2RF4A

Crystal structure of the rna polymerase i subcomplex a14/43
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
192
structure length
174
Chain Sequence
b'KQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDGNSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA4
publication title Functional architecture of RNA polymerase I.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 23
structure length 174
sequence length 192
chains with identical sequence C, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
A PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2rf4A02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2rf4A01
4A75A 5M5WH 3HFZB 1EQQA 4LNQA 1GKHA 1KL9A 2UU9L 1E1TA 2WAQG 4UP7A 4DKAC 4GNXB 1TWAH 3TS0A 4LUVA 1N8RC 3KF8B 2PI2E 4BBSH 1N36Q 1J5EQ 4B3RQ 4A3FH 1CKNB 1EYGA 2E5LQ 1B70B 3PO3H 3OTOL 1YITA 4DV2Q 2NVTH 2D0PA 1YVCA 4R4QA 2MFIA 2UUBQ 3CPFA 2K4KA 5GROA 2UUAQ 4YCUA 2R7ZG 1PVOA 2EIFA 1VQ5A 1JJCB 4OWWB 2UXCL 1JJ2A 4JI2Q 1KHIA 4QL5A 1IBKL 3I4MG 3HOYH 3FP9A 2CCZA 1NY4A 3CC2A 4A3MG 1CKMA 2OQKA 3CD6A 4WJ4A 3CCQA 1LYLA 2B63H 3ZJYC 4P75A 1CKOA 3AQQA 4EX5A 3GTKH 2KHJA 3G71A 3KJPA 1V43A 3CCLA 2JA8H 3GTPH 1WCMH 4TVAB 1SFOH 4A93G 1B8AA 3JC66 4DV3Q 1FL0A 2AHOB 3BJUA 3UDFA 4DR3Q 4LF7Q 4OONA 3PUXA 3I4NG 2R7FA 4LFAL 2I5LX 2JJQA 1Y1VG 4NXNL 1XMQQ 1B7YB 1L1OC 4UPAA 3ERSX 4JI3Q 2GVBA 2RF4A 2NVYH 1GD7A 1Z47A 1M90C 1XPUA 4GKKL 5C4XG 2YU9H 2EQSA 4JI1L 4R4OA 4OWXB 4DR5L 1G51A 5M3MG 3J81j 4YHHL 3GTJH 3HOVH 2ZTCA 3SGIA 3PV0A 1OTCA 5JJIA 1KRTA 4GS3A 3M4OH 4A3CH 1NMFA 4JI4Q 3KLWA 3OTOQ 4A3IH 4GKJL 2UXBQ 4IJLA 4HJAA 1UE5A 2CWAA 1L1OA 5LMUQ 4WJ3M 1HZAA 1ASYA 5IYBH 3F2BA 4IPDA 5M5XH 5IP9H 5M3FH 1EIYB 2IHEA 3M4QA 1VQOA 1K83H 3K80C 2JA5H 4B3TQ 3S1NH 2UXCQ 4YY3Q 4QGUA 4IFDI 4DK6C 1PH7A 4GN4B 1X3FA 1SE8A 5BR8L 2PI2A 1UEBA 2CWPA 3T1HQ 3ULPA 4LWCA 1TXYA 1M1KC 1P8LA 1K73C 3CC4A 1A62A 3CPWA 1T9HA 1YJ9A 4DUZQ 1OXUA 4A3BG 4NPSA 2E2HH 1C9OA 1VS0A 5IP7G 4X6AH 2JA7H 1O7IA 4A3DH 4BBRG 2MNAA 1L1OB 4POFA 3HOXH 2XGTA 1QVGA 2AMCB 2A1AA 1FJGQ 2RCNA 3S15H 1IYJB 3F1ZA 1N9WA 2Q2HA 2JA6G 1XTDA 3PF4A 2JE6I 4YCVA 3TREA 2Z0SA 5FJ8G 4LFCL 3S2HH 3CCUA 1W2BA 1OXVA 4OO1G 1VQJA 5IYCG 2MO0A 3HOZH 1EUJA 2NZOA 1N34Q 3UDIA 1VQ8A 4IPCA 1P16A 1WFQA 3U4VA 2BA1A 1L2FA 5GADC 4R4TA 1YHQA 4LF6L 4L5TA 3ICEA 5ELOA 1Y1WH 4JI0Q 2HT1A 1JE5A 3RLFA 4X64L 1S72A 2VL6A 2NN6I 3A5UA 1PFSA 4A3KG 1XJVA 1Y14B 4KHZA 3IRBA 4PZ7A 4LF9Q 4BY7H 4LFBL 1IL2A 4UP9A 2FXQA 2PQAA 4LF5Q 4X66L 3DLLA 3S24A 5C0XI 4DR1Q 3GTMH 4DR6L 4JI8Q 4DV6Q 1XNRL 4DAYB 4LW1A 5EAYA 5IY0A 3HOWH 1I94L 3ULJA 1D7QA 1BBWA 2UUCQ 4A3LG 4AQYQ 1X3GA 1KC8C 2VQEL 4YWKA 1I5FA 4BA1I 2H5XA 4GN3B 4R4IA 4QJFA 4X65Q 3M7NA 4OWTB 1I6HH 2F4VL 1HNWL 2WFWA 2B29A 1VQAA 2V1CC 4JBJA 4P74A 4C3JH 3E9IA 4H02A 3CC7A 5LMNL 1XPRA 1A63A 3F8TA 1MJEA 2Y0SE 2PQAB 3H3VI 4BXXH 1IBLQ 1ASZA 4YCWA 1PH4A 2I5HA 2HIXA 3RLNA 1NE3A 1Q46A 3G48A 3MEFA 4HJ5A 1Q1EA 2LSSA 2VQFQ 3T1YQ 2UUAL 4KHPL 2K5NA 3CW2C 3FKIH 1N33Q 4PG3A 5LMNW 4JI6L 3L7ZC 1MJCA 4DPGA 1FGUA 2NZHA 3JAMi 1JB7A 1C7YA 4K0KL 2VUMH 1HR0L 3OYYA 1OXTA 1EOVA 4BY1H 4JI7L 2CFMA 4DR7Q 1YEZA 3NENA 4GLAC 4A76A 2N78A 1BBUA 1HNZQ 3H0GH 4IOAA 2LXKA 2K50A 3PCOB 3D0FA 2ATWA 1KAWA 2YTXA 4A3EH 4DUYL 1EWIA 1IBMQ 1HR0W 4JI5Q 4X62L 4IPHA 2ASBA 1N33L 1L0WA 2ZM6L 4B3ML 4JCVE 4JOIC 4JV5L 5C3EH 2UXDQ 3I2ZA 1VQDA 4NB3A 3F2DA 1NJIC 3D31A 4LUOA 5AJ3L 4LF4Q 4HIOA 2R7DA 1HNXL 4B3SQ 4JYAL 4DV1Q 3M9BA 5FLMH 1TWCH 1K9MC 1EIFA 1XMOL 1YIJA 4O2DA 3AEVA 1HZCA 3CXCA 4DR2L 1QVFA 4TQUS 2OCEA 2I5MX 3GTQH 1PYBA 4A3IG 2PMZE 4JOIA 4LUZA 4DV7Q 1Q1BA 4APVA 2R7ZH 2BA0A 2Q2IA 2Y0SG 3I55A 1Z9FA 1PH8A 3AFPA 2UU9Q 5IYBG 1SLJA 1N32L 4JC0A 2YTYA 3MXNB 3U4ZA 4AH6A 3E0EA 1LM0A 4DV5L 5C44G 4RMFA 1PH2A 3S1QH 3CQZH 4IO9A 4JI6Q 3PUVA 2IX0A 4HIKA 3UDGA 1X9NA 4K0KQ 3TQYA 2R6GA 4P73A 4PZ8A 1NTGA 1RL2A 4HIDA 2GN5A 3L0OA 4MZ9A 4JBKA 5JJLA 1HZ9A 4DNIA 5IWAL 1IBKQ 3PUYA 3RZOH 4A93H 4LF8L 2B3GA 4DV0L 1G291 4DUYQ 3KOJA 4HJ9A 5ELNA 3CCEA 1E22A 4GOPC 4FDBA 1Q82C 4DAMA 1Y1VH 5E7NA 1VQMA 1CSQA 1LUZA 2BH2A 3RNUA 3S2DH 1EFWA 5C4XH 1QZGA 1UE6A 4Y7NH 4UY8C 1WJJA 1PH6A 1FVIA 4OX9L 2DGYA 4DR4L 4XIGS 4C2MH 1X55A 3RR5A 5JJKA 1HJPA 5HGQA 5M3MH 4A3JG 1K8AC 4L5SA 4NXML 4LFAQ 2A8VA 4NXNQ 4QY7A 1RIPA 4DV4L 1I3QH 4C3HH 4GOPA 1Y1WG 1R9TH 1X6OA 3W5OA 5GAGC 3J7A5 5IYDH 1VQCA 1SN8A 4GKKQ 2NVQH 4JI1Q 1Q86C 1LTLA 4MTNA 2ZJPA 4BY7G 2QGQA 4DR5Q 3BZKA 4YHHQ 2NVXH 1I50H 3TS2A 1X56A 2QEXA 3J81i 3KYHC 1OXXK 2HHHL 2ES2A 2PNHA 3GTLH 3S1RH 4GKJQ 1QVCA 1V1QA 3A74A 1PHJA 3I4OA 2K5HA 1YJNA 4HIMA 3CMEA 2I0QA 1KIXA 4A3BH 4A3GG 2RHQB 4ME3A 5IP7H 4C3IH 1UE1A 4GOPB 3H15A 2R93G 4BBRH 1N36L 1PH5A 1Q8KA 2E8GA 3A5ZB 2YYZA 4MNOA 1J5EL 4B3RL 4R4CA 2E5LL 2K52A 5BR8Q 3PO2G 3HOUH 4IJHA 2K14A 4DV2L 1GO3E 2KENA 2Q2TA 2D62A 4JBWA 4YWLA 3RN2A 2UUBL 1X54A 5FJ8H 2IX1A 3CAMA 4OO1I 3KJOA 1XNQL 2VNUD 1JJGA 2ALYB 1CSPA 1K3RA 4GLVB 1U0LA 5IYCH 3M3YH 3J80i 2VS1A 4DR4Q 4JI2L 4BBSG 3GTOH 4HJ8A 3NBHB 3BU2A 3K81C 4A3FG 1QZHA 3PO3G 4L5RC 2IY5B 3GO5A 3STBC 1SROA 2IHFA 2VZAA 4BY1G 4NXMQ 3K7AH 2KCMA 4A3KH 1VQ4A 4LFCQ 4P71A 3CCRA 2F3IA 1KXLA 2WB1G 2Z6KC 1HH2P 3AFQA 2OQ0A 3ER0A 4L5QA 1EQRA 1VQEA 1VQ9A 3HOYG 3KFUA 5GAHC 4LF7L 4A3EG 4LF6Q 3PUZA 1SMXA 4A3LH 3FHWA 1OXSC 1VQGA 1IZ6A 1YHBA 3EIVA 5HY6A 3UDXA 3JAMc 4X64Q 2B63G 3A0JA 1XMQL 2MQHA 1VQFA 1Q12A 3GDEA 4JI3L 1XPOA 4P72A 5C3EG 4IOCA 5M5YH 2HIVA 3M85A 3UE0A 4LFBQ 1Q7YC 3NEMA 2R92H 1TWHH 4DR6Q 4X66Q 2JA8G 2VY3A 1WCMG 2Z6KA 1XNRQ 2XTIA 2KHIA 2MO1A 1I94Q 5FLMG 5H1SE 2YV5A 4AYBE 2DUDA 2VQEQ 4JI4L 1Q81C 2UXBL 5J3BA 4Y52H 1WYDA 3G6EA 3E9HA 4PMWA 5LMUL 2E2IH 1XNQQ 3CP0A 2F4VQ 3S14H 3TRZA 2QA4A 4J15A 1HNWQ 4HJ7A 2L15A 1VQBA 5IT9c 4B3TL 4YY3L 4GN5A 5LMNQ 1VQHA 5DLQE 4A3CG 4KI0A 3T1HL 3Q8DA 1YJWA 2HQLA 3S17H 5GAEC 2YTVA 1U5KA 2AKWB 1PH9A 1E24A 2N3SA 4DUZL 4KHPQ 4ALPA 1AE3A 2AWOA 4UP8A 2C35B 3EBEA 5M3FG 3F2CA 5IP9G 1CUKA 3B6YA 5C0XJ 1E1OA 2CQOA 3I4MH 2JA5G 1MIUA 1TWFH 4XTCS 4A3MH 4R1JA 1FJGL 1JT8A 1K0RA 4PZ6A 4IFDG 1PYSB 4IPGA 1HR0Q 4JI7Q 3KF6A 1IXRA 1H95A 3I7FA 2ZTDA 3AYHB 3S1MH 5GQOA 2N8NA 1DGSA 2EXDA 5JEAG 3J7ZC 2ID0A 3ULLA 2JA7G 3KDFA 2VW9A 4A3DG 1VQ7A 1G6PA 1N34L 1X65A 3HOXG 1VQ6A 1YHAA 1VQLA 4KLKA 3I4NH 4X62Q 4DK3C 1A8VA 1J6QA 1YBYA 3K0XA 1UWVA 3PGZA 2N49A 2ZM6Q 2K5VA 4B3MQ 2ZJQA 3OW2A 4JI0L 4A4IA 4JV5Q 1VQPA 1K8GA 1D8LA 2KBNA 4LF9L 3G4SA 2CKZB 2JEBI 5IYDG 3HOZG 5AJ3Q 3KF6B 4AYBG 2WP8J 4LF5L 4DR1L 1AH9A 1HNXQ 4JYAQ 4JI8L 3CCVA 3PIOA 4DV6L 1E3PA 1E7ZA 3K8AA 1XMOQ 2WB1E 5C44H 2UUCL 3L2PA 1KRSA 2IT1A 3KDFB 4AQYL 4QIWE 3UE1A 3PSIA 2JA9A 4DR2Q 1HZBA 2OTLA 1GVPA 2Q2UA 3U58A 4X65L 3M4PA 1VQKA 3TEHB 1BKBA 2NN6G 3W1BA 3HKZE 3HKSA 3W1GA 5K36G 2ZTEA 1N32Q 3K7UC 3U50C 4QQBX 2GVAA 5C0XG 3HOWG 4DV5Q 1YNXA 2JQOA 2KCTA 1VQNA 1IBLL 2WAQE 3J81c 3HOUG 2F52A 2A19A 3CCJA 2OTJA 2VQFL 1TWGH 2ZJRA 4GLXA 4O0AA 3WWVA 1QUQA 3T1YL 1PH3A 3GD7A 4AIMA 1BVSA 3CMAA 3CF5A 1MKHA 5IWAQ 3CCMA 1KQSA 1JMCA 2E2JH 3HOVG 3H3VH 4A3JH 1PA6A 4LF8Q 3EN2A 2JK8A 5FLXc 4DV0Q 1C0AA 1NMGA 3PIPA 3I56A 1V9PA 1WI5A 4GNXC 4YWMA 1YI2A 2JA6H 2JEAI 4BXXG 1S40A 1KD1C 4DR7L 2OWOA 3S16H 3PF5A 1HNZL 3GTGH 2AWNA 4POGA 1S3OA 1A0IA 5C4JH 4OX9Q 3BZCA 3FKIG 1SR3A 1X3EA 1WOCA 4OXPA 3J80c 1IBML 4JI5L 3LGJA 4EQ5A 1QUQB 3NELA 2VUMG 2RHSB 1PH1A 2BH8A 4DV4Q 4GNXA 1UE7A 2UXDL 3RZDH 3H0GG 4BA2I 3RLOA 4JBMA 3PUWA 1CKNA 2K75A 5IE8A 4LF4L 4A3GH 3DM3A 4B3SL 1W3SA 2R92G 4IFDJ 4DV3L 2R93H 4DV1L 4DR3L 4JG2A 1VCIA 3RN5A 3HKZG 3CCSA 3VDYA 1PV4A 1SRUA 2HHHQ 3PO2H 1AE2A 5JEAJ 1GM5A 3STBD 1VQIA 1NBWA 2LXJA 4DV7L 4RG1A 1YZ6A 2D0OA
chains in the Genus database with same CATH superfamily
3KLRA 4A3KB 1E1TA 2WAQG 1O75A 4YIJA 5LMNH 2WINB 3V6KA 5KFQA 5KFTA 4B3RQ 2PZTA 1DONA 2NVTH 1SE4A 2EOTA 2NZ1D 2E2IA 4KHPH 1I7LA 1PVOA 1F9SA 2EIFA 1HTPA 1IHZA 2R86A 1JJCB 1O7ZA 5KFFA 4JI2Q 1F9PA 1IBKL 1TWHB 3Q1KA 5I4DA 3KXYT 4JI7H 4J9RA 4CDFC 2OQKA 1D5MC 3TP6A 1AN7A 3ZJYC 1T5EA 4R8UA 1YNNC 1CKOA 5JOBA 3GTKH 5DG8A 1DV2A 3KJPA 1V43A 3K5LA 4U68A 3S14B 4TVAB 2EY1A 4DV3Q 5D14A 2J4XA 1HXYD 5DM63 3M4IA 2JJQA 4Q44A 1B7YB 4UPAA 2V4RA 4JI3Q 2GVBA 2RF4A 1M4VA 4YJ2F 3GV5B 3S17B 5KEEA 2EQSA 4JI1L 2FK2A 2HD3A 1STBA 1TS4A 5M3MG 3J81j 3GTJH 5EWFA 4GC7A 3PV0A 2RDGA 5JJIA 1KRTA 2RGVA 5CB4F 4YR0A 3BJYA 2W6MA 3OTOQ 1EFID 4IJLA 4HJAA 1E2WA 1PFMA 1UE5A 3ERQA 4KJOA 5LMUQ 3EPGA 2FK3A 2W9CA 5M5XH 3O13A 1PYWD 4YR2A 5KFWA 1KC7A 2E2DC 2FLLA 4GN4B 1X3FA 1CTMA 5BR8L 1G6ZA 2YS7A 1UEBA 3T1HQ 4ECWA 4LWCA 1TXYA 5D3DA 1P8LA 3CPWA 1YJ9A 1T9HA 1OXUA 1CHQD 3HRZC 1GUWA 4OGQC 4KKUA 2Y0SB 5ISRA 5M3MB 2L5TA 2XGTA 2A1AA 1B53A 2RCNA 2HVSA 1STEA 1EYCA 3F1ZA 4B9WA 5C44B 5DG7A 2QDBA 4YCVA 3RB0A 2Z0SA 1LABA 5FJ8G 1CA5A 2C2DA 5C5JA 4DR4H 3A56A 1KABA 5JAVA 5IYCG 2MO0A 4ODGA 4M1UB 3TQ1A 2F0DA 3M9MB 2FJ2A 5C8YF 2JA6A 1YHQA 4R4TA 3TP8A 2HT1A 4DK0A 3MFYA 2CH4W 3GTGA 4BY7H 3K5HA 5K36H 3NBIA 5FO8B 3M9NB 2PQAA 4DR1Q 1RDPD 4IWYA 3VR6A 1TWGB 4JI8Q 1D5XC 4DV6Q 1G91A 4RZRA 1SYFA 2W9AA 1LTTD 3HOWH 1D7QA 2XNAC 1GSHA 3PN1A 2EYMA 1BOSA 4LK1C 1CQIB 1X3GA 2XCPA 4R4IA 3M7NA 4DV4H 1B6RA 1AW7A 1I6HH 1IW7D 2BCOA 1X3PA 2A74C 5C4JB 1VQAA 3HOVH 4B3RH 2HCCA 3RGZA 3R3OA 5EPJA 1ASZA 2NUCA 5J2UF 1PRTC 1SNDA 4RWSC 2I5HA 5L1LA 1PMRA 2LSSA 4ECSA 1TWAA 3RAQA 4JI2H 3FKIH 1JORA 5LMNW 2FLPA 3MA2B 4JI6L 2R8KA 2HVRA 4DPGA 2FFKB 2F0MA 1C7YA 2R93B 3VA7A 1NR2A 4CKBA 1EOVA 4UCSA 1Q8IA 3HG9A 1E0BA 1HNZQ 1JKJB 3Q0AA 1E2VA 3G8CA 2EY6A 3DMUA 3PCOB 4XX0B 1O80A 3D0FA 5M5WB 1KAWA 3FRPB 5KFDA 4Q43A 4DUYL 2ASBA 4WFN3 2B63A 2C2RA 1D2BA 4IZOA 4JI3H 4RKLA 3PO3B 2PQEA 3I2ZA 4NB3A 3MWMA 4RAYA 2JP1A 1H9MA 1NJIC 1CFMA 4F4XA 4IRDA 1JR0D 4JYAL 4MAMA 1L2ZA 1PRTB 1TWCH 2KA7A 4OELB 1TQOA 1XMOL 1YIJA 2E76C 5CC4A 2XCLA 2IWHA 4DA2A 1HQMC 4LH6A 2F0PA 2F0TA 1J8IA 2IJ0A 5LMUH 4ED8A 4JOIA 3GIPA 1YNND 2VPQA 1RJRA 4X3KA 3I55A 5IYBG 3LWBA 1HA5A 4IALA 3MXNB 3U4ZA 2QK4A 1EEFD 3E0EA 2B2UA 4DV5L 1PH2A 3S1QH 2JA8B 3GTPB 5J2TF 1SYDA 3PUVA 3T1HH 3GV7B 2IX0A 2EE1A 3UDGA 4MTKA 1RODA 4K0KQ 3HGBA 1SE3A 3ITPA 2G9HD 4PZ8A 1NTGA 2B2WA 5D1PA 2Q8IB 1B44D 1MSHA 2XWJB 1DV1A 3U9OA 1IL8A 2A73B 2YU9B 2YZMA 4DV0L 1RJPA 2EYHA 1Q90A 5ELNA 4MIUA 3CCEA 2DNEA 2F0KA 2FB9A 3DWPA 4DAMA 1Y1VH 1VQMA 1CSQA 2C5CA 3RNUA 2E2HA 3SVMA 4UY8C 1LT3D 1WJJA 2JA7A 1L0XB 4ULLA 3TN2A 2FPIB 4XIGS 1X55A 4ETSA 5KNDA 5JJKA 4ZLTF 2B2TA 3KUPA 5I6WA 5IOCA 5KFHA 2IA6A 5M3FB 2J6TA 4H44C 2A8VA 4O3QA 1BQQT 4NXNQ 1F77A 1RIPA 4DV4L 1Y1WG 1R9TH 4HMIA 1X6OA 3QG1A 3K58A 1F9QA 1S4ZA 1CS0A 4DR1H 4JW0A 1LTLA 2ZJPA 4JI8H 4DV6H 1STAA 4CJ1B 3BZKA 2NVXH 1I50H 3TS2A 5I2YA 4KN7C 2KEDA 2CH4A 2XWBB 2QEXA 3Q23A 3FDSA 1OXXK 2HHHL 4CBVA 2ES2A 3HOXB 5BPHA 4GKJQ 1VBHA 3A74A 2HDMA 1PHJA 1EOTA 4A2AA 5G3LD 2JYOA 4HIMA 5KFPA 5K5PA 3GTMA 2QKIC 1KIXA 1K8OA 4EYIB 1SNPA 3MC0B 4K14A 1UE1A 3E5SA 2E8GA 1J5EL 2K03A 4R4CA 4C3JG 1KJ9A 2F3VA 3DF7A 4S3SA 1GO3E 2D62A 3DEPA 3CAMA 3KJOA 2VNUD 1Y1WB 5IYZF 4OO1H 4GLVB 2R6FA 5D1OB 5IODA 3VPBA 3SE0A 2O4XA 4ZYSA 2EDGA 2QYZA 3GO5A 1UC9A 2VZAA 4DXGA 4LFCQ 1VQ4A 1U4PA 2QILA 4MA5A 4UAIA 4U7CA 5DGAA 2YYAA 4LF7L 1TIID 3LNNA 4LF6Q 3PUZA 4C3JB 1OXSC 3EIVA 1WR2A 3P20A 1TS5A 1BJTA 5CA0F 3A0JA 2MQHA 2FMMA 2OEOA 4R9WA 3GDEA 1K0SA 3H0GA 1PRTD 5KFYA 5C3EG 3CVZA 1A9XA 5M5YH 3UE0A 1Q7YC 3NEMA 