4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
1HNWQ 3U4VA 4GNXC 2AMCB 1OXXK 3M4QA 3FKIH 4JI5L 4A3IH 2OTLA 4LF4L 1NJIC 3RN5A 4DAYB 4A3KG 3M3YH 1HZ9A 1N34Q 1CKOA 4A3LH 2MO1A 2A19A 2D0PA 3PUXA 2E5LQ 4PZ8A 4JI4Q 4LFBL 1UE6A 1EQRA 1VQJA 4GN3B 3EIVA 3CCVA 1M90C 4LF5L 4GNXA 3ER0A 4JBWA 1VQOA 1HNXQ 2PNHA 1HH2P 1KL9A 3K8AA 3FHWA 2MO0A 5LMNQ 4DUYQ 4B3TL 1A8VA 2YYZA 1IBLL 2VS1A 1E1OA 1HZBA 1Z9FA 3PUZA 1TWCH 1G6PA 1UWVA 2K52A 2KHIA 4DR6Q 1Y1VG 1X56A 3W5OA 4X65L 2D0OA 1QUQA 1Q82C 4LF9Q 4HJ7A 2HHHQ 3S15H 1YJWA 2I5MX 3STBC 2UXDL 4EX5A 3S16H 2QEXA 4NXNQ 3AYHB 2KHJA 4PMWA 3ULJA 3PO3G 2CKZB 5IE8A 1PH1A 3CW2C 2JA5H 1WYDA 1NE3A 2K50A 5JEAG 4DV4Q 4GOPC 2KENA 2JK8A 4LUOA 2JEAI 1PVOA 4HJ5A 3F2BA 4B3RQ 4X62L 2JE6I 4KI0A 2C35B 4OONA 2XGTA 2ATWA 2PI2E 2R7FA 2RHQB 1IZ6A 3PUYA 3JAMc 4DV6L 2UUAL 2F4VQ 1VQ6A 5M3MH 5IP9H 3UDFA 3KDFA 4AIMA 4GOPA 2LXJA 4GN5A 3M4OH 2JJQA 2AHOB 4IO9A 4MNOA 4DR3L 4A3MG 1SE8A 4A4IA 1HR0Q 4JI3Q 3CAMA 3CD6A 2EXDA 3H0GG 1JJGA 4LF7Q 1CKMA 1NY4A 2JA6G 2R93H 2OTJA 4IJHA 4LNQA 1I94L 1P8LA 1G51A 3K80C 1XPRA 2R7ZG 1YIJA 4KHPQ 1X54A 4GLVB 3FP9A 4DKAC 4JI7L 2GN5A 1JJ2A 3L7ZC 5FLMG 2IX0A 3RNUA 4UY8C 1X3EA 4DR7Q 4LF8L 1IXRA 2JA7H 3UDIA 5C44G 3CCSA 2KCMA 4DV3L 3GTKH 2YTVA 1JE5A 1OXVA 3I2ZA 1B70B 4JI1L 4X66L 4DV2Q 1PH9A 3S1MH 3G71A 2ZTCA 4OWXB 5HY6A 4DAMA 3GDEA 4QJFA 4P72A 2ZM6L 2ID0A 1K0RA 4R4TA 4AYBE 4JC0A 2IX1A 3CP0A 3PF4A 3M85A 2B29A 4BBRG 3GTJH 3RLFA 3IRBA 3OTOL 3CCLA 4BY1H 1N32L 2PQAB 3M9BA 3CC4A 2R6GA 2YTXA 1L1OC 4IPGA 5FLXc 2JA8H 2BH8A 2JEBI 4AYBG 3CCUA 3CCEA 2FXQA 3Q8DA 3K7UC 1NTGA 2AWOA 4POFA 3KF6B 1IBKQ 3CC7A 2UUBL 3I4MG 2DGYA 5HGQA 4HIMA 4DR2Q 1SRUA 1E24A 1SMXA 3NBHB 1CUKA 1EOVA 1YZ6A 4A3KH 1VCIA 2GVBA 3HKSA 4L5QA 4LFCL 1CKNA 1L1OA 3D31A 2CCZA 4R1JA 1VQ8A 3I4NH 3KF8B 2L15A 1VQHA 2WP8J 4LUVA 3PO2G 3E9IA 3U50C 1FJGL 2N3SA 4NPSA 3HOVG 4DUZQ 1NBWA 1VQCA 3GD7A 4LF6Q 4NXML 5C4XG 1WOCA 2OQ0A 4C3IH 3KJPA 5JJKA 4IOCA 4GKKQ 3HOUG 1XPOA 1PYBA 4DV7L 1I5FA 1Y1VH 1JT8A 1VQIA 1W3SA 1TWHH 1PFSA 2VQEQ 3T1YQ 3K81C 4DR4Q 4C3HH 5M5XH 4BA2I 1QVGA 2OCEA 1BBWA 2N8NA 2XTIA 3HFZB 3T1HQ 2Q2UA 1WCMG 2ZJQA 4A76A 4JI6Q 1N33Q 3ICEA 3PO3H 1HNZL 4O0AA 2ASBA 4UP9A 3J81i 5GROA 1VQ7A 2LSSA 2N78A 2K5HA 2Q2TA 1HNWL 3JAMi 1Q46A 1L0WA 3S2HH 1P16A 2UU9Q 4PZ7A 3U58A 3PCOB 2UXCQ 1PH7A 3I7FA 4A3JG 3OYYA 4GKJQ 1N34L 1YHQA 3S1NH 2E5LL 4JI4L 4B3ML 2VQFQ 4JYAL 2UUCQ 5C0XJ 1K8GA 1Q7YC 5M5YH 4BY7G 1XMQQ 3RN2A 1QZGA 4APVA 1HNXL 4DK3C 4WJ3M 5JJIA 3K0XA 1A63A 1LM0A 3H0GH 3KOJA 2CWPA 5GQOA 4C2MH 3MXNB 5LMNL 4DUYL 4IPCA 4DV0Q 2JA6H 1JJCB 1EFWA 3CPFA 4B3SQ 1YHAA 2OQKA 4YCVA 1VQLA 1OXTA 4BXXG 2NVYH 3KF6A 2I5LX 4UPAA 1VQ5A 2R7ZH 4A3BH 4LF9L 4DR6L 3M4PA 4A3CG 1IBMQ 2HHHL 2K4KA 1BBUA 2I5HA 2RHSB 5FJ8G 4JV5Q 2MQHA 3GTLH 3ZJYC 1GM5A 1S3OA 5FLMH 1GD7A 1VQPA 4LFAQ 1X6OA 1E3PA 4IPDA 3CCQA 1VQBA 3S14H 5LMUQ 5C44H 2YU9H 4A3FG 4DV4L 2WFWA 2A1AA 2PMZE 4TVAB 3S1RH 4OO1G 4B3RL 4UP8A 4XTCS 5E7NA 3KJOA 1KD1C 1XPUA 4JBJA 2MNAA 1JMCA 1NMGA 1RL2A 3J81c 4OO1I 2F4VL 1V9PA 1K73C 2E8GA 3DM3A 1Q81C 4YWMA 4JI2Q 3J80c 3CF5A 1YEZA 3HOXG 4BBRH 4AH6A 1UE7A 1TXYA 2NN6G 4EQ5A 3J7A5 3I55A 4MZ9A 4JI3L 5K36G 1RIPA 1SR3A 1HR0L 3NEMA 3I56A 4K0KQ 3L2PA 3CCJA 1ASZA 1YVCA 4LF7L 1WI5A 2ALYB 1KC8C 2I0QA 2K75A 3G48A 2UXBL 1K3RA 3HOYH 4HIKA 2K5NA 3D0FA 3TEHB 1A0IA 4LWCA 4C3JH 4KHPL 5M5WH 1Y1WG 1Z47A 1WFQA 4OWWB 3PO2H 1I6HH 4GS3A 4DR7L 3BU2A 3RLNA 1YJNA 2IY5B 1FL0A 3HOVH 3UDGA 1GKHA 5C4XH 4JI0L 1VQGA 1GVPA 1VQEA 4YWLA 2R92G 1J5EQ 1OXUA 1XNQQ 3HOUH 4X64Q 3F8TA 1YITA 4DV2L 1VQ9A 2E2JH 1XNRQ 3MEFA 3ULPA 4X6AH 4JOIC 4DV1L 1PA6A 5IY0A 1VQNA 5C4JH 3GTPH 3W1BA 5GAEC 4DR5Q 3WWVA 2NVQH 1SN8A 4A3EG 2CWAA 3CMAA 1WCMH 1EUJA 4YWKA 1VQDA 5GADC 3L0OA 3UE0A 4QQBX 4JOIA 1V1QA 2KCTA 3BJUA 4JI7Q 1U0LA 4BA1I 5M3FG 1PH3A 1IBKL 1X3FA 1HZAA 5BR8Q 3S1QH 3PUWA 4JI8Q 1V43A 2YV5A 3GO5A 4DR2L 1XNRL 2JA9A 4A3JH 2OWOA 2QA4A 4WJ4A 4DR1Q 1FGUA 4DV3Q 2B63G 4OWTB 4BBSG 2Z6KC 3PSIA 4GLAC 1VQFA 3G4SA 2KBNA 5C0XG 1R9TH 4BY7H 1EWIA 4IJLA 2VUMG 3PUVA 4OX9Q 4R4IA 4H02A 4R4CA 4AQYL 2ZM6Q 3I4NG 3DLLA 5C0XI 2RF4A 2ZTDA 4Y52H 4R4QA 2VW9A 2EIFA 1BVSA 1TWAH 2JQOA 4DNIA 5EAYA 5IP9G 5IWAL 5AJ3L 2Z6KA 4R4OA 3GTMH 1B7YB 2HIXA 3STBD 5IYBG 1Q8KA 1YJ9A 1N36Q 1MJEA 4A3CH 4A75A 5FJ8H 2BA0A 1X55A 5C3EG 4YY3Q 1A62A 2BA1A 4HIOA 2VQEL 1EIYB 3T1YL 1AH9A 4DR4L 4MTNA 2NVXH 1SFOH 1TWFH 1QUQB 2MFIA 2Z0SA 3T1HL 3RZDH 4JI6L 1KXLA 1N9WA 5ELOA 3ERSX 1YI2A 1QZHA 3HOWG 3PGZA 2WAQE 4A3FH 4YHHL 3J80i 4DPGA 5DLQE 3M7NA 5IYDG 4DV5Q 1PH5A 4A93G 2UXCL 4QY7A 4GKJL 3CQZH 4IPHA 2WAQG 1W2BA 4TQUS 2F3IA 1XMOQ 1UEBA 4ME3A 2VQFL 1CSPA 3HOXH 2UUCL 4HJ9A 2CFMA 1LUZA 4HJ8A 3KDFB 4A3MH 1SROA 1UE5A 4PG3A 4B3SL 2PQAA 4A3GG 3J7ZC 3LGJA 3OW2A 4KLKA 1I3QH 1HNZQ 2NZHA 1X65A 1KRSA 1I50H 1C0AA 3PV0A 1Q12A 1IBML 3H15A 5IP7G 4JV5L 1Y1WH 2VZAA 5IT9c 1UE1A 2K14A 1Q1BA 4UP7A 3CCMA 2WB1E 1SLJA 3RLOA 3W1GA 4ALPA 2R7DA 2HQLA 4NXNL 1OTCA 1AE2A 2H5XA 4JI5Q 2N49A 4O2DA 1PH2A 4LF4Q 4OXPA 4LFAL 5GAHC 5LMUL 4XIGS 3S24A 3VDYA 2E2IH 2R92H 4A3DG 4B3MQ 1D7QA 4JYAQ 4IFDJ 3H3VI 3TS0A 3BZCA 1WJJA 3RR5A 5IYCG 1PV4A 3HOZG 2WB1G 4LFBQ 4LF5Q 2HT1A 1S40A 1X9NA 1N8RC 3KFUA 2VL6A 4A3EH 4B3TQ 3S2DH 4JI2L 4QGUA 3E0EA 2ZJRA 1Q86C 1IBLQ 3SGIA 3NELA 1J6QA 1MIUA 2V1CC 1IYJB 3B6YA 1TWGH 1KAWA 2Q2IA 1LTLA 4X65Q 3U4ZA 1VQMA 4K0KL 2UXDQ 1G291 5M3FH 3CPWA 3F1ZA 4JG2A 2NN6I 4P74A 3I4MH 1VS0A 3I4OA 4GN4B 1EYGA 1HJPA 2ZTEA 1OXSC 2B63H 2E2HH 4BBSH 3PIOA 1MKHA 2IT1A 2GVAA 1IL2A 1C7YA 3TS2A 4LUZA 1K83H 2VUMH 1CKNB 1L1OB 4X62Q 3A0JA 3FKIG 4A3IG 1QVCA 1FVIA 2QGQA 1KIXA 1H95A 1D8LA 1YBYA 1VQAA 4DV6Q 1J5EL 2UUAQ 1XNQL 4A3LG 3UDXA 4X64L 2ES2A 4P75A 3EBEA 1T9HA 2RCNA 1BKBA 1C9OA 5GAGC 1L2FA 5IYBH 4JBMA 4L5RC 2NZOA 4HJAA 2Y0SE 3NENA 5C3EH 3AEVA 4DR3Q 4JCVE 3AQQA 1E7ZA 4DR5L 2DUDA 4DK6C 2UXBQ 2EQSA 4QL5A 4L5SA 5H1SE 3HOWH 4A3BG 1NMFA 3KLWA 2Y0SG 5J3BA 1PH6A 2B3GA 1I94Q 4BXXH 1B8AA 3UE1A 5JJLA 1K9MC 3J81j 2BH2A 4QIWE 3TRZA 1Y14B 5BR8L 5LMNW 3GTOH 5IYDH 4JI8L 4A93H 1XTDA 4LF8Q 1YNXA 4GLXA 1PH8A 4JI0Q 3CXCA 4LW1A 1XJVA 4DR1L 2VY3A 4RMFA 1K8AC 2JA5G 1KHIA 4RG1A 5JEAJ 1PH4A 4JI1Q 1LYLA 2F52A 3F2CA 4X66Q 4HIDA 3AFQA 4DV1Q 1VQ4A 4OX9L 1EIFA 1PYSB 3AFPA 4NB3A 3E9HA 4GKKL 2ZJPA 2K5VA 4DUZL 1U5KA 4GNXB 2UU9L 4POGA 4A3GH 1MJCA 1Q1EA 4YCWA 3GTGH 3PF5A 5M3MG 3G6EA 3KYHC 4L5TA 1N36L 3OTOQ 1DGSA 1E22A 1N32Q 5IP7H 4YY3L 1PHJA 2IHEA 3BZKA 1E1TA 1X3GA 4YCUA 3K7AH 1ASYA 2R93G 3H3VH 3HOYG 3ULLA 3F2DA 2UUBQ 4LF6L 2YTYA 1VQKA 1O7IA 3A5UA 1JB7A 1N33L 1S72A 2A8VA 3PIPA 4A3DH 4P73A 2LXKA 4LFCQ 5IYCH 4IFDG 4IOAA 2AKWB 1HR0W 3HOZH 1YHBA 4Y7NH 4KHZA 4AQYQ 4DV5L 1CSQA 1KRTA 1M1KC 3TREA 4JBKA 1FJGQ 4PZ6A 1KQSA 4IFDI 3HKZE 4NXMQ 1XMOL 3S17H 5IWAQ 4P71A 5AJ3Q 1EQQA 2JA7G 1HZCA 3CC2A 3TQYA 2AWNA 1XMQL 3CMEA 4DV7Q 3CCRA 2PI2A 3HKZG 2HIVA 1AE3A 4GOPB 3JC66 4FDBA 1QVFA 2D62A 4J15A 4DV0L 3EN2A 3GTQH 3A74A 2IHFA 5ELNA 2Q2HA 3A5ZB 3RZOH 2VNUD 4BY1G 2NVTH 4YHHQ 2CQOA 2JA8G 1GO3E
chains in the Genus database with same CATH superfamily
2K03A 2DIKA 5CC4A 2F0KA 2HGSA 4PDBA 3DMUA 3V6JA 1PMRA 1S03G 5IT9E 2AUJD 3RN5A 1MHWC 2OLSA 1CKOA 4A3LH 1ZEQX 1PFBA 2D0PA 1EEID 5I4DA 3U9OA 4GN3B 4A3JB 1GSHA 4ZK9B 4JBWA 1VQOA 4MV3A 2K32A 2UUCH 3K8AA 4MV8A 3EYYA 3F8NA 1FGBD 1XMQH 2MO0A 4B3TL 2XRSD 1IKLA 3I91A 2QEJC 1Z9FA 3PUZA 3G8CA 1G6PA 2CW0C 3OWEB 4DV0H 4DR6Q 4X65L 1QUQA 2UXDL 4HJ7A 2QK4A 2W6OA 3STBC 4EX5A 3J80E 2QEXA 4ID6A 4G7ZC 3AYHB 1PH1A 4RCNA 2JA5H 3NWSA 3TSSA 4LFAH 2KENA 4A3DB 2ZXOA 2JEAI 4X62L 5K2MA 4KI0A 5NUCA 4FF4A 2EE1A 2ATWA 4RA8A 2RHQB 1F2MA 3PUYA 2F0DA 1WTOA 1VQ6A 2B2YA 1STGA 2F1MA 1ENCA 1II3A 3DWPA 3UDFA 5M3MH 4O2AF 3CQZB 3S17B 2HVRA 4GN5A 1E2ZA 3D6WA 3M4OH 2AHOB 4JI3Q 1RYSA 1SE8A 4DL7A 3CAMA 2CH4A 3HG9A 4LF7Q 1PTOH 1WCMA 4O3SA 4K0KH 5KFBA 3WOEA 3K80C 3BS1A 2B2UA 1JC7A 4GLVB 3TP5A 4DKAC 4JI7L 2GN5A 1JJ2A 1DIKA 1G8ZD 1HCZA 5K5PA 5FLMG 3RNUA 5KYLA 5I2XA 1OO9B 4DR7Q 3PW5A 3RAXA 3H09A 2D2CC 4APMA 2KOLA 1SE2A 2JA7H 4DV3L 1KLGD 1V4YA 4G57A 4M7EA 1I4QA 3G71A 2W9BA 1J5EH 2RQXA 2ENBA 4UFZA 2ZM6L 2ID0A 3Q8RB 4R4TA 2ATLA 3CP0A 3PF4A 3M85A 5IGDA 3OHAA 3DUZA 2KCCA 1N32L 1DM0B 2PQAB 4EGVA 1S5BD 3ORRA 1BOSA 1TWCB 3CC4A 2YTXA 3VR5A 2F0IA 2JA8H 2JP1A 2JEBI 4AYBG 3K7UC 1IBKQ 2NVXA 1K28A 1GUTA 4KMUC 2F0EA 3CC7A 4EGJA 3SXHA 1VDZA 5KKNB 5CV5A 1W6JA 5BR8H 4DL3A 1L1OA 2Z4HA 4R1JA 4RGNA 3I4NH 3KF8B 3W2DA 2L15A 3BYYB 3PO2G 4ED2A 4ECRA 3E9IA 3P7JA 3U50C 2B63B 3GIQA 3I12A 2N3SA 3HOVG 4QUCA 1VQCA 3GD7A 5KT2A 3G6VA 1G2TA 1PZKD 3KJPA 3I90A 5T1GA 1W96A 1ULZA 2XVSA 1JT8A 4QMGA 1VQIA 1TWHH 2NBFA 2A74C 3T1YQ 1IOWA 4DR4Q 2F0OA 5M5XH 2YYAA 1QVGA 2MHVA 3HFZB 3SHLA 1N33Q 4A76A 3PO3H 5KG6A 1I50A 3J81i 3NBIA 1TA8A 5KFVA 5GROA 3ZYYX 4IRDA 2WIIB 2JEJA 1Y1WA 3IFDA 4NMZA 1S9FA 1B4OA 4FNFA 2LS01 5E4XA 2NU8B 2EXZA 3N43B 4PZ7A 3U58A 2UXCQ 1WSCA 4I4TF 4MAMA 1BXTA 2R92A 3R8BA 1PFMA 3S1NH 2F0PA 3N6XA 3KHLA 4B3ML 2VQFQ 4BY7G 1NCVA 1BBXC 4B08A 3RN2A 5JJIA 3O13A 3MXPA 4RCOA 2EVBA 1WTWA 3S1MB 1WVLA 2CWPA 4CKEA 3MXNB 2QYZA 2JA6H 4QUFA 3FPPA 1SJHD 2OQKA 2NVYH 3UI2A 3KF6A 2I5LX 4UPAA 4DR6L 4A3GB 1RD9D 4A3CG 4HMIA 1HNZH 5EQ0A 3NBHA 4BY1B 4JV5Q 2MQHA 3ZJYC 1GM5A 1GD7A 4HEDA 4EQNA 1HRJA 1X6OA 1S5FD 2E2HA 1M6VA 1QWYA 4MA5A 1H9SB 3S1RH 4OO1G 1BF4A 2VUMA 4XTCS 3KJOA 1XPUA 5EBDA 1NMGA 1AZQA 1KC7A 4EFBA 3WNZA 1Q81C 4YWMA 2OH2A 3HOXG 4XQNA 2V5AA 4HSVA 4B3TH 2VR1A 4JI3L 1CHQD 1SR3A 4X3KA 3I56A 3L2PA 3CCJA 1Y1VB 1ASZA 4LF7L 2SNMA 4X65H 2JN4A 3D4DA 2UXBL 3GIKA 2UXDH 4C3HB 3E6ZX 2R6FA 5M5WH 3HB9A 2I07B 4J9SA 5CBAE 4TV9F 4J1MA 1W93A 2EYMA 1T94A 3GTOA 3QOJA 4DAYA 4DR7L 3SK6A 5KFNA 4K6DA 4L63B 1GKHA 3S2HB 5KT6A 2K5DA 4X62H 4YWLA 4A3IB 4UCSA 1XNRQ 4IRCA 2F4IA 1R9TA 1NAPA 4JOIC 1WTPA 5DQGA 1UC9A 3W1BA 3H4DA 4A3EG 3BZDB 5EOYA 3H0GB 1SYXB 3V96A 1C48A 4QQBX 4MV1A 1V1QA 1Z2PX 3A7AB 1TR5A 3BJUA 4A3BB 2R7ZB 2Y0SB 1PH3A 1A15A 1IBKL 4U673 3HEJA 2CQAA 3IAYA 3S1QH 5EWGA 1HTPA 1VAJA 3BDCA 2Z8LA 5A2QE 2OWOA 2PBZA 2QA4A 5I6YA 2RDJA 4RB1A 4QWEA 4HAEA 4KTAA 2R61A 1VQFA 4V0BA 5C0XG 3SK4A 4EQPA 3G4SA 1EWIA 4IJLA 3EROA 4H44C 2C9OA 2F0JA 3PUVA 4R4IA 2ZJTA 3DLLA 2RF4A 2KEDA 3A7LA 2L5TA 5AJ3L 2Z6KA 3SVMA 5ELCA 3D4WA 5IYBG 4YBZB 2B2TC 5KFQA 4R8NA 3J81L 1AP0A 3T1YL 1N32H 4DR4L 3GQBA 1X3PA 5KG5A 1TWFH 1QUQB 2G9DA 4FXDA 1YI2A 1QZHA 1KXLA 4Q45A 2OT2A 2CH4W 1ONLA 4A3FH 2KVMA 5LOVF 5JQWA 5EPLA 3J80i 2YRXA 1D6EC 5DLQE 5IYDG 3CRKC 3TN2A 4A93G 1EEFD 2UXCL 1LT6D 4QY7A 2C2RA 4AQYH 2VA2A 3NTHA 2VQFL 2WV6D 5LA6F 2CFMA 2K6AA 1HUNA 5HV6A 1M8AA 3VPDA 3HOUB 2M2LA 4HJ8A 4RNMA 5ISRA 2RGVA 4XT1B 4C1NK 1QB5D 2HCCA 3LGJA 3ND9A 4OL7A 4DK1A 2R7NA 4HYKA 1RCVD 2NZHA 1WCMB 5EPJA 4F8MA 1TWGA 4HQ6A 2ASLA 1NR2A 4JV5L 1TIID 2O4XA 1Q1BA 3CCMA 4YHHH 3W1GA 3GTLH 4ALPA 4NXNL 2N49A 4OXPA 2SEBD 3DM1A 1D7QA 2E2IH 2JA5A 4FXKC 4A3DG 3OHBA 3V2TA 3H3VI 5FLXL 2J7ZA 3BZCA 3RR5A 4LFBQ 1BNZA 2HT1A 1YNJD 4S3SA 4XT3B 1NNXA 1TQOA 1HXYD 4FBTA 3KFUA 5D14A 2W9BB 3S2DH 1BCPB 1I4PA 3ORQA 1PK8A 4ED8A 3DEPA 2RA4A 4PWQA 3VR6A 5C3WA 2VOBA 3MWDA 5L1LA 3QR8A 3VPCA 1F9PA 1V8QA 2RBMA 1XYIA 4DR6H 1EQTA 3C3LA 5L1IA 2NVXB 1BR9A 3BG3A 2EY1A 1OXSC 3KUPA 4V190 2IT1A 2GVAA 1GSAA 2B8GA 3RUPA 1STYA 1L1OB 5DNFA 4J6HA 