4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
3F8TA 1VQBA 2MQHA 3K7AH 2GVBA 2EXDA 3KFUA 4JBMA 2YYZA 4IPCA 4LFCQ 2JEBI 2NVTH 1Q82C 1L2FA 4HIOA 4LF6Q 3I4MH 5M3MG 4LF9Q 4HJ8A 1VQ9A 1QZGA 4R4QA 5C0XJ 4LFBQ 4LFCL 1P8LA 1VQCA 2JJQA 2DGYA 5IWAQ 2CQOA 4LF6L 1L0WA 4JYAQ 4LF9L 1R9TH 1C7YA 1SRUA 1A0IA 4DV0Q 2OWOA 2BH2A 4MNOA 5GADC 4JCVE 1HR0L 1TWGH 3HOZG 4B3RQ 4LFBL 4JBWA 4YWLA 1KRTA 1WCMH 2AWNA 3M9BA 2VL6A 4DV0L 2CWPA 1PH5A 1OXXK 1Z47A 2VUMG 1JE5A 1CKOA 3B6YA 3E9HA 4DUZQ 4QL5A 4POFA 1RL2A 1KC8C 1PFSA 4OXPA 2R93G 1E22A 3ERSX 3M4PA 2UXDQ 3I2ZA 3TREA 3L7ZC 3PIOA 4LWCA 1Q8KA 1X3EA 2RF4A 1FL0A 3E0EA 4JI8Q 4PG3A 4LF5Q 4DR4L 3FHWA 3CCQA 1SR3A 3PUZA 2HIXA 2BH8A 4UP8A 4A3CH 1KD1C 2YU9H 2R92G 4OO1G 3J81i 4JI4Q 2N3SA 2KENA 4X66Q 4P73A 3T1HQ 1IBLQ 1PV4A 4JI4L 2N78A 3M85A 2I0QA 3HOYH 4YY3Q 1XTDA 4OWXB 2E2HH 1IBLL 4HIDA 3AYHB 1TWCH 1VQPA 2XTIA 2UXBQ 1B8AA 1X56A 4DR2Q 2EIFA 4YY3L 2JA6G 1SLJA 2PNHA 2JK8A 5C0XG 2OQKA 3HOZH 1BKBA 2MFIA 4GOPC 1I50H 4UP9A 2UXBL 4DR2L 3HOWG 4IPGA 1YNXA 1X54A 4DV5L 3CAMA 3PUYA 1Q12A 3S17H 5ELOA 2ZTDA 3Q8DA 4YCUA 2B3GA 3PGZA 2VW9A 4DR3Q 3CF5A 1NJIC 4X62Q 2PI2E 4A3MG 2K5VA 2K14A 3KYHC 3KOJA 4GN5A 3HKSA 1M90C 1N33Q 2R93H 1HJPA 3TS0A 4JI2Q 2VQFL 4JC0A 4DR3L 2AKWB 2RHSB 3D0FA 4X62L 2IY5B 2V1CC 3S1MH 3HOUG 1YI2A 4R4TA 1EIFA 1KHIA 1Q1BA 1N33L 3ER0A 1HZCA 4HJ7A 4AYBE 4YWMA 4OO1I 1PHJA 3A5ZB 1OXUA 4QY7A 4JI5L 2R92H 2N8NA 2VQEQ 2D62A 1VQGA 2ES2A 2UUCQ 1VQ6A 3TEHB 2VS1A 4A3FG 4WJ4A 5JJIA 4ME3A 2D0PA 1Q46A 3PCOB 4IO9A 3RN2A 1J5EQ 2VQEL 3AQQA 4O0AA 4HIMA 4JG2A 2UUCL 4GLXA 4DR7L 4DAYB 2OTLA 1NBWA 3KF8B 1UE6A 1E3PA 5M5YH 4JI3Q 4AYBG 4DV4Q 3RN5A 1EUJA 1LUZA 5C0XI 5K36G 3L0OA 3GTLH 1WYDA 4JI3L 1JJ2A 1NY4A 4DV4L 1GKHA 5IE8A 2CCZA 3GTGH 4HJ5A 1QVGA 2R7DA 5IP9G 2L15A 2YTVA 5J3BA 4GNXC 1QVFA 4X64L 1L1OC 4A3MH 1JJCB 5ELNA 3J7A5 3KF6B 4X6AH 2K75A 2HT1A 3KF6A 1TWAH 4A3GG 1BBUA 1PH2A 3AEVA 4A3CG 4RG1A 4LF8L 3CP0A 4JI0L 3BZCA 4A3IH 4A3KH 1P16A 4IFDG 3IRBA 4H02A 4J15A 3CPWA 3NELA 3WWVA 1YIJA 3GD7A 5M5XH 3S16H 1NTGA 4LW1A 2K52A 2ZJPA 4DR5L 3HOYG 2YTXA 4A3FH 1G291 2QA4A 5IYDH 1V9PA 3HKZE 4GKKL 1HNZQ 1IXRA 1HR0Q 2LXJA 4DK6C 1VQAA 1VQNA 2AHOB 1X6OA 1XNRQ 5JEAJ 1HNZL 2IHFA 2KCMA 2UXCL 4BY1G 4B3MQ 2WAQE 1UE5A 4BA1I 3CXCA 2JA8H 3I55A 4TQUS 3A5UA 4DV3Q 1XNRL 1Y1WG 4GN3B 1CUKA 4LFAQ 3CCLA 4B3ML 4AQYL 3S1RH 4AH6A 4A93H 3PSIA 1VQLA 5IP9H 3FKIH 4DV3L 3HKZG 1AH9A 4LFAL 2ID0A 4DR4Q 3TQYA 4OWWB 1HZAA 4IOCA 5GQOA 5HY6A 4TVAB 3U4ZA 1JT8A 1OTCA 3GTJH 4ALPA 2WAQG 4YWKA 3PUXA 1D8LA 2K5HA 2WFWA 4JV5L 3CCEA 4A3GH 1XPRA 4DPGA 1CSQA 4P74A 4JI6Q 5BR8L 1U5KA 5FLXc 4IFDI 3GTQH 2R6GA 1YHBA 1YJNA 1VQIA 4GLAC 5IYBH 5C3EH 3D31A 5IT9c 4DR6Q 4JI6L 1QVCA 3K0XA 5LMUL 1T9HA 4OONA 1AE2A 5M3FG 1UE7A 1PH3A 4L5RC 4DR6L 3AFPA 4JI7L 2C35B 1LTLA 4QGUA 3PF5A 3RLOA 2MO0A 1Q7YC 1OXSC 4A3EG 1XMOL 4XTCS 3CMEA 1RIPA 4YHHQ 4DV5Q 4IOAA 1VQEA 2CWAA 5IP7H 4EX5A 3PO3H 3I4OA 4P71A 4BY1H 3GTMH 3DLLA 3I56A 1N34L 1IYJB 1V43A 3U4VA 4YHHL 2NVYH 4JBJA 1GD7A 3PO2H 1Y1WH 4YCWA 3JAMi 2ZTCA 2HHHQ 2VQFQ 1JMCA 4PMWA 2PMZE 3HOVH 2H5XA 3UDGA 1KRSA 4PZ7A 1PH8A 1A62A 2WB1E 2NVQH 3PUVA 3U50C 5DLQE 2R7ZG 1IZ6A 3AFQA 2HHHL 2Z0SA 4A3DH 2A8VA 2KHIA 5H1SE 1PH1A 1DGSA 1X55A 4P72A 3I7FA 1YZ6A 4JI5Q 4DV6Q 2ATWA 5FLMH 4NXML 4DV1Q 1Y14B 4A3IG 3K80C 3UDIA 4A3KG 4LNQA 3ICEA 1SN8A 2OCEA 4XIGS 1Q86C 4DV6L 2HIVA 1K0RA 4DV1L 1K9MC 2ASBA 4BBSG 4GNXB 1YHQA 4DV7Q 4LF7L 3RZOH 3F2CA 4OX9Q 3H0GG 4DR7Q 4GNXA 1NMGA 5LMNW 4P75A 4IPDA 3KJPA 1VS0A 1L1OA 2BA1A 4DKAC 4DV7L 1E1TA 4A3BG 1N32L 2EQSA 3M4QA 1B70B 4DV2L 5E7NA 4OX9L 5JJKA 5M3FH 3W1BA 3RZDH 1VQHA 3J80i 1VQDA 2I5MX 1N36L 2VNUD 3M4OH 1EIYB 4HJAA 4A3EH 2Z6KC 3ULJA 1WOCA 1YITA 1IBMQ 2JA8G 3A0JA 3UE0A 2JEAI 3EIVA 1SMXA 1K3RA 2E5LL 3TS2A 2B63G 4X64Q 2IT1A 1IBML 4A93G 4BA2I 1I6HH 1O7IA 4KI0A 2BA0A 1WFQA 3DM3A 3J81c 3OW2A 1I3QH 1KL9A 1MJCA 3FKIG 1NMFA 3J81j 1Q81C 2E2IH 4UY8C 2PQAB 2NVXH 1LM0A 4KHPQ 3CCUA 3A74A 2QEXA 1Z9FA 2PQAA 2VZAA 2NZOA 2AMCB 1S3OA 2FXQA 1E7ZA 3GTOH 4BXXH 1E1OA 1K83H 4LF8Q 2R7ZH 4KHPL 3E9IA 3HFZB 4JI0Q 3S2DH 4PZ6A 4YCVA 1TXYA 2UUAQ 4NXNQ 3CD6A 1S40A 4X65L 2YTYA 4EQ5A 2JA7H 2R7FA 4R4IA 2JE6I 2Q2TA 4L5QA 4NXNL 3RLFA 4DR5Q 2UUAL 1XNQQ 3CCSA 2E2JH 4Y7NH 2IX0A 4MZ9A 4PZ8A 5IYBG 1N8RC 1H95A 5C3EG 3W1GA 4APVA 5JJLA 2IHEA 1FGUA 3OYYA 3L2PA 1YEZA 3RR5A 3S24A 4BBRH 4B3TQ 4BBSH 4GKKQ 3F2DA 4RMFA 1XNQL 2QGQA 3H0GH 4L5TA 3UDXA 3S14H 3GTPH 5M5WH 2IX1A 1YHAA 1GM5A 3NEMA 3KLWA 4GS3A 1VQ7A 4B3TL 1AE3A 4L5SA 4A3BH 2UXCQ 2D0OA 1WJJA 2OTJA 1EWIA 3STBC 5IP7G 1K8GA 1I94Q 1XJVA 1M1KC 3PO3G 3I4NG 1PYSB 1A8VA 2JA5H 4JOIC 3GDEA 1Q1EA 2DUDA 3F1ZA 1PYBA 4AQYQ 1XMQQ 1SFOH 2F3IA 2ZJRA 1MJEA 1HNXL 2Q2HA 1I94L 2NN6G 3PO2G 3H15A 4HJ9A 2B63H 3EN2A 1XMQL 3HOVG 2JA9A 4KHZA 2KBNA 1WI5A 2ZM6Q 1OXVA 4POGA 3CQZH 4A3DG 1X3GA 5IYCH 1PVOA 1N9WA 3UE1A 2ZM6L 3S2HH 3BU2A 2E8GA 5GAGC 1HR0W 1BBWA 5FLMG 1ASYA 3JC66 5GAHC 3T1YQ 2PI2A 4GOPB 5BR8Q 5FJ8G 3J80c 3CCMA 2CFMA 3LGJA 3GO5A 3MEFA 4R4OA 4QJFA 3CMAA 1UEBA 5IWAL 4GOPA 1VQ5A 1B7YB 1CKNB 1HZBA 1KIXA 4JYAL 4IJHA 1XPUA 1G6PA 3T1YL 1EOVA 3W5OA 1CKNA 1XPOA 1SROA 4DUYQ 4JV5Q 2LXKA 5LMUQ 4B3RL 4WJ3M 1U0LA 4C3JH 4DAMA 3BZKA 1V1QA 3CCRA 3S15H 4A3LG 2UU9Q 4JI7Q 1UE1A 4HIKA 1I5FA 1MKHA 2NZHA 1YVCA 4DUYL 2N49A 3BJUA 4IPHA 4JI1Q 1IL2A 3S1QH 2OQ0A 1XMOQ 2K4KA 4GKJQ 1VCIA 4GN4B 4B3SQ 2UU9L 4UPAA 4A3JG 2JQOA 4DUZL 5C4XG 3SGIA 2KCTA 5C44G 1BVSA 1PH7A 4GKJL 1Y1VG 1FVIA 4JI1L 3G6EA 1N34Q 2ZJQA 4DNIA 3VDYA 4B3SL 4R1JA 2UXDL 3PUWA 2F4VQ 3CPFA 3I4NH 5AJ3Q 4UP7A 4JI8L 3PV0A 4LF4Q 4LF5L 4QQBX 2NN6I 3M7NA 5JEAG 2K5NA 2F4VL 1YBYA 5AJ3L 1A63A 4LF4L 3J7ZC 1HNWQ 1CSPA 4AIMA 1W3SA 3G71A 1YJWA 4X66L 3RNUA 3T1HL 5M3MH 2K50A 4BXXG 2RCNA 4NXMQ 2HQLA 1KQSA 3OTOQ 4JBKA 1HNWL 3K81C 3TRZA 3CC4A 2Y0SE 3PF4A 1ASZA 2Z6KA 2JA7G 1TWFH 3CCJA 2F52A 3OTOL 5FJ8H 1VQKA 4BY7G 1C9OA 3EBEA 2WP8J 4LF7Q 2CKZB 3NENA 4R4CA 3CC7A 4OWTB 3ULPA 1QZHA 1PH4A 1OXTA 1FJGQ 4A75A 5GROA 3S1NH 4BBRG 2VUMH 3CW2C 3K8AA 3HOXG 5LMNQ 1N32Q 4DV2Q 1L1OB 1VQJA 2WB1G 2KHJA 4A3LH 2LSSA 1VQFA 4LUVA 1N36Q 1FJGL 1PA6A 1YJ9A 1HH2P 4DK3C 3CC2A 3STBD 5LMNL 1EQRA 2Y0SG 5GAEC 2Q2UA 3FP9A 5IY0A 4A3JH 1X65A 3CCVA 2E5LQ 5C4XH 2MNAA 3PIPA 5C44H 4IFDJ 2JA5G 1UWVA 1Y1VH 5EAYA 4JI2L 1SE8A 3K7UC 1LYLA 1HZ9A 2ZTEA 5HGQA 5IYDG 4KLKA 1X3FA 4C3IH 1VQMA 2UUBQ 5C4JH 4NB3A 4GLVB 2A1AA 1MIUA 2B29A 1JB7A 3KJOA 2GN5A 3G48A 4IJLA 3H3VI 3I4MG 4LUOA 4QIWE 4A4IA 3KDFB 2UUBL 3H3VH 5IYCG 3GTKH 1VQ8A 4DR1Q 4FDBA 3KDFA 3ULLA 4MTNA 2ALYB 1IBKQ 4X65Q 2MO1A 1VQOA 1W2BA 1C0AA 2AWOA 1J5EL 1PH9A 2Q2IA 3MXNB 1KAWA 4DR1L 1EFWA 1JJGA 1IBKL 2VY3A 4K0KQ 4JOIA 2JA6H 1WCMG 1KXLA 1E24A 1TWHH 2RHQB 1S72A 1K8AC 4BY7H 1J6QA 1G51A 4O2DA 3HOWH 4K0KL 1PH6A 4Y52H 3HOXH 3JAMc 3M3YH 2I5LX 4C2MH 1GVPA 1GO3E 3RLNA 3UDFA 4C3HH 4NPSA 4LUZA 3G4SA 2XGTA 2A19A 1EYGA 1HNXQ 3NBHB 3HOUH 1VQ4A 1QUQB 1K73C 1D7QA 1CKMA 1QUQA 3ZJYC 3F2BA 4A76A 3U58A 1EQQA 1NE3A 2YV5A 2I5HA 1X9NA 2GVAA
chains in the Genus database with same CATH superfamily
5LOVF 2GVBA 1SYEA 2G5DA 1YNJD 4LFCQ 2NVTH 1WD0A 2FPPB 1GJXA 5E3FA 3MFHA 4LF9Q 3CRLC 4DF7A 3SK6A 1QZGA 4IALA 1A15A 2TMPA 3QOJA 5M5XB 4LFBQ 4JV0A 1TQOA 2YS6A 2AQ1B 3RTXA 5IWAQ 2XGQA 4LF6L 2XWBB 3H0GB 4HCEA 1SRUA 1STNA 2WB1B 5T1IA 4DV0Q 3S14B 5M5WB 5HBRB 4ECRA 1GOZA 3WDNA 2AWNA 4DNRB 1GSAA 3M9BA 4XT1B 4RB1A 4EFBA 3MHBA 1JE5A 2EYPA 2PZTA 3B6YA 2N88A 4N9PA 5ELCA 5HURA 1HTLD 5LA6F 4H7BA 2UXCH 1EY4A 2R93G 2B2WA 1TVXA 2O2LD 3L3OC 2UXDQ 3I2ZA 1ILPA 3L7ZC 4A93B 2C22A 3F8NA 1Q8KA 1X3EA 2RF4A 5EQ0A 1JX4A 2B63A 1FL0A 2YW2A 4JI8Q 4Z9CB 3T53B 4LF5Q 4DR4L 1C48A 4ECTA 1EU4A 3CCQA 2O5IC 4A3CH 2YU9H 4OO1G 4IUNA 4JI4Q 2ZM6H 3J7AK 4EEYA 4C5BA 2DIKA 2KENA 1HUMA 3T1HQ 5IGDA 2YZGA 2KEEA 1EY6A 2HDLA 1U9RA 1B3QA 2Z1CA 3VPCA 1CZWA 5CV7A 5C5MA 3GTQB 2E2HH 4UCVA 1IBLL 4LAAA 3OWFA 3RUZA 4QWBA 2UVWA 5D65A 1VQPA 4B3RH 2UXBQ 2F3VA 4DR2Q 1DYQA 4ABNA 2F0DA 4J0MA 2MFIA 3K6OA 4O3QA 1UC9A 1HQMC 1PYWD 3HOWG 3MR3A 1X54A 4DV5L 1Q12A 4QWAA 3SR1A 4RAUC 4DUZH 2WINB 1GUOA 3MZ5A 4JI1H 4R8IA 4ME6A 1NJIC 4X62Q 2M2LA 2PI2E 3R5HA 1LT3D 2OLSA 1UUPA 1NNXA 3HKSA 2R93H 1A3TA 2WYOA 4FM9A 4DR3L 1Z2PX 2IY5B 3S1MH 3HOUG 1O78A 4F4ZA 5BN4A 3V4SA 4NLGA 2B8FA 2QW7A 3ETJA 4CJ2C 1PZJD 4QCLA 2HDMA 4OO1H 2VQEQ 1VQGA 2E2DC 3PW7A 1QNKA 1TWFB 3A55A 2HD3A 4RCNA 5EPLA 3TEHB 1VQ6A 1EYAA 1QILA 2KOLA 1Q46A 2J9GA 1J5EQ 3AQQA 3BZDB 2FK3A 3TIGA 3OTOH 3GQBA 4DR7L 1IOWA 3KF8B 1UE6A 5M5YH 4JI3Q 4TKOB 2VUMA 2RQXA 4YAJB 3DWPA 3E5SA 3VR5A 5DQGA 5LMNH 1KDAA 2RGVA 2PYKA 1M7JA 1QVGA 2R7DA 4EEQA 1QVFA 1C30A 4JI2H 5LYJF 1L1OC 1B53A 1PFNA 2RCFA 3MWDA 2HVQA 2HCCA 3J7A5 4K5VA 4HYKA 3KF6B 3TP8A 1GGOA 4ECYA 2NUCA 3RD4A 1TWAH 5KFNA 2X6GA 2AQ2B 4S3SA 4Q8EA 1PTOC 1TU2B 3A8JE 4A3IH 3KXYT 2PBZA 4A3KH 3S2DB 2EJGC 1HFNA 4UCUA 5DG8A 2CW8A 2K52A 1I4PA 2ZJPA 3HOYG 2W7OA 1IBKH 5KFFA 2JA6A 5BN5A 3RAXA 3TIIA 1TWHA 5KFOA 1IL8A 1B44D 2A6ED 2R84A 1HNZQ 1HR0Q 1O7LA 2ZT9C 1CI3M 1VQAA 3BYTB 4BBRB 1PRTC 2Z8LA 1SYDA 4IRKA 1X6OA 1XNRQ 1B6RA 1BXTA 1SBBB 2KCMA 2Q8RE 4BA1I 1UE5A 3I55A 3C1FA 3A5UA 3JSLA 3PZPA 2Y0SA 1GUTA 4LFAQ 3S1RH 2YRWA 1EY7A 3KHHA 4JW0A 4MTKA 4DV3L 2IP4A 1HRJA 2Q8IB 2W9CA 1KTKA 2ID0A 1E2ZA 1VF5C 1HZAA 1BDOA 4IOCA 5GQOA 1SYGA 3V4ZA 4ED3A 2KUMA 3I4MB 5BN3A 3TSSA 1PTOF 5KFXA 2XSCA 2DWCA 5L1LA 1EY5A 5EOYA 5BR8L 1R9TB 4IFDI 2QK4A 2VUGA 2ICIA 1SCUB 1JLLB 5TSSA 4LF6H 1K3BC 5C3EH 1WCMB 1QVCA 2QILA 4WD3A 3KHRA 2C00A 3JRWA 2F0NA 1PRTF 4OONA 4C3JB 3IKJA 4MV4A 4QMGA 3PF5A 2MO0A 3OIQA 1Q7YC 2FMCA 4A3EG 2F0SA 2K05A 1XMOL 4QIWA 1RIPA 4H13C 1KJ8A 1F2YA 2EYOA 3I56A 1N34L 1LTAD 1V43A 1OO9B 4JV1A 4DR4H 2VQFQ 3ND9A 3TZUA 3HOVH 1V1PA 3UDGA 2R8GA 1CTMA 4DK1A 2YU9A 2WB1E 1ZXTA 3PUVA 3RAQA 4A3DH 1IZ6A 3AFQA 2HHHL 2J6SA 3V6HA 2KHIA 5I2XA 1PH1A 3IFTA 3BG5A 3T51B 4DV6Q 2ATWA 5FLMH 1XYIA 1CZGA 2E2HA 1WTWA 2I8CA 1IBLH 2J6TA 1AZQA 3DXJC 1XTCD 1VDZA 2F0JA 4GNXB 3DEOA 5LHY1 3H0GG 1I50B 2ALZA 2DN8A 4O3PA 2XCPA 2BA1A 1PRTD 4DV7L 3I91A 1N32L 1S0NA 1CFMA 4OX9L 4DV2L 4ED1A 3QR8A 4DV5H 1WVLA 1N36L 1VQDA 2I5MX 4MA5A 3M4OH 3J80E 4A3EH 1IBMQ 2CW0C 3UE0A 3R5FA 1CT1D 2R93A 1MD2D 4X64Q 2IT1A 4DR3H 4A93G 2BQ3A 3BQ1A 4KI0A 1WFQA 1KL9A 4UY8C 4K2KA 5BPHA 2WAQA 4KHPQ 2R3ZA 4EG0A 2R92B 2FE3A 5C4JB 1H9KA 4PV1C 4J9NA 2FXQA 4LMQD 3E9IA 3HFZB 5JVG3 1PXUA 4JI0Q 4PZ6A 2WACA 4ZRZA 3X3MA 2UUAQ 5CV6A 1S40A 3CHBD 4X65L 5IOCA 4ZUIA 4R4IA 1ZYRC 1JOKA 5KT7A 3DUZA 5KT2A 4DR7H 1N8RC 1Z6HA 2JA6B 2IHEA 4GKKQ 4B3TQ 5DGBA 3OWEB 4QW8A 3IG0A 2QGQA 3H0GH 4L5TA 5KFPA 4ZYSA 3G6VA 3S14H 5M5WH 4J9OA 3NEMA 4GS3A 4L5SA 1RF2D 3D4WA 4DL7A 1XDNA 1WJJA 2R6FA 1EWIA 1EOTA 2L5TA 3FMAA 3H4DA 2F4IA 1I94Q 1AZPA 2R8JA 4A3MB 1A8VA 2JA5H 5A2QW 4ED2A 2I46A 1Q1EA 2RSOA 1PYBA 1O7ZA 1HNXL 5KFWA 1RK6A 5DG9A 4HJ9A 3NTIA 3GILA 1XMQL 4EBEA 2FLLA 3RB4A 1TWAA 5EBCA 5I6WA 3GIMA 1BNZA 3QO2A 3MR2A 1XWEA 3K58A 2ZDHA 3MFYA 5FLXL 1X3GA 3M9OB 1S5CD 1EIHA 3BU2A 3KLRA 4RU9A 5GAGC 4FF2A 5IT9L 1BBWA 1DJRD 5GAHC 2PI2A 4WBNF 3J80c 3CCMA 1VQ5A 4CBVA 4DGZA 1UEBA 5IWAL 4GOPA 1O80A 1SNPA 5KYLA 1CKNA 4L63B 1RTNA 4N8FA 4WJ3M 5LMUQ 1PZID 4DAMA 2JN4A 2VB2X 4A3LG 1VMPA 5IGGA 1S0OA 2NZHA 4JV5L 4DUYL 2B2YA 3V6JA 4GKJQ 1FNWA 1AN8A 4GN4B 