4QIWE

Crystal structure of euryarchaeal rna polymerase from thermococcus kodakarensis
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
181
structure length
181
Chain Sequence
MYKLLKVKDVVRIPPRMFTMDPKEAAKIVLRETYEGIYDRDEGVVLAILDVEEISEGVIVPGDGATYHEAIFNVLVWEPRNQEVVEGEVVEMMPYGAFIRIGPMDGLVHISQLMDDYVVFDEKNRQFIGKETNRVLKLGDYVRARIIGVSVKSRVIRENKINMTMRQPGLGKFEWIEKEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase
publication title The X-ray crystal structure of the euryarchaeal RNA polymerase in an open-clamp configuration.
pubmed doi rcsb
molecule tags Transcription
total genus 33
structure length 181
sequence length 181
chains with identical sequence Q
ec nomenclature
pdb deposition date 2014-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00575 S1 S1 RNA binding domain
E PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 4qiwE02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 4qiwE01
5JEAG 3H0GH 1Q1EA 3PIPA 2VUMG 3GTKH 1QUQA 3E9HA 3OYYA 4JI1L 3CCEA 2JA7H 4NXNL 4A93H 1KXLA 4A3GG 1N34Q 2D0PA 4HJ5A 3STBD 3JC66 3I4MG 1CUKA 3M4OH 2R7ZG 4A3JH 5HGQA 2RHSB 4LF8Q 2UXDL 4DNIA 2F52A 3CMAA 1IBLQ 2E2JH 1XNRQ 2ATWA 4JYAL 3CCVA 5M5WH 2Z6KA 4GN3B 5LMUL 3PUVA 3CCQA 1Y1VH 4DV6Q 4R4IA 3L7ZC 4GLVB 3PO2H 1WYDA 1KD1C 1AH9A 1X55A 4A3LG 2NZOA 1K8GA 2UXCQ 1FGUA 1I94Q 5ELOA 1V9PA 4JI7Q 1HZ9A 2GVBA 2C35B 1FJGL 2IHEA 4JI8Q 4LF6L 4DR6Q 3AFQA 3EN2A 2QGQA 4GNXA 4DV7Q 1UE5A 4LF9Q 3HKSA 1NBWA 4YCVA 1YJWA 4LUVA 5GAHC 2N3SA 3DLLA 4YCUA 3D31A 1OXTA 4IOCA 1XMQL 3CCRA 1QVCA 5JJLA 4BY1G 3AYHB 2MO1A 4GOPB 3BZCA 1EIYB 3GO5A 2R7DA 3RNUA 2YU9H 1X65A 1YNXA 1L1OC 3FKIH 2BH8A 1Q1BA 2RCNA 3FHWA 4OWXB 1VQ5A 3H3VI 3PO3G 4A3MG 3U50C 4AH6A 1JMCA 4X62L 2JA5G 3CXCA 4IFDG 4A3IH 1N8RC 4LFBL 2LXJA 1AE3A 3I55A 2UUCQ 5C44H 5EAYA 3HFZB 4JI5L 1FL0A 2K75A 4XIGS 1K9MC 2E2HH 2JA6G 5E7NA 3CMEA 5C4XG 1I6HH 1B7YB 1V1QA 4R4QA 3JAMi 4A3KH 3HOXH 1CKNA 1UE6A 4KHZA 1HNZQ 4QJFA 1PH9A 1HR0L 4A3FH 4X6AH 2IX0A 3J81i 4A3CG 1NMFA 3GDEA 4JI6Q 2Z6KC 2B63H 2K5VA 3K8AA 4DR3Q 3I4NG 2ZTCA 1BVSA 1E7ZA 4HJ9A 1MKHA 2BA1A 4DV5L 1K73C 1IBML 4A76A 2VW9A 3S1RH 4A3DH 3G48A 3GTOH 4R4TA 4GKJQ 1HJPA 1VQHA 3ULJA 1QZGA 1PH2A 4LF7L 3BU2A 5IY0A 2Z0SA 2K52A 3F2DA 3M3YH 1S40A 2A1AA 1U5KA 1UEBA 5M3MH 2UUAQ 1TWCH 3ULPA 1VQLA 1X9NA 3H3VH 2IT1A 3M4QA 3PGZA 2F3IA 4C3HH 1IYJB 4GNXC 4NB3A 3SGIA 4BBRG 4BXXH 5C3EG 4YCWA 3CC2A 3GTMH 2CWAA 1VQKA 2E8GA 1N34L 1HNXQ 2KCTA 3KLWA 1YHBA 5IYCH 3ERSX 4JI3L 4EX5A 3W1GA 1YJ9A 1XMOQ 4KI0A 2HIVA 4LFCQ 2L15A 2HT1A 1P16A 2NN6G 1C7YA 5C0XG 3EBEA 1PFSA 1VQGA 3RZOH 1HZBA 4DUZQ 2XTIA 1I5FA 4OXPA 1EFWA 4DV6L 5JEAJ 1Y14B 4X65Q 2JA7G 1VQFA 2FXQA 2OQKA 3UDIA 1HZAA 4QGUA 4A93G 2OQ0A 1SE8A 4HJAA 2DUDA 1PH6A 3KJOA 1CSPA 3PUXA 2Q2HA 3BZKA 5IP9H 4A3JG 1I94L 3K7AH 4JI7L 4DUYQ 4KHPQ 2HIXA 2CQOA 3CCUA 2UUBQ 1KQSA 1WI5A 3KF6B 4FDBA 2A19A 4P74A 4YHHL 1E3PA 1K83H 3KDFB 4DV1Q 2AKWB 4JCVE 5C0XI 2ZJQA 4B3MQ 3TS2A 2VS1A 4DR6L 2R92H 1S3OA 3CCJA 2JA8H 3PO2G 2ID0A 5BR8Q 3DM3A 4DV2Q 1VQOA 2BA0A 4LWCA 1QVGA 2ALYB 3T1HL 3PCOB 1TWAH 4UPAA 1PH8A 4JOIA 4X64Q 1L1OA 3PUZA 5IP7H 1J5EQ 2E2IH 4XTCS 2PI2E 4GKKQ 1VQ4A 1E1TA 1QZHA 1HZCA 1N36L 4B3SL 1Y1WH 4A3BH 4LF4Q 4DR7Q 1X3EA 5FLMH 2R6GA 1YJNA 3HOYH 1L2FA 3TQYA 5LMNW 4B3TL 4BY7G 4NXMQ 1SLJA 1Z9FA 4UP9A 2WB1G 2EIFA 1PH3A 1K0RA 1G51A 3VDYA 4BBSG 2PQAA 2UUCL 3RR5A 3CC4A 2UXBQ 1IL2A 1A62A 1PYBA 4GLAC 4QL5A 4DV4L 4J15A 1ASZA 1NE3A 5IWAL 3CPWA 2WB1E 2H5XA 4R4OA 1E22A 1HNZL 3GD7A 5LMNQ 3ICEA 4POGA 4DAMA 4B3RQ 4IPGA 1M1KC 1WOCA 4MNOA 3U4VA 4JI6L 1XNQL 2K50A 2R93G 1A63A 1ASYA 1T9HA 4O0AA 3OTOQ 1JJGA 4DV3Q 1BBWA 4DR3L 4JBMA 4C3IH 4JG2A 4L5RC 2JK8A 4DK3C 5C44G 1N32Q 1XPUA 1DGSA 4YWKA 5FJ8G 3NEMA 1TWGH 3MXNB 4GKJL 3TS0A 2B3GA 2MQHA 1X54A 2MFIA 3PF4A 2JJQA 1NY4A 2UUAL 1PYSB 2VL6A 4HJ7A 5IYDG 5IYBH 4HIKA 1HNWQ 1O7IA 1N33Q 2ZJRA 3CD6A 2WFWA 4A3DG 4RG1A 3HOUG 3FP9A 4IPDA 2UU9Q 3RLNA 3M9BA 1HNXL 4OONA 4X66Q 2VNUD 1VQ9A 1BKBA 3TEHB 1VQEA 4JOIC 4DPGA 3PF5A 2I5LX 3I2ZA 2HQLA 1KRSA 2VUMH 4LFCL 2ZJPA 4DR4Q 1OXVA 3S16H 3K7UC 4A3EH 4YY3Q 4HIOA 4A3GH 4DUZL 1M90C 2MO0A 4GN5A 2IX1A 4LF5Q 3I4MH 4X65L 4RMFA 3A5UA 3HKZG 4IJHA 3CAMA 3F8TA 1VQ7A 1GKHA 4AQYQ 3G4SA 1JT8A 2WAQG 4JC0A 1OXSC 2V1CC 3HOZG 3S1MH 4KHPL 1GM5A 4DUYL 3S14H 3KF6A 2NVXH 4L5SA 1YHQA 1SRUA 2UUBL 4NXNQ 2N8NA 2IY5B 1QUQB 3CW2C 1J6QA 3W5OA 3HOWG 3H15A 4K0KL 2F4VL 3HKZE 4B3ML 1TWFH 4PZ6A 5C0XJ 4IFDI 2I5MX 3CCMA 3J80c 1EQRA 1WCMH 1FVIA 1W3SA 3NELA 1EUJA 2WAQE 1BBUA 4GS3A 4DV2L 2UXDQ 1PH7A 1CSQA 3L2PA 2CWPA 2JQOA 4X64L 1J5EL 3GTPH 4JYAQ 4QIWE 4YWLA 5IP9G 1IZ6A 4GKKL 1XPOA 1KC8C 1YITA 1YEZA 2RF4A 4LW1A 2OCEA 1C0AA 3F1ZA 1X56A 1CKMA 2N49A 2JEBI 3KOJA 4OO1G 2JA8G 3L0OA 3M85A 3UE1A 1GO3E 2YTYA 4JI2Q 4UY8C 3A74A 1VQIA 1WJJA 4P71A 3UDGA 3U58A 2CCZA 4OWWB 1UWVA 1FJGQ 1SFOH 4LF8L 3E9IA 1IBLL 1XNRL 3G6EA 1JE5A 2VY3A 4POFA 4JI0Q 2MNAA 2AHOB 1Q8KA 5ELNA 3H0GG 4GNXB 2KHJA 3PO3H 4A3MH 5M3FH 5LMNL 1OTCA 1TXYA 2BH2A 4B3RL 1NJIC 4PMWA 1G291 3I4OA 3J7ZC 3ZJYC 1XMQQ 1EQQA 3OTOL 3CCSA 2UXCL 4DV3L 3BJUA 1KL9A 1C9OA 1Q7YC 4P72A 1N32L 3K0XA 2K5NA 2NN6I 1RIPA 2Y0SE 4JI8L 4DR5Q 2A8VA 3AFPA 5AJ3Q 2NVTH 1Y1VG 4DV7L 4DV0Q 4LF9L 3I4NH 4LFBQ 1UE1A 4Y52H 1N9WA 3PUYA 1YZ6A 2B29A 1W2BA 3GTLH 2WP8J 1EWIA 2LSSA 2JE6I 1AE2A 1HNWL 1QVFA 1X6OA 4GOPA 2Q2UA 3S17H 2UU9L 1NTGA 5K36G 2D0OA 1CKNB 1KAWA 2EXDA 3B6YA 1PV4A 1SROA 3A0JA 1Q46A 4MTNA 4TQUS 1X3FA 3J81j 4DR4L 1IBMQ 2NVQH 5GAEC 2HHHQ 4BBRH 1EYGA 3KYHC 4HIMA 4YY3L 1PHJA 4LNQA 3D0FA 4JV5Q 2GVAA 4DR2Q 4LF5L 4LF7Q 4DR1Q 4DAYB 1I3QH 3S15H 4IO9A 1D7QA 2PMZE 3HOVH 1YBYA 4PZ7A 3FKIG 4LFAQ 1LTLA 1RL2A 3PUWA 4ALPA 2OWOA 1XTDA 4PZ8A 4EQ5A 3S24A 3T1YQ 4P73A 4A3EG 4IPCA 3E0EA 4A3IG 3ULLA 2EQSA 3UDXA 1YI2A 4IFDJ 4MZ9A 4JI3Q 1UE7A 4LUZA 1XPRA 4JI4Q 1E1OA 1Q12A 3I7FA 3F2BA 4A3KG 2YV5A 3HOXG 1E24A 1I50H 1YHAA 3F2CA 4WJ3M 1HH2P 4A3LH 3EIVA 3S2DH 4A3FG 1IBKQ 2AWOA 1VS0A 1U0LA 2D62A 1VQBA 2AWNA 2K4KA 4L5QA 2QEXA 3CC7A 2B63G 5JJIA 5GADC 3AQQA 2E5LQ 3S1NH 5DLQE 4R1JA 4UP8A 1PA6A 4BA2I 1WCMG 4O2DA 1K3RA 1B70B 3RLFA 5IT9c 3CQZH 4JI2L 4GLXA 1JJCB 2ZM6Q 5J3BA 4OX9Q 1L0WA 2ASBA 1XMOL 1KHIA 1MJCA 2KCMA 2KHIA 3CPFA 2K14A 1VQAA 4JBJA 4C2MH 5M3MG 4GOPC 2VQFQ 4BY7H 2VQEQ 3GTQH 1X3GA 1KIXA 2Q2IA 4JI0L 2ZTDA 1OXUA 4L5TA 1H95A 2R7ZH 1KRTA 4BXXG 3M4PA 3T1HQ 2Q2TA 4GN4B 3TREA 3KFUA 4BBSH 3JAMc 4JBKA 4IPHA 1L1OB 5IYCG 2YTVA 1SN8A 4B3SQ 1N36Q 2YYZA 1EIFA 4Y7NH 3J81c 1P8LA 2XGTA 4APVA 4JI1Q 1TWHH 3KF8B 4B3TQ 3KDFA 2CFMA 3Q8DA 3STBC 4AYBG 4DV1L 4IJLA 4DR5L 4OO1I 5AJ3L 2R93H 2K5HA 4DV0L 5M3FG 3A5ZB 5BR8L 1VCIA 2PQAB 2AMCB 2ZTEA 5FJ8H 4DV4Q 1V43A 5LMUQ 1Q82C 4DKAC 4AYBE 1VQJA 5IWAQ 1CKOA 3CP0A 3K80C 4QQBX 1SR3A 4DR7L 2I0QA 3MEFA 4LF4L 3TRZA 4K0KQ 1VQNA 3AEVA 1VQDA 4NXML 1XNQQ 2R92G 3ER0A 5IYDH 4A75A 3CF5A 2GN5A 2IHFA 2HHHL 4PG3A 3HOUH 1R9TH 3J80i 4BY1H 3W1BA 5C4JH 4P75A 5IP7G 2RHQB 1K8AC 3UDFA 4DR2L 4JV5L 2UXBL 1PVOA 4LF6Q 4DR1L 1PH5A 1D8LA 1Y1WG 5GROA 3OW2A 3I56A 4A3BG 2PNHA 5FLMG 3HOYG 3NENA 4IOAA 4YHHQ 2JA5H 2Y0SG 4LFAL 3GTJH 2PI2A 1B8AA 3CCLA 5FLXc 3NBHB 3PIOA 3GTGH 2JA6H 5C4XH 2N78A 4C3JH 1WFQA 4UP7A 3M7NA 2CKZB 3T1YL 1LM0A 1Q86C 4AIMA 2KENA 3U4ZA 4KLKA 1VQMA 4A4IA 1NMGA 4TVAB 4JBWA 1JJ2A 1HR0W 2VZAA 2LXKA 4ME3A 4JI4L 1LUZA 4A3CH 3J7A5 4HIDA 3HOVG 5HY6A 1A0IA 4BA1I 4QY7A 4X62Q 3HOWH 5M5YH 5H1SE 1PH1A 1S72A 1GVPA 3PSIA 3G71A 1IBKL 1JB7A 4JI5Q 1SMXA 1MIUA 3UE0A 2OTJA 3PV0A 1MJEA 1VQ8A 1EOVA 3WWVA 2E5LL 2JA9A 1N33L 1OXXK 1A8VA 3RLOA 1PH4A 3S1QH 2OTLA 5JJKA 2KBNA 4X66L 4H02A 1HR0Q 5IE8A 1LYLA 1G6PA 1GD7A 1XJVA 3K81C 5GAGC 2ZM6L 3RN5A 1VQPA 4OWTB 4OX9L 4WJ4A 3LGJA 4DV5Q 2F4VQ 4DK6C 4NPSA 5C3EH 2VQFL 2I5HA 4R4CA 3RN2A 3IRBA 1VQCA 2VQEL 1Q81C 1VQ6A 5IYBG 5GQOA 3S2HH 2NZHA 2NVYH 4YWMA 2QA4A 1YIJA 3HOZH 2JEAI 4LUOA 2YTXA 3KJPA 5M5XH 4HJ8A 2R7FA 4AQYL 1IXRA 1YVCA 2DGYA 3RZDH 2ES2A 1Z47A
chains in the Genus database with same CATH superfamily
3H0GH 1I3QB 2OXPA 3S15B 4JI1L 2JA7H 4YAKB 5M5XB 3DWQA 5CC4A 2FE3A 3ND9A 3STBD 3I4MG 4UCSA 3RB3A 1SYGA 1WTPA 4J0MA 5C5LA 4AQYH 2CHBD 4EQNA 4Q44A 2E2JH 2UVWA 2EYFA 3R2TA 2KEDA 5EPKA 2VPSA 4FYDA 1CQJB 5M5WH 1KDAA 4DF7A 5LMUL 1YNJC 1II3A 1CA6A 3KTMA 1Y1VH 4R4IA 3RAXA 3EROA 1TU2B 1KJQA 3N42B 1KD1C 1I50B 1TWCA 1K8GA 4YR2A 1I94Q 5ELOA 4JI7Q 3OW7A 1H9SA 4HNVA 2R3ZA 1N56A 3PR5B 4KHVA 2IHEA 1RK6A 1I4QA 4J9OA 3K5IA 2EE1A 5EKLA 3BQ1A 4Q8EA 2EYJA 1PK8A 5F9LA 3HKSA 2LFNA 5BN4A 4J9SA 5KG3A 2L0CA 4C2MB 1LT6D 1OXTA 2VB2X 3GTQB 5J2UF 5ELDA 2AU0A 4ILWA 2MO1A 4R7RA 2GLTA 3HBLA 2JYOA 1YNXA 1L1OC 1Q1BA 1QWYA 1VQ5A 1Y69U 1Z7TA 3H3VI 3KHGA 4KV6A 1U9RA 1M0WA 1WVLA 1TWHB 1RKNA 2RQXA 5EDWA 3I55A 1QJOA 4JI5L 1S03G 1FL0A 2K75A 2JA6G 1L2ZA 1EYZA 2WDTA 2NB0A 1V1QA 4R4QA 4A3KH 4BS9A 3J7YW 2XGQA 1SMYC 5LYJF 1HR0L 3W2DA 2E2IA 4X62H 3ITPA 4A2AA 1LLRD 3N43B 4QWAA 3BABA 3JAMW 3I4NG 1G2TA 1BVSA 4HJ9A 4DV5L 3L4JA 4A76A 3OHAA 3G48A 1PLFA 2YZNA 4R4TA 1FKAH 1HJPA 1PH2A 3PVXA 1F2MA 3BU2A 2FKLA 4ED7A 1T36A 1S40A 4BWSC 2HQEA 5EKIA 4YJ2F 1UEBA 3HOUB 2UUAQ 3K58A 4EBCA 1GHJA 2WINB 5A2QE 1VQLA 1WTHA 2F3IA 1RD9D 1IYJB 1SYXB 4NW2A 3SGIA 4BXXH 1AUVA 2EZVA 1GUTA 1VQKA 4LF7H 2F0PA 1GSOA 4Y8VB 3MVVA 4EX5A 3GTGB 4KI0A 3HXLA 5KFRA 3VYUA 3HKZB 4RNOA 1A15A 1KABA 3GIQA 1B53A 3NUCA 4ED2A 1PFSA 1YNNC 3RZOH 2C28A 2GPSA 1ENCA 5JEAJ 2FXQA 4K6LA 2HJWA 1HZAA 1SE8A 5J39A 4JI3H 3PZPA 3GP7A 4RH6A 3MAQA 3KJOA 3PUXA 1PH6A 2IW3A 3J7AV 1O7LA 1KQSA 3KF6B 4FDBA 1CZWA 2A19A 3HGBA 4P74A 1E3PA 4DV1Q 1BNZA 1FGBD 5KIXA 4A3LG 3S1QB 4MTDA 2A74C 2JA8H 1AP0A 1GLVA 4MTKA 5BR8Q 2VUMA 3N40P 4DV2Q 2DN8A 3T53B 2EDGA 5KFGA 4LWCA 1I94H 3T1HL 4JI7H 1BNCA 3PUZA 5IP7H 4XTCS 2FLNA 4RNNA 3AB9A 4JUZA 1HZCA 4A3BH 4HNTA 2NVYB 1X3EA 5FLMH 1YJNA 3HOZB 1KNEA 1L2FA 3TQYA 3N6XA 4BY7G 1Z9FA 3RZDB 2H1EA 1CT1D 2QW7A 3VDYA 5L1JA 4FU0A 2PQAA 3CC4A 4A93B 1A62A 4QL5A 4J15A 3ND8A 5JUMA 4B3TH 1NE3A 3CPWA 2WB1E 1SNMA 4R4OA 3C2PA 2AGQA 5LMNQ 4CJ2C 1F2LA 4B3RQ 4IPGA 3GV7B 2FK2A 1A63A 4ZAIA 2R93G 5G3LF 1JJGA 5TSSA 1D1KA 5I6WA 1CQIB 2JK8A 1DJRD 1DGSA 2TMPA 3BVZA 1TWGH 3MXNB 3NEMA 4GKJL 2XCLA 2V4QA 2B3GA 1EYCA 4X3SA 1EY6A 1X54A 1NY4A 1AEXA 1WTWA 5JQWA 3BQ2A 2XWJB 4N9TA 2E75C 5NUCA 5IYBH 2EY5A 2ZJRA 4K2KA 2XSCA 4RG1A 4IPDA 2UU9Q 3M9BA 4OONA 2F0NA 3JZIA 1SNQA 2B2WA 3P1HA 3PF5A 2ZDGA 2I5LX 3J80E 2UUAH 1T94A 4LFCL 4DR4Q 3S16H 3PR4A 1JCKB 3QZ8A 3K7UC 4A3GH 1M90C 3FKIB 4C3HG 3U9OA 4X65L 2D5DA 4ETSA 1ZYRD 4S3SA 3IKJA 2XCPA 3RTXA 1JT8A 2WAQG 2R8IA 4FF4A 5C44B 3S14H 1BCPD 2NVXH 2RCFA 4OIJA 3W5OA 3HOXB 1TQOA 5C0XJ 4IFDI 2I5MX 3CCMA 1WTQA 1W3SA 1FVIA 1EUJA 3WOFA 2QDBA 1BBUA 5DG9A 1L0XB 5KG1A 3L2PA 2ASDA 3EVQA 4A3DB 1EYAA 3S1RB 2YS6A 4GKKL 1XPOA 4FBUA 4DV1H 1YEZA 1EZ1A 2F4VH 4EGJA 2WTFA 1Z6HA 2N49A 1STBA 4LAAA 4DV2H 3L0OA 2GA4B 5CR3A 1CTMA 2JA7A 2CCZA 3N8DA 2EPBA 4LJZC 3MC0B 3C1EA 4I4TF 4DXFA 3E9IA 2X69A 3VA7A 1IBLL 1XNRL 2VY3A 4F87A 2B2WC 1CQVA 1SYBA 4POFA 4JI0Q 1RK5A 5EBDA 4LMQD 4GNXB 1MZBA 4A3MH 5M3FH 1BJTA 2NU8B 4PMWA 4AYBB 3I70A 1SYEA 3SK5A 3ZJYC 4UAIA 3MFGA 2XWBB 1C9OA 4ZRZA 3K0XA 1BOSA 2K5NA 5DGAA 2Y0SE 4RUCA 3NWSA 4JI8L 1TS4A 5LMNH 3AFPA 2ALZA 3BYTB 4B3RH 4DV0Q 2NUAB 1K8MA 3WO0A 5JH7F 3GTLH 1W2BA 4H44C 3QZ7A 1K83B 2L9HA 4ECYA 1EWIA 2WB1A 5DG7A 4YJ3F 2JE6I 1AE2A 1QVFA 1TT2A 4GOPA 3S17H 2JP1A 2FMAA 3ORQA 