1Y1VG

Refined rna polymerase ii-tfiis complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase II largest subunit
publication title Complete RNA polymerase II elongation complex structure and its interactions with NTP and TFIIS.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/transcription
total genus 23
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2004-11-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1y1vG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 1y1vG01
4H02A 1QUQA 1EUJA 1N34L 4HIKA 4A3EG 4R4OA 4L5QA 5K36G 3F8TA 4O2DA 2WB1G 3DLLA 1PH8A 1SMXA 1OTCA 3CC2A 4DUZQ 2QEXA 1C7YA 2IY5B 3J80i 2HHHQ 4BY1G 2F4VQ 3A5UA 1KAWA 1CUKA 4X64Q 1N32L 3CXCA 2D0OA 2ALYB 1Q1EA 2JEBI 1VQPA 4Y7NH 2UUBL 5LMNW 4BBSH 3T1HL 1OXSC 4GKJL 3KYHC 3OYYA 1M1KC 3CMEA 2LXKA 4JI5L 1XMQL 3I2ZA 2KENA 3PUZA 1GKHA 4JG2A 4KLKA 1KRTA 4DR4L 4A3GH 2CCZA 4WJ3M 1X9NA 4R4IA 2ZJQA 4LF8Q 3W1GA 5BR8L 4A3LH 2CQOA 2Y0SE 4DV1Q 4KI0A 3A5ZB 1IXRA 5C3EG 5GQOA 3S1QH 2Q2TA 4GN4B 4DK3C 3M4QA 2QGQA 1EIFA 2B3GA 4A3MH 4OX9Q 3AYHB 2GVBA 4A76A 3CCUA 4IPCA 1HH2P 4RG1A 5IYBG 4DR5L 2GN5A 4JBMA 2MFIA 3HOYG 5AJ3L 1E1OA 1KRSA 3AQQA 4A3EH 5M5WH 1K9MC 2E2JH 5JJIA 2IT1A 1MKHA 1PYSB 4DV7L 1IBMQ 1V1QA 3I56A 1N8RC 3K7UC 2NN6I 4BA1I 5IP7H 3AFPA 3MXNB 4HIMA 2MQHA 2OWOA 1YIJA 3KJOA 4QJFA 3I4MG 3GD7A 4POFA 1HZAA 4JI1Q 3STBC 1CSPA 1FGUA 3L7ZC 4LUOA 2VQFQ 3ULJA 1BVSA 4DR3Q 4KHPL 4DV0L 4KHZA 4BBRG 5JJLA 3S15H 4X62Q 1B70B 2UXDQ 3K80C 5J3BA 3U4VA 3J81i 4AQYL 1DGSA 5C3EH 5FLMG 4WJ4A 3ULPA 4LF5L 1MJEA 1D8LA 3NELA 2PQAA 5M5XH 4A3IH 4QQBX 1Q7YC 3I4NH 3EIVA 1HR0L 1KL9A 2YV5A 2WFWA 2VL6A 3CPWA 3RN2A 3HOWH 3JAMc 1SE8A 1UEBA 4P72A 3OTOL 2UUBQ 1XNQQ 5M3FG 2ZTDA 3K7AH 2WP8J 5ELOA 5IYBH 1PYBA 3HOYH 1X55A 4OXPA 1G6PA 1XPOA 2Z0SA 3NENA 3HOVG 4P75A 1T9HA 5LMUL 4IFDI 1RL2A 2K52A 4LFCL 4DK6C 2JA6H 2R92H 4OWTB 2KHJA 4LF6Q 1P16A 1VQ7A 3GTJH 2AWOA 1WCMG 3GDEA 1ASZA 3PO2H 2IHFA 1O7IA 1HNWL 3CPFA 4B3RQ 2VQEQ 1VCIA 4FDBA 4TVAB 3A74A 3I4MH 1FVIA 4YWKA 2BA1A 2Q2IA 2UUAQ 2VY3A 2B63G 4LNQA 1IBKL 5E7NA 2JEAI 1AE3A 4GKKQ 3EN2A 3KLWA 4AH6A 3RNUA 1VQOA 2Q2UA 4DV3L 4AIMA 5IYCG 3AEVA 3RLFA 4IPDA 1NJIC 4A3JG 1SLJA 2FXQA 1LUZA 3K0XA 1IL2A 2AHOB 3KFUA 2JA8H 3L2PA 1WOCA 3DM3A 2ZJRA 4LUVA 4OO1I 2R7DA 1CSQA 1OXVA 1A0IA 1N36L 3CCQA 4P71A 1EQQA 2PI2A 4BA2I 4DR1Q 1N33L 1V43A 2BH8A 2F52A 1WYDA 4GS3A 4POGA 4P74A 4IO9A 4UPAA 1G51A 4JI7L 3S14H 3RN5A 1BBWA 2UU9L 4JI8Q 2HQLA 4DUYL 5GAHC 4EX5A 5M3MH 2JJQA 3GTQH 1HZ9A 3CAMA 1VQEA 2YTYA 4IOCA 2E5LQ 1NTGA 4QGUA 3PUYA 1MJCA 1JJ2A 1FJGQ 3GTMH 1JE5A 2QA4A 1YHBA 2EQSA 2R7FA 2YU9H 1A8VA 2NVYH 4LF4Q 2KBNA 2KCTA 5IWAL 1Q82C 4DPGA 4DR2L 4JV5L 5H1SE 4NXNQ 5IYCH 4GLXA 4A3MG 1XMOQ 1SN8A 2K14A 3OW2A 3KJPA 3L0OA 4YCWA 4A3JH 4O0AA 1QVCA 1Z9FA 2OCEA 4YY3L 3S17H 1W3SA 5IY0A 1VQLA 1HNZQ 1IBLL 3KDFB 3RLOA 1E3PA 4DV6Q 3H3VI 3KF8B 4LFBL 2EXDA 3S24A 4DV5L 1EFWA 2JA5H 3CF5A 3GO5A 4DV4Q 2DGYA 1J5EQ 1G291 1XTDA 5IP7G 4UP8A 1B8AA 3KF6B 5M5YH 1YI2A 4K0KL 3BU2A 4JI0Q 1YVCA 4OO1G 1YZ6A 4PZ7A 1VQKA 4QL5A 4X65L 4HJ5A 1ASYA 4JI2Q 2NZOA 3G6EA 1Y14B 3F2BA 2C35B 2OQKA 4PMWA 1XPUA 4GOPA 2BA0A 2UXBL 4LFAQ 1E22A 3F2DA 1XNRL 3E9IA 1WI5A 3CMAA 3ULLA 3T1YL 2MO0A 1I94L 2JQOA 4PZ8A 1PFSA 4A3IG 4L5SA 3I4NG 5IT9c 1EQRA 4B3ML 1PVOA 1GM5A 2VUMH 3SGIA 1E7ZA 1JB7A 2JA9A 3HOWG 1B7YB 1PH6A 4GLVB 4OWXB 4C2MH 4DR7Q 3J80c 4UP7A 1OXUA 1SROA 3UDGA 2UUCL 3PF5A 4B3TQ 4APVA 2JA7H 1Z47A 1PA6A 3CC7A 2JA6G 2R92G 4HJAA 1I3QH 3S2HH 4GN5A 1K0RA 3PF4A 3B6YA 2K5NA 2RHQB 2RF4A 3RZDH 3E0EA 3M4PA 2HIXA 3UDFA 3A0JA 4A3DH 3S1MH 4JYAQ 1S40A 2K5HA 3PO2G 4X6AH 1Y1VH 1CKMA 2YYZA 1OXTA 3PGZA 3PSIA 4LF7L 1C0AA 1JMCA 3PCOB 2VNUD 1X3FA 4JI3Q 2ZM6Q 4DV2Q 2NZHA 2VS1A 1EYGA 4JI4L 1L2FA 4UP9A 4C3HH 5LMNL 1AE2A 4X66L 1X56A 4YHHQ 4BXXH 1VQBA 1N34Q 1EWIA 3M7NA 5GAEC 2MNAA 2Y0SG 2YTXA 3CD6A 4DR6L 4LUZA 4AYBE 1UE1A 3JC66 3I4OA 3JAMi 2JA8G 1GO3E 1YNXA 1BBUA 3H15A 1VQNA 1E24A 1N32Q 1K73C 3FKIH 4R4TA 3S16H 1PH2A 1VQCA 3T1HQ 3AFQA 4IJHA 4GKJQ 3S1RH 4JI5Q 1XMQQ 4PG3A 4ME3A 3CCRA 1K3RA 4DR4Q 5JEAJ 3BZCA 5IE8A 2N8NA 2UXCL 4NXML 5BR8Q 1GVPA 1PH4A 3ICEA 1K83H 3NBHB 5M3MG 4JI6L 3U50C 2N3SA 3LGJA 1PH7A 4JBWA 2LSSA 1HNXL 1J6QA 2K75A 3RZOH 3J81c 3H3VH 3FHWA 2K5VA 2E2HH 2N78A 1PH9A 3FP9A 4DR5Q 2NVXH 2NN6G 5AJ3Q 4TQUS 1NE3A 1YJNA 4BY7G 1SFOH 1HZCA 3BZKA 2A1AA 2RHSB 1YHQA 2EIFA 4C3IH 3KDFA 3TRZA 3G4SA 2CWPA 3U4ZA 4DV7Q 4HJ8A 2N49A 1WFQA 3W1BA 1S3OA 4AYBG 2IHEA 2R7ZG 3H0GH 1M90C 3GTGH 2JA5G 2D0PA 1LTLA 5ELNA 4DUZL 3D31A 2HHHL 2F4VL 1UWVA 4X64L 4KHPQ 1A62A 3IRBA 3PUWA 4DV0Q 3CCJA 2AWNA 1RIPA 1XPRA 1Q1BA 4AQYQ 1LM0A 1NMGA 3K81C 5HGQA 4GNXB 2KCMA 4UY8C 1Q12A 2KHIA 4LF5Q 4A3BH 5EAYA 5IYDG 4LF8L 1HR0Q 4IFDG 4JOIC 3PUVA 5C0XJ 4DV1L 4GNXC 2WB1E 3OTOQ 4HIOA 2ATWA 2I0QA 4OONA 2OTJA 4L5RC 1PHJA 1EOVA 4A93H 3RR5A 1E1TA 1PH3A 4YCVA 4A3FH 4JBJA 4BY7H 1VQIA 4J15A 4A75A 2VUMG 3S2DH 1YITA 5LMUQ 4OX9L 4HIDA 1L0WA 2MO1A 1V9PA 4LFCQ 3E9HA 3ERSX 3PO3G 4P73A 3WWVA 1KXLA 2ZTEA 1VQAA 4GN3B 3ZJYC 2R7ZH 3M3YH 4IOAA 2JA7G 4MTNA 1JT8A 1HNWQ 4R1JA 3M4OH 4A3CH 1C9OA 2CFMA 1VS0A 3CCMA 3BJUA 1U0LA 2PNHA 1IBML 1CKNB 2DUDA 4LF9L 1VQGA 5C4JH 1IBKQ 1I50H 4A3DG 1VQMA 5GROA 4HJ9A 1Y1VG 4NPSA 1VQ4A 4DV3Q 1Y1WH 1QZHA 5IP9G 3TS0A 3HOUH 2A19A 1YJWA 3GTPH 1TWHH 2Z6KC 1YBYA 4JI1L 1NMFA 1SR3A 3GTKH 5IYDH 1UE6A 3STBD 4BXXG 1MIUA 4DR3L 4GLAC 5C44H 1N36Q 4QY7A 1CKOA 4X62L 3M85A 1W2BA 2UXDL 2YTVA 4IJLA 5FJ8H 2IX1A 1N33Q 1VQFA 1TWFH 2E8GA 3HOXH 2R93G 3HKZE 2VW9A 2E2IH 1GD7A 3FKIG 1HJPA 4JI7Q 1VQDA 2UU9Q 3PO3H 4DUYQ 1KC8C 1JJCB 2PMZE 1XNQL 2B29A 2HT1A 1R9TH 4A3KH 3J81j 3F2CA 3HFZB 3G48A 3RLNA 3HOZH 1VQ8A 4LF6L 3TQYA 3GTOH 3KOJA 1HR0W 2HIVA 2NVQH 5IWAQ 3VDYA 5DLQE 4DR2Q 4JV5Q 5IP9H 3PIOA 2ZJPA 2VQEL 1KD1C 2BH2A 4B3RL 2ID0A 1H95A 1L1OB 4EQ5A 4B3SL 3UE1A 2XGTA 1TXYA 1X3GA 4YY3Q 2UUAL 3CCEA 1KQSA 4GKKL 1X54A 1TWGH 2AKWB 3EBEA 3U58A 3UE0A 3PV0A 5C4XG 1IBLQ 3CC4A 4OWWB 4MNOA 4MZ9A 3CCLA 1L1OC 1YEZA 4LFBQ 2CKZB 3TEHB 4DV5Q 2ASBA 1Q8KA 1D7QA 1QUQB 1I5FA 3G71A 4Y52H 2I5LX 1QVFA 1VQ9A 4LF9Q 2R93H 2A8VA 4BY1H 3H0GG 3NEMA 4K0KQ 3HKZG 3I7FA 4R4CA 2H5XA 4LW1A 5JEAG 4DR1L 4X65Q 5C0XI 1HZBA 1X6OA 1X65A 1UE5A 1SRUA 3D0FA 4JOIA 3J7ZC 4ALPA 2R6GA 4GNXA 2UXBQ 4JI8L 1N9WA 1XNRQ 4YCUA 1Q81C 3T1YQ 4GOPB 1I94Q 4HJ7A 4A3BG 3CP0A 2E5LL 4B3MQ 1FJGL 5JJKA 1A63A 3CCSA 3TREA 4GOPC 4JC0A 1TWCH 4LF4L 5FLXc 4NB3A 1K8AC 2UUCQ 1NBWA 4A93G 5C4XH 4A3FG 4NXNL 2WAQE 3W5OA 1XMOL 3UDIA 2OQ0A 1IYJB 2I5HA 1PH1A 1HNZL 2Z6KA 1VQ6A 1CKNA 1XJVA 4DV6L 1KIXA 3KF6A 4LF7Q 4A3CG 3GTLH 3TS2A 4PZ6A 4JBKA 2AMCB 4DV4L 1FL0A 4YWLA 1VQJA 2IX0A 4DNIA 1QVGA 1J5EL 2K50A 4QIWE 4DAYB 4L5TA 4B3SQ 1WJJA 4JI4Q 2F3IA 3ER0A 5LMNQ 4DAMA 3Q8DA 4XTCS 1OXXK 2I5MX 4X66Q 1Y1WG 4JI0L 3HOUG 1AH9A 4BBRH 1KHIA 2OTLA 1PV4A 1X3EA 2L15A 4LWCA 4JCVE 4DR6Q 1IZ6A 2D62A 2CWAA 4IPGA 4RMFA 5FLMH 4JI2L 1NY4A 2JE6I 3J7A5 5C0XG 3MEFA 1VQHA 2K4KA 3UDXA 4LFAL 1I6HH 5C44G 1YJ9A 1LYLA 1P8LA 1Q86C 5HY6A 5FJ8G 4YWMA 2PQAB 2LXJA 5GAGC 5M3FH 1UE7A 1BKBA 2XTIA 3CQZH 3HOXG 2JK8A 1S72A 4IPHA 2ZTCA 3HOVH 1TWAH 5GADC 2WAQG 4DKAC 3I55A 1VQ5A 2UXCQ 2PI2E 4NXMQ 4DR7L 1QZGA 3PIPA 4BBSG 4JI6Q 2VZAA 4B3TL 4A3KG 3PUXA 4A3GG 1WCMH 3F1ZA 1JJGA 1HNXQ 1YHAA 3HOZG 2V1CC 1U5KA 3K8AA 4A3LG 2Q2HA 2ES2A 2B63H 3CW2C 4R4QA 4JYAL 1L1OA 3CCVA 4IFDJ 4XIGS 3S1NH 1K8GA 4A4IA 1EIYB 4JI3L 2RCNA 2ZM6L 4DV2L 1PH5A 2NVTH 3M9BA 4C3JH 3HKSA 2VQFL 1Q46A 2GVAA 4YHHL
chains in the Genus database with same CATH superfamily
3NUCA 1I3QB 1SE4A 3K0YA 2F1MA 2RKSA 2LS01 4PQXA 1PH8A 4O2DA 1X3PA 1OTCA 2VUGA 1EQTA 3FPPA 5KG6A 4XQQA 1KAWA 4HSVA 4F4XA 1F77A 1F9SA 4I55F 2ALYB 2JEBI 1WTRA 2UUBL 4IRCA 1RTNA 4GKJL 2LXKA 3I2ZA 4HR7B 3Q23A 4A3GH 4O3NA 2FMCA 2XN9C 1X9NA 1WTVA 4RNMA 4AQYH 4A3LH 2CQOA 2FK2A 1HPCA 2E5LH 1IXRA 3S1QH 4KMUC 3FKIB 3TP5A 4R9WA 4XT3B 4G57A 2YYAA 2DY7A 4OX9Q 3T53B 3AYHB 3S1RB 3P1HA 2GVBA 1DD2A 3CCUA 4IPCA 1HH2P 4RG1A 4NXNH 3MZ5A 2GN5A 3HOYG 3TP6A 3AQQA 1GUTA 2IT1A 1K1QA 1MKHA 4DV7L 2EZVA 5KFCA 1ZQ7A 3I56A 4DV6H 2B63A 2C00A 2NN6I 1VAJA 3RZOB 2SCUB 2BQRA 2OWOA 1AN8A 4H44C 4MV8A 2KVMA 4DV4H 1UNSA 1B3AA 3GD7A 4KY5A 4POFA 3STBC 1CSPA 4RB2C 4XYLB 5D1PA 1BVSA 4DR3Q 1MD2D 3BVMA 5CBAE 4ECZA 4X62Q 3SEBA 2UXDQ 3U4VA 5C3EH 4LFAH 4XDXA 4WJ4A 4QQBX 3RJ0A 2SNMA 1TT2A 5BPHA 1Q7YC 4K14A 1DOLA 3OIPA 1KL9A 2YV5A 2WFWA 3HOWH 3RN2A 2UUBQ 1ESFA 5M3FG 2WP8J 4IUUA 5KFNA 1SXTA 1XPOA 1FYCA 1D2BA 5EPJA 4P75A 1G6PA 2UU9H 3BDOA 1X3QA 5HURA 4LF6Q 2KHJA 3FMCA 1NCVA 1EY8A 1D1IA 3OWEB 4A3BB 4TRDA 3GDEA 3CPFA 1UC9A 1JIHA 4FDBA 3I4MH 1FVIA 3QZ7A 2Q2IA 2Z8LA 2EYJA 1IBKL 5E7NA 2JEAI 1Z2NX 3RTXA 4Q44A 3RNUA 1L0XB 4DV3L 2JA7A 4AIMA 4O3QA 2O03A 2GPWA 1U4MA 3MFHA 1I3QA 1SLJA 4C3JG 4LAAA 1IL2A 5E4XA 1WOCA 4XX0B 2R7DA 1PRTD 4WORA 3ND8A 2F0TA 4N9TA 2R3ZA 4F7XA 5EKLA 4CKEA 1I50B 1V43A 2F52A 5CMDA 1Y1WB 4GS3A 3HOUB 1QE6A 1B9NA 4UPAA 3NK9A 5EJWA 3RN5A 4HR7A 1U4RA 4DUYL 1XMQH 1ENFA 1XWEA 1SNCA 4EX5A 1I4XA 1HZ9A 1ENAA 2EE1A 1XNRH 4QGUA 5D14A 2PZWA 4ULLA 2R85A 2RCFA 3CRLC 2SEBD 3CRKC 2EQSA 1JR0D 2PN1A 5J2TF 2KBNA 2KCTA 5CV9A 1Q82C 3VR2A 2NN6H 2MP1A 4XQNA 2JN4A 2JA6A 1SN8A 2K14A 1CQIB 3L0OA 4O0AA 3NE5B 4RAUC 1R9TB 1M6VA 3S17H 2A5HA 1YNJC 5KEEA 3C0FB 1V4YA 2SNSA 2C28A 4LFBL 2EXDA 4JV0A 1RCVD 1CFMA 3V96A 4H7BA 5C6AA 2NVQB 1J5EQ 4F4ZA 5CBEE 4L1KA 3NBIA 2XRQD 5A2QE 4XQJA 1YVCA 3MFGA 5CORA 2RDHA 4O3SA 4HJ5A 2Y0SA 1TWGB 3GILA 4Q0YA 1K3BC 3OMCA 4ED3A 4JI2Q 1Y14B 1R4PB 2OQKA 4DV0H 2WKCA 3VR5A 2UXBL 4O4IF 2UVVA 1E2WA 4DR6H 3T1YL 2J7ZA 2JQOA 4E6IA 4BY1B 1HR0H 1CQFA 4K5WA 4ODGA 4C1NK 3NPPA 3SGIA 3HOWG 5EPKA 1VF5C 1QWYA 5CV5A 2B2WA 3OIQA 5IT9L 4ED8A 1VDZA 1SROA 3GV5B 4I7AA 4APVA 4YP3A 2JA7H 5IIFA 3BDLA 1Z47A 4KN7C 1FGBD 3I91A 4ZKBB 1I3QH 3FEWX 1S5FD 3A7AB 4C1NI 5BN3A 2K5NA 2FHTA 1HNWH 2HIXA 4KD4A 4TUYF 3TP8A 3MR2A 1WR2A 2N88A 2K5HA 3N6RA 4DAYA 3N6XA 4HQ6A 3G6VA 4J9MA 1C0AA 1TWCB 1X3FA 1ENCA 4DV2Q 1L2FA 2SDFA 1M0TA 1DV2A 2JEGA 3T56B 4RFBA 4LUZA 2XCAA 2Q8IB 5KFBA 1YNXA 3H15A 1VQNA 3GTLB 1E24A 5JJZA 1N32Q 1RYRA 3FKIH 2PVPA 3S9WA 4R4TA 3ETJA 1PH2A 1VQCA 3KLRA 3WNZA 3S1RH 4JI5Q 4DNRB 1TR5A 4TQRA 3A56A 2F0UA 4BBRB 3BZCA 4CJ0B 3OUZA 2UXCL 3L4KA 2K32A 5BR8Q 1PH4A 3ICEA 3NBHB 2IPKD 2MHVA 3U50C 4S3SA 1AP0A 4JBWA 5KYIA 1I4QA 2FMMA 2LSSA 3AU7A 1EZ6A 4HTHA 3KXYT 3RZOH 2KUMA 4TSSA 4L6TB 4UFZA 1I7LA 4C2MA 4ZCKA 4CGYB 1HUMA 2F0SA 2G5DA 1STGA 4DR2H 3FP9A 3HOVB 2V4QA 1R9TA 2YZNA 2NN6G 5AJ3Q 3NXWA 4EYIB 4OX9H 1ZEQX 4YY3H 1IW7D 2V9WA 2A1AA 2RHSB 1YHQA 3TRZA 3PVXA 2CWPA 3U4ZA 1EYDA 1EY9A 1IL8A 4EVOA 1WCMB 2R7ZG 5G3LD 5TSSA 1M90C 1ICWA 4LF9H 5ELNA 1KEEA 3D31A 3WOEA 3ND9A 1B6SA 3RB6A 4WBNF 1BO0A 1TWGA 4X64L 2OT2A 3IRBA 5HBRB 3Q0AA 2NU8B 2AWNA 4XYQA 4HNUA 4X65H 3GIIA 3BABA 1FNVA 5HGQA 2KCMA 3PIO3 5EWGA 4A3BH 4DR3H 3WOFA 5IYDG 2XCLA 2K7VA 3NTHA 4RGTA 2UXDH 5KT5A 4EBCA 5C3XA 3PUVA 4OONA 3QIAA 4L5RC 1EOVA 1HQRD 2BDNA 4A3FH 1VQIA 4A75A 5DM73 3UQ8A 4QWEA 1TS5A 5LMUQ 5FOBB 4BBSB 4LFCQ 1L0WA 2MO1A 3E9HA 3ERSX 3PO3G 1RYSA 4P73A 4X3KA 3L3OC 1BF4A 4MN3A 2W9CB 1K83A 1ZYRC 4IOAA 2JA7G 3HS0C 4KHVA 2CW0D 5KFGA 1CA6A 1LT5D 1JT8A 3HBLA 1S97A 3MXNA 1T5EA 1VS0A 3BJYA 5EOYA 3NWSA 2PNHA 4MAMA 2DUDA 1TWCA 3KLSX 1I50H 4LF7H 4M8AA 2NVXA 4A3MB 4NPSA 5COYA 