1QVCA 1Z7TA 2QGQA 4CKCA 1D8LA 2JA7A 1YBYA 1PDQA 4DV6Q 1CZWA 3UDXA 1XNRL 1LTBD 2RCNA 1C9OA 5GAGC 4L5RC 3CU7A 3Q1KA 1GSOA 2NZOA 2W6QA 2Y0SE 3NENA 4JCVE 3AQQA 3P20A 1E7ZA 2K5QA 5M5YB 4JI3H 2EQSA 3FMCA 4MA0A 5H1SE 3HOWH 1KDBA 1NMFA 3KLWA 3MWYW 4ZAIA 3Q0AA 4LF7H 5HURA 4FM9A 1N56A 5EDWA 4RGTA 1ET6A 5EGTA 3TINA 4QIWE 5FD6A 4K2LA 1EU3A 2PZUA 4BS9A 1Y1WB 2FJZA 1E2WA 4JI0Q 1SEIA 4DR7H 1CA6A 2VY3A 4FP5D 4YIJA 5I9OA 5IT9L 1K8AC 3L4KA 2AUKA 1JOQA 2FMMA 5KX5F 1U4PA 1ZYRD 2R92B 3S14B 1STNA 4DV1Q 2B2WC 3AFPA 4HSPA 3RB6A 1JWSD 4POGA 3L4JA 1S5DD 5FLXW 3PF5A 3ITPA 2PO4A 2VPSA 3G6EA 3KYHC 5EKLA 3LP8A 2LFNA 4L5TA 1LO5D 2BDNA 1NR4A 1E22A 2K1BA 2K28A 3OTOQ 4TV8F 1TWHA 3BZKA 3OHXC 1X3GA 5KFIA 3I4LA 2XGQA 4IWXA 3T5KA 3F2DA 3J80L 2YTYA 3FRPB 2XCPA 3K5LA 1JB7A 1IBKH 1S72A 2UVVA 1KBLA 4N8X1 4LFCQ 5CBEE 4IFDG 4XDXA 3U9TA 1SAPA 1YHBA 2E2HB 1M1KC 2EY2A 1HA6A 1CQIB 4HR7A 3AB9A 4P2CB 2VUMB 5CV8A 3PO2B 3HKZE 4XQJA 2Z4IA 5IWAQ 1C4QA 3HOVB 3TQTA 1HZCA 4DL2A 3CC2A 3TQYA 1XMQL 4DV7Q 3AU7A 1B9NA 4IZ8A 5IGFA 4R8UA 2PI2A 1A2UA 3A55A 1TS4A 1AE3A 5T1IA 4G7OC 2JA6A 5JJZA 1FKAH 4J15A 3OSOA 2DN8A 2RKSA 4DV0L 2YZGA 4CJ2C 5ELEA 2F0QA 5LHY1 5C4JB 3RZOH 2VNUD 5D3IB 5ELBA 4BY1G 2NVYA 4DLKA 3T1YH 4DR4H 2PW5A 3BVMA 2CQOA 1N33H 1HNWQ 2AMCB 2A6EC 1TT2A 4N9PA 3MR5A 3M4QA 2QDBA 5FO9B 1NJIC 3GTOB 4DAYB 1CQJB 4NKLA 1N34Q 3M3YH 3MR3A 2UXCH 4KN4C 4LFBL 1EUCB 1I7NA 1UE6A 1VQJA 3ETJA 3CCVA 1OWTA 1HH2P 2KHSA 4I7AA 2VQFH 1EY7A 4KHVA 4DU9A 2EZVA 4DL6A 3J7AK 3OIQA 4DUYQ 1R9TB 1LTTD 1A3UA 4X3UA 5C6AA 2KA7A 2EJGC 2K52A 1Y1VG 4LF9Q 5KFXA 2FB9A 1DCZA 3I72A 1YJWA 2I5MX 2WACA 1D1IA 3S15H 3S16H 4HNTA 3X3NA 3GQCA 4JV5H 1EY9A 2RVLA 3NP8A 3RGZA 1IYVA 1NE3A 2B2YC 1G6ZA 5G3LF 2K50A 2JK8A 4HCEA 3OMCA 3RV3A 5KIXA 3HOZB 4OONA 1U9RA 4Y7NB 2AQ2B 3JAMc 4DV6L 4MTKA 3MFYA 4KKSA 3Q8QB 3GTKA 2LXJA 5I9PA 1GUSA 2PMZB 2EYHA 4G7HC 3HOXB 1HR0Q 4EQOA 3H0GG 4PMCA 3WO0A 1A6XA 4ED3A 4WORA 1CKMA 2DY7A 2R93H 3K3VA 3NHHA 4G4KA 1SYDA 2Z1CA 1L2ZA 2R7ZG 4KHPQ 4ZOLF 3T56B 3NE5B 3FP9A 3JSNA 1KDAA 3RTXA 2NVTB 4QWDA 2IX0A 4UY8C 1BCPC 3PVXA 3D3RA 2IA6A 4EG0A 2XNAC 2KCMA 2YTVA 3ERQA 1PH9A 3N52A 1B70B 5F9LA 5C5JA 4EBEA 4FYDA 2R82A 4NDXA 4IRKA 5HY6A 4DAMA 3GDEA 2EJMA 4ZKCB 4QJFA 4RKBA 4P72A 3PIO3 1XNRH 3KBGA 2JEGA 4L6TB 3GIMA 4JUZA 5BN3A 4AYBE 4XZ3B 2B29A 2ZT9C 4CBVA 4BBRG 3OTOL 3R2IA 4IPGA 1IL8A 1L1OC 3NQTA 3V05A 1TWFA 1TWGB 1H9RA 4ME6A 1SMXA 1CUKA 1YZ6A 4A3KH 1EZ1A 3KALA 4L5QA 5ELFA 4LFCL 1AUVA 3H20A 3V6KA 4F4WA 5KFUA 1I4GA 2JA5B 1SNCA 5DLGA 4NPSA 4DUZQ 1NBWA 3K59A 4KKTA 1WOCA 2AQ3B 1F2LA 4C3IH 5JJKA 1E0BA 3HOUG 5IODA 3MJFA 4DV7L 1C8CA 5M3MB 5BPFA 2W9AA 2AU0A 4N8FA 1LV9A 2VQEQ 3M4OB 3K81C 4C2MA 1STBA 3HS0C 2Q2UA 2OCEA 4LF6Q 4GZYC 2L55A 3KXYT 1WCMG 4NW2A 4JI6Q 3W3AA 1HNZL 2EDGA 2ASBA 1JOKA 3RV4A 5KFKA 1TKWB 3SK8A 2Q2TA 1CZGA 1HNWL 5JEAH 2R7KA 4OGQC 1VKZA 4YR3A 4QW8A 3MHBA 3GTLA 4YQWA 1FYCA 3A8IE 3LMLA 3OYYA 3BQ1A 4GKJQ 1N34L 3VMMA 4JPBW 3VR3A 1YHQA 4A93B 1S0NA 1QG7A 4EVOA 3TIGA 1Q7YC 1VMPA 1I4HA 4APVA 2JA7B 4IURA 1BCPF 1Q8IA 1TS2A 2FFKB 3MEHA 3URYA 3GV6A 3KOJA 5GQOA 4DUYL 3R5FA 1JJCB 1EFWA 4LH6A 4YR2A 1STAA 1XXGA 2A6HD 1OXTA 1UEAB 2FLPA 2IMWP 2QCPX 4X3SA 4LF9L 2XSCA 1BBUA 2I5HA 5FKAC 5FJ8G 2KCNA 4ECWA 1S3OA 4KKUA 3R23A 4XYMB 1A9XA 4ZI7F 3K7AB 5LMUQ 3V6HA 5A2QL 5C44H 2YU9H 1X3QA 1CK1A 2PMZE 2W70A 3GV8B 5FK9C 4UP8A 5E7NA 1KD1C 4DL5A 2ICEC 4JBJA 2MNAA 5L37A 3I4NB 4LFBH 4MN3A 4OO1I 1V9PA 2KQ3A 1IW7C 3K58A 1DV1A 4JI2Q 1YEZA 3K5OA 4FS2A 4AH6A 2NN6G 1TXYA 3J7A5 4M9UA 2MUYA 4K5XA 1I7LA 1RIPA 4LAAA 4ZKBB 1HR0L 1V51A 5KFEA 4FXGC 2DWCA 2HHHH 1KC8C 1TAEA 4U6PA 2K75A 1MSHA 1K3RA 4JW0A 2K5NA 1J9OA 2XCLA 5DQIA 3G7LA 4C3JH 4KHPL 2V4QA 3FDTA 1Y1WG 3GILA 5JPNC 1WFQA 1KABA 4OWWB 4ZUIA 4O1NA 1YJNA 1FL0A 2WAQA 5C4XH 4IUPA 5I2YA 1GVPA 1VQEA 1SMYD 2R92G 4HR7B 3BDLA 3F8TA 1YITA 4KV6A 2E2JH 3S1NB 3MEFA 3OMGA 4DV6H 3T4AC 2VB2X 5IY0A 1BNCA 3X3MA 5KT7A 1F2YA 3TP7A 5LL6S 5GAEC 1ZETA 2NVQH 2QDLA 4R8UB 1S97A 3A56A 3CMAA 3QFFA 3K57A 2JA6B 3IG0A 5CB4F 3GP7A 1KNEA 2KCTA 1F9QA 4RAYA 2NVYB 1U0LA 3WOFA 4BA1I 4ODGA 1X3FA 1KAAA 5KG1A 1SNOA 2Q8RE 3PUWA 5IGGA 2YV5A 2IBKA 4A3JH 5D65A 1QJOA 2YS6A 2X0SA 4DR1Q 2HDLA 5CA1F 4O3OA 1EY0A 1UUPA 4OWTB 4BBSG 4JI0H 2WB1A 2Z6KC 4JK1C 5I47A 1Z2NX 2VUMG 4OX9Q 4H02A 2NTTA 3VYSA 4AQYL 3S1RB 2W7OA 1PTOD 4FF3A 5KNCA 5C0XI 4DV1H 2VW9A 2RSNA 3N6RA 1OTCA 1TWAH 1K8MA 2UU9Q 1AW7A 5EAYA 4BXXH 5L1KA 1B7YB 2HIXA 1N36Q 5TSSA 1MD2D 2BA0A 1X55A 5C3EG 1A62A 2K33A 2VQEL 3OTOH 3PW4A 1SFOH 1EOTA 3RZDH 4JI6L 1QCBD 3ERSX 1I6UA 2PPBC 3PGZA 2V9WA 4YP3A 4YHHL 4XYLB 4PQXA 4ZQ3A 5D1PA 1A3VA 3NTKA 1E4EB 3M7NA 5FPRA 4DV5Q 1O7YA 4LFCH 4MV7A 4C5BA 2DJGC 3EA6A 4GKJL 2W7PA 3CQZH 3MTSA 3DXJC 1W2BA 3V4ZA 4TQUS 3BQ0A 1XMOQ 1UEBA 1ZKOA 4C1NI 4ED7A 3BQ2A 2FJ2A 3D8GA 2KSWA 5IWAH 5K36H 3GTKB 1WTHA 4A3MH 2VPQA 4DV7H 5DG8A 4PG3A 1AFPA 3VA7A 2XN9C 4LK1C 1KTKA 3OW2A 1VBHA 3BJYA 1T5XD 1KRSA 5FO8B 1C0AA 4YAJB 5IP7G 1B50A 2WYOA 1IKMA 1UE1A 3MXUA 3M7GA 2F0WA 4DFAA 3IL8A 1KJIA 4JI5Q 1HNWH 1RKNA 5GAHC 5LMUL 1EIHA 2PN1A 4CC5A 4JYAQ 5EWEA 4IUVA 3TS0A 5IOCA 1WJJA 5IYCG 3HOZG 2WKDA 1N34H 2K04A 1K83A 1S5CD 4OHJA 1G91A 1N8RC 2V4DA 2PVPA 1BDOA 1PTOC 4JI2L 3WDNA 4MV4A 4KY5A 3HBLA 3SGIA 4DUYH 3B6YA 2IWHA 4DAPA 5KFDA 3U4ZA 1VQMA 4UCOA 1EZ8A 5M3FH 3CPWA 2R93A 4LF9H 4P74A 1DD2A 3I4MH 1FR3A 3I4OA 1SYBA 1XWEA 1TWFB 2GPSA 4ZYSA 2HVQA 2FK3A 1PFNA 2B63H 4WJWA 4CJ1B 2EYOA 1MKHA 2K05A 1VBGA 1C7YA 1JLLB 4A3FB 4ECXA 2E76C 3A0JA 2FLNA 4K6LA 1H95A 1KIXA 1VQAA 4A3LG 2ES2A 1BKBA 5EBCA 3K6OA 4HJAA 3AEVA 5CV7A 2DUDA 4DK6C 2KEEA 1HR0H 1EYZA 5LL6b 2G5DA 3F2UA 4C2MB 5F9NA 2B3GA 3TMEA 1WD0A 4K14A 3UE1A 5JJLA 5KFSA 1K9MC 5JAVA 2F03A 1Y14B 3MC0B 3SE0A 4KHPH 4IHJF 1SYCA 1EUDB 1XTDA 2RGRA 3KTMA 4LF8Q 1PH8A 4C5CA 5GONF 4DR1L 3GTLB 2O5IC 4K5VA 4BWSC 4RMFA 2JA5G 3RBEA 4R9WA 5JEAJ 3F2CA 1LLRD 1VQ4A 4OX9L 1JR0D 3GLKA 5DLFA 2K5VA 1U5KA 1HQRD 5KFYA 2UU9L 4A3GH 1Q1EA 3GTGH 3OUUA 1X32A 5M3MG 3S2DB 1N36L 1DGSA 1B53A 2XGPA 3EPIA 3SEBA 2WINB 3QB3A 4ME5A 3RUZA 4BBRB 2XRQD 2VUGA 1FNWA 4MV9A 3QJYA 3R2TA 2IJ0A 1ASYA 3H3VH 3ULLA 2UUBQ 3KLSX 3A5UA 5JVDF 1N33L 4A2BA 3QZ8A 4P73A 4ECYA 1B3AA 2BR0A 1CE8A 4TKOB 1SE4A 1MBYA 3MWMA 4KHZA 4DV5L 5D1OA 1L0XB 2M00A 1FJGQ 4IFDI 4FS1A 4RAZA 4NXMQ 3VYUA 1XMOL 1K8OA 3BABA 4HMJA 2JA7G 4DUZH 1SCUB 2I46A 2JEFA 4HCSA 3MR6A 3VPBA 1BGWA 4FDBA 2L12A 1QVFA 2D62A 3M4IA 4LSXA 3EN2A 3GTQH 3A74A 2VQEH 2Q2HA 3A5ZB 1U4LA 2L1BA 3NUCA 4LF6H 4JI6H 4Q8FA 2JA8G 1Y8OB 1GO3E 4J0MA 1EZ6A 3KHHA 3L3OC 4HNUA 2WE6A 1PZJD 3FKIH 4JI5L 4A3IH 2XD4A 1D2BA 2IW3A 2R8JA 2AQ4A 2YU9A 3PUXA 4JI4Q 4PZ8A 3I4NG 4GKJH 4GNXA 3ER0A 3NGDA 4K5WA 1HNXQ 3FDSA 2PNHA 5IGEA 2W9CA 2W6ZA 4O3QA 3MFIA 3FHWA 5LMNQ 1M4VA 5I6WA 2VS1A 1E1OA 3VYRA 4F87A 1QNUA 2GLTA 2MJ8A 1SDFA 2KHIA 3Q6SA 2I8CA 4O2BF 5KFJA 4PMBA 1X56A 3W5OA 1Q82C 5EPKA 2HHHQ 2F0LA 2C22A 4ULLA 1KJJA 1RK5A 2FK2A 2KHJA 3A8JE 4PMWA 4RUCA 1U4RA 4EBCA 3PO3G 3FPUB 5IE8A 1WYDA 3RMHA 2ALZA 1WD1A 4ECQA 3H94A 4DV4Q 2LY7A 5E3FA 3J81W 5LMUH 4HJ5A 1MZBA 1HPCA 2A69D 4K2KA 1G2SA 2WB1B 4CKBA 1ZHSA 3CVZA 2R7FA 4YAKB 2W57A 2E2DC 3Q8PB 2DJFC 5IP9H 2PYKA 4GOPA 3Q22A 4UCVA 4UCUA 2JJQA 4JI2H 4A3MG 4A4IA 4I65A 4MIUA 3CD6A 1GJXA 1JJGA 2GPWA 5L1JA 1LTID 4IUQA 2JA6G 1TS5A 2EOTA 2OTJA 2JEIA 5J1ZA 1P8LA 2X69A 3G6JB 1XPRA 1YIJA 1X54A 3RZOB 3T5LA 4RNNA 2R7MA 4KK7A 4E4TA 2A5HA 1I50B 3HRZC 4FVMA 3FMAA 2FPPB 4LF8L 4O42A 1IXRA 2H1EA 3VA5A 3KLRA 3CCSA 3QWNA 3TRZA 1RYRA 3I2ZA 3M3YB 1A2TA 3EFXD 2L9HA 1LTSD 4IZOA 2W6NA 5KYIA 3LX0A 1YNJC 1TWAA 4JC0A 2IX1A 4F88A 3K3PA 2K7VA 3PR5B 3C1FA 3GTJH 4OELB 3RLFA 3CCLA 3OSNA 3M9BA 2IP4A 1S68A 3OIPA 4LJZC 2UVUA 5FLXc 3NQIA 1JWMD 3Q23A 1GUOA 3Q8DA 2WTFA 4O4HF 1SFOA 3KF6B 1YNND 3I4MG 2UUBL 2YS7A 5JH7F 2DGYA 5HGQA 4HIMA 3S16B 1SRUA 2OXPA 3NBHB 2DPJA 3OOCA 4TQSA 4JV2A 1RJPA 3BA9A 5D8DA 1CKNA 2BCOA 2CCZA 1VQ8A 4HNVA 4JV1A 4RWSC 4LUVA 1VQHA 2WP8J 5LL6X 2HCIA 5JVG3 1JORA 4DR1H 1W6KA 4KN7C 1JX4A 1FJGL 4BBSB 4J9RA 1S0OA 3GIJA 3CQZA 1GUGA 2B2VA 4NXML 4OX9H 1K83B 2OQ0A 4YB8B 3TP6A 3VR2A 3IFTA 1PYBA 4Q0FA 4ECVA 2UU9H 1W3SA 2FHTA 4ILWA 1JWUD 1N36H 3DHQA 4ED1A 1BBWA 2N8NA 5C3EB 4DNRB 3TP8A 3T1HQ 2ZJQA 3ICEA 2R93B 4O0AA 4C5AA 4UP9A 5KFAA 4J9LA 5J22A 1VQ7A 2LSSA 4M8AA 2K5HA 3KHRA 4RNOA 1Q46A 1AN8A 1B1ZA 1L0WA 4Q8EA 1E4FT 1EYDA 1PRTD 2EYJA 3L9AX 5C5LA 5C4ZA 1PH7A 1CTMA 3DF7A 1KJ9A 4DV5H 4JI4L 4GC6A 1K8GA 4ED6A 5M5YH 1K1SA 3M9OB 2RCFA 2HD3A 1HNXL 1XMOH 4DK3C 3PIP3 4IUTA 3K0XA 4WJ3M 5LP6F 3C0FB 1ZYRC 5LMNL 3TIIA 4IPCA 3NK9A 4B3SQ 5KFLA 1YHAA 4YCVA 1VQLA 5IT9W 5FO7B 3CRLC 3M4PA 1IBMQ 2HHHL 2RHSB 2RDFA 5FLMH 4DK0A 4HTHA 2FK1A 1BXRA 1XDNA 4DL4A 2C2EA 2DY8A 2D5DA 2K01A 4IPDA 5KFCA 3S14H 1VQBA 2BOSA 1LT5D 2B63A 4JI5H 4A3FG 3T13A 4DV4L 4A3KB 2A1AA 4MTDA 5LXTF 1B6SA 4JYAH 1JMCA 4JV0A 1SNMA 1EWCA 3J80W 3QIAA 1CQFA 2E8GA 3DM3A 3J80c 3N40P 2DLNA 3RJ0A 1CFMA 1UE7A 3TBIB 3ONAB 4MZ9A 4ECSA 1F77A 5KFMA 2L11A 2B2UC 5C8YF 1YVCA 1WI5A 2ALYB 4EEQA 3A8KE 4HN7A 5JUMA 1EY4A 3HOYH 4RHSA 2F0TA 3D0FA 3TEHB 1Z2OX 1XTCD 4XXEA 3TZDA 2O03A 1ICFB 3CKIB 1Z47A 2QF7A 3PO2H 1I6HH 4GS3A 3BU2A 3RLNA 2IY5B 5KNBA 3HOVH 1WH2A 3UDGA 2FKLA 2F0MA 4JI0L 5KG0A 2G9HD 5D1OB 1V1PA 2PW7A 1OXUA 3R5HA 1XNQQ 2A68D 4ZCKA 4X64Q 5CV4A 3ULPA 1DOLA 2FMAA 4DGZA 4DV1L 4X6AH 3QOLA 1VQNA 5C4JH 3GTPH 1D5XC 4ZQIA 2F0UA 1D1KA 4DR5Q 1SN8A 5KG7A 2YL2A 4CHTB 3GTGA 1CHPD 3M4YA 4CDDC 4RU9A 4I7ZC 2PCFB 4IAJA 2R85A 1EUJA 5BN5A 4YWKA 5KNDA 3A54A 3L0OA 3UE0A 4YR0A 4K8IA 4JI7Q 1MGSA 3MAQA 2MP1A 1WTQA 1V43A 1CS0A 4UCRA 2CW7A 1FGUA 4DV3Q 3OUZA 2OEOA 4Q0YA 1U4MA 4LF8H 4GLAC 4BY7H 3RFCA 2KBNA 1R9TH 2YU9B 3IKJA 2ZXPA 3NSWA 1R4QB 2ZM6Q 2CW0D 4Y52H 1SXTA 4QWAA 4R4QA 1S5ED 2BQRA 4DNIA 1BVSA 5IP9G 5KG3A 2UVRA 2J0TD 5IWAL 5KFWA 4R4OA 4RGOS 4TRDA 3GTMH 5DGAA 3STBD 2B2WA 1YJ9A 1Q8KA 2EYLA 4F4YA 1S0MA 4TSSA 4A3CH 4A75A 4YY3Q 2NZ1D 1PX2A 1EIYB 1B9MA 4IUNA 1AH9A 4MTNA 5KFHA 2DZDA 1S4ZA 3MXGA 2MFIA 2Z0SA 3T1HL 1AZPA 4OIKA 1TU2B 2R7LA 2RSOA 3MWEA 1N9WA 3HOWG 1MI2A 2UUBH 4DXFA 1PTOB 2XWJB 4OO1H 4C3JB 4DNTB 5IGCA 3E5SA 3FKIA 1PH5A 2NUAB 1KEEA 2LKVA 3N41B 4CJ0B 3OW7A 5IYZF 1EY8A 2WAQG 5C4HA 3E5NA 3JRXA 1FJGH 3KAJA 2E2IA 4ME3A 4MV6A 3HOXH 5DG7A 2YZMA 4NXMH 1CT1D 4UAIA 4F4XA 1JQYD 3OPOA 3I70A 2E2JB 1TY2A 5KG2A 2VXWA 4Y8VB 1SROA 1UE5A 4B3SL 2CW8A 3JZIA 5EZYF 4QWCA 2NUCA 4KLKA 1D5ZC 1I3QH 2E75C 3KLSA 3R3OA 4CGYB 2NVQB 1X65A 1J8IA 1M0TA 1IBML 2QILA 3H15A 4WRDA 1JXLA 4FF1A 2VZAA 2SDFA 2HQEA 4RKLA 2R7DA 5DAUA 1AE2A 2H5XA 2JA8B 3G6YA 4LF4Q 2R8GA 3PW2A 2I80A 4EBDA 4U68A 4XIGS 1LACA 3S24A 4B9WA 3VDYA 4B3MQ 3JRWA 4QIWA 1TS3A 1GHJA 5KFFA 3OSPA 2ASDA 1DZ1A 2WB1G 3I8ZA 3K5MA 4O3PA 4J8QA 4LF5Q 1S40A 1X9NA 4JI4H 2LMCB 5J2TF 1ICWA 1O75A 1N48A 4QB4A 1HNXH 2VL6A 4A3EH 3I3CA 1GOZA 4QGUA 1IBLQ 5LMNH 3NELA 4ED0A 1J6QA 2KJXA 1UNNC 2UVWA 3PN1A 1TWAB 2SNSA 1TWGH 2Q2IA 5KEEA 4IUUA 5KT5A 3JAME 1G291 1D5MC 3F1ZA 4JG2A 1AEXA 4J9MA 2AGOA 1TWHB 1EQVA 1VS0A 1EYGA 1SFOB 1HJPA 3K0YA 5KT4A 3RZDB 5M5XB 2NB0A 2RDGA 3PIOA 3KAKA 3PO3B 5C0XH 4RUAA 1ENFA 3RB0A 1GUNA 4LUZA 3TS2A 1CKNB 2Z6BA 4DV4H 5EJWA 3C2PA 2UUAQ 1XNQL 4X64L 1T9HA 1UC8A 4F4ZA 5IYBH 3HKZA 4J9KA 4DR3Q 2O5JC 4Q44A 4DR5L 