2RF4A

Crystal structure of the rna polymerase i subcomplex a14/43
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
192
structure length
174
Chain Sequence
KQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDGNSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase I subunit RPA4
publication title Functional architecture of RNA polymerase I.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 23
structure length 174
sequence length 192
chains with identical sequence C, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
A PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2rf4A02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2rf4A01
1E3PA 2I5HA 2NVXH 3CC4A 1FJGL 1PHJA 3PUVA 2XTIA 5GAHC 3KFUA 2JA9A 3TRZA 4HIOA 2RHSB 2VW9A 1XNQQ 3GTMH 1VQJA 1W2BA 4BXXH 2JA7H 3CCSA 3HOUH 3CXCA 2N78A 4B3TQ 2YU9H 3J81j 1YHBA 2JA8G 2BH2A 3K0XA 4P75A 5LMNL 4BBSH 4QIWE 2LSSA 2MNAA 3CCMA 3FKIG 3HKZE 3OTOQ 2UUCQ 3EIVA 4A93H 2MQHA 4OWWB 5GAEC 3OTOL 2UUCL 4KI0A 2DUDA 5C4XH 4LNQA 4A3LG 3CC2A 3S1NH 1VQ8A 2Z6KC 2K4KA 2K5VA 4DV3Q 3K80C 4YCVA 2HHHQ 4JBMA 1HJPA 4JI0Q 4L5SA 1NY4A 4B3RQ 1D7QA 1QVGA 2HHHL 4JI0L 1SLJA 2R92G 2PQAA 2AWNA 4JI1Q 1E1OA 1KD1C 4PZ8A 4DK6C 4JI1L 1PA6A 4O2DA 4IO9A 2OQ0A 1VQDA 1HNXQ 1JE5A 1PH3A 3DLLA 4C3IH 2E8GA 4DUZQ 4A3JG 1HNXL 2CCZA 2BA0A 2ALYB 2LXJA 4DUZL 2HQLA 3CCQA 4A3FG 4LFBQ 3H15A 5E7NA 3E9HA 4GOPC 3RNUA 2R7ZH 4LFBL 3U50C 4JBWA 3M4QA 1KRTA 1EIYB 4C3HH 1KC8C 3I4MH 2EIFA 2Q2TA 5JEAG 4ME3A 3T1HQ 1WCMG 3T1HL 1PFSA 4OO1I 3CP0A 2JEAI 3CMEA 3HOYG 1UE1A 4GLXA 2ZJQA 4O0AA 1KRSA 1WOCA 2RF4A 4IOCA 1XJVA 2IHFA 4RG1A 5GROA 5FLMG 4HJ7A 1XMOQ 1S40A 3HOWG 4DR7Q 4UP7A 4BA1I 1TWCH 1V9PA 4X62Q 1XMOL 2KCTA 3NBHB 4APVA 5IP9H 1EOVA 4AQYQ 4DR7L 5DLQE 1YHAA 4AQYL 1A62A 4IPGA 3CCRA 1M90C 3H3VI 1QZHA 1Q1EA 1CKNA 4P74A 3G4SA 4JI4Q 4OWXB 2PQAB 4GKKQ 3CPWA 4JI4L 1YHQA 2UXDQ 4JG2A 4GKKL 4MTNA 1FJGQ 3A0JA 3BJUA 2UXDL 4OX9Q 1P8LA 1I3QH 4OX9L 1H95A 1YBYA 2D62A 4IJLA 4HIKA 2Y0SE 2ZTDA 3VDYA 1O7IA 1SROA 1CKOA 5JJLA 1CSPA 2K14A 3L2PA 3ERSX 3E0EA 2C35B 2YTVA 4J15A 4QGUA 2YYZA 4K0KL 4DR5L 3CD6A 4DAYB 4LF5Q 3S2DH 4A3BG 1OXTA 1J5EQ 1TWAH 5ELNA 1NMGA 2YV5A 3RN2A 4LF5L 1J5EL 3FHWA 2R7FA 4OONA 1UE7A 1VQ6A 1C9OA 3CMAA 1YJNA 3OYYA 1XNRQ 5BR8Q 2VZAA 2JA8H 4AYBG 1XNRL 3F2BA 2OCEA 1PV4A 5BR8L 5JJIA 4JOIC 4IFDJ 2L15A 1WJJA 3F1ZA 3FKIH 4TQUS 2EXDA 4X6AH 4GLAC 3STBD 1GKHA 3JC66 1AE2A 3ICEA 1CKNB 2WP8J 2IHEA 4A3LH 3ZJYC 4JI2Q 3STBC 4IFDI 4JV5Q 1M1KC 2UXBQ 3PO2G 5JJKA 4LWCA 1HR0L 4JI2L 3KJPA 1NE3A 1VQFA 1EYGA 4DR6Q 4DR3Q 2R92H 1OXUA 4HIMA 1JB7A 4NXNQ 1CUKA 2GVBA 2RHQB 3ER0A 4DR3L 4NXNL 4MZ9A 1YZ6A 2GVAA 3CQZH 5C3EG 1Q82C 3RN5A 1EWIA 4DV7Q 1YIJA 2V1CC 1A0IA 4BA2I 1BKBA 5H1SE 1MJCA 4A3JH 5C4JH 2ZTCA 3KLWA 4XTCS 2A19A 5IY0A 1PH9A 3HOVG 4A3DG 4A3FH 1N9WA 2AMCB 3U4ZA 3M4OH 5IE8A 1JMCA 1VQAA 4DV0L 3HFZB 2K75A 1SR3A 3M85A 4GKJL 2R93G 1QUQA 1HH2P 3UE1A 4L5RC 2LXKA 4DV1L 4BY1G 1L2FA 1E24A 4AH6A 5IYBG 3GTQH 1KAWA 1WCMH 4X66Q 3HOYH 3OW2A 5LMNQ 1LTLA 4X66L 5FLMH 1UE5A 3U58A 1I5FA 3HOWH 2UXCQ 3M4PA 1C0AA 3TS2A 1QVFA 4KHZA 3RZDH 1N36Q 4MNOA 2UXCL 3L7ZC 1OTCA 3WWVA 4JBKA 3J7A5 2BA1A 4TVAB 3I4OA 1N36L 2E5LQ 1YJ9A 1VQLA 1G6PA 2YTXA 1HZ9A 1XMQQ 2E5LL 3NEMA 4JI8L 2E2JH 2VUMG 1MIUA 1VCIA 2NN6G 3CCJA 3CCUA 1XMQL 4LF9Q 2BH8A 5M5WH 4IPHA 1HNWQ 3DM3A 4GN5A 3W5OA 1X9NA 4LF9L 1HNWL 1K3RA 2N8NA 1I94Q 4JI5Q 2UU9Q 4IPDA 1I94L 1X54A 4JI5L 1JJ2A 1QVCA 2MO1A 5IYDG 2UU9L 4A3EG 1K8GA 1TWGH 4WJ3M 5K36G 1OXSC 1HZAA 5ELOA 4LF6L 3G6EA 4LUZA 5C0XJ 1QUQB 4HJ9A 4UP8A 5M3MG 1CSQA 2K5HA 4P73A 4X65Q 4A3BH 5IT9c 2E2HH 1KXLA 4X65L 3HOZG 1X65A 4DV4Q 3S1RH 3MXNB 2JA6G 3D31A 5C0XI 3UDIA 5M3FG 3AFPA 4NXMQ 4DV4L 1PH1A 1KQSA 2Q2UA 1HZCA 4KHPQ 1VQ4A 4QJFA 3RLOA 1ASYA 1VQ5A 4NXML 4LF7Q 4KHPL 2CFMA 5GAGC 4HJAA 1N33L 4LF7L 5EAYA 2B3GA 1WYDA 1Y1VG 2NZHA 3K8AA 5LMUL 1E1TA 3HOXG 3AEVA 2CWAA 1DGSA 1PH4A 4PZ7A 1IBKQ 1TWHH 1IBKL 3PO2H 3A74A 4GNXA 1Q1BA 4DV6Q 2Q2IA 1QZGA 2N3SA 4DV6L 1X3GA 5HGQA 1YVCA 3S24A 1GD7A 3Q8DA 4RMFA 2OWOA 3F2DA 1RL2A 3K7UC 3KF8B 4LF8Q 2I0QA 3HKSA 5C3EH 1PH5A 3PGZA 4LF8L 1Q86C 4YY3Q 2OTLA 3W1BA 1VQ9A 2GN5A 4GLVB 4PMWA 4YY3L 4JI6Q 4BY7G 1BBUA 1TXYA 3PF4A 1S3OA 3HOVH 3PO3G 5FJ8G 2AKWB 3KJOA 4JI6L 2VL6A 4A3DH 4JI3Q 2WAQE 1YJWA 4DR5Q 4K0KQ 1X3EA 2F3IA 4JI3L 5FLXc 3BU2A 2R93H 1XPUA 4P71A 2UUBL 2HT1A 1UEBA 4POGA 3B6YA 3S17H 2VS1A 4LFAQ 3EBEA 3ULJA 4BY1H 1EQRA 5IYBH 4A3IG 2ZM6Q 4LFAL 2NVQH 1WFQA 4JYAQ 1I6HH 5LMNW 2ZM6L 3GTKH 1L1OA 4EX5A 1B70B 1HZBA 2PNHA 4JYAL 1B7YB 1OXXK 2JK8A 5HY6A 3S2HH 1LUZA 4UPAA 4A3GG 1SRUA 4LW1A 1WI5A 4GNXB 3HKZG 2QGQA 2PI2A 3KDFA 3K81C 2OQKA 5IP7G 1HR0Q 1VQKA 2VUMH 4IOAA 1PH6A 5JEAJ 1IBMQ 4X64L 4A93G 4BBRG 1EIFA 