1VQ4A 1Y1WH 3HOUH 2A6HD 1SFOA 4JW0A 1YJWA 3D4DA 3Q24A 2Z6KC 4H0LC 1QCBD 3IAYA 4X66H 5DG9A 1MIUA 5EPLA 5KG1A 2QEJC 3T5LA 1W2BA 4Q0FA 2YZGA 4J0MA 4FF3A 4BS9A 2C2DA 1CHQD 2R93G 2A68D 1GD7A 3FKIG 4Z9CB 1M8AA 1Q90A 1LV9A 1K0SA 1R9TH 4TQSA 3H4BA 1F9RA 1PRTF 2RDFA 3NBHA 3C3LA 5JUMA 3G48A 2E74C 4I50F 3H91A 4JI6H 3TQYA 4FP5D 4F50A 2PNRC 2HIVA 4A3IB 2EYFA 2NVQH 3OHAA 1HNXH 5IWAQ 1GLVA 3VDYA 4JV5Q 5IP9H 4J6HA 4QUCA 3PIOA 2YS6A 5EZYF 4B3SL 3UE1A 1X3GA 4DGZA 4OL7A 2DN8A 3CCEA 3HOYB 2ASJA 1TWGH 2F0KA 2AKWB 4J9LA 1IBLQ 3CC4A 1L1OC 2VB3X 3TEHB 4EBDA 2B2VC 2JYOA 2RSOA 1I4RA 3I70A 1QUQB 2ASBA 1TVXA 2F0PA 2CW8A 4BY1H 2NTTA 3IKJA 2FJZA 3HEJA 5D8DA 1GUOA 1TY0A 2NUCA 4LW1A 3KLSA 2NB0A 2ASDA 1X6OA 1X65A 1SRUA 3J7ZC 2R6GA 3ITPA 4O1NA 1N9WA 5T14A 1KABA 1I4HA 4CKBA 2B2TA 2JA8B 1RF2D 2CHBD 1EUDB 4HSPA 3DM1A 5DGAA 4DXFA 4A3BG 5LL6S 3H40A 2W9BA 1JOQA 5C5LA 2E5LL 2CQYA 5ISRA 4YB8B 3MR5A 1FKAH 1HFGA 1JQYD 3HXLA 1A63A 1V8QA 1TWCH 4P2CB 2UUCQ 1NBWA 1GJXA 4A3FG 3I12A 2W9CA 4NXNL 2K05A 5FLXL 1DOMA 3W5OA 1LACA 3K57A 2F0JA 3BQ0A 3LMLA 4R8UB 3GTQB 5KNBA 2IWHA 2XGPA 2W6OA 2WINB 1XJVA 1HQMC 4DV6L 1KIXA 1JX4A 3KF6A 3GTLH 3TS2A 2YU9B 4PZ6A 1M7JA 4DV4L 1VQJA 4B3SQ 1BJTA 4CDEC 4JI4Q 4L5TA 3T16A 5LMNQ 4DAMA 1Y1WG 3HOUG 4YIJA 4ECQA 4BBRH 4IRDA 4JI1H 4DV2H 1Z7TA 4JCVE 1KNAA 4AYBB 2DJFC 2VQFH 4RMFA 2RGVA 4IPGA 4K5VA 5FLMH 5KT7A 3MWDA 5C0XG 2K4KA 3LWBA 3T51B 4LFAL 3R5XA 5I4DA 1LYLA 2JA5B 3KUPA 1S5ED 3CVZA 4HNTA 2PQAB 3PR5B 2EJMA 5AFWA 4DK1A 1GUSA 4F4WA 1S10A 4EGJA 3T4AC 5JPNC 3TN2A 3HOVH 3OHXC 4RUAA 1XNQH 5KGUA 4NXMQ 3RB0A 2YS7A 1M4VA 1PFBA 2EDGA 1LTRD 4DL3A 4ECVA 3PUXA 1LTBD 1WCMH 3T5HA 1MZBA 2V1CC 1EY5A 1TKWB 2Q2HA 4EQPA 2JEJA 2MPMA 3CW2C 4RKLA 4B3RH 1FR3A 2VUMB 4UCVA 5I9OA 3RGZA 4A4IA 1EIYB 3J80W 5BPFA 1B3QA 2KJXA 3TQ1A 4J9KA 5I2YA 4J9PA 1Y8OB 4H02A 5E3FA 3S2HB 1QUQA 3SK6A 1EUJA 4CDDC 4ECRA 4UCTA 3E5SA 4L5QA 2X0SA 2RA4A 4DUZQ 2QEXA 3I4LA 4YAKB 3J80i 3LX0A 5D1OB 1Y1VB 4BY1G 2HHHQ 1S4ZA 2F4VQ 2DY8A 1CUKA 4EG0A 3Q8RB 3CU7A 1VQPA 1Q1EA 3PQIA 2VQDA 2DJGC 4BBSH 1OXSC 3KYHC 2K03A 4V190 4FS1A 4RZRA 1XMQL 2ASLA 3PUZA 2KENA 5G3LF 1GKHA 2EYMA 4ZUIA 1KRTA 4B9WA 4DR4L 4R8IA 2YZMA 3RBEA 1JWMD 2ZJQA 4LF8Q 5EQ0A 1UNNC 4MV9A 4DV1Q 5C8YF 1BCPF 2A69C 3A5ZB 3E0JA 1DONA 2A6EC 1FJGH 3CQZA 2PO4A 4DK3C 2Q2TA 4M9UA 4MTKA 2QGQA 1EIFA 2B3GA 4A3MH 4LF4H 1O7ZA 2AQ2B 3U9OA 2RDGA 4A76A 3RAQA 1KDAA 1EU4A 5IYBG 5D3IB 5KFVA 1XMOH 3TDQA 4LFCH 1E1OA 3IL8A 5J1ZA 4DN4M 1IBMQ 4MA0A 4LH7A 3K7UC 2ZJTA 3E5NA 4ECYA 1E2ZA 1YIJA 3J81W 3N52A 1EEFD 4PWQA 1YNND 1FGUA 3H3VC 5JJLA 3N43B 3TSSA 4DV0L 4BBRG 1KDCA 1B70B 5J3BA 1D6EC 3J81i 3MR3A 5L1IA 4J8QA 3K5MA 2WYOA 2X69A 5FLMG 3KHRA 3FMAA 4LF5L 5I6YA 1MJEA 3GTGB 3EVQA 2PQAA 4A3IH 5BN5A 2F0IA 3EIVA 1HR0L 2WV6D 5DAUA 2ZTDA 5ELOA 2K5DA 4M1UB 1PYBA 3HOYH 4IURA 2Z0SA 3HOVG 4Y52H 2K52A 2LMCB 4OWTB 2FB9A 2KCCA 3C1EA 1VBGA 4N8FA 4F8MA 2AWOA 1WCMG 1HNWL 2VQEQ 1VBHA 3TINA 2EXZA 4TVAB 3A74A 3VYSA 4JYAH 4MV1A 2AGOA 2UUAQ 4GKKQ 1PLFA 1AE3A 4JV5H 4B9XA 1VQOA 1ONLA 3RLFA 1DCZA 4UHVA 1QB5D 2R7ZB 1SYCA 2FXQA 3JAME 1LUZA 2FMAA 4YHHH 5DLFA 2AHOB 2JA8H 4K6LA 3VA5A 1N34H 2NYZD 2ZJRA 4N9PA 1A0IA 5D1OA 3CCQA 5C5JA 1Y1VA 2FLLA 2PI2A 4BA2I 3F8NA 4RB3C 4RB1A 4U68A 4DR1Q 1N33L 5LOVF 1WYDA 5KFJA 5KFFA 5EKKA 1SNDA 3GTPB 1G51A 4JI7L 4RKBA 1BBWA 4JI8Q 2MCTA 2HQLA 2UVRA 3JRWA 3M4IA 5C5MA 1BOSA 3GTQH 2L55A 3JRXA 1DJRD 3CAMA 1VQEA 2VOBA 4XZ3B 2UVUA 1MJCA 4UAIA 1JE5A 2HQEA 5A2QL 4OGQC 2R7KA 3CHBD 2R7FA 2YU9H 1A8VA 1EFID 1EHIA 3QWNA 4O2BF 2E2IB 4DPGA 4DR2L 1ILPA 3PO3B 4A3MG 2R8JA 5ELFA 3KJPA 3M9MB 4DR5H 4YY3L 3BYYB 2UUCH 5IOCA 4MHEA 5IY0A 5KIXA 4X3TA 4APMA 3GQCA 4EGQA 1E3PA 3S24A 1O7LA 2JA5H 3GO5A 4KY7A 2DGYA 4IWYA 3J7AK 1TS4A 1R4QB 1XTDA 1D1KA 4RGOS 3R2IA 4K0KL 3BU2A 4JI0Q 4OO1G 2VPSA 4IR9A 2GLTA 3BQ2A 4PZ7A 1ZHSA 1K1SA 4QL5A 4X65L 1ASYA 1HCZA 1RJTA 3F2BA 4KHPH 4FO2A 2KECA 4GOPA 2BA0A 3N8DA 1QG7A 1RKNA 1B04A 2O2LD 1UEAB 3F2DA 2WB1B 4IUPA 1NAPA 5JOBA 5EGTA 3CMAA 2BE5C 2PCFB 1I94L 2R93B 4FF1A 4A3IG 4L5SA 5H80A 5IT9c 1EQRA 3OTOH 2VUMH 1LTAD 1LT6D 1E7ZA 1JB7A 2JA9A 4ECTA 1B7YB 4GLVB 4OWXB 4DR7Q 4CC6A 4KD3A 1CZGA 4B3TQ 2ZT9C 4DL6A 4FF2A 3QZ8A 1PA6A 2F3WA 3S2HH 2RHQB 2V4DA 1VF7A 2OLSA 1Y1VH 1BXTA 4LF7L 3IFDA 3PGZA 2ICIA 4R7RA 1GHKA 2KHSA 3PCOB 4JI3Q 2ZM6Q 2NZHA 2VS1A 2OF1A 3MWEA 4KKSA 4J9QA 2R7ZA 3DEOA 1GHJA 4X66L 1X56A 2DPIA 2IA6A 1EWIA 1SMYC 1KJ8A 5GAEC 3CD6A 2E2DC 3TZUA 3J80E 2JA8G 4HMJA 1N36H 5EBDA 2FFKB 4PMBA 5FD6A 1CT1D 2PMZB 2PBZA 3MR6A 1EU3A 5I9PA 4GKJQ 1CS0A 2Z4HA 4IJHA 2DIKA 2YL2A 3TMEA 2F03A 2HHHH 4ME3A 2PW7A 5JEAJ 4YAJB 2N8NA 3H09A 1TY2A 2K33A 4ECXA 3JSLA 1SYBA 5KFHA 2FJ2A 4JI6L 5L1LA 1I6HB 3LGJA 1STHA 2HCIA 4O42A 4Q8EA 1PH7A 1HHVA 2XVSA 1HNXL 3MC0B 4DV1H 1EWHA 3FHWA 3U9SA 4A3FB 1RK5A 4WRDA 3KTMA 1DZ1A 4H13C 1TWAB 4TQUS 1O78A 3PW4A 2F0EA 1AUXA 4HJ8A 1FD7D 4DV7Q 1Z2OX 1CI3M 1RDPD 1WFQA 4AYBG 5LL6X 2IHEA 2FK1A 4RNNA 4FVMA 2HDLA 1PYWD 2R84A 4DV5H 3GTGH 1GXDC 2VA3A 4ABNA 1UUPA 2JA5G 4NDXA 3D6CA 4DFAA 4ZLTF 4YR0A 1JORA 2WACA 5ELEA 1UWVA 2CH4A 3R23A 1A62A 3PUWA 2G9HD 1RIPA 2NVTB 3J81E 3BVGA 1Q1BA 1TA8A 3K81C 4UY8C 3AB9A 1Q12A 3K5NA 1U4PA 2Z1CA 2LFNA 3KBXA 1EIHA 3RAXA 3GV7B 5FO8B 2HD3A 4TKOB 4K8IA 2NU7B 1B53A 2R82A 2IBKA 3FKIA 2R93A 1WD0A 3VYRA 2F0LA 4GNXC 2WB1E 3KAKA 2JXMB 1CHPD 1QILA 4B3MH 3DF7A 2AU0A 1E1TA 4MV4A 4J15A 2VUMG 2KCNA 5FD5A 2R7ZH 3D4RA 4QCLA 1GUGA 4EEYA 4I7HA 3HB9A 3R8BA 1EY0A 3DXJC 2F0QA 1AZPA 4QIWB 1VQGA 4RCOA 1IBKQ 2N55A 2RDIA 4V0BA 5EWFA 1OWTA 1Y1VG 5E1FA 1QJOA 1EY4A 4DV3Q 1LABA 4NP5A 1STBA 1E4FT 2A19A 3I90A 3GTPH 2KSWA 3RFCA 2X6GA 2UUAH 4NLGA 4ZK9B 4JI1L 2BR0A 3QJYA 4XYOA 4CJ2C 2W71A 5IYDH 1PRTC 2QK4A 2E2JB 4G3IA 5M5WB 4QY7A 3F2UA 4KJNA 1PZID 2ZDHA 3M85A 1FNUA 1EOTA 4JV1A 3V4ZA 1OO9B 2PMZA 2XNAC 1Q3LA 4IUTA 4RHRA 2H4OA 4IZ8A 2E2IH 1NR2A 2VW9A 3PO3H 4DUYQ 2EJGC 1JJCB 2MUYA 2PMZE 1XNQL 3H20A 1A6XA 2A74C 2HT1A 1F9PA 3QG1A 1PTOB 1EUCB 4A3KH 3J81j 3S15B 4UCUA 4JI8H 3F2CA 3R3OA 3RLNA 1VQ8A 1JE4A 3G6JB 2Z9HA 3I4NB 3MTSA 3DWPA 4B3RL 3M7GA 3QO2A 1PMRA 2K6AA 3WDNA 2ID0A 1H95A 1TWAA 3G6XA 1X54A 2F0DA 5DQGA 3EBEA 4YJ3F 5C4XG 2R92B 3EROA 4OWWB 4LFBQ 5K36H 1Q8KA 3R93A 3PO2B 1I50A 2R93H 1SNQA 1Y1WA 3HKZG 3PW2A 1WTWA 2H5XA 3J7YW 1BBXC 1T36A 3BA9A 5C0XI 1IYVA 1JLLB 2R8GA 1HZBA 2VPQA 3D0FA 4JI0H 4JOIA 4ALPA 3K3VA 4IRKA 3W2DA 2UXBQ 5CAEB 4ED2A 2DNCA 4YCUA 4IN3A 1Q81C 3T1YQ 1G91A 1S03G 1F2LA 3RD4A 3PW7A 2BDOA 4RZQA 1FJGL 4QW8A 5JJKA 3CCSA 3TREA 4GOPC 4LF4L 5FLXc 4NB3A 2JSOA 2YRXA 3S14B 4G7OC 1XMOL 1AW7A 3OOCA 5M3MB 2JP1A 1LTTD 3Q8QB 2A73B 2F4IA 1HNZL 4QIWA 4PNYA 2C5CA 1ZYRD 3SHLA 3GTMB 4IAJA 1MI2A 2W7OA 2AGQA 4PMCA 2OEOA 5KYLA 4KN4C 2L12A 3MFYA 2K50A 4QIWE 2F3IA 2I5MX 1BQQT 2FLPA 1D5ZC 1KHIA 4CHTB 2OTLA 1X3EA 4LWCA 4RUCA 1T94A 1IZ6A 3RB3A 3AMUA 1WTQA 4JV2A 3N40P 1NY4A 1SNPA 1BNCA 3MEFA 2WKDA 3UDXA 2OXPA 1I6HH 4X62H 1RJQA 3EPGA 1RD9D 4HAEA 2ZXOA 2F0GA 1NUCA 1B50A 2L1BA 2PYKA 5GAGC 4NKLA 5M5YB 4DAVA 5KFRA 4O3RA 1S72A 1S0MA 5CV8A 2UUBH 1TWAH 2WAQG 2KOLA 2UXCQ 1VQ5A 2ZDQA 1QZGA 4GZYC 1NR4A 1MBYA 2VZAA 4LMYA 4IHJF 4A3KG 3OW7A 4LF6H 2PZTA 4RGNA 3RV3A 2KEDA 1U5KA 5KT6A 5L1KA 5D3DA 2O5IC 4R4QA 4JYAL 4QWCA 5KG0A 2PQEA 1PH5A 3VA7A 2NVTH 3K5HA 3HKSA 5C0XH 1TQOA 3P20A 2GVAA 1AUVA 5T1GA 4YHHL 1TU2B 1N34L 4HIKA 4A3EG 3GTLA 5K36G 5KFPA 4CDFC 4DV7H 2WB1G 1BCPC 3S1MB 4R8NA 2B8FA 5KG7A 3A5UA 2XGQA 4X64Q 2J6TA 3CXCA 2D0OA 4FU0A 2XCPA 4EYHB 2AUKA 1X32A 1MHWC 5LMNW 3T1HL 1M1KC 3CMEA 2EVBA 1BGWA 3H4DA 4WJ3M 2CCZA 3MEHA 3OSNA 2F0NA 3T13A 5T1IA 1GSHA 1K28A 4U673 1EYAA 2KQ3A 3OHBA 4ECUA 3S16B 1T3NA 1F2ZA 3LP8A 3A54A 5KFEA 2FPIB 4YQWA 2CW0C 4DR5L 1J8IA 1WCMA 1KRSA 2E2JH 5M5WH 2XRSD 1PYSB 3GTMA 5KG5A 1V1QA 2I46A 5IP7H 1JKJB 3EFXD 4HIMA 2MQHA 2GPSA 2C9OA 3VMMA 1J5EH 2JEIA 3Q1KA 1IBKH 1HZAA 5FLXW 2W8KA 4O2AF 3L7ZC 4LUOA 1PTOH 5JQWA 4KHPL 2DNEA 4C56C 3S15H 4JI2H 4AQYL 1GGOA 5I6WA 3ULPA 4K2LA 3H0GB 1D8LA 2A68C 3NELA 3I4NH 4MTEA 2VL6A 3OTOL 4P72A 5IYBH 3R2TA 5CV4A 2XIGA 3JAML 4OXPA 1E2VA 3NENA 1T9HA 3URYA 4QWAA 1RL2A 2R92H 5E4WC 2DLNA 5BMVF 4Q45A 1VQ7A 4QMGA 1I6UA 3GLKA 5KG2A 4DU9A 3RBDA 3W3AA 3DEPA 1KTKA 2B2WC 2NWGA 1ASZA 3PO2H 2IHFA 1O7IA 1WD1A 3VR3A 2RDJA 5KFLA 5IODA 4A93B 2BA1A 4ED6A 1A9XA 1F2MA 3J7AF 2M00A 2RGRA 3EN2A 3M4YA 2FP4B 2Q2UA 3V6HA 5IYCG 3AEVA 4IPDA 1SJHD 2D5DA 4A3JG 3L2PA 3DM3A 4OO1I 5IT9W 1CSQA 1OXVA 1N36L 4P71A 1EQQA 3OPOA 5KFQA 2BH8A 1N32H 5JVG3 1WTXA 4P74A 1S5CD 3OMGA 1TWHB 3MVVA 1I7NA 3S14H 2UU9L 1I4GA 3TBIB 2HJWA 4JI5H 3IG0A 4FBUA 2XWBB 5GAHC 3DUZA 4OEMB 3GTKB 3DWQA 5M3MH 2JJQA 3UFXB 3M9NB 4GC7A 2KA7A 2ATLA 5C44B 5J39A 2YTYA 4IOCA 2E5LQ 1NTGA 3ORRA 3PUYA 5BR8H 3GTMH 3T1YH 4KK7A 2QA4A 1MSHA 1IKLA 2XIWA 4K8JA 1PTOD 2AQ3B 1BUVT 2A69D 2K04A 1STAA 5IGBA 5KFTA 4NXNQ 2W6MA 4GLXA 4ZYSA 1LTSD 5DGBA 3KALA 1Z9FA 1DIKA 4ZQIA 2W70A 5LHY1 1VQLA 5DG7A 3KDFB 3RLOA 4DV6Q 3GTOB 3GV6A 4DV5L 1EFWA 3CF5A 4DV4Q 1STEA 2W6NA 5JAVA 5IP7G 5M5YH 1B8AA 2PW5A 2J6UA 1ZKOA 3FPUB 1L2ZA 4MV7A 4ECSA 2V5AA 1VQKA 2L4NA 3RV4A 1I6VC 1BNZA 2MJ8A 3ETHA 3G6EA 1PFMA 4HNVA 5FK9C 4PMWA 5C4HA 2W6QA 4LFAQ 1E22A 1XNRL 5CV7A 3MJFA 4XYMB 1WI5A 5EKIA 3MWMA 1K8OA 1PFSA 5K2MA 3I4NG 3VPBA 4B3ML 5CA1F 1GM5A 4EEQA 1PH6A 4OIKA 4UP7A 5GONF 1OXUA 3SK8A 3UDGA 4R8UA 3GTQA 3PF5A 2DWCA 5FPRA 5LMUH 5L9XA 2TSSA 3MXGA 3VPCA 3J80L 3K58A 3CC7A 1KC7A 2R92G 4GN5A 1K0RA 3B6YA 1GUWA 1JICA 3VPDA 1ZXTA 3SK5A 3IN5A 3M4PA 2YU9A 3A0JA 3S1MH 1K8MA 3PO2G 3T5KA 4OO1H 1CKMA 1JWSD 5EBCA 5KFZA 1JMCA 4BWGB 5LP6F 1Y8NB 2FE3A 1O80A 5C4XB 4AYBA 4UP9A 4C3HH 4BXXH 3N42B 3ORQA 1VQBA 5KT2A 2XWJB 3BS1A 2MNAA 2SOBA 2YTXA 1N48A 4C3IG 4DR6L 5KT3A 2JA5A 4AYBE 3JC66 3I4OA 3HKZB 1GO3E 4O4HF 1BBUA 4A2BA 5KX5F 1B9MA 1K73C 1G6ZA 3WO0A 3RUPA 3S16H 2C2RA 3AFQA 4I65A 4NMZA 5KRUA 1XMQQ 1AN7A 1K3RA 4DR4Q 2HVQA 3GTKA 1HTPA 3K3PA 1WTHA 1CTMA 3MXPA 1KAAA 3V05A 5M3MG 3V6JA 4CKCA 2N3SA 3BA8A 2VR1A 1STNA 2EYPA 2W6PA 2ZXRA 4I4TF 5LA6F 2WDTA 3G6YA 2VUMA 1TS3A 3A8JE 2K5VA 5IWAH 3WO1A 2N78A 3J81L 2F0VA 2EPBA 4RNOA 4BY7G 1NE3A 3DWAA 2HVSA 1HZCA 2F0WA 3KDFA 1E0BA 1IBLH 3R5FA 1CE8A 5KFXA 1JWUD 3I3CA 3H0GH 1G2SA 4U6PA 4Q8FA 3N41B 2B63B 1LTLA 2EY2A 2EYHA 1AFPA 2EJFC 4YR3A 3MWYW 4DV0Q 5J2UF 1XPRA 5CV6A 4FF4A 1S0NA 1NMGA 1H9JA 2KHIA 4LF5Q 5EAYA 3NQTA 1HR0Q 5C0XJ 2ATWA 2I0QA 2OTJA 2HGSA 1LLRD 4A93H 2WAQB 2B2TC 4JBJA 4Y7NB 1YITA 4OX9L 4HIDA 1Y8PB 3A8KE 2ALZA 4J9NA 3WWVA 4A3KB 1VQAA 3O13A 4GN3B 3ZJYC 3BG5A 3SI8A 1DYQA 1HNWQ 1SE3A 4R1JA 4A3CH 4CJ1B 2CFMA 1ICFB 3CCMA 4IUVA 1CKNB 4LF9L 1JDEA 1U4LA 1VQMA 4HN7A 5GROA 4HJ9A 2HUGA 3HZXA 3OSOA 5IGEA 1QZHA 4B3SH 1TWHH 3V2TA 2DZDA 3NQIA 4JI4H 4J9SA 3KBGA 1YBYA 2QDLA 5LMNH 1NMFA 1SR3A 4XT1B 4RA8A 2ENBA 3GTKH 1S0OA 1BCPB 1UE6A 3STBD 4C3HG 4A3EB 4BXXG 4KKUA 3X3NA 4DR3L 5C44H 3GTGA 3HKZA 1CKOA 4X62L 2UXDL 4OHJA 4MA5A 2YTVA 4IJLA 5FJ8H 1S9FA 2M9VA 5CR3A 2IX1A 1N33Q 1SMYD 4L8JA 4UDUC 4QUFA 2UVWA 3HKZE 1HJPA 4JI7Q 2G9DA 3RUZA 5K5PA 4ECWA 2B29A 5C3WA 2VB2X 2V58A 4ED0A 3MFIA 1JOKA 3Q8SB 1HA6A 4NXMH 1HFNA 1RHPA 4FYDA 4YJ2F 3HFZB 4LSAA 3NP8A 4LF6L 1W96A 4O3OA 4JVZA 3GTOH 1U9RA 3KOJA 2ZDGA 4EFEA 2IMWP 1IHZA 5I47A 3Q6SA 4JK1C 5M5XB 1RJRA 1B33N 1IOWA 4L63B 4TV8F 3K5OA 1B1ZA 5DLQE 4DF7A 4DR2Q 5KKNB 4J9RA 5F9LA 