4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
1E7ZA 1WFQA 2NZHA 2UXBL 3S1RH 1MKHA 3PUZA 4A3JG 4GKKL 1KQSA 3DM3A 4AQYL 3HOUH 1PFSA 2EIFA 2JE6I 4R1JA 3F1ZA 3W1GA 4JI6L 2Z6KC 4L5TA 5AJ3Q 1JE5A 1K83H 2WB1G 4UPAA 4A3EH 4C2MH 5LMUL 2WB1E 1Y1WH 1JMCA 2D62A 3HOUG 3JAMc 2E5LQ 4UY8C 4GKJL 4HJAA 1Y1WG 3MXNB 4LF7L 1NY4A 3GTGH 1X56A 4PZ7A 4C3IH 3PGZA 1L2FA 3H0GG 4B3SQ 1Y1VG 2F3IA 4OO1I 3L0OA 4QY7A 4B3ML 2OCEA 4KI0A 2NVTH 1CKNA 3E9HA 3L7ZC 3PV0A 4IJHA 4JOIC 4P73A 1H95A 3CCJA 3UDXA 4DV1Q 1L1OB 2VUMH 4LF5L 4JCVE 4DR2L 4DNIA 4YY3Q 3BU2A 4BA2I 3BJUA 3BZCA 4R4TA 3VDYA 1K9MC 5IYDG 1IZ6A 4YWKA 4QIWE 4DR5L 3UDGA 2JA5H 3I7FA 3M7NA 2IHFA 1BBUA 1AE3A 1D7QA 3ULJA 2UU9Q 1KRTA 4GLXA 4A3KH 4R4QA 4IO9A 2R7ZG 4A3IG 1VQFA 2MFIA 1PA6A 4J15A 1BKBA 2D0PA 1K8GA 1VQPA 3T1YQ 3KOJA 4JI0L 3EIVA 2KCTA 1O7IA 3PUVA 1SMXA 3OTOQ 2DUDA 1W2BA 3S16H 1JJGA 2I5HA 4OWTB 3OYYA 4QL5A 3S15H 4TVAB 1VS0A 4PMWA 3HKSA 4DR1L 2JEAI 2B63H 4OXPA 3HOWH 5GAEC 4R4IA 4LF8L 4IOAA 3M3YH 4RG1A 4GOPB 2IY5B 4DR5Q 2HT1A 3CAMA 3CXCA 4DR7L 3S17H 3F2CA 2MO0A 4DUYL 2RCNA 2VS1A 5C4XG 4L5QA 1CKMA 4JG2A 3I55A 4DV7Q 1QVFA 3PCOB 4JYAL 5C4XH 2NN6G 2IX0A 5C3EH 4MTNA 2K52A 2RHQB 3S14H 1PHJA 1XNQL 5C0XJ 2JQOA 4ALPA 4X66Q 3D31A 3AFQA 4A3GG 3M85A 5HY6A 4KLKA 1YHQA 1VQ6A 4IFDJ 2E5LL 1XNRL 1YHAA 4JI3Q 2AKWB 2V1CC 1IBKQ 2VY3A 4LF6Q 4DAMA 2HQLA 5FJ8G 1A62A 4DAYB 2VNUD 1OXXK 4LF9L 3F2BA 3CD6A 3S1QH 3CCQA 1E24A 5DLQE 1UWVA 2PQAB 4A3DH 4GKKQ 2R7DA 5IP9H 4A3BH 1U0LA 3A0JA 1T9HA 1LM0A 1Q86C 3PO2H 4DR6Q 4LF7Q 3SGIA 3U50C 1IBLL 1ASZA 3GTQH 4GKJQ 1WOCA 3RLNA 5C4JH 3AEVA 2OQ0A 2K5VA 5J3BA 4FDBA 4LF4L 1FJGL 4A3LH 1EQQA 4HJ5A 4A93G 2LSSA 1TWHH 3G4SA 5JEAJ 4GN5A 1EYGA 2UU9L 2LXKA 1WI5A 3UE1A 1OTCA 3PO3H 3Q8DA 4BXXH 2CCZA 1VQIA 1I3QH 2N3SA 4HJ9A 4BBRH 1UE5A 4JI7L 4OWXB 2WAQE 1TWGH 4NB3A 3J81c 2YV5A 1G291 1Q46A 3ER0A 3I2ZA 4O2DA 1PH5A 1XNQQ 1YEZA 1PH7A 1PVOA 3H15A 3PF5A 3CMEA 1VQEA 3W5OA 1N34L 4AYBE 4B3SL 4DV4Q 4B3TQ 1QZGA 1IL2A 4DK6C 1N36Q 2HIXA 1CKNB 5EAYA 2ZJQA 2IT1A 2Z6KA 4JI5Q 2JA6H 3I4MG 4DR7Q 2B63G 4B3RL 1U5KA 4LFBL 3TRZA 4NXNL 4LFAQ 1SLJA 2KCMA 3UE0A 1I94Q 3BZKA 2JEBI 3T1HQ 2MO1A 1Z9FA 4X62L 1VQAA 2PI2E 4IFDI 1V43A 4JI1L 1Q12A 3G6EA 2R93G 2WFWA 4YCWA 1FJGQ 2R7FA 3M4OH 4QGUA 3E0EA 3KYHC 4YWLA 1PH6A 1VQBA 4AH6A 3GDEA 4YCVA 1Q8KA 4P75A 1AH9A 3FP9A 1TWCH 4JI4L 2ZTEA 3NELA 5M3MH 2ID0A 1VQDA 2MNAA 3KFUA 1L1OC 4DV2L 2NVYH 1NE3A 1FGUA 3L2PA 2XGTA 2NZOA 2UUAQ 1SR3A 1N9WA 2BH8A 1WCMH 2JJQA 4A3CH 3I4OA 1L1OA 3FHWA 2Q2IA 3K7AH 5M3FG 3STBC 4BY7H 2PI2A 2Q2TA 2F4VQ 3TREA 3KLWA 2F52A 3IRBA 5GROA 4HIOA 1J5EQ 1VQKA 1GVPA 1NMGA 1E3PA 2VQFL 1K8AC 1VQ5A 5GAGC 2YTVA 2VQFQ 1D8LA 1MIUA 3CC4A 1XNRQ 2JA8G 3S24A 1Q1BA 3S1MH 1NBWA 3K81C 1PYSB 1BVSA 2VL6A 4X66L 3U58A 1HZBA 1KD1C 4A4IA 2UXCL 4DV5Q 2E2HH 2K5NA 2WAQG 2QEXA 2D0OA 5H1SE 1SFOH 1VQ7A 1LTLA 4JI8L 2HHHL 1VQMA 2AHOB 4PZ6A 1A0IA 1HNXL 1P8LA 2XTIA 4DV7L 1Q81C 1HNZQ 2E2IH 2UUCL 2QA4A 1PV4A 4BA1I 4DV3Q 1XJVA 2MQHA 2K14A 3CC2A 2NVQH 3RN2A 1OXUA 3GO5A 4YY3L 3PUWA 1VCIA 2BH2A 5IYBH 1HNWL 4DR4Q 1VQOA 3PO3G 4DV1L 1PH3A 1VQ8A 1EOVA 4A3BG 4OX9L 1TWAH 4JI1Q 3J7A5 1UE6A 3G48A 1KXLA 2Z0SA 3CCLA 1C9OA 4A3JH 3KF8B 4L5RC 1X3FA 1PH9A 2OTLA 1YVCA 3F8TA 4A3KG 3HOYH 3CCRA 4DR4L 4JBJA 4A3MG 1N32Q 1A8VA 3CMAA 1VQ9A 1CUKA 1JB7A 1QUQB 4YCUA 3HKZE 2UUCQ 3ICEA 5JJKA 1HZCA 3J80i 3GTJH 1WJJA 5GADC 4R4OA 3F2DA 1YZ6A 3S1NH 1W3SA 1YHBA 3CCUA 2YU9H 1B7YB 4X6AH 1KAWA 4YWMA 3HOXH 4DV6L 3PSIA 1TXYA 5IT9c 4A75A 1VQNA 4DR1Q 1Q1EA 2UUBL 4JV5L 4JI4Q 1Y1VH 3HOXG 1FVIA 4A3IH 2RF4A 3CP0A 4PG3A 4APVA 3S2HH 1VQHA 2VUMG 4X64L 3J7ZC 3ERSX 3GTPH 1SN8A 1QZHA 5M5XH 2AMCB 1HNWQ 1CKOA 2R6GA 1HZ9A 2F4VL 5ELOA 1YJNA 3E9IA 4P74A 1QVCA 4POGA 2VW9A 1KIXA 3I4NH 1LUZA 1IBLQ 4LNQA 1JJ2A 3A5ZB 3PUYA 3HFZB 1PYBA 2BA1A 3WWVA 5FLXc 3HOZG 5LMUQ 2GN5A 5M5WH 4DV0Q 3NEMA 4XIGS 2E8GA 3FKIG 3GD7A 4JBWA 4JI2L 4IPCA 4A76A 4LF9Q 1I6HH 1HZAA 4Y52H 2AWNA 3U4VA 5GAHC 1NTGA 4X62Q 4DUZL 1QUQA 2KHJA 1WCMG 1KC8C 2ZJRA 1J5EL 2E2JH 4A3CG 2JA9A 1PH2A 1YI2A 2ZTCA 2EQSA 3EN2A 1EIYB 1S3OA 3CC7A 1YNXA 2KHIA 4AIMA 1PH4A 3PUXA 4TQUS 1GO3E 1N8RC 2UXDQ 4X65L 3TS0A 3RNUA 3J81i 3DLLA 4KHPQ 5FJ8H 4PZ8A 3RZDH 4YHHQ 5IYBG 4A3FH 1SRUA 4LW1A 4LF4Q 1E1TA 3ULLA 1M1KC 4A3LG 3AFPA 3T1YL 5BR8Q 1YITA 2K50A 5BR8L 4IOCA 2L15A 3NENA 4DUYQ 1Q82C 4HJ8A 2UXBQ 4BY1G 1CSPA 3GTKH 1DGSA 5JEAG 1IBMQ 1TWFH 2A8VA 2ZM6Q 3H3VH 2N8NA 4EQ5A 1S40A 3CF5A 5IYDH 1X6OA 3OW2A 4BBSG 1J6QA 4IPGA 1IYJB 3I56A 2A19A 4UP9A 1YJWA 2ZTDA 4A3MH 1E22A 1X65A 5C44H 4B3RQ 5C0XG 4LF6L 3KJPA 1IBKL 1N33Q 3K80C 1ASYA 1X55A 5GQOA 1BBWA 4LFCL 1G51A 2JA7H 4DR3L 3PIPA 2DGYA 1KL9A 1L0WA 5C0XI 1UE7A 4H02A 3TEHB 4HIMA 3EBEA 4NXMQ 3KDFB 4XTCS 4GN4B 5C44G 4B3MQ 4DR6L 4WJ3M 4GN3B 4GS3A 2ES2A 1MJCA 1I5FA 1V9PA 3HOVH 1EIFA 2JA7G 2OWOA 3STBD 2JA5G 3H0GH 4WJ4A 3HOVG 4JBKA 3RLFA 2NN6I 5HGQA 2ATWA 3S2DH 4JC0A 3ZJYC 1K3RA 4GOPA 3PIOA 4A93H 5FLMG 3GTMH 4DV4L 1NMFA 1P16A 2JK8A 3M4QA 4JI3L 3UDIA 3RLOA 3KJOA 3CW2C 4GNXC 3G71A 4DR2Q 4LF5Q 3I4MH 1PH1A 1OXTA 2CKZB 2R7ZH 3I4NG 2B3GA 1GKHA 4JI2Q 2B29A 4GNXA 2I5MX 1HR0L 4IJLA 2Q2UA 1C7YA 1Q7YC 4GNXB 4DV2Q 4C3HH 3D0FA 2CWAA 2R93H 4C3JH 4LUZA 4NXML 1K0RA 4KHZA 3M4PA 3K0XA 3OTOL 1X3EA 5M3FH 3FKIH 1EWIA 1HH2P 1K73C 2Y0SE 2NVXH 1JT8A 4X65Q 5LMNL 2A1AA 4NPSA 3KF6B 3CCVA 1XPUA 3HOZH 4QQBX 4HIDA 5IY0A 4AYBG 4AQYQ 3U4ZA 3KF6A 2VQEQ 1NJIC 2CQOA 1I94L 2UUAL 4GLAC 4IPHA 4BY7G 4A3DG 2OQKA 2PQAA 5M5YH 1XPOA 4JV5Q 5IP9G 5IYCH 4R4CA 1KHIA 4QJFA 3UDFA 1V1QA 2HIVA 1SE8A 4A3FG 4L5SA 2PNHA 4IFDG 4OX9Q 1SROA 1M90C 1KRSA 4YHHL 4O0AA 2I0QA 3CPFA 4KHPL 4DV0L 4HJ7A 5JJIA 5ELNA 3AQQA 1N33L 3JC66 4DV3L 2WP8J 4GLVB 1HJPA 5E7NA 1XMOL 4LWCA 1CSQA 4DK3C 4BBRG 3HKZG 5IWAL 1X3GA 2YTYA 3CQZH 1N36L 2ASBA 4OO1G 3CCEA 2UXCQ 1VQCA 2ALYB 4HIKA 2IX1A 1N34Q 1IXRA 3A74A 4P72A 1XMQQ 4K0KL 3JAMi 3RN5A 2FXQA 2BA0A 2GVBA 4P71A 4LFCQ 1XPRA 3H3VI 4JOIA 3J81j 1Y14B 3M9BA 1HR0W 2I5LX 3RR5A 1WYDA 2K75A 3LGJA 1VQJA 5LMNW 3GTLH 4BXXG 4DV6Q 1HNXQ 3RZOH 4A3EG 3PO2G 4LUVA 4LF8Q 3W1BA 5IE8A 1EUJA 2HHHQ 2VZAA 3HOYG 1X54A 1MJEA 5LMNQ 1UEBA 1VQGA 5AJ3L 1IBML 3ULPA 1I50H 4A3GH 4DUZQ 1Z47A 4X64Q 2EXDA 3TQYA 4UP7A 1VQ4A 2K4KA 3CCMA 1FL0A 1XMQL 4K0KQ 1R9TH 5K36G 1B70B 2AWOA 4ME3A 2Q2HA 2UXDL 1GD7A 4GOPC 5FLMH 1HR0Q 2JA6G 2H5XA 5JJLA 2R92H 5IWAQ 4DPGA 2KENA 4LFAL 1JJCB 2RHSB 3CPWA 2OTJA 1EFWA 3GTOH 2K5HA 1OXVA 2C35B 2CFMA 2KBNA 3K8AA 4JI5L 1YIJA 2R92G 4LUOA 1EQRA 2Y0SG 1N32L 3MEFA 1A63A 2N49A 1HNZL 3PF4A 4OONA 2GVAA 5IYCG 3A5UA 2N78A 1AE2A 2QGQA 4MNOA 1PH8A 3CCSA 5IP7H 1B8AA 4JI8Q 2JA8H 1UE1A 1RIPA 4B3TL 1S72A 4IPDA 1RL2A 3T1HL 1YJ9A 4JYAQ 2IHEA 3HOWG 4Y7NH 4JBMA 1X9NA 2ZJPA 4JI0Q 2VQEL 1XMOQ 4JI7Q 5C3EG 4NXNQ 4DR3Q 4LFBQ 2YYZA 5IP7G 1OXSC 4OWWB 2CWPA 3NBHB 1YBYA 3K7UC 3KDFA 4RMFA 1E1OA 4MZ9A 1XTDA 1LYLA 3AYHB 1QVGA 4EX5A 1GM5A 4JI6Q 1VQLA 4BY1H 3TS2A 2YTXA 4DKAC 5M3MG 4POFA 4UP8A 2LXJA 2ZM6L 1C0AA 4DV5L 3B6YA 2PMZE 1G6PA 4BBSH 2UUBQ 3J80c
chains in the Genus database with same CATH superfamily
2UXBL 4GKKL 1CFMA 1VF5C 4X64H 3HOUH 4IAJA 3WOEA 3FPUB 4NKLA 4R1JA 3W1GA 1DCZA 2X6LA 2XD4A 5AFWA 2PYKA 1F2MA 4E6IA 4TQSA 2WB1G 4UPAA 1Y1WH 5LMUL 2XVSA 2D62A 5KYIA 2E5LQ 1IYVA 1STHA 3MXNB 1Y1WG 1BF4A 2QYZA 3FKIA 4O4LF 1EEFD 4JI6H 2W6OA 1X56A 4PZ7A 5C3WA 3R3OA 1H95A 3E9HA 4JOIC 5KX5F 1S5BD 4A3GB 4LF5L 4JCVE 5KFJA 1H9KA 4DNIA 1MZBA 2YW2A 5KFEA 3T1HH 4RKLA 3FEWX 4CDEC 4YY3Q 3BU2A 3N44B 3TIIA 3BJUA 4R4TA 3V96A 3PW7A 1K9MC 1ZETA 2JA5B 4RKBA 3M7NA 2A6HC 4MTEA 2JA5A 2SOBA 2IHFA 4CC6A 3K6OA 1W6KA 5JVH3 2EVBA 3O13A 1VQFA 4KY5A 4A3IG 3I90A 2F0QA 2D0PA 3KOJA 2KCTA 3PUVA 3OTOQ 3HOVB 1W2BA 3GIQA 3SE7A 4RGTA 3OYYA 4G57A 3S15H 4DR1L 5KFOA 1CK1A 4OXPA 4R4IA 4LF8L 1CS0A 3M3YH 4TV8F 4GOPB 1IBKH 1OWTA 4DR5Q 1PFBA 2HT1A 5D1OB 4LF6H 4DR7L 2E2DC 1H9RA 4RUAA 1MGSA 4BS9A 2MO0A 4KHVA 4DUYL 2RCNA 1HQMC 4IUQA 5C4XG 4X3TA 4DV7Q 3M9OB 3WNZA 2XGQA 4R8NA 5C4XH 3BDLA 5IT9L 3KHRA 2IX0A 1K83A 2C2EA 1V1PB 4MTNA 4RAYA 3BDCA 3TINA 4X66Q 2NN6H 3DWQA 2J0TD 1XYIA 4O4IF 3M85A 4KLKA 3U9OA 1VQ6A 3PW0A 4FF1A 1YHAA 2F0HA 5DM73 4JI1H 2NVYB 2PMZA 1RKNA 5FJ8G 3OHXC 5EPKA 5M9OA 4QWBA 4IURA 1CHPD 3F2BA 2P5ZX 4WBNF 1TY0A 1UWVA 2R7DA 3OMCA 1H9JA 1Q86C 3IG0A 1LM0A 5IGCA 5F2DA 4LF7Q 3SGIA 4FU0A 1IBLL 3P1HA 3GTJB 3DWAA 4XT1B 2WDTA 4UCVA 3RBDA 2R93A 3AEVA 4O3PA 5D3IB 1RJRA 4LF4L 2PW7A 3NHHA 5EZYF 3G4SA 5JEAJ 4KY6A 4DL3A 1I4RA 5E3FA 1I94H 2CCZA 5KFUA 1BXTA 3M9NB 2YV5A 4PNYA 1PVOA 1WTVA 4GKKH 3S9WA 1EZ6A 2A6ED 2R8IA 4Q0YA 1H9MA 1CA5A 4DV7H 2EE1A 3MZ5A 1S5FD 1SNMA 1IL2A 3DWPA 2V9WA 2IT1A 4B3RL 4MV8A 1TWHB 1U5KA 3I91A 4KJOA 3TN2A 3QZ8A 2JA6A 4LFAQ 1TWFB 2R7KA 3BZKA 2JEBI 4TKOB 4DAVA 1RJPA 3T1HQ 4CBVA 4KMUC 4X62L 2PI2E 1RCVD 1V43A 1VMCA 1KNAA 2JP1A 4MV3A 5LYJF 3BQ1A 4QGUA 1Q8IA 1ICWA 1T36A 1PTOD 2NUAB 1AH9A 3FP9A 2PMZB 2NVYA 2R86A 2ID0A 4G7OC 2MNAA 1L1OC 2EYMA 2XGTA 3VYSA 3PN1A 1L0YB 5K2MA 3OTOH 2W9CB 3HB9A 4BY7H 2Z9HA 1BBXC 2PI2A 2F4VQ 2F52A 3JAMW 1U4RA 4HIOA 1S5ED 4EEYA 1GVPA 3BG3A 2YZMA 3NWTA 2NU7B 2YTVA 1PFNA 1QNUA 2JA8G 4RHSA 3S1MB 1UNNC 5EPJA 1S0MA 3K81C 4FF2A 3RB0A 2NZ1D 2UXCL 1ZEQX 2WAQG 1BCPD 1GHKA 3A54A 4FP5D 4O42A 2AHOB 2K5WA 2QILA 2HJWA 5KFAA 3OSOA 2ASLA 1GUWA 3CRKC 2UUCL 1E0BA 1YNND 1VCIA 2HCCA 1HNWL 1CQVA 3TP5A 3J7AV 1JOQA 2D9UA 4JI1Q 4CKEA 1DD2A 3BAAA 4CC5A 5C5JA 2NU9B 2OTLA 3F8TA 3NTKA 4DR4L 2UVRA 4JV0A 4U673 5I2XA 3CMAA 2QDLA 3I4NB 3MR5A 1QUQB 4CJ0B 3PVXA 3L4KA 3S1NH 3F2DA 3A56A 5BR8H 1W3SA 4UAIA 1B7YB 3PSIA 1TXYA 4A75A 4DR1Q 3G6VA 2F4VH 1UNSA 1S0NA 2EY2A 5LOVF 1RK6A 2BE5C 5DAUA 4O2AF 4PG3A 3AB9A 4APVA 4C3HG 2VUMG 2LKVA 2Z4HA 3LNNA 3J7ZC 1BJTA 3Q2OA 1Y1WA 1CKOA 2VA3A 1HZ9A 2SNMA 4P74A 5J1ZA 1GGOA 3P20A 4C2MA 3V4SA 1SXTA 1LUZA 5C4HA 4DLKA 3HFZB 2BA1A 3WWVA 5NUCA 2OH2A 2GN5A 3RAQA 2E8GA 1K8MA 4JBWA 4JI2L 4IRCA 4FM9A 1HZAA 4Y52H 4PMCA 3OSPA 5EBDA 5ELCA 1KJ8A 1NTGA 3CQZB 4DR2H 4A3CG 1TWGA 2ZJRA 1JWSD 1EYAA 2JA9A 1MBYA 2ZTCA 3EN2A 2R87A 2F0PA 4AIMA 4UHVA 4TQUS 4Q0FA 1SMYC 5IOCA 3J81i 3RZDH 2PCFB 1SRUA 4LW1A 4ZCKA 5FO9B 3G6YA 5BR8Q 1YITA 2K50A 3S14B 2UXBQ 3GTKH 4DR1H 4EGQA 2CW8A 4LSAA 4M9UA 4RNMA 1X6OA 1W96A 5GONF 4IPGA 4UP9A 2ZTDA 4F4YA 4RNOA 1N33Q 4S3SA 5KT6A 2EDGA 1X55A 2CQAA 1BBWA 1EY0A 4C1NI 2UXDH 1G51A 2DGYA 1UE7A 4JV2A 3S2HB 3KDFB 1D1IA 4GN4B 5C44G 5I6YA 4DL6A 4GS3A 2K03A 3TP8A 3Q0AA 5C44B 2OWOA 4QUCA 4O3NA 4F4WA 2ZT9C 1SEBD 2Q8IB 4CHTB 3GTMA 1K3RA 2F0SA 4A93H 5LHY1 1X3QA 2CW0C 3S1NB 3KXYT 2JK8A 4GNXC 4DR2Q 2R7ZA 1PH1A 2CKZB 2W57A 4L6TB 4DK1A 4L63B 4GNXA 1RYRA 4QUFA 4OL7A 4GNXB 2AGQA 4C5BA 2CWAA 2R93H 3TIGA 4RGOS 4LUZA 1HRJA 4C5AA 4OELB 3K0XA 5M3FH 4ZUJA 2FMCA 3AU7A 4LF8H 4B9XA 4EGJA 2R7LA 1K73C 1F9PA 2NVXH 2UXBH 3HZXA 1O7YA 5LMNL 5DGAA 3MR3A 2VXWA 1F9SA 4IUPA 1I94L 5IY0A 1NJIC 1TU2B 3R5FA 1I4PA 4IPHA 1GUSA 4HN7A 2O03A 5C3EB 3RUPA 2PZTA 5IP9G 1E2VA 5E1FA 2WINB 5DLFA 3OUUA 1KHIA 1V1QA 4A3FG 4L1KA 3LWUA 4CDFC 4IFDG 1EOTA 2V4DA 2FFKB 3CPFA 1X32A 2C28A 4DV0L 4YR0A 1TAEA 4KKSA 4DV3L 4PQXA 2W7PA 5M5XB 2DNCA 4O2BF 4BY7B 1CSQA 2BQRA 5KT5A 3BVZA 5IWAL 4HYKA 1GSAA 4OO1G 1XNRH 2RDFA 1EZ8A 3CCEA 1SNDA 2ALYB 5EPLA 3M4OB 1IL8A 1IXRA 3A74A 3EA6A 3FKIB 1N34Q 1I50A 4QWCA 3JAMi 5EWFA 