7AA 3O13A 5JEAJ 5KT2A 1S68A 2JA9A 4DL4A 1MJEA 3EN2A 4GN3B 3SE0A 4WJ4A 1NMFA 2P5ZX 4UCVA 3HOUG
chains in the Genus database with same CATH topology
1GD7A 2I0QA 2F4VQ 3I4NH 3WWVA 4B3RL 1N8RC 2Y0SE 1LTLA 3KDFA 2OTJA 4O0AA 2KENA 4KHPL 2A19A 4LFAQ 3UE1A 2N3SA 2NZOA 4DR1L 4LFBL 2I5LX 4DV3L 1BVSA 4IFDI 2NVXH 1E22A 1VQ7A 2BH8A 1JB7A 3STBC 3J80c 4HJ8A 2Q2HA 1E1TA 4BBRG 5C3EG 1VQ8A 2UXBQ 4LF6Q 4DV2L 4XIGS 1I50H 1HNWL 1A8VA 1Q12A 1I94Q 4A3JG 2B63G 1EQRA 3CXCA 2BA1A 2RHQB 3OYYA 1IL2A 3I4OA 4A3BH 2N8NA 3HOZG 2WB1E 3B6YA 5M3MH 2CKZB 4A3GH 3H3VI 4DR6L 3HOYG 4L5RC 4A3LG 4AYBE 4JI2L 2CWAA 1N33L 3H3VH 3F2DA 4BA2I 3D31A 2HHHQ 4JC0A 3AFQA 1L1OC 3I56A 4A3CH 2KHIA 1Y1WH 2MO1A 1YITA 2A8VA 1X3FA 3KYHC 4GLAC 4P71A 1FVIA 3PUXA 3CF5A 4IOCA 1IBLQ 1YHBA 2UXCL 1CSPA 5AJ3Q 1YIJA 3ULLA 4LUOA 1XMQQ 4A3EG 1XJVA 3HOXG 1EOVA 1K8GA 1JE5A 2B29A 4B3TQ 2R93G 3KF6A 1XNRQ 1D8LA 3F8TA 4BY7H 1Q1EA 2JQOA 1VS0A 3HFZB 4X65Q 1IBMQ 2JA6G 5IYBG 3RZDH 5FLMH 1K73C 1MKHA 3MXNB 4JBJA 5M3FH 4OWWB 1OXTA 4DV1Q 2AWOA 4A93G 4FDBA 4C3HH 3S1RH 2AHOB 1LYLA 3UE0A 4PZ7A 4YHHL 2PQAA 4GNXB 2K75A 1FJGL 3L0OA 4A4IA 1QVGA 2IX0A 2OQKA 5C0XI 2DGYA 4UY8C 4JI4Q 1HZAA 1IXRA 1UE1A 2ZTEA 3JAMi 4JI8Q 4DR7L 4A3DH 1GVPA 4L5TA 4BY1H 1UEBA 3CW2C 5IWAQ 2R7ZG 1L1OB 1XPUA 1B7YB 2A1AA 1PV4A 1G51A 1S3OA 1IBKQ 4TVAB 3ULPA 3PO3H 4QJFA 1SE8A 2AMCB 1Y1VG 1PH6A 2OQ0A 1C7YA 4DR4L 3CPFA 1TWGH 2V1CC 1C0AA 1V1QA 1N9WA 4IFDJ 4C3JH 2CWPA 5C4XH 4LF7L 4GN4B 4R4QA 1LM0A 1EUJA 1L2FA 4GN5A 2E2JH 4X66L 4B3SL 3I2ZA 5GADC 2QA4A 2ZTCA 3AEVA 1R9TH 1U0LA 4YY3L 3OW2A 3NEMA 3PUVA 1X6OA 3CMAA 2ZJQA 3S2DH 2QGQA 3PGZA 1BBWA 2UUAQ 1PYBA 4JV5Q 2UXDL 5M5YH 3CQZH 1I5FA 3PCOB 4L5QA 4MTNA 5IP9H 2ZJPA 4XTCS 5BR8L 3U58A 4KLKA 4AH6A 5JEAG 5EAYA 1QZGA 3HOWH 1VQGA 4BA1I 4DV4L 2R92H 1XMOL 2Q2UA 4IJHA 2JA7H 3GDEA 4OX9Q 2UUBL 1NJIC 1E7ZA 4OONA 3GTJH 4A3MG 1KIXA 1OXXK 1YI2A 3CCLA 1Q7YC 2JK8A 2LSSA 1W2BA 2MQHA 3HKZG 2JJQA 3K81C 1PH4A 4B3RQ 4GKJL 1VQDA 2EXDA 4IJLA 4YCWA 3PF5A 4Y7NH 4YWMA 2C35B 4KHPQ 3S1QH 3W1BA 1EFWA 2I5HA 3S14H 1EQQA 5LMUL 2R7DA 2I5MX 4APVA 4DR1Q 4JOIC 4LFBQ 4DV3Q 3FP9A 4NXML 1Q86C 3FHWA 4LFCL 2BA0A 1PH2A 3DM3A 1PH7A 2IHFA 2VW9A 3CCVA 2JA5G 4HJ5A 3K0XA 1WOCA 4DV2Q 1HNWQ 3TREA 3K80C 4PMWA 1E1OA 4P72A 2K4KA 1OXVA 1NTGA 2KHJA 4GS3A 4R4TA 4GOPB 4LNQA 4L5SA 5GROA 2Y0SG 5H1SE 5DLQE 4JI5L 3HKSA 3CCMA 2K50A 4PZ6A 4LF9L 1A0IA 4DR6Q 4B3ML 4OO1G 1N34L 1XNQL 1XPRA 3ICEA 4JI2Q 4EQ5A 1N33Q 3E9IA 1CKNA 2Z6KA 1W3SA 2K52A 4TQUS 4UP7A 3UDIA 4A3FG 4JI0L 2ES2A 2E5LL 2B3GA 4C2MH 2B63H 3M7NA 2YYZA 1GKHA 1SLJA 1Y14B 1PVOA 2FXQA 2HT1A 1RIPA 2PI2E 2VUMG 2OCEA 4UP9A 4A75A 1H95A 4QL5A 5IYDG 3J81c 2UXCQ 4LWCA 1GO3E 4GNXA 3DLLA 3FKIH 4OWXB 1GM5A 2JEBI 4H02A 1HR0L 1ASZA 4JI6L 4LF8L 1N32L 1TWCH 4DV5L 1S72A 1X54A 4BXXG 5LMNL 1JJGA 3NENA 2WB1G 2RHSB 3I4MG 3HOVH 2JE6I 4JI3L 1B8AA 1X56A 2UU9L 4AYBG 4DKAC 1CKOA 1KAWA 2GVAA 1UE7A 3HOXH 4R1JA 3TS0A 1J6QA 4PZ8A 4KI0A 2R93H 3F2BA 4YHHQ 1UWVA 3CC7A 1FJGQ 1JJCB 2OTLA 2JA6H 3PV0A 3I4NG 2IHEA 1EIYB 4YWKA 3G48A 5IP7G 1VQHA 4RG1A 3F2CA 1JMCA 2JA8H 4DR7Q 2IT1A 3PUZA 4A93H 4IPCA 2QEXA 4GKKL 3H0GH 4EX5A 4LF5L 1LUZA 1DGSA 3AQQA 3PUWA 1RL2A 1K9MC 5FJ8H 4P74A 1HZBA 2VQFL 1I6HH 3AFPA 1V43A 1C9OA 1HR0W 2CQOA 4JI7L 1X9NA 3JC66 4DR4Q 4IFDG 4JBKA 5IE8A 4DR3L 5JJIA 5LMNW 2ZTDA 4LF7Q 1K8AC 2R7ZH 4X64L 3Q8DA 4X66Q 3CPWA 3CCQA 2UUCL 4B3SQ 1YHAA 3SGIA 4K0KL 1VCIA 5GQOA 2WAQE 4DPGA 4BBSH 2NVYH 1Y1VH 4DK3C 1PH8A 2VZAA 2IY5B 1P16A 1VQBA 1HH2P 3H15A 1YJ9A 3U50C 5GAEC 2UXDQ 4LF4L 1X3GA 2NVQH 1I94L 5BR8Q 1X65A 1VQPA 1Y1WG 3CC2A 3KDFB 4J15A 1XMOQ 2NN6I 5ELOA 3TQYA 1I3QH 5ELNA 2N49A 4O2DA 2PNHA 3G71A 2UUBQ 3M4PA 1Q82C 4JBWA 2BH2A 2EQSA 1UE5A 2ZJRA 4DV0L 1WCMH 1AH9A 4IPGA 4DR2L 1KL9A 1N36L 2HHHL 4P75A 5GAGC 2AWNA 5JJLA 1HNXL 4GKJQ 1A63A 1CKMA 1OXUA 1VQMA 3TEHB 1E3PA 4OXPA 4GOPA 4A3KH 2D62A 3S1NH 1VQ6A 3K8AA 2OWOA 1EYGA 2E2IH 1KHIA 3S15H 5IY0A 1S40A 4AQYL 1JJ2A 1TWFH 1K83H 2YTXA 4LFCQ 5J3BA 3OTOL 1PH5A 1TWAH 1WFQA 3BU2A 3S1MH 4JYAL 1YEZA 3PO2H 3CCRA 1SR3A 4C3IH 1M1KC 1WYDA 5IT9c 5IYCH 2RF4A 1KRSA 5C44G 4A3IH 2NVTH 4BY1G 1HZCA 4JCVE 4DAYB 4JI5Q 3TRZA 2JA5H 4LF9Q 1CSQA 2KCTA 4B3MQ 1VQIA 1CUKA 1QVCA 1Z47A 3J7ZC 2VQEL 5FLXc 4DV7L 1N34Q 1XNQQ 3PO3G 1BBUA 3K7AH 4QIWE 3U4ZA 5HGQA 4X62L 1G291 2GN5A 3KF6B 4JI8L 1K0RA 3CCUA 2E5LQ 3BZKA 1WJJA 4R4OA 1T9HA 3PSIA 3NBHB 3HOUH 4NB3A 2ZM6L 1VQEA 4KHZA 3T1YL 4NPSA 1VQJA 1UE6A 3ULJA 2D0PA 3RZOH 3U4VA 1U5KA 3GTPH 1HR0Q 1YBYA 5M5XH 2L15A 4DV6L 4JI6Q 4LF8Q 2Z0SA 3EBEA 3NELA 4A76A 1SRUA 2PQAB 2MNAA 4DV5Q 1N32Q 3F1ZA 3M9BA 3J80i 5LMNQ 1G6PA 1A62A 1P8LA 2CFMA 4QGUA 4IPDA 5C0XJ 2VUMH 1X3EA 1QUQB 1IYJB 4JI3Q 3HOWG 2VNUD 4DK6C 2UU9Q 5IYDH 3ZJYC 4BBRH 2XTIA 5C3EH 1FGUA 4DUZL 4HJ9A 1KQSA 2JA7G 5JJKA 2H5XA 3T1HL 4NXNL 1OTCA 3TS2A 3EIVA 4A3JH 1TWHH 2ALYB 3L7ZC 3J81j 3KJPA 4HJ7A 5C4JH 3KOJA 4POFA 3RR5A 3AYHB 3HOZH 3RLNA 1KRTA 1HNZL 1QZHA 4JG2A 3HOYH 5HY6A 4A3LH 5K36G 4Y52H 3CAMA 4GKKQ 2DUDA 4DR5L 4LF5Q 2AKWB 3GTQH 1WI5A 2VQFQ 4YWLA 5IP7H 4JI1L 4JI7Q 2RCNA 3PUYA 1KXLA 1L1OA 2WFWA 4DR3Q 2KCMA 4A3EH 2D0OA 4X64Q 2WP8J 4HIOA 1SFOH 4JBMA 2UUCQ 1KC8C 3M4QA 4K0KQ 2HIVA 3KLWA 1VQCA 2K5HA 2Z6KC 5IYBH 4UPAA 2EIFA 1J5EL 4YCVA 3S2HH 4LF4Q 2PMZE 1L0WA 1YJWA 1Q1BA 4X6AH 4R4IA 4DUYL 1X55A 4POGA 2R6GA 4GLVB 4GNXC 1AE2A 1Q8KA 1YNXA 3LGJA 3CMEA 1SN8A 1Q81C 3A5ZB 1TXYA 1NY4A 3A74A 2N78A 3M85A 1PH9A 2K5VA 2F4VL 2CCZA 3M4OH 4DV0Q 2KBNA 1EWIA 2LXKA 3FKIG 3M3YH 3K7UC 1E24A 2XGTA 4DR2Q 4OWTB 4HJAA 1N36Q 4GLXA 2WAQG 4IPHA 1HNXQ 4LFAL 2LXJA 3CCEA 5GAHC 1NE3A 3E0EA 3UDGA 4YY3Q 3HOVG 4A3BG 3GTOH 3RLFA 5M3MG 1PYSB 4A3GG 2UXBL 2HIXA 3GD7A 1PFSA 4AQYQ 4LF6L 3A5UA 1PA6A 3E9HA 1FL0A 3OTOQ 2YV5A 2F52A 3G4SA 1PH1A 2YTYA 2Q2TA 4A3CG 4JYAQ 1CKNB 4DV4Q 1MIUA 3L2PA 2ATWA 1VQLA 2JA8G 2MFIA 1O7IA 1M90C 4WJ3M 3PIOA 3W1GA 3H0GG 2K5NA 3I7FA 4QQBX 4UP8A 3BJUA 4AIMA 1VQFA 4IO9A 4DV7Q 3PF4A 2VQEQ 5FJ8G 1HJPA 4BY7G 2YTVA 1QUQA 4X62Q 3D0FA 5FLMG 1ASYA 1OXSC 1VQOA 1IBLL 5C44H 5AJ3L 4A3MH 3CCSA 2E8GA 5M3FG 2ID0A 5LMUQ 1VQ4A 1XMQL 1Q46A 1V9PA 2ZM6Q 3W5OA 3T1YQ 4NXMQ 3S17H 3J7A5 1JT8A 4B3TL 4DNIA 4IOAA 1QVFA 1XNRL 4ALPA 1HZ9A 4BBSG 3KFUA 4DV6Q 4LW1A 1IBML 2GVBA 4X65L 3G6EA 2PI2A 1YJNA 4HIKA 3MEFA 4P73A 5C0XG 3KJOA 3KF8B 4DV1L 3I55A 3S24A 3RNUA 4A3DG 4JI0Q 1B70B 3CP0A 4MNOA 4HIDA 3JAMc 1Z9FA 2VL6A 3CCJA 3GTKH 4DUZQ 2ASBA 2NZHA 2R7FA 4JOIA 3CC4A 3T1HQ 4NXNQ 4HIMA 3RN2A 4JI4L 2K14A 2NN6G 1WCMG 4YCUA 4GOPC 4OO1I 4DAMA 1VQ5A 3GO5A 5C4XG 2HQLA 5IWAL 4LUVA 1PH3A 4MZ9A 1NBWA 5M5WH 1HNZQ 4A3KG 1IBKL 1D7QA 5E7NA 3VDYA 3RN5A 4DR5Q 4A3FH 1KD1C 1VQKA 4R4CA 3J81i 1VQ9A 1VQAA 1AE3A 1MJCA 3BZCA 5IP9G 4JI1Q 3UDXA 3STBD 2Q2IA 3CD6A 3A0JA 2E2HH 1XTDA 4PG3A 3PO2G 4LUZA 3PIPA 3HKZE 1SMXA 3ERSX 2YU9H 2R92G 1K3RA 3GTMH 2MO0A 5IYCG 1XPOA 3RLOA 1IZ6A 4BXXH 4A3IG 4RMFA 1PHJA 2UUAL 3GTLH 3I4MH 4JV5L 2VY3A 3S16H 2F3IA 2JEAI 1NMGA 1VQNA 1YHQA 2VS1A 2IX1A 3GTGH 5JEAJ 1J5EQ 1YVCA 3IRBA 2JA9A 3ER0A 4OX9L 1BKBA 1EIFA 3EN2A 4GN3B 4QY7A 4DUYQ 4ME3A 1MJEA 4WJ4A 1SROA 3UDFA 1NMFA 1YZ6A 3HOUG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GD7 A;  2I0Q A;  2F4V Q;  3I4N H;  3WWV A;  4B3R L;  1N8R C;  2Y0S E;  1LTL A;  3KDF A;  2OTJ A;  4O0A A;  2KEN A;  4KHP L;  2A19 A;  4LFA Q;  3UE1 A;  2N3S A;  2NZO A;  4DR1 L;  4LFB L;  2I5L X;  4DV3 L;  1BVS A;  4IFD I;  2NVX H;  1E22 A;  1VQ7 A;  2BH8 A;  1JB7 A;  3STB C;  3J80 c;  4HJ8 A;  2Q2H A;  1E1T A;  4BBR G;  5C3E G;  1VQ8 A;  2UXB Q;  4LF6 Q;  4DV2 L;  4XIG S;  1I50 H;  1HNW L;  1A8V A;  1Q12 A;  1I94 Q;  4A3J G;  2B63 G;  