4X66Q 1S5DD 4DR3H 1A15A 1WCMG 4EVOA 2XTIA 4O3PA 4Q8EA 2KHIA 5EBCA 1I94Q 3GIKA 5DLFA 5H1SE 1BNZA 2HGSA 2VQEQ 2UXBL 2F0FA 4UHVA 4CGYB 2VUMB 5KYLA 2E2IH 2O5JC 2F4VQ 2WAQA 1SXTA 4CHTB 1HNWQ 1KDAA 2K5WA 2L15A 3DUZA 4HAEA 2ASLA 5C6AA 4HMJA 2FJZA 5KFBA 4RNNA 4A3CG 2ASDA 4O3OA 1PH9A 3C2PA 5C1PA 5IGDA 3LP8A 5C3EB 4UP8A 1WTRA 4J1MA 2C35B 2EYJA 5CORA 2UUAQ 3PVXA 1CUKA 2UXCH 4OL7A 2CQOA 2JA5G 2R61A 5FPOA 2SDFA 4CDCC 3LWEA 4IFDG 1PYSB 1HR0Q 1DOKA 1WSCA 3KF6A 4CDEC 2JEGA 3GIQA 4YP3A 1I4QA 4X3UA 1SNOA 5JVH3 4FBUA 4ZHQF 3S1MH 4PDBA 2NWGA 3SK6A 5C4ZA 2K01A 3A7LA 2VW9A 1VQ7A 2IX3A 3I4NH 4X62Q 4DK3C 1J6QA 1UWVA 4NXNH 2N49A 2ZM6Q 2ZJQA 4JI0L 3CQZB 4ECUA 4O3SA 4JV5Q 4J9NA 1VQPA 5CV9A 1A6XA 2QDLA 5L37A 3G4SA 3HOZG 1EQTA 5AJ3Q 4AYBG 2WP8J 4LF5L 1DD2A 2IP4A 3BS1A 2JEJA 1E7ZA 4FP5D 4KD3A 1D1IA 2N55A 4MV3A 5I6YA 3PIO3 3L2PA 4GKJH 4AQYL 1SNQA 1WTOA 4QIWE 3UE1A 4A93B 4DR2Q 2C22A 2OTLA 1GVPA 4LF5H 3M4PA 2HJWA 3JSLA 2JEFA 2NN6G 2F0GA 1AFPA 3HKSA 4L63B 2ZTEA 1DCZA 5FK9C 5C4XB 1G2TA 4EG0A 1WVLA 2GVAA 4AQYH 5CV6A 2DJGC 3OUUA 2JQOA 1KDBA 4J9OA 3HOUG 3MVVA 5LL6S 4O3RA 1A3TA 5KT5A 3CCJA 3J80W 1SSOA 2YRXA 3T1YL 4XZ3B 4O0AA 4C3HB 1QUQA 2PW7A 1PH3A 2X6LA 4AIMA 3CCMA 1C8CA 2NVQB 5IWAQ 3R5HA 2XC9A 3P7JA 3PR4A 3H3VH 3K0YA 1PA6A 3SK4A 3EN2A 1F9RA 1NMGA 2DY7A 1WI5A 3PIPA 3I56A 4YWMA 2JA6H 4BXXG 2HCIA 4UCOA 5KG3A 5LOVF 4IQZA 1S97A 4LFCH 2J7ZA 1TY2A 3T13A 3GTLB 4ZRZA 4RUCA 3GTGH 2BE5C 4OX9Q 3HP3A 4CKCA 2A6EC 1PZJD 1X3EA 1WOCA 1IBML 4LF6H 2I80A 1E4EB 4BBRB 3KLSA 5ELFA 2BH8A 4FF1A 4GNXA 3HOUB 2UXDL 2WYOA 1OO9B 4X66H 1CKNA 2K75A 5IE8A 4RZQA 2IBKA 3ORRA 3I8ZA 4B3SL 2R92G 1PTOH 1I94H 1JOQA 4JG2A 3H40A 1NR4A 1S0NA 4PQXA 3HKZG 3VDYA 1PV4A 3VYSA 3GTOB 3PO2H 2VQEH 1AE2A 4GZYC 3JZIA 5IT9W 2W6ZA 2LXJA 4I7AA 4QIWA 2WV6D 4RG1A 2F4VH 2D0OA 5KT6A 1HNWH 2RDFA 3K7AB 4IUTA 3HFZB 4K5VA 4A75A 1EQQA 2UU9L 4LNQA 3GP7A 4NKLA 1NUCA 1TWAH 3KHLA 4BBSH 3Q8RB 4KY7A 1JOKA 1AUVA 4A3FH 1V8QA 1EYGA 2E5LQ 2ZJTA 1YITA 2EYLA 1YVCA 4QWEA 3FVQA 2MFIA 4K5XA 5GROA 2L11A 3V96A 4YCUA 2R7ZG 3TSSA 3TINA 3PMFA 5DNFA 4FVMA 4OWWB 1JJ2A 2KOLA 2R92B 1LTSD 3HOYH 1Z2OX 1HR0H 1ENCA 1LLRD 3CC2A 4A3MG 4J9QA 2VUGA 1PZID 4WJ4A 3GV8B 2B63H 3OIPA 3NTHA 3FPUB 4MV9A 5KNCA 4P75A 3MJFA 3AQQA 5KG0A 3MTSA 4IRCA 1K8MA 3EFXD 2IPKD 1TWFA 4X62H 2Z4IA 1B8AA 3BJUA 4PWQA 4ZUJA 3KAJA 2ZM6H 3PUXA 3MHBA 4JV5H 1L1OC 1Z47A 3T53B 1QJOA 2MUYA 4DR5L 1M6VA 4R8NA 4YHHL 5EJWA 1OTCA 5G3LF 5KFAA 4GS3A 3M4OH 4DR2H 3KAKA 4A3MB 4RB1A 3KLWA 1RTNA 4A3IH 4MV1A 5EWEA 3GV3A 3TP5A 4WJ3M 1HZAA 1MZBA 3F2BA 2SEBD 3J81W 2O03A 5IP9H 1EIYB 1RK6A 3L4KA 5IT9E 5KFGA 4EBDA 4YY3Q 4QGUA 3TZDA 4DK6C 5CAEB 2Z4HA 5TSSA 2CWPA 1JCKB 3ULPA 1ILPA 4LH7A 1K73C 3CC4A 1T36A 2DPIA 4FF2A 4K8IA 2K33A 4B9XA 4DUZQ 4A3BG 1FNUA 3N6RA 4ZKBB 2E2HH 1C9OA 2F0WA 3QOJA 1IOVA 4FU0A 3BDCA 4C3IG 2JA7H 5IWAH 4A3DH 1L1OB 1EEID 4POFA 1FJGQ 1I4XA 5IGFA 1D1KA 3S15H 1QOHA 3OMGA 1N9WA 5A35A 4G3IA 3D8GA 1XTDA 3PF4A 5CBEE 3BVZA 3S2HH 1EWHA 4DAYA 3ETHA 4OX9H 5DQGA 1VQJA 1Z7TA 2MHVA 3QWNA 2G5DA 1SAPA 2NZOA 3N6XA 3UDIA 1PRTF 3U4VA 5LP6F 1ESFA 5KG2A 3H91A 1L2FA 4NXMH 3RTXA 3QR8A 4TV8F 1JE5A 4X64L 1S72A 3S1RB 4A3KG 1T3NA 4LF9Q 1DYQA 2L9HA 4LFBL 4DR6L 3GTMH 3IN5A 2V5AA 1GSAA 5C0XH 1MSGA 3ULJA 3QJYA 2UUCQ 2NU8B 4ZUIA 4A3JB 3K5NA 4BA1I 4IR9A 3GQCA 3A8JE 1I6UA 4RKBA 4WJWA 4EQNA 2L12A 1RTOA 5LL6X 5LYJF 4IUPA 1GOZA 2AUKA 2BE5D 3E0JA 5EZYF 3IKJA 1B50A 4WORA 1JQYD 2A6ED 4DGZA 4PMBA 1W6KA 3E9IA 5LMNL 2E5LH 2F0IA 1MJEA 2EJGC 4I4TF 3J81E 3NSWA 1PH4A 2P0AA 1XNQH 2H4OA 1EY4A 2HIXA 1Q46A 4KD4A 5L9XA 1Q1EA 5C4HA 2VQFQ 4KHPL 2WKDA 4RB3C 2K5NA 3RZDB 2VB2X 2R8GA 4A3GB 1MI2A 3KHHA 2AGQA 5JQWA 3BDOA 3RBDA 3OWFA 5FLXE 2EXZA 2XGPA 1FKAH 3OYYA 2J9GA 4JI7L 4EFBA 1LT6D 5F9LA 4FNFA 3R8BA 1SCUB 4A76A 2N78A 4E4TA 3H0GH 1FNWA 2O5IC 1GLVA 1VMCA 3FMCA 1O78A 2ATWA 4JPBW 2YTXA 2Q8RE 1TKWB 1EWIA 4A3EH 1HR0W 4J9KA 4O1NA 3FPPA 3H4DA 4IPHA 3MWYW 1L0WA 2W9BB 5KT3A 2NU7B 4B3ML 3PW5A 3RAXA 2K04A 2Q8TA 2NVTB 1VQDA 3F2DA 1PX2A 2PNRC 4I7ZC 3N43B 3EYYA 4EEYA 2HUGA 3MWDA 2WACA 4QWBA 2ZXPA 4ILWA 1HNXL 2W6NA 1GHJA 4DK1A 3L3OC 3M9BA 1VAJA 2C00A 4O4IF 1K9MC 4B3MH 4ID6A 4O2DA 2KECA 4QUFA 3BQ1A 2R84A 5DQHA 1QE6A 3T16A 1QVFA 2NVYA 2OCEA 5FD5A 3M7GA 1PYBA 2IW3A 1HNXH 1Q1BA 4ZQ3A 4K6DA 3JRXA 2SOBA 2Q2IA 2Y0SG 4RGTA 3Q2OA 4C5AA 2WDTA 3PW4A 5J39A 2F03A 3GTKB 4YY3H 5DEHA 2YTYA 1RCVD 1LM0A 5C44G 2W57A 4JI6Q 2NTTA 3DXJC 3ZYYX 4HIKA 4TQSA 4L1KA 3TQYA 2K5QA 2R6GA 2RSOA 3PW0A 1H9SA 4DUZH 1Y8NB 3RMHA 4UDUC 1Y69U 1RL2A 4RB0A 2GN5A 3L0OA 2JA5A 1K83A 1HZ9A 4R8IA 5DGBA 4R7RA 4DLKA 2V4QA 3RV4A 3QIAA 1FJGH 3GTJB 4DUYQ 4GOPC 4IZ8A 3RF2A 3V6JA 3F8NA 3C3LA 5JEAH 3S2DH 1EFWA 1UE6A 4Y7NH 2EY5A 3OOCA 1PH6A 4DR4L 1ENAA 4H13C 5GONF 4CC5A 3KHRA 2FKLA 3IFDA 5HGQA 5M3MH 5DM73 4DFAA 5M5XB 4JV1A 4Q8FA 1X3QA 4LFAQ 2F0LA 1NNXA 3VPCA 3QZ8A 4LF9H 5IGGA 3W5OA 1VQCA 1SN8A 4GKKQ 4AYBA 1Q86C 4BY7G 2AUJD 2QGQA 3J7AV 2UUCH 1X56A 4L8JA 5L1JA 1ICFB 3J81i 1TS3A 1O7LA 4J6HA 2CQAA 2VA3A 3M4YA 5T14A 2RKSA 3I4OA 3CKIB 3DWQA 3NBHA 1WD1A 2XIWA 3ND9A 1LO5D 3OSOA 1BO0A 3KALA 2RHQB 4U6PA 2ICIA 4GOPB 2R93G 1B4OA 5COYA 2R7NA 1PH5A 1Q8KA 4B3RL 2ENBA 2W6OA 4DL2A 1K28A 1EY5A 2K52A 5IGEA 4JBWA 1DOMA 1X54A 5FJ8H 2IX1A 3D6WA 4OO1I 4LSXA 2VQFH 2ALYB 1ET9A 4QWCA 4BS9A 5IYCH 3M3YH 2BOSA 3G6JB 4BY7B 2YCHA 4JI2L 1RYRA 3VR5A 4HJ8A 4QMGA 3PO3G 1O7YA 3HOWB 2IHFA 2KCMA 2HQEA 4P71A 1CZGA 1PK8A 1W6JA 5CV4A 4IN3A 1KXLA 2BQUA 1V1PB 4X3SA 3D3RA 1RJTA 4L5QA 1I6HB 4HNVA 5GAHC 2YZNA 2AQ3B 3HOVB 5E4WC 2ATLA 1HFNA 1VQFA 2WB1A 4JI3L 4IRKA 2HIVA 5EKLA 1I4PA 4TRDA 3U9TA 4DV3H 2JA8G 3T51B 2Z6KA 1XNRQ 2ZXRA 1WH2A 3T5KA 3HKZA 2B2VC 3FKIB 1VF5C 1JLLB 1Q81C 2HVQA 1WYDA 2EJFC 4LAAA 2L0CA 3BQ2A 3D4DA 3E9HA 4PMWA 5LMUL 3CP0A 2PZWA 4RCOA 1Z6HA 1TY0A 2E75C 3E6ZX 5IT9c 2KCCA 1CHPD 4MTDA 1S03G 3OTOH 1F2YA 5EPLA 3T1HL 3GTQA 3Q8DA 3SR1A 3TIIA 2R3ZA 1EY9A 1YJWA 2R7ZA 2D2CC 5ELBA 4CDDC 3L4JA 3SHLA 2AWOA 3T5HA 5M3FG 3I4MH 1E1OA 3OHBA 2ASJA 3NWSA 1TWFH 4XTCS 4RGNA 1SFOB 4R1JA 3V05A 2LY7A 5C3WA 1TWCB 4YJ3F 1IXRA 2B8GA 3RB3A 5FD6A 1H95A 4DU9A 4X3TA 5JH7F 3PQIA 5EBDA 3ULLA 3T5JA 1BCPD 2K05A 3HOXG 1YHAA 1VQLA 4KLKA 1VQ6A 5H80A 1FNVA 3V4SA 4LFAH 4O4HF 1N33Q 3PGZA 1YBYA 3S1QB 3OW2A 1SNMA 5CYUA 3SDZA 3OHXC 4GKKH 4C2MA 3MFGA 2NBFA 1AH9A 4DR1L 4JI8L 4DV6L 3PR5B 2AU0A 3S1NB 1ESRA 3EROA 4XDXA 1Z2NX 1TA8A 4F7XA 3KDFB 1CQVA 1WD0A 3OSNA 1I3QA 2JA9A 2X6GA 1GUTA 1VQKA 1EZ6A 1QG7A 3TEHB 1I7NA 1F2MA 1Y1VB 4JV0A 3W1GA 1C4QA 4RA8A 3WO0A 2B2YC 1PZKD 1IKLA 2F0SA 3U50C 1N32Q 4QQBX 2K28A 1YNXA 1S5CD 3H94A 5KT4A 1VQNA 2C28A 2WAQE 3J81c 3W2DA 1BBXC 4EGJA 5DQIA 2ZJRA 5I9OA 1R9TB 1EYZA 1KBLA 2WE6A 3H3VI 1KQSA 3CF5A 1A3VA 1MKHA 2E2JH 4YR3A 1WTHA 1KLUD 1HCZA 2K7VA 1ULZA 3MR6A 4LF8Q 5FLXc 2JK8A 2NVXB 1I50B 1YI2A 1KD1C 3IL8A 3BG3A 2OWOA 3S16H 1HNZL 1S3OA 1SEBD 1NAPA 3VA5A 1JC7A 2R7KA 2C2EA 4OXPA 2DZDA 1EY6A 3Q6SA 3QZ7A 2TSSA 3NELA 2VUMG 1DOLA 2RHSB 3LWUA 1PH1A 4XQQA 1IYVA 2GPSA 5KFUA 4F50A 1HNZH 1LTID 1UE7A 3VYTA 5FPRA 5D8DA 3G6VA 2EY2A 2PW5A 4DNTB 1XNRH 1PFBA 1W3SA 4FXDA 4IFDJ 2FPPB 4DR3L 2DN8A 1KAAA 4XXEA 4YAJB 1XWEA 1XDNA 1TS2A 5FO9B 2NU6B 2W8LA 4ECYA 4EGQA 5KFCA 1JXLA 1KEEA 1D6EC 1VQIA 1TAEA 4C5CA 3TZUA 1S10A 1CZWA 2MJ8A 1TWHA 3RGXA 1QNUA 3TS0A 1N8RC 3KF8B 2PI2E 2J6SA 1N36Q 3J7AK 3V2TA 4DV2Q 2V58A 2D0PA 1KTKA 4R4QA 4J9PA 2UUBQ 3CPFA 2VOBA 5C3XA 3N40P 2BQ3A 4V0BA 1VQ5A 5JVDF 4MN3A 4QB4A 2UXCL 5M5YB 1KHIA 4QL5A 3MEHA 4DNRB 5FOBB 4K0KH 4EBEA 1NY4A 4MA0A 2W7PA 4RU9A 2MP1A 5CV7A 4EGVA 3CD6A 4A2BA 1ZQ7A 4C5BA 1LTAD 2FE3A 2XVSA 1HA6A 3G6XA 5KT7A 4J9MA 2AQ1B 1JWSD 1UUPA 2KHJA 5AFWA 2RDHA 4FS2A 5KG4A 2E2IB 3OIQA 3CCLA 3N8DA 2M2LA 1WCMH 3DEOA 3RUZA 4A93G 2F0NA 4BWSC 1FL0A 3UDFA 3I4NG 4J9LA 4OONA 2ICEC 1K3BC 2I5LX 3BYTB 4FM9A 4NXNL 1XMQQ 4M7EA 3MXUA 3ERSX 5C4XG 1EYDA 2NVYH 1GD7A 2EYOA 1V4YA 3HB9A 3Q22A 4G57A 1G51A 4R8UB 3BVGA 3J81L 2KJXA 4M8AA 4MV8A 5EPKA 3NHHA 1M0TA 4A3CH 2OH2A 1NMFA 3KBXA 3ND8A 3RB6A 4JI4Q 4GKJL 4C3HG 2GA4B 4I7HA 2RSNA 2Y0SA 1VKZA 5IGCA 3ETJA 1N32H 5FLXL 4IPDA 3S1MB 3M4QA 1VQOA 1K83H 3K80C 2JA5H 4B3TQ 3N44B 5CGKA 1STYA 4C56C 1SE8A 2PI2A 2FPGB 4IFDH 5CBAE 3I4NB 3IAYA 2ZT9C 1M1KC 5L1KA 1A62A 1CK1A 2D9UA 2RVLA 3H3VC 1VS0A 5T1IA 5IP7G 4X6AH 3WNZA 5EWGA 3NUCA 5C1OA 1O7IA 5KNBA 4BBRG 2MNAA 3CU7A 4LF8H 2EJMA 2W8KA 2AMCB 5HURA 2MCTA 1OWTA 4Y8VB 4F88A 1HHVA 2Z8LA 2W9CB 4N9PA 3H09A 1GUSA 4DF7A 4F87A 2JA6G 3AMUA 2G9DA 4LFCL 1EUDB 1TWGA 3Q24A 3VR2A 4QW8A 1OXVA 3HOZH 1EUJA 2I8CA 2F0EA 1N34Q 3H4BA 1VQ8A 4Q45A 4IPCA 1WFQA 4LF6L 4MV4A 4Q0YA 1GSOA 5ELOA 3R2TA 1BUVT 2EPBA 2VL6A 3A5UA 1XJVA 5J1ZA 1Y14B 1PTOC 1R4PB 4KHZA 3IRBA 3OSPA 2NN6H 5KGUA 2FXQA 4X66L 2A5HA 5C0XI 3DLLA 2YW2A 4LW1A 2NUAB 3NXWA 1I94L 2XIGA 4RB2C 4A3LG 4MV6A 2QF7A 4ME5A 1KC8C 2VQEL 1I5FA 4GN3B 2JA6B 4EFEA 4I65A 4X65Q 1JX4A 4LSAA 1EHIA 4OWTB 2F4VL 2KVMA 2J0TD 1BDOA 5D3IB 1HUNA 1HNWL 1SJHD 2R93A 3GTGB 1N36H 1JDEA 2WFWA 4KV6A 1A3UA 2V1CC 4JBJA 4P74A 3CC7A 5JUMA 1GXDC 3I70A 4P2CB 3F8TA 4H7BA 4DV2H 1SDFA 2PQAB 4BXXH 1IBLQ 5FKAC 2UUBH 4YCWA 5CV8A 2KUMA 3QB3A 4QCLA 3RLNA 2FINB 3I72A 1IYUA 1PLFA 3J7YW 2UUAL 2XGQA 4DL6A 1GYFA 1UNSA 2BDOA 3I91A 1PFNA 4PG3A 4ZOLF 3K5OA 3L7ZC 3KK7A 1B1ZA 1PTOB 2NZHA 1JB7A 4XYMB 1HR0L 1OXTA 4BY1H 4V190 2DIKA 4RNMA 5KFIA 2CFMA 4XT3B 4DR7Q 1BCPF 1YEZA 3PO2B 2CW7A 3NENA 3SEBA 2UUAH 2WIIB 4CC6A 1ZHSA 2XCAA 4IOAA 3PZPA 1JWMD 2LXKA 1S0MA 3D6CA 2VXWA 3J80E 2BDNA 4FXKC 3BA8A 4DL5A 4JI5Q 4X62L 1TWAB 3K6OA 4BBSB 2A68C 2KQ3A 2ZM6L 5BMVF 4A3FB 4JOIC 5KFZA 4JV5L 3MXNA 1KJJA 1II3A 4ZKCB 4DL7A 5AJ3L 4LUOA 4LF4Q 3GTPA 2NTSA 2B2UC 3BQ0A 1BF4A 4DV1Q 5FLMH 3AEVA 4KMUC 1HZCA 4JI4H 3HOYB 4DR2L 3EVQA 3T5LA 5KRUA 2B2WC 2I5MX 3GTQH 4APMA 3V6HA 2YU9A 4A3IG 3TIGA 2KEEA 2PMZE 4LUZA 4DV7Q 2DLNA 3NP8A 2R7ZH 2B63B 1PH8A 5EQ0A 3AFPA 1SLJA 4B3TH 5JPNC 3NTIA 2DWCA 3GILA 1UNNC 2JSOA 4TUYF 4NW2A 2W70A 4YB8B 3GIJA 1X9NA 5A2QW 2O2LD 2B39A 2A69C 5KFSA 3CRLC 5ELEA 2B2TC 5JJLA 4DNIA 5IWAL 1IBKQ 3PUYA 3RZOH 3OUZA 3IG0A 4N8X1 5D65A 4KKSA 1Q82C 1W96A 1G8ZD 1LUZA 3HBLA 1BXRA 4A3IB 4OX9L 2AQ2B 4C2MH 1N34H 4EQPA 2F0HA 4ZQIA 4IUVA 4A3JG 2XRQD 4WRDA 1K8AC 4L5SA 4NXML 2I87A 1EY8A 4UFZA 2CHBD 3P1HA 1I3QH 5KFNA 3J7A5 4ECQA 5GAGC 5IYDH 4ED0A 1MHWC 4JI1Q 3BG5A 3ORQA 4I50F 1N48A 1JB3A 2ZXOA 2W71A 4F8MA 2E2HB 2UVVA 1J9OA 2JA7B 2J6UA 4A3DB 1Y1WA 3UQ8A 1B2TA 4EQOA 3P75A 3S1RH 2A6HD 1V1QA 5D1OA 4X65H 3S15B 5IIFA 3OPOA 4XQNA 1YJNA 5E4XA 2RBMA 1VBGA 3CMEA 4A3BH 4A3GG 1E4GT 3S2HB 2PMZA 4C3IH 3NTKA 1TU2B 2IL8A 2YYZA 3IFTA 2E5LL 4PNYA 1IBLH 5BR8Q 2K14A 4UCVA 2KENA 3RN2A 2F0UA 1KLGD 4IUNA 2FMCA 2SNSA 4HR7B 5JPMC 1XNQL 1JJGA 5C5MA 1PTOD 2V59A 1U0LA 3J80i 4NDXA 5A2QE 4DR4Q 3C0FB 2F3WA 2F0QA 3BU2A 4QWDA 3GTMB 1QZHA 4XQJA 1ML0D 4IHJF 2IY5B 2CW0C 2KSWA 4DR7H 3MWEA 5F9NA 5KFMA 3VMMA 4ME6A 4A3KH 3N52A 1HH2P 3ER0A 1VQ9A 1EQRA 4HR7A 4JI5H 5M9OA 2N88A 3KFUA 3A8KE 2VUMA 4A3EG 4RUAA 1XXGA 3FHWA 2CZGA 1IZ6A 1YHBA 3UDXA 2R8IA 3NPPA 3PW7A 2JN4A 1Q12A 1XPOA 2K1BA 4P72A 1VDZA 5KFVA 2AGOA 3WOFA 4LF4H 3MFIA 1TWHH 3R93A 1ZYRC 4DV1H 2VY3A 2MO1A 4K2KA 1EUCB 3OMCA 4AYBE 2OXPA 1S5FD 3F2UA 4Y52H 3I90A 4DV7H 1ET6A 2UVWA 1WCMA 3NGDA 3S14H 4O2BF 1QCBD 4J15A 2QA4A 3QFFA 3H0GB 3V4ZA 1H9KA 3GV6A 3QO2A 1U4RA 4YY3L 3I4LA 