4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
b'MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
4LW1A 1B7YB 3B6YA 1E1OA 2WB1G 1W2BA 1PH4A 4LFCL 4LF4L 4KHPL 4P75A 1S40A 4JG2A 1Q1BA 3CCSA 3GTOH 2K75A 5AJ3L 4JCVE 3FKIG 1SE8A 4YWKA 2KHJA 1HJPA 4YY3Q 2IHEA 3CCQA 2MQHA 4A3LG 2ZTCA 4B3RQ 1AE2A 3CC2A 1NE3A 3PF5A 1IBLQ 1NTGA 3KFUA 1GKHA 2QA4A 4JI4L 2OWOA 5GQOA 3F2DA 3Q8DA 4HIKA 1FJGQ 4QIWE 2KCMA 1SFOH 4X65Q 4LF5Q 4UY8C 4DR7Q 1I94Q 4GOPB 1K9MC 3HOYH 4X6AH 1VQKA 3J80i 1Y14B 2WB1E 4DUYQ 4NXMQ 1EQRA 1VCIA 4AYBG 1Q1EA 1MJEA 4A4IA 4YWLA 1EIYB 4JI5L 4WJ4A 3EBEA 2K4KA 4DNIA 2C35B 4QGUA 3K7UC 4DK3C 1HR0L 3HOWH 2CWPA 3M4QA 2YTYA 4QY7A 3PO2H 1SLJA 1E7ZA 4NXNL 2E2JH 1Q82C 1WCMH 1UE7A 5GAGC 5HGQA 1VQ5A 4A3DH 4IPHA 3A74A 1B8AA 1XTDA 4KHPQ 4GOPA 4X62L 1GD7A 1PH9A 1KD1C 3TEHB 5GADC 2F4VQ 1IYJB 4JI2L 3PF4A 2K50A 4UPAA 4A3IG 1Z9FA 4DR1Q 5BR8Q 3GTPH 1IBKQ 1JJGA 3BU2A 5ELOA 3CCEA 3RN2A 4A3KH 4DR3L 3PO2G 4JI1Q 3GTLH 3NELA 3FHWA 3NBHB 4X64L 3AYHB 4LF9Q 4A3GH 1KL9A 2CFMA 2IX0A 2YTVA 1D8LA 2IY5B 1G51A 2N8NA 1HZBA 1N34L 2R7ZH 2A19A 4XTCS 3S15H 1N33L 4A93H 2I0QA 4DR4Q 3M4PA 4O2DA 4JBMA 3AQQA 1JJ2A 2VUMH 3H3VI 1VQ6A 4R4CA 1IBMQ 4IPCA 3CPWA 1EWIA 2YYZA 4LUZA 3CQZH 3HOUH 4JI3L 4GKKQ 4JV5Q 1NJIC 3GD7A 4OXPA 4JI5Q 4L5SA 3EIVA 2B63H 1FL0A 1YITA 4H02A 2UUBQ 1T9HA 4IJHA 1HH2P 1YHBA 4R4QA 3UDXA 1NBWA 5IYCG 2ZM6L 3KF8B 4BXXH 3DLLA 3CCLA 4X66Q 4NXNQ 5IT9c 2A1AA 2AKWB 2VS1A 1X3GA 5IP9H 1Y1WH 3GTGH 1S3OA 4DR5L 2VUMG 3PUVA 2K5VA 4GNXB 2KENA 1X54A 4DV2L 2JA5H 2B3GA 3S17H 2JA6H 3HOUG 2D62A 4AQYL 2K5NA 2JA7H 5JJLA 1XPOA 2LSSA 2E5LL 3G71A 4IO9A 1EUJA 2GVAA 3J81i 3K7AH 3PO3G 2I5HA 2MNAA 4A3EG 3KYHC 2MO0A 3F2CA 4NPSA 4BXXG 3G48A 5FJ8H 3GTJH 3J7A5 2BA1A 2N49A 3U4VA 2UXCQ 1X3FA 1Q46A 3U58A 5IYBH 4YCUA 4YCWA 4BA2I 1EOVA 2R7FA 3I4NH 4JI6L 3MXNB 1N32L 1VQGA 1VQ9A 1K3RA 4GNXA 3KF6B 4JYAQ 3E0EA 4RG1A 3PIOA 5C0XG 2YU9H 4P72A 1YVCA 4JI8Q 2OTLA 4DR6Q 1VQ8A 4A3CH 3K8AA 2Q2IA 1PFSA 2UU9L 3HOZH 3I2ZA 4LNQA 4DV0L 4OONA 5C3EG 4HIOA 2GN5A 4DV7L 3U50C 1MKHA 2N78A 2MO1A 3AEVA 5C0XI 3HKZE 1XNRQ 2Q2TA 1L1OB 1VQBA 4R1JA 2Z6KA 4P74A 1HNWQ 1PH2A 5LMUL 1KIXA 4POGA 5IWAL 4IFDJ 2JEAI 4OWWB 3W1BA 4OX9L 4OWTB 1V1QA 2OQ0A 3KF6A 3KJPA 3S1RH 1VQ4A 1HR0W 1Q12A 1TWCH 4B3SL 4LFBL 3UE1A 4J15A 4BA1I 3L2PA 2ES2A 2UXBL 1XMQL 3STBC 4P71A 3I56A 3CMEA 1AH9A 4A3BG 2VL6A 5C4JH 1CSQA 4JBKA 1L1OC 4A3FH 1L1OA 3T1YQ 1EYGA 4GKJQ 3RZDH 3H0GH 3M4OH 4QQBX 1D7QA 3DM3A 3CW2C 4DV5L 2UUCL 3CAMA 4A75A 1VQCA 2VZAA 4LF7Q 1YNXA 1Q8KA 2KHIA 1K0RA 3KDFB 1TXYA 3SGIA 3I4MH 4BBSG 1N36Q 1SR3A 1UE5A 4XIGS 2I5LX 1J5EL 1HNZQ 4DV0Q 3J80c 2R93H 1BKBA 4GLVB 3OYYA 4A3JH 1IL2A 3GTQH 1JE5A 2PI2A 4QJFA 1QVCA 2E2IH 4JI7L 1GVPA 4DV1Q 3E9IA 5M5XH 1PYSB 1CKMA 4JI0L 2QGQA 4FDBA 2NZHA 5K36G 1WYDA 4YWMA 1YHAA 3F1ZA 1EQQA 4BY7H 2Z0SA 4O0AA 4K0KL 1X56A 4MZ9A 4POFA 4L5TA 4DV3Q 3EN2A 1HNXL 3S1MH 4GN4B 3KDFA 1VQDA 2MFIA 3H15A 1XNQL 2NVTH 4AH6A 4LFBQ 1MIUA 4A76A 4LFAQ 3D0FA 2R92H 1C7YA 3HOYG 1AE3A 4IFDG 1LYLA 4MNOA 4LF4Q 4LFCQ 1E1TA 3M9BA 3UDGA 1JT8A 2K52A 3BJUA 5AJ3Q 2JA8H 2V1CC 4DV5Q 5JEAG 1XMOL 5FLMH 1KXLA 1QVGA 2D0PA 2IX1A 4AYBE 2VY3A 3PIPA 3PV0A 3HOWG 2BH2A 1B70B 4HIDA 2LXJA 4JI4Q 4R4TA 5JJIA 1BVSA 1A62A 1WCMG 1J5EQ 3TQYA 4A3DG 1JJCB 2H5XA 1OXXK 3TRZA 1C9OA 2UXDL 2D0OA 4DV6L 1G6PA 4LF6L 2NVXH 1PH8A 2E8GA 1J6QA 2NN6G 1Q86C 4IOAA 4Y7NH 4GN5A 4A3KG 5M3FH 3CXCA 1I3QH 2A8VA 1HNXQ 1HR0Q 2RCNA 4A3GG 4JOIC 3JAMi 2BA0A 3GO5A 3NEMA 2NN6I 3AFPA 2I5MX 2R7ZG 4A93G 1X55A 2OCEA 1R9TH 1PH5A 2DGYA 1CKNB 5EAYA 3PUZA 3T1HL 1VQLA 1W3SA 3TS0A 1X65A 2PI2E 2WAQG 4DKAC 4X62Q 4YHHL 1Z47A 3J81c 3K0XA 3M85A 1OXUA 3KJOA 4JI2Q 3K80C 4GLAC 3S2HH 2B63G 1HZAA 2B29A 3PUYA 2KBNA 4C3IH 4DR3Q 3JC66 4LWCA 5J3BA 2NVQH 3S1QH 4X64Q 4R4IA 1GO3E 1LTLA 5IP9G 1Y1WG 4L5RC 3S14H 3S2DH 2VNUD 1KQSA 1N34Q 4B3ML 2VQFL 1PH1A 1Q7YC 1M1KC 1N33Q 5C4XH 1CKNA 1Q81C 2JA5G 1JMCA 1N8RC 3HOXH 4BY1H 5M3MH 2JA6G 3HOVH 3CCJA 3KLWA 2JA7G 4LF8L 1Y1VH 1OXSC 4EX5A 4WJ3M 3RLFA 2VW9A 1YJNA 4JI3Q 1ASZA 4JC0A 2RF4A 5LMNL 1VQFA 1QZHA 2F3IA 2JA9A 3OTOL 4DUZL 5FJ8G 3E9HA 2ID0A 3FP9A 1E24A 2JK8A 3RR5A 3STBD 5IYBG 2ZM6Q 1V43A 1IXRA 4AIMA 2NVYH 4OO1G 3CCUA 4LUVA 1LM0A 4ALPA 1E22A 2AHOB 3I4NG 5M5YH 1PYBA 5FLXc 4HJ8A 4DR5Q 3M3YH 1A63A 4YY3L 1YEZA 4C3JH 4DV2Q 3W5OA 4P73A 1PH7A 4B3RL 3LGJA 4AQYQ 1IBLL 4A3CG 5C44H 5IP7H 4ME3A 2E5LQ 3HOZG 4UP9A 1WJJA 5IYDH 1VQPA 3OW2A 1FJGL 4BBRH 1PA6A 1VQJA 4X65L 4LF5L 1TWFH 1WI5A 4DR7L 1I94L 3I4OA 2ZJRA 1NY4A 2F52A 4NXML 1KAWA 4DUYL 1TWHH 4IPDA 3ULPA 5E7NA 2ZJQA 4YCVA 1E3PA 4JI6Q 1SMXA 2XTIA 2YV5A 3CCVA 1N32Q 3FKIH 4UP7A 2JE6I 1YBYA 4PMWA 2HHHL 2L15A 3D31A 3W1GA 1CSPA 1G291 3L0OA 2UU9Q 1OTCA 5ELNA 3OTOQ 3G6EA 4DUZQ 3HKSA 4DV7Q 1TWAH 1K83H 2EQSA 4DPGA 3U4ZA 3RN5A 4C3HH 4A3FG 1X6OA 2WFWA 3H0GG 1OXTA 1H95A 4B3TL 3CCRA 2FXQA 4GS3A 1KC8C 4RMFA 3BZCA 4PZ7A 2ASBA 2F4VL 4C2MH 5LMUQ 1QVFA 1FVIA 3I7FA 1VS0A 5IWAQ 4DR1L 3ULJA 3GTMH 4OX9Q 5JJKA 1FGUA 1K8GA 5BR8L 3I4MG 1IBKL 4B3SQ 4MTNA 2HT1A 4JI1L 4LF9L 2ZJPA 3CP0A 2R93G 2UXBQ 1XMQQ 4A3JG 1C0AA 4DR4L 3MEFA 1K8AC 2EIFA 2DUDA 2OQKA 3UDFA 4PZ6A 2UUAL 1CUKA 1UWVA 1IBML 3GTKH 4IOCA 4BY7G 4R4OA 3L7ZC 2UUCQ 1NMFA 3GDEA 3F8TA 4QL5A 4DV4L 4GKKL 4IFDI 3KOJA 4A3IH 4JV5L 1PH3A 4JBWA 4NB3A 3K81C 2UUBL 2HHHQ 4OWXB 1GM5A 5M5WH 3AFQA 1VQHA 3H3VH 3CC7A 2VQEL 1X9NA 3G4SA 2R92G 4X66L 3BZKA 2IT1A 2HIXA 1SN8A 1XJVA 4HJ5A 1JB7A 1KRSA 1U5KA 2AWNA 3CF5A 4GOPC 4JI7Q 3RLOA 2JA8G 4HJ9A 2Y0SG 4JI0Q 4APVA 3IRBA 4B3TQ 1RL2A 2RHSB 3NENA 4GN3B 5FLMG 5GAEC 4HJ7A 1U0LA 3S16H 3VDYA 3JAMc 5LMNW 4K0KQ 1PV4A 1OXVA 1VQAA 3PUWA 3CCMA 1VQIA 2BH8A 2IHFA 2R7DA 3PGZA 1SRUA 2HIVA 4JOIA 3A5UA 2JQOA 4A3MH 4EQ5A 5C0XJ 1XNQQ 1LUZA 1VQ7A 4HJAA 2UXCL 1BBUA 1QUQB 5IYCH 1P16A 3CD6A 4KI0A 1I5FA 1P8LA 3UE0A 1S72A 2WP8J 1IZ6A 2ZTDA 2HQLA 2ZTEA 3CPFA 2ALYB 1VQMA 2UUAQ 4JYAL 4GLXA 2PMZE 4DR2L 3S1NH 1YI2A 1K73C 2N3SA 1XMOQ 4JI8L 2Y0SE 3J7ZC 3J81j 5M3FG 2KCTA 4DV4Q 3UDIA 4LUOA 4DR6L 3A5ZB 3RLNA 1YJ9A 3A0JA 1YZ6A 3PO3H 4A3MG 5HY6A 1EIFA 4TQUS 4A3EH 2K14A 3TS2A 1XNRL 2EXDA 1EFWA 1XPUA 2VQEQ 2JJQA 1I6HH 2RHQB 1QUQA 4JBJA 5DLQE 3ER0A 1HNWL 3TREA 1UEBA 2Q2HA 4KHZA 2UXDQ 4DV6Q 1A0IA 5GAHC 3PSIA 4LF6Q 1V9PA 4DAYB 2WAQE 1N9WA 2OTJA 1A8VA 1MJCA 1SROA 2AMCB 2CKZB 4HIMA 4UP8A 4IPGA 1O7IA 2CQOA 3HKZG 1VQEA 2AWOA 1M90C 3WWVA 5C3EH 2QEXA 1ASYA 2PNHA 2E2HH 1PHJA 4DK6C 3T1YL 3HFZB 4TVAB 4GKJL 5C4XG 1NMGA 1WOCA 3HOXG 4BY1G 5M3MG 3HOVG 3T1HQ 1XPRA 2XGTA 1VQOA 1L0WA 4GNXC 4LF7L 4OO1I 2PQAB 1Y1VG 4YHHQ 3I55A 3CMAA 1YJWA 1QZGA 4PG3A 4DR2Q 1X3EA 3F2BA 5H1SE 1CKOA 1HZCA 1WFQA 1N36L 1L2FA 2NZOA 4KLKA 2ATWA 3S24A 3ULLA 1UE1A 1HNZL 4IJLA 3ICEA 2Q2UA 5IY0A 1PH6A 3ZJYC 3RZOH 1UE6A 4DAMA 4DV1L 4A3BH 2Z6KC 1DGSA 4B3MQ 2VQFQ 1VQNA 4Y52H 1KRTA 2CWAA 4L5QA 2JEBI 1KHIA 3M7NA 4PZ8A 1YIJA 3PUXA 2K5HA 3ERSX 1YHQA 1TWGH 4A3LH 2PQAA 3CC4A 4DV3L 2LXKA 1I50H 2YTXA 5IP7G 5C44G 4LF8Q 2GVBA 1PVOA 5IYDG 5GROA 2CCZA 2R6GA 4BBRG 5IE8A 1HZ9A 3PCOB 5LMNQ 5JEAJ 4BBSH 1RIPA 4LFAL 1BBWA 3RNUA
chains in the Genus database with same CATH superfamily
3TQ1A 4RB0A 2YW2A 3BYTB 3D4RA 2NVXB 4LF4L 2WB1G 3MR3A 4LFCL 3FDTA 2XIGA 4JG2A 4UCUA 3VPBA 4X3UA 3CCSA 3GTOH 2K75A 5I6WA 2H4OA 1SE8A 4YWKA 1V1PA 1AW7A 1HQRD 4ZUIA 1IHZA 2KCCA 2JYOA 3CC2A 3SR1A 1G8ZD 3EROA 1NNXA 4EFEA 1TIID 5GQOA 1FJGQ 4QIWE 1FKAH 3IFTA 3BQ0A 3T5HA 1CQFA 3KHHA 2F0FA 2FE3A 1B50A 2AQ2B 1PZID 5EKKA 1VQKA 4DUYQ 4DR2H 1EWCA 1EQRA 1GXDC 2O5IC 4AYBG 4JI8H 4QW8A 1Q1EA 2IL8A 5A2QE 2NVQB 3HKZB 2K4KA 4DNIA 4QGUA 2CWPA 3M4QA 3TP7A 2E2JH 3BA9A 4BY1B 2EPBA 1HNWH 3P1HA 2ASJA 4KHPQ 3DXJC 4GOPA 2FB9A 1GD7A 1M4VA 1PH9A 4LF8H 5ELCA 4UPAA 4A3IG 5LMNH 2CHBD 3V6JA 4F88A 5ELOA 1PTOH 4MTDA 1A2UA 4DR3L 2FINB 4FXGC 3Q8SB 3GTLH 1W6JA 4IUVA 1KL9A 2CFMA 2RSOA 2R7ZH 4XTCS 5IT9E 1KAAA 4DR4Q 4O4HF 1KBLA 4JBMA 1VBGA 1V51A 1LACA 1STAA 4XX0B 4LF7H 5HV6A 1VQ6A 1IBMQ 3CPWA 2A68D 1EWIA 1CT1D 1EU4A 4MHEA 3R5FA 2K05A 1EQVA 3CQZH 3HOUH 2B2VC 2MCTA 1N36H 4GKKQ 1TS3A 3L3OC 2MGSA 3RZOB 3GD7A 4ECQA 2QILA 2NU7B 4Z9CB 2AU0A 2ZM6L 5IYCG 1SYXB 3NBHA 2DIKA 4DV1H 1CA5A 4NXMH 4X66Q 3RJ0A 5IT9c 2AKWB 3GTGH 1X3GA 5AFWA 5IP9H 1Y1WH 5EOYA 1S3OA 3J7AF 5F9NA 2VUMG 1TWGB 2BOSA 3GV6A 3KHRA 2KENA 3TBIB 5IYZF 4DV3H 2JA6H 2D62A 2DNEA 5JJLA 4CBVA 1T36A 2AGPA 3G71A 4IO9A 1WTXA 5DAUA 3J81i 2KECA 4A3EG 2B2YC 4C3HB 2BQRA 1XWEA 2NWGA 5FJ8H 3J7A5 2BA1A 4LFCH 5CORA 3VR6A 5C3XA 3GTOB 4UCSA 1C48A 1PMRA 3EFXD 1LT4D 3KF8A 5L1LA 4DK0A 4YCUA 4YCWA 2RDFA 3MXNB 1B4OA 3KF6B 3PIOA 2ZT9C 2YU9H 4I7AA 3J7AK 2PQEA 4DR6Q 1S10A 5FO7B 5D8DA 3GTMA 2ASDA 3I2ZA 2EY6A 2W6MA 4DV0L 3GTKB 2N78A 3GQCA 4K14A 2R87A 1AP0A 2Q2TA 1VQBA 2VPQA 2Z6KA 2W9CA 4Q8FA 3JSNA 1PH2A 4LH7A 2P5ZX 4IFDJ 4OWWB 1EWHA 2CW0C 1HR0W 1Q12A 3KHLA 2E2JB 3GV3A 5ELDA 1K1QA 4MV3A 1J8IA 4DL7A 1C30A 1SFOA 4ME6A 1SYBA 4P71A 4DN4M 3ONAB 3J80E 2PW7A 4A3BG 1CSQA 3ITPA 1JOQA 1L1OA 3T1YQ 3DEPA 3M4OH 1SE3A 4QQBX 3QG1A 1D7QA 1HFGA 2VZAA 5A2QW 3N44B 3BABA 3GTLB 4UDUC 3BDOA 2KHIA 1SYCA 4XT3B 4DR3H 1PX2A 2CH4A 2R7ZB 1UE5A 2YRXA 4XIGS 3MWMA 2IA6A 1HNZQ 3J80c 1BKBA 4QJFA 1KLGD 5LOVF 4IFDH 2WAQB 5EGTA 2W6NA 3HOUB 1CKMA 2TMPA 5D3IB 2ZXRA 4K5XA 4YWMA 1UEAB 5C6AA 1PTOC 2XNAC 3PO3B 1EY8A 1BUVT 2LY7A 4GN4B 3KDFA 2XVSA 2L55A 1XNQL 2ZM6H 3GTGB 3MJFA 2PVPA 2MUYA 4LFAQ 4ED7A 3CVZA 5IT9W 3OHAA 1C7YA 2VUMA 1II3A 1AE3A 2A6EC 4MNOA 2JA6B 4CDEC 1TY2A 4XYLB 2ZDQA 1A2TA 3UDGA 3RIZA 4ED1A 1S97A 2K52A 4JW0A 2A74C 5AJ3Q 2RBMA 2JA8H 2V1CC 4S3SA 1XMOL 5FLMH 1XDNA 1SYGA 2B2WC 3HOWG 4AYBE 2V58A 4IQZA 2LXJA 5L1IA 1DOKA 1BVSA 5JJIA 2R6FA 4MA5A 2AQ1B 4GKJH 5BN5A 5KG4A 4A3DG 2GPSA 1OXXK 1Y8PB 2YU9B 2UXDL 2FJ2A 4LF6L 3GIQA 4G3IA 2E8GA 1J6QA 1F9PA 3MWDA 4TKOB 5EBCA 2K04A 3DMUA 3CXCA 1G2SA 4DV0H 1I3QH 2A8VA 2NUCA 1HNXQ 1PFNA 2RCNA 4V190 4A3GG 4JOIC 3JAMi 4M7EA 1JX4A 3NEMA 5CBEE 2IP4A 4A93G 1IW7D 1R9TH 4WD3A 5CBAE 3VR4A 1PH5A 4P2CB 2B8FA 4JVZA 5KFCA 3T1HL 1B9NA 3N6XA 3TS0A 1X65A 1Q3LA 3AU7A 2E76C 3K0XA 3M85A 2DZDA 3KJOA 2L0CA 5JVLA 2K5QA 2F0MA 1KABA 3PUYA 4C5BA 1ICFB 4G7OC 4HMIA 3JC66 3NUCA 3HS0C 1SNPA 4LWCA 4QUCA 3S1QH 1KJJA 3K3VA 4NW2A 3M4OB 4QW9A 3RUZA 1E4EB 2DLNA 4L5RC 3T16A 3RUPA 1SNMA 4KMUC 1Q7YC 1Z2PX 2I8CA 2JA5G 2JN4A 1HQMC 1MSHA 3HOVH 1I50A 3EPIA 1O75A 1WH2A 4J9KA 2JA7G 1QJOA 5CV6A 4HAEA 2K03A 4XYMB 2VW9A 1MSGA 1F2LA 1DOLA 5KG0A 4ECWA 2F3IA 2DY8A 2JA9A 3OTOL 4L63B 3E9HA 2IMWP 1JIHA 4R8IA 2K5DA 3J80W 1S03G 1E24A 2JK8A 3RR5A 1FGBD 4HMJA 3STBD 5IYBG 4AIMA 2NVYH 3H0GA 4KY7A 2AHOB 2QDLA 3I4NG 1JOKA 2W6OA 4DR5Q 4HR7B 4C3JH 4P73A 1ONLA 3O13A 1S0OA 5KFPA 2WV6D 4AQYQ 1XNQH 5J22A 5C44H 1WJJA 1BCPD 2R93A 5NUCA 3TINA 3VYUA 5DQHA 4X65L 2ENBA 1GUTA 2PMZB 5CGKA 2A73B 1Y8NB 3A8JE 2JA8B 5KFTA 2IPKD 1TWHH 3LX0A 3VR3A 1K3BC 4YCVA 4KHVA 3GTPB 1XMOH 1T94A 1SMXA 2XTIA 2YV5A 4IUNA 1SNDA 4J9NA 1EEFD 1TVXA 2L15A 3R2IA 1OTCA 5FO8B 5ELNA 4KKUA 2F0KA 1QCBD 1TWAH 5D1OB 4XZ3B 2UXDH 3OHXC 5C1OA 4LF6H 1LT5D 4B3TL 1EUCB 2FXQA 4RMFA 4PZ7A 2F4VL 3RGZA 4C2MH 1I3QB 5IWAQ 3ULJA 2W7PA 4OX9Q 4ZQ3A 1IBKL 4B3SQ 3G8CA 2EYPA 1HUNA 1ZETA 2Z4IA 1R9TB 4G4KA 4LF9L 4DNTB 3K5IA 4A3JG 2C00A 4ODGA 3A56A 1WTRA 3T1HH 4WBNF 2XSCA 4YP3A 1SE2A 2UUAL 2RCFA 4LK1C 1LTBD 1AEXA 