1I50B 3OWFA 1U4PA 2GVBA 2L5TA 4P71A 4ECZA 2FINB 5C4ZA 3C1FA 1XPRA 4MV6A 4OIJA 4J9OA 1VQJA 3KALA 1PTOH 1NCVA 2NBFA 5LMNW 2MGSA 4DV6Q 1HNXQ 4C56C 4A3EG 2W70A 2D2CC 4LF8Q 3HOYG 1EUJA 2HHHQ 1RTNA 2VZAA 4EEQA 3D8GA 3T1YH 4OEMB 1SSOA 1EIGA 3N41B 4J9PA 1KNEA 2X69A 4A3GH 3EJIA 2FLLA 1HTLD 2LS01 4RAUC 2WAQA 4V190 1EL0A 2K4KA 1XMQL 4K0KQ 4PDBA 1F9QA 2UXDL 2R92A 3EPGA 2EY5A 3CU7A 1KLUD 5EBCA 2JA6G 5JJLA 4DR3H 1VMPA 2CH4A 4DPGA 3NTHA 2JXMB 2KQ3A 1HA5A 1K3BC 1EFWA 5COYA 2C35B 2R92G 1EUCB 2J9GA 1LT3D 1FNVA 1EQRA 1O7LA 1K83B 4L8JA 1AN7A 3GTKB 1GXDC 3RGZA 1B1ZA 3V05A 1HNZL 3PF4A 2JA8H 1AE2A 4DA2A 1PH8A 4BBSB 2IJ0A 3CCSA 1B8AA 1S72A 3Q8SB 4IPDA 5EKKA 2O2LD 1RD9D 2RKSA 3HOWG 2FK2A 1ET9A 5J2TF 4BWSC 3HBLA 1OXSC 4OWWB 1J8IA 2CWPA 3MFHA 3K7UC 1E1OA 4MZ9A 3R8BA 1VQLA 2XCLA 1HCZA 3TS2A 1T5XD 2YTXA 1BNCA 4DV6H 3K3VA 2WACA 3HEJA 2DLNA 1SNQA 2NU6B 2ZM6L 1FKAH 1AUXA 3MXPA 3DF7A 2CQOA 2NZHA 2VQDA 1STGA 1KQSA 3DM3A 4WD3A 1JDBB 2JE6I 3TQTA 3VMMA 2Z6KC 4JI7H 2A74C 4QWAA 5EOYA 1JE5A 1K83H 1SNCA 1MD2D 4ZOLF 3JAMc 2BE5D 4YIJA 4GKJL 4HJAA 4EQPA 2QKIC 3D3RA 3PR5B 1MSGA 5KG7A 1G91A 1NY4A 5KFXA 3PGZA 1L2FA 2LY7A 5CORA 4DV4H 4B3SQ 2F3IA 4OO1I 2JEGA 4XYOA 4QY7A 1WTOA 2NVTH 4IJHA 4X3KA 2ZDGA 3IFTA 3PMFA 1Z6HA 5IGEA 2XRQD 2PNRC 1T5EA 4BA2I 1E4FT 3RGXA 3VDYA 2YU9B 4HMJA 4YWKA 3M4IA 3GTKA 3W2DA 4O3SA 1D7QA 3ULJA 1KRTA 4A3KH 3GV3A 1IBLH 4IN3A 2RGVA 2O5JC 1ESFA 4WRDA 4J15A 1BKBA 2WIIB 1B33N 3T1YQ 2IMWP 1O7IA 1SE4A 2FPIB 4ZRZA 1JJGA 1I7LA 1K28A 3J80E 2I5HA 4OWTB 1AFPA 2W9CA 3BQ2A 4PMWA 1SE2A 4RA8A 2JEAI 1TWAB 2B2WA 2B63H 3HOWH 2NVQB 3NSWA 2YCHA 2VQFH 4FXDA 2IY5B 5IYZF 3H4DA 3CAMA 3CXCA 3F2CA 2FHTA 2CQYA 4F50A 1CKMA 2DY7A 4JG2A 4ODGA 4KTAA 3S1RB 1XTCD 4DR6H 3T56B 5CMDA 3C46A 3PO2B 1QE6A 2N55A 4DV3H 2C22A 2SDFA 2RHQB 1XNQL 1HUMA 4B3SH 4DUYH 4G7HC 1AUVA 3DHQA 3SVMA 5HY6A 1YHQA 4X65H 3C1EA 4IUNA 4EGVA 1EU4A 1TT2A 1E2ZA 2NVXA 1A62A 2NTTA 1TWHA 2VNUD 2NVXB 1OXXK 2W9AA 4C3IG 2ZXRA 2EY6A 2F0NA 4HNTA 5L9XA 1RJQA 1G2SA 1M8AA 1PMRA 1KC7A 5KNBA 1NNXA 1U0LA 4F7XA 1UC8A 5G3LD 4GKJQ 1WOCA 5EQ0A 5C4JH 4ECUA 5DG7A 2OQ0A 2K5VA 2MJ8A 3L9AX 2Q8RE 4WJWA 1WI5A 4BXXH 4J9LA 2R8GA 1R4QB 3GV8B 2AQ1B 1NR2A 1STBA 1BDOA 1TWGH 1WCMB 3OIPA 4RH6A 2NVTB 3ER0A 1PH5A 4O2DA 3MXGA 1YEZA 5KFKA 5DNFA 3H15A 3FMCA 1QCBD 4HMIA 1E4EA 2PO4A 2W8KA 3SI8A 3CMEA 3KAKA 2X0SA 2YYAA 3ETJA 3HP3A 4C3IB 4Q44A 1I3QB 4EQOA 1B04A 4DV4Q 1CKNB 2ICEC 2Z6KA 1A2UA 3I4MG 5KFZA 3MFIA 1A3TA 4KKTA 3TRZA 1G8ZD 4J9QA 3WO1A 4U7CA 1Y1WB 1Z2PX 3MWMA 2RGRA 1WVLA 2FPPB 3QG1A 5CC4A 4KN4C 2B63A 2L55A 3CQZA 2F0TA 2XWJB 2W6ZA 2R7FA 3MXUA 2GPWA 1ZYRC 4AH6A 1HQRD 3GDEA 2C2RA 1Q8KA 4P75A 2QEJC 3L4JA 2ZTEA 5JOBA 2SNSA 5M3MH 4HSVA 1Q3LA 5I2YA 2V5AA 3GTGA 4DV2L 2NVYH 4F4ZA 1FGUA 2TMPA 2R8KA 2UUAQ 1SR3A 4DR7H 2W6PA 3I4OA 1WD0A 1L1OA 3FHWA 3I70A 3STBC 4J9MA 2KOLA 3ERQA 3IRBA 2DPIA 3MC0B 5C4XB 5KT2A 1VQ5A 2VQFQ 4KV6A 1D8LA 4Z9CB 2FK1A 3QOLA 1HNWH 2VL6A 1BVSA 4X66L 5KFNA 2UVUA 1KD1C 1HZBA 1SFOA 3IKJA 1XMQH 2KCNA 2K5NA 5KG5A 1VQ7A 2HHHL 2JSOA 4JK1C 4LFCH 3HOZB 1A0IA 1HNXL 4XDXA 4DV7L 2E2IH 3GV6A 4BA1I 4DV3Q 3CC2A 1D2BA 4NLGA 4DF7A 3RN2A 3SEBA 4OO1H 4B3MH 4FBTA 2BH2A 2F0DA 5C8YF 4DR4Q 4RB1A 1E4EB 4DV1L 2L0CA 2UXCH 1TWAH 2R8JA 1N48A 3GQBA 4DUZH 4RCOA 3J7A5 3T16A 4MTKA 3G48A 4G7ZC 1VAJA 3CCLA 3J81E 4K6LA 4A3JH 4MV9A 2RBMA 3QWNA 3KF8B 4ZHQF 4GC6A 1AEXA 1X3FA 3K57A 4A3KG 3MWEA 1N32Q 3RTXA 1JOOA 1CUKA 1M7JA 5IWAH 4YCUA 2YS6A 1S5DD 2UUCQ 2GLTA 3VR3A 3GTJH 3R23A 3W3AA 4R4OA 5CV7A 3GTMB 1WH2A 2YU9H 3CCUA 2FPGB 1KDBA 4YWMA 3N40P 4EFEA 2UUBL 4TQRA 2RVLA 4A3IH 5A2QW 1BCPB 3E0JA 2AQ3B 3MVVA 3VYUA 3N8DA 2RF4A 4AQYH 2KSWA 4J6HA 2XIGA 1SN8A 4B3RH 1A3VA 5LL6S 1HNWQ 1PTOF 1PX2A 2F4VL 5ELOA 1YJNA 2YZGA 3E9IA 4NXNH 1GUOA 4DAPA 3HOXB 2VW9A 3TMEA 1J9OA 3N52A 1KIXA 4YBZB 2BQ3A 1C48A 5D8DA 3V6KA 2VPSA 1JJ2A 2RSNA 3RD4A 1EWCA 2Z1CA 1HPCA 5LMUQ 3MR6A 2E2HB 4XIGS 4AYBB 3KLSX 5KG6A 5M5YB 4RU9A 4A76A 4LF9Q 2F0LA 4C3JG 2F0MA 4RZRA 2OLSA 4CDDC 3BA9A 5KFVA 4K6DA 4FBUA 5GAHC 4X62Q 1LT6D 1WCMG 1LT5D 4CJ2C 4RHRA 1PH2A 3IL8A 1H9SA 1EIYB 2BDOA 3RMHA 2KHIA 4EG0A 3K59A 5KNDA 1VBHA 1GO3E 1TR5A 3G6JB 1N8RC 4X65L 3FDTA 4KHPQ 4QCLA 5FJ8H 1TWCB 4IUTA 5LMNH 3SK4A 4LF4Q 1E1TA 4A3LG 4NXMH 1T3NA 5BR8L 2L15A 3NENA 4J9KA 3BJYA 5KFBA 2RDIA 1QNKA 2DN8A 1BO0A 1DGSA 5IGBA 3GIDA 1ILQA 1GHJA 1S40A 1STNA 3CF5A 4BBSG 5G3LF 4V0BA 4YY3H 1EUDB 3VR4A 5FPRA 1X65A 5C44H 4B3RQ 5C0XG 3JAML 1F9RA 2L12A 3FDSA 4Q43A 3E5SA 5KG3A 4DL2A 2KEEA 4DAYA 2R92B 1I7NA 5C0XH 4DR3L 4I7HA 3PIPA 5DGBA 1L0WA 3TEHB 3EBEA 2WB1A 4B3MQ 3G6XA 1MJCA 1I5FA 2KECA 5LMUH 1EIFA 4HAEA 2JA7G 1SAPA 3H0GH 1SYBA 1TA8A 2ATWA 3S2DH 4O4HF 4GOPA 1ZHSA 2ZXOA 2X6GA 3GTMH 5HV6A 1IOWA 1NMFA 1P16A 3UDIA 3H20A 2DJGC 4XT3B 3WDNA 3G71A 1C3OA 2E2HA 1SDFA 5HURA 2R7ZH 3Q8RB 3I4NG 4LMYA 5KFMA 1JB3A 4JI2Q 4XYMB 3HOYB 5HBRB 4FS1A 3N6RA 2MHVA 1Q7YC 1C7YA 4DV2Q 1KJ9A 4C3HH 3GTOA 1V1PA 4FXKC 3RIZA 2EYLA 3M4PA 3OTOL 3FKIH 4IALA 5FO8B 4WFN3 4DL4A 3PQIA 4LF4H 1DV2A 3QR8A 4RAZA 3NQIA 1TS4A 3BYYB 2Y0SE 1A6XA 1JT8A 5EGTA 1PFMA 3NBIA 1AP0A 3NE5B 2A1AA 2UUBH 2HDMA 3OMGA 3KF6B 3CCVA 2H4OA 4QQBX 2VPQA 2EY1A 4AQYQ 2UUAL 2ZDQA 3KF6A 2VQEQ 2RCFA 2M05A 4GLAC 4BY7G 3WO0A 2H1EA 4ILWA 4YR2A 1DXMA 5FOBB 3MHBA 1PRTF 4QJFA 1FR3A 2B8FA 2HIVA 4ZUIA 3K5LA 4IRDA 4L5SA 2BOSA 1S03G 1O78A 2PNHA 2TSSA 4ME6A 5DG8A 1ZXTA 3JZIA 3KBXA 4DXGA 4DU9A 2FLPA 4ZKCB 4KHPL 4HJ7A 3VPCA 4LF7H 5ELNA 1JLLB 3S17B 3CHBD 2N88A 3JC66 4H7BA 2WP8J 4DNTB 3S1QB 1PK8A 3I8ZA 5E7NA 1XMOL 1S10A 3F2UA 2UVWA 3UI2A 2F0GA 1EY6A 4BBRG 4DK3C 3NBHA 2FMAA 4X62H 2ASBA 4ECQA 1M6VA 5JVDF 3SHLA 2KEDA 4P72A 1XMOH 2K33A 1FYCA 2Z6BA 3M9BA 4HCEA 3VA7A 3RR5A 4DV2H 4OX9H 3LGJA 2Z4IA 3NUCA 2DZDA 4BXXG 2EZVA 4ME5A 4LUVA 2JA6B 2R6FA 3EYYA 3LWBA 1VKZA 2K5DA 3ULPA 2A69C 4LFAH 1KLGD 3N42B 4UP7A 4CGYB 3HOWB 4OGQC 1F2LA 3JRWA 5EWGA 3CCMA 1RYSA 4JYAH 2HCIA 5K36G 1B70B 1EY9A 4JI0H 4ECVA 2Q2HA 3S16B 1EYZA 5KFPA 3D4DA 1GD7A 1HR0Q 3X3NA 2H5XA 2ZDHA 3J7AF 1AZQA 4LFAL 1RODA 2HQEA 2RHSB 3CPWA 1PDQA 4BBRB 1QILA 3GTOH 2K5HA 1S0OA 4CDCC 1O80A 4MV1A 2Y0SG 5IT9W 5LP6F 1YNJC 1N32L 4HNVA 3K5HA 2N49A 2IW3A 4DV1H 2WKCA 2N78A 3S2DB 4QB4A 5IP7H 4JI8Q 1UE1A 4XX0B 4MIUA 1ULZA 4A2BA 3T1HL 2C00A 4N8FA 5EWEA 5KYLA 1X9NA 4ECXA 1XMOQ 2EYPA 2E75C 5IGFA 3A7LA 2EYFA 3NBHB 5LL6X 4ECWA 1LYLA 1TS2A 3AYHB 3OIQA 2E2IB 3K5MA 1C30A 3QO2A 3J80L 4IUUA 4JI6Q 1WTHA 5FLXL 4IZOA 2YU9A 2DNEA 1JICA 4DKAC 3R5HA 4POFA 2LXJA 3I72A 1CQJB 2EYHA 1HA6A 2PMZE 5F9LA 4BBSH 2UUBQ 3J80c 1WFQA 5IGGA 5JVLA 1GOZA 3PUZA 4A3JG 1NAPA 3TP7A 5ELBA 1JC7A 4AQYL 1Z2NX 2JEFA 5I6WA 4O3QA 4YAKB 3CKIB 3F1ZA 3D6WA 4DGZA 3SK8A 5AJ3Q 4A3EH 2IP4A 4C2MH 5KFGA 2DIKA 2V58A 4EVOA 5EKLA 4YHHH 4KY7A 4LF7L 2B2YC 5M3MB 3GTGH 1SYFA 4C3IH 3H0GG 1DV1A 3E3XA 2WYOA 4B3TH 1Y1VG 3L0OA 1WD1A 1VBGA 4KI0A 3VYRA 1CKNA 1GSHA 4P73A 3V4ZA 1PYWD 4ED6A 3CCJA 3UDXA 4DV1Q 1K1SA 1FNUA 5BPFA 2J6TA 3J7AK 5FLXE 1RF2D 3VR6A 4CKBA 5CYUA 4QIWE 4DR5L 2JA5H 2I46A 1JDEA 3I7FA 1ENFA 1CA6A 2BR0A 4UCSA 2KCCA 4C1NK 1PLFA 2NWGA 1AE3A 2EJMA 3KUPA 2PVPA 2UU9Q 4GLXA 1LTSD 3FRPB 4R4QA 4O3OA 1WTWA 2P0AA 3Q1KA 4ECSA 3QB3A 1K8GA 1VQPA 3EIVA 1DZ1A 1S4ZA 1SMXA 1EY5A 2DUDA 3A8IE 4X66H 3K3PA 2IPKD 1GUNA 4TVAB 1VS0A 4FXGC 3RAXA 3MTSA 1TY2A 1G2TA 4XXEA 1RJTA 5GAEC 4IOAA 3T5LA 2W9BA 1ICFB 1GSOA 5JPNC 1SNOA 4LJZC 4FS2A 5I4DA 1B9NA 1FGBD 3ONAB 5KFFA 4A3MB 3S17H 5EDWA 4R8IA 1SFOB 2VS1A 4ED2A 1KAAA 3C3LA 4WORA 2VUGA 3GTLB 1QVFA 4E4TA 2EJGC 4HTHA 2NN6G 3PW2A 5C3EH 4O3RA 2K52A 4JI5H 2NU8B 5C0XJ 4ALPA 2R7MA 3D31A 3H6MA 5A2QE 3TBIB 2E5LL 1EZ1A 1K0SA 5KFDA 4HR7B 4JI8H 1NSNS 4JI3Q 5JH7F 1PRTD 1ZKOA 4RFBA 2Q8TA 3BQ0A 1B4OA 1IBKQ 1KBLA 4LF6Q 4DR5H 1QJOA 2HQLA 4DAMA 4TV9F 4YQWA 4LF9L 3CD6A 2L1BA 3CCQA 1N33H 1LTGD 3HKZB 3KF8A 1BXRA 2PQAB 4GKKQ 3HKZA 4A2AA 5IP9H 2R85A 2EJFC 4A3BH 1JIHA 1T9HA 3SXHA 3PO2H 1KJIA 2BDNA 4MA0A 2UU9H 3I3CA 1JWMD 4XQJA 1ML0D 3U50C 1ASZA 3FVQA 1CZGA 2J7ZA 3RLNA 5J3BA 1EHIA 3FMAA 4FDBA 3NWSA 2R7ZB 1EQQA 3VPDA 2LSSA 5EJWA 4GN5A 2UU9L 4IRKA 1OTCA 3PO3H 3JRXA 1VQIA 1I3QH 2Z8LA 1BUVT 2N3SA 4HJ9A 2XRSD 3T53B 3R5XA 1UE5A 1SYEA 2WAQE 4NB3A 1Q46A 1XNQQ 3EVQA 1KDAA 2W6QA 4M7EA 2XNAC 3NXWA 3DMUA 5JPMC 3W5OA 1N34L 1CT1D 4Q5VA 3HXLA 5CV8A 4B3TQ 5FO7B 3SR1A 2ZJQA 5EAYA 2W6MA 4JI5Q 2JA6H 4LFBL 1VDZA 5KG1A 3NGDA 4NXNL 1HFNA 3UE0A 1I94Q 2ALZA 5ISRA 2B8GA 1Z9FA 1I4XA 3GIKA 1VQAA 3G6EA 1Q12A 4ZK9B 4ECTA 5HGTA 5KKNB 4JPBW 4YCWA 4F8MA 1FJGQ 2QCPX 3KYHC 1PH6A 4YCVA 4UFZA 3H91A 4JI4L 1TWCH 2W7OA 3NELA 3NQTA 5C1PA 2R3ZA 2DJFC 3G7LA 3KAJA 3L2PA 1R4PB 2KVMA 2NZOA 5KFWA 1WCMH 4FF3A 3E6ZX 2R82A 3K7AH 5M3FG 3T5KA 5T1IA 2Q2TA 3KLWA 5BN4A 1SJED 2VOBA 1I4GA 1J5EQ 3KHHA 1JWUD 1NMGA 5JVG3 3Q24A 1B2TA 4U6PA 2VQFL 1K8AC 3H94A 5GAGC 3CC4A 1XNRQ 4X6AH 1MIUA 2AGPA 3S24A 1Q1BA 3MFGA 3S1MH 1NBWA 1PYSB 3U58A 4A4IA 2E2HH 3KK7A 5EKIA 3MAQA 2BCOA 2D0OA 5H1SE 5C1OA 1TVXA 2FLNA 4JI8L 4JW0A 4PZ6A 5DEHA 2XTIA 1Q81C 1KJJA 2C2DA 3C2PA 4QIWB 1PV4A 2A68D 3RB3A 2NVQH 3OWEB 1LABA 1OXUA 3GO5A 3BYTB 1BGWA 2HHHH 4HCSA 3PO3G 4J0MA 1EOVA 3V6JA 2EYJA 4OX9L 1SJHD 1Z2OX 2K6AA 2I80A 4JI3H 2PZUA 1M0TA 2EXZA 2OEOA 1KXLA 4EBEA 4NP5A 2Z0SA 4EYIB 1C9OA 1ONLA 1PZID 5I47A 1PH9A 4KJNA 1STAA 1YVCA 3RV4A 3CCRA 5FD5A 1BCPF 5KGUA 4M1UB 5KFSA 4DXFA 3HKZE 3GV7B 5JJKA 1HZCA 3J80i 2HD3A 1WJJA 5GADC 5FD6A 1YZ6A 3R93A 1YHBA 3MXNA 3VA5A 1FNWA 3T5JA 3KLRA 5IT9c 3BVMA 5FKAC 4EFBA 1Q1EA 2G9DA 1NR4A 1DOMA 4ZAIA 5TSSA 1UUPA 4K5WA 4QWEA 1JX4A 3CP0A 3S2HH 1VQHA 2QK4A 4N9TA 4R7RA 3ERSX 3GTPH 4KD4A 1QZHA 2PW5A 4NMZA 2R6GA 1CQIB 4ED8A 1CTMA 1EIHA 1S9FA 1LT4D 4JV1A 1EY8A 1QVCA 4JV5H 4POGA 3JSLA 2L9HA 5CB4F 1QWYA 4LNQA 4KD3A 5C5MA 3T4AC 3A5ZB 5CV4A 1PYBA 1G6ZA 3MA2B 4B9WA 1BR9A 2F0OA 2CH4W 3GD7A 2HVSA 4IPCA 1PTOC 3Q23A 1I6HH 4HQ6A 2AWNA 4K5VA 4QIWA 5D14A 4K2KA 3SK6A 1N56A 1STEA 4ZKBB 1PRTC 2EQSA 1FJGH 1F2YA 1S3OA 3L3OC 3CC7A 2XGPA 3I4LA 3DM1A 2XCPA 3BDOA 3OHAA 2PN1A 2RSOA 1SBBB 2UXDQ 4H13C 3HRZC 4PZ8A 1DM0B 4QW9A 4A3FH 1LACA 1D1KA 1ZHQA 4Y7NB 1HXYD 3NTIA 4IOCA 2JYOA 1EY4A 4BY1G 1TWFH 2A8VA 1YNJD 3X3MA 2J6UA 1WTPA 3R2IA 3J81L 1S97A 2DWCA 4ED3A 1TQOA 4YB8B 1LTRD 3TSSA 2M9VA 3M3YB 4Q8FA 3KJPA 1LTAD 3N43B 3K80C 1JE4A 2JA7H 5BMVF 1KL9A 4I7ZC 2MPMA 4A3IB 5D65A 3RF2A 4DR6L 4WJ3M 3PW4A 3K58A 1V9PA 1E4GT 3N6XA 2A6EC 3K5OA 4RWSC 2K32A 1X3PA 3STBD 3ND8A 3A8KE 2JA5G 4JBKA 1DOKA 2NN6I 1S68A 4JC0A 3ZJYC 4IR1A 4ECYA 5CA1F 4MHEA 1LTBD 4B3TL 5IODA 4PV1C 3KJOA 5KFRA 2M2LA 3RLOA 3I4MH 1OXTA 1SNPA 2V59A 4M8AA 2PZWA 4GZYC 2FMMA 1O75A 1EQTA 1HR0L 3H40A 2C5CA 2XSCA 3D0FA 5KFYA 3D4WA 4C3JH 4KHZA 4OHJA 4BY1B 4Q45A 4RUCA 2OF1A 3GIJA 5K5PA 3EFXD 4X65Q 4RB0A 4NPSA 1JKJB 3WOFA 3HOZH 4AYBG 1SCUB 1AN8A 3U4ZA 5IIFA 1B53A 2XC9A 4DL5A 5FLXW 3DEOA 2E2IA 5M5YH 4JV5Q 3T5HA 1TWFA 5IYCH 4R4CA 1I6HB 1TS3A 4OIKA 1D5MC 3UDFA 5A2QL 1SE3A 5CAEB 4I7AA 2OXPA 4O0AA 1BCPC 5JJIA 2MP1A 3AQQA 2IWHA 3IAYA 1N33L 4GLVB 3CVZA 1HJPA 1QOHA 3Q22A 3HKZG 2F0WA 1X3GA 1YNNC 4ZQIA 3CQZH 1A3UA 1IKMA 3HGBA 3M9MB 4C3JB 3H4BA 4HIKA 2IX1A 2B2TC 2G9HD 3EQLC 4J9SA 2FK3A 4YAJB 2R61A 1PRTB 1DIKA 3H3VI 4JOIA 4DNRB 1Y14B 3J81j 1V51A 1WYDA 2K75A 2R7NA 4HNUA 4A3KB 3P7JA 3RZOB 3GTLH 3RZOH 3MR2A 