3PQIA 2UU9L 2JQOA 1G2TA 2CW0D 3SGIA 2KCTA 1BVSA 2W6NA 1ENCA 1LTRD 1KLGD 2ZJQA 1H9MA 2UXDL 1DV2A 4DV3H 3CPFA 2YZNA 4UCSA 2C2DA 1YNNC 2KA7A 2R8HA 4UP7A 2F0MA 4JI8L 4LF5L 2NN6I 4FP5D 2KCNA 3MXGA 2K5NA 5JPMC 1V1PB 4A3GB 4IRDA 4LF4L 3J7ZC 5KGUA 1LLRD 1HNWQ 1Z2OX 1W3SA 3P20A 1JICA 3T1HL 2XGPA 1W6JA 5M3MH 5CBEE 4BXXG 1HA6A 1DOLA 1KQSA 5BR8H 3K81C 3ZYYX 1ZYRD 2K32A 1ASZA 2Z6KA 4F8MA 1TWFH 3RF2A 2F52A 4FXGC 4X3SA 1C9OA 4LF7Q 2RSNA 4XQQA 4R4CA 2C2RA 5KFGA 3W2DA 3T5HA 3VMMA 3ULPA 4FNFA 2HVSA 1GUNA 3I73A 1C4QA 4BBRG 3CW2C 3K8AA 2FMAA 1XMOH 3I8ZA 4BY1B 2KHJA 4A3LH 1VQFA 4LUVA 4EVOA 3NQTA 4HTHA 2XVSA 2ZXOA 1YJ9A 3PO2B 1K1QA 1KJIA 3E6ZX 3J81L 4PMCA 2UVUA 5ELDA 3FP9A 3CU7A 1X65A 1ULZA 3PIPA 4QWCA 1E4GT 4PNYA 3TQ1A 3EPGA 1LYLA 1HZ9A 3Q8RB 4HSVA 1KNAA 4KLKA 3HB9A 4KJNA 2W9AA 2AQ3B 3T5JA 2HHHH 1MBYA 5KEEA 3GV7B 2XIGA 3PW0A 2A1AA 1MIUA 1JB7A 4F4XA 2WAQB 3H3VI 4YJ2F 3I4MG 2Z9HA 4IHJF 1PZKD 5IYCG 3GTKH 2NZ1D 3KDFA 4MTNA 1G6ZA 2KQ3A 2R7KA 2GPSA 4JI5H 5CA0F 1J5EL 2F03A 4UAIA 4XT3B 3IL8A 5C4ZA 1RJTA 4LMYA 4DL2A 1JJGA 4K0KQ 3SK4A 1WCMG 5EGTA 2YZMA 1E24A 3RUPA 4ECWA 1K8AC 4DU9A 4DV7H 2PCFB 1N32H 4OX9H 4C3JG 2XRSD 3QZ8A 4DV2H 1N36H 4Y52H 5IT9E 1EYZA 4OELB 3M3YH 3HP3A 1V4YA 5LP6F 4G7ZC 2WKCA 1GVPA 1SE2A 1CA5A 2FPIB 2L1BA 4KKSA 4NPSA 1KC7A 2D5DA 1LTSD 1FNVA 2CZGA 1STHA 4ETSA 2A73B 2GA4B 1JDEA 5CC4A 3C0FB 1QUQA 4X3UA 3ZJYC 1K83B 1U4PA 3IFDA 3W1GA 1EQQA 1RCVD 2R7ZB 1CQIB 1X9NA 1RDPD 3OSNA 2R8IA 2R7LA 5ISRA 5I4DA 5KT5A 3KFUA 4JBMA 2YYZA 4IPCA 2JEBI 2NWGA 2G9DA 4X65H 1L2FA 1RHPA 4HIOA 4RNMA 3I4MH 2E2JB 4HJ8A 1VQ9A 5KFAA 2NTSA 4R4QA 5C0XJ 2EXZA 1P8LA 3LWEA 4TSSA 4R8UB 3T5KA 1SYBA 1B1ZA 2CQOA 5DM63 4JYAQ 3MWYW 1R9TH 2OWOA 1A0IA 3GTPB 4MNOA 4C56C 5GADC 1HR0L 3H0GA 2WB1A 4A3BB 1WCMH 4C1NK 4O3RA 2X6LA 2FINB 4IUUA 2CWPA 4RAZA 4DL6A 2VUMG 3BAAA 3DF7A 1BUVT 1CKOA 5CV9A 2JA5A 4G7HC 4K5XA 1PFSA 3SK5A 1E22A 3ERSX 3M4PA 4IUVA 1HNXH 3S1RB 2LS01 3PMFA 4PG3A 4AQYH 3KBXA 1XMQH 2QEJC 2BH8A 1E0BA 2BCOA 4Q43A 2J0TD 3M4YA 2W57A 1KD1C 2R92G 4RUCA 5DQIA 2QDBA 3R93A 3J81E 4ODGA 2BR0A 4X66Q 4P73A 3A8KE 1D5XC 2F0QA 3ORQA 5IGFA 3MEHA 2Q8TA 2I0QA 4KKTA 1EQTA 4DNTB 4YY3Q 4ZQIA 5J2TF 5IWAH 5EDWA 1PFMA 4HIDA 1DONA 3AYHB 5C3EB 2XTIA 1B8AA 1X56A 5CYUA 2JA6G 3URYA 5C0XG 3PVXA 4JV5H 4GOPC 4DUYH 1I50H 2XNAC 5IGCA 3K5MA 2DZDA 4CJ0B 1YNXA 5D3IB 2UU9H 2V9WA 4K6DA 2EE1A 5JVH3 5ELEA 2ZTDA 3C2PA 1KJJA 3LNNA 2B3GA 3PGZA 5AFWA 3NXWA 2WE6A 2UXDH 5DLFA 2W6OA 4A3MG 4ECQA 2K14A 3KYHC 3KOJA 1N33Q 4JI8H 2DPIA 2VQFL 3N40P 3D0FA 5KFJA 2JYOA 1IKMA 2V1CC 3BDOA 5IGBA 3RBEA 4R4TA 1EIFA 3ER0A 4LF4H 1NAPA 1HZCA 4HJ7A 4A3DB 2L9HA 3I4LA 5KFLA 4MIUA 4OO1I 1F77A 1PHJA 3T1HH 2R92H 2NU9B 4WORA 2P5ZX 3LWUA 1D5MC 2UUCQ 3DM1A 2D0PA 4ME3A 1TWFA 4J9RA 1SXTA 2AGOA 2O4XA 4O0AA 4RGMA 2F0LA 3KLSA 4GLXA 4K2LA 1WTRA 2OTLA 1NBWA 3S1NB 1TAEA 1UC8A 1E3PA 3KF8A 5LL6S 3JAML 5L1IA 4DV4Q 1LUZA 5C0XH 4KD3A 3ITPA 1WYDA 4ZHQF 1NY4A 1DD2A 1Y1VB 4HJ5A 2OF1A 2ASDA 2YTVA 4FXDA 4X64L 4RB2C 5C1OA 4C3IB 2FB9A 4JPBW 2F0HA 4A3MH 4PDBA 1D1IA 1JJCB 5G3LF 4A2AA 1Q90A 4J9QA 4ME5A 1QCBD 1RJPA 1ESRA 5C5LA 5J1ZA 5L37A 1B3AA 3KF6A 4ZQ3A 2B39A 1LT6D 4A3GG 4A3CG 2X69A 3V96A 3CP0A 3GTKA 4JI0L 1SJED 1U4MA 3PR5B 4C5AA 3H91A 1OWTA 3EYYA 3WWVA 3TQTA 1J5EH 3GD7A 5H80A 2CH4W 1WTOA 3VYTA 1A2UA 4Q8FA 2R82A 1SEIA 1PFBA 1E4EB 2M9VA 4FF4A 4GKKL 1UEAB 4XYQA 2VPSA 3HOXB 3NHHA 4C2MB 1SE4A 5JEAJ 2JEFA 2IHFA 1STAA 1Y8PB 4BY1G 4B3MQ 1M0TA 2WAQE 2EYLA 4TQUS 2I87A 2PN1A 3MR6A 4XDXA 2XCAA 2IWHA 4CDDC 1CUKA 2JA5B 1BCPC 5DQHA 1E2WA 1R4PB 5C6AA 1AH9A 5G3LD 1TS5A 1E2VA 3K7AB 5HY6A 4TVAB 2AUKA 1JT8A 2XWJB 1GXDC 4KV6A 3GTJH 2WAQG 5CMDA 4YWKA 4Y8VB 3PUXA 5KFUA 3OSOA 4A3GH 3DWAA 4DPGA 1CSQA 4P74A 4JI6Q 1U5KA 2FLPA 5CR3A 4FS1A 2R6GA 2NU6B 4GLAC 3M4IA 1R9TA 1EY0A 3L4JA 3D31A 3NP8A 4AYBA 2OT2A 4WRDA 1HR0H 5LMUL 1WCMA 1I6UA 3QG1A 4YAKB 4O4HF 4DN4M 4HMIA 4JK1C 1UE7A 1X3PA 4DR6L 1CA6A 3J7AV 2PNRC 1I7NA 1PX2A 1LTID 2A6EC 1QE6A 4G3IA 2V58A 3GV3A 4EX5A 3PO3H 3I4OA 4P71A 4BY1H 3PN1A 1KJQA 4YHHL 1BCPF 4JBJA 3PO2H 1EL0A 3M9MB 2DPJA 1LO5D 3JAME 2R8KA 1PH8A 4PZ7A 1A62A 2UVVA 5KG5A 3U50C 5DLQE 2R7ZG 2UVRA 2JEIA 2A8VA 4HAEA 2A6HC 5T14A 1TR5A 5H1SE 2OH2A 1YZ6A 2L11A 4DV1Q 1STBA 5M3MB 4A3IG 1EYDA 1LACA 2B2UA 1TWCB 3K80C 4A3KG 2OCEA 3I12A 1Q86C 3NBIA 3Q8SB 2IA6A 1YHQA 3RZOH 3SVMA 4LF7L 3HOZB 5JOBA 2IMWP 2QDLA 4GNXA 1EEFD 2EYHA 4F7XA 3OUZA 4IPDA 3FEWX 1VS0A 3VYSA 1I50A 1E1TA 4A3BG 3S17B 5K2MA 1B70B 5EKLA 5CBAE 5JJKA 1A2TA 3W1BA 4IUQA 1W96A 2SEBD 1W93A 1O7YA 1EIYB 4HJAA 2MJ8A 1PTOB 1B50A 1T36A 3EIVA 5GONF 1SMXA 1BCPD 2TSSA 4OL7A 5E4WC 2VQFH 3RB3A 3OUUA 3DM3A 3X3NA 3AMUA 3OW2A 5JEAH 3J81j 1NMFA 2E2IH 1LM0A 3J7AF 1LT5D 1BO0A 1Z9FA 4IURA 1PRTB 2R92A 3ERQA 1K83H 2R7ZH 3RB6A 1D6EC 2W9BA 1TXYA 1SMYC 1EY8A 3GTKB 4LSAA 4MA0A 1VBGA 1ZHQA 3EQLC 1K8OA 4ED7A 1GUGA 4NXNL 3CCSA 4LSXA 2E2JH 4CDCC 1T94A 1H95A 2XD4A 5C3EG 4EGJA 5JJLA 1B2TA 3S24A 1SSOA 4Q0FA 3N8DA 3F2DA 4RMFA 1XNQL 5KT4A 2N55A 3UDXA 4ZI7F 1CE8A 3GTPH 3GIPA 1YHAA 2K5WA 1GM5A 3KLWA 4LJZC 4A3BH 2UXCQ 3VPBA 4QUFA 2LKVA 4IQZA 3M3YB 1HUNA 1K8GA 4XQNA 3NQIA 1BJTA 5KFRA 4RNNA 3GDEA 4X64H 3F1ZA 3C1EA 4Q45A 3U9SA 5L1JA 3TN2A 1MJEA 3J80W 1AW7A 4I7ZC 3A56A 3EN2A 3HOVG 5CAEB 2ZM6Q 2EY2A 2KBNA 3OHBA 4POGA 2A6HD 2HGSA 4FO2A 4A3DG 3E5NA 4JI0H 4ILWA 3I70A 4MV7A 4RKBA 3S16B 4HNTA 4EYHB 3VYUA 4A3FB 5FLMG 1ASYA 3FPUB 2F0UA 2ASBA 4O2AF 3LGJA 4R4OA 4QJFA 4DAPA 4YB8B 1S5BD 2ZXRA 1HZBA 4JYAL 4IJHA 3T1YL 3W5OA 4GKKH 4L6TB 3MXPA 4WJWA 4RB3C 1RTOA 1U0LA 4AYBB 1V1QA 3S15H 3SE0A 2VQDA 4HIKA 1YVCA 1VKZA 4J9SA 3BJUA 4JI1Q 2OQ0A 1VCIA 2BE5C 2C5CA 4UPAA 1U4RA 4UCTA 1Y1VG 3G6EA 3VPDA 3TINA 5KFYA 4DNIA 3VDYA 4B3SL 5FD6A 3PUWA 2J7ZA 4UDUC 4C3IG 1ESFA 4HMJA 3D6WA 2JXMB 3M7NA 2F4VL 5AJ3L 1A63A 3GTJA 3N42B 3HBLA 5KIXA 1GUWA 3L4KA 3MA2B 1JIHA 4X66L 2B2WC 2F0VA 1SMYD 3MJFA 4MTEA 3OTOQ 4O1NA 1Z2NX 1DOKA 3CC4A 4IR1A 1STEA 4GZYC 4TQRA 3OHAA 1IW7D 5LMUH 1TKWB 3NENA 2L4NA 3K59A 4JVZA 4OWTB 5A35A 4DR6H 4A75A 5GROA 3S1NH 3Q24A 1JR0D 4J9MA 2EZVA 3HOXG 3TP5A 5LMNQ 2WB1G 4MAMA 5NUCA 2LSSA 1FJGL 2W6MA 4EFEA 1N56A 1UNSA 4YHHH 2J4XA 2ATLA 4IUPA 3JRXA 4IFDJ 2JA5G 3BABA 1Y1VH 3HKZB 4HQ6A 4ECXA 2NVQB 1SE8A 3Q8QB 5C3WA 3K7UC 5ELBA 2ZTEA 5HGQA 1NCVA 4CKBA 1Y8NB 1X3FA 4C3IH 5FO9B 1VQMA 5I47A 4MHEA 2XC9A 1KNEA 4DK0A 2K6AA 3VR3A 4R8NA 5KFMA 3G48A 3K5NA 4JUZA 4EBDA 1RYRA 4I65A 4LUOA 4A4IA 2UUBL 3Q22A 1VQ8A 4FDBA 2ALYB 1IBKQ 2MO1A 1VQOA 1C0AA 2W9BB 1S9FA 5I9OA 2Q2IA 4DAYA 1PH9A 5JUMA 1KAWA 4DR1L 1TS2A 5DLGA 2PO4A 2VY3A 2WKDA 4JOIA 3MWEA 2ZXPA 3A54A 3G7LA 3NSWA 1G51A 3NPPA 1G91A 5KYIA 2BE5D 3GIJA 3HOXH 1AP0A 1ZETA 4R7RA 2I5LX 4C2MH 1GO3E 4KD4A 3UDFA 1FD7D 3GTLB 1I3QB 4LUZA 2XGTA 4YIJA 3ETHA 1B04A 3NBHB 2E2IA 4CJ1B 1VQ4A 5KFIA 4LK1C 1K73C 1EU3A 1S97A 3GTOB 3F2BA 4A76A 3U58A 4O3NA 4O3SA 2YV5A 5A2QL 2I5HA 3HG9A 4AIMA 5DNFA 3G6JB 1JWUD 2R86A 1K83A 2K04A 2B2VA 2R7ZA 2W8LA 3K7AH 1G8ZD 3N52A 2EYFA 2EVBA 1GHKA 2SOBA 1Q82C 3SEBA 3I90A 4LF6Q 2W71A 5M3MG 3PW2A 3C3LA 3VR4A 4NXNH 4LFCL 2PMZB 2JJQA 4BBSB 1II3A 4LF9L 4R8UA 4F4YA 1C7YA 1EY9A 3HOZG 4LFBL 3H3VC 4U673 1XNQH 1SAPA 3GTPA 5K36H 3G6XA 2B8GA 4DV0L 5KRUA 1OXXK 2DNEA 2EJMA 1NR2A 2XN9C 2DY7A 3RFCA 1GYFA 1Q8IA 2C9OA 4QL5A 5KNCA 4POFA 1RL2A 3D4RA 3GIDA 5FKAC 3PIOA 4LWCA 5EWFA 3Q1KA 1B9NA 4JV2A 4V190 1HCZA 1RKNA 3KALA 3E0EA 2JEJA 2RDGA 3FHWA 3CQZB 3Q8PB 3R23A 2O03A 4UP8A 2F0KA 3BA8A 1PMRA 3GTJB 1J8IA 1EZ1A 4I7AA 4IFDH 3BA9A 4ECSA 2OXPA 1RJQA 1JXLA 1WTHA 3EJIA 1IBLQ 4FF3A 1IKLA 1PV4A 4JI4L 4ECVA 1NSNS 1TT2A 3CRKC 2JSOA 5DG7A 1XTDA 4JYAH 1KEEA 3VR6A 3T1YH 2M00A 1TWCH 5HV6A 3T13A 4HR7A 2A69C 1CQJB 1SLJA 2PNHA 3S1QB 2B2TA 3BYYB 3HOZH 5KFDA 2YRXA 1BKBA 2UXBL 4DR2L 4IPGA 2VA3A 1ET6A 3PUYA 4NKLA 4DAVA 3S17H 1N48A 1MHWC 2RA4A 3DEPA 5ELOA 2IBKA 3PO3B 3SHLA 3T56B 4KTAA 4YCUA 5C8YF 4DR3Q 3CF5A 2FP4B 4B3SH 1BOSA 4O2BF 2K5VA 4ULLA 1S10A 1PTOH 3RBDA 2NU8B 3VR2A 1N34H 4JC0A 2AKWB 2RHSB 4X62L 2F4VH 1Z7TA 1KHIA 1Q1BA 4EQOA 4AYBE 4RA8A 1WSCA 2W6QA 4YWMA 4OEMB 4X66H 3Q23A 1OXUA 4IWYA 2N8NA 2YCHA 2ES2A 4X3KA 1CK1A 5C1PA 2VA2A 4A3FG 4WJ4A 5JJIA 1A6XA 3PCOB 4IO9A 3RN2A 4R9WA 2KHSA 2VQEL 4HIMA 1I4HA 4JG2A 3HGBA 2BQRA 4RKLA 3RZOB 3N43B 4DAYB 4DXFA 5A2QE 3AU7A 2C28A 4AYBG 3RN5A 5E1FA 5C0XI 3L0OA 2VOBA 4K5WA 1V51A 3BVMA 5KFBA 1FJGH 4JI3L 1SE3A 1JJ2A 3OMCA 4A3JB 3BVGA 5FLXE 4X3TA 5IE8A 4HEDA 3BQ0A 1DOMA 1Y1VA 2NBFA 2EPBA 4KY6A 4IR9A 1ENAA 1MSHA 4QWEA 4M9UA 2E2IB 2LMCB 1ILQA 4X6AH 2K75A 3T4AC 2MCTA 1BBUA 2BDNA 4ZK9B 1PH2A 1D5ZC 3TP7A 3IAYA 2UUBH 4CKEA 3BZCA 2AQ4A 3H09A 1P16A 4GC6A 5FK9C 3CPWA 2W8KA 4J15A 3NELA 1YIJA 3K5HA 2KCCA 4MV1A 1F2LA 1NTGA 4OHJA 4LW1A 3S16H 4DR1H 2JP1A 2M05A 4A3FH 1I4GA 2IW3A 1G291 1FR3A 1V9PA 3HKZE 2A69D 1ET9A 2LXJA 4DK6C 3A7AB 1E4EA 1VQNA 4RZRA 4J9PA 2CW7A 3U9TA 2AHOB 1STYA 1HNZL 1B4OA 2UXCL 4C3HB 4C2MA 4ID6A 3CXCA 3WOEA 2JA8H 3GIIA 4M7EA 4DV3Q 1XNRL 3GV6A 1EFID 2SNMA 4TV9F 1JE4A 1WD1A 5I9PA 4GN3B 1WTPA 3CCLA 2RDHA 3NTKA 1EYCA 1L0YB 1VQLA 3FKIH 1A3VA 1JDBB 3HKZG 4LFAL 3TQYA 1L2ZA 2EY6A 1I7LA 1M8AA 2R61A 1TS4A 3H94A 1EWHA 2X0SA 5D1OB 2PZWA 5KFSA 4IWXA 1XPRA 2F0PA 1I6VC 5KG0A 4LFCH 4P2CB 1L0XB 5FLXc 1YJNA 5IYBH 4LF9H 4DFAA 4HNUA 1QNUA 3DHQA 3FPPA 5IT9c 4PWQA 5IYZF 4LFBH 1JWMD 5CORA 1T9HA 5T1GA 1AE2A 3BS1A 1PH3A 3S15B 4E4TA 4DV0H 4HR7B 2C35B 5KFHA 3RLOA 3ORRA 4XQJA 4IOAA 3PR4A 5IP7H 2CWAA 1H9SA 5JPNC 3GTMH 3DLLA 4EBCA 2NN6H 3K5IA 2HHHQ 1SNCA 4PMWA 2PMZE 1DZ1A 2B2YC 2FK1A 2NVQH 3R8BA 4MV9A 2EDGA 2AUJD 4LF5H 1EWCA 4J9LA 1DGSA 4P72A 4CDEC 4YQWA 4JI5Q 1KDBA 4JI4H 1PDQA 3UDIA 3FMCA 4J1MA 1S5ED 1SN8A 4XIGS 2V4RA 3HS0C 3N44B 4DV6L 2FPGB 1TWCA 1K9MC 3RV3A 4BBSG 4DV7Q 1F2ZA 1PLFA 1KDCA 4OX9Q 4UFZA 5LMNW 3KJPA 1TY0A 1L1OA 4DKAC 2UXBH 4DR2H 5E7NA 3TDQA 1K28A 5EBDA 4CHTB 5D14A 3J80i 3KTMA 5ELFA 1ML0D 1QOHA 4OGQC 1CHQD 2Z6KC 3ULJA 1YITA 2JEAI 4O3OA 3A0JA 3TMEA 4BWGB 3K57A 1JKJB 1F9SA 3LMLA 1T3NA 3EFXD 1WTXA 1IBML 4NP5A 1I6HH 3J81c 2BA0A 4PMBA 4X62H 3BG3A 3GTLH 1I3QH 1MJCA 3H6MA 5EWGA 3RGZA 2PQAB 2NVXH 2W70A 3CCUA 4RHRA 2QEXA 1UAPA 2NZOA 4TRDA 2AMCB 5FOBB 4ECUA 3GTOH 1G2SA 4LF8Q 5FPOA 4KHPL 3BQ2A 3PW4A 2WDTA 3OSPA 1XX8A 3MXNA 2YTYA 1K0SA 1NR4A 4C1NI 2JA7H 2VQEH 5KFZA 2JE6I 2Q2TA 2UUAL 3RLFA 4DR5Q 4KKUA 1BCPB 4Y7NH 4MZ9A 1JWSD 4APVA 1FGUA 3OYYA 3L2PA 1YEZA 3RR5A 1EIGA 4BBSH 1IYVA 1A9XA 2F0GA 3GTGB 4JI3H 4QUCA 4B3TL 1VQ7A 1AE3A 1C8CA 1S0MA 2D0OA 1EUCB 3K0YA 1JORA 3CKIB 2R7NA 1XJVA 1QB5D 1M1KC 3PO3G 2DUDA 4AQYQ 1SFOH 1XMQQ 2F3IA 2K5DA 2ZJRA 1I94L 3PO2G 3H15A 2ASLA 2PPBC 4DA2A 1X3QA 4LH6A 4KHZA 1OXVA 2LY7A 4RZQA 3CQZH 4ECZA 4WFN3 1K8MA 1MZBA 3UE1A 1BQQT 1AUVA 2E8GA 2HQEA 5FPRA 5FJ8G 1PH6A 2CFMA 3TS2A 3QJYA 2KVMA 1JQYD 1XPUA 1G6PA 5FD5A 1EOVA 5CGKA 1XPOA 4JV5Q 3UI2A 4DUYQ 1TA8A 3CCRA 3BZKA 1JCKB 5M9OA 2UU9Q 2K28A 2I80A 4JI7Q 1HNZH 1UE1A 1I5FA 1MKHA 1IL2A 1FKAH 2N49A 4IPHA 3S1QH 3DWQA 1EZ6A 4A3JG 4G4KA 1XNRH 4YP3A 1PH7A 4GKJL 1FVIA 2D9UA 1H9SB 3BJYA 3FKIA 3KHGA 5EWEA 3L9AX 5J39A 1NUCA 3FVQA 3MFIA 2DJFC 4LFAH 3PV0A 4LF4Q 1D2BA 1ZKOA 1IOVA 2K1BA 4F4WA 5JEAG 5I6YA 1YBYA 2K01A 3V6KA 5EPKA 5DM73 1J9OA 1CS0A 3RNUA 5KFVA 3R2TA 3VYRA 2K03A 2K50A 4NXMQ 4IUTA 