1GOZA 1L1OB 3K7AB 1TXYA 4YY3Q 1UC8A 3RF2A 2VXWA 4FM9A 3K59A 3QB3A 3UE0A 2JA6B 4FXGC 2L5TA 5C1PA 1EL0A 4RHSA 3U9TA 3VR4A 3GTJB 1PTOF 1G8ZD 1GSAA 4LF9Q 2A8VA 3H0GG 3GQBA 3NEMA 4K0KQ 5FKAC 3GIKA 4DUZH 3PIP3 2K5WA 3GTPA 4R4CA 4RWSC 3PN1A 4X65Q 4MV6A 2F4VH 1EZ8A 1UE5A 4HYKA 2CQAA 1G2TA 4F88A 3VR6A 2Y0SB 5HV6A 4FNFA 3NSWA 1I94Q 3GIPA 1EYZA 3EJIA 4A2AA 4LF8H 4OELB 3CP0A 2NUAB 2E2IA 2W57A 5KFIA 3BQ1A 2WAQA 1ESRA 1W93A 4KV6A 2NU6B 5ELBA 4JC0A 1K8AC 2J6SA 4A93G 5C4XH 2WAQE 3GV8B 4DLKA 3UDIA 1LTID 5LXTF 4LK1C 1RK6A 5KNDA 1IYJB 2I5HA 4Q43A 1YNJD 2Z6KA 1VQ6A 1CKNA 2LY7A 4DNTB 2R7MA 1IBMH 1V1PB 4G4KA 4LF7Q 4A3CG 4F4YA 2IP4A 4JBKA 2B39A 2IW3A 2NVYB 4TV9F 4YWLA 1J5EL 1QVGA 4DAYB 3ER0A 4X66Q 1OXXK 4A3JB 1HXYD 1AH9A 3TZDA 4N8X1 2X6LA 1SJED 5KG3A 4ETSA 1CZWA 2WB1A 5M9OA 4JI2L 2JE6I 3J7A5 1VQHA 2AUJD 5C44G 4DL2A 1MSGA 1HRJA 3LWEA 1Q86C 2EY5A 5HY6A 5FJ8G 1O7YA 4YWMA 2IJ0A 2LXJA 2JK8A 4PV1C 1IOVA 2ZTCA 3BVZA 2B2YA 4DKAC 3R5HA 4X3SA 1N56A 3PIPA 5KFWA 4EBEA 4JI6Q 3UI2A 4DR4H 5CYUA 2K1BA 1QNKA 4DA2A 4ME5A 3FDTA 4A3GG 1HNXQ 1YHAA 3BDCA 2QILA 3K8AA 3GV3A 1QNUA 4A3LG 5KG4A 3NGDA 1KLGD 2B63H 1MGSA 4UCRA 2C22A 2VQEH 1L1OA 3CCVA 2XC9A 2KEEA 2B2VA 4C2MB 2Z4IA 3D8GA 4GKKH 2R7LA 1L0YB 3K6OA 4DV2L 2AQ1B 3M9BA 2J4XA 2JEFA 2VQFL 1Q46A 3M7NA 3L4JA 3LWUA 3GTJA 1A15A 4QW9A 1JC7A 4U7CA 4R4OA 3F8TA 3DLLA 3RZDB 3JSNA 2AGPA 1SMXA 3CC2A 3SK4A 5A35A 4A3DB 4LSXA 1C7YA 2IY5B 2O5JC 1J9OA 4DXGA 1N32L 4EGVA 4DR1H 4Y7NH 4RB0A 3OYYA 1H9SB 4JI5L 4JG2A 4KLKA 4IWXA 5EDWA 4R4IA 1V51A 1SEBD 3W1GA 5BR8L 3K5LA 2CVRA 2Y0SE 3TP7A 3TIIA 5JVDF 4KI0A 4QF4A 3SVMA 4LF5H 2WIIB 5C3EG 5GQOA 2P5ZX 4GN4B 3M4QA 3MHBA 1GYFA 2J0TD 4PDBA 1C4QA 3JZIA 5CA0F 4MV3A 4DL4A 4JBMA 2MFIA 5AJ3L 5IGCA 2IL8A 4A3EH 1K9MC 5JJIA 1C30A 1K83B 4ZUJA 4IQZA 4RU9A 1V1PA 5KFKA 1VMCA 1F2YA 4ED7A 1AEXA 5KT4A 1N8RC 2NVYA 4BA1I 3AFPA 1Y69U 3MXNB 2I8CA 2OH2A 3KJOA 2E2HB 4QJFA 3I4MG 3MAQA 5DLGA 1RODA 2NVXB 4JI1Q 2WE6A 3M9OB 3CKIB 1SFOB 4MIUA 3ULJA 2VQFQ 1KBLA 4KHZA 3VYUA 4C3IB 5JVLA 2K5QA 1RTOA 3K80C 1DGSA 1QOHA 3QOJA 1XDNA 2F0OA 5M5XH 1SYDA 1DV1A 1I4PA 4JPBW 3CPWA 1N33H 3OWFA 1SE8A 1UEBA 2F0FA 4K5XA 3JAMc 1SE2A 1XNQQ 1XYIA 3K7AH 1UAPA 5FO7B 1X55A 4JI7H 2E76C 2V59A 2F3VA 1EY6A 5LMUL 2JA6H 4IFDI 4LFCL 4DK6C 4C5BA 4FS2A 4DR7H 1P16A 5L1JA 5DNFA 2J9GA 4B3TH 3L9AX 3GTJH 5JH7F 4ZAIA 5IGGA 4B3RQ 4ILWA 1XX8A 4FXKC 1VCIA 1WTOA 4Y8VB 3A7LA 4YWKA 2VY3A 2B63G 4LNQA 4BY7B 2NU9B 3S2DB 3KLWA 4AH6A 4ZI7F 3RIZA 2FK3A 4JI3H 2ZM6H 4HCEA 1HTLD 3RMHA 2QKIC 1NJIC 1A2TA 3FRPB 2MGSA 5IGFA 3M3YB 4YBZB 1DM0B 3K0XA 5DM63 3KFUA 4DL5A 4LUVA 3TIGA 3M4OB 3KK7A 4B08A 3C1FA 1E4GT 2PZUA 1H9RA 2QF7A 5C4JB 4NW2A 2K28A 1BCPD 2F0HA 4POGA 1E4EB 4K0KH 5CGKA 1H9SA 4IO9A 1SSOA 1WSCA 4YR2A 4GKJH 3ONAB 5EWEA 1PXUA 1ET6A 1H9KA 4EQOA 2RBMA 3HGBA 1JOOA 1CK1A 1SEIA 2EYOA 2QCPX 1KJQA 1JJ2A 3PW5A 4DK0A 1FJGQ 3V6KA 1DOKA 1B6RA 3SXHA 1I94H 1YHBA 1LO5D 1TWFB 2GA4B 2W9BB 1SYGA 1CM9A 1SBBB 2NVYH 3D3RA 3HOXB 4LF4Q 5IWAL 1PZKD 1IW7C 4JV5L 5H1SE 2RSNA 5IYCH 1XMOQ 2R92A 3OW2A 4A3JH 5C1OA 4YCWA 1QVCA 2OCEA 1W3SA 2NTSA 3P75A 2Q8TA 2LKVA 3QFFA 4FXDA 1H9MA 3BYTB 4DL7A 1HNZQ 1IBLL 3HOZB 2CW7A 2M2LA 5L37A 3KF8B 5FO9B 3H3VI 2K01A 2FKLA 5F2DA 1G291 2E2HA 2W6ZA 4UP8A 3KF6B 1KJIA 5KFOA 1YI2A 1O75A 1YZ6A 1EZ1A 1DXMA 2L9HA 4C3HB 1GUNA 1STYA 2NZOA 2C35B 3SDZA 1XPUA 4ID6A 2QDBA 4UCOA 4IFDH 4JUZA 3E9IA 5CC4A 1ILQA 3ULLA 2MO0A 4UCSA 4FBTA 4PZ8A 3KHGA 3QR8A 1PVOA 3I72A 2VA2A 1KJJA 4EFBA 4C2MH 3J80c 1Z2PX 4LJZC 2UUCL 4KKTA 1S5BD 1HA5A 3PW0A 3VYTA 2JA6G 2R61A 3G7LA 4HJAA 4BWSC 3PF4A 2IX3A 5KFYA 3RZDH 2RF4A 3H6MA 2B2YC 3E0EA 3UDFA 5HGTA 3H94A 4A3DH 2A6HC 4JYAQ 1S40A 4X6AH 1ZHQA 2YYZA 3GP7A 1OXTA 3PSIA 2XD4A 3I73A 4OIJA 3JAMW 2VNUD 2B2UA 3OUUA 1WTPA 1XTCD 2H1EA 1EYGA 4DV3H 4JI4L 5LMNL 1AE2A 4YHHQ 2I07B 5IT9E 1N34Q 2R8HA 2D2CC 5JPMC 2Y0SG 2C2EA 2ICEC 3T5JA 1UE1A 1S68A 2EOTA 3JAMi 2DPJA 1W6JA 1A3VA 2NBFA 1XXGA 1E4EA 1KJ9A 3D6WA 5F9NA 2I87A 3KAJA 5ELCA 3T1HQ 4G7HC 4PG3A 3CCRA 3NHHA 4C5AA 1BDOA 1SYEA 1C3OA 4DUYH 5IE8A 3A8IE 3PZPA 4NXML 5KFUA 2EYLA 1GVPA 3NTKA 4IUQA 3Q22A 2V4RA 1K83H 5KFSA 1IYUA 1LTGD 4RGMA 2NZ1D 3RGXA 2R8IA 1TWFA 3E6ZX 1IKMA 2BOSA 1J6QA 1CA5A 2K75A 1B2TA 4RAYA 1PX2A 3J81c 2HCCA 3H3VH 5M3FB 2AQ4A 2F0MA 3G8CA 2E2HH 3CQZB 1PH9A 3D4WA 4KJOA 4DR5Q 2NVXH 4HCSA 1M0WA 1YJNA 1S5DD 1SFOH 5KFMA 3BZKA 4LMQD 2EIFA 4C3IH 3V4SA 3G4SA 2W7PA 4Q5VA 1A3UA 2N49A 3KF8A 2FPPB 3W1BA 1S3OA 4ZQ3A 4LFBH 3SE7A 5DQHA 3P7JA 4ZOLF 1PDQA 3KHLA 1EY7A 2D0PA 5DEHA 5JEAH 4DUZL 1EQVA 4E4TA 2HHHL 3S1NB 2F4VL 4RCNA 2R87A 3BG3A 2R8KA 4KHPQ 3TQTA 3CCJA 3C46A 4C3JB 4AQYQ 1LM0A 3GIQA 4GNXB 2UXBH 2HDMA 4ZRZA 4LF8L 5KNCA 4IFDG 4JOIC 4DV1L 5NUCA 4HIOA 3OTOQ 3DHQA 1PHJA 1SDFA 1RJPA 1JXLA 3RR5A 1PH3A 1F9QA 4YCVA 4BY7H 2A6ED 4HMIA 3S2DH 1JDBB 3Q2OA 1SNMA 1V9PA 1FNWA 3HP3A 1B4OA 1ML0D 2ZTEA 4A3GB 3M3YH 1KXLA 2RVLA 1SYFA 1JCKB 2YRWA 4MTNA 4IZOA 3M4OH 2Z6BA 1C9OA 4CBVA 5KFDA 3BJUA 1U0LA 1SAPA 4J1MA 1IBML 1ZETA 3S1QB 5C4JH 4A3DG 1TS2A 1PRTB 1V1OA 3LNNA 5IP9G 3EA6A 4K6DA 3TS0A 3GIJA 4MTDA 3QOLA 1T5XD 1WVLA 3IFTA 4RH6A 4G7ZC 2WTFA 4GLAC 1CQJB 3H0GA 1N36Q 4HEDA 1Q8IA 1VQFA 1TWFH 2E8GA 4EQNA 1EYCA 2BCOA 2O4XA 3ZYYX 4J9OA 3HOXH 1KNEA 3X3MA 3J7AV 1VQDA 1KLUD 1SNOA 2UU9Q 1KC8C 1W6KA 1CQVA 3SE0A 4IR1A 1GSOA 2UXCH 5DG8A 3GIMA 1II3A 1EIGA 3HOZH 1JB3A 1WH2A 4ED1A 5C3EB 1HR0W 1PTOC 1VKZA 4O4LF 4LH6A 4QWDA 2RQXA 1SCUB 2YCHA 3HOWB 5LYJF 2BH2A 2ZJPA 1B44D 2VQEL 1KD1C 3EPIA 4KY6A 4X3UA 4K2KA 5BN4A 4EQ5A 2XGTA 4DAPA 2UUAL 2L0CA 1KQSA 4GKKL 2P0AA 3U58A 4ZKCB 3PV0A 5IGDA 1TAEA 4MNOA 4MZ9A 3CCLA 1YEZA 5FPOA 2CKZB 2HVRA 4KTAA 4DV5Q 1D7QA 4O3PA 4GC6A 1I5FA 1VMPA 3E3XA 2I5LX 3G71A 1HNZH 1QVFA 1VQ9A 1PZJD 3I4MB 4IALA 2E75C 3I7FA 4F87A 1TWHA 3KHHA 5JEAG 5JVH3 4DR1L 2R86A 3C2PA 4X64H 2TMPA 2CH4W 4WFN3 2PPBC 2CZGA 4QB4A 4GNXA 4M7EA 4JI8L 1XNRQ 1NNXA 1BXRA 2B8GA 2EY1A 4GOPB 2QW7A 4C5CA 4HJ7A 3BAAA 3DMUA 1SYXB 3HRZC 4B3MQ 3PR4A 2YW2A 3EQLC 2W9AA 3EYYA 3GIDA 1LT3D 5J22A 4ZHQF 3I8ZA 1HUNA 3NWTA 2W8LA 1C48A 2FPGB 1KDBA 1NSNS 1PK8A 2OQ0A 3GTOA 3BZDB 1PH1A 2ZXPA 3MA2B 5A2QW 1D5XC 4IUNA 3OSPA 2R6FA 5DQIA 1PFNA 5ELDA 3Q8PB 1YNNC 2AMCB 1Z6HA 5D65A 1FL0A 4DNIA 2IX0A 3FVQA 1AZQA 5LL6b 2D9UA 1WJJA 1TIID 3Q8DA 4XTCS 4JI0L 4CDCC 1EWCA 4WD3A 1PV4A 3S17B 2L15A 4QWBA 4DR6Q 2D62A 2CWAA 4ME6A 5FLXE 3NTIA 1ET9A 5IYZF 2FINB 3SR1A 2BQ3A 1A2UA 2Q8RE 2XSCA 1A3TA 2B2UC 4CC5A 1YJ9A 1P8LA 2I80A 5CB4F 5M3FH 2BE5D 1UE7A 1EEID 1BKBA 2XTIA 3CQZH 3HOXG 1C8CA 4IPHA 4I7ZC 3I55A 5GADC 3T1HH 2PI2E 1ULZA 4DR7L 4BBSG 2L11A 3K5IA 2EY6A 5C4ZA 3PMFA 4B3TL 3MXUA 3F1ZA 1JJGA 3HOZG 4WJWA 5I2XA 3HG9A 3N44B 2ES2A 3RB4A 2M05A 1D5MC 2R7NA 2QYZA 3ERQA 4IFDJ 3A55A 4XIGS 1LT4D 3S1NH 1K8GA 4XXEA 1BR9A 3FDSA 2BQUA 4JI3L 2RCNA 2ZM6L 4C3JH 2JA7B 4RAZA 2FLNA 5KFAA
chains in the Genus database with same CATH topology
4H02A 1QUQA 1EUJA 1N34L 4HIKA 4A3EG 4R4OA 4L5QA 5K36G 3F8TA 4O2DA 2WB1G 3DLLA 1PH8A 1SMXA 1OTCA 3CC2A 4DUZQ 2QEXA 1C7YA 2IY5B 3J80i 2HHHQ 4BY1G 2F4VQ 3A5UA 1KAWA 1CUKA 4X64Q 1N32L 3CXCA 2D0OA 2ALYB 1Q1EA 2JEBI 1VQPA 4Y7NH 2UUBL 5LMNW 4BBSH 3T1HL 1OXSC 4GKJL 3KYHC 3OYYA 1M1KC 3CMEA 2LXKA 4JI5L 1XMQL 3I2ZA 2KENA 3PUZA 1GKHA 4JG2A 4KLKA 1KRTA 4DR4L 4A3GH 2CCZA 4WJ3M 1X9NA 4R4IA 2ZJQA 4LF8Q 3W1GA 5BR8L 4A3LH 2CQOA 2Y0SE 4DV1Q 4KI0A 3A5ZB 1IXRA 5C3EG 5GQOA 3S1QH 2Q2TA 4GN4B 4DK3C 3M4QA 2QGQA 1EIFA 2B3GA 4A3MH 4OX9Q 3AYHB 2GVBA 4A76A 3CCUA 4IPCA 1HH2P 4RG1A 5IYBG 4DR5L 2GN5A 4JBMA 2MFIA 3HOYG 5AJ3L 1E1OA 1KRSA 3AQQA 4A3EH 5M5WH 1K9MC 2E2JH 5JJIA 2IT1A 1MKHA 1PYSB 4DV7L 1IBMQ 1V1QA 3I56A 1N8RC 3K7UC 2NN6I 4BA1I 5IP7H 3AFPA 3MXNB 4HIMA 2MQHA 2OWOA 1YIJA 3KJOA 4QJFA 3I4MG 3GD7A 4POFA 1HZAA 4JI1Q 3STBC 1CSPA 1FGUA 3L7ZC 4LUOA 2VQFQ 3ULJA 1BVSA 4DR3Q 4KHPL 4DV0L 4KHZA 4BBRG 5JJLA 3S15H 4X62Q 1B70B 2UXDQ 3K80C 5J3BA 3U4VA 3J81i 4AQYL 1DGSA 5C3EH 5FLMG 4WJ4A 3ULPA 4LF5L 1MJEA 1D8LA 3NELA 2PQAA 5M5XH 4A3IH 4QQBX 1Q7YC 3I4NH 3EIVA 1HR0L 1KL9A 2YV5A 2WFWA 2VL6A 3CPWA 3RN2A 3HOWH 3JAMc 1SE8A 1UEBA 4P72A 3OTOL 2UUBQ 1XNQQ 5M3FG 2ZTDA 3K7AH 2WP8J 5ELOA 5IYBH 1PYBA 3HOYH 1X55A 4OXPA 1G6PA 1XPOA 2Z0SA 3NENA 3HOVG 4P75A 1T9HA 5LMUL 4IFDI 1RL2A 2K52A 4LFCL 4DK6C 2JA6H 2R92H 4OWTB 2KHJA 4LF6Q 1P16A 1VQ7A 3GTJH 2AWOA 1WCMG 3GDEA 1ASZA 3PO2H 2IHFA 1O7IA 1HNWL 3CPFA 4B3RQ 2VQEQ 1VCIA 4FDBA 4TVAB 3A74A 3I4MH 1FVIA 4YWKA 2BA1A 2Q2IA 2UUAQ 2VY3A 2B63G 4LNQA 1IBKL 5E7NA 2JEAI 1AE3A 4GKKQ 3EN2A 3KLWA 4AH6A 3RNUA 1VQOA 2Q2UA 4DV3L 4AIMA 5IYCG 3AEVA 3RLFA 4IPDA 1NJIC 4A3JG 1SLJA 2FXQA 1LUZA 3K0XA 1IL2A 2AHOB 3KFUA 2JA8H 3L2PA 1WOCA 3DM3A 2ZJRA 4LUVA 4OO1I 2R7DA 1CSQA 1OXVA 1A0IA 1N36L 3CCQA 4P71A 1EQQA 2PI2A 4BA2I 4DR1Q 1N33L 1V43A 2BH8A 2F52A 1WYDA 4GS3A 4POGA 4P74A 4IO9A 4UPAA 1G51A 4JI7L 3S14H 3RN5A 1BBWA 2UU9L 4JI8Q 2HQLA 4DUYL 5GAHC 4EX5A 5M3MH 2JJQA 3GTQH 1HZ9A 3CAMA 1VQEA 2YTYA 4IOCA 2E5LQ 1NTGA 4QGUA 3PUYA 1MJCA 1JJ2A 1FJGQ 3GTMH 1JE5A 2QA4A 1YHBA 2EQSA 2R7FA 2YU9H 1A8VA 2NVYH 4LF4Q 2KBNA 2KCTA 5IWAL 1Q82C 4DPGA 4DR2L 4JV5L 5H1SE 4NXNQ 5IYCH 4GLXA 4A3MG 1XMOQ 1SN8A 2K14A 3OW2A 3KJPA 3L0OA 4YCWA 4A3JH 4O0AA 1QVCA 1Z9FA 2OCEA 4YY3L 3S17H 1W3SA 5IY0A 1VQLA 1HNZQ 1IBLL 3KDFB 3RLOA 1E3PA 4DV6Q 3H3VI 3KF8B 4LFBL 2EXDA 3S24A 4DV5L 1EFWA 2JA5H 3CF5A 3GO5A 4DV4Q 2DGYA 1J5EQ 1G291 1XTDA 5IP7G 4UP8A 1B8AA 3KF6B 5M5YH 1YI2A 4K0KL 3BU2A 4JI0Q 1YVCA 4OO1G 1YZ6A 4PZ7A 1VQKA 4QL5A 4X65L 4HJ5A 1ASYA 4JI2Q 2NZOA 3G6EA 1Y14B 3F2BA 2C35B 2OQKA 4PMWA 1XPUA 4GOPA 2BA0A 2UXBL 4LFAQ 1E22A 3F2DA 1XNRL 3E9IA 1WI5A 3CMAA 3ULLA 3T1YL 2MO0A 1I94L 2JQOA 4PZ8A 1PFSA 4A3IG 4L5SA 3I4NG 5IT9c 1EQRA 4B3ML 1PVOA 1GM5A 2VUMH 3SGIA 1E7ZA 1JB7A 2JA9A 3HOWG 1B7YB 1PH6A 4GLVB 4OWXB 4C2MH 4DR7Q 3J80c 4UP7A 1OXUA 1SROA 3UDGA 2UUCL 3PF5A 4B3TQ 4APVA 2JA7H 1Z47A 1PA6A 3CC7A 2JA6G 2R92G 4HJAA 1I3QH 3S2HH 4GN5A 1K0RA 3PF4A 3B6YA 2K5NA 2RHQB 2RF4A 3RZDH 3E0EA 3M4PA 2HIXA 3UDFA 3A0JA 4A3DH 3S1MH 4JYAQ 1S40A 2K5HA 3PO2G 4X6AH 1Y1VH 1CKMA 2YYZA 1OXTA 3PGZA 3PSIA 4LF7L 1C0AA 1JMCA 3PCOB 2VNUD 1X3FA 4JI3Q 2ZM6Q 4DV2Q 2NZHA 2VS1A 1EYGA 4JI4L 1L2FA 4UP9A 4C3HH 5LMNL 1AE2A 4X66L 1X56A 4YHHQ 4BXXH 1VQBA 1N34Q 1EWIA 3M7NA 5GAEC 2MNAA 2Y0SG 2YTXA 3CD6A 4DR6L 4LUZA 4AYBE 1UE1A 3JC66 3I4OA 3JAMi 2JA8G 1GO3E 1YNXA 1BBUA 3H15A 1VQNA 1E24A 1N32Q 1K73C 3FKIH 4R4TA 3S16H 1PH2A 1VQCA 3T1HQ 3AFQA 4IJHA 4GKJQ 3S1RH 4JI5Q 1XMQQ 4PG3A 4ME3A 3CCRA 1K3RA 4DR4Q 5JEAJ 3BZCA 5IE8A 2N8NA 2UXCL 4NXML 5BR8Q 1GVPA 1PH4A 3ICEA 1K83H 3NBHB 5M3MG 4JI6L 3U50C 2N3SA 3LGJA 1PH7A 4JBWA 2LSSA 1HNXL 1J6QA 2K75A 3RZOH 3J81c 3H3VH 3FHWA 2K5VA 2E2HH 2N78A 1PH9A 3FP9A 4DR5Q 2NVXH 2NN6G 5AJ3Q 4TQUS 1NE3A 1YJNA 4BY7G 1SFOH 1HZCA 3BZKA 2A1AA 2RHSB 1YHQA 2EIFA 4C3IH 3KDFA 3TRZA 3G4SA 2CWPA 3U4ZA 4DV7Q 4HJ8A 2N49A 1WFQA 3W1BA 1S3OA 4AYBG 2IHEA 2R7ZG 3H0GH 1M90C 3GTGH 2JA5G 2D0PA 1LTLA 5ELNA 4DUZL 3D31A 2HHHL 2F4VL 1UWVA 4X64L 4KHPQ 1A62A 3IRBA 3PUWA 4DV0Q 3CCJA 2AWNA 1RIPA 1XPRA 1Q1BA 4AQYQ 1LM0A 1NMGA 3K81C 5HGQA 4GNXB 2KCMA 4UY8C 1Q12A 2KHIA 4LF5Q 4A3BH 5EAYA 5IYDG 4LF8L 1HR0Q 4IFDG 4JOIC 3PUVA 5C0XJ 4DV1L 4GNXC 2WB1E 3OTOQ 4HIOA 2ATWA 2I0QA 4OONA 2OTJA 4L5RC 1PHJA 1EOVA 4A93H 3RR5A 1E1TA 1PH3A 4YCVA 4A3FH 4JBJA 4BY7H 1VQIA 