5GADC 1IBML 4R1JA 4DR1Q 1K9MC 4FDBA 3RLNA 4DR1L 1FGUA 1FVIA 1P16A 4YWMA 3BZCA 2JA5G 1U0LA 3CCLA 1L0WA 1EUJA 3J81i 3UDGA 5IYDH 2VQFL 4A3EH 4A3MG 4NPSA 3PIPA 4WJ4A 3S16H 1V1QA 1PVOA 2OTJA 4A75A 4R4TA 5M3MH 1SE8A 4DV0Q 1MJEA 1C7YA 4GKJQ 3PUXA 4LF4Q 4GS3A 3PV0A 4PG3A 1YNXA 3EN2A 4YCUA 2F4VQ 3HOZH 3S1MH 4JV5L 2JA6H 4LF4L 4DUYQ 3UE0A 1L1OB 3G71A 4DV1Q 1Q8KA 4JC0A 4DKAC 2DGYA 5M3FH 1Y1WG 2KENA 4DUYL 1SFOH 2F4VL 3FP9A 4H02A 4YCWA 3M7NA 4GN4B 3NELA 4GOPA 4OO1G 1VQOA 1A8VA 4POFA 2K50A 1NBWA 3G48A 2VNUD 1SMXA 3F8TA 1BVSA 1Y1VH 3KDFB 4DV2L 1X55A 3HOXH 2JQOA 2MO0A 2NZOA 1K8AC 3LGJA 3CPFA 4JI8Q 3JAMi 4HJ5A 3CC7A 1NMFA 4DNIA 2IX1A 1JJGA 2D0OA 1BBWA 1VQ7A 1JT8A 2H5XA 4DR2Q 2JEBI 4C3JH 3T1YQ 4UY8C 4B3MQ 3GTOH 2IY5B 1G291 2VY3A 4OWTB 4DR2L 3CCVA 3T1YL 4YWLA 4B3ML 2B63G 5J3BA 4A3KG 3W1GA 2N49A 1XNQL 1VQEA 3GTGH 1A63A 4UP9A 2WB1E 4C2MH 3UDXA 4BY7H 2A1AA 1N8RC 4YWKA 3RLFA 4AYBE 1IBLQ 4LF6Q 2Y0SG 4B3TL 5FJ8H 3PO3H 4A3CG 1VQIA 3ULLA 1IBLL 2WAQG 3TEHB 1AH9A 1J6QA 1UWVA 1JJCB 4JCVE 5M5YH 1KHIA 2KBNA 1KL9A 1X56A 2NVYH 3I55A 1IL2A 1K83H 3GDEA 5M5XH 4GOPB 4A3IH 3F2CA 3AYHB 1PYSB 2CQOA 4IPCA 3GO5A 1IXRA 4DV3L 1EQQA 3I4NG 2F52A 4B3RL 3I7FA 4R4QA 3CW2C 2Q2HA 5C44G 1Y14B 1N33Q 3GD7A 3GTLH 2FXQA 4LUOA 4A3GH 2I5LX 1YEZA 5LMUQ 4JI7Q 2RCNA 3H0GG 4DPGA 1OXVA 4JI7L 2B29A 1R9TH 5IYCG 2ZJPA 4AIMA 3MEFA 4QY7A 5GQOA 1KIXA 1Q46A 5IP7H 1HR0W 4IFDG 4JOIA 1N32Q 1PH8A 1T9HA 2R6GA 2YTYA 3UDFA 1GO3E 2I5MX 4BBRH 3KOJA 1FL0A 3PUZA 4DK3C 3PCOB 1N32L 1TWFH 4YHHQ 3KF6A 1U5KA 3RR5A 2JA5H 2UUAQ 2WFWA 4LUVA 4YHHL 3CF5A 4QL5A 3PUWA 4DV5Q 4HIDA 1ASZA 1Q7YC 2ZJRA 3IRBA 2D0PA 1K73C 1VQPA 4A3MH 2UUAL 4DV5L 1IZ6A 4BXXG 2CWPA 2KHIA 5IWAQ 3TS0A 1Z9FA 2JA7G 3HOUG 4OXPA 4NB3A 5IWAL 3J80c 4BBSG 3BZKA 4B3SQ 1E22A 4A76A 1K0RA 3K7AH 3SGIA 1VQHA 2UUBQ 4B3SL 4X62L 4JBJA 2PMZE 3ULPA 1B8AA 3TREA 4R4IA 1Y1WH 1VQGA 3GTJH 2K5NA 5C4XG 2KCMA 2JJQA 2NN6I 2IT1A 2EQSA 2AWOA 3NENA 3J81c 1PH2A 1NTGA 4L5TA 3J7ZC 4QQBX 1XPOA 1XPRA 1VQMA 2ES2A 3GTPH 4Y52H 1X3FA 3S15H 3U4VA 4GN3B 1GM5A 3CAMA 1Z47A 4P72A 3S1QH 1IYJB 2PI2E 2K52A 4HJ8A 3H3VH 3J80i 1LYLA 3PSIA 3A5ZB 1UE6A 1Q12A 3KF6B 1D8LA 4X64Q 1PYBA 4A4IA 2VQEQ 4EQ5A 3AFQA 4ALPA 1GVPA 3D0FA 2VQEL 2R7ZG 2ASBA 3E9IA 3L0OA 2B63H 1VQNA 2A8VA 4A3KH 1VQBA 2VQFQ 3PF5A 3I4MG 2ZTEA 2Z6KA 2WB1G 4DAMA 1I50H 4A3CH 1VQCA 1RIPA 4PZ6A 2AHOB 2HIVA 3PIOA 3CCEA 4GNXC 1EFWA 4LFCQ 1YITA 3JAMc 4LFCL 1VS0A 3I2ZA 1AE3A 2Z0SA 5AJ3Q 3I56A 3RZOH 2JE6I 4Y7NH 1Q81C 3S14H 5IP9G 1G51A 1SN8A 5AJ3L 2QEXA 2ID0A 3PUYA 5C0XG 1E7ZA 3A5UA 2UXBL 3I4NH 2QA4A 1MKHA 1X6OA 1NJIC 4KLKA 1YI2A 5C44H 2ATWA 4DR4Q 4DR6L 1XTDA 1S72A 2CKZB 4DV2Q 2IX0A 2XGTA 2NVTH 2KHJA 1HNZQ 4DR4L 3AQQA 1CKMA 3H0GH 4R4OA 1HNZL 2MFIA 1N34Q 5IYCH 4DV7L 3KYHC 3TQYA 1LM0A 1N34L 2E2IH 4L5QA 1PH7A 1V43A 4R4CA 4IJHA 3M3YH 2R7DA 4XIGS 1W3SA 2HIXA 3M9BA 1L1OC
chains in the Genus database with same CATH superfamily
2NVYA 1K83A 1FJGL 4JI4H 1PHJA 3ORQA 1PFBA 1RK6A 3TRZA 4HIOA 1SYEA 1NAPA 1VQJA 1DIKA 1KTKA 2GA4B 1XDNA 2JA7H 4IQZA 3KALA 3H0GB 5H80A 2DN8A 2F0FA 1YHBA 2JA8G 4QB4A 5KGUA 4QIWE 4FXDA 2MPMA 4FP5D 3HKZA 1H9MA 4J9LA 1HQRD 1PRTB 2PYKA 4OWWB 4DR5H 3BQ2A 2BQUA 5KFGA 1LV9A 3IG0A 5EKLA 2SEBD 3S1NH 1VQ8A 3DF7A 4XT1B 2F3VA 2F0DA 2E75C 2K4KA 4B3RQ 3LMLA 1NY4A 1D7QA 1SMYD 2HHHL 1G8ZD 3K6OA 3RGZA 2JA5A 2HVSA 4L6TB 4C2MB 4JI1Q 1GSAA 4O3NA 1M8AA 1E4EB 4PZ8A 1W93A 5IYZF 2JEFA 4DK6C 2RGRA 3BG5A 3TQ1A 1AZPA 4RCNA 4IO9A 4HN7A 3ERQA 3EJIA 1PH3A 2FK2A 3J80W 1V8QA 1HNXL 4DUZQ 2PPBC 4A3JG 1YNJD 2NVYB 2ALYB 1K83B 2I07B 2XRSD 3L4KA 3MJFA 1BF4A 1E2ZA 3ETHA 2EDGA 3NHHA 3GTJA 2RDFA 2ZT9C 5JEAG 1Q3LA 3KHRA 3EFXD 1CHQD 5I4DA 3T1HL 5ELFA 4APMA 1X32A 3HKZB 1AFPA 1S40A 2P0AA 5GROA 1XMOQ 3GTPA 1IOVA 4IAJA 1KAAA 2F0LA 4DR7L 2G9DA 4APVA 4E4TA 4PMCA 4DV0H 4BBRB 2QDBA 5C0XH 4AQYL 1O78A 1WTHA 1JICA 2EYMA 1A3TA 3P75A 4MIUA 2JA5B 1M0WA 3T5JA 4GKKQ 1JWUD 3FDTA 4JI4L 4DV1H 4NDXA 2RKSA 2UXDQ 4MTNA 2BDNA 2K03A 2B63A 4XDXA 4OX9Q 5D1PA 1B2TA 5J2TF 3G6XA 5EGTA 4J9OA 1C48A 4X3TA 2D62A 2DWCA 3WOEA 5CC4A 5JJLA 2WAQA 1N36H 3L2PA 4G3IA 3ERSX 3E0EA 2C35B 2HUGA 2PZWA 2YYZA 4DR5L 3CD6A 3GTJB 3N6RA 3FMCA 4EFEA 1OXTA 1NUCA 4J8QA 4DL5A 5C5LA 2UVWA 4OONA 4LF9H 1VQ6A 1C9OA 2UVVA 2HVQA 2QK4A 4H0LC 2HDMA 3GTPB 4IUNA 2VZAA 4R8NA 1RDPD 2OCEA 2XN9C 5JJIA 1N56A 3EPGA 3NE5B 1Q8IA 2L15A 1WJJA 2CW0C 3F1ZA 4LF6H 3STBD 3U9TA 3JC66 5EBDA 1GXDC 3BQ0A 3D6WA 2BQ3A 1JB3A 3FDSA 4JI2Q 4IFDI 1M1KC 2XD4A 4ME6A 1EHIA 1SYFA 4B9XA 2B63B 3KJPA 1NE3A 1BBXC 1VQFA 4DR6Q 5CV7A 2B2WA 4DR3Q 4J9SA 4DV4H 1E2WA 2PZUA 4NXMH 2RHQB 5KFKA 2QW7A 3H40A 1I4RA 4O2AF 1WCMA 5C3EG 4FNFA 4LF7H 2WAQB 4MTKA 3RN5A 1JORA 4DV7Q 1YIJA 2L5TA 5LMUH 1BKBA 1N48A 2YZMA 3N44B 1WTXA 