4XQJA 3IFTA 4OEMB 5KFLA 1TS2A 3G7LA 2YRWA 1HPCA 2EXDA 1SROA 2EXZA 4H7BA 1X3FA 1AFPA 2W7OA 1S5CD 4E4TA 4EGQA 4LNQA 3X3NA 4YQWA 2QKIC 1EY9A 2GVAA 4DR2Q 4LF5L 1QG7A 4IN3A 4DR1Q 4DAYB 1I3QH 2UU9H 3S15H 4IO9A 2PMZE 3JSLA 4FS1A 3DEPA 2EJMA 1GGOA 4DR4H 1LTLA 1RL2A 4G7ZC 1IYVA 1CHQD 1JR0D 1XTDA 3MXPA 3BAAA 5IT9E 3T1YQ 2M2LA 4A3EG 1PRTF 4A3IG 3E0EA 3NP8A 2MP1A 3UDXA 4ZLTF 3QWNA 2XN9C 5EBCA 1XPRA 1E1OA 3M4YA 3F2BA 2YV5A 1I50H 1YHAA 1BDOA 2NU7B 1JX4A 4DU9A 1LT5D 2FPIB 2HVQA 4IUPA 2G9DA 1AN7A 2AWOA 1D7QA 4L5QA 3CC7A 5GADC 3T13A 4R1JA 4BA2I 2UVVA 1WCMG 2CVRA 4O2DA 1K3RA 3GTJA 2AGOA 1QB5D 4M7EA 2R85A 2JA6A 5JOBA 4OX9Q 3TP6A 2D2CC 1SBBB 1KHIA 2KCMA 4GOPC 2FP4B 2WKDA 5M3MG 4C2MH 4JBJA 2WYOA 5EWEA 3TN2A 2VQFQ 2IPKD 3FMCA 2VQEQ 3GTQH 3N44B 1Z2PX 4L5TA 1H95A 1IOWA 1PRTC 3I91A 4C5CA 3T1HQ 4GN4B 3QB3A 5KT3A 4IPHA 1O7ZA 3I4MB 1P8LA 4APVA 3MR2A 1EHIA 3TBIB 1TWHH 3UQ8A 4JI0H 3STBC 5T1IA 1AUXA 1MI2A 1E4EB 5DQGA 2B2YA 2HD3A 4U673 5KFWA 1TA8A 5I6YA 1KNAA 3D4RA 1B1ZA 2N55A 4IZOA 2O5IC 1VBGA 4TUYF 4O3RA 2ZTEA 1TWFB 1Q82C 1V43A 4ZYSA 4ME6A 3T4AC 4EQOA 1HTPA 4DR7L 1EY5A 1ICFB 3MEFA 2R7LA 3R5XA 2GPWA 1LT4D 1H9MA 4DV0H 4MIUA 4RCNA 5KFIA 3RB6A 2GN5A 2IHFA 3HB9A 3GTKA 3HG9A 1ZKOA 1RJPA 3HOUH 4WFN3 5L1KA 1ENFA 4UDUC 2WE6A 2RHQB 2RSNA 4LF6Q 2QYZA 4O4HF 1V8QA 4TQRA 1D8LA 1EY0A 3TDQA 5GROA 3I56A 3HRZC 2KQ3A 3HOYG 2KCCA 3GIIA 2JA5H 4MV7A 1SFOB 4IFDH 2PI2A 5CA0F 3IN5A 3A54A 1DXMA 3R23A 3NBHB 3GTGH 1PFMA 2N78A 5C4XH 2KA7A 1Q86C 4DR2H 3G6JB 4ECXA 3U4ZA 4DR1H 2DNEA 4TVAB 5D1OA 3QR8A 1HR0W 2FJZA 2ZDQA 2VZAA 2LXKA 5FO7B 4FXKC 3NQIA 4JI4L 2DY8A 3N41B 3MWEA 3HOVG 4IWXA 3KAJA 3A8IE 4QY7A 4OHJA 1S10A 1JB7A 2B2YC 4I55F 3T1YH 3VR2A 2NVTB 2OTJA 3R3OA 1VKZA 1GUNA 4RB1A 1WTRA 1N33L 2PCFB 2V4RA 2XIWA 1OXXK 1A8VA 3I4NB 3S1QH 2CW7A 2C00A 1X3QA 2VB3X 1XXGA 3WO1A 1GD7A 5EWFA 3Q8RB 3LWUA 2C2DA 3Q24A 4OWTB 3TSSA 1U4LA 3L3OC 2RVLA 4XT3B 2JEJA 2XRQD 2YU9A 2W8KA 3RN2A 3MWMA 4EYIB 1VQ6A 1S5ED 5CMDA 4R9WA 3PW2A 2NVYH 3OWFA 2Q8TA 3HOZH 2JEAI 2O5JC 4XYOA 2B39A 1JWSD 3KJPA 1TIID 3D6CA 2NVQB 3K3PA 4X66H 4OX9H 1YVCA 3SE0A 3RZDH 2E2HA 1J9OA 2W6NA 1Q1EA 2VUMG 2VQFH 1QUQA 2VQEH 1UUPA 4G4KA 1SXTA 2VA3A 4A93H 3RGXA 3CHBD 4HJ5A 3T1HH 1CUKA 1PTOB 4Q0FA 1R4QB 2F0GA 4A3JH 3A7LA 5HGQA 2R7ZG 3MFIA 2B63A 1VF5C 4XYLB 4X3TA 1TAEA 4DNIA 2YS7A 1IBLQ 1XNRQ 4QCLA 3GTOA 2QILA 4O42A 5KRUA 4MA0A 2Z6KA 1Q90A 4Q5VA 4RWSC 4Q45A 2HVSA 2KOLA 3PO2H 1PFNA 4CDCC 4PMCA 1XYIA 1HA6A 1X55A 3MWDA 2K7VA 1XDNA 3S2DB 2NZOA 4LH7A 3OIQA 4O3NA 2R8KA 2ENBA 1HZ9A 5HGTA 5KFAA 4IHJF 3S1NB 2YRXA 4ME5A 1RHPA 1HUMA 1B3AA 4JI8Q 5FO8B 4DR6Q 2WAQA 1TKWB 2QGQA 1UE5A 3CQZB 4YCVA 1YJWA 1EY4A 2B2VA 5GAHC 3K5LA 4QIWA 3VMMA 3DLLA 4BY7B 2EOTA 3DUZA 4IOCA 4O3QA 2YCHA 2F4IA 1ULZA 4JV2A 5HBRB 5JJLA 4BY1G 4LF6H 4B9XA 2VA2A 3RNUA 1I7LA 1X65A 3FKIH 4FF2A 2RCNA 4JW0A 3SK6A 4M1UB 1D2BA 1BO0A 4OWXB 2VQDA 3PO3G 1A2UA 3CXCA 2UUCQ 1LT3D 5C44H 2R92A 5E7NA 2R93B 1STAA 1KEEA 1B7YB 1RTNA 3JAMi 3OHBA 3HOXH 1CKNA 1UE6A 4KHZA 1DIKA 1PH9A 2MGSA 2F0IA 2PZTA 1NMFA 5EKKA 4ZUJA 4DAVA 4JI6Q 2NU6B 4LFBH 2Z6KC 1E0BA 2EYOA 2J6UA 3CVZA 1EIGA 1Y1WA 2HCCA 4XT1B 4A3DH 1LABA 3S1RH 2VW9A 5JVG3 3F8NA 2XGPA 4IUUA 5AFWA 4HCEA 1EU3A 2PZWA 2O2LD 1ZEQX 4RGMA 3H3VC 3F2DA 3M3YH 2A68C 2N88A 2KHSA 5C4JB 3ULPA 2KEEA 3M4QA 4PQXA 4H0LC 2KCNA 4BBRG 5C3EG 4YCWA 1AZQA 2QDLA 2E8GA 1PFBA 1N34L 3K3VA 1YHBA 3MTSA 5IYCH 3MA2B 4C5AA 4P2CB 4QW9A 4ID6A 1GUWA 2HT1A 2HIVA 5E3FA 3GTMB 2RDHA 3EBEA 2DIKA 4WJWA 1IKLA 4DUZQ 2J7ZA 4DV6L 4ECTA 2JA7G 5IYZF 1VQFA 2R7KA 2K6AA 2YYAA 4QGUA 3V4SA 5KFSA 4HJAA 5M5YB 5DGBA 3EJIA 3OPOA 3I4LA 1IBLH 3NBIA 1S5DD 3S9WA 1VDZA 2XC9A 3EQLC 4GZYC 1K83H 1A6XA 4K0KQ 2AKWB 4B3MQ 1S0OA 2ZXRA 3JSNA 1S3OA 3K7AB 3T5JA 2ID0A 2BA0A 5DNFA 3Q2OA 1QVGA 1JQYD 1C4QA 2ALYB 4UPAA 4ECUA 1K3BC 1L1OA 5ELBA 2P0AA 4ED1A 4DR7Q 3KF8A 4HYKA 4IRDA 4DR6H 1TWAB 3OOCA 1U4RA 1A3VA 4UP9A 2WB1G 2RDIA 3MXUA 4IRCA 1NR2A 4NLGA 4NP5A 4GLAC 2K33A 4Z9CB 1WCMA 4YAJB 2UVRA 4LSAA 3M4OB 2J6SA 2DNCA 5EWGA 1E22A 1HNZL 1BF4A 1D5MC 3ICEA 3QIAA 1SE3A 4XDXA 4DAMA 3GTPA 1M1KC 3U4VA 1A3UA 1QCBD 4IALA 3E6ZX 4DR3L 1B50A 2UUCH 4X3UA 5D3DA 2CW0C 5H80A 1N32Q 5IWAH 3V05A 5FJ8G 1HRJA 1IW7C 2E2DC 3TS0A 1M7JA 4YR0A 2MQHA 3BDCA 3HS0C 3MZ5A 4QWBA 1XNQH 4JI6H 1DM0B 3VYSA 5F9NA 3SVMA 5IYDG 1S9FA 1DV1A 1N33Q 5COYA 3CD6A 1J8IA 5KFKA 2JA5A 3RLNA 1HNXL 2EYHA 3J81L 2JEIA 3TEHB 1EU4A 1KRSA 2G9HD 1OXVA 3ETJA 2RKSA 4YY3Q 4GN5A 2IX1A 4UCOA 3I4MH 3OMCA 2RDJA 5FPOA 3F8TA 1VQ7A 2W9CA 4A3IB 5KFMA 4JC0A 1OXSC 2V1CC 1FNVA 4KHPL 1GM5A 2OF1A 4DUYL 4EYHB 3KF6A 4R8UA 2FFKB 1SRUA 3DMUA 2UUBL 4DUZH 1J6QA 1TWFH 1I4XA 4PZ6A 2I46A 1RJTA 5LL6X 4I7HA 2K01A 3BA8A 4PMBA 3OSNA 1PH7A 1CSQA 3BS1A 2CWPA 4X64L 1J5EL 4KKSA 4YWLA 2R7MA 1T5XD 5DM73 1SEIA 4DGZA 4Q8FA 2I07B 1CS0A 1V1OA 5CB4F 1X32A 3TIGA 2RF4A 3ORRA 4K0KH 4B3MH 4LW1A 5FLXL 4MV8A 5KFVA 2VR1A 3F1ZA 1QNUA 1H9KA 1O80A 2JEBI 2A6HD 5M3MB 4XZ3B 1TWCB 3ZYYX 2JA8G 3E5SA 2YTYA 1H9SB 3A74A 4P71A 3UDGA 4OWWB 3ETHA 2EJFC 1UWVA 1WR2A 4XX0B 1SFOH 1EFID 2BQRA 3MFHA 3HP3A 1SNPA 3SI8A 3U9TA 4CJ1B 5ELNA 1IHZA 4MTEA 1PTOD 3PW0A 2J0TD 1OTCA 2BH2A 1NJIC 4IUQA 1G291 3URYA 2OLSA 4O2AF 4F7XA 5C5JA 1EQQA 1SYCA 3OTOL 4FP5D 2R84A 5D8DA 4DV3L 4U68A 3QO2A 2IBKA 1KL9A 4PV1C 3VR4A 1IL8A 2SNMA 1DOLA 4GC6A 2MJ8A 2NN6I 4DR5Q 2NVTH 3LX0A 3BA9A 5AJ3Q 3K5MA 4DV7L 1B04A 3NK9A 4LF9L 2BR0A 3I4NH 1UE1A 4Y52H 1N9WA 3PUYA 1STNA 1YZ6A 1K28A 2EYMA 1B6RA 2BE5D 1HNWL 4MV4A 1N32H 3RGZA 2R7ZA 4L6TB 4RB2C 3R5FA 2AUKA 2D0OA 4DL2A 1KAWA 4JVZA 1ZQ7A 3NWTA 1MBYA 5KGUA 2E2IB 1EQVA 2K1BA 4MTNA 4B08A 1TS3A 4HTHA 1MHWC 4UHVA 3RB4A 1G91A 1VF7A 2NVQH 2HHHQ 2A69D 3HOYB 3KYHC 1PHJA 5EOYA 1UNSA 3O13A 5KFEA 2RSOA 2JXMB 1DV2A 1YBYA 3TP8A 1AW7A 4CHTB 1PTOH 3PUWA 5I4DA 4ALPA 1A3TA 4YY3H 4EQ5A 1EUCB 3DEOA 4P73A 3HOVB 4IPCA 1WD1A 1JKJB 3ULLA 2EQSA 4IFDJ 3FDSA 4MZ9A 1S0MA 2L5TA 1UE7A 3I7FA 3ONAB 1SE2A 1O7YA 1R9TA 4A3LH 3EIVA 3S2DH 3QG1A 4A3FG 3TIIA 1IBKQ 1F9PA 3JAME 1VS0A 2QEXA 2K4KA 2B63G 5JJIA 1DCZA 5LA6F 2LS01 4QWDA 3S1NH 1B3QA 3A7AB 3SK4A 1DZ1A 1QE6A 1QNKA 4JI2L 3BVGA 3CQZH 5L37A 5KNCA 1JJCB 1I4PA 2K28A 5J3BA 1L0WA 4GLXA 1XMOL 3QOLA 5KFUA 3PMFA 2K14A 5KEEA 4RB0A 3KHHA 4BY7H 1EOTA 1WTVA 5BPFA 5KFTA 2Q2IA 2R8JA 4G3IA 1OXUA 2DLNA 2A6ED 3N52A 4K5XA 3SEBA 1E4FT 2VUMB 3RJ0A 1B4OA 4JBKA 2V5AA 4J9NA 2BOSA 3CU7A 2YTVA 4RGTA 1SN8A 2ZDHA 1G2SA 3GQBA 3J81c 2F0TA 2XGTA 1I7NA 4JI1Q 3KDFA 2CFMA 2BDNA 2HVRA 2W9BA 5FD5A 3S1MB 2DZDA 2R93H 2DPJA 4KMUC 3A5ZB 5M3FG 3RUPA 4F8MA 1VCIA 2PQAB 2AMCB 1G8ZD 2X6LA 5LMUQ 2FPGB 3WDNA 2C22A 4JV1A 1L0YB 4QQBX 2J9GA 5E4XA 4DR5H 4LF4L 3V6KA 5KG6A 3TRZA 2G5DA 1VQNA 4J9QA 1VQDA 4NXML 3LP8A 2R92G 3ER0A 5BR8H 4HN7A 4DFAA 3H0GA 1NAPA 4E6IA 1DOMA 3SDZA 4K5WA 3W1BA 5C4JH 4P75A 2Z4HA 4JV5L 1K8AC 2W6QA 4IR1A 1EL0A 5LL6S 1PH5A 3OSOA 4RA8A 4WRDA 1Y1WG 3OW2A 3X3MA 2PNHA 4BY1B 2UVUA 5CV7A 4LFAL 4CBVA 5FLXc 2HHHH 3MR6A 2F0OA 5A2QL 1Y1VA 4OO1I 4UP7A 3PO3B 2JN4A 2R7NA 2KENA 2R61A 4DN4M 2FK1A 1GOZA 4A3CH 2SNSA 5KKNB 4PDBA 4TV8F 5M5YH 5H1SE 1LO5D 1KLGD 3P20A 3PSIA 3G71A 1SCUB 4JI5Q 3V2TA 1MIUA 1YNJD 3PV0A 1VQ8A 2E5LL 3VPBA 2F0LA 1RDPD 4KK7A 5D14A 4C3IG 4FM9A 2PBZA 1S5BD 1HR0Q 4ZCKA 3OSPA 3OUZA 1XJVA 4RAZA 1STYA 5GAGC 4WJ4A 2ZM6L 1VQPA 1IBKH 4DV5Q 1U4MA 4DK6C 3T5HA 2I5HA 1IYUA 5D65A 3IRBA 1VQCA 5KT4A 1KJIA 3RIZA 5KFCA 2QA4A 2TSSA 1IOVA 4LUOA 2YTXA 1LV9A 5M5XH 4BBRB 1EZ8A 2R7FA 4JK1C 4AQYL 2NN6H 5CV4A 2DGYA 1IKMA 2ES2A 1UNNC 4ECRA 5JEAG 4MV1A 4NXNL 1KXLA 2D0PA 1Y8PB 1VAJA 3JC66 2F0EA 3M4OH 4G57A 1VMCA 2JA7B 3VYTA 5CV9A 4IWYA 4ZKCB 3SR1A 2F52A 4KN7C 1TWFA 2CH4A 4UCUA 1VBHA 2R8HA 4JI1H 5KFNA 5T1GA 3CCQA 1I6VC 4QWEA 3L7ZC 3KLSA 4GLVB 1RJRA 4HR7A 2YW2A 4H13C 4XQNA 1WYDA 2XRSD 1RTOA 3R5HA 1AH9A 1A9XA 1SMYD 2RDGA 2KVMA 3TINA 1E4GT 1FGUA 3I72A 1V9PA 2W6ZA 2GVBA 4ZOLF 2C35B 2F0HA 1W93A 5LMUH 4CC6A 1SDFA 2W71A 2F3WA 2FLPA 2R87A 5KFDA 4B9WA 1TY2A 4LH6A 2F0VA 1SYDA 4DV7Q 4LF9Q 3K0YA 3I73A 2FMMA 4JV0A 1EZ6A 4YCUA 1JWUD 4I7AA 3KHLA 4R8IA 1XMQL 1XTCD 1Y8OB 3FRPB 3BZDB 4GOPB 2F0DA 3BZCA 2KUMA 1ESFA 5KT5A 2BH8A 3GV8B 3V6JA 3H20A 1PRTB 4Y7NB 3J80L 4AH6A 2JA5G 4X62L 4IFDG 4A3IH 3BQ0A 2LXJA 1AE3A 2W9AA 3M9NB 1V4YA 1YNND 5C4XG 2FLLA 4L1KA 3QJYA 4MV9A 5IGEA 2ZXOA 1DYQA 1HA5A 4I7ZC 4KN4C 4QJFA 4X6AH 4HQ6A 5KYLA 3VR5A 4WBNF 4U6PA 2K5VA 3K8AA 1E7ZA 3TZUA 1IBML 4JI5H 1K73C 3BG3A 3GIJA 2R6FA 2Y0SA 3J81W 2ZXPA 1AZPA 4GKJQ 1B6SA 1VQHA 1HTLD 1QZGA 4LF7L 2I80A 3TQ1A 2Z0SA 1HR0H 2QK4A 3RFCA 5KFQA 2A1AA 5M3MH 1BQQT 1TWCH 1F9SA 3NSWA 1X9NA 2CQAA 2IT1A 1FNUA 2I87A 4DV5H 4K5VA 4EEYA 4RKLA 4CDFC 4ECQA 5CV5A 3CC2A 1SAPA 2CWAA 2LMCB 1ZXTA 2B2TA 1E2ZA 2KCTA 3NTKA 3WOEA 3GTJB 3ERSX 4JI3L 1GSHA 1NNXA 2SEBD 5A35A 1WH2A 1RYRA 1XMOQ 2JA6B 1KC7A 3DWAA 4LFCQ 2WACA 3GIPA 5C0XG 2IL8A 1HZBA 1CZGA 2M00A 1I5FA 1TWGA 2BDOA 4X65Q 1Y14B 2PMZA 2OQKA 4DL3A 1PZID 2FJ2A 4IUVA 2FHTA 1RJQA 4A93G 2OQ0A 2DUDA 5IIFA 3BZKA 5LL6b 1T3NA 5IP9H 4A3JG 1I94L 1BXTA 5F2DA 4JI7L 3ERQA 4RU9A 2AQ3B 3TMEA 2CQOA 2PW5A 3VPDA 1E2VA 1O78A 5FLXW 1NSNS 2OEOA 4YHHL 4JCVE 4X3KA 2ZJQA 3TS2A 2VS1A 3RMHA 3E0JA 3M7GA 4OO1H 1R4PB 5KFHA 2QCPX 3PO2G 3M9OB 2J6TA 3VR3A 3GILA 4JOIA 5KFFA 2E2IH 4K6DA 3IAYA 4GKKQ 1K1SA 1VQ4A 4B3SL 1N36L 1EEFD 4LF4Q 3HOYH 2R6GA 4B3TL 4NXMQ 5JJZA 5T14A 3UI2A 2NVXA 4QF4A 2MCTA 1G51A 3GTKB 5HV6A 1N48A 4BBSG 3KALA 4IUTA 5KT7A 2L55A 1PYBA 2B2TC 4DV4L 1ASZA 5G3LD 3H6MA 1Q8IA 2V9WA 3GD7A 3EYYA 3IFDA 1W6KA 5DM63 1OWTA 1WOCA 4MNOA 2B8FA 2K50A 1RF2D 1B44D 5E4WC 1T9HA 2B8GA 4O0AA 4KJNA 2DPIA 1SEBD 2NZ1D 1M0TA 4L5RC 3K57A 5IT9L 3TP5A 5C44G 1XPUA 4KD3A 5K36H 4HEDA 4RAUC 5BPHA 5D1OB 4IR9A 1F9QA 2PZUA 1BR9A 2WV6D 3PF4A 1K1QA 2JJQA 4RZQA 5DLFA 2UUAL 4IQZA 2BE5C 1H9RA 2VL6A 4HJ7A 5IGCA 3BDOA 4A3DG 2WFWA 2PO4A 4GKJH 1JICA 3SHLA 4DAPA 2FB9A 1VQ9A 3J7AK 4JOIC 1EIHA 3I2ZA 4RFBA 4BWGB 3MEHA 3BYYB 2VUMH 3T5KA 3LNNA 2NBFA 3SXHA 4HIOA 4RUAA 2YU9B 2EJGC 3BDLA 4TKOB 4LF5Q 1HHVA 5KFYA 2XCAA 2AQ4A 4RMFA 4C3JG 3A5UA 4IJHA 4C1NK 3CAMA 4RB3C 1GKHA 4AQYQ 4M9UA 3GTLA 1V1PA 4V0BA 3VYRA 1GJXA 3S1MH 4LFCH 3IG0A 4UCRA 3Q8SB 5C1OA 2E2HB 1YHQA 2R82A 4NXNQ 2IY5B 3PQIA 1QUQB 3CW2C 1I6HB 3HOWG 3H4BA 4X65H 2F4VL 3HKZE 4O2BF 4O1NA 3J80c 4A3FB 1EQRA 3JRWA 2AGPA 1BCPF 2B63B 2F0SA 4GS3A 4DV2L 5IGGA 4FXDA 3KAKA 3OUUA 2JQOA 4J1MA 2F0WA 3GTOB 5K2MA 2DWCA 1KC8C 1YITA 1I3QA 2R86A 4KKUA 1X56A 1F2ZA 3A8KE 2A5HA 2Z4IA 3KOJA 4FF3A 3SK8A 1FD7D 3DF7A 1GO3E 4C3HB 1WJJA 1I4RA 2R8GA 4GKKH 4LF8L 3V96A 4LF4H 3D6WA 2MNAA 2AHOB 1ZYRC 2WAQB 3H0GG 2PPBC 4F4XA 4NXMH 3PO3H 3CKIB 3I12A 5LMNL 4IURA 1I50A 4QIWB 4B3RL 3RB0A 3J7ZC 1XMQQ 1BCPC 3VR6A 3CCSA 2UXCL 3NTIA 1TR5A 2PQEA 3A8JE 3VPCA 2W6MA 5M3FB 1XNRH 2M9VA 4J6HA 1Q7YC 4P72A 3KK7A 3PW7A 3BVMA 1PZJD 1RIPA 1Y1VG 2IX3A 5JAVA 2ATLA 4C2MA 2LKVA 3CRKC 3GTQA 2WP8J 2R92B 2LSSA 4KY6A 1PXUA 1X6OA 4QMGA 2Q2UA 2Z6BA 2UU9L 1NTGA 4JI8H 5JVLA 1CKNB 4TSSA 5FK9C 3K59A 2PYKA 3A0JA 2VOBA 5EPLA 5DLGA 3EPIA 4EQPA 5A2QW 4DR4L 1IBMQ 1Y1WB 4N8X1 4BBRH 1TWHA 4HIMA 1SSOA 4RKBA 4LF7Q 1LACA 2F0UA 1PRTD 4PZ7A 4IRKA 3GQCA 1GYFA 1SNOA 4PZ8A 2JSOA 4ZQIA 2JEFA 3S24A 5JVH3 1C8CA 3P7JA 1YI2A 4LF5H 4APMA 3J7AF 3Q23A 4Q0YA 5C1PA 4JI3Q 3RBDA 5ELFA 4JI4Q 3AU7A 1CFMA 4DA2A 3P75A 4A3KG 1I6UA 2C9OA 1ICWA 4C3IB 1HH2P 3LWBA 3MFYA 4NXNH 1G6ZA 1U0LA 4QB4A 