1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/transcription
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
1A62A 2R6GA 1IYJB 4DV7L 4HJ7A 3HOYG 3GTGH 4P73A 4FDBA 4IFDJ 4LUZA 4L5SA 3L0OA 4DR4Q 3OTOL 4P75A 3UE1A 4C2MH 2NVYH 1VQKA 4OX9Q 3S1QH 4A3DH 4JI7Q 2R92H 5JJIA 1Y1VG 5M3FG 3T1YQ 2YV5A 4BY1H 1IXRA 2E8GA 1NY4A 2WB1E 3PUWA 3KLWA 4A3JH 1XMOQ 4JI0L 4JI6L 1PH8A 4B3MQ 1VQMA 4BBRH 4UP8A 3CP0A 2CWPA 3PO2H 5K36G 2B63H 2CKZB 1HNZQ 3CPWA 2K52A 3BZKA 4IPHA 1XPOA 2QA4A 3KDFB 4NXNL 4JI4Q 4HJ5A 2UXDQ 1J6QA 4GN3B 4DV6L 1BKBA 4DV7Q 4GNXC 3F2CA 1JJ2A 2KCTA 1N9WA 4IPCA 5BR8L 4K0KQ 4TQUS 4LNQA 4MZ9A 1AE3A 3HKSA 2UUAL 3I4NG 3A74A 1MJEA 2ATWA 3GTPH 5LMNL 3J81j 2L15A 4AQYL 4NXMQ 1W2BA 4JI6Q 1DGSA 4GNXB 5C4XG 4JI0Q 1NJIC 2CQOA 1FVIA 2AWNA 2EQSA 1X9NA 2IX0A 4B3TL 1SMXA 2K50A 1X3FA 3CCQA 5C4JH 2PQAA 4DK3C 3U50C 2A19A 4BY7H 2AHOB 2UXBL 1Y14B 3JAMi 4AH6A 3GTJH 4NXNQ 1X65A 1E22A 4A75A 2R93H 3AYHB 1PH9A 2YU9H 1BBWA 1BVSA 3GO5A 3KF8B 5M3MG 5FLXc 1FJGQ 1KHIA 4XIGS 3NBHB 1CKOA 5BR8Q 4Y7NH 4JI5L 3F2BA 1QUQA 4YWMA 4IPDA 2R7DA 5HGQA 3SGIA 5FJ8G 1JT8A 1OXVA 2KHJA 1EQRA 1JJGA 4R1JA 5LMNQ 2AKWB 3CQZH 2K75A 3CCVA 3KJPA 4AQYQ 1N36Q 3I4OA 4GS3A 3I56A 1JE5A 4GKKQ 4UPAA 2HIVA 2F52A 1NBWA 3HOUG 3RR5A 5IYCG 4JBWA 2NZOA 4JYAQ 1OXTA 2YYZA 1TWHH 1K73C 4JOIC 5DLQE 3TREA 4B3TQ 2JA6G 2UXCQ 2MFIA 3PCOB 2UXBQ 4X66L 2F4VQ 2ZTDA 4LF4L 3M4QA 5GADC 4A3CG 2BH2A 4KHZA 2VS1A 1YEZA 3PIPA 4R4QA 1L0WA 3EN2A 3PSIA 4JI8Q 3HFZB 3K8AA 3KYHC 4HIKA 4LFCL 4JI5Q 3KFUA 1UEBA 1Q1BA 2K5VA 4JI1L 4DV0L 4LF7L 1FGUA 2B29A 5LMUQ 1HZAA 2QGQA 3BZCA 1YJWA 2VUMH 2WAQE 4A3LG 3PO3H 1I5FA 3A5UA 2A1AA 2AWOA 3F2DA 4GOPC 1VQGA 4C3JH 4DV5L 3CCEA 3U58A 3PGZA 1YJ9A 3ULPA 1YHAA 1C0AA 1UE1A 4LF5L 2ID0A 5IYDH 1EOVA 4LWCA 3T1HQ 2ES2A 5FLMG 3GTOH 4DR6L 4QY7A 3W5OA 2IX1A 1A8VA 1JJCB 2IT1A 2LSSA 4IO9A 4NB3A 1K9MC 3PF4A 4OXPA 5IYBG 1VCIA 2Y0SG 1PYSB 1CUKA 4A3IG 2ZM6Q 4IFDI 4GOPB 4JBJA 4AYBE 2I5LX 1H95A 4JI2Q 4JI1Q 3AFQA 3KOJA 4DR4L 5C0XI 2JA8H 4PMWA 1IZ6A 3UE0A 2OQ0A 4OX9L 3HOXH 1PHJA 4C3HH 3J81i 2WP8J 3HOVH 5ELNA 3H0GH 3MEFA 1RL2A 3GDEA 3T1YL 3CXCA 4DV5Q 1M90C 4A3MH 1XMOL 4B3ML 3D31A 4LF5Q 1K83H 2RHQB 4A3FG 4DR6Q 1SLJA 1XJVA 1SFOH 4OONA 1KXLA 1VQ5A 1HNZL 3M85A 3E0EA 4JBMA 1VQNA 2H5XA 2NVXH 3RLOA 2C35B 5GQOA 1V1QA 4DAMA 4BBSG 3KJOA 2UU9Q 5JEAG 2UXDL 2UUCL 3PUXA 3FKIH 1A63A 1MKHA 1SR3A 1PFSA 1I3QH 2KBNA 5EAYA 4K0KL 1VQIA 3KF6B 2F3IA 4IJHA 1HR0Q 1YZ6A 5JJLA 1ASZA 4A3GG 4GLAC 4X65L 1Q7YC 3GTQH 3ERSX 4NXML 3HOZG 3KDFA 4LUVA 5GAEC 2ZTEA 1VQ6A 3M4PA 3PUZA 3RN5A 2GN5A 3CPFA 4AYBG 1WYDA 1X55A 2QEXA 3G48A 1YHQA 3I4MG 4QGUA 3FP9A 3K7AH 1GVPA 2DGYA 1X3EA 3K7UC 4YCVA 1CKMA 3B6YA 1HZ9A 4B3RL 3UDXA 1XMQQ 1JB7A 2R7ZG 1P16A 1L2FA 1Z9FA 5IP7H 1GO3E 2UUCQ 4DR5L 1X54A 4JI3Q 2IY5B 1OXUA 1X6OA 4EX5A 3HOWG 1SROA 4P72A 1FJGL 4LF9L 4YHHQ 1CSQA 5AJ3L 2RF4A 3CAMA 4MTNA 3ULJA 3OW2A 1UE7A 1FL0A 1K0RA 4HJ9A 2KHIA 2BA0A 4HJ8A 4A3BH 3CCLA 3ULLA 2NVTH 4GN4B 4DR1Q 1MJCA 4X65Q 1N36L 2MO1A 1RIPA 5GAHC 4RG1A 1XPUA 4KLKA 1N34L 1VQBA 4A3KH 1EFWA 4GKKL 2OWOA 1Y1WH 1WCMH 2AMCB 3CW2C 1KD1C 4DKAC 2MO0A 2UXCL 4A93G 5M5WH 2MQHA 3K80C 1VQEA 1E24A 1I94L 4B3RQ 2FXQA 2HHHL 2F4VL 1KL9A 4PZ7A 4DR5Q 1C7YA 2E2HH 1IBML 3K0XA 3S14H 3J80c 3BU2A 3NELA 3CMEA 1HNWQ 4JI8L 1SRUA 4JC0A 4LF9Q 5IP9H 5AJ3Q 1NTGA 1EWIA 2JE6I 5LMUL 1VQLA 1VQ7A 1KRSA 5J3BA 4A4IA 2UUBQ 4JV5L 4WJ3M 5GROA 4POFA 2VW9A 4BXXH 1NE3A 2JA5H 1LM0A 2RHSB 5C3EH 3DLLA 2Y0SE 1N34Q 1D8LA 3JC66 2K5HA 4J15A 4OWTB 3AFPA 3WWVA 4DR3Q 1D7QA 1XPRA 2Z6KA 2JA7G 1VQ9A 3GD7A 3PF5A 3S15H 2YTXA 1BBUA 3CCRA 4TVAB 4HIMA 1C9OA 3HOYH 1TXYA 3T1HL 2GVAA 1I94Q 2Z0SA 1CKNA 1HZCA 4DAYB 3UDIA 3L2PA 2E2IH 2HHHQ 2HT1A 3AEVA 1G6PA 3LGJA 3H3VH 5ELOA 1IBMQ 4A3EG 1V43A 1VQOA 5C44G 2ZM6L 4OWWB 3G71A 1Y1VH 5M3FH 4IOCA 2VQEL 4X6AH 4JI2L 1IBKL 3J7ZC 5M5YH 3M3YH 3EBEA 1TWCH 4JV5Q 1TWFH 2XTIA 4P71A 1UWVA 4R4IA 3OYYA 3S1RH 1QUQB 2IHEA 1K8GA 3UDGA 4IFDG 1N33L 5JJKA 2VQFQ 4A3DG 3PIOA 2VZAA 1VQJA 3A5ZB 2R92G 2ZJQA 3I7FA 4BY1G 4DR7L 3CCJA 1YITA 5C0XG 1S3OA 4YY3L 4A3JG 2DUDA 2V1CC 3E9HA 1QVCA 3RZDH 4AIMA 1Q81C 4BBRG 1PH3A 3PO2G 1UE6A 2CWAA 5IY0A 1Q12A 3AQQA 1L1OC 2B63G 1VQFA 3ER0A 2I5HA 4P74A 3K81C 2UU9L 3I4NH 2KCMA 3GTLH 3W1BA 1Q86C 2VQEQ 1IBKQ 2K5NA 5C4XH 1NMGA 4APVA 3S1NH 1VQAA 1X56A 4L5RC 1N8RC 1HR0L 4O0AA 1L1OB 3EIVA 1N33Q 3VDYA 4RMFA 3S2DH 2NN6G 2YTYA 4O2DA 1VQPA 2K4KA 4XTCS 1MIUA 1K8AC 1NMFA 1JMCA 4DR7Q 1E7ZA 2N49A 4R4OA 4YY3Q 1XNQQ 1PYBA 1Z47A 4X62L 5M3MH 2OTLA 4LUOA 1WJJA 2D0PA 2D62A 3KF6A 3RN2A 4JBKA 1N32Q 1XMQL 1LUZA 1QVGA 3I2ZA 5HY6A 1E3PA 5H1SE 4BY7G 4JI3L 5FJ8H 3H15A 1B8AA 1SN8A 4A76A 3TS0A 4LFAL 1E1TA 4QIWE 2MNAA 1YIJA 2NN6I 2R93G 1K3RA 4YHHL 3HOUH 1I50H 5IYCH 2PNHA 4JG2A 3L7ZC 1PH5A 1QVFA 2JA6H 4DR1L 1G51A 4R4TA 4LFBQ 1VQCA 1PH2A 1VQ4A 1B7YB 1XTDA 4A3CH 2PI2E 1WOCA 1U5KA 2BH8A 2IHFA 3U4VA 2D0OA 3UDFA 4X62Q 3G6EA 2I5MX 1PV4A 3STBC 1J5EL 1GD7A 1TWGH 3PUVA 2CCZA 4UY8C 4GLVB 4ALPA 2Q2IA 4GLXA 4DV4L 1G291 1PH6A 1VQDA 4LFAQ 1OXSC 1X3GA 4YCUA 4C3IH 4HJAA 1HZBA 4GNXA 1TWAH 3TRZA 3PUYA 4A3LH 1HNWL 5C0XJ 4DV2L 2YTVA 3W1GA 5LMNW 4DUYQ 1VQ8A 3F1ZA 4QQBX 3IRBA 3RLNA 2UUBL 5IWAQ 1Q1EA 2I0QA 1HJPA 2JEAI 4GKJQ 5FLMH 2VUMG 5GAGC 4QL5A 4PG3A 4H02A 5E7NA 4DR3L 1OTCA 3PO3G 1KC8C 3M9BA 5IYBH 1LTLA 3H3VI 3CCUA 2JK8A 4A3IH 1W3SA 1J5EQ 4OO1G 4DUZL 5IYDG 3CC7A 1PVOA 4R4CA 1HH2P 3CC4A 2VY3A 1U0LA 1IL2A 4DV3L 4DV4Q 1Q82C 1Q46A 1VQHA 3OTOQ 1OXXK 3JAMc 3I55A 3Q8DA 2E5LL 4MNOA 3STBD 1PH1A 1EYGA 1HNXL 4DV2Q 3U4ZA 1EQQA 1UE5A 1M1KC 5M5XH 2HIXA 4L5TA 1V9PA 1B70B 4OO1I 4A3FH 2JA8G 2N78A 1O7IA 5JEAJ 3HOXG 2VQFL 4LW1A 1VS0A 3CCSA 1XNRL 3HOVG 2N8NA 4BBSH 3H0GG 2NZHA 3CMAA 2ALYB 2XGTA 3HKZE 1S72A 3J80i 1KQSA 4A3MG 4BA2I 4JOIA 4DUZQ 2B3GA 3ICEA 4DV6Q 3RZOH 2WB1G 4LF8L 4DV3Q 3BJUA 3TS2A 2A8VA 4WJ4A 2OCEA 2PQAB 1KAWA 2K14A 2LXJA 2E5LQ 3S24A 2UUAQ 1E1OA 4A3GH 2LXKA 2EIFA 4UP7A 1P8LA 1QZGA 2HQLA 4L5QA 1HNXQ 1ASYA 2ZJPA 2E2JH 3HOZH 3CC2A 3FKIG 1YNXA 3CF5A 2Z6KC 3I4MH 4YCWA 3GTKH 2Q2HA 4KI0A 4DPGA 2JA9A 4OWXB 2R7ZH 2ZJRA 1XNRQ 3DM3A 4NPSA 4DV1L 3GTMH 1AE2A 3FHWA 1YHBA 4GOPA 4JYAL 1I6HH 1AH9A 1SE8A 2GVBA 4DR2L 1XNQL 2KENA 1EIFA 4POGA 3M7NA 3HOWH 4ME3A 4YWLA 3TQYA 4IPGA 2R7FA 4UP9A 1YJNA 4LF8Q 1N32L 3J7A5 1IBLL 2OQKA 1L1OA 1PA6A 4B3SL 2NVQH 3NEMA 4YWKA 1EIYB 4Y52H 1CKNB 4X64L 5IP7G 2BA1A 2N3SA 3NENA 3S16H 2JEBI 1HR0W 3HKZG 1T9HA 3S17H 2Q2TA 1R9TH 1YBYA 2PMZE 3CD6A 5IE8A 4KHPL 1QZHA 3MXNB 4A93H 4GN5A 4PZ6A 4A3BG 4IOAA 4LFBL 1S40A 4DV1Q 3J81c 4X66Q 4A3KG 4DR2Q 4LF4Q 1EUJA 1GKHA 2WFWA 1CSPA 3TEHB 1WCMG 1Y1WG 3S2HH 2ZTCA 5IT9c 2PI2A 4BA1I 4LF6L 3D0FA 1IBLQ 3M4OH 4JCVE 4LFCQ 4DNIA 4B3SQ 2Q2UA 1Q8KA 1YI2A 4DV0Q 4LF7Q 3RLFA 4X64Q 4HIOA 4PZ8A 1KRTA 3PV0A 1YVCA 3E9IA 2VL6A 4DUYL 2EXDA 4JI7L 2JA7H 2RCNA 3CCMA 5IP9G 1GM5A 2JJQA 4KHPQ 3ZJYC 2VNUD 4EQ5A 5IWAL 3G4SA 3RNUA 4GKJL 4DK6C 1PH4A 1WFQA 2JQOA 3F8TA 4BXXG 1KIXA 1A0IA 2JA5G 4HIDA 5C3EG 4IJLA 4QJFA 2OTJA 4A3EH 1PH7A 3A0JA 2WAQG 5C44H 1WI5A 3S1MH 4JI4L 2CFMA 1LYLA 4LF6Q 2ASBA
chains in the Genus database with same CATH superfamily
2UXBH 4HJ7A 3Q6SA 3D4WA 4RKLA 3PW7A 4P73A 4XXEA 2KA7A 2WB1B 4FDBA 2DWCA 2XGQA 4P75A 4C2MH 2NVXB 4IFDH 3WO0A 4HCEA 3S1QH 3P7JA 2R92A 5JJIA 3GTQA 1HA5A 4BY1H 5KFSA 1NY4A 5D1PA 4JI6L 3E3XA 3M9NB 3GV7B 1MI2A 1EY8A 1ZHQA 4QMGA 2L55A 2C2RA 3CPWA 2K52A 4IPHA 1PTOH 3D4RA 5KFPA 2HDLA 4JI4Q 4NXNL 3A8JE 1J6QA 1JWSD 2DY8A 1CQFA 4GN3B 5I47A 1BO0A 1A3TA 3NWSA 5BR8L 5C4ZA 4TUYF 4TQUS 1F2YA 4KK7A 4UCTA 1TWGB 4TV9F 3QOLA 2UUAL 5LL6b 1S0MA 2ATWA 3R2TA 5DLGA 2V4RA 1HFGA 5LMNL 1KJ8A 2XIGA 5KFDA 4JI6Q 5C4XG 3J7AV 1X9NA 2B2WA 4B3TL 4HR7A 4CDDC 2PQAA 4DK3C 5D14A 4BY7H 3BZDB 1WTWA 5JPMC 2L1BA 3JAMi 4NXNQ 1E22A 1SYBA 5KT4A 1Y1WB 1WCMB 1QG7A 2YU9H 3GO5A 5D3IB 4MV9A 2QK4A 4G7ZC 5BR8Q 2EJMA 4DXGA 4JI5L 1JORA 2VOBA 2FPGB 2R7DA 4WJWA 3K3PA 5KFFA 1EQRA 2EVBA 1D5ZC 5LMNQ 2AKWB 3CVZA 3KJPA 4QW8A 4UCSA 5BN5A 1HR0H 5KX5F 1Z7TA 2NU8B 1MGSA 2NZOA 2YYZA 4B3TQ 1JB3A 5DLQE 4ED7A 1LT4D 3QB3A 4QWBA 4A3FB 3UFXB 3PR4A 1HRJA 1EEID 5COYA 2JSOA 4KHZA 1HNZH 2OEOA 1TU2B 3PIPA 4BBSB 5NUCA 4JI5Q 3BVMA 1XXGA 2M00A 4F88A 4IRDA 4JI1L 3RB6A 4LF7L 1FGUA 2B29A 1WR2A 4WD3A 3BDOA 2VUMA 1PTOF 4XDXA 4A3GB 4IUTA 1B6SA 1Y1VB 5M3FB 3N6XA 5IYZF 1VQGA 4MIUA 3U58A 4ULLA 4IHJF 3PGZA 4OO1H 4NXMH 1CZGA 4LWCA 2ES2A 3GTOH 4DR6L 1XDNA 5CYUA 2Q8TA 2IX1A 2VB3X 1TY0A 2V4DA 3D6WA 3LWUA 4ODGA 4ZK9B 1S9FA 4OXPA 3MR3A 1VCIA 4KHVA 2B2VC 1I6HB 1SJHD 4CBVA 3VMMA 2XC9A 4EQOA 2I5LX 4KY7A 3RZDB 1BNZA 4I7AA 5KNDA 4JI1Q 4DR5H 3U9SA 4DR4L 5C0XI 4OX9L 4CDCC 5C4HA 1I6VC 3GLKA 1BNCA 4U673 4RZQA 4RZRA 2CQAA 1A2UA 3R5XA 1K83H 2XD4A 3IN5A 3ZYYX 2WB1A 4DR6Q 3VA7A 3HXLA 2R8GA 4RUAA 1VQNA 4K2KA 3K58A 1ESRA 2NVXA 3RLOA 4MV4A 1VKZA 3DUZA 2UUCL 2W57A 3V6HA 5KFEA 1ICWA 2HHHH 2DLNA 1A63A 2MJ8A 4DXFA 3S2HB 1I3QA 3N41B 5EWGA 1YZ6A 3M4OB 5CV6A 3RJ0A 1DONA 1AUVA 3NK9A 3GTQH 2F0GA 3RF2A 4LUVA 4RWSC 2ZTEA 1D5XC 1VQ6A 1I4PA 1BCPF 1WYDA 2JXMB 4AYBG 3G48A 4QGUA 4YCVA 3OWEB 2F0JA 5IT9L 5EOYA 1HPCA 2JA6B 1CKMA 3B6YA 2LMCB 4B3RL 3RIZA 3FVQA 1P16A 5E4WC 1Z9FA 2UUCQ 2IY5B 1L2ZA 1X6OA 3RUPA 1FJGL 3Q0AA 1WTXA 3SI8A 1JLLB 1CSQA 2RF4A 1DOMA 2ZM6H 3K5OA 1K0RA 3Q23A 2KHIA 4HJ9A 3GTGB 3LWBA 3CCLA 3ULLA 3QFFA 4GN4B 1MJCA 4JI2H 2ICIA 4KLKA 1VQBA 4C3IB 4GKKL 4HMJA 3GQCA 1Y1WA 1WCMA 3CW2C 1PTOC 4YQWA 2UXCL 4RFBA 4A93G 2MQHA 3K80C 4B3RQ 1E24A 2FXQA 4YP3A 2VPQA 3PO2B 4JW0A 4YY3H 4RUCA 4PZ7A 1DD2A 2BDOA 2K28A 4ZYSA 1IBML 3S14H 3KHLA 2B39A 3DMUA 1HNWQ 1SRUA 2UU9H 1EWIA 1SYXB 4POFA 2VW9A 4HSVA 1PZJD 3DLLA 2GLTA 3JC66 4J15A 1D7QA 2WAQA 3GTPB 1VQ9A 2G9HD 5FO7B 3CCRA 2YRXA 1PDQA 2NU7B 2Z0SA 4DAYB 2E2IH 3UDIA 3RBDA 2HT1A 4MV3A 3SK4A 1K8MA 3H3VH 2R6FA 1A6XA 1IBMQ 1VQOA 4OWWB 3E0JA 5J1ZA 1Y1VA 3W3AA 1M0TA 4IOCA 2VQEL 1DCZA 4X6AH 5M5YH 1F77A 3K5HA 4ZUJA 5FK9C 3VR2A 4HEDA 1RYRA 1UWVA 2W9BB 3OYYA 3S1RH 5JJKA 2IHEA 3OUZA 5LYJF 4IWYA 3RV4A 1DOLA 3PIOA 4A3DG 3V2TA 2R92G 5CGKA 4DLKA 4DR1H 3CQZB 3CCJA 1HXYD 2QDBA 1YITA 1M0WA 4A3JG 2V1CC 3E9HA 1QVCA 1Q81C 4H7BA 3EVQA 2JN4A 2C2DA 4IUVA 3GIPA 1VQFA 2F0IA 4BWSC 1BCPC 1LTAD 2ASJA 3K81C 3I4NH 5CBEE 3MXGA 1Q86C 2VQEQ 2RKSA 4DV4H 5KIXA 1X56A 3E5NA 1LO5D 1HR0L 3T5KA 3IG0A 2K1BA 3CU7A 2YTYA 4JYAQ 4ED6A 2SCUB 1MIUA 1IOVA 3I73A 2A6EC 4R4OA 5A35A 1XNQQ 3PO3B 4UFZA 4QWCA 2OTLA 4X62L 2IX3A 2D62A 2D0PA 4C3JB 5D1OB 5CV7A 1FKAH 2PO4A 5H1SE 1B8AA 1IL8A 2VPSA 1K3BC 5FD5A 2R93G 2NN6I 5K2MA 3H94A 3GIDA 3HOUH 1I50H 3K5NA 4OHJA 3M4IA 2J6UA 2JA6A 2PNHA 2R84A 4H0LC 3CRLC 3DM1A 2J7ZA 4LFBQ 3FRPB 2JA8B 3TSSA 5IT9W 5T1GA 3HOXB 4J9KA 2KJXA 4UCRA 1RDPD 4JPBW 4C3HB 1F9QA 1WOCA 2PI2E 4RNMA 2PBZA 2IHFA 4X62Q 3G6EA 3UDFA 1PV4A 3L4KA 5LP6F 3RB0A 2B2TC 1TWGH 4A3MB 2CCZA 2FK1A 4ALPA 2Q2IA 1STGA 1G291 1W96A 1OXSC 1X3GA 1WD1A 4A3LH 4EEQA 5L1KA 3H40A 4LSAA 5KEEA 4O42A 2F0LA 3FDSA 2AUKA 2D2CC 3G6JB 1UAPA 2K6AA 4TSSA 5JH7F 4ECRA 1GGOA 5C0XH 3JSLA 1Q1EA 4GKJQ 1IW7C 2VUMG 1I4QA 1LTTD 2L5TA 3I4LA 1OTCA 1S5CD 4XYQA 4O4IF 5IYBH 2AUJD 2Y0SA 3OWFA 5KFNA 1W3SA 3N42B 4ABNA 5J39A 3M9OB 1PVOA 1HH2P 5DM73 2VY3A 1U0LA 4LF4H 3NTKA 1STYA 4DV3L 1Q82C 4V190 1Z6HA 1IKMA 2YS7A 3OTOQ 3VYRA 3JAMc 3I55A 1DOKA 3PW2A 