3VA5A 5IY0A 3SXHA 3TP7A 2NTSA 4C5BA 4YQWA 4DV0L 3HFZB 4YAJB 2KEEA 2TSSA 2PCFB 1CS0A 1QUQA 3UE1A 5FD5A 2FLPA 1ENAA 4DV1L 2R84A 2RA4A 3TIGA 2C00A 4G4KA 4EGJA 1WCMH 3HOYH 3PIO3 4LF8H 3U9OA 5FLMH 5CA0F 2UXCQ 5CV6A 1QVFA 4KHZA 3RZDH 4JI6H 1ULZA 1N36L 4JI3H 4K0KH 3NEMA 2YL2A 3WOFA 3RB3A 3CCUA 2YS7A 2FB9A 3DM3A 3VYUA 2TMPA 1WCMB 3W5OA 4LF9L 2F3WA 3ND9A 1EU4A 2N8NA 3OUUA 2J6TA 5EPLA 4HMJA 4IPDA 5K2MA 4ZCKA 1QVCA 1MSGA 1GUWA 1Y8PB 4K2KA 3RZDB 1OXSC 4KKUA 4LF6L 1WSCA 2R3ZA 4KD3A 3G6EA 2J0TD 4ABNA 1QUQB 5KFPA 5IT9c 2E2HH 3V6KA 4X3UA 3H4DA 1KXLA 1HR0H 4X3SA 4DL6A 2D5DA 1X65A 3VR6A 3J7AF 2CVRA 5C0XI 4DV4L 3QJYA 2XIGA 2Q2UA 1HZCA 2BDOA 2J9GA 4ED2A 4NXML 3LWUA 3R3OA 2VQFH 4HJAA 1PTOF 4LF7L 2NZ1D 1AP0A 5LMUL 4C3IB 1DGSA 1EIGA 4PZ7A 1PH4A 1A6XA 1Q90A 3PO2H 1Q1BA 2AUJD 2MCTA 3I4MB 1TWAA 4IUUA 4KN7C 3MZ5A 5KFIA 5F9LA 2A69D 4DAPA 4QWEA 3HG9A 4LF8L 2OTLA 4RNMA 3C1EA 3V6JA 1M0TA 2EYOA 3T5KA 3TP5A 4FF4A 1S3OA 3HOVH 3KTMA 4RU9A 4JI6L 1TS4A 4DL2A 1YJWA 3FKIA 2GPSA 1X3EA 4JI3L 1PLFA 4I4TF 2HT1A 1D6EC 3P1HA 3S17H 2C2RA 4YIJA 3TP8A 4TV8F 3I3CA 5FOBB 1EQRA 5IYBH 4Q5VA 2ZM6Q 1S68A 5KFYA 4JYAQ 2NUAB 5LMNW 1L1OA 3F8NA 1HZBA 3A8IE 1FNUA 2JK8A 1EYZA 1RHPA 2L55A 4FF1A 4FF2A 1RJRA 1IBLH 3HKZG 3OWFA 2VQDA 3KDFA 4CDFC 5KNBA 5A2QL 4K6LA 2F0MA 1WH2A 5ELDA 2OQKA 4IOAA 1TWAB 3G8CA 2NN6H 1PH6A 3PVXA 1EY5A 4BBRG 2NU8B 4DR1Q 1GHJA 1PX2A 4B3RH 5CMDA 5FLXL 2JA5G 5ELEA 1L0WA 3MR6A 5IT9E 2VQFL 2DY7A 5HBRB 3PIPA 1JWSD 3FKIB 3S16H 1PVOA 2R8JA 1DD2A 1SE8A 1WTVA 1MJEA 4PG3A 2F4VQ 2JA6H 4DUYQ 1L1OB 2HJWA 2VB2X 4DKAC 4L5SA 5D8DA 4H02A 4YCWA 1EUCB 3M7NA 4GOPA 3NELA 1GOZA 2XNAC 4QMGA 1S4ZA 1VQOA 3MR3A 4DV5H 1KJ8A 3TIIA 1NBWA 1G2SA 5LP6F 2VNUD 1SMXA 3MWDA 2AGOA 3KDFB 1BVSA 2YS6A 4MA0A 5IWAH 3GTGA 5C4JB 2QKIC 4FYDA 1SCUB 4IR9A 1F2YA 4JV0A 3NP8A 4A3FB 3UFXB 3OSPA 2F0JA 4IZ8A 2ZJTA 3CC7A 5KFXA 1BBWA 5KT5A 2F0NA 3EA6A 2FLNA 2JEBI 4LK1C 4B3MQ 3GTOH 4UCSA 2B2VA 2VY3A 4YWLA 2B63G 3C0FB 3GTGH 2WB1E 3HOWB 1RKNA 3UDXA 2GPWA 3ULLA 1EIHA 1IBLL 3TBIB 2WAQG 5J1ZA 1SE4A 5M5YH 4ED8A 1SYCA 4ED1A 5M5XH 1B9NA 1W6JA 1TWHA 2R8KA 5M5WB 4GOPB 4A3IH 3F2CA 3PQIA 2HDLA 4RNOA 1OWTA 3IFTA 5JVDF 3EPIA 1TWFA 4B3RL 3SE0A 4R4QA 3CW2C 5FPOA 3GTGB 1EY6A 4LUOA 1J9OA 3OIPA 3K5LA 4A3GH 2I5LX 3LWEA 4J1MA 3BQ1A 2O4XA 2AU0A 3Q8PB 4DPGA 4TQRA 3QR8A 1RTOA 1S9FA 1HR0W 1VMPA 3MEFA 4QY7A 3R2IA 1FD7D 1Q46A 4A3BB 3TINA 4QWDA 1PH8A 2R6GA 2YTYA 5FLXW 4XQQA 1CI3M 2ICIA 3PCOB 3TZDA 1TWFH 1X3PA 2R93A 1U5KA 3E0JA 1KBLA 4HIDA 3HRZC 3OIQA 3T5HA 1ASZA 3BJYA 5JVG3 4DR6H 3PR4A 1Q7YC 3IRBA 1A3VA 1K73C 5CR3A 4A3MH 4DV5L 5LA6F 4KMUC 1DONA 1Z2NX 2CWPA 2KHIA 1HNZH 3QFFA 1S10A 5J39A 2KVMA 5IWAL 3JZIA 4DV7H 4DGZA 1STYA 1AUVA 2IMWP 1E22A 1MSHA 1TWHB 3K7AH 1RCVD 2UUBQ 5JPNC 3ULPA 1B8AA 2I87A 2V59A 3OUZA 4R4IA 1TWFB 3A7AB 4QCLA 3T4AC 5KFEA 2VUMA 1Z2OX 4GC6A 2JJQA 2NN6I 2IT1A 2EQSA 3MC0B 1PH2A 2R6FA 1DJRD 4O3OA 2W6NA 4QQBX 1XPOA 2V4DA 2ES2A 3NTKA 1X3FA 1FYCA 5LXTF 2KCCA 3U9SA 5IGCA 3RB6A 4YR0A 4A3DB 2Z6BA 4GN3B 1GM5A 3S1QH 1YNND 2F03A 2PI2E 2K52A 2PN1A 1LYLA 3PSIA 1JOKA 1UE6A 2R93B 1GSHA 4C3IG 3OTOH 2UUCH 1JX4A 2F0PA 3E6ZX 2R82A 4ALPA 1ZQ7A 5EPJA 2NVQB 5IGEA 1I6HB 3NWTA 1BGWA 2BQRA 1VQBA 3OMGA 3I4MG 3PF5A 2Z6KA 1I50H 2IW3A 4KY5A 1KJIA 1I7NA 4IRCA 3CCEA 4GNXC 2HIVA 1EFWA 4LFCQ 1Y1VA 2BOSA 1YITA 1C30A 3RZOH 1AE3A 2Z0SA 1RODA 2J4XA 2VUMB 4LMQD 3Q8RB 5D3DA 1EYAA 1SN8A 1IL8A 2FHTA 3I91A 4LFBH 2NTTA 2QA4A 1X6OA 4KLKA 3GILA 3BVMA 1B4OA 5C44H 2ATWA 3NK9A 4DR4Q 4DR6L 2OEOA 2MHVA 4HQ6A 5F9NA 2V9WA 4DV2Q 1WTPA 2XGTA 3AQQA 2FMMA 1HNZL 1STAA 1N34Q 4EGQA 2IPKD 5IYCH 4Q45A 4DV7L 5IGFA 2LFNA 4C1NK 2J6SA 4DF7A 1QE6A 4IUVA 3H09A 2OLSA 4XIGS 2HIXA 3RUPA 1E3PA 5EKIA 4QF4A 2NVXH 1HRJA 3QZ8A 2D2CC 2XTIA 5GAHC 1UEAB 4LH7A 5ELBA 1XNQQ 2Z1CA 2BR0A 4FU0A 2DJFC 4BXXH 1A3UA 1Y1VB 3H91A 3GTLA 3T56B 4BBSH 4S3SA 1STBA 3CCMA 2MNAA 1TT2A 3FKIG 3HKZE 1KDAA 3G6JB 1EUDB 2EYFA 2EJFC 3EIVA 2HGSA 3OTOL 2UUCL 5CAEB 4A2AA 1XX8A 2M05A 4A3LG 3CC2A 4C3JB 4LF5H 3NBHA 1GJXA 1J5EH 5G3LD 4JI0Q 3UI2A 1EY0A 4ODGA 4XQNA 3RAQA 1I4XA 3NBIA 1SEIA 2PQAA 2EE1A 2F0GA 4BY7B 1KD1C 1XNRH 3PO3B 1PA6A 4XYMB 1VF5C 3C2PA 4HNUA 2BA0A 2MJ8A 1HQMC 4NW2A 5CBAE 2R8GA 1IYVA 2HQLA 4A3FG 2L1BA 5E7NA 1QWYA 3K57A 2I80A 2R7ZH 4LFBL 3U50C 4JBWA 2IJ0A 4KTAA 5LL6b 1XXGA 2JP1A 3M4QA 1E4GT 4I50F 4EVOA 1KC8C 4HEDA 3IKJA 3GTLB 4MV3A 3OHBA 4CC6A 4NXNH 3J81W 1PFSA 3CP0A 3CMEA 2OF1A 2K1BA 4IUQA 4RG1A 4IWYA 4HJ7A 3HOWG 5AFWA 5FO7B 4BA1I 1KJQA 5IP9H 3I72A 3NBHB 1EOVA 5DLQE 1I4GA 4A93B 1A62A 4IPGA 1M90C 1Q1EA 3G4SA 5JVH3 1JCKB 1EQVA 2PQAB 5CYUA 4CHTB 3OWEB 1YHQA 1PTOH 1T94A 4JG2A 4Q0YA 5IT9L 1I7LA 3A0JA 2W9AA 2KECA 3RAXA 4X66H 1I3QH 3DXJC 1TA8A 5KFOA 2RSNA 2W71A 