1WSCA 3KLSX 4MV3A 3AQQA 2W6PA 1KAAA 5DLQE 4UP8A 1PA6A 4TV9F 1ET6A 5ELEA 1UEAB 1B70B 4DL6A 5IT9c 3GTGA 1ML0D 3HKZA 4YHHQ 1MJCA 1OO9B 1VQAA 4DL7A 4N8FA 5JPNC 5DQHA 4YBZB 1X3GA 4JI0L 1STEA 1S68A 4O3SA 1SE4A 2ZTDA 3Q6SA 1BUVT 1KDCA 2KJXA 1KRTA 4BXXG 2HUGA 2Q2TA 3KFUA 3TREA 5LP6F 3I90A 4A3EB 2MPMA 1L1OB 3I8ZA 2CW8A 2XD4A 3LMLA 2BQ3A 3OIPA 5J2TF 4B3SQ 4DLKA 2F0FA 2YYZA 1N36Q 4RNMA 2H4OA 4Y7NH 2D9UA 3KF8B 3D4WA 4B3TQ 2EYLA 5CV6A 4O3PA 4IJLA 5KG0A 3H4DA 4MHEA 2Z9HA 1NUCA 1X3PA 2K5HA 2RA4A 4DV0L 2YL2A 5L1IA 1XMQH 3T5LA 5K5PA 2AUJD 2EY2A 2HDLA 2QEJC 1LTGD 4FVMA 1M8AA 4DV4Q 1CHPD 5FJ8H 3D4DA 4DKAC 3GIDA 4AYBE 1VQJA 1WCMB 3K80C 2NVYA 1SR3A 2BQUA 1TVXA 4KY7A 2AQ1B 2I0QA 3RV4A 1D5ZC 1WTOA 1C3OA 3PW5A 3GTPB 5LXTF 5IYDH 2K5QA 4HMJA 3K5HA 3CF5A 1STHA 4PG3A 5HURA 1D5XC 5IP7G 1F2YA 1PVOA 3UDFA 4DR2L 2UXBL 4QW8A 4A2BA 4DR7H 3FVQA 4DR1L 2XIGA 5BN3A 4IZ8A 4A3BG 4KTAA 5FLMG 3NENA 3J80W 4IOAA 2Y0SG 1H9JA 3GTJH 1IBMH 5BMVF 3MHBA 1JOOA 3TP7A 4UCTA 5C5MA 2PVPA 2V4DA 3PIOA 2JA6H 3M7NA 2CH4W 1DD2A 2WKCA 4NMZA 3Q1KA 2CKZB 3T1YL 5DG8A 1M6VA 4AIMA 4DK1A 4DNRB 2JA5B 2SOBA 4WD3A 4KLKA 1D1IA 4A4IA 1VQMA 1NMGA 3C46A 1JJ2A 3MXNA 4JBWA 3KHRA 4O4IF 5C4XB 4HIDA 3OWEB 4L8JA 5HY6A 1A0IA 4V190 4BA1I 3FPPA 2DJGC 2I8CA 2RBMA 3GV5B 1W96A 4RAYA 3D8GA 1SMXA 3UE0A 3NXWA 3WWVA 1LTAD 4NKLA 1LTRD 3RLOA 1PH4A 1UAPA 4JI4H 2OTLA 2W9CB 4HMIA 4X66L 4H02A 1G6PA 5IE8A 5EQ0A 4OX9L 3RN5A 1HUNA 1K0SA 4R8UB 3LGJA 2F4VQ 2ZT9C 4NPSA 2VQFL 3FKIA 1DOKA 2VQEL 1N33H 4K14A 2QF7A 1KDBA 5IYBG 1YIJA 1CK1A 4YWMA 3Q0AA 4EG0A 4F50A 1MD2D 4HJ8A 2K32A 4O4LF 4ZK9B 5IOCA 4YHHH 1W6JA 2RDFA 4Q43A 4EBEA 3PIPA 3GTKH 3E9HA 3OYYA 3PIO3 3CCEA 1GHKA 2YZMA 1JWMD 4OELB 4EFBA 2L11A 4A3GG 1N34Q 4HSPA 2Q8RE 3MR5A 5C8YF 2RHSB 2X6GA 4RCOA 4CDDC 4LF8Q 1JB3A 2UXDL 4B3SH 3CMAA 1N36H 1I4GA 2ATWA 4JYAL 3CCVA 4FBTA 4GN3B 3PUVA 1FNWA 4A3JB 4DV6Q 4R8NA 3A55A 4RHRA 3OMGA 4I65A 2PN1A 3W3AA 2W6OA 5IODA 3HEJA 2UXCQ 3MWYW 3F2UA 3E3XA 1HXYD 4MN3A 4C1NI 3PO2B 3FEWX 4DV4H 4EEQA 1FJGL 3EPGA 4LF6L 4C56C 5DQIA 1B9NA 2F3VA 3AFQA 3EN2A 3FDTA 5FO9B 4GNXA 5LHY1 2F03A 3K6OA 1NBWA 3M9MB 1M4VA 4LUVA 2N3SA 4AYBA 3C1FA 4L63B 1ESRA 2A68D 3D31A 3U9SA 3M4IA 3RF2A 1LTBD 3CCRA 1QVCA 4ECVA 2Z1CA 3AYHB 3PIP3 2R7ZB 3KBXA 1EIYB 3GO5A 2R7DA 2YU9H 1JDBB 4BBSB 3FHWA 4OL7A 2W8LA 2MHVA 1MSGA 4A3MG 3DXJC 3U50C 1JMCA 1BGWA 1UC9A 4LFBL 4DK0A 1N8RC 2EVBA 1K83A 2CZGA 5IT9W 5EAYA 3HFZB 3BJYA 2E2HH 4XIGS 5GONF 1K9MC 3CMEA 1STGA 1SNDA 1I6HH 2ICEC 2AQ2B 4ED6A 3LWEA 4XYMB 1HNZQ 4A3FH 2IX0A 3KBGA 4NDXA 3J81i 4A3CG 3GDEA 2B63H 2J4XA 4DR3Q 3HZXA 2ZTCA 4WJ3M 1KLUD 5KX5F 1MKHA 2BA1A 5L9XA 2V58A 5IGFA 3GTOH 4QUCA 2F1MA 2O03A 3OHXC 4DAYA 3ULJA 5IY0A 2K52A 5KG4A 2NU9B 5KG2A 2F0KA 1U5KA 5KFPA 1R9TB 4HCSA 4QWCA 3T51B 1B9MA 3I3CA 3H3VH 3PGZA 4C3HH 4CDEC 4GNXC 3M3YB 1Z2NX 4NB3A 3BG5A 3GTMH 1S5FD 1HNXQ 4YR3A 3KLWA 5DAUA 3MJFA 5KG7A 3W1GA 1YJ9A 2A73B 2L15A 4C3JB 3AMUA 1P16A 2NN6G 4JPBW 1C7YA 3TQTA 1VQGA 5CV8A 2XTIA 1TS5A 4OXPA 1EFWA 2L4NA 1AN8A 1HCZA 1BXRA 1EEID 1N34H 5EZYF 3UDIA 3DM1A 2E74C 5C3XA 3HOWB 4TRDA 2YZGA 1CSPA 4MA5A 2Q2HA 4LF8H 5EJWA 1C30A 1T5EA 3K7AH 4KHPQ 4DUYQ 2HIXA 3CCUA 2UUBQ 1WI5A 5BN5A 4CC5A 2FINB 2CW0D 3KDFB 4DV6H 5CAEB 1RODA 5C0XI 5IGBA 1B2TA 2W9BB 4DR6L 2R92H 4IUNA 3CCJA 4ED8A 2FK3A 3Q22A 1PMRA 5KT2A 1IW7D 4RGOS 5I9OA 3DM3A 4KKTA 4F4WA 1VQOA 2ASJA 2UXCH 5M9OA 3V6HA 1RCVD 1TWAH 3PCOB 4FNFA 3T16A 4X64Q 1PH8A 5C3EB 1J5EQ 1SJHD 2PI2E 4HNUA 3D3RA 1E1TA 1QZHA 4ED3A 2B2UA 1Y1WH 3H94A 3S2HB 3Q8QB 1E4EA 5LMNW 2F0JA 1SLJA 4ABNA 4N9PA 5C4HA 1K8OA 2EIFA 1PH3A 1HQRD 2Q8IB 1B33N 3C0FB 3E5NA 1K0RA 1EYDA 1JOQA 4CKBA 3H0GB 3T56B 2W57A 4UFZA 4ZKBB 5CA1F 3NTHA 2UUCL 3RR5A 2UXBQ 1EY8A 1IL2A 1KTKA 1U4PA 4G7OC 5FD6A 1EWHA 1VMPA 3DHQA 2IMWP 3SE7A 5IWAL 4CGYB 1JE4A 2H5XA 1F9RA 2NYZD 3IL8A 1CA5A 5CBEE 4POGA 2E2JB 4ULLA 1XNQL 4J9RA 4JI6L 5M5WB 2EYPA 1ASYA 3OTOQ 5FPRA 4DV3Q 1BBWA 1Y1VB 4JBMA 4C3IH 2BCOA 4JG2A 4EGVA 5KYIA 2FMCA 4DK3C 2KSWA 2Z8LA 3MXGA 1LTTD 4K8JA 4YWKA 1HNZH 1ONLA 3DWPA 5CYUA 3L9AX 5FOBB 5KFBA 2MFIA 2C2EA 1JLLB 4ECWA 1SFOA 5FKAC 1PYSB 3JRXA 5D1PA 3RAQA 5J1ZA 4DR3H 4YP3A 1CM9A 1QILA 2EY6A 3NBHA 4HIKA 1HNWQ 3QFFA 1O7IA 2WB1B 3JAML 4U7CA 5CORA 3HOUG 3FP9A 4YIJA 4X66Q 2VNUD 1BKBA 4ECSA 1GUOA 1VQEA 4DPGA 1MSHA 1ZHSA 4FO2A 5I2XA 5JEAH 1GUSA 2HQLA 3GIMA 2NTTA 2ZJPA 2B2UC 2NWGA 3KXYT 4A3EH 4DUZL 2MO0A 4EFEA 1TY0A 1HNXH 5CGKA 3HKZG 1O75A 1NCVA 3NQTA 4PNYA 3G4SA 2ZJTA 1GXDC 5KFXA 3GV6A 2IWHA 4L5SA 2DY7A 2N8NA 4A3KB 3H15A 1EQTA 4K0KL 4B3ML 1CE8A 4FXGC 1WCMH 2IJ0A 3NELA 2WAQE 2UXDQ 2HGSA 4DL5A 1C48A 1KBLA 3WNZA 4KHPH 4DUYH 2SDFA 4JYAQ 3GTPH 4QIWE 5IP9G 4C5BA 3VA5A 1IZ6A 1S0NA 2UUBH 3H40A 5KG5A 2NUCA 3A56A 1S4ZA 2OCEA 3EFXD 4HR7B 5KNBA 4CKEA 1CKMA 5I9PA 1C0AA 1CQFA 2SCUB 2K5WA 4J9MA 4OO1G 4I50F 3GLKA 4F88A 3M85A 3UE1A 1JOKA 4JI2Q 4X64H 4UY8C 5KFZA 1J5EH 3HOZG 1SYFA 1VQIA 3U58A 1FJGQ 3G6EA 1JE5A 2NTSA 2OT2A 4ODGA 4CKCA 1ILPA 1Q8KA 3R2IA 5ELCA 2IA6A 2HDMA 2KHJA 1TXYA 3I4OA 3FPUB 4HSVA 3RZOB 3RD4A 3BJUA 1PTOF 2PW7A 5LOVF 2UXBH 4ZQ3A 1MGSA 5CBAE 1N32L 3NE5B 2A8VA 4LSXA 3CQZA 1HFGA 1PX2A 4LFBQ 1PZKD 4ZUIA 3G6XA 3OTOH 2B29A 4FF1A 2X0SA 4DV3H 1PYWD 4UCVA 1CI3M 2JA8B 3KUPA 4K2LA 2A6HC 1Z2OX 4EBDA 5K36G 1JDEA 5KT6A 4DV7H 3B6YA 1PV4A 4LF9H 1JC7A 1Q46A 1E2WA 4K8IA 4TQUS 3J81j 3N6RA 2K04A 3KLRA 1WD0A 5GAEC 4A3BB 3CRLC 1EYGA 4KJOA 4YY3L 1HNWH 3D0FA 4MV6A 2Y0SB 4JV5Q 4RZRA 4WORA 1KJ8A 2R93A 1PTOC 1DONA 5JVDF 4OGQC 3HOVH 5C0XH 5I2YA 3FKIG 2C5CA 4LFAQ 3PN1A 4RHSA 2ICIA 2OWOA 4J8QA 2W7PA 4MAMA 1D6EC 2VUGA 1S97A 3PW4A 3Q8PB 1A2TA 3K5OA 1UC8A 2E76C 1KJJA 1QOHA 4ECZA 5KFJA 2FPPB 4XQQA 3K5NA 4PWQA 4LUZA 1HFNA 1Q12A 1KJ9A 3HOXG 1E24A 2L1BA 3F2CA 4ZI7F 5C3WA 3G6VA 2D62A 1TWGB 1VQBA 1FR3A 2AWNA 2XVSA 3TZDA 2PMZB 2E5LQ 3J81E 2C2RA 4OIKA 2UXDH 5C4ZA 1GSAA 4DL4A 4FS2A 1SJED 3RLFA 4JYAH 1NR4A 2A69C 2ASBA 2ZM6Q 1HQMC 3GTMA 1LTSD 5ISRA 2EY1A 2K5DA 3CPFA 2KHIA 2MUYA 4M8AA 3RV3A 1KIXA 2RGVA 2R7ZH 5I47A 3M4PA 1EY7A 4QUFA 3S16B 4BBSH 4JI2H 2XNAC 1I4HA 3H91A 3JAMc 4F4ZA 5IYCG 4A3GB 1XMOH 1XX8A 1JORA 2CQYA 1FJGH 4XYQA 1EWCA 1EIFA 2L12A 1GUGA 3Q8DA 4AYBG 4DV1L 4ZHQF 4DR5L 5AJ3L 5KNDA 4ED0A 2O4XA 3S14B 2NVXB 5BR8L 1JXLA 4TQSA 1ET9A 2KECA 1F77A 3GIKA 5FLXE 5IWAQ 2M05A 2JEGA 1CKOA 3CP0A 4CJ0B 4EVOA 3NHHA 2RGRA 3QOJA 1TWAA 1V51A 3AEVA 1EUDB 3R93A 1XNQQ 2ASLA 4A75A 4GC7A 1WTXA 4RGNA 1FYCA 3MR3A 2HHHL 3L4KA 4G7HC 1R9TH 3J80i 4BY1H 2VXWA 4IAJA 2A6EC 4O3OA 1ILQA 3V4ZA 3UFXB 2VPQA 1ZETA 3H09A 4KD4A 5JPMC 5L1LA 1BBXC 1B8AA 2DJFC 2LY7A 3CCLA 2V59A 1PDQA 4C3JH 1WFQA 5EGTA 4LK1C 4JV5H 1LM0A 2B2VC 4A3MB 1RYSA 3G6YA 2F0MA 1JIHA 5KFOA 4ME3A 1LUZA 3J7A5 5E1FA 4J9KA 1ENAA 4J9LA 4LFAH 3R8BA 5C6AA 4X62Q 3GV3A 4HAEA 1PH1A 3HOWH 1S72A 1GVPA 3EA6A 3NGDA 1IBKL 1BCPB 1Y8NB 1MJEA 1LTID 1EOVA 2P5ZX 2JA9A 2IP4A 2K05A 5D3IB 5JJKA 2F0QA 3GTLB 2KBNA 4KY5A 1V1PB 4DNTB 1LYLA 5EPJA 2PNRC 4XXEA 5J22A 3K81C 3C3LA 2K03A 3S17B 3RBEA 3RUZA 2WIIB 4J9PA 2HCIA 5C3EH 5IGDA 4F4YA 4R4CA 1Q81C 5DEHA 2E5LH 2OH2A 4YB8B 3G8CA 1Q3LA 5GQOA 3NPPA 2NZHA 3S2HH 1SNCA 3FMAA 2W70A 1XWEA 4LMYA 1IXRA 4DXGA 2ZM6H 1ZHQA 1Z47A
chains in the Genus database with same CATH topology
5JEAG 3H0GH 1Q1EA 3PIPA 2VUMG 3GTKH 1QUQA 3E9HA 3OYYA 4JI1L 3CCEA 2JA7H 4NXNL 4A93H 1KXLA 4A3GG 1N34Q 2D0PA 4HJ5A 3STBD 3JC66 3I4MG 1CUKA 3M4OH 2R7ZG 4A3JH 5HGQA 2RHSB 4LF8Q 2UXDL 4DNIA 2F52A 3CMAA 1IBLQ 2E2JH 1XNRQ 2ATWA 4JYAL 3CCVA 5M5WH 2Z6KA 4GN3B 5LMUL 3PUVA 3CCQA 1Y1VH 4DV6Q 4R4IA 3L7ZC 4GLVB 3PO2H 1WYDA 1KD1C 1AH9A 1X55A 4A3LG 2NZOA 1K8GA 2UXCQ 1FGUA 1I94Q 5ELOA 1V9PA 4JI7Q 1HZ9A 2GVBA 2C35B 1FJGL 2IHEA 4JI8Q 4LF6L 4DR6Q 3AFQA 3EN2A 2QGQA 4GNXA 4DV7Q 1UE5A 4LF9Q 3HKSA 1NBWA 4YCVA 1YJWA 4LUVA 5GAHC 2N3SA 3DLLA 4YCUA 3D31A 1OXTA 4IOCA 1XMQL 3CCRA 1QVCA 5JJLA 4BY1G 3AYHB 2MO1A 4GOPB 3BZCA 1EIYB 3GO5A 2R7DA 3RNUA 2YU9H 1X65A 1YNXA 1L1OC 3FKIH 2BH8A 1Q1BA 2RCNA 3FHWA 4OWXB 1VQ5A 3H3VI 3PO3G 4A3MG 3U50C 4AH6A 1JMCA 4X62L 2JA5G 3CXCA 4IFDG 4A3IH 1N8RC 4LFBL 2LXJA 1AE3A 3I55A 2UUCQ 5C44H 5EAYA 3HFZB 4JI5L 1FL0A 2K75A 4XIGS 1K9MC 2E2HH 2JA6G 5E7NA 3CMEA 5C4XG 1I6HH 1B7YB 1V1QA 4R4QA 3JAMi 4A3KH 3HOXH 1CKNA 1UE6A 4KHZA 1HNZQ 4QJFA 1PH9A 1HR0L 4A3FH 4X6AH 2IX0A 3J81i 4A3CG 1NMFA 3GDEA 4JI6Q 2Z6KC 2B63H 2K5VA 3K8AA 4DR3Q 3I4NG 2ZTCA 1BVSA 1E7ZA 4HJ9A 1MKHA 2BA1A 4DV5L 1K73C 1IBML 4A76A 2VW9A 3S1RH 4A3DH 3G48A 3GTOH 4R4TA 4GKJQ 1HJPA 1VQHA 3ULJA 1QZGA 1PH2A 4LF7L 3BU2A 5IY0A 2Z0SA 2K52A 3F2DA 3M3YH 1S40A 2A1AA 1U5KA 1UEBA 5M3MH 2UUAQ 1TWCH 3ULPA 1VQLA 1X9NA 3H3VH 2IT1A 3M4QA 3PGZA 2F3IA 4C3HH 1IYJB 4GNXC 4NB3A 3SGIA 4BBRG 4BXXH 5C3EG 4YCWA 3CC2A 3GTMH 2CWAA 1VQKA 2E8GA 1N34L 1HNXQ 2KCTA 3KLWA 1YHBA 5IYCH 3ERSX 4JI3L 4EX5A 3W1GA 1YJ9A 1XMOQ 4KI0A 2HIVA 4LFCQ 2L15A 2HT1A 1P16A 2NN6G 1C7YA 5C0XG 3EBEA 1PFSA 1VQGA 3RZOH 1HZBA 4DUZQ 2XTIA 1I5FA 4OXPA 1EFWA 4DV6L 5JEAJ 1Y14B 4X65Q 2JA7G 1VQFA 2FXQA 2OQKA 3UDIA 1HZAA 4QGUA 4A93G 2OQ0A 1SE8A 4HJAA 2DUDA 1PH6A 3KJOA 1CSPA 3PUXA 2Q2HA 3BZKA 5IP9H 4A3JG 1I94L 3K7AH 4JI7L 4DUYQ 4KHPQ 2HIXA 2CQOA 3CCUA 2UUBQ 1KQSA 1WI5A 3KF6B 4FDBA 2A19A 4P74A 4YHHL 1E3PA 1K83H 3KDFB 4DV1Q 2AKWB 4JCVE 5C0XI 2ZJQA 4B3MQ 3TS2A 2VS1A 4DR6L 2R92H 1S3OA 3CCJA 2JA8H 3PO2G 2ID0A 5BR8Q 3DM3A 4DV2Q 1VQOA 2BA0A 4LWCA 1QVGA 2ALYB 3T1HL 3PCOB 1TWAH 4UPAA 1PH8A 4JOIA 4X64Q 1L1OA 3PUZA 5IP7H 1J5EQ 2E2IH 4XTCS 2PI2E 4GKKQ 1VQ4A 1E1TA 1QZHA 1HZCA 1N36L 4B3SL 1Y1WH 4A3BH 4LF4Q 4DR7Q 1X3EA 5FLMH 2R6GA 1YJNA 3HOYH 1L2FA 3TQYA 5LMNW 4B3TL 4BY7G 4NXMQ 1SLJA 1Z9FA 4UP9A 2WB1G 2EIFA 1PH3A 1K0RA 1G51A 3VDYA 4BBSG 2PQAA 2UUCL 3RR5A 3CC4A 2UXBQ 1IL2A 1A62A 1PYBA 4GLAC 4QL5A 4DV4L 4J15A 1ASZA 1NE3A 5IWAL 3CPWA 2WB1E 2H5XA 4R4OA 1E22A 1HNZL 3GD7A 5LMNQ 3ICEA 4POGA 4DAMA 4B3RQ 4IPGA 1M1KC 1WOCA 4MNOA 3U4VA 4JI6L 1XNQL 2K50A 2R93G 1A63A 1ASYA 1T9HA 4O0AA 3OTOQ 1JJGA 4DV3Q 1BBWA 4DR3L 4JBMA 4C3IH 4JG2A 4L5RC 2JK8A 4DK3C 5C44G 1N32Q 1XPUA 1DGSA 4YWKA 5FJ8G 3NEMA 1TWGH 3MXNB 4GKJL 3TS0A 2B3GA 2MQHA 1X54A 2MFIA 3PF4A 2JJQA 1NY4A 2UUAL 1PYSB 2VL6A 4HJ7A 5IYDG 5IYBH 4HIKA 1HNWQ 1O7IA 1N33Q 2ZJRA 3CD6A 2WFWA 4A3DG 4RG1A 3HOUG 3FP9A 4IPDA 2UU9Q 3RLNA 3M9BA 1HNXL 4OONA 4X66Q 2VNUD 1VQ9A 1BKBA 3TEHB 1VQEA 4JOIC 4DPGA 3PF5A 2I5LX 3I2ZA 2HQLA 1KRSA 2VUMH 4LFCL 2ZJPA 4DR4Q 1OXVA 3S16H 3K7UC 4A3EH 4YY3Q 4HIOA 4A3GH 4DUZL 1M90C 2MO0A 4GN5A 2IX1A 4LF5Q 3I4MH 4X65L 4RMFA 3A5UA 3HKZG 4IJHA 3CAMA 3F8TA 1VQ7A 1GKHA 4AQYQ 3G4SA 1JT8A 2WAQG 4JC0A 1OXSC 2V1CC 3HOZG 3S1MH 4KHPL 1GM5A 4DUYL 3S14H 3KF6A 2NVXH 4L5SA 1YHQA 1SRUA 2UUBL 4NXNQ 2N8NA 2IY5B 1QUQB 3CW2C 1J6QA 3W5OA 3HOWG 3H15A 4K0KL 2F4VL 3HKZE 4B3ML 1TWFH 4PZ6A 5C0XJ 4IFDI 2I5MX 3CCMA 3J80c 1EQRA 1WCMH 1FVIA 1W3SA 3NELA 1EUJA 2WAQE 1BBUA 4GS3A 4DV2L 2UXDQ 1PH7A 1CSQA 3L2PA 2CWPA 2JQOA 4X64L 1J5EL 3GTPH 4JYAQ 4QIWE 4YWLA 5IP9G 1IZ6A 4GKKL 1XPOA 1KC8C 1YITA 1YEZA 2RF4A 4LW1A 2OCEA 1C0AA 3F1ZA 1X56A 1CKMA 2N49A 2JEBI 3KOJA 4OO1G 2JA8G 3L0OA 3M85A 3UE1A 1GO3E 2YTYA 4JI2Q 4UY8C 3A74A 1VQIA 1WJJA 4P71A 3UDGA 3U58A 2CCZA 4OWWB 1UWVA 1FJGQ 1SFOH 4LF8L 3E9IA 1IBLL 1XNRL 3G6EA 1JE5A 2VY3A 4POFA 4JI0Q 2MNAA 2AHOB 1Q8KA 5ELNA 3H0GG 4GNXB 2KHJA 3PO3H 4A3MH 5M3FH 5LMNL 1OTCA 1TXYA 2BH2A 4B3RL 1NJIC 4PMWA 1G291 3I4OA 3J7ZC 3ZJYC 1XMQQ 1EQQA 3OTOL 