2HQLA 5CV4A 2EYJA 3QWNA 2D2CC 1HNWL 4FU0A 4BWSC 2W6ZA 3TRZA 3TBIB 4FBUA 1CM9A 2OEOA 1S03G 4KJOA 3CCJA 4O42A 1VQKA 5FJ8H 1QWYA 3SXHA 2WP8J 2QYZA 1E4FT 2FHTA 3CC7A 3GQCA 1K1SA 2R87A 1EQVA 2LFNA 4J9KA 5DEHA 1QJOA 1L1OB 1VQJA 1GLVA 5JH7F 3TZDA 4C3HG 2NVYB 5KNBA 1PA6A 3GTMA 5KT3A 1D1KA 2ZJTA 1Y1WB 5GAEC 5IY0A 4A3JH 2E5LQ 2VXWA 3RGXA 1BF4A 1AN7A 1SNMA 2A68C 1BNCA 3HKZA 5IYDG 3EVQA 4NDXA 4EQNA 3FRPB 4XXEA 4GLVB 2B29A 3SI8A 4IJLA 3QIAA 3EA6A 4DL5A 3CVZA 1TY2A 4FVMA 1PK8A 2R85A 5KKNB 4FF1A 1W2BA 4DV6H 2AWOA 3RJ0A 1KBLA 4IZOA 1EEID 3MXNB 5BMVF 2A5HA 1EFWA 5D8DA 3T16A 4B9XA 4XYOA 2PZUA 1SNQA 2KECA 2RHQB 5M3FB 1S72A 3RZDB 1J6QA 1SYXB 4O2DA 1SJHD 3HOWH 4K0KL 1DIKA 3OMGA 4MTDA 1IW7C 5KG1A 2PVPA 4RNOA 1LTTD 4DL4A 3JAMc 4O4LF 5EKIA 4HCSA 1T5EA 4C3HH 2F0TA 1RYSA 1SEBD 1EYGA 1IBMH 3GTLA 1I3QA 1HXYD 3GP7A 4O4IF 3HOUH 4EQPA 2AU0A 2NVXA 3K5LA 1D7QA 3NBHA 4TQSA 1STGA 3R2IA 3NUCA 5KFTA 5IYDH 3GTOA 5KX5F 3F8TA 1JOOA 1VQBA 5KG6A 4KHPH 2MQHA 3J80L 2JEGA 2EXDA 1X32A 3I3CA 2JA7A 2Z6BA 1EZ8A 3SDZA 2UUAH 1LTBD 1VQCA 2ENBA 4RAYA 2DGYA 1L0WA 2PMZA 4KN4C 2BH2A 1LV9A 3AB9A 4JCVE 4Q5VA 1TWGH 2RDFA 3K5OA 4RFBA 3SK8A 4B3RQ 4JBWA 4YWLA 1KRTA 3D4DA 5K5PA 2VL6A 4B3TH 1PH5A 1Z47A 2W7PA 2HUGA 3GV5B 4MN3A 4K8IA 1S68A 2JA8B 2RBMA 3E9HA 4CKCA 4DUZQ 1KC8C 1SFOA 3E0JA 4OXPA 4N9TA 3BDLA 2B63B 1M6VA 3RB0A 1V1OA 3TREA 2I07B 1I94H 2MGSA 4ED0A 2CVRA 3FKIB 2NU7B 2A68D 3UFXB 1SR3A 3PUZA 2HIXA 1Q3LA 3ND8A 3V2TA 3CQZA 3S2HB 1RK5A 3R3OA 3J81i 2VPQA 2N3SA 3S9WA 3P75A 2FMMA 2C2EA 4YR3A 1VBHA 5F9NA 1F2MA 3U9OA 1SNOA 4Q0YA 2N78A 3M85A 3HOYH 5EPJA 4OWXB 3NK9A 3KK7A 1TS3A 1HTPA 3MVVA 3QOLA 2EIFA 4YY3L 2L55A 3KLSX 3GV8B 2JK8A 2OQKA 4UP9A 1KJ9A 2WV6D 2F0OA 3CAMA 5BPFA 2DJGC 2EJFC 1FNUA 3EROA 3MR5A 1BGWA 2G9HD 3Q8DA 4GKJH 4UCRA 3W3AA 3I4NB 2VW9A 3WO0A 3F2UA 4RGNA 3GTMB 3M9NB 2PQEA 4GN5A 4V0BA 1M90C 4ZLTF 1HJPA 3TS0A 4JI2Q 2FKLA 1YI2A 2CHBD 1B9MA 1HQRD 1PTOD 1N33L 2F0WA 1JOQA 2CQAA 2E76C 3Q6SA 3GLKA 4CDFC 3MAQA 1I4RA 2WIIB 3A5ZB 3N6RA 4QY7A 4JI5L 2D62A 1HNWH 2IX3A 2F3WA 3HXLA 4M1UB 2VS1A 5HGTA 5DGAA 2BOSA 2PW7A 5F9LA 4IRCA 3KBGA 2UUCL 3KUPA 2L0CA 2F0IA 4TUYF 2VUMB 5KFKA 2F1MA 4LF7H 1EUJA 2EOTA 4UHVA 1M0WA 5C3XA 4ZUJA 5C4HA 5K36G 1CQFA 4XYMB 2FK2A 4CGYB 2B2UC 1TIID 1FYCA 4DV4L 5C4XB 5C44B 1GKHA 3GTGH 4KN7C 2CCZA 2YS7A 5CV8A 5IP9G 5EZYF 2XRQD 2L15A 3D3RA 5J3BA 4GNXC 2H4OA 1B6SA 1KAAA 3V05A 3NE5B 1I6HB 5ELNA 1VAJA 1ZHSA 3RMHA 2NVXB 2DY8A 1S5DD 3HRZC 1LT4D 2A74C 1Y8OB 2HT1A 3AEVA 4RG1A 4LF8L 3IN5A 1AUXA 5L9XA 1HHVA 3J7YW 3IRBA 4H02A 4IFDG 1O75A 5L1KA 3MFGA 5C5JA 4FBTA 5M5XH 2MPMA 2RDJA 2JA7B 3PIO3 1TWHB 4DR5L 2SNSA 2YTXA 4BY7B 1SNDA 4G57A 4MV8A 4Y7NB 2QA4A 5IGEA 1DM0B 1IXRA 5KNDA 1IYUA 2ZDGA 4K0KH 2NTTA 1F9RA 2WTFA 5CV5A 3Q0AA 2DLNA 2FFKB 3FDSA 2Y0SB 1LTGD 3A7LA 1Y1WG 2ASJA 4B3ML 1VF7A 4AQYL 4A93H 3D8GA 4AH6A 1WH2A 3PSIA 1SFOB 2W9CB 5IP9H 5FLXW 1JC7A 4EGVA 3R5XA 4DR4Q 1XXGA 1GHJA 4OWWB 4L8JA 2GPWA 5IT9W 4PQXA 4RWSC 4RGTA 4I4TF 3U4ZA 2NVTB 1WR2A 3WNZA 1OTCA 5KG3A 3T5LA 4ALPA 3HEJA 1D8LA 1ICWA 2K5HA 2K5QA 2WFWA 3GIQA 3CCEA 3UQ8A 1F9PA 5D1OA 5F2DA 2XCLA 3JSNA 4ED8A 3WO1A 1BR9A 3GTQH 1YHBA 3DMUA 1VQIA 1CHPD 3G8CA 4KMUC 3OHXC 4DR6Q 1TWGA 4JI6L 5JJZA 4F88A 4MV6A 2CH4A 3K0XA 5LL6b 3PIP3 4APMA 2V59A 4L5RC 5M3FG 4FYDA 3AFPA 4JI7L 1LTLA 4QIWB 4QGUA 4EGQA 1RD9D 2NUAB 1OXSC 1I4XA 4XTCS 3CMEA 4YHHQ 4DV5Q 4YR2A 1VQEA 5I2YA 5J22A 1GUSA 4IN3A 3D6CA 2MHVA 1S4ZA 2PW5A 1IYJB 3U4VA 2V4QA 1KLUD 1M4VA 2NVYH 3O13A 1GD7A 1ZQ7A 5JVLA 1RODA 1Y69U 1Y1WH 1ICFB 4YCWA 3LX0A 5E4XA 2ZTCA 2IPKD 4E6IA 3JAMi 2K33A 2R7MA 1JMCA 2YU9B 2H5XA 1KRSA 2HJWA 2KSWA 2F0FA 1BBXC 2Z0SA 3MXUA 4RCOA 2O5JC 2V4DA 1QG7A 5COYA 2E75C 4U7CA 1X55A 1CQVA 3I7FA 4YJ3F 5FO7B 4NXML 2MUYA 1Y14B 2E2HB 4F87A 2Z4IA 4OIJA 2F0EA 4LNQA 3ICEA 5JQWA 2HIVA 4IZ8A 1K0RA 3KHLA 4DV1L 4XYLB 3F2CA 1I4QA 4DR7Q 4FXKC 4YY3H 1NMGA 2K7VA 2DNCA 4P75A 3J81W 3H20A 2QF7A 2EQSA 3M4QA 2CQYA 4H44C 1V8QA 4U6PA 5M3FH 3RZDH 1VQHA 3NWTA 4XX0B 2VNUD 4LH7A 4TV8F 1WOCA 1R4QB 4U68A 1WTVA 2JA8G 2R93B 2VR1A 1MSGA 1K3RA 2NB0A 2E5LL 2HVRA 3S1MB 2EY5A 3H40A 2B63G 3JZIA 4BA2I 3K3PA 1O7IA 3MWMA 3FKIG 4CC5A 4ZAIA 1Q81C 1H9JA 1N33H 4RUAA 3A74A 2PQAA 2VZAA 4M8AA 1S3OA 1E7ZA 2FLNA 4BXXH 1E1OA 4RH6A 1EHIA 3S2DH 4KHVA 4YCVA 4NXNQ 3CD6A 4F50A 4EQ5A 5LXTF 2R7FA 2BQUA 2UUCH 4L5QA 1F9QA 5M5YB 1XNQQ 2IX0A 4PZ8A 5IYBG 1DCZA 5KG2A 4Q44A 4BBRH 2SDFA 4NMZA 4L1KA 2BDOA 2YL2A 2EY1A 4HN7A 2IX1A 3HOWB 3KAKA 4B08A 4DV4H 3GTGA 5KG4A 1W6KA 2IJ0A 2OTJA 2YYAA 1T5XD 1YNND 4QB4A 3STBC 5IP7G 5IIFA 3I4NG 3P1HA 1PYSB 3LWBA 3Q2OA 4MV3A 4JOIC 5J2UF 3RIZA 2Q2HA 2NN6G 2E74C 1A3UA 3HOUB 2B63H 1TWAB 4RHSA 2RGRA 2JA9A 1WI5A 3WOFA 4ZOLF 1BXRA 3VA5A 4A3IB 4I55F 2FJ2A 4A3KB 4LF8H 2EYMA 4I7HA 5IYCH 1PVOA 1N9WA 2ZM6L 3BVZA 3S2HH 5KFQA 1HR0W 3NWSA 5DAUA 4QWDA 5JVDF 2KEDA 3JC66 3T1YQ 4GOPB 5BR8Q 3QFFA 3MEFA 1IHZA 1MGSA 2MP1A 3GO5A 3CMAA 3KAJA 4DR5H 1FGBD 4ED6A 4G7OC 1B7YB 1CKNB 4ZKBB 1KIXA 1EUDB 2AGQA 4KY5A 1U4LA 3MC0B 1SROA 1AFPA 2LXKA 3HZXA 4B3RL 2B2VC 4C3JH 1TWGB 3OW7A 2VB3X 4KK7A 5KFEA 3M7GA 3NTHA 3ONAB 4GC7A 4RB0A 5EKKA 3LP8A 1XMOQ 2K4KA 4IAJA 3EPIA 4B3SQ 3PW5A 1HFGA 4DUZL 5C4XG 4I50F 5C44G 4B3MH 4JI1L 1N34Q 1MI2A 4R1JA 2P0AA 3SE7A 2F4VQ 3I4NH 5AJ3Q 4KY7A 1KABA 1HPCA 3N6XA 4QQBX 4DLKA 3OOCA 4H0LC 4HNVA 1CSPA 4K8JA 2SCUB 1HA5A 3G71A 1YJWA 2XIWA 1C3OA 5FO8B 1YNJC 4NW2A 5IODA 4YR0A 2RCNA 4J6HA 4UCOA 2J6UA 3GTQA 4JBKA 2AGPA 1VMCA 2Y0SE 3PF4A 1H9RA 3HOYB 4RGOS 2HCIA 2JA7G 4JI6H 3OTOL 4BY7G 3EBEA 2CKZB 1SDFA 3H4BA 4K6LA 4BS9A 1GSOA 4QW9A 1QZHA 1SYFA 1PH4A 1OXTA 3QZ7A 1FJGQ 4OIKA 3OPOA 3NGDA 4JI7H 2VUMH 1N32Q 3VA7A 4DV2Q 3A8IE 1N36Q 1HH2P 4DK3C 1ZEQX 2KJXA 3CC2A 3STBD 5LMNL 1EQRA 2Y0SG 2NVYA 4YBZB 3TP6A 2Q2UA 1Y1WA 3CCVA 3HOVB 1RJRA 5C4XH 1LABA 2MNAA 4DXGA 3GIKA 5C44H 4K14A 4DL3A 2RDIA 1UWVA 5EAYA 5D1PA 4CC6A 4JI2L 2RVLA 4XZ3B 2B2TC 2H1EA 4EYIB 2ICEC 5KFCA 4HSPA 2UUBQ 5C4JH 4NB3A 2IL8A 4J8QA 3KJOA 2GN5A 2ZDQA 3E3XA 4QIWE 4ZCKA 3H3VH 3KDFB 4QF4A 2FJZA 2NYZD 2GLTA 4NXMH 2QCPX 4DR1Q 2W6PA 3ULLA 4X65Q 3JAMW 3QB3A 5CA1F 1UNNC 5KT6A 4DV1H 4C5CA 2Z4HA 3G6YA 2L12A 1IBKL 2RKSA 4N8X1 2JA6H 5CB4F 3FDTA 5EJWA 1KXLA 5JAVA 1TWHH 1B33N 1DXMA 4BY7H 1DV1A 1ENFA 2V5AA 3N41B 5LL6X 3C46A 3M4OB 3OIPA 4A3EB 5D3DA 3MTSA 1S5FD 1GSHA 4B9WA 1JB3A 3P7JA 5KG7A 2QKIC 1ONLA 3RLNA 1WTQA 2E5LH 1AEXA 4FS2A 3G4SA 3K3VA 3RV4A 2A19A 4ZKCB 1HNXQ 1SYCA 3I72A 1QUQB 3BDCA 1CKMA 4A2BA 1NE3A 2GVAA
chains in the Genus database with same CATH topology
3F8TA 1VQBA 2MQHA 3K7AH 2GVBA 2EXDA 3KFUA 4JBMA 2YYZA 4IPCA 4LFCQ 2JEBI 2NVTH 1Q82C 1L2FA 4HIOA 4LF6Q 3I4MH 5M3MG 4LF9Q 4HJ8A 1VQ9A 1QZGA 4R4QA 5C0XJ 4LFBQ 4LFCL 1P8LA 1VQCA 2JJQA 2DGYA 5IWAQ 2CQOA 4LF6L 1L0WA 4JYAQ 4LF9L 1R9TH 1C7YA 1SRUA 1A0IA 4DV0Q 2OWOA 2BH2A 4MNOA 5GADC 4JCVE 1HR0L 1TWGH 3HOZG 4B3RQ 4LFBL 4JBWA 4YWLA 1KRTA 1WCMH 2AWNA 3M9BA 2VL6A 4DV0L 2CWPA 1PH5A 1OXXK 1Z47A 2VUMG 1JE5A 1CKOA 3B6YA 3E9HA 4DUZQ 4QL5A 4POFA 1RL2A 1KC8C 1PFSA 4OXPA 2R93G 1E22A 3ERSX 3M4PA 2UXDQ 3I2ZA 3TREA 3L7ZC 3PIOA 4LWCA 1Q8KA 1X3EA 2RF4A 1FL0A 3E0EA 4JI8Q 4PG3A 4LF5Q 4DR4L 3FHWA 3CCQA 1SR3A 3PUZA 2HIXA 2BH8A 4UP8A 4A3CH 1KD1C 2YU9H 2R92G 4OO1G 3J81i 4JI4Q 2N3SA 2KENA 4X66Q 4P73A 3T1HQ 1IBLQ 1PV4A 4JI4L 2N78A 3M85A 2I0QA 3HOYH 4YY3Q 1XTDA 4OWXB 2E2HH 1IBLL 4HIDA 3AYHB 1TWCH 1VQPA 2XTIA 2UXBQ 1B8AA 1X56A 4DR2Q 2EIFA 4YY3L 2JA6G 1SLJA 2PNHA 2JK8A 5C0XG 2OQKA 3HOZH 1BKBA 2MFIA 4GOPC 1I50H 4UP9A 2UXBL 4DR2L 3HOWG 4IPGA 1YNXA 1X54A 4DV5L 3CAMA 3PUYA 1Q12A 3S17H 5ELOA 2ZTDA 3Q8DA 4YCUA 2B3GA 3PGZA 2VW9A 4DR3Q 3CF5A 1NJIC 4X62Q 2PI2E 4A3MG 2K5VA 2K14A 3KYHC 3KOJA 4GN5A 3HKSA 1M90C 1N33Q 2R93H 1HJPA 3TS0A 4JI2Q 2VQFL 4JC0A 4DR3L 2AKWB 2RHSB 3D0FA 4X62L 2IY5B 2V1CC 3S1MH 3HOUG 1YI2A 4R4TA 1EIFA 1KHIA 1Q1BA 1N33L 3ER0A 1HZCA 4HJ7A 4AYBE 4YWMA 4OO1I 1PHJA 3A5ZB 1OXUA 4QY7A 4JI5L 2R92H 2N8NA 2VQEQ 2D62A 1VQGA 2ES2A 2UUCQ 1VQ6A 3TEHB 2VS1A 4A3FG 4WJ4A 5JJIA 4ME3A 2D0PA 1Q46A 3PCOB 4IO9A 3RN2A 1J5EQ 2VQEL 3AQQA 4O0AA 4HIMA 4JG2A 2UUCL 4GLXA 4DR7L 4DAYB 2OTLA 1NBWA 3KF8B 1UE6A 1E3PA 5M5YH 4JI3Q 4AYBG 4DV4Q 3RN5A 1EUJA 1LUZA 5C0XI 5K36G 3L0OA 3GTLH 1WYDA 4JI3L 1JJ2A 1NY4A 4DV4L 1GKHA 5IE8A 2CCZA 3GTGH 4HJ5A 1QVGA 2R7DA 5IP9G 2L15A 2YTVA 5J3BA 4GNXC 1QVFA 4X64L 1L1OC 4A3MH 1JJCB 5ELNA 3J7A5 3KF6B 4X6AH 2K75A 2HT1A 3KF6A 1TWAH 4A3GG 1BBUA 1PH2A 3AEVA 4A3CG 4RG1A 4LF8L 3CP0A 4JI0L 3BZCA 4A3IH 4A3KH 1P16A 4IFDG 3IRBA 4H02A 4J15A 3CPWA 3NELA 3WWVA 1YIJA 3GD7A 5M5XH 3S16H 1NTGA 4LW1A 2K52A 2ZJPA 4DR5L 3HOYG 2YTXA 4A3FH 1G291 2QA4A 5IYDH 1V9PA 3HKZE 4GKKL 1HNZQ 1IXRA 1HR0Q 2LXJA 4DK6C 1VQAA 1VQNA 2AHOB 1X6OA 1XNRQ 5JEAJ 1HNZL 2IHFA 2KCMA 2UXCL 4BY1G 4B3MQ 2WAQE 1UE5A 4BA1I 3CXCA 2JA8H 3I55A 4TQUS 3A5UA 4DV3Q 1XNRL 1Y1WG 4GN3B 1CUKA 4LFAQ 3CCLA 4B3ML 4AQYL 3S1RH 4AH6A 4A93H 3PSIA 1VQLA 5IP9H 3FKIH 4DV3L 3HKZG 1AH9A 4LFAL 2ID0A 4DR4Q 3TQYA 4OWWB 1HZAA 4IOCA 5GQOA 5HY6A 4TVAB 3U4ZA 1JT8A 1OTCA 3GTJH 4ALPA 2WAQG 4YWKA 3PUXA 1D8LA 2K5HA 2WFWA 4JV5L 3CCEA 4A3GH 1XPRA 4DPGA 1CSQA 4P74A 4JI6Q 5BR8L 1U5KA 5FLXc 4IFDI 3GTQH 2R6GA 1YHBA 1YJNA 1VQIA 4GLAC 5IYBH 5C3EH 3D31A 5IT9c 4DR6Q 4JI6L 1QVCA 3K0XA 5LMUL 1T9HA 4OONA 1AE2A 5M3FG 1UE7A 1PH3A 4L5RC 4DR6L 3AFPA 4JI7L 2C35B 1LTLA 4QGUA 3PF5A 3RLOA 2MO0A 1Q7YC 1OXSC 4A3EG 1XMOL 4XTCS 3CMEA 1RIPA 4YHHQ 4DV5Q 4IOAA 1VQEA 2CWAA 5IP7H 4EX5A 3PO3H 3I4OA 4P71A 4BY1H 3GTMH 3DLLA 3I56A 1N34L 1IYJB 1V43A 3U4VA 4YHHL 2NVYH 4JBJA 1GD7A 3PO2H 1Y1WH 4YCWA 3JAMi 2ZTCA 2HHHQ 2VQFQ 1JMCA 4PMWA 2PMZE 3HOVH 2H5XA 3UDGA 1KRSA 4PZ7A 1PH8A 1A62A 2WB1E 2NVQH 3PUVA 3U50C 5DLQE 2R7ZG 1IZ6A 3AFQA 2HHHL 2Z0SA 4A3DH 2A8VA 2KHIA 5H1SE 1PH1A 1DGSA 1X55A 4P72A 3I7FA 1YZ6A 4JI5Q 4DV6Q 2ATWA 5FLMH 4NXML 4DV1Q 1Y14B 4A3IG 3K80C 3UDIA 4A3KG 4LNQA 3ICEA 1SN8A 2OCEA 4XIGS 1Q86C 4DV6L 2HIVA 1K0RA 4DV1L 1K9MC 2ASBA 4BBSG 4GNXB 1YHQA 4DV7Q 4LF7L 3RZOH 3F2CA 4OX9Q 3H0GG 4DR7Q 4GNXA 1NMGA 5LMNW 4P75A 4IPDA 3KJPA 1VS0A 1L1OA 2BA1A 4DKAC 4DV7L 1E1TA 4A3BG 1N32L 2EQSA 3M4QA 1B70B 4DV2L 5E7NA 4OX9L 5JJKA 5M3FH 3W1BA 3RZDH 1VQHA 3J80i 1VQDA 2I5MX 1N36L 2VNUD 3M4OH 1EIYB 4HJAA 4A3EH 2Z6KC 3ULJA 1WOCA 1YITA 1IBMQ 2JA8G 3A0JA 3UE0A 2JEAI 3EIVA 1SMXA 1K3RA 2E5LL 3TS2A 2B63G 4X64Q 2IT1A 1IBML 4A93G 4BA2I 1I6HH 1O7IA 4KI0A 2BA0A 1WFQA 3DM3A 3J81c 3OW2A 1I3QH 1KL9A 1MJCA 3FKIG 1NMFA 3J81j 1Q81C 2E2IH 4UY8C 2PQAB 2NVXH 1LM0A 4KHPQ 3CCUA 3A74A 2QEXA 1Z9FA 2PQAA 2VZAA 2NZOA 2AMCB 1S3OA 2FXQA 1E7ZA 3GTOH 4BXXH 1E1OA 1K83H 4LF8Q 2R7ZH 4KHPL 3E9IA 3HFZB 4JI0Q 3S2DH 4PZ6A 4YCVA 1TXYA 2UUAQ 4NXNQ 3CD6A 1S40A 4X65L 2YTYA 4EQ5A 2JA7H 2R7FA 4R4IA 2JE6I 2Q2TA 4L5QA 4NXNL 3RLFA 4DR5Q 2UUAL 1XNQQ 3CCSA 2E2JH 4Y7NH 2IX0A 4MZ9A 4PZ8A 5IYBG 1N8RC 1H95A 5C3EG 3W1GA 4APVA 5JJLA 2IHEA 1FGUA 3OYYA 3L2PA 1YEZA 3RR5A 3S24A 4BBRH 4B3TQ 4BBSH 4GKKQ 3F2DA 4RMFA 1XNQL 2QGQA 3H0GH 4L5TA 3UDXA 3S14H 3GTPH 5M5WH 2IX1A 1YHAA 1GM5A 3NEMA 3KLWA 4GS3A 1VQ7A 4B3TL 1AE3A 4L5SA 4A3BH 2UXCQ 2D0OA 1WJJA 2OTJA 1EWIA 3STBC 5IP7G 1K8GA 1I94Q 1XJVA 1M1KC 3PO3G 3I4NG 1PYSB 1A8VA 2JA5H 4JOIC 3GDEA 1Q1EA 2DUDA 3F1ZA 1PYBA 4AQYQ 1XMQQ 1SFOH 2F3IA 2ZJRA 1MJEA 1HNXL 2Q2HA 1I94L 