4MA5A 3W1BA 4I55F 1K1QA 2A69D 4EQNA 1MJEA 3PIO3 3Q6SA 1STYA 4HSPA 2K04A 1WTXA 3LWEA 1I50H 5JAVA 2B63B 1A2TA 1RHPA 2YZNA 1EY7A 1D5ZC 3TQYA 1KTKA 4K8JA 5CBEE 2FE3A 1FL0A 2JEJA 2B39A 4TSSA 3DEPA 3GTGB 2AWOA 2L11A 1Y1VB 4GOPC 5FLMH 2R92H 4YJ3F 2IBKA 4B08A 2KENA 2PPBC 1AZPA 3VR5A 2FJ2A 1HNXH 1OXVA 2CFMA 2KBNA 2XIWA 2KA7A 1IOVA 4LUOA 3A7AB 4LSXA 5C6AA 3QOJA 1HTPA 2SEBD 4OONA 2CHBD 4A93B 5L1KA 3PR4A 4EBCA 1RIPA 4A3FB 4A3JB 3RZDB 2ZJTA 4K0KH 1YJ9A 1TKWB 4KKUA 2Y0SA 1PXUA 4LH6A 2IHEA 4IR9A 1SYGA 3ITPA 1ENAA 4JI7Q 2VQEL 1Q90A 2M00A 5C3EG 4DR3Q 2YYZA 5IP7G 4RMFA 3KDFA 5KG4A 1W6JA 1XTDA 1I6VC 1W93A 1BQQT 1CE8A 4KK7A 4EX5A 1KDCA 5M3FB 4BY1H 4HR7A 5M3MG 4XQQA 4C2MB 1LV9A 4K8IA 1C0AA 4ZI7F 3GV5B 4XYQA 2F0VA 3JSNA 2V4QA 2UXCQ 2IX3A 5DLGA 1E7ZA 1VF7A 3S1RH 1MKHA 2AUKA 5CR3A 2WV6D 3SE0A 4CKCA 1PFSA 3I4MB 3OOCA 2EIFA 2JN4A 3MWYW 5LL6b 5M5WB 4JI6L 2CVRA 4L5TA 2I07B 3RUZA 4UCOA 2E74C 5T14A 2WB1E 1JMCA 3HOUG 4H0LC 1KABA 4UY8C 2W9BB 3GIMA 1R9TB 1T94A 5T1GA 4B3ML 2OCEA 4TRDA 4J9NA 2VB3X 3L7ZC 3PV0A 2ZXPA 3FPPA 4EBDA 2MCTA 2VUMH 1BNZA 1L1OB 3RV3A 4DR2L 1EQVA 1EYDA 2YS7A 3MJFA 4YR3A 5L1JA 1TS5A 3BZCA 3OSNA 3LX0A 5IYDG 1IZ6A 3UDGA 3GLKA 2K1BA 1Y8OB 2XN9C 1MHWC 4Q8EA 1IKLA 1BBUA 2IA6A 5KRUA 4C5CA 1PTOB 1EFID 4RCNA 2Y0SB 4IO9A 2R7ZG 2MFIA 1PA6A 1EU3A 3E5NA 2F0KA 4JI0L 3GTPB 3S16H 2W8LA 3TZUA 4QL5A 3OW7A 5JQWA 3PIP3 3HKSA 2VA2A 4G4KA 4EYHB 2AUJD 1EYCA 1WTRA 1DONA 2UVVA 2GPSA 4RG1A 2I87A 2SCUB 5DQIA 1IW7C 2O4XA 1UC9A 3OUZA 3H3VC 4IFDH 2R8HA 1TWCA 4L5QA 2F0UA 3I55A 2B2TA 1M4VA 1XX8A 3PCOB 4JYAL 1QG7A 3ETHA 3GTQB 3S14H 3KHLA 1PHJA 3BABA 2FJZA 2JQOA 4FVMA 3H09A 3AFQA 4YP3A 1F2ZA 2F4IA 4IFDJ 2O5IC 1XNRL 2F3WA 2ASJA 1IHZA 2AKWB 5JUMA 1SYCA 2V1CC 3LMLA 2R84A 1R9TA 2JA7A 2VY3A 5KFIA 1EEID 4DAYB 3BS1A 1MI2A 3S1QH 2ASDA 3M4YA 1E24A 1KJQA 5DLQE 4A3DH 4C3HB 5LA6F 3IFDA 2W71A 5KFQA 3NPPA 4DN4M 3A0JA 4DR6Q 3K5IA 4ED0A 3C0FB 5CGKA 5BPHA 1ESRA 3TDQA 3GTQH 1LO5D 4RB2C 4XZ3B 2JEIA 1FJGL 1MSHA 4A3LH 4A93G 4HJ5A 1TWHH 3VR2A 1EYGA 5KEEA 2MUYA 2CW7A 3M7GA 2LXKA 3UE1A 3Q8DA 1HHVA 1TIID 4BBRH 3T51B 4JI7L 2KHSA 1WSCA 4OWXB 2AU0A 1A9XA 1N34H 4MV7A 3J81c 1G291 3HS0C 3I2ZA 4LMQD 1PH7A 3GQCA 2A73B 1CI3M 1H9SB 3PF5A 4DL7A 4K5XA 4MN3A 2C9OA 5BN5A 1VQEA 2FP4B 4AYBE 4GKJH 3MFYA 4RB3C 4B3SL 2D5DA 3BZDB 1QZGA 4DK6C 5I9OA 2HIXA 1N36Q 4DR7Q 1XDNA 4UDUC 2WTFA 3GILA 3PZPA 4UCTA 2B63G 4MTDA 2K01A 3RBEA 1FD7D 1SLJA 5CA0F 1LTID 2KCMA 5E4WC 3JAME 3G8CA 4ZYSA 3HG9A 2QW7A 3I73A 3U9TA 2OT2A 2MO1A 4IFDI 2CZGA 4JI1L 2R93G 5C4JB 2VQEH 2WAQB 2WFWA 3CRLC 4QMGA 2NYZD 5FPOA 4TUYF 5F9NA 3M4OH 3ZYYX 3E0EA 4YWLA 1WTQA 4UCUA 1VQBA 2HDLA 5K36H 2RDGA 2JA7B 3KBGA 1VQDA 3ND9A 3KFUA 1NE3A 4DK0A 2JJQA 1N9WA 2BH8A 4A3CH 3J7YW 3MWDA 3SK5A 1HUNA 2G5DA 2Q2IA 2JA8B 4G3IA 3TREA 5GROA 1ZQ7A 1VQKA 1IBMH 4KN7C 1K8OA 1C8CA 1ET6A 1E3PA 3TP6A 1CM9A 1M0WA 1JCKB 3J81W 5ELFA 1PZJD 1DJRD 2A5HA 4LK1C 1B3AA 3UFXB 4J8QA 1V1OA 4DV5Q 2QEXA 5J39A 4Y8VB 4ED7A 1SFOH 1LTLA 2F03A 1VQMA 2HGSA 3LP8A 2K05A 4PWQA 1P8LA 1BOSA 4J1MA 1HNZQ 2RQXA 2NUCA 2QA4A 1GUTA 2F1MA 1XJVA 2MQHA 2K14A 3GTOB 5DQGA 2DPJA 4QWDA 5ELDA 4YY3L 3PUWA 1DOLA 5IYBH 5E4XA 1TWAA 1VQOA 3S15B 3GIIA 1PH3A 1VQ8A 4A3BG 2R93B 2YL2A 3GTJA 1UE6A 4QF4A 2HVRA 4YJ2F 4I50F 5L1IA 1I4QA 5A35A 4IUVA 3I12A 3D6CA 3HOYH 4F4XA 4JBJA 4A3MG 1A8VA 2RDJA 1VQ9A 5FK9C 1B6RA 3T13A 1JB7A 1B6SA 4QW8A 1A15A 4X3SA 2XCAA 3ICEA 4NW2A 2QF7A 1KAWA 4XQNA 3HOXH 4DV6L 3IN5A 3H0GB 3OHBA 1VQNA 2DY8A 2QDBA 1E2WA 4JI4Q 4JV5L 5LXTF 1Y1VH 3HOXG 1FVIA 2J4XA 3ORQA 2RDHA 1QB5D 1F77A 4X64L 3BG5A 3NP8A 3K0YA 5L37A 2AMCB 5M5XH 4IWYA 1IW7D 3MEHA 4A3EB 2B2YA 1D6EC 5L1LA 3I4NH 4IZ8A 3TZDA 2E76C 1IBLQ 4LH7A 4KHPH 3Q8PB 3PUYA 3HOUB 5FLXc 1Y69U 3HOZG 1N36H 5M5WH 4DV0Q 3NEMA 3QJYA 5C3XA 3F8NA 3FKIG 1ZYRD 4ZLTF 4FYDA 3U4VA 3VYTA 4L5RC 4DUZL 1QUQA 2KHJA 1J5EL 1KC8C 2E2JH 4LF5H 3DUZA 2HUGA 1YI2A 5KFHA 3RB6A 4RNNA 3K7AB 3SDZA 1KEEA 1YNXA 4R9WA 4N9PA 2B2VC 4ETSA 2F0JA 3PUXA 1PH4A 4FNFA 1SYXB 3TS0A 3RNUA 3DLLA 4YHHQ 5IYBG 2VB2X 3ULLA 1M1KC 2V4RA 2HVQA 4MAMA 3AFPA 3T1YL 1Q82C 4DUYQ 2VR1A 3QIAA 2B2WC 4HJ8A 1CSPA 3D4RA 2I8CA 4LF9H 2FKLA 3PW5A 5JEAG 1IBMQ 1JXLA 2ZM6Q 3H3VH 2N8NA 4EQ5A 4HEDA 5IYDH 5JEAH 1PZKD 3OW2A 3BA8A 1J6QA 3I56A 1IYJB 1YJWA 2A19A 4X3UA 2K28A 4A3MH 1E22A 3AMUA 3H0GA 4DV5H 4LF6L 5J22A 1L0XB 1IBKL 4IHJF 1CQFA 1ASYA 5GQOA 4LFCL 3RB4A 5C5LA 1HNZH 4U68A 4H02A 1Y8PB 5C0XI 4HIMA 4NXMQ 4A3GG 4XTCS 2AGOA 4GN3B 1IYUA 1TWGB 4ABNA 2ES2A 2PBZA 3RJ0A 3HOVH 4N8X1 4RGMA 1JQYD 1WR2A 3QFFA 1B44D 4DV0H 4WJ4A 3HOVG 2KUMA 4NDXA 4RGNA 3RLFA 4F88A 5HGQA 5DM63 4FO2A 3PIOA 2F0FA 5FLMG 1Y1VA 4JUZA 3A8JE 4DV4L 3M4QA 4JI3L 3K5NA 1GM5A 3P75A 4LF5Q 2EOTA 2CW0D 3CW2C 3TQ1A 2LFNA 2ATLA 3URYA 2B3GA 1GKHA 2B29A 2L4NA 4BWGB 3R2TA 2I5MX 4PMBA 1WCMA 1II3A 4IJLA 2Q2UA 4LFBH 1B3QA 5DQHA 3J80W 5CV5A 1GUGA 1L2ZA 4NXML 4A3BB 1K0RA 1Z7TA 3KLSA 5IT9E 2A68C 1X3EA 1EWIA 1RTOA 5KFLA 1HH2P 4H44C 5J2UF 1XXGA 1GYFA 1UAPA 4JVZA 3V2TA 1JOKA 4JI4H 1ENCA 4F87A 5KT4A 3PO3B 1I3QA 4K14A 1DYQA 2YRWA 1XPUA 4HIDA 1C4QA 1B9MA 2F0IA 4A3DG 2OQKA 2PQAA 1CZWA 2F3VA 4FF4A 1JORA 1XPOA 2W6NA 4JI2H 3A55A 4ZQ3A 2K5QA 2XWBB 1SE8A 1O7ZA 1JR0D 5I9PA 3U9SA 4IWXA 3RFCA 4OX9Q 1SROA 1U9RA 2E5LH 1M90C 4ED1A 1OO9B 1KRSA 1LLRD 4YHHL 2AQ4A 2I0QA 4K2LA 1I6UA 2UUAH 4R8UB 3GP7A 3ORRA 5CV9A 4R8UA 1RDPD 4LWCA 5KNCA 5BN3A 2YTYA 2ICIA 2NB0A 1N36L 4LAAA 1VQCA 1U4MA 5KFTA 1XMQQ 4K0KL 1SEIA 4RZQA 3KTMA 3RN5A 2FXQA 1UEAB 2BA0A 1XNQH 2GA4B 4LFCQ 1V4YA 1RK5A 5KG2A 1HR0W 1NUCA 5DG9A 1HR0H 2I5LX 4DFAA 2J6SA 1V8QA 2AQ2B 2LMCB 3NK9A 4AYBA 1S5CD 3PO2G 3GTLA 5IE8A 3GIPA 4DR4H 5IGDA 1X54A 5LMNQ 4XYLB 3GTPA 1UEBA 1LTTD 1VQGA 2K7VA 5CBAE 5AJ3L 1IBML 2VUMA 2VUMB 5JJZA 2B2VA 2YRXA 4DUZQ 5D1PA 1Z47A 2ZM6H 2B2UA 2EXDA 4X64Q 1Y8NB 3V6HA 5CV6A 1VQ4A 3Q8QB 5KT7A 1R9TH 2B2UC 1ILPA 3KHGA 1SMYD 2WKDA 1B50A 1HFGA 4ME3A 1D5XC 2EPBA 1N32H 3BVGA 3EPIA 5D3DA 5IWAQ 2UUCH 1JJCB 2OTJA 3K8AA 4JI5L 1YIJA 5H80A 5KFCA 4UCRA 3EROA 4ECRA 3GTQA 4I4TF 3MEFA 4P2CB 4O1NA 1A63A 3UQ8A 4ID6A 1XWEA 2GVAA 5IYCG 3A5UA 4J9RA 1I4HA 2QGQA 4MNOA 4GC7A 2PQEA 5KG0A 1J5EH 5ELEA 4CJ1B 2F0EA 1RL2A 4JYAQ 2RA4A 4Y7NH 4JBMA 2BQUA 2KJXA 2ZJPA 4JI0Q 4NXNQ 2WE6A 2EYOA 4A3DB 4LFBQ 1U4LA 1SYDA 3OPOA 1AW7A 1GLVA 1YBYA 2WB1B 3DXJC 3VPBA 4I65A 1QVGA 4ULLA 4APMA 2IL8A 2E2JB 1CHQD 5KT3A 3QZ7A 2ENBA 2FB9A 4MV4A 5KIXA 5D1OA 4UP8A 1EWHA 1GJXA 4DV5L 3B6YA 4IQZA 1G6PA 2NTSA 2A6HD
chains in the Genus database with same CATH topology
1E7ZA 1WFQA 2NZHA 2UXBL 3S1RH 1MKHA 3PUZA 4A3JG 4GKKL 1KQSA 3DM3A 4AQYL 3HOUH 1PFSA 2EIFA 2JE6I 4R1JA 3F1ZA 3W1GA 4JI6L 2Z6KC 4L5TA 5AJ3Q 1JE5A 1K83H 2WB1G 4UPAA 4A3EH 4C2MH 5LMUL 2WB1E 1Y1WH 1JMCA 2D62A 3HOUG 3JAMc 2E5LQ 4UY8C 4GKJL 4HJAA 1Y1WG 3MXNB 4LF7L 1NY4A 3GTGH 1X56A 4PZ7A 4C3IH 3PGZA 1L2FA 3H0GG 4B3SQ 1Y1VG 2F3IA 4OO1I 3L0OA 4QY7A 4B3ML 2OCEA 4KI0A 2NVTH 1CKNA 3E9HA 3L7ZC 3PV0A 4IJHA 4JOIC 4P73A 1H95A 3CCJA 3UDXA 4DV1Q 1L1OB 2VUMH 4LF5L 4JCVE 4DR2L 4DNIA 4YY3Q 3BU2A 4BA2I 3BJUA 3BZCA 4R4TA 3VDYA 1K9MC 5IYDG 1IZ6A 4YWKA 4QIWE 4DR5L 3UDGA 2JA5H 3I7FA 3M7NA 2IHFA 1BBUA 1AE3A 1D7QA 3ULJA 2UU9Q 1KRTA 4GLXA 4A3KH 4R4QA 4IO9A 2R7ZG 4A3IG 1VQFA 2MFIA 1PA6A 4J15A 1BKBA 2D0PA 1K8GA 1VQPA 3T1YQ 3KOJA 4JI0L 3EIVA 2KCTA 1O7IA 3PUVA 1SMXA 3OTOQ 2DUDA 1W2BA 3S16H 1JJGA 2I5HA 4OWTB 3OYYA 4QL5A 3S15H 4TVAB 1VS0A 4PMWA 3HKSA 4DR1L 2JEAI 2B63H 4OXPA 3HOWH 5GAEC 4R4IA 4LF8L 4IOAA 3M3YH 4RG1A 4GOPB 2IY5B 4DR5Q 2HT1A 3CAMA 3CXCA 4DR7L 3S17H 3F2CA 2MO0A 4DUYL 2RCNA 2VS1A 5C4XG 4L5QA 1CKMA 4JG2A 3I55A 4DV7Q 1QVFA 3PCOB 4JYAL 5C4XH 2NN6G 2IX0A 5C3EH 4MTNA 2K52A 2RHQB 3S14H 1PHJA 1XNQL 5C0XJ 2JQOA 4ALPA 4X66Q 3D31A 3AFQA 4A3GG 3M85A 5HY6A 4KLKA 1YHQA 1VQ6A 4IFDJ 2E5LL 1XNRL 1YHAA 4JI3Q 2AKWB 2V1CC 1IBKQ 2VY3A 4LF6Q 4DAMA 2HQLA 5FJ8G 1A62A 4DAYB 2VNUD 1OXXK 4LF9L 3F2BA 3CD6A 3S1QH 3CCQA 1E24A 5DLQE 1UWVA 2PQAB 4A3DH 4GKKQ 2R7DA 5IP9H 4A3BH 1U0LA 3A0JA 1T9HA 1LM0A 1Q86C 3PO2H 4DR6Q 4LF7Q 3SGIA 3U50C 1IBLL 1ASZA 3GTQH 4GKJQ 1WOCA 3RLNA 5C4JH 3AEVA 2OQ0A 2K5VA 5J3BA 4FDBA 4LF4L 1FJGL 4A3LH 1EQQA 4HJ5A 4A93G 2LSSA 1TWHH 3G4SA 5JEAJ 4GN5A 1EYGA 2UU9L 2LXKA 1WI5A 3UE1A 1OTCA 3PO3H 3Q8DA 4BXXH 2CCZA 1VQIA 1I3QH 2N3SA 4HJ9A 4BBRH 1UE5A 4JI7L 4OWXB 2WAQE 1TWGH 4NB3A 3J81c 2YV5A 1G291 1Q46A 3ER0A 3I2ZA 4O2DA 1PH5A 1XNQQ 1YEZA 1PH7A 1PVOA 3H15A 3PF5A 3CMEA 1VQEA 3W5OA 1N34L 4AYBE 4B3SL 4DV4Q 4B3TQ 1QZGA 1IL2A 4DK6C 1N36Q 2HIXA 1CKNB 5EAYA 2ZJQA 2IT1A 2Z6KA 4JI5Q 2JA6H 3I4MG 4DR7Q 2B63G 4B3RL 1U5KA 4LFBL 3TRZA 4NXNL 4LFAQ 1SLJA 2KCMA 3UE0A 1I94Q 3BZKA 2JEBI 3T1HQ 2MO1A 1Z9FA 4X62L 1VQAA 2PI2E 4IFDI 1V43A 4JI1L 1Q12A 3G6EA 2R93G 2WFWA 4YCWA 1FJGQ 2R7FA 3M4OH 4QGUA 3E0EA 3KYHC 4YWLA 1PH6A 1VQBA 4AH6A 3GDEA 4YCVA 1Q8KA 4P75A 1AH9A 3FP9A 1TWCH 4JI4L 2ZTEA 3NELA 5M3MH 2ID0A 1VQDA 2MNAA 3KFUA 1L1OC 4DV2L 2NVYH 1NE3A 1FGUA 3L2PA 2XGTA 2NZOA 2UUAQ 1SR3A 1N9WA 2BH8A 1WCMH 2JJQA 4A3CH 3I4OA 1L1OA 3FHWA 2Q2IA 3K7AH 5M3FG 3STBC 4BY7H 2PI2A 2Q2TA 2F4VQ 3TREA 3KLWA 2F52A 3IRBA 5GROA 4HIOA 1J5EQ 1VQKA 1GVPA 1NMGA 1E3PA 2VQFL 1K8AC 1VQ5A 5GAGC 2YTVA 2VQFQ 1D8LA 1MIUA 3CC4A 1XNRQ 2JA8G 3S24A 1Q1BA 3S1MH 1NBWA 3K81C 1PYSB 1BVSA 2VL6A 4X66L 3U58A 1HZBA 1KD1C 4A4IA 2UXCL 4DV5Q 2E2HH 2K5NA 2WAQG 2QEXA 2D0OA 5H1SE 1SFOH 1VQ7A 1LTLA 4JI8L 2HHHL 1VQMA 2AHOB 4PZ6A 1A0IA 1HNXL 1P8LA 2XTIA 4DV7L 1Q81C 1HNZQ 2E2IH 2UUCL 2QA4A 1PV4A 4BA1I 4DV3Q 1XJVA 2MQHA 2K14A 3CC2A 2NVQH 3RN2A 1OXUA 3GO5A 4YY3L 3PUWA 1VCIA 2BH2A 5IYBH 1HNWL 4DR4Q 1VQOA 3PO3G 4DV1L 1PH3A 1VQ8A 1EOVA 4A3BG 4OX9L 1TWAH 4JI1Q 3J7A5 1UE6A 3G48A 1KXLA 2Z0SA 3CCLA 1C9OA 4A3JH 3KF8B 4L5RC 1X3FA 1PH9A 2OTLA 1YVCA 3F8TA 4A3KG 3HOYH 3CCRA 4DR4L 4JBJA 4A3MG 1N32Q 1A8VA 3CMAA 1VQ9A 1CUKA 1JB7A 1QUQB 4YCUA 3HKZE 2UUCQ 3ICEA 5JJKA 1HZCA 3J80i 3GTJH 1WJJA 5GADC 4R4OA 3F2DA 1YZ6A 3S1NH 1W3SA 1YHBA 3CCUA 2YU9H 1B7YB 4X6AH 1KAWA 4YWMA 3HOXH 4DV6L 3PSIA 1TXYA 5IT9c 4A75A 1VQNA 4DR1Q 1Q1EA 2UUBL 4JV5L 4JI4Q 1Y1VH 3HOXG 1FVIA 4A3IH 2RF4A 3CP0A 4PG3A 4APVA 3S2HH 1VQHA 2VUMG 4X64L 3J7ZC 3ERSX 3GTPH 1SN8A 1QZHA 5M5XH 2AMCB 1HNWQ 1CKOA 2R6GA 1HZ9A 2F4VL 5ELOA 1YJNA 3E9IA 4P74A 1QVCA 4POGA 2VW9A 1KIXA 3I4NH 1LUZA 1IBLQ 4LNQA 1JJ2A 3A5ZB 3PUYA 3HFZB 1PYBA 2BA1A 3WWVA 5FLXc 3HOZG 5LMUQ 2GN5A 5M5WH 4DV0Q 3NEMA 4XIGS 2E8GA 3FKIG 3GD7A 4JBWA 4JI2L 4IPCA 4A76A 4LF9Q 1I6HH 1HZAA 4Y52H 2AWNA 3U4VA 5GAHC 1NTGA 4X62Q 4DUZL 1QUQA 2KHJA 1WCMG 1KC8C 2ZJRA 1J5EL 2E2JH 4A3CG 2JA9A 1PH2A 1YI2A 2ZTCA 2EQSA 3EN2A 1EIYB 1S3OA 3CC7A 1YNXA 2KHIA 4AIMA 1PH4A 3PUXA 4TQUS 1GO3E 1N8RC 2UXDQ 4X65L 3TS0A 3RNUA 3J81i 3DLLA 4KHPQ 5FJ8H 4PZ8A 3RZDH 4YHHQ 5IYBG 4A3FH 1SRUA 4LW1A 4LF4Q 1E1TA 3ULLA 1M1KC 4A3LG 3AFPA 3T1YL 5BR8Q 1YITA 2K50A 5BR8L 4IOCA 2L15A 3NENA 4DUYQ 1Q82C 4HJ8A 2UXBQ 4BY1G 1CSPA 3GTKH 1DGSA 5JEAG 1IBMQ 1TWFH 2A8VA 2ZM6Q 3H3VH 2N8NA 4EQ5A 1S40A 3CF5A 5IYDH 1X6OA 3OW2A 4BBSG 1J6QA 4IPGA 1IYJB 3I56A 2A19A 4UP9A 1YJWA 2ZTDA 4A3MH 1E22A 1X65A 5C44H 4B3RQ 5C0XG 4LF6L 3KJPA 1IBKL 1N33Q 3K80C 1ASYA 1X55A 5GQOA 1BBWA 4LFCL 1G51A 2JA7H 4DR3L 3PIPA 2DGYA 1KL9A 1L0WA 5C0XI 1UE7A 4H02A 3TEHB 4HIMA 3EBEA 4NXMQ 3KDFB 4XTCS 4GN4B 5C44G 4B3MQ 4DR6L 