4GN5A 3EQLC 4KI0A 4A3EB 4F4YA 2A68D 3K57A 3S17H 2HQLA 5BN4A 1U5KA 3HXLA 3SXHA 4DUZL 1AE3A 1BCPC 1IKMA 3NQIA 3EBEA 5EDWA 2BQRA 3EA6A 3B6YA 4CJ2C 4J9SA 3CRKC 1IBKH 1EIHA 4FBTA 3CQZA 4XYLB 2WAQB 1FJGL 1CQFA 1JT8A 1K0RA 3MR2A 1SE2A 4IPGA 4RFBA 2UVRA 4O3NA 4ED6A 2Z9HA 1GGOA 1CQJB 5HBRB 3WDNA 4Q5VA 2PYKA 3I7FA 2ZTDA 3AYHB 1U4MA 5GQOA 4C1NI 5I47A 1DGSA 2EXDA 5JEAG 4JV2A 4UCTA 2ID0A 3VYRA 1G6PA 5KFJA 1Z2PX 1X65A 1AZPA 1RKNA 3URYA 1B3QA 1SMYC 3K0XA 2R8JA 3HS0C 4A4IA 5E3FA 4ED2A 2I07B 4JI1H 3E3XA 4LF9L 2CKZB 2A69D 3KF6B 1GUOA 2EYPA 4JYAQ 5LA6F 3CCVA 3SK8A 3PIOA 1LT5D 3KBGA 1JDBB 3K8AA 1XMOQ 1TR5A 2WB1E 5C44H 2UUCL 5L1IA 1KRSA 3UFXB 4IWXA 1BCPB 4G4KA 1LTGD 1HZBA 1UAPA 2Q2UA 3U58A 4DN4M 1BKBA 1KNAA 5EGTA 4JVZA 3HKZE 1UC8A 2FP4B 1EYAA 5K36G 1DZ1A 2DJFC 3S2DB 4WBNF 4Y7NB 4YBZB 3VPDA 3HOWG 4DV5Q 1I4HA 5BR8H 1F2ZA 1SJED 3GTLA 2KCTA 2FMAA 4ED3A 3G6YA 2A19A 2VQFL 1TWGH 4GLXA 2EZVA 1KJ8A 3MR5A 3MXPA 1E4EA 1ZHQA 1CI3M 4FO2A 2WTFA 4EBCA 4ED7A 3HOVG 3J7AF 4DV0Q 1C0AA 4GNXC 1S40A 1N56A 3PIP3 4ECVA 5CA1F 3PF5A 5HGTA 4G7HC 2AWNA 5ELDA 4POGA 1A0IA 5C4JH 1DXMA 1ENFA 3FKIG 3NQTA 3JAMW 3GTOA 1GJXA 3J80c 2EVBA 4K2LA 3RB4A 3U9SA 1XX8A 1QUQB 1U9RA 3N42B 4DV4Q 2YS6A 4ED1A 1DJRD 1JWUD 4BA2I 4RNOA 1KNEA 4JBMA 3PUWA 3BAAA 4KK7A 2AQ4A 1MGSA 3C1FA 3BDLA 3DM3A 2QW7A 4RCNA 2NU9B 2E74C 4DV3L 2R93H 1LV9A 3M3YB 2R87A 3CCSA 4B08A 4IR1A 1SRUA 2HHHQ 1DIKA 1RHPA 3R2IA 2MPMA 1XTCD 2CW0D 1GM5A 1NBWA 1JOOA 2R92A 3MFHA 4EYHB 1YNJC 5M5WH 1HFGA 3GIDA 1SBBB 1GKHA 1KL9A 3A7AB 4UP7A 5CMDA 4GNXB 4DKAC 1ZKOA 1B33N 1UEAB 4LUVA 5KT2A 1J5EQ 1S0OA 1CKNB 3I12A 1B70B 3PO3H 1EIGA 3OTOL 4MHEA 5DAUA 1C30A 1G2SA 1EU3A 2K4KA 4QF4A 3OHAA 1EZ8A 1KDCA 4HCEA 2GLTA 4JI6H 1ZYRD 4QIWB 5NUCA 3I4MG 1HUMA 1FYCA 2NB0A 3FP9A 5J22A 4TSSA 2CCZA 4G7OC 2ALZA 1CKMA 5CR3A 4GC6A 4N9TA 1FR3A 4IUUA 1LYLA 1Q3LA 4K5WA 3CCQA 5K2MA 5KX5F 1JICA 4EX5A 4HQ6A 5KYIA 3G71A 4FXGC 4DAPA 2W7OA 2JA8H 3GTPH 4DUYH 1SFOH 1QNKA 5T1GA 3JC66 4C1NK 2AHOB 4DR3Q 4ABNA 4LF7Q 4I55F 1RF2D 2R7FA 4LFAL 3JAME 1Y1VG 1AEXA 3OWEB 4OHJA 1XPUA 4U673 1M90C 3RFCA 4GKKL 3LX0A 2YU9H 3H20A 3K3PA 4R4OA 4ZCKA 1AN8A 4JYAH 4OWXB 4KY6A 1Y8PB 4HSVA 1XMOH 2ZTCA 3C1EA 5ELCA 4RHRA 3SGIA 2K32A 4DXFA 3I4MB 2PVPA 4O4LF 1EL0A 1TWFB 2UXBQ 1CE8A 2CWAA 2PPBC 1L1OA 2XSCA 1NCVA 1ASYA 5IYBH 1LTRD 4KJNA 2K5DA 5M3FH 3BABA 2IHEA 1SYEA 4DV5H 3NE5B 3S1NH 2CW8A 3EPIA 1FGBD 2M00A 2UXCQ 4IFDI 1H9RA 1PH7A 1PTOF 3SE7A 1QWYA 2JXMB 1SMYD 5LHY1 2R7MA 3OW7A 4J8QA 5E1FA 5KFXA 3J80L 4NPSA 1L0YB 4NLGA 4FYDA 3JRWA 3K5IA 4RHSA 4DV0H 3HOXH 3WO1A 1QVGA 3KHGA 1X32A 1IYJB 2I46A 2Q2HA 2JE6I 5KG5A 4KHVA 2FHTA 3TREA 3CCUA 3QOLA 4CKEA 1W2BA 4OO1G 2LKVA 3N41B 2SCUB 4PMCA 1NSNS 1P16A 5JVG3 2BA1A 2WKCA 5GADC 4DAVA 4L5TA 3ICEA 4J0MA 1Y1WH 3A54A 4JI0Q 3RLFA 1KJQA 2NN6I 1PFSA 1E2ZA 1EY7A 2YRWA 4PZ7A 4YQWA 1IL2A 4UP9A 2ZDHA 4LF5Q 3CHBD 3S24A 1XNRL 4DAYB 5EAYA 5IY0A 4L6TB 1HRJA 2HHHH 2E2JB 1BBWA 4RAUC 4AQYQ 5KG7A 4YWKA 5JVLA 2H5XA 5BN3A 4HSPA 4QJFA 5IT9L 2X69A 2VB3X 3E5NA 2IMWP 3S16B 2PBZA 2ZDQA 4ZK9B 3VR4A 1R4QB 2B29A 1LACA 2XRSD 4C3JH 1XPRA 1RJQA 1J5EH 4H02A 1A63A 1T5XD 4O2AF 2XN9C 2Y0SE 2YL2A 3BA9A 1T94A 2PMZB 3BZDB 4NP5A 3Q8SB 2H1EA 4ZI7F 1NE3A 5I9PA 2V4DA 3G48A 3MEFA 4HJ5A 3T1YQ 2F0JA 3CW2C 2W9BA 4M9UA 2LS01 4WD3A 5KFRA 1TVXA 1MJCA 3JAMi 1FGUA 2SNMA 4H0LC 4YAKB 4K0KL 2VUMH 2VA2A 4IAJA 2NYZD 4GLAC 3AB9A 1BBUA 2F4IA 4LMQD 3SK5A 4F4ZA 1SYBA 2K50A 3MR3A 1YNJD 1CA6A 4LF7H 1IBMQ 4BWGB 1GUNA 1N33L 2V9WA 3GIIA 2PO4A 3EJIA 3L9AX 4JCVE 5C3EH 2UXDQ 3GTKA 3DWAA 3GIMA 3D31A 1B6SA 4HIOA 2R7DA 4B3SQ 5LXTF 1N33H 1QILA 1C48A 1EIFA 4LMYA 5C5LA 1Y8OB 2RQXA 2UXBH 3CXCA 5KKNB 4TQUS 1PXUA 5A2QL 3Q8QB 4OEMB 4APVA 3RV3A 5KG6A 2BA0A 3PW2A 3GTJA 1ILQA 1Z9FA 2UU9Q 4KN4C 5EKIA 1N32L 2L1BA 4FF4A 3SI8A 1VF7A 4JC0A 4AH6A 1B3AA 3A8IE 3BYYB 4RMFA 3UI2A 3CQZH 4IO9A 1MD2D 1WCMB 1M8AA 4XYQA 1KJIA 4DL3A 2HDLA 4P73A 3LMLA 5BN5A 4HIDA 5KFKA 2FLNA 4MZ9A 4JBKA 2NVYB 1PDQA 1SNCA 2Z1CA 2PZUA 4A93H 4LF8L 2B3GA 2CQYA 1G291 3BVMA 1ZETA 3KOJA 4HJ9A 2FK1A 4O42A 1E22A 4FDBA 5E7NA 4RGMA 5EKKA 2BH2A 1K1SA 1B9NA 3R23A 1IOWA 1ONLA 5C4XH 1QZGA 2W6QA 1FVIA 2AGPA 2DGYA 1JIHA 3RR5A 4UCUA 1EQVA 4HEDA 1HJPA 1H9SB 4XT1B 1F2LA 1I6VC 2A6HC 2JA5B 1K83B 4LJZC 2F0VA 5DLGA 4JI0H 2OT2A 5HV6A 4IUQA 2VPSA 2L55A 4QY7A 4C3HH 4GOPA 5F2DA 2DPJA 2PN1A 2NVQH 4MTNA 1ICWA 4HNUA 4DR5Q 3C46A 4YHHQ 4MV7A 1STNA 3KYHC 4OIKA 2PNHA 3GTLH 1QVCA 2OF1A 4Z9CB 2K5HA 3T56B 2ZDGA 2I0QA 5KIXA 4ME3A 5FO7B 5IP7H 1QB5D 3H15A 4BBRH 1N36L 4CJ0B 3HOZB 4MNOA 3A5ZB 4AYBB 3DM1A 3PO2G 2K6AA 3HOUH 4IJHA 4DV2L 1V1PA 2Q2TA 1HPCA 2M9VA 4YWLA 1ZXTA 2F1MA 2UUBL 3T1YH 4TV9F 1CSPA 1H9JA 1K3RA 3RUPA 1C3OA 4N8FA 2VS1A 2X0SA 4BBSG 1VMPA 3GTOH 3NBHB 3K81C 5EOYA 3NK9A 4A3FG 4MTEA 4KKTA 2R82A 4L5RC 2R85A 2M05A 3STBC 1SROA 1HQRD 2GPWA 4NXMQ 4BY1G 3KTMA 3K7AH 1XYIA 2VQDA 5BPFA 3CCRA 2F3IA 3FKIA 4K6LA 2WB1G 2Z6KC 3K3VA 3AFQA 1STGA 2OQ0A 1VQEA 5CV5A 1IBMH 3HOYG 1SEIA 1WTWA 3JSNA 1SYXB 3TQTA 4HNTA 2BR0A 1SMXA 4A3LH 1RYSA 1VQGA 2L4NA 5HY6A 3JAMc 1A2TA 1EY0A 4X64Q 3H6MA 2Z6BA 3MXGA 1XMQL 2LMCB 2B63G 4FS1A 2UXDH 1STHA 1SYCA 4IOCA 3K59A 4LFBQ 3M85A 4QW9A 1AP0A 2R92H 4B3SH 3X3NA 4DR6Q 4ECZA 1GUGA 4KY5A 1BNCA 5FLMG 1XMQH 2YV5A 4UCRA 2DUDA 3A55A 4JI4L 2RDIA 5J3BA 3TMEA 3G6EA 4BY1B 2CVRA 2RA4A 3T4AC 1SFOA 3R5FA 3S9WA 2B8FA 4OIJA 1XNQQ 2UU9H 3TRZA 5LL6b 1EU4A 4HJ7A 1VQBA 2WB1B 1TWCA 1HTLD 1S9FA 3HZXA 4B3TL 4KTAA 5LMNQ 1VQHA 3MAQA 3DHQA 5DLQE 5IGBA 2B2VA 4QUCA 3HKZB 5GAEC 1V1OA 2YTVA 2AKWB 2RDJA 1E24A 1LT4D 2N3SA 1W93A 4KHPQ 4ALPA 2EYFA 3F2CA 5IP9G 1CT1D 5C0XJ 4PV1C 3NWTA 1MIUA 1M7JA 4A3MH 4PZ6A 2XD4A 4JI7Q 4QWAA 1B04A 4ECRA 3G7LA 3TDQA 2N8NA 3K5MA 2QEJC 3GTQB 2W6PA 1E4FT 1I4RA 3J7ZC 3HEJA 1GHKA 2JA7G 3KDFA 4NMZA 1WTVA 2R7ZB 4A3DG 1N34L 4ECXA 4FF3A 1MBYA 4F4WA 2QCPX 2P5ZX 2R7LA 3RD4A 4HYKA 1A8VA 3FEWX 1WTPA 1Y1VA 1U4LA 3KLSX 2K5VA 4B3MQ 3M4OB 3RIZA 4RGOS 1D5ZC 1K8GA 1D8LA 2KBNA 3GLKA 1EZ1A 3FDTA 2JEBI 5IYDG 1S68A 4DR5H 4EEQA 4YHHH 1WTXA 1HNXQ 5KFOA 4TKOB 1RK5A 1E3PA 1ZEQX 3TBIB 3VYUA 4ZAIA 2IT1A 2OLSA 3WOEA 3TP7A 3I3CA 4E6IA 3RZOB 4G7ZC 3PSIA 1R9TA 4HCSA 1S5ED 4X65L 3W1BA 3GQBA 3M9OB 5FLXW 2NVXA 5DG9A 2D5DA 1B9MA 1I50A 3MZ5A 5JJZA 3K7UC 5KG1A 3D4RA 4XYOA 5C0XG 3I73A 4C2MB 1CM9A 1K1QA 1AZQA 1IBLL 3AU7A 2F0OA 1BR9A 4JK1C 2DNCA 1RD9D 2F52A 4HTHA 2OTJA 2KCNA 3RBEA 1I3QB 3WWVA 4IURA 1AUXA 2C9OA 3D4WA 3GD7A 3CMAA 1BVSA 1EWCA 1JMCA 2TMPA 3JAML 2B2YA 4A3JH 3ONAB 4JUZA 3W3AA 3R5XA 1JE4A 1I4GA 2JEAI 1V9PA 4K8JA 2VR1A 4DR7L 1BXTA 2KHSA 1SYGA 1IW7C 2R8HA 3RJ0A 1FD7D 3BZCA 5KFEA 1SR3A 5KFLA 1DM0B 4A3BB 2MGSA 3Q8PB 4JI5L 3LGJA 4EQ5A 4HN7A 4C3IB 1TT2A 3VR3A 2UVUA 4X64H 1BGWA 1S5BD 1A2UA 2DY8A 2RCFA 4RAZA 1V51A 3FMAA 3RZDH 4LFBH 3KF8A 2LFNA 3H0GG 5I2XA 3RLOA 4DR6H 4LF4L 4A3GH 4DV1L 2RGRA 3X3MA 1WTQA 1VCIA 4Q0FA 3RN5A 4RH6A 1M0WA 4ECTA 5JEAJ 3STBD 4DL4A 1LTBD 2PCFB 4DV7L 2JEIA 4TQRA 2YZGA 1YZ6A
chains in the Genus database with same CATH topology
4A75A 5M5WH 3HFZB 1EQQA 4LNQA 1GKHA 1KL9A 2UU9L 1E1TA 2WAQG 4UP7A 4DKAC 4GNXB 1TWAH 3TS0A 4LUVA 1N8RC 3KF8B 2PI2E 4BBSH 1N36Q 1J5EQ 4B3RQ 4A3FH 1CKNB 1EYGA 2E5LQ 1B70B 3PO3H 3OTOL 1YITA 4DV2Q 2NVTH 2D0PA 1YVCA 4R4QA 2MFIA 2UUBQ 3CPFA 2K4KA 5GROA 2UUAQ 4YCUA 2R7ZG 1PVOA 2EIFA 1VQ5A 1JJCB 4OWWB 2UXCL 1JJ2A 4JI2Q 1KHIA 4QL5A 1IBKL 3I4MG 3HOYH 3FP9A 2CCZA 1NY4A 3CC2A 4A3MG 1CKMA 2OQKA 3CD6A 4WJ4A 3CCQA 1LYLA 2B63H 3ZJYC 4P75A 1CKOA 3AQQA 4EX5A 3GTKH 2KHJA 3G71A 3KJPA 1V43A 3CCLA 2JA8H 3GTPH 1WCMH 4TVAB 1SFOH 4A93G 1B8AA 3JC66 4DV3Q 1FL0A 2AHOB 3BJUA 3UDFA 4DR3Q 4LF7Q 4OONA 3PUXA 3I4NG 2R7FA 4LFAL 2I5LX 2JJQA 1Y1VG 4NXNL 1XMQQ 1B7YB 1L1OC 4UPAA 3ERSX 4JI3Q 2GVBA 2RF4A 2NVYH 1GD7A 1Z47A 1M90C 1XPUA 4GKKL 5C4XG 2YU9H 2EQSA 4JI1L 4R4OA 4OWXB 4DR5L 1G51A 5M3MG 3J81j 4YHHL 3GTJH 3HOVH 2ZTCA 3SGIA 3PV0A 1OTCA 5JJIA 1KRTA 4GS3A 3M4OH 4A3CH 1NMFA 4JI4Q 3KLWA 3OTOQ 4A3IH 4GKJL 2UXBQ 4IJLA 4HJAA 1UE5A 2CWAA 1L1OA 5LMUQ 4WJ3M 1HZAA 1ASYA 5IYBH 3F2BA 4IPDA 5M5XH 5IP9H 5M3FH 1EIYB 2IHEA 3M4QA 1VQOA 1K83H 3K80C 2JA5H 4B3TQ 3S1NH 2UXCQ 4YY3Q 4QGUA 4IFDI 4DK6C 1PH7A 4GN4B 1X3FA 1SE8A 5BR8L 2PI2A 1UEBA 2CWPA 3T1HQ 3ULPA 4LWCA 1TXYA 1M1KC 1P8LA 1K73C 3CC4A 1A62A 3CPWA 1T9HA 1YJ9A 4DUZQ 1OXUA 4A3BG 4NPSA 2E2HH 1C9OA 1VS0A 5IP7G 4X6AH 2JA7H 1O7IA 4A3DH 4BBRG 2MNAA 1L1OB 4POFA 3HOXH 2XGTA 1QVGA 2AMCB 2A1AA 1FJGQ 2RCNA 3S15H 1IYJB 3F1ZA 1N9WA 2Q2HA 2JA6G 1XTDA 3PF4A 2JE6I 4YCVA 3TREA 2Z0SA 5FJ8G 4LFCL 3S2HH 3CCUA 1W2BA 1OXVA 4OO1G 1VQJA 5IYCG 2MO0A 3HOZH 1EUJA 2NZOA 1N34Q 3UDIA 1VQ8A 4IPCA 1P16A 1WFQA 3U4VA 2BA1A 1L2FA 5GADC 4R4TA 1YHQA 4LF6L 4L5TA 3ICEA 5ELOA 1Y1WH 4JI0Q 2HT1A 1JE5A 3RLFA 4X64L 1S72A 2VL6A 2NN6I 3A5UA 1PFSA 4A3KG 1XJVA 1Y14B 4KHZA 3IRBA 4PZ7A 4LF9Q 4BY7H 4LFBL 1IL2A 4UP9A 2FXQA 2PQAA 4LF5Q 4X66L 3DLLA 3S24A 5C0XI 4DR1Q 3GTMH 4DR6L 4JI8Q 4DV6Q 1XNRL 4DAYB 4LW1A 5EAYA 5IY0A 3HOWH 1I94L 3ULJA 1D7QA 1BBWA 2UUCQ 4A3LG 4AQYQ 1X3GA 1KC8C 2VQEL 4YWKA 1I5FA 4BA1I 2H5XA 4GN3B 4R4IA 4QJFA 4X65Q 3M7NA 4OWTB 1I6HH 2F4VL 1HNWL 2WFWA 2B29A 1VQAA 2V1CC 4JBJA 4P74A 4C3JH 3E9IA 4H02A 3CC7A 5LMNL 1XPRA 1A63A 3F8TA 1MJEA 2Y0SE 2PQAB 3H3VI 4BXXH 1IBLQ 1ASZA 4YCWA 1PH4A 2I5HA 2HIXA 3RLNA 1NE3A 1Q46A 3G48A 3MEFA 4HJ5A 1Q1EA 2LSSA 2VQFQ 3T1YQ 2UUAL 4KHPL 2K5NA 3CW2C 3FKIH 1N33Q 4PG3A 5LMNW 4JI6L 3L7ZC 1MJCA 4DPGA 1FGUA 2NZHA 3JAMi 1JB7A 1C7YA 4K0KL 2VUMH 1HR0L 3OYYA 1OXTA 1EOVA 4BY1H 4JI7L 2CFMA 4DR7Q 1YEZA 3NENA 4GLAC 4A76A 2N78A 1BBUA 1HNZQ 3H0GH 4IOAA 2LXKA 2K50A 3PCOB 3D0FA 2ATWA 1KAWA 2YTXA 4A3EH 4DUYL 1EWIA 1IBMQ 1HR0W 4JI5Q 4X62L 4IPHA 2ASBA 1N33L 1L0WA 2ZM6L 4B3ML 4JCVE 4JOIC 4JV5L 5C3EH 2UXDQ 3I2ZA 1VQDA 4NB3A 3F2DA 1NJIC 3D31A 4LUOA 5AJ3L 4LF4Q 4HIOA 2R7DA 1HNXL 4B3SQ 4JYAL 4DV1Q 3M9BA 5FLMH 1TWCH 1K9MC 1EIFA 1XMOL 1YIJA 4O2DA 3AEVA 1HZCA 3CXCA 4DR2L 1QVFA 4TQUS 2OCEA 2I5MX 3GTQH 1PYBA 4A3IG 2PMZE 4JOIA 4LUZA 4DV7Q 1Q1BA 4APVA 2R7ZH 2BA0A 2Q2IA 2Y0SG 3I55A 1Z9FA 1PH8A 3AFPA 2UU9Q 5IYBG 1SLJA 1N32L 4JC0A 2YTYA 3MXNB 3U4ZA 4AH6A 3E0EA 1LM0A 4DV5L 5C44G 4RMFA 1PH2A 3S1QH 3CQZH 4IO9A 4JI6Q 3PUVA 2IX0A 4HIKA 3UDGA 1X9NA 4K0KQ 3TQYA 2R6GA 4P73A 4PZ8A 1NTGA 1RL2A 4HIDA 2GN5A 3L0OA 4MZ9A 4JBKA 5JJLA 1HZ9A 4DNIA 5IWAL 1IBKQ 3PUYA 3RZOH 4A93H 4LF8L 2B3GA 4DV0L 1G291 4DUYQ 3KOJA 4HJ9A 5ELNA 3CCEA 1E22A 4GOPC 4FDBA 1Q82C 4DAMA 1Y1VH 5E7NA 1VQMA 1CSQA 1LUZA 2BH2A 3RNUA 3S2DH 1EFWA 5C4XH 1QZGA 1UE6A 4Y7NH 4UY8C 1WJJA 1PH6A 1FVIA 4OX9L 2DGYA 4DR4L 4XIGS 4C2MH 1X55A 3RR5A 5JJKA 1HJPA 5HGQA 5M3MH 4A3JG 1K8AC 4L5SA 4NXML 4LFAQ 2A8VA 4NXNQ 4QY7A 1RIPA 4DV4L 1I3QH 4C3HH 4GOPA 1Y1WG 1R9TH 1X6OA 3W5OA 5GAGC 3J7A5 5IYDH 1VQCA 1SN8A 4GKKQ 2NVQH 4JI1Q 1Q86C 1LTLA 4MTNA 2ZJPA 4BY7G 2QGQA 4DR5Q 3BZKA 4YHHQ 2NVXH 1I50H 3TS2A 1X56A 2QEXA 3J81i 3KYHC 1OXXK 2HHHL 2ES2A 2PNHA 3GTLH 3S1RH 4GKJQ 1QVCA 1V1QA 3A74A 1PHJA 3I4OA 2K5HA 1YJNA 4HIMA 3CMEA 2I0QA 1KIXA 4A3BH 4A3GG 2RHQB 4ME3A 5IP7H 4C3IH 1UE1A 4GOPB 3H15A 2R93G 4BBRH 1N36L 1PH5A 1Q8KA 2E8GA 3A5ZB 2YYZA 4MNOA 1J5EL 4B3RL 4R4CA 2E5LL 2K52A 5BR8Q 3PO2G 3HOUH 4IJHA 2K14A 4DV2L 1GO3E 2KENA 2Q2TA 2D62A 4JBWA 4YWLA 3RN2A 2UUBL 1X54A 5FJ8H 2IX1A 3CAMA 4OO1I 3KJOA 1XNQL 2VNUD 1JJGA 2ALYB 1CSPA 1K3RA 4GLVB 1U0LA 5IYCH 3M3YH 