2NN6G 3PO2G 3H15A 4HJ9A 2B63H 3EN2A 1XMQL 3HOVG 2JA9A 4KHZA 2KBNA 1WI5A 2ZM6Q 1OXVA 4POGA 3CQZH 4A3DG 1X3GA 5IYCH 1PVOA 1N9WA 3UE1A 2ZM6L 3S2HH 3BU2A 2E8GA 5GAGC 1HR0W 1BBWA 5FLMG 1ASYA 3JC66 5GAHC 3T1YQ 2PI2A 4GOPB 5BR8Q 5FJ8G 3J80c 3CCMA 2CFMA 3LGJA 3GO5A 3MEFA 4R4OA 4QJFA 3CMAA 1UEBA 5IWAL 4GOPA 1VQ5A 1B7YB 1CKNB 1HZBA 1KIXA 4JYAL 4IJHA 1XPUA 1G6PA 3T1YL 1EOVA 3W5OA 1CKNA 1XPOA 1SROA 4DUYQ 4JV5Q 2LXKA 5LMUQ 4B3RL 4WJ3M 1U0LA 4C3JH 4DAMA 3BZKA 1V1QA 3CCRA 3S15H 4A3LG 2UU9Q 4JI7Q 1UE1A 4HIKA 1I5FA 1MKHA 2NZHA 1YVCA 4DUYL 2N49A 3BJUA 4IPHA 4JI1Q 1IL2A 3S1QH 2OQ0A 1XMOQ 2K4KA 4GKJQ 1VCIA 4GN4B 4B3SQ 2UU9L 4UPAA 4A3JG 2JQOA 4DUZL 5C4XG 3SGIA 2KCTA 5C44G 1BVSA 1PH7A 4GKJL 1Y1VG 1FVIA 4JI1L 3G6EA 1N34Q 2ZJQA 4DNIA 3VDYA 4B3SL 4R1JA 2UXDL 3PUWA 2F4VQ 3CPFA 3I4NH 5AJ3Q 4UP7A 4JI8L 3PV0A 4LF4Q 4LF5L 4QQBX 2NN6I 3M7NA 5JEAG 2K5NA 2F4VL 1YBYA 5AJ3L 1A63A 4LF4L 3J7ZC 1HNWQ 1CSPA 4AIMA 1W3SA 3G71A 1YJWA 4X66L 3RNUA 3T1HL 5M3MH 2K50A 4BXXG 2RCNA 4NXMQ 2HQLA 1KQSA 3OTOQ 4JBKA 1HNWL 3K81C 3TRZA 3CC4A 2Y0SE 3PF4A 1ASZA 2Z6KA 2JA7G 1TWFH 3CCJA 2F52A 3OTOL 5FJ8H 1VQKA 4BY7G 1C9OA 3EBEA 2WP8J 4LF7Q 2CKZB 3NENA 4R4CA 3CC7A 4OWTB 3ULPA 1QZHA 1PH4A 1OXTA 1FJGQ 4A75A 5GROA 3S1NH 4BBRG 2VUMH 3CW2C 3K8AA 3HOXG 5LMNQ 1N32Q 4DV2Q 1L1OB 1VQJA 2WB1G 2KHJA 4A3LH 2LSSA 1VQFA 4LUVA 1N36Q 1FJGL 1PA6A 1YJ9A 1HH2P 4DK3C 3CC2A 3STBD 5LMNL 1EQRA 2Y0SG 5GAEC 2Q2UA 3FP9A 5IY0A 4A3JH 1X65A 3CCVA 2E5LQ 5C4XH 2MNAA 3PIPA 5C44H 4IFDJ 2JA5G 1UWVA 1Y1VH 5EAYA 4JI2L 1SE8A 3K7UC 1LYLA 1HZ9A 2ZTEA 5HGQA 5IYDG 4KLKA 1X3FA 4C3IH 1VQMA 2UUBQ 5C4JH 4NB3A 4GLVB 2A1AA 1MIUA 2B29A 1JB7A 3KJOA 2GN5A 3G48A 4IJLA 3H3VI 3I4MG 4LUOA 4QIWE 4A4IA 3KDFB 2UUBL 3H3VH 5IYCG 3GTKH 1VQ8A 4DR1Q 4FDBA 3KDFA 3ULLA 4MTNA 2ALYB 1IBKQ 4X65Q 2MO1A 1VQOA 1W2BA 1C0AA 2AWOA 1J5EL 1PH9A 2Q2IA 3MXNB 1KAWA 4DR1L 1EFWA 1JJGA 1IBKL 2VY3A 4K0KQ 4JOIA 2JA6H 1WCMG 1KXLA 1E24A 1TWHH 2RHQB 1S72A 1K8AC 4BY7H 1J6QA 1G51A 4O2DA 3HOWH 4K0KL 1PH6A 4Y52H 3HOXH 3JAMc 3M3YH 2I5LX 4C2MH 1GVPA 1GO3E 3RLNA 3UDFA 4C3HH 4NPSA 4LUZA 3G4SA 2XGTA 2A19A 1EYGA 1HNXQ 3NBHB 3HOUH 1VQ4A 1QUQB 1K73C 1D7QA 1CKMA 1QUQA 3ZJYC 3F2BA 4A76A 3U58A 1EQQA 1NE3A 2YV5A 2I5HA 1X9NA 2GVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8T A;  1VQB A;  2MQH A;  3K7A H;  2GVB A;  2EXD A;  3KFU A;  4JBM A;  2YYZ A;  4IPC A;  4LFC Q;  2JEB I;  2NVT H;  1Q82 C;  1L2F A;  4HIO A;  4LF6 Q;  3I4M H;  5M3M G;  4LF9 Q;  4HJ8 A;  1VQ9 A;  1QZG A;  4R4Q A;  5C0X J;  4LFB Q;  4LFC L;  1P8L A;  1VQC A;  2JJQ A;  2DGY A;  5IWA Q;  2CQO A;  4LF6 L;  1L0W A;  4JYA Q;  4LF9 L;  1R9T H;  1C7Y A;  1SRU A;  1A0I A;  4DV0 Q;  2OWO A;  2BH2 A;  4MNO A;  5GAD C;  4JCV E;  1HR0 L;  1TWG H;  3HOZ G;  4B3R Q;  4LFB L;  4JBW A;  4YWL A;  1KRT A;  1WCM H;  2AWN A;  3M9B A;  2VL6 A;  4DV0 L;  2CWP A;  1PH5 A;  1OXX K;  1Z47 A;  2VUM G;  1JE5 A;  1CKO A;  3B6Y A;  3E9H A;  4DUZ Q;  4QL5 A;  4POF A;  1RL2 A;  1KC8 C;  1PFS A;  4OXP A;  2R93 G;  1E22 A;  3ERS X;  3M4P A;  2UXD Q;  3I2Z A;  3TRE A;  3L7Z C;  3PIO A;  4LWC A;  1Q8K A;  1X3E A;  2RF4 A;  1FL0 A;  3E0E A;  4JI8 Q;  4PG3 A;  4LF5 Q;  4DR4 L;  3FHW A;  3CCQ A;  1SR3 A;  3PUZ A;  2HIX A;  2BH8 A;  4UP8 A;  4A3C H;  1KD1 C;  2YU9 H;  2R92 G;  4OO1 G;  3J81 i;  4JI4 Q;  2N3S A;  2KEN A;  4X66 Q;  4P73 A;  3T1H Q;  1IBL Q;  1PV4 A;  4JI4 L;  2N78 A;  3M85 A;  2I0Q A;  3HOY H;  4YY3 Q;  1XTD A;  4OWX B;  2E2H H;  1IBL L;  4HID A;  3AYH B;  1TWC H;  1VQP A;  2XTI A;  2UXB Q;  1B8A A;  1X56 A;  4DR2 Q;  2EIF A;  4YY3 L;  2JA6 G;  1SLJ A;  2PNH A;  2JK8 A;  5C0X G;  2OQK A;  3HOZ H;  1BKB A;  2MFI A;  4GOP C;  1I50 H;  4UP9 A;  2UXB L;  4DR2 L;  3HOW G;  4IPG A;  1YNX A;  1X54 A;  4DV5 L;  3CAM A;  3PUY A;  1Q12 A;  3S17 H;  5ELO A;  2ZTD A;  3Q8D A;  4YCU A;  2B3G A;  3PGZ A;  2VW9 A;  4DR3 Q;  3CF5 A;  1NJI C;  4X62 Q;  2PI2 E;  4A3M G;  2K5V A;  2K14 A;  3KYH C;  3KOJ A;  4GN5 A;  3HKS A;  1M90 C;  1N33 Q;  2R93 H;  1HJP A;  3TS0 A;  4JI2 Q;  2VQF L;  4JC0 A;  4DR3 L;  2AKW B;  2RHS B;  3D0F A;  4X62 L;  2IY5 B;  2V1C C;  3S1M H;  3HOU G;  1YI2 A;  4R4T A;  1EIF A;  1KHI A;  1Q1B A;  1N33 L;  3ER0 A;  1HZC A;  4HJ7 A;  4AYB E;  4YWM A;  4OO1 I;  1PHJ A;  3A5Z B;  1OXU A;  4QY7 A;  4JI5 L;  2R92 H;  2N8N A;  2VQE Q;  2D62 A;  1VQG A;  2ES2 A;  2UUC Q;  1VQ6 A;  3TEH B;  2VS1 A;  4A3F G;  4WJ4 A;  5JJI A;  4ME3 A;  2D0P A;  1Q46 A;  3PCO B;  4IO9 A;  3RN2 A;  1J5E Q;  2VQE L;  3AQQ A;  4O0A A;  4HIM A;  4JG2 A;  2UUC L;  4GLX A;  4DR7 L;  4DAY B;  2OTL A;  1NBW A;  3KF8 B;  1UE6 A;  1E3P A;  5M5Y H;  4JI3 Q;  4AYB G;  4DV4 Q;  3RN5 A;  1EUJ A;  1LUZ A;  5C0X I;  5K36 G;  3L0O A;  3GTL H;  1WYD A;  4JI3 L;  1JJ2 A;  1NY4 A;  4DV4 L;  1GKH A;  5IE8 A;  2CCZ A;  3GTG H;  4HJ5 A;  1QVG A;  2R7D A;  5IP9 G;  2L15 A;  2YTV A;  5J3B A;  4GNX C;  1QVF A;  4X64 L;  1L1O C;  4A3M H;  1JJC B;  5ELN A;  3J7A 5;  3KF6 B;  4X6A H;  2K75 A;  2HT1 A;  3KF6 A;  1TWA H;  4A3G G;  1BBU A;  1PH2 A;  3AEV A;  4A3C G;  4RG1 A;  4LF8 L;  3CP0 A;  4JI0 L;  3BZC A;  4A3I H;  4A3K H;  1P16 A;  4IFD G;  3IRB A;  4H02 A;  4J15 A;  3CPW A;  3NEL A;  3WWV A;  1YIJ A;  3GD7 A;  5M5X H;  3S16 H;  1NTG A;  4LW1 A;  2K52 A;  2ZJP A;  4DR5 L;  3HOY G;  2YTX A;  4A3F H;  1G29 1;  2QA4 A;  5IYD H;  1V9P A;  3HKZ E;  4GKK L;  1HNZ Q;  1IXR A;  1HR0 Q;  2LXJ A;  4DK6 C;  1VQA A;  1VQN A;  2AHO B;  1X6O A;  1XNR Q;  5JEA J;  1HNZ L;  2IHF A;  2KCM A;  2UXC L;  4BY1 G;  4B3M Q;  2WAQ E;  1UE5 A;  4BA1 I;  3CXC A;  2JA8 H;  3I55 A;  4TQU S;  3A5U A;  4DV3 Q;  1XNR L;  1Y1W G;  4GN3 B;  1CUK A;  4LFA Q;  3CCL A;  4B3M L;  4AQY L;  3S1R H;  4AH6 A;  4A93 H;  3PSI A;  1VQL A;  5IP9 H;  3FKI H;  4DV3 L;  3HKZ G;  1AH9 A;  4LFA L;  2ID0 A;  4DR4 Q;  3TQY A;  4OWW B;  1HZA A;  4IOC A;  5GQO A;  5HY6 A;  4TVA B;  3U4Z A;  1JT8 A;  1OTC A;  3GTJ H;  4ALP A;  2WAQ G;  4YWK A;  3PUX A;  1D8L A;  2K5H A;  2WFW A;  4JV5 L;  3CCE A;  4A3G H;  1XPR A;  4DPG A;  1CSQ A;  4P74 A;  4JI6 Q;  5BR8 L;  1U5K A;  5FLX c;  4IFD I;  3GTQ H;  2R6G A;  1YHB A;  1YJN A;  1VQI A;  4GLA C;  5IYB H;  5C3E H;  3D31 A;  5IT9 c;  4DR6 Q;  4JI6 L;  1QVC A;  3K0X A;  5LMU L;  1T9H A;  4OON A;  1AE2 A;  5M3F G;  1UE7 A;  1PH3 A;  4L5R C;  4DR6 L;  3AFP A;  4JI7 L;  2C35 B;  1LTL A;  4QGU A;  3PF5 A;  3RLO A;  2MO0 A;  1Q7Y C;  1OXS C;  4A3E G;  1XMO L;  4XTC S;  3CME A;  1RIP A;  4YHH Q;  4DV5 Q;  4IOA A;  1VQE A;  2CWA A;  5IP7 H;  4EX5 A;  3PO3 H;  3I4O A;  4P71 A;  4BY1 H;  3GTM H;  3DLL A;  3I56 A;  1N34 L;  1IYJ B;  1V43 A;  3U4V A;  4YHH L;  2NVY H;  4JBJ A;  1GD7 A;  3PO2 H;  1Y1W H;  4YCW A;  3JAM i;  2ZTC A;  2HHH Q;  2VQF Q;  1JMC A;  4PMW A;  2PMZ E;  3HOV H;  2H5X A;  3UDG A;  1KRS A;  4PZ7 A;  1PH8 A;  1A62 A;  2WB1 E;  2NVQ H;  3PUV A;  3U50 C;  5DLQ E;  2R7Z G;  1IZ6 A;  3AFQ A;  2HHH L;  2Z0S A;  4A3D H;  2A8V A;  2KHI A;  5H1S E;  1PH1 A;  1DGS A;  1X55 A;  4P72 A;  3I7F A;  1YZ6 A;  4JI5 Q;  4DV6 Q;  2ATW A;  5FLM H;  4NXM L;  4DV1 Q;  1Y14 B;  4A3I G;  3K80 C;  3UDI A;  4A3K G;  4LNQ A;  3ICE A;  1SN8 A;  2OCE A;  4XIG S;  1Q86 C;  4DV6 L;  2HIV A;  1K0R A;  4DV1 L;  1K9M C;  2ASB A;  4BBS G;  4GNX B;  1YHQ A;  4DV7 Q;  4LF7 L;  3RZO H;  3F2C A;  4OX9 Q;  3H0G G;  4DR7 Q;  4GNX A;  1NMG A;  5LMN W;  4P75 A;  4IPD A;  3KJP A;  1VS0 A;  1L1O A;  2BA1 A;  4DKA C;  4DV7 L;  1E1T A;  4A3B G;  1N32 L;  2EQS A;  3M4Q A;  1B70 B;  4DV2 L;  5E7N A;  4OX9 L;  5JJK A;  5M3F H;  3W1B A;  3RZD H;  1VQH A;  3J80 i;  1VQD A;  2I5M X;  1N36 L;  2VNU D;  3M4O H;  1EIY B;  4HJA A;  4A3E H;  2Z6K C;  3ULJ A;  1WOC A;  1YIT A;  1IBM Q;  2JA8 G;  3A0J A;  3UE0 A;  2JEA I;  3EIV A;  1SMX A;  1K3R A;  2E5L L;  3TS2 A;  2B63 G;  4X64 Q;  2IT1 A;  1IBM L;  4A93 G;  4BA2 I;  1I6H H;  1O7I A;  4KI0 A;  2BA0 A;  1WFQ A;  3DM3 A;  3J81 c;  3OW2 A;  1I3Q H;  1KL9 A;  1MJC A;  3FKI G;  1NMF A;  3J81 j;  1Q81 C;  2E2I H;  4UY8 C;  2PQA B;  2NVX H;  1LM0 A;  4KHP Q;  3CCU A;  3A74 A;  2QEX A;  1Z9F A;  2PQA A;  2VZA A;  2NZO A;  2AMC B;  1S3O A;  2FXQ A;  1E7Z A;  3GTO H;  4BXX H;  1E1O A;  1K83 H;  4LF8 Q;  2R7Z H;  4KHP L;  3E9I A;  3HFZ B;  4JI0 Q;  3S2D H;  4PZ6 A;  4YCV A;  1TXY A;  2UUA Q;  4NXN Q;  3CD6 A;  1S40 A;  4X65 L;  2YTY A;  4EQ5 A;  2JA7 H;  2R7F A;  4R4I A;  2JE6 I;  2Q2T A;  4L5Q A;  4NXN L;  3RLF A;  4DR5 Q;  2UUA L;  1XNQ Q;  3CCS A;  2E2J H;  4Y7N H;  2IX0 A;  4MZ9 A;  4PZ8 A;  5IYB G;  1N8R C;  1H95 A;  5C3E G;  3W1G A;  4APV A;  5JJL A;  2IHE A;  1FGU A;  3OYY A;  3L2P A;  1YEZ A;  3RR5 A;  3S24 A;  4BBR H;  4B3T Q;  4BBS H;  4GKK Q;  3F2D A;  4RMF A;  1XNQ L;  2QGQ A;  3H0G H;  4L5T A;  3UDX A;  3S14 H;  3GTP H;  5M5W H;  2IX1 A;  1YHA A;  1GM5 A;  3NEM A;  3KLW A;  4GS3 A;  1VQ7 A;  4B3T L;  1AE3 A;  4L5S A;  4A3B H;  2UXC Q;  2D0O A;  1WJJ A;  2OTJ A;  1EWI A;  3STB C;  5IP7 G;  1K8G A;  1I94 Q;  1XJV A;  1M1K C;  3PO3 G;  3I4N G;  1PYS B;  1A8V A;  2JA5 H;  4JOI C;  3GDE A;  1Q1E A;  2DUD A;  3F1Z A;  1PYB A;  4AQY Q;  1XMQ Q;  1SFO H;  2F3I A;  2ZJR A;  1MJE A;  1HNX L;  2Q2H A;  1I94 L;  2NN6 G;  3PO2 G;  3H15 A;  4HJ9 A;  2B63 H;  3EN2 A;  1XMQ L;  3HOV G;  2JA9 A;  4KHZ A;  2KBN A;  1WI5 A;  2ZM6 Q;  1OXV A;  4POG A;  3CQZ H;  4A3D G;  1X3G A;  5IYC H;  1PVO A;  1N9W A;  3UE1 A;  2ZM6 L;  3S2H H;  3BU2 A;  2E8G A;  5GAG C;  1HR0 W;  1BBW A;  5FLM G;  1ASY A;  3JC6 6;  5GAH C;  3T1Y Q;  2PI2 A;  4GOP B;  5BR8 Q;  5FJ8 G;  3J80 c;  3CCM A;  2CFM A;  3LGJ A;  3GO5 A;  3MEF A;  4R4O A;  4QJF A;  3CMA A;  1UEB A;  5IWA L;  4GOP A;  1VQ5 A;  1B7Y B;  1CKN B;  1HZB A;  1KIX A;  4JYA L;  4IJH A;  1XPU A;  1G6P A;  3T1Y L;  1EOV A;  3W5O A;  1CKN A;  1XPO A;  1SRO A;  4DUY Q;  4JV5 Q;  2LXK A;  5LMU Q;  4B3R L;  4WJ3 M;  1U0L A;  4C3J H;  4DAM A;  3BZK A;  1V1Q A;  3CCR A;  3S15 H;  4A3L G;  2UU9 Q;  4JI7 Q;  1UE1 A;  4HIK A;  1I5F A;  1MKH A;  2NZH A;  1YVC A;  4DUY L;  2N49 A;  3BJU A;  4IPH A;  4JI1 Q;  1IL2 A;  3S1Q H;  2OQ0 A;  1XMO Q;  2K4K A;  4GKJ Q;  1VCI A;  4GN4 B;  4B3S Q;  2UU9 L;  4UPA A;  4A3J G;  2JQO A;  4DUZ L;  5C4X G;  3SGI A;  2KCT A;  5C44 G;  1BVS A;  1PH7 A;  4GKJ L;  1Y1V G;  1FVI A;  4JI1 L;  3G6E A;  1N34 Q;  2ZJQ A;  4DNI A;  3VDY A;  4B3S L;  4R1J A;  2UXD L;  3PUW A;  2F4V Q;  3CPF A;  3I4N H;  5AJ3 Q;  4UP7 A;  4JI8 L;  3PV0 A;  4LF4 Q;  4LF5 L;  4QQB X;  2NN6 I;  3M7N A;  5JEA G;  2K5N A;  2F4V L;  1YBY A;  5AJ3 L;  1A63 A;  4LF4 L;  3J7Z C;  1HNW Q;  1CSP A;  4AIM A;  1W3S A;  3G71 A;  1YJW A;  4X66 L;  3RNU A;  3T1H L;  5M3M H;  2K50 A;  4BXX G;  2RCN A;  4NXM Q;  2HQL A;  1KQS A;  3OTO Q;  4JBK A;  1HNW L;  3K81 C;  3TRZ A;  3CC4 A;  2Y0S E;  3PF4 A;  1ASZ A;  2Z6K A;  2JA7 G;  1TWF H;  3CCJ A;  2F52 A;  3OTO L;  5FJ8 H;  1VQK A;  4BY7 G;  1C9O A;  3EBE A;  2WP8 J;  4LF7 Q;  2CKZ B;  3NEN A;  4R4C A;  3CC7 A;  4OWT B;  3ULP A;  1QZH A;  1PH4 A;  1OXT A;  1FJG Q;  4A75 A;  5GRO A;  3S1N H;  4BBR G;  2VUM H;  3CW2 C;  3K8A A;  3HOX G;  5LMN Q;  1N32 Q;  4DV2 Q;  1L1O B;  1VQJ A;  2WB1 G;  2KHJ A;  4A3L H;  2LSS A;  1VQF A;  4LUV A;  1N36 Q;  1FJG L;  1PA6 A;  1YJ9 A;  1HH2 P;  4DK3 C;  3CC2 A;  3STB D;  5LMN L;  1EQR A;  2Y0S G;  5GAE C;  2Q2U A;  3FP9 A;  5IY0 A;  4A3J H;  1X65 A;  3CCV A;  2E5L Q;  5C4X H;  2MNA A;  3PIP A;  5C44 H;  4IFD J;  2JA5 G;  1UWV A;  1Y1V H;  5EAY A;  4JI2 L;  1SE8 A;  3K7U C;  1LYL A;  1HZ9 A;  2ZTE A;  5HGQ A;  5IYD G;  4KLK A;  1X3F A;  4C3I H;  1VQM A;  2UUB Q;  5C4J H;  4NB3 A;  4GLV B;  2A1A A;  1MIU A;  2B29 A;  1JB7 A;  3KJO A;  2GN5 A;  3G48 A;  4IJL A;  3H3V I;  3I4M G;  4LUO A;  4QIW E;  4A4I A;  3KDF B;  2UUB L;  3H3V H;  5IYC G;  3GTK H;  1VQ8 A;  4DR1 Q;  4FDB A;  3KDF A;  3ULL A;  4MTN A;  2ALY B;  1IBK Q;  4X65 Q;  2MO1 A;  1VQO A;  1W2B A;  1C0A A;  2AWO A;  1J5E L;  1PH9 A;  2Q2I A;  3MXN B;  1KAW A;  4DR1 L;  1EFW A;  1JJG A;  1IBK L;  2VY3 A;  4K0K Q;  4JOI A;  2JA6 H;  1WCM G;  1KXL A;  1E24 A;  1TWH H;  2RHQ B;  1S72 A;  1K8A C;  4BY7 H;  1J6Q A;  1G51 A;  4O2D A;  3HOW H;  4K0K L;  1PH6 A;  4Y52 H;  3HOX H;  3JAM c;  3M3Y H;  2I5L X;  4C2M H;  1GVP A;  1GO3 E;  3RLN A;  3UDF A;  4C3H H;  4NPS A;  4LUZ A;  3G4S A;  2XGT A;  2A19 A;  1EYG A;  1HNX Q;  3NBH B;  3HOU H;  1VQ4 A;  1QUQ B;  1K73 C;  1D7Q A;  1CKM A;  1QUQ A;  3ZJY C;  3F2B A;  4A76 A;  3U58 A;  1EQQ A;  1NE3 A;  2YV5 A;  2I5H A;  1X9N A;  2GVA A; 