5JOBA 1EYGA 4B3SH 1F9RA 5M5XH 2HIXA 1BF4A 2R7MA 4A3FH 2N78A 2E74C 2K33A 4LAAA 1AFPA 2RDHA 5EQ0A 1VS0A 4NMZA 1VAJA 4G57A 3HOVG 4BBSH 3H0GG 4LSXA 5C5MA 5JEAH 4ECTA 1E2WA 4G4KA 4A3KB 2B3GA 3KTMA 4DV6Q 5DAUA 3JAMW 4FXGC 4C1NI 2WB1G 4LF8L 4DV3Q 4XYMB 5DQIA 2R8HA 4WJ4A 4EBDA 3OSPA 2W9BA 2DPJA 2F0NA 4A3GH 5DEHA 4JV0A 2EIFA 1P8LA 1U4RA 2HQLA 1OO9B 2F0EA 1KJIA 5C1PA 3MZ5A 5KG1A 2Z6KC 3I8ZA 4KJOA 3GTKA 1CQIB 2JP1A 4J9OA 1B2TA 2R7ZA 3R8BA 1BBXC 2ZJRA 3ND8A 3ORRA 3DM3A 4KKUA 4ME5A 1AE2A 1I6HH 1W6JA 2GVBA 3H3VC 1V4YA 4I7HA 4RH6A 5KFWA 3TQYA 1YJNA 4LF8Q 2PMZB 3SXHA 5LL6X 3K5MA 2PPBC 5KYLA 1KDBA 2F0PA 3HOYB 4JI4H 4OEMB 3OOCA 4Y52H 4DL3A 3ERQA 2B2VA 4X64L 2N3SA 1CE8A 1HR0W 3HKZG 4LMQD 1RJTA 2Q2TA 4QIWA 1R4QB 3PW4A 3GILA 4DN4M 5BPHA 1K8OA 3MXNB 3KALA 4A3BG 3NTHA 3M3YB 2EZVA 2PYKA 1TIID 4JI6H 1TWFB 2RSOA 5KFJA 1I7LA 2WFWA 3S2HH 3BVZA 1WCMG 1Y1WG 1EIHA 4RAZA 2ZTCA 3LMLA 4FYDA 3KHHA 4GZYC 3M4OH 4LFCQ 4DNIA 4HAEA 4NXNH 1ENFA 1Q8KA 1YI2A 3IFTA 4X64Q 1EY4A 3EPIA 1TT2A 3MWYW 4OIKA 1KRTA 4FF2A 5BR8H 1STNA 3RMHA 2JA7A 1CS0A 2NUAB 3NUCA 5CA1F 2VNUD 5LMNH 4IQZA 2ATLA 1WFQA 4BXXG 3HB9A 1A0IA 4QJFA 2CW8A 4A3EH 2WAQG 1KEEA 2V58A 4B3TH 1S03G 2F0QA 4DV7L 3GTGH 4PQXA 5HGTA 2F4IA 4QWEA 4DK1A 3L0OA 3GIQA 4EBCA 4C2MA 1PZKD 2V9WA 1VQKA 4CDFC 2EYOA 2SNMA 4JI5H 1QB5D 2DN8A 2QW7A 1Y1VG 5M3FG 3T1YQ 3LNNA 1IXRA 1QWYA 1GOZA 4JI0L 1PH8A 2Z6BA 4OELB 3PO2H 2G5DA 1I4XA 2K5QA 5TSSA 3PR5B 2CKZB 3NWTA 2GA4B 5IGEA 3BZKA 3HS0C 5ELCA 2MHVA 1V1PB 3T16A 2QA4A 2B8GA 1XPOA 3MFHA 3Q8QB 4HJ5A 4UDUC 3T56B 4DV7Q 1JJ2A 1AZQA 4Q5VA 1I7NA 1DXMA 1D1IA 4IRKA 2EYLA 4LNQA 2GPSA 3RTXA 1AE3A 1B53A 4F4XA 3GTPH 2ZXRA 4ECWA 2B2UC 1PRTF 3QZ7A 3QZ8A 3V6JA 2NN6H 4MV6A 3J81j 2L15A 4JI1H 1NUCA 1PYWD 4GNXB 4ECXA 4JI0Q 4J9PA 4CHTB 1A3UA 3RUZA 3AU7A 2C2EA 2EXZA 1SMXA 2K50A 1X3FA 3CCQA 2MP1A 2A19A 2AHOB 4ECQA 1Y14B 3TP5A 4ZI7F 1ZQ7A 3A8IE 5KG2A 1X65A 1B9MA 1UNSA 4A75A 4DR6H 2YU9A 1BVSA 1BR9A 5M3MG 5FLXc 1VBGA 4FU0A 4A3IB 2SOBA 2F1MA 5I6YA 1SCUB 3L4JA 3OMCA 5I2XA 1QUQA 4KY6A 2F0VA 3I12A 3OPOA 4HN7A 1Q3LA 1E0BA 5FJ8G 2JEIA 1SNDA 1FR3A 2EY5A 1N36Q 3CQZH 2K75A 3CCVA 4YR0A 3A56A 3S14B 3TMEA 3I56A 1JE5A 4OX9H 4UPAA 3I70A 2HIVA 3RFCA 1S97A 1NBWA 5IYCG 2PMZA 4JBWA 1TWHH 1K73C 2JA6G 4K6LA 5L1LA 3R93A 2IA6A 5DM63 3J80E 2F4VQ 1E4EA 1FNUA 4LF4L 3TIGA 3M4QA 2X69A 4C5CA 4Q0FA 1L0WA 5A2QL 4JI8Q 5KFQA 3K8AA 3KYHC 3KFUA 1H9JA 2UUCH 4DV0L 2E2IB 2ICEC 5LMUQ 1DYQA 1JC7A 2P5ZX 2R61A 2QF7A 1C8CA 1EWHA 3GV6A 3PO3H 1CI3M 1I5FA 3A5UA 2GPWA 2SDFA 4JK1C 4C3JH 4DV5L 2YW2A 4LF5L 2ID0A 3T1HQ 1C48A 4N8X1 4QY7A 3I4MB 2Z9HA 4I55F 1A8VA 2LSSA 4IO9A 2R87A 4ED3A 2BQ3A 2FJZA 3PF4A 1JWUD 4DL6A 4J9LA 2NU6B 2Y0SG 1PYSB 1CUKA 5EKKA 1B1ZA 3GTMB 4V0BA 5KG5A 4E4TA 1SYDA 4B3RH 4AYBE 1VMPA 3AFQA 2A73B 3KOJA 2JA8H 2R86A 4PMWA 1IZ6A 1E2ZA 3UE0A 4J9MA 3HOXH 1PHJA 2MCTA 1T94A 4C3HH 3K57A 2MUYA 3MEHA 5ELNA 3MEFA 1B50A 1RL2A 3N43B 1JQYD 3MXPA 4DV5Q 3KHGA 2AQ4A 4A3MH 4K2LA 3D31A 5EBDA 4LF5Q 1U4MA 3GIMA 1PRTC 1K83A 3KBXA 4GKKH 1SLJA 1SFOH 1VQ5A 3BDCA 5GQOA 1V1QA 4DAMA 1W93A 3DWAA 2RA4A 2EY1A 2B2TA 2LY7A 3PUXA 1CK1A 1MKHA 1SYCA 3T5JA 1IBMH 1VQIA 3J7AF 1ASZA 1K1SA 4GLAC 1Q7YC 1V1PA 3ERSX 3HOZG 1G8ZD 1ICFB 1MBYA 2WACA 3SE0A 5LHY1 2WIIB 1X3QA 3M4PA 2QEXA 5FPOA 3HOUB 1I50B 3K7UC 1X3EA 5F2DA 4FXKC 1AP0A 4YAKB 2R7ZG 1GSAA 3PVXA 1L2FA 4DL2A 2KSWA 1KLGD 5IP7H 1GO3E 5K5PA 4JI3Q 5C1OA 2SEBD 1JXLA 2Q8IB 5KFIA 1A2TA 1HTPA 1OXUA 5L37A 5EPLA 2W70A 1O7YA 1SROA 4C5BA 4RB1A 2R85A 2M2LA 4LF9L 4YHHQ 4O3PA 3VR6A 5KFBA 1UE7A 1FL0A 2VQEH 2NVTH 1SNMA 1CA6A 4RG1A 1N34L 4A3KH 4HNUA 2A74C 2C00A 2V4QA 1QCBD 5KT2A 4IUPA 2MO0A 4FF3A 4K14A 3RD4A 1S5DD 4Z9CB 1G91A 1VQEA 4JYAH 2EJGC 2HCIA 4BBRB 5AFWA 1VBHA 1XNQH 5EGTA 4O3QA 1S5FD 2O4XA 4O4LF 1BXRA 2IW3A 3KAKA 4F7XA 1ET6A 3FPUB 5ELEA 4JC0A 2B2YC 5IP9H 4LF9Q 2E75C 1NTGA 2KEEA 3LWEA 1VQLA 2UUBQ 4A4IA 2WE6A 4JV5L 2K5DA 2ZXOA 5HBRB 1NE3A 1LM0A 5FOBB 1N34Q 4OWTB 4R8UB 4OL7A 4DR3Q 2EPBA 1XPRA 2Z6KA 2JA7G 2ZT9C 3GD7A 5M5XB 2YTXA 2J4XA 4MV8A 4LFBH 1S5BD 1C9OA 3HOYH 1CT1D 2CQYA 3KHRA 2E2IA 2L9HA 3AEVA 5ELOA 1UUPA 4X62H 2HVRA 3JZIA 1V43A 5C44G 1DV1A 3GTJB 2RVLA 1IBKL 3KLRA 3M3YH 3G6YA 2NWGA 3VYTA 4JV5Q 1TWFH 2I46A 4Y7NB 2DZDA 5K36H 2QYZA 4XT1B 2EJFC 4J9NA 2M05A 4IFDG 1N33L 2VQFQ 3A5ZB 2ZJQA 1BXTA 3I7FA 4BY1G 4DAVA 4DR7L 2YZNA 4HNTA 5J22A 1B4OA 2J9GA 3LX0A 4GKJH 4LK1C 1B33N 5IY0A 4EYHB 1Q12A 3AQQA 4K5XA 2WDTA 3ER0A 1ZEQX 2AGOA 2K03A 4DU9A 5C3XA 1BQQT 2A69C 2VA2A 3SHLA 1A9XA 5KKNB 1IBKQ 4APVA 3RB4A 1VQAA 3OTOH 1N8RC 3C1EA 1ULZA 1ENCA 4HCSA 4O0AA 1N33Q 3VDYA 4RMFA 4ID6A 4DR7Q 2K4KA 2W7PA 1E7ZA 2N49A 2JEJA 1Z47A 1ZETA 1N32Q 4JVZA 5ELDA 5IOCA 1LUZA 1JCKB 5KFTA 4NDXA 4BY7G 1WTPA 3TS0A 5GONF 4DV6H 4LFAL 1E1TA 4F4YA 4DV3H 1PRTB 2CH4W 1O80A 1I50A 4J6HA 1AZPA 3N52A 4JG2A 3J81E 5CC4A 1G51A 3AMUA 1FYCA 4HTHA 3TZDA 1VQ4A 1OWTA 4A3CH 4RGMA 2L0CA 3DHQA 4EEYA 1U5KA 2BH8A 3U4VA 4GC7A 4CC5A 1J5EL 1TWGA 5JPNC 3SR1A 2IMWP 2L4NA 4F87A 4GLXA 1WTQA 3V4SA 1PH6A 1VQDA 2PVPA 1PRTD 4LFAQ 1FD7D 4A3EB 1HNWL 3TINA 4LF8H 1TWAH 2F0MA 3PUYA 4DV2L 2YTVA 4DUYQ 5LMNW 5KFRA 1TS2A 2KEDA 3FKIB 3IRBA 3RLNA 5IWAQ 2F0UA 3QIAA 3H20A 1M8AA 2B2UA 5FLMH 2NB0A 2LKVA 3MXUA 2N55A 4CJ1B 5KT6A 1A15A 1YNJD 3CCUA 2JK8A 4A3IH 5KGUA 1J5EQ 3BYYB 3MTSA 4EQNA 4DUZL 4OO1G 3CC7A 5DQHA 1JOOA 3VR5A 1IL2A 3P75A 4ZRZA 1VMCA 2CW0D 1VQHA 3U9OA 1OXXK 2E5LL 4R8UA 4IAJA 1QJOA 4MNOA 1HNXL 4DV2Q 1UE5A 4L5TA 4X64H 3PN1A 1S5ED 1B70B 3JRXA 3QJYA 3D8GA 4PV1C 4HQ6A 3TQTA 2F0DA 2AU0A 4LW1A 4PNYA 2Z1CA 1XNRL 1E2VA 3M9MB 3CMAA 1GXDC 3HKZE 3N40P 1KQSA 2EDGA 4DUZQ 2YCHA 1NAPA 3RZOH 4X3UA 4NW2A 2EY6A 2IWHA 5A2QE 5DNFA 3TS2A 2A8VA 4O3NA 2PCFB 1K0SA 1XYIA 2E5LQ 5JVDF 3RGXA 1HNXQ 2XN9C 5JVLA 3CC2A 2E2HB 3M4YA 2PZTA 5L9XA 2QILA 3I4MH 4ECYA 4YCWA 4DPGA 4OWXB 1EU4A 3C46A 3Q8RB 3T1YH 3TN2A 5EPJA 3T13A 1LT6D 1XNRQ 4NPSA 3GTMH 4JYAL 1UC8A 1SE8A 4DR2L 1XNQL 5C3EB 4MAMA 4KV6A 1PXUA 3EQLC 1SMYD 2EYJA 3HOWH 3J80L 4IPGA 5IIFA 2R7FA 4UP9A 5C5LA 4TKOB 2FK2A 2HCCA 1TWHB 1IBLL 5FPRA 2CZGA 1CKNB 4DV7H 3NENA 1T9HA 1YBYA 4UCVA 3NSWA 1Z2PX 3CD6A 2HUGA 1KAAA 4KHPL 4K8JA 1H9SB 2CVRA 2CH4A 4J9SA 3BJYA 1PFMA 2FP4B 4LFBL 1S40A 5KNBA 2FFKB 4X66Q 4ECVA 4JI0H 4DR2Q 1KC7A 3VR4A 3Q24A 5L1JA 1EHIA 4ZKCB 1KBLA 1EEFD 5IT9c 2PI2A 4BA1I 4MV1A 5EZYF 1IBLQ 1F9PA 2FHTA 4JCVE 2W6PA 4RU9A 2Q2UA 2J0TD 3RLFA 1CHPD 1PLFA 1B44D 3PV0A 5CB4F 3E9IA 2VL6A 1PZID 1CQJB 2DJFC 3CRKC 4JI7L 1SEBD 3GTLB 1GM5A 4KHPQ 2A69D 1N36H 4GKJL 3BQ1A 1PH4A 3GP7A 5G3LD 3F8TA 3I90A 1KIXA 4XQNA 4HIDA 4RA8A 2OTJA 4N8FA 5KG7A 4G7OC 3S2DB 5E4XA 1T5XD 2EYPA 4Q45A 2XCPA 5C3WA 2CFMA 2R6GA 1IYJB 3F8NA 2EYFA 2F4VH 3GTGA 1O78A 3SDZA 3N44B 2F0OA 1LACA 1B9NA 2HGSA 4O3RA 1SFOB 2DPIA 3OTOL 1KABA 3UE1A 3QOJA 3KK7A 3ETJA 2ASLA 4JI7Q 4EG0A 1I4RA 1STBA 3PUWA 3KLWA 1XMOQ 4XT3B 4NP5A 5IODA 1VQMA 4B3MQ 4BBRH 2I07B 2CWPA 4M8AA 4RB2C 2B63H 1HNZQ 1TQOA 5JVH3 2RQXA 1CA5A 1DIKA 5CR3A 3KDFB 2UXDQ 1K1QA 4DV6L 1BKBA 4JV1A 1NSNS 4GNXC 2K5WA 1TY2A 2KCTA 1N9WA 1Y8NB 4IPCA 4KN7C 4EQPA 4K0KQ 4MZ9A 2RSNA 1PK8A 3I4NG 3A74A 2B8FA 1WVLA 3GTPA 2W9CB 2B2YA 4AQYL 4NXMQ 4DV0H 3HGBA 1W2BA 1DGSA 5KFOA 4DAYA 2CQOA 4FS2A 1K28A 1W6KA 3V6KA 2KCCA 2NU9B 3U50C 2NVTB 4DFAA 4DV5H 4TQSA 4AH6A 3GTJH 5DGBA 4LF5H 1F9SA 5T1IA 1NCVA 3AYHB 1PH9A 1B3QA 4KKSA 1MSHA 4N9TA 2H1EA 4IUNA 1KHIA 3NBHB 1CKOA 2BE5D 1SJED 4Y7NH 1JDBB 2W6OA 1QNUA 4XQJA 3BQ2A 4CJ0B 1UEAB 1OXVA 2KHJA 1EY9A 5EJWA 3V05A 3CQZA 1QILA 4AQYQ 5FO9B 5CBAE 1GSHA 3FDTA 4KMUC 3FEWX 1WTHA 5H80A 1RYSA 5D8DA 3HOUG 2O5JC 2R8JA 3RR5A 1JKJB 1HHVA 2IJ0A 1OXTA 1TWHA 2FE3A 1WTRA 1IYVA 3PCOB 3GIIA 1RD9D 3TBIB 1LTSD 2ZTDA 3DXJC 5GADC 3OHBA 1RTOA 2VS1A 1HTLD 3EFXD 3W2DA 4QW9A 2CW7A 3EYYA 1VF5C 3EN2A 1RTNA 4LFCL 2HJWA 1UEBA 3OMGA 4JI3H 1Q1BA 1PX2A 2KCNA 4LH6A 1B3AA 2Z8LA 3S9WA 4A2AA 1HZAA 2QGQA 1YJWA 2HQEA 4A3LG 1TVXA 5C6AA 1BGWA 4YHHH 2XIWA 2AWOA 4NLGA 2F0SA 1EY0A 2NTSA 3PW5A 3F2DA 5I2YA 3MC0B 1F2LA 3CCEA 1RJRA 2WKDA 5D1OA 5IYDH 1YHAA 1UE1A 4ZKBB 1ESFA 1D2BA 4B9WA 1EOVA 4AYBB 3GV5B 3BG3A 2NBFA 4RKBA 3A55A 3L3OC 4EGVA 5IYBG 5IGFA 1VF7A 2ZM6Q 4IFDI 4GOPB 1J9OA 1RCVD 4ZOLF 1EQVA 3OSOA 4JI2Q 4F4WA 3T5LA 3WDNA 4OIJA 4LF9H 1PFNA 3LP8A 4MA0A 1RODA 3I72A 3T1YL 1M6VA 4FP5D 3CXCA 2UUBH 3RGZA 4ZCKA 2YYAA 4O4HF 4E6IA 3S17B 1R9TB 1N34H 4A3FG 1SFOA 4DR3H 1KXLA 3E0EA 4JBMA 4A93B 3JSNA 2C35B 4BBSG 2FKLA 3KJOA 2UU9Q 5JEAG 3FKIH 4R8IA 1I4GA 3KAJA 4Q0YA 3T51B 2W9AA 2R3ZA 1ET9A 4M1UB 1SNCA 4I50F 2F3IA 4I65A 4TV8F 4KD4A 2J6TA 3VA5A 4FF4A 4A3GG 1Y69U 4C56C 4CJ2C 4X65L 2W6NA 3KDFA 4J8QA 3J81L 3H4BA 1T5EA 3JRWA 4JV5H 2V5AA 3RN5A 3PUZA 2BR0A 2GN5A 3CPFA 3RB3A 3DEOA 2VQFH 2DGYA 3RV3A 2X6GA 3MWEA 4MV7A 3UDXA 1XMQQ 1JB7A 2LFNA 2TMPA 2R8KA 4DNRB 4EX5A 1S0OA 2R8IA 4P72A 1EYDA 5KFCA 5AJ3L 2YS6A 2KOLA 3CAMA 4MTNA 3ULJA 2CHBD 5CAEB 3U9TA 3IKJA 1O7LA 4DR1Q 4X65Q 1N36L 2BOSA 2MO1A 2V59A 1IBKH 1CFMA 1SYGA 2NVYB 1TWAB 2OWOA 5KG3A 1I6UA 4A3DB 1KD1C 2WKCA 1O7ZA 2R92B 1N33H 4IUQA 3NBHA 5CMDA 5M5WH 2KUMA 2FMCA 3V96A 4A3JB 4CKBA 1I94L 4DR7H 2F4VL 2FLPA 1HUMA 1C7YA 2E2HH 1B04A 3K0XA 3QO2A 5BPFA 3BU2A 4JI8L 4RHSA 5AJ3Q 3N6RA 1S0NA 1S68A 1XX8A 5LMUL 1VQ7A 1KRSA 4QWDA 4WJ3M 5GROA 2EYHA 2R82A 3GV3A 3EROA 2JA5H 5C3EH 2MPMA 2L11A 4L8JA 1D8LA 5D3DA 2K5HA 1RKNA 3WWVA 4LH7A 2FLNA 1CQVA 3PF5A 3TP7A 1EIGA 3HG9A 1V51A 3T1HL 1I94Q 1G6PA 4RGOS 5E1FA 3AB9A 3I3CA 1GUWA 2R7LA 3R5HA 3LGJA 4CKCA 4HR7B 4A3EG 5C4JB 5KFGA 1NR4A 2WTFA 3MXNA 2X6LA 3D4DA 1GJXA 3RZOB 4LFAH 3EBEA 4AYBA 1TWFA 4Y8VB 2A6HC 2XTIA 2DNCA 4P71A 4C3IG 1K8GA 2NYZD 4DUYH 1FNWA 4IR9A 2VZAA 1VQJA 3BYTB 5IGDA 1H9RA 4ME6A 2XRSD 3OSNA 1C4QA 1S3OA 2ZDGA 2DUDA 5FKAC 4YIJA 5LXTF 4AIMA 1PH3A 1GUGA 2CWAA 3PO2G 2IBKA 3C2PA 2BQUA 2F3WA 1EU3A 4FNFA 5FD6A 3ONAB 4IN3A 2I5HA 1J5EH 3GTLH 4I4TF 1Y8OB 3HOWB 5C4XH 1NMGA 3DWQA 5I9PA 1HNWH 3FMAA 4ED8A 5CV5A 1AEXA 1L1OB 1ZKOA 3EIVA 1U4LA 4DV2H 3S2DH 1DZ1A 3FPPA 3KLSA 4R9WA 3K0YA 4O2AF 2NN6G 1JMCA 4O2DA 1VQPA 4XTCS 2VUMB 1K8AC 1NMFA 1M7JA 4LUOA 3RN2A 3I2ZA 3CKIB 4CDEC 2VQDA 4ED0A 2DNEA 3NPPA 4JI3L 4DUZH 3BAAA 2FLLA 2MNAA 1IYUA 1E4FT 3KUPA 3T5HA 1K3RA 5EKLA 3SEBA 4YHHL 4K5VA 2L12A 2E5LH 1YNJC 1HQRD 3DF7A 3J81W 4XZ3B 1HNXH 2JEFA 1QVFA 4R4TA 4DAPA 1J8IA 1B7YB 1XTDA 3ITPA 4ILWA 3NE5B 1HUNA 2YL2A 2WV6D 5KG4A 2CW0C 2Z4IA 3HOVB 3H0GB 5L1IA 4EYIB 2I80A 1EUCB 2FB9A 5JAVA 4G3IA 1XNRH 5IGCA 2EYMA 5G3LF 4GLVB 2AQ2B 4IRCA 3PW0A 1EYCA 3VPCA 2NVYA 1HZBA 4GNXA 1TWAA 2QEJC 3W1GA 1VQ8A 2XWJB 1FNVA 4QQBX 2UUBL 5EDWA 3PMFA 2I0QA 1HJPA 1I3QB 5EPKA 1LT3D 5GAGC 4PG3A 4DR3L 5E7NA 3PO3G 4YAJB 3VPBA 5KFHA 4YR2A 1KC8C 3M9BA 4F50A 4HYKA 3H3VI 4EFBA 2XCLA 4C3JG 2E76C 5M9OA 2I8CA 1UNNC 5JQWA 5J2UF 4X66H 2SNSA 4DR2H 4RNNA 3K7AB 2B63B 3MFGA 2A5HA 4IWXA 3STBD 1IBLH 3U4ZA 1I4HA 4L63B 1EQQA 1LT5D 3MR5A 1N56A 3HKZB 1STEA 4F8MA 2JA8G 3QR8A 3D3RA 1SMYC 1O7IA 3HOXG 1BJTA 2VQFL 4C3HG 4A3BB 1WTOA 2FJ2A 1Q90A 3CCSA 1RJPA 4KHPH 3I91A 2NUCA 1LTRD 3J80i 3EPGA 2O2LD 4A3MG 1KNEA 5KFLA 1LABA 3HBLA 4F4ZA 2O5IC 5A2QW 1O75A 5KG0A 3X3NA 1RK5A 1GLVA 1KAWA 2LXJA 4QB4A 2YZMA 2UUAQ 1E1OA 1HQMC 2LXKA 2ZXPA 1QZGA 5FO8B 4L5QA 2EY2A 3P20A 1ASYA 2E2JH 4WRDA 2IP4A 5F9LA 1WD0A 3CF5A 4S3SA 3VYSA 