1EQR A;  3CXC A;  2BA1 A;  2RHQ B;  3OYY A;  1IL2 A;  3I4O A;  4A3B H;  2N8N A;  3HOZ G;  2WB1 E;  3B6Y A;  5M3M H;  2CKZ B;  4A3G H;  3H3V I;  4DR6 L;  3HOY G;  4L5R C;  4A3L G;  4AYB E;  4JI2 L;  2CWA A;  1N33 L;  3H3V H;  3F2D A;  4BA2 I;  3D31 A;  2HHH Q;  4JC0 A;  3AFQ A;  1L1O C;  3I56 A;  4A3C H;  2KHI A;  1Y1W H;  2MO1 A;  1YIT A;  2A8V A;  1X3F A;  3KYH C;  4GLA C;  4P71 A;  1FVI A;  3PUX A;  3CF5 A;  4IOC A;  1IBL Q;  1YHB A;  2UXC L;  1CSP A;  5AJ3 Q;  1YIJ A;  3ULL A;  4LUO A;  1XMQ Q;  4A3E G;  1XJV A;  3HOX G;  1EOV A;  1K8G A;  1JE5 A;  2B29 A;  4B3T Q;  2R93 G;  3KF6 A;  1XNR Q;  1D8L A;  3F8T A;  4BY7 H;  1Q1E A;  2JQO A;  1VS0 A;  3HFZ B;  4X65 Q;  1IBM Q;  2JA6 G;  5IYB G;  3RZD H;  5FLM H;  1K73 C;  1MKH A;  3MXN B;  4JBJ A;  5M3F H;  4OWW B;  1OXT A;  4DV1 Q;  2AWO A;  4A93 G;  4FDB A;  4C3H H;  3S1R H;  2AHO B;  1LYL A;  3UE0 A;  4PZ7 A;  4YHH L;  2PQA A;  4GNX B;  2K75 A;  1FJG L;  3L0O A;  4A4I A;  1QVG A;  2IX0 A;  2OQK A;  5C0X I;  2DGY A;  4UY8 C;  4JI4 Q;  1HZA A;  1IXR A;  1UE1 A;  2ZTE A;  3JAM i;  4JI8 Q;  4DR7 L;  4A3D H;  1GVP A;  4L5T A;  4BY1 H;  1UEB A;  3CW2 C;  5IWA Q;  2R7Z G;  1L1O B;  1XPU A;  1B7Y B;  2A1A A;  1PV4 A;  1G51 A;  1S3O A;  1IBK Q;  4TVA B;  3ULP A;  3PO3 H;  4QJF A;  1SE8 A;  2AMC B;  1Y1V G;  1PH6 A;  2OQ0 A;  1C7Y A;  4DR4 L;  3CPF A;  1TWG H;  2V1C C;  1C0A A;  1V1Q A;  1N9W A;  4IFD J;  4C3J H;  2CWP A;  5C4X H;  4LF7 L;  4GN4 B;  4R4Q A;  1LM0 A;  1EUJ A;  1L2F A;  4GN5 A;  2E2J H;  4X66 L;  4B3S L;  3I2Z A;  5GAD C;  2QA4 A;  2ZTC A;  3AEV A;  1R9T H;  1U0L A;  4YY3 L;  3OW2 A;  3NEM A;  3PUV A;  1X6O A;  3CMA A;  2ZJQ A;  3S2D H;  2QGQ A;  3PGZ A;  1BBW A;  2UUA Q;  1PYB A;  4JV5 Q;  2UXD L;  5M5Y H;  3CQZ H;  1I5F A;  3PCO B;  4L5Q A;  4MTN A;  5IP9 H;  2ZJP A;  4XTC S;  5BR8 L;  3U58 A;  4KLK A;  4AH6 A;  5JEA G;  5EAY A;  1QZG A;  3HOW H;  1VQG A;  4BA1 I;  4DV4 L;  2R92 H;  1XMO L;  2Q2U A;  4IJH A;  2JA7 H;  3GDE A;  4OX9 Q;  2UUB L;  1NJI C;  1E7Z A;  4OON A;  3GTJ H;  4A3M G;  1KIX A;  1OXX K;  1YI2 A;  3CCL A;  1Q7Y C;  2JK8 A;  2LSS A;  1W2B A;  2MQH A;  3HKZ G;  2JJQ A;  3K81 C;  1PH4 A;  4B3R Q;  4GKJ L;  1VQD A;  2EXD A;  4IJL A;  4YCW A;  3PF5 A;  4Y7N H;  4YWM A;  2C35 B;  4KHP Q;  3S1Q H;  3W1B A;  1EFW A;  2I5H A;  3S14 H;  1EQQ A;  5LMU L;  2R7D A;  2I5M X;  4APV A;  4DR1 Q;  4JOI C;  4LFB Q;  4DV3 Q;  3FP9 A;  4NXM L;  1Q86 C;  3FHW A;  4LFC L;  2BA0 A;  1PH2 A;  3DM3 A;  1PH7 A;  2IHF A;  2VW9 A;  3CCV A;  2JA5 G;  4HJ5 A;  3K0X A;  1WOC A;  4DV2 Q;  1HNW Q;  3TRE A;  3K80 C;  4PMW A;  1E1O A;  4P72 A;  2K4K A;  1OXV A;  1NTG A;  2KHJ A;  4GS3 A;  4R4T A;  4GOP B;  4LNQ A;  4L5S A;  5GRO A;  2Y0S G;  5H1S E;  5DLQ E;  4JI5 L;  3HKS A;  3CCM A;  2K50 A;  4PZ6 A;  4LF9 L;  1A0I A;  4DR6 Q;  4B3M L;  4OO1 G;  1N34 L;  1XNQ L;  1XPR A;  3ICE A;  4JI2 Q;  4EQ5 A;  1N33 Q;  3E9I A;  1CKN A;  2Z6K A;  1W3S A;  2K52 A;  4TQU S;  4UP7 A;  3UDI A;  4A3F G;  4JI0 L;  2ES2 A;  2E5L L;  2B3G A;  4C2M H;  2B63 H;  3M7N A;  2YYZ A;  1GKH A;  1SLJ A;  1Y14 B;  1PVO A;  2FXQ A;  2HT1 A;  1RIP A;  2PI2 E;  2VUM G;  2OCE A;  4UP9 A;  4A75 A;  1H95 A;  4QL5 A;  5IYD G;  3J81 c;  2UXC Q;  4LWC A;  1GO3 E;  4GNX A;  3DLL A;  3FKI H;  4OWX B;  1GM5 A;  2JEB I;  4H02 A;  1HR0 L;  1ASZ A;  4JI6 L;  4LF8 L;  1N32 L;  1TWC H;  4DV5 L;  1S72 A;  1X54 A;  4BXX G;  5LMN L;  1JJG A;  3NEN A;  2WB1 G;  2RHS B;  3I4M G;  3HOV H;  2JE6 I;  4JI3 L;  1B8A A;  1X56 A;  2UU9 L;  4AYB G;  4DKA C;  1CKO A;  1KAW A;  2GVA A;  1UE7 A;  3HOX H;  4R1J A;  3TS0 A;  1J6Q A;  4PZ8 A;  4KI0 A;  2R93 H;  3F2B A;  4YHH Q;  1UWV A;  3CC7 A;  1FJG Q;  1JJC B;  2OTL A;  2JA6 H;  3PV0 A;  3I4N G;  2IHE A;  1EIY B;  4YWK A;  3G48 A;  5IP7 G;  1VQH A;  4RG1 A;  3F2C A;  1JMC A;  2JA8 H;  4DR7 Q;  2IT1 A;  3PUZ A;  4A93 H;  4IPC A;  2QEX A;  4GKK L;  3H0G H;  4EX5 A;  4LF5 L;  1LUZ A;  1DGS A;  3AQQ A;  3PUW A;  1RL2 A;  1K9M C;  5FJ8 H;  4P74 A;  1HZB A;  2VQF L;  1I6H H;  3AFP A;  1V43 A;  1C9O A;  1HR0 W;  2CQO A;  4JI7 L;  1X9N A;  3JC6 6;  4DR4 Q;  4IFD G;  4JBK A;  5IE8 A;  4DR3 L;  5JJI A;  5LMN W;  2ZTD A;  4LF7 Q;  1K8A C;  2R7Z H;  4X64 L;  3Q8D A;  4X66 Q;  3CPW A;  3CCQ A;  2UUC L;  4B3S Q;  1YHA A;  3SGI A;  4K0K L;  1VCI A;  5GQO A;  2WAQ E;  4DPG A;  4BBS H;  2NVY H;  1Y1V H;  4DK3 C;  1PH8 A;  2VZA A;  2IY5 B;  1P16 A;  1VQB A;  1HH2 P;  3H15 A;  1YJ9 A;  3U50 C;  5GAE C;  2UXD Q;  4LF4 L;  1X3G A;  2NVQ H;  1I94 L;  5BR8 Q;  1X65 A;  1VQP A;  1Y1W G;  3CC2 A;  3KDF B;  4J15 A;  1XMO Q;  2NN6 I;  5ELO A;  3TQY A;  1I3Q H;  5ELN A;  2N49 A;  4O2D A;  2PNH A;  3G71 A;  2UUB Q;  3M4P A;  1Q82 C;  4JBW A;  2BH2 A;  2EQS A;  1UE5 A;  2ZJR A;  4DV0 L;  1WCM H;  1AH9 A;  4IPG A;  4DR2 L;  1KL9 A;  1N36 L;  2HHH L;  4P75 A;  5GAG C;  2AWN A;  5JJL A;  1HNX L;  4GKJ Q;  1A63 A;  1CKM A;  1OXU A;  1VQM A;  3TEH B;  1E3P A;  4OXP A;  4GOP A;  4A3K H;  2D62 A;  3S1N H;  1VQ6 A;  3K8A A;  2OWO A;  1EYG A;  2E2I H;  1KHI A;  3S15 H;  5IY0 A;  1S40 A;  4AQY L;  1JJ2 A;  1TWF H;  1K83 H;  2YTX A;  4LFC Q;  5J3B A;  3OTO L;  1PH5 A;  1TWA H;  1WFQ A;  3BU2 A;  3S1M H;  4JYA L;  1YEZ A;  3PO2 H;  3CCR A;  1SR3 A;  4C3I H;  1M1K C;  1WYD A;  5IT9 c;  5IYC H;  2RF4 A;  1KRS A;  5C44 G;  4A3I H;  2NVT H;  4BY1 G;  1HZC A;  4JCV E;  4DAY B;  4JI5 Q;  3TRZ A;  2JA5 H;  4LF9 Q;  1CSQ A;  2KCT A;  4B3M Q;  1VQI A;  1CUK A;  1QVC A;  1Z47 A;  3J7Z C;  2VQE L;  5FLX c;  4DV7 L;  1N34 Q;  1XNQ Q;  3PO3 G;  1BBU A;  3K7A H;  4QIW E;  3U4Z A;  5HGQ A;  4X62 L;  1G29 1;  2GN5 A;  3KF6 B;  4JI8 L;  1K0R A;  3CCU A;  2E5L Q;  3BZK A;  1WJJ A;  4R4O A;  1T9H A;  3PSI A;  3NBH B;  3HOU H;  4NB3 A;  2ZM6 L;  1VQE A;  4KHZ A;  3T1Y L;  4NPS A;  1VQJ A;  1UE6 A;  3ULJ A;  2D0P A;  3RZO H;  3U4V A;  1U5K A;  3GTP H;  1HR0 Q;  1YBY A;  5M5X H;  2L15 A;  4DV6 L;  4JI6 Q;  4LF8 Q;  2Z0S A;  3EBE A;  3NEL A;  4A76 A;  1SRU A;  2PQA B;  2MNA A;  4DV5 Q;  1N32 Q;  3F1Z A;  3M9B A;  3J80 i;  5LMN Q;  1G6P A;  1A62 A;  1P8L A;  2CFM A;  4QGU A;  4IPD A;  5C0X J;  2VUM H;  1X3E A;  1QUQ B;  1IYJ B;  4JI3 Q;  3HOW G;  2VNU D;  4DK6 C;  2UU9 Q;  5IYD H;  3ZJY C;  4BBR H;  2XTI A;  5C3E H;  1FGU A;  4DUZ L;  4HJ9 A;  1KQS A;  2JA7 G;  5JJK A;  2H5X A;  3T1H L;  4NXN L;  1OTC A;  3TS2 A;  3EIV A;  4A3J H;  1TWH H;  2ALY B;  3L7Z C;  3J81 j;  3KJP A;  4HJ7 A;  5C4J H;  3KOJ A;  4POF A;  3RR5 A;  3AYH B;  3HOZ H;  3RLN A;  1KRT A;  1HNZ L;  1QZH A;  4JG2 A;  3HOY H;  5HY6 A;  4A3L H;  5K36 G;  4Y52 H;  3CAM A;  4GKK Q;  2DUD A;  4DR5 L;  4LF5 Q;  2AKW B;  3GTQ H;  1WI5 A;  2VQF Q;  4YWL A;  5IP7 H;  4JI1 L;  4JI7 Q;  2RCN A;  3PUY A;  1KXL A;  1L1O A;  2WFW A;  4DR3 Q;  2KCM A;  4A3E H;  2D0O A;  4X64 Q;  2WP8 J;  4HIO A;  1SFO H;  4JBM A;  2UUC Q;  1KC8 C;  3M4Q A;  4K0K Q;  2HIV A;  3KLW A;  1VQC A;  2K5H A;  2Z6K C;  5IYB H;  4UPA A;  2EIF A;  1J5E L;  4YCV A;  3S2H H;  4LF4 Q;  2PMZ E;  1L0W A;  1YJW A;  1Q1B A;  4X6A H;  4R4I A;  4DUY L;  1X55 A;  4POG A;  2R6G A;  4GLV B;  4GNX C;  1AE2 A;  1Q8K A;  1YNX A;  3LGJ A;  3CME A;  1SN8 A;  1Q81 C;  3A5Z B;  1TXY A;  1NY4 A;  3A74 A;  2N78 A;  3M85 A;  1PH9 A;  2K5V A;  2F4V L;  2CCZ A;  3M4O H;  4DV0 Q;  2KBN A;  1EWI A;  2LXK A;  3FKI G;  3M3Y H;  3K7U C;  1E24 A;  2XGT A;  4DR2 Q;  4OWT B;  4HJA A;  1N36 Q;  4GLX A;  2WAQ G;  