4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
3B6YA 1TWGH 3HOVG 1SR3A 4DV3L 2UUAQ 4QIWE 2IX1A 3JAMc 3OTOL 1JT8A 3IRBA 3EN2A 4DR2Q 3H0GH 3K80C 4X65L 2MO0A 1XMOL 4PZ8A 4DV5Q 3MEFA 2E5LQ 4X64L 4JCVE 5JJLA 3D31A 1MKHA 1GVPA 4YCUA 2E8GA 1B70B 5GROA 5LMNL 1YJ9A 1PH8A 1J5EQ 3A74A 3K8AA 4DR6Q 1C0AA 4JBKA 1K8GA 4MTNA 2LSSA 3ZJYC 4DR7L 4GKKQ 5LMUQ 3PGZA 5BR8Q 1JJ2A 1HZ9A 1G291 3A5UA 1VQ9A 4Y52H 1N34L 4A3CH 3CPWA 4GOPB 3CCEA 2VQFQ 4JI1L 3F2CA 1VQ5A 2OCEA 4JYAQ 2BA0A 2K4KA 2JA8G 4UPAA 3RNUA 4JI3Q 1V43A 3I2ZA 1EWIA 5M3MH 4DV4L 1XJVA 4R1JA 4P74A 3SGIA 1OXTA 5AJ3Q 2JE6I 1VQCA 5JJIA 5IYDG 4KLKA 3S14H 4BY1H 4A3JG 5M3MG 2UU9L 3S16H 1E7ZA 3K7UC 2H5XA 1E1TA 3KF6B 3CPFA 1VQ6A 1P16A 1W3SA 2MFIA 3H3VH 4LFBQ 1N33Q 1IBML 2HQLA 5ELOA 4A3CG 3RR5A 3S1RH 1SRUA 1C7YA 3PO3H 1OXSC 4YCWA 1KIXA 2UUCL 2KCTA 1MJEA 3HOUG 2HIXA 1QZHA 3GTQH 4LFCL 4LF5Q 1L1OB 1HNZL 3S2DH 1I3QH 2QEXA 1VQOA 3H0GG 3L2PA 1YITA 2KHIA 3PIPA 3TRZA 2UXCL 2NZOA 4AH6A 3J81i 3T1YL 3S24A 3I4NH 2VQEQ 2Y0SE 3STBD 3HOYH 1B8AA 3FKIG 4OO1G 3M85A 4A3DG 3CF5A 2DUDA 3CCSA 4IFDG 1SFOH 1EFWA 2UXBL 2IX0A 2VL6A 4OX9L 2OWOA 3DLLA 2K50A 4IO9A 3CQZH 2JA7H 2VUMH 2DGYA 3W5OA 3VDYA 1E3PA 1TWAH 3TQYA 2UXBQ 4GS3A 5JJKA 5J3BA 2CQOA 1GM5A 4R4OA 1XPUA 3RZOH 1X65A 3HKSA 5FJ8H 1YJWA 1HR0Q 3RLFA 5C0XJ 1CKOA 2ALYB 3J7A5 4BA2I 3J81j 3U4ZA 4PZ7A 5C4XH 3J81c 1QZGA 1MJCA 4JBMA 2HT1A 4JI5Q 1PA6A 2I5LX 2KCMA 1OXUA 1HNZQ 1XNRQ 4DR4L 3FP9A 1K83H 4YY3L 5M3FG 2K52A 1HJPA 4BBSG 4DR5L 3A5ZB 1O7IA 4PG3A 4LF6L 3K81C 2HHHL 4L5SA 4KHPL 4KHZA 5IP7H 2EXDA 4DR1Q 2R7DA 3PO3G 1A8VA 5C3EH 1PH1A 1VQLA 2F52A 4DK6C 2E2JH 2VZAA 1YVCA 2ZM6Q 1Q81C 3H15A 1PHJA 4A75A 1Q82C 2AMCB 2D0PA 5E7NA 4IOCA 4IOAA 3HFZB 1D8LA 1BBWA 1YBYA 2UU9Q 3TEHB 3ULLA 1S3OA 5ELNA 1V1QA 5FJ8G 2HHHQ 4A3LG 2R7FA 5IYBH 1YIJA 2VS1A 3K0XA 3PUVA 3TS0A 4JOIA 4B3TQ 1VQBA 3U4VA 3HOWH 2JA7G 1HZCA 3STBC 2B63G 2A1AA 1YEZA 1HR0W 1VQNA 2WFWA 1OTCA 4LF9L 1PYBA 3EBEA 3NEMA 3S1MH 4A3DH 1UE7A 3GTMH 5IE8A 3G71A 1AH9A 1JJGA 2BH8A 3CCUA 4L5RC 4IPGA 3F2DA 3FHWA 2D62A 3I7FA 5C44H 4DR6L 5K36G 3GTOH 1FJGQ 1JB7A 2VW9A 2V1CC 3E9IA 1KAWA 2GN5A 2HIVA 3T1HL 1VQIA 2AHOB 1JMCA 2YU9H 2E5LL 1RIPA 1ASZA 3CAMA 1P8LA 4HJ5A 4A3IG 5C44G 1D7QA 2K5HA 4QGUA 1NMGA 2ZJPA 2R93H 2R92G 4H02A 4DV3Q 4O2DA 4AIMA 3HOUH 4JG2A 2A19A 2JQOA 1I94L 4IFDI 3J80i 1HNXQ 3KJPA 4A3MH 4B3RQ 3E0EA 4NXNL 4DK3C 4QJFA 4B3SL 2VNUD 4DAMA 3I56A 2PNHA 1N32L 1L2FA 3UE1A 1DGSA 2BA1A 1PV4A 3UE0A 1UE6A 2Q2IA 1KL9A 2NN6G 3S1QH 1X54A 2WB1E 2A8VA 1X9NA 1BVSA 1VQEA 3ER0A 4ALPA 2NVXH 4R4IA 1V9PA 1VQKA 1KXLA 3U50C 3AFQA 4GN5A 4A4IA 3UDIA 4L5TA 1IBLL 3OW2A 2KHJA 4LWCA 1IBMQ 1OXVA 1N33L 4A3GG 4DR3L 2I5HA 4XIGS 5IYCH 3JC66 2NVTH 1G51A 3F1ZA 3MXNB 1WCMG 2NN6I 3H3VI 1GKHA 3TREA 4X62Q 3HOWG 5FLMG 4UP9A 4PMWA 4JI6L 1IXRA 4MNOA 1XNQL 1XNQQ 4A93H 1K3RA 1Y1VG 2Z6KA 1QVGA 4JI6Q 3A0JA 2YTVA 3AFPA 4X62L 4A3LH 4OWXB 5IT9c 3RZDH 1KC8C 3HKZE 1SMXA 5GAHC 4A3FH 3RN5A 1N8RC 4AQYQ 3NELA 4P71A 3GTGH 1TWFH 1UEBA 1E1OA 2VQFL 1ASYA 3PUZA 1N36L 4GOPA 1IBLQ 4A3FG 2JA6H 3M4OH 1LYLA 1KRTA 5GADC 4K0KL 1UE1A 1S40A 5FLXc 1WOCA 1FL0A 2PMZE 5C3EG 3KDFA 1CKMA 3OYYA 5JEAJ 1CSQA 2Z0SA 1A63A 3S2HH 4GNXA 1CKNA 4LF6Q 2ASBA 1M1KC 3I4MH 1VQFA 4X64Q 4BBRG 3KJOA 2NVQH 4DV5L 5M3FH 3W1GA 3TS2A 4IPCA 1LUZA 3GTJH 1Q7YC 4BXXH 1XMQL 4P75A 3HOZG 1CKNB 1L1OC 4B3RL 4DUZQ 3HOYG 2OQ0A 1Q12A 3KOJA 1EUJA 4OONA 4RG1A 4FDBA 5C4XG 3M4PA 3M7NA 2WAQE 4TVAB 3CCJA 3UDFA 5IWAL 3KLWA 4DUZL 2AWOA 1E22A 2ATWA 4GN4B 4LFAQ 4JI8L 2K5VA 1RL2A 3CCRA 2CFMA 2XTIA 1AE2A 3ULJA 4AYBG 5M5YH 4DKAC 4LNQA 1L1OA 1Z47A 2K5NA 1W2BA 1U5KA 4YWMA 3J7ZC 1FJGL 3NENA 4DUYQ 2QGQA 1VCIA 2UXDQ 3WWVA 3S1NH 3PF5A 4X6AH 4K0KQ 5C0XI 1KD1C 1I50H 4LF9Q 3I4NG 4DV1L 4LF8Q 2JA5G 1N36Q 5H1SE 1FVIA 4DV0Q 1SROA 3RN2A 2CKZB 2WAQG 4HIKA 1PH5A 2JA6G 4JI7L 1VQMA 3GD7A 1YHBA 1YJNA 4P73A 1IYJB 3KF6A 3W1BA 1SN8A 2B29A 4UY8C 4EQ5A 4HJAA 1CUKA 1HNWL 3PO2G 3GTPH 1GD7A 4A93G 2KBNA 4JV5Q 4JC0A 4LF4L 4A3BG 4YWLA 2D0OA 2PI2E 5DLQE 3HOXH 2FXQA 1LTLA 2ID0A 2N8NA 1EIYB 2RHSB 4A3EG 1Y1WG 1X56A 4LF7Q 1HZAA 1PH6A 4A3BH 4GLVB 4GLAC 5M5XH 1AE3A 4C3IH 1Q8KA 5IYBG 3CMAA 2OTLA 3PO2H 3PSIA 3CCQA 1X3FA 3F8TA 3U58A 2Z6KC 3Q8DA 4LW1A 4DV6L 2PQAB 4A3JH 1PH9A 2I0QA 4OO1I 2CWPA 4DV7L 2UUBL 2XGTA 1CSPA 1NTGA 4R4TA 2QA4A 4IJHA 4DR4Q 4B3SQ 3EIVA 3S17H 1XPOA 1NJIC 3CCMA 1HNXL 4BY7G 3CC7A 2OQKA 2NZHA 1I94Q 1XTDA 5IP7G 4GN3B 3PUWA 3K7AH 2E2HH 1WFQA 4YCVA 4BA1I 1Q86C 1IBKL 4UP8A 4JI2Q 2PI2A 5M5WH 4IJLA 1X3EA 5LMNW 1M90C 4JI4L 4NXMQ 3RLNA 4NXML 2R6GA 4OX9Q 3KF8B 1KRSA 4HIDA 3T1HQ 3I4MG 3GTKH 1MIUA 3HKZG 3S15H 4APVA 4BY7H 3I55A 1VQJA 3KDFB 3I4OA 1PH4A 2MNAA 2Q2HA 4ME3A 3BZCA 2JA9A 2VQEL 3T1YQ 2WP8J 1EQRA 3HOZH 2YTYA 3KFUA 5IP9G 1QUQB 1X3GA 2MQHA 2F4VQ 3BZKA 2OTJA 4WJ3M 4GKJL 3PUXA 2GVBA 1PH7A 4IPHA 4B3TL 4A3KH 4DV7Q 2UUBQ 4POFA 4DV2L 4LUOA 4YWKA 4GNXB 4LFCQ 4MZ9A 4QY7A 3FKIH 3D0FA 3CW2C 4DNIA 5EAYA 3PIOA 4A3KG 2IHFA 4B3MQ 2JEAI 2IY5B 1G6PA 1A0IA 3HOXG 3ULPA 5IY0A 3ERSX 1Z9FA 4O0AA 4NB3A 4POGA 3BU2A 2ZM6L 2RF4A 5IP9H 3E9HA 1BKBA 3PV0A 4HJ7A 4B3ML 4LF4Q 1Q46A 1YI2A 1JJCB 1WI5A 2PQAA 1VQPA 4DR1L 1K8AC 4KHPQ 1YNXA 2AWNA 2ZTDA 4DR5Q 2L15A 5FLMH 4DV2Q 1EIFA 1SE8A 1NMFA 1X55A 3CP0A 4YY3Q 4GLXA 1PVOA 2I5MX 1TWCH 1TXYA 3UDXA 4JI3L 4J15A 4HIMA 1XNRL 5JEAG 4JI7Q 4GKJQ 4R4QA 4DAYB 4JI1Q 2JA5H 4A3GH 2F4VL 4JYAL 4JV5L 2ZTCA 4JI5L 4DV0L 1TWHH 1I5FA 1GO3E 2R7ZH 5BR8L 1QVCA 4LUZA 1XPRA 4L5QA 3M4QA 3PUYA 1EQQA 2N78A 2F3IA 2LXKA 4JBWA 5HGQA 1JE5A 4BY1G 1S72A 1HR0L 3CCLA 3LGJA 3J80c 1U0LA 2B3GA 3CMEA 5LMNQ 1VQDA 3PCOB 3CC2A 1SLJA 4A3IH 1NBWA 3L7ZC 3G6EA 2BH2A 4P72A 2YYZA 1T9HA 2N49A 1EOVA 4JI2L 1KHIA 1UWVA 4DR2L 4JI4Q 1N9WA 3JAMi 2VUMG 3CXCA 3G48A 3OTOQ 1IBKQ 2NVYH 5HY6A 5IWAQ 2ZJRA 1B7YB 2GVAA 2ES2A 4OXPA 1QVFA 1PH3A 1K9MC 4OWWB 2ZTEA 1KQSA 2Y0SG 4JI0Q 4BXXG 2UXCQ 1I6HH 4OWTB 1EYGA 2R93G 4JOIC 4A3EH 1Y1WH 1XMQQ 3PF4A 1YHAA 5C0XG 2Q2UA 3GTLH 4BBRH 3CD6A 1NE3A 1YHQA 1NY4A 2JJQA 4X66Q 2JEBI 3G4SA 2EIFA 4LF5L 2JK8A 2LXJA 1HH2P 2WB1G 1IL2A 4A76A 1K0RA 3NBHB 4C2MH 4DV6Q 3HOVH 2VY3A 3M9BA 4QL5A 2UUCQ 2IT1A 4TQUS 1VQ4A 3AQQA 4GNXC 1WYDA 4R4CA 4Y7NH 4LF7L 1BBUA 2R7ZG 2B63H 1Q1EA 2RHQB 4HIOA 4LFBL 3GO5A 4AQYL 3CC4A 3CCVA 1E24A 4HJ8A 1K73C 4YHHQ 1Y1VH 2E2IH 1R9TH 4EX5A 1VQAA 1HNWQ 1Q1BA 2Q2TA 1Y14B 2N3SA 1WCMH 1J6QA 5AJ3L 4C3HH 5IYDH 3ICEA 5IYCG 4DV4Q 4C3JH 4YHHL 4NPSA 4XTCS 1IZ6A 4WJ4A 2IHEA 4GOPC 1PYSB 2ZJQA 1C9OA 2C35B 4DR3Q 3AEVA 2RCNA 3KYHC 2MO1A 4HJ9A 2JA8H 2YV5A 5GAEC 1N34Q 1UE5A 3L0OA 4JBJA 4DV1Q 4LF8L 5LMUL 4QQBX 4GKKL 4DR7Q 4KI0A 2CCZA 3UDGA 1A62A 2K75A 1VQ7A 4DUYL 1YZ6A 2UXDL 2CWAA 4RMFA 3RLOA 2KENA 4IPDA 4BBSH 1HZBA 3GDEA 1PH2A 2AKWB 1PFSA 3BJUA 4AYBE 3AYHB 1N32Q 5GQOA 4X66L 1OXXK 3F2BA 4PZ6A 4LUVA 1FGUA 1XMOQ 4X65Q 1X6OA 3DM3A 4JI8Q 1QUQA 4LFAL 2EQSA 4A3MG 1WJJA 5C4JH 4NXNQ 1H95A 4DPGA 1VQ8A 4UP7A 2UUAL 5GAGC 3M3YH 4JI0L 4IFDJ 1VQHA 1LM0A 1VQGA 1J5EL 2K14A 2YTXA 2R92H 1L0WA 1VS0A
chains in the Genus database with same CATH superfamily
2OXPA 4EQPA 1TWGH 2PZUA 3GTLB 5FKAC 4DV3L 3KXYT 4RCOA 2UUAQ 4ZI7F 3JAMc 3OTOL 4DR2Q 3K80C 1DOLA 3V4SA 1KABA 4ME6A 4O4IF 2K5DA 2W9BA 1N33H 1CTMA 5M3MB 1TWGA 4TUYF 4R8UA 5DNFA 2B2VC 4QWAA 4MTNA 3I3CA 2LSSA 3MVVA 1HQRD 4RZQA 2YU9A 3IAYA 5LMUQ 4IWXA 5BR8Q 4LF5H 1G291 2KEDA 3K5NA 4U7CA 1N32H 2JP1A 4GOPB 2VQFQ 3OMCA 2OCEA 2K4KA 4NXNH 4DV7H 1V43A 3P20A 1EWIA 5HV6A 4J9LA 4J9RA 4DL2A 5C5LA 5AJ3Q 1TWHB 4ED2A 1VQCA 1KLUD 5DM73 4RKLA 3EA6A 1AN7A 4YP3A 2FMAA 4J9MA 4RAZA 1SNPA 3WOEA 3RUZA 5M3MG 2UU9L 1STBA 1E7ZA 3E6ZX 3S16H 2DLNA 3BABA 3RBDA 3GTMA 1F9SA 3OMGA 4F4WA 1JDBB 3PR5B 5ELDA 3T5HA 1KDCA 4YCWA 2UVVA 4DR6H 2BQRA 2UUCL 2KCTA 4CJ1B 2L12A 1MJEA 5F9LA 3HOUG 1LTSD 1HR0H 5BR8H 5DG8A 1IYVA 1L1OB 5IGDA 2KEEA 2QYZA 1I4XA 1HNZL 3S2DH 2FPGB 3CHBD 2B2TA 2PZWA 3L2PA 3GV7B 3FRPB 2YRWA 1LT4D 2KHIA 4CC6A 3PIPA 5D3DA 3TP6A 3S24A 4M8AA 2VQEQ 2Y0SE 1LT3D 3STBD 3I4NH 3F8NA 1XWEA 2KVMA 2XRQD 3FKIG 1R4PB 4OO1G 4G3IA 1DONA 1PFMA 4ECZA 3N44B 4IFDG 1Y1VA 4FS1A 2UXBL 5CBEE 2OWOA 2ZM6H 5DM63 2DGYA 3VDYA 3TQYA 1R9TB 1M0TA 2NVXA 1D5ZC 3RD4A 5J3BA 1GM5A 4ZUJA 5KFGA 4N8FA 2HHHH 5ELFA 3MC0B 3RLFA 3A54A 3EROA 1DD2A 3DM1A 4BA2I 1TVXA 3U4ZA 1GLVA 3J7AK 4NMZA 2CW0C 2DNCA 1QB5D 1CA5A 1Q3LA 5K2MA 2I8CA 4RB3C 3BVGA 1HFGA 3MHBA 1C3OA 2XGPA 4RUAA 1NAPA 1JQYD 4YY3L 5M3FG 2K52A 4HN7A 2W70A 5L1JA 4H0LC 4BBSG 4DR5L 3MAQA 2EJFC 2F0IA 1O7IA 4IUUA 4L5SA 4KHZA 3VR6A 1HCZA 2R7DA 1A8VA 1Y69U 1VQLA 3V6KA 4DK6C 5C3EB 4UCOA 4J9SA 5C5MA 1VS0A 2GLTA 4XYMB 3KUPA 4UCVA 1Q82C 2MJ8A 2OEOA 1YBYA 1ULZA 1QWYA 3ULLA 4DK0A 3HOXB 3SR1A 4BWSC 4I7ZC 3PUVA 2IBKA 3OSNA 1VQBA 1EHIA 3HOWH 1SNMA 1A2TA 3JRXA 2WDTA 1HZCA 4HEDA 5D3IB 3BDCA 1VQNA 1AP0A 1GUWA 4UCUA 1OTCA 4LF9L 5EKKA 1PYBA 1Z7TA 4A3DH 4A3GB 5IE8A 3KBGA 1EY0A 3FEWX 2VUMB 1KJ9A 4UCSA 1SMYC 1TWCB 2W8LA 1SYCA 3EFXD 1PLFA 5C44H 1Y8PB 3GTOH 1FJGQ 3I12A 2F0JA 2ZXOA 2GN5A 2CQYA 1XX8A 2B2WC 1BR9A 1P8LA 4QWDA 3TMEA 5IGFA 2K5HA 3J7AF 1D7QA 5IGBA 4EEYA 3GTOA 4TV8F 4JG2A 2A19A 1PK8A 4IQZA 3J80i 2FJ2A 1MZBA 3E5NA 4ID6A 1PTOH 3G6JB 4EVOA 1V51A 4I55F 1S9FA 4PV1C 4DNRB 3FKIB 5IODA 2W6PA 5KT6A 3KBXA 4DN4M 3MJFA 2GPSA 3I56A 2PNHA 1N32L 1L2FA 4A3KB 3CRKC 3PO3B 1DGSA 2A69C 3UE0A 2Q2IA 3T4AC 3DWQA 5CV6A 2F0FA 1TIID 2JEGA 1VQEA 4ALPA 3OSPA 3K5IA 4RCNA 4IRKA 2PBZA 2XWBB 2HDLA 4GN5A 1IBLL 3UDIA 4Q0FA 3OW2A 3LWUA 1N33L 5EPJA 4XIGS 5JPMC 1CQFA 3JC66 1X32A 3HOWG 4O3RA 1PTOC 3SHLA 1BCPB 5FLMG 4DV3H 1ZEQX 2EVBA 4N9PA 1TKWB 2BDOA 1XNQL 2IJ0A 2L0CA 3J80E 4MTKA 1FGBD 5G3LF 4KK7A 4JI6Q 1O75A 4X62L 1WTXA 3GTKA 2PNRC 4A3IB 4OWXB 3RZDH 5DGAA 3HRZC 5GAHC 3RN5A 4RA8A 4P71A 2WE6A 1UEBA 3C1FA 3PIP3 4G7OC 1N36L 4A3FG 2C2RA 3H0GA 1UE1A 1VAJA 2WYOA 3S17B 4QF4A 1PYWD 3OYYA 1RHPA 1STGA 1T36A 2F0OA 1WTPA 4BWGB 1CKNA 5KFSA 1Q90A 4LF8H 3I4MH 1VQFA 1N36H 3KJOA 1S5CD 2NVXB 5C0XH 1R9TA 5C4HA 1LUZA 3GTJH 1JOKA 2NTSA 4RHSA 3M3YB 5FD6A 5CV9A 1XMQL 4P75A 2ZXPA 1L1OC 2J9GA 4FM9A 1EYAA 4HCEA 3KOJA 5KYLA 4OONA 4FDBA 4QB4A 4ED3A 2V4RA 1K83A 4JI6H 4HYKA 2AWOA 3MR3A 5DG9A 4GN4B 2YS6A 4AQYH 4JI8L 2PVPA 4IHJF 4LSXA 2UVRA 3KHLA 4XT3B 3HOUB 2XTIA 4K2LA 1HA6A 1IBLH 1TU2B 4C3HG 3J7ZC 1V1OA 1VCIA 2SDFA 3WWVA 1FKAH 1LTBD 2EOTA 5EOYA 2R8GA 5CBAE 2JA6G 1PH5A 2MPMA 4JI7L 5CR3A 3LX0A 3GTMB 4HMIA 4P73A 1IYJB 1YNJC 4PWQA 2B29A 4UY8C 2PMZB 1SCUB 4CDCC 2O2LD 1NR4A 2XGQA 2DWCA 2V4DA 1GD7A 2HGSA 5JJZA 4JV5Q 4IUTA 4A3BG 1QE6A 4IZOA 2BCOA 1O7ZA 4XXEA 4JI2H 2KSWA 2FXQA 2E2HB 3TZDA 3K3VA 4R8NA 3T1HH 3WDNA 1HZAA 1TR5A 4ZK9B 4A3BH 2NU6B 1RD9D 2NTTA 1F2YA 3PO2H 4FO2A 1X3FA 3F8TA 2Z6KC 4A3JH 4HNTA 4RNOA 5KFBA 2XIWA 3H91A 2DPJA 2XGTA 4Q44A 2FLNA 1CSPA 3NWTA 2KUMA 4LK1C 4YAJB 3NTKA 1S68A 1STYA 4F7XA 1K83B 3NHHA 3CC7A 1CM9A 4A3BB 2VOBA 1U4RA 3FPPA 2AU0A 4GN3B 2IMWP 1ONLA 4BA1I 3L4JA 1W96A 2M05A 5E3FA 5EWFA 3KHGA 4JI2Q 2PI2A 3AMUA 4IWYA 4EFBA 4IUQA 3T1HQ 3S15H 4LMYA 4GC6A 1MIUA 4OL7A 2WIIB 5CMDA 4G7ZC 5KFRA 1JX4A 1K28A 2Q2HA 2JA9A 2R8KA 1EQRA 3M7GA 4ECUA 3JZIA 3HOZH 3KFUA 1X3GA 2MQHA 4DR4H 2F4VQ 4WJ3M 2X6GA 3K58A 1CQVA 1STHA 5C6AA 1DOKA 4O3SA 1HUMA 2SEBD 4POFA 4DV2L 1RK6A 5KFDA 2RVLA 3GIKA 2L55A 3D0FA 1SNQA 3TIIA 4IZ8A 3MXNA 