4J15A 4A75A 2VUMG 3S2DH 1YITA 5LMUQ 4OX9L 4HIDA 1L0WA 2MO1A 1V9PA 4LFCQ 3E9HA 3ERSX 3PO3G 4P73A 3WWVA 1KXLA 2ZTEA 1VQAA 4GN3B 3ZJYC 2R7ZH 3M3YH 4IOAA 2JA7G 4MTNA 1JT8A 1HNWQ 4R1JA 3M4OH 4A3CH 1C9OA 2CFMA 1VS0A 3CCMA 3BJUA 1U0LA 2PNHA 1IBML 1CKNB 2DUDA 4LF9L 1VQGA 5C4JH 1IBKQ 1I50H 4A3DG 1VQMA 5GROA 4HJ9A 1Y1VG 4NPSA 1VQ4A 4DV3Q 1Y1WH 1QZHA 5IP9G 3TS0A 3HOUH 2A19A 1YJWA 3GTPH 1TWHH 2Z6KC 1YBYA 4JI1L 1NMFA 1SR3A 3GTKH 5IYDH 1UE6A 3STBD 4BXXG 1MIUA 4DR3L 4GLAC 5C44H 1N36Q 4QY7A 1CKOA 4X62L 3M85A 1W2BA 2UXDL 2YTVA 4IJLA 5FJ8H 2IX1A 1N33Q 1VQFA 1TWFH 2E8GA 3HOXH 2R93G 3HKZE 2VW9A 2E2IH 1GD7A 3FKIG 1HJPA 4JI7Q 1VQDA 2UU9Q 3PO3H 4DUYQ 1KC8C 1JJCB 2PMZE 1XNQL 2B29A 2HT1A 1R9TH 4A3KH 3J81j 3F2CA 3HFZB 3G48A 3RLNA 3HOZH 1VQ8A 4LF6L 3TQYA 3GTOH 3KOJA 1HR0W 2HIVA 2NVQH 5IWAQ 3VDYA 5DLQE 4DR2Q 4JV5Q 5IP9H 3PIOA 2ZJPA 2VQEL 1KD1C 2BH2A 4B3RL 2ID0A 1H95A 1L1OB 4EQ5A 4B3SL 3UE1A 2XGTA 1TXYA 1X3GA 4YY3Q 2UUAL 3CCEA 1KQSA 4GKKL 1X54A 1TWGH 2AKWB 3EBEA 3U58A 3UE0A 3PV0A 5C4XG 1IBLQ 3CC4A 4OWWB 4MNOA 4MZ9A 3CCLA 1L1OC 1YEZA 4LFBQ 2CKZB 3TEHB 4DV5Q 2ASBA 1Q8KA 1D7QA 1QUQB 1I5FA 3G71A 4Y52H 2I5LX 1QVFA 1VQ9A 4LF9Q 2R93H 2A8VA 4BY1H 3H0GG 3NEMA 4K0KQ 3HKZG 3I7FA 4R4CA 2H5XA 4LW1A 5JEAG 4DR1L 4X65Q 5C0XI 1HZBA 1X6OA 1X65A 1UE5A 1SRUA 3D0FA 4JOIA 3J7ZC 4ALPA 2R6GA 4GNXA 2UXBQ 4JI8L 1N9WA 1XNRQ 4YCUA 1Q81C 3T1YQ 4GOPB 1I94Q 4HJ7A 4A3BG 3CP0A 2E5LL 4B3MQ 1FJGL 5JJKA 1A63A 3CCSA 3TREA 4GOPC 4JC0A 1TWCH 4LF4L 5FLXc 4NB3A 1K8AC 2UUCQ 1NBWA 4A93G 5C4XH 4A3FG 4NXNL 2WAQE 3W5OA 1XMOL 3UDIA 2OQ0A 1IYJB 2I5HA 1PH1A 1HNZL 2Z6KA 1VQ6A 1CKNA 1XJVA 4DV6L 1KIXA 3KF6A 4LF7Q 4A3CG 3GTLH 3TS2A 4PZ6A 4JBKA 2AMCB 4DV4L 1FL0A 4YWLA 1VQJA 2IX0A 4DNIA 1QVGA 1J5EL 2K50A 4QIWE 4DAYB 4L5TA 4B3SQ 1WJJA 4JI4Q 2F3IA 3ER0A 5LMNQ 4DAMA 3Q8DA 4XTCS 1OXXK 2I5MX 4X66Q 1Y1WG 4JI0L 3HOUG 1AH9A 4BBRH 1KHIA 2OTLA 1PV4A 1X3EA 2L15A 4LWCA 4JCVE 4DR6Q 1IZ6A 2D62A 2CWAA 4IPGA 4RMFA 5FLMH 4JI2L 1NY4A 2JE6I 3J7A5 5C0XG 3MEFA 1VQHA 2K4KA 3UDXA 4LFAL 1I6HH 5C44G 1YJ9A 1LYLA 1P8LA 1Q86C 5HY6A 5FJ8G 4YWMA 2PQAB 2LXJA 5GAGC 5M3FH 1UE7A 1BKBA 2XTIA 3CQZH 3HOXG 2JK8A 1S72A 4IPHA 2ZTCA 3HOVH 1TWAH 5GADC 2WAQG 4DKAC 3I55A 1VQ5A 2UXCQ 2PI2E 4NXMQ 4DR7L 1QZGA 3PIPA 4BBSG 4JI6Q 2VZAA 4B3TL 4A3KG 3PUXA 4A3GG 1WCMH 3F1ZA 1JJGA 1HNXQ 1YHAA 3HOZG 2V1CC 1U5KA 3K8AA 4A3LG 2Q2HA 2ES2A 2B63H 3CW2C 4R4QA 4JYAL 1L1OA 3CCVA 4IFDJ 4XIGS 3S1NH 1K8GA 4A4IA 1EIYB 4JI3L 2RCNA 2ZM6L 4DV2L 1PH5A 2NVTH 3M9BA 4C3JH 3HKSA 2VQFL 1Q46A 2GVAA 4YHHL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  1QUQ A;  1EUJ A;  1N34 L;  4HIK A;  4A3E G;  4R4O A;  4L5Q A;  5K36 G;  3F8T A;  4O2D A;  2WB1 G;  3DLL A;  1PH8 A;  1SMX A;  1OTC A;  3CC2 A;  4DUZ Q;  2QEX A;  1C7Y A;  2IY5 B;  3J80 i;  2HHH Q;  4BY1 G;  2F4V Q;  3A5U A;  1KAW A;  1CUK A;  4X64 Q;  1N32 L;  3CXC A;  2D0O A;  2ALY B;  1Q1E A;  2JEB I;  1VQP A;  4Y7N H;  2UUB L;  5LMN W;  4BBS H;  3T1H L;  1OXS C;  4GKJ L;  3KYH C;  3OYY A;  1M1K C;  3CME A;  2LXK A;  4JI5 L;  1XMQ L;  3I2Z A;  2KEN A;  3PUZ A;  1GKH A;  4JG2 A;  4KLK A;  1KRT A;  4DR4 L;  4A3G H;  2CCZ A;  4WJ3 M;  1X9N A;  4R4I A;  2ZJQ A;  4LF8 Q;  3W1G A;  5BR8 L;  4A3L H;  2CQO A;  2Y0S E;  4DV1 Q;  4KI0 A;  3A5Z B;  1IXR A;  5C3E G;  5GQO A;  3S1Q H;  2Q2T A;  4GN4 B;  4DK3 C;  3M4Q A;  2QGQ A;  1EIF A;  2B3G A;  4A3M H;  4OX9 Q;  3AYH B;  2GVB A;  4A76 A;  3CCU A;  4IPC A;  1HH2 P;  4RG1 A;  5IYB G;  4DR5 L;  2GN5 A;  4JBM A;  2MFI A;  3HOY G;  5AJ3 L;  1E1O A;  1KRS A;  3AQQ A;  4A3E H;  5M5W H;  1K9M C;  2E2J H;  5JJI A;  2IT1 A;  1MKH A;  1PYS B;  4DV7 L;  1IBM Q;  1V1Q A;  3I56 A;  1N8R C;  3K7U C;  2NN6 I;  4BA1 I;  5IP7 H;  3AFP A;  3MXN B;  4HIM A;  2MQH A;  2OWO A;  1YIJ A;  3KJO A;  4QJF A;  3I4M G;  3GD7 A;  4POF A;  1HZA A;  4JI1 Q;  3STB C;  1CSP A;  1FGU A;  3L7Z C;  4LUO A;  2VQF Q;  3ULJ A;  1BVS A;  4DR3 Q;  4KHP L;  4DV0 L;  4KHZ A;  4BBR G;  5JJL A;  3S15 H;  4X62 Q;  1B70 B;  2UXD Q;  3K80 C;  5J3B A;  3U4V A;  3J81 i;  4AQY L;  1DGS A;  5C3E H;  5FLM G;  4WJ4 A;  3ULP A;  4LF5 L;  1MJE A;  1D8L A;  3NEL A;  2PQA A;  5M5X H;  4A3I H;  4QQB X;  1Q7Y C;  3I4N H;  3EIV A;  1HR0 L;  1KL9 A;  2YV5 A;  2WFW A;  2VL6 A;  3CPW A;  3RN2 A;  3HOW H;  3JAM c;  1SE8 A;  1UEB A;  4P72 A;  3OTO L;  2UUB Q;  1XNQ Q;  5M3F G;  2ZTD A;  3K7A H;  2WP8 J;  5ELO A;  5IYB H;  1PYB A;  3HOY H;  1X55 A;  4OXP A;  1G6P A;  1XPO A;  2Z0S A;  3NEN A;  3HOV G;  4P75 A;  1T9H A;  5LMU L;  4IFD I;  1RL2 A;  2K52 A;  4LFC L;  4DK6 C;  2JA6 H;  2R92 H;  4OWT B;  2KHJ A;  4LF6 Q;  1P16 A;  1VQ7 A;  3GTJ H;  2AWO A;  1WCM G;  3GDE A;  1ASZ A;  3PO2 H;  2IHF A;  1O7I A;  1HNW L;  3CPF A;  4B3R Q;  2VQE Q;  1VCI A;  4FDB A;  4TVA B;  3A74 A;  3I4M H;  1FVI A;  4YWK A;  2BA1 A;  2Q2I A;  2UUA Q;  2VY3 A;  2B63 G;  4LNQ A;  1IBK L;  5E7N A;  2JEA I;  1AE3 A;  4GKK Q;  3EN2 A;  3KLW A;  4AH6 A;  3RNU A;  1VQO A;  2Q2U A;  4DV3 L;  4AIM A;  5IYC G;  3AEV A;  3RLF A;  4IPD A;  1NJI C;  4A3J G;  1SLJ A;  2FXQ A;  1LUZ A;  3K0X A;  1IL2 A;  2AHO B;  3KFU A;  2JA8 H;  3L2P A;  1WOC A;  3DM3 A;  2ZJR A;  4LUV A;  4OO1 I;  2R7D A;  1CSQ A;  1OXV A;  1A0I A;  1N36 L;  3CCQ A;  4P71 A;  1EQQ A;  2PI2 A;  4BA2 I;  4DR1 Q;  1N33 L;  1V43 A;  2BH8 A;  2F52 A;  1WYD A;  4GS3 A;  4POG A;  4P74 A;  4IO9 A;  4UPA A;  1G51 A;  4JI7 L;  3S14 H;  3RN5 A;  1BBW A;  2UU9 L;  4JI8 Q;  2HQL A;  4DUY L;  5GAH C;  4EX5 A;  5M3M H;  2JJQ A;  3GTQ H;  1HZ9 A;  3CAM A;  1VQE A;  2YTY A;  4IOC A;  2E5L Q;  1NTG A;  4QGU A;  3PUY A;  1MJC A;  1JJ2 A;  1FJG Q;  3GTM H;  1JE5 A;  2QA4 A;  1YHB A;  2EQS A;  2R7F A;  2YU9 H;  1A8V A;  2NVY H;  4LF4 Q;  2KBN A;  2KCT A;  5IWA L;  1Q82 C;  4DPG A;  4DR2 L;  4JV5 L;  5H1S E;  4NXN Q;  5IYC H;  4GLX A;  4A3M G;  1XMO Q;  1SN8 A;  2K14 A;  3OW2 A;  3KJP A;  3L0O A;  4YCW A;  4A3J H;  4O0A A;  1QVC A;  1Z9F A;  2OCE A;  4YY3 L;  3S17 H;  1W3S A;  5IY0 A;  1VQL A;  1HNZ Q;  1IBL L;  3KDF B;  3RLO A;  1E3P A;  4DV6 Q;  3H3V I;  3KF8 B;  4LFB L;  2EXD A;  3S24 A;  4DV5 L;  1EFW A;  2JA5 H;  3CF5 A;  3GO5 A;  4DV4 Q;  2DGY A;  1J5E Q;  1G29 1;  1XTD A;  5IP7 G;  4UP8 A;  1B8A A;  3KF6 B;  5M5Y H;  1YI2 A;  4K0K L;  3BU2 A;  4JI0 Q;  1YVC A;  4OO1 G;  1YZ6 A;  4PZ7 A;  1VQK A;  4QL5 A;  4X65 L;  4HJ5 A;  1ASY A;  4JI2 Q;  2NZO A;  3G6E A;  1Y14 B;  3F2B A;  2C35 B;  2OQK A;  4PMW A;  1XPU A;  4GOP A;  2BA0 A;  2UXB L;  4LFA Q;  1E22 A;  3F2D A;  1XNR L;  3E9I A;  1WI5 A;  3CMA A;  3ULL A;  3T1Y L;  2MO0 A;  1I94 L;  2JQO A;  4PZ8 A;  1PFS A;  4A3I G;  4L5S A;  3I4N G;  5IT9 c;  1EQR A;  4B3M L;  1PVO A;  1GM5 A;  2VUM H;  3SGI A;  1E7Z A;  1JB7 A;  2JA9 A;  3HOW G;  1B7Y B;  1PH6 A;  4GLV B;  4OWX B;  4C2M H;  4DR7 Q;  3J80 c;  4UP7 A;  1OXU A;  1SRO A;  3UDG A;  2UUC L;  3PF5 A;  4B3T Q;  4APV A;  2JA7 H;  1Z47 A;  1PA6 A;  3CC7 A;  2JA6 G;  2R92 G;  4HJA A;  1I3Q H;  3S2H H;  4GN5 A;  1K0R A;  3PF4 A;  3B6Y A;  2K5N A;  2RHQ B;  2RF4 A;  3RZD H;  3E0E A;  3M4P A;  2HIX A;  3UDF A;  3A0J A;  4A3D H;  3S1M H;  4JYA Q;  1S40 A;  2K5H A;  3PO2 G;  4X6A H;  1Y1V H;  1CKM A;  2YYZ A;  1OXT A;  3PGZ A;  3PSI A;  4LF7 L;  1C0A A;  1JMC A;  3PCO B;  2VNU D;  1X3F A;  4JI3 Q;  2ZM6 Q;  4DV2 Q;  2NZH A;  2VS1 A;  1EYG A;  4JI4 L;  1L2F A;  4UP9 A;  4C3H H;  5LMN L;  1AE2 A;  4X66 L;  1X56 A;  4YHH Q;  4BXX H;  1VQB A;  1N34 Q;  1EWI A;  3M7N A;  5GAE C;  2MNA A;  2Y0S G;  2YTX A;  3CD6 A;  4DR6 L;  4LUZ A;  4AYB E;  1UE1 A;  3JC6 6;  3I4O A;  3JAM i;  2JA8 G;  1GO3 E;  1YNX A;  1BBU A;  3H15 A;  1VQN A;  1E24 A;  1N32 Q;  1K73 C;  3FKI H;  4R4T A;  3S16 H;  1PH2 A;  1VQC A;  3T1H Q;  3AFQ A;  4IJH A;  4GKJ Q;  3S1R H;  4JI5 Q;  1XMQ Q;  4PG3 A;  4ME3 A;  3CCR A;  1K3R A;  4DR4 Q;  5JEA J;  3BZC A;  5IE8 A;  2N8N A;  2UXC L;  4NXM L;  5BR8 Q;  1GVP A;  1PH4 A;  3ICE A;  1K83 H;  3NBH B;  5M3M G;  4JI6 L;  3U50 C;  2N3S A;  3LGJ A;  1PH7 A;  4JBW A;  2LSS A;  1HNX L;  1J6Q A;  2K75 A;  3RZO H;  3J81 c;  3H3V H;  3FHW A;  2K5V A;  2E2H H;  2N78 A;  1PH9 A;  3FP9 A;  4DR5 Q;  2NVX H;  2NN6 G;  5AJ3 Q;  4TQU S;  1NE3 A;  1YJN A;  4BY7 G;  1SFO H;  1HZC A;  3BZK A;  2A1A A;  2RHS B;  1YHQ A;  2EIF A;  4C3I H;  3KDF A;  3TRZ A;  3G4S A;  2CWP A;  3U4Z A;  4DV7 Q;  4HJ8 A;  2N49 A;  1WFQ A;  3W1B A;  1S3O A;  4AYB G;  2IHE A;  2R7Z G;  3H0G H;  1M90 C;  3GTG H;  2JA5 G;  2D0P A;  1LTL A;  5ELN A;  4DUZ L;  3D31 A;  2HHH L;  2F4V L;  1UWV A;  4X64 L;  4KHP Q;  1A62 A;  3IRB A;  3PUW A;  4DV0 Q;  3CCJ A;  2AWN A;  1RIP A;  1XPR A;  1Q1B A;  4AQY Q;  1LM0 A;  1NMG A;  3K81 C;  5HGQ A;  4GNX B;  2KCM A;  4UY8 C;  1Q12 A;  2KHI A;  4LF5 Q;  4A3B H;  5EAY A;  5IYD G;  4LF8 L;  1HR0 Q;  4IFD G;  4JOI C;  3PUV A;  5C0X J;  4DV1 L;  4GNX C;  2WB1 E;  3OTO Q;  4HIO A;  2ATW A;  2I0Q A;  4OON A;  2OTJ A;  4L5R C;  1PHJ A;  1EOV A;  4A93 H;  3RR5 A;  1E1T A;  1PH3 A;  4YCV A;  4A3F H;  4JBJ A;  4BY7 H;  1VQI A;  4J15 A;  4A75 A;  2VUM G;  3S2D H;  1YIT A;  5LMU Q;  4OX9 L;  4HID A;  1L0W A;  2MO1 A;  1V9P A;  4LFC Q;  3E9H A;  3ERS X;  3PO3 G;  4P73 A;  3WWV A;  1KXL A;  2ZTE A;  1VQA A;  4GN3 B;  3ZJY C;  2R7Z H;  3M3Y H;  4IOA A;  2JA7 G;  4MTN A;  1JT8 A;  1HNW Q;  4R1J A;  3M4O H;  4A3C H;  1C9O A;  2CFM A;  1VS0 A;  3CCM A;  3BJU A;  1U0L A;  2PNH A;  1IBM L;  1CKN B;  2DUD A;  4LF9 L;  1VQG A;  5C4J H;  1IBK Q;  1I50 H;  4A3D G;  1VQM A;  5GRO A;  4HJ9 A;  1Y1V G;  4NPS A;  1VQ4 A;  4DV3 Q;  1Y1W H;  1QZH A;  5IP9 G;  3TS0 A;  3HOU H;  2A19 A;  1YJW A;  3GTP H;  1TWH H;  2Z6K C;  1YBY A;  4JI1 L;  1NMF A;  1SR3 A;  3GTK H;  5IYD H;  1UE6 A;  3STB D;  4BXX G;  1MIU A;  4DR3 L;  4GLA C;  5C44 H;  1N36 Q;  4QY7 A;  1CKO A;  4X62 L;  3M85 A;  1W2B A;  2UXD L;  2YTV A;  4IJL A;  5FJ8 H;  2IX1 A;  1N33 Q;  1VQF A;  1TWF H;  2E8G A;  3HOX H;  2R93 G;  3HKZ E;  2VW9 A;  2E2I H;  1GD7 A;  3FKI G;  1HJP A;  4JI7 Q;  1VQD A;  2UU9 Q;  3PO3 H;  4DUY Q;  1KC8 C;  1JJC B;  2PMZ E;  1XNQ L;  2B29 A;  2HT1 A;  1R9T H;  4A3K H;  3J81 j;  3F2C A;  3HFZ B;  3G48 A;  3RLN A;  3HOZ H;  1VQ8 A;  4LF6 L;  3TQY A;  3GTO H;  3KOJ A;  1HR0 W;  2HIV A;  2NVQ H;  5IWA Q;  3VDY A;  5DLQ E;  4DR2 Q;  4JV5 Q;  5IP9 H;  3PIO A;  2ZJP A;  2VQE L;  1KD1 C;  2BH2 A;  4B3R L;  2ID0 A;  1H95 A;  1L1O B;  4EQ5 A;  4B3S L;  3UE1 A;  2XGT A;  1TXY A;  1X3G A;  4YY3 Q;  2UUA L;  3CCE A;  1KQS A;  4GKK L;  1X54 A;  1TWG H;  2AKW B;  3EBE A;  3U58 A;  3UE0 A;  3PV0 A;  5C4X G;  1IBL Q;  3CC4 A;  4OWW B;  4MNO A;  4MZ9 A;  3CCL A;  1L1O C;  1YEZ A;  4LFB Q;  2CKZ B;  3TEH B;  4DV5 Q;  2ASB A;  1Q8K A;  1D7Q A;  1QUQ B;  1I5F A;  3G71 A;  4Y52 H;  2I5L X;  1QVF A;  1VQ9 A;  4LF9 Q;  2R93 H;  2A8V A;  4BY1 H;  3H0G G;  3NEM A;  4K0K Q;  3HKZ G;  3I7F A;  4R4C A;  2H5X A;  4LW1 A;  5JEA G;  4DR1 L;  4X65 Q;  5C0X I;  1HZB A;  1X6O A;  1X65 A;  1UE5 A;  1SRU A;  3D0F A;  4JOI A;  3J7Z C;  4ALP A;  2R6G A;  4GNX A;  2UXB Q;  4JI8 L;  1N9W A;  1XNR Q;  4YCU A;  1Q81 C;  3T1Y Q;  4GOP B;  