3CCSA 2UXCL 4DV3L 3BJUA 1KL9A 1C9OA 1Q7YC 4P72A 1N32L 3K0XA 2K5NA 2NN6I 1RIPA 2Y0SE 4JI8L 4DR5Q 2A8VA 3AFPA 5AJ3Q 2NVTH 1Y1VG 4DV7L 4DV0Q 4LF9L 3I4NH 4LFBQ 1UE1A 4Y52H 1N9WA 3PUYA 1YZ6A 2B29A 1W2BA 3GTLH 2WP8J 1EWIA 2LSSA 2JE6I 1AE2A 1HNWL 1QVFA 1X6OA 4GOPA 2Q2UA 3S17H 2UU9L 1NTGA 5K36G 2D0OA 1CKNB 1KAWA 2EXDA 3B6YA 1PV4A 1SROA 3A0JA 1Q46A 4MTNA 4TQUS 1X3FA 3J81j 4DR4L 1IBMQ 2NVQH 5GAEC 2HHHQ 4BBRH 1EYGA 3KYHC 4HIMA 4YY3L 1PHJA 4LNQA 3D0FA 4JV5Q 2GVAA 4DR2Q 4LF5L 4LF7Q 4DR1Q 4DAYB 1I3QH 3S15H 4IO9A 1D7QA 2PMZE 3HOVH 1YBYA 4PZ7A 3FKIG 4LFAQ 1LTLA 1RL2A 3PUWA 4ALPA 2OWOA 1XTDA 4PZ8A 4EQ5A 3S24A 3T1YQ 4P73A 4A3EG 4IPCA 3E0EA 4A3IG 3ULLA 2EQSA 3UDXA 1YI2A 4IFDJ 4MZ9A 4JI3Q 1UE7A 4LUZA 1XPRA 4JI4Q 1E1OA 1Q12A 3I7FA 3F2BA 4A3KG 2YV5A 3HOXG 1E24A 1I50H 1YHAA 3F2CA 4WJ3M 1HH2P 4A3LH 3EIVA 3S2DH 4A3FG 1IBKQ 2AWOA 1VS0A 1U0LA 2D62A 1VQBA 2AWNA 2K4KA 4L5QA 2QEXA 3CC7A 2B63G 5JJIA 5GADC 3AQQA 2E5LQ 3S1NH 5DLQE 4R1JA 4UP8A 1PA6A 4BA2I 1WCMG 4O2DA 1K3RA 1B70B 3RLFA 5IT9c 3CQZH 4JI2L 4GLXA 1JJCB 2ZM6Q 5J3BA 4OX9Q 1L0WA 2ASBA 1XMOL 1KHIA 1MJCA 2KCMA 2KHIA 3CPFA 2K14A 1VQAA 4JBJA 4C2MH 5M3MG 4GOPC 2VQFQ 4BY7H 2VQEQ 3GTQH 1X3GA 1KIXA 2Q2IA 4JI0L 2ZTDA 1OXUA 4L5TA 1H95A 2R7ZH 1KRTA 4BXXG 3M4PA 3T1HQ 2Q2TA 4GN4B 3TREA 3KFUA 4BBSH 3JAMc 4JBKA 4IPHA 1L1OB 5IYCG 2YTVA 1SN8A 4B3SQ 1N36Q 2YYZA 1EIFA 4Y7NH 3J81c 1P8LA 2XGTA 4APVA 4JI1Q 1TWHH 3KF8B 4B3TQ 3KDFA 2CFMA 3Q8DA 3STBC 4AYBG 4DV1L 4IJLA 4DR5L 4OO1I 5AJ3L 2R93H 2K5HA 4DV0L 5M3FG 3A5ZB 5BR8L 1VCIA 2PQAB 2AMCB 2ZTEA 5FJ8H 4DV4Q 1V43A 5LMUQ 1Q82C 4DKAC 4AYBE 1VQJA 5IWAQ 1CKOA 3CP0A 3K80C 4QQBX 1SR3A 4DR7L 2I0QA 3MEFA 4LF4L 3TRZA 4K0KQ 1VQNA 3AEVA 1VQDA 4NXML 1XNQQ 2R92G 3ER0A 5IYDH 4A75A 3CF5A 2GN5A 2IHFA 2HHHL 4PG3A 3HOUH 1R9TH 3J80i 4BY1H 3W1BA 5C4JH 4P75A 5IP7G 2RHQB 1K8AC 3UDFA 4DR2L 4JV5L 2UXBL 1PVOA 4LF6Q 4DR1L 1PH5A 1D8LA 1Y1WG 5GROA 3OW2A 3I56A 4A3BG 2PNHA 5FLMG 3HOYG 3NENA 4IOAA 4YHHQ 2JA5H 2Y0SG 4LFAL 3GTJH 2PI2A 1B8AA 3CCLA 5FLXc 3NBHB 3PIOA 3GTGH 2JA6H 5C4XH 2N78A 4C3JH 1WFQA 4UP7A 3M7NA 2CKZB 3T1YL 1LM0A 1Q86C 4AIMA 2KENA 3U4ZA 4KLKA 1VQMA 4A4IA 1NMGA 4TVAB 4JBWA 1JJ2A 1HR0W 2VZAA 2LXKA 4ME3A 4JI4L 1LUZA 4A3CH 3J7A5 4HIDA 3HOVG 5HY6A 1A0IA 4BA1I 4QY7A 4X62Q 3HOWH 5M5YH 5H1SE 1PH1A 1S72A 1GVPA 3PSIA 3G71A 1IBKL 1JB7A 4JI5Q 1SMXA 1MIUA 3UE0A 2OTJA 3PV0A 1MJEA 1VQ8A 1EOVA 3WWVA 2E5LL 2JA9A 1N33L 1OXXK 1A8VA 3RLOA 1PH4A 3S1QH 2OTLA 5JJKA 2KBNA 4X66L 4H02A 1HR0Q 5IE8A 1LYLA 1G6PA 1GD7A 1XJVA 3K81C 5GAGC 2ZM6L 3RN5A 1VQPA 4OWTB 4OX9L 4WJ4A 3LGJA 4DV5Q 2F4VQ 4DK6C 4NPSA 5C3EH 2VQFL 2I5HA 4R4CA 3RN2A 3IRBA 1VQCA 2VQEL 1Q81C 1VQ6A 5IYBG 5GQOA 3S2HH 2NZHA 2NVYH 4YWMA 2QA4A 1YIJA 3HOZH 2JEAI 4LUOA 2YTXA 3KJPA 5M5XH 4HJ8A 2R7FA 4AQYL 1IXRA 1YVCA 2DGYA 3RZDH 2ES2A 1Z47A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5JEA G;  3H0G H;  1Q1E A;  3PIP A;  2VUM G;  3GTK H;  1QUQ A;  3E9H A;  3OYY A;  4JI1 L;  3CCE A;  2JA7 H;  4NXN L;  4A93 H;  1KXL A;  4A3G G;  1N34 Q;  2D0P A;  4HJ5 A;  3STB D;  3JC6 6;  3I4M G;  1CUK A;  3M4O H;  2R7Z G;  4A3J H;  5HGQ A;  2RHS B;  4LF8 Q;  2UXD L;  4DNI A;  2F52 A;  3CMA A;  1IBL Q;  2E2J H;  1XNR Q;  2ATW A;  4JYA L;  3CCV A;  5M5W H;  2Z6K A;  4GN3 B;  5LMU L;  3PUV A;  3CCQ A;  1Y1V H;  4DV6 Q;  4R4I A;  3L7Z C;  4GLV B;  3PO2 H;  1WYD A;  1KD1 C;  1AH9 A;  1X55 A;  4A3L G;  2NZO A;  1K8G A;  2UXC Q;  1FGU A;  1I94 Q;  5ELO A;  1V9P A;  4JI7 Q;  1HZ9 A;  2GVB A;  2C35 B;  1FJG L;  2IHE A;  4JI8 Q;  4LF6 L;  4DR6 Q;  3AFQ A;  3EN2 A;  2QGQ A;  4GNX A;  4DV7 Q;  1UE5 A;  4LF9 Q;  3HKS A;  1NBW A;  4YCV A;  1YJW A;  4LUV A;  5GAH C;  2N3S A;  3DLL A;  4YCU A;  3D31 A;  1OXT A;  4IOC A;  1XMQ L;  3CCR A;  1QVC A;  5JJL A;  4BY1 G;  3AYH B;  2MO1 A;  4GOP B;  3BZC A;  1EIY B;  3GO5 A;  2R7D A;  3RNU A;  2YU9 H;  1X65 A;  1YNX A;  1L1O C;  3FKI H;  2BH8 A;  1Q1B A;  2RCN A;  3FHW A;  4OWX B;  1VQ5 A;  3H3V I;  3PO3 G;  4A3M G;  3U50 C;  4AH6 A;  1JMC A;  4X62 L;  2JA5 G;  3CXC A;  4IFD G;  4A3I H;  1N8R C;  4LFB L;  2LXJ A;  1AE3 A;  3I55 A;  2UUC Q;  5C44 H;  5EAY A;  3HFZ B;  4JI5 L;  1FL0 A;  2K75 A;  4XIG S;  1K9M C;  2E2H H;  2JA6 G;  5E7N A;  3CME A;  5C4X G;  1I6H H;  1B7Y B;  1V1Q A;  4R4Q A;  3JAM i;  4A3K H;  3HOX H;  1CKN A;  1UE6 A;  4KHZ A;  1HNZ Q;  4QJF A;  1PH9 A;  1HR0 L;  4A3F H;  4X6A H;  2IX0 A;  3J81 i;  4A3C G;  1NMF A;  3GDE A;  4JI6 Q;  2Z6K C;  2B63 H;  2K5V A;  3K8A A;  4DR3 Q;  3I4N G;  2ZTC A;  1BVS A;  1E7Z A;  4HJ9 A;  1MKH A;  2BA1 A;  4DV5 L;  1K73 C;  1IBM L;  4A76 A;  2VW9 A;  3S1R H;  4A3D H;  3G48 A;  3GTO H;  4R4T A;  4GKJ Q;  1HJP A;  1VQH A;  3ULJ A;  1QZG A;  1PH2 A;  4LF7 L;  3BU2 A;  5IY0 A;  2Z0S A;  2K52 A;  3F2D A;  3M3Y H;  1S40 A;  2A1A A;  1U5K A;  1UEB A;  5M3M H;  2UUA Q;  1TWC H;  3ULP A;  1VQL A;  1X9N A;  3H3V H;  2IT1 A;  3M4Q A;  3PGZ A;  2F3I A;  4C3H H;  1IYJ B;  4GNX C;  4NB3 A;  3SGI A;  4BBR G;  4BXX H;  5C3E G;  4YCW A;  3CC2 A;  3GTM H;  2CWA A;  1VQK A;  2E8G A;  1N34 L;  1HNX Q;  2KCT A;  3KLW A;  1YHB A;  5IYC H;  3ERS X;  4JI3 L;  4EX5 A;  3W1G A;  1YJ9 A;  1XMO Q;  4KI0 A;  2HIV A;  4LFC Q;  2L15 A;  2HT1 A;  1P16 A;  2NN6 G;  1C7Y A;  5C0X G;  3EBE A;  1PFS A;  1VQG A;  3RZO H;  1HZB A;  4DUZ Q;  2XTI A;  1I5F A;  4OXP A;  1EFW A;  4DV6 L;  5JEA J;  1Y14 B;  4X65 Q;  2JA7 G;  1VQF A;  2FXQ A;  2OQK A;  3UDI A;  1HZA A;  4QGU A;  4A93 G;  2OQ0 A;  1SE8 A;  4HJA A;  2DUD A;  1PH6 A;  3KJO A;  1CSP A;  3PUX A;  2Q2H A;  3BZK A;  5IP9 H;  4A3J G;  1I94 L;  3K7A H;  4JI7 L;  4DUY Q;  4KHP Q;  2HIX A;  2CQO A;  3CCU A;  2UUB Q;  1KQS A;  1WI5 A;  3KF6 B;  4FDB A;  2A19 A;  4P74 A;  4YHH L;  1E3P A;  1K83 H;  3KDF B;  4DV1 Q;  2AKW B;  4JCV E;  5C0X I;  2ZJQ A;  4B3M Q;  3TS2 A;  2VS1 A;  4DR6 L;  2R92 H;  1S3O A;  3CCJ A;  2JA8 H;  3PO2 G;  2ID0 A;  5BR8 Q;  3DM3 A;  4DV2 Q;  1VQO A;  2BA0 A;  4LWC A;  1QVG A;  2ALY B;  3T1H L;  3PCO B;  1TWA H;  4UPA A;  1PH8 A;  4JOI A;  4X64 Q;  1L1O A;  3PUZ A;  5IP7 H;  1J5E Q;  2E2I H;  4XTC S;  2PI2 E;  4GKK Q;  1VQ4 A;  1E1T A;  1QZH A;  1HZC A;  1N36 L;  4B3S L;  1Y1W H;  4A3B H;  4LF4 Q;  4DR7 Q;  1X3E A;  5FLM H;  2R6G A;  1YJN A;  3HOY H;  1L2F A;  3TQY A;  5LMN W;  4B3T L;  4BY7 G;  4NXM Q;  1SLJ A;  1Z9F A;  4UP9 A;  2WB1 G;  2EIF A;  1PH3 A;  1K0R A;  1G51 A;  3VDY A;  4BBS G;  2PQA A;  2UUC L;  3RR5 A;  3CC4 A;  2UXB Q;  1IL2 A;  1A62 A;  1PYB A;  4GLA C;  4QL5 A;  4DV4 L;  4J15 A;  1ASZ A;  1NE3 A;  5IWA L;  3CPW A;  2WB1 E;  2H5X A;  4R4O A;  1E22 A;  1HNZ L;  3GD7 A;  5LMN Q;  3ICE A;  4POG A;  4DAM A;  4B3R Q;  4IPG A;  1M1K C;  1WOC A;  4MNO A;  3U4V A;  4JI6 L;  1XNQ L;  2K50 A;  2R93 G;  1A63 A;  1ASY A;  1T9H A;  4O0A A;  3OTO Q;  1JJG A;  4DV3 Q;  1BBW A;  4DR3 L;  4JBM A;  4C3I H;  4JG2 A;  4L5R C;  2JK8 A;  4DK3 C;  5C44 G;  1N32 Q;  1XPU A;  1DGS A;  4YWK A;  5FJ8 G;  3NEM A;  1TWG H;  3MXN B;  4GKJ L;  3TS0 A;  2B3G A;  2MQH A;  1X54 A;  2MFI A;  3PF4 A;  2JJQ A;  1NY4 A;  2UUA L;  1PYS B;  2VL6 A;  4HJ7 A;  5IYD G;  5IYB H;  4HIK A;  1HNW Q;  1O7I A;  1N33 Q;  2ZJR A;  3CD6 A;  2WFW A;  4A3D G;  4RG1 A;  3HOU G;  3FP9 A;  4IPD A;  2UU9 Q;  3RLN A;  3M9B A;  1HNX L;  4OON A;  4X66 Q;  2VNU D;  1VQ9 A;  1BKB A;  3TEH B;  1VQE A;  4JOI C;  4DPG A;  3PF5 A;  2I5L X;  3I2Z A;  2HQL A;  1KRS A;  2VUM H;  4LFC L;  2ZJP A;  4DR4 Q;  1OXV A;  3S16 H;  3K7U C;  4A3E H;  4YY3 Q;  4HIO A;  4A3G H;  4DUZ L;  1M90 C;  2MO0 A;  4GN5 A;  2IX1 A;  4LF5 Q;  3I4M H;  4X65 L;  4RMF A;  3A5U A;  3HKZ G;  4IJH A;  3CAM A;  3F8T A;  1VQ7 A;  1GKH A;  4AQY Q;  3G4S A;  1JT8 A;  2WAQ G;  4JC0 A;  1OXS C;  2V1C C;  3HOZ G;  3S1M H;  4KHP L;  1GM5 A;  4DUY L;  3S14 H;  3KF6 A;  2NVX H;  4L5S A;  1YHQ A;  1SRU A;  2UUB L;  4NXN Q;  2N8N A;  2IY5 B;  1QUQ B;  3CW2 C;  1J6Q A;  3W5O A;  3HOW G;  3H15 A;  4K0K L;  2F4V L;  3HKZ E;  4B3M L;  1TWF H;  4PZ6 A;  5C0X J;  4IFD I;  2I5M X;  3CCM A;  3J80 c;  1EQR A;  1WCM H;  1FVI A;  1W3S A;  3NEL A;  1EUJ A;  2WAQ E;  1BBU A;  4GS3 A;  4DV2 L;  2UXD Q;  1PH7 A;  1CSQ A;  3L2P A;  2CWP A;  2JQO A;  4X64 L;  1J5E L;  3GTP H;  4JYA Q;  4QIW E;  4YWL A;  5IP9 G;  1IZ6 A;  4GKK L;  1XPO A;  1KC8 C;  1YIT A;  1YEZ A;  2RF4 A;  4LW1 A;  2OCE A;  1C0A A;  3F1Z A;  1X56 A;  1CKM A;  2N49 A;  2JEB I;  3KOJ A;  4OO1 G;  2JA8 G;  3L0O A;  3M85 A;  3UE1 A;  1GO3 E;  2YTY A;  4JI2 Q;  4UY8 C;  3A74 A;  1VQI A;  1WJJ A;  4P71 A;  3UDG A;  3U58 A;  2CCZ A;  4OWW B;  1UWV A;  1FJG Q;  1SFO H;  4LF8 L;  3E9I A;  1IBL L;  1XNR L;  3G6E A;  1JE5 A;  2VY3 A;  4POF A;  4JI0 Q;  2MNA A;  2AHO B;  1Q8K A;  5ELN A;  3H0G G;  4GNX B;  2KHJ A;  3PO3 H;  4A3M H;  5M3F H;  5LMN L;  1OTC A;  1TXY A;  2BH2 A;  4B3R L;  1NJI C;  4PMW A;  1G29 1;  3I4O A;  3J7Z C;  3ZJY C;  1XMQ Q;  1EQQ A;  3OTO L;  3CCS A;  2UXC L;  4DV3 L;  3BJU A;  1KL9 A;  1C9O A;  1Q7Y C;  4P72 A;  1N32 L;  3K0X A;  2K5N A;  2NN6 I;  1RIP A;  2Y0S E;  4JI8 L;  4DR5 Q;  2A8V A;  3AFP A;  5AJ3 Q;  2NVT H;  1Y1V G;  4DV7 L;  4DV0 Q;  4LF9 L;  3I4N H;  4LFB Q;  1UE1 A;  4Y52 H;  1N9W A;  3PUY A;  1YZ6 A;  2B29 A;  1W2B A;  3GTL H;  2WP8 J;  1EWI A;  2LSS A;  2JE6 I;  1AE2 A;  1HNW L;  1QVF A;  1X6O A;  4GOP A;  2Q2U A;  3S17 H;  2UU9 L;  1NTG A;  5K36 G;  2D0O A;  1CKN B;  1KAW A;  2EXD A;  3B6Y A;  1PV4 A;  1SRO A;  3A0J A;  1Q46 A;  4MTN A;  4TQU S;  1X3F A;  3J81 j;  4DR4 L;  1IBM Q;  2NVQ H;  5GAE C;  2HHH Q;  4BBR H;  1EYG A;  3KYH C;  4HIM A;  4YY3 L;  1PHJ A;  4LNQ A;  3D0F A;  4JV5 Q;  2GVA A;  4DR2 Q;  4LF5 L;  4LF7 Q;  4DR1 Q;  4DAY B;  1I3Q H;  3S15 H;  4IO9 A;  1D7Q A;  2PMZ E;  3HOV H;  1YBY A;  4PZ7 A;  3FKI G;  4LFA Q;  1LTL A;  1RL2 A;  3PUW A;  4ALP A;  2OWO A;  1XTD A;  4PZ8 A;  4EQ5 A;  3S24 A;  3T1Y Q;  4P73 A;  4A3E G;  4IPC A;  3E0E A;  4A3I G;  3ULL A;  2EQS A;  3UDX A;  1YI2 A;  4IFD J;  4MZ9 A;  4JI3 Q;  1UE7 A;  4LUZ A;  1XPR A;  4JI4 Q;  1E1O A;  1Q12 A;  3I7F A;  3F2B A;  4A3K G;  2YV5 A;  3HOX G;  1E24 A;  1I50 H;  1YHA A;  3F2C A;  4WJ3 M;  1HH2 P;  4A3L H;  3EIV A;  3S2D H;  4A3F G;  1IBK Q;  2AWO A;  1VS0 A;  1U0L A;  2D62 A;  1VQB A;  2AWN A;  2K4K A;  4L5Q A;  2QEX A;  3CC7 A;  2B63 G;  5JJI A;  5GAD C;  3AQQ A;  2E5L Q;  3S1N H;  5DLQ E;  4R1J A;  4UP8 A;  1PA6 A;  4BA2 I;  1WCM G;  4O2D A;  1K3R A;  1B70 B;  3RLF A;  5IT9 c;  3CQZ H;  4JI2 L;  4GLX A;  1JJC B;  2ZM6 Q;  5J3B A;  4OX9 Q;  1L0W A;  2ASB A;  1XMO L;  1KHI A;  1MJC A;  2KCM A;  2KHI A;  3CPF A;  2K14 A;  1VQA A;  4JBJ A;  4C2M H;  5M3M G;  4GOP C;  2VQF Q;  4BY7 H;  2VQE Q;  3GTQ H;  1X3G A;  1KIX A;  2Q2I A;  4JI0 L;  2ZTD A;  1OXU A;  4L5T A;  1H95 A;  2R7Z H;  1KRT A;  4BXX G;  3M4P A;  3T1H Q;  2Q2T A;  4GN4 B;  3TRE A;  3KFU A;  4BBS H;  3JAM c;  4JBK A;  4IPH A;  1L1O B;  5IYC G;  2YTV A;  1SN8 A;  4B3S Q;  1N36 Q;  2YYZ A;  1EIF A;  4Y7N H;  3J81 c;  1P8L A;  2XGT A;  4APV A;  4JI1 Q;  1TWH H;  3KF8 B;  4B3T Q;  3KDF A;  2CFM A;  3Q8D A;  3STB C;  4AYB G;  4DV1 L;  4IJL A;  4DR5 L;  4OO1 I;  5AJ3 L;  2R93 H;  2K5H A;  4DV0 L;  5M3F