2M05A 2UXBQ 3BG5A 4A3MB 3GTJA 1GHKA 5J3BA 1PH6A 2MGSA 1I94Q 1GXDC 4IR1A 3KK7A 1BUVT 2A6HC 2MPMA 2V59A 1JICA 1SNDA 4DXGA 2BH2A 1KLUD 1B04A 3ETHA 5IYDH 2GA4B 4A93H 3GIDA 1YNXA 4GLXA 1T36A 5EWFA 4ECZA 2FLLA 1RJRA 3CXCA 1XJVA 2RDHA 2J6UA 3HGBA 2B39A 5JVH3 4H0LC 4JI1Q 2IPKD 2PNRC 4X66Q 4KJNA 3PQIA 1EIFA 1PYSB 4NB3A 3E9HA 4DUZL 4RGMA 1GUWA 5KG4A 2F3WA 1EYCA 3GV5B 3RAQA 1UNSA 4YCWA 5A2QW 5C5MA 5DEHA 2FMCA 5D3DA 3KHGA 2C2DA 1T3NA 4KD4A 4XYOA 5JOBA 4YY3L 1Y8PB 2IHEA 2YRWA 4L8JA 4YCUA 3K7AH 2R93G 3HOYG 5CV9A 3SR1A 5M3FB 5A35A 1VQKA 1DJRD 4LF6L 4JI8H 4IN3A 4A3DH 3I4MB 2R3ZA 4ZUJA 5DQHA 4UDUC 4IOAA 3PW0A 1I4RA 3N8DA 1LT4D 1HR0W 1KJ8A 1LTGD 5EKIA 4CC6A 1CSQA 1KRTA 5M5WB 2NWGA 3TREA 3GV3A 4PZ6A 4KD3A 5HGTA 1STEA 1KQSA 2W71A 3R5XA 2BE5D 5DM73 4NLGA 2EY5A 3S17H 1HQMC 5AJ3Q 5CR3A 1O80A 2L4NA 3JSLA 4DAVA 1SMYC 2EJFC 3CCRA 2SOBA 2F0NA 2HIVA 5BN4A 1NSNS 1LTRD 2XIGA 5E4WC 3BVZA 3Q8SB 3I73A 1DXMA 5ELNA 4RZQA 5C3XA 1TVXA 3BAAA 2V58A 4WD3A 2QKIC 3T1HH 3EJIA 5F2DA 3BYTB 1VF5C 3U4VA 4GNXC 1OXXK 1BO0A 2WKCA 4G3IA 2OTLA 4LF4L 5CORA 4QF4A 4GC7A 4B9XA 4A3KG 1HZ9A 4QWBA 3S1QB 2MO1A 2A19A 1RJTA 1CA5A 2E5LQ 4LSAA 2FP4B 1EQRA 3EIVA 1M90C 4LF5L 2NU9B 1V1PB 3MVVA 1KL9A 1GYFA 5H80A 1B33N 2L0CA 2R8KA 1A8VA 5DM63 2YYZA 5CMDA 1IBLL 2PZWA 1HZBA 4C3IG 1K0SA 1TWCH 1UWVA 1S10A 4B3SH 3GTGB 2XCAA 2D0OA 4AYBA 1EYAA 2J4XA 3NPPA 3EVQA 4NXNQ 1IBMH 3MFHA 3ULJA 1ILQA 1LTAD 1H9JA 2CKZB 2AGQA 3CW2C 2C00A 5JEAG 4GOPC 3IN5A 4LUOA 1PVOA 3F2BA 4B3RQ 2W8KA 2JE6I 4U7CA 4WBNF 2C35B 2XGTA 4ZHQF 5C1OA 3TDQA 2PI2E 2F4VQ 1IZ6A 2UUAL 4UHVA 2BE5C 2R84A 3KDFA 4AIMA 3M9NB 3GV7B 3NTIA 4IO9A 4MNOA 4DR3L 3QZ7A 3GTPA 2F0VA 1SBBB 2EXDA 4PNYA 4XX0B 1WTXA 1NY4A 4IJHA 4LNQA 5DGBA 2RDIA 1I94L 1G51A 5E1FA 3PW7A 3GTQB 1KJQA 4IFDH 3S9WA 1GGOA 5KFZA 1PYWD 2Q8IB 3L7ZC 1X3EA 1HUMA 3H40A 3RF2A 2I87A 1C3OA 3FKIB 3UDIA 5C44G 3GTKH 4XYQA 2J9GA 1JE5A 1OXVA 2HDMA 4JI1L 3S1MH 4X66L 4DV2Q 2ZTCA 4OWXB 2E2IB 5C1PA 4J9QA 1Y69U 5COYA 5DG9A 1XNQH 4X64H 2BDOA 2HUGA 1K0RA 1CM9A 5T14A 2EYPA 2CZGA 1RDPD 5L9XA 3GTMA 2DPIA 1GLVA 3MZ5A 1B44D 3J7YW 3IRBA 4BY1H 2YZNA 2ZXRA 5LYJF 4DR5H 5CV6A 3HZXA 2R6GA 4TQRA 2BH8A 3D4RA 3CCUA 3SI8A 3CCEA 2FXQA 1I4XA 4KY7A 1NTGA 2AWOA 2M9VA 4MHEA 4POFA 1BJTA 1PTOF 5JVLA 5ELDA 4JI7H 3GTQA 4DR2Q 2R8IA 1E24A 1EOVA 2B2VC 3RB4A 1VCIA 2GVBA 3HKSA 4C3JG 4WFN3 4DF7A 1ZXTA 3D31A 3RB3A 2WDTA 4IALA 4DV3H 4QIWB 1EY5A 1JIHA 3VR4A 4J9PA 1HA5A 2NU7B 4EYHB 1SE3A 3Q24A 2C28A 5C4XG 4YJ2F 2P5ZX 2PMZA 4ZLTF 2ZM6H 4IOCA 4XQQA 4GKKQ 1XPOA 1I5FA 1Y1VH 2P0AA 2YCHA 5KFRA 1EFID 4H7BA 1PFSA 2KUMA 2CQYA 4C3HH 5HBRB 4BA2I 5CA0F 2XTIA 2Z9HA 5IGBA 4YY3H 1EY6A 1I3QA 3TQ1A 2FINB 3KBXA 5AFWA 3E3XA 3RD4A 2N78A 3P75A 3RGXA 3JAMi 1AUXA 3HOWB 3S2HH 4EGQA 2XC9A 3K5NA 1P16A 1F2ZA 2B8FA 3PCOB 4O3RA 3I7FA 4A3JG 1HFGA 2E5LL 4JYAL 2UUCQ 5C0XJ 3NWTA 1Y8NB 2F0HA 1XMQQ 1QZGA 2WAQB 1FNVA 1A63A 3PR4A 1LM0A 2ZDHA 2ZDQA 2W6MA 4I7HA 3H0GH 4EEYA 4C2MH 4DV0Q 3HKZB 3CPFA 5CYUA 4BXXG 1SEBD 2FPGB 1VQ5A 4A3BH 1PRTB 2XWBB 2R7ZH 5EKKA 2K4KA 3GTJB 2OF1A 2EPBA 2NU6B 1VQPA 1ZQ7A 1Q3LA 4LFAQ 3PZPA 1E3PA 3CCQA 1ESFA 4EFEA 3P1HA 4LF4H 1B3QA 2WFWA 4TVAB 3U9SA 4B3RL 1WTRA 3GIIA 3RBDA 4B3MH 2PQEA 1IHZA 4NP5A 4H13C 1RL2A 3LWEA 3SDZA 3LNNA 4OEMB 3J81c 1SYGA 4PV1C 2F4VL 4LF5H 1F9SA 1K73C 3CF5A 2BQUA 4O3NA 1CI3M 4BBRH 1F9RA 3WO1A 3V4SA 4EQ5A 5G3LD 3I55A 1IBLH 4RB2C 5K36G 1K1QA 3NEMA 4K0KQ 1O78A 2I0QA 2SCUB 3OWFA 1RODA 3G48A 3FVQA 4ECUA 4HIKA 2J6SA 1A0IA 4LWCA 1TY0A 4DN4M 3UQ8A 4IQZA 3SE7A 1RF2D 4CDEC 2HJWA 4QW9A 1EU4A 1B6RA 1E2VA 1ILPA 1VQGA 4LH7A 1QILA 4X3TA 4RAUC 4YJ3F 1J5EQ 1BQQT 3HOUH 4DV2L 1VQ9A 2ICIA 1E4GT 2UUAH 1PXUA 1PA6A 1NUCA 1RJQA 5BMVF 1L0YB 3C46A 1O7ZA 3WWVA 3H3VC 2CWAA 4DR3H 4ABNA 1WCMH 1K3BC 2UXBH 5GADC 1VQDA 2IX3A 2A6ED 1LABA 3GIPA 4JOIA 3QG1A 1C30A 4Q43A 5KGUA 1I94H 3T51B 5M3FG 3H91A 1Q90A 1HZAA 5BR8Q 1EHIA 2ZDGA 4JI8Q 1ZHQA 3GO5A 4DR2L 4R7RA 3EPGA 3S15B 2JA9A 2W8LA 4WJ4A 1FNUA 1LT3D 3FEWX 4RB3C 1KDCA 2B63G 4MTEA 3PSIA 4C56C 3MFGA 4R4CA 4KY6A 1KNAA 4JI1H 4CDCC 4LMQD 4X66H 2ZTDA 2A69C 1JCKB 1VMCA 2EIFA 2JQOA 2N55A 4CDFC 4GKKL 1UAPA 2JSOA 2BQ3A 4OIJA 1FD7D 2F3VA 2EY6A 1MJEA 3D6CA 5FJ8H 1RTOA 4KJOA 4I50F 2BA1A 4HIOA 2YW2A 3MR2A 2NVXH 3JAML 4AYBB 4QCLA 5ELOA 1QOHA 1JKJB 2B2TA 4FO2A 3HOYB 2WAQE 3MA2B 2DNCA 1SNQA 2R86A 4DPGA 4RH6A 1SYEA 1STHA 1I6HB 4Z9CB 2A73B 4IPHA 3AMUA 1SSOA 5KFPA 2Q8TA 2F3IA 2J6TA 5J2UF 1CSPA 2UUCL 4HJ9A 2NN6H 4J9NA 2TMPA 2K5WA 5CAEB 3DWQA 1LUZA 1JDEA 1JDBB 4O4LF 1RTNA 3KDFB 3CHBD 5FOBB 2PQAA 4A3GG 1JOOA 3J7ZC 3GTPB 1TWCA 1HNZQ 3M9MB 2F0FA 4I55F 5JPMC 1I50H 4RHRA 2MCTA 3PV0A 3HXLA 1Q12A 3J7AF 4F50A 3BDOA 3T5HA 1VF7A 1Y1WH 3BVGA 1BCPD 5IT9c 4DA2A 2K14A 3VYTA 4UP7A 1ESRA 2HVSA 2WB1E 1SLJA 3RLOA 4F7XA 1XX8A 3HP3A 2HQLA 4LFAL 1DOKA 4O2DA 1PH2A 3KF8A 4IR9A 3DWAA 1YNNC 2R92H 4A2AA 1SJED 4IFDJ 4LMYA 1V1OA 5FD5A 1PV4A 2JYOA 5KRUA 3T53B 5BPHA 1I6VC 2PZTA 5KFOA 2E5LH 4BY7B 1ET9A 2R8HA 3K5IA 4B3TQ 1EL0A 5FPOA 4ETSA 4E6IA 3E0EA 2ZJRA 1Q86C 3N42B 3LWBA 2V1CC 1MIUA 2IL8A 1IYJB 3J81E 3N44B 1KAWA 2E74C 1LTLA 1IYUA 2NYZD 4JVZA 4C3IB 4X65Q 3GTMB 4K0KL 2R87A 3H6MA 2UXDQ 4C3HG 2ASJA 1RHPA 2NN6I 4FU0A 2H4OA 2X6LA 1ENAA 1QE6A 4GN4B 2C5CA 2JXMB 2N88A 1E4EA 4NXNH 2ZTEA 2E2HH 4BBSH 4FBUA 1H9KA 1IL2A 4ZRZA 3G6XA 1K83H 5M9OA 2VUMH 5CGKA 3JAMW 4RB0A 4X62Q 4R8IA 2FE3A 3FKIG 2O2LD 4A3IG 4B3RH 1FVIA 1PRTC 1A3TA 1J5EL 4UCTA 4ECTA 4BWGB 4P75A 3EBEA 4JBMA 4TUYF 2F4VH 1L2FA 1EWHA 4K8JA 1O7LA 1T5EA 3MXNA 3RIZA 2DNEA 1AN7A 5C3EH 2NTSA 1WTVA 1QNKA 1HHVA 4Q5VA 1R4PB 4QL5A 4L5SA 1DV2A 5KFTA 4A3BG 1JE4A 2Y0SG 2FPIB 1B8AA 4J9OA 1I3QB 3C1EA 5KFGA 2X6GA 3J81j 1Z6HA 5BR8L 3GTOH 2D9UA 5LMNW 3UFXB 4JI8L 4IWYA 1PLFA 1H9SA 5FLXE 1WR2A 4LW1A 2CVRA 2TSSA 3R93A 3TZUA 1KHIA 3LWUA 4RG1A 1PH4A 1LYLA 2F52A 4HIDA 3AFQA 5C44B 3EQLC 4DV2H 2ZJPA 5IIFA 4RZRA 2AGPA 4GNXB 1EIGA 2W9CB 1MJCA 2EYFA 1ML0D 1SNPA 1HFNA 4A3EB 1N32Q 1Y1VA 5IP7H 3NXWA 1PHJA 3T5JA 1E1TA 3QO2A 1H9MA 4EYIB 1B2TA 2VB3X 1M7JA 2V4RA 1O7IA 2F0SA 1CQVA 2A8VA 2CHBD 3PIPA 2LXKA 4DR2H 5IYCH 1MSGA 4M1UB 2AKWB 3HOZH 3K5HA 1RK6A 2F0GA 4Y7NH 1IOVA 4AQYQ 1IW7D 4JBKA 4FF2A 2VQDA 1PZID 3DEOA 3ND8A 2XIWA 3H4BA 2QW7A 3Q2OA 4RFBA 3SK5A 1SYFA 4P71A 1EQQA 1DONA 1DYQA 3T16A 5J39A 5C4XB 2AWNA 4O4IF 1HTLD 3CMEA 4GKKH 3E0JA 2A68C 3H0GA 3HKZG 3J7AV 5KT3A 1PRTF 3JC66 4GOPB 2AQ1B 3BA8A 3PMFA 1JB3A 2IHFA 4L1KA 4N9TA 2W6PA 2KECA 2R7ZA 2Y0SA 2NVTH 4YHHQ 1DOMA 1M0WA 2VA3A
chains in the Genus database with same CATH topology
1HNWQ 3U4VA 4GNXC 2AMCB 1OXXK 3M4QA 3FKIH 4JI5L 4A3IH 2OTLA 4LF4L 1NJIC 3RN5A 4DAYB 4A3KG 3M3YH 1HZ9A 1N34Q 1CKOA 4A3LH 2MO1A 2A19A 2D0PA 3PUXA 2E5LQ 4PZ8A 4JI4Q 4LFBL 1UE6A 1EQRA 1VQJA 4GN3B 3EIVA 3CCVA 1M90C 4LF5L 4GNXA 3ER0A 4JBWA 1VQOA 1HNXQ 2PNHA 1HH2P 1KL9A 3K8AA 3FHWA 2MO0A 5LMNQ 4DUYQ 4B3TL 1A8VA 2YYZA 1IBLL 2VS1A 1E1OA 1HZBA 1Z9FA 3PUZA 1TWCH 1G6PA 1UWVA 2K52A 2KHIA 4DR6Q 1Y1VG 1X56A 3W5OA 4X65L 2D0OA 1QUQA 1Q82C 4LF9Q 4HJ7A 2HHHQ 3S15H 1YJWA 2I5MX 3STBC 2UXDL 4EX5A 3S16H 2QEXA 4NXNQ 3AYHB 2KHJA 4PMWA 3ULJA 3PO3G 2CKZB 5IE8A 1PH1A 3CW2C 2JA5H 1WYDA 1NE3A 2K50A 5JEAG 4DV4Q 4GOPC 2KENA 2JK8A 4LUOA 2JEAI 1PVOA 4HJ5A 3F2BA 4B3RQ 4X62L 2JE6I 4KI0A 2C35B 4OONA 2XGTA 2ATWA 2PI2E 2R7FA 2RHQB 1IZ6A 3PUYA 3JAMc 4DV6L 2UUAL 2F4VQ 1VQ6A 5M3MH 5IP9H 3UDFA 3KDFA 4AIMA 4GOPA 2LXJA 4GN5A 3M4OH 2JJQA 2AHOB 4IO9A 4MNOA 4DR3L 4A3MG 1SE8A 4A4IA 1HR0Q 4JI3Q 3CAMA 3CD6A 2EXDA 3H0GG 1JJGA 4LF7Q 1CKMA 1NY4A 2JA6G 2R93H 2OTJA 4IJHA 4LNQA 1I94L 1P8LA 1G51A 3K80C 1XPRA 2R7ZG 1YIJA 4KHPQ 1X54A 4GLVB 3FP9A 4DKAC 4JI7L 2GN5A 1JJ2A 3L7ZC 5FLMG 2IX0A 3RNUA 4UY8C 1X3EA 4DR7Q 4LF8L 1IXRA 2JA7H 3UDIA 5C44G 3CCSA 2KCMA 4DV3L 3GTKH 2YTVA 1JE5A 1OXVA 3I2ZA 1B70B 4JI1L 4X66L 4DV2Q 1PH9A 3S1MH 3G71A 2ZTCA 4OWXB 5HY6A 4DAMA 3GDEA 4QJFA 4P72A 2ZM6L 2ID0A 1K0RA 4R4TA 4AYBE 4JC0A 2IX1A 3CP0A 3PF4A 3M85A 2B29A 4BBRG 3GTJH 3RLFA 3IRBA 3OTOL 3CCLA 4BY1H 1N32L 2PQAB 3M9BA 3CC4A 2R6GA 2YTXA 1L1OC 4IPGA 5FLXc 2JA8H 2BH8A 2JEBI 4AYBG 3CCUA 3CCEA 2FXQA 3Q8DA 3K7UC 1NTGA 2AWOA 4POFA 3KF6B 1IBKQ 3CC7A 2UUBL 3I4MG 2DGYA 5HGQA 4HIMA 4DR2Q 1SRUA 1E24A 1SMXA 3NBHB 1CUKA 1EOVA 1YZ6A 4A3KH 1VCIA 2GVBA 3HKSA 4L5QA 4LFCL 1CKNA 1L1OA 3D31A 2CCZA 4R1JA 1VQ8A 3I4NH 3KF8B 2L15A 1VQHA 2WP8J 4LUVA 3PO2G 3E9IA 3U50C 1FJGL 2N3SA 4NPSA 3HOVG 4DUZQ 1NBWA 1VQCA 3GD7A 4LF6Q 4NXML 5C4XG 1WOCA 2OQ0A 4C3IH 3KJPA 5JJKA 4IOCA 4GKKQ 3HOUG 1XPOA 1PYBA 4DV7L 1I5FA 1Y1VH 1JT8A 1VQIA 1W3SA 1TWHH 1PFSA 2VQEQ 3T1YQ 3K81C 4DR4Q 4C3HH 5M5XH 4BA2I 1QVGA 2OCEA 1BBWA 2N8NA 2XTIA 3HFZB 3T1HQ 2Q2UA 1WCMG 2ZJQA 4A76A 4JI6Q 1N33Q 3ICEA 3PO3H 1HNZL 4O0AA 2ASBA 4UP9A 3J81i 5GROA 1VQ7A 2LSSA 2N78A 2K5HA 2Q2TA 1HNWL 3JAMi 1Q46A 1L0WA 3S2HH 1P16A 2UU9Q 4PZ7A 3U58A 3PCOB 2UXCQ 1PH7A 3I7FA 4A3JG 3OYYA 4GKJQ 1N34L 1YHQA 3S1NH 2E5LL 4JI4L 4B3ML 2VQFQ 4JYAL 2UUCQ 5C0XJ 1K8GA 1Q7YC 5M5YH 4BY7G 1XMQQ 3RN2A 1QZGA 4APVA 1HNXL 4DK3C 4WJ3M 5JJIA 3K0XA 1A63A 1LM0A 3H0GH 3KOJA 2CWPA 5GQOA 4C2MH 3MXNB 5LMNL 4DUYL 4IPCA 4DV0Q 2JA6H 1JJCB 1EFWA 3CPFA 4B3SQ 1YHAA 2OQKA 4YCVA 1VQLA 1OXTA 4BXXG 2NVYH 3KF6A 2I5LX 4UPAA 1VQ5A 2R7ZH 4A3BH 4LF9L 4DR6L 3M4PA 4A3CG 1IBMQ 2HHHL 2K4KA 1BBUA 2I5HA 2RHSB 5FJ8G 4JV5Q 2MQHA 3GTLH 3ZJYC 1GM5A 1S3OA 5FLMH 1GD7A 1VQPA 4LFAQ 1X6OA 1E3PA 4IPDA 3CCQA 1VQBA 3S14H 5LMUQ 5C44H 2YU9H 4A3FG 4DV4L 2WFWA 2A1AA 2PMZE 4TVAB 3S1RH 4OO1G 4B3RL 4UP8A 4XTCS 5E7NA 3KJOA 1KD1C 1XPUA 4JBJA 2MNAA 1JMCA 1NMGA 1RL2A 3J81c 4OO1I 2F4VL 1V9PA 1K73C 2E8GA 3DM3A 1Q81C 4YWMA 4JI2Q 3J80c 3CF5A 1YEZA 3HOXG 4BBRH 4AH6A 1UE7A 1TXYA 2NN6G 4EQ5A 3J7A5 3I55A 4MZ9A 4JI3L 5K36G 1RIPA 1SR3A 1HR0L 3NEMA 3I56A 4K0KQ 3L2PA 3CCJA 1ASZA 1YVCA 4LF7L 1WI5A 2ALYB 1KC8C 2I0QA 2K75A 3G48A 2UXBL 1K3RA 3HOYH 4HIKA 2K5NA 3D0FA 3TEHB 1A0IA 4LWCA 4C3JH 4KHPL 5M5WH 1Y1WG 1Z47A 1WFQA 4OWWB 3PO2H 1I6HH 4GS3A 4DR7L 3BU2A 3RLNA 1YJNA 2IY5B 1FL0A 3HOVH 3UDGA 1GKHA 5C4XH 4JI0L 1VQGA 1GVPA 1VQEA 4YWLA 2R92G 1J5EQ 1OXUA 1XNQQ 3HOUH 4X64Q 3F8TA 1YITA 4DV2L 1VQ9A 2E2JH 1XNRQ 3MEFA 3ULPA 4X6AH 4JOIC 4DV1L 1PA6A 5IY0A 1VQNA 5C4JH 3GTPH 3W1BA 5GAEC 4DR5Q 3WWVA 2NVQH 1SN8A 4A3EG 2CWAA 3CMAA 1WCMH 1EUJA 4YWKA 1VQDA 5GADC 3L0OA 3UE0A 4QQBX 4JOIA 1V1QA 2KCTA 3BJUA 4JI7Q 1U0LA 4BA1I 5M3FG 1PH3A 1IBKL 1X3FA 1HZAA 5BR8Q 3S1QH 3PUWA 4JI8Q 1V43A 2YV5A 3GO5A 4DR2L 1XNRL 2JA9A 4A3JH 2OWOA 2QA4A 4WJ4A 4DR1Q 1FGUA 4DV3Q 2B63G 4OWTB 4BBSG 2Z6KC 3PSIA 4GLAC 1VQFA 3G4SA 2KBNA 5C0XG 1R9TH 4BY7H 1EWIA 4IJLA 2VUMG 3PUVA 4OX9Q 4R4IA 4H02A 4R4CA 4AQYL 2ZM6Q 3I4NG 3DLLA 5C0XI 2RF4A 2ZTDA 4Y52H 4R4QA 2VW9A 2EIFA 1BVSA 1TWAH 2JQOA 4DNIA 5EAYA 5IP9G 5IWAL 5AJ3L 2Z6KA 4R4OA 3GTMH 1B7YB 2HIXA 3STBD 5IYBG 1Q8KA 1YJ9A 1N36Q 1MJEA 4A3CH 4A75A 5FJ8H 2BA0A 1X55A 5C3EG 4YY3Q 1A62A 2BA1A 4HIOA 2VQEL 1EIYB 3T1YL 1AH9A 4DR4L 4MTNA 2NVXH 1SFOH 1TWFH 1QUQB 2MFIA 2Z0SA 3T1HL 3RZDH 4JI6L 1KXLA 1N9WA 5ELOA 3ERSX 1YI2A 1QZHA 3HOWG 3PGZA 2WAQE 4A3FH 4YHHL 3J80i 4DPGA 5DLQE 3M7NA 5IYDG 4DV5Q 1PH5A 4A93G 2UXCL 4QY7A 4GKJL 3CQZH 4IPHA 2WAQG 1W2BA 4TQUS 2F3IA 1XMOQ 1UEBA 4ME3A 2VQFL 1CSPA 3HOXH 2UUCL 4HJ9A 2CFMA 1LUZA 4HJ8A 3KDFB 4A3MH 1SROA 1UE5A 4PG3A 4B3SL 2PQAA 