#chains in the Genus database with same CATH topology
 5LOV F;  2GVB A;  1SYE A;  2G5D A;  1YNJ D;  4LFC Q;  2NVT H;  1WD0 A;  2FPP B;  1GJX A;  5E3F A;  3MFH A;  4LF9 Q;  3CRL C;  4DF7 A;  3SK6 A;  1QZG A;  4IAL A;  1A15 A;  2TMP A;  3QOJ A;  5M5X B;  4LFB Q;  4JV0 A;  1TQO A;  2YS6 A;  2AQ1 B;  3RTX A;  5IWA Q;  2XGQ A;  4LF6 L;  2XWB B;  3H0G B;  4HCE A;  1SRU A;  1STN A;  2WB1 B;  5T1I A;  4DV0 Q;  3S14 B;  5M5W B;  5HBR B;  4ECR A;  1GOZ A;  3WDN A;  2AWN A;  4DNR B;  1GSA A;  3M9B A;  4XT1 B;  4RB1 A;  4EFB A;  3MHB A;  1JE5 A;  2EYP A;  2PZT A;  3B6Y A;  2N88 A;  4N9P A;  5ELC A;  5HUR A;  1HTL D;  5LA6 F;  4H7B A;  2UXC H;  1EY4 A;  2R93 G;  2B2W A;  1TVX A;  2O2L D;  3L3O C;  2UXD Q;  3I2Z A;  1ILP A;  3L7Z C;  4A93 B;  2C22 A;  3F8N A;  1Q8K A;  1X3E A;  2RF4 A;  5EQ0 A;  1JX4 A;  2B63 A;  1FL0 A;  2YW2 A;  4JI8 Q;  4Z9C B;  3T53 B;  4LF5 Q;  4DR4 L;  1C48 A;  4ECT A;  1EU4 A;  3CCQ A;  2O5I C;  4A3C H;  2YU9 H;  4OO1 G;  4IUN A;  4JI4 Q;  2ZM6 H;  3J7A K;  4EEY A;  4C5B A;  2DIK A;  2KEN A;  1HUM A;  3T1H Q;  5IGD A;  2YZG A;  2KEE A;  1EY6 A;  2HDL A;  1U9R A;  1B3Q A;  2Z1C A;  3VPC A;  1CZW A;  5CV7 A;  5C5M A;  3GTQ B;  2E2H H;  4UCV A;  1IBL L;  4LAA A;  3OWF A;  3RUZ A;  4QWB A;  2UVW A;  5D65 A;  1VQP A;  4B3R H;  2UXB Q;  2F3V A;  4DR2 Q;  1DYQ A;  4ABN A;  2F0D A;  4J0M A;  2MFI A;  3K6O A;  4O3Q A;  1UC9 A;  1HQM C;  1PYW D;  3HOW G;  3MR3 A;  1X54 A;  4DV5 L;  1Q12 A;  4QWA A;  3SR1 A;  4RAU C;  4DUZ H;  2WIN B;  1GUO A;  3MZ5 A;  4JI1 H;  4R8I A;  4ME6 A;  1NJI C;  4X62 Q;  2M2L A;  2PI2 E;  3R5H A;  1LT3 D;  2OLS A;  1UUP A;  1NNX A;  3HKS A;  2R93 H;  1A3T A;  2WYO A;  4FM9 A;  4DR3 L;  1Z2P X;  2IY5 B;  3S1M H;  3HOU G;  1O78 A;  4F4Z A;  5BN4 A;  3V4S A;  4NLG A;  2B8F A;  2QW7 A;  3ETJ A;  4CJ2 C;  1PZJ D;  4QCL A;  2HDM A;  4OO1 H;  2VQE Q;  1VQG A;  2E2D C;  3PW7 A;  1QNK A;  1TWF B;  3A55 A;  2HD3 A;  4RCN A;  5EPL A;  3TEH B;  1VQ6 A;  1EYA A;  1QIL A;  2KOL A;  1Q46 A;  2J9G A;  1J5E Q;  3AQQ A;  3BZD B;  2FK3 A;  3TIG A;  3OTO H;  3GQB A;  4DR7 L;  1IOW A;  3KF8 B;  1UE6 A;  5M5Y H;  4JI3 Q;  4TKO B;  2VUM A;  2RQX A;  4YAJ B;  3DWP A;  3E5S A;  3VR5 A;  5DQG A;  5LMN H;  1KDA A;  2RGV A;  2PYK A;  1M7J A;  1QVG A;  2R7D A;  4EEQ A;  1QVF A;  1C30 A;  4JI2 H;  5LYJ F;  1L1O C;  1B53 A;  1PFN A;  2RCF A;  3MWD A;  2HVQ A;  2HCC A;  3J7A 5;  4K5V A;  4HYK A;  3KF6 B;  3TP8 A;  1GGO A;  4ECY A;  2NUC A;  3RD4 A;  1TWA H;  5KFN A;  2X6G A;  2AQ2 B;  4S3S A;  4Q8E A;  1PTO C;  1TU2 B;  3A8J E;  4A3I H;  3KXY T;  2PBZ A;  4A3K H;  3S2D B;  2EJG C;  1HFN A;  4UCU A;  5DG8 A;  2CW8 A;  2K52 A;  1I4P A;  2ZJP A;  3HOY G;  2W7O A;  1IBK H;  5KFF A;  2JA6 A;  5BN5 A;  3RAX A;  3TII A;  1TWH A;  5KFO A;  1IL8 A;  1B44 D;  2A6E D;  2R84 A;  1HNZ Q;  1HR0 Q;  1O7L A;  2ZT9 C;  1CI3 M;  1VQA A;  3BYT B;  4BBR B;  1PRT C;  2Z8L A;  1SYD A;  4IRK A;  1X6O A;  1XNR Q;  1B6R A;  1BXT A;  1SBB B;  2KCM A;  2Q8R E;  4BA1 I;  1UE5 A;  3I55 A;  3C1F A;  3A5U A;  3JSL A;  3PZP A;  2Y0S A;  1GUT A;  4LFA Q;  3S1R H;  2YRW A;  1EY7 A;  3KHH A;  4JW0 A;  4MTK A;  4DV3 L;  2IP4 A;  1HRJ A;  2Q8I B;  2W9C A;  1KTK A;  2ID0 A;  1E2Z A;  1VF5 C;  1HZA A;  1BDO A;  4IOC A;  5GQO A;  1SYG A;  3V4Z A;  4ED3 A;  2KUM A;  3I4M B;  5BN3 A;  3TSS A;  1PTO F;  5KFX A;  2XSC A;  2DWC A;  5L1L A;  1EY5 A;  5EOY A;  5BR8 L;  1R9T B;  4IFD I;  2QK4 A;  2VUG A;  2ICI A;  1SCU B;  1JLL B;  5TSS A;  4LF6 H;  1K3B C;  5C3E H;  1WCM B;  1QVC A;  2QIL A;  4WD3 A;  3KHR A;  2C00 A;  3JRW A;  2F0N A;  1PRT F;  4OON A;  4C3J B;  3IKJ A;  4MV4 A;  4QMG A;  3PF5 A;  2MO0 A;  3OIQ A;  1Q7Y C;  2FMC A;  4A3E G;  2F0S A;  2K05 A;  1XMO L;  4QIW A;  1RIP A;  4H13 C;  1KJ8 A;  1F2Y A;  2EYO A;  3I56 A;  1N34 L;  1LTA D;  1V43 A;  1OO9 B;  4JV1 A;  4DR4 H;  2VQF Q;  3ND9 A;  3TZU A;  3HOV H;  1V1P A;  3UDG A;  2R8G A;  1CTM A;  4DK1 A;  2YU9 A;  2WB1 E;  1ZXT A;  3PUV A;  3RAQ A;  4A3D H;  1IZ6 A;  3AFQ A;  2HHH L;  2J6S A;  3V6H A;  2KHI A;  5I2X A;  1PH1 A;  3IFT A;  3BG5 A;  3T51 B;  4DV6 Q;  2ATW A;  5FLM H;  1XYI A;  1CZG A;  2E2H A;  1WTW A;  2I8C A;  1IBL H;  2J6T A;  1AZQ A;  3DXJ C;  1XTC D;  1VDZ A;  2F0J A;  4GNX B;  3DEO A;  5LHY 1;  3H0G G;  1I50 B;  2ALZ A;  2DN8 A;  4O3P A;  2XCP A;  2BA1 A;  1PRT D;  4DV7 L;  3I91 A;  1N32 L;  1S0N A;  1CFM A;  4OX9 L;  4DV2 L;  4ED1 A;  3QR8 A;  4DV5 H;  1WVL A;  1N36 L;  1VQD A;  2I5M X;  4MA5 A;  3M4O H;  3J80 E;  4A3E H;  1IBM Q;  2CW0 C;  3UE0 A;  3R5F A;  1CT1 D;  2R93 A;  1MD2 D;  4X64 Q;  2IT1 A;  4DR3 H;  4A93 G;  2BQ3 A;  3BQ1 A;  4KI0 A;  1WFQ A;  1KL9 A;  4UY8 C;  4K2K A;  5BPH A;  2WAQ A;  4KHP Q;  2R3Z A;  4EG0 A;  2R92 B;  2FE3 A;  5C4J B;  1H9K A;  4PV1 C;  4J9N A;  2FXQ A;  4LMQ D;  3E9I A;  3HFZ B;  5JVG 3;  1PXU A;  4JI0 Q;  4PZ6 A;  2WAC A;  4ZRZ A;  3X3M A;  2UUA Q;  5CV6 A;  1S40 A;  3CHB D;  4X65 L;  5IOC A;  4ZUI A;  4R4I A;  1ZYR C;  1JOK A;  5KT7 A;  3DUZ A;  5KT2 A;  4DR7 H;  1N8R C;  1Z6H A;  2JA6 B;  2IHE A;  4GKK Q;  4B3T Q;  5DGB A;  3OWE B;  4QW8 A;  3IG0 A;  2QGQ A;  3H0G H;  4L5T A;  5KFP A;  4ZYS A;  3G6V A;  3S14 H;  5M5W H;  4J9O A;  3NEM A;  4GS3 A;  4L5S A;  1RF2 D;  3D4W A;  4DL7 A;  1XDN A;  1WJJ A;  2R6F A;  1EWI A;  1EOT A;  2L5T A;  3FMA A;  3H4D A;  2F4I A;  1I94 Q;  1AZP A;  2R8J A;  4A3M B;  1A8V A;  2JA5 H;  5A2Q W;  4ED2 A;  2I46 A;  1Q1E A;  2RSO A;  1PYB A;  1O7Z A;  1HNX L;  5KFW A;  1RK6 A;  5DG9 A;  4HJ9 A;  3NTI A;  3GIL A;  1XMQ L;  4EBE A;  2FLL A;  3RB4 A;  1TWA A;  5EBC A;  5I6W A;  3GIM A;  1BNZ A;  3QO2 A;  3MR2 A;  1XWE A;  3K58 A;  2ZDH A;  3MFY A;  5FLX L;  1X3G A;  3M9O B;  1S5C D;  1EIH A;  3BU2 A;  3KLR A;  4RU9 A;  5GAG C;  4FF2 A;  5IT9 L;  1BBW A;  1DJR D;  5GAH C;  2PI2 A;  4WBN F;  3J80 c;  3CCM A;  1VQ5 A;  4CBV A;  4DGZ A;  1UEB A;  5IWA L;  4GOP A;  1O80 A;  1SNP A;  5KYL A;  1CKN A;  4L63 B;  1RTN A;  4N8F A;  4WJ3 M;  5LMU Q;  1PZI D;  4DAM A;  2JN4 A;  2VB2 X;  4A3L G;  1VMP A;  5IGG A;  1S0O A;  2NZH A;  4JV5 L;  4DUY L;  2B2Y A;  3V6J A;  4GKJ Q;  1FNW A;  1AN8 A;  4GN4 B;  3PQI A;  2UU9 L;  2JQO A;  1G2T A;  2CW0 D;  3SGI A;  2KCT A;  1BVS A;  2W6N A;  1ENC A;  1LTR D;  1KLG D;  2ZJQ A;  1H9M A;  2UXD L;  1DV2 A;  4DV3 H;  3CPF A;  2YZN A;  4UCS A;  2C2D A;  1YNN C;  2KA7 A;  2R8H A;  4UP7 A;  2F0M A;  4JI8 L;  4LF5 L;  2NN6 I;  4FP5 D;  2KCN A;  3MXG A;  2K5N A;  5JPM C;  1V1P B;  4A3G B;  4IRD A;  4LF4 L;  3J7Z C;  5KGU A;  1LLR D;  1HNW Q;  1Z2O X;  1W3S A;  3P20 A;  1JIC A;  3T1H L;  2XGP A;  1W6J A;  5M3M H;  5CBE E;  4BXX G;  1HA6 A;  1DOL A;  1KQS A;  5BR8 H;  3K81 C;  3ZYY X;  1ZYR D;  2K32 A;  1ASZ A;  2Z6K A;  4F8M A;  1TWF H;  3RF2 A;  2F52 A;  4FXG C;  4X3S A;  1C9O A;  4LF7 Q;  2RSN A;  4XQQ A;  4R4C A;  2C2R A;  5KFG A;  3W2D A;  3T5H A;  3VMM A;  3ULP A;  4FNF A;  2HVS A;  1GUN A;  3I73 A;  1C4Q A;  4BBR G;  3CW2 C;  3K8A A;  2FMA A;  1XMO H;  3I8Z A;  4BY1 B;  2KHJ A;  4A3L H;  1VQF A;  4LUV A;  4EVO A;  3NQT A;  4HTH A;  2XVS A;  2ZXO A;  1YJ9 A;  3PO2 B;  1K1Q A;  1KJI A;  3E6Z X;  3J81 L;  4PMC A;  2UVU A;  5ELD A;  3FP9 A;  3CU7 A;  1X65 A;  1ULZ A;  3PIP A;  4QWC A;  1E4G T;  4PNY A;  3TQ1 A;  3EPG A;  1LYL A;  1HZ9 A;  3Q8R B;  4HSV A;  1KNA A;  4KLK A;  3HB9 A;  4KJN A;  2W9A A;  2AQ3 B;  3T5J A;  2HHH H;  1MBY A;  5KEE A;  3GV7 B;  2XIG A;  3PW0 A;  2A1A A;  1MIU A;  1JB7 A;  4F4X A;  2WAQ B;  3H3V I;  4YJ2 F;  3I4M G;  2Z9H A;  4IHJ F;  1PZK D;  5IYC G;  3GTK H;  2NZ1 D;  3KDF A;  4MTN A;  1G6Z A;  2KQ3 A;  2R7K A;  2GPS A;  4JI5 H;  5CA0 F;  1J5E L;  2F03 A;  4UAI A;  4XT3 B;  3IL8 A;  5C4Z A;  1RJT A;  4LMY A;  4DL2 A;  1JJG A;  4K0K Q;  3SK4 A;  1WCM G;  5EGT A;  2YZM A;  1E24 A;  3RUP A;  4ECW A;  1K8A C;  4DU9 A;  4DV7 H;  2PCF B;  1N32 H;  4OX9 H;  4C3J G;  2XRS D;  3QZ8 A;  4DV2 H;  1N36 H;  4Y52 H;  5IT9 E;  1EYZ A;  4OEL B;  3M3Y H;  3HP3 A;  1V4Y A;  5LP6 F;  4G7Z C;  2WKC A;  1GVP A;  1SE2 A;  1CA5 A;  2FPI B;  2L1B A;  4KKS A;  4NPS A;  1KC7 A;  2D5D A;  1LTS D;  1FNV A;  2CZG A;  1STH A;  4ETS A;  2A73 B;  2GA4 B;  1JDE A;  5CC4 A;  3C0F B;  1QUQ A;  4X3U A;  3ZJY C;  1K83 B;  1U4P A;  3IFD A;  3W1G A;  1EQQ A;  1RCV D;  2R7Z B;  1CQI B;  1X9N A;  1RDP D;  3OSN A;  2R8I A;  2R7L A;  5ISR A;  5I4D A;  5KT5 A;  3KFU A;  4JBM A;  2YYZ A;  4IPC A;  2JEB I;  2NWG A;  2G9D A;  4X65 H;  1L2F A;  1RHP A;  4HIO A;  4RNM A;  3I4M H;  2E2J B;  4HJ8 A;  1VQ9 A;  5KFA A;  2NTS A;  4R4Q A;  5C0X J;  2EXZ A;  1P8L A;  3LWE A;  4TSS A;  4R8U B;  3T5K A;  1SYB A;  1B1Z A;  2CQO A;  5DM6 3;  4JYA Q;  3MWY W;  1R9T H;  2OWO A;  1A0I A;  3GTP B;  4MNO A;  4C56 C;  5GAD C;  1HR0 L;  3H0G A;  2WB1 A;  4A3B B;  1WCM H;  4C1N K;  4O3R A;  2X6L A;  2FIN B;  4IUU A;  2CWP A;  4RAZ A;  4DL6 A;  2VUM G;  3BAA A;  3DF7 A;  1BUV T;  1CKO A;  5CV9 A;  2JA5 A;  4G7H C;  4K5X A;  1PFS A;  3SK5 A;  1E22 A;  3ERS X;  3M4P A;  4IUV A;  1HNX H;  3S1R B;  2LS0 1;  3PMF A;  4PG3 A;  4AQY H;  3KBX A;  1XMQ H;  2QEJ C;  2BH8 A;  1E0B A;  2BCO A;  4Q43 A;  2J0T D;  3M4Y A;  2W57 A;  1KD1 C;  2R92 G;  4RUC A;  5DQI A;  2QDB A;  3R93 A;  3J81 E;  4ODG A;  2BR0 A;  4X66 Q;  4P73 A;  3A8K E;  1D5X C;  2F0Q A;  3ORQ A;  5IGF A;  3MEH A;  2Q8T A;  2I0Q A;  4KKT A;  1EQT A;  4DNT B;  4YY3 Q;  4ZQI A;  5J2T F;  5IWA H;  5EDW A;  1PFM A;  4HID A;  1DON A;  3AYH B;  5C3E B;  2XTI A;  1B8A A;  1X56 A;  5CYU A;  