G;  3A5Z B;  5BR8 L;  1VCI A;  2PQA B;  2AMC B;  2ZTE A;  5FJ8 H;  4DV4 Q;  1V43 A;  5LMU Q;  1Q82 C;  4DKA C;  4AYB E;  1VQJ A;  5IWA Q;  1CKO A;  3CP0 A;  3K80 C;  4QQB X;  1SR3 A;  4DR7 L;  2I0Q A;  3MEF A;  4LF4 L;  3TRZ A;  4K0K Q;  1VQN A;  3AEV A;  1VQD A;  4NXM L;  1XNQ Q;  2R92 G;  3ER0 A;  5IYD H;  4A75 A;  3CF5 A;  2GN5 A;  2IHF A;  2HHH L;  4PG3 A;  3HOU H;  1R9T H;  3J80 i;  4BY1 H;  3W1B A;  5C4J H;  4P75 A;  5IP7 G;  2RHQ B;  1K8A C;  3UDF A;  4DR2 L;  4JV5 L;  2UXB L;  1PVO A;  4LF6 Q;  4DR1 L;  1PH5 A;  1D8L A;  1Y1W G;  5GRO A;  3OW2 A;  3I56 A;  4A3B G;  2PNH A;  5FLM G;  3HOY G;  3NEN A;  4IOA A;  4YHH Q;  2JA5 H;  2Y0S G;  4LFA L;  3GTJ H;  2PI2 A;  1B8A A;  3CCL A;  5FLX c;  3NBH B;  3PIO A;  3GTG H;  2JA6 H;  5C4X H;  2N78 A;  4C3J H;  1WFQ A;  4UP7 A;  3M7N A;  2CKZ B;  3T1Y L;  1LM0 A;  1Q86 C;  4AIM A;  2KEN A;  3U4Z A;  4KLK A;  1VQM A;  4A4I A;  1NMG A;  4TVA B;  4JBW A;  1JJ2 A;  1HR0 W;  2VZA A;  2LXK A;  4ME3 A;  4JI4 L;  1LUZ A;  4A3C H;  3J7A 5;  4HID A;  3HOV G;  5HY6 A;  1A0I A;  4BA1 I;  4QY7 A;  4X62 Q;  3HOW H;  5M5Y H;  5H1S E;  1PH1 A;  1S72 A;  1GVP A;  3PSI A;  3G71 A;  1IBK L;  1JB7 A;  4JI5 Q;  1SMX A;  1MIU A;  3UE0 A;  2OTJ A;  3PV0 A;  1MJE A;  1VQ8 A;  1EOV A;  3WWV A;  2E5L L;  2JA9 A;  1N33 L;  1OXX K;  1A8V A;  3RLO A;  1PH4 A;  3S1Q H;  2OTL A;  5JJK A;  2KBN A;  4X66 L;  4H02 A;  1HR0 Q;  5IE8 A;  1LYL A;  1G6P A;  1GD7 A;  1XJV A;  3K81 C;  5GAG C;  2ZM6 L;  3RN5 A;  1VQP A;  4OWT B;  4OX9 L;  4WJ4 A;  3LGJ A;  4DV5 Q;  2F4V Q;  4DK6 C;  4NPS A;  5C3E H;  2VQF L;  2I5H A;  4R4C A;  3RN2 A;  3IRB A;  1VQC A;  2VQE L;  1Q81 C;  1VQ6 A;  5IYB G;  5GQO A;  3S2H H;  2NZH A;  2NVY H;  4YWM A;  2QA4 A;  1YIJ A;  3HOZ H;  2JEA I;  4LUO A;  2YTX A;  3KJP A;  5M5X H;  4HJ8 A;  2R7F A;  4AQY L;  1IXR A;  1YVC A;  2DGY A;  3RZD H;  2ES2 A;  1Z47 A; 
#chains in the Genus database with same CATH topology
 3H0G H;  1I3Q B;  2OXP A;  3S15 B;  4JI1 L;  2JA7 H;  4YAK B;  5M5X B;  3DWQ A;  5CC4 A;  2FE3 A;  3ND9 A;  3STB D;  3I4M G;  4UCS A;  3RB3 A;  1SYG A;  1WTP A;  4J0M A;  5C5L A;  4AQY H;  2CHB D;  4EQN A;  4Q44 A;  2E2J H;  2UVW A;  2EYF A;  3R2T A;  2KED A;  5EPK A;  2VPS A;  4FYD A;  1CQJ B;  5M5W H;  1KDA A;  4DF7 A;  5LMU L;  1YNJ C;  1II3 A;  1CA6 A;  3KTM A;  1Y1V H;  4R4I A;  3RAX A;  3ERO A;  1TU2 B;  1KJQ A;  3N42 B;  1KD1 C;  1I50 B;  1TWC A;  1K8G A;  4YR2 A;  1I94 Q;  5ELO A;  4JI7 Q;  3OW7 A;  1H9S A;  4HNV A;  2R3Z A;  1N56 A;  3PR5 B;  4KHV A;  2IHE A;  1RK6 A;  1I4Q A;  4J9O A;  3K5I A;  2EE1 A;  5EKL A;  3BQ1 A;  4Q8E A;  2EYJ A;  1PK8 A;  5F9L A;  3HKS A;  2LFN A;  5BN4 A;  4J9S A;  5KG3 A;  2L0C A;  4C2M B;  1LT6 D;  1OXT A;  2VB2 X;  3GTQ B;  5J2U F;  5ELD A;  2AU0 A;  4ILW A;  2MO1 A;  4R7R A;  2GLT A;  3HBL A;  2JYO A;  1YNX A;  1L1O C;  1Q1B A;  1QWY A;  1VQ5 A;  1Y69 U;  1Z7T A;  3H3V I;  3KHG A;  4KV6 A;  1U9R A;  1M0W A;  1WVL A;  1TWH B;  1RKN A;  2RQX A;  5EDW A;  3I55 A;  1QJO A;  4JI5 L;  1S03 G;  1FL0 A;  2K75 A;  2JA6 G;  1L2Z A;  1EYZ A;  2WDT A;  2NB0 A;  1V1Q A;  4R4Q A;  4A3K H;  4BS9 A;  3J7Y W;  2XGQ A;  1SMY C;  5LYJ F;  1HR0 L;  3W2D A;  2E2I A;  4X62 H;  3ITP A;  4A2A A;  1LLR D;  3N43 B;  4QWA A;  3BAB A;  3JAM W;  3I4N G;  1G2T A;  1BVS A;  4HJ9 A;  4DV5 L;  3L4J A;  4A76 A;  3OHA A;  3G48 A;  1PLF A;  2YZN A;  4R4T A;  1FKA H;  1HJP A;  1PH2 A;  3PVX A;  1F2M A;  3BU2 A;  2FKL A;  4ED7 A;  1T36 A;  1S40 A;  4BWS C;  2HQE A;  5EKI A;  4YJ2 F;  1UEB A;  3HOU B;  2UUA Q;  3K58 A;  4EBC A;  1GHJ A;  2WIN B;  5A2Q E;  1VQL A;  1WTH A;  2F3I A;  1RD9 D;  1IYJ B;  1SYX B;  4NW2 A;  3SGI A;  4BXX H;  1AUV A;  2EZV A;  1GUT A;  1VQK A;  4LF7 H;  2F0P A;  1GSO A;  4Y8V B;  3MVV A;  4EX5 A;  3GTG B;  4KI0 A;  3HXL A;  5KFR A;  3VYU A;  3HKZ B;  4RNO A;  1A15 A;  1KAB A;  3GIQ A;  1B53 A;  3NUC A;  4ED2 A;  1PFS A;  1YNN C;  3RZO H;  2C28 A;  2GPS A;  1ENC A;  5JEA J;  2FXQ A;  4K6L A;  2HJW A;  1HZA A;  1SE8 A;  5J39 A;  4JI3 H;  3PZP A;  3GP7 A;  4RH6 A;  3MAQ A;  3KJO A;  3PUX A;  1PH6 A;  2IW3 A;  3J7A V;  1O7L A;  1KQS A;  3KF6 B;  4FDB A;  1CZW A;  2A19 A;  3HGB A;  4P74 A;  1E3P A;  4DV1 Q;  1BNZ A;  1FGB D;  5KIX A;  4A3L G;  3S1Q B;  4MTD A;  2A74 C;  2JA8 H;  1AP0 A;  1GLV A;  4MTK A;  5BR8 Q;  2VUM A;  3N40 P;  4DV2 Q;  2DN8 A;  3T53 B;  2EDG A;  5KFG A;  4LWC A;  1I94 H;  3T1H L;  4JI7 H;  1BNC A;  3PUZ A;  5IP7 H;  4XTC S;  2FLN A;  4RNN A;  3AB9 A;  4JUZ A;  1HZC A;  4A3B H;  4HNT A;  2NVY B;  1X3E A;  5FLM H;  1YJN A;  3HOZ B;  1KNE A;  1L2F A;  3TQY A;  3N6X A;  4BY7 G;  1Z9F A;  3RZD B;  2H1E A;  1CT1 D;  2QW7 A;  3VDY A;  5L1J A;  4FU0 A;  2PQA A;  3CC4 A;  4A93 B;  1A62 A;  4QL5 A;  4J15 A;  3ND8 A;  5JUM A;  4B3T H;  1NE3 A;  3CPW A;  2WB1 E;  1SNM A;  4R4O A;  3C2P A;  2AGQ A;  5LMN Q;  4CJ2 C;  1F2L A;  4B3R Q;  4IPG A;  3GV7 B;  2FK2 A;  1A63 A;  4ZAI A;  2R93 G;  5G3L F;  1JJG A;  5TSS A;  1D1K A;  5I6W A;  1CQI B;  2JK8 A;  1DJR D;  1DGS A;  2TMP A;  3BVZ A;  1TWG H;  3MXN B;  3NEM A;  4GKJ L;  2XCL A;  2V4Q A;  2B3G A;  1EYC A;  4X3S A;  1EY6 A;  1X54 A;  1NY4 A;  1AEX A;  1WTW A;  5JQW A;  3BQ2 A;  2XWJ B;  4N9T A;  2E75 C;  5NUC A;  5IYB H;  2EY5 A;  2ZJR A;  4K2K A;  2XSC A;  4RG1 A;  4IPD A;  2UU9 Q;  3M9B A;  4OON A;  2F0N A;  3JZI A;  1SNQ A;  2B2W A;  3P1H A;  3PF5 A;  2ZDG A;  2I5L X;  3J80 E;  2UUA H;  1T94 A;  4LFC L;  4DR4 Q;  3S16 H;  3PR4 A;  1JCK B;  3QZ8 A;  3K7U C;  4A3G H;  1M90 C;  3FKI B;  4C3H G;  3U9O A;  4X65 L;  2D5D A;  4ETS A;  1ZYR D;  4S3S A;  3IKJ A;  2XCP A;  3RTX A;  1JT8 A;  2WAQ G;  2R8I A;  4FF4 A;  5C44 B;  3S14 H;  1BCP D;  2NVX H;  2RCF A;  4OIJ A;  3W5O A;  3HOX B;  1TQO A;  5C0X J;  4IFD I;  2I5M X;  3CCM A;  1WTQ A;  1W3S A;  1FVI A;  1EUJ A;  3WOF A;  2QDB A;  1BBU A;  5DG9 A;  1L0X B;  5KG1 A;  3L2P A;  2ASD A;  3EVQ A;  4A3D B;  1EYA A;  3S1R B;  2YS6 A;  4GKK L;  1XPO A;  4FBU A;  4DV1 H;  1YEZ A;  1EZ1 A;  2F4V H;  4EGJ A;  2WTF A;  1Z6H A;  2N49 A;  1STB A;  4LAA A;  4DV2 H;  3L0O A;  2GA4 B;  5CR3 A;  1CTM A;  2JA7 A;  2CCZ A;  3N8D A;  2EPB A;  4LJZ C;  3MC0 B;  3C1E A;  4I4T F;  4DXF A;  3E9I A;  2X69 A;  3VA7 A;  1IBL L;  1XNR L;  2VY3 A;  4F87 A;  2B2W C;  1CQV A;  1SYB A;  4POF A;  4JI0 Q;  1RK5 A;  5EBD A;  4LMQ D;  4GNX B;  1MZB A;  4A3M H;  5M3F H;  1BJT A;  2NU8 B;  4PMW A;  4AYB B;  3I70 A;  1SYE A;  3SK5 A;  3ZJY C;  4UAI A;  3MFG A;  2XWB B;  1C9O A;  4ZRZ A;  3K0X A;  1BOS A;  2K5N A;  5DGA A;  2Y0S E;  4RUC A;  3NWS A;  4JI8 L;  1TS4 A;  5LMN H;  3AFP A;  2ALZ A;  3BYT B;  4B3R H;  4DV0 Q;  2NUA B;  1K8M A;  3WO0 A;  5JH7 F;  3GTL H;  1W2B A;  4H44 C;  3QZ7 A;  1K83 B;  2L9H A;  4ECY A;  1EWI A;  2WB1 A;  5DG7 A;  4YJ3 F;  2JE6 I;  1AE2 A;  1QVF A;  1TT2 A;  4GOP A;  3S17 H;  2JP1 A;  2FMA A;  3ORQ A;  4XQJ A;  3IFT A;  4OEM B;  5KFL A;  1TS2 A;  3G7L A;  2YRW A;  1HPC A;  2EXD A;  1SRO A;  2EXZ A;  4H7B A;  1X3F A;  1AFP A;  2W7O A;  1S5C D;  4E4T A;  4EGQ A;  4LNQ A;  3X3N A;  4YQW A;  2QKI C;  1EY9 A;  2GVA A;  4DR2 Q;  4LF5 L;  1QG7 A;  4IN3 A;  4DR1 Q;  4DAY B;  1I3Q H;  2UU9 H;  3S15 H;  4IO9 A;  2PMZ E;  3JSL A;  4FS1 A;  3DEP A;  2EJM A;  1GGO A;  4DR4 H;  1LTL A;  1RL2 A;  4G7Z C;  1IYV A;  1CHQ D;  1JR0 D;  1XTD A;  3MXP A;  3BAA A;  5IT9 E;  3T1Y Q;  2M2L A;  4A3E G;  1PRT F;  4A3I G;  3E0E A;  3NP8 A;  2MP1 A;  3UDX A;  4ZLT F;  3QWN A;  2XN9 C;  5EBC A;  1XPR A;  1E1O A;  3M4Y A;  3F2B A;  2YV5 A;  1I50 H;  1YHA A;  1BDO A;  2NU7 B;  1JX4 A;  4DU9 A;  1LT5 D;  2FPI B;  2HVQ A;  4IUP A;  2G9D A;  1AN7 A;  2AWO A;  1D7Q A;  4L5Q A;  3CC7 A;  5GAD C;  3T13 A;  4R1J A;  4BA2 I;  2UVV A;  1WCM G;  2CVR A;  4O2D A;  1K3R A;  3GTJ A;  2AGO A;  1QB5 D;  4M7E A;  2R85 A;  2JA6 A;  5JOB A;  4OX9 Q;  3TP6 A;  2D2C C;  1SBB B;  1KHI A;  2KCM A;  4GOP C;  2FP4 B;  2WKD A;  5M3M G;  4C2M H;  4JBJ A;  2WYO A;  5EWE A;  3TN2 A;  2VQF Q;  2IPK D;  3FMC A;  2VQE Q;  3GTQ H;  3N44 B;  1Z2P X;  4L5T A;  1H95 A;  1IOW A;  1PRT C;  3I91 A;  4C5C A;  3T1H Q;  4GN4 B;  3QB3 A;  5KT3 A;  4IPH A;  1O7Z A;  3I4M B;  1P8L A;  4APV A;  3MR2 A;  1EHI A;  3TBI B;  1TWH H;  3UQ8 A;  4JI0 H;  3STB C;  5T1I A;  1AUX A;  1MI2 A;  1E4E B;  5DQG A;  2B2Y A;  2HD3 A;  4U67 3;  5KFW A;  1TA8 A;  5I6Y A;  1KNA A;  3D4R A;  1B1Z A;  2N55 A;  4IZO A;  2O5I C;  1VBG A;  4TUY F;  4O3R A;  2ZTE A;  1TWF B;  1Q82 C;  1V43 A;  4ZYS A;  4ME6 A;  3T4A C;  4EQO A;  1HTP A;  4DR7 L;  1EY5 A;  1ICF B;  3MEF A;  2R7L A;  3R5X A;  2GPW A;  1LT4 D;  1H9M A;  4DV0 H;  4MIU A;  4RCN A;  5KFI A;  3RB6 A;  2GN5 A;  2IHF A;  3HB9 A;  3GTK A;  3HG9 A;  1ZKO A;  1RJP A;  3HOU H;  4WFN 3;  5L1K A;  1ENF A;  4UDU C;  2WE6 A;  2RHQ B;  2RSN A;  4LF6 Q;  2QYZ A;  4O4H F;  1V8Q A;  4TQR A;  1D8L A;  1EY0 A;  3TDQ A;  5GRO A;  3I56 A;  3HRZ C;  2KQ3 A;  3HOY G;  2KCC A;  3GII A;  2JA5 H;  4MV7 A;  1SFO B;  4IFD H;  2PI2 A;  5CA0 F;  3IN5 A;  3A54 A;  1DXM A;  3R23 A;  3NBH B;  3GTG H;  1PFM A;  2N78 A;  5C4X H;  2KA7 A;  1Q86 C;  4DR2 H;  3G6J B;  4ECX A;  3U4Z A;  4DR1 H;  2DNE A;  4TVA B;  5D1O A;  3QR8 A;  1HR0 W;  2FJZ A;  2ZDQ A;  2VZA A;  2LXK A;  5FO7 B;  4FXK C;  3NQI A;  4JI4 L;  2DY8 A;  3N41 B;  3MWE A;  3HOV G;  4IWX A;  3KAJ A;  3A8I E;  4QY7 A;  4OHJ A;  1S10 A;  1JB7 A;  2B2Y C;  4I55 F;  3T1Y H;  3VR2 A;  2NVT B;  2OTJ A;  3R3O A;  1VKZ A;  1GUN A;  4RB1 A;  1WTR A;  1N33 L;  2PCF B;  2V4R A;  2XIW A;  1OXX K;  1A8V A;  3I4N B;  3S1Q H;  2CW7 A;  2C00 A;  1X3Q A;  2VB3 X;  1XXG A;  3WO1 A;  1GD7 A;  5EWF A;  3Q8R B;  3LWU A;  2C2D A;  3Q24 A;  4OWT B;  3TSS A;  1U4L A;  3L3O C;  2RVL A;  4XT3 B;  2JEJ A;  2XRQ D;  2YU9 A;  2W8K A;  3RN2 A;  3MWM A;  4EYI B;  1VQ6 A;  1S5E D;  5CMD A;  4R9W A;  3PW2 A;  2NVY H;  3OWF A;  2Q8T A;  3HOZ H;  2JEA I;  2O5J C;  4XYO A;  2B39 A;  1JWS D;  3KJP A;  1TII D;  3D6C A;  2NVQ B;  3K3P A;  4X66 H;  4OX9 H;  1YVC A;  3SE0 A;  3RZD H;  2E2H A;  1J9O A;  2W6N A;  1Q1E A;  2VUM G;  2VQF H;  1QUQ A;  2VQE H;  1UUP A;  4G4K A;  1SXT A;  2VA3 A;  4A93 H;  3RGX A;  3CHB D;  4HJ5 A;  3T1H H;  1CUK A;  1PTO B;  4Q0F A;  1R4Q B;  2F0G A;  4A3J H;  3A7L A;  5HGQ A;  2R7Z G;  3MFI A;  2B63 A;  1VF5 C;  4XYL B;  4X3T A;  1TAE A;  4DNI A;  2YS7 A;  1IBL Q;  1XNR Q;  4QCL A;  3GTO A;  2QIL A;  4O42 A;  5KRU A;  4MA0 A;  2Z6K A;  1Q90 A;  4Q5V A;  4RWS C;  4Q45 A;  2HVS A;  2KOL A;  3PO2 H;  1PFN A;  4CDC C;  4PMC A;  1XYI A;  1HA6 A;  1X55 A;  3MWD A;  2K7V A;  1XDN A;  3S2D B;  2NZO A;  4LH7 A;  3OIQ A;  4O3N A;  2R8K A;  2ENB A;  1HZ9 A;  5HGT A;  5KFA A;  4IHJ F;  3S1N B;  2YRX A;  4ME5 A;  1RHP A;  1HUM A;  1B3A A;  4JI8 Q;  5FO8 B;  4DR6 Q;  2WAQ A;  1TKW B;  2QGQ A;  1UE5 A;  3CQZ B;  4YCV A;  1YJW A;  1EY4 A;  2B2V A;  5GAH C;  3K5L A;  4QIW A;  3VMM A;  3DLL A;  4BY7 B;  2EOT A;  3DUZ A;  4IOC A;  4O3Q A;  2YCH A;  2F4I A;  1ULZ A;  4JV2 A;  5HBR B;  5JJL A;  4BY1 G;  4LF6 H;  4B9X A;  2VA2 A;  3RNU A;  1I7L A;  1X65 A;  