3AB9A 3P1HA 3PIOA 4IN3A 2C22A 2IHFA 2JEAI 3R93A 3QZ7A 3JSLA 3ERSX 4O0AA 3NQTA 4NB3A 3GTQB 2R82A 3R5XA 4I65A 4I50F 2JEFA 2RF4A 3MFGA 1BKBA 3IG0A 1DOMA 2MHVA 5LYJF 1IBKH 1YI2A 1EEID 2A69D 4CBVA 4DR1L 1K8AC 1WR2A 4KHPQ 2VPQA 2QW7A 2YU9B 3M9OB 2R8HA 5FLMH 3GIJA 2J4XA 3I4MB 1NMFA 4GLXA 5J2UF 5KFHA 3W3AA 1MD2D 1TXYA 4JI3L 4HAEA 1XNRL 5JEAG 1XYIA 4JI7Q 4R4QA 2JA5H 4JI1Q 4CKEA 4JYAL 2ZTCA 1STNA 4JI5L 3S1MB 1T5EA 3Q8SB 2UUBH 1BGWA 4GZYC 4LFCH 2N88A 4KKSA 3Q24A 2WAQB 5HGQA 4DV6H 3PQIA 4JV0A 3PW7A 2EPBA 2UUCH 1JOQA 3VPBA 4RGNA 1I4GA 3I91A 3N6XA 1S0MA 3CC2A 1A9XA 1SLJA 2NZ1D 3L7ZC 4A3IH 5CAEB 4P72A 1TAEA 4JI4Q 1KHIA 3BZDB 1N9WA 2VUMG 3CXCA 4UCRA 4HNUA 2F0KA 5D65A 1NNXA 2ES2A 1I3QA 3QG1A 5CB4F 5KT7A 1I6HH 4OWTB 1XMQQ 4YR3A 5C0XG 2BE5C 3R2IA 1NE3A 2R84A 5CA0F 4JI1H 1N34H 4A2BA 4LF5L 5KG6A 5KT2A 3O13A 2O5IC 1E2VA 4IR9A 1K0RA 3NBHB 2J6SA 4C2MH 1TY2A 1GXDC 3M9BA 1PX2A 5I47A 1D5XC 2DN8A 4NDXA 4RH6A 3GQCA 3ETHA 2IT1A 5C4XB 3AQQA 1Q8IA 5C5JA 4O3QA 4ECSA 4MAMA 2R7ZG 4ED7A 4HIOA 3GO5A 1PFNA 3CC4A 3CCVA 3MWYW 4YHHQ 1T94A 4YB8B 1GUGA 5IWAH 2X69A 1QJOA 5KIXA 2Q2TA 1Y14B 1WCMH 4JI0H 4OEMB 2MCTA 3VYTA 4XTCS 1M7JA 5KFKA 1HTLD 4GOPC 2ZJQA 1EYCA 2C35B 3AEVA 2R7MA 1EQTA 2W9AA 2M00A 1SMYD 2MO1A 2QILA 1UE5A 3I4LA 4LF8L 5M5YB 4C3JG 1H9MA 2Z6BA 3QR8A 4M9UA 4DLKA 2NN6H 3CRLC 2NWGA 1EIHA 2UXDL 1YZ6A 3RLOA 3WNZA 1TWAA 3KK7A 4BBSH 1PH2A 2W6NA 2K7VA 5IT9W 2AKWB 2FB9A 2AUJD 3BDOA 4AYBE 5FO8B 1N32Q 2W6MA 4O2AF 1GUOA 1M8AA 3I8ZA 1Z6HA 1X6OA 5M9OA 4X65Q 1ZHQA 1IOWA 5I6WA 3HOVB 2VQFH 3VYUA 2RGVA 5LL6S 1H95A 4MA0A 4DPGA 1Y1WA 1VQ8A 4UP7A 3J7AV 4HMJA 4IFDJ 1VQHA 1LM0A 3VYSA 1L0WA 2HUGA 1J5EQ 3B6YA 1TT2A 3Q8PB 1GUNA 2H1EA 3P7JA 5L9XA 1JT8A 4ED6A 3S2HB 3IRBA 3H0GH 4PNYA 1B6RA 1Z2NX 1L0XB 4JVZA 2W6OA 4DV5Q 4O4LF 5JJLA 4JCVE 1GYFA 1ILPA 5A2QL 1O80A 4YCUA 5GROA 1B70B 4IFDH 5DEHA 1PH8A 3ONAB 2EYOA 4OIKA 4Y8VB 3M4YA 3GTGB 4CHTB 3FMCA 4BS9A 2HDMA 4GKKQ 1W93A 3PGZA 1VQ9A 1S5FD 1HZ9A 3A5UA 2RSNA 3F2CA 1VQ5A 2BA0A 1SBBB 4J6HA 1OXTA 2JE6I 2CW8A 3HKZA 4KLKA 3CQZA 4BY1H 4A3JG 1SEBD 2K28A 2NUCA 3IFDA 2R8IA 2H5XA 1HPCA 4DR2H 2E2HA 2MFIA 3H3VH 1IBML 1U9RA 3S1QB 5ELOA 2E5LH 5JQWA 4A3CG 3RR5A 3GV5B 2WB1A 3MFHA 5C4JB 1OXSC 3KLRA 2YW2A 1STEA 4HR7B 2FPIB 1MSHA 4LAAA 4YBZB 4LFCL 3L3OC 2Z4IA 1FNWA 4A3MB 1G91A 2J6TA 1DZ1A 3UI2A 2RGRA 5KFQA 4CKCA 2UXCL 2NZOA 4AH6A 3J81i 1KLGD 4RB0A 4XT1B 1B8AA 1LTID 2EYFA 3QOJA 3M85A 5CV8A 4C3JB 5E4XA 2CW7A 2VQDA 2DUDA 2C00A 1KNEA 2VL6A 3QB3A 3S16B 1W6JA 4ABNA 3CQZH 2JA7H 4XYOA 3TQTA 3GP7A 2FMMA 3A8IE 2KOLA 3PW2A 4F50A 2UXBQ 4GS3A 3VA5A 4CDFC 5JJKA 1E2WA 3A55A 3NUCA 3GTGA 1X65A 3D4DA 3HKSA 1YJWA 3J80W 5C0XJ 2ASDA 1CKOA 5EKLA 2ALYB 4Y7NB 3P75A 2D5DA 4UHVA 2J0TD 3J81c 2HT1A 3GIIA 4C5AA 2Q8RE 3KALA 3NK9A 1OXUA 1HNZQ 3TQ1A 3FP9A 1XDNA 5JAVA 4XYLB 1HJPA 4QW8A 3OW7A 2QDBA 4F4YA 2F0HA 3HS0C 4K8IA 2XC9A 3LMLA 4WORA 4ZHQF 3W2DA 1YVCA 5KG1A 2ZM6Q 3NSWA 4XYQA 3C3LA 1U4LA 5JVH3 2J6UA 4RZRA 5LOVF 1A3TA 4N8X1 1BBWA 2UU9Q 3TEHB 1MGSA 2BOSA 5ELNA 1D6EC 1HTPA 1V1QA 3C1EA 4MV8A 3QIAA 2R7FA 3HKZB 1YIJA 1G8ZD 1PRTB 4XQQA 3V2TA 2VS1A 3OUUA 3K0XA 3TS0A 1HA5A 4JOIA 2EYHA 3U4VA 1ZHSA 4L1KA 2JA7G 1TS4A 3STBC 2QKIC 2D9UA 3KTMA 1A15A 2MGSA 1BQQT 3NEMA 4CDEC 4F4ZA 2L9HA 1RJRA 2RDIA 3G71A 1JJGA 3CQZB 1VBHA 2ASJA 3ORRA 2BH8A 4IPGA 2E75C 2D62A 2J7ZA 1C8CA 2R7KA 1I50B 4XQNA 1KAWA 1PZKD 1D1KA 3I90A 2AHOB 1UUPA 1EY9A 1IBMH 5K36H 3CVZA 4QGUA 5I9OA 2ZJPA 2UVWA 5LL6X 2R93H 3C0FB 4DV3Q 2EJMA 4P2CB 1S5ED 4O2DA 4AIMA 1RDPD 3PIO3 2JQOA 2Z4HA 1I94L 4IFDI 2HJWA 3KJPA 4A3MH 1U4PA 4B3RQ 5E4WC 4ZOLF 4B3SL 4JUZA 1UE6A 1SNDA 1KL9A 2EY2A 2NN6G 4KY6A 1X54A 2NYZD 2A8VA 5CV4A 2FKLA 2B2UA 1BVSA 5M3FB 2NU7B 2XSCA 1JWSD 1KXLA 1FJGH 1UNNC 2K33A 3MTSA 4BY1B 4MV4A 5FLXL 1K1QA 1IBMQ 3RTXA 4DR3L 5JEAH 3T5JA 3Q6SA 1G51A 3H3VI 1WCMG 2NN6I 5D1OA 1A3UA 5L37A 1AUVA 4A93H 4MNOA 3IKJA 2WAQA 1I7NA 3A0JA 2K05A 4YJ2F 1KC8C 2EY6A 4LFAH 3NELA 1ZYRC 4EG0A 1E1OA 4C2MA 3PUZA 3V4ZA 1SFOA 1PXUA 2R61A 4K0KL 2R7ZB 5FLXc 1WOCA 1SE3A 4DUYH 3H09A 2JA5B 1FNVA 1B4OA 1A63A 3SK6A 3HBLA 5HBRB 4IRDA 1M1KC 4BBRG 4DV5L 5M3FH 5KFOA 4F4XA 4IPCA 5F2DA 1X3QA 1Q7YC 2K01A 4O2BF 4RAYA 4I7HA 3HOZG 4B3RL 4DUZQ 3HOYG 2OQ0A 1Q12A 5CV7A 1WTQA 1B6SA 4X62H 1EUJA 4RG1A 3NBHA 1TS2A 4TVAB 3SDZA 4JV5H 4BBSB 1RKNA 4KN4C 2G5DA 3CCRA 3ULJA 4AYBG 4DGZA 4LNQA 4E4TA 5M5YH 4DKAC 3VPDA 5CA1F 5DQHA 4LF7H 5I4DA 1GGOA 2UXDQ 3GIMA 5FLXW 2NU9B 5KFXA 5J1ZA 4X3SA 2SOBA 1KD1C 1I50H 3I4NG 1CK1A 4LF8Q 4C3HB 2JA5G 1E4GT 4DV0Q 4TV9F 2W6QA 2XIGA 4HIKA 2H4OA 1VQMA 3GD7A 1I4PA 1KTKA 2E2IB 4NKLA 2E74C 3KF6A 1KJJA 1BBXC 2B8FA 2BE5D 3S15B 4EQ5A 4HJAA 1CUKA 4TRDA 2GPWA 3PO2G 1KBLA 3GTPH 5JOBA 4PDBA 4LH6A 5I2YA 4YR2A 4AYBB 2PCFB 4JC0A 1RCVD 1VDZA 4YWLA 2F0EA 2ZDHA 3F2UA 1KJIA 3R23A 2FLPA 3HOXH 4C2MB 1EIYB 4GLVB 3R5HA 2PW5A 5KFJA 3CU7A 1AE3A 3CMAA 1Q8KA 5IYBG 3N43B 3PW5A 1LTGD 2B39A 3U58A 2I0QA 1PH9A 2OH2A 4RB2C 4LF9H 1PRTF 4DV7L 1LT6D 5LHY1 1VMCA 4ZUIA 1NTGA 2C9OA 5FOBB 2QA4A 3LWBA 3L9AX 1AW7A 1XPOA 2JEJA 5EPLA 4KHVA 3EQLC 1V1PA 1A3VA 1HNXL 2RKSA 2PN1A 3ITPA 3RB3A 4MV7A 1TWFB 1L2ZA 1O7LA 1XTDA 1I7LA 2E2HH 3NTIA 3MWEA 2WKDA 4YCVA 2AUKA 3JRWA 5EWGA 5LMNW 4JI4L 1X3EA 3U9SA 1M90C 4NXML 2R6GA 3TP7A 5T1GA 2CVRA 3HKZG 3GTKH 2AQ4A 3KDFB 2TMPA 3I4OA 4DFAA 4FU0A 4ME3A 1EFID 3BZCA 5FPOA 4YY3H 4O3NA 3V05A 4KKUA 3PUXA 1CA6A 1KNAA 4F87A 4IPHA 4B3TL 1B50A 1Z2PX 2UUBQ 1S0NA 3DXJC 4LFCQ 1LABA 1Y8OB 4ECVA 3RIZA 3S2DB 1VF5C 4DNIA 1J8IA 4K6LA 3OUZA 2IY5B 1G6PA 1A0IA 3ULPA 1RTOA 5A2QE 5IY0A 3E3XA 1BCPC 3BU2A 1BNCA 4NXMH 3R2TA 1STAA 4ECQA 4JI4H 3VR2A 2FP4B 2R93B 5IGGA 4LF4Q 1Q46A 3BAAA 5BPHA 4DL6A 1YNXA 3GTJB 1V8QA 1TWHA 4IAJA 3QZ8A 3R8BA 2XCLA 3EYYA 1PTOF 2HQEA 4FNFA 4DV2Q 2UXCH 1SE8A 4DXFA 3TINA 4J9NA 5KNCA 4J0MA 1II3A 1CT1D 2F4VL 2A73B 1TWHH 1I5FA 1VMPA 1BXRA 1EYZA 2N78A 2LXKA 4JBWA 4BY1G 2QF7A 1HR0L 3CCLA 3LGJA 2F0LA 4ED0A 2E2IA 2JN4A 1T5XD 1NBWA 2BH2A 5C8YF 4LJZC 3DUZA 1A2UA 3QOLA 1Z2OX 3MFIA 5KT4A 1SNOA 1UWVA 4JI2L 3JAMi 3CKIB 4RB1A 4EGQA 5NUCA 2ZJRA 2W8KA 1PMRA 1PH3A 1HNWH 2B63A 4NP5A 2ZTEA 3H0GB 2YS7A 4ED8A 4QUFA 1JXLA 3Q1KA 4QCLA 2V9WA 4JOIC 2WB1B 4JV2A 1G2TA 1YHAA 3GTLH 5D1PA 1LO5D 1OWTA 1NY4A 3G4SA 4O1NA 2EYMA 2SNSA 2EIFA 4DV1H 2YRXA 4UFZA 3OOCA 3T51B 2LS01 4A76A 3HOVH 1MSGA 4Q8EA 4GNXC 3EJIA 1WYDA 2ATLA 2RDGA 1UNSA 2R93A 2PW7A 1XMOH 4X65H 4XX0B 3BG3A 4LFBL 4AQYL 2WACA 1CZWA 1M6VA 1LV9A 2E2IH 2HCCA 4EX5A 1D2BA 2EYJA 1GUTA 1SXTA 3VPCA 1Q1BA 1DXMA 4C3HH 5IYDH 4QW9A 5IYCG 4DV4Q 4C5BA 2UUAH 4C3JH 4MTEA 1XMQH 4YHHL 3M4IA 3T5KA 1PYSB 1C9OA 1SAPA 1JCKB 4DV5H 4HJ9A 2JA8H 1N34Q 2R87A 1Y8NB 3L0OA 1IKMA 4A3DB 1BCPF 5KFWA 4DR7Q 4KI0A 2CCZA 4EBEA 3DMUA 1VQ7A 1ILQA 1UC8A 2RBMA 4RMFA 2KENA 4IPDA 5D1OB 4PMCA 1GSAA 3BJUA 1XMOQ 4JI8Q 1QUQA 3D4WA 2EQSA 1WJJA 5C4JH 4NXNQ 4JV1A 5DGBA 5GAGC 2W6ZA 1VQGA 1J6QA 2R92H 3CCUA 4BY7H 2FJZA 2E76C 3LNNA 3HOVG 2P0AA 4C1NK 4QIWE 2IX1A 2RDJA 3MR6A 3H4BA 2C2EA 4LFBH 2HVSA 4DR3H 2AQ2B 4DAYA 1XMOL 4PZ8A 2BQ3A 3MEFA 4IURA 2W71A 2C28A 1LLRD 3D31A 1MKHA 1GVPA 2E8GA 2NB0A 1NUCA 5CV5A 4O3OA 3BQ2A 4DR6Q 3A74A 3K8AA 1C0AA 1TS5A 1K8GA 2JA5A 4F88A 2D2CC 5KFVA 2F0DA 4DR7L 3TZUA 3MA2B 1R4QB 2AGPA 1N34L 4KJOA 2NUAB 3CCEA 4JI1L 4JYAQ 2A68C 4A93B 4EBDA 2JA8G 1H9SB 4UPAA 4JI3Q 3MZ5A 5KFMA 3I2ZA 1PRTD 4DV4L 1JE4A 1EZ8A 1F9PA 4P74A 4X3KA 2F0PA 4LH7A 4FBUA 3MWMA 5IYDG 2VUMA 2EXZA 2YZMA 1SDFA 1BF4A 2F0QA 3K7UC 3KF6B 4C3IG 1E1TA 3JAMW 1K3BC 4BY7B 2DNEA 3CPFA 4LFBQ 2ZDGA 2N55A 1N33Q 2R92A 2HQLA 5EGTA 3S1RH 2F0TA 3LP8A 1QNUA 1RJPA 2G9HD 2NU8B 1ZKOA 3NGDA 5C4ZA 4QWCA 2HIXA 1GOZA 1QZHA 4WRDA 3GTQH 1PTOB 5GONF 3OIQA 3J81E 4JI5H 1UEAB 1DJRD 4M1UB 3SXHA 5EKIA 1YITA 4JI3H 2RA4A 3DEPA 4ZQ3A 5JVDF 2JA8B 2P5ZX 5D14A 4KY5A 3Q23A 2HD3A 3HOYH 4DR1H 4A3DG 1ZQ7A 3GTOB 1EFWA 2IX0A 3SK8A 5LL6b 3SE0A 3DLLA 4IO9A 2VUMH 5KFLA 1DM0B 2FFKB 5G3LD 3W5OA 1E3PA 3RGXA 2OLSA 1BOSA 3RB4A 1I6UA 4EQOA 2CQOA 1EU4A 4R4OA 3ZYYX 1XPUA 1HR0Q 3HOWB 2A6HC 2IW3A 3J7A5 3J81j 2V4QA 1MJCA 2FHTA 4MIUA 4JBMA 4I4TF 1G2SA 4B3TH 4CC5A 1GSHA 3PW4A 5KG0A 4APMA 3TP5A 5FK9C 2I5LX 4M7EA 1KAAA 1K83H 2IPKD 3KHHA 4EFEA 3A5ZB 3JAML 4PG3A 2VQEH 4MA5A 3GILA 2K03A 2L4NA 2EE1A 1CQIB 1WSCA 5DG7A 1GHKA 5C3EH 1PH1A 3A8JE 2E2JH 2RDFA 2VB2X 2OT2A 4ZLTF 3RF2A 1PHJA 4ZCKA 3H15A 2LMCB 4A3JB 5FD5A 3Q8QB 3PO2B 5H80A 3PZPA 2D0PA 4IOCA 1XTCD 1D8LA 4ED1A 3TN2A 1S3OA 2F3WA 5FJ8G 4A3LG 2R86A 4B08A 4HSVA 5IYBH 5EBCA 4C5CA 1HNXH 1AFPA 4B3TQ 2O5JC 2W9CB 3KF8A 4J9PA 4KMUC 4KJNA 1HQMC 1HNZH 2A1AA 1YEZA 5IYZF 1GUSA 2WFWA 5D8DA 3V6HA 4Q43A 3EBEA 4DAPA 1UE7A 3GTMH 4OO1H 3D8GA 1X3PA 3HZXA 4QIWB 4L5RC 5JVLA 3FHWA 5K36G 4XZ3B 3E9IA 5C3WA 4B9XA 1VQIA 4OELB 1JMCA 2YU9H 1H9JA 1BXTA 2E5LL 1RIPA 1ASZA 5E1FA 1EEFD 5IT9L 1SYFA 5L1LA 4A3IG 4Q0YA 4GC7A 1NMGA 4IRCA 4WFN3 2UU9H 1Y1VB 4H02A 3HOUH 2XNAC 1IYUA 4KKTA 5KRUA 1JWMD 2EY1A 1HNXQ 3OSOA 4RGOS 3E0EA 4CJ2C 4NLGA 5KT5A 1PDQA 5CC4A 3FDSA 3U9TA 4QJFA 3TDQA 4DAMA 4K5WA 5JH7F 3UE1A 2BA1A 1EQVA 2VA3A 3S1QH 2HCIA 3GIQA 1X9NA 1CHQD 3ER0A 2NVXH 5I9PA 3QFFA 4R4IA 1V9PA 3U50C 3AFQA 4O42A 1SYGA 4L5TA 1F77A 1IHZA 2KHJA 3AU7A 3GQBA 1OXVA 4LWCA 4A3GG 5KG3A 4UCTA 3GTKB 2FMCA 1GKHA 4X62Q 4DUZH 2ALZA 4UP9A 4JI6L 5EJWA 1XNQQ 3K5HA 4K14A 4JK1C 1Y1VG 1B1ZA 1EIGA 2ZDQA 2YTVA 3AFPA 1QG7A 1M4VA 1QCBD 4J1MA 5JVG3 5IT9c 4FXDA 3GTGH 1U4MA 4A3FH 1N8RC 1QNKA 2KCNA 1TWFH 3VR5A 2VQFL 4K5XA 3R3OA 1IBLQ 1SYEA 2ZT9C 3M4OH 5GADC 5HGTA 2WTFA 1FL0A 2PMZE 5C3EG 3RJ0A 4KY7A 3S2HH 3E0JA 4QWEA 4LSAA 4GNXA 2ASBA 3G8CA 3MXGA 4UAIA 4RNMA 2AQ1B 3TS2A 5L1KA 4BXXH 4U673 3DWAA 4DL4A 4YR0A 1CKNB 1JWUD 2F0VA 2I46A 1TQOA 4KTAA 1ICWA 5C4XG 1J9OA 2B2UC 3MEHA 3MR5A 3M7NA 2WAQE 3CCJA 2ATWA 1IW7C 3UDFA 3KLWA 5IWAL 2XWJB 4DUZL 1KC7A 4ME5A 2Y0SA 4YIJA 2Z8LA 4LFAQ 1D5MC 2FINB 4R8IA 3GIPA 1TA8A 2CFMA 1AE2A 1FJGL 2K5NA 4YWMA 2I07B 1TWCA 5J2TF 3T16A 4H13C 4HR7A 3OPOA 2B2YC 3S1NH 3PF5A 3RV3A 4K0KQ 3Q8RB 5JUMA 2XCPA 4DL7A 4LF9Q 4DV1L 4MV6A 4CKBA 2QDLA 5H1SE 1FVIA 1XXGA 5T1IA 3G6XA 2QEJC 4B3SH 2CKZB 2WAQG 1ET9A 2AGQA 2UVUA 1YJNA 1JORA 3W1BA 1SN8A 4DF7A 5ISRA 4FF3A 1I94H 1HNWL 1EL0A 4J8QA 1AZQA 4A93G 3J81W 1AEXA 3HEJA 1O7YA 5DLGA 1S10A 5DLQE 3SEBA 3X3MA 2I80A 2RHSB 4A3EG 1Y1WG 1X56A 4FXKC 3E5SA 2Q8TA 4LF7Q 1ESRA 4GLAC 5M5XH 2VXWA 3TBIB 4ZQIA 4C3IH 1JIHA 4AYBA 2XN9C 3CCQA 2CHBD 4LW1A 4DV6L 3EPGA 4OO1I 1I6HB 1C4QA 3PN1A 1I4HA 2Q8IB 4DV0H 4R4TA 2IX3A 4IJHA 4B3SQ 3EIVA 3D6CA 3S17H 4WJWA 2YZGA 3RUPA 2F0UA 3M9MB 5KGUA 3BA8A 3BJYA 3J7YW 3A8KE 4BY7G 1BJTA 5IGCA 2NZHA 2EZVA 1I94Q 3ERQA 3K7AH 2RDHA 1EUCB 3NBIA 4OHJA 1Q86C 1IBKL 3H4DA 1GHJA 4TQRA 4UP8A 3WOFA 4MV1A 3IL8A 3I4MG 4HIDA 4RU9A 1LTRD 4ZKBB 1TWAB 2VA2A 2EYLA 4KHPH 2MNAA 3D4RA 3VR4A 2VQEL 5DQGA 3N52A 4DR5H 2WP8J 4DV2H 4KN7C 2YTYA 5IP9G 3BZKA 4GKJL 4GKJH 1CE8A 2A6HD 2GVBA 3ND8A 3MXPA 3I4NB 3OWEB 5KFFA 4YWKA 2L1BA 4GNXB 3FPUB 2B2YA 5CORA 4QY7A 4I7AA 3Q0AA 3CW2C 1SE4A 4B9WA 4O3PA 4FXGC 5TSSA 4A3KG 1L0YB 1SEIA 4WD3A 4XQJA 4POGA 3S9WA 4RWSC 5KG2A 2ZM6L 5IP9H 3E9HA 3PV0A 3SE7A 5C3XA 3K5OA 3KLSX 2GA4B 4B3ML 1WI5A 4RGTA 3GTJA 4KV6A 2MP1A 1SE2A 3WO1A 1F2ZA 3T1YH 3HOZB 1FYCA 5C44B 1PVOA 2I5MX 2IP4A 4HIMA 2Y0SB 4A3GH 2RCFA 