4WJ3M 4GN3B 4GS3A 2ES2A 1MJCA 1I5FA 1V9PA 3HOVH 1EIFA 2JA7G 2OWOA 3STBD 2JA5G 3H0GH 4WJ4A 3HOVG 4JBKA 3RLFA 2NN6I 5HGQA 2ATWA 3S2DH 4JC0A 3ZJYC 1K3RA 4GOPA 3PIOA 4A93H 5FLMG 3GTMH 4DV4L 1NMFA 1P16A 2JK8A 3M4QA 4JI3L 3UDIA 3RLOA 3KJOA 3CW2C 4GNXC 3G71A 4DR2Q 4LF5Q 3I4MH 1PH1A 1OXTA 2CKZB 2R7ZH 3I4NG 2B3GA 1GKHA 4JI2Q 2B29A 4GNXA 2I5MX 1HR0L 4IJLA 2Q2UA 1C7YA 1Q7YC 4GNXB 4DV2Q 4C3HH 3D0FA 2CWAA 2R93H 4C3JH 4LUZA 4NXML 1K0RA 4KHZA 3M4PA 3K0XA 3OTOL 1X3EA 5M3FH 3FKIH 1EWIA 1HH2P 1K73C 2Y0SE 2NVXH 1JT8A 4X65Q 5LMNL 2A1AA 4NPSA 3KF6B 3CCVA 1XPUA 3HOZH 4QQBX 4HIDA 5IY0A 4AYBG 4AQYQ 3U4ZA 3KF6A 2VQEQ 1NJIC 2CQOA 1I94L 2UUAL 4GLAC 4IPHA 4BY7G 4A3DG 2OQKA 2PQAA 5M5YH 1XPOA 4JV5Q 5IP9G 5IYCH 4R4CA 1KHIA 4QJFA 3UDFA 1V1QA 2HIVA 1SE8A 4A3FG 4L5SA 2PNHA 4IFDG 4OX9Q 1SROA 1M90C 1KRSA 4YHHL 4O0AA 2I0QA 3CPFA 4KHPL 4DV0L 4HJ7A 5JJIA 5ELNA 3AQQA 1N33L 3JC66 4DV3L 2WP8J 4GLVB 1HJPA 5E7NA 1XMOL 4LWCA 1CSQA 4DK3C 4BBRG 3HKZG 5IWAL 1X3GA 2YTYA 3CQZH 1N36L 2ASBA 4OO1G 3CCEA 2UXCQ 1VQCA 2ALYB 4HIKA 2IX1A 1N34Q 1IXRA 3A74A 4P72A 1XMQQ 4K0KL 3JAMi 3RN5A 2FXQA 2BA0A 2GVBA 4P71A 4LFCQ 1XPRA 3H3VI 4JOIA 3J81j 1Y14B 3M9BA 1HR0W 2I5LX 3RR5A 1WYDA 2K75A 3LGJA 1VQJA 5LMNW 3GTLH 4BXXG 4DV6Q 1HNXQ 3RZOH 4A3EG 3PO2G 4LUVA 4LF8Q 3W1BA 5IE8A 1EUJA 2HHHQ 2VZAA 3HOYG 1X54A 1MJEA 5LMNQ 1UEBA 1VQGA 5AJ3L 1IBML 3ULPA 1I50H 4A3GH 4DUZQ 1Z47A 4X64Q 2EXDA 3TQYA 4UP7A 1VQ4A 2K4KA 3CCMA 1FL0A 1XMQL 4K0KQ 1R9TH 5K36G 1B70B 2AWOA 4ME3A 2Q2HA 2UXDL 1GD7A 4GOPC 5FLMH 1HR0Q 2JA6G 2H5XA 5JJLA 2R92H 5IWAQ 4DPGA 2KENA 4LFAL 1JJCB 2RHSB 3CPWA 2OTJA 1EFWA 3GTOH 2K5HA 1OXVA 2C35B 2CFMA 2KBNA 3K8AA 4JI5L 1YIJA 2R92G 4LUOA 1EQRA 2Y0SG 1N32L 3MEFA 1A63A 2N49A 1HNZL 3PF4A 4OONA 2GVAA 5IYCG 3A5UA 2N78A 1AE2A 2QGQA 4MNOA 1PH8A 3CCSA 5IP7H 1B8AA 4JI8Q 2JA8H 1UE1A 1RIPA 4B3TL 1S72A 4IPDA 1RL2A 3T1HL 1YJ9A 4JYAQ 2IHEA 3HOWG 4Y7NH 4JBMA 1X9NA 2ZJPA 4JI0Q 2VQEL 1XMOQ 4JI7Q 5C3EG 4NXNQ 4DR3Q 4LFBQ 2YYZA 5IP7G 1OXSC 4OWWB 2CWPA 3NBHB 1YBYA 3K7UC 3KDFA 4RMFA 1E1OA 4MZ9A 1XTDA 1LYLA 3AYHB 1QVGA 4EX5A 1GM5A 4JI6Q 1VQLA 4BY1H 3TS2A 2YTXA 4DKAC 5M3MG 4POFA 4UP8A 2LXJA 2ZM6L 1C0AA 4DV5L 3B6YA 2PMZE 1G6PA 4BBSH 2UUBQ 3J80c
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E7Z A;  1WFQ A;  2NZH A;  2UXB L;  3S1R H;  1MKH A;  3PUZ A;  4A3J G;  4GKK L;  1KQS A;  3DM3 A;  4AQY L;  3HOU H;  1PFS A;  2EIF A;  2JE6 I;  4R1J A;  3F1Z A;  3W1G A;  4JI6 L;  2Z6K C;  4L5T A;  5AJ3 Q;  1JE5 A;  1K83 H;  2WB1 G;  4UPA A;  4A3E H;  4C2M H;  5LMU L;  2WB1 E;  1Y1W H;  1JMC A;  2D62 A;  3HOU G;  3JAM c;  2E5L Q;  4UY8 C;  4GKJ L;  4HJA A;  1Y1W G;  3MXN B;  4LF7 L;  1NY4 A;  3GTG H;  1X56 A;  4PZ7 A;  4C3I H;  3PGZ A;  1L2F A;  3H0G G;  4B3S Q;  1Y1V G;  2F3I A;  4OO1 I;  3L0O A;  4QY7 A;  4B3M L;  2OCE A;  4KI0 A;  2NVT H;  1CKN A;  3E9H A;  3L7Z C;  3PV0 A;  4IJH A;  4JOI C;  4P73 A;  1H95 A;  3CCJ A;  3UDX A;  4DV1 Q;  1L1O B;  2VUM H;  4LF5 L;  4JCV E;  4DR2 L;  4DNI A;  4YY3 Q;  3BU2 A;  4BA2 I;  3BJU A;  3BZC A;  4R4T A;  3VDY A;  1K9M C;  5IYD G;  1IZ6 A;  4YWK A;  4QIW E;  4DR5 L;  3UDG A;  2JA5 H;  3I7F A;  3M7N A;  2IHF A;  1BBU A;  1AE3 A;  1D7Q A;  3ULJ A;  2UU9 Q;  1KRT A;  4GLX A;  4A3K H;  4R4Q A;  4IO9 A;  2R7Z G;  4A3I G;  1VQF A;  2MFI A;  1PA6 A;  4J15 A;  1BKB A;  2D0P A;  1K8G A;  1VQP A;  3T1Y Q;  3KOJ A;  4JI0 L;  3EIV A;  2KCT A;  1O7I A;  3PUV A;  1SMX A;  3OTO Q;  2DUD A;  1W2B A;  3S16 H;  1JJG A;  2I5H A;  4OWT B;  3OYY A;  4QL5 A;  3S15 H;  4TVA B;  1VS0 A;  4PMW A;  3HKS A;  4DR1 L;  2JEA I;  2B63 H;  4OXP A;  3HOW H;  5GAE C;  4R4I A;  4LF8 L;  4IOA A;  3M3Y H;  4RG1 A;  4GOP B;  2IY5 B;  4DR5 Q;  2HT1 A;  3CAM A;  3CXC A;  4DR7 L;  3S17 H;  3F2C A;  2MO0 A;  4DUY L;  2RCN A;  2VS1 A;  5C4X G;  4L5Q A;  1CKM A;  4JG2 A;  3I55 A;  4DV7 Q;  1QVF A;  3PCO B;  4JYA L;  5C4X H;  2NN6 G;  2IX0 A;  5C3E H;  4MTN A;  2K52 A;  2RHQ B;  3S14 H;  1PHJ A;  1XNQ L;  5C0X J;  2JQO A;  4ALP A;  4X66 Q;  3D31 A;  3AFQ A;  4A3G G;  3M85 A;  5HY6 A;  4KLK A;  1YHQ A;  1VQ6 A;  4IFD J;  2E5L L;  1XNR L;  1YHA A;  4JI3 Q;  2AKW B;  2V1C C;  1IBK Q;  2VY3 A;  4LF6 Q;  4DAM A;  2HQL A;  5FJ8 G;  1A62 A;  4DAY B;  2VNU D;  1OXX K;  4LF9 L;  3F2B A;  3CD6 A;  3S1Q H;  3CCQ A;  1E24 A;  5DLQ E;  1UWV A;  2PQA B;  4A3D H;  4GKK Q;  2R7D A;  5IP9 H;  4A3B H;  1U0L A;  3A0J A;  1T9H A;  1LM0 A;  1Q86 C;  3PO2 H;  4DR6 Q;  4LF7 Q;  3SGI A;  3U50 C;  1IBL L;  1ASZ A;  3GTQ H;  4GKJ Q;  1WOC A;  3RLN A;  5C4J H;  3AEV A;  2OQ0 A;  2K5V A;  5J3B A;  4FDB A;  4LF4 L;  1FJG L;  4A3L H;  1EQQ A;  4HJ5 A;  4A93 G;  2LSS A;  1TWH H;  3G4S A;  5JEA J;  4GN5 A;  1EYG A;  2UU9 L;  2LXK A;  1WI5 A;  3UE1 A;  1OTC A;  3PO3 H;  3Q8D A;  4BXX H;  2CCZ A;  1VQI A;  1I3Q H;  2N3S A;  4HJ9 A;  4BBR H;  1UE5 A;  4JI7 L;  4OWX B;  2WAQ E;  1TWG H;  4NB3 A;  3J81 c;  2YV5 A;  1G29 1;  1Q46 A;  3ER0 A;  3I2Z A;  4O2D A;  1PH5 A;  1XNQ Q;  1YEZ A;  1PH7 A;  1PVO A;  3H15 A;  3PF5 A;  3CME A;  1VQE A;  3W5O A;  1N34 L;  4AYB E;  4B3S L;  4DV4 Q;  4B3T Q;  1QZG A;  1IL2 A;  4DK6 C;  1N36 Q;  2HIX A;  1CKN B;  5EAY A;  2ZJQ A;  2IT1 A;  2Z6K A;  4JI5 Q;  2JA6 H;  3I4M G;  4DR7 Q;  2B63 G;  4B3R L;  1U5K A;  4LFB L;  3TRZ A;  4NXN L;  4LFA Q;  1SLJ A;  2KCM A;  3UE0 A;  1I94 Q;  3BZK A;  2JEB I;  3T1H Q;  2MO1 A;  1Z9F A;  4X62 L;  1VQA A;  2PI2 E;  4IFD I;  1V43 A;  4JI1 L;  1Q12 A;  3G6E A;  2R93 G;  2WFW A;  4YCW A;  1FJG Q;  2R7F A;  3M4O H;  4QGU A;  3E0E A;  3KYH C;  4YWL A;  1PH6 A;  1VQB A;  4AH6 A;  3GDE A;  4YCV A;  1Q8K A;  4P75 A;  1AH9 A;  3FP9 A;  1TWC H;  4JI4 L;  2ZTE A;  3NEL A;  5M3M H;  2ID0 A;  1VQD A;  2MNA A;  3KFU A;  1L1O C;  4DV2 L;  2NVY H;  1NE3 A;  1FGU A;  3L2P A;  2XGT A;  2NZO A;  2UUA Q;  1SR3 A;  1N9W A;  2BH8 A;  1WCM H;  2JJQ A;  4A3C H;  3I4O A;  1L1O A;  3FHW A;  2Q2I A;  3K7A H;  5M3F G;  3STB C;  4BY7 H;  2PI2 A;  2Q2T A;  2F4V Q;  3TRE A;  3KLW A;  2F52 A;  3IRB A;  5GRO A;  4HIO A;  1J5E Q;  1VQK A;  1GVP A;  1NMG A;  1E3P A;  2VQF L;  1K8A C;  1VQ5 A;  5GAG C;  2YTV A;  2VQF Q;  1D8L A;  1MIU A;  3CC4 A;  1XNR Q;  2JA8 G;  3S24 A;  1Q1B A;  3S1M H;  1NBW A;  3K81 C;  1PYS B;  1BVS A;  2VL6 A;  4X66 L;  3U58 A;  1HZB A;  1KD1 C;  4A4I A;  2UXC L;  4DV5 Q;  2E2H H;  2K5N A;  2WAQ G;  2QEX A;  2D0O A;  5H1S E;  1SFO H;  1VQ7 A;  1LTL A;  4JI8 L;  2HHH L;  1VQM A;  2AHO B;  4PZ6 A;  1A0I A;  1HNX L;  1P8L A;  2XTI A;  4DV7 L;  1Q81 C;  1HNZ Q;  2E2I H;  2UUC L;  2QA4 A;  1PV4 A;  4BA1 I;  4DV3 Q;  1XJV A;  2MQH A;  2K14 A;  3CC2 A;  2NVQ H;  3RN2 A;  1OXU A;  3GO5 A;  4YY3 L;  3PUW A;  1VCI A;  2BH2 A;  5IYB H;  1HNW L;  4DR4 Q;  1VQO A;  3PO3 G;  4DV1 L;  1PH3 A;  1VQ8 A;  1EOV A;  4A3B G;  4OX9 L;  1TWA H;  4JI1 Q;  3J7A 5;  1UE6 A;  3G48 A;  1KXL A;  2Z0S A;  3CCL A;  1C9O A;  4A3J H;  3KF8 B;  4L5R C;  1X3F A;  1PH9 A;  2OTL A;  1YVC A;  3F8T A;  4A3K G;  3HOY H;  3CCR A;  4DR4 L;  4JBJ A;  4A3M G;  1N32 Q;  1A8V A;  3CMA A;  1VQ9 A;  1CUK A;  1JB7 A;  1QUQ B;  4YCU A;  3HKZ E;  2UUC Q;  3ICE A;  5JJK A;  1HZC A;  3J80 i;  3GTJ H;  1WJJ A;  5GAD C;  4R4O A;  3F2D A;  1YZ6 A;  3S1N H;  1W3S A;  1YHB A;  3CCU A;  2YU9 H;  1B7Y B;  4X6A H;  1KAW A;  4YWM A;  3HOX H;  4DV6 L;  3PSI A;  1TXY A;  5IT9 c;  4A75 A;  1VQN A;  4DR1 Q;  1Q1E A;  2UUB L;  4JV5 L;  4JI4 Q;  1Y1V H;  3HOX G;  1FVI A;  4A3I H;  2RF4 A;  3CP0 A;  4PG3 A;  4APV A;  3S2H H;  1VQH A;  2VUM G;  4X64 L;  3J7Z C;  3ERS X;  3GTP H;  1SN8 A;  1QZH A;  5M5X H;  2AMC B;  1HNW Q;  1CKO A;  2R6G A;  1HZ9 A;  2F4V L;  5ELO A;  1YJN A;  3E9I A;  4P74 A;  1QVC A;  4POG A;  2VW9 A;  1KIX A;  3I4N H;  1LUZ A;  1IBL Q;  4LNQ A;  1JJ2 A;  3A5Z B;  3PUY A;  3HFZ B;  1PYB A;  2BA1 A;  3WWV A;  5FLX c;  3HOZ G;  5LMU Q;  2GN5 A;  5M5W H;  4DV0 Q;  3NEM A;  4XIG S;  2E8G A;  3FKI G;  3GD7 A;  4JBW A;  4JI2 L;  4IPC A;  4A76 A;  4LF9 Q;  1I6H H;  1HZA A;  4Y52 H;  2AWN A;  3U4V A;  5GAH C;  1NTG A;  4X62 Q;  4DUZ L;  1QUQ A;  2KHJ A;  1WCM G;  1KC8 C;  2ZJR A;  1J5E L;  2E2J H;  4A3C G;  2JA9 A;  1PH2 A;  1YI2 A;  2ZTC A;  2EQS A;  3EN2 A;  1EIY B;  1S3O A;  3CC7 A;  1YNX A;  2KHI A;  4AIM A;  1PH4 A;  3PUX A;  4TQU S;  1GO3 E;  1N8R C;  2UXD Q;  4X65 L;  3TS0 A;  3RNU A;  3J81 i;  3DLL A;  4KHP Q;  5FJ8 H;  4PZ8 A;  3RZD H;  4YHH Q;  5IYB G;  4A3F H;  1SRU A;  4LW1 A;  4LF4 Q;  1E1T A;  3ULL A;  1M1K C;  4A3L G;  3AFP A;  3T1Y L;  5BR8 Q;  1YIT A;  2K50 A;  5BR8 L;  4IOC A;  2L15 A;  3NEN A;  4DUY Q;  1Q82 C;  4HJ8 A;  2UXB Q;  4BY1 G;  1CSP A;  3GTK H;  1DGS A;  5JEA G;  1IBM Q;  1TWF H;  2A8V A;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  1S40 A;  3CF5 A;  5IYD H;  1X6O A;  3OW2 A;  4BBS G;  1J6Q A;  4IPG A;  1IYJ B;  3I56 A;  2A19 A;  4UP9 A;  1YJW A;  2ZTD A;  4A3M H;  1E22 A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  4LF6 L;  3KJP A;  1IBK L;  1N33 Q;  3K80 C;  1ASY A;  1X55 A;  5GQO A;  1BBW A;  4LFC L;  1G51 A;  2JA7 H;  4DR3 L;  3PIP A;  2DGY A;  1KL9 A;  1L0W A;  5C0X I;  1UE7 A;  4H02 A;  3TEH B;  4HIM A;  3EBE A;  4NXM Q;  3KDF B;  4XTC S;  4GN4 B;  5C44 G;  4B3M Q;  4DR6 L;  4WJ3 M;  4GN3 B;  4GS3 A;  2ES2 A;  1MJC A;  1I5F A;  1V9P A;  3HOV H;  1EIF A;  2JA7 G;  2OWO A;  3STB D;  2JA5 G;  3H0G H;  4WJ4 A;  3HOV G;  4JBK A;  3RLF A;  2NN6 I;  5HGQ A;  2ATW A;  3S2D H;  4JC0 A;  3ZJY C;  1K3R A;  4GOP A;  3PIO A;  4A93 H;  5FLM G;  3GTM H;  4DV4 L;  1NMF A;  1P16 A;  2JK8 A;  3M4Q A;  4JI3 L;  3UDI A;  3RLO A;  3KJO A;  3CW2 C;  4GNX C;  3G71 A;  4DR2 Q;  4LF5 Q;  3I4M H;  1PH1 A;  1OXT A;  2CKZ B;  2R7Z H;  3I4N G;  2B3G A;  1GKH A;  4JI2 Q;  2B29 A;  4GNX A;  2I5M X;  1HR0 L;  4IJL A;  2Q2U A;  1C7Y A;  1Q7Y C;  4GNX B;  4DV2 Q;  4C3H H;  3D0F A;  2CWA A;  2R93 H;  4C3J H;  4LUZ A;  4NXM L;  1K0R A;  4KHZ A;  3M4P A;  3K0X A;  3OTO L;  1X3E A;  5M3F H;  3FKI H;  1EWI A;  1HH2 P;  1K73 C;  2Y0S E;  2NVX H;  1JT8 A;  4X65 Q;  5LMN L;  2A1A A;  4NPS A;  3KF6 B;  3CCV A;  1XPU A;  3HOZ H;  4QQB X;  4HID A;  5IY0 A;  4AYB G;  4AQY Q;  3U4Z A;  3KF6 A;  2VQE Q;  1NJI C;  2CQO A;  1I94 L;  2UUA L;  4GLA C;  4IPH A;  4BY7 G;  4A3D G;  2OQK A;  2PQA A;  5M5Y H;  1XPO A;  4JV5 Q;  5IP9 G;  5IYC H;  4R4C A;  1KHI A;  4QJF A;  3UDF A;  1V1Q A;  2HIV A;  1SE8 A;  4A3F G;  4L5S A;  2PNH A;  4IFD G;  4OX9 Q;  1SRO A;  1M90 C;  1KRS A;  4YHH L;  4O0A A;  2I0Q A;  3CPF A;  4KHP L;  4DV0 L;  4HJ7 A;  5JJI A;  5ELN A;  3AQQ A;  1N33 L;  3JC6 6;  4DV3 L;  2WP8 J;  4GLV B;  1HJP A;  5E7N A;  1XMO L;  4LWC A;  1CSQ A;  4DK3 C;  4BBR G;  3HKZ G;  5IWA L;  1X3G A;  2YTY A;  3CQZ H;  1N36 L;  2ASB A;  4OO1 G;  3CCE A;  2UXC Q;  1VQC A;  2ALY B;  4HIK A;  2IX1 A;  1N34 Q;  1IXR A;  3A74 A;  4P72 A;  1XMQ Q;  4K0K L;  3JAM i;  3RN5 A;  2FXQ A;  2BA0 A;  2GVB A;  4P71 A;  4LFC Q;  1XPR A;  3H3V I;  4JOI A;  3J81 j;  1Y14 B;  3M9B A;  1HR0 W;  2I5L X;  3RR5 A;  1WYD A;  2K75 A;  3LGJ A;  1VQJ A;  5LMN W;  3GTL H;  4BXX G;  4DV6 Q;  1HNX Q;  3RZO H;  4A3E G;  3PO2 G;  4LUV A;  4LF8 Q;  3W1B A;  5IE8 A;  1EUJ A;  2HHH Q;  2VZA A;  3HOY G;  1X54 A;  1MJE A;  5LMN Q;  1UEB A;  1VQG A;  5AJ3 L;  1IBM L;  3ULP A;  1I50 H;  4A3G H;  4DUZ Q;  1Z47 A;  4X64 Q;  2EXD A;  3TQY A;  4UP7 A;  1VQ4 A;  2K4K A;  3CCM A;  1FL0 A;  1XMQ L;  4K0K Q;  1R9T H;  5K36 G;  1B70 B;  2AWO A;  4ME3 A;  2Q2H A;  2UXD L;  1GD7 A;  4GOP C;  5FLM H;  1HR0 Q;  2JA6 G;  2H5X A;  5JJL A;  2R92 H;  5IWA Q;  4DPG A;  2KEN A;  4LFA L;  1JJC B;  2RHS B;  3CPW A;  2OTJ A;  1EFW A;  3GTO H;  2K5H A;  1OXV A;  2C35 B;  2CFM A;  2KBN A;  3K8A A;  4JI5 L;  1YIJ A;  2R92 G;  4LUO A;  1EQR A;  2Y0S G;  1N32 L;  3MEF A;  1A63 A;  2N49 A;  1HNZ L;  3PF4 A;  4OON A;  2GVA A;  5IYC G;  3A5U A;  2N78 A;  1AE2 A;  2QGQ A;  4MNO A;  1PH8 A;  3CCS A;  5IP7 H;  1B8A A;  4JI8 Q;  2JA8 H;  1UE1 A;  1RIP A;  4B3T L;  1S72 A;  4IPD A;  1RL2 A;  3T1H L;  1YJ9 A;  4JYA Q;  2IHE A;  3HOW G;  4Y7N H;  4JBM A;  1X9N A;  2ZJP A;  4JI0 Q;  2VQE L;  1XMO Q;  4JI7 Q;  5C3E G;  4NXN Q;  4DR3 Q;  4LFB Q;  2YYZ A;  5IP7 G;  1OXS C;  4OWW B;  2CWP A;  3NBH B;  1YBY A;  3K7U C;  3KDF A;  4RMF A;  1E1O A;  4MZ9 A;  1XTD A;  1LYL A;  3AYH B;  1QVG A;  4EX5 A;  1GM5 A;  4JI6 Q;  1VQL A;  4BY1 H;  3TS2 A;  2YTX A;  4DKA C;  5M3M G;  4POF A;  4UP8 A;  2LXJ A;  2ZM6 L;  1C0A A;  4DV5 L;  3B6Y A;  2PMZ E;  1G6P A;  4BBS H;  2UUB Q;  3J80 c; 