3FKI H;  4FF2 A;  2RCN A;  4JW0 A;  3SK6 A;  4M1U B;  1D2B A;  1BO0 A;  4OWX B;  2VQD A;  3PO3 G;  1A2U A;  3CXC A;  2UUC Q;  1LT3 D;  5C44 H;  2R92 A;  5E7N A;  2R93 B;  1STA A;  1KEE A;  1B7Y B;  1RTN A;  3JAM i;  3OHB A;  3HOX H;  1CKN A;  1UE6 A;  4KHZ A;  1DIK A;  1PH9 A;  2MGS A;  2F0I A;  2PZT A;  1NMF A;  5EKK A;  4ZUJ A;  4DAV A;  4JI6 Q;  2NU6 B;  4LFB H;  2Z6K C;  1E0B A;  2EYO A;  2J6U A;  3CVZ A;  1EIG A;  1Y1W A;  2HCC A;  4XT1 B;  4A3D H;  1LAB A;  3S1R H;  2VW9 A;  5JVG 3;  3F8N A;  2XGP A;  4IUU A;  5AFW A;  4HCE A;  1EU3 A;  2PZW A;  2O2L D;  1ZEQ X;  4RGM A;  3H3V C;  3F2D A;  3M3Y H;  2A68 C;  2N88 A;  2KHS A;  5C4J B;  3ULP A;  2KEE A;  3M4Q A;  4PQX A;  4H0L C;  2KCN A;  4BBR G;  5C3E G;  4YCW A;  1AZQ A;  2QDL A;  2E8G A;  1PFB A;  1N34 L;  3K3V A;  1YHB A;  3MTS A;  5IYC H;  3MA2 B;  4C5A A;  4P2C B;  4QW9 A;  4ID6 A;  1GUW A;  2HT1 A;  2HIV A;  5E3F A;  3GTM B;  2RDH A;  3EBE A;  2DIK A;  4WJW A;  1IKL A;  4DUZ Q;  2J7Z A;  4DV6 L;  4ECT A;  2JA7 G;  5IYZ F;  1VQF A;  2R7K A;  2K6A A;  2YYA A;  4QGU A;  3V4S A;  5KFS A;  4HJA A;  5M5Y B;  5DGB A;  3EJI A;  3OPO A;  3I4L A;  1IBL H;  3NBI A;  1S5D D;  3S9W A;  1VDZ A;  2XC9 A;  3EQL C;  4GZY C;  1K83 H;  1A6X A;  4K0K Q;  2AKW B;  4B3M Q;  1S0O A;  2ZXR A;  3JSN A;  1S3O A;  3K7A B;  3T5J A;  2ID0 A;  2BA0 A;  5DNF A;  3Q2O A;  1QVG A;  1JQY D;  1C4Q A;  2ALY B;  4UPA A;  4ECU A;  1K3B C;  1L1O A;  5ELB A;  2P0A A;  4ED1 A;  4DR7 Q;  3KF8 A;  4HYK A;  4IRD A;  4DR6 H;  1TWA B;  3OOC A;  1U4R A;  1A3V A;  4UP9 A;  2WB1 G;  2RDI A;  3MXU A;  4IRC A;  1NR2 A;  4NLG A;  4NP5 A;  4GLA C;  2K33 A;  4Z9C B;  1WCM A;  4YAJ B;  2UVR A;  4LSA A;  3M4O B;  2J6S A;  2DNC A;  5EWG A;  1E22 A;  1HNZ L;  1BF4 A;  1D5M C;  3ICE A;  3QIA A;  1SE3 A;  4XDX A;  4DAM A;  3GTP A;  1M1K C;  3U4V A;  1A3U A;  1QCB D;  4IAL A;  3E6Z X;  4DR3 L;  1B50 A;  2UUC H;  4X3U A;  5D3D A;  2CW0 C;  5H80 A;  1N32 Q;  5IWA H;  3V05 A;  5FJ8 G;  1HRJ A;  1IW7 C;  2E2D C;  3TS0 A;  1M7J A;  4YR0 A;  2MQH A;  3BDC A;  3HS0 C;  3MZ5 A;  4QWB A;  1XNQ H;  4JI6 H;  1DM0 B;  3VYS A;  5F9N A;  3SVM A;  5IYD G;  1S9F A;  1DV1 A;  1N33 Q;  5COY A;  3CD6 A;  1J8I A;  5KFK A;  2JA5 A;  3RLN A;  1HNX L;  2EYH A;  3J81 L;  2JEI A;  3TEH B;  1EU4 A;  1KRS A;  2G9H D;  1OXV A;  3ETJ A;  2RKS A;  4YY3 Q;  4GN5 A;  2IX1 A;  4UCO A;  3I4M H;  3OMC A;  2RDJ A;  5FPO A;  3F8T A;  1VQ7 A;  2W9C A;  4A3I B;  5KFM A;  4JC0 A;  1OXS C;  2V1C C;  1FNV A;  4KHP L;  1GM5 A;  2OF1 A;  4DUY L;  4EYH B;  3KF6 A;  4R8U A;  2FFK B;  1SRU A;  3DMU A;  2UUB L;  4DUZ H;  1J6Q A;  1TWF H;  1I4X A;  4PZ6 A;  2I46 A;  1RJT A;  5LL6 X;  4I7H A;  2K01 A;  3BA8 A;  4PMB A;  3OSN A;  1PH7 A;  1CSQ A;  3BS1 A;  2CWP A;  4X64 L;  1J5E L;  4KKS A;  4YWL A;  2R7M A;  1T5X D;  5DM7 3;  1SEI A;  4DGZ A;  4Q8F A;  2I07 B;  1CS0 A;  1V1O A;  5CB4 F;  1X32 A;  3TIG A;  2RF4 A;  3ORR A;  4K0K H;  4B3M H;  4LW1 A;  5FLX L;  4MV8 A;  5KFV A;  2VR1 A;  3F1Z A;  1QNU A;  1H9K A;  1O80 A;  2JEB I;  2A6H D;  5M3M B;  4XZ3 B;  1TWC B;  3ZYY X;  2JA8 G;  3E5S A;  2YTY A;  1H9S B;  3A74 A;  4P71 A;  3UDG A;  4OWW B;  3ETH A;  2EJF C;  1UWV A;  1WR2 A;  4XX0 B;  1SFO H;  1EFI D;  2BQR A;  3MFH A;  3HP3 A;  1SNP A;  3SI8 A;  3U9T A;  4CJ1 B;  5ELN A;  1IHZ A;  4MTE A;  1PTO D;  3PW0 A;  2J0T D;  1OTC A;  2BH2 A;  1NJI C;  4IUQ A;  1G29 1;  3URY A;  2OLS A;  4O2A F;  4F7X A;  5C5J A;  1EQQ A;  1SYC A;  3OTO L;  4FP5 D;  2R84 A;  5D8D A;  4DV3 L;  4U68 A;  3QO2 A;  2IBK A;  1KL9 A;  4PV1 C;  3VR4 A;  1IL8 A;  2SNM A;  1DOL A;  4GC6 A;  2MJ8 A;  2NN6 I;  4DR5 Q;  2NVT H;  3LX0 A;  3BA9 A;  5AJ3 Q;  3K5M A;  4DV7 L;  1B04 A;  3NK9 A;  4LF9 L;  2BR0 A;  3I4N H;  1UE1 A;  4Y52 H;  1N9W A;  3PUY A;  1STN A;  1YZ6 A;  1K28 A;  2EYM A;  1B6R A;  2BE5 D;  1HNW L;  4MV4 A;  1N32 H;  3RGZ A;  2R7Z A;  4L6T B;  4RB2 C;  3R5F A;  2AUK A;  2D0O A;  4DL2 A;  1KAW A;  4JVZ A;  1ZQ7 A;  3NWT A;  1MBY A;  5KGU A;  2E2I B;  1EQV A;  2K1B A;  4MTN A;  4B08 A;  1TS3 A;  4HTH A;  1MHW C;  4UHV A;  3RB4 A;  1G91 A;  1VF7 A;  2NVQ H;  2HHH Q;  2A69 D;  3HOY B;  3KYH C;  1PHJ A;  5EOY A;  1UNS A;  3O13 A;  5KFE A;  2RSO A;  2JXM B;  1DV2 A;  1YBY A;  3TP8 A;  1AW7 A;  4CHT B;  1PTO H;  3PUW A;  5I4D A;  4ALP A;  1A3T A;  4YY3 H;  4EQ5 A;  1EUC B;  3DEO A;  4P73 A;  3HOV B;  4IPC A;  1WD1 A;  1JKJ B;  3ULL A;  2EQS A;  4IFD J;  3FDS A;  4MZ9 A;  1S0M A;  2L5T A;  1UE7 A;  3I7F A;  3ONA B;  1SE2 A;  1O7Y A;  1R9T A;  4A3L H;  3EIV A;  3S2D H;  3QG1 A;  4A3F G;  3TII A;  1IBK Q;  1F9P A;  3JAM E;  1VS0 A;  2QEX A;  2K4K A;  2B63 G;  5JJI A;  1DCZ A;  5LA6 F;  2LS0 1;  4QWD A;  3S1N H;  1B3Q A;  3A7A B;  3SK4 A;  1DZ1 A;  1QE6 A;  1QNK A;  4JI2 L;  3BVG A;  3CQZ H;  5L37 A;  5KNC A;  1JJC B;  1I4P A;  2K28 A;  5J3B A;  1L0W A;  4GLX A;  1XMO L;  3QOL A;  5KFU A;  3PMF A;  2K14 A;  5KEE A;  4RB0 A;  3KHH A;  4BY7 H;  1EOT A;  1WTV A;  5BPF A;  5KFT A;  2Q2I A;  2R8J A;  4G3I A;  1OXU A;  2DLN A;  2A6E D;  3N52 A;  4K5X A;  3SEB A;  1E4F T;  2VUM B;  3RJ0 A;  1B4O A;  4JBK A;  2V5A A;  4J9N A;  2BOS A;  3CU7 A;  2YTV A;  4RGT A;  1SN8 A;  2ZDH A;  1G2S A;  3GQB A;  3J81 c;  2F0T A;  2XGT A;  1I7N A;  4JI1 Q;  3KDF A;  2CFM A;  2BDN A;  2HVR A;  2W9B A;  5FD5 A;  3S1M B;  2DZD A;  2R93 H;  2DPJ A;  4KMU C;  3A5Z B;  5M3F G;  3RUP A;  4F8M A;  1VCI A;  2PQA B;  2AMC B;  1G8Z D;  2X6L A;  5LMU Q;  2FPG B;  3WDN A;  2C22 A;  4JV1 A;  1L0Y B;  4QQB X;  2J9G A;  5E4X A;  4DR5 H;  4LF4 L;  3V6K A;  5KG6 A;  3TRZ A;  2G5D A;  1VQN A;  4J9Q A;  1VQD A;  4NXM L;  3LP8 A;  2R92 G;  3ER0 A;  5BR8 H;  4HN7 A;  4DFA A;  3H0G A;  1NAP A;  4E6I A;  1DOM A;  3SDZ A;  4K5W A;  3W1B A;  5C4J H;  4P75 A;  2Z4H A;  4JV5 L;  1K8A C;  2W6Q A;  4IR1 A;  1EL0 A;  5LL6 S;  1PH5 A;  3OSO A;  4RA8 A;  4WRD A;  1Y1W G;  3OW2 A;  3X3M A;  2PNH A;  4BY1 B;  2UVU A;  5CV7 A;  4LFA L;  4CBV A;  5FLX c;  2HHH H;  3MR6 A;  2F0O A;  5A2Q L;  1Y1V A;  4OO1 I;  4UP7 A;  3PO3 B;  2JN4 A;  2R7N A;  2KEN A;  2R61 A;  4DN4 M;  2FK1 A;  1GOZ A;  4A3C H;  2SNS A;  5KKN B;  4PDB A;  4TV8 F;  5M5Y H;  5H1S E;  1LO5 D;  1KLG D;  3P20 A;  3PSI A;  3G71 A;  1SCU B;  4JI5 Q;  3V2T A;  1MIU A;  1YNJ D;  3PV0 A;  1VQ8 A;  2E5L L;  3VPB A;  2F0L A;  1RDP D;  4KK7 A;  5D14 A;  4C3I G;  4FM9 A;  2PBZ A;  1S5B D;  1HR0 Q;  4ZCK A;  3OSP A;  3OUZ A;  1XJV A;  4RAZ A;  1STY A;  5GAG C;  4WJ4 A;  2ZM6 L;  1VQP A;  1IBK H;  4DV5 Q;  1U4M A;  4DK6 C;  3T5H A;  2I5H A;  1IYU A;  5D65 A;  3IRB A;  1VQC A;  5KT4 A;  1KJI A;  3RIZ A;  5KFC A;  2QA4 A;  2TSS A;  1IOV A;  4LUO A;  2YTX A;  1LV9 A;  5M5X H;  4BBR B;  1EZ8 A;  2R7F A;  4JK1 C;  4AQY L;  2NN6 H;  5CV4 A;  2DGY A;  1IKM A;  2ES2 A;  1UNN C;  4ECR A;  5JEA G;  4MV1 A;  4NXN L;  1KXL A;  2D0P A;  1Y8P B;  1VAJ A;  3JC6 6;  2F0E A;  3M4O H;  4G57 A;  1VMC A;  2JA7 B;  3VYT A;  5CV9 A;  4IWY A;  4ZKC B;  3SR1 A;  2F52 A;  4KN7 C;  1TWF A;  2CH4 A;  4UCU A;  1VBH A;  2R8H A;  4JI1 H;  5KFN A;  5T1G A;  3CCQ A;  1I6V C;  4QWE A;  3L7Z C;  3KLS A;  4GLV B;  1RJR A;  4HR7 A;  2YW2 A;  4H13 C;  4XQN A;  1WYD A;  2XRS D;  1RTO A;  3R5H A;  1AH9 A;  1A9X A;  1SMY D;  2RDG A;  2KVM A;  3TIN A;  1E4G T;  1FGU A;  3I72 A;  1V9P A;  2W6Z A;  2GVB A;  4ZOL F;  2C35 B;  2F0H A;  1W93 A;  5LMU H;  4CC6 A;  1SDF A;  2W71 A;  2F3W A;  2FLP A;  2R87 A;  5KFD A;  4B9W A;  1TY2 A;  4LH6 A;  2F0V A;  1SYD A;  4DV7 Q;  4LF9 Q;  3K0Y A;  3I73 A;  2FMM A;  4JV0 A;  1EZ6 A;  4YCU A;  1JWU D;  4I7A A;  3KHL A;  4R8I A;  1XMQ L;  1XTC D;  1Y8O B;  3FRP B;  3BZD B;  4GOP B;  2F0D A;  3BZC A;  2KUM A;  1ESF A;  5KT5 A;  2BH8 A;  3GV8 B;  3V6J A;  3H20 A;  1PRT B;  4Y7N B;  3J80 L;  4AH6 A;  2JA5 G;  4X62 L;  4IFD G;  4A3I H;  3BQ0 A;  2LXJ A;  1AE3 A;  2W9A A;  3M9N B;  1V4Y A;  1YNN D;  5C4X G;  2FLL A;  4L1K A;  3QJY A;  4MV9 A;  5IGE A;  2ZXO A;  1DYQ A;  1HA5 A;  4I7Z C;  4KN4 C;  4QJF A;  4X6A H;  4HQ6 A;  5KYL A;  3VR5 A;  4WBN F;  4U6P A;  2K5V A;  3K8A A;  1E7Z A;  3TZU A;  1IBM L;  4JI5 H;  1K73 C;  3BG3 A;  3GIJ A;  2R6F A;  2Y0S A;  3J81 W;  2ZXP A;  1AZP A;  4GKJ Q;  1B6S A;  1VQH A;  1HTL D;  1QZG A;  4LF7 L;  2I80 A;  3TQ1 A;  2Z0S A;  1HR0 H;  2QK4 A;  3RFC A;  5KFQ A;  2A1A A;  5M3M H;  1BQQ T;  1TWC H;  1F9S A;  3NSW A;  1X9N A;  2CQA A;  2IT1 A;  1FNU A;  2I87 A;  4DV5 H;  4K5V A;  4EEY A;  4RKL A;  4CDF C;  4ECQ A;  5CV5 A;  3CC2 A;  1SAP A;  2CWA A;  2LMC B;  1ZXT A;  2B2T A;  1E2Z A;  2KCT A;  3NTK A;  3WOE A;  3GTJ B;  3ERS X;  4JI3 L;  1GSH A;  1NNX A;  2SEB D;  5A35 A;  1WH2 A;  1RYR A;  1XMO Q;  2JA6 B;  1KC7 A;  3DWA A;  4LFC Q;  2WAC A;  3GIP A;  5C0X G;  2IL8 A;  1HZB A;  1CZG A;  2M00 A;  1I5F A;  1TWG A;  2BDO A;  4X65 Q;  1Y14 B;  2PMZ A;  2OQK A;  4DL3 A;  1PZI D;  2FJ2 A;  4IUV A;  2FHT A;  1RJQ A;  4A93 G;  2OQ0 A;  2DUD A;  5IIF A;  3BZK A;  5LL6 b;  1T3N A;  5IP9 H;  4A3J G;  1I94 L;  1BXT A;  5F2D A;  4JI7 L;  3ERQ A;  4RU9 A;  2AQ3 B;  3TME A;  2CQO A;  2PW5 A;  3VPD A;  1E2V A;  1O78 A;  5FLX W;  1NSN S;  2OEO A;  4YHH L;  4JCV E;  4X3K A;  2ZJQ A;  3TS2 A;  2VS1 A;  3RMH A;  3E0J A;  3M7G A;  4OO1 H;  1R4P B;  5KFH A;  2QCP X;  3PO2 G;  3M9O B;  2J6T A;  3VR3 A;  3GIL A;  4JOI A;  5KFF A;  2E2I H;  4K6D A;  3IAY A;  4GKK Q;  1K1S A;  1VQ4 A;  4B3S L;  1N36 L;  1EEF D;  4LF4 Q;  3HOY H;  2R6G A;  4B3T L;  4NXM Q;  5JJZ A;  5T14 A;  3UI2 A;  2NVX A;  4QF4 A;  2MCT A;  1G51 A;  3GTK B;  5HV6 A;  1N48 A;  4BBS G;  3KAL A;  4IUT A;  5KT7 A;  2L55 A;  1PYB A;  2B2T C;  4DV4 L;  1ASZ A;  5G3L D;  3H6M A;  1Q8I A;  2V9W A;  3GD7 A;  3EYY A;  3IFD A;  1W6K A;  5DM6 3;  1OWT A;  1WOC A;  4MNO A;  2B8F A;  2K50 A;  1RF2 D;  1B44 D;  5E4W C;  1T9H A;  2B8G A;  4O0A A;  4KJN A;  2DPI A;  1SEB D;  2NZ1 D;  1M0T A;  4L5R C;  3K57 A;  5IT9 L;  3TP5 A;  5C44 G;  1XPU A;  4KD3 A;  5K36 H;  4HED A;  4RAU C;  5BPH A;  5D1O B;  4IR9 A;  1F9Q A;  2PZU A;  1BR9 A;  2WV6 D;  3PF4 A;  1K1Q A;  2JJQ A;  4RZQ A;  5DLF A;  2UUA L;  4IQZ A;  2BE5 C;  1H9R A;  2VL6 A;  4HJ7 A;  5IGC A;  3BDO A;  4A3D G;  2WFW A;  2PO4 A;  4GKJ H;  1JIC A;  3SHL A;  4DAP A;  2FB9 A;  1VQ9 A;  3J7A K;  4JOI C;  1EIH A;  3I2Z A;  4RFB A;  4BWG B;  3MEH A;  3BYY B;  2VUM H;  3T5K A;  3LNN A;  2NBF A;  3SXH A;  4HIO A;  4RUA A;  2YU9 B;  2EJG C;  3BDL A;  4TKO B;  4LF5 Q;  1HHV A;  5KFY A;  2XCA A;  2AQ4 A;  4RMF A;  4C3J G;  3A5U A;  4IJH A;  4C1N K;  3CAM A;  4RB3 C;  1GKH A;  4AQY Q;  4M9U A;  3GTL A;  1V1P A;  4V0B A;  3VYR A;  1GJX A;  3S1M H;  4LFC H;  3IG0 A;  4UCR A;  3Q8S B;  5C1O A;  2E2H B;  1YHQ A;  2R82 A;  4NXN Q;  2IY5 B;  3PQI A;  1QUQ B;  3CW2 C;  1I6H B;  3HOW G;  3H4B A;  4X65 H;  2F4V L;  3HKZ E;  4O2B F;  4O1N A;  3J80 c;  4A3F B;  1EQR A;  3JRW A;  2AGP A;  1BCP F;  2B63 B;  2F0S A;  4GS3 A;  4DV2 L;  5IGG A;  4FXD A;  3KAK A;  3OUU A;  2JQO A;  4J1M A;  2F0W A;  3GTO B;  5K2M A;  2DWC A;  1KC8 C;  1YIT A;  1I3Q A;  2R86 A;  4KKU A;  1X56 A;  1F2Z A;  