3UQ8A 1GO3E 2FK2A 5BR8L 1BUVT 1NCVA 1XPRA 1I50A 4L5QA 3M4QA 4DXGA 3M4OB 1EQQA 4MV3A 2F3IA 1S72A 2JA6B 5M5WB 1U0LA 4RAUC 3M9NB 2B2WA 2CW0D 4A3FB 1VQDA 4DL5A 3PCOB 1EUDB 4ZRZA 3G6EA 4FBTA 1EZ6A 4OGQC 5LA6F 1KDAA 4DR2L 5C1OA 2PO4A 5ELEA 3OTOQ 5IWAQ 1EY6A 1E4FT 2GVAA 2NVTB 2L5TA 4OWWB 2Y0SG 4ECRA 1ENAA 2QCPX 4JI0Q 5KFIA 4BXXG 2UXCQ 4DV4H 2YZNA 2Q2UA 3BA9A 3PMFA 4C1NI 4DNTB 3CD6A 4G4KA 2Z1CA 1YHQA 1HUNA 2JJQA 1RTNA 2JEBI 5HURA 4X66Q 4DA2A 5CYUA 2WKCA 2CH4A 2WB1G 3A7LA 4QL5A 5A2QW 3H40A 1JKJB 1V1PB 2F0WA 4TQUS 1IW7D 4R4CA 4Y7NH 1BBUA 4QWBA 4DU9A 3K5LA 2B63H 1Q1EA 4JI8H 3T5LA 4IR1A 1E24A 4K8JA 4PMBA 1UC9A 2KJXA 5KT3A 3OTOH 4DL3A 1Y1VH 5ELBA 1VQAA 2JA7B 5BN5A 1B2TA 5DLFA 5COYA 5KFZA 1J5EH 1C30A 4FS2A 5IOCA 2PMZA 3ICEA 2G9DA 2E2DC 5EBDA 2A6ED 4WJ4A 2IHEA 1D1IA 1RODA 1K8MA 3KYHC 2K6AA 3JAME 1VBGA 2X0SA 2YV5A 3BYYB 5GAEC 5KX5F 4JBJA 3OHBA 4QQBX 4GKKL 3IN5A 3BYTB 3UDGA 2CQAA 4HQ6A 4DUYL 2LKVA 2C5CA 3GV6A 3RMHA 2CWAA 3HG9A 1IKLA 1OXXK 2OF1A 3T13A 4LUVA 4ZKCB 3DM3A 1MBYA 2BQUA 4YHHH 2EY5A 5J22A 2C2DA 1T3NA 4RKBA 2VB3X 3M3YH 2W7OA 2IA6A 3IFTA 3I72A 1J5EL 2K14A 1CZGA 2YTXA 3VYRA 3URYA 1ML0D 1SR3A 5KNBA 1O78A 2TSSA 4A3EB 1Y1WB 1W6KA 2E2JB 3EN2A 4X65L 2MO0A 2E5LQ 4WBNF 2W9BB 4X64L 5KFCA 4HNVA 1PTOD 4LF6L 3V96A 1YJ9A 3VR3A 5LMNL 1HFNA 3GIDA 4JBKA 3EVQA 3ZJYC 3BQ0A 4J9QA 2IL8A 2L11A 5LXTF 1V4YA 2JXMB 1JJ2A 5IT9E 4Y52H 3H20A 4EYIB 4A3CH 3CPWA 5DQIA 4ECTA 1EWCA 2CZGA 3RNUA 5M3MH 1XJVA 1TY0A 4R1JA 1TS3A 5FO7B 3SGIA 4DK1A 5JJIA 1ZYRD 1WTHA 3S14H 3Q2OA 4R7RA 4FF4A 5KNDA 4IALA 2R8JA 3R5FA 1CS0A 1VQ6A 1P16A 1OO9B 1W3SA 3TIGA 1CQJB 1SRUA 1C7YA 3GV8B 3PO3H 4V190 1EY8A 2ZJTA 3HXLA 3GTLA 5KFNA 3OHXC 4PQXA 1KIXA 5BMVF 1S5DD 3U9OA 2A5HA 3KAJA 3MR2A 1E4EA 4LF5Q 2NBFA 1VKZA 2KA7A 3TP8A 4JYAH 1I3QH 2QEXA 1VQOA 3H0GG 3N42B 1XNRH 4RGMA 1LT5D 5BN3A 3TRZA 5KG4A 1JR0D 3T1YL 1DCZA 3SK4A 2CH4W 3CF5A 1EOTA 5L1IA 1RF2D 4F8MA 5IGEA 3CCSA 1SFOH 1LACA 1WCMB 4OX9L 5ELCA 1JOOA 3NTHA 2K50A 2R85A 2FK3A 1JDEA 4U6PA 1TWAH 3MFYA 3GV3A 3RAQA 1YNJD 4QUCA 4IUNA 1MHWC 3H6MA 3RZOH 4S3SA 1B3QA 5FJ8H 5T14A 4EYHB 1JICA 2MUYA 3OIPA 4RNNA 1QZGA 4PZ7A 5C4XH 1EY4A 4FF2A 2YL2A 3RFCA 2R7LA 4JI5Q 1BCPD 1N56A 1PA6A 4MHEA 4RUCA 2KCMA 1XNRQ 4DR4L 5KFUA 1S0OA 3A56A 1MI2A 1YNND 1E4EB 5EDWA 3G6VA 4BBRB 1I4RA 3K81C 4JPBW 2HHHL 4KHPL 5IP7H 2EXDA 1SYDA 4DR1Q 3H3VC 3PO3G 2R7ZA 2F52A 4ECWA 4ECXA 2VZAA 1Q81C 2DZDA 1EYDA 5JPNC 4A75A 1B9NA 2AMCB 5E7NA 4IOAA 5M5XB 3HFZB 2UXBH 1ZXTA 2HHHQ 2QK4A 3DEOA 2KECA 5KFYA 1B3AA 2B8GA 5A35A 4ZYSA 3HGBA 1WVLA 4QMGA 4Z9CB 2B63G 1SSOA 1HR0W 4OIJA 3S1MH 1F2MA 2IWHA 4LMQD 1ESFA 3BVZA 2EDGA 1AH9A 1AZPA 3F2DA 4N9TA 3I7FA 4DR6L 1JB7A 2VW9A 2V1CC 3T1HL 2B2TC 2HIVA 3CAMA 1SYXB 2V59A 1FD7D 3BDLA 4HJ5A 5C44G 1DV1A 3BG5A 3FVQA 1IL8A 2R92G 3KLSA 2BR0A 3KHRA 1H9RA 1I3QB 4ODGA 4XDXA 1WTRA 2B63B 1HXYD 3KAKA 4ECYA 5IIFA 4R8UB 4EQNA 4Q5VA 4NXNL 1DYQA 2K5QA 2XRSD 5KFTA 3RB0A 4DK3C 5J39A 4H44C 2VNUD 3GTQA 3GTPA 4J9KA 3RAXA 1ET6A 1PV4A 3A7AB 3ND9A 3ETJA 2X6LA 4QIWA 2WB1E 2ENBA 5DAUA 5KKNB 3N40P 3SK5A 1F2LA 2NVQB 3RB6A 1RYRA 1VQKA 4LF6H 1EY7A 2FE3A 3BVMA 4A4IA 1WTOA 4X64H 5KFPA 4J9OA 1KEEA 3UFXB 2I5HA 1K1SA 3DWPA 5IYCH 2NVTH 2XCAA 3F1ZA 3MXNB 4JV5L 3JSNA 3N41B 3TREA 3NPPA 4CGYB 4L8JA 4PMWA 4RFBA 3X3NA 1IXRA 4H7BA 1K3RA 1LTAD 2Z6KA 1QVGA 3I70A 1PFBA 2JA6A 4A3LH 4KD4A 2LFNA 3RGZA 4B3RH 4L63B 3HKZE 1SMXA 1ENFA 4AQYQ 3RBEA 4G57A 1ASYA 2AGOA 2XVSA 1JC7A 4GOPA 2JA6H 1B04A 4YAKB 4Q8FA 1PRTC 1LYLA 1KRTA 1G6ZA 2A6EC 3VA7A 1JB3A 5KEEA 1S40A 4O4HF 1C48A 2UXDH 3HB9A 1NSNS 2V58A 3KDFA 1CKMA 5JEAJ 1CSQA 2Z0SA 4K6DA 1BNZA 1DV2A 4K0KH 2R7NA 4LF6Q 2NVQH 1TWGB 4X3UA 1B53A 4X64Q 5KFAA 4CJ0B 2JEIA 4E6IA 2DJGC 4IUVA 4L6TB 3W1GA 1M0WA 3NE5B 2ASLA 2DPIA 2RQXA 2R6FA 3QWNA 4X3TA 3HP3A 1FNUA 4CDDC 1TWFA 1XNQH 3M4PA 3RV4A 4ETSA 1E22A 2VPSA 2K5VA 1RL2A 2F4IA 4NW2A 5K5PA 1KJQA 5AFWA 1WH2A 3K0YA 3K57A 2W9CA 2W7PA 1L1OA 1Z47A 1W2BA 1U5KA 3NENA 3I73A 2M2LA 2QGQA 4HSPA 4DUYQ 2RSOA 4K2KA 1SJHD 4ILWA 4HCSA 4X6AH 4R9WA 5C0XI 1N36Q 1JLLB 1SROA 3RN2A 1H9KA 1K8OA 4A2AA 2HVRA 1YHBA 5BN4A 5C1PA 1ZETA 3G7LA 4EBCA 1B33N 3OHAA 4C56C 3OWFA 3QJYA 1PZJD 2F3VA 1SJED 4IUPA 1F9RA 1CI3M 1RJQA 2ZXRA 2KBNA 3G6YA 4LF4L 2F0GA 2D0OA 2PI2E 4HTHA 2ID0A 1LTLA 3K7AB 3J81L 2N8NA 3NWSA 1HRJA 3TSSA 5KG7A 1PH6A 4EGVA 1YNNC 3C2PA 4FF1A 2OTLA 3PSIA 3FDTA 3Q8DA 3SI8A 2PQAB 2FK1A 2V5AA 2WINB 2CWPA 2UUBL 4DR4Q 2F4VH 1S4ZA 3C46A 4MN3A 1NJIC 2NVYB 3FMAA 3CCMA 5F9NA 2DJFC 4ULLA 2OQKA 5I6YA 2JYOA 3T53B 2PYKA 5IP7G 2SCUB 3PUWA 3NXWA 5KG5A 1RYSA 3RZDB 1WFQA 4B3MH 1K0SA 1PZID 2OTJA 5M5WH 4IJLA 4NXMQ 3GTPB 1WTVA 3K59A 3RLNA 2FPPB 1F9QA 3RZOB 4OX9Q 3KF8B 1KRSA 1EZ1A 3K5MA 3PVXA 4APVA 3I55A 3BQ1A 1VQJA 2EJGC 2R3ZA 4JW0A 1PH4A 5BPFA 2LY7A 1UAPA 2A68D 2B2VA 3T1YQ 3D6WA 1SFOB 1AN8A 3EPIA 1QILA 1QUQB 3J80L 1ENCA 3S1NB 4YQWA 1BDOA 3HOYB 3NP8A 1PH7A 3MWDA 4MV9A 4EEQA 4A3KH 4DV7Q 3BS1A 4KD3A 4LUOA 1B44D 5I2XA 2ICEC 4MZ9A 2KCCA 3DF7A 1CHPD 2F1MA 1WTWA 3FKIH 4EGJA 5EWEA 1S97A 5EAYA 2NVYA 4B3MQ 3H94A 3HOXG 1I6VC 1Z9FA 2F0MA 2EYPA 3DHQA 2M9VA 3K3PA 4HJ7A 3N6RA 3FKIA 4OX9H 1QOHA 1JJCB 1KDBA 1HHVA 2PQAA 3S1RB 1VQPA 2F0NA 1EWHA 2AWNA 1B9MA 2ZTDA 2HVQA 4DR5Q 2L15A 3N8DA 1EIFA 1GJXA 1X55A 4YY3Q 3CP0A 1DIKA 1TWCH 1H9SA 3UDXA 1LTTD 1S5BD 4J15A 4GKJQ 1SNCA 4DAYB 1EY5A 3S14B 5KYIA 2XD4A 4DV0L 4V0BA 1WD0A 1WCMA 2R7ZH 3V6JA 1QVCA 1VF7A 4LUZA 3PUYA 2VUGA 1JE5A 2ICIA 3D3RA 3J80c 3ORQA 2B3GA 4K5VA 3CMEA 5LMNQ 2YCHA 1I4QA 1A6XA 2YYZA 1T9HA 2N49A 4RHRA 1EOVA 2DIKA 2K32A 1S03G 2F0SA 3Q22A 3G48A 2KQ3A 4LF4H 1IBKQ 2NVYH 4UDUC 5HY6A 1ICFB 3PW0A 1B7YB 4OXPA 1QVFA 1K9MC 1KQSA 1NR2A 4MTDA 3SVMA 3QO2A 2R93G 1EYGA 1IOVA 3PF4A 4A3EH 1Y1WH 1RK5A 1E2ZA 2BDNA 2K1BA 4BBRH 1BO0A 4FYDA 4JI7H 2R92B 2YYAA 4C3IB 4YJ3F 2KHSA 2W57A 2JK8A 2LXJA 1HH2P 1IL2A 4Q45A 4ZAIA 4DR7H 4DV6Q 1KJ8A 1EU3A 2VY3A 1E0BA 2UUCQ 2PPBC 3VMMA 2AQ3B 4FP5D 5LMNH 1VQ4A 4LF7L 1AUXA 2SNMA 2RHQB 5EQ0A 4U68A 4HJ8A 1K73C 1CFMA 4TSSA 1R9TH 1RJTA 2I87A 1HNWQ 4G7HC 2JA7A 2N3SA 2A74C 1FR3A 1WD1A 5AJ3L 2K5WA 5LP6F 5FLXE 1GSOA 3WO0A 4NPSA 2Z9HA 1N48A 1IZ6A 2DY7A 4DR3Q 3NQIA 2PQEA 2RCNA 3PR4A 2O03A 2DY8A 4FVMA 4X66H 4DV1Q 5CGKA 2F03A 5LMUL 3MXUA 5FPRA 4TQSA 1A62A 2K75A 3GLKA 5EZYF 1HZBA 2K04A 3GDEA 5EPKA 5LMUH 5KFEA 1PFSA 4GKKH 3AYHB 5GQOA 4X66L 3F2BA 3L4KA 4PZ6A 3T56B 2O4XA 2VR1A 1FGUA 4DAVA 2FLLA 4LFAL 5FO9B 4A3MG 1SYBA 3LWEA 2WV6D 3K6OA 2UUAL 2PZTA 4TKOB 4JI0L 2JSOA
chains in the Genus database with same CATH topology
3B6YA 1TWGH 3HOVG 1SR3A 4DV3L 2UUAQ 4QIWE 2IX1A 3JAMc 3OTOL 1JT8A 3IRBA 3EN2A 4DR2Q 3H0GH 3K80C 4X65L 2MO0A 1XMOL 4PZ8A 4DV5Q 3MEFA 2E5LQ 4X64L 4JCVE 5JJLA 3D31A 1MKHA 1GVPA 4YCUA 2E8GA 1B70B 5GROA 5LMNL 1YJ9A 1PH8A 1J5EQ 3A74A 3K8AA 4DR6Q 1C0AA 4JBKA 1K8GA 4MTNA 2LSSA 3ZJYC 4DR7L 4GKKQ 5LMUQ 3PGZA 5BR8Q 1JJ2A 1HZ9A 1G291 3A5UA 1VQ9A 4Y52H 1N34L 4A3CH 3CPWA 4GOPB 3CCEA 2VQFQ 4JI1L 3F2CA 1VQ5A 2OCEA 4JYAQ 2BA0A 2K4KA 2JA8G 4UPAA 3RNUA 4JI3Q 1V43A 3I2ZA 1EWIA 5M3MH 4DV4L 1XJVA 4R1JA 4P74A 3SGIA 1OXTA 5AJ3Q 2JE6I 1VQCA 5JJIA 5IYDG 4KLKA 3S14H 4BY1H 4A3JG 5M3MG 2UU9L 3S16H 1E7ZA 3K7UC 2H5XA 1E1TA 3KF6B 3CPFA 1VQ6A 1P16A 1W3SA 2MFIA 3H3VH 4LFBQ 1N33Q 1IBML 2HQLA 5ELOA 4A3CG 3RR5A 3S1RH 1SRUA 1C7YA 3PO3H 1OXSC 4YCWA 1KIXA 2UUCL 2KCTA 1MJEA 3HOUG 2HIXA 1QZHA 3GTQH 4LFCL 4LF5Q 1L1OB 1HNZL 3S2DH 1I3QH 2QEXA 1VQOA 3H0GG 3L2PA 1YITA 2KHIA 3PIPA 3TRZA 2UXCL 2NZOA 4AH6A 3J81i 3T1YL 3S24A 3I4NH 2VQEQ 2Y0SE 3STBD 3HOYH 1B8AA 3FKIG 4OO1G 3M85A 4A3DG 3CF5A 2DUDA 3CCSA 4IFDG 1SFOH 1EFWA 2UXBL 2IX0A 2VL6A 4OX9L 2OWOA 3DLLA 2K50A 4IO9A 3CQZH 2JA7H 2VUMH 2DGYA 3W5OA 3VDYA 1E3PA 1TWAH 3TQYA 2UXBQ 4GS3A 5JJKA 5J3BA 2CQOA 1GM5A 4R4OA 1XPUA 3RZOH 1X65A 3HKSA 5FJ8H 1YJWA 1HR0Q 3RLFA 5C0XJ 1CKOA 2ALYB 3J7A5 4BA2I 3J81j 3U4ZA 4PZ7A 5C4XH 3J81c 1QZGA 1MJCA 4JBMA 2HT1A 4JI5Q 1PA6A 2I5LX 2KCMA 1OXUA 1HNZQ 1XNRQ 4DR4L 3FP9A 1K83H 4YY3L 5M3FG 2K52A 1HJPA 4BBSG 4DR5L 3A5ZB 1O7IA 4PG3A 4LF6L 3K81C 2HHHL 4L5SA 4KHPL 4KHZA 5IP7H 2EXDA 4DR1Q 2R7DA 3PO3G 1A8VA 5C3EH 1PH1A 1VQLA 2F52A 4DK6C 2E2JH 2VZAA 1YVCA 2ZM6Q 1Q81C 3H15A 1PHJA 4A75A 1Q82C 2AMCB 2D0PA 5E7NA 4IOCA 4IOAA 3HFZB 1D8LA 1BBWA 1YBYA 2UU9Q 3TEHB 3ULLA 1S3OA 5ELNA 1V1QA 5FJ8G 2HHHQ 4A3LG 2R7FA 5IYBH 1YIJA 2VS1A 3K0XA 3PUVA 3TS0A 4JOIA 4B3TQ 1VQBA 3U4VA 3HOWH 2JA7G 1HZCA 3STBC 2B63G 2A1AA 1YEZA 1HR0W 1VQNA 2WFWA 1OTCA 4LF9L 1PYBA 3EBEA 3NEMA 3S1MH 4A3DH 1UE7A 3GTMH 5IE8A 3G71A 1AH9A 1JJGA 2BH8A 3CCUA 4L5RC 4IPGA 3F2DA 3FHWA 2D62A 3I7FA 5C44H 4DR6L 5K36G 3GTOH 1FJGQ 1JB7A 2VW9A 2V1CC 3E9IA 1KAWA 2GN5A 2HIVA 3T1HL 1VQIA 2AHOB 1JMCA 2YU9H 2E5LL 1RIPA 1ASZA 3CAMA 1P8LA 4HJ5A 4A3IG 5C44G 1D7QA 2K5HA 4QGUA 1NMGA 2ZJPA 2R93H 2R92G 4H02A 4DV3Q 4O2DA 4AIMA 3HOUH 4JG2A 2A19A 2JQOA 1I94L 4IFDI 3J80i 1HNXQ 3KJPA 4A3MH 4B3RQ 3E0EA 4NXNL 4DK3C 4QJFA 4B3SL 2VNUD 4DAMA 3I56A 2PNHA 1N32L 1L2FA 3UE1A 1DGSA 2BA1A 1PV4A 3UE0A 1UE6A 2Q2IA 1KL9A 2NN6G 3S1QH 1X54A 2WB1E 2A8VA 1X9NA 1BVSA 1VQEA 3ER0A 4ALPA 2NVXH 4R4IA 1V9PA 1VQKA 1KXLA 3U50C 3AFQA 4GN5A 4A4IA 3UDIA 4L5TA 1IBLL 3OW2A 2KHJA 4LWCA 1IBMQ 1OXVA 1N33L 4A3GG 4DR3L 2I5HA 4XIGS 5IYCH 3JC66 2NVTH 1G51A 3F1ZA 3MXNB 1WCMG 2NN6I 3H3VI 1GKHA 3TREA 4X62Q 3HOWG 5FLMG 4UP9A 4PMWA 4JI6L 1IXRA 4MNOA 1XNQL 1XNQQ 4A93H 1K3RA 1Y1VG 2Z6KA 1QVGA 4JI6Q 3A0JA 2YTVA 3AFPA 4X62L 4A3LH 4OWXB 5IT9c 3RZDH 1KC8C 3HKZE 1SMXA 5GAHC 4A3FH 3RN5A 1N8RC 4AQYQ 3NELA 4P71A 3GTGH 1TWFH 1UEBA 1E1OA 2VQFL 1ASYA 3PUZA 1N36L 4GOPA 1IBLQ 4A3FG 2JA6H 3M4OH 1LYLA 1KRTA 5GADC 4K0KL 1UE1A 1S40A 5FLXc 1WOCA 1FL0A 2PMZE 5C3EG 3KDFA 1CKMA 3OYYA 5JEAJ 1CSQA 2Z0SA 1A63A 3S2HH 4GNXA 1CKNA 4LF6Q 2ASBA 1M1KC 3I4MH 1VQFA 4X64Q 4BBRG 3KJOA 2NVQH 4DV5L 5M3FH 3W1GA 3TS2A 4IPCA 1LUZA 3GTJH 1Q7YC 4BXXH 1XMQL 4P75A 3HOZG 1CKNB 1L1OC 4B3RL 4DUZQ 3HOYG 2OQ0A 1Q12A 3KOJA 1EUJA 4OONA 4RG1A 4FDBA 5C4XG 3M4PA 3M7NA 2WAQE 4TVAB 3CCJA 3UDFA 5IWAL 3KLWA 4DUZL 2AWOA 1E22A 2ATWA 4GN4B 4LFAQ 4JI8L 2K5VA 1RL2A 3CCRA 2CFMA 2XTIA 1AE2A 3ULJA 4AYBG 5M5YH 4DKAC 4LNQA 1L1OA 1Z47A 2K5NA 1W2BA 1U5KA 4YWMA 3J7ZC 1FJGL 3NENA 4DUYQ 2QGQA 1VCIA 2UXDQ 3WWVA 3S1NH 3PF5A 4X6AH 4K0KQ 5C0XI 1KD1C 1I50H 4LF9Q 3I4NG 4DV1L 4LF8Q 2JA5G 1N36Q 5H1SE 1FVIA 4DV0Q 1SROA 3RN2A 2CKZB 2WAQG 4HIKA 1PH5A 2JA6G 4JI7L 1VQMA 3GD7A 1YHBA 1YJNA 4P73A 1IYJB 3KF6A 3W1BA 1SN8A 2B29A 4UY8C 4EQ5A 4HJAA 1CUKA 1HNWL 3PO2G 3GTPH 1GD7A 4A93G 2KBNA 4JV5Q 4JC0A 4LF4L 4A3BG 4YWLA 2D0OA 2PI2E 5DLQE 3HOXH 2FXQA 1LTLA 2ID0A 2N8NA 1EIYB 2RHSB 4A3EG 1Y1WG 1X56A 4LF7Q 1HZAA 1PH6A 4A3BH 4GLVB 4GLAC 5M5XH 1AE3A 4C3IH 1Q8KA 5IYBG 3CMAA 2OTLA 3PO2H 3PSIA 3CCQA 1X3FA 3F8TA 3U58A 2Z6KC 3Q8DA 4LW1A 4DV6L 2PQAB 4A3JH 1PH9A 2I0QA 4OO1I 2CWPA 4DV7L 2UUBL 2XGTA 1CSPA 1NTGA 4R4TA 2QA4A 4IJHA 4DR4Q 4B3SQ 3EIVA 3S17H 1XPOA 1NJIC 3CCMA 1HNXL 4BY7G 3CC7A 2OQKA 2NZHA 1I94Q 1XTDA 5IP7G 4GN3B 3PUWA 3K7AH 2E2HH 1WFQA 4YCVA 4BA1I 1Q86C 1IBKL 4UP8A 4JI2Q 2PI2A 5M5WH 4IJLA 1X3EA 5LMNW 1M90C 4JI4L 4NXMQ 3RLNA 4NXML 2R6GA 4OX9Q 3KF8B 1KRSA 4HIDA 3T1HQ 3I4MG 3GTKH 1MIUA 3HKZG 3S15H 4APVA 4BY7H 3I55A 1VQJA 3KDFB 3I4OA 1PH4A 2MNAA 2Q2HA 4ME3A 3BZCA 2JA9A 2VQEL 3T1YQ 