4A3GG 3J7ZC 3LGJA 3OW2A 4KLKA 1I3QH 1HNZQ 2NZHA 1X65A 1KRSA 1I50H 1C0AA 3PV0A 1Q12A 1IBML 3H15A 5IP7G 4JV5L 1Y1WH 2VZAA 5IT9c 1UE1A 2K14A 1Q1BA 4UP7A 3CCMA 2WB1E 1SLJA 3RLOA 3W1GA 4ALPA 2R7DA 2HQLA 4NXNL 1OTCA 1AE2A 2H5XA 4JI5Q 2N49A 4O2DA 1PH2A 4LF4Q 4OXPA 4LFAL 5GAHC 5LMUL 4XIGS 3S24A 3VDYA 2E2IH 2R92H 4A3DG 4B3MQ 1D7QA 4JYAQ 4IFDJ 3H3VI 3TS0A 3BZCA 1WJJA 3RR5A 5IYCG 1PV4A 3HOZG 2WB1G 4LFBQ 4LF5Q 2HT1A 1S40A 1X9NA 1N8RC 3KFUA 2VL6A 4A3EH 4B3TQ 3S2DH 4JI2L 4QGUA 3E0EA 2ZJRA 1Q86C 1IBLQ 3SGIA 3NELA 1J6QA 1MIUA 2V1CC 1IYJB 3B6YA 1TWGH 1KAWA 2Q2IA 1LTLA 4X65Q 3U4ZA 1VQMA 4K0KL 2UXDQ 1G291 5M3FH 3CPWA 3F1ZA 4JG2A 2NN6I 4P74A 3I4MH 1VS0A 3I4OA 4GN4B 1EYGA 1HJPA 2ZTEA 1OXSC 2B63H 2E2HH 4BBSH 3PIOA 1MKHA 2IT1A 2GVAA 1IL2A 1C7YA 3TS2A 4LUZA 1K83H 2VUMH 1CKNB 1L1OB 4X62Q 3A0JA 3FKIG 4A3IG 1QVCA 1FVIA 2QGQA 1KIXA 1H95A 1D8LA 1YBYA 1VQAA 4DV6Q 1J5EL 2UUAQ 1XNQL 4A3LG 3UDXA 4X64L 2ES2A 4P75A 3EBEA 1T9HA 2RCNA 1BKBA 1C9OA 5GAGC 1L2FA 5IYBH 4JBMA 4L5RC 2NZOA 4HJAA 2Y0SE 3NENA 5C3EH 3AEVA 4DR3Q 4JCVE 3AQQA 1E7ZA 4DR5L 2DUDA 4DK6C 2UXBQ 2EQSA 4QL5A 4L5SA 5H1SE 3HOWH 4A3BG 1NMFA 3KLWA 2Y0SG 5J3BA 1PH6A 2B3GA 1I94Q 4BXXH 1B8AA 3UE1A 5JJLA 1K9MC 3J81j 2BH2A 4QIWE 3TRZA 1Y14B 5BR8L 5LMNW 3GTOH 5IYDH 4JI8L 4A93H 1XTDA 4LF8Q 1YNXA 4GLXA 1PH8A 4JI0Q 3CXCA 4LW1A 1XJVA 4DR1L 2VY3A 4RMFA 1K8AC 2JA5G 1KHIA 4RG1A 5JEAJ 1PH4A 4JI1Q 1LYLA 2F52A 3F2CA 4X66Q 4HIDA 3AFQA 4DV1Q 1VQ4A 4OX9L 1EIFA 1PYSB 3AFPA 4NB3A 3E9HA 4GKKL 2ZJPA 2K5VA 4DUZL 1U5KA 4GNXB 2UU9L 4POGA 4A3GH 1MJCA 1Q1EA 4YCWA 3GTGH 3PF5A 5M3MG 3G6EA 3KYHC 4L5TA 1N36L 3OTOQ 1DGSA 1E22A 1N32Q 5IP7H 4YY3L 1PHJA 2IHEA 3BZKA 1E1TA 1X3GA 4YCUA 3K7AH 1ASYA 2R93G 3H3VH 3HOYG 3ULLA 3F2DA 2UUBQ 4LF6L 2YTYA 1VQKA 1O7IA 3A5UA 1JB7A 1N33L 1S72A 2A8VA 3PIPA 4A3DH 4P73A 2LXKA 4LFCQ 5IYCH 4IFDG 4IOAA 2AKWB 1HR0W 3HOZH 1YHBA 4Y7NH 4KHZA 4AQYQ 4DV5L 1CSQA 1KRTA 1M1KC 3TREA 4JBKA 1FJGQ 4PZ6A 1KQSA 4IFDI 3HKZE 4NXMQ 1XMOL 3S17H 5IWAQ 4P71A 5AJ3Q 1EQQA 2JA7G 1HZCA 3CC2A 3TQYA 2AWNA 1XMQL 3CMEA 4DV7Q 3CCRA 2PI2A 3HKZG 2HIVA 1AE3A 4GOPB 3JC66 4FDBA 1QVFA 2D62A 4J15A 4DV0L 3EN2A 3GTQH 3A74A 2IHFA 5ELNA 2Q2HA 3A5ZB 3RZOH 2VNUD 4BY1G 2NVTH 4YHHQ 2CQOA 2JA8G 1GO3E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HNW Q;  3U4V A;  4GNX C;  2AMC B;  1OXX K;  3M4Q A;  3FKI H;  4JI5 L;  4A3I H;  2OTL A;  4LF4 L;  1NJI C;  3RN5 A;  4DAY B;  4A3K G;  3M3Y H;  1HZ9 A;  1N34 Q;  1CKO A;  4A3L H;  2MO1 A;  2A19 A;  2D0P A;  3PUX A;  2E5L Q;  4PZ8 A;  4JI4 Q;  4LFB L;  1UE6 A;  1EQR A;  1VQJ A;  4GN3 B;  3EIV A;  3CCV A;  1M90 C;  4LF5 L;  4GNX A;  3ER0 A;  4JBW A;  1VQO A;  1HNX Q;  2PNH A;  1HH2 P;  1KL9 A;  3K8A A;  3FHW A;  2MO0 A;  5LMN Q;  4DUY Q;  4B3T L;  1A8V A;  2YYZ A;  1IBL L;  2VS1 A;  1E1O A;  1HZB A;  1Z9F A;  3PUZ A;  1TWC H;  1G6P A;  1UWV A;  2K52 A;  2KHI A;  4DR6 Q;  1Y1V G;  1X56 A;  3W5O A;  4X65 L;  2D0O A;  1QUQ A;  1Q82 C;  4LF9 Q;  4HJ7 A;  2HHH Q;  3S15 H;  1YJW A;  2I5M X;  3STB C;  2UXD L;  4EX5 A;  3S16 H;  2QEX A;  4NXN Q;  3AYH B;  2KHJ A;  4PMW A;  3ULJ A;  3PO3 G;  2CKZ B;  5IE8 A;  1PH1 A;  3CW2 C;  2JA5 H;  1WYD A;  1NE3 A;  2K50 A;  5JEA G;  4DV4 Q;  4GOP C;  2KEN A;  2JK8 A;  4LUO A;  2JEA I;  1PVO A;  4HJ5 A;  3F2B A;  4B3R Q;  4X62 L;  2JE6 I;  4KI0 A;  2C35 B;  4OON A;  2XGT A;  2ATW A;  2PI2 E;  2R7F A;  2RHQ B;  1IZ6 A;  3PUY A;  3JAM c;  4DV6 L;  2UUA L;  2F4V Q;  1VQ6 A;  5M3M H;  5IP9 H;  3UDF A;  3KDF A;  4AIM A;  4GOP A;  2LXJ A;  4GN5 A;  3M4O H;  2JJQ A;  2AHO B;  4IO9 A;  4MNO A;  4DR3 L;  4A3M G;  1SE8 A;  4A4I A;  1HR0 Q;  4JI3 Q;  3CAM A;  3CD6 A;  2EXD A;  3H0G G;  1JJG A;  4LF7 Q;  1CKM A;  1NY4 A;  2JA6 G;  2R93 H;  2OTJ A;  4IJH A;  4LNQ A;  1I94 L;  1P8L A;  1G51 A;  3K80 C;  1XPR A;  2R7Z G;  1YIJ A;  4KHP Q;  1X54 A;  4GLV B;  3FP9 A;  4DKA C;  4JI7 L;  2GN5 A;  1JJ2 A;  3L7Z C;  5FLM G;  2IX0 A;  3RNU A;  4UY8 C;  1X3E A;  4DR7 Q;  4LF8 L;  1IXR A;  2JA7 H;  3UDI A;  5C44 G;  3CCS A;  2KCM A;  4DV3 L;  3GTK H;  2YTV A;  1JE5 A;  1OXV A;  3I2Z A;  1B70 B;  4JI1 L;  4X66 L;  4DV2 Q;  1PH9 A;  3S1M H;  3G71 A;  2ZTC A;  4OWX B;  5HY6 A;  4DAM A;  3GDE A;  4QJF A;  4P72 A;  2ZM6 L;  2ID0 A;  1K0R A;  4R4T A;  4AYB E;  4JC0 A;  2IX1 A;  3CP0 A;  3PF4 A;  3M85 A;  2B29 A;  4BBR G;  3GTJ H;  3RLF A;  3IRB A;  3OTO L;  3CCL A;  4BY1 H;  1N32 L;  2PQA B;  3M9B A;  3CC4 A;  2R6G A;  2YTX A;  1L1O C;  4IPG A;  5FLX c;  2JA8 H;  2BH8 A;  2JEB I;  4AYB G;  3CCU A;  3CCE A;  2FXQ A;  3Q8D A;  3K7U C;  1NTG A;  2AWO A;  4POF A;  3KF6 B;  1IBK Q;  3CC7 A;  2UUB L;  3I4M G;  2DGY A;  5HGQ A;  4HIM A;  4DR2 Q;  1SRU A;  1E24 A;  1SMX A;  3NBH B;  1CUK A;  1EOV A;  1YZ6 A;  4A3K H;  1VCI A;  2GVB A;  3HKS A;  4L5Q A;  4LFC L;  1CKN A;  1L1O A;  3D31 A;  2CCZ A;  4R1J A;  1VQ8 A;  3I4N H;  3KF8 B;  2L15 A;  1VQH A;  2WP8 J;  4LUV A;  3PO2 G;  3E9I A;  3U50 C;  1FJG L;  2N3S A;  4NPS A;  3HOV G;  4DUZ Q;  1NBW A;  1VQC A;  3GD7 A;  4LF6 Q;  4NXM L;  5C4X G;  1WOC A;  2OQ0 A;  4C3I H;  3KJP A;  5JJK A;  4IOC A;  4GKK Q;  3HOU G;  1XPO A;  1PYB A;  4DV7 L;  1I5F A;  1Y1V H;  1JT8 A;  1VQI A;  1W3S A;  1TWH H;  1PFS A;  2VQE Q;  3T1Y Q;  3K81 C;  4DR4 Q;  4C3H H;  5M5X H;  4BA2 I;  1QVG A;  2OCE A;  1BBW A;  2N8N A;  2XTI A;  3HFZ B;  3T1H Q;  2Q2U A;  1WCM G;  2ZJQ A;  4A76 A;  4JI6 Q;  1N33 Q;  3ICE A;  3PO3 H;  1HNZ L;  4O0A A;  2ASB A;  4UP9 A;  3J81 i;  5GRO A;  1VQ7 A;  2LSS A;  2N78 A;  2K5H A;  2Q2T A;  1HNW L;  3JAM i;  1Q46 A;  1L0W A;  3S2H H;  1P16 A;  2UU9 Q;  4PZ7 A;  3U58 A;  3PCO B;  2UXC Q;  1PH7 A;  3I7F A;  4A3J G;  3OYY A;  4GKJ Q;  1N34 L;  1YHQ A;  3S1N H;  2E5L L;  4JI4 L;  4B3M L;  2VQF Q;  4JYA L;  2UUC Q;  5C0X J;  1K8G A;  1Q7Y C;  5M5Y H;  4BY7 G;  1XMQ Q;  3RN2 A;  1QZG A;  4APV A;  1HNX L;  4DK3 C;  4WJ3 M;  5JJI A;  3K0X A;  1A63 A;  1LM0 A;  3H0G H;  3KOJ A;  2CWP A;  5GQO A;  4C2M H;  3MXN B;  5LMN L;  4DUY L;  4IPC A;  4DV0 Q;  2JA6 H;  1JJC B;  1EFW A;  3CPF A;  4B3S Q;  1YHA A;  2OQK A;  4YCV A;  1VQL A;  1OXT A;  4BXX G;  2NVY H;  3KF6 A;  2I5L X;  4UPA A;  1VQ5 A;  2R7Z H;  4A3B H;  4LF9 L;  4DR6 L;  3M4P A;  4A3C G;  1IBM Q;  2HHH L;  2K4K A;  1BBU A;  2I5H A;  2RHS B;  5FJ8 G;  4JV5 Q;  2MQH A;  3GTL H;  3ZJY C;  1GM5 A;  1S3O A;  5FLM H;  1GD7 A;  1VQP A;  4LFA Q;  1X6O A;  1E3P A;  4IPD A;  3CCQ A;  1VQB A;  3S14 H;  5LMU Q;  5C44 H;  2YU9 H;  4A3F G;  4DV4 L;  2WFW A;  2A1A A;  2PMZ E;  4TVA B;  3S1R H;  4OO1 G;  4B3R L;  4UP8 A;  4XTC S;  5E7N A;  3KJO A;  1KD1 C;  1XPU A;  4JBJ A;  2MNA A;  1JMC A;  1NMG A;  1RL2 A;  3J81 c;  4OO1 I;  2F4V L;  1V9P A;  1K73 C;  2E8G A;  3DM3 A;  1Q81 C;  4YWM A;  4JI2 Q;  3J80 c;  3CF5 A;  1YEZ A;  3HOX G;  4BBR H;  4AH6 A;  1UE7 A;  1TXY A;  2NN6 G;  4EQ5 A;  3J7A 5;  3I55 A;  4MZ9 A;  4JI3 L;  5K36 G;  1RIP A;  1SR3 A;  1HR0 L;  3NEM A;  3I56 A;  4K0K Q;  3L2P A;  3CCJ A;  1ASZ A;  1YVC A;  4LF7 L;  1WI5 A;  2ALY B;  1KC8 C;  2I0Q A;  2K75 A;  3G48 A;  2UXB L;  1K3R A;  3HOY H;  4HIK A;  2K5N A;  3D0F A;  3TEH B;  1A0I A;  4LWC A;  4C3J H;  4KHP L;  5M5W H;  1Y1W G;  1Z47 A;  1WFQ A;  4OWW B;  3PO2 H;  1I6H H;  4GS3 A;  4DR7 L;  3BU2 A;  3RLN A;  1YJN A;  2IY5 B;  1FL0 A;  3HOV H;  3UDG A;  1GKH A;  5C4X H;  4JI0 L;  1VQG A;  1GVP A;  1VQE A;  4YWL A;  2R92 G;  1J5E Q;  1OXU A;  1XNQ Q;  3HOU H;  4X64 Q;  3F8T A;  1YIT A;  4DV2 L;  1VQ9 A;  2E2J H;  1XNR Q;  3MEF A;  3ULP A;  4X6A H;  4JOI C;  4DV1 L;  1PA6 A;  5IY0 A;  1VQN A;  5C4J H;  3GTP H;  3W1B A;  5GAE C;  4DR5 Q;  3WWV A;  2NVQ H;  1SN8 A;  4A3E G;  2CWA A;  3CMA A;  1WCM H;  1EUJ A;  4YWK A;  1VQD A;  5GAD C;  3L0O A;  3UE0 A;  4QQB X;  4JOI A;  1V1Q A;  2KCT A;  3BJU A;  4JI7 Q;  1U0L A;  4BA1 I;  5M3F G;  1PH3 A;  1IBK L;  1X3F A;  1HZA A;  5BR8 Q;  3S1Q H;  3PUW A;  4JI8 Q;  1V43 A;  2YV5 A;  3GO5 A;  4DR2 L;  1XNR L;  2JA9 A;  4A3J H;  2OWO A;  2QA4 A;  4WJ4 A;  4DR1 Q;  1FGU A;  4DV3 Q;  2B63 G;  4OWT B;  4BBS G;  2Z6K C;  3PSI A;  4GLA C;  1VQF A;  3G4S A;  2KBN A;  5C0X G;  1R9T H;  4BY7 H;  1EWI A;  4IJL A;  2VUM G;  3PUV A;  4OX9 Q;  4R4I A;  4H02 A;  4R4C A;  4AQY L;  2ZM6 Q;  3I4N G;  3DLL A;  5C0X I;  2RF4 A;  2ZTD A;  4Y52 H;  4R4Q A;  2VW9 A;  2EIF A;  1BVS A;  1TWA H;  2JQO A;  4DNI A;  5EAY A;  5IP9 G;  5IWA L;  5AJ3 L;  2Z6K A;  4R4O A;  3GTM H;  1B7Y B;  2HIX A;  3STB D;  5IYB G;  1Q8K A;  1YJ9 A;  1N36 Q;  1MJE A;  4A3C H;  4A75 A;  5FJ8 H;  2BA0 A;  1X55 A;  5C3E G;  4YY3 Q;  1A62 A;  2BA1 A;  4HIO A;  2VQE L;  1EIY B;  3T1Y L;  1AH9 A;  4DR4 L;  4MTN A;  2NVX H;  1SFO H;  1TWF H;  1QUQ B;  2MFI A;  2Z0S A;  3T1H L;  3RZD H;  4JI6 L;  1KXL A;  1N9W A;  5ELO A;  3ERS X;  1YI2 A;  1QZH A;  3HOW G;  3PGZ A;  2WAQ E;  4A3F H;  4YHH L;  3J80 i;  4DPG A;  5DLQ E;  3M7N A;  5IYD G;  4DV5 Q;  1PH5 A;  4A93 G;  2UXC L;  4QY7 A;  4GKJ L;  3CQZ H;  4IPH A;  2WAQ G;  1W2B A;  4TQU S;  2F3I A;  1XMO Q;  1UEB A;  4ME3 A;  2VQF L;  1CSP A;  3HOX H;  2UUC L;  4HJ9 A;  2CFM A;  1LUZ A;  4HJ8 A;  3KDF B;  4A3M H;  1SRO A;  1UE5 A;  4PG3 A;  4B3S L;  2PQA A;  4A3G G;  3J7Z C;  3LGJ A;  3OW2 A;  4KLK A;  1I3Q H;  1HNZ Q;  2NZH A;  1X65 A;  1KRS A;  1I50 H;  1C0A A;  3PV0 A;  1Q12 A;  1IBM L;  3H15 A;  5IP7 G;  4JV5 L;  1Y1W H;  2VZA A;  5IT9 c;  1UE1 A;  2K14 A;  1Q1B A;  4UP7 A;  3CCM A;  2WB1 E;  1SLJ A;  3RLO A;  3W1G A;  4ALP A;  2R7D A;  2HQL A;  4NXN L;  1OTC A;  1AE2 A;  2H5X A;  4JI5 Q;  2N49 A;  4O2D A;  1PH2 A;  4LF4 Q;  4OXP A;  4LFA L;  5GAH C;  5LMU L;  4XIG S;  3S24 A;  3VDY A;  2E2I H;  2R92 H;  4A3D G;  4B3M Q;  1D7Q A;  4JYA Q;  4IFD J;  3H3V I;  3TS0 A;  3BZC A;  1WJJ A;  3RR5 A;  5IYC G;  1PV4 A;  3HOZ G;  2WB1 G;  4LFB Q;  4LF5 Q;  2HT1 A;  1S40 A;  1X9N A;  1N8R C;  3KFU A;  2VL6 A;  4A3E H;  4B3T Q;  3S2D H;  4JI2 L;  4QGU A;  3E0E A;  2ZJR A;  1Q86 C;  1IBL Q;  3SGI A;  3NEL A;  1J6Q A;  1MIU A;  2V1C C;  1IYJ B;  3B6Y A;  1TWG H;  1KAW A;  2Q2I A;  1LTL A;  4X65 Q;  3U4Z A;  1VQM A;  4K0K L;  2UXD Q;  1G29 1;  5M3F H;  3CPW A;  3F1Z A;  4JG2 A;  2NN6 I;  4P74 A;  3I4M H;  1VS0 A;  3I4O A;  4GN4 B;  1EYG A;  1HJP A;  2ZTE A;  1OXS C;  2B63 H;  2E2H H;  4BBS H;  3PIO A;  1MKH A;  2IT1 A;  2GVA A;  1IL2 A;  1C7Y A;  3TS2 A;  4LUZ A;  1K83 H;  2VUM H;  1CKN B;  1L1O B;  4X62 Q;  3A0J A;  3FKI G;  4A3I G;  1QVC A;  1FVI A;  2QGQ A;  1KIX A;  1H95 A;  1D8L A;  1YBY A;  1VQA A;  4DV6 Q;  1J5E L;  2UUA Q;  1XNQ L;  4A3L G;  3UDX A;  4X64 L;  2ES2 A;  4P75 A;  3EBE A;  1T9H A;  2RCN A;  1BKB A;  1C9O A;  5GAG C;  1L2F A;  5IYB H;  4JBM A;  4L5R C;  2NZO A;  4HJA A;  2Y0S E;  3NEN A;  5C3E H;  3AEV A;  4DR3 Q;  4JCV E;  3AQQ A;  1E7Z A;  4DR5 L;  2DUD A;  4DK6 C;  2UXB Q;  2EQS A;  4QL5 A;  4L5S A;  5H1S E;  3HOW H;  4A3B G;  1NMF A;  3KLW A;  2Y0S G;  5J3B A;  1PH6 A;  2B3G A;  1I94 Q;  4BXX H;  1B8A A;  3UE1 A;  5JJL A;  1K9M C;  3J81 j;  2BH2 A;  4QIW E;  3TRZ A;  1Y14 B;  5BR8 L;  5LMN W;  3GTO H;  5IYD H;  4JI8 L;  4A93 H;  1XTD A;  4LF8 Q;  1YNX A;  4GLX A;  1PH8 A;  4JI0 Q;  3CXC A;  4LW1 A;  1XJV A;  4DR1 L;  2VY3 A;  4RMF A;  1K8A C;  2JA5 G;  1KHI A;  4RG1 A;  5JEA J;  1PH4 A;  4JI1 Q;  1LYL A;  2F52 A;  3F2C A;  4X66 Q;  4HID A;  3AFQ A;  4DV1 Q;  1VQ4 A;  4OX9 L;  1EIF A;  1PYS B;  3AFP A;  4NB3 A;  3E9H A;  4GKK L;  2ZJP A;  2K5V A;  4DUZ L;  1U5K A;  4GNX B;  2UU9 L;  4POG A;  4A3G H;  1MJC A;  1Q1E A;  4YCW A;  3GTG H;  3PF5 A;  5M3M G;  3G6E A;  3KYH C;  4L5T A;  1N36 L;  3OTO Q;  1DGS A;  1E22 A;  1N32 Q;  5IP7 H;  4YY3 L;  1PHJ A;  2IHE A;  3BZK A;  1E1T A;  1X3G A;  4YCU A;  3K7A H;  1ASY A;  2R93 G;  3H3V H;  3HOY G;  3ULL A;  3F2D A;  2UUB Q;  4LF6 L;  2YTY A;  1VQK A;  1O7I A;  3A5U A;  1JB7 A;  1N33 L;  1S72 A;  2A8V A;  3PIP A;  4A3D H;  4P73 A;  2LXK A;  4LFC Q;  5IYC H;  4IFD G;  4IOA A;  2AKW B;  1HR0 W;  3HOZ H;  1YHB A;  4Y7N H;  4KHZ A;  4AQY Q;  4DV5 L;  1CSQ A;  1KRT A;  1M1K C;  3TRE A;  4JBK A;  1FJG Q;  4PZ6 A;  1KQS A;  4IFD I;  3HKZ E;  4NXM Q;  1XMO L;  3S17 H;  5IWA Q;  4P71 A;  5AJ3 Q;  1EQQ A;  2JA7 G;  1HZC A;  3CC2 A;  3TQY A;  2AWN A;  1XMQ L;  3CME A;  4DV7 Q;  3CCR A;  2PI2 A;  3HKZ G;  2HIV A;  1AE3 A;  4GOP B;  3JC6 6;  4FDB A;  1QVF A;  2D62 A;  4J15 A;  4DV0 L;  3EN2 A;  3GTQ H;  3A74 A;  2IHF A;  5ELN A;  2Q2H A;  3A5Z B;  3RZO H;  2VNU D;  4BY1 G;  2NVT H;  4YHH Q;  2CQO A;  2JA8 G;  1GO3 E; 