1AZPA 3KBGA 2VB2X 4RH6A 4G57A 2E5LH 2EYJA 3N8DA 3GDEA 3HP3A 4B9WA 4JV5L 1D1IA 2V59A 3S1QB 3R23A 3MTSA 4OWXB 1VQHA 3TZUA 1H9KA 2VQEL 2NBFA 3CC7A 2CH4W 1KC7A 2IT1A 2HIXA 3HOVB 3VPCA 4CC5A 4JI6H 1N56A 1PRTD 1D5XC 2JA7A 2RDHA 3IRBA 2RHSB 3S16H 3HOZB 4O1NA 3V96A 4GC6A 4K0KQ 2VB3X 3OTOH 3RV3A 2BQUA 3BDLA 4FF4A 5KFEA 1OXVA 1VQAA 2EYLA 2XGPA 2IHFA 2R7DA 3A5UA 4A3MH 1DXMA 2JQOA 2K5WA 2UXCL 4J9LA 3CD6A 1YNJC 2F0QA 1H9SB 2UVRA 1S72A 5CA1F 1I4PA 2VOBA 2ALYB 3MFIA 1Y1VA 4ID6A 5C44B 4IHJF 4RCNA 1JDBB 2N3SA 2ZDGA 1EYCA 3D3RA 4IRKA 1T3NA 3A55A 3TN2A 1YZ6A 4X65H 5HY6A 1AN7A 1QNKA 3MR2A 1H9RA 1TWHB 2WDTA 4EBDA 3NQTA 3Q1KA 4FM9A 3VYTA 2E74C 1TT2A 3TREA 2R3ZA 4O4LF 3T5JA 1LLRD 1K0SA 1A0IA 1EEID 2O5JC 3HBLA 1DCZA 4CJ1B 1BNCA 1GUOA 1TU2B 2AMCB 2CKZB 2J6TA 5IGGA 1A6XA 1Z7TA 4IPGA 4O4IF 1TWAB 3HKZG 2RVLA 2JEIA 1V1OA 1ASYA 5L1JA 4R8NA 2KEDA 1ESRA 3MZ5A 4C2MB 4B3TH 4Q0FA 5I47A 4DL6A 4BY1G 1YNND 5ELFA 1S68A 5C5LA 3E5NA 1L0WA 1YJWA 1QZGA 3RAXA 4DR2Q 5IOCA 4RZRA 1CKOA 4ECYA 2C2EA 4LF9H 2J7ZA 1JDEA 3NBIA 1ZEQX 4ECUA 3TMEA 5EPJA 1PZKD 2Q2UA 3RF2A 3I72A 2XWBB 1VDZA 1O80A 2UUAH 3RB6A 5FK9C 1HUMA 2DNCA 2EE1A 2FMMA 3NTKA 3PMFA 1LV9A 4UCVA 3GV7B 4ZRZA 2NZ1D 1PVOA 2LXKA 5IP7G 4LF8Q 1AUVA 2Q8IB 2D9UA 3BVMA 5IYDG 5C3WA 4BBSH 5LMNQ 2VQEH 5JEAJ 5KYLA 3BVGA 1LTRD 2K32A 1JWUD 1RJPA 2KCNA 1B7YB 3B6YA 3JSLA 1U9RA 2FLLA 4V0BA 2B2UC 3PIP3 5M9OA 1E4GT 5KFNA 3H4BA 4JCVE 1UNNC 3GP7A 2KHJA 1HJPA 3A8KE 4K6DA 3CCQA 2MQHA 3C46A 4EYHB 2SDFA 4B3RQ 4A3MB 1IBLQ 2RQXA 4PMBA 5JVG3 4JI4L 2UXCH 4LSAA 1SEIA 4HIKA 4YR2A 1PTOF 2KCMA 5FPRA 1B3QA 4LF5Q 3NK9A 4C3HG 5FD6A 1I94Q 2NVXA 1K9MC 3HOYH 4X6AH 4O3RA 4YHHH 1Y14B 4J6HA 4NXMQ 2XCPA 3QOJA 3T13A 3SK8A 5JEAH 4K5VA 4JI5L 5CAEB 1AUXA 5FKAC 1HR0L 3S14B 2YTYA 2HD3A 4QY7A 3PO2H 1SLJA 4DL3A 3KXYT 4NXNL 1LT6D 2VQFH 4RB2C 1WCMH 2O4XA 5HGQA 2WKDA 4HCSA 2OEOA 5T1GA 1EUDB 4IPHA 5ELEA 1KNEA 1KLUD 2PNRC 5TSSA 4X62L 2Q8RE 4EFBA 1KD1C 3K5OA 1JQYD 1RYRA 3PF4A 2W9BB 4JI2L 4O3PA 2R85A 1R4PB 3CRKC 3H20A 5A2QL 4RNOA 4A3KH 3HKZA 4EVOA 4JI1Q 4OEMB 1KJ8A 3VYSA 3AYHB 2F4IA 4QCLA 2B8GA 2IX0A 3K59A 1D8LA 2F0IA 4FO2A 1N34L 1XXGA 2L12A 3MA2B 1F2ZA 4UCOA 4O2DA 1ENFA 1F2YA 4C56C 3H3VI 2FK3A 2W57A 1XYIA 4EBCA 2W6ZA 4OIKA 2HCCA 3SVMA 1TWFB 1WR2A 4OXPA 3DEOA 2B63H 1FR3A 4H02A 4IUPA 1YITA 2V9WA 4LMQD 1T9HA 2K7VA 3UDXA 1YHBA 4BXXH 4MAMA 1MI2A 3DLLA 1KNAA 2A1AA 3FKIB 5IT9L 2MJ8A 1PDQA 1WD0A 3A7AB 2FPIB 4GNXB 5KFXA 3SE0A 2B3GA 3S17H 3HOUG 4BBSB 3KAJA 1ENAA 2W70A 1CA6A 1FD7D 3MXPA 5CV5A 2EJGC 1WTVA 2R7NA 3QO2A 3K7AH 3PO3G 3QFFA 2C9OA 2Z8LA 4NPSA 1K8MA 3X3NA 4IR9A 4QUFA 2F0UA 1Q46A 3U58A 1HPCA 3OPOA 5G3LD 4BA2I 4RUAA 3DUZA 1L0XB 2R7FA 5FLXE 1N32L 1TWGA 1VQGA 4QWBA 1K3RA 4JYAQ 1JKJB 4RG1A 2YS7A 1EL0A 1YVCA 5DLGA 5KIXA 4A3CH 2Q2IA 1PFSA 1PLFA 2UU9L 4LNQA 2C28A 5C3EG 3PW0A 1HHVA 5GONF 4DV7L 3U50C 3AEVA 3T5KA 3URYA 3HKZE 1XNRQ 2F0LA 4I7HA 2V4QA 3GTOA 2RDIA 2E75C 4ABNA 2UVWA 5JPMC 4P74A 1TS4A 5LMUL 1Y8OB 2JEAI 3MXNA 4JI5H 4OWTB 1QG7A 5M5WB 1V1QA 2OQ0A 3KF6A 4DF7A 3S1RH 1VQ4A 2D5DA 3PO2B 4TQRA 1HR0H 2BE5D 3UE1A 1QOHA 1WCMB 1GSOA 4NXNH 2UXBL 3I56A 2HVQA 4DU9A 2F0OA 3P7JA 1CFMA 4GC7A 2KVMA 3GTKA 1AH9A 5C4JH 4HNVA 4RGNA 4CJ0B 2ZXOA 4A3FH 4X62H 1EYGA 3NHHA 3BS1A 3RZDH 4GKJQ 4XQJA 3CW2C 4DV5L 4A75A 3FMAA 4A3KB 2KA7A 3T4AC 2ZDHA 3SGIA 1I4RA 3I4MH 4I7ZC 5DQGA 1SCUB 1DD2A 2I5LX 3RD4A 3RMHA 4F4WA 1N34H 4DV0Q 2D2CC 4KD4A 3J7YW 1KTKA 3IKJA 2JSOA 3J80L 1JLLB 3ETJA 1QVCA 1CE8A 2AGOA 4JI7L 1GVPA 2FMAA 4JI0L 2QGQA 2F03A 1WYDA 5KG5A 3HB9A 2J9GA 4BY7H 4ZHQF 2Z0SA 2PO4A 4L5TA 3V6KA 1Q90A 1I6HB 4CHTB 4J9OA 2NVTH 3QWNA 5KFWA 2R7ZA 4A76A 3DWAA 2QKIC 2R92H 3NTHA 4IFDG 1LTTD 1NSNS 5DG9A 1Q8IA 3P20A 5KYIA 2R84A 2Z6BA 3MAQA 3RAQA 3BJUA 1MD2D 4HYKA 2KUMA 4RA8A 2D0PA 5DEHA 2R8KA 1VAJA 4XXEA 4F4XA 1O7YA 4HNUA 3X3MA 4HIDA 4UCTA 1JB3A 1ML0D 3GTGA 1A62A 4ECXA 3N41B 4L8JA 5KFBA 1JJCB 1NUCA 2R7KA 1D6EC 1OWTA 1N32H 4NDXA 3C3LA 2KJXA 1I4GA 4L6TB 2JA6A 2D0OA 4DV6L 3D6WA 1PH8A 2NN6G 4CKBA 3J81E 4OL7A 1KDAA 5EKLA 4IOAA 4Y7NH 4GN5A 3OUUA 3GIIA 1ZQ7A 4XQNA 2NU8B 2UU9H 3FPPA 5M3FH 2O2LD 4DV7H 3N40P 4M9UA 2NN6I 2OCEA 2EZVA 3M9NB 2F1MA 2DGYA 1B2TA 2NUAB 3PUZA 5LMUH 4O2BF 3S1RB 5ELBA 3GIPA 2YU9A 2PZWA 4DKAC 3J81c 3S2HH 3FDSA 2UXBH 5CMDA 4C3IH 2KBNA 4UHVA 2PZTA 4A3FB 4LF4H 4X64Q 3RZDB 5C5JA 4OO1H 2DPIA 3BQ2A 1SXTA 4B3ML 1GHKA 1B6RA 1ENCA 1N33Q 4DV5H 3C2PA 1Q81C 3HOXH 3I4MB 1HA6A 1EY6A 4WJ3M 4EX5A 4ILWA 4JI3Q 1YJNA 3M7GA 4JC0A 1ASZA 4L1KA 4MV9A 5KFDA 3MHBA 3FP9A 3K5NA 4IALA 3MFYA 4JI7H 3E0JA 4KJNA 1E4EA 2I87A 2HDLA 4LUVA 4JI0H 4ALPA 2K1BA 5M5YH 4BY7B 1H9JA 3EVQA 4HJ8A 1EY0A 4ZK9B 4DXGA 4HEDA 4DV2Q 1PH7A 2NVTB 1B04A 5F9LA 3EPGA 5E4XA 1STYA 2E5LQ 4ME3A 3HOZG 2R92B 4Q5VA 4J1MA 2X69A 1AFPA 1FJGL 4MV1A 4BBRH 2RDJA 2PBZA 1S5FD 4YAKB 2BDNA 4LAAA 1FNUA 3KLSX 3H6MA 2ZJRA 4PQXA 1ZHQA 2Y0SB 3FRPB 4DUYL 3OOCA 4IPDA 4ZOLF 3OHBA 5E7NA 3EJIA 2R7MA 5LXTF 1XTCD 4JI6Q 1PTOB 2A6HD 3H09A 2FMCA 1SAPA 4UP7A 4HR7A 5K2MA 4PMWA 2HHHL 2FFKB 3D31A 1I7NA 3A8IE 2H1EA 1CSPA 3L0OA 5EPLA 3OTOQ 3G6EA 1UC9A 1I7LA 3K6OA 1C3OA 1NR2A 2EQSA 3RN5A 2XC9A 3U4ZA 2PMZA 1X6OA 3H0GG 3CQZB 3EQLC 4PV1C 5JPNC 1DOMA 2ASBA 3WO1A 1JICA 3FPUB 3BA8A 1QVFA 3GTPA 4NLGA 1B53A 4F4YA 1EZ8A 2EYFA 4RHSA 5DM73 3VA7A 3R5HA 3M9MB 1BQQT 1Y1WB 2AUJD 3CP0A 2R93G 4JUZA 1G2TA 1XMQQ 1GGOA 1QILA 2PW5A 2C5CA 3NE5B 4DR4L 2FLPA 5KT4A 1DJRD 2DUDA 2OQKA 3UDFA 4PZ6A 3LP8A 3H94A 1UWVA 1IBML 4JV0A 4Q44A 4FF1A 3F2UA 3OWEB 3J81W 4R4OA 3L7ZC 2UUCQ 4QL5A 4C3IB 4GKKL 1I3QA 3JAME 3KOJA 4A3IH 1H9MA 2EJFC 2F0SA 3OSPA 3Q8RB 4F4ZA 5LL6b 4ED0A 1IL8A 1GM5A 3AFQA 1R9TA 3G4SA 2W6QA 4KV6A 3BZKA 4X66L 4B3MH 1XJVA 1D5ZC 1JB7A 3IFDA 1KRSA 4FBTA 1J9OA 3CF5A 2ZJTA 3BDCA 4GOPC 2PPBC 4ED3A 3RLOA 4JPBW 3V4SA 4ZYSA 5K36G 4B3TQ 3NENA 4GN3B 4O3NA 3ERQA 2B2TC 4CJ2C 1U0LA 4K8IA 2EOTA 2L9HA 1MBYA 2DJFC 1F9RA 3JAMc 5LMNW 2G9DA 5BPHA 1N48A 1JXLA 4I50F 1VQIA 2R61A 4DNRB 1UAPA 2HIVA 1LUZA 1VQ7A 5L9XA 2KSWA 5IYCH 2EVBA 3Q8PB 4RWSC 2UUAQ 4K6LA 1ILPA 3Q24A 2PMZE 4GLXA 3FVQA 3S1NH 1YI2A 1IOWA 2OH2A 3NWSA 5LA6F 4RCOA 3J7ZC 4DR6L 3DWQA 3UDIA 5CR3A 5KT6A 3A5ZB 1FJGH 2RGRA 4X3TA 5KFUA 1U4MA 3NTIA 4K2LA 4A3MG 4TQUS 4A3EH 2WB1B 2CZGA 3E5SA 5D14A 2VQEQ 4FBUA 4DUYH 5EWEA 1F9QA 1H9SA 2A68C 1IYVA 3PW4A 3TDQA 3VR2A 4YQWA 2OTJA 4EGJA 4YR0A 2HHHH 3KBXA 4H44C 1MJCA 3K0YA 1SROA 2OT2A 4ZKCB 2QK4A 4RFBA 4TSSA 4IAJA 3R8BA 4O3OA 4A2AA 1VQEA 1M90C 2QEXA 2PNHA 2E2HH 1TWHA 5L1KA 1X32A 3T1YL 1DZ1A 5C4XG 4AYBB 1K8OA 1RK5A 5M3MG 3UFXB 1HXYD 2XGTA 1Y1VG 4YHHQ 5JAVA 4J9RA 3F2BA 3CRLC 4B08A 1HZCA 2GPWA 2NZOA 2ATWA 3BG5A 3ULLA 1UE1A 1DV1A 3I91A 3NQIA 4IJLA 1HNZL 1TWAA 4DR4H 4A2BA 3ZJYC 4EQPA 1E4FT 3RB4A 1IBMH 4A3BH 2Z6KC 4C2MA 2FKLA 2VQFQ 2VXWA 3Q23A 4A3IB 1KHIA 5LYJF 4IUUA 4PZ8A 1YIJA 4GKKH 2K5HA 4A3LH 2YTXA 1I50H 2LMCB 1JWSD 3U9SA 4K8JA 4R9WA 4N9PA 2CCZA 2R6GA 3PCOB 1SNOA 4X66H 5J39A 4LFAL 3N52A 2EXZA 5JJZA 1GHJA 3GLKA 5BPFA 1W2BA 2Z9HA 4QMGA 1SBBB 4P75A 1S40A 3TP8A 5FD5A 5AJ3L 2GLTA 3FKIG 4ZUJA 4YY3Q 2IHEA 3JAMW 2DN8A 2ZTCA 3SXHA 1GKHA 2QA4A 2OWOA 3Q8DA 4N9TA 4YR3A 2WKCA 3MWYW 4UY8C 4DR7Q 3DM1A 1VCIA 1EYZA 4DR6H 4WJ4A 3EBEA 3NGDA 3HOWH 2C35B 2KEEA 2Q8TA 4ED2A 5KFOA 5D1PA 3A7LA 4A3DH 2A69D 3A74A 4BWGB 4O3QA 1B6SA 4MIUA 2XCAA 3RTXA 3MXGA 5KT5A 2K50A 4UFZA 2FHTA 4M8AA 5IGBA 4BS9A 4DR1Q 2HCIA 2WE6A 4Q45A 5BR8Q 3BU2A 2NVYB 2E2HB 3PO2G 3KTMA 3NP8A 3FHWA 4NP5A 4A3GH 2SOBA 1UNSA 4U7CA 2YTVA 2IY5B 3T1YH 1G51A 1STHA 4C3JB 3S15H 4A93H 1EZ1A 2CQYA 1K28A 5DGBA 2HGSA 3AQQA 1JJ2A 2R8IA 1WTHA 3K5MA 4IPCA 1CI3M 4UCRA 2W9BA 1STBA 1RDPD 4DL2A 1RJTA 1TAEA 4NMZA 4JI5Q 1HNZH 3EIVA 1FL0A 1B9MA 2UUBQ 4A3BB 5LP6F 1HH2P 4R4QA 1M7JA 3HRZC 1ILQA 5KG3A 4HSVA 4NXNQ 3T5LA 2VS1A 4RKLA 1DYQA 4DR5L 1EFID 2EJMA 2W9AA 4MTEA 2AGQA 4QB4A 3SDZA 1X54A 2JA5H 3G6VA 3LWEA 3I70A 4AQYL 2K5NA 2JA7H 4RZQA 3T56B 2MP1A 1RTNA 1TWFA 3R5XA 4Y8VB 4LFAH 3F2CA 4DK1A 4BXXG 1IW7C 5KFRA 3GTJH 2N49A 2VA3A 3U4VA 1X3FA 5LHY1 3P75A 5IYBH 4ED6A 3HXLA 1BGWA 2KQ3A 2F4VH 3FKIA 1Y69U 5FPOA 1RYSA 3D6CA 3I4NH 3GIMA 4ECSA 5CV7A 2YCHA 4GNXA 3U9TA 1IBKH 1G6ZA 5C0XG 4P72A 1VF5C 4JI8Q 4RHRA 3K8AA 3RB3A 2OF1A 2QCPX 2VUGA 5KFMA 4OONA 4HIOA 1RTOA 5C0XI 4F87A 4YB8B 4FXKC 4R1JA 4R7RA 3U9OA 4FP5D 1HNWQ 4POGA 1KIXA 5IWAL 4JV5H 5EQ0A 1O7LA 5CYUA 3W1BA 4OX9L 3KJPA 4B3SL 5G3LF 1TWCH 4EQNA 1BCPB 4LFBL 4EEQA 5IGDA 4BA1I 3L2PA 4WORA 4A3DB 3STBC 4DLKA 1SDFA 4FNFA 3C0FB 3CMEA 4LSXA 3BQ1A 3AB9A 5KEEA 2VL6A 1O78A 4JBKA 3S16B 3MWEA 2JP1A 3BAAA 2G9HD 3DM3A 3CAMA 2EYOA 4LF7Q 1YNXA 1JCKB 1Q8KA 1G91A 3WDNA 4A3GB 1K0RA 1JWMD 3IL8A 1TXYA 1RJRA 1BCPC 2R8HA 2YRWA 1ZXTA 4ZLTF 1N36Q 4ED8A 1J5EL 1WCMA 5KRUA 3NXWA 3OYYA 4XYQA 4A3JH 1IL2A 3GTQH 2EYMA 2PI2A 4PNYA 4Q43A 3MR6A 2E2IH 3K57A 4DV1Q 3E9IA 5M5XH 3MFGA 4TQSA 4FDBA 2LS01 3TSSA 2R8JA 2CQAA 2QDBA 1SSOA 3F1ZA 1EQQA 2TSSA 5H80A 4O0AA 4K0KL 4H13C 5E3FA 4TV9F 1X56A 3L4JA 1L2ZA 3NSWA 5EPKA 3EN2A 4DV3Q 3S1MH 4CDCC 2RKSA 4AH6A 2NYZD 5T1IA 1EQTA 3D0FA 1OO9B 1HTLD 1SMYD 1EYDA 2JA5B 4DR5H 2ICEC 2F0PA 4LF4Q 3KHGA 4LFCQ 1S5BD 3M9BA 1JT8A 2HUGA 4DV5Q 1B1ZA 5IODA 1KXLA 4YJ3F 2IX1A 5C1PA 1SEBD 3GTJB 1CQJB 1I4QA 3BYYB 1PK8A 4Q8EA 4DA2A 5KG6A 4ZI7F 4QF4A 3TQYA 3NPPA 3I4NB 2H5XA 1FYCA 1HTPA 3TRZA 5JVH3 1C9OA 1SJHD 5C4ZA 1G6PA 1EU3A 2NVXH 3R2TA 3V6HA 3ND9A 1TS5A 1B33N 5KG2A 2B2VA 2F3WA 4C1NI 2F0GA 1HA5A 5DLFA 3GO5A 3PW7A 3KUPA 2R7ZG 1X55A 4DL5A 3D4DA 1CKNB 1PRTC 3OIPA 3JRXA 3CU7A 5COYA 5IWAH 1W3SA 1TWCB 2PI2E 1LTGD 2WAQG 4B3SH 4QWEA 4LFBH 3J81L 4KTAA 5CC4A 3EA6A 5C4HA 1V4YA 4ECRA 4IR1A 1HZAA 2BCOA 2B29A 2B2YA 5KGUA 4MV8A 4DR3Q 3RBEA 2K33A 3UI2A 2NVQH 4RNNA 5DGAA 1GO3E 1LTLA 4YBZB 5IP9G 1Y1WG 2VNUD 1PH1A 1M1KC 5KT3A 4RB3C 4ME5A 1GUWA 4PDBA 3OW7A 4LJZC 1N8RC 5T14A 5C8YF 4BY1H 2JA6G 4ETSA 1QNUA 2IW3A 3KLWA 3R3OA 4LF8L 3C1EA 2CW0D 4JI4H 2RF4A 4TRDA 1J5EH 1BDOA 5LMNL 1VQFA 3GTQB 4DUZL 3HOYB 5FJ8G 3H91A 2E2IB 2ZM6Q 4OO1G 1I6VC 1BF4A 3HEJA 4JV2A 3H4DA 4KY5A 2V4DA 1QE6A 5FLXc 3HGBA 1A63A 1U4LA 2XIWA 4K0KH 4IUTA 3W5OA 1AZQA 5KFLA 4B3RL 3LGJA 1IBLL 4OGQC 1KDCA 5IP7H 4UP9A 5IYDH 1VQPA 3OW2A 1PA6A 3OSNA 3RGXA 1VQJA 4ECVA 5HGTA 4LF5L 1WI5A 1LTAD 3TP5A 3I4OA 1I94L 3GQBA 1NY4A 2F52A 4X3KA 3UQ8A 1YNNC 4NXML 5FO9B 4JI2H 3R93A 4FVMA 3S9WA 2JE6I 3G6YA 2F0VA 1YBYA 2HQEA 1PTOD 2CW7A 2FP4B 1CK1A 3W1GA 1G291 1RHPA 4J0MA 1RKNA 5BMVF 2R92A 1EIGA 3HKSA 4HTHA 1MHWC 1K83H 1CQIB 2R7LA 4C3HH 1HFNA 2WFWA 1BBXC 1H95A 2EY5A 2A6ED 2Y0SA 3CCRA 4R8UB 1RODA 1KC8C 3EYYA 3LWUA 1TS2A 2B63B 3I7FA 1SNCA 1VS0A 4ECTA 5I6YA 5I2YA 1W93A 3GTLA 3TZDA 2HT1A 4JI1L 1PXUA 4EGVA 5KKNB 2J6SA 4U6PA 3PN1A 2M9VA 1WD1A 1K8AC 2EIFA 3S17B 1CUKA 3GTKH 1RJQA 2WAQA 5KFZA 3CQZA 1SYFA 2PN1A 1AN8A 3K7AB 3OIQA 1NMFA 4DV4L 4IWXA 2IBKA 4IFDI 2YZNA 2B2WA 1PH3A 4IZ8A 4JBWA 1LABA 2QYZA 4E6IA 4G7HC 2HHHQ 3H3VH 1EYAA 3SK6A 2FPPB 1Y1WA 1SN8A 4JK1C 1SYEA 2SEBD 3TQTA 5HBRB 1PFMA 3OSOA 3M4IA 2SNMA 5LL6X 2JA8G 3JZIA 5KG1A 5FLMG 4N8FA 4HJ7A 1SE4A 4ZAIA 3ORQA 2B2TA 3VDYA 4HCEA 3JAML 4I65A 1PV4A 5BN3A 3OMCA 1LTSD 4DUZH 2L11A 3PUWA 2CW8A 3PGZA 4JOIA 1XNQQ 2K6AA 2W8LA 4EGQA 5KFYA 1TKWB 3I4LA 3Q8QB 1QUQB 1SMYC 2BQ3A 3K58A 3MFHA 1BO0A 1GLVA 5FLXW 1P8LA 3UE0A 1IZ6A 