3F2UA 4N9PA 4KI0A 1SNOA 2JA9A 4U7CA 4JI7H 3OHXC 2NTTA 1VDZA 2RDFA 3OIQA 1NNXA 1EUDB 4DV1L 4QWAA 3GTMA 3OIPA 1YHBA 1XMOH 1AH9A 1TS5A 4UAIA 1AN7A 5FLXE 4B3MH 1EIFA 4POGA 3M7NA 4RNOA 5KYIA 2TSSA 4ME3A 4YWLA 2WAQB 3K5IA 1X3PA 1N32L 3J7A5 2A68D 4L6TB 3S15B 1PFBA 3X3MA 4IZOA 2OQKA 3NHHA 1L1OA 1PA6A 2JYOA 2UXDH 1KDCA 5KFYA 2D5DA 2K32A 4RGTA 1EZ8A 5IP7G 3S16H 2JEBI 3TZUA 3RBEA 1ZYRD 3HP3A 1JOKA 2AQ1B 3S17H 4K0KH 1QE6A 3QG1A 1R9TH 1LTBD 1TKWB 4FXDA 4Q44A 2VR1A 5IGBA 3OHAA 1QZHA 5KG6A 4A93H 1AN8A 2Q8RE 4GN5A 4PZ6A 4IOAA 4EGQA 4DV1Q 1TWCB 2HD3A 4A3KG 1EUJA 2A6HD 2F0HA 1TS3A 3HEJA 4PMBA 1BUVT 2EOTA 4HNVA 1RJQA 4LF6L 3D0FA 5EKIA 1T3NA 3UQ8A 5I9OA 4LF7Q 4PZ8A 3Q2OA 4FF1A 3MFYA 1MZBA 4B9XA 4DUYL 2EXDA 4X3TA 2RCNA 3H0GA 5IP9G 3D6CA 4EQ5A 5IWAL 3G4SA 3G8CA 4AQYH 2HVQA 3S1NB 1ENAA 2JQOA 4IJLA 1B6RA 1PH7A 2KQ3A 3A0JA 4RCOA 1GUSA 4DA2A 4DF7A 5KFUA 3S1MH 3URYA 1LYLA 3MVVA 4LF6Q 2ASBA 1A62A 2RCFA 2FPIB 4MHEA 3HOYG 4BS9A 4IFDJ 2WINB 4LUZA 5BMVF 4L5SA 4O1NA 5M3MB 4DR4Q 4OX9Q 2K04A 2NVYH 3BS1A 2YZGA 1KJJA 5BN3A 1D1KA 4A3DH 3ND9A 2R92H 4IR1A 2YV5A 3SE7A 2KECA 2E8GA 2WB1E 4A3JH 4RCNA 4UP8A 3CP0A 3K3VA 2VUGA 5K36G 2FINB 2B63A 1V1OA 3MFIA 1ILPA 3MWDA 4FBTA 2BE5C 4RB3C 5KFKA 1F2MA 2QCPX 2F0WA 1RF2D 1CM9A 1CTMA 3MA2B 2H4OA 3HKZA 3F2CA 4P2CB 2VB2X 2ENBA 5HURA 2WYOA 1G6ZA 2JEGA 3DEPA 3HKSA 1S4ZA 3UI2A 1MJEA 4LFCH 2XGPA 3KLSX 5ELBA 5KT7A 1LTID 4UHVA 4XQQA 1JICA 2FPPB 1D6EC 1NJIC 5DG7A 1FVIA 2AWNA 2EQSA 3L9AX 3Q1KA 2PZUA 2IX0A 5IGGA 5BN4A 5C4JH 1JDEA 1GYFA 3R23A 3WOFA 2UXBL 1HCZA 1WH2A 3GTJA 4KKTA 4YJ2F 5HV6A 3EJIA 3WNZA 4TQRA 4ETSA 2R93H 1GSOA 1BBWA 1NR2A 3CHBD 3KF8B 4Q43A 1FJGQ 2Y0SB 1ZXTA 4XIGS 3F2BA 5M5WB 3OW7A 4YWMA 3TDQA 4ZUIA 1SE3A 4IPDA 3BA9A 1F2ZA 5HGQA 4JV2A 3SGIA 1JT8A 1C30A 4IZ8A 1JJGA 4R1JA 2N88A 1YNNC 3I4OA 4GS3A 4RAYA 4GKKQ 1AUXA 5EBCA 2F52A 1STAA 1KJQA 2PW5A 2PN1A 2UXCQ 4J9QA 4JOIC 3TREA 4XYOA 1Y8PB 2MFIA 2UXBQ 4X66L 2JA5B 5I6WA 4A3CG 3C1FA 2BH2A 1XWEA 3JAML 1YEZA 1EL0A 4R4QA 2D9UA 4MTDA 1XMQH 3PSIA 4Q8EA 3HFZB 4HIKA 4O3OA 1TA8A 1GHJA 4KY5A 2K5VA 3BG5A 1JIHA 2DJGC 2QKIC 3BZCA 2VUMH 1TWCA 3TP8A 2WAQE 1A3VA 2C9OA 1E4GT 3NP8A 2RGVA 1G2SA 4UCUA 2A1AA 1SDFA 1SNQA 3OUUA 1SSOA 4GOPC 4J9RA 3HOZB 1YJ9A 4X65H 4X3SA 5DQGA 3ULPA 1C0AA 5FLMG 1N48A 4HMIA 3W5OA 5D65A 3GTKB 1JJCB 2IT1A 2FMMA 4NB3A 1K9MC 2R7ZB 4BWGB 4X3KA 4A3IG 1GUOA 2VXWA 2F0FA 2K05A 4JBJA 4M9UA 3HZXA 4ZAIA 1KNAA 4ECSA 3SK6A 2OH2A 2OQ0A 1EYAA 1SBBB 4RHRA 2NVQB 3J81i 2WP8J 3E6ZX 3NBIA 3HOVH 3H0GH 3GDEA 2XRQD 1MSGA 1M90C 1DV2A 3J7AK 4LJZC 1XMOL 4O2BF 4B3ML 2FK3A 2UVVA 5C4XB 1U9RA 4QUFA 4QIWB 4DGZA 3GIJA 2RHQB 1XJVA 4OONA 2XCAA 1HNZL 3M85A 1QOHA 3A7AB 2H5XA 2NVXH 2J6SA 3Q8PB 3TQ1A 2C22A 1SYFA 2KHSA 2UXDL 1I94H 3QWNA 4IURA 3FKIA 5CA0F 5KFZA 1SR3A 1PFSA 1I3QH 2KBNA 4EFEA 5EAYA 4K0KL 5KNCA 1WSCA 2R7KA 1TR5A 3KF6B 4IJHA 1HR0Q 5JJLA 1GHKA 4JI8H 1LTGD 4WBNF 2ZDHA 3RAQA 1CHQD 4NXML 2PW7A 5LMUH 5GAEC 3E5SA 3DWPA 1YHQA 1X55A 1RHPA 3I4MG 3FP9A 3K7AH 1GVPA 2JA7B 1HZ9A 1SNPA 4C1NK 2E2DC 4CKEA 3G6XA 3VYUA 3Q8SB 1AW7A 4GC6A 3T1HH 4DR5L 1X54A 1STHA 2UVWA 3HOWG 3NXWA 3TIIA 5C44B 3N8DA 4JUZA 1EY5A 3OW2A 4WORA 5JVG3 4K8IA 4A3BH 5DLFA 4HJ8A 2BA0A 5DGAA 5E3FA 2ASDA 1RIPA 2F0TA 5GAHC 3K6OA 1XPUA 2AGQA 1JOQA 5J2TF 2IL8A 1EFWA 4C2MB 1Y1WH 1WCMH 2AMCB 3KF8A 4B08A 3S1QB 5DG8A 4DKAC 1MHWC 1WTVA 4BY1B 4RAUC 3NQIA 4FVMA 2EE1A 2HHHL 1ZHSA 4EBEA 1KL9A 2C5CA 4U68A 3BVGA 1D5MC 4DR5Q 5JUMA 2E2HA 3J80c 2RDJA 3NELA 4KJNA 3CMEA 3ORQA 1PTOB 1IKLA 4HSPA 4PWQA 2W6MA 1Q8IA 2JE6I 2W6QA 5J3BA 3IL8A 4BXXH 2XWBB 2X0SA 1H9KA 2B2WC 2JA5A 1TS4A 2RHSB 2Y0SE 3VPDA 1L0YB 3AFPA 4J1MA 4XYLB 5KRUA 5KFXA 3S15H 3PIP3 4R7RA 1BBUA 4HIMA 4TVAB 3GQBA 1TXYA 2GVAA 3J80W 2OT2A 1JX4A 1CKNA 1HZCA 1DM0B 3L2PA 4KD3A 2HHHQ 4O3SA 4ED2A 2RDGA 1R4PB 4RB0A 2XVSA 2R93A 4MTKA 2R7NA 1PTOD 1BOSA 3H4DA 2ZM6L 4BY7B 3G71A 1LLRD 1Y1VH 2QDLA 1KDAA 1XTCD 1H9SA 5M3FH 1ONLA 1RK6A 3GV8B 4JI2L 3J7ZC 2YU9B 3SVMA 5DG9A 4G7HC 1TWCH 2RDIA 3BA8A 3IFDA 4R4IA 1QUQB 3UDGA 3C3LA 4A2BA 4YBZB 4OGQC 2AGPA 5I4DA 4DL7A 2E2JB 1EY6A 3NQTA 3SK5A 5C0XG 4YY3L 4ZHQF 2C28A 3RZDH 1YNND 4BBRG 1KTKA 1UE6A 4PDBA 5FLXL 4WFN3 2B63G 1L1OC 5C8YF 3C0FB 2I87A 4P74A 2UU9L 4MN3A 2F03A 3GTLA 2KCMA 1E4EB 3W1BA 1KLUD 2KVMA 2K5NA 2OF1A 1DJRD 3S1NH 4L5RC 1TAEA 2NZ1D 4QF4A 1GUTA 1BCPB 1S10A 4I7ZC 3S16B 5CV8A 2W7OA 4ECZA 1H95A 2PNRC 3HRZC 1JWMD 4XX0B 4YY3Q 4H44C 1PYBA 4EVOA 5M3MH 2RBMA 5LOVF 1LV9A 1WJJA 3KF6A 4JBKA 4CC6A 1XMQL 1QVGA 1CZWA 2IPKD 4MTEA 5HY6A 1E3PA 1GUNA 4APMA 5FJ8H 3H15A 3GTOB 1SN8A 4A76A 1G2TA 5CV4A 1IHZA 4QIWE 2K01A 1YIJA 4KN4C 1BCPD 1T36A 5IYCH 2LS01 2UUAH 4DNTB 1SE2A 1C3OA 5CV9A 1PH5A 3L7ZC 1M4VA 4TRDA 2JA6H 5C5JA 4DR1L 2W8KA 3WOEA 3T53B 1VQCA 1PH2A 5IT9E 1H9MA 4DK0A 5KFAA 2D0OA 2I5MX 1SE4A 3STBC 1GD7A 3PUVA 4UY8C 4Q8FA 2W9CA 1K83B 4DV4L 2A6ED 4YCUA 4C3IH 4HJAA 3TRZA 1ILQA 5C0XJ 2YRWA 3S1MB 5LA6F 2PZWA 1V8QA 3M7GA 3F1ZA 3KBGA 4DL4A 5ISRA 3MAQA 2JEAI 3WO1A 3MR2A 2W8LA 3KXYT 4QL5A 4H02A 4J0MA 1JR0D 4K6DA 1LTLA 3MHBA 3K59A 3GTQB 1U4PA 5LL6S 4YB8B 1Z2NX 4DV1H 5IYDG 1SYEA 4R4CA 3CC4A 2ZJTA 3VR3A 1JE4A 3RAXA 4DV4Q 1Q46A 2AQ3B 5EWFA 3V4ZA 3T4AC 1N32H 3Q8DA 5ELFA 2HVSA 2UVUA 1PH1A 4K5WA 4YR3A 4RGNA 1M1KC 1PMRA 3TP6A 4LF7H 3G7LA 1SEIA 3MWMA 1V9PA 3H09A 3R5FA 4OO1I 4R8NA 4IUUA 1EQTA 5CORA 1HFNA 3R2IA 5JEAJ 2VA3A 4L1KA 2XSCA 2ZDQA 2RGRA 2W6ZA 2A68C 1SXTA 1L0XB 3MJFA 2N8NA 3MR6A 2HDMA 2UVRA 4ZQ3A 2NZHA 2OLSA 2ALYB 2XGTA 1S72A 2BQRA 4BA2I 2M9VA 4JOIA 3IAYA 1IW7D 1MD2D 3ICEA 3JAME 5JJZA 1ZYRC 2BCOA 5KFMA 3BJUA 3PQIA 3BABA 4DL5A 2OCEA 4ZLTF 2BDNA 2PQAB 5KFVA 2K14A 4LF6H 3PZPA 4QCLA 3S24A 4UP7A 5KT5A 4LMYA 3HOZH 4PMCA 3PIO3 2ZJPA 4UCOA 3A7LA 3FKIG 3R3OA 2R93B 4FM9A 1YNXA 4DR4H 2OXPA 1EZ6A 3GTKH 2FMAA 4MA5A 2Q2HA 4ZQIA 1EWCA 3SK8A 2R7ZH 2PQEA 3BDLA 3NGDA 3FHWA 4GOPA 5IWAH 5FLXW 1EFID 1SAPA 2KENA 3P1HA 5EWEA 4NKLA 1QNKA 2MGSA 2P0AA 3H6MA 1X32A 4B3SL 2NVQH 2XNAC 3NEMA 4YWKA 1EIYB 1Z2OX 2DIKA 4M7EA 3EA6A 1EYZA 2BA1A 1KJ9A 3H91A 5F9NA 3G6VA 1FGBD 1R9TA 4FBUA 4KTAA 2PMZE 5T14A 5IE8A 3O13A 5KT3A 5M5YB 4YJ3F 4EGJA 2Z4HA 3GTOA 1BDOA 3J81c 3K5LA 3S1RB 4LF4Q 1GKHA 1HA6A 1CSPA 3TEHB 3A54A 3BQ0A 2O03A 2G9DA 2ALZA 1UC9A 4U6PA 4IALA 4B3SQ 4C5AA 4DV0Q 4CGYB 4FO2A 3NTIA 2F3VA 4HIOA 3FMCA 1FJGH 1EY7A 3GIKA 1YVCA 1IOWA 3I4NB 4FS1A 2F0KA 2JA7H 3CCMA 2JJQA 3J7YW 3ETHA 3ZJYC 1ML0D 2W71A 1EOTA 2DY7A 3RNUA 4DK6C 4H13C 4QUCA 1II3A 4ECUA 2JA5G 5C3EG 2K7VA 3A8KE 2UXCH 1EZ1A 5C44H 1WI5A 4ED1A 4JI4L 3Q22A
chains in the Genus database with same CATH topology
1A62A 2R6GA 1IYJB 4DV7L 4HJ7A 3HOYG 3GTGH 4P73A 4FDBA 4IFDJ 4LUZA 4L5SA 3L0OA 4DR4Q 3OTOL 4P75A 3UE1A 4C2MH 2NVYH 1VQKA 4OX9Q 3S1QH 4A3DH 4JI7Q 2R92H 5JJIA 1Y1VG 5M3FG 3T1YQ 2YV5A 4BY1H 1IXRA 2E8GA 1NY4A 2WB1E 3PUWA 3KLWA 4A3JH 1XMOQ 4JI0L 4JI6L 1PH8A 4B3MQ 1VQMA 4BBRH 4UP8A 3CP0A 2CWPA 3PO2H 5K36G 2B63H 2CKZB 1HNZQ 3CPWA 2K52A 3BZKA 4IPHA 1XPOA 2QA4A 3KDFB 4NXNL 4JI4Q 4HJ5A 2UXDQ 1J6QA 4GN3B 4DV6L 1BKBA 4DV7Q 4GNXC 3F2CA 1JJ2A 2KCTA 1N9WA 4IPCA 5BR8L 4K0KQ 4TQUS 4LNQA 4MZ9A 1AE3A 3HKSA 2UUAL 3I4NG 3A74A 1MJEA 2ATWA 3GTPH 5LMNL 3J81j 2L15A 4AQYL 4NXMQ 1W2BA 4JI6Q 1DGSA 4GNXB 5C4XG 4JI0Q 1NJIC 2CQOA 1FVIA 2AWNA 2EQSA 1X9NA 2IX0A 4B3TL 1SMXA 2K50A 1X3FA 3CCQA 5C4JH 2PQAA 4DK3C 3U50C 2A19A 4BY7H 2AHOB 2UXBL 1Y14B 3JAMi 4AH6A 3GTJH 4NXNQ 1X65A 1E22A 4A75A 2R93H 3AYHB 1PH9A 2YU9H 1BBWA 1BVSA 3GO5A 3KF8B 5M3MG 5FLXc 1FJGQ 1KHIA 4XIGS 3NBHB 1CKOA 5BR8Q 4Y7NH 4JI5L 3F2BA 1QUQA 4YWMA 4IPDA 2R7DA 5HGQA 3SGIA 5FJ8G 1JT8A 1OXVA 2KHJA 1EQRA 1JJGA 4R1JA 5LMNQ 2AKWB 3CQZH 2K75A 3CCVA 3KJPA 4AQYQ 1N36Q 3I4OA 4GS3A 3I56A 1JE5A 4GKKQ 4UPAA 2HIVA 2F52A 1NBWA 3HOUG 3RR5A 5IYCG 4JBWA 2NZOA 4JYAQ 1OXTA 2YYZA 1TWHH 1K73C 4JOIC 5DLQE 3TREA 4B3TQ 2JA6G 2UXCQ 2MFIA 3PCOB 2UXBQ 4X66L 2F4VQ 2ZTDA 4LF4L 3M4QA 5GADC 4A3CG 2BH2A 4KHZA 2VS1A 1YEZA 3PIPA 4R4QA 1L0WA 3EN2A 3PSIA 4JI8Q 3HFZB 3K8AA 3KYHC 4HIKA 4LFCL 4JI5Q 3KFUA 1UEBA 1Q1BA 2K5VA 4JI1L 4DV0L 4LF7L 1FGUA 2B29A 5LMUQ 1HZAA 2QGQA 3BZCA 1YJWA 2VUMH 2WAQE 4A3LG 3PO3H 1I5FA 3A5UA 2A1AA 2AWOA 3F2DA 4GOPC 1VQGA 4C3JH 4DV5L 3CCEA 3U58A 3PGZA 1YJ9A 3ULPA 1YHAA 1C0AA 1UE1A 4LF5L 2ID0A 5IYDH 1EOVA 4LWCA 3T1HQ 2ES2A 5FLMG 3GTOH 4DR6L 4QY7A 3W5OA 2IX1A 1A8VA 1JJCB 2IT1A 2LSSA 4IO9A 4NB3A 1K9MC 3PF4A 4OXPA 5IYBG 1VCIA 2Y0SG 1PYSB 1CUKA 4A3IG 2ZM6Q 4IFDI 4GOPB 4JBJA 4AYBE 2I5LX 1H95A 4JI2Q 4JI1Q 3AFQA 3KOJA 4DR4L 5C0XI 2JA8H 4PMWA 1IZ6A 3UE0A 2OQ0A 4OX9L 3HOXH 1PHJA 4C3HH 3J81i 2WP8J 3HOVH 5ELNA 3H0GH 3MEFA 1RL2A 3GDEA 3T1YL 3CXCA 4DV5Q 1M90C 4A3MH 1XMOL 4B3ML 3D31A 4LF5Q 1K83H 2RHQB 4A3FG 4DR6Q 1SLJA 1XJVA 1SFOH 4OONA 1KXLA 1VQ5A 1HNZL 3M85A 3E0EA 4JBMA 1VQNA 2H5XA 2NVXH 3RLOA 2C35B 5GQOA 1V1QA 4DAMA 4BBSG 3KJOA 2UU9Q 5JEAG 2UXDL 2UUCL 3PUXA 3FKIH 1A63A 1MKHA 1SR3A 1PFSA 1I3QH 2KBNA 5EAYA 4K0KL 1VQIA 3KF6B 2F3IA 4IJHA 1HR0Q 1YZ6A 5JJLA 1ASZA 4A3GG 4GLAC 4X65L 1Q7YC 3GTQH 3ERSX 4NXML 3HOZG 3KDFA 4LUVA 5GAEC 2ZTEA 1VQ6A 3M4PA 3PUZA 3RN5A 2GN5A 3CPFA 4AYBG 1WYDA 1X55A 2QEXA 3G48A 1YHQA 3I4MG 4QGUA 3FP9A 3K7AH 1GVPA 2DGYA 1X3EA 3K7UC 4YCVA 1CKMA 3B6YA 1HZ9A 4B3RL 3UDXA 1XMQQ 1JB7A 2R7ZG 1P16A 1L2FA 1Z9FA 5IP7H 1GO3E 2UUCQ 4DR5L 1X54A 4JI3Q 2IY5B 1OXUA 1X6OA 4EX5A 3HOWG 1SROA 4P72A 1FJGL 4LF9L 4YHHQ 1CSQA 5AJ3L 2RF4A 3CAMA 4MTNA 3ULJA 3OW2A 1UE7A 1FL0A 1K0RA 4HJ9A 2KHIA 2BA0A 4HJ8A 4A3BH 3CCLA 3ULLA 2NVTH 4GN4B 4DR1Q 1MJCA 4X65Q 1N36L 2MO1A 1RIPA 5GAHC 4RG1A 1XPUA 4KLKA 1N34L 1VQBA 4A3KH 1EFWA 4GKKL 2OWOA 1Y1WH 1WCMH 2AMCB 3CW2C 1KD1C 4DKAC 2MO0A 2UXCL 4A93G 5M5WH 2MQHA 3K80C 1VQEA 1E24A 1I94L 4B3RQ 2FXQA 2HHHL 2F4VL 1KL9A 4PZ7A 4DR5Q 1C7YA 2E2HH 1IBML 3K0XA 3S14H 3J80c 3BU2A 3NELA 3CMEA 1HNWQ 4JI8L 1SRUA 4JC0A 4LF9Q 5IP9H 5AJ3Q 1NTGA 1EWIA 2JE6I 5LMUL 1VQLA 1VQ7A 1KRSA 5J3BA 4A4IA 2UUBQ 4JV5L 4WJ3M 5GROA 4POFA 2VW9A 4BXXH 1NE3A 2JA5H 1LM0A 2RHSB 5C3EH 3DLLA 2Y0SE 1N34Q 1D8LA 3JC66 2K5HA 4J15A 4OWTB 3AFPA 3WWVA 4DR3Q 1D7QA 1XPRA 2Z6KA 2JA7G 1VQ9A 3GD7A 3PF5A 3S15H 2YTXA 1BBUA 3CCRA 4TVAB 4HIMA 1C9OA 3HOYH 1TXYA 3T1HL 2GVAA 1I94Q 2Z0SA 1CKNA 1HZCA 4DAYB 3UDIA 3L2PA 2E2IH 2HHHQ 2HT1A 3AEVA 1G6PA 3LGJA 3H3VH 5ELOA 1IBMQ 4A3EG 1V43A 1VQOA 5C44G 2ZM6L 4OWWB 3G71A 1Y1VH 5M3FH 4IOCA 2VQEL 4X6AH 4JI2L 1IBKL 3J7ZC 5M5YH 3M3YH 3EBEA 1TWCH 4JV5Q 1TWFH 2XTIA 4P71A 1UWVA 4R4IA 3OYYA 3S1RH 1QUQB 2IHEA 1K8GA 3UDGA 4IFDG 1N33L 5JJKA 2VQFQ 4A3DG 3PIOA 2VZAA 1VQJA 3A5ZB 2R92G 2ZJQA 3I7FA 4BY1G 4DR7L 3CCJA 1YITA 5C0XG 1S3OA 4YY3L 4A3JG 2DUDA 2V1CC 3E9HA 1QVCA 3RZDH 4AIMA 1Q81C 4BBRG 1PH3A 3PO2G 1UE6A 2CWAA 5IY0A 1Q12A 3AQQA 1L1OC 2B63G 1VQFA 3ER0A 2I5HA 4P74A 3K81C 2UU9L 3I4NH 2KCMA 3GTLH 3W1BA 1Q86C 2VQEQ 1IBKQ 2K5NA 5C4XH 1NMGA 4APVA 3S1NH 1VQAA 1X56A 4L5RC 1N8RC 1HR0L 4O0AA 1L1OB 3EIVA 1N33Q 3VDYA 4RMFA 3S2DH 2NN6G 2YTYA 4O2DA 1VQPA 2K4KA 4XTCS 1MIUA 1K8AC 1NMFA 1JMCA 4DR7Q 1E7ZA 2N49A 4R4OA 4YY3Q 1XNQQ 1PYBA 1Z47A 4X62L 5M3MH 2OTLA 4LUOA 1WJJA 2D0PA 2D62A 3KF6A 3RN2A 4JBKA 1N32Q 1XMQL 1LUZA 1QVGA 3I2ZA 5HY6A 1E3PA 5H1SE 4BY7G 4JI3L 5FJ8H 3H15A 1B8AA 1SN8A 4A76A 3TS0A 4LFAL 1E1TA 4QIWE 2MNAA 1YIJA 2NN6I 2R93G 1K3RA 4YHHL 3HOUH 1I50H 5IYCH 2PNHA 