4IPH A;  1HNX Q;  4LFA L;  2LXJ A;  3CCE A;  5GAH C;  1NE3 A;  3E0E A;  3UDG A;  4YY3 Q;  3HOV G;  4A3B G;  3GTO H;  3RLF A;  5M3M G;  1PYS B;  4A3G G;  2UXB L;  2HIX A;  3GD7 A;  1PFS A;  4AQY Q;  4LF6 L;  3A5U A;  1PA6 A;  3E9H A;  1FL0 A;  3OTO Q;  2YV5 A;  2F52 A;  3G4S A;  1PH1 A;  2YTY A;  2Q2T A;  4A3C G;  4JYA Q;  1CKN B;  4DV4 Q;  1MIU A;  3L2P A;  2ATW A;  1VQL A;  2JA8 G;  2MFI A;  1O7I A;  1M90 C;  4WJ3 M;  3PIO A;  3W1G A;  3H0G G;  2K5N A;  3I7F A;  4QQB X;  4UP8 A;  3BJU A;  4AIM A;  1VQF A;  4IO9 A;  4DV7 Q;  3PF4 A;  2VQE Q;  5FJ8 G;  1HJP A;  4BY7 G;  2YTV A;  1QUQ A;  4X62 Q;  3D0F A;  5FLM G;  1ASY A;  1OXS C;  1VQO A;  1IBL L;  5C44 H;  5AJ3 L;  4A3M H;  3CCS A;  2E8G A;  5M3F G;  2ID0 A;  5LMU Q;  1VQ4 A;  1XMQ L;  1Q46 A;  1V9P A;  2ZM6 Q;  3W5O A;  3T1Y Q;  4NXM Q;  3S17 H;  3J7A 5;  1JT8 A;  4B3T L;  4DNI A;  4IOA A;  1QVF A;  1XNR L;  4ALP A;  1HZ9 A;  4BBS G;  3KFU A;  4DV6 Q;  4LW1 A;  1IBM L;  2GVB A;  4X65 L;  3G6E A;  2PI2 A;  1YJN A;  4HIK A;  3MEF A;  4P73 A;  5C0X G;  3KJO A;  3KF8 B;  4DV1 L;  3I55 A;  3S24 A;  3RNU A;  4A3D G;  4JI0 Q;  1B70 B;  3CP0 A;  4MNO A;  4HID A;  3JAM c;  1Z9F A;  2VL6 A;  3CCJ A;  3GTK H;  4DUZ Q;  2ASB A;  2NZH A;  2R7F A;  4JOI A;  3CC4 A;  3T1H Q;  4NXN Q;  4HIM A;  3RN2 A;  4JI4 L;  2K14 A;  2NN6 G;  1WCM G;  4YCU A;  4GOP C;  4OO1 I;  4DAM A;  1VQ5 A;  3GO5 A;  5C4X G;  2HQL A;  5IWA L;  4LUV A;  1PH3 A;  4MZ9 A;  1NBW A;  5M5W H;  1HNZ Q;  4A3K G;  1IBK L;  1D7Q A;  5E7N A;  3VDY A;  3RN5 A;  4DR5 Q;  4A3F H;  1KD1 C;  1VQK A;  4R4C A;  3J81 i;  1VQ9 A;  1VQA A;  1AE3 A;  1MJC A;  3BZC A;  5IP9 G;  4JI1 Q;  3UDX A;  3STB D;  2Q2I A;  3CD6 A;  3A0J A;  2E2H H;  1XTD A;  4PG3 A;  3PO2 G;  4LUZ A;  3PIP A;  3HKZ E;  1SMX A;  3ERS X;  2YU9 H;  2R92 G;  1K3R A;  3GTM H;  2MO0 A;  5IYC G;  1XPO A;  3RLO A;  1IZ6 A;  4BXX H;  4A3I G;  4RMF A;  1PHJ A;  2UUA L;  3GTL H;  3I4M H;  4JV5 L;  2VY3 A;  3S16 H;  2F3I A;  2JEA I;  1NMG A;  1VQN A;  1YHQ A;  2VS1 A;  2IX1 A;  3GTG H;  5JEA J;  1J5E Q;  1YVC A;  3IRB A;  2JA9 A;  3ER0 A;  4OX9 L;  1BKB A;  1EIF A;  3EN2 A;  4GN3 B;  4QY7 A;  4DUY Q;  4ME3 A;  1MJE A;  4WJ4 A;  1SRO A;  3UDF A;  1NMF A;  1YZ6 A;  3HOU G; 
#chains in the Genus database with same CATH topology
 2I0Q A;  1W93 A;  3SDZ A;  1DV1 A;  4DV6 H;  4B3R L;  1N8R C;  1LTL A;  2HGS A;  4ABN A;  5M5W B;  5A35 A;  1H9J A;  3VYU A;  2W9B B;  3A8I E;  3H91 A;  5KND A;  2JA6 A;  3QZ7 A;  3UE1 A;  1NSN S;  3D4R A;  4LFB L;  3MR2 A;  2NVX H;  2BH8 A;  4LK1 C;  3D3R A;  1PFN A;  2O2L D;  2UXB Q;  5EDW A;  4LF6 Q;  1QJO A;  1HNW L;  4Q8E A;  2AQ4 A;  2I8C A;  5ELE A;  4JPB W;  1A8V A;  3BAB A;  2MHV A;  1QCB D;  1WD0 A;  3KHH A;  3GTM B;  3PQI A;  3T51 B;  2FFK B;  2RHQ B;  5A2Q L;  3I4M B;  4ZLT F;  4A3B H;  2N8N A;  5M3M H;  4KKU A;  2DPI A;  3EA6 A;  3H3V I;  2VA3 A;  2R7Z A;  3FDT A;  4K8I A;  4L5R C;  2AQ3 B;  2EVB A;  1IW7 D;  1KDC A;  4JC0 A;  3TP6 A;  4M1U B;  4A3C H;  3GTO A;  1QB5 D;  1WTX A;  5JOB A;  3KYH C;  1JIH A;  1K28 A;  3GV5 B;  3PUX A;  5KIX A;  3I4N B;  4YBZ B;  1YIJ A;  1XMQ Q;  4A3E G;  1XJV A;  1GSA A;  3BDO A;  1TY0 A;  1K8G A;  1JE5 A;  2KCC A;  1CZG A;  4X65 Q;  4O2A F;  2JA6 G;  3Q8Q B;  3J7A V;  1EY0 A;  1DOM A;  3MXN B;  3VA7 A;  4JBJ A;  3OHB A;  4DV1 Q;  1SJH D;  1SMY D;  4A93 G;  1ZET A;  2K01 A;  2RA4 A;  4Q43 A;  1QOH A;  1MI2 A;  1MZB A;  4HAE A;  2PQA A;  2J6S A;  4A4I A;  2OQK A;  5KG4 A;  2DGY A;  1WVL A;  4JI4 Q;  2XVS A;  1TWF A;  3X3N A;  1AFP A;  2ICE C;  2NTT A;  4JI8 Q;  5C0X H;  3BQ2 A;  1GVP A;  3SR1 A;  4A3G B;  1FD7 D;  4DL6 A;  4X64 H;  4L5T A;  5LXT F;  3U9T A;  1UEB A;  1O78 A;  3CW2 C;  2DY8 A;  2R7Z G;  1L1O B;  1T36 A;  2A6H D;  4XT1 B;  2A1A A;  1IBK Q;  2UXB H;  1ZXT A;  1AUV A;  2OQ0 A;  1S5B D;  5KFB A;  4YR2 A;  4EYI B;  1C0A A;  2F0U A;  2V1C C;  2FIN B;  4FM9 A;  2BR0 A;  4C3J H;  2CWP A;  4E4T A;  2BQR A;  1EUJ A;  2E2J H;  1TR5 A;  4X66 L;  2R8I A;  5GAD C;  2ZTC A;  3FRP B;  1U4L A;  3AEV A;  1U0L A;  4YY3 L;  4BY7 B;  1KLG D;  2EDG A;  1SYF A;  2FHT A;  1H9R A;  2CH4 W;  1PFB A;  1KJ8 A;  1SNO A;  5M3F B;  5KFS A;  3GTP A;  3U58 A;  1UAP A;  1ET9 A;  2XRS D;  1VQG A;  4BA1 I;  3GQC A;  3NP8 A;  2R92 H;  3PW2 A;  1XMO L;  2Q2U A;  4QWA A;  3GDE A;  2UUB L;  4FS1 A;  1XMQ H;  4A3M G;  1OXX K;  3BS1 A;  3M4I A;  4A3D B;  1I4X A;  1W6J A;  2W57 A;  2JK8 A;  4TQS A;  1F9P A;  1W2B A;  2MQH A;  1SSO A;  1T5E A;  2JJQ A;  3K81 C;  4X65 H;  4IAJ A;  4JV2 A;  1EY9 A;  2HVS A;  5K36 H;  4YCW A;  3PF5 A;  1CI3 M;  2C35 B;  4C3I G;  4DV1 H;  2J6U A;  2OH2 A;  2I80 A;  1DD2 A;  1EFW A;  4UCU A;  1S4Z A;  4APV A;  4DR1 Q;  3TQT A;  4DV3 Q;  2D9U A;  3FHW A;  4LFC L;  2MGS A;  5C4X B;  2MCT A;  1PH7 A;  3CCV A;  4JI4 H;  2EXZ A;  1B3A A;  3TRE A;  1E0B A;  1R9T B;  4JI8 H;  1E1O A;  4P72 A;  5HUR A;  4O3P A;  5IT9 L;  2R82 A;  3R23 A;  2B2U C;  3KAK A;  1OXV A;  1NTG A;  5L1K A;  2IA6 A;  1G6Z A;  5GRO A;  5M5Y B;  4YQW A;  1IBK H;  2KSW A;  1XNQ L;  4RB1 A;  5KEE A;  1GHJ A;  3E9I A;  2Z6K A;  4TQU S;  2BOS A;  2PBZ A;  1CQJ B;  2W6O A;  2YYZ A;  1GKH A;  1SLJ A;  1Y14 B;  1PVO A;  4UAI A;  3PW4 A;  2PI2 E;  3T4A C;  2Z8L A;  4ECZ A;  3N44 B;  2UXC Q;  2OF1 A;  4LWC A;  4GNX A;  1LTR D;  3FKI H;  1ASZ A;  1PLF A;  4LF8 L;  1TWC H;  2HJW A;  3JZI A;  3HP3 A;  2K04 A;  3V4Z A;  5E3F A;  5LMN L;  3C46 A;  3RB4 A;  3NEN A;  4RHR A;  2WB1 G;  2RHS B;  4C5A A;  1RTO A;  4HMI A;  2JE6 I;  1B8A A;  2UU9 L;  1RK6 A;  2XIW A;  1CKO A;  1KJQ A;  5KX5 F;  2E2I A;  3QR8 A;  4JVZ A;  1UWV A;  3TSS A;  1FJG Q;  3F2C A;  1LT3 D;  2Q8R E;  3RTX A;  4DR7 Q;  2PMZ B;  4FVM A;  4IRD A;  5CV4 A;  4GZY C;  2PQE A;  1UC8 A;  4DR1 H;  1RYR A;  4LF5 L;  3PUW A;  4DV3 H;  2VPQ A;  2B63 B;  1DON A;  1PMR A;  3TBI B;  4P74 A;  1HQR D;  1HZB A;  2VQF L;  3AFP A;  1V43 A;  1X9N A;  5D3I B;  3K3V A;  4O2B F;  4DR4 Q;  1CTM A;  5HBR B;  4JBK A;  5IE8 A;  2AQ1 B;  2QKI C;  5JJI A;  4X3T A;  4LF7 Q;  3P1H A;  1C3O A;  2BQU A;  1A2U A;  2UUC L;  4B3S Q;  3J7A F;  3MXU A;  5GQO A;  5L37 A;  3K5I A;  1TII D;  2OXP A;  5D3D A;  1PH8 A;  2VZA A;  4ZQI A;  3R5H A;  5TSS A;  1P16 A;  5ELB A;  3VPD A;  1GUT A;  5DGA A;  4PNY A;  5ELF A;  2R84 A;  4LF4 L;  4PWQ A;  1X3G A;  4DF7 A;  3HOX B;  4C1N I;  2GPW A;  1IW7 C;  3GV3 A;  1VQP A;  2R93 B;  1BBX C;  3CC2 A;  4APM A;  3TQY A;  1I3Q H;  4O2D A;  1JWU D;  3J81 W;  2UXC H;  1PYW D;  1Q82 C;  2M00 A;  2NN6 H;  3K57 A;  3N42 B;  4H0L C;  3QIA A;  5JJL A;  3D4D A;  2RGR A;  3W3A A;  4DL7 A;  1E3P A;  1SXT A;  4GOP A;  3S1N H;  2XN9 C;  1VQ6 A;  5FO7 B;  4IUN A;  1FYC A;  1EYG A;  3S15 H;  5EWF A;  1DM0 B;  2XIG A;  3OHX C;  2EYP A;  4HMJ A;  3QB3 A;  4CDD C;  5J3B A;  3OTO L;  2W9B A;  4F7X A;  1TWA H;  1WFQ A;  2R61 A;  1RF2 D;  4CC6 A;  1YEZ A;  4DGZ A;  1ET6 A;  4BBS B;  4IUU A;  4DR7 H;  1BF4 A;  1WYD A;  2NVY B;  5IT9 c;  2ZDG A;  4ME6 A;  1KBL A;  1KRS A;  3VYS A;  2NVT H;  2MUY A;  3N52 A;  1E2Z A;  3TRZ A;  4LF9 Q;  2KCT A;  2F3V A;  2WV6 D;  4B3M Q;  1VQI A;  1QVC A;  4MV8 A;  5I2Y A;  2A6H C;  1IL2 A;  3CCU A;  1K0R A;  2E5L Q;  4O3S A;  4LF7 H;  2C00 A;  1C30 A;  3PW7 A;  4NB3 A;  5BPF A;  4B3S H;  4EFE A;  4NPS A;  5IGD A;  5KFW A;  3ULJ A;  3U4V A;  4RAU C;  4DV6 L;  4A3K B;  3QOJ A;  2MNA A;  4DV5 Q;  2R8H A;  2E2I B;  3F1Z A;  3M9B A;  3J80 