#chains in the Genus database with same CATH topology
 2UXB L;  4GKK L;  1CFM A;  1VF5 C;  4X64 H;  3HOU H;  4IAJ A;  3WOE A;  3FPU B;  4NKL A;  4R1J A;  3W1G A;  1DCZ A;  2X6L A;  2XD4 A;  5AFW A;  2PYK A;  1F2M A;  4E6I A;  4TQS A;  2WB1 G;  4UPA A;  1Y1W H;  5LMU L;  2XVS A;  2D62 A;  5KYI A;  2E5L Q;  1IYV A;  1STH A;  3MXN B;  1Y1W G;  1BF4 A;  2QYZ A;  3FKI A;  4O4L F;  1EEF D;  4JI6 H;  2W6O A;  1X56 A;  4PZ7 A;  5C3W A;  3R3O A;  1H95 A;  3E9H A;  4JOI C;  5KX5 F;  1S5B D;  4A3G B;  4LF5 L;  4JCV E;  5KFJ A;  1H9K A;  4DNI A;  1MZB A;  2YW2 A;  5KFE A;  3T1H H;  4RKL A;  3FEW X;  4CDE C;  4YY3 Q;  3BU2 A;  3N44 B;  3TII A;  3BJU A;  4R4T A;  3V96 A;  3PW7 A;  1K9M C;  1ZET A;  2JA5 B;  4RKB A;  3M7N A;  2A6H C;  4MTE A;  2JA5 A;  2SOB A;  2IHF A;  4CC6 A;  3K6O A;  1W6K A;  5JVH 3;  2EVB A;  3O13 A;  1VQF A;  4KY5 A;  4A3I G;  3I90 A;  2F0Q A;  2D0P A;  3KOJ A;  2KCT A;  3PUV A;  3OTO Q;  3HOV B;  1W2B A;  3GIQ A;  3SE7 A;  4RGT A;  3OYY A;  4G57 A;  3S15 H;  4DR1 L;  5KFO A;  1CK1 A;  4OXP A;  4R4I A;  4LF8 L;  1CS0 A;  3M3Y H;  4TV8 F;  4GOP B;  1IBK H;  1OWT A;  4DR5 Q;  1PFB A;  2HT1 A;  5D1O B;  4LF6 H;  4DR7 L;  2E2D C;  1H9R A;  4RUA A;  1MGS A;  4BS9 A;  2MO0 A;  4KHV A;  4DUY L;  2RCN A;  1HQM C;  4IUQ A;  5C4X G;  4X3T A;  4DV7 Q;  3M9O B;  3WNZ A;  2XGQ A;  4R8N A;  5C4X H;  3BDL A;  5IT9 L;  3KHR A;  2IX0 A;  1K83 A;  2C2E A;  1V1P B;  4MTN A;  4RAY A;  3BDC A;  3TIN A;  4X66 Q;  2NN6 H;  3DWQ A;  2J0T D;  1XYI A;  4O4I F;  3M85 A;  4KLK A;  3U9O A;  1VQ6 A;  3PW0 A;  4FF1 A;  1YHA A;  2F0H A;  5DM7 3;  4JI1 H;  2NVY B;  2PMZ A;  1RKN A;  5FJ8 G;  3OHX C;  5EPK A;  5M9O A;  4QWB A;  4IUR A;  1CHP D;  3F2B A;  2P5Z X;  4WBN F;  1TY0 A;  1UWV A;  2R7D A;  3OMC A;  1H9J A;  1Q86 C;  3IG0 A;  1LM0 A;  5IGC A;  5F2D A;  4LF7 Q;  3SGI A;  4FU0 A;  1IBL L;  3P1H A;  3GTJ B;  3DWA A;  4XT1 B;  2WDT A;  4UCV A;  3RBD A;  2R93 A;  3AEV A;  4O3P A;  5D3I B;  1RJR A;  4LF4 L;  2PW7 A;  3NHH A;  5EZY F;  3G4S A;  5JEA J;  4KY6 A;  4DL3 A;  1I4R A;  5E3F A;  1I94 H;  2CCZ A;  5KFU A;  1BXT A;  3M9N B;  2YV5 A;  4PNY A;  1PVO A;  1WTV A;  4GKK H;  3S9W A;  1EZ6 A;  2A6E D;  2R8I A;  4Q0Y A;  1H9M A;  1CA5 A;  4DV7 H;  2EE1 A;  3MZ5 A;  1S5F D;  1SNM A;  1IL2 A;  3DWP A;  2V9W A;  2IT1 A;  4B3R L;  4MV8 A;  1TWH B;  1U5K A;  3I91 A;  4KJO A;  3TN2 A;  3QZ8 A;  2JA6 A;  4LFA Q;  1TWF B;  2R7K A;  3BZK A;  2JEB I;  4TKO B;  4DAV A;  1RJP A;  3T1H Q;  4CBV A;  4KMU C;  4X62 L;  2PI2 E;  1RCV D;  1V43 A;  1VMC A;  1KNA A;  2JP1 A;  4MV3 A;  5LYJ F;  3BQ1 A;  4QGU A;  1Q8I A;  1ICW A;  1T36 A;  1PTO D;  2NUA B;  1AH9 A;  3FP9 A;  2PMZ B;  2NVY A;  2R86 A;  2ID0 A;  4G7O C;  2MNA A;  1L1O C;  2EYM A;  2XGT A;  3VYS A;  3PN1 A;  1L0Y B;  5K2M A;  3OTO H;  2W9C B;  3HB9 A;  4BY7 H;  2Z9H A;  1BBX C;  2PI2 A;  2F4V Q;  2F52 A;  3JAM W;  1U4R A;  4HIO A;  1S5E D;  4EEY A;  1GVP A;  3BG3 A;  2YZM A;  3NWT A;  2NU7 B;  2YTV A;  1PFN A;  1QNU A;  2JA8 G;  4RHS A;  3S1M B;  1UNN C;  5EPJ A;  1S0M A;  3K81 C;  4FF2 A;  3RB0 A;  2NZ1 D;  2UXC L;  1ZEQ X;  2WAQ G;  1BCP D;  1GHK A;  3A54 A;  4FP5 D;  4O42 A;  2AHO B;  2K5W A;  2QIL A;  2HJW A;  5KFA A;  3OSO A;  2ASL A;  1GUW A;  3CRK C;  2UUC L;  1E0B A;  1YNN D;  1VCI A;  2HCC A;  1HNW L;  1CQV A;  3TP5 A;  3J7A V;  1JOQ A;  2D9U A;  4JI1 Q;  4CKE A;  1DD2 A;  3BAA A;  4CC5 A;  5C5J A;  2NU9 B;  2OTL A;  3F8T A;  3NTK A;  4DR4 L;  2UVR A;  4JV0 A;  4U67 3;  5I2X A;  3CMA A;  2QDL A;  3I4N B;  3MR5 A;  1QUQ B;  4CJ0 B;  3PVX A;  3L4K A;  3S1N H;  3F2D A;  3A56 A;  5BR8 H;  1W3S A;  4UAI A;  1B7Y B;  3PSI A;  1TXY A;  4A75 A;  4DR1 Q;  3G6V A;  2F4V H;  1UNS A;  1S0N A;  2EY2 A;  5LOV F;  1RK6 A;  2BE5 C;  5DAU A;  4O2A F;  4PG3 A;  3AB9 A;  4APV A;  4C3H G;  2VUM G;  2LKV A;  2Z4H A;  3LNN A;  3J7Z C;  1BJT A;  3Q2O A;  1Y1W A;  1CKO A;  2VA3 A;  1HZ9 A;  2SNM A;  4P74 A;  5J1Z A;  1GGO A;  3P20 A;  4C2M A;  3V4S A;  1SXT A;  1LUZ A;  5C4H A;  4DLK A;  3HFZ B;  2BA1 A;  3WWV A;  5NUC A;  2OH2 A;  2GN5 A;  3RAQ A;  2E8G A;  1K8M A;  4JBW A;  4JI2 L;  4IRC A;  4FM9 A;  1HZA A;  4Y52 H;  4PMC A;  3OSP A;  5EBD A;  5ELC A;  1KJ8 A;  1NTG A;  3CQZ B;  4DR2 H;  4A3C G;  1TWG A;  2ZJR A;  1JWS D;  1EYA A;  2JA9 A;  1MBY A;  2ZTC A;  3EN2 A;  2R87 A;  2F0P A;  4AIM A;  4UHV A;  4TQU S;  4Q0F A;  1SMY C;  5IOC A;  3J81 i;  3RZD H;  2PCF B;  1SRU A;  4LW1 A;  4ZCK A;  5FO9 B;  3G6Y A;  5BR8 Q;  1YIT A;  2K50 A;  3S14 B;  2UXB Q;  3GTK H;  4DR1 H;  4EGQ A;  2CW8 A;  4LSA A;  4M9U A;  4RNM A;  1X6O A;  1W96 A;  5GON F;  4IPG A;  4UP9 A;  2ZTD A;  4F4Y A;  4RNO A;  1N33 Q;  4S3S A;  5KT6 A;  2EDG A;  1X55 A;  2CQA A;  1BBW A;  1EY0 A;  4C1N I;  2UXD H;  1G51 A;  2DGY A;  1UE7 A;  4JV2 A;  3S2H B;  3KDF B;  1D1I A;  4GN4 B;  5C44 G;  5I6Y A;  4DL6 A;  4GS3 A;  2K03 A;  3TP8 A;  3Q0A A;  5C44 B;  2OWO A;  4QUC A;  4O3N A;  4F4W A;  2ZT9 C;  1SEB D;  2Q8I B;  4CHT B;  3GTM A;  1K3R A;  2F0S A;  4A93 H;  5LHY 1;  1X3Q A;  2CW0 C;  3S1N B;  3KXY T;  2JK8 A;  4GNX C;  4DR2 Q;  2R7Z A;  1PH1 A;  2CKZ B;  2W57 A;  4L6T B;  4DK1 A;  4L63 B;  4GNX A;  1RYR A;  4QUF A;  4OL7 A;  4GNX B;  2AGQ A;  4C5B A;  2CWA A;  2R93 H;  3TIG A;  4RGO S;  4LUZ A;  1HRJ A;  4C5A A;  4OEL B;  3K0X A;  5M3F H;  4ZUJ A;  2FMC A;  3AU7 A;  4LF8 H;  4B9X A;  4EGJ A;  2R7L A;  1K73 C;  1F9P A;  2NVX H;  2UXB H;  3HZX A;  1O7Y A;  5LMN L;  5DGA A;  3MR3 A;  2VXW A;  1F9S A;  4IUP A;  1I94 L;  5IY0 A;  1NJI C;  1TU2 B;  3R5F A;  1I4P A;  4IPH A;  1GUS A;  4HN7 A;  2O03 A;  5C3E B;  3RUP A;  2PZT A;  5IP9 G;  1E2V A;  5E1F A;  2WIN B;  5DLF A;  3OUU A;  1KHI A;  1V1Q A;  4A3F G;  4L1K A;  3LWU A;  4CDF C;  4IFD G;  1EOT A;  2V4D A;  2FFK B;  3CPF A;  1X32 A;  2C28 A;  4DV0 L;  4YR0 A;  1TAE A;  4KKS A;  4DV3 L;  4PQX A;  2W7P A;  5M5X B;  2DNC A;  4O2B F;  4BY7 B;  1CSQ A;  2BQR A;  5KT5 A;  3BVZ A;  5IWA L;  4HYK A;  1GSA A;  4OO1 G;  1XNR H;  2RDF A;  1EZ8 A;  3CCE A;  1SND A;  2ALY B;  5EPL A;  3M4O B;  1IL8 A;  1IXR A;  3A74 A;  3EA6 A;  3FKI B;  1N34 Q;  1I50 A;  4QWC A;  3JAM i;  5EWF A;  1I50 B;  3OWF A;  1U4P A;  2GVB A;  2L5T A;  4P71 A;  4ECZ A;  2FIN B;  5C4Z A;  3C1F A;  1XPR A;  4MV6 A;  4OIJ A;  4J9O A;  1VQJ A;  3KAL A;  1PTO H;  1NCV A;  2NBF A;  5LMN W;  2MGS A;  4DV6 Q;  1HNX Q;  4C56 C;  4A3E G;  2W70 A;  2D2C C;  4LF8 Q;  3HOY G;  1EUJ A;  2HHH Q;  1RTN A;  2VZA A;  4EEQ A;  3D8G A;  3T1Y H;  4OEM B;  1SSO A;  1EIG A;  3N41 B;  4J9P A;  1KNE A;  2X69 A;  4A3G H;  3EJI A;  2FLL A;  1HTL D;  2LS0 1;  4RAU C;  2WAQ A;  4V19 0;  1EL0 A;  2K4K A;  1XMQ L;  4K0K Q;  4PDB A;  1F9Q A;  2UXD L;  2R92 A;  3EPG A;  2EY5 A;  3CU7 A;  1KLU D;  5EBC A;  2JA6 G;  5JJL A;  4DR3 H;  1VMP A;  2CH4 A;  4DPG A;  3NTH A;  2JXM B;  2KQ3 A;  1HA5 A;  1K3B C;  1EFW A;  5COY A;  2C35 B;  2R92 G;  1EUC B;  2J9G A;  1LT3 D;  1FNV A;  1EQR A;  1O7L A;  1K83 B;  4L8J A;  1AN7 A;  3GTK B;  1GXD C;  3RGZ A;  1B1Z A;  3V05 A;  1HNZ L;  3PF4 A;  2JA8 H;  1AE2 A;  4DA2 A;  1PH8 A;  4BBS B;  2IJ0 A;  3CCS A;  1B8A A;  1S72 A;  3Q8S B;  4IPD A;  5EKK A;  2O2L D;  1RD9 D;  2RKS A;  3HOW G;  2FK2 A;  1ET9 A;  5J2T F;  4BWS C;  3HBL A;  1OXS C;  4OWW B;  1J8I A;  2CWP A;  3MFH A;  3K7U C;  1E1O A;  4MZ9 A;  3R8B A;  1VQL A;  2XCL A;  1HCZ A;  3TS2 A;  1T5X D;  2YTX A;  1BNC A;  4DV6 H;  3K3V A;  2WAC A;  3HEJ A;  2DLN A;  1SNQ A;  2NU6 B;  2ZM6 L;  1FKA H;  1AUX A;  3MXP A;  3DF7 A;  2CQO A;  2NZH A;  2VQD A;  1STG A;  1KQS A;  3DM3 A;  4WD3 A;  1JDB B;  2JE6 I;  3TQT A;  3VMM A;  2Z6K C;  4JI7 H;  2A74 C;  4QWA A;  5EOY A;  1JE5 A;  1K83 H;  1SNC A;  1MD2 D;  4ZOL F;  3JAM c;  2BE5 D;  4YIJ A;  4GKJ L;  4HJA A;  4EQP A;  2QKI C;  3D3R A;  3PR5 B;  1MSG A;  5KG7 A;  1G91 A;  1NY4 A;  5KFX A;  3PGZ A;  1L2F A;  2LY7 A;  5COR A;  4DV4 H;  4B3S Q;  2F3I A;  4OO1 I;  2JEG A;  4XYO A;  4QY7 A;  1WTO A;  2NVT H;  4IJH A;  4X3K A;  2ZDG A;  3IFT A;  3PMF A;  1Z6H A;  5IGE A;  2XRQ D;  2PNR C;  1T5E A;  4BA2 I;  1E4F T;  3RGX A;  3VDY A;  2YU9 B;  4HMJ A;  4YWK A;  3M4I A;  3GTK A;  3W2D A;  4O3S A;  1D7Q A;  3ULJ A;  1KRT A;  4A3K H;  3GV3 A;  1IBL H;  4IN3 A;  2RGV A;  2O5J C;  1ESF A;  4WRD A;  4J15 A;  1BKB A;  2WII B;  1B33 N;  3T1Y Q;  2IMW P;  1O7I A;  1SE4 A;  2FPI B;  4ZRZ A;  1JJG A;  1I7L A;  1K28 A;  3J80 E;  2I5H A;  4OWT B;  1AFP A;  2W9C A;  3BQ2 A;  4PMW A;  1SE2 A;  4RA8 A;  2JEA I;  1TWA B;  2B2W A;  2B63 H;  3HOW H;  2NVQ B;  3NSW A;  2YCH A;  2VQF H;  4FXD A;  2IY5 B;  5IYZ F;  3H4D A;  3CAM A;  3CXC A;  3F2C A;  2FHT A;  2CQY A;  4F50 A;  1CKM A;  2DY7 A;  4JG2 A;  4ODG A;  4KTA A;  3S1R B;  1XTC D;  4DR6 H;  3T56 B;  5CMD A;  3C46 A;  3PO2 B;  1QE6 A;  2N55 A;  4DV3 H;  2C22 A;  2SDF A;  2RHQ B;  1XNQ L;  1HUM A;  4B3S H;  4DUY H;  4G7H C;  1AUV A;  3DHQ A;  3SVM A;  5HY6 A;  1YHQ A;  4X65 H;  3C1E A;  4IUN A;  4EGV A;  1EU4 A;  1TT2 A;  1E2Z A;  2NVX A;  1A62 A;  2NTT A;  1TWH A;  2VNU D;  2NVX B;  1OXX K;  2W9A A;  4C3I G;  2ZXR A;  2EY6 A;  2F0N A;  4HNT A;  5L9X A;  1RJQ A;  1G2S A;  1M8A A;  1PMR A;  1KC7 A;  5KNB A;  1NNX A;  1U0L A;  4F7X A;  1UC8 A;  5G3L D;  4GKJ Q;  1WOC A;  5EQ0 A;  5C4J H;  4ECU A;  5DG7 A;  2OQ0 A;  2K5V A;  2MJ8 A;  3L9A X;  2Q8R E;  4WJW A;  1WI5 A;  4BXX H;  4J9L A;  2R8G A;  1R4Q B;  3GV8 B;  2AQ1 B;  1NR2 A;  1STB A;  1BDO A;  1TWG H;  1WCM B;  3OIP A;  4RH6 A;  2NVT B;  3ER0 A;  1PH5 A;  