4JG2A 3L7ZC 1PH5A 1QVFA 2JA6H 4DR1L 1G51A 4R4TA 4LFBQ 1VQCA 1PH2A 1VQ4A 1B7YB 1XTDA 4A3CH 2PI2E 1WOCA 1U5KA 2BH8A 2IHFA 3U4VA 2D0OA 3UDFA 4X62Q 3G6EA 2I5MX 1PV4A 3STBC 1J5EL 1GD7A 1TWGH 3PUVA 2CCZA 4UY8C 4GLVB 4ALPA 2Q2IA 4GLXA 4DV4L 1G291 1PH6A 1VQDA 4LFAQ 1OXSC 1X3GA 4YCUA 4C3IH 4HJAA 1HZBA 4GNXA 1TWAH 3TRZA 3PUYA 4A3LH 1HNWL 5C0XJ 4DV2L 2YTVA 3W1GA 5LMNW 4DUYQ 1VQ8A 3F1ZA 4QQBX 3IRBA 3RLNA 2UUBL 5IWAQ 1Q1EA 2I0QA 1HJPA 2JEAI 4GKJQ 5FLMH 2VUMG 5GAGC 4QL5A 4PG3A 4H02A 5E7NA 4DR3L 1OTCA 3PO3G 1KC8C 3M9BA 5IYBH 1LTLA 3H3VI 3CCUA 2JK8A 4A3IH 1W3SA 1J5EQ 4OO1G 4DUZL 5IYDG 3CC7A 1PVOA 4R4CA 1HH2P 3CC4A 2VY3A 1U0LA 1IL2A 4DV3L 4DV4Q 1Q82C 1Q46A 1VQHA 3OTOQ 1OXXK 3JAMc 3I55A 3Q8DA 2E5LL 4MNOA 3STBD 1PH1A 1EYGA 1HNXL 4DV2Q 3U4ZA 1EQQA 1UE5A 1M1KC 5M5XH 2HIXA 4L5TA 1V9PA 1B70B 4OO1I 4A3FH 2JA8G 2N78A 1O7IA 5JEAJ 3HOXG 2VQFL 4LW1A 1VS0A 3CCSA 1XNRL 3HOVG 2N8NA 4BBSH 3H0GG 2NZHA 3CMAA 2ALYB 2XGTA 3HKZE 1S72A 3J80i 1KQSA 4A3MG 4BA2I 4JOIA 4DUZQ 2B3GA 3ICEA 4DV6Q 3RZOH 2WB1G 4LF8L 4DV3Q 3BJUA 3TS2A 2A8VA 4WJ4A 2OCEA 2PQAB 1KAWA 2K14A 2LXJA 2E5LQ 3S24A 2UUAQ 1E1OA 4A3GH 2LXKA 2EIFA 4UP7A 1P8LA 1QZGA 2HQLA 4L5QA 1HNXQ 1ASYA 2ZJPA 2E2JH 3HOZH 3CC2A 3FKIG 1YNXA 3CF5A 2Z6KC 3I4MH 4YCWA 3GTKH 2Q2HA 4KI0A 4DPGA 2JA9A 4OWXB 2R7ZH 2ZJRA 1XNRQ 3DM3A 4NPSA 4DV1L 3GTMH 1AE2A 3FHWA 1YHBA 4GOPA 4JYAL 1I6HH 1AH9A 1SE8A 2GVBA 4DR2L 1XNQL 2KENA 1EIFA 4POGA 3M7NA 3HOWH 4ME3A 4YWLA 3TQYA 4IPGA 2R7FA 4UP9A 1YJNA 4LF8Q 1N32L 3J7A5 1IBLL 2OQKA 1L1OA 1PA6A 4B3SL 2NVQH 3NEMA 4YWKA 1EIYB 4Y52H 1CKNB 4X64L 5IP7G 2BA1A 2N3SA 3NENA 3S16H 2JEBI 1HR0W 3HKZG 1T9HA 3S17H 2Q2TA 1R9TH 1YBYA 2PMZE 3CD6A 5IE8A 4KHPL 1QZHA 3MXNB 4A93H 4GN5A 4PZ6A 4A3BG 4IOAA 4LFBL 1S40A 4DV1Q 3J81c 4X66Q 4A3KG 4DR2Q 4LF4Q 1EUJA 1GKHA 2WFWA 1CSPA 3TEHB 1WCMG 1Y1WG 3S2HH 2ZTCA 5IT9c 2PI2A 4BA1I 4LF6L 3D0FA 1IBLQ 3M4OH 4JCVE 4LFCQ 4DNIA 4B3SQ 2Q2UA 1Q8KA 1YI2A 4DV0Q 4LF7Q 3RLFA 4X64Q 4HIOA 4PZ8A 1KRTA 3PV0A 1YVCA 3E9IA 2VL6A 4DUYL 2EXDA 4JI7L 2JA7H 2RCNA 3CCMA 5IP9G 1GM5A 2JJQA 4KHPQ 3ZJYC 2VNUD 4EQ5A 5IWAL 3G4SA 3RNUA 4GKJL 4DK6C 1PH4A 1WFQA 2JQOA 3F8TA 4BXXG 1KIXA 1A0IA 2JA5G 4HIDA 5C3EG 4IJLA 4QJFA 2OTJA 4A3EH 1PH7A 3A0JA 2WAQG 5C44H 1WI5A 3S1MH 4JI4L 2CFMA 1LYLA 4LF6Q 2ASBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A62 A;  2R6G A;  1IYJ B;  4DV7 L;  4HJ7 A;  3HOY G;  3GTG H;  4P73 A;  4FDB A;  4IFD J;  4LUZ A;  4L5S A;  3L0O A;  4DR4 Q;  3OTO L;  4P75 A;  3UE1 A;  4C2M H;  2NVY H;  1VQK A;  4OX9 Q;  3S1Q H;  4A3D H;  4JI7 Q;  2R92 H;  5JJI A;  1Y1V G;  5M3F G;  3T1Y Q;  2YV5 A;  4BY1 H;  1IXR A;  2E8G A;  1NY4 A;  2WB1 E;  3PUW A;  3KLW A;  4A3J H;  1XMO Q;  4JI0 L;  4JI6 L;  1PH8 A;  4B3M Q;  1VQM A;  4BBR H;  4UP8 A;  3CP0 A;  2CWP A;  3PO2 H;  5K36 G;  2B63 H;  2CKZ B;  1HNZ Q;  3CPW A;  2K52 A;  3BZK A;  4IPH A;  1XPO A;  2QA4 A;  3KDF B;  4NXN L;  4JI4 Q;  4HJ5 A;  2UXD Q;  1J6Q A;  4GN3 B;  4DV6 L;  1BKB A;  4DV7 Q;  4GNX C;  3F2C A;  1JJ2 A;  2KCT A;  1N9W A;  4IPC A;  5BR8 L;  4K0K Q;  4TQU S;  4LNQ A;  4MZ9 A;  1AE3 A;  3HKS A;  2UUA L;  3I4N G;  3A74 A;  1MJE A;  2ATW A;  3GTP H;  5LMN L;  3J81 j;  2L15 A;  4AQY L;  4NXM Q;  1W2B A;  4JI6 Q;  1DGS A;  4GNX B;  5C4X G;  4JI0 Q;  1NJI C;  2CQO A;  1FVI A;  2AWN A;  2EQS A;  1X9N A;  2IX0 A;  4B3T L;  1SMX A;  2K50 A;  1X3F A;  3CCQ A;  5C4J H;  2PQA A;  4DK3 C;  3U50 C;  2A19 A;  4BY7 H;  2AHO B;  2UXB L;  1Y14 B;  3JAM i;  4AH6 A;  3GTJ H;  4NXN Q;  1X65 A;  1E22 A;  4A75 A;  2R93 H;  3AYH B;  1PH9 A;  2YU9 H;  1BBW A;  1BVS A;  3GO5 A;  3KF8 B;  5M3M G;  5FLX c;  1FJG Q;  1KHI A;  4XIG S;  3NBH B;  1CKO A;  5BR8 Q;  4Y7N H;  4JI5 L;  3F2B A;  1QUQ A;  4YWM A;  4IPD A;  2R7D A;  5HGQ A;  3SGI A;  5FJ8 G;  1JT8 A;  1OXV A;  2KHJ A;  1EQR A;  1JJG A;  4R1J A;  5LMN Q;  2AKW B;  3CQZ H;  2K75 A;  3CCV A;  3KJP A;  4AQY Q;  1N36 Q;  3I4O A;  4GS3 A;  3I56 A;  1JE5 A;  4GKK Q;  4UPA A;  2HIV A;  2F52 A;  1NBW A;  3HOU G;  3RR5 A;  5IYC G;  4JBW A;  2NZO A;  4JYA Q;  1OXT A;  2YYZ A;  1TWH H;  1K73 C;  4JOI C;  5DLQ E;  3TRE A;  4B3T Q;  2JA6 G;  2UXC Q;  2MFI A;  3PCO B;  2UXB Q;  4X66 L;  2F4V Q;  2ZTD A;  4LF4 L;  3M4Q A;  5GAD C;  4A3C G;  2BH2 A;  4KHZ A;  2VS1 A;  1YEZ A;  3PIP A;  4R4Q A;  1L0W A;  3EN2 A;  3PSI A;  4JI8 Q;  3HFZ B;  3K8A A;  3KYH C;  4HIK A;  4LFC L;  4JI5 Q;  3KFU A;  1UEB A;  1Q1B A;  2K5V A;  4JI1 L;  4DV0 L;  4LF7 L;  1FGU A;  2B29 A;  5LMU Q;  1HZA A;  2QGQ A;  3BZC A;  1YJW A;  2VUM H;  2WAQ E;  4A3L G;  3PO3 H;  1I5F A;  3A5U A;  2A1A A;  2AWO A;  3F2D A;  4GOP C;  1VQG A;  4C3J H;  4DV5 L;  3CCE A;  3U58 A;  3PGZ A;  1YJ9 A;  3ULP A;  1YHA A;  1C0A A;  1UE1 A;  4LF5 L;  2ID0 A;  5IYD H;  1EOV A;  4LWC A;  3T1H Q;  2ES2 A;  5FLM G;  3GTO H;  4DR6 L;  4QY7 A;  3W5O A;  2IX1 A;  1A8V A;  1JJC B;  2IT1 A;  2LSS A;  4IO9 A;  4NB3 A;  1K9M C;  3PF4 A;  4OXP A;  5IYB G;  1VCI A;  2Y0S G;  1PYS B;  1CUK A;  4A3I G;  2ZM6 Q;  4IFD I;  4GOP B;  4JBJ A;  4AYB E;  2I5L X;  1H95 A;  4JI2 Q;  4JI1 Q;  3AFQ A;  3KOJ A;  4DR4 L;  5C0X I;  2JA8 H;  4PMW A;  1IZ6 A;  3UE0 A;  2OQ0 A;  4OX9 L;  3HOX H;  1PHJ A;  4C3H H;  3J81 i;  2WP8 J;  3HOV H;  5ELN A;  3H0G H;  3MEF A;  1RL2 A;  3GDE A;  3T1Y L;  3CXC A;  4DV5 Q;  1M90 C;  4A3M H;  1XMO L;  4B3M L;  3D31 A;  4LF5 Q;  1K83 H;  2RHQ B;  4A3F G;  4DR6 Q;  1SLJ A;  1XJV A;  1SFO H;  4OON A;  1KXL A;  1VQ5 A;  1HNZ L;  3M85 A;  3E0E A;  4JBM A;  1VQN A;  2H5X A;  2NVX H;  3RLO A;  2C35 B;  5GQO A;  1V1Q A;  4DAM A;  4BBS G;  3KJO A;  2UU9 Q;  5JEA G;  2UXD L;  2UUC L;  3PUX A;  3FKI H;  1A63 A;  1MKH A;  1SR3 A;  1PFS A;  1I3Q H;  2KBN A;  5EAY A;  4K0K L;  1VQI A;  3KF6 B;  2F3I A;  4IJH A;  1HR0 Q;  1YZ6 A;  5JJL A;  1ASZ A;  4A3G G;  4GLA C;  4X65 L;  1Q7Y C;  3GTQ H;  3ERS X;  4NXM L;  3HOZ G;  3KDF A;  4LUV A;  5GAE C;  2ZTE A;  1VQ6 A;  3M4P A;  3PUZ A;  3RN5 A;  2GN5 A;  3CPF A;  4AYB G;  1WYD A;  1X55 A;  2QEX A;  3G48 A;  1YHQ A;  3I4M G;  4QGU A;  3FP9 A;  3K7A H;  1GVP A;  2DGY A;  1X3E A;  3K7U C;  4YCV A;  1CKM A;  3B6Y A;  1HZ9 A;  4B3R L;  3UDX A;  1XMQ Q;  1JB7 A;  2R7Z G;  1P16 A;  1L2F A;  1Z9F A;  5IP7 H;  1GO3 E;  2UUC Q;  4DR5 L;  1X54 A;  4JI3 Q;  2IY5 B;  1OXU A;  1X6O A;  4EX5 A;  3HOW G;  1SRO A;  4P72 A;  1FJG L;  4LF9 L;  4YHH Q;  1CSQ A;  5AJ3 L;  2RF4 A;  3CAM A;  4MTN A;  3ULJ A;  3OW2 A;  1UE7 A;  1FL0 A;  1K0R A;  4HJ9 A;  2KHI A;  2BA0 A;  4HJ8 A;  4A3B H;  3CCL A;  3ULL A;  2NVT H;  4GN4 B;  4DR1 Q;  1MJC A;  4X65 Q;  1N36 L;  2MO1 A;  1RIP A;  5GAH C;  4RG1 A;  1XPU A;  4KLK A;  1N34 L;  1VQB A;  4A3K H;  1EFW A;  4GKK L;  2OWO A;  1Y1W H;  1WCM H;  2AMC B;  3CW2 C;  1KD1 C;  4DKA C;  2MO0 A;  2UXC L;  4A93 G;  5M5W H;  2MQH A;  3K80 C;  1VQE A;  1E24 A;  1I94 L;  4B3R Q;  2FXQ A;  2HHH L;  2F4V L;  1KL9 A;  4PZ7 A;  4DR5 Q;  1C7Y A;  2E2H H;  1IBM L;  3K0X A;  3S14 H;  3J80 c;  3BU2 A;  3NEL A;  3CME A;  1HNW Q;  4JI8 L;  1SRU A;  4JC0 A;  4LF9 Q;  5IP9 H;  5AJ3 Q;  1NTG A;  1EWI A;  2JE6 I;  5LMU L;  1VQL A;  1VQ7 A;  1KRS A;  5J3B A;  4A4I A;  2UUB Q;  4JV5 L;  4WJ3 M;  5GRO A;  4POF A;  2VW9 A;  4BXX H;  1NE3 A;  2JA5 H;  1LM0 A;  2RHS B;  5C3E H;  3DLL A;  2Y0S E;  1N34 Q;  1D8L A;  3JC6 6;  2K5H A;  4J15 A;  4OWT B;  3AFP A;  3WWV A;  4DR3 Q;  1D7Q A;  1XPR A;  2Z6K A;  2JA7 G;  1VQ9 A;  3GD7 A;  3PF5 A;  3S15 H;  2YTX A;  1BBU A;  3CCR A;  4TVA B;  4HIM A;  1C9O A;  3HOY H;  1TXY A;  3T1H L;  2GVA A;  1I94 Q;  2Z0S A;  1CKN A;  1HZC A;  4DAY B;  3UDI A;  3L2P A;  2E2I H;  2HHH Q;  2HT1 A;  3AEV A;  1G6P A;  3LGJ A;  3H3V H;  5ELO A;  1IBM Q;  4A3E G;  1V43 A;  1VQO A;  5C44 G;  2ZM6 L;  4OWW B;  3G71 A;  1Y1V H;  5M3F H;  4IOC A;  2VQE L;  4X6A H;  4JI2 L;  1IBK L;  3J7Z C;  5M5Y H;  3M3Y H;  3EBE A;  1TWC H;  4JV5 Q;  1TWF H;  2XTI A;  4P71 A;  1UWV A;  4R4I A;  3OYY A;  3S1R H;  1QUQ B;  2IHE A;  1K8G A;  3UDG A;  4IFD G;  1N33 L;  5JJK A;  2VQF Q;  4A3D G;  3PIO A;  2VZA A;  1VQJ A;  3A5Z B;  2R92 G;  2ZJQ A;  3I7F A;  4BY1 G;  4DR7 L;  3CCJ A;  1YIT A;  5C0X G;  1S3O A;  4YY3 L;  4A3J G;  2DUD A;  2V1C C;  3E9H A;  1QVC A;  3RZD H;  4AIM A;  1Q81 C;  4BBR G;  1PH3 A;  3PO2 G;  1UE6 A;  2CWA A;  5IY0 A;  1Q12 A;  3AQQ A;  1L1O C;  2B63 G;  1VQF A;  3ER0 A;  2I5H A;  4P74 A;  3K81 C;  2UU9 L;  3I4N H;  2KCM A;  3GTL H;  3W1B A;  1Q86 C;  2VQE Q;  1IBK Q;  2K5N A;  5C4X H;  1NMG A;  4APV A;  3S1N H;  1VQA A;  1X56 A;  4L5R C;  1N8R C;  1HR0 L;  4O0A A;  1L1O B;  3EIV A;  1N33 Q;  3VDY A;  4RMF A;  3S2D H;  2NN6 G;  2YTY A;  4O2D A;  1VQP A;  2K4K A;  4XTC S;  1MIU A;  1K8A C;  1NMF A;  1JMC A;  4DR7 Q;  1E7Z A;  2N49 A;  4R4O A;  4YY3 Q;  1XNQ Q;  1PYB A;  1Z47 A;  4X62 L;  5M3M H;  2OTL A;  4LUO A;  1WJJ A;  2D0P A;  2D62 A;  3KF6 A;  3RN2 A;  4JBK A;  1N32 Q;  1XMQ L;  1LUZ A;  1QVG A;  3I2Z A;  5HY6 A;  1E3P A;  5H1S E;  4BY7 G;  4JI3 L;  5FJ8 H;  3H15 A;  1B8A A;  1SN8 A;  4A76 A;  3TS0 A;  4LFA L;  1E1T A;  4QIW E;  2MNA A;  1YIJ A;  2NN6 I;  2R93 G;  1K3R A;  4YHH L;  3HOU H;  1I50 H;  5IYC H;  2PNH A;  4JG2 A;  3L7Z C;  1PH5 A;  1QVF A;  2JA6 H;  4DR1 L;  1G51 A;  4R4T A;  4LFB Q;  1VQC A;  1PH2 A;  1VQ4 A;  1B7Y B;  1XTD A;  4A3C H;  2PI2 E;  1WOC A;  1U5K A;  2BH8 A;  2IHF A;  3U4V A;  2D0O A;  3UDF A;  4X62 Q;  3G6E A;  2I5M X;  1PV4 A;  3STB C;  1J5E L;  1GD7 A;  1TWG H;  3PUV A;  2CCZ A;  4UY8 C;  4GLV B;  4ALP A;  2Q2I A;  4GLX A;  4DV4 L;  1G29 1;  1PH6 A;  1VQD A;  4LFA Q;  1OXS C;  1X3G A;  4YCU A;  4C3I H;  4HJA A;  1HZB A;  4GNX A;  1TWA H;  3TRZ A;  3PUY A;  4A3L H;  1HNW L;  5C0X J;  4DV2 L;  2YTV A;  3W1G A;  5LMN W;  4DUY Q;  1VQ8 A;  3F1Z A;  4QQB X;  3IRB A;  3RLN A;  2UUB L;  5IWA Q;  1Q1E A;  2I0Q A;  1HJP A;  2JEA I;  4GKJ Q;  5FLM H;  2VUM G;  5GAG C;  4QL5 A;  4PG3 A;  4H02 A;  5E7N A;  4DR3 L;  1OTC A;  3PO3 G;  1KC8 C;  3M9B A;  5IYB H;  1LTL A;  3H3V I;  3CCU A;  2JK8 A;  4A3I H;  1W3S A;  1J5E Q;  4OO1 G;  4DUZ L;  5IYD G;  3CC7 A;  1PVO A;  4R4C A;  1HH2 P;  3CC4 A;  2VY3 A;  1U0L A;  1IL2 A;  4DV3 L;  4DV4 Q;  1Q82 C;  1Q46 A;  1VQH A;  3OTO Q;  1OXX K;  3JAM c;  3I55 A;  3Q8D A;  2E5L L;  4MNO A;  3STB D;  1PH1 A;  1EYG A;  1HNX L;  4DV2 Q;  3U4Z A;  1EQQ A;  1UE5 A;  1M1K C;  5M5X H;  2HIX A;  4L5T A;  1V9P A;  1B70 B;  4OO1 I;  4A3F H;  2JA8 G;  2N78 A;  1O7I A;  5JEA J;  3HOX G;  2VQF L;  4LW1 A;  1VS0 A;  3CCS A;  1XNR L;  3HOV G;  2N8N A;  4BBS H;  3H0G G;  2NZH A;  3CMA A;  2ALY B;  2XGT A;  3HKZ E;  1S72 A;  3J80 i;  1KQS A;  4A3M G;  4BA2 I;  4JOI A;  4DUZ Q;  2B3G A;  3ICE A;  4DV6 Q;  3RZO H;  2WB1 G;  4LF8 L;  4DV3 Q;  3BJU A;  3TS2 A;  2A8V A;  4WJ4 A;  2OCE A;  2PQA B;  1KAW A;  2K14 A;  2LXJ A;  2E5L Q;  3S24 A;  2UUA Q;  1E1O A;  4A3G H;  2LXK A;  2EIF A;  4UP7 A;  1P8L A;  1QZG A;  2HQL A;  4L5Q A;  1HNX Q;  1ASY A;  2ZJP A;  2E2J H;  3HOZ H;  3CC2 A;  3FKI G;  1YNX A;  3CF5 A;  2Z6K C;  3I4M H;  4YCW A;  3GTK H;  2Q2H A;  4KI0 A;  4DPG A;  2JA9 A;  4OWX B;  2R7Z H;  2ZJR A;  1XNR Q;  3DM3 A;  4NPS A;  4DV1 L;  3GTM H;  1AE2 A;  3FHW A;  1YHB A;  4GOP A;  4JYA L;  1I6H H;  1AH9 A;  1SE8 A;  2GVB A;  4DR2 L;  1XNQ L;  2KEN A;  1EIF A;  4POG A;  3M7N A;  3HOW H;  4ME3 A;  4YWL A;  3TQY A;  4IPG A;  2R7F A;  4UP9 A;  1YJN A;  4LF8 Q;  1N32 L;  3J7A 5;  1IBL L;  2OQK A;  1L1O A;  1PA6 A;  4B3S L;  2NVQ H;  3NEM A;  4YWK A;  1EIY B;  4Y52 H;  1CKN B;  4X64 L;  5IP7 G;  2BA1 A;  2N3S A;  3NEN A;  3S16 H;  2JEB I;  1HR0 W;  3HKZ G;  1T9H A;  3S17 H;  2Q2T A;  1R9T H;  1YBY A;  2PMZ E;  3CD6 A;  5IE8 A;  4KHP L;  1QZH A;  3MXN B;  4A93 H;  4GN5 A;  4PZ6 A;  4A3B G;  4IOA A;  4LFB L;  1S40 A;  4DV1 Q;  3J81 c;  4X66 Q;  4A3K G;  4DR2 Q;  4LF4 Q;  1EUJ A;  1GKH A;  2WFW A;  1CSP A;  3TEH B;  1WCM G;  1Y1W G;  3S2H H;  2ZTC A;  5IT9 c;  2PI2 A;  4BA1 I;  4LF6 L;  3D0F A;  1IBL Q;  3M4O H;  4JCV E;  4LFC Q;  4DNI A;  4B3S Q;  2Q2U A;  1Q8K A;  1YI2 A;  4DV0 Q;  4LF7 Q;  3RLF A;  4X64 Q;  4HIO A;  4PZ8 A;  1KRT A;  3PV0 A;  1YVC A;  3E9I A;  2VL6 A;  4DUY L;  2EXD A;  4JI7 L;  2JA7 H;  2RCN A;  3CCM A;  5IP9 G;  1GM5 A;  2JJQ A;  4KHP Q;  3ZJY C;  2VNU D;  4EQ5 A;  5IWA L;  3G4S A;  3RNU A;  4GKJ L;  4DK6 C;  1PH4 A;  1WFQ A;  2JQO A;  3F8T A;  4BXX G;  1KIX A;  1A0I A;  2JA5 G;  4HID A;  5C3E G;  4IJL A;  4QJF A;  2OTJ A;  4A3E H;  1PH7 A;  3A0J A;  2WAQ G;  5C44 H;  1WI5 A;  3S1M H;  4JI4 L;  2CFM A;  1LYL A;  4LF6 Q;  2ASB A; 