i;  1BO0 A;  1A62 A;  1P8L A;  2CFM A;  4FXK C;  5C0X J;  1NCV A;  5IYD H;  1IL8 A;  5L1J A;  4RHS A;  1SE3 A;  2XTI A;  2L55 A;  5JJK A;  1BCP D;  2K03 A;  3PO2 B;  2NUA B;  1M0T A;  5FLX L;  4FF3 A;  3N6R A;  3PZP A;  4Q44 A;  4F4X A;  2W9A A;  3J81 j;  2ALY B;  3L7Z C;  3MXN A;  1J9O A;  3FKI A;  4ME5 A;  3RR5 A;  3HOZ H;  2H4O A;  4NW2 A;  4G7H C;  3DEP A;  1TWC A;  5HY6 A;  4A3L H;  5K36 G;  3E5N A;  3CAM A;  4GKK Q;  5EOY A;  1JWM D;  4C56 C;  4WBN F;  3HOU B;  2Y0S B;  4JI7 Q;  5E1F A;  3PUY A;  2W7O A;  4EQP A;  1L1O A;  1PK8 A;  5KFH A;  5COR A;  4X3S A;  3I90 A;  3V96 A;  3LX0 A;  2V9W A;  4JBM A;  2YYA A;  4K0K Q;  5FPO A;  4LF9 H;  1VQC A;  4YAK B;  5CBE E;  4B3M H;  2VUM B;  1ML0 D;  3LWB A;  2EIF A;  3SVM A;  4IFD H;  3JRX A;  4YCV A;  4QCL A;  2E5L H;  2QEJ C;  1IYU A;  4RFB A;  4R4I A;  2UVU A;  1X55 A;  2B2T C;  4GLV B;  3RGX A;  3LGJ A;  1AZP A;  3A5Z B;  2DPJ A;  2N78 A;  2L1B A;  3M4O H;  1EQV A;  1AEX A;  4AYB B;  2LXK A;  3NWT A;  5IYZ F;  3FKI G;  5C4H A;  4DAP A;  1EL0 A;  1RD9 D;  4GLX A;  3PW0 A;  3GV8 B;  2A74 C;  3GTQ B;  1EWC A;  4M7E A;  5EWG A;  4YY3 Q;  1V8Q A;  2XGP A;  2YZM A;  3RLF A;  2XWB B;  4A3G G;  2UXB L;  4AQY Q;  2R8J A;  4LF6 L;  4R9W A;  2HVR A;  5C5L A;  1PA6 A;  3OWE B;  3GIP A;  4A3E B;  5IT9 E;  3IN5 A;  4J9R A;  2F52 A;  5EQ0 A;  1GUN A;  4Y8V B;  1EY4 A;  1CKN B;  1E4G T;  5CAE B;  3L2P A;  1UUP A;  2BE5 D;  1VQL A;  3GIK A;  3RAX A;  3BG5 A;  4K6L A;  2HQE A;  1TY2 A;  3BDL A;  1O7I A;  4WJ3 M;  5KFX A;  4GKK H;  1B9M A;  2SDF A;  2AQ2 B;  2X6G A;  1RYS A;  1R9T A;  5JEA H;  4AIM A;  3MVV A;  5JUM A;  3E5S A;  2VQE Q;  4GC6 A;  4JI7 H;  2V4Q A;  1F2M A;  2EY1 A;  4BY7 G;  1KNA A;  5EPK A;  3D0F A;  5FLM G;  1ASY A;  1OXS C;  3HS0 C;  5IGG A;  3RUP A;  5M3F G;  3FPP A;  2ID0 A;  1XMQ L;  2B2V C;  1Q46 A;  1V9P A;  2FB9 A;  3M3Y B;  3T1Y Q;  1STN A;  3S17 H;  4K0K H;  3TME A;  4IOA A;  3MHB A;  1O7Y A;  1EHI A;  4OEM B;  4X65 L;  3G6E A;  2PI2 A;  2E75 C;  1BXR A;  5C5J A;  2V4R A;  1V1P A;  3MEF A;  3GTO B;  2KVM A;  1K8M A;  1I6V C;  1LT5 D;  4DV1 L;  3I55 A;  4A3D G;  1YNN D;  1ICF B;  4HR7 B;  3GTK H;  4DUZ Q;  4MV4 A;  3TN2 A;  4JOI A;  1O75 A;  4NXN Q;  3RN2 A;  4JI4 L;  1F2Y A;  2NN6 G;  4MTE A;  2KOL A;  3HGB A;  1E2V A;  5KYI A;  5C4X G;  2KEC A;  1PH3 A;  4YY3 H;  3Q8R B;  2C22 A;  1IBK L;  1D7Q A;  1FR3 A;  5E7N A;  5EZY F;  4AQY H;  1D1I A;  4EVO A;  1TS5 A;  2PMZ A;  4A3M B;  3G6V A;  1VQA A;  1RHP A;  4JI1 Q;  2LFN A;  2Q2I A;  2Z1C A;  2SNS A;  1KAB A;  3PIP A;  2YU9 H;  2B63 A;  3ERS X;  5DNF A;  1K3R A;  3Q0A A;  5KG1 A;  3TQ1 A;  3OIP A;  1PHJ A;  4S3S A;  1I4G A;  3GTL H;  3PR4 A;  2VY3 A;  3S16 H;  2OLS A;  1MBY A;  1VQN A;  2VQE H;  3GTG H;  4FBU A;  2N55 A;  3IRB A;  3KTM A;  4K14 A;  2KA7 A;  2UVR A;  1BKB A;  3MWD A;  1PRT C;  4ME3 A;  1V51 A;  1SRO A;  3T1Y H;  1JXL A;  1YZ6 A;  1F9Q A;  2HCI A;  2F4V Q;  1WSC A;  4R8I A;  1ULZ A;  2R93 A;  2OTJ A;  3C1F A;  2Q8I B;  1EZ1 A;  3E6Z X;  2LMC B;  1M8A A;  3DWA A;  4DR1 L;  4K2L A;  1GUO A;  3JAM W;  4DV3 L;  1EFI D;  1E22 A;  1VQ7 A;  3A7L A;  4XQN A;  3RGZ A;  4KJO A;  4DUZ H;  1VQ8 A;  2Q2H A;  4NXN H;  3K5M A;  4CDC C;  4XIG S;  1I50 H;  3CU7 A;  4CJ0 B;  1ZHS A;  5C1O A;  4L8J A;  1BCP C;  1T94 A;  4UFZ A;  3RFC A;  5BN4 A;  4PQX A;  3MXP A;  2B63 G;  3M9N B;  1EQR A;  4KY7 A;  3OYY A;  2WB1 B;  3I4O A;  4XQQ A;  3HOZ G;  2WB1 E;  3B6Y A;  1STB A;  1TS4 A;  4CC5 A;  4DN4 M;  2R3Z A;  1TT2 A;  4A3L G;  2CWA A;  2UVW A;  3I56 A;  2KHI A;  1Y1W H;  4JI1 H;  2MO1 A;  3KF8 A;  4O3Q A;  1X3F A;  2FMC A;  3LWE A;  4GLA C;  4ED2 A;  1YHB A;  2UXC L;  1CSP A;  3J81 L;  3ULL A;  3HOX G;  2CW7 A;  3EJI A;  4XX0 B;  5NUC A;  2R93 G;  1CHQ D;  3DF7 A;  3CKI B;  3F8T A;  1Q1E A;  1IBM Q;  3ETJ A;  3HFZ B;  3ONA B;  1XDN A;  1OO9 B;  1K73 C;  2NVX B;  4WRD A;  2OT2 A;  4OWW B;  3MA2 B;  5K2M A;  5FLX E;  3S1R H;  1LYL A;  4GNX B;  1BNZ A;  2F4V H;  1FJG L;  1BDO A;  3L0O A;  2B2V A;  4I65 A;  5EKI A;  3T13 A;  3M7G A;  3BVM A;  5C0X I;  3JRW A;  4UY8 C;  4L6T B;  2FPG B;  4A3B B;  1FKA H;  4DR7 L;  5M3M B;  1GLV A;  5KFI A;  3RB0 A;  3QZ8 A;  1DV2 A;  2C9O A;  4G57 A;  1PTO D;  3MWY W;  2V58 A;  3NWS A;  3HG9 A;  3KBG A;  3GP7 A;  5I9O A;  1G51 A;  5JJZ A;  3PO3 H;  4TVA B;  3ULP A;  3J80 W;  3N8D A;  2HD3 A;  3CHB D;  2AMC B;  5KKN B;  4YIJ A;  1PH6 A;  3S9W A;  1MSG A;  3DWP A;  4OIJ A;  4DR4 L;  3CPF A;  2IW3 A;  4IFD J;  1ZEQ X;  4LF7 L;  3BDC A;  1LM0 A;  4KKS A;  2AU0 A;  1VDZ A;  4B3S L;  3PN1 A;  3I2Z A;  4C1N K;  3VR4 A;  3I8Z A;  4F88 A;  3NEM A;  2G9H D;  2J9G A;  5KFT A;  4ECW A;  1X6O A;  3S2D H;  2Y0S A;  3MTS A;  2FPI B;  1PYB A;  3CQZ H;  2ICI A;  4MTN A;  1F9S A;  4XTC S;  3HOW H;  4O4L F;  5JEA G;  5EAY A;  2W6Z A;  4DV4 L;  3KAJ A;  1AW7 A;  4IJH A;  1NJI C;  1E7Z A;  5KFD A;  2VUM A;  2F0J A;  4OON A;  4QMG A;  1YI2 A;  1HCZ A;  1Q7Y C;  2LSS A;  3D6C A;  3VMM A;  3K6O A;  5BMV F;  1IBM H;  1L0X B;  1VQD A;  1JOO A;  4EQO A;  4DLK A;  3HZX A;  3WO0 A;  2NUC A;  3I12 A;  3S14 H;  2I5H A;  2I5M X;  4DL2 A;  4AYB A;  3GTG A;  4GC7 A;  4FF2 A;  4NXM L;  1Q86 C;  1YNN C;  2BA0 A;  4C3J B;  1CE8 A;  3K5L A;  2IHF A;  4QWE A;  4RKL A;  4XYQ A;  5I2X A;  3K0X A;  2E2J B;  3K80 C;  3ERQ A;  4CDF C;  3GTQ A;  2K4K A;  1Q8I A;  5E4W C;  5KFG A;  1WTQ A;  4R4T A;  2NYZ D;  4DNT B;  4XDX A;  4GOP B;  2K32 A;  5G3L D;  4UCT A;  2Y0S G;  2EYH A;  4PMC A;  3HKS A;  1JLL B;  2K50 A;  4PZ6 A;  4LF9 L;  2L4N A;  4MAM A;  5KFR A;  4B3M L;  5KFK A;  3OSN A;  4JI2 Q;  1N33 Q;  3H09 A;  2R92 B;  1CKN A;  1H9K A;  4UDU C;  2IMW P;  2E5L L;  2B3G A;  4C2M H;  1RJR A;  1LO5 D;  5KFV A;  2B2Y C;  2VUM G;  4A75 A;  4UP9 A;  1H95 A;  4QL5 A;  3J81 c;  5C1P A;  1EEF D;  4HNU A;  4H02 A;  3EQL C;  1JIC A;  5JPN C;  2I87 A;  2YZG A;  1ROD A;  4DV5 L;  1S72 A;  3G7L A;  1LV9 A;  4KTA A;  4YB8 B;  5F9N A;  3ERO A;  1I7L A;  3HOV H;  1TAE A;  5T1G A;  4AYB G;  4DKA C;  2GVA A;  3FVQ A;  1EY5 A;  1J8I A;  1JX4 A;  4PZ8 A;  5DEH A;  4ETS A;  5EBC A;  4Q0Y A;  1HQM C;  3CC7 A;  3BYT B;  2FKL A;  4HNV A;  4ZRZ A;  4EFB A;  3PV0 A;  3G48 A;  1VQH A;  4HR7 A;  1JMC A;  3PUZ A;  3T5L A;  3KK7 A;  5T14 A;  4GKK L;  3H0G H;  5KT6 A;  4EX5 A;  2SEB D;  2PZU A;  3AQQ A;  1RL2 A;  2BDN A;  5D14 A;  5FJ8 H;  1K9M C;  1I6H H;  4YJ3 F;  5LA6 F;  5LL6 S;  1T3N A;  1HR0 W;  2K5W A;  2CQO A;  4JI7 L;  3BZD B;  2K5D A;  3P20 A;  3SK5 A;  3FKI B;  3RD4 A;  1K8A C;  4RCO A;  4RU9 A;  2DNE A;  1Y8N B;  3CCQ A;  5BN3 A;  1TWC B;  4K0K L;  5CB4 F;  5F2D A;  5EKL A;  1BR9 A;  3TZD A;  3VR3 A;  1GGO A;  1Y1V H;  1N33 H;  1KTK A;  1FGB D;  3H15 A;  4J9K A;  1S97 A;  2UXD Q;  4JV1 A;  1I94 L;  2TMP A;  5BR8 Q;  2E74 C;  1Y1W G;  3KDF B;  2NN6 I;  5ELO A;  2JSO A;  2W9C B;  5CR3 A;  2IP4 A;  3VR5 A;  2EQS A;  3EPI A;  2RKS A;  2ZJR A;  4LF6 H;  4RB0 A;  5JVH 3;  1KL9 A;  3ORR A;  4DXF A;  5GAG C;  2CZG A;  1HTL D;  1CKM A;  3ZYY X;  1VQM A;  3QFF A;  4J8Q A;  4K5W A;  3H6M A;  3TP8 A;  1ONL A;  2D62 A;  2O03 A;  3UQ8 A;  4Q0F A;  2IJ0 A;  4AQY L;  1JJ2 A;  1HA5 A;  5HV6 A;  3MWE A;  3SHL A;  1K83 H;  5EBD A;  4CGY B;  1GSH A;  1S0M A;  2CW0 D;  2B8G A;  3FEW X;  1PH5 A;  3BU2 A;  4F50 A;  1TVX A;  3KXY T;  1Z6H A;  3H94 A;  1SR3 A;  3K59 A;  3ND8 A;  1EIG A;  5IYC H;  5M9O A;  4F87 A;  4TUY F;  3J7A K;  