2ZTEA 2HQLA 1VQMA 4JYAL 4B3RH 5JOBA 3FEWX 2N88A 1S5DD 1K73C 1IBLH 1NCVA 1XMOQ 4QIWB 2Y0SE 4ZCKA 3W2DA 4EYIB 1CM9A 5C4JB 1U4RA 2IWHA 1YJ9A 3A0JA 3PO3H 4LF5H 2K14A 3HG9A 3M9OB 1I94H 5J2TF 5I2XA 1XNRL 4I4TF 2DJGC 1A3UA 2JJQA 4JBJA 1GOZA 1ZYRD 5DLQE 2M05A 5KT2A 2XN9C 1UEBA 2Q2HA 1GUGA 4KHZA 5IGFA 2UXDQ 4X3SA 4LF6Q 1V9PA 4DAYB 2WAQE 1N9WA 1M0TA 4HIMA 3IN5A 4H0LC 1K83B 4DAVA 4J9SA 2CQOA 5CV4A 2I07B 5C3EH 2LFNA 2WB1A 4RKBA 4O2AF 1PHJA 4DK6C 5KNDA 1B3AA 3HFZB 2N55A 4TVAB 4GKJL 5EWFA 1NMGA 1WOCA 2W8KA 4IRCA 1TA8A 4J9MA 3HOVG 3T1HQ 1VQOA 1S5ED 2ASLA 2PCFB 2PQAB 4YIJA 3CMAA 2W71A 5EWGA 2AUKA 1X3EA 3QZ8A 4JI1H 3MEHA 1WFQA 4F50A 1E2ZA 1L2FA 1TR5A 3ICEA 2F0DA 1W6KA 3KLRA 4CKEA 1PH6A 3QB3A 4IRDA 4DAMA 2F0NA 1D2BA 5KFAA 5DNFA 1WTPA 4MV6A 1V1PB 2CWAA 4L5QA 1KRTA 4C3JG 1CTMA 1EY4A 5EBDA 1GSHA 4AYBA 1A3VA 3Q6SA 4DV4H 2V5AA 1STEA 3ERSX 5IGEA 1ULZA 3CC4A 5C44G 3SE7A 1T5EA 4NKLA 2RDGA 5IGCA 5IE8A 3I12A 1RIPA 1BBWA 5D3DA 3GTMH 4PMCA 4LW1A 1PH4A 1E1OA 4KHPL 4OHJA 1BCPF 4DV6H 4Y7NB 4E4TA 3GILA 1Q1BA 5KNBA 1EHIA 2LKVA 2OXPA 1CHPD 5M3FB 5KFHA 1V8QA 3K3PA 3VA5A 4A3LG 4J9PA 2BE5C 3H3VC 1AE2A 1NE3A 1RF2D 4CKCA 3PF5A 1A9XA 3GV5B 1NTGA 3KFUA 1ZHSA 1DIKA 3F2DA 4O42A 2NB0A 1SFOH 2X6GA 4X65Q 4HSPA 2F0EA 3GV8B 1GUSA 4LMYA 4RGMA 5D1OA 4GOPB 5JQWA 2YZGA 4J9QA 4JYAH 3J80i 2WB1E 1EOTA 3S2HB 1KJ9A 1GYFA 1M0WA 4RAYA 3WO0A 1MJEA 4HQ6A 4A4IA 1S0NA 4YWLA 3ZYYX 2E2DC 1EIYB 3N43B 2AQ4A 3K7UC 4DK3C 5C5MA 5DG8A 2JEFA 2QEJC 1E7ZA 1XNRH 1WSCA 3I90A 1EY5A 4KN4C 1Q82C 3HOXB 1UE7A 3KLSA 5GAGC 1VQ5A 3NWTA 4MA0A 5EDWA 3PZPA 1B8AA 2QW7A 1XTDA 1YNJD 1F2MA 2P0AA 1ET6A 1DV2A 1Z6HA 4RGTA 3TEHB 5GADC 1GJXA 2M00A 2F4VQ 1IYJB 2SCUB 2NN6H 1Z9FA 3LMLA 3D8GA 2J6UA 4FS2A 5C3EB 3GTPH 1JJGA 1IBKQ 1UC8A 3CCEA 3RN2A 3NELA 4X64L 3NBHB 4LF9Q 5M5YB 4WFN3 4C5AA 5KG7A 2N8NA 1HZBA 2EY2A 3PIO3 2A19A 2F0JA 1N33L 2I0QA 5DG7A 3M4PA 2VUMH 2ATLA 4R4CA 2F3VA 2YYZA 5I9OA 4LUZA 4BBRB 5D65A 4JI3L 4RB1A 1PRTF 4JV5Q 3GIKA 1NJIC 4IWYA 4L5SA 2KHSA 2NVYA 2E2HA 2C22A 4IJHA 1NBWA 3KF8B 3CCLA 4EBEA 1VF7A 4QWDA 2RSNA 3PUVA 2K5VA 3MVVA 5IIFA 1KJQA 3W3AA 4DV2L 4HN7A 1VMPA 1SYDA 4K2KA 1XPOA 2LSSA 2E5LL 3GTMB 1DONA 1EUJA 2BDOA 2GVAA 3HZXA 2I5HA 2MNAA 5BN4A 3KYHC 2MO0A 4EQOA 2FK1A 3BVZA 3G48A 3CKIB 1WTQA 4KHPH 5A35A 2PZUA 2UXCQ 2B39A 4FU0A 5JVDF 2W9CB 4IZOA 2EYHA 1A3TA 4APMA 5EZYF 1EOVA 4IN3A 4JI6L 1S5CD 1VQ9A 3IAYA 3H40A 3E0EA 1HCZA 1WTOA 2NU6B 1EY7A 5KFSA 1U4PA 4FF3A 2JXMB 2OTLA 1SFOB 1BXTA 1VQ8A 3RFCA 3TP6A 3HOZH 2NTTA 4XDXA 1F9SA 2GN5A 4N8X1 1MKHA 2YYAA 2F0TA 2MO1A 4XT1B 1ZYRC 2EDGA 1L1OB 3V2TA 3VMMA 1EY9A 5E4WC 5EKIA 2HJWA 5K5PA 4CDDC 4TV8F 3PW2A 3QZ7A 2PYKA 1CS0A 4CC6A 1D1KA 4J15A 3I3CA 2ES2A 3KK7A 1XMQL 1BNZA 2UVUA 4DL4A 1CZGA 1L1OC 2YZMA 2B2UA 3H0GH 1HRJA 2UUCL 3DHQA 4BWSC 1VQCA 1JOOA 2KOLA 2W7OA 5KFQA 4LH6A 4RUCA 3KDFB 5DM63 1RD9D 3GIDA 1E2WA 3SEBA 4BBSG 4QWAA 4X64H 3QR8A 1SR3A 2VQDA 2R86A 5KT7A 1FNVA 2VUMB 2R93H 4GLVB 1N33H 1O7ZA 1R4QB 1JE5A 3S1NB 2FPGB 1PZJD 1PYSB 2A6HC 2NZHA 4OIJA 1E0BA 4JI3H 1YHAA 1CQVA 4A3EB 5CA0F 1F77A 4RAZA 4MZ9A 5KFGA 4POFA 2XWJB 5J1ZA 3WOEA 1WVLA 1HNXL 4QWCA 3H15A 1VQDA 2MFIA 3SK5A 3QJYA 4LFBQ 3G7LA 1MIUA 5KX5F 4RAUC 3HOYG 3WNZA 4FF2A 1LYLA 1E1TA 1WTWA 4DV2H 2FJZA 3I73A 5K36H 5JEAG 1T5XD 1QVGA 1CZWA 2VY3A 2XRSD 3PV0A 4CGYB 3PIPA 2WYOA 2L1BA 3ORRA 3MC0B 3LWBA 2BH2A 3GIJA 4WRDA 2R8GA 1B70B 1IYUA 4JV1A 1LTID 2DWCA 1X3QA 4JI4Q 4R4TA 1WCMG 1J5EQ 2VR1A 4MV4A 3Q0AA 5I9PA 3OMGA 3PR5B 2JA5A 2DY7A 3RBDA 1STGA 2C2RA 2GA4B 2O03A 1GUNA 1Q86C 4KY6A 3RV4A 3PVXA 4KKSA 2XGQA 4A3KG 5DQIA 4RU9A 4CDFC 1HR0Q 3GTJA 2BA0A 3M4YA 3BZDB 5KFKA 3AFPA 2I5MX 2ZXPA 3OWFA 3TIIA 2HVRA 2F0WA 3L9AX 5EAYA 3FMCA 1VQLA 1I50B 1IKMA 1DM0B 4X62Q 3DWPA 3N6RA 4YHHL 1Z47A 1OXUA 4JI2Q 3K80C 4GLAC 1ESFA 3QIAA 2B63G 1XMQH 3QOLA 4U68A 1L0YB 2F0HA 1KEEA 1ZKOA 3WOFA 2M2LA 1PYWD 5CV8A 5J3BA 3H0GB 4R4IA 2CVRA 4M1UB 3KAKA 3E3XA 1QWYA 4KJOA 3S2DH 3S14H 4FS1A 5FOBB 4UAIA 1N34Q 1KQSA 2VQFL 3BG3A 2L5TA 1LT3D 1CKNA 5C4XH 2UUCH 3I8ZA 1GSAA 1JMCA 5M3MH 3CCJA 1TWCA 2V4RA 1Y1VH 1OXSC 2WTFA 4XQQA 3RLFA 1VBHA 2R93B 1QZHA 3F8NA 3L4KA 4KKTA 5KFVA 2ID0A 4ULLA 4EEYA 1V43A 1IXRA 4YJ2F 3CCUA 1JC7A 1LM0A 1E22A 4FYDA 1PYBA 2R82A 2ALZA 5J2UF 1QB5D 3AMUA 3M3YH 1RCVD 5FLXL 4YY3L 1STNA 3HOWB 1JR0D 1YEZA 4GZYC 3MXUA 1HNXH 5KFIA 1I4XA 4A3CG 4RGOS 3SI8A 3GTQA 2W6PA 1TY0A 4KD3A 2NU9B 1JORA 2E2IA 1TWFH 3D4WA 4DR7L 2WINB 4MV7A 2G5DA 3VYRA 1UUPA 3LNNA 1KAWA 5EJWA 3ULPA 2ZJQA 4FXDA 3JRWA 1E3PA 4DAPA 3E6ZX 3CCVA 1N32Q 3FKIH 4TUYF 4U673 3ETHA 2MHVA 3G6JB 5E1FA 3KALA 3S15B 4A93B 2UU9Q 4DUZQ 4DV7Q 5L37A 2FK2A 2I46A 4DPGA 4A3FG 5F2DA 5I4DA 3DF7A 1OXTA 2QF7A 1PFBA 5ISRA 3BJYA 4XYOA 4GS3A 3BZCA 4IURA 1MGSA 5LMUQ 1FVIA 2K28A 1ET9A 4DR1L 5JJKA 1FGUA 1K8GA 5BR8L 3I4MG 2J0TD 3CHBD 4I55F 1X3PA 4G7ZC 1K1SA 4MTNA 2C2DA 2ZJPA 5JUMA 1RK6A 4DGZA 2UXBQ 4IUQA 4PWQA 3OUZA 1EZ6A 1C0AA 2HDMA 3MEFA 1Z2OX 2UVVA 4ZQIA 2JA7B 2J4XA 1XX8A 4AQYH 4IOCA 4R8UA 4BY7G 1BXRA 2K01A 3F8TA 2B63A 1JE4A 1LO5D 4J8QA 2ICIA 3SHLA 3RB0A 3V4ZA 4NB3A 3K81C 2UUBL 3S2DB 3PW5A 2IJ0A 4F7XA 5M5WH 2NTSA 1X9NA 2R92G 4C1NK 4ZKBB 2X6LA 5C4XB 3SK4A 1IOVA 1ICWA 2Z1CA 4B9XA 1PRTB 4H7BA 5M3MB 4HJ5A 1U5KA 2AWNA 4F8MA 4Q0YA 4JI7Q 1Y1VB 4HJ9A 2Y0SG 4JI0Q 4APVA 1RL2A 2I80A 5GAEC 4DXFA 2WACA 3Q2OA 2EY1A 4WJWA 2JEGA 1A15A 3C1FA 2YS6A 3CCMA 4YAJB 5JH7F 2BH8A 3Q22A 1KJIA 1SRUA 2WIIB 4EQ5A 5C0XJ 2YL2A 1VMCA 5KFFA 4RNMA 4HJAA 1BBUA 3M3YB 2A69C 1P16A 4MN3A 2VA2A 2XD4A 4KI0A 1I5FA 2DPJA 1S0MA 3V05A 3K5LA 3N42B 2WP8J 4YY3H 4OX9H 2ZTDA 2XCLA 3CPFA 5HURA 3PR4A 4DR2L 1SNQA 3G6XA 4JI8L 1C8CA 3J81j 5M3FG 2AQ3B 2KCTA 4DV4Q 4LUOA 3RLNA 3T53B 3K5HA 3T51B 3ND8A 3VPDA 1S4ZA 2L4NA 2OLSA 1EIFA 2RGVA 4DR7H 3TS2A 2EXDA 1EFWA 4ECZA 1XPUA 1I6HH 2A5HA 1S9FA 1Z2NX 2RHQB 1QUQA 2BR0A 3ER0A 1HNWL 1BR9A 5KNCA 4DV6Q 3IG0A 3TIGA 5GAHC 2SNSA 3PSIA 1CHQD 4HNTA 5CV9A 2FLNA 1BOSA 4EG0A 1A8VA 1C4QA 5C0XH 4QIWA 3VR5A 4A3JB 4C3IG 4UP8A 1O7IA 4MTKA 5M5XB 2AWOA 3WWVA 1FNWA 4C5CA 1EIHA 3MR5A 3HOXG 1NAPA 1I4HA 1MZBA 1M8AA 1XPRA 3S1MB 4DR1H 3PQIA 4GNXC 4LF7L 4OO1I 3A54A 3I55A 5BR8H 1VKZA 4PG3A 5H1SE 4DAYA 4O3SA 1N36L 4KN7C 1IKLA 4KLKA 1SJED 1TQOA 3S24A 4OELB 2X0SA 1K83A 1M6VA 5IY0A 3J7AV 3RZOH 2RA4A 5CB4F 1UE6A 4DV1L 1DGSA 4B3MQ 2IX3A 1VQNA 2MPMA 1NR4A 4K5WA 4Y52H 2JEBI 1BJTA 3M7NA 2Z4HA 3PUXA 1I6UA 2XRQD 1D5MC 1YHQA 1TWGH 2PQAA 1E2VA 4KK7A 4DV3L 2UUBH 5LL6S 2GVBA 1W96A 2HVSA 2JEJA 5GROA 4BBRG 1HZ9A 4DFAA 1KDBA 5KFJA 1B44D 3RNUA 2VPSA
chains in the Genus database with same CATH topology
4LW1A 1B7YB 3B6YA 1E1OA 2WB1G 1W2BA 1PH4A 4LFCL 4LF4L 4KHPL 4P75A 1S40A 4JG2A 1Q1BA 3CCSA 3GTOH 2K75A 5AJ3L 4JCVE 3FKIG 1SE8A 4YWKA 2KHJA 1HJPA 4YY3Q 2IHEA 3CCQA 2MQHA 4A3LG 2ZTCA 4B3RQ 1AE2A 3CC2A 1NE3A 3PF5A 1IBLQ 1NTGA 3KFUA 1GKHA 2QA4A 4JI4L 2OWOA 5GQOA 3F2DA 3Q8DA 4HIKA 1FJGQ 4QIWE 2KCMA 1SFOH 4X65Q 4LF5Q 4UY8C 4DR7Q 1I94Q 4GOPB 1K9MC 3HOYH 4X6AH 1VQKA 3J80i 1Y14B 2WB1E 4DUYQ 4NXMQ 1EQRA 1VCIA 4AYBG 1Q1EA 1MJEA 4A4IA 4YWLA 1EIYB 4JI5L 4WJ4A 3EBEA 2K4KA 4DNIA 2C35B 4QGUA 3K7UC 4DK3C 1HR0L 3HOWH 2CWPA 3M4QA 2YTYA 4QY7A 3PO2H 1SLJA 1E7ZA 4NXNL 2E2JH 1Q82C 1WCMH 1UE7A 5GAGC 5HGQA 1VQ5A 4A3DH 4IPHA 3A74A 1B8AA 1XTDA 4KHPQ 4GOPA 4X62L 1GD7A 1PH9A 1KD1C 3TEHB 5GADC 2F4VQ 1IYJB 4JI2L 3PF4A 2K50A 4UPAA 4A3IG 1Z9FA 4DR1Q 5BR8Q 3GTPH 1IBKQ 1JJGA 3BU2A 5ELOA 3CCEA 3RN2A 4A3KH 4DR3L 3PO2G 4JI1Q 3GTLH 3NELA 3FHWA 3NBHB 4X64L 3AYHB 4LF9Q 4A3GH 1KL9A 2CFMA 2IX0A 2YTVA 1D8LA 2IY5B 1G51A 2N8NA 1HZBA 1N34L 2R7ZH 2A19A 4XTCS 3S15H 1N33L 4A93H 2I0QA 4DR4Q 3M4PA 4O2DA 4JBMA 3AQQA 1JJ2A 2VUMH 3H3VI 1VQ6A 4R4CA 1IBMQ 4IPCA 3CPWA 1EWIA 2YYZA 4LUZA 3CQZH 3HOUH 4JI3L 4GKKQ 4JV5Q 1NJIC 3GD7A 4OXPA 4JI5Q 4L5SA 3EIVA 2B63H 1FL0A 1YITA 4H02A 2UUBQ 1T9HA 4IJHA 1HH2P 1YHBA 4R4QA 3UDXA 1NBWA 5IYCG 2ZM6L 3KF8B 4BXXH 3DLLA 3CCLA 4X66Q 4NXNQ 5IT9c 2A1AA 2AKWB 2VS1A 1X3GA 5IP9H 1Y1WH 3GTGH 1S3OA 4DR5L 2VUMG 3PUVA 2K5VA 4GNXB 2KENA 1X54A 4DV2L 2JA5H 2B3GA 3S17H 2JA6H 3HOUG 2D62A 4AQYL 2K5NA 2JA7H 5JJLA 1XPOA 2LSSA 2E5LL 3G71A 4IO9A 1EUJA 2GVAA 3J81i 3K7AH 3PO3G 2I5HA 2MNAA 4A3EG 3KYHC 2MO0A 3F2CA 4NPSA 4BXXG 3G48A 5FJ8H 3GTJH 3J7A5 2BA1A 2N49A 3U4VA 2UXCQ 1X3FA 1Q46A 3U58A 5IYBH 4YCUA 4YCWA 4BA2I 1EOVA 2R7FA 3I4NH 4JI6L 3MXNB 1N32L 1VQGA 1VQ9A 1K3RA 4GNXA 3KF6B 4JYAQ 3E0EA 4RG1A 3PIOA 5C0XG 2YU9H 4P72A 1YVCA 4JI8Q 2OTLA 4DR6Q 1VQ8A 4A3CH 3K8AA 2Q2IA 1PFSA 2UU9L 3HOZH 3I2ZA 4LNQA 4DV0L 4OONA 5C3EG 4HIOA 2GN5A 4DV7L 3U50C 1MKHA 2N78A 2MO1A 3AEVA 5C0XI 3HKZE 1XNRQ 2Q2TA 1L1OB 1VQBA 4R1JA 2Z6KA 4P74A 1HNWQ 1PH2A 5LMUL 1KIXA 4POGA 5IWAL 4IFDJ 2JEAI 4OWWB 3W1BA 4OX9L 4OWTB 1V1QA 2OQ0A 3KF6A 3KJPA 3S1RH 1VQ4A 1HR0W 1Q12A 1TWCH 4B3SL 4LFBL 3UE1A 4J15A 4BA1I 3L2PA 2ES2A 2UXBL 1XMQL 3STBC 4P71A 3I56A 3CMEA 1AH9A 4A3BG 2VL6A 5C4JH 1CSQA 4JBKA 1L1OC 4A3FH 1L1OA 3T1YQ 1EYGA 4GKJQ 3RZDH 3H0GH 3M4OH 4QQBX 1D7QA 3DM3A 3CW2C 4DV5L 2UUCL 3CAMA 4A75A 1VQCA 2VZAA 4LF7Q 1YNXA 1Q8KA 2KHIA 1K0RA 3KDFB 1TXYA 3SGIA 3I4MH 4BBSG 1N36Q 1SR3A 1UE5A 4XIGS 2I5LX 1J5EL 1HNZQ 4DV0Q 3J80c 2R93H 1BKBA 4GLVB 3OYYA 4A3JH 1IL2A 3GTQH 1JE5A 2PI2A 4QJFA 1QVCA 2E2IH 4JI7L 1GVPA 4DV1Q 3E9IA 5M5XH 1PYSB 1CKMA 4JI0L 2QGQA 4FDBA 2NZHA 5K36G 1WYDA 4YWMA 1YHAA 3F1ZA 1EQQA 4BY7H 2Z0SA 4O0AA 4K0KL 1X56A 4MZ9A 4POFA 4L5TA 4DV3Q 3EN2A 1HNXL 3S1MH 4GN4B 3KDFA 1VQDA 2MFIA 3H15A 1XNQL 2NVTH 4AH6A 4LFBQ 1MIUA 4A76A 4LFAQ 3D0FA 2R92H 1C7YA 3HOYG 1AE3A 4IFDG 1LYLA 4MNOA 4LF4Q 4LFCQ 1E1TA 3M9BA 3UDGA 1JT8A 2K52A 3BJUA 5AJ3Q 2JA8H 2V1CC 4DV5Q 5JEAG 1XMOL 5FLMH 1KXLA 1QVGA 2D0PA 2IX1A 4AYBE 2VY3A 3PIPA 3PV0A 3HOWG 2BH2A 1B70B 4HIDA 2LXJA 4JI4Q 4R4TA 5JJIA 1BVSA 1A62A 1WCMG 1J5EQ 3TQYA 4A3DG 1JJCB 2H5XA 1OXXK 3TRZA 1C9OA 2UXDL 2D0OA 4DV6L 1G6PA 4LF6L 2NVXH 1PH8A 2E8GA 1J6QA 2NN6G 1Q86C 4IOAA 4Y7NH 4GN5A 4A3KG 5M3FH 3CXCA 1I3QH 2A8VA 1HNXQ 1HR0Q 2RCNA 4A3GG 4JOIC 3JAMi 2BA0A 3GO5A 3NEMA 2NN6I 3AFPA 2I5MX 2R7ZG 4A93G 1X55A 2OCEA 1R9TH 1PH5A 2DGYA 1CKNB 5EAYA 3PUZA 3T1HL 1VQLA 1W3SA 3TS0A 1X65A 2PI2E 2WAQG 4DKAC 4X62Q 4YHHL 1Z47A 3J81c 3K0XA 3M85A 1OXUA 3KJOA 4JI2Q 3K80C 4GLAC 3S2HH 2B63G 1HZAA 2B29A 3PUYA 2KBNA 4C3IH 4DR3Q 3JC66 4LWCA 5J3BA 2NVQH 3S1QH 4X64Q 4R4IA 1GO3E 1LTLA 5IP9G 1Y1WG 4L5RC 3S14H 3S2DH 2VNUD 1KQSA 1N34Q 4B3ML 2VQFL 1PH1A 1Q7YC 1M1KC 1N33Q 5C4XH 1CKNA 1Q81C 2JA5G 1JMCA 1N8RC 3HOXH 4BY1H 5M3MH 2JA6G 3HOVH 3CCJA 3KLWA 2JA7G 4LF8L 1Y1VH 1OXSC 4EX5A 4WJ3M 3RLFA 2VW9A 1YJNA 4JI3Q 1ASZA 4JC0A 2RF4A 5LMNL 1VQFA 1QZHA 2F3IA 2JA9A 3OTOL 4DUZL 5FJ8G 3E9HA 2ID0A 3FP9A 1E24A 2JK8A 3RR5A 3STBD 5IYBG 2ZM6Q 1V43A 1IXRA 4AIMA 2NVYH 4OO1G 3CCUA 4LUVA 1LM0A 4ALPA 1E22A 2AHOB 3I4NG 5M5YH 1PYBA 5FLXc 4HJ8A 4DR5Q 3M3YH 1A63A 4YY3L 1YEZA 4C3JH 4DV2Q 3W5OA 4P73A 1PH7A 4B3RL 3LGJA 4AQYQ 1IBLL 4A3CG 5C44H 5IP7H 4ME3A 2E5LQ 3HOZG 4UP9A 1WJJA 5IYDH 1VQPA 3OW2A 1FJGL 4BBRH 1PA6A 1VQJA 4X65L 4LF5L 1TWFH 1WI5A 4DR7L 1I94L 3I4OA 2ZJRA 1NY4A 2F52A 4NXML 1KAWA 4DUYL 1TWHH 4IPDA 3ULPA 5E7NA 2ZJQA 4YCVA 1E3PA 4JI6Q 1SMXA 2XTIA 2YV5A 3CCVA 1N32Q 3FKIH 4UP7A 2JE6I 1YBYA 4PMWA 2HHHL 2L15A 3D31A 3W1GA 1CSPA 1G291 3L0OA 2UU9Q 1OTCA 5ELNA 3OTOQ 3G6EA 4DUZQ 3HKSA 