4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
4JI8Q 1YI2A 1N8RC 1GO3E 4XTCS 1EYGA 3CC7A 1SN8A 4GN4B 3JC66 4GOPB 3NEMA 4A3GG 2JK8A 3RLFA 1N34L 4C2MH 4QY7A 1E1OA 3UDIA 5JJKA 4JI3L 4A3IG 1UEBA 1X56A 5GAHC 4HIDA 4Y52H 5IE8A 2BA0A 2N49A 1Y1WH 1NBWA 3K7AH 3FP9A 2ZJPA 4DK3C 3GDEA 4DAMA 4QJFA 3KF6B 1D8LA 4O0AA 3T1HL 2ZJRA 3CCQA 4X62L 4A93G 1CKNB 4RG1A 4KHPL 2IX1A 1M1KC 1EIFA 1UE5A 4DV5L 4A3EH 3HOYH 1VQIA 1TWFH 4JI7L 1IYJB 1WYDA 2VY3A 4DR6Q 1TWHH 3K81C 5LMNL 3J7A5 4LF9L 2R7FA 1VQ5A 4BXXG 4GKKQ 1IBMQ 1IBLQ 2UUBQ 4KLKA 5M5YH 5M3FH 2Y0SG 3H0GG 4JG2A 1IL2A 3GO5A 2K50A 1MIUA 2Z0SA 2NVYH 1E1TA 1VQOA 1N33Q 3HOUG 4LUVA 4YY3L 4OX9L 4FDBA 2Y0SE 3SGIA 1PH2A 3GTOH 4B3RL 1YITA 2IHFA 4EX5A 3KDFB 3WWVA 4APVA 3H3VI 4JOIC 1YHAA 4DR5Q 1QUQB 1AE2A 3K0XA 4A3LG 1E24A 1H95A 2IX0A 3F2BA 4NXNL 4DAYB 1SLJA 4PZ8A 1YJ9A 4AYBG 5ELOA 3HKZG 1EIYB 2A8VA 3J81j 1K3RA 3CMAA 4TVAB 4R4TA 2MNAA 3CP0A 1VQ9A 2NZHA 1PFSA 3U50C 5K36G 4A3MG 1QVCA 5JJIA 2VL6A 5JEAJ 2UXCQ 5C0XG 1IBKL 4B3TL 2PQAA 2RHQB 1XNQQ 4DR4Q 4UP8A 1ASYA 3S15H 4JI4Q 1N32L 4EQ5A 2PQAB 2KBNA 5M3FG 1EWIA 1UE6A 3STBC 4GKJL 2K14A 1U5KA 4QIWE 3PO3H 4A3CH 1D7QA 4DR7L 4YWLA 1SR3A 1IXRA 1VQBA 4A3FH 3BZCA 3K7UC 5JEAG 4JI4L 2BH2A 3S1QH 1DGSA 1XNQL 5IWAL 1VQHA 4DV7L 1YIJA 2R93G 3KJPA 3U4VA 3A5UA 4GNXA 2GVAA 4OWTB 4OONA 1YJNA 3S16H 1Y1WG 5IYCG 4IFDG 4BY1H 1OXXK 1V1QA 5C3EH 2LXKA 3G4SA 1K8AC 3HOXG 5IT9c 5IP7G 4DUZQ 2VUMH 1XTDA 1Q7YC 4LF7Q 2CKZB 2ZM6Q 4IPCA 3RLNA 3A74A 3K80C 4LF8L 5E7NA 2VW9A 1I3QH 3CCJA 4X6AH 1NMGA 4B3RQ 4NB3A 2WB1G 4IFDI 1QUQA 5IYBG 4LUOA 4YY3Q 4L5QA 2HIVA 1TWGH 3L7ZC 2EIFA 4MNOA 4BBRH 3PGZA 4MTNA 3J7ZC 3PSIA 2NZOA 3F2DA 1BBUA 1IBML 4P74A 2V1CC 2UUBL 4J15A 3CPFA 1HNZL 2E5LQ 1FJGQ 4MZ9A 4OO1G 1P16A 1N36Q 2HT1A 1G291 4GKJQ 2VNUD 3CCRA 2VQEL 3HKSA 1WFQA 2IY5B 1Q81C 2CQOA 3PUXA 4DK6C 1RL2A 2WAQG 5IP7H 3E0EA 4KHPQ 3ER0A 4X62Q 3AEVA 3TS2A 3ULPA 3NBHB 2GN5A 4GOPA 1NE3A 2KCMA 1KRSA 2HQLA 3JAMc 1R9TH 4YCUA 2PI2A 1EUJA 3M85A 2AHOB 1Q12A 2UU9Q 5HY6A 1C7YA 4DUYL 1LUZA 1B7YB 1Y14B 2K4KA 2IT1A 3B6YA 3PIPA 1K73C 3S1MH 2R6GA 4DV1L 1K8GA 3I4OA 2ZTDA 2YTYA 4C3IH 1PH6A 1TXYA 4GLAC 1WCMG 3F1ZA 3PV0A 3U4ZA 1OXSC 2ID0A 3PF5A 1KD1C 2I0QA 4A3CG 3CCVA 1C0AA 2NN6G 1N33L 2B63G 4DR1Q 2JA6G 4AQYQ 3GTKH 4OWWB 1HH2P 2ZM6L 1BKBA 5GQOA 1HZBA 4JYAQ 4B3MQ 1LYLA 1SE8A 5EAYA 2PMZE 3RN2A 1QZGA 4LNQA 2F4VQ 5IY0A 4DV2Q 4LF9Q 4UPAA 1G51A 1K0RA 1K83H 1YHBA 2ATWA 3S17H 3F8TA 3MEFA 4LFBQ 2JA9A 4GN3B 5C4XG 1CKNA 4B3ML 1A62A 5FLXc 4BY7H 1YZ6A 3ULLA 1V43A 1BBWA 2JA8H 1HZ9A 3GD7A 3BJUA 1N9WA 2JA7H 3T1HQ 1XNRQ 1PA6A 1PH3A 2KCTA 1PH8A 1JJ2A 1LTLA 1HNZQ 5IP9H 1FL0A 1OXVA 2AMCB 1S40A 2E5LL 1FJGL 2UXBL 3H0GH 4JC0A 4LWCA 5C44G 1N34Q 2JA6H 4A3GH 3TREA 1KHIA 4B3TQ 3M7NA 1N32Q 1KIXA 1X55A 3DM3A 2MO1A 2EXDA 3KF6A 2OQ0A 5GROA 4DR2Q 1YVCA 2QA4A 2OCEA 2D0OA 4A3JH 2N3SA 3S2DH 2R7DA 2VQEQ 1PYSB 1QVGA 4BBSH 2E2JH 1X3EA 3G71A 4B3SL 4GLXA 1N36L 1VQ7A 3KOJA 4IPDA 2R7ZH 1X9NA 1E22A 2F4VL 4PMWA 2QEXA 4AIMA 4JYAL 1NMFA 1CUKA 1HNXL 1VQPA 1VQ8A 3MXNB 5C44H 4ME3A 2WFWA 1WJJA 3KF8B 4DV0L 1Q8KA 2WB1E 2YTVA 3IRBA 3CC2A 3FKIG 1CKOA 1K9MC 4K0KL 4OO1I 5HGQA 4H02A 4DV4L 2OWOA 2ALYB 4DV1Q 1FGUA 2R93H 2CWAA 2JA5G 4LF7L 1BVSA 4DUZL 2R92H 1XPOA 5GAGC 3RN5A 2R92G 3CD6A 2CCZA 4A93H 4A76A 1GVPA 4LFAL 2UXCL 1Q82C 5AJ3L 3GTLH 2VS1A 3AFPA 3I4MG 4HIOA 2AKWB 2Q2UA 4P73A 2LSSA 5AJ3Q 3HFZB 5IWAQ 3HOZG 1JE5A 1SROA 4LFAQ 4ALPA 4IFDJ 1A63A 4POGA 5BR8Q 1J5EQ 1HJPA 1I5FA 1W3SA 4R4QA 3HOXH 1UE7A 1VQ4A 3KYHC 2DGYA 2UXDL 2BA1A 4DR7Q 5FJ8H 3I4NG 3M4PA 2N8NA 3EN2A 1WCMH 4DV4Q 3T1YQ 2GVBA 3RZDH 4K0KQ 1O7IA 4JI8L 3STBD 2WP8J 4LF4L 4POFA 2YYZA 1XNRL 4UP7A 4TQUS 1YBYA 2JEBI 2AWNA 4OXPA 3W1BA 4DR4L 4QQBX 3D31A 4YWKA 2C35B 1KXLA 2K5VA 1EQQA 4JI5Q 1AE3A 4LF5Q 5C0XJ 1YHQA 3NENA 4LFBL 2CWPA 1MJCA 1L0WA 2ES2A 2ASBA 4DR3Q 1TWCH 2K5HA 4B3SQ 1NY4A 1PYBA 4NXNQ 1VQEA 1X54A 4R4IA 5ELNA 3CPWA 4X65Q 4KHZA 5C0XI 4DR5L 5C3EG 4JBWA 4AQYL 2NVTH 4DV3Q 3HOWH 3M3YH 4JI2Q 4P71A 4X66Q 3CXCA 3A5ZB 3GTPH 5M5WH 3PIOA 2XGTA 2B3GA 4C3HH 2EQSA 3L2PA 1S72A 2F3IA 3HOYG 5LMUQ 2XTIA 1ASZA 2PNHA 4DKAC 5J3BA 2YV5A 1YEZA 3A0JA 4L5RC 2K75A 2KHJA 3E9HA 2UXBQ 3D0FA 1VQKA 4KI0A 5LMNW 3I4NH 1PH7A 1E7ZA 1L1OB 4IJLA 4DR6L 3PO3G 3HOVH 1VQGA 3UDGA 2ZJQA 1YNXA 4JI7Q 4DV6Q 2UUCL 2LXJA 1T9HA 2D62A 1PHJA 1WOCA 4L5SA 3E9IA 4A4IA 3OYYA 3DLLA 4LFCQ 1XMOQ 2QGQA 4GNXC 3S1NH 3I55A 2DUDA 4R4OA 4YWMA 1XPRA 3M4OH 3KJOA 1OXTA 1CSQA 1Q46A 1PH5A 4A3DG 1L1OA 3OTOL 4NPSA 4Y7NH 5GAEC 4HJ7A 3I4MH 4NXML 2R7ZG 1EFWA 2JA7G 4DV2L 2OTJA 1A0IA 2VUMG 1XMOL 4LFCL 1WI5A 2F52A 4IPHA 4PZ7A 4A3KG 2VQFL 1LM0A 4DV6L 2UUCQ 4A3BH 2YTXA 4DR1L 4BA2I 2N78A 4A3FG 2A1AA 4R4CA 4GNXB 5H1SE 3L0OA 4PG3A 4JCVE 3CCEA 4HJ9A 1VQDA 3TEHB 2HHHL 1IZ6A 2UUAL 1U0LA 3PCOB 4LF8Q 1X3GA 2RF4A 4DPGA 3S1RH 3GTMH 4GKKL 5IP9G 1XMQQ 3PUWA 2B63H 4OWXB 5IYCH 5FLMH 4DUYQ 1QVFA 3RZOH 4JI2L 3CCUA 5LMNQ 2D0PA 2I5LX 2UU9L 4DV3L 3HOVG 5GADC 4O2DA 4PZ6A 1Q1BA 3RNUA 2FXQA 1JMCA 3ICEA 3AQQA 3M9BA 1VQ6A 1NJIC 1I94L 3PUYA 4DV5Q 1W2BA 4GLVB 4A3EG 4IPGA 1EOVA 4A3KH 3GTJH 4DR3L 2E2IH 1Q86C 5C4JH 4NXMQ 1J6QA 3I56A 3TQYA 1A8VA 3OW2A 3TRZA 5IYDG 5FJ8G 3BU2A 1I50H 2KHIA 3CCSA 3NELA 2PI2E 3AYHB 1JJCB 3FHWA 1VQMA 3HOUH 4JBJA 1VCIA 1E3PA 4LF4Q 2OQKA 4L5TA 1S3OA 3EIVA 3W5OA 1TWAH 2WAQE 4IOCA 3KDFA 2JQOA 3UE0A 3CCMA 4UP9A 3PF4A 2Q2HA 1HR0W 4JI0Q 2UXDQ 4WJ4A 2E2HH 3CC4A 1CSPA 1Y1VG 4R1JA 4YCVA 5M3MH 5BR8L 3J80i 2RCNA 1J5EL 4JV5Q 1VQLA 1L2FA 4YHHL 2NVXH 4BY7G 3ZJYC 4A3JG 4JI6L 1KRTA 1I94Q 5C4XH 4X64L 3I7FA 1X6OA 2KENA 4X66L 4A3LH 3GTGH 3LGJA 4IO9A 4A3DH 2L15A 1HZAA 1VQAA 4X64Q 2MQHA 4DV7Q 1GM5A 1YJWA 3KLWA 4JI1L 1L1OC 2K5NA 3H15A 2BH8A 2AWOA 1MJEA 2Q2TA 4JI5L 3TS0A 1IBLL 1KC8C 1JB7A 4JBMA 3CAMA 3UE1A 4LF5L 4BXXH 5IYDH 1B70B 3JAMi 4GS3A 1KQSA 1X3FA 1Z9FA 4UY8C 1UWVA 3GTQH 4AYBE 4JI1Q 1KL9A 3PUVA 1HZCA 2Z6KC 1HNXQ 1Q1EA 1Z47A 3BZKA 1OTCA 1Y1VH 5M3MG 2A19A 1PH9A 4AH6A 3T1YL 2VZAA 1IBKQ 4XIGS 2RHSB 3VDYA 4GN5A 3G48A 3CCLA 1P8LA 2Z6KA 4BA1I 5FLMG 1KAWA 5JJLA 4LF6L 3Q8DA 3HKZE 4RMFA 4YHHQ 3S24A 3W1GA 1HR0Q 4JOIA 4HJ5A 1B8AA 2JE6I 3CF5A 4A75A 3U58A 3ULJA 2H5XA 3UDXA 3PO2H 4JI3Q 1PVOA 1HR0L 1VQJA 4LF6Q 4DR2L 2IHEA 1JT8A 1RIPA 3CMEA 2NN6I 1SFOH 1G6PA 2Q2IA 3F2CA 1PH4A 1PH1A 3K8AA 3S14H 4A3BG 1EQRA 2JJQA 1GD7A 1FVIA 2I5MX 4QGUA 1VQCA 4P75A 4HIKA 4OX9Q 4HIMA 3HOWG 3ERSX 4DNIA 2I5HA 3M4QA 4LUZA 2OTLA 3J80c 4HJ8A 2HIXA 2MFIA 2ZTCA 1X65A 2K52A 3J81c 1PV4A 2JA5H 3RR5A 4BBRG 5LMUL 3S2HH 1I6HH 3EBEA 3KFUA 2YU9H 1CKMA 2B29A 1M90C 3FKIH 4HJAA 2CFMA 1SRUA 1MKHA 1UE1A 4YCWA 4DV0Q 1HNWL 1V9PA 4A3IH 3CW2C 4IOAA 2VQFQ 2JEAI 3PO2G 4X65L 1AH9A 3HOZH 4GOPC 5M5XH 1XJVA 5DLQE 1SMXA 1C9OA 2E8GA 1HNWQ 3AFQA 3I2ZA 4QL5A 4A3MH 4BY1G 1OXUA 4WJ3M 3PUZA 3J81i 4JBKA 1JJGA 4JI6Q 1QZHA 1XMQL 1GKHA 3CQZH 3OTOQ 3H3VH 2ZTEA 4P72A 3G6EA 1XPUA 2MO0A 4IJHA 2JA8G 4BBSG 1VS0A 4C3JH 4JV5L 1VQFA 3RLOA 1VQNA 2NVQH 3UDFA 2HHHQ 2UUAQ 4LW1A 4JI0L 1NTGA 5IYBH
chains in the Genus database with same CATH superfamily
4FF3A 4JI8Q 2AQ3B 1SN8A 1T5EA 3JC66 4JI6H 4HSPA 1KNAA 2NU6B 3RLFA 1KBLA 2AUJD 2MGSA 3NP8A 3T53B 2FPGB 2X0SA 1PFBA 3NPPA 5FO7B 3UDIA 2DWCA 5DQGA 1X56A 4HIDA 5KG6A 4Y52H 2BA0A 3V6HA 4JI1H 3K7AH 3FP9A 2ZJPA 4ODGA 2PZWA 4U6PA 1D8LA 1L0XB 4R7RA 2ZJRA 3CCQA 1CT1D 4XT1B 2D9UA 1EEFD 1PRTC 1UE5A 1JB3A 4DV5L 2R86A 1VQIA 1TWFH 4DU9A 1E2ZA 4JI7L 2VY3A 5C4ZA 4I4TF 5LMNL 3J7A5 3I90A 2PZUA 4X62H 3SXHA 5M5YH 3BYTB 2Y0SG 1IL2A 1A15A 3G6XA 2K50A 1MIUA 1E1TA 5BPFA 1N33Q 1Q8IA 4LUVA 1PZKD 5EPJA 3SK5A 5DM73 4YY3L 4FBTA 5C8YF 3GV7B 3I12A 5J2UF 3N40P 5JUMA 3TSSA 3D3RA 3H4DA 2RQXA 3KDFB 4N9PA 3SE7A 1K83B 2K5DA 1RJRA 1RF2D 4DN4M 3ND8A 3H3VI 5KFEA 1S5DD 2K5WA 1AE2A 4DR5Q 4A3LG 1SFOB 1VBHA 2FLPA 1H95A 1U4LA 2F0LA 4NXNL 4DAYB 3I72A 1HQRD 2C9OA 3PIP3 4AYBG 3HKZG 1KAAA 2MNAA 3CP0A 4B08A 3RBDA 2SDFA 5C0XG 4R8IA 3D8GA 1ASYA 3S15H 2JEGA 3H91A 4ECZA 5EBDA 1GUTA 4UCUA 4A3KB 4GKJL 2EJMA 3RB4A 3VYSA 4XQQA 4A3CH 1KJ9A 5KFAA 1TVXA 1RJQA 3VR4A 4IUVA 1IXRA 4A3FH 2C2EA 5JEAG 3OPOA 2DIKA 3SK8A 2BH2A 1Q90A 3S1QH 1IHZA 4O1NA 2R7KA 3PMFA 1DONA 2R93G 5EWEA 3CHBD 3OSOA 2F0EA 1D1KA 4LK1C 2B2YA 4OWTB 4OONA 4CDFC 1Y1WG 1V1QA 1K8AC 3HOXG 5IT9c 5KT7A 2G5DA 2QILA 1Q7YC 4RAUC 2CKZB 3K5MA 3EROA 5C0XH 2YZMA 1ESRA 2ZM6Q 1SYGA 3A74A 3K80C 2XGQA 1BCPC 4HNTA 2L1BA 3CCJA 1NMGA 1PLFA 1NUCA 1EY4A 4YY3Q 3L7ZC 1TWGH 4BBRH 4U7CA 4MNOA 3J7ZC 3PGZA 2RBMA 3Q1KA 4ZAIA 2HDLA 5F9LA 3MEHA 3PSIA 5I4DA 2EYPA 4J9RA 2DLNA 4C5BA 1BBUA 2ASDA 4J15A 4CDDC 2FFKB 4C56C 2C2DA 2AGQA 4OO1G 1N36Q 4ECSA 2KEEA 2KCCA 2VNUD 2IY5B 3HKSA 4EQOA 3GIPA 1B3AA 1EL0A 3PN1A 1PRTD 5IP7H 3E0EA 1F9QA 3AB9A 3ER0A 3AEVA 4QMGA 5EWFA 4KD4A 4GOPA 1NE3A 3K7AB 4EQNA 2HQLA 4DR6H 4O42A 4IRCA 1CS0A 1KJQA 1KLUD 2CZGA 3MHBA 1Q12A 1D5ZC 3C2PA 2P5ZX 2NTSA 3TN2A 4DUYL 1B7YB 2K4KA 3PIPA 3S1MH 4CJ1B 4C3IH 5NUCA 2OH2A 1JLLB 1S5BD 1WCMG 1QNUA 1C0AA 2RDJA 2B63G 5L37A 4C3IB 4AQYQ 4OWWB 2PMZA 1HH2P 5E4XA 1Y1VA 3T5LA 1HZBA 4DL5A 1SE8A 2PMZE 2JA6A 3S9WA 1DCZA 3R5FA 3GIDA 4DV2Q 4LF9Q 4UPAA 1G51A 1YHBA 3F8TA 1R9TA 1RD9D 2MHVA 2UUAH 3DWPA 1ZQ7A 4F4ZA 5C4XG 2BDOA 4M1UB 4F50A 2GLTA 1A62A 4DR7H 4ME6A 3ULLA 5I9OA 4EG0A 2UXBH 1BBWA 1HZ9A 3HKZB 1EIHA 3H3VC 4MV9A 2EYMA 2JXMB 3ONAB 3T1HQ 1A3UA 2TMPA 1JDBB 1MZBA 1BGWA 4MTEA 1PH3A 2E2JB 3K3PA 4UCSA 3BABA 4HAEA 1JJ2A 2AMCB 1S40A 2YRWA 1KNEA 3H0GH 4JC0A 1GYFA 2NVQB 3PR4A 3VYTA 3DM3A 1SE3A 1FYCA 1GLVA 2C5CA 2QCPX 5GROA 4BBSB 3BA8A 2GA4B 3HGBA 4LF5H 3TP6A 2JA7B 3MWMA 3ETHA 2F1MA 4RU9A 2BQRA 1LO5D 1AN8A 3KBGA 2VA2A 4ULLA 3S2DH 2R7DA 1AN7A 4BBSH 2R93B 1I4HA 4ME5A 1N36L 2FK2A 5LA6F 1TWCB 1Y1WB 3J80E 2L9HA 1X9NA 2Z6BA 2F4VL 2G9DA 4PMWA 1TS3A 4MTDA 2R8KA 3MC0B 4H13C 5C44H 1EYAA 1BXRA 4ME3A 4DXFA 3KF8B 1I4RA 1Q8KA 2YTVA 3IRBA 2PW5A 4C3HB 2W57A 3N43B 4A3JB 4H02A 4DV4L 3T51B 4QWBA 2K03A 3PIO3 5KT6A 3WDNA 3RGZA 1IKLA 1PMRA 4JVZA 1OWTA 4DV1Q 4ZLTF 5JVDF 4J9NA 2EYJA 1BVSA 4PMBA 2R92H 3KHLA 1XPOA 2XRQD 3SVMA 4B3TH 2R92G 2XWBB 3CD6A 2E2IB 2CCZA 4A76A 4RAYA 5EKLA 2XC9A 4LFAL 3GIJA 1Q82C 1WVLA 4HR7B 4CGYB 2VS1A 1PZID 3CQZA 1F2LA 5M9OA 1Y1WA 2LSSA 3HFZB 3M4OB 5L9XA 4LFAQ 4IFDJ 4KY6A 1SCUB 3HOUB 1HJPA 1I5FA 1W3SA 3HOXH 1UE7A 2HCIA 1LV9A 3MXPA 1I94H 3IFTA 4O3PA 2N8NA 4A3GB 1GUWA 3HOXB 4DV4Q 4LFBH 2RCFA 4LF4L 1XNRL 1HCZA 2A74C 2WP8J 2YYZA 4UP7A 2JEBI 2AWNA 4OXPA 1HR0H 3S15B 5JEAH 4RNOA 2EYOA 4YWKA 4YR2A 2KOLA 3N6RA 4H7BA 1KXLA 2O03A 1I6VC 2IX3A 1EQQA 1WSCA 5C0XJ 3NENA 2QDLA 1BDOA 2E76C 1V1OA 5BN5A 4NXNQ 2IBKA 2OEOA 4R4IA 4C1NI 4BWSC 4DR5L 1N34H 3RZDB 2NVTH 4DV3Q 2EJGC 3A5ZB 1B9NA 5M5WH 2XGTA 1W6JA 2EQSA 5EOYA 2F3IA 1A9XA 3PR5B 2W9CA 4K6LA 1SE2A 2OXPA 1W93A 1YEZA 2YV5A 4ED6A 5M5WB 1WTWA 2KHJA 3E9HA 5CORA 2VR1A 3LP8A 1U4PA 1MSGA 1BXTA 1L1OB 4IJLA 1XMQH 5BN3A 4LJZC 4JI7Q 2UUCL 1CQFA 2O4XA 4LF8H 1O7YA 3E9IA 3HS0C 3OYYA 2MPMA 3HBLA 2M9VA 1XMOQ 3OSPA 4YWMA 4R4OA 1ESFA 3D6WA 1WR2A 1Q46A 1PH5A 3P20A 1L1OA 3I4MH 4NXML 3R2TA 2PMZB 2B63B 2JA7G 3BQ1A 4RWSC 4B3RH 4DV2L 2OTJA 5D65A 3DM1A 1WI5A 4PZ7A 4UDUC 3Q23A 2ZM6H 5LP6F 2AQ1B 4AYBB 3T5JA 3QWNA 4R4CA 4BS9A 4GNXB 1STYA 3L0OA 4IUTA 2UU9H 3MFGA 4MV3A 2YYAA 4I65A 4LF8Q 5LL6S 4DV5H 5I2YA 1YNNC 