2WP8J 1EQRA 3HOZH 2YTYA 3KFUA 5IP9G 1QUQB 1X3GA 2MQHA 2F4VQ 3BZKA 2OTJA 4WJ3M 4GKJL 3PUXA 2GVBA 1PH7A 4IPHA 4B3TL 4A3KH 4DV7Q 2UUBQ 4POFA 4DV2L 4LUOA 4YWKA 4GNXB 4LFCQ 4MZ9A 4QY7A 3FKIH 3D0FA 3CW2C 4DNIA 5EAYA 3PIOA 4A3KG 2IHFA 4B3MQ 2JEAI 2IY5B 1G6PA 1A0IA 3HOXG 3ULPA 5IY0A 3ERSX 1Z9FA 4O0AA 4NB3A 4POGA 3BU2A 2ZM6L 2RF4A 5IP9H 3E9HA 1BKBA 3PV0A 4HJ7A 4B3ML 4LF4Q 1Q46A 1YI2A 1JJCB 1WI5A 2PQAA 1VQPA 4DR1L 1K8AC 4KHPQ 1YNXA 2AWNA 2ZTDA 4DR5Q 2L15A 5FLMH 4DV2Q 1EIFA 1SE8A 1NMFA 1X55A 3CP0A 4YY3Q 4GLXA 1PVOA 2I5MX 1TWCH 1TXYA 3UDXA 4JI3L 4J15A 4HIMA 1XNRL 5JEAG 4JI7Q 4GKJQ 4R4QA 4DAYB 4JI1Q 2JA5H 4A3GH 2F4VL 4JYAL 4JV5L 2ZTCA 4JI5L 4DV0L 1TWHH 1I5FA 1GO3E 2R7ZH 5BR8L 1QVCA 4LUZA 1XPRA 4L5QA 3M4QA 3PUYA 1EQQA 2N78A 2F3IA 2LXKA 4JBWA 5HGQA 1JE5A 4BY1G 1S72A 1HR0L 3CCLA 3LGJA 3J80c 1U0LA 2B3GA 3CMEA 5LMNQ 1VQDA 3PCOB 3CC2A 1SLJA 4A3IH 1NBWA 3L7ZC 3G6EA 2BH2A 4P72A 2YYZA 1T9HA 2N49A 1EOVA 4JI2L 1KHIA 1UWVA 4DR2L 4JI4Q 1N9WA 3JAMi 2VUMG 3CXCA 3G48A 3OTOQ 1IBKQ 2NVYH 5HY6A 5IWAQ 2ZJRA 1B7YB 2GVAA 2ES2A 4OXPA 1QVFA 1PH3A 1K9MC 4OWWB 2ZTEA 1KQSA 2Y0SG 4JI0Q 4BXXG 2UXCQ 1I6HH 4OWTB 1EYGA 2R93G 4JOIC 4A3EH 1Y1WH 1XMQQ 3PF4A 1YHAA 5C0XG 2Q2UA 3GTLH 4BBRH 3CD6A 1NE3A 1YHQA 1NY4A 2JJQA 4X66Q 2JEBI 3G4SA 2EIFA 4LF5L 2JK8A 2LXJA 1HH2P 2WB1G 1IL2A 4A76A 1K0RA 3NBHB 4C2MH 4DV6Q 3HOVH 2VY3A 3M9BA 4QL5A 2UUCQ 2IT1A 4TQUS 1VQ4A 3AQQA 4GNXC 1WYDA 4R4CA 4Y7NH 4LF7L 1BBUA 2R7ZG 2B63H 1Q1EA 2RHQB 4HIOA 4LFBL 3GO5A 4AQYL 3CC4A 3CCVA 1E24A 4HJ8A 1K73C 4YHHQ 1Y1VH 2E2IH 1R9TH 4EX5A 1VQAA 1HNWQ 1Q1BA 2Q2TA 1Y14B 2N3SA 1WCMH 1J6QA 5AJ3L 4C3HH 5IYDH 3ICEA 5IYCG 4DV4Q 4C3JH 4YHHL 4NPSA 4XTCS 1IZ6A 4WJ4A 2IHEA 4GOPC 1PYSB 2ZJQA 1C9OA 2C35B 4DR3Q 3AEVA 2RCNA 3KYHC 2MO1A 4HJ9A 2JA8H 2YV5A 5GAEC 1N34Q 1UE5A 3L0OA 4JBJA 4DV1Q 4LF8L 5LMUL 4QQBX 4GKKL 4DR7Q 4KI0A 2CCZA 3UDGA 1A62A 2K75A 1VQ7A 4DUYL 1YZ6A 2UXDL 2CWAA 4RMFA 3RLOA 2KENA 4IPDA 4BBSH 1HZBA 3GDEA 1PH2A 2AKWB 1PFSA 3BJUA 4AYBE 3AYHB 1N32Q 5GQOA 4X66L 1OXXK 3F2BA 4PZ6A 4LUVA 1FGUA 1XMOQ 4X65Q 1X6OA 3DM3A 4JI8Q 1QUQA 4LFAL 2EQSA 4A3MG 1WJJA 5C4JH 4NXNQ 1H95A 4DPGA 1VQ8A 4UP7A 2UUAL 5GAGC 3M3YH 4JI0L 4IFDJ 1VQHA 1LM0A 1VQGA 1J5EL 2K14A 2YTXA 2R92H 1L0WA 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6Y A;  1TWG H;  3HOV G;  1SR3 A;  4DV3 L;  2UUA Q;  4QIW E;  2IX1 A;  3JAM c;  3OTO L;  1JT8 A;  3IRB A;  3EN2 A;  4DR2 Q;  3H0G H;  3K80 C;  4X65 L;  2MO0 A;  1XMO L;  4PZ8 A;  4DV5 Q;  3MEF A;  2E5L Q;  4X64 L;  4JCV E;  5JJL A;  3D31 A;  1MKH A;  1GVP A;  4YCU A;  2E8G A;  1B70 B;  5GRO A;  5LMN L;  1YJ9 A;  1PH8 A;  1J5E Q;  3A74 A;  3K8A A;  4DR6 Q;  1C0A A;  4JBK A;  1K8G A;  4MTN A;  2LSS A;  3ZJY C;  4DR7 L;  4GKK Q;  5LMU Q;  3PGZ A;  5BR8 Q;  1JJ2 A;  1HZ9 A;  1G29 1;  3A5U A;  1VQ9 A;  4Y52 H;  1N34 L;  4A3C H;  3CPW A;  4GOP B;  3CCE A;  2VQF Q;  4JI1 L;  3F2C A;  1VQ5 A;  2OCE A;  4JYA Q;  2BA0 A;  2K4K A;  2JA8 G;  4UPA A;  3RNU A;  4JI3 Q;  1V43 A;  3I2Z A;  1EWI A;  5M3M H;  4DV4 L;  1XJV A;  4R1J A;  4P74 A;  3SGI A;  1OXT A;  5AJ3 Q;  2JE6 I;  1VQC A;  5JJI A;  5IYD G;  4KLK A;  3S14 H;  4BY1 H;  4A3J G;  5M3M G;  2UU9 L;  3S16 H;  1E7Z A;  3K7U C;  2H5X A;  1E1T A;  3KF6 B;  3CPF A;  1VQ6 A;  1P16 A;  1W3S A;  2MFI A;  3H3V H;  4LFB Q;  1N33 Q;  1IBM L;  2HQL A;  5ELO A;  4A3C G;  3RR5 A;  3S1R H;  1SRU A;  1C7Y A;  3PO3 H;  1OXS C;  4YCW A;  1KIX A;  2UUC L;  2KCT A;  1MJE A;  3HOU G;  2HIX A;  1QZH A;  3GTQ H;  4LFC L;  4LF5 Q;  1L1O B;  1HNZ L;  3S2D H;  1I3Q H;  2QEX A;  1VQO A;  3H0G G;  3L2P A;  1YIT A;  2KHI A;  3PIP A;  3TRZ A;  2UXC L;  2NZO A;  4AH6 A;  3J81 i;  3T1Y L;  3S24 A;  3I4N H;  2VQE Q;  2Y0S E;  3STB D;  3HOY H;  1B8A A;  3FKI G;  4OO1 G;  3M85 A;  4A3D G;  3CF5 A;  2DUD A;  3CCS A;  4IFD G;  1SFO H;  1EFW A;  2UXB L;  2IX0 A;  2VL6 A;  4OX9 L;  2OWO A;  3DLL A;  2K50 A;  4IO9 A;  3CQZ H;  2JA7 H;  2VUM H;  2DGY A;  3W5O A;  3VDY A;  1E3P A;  1TWA H;  3TQY A;  2UXB Q;  4GS3 A;  5JJK A;  5J3B A;  2CQO A;  1GM5 A;  4R4O A;  1XPU A;  3RZO H;  1X65 A;  3HKS A;  5FJ8 H;  1YJW A;  1HR0 Q;  3RLF A;  5C0X J;  1CKO A;  2ALY B;  3J7A 5;  4BA2 I;  3J81 j;  3U4Z A;  4PZ7 A;  5C4X H;  3J81 c;  1QZG A;  1MJC A;  4JBM A;  2HT1 A;  4JI5 Q;  1PA6 A;  2I5L X;  2KCM A;  1OXU A;  1HNZ Q;  1XNR Q;  4DR4 L;  3FP9 A;  1K83 H;  4YY3 L;  5M3F G;  2K52 A;  1HJP A;  4BBS G;  4DR5 L;  3A5Z B;  1O7I A;  4PG3 A;  4LF6 L;  3K81 C;  2HHH L;  4L5S A;  4KHP L;  4KHZ A;  5IP7 H;  2EXD A;  4DR1 Q;  2R7D A;  3PO3 G;  1A8V A;  5C3E H;  1PH1 A;  1VQL A;  2F52 A;  4DK6 C;  2E2J H;  2VZA A;  1YVC A;  2ZM6 Q;  1Q81 C;  3H15 A;  1PHJ A;  4A75 A;  1Q82 C;  2AMC B;  2D0P A;  5E7N A;  4IOC A;  4IOA A;  3HFZ B;  1D8L A;  1BBW A;  1YBY A;  2UU9 Q;  3TEH B;  3ULL A;  1S3O A;  5ELN A;  1V1Q A;  5FJ8 G;  2HHH Q;  4A3L G;  2R7F A;  5IYB H;  1YIJ A;  2VS1 A;  3K0X A;  3PUV A;  3TS0 A;  4JOI A;  4B3T Q;  1VQB A;  3U4V A;  3HOW H;  2JA7 G;  1HZC A;  3STB C;  2B63 G;  2A1A A;  1YEZ A;  1HR0 W;  1VQN A;  2WFW A;  1OTC A;  4LF9 L;  1PYB A;  3EBE A;  3NEM A;  3S1M H;  4A3D H;  1UE7 A;  3GTM H;  5IE8 A;  3G71 A;  1AH9 A;  1JJG A;  2BH8 A;  3CCU A;  4L5R C;  4IPG A;  3F2D A;  3FHW A;  2D62 A;  3I7F A;  5C44 H;  4DR6 L;  5K36 G;  3GTO H;  1FJG Q;  1JB7 A;  2VW9 A;  2V1C C;  3E9I A;  1KAW A;  2GN5 A;  2HIV A;  3T1H L;  1VQI A;  2AHO B;  1JMC A;  2YU9 H;  2E5L L;  1RIP A;  1ASZ A;  3CAM A;  1P8L A;  4HJ5 A;  4A3I G;  5C44 G;  1D7Q A;  2K5H A;  4QGU A;  1NMG A;  2ZJP A;  2R93 H;  2R92 G;  4H02 A;  4DV3 Q;  4O2D A;  4AIM A;  3HOU H;  4JG2 A;  2A19 A;  2JQO A;  1I94 L;  4IFD I;  3J80 i;  1HNX Q;  3KJP A;  4A3M H;  4B3R Q;  3E0E A;  4NXN L;  4DK3 C;  4QJF A;  4B3S L;  2VNU D;  4DAM A;  3I56 A;  2PNH A;  1N32 L;  1L2F A;  3UE1 A;  1DGS A;  2BA1 A;  1PV4 A;  3UE0 A;  1UE6 A;  2Q2I A;  1KL9 A;  2NN6 G;  3S1Q H;  1X54 A;  2WB1 E;  2A8V A;  1X9N A;  1BVS A;  1VQE A;  3ER0 A;  4ALP A;  2NVX H;  4R4I A;  1V9P A;  1VQK A;  1KXL A;  3U50 C;  3AFQ A;  4GN5 A;  4A4I A;  3UDI A;  4L5T A;  1IBL L;  3OW2 A;  2KHJ A;  4LWC A;  1IBM Q;  1OXV A;  1N33 L;  4A3G G;  4DR3 L;  2I5H A;  4XIG S;  5IYC H;  3JC6 6;  2NVT H;  1G51 A;  3F1Z A;  3MXN B;  1WCM G;  2NN6 I;  3H3V I;  1GKH A;  3TRE A;  4X62 Q;  3HOW G;  5FLM G;  4UP9 A;  4PMW A;  4JI6 L;  1IXR A;  4MNO A;  1XNQ L;  1XNQ Q;  4A93 H;  1K3R A;  1Y1V G;  2Z6K A;  1QVG A;  4JI6 Q;  3A0J A;  2YTV A;  3AFP A;  4X62 L;  4A3L H;  4OWX B;  5IT9 c;  3RZD H;  1KC8 C;  3HKZ E;  1SMX A;  5GAH C;  4A3F H;  3RN5 A;  1N8R C;  4AQY Q;  3NEL A;  4P71 A;  3GTG H;  1TWF H;  1UEB A;  1E1O A;  2VQF L;  1ASY A;  3PUZ A;  1N36 L;  4GOP A;  1IBL Q;  4A3F G;  2JA6 H;  3M4O H;  1LYL A;  1KRT A;  5GAD C;  4K0K L;  1UE1 A;  1S40 A;  5FLX c;  1WOC A;  1FL0 A;  2PMZ E;  5C3E G;  3KDF A;  1CKM A;  3OYY A;  5JEA J;  1CSQ A;  2Z0S A;  1A63 A;  3S2H H;  4GNX A;  1CKN A;  4LF6 Q;  2ASB A;  1M1K C;  3I4M H;  1VQF A;  4X64 Q;  4BBR G;  3KJO A;  2NVQ H;  4DV5 L;  5M3F H;  3W1G A;  3TS2 A;  4IPC A;  1LUZ A;  3GTJ H;  1Q7Y C;  4BXX H;  1XMQ L;  4P75 A;  3HOZ G;  1CKN B;  1L1O C;  4B3R L;  4DUZ Q;  3HOY G;  2OQ0 A;  1Q12 A;  3KOJ A;  1EUJ A;  4OON A;  4RG1 A;  4FDB A;  5C4X G;  3M4P A;  3M7N A;  2WAQ E;  4TVA B;  3CCJ A;  3UDF A;  5IWA L;  3KLW A;  4DUZ L;  2AWO A;  1E22 A;  2ATW A;  4GN4 B;  4LFA Q;  4JI8 L;  2K5V A;  1RL2 A;  3CCR A;  2CFM A;  2XTI A;  1AE2 A;  3ULJ A;  4AYB G;  5M5Y H;  4DKA C;  4LNQ A;  1L1O A;  1Z47 A;  2K5N A;  1W2B A;  1U5K A;  4YWM A;  3J7Z C;  1FJG L;  3NEN A;  4DUY Q;  2QGQ A;  1VCI A;  2UXD Q;  3WWV A;  3S1N H;  3PF5 A;  4X6A H;  4K0K Q;  5C0X I;  1KD1 C;  1I50 H;  4LF9 Q;  3I4N G;  4DV1 L;  4LF8 Q;  2JA5 G;  1N36 Q;  5H1S E;  1FVI A;  4DV0 Q;  1SRO A;  3RN2 A;  2CKZ B;  2WAQ G;  4HIK A;  1PH5 A;  2JA6 G;  4JI7 L;  1VQM A;  3GD7 A;  1YHB A;  1YJN A;  4P73 A;  1IYJ B;  3KF6 A;  3W1B A;  1SN8 A;  2B29 A;  4UY8 C;  4EQ5 A;  4HJA A;  1CUK A;  1HNW L;  3PO2 G;  3GTP H;  1GD7 A;  4A93 G;  2KBN A;  4JV5 Q;  4JC0 A;  4LF4 L;  4A3B G;  4YWL A;  2D0O A;  2PI2 E;  5DLQ E;  3HOX H;  2FXQ A;  1LTL A;  2ID0 A;  2N8N A;  1EIY B;  2RHS B;  4A3E G;  1Y1W G;  1X56 A;  4LF7 Q;  1HZA A;  1PH6 A;  4A3B H;  4GLV B;  4GLA C;  5M5X H;  1AE3 A;  4C3I H;  1Q8K A;  5IYB G;  3CMA A;  2OTL A;  3PO2 H;  3PSI A;  3CCQ A;  1X3F A;  3F8T A;  3U58 A;  2Z6K C;  3Q8D A;  4LW1 A;  4DV6 L;  2PQA B;  4A3J H;  1PH9 A;  2I0Q A;  4OO1 I;  2CWP A;  4DV7 L;  2UUB L;  2XGT A;  1CSP A;  1NTG A;  4R4T A;  2QA4 A;  4IJH A;  4DR4 Q;  4B3S Q;  3EIV A;  3S17 H;  1XPO A;  1NJI C;  3CCM A;  1HNX L;  4BY7 G;  3CC7 A;  2OQK A;  2NZH A;  1I94 Q;  1XTD A;  5IP7 G;  4GN3 B;  3PUW A;  3K7A H;  2E2H H;  1WFQ A;  4YCV A;  4BA1 I;  1Q86 C;  1IBK L;  4UP8 A;  4JI2 Q;  2PI2 A;  5M5W H;  4IJL A;  1X3E A;  5LMN W;  1M90 C;  4JI4 L;  4NXM Q;  3RLN A;  4NXM L;  2R6G A;  4OX9 Q;  3KF8 B;  1KRS A;  4HID A;  3T1H Q;  3I4M G;  3GTK H;  1MIU A;  3HKZ G;  3S15 H;  4APV A;  4BY7 H;  3I55 A;  1VQJ A;  3KDF B;  3I4O A;  1PH4 A;  2MNA A;  2Q2H A;  4ME3 A;  3BZC A;  2JA9 A;  2VQE L;  3T1Y Q;  2WP8 J;  1EQR A;  3HOZ H;  2YTY A;  3KFU A;  5IP9 G;  1QUQ B;  1X3G A;  2MQH A;  2F4V Q;  3BZK A;  2OTJ A;  4WJ3 M;  4GKJ L;  3PUX A;  2GVB A;  1PH7 A;  4IPH A;  4B3T L;  4A3K H;  4DV7 Q;  2UUB Q;  4POF A;  4DV2 L;  4LUO A;  4YWK A;  4GNX B;  4LFC Q;  4MZ9 A;  4QY7 A;  3FKI H;  3D0F A;  3CW2 C;  4DNI A;  5EAY A;  3PIO A;  4A3K G;  2IHF A;  4B3M Q;  2JEA I;  2IY5 B;  1G6P A;  1A0I A;  3HOX G;  3ULP A;  5IY0 A;  3ERS X;  1Z9F A;  4O0A A;  4NB3 A;  4POG A;  3BU2 A;  2ZM6 L;  2RF4 A;  5IP9 H;  3E9H A;  1BKB A;  3PV0 A;  4HJ7 A;  4B3M L;  4LF4 Q;  1Q46 A;  1YI2 A;  1JJC B;  1WI5 A;  2PQA A;  1VQP A;  4DR1 L;  1K8A C;  4KHP Q;  1YNX A;  2AWN A;  2ZTD A;  4DR5 Q;  2L15 A;  5FLM H;  4DV2 Q;  1EIF A;  1SE8 A;  1NMF A;  1X55 A;  3CP0 A;  4YY3 Q;  4GLX A;  1PVO A;  2I5M X;  1TWC H;  1TXY A;  3UDX A;  4JI3 L;  4J15 A;  4HIM A;  1XNR L;  5JEA G;  4JI7 Q;  4GKJ Q;  4R4Q A;  4DAY B;  4JI1 Q;  2JA5 H;  4A3G H;  2F4V L;  4JYA L;  4JV5 L;  2ZTC A;  4JI5 L;  4DV0 L;  1TWH H;  1I5F A;  1GO3 E;  2R7Z H;  5BR8 L;  1QVC A;  4LUZ A;  1XPR A;  4L5Q A;  3M4Q A;  3PUY A;  1EQQ A;  2N78 A;  2F3I A;  2LXK A;  4JBW A;  5HGQ A;  1JE5 A;  4BY1 G;  1S72 A;  1HR0 L;  3CCL A;  3LGJ A;  3J80 c;  1U0L A;  2B3G A;  3CME A;  5LMN Q;  1VQD A;  3PCO B;  3CC2 A;  1SLJ A;  4A3I H;  1NBW A;  3L7Z C;  3G6E A;  2BH2 A;  4P72 A;  2YYZ A;  1T9H A;  2N49 A;  1EOV A;  4JI2 L;  1KHI A;  1UWV A;  4DR2 L;  4JI4 Q;  1N9W A;  3JAM i;  2VUM G;  3CXC A;  3G48 A;  3OTO Q;  1IBK Q;  2NVY H;  5HY6 A;  5IWA Q;  2ZJR A;  1B7Y B;  2GVA A;  2ES2 A;  4OXP A;  1QVF A;  1PH3 A;  1K9M C;  4OWW B;  2ZTE A;  1KQS A;  2Y0S G;  4JI0 Q;  4BXX G;  2UXC Q;  1I6H H;  4OWT B;  1EYG A;  2R93 G;  4JOI C;  4A3E H;  1Y1W H;  1XMQ Q;  3PF4 A;  1YHA A;  5C0X G;  2Q2U A;  3GTL H;  4BBR H;  3CD6 A;  1NE3 A;  1YHQ A;  1NY4 A;  2JJQ A;  4X66 Q;  2JEB I;  3G4S A;  2EIF A;  4LF5 L;  2JK8 A;  2LXJ A;  1HH2 P;  2WB1 G;  1IL2 A;  4A76 A;  1K0R A;  3NBH B;  4C2M H;  4DV6 Q;  3HOV H;  2VY3 A;  3M9B A;  4QL5 A;  2UUC Q;  2IT1 A;  4TQU S;  1VQ4 A;  3AQQ A;  4GNX C;  1WYD A;  4R4C A;  4Y7N H;  4LF7 L;  1BBU A;  2R7Z G;  2B63 H;  1Q1E A;  2RHQ B;  4HIO A;  4LFB L;  3GO5 A;  4AQY L;  3CC4 A;  3CCV A;  1E24 A;  4HJ8 A;  1K73 C;  4YHH Q;  1Y1V H;  2E2I H;  1R9T H;  4EX5 A;  1VQA A;  1HNW Q;  1Q1B A;  2Q2T A;  1Y14 B;  2N3S A;  1WCM H;  1J6Q A;  5AJ3 L;  4C3H H;  5IYD H;  3ICE A;  5IYC G;  4DV4 Q;  4C3J H;  4YHH L;  4NPS A;  4XTC S;  1IZ6 A;  4WJ4 A;  2IHE A;  4GOP C;  1PYS B;  2ZJQ A;  1C9O A;  2C35 B;  4DR3 Q;  3AEV A;  2RCN A;  3KYH C;  2MO1 A;  4HJ9 A;  2JA8 H;  2YV5 A;  5GAE C;  1N34 Q;  1UE5 A;  3L0O A;  4JBJ A;  4DV1 Q;  4LF8 L;  5LMU L;  4QQB X;  4GKK L;  4DR7 Q;  4KI0 A;  2CCZ A;  3UDG A;  1A62 A;  2K75 A;  1VQ7 A;  4DUY L;  1YZ6 A;  2UXD L;  2CWA A;  4RMF A;  3RLO A;  2KEN A;  4IPD A;  4BBS H;  1HZB A;  3GDE A;  1PH2 A;  2AKW B;  1PFS A;  3BJU A;  4AYB E;  3AYH B;  1N32 Q;  5GQO A;  4X66 L;  1OXX K;  3F2B A;  4PZ6 A;  4LUV A;  1FGU A;  1XMO Q;  4X65 Q;  1X6O A;  3DM3 A;  4JI8 Q;  1QUQ A;  4LFA L;  2EQS A;  4A3M G;  1WJJ A;  5C4J H;  4NXN Q;  1H95 A;  4DPG A;  1VQ8 A;  4UP7 A;  2UUA L;  5GAG C;  3M3Y H;  4JI0 L;  4IFD J;  1VQH A;  1LM0 A;  1VQG A;  1J5E L;  2K14 A;  2YTX A;  2R92 H;  1L0W A;  1VS0 A; 