2JA6 G;  3URY A;  5C0X G;  3PVX A;  4JV5 H;  4GOP C;  4DUY H;  1I50 H;  2XNA C;  5IGC A;  3K5M A;  2DZD A;  4CJ0 B;  1YNX A;  5D3I B;  2UU9 H;  2V9W A;  4K6D A;  2EE1 A;  5JVH 3;  5ELE A;  2ZTD A;  3C2P A;  1KJJ A;  3LNN A;  2B3G A;  3PGZ A;  5AFW A;  3NXW A;  2WE6 A;  2UXD H;  5DLF A;  2W6O A;  4A3M G;  4ECQ A;  2K14 A;  3KYH C;  3KOJ A;  1N33 Q;  4JI8 H;  2DPI A;  2VQF L;  3N40 P;  3D0F A;  5KFJ A;  2JYO A;  1IKM A;  2V1C C;  3BDO A;  5IGB A;  3RBE A;  4R4T A;  1EIF A;  3ER0 A;  4LF4 H;  1NAP A;  1HZC A;  4HJ7 A;  4A3D B;  2L9H A;  3I4L A;  5KFL A;  4MIU A;  4OO1 I;  1F77 A;  1PHJ A;  3T1H H;  2R92 H;  2NU9 B;  4WOR A;  2P5Z X;  3LWU A;  1D5M C;  2UUC Q;  3DM1 A;  2D0P A;  4ME3 A;  1TWF A;  4J9R A;  1SXT A;  2AGO A;  2O4X A;  4O0A A;  4RGM A;  2F0L A;  3KLS A;  4GLX A;  4K2L A;  1WTR A;  2OTL A;  1NBW A;  3S1N B;  1TAE A;  1UC8 A;  1E3P A;  3KF8 A;  5LL6 S;  3JAM L;  5L1I A;  4DV4 Q;  1LUZ A;  5C0X H;  4KD3 A;  3ITP A;  1WYD A;  4ZHQ F;  1NY4 A;  1DD2 A;  1Y1V B;  4HJ5 A;  2OF1 A;  2ASD A;  2YTV A;  4FXD A;  4X64 L;  4RB2 C;  5C1O A;  4C3I B;  2FB9 A;  4JPB W;  2F0H A;  4A3M H;  4PDB A;  1D1I A;  1JJC B;  5G3L F;  4A2A A;  1Q90 A;  4J9Q A;  4ME5 A;  1QCB D;  1RJP A;  1ESR A;  5C5L A;  5J1Z A;  5L37 A;  1B3A A;  3KF6 A;  4ZQ3 A;  2B39 A;  1LT6 D;  4A3G G;  4A3C G;  2X69 A;  3V96 A;  3CP0 A;  3GTK A;  4JI0 L;  1SJE D;  1U4M A;  3PR5 B;  4C5A A;  3H91 A;  1OWT A;  3EYY A;  3WWV A;  3TQT A;  1J5E H;  3GD7 A;  5H80 A;  2CH4 W;  1WTO A;  3VYT A;  1A2U A;  4Q8F A;  2R82 A;  1SEI A;  1PFB A;  1E4E B;  2M9V A;  4FF4 A;  4GKK L;  1UEA B;  4XYQ A;  2VPS A;  3HOX B;  3NHH A;  4C2M B;  1SE4 A;  5JEA J;  2JEF A;  2IHF A;  1STA A;  1Y8P B;  4BY1 G;  4B3M Q;  1M0T A;  2WAQ E;  2EYL A;  4TQU S;  2I87 A;  2PN1 A;  3MR6 A;  4XDX A;  2XCA A;  2IWH A;  4CDD C;  1CUK A;  2JA5 B;  1BCP C;  5DQH A;  1E2W A;  1R4P B;  5C6A A;  1AH9 A;  5G3L D;  1TS5 A;  1E2V A;  3K7A B;  5HY6 A;  4TVA B;  2AUK A;  1JT8 A;  2XWJ B;  1GXD C;  4KV6 A;  3GTJ H;  2WAQ G;  5CMD A;  4YWK A;  4Y8V B;  3PUX A;  5KFU A;  3OSO A;  4A3G H;  3DWA A;  4DPG A;  1CSQ A;  4P74 A;  4JI6 Q;  1U5K A;  2FLP A;  5CR3 A;  4FS1 A;  2R6G A;  2NU6 B;  4GLA C;  3M4I A;  1R9T A;  1EY0 A;  3L4J A;  3D31 A;  3NP8 A;  4AYB A;  2OT2 A;  4WRD A;  1HR0 H;  5LMU L;  1WCM A;  1I6U A;  3QG1 A;  4YAK B;  4O4H F;  4DN4 M;  4HMI A;  4JK1 C;  1UE7 A;  1X3P A;  4DR6 L;  1CA6 A;  3J7A V;  2PNR C;  1I7N A;  1PX2 A;  1LTI D;  2A6E C;  1QE6 A;  4G3I A;  2V58 A;  3GV3 A;  4EX5 A;  3PO3 H;  3I4O A;  4P71 A;  4BY1 H;  3PN1 A;  1KJQ A;  4YHH L;  1BCP F;  4JBJ A;  3PO2 H;  1EL0 A;  3M9M B;  2DPJ A;  1LO5 D;  3JAM E;  2R8K A;  1PH8 A;  4PZ7 A;  1A62 A;  2UVV A;  5KG5 A;  3U50 C;  5DLQ E;  2R7Z G;  2UVR A;  2JEI A;  2A8V A;  4HAE A;  2A6H C;  5T14 A;  1TR5 A;  5H1S E;  2OH2 A;  1YZ6 A;  2L11 A;  4DV1 Q;  1STB A;  5M3M B;  4A3I G;  1EYD A;  1LAC A;  2B2U A;  1TWC B;  3K80 C;  4A3K G;  2OCE A;  3I12 A;  1Q86 C;  3NBI A;  3Q8S B;  2IA6 A;  1YHQ A;  3RZO H;  3SVM A;  4LF7 L;  3HOZ B;  5JOB A;  2IMW P;  2QDL A;  4GNX A;  1EEF D;  2EYH A;  4F7X A;  3OUZ A;  4IPD A;  3FEW X;  1VS0 A;  3VYS A;  1I50 A;  1E1T A;  4A3B G;  3S17 B;  5K2M A;  1B70 B;  5EKL A;  5CBA E;  5JJK A;  1A2T A;  3W1B A;  4IUQ A;  1W96 A;  2SEB D;  1W93 A;  1O7Y A;  1EIY B;  4HJA A;  2MJ8 A;  1PTO B;  1B50 A;  1T36 A;  3EIV A;  5GON F;  1SMX A;  1BCP D;  2TSS A;  4OL7 A;  5E4W C;  2VQF H;  3RB3 A;  3OUU A;  3DM3 A;  3X3N A;  3AMU A;  3OW2 A;  5JEA H;  3J81 j;  1NMF A;  2E2I H;  1LM0 A;  3J7A F;  1LT5 D;  1BO0 A;  1Z9F A;  4IUR A;  1PRT B;  2R92 A;  3ERQ A;  1K83 H;  2R7Z H;  3RB6 A;  1D6E C;  2W9B A;  1TXY A;  1SMY C;  1EY8 A;  3GTK B;  4LSA A;  4MA0 A;  1VBG A;  1ZHQ A;  3EQL C;  1K8O A;  4ED7 A;  1GUG A;  4NXN L;  3CCS A;  4LSX A;  2E2J H;  4CDC C;  1T94 A;  1H95 A;  2XD4 A;  5C3E G;  4EGJ A;  5JJL A;  1B2T A;  3S24 A;  1SSO A;  4Q0F A;  3N8D A;  3F2D A;  4RMF A;  1XNQ L;  5KT4 A;  2N55 A;  3UDX A;  4ZI7 F;  1CE8 A;  3GTP H;  3GIP A;  1YHA A;  2K5W A;  1GM5 A;  3KLW A;  4LJZ C;  4A3B H;  2UXC Q;  3VPB A;  4QUF A;  2LKV A;  4IQZ A;  3M3Y B;  1HUN A;  1K8G A;  4XQN A;  3NQI A;  1BJT A;  5KFR A;  4RNN A;  3GDE A;  4X64 H;  3F1Z A;  3C1E A;  4Q45 A;  3U9S A;  5L1J A;  3TN2 A;  1MJE A;  3J80 W;  1AW7 A;  4I7Z C;  3A56 A;  3EN2 A;  3HOV G;  5CAE B;  2ZM6 Q;  2EY2 A;  2KBN A;  3OHB A;  4POG A;  2A6H D;  2HGS A;  4FO2 A;  4A3D G;  3E5N A;  4JI0 H;  4ILW A;  3I70 A;  4MV7 A;  4RKB A;  3S16 B;  4HNT A;  4EYH B;  3VYU A;  4A3F B;  5FLM G;  1ASY A;  3FPU B;  2F0U A;  2ASB A;  4O2A F;  3LGJ A;  4R4O A;  4QJF A;  4DAP A;  4YB8 B;  1S5B D;  2ZXR A;  1HZB A;  4JYA L;  4IJH A;  3T1Y L;  3W5O A;  4GKK H;  4L6T B;  3MXP A;  4WJW A;  4RB3 C;  1RTO A;  1U0L A;  4AYB B;  1V1Q A;  3S15 H;  3SE0 A;  2VQD A;  4HIK A;  1YVC A;  1VKZ A;  4J9S A;  3BJU A;  4JI1 Q;  2OQ0 A;  1VCI A;  2BE5 C;  2C5C A;  4UPA A;  1U4R A;  4UCT A;  1Y1V G;  3G6E A;  3VPD A;  3TIN A;  5KFY A;  4DNI A;  3VDY A;  4B3S L;  5FD6 A;  3PUW A;  2J7Z A;  4UDU C;  4C3I G;  1ESF A;  4HMJ A;  3D6W A;  2JXM B;  3M7N A;  2F4V L;  5AJ3 L;  1A63 A;  3GTJ A;  3N42 B;  3HBL A;  5KIX A;  1GUW A;  3L4K A;  3MA2 B;  1JIH A;  4X66 L;  2B2W C;  2F0V A;  1SMY D;  3MJF A;  4MTE A;  3OTO Q;  4O1N A;  1Z2N X;  1DOK A;  3CC4 A;  4IR1 A;  1STE A;  4GZY C;  4TQR A;  3OHA A;  1IW7 D;  5LMU H;  1TKW B;  3NEN A;  2L4N A;  3K59 A;  4JVZ A;  4OWT B;  5A35 A;  4DR6 H;  4A75 A;  5GRO A;  3S1N H;  3Q24 A;  1JR0 D;  4J9M A;  2EZV A;  3HOX G;  3TP5 A;  5LMN Q;  2WB1 G;  4MAM A;  5NUC A;  2LSS A;  1FJG L;  2W6M A;  4EFE A;  1N56 A;  1UNS A;  4YHH H;  2J4X A;  2ATL A;  4IUP A;  3JRX A;  4IFD J;  2JA5 G;  3BAB A;  1Y1V H;  3HKZ B;  4HQ6 A;  4ECX A;  2NVQ B;  1SE8 A;  3Q8Q B;  5C3W A;  3K7U C;  5ELB A;  2ZTE A;  5HGQ A;  1NCV A;  4CKB A;  1Y8N B;  1X3F A;  4C3I H;  5FO9 B;  1VQM A;  5I47 A;  4MHE A;  2XC9 A;  1KNE A;  4DK0 A;  2K6A A;  3VR3 A;  4R8N A;  5KFM A;  3G48 A;  3K5N A;  4JUZ A;  4EBD A;  1RYR A;  4I65 A;  4LUO A;  4A4I A;  2UUB L;  3Q22 A;  1VQ8 A;  4FDB A;  2ALY B;  1IBK Q;  2MO1 A;  1VQO A;  1C0A A;  2W9B B;  1S9F A;  5I9O A;  2Q2I A;  4DAY A;  1PH9 A;  5JUM A;  1KAW A;  4DR1 L;  1TS2 A;  5DLG A;  2PO4 A;  2VY3 A;  2WKD A;  4JOI A;  3MWE A;  2ZXP A;  3A54 A;  3G7L A;  3NSW A;  1G51 A;  3NPP A;  1G91 A;  5KYI A;  2BE5 D;  3GIJ A;  3HOX H;  1AP0 A;  1ZET A;  4R7R A;  2I5L X;  4C2M H;  1GO3 E;  4KD4 A;  3UDF A;  1FD7 D;  3GTL B;  1I3Q B;  4LUZ A;  2XGT A;  4YIJ A;  3ETH A;  1B04 A;  3NBH B;  2E2I A;  4CJ1 B;  1VQ4 A;  5KFI A;  4LK1 C;  1K73 C;  1EU3 A;  1S97 A;  3GTO B;  3F2B A;  4A76 A;  3U58 A;  4O3N A;  4O3S A;  2YV5 A;  5A2Q L;  2I5H A;  3HG9 A;  4AIM A;  5DNF A;  3G6J B;  1JWU D;  2R86 A;  1K83 A;  2K04 A;  2B2V A;  2R7Z A;  2W8L A;  3K7A H;  1G8Z D;  3N52 A;  2EYF A;  2EVB A;  1GHK A;  2SOB A;  1Q82 C;  3SEB A;  3I90 A;  4LF6 Q;  2W71 A;  5M3M G;  3PW2 A;  3C3L A;  3VR4 A;  4NXN H;  4LFC L;  2PMZ B;  2JJQ A;  4BBS B;  1II3 A;  4LF9 L;  4R8U A;  4F4Y A;  1C7Y A;  1EY9 A;  3HOZ G;  4LFB L;  3H3V C;  4U67 3;  1XNQ H;  1SAP A;  3GTP A;  5K36 H;  3G6X A;  2B8G A;  4DV0 L;  5KRU A;  1OXX K;  2DNE A;  2EJM A;  1NR2 A;  2XN9 C;  2DY7 A;  3RFC A;  1GYF A;  1Q8I A;  2C9O A;  4QL5 A;  5KNC A;  4POF A;  1RL2 A;  3D4R A;  3GID A;  5FKA C;  3PIO A;  4LWC A;  5EWF A;  3Q1K A;  1B9N A;  4JV2 A;  4V19 0;  1HCZ A;  1RKN A;  3KAL A;  3E0E A;  2JEJ A;  2RDG A;  3FHW A;  3CQZ B;  3Q8P B;  3R23 A;  2O03 A;  4UP8 A;  2F0K A;  3BA8 A;  1PMR A;  3GTJ B;  1J8I A;  1EZ1 A;  4I7A A;  4IFD H;  3BA9 A;  4ECS A;  2OXP A;  1RJQ A;  1JXL A;  1WTH A;  3EJI A;  1IBL Q;  4FF3 A;  1IKL A;  1PV4 A;  4JI4 L;  4ECV A;  1NSN S;  1TT2 A;  3CRK C;  2JSO A;  5DG7 A;  1XTD A;  4JYA H;  1KEE A;  3VR6 A;  3T1Y H;  2M00 A;  1TWC H;  5HV6 A;  3T13 A;  4HR7 A;  2A69 C;  1CQJ B;  1SLJ A;  2PNH A;  3S1Q B;  2B2T A;  3BYY B;  3HOZ H;  5KFD A;  2YRX A;  1BKB A;  2UXB L;  4DR2 L;  4IPG A;  2VA3 A;  1ET6 A;  3PUY A;  4NKL A;  4DAV A;  3S17 H;  1N48 A;  1MHW C;  2RA4 A;  3DEP A;  5ELO A;  2IBK A;  3PO3 B;  3SHL A;  3T56 B;  4KTA A;  4YCU A;  5C8Y F;  4DR3 Q;  3CF5 A;  2FP4 B;  4B3S H;  1BOS A;  4O2B F;  2K5V A;  4ULL A;  1S10 A;  1PTO H;  3RBD A;  2NU8 B;  3VR2 A;  1N34 H;  4JC0 A;  2AKW B;  2RHS B;  4X62 L;  2F4V H;  1Z7T A;  1KHI A;  1Q1B A;  4EQO A;  4AYB E;  4RA8 A;  1WSC A;  2W6Q A;  4YWM A;  4OEM B;  4X66 H;  3Q23 A;  1OXU A;  4IWY A;  2N8N A;  2YCH A;  2ES2 A;  4X3K A;  1CK1 A;  5C1P A;  2VA2 A;  4A3F G;  4WJ4 A;  5JJI A;  1A6X A;  3PCO B;  4IO9 A;  3RN2 A;  4R9W A;  2KHS A;  2VQE L;  4HIM A;  1I4H A;  4JG2 A;  3HGB A;  2BQR A;  4RKL A;  3RZO B;  3N43 B;  4DAY B;  4DXF A;  5A2Q E;  3AU7 A;  2C28 A;  4AYB G;  3RN5 A;  5E1F A;  5C0X I;  3L0O A;  2VOB A;  4K5W A;  1V51 A;  3BVM A;  5KFB A;  1FJG H;  4JI3 L;  1SE3 A;  1JJ2 A;  3OMC A;  4A3J B;  3BVG A;  5FLX E;  4X3T A;  5IE8 A;  4HED A;  3BQ0 A;  1DOM A;  1Y1V A;  2NBF A;  2EPB A;  4KY6 A;  4IR9 A;  1ENA A;  1MSH A;  4QWE A;  4M9U A;  2E2I B;  2LMC B;  1ILQ A;  4X6A H;  2K75 A;  3T4A C;  2MCT A;  1BBU A;  2BDN A;  4ZK9 B;  1PH2 A;  1D5Z C;  3TP7 A;  3IAY A;  2UUB H;  4CKE A;  3BZC A;  2AQ4 A;  3H09 A;  1P16 A;  4GC6 A;  5FK9 C;  3CPW A;  2W8K A;  4J15 A;  3NEL A;  1YIJ A;  3K5H A;  2KCC A;  4MV1 A;  1F2L A;  1NTG A;  4OHJ A;  4LW1 A;  3S16 H;  4DR1 H;  2JP1 A;  2M05 A;  4A3F H;  1I4G A;  2IW3 A;  1G29 1;  1FR3 A;  1V9P A;  3HKZ E;  2A69 D;  1ET9 A;  2LXJ A;  4DK6 C;  3A7A B;  1E4E A;  1VQN A;  4RZR A;  4J9P A;  2CW7 A;  3U9T A;  2AHO B;  1STY A;  1HNZ L;  1B4O A;  2UXC L;  4C3H B;  4C2M A;  4ID6 A;  3CXC A;  3WOE A;  2JA8 H;  3GII A;  4M7E A;  4DV3 Q;  1XNR L;  3GV6 A;  1EFI D;  2SNM A;  4TV9 F;  1JE4 A;  1WD1 A;  5I9P A;  4GN3 B;  1WTP A;  3CCL A;  2RDH A;  3NTK A;  1EYC A;  1L0Y B;  1VQL A;  3FKI H;  1A3V A;  1JDB B;  3HKZ G;  4LFA L;  3TQY A;  1L2Z A;  2EY6 A;  1I7L A;  1M8A A;  2R61 A;  1TS4 A;  3H94 A;  1EWH A;  2X0S A;  5D1O B;  2PZW A;  5KFS A;  4IWX A;  1XPR A;  2F0P A;  1I6V C;  5KG0 A;  4LFC H;  4P2C B;  1L0X B;  5FLX c;  1YJN A;  5IYB H;  4LF9 H;  4DFA A;  4HNU A;  1QNU A;  3DHQ A;  3FPP A;  5IT9 c;  4PWQ A;  5IYZ F;  4LFB H;  1JWM D;  5COR A;  1T9H A;  5T1G A;  1AE2 A;  3BS1 A;  1PH3 A;  3S15 B;  4E4T A;  4DV0 H;  4HR7 B;  2C35 B;  5KFH A;  3RLO A;  3ORR A;  4XQJ A;  4IOA A;  3PR4 A;  5IP7 H;  2CWA A;  1H9S A;  5JPN C;  3GTM H;  3DLL A;  4EBC A;  2NN6 H;  3K5I A;  2HHH Q;  1SNC A;  4PMW A;  2PMZ E;  1DZ1 A;  2B2Y C;  2FK1 A;  2NVQ H;  3R8B A;  4MV9 A;  2EDG A;  2AUJ D;  4LF5 H;  1EWC A;  4J9L A;  1DGS A;  4P72 A;  4CDE C;  4YQW A;  4JI5 Q;  1KDB A;  4JI4 H;  1PDQ A;  3UDI A;  3FMC A;  4J1M A;  1S5E D;  1SN8 A;  4XIG S;  2V4R A;  3HS0 C;  3N44 B;  4DV6 L;  2FPG B;  1TWC A;  1K9M C;  3RV3 A;  4BBS G;  4DV7 Q;  1F2Z A;  1PLF A;  1KDC A;  4OX9 Q;  4UFZ A;  5LMN W;  