4DV7Q 1TWAH 1K83H 2EQSA 4DPGA 3U4ZA 3RN5A 4C3HH 4A3FG 1X6OA 2WFWA 3H0GG 1OXTA 1H95A 4B3TL 3CCRA 2FXQA 4GS3A 1KC8C 4RMFA 3BZCA 4PZ7A 2ASBA 2F4VL 4C2MH 5LMUQ 1QVFA 1FVIA 3I7FA 1VS0A 5IWAQ 4DR1L 3ULJA 3GTMH 4OX9Q 5JJKA 1FGUA 1K8GA 5BR8L 3I4MG 1IBKL 4B3SQ 4MTNA 2HT1A 4JI1L 4LF9L 2ZJPA 3CP0A 2R93G 2UXBQ 1XMQQ 4A3JG 1C0AA 4DR4L 3MEFA 1K8AC 2EIFA 2DUDA 2OQKA 3UDFA 4PZ6A 2UUAL 1CUKA 1UWVA 1IBML 3GTKH 4IOCA 4BY7G 4R4OA 3L7ZC 2UUCQ 1NMFA 3GDEA 3F8TA 4QL5A 4DV4L 4GKKL 4IFDI 3KOJA 4A3IH 4JV5L 1PH3A 4JBWA 4NB3A 3K81C 2UUBL 2HHHQ 4OWXB 1GM5A 5M5WH 3AFQA 1VQHA 3H3VH 3CC7A 2VQEL 1X9NA 3G4SA 2R92G 4X66L 3BZKA 2IT1A 2HIXA 1SN8A 1XJVA 4HJ5A 1JB7A 1KRSA 1U5KA 2AWNA 3CF5A 4GOPC 4JI7Q 3RLOA 2JA8G 4HJ9A 2Y0SG 4JI0Q 4APVA 3IRBA 4B3TQ 1RL2A 2RHSB 3NENA 4GN3B 5FLMG 5GAEC 4HJ7A 1U0LA 3S16H 3VDYA 3JAMc 5LMNW 4K0KQ 1PV4A 1OXVA 1VQAA 3PUWA 3CCMA 1VQIA 2BH8A 2IHFA 2R7DA 3PGZA 1SRUA 2HIVA 4JOIA 3A5UA 2JQOA 4A3MH 4EQ5A 5C0XJ 1XNQQ 1LUZA 1VQ7A 4HJAA 2UXCL 1BBUA 1QUQB 5IYCH 1P16A 3CD6A 4KI0A 1I5FA 1P8LA 3UE0A 1S72A 2WP8J 1IZ6A 2ZTDA 2HQLA 2ZTEA 3CPFA 2ALYB 1VQMA 2UUAQ 4JYAL 4GLXA 2PMZE 4DR2L 3S1NH 1YI2A 1K73C 2N3SA 1XMOQ 4JI8L 2Y0SE 3J7ZC 3J81j 5M3FG 2KCTA 4DV4Q 3UDIA 4LUOA 4DR6L 3A5ZB 3RLNA 1YJ9A 3A0JA 1YZ6A 3PO3H 4A3MG 5HY6A 1EIFA 4TQUS 4A3EH 2K14A 3TS2A 1XNRL 2EXDA 1EFWA 1XPUA 2VQEQ 2JJQA 1I6HH 2RHQB 1QUQA 4JBJA 5DLQE 3ER0A 1HNWL 3TREA 1UEBA 2Q2HA 4KHZA 2UXDQ 4DV6Q 1A0IA 5GAHC 3PSIA 4LF6Q 1V9PA 4DAYB 2WAQE 1N9WA 2OTJA 1A8VA 1MJCA 1SROA 2AMCB 2CKZB 4HIMA 4UP8A 4IPGA 1O7IA 2CQOA 3HKZG 1VQEA 2AWOA 1M90C 3WWVA 5C3EH 2QEXA 1ASYA 2PNHA 2E2HH 1PHJA 4DK6C 3T1YL 3HFZB 4TVAB 4GKJL 5C4XG 1NMGA 1WOCA 3HOXG 4BY1G 5M3MG 3HOVG 3T1HQ 1XPRA 2XGTA 1VQOA 1L0WA 4GNXC 4LF7L 4OO1I 2PQAB 1Y1VG 4YHHQ 3I55A 3CMAA 1YJWA 1QZGA 4PG3A 4DR2Q 1X3EA 3F2BA 5H1SE 1CKOA 1HZCA 1WFQA 1N36L 1L2FA 2NZOA 4KLKA 2ATWA 3S24A 3ULLA 1UE1A 1HNZL 4IJLA 3ICEA 2Q2UA 5IY0A 1PH6A 3ZJYC 3RZOH 1UE6A 4DAMA 4DV1L 4A3BH 2Z6KC 1DGSA 4B3MQ 2VQFQ 1VQNA 4Y52H 1KRTA 2CWAA 4L5QA 2JEBI 1KHIA 3M7NA 4PZ8A 1YIJA 3PUXA 2K5HA 3ERSX 1YHQA 1TWGH 4A3LH 2PQAA 3CC4A 4DV3L 2LXKA 1I50H 2YTXA 5IP7G 5C44G 4LF8Q 2GVBA 1PVOA 5IYDG 5GROA 2CCZA 2R6GA 4BBRG 5IE8A 1HZ9A 3PCOB 5LMNQ 5JEAJ 4BBSH 1RIPA 4LFAL 1BBWA 3RNUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LW1 A;  1B7Y B;  3B6Y A;  1E1O A;  2WB1 G;  1W2B A;  1PH4 A;  4LFC L;  4LF4 L;  4KHP L;  4P75 A;  1S40 A;  4JG2 A;  1Q1B A;  3CCS A;  3GTO H;  2K75 A;  5AJ3 L;  4JCV E;  3FKI G;  1SE8 A;  4YWK A;  2KHJ A;  1HJP A;  4YY3 Q;  2IHE A;  3CCQ A;  2MQH A;  4A3L G;  2ZTC A;  4B3R Q;  1AE2 A;  3CC2 A;  1NE3 A;  3PF5 A;  1IBL Q;  1NTG A;  3KFU A;  1GKH A;  2QA4 A;  4JI4 L;  2OWO A;  5GQO A;  3F2D A;  3Q8D A;  4HIK A;  1FJG Q;  4QIW E;  2KCM A;  1SFO H;  4X65 Q;  4LF5 Q;  4UY8 C;  4DR7 Q;  1I94 Q;  4GOP B;  1K9M C;  3HOY H;  4X6A H;  1VQK A;  3J80 i;  1Y14 B;  2WB1 E;  4DUY Q;  4NXM Q;  1EQR A;  1VCI A;  4AYB G;  1Q1E A;  1MJE A;  4A4I A;  4YWL A;  1EIY B;  4JI5 L;  4WJ4 A;  3EBE A;  2K4K A;  4DNI A;  2C35 B;  4QGU A;  3K7U C;  4DK3 C;  1HR0 L;  3HOW H;  2CWP A;  3M4Q A;  2YTY A;  4QY7 A;  3PO2 H;  1SLJ A;  1E7Z A;  4NXN L;  2E2J H;  1Q82 C;  1WCM H;  1UE7 A;  5GAG C;  5HGQ A;  1VQ5 A;  4A3D H;  4IPH A;  3A74 A;  1B8A A;  1XTD A;  4KHP Q;  4GOP A;  4X62 L;  1GD7 A;  1PH9 A;  1KD1 C;  3TEH B;  5GAD C;  2F4V Q;  1IYJ B;  4JI2 L;  3PF4 A;  2K50 A;  4UPA A;  4A3I G;  1Z9F A;  4DR1 Q;  5BR8 Q;  3GTP H;  1IBK Q;  1JJG A;  3BU2 A;  5ELO A;  3CCE A;  3RN2 A;  4A3K H;  4DR3 L;  3PO2 G;  4JI1 Q;  3GTL H;  3NEL A;  3FHW A;  3NBH B;  4X64 L;  3AYH B;  4LF9 Q;  4A3G H;  1KL9 A;  2CFM A;  2IX0 A;  2YTV A;  1D8L A;  2IY5 B;  1G51 A;  2N8N A;  1HZB A;  1N34 L;  2R7Z H;  2A19 A;  4XTC S;  3S15 H;  1N33 L;  4A93 H;  2I0Q A;  4DR4 Q;  3M4P A;  4O2D A;  4JBM A;  3AQQ A;  1JJ2 A;  2VUM H;  3H3V I;  1VQ6 A;  4R4C A;  1IBM Q;  4IPC A;  3CPW A;  1EWI A;  2YYZ A;  4LUZ A;  3CQZ H;  3HOU H;  4JI3 L;  4GKK Q;  4JV5 Q;  1NJI C;  3GD7 A;  4OXP A;  4JI5 Q;  4L5S A;  3EIV A;  2B63 H;  1FL0 A;  1YIT A;  4H02 A;  2UUB Q;  1T9H A;  4IJH A;  1HH2 P;  1YHB A;  4R4Q A;  3UDX A;  1NBW A;  5IYC G;  2ZM6 L;  3KF8 B;  4BXX H;  3DLL A;  3CCL A;  4X66 Q;  4NXN Q;  5IT9 c;  2A1A A;  2AKW B;  2VS1 A;  1X3G A;  5IP9 H;  1Y1W H;  3GTG H;  1S3O A;  4DR5 L;  2VUM G;  3PUV A;  2K5V A;  4GNX B;  2KEN A;  1X54 A;  4DV2 L;  2JA5 H;  2B3G A;  3S17 H;  2JA6 H;  3HOU G;  2D62 A;  4AQY L;  2K5N A;  2JA7 H;  5JJL A;  1XPO A;  2LSS A;  2E5L L;  3G71 A;  4IO9 A;  1EUJ A;  2GVA A;  3J81 i;  3K7A H;  3PO3 G;  2I5H A;  2MNA A;  4A3E G;  3KYH C;  2MO0 A;  3F2C A;  4NPS A;  4BXX G;  3G48 A;  5FJ8 H;  3GTJ H;  3J7A 5;  2BA1 A;  2N49 A;  3U4V A;  2UXC Q;  1X3F A;  1Q46 A;  3U58 A;  5IYB H;  4YCU A;  4YCW A;  4BA2 I;  1EOV A;  2R7F A;  3I4N H;  4JI6 L;  3MXN B;  1N32 L;  1VQG A;  1VQ9 A;  1K3R A;  4GNX A;  3KF6 B;  4JYA Q;  3E0E A;  4RG1 A;  3PIO A;  5C0X G;  2YU9 H;  4P72 A;  1YVC A;  4JI8 Q;  2OTL A;  4DR6 Q;  1VQ8 A;  4A3C H;  3K8A A;  2Q2I A;  1PFS A;  2UU9 L;  3HOZ H;  3I2Z A;  4LNQ A;  4DV0 L;  4OON A;  5C3E G;  4HIO A;  2GN5 A;  4DV7 L;  3U50 C;  1MKH A;  2N78 A;  2MO1 A;  3AEV A;  5C0X I;  3HKZ E;  1XNR Q;  2Q2T A;  1L1O B;  1VQB A;  4R1J A;  2Z6K A;  4P74 A;  1HNW Q;  1PH2 A;  5LMU L;  1KIX A;  4POG A;  5IWA L;  4IFD J;  2JEA I;  4OWW B;  3W1B A;  4OX9 L;  4OWT B;  1V1Q A;  2OQ0 A;  3KF6 A;  3KJP A;  3S1R H;  1VQ4 A;  1HR0 W;  1Q12 A;  1TWC H;  4B3S L;  4LFB L;  3UE1 A;  4J15 A;  4BA1 I;  3L2P A;  2ES2 A;  2UXB L;  1XMQ L;  3STB C;  4P71 A;  3I56 A;  3CME A;  1AH9 A;  4A3B G;  2VL6 A;  5C4J H;  1CSQ A;  4JBK A;  1L1O C;  4A3F H;  1L1O A;  3T1Y Q;  1EYG A;  4GKJ Q;  3RZD H;  3H0G H;  3M4O H;  4QQB X;  1D7Q A;  3DM3 A;  3CW2 C;  4DV5 L;  2UUC L;  3CAM A;  4A75 A;  1VQC A;  2VZA A;  4LF7 Q;  1YNX A;  1Q8K A;  2KHI A;  1K0R A;  3KDF B;  1TXY A;  3SGI A;  3I4M H;  4BBS G;  1N36 Q;  1SR3 A;  1UE5 A;  4XIG S;  2I5L X;  1J5E L;  1HNZ Q;  4DV0 Q;  3J80 c;  2R93 H;  1BKB A;  4GLV B;  3OYY A;  4A3J H;  1IL2 A;  3GTQ H;  1JE5 A;  2PI2 A;  4QJF A;  1QVC A;  2E2I H;  4JI7 L;  1GVP A;  4DV1 Q;  3E9I A;  5M5X H;  1PYS B;  1CKM A;  4JI0 L;  2QGQ A;  4FDB A;  2NZH A;  5K36 G;  1WYD A;  4YWM A;  1YHA A;  3F1Z A;  1EQQ A;  4BY7 H;  2Z0S A;  4O0A A;  4K0K L;  1X56 A;  4MZ9 A;  4POF A;  4L5T A;  4DV3 Q;  3EN2 A;  1HNX L;  3S1M H;  4GN4 B;  3KDF A;  1VQD A;  2MFI A;  3H15 A;  1XNQ L;  2NVT H;  4AH6 A;  4LFB Q;  1MIU A;  4A76 A;  4LFA Q;  3D0F A;  2R92 H;  1C7Y A;  3HOY G;  1AE3 A;  4IFD G;  1LYL A;  4MNO A;  4LF4 Q;  4LFC Q;  1E1T A;  3M9B A;  3UDG A;  1JT8 A;  2K52 A;  3BJU A;  5AJ3 Q;  2JA8 H;  2V1C C;  4DV5 Q;  5JEA G;  1XMO L;  5FLM H;  1KXL A;  1QVG A;  2D0P A;  2IX1 A;  4AYB E;  2VY3 A;  3PIP A;  3PV0 A;  3HOW G;  2BH2 A;  1B70 B;  4HID A;  2LXJ A;  4JI4 Q;  4R4T A;  5JJI A;  1BVS A;  1A62 A;  1WCM G;  1J5E Q;  3TQY A;  4A3D G;  1JJC B;  2H5X A;  1OXX K;  3TRZ A;  1C9O A;  2UXD L;  2D0O A;  4DV6 L;  1G6P A;  4LF6 L;  2NVX H;  1PH8 A;  2E8G A;  1J6Q A;  2NN6 G;  1Q86 C;  4IOA A;  4Y7N H;  4GN5 A;  4A3K G;  5M3F H;  3CXC A;  1I3Q H;  2A8V A;  1HNX Q;  1HR0 Q;  2RCN A;  4A3G G;  4JOI C;  3JAM i;  2BA0 A;  3GO5 A;  3NEM A;  2NN6 I;  3AFP A;  2I5M X;  2R7Z G;  4A93 G;  1X55 A;  2OCE A;  1R9T H;  1PH5 A;  2DGY A;  1CKN B;  5EAY A;  3PUZ A;  3T1H L;  1VQL A;  1W3S A;  3TS0 A;  1X65 A;  2PI2 E;  2WAQ G;  4DKA C;  4X62 Q;  4YHH L;  1Z47 A;  3J81 c;  3K0X A;  3M85 A;  1OXU A;  3KJO A;  4JI2 Q;  3K80 C;  4GLA C;  3S2H H;  2B63 G;  1HZA A;  2B29 A;  3PUY A;  2KBN A;  4C3I H;  4DR3 Q;  3JC6 6;  4LWC A;  5J3B A;  2NVQ H;  3S1Q H;  4X64 Q;  4R4I A;  1GO3 E;  1LTL A;  5IP9 G;  1Y1W G;  4L5R C;  3S14 H;  3S2D H;  2VNU D;  1KQS A;  1N34 Q;  4B3M L;  2VQF L;  1PH1 A;  1Q7Y C;  1M1K C;  1N33 Q;  5C4X H;  1CKN A;  1Q81 C;  2JA5 G;  1JMC A;  1N8R C;  3HOX H;  4BY1 H;  5M3M H;  2JA6 G;  3HOV H;  3CCJ A;  3KLW A;  2JA7 G;  4LF8 L;  1Y1V H;  1OXS C;  4EX5 A;  4WJ3 M;  3RLF A;  2VW9 A;  1YJN A;  4JI3 Q;  1ASZ A;  4JC0 A;  2RF4 A;  5LMN L;  1VQF A;  1QZH A;  2F3I A;  2JA9 A;  3OTO L;  4DUZ L;  5FJ8 G;  3E9H A;  2ID0 A;  3FP9 A;  1E24 A;  2JK8 A;  3RR5 A;  3STB D;  5IYB G;  2ZM6 Q;  1V43 A;  1IXR A;  4AIM A;  2NVY H;  4OO1 G;  3CCU A;  4LUV A;  1LM0 A;  4ALP A;  1E22 A;  2AHO B;  3I4N G;  5M5Y H;  1PYB A;  5FLX c;  4HJ8 A;  4DR5 Q;  3M3Y H;  1A63 A;  4YY3 L;  1YEZ A;  4C3J H;  4DV2 Q;  3W5O A;  4P73 A;  1PH7 A;  4B3R L;  3LGJ A;  4AQY Q;  1IBL L;  4A3C G;  5C44 H;  5IP7 H;  4ME3 A;  2E5L Q;  3HOZ G;  4UP9 A;  1WJJ A;  5IYD H;  1VQP A;  3OW2 A;  1FJG L;  4BBR H;  1PA6 A;  1VQJ A;  4X65 L;  4LF5 L;  1TWF H;  1WI5 A;  4DR7 L;  1I94 L;  3I4O A;  2ZJR A;  1NY4 A;  2F52 A;  4NXM L;  1KAW A;  4DUY L;  1TWH H;  4IPD A;  3ULP A;  5E7N A;  2ZJQ A;  4YCV A;  1E3P A;  4JI6 Q;  1SMX A;  2XTI A;  2YV5 A;  3CCV A;  1N32 Q;  3FKI H;  4UP7 A;  2JE6 I;  1YBY A;  4PMW A;  2HHH L;  2L15 A;  3D31 A;  3W1G A;  1CSP A;  1G29 1;  3L0O A;  2UU9 Q;  1OTC A;  5ELN A;  3OTO Q;  3G6E A;  4DUZ Q;  3HKS A;  4DV7 Q;  1TWA H;  1K83 H;  2EQS A;  4DPG A;  3U4Z A;  3RN5 A;  4C3H H;  4A3F G;  1X6O A;  2WFW A;  3H0G G;  1OXT A;  1H95 A;  4B3T L;  3CCR A;  2FXQ A;  4GS3 A;  1KC8 C;  4RMF A;  3BZC A;  4PZ7 A;  2ASB A;  2F4V L;  4C2M H;  5LMU Q;  1QVF A;  1FVI A;  3I7F A;  1VS0 A;  5IWA Q;  4DR1 L;  3ULJ A;  3GTM H;  4OX9 Q;  5JJK A;  1FGU A;  1K8G A;  5BR8 L;  3I4M G;  1IBK L;  4B3S Q;  4MTN A;  2HT1 A;  4JI1 L;  4LF9 L;  2ZJP A;  3CP0 A;  2R93 G;  2UXB Q;  1XMQ Q;  4A3J G;  1C0A A;  4DR4 L;  3MEF A;  1K8A C;  2EIF A;  2DUD A;  2OQK A;  3UDF A;  4PZ6 A;  2UUA L;  1CUK A;  1UWV A;  1IBM L;  3GTK H;  4IOC A;  4BY7 G;  4R4O A;  3L7Z C;  2UUC Q;  1NMF A;  3GDE A;  3F8T A;  4QL5 A;  4DV4 L;  4GKK L;  4IFD I;  3KOJ A;  4A3I H;  4JV5 L;  1PH3 A;  4JBW A;  4NB3 A;  3K81 C;  2UUB L;  2HHH Q;  4OWX B;  1GM5 A;  5M5W H;  3AFQ A;  1VQH A;  3H3V H;  3CC7 A;  2VQE L;  1X9N A;  3G4S A;  2R92 G;  4X66 L;  3BZK A;  2IT1 A;  2HIX A;  1SN8 A;  1XJV A;  4HJ5 A;  1JB7 A;  1KRS A;  1U5K A;  2AWN A;  3CF5 A;  4GOP C;  4JI7 Q;  3RLO A;  2JA8 G;  4HJ9 A;  2Y0S G;  4JI0 Q;  4APV A;  3IRB A;  4B3T Q;  1RL2 A;  2RHS B;  3NEN A;  4GN3 B;  5FLM G;  5GAE C;  4HJ7 A;  1U0L A;  3S16 H;  3VDY A;  3JAM c;  5LMN W;  4K0K Q;  1PV4 A;  1OXV A;  1VQA A;  3PUW A;  3CCM A;  1VQI A;  2BH8 A;  2IHF A;  2R7D A;  3PGZ A;  1SRU A;  2HIV A;  4JOI A;  3A5U A;  2JQO A;  4A3M H;  4EQ5 A;  5C0X J;  1XNQ Q;  1LUZ A;  1VQ7 A;  4HJA A;  2UXC L;  1BBU A;  1QUQ B;  5IYC H;  1P16 A;  3CD6 A;  4KI0 A;  1I5F A;  1P8L A;  3UE0 A;  1S72 A;  2WP8 J;  1IZ6 A;  2ZTD A;  2HQL A;  2ZTE A;  3CPF A;  2ALY B;  1VQM A;  2UUA Q;  4JYA L;  4GLX A;  2PMZ E;  4DR2 L;  3S1N H;  1YI2 A;  1K73 C;  2N3S A;  1XMO Q;  4JI8 L;  2Y0S E;  3J7Z C;  3J81 j;  5M3F G;  2KCT A;  4DV4 Q;  3UDI A;  4LUO A;  4DR6 L;  3A5Z B;  3RLN A;  1YJ9 A;  3A0J A;  1YZ6 A;  3PO3 H;  4A3M G;  5HY6 A;  1EIF A;  4TQU S;  4A3E H;  2K14 A;  3TS2 A;  1XNR L;  2EXD A;  1EFW A;  1XPU A;  2VQE Q;  2JJQ A;  1I6H H;  2RHQ B;  1QUQ A;  4JBJ A;  5DLQ E;  3ER0 A;  1HNW L;  3TRE A;  1UEB A;  2Q2H A;  4KHZ A;  2UXD Q;  4DV6 Q;  1A0I A;  5GAH C;  3PSI A;  4LF6 Q;  1V9P A;  4DAY B;  2WAQ E;  1N9W A;  2OTJ A;  1A8V A;  1MJC A;  1SRO A;  2AMC B;  2CKZ B;  4HIM A;  4UP8 A;  4IPG A;  1O7I A;  2CQO A;  3HKZ G;  1VQE A;  2AWO A;  1M90 C;  3WWV A;  5C3E H;  2QEX A;  1ASY A;  2PNH A;  2E2H H;  1PHJ A;  4DK6 C;  3T1Y L;  3HFZ B;  4TVA B;  4GKJ L;  5C4X G;  1NMG A;  1WOC A;  3HOX G;  4BY1 G;  5M3M G;  3HOV G;  3T1H Q;  1XPR A;  2XGT A;  1VQO A;  1L0W A;  4GNX C;  4LF7 L;  4OO1 I;  2PQA B;  1Y1V G;  4YHH Q;  3I55 A;  3CMA A;  1YJW A;  1QZG A;  4PG3 A;  4DR2 Q;  1X3E A;  3F2B A;  5H1S E;  1CKO A;  1HZC A;  1WFQ A;  1N36 L;  1L2F A;  2NZO A;  4KLK A;  2ATW A;  3S24 A;  3ULL A;  1UE1 A;  1HNZ L;  4IJL A;  3ICE A;  2Q2U A;  5IY0 A;  1PH6 A;  3ZJY C;  3RZO H;  1UE6 A;  4DAM A;  4DV1 L;  4A3B H;  2Z6K C;  1DGS A;  4B3M Q;  2VQF Q;  1VQN A;  4Y52 H;  1KRT A;  2CWA A;  4L5Q A;  2JEB I;  1KHI A;  3M7N A;  4PZ8 A;  1YIJ A;  3PUX A;  2K5H A;  3ERS X;  1YHQ A;  1TWG H;  4A3L H;  2PQA A;  3CC4 A;  4DV3 L;  2LXK A;  1I50 H;  2YTX A;  5IP7 G;  5C44 G;  4LF8 Q;  2GVB A;  1PVO A;  5IYD G;  5GRO A;  2CCZ A;  2R6G A;  4BBR G;  5IE8 A;  1HZ9 A;  3PCO B;  5LMN Q;  5JEA J;  4BBS H;  1RIP A;  4LFA L;  1BBW A;  3RNU A; 