#chains in the Genus database with same CATH topology
 2OXP A;  4EQP A;  1TWG H;  2PZU A;  3GTL B;  5FKA C;  4DV3 L;  3KXY T;  4RCO A;  2UUA Q;  4ZI7 F;  3JAM c;  3OTO L;  4DR2 Q;  3K80 C;  1DOL A;  3V4S A;  1KAB A;  4ME6 A;  4O4I F;  2K5D A;  2W9B A;  1N33 H;  1CTM A;  5M3M B;  1TWG A;  4TUY F;  4R8U A;  5DNF A;  2B2V C;  4QWA A;  4MTN A;  3I3C A;  2LSS A;  3MVV A;  1HQR D;  4RZQ A;  2YU9 A;  3IAY A;  5LMU Q;  4IWX A;  5BR8 Q;  4LF5 H;  1G29 1;  2KED A;  3K5N A;  4U7C A;  1N32 H;  2JP1 A;  4GOP B;  2VQF Q;  3OMC A;  2OCE A;  2K4K A;  4NXN H;  4DV7 H;  1V43 A;  3P20 A;  1EWI A;  5HV6 A;  4J9L A;  4J9R A;  4DL2 A;  5C5L A;  5AJ3 Q;  1TWH B;  4ED2 A;  1VQC A;  1KLU D;  5DM7 3;  4RKL A;  3EA6 A;  1AN7 A;  4YP3 A;  2FMA A;  4J9M A;  4RAZ A;  1SNP A;  3WOE A;  3RUZ A;  5M3M G;  2UU9 L;  1STB A;  1E7Z A;  3E6Z X;  3S16 H;  2DLN A;  3BAB A;  3RBD A;  3GTM A;  1F9S A;  3OMG A;  4F4W A;  1JDB B;  3PR5 B;  5ELD A;  3T5H A;  1KDC A;  4YCW A;  2UVV A;  4DR6 H;  2BQR A;  2UUC L;  2KCT A;  4CJ1 B;  2L12 A;  1MJE A;  5F9L A;  3HOU G;  1LTS D;  1HR0 H;  5BR8 H;  5DG8 A;  1IYV A;  1L1O B;  5IGD A;  2KEE A;  2QYZ A;  1I4X A;  1HNZ L;  3S2D H;  2FPG B;  3CHB D;  2B2T A;  2PZW A;  3L2P A;  3GV7 B;  3FRP B;  2YRW A;  1LT4 D;  2KHI A;  4CC6 A;  3PIP A;  5D3D A;  3TP6 A;  3S24 A;  4M8A A;  2VQE Q;  2Y0S E;  1LT3 D;  3STB D;  3I4N H;  3F8N A;  1XWE A;  2KVM A;  2XRQ D;  3FKI G;  1R4P B;  4OO1 G;  4G3I A;  1DON A;  1PFM A;  4ECZ A;  3N44 B;  4IFD G;  1Y1V A;  4FS1 A;  2UXB L;  5CBE E;  2OWO A;  2ZM6 H;  5DM6 3;  2DGY A;  3VDY A;  3TQY A;  1R9T B;  1M0T A;  2NVX A;  1D5Z C;  3RD4 A;  5J3B A;  1GM5 A;  4ZUJ A;  5KFG A;  4N8F A;  2HHH H;  5ELF A;  3MC0 B;  3RLF A;  3A54 A;  3ERO A;  1DD2 A;  3DM1 A;  4BA2 I;  1TVX A;  3U4Z A;  1GLV A;  3J7A K;  4NMZ A;  2CW0 C;  2DNC A;  1QB5 D;  1CA5 A;  1Q3L A;  5K2M A;  2I8C A;  4RB3 C;  3BVG A;  1HFG A;  3MHB A;  1C3O A;  2XGP A;  4RUA A;  1NAP A;  1JQY D;  4YY3 L;  5M3F G;  2K52 A;  4HN7 A;  2W70 A;  5L1J A;  4H0L C;  4BBS G;  4DR5 L;  3MAQ A;  2EJF C;  2F0I A;  1O7I A;  4IUU A;  4L5S A;  4KHZ A;  3VR6 A;  1HCZ A;  2R7D A;  1A8V A;  1Y69 U;  1VQL A;  3V6K A;  4DK6 C;  5C3E B;  4UCO A;  4J9S A;  5C5M A;  1VS0 A;  2GLT A;  4XYM B;  3KUP A;  4UCV A;  1Q82 C;  2MJ8 A;  2OEO A;  1YBY A;  1ULZ A;  1QWY A;  3ULL A;  4DK0 A;  3HOX B;  3SR1 A;  4BWS C;  4I7Z C;  3PUV A;  2IBK A;  3OSN A;  1VQB A;  1EHI A;  3HOW H;  1SNM A;  1A2T A;  3JRX A;  2WDT A;  1HZC A;  4HED A;  5D3I B;  3BDC A;  1VQN A;  1AP0 A;  1GUW A;  4UCU A;  1OTC A;  4LF9 L;  5EKK A;  1PYB A;  1Z7T A;  4A3D H;  4A3G B;  5IE8 A;  3KBG A;  1EY0 A;  3FEW X;  2VUM B;  1KJ9 A;  4UCS A;  1SMY C;  1TWC B;  2W8L A;  1SYC A;  3EFX D;  1PLF A;  5C44 H;  1Y8P B;  3GTO H;  1FJG Q;  3I12 A;  2F0J A;  2ZXO A;  2GN5 A;  2CQY A;  1XX8 A;  2B2W C;  1BR9 A;  1P8L A;  4QWD A;  3TME A;  5IGF A;  2K5H A;  3J7A F;  1D7Q A;  5IGB A;  4EEY A;  3GTO A;  4TV8 F;  4JG2 A;  2A19 A;  1PK8 A;  4IQZ A;  3J80 i;  2FJ2 A;  1MZB A;  3E5N A;  4ID6 A;  1PTO H;  3G6J B;  4EVO A;  1V51 A;  4I55 F;  1S9F A;  4PV1 C;  4DNR B;  3FKI B;  5IOD A;  2W6P A;  5KT6 A;  3KBX A;  4DN4 M;  3MJF A;  2GPS A;  3I56 A;  2PNH A;  1N32 L;  1L2F A;  4A3K B;  3CRK C;  3PO3 B;  1DGS A;  2A69 C;  3UE0 A;  2Q2I A;  3T4A C;  3DWQ A;  5CV6 A;  2F0F A;  1TII D;  2JEG A;  1VQE A;  4ALP A;  3OSP A;  3K5I A;  4RCN A;  4IRK A;  2PBZ A;  2XWB B;  2HDL A;  4GN5 A;  1IBL L;  3UDI A;  4Q0F A;  3OW2 A;  3LWU A;  1N33 L;  5EPJ A;  4XIG S;  5JPM C;  1CQF A;  3JC6 6;  1X32 A;  3HOW G;  4O3R A;  1PTO C;  3SHL A;  1BCP B;  5FLM G;  4DV3 H;  1ZEQ X;  2EVB A;  4N9P A;  1TKW B;  2BDO A;  1XNQ L;  2IJ0 A;  2L0C A;  3J80 E;  4MTK A;  1FGB D;  5G3L F;  4KK7 A;  4JI6 Q;  1O75 A;  4X62 L;  1WTX A;  3GTK A;  2PNR C;  4A3I B;  4OWX B;  3RZD H;  5DGA A;  3HRZ C;  5GAH C;  3RN5 A;  4RA8 A;  4P71 A;  2WE6 A;  1UEB A;  3C1F A;  3PIP 3;  4G7O C;  1N36 L;  4A3F G;  2C2R A;  3H0G A;  1UE1 A;  1VAJ A;  2WYO A;  3S17 B;  4QF4 A;  1PYW D;  3OYY A;  1RHP A;  1STG A;  1T36 A;  2F0O A;  1WTP A;  4BWG B;  1CKN A;  5KFS A;  1Q90 A;  4LF8 H;  3I4M H;  1VQF A;  1N36 H;  3KJO A;  1S5C D;  2NVX B;  5C0X H;  1R9T A;  5C4H A;  1LUZ A;  3GTJ H;  1JOK A;  2NTS A;  4RHS A;  3M3Y B;  5FD6 A;  5CV9 A;  1XMQ L;  4P75 A;  2ZXP A;  1L1O C;  2J9G A;  4FM9 A;  1EYA A;  4HCE A;  3KOJ A;  5KYL A;  4OON A;  4FDB A;  4QB4 A;  4ED3 A;  2V4R A;  1K83 A;  4JI6 H;  4HYK A;  2AWO A;  3MR3 A;  5DG9 A;  4GN4 B;  2YS6 A;  4AQY H;  4JI8 L;  2PVP A;  4IHJ F;  4LSX A;  2UVR A;  3KHL A;  4XT3 B;  3HOU B;  2XTI A;  4K2L A;  1HA6 A;  1IBL H;  1TU2 B;  4C3H G;  3J7Z C;  1V1O A;  1VCI A;  2SDF A;  3WWV A;  1FKA H;  1LTB D;  2EOT A;  5EOY A;  2R8G A;  5CBA E;  2JA6 G;  1PH5 A;  2MPM A;  4JI7 L;  5CR3 A;  3LX0 A;  3GTM B;  4HMI A;  4P73 A;  1IYJ B;  1YNJ C;  4PWQ A;  2B29 A;  4UY8 C;  2PMZ B;  1SCU B;  4CDC C;  2O2L D;  1NR4 A;  2XGQ A;  2DWC A;  2V4D A;  1GD7 A;  2HGS A;  5JJZ A;  4JV5 Q;  4IUT A;  4A3B G;  1QE6 A;  4IZO A;  2BCO A;  1O7Z A;  4XXE A;  4JI2 H;  2KSW A;  2FXQ A;  2E2H B;  3TZD A;  3K3V A;  4R8N A;  3T1H H;  3WDN A;  1HZA A;  1TR5 A;  4ZK9 B;  4A3B H;  2NU6 B;  1RD9 D;  2NTT A;  1F2Y A;  3PO2 H;  4FO2 A;  1X3F A;  3F8T A;  2Z6K C;  4A3J H;  4HNT A;  4RNO A;  5KFB A;  2XIW A;  3H91 A;  2DPJ A;  2XGT A;  4Q44 A;  2FLN A;  1CSP A;  3NWT A;  2KUM A;  4LK1 C;  4YAJ B;  3NTK A;  1S68 A;  1STY A;  4F7X A;  1K83 B;  3NHH A;  3CC7 A;  1CM9 A;  4A3B B;  2VOB A;  1U4R A;  3FPP A;  2AU0 A;  4GN3 B;  2IMW P;  1ONL A;  4BA1 I;  3L4J A;  1W96 A;  2M05 A;  5E3F A;  5EWF A;  3KHG A;  4JI2 Q;  2PI2 A;  3AMU A;  4IWY A;  4EFB A;  4IUQ A;  3T1H Q;  3S15 H;  4LMY A;  4GC6 A;  1MIU A;  4OL7 A;  2WII B;  5CMD A;  4G7Z C;  5KFR A;  1JX4 A;  1K28 A;  2Q2H A;  2JA9 A;  2R8K A;  1EQR A;  3M7G A;  4ECU A;  3JZI A;  3HOZ H;  3KFU A;  1X3G A;  2MQH A;  4DR4 H;  2F4V Q;  4WJ3 M;  2X6G A;  3K58 A;  1CQV A;  1STH A;  5C6A A;  1DOK A;  4O3S A;  1HUM A;  2SEB D;  4POF A;  4DV2 L;  1RK6 A;  5KFD A;  2RVL A;  3GIK A;  2L55 A;  3D0F A;  1SNQ A;  3TII A;  4IZ8 A;  3MXN A;  3AB9 A;  3P1H A;  3PIO A;  4IN3 A;  2C22 A;  2IHF A;  2JEA I;  3R93 A;  3QZ7 A;  3JSL A;  3ERS X;  4O0A A;  3NQT A;  4NB3 A;  3GTQ B;  2R82 A;  3R5X A;  4I65 A;  4I50 F;  2JEF A;  2RF4 A;  3MFG A;  1BKB A;  3IG0 A;  1DOM A;  2MHV A;  5LYJ F;  1IBK H;  1YI2 A;  1EEI D;  2A69 D;  4CBV A;  4DR1 L;  1K8A C;  1WR2 A;  4KHP Q;  2VPQ A;  2QW7 A;  2YU9 B;  3M9O B;  2R8H A;  5FLM H;  3GIJ A;  2J4X A;  3I4M B;  1NMF A;  4GLX A;  5J2U F;  5KFH A;  3W3A A;  1MD2 D;  1TXY A;  4JI3 L;  4HAE A;  1XNR L;  5JEA G;  1XYI A;  4JI7 Q;  4R4Q A;  2JA5 H;  4JI1 Q;  4CKE A;  4JYA L;  2ZTC A;  1STN A;  4JI5 L;  3S1M B;  1T5E A;  3Q8S B;  2UUB H;  1BGW A;  4GZY C;  4LFC H;  2N88 A;  4KKS A;  3Q24 A;  2WAQ B;  5HGQ A;  4DV6 H;  3PQI A;  4JV0 A;  3PW7 A;  2EPB A;  2UUC H;  1JOQ A;  3VPB A;  4RGN A;  1I4G A;  3I91 A;  3N6X A;  1S0M A;  3CC2 A;  1A9X A;  1SLJ A;  2NZ1 D;  3L7Z C;  4A3I H;  5CAE B;  4P72 A;  1TAE A;  4JI4 Q;  1KHI A;  3BZD B;  1N9W A;  2VUM G;  3CXC A;  4UCR A;  4HNU A;  2F0K A;  5D65 A;  1NNX A;  2ES2 A;  1I3Q A;  3QG1 A;  5CB4 F;  5KT7 A;  1I6H H;  4OWT B;  1XMQ Q;  4YR3 A;  5C0X G;  2BE5 C;  3R2I A;  1NE3 A;  2R84 A;  5CA0 F;  4JI1 H;  1N34 H;  4A2B A;  4LF5 L;  5KG6 A;  5KT2 A;  3O13 A;  2O5I C;  1E2V A;  4IR9 A;  1K0R A;  3NBH B;  2J6S A;  4C2M H;  1TY2 A;  1GXD C;  3M9B A;  1PX2 A;  5I47 A;  1D5X C;  2DN8 A;  4NDX A;  4RH6 A;  3GQC A;  3ETH A;  2IT1 A;  5C4X B;  3AQQ A;  1Q8I A;  5C5J A;  4O3Q A;  4ECS A;  4MAM A;  2R7Z G;  4ED7 A;  4HIO A;  3GO5 A;  1PFN A;  3CC4 A;  3CCV A;  3MWY W;  4YHH Q;  1T94 A;  4YB8 B;  1GUG A;  5IWA H;  2X69 A;  1QJO A;  5KIX A;  2Q2T A;  1Y14 B;  1WCM H;  4JI0 H;  4OEM B;  2MCT A;  3VYT A;  4XTC S;  1M7J A;  5KFK A;  1HTL D;  4GOP C;  2ZJQ A;  1EYC A;  2C35 B;  3AEV A;  2R7M A;  1EQT A;  2W9A A;  2M00 A;  1SMY D;  2MO1 A;  2QIL A;  1UE5 A;  3I4L A;  4LF8 L;  5M5Y B;  4C3J G;  1H9M A;  2Z6B A;  3QR8 A;  4M9U A;  4DLK A;  2NN6 H;  3CRL C;  2NWG A;  1EIH A;  2UXD L;  1YZ6 A;  3RLO A;  3WNZ A;  1TWA A;  3KK7 A;  4BBS H;  1PH2 A;  2W6N A;  2K7V A;  5IT9 W;  2AKW B;  2FB9 A;  2AUJ D;  3BDO A;  4AYB E;  5FO8 B;  1N32 Q;  2W6M A;  4O2A F;  1GUO A;  1M8A A;  3I8Z A;  1Z6H A;  1X6O A;  5M9O A;  4X65 Q;  1ZHQ A;  1IOW A;  5I6W A;  3HOV B;  2VQF H;  3VYU A;  2RGV A;  5LL6 S;  1H95 A;  4MA0 A;  4DPG A;  1Y1W A;  1VQ8 A;  4UP7 A;  3J7A V;  4HMJ A;  4IFD J;  1VQH A;  1LM0 A;  3VYS A;  1L0W A;  2HUG A;  1J5E Q;  3B6Y A;  1TT2 A;  3Q8P B;  1GUN A;  2H1E A;  3P7J A;  5L9X A;  1JT8 A;  4ED6 A;  3S2H B;  3IRB A;  3H0G H;  4PNY A;  1B6R A;  1Z2N X;  1L0X B;  4JVZ A;  2W6O A;  4DV5 Q;  4O4L F;  5JJL A;  4JCV E;  1GYF A;  1ILP A;  5A2Q L;  1O80 A;  4YCU A;  5GRO A;  1B70 B;  4IFD H;  5DEH A;  1PH8 A;  3ONA B;  2EYO A;  4OIK A;  4Y8V B;  3M4Y A;  3GTG B;  4CHT B;  3FMC A;  4BS9 A;  2HDM A;  4GKK Q;  1W93 A;  3PGZ A;  1VQ9 A;  1S5F D;  1HZ9 A;  3A5U A;  2RSN A;  3F2C A;  1VQ5 A;  2BA0 A;  1SBB B;  4J6H A;  1OXT A;  2JE6 I;  2CW8 A;  3HKZ A;  4KLK A;  3CQZ A;  4BY1 H;  4A3J G;  1SEB D;  2K28 A;  2NUC A;  3IFD A;  2R8I A;  2H5X A;  1HPC A;  4DR2 H;  2E2H A;  2MFI A;  3H3V H;  1IBM L;  1U9R A;  3S1Q B;  5ELO A;  2E5L H;  5JQW A;  4A3C G;  3RR5 A;  3GV5 B;  2WB1 A;  3MFH A;  5C4J B;  1OXS C;  3KLR A;  2YW2 A;  1STE A;  4HR7 B;  2FPI