1PTO H;  4JCV E;  4F4Y A;  2JA5 H;  3N43 B;  4I4T F;  1PTO C;  1WTH A;  1N34 Q;  1CUK A;  4MTK A;  5C8Y F;  2VQE L;  1UC9 A;  3PO3 G;  1V4Y A;  1I3Q B;  3U4Z A;  5JH7 F;  2GN5 A;  3KF6 B;  2WB1 A;  3ORQ A;  3BZK A;  1C8C A;  3D4W A;  3KAL A;  5EPL A;  1QE6 A;  3T1Y L;  1VQJ A;  1B04 A;  3RZO H;  4BWS C;  3UI2 A;  5I4D A;  3T53 B;  5M5X H;  2L15 A;  4JI6 Q;  3S1N B;  2KHS A;  1N32 Q;  4A2A A;  2UXD H;  4RWS C;  3R2T A;  3S15 B;  5BR8 H;  2EYO A;  1DZ1 A;  5LOV F;  1KC7 A;  3UFX B;  1IYJ B;  4JI3 Q;  3HOW G;  2VNU D;  4KJN A;  1BNC A;  4MV9 A;  3JAM L;  4BBR H;  5C3E H;  4HJ9 A;  1FGU A;  4DUZ L;  5I47 A;  1TWA B;  1KQS A;  3NK9 A;  4NXN L;  1EY7 A;  1OTC A;  1RKN A;  4JW0 A;  3TS2 A;  4QW9 A;  1EU4 A;  3EIV A;  4A3J H;  2OEO A;  1D1K A;  5KG0 A;  1G8Z D;  1TWH H;  5KFQ A;  3F2U A;  2NVX A;  3KLS A;  5C4J H;  4WJW A;  2NVT B;  1V1P B;  1JOK A;  4ODG A;  3A8J E;  2YZN A;  5JVL A;  2IBK A;  2J0T D;  5I6W A;  2DUD A;  2AKW B;  5L1L A;  4RAY A;  3VR2 A;  4U68 A;  1WI5 A;  2Z9H A;  5KFC A;  1LAC A;  5IP7 H;  4JI1 L;  2RCN A;  1KXL A;  2G9D A;  3R5F A;  2QF7 A;  2F0D A;  2KCM A;  2M2L A;  2AUK A;  2D0O A;  2EYJ A;  2WP8 J;  1JDB B;  5FKA C;  4HNT A;  4J9P A;  1KJ9 A;  3M4Q A;  2CQA A;  4RUA A;  4OIK A;  5DM6 3;  4FF4 A;  2NWG A;  5IYB H;  1N34 H;  4UPA A;  1SNP A;  3J7Y W;  3H0G A;  2GA4 B;  3S2H H;  2PMZ E;  1Q1B A;  1PZK D;  3GIJ A;  2BQ3 A;  1AE2 A;  3RF2 A;  1YNX A;  3CME A;  1SN8 A;  4QWD A;  4JV0 A;  1TXY A;  1GYF A;  2F4V L;  2C2D A;  2K5V A;  4DV0 Q;  1N48 A;  3HOZ B;  4JI6 H;  4CDE C;  5KFF A;  4DR2 Q;  1N32 H;  1N36 Q;  4IPH A;  1SBB B;  4DK1 A;  4JI3 H;  3E0E A;  2XWJ B;  3IG0 A;  1TKW B;  3HOV G;  2K28 A;  3MFY A;  3V6K A;  4CJ2 C;  4A3B G;  1W96 A;  5M3M G;  3J80 L;  2RSO A;  3HB9 A;  4HYK A;  5C5M A;  1V1O A;  3NGD A;  3A5U A;  1AUX A;  1SCU B;  4QIW A;  1ILP A;  4RZR A;  4LSA A;  1FL0 A;  2ZT9 C;  2YV5 A;  4MA0 A;  4TQR A;  1PH1 A;  2YTY A;  4JYA Q;  4A3C G;  2XCL A;  1DOL A;  4DV4 Q;  1MIU A;  3NBH A;  2F0I A;  2KUM A;  1M90 C;  2X69 A;  2C5C A;  3LWU A;  3DHQ A;  3H0G G;  4QUC A;  2K5N A;  1JOR A;  3FDS A;  1VQF A;  4IO9 A;  2C2E A;  5FJ8 G;  3I73 A;  1HJP A;  2RQX A;  2YTV A;  1QUQ A;  1A2T A;  2F0G A;  4X62 Q;  1K83 A;  2ATL A;  3WDN A;  3M4O B;  5C44 H;  1VQ4 A;  2YRX A;  3CCS A;  2ZM6 Q;  4NXM Q;  3WNZ A;  2YW2 A;  1NR4 A;  4EYH B;  4ED6 A;  1FJG H;  2R92 A;  5D65 A;  4U7C A;  3KFU A;  1Z7T A;  4LW1 A;  4JK1 C;  1IBM L;  4K2K A;  4ECU A;  2GPS A;  5A2Q E;  4EBE A;  3PVX A;  2E76 C;  5C0X G;  3KJO A;  3KF8 B;  1B3Q A;  2F0P A;  1SYC A;  1B70 B;  4HID A;  3JAM c;  2F0N A;  3CCJ A;  2PN1 A;  2Z4I A;  4DV0 H;  3CC4 A;  2R87 A;  3D6W A;  4HIM A;  4DR4 H;  1HXY D;  1PRT D;  4DR2 H;  4NLG A;  4ZI7 F;  1N36 H;  1R4Q B;  1EYD A;  4C3J G;  4TV8 F;  2B2U A;  4OO1 H;  1XX8 A;  3VPB A;  4FS2 A;  3EVQ A;  2JEI A;  2WKD A;  2WAC A;  4MIU A;  3H20 A;  3RN5 A;  4DR5 Q;  2BCO A;  4A3F H;  3DEO A;  1WTO A;  4I55 F;  4R4C A;  3Q8P B;  2I46 A;  4JYA H;  1MGS A;  3CD6 A;  3S17 B;  2XCP A;  4DV4 H;  2E2H H;  2CW0 C;  1WTP A;  1EYC A;  1YNJ D;  2R92 G;  3NTK A;  1TWH A;  4MV7 A;  1D5M C;  5IYC G;  1XPO A;  5LYJ F;  4EGQ A;  4IUQ A;  1YHQ A;  4ZYS A;  2IX1 A;  3T5H A;  3M4Y A;  1EY8 A;  3GTK B;  2F1M A;  3ER0 A;  2L5T A;  4E6I A;  4QY7 A;  3BQ0 A;  2ZM6 H;  2EPB A;  4NXM H;  5JAV A;  1Z2P X;  2HVQ A;  5KG7 A;  3SK4 A;  1JB3 A;  2Y0S E;  4ID6 A;  4LH7 A;  4KY5 A;  5IGF A;  3KDF A;  4O0A A;  3GID A;  2KEN A;  1HUM A;  2W9C A;  2N3S A;  2NZO A;  3IL8 A;  1RJQ A;  1S5E D;  2F0Q A;  1BVS A;  1AP0 A;  2CHB D;  1JB7 A;  3STB C;  3J80 c;  4U6P A;  1E1T A;  4BBR G;  5C3E G;  1SNC A;  3L4J A;  4ED8 A;  3R2I A;  1IOV A;  2YU9 B;  5J2T F;  1I94 Q;  1SDF A;  4A3J G;  1JKJ B;  2B39 A;  2Q8T A;  5CV7 A;  5KT5 A;  4DL3 A;  3GTL B;  3R3O A;  3S16 B;  1EOT A;  2CKZ B;  3CRL C;  4RGM A;  1XXG A;  3GTG B;  4DR5 H;  4AYB E;  4JI2 L;  1N33 L;  4ECX A;  4DV5 H;  1A3V A;  3F2D A;  3D31 A;  4BA2 I;  3AFQ A;  2QW7 A;  2KEE A;  3V05 A;  5EPJ A;  4YR3 A;  4BS9 A;  2MPM A;  3BA9 A;  4P71 A;  4IUT A;  1CS0 A;  1FVI A;  4F4Z A;  4IOC A;  1IBL Q;  5AJ3 Q;  2DIK A;  4UCS A;  5KFN A;  4EBD A;  1EOV A;  3LML A;  4DNR B;  1I3Q A;  2O5J C;  4L1K A;  3KF6 A;  1D8L A;  1U9R A;  2JQO A;  1VS0 A;  2FMA A;  2EYL A;  5IYB G;  3RZD H;  4O3O A;  1IHZ A;  4RB3 C;  3IAY A;  5IGE A;  1MKH A;  2A73 B;  4FDB A;  1BCP B;  1I50 B;  4C3H H;  1EU3 A;  1ZKO A;  4ECY A;  4DK0 A;  3UE0 A;  4PZ7 A;  5KG5 A;  4MHE A;  2WKC A;  2IX0 A;  2JEF A;  1HZA A;  1KDA A;  4UCO A;  3G6J B;  5DG7 A;  4LSX A;  2QYZ A;  3BQ1 A;  1TWA A;  3TDQ A;  4BY1 H;  3NSW A;  1SAP A;  2X0S A;  4EEQ A;  3NPP A;  5IWA Q;  4KMU C;  1B7Y B;  1PV4 A;  1S3O A;  2XRQ D;  3T56 B;  1Y1W B;  1F77 A;  2A5H A;  2F0S A;  4QUF A;  4HED A;  2FK2 A;  1HHV A;  1TWG H;  1I94 H;  5T1I A;  1N9W A;  1QNU A;  3K5N A;  4GN4 B;  1L2F A;  1VF7 A;  4G3I A;  4J9S A;  4RB2 C;  3OW2 A;  4LH6 A;  3CMA A;  3PGZ A;  1BBW A;  2UUA Q;  1PZJ D;  2FE3 A;  2UXD L;  2QK4 A;  1I5F A;  4FNF A;  4L5Q A;  5IP9 H;  5KNC A;  5BR8 L;  1QZG A;  3S1R B;  1HPC A;  1EZ6 A;  5J39 A;  2JA7 H;  5KFU A;  4OX9 Q;  1IBL H;  1GJX A;  2YL2 A;  3GTJ H;  1B50 A;  1UEA B;  4ED3 A;  3U9S A;  3CCL A;  2HUG A;  2NU7 B;  5FPR A;  4FU0 A;  2J4X A;  4XQJ A;  3RV4 A;  4M8A A;  2PZW A;  2WE6 A;  3T16 A;  2VPS A;  5EKK A;  4IJL A;  3PO3 B;  4Y7N H;  4KHP Q;  3S1Q H;  3W1B A;  5LMU L;  2R7D A;  5EJW A;  3FP9 A;  3JSL A;  5DGB A;  4DAV A;  5DQI A;  3SEB A;  3TP5 A;  2VW9 A;  4HJ5 A;  4WD3 A;  1WOC A;  4DV2 Q;  1ILQ A;  2VUG A;  2WDT A;  4TSS A;  1QIL A;  4PMW A;  1Z2N X;  5CA1 F;  1K8O A;  3V6H A;  5IIF A;  4ECT A;  2KHJ A;  3S2D B;  4L5S A;  5IWA H;  3KHG A;  3CQZ B;  4RNO A;  4KY6 A;  3HOW B;  4DR6 Q;  4OO1 G;  3A55 A;  4DU9 A;  1N34 L;  4ZUJ A;  2W70 A;  1W3S A;  2K52 A;  1K0S A;  4A3F G;  2CVR A;  3NXW A;  1FNV A;  4B9X A;  2FXQ A;  2W6Q A;  1RIP A;  3MR6 A;  2OCE A;  3H40 A;  5IYD G;  3K0Y A;  2B2T A;  1GO3 E;  4EQN A;  4IUP A;  3DLL A;  3GIL A;  1YNJ C;  4JI6 L;  3Q1K A;  1S0O A;  2UUA H;  1N32 L;  3V6J A;  1JJG A;  3S14 B;  4JI3 L;  2A69 C;  1X56 A;  4JUZ A;  1NAP A;  2PW7 A;  5KG3 A;  4XYL B;  1KAW A;  3WOF A;  5HGT A;  4OX9 H;  1S10 A;  5IT9 W;  1J6Q A;  2RDJ A;  3F2B A;  4YHH Q;  1O80 A;  1UNN C;  1JJC B;  5KT4 A;  2OTL A;  2JA6 H;  2AUJ D;  4J9Q A;  4YWK A;  4K5V A;  4NKL A;  4RG1 A;  2JA8 H;  2JXM B;  2IT1 A;  2RVL A;  4A93 H;  1VAJ A;  1STH A;  4KHP H;  2YS6 A;  2RDG A;  4ED0 A;  5BPH A;  4HN7 A;  1LUZ A;  1DGS A;  4MN3 A;  4C2M B;  2F4I A;  4DV2 H;  5KFY A;  1MD2 D;  4IFD G;  3NBI A;  5LMN W;  2W8K A;  4IZ8 A;  3RB3 A;  2ZJT A;  2R7Z H;  3Q8D A;  2X6L A;  1D5X C;  2M05 A;  2RSN A;  5CV8 A;  1VCI A;  5DLG A;  1EY6 A;  4M9U A;  4V0B A;  4DR6 H;  1C4Q A;  3HOV B;  4DK3 C;  4P2C B;  4ECQ A;  1HH2 P;  1UNS A;  3U50 C;  1GOZ A;  1LTB D;  1VMP A;  2NVQ H;  1HA6 A;  1K1Q A;  4IRK A;  1X65 A;  1GHK A;  1DYQ A;  4ZCK A;  4J15 A;  5E4X A;  1TWG A;  2EY5 A;  4DFA A;  3M4P A;  2BH2 A;  4JBW A;  2UVV A;  4DV0 L;  1A9X A;  3KLS X;  1WCM H;  5JPM C;  4DR2 L;  3VPC A;  1N36 L;  3GTK A;  2HHH L;  4P75 A;  2PW5 A;  4GKJ Q;  3H0G B;  1OXU A;  3TEH B;  1SND A;  3BYY B;  2F3W A;  2ZXR A;  4KK7 A;  2VOB A;  3A8K E;  1I6H B;  5IY0 A;  1S40 A;  1TWF H;  2YTX A;  4C3H G;  1DIK A;  4YHH H;  1BXT A;  1LLR D;  1SYE A;  4LMQ D;  4ECV A;  2JA7 A;  2ZXO