#chains in the Genus database with same CATH topology
 2UXB H;  4HJ7 A;  3Q6S A;  3D4W A;  4RKL A;  3PW7 A;  4P73 A;  4XXE A;  2KA7 A;  2WB1 B;  4FDB A;  2DWC A;  2XGQ A;  4P75 A;  4C2M H;  2NVX B;  4IFD H;  3WO0 A;  4HCE A;  3S1Q H;  3P7J A;  2R92 A;  5JJI A;  3GTQ A;  1HA5 A;  4BY1 H;  5KFS A;  1NY4 A;  5D1P A;  4JI6 L;  3E3X A;  3M9N B;  3GV7 B;  1MI2 A;  1EY8 A;  1ZHQ A;  4QMG A;  2L55 A;  2C2R A;  3CPW A;  2K52 A;  4IPH A;  1PTO H;  3D4R A;  5KFP A;  2HDL A;  4JI4 Q;  4NXN L;  3A8J E;  1J6Q A;  1JWS D;  2DY8 A;  1CQF A;  4GN3 B;  5I47 A;  1BO0 A;  1A3T A;  3NWS A;  5BR8 L;  5C4Z A;  4TUY F;  4TQU S;  1F2Y A;  4KK7 A;  4UCT A;  1TWG B;  4TV9 F;  3QOL A;  2UUA L;  5LL6 b;  1S0M A;  2ATW A;  3R2T A;  5DLG A;  2V4R A;  1HFG A;  5LMN L;  1KJ8 A;  2XIG A;  5KFD A;  4JI6 Q;  5C4X G;  3J7A V;  1X9N A;  2B2W A;  4B3T L;  4HR7 A;  4CDD C;  2PQA A;  4DK3 C;  5D14 A;  4BY7 H;  3BZD B;  1WTW A;  5JPM C;  2L1B A;  3JAM i;  4NXN Q;  1E22 A;  1SYB A;  5KT4 A;  1Y1W B;  1WCM B;  1QG7 A;  2YU9 H;  3GO5 A;  5D3I B;  4MV9 A;  2QK4 A;  4G7Z C;  5BR8 Q;  2EJM A;  4DXG A;  4JI5 L;  1JOR A;  2VOB A;  2FPG B;  2R7D A;  4WJW A;  3K3P A;  5KFF A;  1EQR A;  2EVB A;  1D5Z C;  5LMN Q;  2AKW B;  3CVZ A;  3KJP A;  4QW8 A;  4UCS A;  5BN5 A;  1HR0 H;  5KX5 F;  1Z7T A;  2NU8 B;  1MGS A;  2NZO A;  2YYZ A;  4B3T Q;  1JB3 A;  5DLQ E;  4ED7 A;  1LT4 D;  3QB3 A;  4QWB A;  4A3F B;  3UFX B;  3PR4 A;  1HRJ A;  1EEI D;  5COY A;  2JSO A;  4KHZ A;  1HNZ H;  2OEO A;  1TU2 B;  3PIP A;  4BBS B;  5NUC A;  4JI5 Q;  3BVM A;  1XXG A;  2M00 A;  4F88 A;  4IRD A;  4JI1 L;  3RB6 A;  4LF7 L;  1FGU A;  2B29 A;  1WR2 A;  4WD3 A;  3BDO A;  2VUM A;  1PTO F;  4XDX A;  4A3G B;  4IUT A;  1B6S A;  1Y1V B;  5M3F B;  3N6X A;  5IYZ F;  1VQG A;  4MIU A;  3U58 A;  4ULL A;  4IHJ F;  3PGZ A;  4OO1 H;  4NXM H;  1CZG A;  4LWC A;  2ES2 A;  3GTO H;  4DR6 L;  1XDN A;  5CYU A;  2Q8T A;  2IX1 A;  2VB3 X;  1TY0 A;  2V4D A;  3D6W A;  3LWU A;  4ODG A;  4ZK9 B;  1S9F A;  4OXP A;  3MR3 A;  1VCI A;  4KHV A;  2B2V C;  1I6H B;  1SJH D;  4CBV A;  3VMM A;  2XC9 A;  4EQO A;  2I5L X;  4KY7 A;  3RZD B;  1BNZ A;  4I7A A;  5KND A;  4JI1 Q;  4DR5 H;  3U9S A;  4DR4 L;  5C0X I;  4OX9 L;  4CDC C;  5C4H A;  1I6V C;  3GLK A;  1BNC A;  4U67 3;  4RZQ A;  4RZR A;  2CQA A;  1A2U A;  3R5X A;  1K83 H;  2XD4 A;  3IN5 A;  3ZYY X;  2WB1 A;  4DR6 Q;  3VA7 A;  3HXL A;  2R8G A;  4RUA A;  1VQN A;  4K2K A;  3K58 A;  1ESR A;  2NVX A;  3RLO A;  4MV4 A;  1VKZ A;  3DUZ A;  2UUC L;  2W57 A;  3V6H A;  5KFE A;  1ICW A;  2HHH H;  2DLN A;  1A63 A;  2MJ8 A;  4DXF A;  3S2H B;  1I3Q A;  3N41 B;  5EWG A;  1YZ6 A;  3M4O B;  5CV6 A;  3RJ0 A;  1DON A;  1AUV A;  3NK9 A;  3GTQ H;  2F0G A;  3RF2 A;  4LUV A;  4RWS C;  2ZTE A;  1D5X C;  1VQ6 A;  1I4P A;  1BCP F;  1WYD A;  2JXM B;  4AYB G;  3G48 A;  4QGU A;  4YCV A;  3OWE B;  2F0J A;  5IT9 L;  5EOY A;  1HPC A;  2JA6 B;  1CKM A;  3B6Y A;  2LMC B;  4B3R L;  3RIZ A;  3FVQ A;  1P16 A;  5E4W C;  1Z9F A;  2UUC Q;  2IY5 B;  1L2Z A;  1X6O A;  3RUP A;  1FJG L;  3Q0A A;  1WTX A;  3SI8 A;  1JLL B;  1CSQ A;  2RF4 A;  1DOM A;  2ZM6 H;  3K5O A;  1K0R A;  3Q23 A;  2KHI A;  4HJ9 A;  3GTG B;  3LWB A;  3CCL A;  3ULL A;  3QFF A;  4GN4 B;  1MJC A;  4JI2 H;  2ICI A;  4KLK A;  1VQB A;  4C3I B;  4GKK L;  4HMJ A;  3GQC A;  1Y1W A;  1WCM A;  3CW2 C;  1PTO C;  4YQW A;  2UXC L;  4RFB A;  4A93 G;  2MQH A;  3K80 C;  4B3R Q;  1E24 A;  2FXQ A;  4YP3 A;  2VPQ A;  3PO2 B;  4JW0 A;  4YY3 H;  4RUC A;  4PZ7 A;  1DD2 A;  2BDO A;  2K28 A;  4ZYS A;  1IBM L;  3S14 H;  3KHL A;  2B39 A;  3DMU A;  1HNW Q;  1SRU A;  2UU9 H;  1EWI A;  1SYX B;  4POF A;  2VW9 A;  4HSV A;  1PZJ D;  3DLL A;  2GLT A;  3JC6 6;  4J15 A;  1D7Q A;  2WAQ A;  3GTP B;  1VQ9 A;  2G9H D;  5FO7 B;  3CCR A;  2YRX A;  1PDQ A;  2NU7 B;  2Z0S A;  4DAY B;  2E2I H;  3UDI A;  3RBD A;  2HT1 A;  4MV3 A;  3SK4 A;  1K8M A;  3H3V H;  2R6F A;  1A6X A;  1IBM Q;  1VQO A;  4OWW B;  3E0J A;  5J1Z A;  1Y1V A;  3W3A A;  1M0T A;  4IOC A;  2VQE L;  1DCZ A;  4X6A H;  5M5Y H;  1F77 A;  3K5H A;  4ZUJ A;  5FK9 C;  3VR2 A;  4HED A;  1RYR A;  1UWV A;  2W9B B;  3OYY A;  3S1R H;  5JJK A;  2IHE A;  3OUZ A;  5LYJ F;  4IWY A;  3RV4 A;  1DOL A;  3PIO A;  4A3D G;  3V2T A;  2R92 G;  5CGK A;  4DLK A;  4DR1 H;  3CQZ B;  3CCJ A;  1HXY D;  2QDB A;  1YIT A;  1M0W A;  4A3J G;  2V1C C;  3E9H A;  1QVC A;  1Q81 C;  4H7B A;  3EVQ A;  2JN4 A;  2C2D A;  4IUV A;  3GIP A;  1VQF A;  2F0I A;  4BWS C;  1BCP C;  1LTA D;  2ASJ A;  3K81 C;  3I4N H;  5CBE E;  3MXG A;  1Q86 C;  2VQE Q;  2RKS A;  4DV4 H;  5KIX A;  1X56 A;  3E5N A;  1LO5 D;  1HR0 L;  3T5K A;  3IG0 A;  2K1B A;  3CU7 A;  2YTY A;  4JYA Q;  4ED6 A;  2SCU B;  1MIU A;  1IOV A;  3I73 A;  2A6E C;  4R4O A;  5A35 A;  1XNQ Q;  3PO3 B;  4UFZ A;  4QWC A;  2OTL A;  4X62 L;  2IX3 A;  2D62 A;  2D0P A;  4C3J B;  5D1O B;  5CV7 A;  1FKA H;  2PO4 A;  5H1S E;  1B8A A;  1IL8 A;  2VPS A;  1K3B C;  5FD5 A;  2R93 G;  2NN6 I;  5K2M A;  3H94 A;  3GID A;  3HOU H;  1I50 H;  3K5N A;  4OHJ A;  3M4I A;  2J6U A;  2JA6 A;  2PNH A;  2R84 A;  4H0L C;  3CRL C;  3DM1 A;  2J7Z A;  4LFB Q;  3FRP B;  2JA8 B;  3TSS A;  5IT9 W;  5T1G A;  3HOX B;  4J9K A;  2KJX A;  4UCR A;  1RDP D;  4JPB W;  4C3H B;  1F9Q A;  1WOC A;  2PI2 E;  4RNM A;  2PBZ A;  2IHF A;  4X62 Q;  3G6E A;  3UDF A;  1PV4 A;  3L4K A;  5LP6 F;  3RB0 A;  2B2T C;  1TWG H;  4A3M B;  2CCZ A;  2FK1 A;  4ALP A;  2Q2I A;  1STG A;  1G29 1;  1W96 A;  1OXS C;  1X3G A;  1WD1 A;  4A3L H;  4EEQ A;  5L1K A;  3H40 A;  4LSA A;  5KEE A;  4O42 A;  2F0L A;  3FDS A;  2AUK A;  2D2C C;  3G6J B;  1UAP A;  2K6A A;  4TSS A;  5JH7 F;  4ECR A;  1GGO A;  5C0X H;  3JSL A;  1Q1E A;  4GKJ Q;  1IW7 C;  2VUM G;  1I4Q A;  1LTT D;  2L5T A;  3I4L A;  1OTC A;  1S5C D;  4XYQ A;  4O4I F;  5IYB H;  2AUJ D;  2Y0S A;  3OWF A;  5KFN A;  1W3S A;  3N42 B;  4ABN A;  5J39 A;  3M9O B;  1PVO A;  1HH2 P;  5DM7 3;  2VY3 A;  1U0L A;  4LF4 H;  3NTK A;  1STY A;  4DV3 L;  1Q82 C;  4V19 0;  1Z6H A;  1IKM A;  2YS7 A;  3OTO Q;  3VYR A;  3JAM c;  3I55 A;  1DOK A;  3PW2 A;  5JOB A;  1EYG A;  4B3S H;  1F9R A;  5M5X H;  2HIX A;  1BF4 A;  2R7M A;  4A3F H;  2N78 A;  2E74 C;  2K33 A;  4LAA A;  1AFP A;  2RDH A;  5EQ0 A;  1VS0 A;  4NMZ A;  1VAJ A;  4G57 A;  3HOV G;  4BBS H;  3H0G G;  4LSX A;  5C5M A;  5JEA H;  4ECT A;  1E2W A;  4G4K A;  4A3K B;  2B3G A;  3KTM A;  4DV6 Q;  5DAU A;  3JAM W;  4FXG C;  4C1N I;  2WB1 G;  4LF8 L;  4DV3 Q;  4XYM B;  5DQI A;  2R8H A;  4WJ4 A;  4EBD A;  3OSP A;  2W9B A;  2DPJ A;  2F0N A;  4A3G H;  5DEH A;  4JV0 A;  2EIF A;  1P8L A;  1U4R A;  2HQL A;  1OO9 B;  2F0E A;  1KJI A;  5C1P A;  3MZ5 A;  5KG1 A;  2Z6K C;  3I8Z A;  4KJO A;  3GTK A;  1CQI B;  2JP1 A;  4J9O A;  1B2T A;  2R7Z A;  3R8B A;  1BBX C;  2ZJR A;  3ND8 A;  3ORR A;  3DM3 A;  4KKU A;  4ME5 A;  1AE2 A;  1I6H H;  1W6J A;  2GVB A;  3H3V C;  1V4Y A;  4I7H A;  4RH6 A;  5KFW A;  3TQY A;  1YJN A;  4LF8 Q;  2PMZ B;  3SXH A;  5LL6 X;  3K5M A;  2PPB C;  5KYL A;  1KDB A;  2F0P A;  3HOY B;  4JI4 H;  4OEM B;  3OOC A;  4Y52 H;  4DL3 A;  3ERQ A;  2B2V A;  4X64 L;  2N3S A;  1CE8 A;  1HR0 W;  3HKZ G;  4LMQ D;  1RJT A;  2Q2T A;  4QIW A;  1R4Q B;  3PW4 A;  3GIL A;  4DN4 M;  5BPH A;  1K8O A;  3MXN B;  3KAL A;  4A3B G;  3NTH A;  3M3Y B;  2EZV A;  2PYK A;  1TII D;  4JI6 H;  1TWF B;  2RSO A;  5KFJ A;  1I7L A;  2WFW A;  3S2H H;  3BVZ A;  1WCM G;  1Y1W G;  1EIH A;  4RAZ A;  2ZTC A;  3LML A;  4FYD A;  3KHH A;  4GZY C;  3M4O H;  4LFC Q;  4DNI A;  4HAE A;  4NXN H;  1ENF A;  1Q8K A;  1YI2 A;  3IFT A;  4X64 Q;  1EY4 A;  3EPI A;  1TT2 A;  3MWY W;  4OIK A;  1KRT A;  4FF2 A;  5BR8 H;  1STN A;  3RMH A;  2JA7 A;  1CS0 A;  2NUA B;  3NUC A;  5CA1 F;  2VNU D;  5LMN H;  4IQZ A;  2ATL A;  1WFQ A;  4BXX G;  3HB9 A;  1A0I A;  4QJF A;  2CW8 A;  4A3E H;  2WAQ G;  1KEE A;  2V58 A;  4B3T H;  1S03 G;  2F0Q A;  4DV7 L;  3GTG H;  4PQX A;  5HGT A;  2F4I A;  4QWE A;  4DK1 A;  3L0O A;  3GIQ A;  4EBC A;  4C2M A;  1PZK D;  2V9W A;  1VQK A;  4CDF C;  2EYO A;  2SNM A;  4JI5 H;  1QB5 D;  2DN8 A;  2QW7 A;  1Y1V G;  5M3F G;  3T1Y Q;  3LNN A;  1IXR A;  1QWY A;  1GOZ A;  4JI0 L;  1PH8 A;  2Z6B A;  4OEL B;  3PO2 H;  2G5D A;  1I4X A;  2K5Q A;  5TSS A;  3PR5 B;  2CKZ B;  3NWT A;  2GA4 B;  5IGE A;  3BZK A;  3HS0 C;  5ELC A;  2MHV A;  1V1P B;  3T16 A;  2QA4 A;  2B8G A;  1XPO A;  3MFH A;  3Q8Q B;  4HJ5 A;  4UDU C;  3T56 B;  4DV7 Q;  1JJ2 A;  1AZQ A;  4Q5V A;  1I7N A;  1DXM A;  1D1I A;  4IRK A;  2EYL A;  4LNQ A;  2GPS A;  3RTX A;  1AE3 A;  1B53 A;  4F4X A;  3GTP H;  2ZXR A;  4ECW A;  2B2U C;  1PRT F;  3QZ7 A;  3QZ8 A;  3V6J A;  2NN6 H;  4MV6 A;  3J81 j;  2L15 A;  4JI1 H;  1NUC A;  1PYW D;  4GNX B;  4ECX A;  4JI0 Q;  4J9P A;  4CHT B;  1A3U A;  3RUZ A;  3AU7 A;  2C2E A;  2EXZ A;  1SMX A;  2K50 A;  1X3F A;  3CCQ A;  2MP1 A;  2A19 A;  2AHO B;  4ECQ A;  1Y14 B;  3TP5 A;  4ZI7 F;  1ZQ7 A;  3A8I E;  5KG2 A;  1X65 A;  1B9M A;  1UNS A;  4A75 A;  4DR6 H;  2YU9 A;  1BVS A;  1BR9 A;  5M3M G;  5FLX c;  1VBG A;  4FU0 A;  4A3I B;  2SOB A;  2F1M A;  5I6Y A;  1SCU B;  3L4J A;  3OMC A;  5I2X A;  1QUQ A;  4KY6 A;  2F0V A;  3I12 A;  3OPO A;  4HN7 A;  1Q3L A;  1E0B A;  5FJ8 G;  2JEI A;  1SND A;  1FR3 A;  2EY5 A;  1N36 Q;  3CQZ H;  2K75 A;  3CCV A;  4YR0 A;  3A56 A;  3S14 B;  3TME A;  3I56 A;  1JE5 A;  4OX9 H;  4UPA A;  3I70 A;  2HIV A;  3RFC A;  1S97 A;  1NBW A;  5IYC G;  2PMZ A;  4JBW A;  1TWH H;  1K73 C;  2JA6 G;  4K6L A;  5L1L A;  3R93 A;  2IA6 A;  5DM6 3;  3J80 E;  