2XVSA 5JUMA 4YR3A 1SROA 2RBMA 1CSPA 2K14A 4QGUA 4J15A 3JAMW 5FK9C 4UCTA 4ECRA 2E5LH 4A3BG 1XMQH 4LF5L 4KKTA 5M9OA 1J5EL 1WD0A 3NQIA 1HNWH 1JQYD 3CMAA 1YJNA 3OYYA 1QJOA 3GV8B 1I94H 2CW0D 5BR8Q 5DM63 4RB2C 3S15B 4I55F 1XNRL 3F2BA 5DG7A 2UU9H 4JOIC 1M6VA 3RFCA 1C8CA 2EXDA 4GLAC 1Z2PX 2QDLA 1GKHA 2W6PA 3SVMA 2E2IA 2CH4A 1GHKA 5EQ0A 3ZJYC 3SK8A 5JJKA 4X65H 1TY0A 2UXBQ 5GONF 4LWCA 2KUMA 4U68A 4U7CA 1K8MA 1EYGA 3ORRA 4O3PA 3GQCA 2R92H 2Q8RE 4HIMA 2GVBA 3ER0A 4RAYA 3PR5B 4NXNL 3NGDA 4MZ9A 1BCPC 2X6GA 2XIWA 3CQZH 4J9NA 2O5IC 3DEOA 4A2BA 1WD1A 2JA7A 1MD2D 2V1CC 1PH9A 3S14B 4Y7NB 2RVLA 3V4ZA 4V0BA 4A3DG 1IBKH 1N9WA 3URYA 2AMCB 5IE8A 1VQAA 4K6DA 2R93G 3I4NB 4L5RC 5KG4A 1L2FA 1E24A 1PK8A 3PN1A 1EWHA 3MAQA 1KLUD 1V4YA 4X66L 4PQXA 3JSLA 3VA7A 5KFHA 1C0AA 2E2IB 3TS2A 1SNDA 3QOJA 3K59A 1OTCA 3M3YB 4TVAB 3I4OA 4J9QA 4K5VA 1VQLA 1G6PA 3KLSA 4MTEA 2YTXA 3MEHA 2UUBH 2E5LL 5EOYA 1HHVA 5KFNA 1FR3A 2E2JH 2VUMG 1MIUA 2EY5A 3CCJA 1XMQL 4IPHA 3I12A 1HNWL 5LL6X 4JI5Q 4CKCA 2JA7B 1I94L 1X54A 2YCHA 2UU9L 5IYDG 1STEA 5K36G 1HZAA 5ELOA 2K32A 2CW7A 5JH7F 1O7ZA 2PW7A 4ECTA 4HJ9A 3IAYA 2M2LA 3DWAA 4P73A 2B2WC 4L63B 3C3LA 3S1NB 2IL8A 4X65L 4O4IF 4RUCA 4DN4M 4XZ3B 4JVZA 4RGOS 4KHPQ 4QJFA 4HYKA 1SYGA 3GIQA 4ECXA 1HTPA 3T16A 3TN2A 3JRXA 4UAIA 3V96A 2I46A 1WYDA 1LTSD 1Y1VG 3K8AA 1E1TA 2CWAA 2ZDQA 5CB4F 3PW7A 1SJHD 3H94A 4KV6A 2AQ1B 3Q24A 3P20A 1IBKL 2JEJA 4DV6Q 3Q1KA 5KX5F 1EZ8A 1X3GA 4IRKA 3CU7A 5J22A 4C3JG 3F2DA 1RL2A 5DNFA 2I0QA 4EBCA 4DV2H 4YY3Q 1UAPA 3DHQA 3W1BA 3N43B 1JOOA 4BY7G 4J9MA 3PO3G 1H9RA 5KT7A 2RDGA 1ESRA 5FJ8G 2AKWB 1B3AA 1B53A 2RSOA 4U673 4RB3C 2F3IA 2KJXA 2MUYA 4JW0A 4ULLA 3HEJA 2UUBL 1EYDA 4EG0A 3FRPB 2VS1A 4LFAQ 3EBEA 1K28A 4BY1H 2EY2A 3SI8A 4O3RA 3T1YH 3QG1A 2B2UC 4TSSA 1UC9A 4NP5A 2VA3A 2HCIA 1B70B 2PNHA 1XNQH 1OXXK 2EY6A 1HA5A 4RA8A 3S2HH 2CZGA 1B3QA 1W96A 1LUZA 5KT4A 2EJMA 4FM9A 4LW1A 4RZQA 1IHZA 2SOBA 1HA6A 5C5JA 1WI5A 1CQIB 4M8AA 2FINB 1AN7A 1NNXA 5IP7G 4RFBA 5JEAJ 1IBMQ 2PW5A 2JN4A 2KHSA 4A93G 5GADC 1EIFA 3UQ8A 4G57A 1K9MC 1II3A 1E0BA 3RLNA 1FGUA 1FVIA 4WORA 1U0LA 4K5WA 1W6KA 4O2BF 3UDGA 1ILPA 3GQBA 4A3EH 1U4LA 2B2TC 2F0QA 4NPSA 4WJ4A 2ICEC 4FS1A 1L0YB 1E4FT 5DQGA 2OTJA 4A75A 5C1PA 1SNMA 3MXPA 5M3MH 4OIKA 1C7YA 3PUXA 1TU2B 4YCUA 4LF4Q 3EN2A 3HOZH 4PMBA 3S1MH 2QYZA 3UE0A 5M3FH 3K5HA 2DGYA 4IZOA 1SJED 4H13C 4YHHH 1DV1A 3NTIA 1GGOA 1JE4A 4GN4B 4BWGB 3JRWA 4A3EB 2C5CA 4M9UA 3OHXC 2CH4W 3F8TA 3MXGA 4DV2L 1QCBD 1Z6HA 3HOXH 1Y69U 2NZOA 4CGYB 2GLTA 1ESFA 4ED7A 2QF7A 1A2UA 4B3SH 2QCPX 5CORA 1NMFA 1T3NA 1BUVT 1VQ7A 1JT8A 5M3FB 3VPDA 3PW0A 2H5XA 2ZXPA 4DR2Q 5EKKA 1GUGA 3MHBA 2E2HA 3TSSA 3SE7A 2KA7A 4MV1A 3T1YL 2L4NA 3HOYB 4ZQ3A 4FO2A 1QILA 1QNKA 1XNQL 4LAAA 4UP9A 3RIZA 2A1AA 1GUSA 3RLFA 1LT5D 4AYBA 3AB9A 4QIWA 3TEHB 4N9TA 3GLKA 1F2LA 1JJCB 4JCVE 1BNZA 1IYUA 3VR2A 2JXMB 4DK1A 3I55A 1IL2A 4EFBA 2CQYA 2FPGB 2W6MA 2CQOA 1C4QA 3I4NG 1EQQA 1BNCA 3D4DA 1N33Q 4PWQA 3FVQA 1HFGA 2EZVA 4XX0B 1YEZA 1S97A 4JI7Q 2RCNA 3V2TA 1AUXA 2Z8LA 3H0GG 4J9KA 3I73A 1J8IA 1R9TH 1ET9A 3PW2A 4V190 4F87A 4IFDG 2E2HB 1N32Q 1SXTA 5DGAA 4XYLB 3RV4A 4FVMA 3NPPA 5DG8A 1MZBA 2UXBH 1B6SA 3BDLA 3KF6A 3CHBD 3RBDA 3RR5A 5C6AA 1Y1WA 2UUAQ 4F88A 2QILA 4YHHL 1CQVA 5I9PA 1GSOA 4AYBB 2P5ZX 2ZJRA 3R23A 2D0PA 5FD6A 1KNEA 4FS2A 4QIWB 5KG0A 4DK0A 1F77A 1VF7A 2JA7G 1STHA 1IKLA 3K5OA 4NB3A 5E1FA 3J80c 2RDJA 3CKIB 3PO2B 2R7NA 1VQHA 1QB5D 4B3SL 1PDQA 2B2VC 4ZKBB 1QNUA 4JBJA 2V5AA 2PMZE 1O75A 2EVBA 3WNZA 5CA1F 3FMAA 1Y1WH 2F0VA 1LTBD 3HS0C 3VYSA 3EROA 5TSSA 4DNTB 3NSWA 4OO1H 4XYOA 1DOKA 2NU6B 5I9OA 2DNEA 3J7ZC 1XPRA 3HOVB 3R5HA 1Z47A 4OHJA 1ZKOA 1PTOD 2RDIA 3KF6B 2VPSA 1ML0D 1Y1WB 3S17B 1PYBA 1K1QA 4IWXA 2VQEQ 3RF2A 1GVPA 5FO8B 2K04A 2JA6A 2A8VA 4A3KH 2A73B 1LTTD 1LTAD 4A3CH 4JI1H 2ENBA 2WE6A 2AHOB 4K5XA 3DM1A 3BABA 1VS0A 2AUKA 4DUZH 2WACA 2PZTA 2EY1A 2MGSA 5AJ3L 2ID0A 5C0XG 1IKMA 1CTMA 3FPPA 2UXBL 1SE3A 3G6YA 2B8GA 3W3AA 3VR3A 1D5MC 4F7XA 1YI2A 3GTOA 1LTID 2CKZB 2NVTH 3G7LA 3SK4A 3S16B 1CKMA 1BOSA 3VR5A 1H9KA 5EWEA 1WR2A 3KYHC 3GIKA 1XMOH 4G7ZC 4YAKB 4IJHA 3MR5A 1CZGA 3QOLA 2AQ2B 2R7DA 2JA6B 2A5HA 5KFFA 4QWBA 3D6CA 3MA2B 1FJGQ 2I5HA 5IODA 4XYQA 5BMVF 3CC4A 1UUPA 3J80E 5BPHA 5DQIA 3KFUA 4GKKH 1RF2D 4ECSA 2A6ED 3CRKC 2RHSB 2UXDH 3GTMH 2C28A 2C2EA 3HOUH 5L1IA 3CXCA 4OX9H 2N78A 3J81j 4ECQA 2BH2A 4RAZA 4P75A 2LS01 2LSSA 5DEHA 5BN4A 3IL8A 1S0NA 3KK7A 4C1NI 1EEID 1SNPA 5GAEC 1B33N 4KI0A 1K3BC 4FXKC 5C4XH 4LNQA 3A55A 3PMFA 5CV8A 3GTOB 2Z6KC 4JK1C 4DV3Q 2HHHQ 2LKVA 3K80C 4YCVA 1TAEA 1EZ6A 1STNA 2NU7B 1D5XC 1QVGA 4KKSA 1BJTA 4N8X1 1TVXA 2AWNA 5COYA 5D3IB 3RMHA 4F50A 3C46A 4JPBW 5A2QW 3SR1A 2KOLA 4JI1L 1TR5A 4UCUA 4O3SA 1LACA 1STGA 1VQDA 3QWNA 