A;  3L9A X;  2F0T A;  2L11 A;  3S1M H;  4JYA L;  3CCR A;  1KNE A;  3OSO A;  4K6D A;  1GSO A;  2AGP A;  4C3I H;  1M1K C;  3WO1 A;  1Y1V B;  3G6X A;  2N88 A;  4A3I H;  2XNA C;  4HCS A;  4BY1 G;  4RNM A;  2H1E A;  4JI5 Q;  1S5F D;  4DAY B;  2YU9 A;  1CSQ A;  1K1S A;  3L3O C;  3OUU A;  4YJ2 F;  4QIW B;  2C28 A;  1BBU A;  3K7A H;  4QIW E;  4RCN A;  4JI0 Q;  4X62 L;  5KT7 A;  2KED A;  5ELD A;  2J7Z A;  1ZYR D;  3SI8 A;  3GTL A;  2FLL A;  3NQT A;  5C3X A;  3PSI A;  3NBH B;  2ZM6 L;  1A6X A;  1MSH A;  2D0P A;  1HFN A;  1U5K A;  3GTP H;  4O3N A;  3DM1 A;  5KFJ A;  1HR0 Q;  1YBY A;  3FPU B;  3OW7 A;  4NDX A;  2Z0S A;  4A76 A;  3E0J A;  4ZUI A;  2F03 A;  5LP6 F;  2VR1 A;  4B08 A;  3RJ0 A;  3MR3 A;  5LL6 b;  1QUQ B;  2KJX A;  1K83 B;  3GV7 B;  3ZJY C;  2F0K A;  1IOW A;  3CVZ A;  3OSP A;  5L9X A;  1H9S B;  1M4V A;  2JA7 G;  4H13 C;  2WTF A;  2RCF A;  3MFG A;  3DWQ A;  2DY7 A;  1RDP D;  2IWH A;  2WIN B;  4GKJ H;  4POF A;  4N8F A;  1I50 A;  3AYH B;  5CC4 A;  1PTO B;  5IOC A;  1EUC B;  1KRT A;  2JA5 B;  3HBL A;  2WAQ A;  4JG2 A;  3HOY H;  4Y52 H;  1F2Z A;  2DWC A;  4ZQ3 A;  2V4D A;  4DR5 L;  4QWB A;  1STA A;  4C5B A;  2WYO A;  4J9N A;  1QWY A;  1QNK A;  1EYA A;  3QJY A;  5DLF A;  2F0V A;  2L9H A;  1F2L A;  3RZO B;  2WFW A;  4J6H A;  1BUV T;  1CK1 A;  4DR3 Q;  4O3R A;  1AN7 A;  2R7L A;  5M5X B;  4X64 Q;  1Y1W A;  5KYL A;  1ENC A;  1SFO H;  3KBX A;  5CV6 A;  3C1E A;  2HIV A;  5GON F;  2EZV A;  4JI5 H;  1TA8 A;  2K5H A;  2Z6K C;  3OIQ A;  1B1Z A;  2ALZ A;  4KN7 C;  5FLX W;  2R8K A;  2QDL A;  4JI0 H;  4BBR B;  5C3E B;  3ND9 A;  3ITP A;  1YJW A;  3PR5 B;  4X6A H;  1I4Q A;  2R6G A;  4GNX C;  4EGV A;  4A3J B;  1Q81 C;  1TWH B;  4DA2 A;  5KFM A;  1HUN A;  3M85 A;  5C4J B;  2DJF C;  2EJG C;  2KBN A;  5DQG A;  1HR0 H;  1EWI A;  2ENB A;  1XWE A;  4RKB A;  2L12 A;  2XGT A;  3T5K A;  2EOT A;  2WAQ G;  4XT3 B;  1HNX Q;  2FP4 B;  1BOS A;  4EBC A;  1SNM A;  5KFP A;  2LXJ A;  1CFM A;  2NZ1 D;  2KCN A;  1VF5 C;  3QOL A;  2R8G A;  5KT3 A;  4WFN 3;  1S9F A;  4FXD A;  4X3U A;  2HIX A;  4JI2 H;  1PFS A;  1U4M A;  1B2T A;  2NBF A;  3E9H A;  1EWH A;  3RMH A;  1BGW A;  4KN4 C;  2F0M A;  2JN4 A;  3G4S A;  2Q2T A;  5JQW A;  3Q6S A;  1XTC D;  2ZXP A;  1WCM A;  1CQV A;  4YP3 A;  2F0W A;  2JA8 G;  2ASL A;  2MFI A;  3NTH A;  3SE7 A;  2A68 D;  3PIO A;  1A3U A;  3A54 A;  4HTH A;  3W1G A;  3S2H B;  2NU9 B;  4QQB X;  4FYD A;  4UP8 A;  3BJU A;  4DV7 Q;  1I4R A;  3PF4 A;  1ENF A;  4FP5 D;  4QB4 A;  2VB3 X;  4DR3 H;  3CQZ A;  5JVD F;  1VQO A;  1IBL L;  3M9O B;  5AJ3 L;  2NU6 B;  2E8G A;  2R7K A;  5LMU Q;  2A6E C;  1SYB A;  1KAA A;  3W5O A;  2W7P A;  4MV3 A;  3RV3 A;  4DNI A;  3LNN A;  1SYG A;  4LMY A;  1HZ9 A;  1STG A;  2GVB A;  3BG3 A;  3PIP 3;  4XXE A;  2YCH A;  1CQF A;  5KFA A;  5DQH A;  1STE A;  4P73 A;  3RNU A;  1SYX B;  3CP0 A;  1PFM A;  2VL6 A;  4DXG A;  1STY A;  4KHV A;  3I91 A;  2NZH A;  2R7F A;  4HCE A;  3T1H Q;  1SJE D;  2K14 A;  5I6Y A;  1PRT F;  3I70 A;  4RH6 A;  4FBT A;  1WCM G;  4GOP C;  3J81 E;  1HNX H;  4OO1 I;  3R93 A;  3DMU A;  3GO5 A;  3RAQ A;  1B53 A;  1T5X D;  5IWA L;  1S03 G;  4ECS A;  4MZ9 A;  1NBW A;  5M5W H;  1HNZ Q;  3VA5 A;  3N6X A;  4R8U A;  4Z9C B;  2FK1 A;  3IFT A;  4J1M A;  2G5D A;  5C44 B;  4I7H A;  1Y8O B;  3STB D;  1B33 N;  3C3L A;  1D2B A;  3FMC A;  3A0J A;  1XTD A;  4PG3 A;  3EYY A;  4LUZ A;  4C2M A;  5ELC A;  2PO4 A;  2B2Y A;  1X3Q A;  1BCP F;  3KLR A;  3GTM H;  1RK5 A;  3X3M A;  4BXX H;  3R5X A;  1CT1 D;  4A3I G;  2UUA L;  1W6K A;  3I4M H;  2EYM A;  4RZQ A;  2QDB A;  1GUS A;  4OL7 A;  2JEA I;  4DV7 H;  1PDQ A;  3GV6 A;  3P7J A;  1J5E Q;  2PCF B;  1YVC A;  4H44 C;  4OX9 L;  4HSV A;  1HTP A;  1EIF A;  4DUY Q;  5LMU H;  3DXJ C;  3UDF A;  1QG7 A;  1ZYR C;  3OUZ A;  1I6U A;  1BJT A;  1SNQ A;  1GD7 A;  3Q23 A;  3I4N H;  3HXL A;  3WWV A;  1SFO A;  1E4E B;  4IR9 A;  2R86 A;  4KHP L;  2HCC A;  2A19 A;  3DUZ A;  4LFA Q;  2K33 A;  4A3F B;  3U9O A;  4K5X A;  2TSS A;  2KQ3 A;  4N9T A;  2I5L X;  3A56 A;  4IFD I;  4HJ8 A;  3BA8 A;  5L1I A;  3T1H H;  4DV2 L;  2E2H B;  3WOE A;  1Q12 A;  2JEG A;  1ICW A;  2C2R A;  2K5Q A;  3CXC A;  3E3X A;  3RBE A;  2BA1 A;  1HNZ H;  5BN5 A;  2E2D C;  4A3G H;  3QG1 A;  4DR6 L;  3HOY G;  1XYI A;  1B6R A;  4RGT A;  4CHT B;  3H3V H;  5EGT A;  2HHH Q;  2EJF C;  3C0F B;  1L1O C;  3H3V C;  1Y1V A;  2IL8 A;  1YIT A;  2A8V A;  3M9M B;  2PYK A;  1HRJ A;  3CF5 A;  4DAY A;  3OMG A;  1DCZ A;  3K5O A;  5COY A;  4LUO A;  5FD6 A;  1CHP D;  2B29 A;  2ZDQ A;  4ZK9 B;  4B3T Q;  1LTA D;  1LT4 D;  5CMD A;  1XNR Q;  2PZT A;  4BY7 H;  2R85 A;  1KLU D;  1J5E H;  1WR2 A;  5FLM H;  4O42 A;  4ZAI A;  3I72 A;  5M3F H;  2R6F A;  1OXT A;  1WTW A;  4DUY H;  2AWO A;  2O5I C;  1WTR A;  4MA5 A;  2AHO B;  3K5H A;  4YHH L;  2K75 A;  1LT6 D;  1QVG A;  1GUW A;  5CBA E;  4RUC A;  3OHA A;  1G2S A;  2PPB C;  3C2P A;  5K5P A;  2CH4 A;  1IXR A;  1UE1 A;  2ZTE A;  3JAM i;  4A3D H;  4ILW A;  1CZW A;  3HKZ A;  2SCU B;  3OPO A;  4LFA H;  1H9S A;  2F0O A;  1XPU A;  2O4X A;  4LJZ C;  4IAL A;  1EUD B;  1VKZ A;  3GIQ A;  4QW8 A;  1A3T A;  3QWN A;  1SE8 A;  2K7V A;  4QJF A;  1OWT A;  1Y1V G;  2PNR C;  3EPG A;  4F8M A;  1KDB A;  1C7Y A;  4C5C A;  3SK6 A;  1V1Q A;  2JA5 A;  5J2U F;  5C4X H;  4XYO A;  2RGV A;  4R4Q A;  4GN5 A;  5CV5 A;  2QA4 A;  2WII B;  1R9T H;  4NMZ A;  3BVG A;  4CKE A;  1LTT D;  3MAQ A;  3PUV A;  2ZJQ A;  3RZD B;  2QGQ A;  1LTS D;  4JV5 Q;  4FO2 A;  1IYV A;  1SMY C;  5C4Z A;  5M5Y H;  3PCO B;  3K3P A;  2ZJP A;  3IKJ A;  2A68 C;  2HHH H;  1WD1 A;  4C3H B;  4A2B A;  4KLK A;  4AH6 A;  1EYZ A;  3T5J A;  2HDM A;  3A7A B;  4G4K A;  1VMC A;  4MV6 A;  1PX2 A;  1JC7 A;  1KIX A;  4KD3 A;  4B3T H;  2VB2 X;  4ULL A;  4RGO S;  1XNR H;  4BY1 B;  1JR0 D;  2SNM A;  3HKZ G;  5D8D A;  4B3R Q;  1PH4 A;  4GKJ L;  2VXW A;  3KHL A;  3GTM A;  5FOB B;  2EXD A;  4RGN A;  3MFI A;  2IPK D;  4YWM A;  3K58 A;  3GIM A;  4EG0 A;  5IOD A;  1EQQ A;  2B2W C;  2FLN A;  1TWG B;  4JOI C;  4V19 0;  4LFB Q;  1II3 A;  2A69 D;  1PH2 A;  3DM3 A;  2JA5 G;  1FNU A;  3MWM A;  4OGQ C;  1HNW Q;  2LKV A;  4X62 H;  1TQO A;  4PDB A;  1LTG D;  4G7O C;  4TV9 F;  1JWS D;  2MP1 A;  4LNQ A;  4GS3 A;  4N9P A;  3TIG A;  1B9N A;  5H1S E;  5DLQ E;  4JI5 L;  3CCM A;  2RBM A;  1A0I A;  4CJ1 B;  3G6Y A;  4TKO B;  2FJZ A;  3H4D A;  1XPR A;  3ICE A;  4EQ5 A;  4ZKB B;  3Q2O A;  4J0M A;  1C48 A;  3UDI A;  4UP7 A;  4JI0 L;  3M7N A;  2JA7 B;  3AB9 A;  2ES2 A;  2B63 H;  4XYM B;  4F4W A;  2VA2 A;  2HDL A;  5AFW A;  3GTJ B;  1PZI D;  2HT1 A;  1S5C D;  1PXU A;  3NTI A;  1U4P A;  1SE4 A;  2FK3 A;  4R8N A;  4OWX B;  1GM5 A;  2JEB I;  1HR0 L;  2EYF A;  1M6V A;  3N40 P;  1BQQ T;  3VYR A;  4JV5 H;  2RDF A;  3TII A;  4Y7N B;  1GXD C;  1X54 A;  4BXX G;  3S1Q B;  4QWC A;  2F0F A;  3I4M G;  2DZD A;  4IRC A;  3RUZ A;  2V5A A;  1D6E C;  1UE7 A;  5D1O B;  3CRK C;  4R1J A;  5CV9 A;  3HOX H;  3TS0 A;  3NQI A;  3JSN A;  4KI0 A;  2R93 H;  1PRT B;  2RDH A;  4IR1 A;  2D2C C;  4B3R H;  3I4N G;  2IHE A;  1EIY B;  5IP7 G;  3EFX D;  5EWE A;  3PIO 3;  4IPC A;  2QEX A;  1CA6 A;  4IWY A;  3MC0 B;  4LFB H;  1LAB A;  1SYD A;  2Z4H A;  4I50 F;  1C9O A;  1CA5 A;  1HNW H;  2W6P A;  5KFO A;  4ZHQ F;  3JC6 6;  3JAM E;  3Q24 A;  4DR3 L;  4X3K A;  1RCV D;  5KFZ A;  2JYO A;  2ZTD A;  1M0W A;  3N41 B;  4HQ6 A;  4OEL B;  4X64 L;  3TIN A;  4X66 Q;  3CPW A;  2NB0 A;  2WAQ B;  1LTI D;  1YHA A;  3SGI A;  5FO8 B;  