3A8K E;  2A5H A;  2Z4I A;  3KOJ A;  4FF3 A;  3SK8 A;  1FD7 D;  3DF7 A;  1GO3 E;  4C3H B;  1WJJ A;  1I4R A;  2R8G A;  4GKK H;  4LF8 L;  3V96 A;  4LF4 H;  3D6W A;  2MNA A;  2AHO B;  1ZYR C;  2WAQ B;  3H0G G;  2PPB C;  4F4X A;  4NXM H;  3PO3 H;  3CKI B;  3I12 A;  5LMN L;  4IUR A;  1I50 A;  4QIW B;  4B3R L;  3RB0 A;  3J7Z C;  1XMQ Q;  1BCP C;  3VR6 A;  3CCS A;  2UXC L;  3NTI A;  1TR5 A;  2PQE A;  3A8J E;  3VPC A;  2W6M A;  5M3F B;  1XNR H;  2M9V A;  4J6H A;  1Q7Y C;  4P72 A;  3KK7 A;  3PW7 A;  3BVM A;  1PZJ D;  1RIP A;  1Y1V G;  2IX3 A;  5JAV A;  2ATL A;  4C2M A;  2LKV A;  3CRK C;  3GTQ A;  2WP8 J;  2R92 B;  2LSS A;  4KY6 A;  1PXU A;  1X6O A;  4QMG A;  2Q2U A;  2Z6B A;  2UU9 L;  1NTG A;  4JI8 H;  5JVL A;  1CKN B;  4TSS A;  5FK9 C;  3K59 A;  2PYK A;  3A0J A;  2VOB A;  5EPL A;  5DLG A;  3EPI A;  4EQP A;  5A2Q W;  4DR4 L;  1IBM Q;  1Y1W B;  4N8X 1;  4BBR H;  1TWH A;  4HIM A;  1SSO A;  4RKB A;  4LF7 Q;  1LAC A;  2F0U A;  1PRT D;  4PZ7 A;  4IRK A;  3GQC A;  1GYF A;  1SNO A;  4PZ8 A;  2JSO A;  4ZQI A;  2JEF A;  3S24 A;  5JVH 3;  1C8C A;  3P7J A;  1YI2 A;  4LF5 H;  4APM A;  3J7A F;  3Q23 A;  4Q0Y A;  5C1P A;  4JI3 Q;  3RBD A;  5ELF A;  4JI4 Q;  3AU7 A;  1CFM A;  4DA2 A;  3P75 A;  4A3K G;  1I6U A;  2C9O A;  1ICW A;  4C3I B;  1HH2 P;  3LWB A;  3MFY A;  4NXN H;  1G6Z A;  1U0L A;  4QB4 A;  1WSC A;  3KLS X;  4MV3 A;  3AQQ A;  2W6P A;  1KAA A;  5DLQ E;  4UP8 A;  1PA6 A;  4TV9 F;  1ET6 A;  5ELE A;  1UEA B;  1B70 B;  4DL6 A;  5IT9 c;  3GTG A;  1ML0 D;  3HKZ A;  4YHH Q;  1MJC A;  1OO9 B;  1VQA A;  4DL7 A;  4N8F A;  5JPN C;  5DQH A;  4YBZ B;  1X3G A;  4JI0 L;  1STE A;  1S68 A;  4O3S A;  1SE4 A;  2ZTD A;  3Q6S A;  1BUV T;  1KDC A;  2KJX A;  1KRT A;  4BXX G;  2HUG A;  2Q2T A;  3KFU A;  3TRE A;  5LP6 F;  3I90 A;  4A3E B;  2MPM A;  1L1O B;  3I8Z A;  2CW8 A;  2XD4 A;  3LML A;  2BQ3 A;  3OIP A;  5J2T F;  4B3S Q;  4DLK A;  2F0F A;  2YYZ A;  1N36 Q;  4RNM A;  2H4O A;  4Y7N H;  2D9U A;  3KF8 B;  3D4W A;  4B3T Q;  2EYL A;  5CV6 A;  4O3P A;  4IJL A;  5KG0 A;  3H4D A;  4MHE A;  2Z9H A;  1NUC A;  1X3P A;  2K5H A;  2RA4 A;  4DV0 L;  2YL2 A;  5L1I A;  1XMQ H;  3T5L A;  5K5P A;  2AUJ D;  2EY2 A;  2HDL A;  2QEJ C;  1LTG D;  4FVM A;  1M8A A;  4DV4 Q;  1CHP D;  5FJ8 H;  3D4D A;  4DKA C;  3GID A;  4AYB E;  1VQJ A;  1WCM B;  3K80 C;  2NVY A;  1SR3 A;  2BQU A;  1TVX A;  4KY7 A;  2AQ1 B;  2I0Q A;  3RV4 A;  1D5Z C;  1WTO A;  1C3O A;  3PW5 A;  3GTP B;  5LXT F;  5IYD H;  2K5Q A;  4HMJ A;  3K5H A;  3CF5 A;  1STH A;  4PG3 A;  5HUR A;  1D5X C;  5IP7 G;  1F2Y A;  1PVO A;  3UDF A;  4DR2 L;  2UXB L;  4QW8 A;  4A2B A;  4DR7 H;  3FVQ A;  4DR1 L;  2XIG A;  5BN3 A;  4IZ8 A;  4A3B G;  4KTA A;  5FLM G;  3NEN A;  3J80 W;  4IOA A;  2Y0S G;  1H9J A;  3GTJ H;  1IBM H;  5BMV F;  3MHB A;  1JOO A;  3TP7 A;  4UCT A;  5C5M A;  2PVP A;  2V4D A;  3PIO A;  2JA6 H;  3M7N A;  2CH4 W;  1DD2 A;  2WKC A;  4NMZ A;  3Q1K A;  2CKZ B;  3T1Y L;  5DG8 A;  1M6V A;  4AIM A;  4DK1 A;  4DNR B;  2JA5 B;  2SOB A;  4WD3 A;  4KLK A;  1D1I A;  4A4I A;  1VQM A;  1NMG A;  3C46 A;  1JJ2 A;  3MXN A;  4JBW A;  3KHR A;  4O4I F;  5C4X B;  4HID A;  3OWE B;  4L8J A;  5HY6 A;  1A0I A;  4V19 0;  4BA1 I;  3FPP A;  2DJG C;  2I8C A;  2RBM A;  3GV5 B;  1W96 A;  4RAY A;  3D8G A;  1SMX A;  3UE0 A;  3NXW A;  3WWV A;  1LTA D;  4NKL A;  1LTR D;  3RLO A;  1PH4 A;  1UAP A;  4JI4 H;  2OTL A;  2W9C B;  4HMI A;  4X66 L;  4H02 A;  1G6P A;  5IE8 A;  5EQ0 A;  4OX9 L;  3RN5 A;  1HUN A;  1K0S A;  4R8U B;  3LGJ A;  2F4V Q;  2ZT9 C;  4NPS A;  2VQF L;  3FKI A;  1DOK A;  2VQE L;  1N33 H;  4K14 A;  2QF7 A;  1KDB A;  5IYB G;  1YIJ A;  1CK1 A;  4YWM A;  3Q0A A;  4EG0 A;  4F50 A;  1MD2 D;  4HJ8 A;  2K32 A;  4O4L F;  4ZK9 B;  5IOC A;  4YHH H;  1W6J A;  2RDF A;  4Q43 A;  4EBE A;  3PIP A;  3GTK H;  3E9H A;  3OYY A;  3PIO 3;  3CCE A;  1GHK A;  2YZM A;  1JWM D;  4OEL B;  4EFB A;  2L11 A;  4A3G G;  1N34 Q;  4HSP A;  2Q8R E;  3MR5 A;  5C8Y F;  2RHS B;  2X6G A;  4RCO A;  4CDD C;  4LF8 Q;  1JB3 A;  2UXD L;  4B3S H;  3CMA A;  1N36 H;  1I4G A;  2ATW A;  4JYA L;  3CCV A;  4FBT A;  4GN3 B;  3PUV A;  1FNW A;  4A3J B;  4DV6 Q;  4R8N A;  3A55 A;  4RHR A;  3OMG A;  4I65 A;  2PN1 A;  3W3A A;  2W6O A;  5IOD A;  3HEJ A;  2UXC Q;  3MWY W;  3F2U A;  3E3X A;  1HXY D;  4MN3 A;  4C1N I;  3PO2 B;  3FEW X;  4DV4 H;  4EEQ A;  1FJG L;  3EPG A;  4LF6 L;  4C56 C;  5DQI A;  1B9N A;  2F3V A;  3AFQ A;  3EN2 A;  3FDT A;  5FO9 B;  4GNX A;  5LHY 1;  2F03 A;  3K6O A;  1NBW A;  3M9M B;  1M4V A;  4LUV A;  2N3S A;  4AYB A;  3C1F A;  4L63 B;  1ESR A;  2A68 D;  3D31 A;  3U9S A;  3M4I A;  3RF2 A;  1LTB D;  3CCR A;  1QVC A;  4ECV A;  2Z1C A;  3AYH B;  3PIP 3;  2R7Z B;  3KBX A;  1EIY B;  3GO5 A;  2R7D A;  2YU9 H;  1JDB B;  4BBS B;  3FHW A;  4OL7 A;  2W8L A;  2MHV A;  1MSG A;  4A3M G;  3DXJ C;  3U50 C;  1JMC A;  1BGW A;  1UC9 A;  4LFB L;  4DK0 A;  1N8R C;  2EVB A;  1K83 A;  2CZG A;  5IT9 W;  5EAY A;  3HFZ B;  3BJY A;  2E2H H;  4XIG S;  5GON F;  1K9M C;  3CME A;  1STG A;  1SND A;  1I6H H;  2ICE C;  2AQ2 B;  4ED6 A;  3LWE A;  4XYM B;  1HNZ Q;  4A3F H;  2IX0 A;  3KBG A;  4NDX A;  3J81 i;  4A3C G;  3GDE A;  2B63 H;  2J4X A;  4DR3 Q;  3HZX A;  2ZTC A;  4WJ3 M;  1KLU D;  5KX5 F;  1MKH A;  2BA1 A;  5L9X A;  2V58 A;  5IGF A;  3GTO H;  4QUC A;  2F1M A;  2O03 A;  3OHX C;  4DAY A;  3ULJ A;  5IY0 A;  2K52 A;  5KG4 A;  2NU9 B;  5KG2 A;  2F0K A;  1U5K A;  5KFP A;  1R9T B;  4HCS A;  4QWC A;  3T51 B;  1B9M A;  3I3C A;  3H3V H;  3PGZ A;  4C3H H;  4CDE C;  4GNX C;  3M3Y B;  1Z2N X;  4NB3 A;  3BG5 A;  3GTM H;  1S5F D;  1HNX Q;  4YR3 A;  3KLW A;  5DAU A;  3MJF A;  5KG7 A;  3W1G A;  1YJ9 A;  2A73 B;  2L15 A;  4C3J B;  3AMU A;  1P16 A;  2NN6 G;  4JPB W;  1C7Y A;  3TQT A;  1VQG A;  5CV8 A;  2XTI A;  1TS5 A;  4OXP A;  1EFW A;  2L4N A;  1AN8 A;  1HCZ A;  1BXR A;  1EEI D;  1N34 H;  5EZY F;  3UDI A;  3DM1 A;  2E74 C;  5C3X A;  3HOW B;  4TRD A;  2YZG A;  1CSP A;  4MA5 A;  2Q2H A;  4LF8 H;  5EJW A;  1C30 A;  1T5E A;  3K7A H;  4KHP Q;  4DUY Q;  2HIX A;  3CCU A;  2UUB Q;  1WI5 A;  5BN5 A;  4CC5 A;  2FIN B;  2CW0 D;  3KDF B;  4DV6 H;  5CAE B;  1ROD A;  5C0X I;  5IGB A;  1B2T A;  2W9B B;  4DR6 L;  2R92 H;  4IUN A;  3CCJ A;  4ED8 A;  2FK3 A;  3Q22 A;  1PMR A;  5KT2 A;  1IW7 D;  4RGO S;  5I9O A;  3DM3 A;  4KKT A;  4F4W A;  1VQO A;  2ASJ A;  2UXC H;  5M9O A;  3V6H A;  1RCV D;  1TWA H;  3PCO B;  4FNF A;  3T16 A;  4X64 Q;  1PH8 A;  5C3E B;  1J5E Q;  1SJH D;  2PI2 E;  4HNU A;  3D3R A;  1E1T A;  1QZH A;  4ED3 A;  2B2U A;  1Y1W H;  3H94 A;  3S2H B;  3Q8Q B;  1E4E A;  5LMN W;  2F0J A;  1SLJ A;  4ABN A;  4N9P A;  5C4H A;  1K8O A;  2EIF A;  1PH3 A;  1HQR D;  2Q8I B;  1B33 N;  3C0F B;  3E5N A;  1K0R A;  1EYD A;  1JOQ A;  4CKB A;  3H0G B;  3T56 B;  2W57 A;  4UFZ A;  4ZKB B;  5CA1 F;  3NTH A;  2UUC L;  3RR5 A;  2UXB Q;  1EY8 A;  1IL2 A;  1KTK A;  1U4P A;  4G7O C;  5FD6 A;  1EWH A;  1VMP A;  3DHQ A;  2IMW P;  3SE7 A;  5IWA L;  4CGY B;  1JE4 A;  2H5X A;  1F9R A;  2NYZ D;  3IL8 A;  1CA5 A;  5CBE E;  4POG A;  2E2J B;  4ULL A;  1XNQ L;  4J9R A;  4JI6 L;  5M5W B;  2EYP A;  1ASY A;  3OTO Q;  5FPR A;  4DV3 Q;  1BBW A;  1Y1V B;  4JBM A;  4C3I H;  2BCO A;  4JG2 A;  4EGV A;  5KYI A;  2FMC A;  4DK3 C;  2KSW A;  2Z8L A;  3MXG A;  1LTT D;  4K8J A;  4YWK A;  1HNZ H;  1ONL A;  3DWP A;  5CYU A;  3L9A X;  5FOB B;  5KFB A;  2MFI A;  2C2E A;  1JLL B;  4ECW A;  1SFO A;  5FKA C;  1PYS B;  3JRX A;  5D1P A;  3RAQ A;  5J1Z A;  4DR3 H;  4YP3 A;  1CM9 A;  1QIL A;  2EY6 A;  3NBH A;  4HIK A;  1HNW Q;  3QFF A;  1O7I A;  2WB1 B;  3JAM L;  4U7C A;  5COR A;  3HOU G;  3FP9 A;  4YIJ A;  4X66 Q;  2VNU D;  1BKB A;  4ECS A;  1GUO A;  1VQE A;  4DPG A;  1MSH A;  1ZHS A;  4FO2 A;  5I2X A;  5JEA H;  1GUS A;  2HQL A;  3GIM A;  2NTT A;  2ZJP A;  2B2U C;  2NWG A;  3KXY T;  4A3E H;  4DUZ L;  2MO0 A;  4EFE A;  1TY0 A;  1HNX H;  5CGK A;  3HKZ G;  1O75 A;  1NCV A;  3NQT A;  4PNY A;  3G4S A;  2ZJT A;  1GXD C;  5KFX A;  3GV6 A;  2IWH A;  4L5S A;  2DY7 A;  2N8N A;  4A3K B;  3H15 A;  1EQT A;  4K0K L;  4B3M L;  1CE8 A;  4FXG C;  1WCM H;  2IJ0 A;  3NEL A;  2WAQ E;  2UXD Q;  2HGS A;  4DL5 A;  1C48 A;  1KBL A;  3WNZ A;  4KHP H;  4DUY H;  2SDF A;  4JYA Q;  3GTP H;  4QIW E;  5IP9 G;  4C5B A;  3VA5 A;  1IZ6 A;  1S0N A;  2UUB H;  3H40 A;  5KG5 A;  2NUC A;  3A56 A;  1S4Z A;  2OCE A;  3EFX D;  4HR7 B;  5KNB A;  4CKE A;  1CKM A;  5I9P A;  1C0A A;  1CQF A;  2SCU B;  2K5W A;  4J9M A;  4OO1 G;  4I50 F;  3GLK A;  4F88 A;  3M85 A;  3UE1 A;  1JOK A;  4JI2 Q;  4X64 H;  4UY8 C;  5KFZ A;  1J5E H;  3HOZ G;  1SYF A;  1VQI A;  3U58 A;  1FJG Q;  3G6E A;  1JE5 A;  2NTS A;  2OT2 A;  4ODG A;  4CKC A;  1ILP A;  1Q8K A;  3R2I A;  5ELC A;  2IA6 A;  2HDM A;  2KHJ A;  1TXY A;  3I4O A;  3FPU B;  4HSV A;  3RZO B;  3RD4 A;  3BJU A;  1PTO F;  2PW7 A;  5LOV F;  2UXB H;  4ZQ3 A;  1MGS A;  5CBA E;  1N32 L;  3NE5 B;  2A8V A;  4LSX A;  3CQZ A;  1HFG A;  1PX2 A;  4LFB Q;  1PZK D;  4ZUI A;  3G6X A;  3OTO H;  2B29 A;  4FF1 A;  2X0S A;  4DV3 H;  1PYW D;  4UCV A;  1CI3 M;  2JA8 B;  3KUP A;  4K2L A;  2A6H C;  1Z2O X;  4EBD A;  5K36 G;  1JDE A;  5KT6 A;  4DV7 H;  3B6Y A;  1PV4 A;  4LF9 H;  1JC7 A;  1Q46 A;  1E2W A;  4K8I A;  4TQU S;  3J81 j;  3N6R A;  2K04 A;  3KLR A;  1WD0 A;  5GAE C;  4A3B B;  3CRL C;  1EYG A;  4KJO A;  4YY3 L;  1HNW H;  3D0F A;  4MV6 A;  2Y0S B;  4JV5 Q;  4RZR A;  4WOR A;  1KJ8 A;  2R93 A;  1PTO C;  1DON A;  5JVD F;  4OGQ C;  3HOV H;  5C0X H;  5I2Y A;  3FKI G;  2C5C A;  4LFA Q;  3PN1 A;  4RHS A;  2ICI A;  2OWO A;  4J8Q A;  2W7P A;  4MAM A;  1D6E C;  2VUG A;  1S97 A;  3PW4 A;  3Q8P B;  1A2T A;  3K5O A;  1UC8 A;  2E76 C;  1KJJ A;  1QOH A;  4ECZ A;  5KFJ A;  2FPP B;  4XQQ A;  3K5N A;  4PWQ A;  4LUZ A;  1HFN A;  1Q12 A;  1KJ9 A;  3HOX G;  1E24 A;  2L1B A;  3F2C A;  4ZI7 F;  5C3W A;  3G6V A;  2D62 A;  1TWG B;  1VQB A;  1FR3 A;  2AWN A;  2XVS A;  3TZD A;  2PMZ B;  2E5L Q;  3J81 E;  2C2R A;  4OIK A;  2UXD H;  5C4Z A;  1GSA A;  4DL4 A;  4FS2 A;  1SJE D;  3RLF A;  4JYA H;  1NR4 A;  2A69 C;  2ASB A;  2ZM6 Q;  1HQM C;  3GTM A;  1LTS D;  5ISR A;  2EY1 A;  2K5D A;  3CPF A;  2KHI A;  2MUY A;  4M8A A;  3RV3 A;  1KIX A;  2RGV A;  2R7Z H;  5I47 A;  3M4P A;  1EY7 A;  4QUF A;  3S16 B;  4BBS H;  4JI2 H;  2XNA C;  1I4H A;  3H91 A;  3JAM c;  4F4Z A;  5IYC G;  4A3G B;  1XMO H;  1XX8 A;  1JOR A;  2CQY A;  1FJG H;  4XYQ A;  1EWC A;  1EIF A;  2L12 A;  1GUG A;  3Q8D A;  4AYB G;  4DV1 L;  4ZHQ F;  4DR5 L;  5AJ3 L;  5KND A;  4ED0 A;  2O4X A;  3S14 B;  2NVX B;  5BR8 L;  1JXL A;  4TQS A;  1ET9 A;  2KEC A;  1F77 A;  3GIK A;  5FLX E;  5IWA Q;  2M05 A;  2JEG A;  1CKO A;  3CP0 A;  4CJ0 B;  4EVO A;  3NHH A;  2RGR A;  3QOJ A;  1TWA A;  1V51 A;  3AEV A;  1EUD B;  3R93 A;  1XNQ Q;  2ASL A;  4A75 A;  4GC7 A;  1WTX A;  4RGN A;  1FYC A;  3MR3 A;  2HHH L;  3L4K A;  4G7H C;  1R9T H;  3J80 i;  4BY1 H;  2VXW A;  4IAJ A;  2A6E C;  4O3O A;  1ILQ A;  3V4Z A;  3UFX B;  2VPQ A;  1ZET A;  3H09 A;  4KD4 A;  5JPM C;  5L1L A;  1BBX C;  1B8A A;  2DJF C;  2LY7 A;  3CCL A;  2V59 A;  1PDQ A;  4C3J H;  1WFQ A;  5EGT A;  4LK1 C;  4JV5 H;  1LM0 A;  2B2V C;  4A3M B;  1RYS A;  3G6Y A;  2F0M A;  1JIH A;  5KFO A;  4ME3 A;  1LUZ A;  3J7A 5;  5E1F A;  4J9K A;  1ENA A;  4J9L A;  4LFA H;  3R8B A;  5C6A A;  4X62 Q;  3GV3 A;  4HAE A;  1PH1 A;  3HOW H;  1S72 A;  1GVP A;  3EA6 A;  3NGD A;  1IBK L;  1BCP B;  1Y8N B;  1MJE A;  1LTI D;  1EOV A;  2P5Z X;  2JA9 A;  2IP4 A;  2K05 A;  5D3I B;  5JJK A;  2F0Q A;  3GTL B;  2KBN A;  4KY5 A;  1V1P B;  4DNT B;  1LYL A;  5EPJ A;  2PNR C;  4XXE A;  5J22 A;  3K81 C;  3C3L A;  2K03 A;  3S17 B;  3RBE A;  3RUZ A;  2WII B;  4J9P A;  2HCI A;  5C3E H;  5IGD A;  4F4Y A;  4R4C A;  1Q81 C;  5DEH A;  2E5L H;  2OH2 A;  4YB8 B;  3G8C A;  1Q3L A;  5GQO A;  3NPP A;  2NZH A;  3S2H H;  1SNC A;  3FMA A;  2W70 A;  1XWE A;  4LMY A;  1IXR A;  4DXG A;  2ZM6 H;  1ZHQ A;  1Z47 A; 