4O2D A;  3MXG A;  1YEZ A;  5KFK A;  5DNF A;  3H15 A;  3FMC A;  1QCB D;  4HMI A;  1E4E A;  2PO4 A;  2W8K A;  3SI8 A;  3CME A;  3KAK A;  2X0S A;  2YYA A;  3ETJ A;  3HP3 A;  4C3I B;  4Q44 A;  1I3Q B;  4EQO A;  1B04 A;  4DV4 Q;  1CKN B;  2ICE C;  2Z6K A;  1A2U A;  3I4M G;  5KFZ A;  3MFI A;  1A3T A;  4KKT A;  3TRZ A;  1G8Z D;  4J9Q A;  3WO1 A;  4U7C A;  1Y1W B;  1Z2P X;  3MWM A;  2RGR A;  1WVL A;  2FPP B;  3QG1 A;  5CC4 A;  4KN4 C;  2B63 A;  2L55 A;  3CQZ A;  2F0T A;  2XWJ B;  2W6Z A;  2R7F A;  3MXU A;  2GPW A;  1ZYR C;  4AH6 A;  1HQR D;  3GDE A;  2C2R A;  1Q8K A;  4P75 A;  2QEJ C;  3L4J A;  2ZTE A;  5JOB A;  2SNS A;  5M3M H;  4HSV A;  1Q3L A;  5I2Y A;  2V5A A;  3GTG A;  4DV2 L;  2NVY H;  4F4Z A;  1FGU A;  2TMP A;  2R8K A;  2UUA Q;  1SR3 A;  4DR7 H;  2W6P A;  3I4O A;  1WD0 A;  1L1O A;  3FHW A;  3I70 A;  3STB C;  4J9M A;  2KOL A;  3ERQ A;  3IRB A;  2DPI A;  3MC0 B;  5C4X B;  5KT2 A;  1VQ5 A;  2VQF Q;  4KV6 A;  1D8L A;  4Z9C B;  2FK1 A;  3QOL A;  1HNW H;  2VL6 A;  1BVS A;  4X66 L;  5KFN A;  2UVU A;  1KD1 C;  1HZB A;  1SFO A;  3IKJ A;  1XMQ H;  2KCN A;  2K5N A;  5KG5 A;  1VQ7 A;  2HHH L;  2JSO A;  4JK1 C;  4LFC H;  3HOZ B;  1A0I A;  1HNX L;  4XDX A;  4DV7 L;  2E2I H;  3GV6 A;  4BA1 I;  4DV3 Q;  3CC2 A;  1D2B A;  4NLG A;  4DF7 A;  3RN2 A;  3SEB A;  4OO1 H;  4B3M H;  4FBT A;  2BH2 A;  2F0D A;  5C8Y F;  4DR4 Q;  4RB1 A;  1E4E B;  4DV1 L;  2L0C A;  2UXC H;  1TWA H;  2R8J A;  1N48 A;  3GQB A;  4DUZ H;  4RCO A;  3J7A 5;  3T16 A;  4MTK A;  3G48 A;  4G7Z C;  1VAJ A;  3CCL A;  3J81 E;  4K6L A;  4A3J H;  4MV9 A;  2RBM A;  3QWN A;  3KF8 B;  4ZHQ F;  4GC6 A;  1AEX A;  1X3F A;  3K57 A;  4A3K G;  3MWE A;  1N32 Q;  3RTX A;  1JOO A;  1CUK A;  1M7J A;  5IWA H;  4YCU A;  2YS6 A;  1S5D D;  2UUC Q;  2GLT A;  3VR3 A;  3GTJ H;  3R23 A;  3W3A A;  4R4O A;  5CV7 A;  3GTM B;  1WH2 A;  2YU9 H;  3CCU A;  2FPG B;  1KDB A;  4YWM A;  3N40 P;  4EFE A;  2UUB L;  4TQR A;  2RVL A;  4A3I H;  5A2Q W;  1BCP B;  3E0J A;  2AQ3 B;  3MVV A;  3VYU A;  3N8D A;  2RF4 A;  4AQY H;  2KSW A;  4J6H A;  2XIG A;  1SN8 A;  4B3R H;  1A3V A;  5LL6 S;  1HNW Q;  1PTO F;  1PX2 A;  2F4V L;  5ELO A;  1YJN A;  2YZG A;  3E9I A;  4NXN H;  1GUO A;  4DAP A;  3HOX B;  2VW9 A;  3TME A;  1J9O A;  3N52 A;  1KIX A;  4YBZ B;  2BQ3 A;  1C48 A;  5D8D A;  3V6K A;  2VPS A;  1JJ2 A;  2RSN A;  3RD4 A;  1EWC A;  2Z1C A;  1HPC A;  5LMU Q;  3MR6 A;  2E2H B;  4XIG S;  4AYB B;  3KLS X;  5KG6 A;  5M5Y B;  4RU9 A;  4A76 A;  4LF9 Q;  2F0L A;  4C3J G;  2F0M A;  4RZR A;  2OLS A;  4CDD C;  3BA9 A;  5KFV A;  4K6D A;  4FBU A;  5GAH C;  4X62 Q;  1LT6 D;  1WCM G;  1LT5 D;  4CJ2 C;  4RHR A;  1PH2 A;  3IL8 A;  1H9S A;  1EIY B;  2BDO A;  3RMH A;  2KHI A;  4EG0 A;  3K59 A;  5KND A;  1VBH A;  1GO3 E;  1TR5 A;  3G6J B;  1N8R C;  4X65 L;  3FDT A;  4KHP Q;  4QCL A;  5FJ8 H;  1TWC B;  4IUT A;  5LMN H;  3SK4 A;  4LF4 Q;  1E1T A;  4A3L G;  4NXM H;  1T3N A;  5BR8 L;  2L15 A;  3NEN A;  4J9K A;  3BJY A;  5KFB A;  2RDI A;  1QNK A;  2DN8 A;  1BO0 A;  1DGS A;  5IGB A;  3GID A;  1ILQ A;  1GHJ A;  1S40 A;  1STN A;  3CF5 A;  4BBS G;  5G3L F;  4V0B A;  4YY3 H;  1EUD B;  3VR4 A;  5FPR A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  3JAM L;  1F9R A;  2L12 A;  3FDS A;  4Q43 A;  3E5S A;  5KG3 A;  4DL2 A;  2KEE A;  4DAY A;  2R92 B;  1I7N A;  5C0X H;  4DR3 L;  4I7H A;  3PIP A;  5DGB A;  1L0W A;  3TEH B;  3EBE A;  2WB1 A;  4B3M Q;  3G6X A;  1MJC A;  1I5F A;  2KEC A;  5LMU H;  1EIF A;  4HAE A;  2JA7 G;  1SAP A;  3H0G H;  1SYB A;  1TA8 A;  2ATW A;  3S2D H;  4O4H F;  4GOP A;  1ZHS A;  2ZXO A;  2X6G A;  3GTM H;  5HV6 A;  1IOW A;  1NMF A;  1P16 A;  3UDI A;  3H20 A;  2DJG C;  4XT3 B;  3WDN A;  3G71 A;  1C3O A;  2E2H A;  1SDF A;  5HUR A;  2R7Z H;  3Q8R B;  3I4N G;  4LMY A;  5KFM A;  1JB3 A;  4JI2 Q;  4XYM B;  3HOY B;  5HBR B;  4FS1 A;  3N6R A;  2MHV A;  1Q7Y C;  1C7Y A;  4DV2 Q;  1KJ9 A;  4C3H H;  3GTO A;  1V1P A;  4FXK C;  3RIZ A;  2EYL A;  3M4P A;  3OTO L;  3FKI H;  4IAL A;  5FO8 B;  4WFN 3;  4DL4 A;  3PQI A;  4LF4 H;  1DV2 A;  3QR8 A;  4RAZ A;  3NQI A;  1TS4 A;  3BYY B;  2Y0S E;  1A6X A;  1JT8 A;  5EGT A;  1PFM A;  3NBI A;  1AP0 A;  3NE5 B;  2A1A A;  2UUB H;  2HDM A;  3OMG A;  3KF6 B;  3CCV A;  2H4O A;  4QQB X;  2VPQ A;  2EY1 A;  4AQY Q;  2UUA L;  2ZDQ A;  3KF6 A;  2VQE Q;  2RCF A;  2M05 A;  4GLA C;  4BY7 G;  3WO0 A;  2H1E A;  4ILW A;  4YR2 A;  1DXM A;  5FOB B;  3MHB A;  1PRT F;  4QJF A;  1FR3 A;  2B8F A;  2HIV A;  4ZUI A;  3K5L A;  4IRD A;  4L5S A;  2BOS A;  1S03 G;  1O78 A;  2PNH A;  2TSS A;  4ME6 A;  5DG8 A;  1ZXT A;  3JZI A;  3KBX A;  4DXG A;  4DU9 A;  2FLP A;  4ZKC B;  4KHP L;  4HJ7 A;  3VPC A;  4LF7 H;  5ELN A;  1JLL B;  3S17 B;  3CHB D;  2N88 A;  3JC6 6;  4H7B A;  2WP8 J;  4DNT B;  3S1Q B;  1PK8 A;  3I8Z A;  5E7N A;  1XMO L;  1S10 A;  3F2U A;  2UVW A;  3UI2 A;  2F0G A;  1EY6 A;  4BBR G;  4DK3 C;  3NBH A;  2FMA A;  4X62 H;  2ASB A;  4ECQ A;  1M6V A;  5JVD F;  3SHL A;  2KED A;  4P72 A;  1XMO H;  2K33 A;  1FYC A;  2Z6B A;  3M9B A;  4HCE A;  3VA7 A;  3RR5 A;  4DV2 H;  4OX9 H;  3LGJ A;  2Z4I A;  3NUC A;  2DZD A;  4BXX G;  2EZV A;  4ME5 A;  4LUV A;  2JA6 B;  2R6F A;  3EYY A;  3LWB A;  1VKZ A;  2K5D A;  3ULP A;  2A69 C;  4LFA H;  1KLG D;  3N42 B;  4UP7 A;  4CGY B;  3HOW B;  4OGQ C;  1F2L A;  3JRW A;  5EWG A;  3CCM A;  1RYS A;  4JYA H;  2HCI A;  5K36 G;  1B70 B;  1EY9 A;  4JI0 H;  4ECV A;  2Q2H A;  3S16 B;  1EYZ A;  5KFP A;  3D4D A;  1GD7 A;  1HR0 Q;  3X3N A;  2H5X A;  2ZDH A;  3J7A F;  1AZQ A;  4LFA L;  1ROD A;  2HQE A;  2RHS B;  3CPW A;  1PDQ A;  4BBR B;  1QIL A;  3GTO H;  2K5H A;  1S0O A;  4CDC C;  1O80 A;  4MV1 A;  2Y0S G;  5IT9 W;  5LP6 F;  1YNJ C;  1N32 L;  4HNV A;  3K5H A;  2N49 A;  2IW3 A;  4DV1 H;  2WKC A;  2N78 A;  3S2D B;  4QB4 A;  5IP7 H;  4JI8 Q;  1UE1 A;  4XX0 B;  4MIU A;  1ULZ A;  4A2B A;  3T1H L;  2C00 A;  4N8F A;  5EWE A;  5KYL A;  1X9N A;  4ECX A;  1XMO Q;  2EYP A;  2E75 C;  5IGF A;  3A7L A;  2EYF A;  3NBH B;  5LL6 X;  4ECW A;  1LYL A;  1TS2 A;  3AYH B;  3OIQ A;  2E2I B;  3K5M A;  1C30 A;  3QO2 A;  3J80 L;  4IUU A;  4JI6 Q;  1WTH A;  5FLX L;  4IZO A;  2YU9 A;  2DNE A;  1JIC A;  4DKA C;  3R5H A;  4POF A;  2LXJ A;  3I72 A;  1CQJ B;  2EYH A;  1HA6 A;  2PMZ E;  5F9L A;  4BBS H;  2UUB Q;  3J80 c;  1WFQ A;  5IGG A;  5JVL A;  1GOZ A;  3PUZ A;  4A3J G;  1NAP A;  3TP7 A;  5ELB A;  1JC7 A;  4AQY L;  1Z2N X;  2JEF A;  5I6W A;  4O3Q A;  4YAK B;  3CKI B;  3F1Z A;  3D6W A;  4DGZ A;  3SK8 A;  5AJ3 Q;  4A3E H;  2IP4 A;  4C2M H;  5KFG A;  2DIK A;  2V58 A;  4EVO A;  5EKL A;  4YHH H;  4KY7 A;  4LF7 L;  2B2Y C;  5M3M B;  3GTG H;  1SYF A;  4C3I H;  3H0G G;  1DV1 A;  3E3X A;  2WYO A;  4B3T H;  1Y1V G;  3L0O A;  1WD1 A;  1VBG A;  4KI0 A;  3VYR A;  1CKN A;  1GSH A;  4P73 A;  3V4Z A;  1PYW D;  4ED6 A;  3CCJ A;  3UDX A;  4DV1 Q;  1K1S A;  1FNU A;  5BPF A;  2J6T A;  3J7A K;  5FLX E;  1RF2 D;  3VR6 A;  4CKB A;  5CYU A;  4QIW E;  4DR5 L;  2JA5 H;  2I46 A;  1JDE A;  3I7F A;  1ENF A;  1CA6 A;  2BR0 A;  4UCS A;  2KCC A;  4C1N K;  1PLF A;  2NWG A;  1AE3 A;  2EJM A;  3KUP A;  2PVP A;  2UU9 Q;  4GLX A;  1LTS D;  3FRP B;  4R4Q A;  4O3O A;  1WTW A;  2P0A A;  3Q1K A;  4ECS A;  3QB3 A;  1K8G A;  1VQP A;  3EIV A;  1DZ1 A;  1S4Z A;  1SMX A;  1EY5 A;  2DUD A;  3A8I E;  4X66 H;  3K3P A;  2IPK D;  1GUN A;  4TVA B;  1VS0 A;  4FXG C;  3RAX A;  3MTS A;  1TY2 A;  1G2T A;  4XXE A;  1RJT A;  5GAE C;  4IOA A;  3T5L A;  2W9B A;  1ICF B;  1GSO A;  5JPN C;  1SNO A;  4LJZ C;  4FS2 A;  5I4D A;  1B9N A;  1FGB D;  3ONA B;  5KFF A;  4A3M B;  3S17 H;  5EDW A;  4R8I A;  1SFO B;  2VS1 A;  4ED2 A;  1KAA A;  3C3L A;  4WOR A;  2VUG A;  3GTL B;  1QVF A;  4E4T A;  2EJG C;  4HTH A;  2NN6 G;  3PW2 A;  5C3E H;  4O3R A;  2K52 A;  4JI5 H;  2NU8 B;  5C0X J;  4ALP A;  2R7M A;  3D31 A;  3H6M A;  5A2Q E;  3TBI B;  2E5L L;  1EZ1 A;  1K0S A;  5KFD A;  4HR7 B;  4JI8 H;  1NSN S;  4JI3 Q;  5JH7 F;  1PRT D;  1ZKO A;  4RFB A;  2Q8T A;  3BQ0 A;  1B4O A;  1IBK Q;  1KBL A;  4LF6 Q;  4DR5 H;  1QJO A;  2HQL A;  4DAM A;  4TV9 F;  4YQW A;  4LF9 L;  3CD6 A;  2L1B A;  3CCQ A;  1N33 H;  1LTG D;  3HKZ B;  3KF8 A;  1BXR A;  2PQA B;  4GKK Q;  3HKZ A;  4A2A A;  5IP9 H;  2R85 A;  2EJF C;  4A3B H;  1JIH A;  1T9H A;  3SXH A;  3PO2 H;  1KJI A;  2BDN A;  4MA0 A;  2UU9 H;  3I3C A;  1JWM D;  4XQJ A;  1ML0 D;  3U50 C;  1ASZ A;  3FVQ A;  1CZG A;  2J7Z A;  3RLN A;  5J3B A;  1EHI A;  3FMA A;  4FDB A;  3NWS A;  2R7Z B;  1EQQ A;  3VPD A;  2LSS A;  5EJW A;  4GN5 A;  2UU9 L;  4IRK A;  1OTC A;  3PO3 H;  3JRX A;  1VQI A;  1I3Q H;  2Z8L A;  1BUV T;  2N3S A;  4HJ9 A;  2XRS D;  3T53 B;  3R5X A;  1UE5 A;  1SYE A;  2WAQ E;  4NB3 A;  1Q46 A;  1XNQ Q;  3EVQ A;  1KDA A;  2W6Q A;  4M7E A;  2XNA C;  3NXW A;  3DMU A;  5JPM C;  3W5O A;  1N34 L;  1CT1 D;  4Q5V A;  3HXL A;  5CV8 A;  4B3T Q;  5FO7 B;  3SR1 A;  2ZJQ A;  5EAY A;  2W6M A;  4JI5 Q;  2JA6 H;  4LFB L;  1VDZ A;  5KG1 A;  3NGD A;  4NXN L;  1HFN A;  3UE0 A;  1I94 Q;  2ALZ A;  5ISR A;  2B8G A;  1Z9F A;  1I4X A;  3GIK A;  1VQA A;  3G6E A;  1Q12 A;  4ZK9 B;  4ECT A;  5HGT A;  5KKN B;  4JPB W;  4YCW A;  4F8M A;  1FJG Q;  2QCP X;  3KYH C;  1PH6 A;  4YCV A;  4UFZ A;  3H91 A;  4JI4 L;  1TWC H;  2W7O A;  3NEL A;  3NQT A;  5C1P A;  2R3Z A;  2DJF C;  3G7L A;  3KAJ A;  3L2P A;  1R4P B;  2KVM A;  2NZO A;  5KFW A;  1WCM H;  4FF3 A;  3E6Z X;  2R82 A;  3K7A H;  5M3F G;  3T5K A;  5T1I A;  2Q2T A;  3KLW A;  5BN4 A;  1SJE D;  2VOB A;  1I4G A;  1J5E Q;  3KHH A;  1JWU D;  1NMG A;  5JVG 3;  3Q24 A;  1B2T A;  4U6P A;  2VQF L;  1K8A C;  3H94 A;  5GAG C;  3CC4 A;  1XNR Q;  4X6A H;  1MIU A;  2AGP A;  3S24 A;  1Q1B A;  3MFG A;  3S1M H;  1NBW A;  1PYS B;  3U58 A;  4A4I A;  2E2H H;  3KK7 A;  5EKI A;  3MAQ A;  2BCO A;  2D0O A;  5H1S E;  5C1O A;  1TVX A;  2FLN A;  4JI8 L;  4JW0 A;  4PZ6 A;  5DEH A;  2XTI A;  1Q81 C;  1KJJ A;  2C2D A;  3C2P A;  4QIW B;  1PV4 A;  2A68 D;  3RB3 A;  2NVQ H;  3OWE B;  1LAB A;  1OXU A;  3GO5 A;  3BYT B;  1BGW A;  2HHH H;  4HCS A;  3PO3 G;  4J0M A;  1EOV A;  3V6J A;  2EYJ A;  4OX9 L;  1SJH D;  1Z2O X;  2K6A A;  2I80 A;  4JI3 H;  2PZU A;  1M0T A;  2EXZ A;  2OEO A;  1KXL A;  4EBE A;  4NP5 A;  2Z0S A;  4EYI B;  1C9O A;  1ONL A;  1PZI D;  5I47 A;  1PH9 A;  4KJN A;  1STA A;  1YVC A;  3RV4 A;  3CCR A;  5FD5 A;  1BCP F;  5KGU A;  4M1U B;  5KFS A;  4DXF A;  3HKZ E;  3GV7 B;  5JJK A;  1HZC A;  3J80 i;  2HD3 A;  1WJJ A;  5GAD C;  5FD6 A;  1YZ6 A;  3R93 A;  1YHB A;  3MXN A;  3VA5 A;  1FNW A;  3T5J A;  3KLR A;  5IT9 c;  3BVM A;  5FKA C;  4EFB A;  1Q1E A;  2G9D A;  1NR4 A;  1DOM A;  4ZAI A;  5TSS A;  1UUP A;  4K5W A;  4QWE A;  1JX4 A;  3CP0 A;  3S2H H;  1VQH A;  2QK4 A;  4N9T A;  4R7R A;  3ERS X;  3GTP H;  4KD4 A;  1QZH A;  2PW5 A;  4NMZ A;  2R6G A;  1CQI B;  4ED8 A;  1CTM A;  1EIH A;  1S9F A;  1LT4 D;  4JV1 A;  1EY8 A;  1QVC A;  4JV5 H;  4POG A;  3JSL A;  2L9H A;  5CB4 F;  1QWY A;  4LNQ A;  4KD3 A;  5C5M A;  3T4A C;  3A5Z B;  5CV4 A;  1PYB A;  1G6Z A;  3MA2 B;  