#chains in the Genus database with same CATH topology
 2K03 A;  2DIK A;  5CC4 A;  2F0K A;  2HGS A;  4PDB A;  3DMU A;  3V6J A;  1PMR A;  1S03 G;  5IT9 E;  2AUJ D;  3RN5 A;  1MHW C;  2OLS A;  1CKO A;  4A3L H;  1ZEQ X;  1PFB A;  2D0P A;  1EEI D;  5I4D A;  3U9O A;  4GN3 B;  4A3J B;  1GSH A;  4ZK9 B;  4JBW A;  1VQO A;  4MV3 A;  2K32 A;  2UUC H;  3K8A A;  4MV8 A;  3EYY A;  3F8N A;  1FGB D;  1XMQ H;  2MO0 A;  4B3T L;  2XRS D;  1IKL A;  3I91 A;  2QEJ C;  1Z9F A;  3PUZ A;  3G8C A;  1G6P A;  2CW0 C;  3OWE B;  4DV0 H;  4DR6 Q;  4X65 L;  1QUQ A;  2UXD L;  4HJ7 A;  2QK4 A;  2W6O A;  3STB C;  4EX5 A;  3J80 E;  2QEX A;  4ID6 A;  4G7Z C;  3AYH B;  1PH1 A;  4RCN A;  2JA5 H;  3NWS A;  3TSS A;  4LFA H;  2KEN A;  4A3D B;  2ZXO A;  2JEA I;  4X62 L;  5K2M A;  4KI0 A;  5NUC A;  4FF4 A;  2EE1 A;  2ATW A;  4RA8 A;  2RHQ B;  1F2M A;  3PUY A;  2F0D A;  1WTO A;  1VQ6 A;  2B2Y A;  1STG A;  2F1M A;  1ENC A;  1II3 A;  3DWP A;  3UDF A;  5M3M H;  4O2A F;  3CQZ B;  3S17 B;  2HVR A;  4GN5 A;  1E2Z A;  3D6W A;  3M4O H;  2AHO B;  4JI3 Q;  1RYS A;  1SE8 A;  4DL7 A;  3CAM A;  2CH4 A;  3HG9 A;  4LF7 Q;  1PTO H;  1WCM A;  4O3S A;  4K0K H;  5KFB A;  3WOE A;  3K80 C;  3BS1 A;  2B2U A;  1JC7 A;  4GLV B;  3TP5 A;  4DKA C;  4JI7 L;  2GN5 A;  1JJ2 A;  1DIK A;  1G8Z D;  1HCZ A;  5K5P A;  5FLM G;  3RNU A;  5KYL A;  5I2X A;  1OO9 B;  4DR7 Q;  3PW5 A;  3RAX A;  3H09 A;  2D2C C;  4APM A;  2KOL A;  1SE2 A;  2JA7 H;  4DV3 L;  1KLG D;  1V4Y A;  4G57 A;  4M7E A;  1I4Q A;  3G71 A;  2W9B A;  1J5E H;  2RQX A;  2ENB A;  4UFZ A;  2ZM6 L;  2ID0 A;  3Q8R B;  4R4T A;  2ATL A;  3CP0 A;  3PF4 A;  3M85 A;  5IGD A;  3OHA A;  3DUZ A;  2KCC A;  1N32 L;  1DM0 B;  2PQA B;  4EGV A;  1S5B D;  3ORR A;  1BOS A;  1TWC B;  3CC4 A;  2YTX A;  3VR5 A;  2F0I A;  2JA8 H;  2JP1 A;  2JEB I;  4AYB G;  3K7U C;  1IBK Q;  2NVX A;  1K28 A;  1GUT A;  4KMU C;  2F0E A;  3CC7 A;  4EGJ A;  3SXH A;  1VDZ A;  5KKN B;  5CV5 A;  1W6J A;  5BR8 H;  4DL3 A;  1L1O A;  2Z4H A;  4R1J A;  4RGN A;  3I4N H;  3KF8 B;  3W2D A;  2L15 A;  3BYY B;  3PO2 G;  4ED2 A;  4ECR A;  3E9I A;  3P7J A;  3U50 C;  2B63 B;  3GIQ A;  3I12 A;  2N3S A;  3HOV G;  4QUC A;  1VQC A;  3GD7 A;  5KT2 A;  3G6V A;  1G2T A;  1PZK D;  3KJP A;  3I90 A;  5T1G A;  1W96 A;  1ULZ A;  2XVS A;  1JT8 A;  4QMG A;  1VQI A;  1TWH H;  2NBF A;  2A74 C;  3T1Y Q;  1IOW A;  4DR4 Q;  2F0O A;  5M5X H;  2YYA A;  1QVG A;  2MHV A;  3HFZ B;  3SHL A;  1N33 Q;  4A76 A;  3PO3 H;  5KG6 A;  1I50 A;  3J81 i;  3NBI A;  1TA8 A;  5KFV A;  5GRO A;  3ZYY X;  4IRD A;  2WII B;  2JEJ A;  1Y1W A;  3IFD A;  4NMZ A;  1S9F A;  1B4O A;  4FNF A;  2LS0 1;  5E4X A;  2NU8 B;  2EXZ A;  3N43 B;  4PZ7 A;  3U58 A;  2UXC Q;  1WSC A;  4I4T F;  4MAM A;  1BXT A;  2R92 A;  3R8B A;  1PFM A;  3S1N H;  2F0P A;  3N6X A;  3KHL A;  4B3M L;  2VQF Q;  4BY7 G;  1NCV A;  1BBX C;  4B08 A;  3RN2 A;  5JJI A;  3O13 A;  3MXP A;  4RCO A;  2EVB A;  1WTW A;  3S1M B;  1WVL A;  2CWP A;  4CKE A;  3MXN B;  2QYZ A;  2JA6 H;  4QUF A;  3FPP A;  1SJH D;  2OQK A;  2NVY H;  3UI2 A;  3KF6 A;  2I5L X;  4UPA A;  4DR6 L;  4A3G B;  1RD9 D;  4A3C G;  4HMI A;  1HNZ H;  5EQ0 A;  3NBH A;  4BY1 B;  4JV5 Q;  2MQH A;  3ZJY C;  1GM5 A;  1GD7 A;  4HED A;  4EQN A;  1HRJ A;  1X6O A;  1S5F D;  2E2H A;  1M6V A;  1QWY A;  4MA5 A;  1H9S B;  3S1R H;  4OO1 G;  1BF4 A;  2VUM A;  4XTC S;  3KJO A;  1XPU A;  5EBD A;  1NMG A;  1AZQ A;  1KC7 A;  4EFB A;  3WNZ A;  1Q81 C;  4YWM A;  2OH2 A;  3HOX G;  4XQN A;  2V5A A;  4HSV A;  4B3T H;  2VR1 A;  4JI3 L;  1CHQ D;  1SR3 A;  4X3K A;  3I56 A;  3L2P A;  3CCJ A;  1Y1V B;  1ASZ A;  4LF7 L;  2SNM A;  4X65 H;  2JN4 A;  3D4D A;  2UXB L;  3GIK A;  2UXD H;  4C3H B;  3E6Z X;  2R6F A;  5M5W H;  3HB9 A;  2I07 B;  4J9S A;  5CBA E;  4TV9 F;  4J1M A;  1W93 A;  2EYM A;  1T94 A;  3GTO A;  3QOJ A;  4DAY A;  4DR7 L;  3SK6 A;  5KFN A;  4K6D A;  4L63 B;  1GKH A;  3S2H B;  5KT6 A;  2K5D A;  4X62 H;  4YWL A;  4A3I B;  4UCS A;  1XNR Q;  4IRC A;  2F4I A;  1R9T A;  1NAP A;  4JOI C;  1WTP A;  5DQG A;  1UC9 A;  3W1B A;  3H4D A;  4A3E G;  3BZD B;  5EOY A;  3H0G B;  1SYX B;  3V96 A;  1C48 A;  4QQB X;  4MV1 A;  1V1Q A;  1Z2P X;  3A7A B;  1TR5 A;  3BJU A;  4A3B B;  2R7Z B;  2Y0S B;  1PH3 A;  1A15 A;  1IBK L;  4U67 3;  3HEJ A;  2CQA A;  3IAY A;  3S1Q H;  5EWG A;  1HTP A;  1VAJ A;  3BDC A;  2Z8L A;  5A2Q E;  2OWO A;  2PBZ A;  2QA4 A;  5I6Y A;  2RDJ A;  4RB1 A;  4QWE A;  4HAE A;  4KTA A;  2R61 A;  1VQF A;  4V0B A;  5C0X G;  3SK4 A;  4EQP A;  3G4S A;  1EWI A;  4IJL A;  3ERO A;  4H44 C;  2C9O A;  2F0J A;  3PUV A;  4R4I A;  2ZJT A;  3DLL A;  2RF4 A;  2KED A;  3A7L A;  2L5T A;  5AJ3 L;  2Z6K A;  3SVM A;  5ELC A;  3D4W A;  5IYB G;  4YBZ B;  2B2T C;  5KFQ A;  4R8N A;  3J81 L;  1AP0 A;  3T1Y L;  1N32 H;  4DR4 L;  3GQB A;  1X3P A;  5KG5 A;  1TWF H;  1QUQ B;  2G9D A;  4FXD A;  1YI2 A;  1QZH A;  1KXL A;  4Q45 A;  2OT2 A;  2CH4 W;  1ONL A;  4A3F H;  2KVM A;  5LOV F;  5JQW A;  5EPL A;  3J80 i;  2YRX A;  1D6E C;  5DLQ E;  5IYD G;  3CRK C;  3TN2 A;  4A93 G;  1EEF D;  2UXC L;  1LT6 D;  4QY7 A;  2C2R A;  4AQY H;  2VA2 A;  3NTH A;  2VQF L;  2WV6 D;  5LA6 F;  2CFM A;  2K6A A;  1HUN A;  5HV6 A;  1M8A A;  3VPD A;  3HOU B;  2M2L A;  4HJ8 A;  4RNM A;  5ISR A;  2RGV A;  4XT1 B;  4C1N K;  1QB5 D;  2HCC A;  3LGJ A;  3ND9 A;  4OL7 A;  4DK1 A;  2R7N A;  4HYK A;  1RCV D;  2NZH A;  1WCM B;  5EPJ A;  4F8M A;  1TWG A;  4HQ6 A;  2ASL A;  1NR2 A;  4JV5 L;  1TII D;  2O4X A;  1Q1B A;  3CCM A;  4YHH H;  3W1G A;  3GTL H;  4ALP A;  4NXN L;  2N49 A;  4OXP A;  2SEB D;  3DM1 A;  1D7Q A;  2E2I H;  2JA5 A;  4FXK C;  4A3D G;  3OHB A;  3V2T A;  3H3V I;  5FLX L;  2J7Z A;  3BZC A;  3RR5 A;  4LFB Q;  1BNZ A;  2HT1 A;  1YNJ D;  4S3S A;  4XT3 B;  1NNX A;  1TQO A;  1HXY D;  4FBT A;  3KFU A;  5D14 A;  2W9B B;  3S2D H;  1BCP B;  1I4P A;  3ORQ A;  1PK8 A;  4ED8 A;  3DEP A;  2RA4 A;  4PWQ A;  3VR6 A;  5C3W A;  2VOB A;  3MWD A;  5L1L A;  3QR8 A;  3VPC A;  1F9P A;  1V8Q A;  2RBM A;  1XYI A;  4DR6 H;  1EQT A;  3C3L A;  5L1I A;  2NVX B;  1BR9 A;  3BG3 A;  2EY1 A;  1OXS C;  3KUP A;  4V19 0;  2IT1 A;  2GVA A;  1GSA A;  2B8G A;  3RUP A;  1STY A;  1L1O B;  5DNF A;  4J6H A;  1QVC A;  1Z7T A;  2QGQ A;  4CKC A;  1D8L A;  2JA7 A;  1YBY A;  1PDQ A;  4DV6 Q;  1CZW A;  3UDX A;  1XNR L;  1LTB D;  2RCN A;  1C9O A;  5GAG C;  4L5R C;  3CU7 A;  3Q1K A;  1GSO A;  2NZO A;  2W6Q A;  2Y0S E;  3NEN A;  4JCV E;  3AQQ A;  3P20 A;  1E7Z A;  2K5Q A;  5M5Y B;  4JI3 H;  2EQS A;  3FMC A;  4MA0 A;  5H1S E;  3HOW H;  1KDB A;  1NMF A;  3KLW A;  3MWY W;  4ZAI A;  3Q0A A;  4LF7 H;  5HUR A;  4FM9 A;  1N56 A;  5EDW A;  4RGT A;  1ET6 A;  5EGT A;  3TIN A;  4QIW E;  5FD6 A;  4K2L A;  1EU3 A;  2PZU A;  4BS9 A;  1Y1W B;  2FJZ A;  1E2W A;  4JI0 Q;  1SEI A;  4DR7 H;  1CA6 A;  2VY3 A;  4FP5 D;  4YIJ A;  5I9O A;  5IT9 L;  1K8A C;  3L4K A;  2AUK A;  1JOQ A;  2FMM A;  5KX5 F;  1U4P A;  1ZYR D;  2R92 B;  3S14 B;  1STN A;  4DV1 Q;  2B2W C;  3AFP A;  4HSP A;  3RB6 A;  1JWS D;  4POG A;  3L4J A;  1S5D D;  5FLX W;  3PF5 A;  3ITP A;  2PO4 A;  2VPS A;  3G6E A;  3KYH C;  5EKL A;  3LP8 A;  2LFN A;  4L5T A;  1LO5 D;  2BDN A;  1NR4 A;  1E22 A;  2K1B A;  2K28 A;  3OTO Q;  4TV8 F;  1TWH A;  3BZK A;  3OHX C;  1X3G A;  5KFI A;  3I4L A;  2XGQ A;  4IWX A;  3T5K A;  3F2D A;  3J80 L;  2YTY A;  3FRP B;  2XCP A;  3K5L A;  1JB7 A;  1IBK H;  1S72 A;  2UVV A;  1KBL A;  4N8X 1;  4LFC Q;  5CBE E;  4IFD G;  4XDX A;  3U9T A;  1SAP A;  1YHB A;  2E2H B;  1M1K C;  2EY2 A;  1HA6 A;  1CQI B;  4HR7 A;  3AB9 A;  4P2C B;  2VUM B;  5CV8 A;  3PO2 B;  3HKZ E;  4XQJ A;  2Z4I A;  5IWA Q;  1C4Q A;  3HOV B;  3TQT A;  1HZC A;  4DL2 A;  3CC2 A;  3TQY A;  1XMQ L;  4DV7 Q;  3AU7 A;  1B9N A;  4IZ8 A;  5IGF A;  4R8U A;  2PI2 A;  1A2U A;  3A55 A;  1TS4 A;  1AE3 A;  5T1I A;  4G7O C;  2JA6 A;  5JJZ A;  1FKA H;  4J15 A;  3OSO A;  2DN8 A;  2RKS A;  4DV0 L;  2YZG A;  4CJ2 C;  5ELE A;  2F0Q A;  5LHY 1;  5C4J B;  3RZO H;  2VNU D;  5D3I B;  5ELB A;  4BY1 G;  2NVY A;  4DLK A;  3T1Y H;  4DR4 H;  2PW5 A;  3BVM A;  2CQO A;  1N33 H;  1HNW Q;  2AMC B;  2A6E C;  1TT2 A;  4N9P A;  3MR5 A;  3M4Q A;  2QDB A;  5FO9 B;  1NJI C;  3GTO B;  4DAY B;  1CQJ B;  4NKL A;  1N34 Q;  3M3Y H;  3MR3 A;  2UXC H;  4KN4 C;  4LFB L;  1EUC B;  1I7N A;  1UE6 A;  1VQJ A;  3ETJ A;  3CCV A;  1OWT A;  1HH2 P;  2KHS A;  4I7A A;  2VQF H;  1EY7 A;  4KHV A;  4DU9 A;  2EZV A;  4DL6 A;  3J7A K;  3OIQ A;  4DUY Q;  1R9T B;  1LTT D;  1A3U A;  4X3U A;  5C6A A;  2KA7 A;  2EJG C;  2K52 A;  1Y1V G;  4LF9 Q;  5KFX A;  2FB9 A;  1DCZ A;  3I72 A;  1YJW A;  2I5M X;  2WAC A;  1D1I A;  3S15 H;  3S16 H;  4HNT A;  3X3N A;  3GQC A;  4JV5 H;  1EY9 A;  2RVL A;  3NP8 A;  3RGZ A;  1IYV A;  1NE3 A;  2B2Y C;  1G6Z A;  5G3L F;  2K50 A;  2JK8 A;  4HCE A;  3OMC A;  3RV3 A;  5KIX A;  3HOZ B;  4OON A;  1U9R A;  4Y7N B;  2AQ2 B;  3JAM c;  4DV6 L;  4MTK A;  3MFY A;  4KKS A;  3Q8Q B;  3GTK A;  2LXJ A;  5I9P A;  1GUS A;  2PMZ B;  2EYH A;  4G7H C;  3HOX B;  1HR0 Q;  4EQO A;  3H0G G;  4PMC A;  3WO0 A;  1A6X A;  4ED3 A;  4WOR A;  1CKM A;  2DY7 A;  2R93 H;  3K3V A;  3NHH A;  4G4K A;  1SYD A;  2Z1C A;  1L2Z A;  2R7Z G;  4KHP Q;  4ZOL F;  3T56 B;  3NE5 B;  3FP9 A;  3JSN A;  1KDA A;  3RTX A;  2NVT B;  4QWD A;  2IX0 A;  4UY8 C;  1BCP C;  3PVX A;  3D3R A;  2IA6 A;  4EG0 A;  2XNA C;  2KCM A;  2YTV A;  3ERQ A;  1PH9 A;  3N52 A;  1B70 B;  5F9L A;  5C5J A;  4EBE A;  4FYD A;  2R82 A;  4NDX A;  4IRK A;  5HY6 A;  4DAM A;  3GDE A;  2EJM A;  4ZKC B;  4QJF A;  4RKB A;  4P72 A;  3PIO 3;  