2F4V Q;  1E4E A;  1FNU A;  4LF4 L;  3TIG A;  3M4Q A;  2X69 A;  4C5C A;  4Q0F A;  1L0W A;  5A2Q L;  4JI8 Q;  5KFQ A;  3K8A A;  3KYH C;  3KFU A;  1H9J A;  2UUC H;  4DV0 L;  2E2I B;  2ICE C;  5LMU Q;  1DYQ A;  1JC7 A;  2P5Z X;  2R61 A;  2QF7 A;  1C8C A;  1EWH A;  3GV6 A;  3PO3 H;  1CI3 M;  1I5F A;  3A5U A;  2GPW A;  2SDF A;  4JK1 C;  4C3J H;  4DV5 L;  2YW2 A;  4LF5 L;  2ID0 A;  3T1H Q;  1C48 A;  4N8X 1;  4QY7 A;  3I4M B;  2Z9H A;  4I55 F;  1A8V A;  2LSS A;  4IO9 A;  2R87 A;  4ED3 A;  2BQ3 A;  2FJZ A;  3PF4 A;  1JWU D;  4DL6 A;  4J9L A;  2NU6 B;  2Y0S G;  1PYS B;  1CUK A;  5EKK A;  1B1Z A;  3GTM B;  4V0B A;  5KG5 A;  4E4T A;  1SYD A;  4B3R H;  4AYB E;  1VMP A;  3AFQ A;  2A73 B;  3KOJ A;  2JA8 H;  2R86 A;  4PMW A;  1IZ6 A;  1E2Z A;  3UE0 A;  4J9M A;  3HOX H;  1PHJ A;  2MCT A;  1T94 A;  4C3H H;  3K57 A;  2MUY A;  3MEH A;  5ELN A;  3MEF A;  1B50 A;  1RL2 A;  3N43 B;  1JQY D;  3MXP A;  4DV5 Q;  3KHG A;  2AQ4 A;  4A3M H;  4K2L A;  3D31 A;  5EBD A;  4LF5 Q;  1U4M A;  3GIM A;  1PRT C;  1K83 A;  3KBX A;  4GKK H;  1SLJ A;  1SFO H;  1VQ5 A;  3BDC A;  5GQO A;  1V1Q A;  4DAM A;  1W93 A;  3DWA A;  2RA4 A;  2EY1 A;  2B2T A;  2LY7 A;  3PUX A;  1CK1 A;  1MKH A;  1SYC A;  3T5J A;  1IBM H;  1VQI A;  3J7A F;  1ASZ A;  1K1S A;  4GLA C;  1Q7Y C;  1V1P A;  3ERS X;  3HOZ G;  1G8Z D;  1ICF B;  1MBY A;  2WAC A;  3SE0 A;  5LHY 1;  2WII B;  1X3Q A;  3M4P A;  2QEX A;  5FPO A;  3HOU B;  1I50 B;  3K7U C;  1X3E A;  5F2D A;  4FXK C;  1AP0 A;  4YAK B;  2R7Z G;  1GSA A;  3PVX A;  1L2F A;  4DL2 A;  2KSW A;  1KLG D;  5IP7 H;  1GO3 E;  5K5P A;  4JI3 Q;  5C1O A;  2SEB D;  1JXL A;  2Q8I B;  5KFI A;  1A2T A;  1HTP A;  1OXU A;  5L37 A;  5EPL A;  2W70 A;  1O7Y A;  1SRO A;  4C5B A;  4RB1 A;  2R85 A;  2M2L A;  4LF9 L;  4YHH Q;  4O3P A;  3VR6 A;  5KFB A;  1UE7 A;  1FL0 A;  2VQE H;  2NVT H;  1SNM A;  1CA6 A;  4RG1 A;  1N34 L;  4A3K H;  4HNU A;  2A74 C;  2C00 A;  2V4Q A;  1QCB D;  5KT2 A;  4IUP A;  2MO0 A;  4FF3 A;  4K14 A;  3RD4 A;  1S5D D;  4Z9C B;  1G91 A;  1VQE A;  4JYA H;  2EJG C;  2HCI A;  4BBR B;  5AFW A;  1VBH A;  1XNQ H;  5EGT A;  4O3Q A;  1S5F D;  2O4X A;  4O4L F;  1BXR A;  2IW3 A;  3KAK A;  4F7X A;  1ET6 A;  3FPU B;  5ELE A;  4JC0 A;  2B2Y C;  5IP9 H;  4LF9 Q;  2E75 C;  1NTG A;  2KEE A;  3LWE A;  1VQL A;  2UUB Q;  4A4I A;  2WE6 A;  4JV5 L;  2K5D A;  2ZXO A;  5HBR B;  1NE3 A;  1LM0 A;  5FOB B;  1N34 Q;  4OWT B;  4R8U B;  4OL7 A;  4DR3 Q;  2EPB A;  1XPR A;  2Z6K A;  2JA7 G;  2ZT9 C;  3GD7 A;  5M5X B;  2YTX A;  2J4X A;  4MV8 A;  4LFB H;  1S5B D;  1C9O A;  3HOY H;  1CT1 D;  2CQY A;  3KHR A;  2E2I A;  2L9H A;  3AEV A;  5ELO A;  1UUP A;  4X62 H;  2HVR A;  3JZI A;  1V43 A;  5C44 G;  1DV1 A;  3GTJ B;  2RVL A;  1IBK L;  3KLR A;  3M3Y H;  3G6Y A;  2NWG A;  3VYT A;  4JV5 Q;  1TWF H;  2I46 A;  4Y7N B;  2DZD A;  5K36 H;  2QYZ A;  4XT1 B;  2EJF C;  4J9N A;  2M05 A;  4IFD G;  1N33 L;  2VQF Q;  3A5Z B;  2ZJQ A;  1BXT A;  3I7F A;  4BY1 G;  4DAV A;  4DR7 L;  2YZN A;  4HNT A;  5J22 A;  1B4O A;  2J9G A;  3LX0 A;  4GKJ H;  4LK1 C;  1B33 N;  5IY0 A;  4EYH B;  1Q12 A;  3AQQ A;  4K5X A;  2WDT A;  3ER0 A;  1ZEQ X;  2AGO A;  2K03 A;  4DU9 A;  5C3X A;  1BQQ T;  2A69 C;  2VA2 A;  3SHL A;  1A9X A;  5KKN B;  1IBK Q;  4APV A;  3RB4 A;  1VQA A;  3OTO H;  1N8R C;  3C1E A;  1ULZ A;  1ENC A;  4HCS A;  4O0A A;  1N33 Q;  3VDY A;  4RMF A;  4ID6 A;  4DR7 Q;  2K4K A;  2W7P A;  1E7Z A;  2N49 A;  2JEJ A;  1Z47 A;  1ZET A;  1N32 Q;  4JVZ A;  5ELD A;  5IOC A;  1LUZ A;  1JCK B;  5KFT A;  4NDX A;  4BY7 G;  1WTP A;  3TS0 A;  5GON F;  4DV6 H;  4LFA L;  1E1T A;  4F4Y A;  4DV3 H;  1PRT B;  2CH4 W;  1O80 A;  1I50 A;  4J6H A;  1AZP A;  3N52 A;  4JG2 A;  3J81 E;  5CC4 A;  1G51 A;  3AMU A;  1FYC A;  4HTH A;  3TZD A;  1VQ4 A;  1OWT A;  4A3C H;  4RGM A;  2L0C A;  3DHQ A;  4EEY A;  1U5K A;  2BH8 A;  3U4V A;  4GC7 A;  4CC5 A;  1J5E L;  1TWG A;  5JPN C;  3SR1 A;  2IMW P;  2L4N A;  4F87 A;  4GLX A;  1WTQ A;  3V4S A;  1PH6 A;  1VQD A;  2PVP A;  1PRT D;  4LFA Q;  1FD7 D;  4A3E B;  1HNW L;  3TIN A;  4LF8 H;  1TWA H;  2F0M A;  3PUY A;  4DV2 L;  2YTV A;  4DUY Q;  5LMN W;  5KFR A;  1TS2 A;  2KED A;  3FKI B;  3IRB A;  3RLN A;  5IWA Q;  2F0U A;  3QIA A;  3H20 A;  1M8A A;  2B2U A;  5FLM H;  2NB0 A;  2LKV A;  3MXU A;  2N55 A;  4CJ1 B;  5KT6 A;  1A15 A;  1YNJ D;  3CCU A;  2JK8 A;  4A3I H;  5KGU A;  1J5E Q;  3BYY B;  3MTS A;  4EQN A;  4DUZ L;  4OO1 G;  3CC7 A;  5DQH A;  1JOO A;  3VR5 A;  1IL2 A;  3P75 A;  4ZRZ A;  1VMC A;  2CW0 D;  1VQH A;  3U9O A;  1OXX K;  2E5L L;  4R8U A;  4IAJ A;  1QJO A;  4MNO A;  1HNX L;  4DV2 Q;  1UE5 A;  4L5T A;  4X64 H;  3PN1 A;  1S5E D;  1B70 B;  3JRX A;  3QJY A;  3D8G A;  4PV1 C;  4HQ6 A;  3TQT A;  2F0D A;  2AU0 A;  4LW1 A;  4PNY A;  2Z1C A;  1XNR L;  1E2V A;  3M9M B;  3CMA A;  1GXD C;  3HKZ E;  3N40 P;  1KQS A;  2EDG A;  4DUZ Q;  2YCH A;  1NAP A;  3RZO H;  4X3U A;  4NW2 A;  2EY6 A;  2IWH A;  5A2Q E;  5DNF A;  3TS2 A;  2A8V A;  4O3N A;  2PCF B;  1K0S A;  1XYI A;  2E5L Q;  5JVD F;  3RGX A;  1HNX Q;  2XN9 C;  5JVL A;  3CC2 A;  2E2H B;  3M4Y A;  2PZT A;  5L9X A;  2QIL A;  3I4M H;  4ECY A;  4YCW A;  4DPG A;  4OWX B;  1EU4 A;  3C46 A;  3Q8R B;  3T1Y H;  3TN2 A;  5EPJ A;  3T13 A;  1LT6 D;  1XNR Q;  4NPS A;  3GTM H;  4JYA L;  1UC8 A;  1SE8 A;  4DR2 L;  1XNQ L;  5C3E B;  4MAM A;  4KV6 A;  1PXU A;  3EQL C;  1SMY D;  2EYJ A;  3HOW H;  3J80 L;  4IPG A;  5IIF A;  2R7F A;  4UP9 A;  5C5L A;  4TKO B;  2FK2 A;  2HCC A;  1TWH B;  1IBL L;  5FPR A;  2CZG A;  1CKN B;  4DV7 H;  3NEN A;  1T9H A;  1YBY A;  4UCV A;  3NSW A;  1Z2P X;  3CD6 A;  2HUG A;  1KAA A;  4KHP L;  4K8J A;  1H9S B;  2CVR A;  2CH4 A;  4J9S A;  3BJY A;  1PFM A;  2FP4 B;  4LFB L;  1S40 A;  5KNB A;  2FFK B;  4X66 Q;  4ECV A;  4JI0 H;  4DR2 Q;  1KC7 A;  3VR4 A;  3Q24 A;  5L1J A;  1EHI A;  4ZKC B;  1KBL A;  1EEF D;  5IT9 c;  2PI2 A;  4BA1 I;  4MV1 A;  5EZY F;  1IBL Q;  1F9P A;  2FHT A;  4JCV E;  2W6P A;  4RU9 A;  2Q2U A;  2J0T D;  3RLF A;  1CHP D;  1PLF A;  1B44 D;  3PV0 A;  5CB4 F;  3E9I A;  2VL6 A;  1PZI D;  1CQJ B;  2DJF C;  3CRK C;  4JI7 L;  1SEB D;  3GTL B;  1GM5 A;  4KHP Q;  2A69 D;  1N36 H;  4GKJ L;  3BQ1 A;  1PH4 A;  3GP7 A;  5G3L D;  3F8T A;  3I90 A;  1KIX A;  4XQN A;  4HID A;  4RA8 A;  2OTJ A;  4N8F A;  5KG7 A;  4G7O C;  3S2D B;  5E4X A;  1T5X D;  2EYP A;  4Q45 A;  2XCP A;  5C3W A;  2CFM A;  2R6G A;  1IYJ B;  3F8N A;  2EYF A;  2F4V H;  3GTG A;  1O78 A;  3SDZ A;  3N44 B;  2F0O A;  1LAC A;  1B9N A;  2HGS A;  4O3R A;  1SFO B;  2DPI A;  3OTO L;  1KAB A;  3UE1 A;  3QOJ A;  3KK7 A;  3ETJ A;  2ASL A;  4JI7 Q;  4EG0 A;  1I4R A;  1STB A;  3PUW A;  3KLW A;  1XMO Q;  4XT3 B;  4NP5 A;  5IOD A;  1VQM A;  4B3M Q;  4BBR H;  2I07 B;  2CWP A;  4M8A A;  4RB2 C;  2B63 H;  1HNZ Q;  1TQO A;  5JVH 3;  2RQX A;  1CA5 A;  1DIK A;  5CR3 A;  3KDF B;  2UXD Q;  1K1Q A;  4DV6 L;  1BKB A;  4JV1 A;  1NSN S;  4GNX C;  2K5W A;  1TY2 A;  2KCT A;  1N9W A;  1Y8N B;  4IPC A;  4KN7 C;  4EQP A;  4K0K Q;  4MZ9 A;  2RSN A;  1PK8 A;  3I4N G;  3A74 A;  2B8F A;  1WVL A;  3GTP A;  2W9C B;  2B2Y A;  4AQY L;  4NXM Q;  4DV0 H;  3HGB A;  1W2B A;  1DGS A;  5KFO A;  4DAY A;  2CQO A;  4FS2 A;  1K28 A;  1W6K A;  3V6K A;  2KCC A;  2NU9 B;  3U50 C;  2NVT B;  4DFA A;  4DV5 H;  4TQS A;  4AH6 A;  3GTJ H;  5DGB A;  4LF5 H;  1F9S A;  5T1I A;  1NCV A;  3AYH B;  1PH9 A;  1B3Q A;  4KKS A;  1MSH A;  4N9T A;  2H1E A;  4IUN A;  1KHI A;  3NBH B;  1CKO A;  2BE5 D;  1SJE D;  4Y7N H;  1JDB B;  2W6O A;  1QNU A;  4XQJ A;  3BQ2 A;  4CJ0 B;  1UEA B;  1OXV A;  2KHJ A;  1EY9 A;  5EJW A;  3V05 A;  3CQZ A;  1QIL A;  4AQY Q;  5FO9 B;  5CBA E;  1GSH A;  3FDT A;  4KMU C;  3FEW X;  1WTH A;  5H80 A;  1RYS A;  5D8D A;  3HOU G;  2O5J C;  2R8J A;  3RR5 A;  1JKJ B;  1HHV A;  2IJ0 A;  1OXT A;  1TWH A;  2FE3 A;  1WTR A;  1IYV A;  3PCO B;  3GII A;  1RD9 D;  3TBI B;  1LTS D;  2ZTD A;  3DXJ C;  5GAD C;  3OHB A;  1RTO A;  2VS1 A;  1HTL D;  3EFX D;  3W2D A;  4QW9 A;  2CW7 A;  3EYY A;  1VF5 C;  3EN2 A;  1RTN A;  4LFC L;  2HJW A;  1UEB A;  3OMG A;  4JI3 H;  1Q1B A;  1PX2 A;  2KCN A;  4LH6 A;  1B3A A;  2Z8L A;  3S9W A;  4A2A A;  1HZA A;  2QGQ A;  1YJW A;  2HQE A;  4A3L G;  1TVX A;  5C6A A;  1BGW A;  4YHH H;  2XIW A;  2AWO A;  4NLG A;  2F0S A;  1EY0 A;  2NTS A;  3PW5 A;  3F2D A;  5I2Y A;  3MC0 B;  1F2L A;  3CCE A;  1RJR A;  2WKD A;  5D1O A;  5IYD H;  1YHA A;  1UE1 A;  4ZKB B;  1ESF A;  1D2B A;  4B9W A;  1EOV A;  4AYB B;  3GV5 B;  3BG3 A;  2NBF A;  4RKB A;  3A55 A;  3L3O C;  4EGV A;  5IYB G;  5IGF A;  1VF7 A;  2ZM6 Q;  4IFD I;  4GOP B;  1J9O A;  1RCV D;  4ZOL F;  1EQV A;  3OSO A;  4JI2 Q;  4F4W A;  3T5L A;  3WDN A;  4OIJ A;  4LF9 H;  1PFN A;  3LP8 A;  4MA0 A;  1ROD A;  3I72 A;  3T1Y L;  1M6V A;  4FP5 D;  3CXC A;  2UUB H;  3RGZ A;  4ZCK A;  2YYA A;  4O4H F;  4E6I A;  3S17 B;  1R9T B;  1N34 H;  4A3F G;  1SFO A;  4DR3 H;  1KXL A;  3E0E A;  4JBM A;  4A93 B;  3JSN A;  2C35 B;  4BBS G;  2FKL A;  3KJO A;  2UU9 Q;  5JEA G;  3FKI H;  4R8I A;  1I4G A;  3KAJ A;  4Q0Y A;  3T51 B;  2W9A A;  2R3Z A;  1ET9 A;  4M1U B;  1SNC A;  4I50 F;  2F3I A;  4I65 A;  4TV8 F;  4KD4 A;  2J6T A;  3VA5 A;  4FF4 A;  4A3G G;  1Y69 U;  4C56 C;  4CJ2 C;  4X65 L;  2W6N A;  3KDF A;  4J8Q A;  3J81 L;  3H4B A;  1T5E A;  3JRW A;  4JV5 H;  2V5A A;  3RN5 A;  3PUZ A;  2BR0 A;  2GN5 A;  3CPF A;  3RB3 A;  3DEO A;  2VQF H;  2DGY A;  3RV3 A;  2X6G A;  3MWE A;  4MV7 A;  3UDX A;  1XMQ Q;  1JB7 A;  2LFN A;  2TMP A;  2R8K A;  4DNR B;  4EX5 A;  1S0O A;  2R8I A;  4P72 A;  1EYD A;  5KFC A;  5AJ3 L;  2YS6 A;  2KOL A;  3CAM A;  4MTN A;  3ULJ A;  2CHB D;  5CAE B;  3U9T A;  3IKJ A;  1O7L A;  4DR1 Q;  4X65 Q;  1N36 L;  2BOS A;  2MO1 A;  2V59 A;  1IBK H;  1CFM A;  1SYG A;  2NVY B;  1TWA B;  2OWO A;  5KG3 A;  1I6U A;  4A3D B;  1KD1 C;  2WKC A;  1O7Z A;  2R92 B;  1N33 H;  4IUQ A;  3NBH A;  5CMD A;  5M5W H;  2KUM A;  2FMC A;  3V96 A;  4A3J B;  4CKB A;  1I94 L;  4DR7 H;  2F4V L;  2FLP A;  1HUM A;  1C7Y A;  2E2H H;  1B04 A;  3K0X A;  3QO2 A;  5BPF A;  3BU2 A;  4JI8 L;  4RHS A;  5AJ3 Q;  3N6R A;  1S0N A;  1S68 A;  1XX8 A;  5LMU L;  1VQ7 A;  1KRS A;  4QWD A;  4WJ3 M;  5GRO A;  2EYH A;  2R82 A;  3GV3 A;  3ERO A;  2JA5 H;  5C3E H;  2MPM A;  2L11 A;  4L8J A;  1D8L A;  5D3D A;  2K5H A;  1RKN A;  3WWV A;  4LH7 A;  2FLN A;  1CQV A;  3PF5 A;  3TP7 A;  1EIG A;  3HG9 A;  1V51 A;  3T1H L;  1I94 Q;  1G6P A;  4RGO S;  5E1F A;  3AB9 A;  3I3C A;  1GUW A;  2R7L A;  3R5H A;  3LGJ A;  4CKC A;  4HR7 B;  4A3E G;  5C4J B;  5KFG A;  1NR4 A;  2WTF A;  3MXN A;  2X6L A;  3D4D A;  1GJX A;  3RZO B;  4LFA H;  3EBE A;  4AYB A;  1TWF A;  4Y8V B;  2A6H C;  2XTI A;  2DNC A;  4P71 A;  4C3I G;  1K8G A;  2NYZ D;  4DUY H;  1FNW A;  4IR9 A;  2VZA A;  1VQJ A;  3BYT B;  5IGD A;  1H9R A;  4ME6 A;  2XRS D;  3OSN A;  1C4Q A;  1S3O A;  2ZDG A;  2DUD A;  5FKA C;  4YIJ A;  5LXT F;  4AIM A;  1PH3 A;  1GUG A;  2CWA A;  3PO2 G;  2IBK A;  3C2P A;  2BQU A;  2F3W A;  1EU3 A;  4FNF A;  5FD6 A;  3ONA B;  4IN3 A;  2I5H A;  