3J80i 2VS1A 4DR4Q 4JI2L 4BBSG 3GTOH 4HJ8A 3NBHB 3BU2A 3K81C 4A3FG 1QZHA 3PO3G 4L5RC 2IY5B 3GO5A 3STBC 1SROA 2IHFA 2VZAA 4BY1G 4NXMQ 3K7AH 2KCMA 4A3KH 1VQ4A 4LFCQ 4P71A 3CCRA 2F3IA 1KXLA 2WB1G 2Z6KC 1HH2P 3AFQA 2OQ0A 3ER0A 4L5QA 1EQRA 1VQEA 1VQ9A 3HOYG 3KFUA 5GAHC 4LF7L 4A3EG 4LF6Q 3PUZA 1SMXA 4A3LH 3FHWA 1OXSC 1VQGA 1IZ6A 1YHBA 3EIVA 5HY6A 3UDXA 3JAMc 4X64Q 2B63G 3A0JA 1XMQL 2MQHA 1VQFA 1Q12A 3GDEA 4JI3L 1XPOA 4P72A 5C3EG 4IOCA 5M5YH 2HIVA 3M85A 3UE0A 4LFBQ 1Q7YC 3NEMA 2R92H 1TWHH 4DR6Q 4X66Q 2JA8G 2VY3A 1WCMG 2Z6KA 1XNRQ 2XTIA 2KHIA 2MO1A 1I94Q 5FLMG 5H1SE 2YV5A 4AYBE 2DUDA 2VQEQ 4JI4L 1Q81C 2UXBL 5J3BA 4Y52H 1WYDA 3G6EA 3E9HA 4PMWA 5LMUL 2E2IH 1XNQQ 3CP0A 2F4VQ 3S14H 3TRZA 2QA4A 4J15A 1HNWQ 4HJ7A 2L15A 1VQBA 5IT9c 4B3TL 4YY3L 4GN5A 5LMNQ 1VQHA 5DLQE 4A3CG 4KI0A 3T1HL 3Q8DA 1YJWA 2HQLA 3S17H 5GAEC 2YTVA 1U5KA 2AKWB 1PH9A 1E24A 2N3SA 4DUZL 4KHPQ 4ALPA 1AE3A 2AWOA 4UP8A 2C35B 3EBEA 5M3FG 3F2CA 5IP9G 1CUKA 3B6YA 5C0XJ 1E1OA 2CQOA 3I4MH 2JA5G 1MIUA 1TWFH 4XTCS 4A3MH 4R1JA 1FJGL 1JT8A 1K0RA 4PZ6A 4IFDG 1PYSB 4IPGA 1HR0Q 4JI7Q 3KF6A 1IXRA 1H95A 3I7FA 2ZTDA 3AYHB 3S1MH 5GQOA 2N8NA 1DGSA 2EXDA 5JEAG 3J7ZC 2ID0A 3ULLA 2JA7G 3KDFA 2VW9A 4A3DG 1VQ7A 1G6PA 1N34L 1X65A 3HOXG 1VQ6A 1YHAA 1VQLA 4KLKA 3I4NH 4X62Q 4DK3C 1A8VA 1J6QA 1YBYA 3K0XA 1UWVA 3PGZA 2N49A 2ZM6Q 2K5VA 4B3MQ 2ZJQA 3OW2A 4JI0L 4A4IA 4JV5Q 1VQPA 1K8GA 1D8LA 2KBNA 4LF9L 3G4SA 2CKZB 2JEBI 5IYDG 3HOZG 5AJ3Q 3KF6B 4AYBG 2WP8J 4LF5L 4DR1L 1AH9A 1HNXQ 4JYAQ 4JI8L 3CCVA 3PIOA 4DV6L 1E3PA 1E7ZA 3K8AA 1XMOQ 2WB1E 5C44H 2UUCL 3L2PA 1KRSA 2IT1A 3KDFB 4AQYL 4QIWE 3UE1A 3PSIA 2JA9A 4DR2Q 1HZBA 2OTLA 1GVPA 2Q2UA 3U58A 4X65L 3M4PA 1VQKA 3TEHB 1BKBA 2NN6G 3W1BA 3HKZE 3HKSA 3W1GA 5K36G 2ZTEA 1N32Q 3K7UC 3U50C 4QQBX 2GVAA 5C0XG 3HOWG 4DV5Q 1YNXA 2JQOA 2KCTA 1VQNA 1IBLL 2WAQE 3J81c 3HOUG 2F52A 2A19A 3CCJA 2OTJA 2VQFL 1TWGH 2ZJRA 4GLXA 4O0AA 3WWVA 1QUQA 3T1YL 1PH3A 3GD7A 4AIMA 1BVSA 3CMAA 3CF5A 1MKHA 5IWAQ 3CCMA 1KQSA 1JMCA 2E2JH 3HOVG 3H3VH 4A3JH 1PA6A 4LF8Q 3EN2A 2JK8A 5FLXc 4DV0Q 1C0AA 1NMGA 3PIPA 3I56A 1V9PA 1WI5A 4GNXC 4YWMA 1YI2A 2JA6H 2JEAI 4BXXG 1S40A 1KD1C 4DR7L 2OWOA 3S16H 3PF5A 1HNZL 3GTGH 2AWNA 4POGA 1S3OA 1A0IA 5C4JH 4OX9Q 3BZCA 3FKIG 1SR3A 1X3EA 1WOCA 4OXPA 3J80c 1IBML 4JI5L 3LGJA 4EQ5A 1QUQB 3NELA 2VUMG 2RHSB 1PH1A 2BH8A 4DV4Q 4GNXA 1UE7A 2UXDL 3RZDH 3H0GG 4BA2I 3RLOA 4JBMA 3PUWA 1CKNA 2K75A 5IE8A 4LF4L 4A3GH 3DM3A 4B3SL 1W3SA 2R92G 4IFDJ 4DV3L 2R93H 4DV1L 4DR3L 4JG2A 1VCIA 3RN5A 3HKZG 3CCSA 3VDYA 1PV4A 1SRUA 2HHHQ 3PO2H 1AE2A 5JEAJ 1GM5A 3STBD 1VQIA 1NBWA 2LXJA 4DV7L 4RG1A 1YZ6A 2D0OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4A75 A;  5M5W H;  3HFZ B;  1EQQ A;  4LNQ A;  1GKH A;  1KL9 A;  2UU9 L;  1E1T A;  2WAQ G;  4UP7 A;  4DKA C;  4GNX B;  1TWA H;  3TS0 A;  4LUV A;  1N8R C;  3KF8 B;  2PI2 E;  4BBS H;  1N36 Q;  1J5E Q;  4B3R Q;  4A3F H;  1CKN B;  1EYG A;  2E5L Q;  1B70 B;  3PO3 H;  3OTO L;  1YIT A;  4DV2 Q;  2NVT H;  2D0P A;  1YVC A;  4R4Q A;  2MFI A;  2UUB Q;  3CPF A;  2K4K A;  5GRO A;  2UUA Q;  4YCU A;  2R7Z G;  1PVO A;  2EIF A;  1VQ5 A;  1JJC B;  4OWW B;  2UXC L;  1JJ2 A;  4JI2 Q;  1KHI A;  4QL5 A;  1IBK L;  3I4M G;  3HOY H;  3FP9 A;  2CCZ A;  1NY4 A;  3CC2 A;  4A3M G;  1CKM A;  2OQK A;  3CD6 A;  4WJ4 A;  3CCQ A;  1LYL A;  2B63 H;  3ZJY C;  4P75 A;  1CKO A;  3AQQ A;  4EX5 A;  3GTK H;  2KHJ A;  3G71 A;  3KJP A;  1V43 A;  3CCL A;  2JA8 H;  3GTP H;  1WCM H;  4TVA B;  1SFO H;  4A93 G;  1B8A A;  3JC6 6;  4DV3 Q;  1FL0 A;  2AHO B;  3BJU A;  3UDF A;  4DR3 Q;  4LF7 Q;  4OON A;  3PUX A;  3I4N G;  2R7F A;  4LFA L;  2I5L X;  2JJQ A;  1Y1V G;  4NXN L;  1XMQ Q;  1B7Y B;  1L1O C;  4UPA A;  3ERS X;  4JI3 Q;  2GVB A;  2RF4 A;  2NVY H;  1GD7 A;  1Z47 A;  1M90 C;  1XPU A;  4GKK L;  5C4X G;  2YU9 H;  2EQS A;  4JI1 L;  4R4O A;  4OWX B;  4DR5 L;  1G51 A;  5M3M G;  3J81 j;  4YHH L;  3GTJ H;  3HOV H;  2ZTC A;  3SGI A;  3PV0 A;  1OTC A;  5JJI A;  1KRT A;  4GS3 A;  3M4O H;  4A3C H;  1NMF A;  4JI4 Q;  3KLW A;  3OTO Q;  4A3I H;  4GKJ L;  2UXB Q;  4IJL A;  4HJA A;  1UE5 A;  2CWA A;  1L1O A;  5LMU Q;  4WJ3 M;  1HZA A;  1ASY A;  5IYB H;  3F2B A;  4IPD A;  5M5X H;  5IP9 H;  5M3F H;  1EIY B;  2IHE A;  3M4Q A;  1VQO A;  1K83 H;  3K80 C;  2JA5 H;  4B3T Q;  3S1N H;  2UXC Q;  4YY3 Q;  4QGU A;  4IFD I;  4DK6 C;  1PH7 A;  4GN4 B;  1X3F A;  1SE8 A;  5BR8 L;  2PI2 A;  1UEB A;  2CWP A;  3T1H Q;  3ULP A;  4LWC A;  1TXY A;  1M1K C;  1P8L A;  1K73 C;  3CC4 A;  1A62 A;  3CPW A;  1T9H A;  1YJ9 A;  4DUZ Q;  1OXU A;  4A3B G;  4NPS A;  2E2H H;  1C9O A;  1VS0 A;  5IP7 G;  4X6A H;  2JA7 H;  1O7I A;  4A3D H;  4BBR G;  2MNA A;  1L1O B;  4POF A;  3HOX H;  2XGT A;  1QVG A;  2AMC B;  2A1A A;  1FJG Q;  2RCN A;  3S15 H;  1IYJ B;  3F1Z A;  1N9W A;  2Q2H A;  2JA6 G;  1XTD A;  3PF4 A;  2JE6 I;  4YCV A;  3TRE A;  2Z0S A;  5FJ8 G;  4LFC L;  3S2H H;  3CCU A;  1W2B A;  1OXV A;  4OO1 G;  1VQJ A;  5IYC G;  2MO0 A;  3HOZ H;  1EUJ A;  2NZO A;  1N34 Q;  3UDI A;  1VQ8 A;  4IPC A;  1P16 A;  1WFQ A;  3U4V A;  2BA1 A;  1L2F A;  5GAD C;  4R4T A;  1YHQ A;  4LF6 L;  4L5T A;  3ICE A;  5ELO A;  1Y1W H;  4JI0 Q;  2HT1 A;  1JE5 A;  3RLF A;  4X64 L;  1S72 A;  2VL6 A;  2NN6 I;  3A5U A;  1PFS A;  4A3K G;  1XJV A;  1Y14 B;  4KHZ A;  3IRB A;  4PZ7 A;  4LF9 Q;  4BY7 H;  4LFB L;  1IL2 A;  4UP9 A;  2FXQ A;  2PQA A;  4LF5 Q;  4X66 L;  3DLL A;  3S24 A;  5C0X I;  4DR1 Q;  3GTM H;  4DR6 L;  4JI8 Q;  4DV6 Q;  1XNR L;  4DAY B;  4LW1 A;  5EAY A;  5IY0 A;  3HOW H;  1I94 L;  3ULJ A;  1D7Q A;  1BBW A;  2UUC Q;  4A3L G;  4AQY Q;  1X3G A;  1KC8 C;  2VQE L;  4YWK A;  1I5F A;  4BA1 I;  2H5X A;  4GN3 B;  4R4I A;  4QJF A;  4X65 Q;  3M7N A;  4OWT B;  1I6H H;  2F4V L;  1HNW L;  2WFW A;  2B29 A;  1VQA A;  2V1C C;  4JBJ A;  4P74 A;  4C3J H;  3E9I A;  4H02 A;  3CC7 A;  5LMN L;  1XPR A;  1A63 A;  3F8T A;  1MJE A;  2Y0S E;  2PQA B;  3H3V I;  4BXX H;  1IBL Q;  1ASZ A;  4YCW A;  1PH4 A;  2I5H A;  2HIX A;  3RLN A;  1NE3 A;  1Q46 A;  3G48 A;  3MEF A;  4HJ5 A;  1Q1E A;  2LSS A;  2VQF Q;  3T1Y Q;  2UUA L;  4KHP L;  2K5N A;  3CW2 C;  3FKI H;  1N33 Q;  4PG3 A;  5LMN W;  4JI6 L;  3L7Z C;  1MJC A;  4DPG A;  1FGU A;  2NZH A;  3JAM i;  1JB7 A;  1C7Y A;  4K0K L;  2VUM H;  1HR0 L;  3OYY A;  1OXT A;  1EOV A;  4BY1 H;  4JI7 L;  2CFM A;  4DR7 Q;  1YEZ A;  3NEN A;  4GLA C;  4A76 A;  2N78 A;  1BBU A;  1HNZ Q;  3H0G H;  4IOA A;  2LXK A;  2K50 A;  3PCO B;  3D0F A;  2ATW A;  1KAW A;  2YTX A;  4A3E H;  4DUY L;  1EWI A;  1IBM Q;  1HR0 W;  4JI5 Q;  4X62 L;  4IPH A;  2ASB A;  1N33 L;  1L0W A;  2ZM6 L;  4B3M L;  4JCV E;  4JOI C;  4JV5 L;  5C3E H;  2UXD Q;  3I2Z A;  1VQD A;  4NB3 A;  3F2D A;  1NJI C;  3D31 A;  4LUO A;  5AJ3 L;  4LF4 Q;  4HIO A;  2R7D A;  1HNX L;  4B3S Q;  4JYA L;  4DV1 Q;  3M9B A;  5FLM H;  1TWC H;  1K9M C;  1EIF A;  1XMO L;  1YIJ A;  4O2D A;  3AEV A;  1HZC A;  3CXC A;  4DR2 L;  1QVF A;  4TQU S;  2OCE A;  2I5M X;  3GTQ H;  1PYB A;  4A3I G;  2PMZ E;  4JOI A;  4LUZ A;  4DV7 Q;  1Q1B A;  4APV A;  2R7Z H;  2BA0 A;  2Q2I A;  2Y0S G;  3I55 A;  1Z9F A;  1PH8 A;  3AFP A;  2UU9 Q;  5IYB G;  1SLJ A;  1N32 L;  4JC0 A;  2YTY A;  3MXN B;  3U4Z A;  4AH6 A;  3E0E A;  1LM0 A;  4DV5 L;  5C44 G;  4RMF A;  1PH2 A;  3S1Q H;  3CQZ H;  4IO9 A;  4JI6 Q;  3PUV A;  2IX0 A;  4HIK A;  3UDG A;  1X9N A;  4K0K Q;  3TQY A;  2R6G A;  4P73 A;  4PZ8 A;  1NTG A;  1RL2 A;  4HID A;  2GN5 A;  3L0O A;  4MZ9 A;  4JBK A;  5JJL A;  1HZ9 A;  4DNI A;  5IWA L;  1IBK Q;  3PUY A;  3RZO H;  4A93 H;  4LF8 L;  2B3G A;  4DV0 L;  1G29 1;  4DUY Q;  3KOJ A;  4HJ9 A;  5ELN A;  3CCE A;  1E22 A;  4GOP C;  4FDB A;  1Q82 C;  4DAM A;  1Y1V H;  5E7N A;  1VQM A;  1CSQ A;  1LUZ A;  2BH2 A;  3RNU A;  3S2D H;  1EFW A;  5C4X H;  1QZG A;  1UE6 A;  4Y7N H;  4UY8 C;  1WJJ A;  1PH6 A;  1FVI A;  4OX9 L;  2DGY A;  4DR4 L;  4XIG S;  4C2M H;  1X55 A;  3RR5 A;  5JJK A;  1HJP A;  5HGQ A;  5M3M H;  4A3J G;  1K8A C;  4L5S A;  4NXM L;  4LFA Q;  2A8V A;  4NXN Q;  4QY7 A;  1RIP A;  4DV4 L;  1I3Q H;  4C3H H;  4GOP A;  1Y1W G;  1R9T H;  1X6O A;  3W5O A;  5GAG C;  3J7A 5;  5IYD H;  1VQC A;  1SN8 A;  4GKK Q;  2NVQ H;  4JI1 Q;  1Q86 C;  1LTL A;  4MTN A;  2ZJP A;  4BY7 G;  2QGQ A;  4DR5 Q;  3BZK A;  4YHH Q;  2NVX H;  1I50 H;  3TS2 A;  1X56 A;  2QEX A;  3J81 i;  3KYH C;  1OXX K;  2HHH L;  2ES2 A;  2PNH A;  3GTL H;  3S1R H;  4GKJ Q;  1QVC A;  1V1Q A;  3A74 A;  1PHJ A;  3I4O A;  2K5H A;  1YJN A;  4HIM A;  3CME A;  2I0Q A;  1KIX A;  4A3B H;  4A3G G;  2RHQ B;  4ME3 A;  5IP7 H;  4C3I H;  1UE1 A;  4GOP B;  3H15 A;  2R93 G;  4BBR H;  1N36 L;  1PH5 A;  1Q8K A;  2E8G A;  3A5Z B;  2YYZ A;  4MNO A;  1J5E L;  4B3R L;  4R4C A;  2E5L L;  2K52 A;  5BR8 Q;  3PO2 G;  3HOU H;  4IJH A;  2K14 A;  4DV2 L;  1GO3 E;  2KEN A;  2Q2T A;  2D62 A;  4JBW A;  4YWL A;  3RN2 A;  2UUB L;  1X54 A;  5FJ8 H;  2IX1 A;  3CAM A;  4OO1 I;  3KJO A;  1XNQ L;  2VNU D;  1JJG A;  2ALY B;  1CSP A;  1K3R A;  4GLV B;  1U0L A;  5IYC H;  3M3Y H;  3J80 i;  2VS1 A;  4DR4 Q;  4JI2 L;  4BBS G;  3GTO H;  4HJ8 A;  3NBH B;  3BU2 A;  3K81 C;  4A3F G;  1QZH A;  3PO3 G;  4L5R C;  2IY5 B;  3GO5 A;  3STB C;  1SRO A;  2IHF A;  2VZA A;  4BY1 G;  4NXM Q;  3K7A H;  2KCM A;  4A3K H;  1VQ4 A;  4LFC Q;  4P71 A;  3CCR A;  2F3I A;  1KXL A;  2WB1 G;  2Z6K C;  1HH2 P;  3AFQ A;  2OQ0 A;  3ER0 A;  4L5Q A;  1EQR A;  1VQE A;  1VQ9 A;  3HOY G;  3KFU A;  5GAH C;  4LF7 L;  4A3E G;  4LF6 Q;  3PUZ A;  1SMX A;  4A3L H;  3FHW A;  1OXS C;  1VQG A;  1IZ6 A;  1YHB A;  3EIV A;  5HY6 A;  3UDX A;  3JAM c;  4X64 Q;  2B63 G;  3A0J A;  1XMQ L;  2MQH A;  1VQF A;  1Q12 A;  3GDE A;  4JI3 L;  1XPO A;  4P72 A;  5C3E G;  4IOC A;  5M5Y H;  2HIV A;  3M85 A;  3UE0 A;  4LFB Q;  1Q7Y C;  3NEM A;  2R92 H;  1TWH H;  4DR6 Q;  4X66 Q;  2JA8 G;  2VY3 A;  1WCM G;  2Z6K A;  1XNR Q;  2XTI A;  2KHI A;  2MO1 A;  1I94 Q;  5FLM G;  5H1S E;  2YV5 A;  4AYB E;  2DUD A;  2VQE Q;  4JI4 L;  1Q81 C;  2UXB L;  5J3B A;  4Y52 H;  1WYD A;  3G6E A;  3E9H A;  4PMW A;  5LMU L;  2E2I H;  1XNQ Q;  3CP0 A;  2F4V Q;  3S14 H;  3TRZ A;  2QA4 A;  4J15 A;  1HNW Q;  4HJ7 A;  2L15 A;  1VQB A;  5IT9 c;  4B3T L;  4YY3 L;  4GN5 A;  5LMN Q;  1VQH A;  5DLQ E;  4A3C G;  4KI0 A;  3T1H L;  3Q8D A;  1YJW A;  2HQL A;  3S17 H;  5GAE C;  2YTV A;  1U5K A;  2AKW B;  1PH9 A;  1E24 A;  2N3S A;  4DUZ L;  4KHP Q;  4ALP A;  1AE3 A;  2AWO A;  4UP8 A;  2C35 B;  3EBE A;  5M3F G;  3F2C A;  5IP9 G;  1CUK A;  3B6Y A;  5C0X J;  1E1O A;  2CQO A;  3I4M H;  2JA5 G;  1MIU A;  1TWF H;  4XTC S;  4A3M H;  4R1J A;  1FJG L;  1JT8 A;  1K0R A;  4PZ6 A;  4IFD G;  1PYS B;  4IPG A;  1HR0 Q;  4JI7 Q;  3KF6 A;  1IXR A;  1H95 A;  3I7F A;  2ZTD A;  3AYH B;  3S1M H;  5GQO A;  2N8N A;  1DGS A;  2EXD A;  5JEA G;  3J7Z C;  2ID0 A;  3ULL A;  2JA7 G;  3KDF A;  2VW9 A;  4A3D G;  1VQ7 A;  1G6P A;  1N34 L;  1X65 A;  3HOX G;  1VQ6 A;  1YHA A;  1VQL A;  4KLK A;  3I4N H;  4X62 Q;  4DK3 C;  1A8V A;  1J6Q A;  1YBY A;  3K0X A;  1UWV A;  3PGZ A;  2N49 A;  2ZM6 Q;  2K5V A;  4B3M Q;  2ZJQ A;  3OW2 A;  4JI0 L;  4A4I A;  4JV5 Q;  1VQP A;  1K8G A;  1D8L A;  2KBN A;  4LF9 L;  3G4S A;  