4JI7H 4GKKL 3N6XA 5DLGA 4DUYQ 5IYCH 4Q43A 3RZOH 4JI2L 3JRWA 3K5HA 2YCHA 4GKJH 3EVQA 3RNUA 5LOVF 2JA5B 1TA8A 1W2BA 1UC9A 2E5LH 4GLVB 2V4QA 4DR3L 1Q86C 2C22A 3MJFA 1CA6A 4XDXA 1KDAA 3I56A 4ZOLF 1A8VA 1F77A 4TQRA 4IQZA 1QNKA 4LH7A 2KSWA 3IG0A 3GTMB 1RODA 2BDNA 1VBGA 1BO0A 1Q3LA 3AYHB 3A8JE 3NQIA 3QO2A 1VCIA 1E3PA 2OQKA 1EU4A 1S5CD 2RKSA 1SMYD 3EIVA 2NN6H 1TWAH 2JQOA 2ASJA 5KEEA 4UP9A 1I6UA 2NTTA 4JI0Q 3S16B 4WJ4A 1CSPA 5KFPA 4YCVA 1J5EL 1FD7D 2JA6B 3TIGA 3BVGA 4KV6A 4YHHL 2NVXH 1E4GT 3R5XA 4BY7G 4FU0A 4A3JG 4ABNA 1HUMA 4X66L 2KENA 3GTGA 3HG9A 1IBLH 3URYA 2FMAA 2L15A 1VQAA 5BR8H 2KVMA 5DNFA 2FMMA 3DXJC 1YJWA 5IWAH 3VYRA 3RV4A 2EDGA 4EQPA 2BH8A 5KFSA 1MI2A 2CW7A 1SNMA 1TS2A 3CAMA 5IYDH 2CQYA 2LS01 2AQ4A 5IGCA 5I6YA 4OIJA 2WACA 3GTQH 5D1OB 5C5MA 3HOWH 1OTCA 1Z47A 3K5OA 1RCVD 1Y1VH 2A19A 1PH9A 2F0IA 5KFRA 2RHSB 1P8LA 3QOLA 1KAWA 2L0CA 4LF6L 3Q8DA 5C4JB 4H44C 4HJ5A 4K5XA 2JE6I 3GIQA 3TINA 3CF5A 3GTKB 4QUFA 4JV1A 2B2YC 3UDXA 5FPOA 4DR2L 2IHEA 1JT8A 1PFNA 1XX8A 5K36H 2Q2IA 1PH4A 4GKKH 3S14H 1GD7A 3T5KA 1VQCA 3T16A 5KRUA 1JKJB 1HNWH 3HOWG 3ERSX 4ECYA 1WTQA 3J80c 2HIXA 2MFIA 1X65A 1Z6HA 5KFOA 5JAVA 3T13A 2CH4W 3S17B 1CKMA 1CZGA 1GOZA 2B29A 2A73B 1M90C 2CFMA 1MKHA 3JRXA 5KFMA 4MN3A 4HYKA 4DV0Q 1EYDA 4K6DA 1LTSD 2SNSA 3TP5A 3S2HB 1I6HB 1JX4A 5A2QW 2VQFQ 3W2DA 3G6JB 2CW0D 5JVG3 4UHVA 2XGPA 1YNJC 3T56B 1N32H 1EWHA 1SMXA 5DLQE 4HEDA 3R2IA 2YRXA 3SK6A 3PUZA 2L55A 3EQLC 5KFWA 3H3VH 4P72A 4BBSG 1XPUA 2MO0A 1LTTD 2L11A 1AZQA 1VS0A 4C3JH 3BG5A 3H94A 1VAJA 2UUAQ 4A2AA 4JI3H 2A68D 1XDNA 5K5PA 2V9WA 4X3UA 3KXYT 4YAJB 1PRTB 4GOPB 5IIFA 2KQ3A 5EKKA 2JK8A 4K8IA 4C2MH 4AQYH 3H09A 1G91A 5JJKA 4YJ3F 4A3IG 4O3NA 1PDQA 3VA5A 1BR9A 2PCFB 4JUZA 4MHEA 5KNCA 1HA6A 3M9MB 3GDEA 4DAMA 3KF6B 3HOYB 4X62L 2EXZA 4A93G 4MIUA 3QR8A 5DAUA 1HNZH 5KT2A 3MFYA 1AUXA 4L1KA 2WTFA 1QWYA 4A3EH 3HOYH 2F0FA 1WYDA 4RKLA 1EOTA 3Q2OA 4NKLA 4DR6Q 3I4NB 1TY2A 4F88A 1WD0A 2QW7A 4BXXG 1DOMA 3BDCA 4X3TA 4QIWB 2W8KA 1JXLA 3SE0A 3H0GG 2R85A 4H0LC 3HOUG 4IR1A 1V1PA 3JAME 3QB3A 2Y0SE 3GTOH 3MWEA 2ZXOA 4R9WA 3WWVA 3M9NB 4APVA 1S0OA 1K0SA 2F0KA 2K6AA 1STNA 4JOIC 1TWFB 1QUQB 4OHJA 4RGNA 5CV7A 1E24A 3ETJA 1S03G 2W6OA 3OUZA 3F2BA 2ZJTA 1LT5D 1H9SB 4YY3H 5I2XA 5L1KA 4ED2A 4LF4H 1ENFA 1GGOA 2DPJA 4V190 5K36G 3G8CA 3KLSX 1QVCA 5LL6X 1KC7A 2DY7A 2WB1A 2W9AA 2VL6A 1RHPA 2K32A 5JEAJ 2UXCQ 1XNQQ 4UP8A 1WTPA 4JI4Q 5KFCA 4F4XA 5CAEB 1JE4A 2P0AA 1UE6A 3RAXA 3ORQA 1WTVA 1TWGA 3V4ZA 1RKNA 4XYQA 3KLRA 4X64H 3VR6A 2RSNA 4PNYA 5IGGA 3Q6SA 1VQBA 3OW7A 3K7UC 3DUZA 5DQHA 3A54A 1CFMA 1EQTA 4LSAA 5DGBA 4DV7L 4B9WA 3KJPA 1YJNA 4GNXA 2ZDGA 2F0SA 2EYLA 4EGVA 4BY1H 3GTLA 3VR2A 5IP7G 2AGPA 4HSVA 4DGZA 5DQIA 3PZPA 4LF8L 1JWMD 4A3FB 2VW9A 2DJFC 4C2MB 2AQ2B 4A3DB 5BN4A 4IFDI 1A6XA 2HIVA 1M6VA 1B2TA 2Q8RE 4MTNA 4GZYC 4QWCA 2A6ED 4DXGA 3MFIA 5DGAA 2E5LQ 2HCCA 4MZ9A 2J7ZA 2B63A 2N88A 2DNCA 2VQEL 5C5JA 1LLRD 4DUYH 1RL2A 3KAJA 1VMCA 4KHPQ 1PTOH 1A2TA 2AUKA 3NUCA 2FP4B 4F7XA 3HZXA 3ULPA 2LFNA 1R9TH 2KCMA 1DD2A 4MV6A 4ECVA 1K1SA 2KUMA 2UU9Q 1HTPA 4I7ZC 5HY6A 1C7YA 3BQ2A 1H9KA 1K73C 1EY9A 3J7AV 2R8GA 2NBFA 4PQXA 1K8GA 1PYWD 1Y8NB 1WCMA 3KHHA 3TZUA 2SEBD 5KX5F 3PV0A 2I0QA 1OXSC 2ID0A 4A3CG 2NU9B 3K3VA 3CCVA 1JICA 2V4DA 3QZ8A 4DR1Q 3FEWX 2NYZD 2ZM6L 5GQOA 1LTID 2K7VA 4B3MQ 1TIID 3KAKA 5AFWA 3FVQA 2CW8A 3A55A 1HTLD 2VB3X 1WTOA 3S17H 3FPPA 2PYKA 4GN3B 5CV5A 3VR5A 1CKNA 2KA7A 1DOKA 1M0WA 1YZ6A 4A3IB 5FD5A 4I55F 5C1OA 4ZCKA 4ECQA 2QF7A 3R93A 1XNRQ 1SXTA 2R82A 2F0GA 2HD3A 3CQZB 4RB2C 5FO8B 1O75A 4UAIA 5IOCA 1Z7TA 3NWTA 4X66H 3GTOA 1CQVA 3FDTA 1HNZQ 5IP9H 1OXVA 1N34Q 2JA6H 4RGOS 4IN3A 3TREA 2F0NA 2LMCB 3G7LA 2R7LA 2M05A 5HGTA 4N8X1 4Y7NB 2RGRA 4BWGB 3J7AF 3MAQA 1AUVA 2D0OA 5FO9B 5CC4A 5KT5A 4K5VA 1I3QB 1ML0D 1PYSB 1B3QA 2WAQA 5EBCA 5KNBA 2E2JH 3BAAA 1X3EA 4O2AF 2O5IC 4B3SL 4GLXA 5KG5A 3KOJA 4TRDA 4IURA 2R7ZH 5J2TF 2BR0A 1RYRA 1E22A 5LHY1 4ZRZA 2Z4HA 4KN7C 2W8LA 4JYAL 1CUKA 1E2WA 1VQPA 1VQ8A 1CQIB 3MXNB 4YHHH 4ED1A 1WJJA 5KG2A 2VQEH 3GTPB 3CC2A 2XIWA 3FKIG 4CJ2C 1CKOA 1EQVA 4MV4A 1RDPD 2RDHA 3RF2A 3I70A 2OWOA 2VQFH 1FGUA 2R93H 4EGQA 1TY0A 4J6HA 1CK1A 3PO2B 2PW7A 4DUZL 4DV0H 1ILQA 4CC6A 2MJ8A 5GAGC 3RN5A 1N56A 4A93H 4CKCA 1GVPA 1DM0B 1R4PB 1AW7A 2J4XA 4IRKA 3V4SA 2AKWB 2K5QA 3V96A 5AJ3Q 3HOZG 3C3LA 4OX9H 4ALPA 2ZDQA 4ED7A 4R4QA 1G2TA 1VQ4A 4OL7A 2DGYA 2UXDL 4QF4A 4RNNA 1XWEA 4UCTA 5FJ8H 5JPMC 3V6JA 5F2DA 3WOFA 3RZDH 2NVTB 2R7MA 4K0KQ 4JI8L 2FK1A 5L1JA 3LX0A 4TQUS 4DR4L 1A2UA 4RB3C 2R7NA 4PDBA 4UCOA 4B3MH 2FK3A 3NSWA 3MA2B 3C1EA 4KKTA 1GSAA 4JI5Q 1AE3A 1TWAA 3DEOA 1B44D 2K04A 1L0WA 3WNZA 4M8AA 2VQDA 1TWCH 1N48A 4Q44A 1PYBA 3Q8PB 1VQEA 4OELB 5ELNA 3CPWA 4X65Q 4KHZA 3GV6A 4ECXA 4LMQD 3KLSA 4JBWA 5J1ZA 1KDCA 4AQYL 3BJYA 3M3YH 5K2MA 2DPIA 1S68A 3CXCA 2EPBA 1S5FD 2B3GA 4C3HH 3L2PA 2Y0SB 1S72A 1EZ1A 5LMUQ 2XTIA 1ASZA 2R8IA 2PNHA 4DKAC 5J3BA 2RDIA 4L5RC 1TS4A 4KHPH 3Q22A 2UXBQ 3JAMW 4KI0A 5LMNW 1PH7A 4CHTB 5DLFA 4CKEA 3HOVH 1VQGA 1IOWA 4KJNA 4DV6Q 2KECA 1T9HA 3GTLB 2D62A 1PHJA 1WOCA 4E6IA 3DLLA 4A4IA 5KFGA 4DK0A 4ED3A 3S1NH 3I55A 2DUDA 3KJOA 4K5WA 3WOEA 1CSQA 4IALA 4NPSA 5GAEC 2EY1A 2R7ZG 5EDWA 3KK7A 2NVXA 1H9SA 4LFCL 2F52A 2R8HA 1ZHQA 4XX0B 4XYOA 5I47A 4A3BH 4Q8FA 3OIPA 4QB4A 2N78A 1GHKA 2A1AA 5KFXA 2NU8B 1AZPA 3OWFA 1I4PA 2WB1B 2HHHL 4UCVA 1IZ6A 3L3OC 1MHWC 1U0LA 2JEFA 1T36A 5F9NA 3BS1A 3GTMH 5DM63 1C8CA 3OHAA 1FR3A 5IP9G 2R6FA 2B63H 4C1NK 3RB6A 5ELBA 3V05A 4Y8VB 2I5LX 4XXEA 4O2DA 1BNCA 1F2YA 1VQ6A 1YNJD 1NJIC 2MCTA 2ATLA 3JSNA 3PW0A 4IZ8A 4A3EG 3OIQA 4DL2A 1EOVA 1FJGH 5KFLA 2IW3A 4JI4H 1KABA 4DR4H 1MBYA 3OW2A 3M9OB 2NVXB 3HOZB 3BU2A 3GV8B 2QDBA 1I50H 2KHIA 3CCSA 2PI2E 4O4LF 1JJCB 1VQMA 1GUSA 1PRTF 1RYSA 3NBIA 4CC5A 1S3OA 4LH6A 3W5OA 3DWQA 2HVSA 3KDFA 5T1IA 2XCLA 1CI3M 3PF4A 1BJTA 2E2HH 4EEQA 5BR8L 3J80i 2RCNA 4JV5Q 4YR0A 4MV1A 3RUZA 2J6SA 4J9QA 4AYBA 4JI6L 5DG8A 1UUPA 4X64L 4RNMA 1NSNS 3RAQA 4A3DH 2OLSA 1GM5A 1EUCB 4NW2A 3E0JA 2E75C 4JI1L 2ICIA 2K01A 2F0QA 2JEIA 3KHRA 1MJEA 2DY8A 4LMYA 3RJ0A 4JI5L 3TS0A 4O3RA 1KC8C 1SYDA 2NUAB 2FKLA 4GS3A 1KQSA 5EWGA 4UY8C 4WRDA 2HVQA 5KFVA 1G6ZA 5T14A 1EY8A 1KL9A 4APMA 1HZCA 2Z6KC 1HNXQ 2CW0C 4YQWA 4AH6A 1IBKQ 1IYUA 2FLNA 3CCLA 2Z6KA 4BA1I 1D6EC 5JJLA 1JQYD 1HR0Q 1L0YB 3U58A 1EUDB 3T5HA 1ILPA 2H5XA 3G6VA 2W7PA 4MA5A 3RB0A 1PVOA 1N33H 1HR0L 1STHA 1LTBD 1SFOH 2A68C 1SNOA 3GV3A 1Y8PB 1PH1A 3DHQA 3CU7A 2F0UA 2JJQA 3GP7A 4A3BG 4ECRA 1BCPD 2I5MX 3R8BA 2FB9A 2I5HA 4EBEA 4HJ8A 1JCKB 1PV4A 2J9GA 4YR3A 3EBEA 3KFUA 4F4YA 1ZYRC 2CQAA 1PFMA 1GUOA 2DZDA 1M7JA 1PTOD 3N44B 1UE1A 2F3VA 5IGEA 3CW2C 4IOAA 3Q24A 3UFXB 5M5XH 1XJVA 4YIJA 4XQNA 3SHLA 1WTXA 1HNWQ 2E8GA 2YS6A 3AFQA 3I2ZA 3RD4A 1SNCA 4BY1G 1JJGA 3MR3A 4IUNA 3J81i 1XNRH 4JI6Q 1SAPA 1QZHA 1XMQL 3GV5B 3CQZH 3OTOQ 1I3QA 2ZTEA 4IJHA 2Q8TA 2JA8G 5KFUA 2VUMA 1I4XA 4HN7A 4JV5L 1JOOA 3S2DB 5KGUA 2NVQH 2J0TD 2W6NA 3RMHA 4C3HG 1NTGA 4CJ0B 2I46A 3FKIA 4O2BF 1NR4A 1GO3E 1LTRD 3TP7A 1GSHA 1EYGA 3OTOH 3NBHA 1TS5A 2XNAC 4GN4B 3ND9A 4A3GG 4ZKCB 1UC8A 3EYYA 1N34L 3M4YA 5EQ0A 4JI3L 2PZTA 4V0BA 2X69A 2V58A 1SJHD 3K5IA 1UAPA 2I8CA 5IE8A 1Y1WH 5KFIA 4FNFA 1HFNA 1SSOA 3GTOB 2RGVA 5FPRA 1CKNB 3UI2A 3PQIA 2E2IA 1M1KC 1EIFA 3FPUB 2W70A 3NWSA 3L9AX 1RK5A 1QG7A 2NB0A 1TWHH 3K81C 3J7AK 2XVSA 3T1HH 3V6KA 2R7FA 1VQ5A 1IBMQ 1IBLQ 2UUBQ 2JA7A 3GILA 2HVRA 4KLKA 1TWHB 4JG2A 4ZHQF 2J6TA 1RTOA 4J9LA 2Z0SA 4JK1C 3OUUA 3H4BA 5FD6A 4OX9L 4FDBA 3SGIA 4B3RL 1YITA 3MR6A 4DV2H 4LF9H 4EX5A 3J7YW 3F8NA 1LTGD 4IFDH 2UXDH 2UVRA 1JDEA 2JA5A 1YHAA 1EYCA 1IKMA 2IX0A 1F2ZA 4RUAA 1O78A 1SLJA 4PZ8A 3GLKA 5ELOA 1FGBD 2A8VA 1I50A 1K3RA 1DJRD 1VQ9A 2NZHA 4I7HA 2NVYB 2QEJC 5KFDA 4DUZH 2RHQB 2NUCA 1GXDC 4EQ5A 2PQAB 2KBNA 1DV1A 4ED0A 3STBC 5E3FA 1U5KA 4QIWE 4FF2A 2WV6D 3VPDA 1D7QA 5KG3A 4DR7L 1D5XC 5GONF 1SR3A 5KYIA 3HP3A 2DNEA 2XN9C 2CHBD 3O13A 5LYJF 2A6EC 2F0DA 1U4MA 3R23A 1DGSA 5KT3A 2K33A 5CV9A 5IWAL 3A7LA 5IGBA 2XWJB 1NR2A 1YIJA 3C1FA 1E4FT 4RKBA 3TP8A 1C30A 1D2BA 2GVAA 1QJOA 3S16H 3M3YB 5IYCG 2PNRC 5HV6A 3J80L 4O4IF 2ENBA 2LXKA 3GTJB 4DL7A 1XNQH 4IZOA 4LF7Q 2A69C 3RLNA 1RJPA 3RIZA 5ISRA 5CGKA 4X6AH 4J9OA 4B3RQ 4NB3A 1J8IA 4O3QA 5IYBG 1IL8A 4G7ZC 1VF5C 2EIFA 5EPKA 2B2VC 2SNMA 3M7GA 2NZOA 2F03A 1FNUA 3S1NB 1IBML 4P74A 2V1CC 2UUBL 3E6ZX 1XMOH 1DIKA 4XT3B 5C3EB 1FJGQ 3BQ0A 3C46A 1SNDA 3A8IE 1P16A 2HT1A 2OT2A 1ET6A 4WFN3 3CCRA 4G7HC 1WFQA 4LAAA 5JJZA 3R5HA 1HRJA 3D6CA 4DK6C 5D1PA 4ZQ3A 1TU2B 2RA4A 5CYUA 3TS2A 1K3BC 1KRSA 3JAMc 3MXGA 4YCUA 2MP1A 2PI2A 1EUJA 3M85A 2AHOB 3PO3B 5CB4F 4RUCA 1TWFA 2IL8A 1CA5A 3KBXA 3B6YA 2IT1A 1JR0D 2D5DA 1KJIA 3H40A 4XZ3B 2R6GA 3QG1A 4CKBA 2AU0A 2Z1CA 2ZTDA 2YTYA 3U9SA 4O4HF 1PH6A 3ZYYX 4GLAC 1B9MA 2WYOA 2B2UC 3E5NA 5CA1F 1SYFA 2NN6G 2W6PA 4QIWA 5KFJA 3BDOA 1VDZA 1B04A 1K28A 4JYAQ 1ZETA 1QZGA 4EFBA 2E2HA 4TSSA 4IWYA 5IY0A 1SNPA 1X32A 1KEEA 3E3XA 3N52A 3CKIB 1K83H 1D5MC 3J81W 2HHHH 4LFBQ 2JA9A 3I8ZA 5L1LA 5KIXA 2L5TA 4Q0YA 4C5CA 4ED8A 5FLXc 1EU3A 4BY7H 1Z2PX 4WJWA 5G3LD 5DEHA 1JIHA 2I87A 2JA8H 3GD7A 3BJUA 3QJYA 2VPQA 1O7ZA 2M00A 2EOTA 2LY7A 4BY7B 2F0WA 2HQEA 5EGTA 1PA6A 2KCTA 3ITPA 3K58A 4R8UA 1G2SA 4M7EA 1FJGL 1LTLA 4PMCA 2R61A 1FL0A 4O3SA 1YNND 5M3MB 2A5HA 2PPBC 1C3OA 4DL4A 4B3TQ 1N32Q 2R93A 3OHBA 4JPBW 4OIKA 1KIXA 1S97A 4F8MA 3Q0AA 2EXDA 3KF6A 1M0TA 4IHJF 1HHVA 1YVCA 2OCEA 4JI5H 3Q8SB 1ENCA 2YZGA 5CR3A 4DF7A 4J9KA 5KG0A 2A69D 5HURA 1SYXB 1QVGA 2KJXA 1IW7D 3GIIA 3G71A 1BNZA 5JOBA 3MFHA 1MGSA 2C28A 1TAEA 2NWGA 4IPDA 2K05A 2QK4A 4K0KH 3C0FB 4RZRA 3T1YH 3CRLC 2UVUA 2QEXA 2X6GA 5G3LF 1DXMA 3HOWB 1NMFA 1HNXL 1Y1VB 4IR9A 2BCOA 4DV0L 1Y69U 1EYZA 2F4IA 2WB1E 5BMVF 5IT9L 2E74C 4OO1I 2DJGC 4RCNA 4FYDA 2ALYB 5LL6b 4LF7L 1S5ED 1EEID 2BOSA 4WORA 4EVOA 3VA7A 3GTLH 1Z2OX 3I4MG 4HIOA 1BF4A 3SEBA 2AGOA 3GIMA 4P73A 4KK7A 4TKOB 3K6OA 5IWAQ 1KJ8A 1A63A 4POGA 5BR8Q 2VPSA 5CA0F 4RGMA 3KYHC 1GJXA 3VPBA 2KHSA 2WE6A 2B2WA 4DR7Q 3TZDA 5IGDA 5D3IB 1AP0A 1RJTA 2F0OA 3KALA 3STBD 1SBBB 3SDZA 4POFA 4DLKA 1YBYA 3W1BA 2FLLA 4KKSA 2C35B 3OHXC 3GTKA 3I73A 4MV8A 1IBKH 4A3MB 3PVXA 4A2BA 1MJCA 2ES2A 3WO1A 2ASBA 3OSNA 4NP5A 2K5HA 1NY4A 1X54A 3MXNA 5C0XI 4YBZB 5D1OA 5C3EG 2VUGA 1B1ZA 2KEDA 3LWUA 2FPIB 2MUYA 1JWSD 1C4QA 4X66Q 5EPLA 3GTPH 2FE3A 3PIOA 3I4LA 1XYIA 3HOYG 5C4HA 3MR2A 5A35A 4DV7H 2WAQB 1SYEA 1XTCD 3JZIA 2K75A 3D0FA 3SR1A 2IMWP 5FLXL 3I4NH 4JV2A 4HCEA 2JN4A 1E7ZA 1Z2NX 2RDGA 3PO3G 1YNXA 3QIAA 5DG9A 1N36H 2LXJA 3R3OA 4JV5H 3GTMA 4L5SA 1WTRA 4LFCQ 2QGQA 3H0GB 4ZYSA 4GNXC 1B6SA 1X3PA 4J8QA 5T1GA 4ZQIA 1F9PA 1LT4D 1OXTA 3BZDB 5TSSA 1V51A 3OTOL 1II3A 1HA5A 5H80A 4FF4A 3NXWA 1A0IA 2VUMG 2B2UA 4A3KG 1LM0A 4RH6A 4DV6L 1AFPA 4LF7H 2YTXA 4BA2I 1KLGD 2YU9B 4PG3A 3IAYA 4JCVE 4X3SA 3CCEA 2F3WA 5KFKA 2A6HD 4FBUA 1I7NA 4LFCH 3PCOB 4EGJA 2IA6A 3NE5B 1X3GA 2YW2A 5KG7A 2FMCA 3S1RH 3K5NA 4S3SA 1WH2A 2JSOA 1XMQQ 5LMNH 2R87A 4OWXB 1ICWA 3SK4A 2D0PA 3U9OA 5KFHA 4FO2A 2PBZA 5GADC 4E4TA 4QWAA 3ICEA 3AQQA 3M9BA 4FXKC 1I94L 3PUYA 4IPGA 1UEAB 1DV2A 2E2IH 4ECUA 2EY6A 3FMCA 5KT4A 1C48A 2B2TA 3QOJA 4NXMQ 4NMZA 3E5SA 1R4QB 3RV3A 2W9BB 4DV3H 3TRZA 3RBEA 3DMUA 4UCRA 2ZXRA 5C3WA 4NXNH 3TMEA 1S4ZA 4FP5D 