1JE5A 1HNXQ 5KT2A 2FLLA 5D65A 5M5YB 3DLLA 3I4LA 2CCZA 2E8GA 1DZ1A 5EZYF 4ECWA 4DUZL 5M5XB 2VXWA 5T1IA 3CCQA 5KG6A 3E9HA 4A3IB 4JI2H 2FE3A 1ET6A 1F9PA 1KRTA 2B2YA 4C3HH 4DAYA 4DL4A 5ELCA 2EIFA 1C3OA 1A2TA 4WRDA 3T1HQ 4DR3H 1H9JA 4A3GB 1WCMG 1A9XA 4RZRA 4OO1I 2JEAI 4FF3A 3HOYG 1UE1A 3I8ZA 1TS5A 4GLXA 1TY2A 3TMEA 4O0AA 1KRSA 4IOCA 2RF4A 1XTCD 5EJWA 2IHFA 5FLMG 1XJVA 2I8CA 5FKAC 4HCEA 3J7AV 4M7EA 4DR7Q 4ED3A 1TWCH 4X62Q 1XMOL 5I47A 5IIFA 4ZUJA 5L1LA 1BCPF 4AQYQ 5KG7A 4PV1C 4IALA 5KFWA 4RB1A 4P74A 4JI4Q 2W6QA 4C3HB 4OWXB 2K33A 2NB0A 3MFHA 3CPWA 4NKLA 4H44C 4GKKL 4A3MB 4UCVA 1CZWA 3BJUA 4KN4C 4EGVA 2UXDL 2PBZA 3MR2A 5KIXA 1P8LA 1EY7A 4OX9L 2M9VA 1H95A 1YBYA 1I50A 2UXCH 5JJZA 2ZTDA 3K7AB 2Y0SA 3L3OC 1CKOA 2K28A 1EWCA 2KQ3A 2SDFA 2EOTA 4DAYB 3S2DH 3TDQA 5ELNA 1UE7A 2NBFA 5E4WC 3MWMA 4QWCA 4E6IA 4C56C 4F4YA 4L8JA 2JA8H 4AYBG 1PV4A 4MV4A 3S1QB 5DLGA 4G7HC 2E2DC 4X6AH 1VKZA 2F4IA 4XQJA 2ZDHA 1FGBD 3ICEA 2WP8J 1DXMA 1M4VA 2XCLA 3ONAB 3PO2G 4TKOB 4ZHQF 1T36A 4JI2L 3MWEA 5CV5A 1BCPD 1AEXA 2NVXA 4DR3L 1I50B 1DOMA 2Y0SB 2R7MA 1N33H 2Q8TA 1EWIA 1A0IA 3D4WA 1QOHA 1K0SA 1RYSA 1MJCA 2B8FA 2N55A 4A3JH 3RZOB 3KLWA 4XTCS 3HOVG 2A19A 5C1OA 1IW7C 3M4OH 3U4ZA 1SR3A 3M85A 2DY8A 3K58A 2R7KA 2K01A 2AGPA 2IBKA 5JEAH 5C44B 4UHVA 3GTQH 4AH6A 5IGGA 5IYBG 4I65A 1KAWA 2WIIB 1RJQA 3I70A 3MXNA 5LMNQ 1LTLA 1UE5A 2B39A 1I5FA 3M4PA 2DLNA 2UXCL 1N36Q 3Q8QB 4WBNF 3J7A5 2BA1A 5KG3A 4GKJH 1HZ9A 1RD9D 4QWAA 2NVXB 1VCIA 2NN6G 4LF9Q 1PXUA 2BH8A 2OH2A 2R7ZA 5DAUA 2SCUB 4B9WA 1K3RA 2FK1A 2ZM6H 1NCVA 4JYAH 5DLFA 2W57A 1TQOA 1VDZA 1JJ2A 2WB1A 4BBSB 1F9QA 1SNOA 3KF8A 1K8GA 1TWGH 4WJ3M 3RBEA 1EYCA 1ZYRC 1BXRA 1CE8A 2ASLA 1PRTC 1EU3A 2HQEA 4UP8A 3PZPA 1CSQA 1JC7A 3SEBA 4J0MA 2R86A 1Y8NB 4DV4Q 3S1RH 1LT3D 3MXNB 4HTHA 2A68C 3D31A 2JA6G 3UDIA 1D1KA 4DR1H 2C2DA 4NXMQ 1KQSA 3K3PA 5K5PA 3RLOA 1WTQA 4LF7Q 1JIHA 3BG3A 2CFMA 2ZXOA 1MI2A 1N33L 3JSNA 1SYDA 5EAYA 3VPBA 4TRDA 3HP3A 2B3GA 1I3QA 5KEEA 4IHJF 2X69A 2FKLA 1EL0A 4CDDC 1ENFA 1ENCA 1G2TA 4GNXA 2R7ZB 1B6RA 3DUZA 2Q2IA 2F4VH 2A6HC 5HGQA 1YVCA 4DUYH 4RMFA 2OWOA 2WB1B 2FJ2A 3KF8B 3RGXA 1GYFA 4LF8Q 3SK6A 1WTOA 5C3EH 1PH5A 3HGBA 3BA9A 4R8UA 2GN5A 4JI6Q 3PF4A 3E3XA 1SYBA 3L4JA 3KJOA 1D5ZC 4JI3Q 2WAQE 4K0KQ 2W70A 4K8JA 2KCNA 5FLXc 2F1MA 3QZ7A 2MP1A 1I4HA 2XCAA 4P71A 1KNAA 3KAJA 4POGA 3RB0A 1JDEA 1PTOB 4C5AA 5BN3A 5KFMA 4A3IG 4B3MH 1PFNA 1H9SA 2ZM6L 4EX5A 4JYAL 1I3QB 2R92A 3S9WA 5KFRA 1ZEQX 2XSCA 4A3GG 2WTFA 3CQZA 4HR7A 4GNXB 3EYYA 2QGQA 4ZQIA 2PI2A 2VPQA 4YB8B 3E5NA 1RYRA 2W7OA 2X0SA 1HR0Q 5C8YF 2R8HA 2N88A 4OL7A 3J80L 4R1JA 4FDBA 2IA6A 4DV3H 4DR1L 3V4SA 3CCLA 3BZCA 3OMCA 4R8UB 1U4RA 3AU7A 5L1JA 3J81i 1RK5A 2AGQA 1FNWA 3M9NB 4A3MG 1B50A 1MBYA 4ZRZA 4MA5A 5KRUA 3H3VC 1LT6D 1O7LA 3KHHA 4HSVA 4GKJQ 5E4XA 1V1PA 5EPKA 3PV0A 2W8LA 1EOTA 1YNXA 1LABA 3A54A 1H9SB 3G71A 4JC0A 3N52A 2F4VL 1K1SA 1SFOH 2KENA 4DUYL 2R92B 3Q8SB 4UFZA 3FP9A 3K0YA 4R9WA 1SE2A 2L9HA 1DM0B 1A8VA 3SHLA 3CQZB 4POFA 4HR7B 2K50A 4EBEA 1LTGD 2WYOA 3NQTA 1X55A 3LP8A 3KBGA 4JV2A 2MO0A 3CPFA 3MXUA 4X62H 5T1GA 5JOBA 2XC9A 4JI8Q 1RJTA 3JAMi 4DNIA 2F0SA 2D0OA 5IT9W 4RB0A 2XGQA 1HPCA 4M1UB 2W6ZA 4EQNA 1HCZA 2IY5B 4B3ML 1OO9B 3W1GA 5FLXE 2N49A 3NUCA 1A63A 1BO0A 4C2MH 1CT1D 2K5QA 4AYBE 1IBLQ 4N9PA 1CK1A 2Y0SG 1KJ9A 3V05A 3HBLA 1V1PB 1VQIA 4CJ2C 1AH9A 1D2BA 2RQXA 2KBNA 1KL9A 4RUAA 2NVYH 2E2JB 4RKBA 1K83H 3GDEA 1AN8A 3O13A 5CV4A 1PYSB 3GO5A 1IXRA 4DV3L 1E2VA 3I7FA 2IX3A 4IN3A 2Q2HA 5C44G 5DM73 3GD7A 4IUTA 4ED6A 1SAPA 5LOVF 5LL6S 2EPBA 1JOQA 2NU9B 5KFCA 4LFCH 5IYCG 3EQLC 4AIMA 4UDUC 1KIXA 5GQOA 3R93A 2HVRA 1EFID 2L11A 4JOIA 1JLLB 2ALZA 3W2DA 2BE5C 4BBRH 1GO3E 2I5MX 5BPFA 1FL0A 3N40P 3QIAA 1QG7A 2JA5H 4O3QA 3TP6A 2WFWA 4R8IA 3PUWA 3MTSA 4DV5Q 3BVGA 1NR4A 5L37A 1VQPA 4DR4H 3VYRA 4X3KA 1L0XB 4BXXG 1LT4D 5IWAQ 2EXZA 3TS0A 3T53B 1Z9FA 5KFUA 5NUCA 2F0WA 3OSNA 3IFDA 4BBSG 3BDOA 1N34H 2FMAA 4MHEA 3HZXA 1K0RA 4A76A 3LX0A 4YJ3F 2EYHA 4EQOA 1LTRD 4X62L 4J6HA 3QB3A 3TREA 3ZYYX 5JVLA 3GTJH 1EY4A 1I6VC 1HTLD 1I4PA 2Q8IB 5KFAA 2C9OA 4U6PA 2AWOA 3NENA 3J81c 4I7ZC 4TQSA 1NTGA 1VAJA 1U4MA 3KLRA 4ZAIA 3A56A 3GTPH 1EY8A 5CBEE 1VQMA 2WKDA 4Y52H 3VPCA 5LMNH 2F0EA 3RJ0A 1CHPD 3CAMA 2O2LD 5C3XA 4RHRA 3H3VH 3J80i 1Q12A 4X64Q 4A4IA 4RGTA 1CA5A 3ETJA 2ZXRA 4BY1B 2R7ZG 5KT3A 3E9IA 4ID6A 2J7ZA 5IGDA 4K8IA 4CBVA 2B63H 2W9CA 4JI0H 1TKWB 4WD3A 4CKEA 3SK5A 2ZTEA 3S2HB 2WB1G 1KLGD 2NWGA 1BCPB 3BVZA 2QEJC 4DA2A 1RIPA 4PZ6A 3PIOA 2R87A 1KABA 4OGQC 3JAMc 4LFCL 3I2ZA 3I56A 4JV5Q 2JE6I 1Q81C 5IP9G 1G51A 4FXGC 4RAUC 2CQAA 2YYAA 2O03A 3K3VA 4OELB 2K7VA 4MAMA 1MKHA 5FPRA 2ASDA 2FP4B 2NYZD 3H20A 1BXTA 1O7YA 1S72A 2IX0A 2KHJA 1HNZQ 4DR4L 1X3QA 5D1OA 3A8KE 2O5JC 1S5DD 