2CKZ B;  2JEB I;  5IYD G;  3HOZ G;  5AJ3 Q;  3KF6 B;  4AYB G;  2WP8 J;  4LF5 L;  4DR1 L;  1AH9 A;  1HNX Q;  4JYA Q;  4JI8 L;  3CCV A;  3PIO A;  4DV6 L;  1E3P A;  1E7Z A;  3K8A A;  1XMO Q;  2WB1 E;  5C44 H;  2UUC L;  3L2P A;  1KRS A;  2IT1 A;  3KDF B;  4AQY L;  4QIW E;  3UE1 A;  3PSI A;  2JA9 A;  4DR2 Q;  1HZB A;  2OTL A;  1GVP A;  2Q2U A;  3U58 A;  4X65 L;  3M4P A;  1VQK A;  3TEH B;  1BKB A;  2NN6 G;  3W1B A;  3HKZ E;  3HKS A;  3W1G A;  5K36 G;  2ZTE A;  1N32 Q;  3K7U C;  3U50 C;  4QQB X;  2GVA A;  5C0X G;  3HOW G;  4DV5 Q;  1YNX A;  2JQO A;  2KCT A;  1VQN A;  1IBL L;  2WAQ E;  3J81 c;  3HOU G;  2F52 A;  2A19 A;  3CCJ A;  2OTJ A;  2VQF L;  1TWG H;  2ZJR A;  4GLX A;  4O0A A;  3WWV A;  1QUQ A;  3T1Y L;  1PH3 A;  3GD7 A;  4AIM A;  1BVS A;  3CMA A;  3CF5 A;  1MKH A;  5IWA Q;  3CCM A;  1KQS A;  1JMC A;  2E2J H;  3HOV G;  3H3V H;  4A3J H;  1PA6 A;  4LF8 Q;  3EN2 A;  2JK8 A;  5FLX c;  4DV0 Q;  1C0A A;  1NMG A;  3PIP A;  3I56 A;  1V9P A;  1WI5 A;  4GNX C;  4YWM A;  1YI2 A;  2JA6 H;  2JEA I;  4BXX G;  1S40 A;  1KD1 C;  4DR7 L;  2OWO A;  3S16 H;  3PF5 A;  1HNZ L;  3GTG H;  2AWN A;  4POG A;  1S3O A;  1A0I A;  5C4J H;  4OX9 Q;  3BZC A;  3FKI G;  1SR3 A;  1X3E A;  1WOC A;  4OXP A;  3J80 c;  1IBM L;  4JI5 L;  3LGJ A;  4EQ5 A;  1QUQ B;  3NEL A;  2VUM G;  2RHS B;  1PH1 A;  2BH8 A;  4DV4 Q;  4GNX A;  1UE7 A;  2UXD L;  3RZD H;  3H0G G;  4BA2 I;  3RLO A;  4JBM A;  3PUW A;  1CKN A;  2K75 A;  5IE8 A;  4LF4 L;  4A3G H;  3DM3 A;  4B3S L;  1W3S A;  2R92 G;  4IFD J;  4DV3 L;  2R93 H;  4DV1 L;  4DR3 L;  4JG2 A;  1VCI A;  3RN5 A;  3HKZ G;  3CCS A;  3VDY A;  1PV4 A;  1SRU A;  2HHH Q;  3PO2 H;  1AE2 A;  5JEA J;  1GM5 A;  3STB D;  1VQI A;  1NBW A;  2LXJ A;  4DV7 L;  4RG1 A;  1YZ6 A;  2D0O A; 
#chains in the Genus database with same CATH topology
 3KLR A;  4A3K B;  1E1T A;  2WAQ G;  1O75 A;  4YIJ A;  5LMN H;  2WIN B;  3V6K A;  5KFQ A;  5KFT A;  4B3R Q;  2PZT A;  1DON A;  2NVT H;  1SE4 A;  2EOT A;  2NZ1 D;  2E2I A;  4KHP H;  1I7L A;  1PVO A;  1F9S A;  2EIF A;  1HTP A;  1IHZ A;  2R86 A;  1JJC B;  1O7Z A;  5KFF A;  4JI2 Q;  1F9P A;  1IBK L;  1TWH B;  3Q1K A;  5I4D A;  3KXY T;  4JI7 H;  4J9R A;  4CDF C;  2OQK A;  1D5M C;  3TP6 A;  1AN7 A;  3ZJY C;  1T5E A;  4R8U A;  1YNN C;  1CKO A;  5JOB A;  3GTK H;  5DG8 A;  1DV2 A;  3KJP A;  1V43 A;  3K5L A;  4U68 A;  3S14 B;  4TVA B;  2EY1 A;  4DV3 Q;  5D14 A;  2J4X A;  1HXY D;  5DM6 3;  3M4I A;  2JJQ A;  4Q44 A;  1B7Y B;  4UPA A;  2V4R A;  4JI3 Q;  2GVB A;  2RF4 A;  1M4V A;  4YJ2 F;  3GV5 B;  3S17 B;  5KEE A;  2EQS A;  4JI1 L;  2FK2 A;  2HD3 A;  1STB A;  1TS4 A;  5M3M G;  3J81 j;  3GTJ H;  5EWF A;  4GC7 A;  3PV0 A;  2RDG A;  5JJI A;  1KRT A;  2RGV A;  5CB4 F;  4YR0 A;  3BJY A;  2W6M A;  3OTO Q;  1EFI D;  4IJL A;  4HJA A;  1E2W A;  1PFM A;  1UE5 A;  3ERQ A;  4KJO A;  5LMU Q;  3EPG A;  2FK3 A;  2W9C A;  5M5X H;  3O13 A;  1PYW D;  4YR2 A;  5KFW A;  1KC7 A;  2E2D C;  2FLL A;  4GN4 B;  1X3F A;  1CTM A;  5BR8 L;  1G6Z A;  2YS7 A;  1UEB A;  3T1H Q;  4ECW A;  4LWC A;  1TXY A;  5D3D A;  1P8L A;  3CPW A;  1YJ9 A;  1T9H A;  1OXU A;  1CHQ D;  3HRZ C;  1GUW A;  4OGQ C;  4KKU A;  2Y0S B;  5ISR A;  5M3M B;  2L5T A;  2XGT A;  2A1A A;  1B53 A;  2RCN A;  2HVS A;  1STE A;  1EYC A;  3F1Z A;  4B9W A;  5C44 B;  5DG7 A;  2QDB A;  4YCV A;  3RB0 A;  2Z0S A;  1LAB A;  5FJ8 G;  1CA5 A;  2C2D A;  5C5J A;  4DR4 H;  3A56 A;  1KAB A;  5JAV A;  5IYC G;  2MO0 A;  4ODG A;  4M1U B;  3TQ1 A;  2F0D A;  3M9M B;  2FJ2 A;  5C8Y F;  2JA6 A;  1YHQ A;  4R4T A;  3TP8 A;  2HT1 A;  4DK0 A;  3MFY A;  2CH4 W;  3GTG A;  4BY7 H;  3K5H A;  5K36 H;  3NBI A;  5FO8 B;  3M9N B;  2PQA A;  4DR1 Q;  1RDP D;  4IWY A;  3VR6 A;  1TWG B;  4JI8 Q;  1D5X C;  4DV6 Q;  1G91 A;  4RZR A;  1SYF A;  2W9A A;  1LTT D;  3HOW H;  1D7Q A;  2XNA C;  1GSH A;  3PN1 A;  2EYM A;  1BOS A;  4LK1 C;  1CQI B;  1X3G A;  2XCP A;  4R4I A;  3M7N A;  4DV4 H;  1B6R A;  1AW7 A;  1I6H H;  1IW7 D;  2BCO A;  1X3P A;  2A74 C;  5C4J B;  1VQA A;  3HOV H;  4B3R H;  2HCC A;  3RGZ A;  3R3O A;  5EPJ A;  1ASZ A;  2NUC A;  5J2U F;  1PRT C;  1SND A;  4RWS C;  2I5H A;  5L1L A;  1PMR A;  2LSS A;  4ECS A;  1TWA A;  3RAQ A;  4JI2 H;  3FKI H;  1JOR A;  5LMN W;  2FLP A;  3MA2 B;  4JI6 L;  2R8K A;  2HVR A;  4DPG A;  2FFK B;  2F0M A;  1C7Y A;  2R93 B;  3VA7 A;  1NR2 A;  4CKB A;  1EOV A;  4UCS A;  1Q8I A;  3HG9 A;  1E0B A;  1HNZ Q;  1JKJ B;  3Q0A A;  1E2V A;  3G8C A;  2EY6 A;  3DMU A;  3PCO B;  4XX0 B;  1O80 A;  3D0F A;  5M5W B;  1KAW A;  3FRP B;  5KFD A;  4Q43 A;  4DUY L;  2ASB A;  4WFN 3;  2B63 A;  2C2R A;  1D2B A;  4IZO A;  4JI3 H;  4RKL A;  3PO3 B;  2PQE A;  3I2Z A;  4NB3 A;  3MWM A;  4RAY A;  2JP1 A;  1H9M A;  1NJI C;  1CFM A;  4F4X A;  4IRD A;  1JR0 D;  4JYA L;  4MAM A;  1L2Z A;  1PRT B;  1TWC H;  2KA7 A;  4OEL B;  1TQO A;  1XMO L;  1YIJ A;  2E76 C;  5CC4 A;  2XCL A;  2IWH A;  4DA2 A;  1HQM C;  4LH6 A;  2F0P A;  2F0T A;  1J8I A;  2IJ0 A;  5LMU H;  4ED8 A;  4JOI A;  3GIP A;  1YNN D;  2VPQ A;  1RJR A;  4X3K A;  3I55 A;  5IYB G;  3LWB A;  1HA5 A;  4IAL A;  3MXN B;  3U4Z A;  2QK4 A;  1EEF D;  3E0E A;  2B2U A;  4DV5 L;  1PH2 A;  3S1Q H;  2JA8 B;  3GTP B;  5J2T F;  1SYD A;  3PUV A;  3T1H H;  3GV7 B;  2IX0 A;  2EE1 A;  3UDG A;  4MTK A;  1ROD A;  4K0K Q;  3HGB A;  1SE3 A;  3ITP A;  2G9H D;  4PZ8 A;  1NTG A;  2B2W A;  5D1P A;  2Q8I B;  1B44 D;  1MSH A;  2XWJ B;  1DV1 A;  3U9O A;  1IL8 A;  2A73 B;  2YU9 B;  2YZM A;  4DV0 L;  1RJP A;  2EYH A;  1Q90 A;  5ELN A;  4MIU A;  3CCE A;  2DNE A;  2F0K A;  2FB9 A;  3DWP A;  4DAM A;  1Y1V H;  1VQM A;  1CSQ A;  2C5C A;  3RNU A;  2E2H A;  3SVM A;  4UY8 C;  1LT3 D;  1WJJ A;  2JA7 A;  1L0X B;  4ULL A;  3TN2 A;  2FPI B;  4XIG S;  1X55 A;  4ETS A;  5KND A;  5JJK A;  4ZLT F;  2B2T A;  3KUP A;  5I6W A;  5IOC A;  5KFH A;  2IA6 A;  5M3F B;  2J6T A;  4H44 C;  2A8V A;  4O3Q A;  1BQQ T;  4NXN Q;  1F77 A;  1RIP A;  4DV4 L;  1Y1W G;  1R9T H;  4HMI A;  1X6O A;  3QG1 A;  3K58 A;  1F9Q A;  1S4Z A;  1CS0 A;  4DR1 H;  4JW0 A;  1LTL A;  2ZJP A;  4JI8 H;  4DV6 H;  1STA A;  4CJ1 B;  3BZK A;  2NVX H;  1I50 H;  3TS2 A;  5I2Y A;  4KN7 C;  2KED A;  2CH4 A;  2XWB B;  2QEX A;  3Q23 A;  3FDS A;  1OXX K;  2HHH L;  4CBV A;  2ES2 A;  3HOX B;  5BPH A;  4GKJ Q;  1VBH A;  3A74 A;  2HDM A;  1PHJ A;  1EOT A;  4A2A A;  5G3L D;  2JYO A;  4HIM A;  5KFP A;  5K5P A;  3GTM A;  2QKI C;  1KIX A;  1K8O A;  4EYI B;  1SNP A;  3MC0 B;  4K14 A;  1UE1 A;  3E5S A;  2E8G A;  1J5E L;  2K03 A;  4R4C A;  4C3J G;  1KJ9 A;  2F3V A;  3DF7 A;  4S3S A;  1GO3 E;  2D62 A;  3DEP A;  3CAM A;  3KJO A;  2VNU D;  1Y1W B;  5IYZ F;  4OO1 H;  4GLV B;  2R6F A;  5D1O B;  5IOD A;  3VPB A;  3SE0 A;  2O4X A;  4ZYS A;  2EDG A;  2QYZ A;  3GO5 A;  1UC9 A;  2VZA A;  4DXG A;  4LFC Q;  1VQ4 A;  1U4P A;  2QIL A;  4MA5 A;  4UAI A;  4U7C A;  5DGA A;  2YYA A;  4LF7 L;  1TII D;  3LNN A;  4LF6 Q;  3PUZ A;  4C3J B;  1OXS C;  3EIV A;  1WR2 A;  3P20 A;  1TS5 A;  1BJT A;  5CA0 F;  3A0J A;  2MQH A;  2FMM A;  2OEO A;  4R9W A;  3GDE A;  1K0S A;  3H0G A;  1PRT D;  5KFY A;  5C3E G;  3CVZ A;  1A9X A;  5M5Y H;  3UE0 A;  1Q7Y C;  3NEM A;  4X66 Q;  1S5D D;  4DR3 H;  1A15 A;  1WCM G;  4EVO A;  2XTI A;  4O3P A;  4Q8E A;  2KHI A;  5EBC A;  1I94 Q;  3GIK A;  5DLF A;  5H1S E;  1BNZ A;  2HGS A;  2VQE Q;  2UXB L;  2F0F A;  4UHV A;  4CGY B;  2VUM B;  5KYL A;  2E2I H;  2O5J C;  2F4V Q;  2WAQ A;  1SXT A;  4CHT B;  1HNW Q;  1KDA A;  2K5W A;  2L15 A;  3DUZ A;  4HAE A;  2ASL A;  5C6A A;  4HMJ A;  2FJZ A;  5KFB A;  4RNN A;  4A3C G;  2ASD A;  4O3O A;  1PH9 A;  3C2P A;  5C1P A;  5IGD A;  3LP8 A;  5C3E B;  4UP8 A;  1WTR A;  4J1M A;  2C35 B;  2EYJ A;  5COR A;  2UUA Q;  3PVX A;  1CUK A;  2UXC H;  4OL7 A;  2CQO A;  2JA5 G;  2R61 A;  5FPO A;  2SDF A;  4CDC C;  3LWE A;  4IFD G;  1PYS B;  1HR0 Q;  1DOK A;  1WSC A;  3KF6 A;  4CDE C;  2JEG A;  3GIQ A;  4YP3 A;  1I4Q A;  4X3U A;  1SNO A;  5JVH 3;  4FBU A;  4ZHQ F;  3S1M H;  4PDB A;  2NWG A;  3SK6 A;  5C4Z A;  2K01 A;  3A7L A;  2VW9 A;  1VQ7 A;  2IX3 A;  3I4N H;  4X62 Q;  4DK3 C;  1J6Q A;  1UWV A;  4NXN H;  2N49 A;  2ZM6 Q;  2ZJQ A;  4JI0 L;  3CQZ B;  4ECU A;  4O3S A;  4JV5 Q;  4J9N A;  1VQP A;  5CV9 A;  1A6X A;  2QDL A;  5L37 A;  3G4S A;  3HOZ G;  1EQT A;  5AJ3 Q;  4AYB G;  2WP8 J;  4LF5 L;  1DD2 A;  2IP4 A;  3BS1 A;  2JEJ A;  1E7Z A;  4FP5 D;  4KD3 A;  1D1I A;  2N55 A;  4MV3 A;  5I6Y A;  3PIO 3;  3L2P A;  4GKJ H;  4AQY L;  1SNQ A;  1WTO A;  4QIW E;  3UE1 A;  4A93 B;  4DR2 Q;  2C22 A;  2OTL A;  1GVP A;  4LF5 H;  3M4P A;  2HJW A;  3JSL A;  2JEF A;  2NN6 G;  2F0G A;  1AFP A;  3HKS A;  4L63 B;  2ZTE A;  1DCZ A;  5FK9 C;  5C4X B;  1G2T A;  4EG0 A;  1WVL A;  2GVA A;  4AQY H;  5CV6 A;  2DJG C;  3OUU A;  2JQO A;  1KDB A;  4J9O A;  3HOU G;  3MVV A;  5LL6 S;  4O3R A;  1A3T A;  5KT5 A;  3CCJ A;  3J80 W;  1SSO A;  2YRX A;  3T1Y L;  4XZ3 B;  4O0A A;  4C3H B;  1QUQ A;  2PW7 A;  1PH3 A;  2X6L A;  4AIM A;  3CCM A;  1C8C A;  2NVQ B;  5IWA Q;  3R5H A;  2XC9 A;  3P7J A;  3PR4 A;  3H3V H;  3K0Y A;  1PA6 A;  3SK4 A;  3EN2 A;  1F9R A;  1NMG A;  2DY7 A;  1WI5 A;  3PIP A;  3I56 A;  4YWM A;  2JA6 H;  4BXX G;  2HCI A;  4UCO A;  5KG3 A;  5LOV F;  4IQZ A;  1S97 A;  4LFC H;  2J7Z A;  1TY2 A;  3T13 A;  3GTL B;  4ZRZ A;  4RUC A;  3GTG H;  2BE5 C;  4OX9 Q;  3HP3 A;  4CKC A;  2A6E C;  1PZJ D;  1X3E A;  1WOC A;  1IBM L;  4LF6 H;  2I80 A;  1E4E B;  4BBR B;  3KLS A;  5ELF A;  2BH8 A;  4FF1 A;  4GNX A;  3HOU B;  2UXD L;  2WYO A;  1OO9 B;  4X66 H;  1CKN A;  2K75 A;  5IE8 A;  4RZQ A;  2IBK A;  3ORR A;  3I8Z A;  4B3S L;  2R92 G;  1PTO H;  1I94 H;  1JOQ A;  4JG2 A;  3H40 A;  1NR4 A;  1S0N A;  4PQX A;  3HKZ G;  3VDY A;  1PV4 A;  3VYS A;  3GTO B;  3PO2 H;  2VQE H;  1AE2 A;  4GZY C;  3JZI A;  5IT9 W;  2W6Z A;  2LXJ A;  4I7A A;  4QIW A;  2WV6 D;  4RG1 A;  2F4V H;  2D0O A;  5KT6 A;  1HNW H;  2RDF A;  3K7A B;  4IUT A;  3HFZ B;  4K5V A;  4A75 A;  1EQQ A;  2UU9 L;  4LNQ A;  3GP7 A;  4NKL A;  1NUC A;  1TWA H;  3KHL A;  4BBS H;  3Q8R B;  4KY7 A;  1JOK A;  1AUV A;  4A3F H;  1V8Q A;  1EYG A;  2E5L Q;  2ZJT A;  1YIT A;  2EYL A;  1YVC A;  4QWE A;  3FVQ A;  2MFI A;  4K5X A;  5GRO A;  2L11 A;  3V96 A;  4YCU A;  2R7Z G;  3TSS A;  3TIN A;  3PMF A;  5DNF A;  4FVM A;  4OWW B;  1JJ2 A;  2KOL A;  2R92 B;  1LTS D;  3HOY H;  1Z2O X;  1HR0 H;  1ENC A;  1LLR D;  3CC2 A;  4A3M G;  4J9Q A;  2VUG A;  1PZI D;  4WJ4 A;  3GV8 B;  2B63 H;  3OIP A;  3NTH A;  3FPU B;  4MV9 A;  5KNC A;  4P75 A;  3MJF A;  3AQQ A;  5KG0 A;  3MTS A;  4IRC A;  1K8M A;  3EFX D;  2IPK D;  1TWF A;  4X62 H;  2Z4I A;  1B8A A;  3BJU A;  4PWQ A;  4ZUJ A;  3KAJ A;  2ZM6 H;  3PUX A;  3MHB A;  4JV5 H;  1L1O C;  1Z47 A;  3T53 B;  1QJO A;  2MUY A;  4DR5 L;  1M6V A;  4R8N A;  4YHH L;  5EJW A;  1OTC A;  5G3L F;  5KFA A;  4GS3 A;  3M4O H;  4DR2 H;  3KAK A;  4A3M B;  4RB1 A;  3KLW A;  1RTN A;  4A3I H;  4MV1 A;  5EWE A;  3GV3 A;  3TP5 A;  4WJ3 M;  1HZA A;  1MZB A;  3F2B A;  2SEB D;  3J81 W;  2O03 A;  5IP9 H;  1EIY B;  1RK6 A;  3L4K A;  5IT9 E;  5KFG A;  4EBD A;  4YY3 Q;  4QGU A;  3TZD A;  4DK6 C;  