3HOUH 3IL8A 1B6RA 2IWHA 5C5LA 4L5TA 3RB3A 4ETSA 5ELDA 1IOVA 5C6AA 2WAQE 3UE0A 3A56A 5KFQA 2HDMA 2Q2HA 3OOCA 4RFBA 2UXDQ 4K14A 3CC4A 3MWDA 1Y1VG 4MAMA 5JVLA 3PW4A 1LT6D 1L2FA 4QWEA 1LACA 5D14A 1I94Q 2NZ1D 5C4XH 3I7FA 5A2QE 5L1IA 3GTGH 4ZK9B 3LGJA 4IO9A 3HRZC 4RA8A 3FMAA 3I3CA 4X64Q 5M5XB 1LABA 2MQHA 2B8GA 5C4XB 2W6QA 2K5NA 3H15A 1PTOB 3TBIB 4EBDA 3A7AB 1U4RA 1JWUD 4ZUJA 4IWXA 1JORA 3CVZA 3K5LA 2Q2TA 4JBMA 1ZYRD 3UE1A 4BXXH 1S10A 4C3IG 4RCOA 1XXGA 4AYBE 1J9OA 4JI1Q 4B3SH 3TIIA 4KTAA 1Q1EA 2RSOA 3BZKA 1K1QA 2VZAA 2GPWA 2Z8LA 4WBNF 1I4GA 1O80A 3VDYA 2XCPA 3G48A 1PTOC 3HKZE 3S24A 3W1GA 2QYZA 1B8AA 2EYHA 4A75A 4JI8H 4KKUA 3ULJA 3MXUA 4QW9A 4HCSA 5E1FA 3S1MB 4ECWA 2F0JA 1OO9B 4LF6Q 3BYYB 4C5AA 1RIPA 3CMEA 4N9TA 1G6PA 1LT3D 2WKCA 1BUVT 4G7OC 3K8AA 4KY5A 1EQRA 1FVIA 1TT2A 4P75A 2RDFA 4OX9Q 2IJ0A 5CBEE 4J1MA 3NK9A 4DNIA 1SE4A 3M4QA 4KJOA 3GQBA 2OTLA 2R92B 1RK6A 3S14B 4YJ2F 5KNDA 2K52A 3J81c 2JA5H 1EZ8A 5EKIA 3RR5A 4BBRG 3S2HH 1I6HH 3KF8A 3MVVA 2YU9H 1PTOF 5EJWA 1L2ZA 4HJAA 5I6WA 2V59A 2TSSA 4A3IH 5CMDA 3LWBA 1AH9A 1TWCA 4GOPC 4B9XA 1H9MA 1C9OA 1HXYD 3RZOB 1BCPF 4QL5A 1B53A 4GC6A 2PQEA 4JBKA 1KTKA 3VPCA 3FRPB 5IGFA 1GKHA 4MA0A 3IN5A 2XD4A 4YAKB 4C3JG 1VQFA 3RLOA 3UDFA 2V5AA 2HHHQ 2VA3A 3FKIB 3KUPA 4JI0L 2VUMH 3RN2A 1YI2A 1N8RC 4XTCS 3CC7A 1B50A 1A3TA 3NEMA 3OWEB 4CDCC 2VUMB 1HFGA 5FLXE 5D8DA 2ASLA 4QY7A 1E1OA 3PW2A 1QOHA 5KFZA 1UEBA 1QCBD 4RZQA 5GAHC 3U9TA 5COYA 4TV8F 1TR5A 2N49A 1EY5A 1NBWA 2WIIB 3W3AA 1S0NA 4DK3C 3MR5A 4KHVA 3T1HL 4QJFA 4KN4C 4O0AA 4QUCA 2ZXPA 5FKAC 4KHPL 4RG1A 4DNTB 2VOBA 1E4EB 2IX1A 1WTHA 2B2WC 4OEMB 5C44B 1IYJB 2UVWA 3RUPA 4EFEA 5FLXW 2M2LA 4TQSA 4LF9L 4YB8B 3I4MB 4GKKQ 5DG7A 5M3FH 1R9TB 1E2VA 3GO5A 3TDQA 2C2RA 3HB9A 3DEPA 4P2CB 2PN1A 4LF6H 1X3QA 2NVYH 1VQOA 3GTQA 2RVLA 4XQJA 1PH2A 4RGTA 2IHFA 3JAML 3BVMA 2F4VH 4L6TB 3P1HA 2R84A 4RAZA 3K0XA 1SDFA 4MV7A 2ZT9C 2WKDA 4F87A 1H9JA 1CM9A 4DR1H 3J80W 3F2UA 5C1PA 1YJ9A 1EIYB 5JQWA 4KD3A 4XYLB 3J81j 2O5JC 2F0TA 4TVAB 4R4TA 3CMAA 3EPGA 3U50C 1PFSA 4A3MG 2CVRA 3IKJA 1E0BA 2I80A 1PK8A 5JJIA 4M9UA 2JEJA 1IBKL 4B3TL 2PQAA 4IUUA 4DR4Q 1N32L 2HJWA 3UQ8A 5M3FG 1HUNA 4FXGC 1EWIA 2K14A 2Z9HA 3PO3H 3JSLA 4YWLA 3NGDA 1KJJA 3BZCA 2EY5A 3DF7A 3V2TA 5IT9E 4JI4L 1XNQL 3K0YA 2YZNA 1TWGB 4BBRB 1VQHA 3P75A 1LTAD 4X3KA 3U4VA 3A5UA 3PW5A 4IFDG 2R7ZB 3BDLA 1OXXK 2CH4A 5C3EH 4U673 3G4SA 3N8DA 4DUZQ 1XTDA 2WINB 2Q8IB 1BOSA 3J81E 4IPCA 5M5YB 5E7NA 4ID6A 1I3QH 3MTSA 4EBCA 4QCLA 2EVBA 3GTGB 2WB1G 5J22A 1QUQA 4FS2A 1Y8OB 4LUOA 2JA8B 2ICEC 4L5QA 1DZ1A 3H20A 4C3JB 3H0GA 1V4YA 2W6MA 1ZXTA 4DR5H 2BE5D 4NLGA 5KFTA 3F2DA 4DNRB 3OMGA 3CPFA 1HNZL 3A8KE 3NQTA 1T5XD 2XCAA 4WD3A 2B2VA 4DV6H 1STEA 4ZKBB 1G291 5ELCA 4GKJQ 3WO0A 1SMYC 1ZEQX 1ULZA 1Q81C 4QWDA 2CQOA 3PUXA 1IBMH 2WAQG 2UUBH 2QKIC 4X62Q 4J9MA 2W71A 3NBHB 1G8ZD 2GN5A 2SOBA 2H4OA 3T4AC 5LMUH 3BA9A 3KHGA 4L63B 3D4RA 3RTXA 1SFOA 4JI2H 1LUZA 1Y14B 3EA6A 2UXCH 4IRDA 1STBA 4A3EB 5FK9C 4DV1L 5KG1A 3I4OA 4DL6A 1TXYA 2FJZA 3F1ZA 3U4ZA 3PF5A 1KD1C 2ZDHA 1N33L 2JA6G 1PX2A 3GTKH 1BKBA 1A3VA 1SYCA 2FHTA 4DAYA 5A2QL 2PVPA 3GQCA 1LYLA 4LNQA 5EAYA 3Q8QB 4ECTA 2F4VQ 4OO1H 1CHQD 2WDTA 3QFFA 1K0RA 2ATWA 1K83A 2R7ZA 4FXDA 3MEFA 5FOBB 4B3ML 5HBRB 3D4DA 3GIKA 3AMUA 1T94A 5KFNA 4U68A 1V43A 4HNUA 5KFFA 1N9WA 2JA7H 1J5EH 1NNXA 1ZKOA 1KDBA 3EFXD 3I91A 5CV4A 5C3XA 2IPKD 1TWAB 3HOVB 1PH8A 2JYOA 2E5LL 2Y0SA 2UXBL 2BE5C 1DOLA 4LWCA 5C44G 4A3GH 1KHIA 2BQ3A 3M7NA 4TV9F 1EY0A 1X55A 2MO1A 1I7LA 3DWAA 2OQ0A 4CBVA 2XIGA 4DR2Q 1NAPA 2QA4A 3NTKA 4A3JH 2YL2A 1SYBA 4G3IA 3LMLA 1NCVA 2N3SA 2H1EA 2VQEQ 1CZWA 1UNNC 3M4IA 3N41B 1JOKA 1HQMC 1VQ7A 3NTHA 4LSXA 4K8JA 4BY1B 4DV4H 4AIMA 2F0VA 4IUQA 3GTQB 2UVVA 2WFWA 1EIGA 1FNWA 1HPCA 1K9MC 2EZVA 4K0KL 5HGQA 3VMMA 1W6KA 4LFAH 1V8QA 1GHJA 4DR2H 4A93B 2F0PA 3L4KA 4A3BB 1HNXH 2CWAA 2JA5G 5M3FB 1VMPA 2EY2A 4TUYF 1ICFB 2D2CC 2F0HA 1FNVA 1E4EA 3N42B 2UXCL 2PO4A 3LWEA 3ERQA 5AJ3L 3AFPA 2Q2UA 1EZ6A 2R3ZA 3SI8A 4CDEC 4KMUC 4IUPA 4R8NA 1JE5A 1SROA 2JP1A 3LNNA 4K2LA 1BQQT 1J5EQ 3TQ1A 1B33N 1GUGA 2XRSD 2FPPB 4Q0FA 4N8FA 2BA1A 3GTPA 3BVZA 1VF7A 5KFYA 3FDSA 1F9SA 3I4NG 3M4PA 3EN2A 1WCMH 4HR7A 3T1YQ 2GVBA 1ONLA 4R8UB 1O7IA 2J6UA 2EE1A 4J0MA 5ELFA 4QQBX 1DYQA 3D31A 1S0MA 1D1IA 4QW8A 2K5VA 4RB1A 4LF5Q 4LFBL 4G57A 5J39A 1YHQA 1K8MA 2CWPA 2XSCA 4DA2A 2ALZA 4DR3Q 4B3SQ 4J9PA 4PV1C 4O3OA 4ILWA 4JV0A 4L8JA 1UNSA 2B2TC 2E2HB 3VYUA 4JI2Q 4UFZA 4P71A 2O2LD 1EFID 1SJED 5IODA 3Q8RB 5D3DA 3A0JA 1O7LA 2E2DC 1K8OA 4HMIA 4HTHA 1VQKA 1FKAH 1PZJD 1GSOA 4DR6L 2A6HC 2L12A 3UDGA 4RB0A 2ZJQA 1I4QA 1CTMA 4EYIB 2HUGA 4FM9A 1XPRA 5KKNB 4JI0H 3M4OH 4JYAH 2GPSA 4A3DG 3KTMA 3TQTA 4F4WA 2FINB 4Y7NH 4HJ7A 2UUCH 2NU7B 1F9RA 1EFWA 2BQUA 2R8JA 3H6MA 2VB2X 5KG4A 1XMOL 2SCUB 1CE8A 1ENAA 4IPHA 4K2KA 1TQOA 4DAPA 3EJIA 2VQFL 2UUCQ 3PW7A 4DR1L 3X3NA 4FF1A 4A3FG 3RGXA 4YP3A 4NXMH 5H1SE 4HJ9A 5IYZF 1VQDA 1EHIA 2X6LA 3TEHB 2UUAL 3G6YA 4EEYA 3GTJA 1MSHA 1VKZA 2RF4A 1SNQA 4DPGA 1IYVA 3HXLA 2VXWA 1PXUA 4DAVA 3PUWA 4Q45A 5FLMH 1QVFA 4NDXA 3CCUA 5LMNQ 2UU9L 3HOVG 4DV3L 2G9HD 5BPHA 4PZ6A 1Q1BA 2KCNA 2FXQA 1JMCA 1QE6A 2C00A 4I50F 5EZYF 4HNVA 2W9CB 3IFDA 4DV5Q 2FJ2A 1ET9A 4A3KH 5JVH3 1QB5D 2W9BA 2K28A 2W7OA 1ZHSA 5C4JH 4GC7A 1J6QA 4Q8EA 3TQYA 5IT9W 3NTIA 4Z9CB 1M8AA 5IYDG 1EWCA 5FJ8G 3S1RB 4X65H 1IW7C 3NELA 3S1QB 2NVYA 3FHWA 4DFAA 4DR3H 4KY7A 4JBJA 1BBXC 4LF4Q 5JH7F 2EJFC 1M4VA 4C2MA 1I50B 5CV6A 3L4JA 4RHRA 2YS7A 4IOCA 3BG3A 3CCMA 1CHPD 4HMJA 1HR0W 4R1JA 5M3MH 3P7JA 4FVMA 2V4RA 4OGQC 1VQLA 4J9SA 4JW0A 2IP4A 4DL3A 1BCPB 1EY6A 3K57A 4PWQA 3ZJYC 2B8FA 1KRTA 4A3LH 1W96A 1H9RA 1X6OA 2W6ZA 1EY7A 2EYFA 1TWHA 1SEIA 1QILA 1AEXA 1HZAA 4RHSA 4DV7Q 4I7AA 5LXTF 3KLWA 2K1BA 1L1OC 1SEBD 2AWOA 4LF5L 1IBLL 1JB7A 4XYMB 3NHHA 1RTNA 1B70B 1TKWB 2YU9A 3JAMi 1JOQA 4HQ6A 1X3FA 2Z4IA 1Z9FA 1UWVA 3PUVA 2R92A 5M3MG 3T1YL 4XIGS 5CV8A 4GN5A 5FLMG 4IAJA 4RMFA 4YHHQ 3MZ5A 4JOIA 5KYLA 4ZUIA 3HEJA 4MTKA 5ELEA 3EPIA 3PO2H 4JI3Q 3VR3A 4ZI7F 1VQJA 2DN8A 5I9PA 2NN6I 1V1PB 5JPNC 1S9FA 3OMCA 4DK1A 3F2CA 2HGSA 2LKVA 3K59A 4HIKA 1T3NA 2OF1A 4QGUA 3RFCA 4HIMA 4LUZA 5CBAE 3D4WA 2ZTCA 1STGA 4FS1A 5LMUL 2I07B 1STAA 2N55A 3FKIH 1SRUA 3MWYW 5E4WC 4YCWA 1HNWL 1V9PA 1F2MA 2F0MA 1B4OA 2JEAI 3PO2G 4X65L 4DV1H 3HOZH 3HKZA 1MD2D 2L4NA 3X3MA 4A3MH 4WJ3M 1OXUA 3J81L 1U9RA 1GUNA 4EYHB 1WCMB 3ORRA 5KFBA 1WD1A 3G6EA 3QZ7A 1CQJB 3CRKC 2B39A 1JC7A 3AU7A 1VQNA 4Q5VA 4LW1A 4G4KA 3GTJH 5IYBH
chains in the Genus database with same CATH topology
4JI8Q 1YI2A 1N8RC 1GO3E 4XTCS 1EYGA 3CC7A 1SN8A 4GN4B 3JC66 4GOPB 3NEMA 4A3GG 2JK8A 3RLFA 1N34L 4C2MH 4QY7A 1E1OA 3UDIA 5JJKA 4JI3L 4A3IG 1UEBA 1X56A 5GAHC 4HIDA 4Y52H 5IE8A 2BA0A 2N49A 1Y1WH 1NBWA 3K7AH 3FP9A 2ZJPA 4DK3C 3GDEA 4DAMA 4QJFA 3KF6B 1D8LA 4O0AA 3T1HL 2ZJRA 3CCQA 4X62L 4A93G 1CKNB 4RG1A 4KHPL 2IX1A 1M1KC 1EIFA 1UE5A 4DV5L 4A3EH 3HOYH 1VQIA 1TWFH 4JI7L 1IYJB 1WYDA 2VY3A 4DR6Q 1TWHH 3K81C 5LMNL 3J7A5 4LF9L 2R7FA 1VQ5A 4BXXG 4GKKQ 1IBMQ 1IBLQ 2UUBQ 4KLKA 5M5YH 5M3FH 2Y0SG 3H0GG 4JG2A 1IL2A 3GO5A 2K50A 1MIUA 2Z0SA 2NVYH 1E1TA 1VQOA 1N33Q 3HOUG 4LUVA 4YY3L 4OX9L 4FDBA 2Y0SE 3SGIA 1PH2A 3GTOH 4B3RL 1YITA 2IHFA 4EX5A 3KDFB 3WWVA 4APVA 3H3VI 4JOIC 1YHAA 4DR5Q 1QUQB 1AE2A 3K0XA 4A3LG 1E24A 1H95A 2IX0A 3F2BA 4NXNL 4DAYB 1SLJA 4PZ8A 1YJ9A 4AYBG 5ELOA 3HKZG 1EIYB 2A8VA 3J81j 1K3RA 3CMAA 4TVAB 4R4TA 2MNAA 3CP0A 1VQ9A 2NZHA 1PFSA 3U50C 5K36G 4A3MG 1QVCA 5JJIA 2VL6A 5JEAJ 2UXCQ 5C0XG 1IBKL 4B3TL 2PQAA 2RHQB 1XNQQ 4DR4Q 4UP8A 1ASYA 3S15H 4JI4Q 1N32L 4EQ5A 2PQAB 2KBNA 5M3FG 1EWIA 1UE6A 3STBC 4GKJL 2K14A 1U5KA 4QIWE 3PO3H 4A3CH 1D7QA 4DR7L 4YWLA 1SR3A 1IXRA 1VQBA 4A3FH 3BZCA 3K7UC 5JEAG 4JI4L 2BH2A 3S1QH 1DGSA 1XNQL 5IWAL 1VQHA 4DV7L 1YIJA 2R93G 3KJPA 3U4VA 3A5UA 4GNXA 2GVAA 4OWTB 4OONA 1YJNA 3S16H 1Y1WG 5IYCG 4IFDG 4BY1H 1OXXK 1V1QA 5C3EH 2LXKA 3G4SA 1K8AC 3HOXG 5IT9c 5IP7G 4DUZQ 2VUMH 1XTDA 1Q7YC 4LF7Q 2CKZB 2ZM6Q 4IPCA 3RLNA 3A74A 3K80C 4LF8L 5E7NA 2VW9A 1I3QH 3CCJA 4X6AH 1NMGA 4B3RQ 4NB3A 2WB1G 4IFDI 1QUQA 5IYBG 4LUOA 4YY3Q 4L5QA 2HIVA 1TWGH 3L7ZC 2EIFA 4MNOA 4BBRH 3PGZA 4MTNA 3J7ZC 3PSIA 2NZOA 3F2DA 1BBUA 1IBML 4P74A 2V1CC 2UUBL 4J15A 3CPFA 1HNZL 2E5LQ 1FJGQ 4MZ9A 4OO1G 1P16A 1N36Q 2HT1A 1G291 4GKJQ 2VNUD 3CCRA 2VQEL 3HKSA 1WFQA 2IY5B 1Q81C 2CQOA 3PUXA 4DK6C 1RL2A 2WAQG 5IP7H 3E0EA 4KHPQ 3ER0A 4X62Q 3AEVA 3TS2A 3ULPA 3NBHB 2GN5A 4GOPA 1NE3A 2KCMA 1KRSA 2HQLA 3JAMc 1R9TH 4YCUA 2PI2A 1EUJA 3M85A 2AHOB 1Q12A 2UU9Q 5HY6A 1C7YA 4DUYL 1LUZA 1B7YB 1Y14B 2K4KA 2IT1A 3B6YA 3PIPA 1K73C 3S1MH 2R6GA 4DV1L 1K8GA 3I4OA 2ZTDA 2YTYA 4C3IH 1PH6A 1TXYA 4GLAC 1WCMG 3F1ZA 3PV0A 3U4ZA 1OXSC 2ID0A 3PF5A 1KD1C 2I0QA 4A3CG 3CCVA 1C0AA 2NN6G 1N33L 2B63G 4DR1Q 2JA6G 4AQYQ 3GTKH 4OWWB 1HH2P 2ZM6L 1BKBA 5GQOA 1HZBA 4JYAQ 4B3MQ 1LYLA 1SE8A 5EAYA 2PMZE 3RN2A 1QZGA 4LNQA 2F4VQ 5IY0A 4DV2Q 4LF9Q 4UPAA 1G51A 1K0RA 1K83H 1YHBA 2ATWA 3S17H 3F8TA 3MEFA 4LFBQ 2JA9A 4GN3B 5C4XG 1CKNA 4B3ML 1A62A 5FLXc 4BY7H 1YZ6A 3ULLA 1V43A 1BBWA 2JA8H 1HZ9A 3GD7A 3BJUA 1N9WA 2JA7H 3T1HQ 1XNRQ 1PA6A 1PH3A 2KCTA 1PH8A 1JJ2A 1LTLA 1HNZQ 5IP9H 1FL0A 1OXVA 2AMCB 1S40A 2E5LL 1FJGL 2UXBL 3H0GH 4JC0A 4LWCA 5C44G 1N34Q 2JA6H 4A3GH 3TREA 1KHIA 4B3TQ 3M7NA 1N32Q 1KIXA 1X55A 3DM3A 2MO1A 2EXDA 3KF6A 2OQ0A 5GROA 4DR2Q 1YVCA 2QA4A 2OCEA 2D0OA 4A3JH 2N3SA 3S2DH 2R7DA 2VQEQ 1PYSB 1QVGA 4BBSH 2E2JH 1X3EA 3G71A 4B3SL 4GLXA 1N36L 1VQ7A 3KOJA 4IPDA 2R7ZH 1X9NA 1E22A 2F4VL 4PMWA 2QEXA 4AIMA 4JYAL 1NMFA 1CUKA 1HNXL 1VQPA 1VQ8A 3MXNB 5C44H 4ME3A 2WFWA 1WJJA 3KF8B 4DV0L 1Q8KA 2WB1E 2YTVA 3IRBA 3CC2A 3FKIG 1CKOA 1K9MC 4K0KL 4OO1I 5HGQA 4H02A 4DV4L 2OWOA 2ALYB 4DV1Q 1FGUA 2R93H 2CWAA 2JA5G 4LF7L 1BVSA 4DUZL 2R92H 1XPOA 5GAGC 3RN5A 2R92G 3CD6A 2CCZA 4A93H 4A76A 1GVPA 4LFAL 2UXCL 1Q82C 5AJ3L 3GTLH 2VS1A 3AFPA 3I4MG 4HIOA 2AKWB 2Q2UA 4P73A 2LSSA 5AJ3Q 3HFZB 5IWAQ 3HOZG 1JE5A 1SROA 4LFAQ 4ALPA 4IFDJ 1A63A 4POGA 5BR8Q 1J5EQ 1HJPA 1I5FA 1W3SA 4R4QA 3HOXH 1UE7A 1VQ4A 3KYHC 2DGYA 2UXDL 2BA1A 4DR7Q 5FJ8H 3I4NG 3M4PA 2N8NA 3EN2A 1WCMH 4DV4Q 3T1YQ 2GVBA 3RZDH 4K0KQ 1O7IA 4JI8L 3STBD 2WP8J 4LF4L 4POFA 2YYZA 1XNRL 4UP7A 4TQUS 1YBYA 2JEBI 2AWNA 4OXPA 3W1BA 4DR4L 4QQBX 3D31A 4YWKA 2C35B 1KXLA 2K5VA 1EQQA 4JI5Q 1AE3A 4LF5Q 5C0XJ 1YHQA 3NENA 4LFBL 2CWPA 1MJCA 1L0WA 2ES2A 2ASBA 4DR3Q 1TWCH 2K5HA 4B3SQ 1NY4A 1PYBA 4NXNQ 1VQEA 1X54A 4R4IA 5ELNA 3CPWA 4X65Q 4KHZA 5C0XI 4DR5L 5C3EG 4JBWA 4AQYL 2NVTH 4DV3Q 3HOWH 3M3YH 4JI2Q 4P71A 4X66Q 3CXCA 3A5ZB 3GTPH 5M5WH 3PIOA 2XGTA 2B3GA 4C3HH 2EQSA 3L2PA 1S72A 2F3IA 3HOYG 5LMUQ 2XTIA 1ASZA 2PNHA 4DKAC 5J3BA 2YV5A 1YEZA 3A0JA 4L5RC 2K75A 2KHJA 3E9HA 2UXBQ 3D0FA 1VQKA 4KI0A 5LMNW 3I4NH 1PH7A 1E7ZA 1L1OB 4IJLA 4DR6L 3PO3G 3HOVH 1VQGA 3UDGA 2ZJQA 1YNXA 4JI7Q 4DV6Q 2UUCL 2LXJA 1T9HA 2D62A 1PHJA 1WOCA 4L5SA 3E9IA 4A4IA 3OYYA 3DLLA 4LFCQ 1XMOQ 2QGQA 4GNXC 3S1NH 3I55A 2DUDA 4R4OA 4YWMA 1XPRA 3M4OH 3KJOA 1OXTA 1CSQA 1Q46A 1PH5A 4A3DG 1L1OA 3OTOL 4NPSA 4Y7NH 5GAEC 4HJ7A 3I4MH 4NXML 2R7ZG 1EFWA 2JA7G 4DV2L 2OTJA 1A0IA 2VUMG 1XMOL 4LFCL 1WI5A 2F52A 4IPHA 4PZ7A 4A3KG 2VQFL 1LM0A 4DV6L 2UUCQ 4A3BH 2YTXA 4DR1L 4BA2I 2N78A 4A3FG 2A1AA 4R4CA 4GNXB 5H1SE 3L0OA 