1XNR H;  3KBG A;  2JEG A;  4L6T B;  3GIM A;  4JUZ A;  5BN3 A;  4AYB E;  4XZ3 B;  2B29 A;  2ZT9 C;  4CBV A;  4BBR G;  3OTO L;  3R2I A;  4IPG A;  1IL8 A;  1L1O C;  3NQT A;  3V05 A;  1TWF A;  1TWG B;  1H9R A;  4ME6 A;  1SMX A;  1CUK A;  1YZ6 A;  4A3K H;  1EZ1 A;  3KAL A;  4L5Q A;  5ELF A;  4LFC L;  1AUV A;  3H20 A;  3V6K A;  4F4W A;  5KFU A;  1I4G A;  2JA5 B;  1SNC A;  5DLG A;  4NPS A;  4DUZ Q;  1NBW A;  3K59 A;  4KKT A;  1WOC A;  2AQ3 B;  1F2L A;  4C3I H;  5JJK A;  1E0B A;  3HOU G;  5IOD A;  3MJF A;  4DV7 L;  1C8C A;  5M3M B;  5BPF A;  2W9A A;  2AU0 A;  4N8F A;  1LV9 A;  2VQE Q;  3M4O B;  3K81 C;  4C2M A;  1STB A;  3HS0 C;  2Q2U A;  2OCE A;  4LF6 Q;  4GZY C;  2L55 A;  3KXY T;  1WCM G;  4NW2 A;  4JI6 Q;  3W3A A;  1HNZ L;  2EDG A;  2ASB A;  1JOK A;  3RV4 A;  5KFK A;  1TKW B;  3SK8 A;  2Q2T A;  1CZG A;  1HNW L;  5JEA H;  2R7K A;  4OGQ C;  1VKZ A;  4YR3 A;  4QW8 A;  3MHB A;  3GTL A;  4YQW A;  1FYC A;  3A8I E;  3LML A;  3OYY A;  3BQ1 A;  4GKJ Q;  1N34 L;  3VMM A;  4JPB W;  3VR3 A;  1YHQ A;  4A93 B;  1S0N A;  1QG7 A;  4EVO A;  3TIG A;  1Q7Y C;  1VMP A;  1I4H A;  4APV A;  2JA7 B;  4IUR A;  1BCP F;  1Q8I A;  1TS2 A;  2FFK B;  3MEH A;  3URY A;  3GV6 A;  3KOJ A;  5GQO A;  4DUY L;  3R5F A;  1JJC B;  1EFW A;  4LH6 A;  4YR2 A;  1STA A;  1XXG A;  2A6H D;  1OXT A;  1UEA B;  2FLP A;  2IMW P;  2QCP X;  4X3S A;  4LF9 L;  2XSC A;  1BBU A;  2I5H A;  5FKA C;  5FJ8 G;  2KCN A;  4ECW A;  1S3O A;  4KKU A;  3R23 A;  4XYM B;  1A9X A;  4ZI7 F;  3K7A B;  5LMU Q;  3V6H A;  5A2Q L;  5C44 H;  2YU9 H;  1X3Q A;  1CK1 A;  2PMZ E;  2W70 A;  3GV8 B;  5FK9 C;  4UP8 A;  5E7N A;  1KD1 C;  4DL5 A;  2ICE C;  4JBJ A;  2MNA A;  5L37 A;  3I4N B;  4LFB H;  4MN3 A;  4OO1 I;  1V9P A;  2KQ3 A;  1IW7 C;  3K58 A;  1DV1 A;  4JI2 Q;  1YEZ A;  3K5O A;  4FS2 A;  4AH6 A;  2NN6 G;  1TXY A;  3J7A 5;  4M9U A;  2MUY A;  4K5X A;  1I7L A;  1RIP A;  4LAA A;  4ZKB B;  1HR0 L;  1V51 A;  5KFE A;  4FXG C;  2DWC A;  2HHH H;  1KC8 C;  1TAE A;  4U6P A;  2K75 A;  1MSH A;  1K3R A;  4JW0 A;  2K5N A;  1J9O A;  2XCL A;  5DQI A;  3G7L A;  4C3J H;  4KHP L;  2V4Q A;  3FDT A;  1Y1W G;  3GIL A;  5JPN C;  1WFQ A;  1KAB A;  4OWW B;  4ZUI A;  4O1N A;  1YJN A;  1FL0 A;  2WAQ A;  5C4X H;  4IUP A;  5I2Y A;  1GVP A;  1VQE A;  1SMY D;  2R92 G;  4HR7 B;  3BDL A;  3F8T A;  1YIT A;  4KV6 A;  2E2J H;  3S1N B;  3MEF A;  3OMG A;  4DV6 H;  3T4A C;  2VB2 X;  5IY0 A;  1BNC A;  3X3M A;  5KT7 A;  1F2Y A;  3TP7 A;  5LL6 S;  5GAE C;  1ZET A;  2NVQ H;  2QDL A;  4R8U B;  1S97 A;  3A56 A;  3CMA A;  3QFF A;  3K57 A;  2JA6 B;  3IG0 A;  5CB4 F;  3GP7 A;  1KNE A;  2KCT A;  1F9Q A;  4RAY A;  2NVY B;  1U0L A;  3WOF A;  4BA1 I;  4ODG A;  1X3F A;  1KAA A;  5KG1 A;  1SNO A;  2Q8R E;  3PUW A;  5IGG A;  2YV5 A;  2IBK A;  4A3J H;  5D65 A;  1QJO A;  2YS6 A;  2X0S A;  4DR1 Q;  2HDL A;  5CA1 F;  4O3O A;  1EY0 A;  1UUP A;  4OWT B;  4BBS G;  4JI0 H;  2WB1 A;  2Z6K C;  4JK1 C;  5I47 A;  1Z2N X;  2VUM G;  4OX9 Q;  4H02 A;  2NTT A;  3VYS A;  4AQY L;  3S1R B;  2W7O A;  1PTO D;  4FF3 A;  5KNC A;  5C0X I;  4DV1 H;  2VW9 A;  2RSN A;  3N6R A;  1OTC A;  1TWA H;  1K8M A;  2UU9 Q;  1AW7 A;  5EAY A;  4BXX H;  5L1K A;  1B7Y B;  2HIX A;  1N36 Q;  5TSS A;  1MD2 D;  2BA0 A;  1X55 A;  5C3E G;  1A62 A;  2K33 A;  2VQE L;  3OTO H;  3PW4 A;  1SFO H;  1EOT A;  3RZD H;  4JI6 L;  1QCB D;  3ERS X;  1I6U A;  2PPB C;  3PGZ A;  2V9W A;  4YP3 A;  4YHH L;  4XYL B;  4PQX A;  4ZQ3 A;  5D1P A;  1A3V A;  3NTK A;  1E4E B;  3M7N A;  5FPR A;  4DV5 Q;  1O7Y A;  4LFC H;  4MV7 A;  4C5B A;  2DJG C;  3EA6 A;  4GKJ L;  2W7P A;  3CQZ H;  3MTS A;  3DXJ C;  1W2B A;  3V4Z A;  4TQU S;  3BQ0 A;  1XMO Q;  1UEB A;  1ZKO A;  4C1N I;  4ED7 A;  3BQ2 A;  2FJ2 A;  3D8G A;  2KSW A;  5IWA H;  5K36 H;  3GTK B;  1WTH A;  4A3M H;  2VPQ A;  4DV7 H;  5DG8 A;  4PG3 A;  1AFP A;  3VA7 A;  2XN9 C;  4LK1 C;  1KTK A;  3OW2 A;  1VBH A;  3BJY A;  1T5X D;  1KRS A;  5FO8 B;  1C0A A;  4YAJ B;  5IP7 G;  1B50 A;  2WYO A;  1IKM A;  1UE1 A;  3MXU A;  3M7G A;  2F0W A;  4DFA A;  3IL8 A;  1KJI A;  4JI5 Q;  1HNW H;  1RKN A;  5GAH C;  5LMU L;  1EIH A;  2PN1 A;  4CC5 A;  4JYA Q;  5EWE A;  4IUV A;  3TS0 A;  5IOC A;  1WJJ A;  5IYC G;  3HOZ G;  2WKD A;  1N34 H;  2K04 A;  1K83 A;  1S5C D;  4OHJ A;  1G91 A;  1N8R C;  2V4D A;  2PVP A;  1BDO A;  1PTO C;  4JI2 L;  3WDN A;  4MV4 A;  4KY5 A;  3HBL A;  3SGI A;  4DUY H;  3B6Y A;  2IWH A;  4DAP A;  5KFD A;  3U4Z A;  1VQM A;  4UCO A;  1EZ8 A;  5M3F H;  3CPW A;  2R93 A;  4LF9 H;  4P74 A;  1DD2 A;  3I4M H;  1FR3 A;  3I4O A;  1SYB A;  1XWE A;  1TWF B;  2GPS A;  4ZYS A;  2HVQ A;  2FK3 A;  1PFN A;  2B63 H;  4WJW A;  4CJ1 B;  2EYO A;  1MKH A;  2K05 A;  1VBG A;  1C7Y A;  1JLL B;  4A3F B;  4ECX A;  2E76 C;  3A0J A;  2FLN A;  4K6L A;  1H95 A;  1KIX A;  1VQA A;  4A3L G;  2ES2 A;  1BKB A;  5EBC A;  3K6O A;  4HJA A;  3AEV A;  5CV7 A;  2DUD A;  4DK6 C;  2KEE A;  1HR0 H;  1EYZ A;  5LL6 b;  2G5D A;  3F2U A;  4C2M B;  5F9N A;  2B3G A;  3TME A;  1WD0 A;  4K14 A;  3UE1 A;  5JJL A;  5KFS A;  1K9M C;  5JAV A;  2F03 A;  1Y14 B;  3MC0 B;  3SE0 A;  4KHP H;  4IHJ F;  1SYC A;  1EUD B;  1XTD A;  2RGR A;  3KTM A;  4LF8 Q;  1PH8 A;  4C5C A;  5GON F;  4DR1 L;  3GTL B;  2O5I C;  4K5V A;  4BWS C;  4RMF A;  2JA5 G;  3RBE A;  4R9W A;  5JEA J;  3F2C A;  1LLR D;  1VQ4 A;  4OX9 L;  1JR0 D;  3GLK A;  5DLF A;  2K5V A;  1U5K A;  1HQR D;  5KFY A;  2UU9 L;  4A3G H;  1Q1E A;  3GTG H;  3OUU A;  1X32 A;  5M3M G;  3S2D B;  1N36 L;  1DGS A;  1B53 A;  2XGP A;  3EPI A;  3SEB A;  2WIN B;  3QB3 A;  4ME5 A;  3RUZ A;  4BBR B;  2XRQ D;  2VUG A;  1FNW A;  4MV9 A;  3QJY A;  3R2T A;  2IJ0 A;  1ASY A;  3H3V H;  3ULL A;  2UUB Q;  3KLS X;  3A5U A;  5JVD F;  1N33 L;  4A2B A;  3QZ8 A;  4P73 A;  4ECY A;  1B3A A;  2BR0 A;  1CE8 A;  4TKO B;  1SE4 A;  1MBY A;  3MWM A;  4KHZ A;  4DV5 L;  5D1O A;  1L0X B;  2M00 A;  1FJG Q;  4IFD I;  4FS1 A;  4RAZ A;  4NXM Q;  3VYU A;  1XMO L;  1K8O A;  3BAB A;  4HMJ A;  2JA7 G;  4DUZ H;  1SCU B;  2I46 A;  2JEF A;  4HCS A;  3MR6 A;  3VPB A;  1BGW A;  4FDB A;  2L12 A;  1QVF A;  2D62 A;  3M4I A;  4LSX A;  3EN2 A;  3GTQ H;  3A74 A;  2VQE H;  2Q2H A;  3A5Z B;  1U4L A;  2L1B A;  3NUC A;  4LF6 H;  4JI6 H;  4Q8F A;  2JA8 G;  1Y8O B;  1GO3 E;  4J0M A;  1EZ6 A;  3KHH A;  3L3O C;  4HNU A;  2WE6 A;  1PZJ D;  3FKI H;  4JI5 L;  4A3I H;  2XD4 A;  1D2B A;  2IW3 A;  2R8J A;  2AQ4 A;  2YU9 A;  3PUX A;  4JI4 Q;  4PZ8 A;  3I4N G;  4GKJ H;  4GNX A;  3ER0 A;  3NGD A;  4K5W A;  1HNX Q;  3FDS A;  2PNH A;  5IGE A;  2W9C A;  2W6Z A;  4O3Q A;  3MFI A;  3FHW A;  5LMN Q;  1M4V A;  5I6W A;  2VS1 A;  1E1O A;  3VYR A;  4F87 A;  1QNU A;  2GLT A;  2MJ8 A;  1SDF A;  2KHI A;  3Q6S A;  2I8C A;  4O2B F;  5KFJ A;  4PMB A;  1X56 A;  3W5O A;  1Q82 C;  5EPK A;  2HHH Q;  2F0L A;  2C22 A;  4ULL A;  1KJJ A;  1RK5 A;  2FK2 A;  2KHJ A;  3A8J E;  4PMW A;  4RUC A;  1U4R A;  4EBC A;  3PO3 G;  3FPU B;  5IE8 A;  1WYD A;  3RMH A;  2ALZ A;  1WD1 A;  4ECQ A;  3H94 A;  4DV4 Q;  2LY7 A;  5E3F A;  3J81 W;  5LMU H;  4HJ5 A;  1MZB A;  1HPC A;  2A69 D;  4K2K A;  1G2S A;  2WB1 B;  4CKB A;  1ZHS A;  3CVZ A;  2R7F A;  4YAK B;  2W57 A;  2E2D C;  3Q8P B;  2DJF C;  5IP9 H;  2PYK A;  4GOP A;  3Q22 A;  4UCV A;  4UCU A;  2JJQ A;  4JI2 H;  4A3M G;  4A4I A;  4I65 A;  4MIU A;  3CD6 A;  1GJX A;  1JJG A;  2GPW A;  5L1J A;  1LTI D;  4IUQ A;  2JA6 G;  1TS5 A;  2EOT A;  2OTJ A;  2JEI A;  5J1Z A;  1P8L A;  2X69 A;  3G6J B;  1XPR A;  1YIJ A;  1X54 A;  3RZO B;  3T5L A;  4RNN A;  2R7M A;  4KK7 A;  4E4T A;  2A5H A;  1I50 B;  3HRZ C;  4FVM A;  3FMA A;  2FPP B;  4LF8 L;  4O42 A;  1IXR A;  2H1E A;  3VA5 A;  3KLR A;  3CCS A;  3QWN A;  3TRZ A;  1RYR A;  3I2Z A;  3M3Y B;  1A2T A;  3EFX D;  2L9H A;  1LTS D;  4IZO A;  2W6N A;  5KYI A;  3LX0 A;  1YNJ C;  1TWA A;  4JC0 A;  2IX1 A;  4F88 A;  3K3P A;  2K7V A;  3PR5 B;  3C1F A;  3GTJ H;  4OEL B;  3RLF A;  3CCL A;  3OSN A;  3M9B A;  2IP4 A;  1S68 A;  3OIP A;  4LJZ C;  2UVU A;  5FLX c;  3NQI A;  1JWM D;  3Q23 A;  1GUO A;  3Q8D A;  2WTF A;  4O4H F;  1SFO A;  3KF6 B;  1YNN D;  3I4M G;  2UUB L;  2YS7 A;  5JH7 F;  2DGY A;  5HGQ A;  4HIM A;  3S16 B;  1SRU A;  2OXP A;  3NBH B;  2DPJ A;  3OOC A;  4TQS A;  4JV2 A;  1RJP A;  3BA9 A;  5D8D A;  1CKN A;  2BCO A;  2CCZ A;  1VQ8 A;  4HNV A;  4JV1 A;  4RWS C;  4LUV A;  1VQH A;  2WP8 J;  5LL6 X;  2HCI A;  5JVG 3;  1JOR A;  4DR1 H;  1W6K A;  4KN7 C;  1JX4 A;  1FJG L;  4BBS B;  4J9R A;  1S0O A;  3GIJ A;  3CQZ A;  1GUG A;  2B2V A;  4NXM L;  4OX9 H;  1K83 B;  2OQ0 A;  4YB8 B;  3TP6 A;  3VR2 A;  3IFT A;  1PYB A;  4Q0F A;  4ECV A;  2UU9 H;  1W3S A;  2FHT A;  4ILW A;  1JWU D;  1N36 H;  3DHQ A;  4ED1 A;  1BBW A;  2N8N A;  5C3E B;  4DNR B;  3TP8 A;  3T1H Q;  2ZJQ A;  3ICE A;  2R93 B;  4O0A A;  4C5A A;  4UP9 A;  5KFA A;  4J9L A;  5J22 A;  1VQ7 A;  2LSS A;  4M8A A;  2K5H A;  3KHR A;  4RNO A;  1Q46 A;  1AN8 A;  1B1Z A;  1L0W A;  4Q8E A;  1E4F T;  1EYD A;  1PRT D;  2EYJ A;  3L9A X;  5C5L A;  5C4Z A;  1PH7 A;  1CTM A;  3DF7 A;  1KJ9 A;  4DV5 H;  4JI4 L;  4GC6 A;  1K8G A;  4ED6 A;  5M5Y H;  1K1S A;  3M9O B;  2RCF A;  2HD3 A;  1HNX L;  1XMO H;  4DK3 C;  3PIP 3;  4IUT A;  3K0X A;  4WJ3 M;  5LP6 F;  3C0F B;  1ZYR C;  5LMN L;  3TII A;  4IPC A;  3NK9 A;  4B3S Q;  5KFL A;  1YHA A;  4YCV A;  1VQL A;  5IT9 W;  5FO7 B;  3CRL C;  3M4P A;  1IBM Q;  2HHH L;  2RHS B;  2RDF A;  5FLM H;  4DK0 A;  4HTH A;  2FK1 A;  1BXR A;  1XDN A;  4DL4 A;  2C2E A;  2DY8 A;  2D5D A;  2K01 A;  4IPD A;  5KFC A;  3S14 H;  1VQB A;  2BOS A;  1LT5 D;  2B63 A;  4JI5 H;  4A3F G;  3T13 A;  4DV4 L;  4A3K B;  2A1A A;  4MTD A;  5LXT F;  1B6S A;  4JYA H;  1JMC A;  4JV0 A;  1SNM A;  1EWC A;  3J80 W;  3QIA A;  1CQF A;  2E8G A;  3DM3 A;  3J80 c;  3N40 P;  2DLN A;  3RJ0 A;  1CFM A;  1UE7 A;  3TBI B;  3ONA B;  4MZ9 A;  4ECS A;  1F77 A;  5KFM A;  2L11 A;  2B2U C;  5C8Y F;  1YVC A;  1WI5 A;  2ALY B;  4EEQ A;  3A8K E;  4HN7 A;  5JUM A;  1EY4 A;  3HOY H;  4RHS A;  2F0T A;  3D0F A;  3TEH B;  1Z2O X;  1XTC D;  4XXE A;  3TZD A;  2O03 A;  1ICF B;  3CKI B;  1Z47 A;  2QF7 A;  3PO2 H;  1I6H H;  4GS3 A;  3BU2 A;  3RLN A;  2IY5 B;  5KNB A;  3HOV H;  1WH2 A;  3UDG A;  2FKL A;  2F0M A;  4JI0 L;  5KG0 A;  2G9H D;  5D1O B;  1V1P A;  2PW7 A;  1OXU A;  3R5H A;  1XNQ Q;  2A68 D;  4ZCK A;  4X64 Q;  5CV4 A;  3ULP A;  1DOL A;  2FMA A;  4DGZ A;  4DV1 L;  4X6A H;  3QOL A;  1VQN A;  5C4J H;  3GTP H;  1D5X C;  4ZQI A;  2F0U A;  1D1K A;  4DR5 Q;  1SN8 A;  5KG7 A;  2YL2 A;  4CHT B;  3GTG A;  1CHP D;  3M4Y A;  4CDD C;  4RU9 A;  4I7Z C;  2PCF B;  4IAJ A;  2R85 A;  1EUJ A;  5BN5 A;  4YWK A;  5KND A;  3A54 A;  3L0O A;  3UE0 A;  4YR0 A;  4K8I A;  4JI7 Q;  1MGS A;  3MAQ A;  2MP1 A;  1WTQ A;  1V43 A;  1CS0 A;  4UCR A;  2CW7 A;  1FGU A;  4DV3 Q;  3OUZ A;  2OEO A;  4Q0Y A;  1U4M A;  4LF8 H;  4GLA C;  4BY7 H;  3RFC A;  2KBN A;  1R9T H;  2YU9 B;  3IKJ A;  2ZXP A;  3NSW A;  1R4Q B;  2ZM6 Q;  2CW0 D;  4Y52 H;  1SXT A;  4QWA A;  4R4Q A;  1S5E D;  2BQR A;  4DNI A;  1BVS A;  5IP9 G;  