#chains in the Genus database with same CATH topology
 3TQ1 A;  4RB0 A;  2YW2 A;  3BYT B;  3D4R A;  2NVX B;  4LF4 L;  2WB1 G;  3MR3 A;  4LFC L;  3FDT A;  2XIG A;  4JG2 A;  4UCU A;  3VPB A;  4X3U A;  3CCS A;  3GTO H;  2K75 A;  5I6W A;  2H4O A;  1SE8 A;  4YWK A;  1V1P A;  1AW7 A;  1HQR D;  4ZUI A;  1IHZ A;  2KCC A;  2JYO A;  3CC2 A;  3SR1 A;  1G8Z D;  3ERO A;  1NNX A;  4EFE A;  1TII D;  5GQO A;  1FJG Q;  4QIW E;  1FKA H;  3IFT A;  3BQ0 A;  3T5H A;  1CQF A;  3KHH A;  2F0F A;  2FE3 A;  1B50 A;  2AQ2 B;  1PZI D;  5EKK A;  1VQK A;  4DUY Q;  4DR2 H;  1EWC A;  1EQR A;  1GXD C;  2O5I C;  4AYB G;  4JI8 H;  4QW8 A;  1Q1E A;  2IL8 A;  5A2Q E;  2NVQ B;  3HKZ B;  2K4K A;  4DNI A;  4QGU A;  2CWP A;  3M4Q A;  3TP7 A;  2E2J H;  3BA9 A;  4BY1 B;  2EPB A;  1HNW H;  3P1H A;  2ASJ A;  4KHP Q;  3DXJ C;  4GOP A;  2FB9 A;  1GD7 A;  1M4V A;  1PH9 A;  4LF8 H;  5ELC A;  4UPA A;  4A3I G;  5LMN H;  2CHB D;  3V6J A;  4F88 A;  5ELO A;  1PTO H;  4MTD A;  1A2U A;  4DR3 L;  2FIN B;  4FXG C;  3Q8S B;  3GTL H;  1W6J A;  4IUV A;  1KL9 A;  2CFM A;  2RSO A;  2R7Z H;  4XTC S;  5IT9 E;  1KAA A;  4DR4 Q;  4O4H F;  1KBL A;  4JBM A;  1VBG A;  1V51 A;  1LAC A;  1STA A;  4XX0 B;  4LF7 H;  5HV6 A;  1VQ6 A;  1IBM Q;  3CPW A;  2A68 D;  1EWI A;  1CT1 D;  1EU4 A;  4MHE A;  3R5F A;  2K05 A;  1EQV A;  3CQZ H;  3HOU H;  2B2V C;  2MCT A;  1N36 H;  4GKK Q;  1TS3 A;  3L3O C;  2MGS A;  3RZO B;  3GD7 A;  4ECQ A;  2QIL A;  2NU7 B;  4Z9C B;  2AU0 A;  2ZM6 L;  5IYC G;  1SYX B;  3NBH A;  2DIK A;  4DV1 H;  1CA5 A;  4NXM H;  4X66 Q;  3RJ0 A;  5IT9 c;  2AKW B;  3GTG H;  1X3G A;  5AFW A;  5IP9 H;  1Y1W H;  5EOY A;  1S3O A;  3J7A F;  5F9N A;  2VUM G;  1TWG B;  2BOS A;  3GV6 A;  3KHR A;  2KEN A;  3TBI B;  5IYZ F;  4DV3 H;  2JA6 H;  2D62 A;  2DNE A;  5JJL A;  4CBV A;  1T36 A;  2AGP A;  3G71 A;  4IO9 A;  1WTX A;  5DAU A;  3J81 i;  2KEC A;  4A3E G;  2B2Y C;  4C3H B;  2BQR A;  1XWE A;  2NWG A;  5FJ8 H;  3J7A 5;  2BA1 A;  4LFC H;  5COR A;  3VR6 A;  5C3X A;  3GTO B;  4UCS A;  1C48 A;  1PMR A;  3EFX D;  1LT4 D;  3KF8 A;  5L1L A;  4DK0 A;  4YCU A;  4YCW A;  2RDF A;  3MXN B;  1B4O A;  3KF6 B;  3PIO A;  2ZT9 C;  2YU9 H;  4I7A A;  3J7A K;  2PQE A;  4DR6 Q;  1S10 A;  5FO7 B;  5D8D A;  3GTM A;  2ASD A;  3I2Z A;  2EY6 A;  2W6M A;  4DV0 L;  3GTK B;  2N78 A;  3GQC A;  4K14 A;  2R87 A;  1AP0 A;  2Q2T A;  1VQB A;  2VPQ A;  2Z6K A;  2W9C A;  4Q8F A;  3JSN A;  1PH2 A;  4LH7 A;  2P5Z X;  4IFD J;  4OWW B;  1EWH A;  2CW0 C;  1HR0 W;  1Q12 A;  3KHL A;  2E2J B;  3GV3 A;  5ELD A;  1K1Q A;  4MV3 A;  1J8I A;  4DL7 A;  1C30 A;  1SFO A;  4ME6 A;  1SYB A;  4P71 A;  4DN4 M;  3ONA B;  3J80 E;  2PW7 A;  4A3B G;  1CSQ A;  3ITP A;  1JOQ A;  1L1O A;  3T1Y Q;  3DEP A;  3M4O H;  1SE3 A;  4QQB X;  3QG1 A;  1D7Q A;  1HFG A;  2VZA A;  5A2Q W;  3N44 B;  3BAB A;  3GTL B;  4UDU C;  3BDO A;  2KHI A;  1SYC A;  4XT3 B;  4DR3 H;  1PX2 A;  2CH4 A;  2R7Z B;  1UE5 A;  2YRX A;  4XIG S;  3MWM A;  2IA6 A;  1HNZ Q;  3J80 c;  1BKB A;  4QJF A;  1KLG D;  5LOV F;  4IFD H;  2WAQ B;  5EGT A;  2W6N A;  3HOU B;  1CKM A;  2TMP A;  5D3I B;  2ZXR A;  4K5X A;  4YWM A;  1UEA B;  5C6A A;  1PTO C;  2XNA C;  3PO3 B;  1EY8 A;  1BUV T;  2LY7 A;  4GN4 B;  3KDF A;  2XVS A;  2L55 A;  1XNQ L;  2ZM6 H;  3GTG B;  3MJF A;  2PVP A;  2MUY A;  4LFA Q;  4ED7 A;  3CVZ A;  5IT9 W;  3OHA A;  1C7Y A;  2VUM A;  1II3 A;  1AE3 A;  2A6E C;  4MNO A;  2JA6 B;  4CDE C;  1TY2 A;  4XYL B;  2ZDQ A;  1A2T A;  3UDG A;  3RIZ A;  4ED1 A;  1S97 A;  2K52 A;  4JW0 A;  2A74 C;  5AJ3 Q;  2RBM A;  2JA8 H;  2V1C C;  4S3S A;  1XMO L;  5FLM H;  1XDN A;  1SYG A;  2B2W C;  3HOW G;  4AYB E;  2V58 A;  4IQZ A;  2LXJ A;  5L1I A;  1DOK A;  1BVS A;  5JJI A;  2R6F A;  4MA5 A;  2AQ1 B;  4GKJ H;  5BN5 A;  5KG4 A;  4A3D G;  2GPS A;  1OXX K;  1Y8P B;  2YU9 B;  2UXD L;  2FJ2 A;  4LF6 L;  3GIQ A;  4G3I A;  2E8G A;  1J6Q A;  1F9P A;  3MWD A;  4TKO B;  5EBC A;  2K04 A;  3DMU A;  3CXC A;  1G2S A;  4DV0 H;  1I3Q H;  2A8V A;  2NUC A;  1HNX Q;  1PFN A;  2RCN A;  4V19 0;  4A3G G;  4JOI C;  3JAM i;  4M7E A;  1JX4 A;  3NEM A;  5CBE E;  2IP4 A;  4A93 G;  1IW7 D;  1R9T H;  4WD3 A;  5CBA E;  3VR4 A;  1PH5 A;  4P2C B;  2B8F A;  4JVZ A;  5KFC A;  3T1H L;  1B9N A;  3N6X A;  3TS0 A;  1X65 A;  1Q3L A;  3AU7 A;  2E76 C;  3K0X A;  3M85 A;  2DZD A;  3KJO A;  2L0C A;  5JVL A;  2K5Q A;  2F0M A;  1KAB A;  3PUY A;  4C5B A;  1ICF B;  4G7O C;  4HMI A;  3JC6 6;  3NUC A;  3HS0 C;  1SNP A;  4LWC A;  4QUC A;  3S1Q H;  1KJJ A;  3K3V A;  4NW2 A;  3M4O B;  4QW9 A;  3RUZ A;  1E4E B;  2DLN A;  4L5R C;  3T16 A;  3RUP A;  1SNM A;  4KMU C;  1Q7Y C;  1Z2P X;  2I8C A;  2JA5 G;  2JN4 A;  1HQM C;  1MSH A;  3HOV H;  1I50 A;  3EPI A;  1O75 A;  1WH2 A;  4J9K A;  2JA7 G;  1QJO A;  5CV6 A;  4HAE A;  2K03 A;  4XYM B;  2VW9 A;  1MSG A;  1F2L A;  1DOL A;  5KG0 A;  4ECW A;  2F3I A;  2DY8 A;  2JA9 A;  3OTO L;  4L63 B;  3E9H A;  2IMW P;  1JIH A;  4R8I A;  2K5D A;  3J80 W;  1S03 G;  1E24 A;  2JK8 A;  3RR5 A;  1FGB D;  4HMJ A;  3STB D;  5IYB G;  4AIM A;  2NVY H;  3H0G A;  4KY7 A;  2AHO B;  2QDL A;  3I4N G;  1JOK A;  2W6O A;  4DR5 Q;  4HR7 B;  4C3J H;  4P73 A;  1ONL A;  3O13 A;  1S0O A;  5KFP A;  2WV6 D;  4AQY Q;  1XNQ H;  5J22 A;  5C44 H;  1WJJ A;  1BCP D;  2R93 A;  5NUC A;  3TIN A;  3VYU A;  5DQH A;  4X65 L;  2ENB A;  1GUT A;  2PMZ B;  5CGK A;  2A73 B;  1Y8N B;  3A8J E;  2JA8 B;  5KFT A;  2IPK D;  1TWH H;  3LX0 A;  3VR3 A;  1K3B C;  4YCV A;  4KHV A;  3GTP B;  1XMO H;  1T94 A;  1SMX A;  2XTI A;  2YV5 A;  4IUN A;  1SND A;  4J9N A;  1EEF D;  1TVX A;  2L15 A;  3R2I A;  1OTC A;  5FO8 B;  5ELN A;  4KKU A;  2F0K A;  1QCB D;  1TWA H;  5D1O B;  4XZ3 B;  2UXD H;  3OHX C;  5C1O A;  4LF6 H;  1LT5 D;  4B3T L;  1EUC B;  2FXQ A;  4RMF A;  4PZ7 A;  2F4V L;  3RGZ A;  4C2M H;  1I3Q B;  5IWA Q;  3ULJ A;  2W7P A;  4OX9 Q;  4ZQ3 A;  1IBK L;  4B3S Q;  3G8C A;  2EYP A;  1HUN A;  1ZET A;  2Z4I A;  1R9T B;  4G4K A;  4LF9 L;  4DNT B;  3K5I A;  4A3J G;  2C00 A;  4ODG A;  3A56 A;  1WTR A;  3T1H H;  4WBN F;  2XSC A;  4YP3 A;  1SE2 A;  2UUA L;  2RCF A;  4LK1 C;  1LTB D;  1AEX A;  1AZP A;  3KBG A;  2VB2 X;  4RH6 A;  4G57 A;  2E5L H;  2EYJ A;  3N8D A;  3GDE A;  3HP3 A;  4B9W A;  4JV5 L;  1D1I A;  2V59 A;  3S1Q B;  3R23 A;  3MTS A;  4OWX B;  1VQH A;  3TZU A;  1H9K A;  2VQE L;  2NBF A;  3CC7 A;  2CH4 W;  1KC7 A;  2IT1 A;  2HIX A;  3HOV B;  3VPC A;  4CC5 A;  4JI6 H;  1N56 A;  1PRT D;  1D5X C;  2JA7 A;  2RDH A;  3IRB A;  2RHS B;  3S16 H;  3HOZ B;  4O1N A;  3V96 A;  4GC6 A;  4K0K Q;  2VB3 X;  3OTO H;  3RV3 A;  2BQU A;  3BDL A;  4FF4 A;  5KFE A;  1OXV A;  1VQA A;  2EYL A;  2XGP A;  2IHF A;  2R7D A;  3A5U A;  4A3M H;  1DXM A;  2JQO A;  2K5W A;  2UXC L;  4J9L A;  3CD6 A;  1YNJ C;  2F0Q A;  1H9S B;  2UVR A;  1S72 A;  5CA1 F;  1I4P A;  2VOB A;  2ALY B;  3MFI A;  1Y1V A;  4ID6 A;  5C44 B;  4IHJ F;  4RCN A;  1JDB B;  2N3S A;  2ZDG A;  1EYC A;  3D3R A;  4IRK A;  1T3N A;  3A55 A;  3TN2 A;  1YZ6 A;  4X65 H;  5HY6 A;  1AN7 A;  1QNK A;  3MR2 A;  1H9R A;  1TWH B;  2WDT A;  4EBD A;  3NQT A;  3Q1K A;  4FM9 A;  3VYT A;  2E74 C;  1TT2 A;  3TRE A;  2R3Z A;  4O4L F;  3T5J A;  1LLR D;  1K0S A;  1A0I A;  1EEI D;  2O5J C;  3HBL A;  1DCZ A;  4CJ1 B;  1BNC A;  1GUO A;  1TU2 B;  2AMC B;  2CKZ B;  2J6T A;  5IGG A;  1A6X A;  1Z7T A;  4IPG A;  4O4I F;  1TWA B;  3HKZ G;  2RVL A;  2JEI A;  1V1O A;  1ASY A;  5L1J A;  4R8N A;  2KED A;  1ESR A;  3MZ5 A;  4C2M B;  4B3T H;  4Q0F A;  5I47 A;  4DL6 A;  4BY1 G;  1YNN D;  5ELF A;  1S68 A;  5C5L A;  3E5N A;  1L0W A;  1YJW A;  1QZG A;  3RAX A;  4DR2 Q;  5IOC A;  4RZR A;  1CKO A;  4ECY A;  2C2E A;  4LF9 H;  2J7Z A;  1JDE A;  3NBI A;  1ZEQ X;  4ECU A;  3TME A;  5EPJ A;  1PZK D;  2Q2U A;  3RF2 A;  3I72 A;  2XWB B;  1VDZ A;  1O80 A;  2UUA H;  3RB6 A;  5FK9 C;  1HUM A;  2DNC A;  2EE1 A;  2FMM A;  3NTK A;  3PMF A;  1LV9 A;  4UCV A;  3GV7 B;  4ZRZ A;  2NZ1 D;  1PVO A;  2LXK A;  5IP7 G;  4LF8 Q;  1AUV A;  2Q8I B;  2D9U A;  3BVM A;  5IYD G;  5C3W A;  4BBS H;  5LMN Q;  2VQE H;  5JEA J;  5KYL A;  3BVG A;  1LTR D;  2K32 A;  1JWU D;  1RJP A;  2KCN A;  1B7Y B;  3B6Y A;  3JSL A;  1U9R A;  2FLL A;  4V0B A;  2B2U C;  3PIP 3;  5M9O A;  1E4G T;  5KFN A;  3H4B A;  4JCV E;  1UNN C;  3GP7 A;  2KHJ A;  1HJP A;  3A8K E;  4K6D A;  3CCQ A;  2MQH A;  3C46 A;  4EYH B;  2SDF A;  4B3R Q;  4A3M B;  1IBL Q;  2RQX A;  4PMB A;  5JVG 3;  4JI4 L;  2UXC H;  4LSA A;  1SEI A;  4HIK A;  4YR2 A;  1PTO F;  2KCM A;  5FPR A;  1B3Q A;  4LF5 Q;  3NK9 A;  4C3H G;  5FD6 A;  1I94 Q;  2NVX A;  1K9M C;  3HOY H;  4X6A H;  4O3R A;  4YHH H;  1Y14 B;  4J6H A;  4NXM Q;  2XCP A;  3QOJ A;  3T13 A;  3SK8 A;  5JEA H;  4K5V A;  4JI5 L;  5CAE B;  1AUX A;  5FKA C;  1HR0 L;  3S14 B;  2YTY A;  2HD3 A;  4QY7 A;  3PO2 H;  1SLJ A;  4DL3 A;  3KXY T;  4NXN L;  1LT6 D;  2VQF H;  4RB2 C;  1WCM H;  2O4X A;  5HGQ A;  2WKD A;  4HCS A;  2OEO A;  5T1G A;  1EUD B;  4IPH A;  5ELE A;  1KNE A;  1KLU D;  2PNR C;  5TSS A;  4X62 L;  2Q8R E;  4EFB A;  1KD1 C;  3K5O A;  1JQY D;  1RYR A;  3PF4 A;  2W9B B;  4JI2 L;  4O3P A;  2R85 A;  1R4P B;  3CRK C;  3H20 A;  5A2Q L;  4RNO A;  4A3K H;  3HKZ A;  4EVO A;  4JI1 Q;  4OEM B;  1KJ8 A;  3VYS A;  3AYH B;  2F4I A;  4QCL A;  2B8G A;  2IX0 A;  3K59 A;  1D8L A;  2F0I A;  4FO2 A;  1N34 L;  1XXG A;  2L12 A;  3MA2 B;  1F2Z A;  4UCO A;  4O2D A;  1ENF A;  1F2Y A;  4C56 C;  3H3V I;  2FK3 A;  2W57 A;  1XYI A;  4EBC A;  2W6Z A;  4OIK A;  2HCC A;  3SVM A;  1TWF B;  1WR2 A;  4OXP A;  3DEO A;  2B63 H;  1FR3 