3KJP A;  1TY0 A;  1L1O A;  4DKA C;  2UXB H;  4DR2 H;  5E7N A;  3TDQ A;  1K28 A;  5EBD A;  4CHT B;  5D14 A;  3J80 i;  3KTM A;  5ELF A;  1ML0 D;  1QOH A;  4OGQ C;  1CHQ D;  2Z6K C;  3ULJ A;  1YIT A;  2JEA I;  4O3O A;  3A0J A;  3TME A;  4BWG B;  3K57 A;  1JKJ B;  1F9S A;  3LML A;  1T3N A;  3EFX D;  1WTX A;  1IBM L;  4NP5 A;  1I6H H;  3J81 c;  2BA0 A;  4PMB A;  4X62 H;  3BG3 A;  3GTL H;  1I3Q H;  1MJC A;  3H6M A;  5EWG A;  3RGZ A;  2PQA B;  2NVX H;  2W70 A;  3CCU A;  4RHR A;  2QEX A;  1UAP A;  2NZO A;  4TRD A;  2AMC B;  5FOB B;  4ECU A;  3GTO H;  1G2S A;  4LF8 Q;  5FPO A;  4KHP L;  3BQ2 A;  3PW4 A;  2WDT A;  3OSP A;  1XX8 A;  3MXN A;  2YTY A;  1K0S A;  1NR4 A;  4C1N I;  2JA7 H;  2VQE H;  5KFZ A;  2JE6 I;  2Q2T A;  2UUA L;  3RLF A;  4DR5 Q;  4KKU A;  1BCP B;  4Y7N H;  4MZ9 A;  1JWS D;  4APV A;  1FGU A;  3OYY A;  3L2P A;  1YEZ A;  3RR5 A;  1EIG A;  4BBS H;  1IYV A;  1A9X A;  2F0G A;  3GTG B;  4JI3 H;  4QUC A;  4B3T L;  1VQ7 A;  1AE3 A;  1C8C A;  1S0M A;  2D0O A;  1EUC B;  3K0Y A;  1JOR A;  3CKI B;  2R7N A;  1XJV A;  1QB5 D;  1M1K C;  3PO3 G;  2DUD A;  4AQY Q;  1SFO H;  1XMQ Q;  2F3I A;  2K5D A;  2ZJR A;  1I94 L;  3PO2 G;  3H15 A;  2ASL A;  2PPB C;  4DA2 A;  1X3Q A;  4LH6 A;  4KHZ A;  1OXV A;  2LY7 A;  4RZQ A;  3CQZ H;  4ECZ A;  4WFN 3;  1K8M A;  1MZB A;  3UE1 A;  1BQQ T;  1AUV A;  2E8G A;  2HQE A;  5FPR A;  5FJ8 G;  1PH6 A;  2CFM A;  3TS2 A;  3QJY A;  2KVM A;  1JQY D;  1XPU A;  1G6P A;  5FD5 A;  1EOV A;  5CGK A;  1XPO A;  4JV5 Q;  3UI2 A;  4DUY Q;  1TA8 A;  3CCR A;  3BZK A;  1JCK B;  5M9O A;  2UU9 Q;  2K28 A;  2I80 A;  4JI7 Q;  1HNZ H;  1UE1 A;  1I5F A;  1MKH A;  1IL2 A;  1FKA H;  2N49 A;  4IPH A;  3S1Q H;  3DWQ A;  1EZ6 A;  4A3J G;  4G4K A;  1XNR H;  4YP3 A;  1PH7 A;  4GKJ L;  1FVI A;  2D9U A;  1H9S B;  3BJY A;  3FKI A;  3KHG A;  5EWE A;  3L9A X;  5J39 A;  1NUC A;  3FVQ A;  3MFI A;  2DJF C;  4LFA H;  3PV0 A;  4LF4 Q;  1D2B A;  1ZKO A;  1IOV A;  2K1B A;  4F4W A;  5JEA G;  5I6Y A;  1YBY A;  2K01 A;  3V6K A;  5EPK A;  5DM7 3;  1J9O A;  1CS0 A;  3RNU A;  5KFV A;  3R2T A;  3VYR A;  2K03 A;  2K50 A;  4NXM Q;  4IUT A;  2HQL A;  5CV4 A;  2EYJ A;  3QWN A;  2D2C C;  1HNW L;  4FU0 A;  4BWS C;  2W6Z A;  3TRZ A;  3TBI B;  4FBU A;  1CM9 A;  2OEO A;  1S03 G;  4KJO A;  3CCJ A;  4O42 A;  1VQK A;  5FJ8 H;  1QWY A;  3SXH A;  2WP8 J;  2QYZ A;  1E4F T;  2FHT A;  3CC7 A;  3GQC A;  1K1S A;  2R87 A;  1EQV A;  2LFN A;  4J9K A;  5DEH A;  1QJO A;  1L1O B;  1VQJ A;  1GLV A;  5JH7 F;  3TZD A;  4C3H G;  2NVY B;  5KNB A;  1PA6 A;  3GTM A;  5KT3 A;  1D1K A;  2ZJT A;  1Y1W B;  5GAE C;  5IY0 A;  4A3J H;  2E5L Q;  2VXW A;  3RGX A;  1BF4 A;  1AN7 A;  1SNM A;  2A68 C;  1BNC A;  3HKZ A;  5IYD G;  3EVQ A;  4NDX A;  4EQN A;  3FRP B;  4XXE A;  4GLV B;  2B29 A;  3SI8 A;  4IJL A;  3QIA A;  3EA6 A;  4DL5 A;  3CVZ A;  1TY2 A;  4FVM A;  1PK8 A;  2R85 A;  5KKN B;  4FF1 A;  1W2B A;  4DV6 H;  2AWO A;  3RJ0 A;  1KBL A;  4IZO A;  1EEI D;  3MXN B;  5BMV F;  2A5H A;  1EFW A;  5D8D A;  3T16 A;  4B9X A;  4XYO A;  2PZU A;  1SNQ A;  2KEC A;  2RHQ B;  5M3F B;  1S72 A;  3RZD B;  1J6Q A;  1SYX B;  4O2D A;  1SJH D;  3HOW H;  4K0K L;  1DIK A;  3OMG A;  4MTD A;  1IW7 C;  5KG1 A;  2PVP A;  4RNO A;  1LTT D;  4DL4 A;  3JAM c;  4O4L F;  5EKI A;  4HCS A;  1T5E A;  4C3H H;  2F0T A;  1RYS A;  1SEB D;  1EYG A;  1IBM H;  3GTL A;  1I3Q A;  1HXY D;  3GP7 A;  4O4I F;  3HOU H;  4EQP A;  2AU0 A;  2NVX A;  3K5L A;  1D7Q A;  3NBH A;  4TQS A;  1STG A;  3R2I A;  3NUC A;  5KFT A;  5IYD H;  3GTO A;  5KX5 F;  3F8T A;  1JOO A;  1VQB A;  5KG6 A;  4KHP H;  2MQH A;  3J80 L;  2JEG A;  2EXD A;  1X32 A;  3I3C A;  2JA7 A;  2Z6B A;  1EZ8 A;  3SDZ A;  2UUA H;  1LTB D;  1VQC A;  2ENB A;  4RAY A;  2DGY A;  1L0W A;  2PMZ A;  4KN4 C;  2BH2 A;  1LV9 A;  3AB9 A;  4JCV E;  4Q5V A;  1TWG H;  2RDF A;  3K5O A;  4RFB A;  3SK8 A;  4B3R Q;  4JBW A;  4YWL A;  1KRT A;  3D4D A;  5K5P A;  2VL6 A;  4B3T H;  1PH5 A;  1Z47 A;  2W7P A;  2HUG A;  3GV5 B;  4MN3 A;  4K8I A;  1S68 A;  2JA8 B;  2RBM A;  3E9H A;  4CKC A;  4DUZ Q;  1KC8 C;  1SFO A;  3E0J A;  4OXP A;  4N9T A;  3BDL A;  2B63 B;  1M6V A;  3RB0 A;  1V1O A;  3TRE A;  2I07 B;  1I94 H;  2MGS A;  4ED0 A;  2CVR A;  3FKI B;  2NU7 B;  2A68 D;  3UFX B;  1SR3 A;  3PUZ A;  2HIX A;  1Q3L A;  3ND8 A;  3V2T A;  3CQZ A;  3S2H B;  1RK5 A;  3R3O A;  3J81 i;  2VPQ A;  2N3S A;  3S9W A;  3P75 A;  2FMM A;  2C2E A;  4YR3 A;  1VBH A;  5F9N A;  1F2M A;  3U9O A;  1SNO A;  4Q0Y A;  2N78 A;  3M85 A;  3HOY H;  5EPJ A;  4OWX B;  3NK9 A;  3KK7 A;  1TS3 A;  1HTP A;  3MVV A;  3QOL A;  2EIF A;  4YY3 L;  2L55 A;  3KLS X;  3GV8 B;  2JK8 A;  2OQK A;  4UP9 A;  1KJ9 A;  2WV6 D;  2F0O A;  3CAM A;  5BPF A;  2DJG C;  2EJF C;  1FNU A;  3ERO A;  3MR5 A;  1BGW A;  2G9H D;  3Q8D A;  4GKJ H;  4UCR A;  3W3A A;  3I4N B;  2VW9 A;  3WO0 A;  3F2U A;  4RGN A;  3GTM B;  3M9N B;  2PQE A;  4GN5 A;  4V0B A;  1M90 C;  4ZLT F;  1HJP A;  3TS0 A;  4JI2 Q;  2FKL A;  1YI2 A;  2CHB D;  1B9M A;  1HQR D;  1PTO D;  1N33 L;  2F0W A;  1JOQ A;  2CQA A;  2E76 C;  3Q6S A;  3GLK A;  4CDF C;  3MAQ A;  1I4R A;  2WII B;  3A5Z B;  3N6R A;  4QY7 A;  4JI5 L;  2D62 A;  1HNW H;  2IX3 A;  2F3W A;  3HXL A;  4M1U B;  2VS1 A;  5HGT A;  5DGA A;  2BOS A;  2PW7 A;  5F9L A;  4IRC A;  3KBG A;  2UUC L;  3KUP A;  2L0C A;  2F0I A;  4TUY F;  2VUM B;  5KFK A;  2F1M A;  4LF7 H;  1EUJ A;  2EOT A;  4UHV A;  1M0W A;  5C3X A;  4ZUJ A;  5C4H A;  5K36 G;  1CQF A;  4XYM B;  2FK2 A;  4CGY B;  2B2U C;  1TII D;  1FYC A;  4DV4 L;  5C4X B;  5C44 B;  1GKH A;  3GTG H;  4KN7 C;  2CCZ A;  2YS7 A;  5CV8 A;  5IP9 G;  5EZY F;  2XRQ D;  2L15 A;  3D3R A;  5J3B A;  4GNX C;  2H4O A;  1B6S A;  1KAA A;  3V05 A;  3NE5 B;  1I6H B;  5ELN A;  1VAJ A;  1ZHS A;  3RMH A;  2NVX B;  2DY8 A;  1S5D D;  3HRZ C;  1LT4 D;  2A74 C;  1Y8O B;  2HT1 A;  3AEV A;  4RG1 A;  4LF8 L;  3IN5 A;  1AUX A;  5L9X A;  1HHV A;  3J7Y W;  3IRB A;  4H02 A;  4IFD G;  1O75 A;  5L1K A;  3MFG A;  5C5J A;  4FBT A;  5M5X H;  2MPM A;  2RDJ A;  2JA7 B;  3PIO 3;  1TWH B;  4DR5 L;  2SNS A;  2YTX A;  4BY7 B;  1SND A;  4G57 A;  4MV8 A;  4Y7N B;  2QA4 A;  5IGE A;  1DM0 B;  1IXR A;  5KND A;  1IYU A;  2ZDG A;  4K0K H;  2NTT A;  1F9R A;  2WTF A;  5CV5 A;  3Q0A A;  2DLN A;  2FFK B;  3FDS A;  2Y0S B;  1LTG D;  3A7L A;  1Y1W G;  2ASJ A;  4B3M L;  1VF7 A;  4AQY L;  4A93 H;  3D8G A;  4AH6 A;  1WH2 A;  3PSI A;  1SFO B;  2W9C B;  5IP9 H;  5FLX W;  1JC7 A;  4EGV A;  3R5X A;  4DR4 Q;  1XXG A;  1GHJ A;  4OWW B;  4L8J A;  2GPW A;  5IT9 W;  4PQX A;  4RWS C;  4RGT A;  4I4T F;  3U4Z A;  2NVT B;  1WR2 A;  3WNZ A;  1OTC A;  5KG3 A;  3T5L A;  4ALP A;  3HEJ A;  1D8L A;  1ICW A;  2K5H A;  2K5Q A;  2WFW A;  3GIQ A;  3CCE A;  3UQ8 A;  1F9P A;  5D1O A;  5F2D A;  2XCL A;  3JSN A;  4ED8 A;  3WO1 A;  1BR9 A;  3GTQ H;  1YHB A;  3DMU A;  1VQI A;  1CHP D;  3G8C A;  4KMU C;  3OHX C;  4DR6 Q;  1TWG A;  4JI6 L;  5JJZ A;  4F88 A;  4MV6 A;  2CH4 A;  3K0X A;  5LL6 b;  3PIP 3;  4APM A;  2V59 A;  4L5R C;  5M3F G;  4FYD A;  3AFP A;  4JI7 L;  1LTL A;  4QIW B;  4QGU A;  4EGQ A;  1RD9 D;  2NUA B;  1OXS C;  1I4X A;  4XTC S;  3CME A;  4YHH Q;  4DV5 Q;  4YR2 A;  1VQE A;  5I2Y A;  5J22 A;  1GUS A;  4IN3 A;  3D6C A;  2MHV A;  1S4Z A;  2PW5 A;  1IYJ B;  3U4V A;  2V4Q A;  1KLU D;  1M4V A;  2NVY H;  3O13 A;  1GD7 A;  1ZQ7 A;  5JVL A;  1ROD A;  1Y69 U;  1Y1W H;  1ICF B;  4YCW A;  3LX0 A;  5E4X A;  2ZTC A;  2IPK D;  4E6I A;  3JAM i;  2K33 A;  2R7M A;  1JMC A;  2YU9 B;  2H5X A;  1KRS A;  2HJW A;  2KSW A;  2F0F A;  1BBX C;  2Z0S A;  3MXU A;  4RCO A;  2O5J C;  2V4D A;  1QG7 A;  5COY A;  2E75 C;  4U7C A;  1X55 A;  1CQV A;  3I7F A;  4YJ3 F;  5FO7 B;  4NXM L;  2MUY A;  1Y14 B;  2E2H B;  4F87 A;  2Z4I A;  4OIJ A;  2F0E A;  4LNQ A;  3ICE A;  5JQW A;  2HIV A;  4IZ8 A;  1K0R A;  3KHL A;  4DV1 L;  4XYL B;  3F2C A;  1I4Q A;  4DR7 Q;  4FXK C;  4YY3 H;  1NMG A;  2K7V A;  2DNC A;  4P75 A;  3J81 W;  3H20 A;  2QF7 A;  2EQS A;  3M4Q A;  2CQY A;  4H44 C;  1V8Q A;  4U6P A;  5M3F H;  3RZD H;  1VQH A;  3NWT A;  4XX0 B;  2VNU D;  4LH7 A;  4TV8 F;  1WOC A;  1R4Q B;  4U68 A;  1WTV A;  2JA8 G;  2R93 B;  2VR1 A;  1MSG A;  1K3R A;  2NB0 A;  2E5L L;  2HVR A;  3S1M B;  2EY5 A;  3H40 A;  2B63 G;  3JZI A;  4BA2 I;  3K3P A;  1O7I A;  3MWM A;  3FKI G;  4CC5 A;  4ZAI A;  1Q81 C;  1H9J A;  1N33 H;  4RUA A;  3A74 A;  2PQA A;  2VZA A;  4M8A A;  1S3O A;  1E7Z A;  2FLN A;  4BXX H;  1E1O A;  4RH6 A;  1EHI A;  3S2D H;  4KHV A;  4YCV A;  4NXN Q;  3CD6 A;  4F50 A;  4EQ5 A;  5LXT F;  2R7F A;  2BQU A;  2UUC H;  4L5Q A;  1F9Q A;  5M5Y B;  1XNQ Q;  2IX0 A;  4PZ8 A;  5IYB G;  1DCZ A;  5KG2 A;  4Q44 A;  4BBR H;  2SDF A;  4NMZ A;  4L1K A;  2BDO A;  2YL2 A;  2EY1 A;  4HN7 A;  2IX1 A;  3HOW B;  3KAK A;  4B08 A;  4DV4 H;  3GTG A;  5KG4 A;  1W6K A;  2IJ0 A;  2OTJ A;  2YYA A;  1T5X D;  1YNN D;  4QB4 A;  3STB C;  5IP7 G;  5IIF A;  3I4N G;  3P1H A;  1PYS B;  3LWB A;  3Q2O A;  4MV3 A;  4JOI C;  5J2U F;  3RIZ A;  2Q2H A;  2NN6 G;  2E74 C;  1A3U A;  3HOU B;  2B63 H;  1TWA B;  4RHS A;  2RGR A;  2JA9 A;  1WI5 A;  3WOF A;  4ZOL F;  1BXR A;  3VA5 A;  4A3I B;  4I55 F;  2FJ2 A;  4A3K B;  4LF8 H;  2EYM A;  4I7H A;  5IYC H;  1PVO A;  1N9W A;  2ZM6 L;  3BVZ A;  3S2H H;  5KFQ A;  1HR0 W;  3NWS A;  5DAU A;  4QWD A;  5JVD F;  2KED A;  3JC6 6;  3T1Y Q;  4GOP B;  5BR8 Q;  3QFF A;  3MEF A;  1IHZ A;  1MGS A;  2MP1 A;  3GO5 A;  3CMA A;  3KAJ A;  4DR5 H;  1FGB D;  4ED6 A;  4G7O C;  1B7Y B;  1CKN B;  4ZKB B;  1KIX A;  1EUD B;  2AGQ A;  4KY5 A;  1U4L A;  3MC0 B;  1SRO A;  1AFP A;  2LXK A;  3HZX A;  4B3R L;  2B2V C;  4C3J H;  1TWG B;  3OW7 A;  2VB3 X;  4KK7 A;  5KFE A;  3M7G A;  3NTH A;  3ONA B;  4GC7 A;  4RB0 A;  5EKK A;  3LP8 A;  1XMO Q;  2K4K A;  4IAJ A;  3EPI A;  4B3S Q;  3PW5 A;  1HFG A;  4DUZ L;  5C4X G;  4I50 F;  5C44 G;  4B3M H;  4JI1 L;  1N34 Q;  1MI2 A;  4R1J A;  2P0A A;  3SE7 A;  2F4V Q;  3I4N H;  5AJ3 Q;  4KY7 A;  1KAB A;  1HPC A;  3N6X A;  4QQB X;  4DLK A;  3OOC A;  4H0L C;  4HNV A;  1CSP A;  4K8J A;  2SCU B;  1HA5 A;  3G71 A;  1YJW A;  2XIW A;  1C3O A;  5FO8 B;  1YNJ C;  4NW2 A;  5IOD A;  4YR0 A;  2RCN A;  4J6H A;  4UCO A;  2J6U A;  3GTQ A;  4JBK A;  2AGP A;  1VMC A;  2Y0S E;  3PF4 A;  1H9R A;  3HOY B;  4RGO S;  2HCI A;  2JA7 G;  4JI6 H;  3OTO L;  4BY7 G;  3EBE A;  2CKZ B;  1SDF A;  3H4B A;  4K6L A;  4BS9 A;  1GSO A;  4QW9 A;  1QZH A;  1SYF A;  1PH4 A;  1OXT A;  3QZ7 A;  1FJG Q;  4OIK A;  3OPO A;  3NGD A;  4JI7 H;  2VUM H;  1N32 Q;  3VA7 A;  4DV2 Q;  3A8I E;  1N36 Q;  1HH2 P;  4DK3 C;  1ZEQ X;  2KJX A;  3CC2 A;  3STB D;  5LMN L;  1EQR A;  2Y0S G;  2NVY A;  4YBZ B;  3TP6 A;  2Q2U A;  1Y1W A;  3CCV A;  3HOV B;  1RJR A;  5C4X H;  1LAB A;  2MNA A;  4DXG A;  3GIK A;  5C44 H;  4K14 A;  4DL3 A;  2RDI A;  1UWV A;  5EAY A;  5D1P A;  4CC6 A;  4JI2 L;  2RVL A;  4XZ3 B;  2B2T C;  2H1E A;  4EYI B;  2ICE C;  5KFC A;  4HSP A;  2UUB Q;  5C4J H;  4NB3 A;  2IL8 A;  4J8Q A;  3KJO A;  2GN5 A;  2ZDQ A;  3E3X A;  4QIW E;  4ZCK A;  3H3V H;  3KDF B;  4QF4 A;  2FJZ A;  2NYZ D;  2GLT A;  4NXM H;  2QCP X;  4DR1 Q;  2W6P A;  3ULL A;  4X65 Q;  3JAM W;  3QB3 A;  5CA1 F;  1UNN C;  5KT6 A;  4DV1 H;  4C5C A;  2Z4H A;  3G6Y A;  2L12 A;  1IBK L;  2RKS A;  4N8X 1;  2JA6 H;  5CB4 F;  3FDT A;  5EJW A;  1KXL A;  5JAV A;  1TWH H;  1B33 N;  1DXM A;  4BY7 H;  1DV1 A;  1ENF A;  2V5A A;  3N41 B;  5LL6 X;  3C46 A;  3M4O B;  3OIP A;  4A3E B;  5D3D A;  3MTS A;  1S5F D;  1GSH A;  4B9W A;  1JB3 A;  3P7J A;  5KG7 A;  2QKI C;  1ONL A;  3RLN A;  1WTQ A;  2E5L H;  1AEX A;  4FS2 A;  3G4S A;  3K3V A;  3RV4 A;  2A19 A;  4ZKC B;  1HNX Q;  1SYC A;  3I72 A;  1QUQ B;  3BDC A;  1CKM A;  4A2B A;  1NE3 A;  2GVA A; 