1I94 Q;  4HJ7 A;  4A3B G;  3CP0 A;  2E5L L;  4B3M Q;  1FJG L;  5JJK A;  1A63 A;  3CCS A;  3TRE A;  4GOP C;  4JC0 A;  1TWC H;  4LF4 L;  5FLX c;  4NB3 A;  1K8A C;  2UUC Q;  1NBW A;  4A93 G;  5C4X H;  4A3F G;  4NXN L;  2WAQ E;  3W5O A;  1XMO L;  3UDI A;  2OQ0 A;  1IYJ B;  2I5H A;  1PH1 A;  1HNZ L;  2Z6K A;  1VQ6 A;  1CKN A;  1XJV A;  4DV6 L;  1KIX A;  3KF6 A;  4LF7 Q;  4A3C G;  3GTL H;  3TS2 A;  4PZ6 A;  4JBK A;  2AMC B;  4DV4 L;  1FL0 A;  4YWL A;  1VQJ A;  2IX0 A;  4DNI A;  1QVG A;  1J5E L;  2K50 A;  4QIW E;  4DAY B;  4L5T A;  4B3S Q;  1WJJ A;  4JI4 Q;  2F3I A;  3ER0 A;  5LMN Q;  4DAM A;  3Q8D A;  4XTC S;  1OXX K;  2I5M X;  4X66 Q;  1Y1W G;  4JI0 L;  3HOU G;  1AH9 A;  4BBR H;  1KHI A;  2OTL A;  1PV4 A;  1X3E A;  2L15 A;  4LWC A;  4JCV E;  4DR6 Q;  1IZ6 A;  2D62 A;  2CWA A;  4IPG A;  4RMF A;  5FLM H;  4JI2 L;  1NY4 A;  2JE6 I;  3J7A 5;  5C0X G;  3MEF A;  1VQH A;  2K4K A;  3UDX A;  4LFA L;  1I6H H;  5C44 G;  1YJ9 A;  1LYL A;  1P8L A;  1Q86 C;  5HY6 A;  5FJ8 G;  4YWM A;  2PQA B;  2LXJ A;  5GAG C;  5M3F H;  1UE7 A;  1BKB A;  2XTI A;  3CQZ H;  3HOX G;  2JK8 A;  1S72 A;  4IPH A;  2ZTC A;  3HOV H;  1TWA H;  5GAD C;  2WAQ G;  4DKA C;  3I55 A;  1VQ5 A;  2UXC Q;  2PI2 E;  4NXM Q;  4DR7 L;  1QZG A;  3PIP A;  4BBS G;  4JI6 Q;  2VZA A;  4B3T L;  4A3K G;  3PUX A;  4A3G G;  1WCM H;  3F1Z A;  1JJG A;  1HNX Q;  1YHA A;  3HOZ G;  2V1C C;  1U5K A;  3K8A A;  4A3L G;  2Q2H A;  2ES2 A;  2B63 H;  3CW2 C;  4R4Q A;  4JYA L;  1L1O A;  3CCV A;  4IFD J;  4XIG S;  3S1N H;  1K8G A;  4A4I A;  1EIY B;  4JI3 L;  2RCN A;  2ZM6 L;  4DV2 L;  1PH5 A;  2NVT H;  3M9B A;  4C3J H;  3HKS A;  2VQF L;  1Q46 A;  2GVA A;  4YHH L; 
#chains in the Genus database with same CATH topology
 3NUC A;  1I3Q B;  1SE4 A;  3K0Y A;  2F1M A;  2RKS A;  2LS0 1;  4PQX A;  1PH8 A;  4O2D A;  1X3P A;  1OTC A;  2VUG A;  1EQT A;  3FPP A;  5KG6 A;  4XQQ A;  1KAW A;  4HSV A;  4F4X A;  1F77 A;  1F9S A;  4I55 F;  2ALY B;  2JEB I;  1WTR A;  2UUB L;  4IRC A;  1RTN A;  4GKJ L;  2LXK A;  3I2Z A;  4HR7 B;  3Q23 A;  4A3G H;  4O3N A;  2FMC A;  2XN9 C;  1X9N A;  1WTV A;  4RNM A;  4AQY H;  4A3L H;  2CQO A;  2FK2 A;  1HPC A;  2E5L H;  1IXR A;  3S1Q H;  4KMU C;  3FKI B;  3TP5 A;  4R9W A;  4XT3 B;  4G57 A;  2YYA A;  2DY7 A;  4OX9 Q;  3T53 B;  3AYH B;  3S1R B;  3P1H A;  2GVB A;  1DD2 A;  3CCU A;  4IPC A;  1HH2 P;  4RG1 A;  4NXN H;  3MZ5 A;  2GN5 A;  3HOY G;  3TP6 A;  3AQQ A;  1GUT A;  2IT1 A;  1K1Q A;  1MKH A;  4DV7 L;  2EZV A;  5KFC A;  1ZQ7 A;  3I56 A;  4DV6 H;  2B63 A;  2C00 A;  2NN6 I;  1VAJ A;  3RZO B;  2SCU B;  2BQR A;  2OWO A;  1AN8 A;  4H44 C;  4MV8 A;  2KVM A;  4DV4 H;  1UNS A;  1B3A A;  3GD7 A;  4KY5 A;  4POF A;  3STB C;  1CSP A;  4RB2 C;  4XYL B;  5D1P A;  1BVS A;  4DR3 Q;  1MD2 D;  3BVM A;  5CBA E;  4ECZ A;  4X62 Q;  3SEB A;  2UXD Q;  3U4V A;  5C3E H;  4LFA H;  4XDX A;  4WJ4 A;  4QQB X;  3RJ0 A;  2SNM A;  1TT2 A;  5BPH A;  1Q7Y C;  4K14 A;  1DOL A;  3OIP A;  1KL9 A;  2YV5 A;  2WFW A;  3HOW H;  3RN2 A;  2UUB Q;  1ESF A;  5M3F G;  2WP8 J;  4IUU A;  5KFN A;  1SXT A;  1XPO A;  1FYC A;  1D2B A;  5EPJ A;  4P75 A;  1G6P A;  2UU9 H;  3BDO A;  1X3Q A;  5HUR A;  4LF6 Q;  2KHJ A;  3FMC A;  1NCV A;  1EY8 A;  1D1I A;  3OWE B;  4A3B B;  4TRD A;  3GDE A;  3CPF A;  1UC9 A;  1JIH A;  4FDB A;  3I4M H;  1FVI A;  3QZ7 A;  2Q2I A;  2Z8L A;  2EYJ A;  1IBK L;  5E7N A;  2JEA I;  1Z2N X;  3RTX A;  4Q44 A;  3RNU A;  1L0X B;  4DV3 L;  2JA7 A;  4AIM A;  4O3Q A;  2O03 A;  2GPW A;  1U4M A;  3MFH A;  1I3Q A;  1SLJ A;  4C3J G;  4LAA A;  1IL2 A;  5E4X A;  1WOC A;  4XX0 B;  2R7D A;  1PRT D;  4WOR A;  3ND8 A;  2F0T A;  4N9T A;  2R3Z A;  4F7X A;  5EKL A;  4CKE A;  1I50 B;  1V43 A;  2F52 A;  5CMD A;  1Y1W B;  4GS3 A;  3HOU B;  1QE6 A;  1B9N A;  4UPA A;  3NK9 A;  5EJW A;  3RN5 A;  4HR7 A;  1U4R A;  4DUY L;  1XMQ H;  1ENF A;  1XWE A;  1SNC A;  4EX5 A;  1I4X A;  1HZ9 A;  1ENA A;  2EE1 A;  1XNR H;  4QGU A;  5D14 A;  2PZW A;  4ULL A;  2R85 A;  2RCF A;  3CRL C;  2SEB D;  3CRK C;  2EQS A;  1JR0 D;  2PN1 A;  5J2T F;  2KBN A;  2KCT A;  5CV9 A;  1Q82 C;  3VR2 A;  2NN6 H;  2MP1 A;  4XQN A;  2JN4 A;  2JA6 A;  1SN8 A;  2K14 A;  1CQI B;  3L0O A;  4O0A A;  3NE5 B;  4RAU C;  1R9T B;  1M6V A;  3S17 H;  2A5H A;  1YNJ C;  5KEE A;  3C0F B;  1V4Y A;  2SNS A;  2C28 A;  4LFB L;  2EXD A;  4JV0 A;  1RCV D;  1CFM A;  3V96 A;  4H7B A;  5C6A A;  2NVQ B;  1J5E Q;  4F4Z A;  5CBE E;  4L1K A;  3NBI A;  2XRQ D;  5A2Q E;  4XQJ A;  1YVC A;  3MFG A;  5COR A;  2RDH A;  4O3S A;  4HJ5 A;  2Y0S A;  1TWG B;  3GIL A;  4Q0Y A;  1K3B C;  3OMC A;  4ED3 A;  4JI2 Q;  1Y14 B;  1R4P B;  2OQK A;  4DV0 H;  2WKC A;  3VR5 A;  2UXB L;  4O4I F;  2UVV A;  1E2W A;  4DR6 H;  3T1Y L;  2J7Z A;  2JQO A;  4E6I A;  4BY1 B;  1HR0 H;  1CQF A;  4K5W A;  4ODG A;  4C1N K;  3NPP A;  3SGI A;  3HOW G;  5EPK A;  1VF5 C;  1QWY A;  5CV5 A;  2B2W A;  3OIQ A;  5IT9 L;  4ED8 A;  1VDZ A;  1SRO A;  3GV5 B;  4I7A A;  4APV A;  4YP3 A;  2JA7 H;  5IIF A;  3BDL A;  1Z47 A;  4KN7 C;  1FGB D;  3I91 A;  4ZKB B;  1I3Q H;  3FEW X;  1S5F D;  3A7A B;  4C1N I;  5BN3 A;  2K5N A;  2FHT A;  1HNW H;  2HIX A;  4KD4 A;  4TUY F;  3TP8 A;  3MR2 A;  1WR2 A;  2N88 A;  2K5H A;  3N6R A;  4DAY A;  3N6X A;  4HQ6 A;  3G6V A;  4J9M A;  1C0A A;  1TWC B;  1X3F A;  1ENC A;  4DV2 Q;  1L2F A;  2SDF A;  1M0T A;  1DV2 A;  2JEG A;  3T56 B;  4RFB A;  4LUZ A;  2XCA A;  2Q8I B;  5KFB A;  1YNX A;  3H15 A;  1VQN A;  3GTL B;  1E24 A;  5JJZ A;  1N32 Q;  1RYR A;  3FKI H;  2PVP A;  3S9W A;  4R4T A;  3ETJ A;  1PH2 A;  1VQC A;  3KLR A;  3WNZ A;  3S1R H;  4JI5 Q;  4DNR B;  1TR5 A;  4TQR A;  3A56 A;  2F0U A;  4BBR B;  3BZC A;  4CJ0 B;  3OUZ A;  2UXC L;  3L4K A;  2K32 A;  5BR8 Q;  1PH4 A;  3ICE A;  3NBH B;  2IPK D;  2MHV A;  3U50 C;  4S3S A;  1AP0 A;  4JBW A;  5KYI A;  1I4Q A;  2FMM A;  2LSS A;  3AU7 A;  1EZ6 A;  4HTH A;  3KXY T;  3RZO H;  2KUM A;  4TSS A;  4L6T B;  4UFZ A;  1I7L A;  4C2M A;  4ZCK A;  4CGY B;  1HUM A;  2F0S A;  2G5D A;  1STG A;  4DR2 H;  3FP9 A;  3HOV B;  2V4Q A;  1R9T A;  2YZN A;  2NN6 G;  5AJ3 Q;  3NXW A;  4EYI B;  4OX9 H;  1ZEQ X;  4YY3 H;  1IW7 D;  2V9W A;  2A1A A;  2RHS B;  1YHQ A;  3TRZ A;  3PVX A;  2CWP A;  3U4Z A;  1EYD A;  1EY9 A;  1IL8 A;  4EVO A;  1WCM B;  2R7Z G;  5G3L D;  5TSS A;  1M90 C;  1ICW A;  4LF9 H;  5ELN A;  1KEE A;  3D31 A;  3WOE A;  3ND9 A;  1B6S A;  3RB6 A;  4WBN F;  1BO0 A;  1TWG A;  4X64 L;  2OT2 A;  3IRB A;  5HBR B;  3Q0A A;  2NU8 B;  2AWN A;  4XYQ A;  4HNU A;  4X65 H;  3GII A;  3BAB A;  1FNV A;  5HGQ A;  2KCM A;  3PIO 3;  5EWG A;  4A3B H;  4DR3 H;  3WOF A;  5IYD G;  2XCL A;  2K7V A;  3NTH A;  4RGT A;  2UXD H;  5KT5 A;  4EBC A;  5C3X A;  3PUV A;  4OON A;  3QIA A;  4L5R C;  1EOV A;  1HQR D;  2BDN A;  4A3F H;  1VQI A;  4A75 A;  5DM7 3;  3UQ8 A;  4QWE A;  1TS5 A;  5LMU Q;  5FOB B;  4BBS B;  4LFC Q;  1L0W A;  2MO1 A;  3E9H A;  3ERS X;  3PO3 G;  1RYS A;  4P73 A;  4X3K A;  3L3O C;  1BF4 A;  4MN3 A;  2W9C B;  1K83 A;  1ZYR C;  4IOA A;  2JA7 G;  3HS0 C;  4KHV A;  2CW0 D;  5KFG A;  1CA6 A;  1LT5 D;  1JT8 A;  3HBL A;  1S97 A;  3MXN A;  1T5E A;  1VS0 A;  3BJY A;  5EOY A;  3NWS A;  2PNH A;  4MAM A;  2DUD A;  1TWC A;  3KLS X;  1I50 H;  4LF7 H;  4M8A A;  2NVX A;  4A3M B;  4NPS A;  5COY A;  1VQ4 A;  1Y1W H;  3HOU H;  2A6H D;  1SFO A;  4JW0 A;  1YJW A;  3D4D A;  3Q24 A;  2Z6K C;  4H0L C;  1QCB D;  3IAY A;  4X66 H;  5DG9 A;  1MIU A;  5EPL A;  5KG1 A;  2QEJ C;  3T5L A;  1W2B A;  4Q0F A;  2YZG A;  4J0M A;  4FF3 A;  4BS9 A;  2C2D A;  1CHQ D;  2R93 G;  2A68 D;  1GD7 A;  3FKI G;  4Z9C B;  1M8A A;  1Q90 A;  1LV9 A;  1K0S A;  1R9T H;  4TQS A;  3H4B A;  1F9R A;  1PRT F;  2RDF A;  3NBH A;  3C3L A;  5JUM A;  3G48 A;  2E74 C;  4I50 F;  3H91 A;  4JI6 H;  3TQY A;  4FP5 D;  4F50 A;  2PNR C;  2HIV A;  4A3I B;  2EYF A;  2NVQ H;  3OHA A;  1HNX H;  5IWA Q;  1GLV A;  3VDY A;  4JV5 Q;  5IP9 H;  4J6H A;  4QUC A;  3PIO A;  2YS6 A;  5EZY F;  4B3S L;  3UE1 A;  1X3G A;  4DGZ A;  4OL7 A;  2DN8 A;  3CCE A;  3HOY B;  2ASJ A;  1TWG H;  2F0K A;  2AKW B;  4J9L A;  1IBL Q;  3CC4 A;  1L1O C;  2VB3 X;  3TEH B;  4EBD A;  2B2V C;  2JYO A;  2RSO A;  1I4R A;  3I70 A;  1QUQ B;  2ASB A;  1TVX A;  2F0P A;  2CW8 A;  4BY1 H;  2NTT A;  3IKJ A;  2FJZ A;  3HEJ A;  5D8D A;  1GUO A;  1TY0 A;  2NUC A;  4LW1 A;  3KLS A;  2NB0 A;  2ASD A;  1X6O A;  1X65 A;  1SRU A;  3J7Z C;  2R6G A;  3ITP A;  4O1N A;  1N9W A;  5T14 A;  1KAB A;  1I4H A;  4CKB A;  2B2T A;  2JA8 B;  1RF2 D;  2CHB D;  1EUD B;  4HSP A;  3DM1 A;  5DGA A;  4DXF A;  4A3B G;  5LL6 S;  3H40 A;  2W9B A;  1JOQ A;  5C5L A;  2E5L L;  2CQY A;  5ISR A;  4YB8 B;  3MR5 A;  1FKA H;  1HFG A;  1JQY D;  3HXL A;  1A63 A;  1V8Q A;  1TWC H;  4P2C B;  2UUC Q;  1NBW A;  1GJX A;  4A3F G;  3I12 A;  2W9C A;  4NXN L;  2K05 A;  5FLX L;  1DOM A;  3W5O A;  1LAC A;  3K57 A;  2F0J A;  3BQ0 A;  3LML A;  4R8U B;  3GTQ B;  5KNB A;  2IWH A;  2XGP A;  2W6O A;  2WIN B;  1XJV A;  1HQM C;  4DV6 L;  1KIX A;  1JX4 A;  3KF6 A;  3GTL H;  3TS2 A;  2YU9 B;  4PZ6 A;  1M7J A;  4DV4 L;  1VQJ A;  4B3S Q;  1BJT A;  4CDE C;  4JI4 Q;  4L5T A;  3T16 A;  5LMN Q;  4DAM A;  1Y1W G;  3HOU G;  4YIJ A;  4ECQ A;  4BBR H;  4IRD A;  4JI1 H;  4DV2 H;  1Z7T A;  4JCV E;  1KNA A;  4AYB B;  2DJF C;  2VQF H;  4RMF A;  2RGV A;  4IPG A;  4K5V A;  5FLM H;  5KT7 A;  3MWD A;  5C0X G;  2K4K A;  3LWB A;  3T51 B;  4LFA L;  3R5X A;  5I4D A;  1LYL A;  2JA5 B;  3KUP A;  1S5E D;  3CVZ A;  4HNT A;  2PQA B;  3PR5 B;  2EJM A;  5AFW A;  4DK1 A;  1GUS A;  4F4W A;  1S10 A;  4EGJ A;  3T4A C;  5JPN C;  3TN2 A;  3HOV H;  3OHX C;  4RUA A;  1XNQ H;  5KGU A;  4NXM Q;  3RB0 A;  2YS7 A;  1M4V A;  1PFB A;  2EDG A;  1LTR D;  4DL3 A;  4ECV A;  3PUX A;  1LTB D;  1WCM H;  3T5H A;  1MZB A;  2V1C C;  1EY5 A;  1TKW B;  2Q2H A;  4EQP A;  2JEJ A;  2MPM A;  3CW2 C;  4RKL A;  4B3R H;  1FR3 A;  2VUM B;  4UCV A;  5I9O A;  3RGZ A;  4A4I A;  1EIY B;  3J80 W;  5BPF A;  1B3Q A;  2KJX A;  3TQ1 A;  4J9K A;  5I2Y A;  4J9P A;  1Y8O B;  4H02 A;  5E3F A;  3S2H B;  1QUQ A;  3SK6 A;  1EUJ A;  4CDD C;  4ECR A;  4UCT A;  3E5S A;  4L5Q A;  2X0S A;  2RA4 A;  4DUZ Q;  2QEX A;  3I4L A;  4YAK B;  3J80 i;  3LX0 A;  5D1O B;  1Y1V B;  4BY1 G;  2HHH Q;  1S4Z A;  2F4V Q;  2DY8 A;  1CUK A;  4EG0 A;  3Q8R B;  3CU7 A;  1VQP A;  1Q1E A;  3PQI A;  2VQD A;  2DJG C;  4BBS H;  1OXS C;  3KYH C;  2K03 A;  4V19 0;  4FS1 A;  4RZR A;  1XMQ L;  2ASL A;  3PUZ A;  2KEN A;  5G3L F;  1GKH A;  2EYM A;  4ZUI A;  1KRT A;  4B9W A;  4DR4 L;  4R8I A;  2YZM A;  3RBE A;  1JWM D;  2ZJQ A;  4LF8 Q;  5EQ0 A;  1UNN C;  4MV9 A;  4DV1 Q;  5C8Y F;  1BCP F;  2A69 C;  3A5Z B;  3E0J A;  1DON A;  2A6E C;  1FJG H;  3CQZ A;  2PO4 A;  4DK3 C;  2Q2T A;  4M9U A;  4MTK A;  2QGQ A;  1EIF A;  2B3G A;  4A3M H;  4LF4 H;  1O7Z A;  2AQ2 B;  3U9O A;  2RDG A;  4A76 A;  3RAQ A;  1KDA A;  1EU4 A;  5IYB G;  5D3I B;  5KFV A;  1XMO H;  3TDQ A;  4LFC H;  1E1O A;  3IL8 A;  5J1Z A;  4DN4 M;  1IBM Q;  4MA0 A;  4LH7 A;  3K7U C;  2ZJT A;  3E5N A;  4ECY A;  1E2Z A;  1YIJ A;  3J81 W;  3N52 A;  1EEF D;  4PWQ A;  