A;  4H02 A;  4IUP A;  1YIT A;  2V9W A;  4LMQ D;  1T9H A;  2K7V A;  3UDX A;  1YHB A;  4BXX H;  4MAM A;  1MI2 A;  3DLL A;  1KNA A;  2A1A A;  3FKI B;  5IT9 L;  2MJ8 A;  1PDQ A;  1WD0 A;  3A7A B;  2FPI B;  4GNX B;  5KFX A;  3SE0 A;  2B3G A;  3S17 H;  3HOU G;  4BBS B;  3KAJ A;  1ENA A;  2W70 A;  1CA6 A;  1FD7 D;  3MXP A;  5CV5 A;  2EJG C;  1WTV A;  2R7N A;  3QO2 A;  3K7A H;  3PO3 G;  3QFF A;  2C9O A;  2Z8L A;  4NPS A;  1K8M A;  3X3N A;  4IR9 A;  4QUF A;  2F0U A;  1Q46 A;  3U58 A;  1HPC A;  3OPO A;  5G3L D;  4BA2 I;  4RUA A;  3DUZ A;  1L0X B;  2R7F A;  5FLX E;  1N32 L;  1TWG A;  1VQG A;  4QWB A;  1K3R A;  4JYA Q;  1JKJ B;  4RG1 A;  2YS7 A;  1EL0 A;  1YVC A;  5DLG A;  5KIX A;  4A3C H;  2Q2I A;  1PFS A;  1PLF A;  2UU9 L;  4LNQ A;  2C28 A;  5C3E G;  3PW0 A;  1HHV A;  5GON F;  4DV7 L;  3U50 C;  3AEV A;  3T5K A;  3URY A;  3HKZ E;  1XNR Q;  2F0L A;  4I7H A;  2V4Q A;  3GTO A;  2RDI A;  2E75 C;  4ABN A;  2UVW A;  5JPM C;  4P74 A;  1TS4 A;  5LMU L;  1Y8O B;  2JEA I;  3MXN A;  4JI5 H;  4OWT B;  1QG7 A;  5M5W B;  1V1Q A;  2OQ0 A;  3KF6 A;  4DF7 A;  3S1R H;  1VQ4 A;  2D5D A;  3PO2 B;  4TQR A;  1HR0 H;  2BE5 D;  3UE1 A;  1QOH A;  1WCM B;  1GSO A;  4NXN H;  2UXB L;  3I56 A;  2HVQ A;  4DU9 A;  2F0O A;  3P7J A;  1CFM A;  4GC7 A;  2KVM A;  3GTK A;  1AH9 A;  5C4J H;  4HNV A;  4RGN A;  4CJ0 B;  2ZXO A;  4A3F H;  4X62 H;  1EYG A;  3NHH A;  3BS1 A;  3RZD H;  4GKJ Q;  4XQJ A;  3CW2 C;  4DV5 L;  4A75 A;  3FMA A;  4A3K B;  2KA7 A;  3T4A C;  2ZDH A;  3SGI A;  1I4R A;  3I4M H;  4I7Z C;  5DQG A;  1SCU B;  1DD2 A;  2I5L X;  3RD4 A;  3RMH A;  4F4W A;  1N34 H;  4DV0 Q;  2D2C C;  4KD4 A;  3J7Y W;  1KTK A;  3IKJ A;  2JSO A;  3J80 L;  1JLL B;  3ETJ A;  1QVC A;  1CE8 A;  2AGO A;  4JI7 L;  1GVP A;  2FMA A;  4JI0 L;  2QGQ A;  2F03 A;  1WYD A;  5KG5 A;  3HB9 A;  2J9G A;  4BY7 H;  4ZHQ F;  2Z0S A;  2PO4 A;  4L5T A;  3V6K A;  1Q90 A;  1I6H B;  4CHT B;  4J9O A;  2NVT H;  3QWN A;  5KFW A;  2R7Z A;  4A76 A;  3DWA A;  2QKI C;  2R92 H;  3NTH A;  4IFD G;  1LTT D;  1NSN S;  5DG9 A;  1Q8I A;  3P20 A;  5KYI A;  2R84 A;  2Z6B A;  3MAQ A;  3RAQ A;  3BJU A;  1MD2 D;  4HYK A;  2KUM A;  4RA8 A;  2D0P A;  5DEH A;  2R8K A;  1VAJ A;  4XXE A;  4F4X A;  1O7Y A;  4HNU A;  3X3M A;  4HID A;  4UCT A;  1JB3 A;  1ML0 D;  3GTG A;  1A62 A;  4ECX A;  3N41 B;  4L8J A;  5KFB A;  1JJC B;  1NUC A;  2R7K A;  1D6E C;  1OWT A;  1N32 H;  4NDX A;  3C3L A;  2KJX A;  1I4G A;  4L6T B;  2JA6 A;  2D0O A;  4DV6 L;  3D6W A;  1PH8 A;  2NN6 G;  4CKB A;  3J81 E;  4OL7 A;  1KDA A;  5EKL A;  4IOA A;  4Y7N H;  4GN5 A;  3OUU A;  3GII A;  1ZQ7 A;  4XQN A;  2NU8 B;  2UU9 H;  3FPP A;  5M3F H;  2O2L D;  4DV7 H;  3N40 P;  4M9U A;  2NN6 I;  2OCE A;  2EZV A;  3M9N B;  2F1M A;  2DGY A;  1B2T A;  2NUA B;  3PUZ A;  5LMU H;  4O2B F;  3S1R B;  5ELB A;  3GIP A;  2YU9 A;  2PZW A;  4DKA C;  3J81 c;  3S2H H;  3FDS A;  2UXB H;  5CMD A;  4C3I H;  2KBN A;  4UHV A;  2PZT A;  4A3F B;  4LF4 H;  4X64 Q;  3RZD B;  5C5J A;  4OO1 H;  2DPI A;  3BQ2 A;  1SXT A;  4B3M L;  1GHK A;  1B6R A;  1ENC A;  1N33 Q;  4DV5 H;  3C2P A;  1Q81 C;  3HOX H;  3I4M B;  1HA6 A;  1EY6 A;  4WJ3 M;  4EX5 A;  4ILW A;  4JI3 Q;  1YJN A;  3M7G A;  4JC0 A;  1ASZ A;  4L1K A;  4MV9 A;  5KFD A;  3MHB A;  3FP9 A;  3K5N A;  4IAL A;  3MFY A;  4JI7 H;  3E0J A;  4KJN A;  1E4E A;  2I87 A;  2HDL A;  4LUV A;  4JI0 H;  4ALP A;  2K1B A;  5M5Y H;  4BY7 B;  1H9J A;  3EVQ A;  4HJ8 A;  1EY0 A;  4ZK9 B;  4DXG A;  4HED A;  4DV2 Q;  1PH7 A;  2NVT B;  1B04 A;  5F9L A;  3EPG A;  5E4X A;  1STY A;  2E5L Q;  4ME3 A;  3HOZ G;  2R92 B;  4Q5V A;  4J1M A;  2X69 A;  1AFP A;  1FJG L;  4MV1 A;  4BBR H;  2RDJ A;  2PBZ A;  1S5F D;  4YAK B;  2BDN A;  4LAA A;  1FNU A;  3KLS X;  3H6M A;  2ZJR A;  4PQX A;  1ZHQ A;  2Y0S B;  3FRP B;  4DUY L;  3OOC A;  4IPD A;  4ZOL F;  3OHB A;  5E7N A;  3EJI A;  2R7M A;  5LXT F;  1XTC D;  4JI6 Q;  1PTO B;  2A6H D;  3H09 A;  2FMC A;  1SAP A;  4UP7 A;  4HR7 A;  5K2M A;  4PMW A;  2HHH L;  2FFK B;  3D31 A;  1I7N A;  3A8I E;  2H1E A;  1CSP A;  3L0O A;  5EPL A;  3OTO Q;  3G6E A;  1UC9 A;  1I7L A;  3K6O A;  1C3O A;  1NR2 A;  2EQS A;  3RN5 A;  2XC9 A;  3U4Z A;  2PMZ A;  1X6O A;  3H0G G;  3CQZ B;  3EQL C;  4PV1 C;  5JPN C;  1DOM A;  2ASB A;  3WO1 A;  1JIC A;  3FPU B;  3BA8 A;  1QVF A;  3GTP A;  4NLG A;  1B53 A;  4F4Y A;  1EZ8 A;  2EYF A;  4RHS A;  5DM7 3;  3VA7 A;  3R5H A;  3M9M B;  1BQQ T;  1Y1W B;  2AUJ D;  3CP0 A;  2R93 G;  4JUZ A;  1G2T A;  1XMQ Q;  1GGO A;  1QIL A;  2PW5 A;  2C5C A;  3NE5 B;  4DR4 L;  2FLP A;  5KT4 A;  1DJR D;  2DUD A;  2OQK A;  3UDF A;  4PZ6 A;  3LP8 A;  3H94 A;  1UWV A;  1IBM L;  4JV0 A;  4Q44 A;  4FF1 A;  3F2U A;  3OWE B;  3J81 W;  4R4O A;  3L7Z C;  2UUC Q;  4QL5 A;  4C3I B;  4GKK L;  1I3Q A;  3JAM E;  3KOJ A;  4A3I H;  1H9M A;  2EJF C;  2F0S A;  3OSP A;  3Q8R B;  4F4Z A;  5LL6 b;  4ED0 A;  1IL8 A;  1GM5 A;  3AFQ A;  1R9T A;  3G4S A;  2W6Q A;  4KV6 A;  3BZK A;  4X66 L;  4B3M H;  1XJV A;  1D5Z C;  1JB7 A;  3IFD A;  1KRS A;  4FBT A;  1J9O A;  3CF5 A;  2ZJT A;  3BDC A;  4GOP C;  2PPB C;  4ED3 A;  3RLO A;  4JPB W;  3V4S A;  4ZYS A;  5K36 G;  4B3T Q;  3NEN A;  4GN3 B;  4O3N A;  3ERQ A;  2B2T C;  4CJ2 C;  1U0L A;  4K8I A;  2EOT A;  2L9H A;  1MBY A;  2DJF C;  1F9R A;  3JAM c;  5LMN W;  2G9D A;  5BPH A;  1N48 A;  1JXL A;  4I50 F;  1VQI A;  2R61 A;  4DNR B;  1UAP A;  2HIV A;  1LUZ A;  1VQ7 A;  5L9X A;  2KSW A;  5IYC H;  2EVB A;  3Q8P B;  4RWS C;  2UUA Q;  4K6L A;  1ILP A;  3Q24 A;  2PMZ E;  4GLX A;  3FVQ A;  3S1N H;  1YI2 A;  1IOW A;  2OH2 A;  3NWS A;  5LA6 F;  4RCO A;  3J7Z C;  4DR6 L;  3DWQ A;  3UDI A;  5CR3 A;  5KT6 A;  3A5Z B;  1FJG H;  2RGR A;  4X3T A;  5KFU A;  1U4M A;  3NTI A;  4K2L A;  4A3M G;  4TQU S;  4A3E H;  2WB1 B;  2CZG A;  3E5S A;  5D14 A;  2VQE Q;  4FBU A;  4DUY H;  5EWE A;  1F9Q A;  1H9S A;  2A68 C;  1IYV A;  3PW4 A;  3TDQ A;  3VR2 A;  4YQW A;  2OTJ A;  4EGJ A;  4YR0 A;  2HHH H;  3KBX A;  4H44 C;  1MJC A;  3K0Y A;  1SRO A;  2OT2 A;  4ZKC B;  2QK4 A;  4RFB A;  4TSS A;  4IAJ A;  3R8B A;  4O3O A;  4A2A A;  1VQE A;  1M90 C;  2QEX A;  2PNH A;  2E2H H;  1TWH A;  5L1K A;  1X32 A;  3T1Y L;  1DZ1 A;  5C4X G;  4AYB B;  1K8O A;  1RK5 A;  5M3M G;  3UFX B;  1HXY D;  2XGT A;  1Y1V G;  4YHH Q;  5JAV A;  4J9R A;  3F2B A;  3CRL C;  4B08 A;  1HZC A;  2GPW A;  2NZO A;  2ATW A;  3BG5 A;  3ULL A;  1UE1 A;  1DV1 A;  3I91 A;  3NQI A;  4IJL A;  1HNZ L;  1TWA A;  4DR4 H;  4A2B A;  3ZJY C;  4EQP A;  1E4F T;  3RB4 A;  1IBM H;  4A3B H;  2Z6K C;  4C2M A;  2FKL A;  2VQF Q;  2VXW A;  3Q23 A;  4A3I B;  1KHI A;  5LYJ F;  4IUU A;  4PZ8 A;  1YIJ A;  4GKK H;  2K5H A;  4A3L H;  2YTX A;  1I50 H;  2LMC B;  1JWS D;  3U9S A;  4K8J A;  4R9W A;  4N9P A;  2CCZ A;  2R6G A;  3PCO B;  1SNO A;  4X66 H;  5J39 A;  4LFA L;  3N52 A;  2EXZ A;  5JJZ A;  1GHJ A;  3GLK A;  5BPF A;  1W2B A;  2Z9H A;  4QMG A;  1SBB B;  4P75 A;  1S40 A;  3TP8 A;  5FD5 A;  5AJ3 L;  2GLT A;  3FKI G;  4ZUJ A;  4YY3 Q;  2IHE A;  3JAM W;  2DN8 A;  2ZTC A;  3SXH A;  1GKH A;  2QA4 A;  2OWO A;  3Q8D A;  4N9T A;  4YR3 A;  2WKC A;  3MWY W;  4UY8 C;  4DR7 Q;  3DM1 A;  1VCI A;  1EYZ A;  4DR6 H;  4WJ4 A;  3EBE A;  3NGD A;  3HOW H;  2C35 B;  2KEE A;  2Q8T A;  4ED2 A;  5KFO A;  5D1P A;  3A7L A;  4A3D H;  2A69 D;  3A74 A;  4BWG B;  4O3Q A;  1B6S A;  4MIU A;  2XCA A;  3RTX A;  3MXG A;  5KT5 A;  2K50 A;  4UFZ A;  2FHT A;  4M8A A;  5IGB A;  4BS9 A;  4DR1 Q;  2HCI A;  2WE6 A;  4Q45 A;  5BR8 Q;  3BU2 A;  2NVY B;  2E2H B;  3PO2 G;  3KTM A;  3NP8 A;  3FHW A;  4NP5 A;  4A3G H;  2SOB A;  1UNS A;  4U7C A;  2YTV A;  2IY5 B;  3T1Y H;  1G51 A;  1STH A;  4C3J B;  3S15 H;  4A93 H;  1EZ1 A;  2CQY A;  1K28 A;  5DGB A;  2HGS A;  3AQQ A;  1JJ2 A;  2R8I A;  1WTH A;  3K5M A;  4IPC A;  1CI3 M;  4UCR A;  2W9B A;  1STB A;  1RDP D;  4DL2 A;  1RJT A;  1TAE A;  4NMZ A;  4JI5 Q;  1HNZ H;  3EIV A;  1FL0 A;  1B9M A;  2UUB Q;  4A3B B;  5LP6 F;  1HH2 P;  4R4Q A;  1M7J A;  3HRZ C;  1ILQ A;  5KG3 A;  4HSV A;  4NXN Q;  3T5L A;  2VS1 A;  4RKL A;  1DYQ A;  4DR5 L;  1EFI D;  2EJM A;  2W9A A;  4MTE A;  2AGQ A;  4QB4 A;  3SDZ A;  1X54 A;  2JA5 H;  3G6V A;  3LWE A;  3I70 A;  4AQY L;  2K5N A;  2JA7 H;  4RZQ A;  3T56 B;  2MP1 A;  1RTN A;  1TWF A;  3R5X A;  4Y8V B;  4LFA H;  3F2C A;  4DK1 A;  4BXX G;  1IW7 C;  5KFR A;  3GTJ H;  2N49 A;  2VA3 A;  3U4V A;  1X3F A;  5LHY 1;  3P75 A;  5IYB H;  4ED6 A;  3HXL A;  1BGW A;  2KQ3 A;  2F4V H;  3FKI A;  1Y69 U;  5FPO A;  1RYS A;  3D6C A;  3I4N H;  3GIM A;  4ECS A;  5CV7 A;  2YCH A;  4GNX A;  3U9T A;  1IBK H;  1G6Z A;  5C0X G;  4P72 A;  1VF5 C;  4JI8 Q;  4RHR A;  3K8A A;  3RB3 A;  2OF1 A;  2QCP X;  2VUG A;  5KFM A;  4OON A;  4HIO A;  1RTO A;  5C0X I;  4F87 A;  4YB8 B;  4FXK C;  4R1J A;  4R7R A;  3U9O A;  4FP5 D;  1HNW Q;  4POG A;  1KIX A;  5IWA L;  4JV5 H;  5EQ0 A;  1O7L A;  5CYU A;  3W1B A;  4OX9 L;  3KJP A;  4B3S L;  5G3L F;  1TWC H;  4EQN A;  1BCP B;  4LFB L;  4EEQ A;  5IGD A;  4BA1 I;  3L2P A;  4WOR A;  4A3D B;  3STB C;  4DLK A;  1SDF A;  4FNF A;  3C0F B;  3CME A;  4LSX A;  3BQ1 A;  3AB9 A;  5KEE A;  2VL6 A;  1O78 A;  4JBK A;  3S16 B;  3MWE A;  2JP1 A;  3BAA A;  2G9H D;  3DM3 A;  3CAM A;  2EYO A;  4LF7 Q;  1YNX A;  1JCK B;  1Q8K A;  1G91 A;  3WDN A;  4A3G B;  1K0R A;  1JWM D;  3IL8 A;  1TXY A;  1RJR A;  1BCP C;  2R8H A;  2YRW A;  1ZXT A;  4ZLT F;  1N36 Q;  4ED8 A;  1J5E L;  1WCM A;  5KRU A;  3NXW A;  3OYY A;  4XYQ A;  4A3J H;  1IL2 A;  3GTQ H;  2EYM A;  2PI2 A;  4PNY A;  4Q43 A;  3MR6 A;  2E2I H;  3K57 A;  4DV1 Q;  3E9I A;  5M5X H;  3MFG A;  4TQS A;  4FDB A;  2LS0 1;  3TSS A;  2R8J A;  2CQA A;  2QDB A;  1SSO A;  3F1Z A;  1EQQ A;  2TSS A;  5H80 A;  4O0A A;  4K0K L;  4H13 C;  5E3F A;  4TV9 F;  1X56 A;  3L4J A;  1L2Z A;  3NSW A;  5EPK A;  3EN2 A;  4DV3 Q;  3S1M H;  4CDC C;  2RKS A;  4AH6 A;  2NYZ D;  5T1I A;  1EQT A;  3D0F A;  1OO9 B;  1HTL D;  1SMY D;  1EYD A;  2JA5 B;  4DR5 H;  2ICE C;  2F0P A;  4LF4 Q;  3KHG A;  4LFC Q;  1S5B D;  3M9B A;  1JT8 A;  2HUG A;  4DV5 Q;  1B1Z A;  5IOD A;  1KXL A;  4YJ3 F;  2IX1 A;  5C1P A;  1SEB D;  3GTJ B;  1CQJ B;  1I4Q A;  3BYY B;  1PK8 A;  4Q8E A;  4DA2 A;  5KG6 A;  4ZI7 F;  4QF4 A;  3TQY A;  3NPP A;  3I4N B;  2H5X A;  1FYC A;  1HTP A;  3TRZ A;  5JVH 3;  1C9O A;  1SJH D;  5C4Z A;  1G6P A;  1EU3 A;  2NVX H;  3R2T A;  3V6H A;  3ND9 A;  1TS5 A;  1B33 N;  5KG2 A;  2B2V A;  2F3W A;  4C1N I;  2F0G A;  1HA5 A;  5DLF A;  3GO5 A;  3PW7 A;  3KUP A;  2R7Z G;  1X55 A;  4DL5 A;  3D4D A;  1CKN B;  1PRT C;  3OIP A;  3JRX A;  3CU7 A;  5COY A;  5IWA H;  1W3S A;  1TWC B;  2PI2 E;  1LTG D;  2WAQ G;  4B3S H;  4QWE A;  4LFB H;  3J81 L;  4KTA A;  5CC4 A;  3EA6 A;  5C4H A;  1V4Y A;  4ECR A;  4IR1 A;  1HZA A;  2BCO A;  2B29 A;  2B2Y A;  5KGU A;  4MV8 A;  4DR3 Q;  3RBE A;  2K33 A;  3UI2 A;  2NVQ H;  4RNN A;  5DGA A;  1GO3 E;  1LTL A;  4YBZ B;  5IP9 G;  1Y1W G;  2VNU D;  1PH1 A;  1M1K C;  5KT3 A;  4RB3 C;  4ME5 A;  1GUW A;  4PDB A;  3OW7 A;  4LJZ C;  1N8R C;  5T14 A;  5C8Y F;  4BY1 H;  2JA6 