5CAE B;  2Z4H A;  5TSS A;  2CWP A;  1JCK B;  3ULP A;  1ILP A;  4LH7 A;  1K73 C;  3CC4 A;  1T36 A;  2DPI A;  4FF2 A;  4K8I A;  2K33 A;  4B9X A;  4DUZ Q;  4A3B G;  1FNU A;  3N6R A;  4ZKB B;  2E2H H;  1C9O A;  2F0W A;  3QOJ A;  1IOV A;  4FU0 A;  3BDC A;  4C3I G;  2JA7 H;  5IWA H;  4A3D H;  1L1O B;  1EEI D;  4POF A;  1FJG Q;  1I4X A;  5IGF A;  1D1K A;  3S15 H;  1QOH A;  3OMG A;  1N9W A;  5A35 A;  4G3I A;  3D8G A;  1XTD A;  3PF4 A;  5CBE E;  3BVZ A;  3S2H H;  1EWH A;  4DAY A;  3ETH A;  4OX9 H;  5DQG A;  1VQJ A;  1Z7T A;  2MHV A;  3QWN A;  2G5D A;  1SAP A;  2NZO A;  3N6X A;  3UDI A;  1PRT F;  3U4V A;  5LP6 F;  1ESF A;  5KG2 A;  3H91 A;  1L2F A;  4NXM H;  3RTX A;  3QR8 A;  4TV8 F;  1JE5 A;  4X64 L;  1S72 A;  3S1R B;  4A3K G;  1T3N A;  4LF9 Q;  1DYQ A;  2L9H A;  4LFB L;  4DR6 L;  3GTM H;  3IN5 A;  2V5A A;  1GSA A;  5C0X H;  1MSG A;  3ULJ A;  3QJY A;  2UUC Q;  2NU8 B;  4ZUI A;  4A3J B;  3K5N A;  4BA1 I;  4IR9 A;  3GQC A;  3A8J E;  1I6U A;  4RKB A;  4WJW A;  4EQN A;  2L12 A;  1RTO A;  5LL6 X;  5LYJ F;  4IUP A;  1GOZ A;  2AUK A;  2BE5 D;  3E0J A;  5EZY F;  3IKJ A;  1B50 A;  4WOR A;  1JQY D;  2A6E D;  4DGZ A;  4PMB A;  1W6K A;  3E9I A;  5LMN L;  2E5L H;  2F0I A;  1MJE A;  2EJG C;  4I4T F;  3J81 E;  3NSW A;  1PH4 A;  2P0A A;  1XNQ H;  2H4O A;  1EY4 A;  2HIX A;  1Q46 A;  4KD4 A;  5L9X A;  1Q1E A;  5C4H A;  2VQF Q;  4KHP L;  2WKD A;  4RB3 C;  2K5N A;  3RZD B;  2VB2 X;  2R8G A;  4A3G B;  1MI2 A;  3KHH A;  2AGQ A;  5JQW A;  3BDO A;  3RBD A;  3OWF A;  5FLX E;  2EXZ A;  2XGP A;  1FKA H;  3OYY A;  2J9G A;  4JI7 L;  4EFB A;  1LT6 D;  5F9L A;  4FNF A;  3R8B A;  1SCU B;  4A76 A;  2N78 A;  4E4T A;  3H0G H;  1FNW A;  2O5I C;  1GLV A;  1VMC A;  3FMC A;  1O78 A;  2ATW A;  4JPB W;  2YTX A;  2Q8R E;  1TKW B;  1EWI A;  4A3E H;  1HR0 W;  4J9K A;  4O1N A;  3FPP A;  3H4D A;  4IPH A;  3MWY W;  1L0W A;  2W9B B;  5KT3 A;  2NU7 B;  4B3M L;  3PW5 A;  3RAX A;  2K04 A;  2Q8T A;  2NVT B;  1VQD A;  3F2D A;  1PX2 A;  2PNR C;  4I7Z C;  3N43 B;  3EYY A;  4EEY A;  2HUG A;  3MWD A;  2WAC A;  4QWB A;  2ZXP A;  4ILW A;  1HNX L;  2W6N A;  1GHJ A;  4DK1 A;  3L3O C;  3M9B A;  1VAJ A;  2C00 A;  4O4I F;  1K9M C;  4B3M H;  4ID6 A;  4O2D A;  2KEC A;  4QUF A;  3BQ1 A;  2R84 A;  5DQH A;  1QE6 A;  3T16 A;  1QVF A;  2NVY A;  2OCE A;  5FD5 A;  3M7G A;  1PYB A;  2IW3 A;  1HNX H;  1Q1B A;  4ZQ3 A;  4K6D A;  3JRX A;  2SOB A;  2Q2I A;  2Y0S G;  4RGT A;  3Q2O A;  4C5A A;  2WDT A;  3PW4 A;  5J39 A;  2F03 A;  3GTK B;  4YY3 H;  5DEH A;  2YTY A;  1RCV D;  1LM0 A;  5C44 G;  2W57 A;  4JI6 Q;  2NTT A;  3DXJ C;  3ZYY X;  4HIK A;  4TQS A;  4L1K A;  3TQY A;  2K5Q A;  2R6G A;  2RSO A;  3PW0 A;  1H9S A;  4DUZ H;  1Y8N B;  3RMH A;  4UDU C;  1Y69 U;  1RL2 A;  4RB0 A;  2GN5 A;  3L0O A;  2JA5 A;  1K83 A;  1HZ9 A;  4R8I A;  5DGB A;  4R7R A;  4DLK A;  2V4Q A;  3RV4 A;  3QIA A;  1FJG H;  3GTJ B;  4DUY Q;  4GOP C;  4IZ8 A;  3RF2 A;  3V6J A;  3F8N A;  3C3L A;  5JEA H;  3S2D H;  1EFW A;  1UE6 A;  4Y7N H;  2EY5 A;  3OOC A;  1PH6 A;  4DR4 L;  1ENA A;  4H13 C;  5GON F;  4CC5 A;  3KHR A;  2FKL A;  3IFD A;  5HGQ A;  5M3M H;  5DM7 3;  4DFA A;  5M5X B;  4JV1 A;  4Q8F A;  1X3Q A;  4LFA Q;  2F0L A;  1NNX A;  3VPC A;  3QZ8 A;  4LF9 H;  5IGG A;  3W5O A;  1VQC A;  1SN8 A;  4GKK Q;  4AYB A;  1Q86 C;  4BY7 G;  2AUJ D;  2QGQ A;  3J7A V;  2UUC H;  1X56 A;  4L8J A;  5L1J A;  1ICF B;  3J81 i;  1TS3 A;  1O7L A;  4J6H A;  2CQA A;  2VA3 A;  3M4Y A;  5T14 A;  2RKS A;  3I4O A;  3CKI B;  3DWQ A;  3NBH A;  1WD1 A;  2XIW A;  3ND9 A;  1LO5 D;  3OSO A;  1BO0 A;  3KAL A;  2RHQ B;  4U6P A;  2ICI A;  4GOP B;  2R93 G;  1B4O A;  5COY A;  2R7N A;  1PH5 A;  1Q8K A;  4B3R L;  2ENB A;  2W6O A;  4DL2 A;  1K28 A;  1EY5 A;  2K52 A;  5IGE A;  4JBW A;  1DOM A;  1X54 A;  5FJ8 H;  2IX1 A;  3D6W A;  4OO1 I;  4LSX A;  2VQF H;  2ALY B;  1ET9 A;  4QWC A;  4BS9 A;  5IYC H;  3M3Y H;  2BOS A;  3G6J B;  4BY7 B;  2YCH A;  4JI2 L;  1RYR A;  3VR5 A;  4HJ8 A;  4QMG A;  3PO3 G;  1O7Y A;  3HOW B;  2IHF A;  2KCM A;  2HQE A;  4P71 A;  1CZG A;  1PK8 A;  1W6J A;  5CV4 A;  4IN3 A;  1KXL A;  2BQU A;  1V1P B;  4X3S A;  3D3R A;  1RJT A;  4L5Q A;  1I6H B;  4HNV A;  5GAH C;  2YZN A;  2AQ3 B;  3HOV B;  5E4W C;  2ATL A;  1HFN A;  1VQF A;  2WB1 A;  4JI3 L;  4IRK A;  2HIV A;  5EKL A;  1I4P A;  4TRD A;  3U9T A;  4DV3 H;  2JA8 G;  3T51 B;  2Z6K A;  1XNR Q;  2ZXR A;  1WH2 A;  3T5K A;  3HKZ A;  2B2V C;  3FKI B;  1VF5 C;  1JLL B;  1Q81 C;  2HVQ A;  1WYD A;  2EJF C;  4LAA A;  2L0C A;  3BQ2 A;  3D4D A;  3E9H A;  4PMW A;  5LMU L;  3CP0 A;  2PZW A;  4RCO A;  1Z6H A;  1TY0 A;  2E75 C;  3E6Z X;  5IT9 c;  2KCC A;  1CHP D;  4MTD A;  1S03 G;  3OTO H;  1F2Y A;  5EPL A;  3T1H L;  3GTQ A;  3Q8D A;  3SR1 A;  3TII A;  2R3Z A;  1EY9 A;  1YJW A;  2R7Z A;  2D2C C;  5ELB A;  4CDD C;  3L4J A;  3SHL A;  2AWO A;  3T5H A;  5M3F G;  3I4M H;  1E1O A;  3OHB A;  2ASJ A;  3NWS A;  1TWF H;  4XTC S;  4RGN A;  1SFO B;  4R1J A;  3V05 A;  2LY7 A;  5C3W A;  1TWC B;  4YJ3 F;  1IXR A;  2B8G A;  3RB3 A;  5FD6 A;  1H95 A;  4DU9 A;  4X3T A;  5JH7 F;  3PQI A;  5EBD A;  3ULL A;  3T5J A;  1BCP D;  2K05 A;  3HOX G;  1YHA A;  1VQL A;  4KLK A;  1VQ6 A;  5H80 A;  1FNV A;  3V4S A;  4LFA H;  4O4H F;  1N33 Q;  3PGZ A;  1YBY A;  3S1Q B;  3OW2 A;  1SNM A;  5CYU A;  3SDZ A;  3OHX C;  4GKK H;  4C2M A;  3MFG A;  2NBF A;  1AH9 A;  4DR1 L;  4JI8 L;  4DV6 L;  3PR5 B;  2AU0 A;  3S1N B;  1ESR A;  3ERO A;  4XDX A;  1Z2N X;  1TA8 A;  4F7X A;  3KDF B;  1CQV A;  1WD0 A;  3OSN A;  1I3Q A;  2JA9 A;  2X6G A;  1GUT A;  1VQK A;  1EZ6 A;  1QG7 A;  3TEH B;  1I7N A;  1F2M A;  1Y1V B;  4JV0 A;  3W1G A;  1C4Q A;  4RA8 A;  3WO0 A;  2B2Y C;  1PZK D;  1IKL A;  2F0S A;  3U50 C;  1N32 Q;  4QQB X;  2K28 A;  1YNX A;  1S5C D;  3H94 A;  5KT4 A;  1VQN A;  2C28 A;  2WAQ E;  3J81 c;  3W2D A;  1BBX C;  4EGJ A;  5DQI A;  2ZJR A;  5I9O A;  1R9T B;  1EYZ A;  1KBL A;  2WE6 A;  3H3V I;  1KQS A;  3CF5 A;  1A3V A;  1MKH A;  2E2J H;  4YR3 A;  1WTH A;  1KLU D;  1HCZ A;  2K7V A;  1ULZ A;  3MR6 A;  4LF8 Q;  5FLX c;  2JK8 A;  2NVX B;  1I50 B;  1YI2 A;  1KD1 C;  3IL8 A;  3BG3 A;  2OWO A;  3S16 H;  1HNZ L;  1S3O A;  1SEB D;  1NAP A;  3VA5 A;  1JC7 A;  2R7K A;  2C2E A;  4OXP A;  2DZD A;  1EY6 A;  3Q6S A;  3QZ7 A;  2TSS A;  3NEL A;  2VUM G;  1DOL A;  2RHS B;  3LWU A;  1PH1 A;  4XQQ A;  1IYV A;  2GPS A;  5KFU A;  4F50 A;  1HNZ H;  1LTI D;  1UE7 A;  3VYT A;  5FPR A;  5D8D A;  3G6V A;  2EY2 A;  2PW5 A;  4DNT B;  1XNR H;  1PFB A;  1W3S A;  4FXD A;  4IFD J;  2FPP B;  4DR3 L;  2DN8 A;  1KAA A;  4XXE A;  4YAJ B;  1XWE A;  1XDN A;  1TS2 A;  5FO9 B;  2NU6 B;  2W8L A;  4ECY A;  4EGQ A;  5KFC A;  1JXL A;  1KEE A;  1D6E C;  1VQI A;  1TAE A;  4C5C A;  3TZU A;  1S10 A;  1CZW A;  2MJ8 A;  1TWH A;  3RGX A;  1QNU A;  3TS0 A;  1N8R C;  3KF8 B;  2PI2 E;  2J6S A;  1N36 Q;  3J7A K;  3V2T A;  4DV2 Q;  2V58 A;  2D0P A;  1KTK A;  4R4Q A;  4J9P A;  2UUB Q;  3CPF A;  2VOB A;  5C3X A;  3N40 P;  2BQ3 A;  4V0B A;  1VQ5 A;  5JVD F;  4MN3 A;  4QB4 A;  2UXC L;  5M5Y B;  1KHI A;  4QL5 A;  3MEH A;  4DNR B;  5FOB B;  4K0K H;  4EBE A;  1NY4 A;  4MA0 A;  2W7P A;  4RU9 A;  2MP1 A;  5CV7 A;  4EGV A;  3CD6 A;  4A2B A;  1ZQ7 A;  4C5B A;  1LTA D;  2FE3 A;  2XVS A;  1HA6 A;  3G6X A;  5KT7 A;  4J9M A;  2AQ1 B;  1JWS D;  1UUP A;  2KHJ A;  5AFW A;  2RDH A;  4FS2 A;  5KG4 A;  2E2I B;  3OIQ A;  3CCL A;  3N8D A;  2M2L A;  1WCM H;  3DEO A;  3RUZ A;  4A93 G;  2F0N A;  4BWS C;  1FL0 A;  3UDF A;  3I4N G;  4J9L A;  4OON A;  2ICE C;  1K3B C;  2I5L X;  3BYT B;  4FM9 A;  4NXN L;  1XMQ Q;  4M7E A;  3MXU A;  3ERS X;  5C4X G;  1EYD A;  2NVY H;  1GD7 A;  2EYO A;  1V4Y A;  3HB9 A;  3Q22 A;  4G57 A;  1G51 A;  4R8U B;  3BVG A;  3J81 L;  2KJX A;  4M8A A;  4MV8 A;  5EPK A;  3NHH A;  1M0T A;  4A3C H;  2OH2 A;  1NMF A;  3KBX A;  3ND8 A;  3RB6 A;  4JI4 Q;  4GKJ L;  4C3H G;  2GA4 B;  4I7H A;  2RSN A;  2Y0S A;  1VKZ A;  5IGC A;  3ETJ A;  1N32 H;  5FLX L;  4IPD A;  3S1M B;  3M4Q A;  1VQO A;  1K83 H;  3K80 C;  2JA5 H;  4B3T Q;  3N44 B;  5CGK A;  1STY A;  4C56 C;  1SE8 A;  2PI2 A;  2FPG B;  4IFD H;  5CBA E;  3I4N B;  3IAY A;  2ZT9 C;  1M1K C;  5L1K A;  1A62 A;  1CK1 A;  2D9U A;  2RVL A;  3H3V C;  1VS0 A;  5T1I A;  5IP7 G;  4X6A H;  3WNZ A;  5EWG A;  3NUC A;  5C1O A;  1O7I A;  5KNB A;  4BBR G;  2MNA A;  3CU7 A;  4LF8 H;  2EJM A;  2W8K A;  2AMC B;  5HUR A;  2MCT A;  1OWT A;  4Y8V B;  4F88 A;  1HHV A;  2Z8L A;  2W9C B;  4N9P A;  3H09 A;  1GUS A;  4DF7 A;  4F87 A;  2JA6 G;  3AMU A;  2G9D A;  4LFC L;  1EUD B;  1TWG A;  3Q24 A;  3VR2 A;  4QW8 A;  1OXV A;  3HOZ H;  1EUJ A;  2I8C A;  2F0E A;  1N34 Q;  3H4B A;  1VQ8 A;  4Q45 A;  4IPC A;  1WFQ A;  4LF6 L;  4MV4 A;  4Q0Y A;  1GSO A;  5ELO A;  3R2T A;  1BUV T;  2EPB A;  2VL6 A;  3A5U A;  1XJV A;  5J1Z A;  1Y14 B;  1PTO C;  1R4P B;  4KHZ A;  3IRB A;  3OSP A;  2NN6 H;  5KGU A;  2FXQ A;  4X66 L;  2A5H A;  5C0X I;  3DLL A;  2YW2 A;  4LW1 A;  2NUA B;  3NXW A;  1I94 L;  2XIG A;  4RB2 C;  4A3L G;  4MV6 A;  2QF7 A;  4ME5 A;  1KC8 C;  2VQE L;  1I5F A;  4GN3 B;  2JA6 B;  4EFE A;  4I65 A;  4X65 Q;  1JX4 A;  4LSA A;  1EHI A;  4OWT B;  2F4V L;  2KVM A;  2J0T D;  1BDO A;  5D3I B;  1HUN A;  1HNW L;  1SJH D;  2R93 A;  3GTG B;  1N36 H;  1JDE A;  2WFW A;  4KV6 A;  1A3U A;  2V1C C;  4JBJ A;  4P74 A;  3CC7 A;  5JUM A;  1GXD C;  3I70 A;  4P2C B;  3F8T A;  4H7B A;  4DV2 H;  1SDF A;  2PQA B;  4BXX H;  1IBL Q;  5FKA C;  2UUB H;  4YCW A;  5CV8 A;  2KUM A;  3QB3 A;  4QCL A;  3RLN A;  2FIN B;  3I72 A;  1IYU A;  1PLF A;  3J7Y W;  2UUA L;  2XGQ A;  4DL6 A;  1GYF A;  1UNS A;  2BDO A;  3I91 A;  1PFN A;  4PG3 A;  4ZOL F;  3K5O A;  3L7Z C;  3KK7 A;  1B1Z A;  1PTO B;  2NZH A;  1JB7 A;  4XYM B;  1HR0 L;  1OXT A;  4BY1 H;  4V19 0;  2DIK A;  4RNM A;  5KFI A;  2CFM A;  4XT3 B;  4DR7 Q;  1BCP F;  1YEZ A;  3PO2 B;  2CW7 A;  3NEN A;  3SEB A;  2UUA H;  2WII B;  4CC6 A;  1ZHS A;  2XCA A;  4IOA A;  3PZP A;  1JWM D;  2LXK A;  1S0M A;  3D6C A;  2VXW A;  3J80 E;  2BDN A;  4FXK C;  3BA8 A;  4DL5 A;  4JI5 Q;  4X62 L;  1TWA B;  3K6O A;  4BBS B;  2A68 C;  2KQ3 A;  2ZM6 L;  5BMV F;  4A3F B;  4JOI C;  5KFZ A;  4JV5 L;  3MXN A;  1KJJ A;  1II3 A;  4ZKC B;  4DL7 A;  5AJ3 L;  4LUO A;  4LF4 Q;  3GTP A;  2NTS A;  2B2U C;  3BQ0 A;  1BF4 A;  4DV1 Q;  5FLM H;  3AEV A;  4KMU C;  1HZC A;  4JI4 H;  3HOY B;  4DR2 L;  3EVQ A;  3T5L A;  5KRU A;  2B2W C;  2I5M X;  3GTQ H;  4APM A;  3V6H A;  2YU9 A;  4A3I G;  3TIG A;  2KEE A;  2PMZ E;  4LUZ A;  4DV7 Q;  2DLN A;  3NP8 A;  2R7Z H;  2B63 B;  1PH8 A;  5EQ0 A;  3AFP A;  1SLJ A;  4B3T H;  5JPN C;  3NTI A;  2DWC A;  3GIL A;  1UNN C;  2JSO A;  4TUY F;  4NW2 A;  2W70 A;  4YB8 B;  3GIJ A;  1X9N A;  5A2Q W;  2O2L D;  2B39 A;  2A69 C;  5KFS A;  3CRL C;  5ELE A;  2B2T C;  5JJL A;  4DNI A;  5IWA L;  1IBK Q;  3PUY A;  3RZO H;  3OUZ A;  3IG0 A;  4N8X 1;  5D65 A;  4KKS A;  1Q82 C;  1W96 A;  1G8Z D;  1LUZ A;  3HBL A;  1BXR A;  4A3I B;  4OX9 L;  2AQ2 B;  4C2M H;  1N34 H;  4EQP A;  2F0H A;  4ZQI A;  4IUV A;  4A3J G;  2XRQ D;  4WRD A;  1K8A C;  4L5S A;  4NXM L;  2I87 A;  1EY8 