4PG3A 4JCVE 3CCEA 4HJ9A 1VQDA 3TEHB 2HHHL 1IZ6A 2UUAL 1U0LA 3PCOB 4LF8Q 1X3GA 2RF4A 4DPGA 3S1RH 3GTMH 4GKKL 5IP9G 1XMQQ 3PUWA 2B63H 4OWXB 5IYCH 5FLMH 4DUYQ 1QVFA 3RZOH 4JI2L 3CCUA 5LMNQ 2D0PA 2I5LX 2UU9L 4DV3L 3HOVG 5GADC 4O2DA 4PZ6A 1Q1BA 3RNUA 2FXQA 1JMCA 3ICEA 3AQQA 3M9BA 1VQ6A 1NJIC 1I94L 3PUYA 4DV5Q 1W2BA 4GLVB 4A3EG 4IPGA 1EOVA 4A3KH 3GTJH 4DR3L 2E2IH 1Q86C 5C4JH 4NXMQ 1J6QA 3I56A 3TQYA 1A8VA 3OW2A 3TRZA 5IYDG 5FJ8G 3BU2A 1I50H 2KHIA 3CCSA 3NELA 2PI2E 3AYHB 1JJCB 3FHWA 1VQMA 3HOUH 4JBJA 1VCIA 1E3PA 4LF4Q 2OQKA 4L5TA 1S3OA 3EIVA 3W5OA 1TWAH 2WAQE 4IOCA 3KDFA 2JQOA 3UE0A 3CCMA 4UP9A 3PF4A 2Q2HA 1HR0W 4JI0Q 2UXDQ 4WJ4A 2E2HH 3CC4A 1CSPA 1Y1VG 4R1JA 4YCVA 5M3MH 5BR8L 3J80i 2RCNA 1J5EL 4JV5Q 1VQLA 1L2FA 4YHHL 2NVXH 4BY7G 3ZJYC 4A3JG 4JI6L 1KRTA 1I94Q 5C4XH 4X64L 3I7FA 1X6OA 2KENA 4X66L 4A3LH 3GTGH 3LGJA 4IO9A 4A3DH 2L15A 1HZAA 1VQAA 4X64Q 2MQHA 4DV7Q 1GM5A 1YJWA 3KLWA 4JI1L 1L1OC 2K5NA 3H15A 2BH8A 2AWOA 1MJEA 2Q2TA 4JI5L 3TS0A 1IBLL 1KC8C 1JB7A 4JBMA 3CAMA 3UE1A 4LF5L 4BXXH 5IYDH 1B70B 3JAMi 4GS3A 1KQSA 1X3FA 1Z9FA 4UY8C 1UWVA 3GTQH 4AYBE 4JI1Q 1KL9A 3PUVA 1HZCA 2Z6KC 1HNXQ 1Q1EA 1Z47A 3BZKA 1OTCA 1Y1VH 5M3MG 2A19A 1PH9A 4AH6A 3T1YL 2VZAA 1IBKQ 4XIGS 2RHSB 3VDYA 4GN5A 3G48A 3CCLA 1P8LA 2Z6KA 4BA1I 5FLMG 1KAWA 5JJLA 4LF6L 3Q8DA 3HKZE 4RMFA 4YHHQ 3S24A 3W1GA 1HR0Q 4JOIA 4HJ5A 1B8AA 2JE6I 3CF5A 4A75A 3U58A 3ULJA 2H5XA 3UDXA 3PO2H 4JI3Q 1PVOA 1HR0L 1VQJA 4LF6Q 4DR2L 2IHEA 1JT8A 1RIPA 3CMEA 2NN6I 1SFOH 1G6PA 2Q2IA 3F2CA 1PH4A 1PH1A 3K8AA 3S14H 4A3BG 1EQRA 2JJQA 1GD7A 1FVIA 2I5MX 4QGUA 1VQCA 4P75A 4HIKA 4OX9Q 4HIMA 3HOWG 3ERSX 4DNIA 2I5HA 3M4QA 4LUZA 2OTLA 3J80c 4HJ8A 2HIXA 2MFIA 2ZTCA 1X65A 2K52A 3J81c 1PV4A 2JA5H 3RR5A 4BBRG 5LMUL 3S2HH 1I6HH 3EBEA 3KFUA 2YU9H 1CKMA 2B29A 1M90C 3FKIH 4HJAA 2CFMA 1SRUA 1MKHA 1UE1A 4YCWA 4DV0Q 1HNWL 1V9PA 4A3IH 3CW2C 4IOAA 2VQFQ 2JEAI 3PO2G 4X65L 1AH9A 3HOZH 4GOPC 5M5XH 1XJVA 5DLQE 1SMXA 1C9OA 2E8GA 1HNWQ 3AFQA 3I2ZA 4QL5A 4A3MH 4BY1G 1OXUA 4WJ3M 3PUZA 3J81i 4JBKA 1JJGA 4JI6Q 1QZHA 1XMQL 1GKHA 3CQZH 3OTOQ 3H3VH 2ZTEA 4P72A 3G6EA 1XPUA 2MO0A 4IJHA 2JA8G 4BBSG 1VS0A 4C3JH 4JV5L 1VQFA 3RLOA 1VQNA 2NVQH 3UDFA 2HHHQ 2UUAQ 4LW1A 4JI0L 1NTGA 5IYBH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI8 Q;  1YI2 A;  1N8R C;  1GO3 E;  4XTC S;  1EYG A;  3CC7 A;  1SN8 A;  4GN4 B;  3JC6 6;  4GOP B;  3NEM A;  4A3G G;  2JK8 A;  3RLF A;  1N34 L;  4C2M H;  4QY7 A;  1E1O A;  3UDI A;  5JJK A;  4JI3 L;  4A3I G;  1UEB A;  1X56 A;  5GAH C;  4HID A;  4Y52 H;  5IE8 A;  2BA0 A;  2N49 A;  1Y1W H;  1NBW A;  3K7A H;  3FP9 A;  2ZJP A;  4DK3 C;  3GDE A;  4DAM A;  4QJF A;  3KF6 B;  1D8L A;  4O0A A;  3T1H L;  2ZJR A;  3CCQ A;  4X62 L;  4A93 G;  1CKN B;  4RG1 A;  4KHP L;  2IX1 A;  1M1K C;  1EIF A;  1UE5 A;  4DV5 L;  4A3E H;  3HOY H;  1VQI A;  1TWF H;  4JI7 L;  1IYJ B;  1WYD A;  2VY3 A;  4DR6 Q;  1TWH H;  3K81 C;  5LMN L;  3J7A 5;  4LF9 L;  2R7F A;  1VQ5 A;  4BXX G;  4GKK Q;  1IBM Q;  1IBL Q;  2UUB Q;  4KLK A;  5M5Y H;  5M3F H;  2Y0S G;  3H0G G;  4JG2 A;  1IL2 A;  3GO5 A;  2K50 A;  1MIU A;  2Z0S A;  2NVY H;  1E1T A;  1VQO A;  1N33 Q;  3HOU G;  4LUV A;  4YY3 L;  4OX9 L;  4FDB A;  2Y0S E;  3SGI A;  1PH2 A;  3GTO H;  4B3R L;  1YIT A;  2IHF A;  4EX5 A;  3KDF B;  3WWV A;  4APV A;  3H3V I;  4JOI C;  1YHA A;  4DR5 Q;  1QUQ B;  1AE2 A;  3K0X A;  4A3L G;  1E24 A;  1H95 A;  2IX0 A;  3F2B A;  4NXN L;  4DAY B;  1SLJ A;  4PZ8 A;  1YJ9 A;  4AYB G;  5ELO A;  3HKZ G;  1EIY B;  2A8V A;  3J81 j;  1K3R A;  3CMA A;  4TVA B;  4R4T A;  2MNA A;  3CP0 A;  1VQ9 A;  2NZH A;  1PFS A;  3U50 C;  5K36 G;  4A3M G;  1QVC A;  5JJI A;  2VL6 A;  5JEA J;  2UXC Q;  5C0X G;  1IBK L;  4B3T L;  2PQA A;  2RHQ B;  1XNQ Q;  4DR4 Q;  4UP8 A;  1ASY A;  3S15 H;  4JI4 Q;  1N32 L;  4EQ5 A;  2PQA B;  2KBN A;  5M3F G;  1EWI A;  1UE6 A;  3STB C;  4GKJ L;  2K14 A;  1U5K A;  4QIW E;  3PO3 H;  4A3C H;  1D7Q A;  4DR7 L;  4YWL A;  1SR3 A;  1IXR A;  1VQB A;  4A3F H;  3BZC A;  3K7U C;  5JEA G;  4JI4 L;  2BH2 A;  3S1Q H;  1DGS A;  1XNQ L;  5IWA L;  1VQH A;  4DV7 L;  1YIJ A;  2R93 G;  3KJP A;  3U4V A;  3A5U A;  4GNX A;  2GVA A;  4OWT B;  4OON A;  1YJN A;  3S16 H;  1Y1W G;  5IYC G;  4IFD G;  4BY1 H;  1OXX K;  1V1Q A;  5C3E H;  2LXK A;  3G4S A;  1K8A C;  3HOX G;  5IT9 c;  5IP7 G;  4DUZ Q;  2VUM H;  1XTD A;  1Q7Y C;  4LF7 Q;  2CKZ B;  2ZM6 Q;  4IPC A;  3RLN A;  3A74 A;  3K80 C;  4LF8 L;  5E7N A;  2VW9 A;  1I3Q H;  3CCJ A;  4X6A H;  1NMG A;  4B3R Q;  4NB3 A;  2WB1 G;  4IFD I;  1QUQ A;  5IYB G;  4LUO A;  4YY3 Q;  4L5Q A;  2HIV A;  1TWG H;  3L7Z C;  2EIF A;  4MNO A;  4BBR H;  3PGZ A;  4MTN A;  3J7Z C;  3PSI A;  2NZO A;  3F2D A;  1BBU A;  1IBM L;  4P74 A;  2V1C C;  2UUB L;  4J15 A;  3CPF A;  1HNZ L;  2E5L Q;  1FJG Q;  4MZ9 A;  4OO1 G;  1P16 A;  1N36 Q;  2HT1 A;  1G29 1;  4GKJ Q;  2VNU D;  3CCR A;  2VQE L;  3HKS A;  1WFQ A;  2IY5 B;  1Q81 C;  2CQO A;  3PUX A;  4DK6 C;  1RL2 A;  2WAQ G;  5IP7 H;  3E0E A;  4KHP Q;  3ER0 A;  4X62 Q;  3AEV A;  3TS2 A;  3ULP A;  3NBH B;  2GN5 A;  4GOP A;  1NE3 A;  2KCM A;  1KRS A;  2HQL A;  3JAM c;  1R9T H;  4YCU A;  2PI2 A;  1EUJ A;  3M85 A;  2AHO B;  1Q12 A;  2UU9 Q;  5HY6 A;  1C7Y A;  4DUY L;  1LUZ A;  1B7Y B;  1Y14 B;  2K4K A;  2IT1 A;  3B6Y A;  3PIP A;  1K73 C;  3S1M H;  2R6G A;  4DV1 L;  1K8G A;  3I4O A;  2ZTD A;  2YTY A;  4C3I H;  1PH6 A;  1TXY A;  4GLA C;  1WCM G;  3F1Z A;  3PV0 A;  3U4Z A;  1OXS C;  2ID0 A;  3PF5 A;  1KD1 C;  2I0Q A;  4A3C G;  3CCV A;  1C0A A;  2NN6 G;  1N33 L;  2B63 G;  4DR1 Q;  2JA6 G;  4AQY Q;  3GTK H;  4OWW B;  1HH2 P;  2ZM6 L;  1BKB A;  5GQO A;  1HZB A;  4JYA Q;  4B3M Q;  1LYL A;  1SE8 A;  5EAY A;  2PMZ E;  3RN2 A;  1QZG A;  4LNQ A;  2F4V Q;  5IY0 A;  4DV2 Q;  4LF9 Q;  4UPA A;  1G51 A;  1K0R A;  1K83 H;  1YHB A;  2ATW A;  3S17 H;  3F8T A;  3MEF A;  4LFB Q;  2JA9 A;  4GN3 B;  5C4X G;  1CKN A;  4B3M L;  1A62 A;  5FLX c;  4BY7 H;  1YZ6 A;  3ULL A;  1V43 A;  1BBW A;  2JA8 H;  1HZ9 A;  3GD7 A;  3BJU A;  1N9W A;  2JA7 H;  3T1H Q;  1XNR Q;  1PA6 A;  1PH3 A;  2KCT A;  1PH8 A;  1JJ2 A;  1LTL A;  1HNZ Q;  5IP9 H;  1FL0 A;  1OXV A;  2AMC B;  1S40 A;  2E5L L;  1FJG L;  2UXB L;  3H0G H;  4JC0 A;  4LWC A;  5C44 G;  1N34 Q;  2JA6 H;  4A3G H;  3TRE A;  1KHI A;  4B3T Q;  3M7N A;  1N32 Q;  1KIX A;  1X55 A;  3DM3 A;  2MO1 A;  2EXD A;  3KF6 A;  2OQ0 A;  5GRO A;  4DR2 Q;  1YVC A;  2QA4 A;  2OCE A;  2D0O A;  4A3J H;  2N3S A;  3S2D H;  2R7D A;  2VQE Q;  1PYS B;  1QVG A;  4BBS H;  2E2J H;  1X3E A;  3G71 A;  4B3S L;  4GLX A;  1N36 L;  1VQ7 A;  3KOJ A;  4IPD A;  2R7Z H;  1X9N A;  1E22 A;  2F4V L;  4PMW A;  2QEX A;  4AIM A;  4JYA L;  1NMF A;  1CUK A;  1HNX L;  1VQP A;  1VQ8 A;  3MXN B;  5C44 H;  4ME3 A;  2WFW A;  1WJJ A;  3KF8 B;  4DV0 L;  1Q8K A;  2WB1 E;  2YTV A;  3IRB A;  3CC2 A;  3FKI G;  1CKO A;  1K9M C;  4K0K L;  4OO1 I;  5HGQ A;  4H02 A;  4DV4 L;  2OWO A;  2ALY B;  4DV1 Q;  1FGU A;  2R93 H;  2CWA A;  2JA5 G;  4LF7 L;  1BVS A;  4DUZ L;  2R92 H;  1XPO A;  5GAG C;  3RN5 A;  2R92 G;  3CD6 A;  2CCZ A;  4A93 H;  4A76 A;  1GVP A;  4LFA L;  2UXC L;  1Q82 C;  5AJ3 L;  3GTL H;  2VS1 A;  3AFP A;  3I4M G;  4HIO A;  2AKW B;  2Q2U A;  4P73 A;  2LSS A;  5AJ3 Q;  3HFZ B;  5IWA Q;  3HOZ G;  1JE5 A;  1SRO A;  4LFA Q;  4ALP A;  4IFD J;  1A63 A;  4POG A;  5BR8 Q;  1J5E Q;  1HJP A;  1I5F A;  1W3S A;  4R4Q A;  3HOX H;  1UE7 A;  1VQ4 A;  3KYH C;  2DGY A;  2UXD L;  2BA1 A;  4DR7 Q;  5FJ8 H;  3I4N G;  3M4P A;  2N8N A;  3EN2 A;  1WCM H;  4DV4 Q;  3T1Y Q;  2GVB A;  3RZD H;  4K0K Q;  1O7I A;  4JI8 L;  3STB D;  2WP8 J;  4LF4 L;  4POF A;  2YYZ A;  1XNR L;  4UP7 A;  4TQU S;  1YBY A;  2JEB I;  2AWN A;  4OXP A;  3W1B A;  4DR4 L;  4QQB X;  3D31 A;  4YWK A;  2C35 B;  1KXL A;  2K5V A;  1EQQ A;  4JI5 Q;  1AE3 A;  4LF5 Q;  5C0X J;  1YHQ A;  3NEN A;  4LFB L;  2CWP A;  1MJC A;  1L0W A;  2ES2 A;  2ASB A;  4DR3 Q;  1TWC H;  2K5H A;  4B3S Q;  1NY4 A;  1PYB A;  4NXN Q;  1VQE A;  1X54 A;  4R4I A;  5ELN A;  3CPW A;  4X65 Q;  4KHZ A;  5C0X I;  4DR5 L;  5C3E G;  4JBW A;  4AQY L;  2NVT H;  4DV3 Q;  3HOW H;  3M3Y H;  4JI2 Q;  4P71 A;  4X66 Q;  3CXC A;  3A5Z B;  3GTP H;  5M5W H;  3PIO A;  2XGT A;  2B3G A;  4C3H H;  2EQS A;  3L2P A;  1S72 A;  2F3I A;  3HOY G;  5LMU Q;  2XTI A;  1ASZ A;  2PNH A;  4DKA C;  5J3B A;  2YV5 A;  1YEZ A;  3A0J A;  4L5R C;  2K75 A;  2KHJ A;  3E9H A;  2UXB Q;  3D0F A;  1VQK A;  4KI0 A;  5LMN W;  3I4N H;  1PH7 A;  1E7Z A;  1L1O B;  4IJL A;  4DR6 L;  3PO3 G;  3HOV H;  1VQG A;  3UDG A;  2ZJQ A;  1YNX A;  4JI7 Q;  4DV6 Q;  2UUC L;  2LXJ A;  1T9H A;  2D62 A;  1PHJ A;  1WOC A;  4L5S A;  3E9I A;  4A4I A;  3OYY A;  3DLL A;  4LFC Q;  1XMO Q;  2QGQ A;  4GNX C;  3S1N H;  3I55 A;  2DUD A;  4R4O A;  4YWM A;  1XPR A;  3M4O H;  3KJO A;  1OXT A;  1CSQ A;  1Q46 A;  1PH5 A;  4A3D G;  1L1O A;  3OTO L;  4NPS A;  4Y7N H;  5GAE C;  4HJ7 A;  3I4M H;  4NXM L;  2R7Z G;  1EFW A;  2JA7 G;  4DV2 L;  2OTJ A;  1A0I A;  2VUM G;  1XMO L;  4LFC L;  1WI5 A;  2F52 A;  4IPH A;  4PZ7 A;  4A3K G;  2VQF L;  1LM0 A;  4DV6 L;  2UUC Q;  4A3B H;  2YTX A;  4DR1 L;  4BA2 I;  2N78 A;  4A3F G;  2A1A A;  4R4C A;  4GNX B;  5H1S E;  3L0O A;  4PG3 A;  4JCV E;  3CCE A;  4HJ9 A;  1VQD A;  3TEH B;  2HHH L;  1IZ6 A;  2UUA L;  1U0L A;  3PCO B;  4LF8 Q;  1X3G A;  2RF4 A;  4DPG A;  3S1R H;  3GTM H;  4GKK L;  5IP9 G;  1XMQ Q;  3PUW A;  2B63 H;  4OWX B;  5IYC H;  5FLM H;  4DUY Q;  1QVF A;  3RZO H;  4JI2 L;  3CCU A;  5LMN Q;  2D0P A;  2I5L X;  2UU9 L;  4DV3 L;  3HOV G;  5GAD C;  4O2D A;  4PZ6 A;  1Q1B A;  3RNU A;  2FXQ A;  1JMC A;  3ICE A;  3AQQ A;  3M9B A;  1VQ6 A;  1NJI C;  1I94 L;  3PUY A;  4DV5 Q;  1W2B A;  4GLV B;  4A3E G;  4IPG A;  1EOV A;  4A3K H;  3GTJ H;  4DR3 L;  2E2I H;  1Q86 C;  5C4J H;  4NXM Q;  1J6Q A;  3I56 A;  3TQY A;  1A8V A;  3OW2 A;  3TRZ A;  5IYD G;  5FJ8 G;  3BU2 A;  1I50 H;  2KHI A;  3CCS A;  3NEL A;  2PI2 E;  3AYH B;  1JJC B;  3FHW A;  1VQM A;  3HOU H;  4JBJ A;  1VCI A;  1E3P A;  4LF4 Q;  2OQK A;  4L5T A;  1S3O A;  3EIV A;  3W5O A;  1TWA H;  2WAQ E;  4IOC A;  3KDF A;  2JQO A;  3UE0 A;  3CCM A;  4UP9 A;  3PF4 A;  2Q2H A;  1HR0 W;  4JI0 Q;  2UXD Q;  4WJ4 A;  2E2H H;  3CC4 A;  1CSP A;  1Y1V G;  4R1J A;  4YCV A;  5M3M H;  5BR8 L;  3J80 i;  2RCN A;  1J5E L;  4JV5 Q;  1VQL A;  1L2F A;  4YHH L;  2NVX H;  4BY7 G;  3ZJY C;  4A3J G;  4JI6 L;  1KRT A;  1I94 Q;  5C4X H;  4X64 L;  3I7F A;  1X6O A;  2KEN A;  4X66 L;  4A3L H;  3GTG H;  3LGJ A;  4IO9 A;  4A3D H;  2L15 A;  1HZA A;  1VQA A;  4X64 Q;  2MQH A;  4DV7 Q;  1GM5 A;  1YJW A;  3KLW A;  4JI1 L;  1L1O C;  2K5N A;  3H15 A;  2BH8 A;  2AWO A;  1MJE A;  2Q2T A;  4JI5 L;  3TS0 A;  1IBL L;  1KC8 C;  1JB7 A;  4JBM A;  3CAM A;  3UE1 A;  4LF5 L;  4BXX H;  5IYD H;  1B70 B;  3JAM i;  4GS3 A;  1KQS A;  1X3F A;  1Z9F A;  4UY8 C;  1UWV A;  3GTQ H;  4AYB E;  4JI1 Q;  1KL9 A;  3PUV A;  1HZC A;  2Z6K C;  1HNX Q;  1Q1E A;  1Z47 A;  3BZK A;  1OTC A;  1Y1V H;  5M3M G;  2A19 A;  1PH9 A;  4AH6 A;  3T1Y L;  2VZA A;  1IBK Q;  4XIG S;  2RHS B;  3VDY A;  4GN5 A;  3G48 A;  3CCL A;  1P8L A;  2Z6K A;  4BA1 I;  5FLM G;  1KAW A;  5JJL A;  4LF6 L;  3Q8D A;  3HKZ E;  4RMF A;  4YHH Q;  3S24 A;  3W1G A;  1HR0 Q;  4JOI A;  4HJ5 A;  1B8A A;  2JE6 I;  3CF5 A;  4A75 A;  3U58 A;  3ULJ A;  2H5X A;  3UDX A;  3PO2 H;  4JI3 Q;  1PVO A;  1HR0 L;  1VQJ A;  4LF6 Q;  4DR2 L;  2IHE A;  1JT8 A;  1RIP A;  3CME A;  2NN6 I;  1SFO H;  1G6P A;  2Q2I A;  3F2C A;  1PH4 A;  1PH1 A;  3K8A A;  3S14 H;  4A3B G;  1EQR A;  2JJQ A;  1GD7 A;  1FVI A;  2I5M X;  4QGU A;  1VQC A;  4P75 A;  4HIK A;  4OX9 Q;  4HIM A;  3HOW G;  3ERS X;  4DNI A;  2I5H A;  3M4Q A;  4LUZ A;  2OTL A;  3J80 c;  4HJ8 A;  2HIX A;  2MFI A;  2ZTC A;  1X65 A;  2K52 A;  3J81 c;  1PV4 A;  2JA5 H;  3RR5 A;  4BBR G;  5LMU L;  3S2H H;  1I6H H;  3EBE A;  3KFU A;  2YU9 H;  1CKM A;  2B29 A;  1M90 C;  3FKI H;  4HJA A;  2CFM A;  1SRU A;  1MKH A;  1UE1 A;  4YCW A;  4DV0 Q;  1HNW L;  1V9P A;  4A3I H;  3CW2 C;  4IOA A;  2VQF Q;  2JEA I;  3PO2 G;  4X65 L;  1AH9 A;  3HOZ H;  4GOP C;  5M5X H;  1XJV A;  5DLQ E;  1SMX A;  1C9O A;  2E8G A;  1HNW Q;  3AFQ A;  3I2Z A;  4QL5 A;  4A3M H;  4BY1 G;  1OXU A;  4WJ3 M;  3PUZ A;  3J81 i;  4JBK A;  1JJG A;  4JI6 Q;  1QZH A;  1XMQ L;  1GKH A;  3CQZ H;  3OTO Q;  3H3V H;  2ZTE A;  4P72 A;  3G6E A;  1XPU A;  2MO0 A;  4IJH A;  2JA8 G;  4BBS G;  1VS0 A;  4C3J H;  4JV5 L;  1VQF A;  3RLO A;  1VQN A;  2NVQ H;  3UDF A;  2HHH Q;  2UUA Q;  4LW1 A;  4JI0 L;  1NTG A;  5IYB H; 