G;  4ETS A;  1QNU A;  2IW3 A;  3KLW A;  3R3O A;  4LF8 L;  3C1E A;  2CW0 D;  4JI4 H;  2RF4 A;  4TRD A;  1J5E H;  1BDO A;  5LMN L;  1VQF A;  3GTQ B;  4DUZ L;  3HOY B;  5FJ8 G;  3H91 A;  2E2I B;  2ZM6 Q;  4OO1 G;  1I6V C;  1BF4 A;  3HEJ A;  4JV2 A;  3H4D A;  4KY5 A;  2V4D A;  1QE6 A;  5FLX c;  3HGB A;  1A63 A;  1U4L A;  2XIW A;  4K0K H;  4IUT A;  3W5O A;  1AZQ A;  5KFL A;  4B3R L;  3LGJ A;  1IBL L;  4OGQ C;  1KDC A;  5IP7 H;  4UP9 A;  5IYD H;  1VQP A;  3OW2 A;  1PA6 A;  3OSN A;  3RGX A;  1VQJ A;  4ECV A;  5HGT A;  4LF5 L;  1WI5 A;  1LTA D;  3TP5 A;  3I4O A;  1I94 L;  3GQB A;  1NY4 A;  2F52 A;  4X3K A;  3UQ8 A;  1YNN C;  4NXM L;  5FO9 B;  4JI2 H;  3R93 A;  4FVM A;  3S9W A;  2JE6 I;  3G6Y A;  2F0V A;  1YBY A;  2HQE A;  1PTO D;  2CW7 A;  2FP4 B;  1CK1 A;  3W1G A;  1G29 1;  1RHP A;  4J0M A;  1RKN A;  5BMV F;  2R92 A;  1EIG A;  3HKS A;  4HTH A;  1MHW C;  1K83 H;  1CQI B;  2R7L A;  4C3H H;  1HFN A;  2WFW A;  1BBX C;  1H95 A;  2EY5 A;  2A6E D;  2Y0S A;  3CCR A;  4R8U B;  1ROD A;  1KC8 C;  3EYY A;  3LWU A;  1TS2 A;  2B63 B;  3I7F A;  1SNC A;  1VS0 A;  4ECT A;  5I6Y A;  5I2Y A;  1W93 A;  3GTL A;  3TZD A;  2HT1 A;  4JI1 L;  1PXU A;  4EGV A;  5KKN B;  2J6S A;  4U6P A;  3PN1 A;  2M9V A;  1WD1 A;  1K8A C;  2EIF A;  3S17 B;  1CUK A;  3GTK H;  1RJQ A;  2WAQ A;  5KFZ A;  3CQZ A;  1SYF A;  2PN1 A;  1AN8 A;  3K7A B;  3OIQ A;  1NMF A;  4DV4 L;  4IWX A;  2IBK A;  4IFD I;  2YZN A;  2B2W A;  1PH3 A;  4IZ8 A;  4JBW A;  1LAB A;  2QYZ A;  4E6I A;  4G7H C;  2HHH Q;  3H3V H;  1EYA A;  3SK6 A;  2FPP B;  1Y1W A;  1SN8 A;  4JK1 C;  1SYE A;  2SEB D;  3TQT A;  5HBR B;  1PFM A;  3OSO A;  3M4I A;  2SNM A;  5LL6 X;  2JA8 G;  3JZI A;  5KG1 A;  5FLM G;  4N8F A;  4HJ7 A;  1SE4 A;  4ZAI A;  3ORQ A;  2B2T A;  3VDY A;  4HCE A;  3JAM L;  4I65 A;  1PV4 A;  5BN3 A;  3OMC A;  1LTS D;  4DUZ H;  2L11 A;  3PUW A;  2CW8 A;  3PGZ A;  4JOI A;  1XNQ Q;  2K6A A;  2W8L A;  4EGQ A;  5KFY A;  1TKW B;  3I4L A;  3Q8Q B;  1QUQ B;  1SMY C;  2BQ3 A;  3K58 A;  3MFH A;  1BO0 A;  1GLV A;  5FLX W;  1P8L A;  3UE0 A;  1IZ6 A;  2ZTE A;  2HQL A;  1VQM A;  4JYA L;  4B3R H;  5JOB A;  3FEW X;  2N88 A;  1S5D D;  1K73 C;  1IBL H;  1NCV A;  1XMO Q;  4QIW B;  2Y0S E;  4ZCK A;  3W2D A;  4EYI B;  1CM9 A;  5C4J B;  1U4R A;  2IWH A;  1YJ9 A;  3A0J A;  3PO3 H;  4LF5 H;  2K14 A;  3HG9 A;  3M9O B;  1I94 H;  5J2T F;  5I2X A;  1XNR L;  4I4T F;  2DJG C;  1A3U A;  2JJQ A;  4JBJ A;  1GOZ A;  1ZYR D;  5DLQ E;  2M05 A;  5KT2 A;  2XN9 C;  1UEB A;  2Q2H A;  1GUG A;  4KHZ A;  5IGF A;  2UXD Q;  4X3S A;  4LF6 Q;  1V9P A;  4DAY B;  2WAQ E;  1N9W A;  1M0T A;  4HIM A;  3IN5 A;  4H0L C;  1K83 B;  4DAV A;  4J9S A;  2CQO A;  5CV4 A;  2I07 B;  5C3E H;  2LFN A;  2WB1 A;  4RKB A;  4O2A F;  1PHJ A;  4DK6 C;  5KND A;  1B3A A;  3HFZ B;  2N55 A;  4TVA B;  4GKJ L;  5EWF A;  1NMG A;  1WOC A;  2W8K A;  4IRC A;  1TA8 A;  4J9M A;  3HOV G;  3T1H Q;  1VQO A;  1S5E D;  2ASL A;  2PCF B;  2PQA B;  4YIJ A;  3CMA A;  2W71 A;  5EWG A;  2AUK A;  1X3E A;  3QZ8 A;  4JI1 H;  3MEH A;  1WFQ A;  4F50 A;  1E2Z A;  1L2F A;  1TR5 A;  3ICE A;  2F0D A;  1W6K A;  3KLR A;  4CKE A;  1PH6 A;  3QB3 A;  4IRD A;  4DAM A;  2F0N A;  1D2B A;  5KFA A;  5DNF A;  1WTP A;  4MV6 A;  1V1P B;  2CWA A;  4L5Q A;  1KRT A;  4C3J G;  1CTM A;  1EY4 A;  5EBD A;  1GSH A;  4AYB A;  1A3V A;  3Q6S A;  4DV4 H;  2V5A A;  1STE A;  3ERS X;  5IGE A;  1ULZ A;  3CC4 A;  5C44 G;  3SE7 A;  1T5E A;  4NKL A;  2RDG A;  5IGC A;  5IE8 A;  3I12 A;  1RIP A;  1BBW A;  5D3D A;  3GTM H;  4PMC A;  4LW1 A;  1PH4 A;  1E1O A;  4KHP L;  4OHJ A;  1BCP F;  4DV6 H;  4Y7N B;  4E4T A;  3GIL A;  1Q1B A;  5KNB A;  1EHI A;  2LKV A;  2OXP A;  1CHP D;  5M3F B;  5KFH A;  1V8Q A;  3K3P A;  3VA5 A;  4A3L G;  4J9P A;  2BE5 C;  3H3V C;  1AE2 A;  1NE3 A;  1RF2 D;  4CKC A;  3PF5 A;  1A9X A;  3GV5 B;  1NTG A;  3KFU A;  1ZHS A;  1DIK A;  3F2D A;  4O42 A;  2NB0 A;  1SFO H;  2X6G A;  4X65 Q;  4HSP A;  2F0E A;  3GV8 B;  1GUS A;  4LMY A;  4RGM A;  5D1O A;  4GOP B;  5JQW A;  2YZG A;  4J9Q A;  4JYA H;  3J80 i;  2WB1 E;  1EOT A;  3S2H B;  1KJ9 A;  1GYF A;  1M0W A;  4RAY A;  3WO0 A;  1MJE A;  4HQ6 A;  4A4I A;  1S0N A;  4YWL A;  3ZYY X;  2E2D C;  1EIY B;  3N43 B;  2AQ4 A;  3K7U C;  4DK3 C;  5C5M A;  5DG8 A;  2JEF A;  2QEJ C;  1E7Z A;  1XNR H;  1WSC A;  3I90 A;  1EY5 A;  4KN4 C;  1Q82 C;  3HOX B;  1UE7 A;  3KLS A;  5GAG C;  1VQ5 A;  3NWT A;  4MA0 A;  5EDW A;  3PZP A;  1B8A A;  2QW7 A;  1XTD A;  1YNJ D;  1F2M A;  2P0A A;  1ET6 A;  1DV2 A;  1Z6H A;  4RGT A;  3TEH B;  5GAD C;  1GJX A;  2M00 A;  2F4V Q;  1IYJ B;  2SCU B;  2NN6 H;  1Z9F A;  3LML A;  3D8G A;  2J6U A;  4FS2 A;  5C3E B;  3GTP H;  1JJG A;  1IBK Q;  1UC8 A;  3CCE A;  3RN2 A;  3NEL A;  4X64 L;  3NBH B;  4LF9 Q;  5M5Y B;  4WFN 3;  4C5A A;  5KG7 A;  2N8N A;  1HZB A;  2EY2 A;  3PIO 3;  2A19 A;  2F0J A;  1N33 L;  2I0Q A;  5DG7 A;  3M4P A;  2VUM H;  2ATL A;  4R4C A;  2F3V A;  2YYZ A;  5I9O A;  4LUZ A;  4BBR B;  5D65 A;  4JI3 L;  4RB1 A;  1PRT F;  4JV5 Q;  3GIK A;  1NJI C;  4IWY A;  4L5S A;  2KHS A;  2NVY A;  2E2H A;  2C22 A;  4IJH A;  1NBW A;  3KF8 B;  3CCL A;  4EBE A;  1VF7 A;  4QWD A;  2RSN A;  3PUV A;  2K5V A;  3MVV A;  5IIF A;  1KJQ A;  3W3A A;  4DV2 L;  4HN7 A;  1VMP A;  1SYD A;  4K2K A;  1XPO A;  2LSS A;  2E5L L;  3GTM B;  1DON A;  1EUJ A;  2BDO A;  2GVA A;  3HZX A;  2I5H A;  2MNA A;  5BN4 A;  3KYH C;  2MO0 A;  4EQO A;  2FK1 A;  3BVZ A;  3G48 A;  3CKI B;  1WTQ A;  4KHP H;  5A35 A;  2PZU A;  2UXC Q;  2B39 A;  4FU0 A;  5JVD F;  2W9C B;  4IZO A;  2EYH A;  1A3T A;  4APM A;  5EZY F;  1EOV A;  4IN3 A;  4JI6 L;  1S5C D;  1VQ9 A;  3IAY A;  3H40 A;  3E0E A;  1HCZ A;  1WTO A;  2NU6 B;  1EY7 A;  5KFS A;  1U4P A;  4FF3 A;  2JXM B;  2OTL A;  1SFO B;  1BXT A;  1VQ8 A;  3RFC A;  3TP6 A;  3HOZ H;  2NTT A;  4XDX A;  1F9S A;  2GN5 A;  4N8X 1;  1MKH A;  2YYA A;  2F0T A;  2MO1 A;  4XT1 B;  1ZYR C;  2EDG A;  1L1O B;  3V2T A;  3VMM A;  1EY9 A;  5E4W C;  5EKI A;  2HJW A;  5K5P A;  4CDD C;  4TV8 F;  3PW2 A;  3QZ7 A;  2PYK A;  1CS0 A;  4CC6 A;  1D1K A;  4J15 A;  3I3C A;  2ES2 A;  3KK7 A;  1XMQ L;  1BNZ A;  2UVU A;  4DL4 A;  1CZG A;  1L1O C;  2YZM A;  2B2U A;  3H0G H;  1HRJ A;  2UUC L;  3DHQ A;  4BWS C;  1VQC A;  1JOO A;  2KOL A;  2W7O A;  5KFQ A;  4LH6 A;  4RUC A;  3KDF B;  5DM6 3;  1RD9 D;  3GID A;  1E2W A;  3SEB A;  4BBS G;  4QWA A;  4X64 H;  3QR8 A;  1SR3 A;  2VQD A;  2R86 A;  5KT7 A;  1FNV A;  2VUM B;  2R93 H;  4GLV B;  1N33 H;  1O7Z A;  1R4Q B;  1JE5 A;  3S1N B;  2FPG B;  1PZJ D;  1PYS B;  2A6H C;  2NZH A;  4OIJ A;  1E0B A;  4JI3 H;  1YHA A;  1CQV A;  4A3E B;  5CA0 F;  1F77 A;  4RAZ A;  4MZ9 A;  5KFG A;  4POF A;  2XWJ B;  5J1Z A;  3WOE A;  1WVL A;  1HNX L;  4QWC A;  3H15 A;  1VQD A;  2MFI A;  3SK5 A;  3QJY A;  4LFB Q;  3G7L A;  1MIU A;  5KX5 F;  4RAU C;  3HOY G;  3WNZ A;  4FF2 A;  1LYL A;  1E1T A;  1WTW A;  4DV2 H;  2FJZ A;  3I73 A;  5K36 H;  5JEA G;  1T5X D;  1QVG A;  1CZW A;  2VY3 A;  2XRS D;  3PV0 A;  4CGY B;  3PIP A;  2WYO A;  2L1B A;  3ORR A;  3MC0 B;  3LWB A;  2BH2 A;  3GIJ A;  4WRD A;  2R8G A;  1B70 B;  1IYU A;  4JV1 A;  1LTI D;  2DWC A;  1X3Q A;  4JI4 Q;  4R4T A;  1WCM G;  1J5E Q;  2VR1 A;  4MV4 A;  3Q0A A;  5I9P A;  3OMG A;  3PR5 B;  2JA5 A;  2DY7 A;  3RBD A;  1STG A;  2C2R A;  2GA4 B;  2O03 A;  1GUN A;  1Q86 C;  4KY6 A;  3RV4 A;  3PVX A;  4KKS A;  2XGQ A;  4A3K G;  5DQI A;  4RU9 A;  4CDF C;  1HR0 Q;  3GTJ A;  2BA0 A;  3M4Y A;  3BZD B;  5KFK A;  3AFP A;  2I5M X;  2ZXP A;  3OWF A;  3TII A;  2HVR A;  2F0W A;  3L9A X;  5EAY A;  3FMC A;  1VQL A;  1I50 B;  1IKM A;  1DM0 B;  4X62 Q;  3DWP A;  3N6R A;  4YHH L;  1Z47 A;  1OXU A;  4JI2 Q;  3K80 C;  4GLA C;  1ESF A;  3QIA A;  2B63 G;  1XMQ H;  3QOL A;  4U68 A;  1L0Y B;  2F0H A;  1KEE A;  1ZKO A;  3WOF A;  2M2L A;  1PYW D;  5CV8 A;  5J3B A;  3H0G B;  4R4I A;  2CVR A;  4M1U B;  3KAK A;  3E3X A;  1QWY A;  4KJO A;  3S2D H;  3S14 H;  4FS1 A;  5FOB B;  4UAI A;  1N34 Q;  1KQS A;  2VQF L;  3BG3 A;  2L5T A;  1LT3 D;  1CKN A;  5C4X H;  2UUC H;  3I8Z A;  1GSA A;  1JMC A;  5M3M H;  3CCJ A;  1TWC A;  2V4R A;  1Y1V H;  1OXS C;  2WTF A;  4XQQ A;  3RLF A;  1VBH A;  2R93 B;  1QZH A;  3F8N A;  3L4K A;  4KKT A;  5KFV A;  2ID0 A;  4ULL A;  4EEY A;  1V43 A;  1IXR A;  4YJ2 F;  3CCU A;  1JC7 A;  1LM0 A;  1E22 A;  4FYD A;  1PYB A;  2R82 A;  2ALZ A;  5J2U F;  1QB5 D;  3AMU A;  3M3Y H;  1RCV D;  5FLX L;  4YY3 L;  1STN A;  3HOW B;  1JR0 D;  1YEZ A;  4GZY C;  3MXU A;  1HNX H;  5KFI A;  1I4X A;  4A3C G;  4RGO S;  3SI8 A;  3GTQ A;  2W6P A;  1TY0 A;  4KD3 A;  2NU9 B;  1JOR A;  2E2I A;  1TWF H;  3D4W A;  4DR7 L;  2WIN B;  4MV7 A;  2G5D A;  3VYR A;  1UUP A;  3LNN A;  1KAW A;  5EJW A;  3ULP A;  2ZJQ A;  4FXD A;  3JRW A;  1E3P A;  4DAP A;  3E6Z X;  3CCV A;  1N32 Q;  3FKI H;  4TUY F;  4U67 3;  3ETH A;  2MHV A;  3G6J B;  5E1F A;  3KAL A;  3S15 B;  4A93 B;  2UU9 Q;  4DUZ Q;  4DV7 Q;  5L37 A;  2FK2 A;  2I46 A;  4DPG A;  4A3F G;  5F2D A;  5I4D A;  3DF7 A;  1OXT A;  2QF7 A;  1PFB A;  5ISR A;  3BJY A;  4XYO A;  4GS3 A;  3BZC A;  4IUR A;  1MGS A;  5LMU Q;  1FVI A;  2K28 A;  1ET9 A;  4DR1 L;  5JJK A;  1FGU A;  1K8G A;  5BR8 L;  3I4M G;  2J0T D;  3CHB D;  4I55 F;  1X3P A;  4G7Z C;  1K1S A;  4MTN A;  2C2D A;  2ZJP A;  5JUM A;  1RK6 A;  4DGZ A;  2UXB Q;  4IUQ A;  4PWQ A;  3OUZ A;  1EZ6 A;  1C0A A;  2HDM A;  3MEF A;  1Z2O X;  2UVV A;  4ZQI A;  2JA7 B;  2J4X A;  1XX8 A;  4AQY H;  4IOC A;  4R8U A;  4BY7 G;  1BXR A;  2K01 A;  3F8T A;  2B63 A;  1JE4 A;  1LO5 D;  4J8Q A;  2ICI A;  3SHL A;  3RB0 A;  3V4Z A;  4NB3 A;  3K81 C;  2UUB L;  3S2D B;  3PW5 A;  2IJ0 A;  4F7X A;  5M5W H;  2NTS A;  1X9N A;  2R92 G;  4C1N K;  4ZKB B;  2X6L A;  5C4X B;  3SK4 A;  1IOV A;  1ICW A;  2Z1C A;  4B9X A;  1PRT B;  4H7B A;  5M3M B;  4HJ5 A;  1U5K A;  2AWN A;  4F8M A;  4Q0Y A;  4JI7 Q;  1Y1V B;  4HJ9 A;  2Y0S G;  4JI0 Q;  4APV A;  1RL2 A;  2I80 A;  5GAE C;  4DXF A;  2WAC A;  3Q2O A;  2EY1 A;  4WJW A;  2JEG A;  1A15 A;  3C1F A;  2YS6 A;  3CCM A;  4YAJ B;  5JH7 F;  2BH8 A;  3Q22 A;  1KJI A;  1SRU A;  2WII B;  4EQ5 A;  5C0X J;  2YL2 A;  1VMC A;  5KFF A;  4RNM A;  4HJA A;  1BBU A;  3M3Y B;  2A69 C;  1P16 A;  4MN3 A;  2VA2 A;  2XD4 A;  4KI0 A;  1I5F A;  2DPJ A;  1S0M A;  3V05 A;  3K5L A;  3N42 B;  2WP8 J;  4YY3 H;  4OX9 H;  2ZTD A;  2XCL A;  3CPF A;  5HUR A;  3PR4 A;  4DR2 L;  1SNQ A;  3G6X A;  4JI8 L;  1C8C A;  3J81 j;  5M3F G;  2AQ3 B;  2KCT A;  4DV4 Q;  4LUO A;  3RLN A;  3T53 B;  3K5H A;  3T51 B;  3ND8 A;  3VPD A;  1S4Z A;  2L4N A;  2OLS A;  1EIF A;  2RGV A;  4DR7 H;  3TS2 A;  2EXD A;  1EFW A;  4ECZ A;  1XPU A;  1I6H H;  2A5H A;  1S9F A;  1Z2N X;  2RHQ B;  1QUQ A;  2BR0 A;  3ER0 A;  1HNW L;  1BR9 A;  5KNC A;  4DV6 Q;  3IG0 A;  3TIG A;  5GAH C;  2SNS A;  3PSI A;  1CHQ D;  4HNT A;  5CV9 A;  2FLN A;  1BOS A;  4EG0 A;  1A8V A;  1C4Q A;  5C0X H;  4QIW A;  3VR5 A;  4A3J B;  4C3I G;  4UP8 A;  1O7I A;  4MTK A;  5M5X B;  2AWO A;  3WWV A;  1FNW A;  4C5C A;  1EIH A;  3MR5 A;  3HOX G;  1NAP A;  1I4H A;  1MZB A;  1M8A A;  1XPR A;  3S1M B;  4DR1 H;  3PQI A;  4GNX C;  4LF7 L;  4OO1 I;  3A54 A;  3I55 A;  5BR8 H;  1VKZ A;  4PG3 A;  5H1S E;  4DAY A;  4O3S A;  1N36 L;  4KN7 C;  1IKL A;  4KLK A;  1SJE D;  1TQO A;  3S24 A;  4OEL B;  2X0S A;  1K83 A;  1M6V A;  5IY0 A;  3J7A V;  3RZO H;  2RA4 A;  5CB4 F;  1UE6 A;  4DV1 L;  1DGS A;  4B3M Q;  2IX3 A;  1VQN A;  2MPM A;  1NR4 A;  4K5W A;  4Y52 H;  2JEB I;  1BJT A;  3M7N A;  2Z4H A;  3PUX A;  1I6U A;  2XRQ D;  1D5M C;  1YHQ A;  1TWG H;  2PQA A;  1E2V A;  4KK7 A;  4DV3 L;  2UUB H;  5LL6 S;  2GVB A;  1W96 A;  2HVS A;  2JEJ A;  5GRO A;  4BBR G;  1HZ9 A;  4DFA A;  1KDB A;  5KFJ A;  1B44 D;  3RNU A;  2VPS A; 