A;  4UFZ A;  2CHB D;  3P1H A;  1I3Q H;  5KFN A;  3J7A 5;  4ECQ A;  5GAG C;  5IYD H;  4ED0 A;  1MHW C;  4JI1 Q;  3BG5 A;  3ORQ A;  4I50 F;  1N48 A;  1JB3 A;  2ZXO A;  2W71 A;  4F8M A;  2E2H B;  2UVV A;  1J9O A;  2JA7 B;  2J6U A;  4A3D B;  1Y1W A;  3UQ8 A;  1B2T A;  4EQO A;  3P75 A;  3S1R H;  2A6H D;  1V1Q A;  5D1O A;  4X65 H;  3S15 B;  5IIF A;  3OPO A;  4XQN A;  1YJN A;  5E4X A;  2RBM A;  1VBG A;  3CME A;  4A3B H;  4A3G G;  1E4G T;  3S2H B;  2PMZ A;  4C3I H;  3NTK A;  1TU2 B;  2IL8 A;  2YYZ A;  3IFT A;  2E5L L;  4PNY A;  1IBL H;  5BR8 Q;  2K14 A;  4UCV A;  2KEN A;  3RN2 A;  2F0U A;  1KLG D;  4IUN A;  2FMC A;  2SNS A;  4HR7 B;  5JPM C;  1XNQ L;  1JJG A;  5C5M A;  1PTO D;  2V59 A;  1U0L A;  3J80 i;  4NDX A;  5A2Q E;  4DR4 Q;  3C0F B;  2F3W A;  2F0Q A;  3BU2 A;  4QWD A;  3GTM B;  1QZH A;  4XQJ A;  1ML0 D;  4IHJ F;  2IY5 B;  2CW0 C;  2KSW A;  4DR7 H;  3MWE A;  5F9N A;  5KFM A;  3VMM A;  4ME6 A;  4A3K H;  3N52 A;  1HH2 P;  3ER0 A;  1VQ9 A;  1EQR A;  4HR7 A;  4JI5 H;  5M9O A;  2N88 A;  3KFU A;  3A8K E;  2VUM A;  4A3E G;  4RUA A;  1XXG A;  3FHW A;  2CZG A;  1IZ6 A;  1YHB A;  3UDX A;  2R8I A;  3NPP A;  3PW7 A;  2JN4 A;  1Q12 A;  1XPO A;  2K1B A;  4P72 A;  1VDZ A;  5KFV A;  2AGO A;  3WOF A;  4LF4 H;  3MFI A;  1TWH H;  3R93 A;  1ZYR C;  4DV1 H;  2VY3 A;  2MO1 A;  4K2K A;  1EUC B;  3OMC A;  4AYB E;  2OXP A;  1S5F D;  3F2U A;  4Y52 H;  3I90 A;  4DV7 H;  1ET6 A;  2UVW A;  1WCM A;  3NGD A;  3S14 H;  4O2B F;  1QCB D;  4J15 A;  2QA4 A;  3QFF A;  3H0G B;  3V4Z A;  1H9K A;  3GV6 A;  3QO2 A;  1U4R A;  4YY3 L;  3I4L A;  4GN5 A;  3EQL C;  4KI0 A;  4A3E B;  4F4Y A;  2A68 D;  3K57 A;  3S17 H;  2HQL A;  5BN4 A;  1U5K A;  3HXL A;  3SXH A;  4DUZ L;  1AE3 A;  1BCP C;  1IKM A;  3NQI A;  3EBE A;  5EDW A;  2BQR A;  3EA6 A;  3B6Y A;  4CJ2 C;  4J9S A;  3CRK C;  1IBK H;  1EIH A;  4FBT A;  3CQZ A;  4XYL B;  2WAQ B;  1FJG L;  1CQF A;  1JT8 A;  1K0R A;  3MR2 A;  1SE2 A;  4IPG A;  4RFB A;  2UVR A;  4O3N A;  4ED6 A;  2Z9H A;  1GGO A;  1CQJ B;  5HBR B;  3WDN A;  4Q5V A;  2PYK A;  3I7F A;  2ZTD A;  3AYH B;  1U4M A;  5GQO A;  4C1N I;  5I47 A;  1DGS A;  2EXD A;  5JEA G;  4JV2 A;  4UCT A;  2ID0 A;  3VYR A;  1G6P A;  5KFJ A;  1Z2P X;  1X65 A;  1AZP A;  1RKN A;  3URY A;  1B3Q A;  1SMY C;  3K0X A;  2R8J A;  3HS0 C;  4A4I A;  5E3F A;  4ED2 A;  2I07 B;  4JI1 H;  3E3X A;  4LF9 L;  2CKZ B;  2A69 D;  3KF6 B;  1GUO A;  2EYP A;  4JYA Q;  5LA6 F;  3CCV A;  3SK8 A;  3PIO A;  1LT5 D;  3KBG A;  1JDB B;  3K8A A;  1XMO Q;  1TR5 A;  2WB1 E;  5C44 H;  2UUC L;  5L1I A;  1KRS A;  3UFX B;  4IWX A;  1BCP B;  4G4K A;  1LTG D;  1HZB A;  1UAP A;  2Q2U A;  3U58 A;  4DN4 M;  1BKB A;  1KNA A;  5EGT A;  4JVZ A;  3HKZ E;  1UC8 A;  2FP4 B;  1EYA A;  5K36 G;  1DZ1 A;  2DJF C;  3S2D B;  4WBN F;  4Y7N B;  4YBZ B;  3VPD A;  3HOW G;  4DV5 Q;  1I4H A;  5BR8 H;  1F2Z A;  1SJE D;  3GTL A;  2KCT A;  2FMA A;  4ED3 A;  3G6Y A;  2A19 A;  2VQF L;  1TWG H;  4GLX A;  2EZV A;  1KJ8 A;  3MR5 A;  3MXP A;  1E4E A;  1ZHQ A;  1CI3 M;  4FO2 A;  2WTF A;  4EBC A;  4ED7 A;  3HOV G;  3J7A F;  4DV0 Q;  1C0A A;  4GNX C;  1S40 A;  1N56 A;  3PIP 3;  4ECV A;  5CA1 F;  3PF5 A;  5HGT A;  4G7H C;  2AWN A;  5ELD A;  4POG A;  1A0I A;  5C4J H;  1DXM A;  1ENF A;  3FKI G;  3NQT A;  3JAM W;  3GTO A;  1GJX A;  3J80 c;  2EVB A;  4K2L A;  3RB4 A;  3U9S A;  1XX8 A;  1QUQ B;  1U9R A;  3N42 B;  4DV4 Q;  2YS6 A;  4ED1 A;  1DJR D;  1JWU D;  4BA2 I;  4RNO A;  1KNE A;  4JBM A;  3PUW A;  3BAA A;  4KK7 A;  2AQ4 A;  1MGS A;  3C1F A;  3BDL A;  3DM3 A;  2QW7 A;  4RCN A;  2NU9 B;  2E74 C;  4DV3 L;  2R93 H;  1LV9 A;  3M3Y B;  2R87 A;  3CCS A;  4B08 A;  4IR1 A;  1SRU A;  2HHH Q;  1DIK A;  1RHP A;  3R2I A;  2MPM A;  1XTC D;  2CW0 D;  1GM5 A;  1NBW A;  1JOO A;  2R92 A;  3MFH A;  4EYH B;  1YNJ C;  5M5W H;  1HFG A;  3GID A;  1SBB B;  1GKH A;  1KL9 A;  3A7A B;  4UP7 A;  5CMD A;  4GNX B;  4DKA C;  1ZKO A;  1B33 N;  1UEA B;  4LUV A;  5KT2 A;  1J5E Q;  1S0O A;  1CKN B;  3I12 A;  1B70 B;  3PO3 H;  1EIG A;  3OTO L;  4MHE A;  5DAU A;  1C30 A;  1G2S A;  1EU3 A;  2K4K A;  4QF4 A;  3OHA A;  1EZ8 A;  1KDC A;  4HCE A;  2GLT A;  4JI6 H;  1ZYR D;  4QIW B;  5NUC A;  3I4M G;  1HUM A;  1FYC A;  2NB0 A;  3FP9 A;  5J22 A;  4TSS A;  2CCZ A;  4G7O C;  2ALZ A;  1CKM A;  5CR3 A;  4GC6 A;  4N9T A;  1FR3 A;  4IUU A;  1LYL A;  1Q3L A;  4K5W A;  3CCQ A;  5K2M A;  5KX5 F;  1JIC A;  4EX5 A;  4HQ6 A;  5KYI A;  3G71 A;  4FXG C;  4DAP A;  2W7O A;  2JA8 H;  3GTP H;  4DUY H;  1SFO H;  1QNK A;  5T1G A;  3JC6 6;  4C1N K;  2AHO B;  4DR3 Q;  4ABN A;  4LF7 Q;  4I55 F;  1RF2 D;  2R7F A;  4LFA L;  3JAM E;  1Y1V G;  1AEX A;  3OWE B;  4OHJ A;  1XPU A;  4U67 3;  1M90 C;  3RFC A;  4GKK L;  3LX0 A;  2YU9 H;  3H20 A;  3K3P A;  4R4O A;  4ZCK A;  1AN8 A;  4JYA H;  4OWX B;  4KY6 A;  1Y8P B;  4HSV A;  1XMO H;  2ZTC A;  3C1E A;  5ELC A;  4RHR A;  3SGI A;  2K32 A;  4DXF A;  3I4M B;  2PVP A;  4O4L F;  1EL0 A;  1TWF B;  2UXB Q;  1CE8 A;  2CWA A;  2PPB C;  1L1O A;  2XSC A;  1NCV A;  1ASY A;  5IYB H;  1LTR D;  4KJN A;  2K5D A;  5M3F H;  3BAB A;  2IHE A;  1SYE A;  4DV5 H;  3NE5 B;  3S1N H;  2CW8 A;  3EPI A;  1FGB D;  2M00 A;  2UXC Q;  4IFD I;  1H9R A;  1PH7 A;  1PTO F;  3SE7 A;  1QWY A;  2JXM B;  1SMY D;  5LHY 1;  2R7M A;  3OW7 A;  4J8Q A;  5E1F A;  5KFX A;  3J80 L;  4NPS A;  1L0Y B;  4NLG A;  4FYD A;  3JRW A;  3K5I A;  4RHS A;  4DV0 H;  3HOX H;  3WO1 A;  1QVG A;  3KHG A;  1X32 A;  1IYJ B;  2I46 A;  2Q2H A;  2JE6 I;  5KG5 A;  4KHV A;  2FHT A;  3TRE A;  3CCU A;  3QOL A;  4CKE A;  1W2B A;  4OO1 G;  2LKV A;  3N41 B;  2SCU B;  4PMC A;  1NSN S;  1P16 A;  5JVG 3;  2BA1 A;  2WKC A;  5GAD C;  4DAV A;  4L5T A;  3ICE A;  4J0M A;  1Y1W H;  3A54 A;  4JI0 Q;  3RLF A;  1KJQ A;  2NN6 I;  1PFS A;  1E2Z A;  1EY7 A;  2YRW A;  4PZ7 A;  4YQW A;  1IL2 A;  4UP9 A;  2ZDH A;  4LF5 Q;  3CHB D;  3S24 A;  1XNR L;  4DAY B;  5EAY A;  5IY0 A;  4L6T B;  1HRJ A;  2HHH H;  2E2J B;  1BBW A;  4RAU C;  4AQY Q;  5KG7 A;  4YWK A;  5JVL A;  2H5X A;  5BN3 A;  4HSP A;  4QJF A;  5IT9 L;  2X69 A;  2VB3 X;  3E5N A;  2IMW P;  3S16 B;  2PBZ A;  2ZDQ A;  4ZK9 B;  3VR4 A;  1R4Q B;  2B29 A;  1LAC A;  2XRS D;  4C3J H;  1XPR A;  1RJQ A;  1J5E H;  4H02 A;  1A63 A;  1T5X D;  4O2A F;  2XN9 C;  2Y0S E;  2YL2 A;  3BA9 A;  1T94 A;  2PMZ B;  3BZD B;  4NP5 A;  3Q8S B;  2H1E A;  4ZI7 F;  1NE3 A;  5I9P A;  2V4D A;  3G48 A;  3MEF A;  4HJ5 A;  3T1Y Q;  2F0J A;  3CW2 C;  2W9B A;  4M9U A;  2LS0 1;  4WD3 A;  5KFR A;  1TVX A;  1MJC A;  3JAM i;  1FGU A;  2SNM A;  4H0L C;  4YAK B;  4K0K L;  2VUM H;  2VA2 A;  4IAJ A;  2NYZ D;  4GLA C;  3AB9 A;  1BBU A;  2F4I A;  4LMQ D;  3SK5 A;  4F4Z A;  1SYB A;  2K50 A;  3MR3 A;  1YNJ D;  1CA6 A;  4LF7 H;  1IBM Q;  4BWG B;  1GUN A;  1N33 L;  2V9W A;  3GII A;  2PO4 A;  3EJI A;  3L9A X;  4JCV E;  5C3E H;  2UXD Q;  3GTK A;  3DWA A;  3GIM A;  3D31 A;  1B6S A;  4HIO A;  2R7D A;  4B3S Q;  5LXT F;  1N33 H;  1QIL A;  1C48 A;  1EIF A;  4LMY A;  5C5L A;  1Y8O B;  2RQX A;  2UXB H;  3CXC A;  5KKN B;  4TQU S;  1PXU A;  5A2Q L;  3Q8Q B;  4OEM B;  4APV A;  3RV3 A;  5KG6 A;  2BA0 A;  3PW2 A;  3GTJ A;  1ILQ A;  1Z9F A;  2UU9 Q;  4KN4 C;  5EKI A;  1N32 L;  2L1B A;  4FF4 A;  3SI8 A;  1VF7 A;  4JC0 A;  4AH6 A;  1B3A A;  3A8I E;  3BYY B;  4RMF A;  3UI2 A;  3CQZ H;  4IO9 A;  1MD2 D;  1WCM B;  1M8A A;  4XYQ A;  1KJI A;  4DL3 A;  2HDL A;  4P73 A;  3LML A;  5BN5 A;  4HID A;  5KFK A;  2FLN A;  4MZ9 A;  4JBK A;  2NVY B;  1PDQ A;  1SNC A;  2Z1C A;  2PZU A;  4A93 H;  4LF8 L;  2B3G A;  2CQY A;  1G29 1;  3BVM A;  1ZET A;  3KOJ A;  4HJ9 A;  2FK1 A;  4O42 A;  1E22 A;  4FDB A;  5E7N A;  4RGM A;  5EKK A;  2BH2 A;  1K1S A;  1B9N A;  3R23 A;  1IOW A;  1ONL A;  5C4X H;  1QZG A;  2W6Q A;  1FVI A;  2AGP A;  2DGY A;  1JIH A;  3RR5 A;  4UCU A;  1EQV A;  4HED A;  1HJP A;  1H9S B;  4XT1 B;  1F2L A;  1I6V C;  2A6H C;  2JA5 B;  1K83 B;  4LJZ C;  2F0V A;  5DLG A;  4JI0 H;  2OT2 A;  5HV6 A;  4IUQ A;  2VPS A;  2L55 A;  4QY7 A;  4C3H H;  4GOP A;  5F2D A;  2DPJ A;  2PN1 A;  2NVQ H;  4MTN A;  1ICW A;  4HNU A;  4DR5 Q;  3C46 A;  4YHH Q;  4MV7 A;  1STN A;  3KYH C;  4OIK A;  2PNH A;  3GTL H;  1QVC A;  2OF1 A;  4Z9C B;  2K5H A;  3T56 B;  2ZDG A;  2I0Q A;  5KIX A;  4ME3 A;  5FO7 B;  5IP7 H;  1QB5 D;  3H15 A;  4BBR H;  1N36 L;  4CJ0 B;  3HOZ B;  4MNO A;  3A5Z B;  4AYB B;  3DM1 A;  3PO2 G;  2K6A A;  3HOU H;  4IJH A;  4DV2 L;  1V1P A;  2Q2T A;  1HPC A;  2M9V A;  4YWL A;  1ZXT A;  2F1M A;  2UUB L;  3T1Y H;  4TV9 F;  1CSP A;  1H9J A;  1K3R A;  3RUP A;  1C3O A;  4N8F A;  2VS1 A;  2X0S A;  4BBS G;  1VMP A;  3GTO H;  3NBH B;  3K81 C;  5EOY A;  3NK9 A;  4A3F G;  4MTE A;  4KKT A;  2R82 A;  4L5R C;  2R85 A;  2M05 A;  3STB C;  1SRO A;  1HQR D;  2GPW A;  4NXM Q;  4BY1 G;  3KTM A;  3K7A H;  1XYI A;  2VQD A;  5BPF A;  3CCR A;  2F3I A;  3FKI A;  4K6L A;  2WB1 G;  2Z6K C;  3K3V A;  3AFQ A;  1STG A;  2OQ0 A;  1VQE A;  5CV5 A;  1IBM H;  3HOY G;  1SEI A;  1WTW A;  3JSN A;  1SYX B;  3TQT A;  4HNT A;  2BR0 A;  1SMX A;  4A3L H;  1RYS A;  1VQG A;  2L4N A;  5HY6 A;  3JAM c;  1A2T A;  1EY0 A;  4X64 Q;  3H6M A;  2Z6B A;  3MXG A;  1XMQ L;  2LMC B;  2B63 G;  4FS1 A;  2UXD H;  1STH A;  1SYC A;  4IOC A;  3K59 A;  4LFB Q;  3M85 A;  4QW9 A;  1AP0 A;  2R92 H;  4B3S H;  3X3N A;  4DR6 Q;  4ECZ A;  1GUG A;  4KY5 A;  1BNC A;  5FLM G;  1XMQ H;  2YV5 A;  4UCR A;  2DUD A;  3A55 A;  4JI4 L;  2RDI A;  5J3B A;  3TME A;  3G6E A;  4BY1 B;  2CVR A;  2RA4 A;  3T4A C;  1SFO A;  3R5F A;  3S9W A;  2B8F A;  4OIJ A;  1XNQ Q;  2UU9 H;  3TRZ A;  5LL6 b;  1EU4 A;  4HJ7 A;  1VQB A;  2WB1 B;  1TWC A;  1HTL D;  1S9F A;  3HZX A;  4B3T L;  4KTA A;  5LMN Q;  1VQH A;  3MAQ A;  3DHQ A;  5DLQ E;  5IGB A;  2B2V A;  4QUC A;  3HKZ B;  5GAE C;  1V1O A;  2YTV A;  2AKW B;  2RDJ A;  1E24 A;  1LT4 D;  2N3S A;  1W93 A;  4KHP Q;  4ALP A;  2EYF A;  3F2C A;  5IP9 G;  1CT1 D;  5C0X J;  4PV1 C;  3NWT A;  1MIU A;  1M7J A;  4A3M H;  4PZ6 A;  2XD4 A;  4JI7 Q;  4QWA A;  1B04 A;  4ECR A;  3G7L A;  3TDQ A;  2N8N A;  3K5M A;  2QEJ C;  3GTQ B;  2W6P A;  1E4F T;  1I4R A;  3J7Z C;  3HEJ A;  1GHK A;  2JA7 G;  3KDF A;  4NMZ A;  1WTV A;  2R7Z B;  4A3D G;  1N34 L;  4ECX A;  4FF3 A;  1MBY A;  4F4W A;  2QCP X;  2P5Z X;  2R7L A;  3RD4 A;  4HYK A;  1A8V A;  3FEW X;  1WTP A;  1Y1V A;  1U4L A;  3KLS X;  2K5V A;  4B3M Q;  3M4O B;  3RIZ A;  4RGO S;  1D5Z C;  1K8G A;  1D8L A;  2KBN A;  3GLK A;  1EZ1 A;  3FDT A;  2JEB I;  5IYD G;  1S68 A;  4DR5 H;  4EEQ A;  4YHH H;  1WTX A;  1HNX Q;  5KFO A;  4TKO B;  1RK5 A;  1E3P A;  1ZEQ X;  3TBI B;  3VYU A;  4ZAI A;  2IT1 A;  2OLS A;  3WOE A;  3TP7 A;  3I3C A;  4E6I A;  3RZO B;  4G7Z C;  3PSI A;  1R9T A;  4HCS A;  1S5E D;  4X65 L;  3W1B A;  3GQB A;  3M9O B;  5FLX W;  2NVX A;  5DG9 A;  2D5D A;  1B9M A;  1I50 A;  3MZ5 A;  5JJZ A;  3K7U C;  5KG1 A;  3D4R A;  4XYO A;  5C0X G;  3I73 A;  4C2M B;  1CM9 A;  1K1Q A;  1AZQ A;  1IBL L;  3AU7 A;  2F0O A;  1BR9 A;  4JK1 C;  2DNC A;  1RD9 D;  2F52 A;  4HTH A;  2OTJ A;  2KCN A;  3RBE A;  1I3Q B;  3WWV A;  4IUR A;  1AUX A;  2C9O A;  3D4W A;  3GD7 A;  3CMA A;  1BVS A;  1EWC A;  1JMC A;  2TMP A;  3JAM L;  2B2Y A;  4A3J H;  3ONA B;  4JUZ A;  3W3A A;  3R5X A;  1JE4 A;  1I4G A;  2JEA I;  1V9P A;  4K8J A;  2VR1 A;  4DR7 L;  1BXT A;  2KHS A;  1SYG A;  1IW7 C;  2R8H A;  3RJ0 A;  1FD7 D;  3BZC A;  5KFE A;  1SR3 A;  5KFL A;  1DM0 B;  4A3B B;  2MGS A;  3Q8P B;  4JI5 L;  3LGJ A;  4EQ5 A;  4HN7 A;  4C3I B;  1TT2 A;  3VR3 A;  2UVU A;  4X64 H;  1BGW A;  1S5B D;  1A2U A;  2DY8 A;  2RCF A;  4RAZ A;  1V51 A;  3FMA A;  3RZD H;  4LFB H;  3KF8 A;  2LFN A;  3H0G G;  5I2X A;  3RLO A;  4DR6 H;  4LF4 L;  4A3G H;  4DV1 L;  2RGR A;  3X3M A;  1WTQ A;  1VCI A;  4Q0F A;  3RN5 A;  4RH6 A;  1M0W A;  4ECT A;  5JEA J;  3STB D;  4DL4 A;  1LTB D;  2PCF B;  4DV7 L;  2JEI A;  4TQR A;  2YZG A;  1YZ6 A; 