5KG3 A;  2UVR A;  2J0T D;  5IWA L;  5KFW A;  4R4O A;  4RGO S;  4TRD A;  3GTM H;  5DGA A;  3STB D;  2B2W A;  1YJ9 A;  1Q8K A;  2EYL A;  4F4Y A;  1S0M A;  4TSS A;  4A3C H;  4A75 A;  4YY3 Q;  2NZ1 D;  1PX2 A;  1EIY B;  1B9M A;  4IUN A;  1AH9 A;  4MTN A;  5KFH A;  2DZD A;  1S4Z A;  3MXG A;  2MFI A;  2Z0S A;  3T1H L;  1AZP A;  4OIK A;  1TU2 B;  2R7L A;  2RSO A;  3MWE A;  1N9W A;  3HOW G;  1MI2 A;  2UUB H;  4DXF A;  1PTO B;  2XWJ B;  4OO1 H;  4C3J B;  4DNT B;  5IGC A;  3E5S A;  3FKI A;  1PH5 A;  2NUA B;  1KEE A;  2LKV A;  3N41 B;  4CJ0 B;  3OW7 A;  5IYZ F;  1EY8 A;  2WAQ G;  5C4H A;  3E5N A;  3JRX A;  1FJG H;  3KAJ A;  2E2I A;  4ME3 A;  4MV6 A;  3HOX H;  5DG7 A;  2YZM A;  4NXM H;  1CT1 D;  4UAI A;  4F4X A;  1JQY D;  3OPO A;  3I70 A;  2E2J B;  1TY2 A;  5KG2 A;  2VXW A;  4Y8V B;  1SRO A;  1UE5 A;  4B3S L;  2CW8 A;  3JZI A;  5EZY F;  4QWC A;  2NUC A;  4KLK A;  1D5Z C;  1I3Q H;  2E75 C;  3KLS A;  3R3O A;  4CGY B;  2NVQ B;  1X65 A;  1J8I A;  1M0T A;  1IBM L;  2QIL A;  3H15 A;  4WRD A;  1JXL A;  4FF1 A;  2VZA A;  2SDF A;  2HQE A;  4RKL A;  2R7D A;  5DAU A;  1AE2 A;  2H5X A;  2JA8 B;  3G6Y A;  4LF4 Q;  2R8G A;  3PW2 A;  2I80 A;  4EBD A;  4U68 A;  4XIG S;  1LAC A;  3S24 A;  4B9W A;  3VDY A;  4B3M Q;  3JRW A;  4QIW A;  1TS3 A;  1GHJ A;  5KFF A;  3OSP A;  2ASD A;  1DZ1 A;  2WB1 G;  3I8Z A;  3K5M A;  4O3P A;  4J8Q A;  4LF5 Q;  1S40 A;  1X9N A;  4JI4 H;  2LMC B;  5J2T F;  1ICW A;  1O75 A;  1N48 A;  4QB4 A;  1HNX H;  2VL6 A;  4A3E H;  3I3C A;  1GOZ A;  4QGU A;  1IBL Q;  5LMN H;  3NEL A;  4ED0 A;  1J6Q A;  2KJX A;  1UNN C;  2UVW A;  3PN1 A;  1TWA B;  2SNS A;  1TWG H;  2Q2I A;  5KEE A;  4IUU A;  5KT5 A;  3JAM E;  1G29 1;  1D5M C;  3F1Z A;  4JG2 A;  1AEX A;  4J9M A;  2AGO A;  1TWH B;  1EQV A;  1VS0 A;  1EYG A;  1SFO B;  1HJP A;  3K0Y A;  5KT4 A;  3RZD B;  5M5X B;  2NB0 A;  2RDG A;  3PIO A;  3KAK A;  3PO3 B;  5C0X H;  4RUA A;  1ENF A;  3RB0 A;  1GUN A;  4LUZ A;  3TS2 A;  1CKN B;  2Z6B A;  4DV4 H;  5EJW A;  3C2P A;  2UUA Q;  1XNQ L;  4X64 L;  1T9H A;  1UC8 A;  4F4Z A;  5IYB H;  3HKZ A;  4J9K A;  4DR3 Q;  2O5J C;  4Q44 A;  4DR5 L;  2M05 A;  2UXB Q;  3BG5 A;  4A3M B;  3GTJ A;  1GHK A;  5J3B A;  1PH6 A;  2MGS A;  1I94 Q;  1GXD C;  4IR1 A;  3KK7 A;  1BUV T;  2A6H C;  2MPM A;  2V59 A;  1JIC A;  1SND A;  4DXG A;  2BH2 A;  1KLU D;  1B04 A;  3ETH A;  5IYD H;  2GA4 B;  4A93 H;  3GID A;  1YNX A;  4GLX A;  1T36 A;  5EWF A;  4ECZ A;  2FLL A;  1RJR A;  3CXC A;  1XJV A;  2RDH A;  2J6U A;  3HGB A;  2B39 A;  5JVH 3;  4H0L C;  4JI1 Q;  2IPK D;  2PNR C;  4X66 Q;  4KJN A;  3PQI A;  1EIF A;  1PYS B;  4NB3 A;  3E9H A;  4DUZ L;  4RGM A;  1GUW A;  5KG4 A;  2F3W A;  1EYC A;  3GV5 B;  3RAQ A;  1UNS A;  4YCW A;  5A2Q W;  5C5M A;  5DEH A;  2FMC A;  5D3D A;  3KHG A;  2C2D A;  1T3N A;  4KD4 A;  4XYO A;  5JOB A;  4YY3 L;  1Y8P B;  2IHE A;  2YRW A;  4L8J A;  4YCU A;  3K7A H;  2R93 G;  3HOY G;  5CV9 A;  3SR1 A;  5M3F B;  5A35 A;  1VQK A;  1DJR D;  4LF6 L;  4JI8 H;  4IN3 A;  4A3D H;  3I4M B;  2R3Z A;  4ZUJ A;  5DQH A;  4UDU C;  4IOA A;  3PW0 A;  1I4R A;  3N8D A;  1LT4 D;  1HR0 W;  1KJ8 A;  1LTG D;  5EKI A;  4CC6 A;  1CSQ A;  1KRT A;  5M5W B;  2NWG A;  3TRE A;  3GV3 A;  4PZ6 A;  4KD3 A;  5HGT A;  1STE A;  1KQS A;  2W71 A;  3R5X A;  2BE5 D;  5DM7 3;  4NLG A;  2EY5 A;  3S17 H;  1HQM C;  5AJ3 Q;  5CR3 A;  1O80 A;  2L4N A;  3JSL A;  4DAV A;  1SMY C;  2EJF C;  3CCR A;  2SOB A;  2F0N A;  2HIV A;  5BN4 A;  1NSN S;  1LTR D;  2XIG A;  5E4W C;  3BVZ A;  3Q8S B;  3I73 A;  1DXM A;  5ELN A;  4RZQ A;  5C3X A;  1TVX A;  3BAA A;  2V58 A;  4WD3 A;  2QKI C;  3T1H H;  3EJI A;  5F2D A;  3BYT B;  1VF5 C;  3U4V A;  4GNX C;  1OXX K;  1BO0 A;  2WKC A;  4G3I A;  2OTL A;  4LF4 L;  5COR A;  4QF4 A;  4GC7 A;  4B9X A;  4A3K G;  1HZ9 A;  4QWB A;  3S1Q B;  2MO1 A;  2A19 A;  1RJT A;  1CA5 A;  2E5L Q;  4LSA A;  2FP4 B;  1EQR A;  3EIV A;  1M90 C;  4LF5 L;  2NU9 B;  1V1P B;  3MVV A;  1KL9 A;  1GYF A;  5H80 A;  1B33 N;  2L0C A;  2R8K A;  1A8V A;  5DM6 3;  2YYZ A;  5CMD A;  1IBL L;  2PZW A;  1HZB A;  4C3I G;  1K0S A;  1TWC H;  1UWV A;  1S10 A;  4B3S H;  3GTG B;  2XCA A;  2D0O A;  4AYB A;  1EYA A;  2J4X A;  3NPP A;  3EVQ A;  4NXN Q;  1IBM H;  3MFH A;  3ULJ A;  1ILQ A;  1LTA D;  1H9J A;  2CKZ B;  2AGQ A;  3CW2 C;  2C00 A;  5JEA G;  4GOP C;  3IN5 A;  4LUO A;  1PVO A;  3F2B A;  4B3R Q;  2W8K A;  2JE6 I;  4U7C A;  4WBN F;  2C35 B;  2XGT A;  4ZHQ F;  5C1O A;  3TDQ A;  2PI2 E;  2F4V Q;  1IZ6 A;  2UUA L;  4UHV A;  2BE5 C;  2R84 A;  3KDF A;  4AIM A;  3M9N B;  3GV7 B;  3NTI A;  4IO9 A;  4MNO A;  4DR3 L;  3QZ7 A;  3GTP A;  2F0V A;  1SBB B;  2EXD A;  4PNY A;  4XX0 B;  1WTX A;  1NY4 A;  4IJH A;  4LNQ A;  5DGB A;  2RDI A;  1I94 L;  1G51 A;  5E1F A;  3PW7 A;  3GTQ B;  1KJQ A;  4IFD H;  3S9W A;  1GGO A;  5KFZ A;  1PYW D;  2Q8I B;  3L7Z C;  1X3E A;  1HUM A;  3H40 A;  3RF2 A;  2I87 A;  1C3O A;  3FKI B;  3UDI A;  5C44 G;  3GTK H;  4XYQ A;  2J9G A;  1JE5 A;  1OXV A;  2HDM A;  4JI1 L;  3S1M H;  4X66 L;  4DV2 Q;  2ZTC A;  4OWX B;  2E2I B;  5C1P A;  4J9Q A;  1Y69 U;  5COY A;  5DG9 A;  1XNQ H;  4X64 H;  2BDO A;  2HUG A;  1K0R A;  1CM9 A;  5T14 A;  2EYP A;  2CZG A;  1RDP D;  5L9X A;  3GTM A;  2DPI A;  1GLV A;  3MZ5 A;  1B44 D;  3J7Y W;  3IRB A;  4BY1 H;  2YZN A;  2ZXR A;  5LYJ F;  4DR5 H;  5CV6 A;  3HZX A;  2R6G A;  4TQR A;  2BH8 A;  3D4R A;  3CCU A;  3SI8 A;  3CCE A;  2FXQ A;  1I4X A;  4KY7 A;  1NTG A;  2AWO A;  2M9V A;  4MHE A;  4POF A;  1BJT A;  1PTO F;  5JVL A;  5ELD A;  4JI7 H;  3GTQ A;  4DR2 Q;  2R8I A;  1E24 A;  1EOV A;  2B2V C;  3RB4 A;  1VCI A;  2GVB A;  3HKS A;  4C3J G;  4WFN 3;  4DF7 A;  1ZXT A;  3D31 A;  3RB3 A;  2WDT A;  4IAL A;  4DV3 H;  4QIW B;  1EY5 A;  1JIH A;  3VR4 A;  4J9P A;  1HA5 A;  2NU7 B;  4EYH B;  1SE3 A;  3Q24 A;  2C28 A;  5C4X G;  4YJ2 F;  2P5Z X;  2PMZ A;  4ZLT F;  2ZM6 H;  4IOC A;  4XQQ A;  4GKK Q;  1XPO A;  1I5F A;  1Y1V H;  2P0A A;  2YCH A;  5KFR A;  1EFI D;  4H7B A;  1PFS A;  2KUM A;  2CQY A;  4C3H H;  5HBR B;  4BA2 I;  5CA0 F;  2XTI A;  2Z9H A;  5IGB A;  4YY3 H;  1EY6 A;  1I3Q A;  3TQ1 A;  2FIN B;  3KBX A;  5AFW A;  3E3X A;  3RD4 A;  2N78 A;  3P75 A;  3RGX A;  3JAM i;  1AUX A;  3HOW B;  3S2H H;  4EGQ A;  2XC9 A;  3K5N A;  1P16 A;  1F2Z A;  2B8F A;  3PCO B;  4O3R A;  3I7F A;  4A3J G;  1HFG A;  2E5L L;  4JYA L;  2UUC Q;  5C0X J;  3NWT A;  1Y8N B;  2F0H A;  1XMQ Q;  1QZG A;  2WAQ B;  1FNV A;  1A63 A;  3PR4 A;  1LM0 A;  2ZDH A;  2ZDQ A;  2W6M A;  4I7H A;  3H0G H;  4EEY A;  4C2M H;  4DV0 Q;  3HKZ B;  3CPF A;  5CYU A;  4BXX G;  1SEB D;  2FPG B;  1VQ5 A;  4A3B H;  1PRT B;  2XWB B;  2R7Z H;  5EKK A;  2K4K A;  3GTJ B;  2OF1 A;  2EPB A;  2NU6 B;  1VQP A;  1ZQ7 A;  1Q3L A;  4LFA Q;  3PZP A;  1E3P A;  3CCQ A;  1ESF A;  4EFE A;  3P1H A;  4LF4 H;  1B3Q A;  2WFW A;  4TVA B;  3U9S A;  4B3R L;  1WTR A;  3GII A;  3RBD A;  4B3M H;  2PQE A;  1IHZ A;  4NP5 A;  4H13 C;  1RL2 A;  3LWE A;  3SDZ A;  3LNN A;  4OEM B;  3J81 c;  1SYG A;  4PV1 C;  2F4V L;  4LF5 H;  1F9S A;  1K73 C;  3CF5 A;  2BQU A;  4O3N A;  1CI3 M;  4BBR H;  1F9R A;  3WO1 A;  3V4S A;  4EQ5 A;  5G3L D;  3I55 A;  1IBL H;  4RB2 C;  5K36 G;  1K1Q A;  3NEM A;  4K0K Q;  1O78 A;  2I0Q A;  2SCU B;  3OWF A;  1ROD A;  3G48 A;  3FVQ A;  4ECU A;  4HIK A;  2J6S A;  1A0I A;  4LWC A;  1TY0 A;  4DN4 M;  3UQ8 A;  4IQZ A;  3SE7 A;  1RF2 D;  4CDE C;  2HJW A;  4QW9 A;  1EU4 A;  1B6R A;  1E2V A;  1ILP A;  1VQG A;  4LH7 A;  1QIL A;  4X3T A;  4RAU C;  4YJ3 F;  1J5E Q;  1BQQ T;  3HOU H;  4DV2 L;  1VQ9 A;  2ICI A;  1E4G T;  2UUA H;  1PXU A;  1PA6 A;  1NUC A;  1RJQ A;  5BMV F;  1L0Y B;  3C46 A;  1O7Z A;  3WWV A;  3H3V C;  2CWA A;  4DR3 H;  4ABN A;  1WCM H;  1K3B C;  2UXB H;  5GAD C;  1VQD A;  2IX3 A;  2A6E D;  1LAB A;  3GIP A;  4JOI A;  3QG1 A;  1C30 A;  4Q43 A;  5KGU A;  1I94 H;  3T51 B;  5M3F G;  3H91 A;  1Q90 A;  1HZA A;  5BR8 Q;  1EHI A;  2ZDG A;  4JI8 Q;  1ZHQ A;  3GO5 A;  4DR2 L;  4R7R A;  3EPG A;  3S15 B;  2JA9 A;  2W8L A;  4WJ4 A;  1FNU A;  1LT3 D;  3FEW X;  4RB3 C;  1KDC A;  2B63 G;  4MTE A;  3PSI A;  4C56 C;  3MFG A;  4R4C A;  4KY6 A;  1KNA A;  4JI1 H;  4CDC C;  4LMQ D;  4X66 H;  2ZTD A;  2A69 C;  1JCK B;  1VMC A;  2EIF A;  2JQO A;  2N55 A;  4CDF C;  4GKK L;  1UAP A;  2JSO A;  2BQ3 A;  4OIJ A;  1FD7 D;  2F3V A;  2EY6 A;  1MJE A;  3D6C A;  5FJ8 H;  1RTO A;  4KJO A;  4I50 F;  2BA1 A;  4HIO A;  2YW2 A;  3MR2 A;  2NVX H;  3JAM L;  4AYB B;  4QCL A;  5ELO A;  1QOH A;  1JKJ B;  2B2T A;  4FO2 A;  3HOY B;  2WAQ E;  3MA2 B;  2DNC A;  1SNQ A;  2R86 A;  4DPG A;  4RH6 A;  1SYE A;  1STH A;  1I6H B;  4Z9C B;  2A73 B;  4IPH A;  3AMU A;  1SSO A;  5KFP A;  2Q8T A;  2F3I A;  2J6T A;  5J2U F;  1CSP A;  2UUC L;  4HJ9 A;  2NN6 H;  4J9N A;  2TMP A;  2K5W A;  5CAE B;  3DWQ A;  1LUZ A;  1JDE A;  1JDB B;  4O4L F;  1RTN A;  3KDF B;  3CHB D;  5FOB B;  2PQA A;  4A3G G;  1JOO A;  3J7Z C;  3GTP B;  1TWC A;  1HNZ Q;  3M9M B;  2F0F A;  4I55 F;  5JPM C;  1I50 H;  4RHR A;  2MCT A;  3PV0 A;  3HXL A;  1Q12 A;  3J7A F;  4F50 A;  3BDO A;  3T5H A;  1VF7 A;  1Y1W H;  3BVG A;  1BCP D;  5IT9 c;  4DA2 A;  2K14 A;  3VYT A;  4UP7 A;  1ESR A;  2HVS A;  2WB1 E;  1SLJ A;  3RLO A;  4F7X A;  1XX8 A;  3HP3 A;  2HQL A;  4LFA L;  1DOK A;  4O2D A;  1PH2 A;  3KF8 A;  4IR9 A;  3DWA A;  1YNN C;  2R92 H;  4A2A A;  1SJE D;  4IFD J;  4LMY A;  1V1O A;  5FD5 A;  1PV4 A;  2JYO A;  5KRU A;  3T53 B;  5BPH A;  1I6V C;  2PZT A;  5KFO A;  2E5L H;  4BY7 B;  1ET9 A;  2R8H A;  3K5I A;  4B3T Q;  1EL0 A;  5FPO A;  4ETS A;  4E6I A;  3E0E A;  2ZJR A;  1Q86 C;  3N42 B;  3LWB A;  2V1C C;  1MIU A;  2IL8 A;  1IYJ B;  3J81 E;  3N44 B;  1KAW A;  2E74 C;  1LTL A;  1IYU A;  2NYZ D;  4JVZ A;  4C3I B;  4X65 Q;  3GTM B;  4K0K L;  2R87 A;  3H6M A;  2UXD Q;  4C3H G;  2ASJ A;  1RHP A;  2NN6 I;  4FU0 A;  2H4O A;  2X6L A;  1ENA A;  1QE6 A;  4GN4 B;  2C5C A;  2JXM B;  2N88 A;  1E4E A;  4NXN H;  2ZTE A;  2E2H H;  4BBS H;  4FBU A;  1H9K A;  1IL2 A;  4ZRZ A;  3G6X A;  1K83 H;  5M9O A;  2VUM H;  5CGK A;  3JAM W;  4RB0 A;  4X62 Q;  4R8I A;  2FE3 A;  3FKI G;  2O2L D;  4A3I G;  4B3R H;  1FVI A;  1PRT C;  1A3T A;  1J5E L;  4UCT A;  4ECT A;  4BWG B;  4P75 A;  3EBE A;  4JBM A;  4TUY F;  2F4V H;  1L2F A;  1EWH A;  4K8J A;  1O7L A;  1T5E A;  3MXN A;  3RIZ A;  2DNE A;  1AN7 A;  5C3E H;  2NTS A;  1WTV A;  1QNK A;  1HHV A;  4Q5V A;  1R4P B;  4QL5 A;  4L5S A;  1DV2 A;  5KFT A;  4A3B G;  1JE4 A;  2Y0S G;  2FPI B;  1B8A A;  4J9O A;  1I3Q B;  3C1E A;  5KFG A;  2X6G A;  3J81 j;  1Z6H A;  5BR8 L;  3GTO H;  2D9U A;  5LMN W;  3UFX B;  4JI8 L;  4IWY A;  1PLF A;  1H9S A;  5FLX E;  1WR2 A;  4LW1 A;  2CVR A;  2TSS A;  3R93 A;  3TZU A;  1KHI A;  3LWU A;  4RG1 A;  1PH4 A;  1LYL A;  2F52 A;  4HID A;  3AFQ A;  5C44 B;  3EQL C;  4DV2 H;  2ZJP A;  5IIF A;  4RZR A;  2AGP A;  4GNX B;  1EIG A;  2W9C B;  1MJC A;  2EYF A;  1ML0 D;  1SNP A;  1HFN A;  4A3E B;  1N32 Q;  1Y1V A;  5IP7 H;  3NXW A;  1PHJ A;  3T5J A;  1E1T A;  3QO2 A;  1H9M A;  4EYI B;  1B2T A;  2VB3 X;  1M7J A;  2V4R A;  1O7I A;  2F0S A;  1CQV A;  2A8V A;  2CHB D;  3PIP A;  2LXK A;  4DR2 H;  5IYC H;  1MSG A;  4M1U B;  2AKW B;  3HOZ H;  3K5H A;  1RK6 A;  2F0G A;  4Y7N H;  1IOV A;  4AQY Q;  1IW7 D;  4JBK A;  4FF2 A;  2VQD A;  1PZI D;  3DEO A;  3ND8 A;  2XIW A;  3H4B A;  2QW7 A;  3Q2O A;  4RFB A;  3SK5 A;  1SYF A;  4P71 A;  1EQQ A;  1DON A;  1DYQ A;  3T16 A;  5J39 A;  5C4X B;  2AWN A;  4O4I F;  1HTL D;  3CME A;  4GKK H;  3E0J A;  2A68 C;  3H0G A;  3HKZ G;  3J7A V;  5KT3 A;  1PRT F;  3JC6 6;  4GOP B;  2AQ1 B;  3BA8 A;  3PMF A;  1JB3 A;  2IHF A;  4L1K A;  4N9T A;  2W6P A;  2KEC A;  2R7Z A;  2Y0S A;  2NVT H;  4YHH Q;  1DOM A;  1M0W A;  2VA3 A; 