#chains in the Genus database with same CATH homology
 4LW1 A;  1B7Y B;  3B6Y A;  1E1O A;  2WB1 G;  1W2B A;  1PH4 A;  4LFC L;  4LF4 L;  4KHP L;  4P75 A;  1S40 A;  4JG2 A;  1Q1B A;  3CCS A;  3GTO H;  2K75 A;  5AJ3 L;  4JCV E;  3FKI G;  1SE8 A;  4YWK A;  2KHJ A;  1HJP A;  4YY3 Q;  2IHE A;  3CCQ A;  2MQH A;  4A3L G;  2ZTC A;  4B3R Q;  1AE2 A;  3CC2 A;  1NE3 A;  3PF5 A;  1IBL Q;  1NTG A;  3KFU A;  1GKH A;  2QA4 A;  4JI4 L;  2OWO A;  5GQO A;  3F2D A;  3Q8D A;  4HIK A;  1FJG Q;  4QIW E;  2KCM A;  1SFO H;  4X65 Q;  4LF5 Q;  4UY8 C;  4DR7 Q;  1I94 Q;  4GOP B;  1K9M C;  3HOY H;  4X6A H;  1VQK A;  3J80 i;  1Y14 B;  2WB1 E;  4DUY Q;  4NXM Q;  1EQR A;  1VCI A;  4AYB G;  1Q1E A;  1MJE A;  4A4I A;  4YWL A;  1EIY B;  4JI5 L;  4WJ4 A;  3EBE A;  2K4K A;  4DNI A;  2C35 B;  4QGU A;  3K7U C;  4DK3 C;  1HR0 L;  3HOW H;  2CWP A;  3M4Q A;  2YTY A;  4QY7 A;  3PO2 H;  1SLJ A;  1E7Z A;  4NXN L;  2E2J H;  1Q82 C;  1WCM H;  1UE7 A;  5GAG C;  5HGQ A;  1VQ5 A;  4A3D H;  4IPH A;  3A74 A;  1B8A A;  1XTD A;  4KHP Q;  4GOP A;  4X62 L;  1GD7 A;  1PH9 A;  1KD1 C;  3TEH B;  5GAD C;  2F4V Q;  1IYJ B;  4JI2 L;  3PF4 A;  2K50 A;  4UPA A;  4A3I G;  1Z9F A;  4DR1 Q;  5BR8 Q;  3GTP H;  1IBK Q;  1JJG A;  3BU2 A;  5ELO A;  3CCE A;  3RN2 A;  4A3K H;  4DR3 L;  3PO2 G;  4JI1 Q;  3GTL H;  3NEL A;  3FHW A;  3NBH B;  4X64 L;  3AYH B;  4LF9 Q;  4A3G H;  1KL9 A;  2CFM A;  2IX0 A;  2YTV A;  1D8L A;  2IY5 B;  1G51 A;  2N8N A;  1HZB A;  1N34 L;  2R7Z H;  2A19 A;  4XTC S;  3S15 H;  1N33 L;  4A93 H;  2I0Q A;  4DR4 Q;  3M4P A;  4O2D A;  4JBM A;  3AQQ A;  1JJ2 A;  2VUM H;  3H3V I;  1VQ6 A;  4R4C A;  1IBM Q;  4IPC A;  3CPW A;  1EWI A;  2YYZ A;  4LUZ A;  3CQZ H;  3HOU H;  4JI3 L;  4GKK Q;  4JV5 Q;  1NJI C;  3GD7 A;  4OXP A;  4JI5 Q;  4L5S A;  3EIV A;  2B63 H;  1FL0 A;  1YIT A;  4H02 A;  2UUB Q;  1T9H A;  4IJH A;  1HH2 P;  1YHB A;  4R4Q A;  3UDX A;  1NBW A;  5IYC G;  2ZM6 L;  3KF8 B;  4BXX H;  3DLL A;  3CCL A;  4X66 Q;  4NXN Q;  5IT9 c;  2A1A A;  2AKW B;  2VS1 A;  1X3G A;  5IP9 H;  1Y1W H;  3GTG H;  1S3O A;  4DR5 L;  2VUM G;  3PUV A;  2K5V A;  4GNX B;  2KEN A;  1X54 A;  4DV2 L;  2JA5 H;  2B3G A;  3S17 H;  2JA6 H;  3HOU G;  2D62 A;  4AQY L;  2K5N A;  2JA7 H;  5JJL A;  1XPO A;  2LSS A;  2E5L L;  3G71 A;  4IO9 A;  1EUJ A;  2GVA A;  3J81 i;  3K7A H;  3PO3 G;  2I5H A;  2MNA A;  4A3E G;  3KYH C;  2MO0 A;  3F2C A;  4NPS A;  4BXX G;  3G48 A;  5FJ8 H;  3GTJ H;  3J7A 5;  2BA1 A;  2N49 A;  3U4V A;  2UXC Q;  1X3F A;  1Q46 A;  3U58 A;  5IYB H;  4YCU A;  4YCW A;  4BA2 I;  1EOV A;  2R7F A;  3I4N H;  4JI6 L;  3MXN B;  1N32 L;  1VQG A;  1VQ9 A;  1K3R A;  4GNX A;  3KF6 B;  4JYA Q;  3E0E A;  4RG1 A;  3PIO A;  5C0X G;  2YU9 H;  4P72 A;  1YVC A;  4JI8 Q;  2OTL A;  4DR6 Q;  1VQ8 A;  4A3C H;  3K8A A;  2Q2I A;  1PFS A;  2UU9 L;  3HOZ H;  3I2Z A;  4LNQ A;  4DV0 L;  4OON A;  5C3E G;  4HIO A;  2GN5 A;  4DV7 L;  3U50 C;  1MKH A;  2N78 A;  2MO1 A;  3AEV A;  5C0X I;  3HKZ E;  1XNR Q;  2Q2T A;  1L1O B;  1VQB A;  4R1J A;  2Z6K A;  4P74 A;  1HNW Q;  1PH2 A;  5LMU L;  1KIX A;  4POG A;  5IWA L;  4IFD J;  2JEA I;  4OWW B;  3W1B A;  4OX9 L;  4OWT B;  1V1Q A;  2OQ0 A;  3KF6 A;  3KJP A;  3S1R H;  1VQ4 A;  1HR0 W;  1Q12 A;  1TWC H;  4B3S L;  4LFB L;  3UE1 A;  4J15 A;  4BA1 I;  3L2P A;  2ES2 A;  2UXB L;  1XMQ L;  3STB C;  4P71 A;  3I56 A;  3CME A;  1AH9 A;  4A3B G;  2VL6 A;  5C4J H;  1CSQ A;  4JBK A;  1L1O C;  4A3F H;  1L1O A;  3T1Y Q;  1EYG A;  4GKJ Q;  3RZD H;  3H0G H;  3M4O H;  4QQB X;  1D7Q A;  3DM3 A;  3CW2 C;  4DV5 L;  2UUC L;  3CAM A;  4A75 A;  1VQC A;  2VZA A;  4LF7 Q;  1YNX A;  1Q8K A;  2KHI A;  1K0R A;  3KDF B;  1TXY A;  3SGI A;  3I4M H;  4BBS G;  1N36 Q;  1SR3 A;  1UE5 A;  4XIG S;  2I5L X;  1J5E L;  1HNZ Q;  4DV0 Q;  3J80 c;  2R93 H;  1BKB A;  4GLV B;  3OYY A;  4A3J H;  1IL2 A;  3GTQ H;  1JE5 A;  2PI2 A;  4QJF A;  1QVC A;  2E2I H;  4JI7 L;  1GVP A;  4DV1 Q;  3E9I A;  5M5X H;  1PYS B;  1CKM A;  4JI0 L;  2QGQ A;  4FDB A;  2NZH A;  5K36 G;  1WYD A;  4YWM A;  1YHA A;  3F1Z A;  1EQQ A;  4BY7 H;  2Z0S A;  4O0A A;  4K0K L;  1X56 A;  4MZ9 A;  4POF A;  4L5T A;  4DV3 Q;  3EN2 A;  1HNX L;  3S1M H;  4GN4 B;  3KDF A;  1VQD A;  2MFI A;  3H15 A;  1XNQ L;  2NVT H;  4AH6 A;  4LFB Q;  1MIU A;  4A76 A;  4LFA Q;  3D0F A;  2R92 H;  1C7Y A;  3HOY G;  1AE3 A;  4IFD G;  1LYL A;  4MNO A;  4LF4 Q;  4LFC Q;  1E1T A;  3M9B A;  3UDG A;  1JT8 A;  2K52 A;  3BJU A;  5AJ3 Q;  2JA8 H;  2V1C C;  4DV5 Q;  5JEA G;  1XMO L;  5FLM H;  1KXL A;  1QVG A;  2D0P A;  2IX1 A;  4AYB E;  2VY3 A;  3PIP A;  3PV0 A;  3HOW G;  2BH2 A;  1B70 B;  4HID A;  2LXJ A;  4JI4 Q;  4R4T A;  5JJI A;  1BVS A;  1A62 A;  1WCM G;  1J5E Q;  3TQY A;  4A3D G;  1JJC B;  2H5X A;  1OXX K;  3TRZ A;  1C9O A;  2UXD L;  2D0O A;  4DV6 L;  1G6P A;  4LF6 L;  2NVX H;  1PH8 A;  2E8G A;  1J6Q A;  2NN6 G;  1Q86 C;  4IOA A;  4Y7N H;  4GN5 A;  4A3K G;  5M3F H;  3CXC A;  1I3Q H;  2A8V A;  1HNX Q;  1HR0 Q;  2RCN A;  4A3G G;  4JOI C;  3JAM i;  2BA0 A;  3GO5 A;  3NEM A;  2NN6 I;  3AFP A;  2I5M X;  2R7Z G;  4A93 G;  1X55 A;  2OCE A;  1R9T H;  1PH5 A;  2DGY A;  1CKN B;  5EAY A;  3PUZ A;  3T1H L;  1VQL A;  1W3S A;  3TS0 A;  1X65 A;  2PI2 E;  2WAQ G;  4DKA C;  4X62 Q;  4YHH L;  1Z47 A;  3J81 c;  3K0X A;  3M85 A;  1OXU A;  3KJO A;  4JI2 Q;  3K80 C;  4GLA C;  3S2H H;  2B63 G;  1HZA A;  2B29 A;  3PUY A;  2KBN A;  4C3I H;  4DR3 Q;  3JC6 6;  4LWC A;  5J3B A;  2NVQ H;  3S1Q H;  4X64 Q;  4R4I A;  1GO3 E;  1LTL A;  5IP9 G;  1Y1W G;  4L5R C;  3S14 H;  3S2D H;  2VNU D;  1KQS A;  1N34 Q;  4B3M L;  2VQF L;  1PH1 A;  1Q7Y C;  1M1K C;  1N33 Q;  5C4X H;  1CKN A;  1Q81 C;  2JA5 G;  1JMC A;  1N8R C;  3HOX H;  4BY1 H;  5M3M H;  2JA6 G;  3HOV H;  3CCJ A;  3KLW A;  2JA7 G;  4LF8 L;  1Y1V H;  1OXS C;  4EX5 A;  4WJ3 M;  3RLF A;  2VW9 A;  1YJN A;  4JI3 Q;  1ASZ A;  4JC0 A;  2RF4 A;  5LMN L;  1VQF A;  1QZH A;  2F3I A;  2JA9 A;  3OTO L;  4DUZ L;  5FJ8 G;  3E9H A;  2ID0 A;  3FP9 A;  1E24 A;  2JK8 A;  3RR5 A;  3STB D;  5IYB G;  2ZM6 Q;  1V43 A;  1IXR A;  4AIM A;  2NVY H;  4OO1 G;  3CCU A;  4LUV A;  1LM0 A;  4ALP A;  1E22 A;  2AHO B;  3I4N G;  5M5Y H;  1PYB A;  5FLX c;  4HJ8 A;  4DR5 Q;  3M3Y H;  1A63 A;  4YY3 L;  1YEZ A;  4C3J H;  4DV2 Q;  3W5O A;  4P73 A;  1PH7 A;  4B3R L;  3LGJ A;  4AQY Q;  1IBL L;  4A3C G;  5C44 H;  5IP7 H;  4ME3 A;  2E5L Q;  3HOZ G;  4UP9 A;  1WJJ A;  5IYD H;  1VQP A;  3OW2 A;  1FJG L;  4BBR H;  1PA6 A;  1VQJ A;  4X65 L;  4LF5 L;  1TWF H;  1WI5 A;  4DR7 L;  1I94 L;  3I4O A;  2ZJR A;  1NY4 A;  2F52 A;  4NXM L;  1KAW A;  4DUY L;  1TWH H;  4IPD A;  3ULP A;  5E7N A;  2ZJQ A;  4YCV A;  1E3P A;  4JI6 Q;  1SMX A;  2XTI A;  2YV5 A;  3CCV A;  1N32 Q;  3FKI H;  4UP7 A;  2JE6 I;  1YBY A;  4PMW A;  2HHH L;  2L15 A;  3D31 A;  3W1G A;  1CSP A;  1G29 1;  3L0O A;  2UU9 Q;  1OTC A;  5ELN A;  3OTO Q;  3G6E A;  4DUZ Q;  3HKS A;  4DV7 Q;  1TWA H;  1K83 H;  2EQS A;  4DPG A;  3U4Z A;  3RN5 A;  4C3H H;  4A3F G;  1X6O A;  2WFW A;  3H0G G;  1OXT A;  1H95 A;  4B3T L;  3CCR A;  2FXQ A;  4GS3 A;  1KC8 C;  4RMF A;  3BZC A;  4PZ7 A;  2ASB A;  2F4V L;  4C2M H;  5LMU Q;  1QVF A;  1FVI A;  3I7F A;  1VS0 A;  5IWA Q;  4DR1 L;  3ULJ A;  3GTM H;  4OX9 Q;  5JJK A;  1FGU A;  1K8G A;  5BR8 L;  3I4M G;  1IBK L;  4B3S Q;  4MTN A;  2HT1 A;  4JI1 L;  4LF9 L;  2ZJP A;  3CP0 A;  2R93 G;  2UXB Q;  1XMQ Q;  4A3J G;  1C0A A;  4DR4 L;  3MEF A;  1K8A C;  2EIF A;  2DUD A;  2OQK A;  3UDF A;  4PZ6 A;  2UUA L;  1CUK A;  1UWV A;  1IBM L;  3GTK H;  4IOC A;  4BY7 G;  4R4O A;  3L7Z C;  2UUC Q;  1NMF A;  3GDE A;  3F8T A;  4QL5 A;  4DV4 L;  4GKK L;  4IFD I;  3KOJ A;  4A3I H;  4JV5 L;  1PH3 A;  4JBW A;  4NB3 A;  3K81 C;  2UUB L;  2HHH Q;  4OWX B;  1GM5 A;  5M5W H;  3AFQ A;  1VQH A;  3H3V H;  3CC7 A;  2VQE L;  1X9N A;  3G4S A;  2R92 G;  4X66 L;  3BZK A;  2IT1 A;  2HIX A;  1SN8 A;  1XJV A;  4HJ5 A;  1JB7 A;  1KRS A;  1U5K A;  2AWN A;  3CF5 A;  4GOP C;  4JI7 Q;  3RLO A;  2JA8 G;  4HJ9 A;  2Y0S G;  4JI0 Q;  4APV A;  3IRB A;  4B3T Q;  1RL2 A;  2RHS B;  3NEN A;  4GN3 B;  5FLM G;  5GAE C;  4HJ7 A;  1U0L A;  3S16 H;  3VDY A;  3JAM c;  5LMN W;  4K0K Q;  1PV4 A;  1OXV A;  1VQA A;  3PUW A;  3CCM A;  1VQI A;  2BH8 A;  2IHF A;  2R7D A;  3PGZ A;  1SRU A;  2HIV A;  4JOI A;  3A5U A;  2JQO A;  4A3M H;  4EQ5 A;  5C0X J;  1XNQ Q;  1LUZ A;  1VQ7 A;  4HJA A;  2UXC L;  1BBU A;  1QUQ B;  5IYC H;  1P16 A;  3CD6 A;  4KI0 A;  1I5F A;  1P8L A;  3UE0 A;  1S72 A;  2WP8 J;  1IZ6 A;  2ZTD A;  2HQL A;  2ZTE A;  3CPF A;  2ALY B;  1VQM A;  2UUA Q;  4JYA L;  4GLX A;  2PMZ E;  4DR2 L;  3S1N H;  1YI2 A;  1K73 C;  2N3S A;  1XMO Q;  4JI8 L;  2Y0S E;  3J7Z C;  3J81 j;  5M3F G;  2KCT A;  4DV4 Q;  3UDI A;  4LUO A;  4DR6 L;  3A5Z B;  3RLN A;  1YJ9 A;  3A0J A;  1YZ6 A;  3PO3 H;  4A3M G;  5HY6 A;  1EIF A;  4TQU S;  4A3E H;  2K14 A;  3TS2 A;  1XNR L;  2EXD A;  1EFW A;  1XPU A;  2VQE Q;  2JJQ A;  1I6H H;  2RHQ B;  1QUQ A;  4JBJ A;  5DLQ E;  3ER0 A;  1HNW L;  3TRE A;  1UEB A;  2Q2H A;  4KHZ A;  2UXD Q;  4DV6 Q;  1A0I A;  5GAH C;  3PSI A;  4LF6 Q;  1V9P A;  4DAY B;  2WAQ E;  1N9W A;  2OTJ A;  1A8V A;  1MJC A;  1SRO A;  2AMC B;  2CKZ B;  4HIM A;  4UP8 A;  4IPG A;  1O7I A;  2CQO A;  3HKZ G;  1VQE A;  2AWO A;  1M90 C;  3WWV A;  5C3E H;  2QEX A;  1ASY A;  2PNH A;  2E2H H;  1PHJ A;  4DK6 C;  3T1Y L;  3HFZ B;  4TVA B;  4GKJ L;  5C4X G;  1NMG A;  1WOC A;  3HOX G;  4BY1 G;  5M3M G;  3HOV G;  3T1H Q;  1XPR A;  2XGT A;  1VQO A;  1L0W A;  4GNX C;  4LF7 L;  4OO1 I;  2PQA B;  1Y1V G;  4YHH Q;  3I55 A;  3CMA A;  1YJW A;  1QZG A;  4PG3 A;  4DR2 Q;  1X3E A;  3F2B A;  5H1S E;  1CKO A;  1HZC A;  1WFQ A;  1N36 L;  1L2F A;  2NZO A;  4KLK A;  2ATW A;  3S24 A;  3ULL A;  1UE1 A;  1HNZ L;  4IJL A;  3ICE A;  2Q2U A;  5IY0 A;  1PH6 A;  3ZJY C;  3RZO H;  1UE6 A;  4DAM A;  4DV1 L;  4A3B H;  2Z6K C;  1DGS A;  4B3M Q;  2VQF Q;  1VQN A;  4Y52 H;  1KRT A;  2CWA A;  4L5Q A;  2JEB I;  1KHI A;  3M7N A;  4PZ8 A;  1YIJ A;  3PUX A;  2K5H A;  3ERS X;  1YHQ A;  1TWG H;  4A3L H;  2PQA A;  3CC4 A;  4DV3 L;  2LXK A;  1I50 H;  2YTX A;  5IP7 G;  5C44 G;  4LF8 Q;  2GVB A;  1PVO A;  5IYD G;  5GRO A;  2CCZ A;  2R6G A;  4BBR G;  5IE8 A;  1HZ9 A;  3PCO B;  5LMN Q;  5JEA J;  4BBS H;  1RIP A;  4LFA L;  1BBW A;  3RNU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...