#chains in the Genus database with same CATH homology
 4A75 A;  5M5W H;  3HFZ B;  1EQQ A;  4LNQ A;  1GKH A;  1KL9 A;  2UU9 L;  1E1T A;  2WAQ G;  4UP7 A;  4DKA C;  4GNX B;  1TWA H;  3TS0 A;  4LUV A;  1N8R C;  3KF8 B;  2PI2 E;  4BBS H;  1N36 Q;  1J5E Q;  4B3R Q;  4A3F H;  1CKN B;  1EYG A;  2E5L Q;  1B70 B;  3PO3 H;  3OTO L;  1YIT A;  4DV2 Q;  2NVT H;  2D0P A;  1YVC A;  4R4Q A;  2MFI A;  2UUB Q;  3CPF A;  2K4K A;  5GRO A;  2UUA Q;  4YCU A;  2R7Z G;  1PVO A;  2EIF A;  1VQ5 A;  1JJC B;  4OWW B;  2UXC L;  1JJ2 A;  4JI2 Q;  1KHI A;  4QL5 A;  1IBK L;  3I4M G;  3HOY H;  3FP9 A;  2CCZ A;  1NY4 A;  3CC2 A;  4A3M G;  1CKM A;  2OQK A;  3CD6 A;  4WJ4 A;  3CCQ A;  1LYL A;  2B63 H;  3ZJY C;  4P75 A;  1CKO A;  3AQQ A;  4EX5 A;  3GTK H;  2KHJ A;  3G71 A;  3KJP A;  1V43 A;  3CCL A;  2JA8 H;  3GTP H;  1WCM H;  4TVA B;  1SFO H;  4A93 G;  1B8A A;  3JC6 6;  4DV3 Q;  1FL0 A;  2AHO B;  3BJU A;  3UDF A;  4DR3 Q;  4LF7 Q;  4OON A;  3PUX A;  3I4N G;  2R7F A;  4LFA L;  2I5L X;  2JJQ A;  1Y1V G;  4NXN L;  1XMQ Q;  1B7Y B;  1L1O C;  4UPA A;  3ERS X;  4JI3 Q;  2GVB A;  2RF4 A;  2NVY H;  1GD7 A;  1Z47 A;  1M90 C;  1XPU A;  4GKK L;  5C4X G;  2YU9 H;  2EQS A;  4JI1 L;  4R4O A;  4OWX B;  4DR5 L;  1G51 A;  5M3M G;  3J81 j;  4YHH L;  3GTJ H;  3HOV H;  2ZTC A;  3SGI A;  3PV0 A;  1OTC A;  5JJI A;  1KRT A;  4GS3 A;  3M4O H;  4A3C H;  1NMF A;  4JI4 Q;  3KLW A;  3OTO Q;  4A3I H;  4GKJ L;  2UXB Q;  4IJL A;  4HJA A;  1UE5 A;  2CWA A;  1L1O A;  5LMU Q;  4WJ3 M;  1HZA A;  1ASY A;  5IYB H;  3F2B A;  4IPD A;  5M5X H;  5IP9 H;  5M3F H;  1EIY B;  2IHE A;  3M4Q A;  1VQO A;  1K83 H;  3K80 C;  2JA5 H;  4B3T Q;  3S1N H;  2UXC Q;  4YY3 Q;  4QGU A;  4IFD I;  4DK6 C;  1PH7 A;  4GN4 B;  1X3F A;  1SE8 A;  5BR8 L;  2PI2 A;  1UEB A;  2CWP A;  3T1H Q;  3ULP A;  4LWC A;  1TXY A;  1M1K C;  1P8L A;  1K73 C;  3CC4 A;  1A62 A;  3CPW A;  1T9H A;  1YJ9 A;  4DUZ Q;  1OXU A;  4A3B G;  4NPS A;  2E2H H;  1C9O A;  1VS0 A;  5IP7 G;  4X6A H;  2JA7 H;  1O7I A;  4A3D H;  4BBR G;  2MNA A;  1L1O B;  4POF A;  3HOX H;  2XGT A;  1QVG A;  2AMC B;  2A1A A;  1FJG Q;  2RCN A;  3S15 H;  1IYJ B;  3F1Z A;  1N9W A;  2Q2H A;  2JA6 G;  1XTD A;  3PF4 A;  2JE6 I;  4YCV A;  3TRE A;  2Z0S A;  5FJ8 G;  4LFC L;  3S2H H;  3CCU A;  1W2B A;  1OXV A;  4OO1 G;  1VQJ A;  5IYC G;  2MO0 A;  3HOZ H;  1EUJ A;  2NZO A;  1N34 Q;  3UDI A;  1VQ8 A;  4IPC A;  1P16 A;  1WFQ A;  3U4V A;  2BA1 A;  1L2F A;  5GAD C;  4R4T A;  1YHQ A;  4LF6 L;  4L5T A;  3ICE A;  5ELO A;  1Y1W H;  4JI0 Q;  2HT1 A;  1JE5 A;  3RLF A;  4X64 L;  1S72 A;  2VL6 A;  2NN6 I;  3A5U A;  1PFS A;  4A3K G;  1XJV A;  1Y14 B;  4KHZ A;  3IRB A;  4PZ7 A;  4LF9 Q;  4BY7 H;  4LFB L;  1IL2 A;  4UP9 A;  2FXQ A;  2PQA A;  4LF5 Q;  4X66 L;  3DLL A;  3S24 A;  5C0X I;  4DR1 Q;  3GTM H;  4DR6 L;  4JI8 Q;  4DV6 Q;  1XNR L;  4DAY B;  4LW1 A;  5EAY A;  5IY0 A;  3HOW H;  1I94 L;  3ULJ A;  1D7Q A;  1BBW A;  2UUC Q;  4A3L G;  4AQY Q;  1X3G A;  1KC8 C;  2VQE L;  4YWK A;  1I5F A;  4BA1 I;  2H5X A;  4GN3 B;  4R4I A;  4QJF A;  4X65 Q;  3M7N A;  4OWT B;  1I6H H;  2F4V L;  1HNW L;  2WFW A;  2B29 A;  1VQA A;  2V1C C;  4JBJ A;  4P74 A;  4C3J H;  3E9I A;  4H02 A;  3CC7 A;  5LMN L;  1XPR A;  1A63 A;  3F8T A;  1MJE A;  2Y0S E;  2PQA B;  3H3V I;  4BXX H;  1IBL Q;  1ASZ A;  4YCW A;  1PH4 A;  2I5H A;  2HIX A;  3RLN A;  1NE3 A;  1Q46 A;  3G48 A;  3MEF A;  4HJ5 A;  1Q1E A;  2LSS A;  2VQF Q;  3T1Y Q;  2UUA L;  4KHP L;  2K5N A;  3CW2 C;  3FKI H;  1N33 Q;  4PG3 A;  5LMN W;  4JI6 L;  3L7Z C;  1MJC A;  4DPG A;  1FGU A;  2NZH A;  3JAM i;  1JB7 A;  1C7Y A;  4K0K L;  2VUM H;  1HR0 L;  3OYY A;  1OXT A;  1EOV A;  4BY1 H;  4JI7 L;  2CFM A;  4DR7 Q;  1YEZ A;  3NEN A;  4GLA C;  4A76 A;  2N78 A;  1BBU A;  1HNZ Q;  3H0G H;  4IOA A;  2LXK A;  2K50 A;  3PCO B;  3D0F A;  2ATW A;  1KAW A;  2YTX A;  4A3E H;  4DUY L;  1EWI A;  1IBM Q;  1HR0 W;  4JI5 Q;  4X62 L;  4IPH A;  2ASB A;  1N33 L;  1L0W A;  2ZM6 L;  4B3M L;  4JCV E;  4JOI C;  4JV5 L;  5C3E H;  2UXD Q;  3I2Z A;  1VQD A;  4NB3 A;  3F2D A;  1NJI C;  3D31 A;  4LUO A;  5AJ3 L;  4LF4 Q;  4HIO A;  2R7D A;  1HNX L;  4B3S Q;  4JYA L;  4DV1 Q;  3M9B A;  5FLM H;  1TWC H;  1K9M C;  1EIF A;  1XMO L;  1YIJ A;  4O2D A;  3AEV A;  1HZC A;  3CXC A;  4DR2 L;  1QVF A;  4TQU S;  2OCE A;  2I5M X;  3GTQ H;  1PYB A;  4A3I G;  2PMZ E;  4JOI A;  4LUZ A;  4DV7 Q;  1Q1B A;  4APV A;  2R7Z H;  2BA0 A;  2Q2I A;  2Y0S G;  3I55 A;  1Z9F A;  1PH8 A;  3AFP A;  2UU9 Q;  5IYB G;  1SLJ A;  1N32 L;  4JC0 A;  2YTY A;  3MXN B;  3U4Z A;  4AH6 A;  3E0E A;  1LM0 A;  4DV5 L;  5C44 G;  4RMF A;  1PH2 A;  3S1Q H;  3CQZ H;  4IO9 A;  4JI6 Q;  3PUV A;  2IX0 A;  4HIK A;  3UDG A;  1X9N A;  4K0K Q;  3TQY A;  2R6G A;  4P73 A;  4PZ8 A;  1NTG A;  1RL2 A;  4HID A;  2GN5 A;  3L0O A;  4MZ9 A;  4JBK A;  5JJL A;  1HZ9 A;  4DNI A;  5IWA L;  1IBK Q;  3PUY A;  3RZO H;  4A93 H;  4LF8 L;  2B3G A;  4DV0 L;  1G29 1;  4DUY Q;  3KOJ A;  4HJ9 A;  5ELN A;  3CCE A;  1E22 A;  4GOP C;  4FDB A;  1Q82 C;  4DAM A;  1Y1V H;  5E7N A;  1VQM A;  1CSQ A;  1LUZ A;  2BH2 A;  3RNU A;  3S2D H;  1EFW A;  5C4X H;  1QZG A;  1UE6 A;  4Y7N H;  4UY8 C;  1WJJ A;  1PH6 A;  1FVI A;  4OX9 L;  2DGY A;  4DR4 L;  4XIG S;  4C2M H;  1X55 A;  3RR5 A;  5JJK A;  1HJP A;  5HGQ A;  5M3M H;  4A3J G;  1K8A C;  4L5S A;  4NXM L;  4LFA Q;  2A8V A;  4NXN Q;  4QY7 A;  1RIP A;  4DV4 L;  1I3Q H;  4C3H H;  4GOP A;  1Y1W G;  1R9T H;  1X6O A;  3W5O A;  5GAG C;  3J7A 5;  5IYD H;  1VQC A;  1SN8 A;  4GKK Q;  2NVQ H;  4JI1 Q;  1Q86 C;  1LTL A;  4MTN A;  2ZJP A;  4BY7 G;  2QGQ A;  4DR5 Q;  3BZK A;  4YHH Q;  2NVX H;  1I50 H;  3TS2 A;  1X56 A;  2QEX A;  3J81 i;  3KYH C;  1OXX K;  2HHH L;  2ES2 A;  2PNH A;  3GTL H;  3S1R H;  4GKJ Q;  1QVC A;  1V1Q A;  3A74 A;  1PHJ A;  3I4O A;  2K5H A;  1YJN A;  4HIM A;  3CME A;  2I0Q A;  1KIX A;  4A3B H;  4A3G G;  2RHQ B;  4ME3 A;  5IP7 H;  4C3I H;  1UE1 A;  4GOP B;  3H15 A;  2R93 G;  4BBR H;  1N36 L;  1PH5 A;  1Q8K A;  2E8G A;  3A5Z B;  2YYZ A;  4MNO A;  1J5E L;  4B3R L;  4R4C A;  2E5L L;  2K52 A;  5BR8 Q;  3PO2 G;  3HOU H;  4IJH A;  2K14 A;  4DV2 L;  1GO3 E;  2KEN A;  2Q2T A;  2D62 A;  4JBW A;  4YWL A;  3RN2 A;  2UUB L;  1X54 A;  5FJ8 H;  2IX1 A;  3CAM A;  4OO1 I;  3KJO A;  1XNQ L;  2VNU D;  1JJG A;  2ALY B;  1CSP A;  1K3R A;  4GLV B;  1U0L A;  5IYC H;  3M3Y H;  3J80 i;  2VS1 A;  4DR4 Q;  4JI2 L;  4BBS G;  3GTO H;  4HJ8 A;  3NBH B;  3BU2 A;  3K81 C;  4A3F G;  1QZH A;  3PO3 G;  4L5R C;  2IY5 B;  3GO5 A;  3STB C;  1SRO A;  2IHF A;  2VZA A;  4BY1 G;  4NXM Q;  3K7A H;  2KCM A;  4A3K H;  1VQ4 A;  4LFC Q;  4P71 A;  3CCR A;  2F3I A;  1KXL A;  2WB1 G;  2Z6K C;  1HH2 P;  3AFQ A;  2OQ0 A;  3ER0 A;  4L5Q A;  1EQR A;  1VQE A;  1VQ9 A;  3HOY G;  3KFU A;  5GAH C;  4LF7 L;  4A3E G;  4LF6 Q;  3PUZ A;  1SMX A;  4A3L H;  3FHW A;  1OXS C;  1VQG A;  1IZ6 A;  1YHB A;  3EIV A;  5HY6 A;  3UDX A;  3JAM c;  4X64 Q;  2B63 G;  3A0J A;  1XMQ L;  2MQH A;  1VQF A;  1Q12 A;  3GDE A;  4JI3 L;  1XPO A;  4P72 A;  5C3E G;  4IOC A;  5M5Y H;  2HIV A;  3M85 A;  3UE0 A;  4LFB Q;  1Q7Y C;  3NEM A;  2R92 H;  1TWH H;  4DR6 Q;  4X66 Q;  2JA8 G;  2VY3 A;  1WCM G;  2Z6K A;  1XNR Q;  2XTI A;  2KHI A;  2MO1 A;  1I94 Q;  5FLM G;  5H1S E;  2YV5 A;  4AYB E;  2DUD A;  2VQE Q;  4JI4 L;  1Q81 C;  2UXB L;  5J3B A;  4Y52 H;  1WYD A;  3G6E A;  3E9H A;  4PMW A;  5LMU L;  2E2I H;  1XNQ Q;  3CP0 A;  2F4V Q;  3S14 H;  3TRZ A;  2QA4 A;  4J15 A;  1HNW Q;  4HJ7 A;  2L15 A;  1VQB A;  5IT9 c;  4B3T L;  4YY3 L;  4GN5 A;  5LMN Q;  1VQH A;  5DLQ E;  4A3C G;  4KI0 A;  3T1H L;  3Q8D A;  1YJW A;  2HQL A;  3S17 H;  5GAE C;  2YTV A;  1U5K A;  2AKW B;  1PH9 A;  1E24 A;  2N3S A;  4DUZ L;  4KHP Q;  4ALP A;  1AE3 A;  2AWO A;  4UP8 A;  2C35 B;  3EBE A;  5M3F G;  3F2C A;  5IP9 G;  1CUK A;  3B6Y A;  5C0X J;  1E1O A;  2CQO A;  3I4M H;  2JA5 G;  1MIU A;  1TWF H;  4XTC S;  4A3M H;  4R1J A;  1FJG L;  1JT8 A;  1K0R A;  4PZ6 A;  4IFD G;  1PYS B;  4IPG A;  1HR0 Q;  4JI7 Q;  3KF6 A;  1IXR A;  1H95 A;  3I7F A;  2ZTD A;  3AYH B;  3S1M H;  5GQO A;  2N8N A;  1DGS A;  2EXD A;  5JEA G;  3J7Z C;  2ID0 A;  3ULL A;  2JA7 G;  3KDF A;  2VW9 A;  4A3D G;  1VQ7 A;  1G6P A;  1N34 L;  1X65 A;  3HOX G;  1VQ6 A;  1YHA A;  1VQL A;  4KLK A;  3I4N H;  4X62 Q;  4DK3 C;  1A8V A;  1J6Q A;  1YBY A;  3K0X A;  1UWV A;  3PGZ A;  2N49 A;  2ZM6 Q;  2K5V A;  4B3M Q;  2ZJQ A;  3OW2 A;  4JI0 L;  4A4I A;  4JV5 Q;  1VQP A;  1K8G A;  1D8L A;  2KBN A;  4LF9 L;  3G4S A;  2CKZ B;  2JEB I;  5IYD G;  3HOZ G;  5AJ3 Q;  3KF6 B;  4AYB G;  2WP8 J;  4LF5 L;  4DR1 L;  1AH9 A;  1HNX Q;  4JYA Q;  4JI8 L;  3CCV A;  3PIO A;  4DV6 L;  1E3P A;  1E7Z A;  3K8A A;  1XMO Q;  2WB1 E;  5C44 H;  2UUC L;  3L2P A;  1KRS A;  2IT1 A;  3KDF B;  4AQY L;  4QIW E;  3UE1 A;  3PSI A;  2JA9 A;  4DR2 Q;  1HZB A;  2OTL A;  1GVP A;  2Q2U A;  3U58 A;  4X65 L;  3M4P A;  1VQK A;  3TEH B;  1BKB A;  2NN6 G;  3W1B A;  3HKZ E;  3HKS A;  3W1G A;  5K36 G;  2ZTE A;  1N32 Q;  3K7U C;  3U50 C;  4QQB X;  2GVA A;  5C0X G;  3HOW G;  4DV5 Q;  1YNX A;  2JQO A;  2KCT A;  1VQN A;  1IBL L;  2WAQ E;  3J81 c;  3HOU G;  2F52 A;  2A19 A;  3CCJ A;  2OTJ A;  2VQF L;  1TWG H;  2ZJR A;  4GLX A;  4O0A A;  3WWV A;  1QUQ A;  3T1Y L;  1PH3 A;  3GD7 A;  4AIM A;  1BVS A;  3CMA A;  3CF5 A;  1MKH A;  5IWA Q;  3CCM A;  1KQS A;  1JMC A;  2E2J H;  3HOV G;  3H3V H;  4A3J H;  1PA6 A;  4LF8 Q;  3EN2 A;  2JK8 A;  5FLX c;  4DV0 Q;  1C0A A;  1NMG A;  3PIP A;  3I56 A;  1V9P A;  1WI5 A;  4GNX C;  4YWM A;  1YI2 A;  2JA6 H;  2JEA I;  4BXX G;  1S40 A;  1KD1 C;  4DR7 L;  2OWO A;  3S16 H;  3PF5 A;  1HNZ L;  3GTG H;  2AWN A;  4POG A;  1S3O A;  1A0I A;  5C4J H;  4OX9 Q;  3BZC A;  3FKI G;  1SR3 A;  1X3E A;  1WOC A;  4OXP A;  3J80 c;  1IBM L;  4JI5 L;  3LGJ A;  4EQ5 A;  1QUQ B;  3NEL A;  2VUM G;  2RHS B;  1PH1 A;  2BH8 A;  4DV4 Q;  4GNX A;  1UE7 A;  2UXD L;  3RZD H;  3H0G G;  4BA2 I;  3RLO A;  4JBM A;  3PUW A;  1CKN A;  2K75 A;  5IE8 A;  4LF4 L;  4A3G H;  3DM3 A;  4B3S L;  1W3S A;  2R92 G;  4IFD J;  4DV3 L;  2R93 H;  4DV1 L;  4DR3 L;  4JG2 A;  1VCI A;  3RN5 A;  3HKZ G;  3CCS A;  3VDY A;  1PV4 A;  1SRU A;  2HHH Q;  3PO2 H;  1AE2 A;  5JEA J;  1GM5 A;  3STB D;  1VQI A;  1NBW A;  2LXJ A;  4DV7 L;  4RG1 A;  1YZ6 A;  2D0O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...