#chains in the Genus database with same CATH topology
 4FF3 A;  4JI8 Q;  2AQ3 B;  1SN8 A;  1T5E A;  3JC6 6;  4JI6 H;  4HSP A;  1KNA A;  2NU6 B;  3RLF A;  1KBL A;  2AUJ D;  2MGS A;  3NP8 A;  3T53 B;  2FPG B;  2X0S A;  1PFB A;  3NPP A;  5FO7 B;  3UDI A;  2DWC A;  5DQG A;  1X56 A;  4HID A;  5KG6 A;  4Y52 H;  2BA0 A;  3V6H A;  4JI1 H;  3K7A H;  3FP9 A;  2ZJP A;  4ODG A;  2PZW A;  4U6P A;  1D8L A;  1L0X B;  4R7R A;  2ZJR A;  3CCQ A;  1CT1 D;  4XT1 B;  2D9U A;  1EEF D;  1PRT C;  1UE5 A;  1JB3 A;  4DV5 L;  2R86 A;  1VQI A;  1TWF H;  4DU9 A;  1E2Z A;  4JI7 L;  2VY3 A;  5C4Z A;  4I4T F;  5LMN L;  3J7A 5;  3I90 A;  2PZU A;  4X62 H;  3SXH A;  5M5Y H;  3BYT B;  2Y0S G;  1IL2 A;  1A15 A;  3G6X A;  2K50 A;  1MIU A;  1E1T A;  5BPF A;  1N33 Q;  1Q8I A;  4LUV A;  1PZK D;  5EPJ A;  3SK5 A;  5DM7 3;  4YY3 L;  4FBT A;  5C8Y F;  3GV7 B;  3I12 A;  5J2U F;  3N40 P;  5JUM A;  3TSS A;  3D3R A;  3H4D A;  2RQX A;  3KDF B;  4N9P A;  3SE7 A;  1K83 B;  2K5D A;  1RJR A;  1RF2 D;  4DN4 M;  3ND8 A;  3H3V I;  5KFE A;  1S5D D;  2K5W A;  1AE2 A;  4DR5 Q;  4A3L G;  1SFO B;  1VBH A;  2FLP A;  1H95 A;  1U4L A;  2F0L A;  4NXN L;  4DAY B;  3I72 A;  1HQR D;  2C9O A;  3PIP 3;  4AYB G;  3HKZ G;  1KAA A;  2MNA A;  3CP0 A;  4B08 A;  3RBD A;  2SDF A;  5C0X G;  4R8I A;  3D8G A;  1ASY A;  3S15 H;  2JEG A;  3H91 A;  4ECZ A;  5EBD A;  1GUT A;  4UCU A;  4A3K B;  4GKJ L;  2EJM A;  3RB4 A;  3VYS A;  4XQQ A;  4A3C H;  1KJ9 A;  5KFA A;  1TVX A;  1RJQ A;  3VR4 A;  4IUV A;  1IXR A;  4A3F H;  2C2E A;  5JEA G;  3OPO A;  2DIK A;  3SK8 A;  2BH2 A;  1Q90 A;  3S1Q H;  1IHZ A;  4O1N A;  2R7K A;  3PMF A;  1DON A;  2R93 G;  5EWE A;  3CHB D;  3OSO A;  2F0E A;  1D1K A;  4LK1 C;  2B2Y A;  4OWT B;  4OON A;  4CDF C;  1Y1W G;  1V1Q A;  1K8A C;  3HOX G;  5IT9 c;  5KT7 A;  2G5D A;  2QIL A;  1Q7Y C;  4RAU C;  2CKZ B;  3K5M A;  3ERO A;  5C0X H;  2YZM A;  1ESR A;  2ZM6 Q;  1SYG A;  3A74 A;  3K80 C;  2XGQ A;  1BCP C;  4HNT A;  2L1B A;  3CCJ A;  1NMG A;  1PLF A;  1NUC A;  1EY4 A;  4YY3 Q;  3L7Z C;  1TWG H;  4BBR H;  4U7C A;  4MNO A;  3J7Z C;  3PGZ A;  2RBM A;  3Q1K A;  4ZAI A;  2HDL A;  5F9L A;  3MEH A;  3PSI A;  5I4D A;  2EYP A;  4J9R A;  2DLN A;  4C5B A;  1BBU A;  2ASD A;  4J15 A;  4CDD C;  2FFK B;  4C56 C;  2C2D A;  2AGQ A;  4OO1 G;  1N36 Q;  4ECS A;  2KEE A;  2KCC A;  2VNU D;  2IY5 B;  3HKS A;  4EQO A;  3GIP A;  1B3A A;  1EL0 A;  3PN1 A;  1PRT D;  5IP7 H;  3E0E A;  1F9Q A;  3AB9 A;  3ER0 A;  3AEV A;  4QMG A;  5EWF A;  4KD4 A;  4GOP A;  1NE3 A;  3K7A B;  4EQN A;  2HQL A;  4DR6 H;  4O42 A;  4IRC A;  1CS0 A;  1KJQ A;  1KLU D;  2CZG A;  3MHB A;  1Q12 A;  1D5Z C;  3C2P A;  2P5Z X;  2NTS A;  3TN2 A;  4DUY L;  1B7Y B;  2K4K A;  3PIP A;  3S1M H;  4CJ1 B;  4C3I H;  5NUC A;  2OH2 A;  1JLL B;  1S5B D;  1WCM G;  1QNU A;  1C0A A;  2RDJ A;  2B63 G;  5L37 A;  4C3I B;  4AQY Q;  4OWW B;  2PMZ A;  1HH2 P;  5E4X A;  1Y1V A;  3T5L A;  1HZB A;  4DL5 A;  1SE8 A;  2PMZ E;  2JA6 A;  3S9W A;  1DCZ A;  3R5F A;  3GID A;  4DV2 Q;  4LF9 Q;  4UPA A;  1G51 A;  1YHB A;  3F8T A;  1R9T A;  1RD9 D;  2MHV A;  2UUA H;  3DWP A;  1ZQ7 A;  4F4Z A;  5C4X G;  2BDO A;  4M1U B;  4F50 A;  2GLT A;  1A62 A;  4DR7 H;  4ME6 A;  3ULL A;  5I9O A;  4EG0 A;  2UXB H;  1BBW A;  1HZ9 A;  3HKZ B;  1EIH A;  3H3V C;  4MV9 A;  2EYM A;  2JXM B;  3ONA B;  3T1H Q;  1A3U A;  2TMP A;  1JDB B;  1MZB A;  1BGW A;  4MTE A;  1PH3 A;  2E2J B;  3K3P A;  4UCS A;  3BAB A;  4HAE A;  1JJ2 A;  2AMC B;  1S40 A;  2YRW A;  1KNE A;  3H0G H;  4JC0 A;  1GYF A;  2NVQ B;  3PR4 A;  3VYT A;  3DM3 A;  1SE3 A;  1FYC A;  1GLV A;  2C5C A;  2QCP X;  5GRO A;  4BBS B;  3BA8 A;  2GA4 B;  3HGB A;  4LF5 H;  3TP6 A;  2JA7 B;  3MWM A;  3ETH A;  2F1M A;  4RU9 A;  2BQR A;  1LO5 D;  1AN8 A;  3KBG A;  2VA2 A;  4ULL A;  3S2D H;  2R7D A;  1AN7 A;  4BBS H;  2R93 B;  1I4H A;  4ME5 A;  1N36 L;  2FK2 A;  5LA6 F;  1TWC B;  1Y1W B;  3J80 E;  2L9H A;  1X9N A;  2Z6B A;  2F4V L;  2G9D A;  4PMW A;  1TS3 A;  4MTD A;  2R8K A;  3MC0 B;  4H13 C;  5C44 H;  1EYA A;  1BXR A;  4ME3 A;  4DXF A;  3KF8 B;  1I4R A;  1Q8K A;  2YTV A;  3IRB A;  2PW5 A;  4C3H B;  2W57 A;  3N43 B;  4A3J B;  4H02 A;  4DV4 L;  3T51 B;  4QWB A;  2K03 A;  3PIO 3;  5KT6 A;  3WDN A;  3RGZ A;  1IKL A;  1PMR A;  4JVZ A;  1OWT A;  4DV1 Q;  4ZLT F;  5JVD F;  4J9N A;  2EYJ A;  1BVS A;  4PMB A;  2R92 H;  3KHL A;  1XPO A;  2XRQ D;  3SVM A;  4B3T H;  2R92 G;  2XWB B;  3CD6 A;  2E2I B;  2CCZ A;  4A76 A;  4RAY A;  5EKL A;  2XC9 A;  4LFA L;  3GIJ A;  1Q82 C;  1WVL A;  4HR7 B;  4CGY B;  2VS1 A;  1PZI D;  3CQZ A;  1F2L A;  5M9O A;  1Y1W A;  2LSS A;  3HFZ B;  3M4O B;  5L9X A;  4LFA Q;  4IFD J;  4KY6 A;  1SCU B;  3HOU B;  1HJP A;  1I5F A;  1W3S A;  3HOX H;  1UE7 A;  2HCI A;  1LV9 A;  3MXP A;  1I94 H;  3IFT A;  4O3P A;  2N8N A;  4A3G B;  1GUW A;  3HOX B;  4DV4 Q;  4LFB H;  2RCF A;  4LF4 L;  1XNR L;  1HCZ A;  2A74 C;  2WP8 J;  2YYZ A;  4UP7 A;  2JEB I;  2AWN A;  4OXP A;  1HR0 H;  3S15 B;  5JEA H;  4RNO A;  2EYO A;  4YWK A;  4YR2 A;  2KOL A;  3N6R A;  4H7B A;  1KXL A;  2O03 A;  1I6V C;  2IX3 A;  1EQQ A;  1WSC A;  5C0X J;  3NEN A;  2QDL A;  1BDO A;  2E76 C;  1V1O A;  5BN5 A;  4NXN Q;  2IBK A;  2OEO A;  4R4I A;  4C1N I;  4BWS C;  4DR5 L;  1N34 H;  3RZD B;  2NVT H;  4DV3 Q;  2EJG C;  3A5Z B;  1B9N A;  5M5W H;  2XGT A;  1W6J A;  2EQS A;  5EOY A;  2F3I A;  1A9X A;  3PR5 B;  2W9C A;  4K6L A;  1SE2 A;  2OXP A;  1W93 A;  1YEZ A;  2YV5 A;  4ED6 A;  5M5W B;  1WTW A;  2KHJ A;  3E9H A;  5COR A;  2VR1 A;  3LP8 A;  1U4P A;  1MSG A;  1BXT A;  1L1O B;  4IJL A;  1XMQ H;  5BN3 A;  4LJZ C;  4JI7 Q;  2UUC L;  1CQF A;  2O4X A;  4LF8 H;  1O7Y A;  3E9I A;  3HS0 C;  3OYY A;  2MPM A;  3HBL A;  2M9V A;  1XMO Q;  3OSP A;  4YWM A;  4R4O A;  1ESF A;  3D6W A;  1WR2 A;  1Q46 A;  1PH5 A;  3P20 A;  1L1O A;  3I4M H;  4NXM L;  3R2T A;  2PMZ B;  2B63 B;  2JA7 G;  3BQ1 A;  4RWS C;  4B3R H;  4DV2 L;  2OTJ A;  5D65 A;  3DM1 A;  1WI5 A;  4PZ7 A;  4UDU C;  3Q23 A;  2ZM6 H;  5LP6 F;  2AQ1 B;  4AYB B;  3T5J A;  3QWN A;  4R4C A;  4BS9 A;  4GNX B;  1STY A;  3L0O A;  4IUT A;  2UU9 H;  3MFG A;  4MV3 A;  2YYA A;  4I65 A;  4LF8 Q;  5LL6 S;  4DV5 H;  5I2Y A;  1YNN C;  4JI7 H;  4GKK L;  3N6X A;  5DLG A;  4DUY Q;  5IYC H;  4Q43 A;  3RZO H;  4JI2 L;  3JRW A;  3K5H A;  2YCH A;  4GKJ H;  3EVQ A;  3RNU A;  5LOV F;  2JA5 B;  1TA8 A;  1W2B A;  1UC9 A;  2E5L H;  4GLV B;  2V4Q A;  4DR3 L;  1Q86 C;  2C22 A;  3MJF A;  1CA6 A;  4XDX A;  1KDA A;  3I56 A;  4ZOL F;  1A8V A;  1F77 A;  4TQR A;  4IQZ A;  1QNK A;  4LH7 A;  2KSW A;  3IG0 A;  3GTM B;  1ROD A;  2BDN A;  1VBG A;  1BO0 A;  1Q3L A;  3AYH B;  3A8J E;  3NQI A;  3QO2 A;  1VCI A;  1E3P A;  2OQK A;  1EU4 A;  1S5C D;  2RKS A;  1SMY D;  3EIV A;  2NN6 H;  1TWA H;  2JQO A;  2ASJ A;  5KEE A;  4UP9 A;  1I6U A;  2NTT A;  4JI0 Q;  3S16 B;  4WJ4 A;  1CSP A;  5KFP A;  4YCV A;  1J5E L;  1FD7 D;  2JA6 B;  3TIG A;  3BVG A;  4KV6 A;  4YHH L;  2NVX H;  1E4G T;  3R5X A;  4BY7 G;  4FU0 A;  4A3J G;  4ABN A;  1HUM A;  4X66 L;  2KEN A;  3GTG A;  3HG9 A;  1IBL H;  3URY A;  2FMA A;  2L15 A;  1VQA A;  5BR8 H;  2KVM A;  5DNF A;  2FMM A;  3DXJ C;  1YJW A;  5IWA H;  3VYR A;  3RV4 A;  2EDG A;  4EQP A;  2BH8 A;  5KFS A;  1MI2 A;  2CW7 A;  1SNM A;  1TS2 A;  3CAM A;  5IYD H;  2CQY A;  2LS0 1;  2AQ4 A;  5IGC A;  5I6Y A;  4OIJ A;  2WAC A;  3GTQ H;  5D1O B;  5C5M A;  3HOW H;  1OTC A;  1Z47 A;  3K5O A;  1RCV D;  1Y1V H;  2A19 A;  1PH9 A;  2F0I A;  5KFR A;  2RHS B;  1P8L A;  3QOL A;  1KAW A;  2L0C A;  4LF6 L;  3Q8D A;  5C4J B;  4H44 C;  4HJ5 A;  4K5X A;  2JE6 I;  3GIQ A;  3TIN A;  3CF5 A;  3GTK B;  4QUF A;  4JV1 A;  2B2Y C;  3UDX A;  5FPO A;  4DR2 L;  2IHE A;  1JT8 A;  1PFN A;  1XX8 A;  5K36 H;  2Q2I A;  1PH4 A;  4GKK H;  3S14 H;  1GD7 A;  3T5K A;  1VQC A;  3T16 A;  5KRU A;  1JKJ B;  1HNW H;  3HOW G;  3ERS X;  4ECY A;  1WTQ A;  3J80 c;  2HIX A;  2MFI A;  1X65 A;  1Z6H A;  5KFO A;  5JAV A;  3T13 A;  2CH4 W;  3S17 B;  1CKM A;  1CZG A;  1GOZ A;  2B29 A;  2A73 B;  1M90 C;  2CFM A;  1MKH A;  3JRX A;  5KFM A;  4MN3 A;  4HYK A;  4DV0 Q;  1EYD A;  4K6D A;  1LTS D;  2SNS A;  3TP5 A;  3S2H B;  1I6H B;  1JX4 A;  5A2Q W;  2VQF Q;  3W2D A;  3G6J B;  2CW0 D;  5JVG 3;  4UHV A;  2XGP A;  1YNJ C;  3T56 B;  1N32 H;  1EWH A;  1SMX A;  5DLQ E;  4HED A;  3R2I A;  2YRX A;  3SK6 A;  3PUZ A;  2L55 A;  3EQL C;  5KFW A;  3H3V H;  4P72 A;  4BBS G;  1XPU A;  2MO0 A;  1LTT D;  2L11 A;  1AZQ A;  1VS0 A;  4C3J H;  3BG5 A;  3H94 A;  1VAJ A;  2UUA Q;  4A2A A;  4JI3 H;  2A68 D;  1XDN A;  5K5P A;  2V9W A;  4X3U A;  3KXY T;  4YAJ B;  1PRT B;  4GOP B;  5IIF A;  2KQ3 A;  5EKK A;  2JK8 A;  4K8I A;  4C2M H;  4AQY H;  3H09 A;  1G91 A;  5JJK A;  4YJ3 F;  4A3I G;  4O3N A;  1PDQ A;  3VA5 A;  1BR9 A;  2PCF B;  4JUZ A;  4MHE A;  5KNC A;  1HA6 A;  3M9M B;  3GDE A;  4DAM A;  3KF6 B;  3HOY B;  4X62 L;  2EXZ A;  4A93 G;  4MIU A;  3QR8 A;  5DAU A;  1HNZ H;  5KT2 A;  3MFY A;  1AUX A;  4L1K A;  2WTF A;  1QWY A;  4A3E H;  3HOY H;  2F0F A;  1WYD A;  4RKL A;  1EOT A;  3Q2O A;  4NKL A;  4DR6 Q;  3I4N B;  1TY2 A;  4F88 A;  1WD0 A;  2QW7 A;  4BXX G;  1DOM A;  3BDC A;  4X3T A;  4QIW B;  2W8K A;  1JXL A;  3SE0 A;  3H0G G;  2R85 A;  4H0L C;  3HOU G;  4IR1 A;  1V1P A;  3JAM E;  3QB3 A;  2Y0S E;  3GTO H;  3MWE A;  2ZXO A;  4R9W A;  3WWV A;  3M9N B;  4APV A;  1S0O A;  1K0S A;  2F0K A;  2K6A A;  1STN A;  4JOI C;  1TWF B;  1QUQ B;  4OHJ A;  4RGN A;  5CV7 A;  1E24 A;  3ETJ A;  1S03 G;  2W6O A;  3OUZ A;  3F2B A;  2ZJT A;  1LT5 D;  1H9S B;  4YY3 H;  5I2X A;  