B;  1MSH A;  4LAA A;  4YBZ B;  4LFC L;  3L3O C;  2Z4I A;  1FNW A;  4A3M B;  1G91 A;  2J6T A;  1DZ1 A;  3UI2 A;  2RGR A;  5KFQ A;  4CKC A;  2UXC L;  2NZO A;  4AH6 A;  3J81 i;  1KLG D;  4RB0 A;  4XT1 B;  1B8A A;  1LTI D;  2EYF A;  3QOJ A;  3M85 A;  5CV8 A;  4C3J B;  5E4X A;  2CW7 A;  2VQD A;  2DUD A;  2C00 A;  1KNE A;  2VL6 A;  3QB3 A;  3S16 B;  1W6J A;  4ABN A;  3CQZ H;  2JA7 H;  4XYO A;  3TQT A;  3GP7 A;  2FMM A;  3A8I E;  2KOL A;  3PW2 A;  4F50 A;  2UXB Q;  4GS3 A;  3VA5 A;  4CDF C;  5JJK A;  1E2W A;  3A55 A;  3NUC A;  3GTG A;  1X65 A;  3D4D A;  3HKS A;  1YJW A;  3J80 W;  5C0X J;  2ASD A;  1CKO A;  5EKL A;  2ALY B;  4Y7N B;  3P75 A;  2D5D A;  4UHV A;  2J0T D;  3J81 c;  2HT1 A;  3GII A;  4C5A A;  2Q8R E;  3KAL A;  3NK9 A;  1OXU A;  1HNZ Q;  3TQ1 A;  3FP9 A;  1XDN A;  5JAV A;  4XYL B;  1HJP A;  4QW8 A;  3OW7 A;  2QDB A;  4F4Y A;  2F0H A;  3HS0 C;  4K8I A;  2XC9 A;  3LML A;  4WOR A;  4ZHQ F;  3W2D A;  1YVC A;  5KG1 A;  2ZM6 Q;  3NSW A;  4XYQ A;  3C3L A;  1U4L A;  5JVH 3;  2J6U A;  4RZR A;  5LOV F;  1A3T A;  4N8X 1;  1BBW A;  2UU9 Q;  3TEH B;  1MGS A;  2BOS A;  5ELN A;  1D6E C;  1HTP A;  1V1Q A;  3C1E A;  4MV8 A;  3QIA A;  2R7F A;  3HKZ B;  1YIJ A;  1G8Z D;  1PRT B;  4XQQ A;  3V2T A;  2VS1 A;  3OUU A;  3K0X A;  3TS0 A;  1HA5 A;  4JOI A;  2EYH A;  3U4V A;  1ZHS A;  4L1K A;  2JA7 G;  1TS4 A;  3STB C;  2QKI C;  2D9U A;  3KTM A;  1A15 A;  2MGS A;  1BQQ T;  3NEM A;  4CDE C;  4F4Z A;  2L9H A;  1RJR A;  2RDI A;  3G71 A;  1JJG A;  3CQZ B;  1VBH A;  2ASJ A;  3ORR A;  2BH8 A;  4IPG A;  2E75 C;  2D62 A;  2J7Z A;  1C8C A;  2R7K A;  1I50 B;  4XQN A;  1KAW A;  1PZK D;  1D1K A;  3I90 A;  2AHO B;  1UUP A;  1EY9 A;  1IBM H;  5K36 H;  3CVZ A;  4QGU A;  5I9O A;  2ZJP A;  2UVW A;  5LL6 X;  2R93 H;  3C0F B;  4DV3 Q;  2EJM A;  4P2C B;  1S5E D;  4O2D A;  4AIM A;  1RDP D;  3PIO 3;  2JQO A;  2Z4H A;  1I94 L;  4IFD I;  2HJW A;  3KJP A;  4A3M H;  1U4P A;  4B3R Q;  5E4W C;  4ZOL F;  4B3S L;  4JUZ A;  1UE6 A;  1SND A;  1KL9 A;  2EY2 A;  2NN6 G;  4KY6 A;  1X54 A;  2NYZ D;  2A8V A;  5CV4 A;  2FKL A;  2B2U A;  1BVS A;  5M3F B;  2NU7 B;  2XSC A;  1JWS D;  1KXL A;  1FJG H;  1UNN C;  2K33 A;  3MTS A;  4BY1 B;  4MV4 A;  5FLX L;  1K1Q A;  1IBM Q;  3RTX A;  4DR3 L;  5JEA H;  3T5J A;  3Q6S A;  1G51 A;  3H3V I;  1WCM G;  2NN6 I;  5D1O A;  1A3U A;  5L37 A;  1AUV A;  4A93 H;  4MNO A;  3IKJ A;  2WAQ A;  1I7N A;  3A0J A;  2K05 A;  4YJ2 F;  1KC8 C;  2EY6 A;  4LFA H;  3NEL A;  1ZYR C;  4EG0 A;  1E1O A;  4C2M A;  3PUZ A;  3V4Z A;  1SFO A;  1PXU A;  2R61 A;  4K0K L;  2R7Z B;  5FLX c;  1WOC A;  1SE3 A;  4DUY H;  3H09 A;  2JA5 B;  1FNV A;  1B4O A;  1A63 A;  3SK6 A;  3HBL A;  5HBR B;  4IRD A;  1M1K C;  4BBR G;  4DV5 L;  5M3F H;  5KFO A;  4F4X A;  4IPC A;  5F2D A;  1X3Q A;  1Q7Y C;  2K01 A;  4O2B F;  4RAY A;  4I7H A;  3HOZ G;  4B3R L;  4DUZ Q;  3HOY G;  2OQ0 A;  1Q12 A;  5CV7 A;  1WTQ A;  1B6S A;  4X62 H;  1EUJ A;  4RG1 A;  3NBH A;  1TS2 A;  4TVA B;  3SDZ A;  4JV5 H;  4BBS B;  1RKN A;  4KN4 C;  2G5D A;  3CCR A;  3ULJ A;  4AYB G;  4DGZ A;  4LNQ A;  4E4T A;  5M5Y H;  4DKA C;  3VPD A;  5CA1 F;  5DQH A;  4LF7 H;  5I4D A;  1GGO A;  2UXD Q;  3GIM A;  5FLX W;  2NU9 B;  5KFX A;  5J1Z A;  4X3S A;  2SOB A;  1KD1 C;  1I50 H;  3I4N G;  1CK1 A;  4LF8 Q;  4C3H B;  2JA5 G;  1E4G T;  4DV0 Q;  4TV9 F;  2W6Q A;  2XIG A;  4HIK A;  2H4O A;  1VQM A;  3GD7 A;  1I4P A;  1KTK A;  2E2I B;  4NKL A;  2E74 C;  3KF6 A;  1KJJ A;  1BBX C;  2B8F A;  2BE5 D;  3S15 B;  4EQ5 A;  4HJA A;  1CUK A;  4TRD A;  2GPW A;  3PO2 G;  1KBL A;  3GTP H;  5JOB A;  4PDB A;  4LH6 A;  5I2Y A;  4YR2 A;  4AYB B;  2PCF B;  4JC0 A;  1RCV D;  1VDZ A;  4YWL A;  2F0E A;  2ZDH A;  3F2U A;  1KJI A;  3R23 A;  2FLP A;  3HOX H;  4C2M B;  1EIY B;  4GLV B;  3R5H A;  2PW5 A;  5KFJ A;  3CU7 A;  1AE3 A;  3CMA A;  1Q8K A;  5IYB G;  3N43 B;  3PW5 A;  1LTG D;  2B39 A;  3U58 A;  2I0Q A;  1PH9 A;  2OH2 A;  4RB2 C;  4LF9 H;  1PRT F;  4DV7 L;  1LT6 D;  5LHY 1;  1VMC A;  4ZUI A;  1NTG A;  2C9O A;  5FOB B;  2QA4 A;  3LWB A;  3L9A X;  1AW7 A;  1XPO A;  2JEJ A;  5EPL A;  4KHV A;  3EQL C;  1V1P A;  1A3V A;  1HNX L;  2RKS A;  2PN1 A;  3ITP A;  3RB3 A;  4MV7 A;  1TWF B;  1L2Z A;  1O7L A;  1XTD A;  1I7L A;  2E2H H;  3NTI A;  3MWE A;  2WKD A;  4YCV A;  2AUK A;  3JRW A;  5EWG A;  5LMN W;  4JI4 L;  1X3E A;  3U9S A;  1M90 C;  4NXM L;  2R6G A;  3TP7 A;  5T1G A;  2CVR A;  3HKZ G;  3GTK H;  2AQ4 A;  3KDF B;  2TMP A;  3I4O A;  4DFA A;  4FU0 A;  4ME3 A;  1EFI D;  3BZC A;  5FPO A;  4YY3 H;  4O3N A;  3V05 A;  4KKU A;  3PUX A;  1CA6 A;  1KNA A;  4F87 A;  4IPH A;  4B3T L;  1B50 A;  1Z2P X;  2UUB Q;  1S0N A;  3DXJ C;  4LFC Q;  1LAB A;  1Y8O B;  4ECV A;  3RIZ A;  3S2D B;  1VF5 C;  4DNI A;  1J8I A;  4K6L A;  3OUZ A;  2IY5 B;  1G6P A;  1A0I A;  3ULP A;  1RTO A;  5A2Q E;  5IY0 A;  3E3X A;  1BCP C;  3BU2 A;  1BNC A;  4NXM H;  3R2T A;  1STA A;  4ECQ A;  4JI4 H;  3VR2 A;  2FP4 B;  2R93 B;  5IGG A;  4LF4 Q;  1Q46 A;  3BAA A;  5BPH A;  4DL6 A;  1YNX A;  3GTJ B;  1V8Q A;  1TWH A;  4IAJ A;  3QZ8 A;  3R8B A;  2XCL A;  3EYY A;  1PTO F;  2HQE A;  4FNF A;  4DV2 Q;  2UXC H;  1SE8 A;  4DXF A;  3TIN A;  4J9N A;  5KNC A;  4J0M A;  1II3 A;  1CT1 D;  2F4V L;  2A73 B;  1TWH H;  1I5F A;  1VMP A;  1BXR A;  1EYZ A;  2N78 A;  2LXK A;  4JBW A;  4BY1 G;  2QF7 A;  1HR0 L;  3CCL A;  3LGJ A;  2F0L A;  4ED0 A;  2E2I A;  2JN4 A;  1T5X D;  1NBW A;  2BH2 A;  5C8Y F;  4LJZ C;  3DUZ A;  1A2U A;  3QOL A;  1Z2O X;  3MFI A;  5KT4 A;  1SNO A;  1UWV A;  4JI2 L;  3JAM i;  3CKI B;  4RB1 A;  4EGQ A;  5NUC A;  2ZJR A;  2W8K A;  1PMR A;  1PH3 A;  1HNW H;  2B63 A;  4NP5 A;  2ZTE A;  3H0G B;  2YS7 A;  4ED8 A;  4QUF A;  1JXL A;  3Q1K A;  4QCL A;  2V9W A;  4JOI C;  2WB1 B;  4JV2 A;  1G2T A;  1YHA A;  3GTL H;  5D1P A;  1LO5 D;  1OWT A;  1NY4 A;  3G4S A;  4O1N A;  2EYM A;  2SNS A;  2EIF A;  4DV1 H;  2YRX A;  4UFZ A;  3OOC A;  3T51 B;  2LS0 1;  4A76 A;  3HOV H;  1MSG A;  4Q8E A;  4GNX C;  3EJI A;  1WYD A;  2ATL A;  2RDG A;  1UNS A;  2R93 A;  2PW7 A;  1XMO H;  4X65 H;  4XX0 B;  3BG3 A;  4LFB L;  4AQY L;  2WAC A;  1CZW A;  1M6V A;  1LV9 A;  2E2I H;  2HCC A;  4EX5 A;  1D2B A;  2EYJ A;  1GUT A;  1SXT A;  3VPC A;  1Q1B A;  1DXM A;  4C3H H;  5IYD H;  4QW9 A;  5IYC G;  4DV4 Q;  4C5B A;  2UUA H;  4C3J H;  4MTE A;  1XMQ H;  4YHH L;  3M4I A;  3T5K A;  1PYS B;  1C9O A;  1SAP A;  1JCK B;  4DV5 H;  4HJ9 A;  2JA8 H;  1N34 Q;  2R87 A;  1Y8N B;  3L0O A;  1IKM A;  4A3D B;  1BCP F;  5KFW A;  4DR7 Q;  4KI0 A;  2CCZ A;  4EBE A;  3DMU A;  1VQ7 A;  1ILQ A;  1UC8 A;  2RBM A;  4RMF A;  2KEN A;  4IPD A;  5D1O B;  4PMC A;  1GSA A;  3BJU A;  1XMO Q;  4JI8 Q;  1QUQ A;  3D4W A;  2EQS A;  1WJJ A;  5C4J H;  4NXN Q;  4JV1 A;  5DGB A;  5GAG C;  2W6Z A;  1VQG A;  1J6Q A;  2R92 H;  3CCU A;  4BY7 H;  2FJZ A;  2E76 C;  3LNN A;  3HOV G;  2P0A A;  4C1N K;  4QIW E;  2IX1 A;  2RDJ A;  3MR6 A;  3H4B A;  2C2E A;  4LFB H;  2HVS A;  4DR3 H;  2AQ2 B;  4DAY A;  1XMO L;  4PZ8 A;  2BQ3 A;  3MEF A;  4IUR A;  2W71 A;  2C28 A;  1LLR D;  3D31 A;  1MKH A;  1GVP A;  2E8G A;  2NB0 A;  1NUC A;  5CV5 A;  4O3O A;  3BQ2 A;  4DR6 Q;  3A74 A;  3K8A A;  1C0A A;  1TS5 A;  1K8G A;  2JA5 A;  4F88 A;  2D2C C;  5KFV A;  2F0D A;  4DR7 L;  3TZU A;  3MA2 B;  1R4Q B;  2AGP A;  1N34 L;  4KJO A;  2NUA B;  3CCE A;  4JI1 L;  4JYA Q;  2A68 C;  4A93 B;  4EBD A;  2JA8 G;  1H9S B;  4UPA A;  4JI3 Q;  3MZ5 A;  5KFM A;  3I2Z A;  1PRT D;  4DV4 L;  1JE4 A;  1EZ8 A;  1F9P A;  4P74 A;  4X3K A;  2F0P A;  4LH7 A;  4FBU A;  3MWM A;  5IYD G;  2VUM A;  2EXZ A;  2YZM A;  1SDF A;  1BF4 A;  2F0Q A;  3K7U C;  3KF6 B;  4C3I G;  1E1T A;  3JAM W;  1K3B C;  4BY7 B;  2DNE A;  3CPF A;  4LFB Q;  2ZDG A;  2N55 A;  1N33 Q;  2R92 A;  2HQL A;  5EGT A;  3S1R H;  2F0T A;  3LP8 A;  1QNU A;  1RJP A;  2G9H D;  2NU8 B;  1ZKO A;  3NGD A;  5C4Z A;  4QWC A;  2HIX A;  1GOZ A;  1QZH A;  4WRD A;  3GTQ H;  1PTO B;  5GON F;  3OIQ A;  3J81 E;  4JI5 H;  1UEA B;  1DJR D;  4M1U B;  3SXH A;  5EKI A;  1YIT A;  4JI3 H;  2RA4 A;  3DEP A;  4ZQ3 A;  5JVD F;  2JA8 B;  2P5Z X;  5D14 A;  4KY5 A;  3Q23 A;  2HD3 A;  3HOY H;  4DR1 H;  4A3D G;  1ZQ7 A;  3GTO B;  1EFW A;  2IX0 A;  3SK8 A;  5LL6 b;  3SE0 A;  3DLL A;  4IO9 A;  2VUM H;  5KFL A;  1DM0 B;  2FFK B;  5G3L D;  3W5O A;  1E3P A;  3RGX A;  2OLS A;  1BOS A;  3RB4 A;  1I6U A;  4EQO A;  2CQO A;  1EU4 A;  4R4O A;  3ZYY X;  1XPU A;  1HR0 Q;  3HOW B;  2A6H C;  2IW3 A;  3J7A 5;  3J81 j;  2V4Q A;  1MJC A;  2FHT A;  4MIU A;  4JBM A;  4I4T F;  1G2S A;  4B3T H;  4CC5 A;  1GSH A;  3PW4 A;  5KG0 A;  4APM A;  3TP5 A;  5FK9 C;  2I5L X;  4M7E A;  1KAA A;  1K83 H;  2IPK D;  3KHH A;  4EFE A;  3A5Z B;  3JAM L;  4PG3 A;  2VQE H;  4MA5 A;  3GIL A;  2K03 A;  2L4N A;  2EE1 A;  1CQI B;  1WSC A;  5DG7 A;  1GHK A;  5C3E H;  1PH1 A;  3A8J E;  2E2J H;  2RDF A;  2VB2 X;  2OT2 A;  4ZLT F;  3RF2 A;  1PHJ A;  4ZCK A;  3H15 A;  2LMC B;  4A3J B;  5FD5 A;  3Q8Q B;  3PO2 B;  5H80 A;  3PZP A;  2D0P A;  4IOC A;  1XTC D;  1D8L A;  4ED1 A;  3TN2 A;  1S3O A;  2F3W A;  5FJ8 G;  4A3L G;  2R86 A;  4B08 A;  4HSV A;  5IYB H;  5EBC A;  4C5C A;  1HNX H;  1AFP A;  4B3T Q;  2O5J C;  2W9C B;  3KF8 A;  4J9P A;  4KMU C;  4KJN A;  1HQM C;  1HNZ H;  2A1A A;  1YEZ A;  5IYZ F;  1GUS A;  2WFW A;  5D8D A;  3V6H A;  4Q43 A;  3EBE A;  4DAP A;  1UE7 A;  3GTM H;  4OO1 H;  3D8G A;  1X3P A;  3HZX A;  4QIW B;  4L5R C;  5JVL A;  3FHW A;  5K36 G;  4XZ3 B;  3E9I A;  5C3W A;  4B9X A;  1VQI A;  4OEL B;  1JMC A;  2YU9 H;  1H9J A;  1BXT A;  2E5L L;  1RIP A;  1ASZ A;  5E1F A;  1EEF D;  5IT9 L;  1SYF A;  5L1L A;  4A3I G;  4Q0Y A;  4GC7 A;  1NMG A;  4IRC A;  4WFN 3;  2UU9 H;  1Y1V B;  4H02 A;  3HOU H;  2XNA C;  1IYU A;  4KKT A;  5KRU A;  1JWM D;  2EY1 A;  1HNX Q;  3OSO A;  4RGO S;  3E0E A;  4CJ2 C;  4NLG A;  5KT5 A;  1PDQ A;  5CC4 A;  3FDS A;  3U9T A;  4QJF A;  3TDQ A;  4DAM A;  4K5W A;  5JH7 F;  3UE1 A;  2BA1 A;  1EQV A;  2VA3 A;  3S1Q H;  2HCI A;  3GIQ A;  1X9N A;  1CHQ D;  3ER0 A;  2NVX H;  5I9P A;  3QFF A;  4R4I A;  1V9P A;  3U50 C;  3AFQ A;  4O42 A;  1SYG A;  4L5T A;  1F77 A;  1IHZ A;  2KHJ A;  3AU7 A;  3GQB A;  1OXV A;  4LWC A;  4A3G G;  5KG3 A;  4UCT A;  3GTK B;  2FMC A;  1GKH A;  4X62 Q;  4DUZ H;  2ALZ A;  4UP9 A;  4JI6 L;  5EJW A;  1XNQ Q;  3K5H A;  4K14 A;  4JK1 C;  1Y1V G;  1B1Z A;  1EIG A;  2ZDQ A;  2YTV A;  3AFP A;  1QG7 A;  1M4V A;  1QCB D;  4J1M A;  5JVG 3;  5IT9 c;  4FXD A;  3GTG H;  1U4M A;  4A3F H;  1N8R C;  1QNK A;  2KCN A;  1TWF H;  3VR5 A;  2VQF L;  4K5X A;  3R3O A;  1IBL Q;  1SYE A;  2ZT9 C;  3M4O H;  5GAD C;  5HGT A;  2WTF A;  1FL0 A;  2PMZ E;  5C3E G;  3RJ0 A;  4KY7 A;  3S2H H;  3E0J A;  4QWE A;  4LSA A;  4GNX A;  2ASB A;  3G8C A;  3MXG A;  4UAI A;  4RNM A;  2AQ1 B;  3TS2 A;  5L1K A;  4BXX H;  4U67 3;  3DWA A;  4DL4 A;  4YR0 A;  1CKN B;  1JWU D;  2F0V A;  2I46 A;  1TQO A;  4KTA A;  1ICW A;  5C4X G;  1J9O A;  2B2U C;  3MEH A;  3MR5 A;  3M7N A;  2WAQ E;  3CCJ A;  2ATW A;  1IW7 C;  3UDF A;  3KLW A;  5IWA