1YNN D;  1FGU A;  3H3V C;  5JJL A;  3N43 B;  3TSS A;  4DV0 L;  4BBR G;  1KDC A;  1B70 B;  5J3B A;  1D6E C;  3J81 i;  3MR3 A;  5L1I A;  4J8Q A;  3K5M A;  2WYO A;  2X69 A;  5FLM G;  3KHR A;  3FMA A;  4LF5 L;  5I6Y A;  1MJE A;  3GTG B;  3EVQ A;  2PQA A;  4A3I H;  5BN5 A;  2F0I A;  3EIV A;  1HR0 L;  2WV6 D;  5DAU A;  2ZTD A;  5ELO A;  2K5D A;  4M1U B;  1PYB A;  3HOY H;  4IUR A;  2Z0S A;  3HOV G;  4Y52 H;  2K52 A;  2LMC B;  4OWT B;  2FB9 A;  2KCC A;  3C1E A;  1VBG A;  4N8F A;  4F8M A;  2AWO A;  1WCM G;  1HNW L;  2VQE Q;  1VBH A;  3TIN A;  2EXZ A;  4TVA B;  3A74 A;  3VYS A;  4JYA H;  4MV1 A;  2AGO A;  2UUA Q;  4GKK Q;  1PLF A;  1AE3 A;  4JV5 H;  4B9X A;  1VQO A;  1ONL A;  3RLF A;  1DCZ A;  4UHV A;  1QB5 D;  2R7Z B;  1SYC A;  2FXQ A;  3JAM E;  1LUZ A;  2FMA A;  4YHH H;  5DLF A;  2AHO B;  2JA8 H;  4K6L A;  3VA5 A;  1N34 H;  2NYZ D;  2ZJR A;  4N9P A;  1A0I A;  5D1O A;  3CCQ A;  5C5J A;  1Y1V A;  2FLL A;  2PI2 A;  4BA2 I;  3F8N A;  4RB3 C;  4RB1 A;  4U68 A;  4DR1 Q;  1N33 L;  5LOV F;  1WYD A;  5KFJ A;  5KFF A;  5EKK A;  1SND A;  3GTP B;  1G51 A;  4JI7 L;  4RKB A;  1BBW A;  4JI8 Q;  2MCT A;  2HQL A;  2UVR A;  3JRW A;  3M4I A;  5C5M A;  1BOS A;  3GTQ H;  2L55 A;  3JRX A;  1DJR D;  3CAM A;  1VQE A;  2VOB A;  4XZ3 B;  2UVU A;  1MJC A;  4UAI A;  1JE5 A;  2HQE A;  5A2Q L;  4OGQ C;  2R7K A;  3CHB D;  2R7F A;  2YU9 H;  1A8V A;  1EFI D;  1EHI A;  3QWN A;  4O2B F;  2E2I B;  4DPG A;  4DR2 L;  1ILP A;  3PO3 B;  4A3M G;  2R8J A;  5ELF A;  3KJP A;  3M9M B;  4DR5 H;  4YY3 L;  3BYY B;  2UUC H;  5IOC A;  4MHE A;  5IY0 A;  5KIX A;  4X3T A;  4APM A;  3GQC A;  4EGQ A;  1E3P A;  3S24 A;  1O7L A;  2JA5 H;  3GO5 A;  4KY7 A;  2DGY A;  4IWY A;  3J7A K;  1TS4 A;  1R4Q B;  1XTD A;  1D1K A;  4RGO S;  3R2I A;  4K0K L;  3BU2 A;  4JI0 Q;  4OO1 G;  2VPS A;  4IR9 A;  2GLT A;  3BQ2 A;  4PZ7 A;  1ZHS A;  1K1S A;  4QL5 A;  4X65 L;  1ASY A;  1HCZ A;  1RJT A;  3F2B A;  4KHP H;  4FO2 A;  2KEC A;  4GOP A;  2BA0 A;  3N8D A;  1QG7 A;  1RKN A;  1B04 A;  2O2L D;  1UEA B;  3F2D A;  2WB1 B;  4IUP A;  1NAP A;  5JOB A;  5EGT A;  3CMA A;  2BE5 C;  2PCF B;  1I94 L;  2R93 B;  4FF1 A;  4A3I G;  4L5S A;  5H80 A;  5IT9 c;  1EQR A;  3OTO H;  2VUM H;  1LTA D;  1LT6 D;  1E7Z A;  1JB7 A;  2JA9 A;  4ECT A;  1B7Y B;  4GLV B;  4OWX B;  4DR7 Q;  4CC6 A;  4KD3 A;  1CZG A;  4B3T Q;  2ZT9 C;  4DL6 A;  4FF2 A;  3QZ8 A;  1PA6 A;  2F3W A;  3S2H H;  2RHQ B;  2V4D A;  1VF7 A;  2OLS A;  1Y1V H;  1BXT A;  4LF7 L;  3IFD A;  3PGZ A;  2ICI A;  4R7R A;  1GHK A;  2KHS A;  3PCO B;  4JI3 Q;  2ZM6 Q;  2NZH A;  2VS1 A;  2OF1 A;  3MWE A;  4KKS A;  4J9Q A;  2R7Z A;  3DEO A;  1GHJ A;  4X66 L;  1X56 A;  2DPI A;  2IA6 A;  1EWI A;  1SMY C;  1KJ8 A;  5GAE C;  3CD6 A;  2E2D C;  3TZU A;  3J80 E;  2JA8 G;  4HMJ A;  1N36 H;  5EBD A;  2FFK B;  4PMB A;  5FD6 A;  1CT1 D;  2PMZ B;  2PBZ A;  3MR6 A;  1EU3 A;  5I9P A;  4GKJ Q;  1CS0 A;  2Z4H A;  4IJH A;  2DIK A;  2YL2 A;  3TME A;  2F03 A;  2HHH H;  4ME3 A;  2PW7 A;  5JEA J;  4YAJ B;  2N8N A;  3H09 A;  1TY2 A;  2K33 A;  4ECX A;  3JSL A;  1SYB A;  5KFH A;  2FJ2 A;  4JI6 L;  5L1L A;  1I6H B;  3LGJ A;  1STH A;  2HCI A;  4O42 A;  4Q8E A;  1PH7 A;  1HHV A;  2XVS A;  1HNX L;  3MC0 B;  4DV1 H;  1EWH A;  3FHW A;  3U9S A;  4A3F B;  1RK5 A;  4WRD A;  3KTM A;  1DZ1 A;  4H13 C;  1TWA B;  4TQU S;  1O78 A;  3PW4 A;  2F0E A;  1AUX A;  4HJ8 A;  1FD7 D;  4DV7 Q;  1Z2O X;  1CI3 M;  1RDP D;  1WFQ A;  4AYB G;  5LL6 X;  2IHE A;  2FK1 A;  4RNN A;  4FVM A;  2HDL A;  1PYW D;  2R84 A;  4DV5 H;  3GTG H;  1GXD C;  2VA3 A;  4ABN A;  1UUP A;  2JA5 G;  4NDX A;  3D6C A;  4DFA A;  4ZLT F;  4YR0 A;  1JOR A;  2WAC A;  5ELE A;  1UWV A;  2CH4 A;  3R23 A;  1A62 A;  3PUW A;  2G9H D;  1RIP A;  2NVT B;  3J81 E;  3BVG A;  1Q1B A;  1TA8 A;  3K81 C;  4UY8 C;  3AB9 A;  1Q12 A;  3K5N A;  1U4P A;  2Z1C A;  2LFN A;  3KBX A;  1EIH A;  3RAX A;  3GV7 B;  5FO8 B;  2HD3 A;  4TKO B;  4K8I A;  2NU7 B;  1B53 A;  2R82 A;  2IBK A;  3FKI A;  2R93 A;  1WD0 A;  3VYR A;  2F0L A;  4GNX C;  2WB1 E;  3KAK A;  2JXM B;  1CHP D;  1QIL A;  4B3M H;  3DF7 A;  2AU0 A;  1E1T A;  4MV4 A;  4J15 A;  2VUM G;  2KCN A;  5FD5 A;  2R7Z H;  3D4R A;  4QCL A;  1GUG A;  4EEY A;  4I7H A;  3HB9 A;  3R8B A;  1EY0 A;  3DXJ C;  2F0Q A;  1AZP A;  4QIW B;  1VQG A;  4RCO A;  1IBK Q;  2N55 A;  2RDI A;  4V0B A;  5EWF A;  1OWT A;  1Y1V G;  5E1F A;  1QJO A;  1EY4 A;  4DV3 Q;  1LAB A;  4NP5 A;  1STB A;  1E4F T;  2A19 A;  3I90 A;  3GTP H;  2KSW A;  3RFC A;  2X6G A;  2UUA H;  4NLG A;  4ZK9 B;  4JI1 L;  2BR0 A;  3QJY A;  4XYO A;  4CJ2 C;  2W71 A;  5IYD H;  1PRT C;  2QK4 A;  2E2J B;  4G3I A;  5M5W B;  4QY7 A;  3F2U A;  4KJN A;  1PZI D;  2ZDH A;  3M85 A;  1FNU A;  1EOT A;  4JV1 A;  3V4Z A;  1OO9 B;  2PMZ A;  2XNA C;  1Q3L A;  4IUT A;  4RHR A;  2H4O A;  4IZ8 A;  2E2I H;  1NR2 A;  2VW9 A;  3PO3 H;  4DUY Q;  2EJG C;  1JJC B;  2MUY A;  2PMZ E;  1XNQ L;  3H20 A;  1A6X A;  2A74 C;  2HT1 A;  1F9P A;  3QG1 A;  1PTO B;  1EUC B;  4A3K H;  3J81 j;  3S15 B;  4UCU A;  4JI8 H;  3F2C A;  3R3O A;  3RLN A;  1VQ8 A;  1JE4 A;  3G6J B;  2Z9H A;  3I4N B;  3MTS A;  3DWP A;  4B3R L;  3M7G A;  3QO2 A;  1PMR A;  2K6A A;  3WDN A;  2ID0 A;  1H95 A;  1TWA A;  3G6X A;  1X54 A;  2F0D A;  5DQG A;  3EBE A;  4YJ3 F;  5C4X G;  2R92 B;  3ERO A;  4OWW B;  4LFB Q;  5K36 H;  1Q8K A;  3R93 A;  3PO2 B;  1I50 A;  2R93 H;  1SNQ A;  1Y1W A;  3HKZ G;  3PW2 A;  1WTW A;  2H5X A;  3J7Y W;  1BBX C;  1T36 A;  3BA9 A;  5C0X I;  1IYV A;  1JLL B;  2R8G A;  1HZB A;  2VPQ A;  3D0F A;  4JI0 H;  4JOI A;  4ALP A;  3K3V A;  4IRK A;  3W2D A;  2UXB Q;  5CAE B;  4ED2 A;  2DNC A;  4YCU A;  4IN3 A;  1Q81 C;  3T1Y Q;  1G91 A;  1S03 G;  1F2L A;  3RD4 A;  3PW7 A;  2BDO A;  4RZQ A;  1FJG L;  4QW8 A;  5JJK A;  3CCS A;  3TRE A;  4GOP C;  4LF4 L;  5FLX c;  4NB3 A;  2JSO A;  2YRX A;  3S14 B;  4G7O C;  1XMO L;  1AW7 A;  3OOC A;  5M3M B;  2JP1 A;  1LTT D;  3Q8Q B;  2A73 B;  2F4I A;  1HNZ L;  4QIW A;  4PNY A;  2C5C A;  1ZYR D;  3SHL A;  3GTM B;  4IAJ A;  1MI2 A;  2W7O A;  2AGQ A;  4PMC A;  2OEO A;  5KYL A;  4KN4 C;  2L12 A;  3MFY A;  2K50 A;  4QIW E;  2F3I A;  2I5M X;  1BQQ T;  2FLP A;  1D5Z C;  1KHI A;  4CHT B;  2OTL A;  1X3E A;  4LWC A;  4RUC A;  1T94 A;  1IZ6 A;  3RB3 A;  3AMU A;  1WTQ A;  4JV2 A;  3N40 P;  1NY4 A;  1SNP A;  1BNC A;  3MEF A;  2WKD A;  3UDX A;  2OXP A;  1I6H H;  4X62 H;  1RJQ A;  3EPG A;  1RD9 D;  4HAE A;  2ZXO A;  2F0G A;  1NUC A;  1B50 A;  2L1B A;  2PYK A;  5GAG C;  4NKL A;  5M5Y B;  4DAV A;  5KFR A;  4O3R A;  1S72 A;  1S0M A;  5CV8 A;  2UUB H;  1TWA H;  2WAQ G;  2KOL A;  2UXC Q;  1VQ5 A;  2ZDQ A;  1QZG A;  4GZY C;  1NR4 A;  1MBY A;  2VZA A;  4LMY A;  4IHJ F;  4A3K G;  3OW7 A;  4LF6 H;  2PZT A;  4RGN A;  3RV3 A;  2KED A;  1U5K A;  5KT6 A;  5L1K A;  5D3D A;  2O5I C;  4R4Q A;  4JYA L;  4QWC A;  5KG0 A;  2PQE A;  1PH5 A;  3VA7 A;  2NVT H;  3K5H A;  3HKS A;  5C0X H;  1TQO A;  3P20 A;  2GVA A;  1AUV A;  5T1G A;  4YHH L;  1TU2 B;  1N34 L;  4HIK A;  4A3E G;  3GTL A;  5K36 G;  5KFP A;  4CDF C;  4DV7 H;  2WB1 G;  1BCP C;  3S1M B;  4R8N A;  2B8F A;  5KG7 A;  3A5U A;  2XGQ A;  4X64 Q;  2J6T A;  3CXC A;  2D0O A;  4FU0 A;  2XCP A;  4EYH B;  2AUK A;  1X32 A;  1MHW C;  5LMN W;  3T1H L;  1M1K C;  3CME A;  2EVB A;  1BGW A;  3H4D A;  4WJ3 M;  2CCZ A;  3MEH A;  3OSN A;  2F0N A;  3T13 A;  5T1I A;  1GSH A;  1K28 A;  4U67 3;  1EYA A;  2KQ3 A;  3OHB A;  4ECU A;  3S16 B;  1T3N A;  1F2Z A;  3LP8 A;  3A54 A;  5KFE A;  2FPI B;  4YQW A;  2CW0 C;  4DR5 L;  1J8I A;  1WCM A;  1KRS A;  2E2J H;  5M5W H;  2XRS D;  1PYS B;  3GTM A;  5KG5 A;  1V1Q A;  2I46 A;  5IP7 H;  1JKJ B;  3EFX D;  4HIM A;  2MQH A;  2GPS A;  2C9O A;  3VMM A;  1J5E H;  2JEI A;  3Q1K A;  1IBK H;  1HZA A;  5FLX W;  2W8K A;  4O2A F;  3L7Z C;  4LUO A;  1PTO H;  5JQW A;  4KHP L;  2DNE A;  4C56 C;  3S15 H;  4JI2 H;  4AQY L;  1GGO A;  5I6W A;  3ULP A;  4K2L A;  3H0G B;  1D8L A;  2A68 C;  3NEL A;  3I4N H;  4MTE A;  2VL6 A;  3OTO L;  4P72 A;  5IYB H;  3R2T A;  5CV4 A;  2XIG A;  3JAM L;  4OXP A;  1E2V A;  3NEN A;  1T9H A;  3URY A;  4QWA A;  1RL2 A;  2R92 H;  5E4W C;  2DLN A;  5BMV F;  4Q45 A;  1VQ7 A;  4QMG A;  1I6U A;  3GLK A;  5KG2 A;  4DU9 A;  3RBD A;  3W3A A;  3DEP A;  1KTK A;  2B2W C;  2NWG A;  1ASZ A;  3PO2 H;  2IHF A;  1O7I A;  1WD1 A;  3VR3 A;  2RDJ A;  5KFL A;  5IOD A;  4A93 B;  2BA1 A;  4ED6 A;  1A9X A;  1F2M A;  3J7A F;  2M00 A;  2RGR A;  3EN2 A;  3M4Y A;  2FP4 B;  2Q2U A;  3V6H A;  5IYC G;  3AEV A;  4IPD A;  1SJH D;  2D5D A;  4A3J G;  3L2P A;  3DM3 A;  4OO1 I;  5IT9 W;  1CSQ A;  1OXV A;  1N36 L;  4P71 A;  1EQQ A;  3OPO A;  5KFQ A;  2BH8 A;  1N32 H;  5JVG 3;  1WTX A;  4P74 A;  1S5C D;  3OMG A;  1TWH B;  3MVV A;  1I7N A;  3S14 H;  2UU9 L;  1I4G A;  3TBI B;  2HJW A;  4JI5 H;  3IG0 A;  4FBU A;  2XWB B;  5GAH C;  3DUZ A;  4OEM B;  3GTK B;  3DWQ A;  5M3M H;  2JJQ A;  3UFX B;  3M9N B;  4GC7 A;  2KA7 A;  2ATL A;  5C44 B;  5J39 A;  2YTY A;  4IOC A;  2E5L Q;  1NTG A;  3ORR A;  3PUY A;  5BR8 H;  3GTM H;  3T1Y H;  4KK7 A;  2QA4 A;  1MSH A;  1IKL A;  2XIW A;  4K8J A;  1PTO D;  2AQ3 B;  1BUV T;  2A69 D;  2K04 A;  1STA A;  5IGB A;  5KFT A;  4NXN Q;  2W6M A;  4GLX A;  4ZYS A;  1LTS D;  5DGB A;  3KAL A;  1Z9F A;  1DIK A;  4ZQI A;  2W70 A;  5LHY 1;  1VQL A;  5DG7 A;  3KDF B;  3RLO A;  4DV6 Q;  3GTO B;  3GV6 A;  4DV5 L;  1EFW A;  3CF5 A;  4DV4 Q;  1STE A;  2W6N A;  5JAV A;  5IP7 G;  5M5Y H;  1B8A A;  2PW5 A;  2J6U A;  1ZKO A;  3FPU B;  1L2Z A;  4MV7 A;  4ECS A;  2V5A A;  1VQK A;  2L4N A;  3RV4 A;  1I6V C;  1BNZ A;  2MJ8 A;  3ETH A;  3G6E A;  1PFM A;  4HNV A;  5FK9 C;  4PMW A;  5C4H A;  2W6Q A;  4LFA Q;  1E22 A;  1XNR L;  5CV7 A;  3MJF A;  4XYM B;  1WI5 A;  5EKI A;  3MWM A;  1K8O A;  1PFS A;  5K2M A;  3I4N G;  3VPB A;  4B3M L;  5CA1 F;  1GM5 A;  4EEQ A;  1PH6 A;  4OIK A;  4UP7 A;  5GON F;  1OXU A;  3SK8 A;  3UDG A;  4R8U A;  3GTQ A;  3PF5 A;  2DWC A;  5FPR A;  5LMU H;  5L9X A;  2TSS A;  3MXG A;  3VPC A;  3J80 L;  3K58 A;  3CC7 A;  1KC7 A;  2R92 G;  4GN5 A;  1K0R A;  3B6Y A;  1GUW A;  1JIC A;  3VPD A;  1ZXT A;  3SK5 A;  3IN5 A;  3M4P A;  2YU9 A;  3A0J A;  3S1M H;  1K8M A;  3PO2 G;  3T5K A;  4OO1 H;  1CKM A;  1JWS D;  5EBC A;  5KFZ A;  1JMC A;  4BWG B;  5LP6 F;  1Y8N B;  2FE3 A;  1O80 A;  5C4X B;  4AYB A;  4UP9 A;  4C3H H;  4BXX H;  3N42 B;  3ORQ A;  1VQB A;  5KT2 A;  2XWJ B;  3BS1 A;  2MNA A;  2SOB A;  2YTX A;  1N48 A;  4C3I G;  4DR6 L;  5KT3 A;  2JA5 A;  4AYB E;  3JC6 6;  3I4O A;  3HKZ B;  1GO3 E;  4O4H F;  1BBU A;  4A2B A;  5KX5 F;  1B9M A;  1K73 C;  1G6Z A;  3WO0 A;  3RUP A;  3S16 H;  2C2R A;  3AFQ A;  4I65 A;  4NMZ A;  5KRU A;  1XMQ Q;  1AN7 A;  1K3R A;  4DR4 Q;  2HVQ A;  3GTK A;  1HTP A;  3K3P A;  1WTH A;  1CTM A;  3MXP A;  1KAA A;  3V05 A;  5M3M G;  3V6J A;  4CKC A;  2N3S A;  3BA8 A;  2VR1 A;  1STN A;  2EYP A;  2W6P A;  2ZXR A;  4I4T F;  5LA6 F;  2WDT A;  3G6Y A;  2VUM A;  1TS3 A;  3A8J E;  2K5V A;  5IWA H;  3WO1 A;  2N78 A;  3J81 L;  2F0V A;  2EPB A;  4RNO A;  4BY7 G;  1NE3 A;  3DWA A;  2HVS A;  1HZC A;  