4B9W A;  1BR9 A;  2F0O A;  2CH4 W;  3GD7 A;  2HVS A;  4IPC A;  1PTO C;  3Q23 A;  1I6H H;  4HQ6 A;  2AWN A;  4K5V A;  4QIW A;  5D14 A;  4K2K A;  3SK6 A;  1N56 A;  1STE A;  4ZKB B;  1PRT C;  2EQS A;  1FJG H;  1F2Y A;  1S3O A;  3L3O C;  3CC7 A;  2XGP A;  3I4L A;  3DM1 A;  2XCP A;  3BDO A;  3OHA A;  2PN1 A;  2RSO A;  1SBB B;  2UXD Q;  4H13 C;  3HRZ C;  4PZ8 A;  1DM0 B;  4QW9 A;  4A3F H;  1LAC A;  1D1K A;  1ZHQ A;  4Y7N B;  1HXY D;  3NTI A;  4IOC A;  2JYO A;  1EY4 A;  4BY1 G;  1TWF H;  2A8V A;  1YNJ D;  3X3M A;  2J6U A;  1WTP A;  3R2I A;  3J81 L;  1S97 A;  2DWC A;  4ED3 A;  1TQO A;  4YB8 B;  1LTR D;  3TSS A;  2M9V A;  3M3Y B;  4Q8F A;  3KJP A;  1LTA D;  3N43 B;  3K80 C;  1JE4 A;  2JA7 H;  5BMV F;  1KL9 A;  4I7Z C;  2MPM A;  4A3I B;  5D65 A;  3RF2 A;  4DR6 L;  4WJ3 M;  3PW4 A;  3K58 A;  1V9P A;  1E4G T;  3N6X A;  2A6E C;  3K5O A;  4RWS C;  2K32 A;  1X3P A;  3STB D;  3ND8 A;  3A8K E;  2JA5 G;  4JBK A;  1DOK A;  2NN6 I;  1S68 A;  4JC0 A;  3ZJY C;  4IR1 A;  4ECY A;  5CA1 F;  4MHE A;  1LTB D;  4B3T L;  5IOD A;  4PV1 C;  3KJO A;  5KFR A;  2M2L A;  3RLO A;  3I4M H;  1OXT A;  1SNP A;  2V59 A;  4M8A A;  2PZW A;  4GZY C;  2FMM A;  1O75 A;  1EQT A;  1HR0 L;  3H40 A;  2C5C A;  2XSC A;  3D0F A;  5KFY A;  3D4W A;  4C3J H;  4KHZ A;  4OHJ A;  4BY1 B;  4Q45 A;  4RUC A;  2OF1 A;  3GIJ A;  5K5P A;  3EFX D;  4X65 Q;  4RB0 A;  4NPS A;  1JKJ B;  3WOF A;  3HOZ H;  4AYB G;  1SCU B;  1AN8 A;  3U4Z A;  5IIF A;  1B53 A;  2XC9 A;  4DL5 A;  5FLX W;  3DEO A;  2E2I A;  5M5Y H;  4JV5 Q;  3T5H A;  1TWF A;  5IYC H;  4R4C A;  1I6H B;  1TS3 A;  4OIK A;  1D5M C;  3UDF A;  5A2Q L;  1SE3 A;  5CAE B;  4I7A A;  2OXP A;  4O0A A;  1BCP C;  5JJI A;  2MP1 A;  3AQQ A;  2IWH A;  3IAY A;  1N33 L;  4GLV B;  3CVZ A;  1HJP A;  1QOH A;  3Q22 A;  3HKZ G;  2F0W A;  1X3G A;  1YNN C;  4ZQI A;  3CQZ H;  1A3U A;  1IKM A;  3HGB A;  3M9M B;  4C3J B;  3H4B A;  4HIK A;  2IX1 A;  2B2T C;  2G9H D;  3EQL C;  4J9S A;  2FK3 A;  4YAJ B;  2R61 A;  1PRT B;  1DIK A;  3H3V I;  4JOI A;  4DNR B;  1Y14 B;  3J81 j;  1V51 A;  1WYD A;  2K75 A;  2R7N A;  4HNU A;  4A3K B;  3P7J A;  3RZO B;  3GTL H;  3RZO H;  3MR2 A;  4MA5 A;  3W1B A;  4I55 F;  1K1Q A;  2A69 D;  4EQN A;  1MJE A;  3PIO 3;  3Q6S A;  1STY A;  4HSP A;  2K04 A;  1WTX A;  3LWE A;  1I50 H;  5JAV A;  2B63 B;  1A2T A;  1RHP A;  2YZN A;  1EY7 A;  1D5Z C;  3TQY A;  1KTK A;  4K8J A;  5CBE E;  2FE3 A;  1FL0 A;  2JEJ A;  2B39 A;  4TSS A;  3DEP A;  3GTG B;  2AWO A;  2L11 A;  1Y1V B;  4GOP C;  5FLM H;  2R92 H;  4YJ3 F;  2IBK A;  4B08 A;  2KEN A;  2PPB C;  1AZP A;  3VR5 A;  2FJ2 A;  1HNX H;  1OXV A;  2CFM A;  2KBN A;  2XIW A;  2KA7 A;  1IOV A;  4LUO A;  3A7A B;  4LSX A;  5C6A A;  3QOJ A;  1HTP A;  2SEB D;  4OON A;  2CHB D;  4A93 B;  5L1K A;  3PR4 A;  4EBC A;  1RIP A;  4A3F B;  4A3J B;  3RZD B;  2ZJT A;  4K0K H;  1YJ9 A;  1TKW B;  4KKU A;  2Y0S A;  1PXU A;  4LH6 A;  2IHE A;  4IR9 A;  1SYG A;  3ITP A;  1ENA A;  4JI7 Q;  2VQE L;  1Q90 A;  2M00 A;  5C3E G;  4DR3 Q;  2YYZ A;  5IP7 G;  4RMF A;  3KDF A;  5KG4 A;  1W6J A;  1XTD A;  1I6V C;  1W93 A;  1BQQ T;  1CE8 A;  4KK7 A;  4EX5 A;  1KDC A;  5M3F B;  4BY1 H;  4HR7 A;  5M3M G;  4XQQ A;  4C2M B;  1LV9 A;  4K8I A;  1C0A A;  4ZI7 F;  3GV5 B;  4XYQ A;  2F0V A;  3JSN A;  2V4Q A;  2UXC Q;  2IX3 A;  5DLG A;  1E7Z A;  1VF7 A;  3S1R H;  1MKH A;  2AUK A;  5CR3 A;  2WV6 D;  3SE0 A;  4CKC A;  1PFS A;  3I4M B;  3OOC A;  2EIF A;  2JN4 A;  3MWY W;  5LL6 b;  5M5W B;  4JI6 L;  2CVR A;  4L5T A;  2I07 B;  3RUZ A;  4UCO A;  2E74 C;  5T14 A;  2WB1 E;  1JMC A;  3HOU G;  4H0L C;  1KAB A;  4UY8 C;  2W9B B;  3GIM A;  1R9T B;  1T94 A;  5T1G A;  4B3M L;  2OCE A;  4TRD A;  4J9N A;  2VB3 X;  3L7Z C;  3PV0 A;  2ZXP A;  3FPP A;  4EBD A;  2MCT A;  2VUM H;  1BNZ A;  1L1O B;  3RV3 A;  4DR2 L;  1EQV A;  1EYD A;  2YS7 A;  3MJF A;  4YR3 A;  5L1J A;  1TS5 A;  3BZC A;  3OSN A;  3LX0 A;  5IYD G;  1IZ6 A;  3UDG A;  3GLK A;  2K1B A;  1Y8O B;  2XN9 C;  1MHW C;  4Q8E A;  1IKL A;  1BBU A;  2IA6 A;  5KRU A;  4C5C A;  1PTO B;  1EFI D;  4RCN A;  2Y0S B;  4IO9 A;  2R7Z G;  2MFI A;  1PA6 A;  1EU3 A;  3E5N A;  2F0K A;  4JI0 L;  3GTP B;  3S16 H;  2W8L A;  3TZU A;  4QL5 A;  3OW7 A;  5JQW A;  3PIP 3;  3HKS A;  2VA2 A;  4G4K A;  4EYH B;  2AUJ D;  1EYC A;  1WTR A;  1DON A;  2UVV A;  2GPS A;  4RG1 A;  2I87 A;  2SCU B;  5DQI A;  1IW7 C;  2O4X A;  1UC9 A;  3OUZ A;  3H3V C;  4IFD H;  2R8H A;  1TWC A;  4L5Q A;  2F0U A;  3I55 A;  2B2T A;  1M4V A;  1XX8 A;  3PCO B;  4JYA L;  1QG7 A;  3ETH A;  3GTQ B;  3S14 H;  3KHL A;  1PHJ A;  3BAB A;  2FJZ A;  2JQO A;  4FVM A;  3H09 A;  3AFQ A;  4YP3 A;  1F2Z A;  2F4I A;  4IFD J;  2O5I C;  1XNR L;  2F3W A;  2ASJ A;  1IHZ A;  2AKW B;  5JUM A;  1SYC A;  2V1C C;  3LML A;  2R84 A;  1R9T A;  2JA7 A;  2VY3 A;  5KFI A;  1EEI D;  4DAY B;  3BS1 A;  1MI2 A;  3S1Q H;  2ASD A;  3M4Y A;  1E24 A;  1KJQ A;  5DLQ E;  4A3D H;  4C3H B;  5LA6 F;  3IFD A;  2W71 A;  5KFQ A;  3NPP A;  4DN4 M;  3A0J A;  4DR6 Q;  3K5I A;  4ED0 A;  3C0F B;  5CGK A;  5BPH A;  1ESR A;  3TDQ A;  3GTQ H;  1LO5 D;  4RB2 C;  4XZ3 B;  2JEI A;  1FJG L;  1MSH A;  4A3L H;  4A93 G;  4HJ5 A;  1TWH H;  3VR2 A;  1EYG A;  5KEE A;  2MUY A;  2CW7 A;  3M7G A;  2LXK A;  3UE1 A;  3Q8D A;  1HHV A;  1TII D;  4BBR H;  3T51 B;  4JI7 L;  2KHS A;  1WSC A;  4OWX B;  2AU0 A;  1A9X A;  1N34 H;  4MV7 A;  3J81 c;  1G29 1;  3HS0 C;  3I2Z A;  4LMQ D;  1PH7 A;  3GQC A;  2A73 B;  1CI3 M;  1H9S B;  3PF5 A;  4DL7 A;  4K5X A;  4MN3 A;  2C9O A;  5BN5 A;  1VQE A;  2FP4 B;  4AYB E;  4GKJ H;  3MFY A;  4RB3 C;  4B3S L;  2D5D A;  3BZD B;  1QZG A;  4DK6 C;  5I9O A;  2HIX A;  1N36 Q;  4DR7 Q;  1XDN A;  4UDU C;  2WTF A;  3GIL A;  3PZP A;  4UCT A;  2B63 G;  4MTD A;  2K01 A;  3RBE A;  1FD7 D;  1SLJ A;  5CA0 F;  1LTI D;  2KCM A;  5E4W C;  3JAM E;  3G8C A;  4ZYS A;  3HG9 A;  2QW7 A;  3I73 A;  3U9T A;  2OT2 A;  2MO1 A;  4IFD I;  2CZG A;  4JI1 L;  2R93 G;  5C4J B;  2VQE H;  2WAQ B;  2WFW A;  3CRL C;  4QMG A;  2NYZ D;  5FPO A;  4TUY F;  5F9N A;  3M4O H;  3ZYY X;  3E0E A;  4YWL A;  1WTQ A;  4UCU A;  1VQB A;  2HDL A;  5K36 H;  2RDG A;  2JA7 B;  3KBG A;  1VQD A;  3ND9 A;  3KFU A;  1NE3 A;  4DK0 A;  2JJQ A;  1N9W A;  2BH8 A;  4A3C H;  3J7Y W;  3MWD A;  3SK5 A;  1HUN A;  2G5D A;  2Q2I A;  2JA8 B;  4G3I A;  3TRE A;  5GRO A;  1ZQ7 A;  1VQK A;  1IBM H;  4KN7 C;  1K8O A;  1C8C A;  1ET6 A;  1E3P A;  3TP6 A;  1CM9 A;  1M0W A;  1JCK B;  3J81 W;  5ELF A;  1PZJ D;  1DJR D;  2A5H A;  4LK1 C;  1B3A A;  3UFX B;  4J8Q A;  1V1O A;  4DV5 Q;  2QEX A;  5J39 A;  4Y8V B;  4ED7 A;  1SFO H;  1LTL A;  2F03 A;  1VQM A;  2HGS A;  3LP8 A;  2K05 A;  4PWQ A;  1P8L A;  1BOS A;  4J1M A;  1HNZ Q;  2RQX A;  2NUC A;  2QA4 A;  1GUT A;  2F1M A;  1XJV A;  2MQH A;  2K14 A;  3GTO B;  5DQG A;  2DPJ A;  4QWD A;  5ELD A;  4YY3 L;  3PUW A;  1DOL A;  5IYB H;  5E4X A;  1TWA A;  1VQO A;  3S15 B;  3GII A;  1PH3 A;  1VQ8 A;  4A3B G;  2R93 B;  2YL2 A;  3GTJ A;  1UE6 A;  4QF4 A;  2HVR A;  4YJ2 F;  4I50 F;  5L1I A;  1I4Q A;  5A35 A;  4IUV A;  3I12 A;  3D6C A;  3HOY H;  4F4X A;  4JBJ A;  4A3M G;  1A8V A;  2RDJ A;  1VQ9 A;  5FK9 C;  1B6R A;  3T13 A;  1JB7 A;  1B6S A;  4QW8 A;  1A15 A;  4X3S A;  2XCA A;  3ICE A;  4NW2 A;  2QF7 A;  1KAW A;  4XQN A;  3HOX H;  4DV6 L;  3IN5 A;  3H0G B;  3OHB A;  1VQN A;  2DY8 A;  2QDB A;  1E2W A;  4JI4 Q;  4JV5 L;  5LXT F;  1Y1V H;  3HOX G;  1FVI A;  2J4X A;  3ORQ A;  2RDH A;  1QB5 D;  1F77 A;  4X64 L;  3BG5 A;  3NP8 A;  3K0Y A;  5L37 A;  2AMC B;  5M5X H;  4IWY A;  1IW7 D;  3MEH A;  4A3E B;  2B2Y A;  1D6E C;  5L1L A;  3I4N H;  4IZ8 A;  3TZD A;  2E76 C;  1IBL Q;  4LH7 A;  4KHP H;  3Q8P B;  3PUY A;  3HOU B;  5FLX c;  1Y69 U;  3HOZ G;  1N36 H;  5M5W H;  4DV0 Q;  3NEM A;  3QJY A;  5C3X A;  3F8N A;  3FKI G;  1ZYR D;  4ZLT F;  4FYD A;  3U4V A;  3VYT A;  4L5R C;  4DUZ L;  1QUQ A;  2KHJ A;  1J5E L;  1KC8 C;  2E2J H;  4LF5 H;  3DUZ A;  2HUG A;  1YI2 A;  5KFH A;  3RB6 A;  4RNN A;  3K7A B;  3SDZ A;  1KEE A;  1YNX A;  4R9W A;  4N9P A;  2B2V C;  4ETS A;  2F0J A;  3PUX A;  1PH4 A;  4FNF A;  1SYX B;  3TS0 A;  3RNU A;  3DLL A;  4YHH Q;  5IYB G;  2VB2 X;  3ULL A;  1M1K C;  2V4R A;  2HVQ A;  4MAM A;  3AFP A;  3T1Y L;  1Q82 C;  4DUY Q;  2VR1 A;  3QIA A;  2B2W C;  4HJ8 A;  1CSP A;  3D4R A;  2I8C A;  4LF9 H;  2FKL A;  3PW5 A;  5JEA G;  1IBM Q;  1JXL A;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  4HED A;  5IYD H;  5JEA H;  1PZK D;  3OW2 A;  3BA8 A;  1J6Q A;  3I56 A;  1IYJ B;  1YJW A;  2A19 A;  4X3U A;  2K28 A;  4A3M H;  1E22 A;  3AMU A;  3H0G A;  4DV5 H;  4LF6 L;  5J22 A;  1L0X B;  1IBK L;  4IHJ F;  1CQF A;  1ASY A;  5GQO A;  4LFC L;  3RB4 A;  5C5L A;  1HNZ H;  4U68 A;  4H02 A;  1Y8P B;  5C0X I;  4HIM A;  4NXM Q;  4A3G G;  4XTC S;  2AGO A;  4GN3 B;  1IYU A;  1TWG B;  4ABN A;  2ES2 A;  2PBZ A;  3RJ0 A;  3HOV H;  4N8X 1;  4RGM A;  1JQY D;  1WR2 A;  3QFF A;  1B44 D;  4DV0 H;  4WJ4 A;  3HOV G;  2KUM A;  4NDX A;  4RGN A;  3RLF A;  4F88 A;  5HGQ A;  5DM6 3;  4FO2 A;  3PIO A;  2F0F A;  5FLM G;  1Y1V A;  4JUZ A;  3A8J E;  4DV4 L;  3M4Q A;  4JI3 L;  3K5N A;  1GM5 A;  3P75 A;  4LF5 Q;  2EOT A;  2CW0 D;  3CW2 C;  3TQ1 A;  2LFN A;  2ATL A;  3URY A;  2B3G A;  1GKH A;  2B29 A;  2L4N A;  4BWG B;  3R2T A;  2I5M X;  4PMB A;  1WCM A;  1II3 A;  4IJL A;  2Q2U A;  4LFB H;  1B3Q A;  5DQH A;  3J80 W;  5CV5 A;  1GUG A;  1L2Z A;  4NXM L;  4A3B B;  1K0R A;  1Z7T A;  3KLS A;  5IT9 E;  2A68 C;  1X3E A;  1EWI A;  1RTO A;  5KFL A;  1HH2 P;  4H44 C;  5J2U F;  1XXG A;  1GYF A;  1UAP A;  4JVZ A;  3V2T A;  1JOK A;  4JI4 H;  1ENC A;  4F87 A;  5KT4 A;  3PO3 B;  1I3Q A;  4K14 A;  1DYQ A;  2YRW A;  1XPU A;  4HID A;  1C4Q A;  1B9M A;  2F0I A;  4A3D G;  2OQK A;  2PQA A;  1CZW A;  2F3V A;  4FF4 A;  1JOR A;  1XPO A;  2W6N A;  4JI2 H;  3A55 A;  4ZQ3 A;  2K5Q A;  2XWB B;  1SE8 A;  1O7Z A;  1JR0 D;  5I9P A;  3U9S A;  4IWX A;  3RFC A;  4OX9 Q;  1SRO A;  1U9R A;  2E5L H;  1M90 C;  4ED1 A;  1OO9 B;  1KRS A;  1LLR D;  4YHH L;  2AQ4 A;  2I0Q A;  4K2L A;  1I6U A;  2UUA H;  4R8U B;  3GP7 A;  3ORR A;  5CV9 A;  4R8U A;  1RDP D;  4LWC A;  5KNC A;  5BN3 A;  2YTY A;  2ICI A;  2NB0 A;  1N36 L;  4LAA A;  1VQC A;  1U4M A;  5KFT A;  1XMQ Q;  4K0K L;  1SEI A;  4RZQ A;  3KTM A;  3RN5 A;  2FXQ A;  1UEA B;  2BA0 A;  1XNQ H;  2GA4 B;  4LFC Q;  1V4Y A;  1RK5 A;  5KG2 A;  1HR0 W;  1NUC A;  5DG9 A;  1HR0 H;  2I5L X;  4DFA A;  2J6S A;  1V8Q A;  2AQ2 B;  2LMC B;  3NK9 A;  4AYB A;  1S5C D;  3PO2 G;  3GTL A;  5IE8 A;  3GIP A;  4DR4 H;  5IGD A;  1X54 A;  5LMN Q;  4XYL B;  3GTP A;  1UEB A;  1LTT D;  1VQG A;  2K7V A;  5CBA E;  5AJ3 L;  1IBM L;  2VUM A;  2VUM B;  5JJZ A;  2B2V A;  2YRX A;  4DUZ Q;  5D1P A;  1Z47 A;  2ZM6 H;  2B2U A;  2EXD A;  4X64 Q;  1Y8N B;  3V6H A;  5CV6 A;  1VQ4 A;  3Q8Q B;  5KT7 A;  1R9T H;  2B2U C;  1ILP A;  3KHG A;  1SMY D;  2WKD A;  1B50 A;  1HFG A;  4ME3 A;  1D5X C;  2EPB A;  1N32 H;  3BVG A;  3EPI A;  5D3D A;  5IWA Q;  2UUC H;  1JJC B;  2OTJ A;  3K8A A;  4JI5 L;  1YIJ A;  5H80 A;  5KFC A;  4UCR A;  3ERO A;  4ECR A;  3GTQ A;  4I4T F;  3MEF A;  4P2C B;  4O1N A;  1A63 A;  3UQ8 A;  4ID6 A;  1XWE A;  2GVA A;  5IYC G;  3A5U A;  4J9R A;  1I4H A;  2QGQ A;  4MNO A;  4GC7 A;  2PQE A;  5KG0 A;  1J5E H;  5ELE A;  4CJ1 B;  2F0E A;  1RL2 A;  4JYA Q;  2RA4 A;  4Y7N H;  4JBM A;  2BQU A;  2KJX A;  2ZJP A;  4JI0 Q;  4NXN Q;  2WE6 A;  2EYO A;  4A3D B;  4LFB Q;  1U4L A;  1SYD A;  3OPO A;  1AW7 A;  1GLV A;  1YBY A;  2WB1 B;  3DXJ C;  3VPB A;  4I65 A;  1QVG A;  4ULL A;  4APM A;  2IL8 A;  2E2J B;  1CHQ D;  5KT3 A;  3QZ7 A;  2ENB A;  2FB9 A;  4MV4 A;  5KIX A;  5D1O A;  4UP8 A;  1EWH A;  1GJX A;  4DV5 L;  3B6Y A;  4IQZ A;  1G6P A;  2NTS A;  2A6H D; 