4DPG A;  2WAQ E;  4BBS H;  2W71 A;  5A2Q W;  2ASD A;  5FO9 B;  2NVY H;  1CM9 A;  1L0Y B;  4J9M A;  2IY5 B;  1VQB A;  1YJ9 A;  4L63 B;  5GAE C;  5KG2 A;  5CGK A;  1ZQ7 A;  4Q45 A;  3MFH A;  2AGQ A;  1PTO F;  2FMM A;  1XMO Q;  5ELN A;  2N49 A;  3G71 A;  2PNH A;  5F9L A;  2EY6 A;  2UUB Q;  2JA6 B;  5DAU A;  1UE5 A;  2EE1 A;  1EEI D;  2JA8 B;  1AH9 A;  1E2W A;  4IPG A;  1ESR A;  2R7M A;  4A93 B;  2XD4 A;  4KKT A;  2AWN A;  1HNX L;  2R7N A;  2K6A A;  5FK9 C;  1A63 A;  3IFD A;  4IZO A;  2F0E A;  4OXP A;  4A3K H;  3KUP A;  1I4P A;  1E4F T;  3K8A A;  2OWO A;  2E2I H;  1KHI A;  5DG8 A;  2J6T A;  3D8G A;  4N8X 1;  1U4R A;  1G2T A;  5LHY 1;  4IHJ F;  5CYU A;  1NR2 A;  4LFC Q;  1E4E A;  2XCA A;  2R7Z B;  1Y69 U;  3OWF A;  3PO2 H;  5ISR A;  2BDO A;  3NE5 B;  2RF4 A;  1K3B C;  3MJF A;  3NUC A;  5C44 G;  1G91 A;  2Z6B A;  1B44 D;  1F9R A;  1HZC A;  2E2H A;  2NVQ B;  1DXM A;  4G7Z C;  5KNB A;  4IWX A;  2B2W A;  1Z47 A;  3J7Z C;  4DV7 L;  1XNQ Q;  4R7R A;  1TS2 A;  5FLX c;  3URY A;  5JVG 3;  4ECR A;  5J1Z A;  5HGQ A;  2YS7 A;  1G29 1;  4JI8 L;  1WJJ A;  4R4O A;  2M9V A;  3J80 E;  2XGQ A;  1WCM B;  1T9H A;  3HOU H;  4X66 H;  1VQE A;  4KHZ A;  4LAA A;  1UE6 A;  4CKB A;  4U67 3;  3GLK A;  1RTN A;  1Q3L A;  4LF8 Q;  5KFE A;  3EBE A;  3NEL A;  3OMC A;  1D5Z C;  1SRU A;  2PQA B;  1KJJ A;  4RAZ A;  5H80 A;  5LMN Q;  1G6P A;  3FMA A;  3W2D A;  4IUR A;  4IPD A;  4QGU A;  3Q8S B;  2VUM H;  1X3E A;  1TWF B;  5G3L F;  4ZKC B;  4DK6 C;  2UU9 Q;  1WTV A;  3RB6 A;  1XMO H;  4KD4 A;  2UUB H;  3V2T A;  3S1M B;  1SEI A;  1JOQ A;  2H5X A;  3T1H L;  2CQY A;  1DOK A;  5DM7 3;  2GLT A;  2V59 A;  4C3I B;  5C3W A;  4FXG C;  3KJP A;  3MZ5 A;  4HJ7 A;  4H7B A;  1JCK B;  4A3I B;  2K05 A;  3KOJ A;  1SE2 A;  3SK8 A;  2RDI A;  3RLN A;  3QO2 A;  1NNX A;  1HNZ L;  1QZH A;  5CA0 F;  3G8C A;  3K7A B;  4K8J A;  4LF5 Q;  3GTQ H;  1N56 A;  4LFC H;  1FNW A;  2QCP X;  2VQF Q;  1H9M A;  1I7N A;  1JE4 A;  4YWL A;  4NP5 A;  4OHJ A;  2VQD A;  4MV1 A;  5IGC A;  4MTD A;  4O4I F;  3H4B A;  4PV1 C;  3TP7 A;  3V4S A;  3GTP B;  3NHH A;  4A3E H;  4FF1 A;  1JDE A;  2FJ2 A;  4HIO A;  3F8N A;  2UUC Q;  1KC8 C;  1L2Z A;  1ESF A;  2EY2 A;  3KLW A;  4R8U B;  1IKL A;  1TU2 B;  4WOR A;  1XNQ H;  2F0L A;  2W6M A;  4UHV A;  1J5E L;  3GII A;  4LF4 Q;  2DNC A;  1L0W A;  2FLP A;  5I9P A;  5KRU A;  4DUY L;  3SXH A;  4HSP A;  2NTS A;  4POG A;  1CQI B;  2YRW A;  1Q8K A;  2P0A A;  3ETH A;  1X32 A;  1NY4 A;  3A74 A;  1PH9 A;  4O4H F;  2W6N A;  2CCZ A;  1M7J A;  2PVP A;  5IGB A;  4LF8 H;  3M3Y H;  2A6E D;  1E24 A;  3K7U C;  5C6A A;  4OWT B;  2JP1 A;  4HJA A;  3HOY B;  1DJR D;  5LMN H;  4CKC A;  2ASJ A;  2NVY A;  3I3C A;  4LFA L;  4J9L A;  4Q5V A;  3CCE A;  2SOB A;  5GAH C;  1NE3 A;  3BAA A;  2FPP B;  2UU9 H;  3UDG A;  3I4L A;  1B4O A;  3GTO H;  1PYS B;  3GD7 A;  1TS3 A;  5D1P A;  4ED1 A;  2D5D A;  3OTO Q;  4IN3 A;  1SFO B;  2EJM A;  2CW8 A;  1R4P B;  3PMF A;  1MHW C;  4DL5 A;  2ATW A;  1I4H A;  2I07 B;  4BWG B;  3RBD A;  3VYT A;  2W8L A;  1HFG A;  4YR0 A;  4LF5 H;  3KHR A;  1A15 A;  4YAJ B;  1KJI A;  3I7F A;  1GUG A;  4CBV A;  3AMU A;  2VQF H;  1Y8P B;  1Q90 A;  1S0N A;  5KG6 A;  3R8B A;  2IX3 A;  3VR6 A;  2DN8 A;  4O1N A;  5DG9 A;  4A3M H;  2UUC H;  1RJT A;  1S5D D;  3J7A 5;  1JT8 A;  3OOC A;  4B3T L;  1QVF A;  1XNR L;  4ALP A;  1JQY D;  4BBS G;  4DV6 Q;  5LL6 X;  1KEE A;  3GTJ A;  3BVZ A;  2LY7 A;  1YJN A;  1VBH A;  1VBG A;  4HIK A;  4LF4 H;  2DJG C;  3MXG A;  3S24 A;  1ZHQ A;  1EZ8 A;  4I7Z C;  4MNO A;  4RA8 A;  3HEJ A;  4IQZ A;  1O7Z A;  1Z9F A;  2LS0 1;  4QF4 A;  2ASB A;  3BJY A;  1EQT A;  2BE5 C;  2DLN A;  3PW5 A;  1ENA A;  4UCR A;  5KFL A;  2XSC A;  4YCU A;  4XZ3 B;  3MR5 A;  4DAM A;  1X3P A;  1VQ5 A;  5D1O A;  5FD5 A;  2HQL A;  3MEH A;  4KV6 A;  1IKM A;  1O7L A;  2ZDH A;  4LUV A;  1AN8 A;  2MJ8 A;  1RJP A;  4A3K G;  1NUC A;  4TRD A;  2QIL A;  4IUV A;  1EIH A;  5KGU A;  3AU7 A;  3VDY A;  3RIZ A;  1KD1 C;  2JEJ A;  2AGO A;  1VQK A;  3J81 i;  3OTO H;  4Q8F A;  2F0H A;  1VQ9 A;  1AE3 A;  3TZU A;  1MJC A;  3BZC A;  5IP9 G;  5J22 A;  3UDX A;  4B9W A;  3Q22 A;  3LP8 A;  3HRZ C;  3L4K A;  3HKZ B;  3PO2 G;  4ZOL F;  2K1B A;  3HKZ E;  1SMX A;  1B6S A;  4EGJ A;  3GQB A;  4RNN A;  4EEY A;  2B8F A;  2MO0 A;  1WH2 A;  3RLO A;  1AZQ A;  1IZ6 A;  1Z2O X;  2NU8 B;  4ED7 A;  2L0C A;  4JV5 L;  4RMF A;  3P75 A;  2XC9 A;  4PMB A;  1SEB D;  2F3I A;  4J9O A;  1NMG A;  2VS1 A;  4I7A A;  3O13 A;  5JEA J;  5KT2 A;  1S68 A;  2JA9 A;  4DL4 A;  1MJE A;  3EN2 A;  4GN3 B;  3SE0 A;  4WJ4 A;  1NMF A;  2P5Z X;  4UCV A;  3HOU G; 
#chains in the Genus database with same CATH homology
 1GD7 A;  2I0Q A;  2F4V Q;  3I4N H;  3WWV A;  4B3R L;  1N8R C;  2Y0S E;  1LTL A;  3KDF A;  2OTJ A;  4O0A A;  2KEN A;  4KHP L;  2A19 A;  4LFA Q;  3UE1 A;  2N3S A;  2NZO A;  4DR1 L;  4LFB L;  2I5L X;  4DV3 L;  1BVS A;  4IFD I;  2NVX H;  1E22 A;  1VQ7 A;  2BH8 A;  1JB7 A;  3STB C;  3J80 c;  4HJ8 A;  2Q2H A;  1E1T A;  4BBR G;  5C3E G;  1VQ8 A;  2UXB Q;  4LF6 Q;  4DV2 L;  4XIG S;  1I50 H;  1HNW L;  1A8V A;  1Q12 A;  1I94 Q;  4A3J G;  2B63 G;  1EQR A;  3CXC A;  2BA1 A;  2RHQ B;  3OYY A;  1IL2 A;  3I4O A;  4A3B H;  2N8N A;  3HOZ G;  2WB1 E;  3B6Y A;  5M3M H;  2CKZ B;  4A3G H;  3H3V I;  4DR6 L;  3HOY G;  4L5R C;  4A3L G;  4AYB E;  4JI2 L;  2CWA A;  1N33 L;  3H3V H;  3F2D A;  4BA2 I;  3D31 A;  2HHH Q;  4JC0 A;  3AFQ A;  1L1O C;  3I56 A;  4A3C H;  2KHI A;  1Y1W H;  2MO1 A;  1YIT A;  2A8V A;  1X3F A;  3KYH C;  4GLA C;  4P71 A;  1FVI A;  3PUX A;  3CF5 A;  4IOC A;  1IBL Q;  1YHB A;  2UXC L;  1CSP A;  5AJ3 Q;  1YIJ A;  3ULL A;  4LUO A;  1XMQ Q;  4A3E G;  1XJV A;  3HOX G;  1EOV A;  1K8G A;  1JE5 A;  2B29 A;  4B3T Q;  2R93 G;  3KF6 A;  1XNR Q;  1D8L A;  3F8T A;  4BY7 H;  1Q1E A;  2JQO A;  1VS0 A;  3HFZ B;  4X65 Q;  1IBM Q;  2JA6 G;  5IYB G;  3RZD H;  5FLM H;  1K73 C;  1MKH A;  3MXN B;  4JBJ A;  5M3F H;  4OWW B;  1OXT A;  4DV1 Q;  2AWO A;  4A93 G;  4FDB A;  4C3H H;  3S1R H;  2AHO B;  1LYL A;  3UE0 A;  4PZ7 A;  4YHH L;  2PQA A;  4GNX B;  2K75 A;  1FJG L;  3L0O A;  4A4I A;  1QVG A;  2IX0 A;  2OQK A;  5C0X I;  2DGY A;  4UY8 C;  4JI4 Q;  1HZA A;  1IXR A;  1UE1 A;  2ZTE A;  3JAM i;  4JI8 Q;  4DR7 L;  4A3D H;  1GVP A;  4L5T A;  4BY1 H;  1UEB A;  3CW2 C;  5IWA Q;  2R7Z G;  1L1O B;  1XPU A;  1B7Y B;  2A1A A;  1PV4 A;  1G51 A;  1S3O A;  1IBK Q;  4TVA B;  3ULP A;  3PO3 H;  4QJF A;  1SE8 A;  2AMC B;  1Y1V G;  1PH6 A;  2OQ0 A;  1C7Y A;  4DR4 L;  3CPF A;  1TWG H;  2V1C C;  1C0A A;  1V1Q A;  1N9W A;  4IFD J;  4C3J H;  2CWP A;  5C4X H;  4LF7 L;  4GN4 B;  4R4Q A;  1LM0 A;  1EUJ A;  1L2F A;  4GN5 A;  2E2J H;  4X66 L;  4B3S L;  3I2Z A;  5GAD C;  2QA4 A;  2ZTC A;  3AEV A;  1R9T H;  1U0L A;  4YY3 L;  3OW2 A;  3NEM A;  3PUV A;  1X6O A;  3CMA A;  2ZJQ A;  3S2D H;  2QGQ A;  3PGZ A;  1BBW A;  2UUA Q;  1PYB A;  4JV5 Q;  2UXD L;  5M5Y H;  3CQZ H;  1I5F A;  3PCO B;  4L5Q A;  4MTN A;  5IP9 H;  2ZJP A;  4XTC S;  5BR8 L;  3U58 A;  4KLK A;  4AH6 A;  5JEA G;  5EAY A;  1QZG A;  3HOW H;  1VQG A;  4BA1 I;  4DV4 L;  2R92 H;  1XMO L;  2Q2U A;  4IJH A;  2JA7 H;  3GDE A;  4OX9 Q;  2UUB L;  1NJI C;  1E7Z A;  4OON A;  3GTJ H;  4A3M G;  1KIX A;  1OXX K;  1YI2 A;  3CCL A;  1Q7Y C;  2JK8 A;  2LSS A;  1W2B A;  2MQH A;  3HKZ G;  2JJQ A;  3K81 C;  1PH4 A;  4B3R Q;  4GKJ L;  1VQD A;  2EXD A;  4IJL A;  4YCW A;  3PF5 A;  4Y7N H;  4YWM A;  2C35 B;  4KHP Q;  3S1Q H;  3W1B