2F0W A;  3KDF A;  1E0B A;  1IBL H;  3R5F A;  1CE8 A;  5KFX A;  1JWU D;  3I3C A;  3H0G H;  1G2S A;  4U6P A;  4Q8F A;  3N41 B;  2B63 B;  1LTL A;  2EY2 A;  2EYH A;  1AFP A;  2EJF C;  4YR3 A;  3MWY W;  4DV0 Q;  5J2U F;  1XPR A;  5CV6 A;  4FF4 A;  1S0N A;  1NMG A;  1H9J A;  2KHI A;  4LF5 Q;  5EAY A;  3NQT A;  1HR0 Q;  5C0X J;  2ATW A;  2I0Q A;  2OTJ A;  2HGS A;  1LLR D;  4A93 H;  2WAQ B;  2B2T C;  4JBJ A;  4Y7N B;  1YIT A;  4OX9 L;  4HID A;  1Y8P B;  3A8K E;  2ALZ A;  4J9N A;  3WWV A;  4A3K B;  1VQA A;  3O13 A;  4GN3 B;  3ZJY C;  3BG5 A;  3SI8 A;  1DYQ A;  1HNW Q;  1SE3 A;  4R1J A;  4A3C H;  4CJ1 B;  2CFM A;  1ICF B;  3CCM A;  4IUV A;  1CKN B;  4LF9 L;  1JDE A;  1U4L A;  1VQM A;  4HN7 A;  5GRO A;  4HJ9 A;  2HUG A;  3HZX A;  3OSO A;  5IGE A;  1QZH A;  4B3S H;  1TWH H;  3V2T A;  2DZD A;  3NQI A;  4JI4 H;  4J9S A;  3KBG A;  1YBY A;  2QDL A;  5LMN H;  1NMF A;  1SR3 A;  4XT1 B;  4RA8 A;  2ENB A;  3GTK H;  1S0O A;  1BCP B;  1UE6 A;  3STB D;  4C3H G;  4A3E B;  4BXX G;  4KKU A;  3X3N A;  4DR3 L;  5C44 H;  3GTG A;  3HKZ A;  1CKO A;  4X62 L;  2UXD L;  4OHJ A;  4MA5 A;  2YTV A;  4IJL A;  5FJ8 H;  1S9F A;  2M9V A;  5CR3 A;  2IX1 A;  1N33 Q;  1SMY D;  4L8J A;  4UDU C;  4QUF A;  2UVW A;  3HKZ E;  1HJP A;  4JI7 Q;  2G9D A;  3RUZ A;  5K5P A;  4ECW A;  2B29 A;  5C3W A;  2VB2 X;  2V58 A;  4ED0 A;  3MFI A;  1JOK A;  3Q8S B;  1HA6 A;  4NXM H;  1HFN A;  1RHP A;  4FYD A;  4YJ2 F;  3HFZ B;  4LSA A;  3NP8 A;  4LF6 L;  1W96 A;  4O3O A;  4JVZ A;  3GTO H;  1U9R A;  3KOJ A;  2ZDG A;  4EFE A;  2IMW P;  1IHZ A;  5I47 A;  3Q6S A;  4JK1 C;  5M5X B;  1RJR A;  1B33 N;  1IOW A;  4L63 B;  4TV8 F;  3K5O A;  1B1Z A;  5DLQ E;  4DF7 A;  4DR2 Q;  5KKN B;  4J9R A;  5F9L A;  1GOZ A;  1L1O B;  3K7A B;  1TXY A;  4YY3 Q;  1UC8 A;  3RF2 A;  2VXW A;  4FM9 A;  3K59 A;  3QB3 A;  3UE0 A;  2JA6 B;  4FXG C;  2L5T A;  5C1P A;  1EL0 A;  4RHS A;  3U9T A;  3VR4 A;  3GTJ B;  1PTO F;  1G8Z D;  1GSA A;  4LF9 Q;  2A8V A;  3H0G G;  3GQB A;  3NEM A;  4K0K Q;  5FKA C;  3GIK A;  4DUZ H;  3PIP 3;  2K5W A;  3GTP A;  4R4C A;  4RWS C;  3PN1 A;  4X65 Q;  4MV6 A;  2F4V H;  1EZ8 A;  1UE5 A;  4HYK A;  2CQA A;  1G2T A;  4F88 A;  3VR6 A;  2Y0S B;  5HV6 A;  4FNF A;  3NSW A;  1I94 Q;  3GIP A;  1EYZ A;  3EJI A;  4A2A A;  4LF8 H;  4OEL B;  3CP0 A;  2NUA B;  2E2I A;  2W57 A;  5KFI A;  3BQ1 A;  2WAQ A;  1ESR A;  1W93 A;  4KV6 A;  2NU6 B;  5ELB A;  4JC0 A;  1K8A C;  2J6S A;  4A93 G;  5C4X H;  2WAQ E;  3GV8 B;  4DLK A;  3UDI A;  1LTI D;  5LXT F;  4LK1 C;  1RK6 A;  5KND A;  1IYJ B;  2I5H A;  4Q43 A;  1YNJ D;  2Z6K A;  1VQ6 A;  1CKN A;  2LY7 A;  4DNT B;  2R7M A;  1IBM H;  1V1P B;  4G4K A;  4LF7 Q;  4A3C G;  4F4Y A;  2IP4 A;  4JBK A;  2B39 A;  2IW3 A;  2NVY B;  4TV9 F;  4YWL A;  1J5E L;  1QVG A;  4DAY B;  3ER0 A;  4X66 Q;  1OXX K;  4A3J B;  1HXY D;  1AH9 A;  3TZD A;  4N8X 1;  2X6L A;  1SJE D;  5KG3 A;  4ETS A;  1CZW A;  2WB1 A;  5M9O A;  4JI2 L;  2JE6 I;  3J7A 5;  1VQH A;  2AUJ D;  5C44 G;  4DL2 A;  1MSG A;  1HRJ A;  3LWE A;  1Q86 C;  2EY5 A;  5HY6 A;  5FJ8 G;  1O7Y A;  4YWM A;  2IJ0 A;  2LXJ A;  2JK8 A;  4PV1 C;  1IOV A;  2ZTC A;  3BVZ A;  2B2Y A;  4DKA C;  3R5H A;  4X3S A;  1N56 A;  3PIP A;  5KFW A;  4EBE A;  4JI6 Q;  3UI2 A;  4DR4 H;  5CYU A;  2K1B A;  1QNK A;  4DA2 A;  4ME5 A;  3FDT A;  4A3G G;  1HNX Q;  1YHA A;  3BDC A;  2QIL A;  3K8A A;  3GV3 A;  1QNU A;  4A3L G;  5KG4 A;  3NGD A;  1KLG D;  2B63 H;  1MGS A;  4UCR A;  2C22 A;  2VQE H;  1L1O A;  3CCV A;  2XC9 A;  2KEE A;  2B2V A;  4C2M B;  2Z4I A;  3D8G A;  4GKK H;  2R7L A;  1L0Y B;  3K6O A;  4DV2 L;  2AQ1 B;  3M9B A;  2J4X A;  2JEF A;  2VQF L;  1Q46 A;  3M7N A;  3L4J A;  3LWU A;  3GTJ A;  1A15 A;  4QW9 A;  1JC7 A;  4U7C A;  4R4O A;  3F8T A;  3DLL A;  3RZD B;  3JSN A;  2AGP A;  1SMX A;  3CC2 A;  3SK4 A;  5A35 A;  4A3D B;  4LSX A;  1C7Y A;  2IY5 B;  2O5J C;  1J9O A;  4DXG A;  1N32 L;  4EGV A;  4DR1 H;  4Y7N H;  4RB0 A;  3OYY A;  1H9S B;  4JI5 L;  4JG2 A;  4KLK A;  4IWX A;  5EDW A;  4R4I A;  1V51 A;  1SEB D;  3W1G A;  5BR8 L;  3K5L A;  2CVR A;  2Y0S E;  3TP7 A;  3TII A;  5JVD F;  4KI0 A;  4QF4 A;  3SVM A;  4LF5 H;  2WII B;  5C3E G;  5GQO A;  2P5Z X;  4GN4 B;  3M4Q A;  3MHB A;  1GYF A;  2J0T D;  4PDB A;  1C4Q A;  3JZI A;  5CA0 F;  4MV3 A;  4DL4 A;  4JBM A;  2MFI A;  5AJ3 L;  5IGC A;  2IL8 A;  4A3E H;  1K9M C;  5JJI A;  1C30 A;  1K83 B;  4ZUJ A;  4IQZ A;  4RU9 A;  1V1P A;  5KFK A;  1VMC A;  1F2Y A;  4ED7 A;  1AEX A;  5KT4 A;  1N8R C;  2NVY A;  4BA1 I;  3AFP A;  1Y69 U;  3MXN B;  2I8C A;  2OH2 A;  3KJO A;  2E2H B;  4QJF A;  3I4M G;  3MAQ A;  5DLG A;  1ROD A;  2NVX B;  4JI1 Q;  2WE6 A;  3M9O B;  3CKI B;  1SFO B;  4MIU A;  3ULJ A;  2VQF Q;  1KBL A;  4KHZ A;  3VYU A;  4C3I B;  5JVL A;  2K5Q A;  1RTO A;  3K80 C;  1DGS A;  1QOH A;  3QOJ A;  1XDN A;  2F0O A;  5M5X H;  1SYD A;  1DV1 A;  1I4P A;  4JPB W;  3CPW A;  1N33 H;  3OWF A;  1SE8 A;  1UEB A;  2F0F A;  4K5X A;  3JAM c;  1SE2 A;  1XNQ Q;  1XYI A;  3K7A H;  1UAP A;  5FO7 B;  1X55 A;  4JI7 H;  2E76 C;  2V59 A;  2F3V A;  1EY6 A;  5LMU L;  2JA6 H;  4IFD I;  4LFC L;  4DK6 C;  4C5B A;  4FS2 A;  4DR7 H;  1P16 A;  5L1J A;  5DNF A;  2J9G A;  4B3T H;  3L9A X;  3GTJ H;  5JH7 F;  4ZAI A;  5IGG A;  4B3R Q;  4ILW A;  1XX8 A;  4FXK C;  1VCI A;  1WTO A;  4Y8V B;  3A7L A;  4YWK A;  2VY3 A;  2B63 G;  4LNQ A;  4BY7 B;  2NU9 B;  3S2D B;  3KLW A;  4AH6 A;  4ZI7 F;  3RIZ A;  2FK3 A;  4JI3 H;  2ZM6 H;  4HCE A;  1HTL D;  3RMH A;  2QKI C;  1NJI C;  1A2T A;  3FRP B;  2MGS A;  5IGF A;  3M3Y B;  4YBZ B;  1DM0 B;  3K0X A;  5DM6 3;  3KFU A;  4DL5 A;  4LUV A;  3TIG A;  3M4O B;  3KK7 A;  4B08 A;  3C1F A;  1E4G T;  2PZU A;  1H9R A;  2QF7 A;  5C4J B;  4NW2 A;  2K28 A;  1BCP D;  2F0H A;  4POG A;  1E4E B;  4K0K H;  5CGK A;  1H9S A;  4IO9 A;  1SSO A;  1WSC A;  4YR2 A;  4GKJ H;  3ONA B;  5EWE A;  1PXU A;  1ET6 A;  1H9K A;  4EQO A;  2RBM A;  3HGB A;  1JOO A;  1CK1 A;  1SEI A;  2EYO A;  2QCP X;  1KJQ A;  1JJ2 A;  3PW5 A;  4DK0 A;  1FJG Q;  3V6K A;  1DOK A;  1B6R A;  3SXH A;  1I94 H;  1YHB A;  1LO5 D;  1TWF B;  2GA4 B;  2W9B B;  1SYG A;  1CM9 A;  1SBB B;  2NVY H;  3D3R A;  3HOX B;  4LF4 Q;  5IWA L;  1PZK D;  1IW7 C;  4JV5 L;  5H1S E;  2RSN A;  5IYC H;  1XMO Q;  2R92 A;  3OW2 A;  4A3J H;  5C1O A;  4YCW A;  1QVC A;  2OCE A;  1W3S A;  2NTS A;  3P75 A;  2Q8T A;  2LKV A;  3QFF A;  4FXD A;  1H9M A;  3BYT B;  4DL7 A;  1HNZ Q;  1IBL L;  3HOZ B;  2CW7 A;  2M2L A;  5L37 A;  3KF8 B;  5FO9 B;  3H3V I;  2K01 A;  2FKL A;  5F2D A;  1G29 1;  2E2H A;  2W6Z A;  4UP8 A;  3KF6 B;  1KJI A;  5KFO A;  1YI2 A;  1O75 A;  1YZ6 A;  1EZ1 A;  1DXM A;  2L9H A;  4C3H B;  1GUN A;  1STY A;  2NZO A;  2C35 B;  3SDZ A;  1XPU A;  4ID6 A;  2QDB A;  4UCO A;  4IFD H;  4JUZ A;  3E9I A;  5CC4 A;  1ILQ A;  3ULL A;  2MO0 A;  4UCS A;  4FBT A;  4PZ8 A;  3KHG A;  3QR8 A;  1PVO A;  3I72 A;  2VA2 A;  1KJJ A;  4EFB A;  4C2M H;  3J80 c;  1Z2P X;  4LJZ C;  2UUC L;  4KKT A;  1S5B D;  1HA5 A;  3PW0 A;  3VYT A;  2JA6 G;  2R61 A;  3G7L A;  4HJA A;  4BWS C;  3PF4 A;  2IX3 A;  5KFY A;  3RZD H;  2RF4 A;  3H6M A;  2B2Y C;  3E0E A;  3UDF A;  5HGT A;  3H94 A;  4A3D H;  2A6H C;  4JYA Q;  1S40 A;  4X6A H;  1ZHQ A;  2YYZ A;  3GP7 A;  1OXT A;  3PSI A;  2XD4 A;  3I73 A;  4OIJ A;  3JAM W;  2VNU D;  2B2U A;  3OUU A;  1WTP A;  1XTC D;  2H1E A;  1EYG A;  4DV3 H;  4JI4 L;  5LMN L;  1AE2 A;  4YHH Q;  2I07 B;  5IT9 E;  1N34 Q;  2R8H A;  2D2C C;  5JPM C;  2Y0S G;  2C2E A;  2ICE C;  3T5J A;  1UE1 A;  1S68 A;  2EOT A;  3JAM i;  2DPJ A;  1W6J A;  1A3V A;  2NBF A;  1XXG A;  1E4E A;  1KJ9 A;  3D6W A;  5F9N A;  2I87 A;  3KAJ A;  5ELC A;  3T1H Q;  4G7H C;  4PG3 A;  3CCR A;  3NHH A;  4C5A A;  1BDO A;  1SYE A;  1C3O A;  4DUY H;  5IE8 A;  3A8I E;  3PZP A;  4NXM L;  5KFU A;  2EYL A;  1GVP A;  3NTK A;  4IUQ A;  3Q22 A;  2V4R A;  1K83 H;  5KFS A;  1IYU A;  1LTG D;  4RGM A;  2NZ1 D;  3RGX A;  2R8I A;  1TWF A;  3E6Z X;  1IKM A;  2BOS A;  1J6Q A;  1CA5 A;  2K75 A;  1B2T A;  4RAY A;  1PX2 A;  3J81 c;  2HCC A;  3H3V H;  5M3F B;  2AQ4 A;  2F0M A;  3G8C A;  2E2H H;  3CQZ B;  1PH9 A;  3D4W A;  4KJO A;  4DR5 Q;  2NVX H;  4HCS A;  1M0W A;  1YJN A;  1S5D D;  1SFO H;  5KFM A;  3BZK A;  4LMQ D;  2EIF A;  4C3I H;  3V4S A;  3G4S A;  2W7P A;  4Q5V A;  1A3U A;  2N49 A;  3KF8 A;  2FPP B;  3W1B A;  1S3O A;  4ZQ3 A;  4LFB H;  3SE7 A;  5DQH A;  3P7J A;  4ZOL F;  1PDQ A;  3KHL A;  1EY7 A;  2D0P A;  5DEH A;  5JEA H;  4DUZ L;  1EQV A;  4E4T A;  2HHH L;  3S1N B;  2F4V L;  4RCN A;  2R87 A;  3BG3 A;  2R8K A;  4KHP Q;  3TQT A;  3CCJ A;  3C46 A;  4C3J B;  4AQY Q;  1LM0 A;  3GIQ A;  4GNX B;  2UXB H;  2HDM A;  4ZRZ A;  4LF8 L;  5KNC A;  4IFD G;  4JOI C;  4DV1 L;  5NUC A;  4HIO A;  3OTO Q;  3DHQ A;  1PHJ A;  1SDF A;  1RJP A;  1JXL A;  3RR5 A;  1PH3 A;  1F9Q A;  4YCV A;  4BY7 H;  2A6E D;  4HMI A;  3S2D H;  1JDB B;  3Q2O A;  1SNM A;  1V9P A;  1FNW A;  3HP3 A;  1B4O A;  1ML0 D;  2ZTE A;  4A3G B;  3M3Y H;  1KXL A;  2RVL A;  1SYF A;  1JCK B;  2YRW A;  4MTN A;  4IZO A;  3M4O H;  2Z6B A;  1C9O A;  4CBV A;  5KFD A;  3BJU A;  1U0L A;  1SAP A;  4J1M A;  1IBM L;  1ZET A;  3S1Q B;  5C4J H;  4A3D G;  1TS2 A;  1PRT B;  1V1O A;  3LNN A;  5IP9 G;  3EA6 A;  4K6D A;  3TS0 A;  3GIJ A;  4MTD A;  3QOL A;  1T5X D;  1WVL A;  3IFT A;  4RH6 A;  4G7Z C;  2WTF A;  4GLA C;  1CQJ B;  3H0G A;  1N36 Q;  4HED A;  1Q8I A;  1VQF A;  1TWF H;  2E8G A;  4EQN A;  1EYC A;  2BCO A;  2O4X A;  3ZYY X;  4J9O A;  3HOX H;  1KNE A;  3X3M A;  3J7A V;  1VQD A;  1KLU D;  1SNO A;  2UU9 Q;  1KC8 C;  1W6K A;  1CQV A;  3SE0 A;  4IR1 A;  1GSO A;  2UXC H;  5DG8 A;  3GIM A;  1II3 A;  1EIG A;  3HOZ H;  1JB3 A;  1WH2 A;  4ED1 A;  5C3E B;  1HR0 W;  1PTO C;  1VKZ A;  4O4L F;  4LH6 A;  4QWD A;  2RQX A;  1SCU B;  2YCH A;  3HOW B;  5LYJ F;  2BH2 A;  2ZJP A;  1B44 D;  2VQE L;  1KD1 C;  3EPI A;  4KY6 A;  4X3U A;  4K2K A;  5BN4 A;  4EQ5 A;  2XGT A;  4DAP A;  2UUA L;  2L0C A;  1KQS A;  4GKK L;  2P0A A;  3U58 A;  4ZKC B;  3PV0 A;  5IGD A;  1TAE A;  4MNO A;  4MZ9 A;  3CCL A;  1YEZ A;  5FPO A;  2CKZ B;  2HVR A;  4KTA A;  4DV5 Q;  1D7Q A;  4O3P A;  4GC6 A;  1I5F A;  1VMP A;  3E3X A;  2I5L X;  3G71 A;  1HNZ H;  1QVF A;  1VQ9 A;  1PZJ D;  3I4M B;  4IAL A;  2E75 C;  3I7F A;  4F87 A;  1TWH A;  3KHH A;  5JEA G;  5JVH 3;  4DR1 L;  2R86 A;  3C2P A;  4X64 H;  2TMP A;  2CH4 W;  4WFN 3;  2PPB C;  2CZG A;  4QB4 A;  4GNX A;  4M7E A;  4JI8 L;  1XNR Q;  1NNX A;  1BXR A;  2B8G A;  2EY1 A;  4GOP B;  2QW7 A;  4C5C A;  4HJ7 A;  3BAA A;  3DMU A;  1SYX B;  3HRZ C;  4B3M Q;  3PR4 A;  2YW2 A;  3EQL C;  2W9A A;  3EYY A;  3GID A;  1LT3 D;  5J22 A;  4ZHQ F;  3I8Z A;  1HUN A;  3NWT A;  2W8L A;  1C48 A;  2FPG B;  1KDB A;  1NSN S;  1PK8 A;  2OQ0 A;  3GTO A;  3BZD B;  1PH1 A;  2ZXP A;  3MA2 B;  5A2Q W;  1D5X C;  4IUN A;  3OSP A;  2R6F A;  5DQI A;  1PFN A;  5ELD A;  3Q8P B;  1YNN C;  2AMC B;  1Z6H A;  5D65 A;  1FL0 A;  4DNI A;  2IX0 A;  3FVQ A;  1AZQ A;  5LL6 b;  2D9U A;  1WJJ A;  1TII D;  3Q8D A;  4XTC S;  4JI0 L;  4CDC C;  1EWC A;  4WD3 A;  1PV4 A;  3S17 B;  2L15 A;  4QWB A;  4DR6 Q;  2D62 A;  2CWA A;  4ME6 A;  5FLX E;  3NTI A;  1ET9 A;  5IYZ F;  2FIN B;  3SR1 A;  2BQ3 A;  1A2U A;  2Q8R E;  2XSC A;  1A3T A;  2B2U C;  4CC5 A;  1YJ9 A;  1P8L A;  2I80 A;  5CB4 F;  5M3F H;  2BE5 D;  1UE7 A;  1EEI D;  1BKB A;  2XTI A;  3CQZ H;  3HOX G;  1C8C A;  4IPH A;  4I7Z C;  3I55 A;  5GAD C;  3T1H H;  2PI2 E;  1ULZ A;  4DR7 L;  4BBS G;  2L11 A;  3K5I A;  2EY6 A;  5C4Z A;  3PMF A;  4B3T L;  3MXU A;  3F1Z A;  1JJG A;  3HOZ G;  4WJW A;  5I2X A;  3HG9 A;  3N44 B;  2ES2 A;  3RB4 A;  2M05 A;  1D5M C;  2R7N A;  2QYZ A;  3ERQ A;  4IFD J;  3A55 A;  4XIG S;  1LT4 D;  3S1N H;  1K8G A;  4XXE A;  1BR9 A;  3FDS A;  2BQU A;  4JI3 L;  2RCN A;  2ZM6 L;  4C3J H;  2JA7 B;  4RAZ A;  2FLN A;  5KFA A; 