1J5E H;  3GTL H;  4I4T F;  1Y8O B;  3HOW B;  5C4X H;  1NMG A;  3DWQ A;  5I9P A;  1HNW H;  3FMA A;  4ED8 A;  5CV5 A;  1AEX A;  1L1O B;  1ZKO A;  3EIV A;  1U4L A;  4DV2 H;  3S2D H;  1DZ1 A;  3FPP A;  3KLS A;  4R9W A;  3K0Y A;  4O2A F;  2NN6 G;  1JMC A;  4O2D A;  1VQP A;  4XTC S;  2VUM B;  1K8A C;  1NMF A;  1M7J A;  4LUO A;  3RN2 A;  3I2Z A;  3CKI B;  4CDE C;  2VQD A;  4ED0 A;  2DNE A;  3NPP A;  4JI3 L;  4DUZ H;  3BAA A;  2FLL A;  2MNA A;  1IYU A;  1E4F T;  3KUP A;  3T5H A;  1K3R A;  5EKL A;  3SEB A;  4YHH L;  4K5V A;  2L12 A;  2E5L H;  1YNJ C;  1HQR D;  3DF7 A;  3J81 W;  4XZ3 B;  1HNX H;  2JEF A;  1QVF A;  4R4T A;  4DAP A;  1J8I A;  1B7Y B;  1XTD A;  3ITP A;  4ILW A;  3NE5 B;  1HUN A;  2YL2 A;  2WV6 D;  5KG4 A;  2CW0 C;  2Z4I A;  3HOV B;  3H0G B;  5L1I A;  4EYI B;  2I80 A;  1EUC B;  2FB9 A;  5JAV A;  4G3I A;  1XNR H;  5IGC A;  2EYM A;  5G3L F;  4GLV B;  2AQ2 B;  4IRC A;  3PW0 A;  1EYC A;  3VPC A;  2NVY A;  1HZB A;  4GNX A;  1TWA A;  2QEJ C;  3W1G A;  1VQ8 A;  2XWJ B;  1FNV A;  4QQB X;  2UUB L;  5EDW A;  3PMF A;  2I0Q A;  1HJP A;  1I3Q B;  5EPK A;  1LT3 D;  5GAG C;  4PG3 A;  4DR3 L;  5E7N A;  3PO3 G;  4YAJ B;  3VPB A;  5KFH A;  4YR2 A;  1KC8 C;  3M9B A;  4F50 A;  4HYK A;  3H3V I;  4EFB A;  2XCL A;  4C3J G;  2E76 C;  5M9O A;  2I8C A;  1UNN C;  5JQW A;  5J2U F;  4X66 H;  2SNS A;  4DR2 H;  4RNN A;  3K7A B;  2B63 B;  3MFG A;  2A5H A;  4IWX A;  3STB D;  1IBL H;  3U4Z A;  1I4H A;  4L63 B;  1EQQ A;  1LT5 D;  3MR5 A;  1N56 A;  3HKZ B;  1STE A;  4F8M A;  2JA8 G;  3QR8 A;  3D3R A;  1SMY C;  1O7I A;  3HOX G;  1BJT A;  2VQF L;  4C3H G;  4A3B B;  1WTO A;  2FJ2 A;  1Q90 A;  3CCS A;  1RJP A;  4KHP H;  3I91 A;  2NUC A;  1LTR D;  3J80 i;  3EPG A;  2O2L D;  4A3M G;  1KNE A;  5KFL A;  1LAB A;  3HBL A;  4F4Z A;  2O5I C;  5A2Q W;  1O75 A;  5KG0 A;  3X3N A;  1RK5 A;  1GLV A;  1KAW A;  2LXJ A;  4QB4 A;  2YZM A;  2UUA Q;  1E1O A;  1HQM C;  2LXK A;  2ZXP A;  1QZG A;  5FO8 B;  4L5Q A;  2EY2 A;  3P20 A;  1ASY A;  2E2J H;  4WRD A;  2IP4 A;  5F9L A;  1WD0 A;  3CF5 A;  4S3S A;  3VYS A;  3F2U A;  4N9P A;  4KI0 A;  1SNO A;  2JA9 A;  4U7C A;  4JI7 H;  3OHX C;  2NTT A;  1VDZ A;  2RDF A;  3OIQ A;  1NNX A;  1EUD B;  4DV1 L;  4QWA A;  3GTM A;  3OIP A;  1YHB A;  1XMO H;  1AH9 A;  1TS5 A;  4UAI A;  1AN7 A;  5FLX E;  4B3M H;  1EIF A;  4POG A;  3M7N A;  4RNO A;  5KYI A;  2TSS A;  4ME3 A;  4YWL A;  2WAQ B;  3K5I A;  1X3P A;  1N32 L;  3J7A 5;  2A68 D;  4L6T B;  3S15 B;  1PFB A;  3X3M A;  4IZO A;  2OQK A;  3NHH A;  1L1O A;  1PA6 A;  2JYO A;  2UXD H;  1KDC A;  5KFY A;  2D5D A;  2K32 A;  4RGT A;  1EZ8 A;  5IP7 G;  3S16 H;  2JEB I;  3TZU A;  3RBE A;  1ZYR D;  3HP3 A;  1JOK A;  2AQ1 B;  3S17 H;  4K0K H;  1QE6 A;  3QG1 A;  1R9T H;  1LTB D;  1TKW B;  4FXD A;  4Q44 A;  2VR1 A;  5IGB A;  3OHA A;  1QZH A;  5KG6 A;  4A93 H;  1AN8 A;  2Q8R E;  4GN5 A;  4PZ6 A;  4IOA A;  4EGQ A;  4DV1 Q;  1TWC B;  2HD3 A;  4A3K G;  1EUJ A;  2A6H D;  2F0H A;  1TS3 A;  3HEJ A;  4PMB A;  1BUV T;  2EOT A;  4HNV A;  1RJQ A;  4LF6 L;  3D0F A;  5EKI A;  1T3N A;  3UQ8 A;  5I9O A;  4LF7 Q;  4PZ8 A;  3Q2O A;  4FF1 A;  3MFY A;  1MZB A;  4B9X A;  4DUY L;  2EXD A;  4X3T A;  2RCN A;  3H0G A;  5IP9 G;  3D6C A;  4EQ5 A;  5IWA L;  3G4S A;  3G8C A;  4AQY H;  2HVQ A;  3S1N B;  1ENA A;  2JQO A;  4IJL A;  1B6R A;  1PH7 A;  2KQ3 A;  3A0J A;  4RCO A;  1GUS A;  4DA2 A;  4DF7 A;  5KFU A;  3S1M H;  3URY A;  1LYL A;  3MVV A;  4LF6 Q;  2ASB A;  1A62 A;  2RCF A;  2FPI B;  4MHE A;  3HOY G;  4BS9 A;  4IFD J;  2WIN B;  4LUZ A;  5BMV F;  4L5S A;  4O1N A;  5M3M B;  4DR4 Q;  4OX9 Q;  2K04 A;  2NVY H;  3BS1 A;  2YZG A;  1KJJ A;  5BN3 A;  1D1K A;  4A3D H;  3ND9 A;  2R92 H;  4IR1 A;  2YV5 A;  3SE7 A;  2KEC A;  2E8G A;  2WB1 E;  4A3J H;  4RCN A;  4UP8 A;  3CP0 A;  3K3V A;  2VUG A;  5K36 G;  2FIN B;  2B63 A;  1V1O A;  3MFI A;  1ILP A;  3MWD A;  4FBT A;  2BE5 C;  4RB3 C;  5KFK A;  1F2M A;  2QCP X;  2F0W A;  1RF2 D;  1CM9 A;  1CTM A;  3MA2 B;  2H4O A;  3HKZ A;  3F2C A;  4P2C B;  2VB2 X;  2ENB A;  5HUR A;  2WYO A;  1G6Z A;  2JEG A;  3DEP A;  3HKS A;  1S4Z A;  3UI2 A;  1MJE A;  4LFC H;  2XGP A;  3KLS X;  5ELB A;  5KT7 A;  1LTI D;  4UHV A;  4XQQ A;  1JIC A;  2FPP B;  1D6E C;  1NJI C;  5DG7 A;  1FVI A;  2AWN A;  2EQS A;  3L9A X;  3Q1K A;  2PZU A;  2IX0 A;  5IGG A;  5BN4 A;  5C4J H;  1JDE A;  1GYF A;  3R23 A;  3WOF A;  2UXB L;  1HCZ A;  1WH2 A;  3GTJ A;  4KKT A;  4YJ2 F;  5HV6 A;  3EJI A;  3WNZ A;  4TQR A;  4ETS A;  2R93 H;  1GSO A;  1BBW A;  1NR2 A;  3CHB D;  3KF8 B;  4Q43 A;  1FJG Q;  2Y0S B;  1ZXT A;  4XIG S;  3F2B A;  5M5W B;  3OW7 A;  4YWM A;  3TDQ A;  4ZUI A;  1SE3 A;  4IPD A;  3BA9 A;  1F2Z A;  5HGQ A;  4JV2 A;  3SGI A;  1JT8 A;  1C30 A;  4IZ8 A;  1JJG A;  4R1J A;  2N88 A;  1YNN C;  3I4O A;  4GS3 A;  4RAY A;  4GKK Q;  1AUX A;  5EBC A;  2F52 A;  1STA A;  1KJQ A;  2PW5 A;  2PN1 A;  2UXC Q;  4J9Q A;  4JOI C;  3TRE A;  4XYO A;  1Y8P B;  2MFI A;  2UXB Q;  4X66 L;  2JA5 B;  5I6W A;  4A3C G;  3C1F A;  2BH2 A;  1XWE A;  3JAM L;  1YEZ A;  1EL0 A;  4R4Q A;  2D9U A;  4MTD A;  1XMQ H;  3PSI A;  4Q8E A;  3HFZ B;  4HIK A;  4O3O A;  1TA8 A;  1GHJ A;  4KY5 A;  2K5V A;  3BG5 A;  1JIH A;  2DJG C;  2QKI C;  3BZC A;  2VUM H;  1TWC A;  3TP8 A;  2WAQ E;  1A3V A;  2C9O A;  1E4G T;  3NP8 A;  2RGV A;  1G2S A;  4UCU A;  2A1A A;  1SDF A;  1SNQ A;  3OUU A;  1SSO A;  4GOP C;  4J9R A;  3HOZ B;  1YJ9 A;  4X65 H;  4X3S A;  5DQG A;  3ULP A;  1C0A A;  5FLM G;  1N48 A;  4HMI A;  3W5O A;  5D65 A;  3GTK B;  1JJC B;  2IT1 A;  2FMM A;  4NB3 A;  1K9M C;  2R7Z B;  4BWG B;  4X3K A;  4A3I G;  1GUO A;  2VXW A;  2F0F A;  2K05 A;  4JBJ A;  4M9U A;  3HZX A;  4ZAI A;  1KNA A;  4ECS A;  3SK6 A;  2OH2 A;  2OQ0 A;  1EYA A;  1SBB B;  4RHR A;  2NVQ B;  3J81 i;  2WP8 J;  3E6Z X;  3NBI A;  3HOV H;  3H0G H;  3GDE A;  2XRQ D;  1MSG A;  1M90 C;  1DV2 A;  3J7A K;  4LJZ C;  1XMO L;  4O2B F;  4B3M L;  2FK3 A;  2UVV A;  5C4X B;  1U9R A;  4QUF A;  4QIW B;  4DGZ A;  3GIJ A;  2RHQ B;  1XJV A;  4OON A;  2XCA A;  1HNZ L;  3M85 A;  1QOH A;  3A7A B;  2H5X A;  2NVX H;  2J6S A;  3Q8P B;  3TQ1 A;  2C22 A;  1SYF A;  2KHS A;  2UXD L;  1I94 H;  3QWN A;  4IUR A;  3FKI A;  5CA0 F;  5KFZ A;  1SR3 A;  1PFS A;  1I3Q H;  2KBN A;  4EFE A;  5EAY A;  4K0K L;  5KNC A;  1WSC A;  2R7K A;  1TR5 A;  3KF6 B;  4IJH A;  1HR0 Q;  5JJL A;  1GHK A;  4JI8 H;  1LTG D;  4WBN F;  2ZDH A;  3RAQ A;  1CHQ D;  4NXM L;  2PW7 A;  5LMU H;  5GAE C;  3E5S A;  3DWP A;  1YHQ A;  1X55 A;  1RHP A;  3I4M G;  3FP9 A;  3K7A H;  1GVP A;  2JA7 B;  1HZ9 A;  1SNP A;  4C1N K;  2E2D C;  4CKE A;  3G6X A;  3VYU A;  3Q8S B;  1AW7 A;  4GC6 A;  3T1H H;  4DR5 L;  1X54 A;  1STH A;  2UVW A;  3HOW G;  3NXW A;  3TII A;  5C44 B;  3N8D A;  4JUZ A;  1EY5 A;  3OW2 A;  4WOR A;  5JVG 3;  4K8I A;  4A3B H;  5DLF A;  4HJ8 A;  2BA0 A;  5DGA A;  5E3F A;  2ASD A;  1RIP A;  2F0T A;  5GAH C;  3K6O A;  1XPU A;  2AGQ A;  1JOQ A;  5J2T F;  2IL8 A;  1EFW A;  4C2M B;  1Y1W H;  1WCM H;  2AMC B;  3KF8 A;  4B08 A;  3S1Q B;  5DG8 A;  4DKA C;  1MHW C;  1WTV A;  4BY1 B;  4RAU C;  3NQI A;  4FVM A;  2EE1 A;  2HHH L;  1ZHS A;  4EBE A;  1KL9 A;  2C5C A;  4U68 A;  3BVG A;  1D5M C;  4DR5 Q;  5JUM A;  2E2H A;  3J80 c;  2RDJ A;  3NEL A;  4KJN A;  3CME A;  3ORQ A;  1PTO B;  1IKL A;  4HSP A;  4PWQ A;  2W6M A;  1Q8I A;  2JE6 I;  2W6Q A;  5J3B A;  3IL8 A;  4BXX H;  2XWB B;  2X0S A;  1H9K A;  2B2W C;  2JA5 A;  1TS4 A;  2RHS B;  2Y0S E;  3VPD A;  1L0Y B;  3AFP A;  4J1M A;  4XYL B;  5KRU A;  5KFX A;  3S15 H;  3PIP 3;  4R7R A;  1BBU A;  4HIM A;  4TVA B;  3GQB A;  1TXY A;  2GVA A;  3J80 W;  2OT2 A;  1JX4 A;  1CKN A;  1HZC A;  1DM0 B;  3L2P A;  4KD3 A;  2HHH Q;  4O3S A;  4ED2 A;  2RDG A;  1R4P B;  4RB0 A;  2XVS A;  2R93 A;  4MTK A;  2R7N A;  1PTO D;  1BOS A;  3H4D A;  2ZM6 L;  4BY7 B;  3G71 A;  1LLR D;  1Y1V H;  2QDL A;  1KDA A;  1XTC D;  1H9S A;  5M3F H;  1ONL A;  1RK6 A;  3GV8 B;  4JI2 L;  3J7Z C;  2YU9 B;  3SVM A;  5DG9 A;  4G7H C;  1TWC H;  2RDI A;  3BA8 A;  3IFD A;  4R4I A;  1QUQ B;  3UDG A;  3C3L A;  4A2B A;  4YBZ B;  4OGQ C;  2AGP A;  5I4D A;  4DL7 A;  2E2J B;  1EY6 A;  3NQT A;  3SK5 A;  5C0X G;  4YY3 L;  4ZHQ F;  2C28 A;  3RZD H;  1YNN D;  4BBR G;  1KTK A;  1UE6 A;  4PDB A;  5FLX L;  4WFN 3;  2B63 G;  1L1O C;  5C8Y F;  3C0F B;  2I87 A;  4P74 A;  2UU9 L;  4MN3 A;  2F03 A;  3GTL A;  2KCM A;  1E4E B;  3W1B A;  1KLU D;  2KVM A;  2K5N A;  2OF1 A;  1DJR D;  3S1N H;  4L5R C;  1TAE A;  2NZ1 D;  4QF4 A;  1GUT A;  1BCP B;  1S10 A;  4I7Z C;  3S16 B;  5CV8 A;  2W7O A;  4ECZ A;  1H95 A;  2PNR C;  3HRZ C;  1JWM D;  4XX0 B;  4YY3 Q;  4H44 C;  1PYB A;  4EVO A;  5M3M H;  2RBM A;  5LOV F;  1LV9 A;  1WJJ A;  3KF6 A;  4JBK A;  4CC6 A;  1XMQ L;  1QVG A;  1CZW A;  2IPK D;  4MTE A;  5HY6 A;  1E3P A;  1GUN A;  4APM A;  5FJ8 H;  3H15 A;  3GTO B;  1SN8 A;  4A76 A;  1G2T A;  5CV4 A;  1IHZ A;  4QIW E;  2K01 A;  1YIJ A;  4KN4 C;  1BCP D;  1T36 A;  5IYC H;  2LS0 1;  2UUA H;  4DNT B;  1SE2 A;  1C3O A;  5CV9 A;  1PH5 A;  3L7Z C;  1M4V A;  4TRD A;  2JA6 H;  5C5J A;  4DR1 L;  2W8K A;  3WOE A;  3T53 B;  1VQC A;  1PH2 A;  5IT9 E;  1H9M A;  4DK0 A;  5KFA A;  2D0O A;  2I5M X;  1SE4 A;  3STB C;  1GD7 A;  3PUV A;  4UY8 C;  4Q8F A;  2W9C A;  1K83 B;  4DV4 L;  2A6E D;  4YCU A;  4C3I H;  4HJA A;  3TRZ A;  1ILQ A;  5C0X J;  2YRW A;  3S1M B;  5LA6 F;  2PZW A;  1V8Q A;  3M7G A;  3F1Z A;  3KBG A;  4DL4 A;  5ISR A;  3MAQ A;  2JEA I;  3WO1 A;  3MR2 A;  2W8L A;  3KXY T;  4QL5 A;  4H02 A;  4J0M A;  1JR0 D;  4K6D A;  1LTL A;  3MHB A;  3K59 A;  3GTQ B;  1U4P A;  5LL6 S;  4YB8 B;  1Z2N X;  4DV1 H;  5IYD G;  1SYE A;  4R4C A;  3CC4 A;  2ZJT A;  3VR3 A;  1JE4 A;  3RAX A;  4DV4 Q;  1Q46 A;  2AQ3 B;  5EWF A;  3V4Z A;  3T4A C;  1N32 H;  3Q8D A;  5ELF A;  2HVS A;  2UVU A;  1PH1 A;  4K5W A;  4YR3 A;  4RGN A;  1M1K C;  1PMR A;  3TP6 A;  4LF7 H;  3G7L A;  1SEI A;  3MWM A;  1V9P A;  3H09 A;  3R5F A;  4OO1 I;  4R8N A;  4IUU A;  1EQT A;  5COR A;  1HFN A;  3R2I A;  5JEA J;  2VA3 A;  4L1K A;  2XSC A;  2ZDQ A;  2RGR A;  2W6Z A;  2A68 C;  1SXT A;  1L0X B;  3MJF A;  2N8N A;  3MR6 A;  2HDM A;  2UVR A;  4ZQ3 A;  2NZH A;  2OLS A;  2ALY B;  2XGT A;  1S72 A;  2BQR A;  4BA2 I;  2M9V A;  4JOI A;  3IAY A;  1IW7 D;  1MD2 D;  3ICE A;  3JAM E;  5JJZ A;  1ZYR C;  2BCO A;  5KFM A;  3BJU A;  3PQI A;  3BAB A;  4DL5 A;  2OCE A;  4ZLT F;  2BDN A;  2PQA B;  5KFV A;  2K14 A;  4LF6 H;  3PZP A;  4QCL A;  3S24 A;  4UP7 A;  5KT5 A;  4LMY A;  3HOZ H;  4PMC A;  3PIO 3;  2ZJP A;  4UCO A;  3A7L A;  3FKI G;  3R3O A;  2R93 B;  4FM9 A;  1YNX A;  4DR4 H;  2OXP A;  1EZ6 A;  3GTK H;  2FMA A;  4MA5 A;  2Q2H A;  4ZQI A;  1EWC A;  3SK8 A;  2R7Z H;  2PQE A;  3BDL A;  3NGD A;  3FHW A;  4GOP A;  5IWA H;  5FLX W;  1EFI D;  1SAP A;  2KEN A;  3P1H A;  5EWE A;  4NKL A;  1QNK A;  2MGS A;  2P0A A;  3H6M A;  1X32 A;  4B3S L;  2NVQ H;  2XNA C;  3NEM A;  4YWK A;  1EIY B;  1Z2O X;  2DIK A;  4M7E A;  3EA6 A;  1EYZ A;  2BA1 A;  1KJ9 A;  3H91 A;  5F9N A;  3G6V A;  1FGB D;  1R9T A;  4FBU A;  4KTA A;  2PMZ E;  5T14 A;  5IE8 A;  3O13 A;  5KT3 A;  5M5Y B;  4YJ3 F;  4EGJ A;  2Z4H A;  3GTO A;  1BDO A;  3J81 c;  3K5L A;  3S1R B;  4LF4 Q;  1GKH A;  1HA6 A;  1CSP A;  3TEH B;  3A54 A;  3BQ0 A;  2O03 A;  2G9D A;  2ALZ A;  1UC9 A;  4U6P A;  4IAL A;  4B3S Q;  4C5A A;  4DV0 Q;  4CGY B;  4FO2 A;  3NTI A;  2F3V A;  4HIO A;  3FMC A;  1FJG H;  1EY7 A;  3GIK A;  1YVC A;  1IOW A;  3I4N B;  4FS1 A;  2F0K A;  2JA7 H;  3CCM A;  2JJQ A;  3J7Y W;  3ETH A;  3ZJY C;  1ML0 D;  2W71 A;  1EOT A;  2DY7 A;  3RNU A;  4DK6 C;  4H13 C;  4QUC A;  1II3 A;  4ECU A;  2JA5 G;  5C3E G;  2K7V A;  3A8K E;  2UXC H;  1EZ1 A;  5C44 H;  1WI5 A;  4ED1 A;  4JI4 L;  3Q22 A; 