5L1K A;  4ED2 A;  4LF4 H;  1ENF A;  1GGO A;  2DPJ A;  4V19 0;  5K36 G;  3G8C A;  3KLS X;  1QVC A;  5LL6 X;  1KC7 A;  2DY7 A;  2WB1 A;  2W9A A;  2VL6 A;  1RHP A;  2K32 A;  5JEA J;  2UXC Q;  1XNQ Q;  4UP8 A;  1WTP A;  4JI4 Q;  5KFC A;  4F4X A;  5CAE B;  1JE4 A;  2P0A A;  1UE6 A;  3RAX A;  3ORQ A;  1WTV A;  1TWG A;  3V4Z A;  1RKN A;  4XYQ A;  3KLR A;  4X64 H;  3VR6 A;  2RSN A;  4PNY A;  5IGG A;  3Q6S A;  1VQB A;  3OW7 A;  3K7U C;  3DUZ A;  5DQH A;  3A54 A;  1CFM A;  1EQT A;  4LSA A;  5DGB A;  4DV7 L;  4B9W A;  3KJP A;  1YJN A;  4GNX A;  2ZDG A;  2F0S A;  2EYL A;  4EGV A;  4BY1 H;  3GTL A;  3VR2 A;  5IP7 G;  2AGP A;  4HSV A;  4DGZ A;  5DQI A;  3PZP A;  4LF8 L;  1JWM D;  4A3F B;  2VW9 A;  2DJF C;  4C2M B;  2AQ2 B;  4A3D B;  5BN4 A;  4IFD I;  1A6X A;  2HIV A;  1M6V A;  1B2T A;  2Q8R E;  4MTN A;  4GZY C;  4QWC A;  2A6E D;  4DXG A;  3MFI A;  5DGA A;  2E5L Q;  2HCC A;  4MZ9 A;  2J7Z A;  2B63 A;  2N88 A;  2DNC A;  2VQE L;  5C5J A;  1LLR D;  4DUY H;  1RL2 A;  3KAJ A;  1VMC A;  4KHP Q;  1PTO H;  1A2T A;  2AUK A;  3NUC A;  2FP4 B;  4F7X A;  3HZX A;  3ULP A;  2LFN A;  1R9T H;  2KCM A;  1DD2 A;  4MV6 A;  4ECV A;  1K1S A;  2KUM A;  2UU9 Q;  1HTP A;  4I7Z C;  5HY6 A;  1C7Y A;  3BQ2 A;  1H9K A;  1K73 C;  1EY9 A;  3J7A V;  2R8G A;  2NBF A;  4PQX A;  1K8G A;  1PYW D;  1Y8N B;  1WCM A;  3KHH A;  3TZU A;  2SEB D;  5KX5 F;  3PV0 A;  2I0Q A;  1OXS C;  2ID0 A;  4A3C G;  2NU9 B;  3K3V A;  3CCV A;  1JIC A;  2V4D A;  3QZ8 A;  4DR1 Q;  3FEW X;  2NYZ D;  2ZM6 L;  5GQO A;  1LTI D;  2K7V A;  4B3M Q;  1TII D;  3KAK A;  5AFW A;  3FVQ A;  2CW8 A;  3A55 A;  1HTL D;  2VB3 X;  1WTO A;  3S17 H;  3FPP A;  2PYK A;  4GN3 B;  5CV5 A;  3VR5 A;  1CKN A;  2KA7 A;  1DOK A;  1M0W A;  1YZ6 A;  4A3I B;  5FD5 A;  4I55 F;  5C1O A;  4ZCK A;  4ECQ A;  2QF7 A;  3R93 A;  1XNR Q;  1SXT A;  2R82 A;  2F0G A;  2HD3 A;  3CQZ B;  4RB2 C;  5FO8 B;  1O75 A;  4UAI A;  5IOC A;  1Z7T A;  3NWT A;  4X66 H;  3GTO A;  1CQV A;  3FDT A;  1HNZ Q;  5IP9 H;  1OXV A;  1N34 Q;  2JA6 H;  4RGO S;  4IN3 A;  3TRE A;  2F0N A;  2LMC B;  3G7L A;  2R7L A;  2M05 A;  5HGT A;  4N8X 1;  4Y7N B;  2RGR A;  4BWG B;  3J7A F;  3MAQ A;  1AUV A;  2D0O A;  5FO9 B;  5CC4 A;  5KT5 A;  4K5V A;  1I3Q B;  1ML0 D;  1PYS B;  1B3Q A;  2WAQ A;  5EBC A;  5KNB A;  2E2J H;  3BAA A;  1X3E A;  4O2A F;  2O5I C;  4B3S L;  4GLX A;  5KG5 A;  3KOJ A;  4TRD A;  4IUR A;  2R7Z H;  5J2T F;  2BR0 A;  1RYR A;  1E22 A;  5LHY 1;  4ZRZ A;  2Z4H A;  4KN7 C;  2W8L A;  4JYA L;  1CUK A;  1E2W A;  1VQP A;  1VQ8 A;  1CQI B;  3MXN B;  4YHH H;  4ED1 A;  1WJJ A;  5KG2 A;  2VQE H;  3GTP B;  3CC2 A;  2XIW A;  3FKI G;  4CJ2 C;  1CKO A;  1EQV A;  4MV4 A;  1RDP D;  2RDH A;  3RF2 A;  3I70 A;  2OWO A;  2VQF H;  1FGU A;  2R93 H;  4EGQ A;  1TY0 A;  4J6H A;  1CK1 A;  3PO2 B;  2PW7 A;  4DUZ L;  4DV0 H;  1ILQ A;  4CC6 A;  2MJ8 A;  5GAG C;  3RN5 A;  1N56 A;  4A93 H;  4CKC A;  1GVP A;  1DM0 B;  1R4P B;  1AW7 A;  2J4X A;  4IRK A;  3V4S A;  2AKW B;  2K5Q A;  3V96 A;  5AJ3 Q;  3HOZ G;  3C3L A;  4OX9 H;  4ALP A;  2ZDQ A;  4ED7 A;  4R4Q A;  1G2T A;  1VQ4 A;  4OL7 A;  2DGY A;  2UXD L;  4QF4 A;  4RNN A;  1XWE A;  4UCT A;  5FJ8 H;  5JPM C;  3V6J A;  5F2D A;  3WOF A;  3RZD H;  2NVT B;  2R7M A;  4K0K Q;  4JI8 L;  2FK1 A;  5L1J A;  3LX0 A;  4TQU S;  4DR4 L;  1A2U A;  4RB3 C;  2R7N A;  4PDB A;  4UCO A;  4B3M H;  2FK3 A;  3NSW A;  3MA2 B;  3C1E A;  4KKT A;  1GSA A;  4JI5 Q;  1AE3 A;  1TWA A;  3DEO A;  1B44 D;  2K04 A;  1L0W A;  3WNZ A;  4M8A A;  2VQD A;  1TWC H;  1N48 A;  4Q44 A;  1PYB A;  3Q8P B;  1VQE A;  4OEL B;  5ELN A;  3CPW A;  4X65 Q;  4KHZ A;  3GV6 A;  4ECX A;  4LMQ D;  3KLS A;  4JBW A;  5J1Z A;  1KDC A;  4AQY L;  3BJY A;  3M3Y H;  5K2M A;  2DPI A;  1S68 A;  3CXC A;  2EPB A;  1S5F D;  2B3G A;  4C3H H;  3L2P A;  2Y0S B;  1S72 A;  1EZ1 A;  5LMU Q;  2XTI A;  1ASZ A;  2R8I A;  2PNH A;  4DKA C;  5J3B A;  2RDI A;  4L5R C;  1TS4 A;  4KHP H;  3Q22 A;  2UXB Q;  3JAM W;  4KI0 A;  5LMN W;  1PH7 A;  4CHT B;  5DLF A;  4CKE A;  3HOV H;  1VQG A;  1IOW A;  4KJN A;  4DV6 Q;  2KEC A;  1T9H A;  3GTL B;  2D62 A;  1PHJ A;  1WOC A;  4E6I A;  3DLL A;  4A4I A;  5KFG A;  4DK0 A;  4ED3 A;  3S1N H;  3I55 A;  2DUD A;  3KJO A;  4K5W A;  3WOE A;  1CSQ A;  4IAL A;  4NPS A;  5GAE C;  2EY1 A;  2R7Z G;  5EDW A;  3KK7 A;  2NVX A;  1H9S A;  4LFC L;  2F52 A;  2R8H A;  1ZHQ A;  4XX0 B;  4XYO A;  5I47 A;  4A3B H;  4Q8F A;  3OIP A;  4QB4 A;  2N78 A;  1GHK A;  2A1A A;  5KFX A;  2NU8 B;  1AZP A;  3OWF A;  1I4P A;  2WB1 B;  2HHH L;  4UCV A;  1IZ6 A;  3L3O C;  1MHW C;  1U0L A;  2JEF A;  1T36 A;  5F9N A;  3BS1 A;  3GTM H;  5DM6 3;  1C8C A;  3OHA A;  1FR3 A;  5IP9 G;  2R6F A;  2B63 H;  4C1N K;  3RB6 A;  5ELB A;  3V05 A;  4Y8V B;  2I5L X;  4XXE A;  4O2D A;  1BNC A;  1F2Y A;  1VQ6 A;  1YNJ D;  1NJI C;  2MCT A;  2ATL A;  3JSN A;  3PW0 A;  4IZ8 A;  4A3E G;  3OIQ A;  4DL2 A;  1EOV A;  1FJG H;  5KFL A;  2IW3 A;  4JI4 H;  1KAB A;  4DR4 H;  1MBY A;  3OW2 A;  3M9O B;  2NVX B;  3HOZ B;  3BU2 A;  3GV8 B;  2QDB A;  1I50 H;  2KHI A;  3CCS A;  2PI2 E;  4O4L F;  1JJC B;  1VQM A;  1GUS A;  1PRT F;  1RYS A;  3NBI A;  4CC5 A;  1S3O A;  4LH6 A;  3W5O A;  3DWQ A;  2HVS A;  3KDF A;  5T1I A;  2XCL A;  1CI3 M;  3PF4 A;  1BJT A;  2E2H H;  4EEQ A;  5BR8 L;  3J80 i;  2RCN A;  4JV5 Q;  4YR0 A;  4MV1 A;  3RUZ A;  2J6S A;  4J9Q A;  4AYB A;  4JI6 L;  5DG8 A;  1UUP A;  4X64 L;  4RNM A;  1NSN S;  3RAQ A;  4A3D H;  2OLS A;  1GM5 A;  1EUC B;  4NW2 A;  3E0J A;  2E75 C;  4JI1 L;  2ICI A;  2K01 A;  2F0Q A;  2JEI A;  3KHR A;  1MJE A;  2DY8 A;  4LMY A;  3RJ0 A;  4JI5 L;  3TS0 A;  4O3R A;  1KC8 C;  1SYD A;  2NUA B;  2FKL A;  4GS3 A;  1KQS A;  5EWG A;  4UY8 C;  4WRD A;  2HVQ A;  5KFV A;  1G6Z A;  5T14 A;  1EY8 A;  1KL9 A;  4APM A;  1HZC A;  2Z6K C;  1HNX Q;  2CW0 C;  4YQW A;  4AH6 A;  1IBK Q;  1IYU A;  2FLN A;  3CCL A;  2Z6K A;  4BA1 I;  1D6E C;  5JJL A;  1JQY D;  1HR0 Q;  1L0Y B;  3U58 A;  1EUD B;  3T5H A;  1ILP A;  2H5X A;  3G6V A;  2W7P A;  4MA5 A;  3RB0 A;  1PVO A;  1N33 H;  1HR0 L;  1STH A;  1LTB D;  1SFO H;  2A68 C;  1SNO A;  3GV3 A;  1Y8P B;  1PH1 A;  3DHQ A;  3CU7 A;  2F0U A;  2JJQ A;  3GP7 A;  4A3B G;  4ECR A;  1BCP D;  2I5M X;  3R8B A;  2FB9 A;  2I5H A;  4EBE A;  4HJ8 A;  1JCK B;  1PV4 A;  2J9G A;  4YR3 A;  3EBE A;  3KFU A;  4F4Y A;  1ZYR C;  2CQA A;  1PFM A;  1GUO A;  2DZD A;  1M7J A;  1PTO D;  3N44 B;  1UE1 A;  2F3V A;  5IGE A;  3CW2 C;  4IOA A;  3Q24 A;  3UFX B;  5M5X H;  1XJV A;  4YIJ A;  4XQN A;  3SHL A;  1WTX A;  1HNW Q;  2E8G A;  2YS6 A;  3AFQ A;  3I2Z A;  3RD4 A;  1SNC A;  4BY1 G;  1JJG A;  3MR3 A;  4IUN A;  3J81 i;  1XNR H;  4JI6 Q;  1SAP A;  1QZH A;  1XMQ L;  3GV5 B;  3CQZ H;  3OTO Q;  1I3Q A;  2ZTE A;  4IJH A;  2Q8T A;  2JA8 G;  5KFU A;  2VUM A;  1I4X A;  4HN7 A;  4JV5 L;  1JOO A;  3S2D B;  5KGU A;  2NVQ H;  2J0T D;  2W6N A;  3RMH A;  4C3H G;  1NTG A;  4CJ0 B;  2I46 A;  3FKI A;  4O2B F;  1NR4 A;  1GO3 E;  1LTR D;  3TP7 A;  1GSH A;  1EYG A;  3OTO H;  3NBH A;  1TS5 A;  2XNA C;  4GN4 B;  3ND9 A;  4A3G G;  4ZKC B;  1UC8 A;  3EYY A;  1N34 L;  3M4Y A;  5EQ0 A;  4JI3 L;  2PZT A;  4V0B A;  2X69 A;  2V58 A;  1SJH D;  3K5I A;  1UAP A;  2I8C A;  5IE8 A;  1Y1W H;  5KFI A;  4FNF A;  1HFN A;  1SSO A;  3GTO B;  2RGV A;  5FPR A;  1CKN B;  3UI2 A;  3PQI A;  2E2I A;  1M1K C;  1EIF A;  3FPU B;  2W70 A;  3NWS A;  3L9A X;  1RK5 A;  1QG7 A;  2NB0 A;  1TWH H;  3K81 C;  3J7A K;  2XVS A;  3T1H H;  3V6K A;  2R7F A;  1VQ5 A;  1IBM Q;  1IBL Q;  2UUB Q;  2JA7 A;  3GIL A;  2HVR A;  4KLK A;  1TWH B;  4JG2 A;  4ZHQ F;  2J6T A;  1RTO A;  4J9L A;  2Z0S A;  4JK1 C;  3OUU A;  3H4B A;  5FD6 A;  4OX9 L;  4FDB A;  3SGI A;  4B3R L;  1YIT A;  3MR6 A;  4DV2 H;  4LF9 H;  4EX5 A;  3J7Y W;  3F8N A;  1LTG D;  4IFD H;  2UXD H;  2UVR A;  1JDE A;  2JA5 A;  1YHA A;  1EYC A;  1IKM A;  2IX0 A;  1F2Z A;  4RUA A;  1O78 A;  1SLJ A;  4PZ8 A;  3GLK A;  5ELO A;  1FGB D;  2A8V A;  1I50 A;  1K3R A;  1DJR D;  1VQ9 A;  2NZH A;  4I7H A;  2NVY B;  2QEJ C;  5KFD A;  4DUZ H;  2RHQ B;  2NUC A;  1GXD C;  4EQ5 A;  2PQA B;  2KBN A;  1DV1 A;  4ED0 A;  3STB C;  5E3F A;  1U5K A;  4QIW E;  4FF2 A;  2WV6 D;  3VPD A;  1D7Q A;  5KG3 A;  4DR7 L;  1D5X C;  5GON F;  1SR3 A;  5KYI A;  3HP3 A;  2DNE A;  2XN9 C;  2CHB D;  3O13 A;  5LYJ F;  2A6E C;  2F0D A;  1U4M A;  3R23 A;  1DGS A;  5KT3 A;  2K33 A;  5CV9 A;  5IWA L;  3A7L A;  5IGB A;  2XWJ B;  1NR2 A;  1YIJ A;  3C1F A;  1E4F T;  4RKB A;  3TP8 A;  1C30 A;  1D2B A;  2GVA A;  1QJO A;  3S16 H;  3M3Y B;  5IYC G;  2PNR C;  5HV6 A;  3J80 L;  4O4I F;  2ENB A;  2LXK A;  3GTJ B;  4DL7 A;  1XNQ H;  4IZO A;  4LF7 Q;  2A69 C;  3RLN A;  1RJP A;  3RIZ A;  5ISR A;  5CGK A;  4X6A H;  4J9O A;  4B3R Q;  4NB3 A;  1J8I A;  4O3Q A;  5IYB G;  1IL8 A;  4G7Z C;  1VF5 C;  2EIF A;  5EPK A;  2B2V C;  2SNM A;  3M7G A;  2NZO A;  2F03 A;  1FNU A;  3S1N B;  1IBM L;  4P74 A;  2V1C C;  2UUB L;  3E6Z X;  1XMO H;  1DIK A;  4XT3 B;  5C3E B;  1FJG Q;  3BQ0 A;  3C46 A;  1SND A;  3A8I E;  1P16 A;  2HT1 A;  2OT2 A;  1ET6 A;  4WFN 3;  3CCR A;  4G7H C;  1WFQ A;  4LAA A;  5JJZ A;  3R5H A;  1HRJ A;  3D6C A;  4DK6 C;  5D1P A;  4ZQ3 A;  1TU2 B;  2RA4 A;  5CYU A;  3TS2 A;  1K3B C;  1KRS A;  3JAM c;  3MXG A;  4YCU A;  2MP1 A;  2PI2 A;  1EUJ A;  3M85 A;  2AHO B;  3PO3 B;  5CB4 F;  4RUC A;  1TWF A;  2IL8 A;  1CA5 A;  3KBX A;  3B6Y A;  2IT1 A;  1JR0 D;  2D5D A;  1KJI A;  3H40 A;  4XZ3 B;  2R6G A;  3QG1 A;  4CKB A;  2AU0 A;  2Z1C A;  2ZTD A;  2YTY A;  3U9S A;  4O4H F;  1PH6 A;  3ZYY X;  4GLA C;  1B9M A;  2WYO A;  2B2U C;  3E5N A;  5CA1 F;  1SYF A;  2NN6 G;  2W6P A;  4QIW A;  5KFJ A;  3BDO A;  1VDZ A;  1B04 A;  1K28 A;  4JYA Q;  1ZET A;  1QZG A;  4EFB A;  2E2H A;  4TSS A;  4IWY A;  5IY0 A;  1SNP A;  1X32 A;  1KEE A;  3E3X A;  3N52 A;  3CKI B;  1K83 H;  1D5M C;  3J81 W;  2HHH H;  4LFB Q;  2JA9 A;  3I8Z A;  5L1L A;  5KIX A;  2L5T A;  4Q0Y A;  4C5C A;  4ED8 A;  5FLX c;  1EU3 A;  4BY7 H;  1Z2P X;  4WJW A;  5G3L D;  5DEH A;  1JIH A;  2I87 A;  2JA8 H;  3GD7 A;  3BJU A;  3QJY A;  2VPQ A;  1O7Z A;  2M00 A;  2EOT A;  2LY7 A;  4BY7 B;  2F0W A;  2HQE A;  5EGT A;  1PA6 A;  2KCT A;  3ITP A;  3K58 A;  4R8U A;  1G2S A;  4M7E A;  1FJG L;  1LTL A;  4PMC A;  2R61 A;  1FL0 A;  4O3S A;  1YNN D;  5M3M B;  2A5H A;  2PPB C;  1C3O A;  4DL4 A;  4B3T Q;  1N32 Q;  2R93 A;  3OHB A;  4JPB W;  4OIK A;  1KIX A;  1S97 A;  4F8M A;  3Q0A A;  2EXD A;  3KF6 A;  1M0T A;  4IHJ F;  1HHV A;  1YVC A;  2OCE A;  4JI5 H;  3Q8S B;  1ENC A;  2YZG A;  5CR3 A;  4DF7 A;  4J9K A;  5KG0 A;  2A69 D;  5HUR A;  1SYX B;  1QVG A;  2KJX A;  1IW7 D;  3GII A;  3G71 A;  1BNZ A;  5JOB A;  3MFH A;  1MGS A;  2C28 A;  1TAE A;  2NWG A;  4IPD A;  2K05 A;  2QK4 A;  4K0K H;  3C0F B;  4RZR A;  3T1Y H;  3CRL C;  2UVU A;  2QEX A;  2X6G A;  5G3L F;  1DXM A;  3HOW B;  1NMF A;  1HNX L;  1Y1V B;  4IR9 A;  2BCO A;  4DV0 L;  1Y69 U;  1EYZ A;  2F4I A;  2WB1 E;  5BMV F;  5IT9 L;  2E74 C;  4OO1 I;  2DJG C;  4RCN A;  4FYD A;  2ALY B;  5LL6 b;  