3T5LA 2MFIA 4OEMB 4YBZB 1PZID 4Z9CB 1TIID 2YU9A 5M3MB 4GZYC 1N34L 1LM0A 2FK3A 3EVQA 2PNRC 4F4WA 4HSPA 3HOZB 3S1MB 2W9CB 1W3SA 1IOWA 3M9BA 1L1OC 2JYOA 3BYYB 3GIIA 3PUVA 2JA9A 4RH6A 2VW9A 5T14A 1MHWC 1W2BA 4RNNA 1M7JA 3CCSA 1SYXB 4YR2A 3V6HA 2E76C 4B3TQ 2YU9H 3HOXB 2CHBD 5KG5A 3K0XA 5LMNL 3N8DA 5KNDA 2OT2A 3M9OB 4CC5A 3OTOQ 2UUCQ 3J81E 5JAVA 1ONLA 2J6UA 2MQHA 1R9TA 1EY9A 2X6LA 4KJOA 3J7AK 2DUDA 2RCFA 4ZYSA 2G9HD 4ILWA 2K5VA 1B1ZA 4JBMA 5I2XA 1HJPA 5D1OB 4JI0L 1SLJA 1SNCA 2SNSA 3K5IA 1JDBB 3N42B 2R92G 4O42A 2YU9B 1E1OA 4I7AA 1SMYC 3TZUA 5BR8H 2B2UA 2DNCA 4DLKA 4O2DA 3GIJA 2OQ0A 2EYPA 2RDHA 4C3IH 2LXJA 1PFMA 1DCZA 4LFBQ 3OHAA 2XRQD 3G6VA 3H15A 3RNUA 4ZOLF 4KJNA 4GOPC 1YNJC 3GV3A 1DOLA 1EIYB 3I4MH 1EZ1A 2Q2TA 3JAME 4ME3A 5FO9B 4H7BA 2JEIA 5CV9A 2ZJQA 4WFN3 3R5FA 1WOCA 4OIJA 3VYTA 1R9TB 2EJGC 2Z4HA 4UP7A 1V9PA 2LMCB 3FPUB 2B2TA 5KG1A 2KCTA 2KEDA 1B9MA 1EEFD 1S0MA 4MTDA 3OPOA 1YHAA 3H6MA 5KFVA 4ZK9B 3CCRA 3H3VI 1XWEA 1QZHA 3A7LA 5DGBA 1CKNA 4ECZA 2W8KA 4DL3A 3HXLA 2F0UA 2XGPA 4IUPA 4RGMA 1ZHQA 3MFIA 5EWFA 4ME5A 4IJLA 3I90A 4HIKA 2Y0SE 3VDYA 1O7IA 5KG2A 4TUYF 4J9PA 4F4XA 2YTVA 4K0KL 3MFGA 5C4HA 4LF5Q 3Q6SA 4JI8H 1J5EQ 1TWAH 1SEBD 3N6XA 4QUCA 1NMGA 2R61A 2YV5A 1ICFB 3RN2A 2C22A 3FHWA 2R7FA 1MGSA 4LJZC 1ZXTA 1UC8A 2YRWA 2IWHA 2EYLA 1XNRQ 4JI5H 5BN5A 4EEQA 2W7PA 4RCOA 1S0OA 3D8GA 5BR8L 4ECYA 4Q43A 2R8IA 1FKAH 4IFDJ 1GUOA 1O80A 3FKIH 4TQUS 5JQWA 2WV6D 2FFKB 4ETSA 1SNQA 1AE2A 4MV9A 3KXYT 1CKNB 2WKCA 2HCCA 2B2YC 3RTXA 2IHEA 2YRXA 4A3LH 1CQJB 2PVPA 3STBC 2CW8A 3DWQA 4ZI7F 2L12A 3CRLC 2R85A 4ECVA 1HR0L 5ISRA 3WO1A 1SDFA 1PRTF 4A3KB 4CDCC 3GP7A 3PW5A 1OXUA 4NXNQ 1JB7A 3BAAA 1WTWA 1CUKA 4KHPH 2UVRA 4KD4A 1EQTA 1YZ6A 2GVAA 3GTMA 1T5XD 1Q82C 4CKBA 1K8OA 1IW7D 4BA2I 5H1SE 3BYTB 2K6AA 3OOCA 1PYWD 4CDEC 2ZTCA 4XT3B 5C4JH 4ECUA 1WVLA 4A3FH 5KFBA 3F2UA 3M9MB 4B08A 5C5MA 1JMCA 1KDCA 2K75A 3P7JA 5EDWA 2JEGA 4GKJL 4DV6H 1HH2P 3D3RA 2LXKA 4ZLTF 3Q2OA 4MV7A 4BY1G 1JXLA 3PIP3 2NVTB 4HNTA 3VR4A 1LLRD 4X66Q 3OW2A 1GLVA 5KNCA 3BA8A 3GIDA 3U58A 3HOWH 4YY3H 1SBBB 2ASJA 2Z4IA 4UCOA 4MNOA 2L0CA 3L7ZC 4JBKA 3WWVA 2E5LQ 1YJ9A 1S03G 1XMQQ 3BDCA 4JI8L 2ZDGA 5I6WA 5KKNB 3SDZA 5M5WH 1HNWQ 4LFAH 1F2MA 4GN5A 1X9NA 3GTMB 2NUCA 1I94Q 4MV8A 3HOUB 2YW2A 2UU9Q 1PZJD 4JI5L 1ZYRD 2MO1A 1PRTD 4A3EG 2RGVA 2BCOA 1VBGA 3M4YA 4DU9A 3QO2A 4HCSA 3R8BA 1S5CD 2VA2A 4LUZA 5C0XJ 4RKLA 5M3MG 2K5HA 4X65Q 1LO5D 4A3BH 4DNRB 5C4XB 2A68D 1TWCA 4X64H 2DIKA 3HOZG 1IBMH 2R7LA 3Q22A 4C5CA 1WTRA 5M3FG 3AFPA 4WJWA 1PH1A 1VQ4A 1ASYA 1VQ5A 2PQEA 3OW7A 4KY7A 5JPMC 2FPIB 4KHPL 3K5MA 5GAGC 1A15A 3NWSA 2VUGA 3RB4A 2NZHA 3DMUA 1BDOA 1CQFA 3HOXG 3AEVA 3RV3A 1IBKQ 4O4LF 4GC7A 1TWHH 1RJPA 2A6HD 4JV5H 1V1OA 3A74A 3Q0AA 5E3FA 4LF4H 1QZGA 2DJGC 2N3SA 4DV6L 4L1KA 3S24A 1GD7A 3BZDB 3Q8DA 1GUTA 3K5NA 1KJJA 1KC7A 1L2ZA 3VMMA 1F2ZA 3HB9A 1ILQA 3K7UC 5IGBA 2UVUA 3HKSA 3PGZA 3GTKA 1Q86C 2YZNA 3C1FA 2A69C 4K2LA 1VQ9A 4PMWA 4GLVB 4KHVA 4YY3L 1JKJB 1BBUA 1TXYA 1TWCB 2W9BA 4A3DH 2VL6A 4QUFA 4DR5Q 4RGNA 3BU2A 2R93H 2PMZA 1XPUA 3DWPA 5F2DA 1UEBA 3B6YA 4CJ1B 2E74C 2F0TA 2V4RA 3ULJA 3LWBA 5HGTA 4DR2H 4Y8VB 4LFAL 2NVQH 1WFQA 1I6HH 3GTKH 4BS9A 1B7YB 3NXWA 5HY6A 3T51B 2DZDA 4UPAA 4BWSC 2KSWA 3DEPA 4B3TH 1SRUA 1GUNA 3M4IA 3TQTA 1B44D 4EYIB 2WINB 3K81C 3S2DB 1VQKA 2VUMH 4O1NA 2G5DA 2OXPA 4X64L 4LMYA 1PTOC 3KHGA 1IBML 5EWGA 4LSXA 3KBXA 4DXFA 3GTKB 3KLSX 1P16A 3OSOA 4YWMA 2XCPA 4TV9F 2JA8B 1EUJA 4N8FA 5KYLA 2W9BB 3GTQA 5IYDH 2F0HA 4MV6A 5K36H 4HNVA 1V1QA 2FPPB 5C3WA 4JI7H 3J81L 2PMZB 4R4TA 4RWSC 5G3LF 3NTHA 4DV0Q 4J9RA 4GS3A 4JV5L 1N32H 4LF4L 3BS1A 4DV1Q 1Q8KA 1Y1WG 4LSAA 1TS3A 3GIPA 3A8JE 4NMZA 4DAVA 2VB3X 2UUAH 4G7OC 1DYQA 2JSOA 2H4OA 4OO1G 1B04A 2VOBA 2K5WA 3KHLA 1R4QB 3G48A 1SSOA 1Y1VH 1U4PA 4FBTA 4A3JB 1ICWA 2FJZA 2JQOA 5LYJF 5C4ZA 1TWGA 1K8AC 3LGJA 5CGKA 3M4OB 4MN3A 4ZUIA 2F0KA 4HJ5A 1JR0D 2IX1A 1JJGA 4NLGA 5KFJA 1CFMA 4JUZA 5HURA 4C3JH 3T1YQ 3JAML 4UY8C 3GTQB 1HUNA 1G291 4OWTB 4DR2L 3H4BA 3CCVA 1BR9A 1S5BD 5J3BA 1F9RA 5A35A 4CJ0B 3WDNA 5KYIA 4A3KG 1VQEA 1PZKD 4XXEA 2A6EC 4BY7H 1N8RC 4YWKA 4LF6Q 3PO3H 4A3CG 4B3TL 3GV5B 5FJ8H 4Q8EA 2AQ4A 4QW8A 1J6QA 1UWVA 3M7GA 1KHIA 3MVVA 5I2YA 1X56A 4UCRA 2K5DA 3PW4A 2A74C 1FNVA 3CVZA 5L9XA 3R2TA 2V58A 3AYHB 4F8MA 2VQEH 1CM9A 4IPCA 5KFDA 1UNNC 2F52A 3X3MA 1U9RA 4IRDA 3MFYA 1I4QA 1Y14B 5KFZA 2ATLA 3GTLH 2FXQA 5EBCA 1G6ZA 1F9SA 1TWGB 5LMUQ 4R7RA 2SNMA 2XWBB 2Z9HA 1OXVA 4JI7L 3WO0A 2B29A 4ED0A 2BE5D 2ZJPA 4DFAA 4LH6A 5IP7H 4QW9A 4PDBA 2YZGA 1T9HA 3ND8A 3UDFA 4DK3C 3Q23A 4A93H 1N32L 4IR1A 1S5FD 3KOJA 3PUZA 4RHSA 4PNYA 3J7YW 3S1RB 4YHHQ 4YP3A 4EBDA 5KFQA 4F4ZA 4LUVA 3CF5A 4QL5A 2UUAL 5D14A 2EYJA 1IZ6A 3HOUG 4DXGA 4OXPA 5HV6A 1PMRA 