#chains in the Genus database with same CATH homology
 1A62 A;  2R6G A;  1IYJ B;  4DV7 L;  4HJ7 A;  3HOY G;  3GTG H;  4P73 A;  4FDB A;  4IFD J;  4LUZ A;  4L5S A;  3L0O A;  4DR4 Q;  3OTO L;  4P75 A;  3UE1 A;  4C2M H;  2NVY H;  1VQK A;  4OX9 Q;  3S1Q H;  4A3D H;  4JI7 Q;  2R92 H;  5JJI A;  1Y1V G;  5M3F G;  3T1Y Q;  2YV5 A;  4BY1 H;  1IXR A;  2E8G A;  1NY4 A;  2WB1 E;  3PUW A;  3KLW A;  4A3J H;  1XMO Q;  4JI0 L;  4JI6 L;  1PH8 A;  4B3M Q;  1VQM A;  4BBR H;  4UP8 A;  3CP0 A;  2CWP A;  3PO2 H;  5K36 G;  2B63 H;  2CKZ B;  1HNZ Q;  3CPW A;  2K52 A;  3BZK A;  4IPH A;  1XPO A;  2QA4 A;  3KDF B;  4NXN L;  4JI4 Q;  4HJ5 A;  2UXD Q;  1J6Q A;  4GN3 B;  4DV6 L;  1BKB A;  4DV7 Q;  4GNX C;  3F2C A;  1JJ2 A;  2KCT A;  1N9W A;  4IPC A;  5BR8 L;  4K0K Q;  4TQU S;  4LNQ A;  4MZ9 A;  1AE3 A;  3HKS A;  2UUA L;  3I4N G;  3A74 A;  1MJE A;  2ATW A;  3GTP H;  5LMN L;  3J81 j;  2L15 A;  4AQY L;  4NXM Q;  1W2B A;  4JI6 Q;  1DGS A;  4GNX B;  5C4X G;  4JI0 Q;  1NJI C;  2CQO A;  1FVI A;  2AWN A;  2EQS A;  1X9N A;  2IX0 A;  4B3T L;  1SMX A;  2K50 A;  1X3F A;  3CCQ A;  5C4J H;  2PQA A;  4DK3 C;  3U50 C;  2A19 A;  4BY7 H;  2AHO B;  2UXB L;  1Y14 B;  3JAM i;  4AH6 A;  3GTJ H;  4NXN Q;  1X65 A;  1E22 A;  4A75 A;  2R93 H;  3AYH B;  1PH9 A;  2YU9 H;  1BBW A;  1BVS A;  3GO5 A;  3KF8 B;  5M3M G;  5FLX c;  1FJG Q;  1KHI A;  4XIG S;  3NBH B;  1CKO A;  5BR8 Q;  4Y7N H;  4JI5 L;  3F2B A;  1QUQ A;  4YWM A;  4IPD A;  2R7D A;  5HGQ A;  3SGI A;  5FJ8 G;  1JT8 A;  1OXV A;  2KHJ A;  1EQR A;  1JJG A;  4R1J A;  5LMN Q;  2AKW B;  3CQZ H;  2K75 A;  3CCV A;  3KJP A;  4AQY Q;  1N36 Q;  3I4O A;  4GS3 A;  3I56 A;  1JE5 A;  4GKK Q;  4UPA A;  2HIV A;  2F52 A;  1NBW A;  3HOU G;  3RR5 A;  5IYC G;  4JBW A;  2NZO A;  4JYA Q;  1OXT A;  2YYZ A;  1TWH H;  1K73 C;  4JOI C;  5DLQ E;  3TRE A;  4B3T Q;  2JA6 G;  2UXC Q;  2MFI A;  3PCO B;  2UXB Q;  4X66 L;  2F4V Q;  2ZTD A;  4LF4 L;  3M4Q A;  5GAD C;  4A3C G;  2BH2 A;  4KHZ A;  2VS1 A;  1YEZ A;  3PIP A;  4R4Q A;  1L0W A;  3EN2 A;  3PSI A;  4JI8 Q;  3HFZ B;  3K8A A;  3KYH C;  4HIK A;  4LFC L;  4JI5 Q;  3KFU A;  1UEB A;  1Q1B A;  2K5V A;  4JI1 L;  4DV0 L;  4LF7 L;  1FGU A;  2B29 A;  5LMU Q;  1HZA A;  2QGQ A;  3BZC A;  1YJW A;  2VUM H;  2WAQ E;  4A3L G;  3PO3 H;  1I5F A;  3A5U A;  2A1A A;  2AWO A;  3F2D A;  4GOP C;  1VQG A;  4C3J H;  4DV5 L;  3CCE A;  3U58 A;  3PGZ A;  1YJ9 A;  3ULP A;  1YHA A;  1C0A A;  1UE1 A;  4LF5 L;  2ID0 A;  5IYD H;  1EOV A;  4LWC A;  3T1H Q;  2ES2 A;  5FLM G;  3GTO H;  4DR6 L;  4QY7 A;  3W5O A;  2IX1 A;  1A8V A;  1JJC B;  2IT1 A;  2LSS A;  4IO9 A;  4NB3 A;  1K9M C;  3PF4 A;  4OXP A;  5IYB G;  1VCI A;  2Y0S G;  1PYS B;  1CUK A;  4A3I G;  2ZM6 Q;  4IFD I;  4GOP B;  4JBJ A;  4AYB E;  2I5L X;  1H95 A;  4JI2 Q;  4JI1 Q;  3AFQ A;  3KOJ A;  4DR4 L;  5C0X I;  2JA8 H;  4PMW A;  1IZ6 A;  3UE0 A;  2OQ0 A;  4OX9 L;  3HOX H;  1PHJ A;  4C3H H;  3J81 i;  2WP8 J;  3HOV H;  5ELN A;  3H0G H;  3MEF A;  1RL2 A;  3GDE A;  3T1Y L;  3CXC A;  4DV5 Q;  1M90 C;  4A3M H;  1XMO L;  4B3M L;  3D31 A;  4LF5 Q;  1K83 H;  2RHQ B;  4A3F G;  4DR6 Q;  1SLJ A;  1XJV A;  1SFO H;  4OON A;  1KXL A;  1VQ5 A;  1HNZ L;  3M85 A;  3E0E A;  4JBM A;  1VQN A;  2H5X A;  2NVX H;  3RLO A;  2C35 B;  5GQO A;  1V1Q A;  4DAM A;  4BBS G;  3KJO A;  2UU9 Q;  5JEA G;  2UXD L;  2UUC L;  3PUX A;  3FKI H;  1A63 A;  1MKH A;  1SR3 A;  1PFS A;  1I3Q H;  2KBN A;  5EAY A;  4K0K L;  1VQI A;  3KF6 B;  2F3I A;  4IJH A;  1HR0 Q;  1YZ6 A;  5JJL A;  1ASZ A;  4A3G G;  4GLA C;  4X65 L;  1Q7Y C;  3GTQ H;  3ERS X;  4NXM L;  3HOZ G;  3KDF A;  4LUV A;  5GAE C;  2ZTE A;  1VQ6 A;  3M4P A;  3PUZ A;  3RN5 A;  2GN5 A;  3CPF A;  4AYB G;  1WYD A;  1X55 A;  2QEX A;  3G48 A;  1YHQ A;  3I4M G;  4QGU A;  3FP9 A;  3K7A H;  1GVP A;  2DGY A;  1X3E A;  3K7U C;  4YCV A;  1CKM A;  3B6Y A;  1HZ9 A;  4B3R L;  3UDX A;  1XMQ Q;  1JB7 A;  2R7Z G;  1P16 A;  1L2F A;  1Z9F A;  5IP7 H;  1GO3 E;  2UUC Q;  4DR5 L;  1X54 A;  4JI3 Q;  2IY5 B;  1OXU A;  1X6O A;  4EX5 A;  3HOW G;  1SRO A;  4P72 A;  1FJG L;  4LF9 L;  4YHH Q;  1CSQ A;  5AJ3 L;  2RF4 A;  3CAM A;  4MTN A;  3ULJ A;  3OW2 A;  1UE7 A;  1FL0 A;  1K0R A;  4HJ9 A;  2KHI A;  2BA0 A;  4HJ8 A;  4A3B H;  3CCL A;  3ULL A;  2NVT H;  4GN4 B;  4DR1 Q;  1MJC A;  4X65 Q;  1N36 L;  2MO1 A;  1RIP A;  5GAH C;  4RG1 A;  1XPU A;  4KLK A;  1N34 L;  1VQB A;  4A3K H;  1EFW A;  4GKK L;  2OWO A;  1Y1W H;  1WCM H;  2AMC B;  3CW2 C;  1KD1 C;  4DKA C;  2MO0 A;  2UXC L;  4A93 G;  5M5W H;  2MQH A;  3K80 C;  1VQE A;  1E24 A;  1I94 L;  4B3R Q;  2FXQ A;  2HHH L;  2F4V L;  1KL9 A;  4PZ7 A;  4DR5 Q;  1C7Y A;  2E2H H;  1IBM L;  3K0X A;  3S14 H;  3J80 c;  3BU2 A;  3NEL A;  3CME A;  1HNW Q;  4JI8 L;  1SRU A;  4JC0 A;  4LF9 Q;  5IP9 H;  5AJ3 Q;  1NTG A;  1EWI A;  2JE6 I;  5LMU L;  1VQL A;  1VQ7 A;  1KRS A;  5J3B A;  4A4I A;  2UUB Q;  4JV5 L;  4WJ3 M;  5GRO A;  4POF A;  2VW9 A;  4BXX H;  1NE3 A;  2JA5 H;  1LM0 A;  2RHS B;  5C3E H;  3DLL A;  2Y0S E;  1N34 Q;  1D8L A;  3JC6 6;  2K5H A;  4J15 A;  4OWT B;  3AFP A;  3WWV A;  4DR3 Q;  1D7Q A;  1XPR A;  2Z6K A;  2JA7 G;  1VQ9 A;  3GD7 A;  3PF5 A;  3S15 H;  2YTX A;  1BBU A;  3CCR A;  4TVA B;  4HIM A;  1C9O A;  3HOY H;  1TXY A;  3T1H L;  2GVA A;  1I94 Q;  2Z0S A;  1CKN A;  1HZC A;  4DAY B;  3UDI A;  3L2P A;  2E2I H;  2HHH Q;  2HT1 A;  3AEV A;  1G6P A;  3LGJ A;  3H3V H;  5ELO A;  1IBM Q;  4A3E G;  1V43 A;  1VQO A;  5C44 G;  2ZM6 L;  4OWW B;  3G71 A;  1Y1V H;  5M3F H;  4IOC A;  2VQE L;  4X6A H;  4JI2 L;  1IBK L;  3J7Z C;  5M5Y H;  3M3Y H;  3EBE A;  1TWC H;  4JV5 Q;  1TWF H;  2XTI A;  4P71 A;  1UWV A;  4R4I A;  3OYY A;  3S1R H;  1QUQ B;  2IHE A;  1K8G A;  3UDG A;  4IFD G;  1N33 L;  5JJK A;  2VQF Q;  4A3D G;  3PIO A;  2VZA A;  1VQJ A;  3A5Z B;  2R92 G;  2ZJQ A;  3I7F A;  4BY1 G;  4DR7 L;  3CCJ A;  1YIT A;  5C0X G;  1S3O A;  4YY3 L;  4A3J G;  2DUD A;  2V1C C;  3E9H A;  1QVC A;  3RZD H;  4AIM A;  1Q81 C;  4BBR G;  1PH3 A;  3PO2 G;  1UE6 A;  2CWA A;  5IY0 A;  1Q12 A;  3AQQ A;  1L1O C;  2B63 G;  1VQF A;  3ER0 A;  2I5H A;  4P74 A;  3K81 C;  2UU9 L;  3I4N H;  2KCM A;  3GTL H;  3W1B A;  1Q86 C;  2VQE Q;  1IBK Q;  2K5N A;  5C4X H;  1NMG A;  4APV A;  3S1N H;  1VQA A;  1X56 A;  4L5R C;  1N8R C;  1HR0 L;  4O0A A;  1L1O B;  3EIV A;  1N33 Q;  3VDY A;  4RMF A;  3S2D H;  2NN6 G;  2YTY A;  4O2D A;  1VQP A;  2K4K A;  4XTC S;  1MIU A;  1K8A C;  1NMF A;  1JMC A;  4DR7 Q;  1E7Z A;  2N49 A;  4R4O A;  4YY3 Q;  1XNQ Q;  1PYB A;  1Z47 A;  4X62 L;  5M3M H;  2OTL A;  4LUO A;  1WJJ A;  2D0P A;  2D62 A;  3KF6 A;  3RN2 A;  4JBK A;  1N32 Q;  1XMQ L;  1LUZ A;  1QVG A;  3I2Z A;  5HY6 A;  1E3P A;  5H1S E;  4BY7 G;  4JI3 L;  5FJ8 H;  3H15 A;  1B8A A;  1SN8 A;  4A76 A;  3TS0 A;  4LFA L;  1E1T A;  4QIW E;  2MNA A;  1YIJ A;  2NN6 I;  2R93 G;  1K3R A;  4YHH L;  3HOU H;  1I50 H;  5IYC H;  2PNH A;  4JG2 A;  3L7Z C;  1PH5 A;  1QVF A;  2JA6 H;  4DR1 L;  1G51 A;  4R4T A;  4LFB Q;  1VQC A;  1PH2 A;  1VQ4 A;  1B7Y B;  1XTD A;  4A3C H;  2PI2 E;  1WOC A;  1U5K A;  2BH8 A;  2IHF A;  3U4V A;  2D0O A;  3UDF A;  4X62 Q;  3G6E A;  2I5M X;  1PV4 A;  3STB C;  1J5E L;  1GD7 A;  1TWG H;  3PUV A;  2CCZ A;  4UY8 C;  4GLV B;  4ALP A;  2Q2I A;  4GLX A;  4DV4 L;  1G29 1;  1PH6 A;  1VQD A;  4LFA Q;  1OXS C;  1X3G A;  4YCU A;  4C3I H;  4HJA A;  1HZB A;  4GNX A;  1TWA H;  3TRZ A;  3PUY A;  4A3L H;  1HNW L;  5C0X J;  4DV2 L;  2YTV A;  3W1G A;  5LMN W;  4DUY Q;  1VQ8 A;  3F1Z A;  4QQB X;  3IRB A;  3RLN A;  2UUB L;  5IWA Q;  1Q1E A;  2I0Q A;  1HJP A;  2JEA I;  4GKJ Q;  5FLM H;  2VUM G;  5GAG C;  4QL5 A;  4PG3 A;  4H02 A;  5E7N A;  4DR3 L;  1OTC A;  3PO3 G;  1KC8 C;  3M9B A;  5IYB H;  1LTL A;  3H3V I;  3CCU A;  2JK8 A;  4A3I H;  1W3S A;  1J5E Q;  4OO1 G;  4DUZ L;  5IYD G;  3CC7 A;  1PVO A;  4R4C A;  1HH2 P;  3CC4 A;  2VY3 A;  1U0L A;  1IL2 A;  4DV3 L;  4DV4 Q;  1Q82 C;  1Q46 A;  1VQH A;  3OTO Q;  1OXX K;  3JAM c;  3I55 A;  3Q8D A;  2E5L L;  4MNO A;  3STB D;  1PH1 A;  1EYG A;  1HNX L;  4DV2 Q;  3U4Z A;  1EQQ A;  1UE5 A;  1M1K C;  5M5X H;  2HIX A;  4L5T A;  1V9P A;  1B70 B;  4OO1 I;  4A3F H;  2JA8 G;  2N78 A;  1O7I A;  5JEA J;  3HOX G;  2VQF L;  4LW1 A;  1VS0 A;  3CCS A;  1XNR L;  3HOV G;  2N8N A;  4BBS H;  3H0G G;  2NZH A;  3CMA A;  2ALY B;  2XGT A;  3HKZ E;  1S72 A;  3J80 i;  1KQS A;  4A3M G;  4BA2 I;  4JOI A;  4DUZ Q;  2B3G A;  3ICE A;  4DV6 Q;  3RZO H;  2WB1 G;  4LF8 L;  4DV3 Q;  3BJU A;  3TS2 A;  2A8V A;  4WJ4 A;  2OCE A;  2PQA B;  1KAW A;  2K14 A;  2LXJ A;  2E5L Q;  3S24 A;  2UUA Q;  1E1O A;  4A3G H;  2LXK A;  2EIF A;  4UP7 A;  1P8L A;  1QZG A;  2HQL A;  4L5Q A;  1HNX Q;  1ASY A;  2ZJP A;  2E2J H;  3HOZ H;  3CC2 A;  3FKI G;  1YNX A;  3CF5 A;  2Z6K C;  3I4M H;  4YCW A;  3GTK H;  2Q2H A;  4KI0 A;  4DPG A;  2JA9 A;  4OWX B;  2R7Z H;  2ZJR A;  1XNR Q;  3DM3 A;  4NPS A;  4DV1 L;  3GTM H;  1AE2 A;  3FHW A;  1YHB A;  4GOP A;  4JYA L;  1I6H H;  1AH9 A;  1SE8 A;  2GVB A;  4DR2 L;  1XNQ L;  2KEN A;  1EIF A;  4POG A;  3M7N A;  3HOW H;  4ME3 A;  4YWL A;  3TQY A;  4IPG A;  2R7F A;  4UP9 A;  1YJN A;  4LF8 Q;  1N32 L;  3J7A 5;  1IBL L;  2OQK A;  1L1O A;  1PA6 A;  4B3S L;  2NVQ H;  3NEM A;  4YWK A;  1EIY B;  4Y52 H;  1CKN B;  4X64 L;  5IP7 G;  2BA1 A;  2N3S A;  3NEN A;  3S16 H;  2JEB I;  1HR0 W;  3HKZ G;  1T9H A;  3S17 H;  2Q2T A;  1R9T H;  1YBY A;  2PMZ E;  3CD6 A;  5IE8 A;  4KHP L;  1QZH A;  3MXN B;  4A93 H;  4GN5 A;  4PZ6 A;  4A3B G;  4IOA A;  4LFB L;  1S40 A;  4DV1 Q;  3J81 c;  4X66 Q;  4A3K G;  4DR2 Q;  4LF4 Q;  1EUJ A;  1GKH A;  2WFW A;  1CSP A;  3TEH B;  1WCM G;  1Y1W G;  3S2H H;  2ZTC A;  5IT9 c;  2PI2 A;  4BA1 I;  4LF6 L;  3D0F A;  1IBL Q;  3M4O H;  4JCV E;  4LFC Q;  4DNI A;  4B3S Q;  2Q2U A;  1Q8K A;  1YI2 A;  4DV0 Q;  4LF7 Q;  3RLF A;  4X64 Q;  4HIO A;  4PZ8 A;  1KRT A;  3PV0 A;  1YVC A;  3E9I A;  2VL6 A;  4DUY L;  2EXD A;  4JI7 L;  2JA7 H;  2RCN A;  3CCM A;  5IP9 G;  1GM5 A;  2JJQ A;  4KHP Q;  3ZJY C;  2VNU D;  4EQ5 A;  5IWA L;  3G4S A;  3RNU A;  4GKJ L;  4DK6 C;  1PH4 A;  1WFQ A;  2JQO A;  3F8T A;  4BXX G;  1KIX A;  1A0I A;  2JA5 G;  4HID A;  5C3E G;  4IJL A;  4QJF A;  2OTJ A;  4A3E H;  1PH7 A;  3A0J A;  2WAQ G;  5C44 H;  1WI5 A;  3S1M H;  4JI4 L;  2CFM A;  1LYL A;  4LF6 Q;  2ASB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...