4LF7 L;  1S5E D;  1EEI D;  2BOS A;  4WOR A;  4EVO A;  3VA7 A;  3GTL H;  1Z2O X;  3I4M G;  4HIO A;  1BF4 A;  3SEB A;  2AGO A;  3GIM A;  4P73 A;  4KK7 A;  4TKO B;  3K6O A;  5IWA Q;  1KJ8 A;  1A63 A;  4POG A;  5BR8 Q;  2VPS A;  5CA0 F;  4RGM A;  3KYH C;  1GJX A;  3VPB A;  2KHS A;  2WE6 A;  2B2W A;  4DR7 Q;  3TZD A;  5IGD A;  5D3I B;  1AP0 A;  1RJT A;  2F0O A;  3KAL A;  3STB D;  1SBB B;  3SDZ A;  4POF A;  4DLK A;  1YBY A;  3W1B A;  2FLL A;  4KKS A;  2C35 B;  3OHX C;  3GTK A;  3I73 A;  4MV8 A;  1IBK H;  4A3M B;  3PVX A;  4A2B A;  1MJC A;  2ES2 A;  3WO1 A;  2ASB A;  3OSN A;  4NP5 A;  2K5H A;  1NY4 A;  1X54 A;  3MXN A;  5C0X I;  4YBZ B;  5D1O A;  5C3E G;  2VUG A;  1B1Z A;  2KED A;  3LWU A;  2FPI B;  2MUY A;  1JWS D;  1C4Q A;  4X66 Q;  5EPL A;  3GTP H;  2FE3 A;  3PIO A;  3I4L A;  1XYI A;  3HOY G;  5C4H A;  3MR2 A;  5A35 A;  4DV7 H;  2WAQ B;  1SYE A;  1XTC D;  3JZI A;  2K75 A;  3D0F A;  3SR1 A;  2IMW P;  5FLX L;  3I4N H;  4JV2 A;  4HCE A;  2JN4 A;  1E7Z A;  1Z2N X;  2RDG A;  3PO3 G;  1YNX A;  3QIA A;  5DG9 A;  1N36 H;  2LXJ A;  3R3O A;  4JV5 H;  3GTM A;  4L5S A;  1WTR A;  4LFC Q;  2QGQ A;  3H0G B;  4ZYS A;  4GNX C;  1B6S A;  1X3P A;  4J8Q A;  5T1G A;  4ZQI A;  1F9P A;  1LT4 D;  1OXT A;  3BZD B;  5TSS A;  1V51 A;  3OTO L;  1II3 A;  1HA5 A;  5H80 A;  4FF4 A;  3NXW A;  1A0I A;  2VUM G;  2B2U A;  4A3K G;  1LM0 A;  4RH6 A;  4DV6 L;  1AFP A;  4LF7 H;  2YTX A;  4BA2 I;  1KLG D;  2YU9 B;  4PG3 A;  3IAY A;  4JCV E;  4X3S A;  3CCE A;  2F3W A;  5KFK A;  2A6H D;  4FBU A;  1I7N A;  4LFC H;  3PCO B;  4EGJ A;  2IA6 A;  3NE5 B;  1X3G A;  2YW2 A;  5KG7 A;  2FMC A;  3S1R H;  3K5N A;  4S3S A;  1WH2 A;  2JSO A;  1XMQ Q;  5LMN H;  2R87 A;  4OWX B;  1ICW A;  3SK4 A;  2D0P A;  3U9O A;  5KFH A;  4FO2 A;  2PBZ A;  5GAD C;  4E4T A;  4QWA A;  3ICE A;  3AQQ A;  3M9B A;  4FXK C;  1I94 L;  3PUY A;  4IPG A;  1UEA B;  1DV2 A;  2E2I H;  4ECU A;  2EY6 A;  3FMC A;  5KT4 A;  1C48 A;  2B2T A;  3QOJ A;  4NXM Q;  4NMZ A;  3E5S A;  1R4Q B;  3RV3 A;  2W9B B;  4DV3 H;  3TRZ A;  3RBE A;  3DMU A;  4UCR A;  2ZXR A;  5C3W A;  4NXN H;  3TME A;  1S4Z A;  4FP5 D;  3HOU H;  3IL8 A;  1B6R A;  2IWH A;  5C5L A;  4L5T A;  3RB3 A;  4ETS A;  5ELD A;  1IOV A;  5C6A A;  2WAQ E;  3UE0 A;  3A56 A;  5KFQ A;  2HDM A;  2Q2H A;  3OOC A;  4RFB A;  2UXD Q;  4K14 A;  3CC4 A;  3MWD A;  1Y1V G;  4MAM A;  5JVL A;  3PW4 A;  1LT6 D;  1L2F A;  4QWE A;  1LAC A;  5D14 A;  1I94 Q;  2NZ1 D;  5C4X H;  3I7F A;  5A2Q E;  5L1I A;  3GTG H;  4ZK9 B;  3LGJ A;  4IO9 A;  3HRZ C;  4RA8 A;  3FMA A;  3I3C A;  4X64 Q;  5M5X B;  1LAB A;  2MQH A;  2B8G A;  5C4X B;  2W6Q A;  2K5N A;  3H15 A;  1PTO B;  3TBI B;  4EBD A;  3A7A B;  1U4R A;  1JWU D;  4ZUJ A;  4IWX A;  1JOR A;  3CVZ A;  3K5L A;  2Q2T A;  4JBM A;  1ZYR D;  3UE1 A;  4BXX H;  1S10 A;  4C3I G;  4RCO A;  1XXG A;  4AYB E;  1J9O A;  4JI1 Q;  4B3S H;  3TII A;  4KTA A;  1Q1E A;  2RSO A;  3BZK A;  1K1Q A;  2VZA A;  2GPW A;  2Z8L A;  4WBN F;  1I4G A;  1O80 A;  3VDY A;  2XCP A;  3G48 A;  1PTO C;  3HKZ E;  3S24 A;  3W1G A;  2QYZ A;  1B8A A;  2EYH A;  4A75 A;  4JI8 H;  4KKU A;  3ULJ A;  3MXU A;  4QW9 A;  4HCS A;  5E1F A;  3S1M B;  4ECW A;  2F0J A;  1OO9 B;  4LF6 Q;  3BYY B;  4C5A A;  1RIP A;  3CME A;  4N9T A;  1G6P A;  1LT3 D;  2WKC A;  1BUV T;  4G7O C;  3K8A A;  4KY5 A;  1EQR A;  1FVI A;  1TT2 A;  4P75 A;  2RDF A;  4OX9 Q;  2IJ0 A;  5CBE E;  4J1M A;  3NK9 A;  4DNI A;  1SE4 A;  3M4Q A;  4KJO A;  3GQB A;  2OTL A;  2R92 B;  1RK6 A;  3S14 B;  4YJ2 F;  5KND A;  2K52 A;  3J81 c;  2JA5 H;  1EZ8 A;  5EKI A;  3RR5 A;  4BBR G;  3S2H H;  1I6H H;  3KF8 A;  3MVV A;  2YU9 H;  1PTO F;  5EJW A;  1L2Z A;  4HJA A;  5I6W A;  2V59 A;  2TSS A;  4A3I H;  5CMD A;  3LWB A;  1AH9 A;  1TWC A;  4GOP C;  4B9X A;  1H9M A;  1C9O A;  1HXY D;  3RZO B;  1BCP F;  4QL5 A;  1B53 A;  4GC6 A;  2PQE A;  4JBK A;  1KTK A;  3VPC A;  3FRP B;  5IGF A;  1GKH A;  4MA0 A;  3IN5 A;  2XD4 A;  4YAK B;  4C3J G;  1VQF A;  3RLO A;  3UDF A;  2V5A A;  2HHH Q;  2VA3 A;  3FKI B;  3KUP A;  4JI0 L;  2VUM H;  3RN2 A;  1YI2 A;  1N8R C;  4XTC S;  3CC7 A;  1B50 A;  1A3T A;  3NEM A;  3OWE B;  4CDC C;  2VUM B;  1HFG A;  5FLX E;  5D8D A;  2ASL A;  4QY7 A;  1E1O A;  3PW2 A;  1QOH A;  5KFZ A;  1UEB A;  1QCB D;  4RZQ A;  5GAH C;  3U9T A;  5COY A;  4TV8 F;  1TR5 A;  2N49 A;  1EY5 A;  1NBW A;  2WII B;  3W3A A;  1S0N A;  4DK3 C;  3MR5 A;  4KHV A;  3T1H L;  4QJF A;  4KN4 C;  4O0A A;  4QUC A;  2ZXP A;  5FKA C;  4KHP L;  4RG1 A;  4DNT B;  2VOB A;  1E4E B;  2IX1 A;  1WTH A;  2B2W C;  4OEM B;  5C44 B;  1IYJ B;  2UVW A;  3RUP A;  4EFE A;  5FLX W;  2M2L A;  4TQS A;  4LF9 L;  4YB8 B;  3I4M B;  4GKK Q;  5DG7 A;  5M3F H;  1R9T B;  1E2V A;  3GO5 A;  3TDQ A;  2C2R A;  3HB9 A;  3DEP A;  4P2C B;  2PN1 A;  4LF6 H;  1X3Q A;  2NVY H;  1VQO A;  3GTQ A;  2RVL A;  4XQJ A;  1PH2 A;  4RGT A;  2IHF A;  3JAM L;  3BVM A;  2F4V H;  4L6T B;  3P1H A;  2R84 A;  4RAZ A;  3K0X A;  1SDF A;  4MV7 A;  2ZT9 C;  2WKD A;  4F87 A;  1H9J A;  1CM9 A;  4DR1 H;  3J80 W;  3F2U A;  5C1P A;  1YJ9 A;  1EIY B;  5JQW A;  4KD3 A;  4XYL B;  3J81 j;  2O5J C;  2F0T A;  4TVA B;  4R4T A;  3CMA A;  3EPG A;  3U50 C;  1PFS A;  4A3M G;  2CVR A;  3IKJ A;  1E0B A;  2I80 A;  1PK8 A;  5JJI A;  4M9U A;  2JEJ A;  1IBK L;  4B3T L;  2PQA A;  4IUU A;  4DR4 Q;  1N32 L;  2HJW A;  3UQ8 A;  5M3F G;  1HUN A;  4FXG C;  1EWI A;  2K14 A;  2Z9H A;  3PO3 H;  3JSL A;  4YWL A;  3NGD A;  1KJJ A;  3BZC A;  2EY5 A;  3DF7 A;  3V2T A;  5IT9 E;  4JI4 L;  1XNQ L;  3K0Y A;  2YZN A;  1TWG B;  4BBR B;  1VQH A;  3P75 A;  1LTA D;  4X3K A;  3U4V A;  3A5U A;  3PW5 A;  4IFD G;  2R7Z B;  3BDL A;  1OXX K;  2CH4 A;  5C3E H;  4U67 3;  3G4S A;  3N8D A;  4DUZ Q;  1XTD A;  2WIN B;  2Q8I B;  1BOS A;  3J81 E;  4IPC A;  5M5Y B;  5E7N A;  4ID6 A;  1I3Q H;  3MTS A;  4EBC A;  4QCL A;  2EVB A;  3GTG B;  2WB1 G;  5J22 A;  1QUQ A;  4FS2 A;  1Y8O B;  4LUO A;  2JA8 B;  2ICE C;  4L5Q A;  1DZ1 A;  3H20 A;  4C3J B;  3H0G A;  1V4Y A;  2W6M A;  1ZXT A;  4DR5 H;  2BE5 D;  4NLG A;  5KFT A;  3F2D A;  4DNR B;  3OMG A;  3CPF A;  1HNZ L;  3A8K E;  3NQT A;  1T5X D;  2XCA A;  4WD3 A;  2B2V A;  4DV6 H;  1STE A;  4ZKB B;  1G29 1;  5ELC A;  4GKJ Q;  3WO0 A;  1SMY C;  1ZEQ X;  1ULZ A;  1Q81 C;  4QWD A;  2CQO A;  3PUX A;  1IBM H;  2WAQ G;  2UUB H;  2QKI C;  4X62 Q;  4J9M A;  2W71 A;  3NBH B;  1G8Z D;  2GN5 A;  2SOB A;  2H4O A;  3T4A C;  5LMU H;  3BA9 A;  3KHG A;  4L63 B;  3D4R A;  3RTX A;  1SFO A;  4JI2 H;  1LUZ A;  1Y14 B;  3EA6 A;  2UXC H;  4IRD A;  1STB A;  4A3E B;  5FK9 C;  4DV1 L;  5KG1 A;  3I4O A;  4DL6 A;  1TXY A;  2FJZ A;  3F1Z A;  3U4Z A;  3PF5 A;  1KD1 C;  2ZDH A;  1N33 L;  2JA6 G;  1PX2 A;  3GTK H;  1BKB A;  1A3V A;  1SYC A;  2FHT A;  4DAY A;  5A2Q L;  2PVP A;  3GQC A;  1LYL A;  4LNQ A;  5EAY A;  3Q8Q B;  4ECT A;  2F4V Q;  4OO1 H;  1CHQ D;  2WDT A;  3QFF A;  1K0R A;  2ATW A;  1K83 A;  2R7Z A;  4FXD A;  3MEF A;  5FOB B;  4B3M L;  5HBR B;  3D4D A;  3GIK A;  3AMU A;  1T94 A;  5KFN A;  4U68 A;  1V43 A;  4HNU A;  5KFF A;  1N9W A;  2JA7 H;  1J5E H;  1NNX A;  1ZKO A;  1KDB A;  3EFX D;  3I91 A;  5CV4 A;  5C3X A;  2IPK D;  1TWA B;  3HOV B;  1PH8 A;  2JYO A;  2E5L L;  2Y0S A;  2UXB L;  2BE5 C;  1DOL A;  4LWC A;  5C44 G;  4A3G H;  1KHI A;  2BQ3 A;  3M7N A;  4TV9 F;  1EY0 A;  1X55 A;  2MO1 A;  1I7L A;  3DWA A;  2OQ0 A;  4CBV A;  2XIG A;  4DR2 Q;  1NAP A;  2QA4 A;  3NTK A;  4A3J H;  2YL2 A;  1SYB A;  4G3I A;  3LML A;  1NCV A;  2N3S A;  2H1E A;  2VQE Q;  1CZW A;  1UNN C;  3M4I A;  3N41 B;  1JOK A;  1HQM C;  1VQ7 A;  3NTH A;  4LSX A;  4K8J A;  4BY1 B;  4DV4 H;  4AIM A;  2F0V A;  4IUQ A;  3GTQ B;  2UVV A;  2WFW A;  1EIG A;  1FNW A;  1HPC A;  1K9M C;  2EZV A;  4K0K L;  5HGQ A;  3VMM A;  1W6K A;  4LFA H;  1V8Q A;  1GHJ A;  4DR2 H;  4A93 B;  2F0P A;  3L4K A;  4A3B B;  1HNX H;  2CWA A;  2JA5 G;  5M3F B;  1VMP A;  2EY2 A;  4TUY F;  1ICF B;  2D2C C;  2F0H A;  1FNV A;  1E4E A;  3N42 B;  2UXC L;  2PO4 A;  3LWE A;  3ERQ A;  5AJ3 L;  3AFP A;  2Q2U A;  1EZ6 A;  2R3Z A;  3SI8 A;  4CDE C;  4KMU C;  4IUP A;  4R8N A;  1JE5 A;  1SRO A;  2JP1 A;  3LNN A;  4K2L A;  1BQQ T;  1J5E Q;  3TQ1 A;  1B33 N;  1GUG A;  2XRS D;  2FPP B;  4Q0F A;  4N8F A;  2BA1 A;  3GTP A;  3BVZ A;  1VF7 A;  5KFY A;  3FDS A;  1F9S A;  3I4N G;  3M4P A;  3EN2 A;  1WCM H;  4HR7 A;  3T1Y Q;  2GVB A;  1ONL A;  4R8U B;  1O7I A;  2J6U A;  2EE1 A;  4J0M A;  5ELF A;  4QQB X;  1DYQ A;  3D31 A;  1S0M A;  1D1I A;  4QW8 A;  2K5V A;  4RB1 A;  4LF5 Q;  4LFB L;  4G57 A;  5J39 A;  1YHQ A;  1K8M A;  2CWP A;  2XSC A;  4DA2 A;  2ALZ A;  4DR3 Q;  4B3S Q;  4J9P A;  4PV1 C;  4O3O A;  4ILW A;  4JV0 A;  4L8J A;  1UNS A;  2B2T C;  2E2H B;  3VYU A;  4JI2 Q;  4UFZ A;  4P71 A;  2O2L D;  1EFI D;  1SJE D;  5IOD A;  3Q8R B;  5D3D A;  3A0J A;  1O7L A;  2E2D C;  1K8O A;  4HMI A;  4HTH A;  1VQK A;  1FKA H;  1PZJ D;  1GSO A;  4DR6 L;  2A6H C;  2L12 A;  3UDG A;  4RB0 A;  2ZJQ A;  1I4Q A;  1CTM A;  4EYI B;  2HUG A;  4FM9 A;  1XPR A;  5KKN B;  4JI0 H;  3M4O H;  4JYA H;  2GPS A;  4A3D G;  3KTM A;  3TQT A;  4F4W A;  2FIN B;  4Y7N H;  4HJ7 A;  2UUC H;  2NU7 B;  1F9R A;  1EFW A;  2BQU A;  2R8J A;  3H6M A;  2VB2 X;  5KG4 A;  1XMO L;  2SCU B;  1CE8 A;  1ENA A;  4IPH A;  4K2K A;  1TQO A;  4DAP A;  3EJI A;  2VQF L;  2UUC Q;  3PW7 A;  4DR1 L;  3X3N A;  4FF1 A;  4A3F G;  3RGX A;  4YP3 A;  4NXM H;  5H1S E;  4HJ9 A;  5IYZ F;  1VQD A;  1EHI A;  2X6L A;  3TEH B;  2UUA L;  3G6Y A;  4EEY A;  3GTJ A;  1MSH A;  1VKZ A;  2RF4 A;  1SNQ A;  4DPG A;  1IYV A;  3HXL A;  2VXW A;  1PXU A;  4DAV A;  3PUW A;  4Q45 A;  5FLM H;  1QVF A;  4NDX A;  3CCU A;  5LMN Q;  2UU9 L;  3HOV G;  4DV3 L;  2G9H D;  5BPH A;  4PZ6 A;  1Q1B A;  2KCN A;  2FXQ A;  1JMC A;  1QE6 A;  2C00 A;  4I50 F;  5EZY F;  4HNV A;  2W9C B;  3IFD A;  4DV5 Q;  2FJ2 A;  1ET9 A;  4A3K H;  5JVH 3;  1QB5 D;  2W9B A;  2K28 A;  2W7O A;  1ZHS A;  5C4J H;  4GC7 A;  1J6Q A;  4Q8E A;  3TQY A;  5IT9 W;  3NTI A;  4Z9C B;  1M8A A;  5IYD G;  1EWC A;  5FJ8 G;  3S1R B;  4X65 H;  1IW7 C;  3NEL A;  3S1Q B;  2NVY A;  3FHW A;  4DFA A;  4DR3 H;  4KY7 A;  4JBJ A;  1BBX C;  4LF4 Q;  5JH7 F;  2EJF C;  1M4V A;  4C2M A;  1I50 B;  5CV6 A;  3L4J A;  4RHR A;  2YS7 A;  4IOC A;  3BG3 A;  3CCM A;  1CHP D;  4HMJ A;  1HR0 W;  4R1J A;  5M3M H;  3P7J A;  4FVM A;  2V4R A;  4OGQ C;  1VQL A;  4J9S A;  4JW0 A;  2IP4 A;  4DL3 A;  1BCP B;  1EY6 A;  3K57 A;  4PWQ A;  3ZJY C;  2B8F A;  1KRT A;  4A3L H;  1W96 A;  1H9R A;  1X6O A;  2W6Z A;  1EY7 A;  2EYF A;  1TWH A;  1SEI A;  1QIL A;  1AEX A;  1HZA A;  4RHS A;  4DV7 Q;  4I7A A;  5LXT F;  3KLW A;  2K1B A;  1L1O C;  1SEB D;  2AWO A;  4LF5 L;  1IBL L;  1JB7 A;  4XYM B;  3NHH A;  1RTN A;  1B70 B;  1TKW B;  2YU9 A;  3JAM i;  1JOQ A;  4HQ6 A;  1X3F A;  2Z4I A;  1Z9F A;  1UWV A;  3PUV A;  2R92 A;  5M3M G;  3T1Y L;  4XIG S;  5CV8 A;  4GN5 A;  5FLM G;  4IAJ A;  4RMF A;  4YHH Q;  3MZ5 A;  4JOI A;  5KYL A;  4ZUI A;  3HEJ A;  4MTK A;  5ELE A;  3EPI A;  3PO2 H;  4JI3 Q;  3VR3 A;  4ZI7 F;  1VQJ A;  2DN8 A;  5I9P A;  2NN6 I;  1V1P B;  5JPN C;  1S9F A;  3OMC A;  4DK1 A;  3F2C A;  2HGS A;  2LKV A;  3K59 A;  4HIK A;  1T3N A;  2OF1 A;  4QGU A;  3RFC A;  4HIM A;  4LUZ A;  5CBA E;  3D4W A;  2ZTC A;  1STG A;  4FS1 A;  5LMU L;  2I07 B;  1STA A;  2N55 A;  3FKI H;  1SRU A;  3MWY W;  5E4W C;  4YCW A;  1HNW L;  1V9P A;  1F2M A;  2F0M A;  1B4O A;  2JEA I;  3PO2 G;  4X65 L;  4DV1 H;  3HOZ H;  3HKZ A;  1MD2 D;  2L4N A;  3X3M A;  4A3M H;  4WJ3 M;  1OXU A;  3J81 L;  1U9R A;  1GUN A;  4EYH B;  1WCM B;  3ORR A;  5KFB A;  1WD1 A;  3G6E A;  3QZ7 A;  1CQJ B;  3CRK C;  2B39 A;  1JC7 A;  3AU7 A;  1VQN A;  4Q5V A;  4LW1 A;  4G4K A;  3GTJ H;  5IYB H; 