#chains in the Genus database with same CATH homology
 3F8T A;  1VQB A;  2MQH A;  3K7A H;  2GVB A;  2EXD A;  3KFU A;  4JBM A;  2YYZ A;  4IPC A;  4LFC Q;  2JEB I;  2NVT H;  1Q82 C;  1L2F A;  4HIO A;  4LF6 Q;  3I4M H;  5M3M G;  4LF9 Q;  4HJ8 A;  1VQ9 A;  1QZG A;  4R4Q A;  5C0X J;  4LFB Q;  4LFC L;  1P8L A;  1VQC A;  2JJQ A;  2DGY A;  5IWA Q;  2CQO A;  4LF6 L;  1L0W A;  4JYA Q;  4LF9 L;  1R9T H;  1C7Y A;  1SRU A;  1A0I A;  4DV0 Q;  2OWO A;  2BH2 A;  4MNO A;  5GAD C;  4JCV E;  1HR0 L;  1TWG H;  3HOZ G;  4B3R Q;  4LFB L;  4JBW A;  4YWL A;  1KRT A;  1WCM H;  2AWN A;  3M9B A;  2VL6 A;  4DV0 L;  2CWP A;  1PH5 A;  1OXX K;  1Z47 A;  2VUM G;  1JE5 A;  1CKO A;  3B6Y A;  3E9H A;  4DUZ Q;  4QL5 A;  4POF A;  1RL2 A;  1KC8 C;  1PFS A;  4OXP A;  2R93 G;  1E22 A;  3ERS X;  3M4P A;  2UXD Q;  3I2Z A;  3TRE A;  3L7Z C;  3PIO A;  4LWC A;  1Q8K A;  1X3E A;  2RF4 A;  1FL0 A;  3E0E A;  4JI8 Q;  4PG3 A;  4LF5 Q;  4DR4 L;  3FHW A;  3CCQ A;  1SR3 A;  3PUZ A;  2HIX A;  2BH8 A;  4UP8 A;  4A3C H;  1KD1 C;  2YU9 H;  2R92 G;  4OO1 G;  3J81 i;  4JI4 Q;  2N3S A;  2KEN A;  4X66 Q;  4P73 A;  3T1H Q;  1IBL Q;  1PV4 A;  4JI4 L;  2N78 A;  3M85 A;  2I0Q A;  3HOY H;  4YY3 Q;  1XTD A;  4OWX B;  2E2H H;  1IBL L;  4HID A;  3AYH B;  1TWC H;  1VQP A;  2XTI A;  2UXB Q;  1B8A A;  1X56 A;  4DR2 Q;  2EIF A;  4YY3 L;  2JA6 G;  1SLJ A;  2PNH A;  2JK8 A;  5C0X G;  2OQK A;  3HOZ H;  1BKB A;  2MFI A;  4GOP C;  1I50 H;  4UP9 A;  2UXB L;  4DR2 L;  3HOW G;  4IPG A;  1YNX A;  1X54 A;  4DV5 L;  3CAM A;  3PUY A;  1Q12 A;  3S17 H;  5ELO A;  2ZTD A;  3Q8D A;  4YCU A;  2B3G A;  3PGZ A;  2VW9 A;  4DR3 Q;  3CF5 A;  1NJI C;  4X62 Q;  2PI2 E;  4A3M G;  2K5V A;  2K14 A;  3KYH C;  3KOJ A;  4GN5 A;  3HKS A;  1M90 C;  1N33 Q;  2R93 H;  1HJP A;  3TS0 A;  4JI2 Q;  2VQF L;  4JC0 A;  4DR3 L;  2AKW B;  2RHS B;  3D0F A;  4X62 L;  2IY5 B;  2V1C C;  3S1M H;  3HOU G;  1YI2 A;  4R4T A;  1EIF A;  1KHI A;  1Q1B A;  1N33 L;  3ER0 A;  1HZC A;  4HJ7 A;  4AYB E;  4YWM A;  4OO1 I;  1PHJ A;  3A5Z B;  1OXU A;  4QY7 A;  4JI5 L;  2R92 H;  2N8N A;  2VQE Q;  2D62 A;  1VQG A;  2ES2 A;  2UUC Q;  1VQ6 A;  3TEH B;  2VS1 A;  4A3F G;  4WJ4 A;  5JJI A;  4ME3 A;  2D0P A;  1Q46 A;  3PCO B;  4IO9 A;  3RN2 A;  1J5E Q;  2VQE L;  3AQQ A;  4O0A A;  4HIM A;  4JG2 A;  2UUC L;  4GLX A;  4DR7 L;  4DAY B;  2OTL A;  1NBW A;  3KF8 B;  1UE6 A;  1E3P A;  5M5Y H;  4JI3 Q;  4AYB G;  4DV4 Q;  3RN5 A;  1EUJ A;  1LUZ A;  5C0X I;  5K36 G;  3L0O A;  3GTL H;  1WYD A;  4JI3 L;  1JJ2 A;  1NY4 A;  4DV4 L;  1GKH A;  5IE8 A;  2CCZ A;  3GTG H;  4HJ5 A;  1QVG A;  2R7D A;  5IP9 G;  2L15 A;  2YTV A;  5J3B A;  4GNX C;  1QVF A;  4X64 L;  1L1O C;  4A3M H;  1JJC B;  5ELN A;  3J7A 5;  3KF6 B;  4X6A H;  2K75 A;  2HT1 A;  3KF6 A;  1TWA H;  4A3G G;  1BBU A;  1PH2 A;  3AEV A;  4A3C G;  4RG1 A;  4LF8 L;  3CP0 A;  4JI0 L;  3BZC A;  4A3I H;  4A3K H;  1P16 A;  4IFD G;  3IRB A;  4H02 A;  4J15 A;  3CPW A;  3NEL A;  3WWV A;  1YIJ A;  3GD7 A;  5M5X H;  3S16 H;  1NTG A;  4LW1 A;  2K52 A;  2ZJP A;  4DR5 L;  3HOY G;  2YTX A;  4A3F H;  1G29 1;  2QA4 A;  5IYD H;  1V9P A;  3HKZ E;  4GKK L;  1HNZ Q;  1IXR A;  1HR0 Q;  2LXJ A;  4DK6 C;  1VQA A;  1VQN A;  2AHO B;  1X6O A;  1XNR Q;  5JEA J;  1HNZ L;  2IHF A;  2KCM A;  2UXC L;  4BY1 G;  4B3M Q;  2WAQ E;  1UE5 A;  4BA1 I;  3CXC A;  2JA8 H;  3I55 A;  4TQU S;  3A5U A;  4DV3 Q;  1XNR L;  1Y1W G;  4GN3 B;  1CUK A;  4LFA Q;  3CCL A;  4B3M L;  4AQY L;  3S1R H;  4AH6 A;  4A93 H;  3PSI A;  1VQL A;  5IP9 H;  3FKI H;  4DV3 L;  3HKZ G;  1AH9 A;  4LFA L;  2ID0 A;  4DR4 Q;  3TQY A;  4OWW B;  1HZA A;  4IOC A;  5GQO A;  5HY6 A;  4TVA B;  3U4Z A;  1JT8 A;  1OTC A;  3GTJ H;  4ALP A;  2WAQ G;  4YWK A;  3PUX A;  1D8L A;  2K5H A;  2WFW A;  4JV5 L;  3CCE A;  4A3G H;  1XPR A;  4DPG A;  1CSQ A;  4P74 A;  4JI6 Q;  5BR8 L;  1U5K A;  5FLX c;  4IFD I;  3GTQ H;  2R6G A;  1YHB A;  1YJN A;  1VQI A;  4GLA C;  5IYB H;  5C3E H;  3D31 A;  5IT9 c;  4DR6 Q;  4JI6 L;  1QVC A;  3K0X A;  5LMU L;  1T9H A;  4OON A;  1AE2 A;  5M3F G;  1UE7 A;  1PH3 A;  4L5R C;  4DR6 L;  3AFP A;  4JI7 L;  2C35 B;  1LTL A;  4QGU A;  3PF5 A;  3RLO A;  2MO0 A;  1Q7Y C;  1OXS C;  4A3E G;  1XMO L;  4XTC S;  3CME A;  1RIP A;  4YHH Q;  4DV5 Q;  4IOA A;  1VQE A;  2CWA A;  5IP7 H;  4EX5 A;  3PO3 H;  3I4O A;  4P71 A;  4BY1 H;  3GTM H;  3DLL A;  3I56 A;  1N34 L;  1IYJ B;  1V43 A;  3U4V A;  4YHH L;  2NVY H;  4JBJ A;  1GD7 A;  3PO2 H;  1Y1W H;  4YCW A;  3JAM i;  2ZTC A;  2HHH Q;  2VQF Q;  1JMC A;  4PMW A;  2PMZ E;  3HOV H;  2H5X A;  3UDG A;  1KRS A;  4PZ7 A;  1PH8 A;  1A62 A;  2WB1 E;  2NVQ H;  3PUV A;  3U50 C;  5DLQ E;  2R7Z G;  1IZ6 A;  3AFQ A;  2HHH L;  2Z0S A;  4A3D H;  2A8V A;  2KHI A;  5H1S E;  1PH1 A;  1DGS A;  1X55 A;  4P72 A;  3I7F A;  1YZ6 A;  4JI5 Q;  4DV6 Q;  2ATW A;  5FLM H;  4NXM L;  4DV1 Q;  1Y14 B;  4A3I G;  3K80 C;  3UDI A;  4A3K G;  4LNQ A;  3ICE A;  1SN8 A;  2OCE A;  4XIG S;  1Q86 C;  4DV6 L;  2HIV A;  1K0R A;  4DV1 L;  1K9M C;  2ASB A;  4BBS G;  4GNX B;  1YHQ A;  4DV7 Q;  4LF7 L;  3RZO H;  3F2C A;  4OX9 Q;  3H0G G;  4DR7 Q;  4GNX A;  1NMG A;  5LMN W;  4P75 A;  4IPD A;  3KJP A;  1VS0 A;  1L1O A;  2BA1 A;  4DKA C;  4DV7 L;  1E1T A;  4A3B G;  1N32 L;  2EQS A;  3M4Q A;  1B70 B;  4DV2 L;  5E7N A;  4OX9 L;  5JJK A;  5M3F H;  3W1B A;  3RZD H;  1VQH A;  3J80 i;  1VQD A;  2I5M X;  1N36 L;  2VNU D;  3M4O H;  1EIY B;  4HJA A;  4A3E H;  2Z6K C;  3ULJ A;  1WOC A;  1YIT A;  1IBM Q;  2JA8 G;  3A0J A;  3UE0 A;  2JEA I;  3EIV A;  1SMX A;  1K3R A;  2E5L L;  3TS2 A;  2B63 G;  4X64 Q;  2IT1 A;  1IBM L;  4A93 G;  4BA2 I;  1I6H H;  1O7I A;  4KI0 A;  2BA0 A;  1WFQ A;  3DM3 A;  3J81 c;  3OW2 A;  1I3Q H;  1KL9 A;  1MJC A;  3FKI G;  1NMF A;  3J81 j;  1Q81 C;  2E2I H;  4UY8 C;  2PQA B;  2NVX H;  1LM0 A;  4KHP Q;  3CCU A;  3A74 A;  2QEX A;  1Z9F A;  2PQA A;  2VZA A;  2NZO A;  2AMC B;  1S3O A;  2FXQ A;  1E7Z A;  3GTO H;  4BXX H;  1E1O A;  1K83 H;  4LF8 Q;  2R7Z H;  4KHP L;  3E9I A;  3HFZ B;  4JI0 Q;  3S2D H;  4PZ6 A;  4YCV A;  1TXY A;  2UUA Q;  4NXN Q;  3CD6 A;  1S40 A;  4X65 L;  2YTY A;  4EQ5 A;  2JA7 H;  2R7F A;  4R4I A;  2JE6 I;  2Q2T A;  4L5Q A;  4NXN L;  3RLF A;  4DR5 Q;  2UUA L;  1XNQ Q;  3CCS A;  2E2J H;  4Y7N H;  2IX0 A;  4MZ9 A;  4PZ8 A;  5IYB G;  1N8R C;  1H95 A;  5C3E G;  3W1G A;  4APV A;  5JJL A;  2IHE A;  1FGU A;  3OYY A;  3L2P A;  1YEZ A;  3RR5 A;  3S24 A;  4BBR H;  4B3T Q;  4BBS H;  4GKK Q;  3F2D A;  4RMF A;  1XNQ L;  2QGQ A;  3H0G H;  4L5T A;  3UDX A;  3S14 H;  3GTP H;  5M5W H;  2IX1 A;  1YHA A;  1GM5 A;  3NEM A;  3KLW A;  4GS3 A;  1VQ7 A;  4B3T L;  1AE3 A;  4L5S A;  4A3B H;  2UXC Q;  2D0O A;  1WJJ A;  2OTJ A;  1EWI A;  3STB C;  5IP7 G;  1K8G A;  1I94 Q;  1XJV A;  1M1K C;  3PO3 G;  3I4N G;  1PYS B;  1A8V A;  2JA5 H;  4JOI C;  3GDE A;  1Q1E A;  2DUD A;  3F1Z A;  1PYB A;  4AQY Q;  1XMQ Q;  1SFO H;  2F3I A;  2ZJR A;  1MJE A;  1HNX L;  2Q2H A;  1I94 L;  2NN6 G;  3PO2 G;  3H15 A;  4HJ9 A;  2B63 H;  3EN2 A;  1XMQ L;  3HOV G;  2JA9 A;  4KHZ A;  2KBN A;  1WI5 A;  2ZM6 Q;  1OXV A;  4POG A;  3CQZ H;  4A3D G;  1X3G A;  5IYC H;  1PVO A;  1N9W A;  3UE1 A;  2ZM6 L;  3S2H H;  3BU2 A;  2E8G A;  5GAG C;  1HR0 W;  1BBW A;  5FLM G;  1ASY A;  3JC6 6;  5GAH C;  3T1Y Q;  2PI2 A;  4GOP B;  5BR8 Q;  5FJ8 G;  3J80 c;  3CCM A;  2CFM A;  3LGJ A;  3GO5 A;  3MEF A;  4R4O A;  4QJF A;  3CMA A;  1UEB A;  5IWA L;  4GOP A;  1VQ5 A;  1B7Y B;  1CKN B;  1HZB A;  1KIX A;  4JYA L;  4IJH A;  1XPU A;  1G6P A;  3T1Y L;  1EOV A;  3W5O A;  1CKN A;  1XPO A;  1SRO A;  4DUY Q;  4JV5 Q;  2LXK A;  5LMU Q;  4B3R L;  4WJ3 M;  1U0L A;  4C3J H;  4DAM A;  3BZK A;  1V1Q A;  3CCR A;  3S15 H;  4A3L G;  2UU9 Q;  4JI7 Q;  1UE1 A;  4HIK A;  1I5F A;  1MKH A;  2NZH A;  1YVC A;  4DUY L;  2N49 A;  3BJU A;  4IPH A;  4JI1 Q;  1IL2 A;  3S1Q H;  2OQ0 A;  1XMO Q;  2K4K A;  4GKJ Q;  1VCI A;  4GN4 B;  4B3S Q;  2UU9 L;  4UPA A;  4A3J G;  2JQO A;  4DUZ L;  5C4X G;  3SGI A;  2KCT A;  5C44 G;  1BVS A;  1PH7 A;  4GKJ L;  1Y1V G;  1FVI A;  4JI1 L;  3G6E A;  1N34 Q;  2ZJQ A;  4DNI A;  3VDY A;  4B3S L;  4R1J A;  2UXD L;  3PUW A;  2F4V Q;  3CPF A;  3I4N H;  5AJ3 Q;  4UP7 A;  4JI8 L;  3PV0 A;  4LF4 Q;  4LF5 L;  4QQB X;  2NN6 I;  3M7N A;  5JEA G;  2K5N A;  2F4V L;  1YBY A;  5AJ3 L;  1A63 A;  4LF4 L;  3J7Z C;  1HNW Q;  1CSP A;  4AIM A;  1W3S A;  3G71 A;  1YJW A;  4X66 L;  3RNU A;  3T1H L;  5M3M H;  2K50 A;  4BXX G;  2RCN A;  4NXM Q;  2HQL A;  1KQS A;  3OTO Q;  4JBK A;  1HNW L;  3K81 C;  3TRZ A;  3CC4 A;  2Y0S E;  3PF4 A;  1ASZ A;  2Z6K A;  2JA7 G;  1TWF H;  3CCJ A;  2F52 A;  3OTO L;  5FJ8 H;  1VQK A;  4BY7 G;  1C9O A;  3EBE A;  2WP8 J;  4LF7 Q;  2CKZ B;  3NEN A;  4R4C A;  3CC7 A;  4OWT B;  3ULP A;  1QZH A;  1PH4 A;  1OXT A;  1FJG Q;  4A75 A;  5GRO A;  3S1N H;  4BBR G;  2VUM H;  3CW2 C;  3K8A A;  3HOX G;  5LMN Q;  1N32 Q;  4DV2 Q;  1L1O B;  1VQJ A;  2WB1 G;  2KHJ A;  4A3L H;  2LSS A;  1VQF A;  4LUV A;  1N36 Q;  1FJG L;  1PA6 A;  1YJ9 A;  1HH2 P;  4DK3 C;  3CC2 A;  3STB D;  5LMN L;  1EQR A;  2Y0S G;  5GAE C;  2Q2U A;  3FP9 A;  5IY0 A;  4A3J H;  1X65 A;  3CCV A;  2E5L Q;  5C4X H;  2MNA A;  3PIP A;  5C44 H;  4IFD J;  2JA5 G;  1UWV A;  1Y1V H;  5EAY A;  4JI2 L;  1SE8 A;  3K7U C;  1LYL A;  1HZ9 A;  2ZTE A;  5HGQ A;  5IYD G;  4KLK A;  1X3F A;  4C3I H;  1VQM A;  2UUB Q;  5C4J H;  4NB3 A;  4GLV B;  2A1A A;  1MIU A;  2B29 A;  1JB7 A;  3KJO A;  2GN5 A;  3G48 A;  4IJL A;  3H3V I;  3I4M G;  4LUO A;  4QIW E;  4A4I A;  3KDF B;  2UUB L;  3H3V H;  5IYC G;  3GTK H;  1VQ8 A;  4DR1 Q;  4FDB A;  3KDF A;  3ULL A;  4MTN A;  2ALY B;  1IBK Q;  4X65 Q;  2MO1 A;  1VQO A;  1W2B A;  1C0A A;  2AWO A;  1J5E L;  1PH9 A;  2Q2I A;  3MXN B;  1KAW A;  4DR1 L;  1EFW A;  1JJG A;  1IBK L;  2VY3 A;  4K0K Q;  4JOI A;  2JA6 H;  1WCM G;  1KXL A;  1E24 A;  1TWH H;  2RHQ B;  1S72 A;  1K8A C;  4BY7 H;  1J6Q A;  1G51 A;  4O2D A;  3HOW H;  4K0K L;  1PH6 A;  4Y52 H;  3HOX H;  3JAM c;  3M3Y H;  2I5L X;  4C2M H;  1GVP A;  1GO3 E;  3RLN A;  3UDF A;  4C3H H;  4NPS A;  4LUZ A;  3G4S A;  2XGT A;  2A19 A;  1EYG A;  1HNX Q;  3NBH B;  3HOU H;  1VQ4 A;  1QUQ B;  1K73 C;  1D7Q A;  1CKM A;  1QUQ A;  3ZJY C;  3F2B A;  4A76 A;  3U58 A;  1EQQ A;  1NE3 A;  2YV5 A;  2I5H A;  1X9N A;  2GVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...