#chains in the Genus database with same CATH homology
 4H02 A;  1QUQ A;  1EUJ A;  1N34 L;  4HIK A;  4A3E G;  4R4O A;  4L5Q A;  5K36 G;  3F8T A;  4O2D A;  2WB1 G;  3DLL A;  1PH8 A;  1SMX A;  1OTC A;  3CC2 A;  4DUZ Q;  2QEX A;  1C7Y A;  2IY5 B;  3J80 i;  2HHH Q;  4BY1 G;  2F4V Q;  3A5U A;  1KAW A;  1CUK A;  4X64 Q;  1N32 L;  3CXC A;  2D0O A;  2ALY B;  1Q1E A;  2JEB I;  1VQP A;  4Y7N H;  2UUB L;  5LMN W;  4BBS H;  3T1H L;  1OXS C;  4GKJ L;  3KYH C;  3OYY A;  1M1K C;  3CME A;  2LXK A;  4JI5 L;  1XMQ L;  3I2Z A;  2KEN A;  3PUZ A;  1GKH A;  4JG2 A;  4KLK A;  1KRT A;  4DR4 L;  4A3G H;  2CCZ A;  4WJ3 M;  1X9N A;  4R4I A;  2ZJQ A;  4LF8 Q;  3W1G A;  5BR8 L;  4A3L H;  2CQO A;  2Y0S E;  4DV1 Q;  4KI0 A;  3A5Z B;  1IXR A;  5C3E G;  5GQO A;  3S1Q H;  2Q2T A;  4GN4 B;  4DK3 C;  3M4Q A;  2QGQ A;  1EIF A;  2B3G A;  4A3M H;  4OX9 Q;  3AYH B;  2GVB A;  4A76 A;  3CCU A;  4IPC A;  1HH2 P;  4RG1 A;  5IYB G;  4DR5 L;  2GN5 A;  4JBM A;  2MFI A;  3HOY G;  5AJ3 L;  1E1O A;  1KRS A;  3AQQ A;  4A3E H;  5M5W H;  1K9M C;  2E2J H;  5JJI A;  2IT1 A;  1MKH A;  1PYS B;  4DV7 L;  1IBM Q;  1V1Q A;  3I56 A;  1N8R C;  3K7U C;  2NN6 I;  4BA1 I;  5IP7 H;  3AFP A;  3MXN B;  4HIM A;  2MQH A;  2OWO A;  1YIJ A;  3KJO A;  4QJF A;  3I4M G;  3GD7 A;  4POF A;  1HZA A;  4JI1 Q;  3STB C;  1CSP A;  1FGU A;  3L7Z C;  4LUO A;  2VQF Q;  3ULJ A;  1BVS A;  4DR3 Q;  4KHP L;  4DV0 L;  4KHZ A;  4BBR G;  5JJL A;  3S15 H;  4X62 Q;  1B70 B;  2UXD Q;  3K80 C;  5J3B A;  3U4V A;  3J81 i;  4AQY L;  1DGS A;  5C3E H;  5FLM G;  4WJ4 A;  3ULP A;  4LF5 L;  1MJE A;  1D8L A;  3NEL A;  2PQA A;  5M5X H;  4A3I H;  4QQB X;  1Q7Y C;  3I4N H;  3EIV A;  1HR0 L;  1KL9 A;  2YV5 A;  2WFW A;  2VL6 A;  3CPW A;  3RN2 A;  3HOW H;  3JAM c;  1SE8 A;  1UEB A;  4P72 A;  3OTO L;  2UUB Q;  1XNQ Q;  5M3F G;  2ZTD A;  3K7A H;  2WP8 J;  5ELO A;  5IYB H;  1PYB A;  3HOY H;  1X55 A;  4OXP A;  1G6P A;  1XPO A;  2Z0S A;  3NEN A;  3HOV G;  4P75 A;  1T9H A;  5LMU L;  4IFD I;  1RL2 A;  2K52 A;  4LFC L;  4DK6 C;  2JA6 H;  2R92 H;  4OWT B;  2KHJ A;  4LF6 Q;  1P16 A;  1VQ7 A;  3GTJ H;  2AWO A;  1WCM G;  3GDE A;  1ASZ A;  3PO2 H;  2IHF A;  1O7I A;  1HNW L;  3CPF A;  4B3R Q;  2VQE Q;  1VCI A;  4FDB A;  4TVA B;  3A74 A;  3I4M H;  1FVI A;  4YWK A;  2BA1 A;  2Q2I A;  2UUA Q;  2VY3 A;  2B63 G;  4LNQ A;  1IBK L;  5E7N A;  2JEA I;  1AE3 A;  4GKK Q;  3EN2 A;  3KLW A;  4AH6 A;  3RNU A;  1VQO A;  2Q2U A;  4DV3 L;  4AIM A;  5IYC G;  3AEV A;  3RLF A;  4IPD A;  1NJI C;  4A3J G;  1SLJ A;  2FXQ A;  1LUZ A;  3K0X A;  1IL2 A;  2AHO B;  3KFU A;  2JA8 H;  3L2P A;  1WOC A;  3DM3 A;  2ZJR A;  4LUV A;  4OO1 I;  2R7D A;  1CSQ A;  1OXV A;  1A0I A;  1N36 L;  3CCQ A;  4P71 A;  1EQQ A;  2PI2 A;  4BA2 I;  4DR1 Q;  1N33 L;  1V43 A;  2BH8 A;  2F52 A;  1WYD A;  4GS3 A;  4POG A;  4P74 A;  4IO9 A;  4UPA A;  1G51 A;  4JI7 L;  3S14 H;  3RN5 A;  1BBW A;  2UU9 L;  4JI8 Q;  2HQL A;  4DUY L;  5GAH C;  4EX5 A;  5M3M H;  2JJQ A;  3GTQ H;  1HZ9 A;  3CAM A;  1VQE A;  2YTY A;  4IOC A;  2E5L Q;  1NTG A;  4QGU A;  3PUY A;  1MJC A;  1JJ2 A;  1FJG Q;  3GTM H;  1JE5 A;  2QA4 A;  1YHB A;  2EQS A;  2R7F A;  2YU9 H;  1A8V A;  2NVY H;  4LF4 Q;  2KBN A;  2KCT A;  5IWA L;  1Q82 C;  4DPG A;  4DR2 L;  4JV5 L;  5H1S E;  4NXN Q;  5IYC H;  4GLX A;  4A3M G;  1XMO Q;  1SN8 A;  2K14 A;  3OW2 A;  3KJP A;  3L0O A;  4YCW A;  4A3J H;  4O0A A;  1QVC A;  1Z9F A;  2OCE A;  4YY3 L;  3S17 H;  1W3S A;  5IY0 A;  1VQL A;  1HNZ Q;  1IBL L;  3KDF B;  3RLO A;  1E3P A;  4DV6 Q;  3H3V I;  3KF8 B;  4LFB L;  2EXD A;  3S24 A;  4DV5 L;  1EFW A;  2JA5 H;  3CF5 A;  3GO5 A;  4DV4 Q;  2DGY A;  1J5E Q;  1G29 1;  1XTD A;  5IP7 G;  4UP8 A;  1B8A A;  3KF6 B;  5M5Y H;  1YI2 A;  4K0K L;  3BU2 A;  4JI0 Q;  1YVC A;  4OO1 G;  1YZ6 A;  4PZ7 A;  1VQK A;  4QL5 A;  4X65 L;  4HJ5 A;  1ASY A;  4JI2 Q;  2NZO A;  3G6E A;  1Y14 B;  3F2B A;  2C35 B;  2OQK A;  4PMW A;  1XPU A;  4GOP A;  2BA0 A;  2UXB L;  4LFA Q;  1E22 A;  3F2D A;  1XNR L;  3E9I A;  1WI5 A;  3CMA A;  3ULL A;  3T1Y L;  2MO0 A;  1I94 L;  2JQO A;  4PZ8 A;  1PFS A;  4A3I G;  4L5S A;  3I4N G;  5IT9 c;  1EQR A;  4B3M L;  1PVO A;  1GM5 A;  2VUM H;  3SGI A;  1E7Z A;  1JB7 A;  2JA9 A;  3HOW G;  1B7Y B;  1PH6 A;  4GLV B;  4OWX B;  4C2M H;  4DR7 Q;  3J80 c;  4UP7 A;  1OXU A;  1SRO A;  3UDG A;  2UUC L;  3PF5 A;  4B3T Q;  4APV A;  2JA7 H;  1Z47 A;  1PA6 A;  3CC7 A;  2JA6 G;  2R92 G;  4HJA A;  1I3Q H;  3S2H H;  4GN5 A;  1K0R A;  3PF4 A;  3B6Y A;  2K5N A;  2RHQ B;  2RF4 A;  3RZD H;  3E0E A;  3M4P A;  2HIX A;  3UDF A;  3A0J A;  4A3D H;  3S1M H;  4JYA Q;  1S40 A;  2K5H A;  3PO2 G;  4X6A H;  1Y1V H;  1CKM A;  2YYZ A;  1OXT A;  3PGZ A;  3PSI A;  4LF7 L;  1C0A A;  1JMC A;  3PCO B;  2VNU D;  1X3F A;  4JI3 Q;  2ZM6 Q;  4DV2 Q;  2NZH A;  2VS1 A;  1EYG A;  4JI4 L;  1L2F A;  4UP9 A;  4C3H H;  5LMN L;  1AE2 A;  4X66 L;  1X56 A;  4YHH Q;  4BXX H;  1VQB A;  1N34 Q;  1EWI A;  3M7N A;  5GAE C;  2MNA A;  2Y0S G;  2YTX A;  3CD6 A;  4DR6 L;  4LUZ A;  4AYB E;  1UE1 A;  3JC6 6;  3I4O A;  3JAM i;  2JA8 G;  1GO3 E;  1YNX A;  1BBU A;  3H15 A;  1VQN A;  1E24 A;  1N32 Q;  1K73 C;  3FKI H;  4R4T A;  3S16 H;  1PH2 A;  1VQC A;  3T1H Q;  3AFQ A;  4IJH A;  4GKJ Q;  3S1R H;  4JI5 Q;  1XMQ Q;  4PG3 A;  4ME3 A;  3CCR A;  1K3R A;  4DR4 Q;  5JEA J;  3BZC A;  5IE8 A;  2N8N A;  2UXC L;  4NXM L;  5BR8 Q;  1GVP A;  1PH4 A;  3ICE A;  1K83 H;  3NBH B;  5M3M G;  4JI6 L;  3U50 C;  2N3S A;  3LGJ A;  1PH7 A;  4JBW A;  2LSS A;  1HNX L;  1J6Q A;  2K75 A;  3RZO H;  3J81 c;  3H3V H;  3FHW A;  2K5V A;  2E2H H;  2N78 A;  1PH9 A;  3FP9 A;  4DR5 Q;  2NVX H;  2NN6 G;  5AJ3 Q;  4TQU S;  1NE3 A;  1YJN A;  4BY7 G;  1SFO H;  1HZC A;  3BZK A;  2A1A A;  2RHS B;  1YHQ A;  2EIF A;  4C3I H;  3KDF A;  3TRZ A;  3G4S A;  2CWP A;  3U4Z A;  4DV7 Q;  4HJ8 A;  2N49 A;  1WFQ A;  3W1B A;  1S3O A;  4AYB G;  2IHE A;  2R7Z G;  3H0G H;  1M90 C;  3GTG H;  2JA5 G;  2D0P A;  1LTL A;  5ELN A;  4DUZ L;  3D31 A;  2HHH L;  2F4V L;  1UWV A;  4X64 L;  4KHP Q;  1A62 A;  3IRB A;  3PUW A;  4DV0 Q;  3CCJ A;  2AWN A;  1RIP A;  1XPR A;  1Q1B A;  4AQY Q;  1LM0 A;  1NMG A;  3K81 C;  5HGQ A;  4GNX B;  2KCM A;  4UY8 C;  1Q12 A;  2KHI A;  4LF5 Q;  4A3B H;  5EAY A;  5IYD G;  4LF8 L;  1HR0 Q;  4IFD G;  4JOI C;  3PUV A;  5C0X J;  4DV1 L;  4GNX C;  2WB1 E;  3OTO Q;  4HIO A;  2ATW A;  2I0Q A;  4OON A;  2OTJ A;  4L5R C;  1PHJ A;  1EOV A;  4A93 H;  3RR5 A;  1E1T A;  1PH3 A;  4YCV A;  4A3F H;  4JBJ A;  4BY7 H;  1VQI A;  4J15 A;  4A75 A;  2VUM G;  3S2D H;  1YIT A;  5LMU Q;  4OX9 L;  4HID A;  1L0W A;  2MO1 A;  1V9P A;  4LFC Q;  3E9H A;  3ERS X;  3PO3 G;  4P73 A;  3WWV A;  1KXL A;  2ZTE A;  1VQA A;  4GN3 B;  3ZJY C;  2R7Z H;  3M3Y H;  4IOA A;  2JA7 G;  4MTN A;  1JT8 A;  1HNW Q;  4R1J A;  3M4O H;  4A3C H;  1C9O A;  2CFM A;  1VS0 A;  3CCM A;  3BJU A;  1U0L A;  2PNH A;  1IBM L;  1CKN B;  2DUD A;  4LF9 L;  1VQG A;  5C4J H;  1IBK Q;  1I50 H;  4A3D G;  1VQM A;  5GRO A;  4HJ9 A;  1Y1V G;  4NPS A;  1VQ4 A;  4DV3 Q;  1Y1W H;  1QZH A;  5IP9 G;  3TS0 A;  3HOU H;  2A19 A;  1YJW A;  3GTP H;  1TWH H;  2Z6K C;  1YBY A;  4JI1 L;  1NMF A;  1SR3 A;  3GTK H;  5IYD H;  1UE6 A;  3STB D;  4BXX G;  1MIU A;  4DR3 L;  4GLA C;  5C44 H;  1N36 Q;  4QY7 A;  1CKO A;  4X62 L;  3M85 A;  1W2B A;  2UXD L;  2YTV A;  4IJL A;  5FJ8 H;  2IX1 A;  1N33 Q;  1VQF A;  1TWF H;  2E8G A;  3HOX H;  2R93 G;  3HKZ E;  2VW9 A;  2E2I H;  1GD7 A;  3FKI G;  1HJP A;  4JI7 Q;  1VQD A;  2UU9 Q;  3PO3 H;  4DUY Q;  1KC8 C;  1JJC B;  2PMZ E;  1XNQ L;  2B29 A;  2HT1 A;  1R9T H;  4A3K H;  3J81 j;  3F2C A;  3HFZ B;  3G48 A;  3RLN A;  3HOZ H;  1VQ8 A;  4LF6 L;  3TQY A;  3GTO H;  3KOJ A;  1HR0 W;  2HIV A;  2NVQ H;  5IWA Q;  3VDY A;  5DLQ E;  4DR2 Q;  4JV5 Q;  5IP9 H;  3PIO A;  2ZJP A;  2VQE L;  1KD1 C;  2BH2 A;  4B3R L;  2ID0 A;  1H95 A;  1L1O B;  4EQ5 A;  4B3S L;  3UE1 A;  2XGT A;  1TXY A;  1X3G A;  4YY3 Q;  2UUA L;  3CCE A;  1KQS A;  4GKK L;  1X54 A;  1TWG H;  2AKW B;  3EBE A;  3U58 A;  3UE0 A;  3PV0 A;  5C4X G;  1IBL Q;  3CC4 A;  4OWW B;  4MNO A;  4MZ9 A;  3CCL A;  1L1O C;  1YEZ A;  4LFB Q;  2CKZ B;  3TEH B;  4DV5 Q;  2ASB A;  1Q8K A;  1D7Q A;  1QUQ B;  1I5F A;  3G71 A;  4Y52 H;  2I5L X;  1QVF A;  1VQ9 A;  4LF9 Q;  2R93 H;  2A8V A;  4BY1 H;  3H0G G;  3NEM A;  4K0K Q;  3HKZ G;  3I7F A;  4R4C A;  2H5X A;  4LW1 A;  5JEA G;  4DR1 L;  4X65 Q;  5C0X I;  1HZB A;  1X6O A;  1X65 A;  1UE5 A;  1SRU A;  3D0F A;  4JOI A;  3J7Z C;  4ALP A;  2R6G A;  4GNX A;  2UXB Q;  4JI8 L;  1N9W A;  1XNR Q;  4YCU A;  1Q81 C;  3T1Y Q;  4GOP B;  1I94 Q;  4HJ7 A;  4A3B G;  3CP0 A;  2E5L L;  4B3M Q;  1FJG L;  5JJK A;  1A63 A;  3CCS A;  3TRE A;  4GOP C;  4JC0 A;  1TWC H;  4LF4 L;  5FLX c;  4NB3 A;  1K8A C;  2UUC Q;  1NBW A;  4A93 G;  5C4X H;  4A3F G;  4NXN L;  2WAQ E;  3W5O A;  1XMO L;  3UDI A;  2OQ0 A;  1IYJ B;  2I5H A;  1PH1 A;  1HNZ L;  2Z6K A;  1VQ6 A;  1CKN A;  1XJV A;  4DV6 L;  1KIX A;  3KF6 A;  4LF7 Q;  4A3C G;  3GTL H;  3TS2 A;  4PZ6 A;  4JBK A;  2AMC B;  4DV4 L;  1FL0 A;  4YWL A;  1VQJ A;  2IX0 A;  4DNI A;  1QVG A;  1J5E L;  2K50 A;  4QIW E;  4DAY B;  4L5T A;  4B3S Q;  1WJJ A;  4JI4 Q;  2F3I A;  3ER0 A;  5LMN Q;  4DAM A;  3Q8D A;  4XTC S;  1OXX K;  2I5M X;  4X66 Q;  1Y1W G;  4JI0 L;  3HOU G;  1AH9 A;  4BBR H;  1KHI A;  2OTL A;  1PV4 A;  1X3E A;  2L15 A;  4LWC A;  4JCV E;  4DR6 Q;  1IZ6 A;  2D62 A;  2CWA A;  4IPG A;  4RMF A;  5FLM H;  4JI2 L;  1NY4 A;  2JE6 I;  3J7A 5;  5C0X G;  3MEF A;  1VQH A;  2K4K A;  3UDX A;  4LFA L;  1I6H H;  5C44 G;  1YJ9 A;  1LYL A;  1P8L A;  1Q86 C;  5HY6 A;  5FJ8 G;  4YWM A;  2PQA B;  2LXJ A;  5GAG C;  5M3F H;  1UE7 A;  1BKB A;  2XTI A;  3CQZ H;  3HOX G;  2JK8 A;  1S72 A;  4IPH A;  2ZTC A;  3HOV H;  1TWA H;  5GAD C;  2WAQ G;  4DKA C;  3I55 A;  1VQ5 A;  2UXC Q;  2PI2 E;  4NXM Q;  4DR7 L;  1QZG A;  3PIP A;  4BBS G;  4JI6 Q;  2VZA A;  4B3T L;  4A3K G;  3PUX A;  4A3G G;  1WCM H;  3F1Z A;  1JJG A;  1HNX Q;  1YHA A;  3HOZ G;  2V1C C;  1U5K A;  3K8A A;  4A3L G;  2Q2H A;  2ES2 A;  2B63 H;  3CW2 C;  4R4Q A;  4JYA L;  1L1O A;  3CCV A;  4IFD J;  4XIG S;  3S1N H;  1K8G A;  4A4I A;  1EIY B;  4JI3 L;  2RCN A;  2ZM6 L;  4DV2 L;  1PH5 A;  2NVT H;  3M9B A;  4C3J H;  3HKS A;  2VQF L;  1Q46 A;  2GVA A;  4YHH L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...