#chains in the Genus database with same CATH homology
 4JI8 Q;  1YI2 A;  1N8R C;  1GO3 E;  4XTC S;  1EYG A;  3CC7 A;  1SN8 A;  4GN4 B;  3JC6 6;  4GOP B;  3NEM A;  4A3G G;  2JK8 A;  3RLF A;  1N34 L;  4C2M H;  4QY7 A;  1E1O A;  3UDI A;  5JJK A;  4JI3 L;  4A3I G;  1UEB A;  1X56 A;  5GAH C;  4HID A;  4Y52 H;  5IE8 A;  2BA0 A;  2N49 A;  1Y1W H;  1NBW A;  3K7A H;  3FP9 A;  2ZJP A;  4DK3 C;  3GDE A;  4DAM A;  4QJF A;  3KF6 B;  1D8L A;  4O0A A;  3T1H L;  2ZJR A;  3CCQ A;  4X62 L;  4A93 G;  1CKN B;  4RG1 A;  4KHP L;  2IX1 A;  1M1K C;  1EIF A;  1UE5 A;  4DV5 L;  4A3E H;  3HOY H;  1VQI A;  1TWF H;  4JI7 L;  1IYJ B;  1WYD A;  2VY3 A;  4DR6 Q;  1TWH H;  3K81 C;  5LMN L;  3J7A 5;  4LF9 L;  2R7F A;  1VQ5 A;  4BXX G;  4GKK Q;  1IBM Q;  1IBL Q;  2UUB Q;  4KLK A;  5M5Y H;  5M3F H;  2Y0S G;  3H0G G;  4JG2 A;  1IL2 A;  3GO5 A;  2K50 A;  1MIU A;  2Z0S A;  2NVY H;  1E1T A;  1VQO A;  1N33 Q;  3HOU G;  4LUV A;  4YY3 L;  4OX9 L;  4FDB A;  2Y0S E;  3SGI A;  1PH2 A;  3GTO H;  4B3R L;  1YIT A;  2IHF A;  4EX5 A;  3KDF B;  3WWV A;  4APV A;  3H3V I;  4JOI C;  1YHA A;  4DR5 Q;  1QUQ B;  1AE2 A;  3K0X A;  4A3L G;  1E24 A;  1H95 A;  2IX0 A;  3F2B A;  4NXN L;  4DAY B;  1SLJ A;  4PZ8 A;  1YJ9 A;  4AYB G;  5ELO A;  3HKZ G;  1EIY B;  2A8V A;  3J81 j;  1K3R A;  3CMA A;  4TVA B;  4R4T A;  2MNA A;  3CP0 A;  1VQ9 A;  2NZH A;  1PFS A;  3U50 C;  5K36 G;  4A3M G;  1QVC A;  5JJI A;  2VL6 A;  5JEA J;  2UXC Q;  5C0X G;  1IBK L;  4B3T L;  2PQA A;  2RHQ B;  1XNQ Q;  4DR4 Q;  4UP8 A;  1ASY A;  3S15 H;  4JI4 Q;  1N32 L;  4EQ5 A;  2PQA B;  2KBN A;  5M3F G;  1EWI A;  1UE6 A;  3STB C;  4GKJ L;  2K14 A;  1U5K A;  4QIW E;  3PO3 H;  4A3C H;  1D7Q A;  4DR7 L;  4YWL A;  1SR3 A;  1IXR A;  1VQB A;  4A3F H;  3BZC A;  3K7U C;  5JEA G;  4JI4 L;  2BH2 A;  3S1Q H;  1DGS A;  1XNQ L;  5IWA L;  1VQH A;  4DV7 L;  1YIJ A;  2R93 G;  3KJP A;  3U4V A;  3A5U A;  4GNX A;  2GVA A;  4OWT B;  4OON A;  1YJN A;  3S16 H;  1Y1W G;  5IYC G;  4IFD G;  4BY1 H;  1OXX K;  1V1Q A;  5C3E H;  2LXK A;  3G4S A;  1K8A C;  3HOX G;  5IT9 c;  5IP7 G;  4DUZ Q;  2VUM H;  1XTD A;  1Q7Y C;  4LF7 Q;  2CKZ B;  2ZM6 Q;  4IPC A;  3RLN A;  3A74 A;  3K80 C;  4LF8 L;  5E7N A;  2VW9 A;  1I3Q H;  3CCJ A;  4X6A H;  1NMG A;  4B3R Q;  4NB3 A;  2WB1 G;  4IFD I;  1QUQ A;  5IYB G;  4LUO A;  4YY3 Q;  4L5Q A;  2HIV A;  1TWG H;  3L7Z C;  2EIF A;  4MNO A;  4BBR H;  3PGZ A;  4MTN A;  3J7Z C;  3PSI A;  2NZO A;  3F2D A;  1BBU A;  1IBM L;  4P74 A;  2V1C C;  2UUB L;  4J15 A;  3CPF A;  1HNZ L;  2E5L Q;  1FJG Q;  4MZ9 A;  4OO1 G;  1P16 A;  1N36 Q;  2HT1 A;  1G29 1;  4GKJ Q;  2VNU D;  3CCR A;  2VQE L;  3HKS A;  1WFQ A;  2IY5 B;  1Q81 C;  2CQO A;  3PUX A;  4DK6 C;  1RL2 A;  2WAQ G;  5IP7 H;  3E0E A;  4KHP Q;  3ER0 A;  4X62 Q;  3AEV A;  3TS2 A;  3ULP A;  3NBH B;  2GN5 A;  4GOP A;  1NE3 A;  2KCM A;  1KRS A;  2HQL A;  3JAM c;  1R9T H;  4YCU A;  2PI2 A;  1EUJ A;  3M85 A;  2AHO B;  1Q12 A;  2UU9 Q;  5HY6 A;  1C7Y A;  4DUY L;  1LUZ A;  1B7Y B;  1Y14 B;  2K4K A;  2IT1 A;  3B6Y A;  3PIP A;  1K73 C;  3S1M H;  2R6G A;  4DV1 L;  1K8G A;  3I4O A;  2ZTD A;  2YTY A;  4C3I H;  1PH6 A;  1TXY A;  4GLA C;  1WCM G;  3F1Z A;  3PV0 A;  3U4Z A;  1OXS C;  2ID0 A;  3PF5 A;  1KD1 C;  2I0Q A;  4A3C G;  3CCV A;  1C0A A;  2NN6 G;  1N33 L;  2B63 G;  4DR1 Q;  2JA6 G;  4AQY Q;  3GTK H;  4OWW B;  1HH2 P;  2ZM6 L;  1BKB A;  5GQO A;  1HZB A;  4JYA Q;  4B3M Q;  1LYL A;  1SE8 A;  5EAY A;  2PMZ E;  3RN2 A;  1QZG A;  4LNQ A;  2F4V Q;  5IY0 A;  4DV2 Q;  4LF9 Q;  4UPA A;  1G51 A;  1K0R A;  1K83 H;  1YHB A;  2ATW A;  3S17 H;  3F8T A;  3MEF A;  4LFB Q;  2JA9 A;  4GN3 B;  5C4X G;  1CKN A;  4B3M L;  1A62 A;  5FLX c;  4BY7 H;  1YZ6 A;  3ULL A;  1V43 A;  1BBW A;  2JA8 H;  1HZ9 A;  3GD7 A;  3BJU A;  1N9W A;  2JA7 H;  3T1H Q;  1XNR Q;  1PA6 A;  1PH3 A;  2KCT A;  1PH8 A;  1JJ2 A;  1LTL A;  1HNZ Q;  5IP9 H;  1FL0 A;  1OXV A;  2AMC B;  1S40 A;  2E5L L;  1FJG L;  2UXB L;  3H0G H;  4JC0 A;  4LWC A;  5C44 G;  1N34 Q;  2JA6 H;  4A3G H;  3TRE A;  1KHI A;  4B3T Q;  3M7N A;  1N32 Q;  1KIX A;  1X55 A;  3DM3 A;  2MO1 A;  2EXD A;  3KF6 A;  2OQ0 A;  5GRO A;  4DR2 Q;  1YVC A;  2QA4 A;  2OCE A;  2D0O A;  4A3J H;  2N3S A;  3S2D H;  2R7D A;  2VQE Q;  1PYS B;  1QVG A;  4BBS H;  2E2J H;  1X3E A;  3G71 A;  4B3S L;  4GLX A;  1N36 L;  1VQ7 A;  3KOJ A;  4IPD A;  2R7Z H;  1X9N A;  1E22 A;  2F4V L;  4PMW A;  2QEX A;  4AIM A;  4JYA L;  1NMF A;  1CUK A;  1HNX L;  1VQP A;  1VQ8 A;  3MXN B;  5C44 H;  4ME3 A;  2WFW A;  1WJJ A;  3KF8 B;  4DV0 L;  1Q8K A;  2WB1 E;  2YTV A;  3IRB A;  3CC2 A;  3FKI G;  1CKO A;  1K9M C;  4K0K L;  4OO1 I;  5HGQ A;  4H02 A;  4DV4 L;  2OWO A;  2ALY B;  4DV1 Q;  1FGU A;  2R93 H;  2CWA A;  2JA5 G;  4LF7 L;  1BVS A;  4DUZ L;  2R92 H;  1XPO A;  5GAG C;  3RN5 A;  2R92 G;  3CD6 A;  2CCZ A;  4A93 H;  4A76 A;  1GVP A;  4LFA L;  2UXC L;  1Q82 C;  5AJ3 L;  3GTL H;  2VS1 A;  3AFP A;  3I4M G;  4HIO A;  2AKW B;  2Q2U A;  4P73 A;  2LSS A;  5AJ3 Q;  3HFZ B;  5IWA Q;  3HOZ G;  1JE5 A;  1SRO A;  4LFA Q;  4ALP A;  4IFD J;  1A63 A;  4POG A;  5BR8 Q;  1J5E Q;  1HJP A;  1I5F A;  1W3S A;  4R4Q A;  3HOX H;  1UE7 A;  1VQ4 A;  3KYH C;  2DGY A;  2UXD L;  2BA1 A;  4DR7 Q;  5FJ8 H;  3I4N G;  3M4P A;  2N8N A;  3EN2 A;  1WCM H;  4DV4 Q;  3T1Y Q;  2GVB A;  3RZD H;  4K0K Q;  1O7I A;  4JI8 L;  3STB D;  2WP8 J;  4LF4 L;  4POF A;  2YYZ A;  1XNR L;  4UP7 A;  4TQU S;  1YBY A;  2JEB I;  2AWN A;  4OXP A;  3W1B A;  4DR4 L;  4QQB X;  3D31 A;  4YWK A;  2C35 B;  1KXL A;  2K5V A;  1EQQ A;  4JI5 Q;  1AE3 A;  4LF5 Q;  5C0X J;  1YHQ A;  3NEN A;  4LFB L;  2CWP A;  1MJC A;  1L0W A;  2ES2 A;  2ASB A;  4DR3 Q;  1TWC H;  2K5H A;  4B3S Q;  1NY4 A;  1PYB A;  4NXN Q;  1VQE A;  1X54 A;  4R4I A;  5ELN A;  3CPW A;  4X65 Q;  4KHZ A;  5C0X I;  4DR5 L;  5C3E G;  4JBW A;  4AQY L;  2NVT H;  4DV3 Q;  3HOW H;  3M3Y H;  4JI2 Q;  4P71 A;  4X66 Q;  3CXC A;  3A5Z B;  3GTP H;  5M5W H;  3PIO A;  2XGT A;  2B3G A;  4C3H H;  2EQS A;  3L2P A;  1S72 A;  2F3I A;  3HOY G;  5LMU Q;  2XTI A;  1ASZ A;  2PNH A;  4DKA C;  5J3B A;  2YV5 A;  1YEZ A;  3A0J A;  4L5R C;  2K75 A;  2KHJ A;  3E9H A;  2UXB Q;  3D0F A;  1VQK A;  4KI0 A;  5LMN W;  3I4N H;  1PH7 A;  1E7Z A;  1L1O B;  4IJL A;  4DR6 L;  3PO3 G;  3HOV H;  1VQG A;  3UDG A;  2ZJQ A;  1YNX A;  4JI7 Q;  4DV6 Q;  2UUC L;  2LXJ A;  1T9H A;  2D62 A;  1PHJ A;  1WOC A;  4L5S A;  3E9I A;  4A4I A;  3OYY A;  3DLL A;  4LFC Q;  1XMO Q;  2QGQ A;  4GNX C;  3S1N H;  3I55 A;  2DUD A;  4R4O A;  4YWM A;  1XPR A;  3M4O H;  3KJO A;  1OXT A;  1CSQ A;  1Q46 A;  1PH5 A;  4A3D G;  1L1O A;  3OTO L;  4NPS A;  4Y7N H;  5GAE C;  4HJ7 A;  3I4M H;  4NXM L;  2R7Z G;  1EFW A;  2JA7 G;  4DV2 L;  2OTJ A;  1A0I A;  2VUM G;  1XMO L;  4LFC L;  1WI5 A;  2F52 A;  4IPH A;  4PZ7 A;  4A3K G;  2VQF L;  1LM0 A;  4DV6 L;  2UUC Q;  4A3B H;  2YTX A;  4DR1 L;  4BA2 I;  2N78 A;  4A3F G;  2A1A A;  4R4C A;  4GNX B;  5H1S E;  3L0O A;  4PG3 A;  4JCV E;  3CCE A;  4HJ9 A;  1VQD A;  3TEH B;  2HHH L;  1IZ6 A;  2UUA L;  1U0L A;  3PCO B;  4LF8 Q;  1X3G A;  2RF4 A;  4DPG A;  3S1R H;  3GTM H;  4GKK L;  5IP9 G;  1XMQ Q;  3PUW A;  2B63 H;  4OWX B;  5IYC H;  5FLM H;  4DUY Q;  1QVF A;  3RZO H;  4JI2 L;  3CCU A;  5LMN Q;  2D0P A;  2I5L X;  2UU9 L;  4DV3 L;  3HOV G;  5GAD C;  4O2D A;  4PZ6 A;  1Q1B A;  3RNU A;  2FXQ A;  1JMC A;  3ICE A;  3AQQ A;  3M9B A;  1VQ6 A;  1NJI C;  1I94 L;  3PUY A;  4DV5 Q;  1W2B A;  4GLV B;  4A3E G;  4IPG A;  1EOV A;  4A3K H;  3GTJ H;  4DR3 L;  2E2I H;  1Q86 C;  5C4J H;  4NXM Q;  1J6Q A;  3I56 A;  3TQY A;  1A8V A;  3OW2 A;  3TRZ A;  5IYD G;  5FJ8 G;  3BU2 A;  1I50 H;  2KHI A;  3CCS A;  3NEL A;  2PI2 E;  3AYH B;  1JJC B;  3FHW A;  1VQM A;  3HOU H;  4JBJ A;  1VCI A;  1E3P A;  4LF4 Q;  2OQK A;  4L5T A;  1S3O A;  3EIV A;  3W5O A;  1TWA H;  2WAQ E;  4IOC A;  3KDF A;  2JQO A;  3UE0 A;  3CCM A;  4UP9 A;  3PF4 A;  2Q2H A;  1HR0 W;  4JI0 Q;  2UXD Q;  4WJ4 A;  2E2H H;  3CC4 A;  1CSP A;  1Y1V G;  4R1J A;  4YCV A;  5M3M H;  5BR8 L;  3J80 i;  2RCN A;  1J5E L;  4JV5 Q;  1VQL A;  1L2F A;  4YHH L;  2NVX H;  4BY7 G;  3ZJY C;  4A3J G;  4JI6 L;  1KRT A;  1I94 Q;  5C4X H;  4X64 L;  3I7F A;  1X6O A;  2KEN A;  4X66 L;  4A3L H;  3GTG H;  3LGJ A;  4IO9 A;  4A3D H;  2L15 A;  1HZA A;  1VQA A;  4X64 Q;  2MQH A;  4DV7 Q;  1GM5 A;  1YJW A;  3KLW A;  4JI1 L;  1L1O C;  2K5N A;  3H15 A;  2BH8 A;  2AWO A;  1MJE A;  2Q2T A;  4JI5 L;  3TS0 A;  1IBL L;  1KC8 C;  1JB7 A;  4JBM A;  3CAM A;  3UE1 A;  4LF5 L;  4BXX H;  5IYD H;  1B70 B;  3JAM i;  4GS3 A;  1KQS A;  1X3F A;  1Z9F A;  4UY8 C;  1UWV A;  3GTQ H;  4AYB E;  4JI1 Q;  1KL9 A;  3PUV A;  1HZC A;  2Z6K C;  1HNX Q;  1Q1E A;  1Z47 A;  3BZK A;  1OTC A;  1Y1V H;  5M3M G;  2A19 A;  1PH9 A;  4AH6 A;  3T1Y L;  2VZA A;  1IBK Q;  4XIG S;  2RHS B;  3VDY A;  4GN5 A;  3G48 A;  3CCL A;  1P8L A;  2Z6K A;  4BA1 I;  5FLM G;  1KAW A;  5JJL A;  4LF6 L;  3Q8D A;  3HKZ E;  4RMF A;  4YHH Q;  3S24 A;  3W1G A;  1HR0 Q;  4JOI A;  4HJ5 A;  1B8A A;  2JE6 I;  3CF5 A;  4A75 A;  3U58 A;  3ULJ A;  2H5X A;  3UDX A;  3PO2 H;  4JI3 Q;  1PVO A;  1HR0 L;  1VQJ A;  4LF6 Q;  4DR2 L;  2IHE A;  1JT8 A;  1RIP A;  3CME A;  2NN6 I;  1SFO H;  1G6P A;  2Q2I A;  3F2C A;  1PH4 A;  1PH1 A;  3K8A A;  3S14 H;  4A3B G;  1EQR A;  2JJQ A;  1GD7 A;  1FVI A;  2I5M X;  4QGU A;  1VQC A;  4P75 A;  4HIK A;  4OX9 Q;  4HIM A;  3HOW G;  3ERS X;  4DNI A;  2I5H A;  3M4Q A;  4LUZ A;  2OTL A;  3J80 c;  4HJ8 A;  2HIX A;  2MFI A;  2ZTC A;  1X65 A;  2K52 A;  3J81 c;  1PV4 A;  2JA5 H;  3RR5 A;  4BBR G;  5LMU L;  3S2H H;  1I6H H;  3EBE A;  3KFU A;  2YU9 H;  1CKM A;  2B29 A;  1M90 C;  3FKI H;  4HJA A;  2CFM A;  1SRU A;  1MKH A;  1UE1 A;  4YCW A;  4DV0 Q;  1HNW L;  1V9P A;  4A3I H;  3CW2 C;  4IOA A;  2VQF Q;  2JEA I;  3PO2 G;  4X65 L;  1AH9 A;  3HOZ H;  4GOP C;  5M5X H;  1XJV A;  5DLQ E;  1SMX A;  1C9O A;  2E8G A;  1HNW Q;  3AFQ A;  3I2Z A;  4QL5 A;  4A3M H;  4BY1 G;  1OXU A;  4WJ3 M;  3PUZ A;  3J81 i;  4JBK A;  1JJG A;  4JI6 Q;  1QZH A;  1XMQ L;  1GKH A;  3CQZ H;  3OTO Q;  3H3V H;  2ZTE A;  4P72 A;  3G6E A;  1XPU A;  2MO0 A;  4IJH A;  2JA8 G;  4BBS G;  1VS0 A;  4C3J H;  4JV5 L;  1VQF A;  3RLO A;  1VQN A;  2NVQ H;  3UDF A;  2HHH Q;  2UUA Q;  4LW1 A;  4JI0 L;  1NTG A;  5IYB H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...