#chains in the Genus database with same CATH homology
 5JEA G;  3H0G H;  1Q1E A;  3PIP A;  2VUM G;  3GTK H;  1QUQ A;  3E9H A;  3OYY A;  4JI1 L;  3CCE A;  2JA7 H;  4NXN L;  4A93 H;  1KXL A;  4A3G G;  1N34 Q;  2D0P A;  4HJ5 A;  3STB D;  3JC6 6;  3I4M G;  1CUK A;  3M4O H;  2R7Z G;  4A3J H;  5HGQ A;  2RHS B;  4LF8 Q;  2UXD L;  4DNI A;  2F52 A;  3CMA A;  1IBL Q;  2E2J H;  1XNR Q;  2ATW A;  4JYA L;  3CCV A;  5M5W H;  2Z6K A;  4GN3 B;  5LMU L;  3PUV A;  3CCQ A;  1Y1V H;  4DV6 Q;  4R4I A;  3L7Z C;  4GLV B;  3PO2 H;  1WYD A;  1KD1 C;  1AH9 A;  1X55 A;  4A3L G;  2NZO A;  1K8G A;  2UXC Q;  1FGU A;  1I94 Q;  5ELO A;  1V9P A;  4JI7 Q;  1HZ9 A;  2GVB A;  2C35 B;  1FJG L;  2IHE A;  4JI8 Q;  4LF6 L;  4DR6 Q;  3AFQ A;  3EN2 A;  2QGQ A;  4GNX A;  4DV7 Q;  1UE5 A;  4LF9 Q;  3HKS A;  1NBW A;  4YCV A;  1YJW A;  4LUV A;  5GAH C;  2N3S A;  3DLL A;  4YCU A;  3D31 A;  1OXT A;  4IOC A;  1XMQ L;  3CCR A;  1QVC A;  5JJL A;  4BY1 G;  3AYH B;  2MO1 A;  4GOP B;  3BZC A;  1EIY B;  3GO5 A;  2R7D A;  3RNU A;  2YU9 H;  1X65 A;  1YNX A;  1L1O C;  3FKI H;  2BH8 A;  1Q1B A;  2RCN A;  3FHW A;  4OWX B;  1VQ5 A;  3H3V I;  3PO3 G;  4A3M G;  3U50 C;  4AH6 A;  1JMC A;  4X62 L;  2JA5 G;  3CXC A;  4IFD G;  4A3I H;  1N8R C;  4LFB L;  2LXJ A;  1AE3 A;  3I55 A;  2UUC Q;  5C44 H;  5EAY A;  3HFZ B;  4JI5 L;  1FL0 A;  2K75 A;  4XIG S;  1K9M C;  2E2H H;  2JA6 G;  5E7N A;  3CME A;  5C4X G;  1I6H H;  1B7Y B;  1V1Q A;  4R4Q A;  3JAM i;  4A3K H;  3HOX H;  1CKN A;  1UE6 A;  4KHZ A;  1HNZ Q;  4QJF A;  1PH9 A;  1HR0 L;  4A3F H;  4X6A H;  2IX0 A;  3J81 i;  4A3C G;  1NMF A;  3GDE A;  4JI6 Q;  2Z6K C;  2B63 H;  2K5V A;  3K8A A;  4DR3 Q;  3I4N G;  2ZTC A;  1BVS A;  1E7Z A;  4HJ9 A;  1MKH A;  2BA1 A;  4DV5 L;  1K73 C;  1IBM L;  4A76 A;  2VW9 A;  3S1R H;  4A3D H;  3G48 A;  3GTO H;  4R4T A;  4GKJ Q;  1HJP A;  1VQH A;  3ULJ A;  1QZG A;  1PH2 A;  4LF7 L;  3BU2 A;  5IY0 A;  2Z0S A;  2K52 A;  3F2D A;  3M3Y H;  1S40 A;  2A1A A;  1U5K A;  1UEB A;  5M3M H;  2UUA Q;  1TWC H;  3ULP A;  1VQL A;  1X9N A;  3H3V H;  2IT1 A;  3M4Q A;  3PGZ A;  2F3I A;  4C3H H;  1IYJ B;  4GNX C;  4NB3 A;  3SGI A;  4BBR G;  4BXX H;  5C3E G;  4YCW A;  3CC2 A;  3GTM H;  2CWA A;  1VQK A;  2E8G A;  1N34 L;  1HNX Q;  2KCT A;  3KLW A;  1YHB A;  5IYC H;  3ERS X;  4JI3 L;  4EX5 A;  3W1G A;  1YJ9 A;  1XMO Q;  4KI0 A;  2HIV A;  4LFC Q;  2L15 A;  2HT1 A;  1P16 A;  2NN6 G;  1C7Y A;  5C0X G;  3EBE A;  1PFS A;  1VQG A;  3RZO H;  1HZB A;  4DUZ Q;  2XTI A;  1I5F A;  4OXP A;  1EFW A;  4DV6 L;  5JEA J;  1Y14 B;  4X65 Q;  2JA7 G;  1VQF A;  2FXQ A;  2OQK A;  3UDI A;  1HZA A;  4QGU A;  4A93 G;  2OQ0 A;  1SE8 A;  4HJA A;  2DUD A;  1PH6 A;  3KJO A;  1CSP A;  3PUX A;  2Q2H A;  3BZK A;  5IP9 H;  4A3J G;  1I94 L;  3K7A H;  4JI7 L;  4DUY Q;  4KHP Q;  2HIX A;  2CQO A;  3CCU A;  2UUB Q;  1KQS A;  1WI5 A;  3KF6 B;  4FDB A;  2A19 A;  4P74 A;  4YHH L;  1E3P A;  1K83 H;  3KDF B;  4DV1 Q;  2AKW B;  4JCV E;  5C0X I;  2ZJQ A;  4B3M Q;  3TS2 A;  2VS1 A;  4DR6 L;  2R92 H;  1S3O A;  3CCJ A;  2JA8 H;  3PO2 G;  2ID0 A;  5BR8 Q;  3DM3 A;  4DV2 Q;  1VQO A;  2BA0 A;  4LWC A;  1QVG A;  2ALY B;  3T1H L;  3PCO B;  1TWA H;  4UPA A;  1PH8 A;  4JOI A;  4X64 Q;  1L1O A;  3PUZ A;  5IP7 H;  1J5E Q;  2E2I H;  4XTC S;  2PI2 E;  4GKK Q;  1VQ4 A;  1E1T A;  1QZH A;  1HZC A;  1N36 L;  4B3S L;  1Y1W H;  4A3B H;  4LF4 Q;  4DR7 Q;  1X3E A;  5FLM H;  2R6G A;  1YJN A;  3HOY H;  1L2F A;  3TQY A;  5LMN W;  4B3T L;  4BY7 G;  4NXM Q;  1SLJ A;  1Z9F A;  4UP9 A;  2WB1 G;  2EIF A;  1PH3 A;  1K0R A;  1G51 A;  3VDY A;  4BBS G;  2PQA A;  2UUC L;  3RR5 A;  3CC4 A;  2UXB Q;  1IL2 A;  1A62 A;  1PYB A;  4GLA C;  4QL5 A;  4DV4 L;  4J15 A;  1ASZ A;  1NE3 A;  5IWA L;  3CPW A;  2WB1 E;  2H5X A;  4R4O A;  1E22 A;  1HNZ L;  3GD7 A;  5LMN Q;  3ICE A;  4POG A;  4DAM A;  4B3R Q;  4IPG A;  1M1K C;  1WOC A;  4MNO A;  3U4V A;  4JI6 L;  1XNQ L;  2K50 A;  2R93 G;  1A63 A;  1ASY A;  1T9H A;  4O0A A;  3OTO Q;  1JJG A;  4DV3 Q;  1BBW A;  4DR3 L;  4JBM A;  4C3I H;  4JG2 A;  4L5R C;  2JK8 A;  4DK3 C;  5C44 G;  1N32 Q;  1XPU A;  1DGS A;  4YWK A;  5FJ8 G;  3NEM A;  1TWG H;  3MXN B;  4GKJ L;  3TS0 A;  2B3G A;  2MQH A;  1X54 A;  2MFI A;  3PF4 A;  2JJQ A;  1NY4 A;  2UUA L;  1PYS B;  2VL6 A;  4HJ7 A;  5IYD G;  5IYB H;  4HIK A;  1HNW Q;  1O7I A;  1N33 Q;  2ZJR A;  3CD6 A;  2WFW A;  4A3D G;  4RG1 A;  3HOU G;  3FP9 A;  4IPD A;  2UU9 Q;  3RLN A;  3M9B A;  1HNX L;  4OON A;  4X66 Q;  2VNU D;  1VQ9 A;  1BKB A;  3TEH B;  1VQE A;  4JOI C;  4DPG A;  3PF5 A;  2I5L X;  3I2Z A;  2HQL A;  1KRS A;  2VUM H;  4LFC L;  2ZJP A;  4DR4 Q;  1OXV A;  3S16 H;  3K7U C;  4A3E H;  4YY3 Q;  4HIO A;  4A3G H;  4DUZ L;  1M90 C;  2MO0 A;  4GN5 A;  2IX1 A;  4LF5 Q;  3I4M H;  4X65 L;  4RMF A;  3A5U A;  3HKZ G;  4IJH A;  3CAM A;  3F8T A;  1VQ7 A;  1GKH A;  4AQY Q;  3G4S A;  1JT8 A;  2WAQ G;  4JC0 A;  1OXS C;  2V1C C;  3HOZ G;  3S1M H;  4KHP L;  1GM5 A;  4DUY L;  3S14 H;  3KF6 A;  2NVX H;  4L5S A;  1YHQ A;  1SRU A;  2UUB L;  4NXN Q;  2N8N A;  2IY5 B;  1QUQ B;  3CW2 C;  1J6Q A;  3W5O A;  3HOW G;  3H15 A;  4K0K L;  2F4V L;  3HKZ E;  4B3M L;  1TWF H;  4PZ6 A;  5C0X J;  4IFD I;  2I5M X;  3CCM A;  3J80 c;  1EQR A;  1WCM H;  1FVI A;  1W3S A;  3NEL A;  1EUJ A;  2WAQ E;  1BBU A;  4GS3 A;  4DV2 L;  2UXD Q;  1PH7 A;  1CSQ A;  3L2P A;  2CWP A;  2JQO A;  4X64 L;  1J5E L;  3GTP H;  4JYA Q;  4QIW E;  4YWL A;  5IP9 G;  1IZ6 A;  4GKK L;  1XPO A;  1KC8 C;  1YIT A;  1YEZ A;  2RF4 A;  4LW1 A;  2OCE A;  1C0A A;  3F1Z A;  1X56 A;  1CKM A;  2N49 A;  2JEB I;  3KOJ A;  4OO1 G;  2JA8 G;  3L0O A;  3M85 A;  3UE1 A;  1GO3 E;  2YTY A;  4JI2 Q;  4UY8 C;  3A74 A;  1VQI A;  1WJJ A;  4P71 A;  3UDG A;  3U58 A;  2CCZ A;  4OWW B;  1UWV A;  1FJG Q;  1SFO H;  4LF8 L;  3E9I A;  1IBL L;  1XNR L;  3G6E A;  1JE5 A;  2VY3 A;  4POF A;  4JI0 Q;  2MNA A;  2AHO B;  1Q8K A;  5ELN A;  3H0G G;  4GNX B;  2KHJ A;  3PO3 H;  4A3M H;  5M3F H;  5LMN L;  1OTC A;  1TXY A;  2BH2 A;  4B3R L;  1NJI C;  4PMW A;  1G29 1;  3I4O A;  3J7Z C;  3ZJY C;  1XMQ Q;  1EQQ A;  3OTO L;  3CCS A;  2UXC L;  4DV3 L;  3BJU A;  1KL9 A;  1C9O A;  1Q7Y C;  4P72 A;  1N32 L;  3K0X A;  2K5N A;  2NN6 I;  1RIP A;  2Y0S E;  4JI8 L;  4DR5 Q;  2A8V A;  3AFP A;  5AJ3 Q;  2NVT H;  1Y1V G;  4DV7 L;  4DV0 Q;  4LF9 L;  3I4N H;  4LFB Q;  1UE1 A;  4Y52 H;  1N9W A;  3PUY A;  1YZ6 A;  2B29 A;  1W2B A;  3GTL H;  2WP8 J;  1EWI A;  2LSS A;  2JE6 I;  1AE2 A;  1HNW L;  1QVF A;  1X6O A;  4GOP A;  2Q2U A;  3S17 H;  2UU9 L;  1NTG A;  5K36 G;  2D0O A;  1CKN B;  1KAW A;  2EXD A;  3B6Y A;  1PV4 A;  1SRO A;  3A0J A;  1Q46 A;  4MTN A;  4TQU S;  1X3F A;  3J81 j;  4DR4 L;  1IBM Q;  2NVQ H;  5GAE C;  2HHH Q;  4BBR H;  1EYG A;  3KYH C;  4HIM A;  4YY3 L;  1PHJ A;  4LNQ A;  3D0F A;  4JV5 Q;  2GVA A;  4DR2 Q;  4LF5 L;  4LF7 Q;  4DR1 Q;  4DAY B;  1I3Q H;  3S15 H;  4IO9 A;  1D7Q A;  2PMZ E;  3HOV H;  1YBY A;  4PZ7 A;  3FKI G;  4LFA Q;  1LTL A;  1RL2 A;  3PUW A;  4ALP A;  2OWO A;  1XTD A;  4PZ8 A;  4EQ5 A;  3S24 A;  3T1Y Q;  4P73 A;  4A3E G;  4IPC A;  3E0E A;  4A3I G;  3ULL A;  2EQS A;  3UDX A;  1YI2 A;  4IFD J;  4MZ9 A;  4JI3 Q;  1UE7 A;  4LUZ A;  1XPR A;  4JI4 Q;  1E1O A;  1Q12 A;  3I7F A;  3F2B A;  4A3K G;  2YV5 A;  3HOX G;  1E24 A;  1I50 H;  1YHA A;  3F2C A;  4WJ3 M;  1HH2 P;  4A3L H;  3EIV A;  3S2D H;  4A3F G;  1IBK Q;  2AWO A;  1VS0 A;  1U0L A;  2D62 A;  1VQB A;  2AWN A;  2K4K A;  4L5Q A;  2QEX A;  3CC7 A;  2B63 G;  5JJI A;  5GAD C;  3AQQ A;  2E5L Q;  3S1N H;  5DLQ E;  4R1J A;  4UP8 A;  1PA6 A;  4BA2 I;  1WCM G;  4O2D A;  1K3R A;  1B70 B;  3RLF A;  5IT9 c;  3CQZ H;  4JI2 L;  4GLX A;  1JJC B;  2ZM6 Q;  5J3B A;  4OX9 Q;  1L0W A;  2ASB A;  1XMO L;  1KHI A;  1MJC A;  2KCM A;  2KHI A;  3CPF A;  2K14 A;  1VQA A;  4JBJ A;  4C2M H;  5M3M G;  4GOP C;  2VQF Q;  4BY7 H;  2VQE Q;  3GTQ H;  1X3G A;  1KIX A;  2Q2I A;  4JI0 L;  2ZTD A;  1OXU A;  4L5T A;  1H95 A;  2R7Z H;  1KRT A;  4BXX G;  3M4P A;  3T1H Q;  2Q2T A;  4GN4 B;  3TRE A;  3KFU A;  4BBS H;  3JAM c;  4JBK A;  4IPH A;  1L1O B;  5IYC G;  2YTV A;  1SN8 A;  4B3S Q;  1N36 Q;  2YYZ A;  1EIF A;  4Y7N H;  3J81 c;  1P8L A;  2XGT A;  4APV A;  4JI1 Q;  1TWH H;  3KF8 B;  4B3T Q;  3KDF A;  2CFM A;  3Q8D A;  3STB C;  4AYB G;  4DV1 L;  4IJL A;  4DR5 L;  4OO1 I;  5AJ3 L;  2R93 H;  2K5H A;  4DV0 L;  5M3F G;  3A5Z B;  5BR8 L;  1VCI A;  2PQA B;  2AMC B;  2ZTE A;  5FJ8 H;  4DV4 Q;  1V43 A;  5LMU Q;  1Q82 C;  4DKA C;  4AYB E;  1VQJ A;  5IWA Q;  1CKO A;  3CP0 A;  3K80 C;  4QQB X;  1SR3 A;  4DR7 L;  2I0Q A;  3MEF A;  4LF4 L;  3TRZ A;  4K0K Q;  1VQN A;  3AEV A;  1VQD A;  4NXM L;  1XNQ Q;  2R92 G;  3ER0 A;  5IYD H;  4A75 A;  3CF5 A;  2GN5 A;  2IHF A;  2HHH L;  4PG3 A;  3HOU H;  1R9T H;  3J80 i;  4BY1 H;  3W1B A;  5C4J H;  4P75 A;  5IP7 G;  2RHQ B;  1K8A C;  3UDF A;  4DR2 L;  4JV5 L;  2UXB L;  1PVO A;  4LF6 Q;  4DR1 L;  1PH5 A;  1D8L A;  1Y1W G;  5GRO A;  3OW2 A;  3I56 A;  4A3B G;  2PNH A;  5FLM G;  3HOY G;  3NEN A;  4IOA A;  4YHH Q;  2JA5 H;  2Y0S G;  4LFA L;  3GTJ H;  2PI2 A;  1B8A A;  3CCL A;  5FLX c;  3NBH B;  3PIO A;  3GTG H;  2JA6 H;  5C4X H;  2N78 A;  4C3J H;  1WFQ A;  4UP7 A;  3M7N A;  2CKZ B;  3T1Y L;  1LM0 A;  1Q86 C;  4AIM A;  2KEN A;  3U4Z A;  4KLK A;  1VQM A;  4A4I A;  1NMG A;  4TVA B;  4JBW A;  1JJ2 A;  1HR0 W;  2VZA A;  2LXK A;  4ME3 A;  4JI4 L;  1LUZ A;  4A3C H;  3J7A 5;  4HID A;  3HOV G;  5HY6 A;  1A0I A;  4BA1 I;  4QY7 A;  4X62 Q;  3HOW H;  5M5Y H;  5H1S E;  1PH1 A;  1S72 A;  1GVP A;  3PSI A;  3G71 A;  1IBK L;  1JB7 A;  4JI5 Q;  1SMX A;  1MIU A;  3UE0 A;  2OTJ A;  3PV0 A;  1MJE A;  1VQ8 A;  1EOV A;  3WWV A;  2E5L L;  2JA9 A;  1N33 L;  1OXX K;  1A8V A;  3RLO A;  1PH4 A;  3S1Q H;  2OTL A;  5JJK A;  2KBN A;  4X66 L;  4H02 A;  1HR0 Q;  5IE8 A;  1LYL A;  1G6P A;  1GD7 A;  1XJV A;  3K81 C;  5GAG C;  2ZM6 L;  3RN5 A;  1VQP A;  4OWT B;  4OX9 L;  4WJ4 A;  3LGJ A;  4DV5 Q;  2F4V Q;  4DK6 C;  4NPS A;  5C3E H;  2VQF L;  2I5H A;  4R4C A;  3RN2 A;  3IRB A;  1VQC A;  2VQE L;  1Q81 C;  1VQ6 A;  5IYB G;  5GQO A;  3S2H H;  2NZH A;  2NVY H;  4YWM A;  2QA4 A;  1YIJ A;  3HOZ H;  2JEA I;  4LUO A;  2YTX A;  3KJP A;  5M5X H;  4HJ8 A;  2R7F A;  4AQY L;  1IXR A;  1YVC A;  2DGY A;  3RZD H;  2ES2 A;  1Z47 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...