5KFSA 4HMIA 3BZKA 4B3SQ 5DQHA 2H1EA 1V51A 2HD3A 3SGIA 1CA6A 1VBHA 5J2UF 1VMCA 1VQGA 2K5NA 5C4XG 5KT6A 3D4RA 2V4QA 1FJGH 2KCMA 3X3NA 2VR1A 5C3EB 2K05A 4ZKCB 4L5TA 4EYHB 3FEWX 1AZQA 3N41B 1RTNA 3S15H 3U4VA 1KDBA 2W6OA 1T5EA 1XYIA 2FMCA 4P72A 4O4HF 1NSNS 3RD4A 1IYJB 4EEYA 3GV6A 3MWYW 4HJ8A 1KEEA 1UNSA 5DG9A 2AQ3B 3A5ZB 1D8LA 3KUPA 1JWMD 2LY7A 1YNNC 1BQQT 1R4PB 3AFQA 1D1IA 4Q0FA 4EQ5A 4K14A 4P2CB 4JV1A 3D0FA 4KY6A 5IOCA 2VQEL 2ASBA 3L0OA 3R5XA 2F0OA 2HHHH 2D9UA 1VQNA 2DPJA 4C3HG 5KFTA 1SFOA 1TS2A 2VQFQ 2F0IA 3RUZA 1AW7A 4DAMA 1Y8OB 4KK7A 4FBUA 1VQCA 5I6YA 3H0GA 1HXYD 4Q44A 1HNXH 2DPIA 4EQPA 4HAEA 5AJ3Q 4Q8FA 2XWJB 3S14H 4Y7NH 2WDTA 2QEXA 1Z7TA 2IP4A 3E5SA 3PUYA 4DL7A 1E7ZA 3A5UA 3I4NH 1NJIC 3T13A 1ZETA 3GV7B 2M00A 3GIMA 3LNNA 1XTDA 3AMUA 1NR2A 3T1HH 1ZHSA 4YJ2F 3H0GH 4R4OA 3IN5A 4C2MA 5L1KA 1DV2A 1E4EA 3TQYA 2E2IH 4IFDH 4L5QA 1PH7A 4I7HA 4DR7H 1V43A 3ITPA 4R4CA 3M3YH 2PO4A 1S5ED 3L9AX 1HUMA 5A2QE 1HFNA 5LHY1 1G91A 3KAKA 4AQYH 1I6UA 5KFLA 4IURA 1SFOB
chains in the Genus database with same CATH topology
1E3PA 2I5HA 2NVXH 3CC4A 1FJGL 1PHJA 3PUVA 2XTIA 5GAHC 3KFUA 2JA9A 3TRZA 4HIOA 2RHSB 2VW9A 1XNQQ 3GTMH 1VQJA 1W2BA 4BXXH 2JA7H 3CCSA 3HOUH 3CXCA 2N78A 4B3TQ 2YU9H 3J81j 1YHBA 2JA8G 2BH2A 3K0XA 4P75A 5LMNL 4BBSH 4QIWE 2LSSA 2MNAA 3CCMA 3FKIG 3HKZE 3OTOQ 2UUCQ 3EIVA 4A93H 2MQHA 4OWWB 5GAEC 3OTOL 2UUCL 4KI0A 2DUDA 5C4XH 4LNQA 4A3LG 3CC2A 3S1NH 1VQ8A 2Z6KC 2K4KA 2K5VA 4DV3Q 3K80C 4YCVA 2HHHQ 4JBMA 1HJPA 4JI0Q 4L5SA 1NY4A 4B3RQ 1D7QA 1QVGA 2HHHL 4JI0L 1SLJA 2R92G 2PQAA 2AWNA 4JI1Q 1E1OA 1KD1C 4PZ8A 4DK6C 4JI1L 1PA6A 4O2DA 4IO9A 2OQ0A 1VQDA 1HNXQ 1JE5A 1PH3A 3DLLA 4C3IH 2E8GA 4DUZQ 4A3JG 1HNXL 2CCZA 2BA0A 2ALYB 2LXJA 4DUZL 2HQLA 3CCQA 4A3FG 4LFBQ 3H15A 5E7NA 3E9HA 4GOPC 3RNUA 2R7ZH 4LFBL 3U50C 4JBWA 3M4QA 1KRTA 1EIYB 4C3HH 1KC8C 3I4MH 2EIFA 2Q2TA 5JEAG 4ME3A 3T1HQ 1WCMG 3T1HL 1PFSA 4OO1I 3CP0A 2JEAI 3CMEA 3HOYG 1UE1A 4GLXA 2ZJQA 4O0AA 1KRSA 1WOCA 2RF4A 4IOCA 1XJVA 2IHFA 4RG1A 5GROA 5FLMG 4HJ7A 1XMOQ 1S40A 3HOWG 4DR7Q 4UP7A 4BA1I 1TWCH 1V9PA 4X62Q 1XMOL 2KCTA 3NBHB 4APVA 5IP9H 1EOVA 4AQYQ 4DR7L 5DLQE 1YHAA 4AQYL 1A62A 4IPGA 3CCRA 1M90C 3H3VI 1QZHA 1Q1EA 1CKNA 4P74A 3G4SA 4JI4Q 4OWXB 2PQAB 4GKKQ 3CPWA 4JI4L 1YHQA 2UXDQ 4JG2A 4GKKL 4MTNA 1FJGQ 3A0JA 3BJUA 2UXDL 4OX9Q 1P8LA 1I3QH 4OX9L 1H95A 1YBYA 2D62A 4IJLA 4HIKA 2Y0SE 2ZTDA 3VDYA 1O7IA 1SROA 1CKOA 5JJLA 1CSPA 2K14A 3L2PA 3ERSX 3E0EA 2C35B 2YTVA 4J15A 4QGUA 2YYZA 4K0KL 4DR5L 3CD6A 4DAYB 4LF5Q 3S2DH 4A3BG 1OXTA 1J5EQ 1TWAH 5ELNA 1NMGA 2YV5A 3RN2A 4LF5L 1J5EL 3FHWA 2R7FA 4OONA 1UE7A 1VQ6A 1C9OA 3CMAA 1YJNA 3OYYA 1XNRQ 5BR8Q 2VZAA 2JA8H 4AYBG 1XNRL 3F2BA 2OCEA 1PV4A 5BR8L 5JJIA 4JOIC 4IFDJ 2L15A 1WJJA 3F1ZA 3FKIH 4TQUS 2EXDA 4X6AH 4GLAC 3STBD 1GKHA 3JC66 1AE2A 3ICEA 1CKNB 2WP8J 2IHEA 4A3LH 3ZJYC 4JI2Q 3STBC 4IFDI 4JV5Q 1M1KC 2UXBQ 3PO2G 5JJKA 4LWCA 1HR0L 4JI2L 3KJPA 1NE3A 1VQFA 1EYGA 4DR6Q 4DR3Q 2R92H 1OXUA 4HIMA 1JB7A 4NXNQ 1CUKA 2GVBA 2RHQB 3ER0A 4DR3L 4NXNL 4MZ9A 1YZ6A 2GVAA 3CQZH 5C3EG 1Q82C 3RN5A 1EWIA 4DV7Q 1YIJA 2V1CC 1A0IA 4BA2I 1BKBA 5H1SE 1MJCA 4A3JH 5C4JH 2ZTCA 3KLWA 4XTCS 2A19A 5IY0A 1PH9A 3HOVG 4A3DG 4A3FH 1N9WA 2AMCB 3U4ZA 3M4OH 5IE8A 1JMCA 1VQAA 4DV0L 3HFZB 2K75A 1SR3A 3M85A 4GKJL 2R93G 1QUQA 1HH2P 3UE1A 4L5RC 2LXKA 4DV1L 4BY1G 1L2FA 1E24A 4AH6A 5IYBG 3GTQH 1KAWA 1WCMH 4X66Q 3HOYH 3OW2A 5LMNQ 1LTLA 4X66L 5FLMH 1UE5A 3U58A 1I5FA 3HOWH 2UXCQ 3M4PA 1C0AA 3TS2A 1QVFA 4KHZA 3RZDH 1N36Q 4MNOA 2UXCL 3L7ZC 1OTCA 3WWVA 4JBKA 3J7A5 2BA1A 4TVAB 3I4OA 1N36L 2E5LQ 1YJ9A 1VQLA 1G6PA 2YTXA 1HZ9A 1XMQQ 2E5LL 3NEMA 4JI8L 2E2JH 2VUMG 1MIUA 1VCIA 2NN6G 3CCJA 3CCUA 1XMQL 4LF9Q 2BH8A 5M5WH 4IPHA 1HNWQ 3DM3A 4GN5A 3W5OA 1X9NA 4LF9L 1HNWL 1K3RA 2N8NA 1I94Q 4JI5Q 2UU9Q 4IPDA 1I94L 1X54A 4JI5L 1JJ2A 1QVCA 2MO1A 5IYDG 2UU9L 4A3EG 1K8GA 1TWGH 4WJ3M 5K36G 1OXSC 1HZAA 5ELOA 4LF6L 3G6EA 4LUZA 5C0XJ 1QUQB 4HJ9A 4UP8A 5M3MG 1CSQA 2K5HA 4P73A 4X65Q 4A3BH 5IT9c 2E2HH 1KXLA 4X65L 3HOZG 1X65A 4DV4Q 3S1RH 3MXNB 2JA6G 3D31A 5C0XI 3UDIA 5M3FG 3AFPA 4NXMQ 4DV4L 1PH1A 1KQSA 2Q2UA 1HZCA 4KHPQ 1VQ4A 4QJFA 3RLOA 1ASYA 1VQ5A 4NXML 4LF7Q 4KHPL 2CFMA 5GAGC 4HJAA 1N33L 4LF7L 5EAYA 2B3GA 1WYDA 1Y1VG 2NZHA 3K8AA 5LMUL 1E1TA 3HOXG 3AEVA 2CWAA 1DGSA 1PH4A 4PZ7A 1IBKQ 1TWHH 1IBKL 3PO2H 3A74A 4GNXA 1Q1BA 4DV6Q 2Q2IA 1QZGA 2N3SA 4DV6L 1X3GA 5HGQA 1YVCA 3S24A 1GD7A 3Q8DA 4RMFA 2OWOA 3F2DA 1RL2A 3K7UC 3KF8B 4LF8Q 2I0QA 3HKSA 5C3EH 1PH5A 3PGZA 4LF8L 1Q86C 4YY3Q 2OTLA 3W1BA 1VQ9A 2GN5A 4GLVB 4PMWA 4YY3L 4JI6Q 4BY7G 1BBUA 1TXYA 3PF4A 1S3OA 3HOVH 3PO3G 5FJ8G 2AKWB 3KJOA 4JI6L 2VL6A 4A3DH 4JI3Q 2WAQE 1YJWA 4DR5Q 4K0KQ 1X3EA 2F3IA 4JI3L 5FLXc 3BU2A 2R93H 1XPUA 4P71A 