A;  1EFW A;  2I5H A;  3S14 H;  1EQQ A;  5LMU L;  2R7D A;  2I5M X;  4APV A;  4DR1 Q;  4JOI C;  4LFB Q;  4DV3 Q;  3FP9 A;  4NXM L;  1Q86 C;  3FHW A;  4LFC L;  2BA0 A;  1PH2 A;  3DM3 A;  1PH7 A;  2IHF A;  2VW9 A;  3CCV A;  2JA5 G;  4HJ5 A;  3K0X A;  1WOC A;  4DV2 Q;  1HNW Q;  3TRE A;  3K80 C;  4PMW A;  1E1O A;  4P72 A;  2K4K A;  1OXV A;  1NTG A;  2KHJ A;  4GS3 A;  4R4T A;  4GOP B;  4LNQ A;  4L5S A;  5GRO A;  2Y0S G;  5H1S E;  5DLQ E;  4JI5 L;  3HKS A;  3CCM A;  2K50 A;  4PZ6 A;  4LF9 L;  1A0I A;  4DR6 Q;  4B3M L;  4OO1 G;  1N34 L;  1XNQ L;  1XPR A;  3ICE A;  4JI2 Q;  4EQ5 A;  1N33 Q;  3E9I A;  1CKN A;  2Z6K A;  1W3S A;  2K52 A;  4TQU S;  4UP7 A;  3UDI A;  4A3F G;  4JI0 L;  2ES2 A;  2E5L L;  2B3G A;  4C2M H;  2B63 H;  3M7N A;  2YYZ A;  1GKH A;  1SLJ A;  1Y14 B;  1PVO A;  2FXQ A;  2HT1 A;  1RIP A;  2PI2 E;  2VUM G;  2OCE A;  4UP9 A;  4A75 A;  1H95 A;  4QL5 A;  5IYD G;  3J81 c;  2UXC Q;  4LWC A;  1GO3 E;  4GNX A;  3DLL A;  3FKI H;  4OWX B;  1GM5 A;  2JEB I;  4H02 A;  1HR0 L;  1ASZ A;  4JI6 L;  4LF8 L;  1N32 L;  1TWC H;  4DV5 L;  1S72 A;  1X54 A;  4BXX G;  5LMN L;  1JJG A;  3NEN A;  2WB1 G;  2RHS B;  3I4M G;  3HOV H;  2JE6 I;  4JI3 L;  1B8A A;  1X56 A;  2UU9 L;  4AYB G;  4DKA C;  1CKO A;  1KAW A;  2GVA A;  1UE7 A;  3HOX H;  4R1J A;  3TS0 A;  1J6Q A;  4PZ8 A;  4KI0 A;  2R93 H;  3F2B A;  4YHH Q;  1UWV A;  3CC7 A;  1FJG Q;  1JJC B;  2OTL A;  2JA6 H;  3PV0 A;  3I4N G;  2IHE A;  1EIY B;  4YWK A;  3G48 A;  5IP7 G;  1VQH A;  4RG1 A;  3F2C A;  1JMC A;  2JA8 H;  4DR7 Q;  2IT1 A;  3PUZ A;  4A93 H;  4IPC A;  2QEX A;  4GKK L;  3H0G H;  4EX5 A;  4LF5 L;  1LUZ A;  1DGS A;  3AQQ A;  3PUW A;  1RL2 A;  1K9M C;  5FJ8 H;  4P74 A;  1HZB A;  2VQF L;  1I6H H;  3AFP A;  1V43 A;  1C9O A;  1HR0 W;  2CQO A;  4JI7 L;  1X9N A;  3JC6 6;  4DR4 Q;  4IFD G;  4JBK A;  5IE8 A;  4DR3 L;  5JJI A;  5LMN W;  2ZTD A;  4LF7 Q;  1K8A C;  2R7Z H;  4X64 L;  3Q8D A;  4X66 Q;  3CPW A;  3CCQ A;  2UUC L;  4B3S Q;  1YHA A;  3SGI A;  4K0K L;  1VCI A;  5GQO A;  2WAQ E;  4DPG A;  4BBS H;  2NVY H;  1Y1V H;  4DK3 C;  1PH8 A;  2VZA A;  2IY5 B;  1P16 A;  1VQB A;  1HH2 P;  3H15 A;  1YJ9 A;  3U50 C;  5GAE C;  2UXD Q;  4LF4 L;  1X3G A;  2NVQ H;  1I94 L;  5BR8 Q;  1X65 A;  1VQP A;  1Y1W G;  3CC2 A;  3KDF B;  4J15 A;  1XMO Q;  2NN6 I;  5ELO A;  3TQY A;  1I3Q H;  5ELN A;  2N49 A;  4O2D A;  2PNH A;  3G71 A;  2UUB Q;  3M4P A;  1Q82 C;  4JBW A;  2BH2 A;  2EQS A;  1UE5 A;  2ZJR A;  4DV0 L;  1WCM H;  1AH9 A;  4IPG A;  4DR2 L;  1KL9 A;  1N36 L;  2HHH L;  4P75 A;  5GAG C;  2AWN A;  5JJL A;  1HNX L;  4GKJ Q;  1A63 A;  1CKM A;  1OXU A;  1VQM A;  3TEH B;  1E3P A;  4OXP A;  4GOP A;  4A3K H;  2D62 A;  3S1N H;  1VQ6 A;  3K8A A;  2OWO A;  1EYG A;  2E2I H;  1KHI A;  3S15 H;  5IY0 A;  1S40 A;  4AQY L;  1JJ2 A;  1TWF H;  1K83 H;  2YTX A;  4LFC Q;  5J3B A;  3OTO L;  1PH5 A;  1TWA H;  1WFQ A;  3BU2 A;  3S1M H;  4JYA L;  1YEZ A;  3PO2 H;  3CCR A;  1SR3 A;  4C3I H;  1M1K C;  1WYD A;  5IT9 c;  5IYC H;  2RF4 A;  1KRS A;  5C44 G;  4A3I H;  2NVT H;  4BY1 G;  1HZC A;  4JCV E;  4DAY B;  4JI5 Q;  3TRZ A;  2JA5 H;  4LF9 Q;  1CSQ A;  2KCT A;  4B3M Q;  1VQI A;  1CUK A;  1QVC A;  1Z47 A;  3J7Z C;  2VQE L;  5FLX c;  4DV7 L;  1N34 Q;  1XNQ Q;  3PO3 G;  1BBU A;  3K7A H;  4QIW E;  3U4Z A;  5HGQ A;  4X62 L;  1G29 1;  2GN5 A;  3KF6 B;  4JI8 L;  1K0R A;  3CCU A;  2E5L Q;  3BZK A;  1WJJ A;  4R4O A;  1T9H A;  3PSI A;  3NBH B;  3HOU H;  4NB3 A;  2ZM6 L;  1VQE A;  4KHZ A;  3T1Y L;  4NPS A;  1VQJ A;  1UE6 A;  3ULJ A;  2D0P A;  3RZO H;  3U4V A;  1U5K A;  3GTP H;  1HR0 Q;  1YBY A;  5M5X H;  2L15 A;  4DV6 L;  4JI6 Q;  4LF8 Q;  2Z0S A;  3EBE A;  3NEL A;  4A76 A;  1SRU A;  2PQA B;  2MNA A;  4DV5 Q;  1N32 Q;  3F1Z A;  3M9B A;  3J80 i;  5LMN Q;  1G6P A;  1A62 A;  1P8L A;  2CFM A;  4QGU A;  4IPD A;  5C0X J;  2VUM H;  1X3E A;  1QUQ B;  1IYJ B;  4JI3 Q;  3HOW G;  2VNU D;  4DK6 C;  2UU9 Q;  5IYD H;  3ZJY C;  4BBR H;  2XTI A;  5C3E H;  1FGU A;  4DUZ L;  4HJ9 A;  1KQS A;  2JA7 G;  5JJK A;  2H5X A;  3T1H L;  4NXN L;  1OTC A;  3TS2 A;  3EIV A;  4A3J H;  1TWH H;  2ALY B;  3L7Z C;  3J81 j;  3KJP A;  4HJ7 A;  5C4J H;  3KOJ A;  4POF A;  3RR5 A;  3AYH B;  3HOZ H;  3RLN A;  1KRT A;  1HNZ L;  1QZH A;  4JG2 A;  3HOY H;  5HY6 A;  4A3L H;  5K36 G;  4Y52 H;  3CAM A;  4GKK Q;  2DUD A;  4DR5 L;  4LF5 Q;  2AKW B;  3GTQ H;  1WI5 A;  2VQF Q;  4YWL A;  5IP7 H;  4JI1 L;  4JI7 Q;  2RCN A;  3PUY A;  1KXL A;  1L1O A;  2WFW A;  4DR3 Q;  2KCM A;  4A3E H;  2D0O A;  4X64 Q;  2WP8 J;  4HIO A;  1SFO H;  4JBM A;  2UUC Q;  1KC8 C;  3M4Q A;  4K0K Q;  2HIV A;  3KLW A;  1VQC A;  2K5H A;  2Z6K C;  5IYB H;  4UPA A;  2EIF A;  1J5E L;  4YCV A;  3S2H H;  4LF4 Q;  2PMZ E;  1L0W A;  1YJW A;  1Q1B A;  4X6A H;  4R4I A;  4DUY L;  1X55 A;  4POG A;  2R6G A;  4GLV B;  4GNX C;  1AE2 A;  1Q8K A;  1YNX A;  3LGJ A;  3CME A;  1SN8 A;  1Q81 C;  3A5Z B;  1TXY A;  1NY4 A;  3A74 A;  2N78 A;  3M85 A;  1PH9 A;  2K5V A;  2F4V L;  2CCZ A;  3M4O H;  4DV0 Q;  2KBN A;  1EWI A;  2LXK A;  3FKI G;  3M3Y H;  3K7U C;  1E24 A;  2XGT A;  4DR2 Q;  4OWT B;  4HJA A;  1N36 Q;  4GLX A;  2WAQ G;  4IPH A;  1HNX Q;  4LFA L;  2LXJ A;  3CCE A;  5GAH C;  1NE3 A;  3E0E A;  3UDG A;  4YY3 Q;  3HOV G;  4A3B G;  3GTO H;  3RLF A;  5M3M G;  1PYS B;  4A3G G;  2UXB L;  2HIX A;  3GD7 A;  1PFS A;  4AQY Q;  4LF6 L;  3A5U A;  1PA6 A;  3E9H A;  1FL0 A;  3OTO Q;  2YV5 A;  2F52 A;  3G4S A;  1PH1 A;  2YTY A;  2Q2T A;  4A3C G;  4JYA Q;  1CKN B;  4DV4 Q;  1MIU A;  3L2P A;  2ATW A;  1VQL A;  2JA8 G;  2MFI A;  1O7I A;  1M90 C;  4WJ3 M;  3PIO A;  3W1G A;  3H0G G;  2K5N A;  3I7F A;  4QQB X;  4UP8 A;  3BJU A;  4AIM A;  1VQF A;  4IO9 A;  4DV7 Q;  3PF4 A;  2VQE Q;  5FJ8 G;  1HJP A;  4BY7 G;  2YTV A;  1QUQ A;  4X62 Q;  3D0F A;  5FLM G;  1ASY A;  1OXS C;  1VQO A;  1IBL L;  5C44 H;  5AJ3 L;  4A3M H;  3CCS A;  2E8G A;  5M3F G;  2ID0 A;  5LMU Q;  1VQ4 A;  1XMQ L;  1Q46 A;  1V9P A;  2ZM6 Q;  3W5O A;  3T1Y Q;  4NXM Q;  3S17 H;  3J7A 5;  1JT8 A;  4B3T L;  4DNI A;  4IOA A;  1QVF A;  1XNR L;  4ALP A;  1HZ9 A;  4BBS G;  3KFU A;  4DV6 Q;  4LW1 A;  1IBM L;  2GVB A;  4X65 L;  3G6E A;  2PI2 A;  1YJN A;  4HIK A;  3MEF A;  4P73 A;  5C0X G;  3KJO A;  3KF8 B;  4DV1 L;  3I55 A;  3S24 A;  3RNU A;  4A3D G;  4JI0 Q;  1B70 B;  3CP0 A;  4MNO A;  4HID A;  3JAM c;  1Z9F A;  2VL6 A;  3CCJ A;  3GTK H;  4DUZ Q;  2ASB A;  2NZH A;  2R7F A;  4JOI A;  3CC4 A;  3T1H Q;  4NXN Q;  4HIM A;  3RN2 A;  4JI4 L;  2K14 A;  2NN6 G;  1WCM G;  4YCU A;  4GOP C;  4OO1 I;  4DAM A;  1VQ5 A;  3GO5 A;  5C4X G;  2HQL A;  5IWA L;  4LUV A;  1PH3 A;  4MZ9 A;  1NBW A;  5M5W H;  1HNZ Q;  4A3K G;  1IBK L;  1D7Q A;  5E7N A;  3VDY A;  3RN5 A;  4DR5 Q;  4A3F H;  1KD1 C;  1VQK A;  4R4C A;  3J81 i;  1VQ9 A;  1VQA A;  1AE3 A;  1MJC A;  3BZC A;  5IP9 G;  4JI1 Q;  3UDX A;  3STB D;  2Q2I A;  3CD6 A;  3A0J A;  2E2H H;  1XTD A;  4PG3 A;  3PO2 G;  4LUZ A;  3PIP A;  3HKZ E;  1SMX A;  3ERS X;  2YU9 H;  2R92 G;  1K3R A;  3GTM H;  2MO0 A;  5IYC G;  1XPO A;  3RLO A;  1IZ6 A;  4BXX H;  4A3I G;  4RMF A;  1PHJ A;  2UUA L;  3GTL H;  3I4M H;  4JV5 L;  2VY3 A;  3S16 H;  2F3I A;  2JEA I;  1NMG A;  1VQN A;  1YHQ A;  2VS1 A;  2IX1 A;  3GTG H;  5JEA J;  1J5E Q;  1YVC A;  3IRB A;  2JA9 A;  3ER0 A;  4OX9 L;  1BKB A;  1EIF A;  3EN2 A;  4GN3 B;  4QY7 A;  4DUY Q;  4ME3 A;  1MJE A;  4WJ4 A;  1SRO A;  3UDF A;  1NMF A;  1YZ6 A;  3HOU G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...