#chains in the Genus database with same CATH homology
 1HNW Q;  3U4V A;  4GNX C;  2AMC B;  1OXX K;  3M4Q A;  3FKI H;  4JI5 L;  4A3I H;  2OTL A;  4LF4 L;  1NJI C;  3RN5 A;  4DAY B;  4A3K G;  3M3Y H;  1HZ9 A;  1N34 Q;  1CKO A;  4A3L H;  2MO1 A;  2A19 A;  2D0P A;  3PUX A;  2E5L Q;  4PZ8 A;  4JI4 Q;  4LFB L;  1UE6 A;  1EQR A;  1VQJ A;  4GN3 B;  3EIV A;  3CCV A;  1M90 C;  4LF5 L;  4GNX A;  3ER0 A;  4JBW A;  1VQO A;  1HNX Q;  2PNH A;  1HH2 P;  1KL9 A;  3K8A A;  3FHW A;  2MO0 A;  5LMN Q;  4DUY Q;  4B3T L;  1A8V A;  2YYZ A;  1IBL L;  2VS1 A;  1E1O A;  1HZB A;  1Z9F A;  3PUZ A;  1TWC H;  1G6P A;  1UWV A;  2K52 A;  2KHI A;  4DR6 Q;  1Y1V G;  1X56 A;  3W5O A;  4X65 L;  2D0O A;  1QUQ A;  1Q82 C;  4LF9 Q;  4HJ7 A;  2HHH Q;  3S15 H;  1YJW A;  2I5M X;  3STB C;  2UXD L;  4EX5 A;  3S16 H;  2QEX A;  4NXN Q;  3AYH B;  2KHJ A;  4PMW A;  3ULJ A;  3PO3 G;  2CKZ B;  5IE8 A;  1PH1 A;  3CW2 C;  2JA5 H;  1WYD A;  1NE3 A;  2K50 A;  5JEA G;  4DV4 Q;  4GOP C;  2KEN A;  2JK8 A;  4LUO A;  2JEA I;  1PVO A;  4HJ5 A;  3F2B A;  4B3R Q;  4X62 L;  2JE6 I;  4KI0 A;  2C35 B;  4OON A;  2XGT A;  2ATW A;  2PI2 E;  2R7F A;  2RHQ B;  1IZ6 A;  3PUY A;  3JAM c;  4DV6 L;  2UUA L;  2F4V Q;  1VQ6 A;  5M3M H;  5IP9 H;  3UDF A;  3KDF A;  4AIM A;  4GOP A;  2LXJ A;  4GN5 A;  3M4O H;  2JJQ A;  2AHO B;  4IO9 A;  4MNO A;  4DR3 L;  4A3M G;  1SE8 A;  4A4I A;  1HR0 Q;  4JI3 Q;  3CAM A;  3CD6 A;  2EXD A;  3H0G G;  1JJG A;  4LF7 Q;  1CKM A;  1NY4 A;  2JA6 G;  2R93 H;  2OTJ A;  4IJH A;  4LNQ A;  1I94 L;  1P8L A;  1G51 A;  3K80 C;  1XPR A;  2R7Z G;  1YIJ A;  4KHP Q;  1X54 A;  4GLV B;  3FP9 A;  4DKA C;  4JI7 L;  2GN5 A;  1JJ2 A;  3L7Z C;  5FLM G;  2IX0 A;  3RNU A;  4UY8 C;  1X3E A;  4DR7 Q;  4LF8 L;  1IXR A;  2JA7 H;  3UDI A;  5C44 G;  3CCS A;  2KCM A;  4DV3 L;  3GTK H;  2YTV A;  1JE5 A;  1OXV A;  3I2Z A;  1B70 B;  4JI1 L;  4X66 L;  4DV2 Q;  1PH9 A;  3S1M H;  3G71 A;  2ZTC A;  4OWX B;  5HY6 A;  4DAM A;  3GDE A;  4QJF A;  4P72 A;  2ZM6 L;  2ID0 A;  1K0R A;  4R4T A;  4AYB E;  4JC0 A;  2IX1 A;  3CP0 A;  3PF4 A;  3M85 A;  2B29 A;  4BBR G;  3GTJ H;  3RLF A;  3IRB A;  3OTO L;  3CCL A;  4BY1 H;  1N32 L;  2PQA B;  3M9B A;  3CC4 A;  2R6G A;  2YTX A;  1L1O C;  4IPG A;  5FLX c;  2JA8 H;  2BH8 A;  2JEB I;  4AYB G;  3CCU A;  3CCE A;  2FXQ A;  3Q8D A;  3K7U C;  1NTG A;  2AWO A;  4POF A;  3KF6 B;  1IBK Q;  3CC7 A;  2UUB L;  3I4M G;  2DGY A;  5HGQ A;  4HIM A;  4DR2 Q;  1SRU A;  1E24 A;  1SMX A;  3NBH B;  1CUK A;  1EOV A;  1YZ6 A;  4A3K H;  1VCI A;  2GVB A;  3HKS A;  4L5Q A;  4LFC L;  1CKN A;  1L1O A;  3D31 A;  2CCZ A;  4R1J A;  1VQ8 A;  3I4N H;  3KF8 B;  2L15 A;  1VQH A;  2WP8 J;  4LUV A;  3PO2 G;  3E9I A;  3U50 C;  1FJG L;  2N3S A;  4NPS A;  3HOV G;  4DUZ Q;  1NBW A;  1VQC A;  3GD7 A;  4LF6 Q;  4NXM L;  5C4X G;  1WOC A;  2OQ0 A;  4C3I H;  3KJP A;  5JJK A;  4IOC A;  4GKK Q;  3HOU G;  1XPO A;  1PYB A;  4DV7 L;  1I5F A;  1Y1V H;  1JT8 A;  1VQI A;  1W3S A;  1TWH H;  1PFS A;  2VQE Q;  3T1Y Q;  3K81 C;  4DR4 Q;  4C3H H;  5M5X H;  4BA2 I;  1QVG A;  2OCE A;  1BBW A;  2N8N A;  2XTI A;  3HFZ B;  3T1H Q;  2Q2U A;  1WCM G;  2ZJQ A;  4A76 A;  4JI6 Q;  1N33 Q;  3ICE A;  3PO3 H;  1HNZ L;  4O0A A;  2ASB A;  4UP9 A;  3J81 i;  5GRO A;  1VQ7 A;  2LSS A;  2N78 A;  2K5H A;  2Q2T A;  1HNW L;  3JAM i;  1Q46 A;  1L0W A;  3S2H H;  1P16 A;  2UU9 Q;  4PZ7 A;  3U58 A;  3PCO B;  2UXC Q;  1PH7 A;  3I7F A;  4A3J G;  3OYY A;  4GKJ Q;  1N34 L;  1YHQ A;  3S1N H;  2E5L L;  4JI4 L;  4B3M L;  2VQF Q;  4JYA L;  2UUC Q;  5C0X J;  1K8G A;  1Q7Y C;  5M5Y H;  4BY7 G;  1XMQ Q;  3RN2 A;  1QZG A;  4APV A;  1HNX L;  4DK3 C;  4WJ3 M;  5JJI A;  3K0X A;  1A63 A;  1LM0 A;  3H0G H;  3KOJ A;  2CWP A;  5GQO A;  4C2M H;  3MXN B;  5LMN L;  4DUY L;  4IPC A;  4DV0 Q;  2JA6 H;  1JJC B;  1EFW A;  3CPF A;  4B3S Q;  1YHA A;  2OQK A;  4YCV A;  1VQL A;  1OXT A;  4BXX G;  2NVY H;  3KF6 A;  2I5L X;  4UPA A;  1VQ5 A;  2R7Z H;  4A3B H;  4LF9 L;  4DR6 L;  3M4P A;  4A3C G;  1IBM Q;  2HHH L;  2K4K A;  1BBU A;  2I5H A;  2RHS B;  5FJ8 G;  4JV5 Q;  2MQH A;  3GTL H;  3ZJY C;  1GM5 A;  1S3O A;  5FLM H;  1GD7 A;  1VQP A;  4LFA Q;  1X6O A;  1E3P A;  4IPD A;  3CCQ A;  1VQB A;  3S14 H;  5LMU Q;  5C44 H;  2YU9 H;  4A3F G;  4DV4 L;  2WFW A;  2A1A A;  2PMZ E;  4TVA B;  3S1R H;  4OO1 G;  4B3R L;  4UP8 A;  4XTC S;  5E7N A;  3KJO A;  1KD1 C;  1XPU A;  4JBJ A;  2MNA A;  1JMC A;  1NMG A;  1RL2 A;  3J81 c;  4OO1 I;  2F4V L;  1V9P A;  1K73 C;  2E8G A;  3DM3 A;  1Q81 C;  4YWM A;  4JI2 Q;  3J80 c;  3CF5 A;  1YEZ A;  3HOX G;  4BBR H;  4AH6 A;  1UE7 A;  1TXY A;  2NN6 G;  4EQ5 A;  3J7A 5;  3I55 A;  4MZ9 A;  4JI3 L;  5K36 G;  1RIP A;  1SR3 A;  1HR0 L;  3NEM A;  3I56 A;  4K0K Q;  3L2P A;  3CCJ A;  1ASZ A;  1YVC A;  4LF7 L;  1WI5 A;  2ALY B;  1KC8 C;  2I0Q A;  2K75 A;  3G48 A;  2UXB L;  1K3R A;  3HOY H;  4HIK A;  2K5N A;  3D0F A;  3TEH B;  1A0I A;  4LWC A;  4C3J H;  4KHP L;  5M5W H;  1Y1W G;  1Z47 A;  1WFQ A;  4OWW B;  3PO2 H;  1I6H H;  4GS3 A;  4DR7 L;  3BU2 A;  3RLN A;  1YJN A;  2IY5 B;  1FL0 A;  3HOV H;  3UDG A;  1GKH A;  5C4X H;  4JI0 L;  1VQG A;  1GVP A;  1VQE A;  4YWL A;  2R92 G;  1J5E Q;  1OXU A;  1XNQ Q;  3HOU H;  4X64 Q;  3F8T A;  1YIT A;  4DV2 L;  1VQ9 A;  2E2J H;  1XNR Q;  3MEF A;  3ULP A;  4X6A H;  4JOI C;  4DV1 L;  1PA6 A;  5IY0 A;  1VQN A;  5C4J H;  3GTP H;  3W1B A;  5GAE C;  4DR5 Q;  3WWV A;  2NVQ H;  1SN8 A;  4A3E G;  2CWA A;  3CMA A;  1WCM H;  1EUJ A;  4YWK A;  1VQD A;  5GAD C;  3L0O A;  3UE0 A;  4QQB X;  4JOI A;  1V1Q A;  2KCT A;  3BJU A;  4JI7 Q;  1U0L A;  4BA1 I;  5M3F G;  1PH3 A;  1IBK L;  1X3F A;  1HZA A;  5BR8 Q;  3S1Q H;  3PUW A;  4JI8 Q;  1V43 A;  2YV5 A;  3GO5 A;  4DR2 L;  1XNR L;  2JA9 A;  4A3J H;  2OWO A;  2QA4 A;  4WJ4 A;  4DR1 Q;  1FGU A;  4DV3 Q;  2B63 G;  4OWT B;  4BBS G;  2Z6K C;  3PSI A;  4GLA C;  1VQF A;  3G4S A;  2KBN A;  5C0X G;  1R9T H;  4BY7 H;  1EWI A;  4IJL A;  2VUM G;  3PUV A;  4OX9 Q;  4R4I A;  4H02 A;  4R4C A;  4AQY L;  2ZM6 Q;  3I4N G;  3DLL A;  5C0X I;  2RF4 A;  2ZTD A;  4Y52 H;  4R4Q A;  2VW9 A;  2EIF A;  1BVS A;  1TWA H;  2JQO A;  4DNI A;  5EAY A;  5IP9 G;  5IWA L;  5AJ3 L;  2Z6K A;  4R4O A;  3GTM H;  1B7Y B;  2HIX A;  3STB D;  5IYB G;  1Q8K A;  1YJ9 A;  1N36 Q;  1MJE A;  4A3C H;  4A75 A;  5FJ8 H;  2BA0 A;  1X55 A;  5C3E G;  4YY3 Q;  1A62 A;  2BA1 A;  4HIO A;  2VQE L;  1EIY B;  3T1Y L;  1AH9 A;  4DR4 L;  4MTN A;  2NVX H;  1SFO H;  1TWF H;  1QUQ B;  2MFI A;  2Z0S A;  3T1H L;  3RZD H;  4JI6 L;  1KXL A;  1N9W A;  5ELO A;  3ERS X;  1YI2 A;  1QZH A;  3HOW G;  3PGZ A;  2WAQ E;  4A3F H;  4YHH L;  3J80 i;  4DPG A;  5DLQ E;  3M7N A;  5IYD G;  4DV5 Q;  1PH5 A;  4A93 G;  2UXC L;  4QY7 A;  4GKJ L;  3CQZ H;  4IPH A;  2WAQ G;  1W2B A;  4TQU S;  2F3I A;  1XMO Q;  1UEB A;  4ME3 A;  2VQF L;  1CSP A;  3HOX H;  2UUC L;  4HJ9 A;  2CFM A;  1LUZ A;  4HJ8 A;  3KDF B;  4A3M H;  1SRO A;  1UE5 A;  4PG3 A;  4B3S L;  2PQA A;  4A3G G;  3J7Z C;  3LGJ A;  3OW2 A;  4KLK A;  1I3Q H;  1HNZ Q;  2NZH A;  1X65 A;  1KRS A;  1I50 H;  1C0A A;  3PV0 A;  1Q12 A;  1IBM L;  3H15 A;  5IP7 G;  4JV5 L;  1Y1W H;  2VZA A;  5IT9 c;  1UE1 A;  2K14 A;  1Q1B A;  4UP7 A;  3CCM A;  2WB1 E;  1SLJ A;  3RLO A;  3W1G A;  4ALP A;  2R7D A;  2HQL A;  4NXN L;  1OTC A;  1AE2 A;  2H5X A;  4JI5 Q;  2N49 A;  4O2D A;  1PH2 A;  4LF4 Q;  4OXP A;  4LFA L;  5GAH C;  5LMU L;  4XIG S;  3S24 A;  3VDY A;  2E2I H;  2R92 H;  4A3D G;  4B3M Q;  1D7Q A;  4JYA Q;  4IFD J;  3H3V I;  3TS0 A;  3BZC A;  1WJJ A;  3RR5 A;  5IYC G;  1PV4 A;  3HOZ G;  2WB1 G;  4LFB Q;  4LF5 Q;  2HT1 A;  1S40 A;  1X9N A;  1N8R C;  3KFU A;  2VL6 A;  4A3E H;  4B3T Q;  3S2D H;  4JI2 L;  4QGU A;  3E0E A;  2ZJR A;  1Q86 C;  1IBL Q;  3SGI A;  3NEL A;  1J6Q A;  1MIU A;  2V1C C;  1IYJ B;  3B6Y A;  1TWG H;  1KAW A;  2Q2I A;  1LTL A;  4X65 Q;  3U4Z A;  1VQM A;  4K0K L;  2UXD Q;  1G29 1;  5M3F H;  3CPW A;  3F1Z A;  4JG2 A;  2NN6 I;  4P74 A;  3I4M H;  1VS0 A;  3I4O A;  4GN4 B;  1EYG A;  1HJP A;  2ZTE A;  1OXS C;  2B63 H;  2E2H H;  4BBS H;  3PIO A;  1MKH A;  2IT1 A;  2GVA A;  1IL2 A;  1C7Y A;  3TS2 A;  4LUZ A;  1K83 H;  2VUM H;  1CKN B;  1L1O B;  4X62 Q;  3A0J A;  3FKI G;  4A3I G;  1QVC A;  1FVI A;  2QGQ A;  1KIX A;  1H95 A;  1D8L A;  1YBY A;  1VQA A;  4DV6 Q;  1J5E L;  2UUA Q;  1XNQ L;  4A3L G;  3UDX A;  4X64 L;  2ES2 A;  4P75 A;  3EBE A;  1T9H A;  2RCN A;  1BKB A;  1C9O A;  5GAG C;  1L2F A;  5IYB H;  4JBM A;  4L5R C;  2NZO A;  4HJA A;  2Y0S E;  3NEN A;  5C3E H;  3AEV A;  4DR3 Q;  4JCV E;  3AQQ A;  1E7Z A;  4DR5 L;  2DUD A;  4DK6 C;  2UXB Q;  2EQS A;  4QL5 A;  4L5S A;  5H1S E;  3HOW H;  4A3B G;  1NMF A;  3KLW A;  2Y0S G;  5J3B A;  1PH6 A;  2B3G A;  1I94 Q;  4BXX H;  1B8A A;  3UE1 A;  5JJL A;  1K9M C;  3J81 j;  2BH2 A;  4QIW E;  3TRZ A;  1Y14 B;  5BR8 L;  5LMN W;  3GTO H;  5IYD H;  4JI8 L;  4A93 H;  1XTD A;  4LF8 Q;  1YNX A;  4GLX A;  1PH8 A;  4JI0 Q;  3CXC A;  4LW1 A;  1XJV A;  4DR1 L;  2VY3 A;  4RMF A;  1K8A C;  2JA5 G;  1KHI A;  4RG1 A;  5JEA J;  1PH4 A;  4JI1 Q;  1LYL A;  2F52 A;  3F2C A;  4X66 Q;  4HID A;  3AFQ A;  4DV1 Q;  1VQ4 A;  4OX9 L;  1EIF A;  1PYS B;  3AFP A;  4NB3 A;  3E9H A;  4GKK L;  2ZJP A;  2K5V A;  4DUZ L;  1U5K A;  4GNX B;  2UU9 L;  4POG A;  4A3G H;  1MJC A;  1Q1E A;  4YCW A;  3GTG H;  3PF5 A;  5M3M G;  3G6E A;  3KYH C;  4L5T A;  1N36 L;  3OTO Q;  1DGS A;  1E22 A;  1N32 Q;  5IP7 H;  4YY3 L;  1PHJ A;  2IHE A;  3BZK A;  1E1T A;  1X3G A;  4YCU A;  3K7A H;  1ASY A;  2R93 G;  3H3V H;  3HOY G;  3ULL A;  3F2D A;  2UUB Q;  4LF6 L;  2YTY A;  1VQK A;  1O7I A;  3A5U A;  1JB7 A;  1N33 L;  1S72 A;  2A8V A;  3PIP A;  4A3D H;  4P73 A;  2LXK A;  4LFC Q;  5IYC H;  4IFD G;  4IOA A;  2AKW B;  1HR0 W;  3HOZ H;  1YHB A;  4Y7N H;  4KHZ A;  4AQY Q;  4DV5 L;  1CSQ A;  1KRT A;  1M1K C;  3TRE A;  4JBK A;  1FJG Q;  4PZ6 A;  1KQS A;  4IFD I;  3HKZ E;  4NXM Q;  1XMO L;  3S17 H;  5IWA Q;  4P71 A;  5AJ3 Q;  1EQQ A;  2JA7 G;  1HZC A;  3CC2 A;  3TQY A;  2AWN A;  1XMQ L;  3CME A;  4DV7 Q;  3CCR A;  2PI2 A;  3HKZ G;  2HIV A;  1AE3 A;  4GOP B;  3JC6 6;  4FDB A;  1QVF A;  2D62 A;  4J15 A;  4DV0 L;  3EN2 A;  3GTQ H;  3A74 A;  2IHF A;  5ELN A;  2Q2H A;  3A5Z B;  3RZO H;  2VNU D;  4BY1 G;  2NVT H;  4YHH Q;  2CQO A;  2JA8 G;  1GO3 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...