L;  2XWJ B;  4DUZ L;  1KC7 A;  4ME5 A;  2Y0S A;  4YIJ A;  2Z8L A;  4LFA Q;  1D5M C;  2FIN B;  4R8I A;  3GIP A;  1TA8 A;  2CFM A;  1AE2 A;  1FJG L;  2K5N A;  4YWM A;  2I07 B;  1TWC A;  5J2T F;  3T16 A;  4H13 C;  4HR7 A;  3OPO A;  2B2Y C;  3S1N H;  3PF5 A;  3RV3 A;  4K0K Q;  3Q8R B;  5JUM A;  2XCP A;  4DL7 A;  4LF9 Q;  4DV1 L;  4MV6 A;  4CKB A;  2QDL A;  5H1S E;  1FVI A;  1XXG A;  5T1I A;  3G6X A;  2QEJ C;  4B3S H;  2CKZ B;  2WAQ G;  1ET9 A;  2AGQ A;  2UVU A;  1YJN A;  1JOR A;  3W1B A;  1SN8 A;  4DF7 A;  5ISR A;  4FF3 A;  1I94 H;  1HNW L;  1EL0 A;  4J8Q A;  1AZQ A;  4A93 G;  3J81 W;  1AEX A;  3HEJ A;  1O7Y A;  5DLG A;  1S10 A;  5DLQ E;  3SEB A;  3X3M A;  2I80 A;  2RHS B;  4A3E G;  1Y1W G;  1X56 A;  4FXK C;  3E5S A;  2Q8T A;  4LF7 Q;  1ESR A;  4GLA C;  5M5X H;  2VXW A;  3TBI B;  4ZQI A;  4C3I H;  1JIH A;  4AYB A;  2XN9 C;  3CCQ A;  2CHB D;  4LW1 A;  4DV6 L;  3EPG A;  4OO1 I;  1I6H B;  1C4Q A;  3PN1 A;  1I4H A;  2Q8I B;  4DV0 H;  4R4T A;  2IX3 A;  4IJH A;  4B3S Q;  3EIV A;  3D6C A;  3S17 H;  4WJW A;  2YZG A;  3RUP A;  2F0U A;  3M9M B;  5KGU A;  3BA8 A;  3BJY A;  3J7Y W;  3A8K E;  4BY7 G;  1BJT A;  5IGC A;  2NZH A;  2EZV A;  1I94 Q;  3ERQ A;  3K7A H;  2RDH A;  1EUC B;  3NBI A;  4OHJ A;  1Q86 C;  1IBK L;  3H4D A;  1GHJ A;  4TQR A;  4UP8 A;  3WOF A;  4MV1 A;  3IL8 A;  3I4M G;  4HID A;  4RU9 A;  1LTR D;  4ZKB B;  1TWA B;  2VA2 A;  2EYL A;  4KHP H;  2MNA A;  3D4R A;  3VR4 A;  2VQE L;  5DQG A;  3N52 A;  4DR5 H;  2WP8 J;  4DV2 H;  4KN7 C;  2YTY A;  5IP9 G;  3BZK A;  4GKJ L;  4GKJ H;  1CE8 A;  2A6H D;  2GVB A;  3ND8 A;  3MXP A;  3I4N B;  3OWE B;  5KFF A;  4YWK A;  2L1B A;  4GNX B;  3FPU B;  2B2Y A;  5COR A;  4QY7 A;  4I7A A;  3Q0A A;  3CW2 C;  1SE4 A;  4B9W A;  4O3P A;  4FXG C;  5TSS A;  4A3K G;  1L0Y B;  1SEI A;  4WD3 A;  4XQJ A;  4POG A;  3S9W A;  4RWS C;  5KG2 A;  2ZM6 L;  5IP9 H;  3E9H A;  3PV0 A;  3SE7 A;  5C3X A;  3K5O A;  3KLS X;  2GA4 B;  4B3M L;  1WI5 A;  4RGT A;  3GTJ A;  4KV6 A;  2MP1 A;  1SE2 A;  3WO1 A;  1F2Z A;  3T1Y H;  3HOZ B;  1FYC A;  5C44 B;  1PVO A;  2I5M X;  2IP4 A;  4HIM A;  2Y0S B;  4A3G H;  2RCF A;  3UQ8 A;  1GO3 E;  2FK2 A;  5BR8 L;  1BUV T;  1NCV A;  1XPR A;  1I50 A;  4L5Q A;  3M4Q A;  4DXG A;  3M4O B;  1EQQ A;  4MV3 A;  2F3I A;  1S72 A;  2JA6 B;  5M5W B;  1U0L A;  4RAU C;  3M9N B;  2B2W A;  2CW0 D;  4A3F B;  1VQD A;  4DL5 A;  3PCO B;  1EUD B;  4ZRZ A;  3G6E A;  4FBT A;  1EZ6 A;  4OGQ C;  5LA6 F;  1KDA A;  4DR2 L;  5C1O A;  2PO4 A;  5ELE A;  3OTO Q;  5IWA Q;  1EY6 A;  1E4F T;  2GVA A;  2NVT B;  2L5T A;  4OWW B;  2Y0S G;  4ECR A;  1ENA A;  2QCP X;  4JI0 Q;  5KFI A;  4BXX G;  2UXC Q;  4DV4 H;  2YZN A;  2Q2U A;  3BA9 A;  3PMF A;  4C1N I;  4DNT B;  3CD6 A;  4G4K A;  2Z1C A;  1YHQ A;  1HUN A;  2JJQ A;  1RTN A;  2JEB I;  5HUR A;  4X66 Q;  4DA2 A;  5CYU A;  2WKC A;  2CH4 A;  2WB1 G;  3A7L A;  4QL5 A;  5A2Q W;  3H40 A;  1JKJ B;  1V1P B;  2F0W A;  4TQU S;  1IW7 D;  4R4C A;  4Y7N H;  1BBU A;  4QWB A;  4DU9 A;  3K5L A;  2B63 H;  1Q1E A;  4JI8 H;  3T5L A;  4IR1 A;  1E24 A;  4K8J A;  4PMB A;  1UC9 A;  2KJX A;  5KT3 A;  3OTO H;  4DL3 A;  1Y1V H;  5ELB A;  1VQA A;  2JA7 B;  5BN5 A;  1B2T A;  5DLF A;  5COY A;  5KFZ A;  1J5E H;  1C30 A;  4FS2 A;  5IOC A;  2PMZ A;  3ICE A;  2G9D A;  2E2D C;  5EBD A;  2A6E D;  4WJ4 A;  2IHE A;  1D1I A;  1ROD A;  1K8M A;  3KYH C;  2K6A A;  3JAM E;  1VBG A;  2X0S A;  2YV5 A;  3BYY B;  5GAE C;  5KX5 F;  4JBJ A;  3OHB A;  4QQB X;  4GKK L;  3IN5 A;  3BYT B;  3UDG A;  2CQA A;  4HQ6 A;  4DUY L;  2LKV A;  2C5C A;  3GV6 A;  3RMH A;  2CWA A;  3HG9 A;  1IKL A;  1OXX K;  2OF1 A;  3T13 A;  4LUV A;  4ZKC B;  3DM3 A;  1MBY A;  2BQU A;  4YHH H;  2EY5 A;  5J22 A;  2C2D A;  1T3N A;  4RKB A;  2VB3 X;  3M3Y H;  2W7O A;  2IA6 A;  3IFT A;  3I72 A;  1J5E L;  2K14 A;  1CZG A;  2YTX A;  3VYR A;  3URY A;  1ML0 D;  1SR3 A;  5KNB A;  1O78 A;  2TSS A;  4A3E B;  1Y1W B;  1W6K A;  2E2J B;  3EN2 A;  4X65 L;  2MO0 A;  2E5L Q;  4WBN F;  2W9B B;  4X64 L;  5KFC A;  4HNV A;  1PTO D;  4LF6 L;  3V96 A;  1YJ9 A;  3VR3 A;  5LMN L;  1HFN A;  3GID A;  4JBK A;  3EVQ A;  3ZJY C;  3BQ0 A;  4J9Q A;  2IL8 A;  2L11 A;  5LXT F;  1V4Y A;  2JXM B;  1JJ2 A;  5IT9 E;  4Y52 H;  3H20 A;  4EYI B;  4A3C H;  3CPW A;  5DQI A;  4ECT A;  1EWC A;  2CZG A;  3RNU A;  5M3M H;  1XJV A;  1TY0 A;  4R1J A;  1TS3 A;  5FO7 B;  3SGI A;  4DK1 A;  5JJI A;  1ZYR D;  1WTH A;  3S14 H;  3Q2O A;  4R7R A;  4FF4 A;  5KND A;  4IAL A;  2R8J A;  3R5F A;  1CS0 A;  1VQ6 A;  1P16 A;  1OO9 B;  1W3S A;  3TIG A;  1CQJ B;  1SRU A;  1C7Y A;  3GV8 B;  3PO3 H;  4V19 0;  1EY8 A;  2ZJT A;  3HXL A;  3GTL A;  5KFN A;  3OHX C;  4PQX A;  1KIX A;  5BMV F;  1S5D D;  3U9O A;  2A5H A;  3KAJ A;  3MR2 A;  1E4E A;  4LF5 Q;  2NBF A;  1VKZ A;  2KA7 A;  3TP8 A;  4JYA H;  1I3Q H;  2QEX A;  1VQO A;  3H0G G;  3N42 B;  1XNR H;  4RGM A;  1LT5 D;  5BN3 A;  3TRZ A;  5KG4 A;  1JR0 D;  3T1Y L;  1DCZ A;  3SK4 A;  2CH4 W;  3CF5 A;  1EOT A;  5L1I A;  1RF2 D;  4F8M A;  5IGE A;  3CCS A;  1SFO H;  1LAC A;  1WCM B;  4OX9 L;  5ELC A;  1JOO A;  3NTH A;  2K50 A;  2R85 A;  2FK3 A;  1JDE A;  4U6P A;  1TWA H;  3MFY A;  3GV3 A;  3RAQ A;  1YNJ D;  4QUC A;  4IUN A;  1MHW C;  3H6M A;  3RZO H;  4S3S A;  1B3Q A;  5FJ8 H;  5T14 A;  4EYH B;  1JIC A;  2MUY A;  3OIP A;  4RNN A;  1QZG A;  4PZ7 A;  5C4X H;  1EY4 A;  4FF2 A;  2YL2 A;  3RFC A;  2R7L A;  4JI5 Q;  1BCP D;  1N56 A;  1PA6 A;  4MHE A;  4RUC A;  2KCM A;  1XNR Q;  4DR4 L;  5KFU A;  1S0O A;  3A56 A;  1MI2 A;  1YNN D;  1E4E B;  5EDW A;  3G6V A;  4BBR B;  1I4R A;  3K81 C;  4JPB W;  2HHH L;  4KHP L;  5IP7 H;  2EXD A;  1SYD A;  4DR1 Q;  3H3V C;  3PO3 G;  2R7Z A;  2F52 A;  4ECW A;  4ECX A;  2VZA A;  1Q81 C;  2DZD A;  1EYD A;  5JPN C;  4A75 A;  1B9N A;  2AMC B;  5E7N A;  4IOA A;  5M5X B;  3HFZ B;  2UXB H;  1ZXT A;  2HHH Q;  2QK4 A;  3DEO A;  2KEC A;  5KFY A;  1B3A A;  2B8G A;  5A35 A;  4ZYS A;  3HGB A;  1WVL A;  4QMG A;  4Z9C B;  2B63 G;  1SSO A;  1HR0 W;  4OIJ A;  3S1M H;  1F2M A;  2IWH A;  4LMQ D;  1ESF A;  3BVZ A;  2EDG A;  1AH9 A;  1AZP A;  3F2D A;  4N9T A;  3I7F A;  4DR6 L;  1JB7 A;  2VW9 A;  2V1C C;  3T1H L;  2B2T C;  2HIV A;  3CAM A;  1SYX B;  2V59 A;  1FD7 D;  3BDL A;  4HJ5 A;  5C44 G;  1DV1 A;  3BG5 A;  3FVQ A;  1IL8 A;  2R92 G;  3KLS A;  2BR0 A;  3KHR A;  1H9R A;  1I3Q B;  4ODG A;  4XDX A;  1WTR A;  2B63 B;  1HXY D;  3KAK A;  4ECY A;  5IIF A;  4R8U B;  4EQN A;  4Q5V A;  4NXN L;  1DYQ A;  2K5Q A;  2XRS D;  5KFT A;  3RB0 A;  4DK3 C;  5J39 A;  4H44 C;  2VNU D;  3GTQ A;  3GTP A;  4J9K A;  3RAX A;  1ET6 A;  1PV4 A;  3A7A B;  3ND9 A;  3ETJ A;  2X6L A;  4QIW A;  2WB1 E;  2ENB A;  5DAU A;  5KKN B;  3N40 P;  3SK5 A;  1F2L A;  2NVQ B;  3RB6 A;  1RYR A;  1VQK A;  4LF6 H;  1EY7 A;  2FE3 A;  3BVM A;  4A4I A;  1WTO A;  4X64 H;  5KFP A;  4J9O A;  1KEE A;  3UFX B;  2I5H A;  1K1S A;  3DWP A;  5IYC H;  2NVT H;  2XCA A;  3F1Z A;  3MXN B;  4JV5 L;  3JSN A;  3N41 B;  3TRE A;  3NPP A;  4CGY B;  4L8J A;  4PMW A;  4RFB A;  3X3N A;  1IXR A;  4H7B A;  1K3R A;  1LTA D;  2Z6K A;  1QVG A;  3I70 A;  1PFB A;  2JA6 A;  4A3L H;  4KD4 A;  2LFN A;  3RGZ A;  4B3R H;  4L63 B;  3HKZ E;  1SMX A;  1ENF A;  4AQY Q;  3RBE A;  4G57 A;  1ASY A;  2AGO A;  2XVS A;  1JC7 A;  4GOP A;  2JA6 H;  1B04 A;  4YAK B;  4Q8F A;  1PRT C;  1LYL A;  1KRT A;  1G6Z A;  2A6E C;  3VA7 A;  1JB3 A;  5KEE A;  1S40 A;  4O4H F;  1C48 A;  2UXD H;  3HB9 A;  1NSN S;  2V58 A;  3KDF A;  1CKM A;  5JEA J;  1CSQ A;  2Z0S A;  4K6D A;  1BNZ A;  1DV2 A;  4K0K H;  2R7N A;  4LF6 Q;  2NVQ H;  1TWG B;  4X3U A;  1B53 A;  4X64 Q;  5KFA A;  4CJ0 B;  2JEI A;  4E6I A;  2DJG C;  4IUV A;  4L6T B;  3W1G A;  1M0W A;  3NE5 B;  2ASL A;  2DPI A;  2RQX A;  2R6F A;  3QWN A;  4X3T A;  3HP3 A;  1FNU A;  4CDD C;  1TWF A;  1XNQ H;  3M4P A;  3RV4 A;  4ETS A;  1E22 A;  2VPS A;  2K5V A;  1RL2 A;  2F4I A;  4NW2 A;  5K5P A;  1KJQ A;  5AFW A;  1WH2 A;  3K0Y A;  3K57 A;  2W9C A;  2W7P A;  1L1O A;  1Z47 A;  1W2B A;  1U5K A;  3NEN A;  3I73 A;  2M2L A;  2QGQ A;  4HSP A;  4DUY Q;  2RSO A;  4K2K A;  1SJH D;  4ILW A;  4HCS A;  4X6A H;  4R9W A;  5C0X I;  1N36 Q;  1JLL B;  1SRO A;  3RN2 A;  1H9K A;  1K8O A;  4A2A A;  2HVR A;  1YHB A;  5BN4 A;  5C1P A;  1ZET A;  3G7L A;  4EBC A;  1B33 N;  3OHA A;  4C56 C;  3OWF A;  3QJY A;  1PZJ D;  2F3V A;  1SJE D;  4IUP A;  1F9R A;  1CI3 M;  1RJQ A;  2ZXR A;  2KBN A;  3G6Y A;  4LF4 L;  2F0G A;  2D0O A;  2PI2 E;  4HTH A;  2ID0 A;  1LTL A;  3K7A B;  3J81 L;  2N8N A;  3NWS A;  1HRJ A;  3TSS A;  5KG7 A;  1PH6 A;  4EGV A;  1YNN C;  3C2P A;  4FF1 A;  2OTL A;  3PSI A;  3FDT A;  3Q8D A;  3SI8 A;  2PQA B;  2FK1 A;  2V5A A;  2WIN B;  2CWP A;  2UUB L;  4DR4 Q;  2F4V H;  1S4Z A;  3C46 A;  4MN3 A;  1NJI C;  2NVY B;  3FMA A;  3CCM A;  5F9N A;  2DJF C;  4ULL A;  2OQK A;  5I6Y A;  2JYO A;  3T53 B;  2PYK A;  5IP7 G;  2SCU B;  3PUW A;  3NXW A;  5KG5 A;  1RYS A;  3RZD B;  1WFQ A;  4B3M H;  1K0S A;  1PZI D;  2OTJ A;  5M5W H;  4IJL A;  4NXM Q;  3GTP B;  1WTV A;  3K59 A;  3RLN A;  2FPP B;  1F9Q A;  3RZO B;  4OX9 Q;  3KF8 B;  1KRS A;  1EZ1 A;  3K5M A;  3PVX A;  4APV A;  3I55 A;  3BQ1 A;  1VQJ A;  2EJG C;  2R3Z A;  4JW0 A;  1PH4 A;  5BPF A;  2LY7 A;  1UAP A;  2A68 D;  2B2V A;  3T1Y Q;  3D6W A;  1SFO B;  1AN8 A;  3EPI A;  1QIL A;  1QUQ B;  3J80 L;  1ENC A;  3S1N B;  4YQW A;  1BDO A;  3HOY B;  3NP8 A;  1PH7 A;  3MWD A;  4MV9 A;  4EEQ A;  4A3K H;  4DV7 Q;  3BS1 A;  4KD3 A;  4LUO A;  1B44 D;  5I2X A;  2ICE C;  4MZ9 A;  2KCC A;  3DF7 A;  1CHP D;  2F1M A;  1WTW A;  3FKI H;  4EGJ A;  5EWE A;  1S97 A;  5EAY A;  2NVY A;  4B3M Q;  3H94 A;  3HOX G;  1I6V C;  1Z9F A;  2F0M A;  2EYP A;  3DHQ A;  2M9V A;  3K3P A;  4HJ7 A;  3N6R A;  3FKI A;  4OX9 H;  1QOH A;  1JJC B;  1KDB A;  1HHV A;  2PQA A;  3S1R B;  1VQP A;  2F0N A;  1EWH A;  2AWN A;  1B9M A;  2ZTD A;  2HVQ A;  4DR5 Q;  2L15 A;  3N8D A;  1EIF A;  1GJX A;  1X55 A;  4YY3 Q;  3CP0 A;  1DIK A;  1TWC H;  1H9S A;  3UDX A;  1LTT D;  1S5B D;  4J15 A;  4GKJ Q;  1SNC A;  4DAY B;  1EY5 A;  3S14 B;  5KYI A;  2XD4 A;  4DV0 L;  4V0B A;  1WD0 A;  1WCM A;  2R7Z H;  3V6J A;  1QVC A;  1VF7 A;  4LUZ A;  3PUY A;  2VUG A;  1JE5 A;  2ICI A;  3D3R A;  3J80 c;  3ORQ A;  2B3G A;  4K5V A;  3CME A;  5LMN Q;  2YCH A;  1I4Q A;  1A6X A;  2YYZ A;  1T9H A;  2N49 A;  4RHR A;  1EOV A;  2DIK A;  2K32 A;  1S03 G;  2F0S A;  3Q22 A;  3G48 A;  2KQ3 A;  4LF4 H;  1IBK Q;  2NVY H;  4UDU C;  5HY6 A;  1ICF B;  3PW0 A;  1B7Y B;  4OXP A;  1QVF A;  1K9M C;  1KQS A;  1NR2 A;  4MTD A;  3SVM A;  3QO2 A;  2R93 G;  1EYG A;  1IOV A;  3PF4 A;  4A3E H;  1Y1W H;  1RK5 A;  1E2Z A;  2BDN A;  2K1B A;  4BBR H;  1BO0 A;  4FYD A;  4JI7 H;  2R92 B;  2YYA A;  4C3I B;  4YJ3 F;  2KHS A;  2W57 A;  2JK8 A;  2LXJ A;  1HH2 P;  1IL2 A;  4Q45 A;  4ZAI A;  4DR7 H;  4DV6 Q;  1KJ8 A;  1EU3 A;  2VY3 A;  1E0B A;  2UUC Q;  2PPB C;  3VMM A;  2AQ3 B;  4FP5 D;  5LMN H;  1VQ4 A;  4LF7 L;  1AUX A;  2SNM A;  2RHQ B;  5EQ0 A;  4U68 A;  4HJ8 A;  1K73 C;  1CFM A;  4TSS A;  1R9T H;  1RJT A;  2I87 A;  1HNW Q;  4G7H C;  2JA7 A;  2N3S A;  2A74 C;  1FR3 A;  1WD1 A;  5AJ3 L;  2K5W A;  5LP6 F;  5FLX E;  1GSO A;  3WO0 A;  4NPS A;  2Z9H A;  1N48 A;  1IZ6 A;  2DY7 A;  4DR3 Q;  3NQI A;  2PQE A;  2RCN A;  3PR4 A;  2O03 A;  2DY8 A;  4FVM A;  4X66 H;  4DV1 Q;  5CGK A;  2F03 A;  5LMU L;  3MXU A;  5FPR A;  4TQS A;  1A62 A;  2K75 A;  3GLK A;  5EZY F;  1HZB A;  2K04 A;  3GDE A;  5EPK A;  5LMU H;  5KFE A;  1PFS A;  4GKK H;  3AYH B;  5GQO A;  4X66 L;  3F2B A;  3L4K A;  4PZ6 A;  3T56 B;  2O4X A;  2VR1 A;  1FGU A;  4DAV A;  2FLL A;  4LFA L;  5FO9 B;  4A3M G;  1SYB A;  3LWE A;  2WV6 D;  3K6O A;  2UUA L;  2PZT A;  4TKO B;  4JI0 L;  2JSO A; 