#chains in the Genus database with same CATH homology
 1E7Z A;  1WFQ A;  2NZH A;  2UXB L;  3S1R H;  1MKH A;  3PUZ A;  4A3J G;  4GKK L;  1KQS A;  3DM3 A;  4AQY L;  3HOU H;  1PFS A;  2EIF A;  2JE6 I;  4R1J A;  3F1Z A;  3W1G A;  4JI6 L;  2Z6K C;  4L5T A;  5AJ3 Q;  1JE5 A;  1K83 H;  2WB1 G;  4UPA A;  4A3E H;  4C2M H;  5LMU L;  2WB1 E;  1Y1W H;  1JMC A;  2D62 A;  3HOU G;  3JAM c;  2E5L Q;  4UY8 C;  4GKJ L;  4HJA A;  1Y1W G;  3MXN B;  4LF7 L;  1NY4 A;  3GTG H;  1X56 A;  4PZ7 A;  4C3I H;  3PGZ A;  1L2F A;  3H0G G;  4B3S Q;  1Y1V G;  2F3I A;  4OO1 I;  3L0O A;  4QY7 A;  4B3M L;  2OCE A;  4KI0 A;  2NVT H;  1CKN A;  3E9H A;  3L7Z C;  3PV0 A;  4IJH A;  4JOI C;  4P73 A;  1H95 A;  3CCJ A;  3UDX A;  4DV1 Q;  1L1O B;  2VUM H;  4LF5 L;  4JCV E;  4DR2 L;  4DNI A;  4YY3 Q;  3BU2 A;  4BA2 I;  3BJU A;  3BZC A;  4R4T A;  3VDY A;  1K9M C;  5IYD G;  1IZ6 A;  4YWK A;  4QIW E;  4DR5 L;  3UDG A;  2JA5 H;  3I7F A;  3M7N A;  2IHF A;  1BBU A;  1AE3 A;  1D7Q A;  3ULJ A;  2UU9 Q;  1KRT A;  4GLX A;  4A3K H;  4R4Q A;  4IO9 A;  2R7Z G;  4A3I G;  1VQF A;  2MFI A;  1PA6 A;  4J15 A;  1BKB A;  2D0P A;  1K8G A;  1VQP A;  3T1Y Q;  3KOJ A;  4JI0 L;  3EIV A;  2KCT A;  1O7I A;  3PUV A;  1SMX A;  3OTO Q;  2DUD A;  1W2B A;  3S16 H;  1JJG A;  2I5H A;  4OWT B;  3OYY A;  4QL5 A;  3S15 H;  4TVA B;  1VS0 A;  4PMW A;  3HKS A;  4DR1 L;  2JEA I;  2B63 H;  4OXP A;  3HOW H;  5GAE C;  4R4I A;  4LF8 L;  4IOA A;  3M3Y H;  4RG1 A;  4GOP B;  2IY5 B;  4DR5 Q;  2HT1 A;  3CAM A;  3CXC A;  4DR7 L;  3S17 H;  3F2C A;  2MO0 A;  4DUY L;  2RCN A;  2VS1 A;  5C4X G;  4L5Q A;  1CKM A;  4JG2 A;  3I55 A;  4DV7 Q;  1QVF A;  3PCO B;  4JYA L;  5C4X H;  2NN6 G;  2IX0 A;  5C3E H;  4MTN A;  2K52 A;  2RHQ B;  3S14 H;  1PHJ A;  1XNQ L;  5C0X J;  2JQO A;  4ALP A;  4X66 Q;  3D31 A;  3AFQ A;  4A3G G;  3M85 A;  5HY6 A;  4KLK A;  1YHQ A;  1VQ6 A;  4IFD J;  2E5L L;  1XNR L;  1YHA A;  4JI3 Q;  2AKW B;  2V1C C;  1IBK Q;  2VY3 A;  4LF6 Q;  4DAM A;  2HQL A;  5FJ8 G;  1A62 A;  4DAY B;  2VNU D;  1OXX K;  4LF9 L;  3F2B A;  3CD6 A;  3S1Q H;  3CCQ A;  1E24 A;  5DLQ E;  1UWV A;  2PQA B;  4A3D H;  4GKK Q;  2R7D A;  5IP9 H;  4A3B H;  1U0L A;  3A0J A;  1T9H A;  1LM0 A;  1Q86 C;  3PO2 H;  4DR6 Q;  4LF7 Q;  3SGI A;  3U50 C;  1IBL L;  1ASZ A;  3GTQ H;  4GKJ Q;  1WOC A;  3RLN A;  5C4J H;  3AEV A;  2OQ0 A;  2K5V A;  5J3B A;  4FDB A;  4LF4 L;  1FJG L;  4A3L H;  1EQQ A;  4HJ5 A;  4A93 G;  2LSS A;  1TWH H;  3G4S A;  5JEA J;  4GN5 A;  1EYG A;  2UU9 L;  2LXK A;  1WI5 A;  3UE1 A;  1OTC A;  3PO3 H;  3Q8D A;  4BXX H;  2CCZ A;  1VQI A;  1I3Q H;  2N3S A;  4HJ9 A;  4BBR H;  1UE5 A;  4JI7 L;  4OWX B;  2WAQ E;  1TWG H;  4NB3 A;  3J81 c;  2YV5 A;  1G29 1;  1Q46 A;  3ER0 A;  3I2Z A;  4O2D A;  1PH5 A;  1XNQ Q;  1YEZ A;  1PH7 A;  1PVO A;  3H15 A;  3PF5 A;  3CME A;  1VQE A;  3W5O A;  1N34 L;  4AYB E;  4B3S L;  4DV4 Q;  4B3T Q;  1QZG A;  1IL2 A;  4DK6 C;  1N36 Q;  2HIX A;  1CKN B;  5EAY A;  2ZJQ A;  2IT1 A;  2Z6K A;  4JI5 Q;  2JA6 H;  3I4M G;  4DR7 Q;  2B63 G;  4B3R L;  1U5K A;  4LFB L;  3TRZ A;  4NXN L;  4LFA Q;  1SLJ A;  2KCM A;  3UE0 A;  1I94 Q;  3BZK A;  2JEB I;  3T1H Q;  2MO1 A;  1Z9F A;  4X62 L;  1VQA A;  2PI2 E;  4IFD I;  1V43 A;  4JI1 L;  1Q12 A;  3G6E A;  2R93 G;  2WFW A;  4YCW A;  1FJG Q;  2R7F A;  3M4O H;  4QGU A;  3E0E A;  3KYH C;  4YWL A;  1PH6 A;  1VQB A;  4AH6 A;  3GDE A;  4YCV A;  1Q8K A;  4P75 A;  1AH9 A;  3FP9 A;  1TWC H;  4JI4 L;  2ZTE A;  3NEL A;  5M3M H;  2ID0 A;  1VQD A;  2MNA A;  3KFU A;  1L1O C;  4DV2 L;  2NVY H;  1NE3 A;  1FGU A;  3L2P A;  2XGT A;  2NZO A;  2UUA Q;  1SR3 A;  1N9W A;  2BH8 A;  1WCM H;  2JJQ A;  4A3C H;  3I4O A;  1L1O A;  3FHW A;  2Q2I A;  3K7A H;  5M3F G;  3STB C;  4BY7 H;  2PI2 A;  2Q2T A;  2F4V Q;  3TRE A;  3KLW A;  2F52 A;  3IRB A;  5GRO A;  4HIO A;  1J5E Q;  1VQK A;  1GVP A;  1NMG A;  1E3P A;  2VQF L;  1K8A C;  1VQ5 A;  5GAG C;  2YTV A;  2VQF Q;  1D8L A;  1MIU A;  3CC4 A;  1XNR Q;  2JA8 G;  3S24 A;  1Q1B A;  3S1M H;  1NBW A;  3K81 C;  1PYS B;  1BVS A;  2VL6 A;  4X66 L;  3U58 A;  1HZB A;  1KD1 C;  4A4I A;  2UXC L;  4DV5 Q;  2E2H H;  2K5N A;  2WAQ G;  2QEX A;  2D0O A;  5H1S E;  1SFO H;  1VQ7 A;  1LTL A;  4JI8 L;  2HHH L;  1VQM A;  2AHO B;  4PZ6 A;  1A0I A;  1HNX L;  1P8L A;  2XTI A;  4DV7 L;  1Q81 C;  1HNZ Q;  2E2I H;  2UUC L;  2QA4 A;  1PV4 A;  4BA1 I;  4DV3 Q;  1XJV A;  2MQH A;  2K14 A;  3CC2 A;  2NVQ H;  3RN2 A;  1OXU A;  3GO5 A;  4YY3 L;  3PUW A;  1VCI A;  2BH2 A;  5IYB H;  1HNW L;  4DR4 Q;  1VQO A;  3PO3 G;  4DV1 L;  1PH3 A;  1VQ8 A;  1EOV A;  4A3B G;  4OX9 L;  1TWA H;  4JI1 Q;  3J7A 5;  1UE6 A;  3G48 A;  1KXL A;  2Z0S A;  3CCL A;  1C9O A;  4A3J H;  3KF8 B;  4L5R C;  1X3F A;  1PH9 A;  2OTL A;  1YVC A;  3F8T A;  4A3K G;  3HOY H;  3CCR A;  4DR4 L;  4JBJ A;  4A3M G;  1N32 Q;  1A8V A;  3CMA A;  1VQ9 A;  1CUK A;  1JB7 A;  1QUQ B;  4YCU A;  3HKZ E;  2UUC Q;  3ICE A;  5JJK A;  1HZC A;  3J80 i;  3GTJ H;  1WJJ A;  5GAD C;  4R4O A;  3F2D A;  1YZ6 A;  3S1N H;  1W3S A;  1YHB A;  3CCU A;  2YU9 H;  1B7Y B;  4X6A H;  1KAW A;  4YWM A;  3HOX H;  4DV6 L;  3PSI A;  1TXY A;  5IT9 c;  4A75 A;  1VQN A;  4DR1 Q;  1Q1E A;  2UUB L;  4JV5 L;  4JI4 Q;  1Y1V H;  3HOX G;  1FVI A;  4A3I H;  2RF4 A;  3CP0 A;  4PG3 A;  4APV A;  3S2H H;  1VQH A;  2VUM G;  4X64 L;  3J7Z C;  3ERS X;  3GTP H;  1SN8 A;  1QZH A;  5M5X H;  2AMC B;  1HNW Q;  1CKO A;  2R6G A;  1HZ9 A;  2F4V L;  5ELO A;  1YJN A;  3E9I A;  4P74 A;  1QVC A;  4POG A;  2VW9 A;  1KIX A;  3I4N H;  1LUZ A;  1IBL Q;  4LNQ A;  1JJ2 A;  3A5Z B;  3PUY A;  3HFZ B;  1PYB A;  2BA1 A;  3WWV A;  5FLX c;  3HOZ G;  5LMU Q;  2GN5 A;  5M5W H;  4DV0 Q;  3NEM A;  4XIG S;  2E8G A;  3FKI G;  3GD7 A;  4JBW A;  4JI2 L;  4IPC A;  4A76 A;  4LF9 Q;  1I6H H;  1HZA A;  4Y52 H;  2AWN A;  3U4V A;  5GAH C;  1NTG A;  4X62 Q;  4DUZ L;  1QUQ A;  2KHJ A;  1WCM G;  1KC8 C;  2ZJR A;  1J5E L;  2E2J H;  4A3C G;  2JA9 A;  1PH2 A;  1YI2 A;  2ZTC A;  2EQS A;  3EN2 A;  1EIY B;  1S3O A;  3CC7 A;  1YNX A;  2KHI A;  4AIM A;  1PH4 A;  3PUX A;  4TQU S;  1GO3 E;  1N8R C;  2UXD Q;  4X65 L;  3TS0 A;  3RNU A;  3J81 i;  3DLL A;  4KHP Q;  5FJ8 H;  4PZ8 A;  3RZD H;  4YHH Q;  5IYB G;  4A3F H;  1SRU A;  4LW1 A;  4LF4 Q;  1E1T A;  3ULL A;  1M1K C;  4A3L G;  3AFP A;  3T1Y L;  5BR8 Q;  1YIT A;  2K50 A;  5BR8 L;  4IOC A;  2L15 A;  3NEN A;  4DUY Q;  1Q82 C;  4HJ8 A;  2UXB Q;  4BY1 G;  1CSP A;  3GTK H;  1DGS A;  5JEA G;  1IBM Q;  1TWF H;  2A8V A;  2ZM6 Q;  3H3V H;  2N8N A;  4EQ5 A;  1S40 A;  3CF5 A;  5IYD H;  1X6O A;  3OW2 A;  4BBS G;  1J6Q A;  4IPG A;  1IYJ B;  3I56 A;  2A19 A;  4UP9 A;  1YJW A;  2ZTD A;  4A3M H;  1E22 A;  1X65 A;  5C44 H;  4B3R Q;  5C0X G;  4LF6 L;  3KJP A;  1IBK L;  1N33 Q;  3K80 C;  1ASY A;  1X55 A;  5GQO A;  1BBW A;  4LFC L;  1G51 A;  2JA7 H;  4DR3 L;  3PIP A;  2DGY A;  1KL9 A;  1L0W A;  5C0X I;  1UE7 A;  4H02 A;  3TEH B;  4HIM A;  3EBE A;  4NXM Q;  3KDF B;  4XTC S;  4GN4 B;  5C44 G;  4B3M Q;  4DR6 L;  4WJ3 M;  4GN3 B;  4GS3 A;  2ES2 A;  1MJC A;  1I5F A;  1V9P A;  3HOV H;  1EIF A;  2JA7 G;  2OWO A;  3STB D;  2JA5 G;  3H0G H;  4WJ4 A;  3HOV G;  4JBK A;  3RLF A;  2NN6 I;  5HGQ A;  2ATW A;  3S2D H;  4JC0 A;  3ZJY C;  1K3R A;  4GOP A;  3PIO A;  4A93 H;  5FLM G;  3GTM H;  4DV4 L;  1NMF A;  1P16 A;  2JK8 A;  3M4Q A;  4JI3 L;  3UDI A;  3RLO A;  3KJO A;  3CW2 C;  4GNX C;  3G71 A;  4DR2 Q;  4LF5 Q;  3I4M H;  1PH1 A;  1OXT A;  2CKZ B;  2R7Z H;  3I4N G;  2B3G A;  1GKH A;  4JI2 Q;  2B29 A;  4GNX A;  2I5M X;  1HR0 L;  4IJL A;  2Q2U A;  1C7Y A;  1Q7Y C;  4GNX B;  4DV2 Q;  4C3H H;  3D0F A;  2CWA A;  2R93 H;  4C3J H;  4LUZ A;  4NXM L;  1K0R A;  4KHZ A;  3M4P A;  3K0X A;  3OTO L;  1X3E A;  5M3F H;  3FKI H;  1EWI A;  1HH2 P;  1K73 C;  2Y0S E;  2NVX H;  1JT8 A;  4X65 Q;  5LMN L;  2A1A A;  4NPS A;  3KF6 B;  3CCV A;  1XPU A;  3HOZ H;  4QQB X;  4HID A;  5IY0 A;  4AYB G;  4AQY Q;  3U4Z A;  3KF6 A;  2VQE Q;  1NJI C;  2CQO A;  1I94 L;  2UUA L;  4GLA C;  4IPH A;  4BY7 G;  4A3D G;  2OQK A;  2PQA A;  5M5Y H;  1XPO A;  4JV5 Q;  5IP9 G;  5IYC H;  4R4C A;  1KHI A;  4QJF A;  3UDF A;  1V1Q A;  2HIV A;  1SE8 A;  4A3F G;  4L5S A;  2PNH A;  4IFD G;  4OX9 Q;  1SRO A;  1M90 C;  1KRS A;  4YHH L;  4O0A A;  2I0Q A;  3CPF A;  4KHP L;  4DV0 L;  4HJ7 A;  5JJI A;  5ELN A;  3AQQ A;  1N33 L;  3JC6 6;  4DV3 L;  2WP8 J;  4GLV B;  1HJP A;  5E7N A;  1XMO L;  4LWC A;  1CSQ A;  4DK3 C;  4BBR G;  3HKZ G;  5IWA L;  1X3G A;  2YTY A;  3CQZ H;  1N36 L;  2ASB A;  4OO1 G;  3CCE A;  2UXC Q;  1VQC A;  2ALY B;  4HIK A;  2IX1 A;  1N34 Q;  1IXR A;  3A74 A;  4P72 A;  1XMQ Q;  4K0K L;  3JAM i;  3RN5 A;  2FXQ A;  2BA0 A;  2GVB A;  4P71 A;  4LFC Q;  1XPR A;  3H3V I;  4JOI A;  3J81 j;  1Y14 B;  3M9B A;  1HR0 W;  2I5L X;  3RR5 A;  1WYD A;  2K75 A;  3LGJ A;  1VQJ A;  5LMN W;  3GTL H;  4BXX G;  4DV6 Q;  1HNX Q;  3RZO H;  4A3E G;  3PO2 G;  4LUV A;  4LF8 Q;  3W1B A;  5IE8 A;  1EUJ A;  2HHH Q;  2VZA A;  3HOY G;  1X54 A;  1MJE A;  5LMN Q;  1UEB A;  1VQG A;  5AJ3 L;  1IBM L;  3ULP A;  1I50 H;  4A3G H;  4DUZ Q;  1Z47 A;  4X64 Q;  2EXD A;  3TQY A;  4UP7 A;  1VQ4 A;  2K4K A;  3CCM A;  1FL0 A;  1XMQ L;  4K0K Q;  1R9T H;  5K36 G;  1B70 B;  2AWO A;  4ME3 A;  2Q2H A;  2UXD L;  1GD7 A;  4GOP C;  5FLM H;  1HR0 Q;  2JA6 G;  2H5X A;  5JJL A;  2R92 H;  5IWA Q;  4DPG A;  2KEN A;  4LFA L;  1JJC B;  2RHS B;  3CPW A;  2OTJ A;  1EFW A;  3GTO H;  2K5H A;  1OXV A;  2C35 B;  2CFM A;  2KBN A;  3K8A A;  4JI5 L;  1YIJ A;  2R92 G;  4LUO A;  1EQR A;  2Y0S G;  1N32 L;  3MEF A;  1A63 A;  2N49 A;  1HNZ L;  3PF4 A;  4OON A;  2GVA A;  5IYC G;  3A5U A;  2N78 A;  1AE2 A;  2QGQ A;  4MNO A;  1PH8 A;  3CCS A;  5IP7 H;  1B8A A;  4JI8 Q;  2JA8 H;  1UE1 A;  1RIP A;  4B3T L;  1S72 A;  4IPD A;  1RL2 A;  3T1H L;  1YJ9 A;  4JYA Q;  2IHE A;  3HOW G;  4Y7N H;  4JBM A;  1X9N A;  2ZJP A;  4JI0 Q;  2VQE L;  1XMO Q;  4JI7 Q;  5C3E G;  4NXN Q;  4DR3 Q;  4LFB Q;  2YYZ A;  5IP7 G;  1OXS C;  4OWW B;  2CWP A;  3NBH B;  1YBY A;  3K7U C;  3KDF A;  4RMF A;  1E1O A;  4MZ9 A;  1XTD A;  1LYL A;  3AYH B;  1QVG A;  4EX5 A;  1GM5 A;  4JI6 Q;  1VQL A;  4BY1 H;  3TS2 A;  2YTX A;  4DKA C;  5M3M G;  4POF A;  4UP8 A;  2LXJ A;  2ZM6 L;  1C0A A;  4DV5 L;  3B6Y A;  2PMZ E;  1G6P A;  4BBS H;  2UUB Q;  3J80 c; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...