#chains in the Genus database with same CATH homology
 3B6Y A;  1TWG H;  3HOV G;  1SR3 A;  4DV3 L;  2UUA Q;  4QIW E;  2IX1 A;  3JAM c;  3OTO L;  1JT8 A;  3IRB A;  3EN2 A;  4DR2 Q;  3H0G H;  3K80 C;  4X65 L;  2MO0 A;  1XMO L;  4PZ8 A;  4DV5 Q;  3MEF A;  2E5L Q;  4X64 L;  4JCV E;  5JJL A;  3D31 A;  1MKH A;  1GVP A;  4YCU A;  2E8G A;  1B70 B;  5GRO A;  5LMN L;  1YJ9 A;  1PH8 A;  1J5E Q;  3A74 A;  3K8A A;  4DR6 Q;  1C0A A;  4JBK A;  1K8G A;  4MTN A;  2LSS A;  3ZJY C;  4DR7 L;  4GKK Q;  5LMU Q;  3PGZ A;  5BR8 Q;  1JJ2 A;  1HZ9 A;  1G29 1;  3A5U A;  1VQ9 A;  4Y52 H;  1N34 L;  4A3C H;  3CPW A;  4GOP B;  3CCE A;  2VQF Q;  4JI1 L;  3F2C A;  1VQ5 A;  2OCE A;  4JYA Q;  2BA0 A;  2K4K A;  2JA8 G;  4UPA A;  3RNU A;  4JI3 Q;  1V43 A;  3I2Z A;  1EWI A;  5M3M H;  4DV4 L;  1XJV A;  4R1J A;  4P74 A;  3SGI A;  1OXT A;  5AJ3 Q;  2JE6 I;  1VQC A;  5JJI A;  5IYD G;  4KLK A;  3S14 H;  4BY1 H;  4A3J G;  5M3M G;  2UU9 L;  3S16 H;  1E7Z A;  3K7U C;  2H5X A;  1E1T A;  3KF6 B;  3CPF A;  1VQ6 A;  1P16 A;  1W3S A;  2MFI A;  3H3V H;  4LFB Q;  1N33 Q;  1IBM L;  2HQL A;  5ELO A;  4A3C G;  3RR5 A;  3S1R H;  1SRU A;  1C7Y A;  3PO3 H;  1OXS C;  4YCW A;  1KIX A;  2UUC L;  2KCT A;  1MJE A;  3HOU G;  2HIX A;  1QZH A;  3GTQ H;  4LFC L;  4LF5 Q;  1L1O B;  1HNZ L;  3S2D H;  1I3Q H;  2QEX A;  1VQO A;  3H0G G;  3L2P A;  1YIT A;  2KHI A;  3PIP A;  3TRZ A;  2UXC L;  2NZO A;  4AH6 A;  3J81 i;  3T1Y L;  3S24 A;  3I4N H;  2VQE Q;  2Y0S E;  3STB D;  3HOY H;  1B8A A;  3FKI G;  4OO1 G;  3M85 A;  4A3D G;  3CF5 A;  2DUD A;  3CCS A;  4IFD G;  1SFO H;  1EFW A;  2UXB L;  2IX0 A;  2VL6 A;  4OX9 L;  2OWO A;  3DLL A;  2K50 A;  4IO9 A;  3CQZ H;  2JA7 H;  2VUM H;  2DGY A;  3W5O A;  3VDY A;  1E3P A;  1TWA H;  3TQY A;  2UXB Q;  4GS3 A;  5JJK A;  5J3B A;  2CQO A;  1GM5 A;  4R4O A;  1XPU A;  3RZO H;  1X65 A;  3HKS A;  5FJ8 H;  1YJW A;  1HR0 Q;  3RLF A;  5C0X J;  1CKO A;  2ALY B;  3J7A 5;  4BA2 I;  3J81 j;  3U4Z A;  4PZ7 A;  5C4X H;  3J81 c;  1QZG A;  1MJC A;  4JBM A;  2HT1 A;  4JI5 Q;  1PA6 A;  2I5L X;  2KCM A;  1OXU A;  1HNZ Q;  1XNR Q;  4DR4 L;  3FP9 A;  1K83 H;  4YY3 L;  5M3F G;  2K52 A;  1HJP A;  4BBS G;  4DR5 L;  3A5Z B;  1O7I A;  4PG3 A;  4LF6 L;  3K81 C;  2HHH L;  4L5S A;  4KHP L;  4KHZ A;  5IP7 H;  2EXD A;  4DR1 Q;  2R7D A;  3PO3 G;  1A8V A;  5C3E H;  1PH1 A;  1VQL A;  2F52 A;  4DK6 C;  2E2J H;  2VZA A;  1YVC A;  2ZM6 Q;  1Q81 C;  3H15 A;  1PHJ A;  4A75 A;  1Q82 C;  2AMC B;  2D0P A;  5E7N A;  4IOC A;  4IOA A;  3HFZ B;  1D8L A;  1BBW A;  1YBY A;  2UU9 Q;  3TEH B;  3ULL A;  1S3O A;  5ELN A;  1V1Q A;  5FJ8 G;  2HHH Q;  4A3L G;  2R7F A;  5IYB H;  1YIJ A;  2VS1 A;  3K0X A;  3PUV A;  3TS0 A;  4JOI A;  4B3T Q;  1VQB A;  3U4V A;  3HOW H;  2JA7 G;  1HZC A;  3STB C;  2B63 G;  2A1A A;  1YEZ A;  1HR0 W;  1VQN A;  2WFW A;  1OTC A;  4LF9 L;  1PYB A;  3EBE A;  3NEM A;  3S1M H;  4A3D H;  1UE7 A;  3GTM H;  5IE8 A;  3G71 A;  1AH9 A;  1JJG A;  2BH8 A;  3CCU A;  4L5R C;  4IPG A;  3F2D A;  3FHW A;  2D62 A;  3I7F A;  5C44 H;  4DR6 L;  5K36 G;  3GTO H;  1FJG Q;  1JB7 A;  2VW9 A;  2V1C C;  3E9I A;  1KAW A;  2GN5 A;  2HIV A;  3T1H L;  1VQI A;  2AHO B;  1JMC A;  2YU9 H;  2E5L L;  1RIP A;  1ASZ A;  3CAM A;  1P8L A;  4HJ5 A;  4A3I G;  5C44 G;  1D7Q A;  2K5H A;  4QGU A;  1NMG A;  2ZJP A;  2R93 H;  2R92 G;  4H02 A;  4DV3 Q;  4O2D A;  4AIM A;  3HOU H;  4JG2 A;  2A19 A;  2JQO A;  1I94 L;  4IFD I;  3J80 i;  1HNX Q;  3KJP A;  4A3M H;  4B3R Q;  3E0E A;  4NXN L;  4DK3 C;  4QJF A;  4B3S L;  2VNU D;  4DAM A;  3I56 A;  2PNH A;  1N32 L;  1L2F A;  3UE1 A;  1DGS A;  2BA1 A;  1PV4 A;  3UE0 A;  1UE6 A;  2Q2I A;  1KL9 A;  2NN6 G;  3S1Q H;  1X54 A;  2WB1 E;  2A8V A;  1X9N A;  1BVS A;  1VQE A;  3ER0 A;  4ALP A;  2NVX H;  4R4I A;  1V9P A;  1VQK A;  1KXL A;  3U50 C;  3AFQ A;  4GN5 A;  4A4I A;  3UDI A;  4L5T A;  1IBL L;  3OW2 A;  2KHJ A;  4LWC A;  1IBM Q;  1OXV A;  1N33 L;  4A3G G;  4DR3 L;  2I5H A;  4XIG S;  5IYC H;  3JC6 6;  2NVT H;  1G51 A;  3F1Z A;  3MXN B;  1WCM G;  2NN6 I;  3H3V I;  1GKH A;  3TRE A;  4X62 Q;  3HOW G;  5FLM G;  4UP9 A;  4PMW A;  4JI6 L;  1IXR A;  4MNO A;  1XNQ L;  1XNQ Q;  4A93 H;  1K3R A;  1Y1V G;  2Z6K A;  1QVG A;  4JI6 Q;  3A0J A;  2YTV A;  3AFP A;  4X62 L;  4A3L H;  4OWX B;  5IT9 c;  3RZD H;  1KC8 C;  3HKZ E;  1SMX A;  5GAH C;  4A3F H;  3RN5 A;  1N8R C;  4AQY Q;  3NEL A;  4P71 A;  3GTG H;  1TWF H;  1UEB A;  1E1O A;  2VQF L;  1ASY A;  3PUZ A;  1N36 L;  4GOP A;  1IBL Q;  4A3F G;  2JA6 H;  3M4O H;  1LYL A;  1KRT A;  5GAD C;  4K0K L;  1UE1 A;  1S40 A;  5FLX c;  1WOC A;  1FL0 A;  2PMZ E;  5C3E G;  3KDF A;  1CKM A;  3OYY A;  5JEA J;  1CSQ A;  2Z0S A;  1A63 A;  3S2H H;  4GNX A;  1CKN A;  4LF6 Q;  2ASB A;  1M1K C;  3I4M H;  1VQF A;  4X64 Q;  4BBR G;  3KJO A;  2NVQ H;  4DV5 L;  5M3F H;  3W1G A;  3TS2 A;  4IPC A;  1LUZ A;  3GTJ H;  1Q7Y C;  4BXX H;  1XMQ L;  4P75 A;  3HOZ G;  1CKN B;  1L1O C;  4B3R L;  4DUZ Q;  3HOY G;  2OQ0 A;  1Q12 A;  3KOJ A;  1EUJ A;  4OON A;  4RG1 A;  4FDB A;  5C4X G;  3M4P A;  3M7N A;  2WAQ E;  4TVA B;  3CCJ A;  3UDF A;  5IWA L;  3KLW A;  4DUZ L;  2AWO A;  1E22 A;  2ATW A;  4GN4 B;  4LFA Q;  4JI8 L;  2K5V A;  1RL2 A;  3CCR A;  2CFM A;  2XTI A;  1AE2 A;  3ULJ A;  4AYB G;  5M5Y H;  4DKA C;  4LNQ A;  1L1O A;  1Z47 A;  2K5N A;  1W2B A;  1U5K A;  4YWM A;  3J7Z C;  1FJG L;  3NEN A;  4DUY Q;  2QGQ A;  1VCI A;  2UXD Q;  3WWV A;  3S1N H;  3PF5 A;  4X6A H;  4K0K Q;  5C0X I;  1KD1 C;  1I50 H;  4LF9 Q;  3I4N G;  4DV1 L;  4LF8 Q;  2JA5 G;  1N36 Q;  5H1S E;  1FVI A;  4DV0 Q;  1SRO A;  3RN2 A;  2CKZ B;  2WAQ G;  4HIK A;  1PH5 A;  2JA6 G;  4JI7 L;  1VQM A;  3GD7 A;  1YHB A;  1YJN A;  4P73 A;  1IYJ B;  3KF6 A;  3W1B A;  1SN8 A;  2B29 A;  4UY8 C;  4EQ5 A;  4HJA A;  1CUK A;  1HNW L;  3PO2 G;  3GTP H;  1GD7 A;  4A93 G;  2KBN A;  4JV5 Q;  4JC0 A;  4LF4 L;  4A3B G;  4YWL A;  2D0O A;  2PI2 E;  5DLQ E;  3HOX H;  2FXQ A;  1LTL A;  2ID0 A;  2N8N A;  1EIY B;  2RHS B;  4A3E G;  1Y1W G;  1X56 A;  4LF7 Q;  1HZA A;  1PH6 A;  4A3B H;  4GLV B;  4GLA C;  5M5X H;  1AE3 A;  4C3I H;  1Q8K A;  5IYB G;  3CMA A;  2OTL A;  3PO2 H;  3PSI A;  3CCQ A;  1X3F A;  3F8T A;  3U58 A;  2Z6K C;  3Q8D A;  4LW1 A;  4DV6 L;  2PQA B;  4A3J H;  1PH9 A;  2I0Q A;  4OO1 I;  2CWP A;  4DV7 L;  2UUB L;  2XGT A;  1CSP A;  1NTG A;  4R4T A;  2QA4 A;  4IJH A;  4DR4 Q;  4B3S Q;  3EIV A;  3S17 H;  1XPO A;  1NJI C;  3CCM A;  1HNX L;  4BY7 G;  3CC7 A;  2OQK A;  2NZH A;  1I94 Q;  1XTD A;  5IP7 G;  4GN3 B;  3PUW A;  3K7A H;  2E2H H;  1WFQ A;  4YCV A;  4BA1 I;  1Q86 C;  1IBK L;  4UP8 A;  4JI2 Q;  2PI2 A;  5M5W H;  4IJL A;  1X3E A;  5LMN W;  1M90 C;  4JI4 L;  4NXM Q;  3RLN A;  4NXM L;  2R6G A;  4OX9 Q;  3KF8 B;  1KRS A;  4HID A;  3T1H Q;  3I4M G;  3GTK H;  1MIU A;  3HKZ G;  3S15 H;  4APV A;  4BY7 H;  3I55 A;  1VQJ A;  3KDF B;  3I4O A;  1PH4 A;  2MNA A;  2Q2H A;  4ME3 A;  3BZC A;  2JA9 A;  2VQE L;  3T1Y Q;  2WP8 J;  1EQR A;  3HOZ H;  2YTY A;  3KFU A;  5IP9 G;  1QUQ B;  1X3G A;  2MQH A;  2F4V Q;  3BZK A;  2OTJ A;  4WJ3 M;  4GKJ L;  3PUX A;  2GVB A;  1PH7 A;  4IPH A;  4B3T L;  4A3K H;  4DV7 Q;  2UUB Q;  4POF A;  4DV2 L;  4LUO A;  4YWK A;  4GNX B;  4LFC Q;  4MZ9 A;  4QY7 A;  3FKI H;  3D0F A;  3CW2 C;  4DNI A;  5EAY A;  3PIO A;  4A3K G;  2IHF A;  4B3M Q;  2JEA I;  2IY5 B;  1G6P A;  1A0I A;  3HOX G;  3ULP A;  5IY0 A;  3ERS X;  1Z9F A;  4O0A A;  4NB3 A;  4POG A;  3BU2 A;  2ZM6 L;  2RF4 A;  5IP9 H;  3E9H A;  1BKB A;  3PV0 A;  4HJ7 A;  4B3M L;  4LF4 Q;  1Q46 A;  1YI2 A;  1JJC B;  1WI5 A;  2PQA A;  1VQP A;  4DR1 L;  1K8A C;  4KHP Q;  1YNX A;  2AWN A;  2ZTD A;  4DR5 Q;  2L15 A;  5FLM H;  4DV2 Q;  1EIF A;  1SE8 A;  1NMF A;  1X55 A;  3CP0 A;  4YY3 Q;  4GLX A;  1PVO A;  2I5M X;  1TWC H;  1TXY A;  3UDX A;  4JI3 L;  4J15 A;  4HIM A;  1XNR L;  5JEA G;  4JI7 Q;  4GKJ Q;  4R4Q A;  4DAY B;  4JI1 Q;  2JA5 H;  4A3G H;  2F4V L;  4JYA L;  4JV5 L;  2ZTC A;  4JI5 L;  4DV0 L;  1TWH H;  1I5F A;  1GO3 E;  2R7Z H;  5BR8 L;  1QVC A;  4LUZ A;  1XPR A;  4L5Q A;  3M4Q A;  3PUY A;  1EQQ A;  2N78 A;  2F3I A;  2LXK A;  4JBW A;  5HGQ A;  1JE5 A;  4BY1 G;  1S72 A;  1HR0 L;  3CCL A;  3LGJ A;  3J80 c;  1U0L A;  2B3G A;  3CME A;  5LMN Q;  1VQD A;  3PCO B;  3CC2 A;  1SLJ A;  4A3I H;  1NBW A;  3L7Z C;  3G6E A;  2BH2 A;  4P72 A;  2YYZ A;  1T9H A;  2N49 A;  1EOV A;  4JI2 L;  1KHI A;  1UWV A;  4DR2 L;  4JI4 Q;  1N9W A;  3JAM i;  2VUM G;  3CXC A;  3G48 A;  3OTO Q;  1IBK Q;  2NVY H;  5HY6 A;  5IWA Q;  2ZJR A;  1B7Y B;  2GVA A;  2ES2 A;  4OXP A;  1QVF A;  1PH3 A;  1K9M C;  4OWW B;  2ZTE A;  1KQS A;  2Y0S G;  4JI0 Q;  4BXX G;  2UXC Q;  1I6H H;  4OWT B;  1EYG A;  2R93 G;  4JOI C;  4A3E H;  1Y1W H;  1XMQ Q;  3PF4 A;  1YHA A;  5C0X G;  2Q2U A;  3GTL H;  4BBR H;  3CD6 A;  1NE3 A;  1YHQ A;  1NY4 A;  2JJQ A;  4X66 Q;  2JEB I;  3G4S A;  2EIF A;  4LF5 L;  2JK8 A;  2LXJ A;  1HH2 P;  2WB1 G;  1IL2 A;  4A76 A;  1K0R A;  3NBH B;  4C2M H;  4DV6 Q;  3HOV H;  2VY3 A;  3M9B A;  4QL5 A;  2UUC Q;  2IT1 A;  4TQU S;  1VQ4 A;  3AQQ A;  4GNX C;  1WYD A;  4R4C A;  4Y7N H;  4LF7 L;  1BBU A;  2R7Z G;  2B63 H;  1Q1E A;  2RHQ B;  4HIO A;  4LFB L;  3GO5 A;  4AQY L;  3CC4 A;  3CCV A;  1E24 A;  4HJ8 A;  1K73 C;  4YHH Q;  1Y1V H;  2E2I H;  1R9T H;  4EX5 A;  1VQA A;  1HNW Q;  1Q1B A;  2Q2T A;  1Y14 B;  2N3S A;  1WCM H;  1J6Q A;  5AJ3 L;  4C3H H;  5IYD H;  3ICE A;  5IYC G;  4DV4 Q;  4C3J H;  4YHH L;  4NPS A;  4XTC S;  1IZ6 A;  4WJ4 A;  2IHE A;  4GOP C;  1PYS B;  2ZJQ A;  1C9O A;  2C35 B;  4DR3 Q;  3AEV A;  2RCN A;  3KYH C;  2MO1 A;  4HJ9 A;  2JA8 H;  2YV5 A;  5GAE C;  1N34 Q;  1UE5 A;  3L0O A;  4JBJ A;  4DV1 Q;  4LF8 L;  5LMU L;  4QQB X;  4GKK L;  4DR7 Q;  4KI0 A;  2CCZ A;  3UDG A;  1A62 A;  2K75 A;  1VQ7 A;  4DUY L;  1YZ6 A;  2UXD L;  2CWA A;  4RMF A;  3RLO A;  2KEN A;  4IPD A;  4BBS H;  1HZB A;  3GDE A;  1PH2 A;  2AKW B;  1PFS A;  3BJU A;  4AYB E;  3AYH B;  1N32 Q;  5GQO A;  4X66 L;  1OXX K;  3F2B A;  4PZ6 A;  4LUV A;  1FGU A;  1XMO Q;  4X65 Q;  1X6O A;  3DM3 A;  4JI8 Q;  1QUQ A;  4LFA L;  2EQS A;  4A3M G;  1WJJ A;  5C4J H;  4NXN Q;  1H95 A;  4DPG A;  1VQ8 A;  4UP7 A;  2UUA L;  5GAG C;  3M3Y H;  4JI0 L;  4IFD J;  1VQH A;  1LM0 A;  1VQG A;  1J5E L;  2K14 A;  2YTX A;  2R92 H;  1L0W A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...