2UUBL 2HT1A 1UEBA 4POGA 3B6YA 3S17H 2VS1A 4LFAQ 3EBEA 3ULJA 4BY1H 1EQRA 5IYBH 4A3IG 2ZM6Q 4LFAL 2NVQH 1WFQA 4JYAQ 1I6HH 5LMNW 2ZM6L 3GTKH 1L1OA 4EX5A 1B70B 1HZBA 2PNHA 4JYAL 1B7YB 1OXXK 2JK8A 5HY6A 3S2HH 1LUZA 4UPAA 4A3GG 1SRUA 4LW1A 1WI5A 4GNXB 3HKZG 2QGQA 2PI2A 3KDFA 3K81C 2OQKA 5IP7G 1HR0Q 1VQKA 2VUMH 4IOAA 1PH6A 5JEAJ 1IBMQ 4X64L 4A93G 4BBRG 1EIFA 5GADC 1IBML 4R1JA 4DR1Q 1K9MC 4FDBA 3RLNA 4DR1L 1FGUA 1FVIA 1P16A 4YWMA 3BZCA 2JA5G 1U0LA 3CCLA 1L0WA 1EUJA 3J81i 3UDGA 5IYDH 2VQFL 4A3EH 4A3MG 4NPSA 3PIPA 4WJ4A 3S16H 1V1QA 1PVOA 2OTJA 4A75A 4R4TA 5M3MH 1SE8A 4DV0Q 1MJEA 1C7YA 4GKJQ 3PUXA 4LF4Q 4GS3A 3PV0A 4PG3A 1YNXA 3EN2A 4YCUA 2F4VQ 3HOZH 3S1MH 4JV5L 2JA6H 4LF4L 4DUYQ 3UE0A 1L1OB 3G71A 4DV1Q 1Q8KA 4JC0A 4DKAC 2DGYA 5M3FH 1Y1WG 2KENA 4DUYL 1SFOH 2F4VL 3FP9A 4H02A 4YCWA 3M7NA 4GN4B 3NELA 4GOPA 4OO1G 1VQOA 1A8VA 4POFA 2K50A 1NBWA 3G48A 2VNUD 1SMXA 3F8TA 1BVSA 1Y1VH 3KDFB 4DV2L 1X55A 3HOXH 2JQOA 2MO0A 2NZOA 1K8AC 3LGJA 3CPFA 4JI8Q 3JAMi 4HJ5A 3CC7A 1NMFA 4DNIA 2IX1A 1JJGA 2D0OA 1BBWA 1VQ7A 1JT8A 2H5XA 4DR2Q 2JEBI 4C3JH 3T1YQ 4UY8C 4B3MQ 3GTOH 2IY5B 1G291 2VY3A 4OWTB 4DR2L 3CCVA 3T1YL 4YWLA 4B3ML 2B63G 5J3BA 4A3KG 3W1GA 2N49A 1XNQL 1VQEA 3GTGH 1A63A 4UP9A 2WB1E 4C2MH 3UDXA 4BY7H 2A1AA 1N8RC 4YWKA 3RLFA 4AYBE 1IBLQ 4LF6Q 2Y0SG 4B3TL 5FJ8H 3PO3H 4A3CG 1VQIA 3ULLA 1IBLL 2WAQG 3TEHB 1AH9A 1J6QA 1UWVA 1JJCB 4JCVE 5M5YH 1KHIA 2KBNA 1KL9A 1X56A 2NVYH 3I55A 1IL2A 1K83H 3GDEA 5M5XH 4GOPB 4A3IH 3F2CA 3AYHB 1PYSB 2CQOA 4IPCA 3GO5A 1IXRA 4DV3L 1EQQA 3I4NG 2F52A 4B3RL 3I7FA 4R4QA 3CW2C 2Q2HA 5C44G 1Y14B 1N33Q 3GD7A 3GTLH 2FXQA 4LUOA 4A3GH 2I5LX 1YEZA 5LMUQ 4JI7Q 2RCNA 3H0GG 4DPGA 1OXVA 4JI7L 2B29A 1R9TH 5IYCG 2ZJPA 4AIMA 3MEFA 4QY7A 5GQOA 1KIXA 1Q46A 5IP7H 1HR0W 4IFDG 4JOIA 1N32Q 1PH8A 1T9HA 2R6GA 2YTYA 3UDFA 1GO3E 2I5MX 4BBRH 3KOJA 1FL0A 3PUZA 4DK3C 3PCOB 1N32L 1TWFH 4YHHQ 3KF6A 1U5KA 3RR5A 2JA5H 2UUAQ 2WFWA 4LUVA 4YHHL 3CF5A 4QL5A 3PUWA 4DV5Q 4HIDA 1ASZA 1Q7YC 2ZJRA 3IRBA 2D0PA 1K73C 1VQPA 4A3MH 2UUAL 4DV5L 1IZ6A 4BXXG 2CWPA 2KHIA 5IWAQ 3TS0A 1Z9FA 2JA7G 3HOUG 4OXPA 4NB3A 5IWAL 3J80c 4BBSG 3BZKA 4B3SQ 1E22A 4A76A 1K0RA 3K7AH 3SGIA 1VQHA 2UUBQ 4B3SL 4X62L 4JBJA 2PMZE 3ULPA 1B8AA 3TREA 4R4IA 1Y1WH 1VQGA 3GTJH 2K5NA 5C4XG 2KCMA 2JJQA 2NN6I 2IT1A 2EQSA 2AWOA 3NENA 3J81c 1PH2A 1NTGA 4L5TA 3J7ZC 4QQBX 1XPOA 1XPRA 1VQMA 2ES2A 3GTPH 4Y52H 1X3FA 3S15H 3U4VA 4GN3B 1GM5A 3CAMA 1Z47A 4P72A 3S1QH 1IYJB 2PI2E 2K52A 4HJ8A 3H3VH 3J80i 1LYLA 3PSIA 3A5ZB 1UE6A 1Q12A 3KF6B 1D8LA 4X64Q 1PYBA 4A4IA 2VQEQ 4EQ5A 3AFQA 4ALPA 1GVPA 3D0FA 2VQEL 2R7ZG 2ASBA 3E9IA 3L0OA 2B63H 1VQNA 2A8VA 4A3KH 1VQBA 2VQFQ 3PF5A 3I4MG 2ZTEA 2Z6KA 2WB1G 4DAMA 1I50H 4A3CH 1VQCA 1RIPA 4PZ6A 2AHOB 2HIVA 3PIOA 3CCEA 4GNXC 1EFWA 4LFCQ 1YITA 3JAMc 4LFCL 1VS0A 3I2ZA 1AE3A 2Z0SA 5AJ3Q 3I56A 3RZOH 2JE6I 4Y7NH 1Q81C 3S14H 5IP9G 1G51A 1SN8A 5AJ3L 2QEXA 2ID0A 3PUYA 5C0XG 1E7ZA 3A5UA 2UXBL 3I4NH 2QA4A 1MKHA 1X6OA 1NJIC 4KLKA 1YI2A 5C44H 2ATWA 4DR4Q 4DR6L 1XTDA 1S72A 2CKZB 4DV2Q 2IX0A 2XGTA 2NVTH 2KHJA 1HNZQ 4DR4L 3AQQA 1CKMA 3H0GH 4R4OA 1HNZL 2MFIA 1N34Q 5IYCH 4DV7L 3KYHC 3TQYA 1LM0A 1N34L 2E2IH 4L5QA 1PH7A 1V43A 4R4CA 4IJHA 3M3YH 2R7DA 4XIGS 1W3SA 2HIXA 3M9BA 1L1OC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1E3P A;  2I5H A;  2NVX H;  3CC4 A;  1FJG L;  1PHJ A;  3PUV A;  2XTI A;  5GAH C;  3KFU A;  2JA9 A;  3TRZ A;  4HIO A;  2RHS B;  2VW9 A;  1XNQ Q;  3GTM H;  1VQJ A;  1W2B A;  4BXX H;  2JA7 H;  3CCS A;  3HOU H;  3CXC A;  2N78 A;  4B3T Q;  2YU9 H;  3J81 j;  1YHB A;  2JA8 G;  2BH2 A;  3K0X A;  4P75 A;  5LMN L;  4BBS H;  4QIW E;  2LSS A;  2MNA A;  3CCM A;  3FKI G;  3HKZ E;  3OTO Q;  2UUC Q;  3EIV A;  4A93 H;  2MQH A;  4OWW B;  5GAE C;  3OTO L;  2UUC L;  4KI0 A;  2DUD A;  5C4X H;  4LNQ A;  4A3L G;  3CC2 A;  3S1N H;  1VQ8 A;  2Z6K C;  2K4K A;  2K5V A;  4DV3 Q;  3K80 C;  4YCV A;  2HHH Q;  4JBM A;  1HJP A;  4JI0 Q;  4L5S A;  1NY4 A;  4B3R Q;  1D7Q A;  1QVG A;  2HHH L;  4JI0 L;  1SLJ A;  2R92 G;  2PQA A;  2AWN A;  4JI1 Q;  1E1O A;  1KD1 C;  4PZ8 A;  4DK6 C;  4JI1 L;  1PA6 A;  4O2D A;  4IO9 A;  2OQ0 A;  1VQD A;  1HNX Q;  1JE5 A;  1PH3 A;  3DLL A;  4C3I H;  2E8G A;  4DUZ Q;  4A3J G;  1HNX L;  2CCZ A;  2BA0 A;  2ALY B;  2LXJ A;  4DUZ L;  2HQL A;  3CCQ A;  4A3F G;  4LFB Q;  3H15 A;  5E7N A;  3E9H A;  4GOP C;  3RNU A;  2R7Z H;  4LFB L;  3U50 C;  4JBW A;  3M4Q A;  1KRT A;  1EIY B;  4C3H H;  1KC8 C;  3I4M H;  2EIF A;  2Q2T A;  5JEA G;  4ME3 A;  3T1H Q;  1WCM G;  3T1H L;  1PFS A;  4OO1 I;  3CP0 A;  2JEA I;  3CME A;  3HOY G;  1UE1 A;  4GLX A;  2ZJQ A;  4O0A A;  1KRS A;  1WOC A;  2RF4 A;  4IOC A;  1XJV A;  2IHF A;  4RG1 A;  5GRO A;  5FLM G;  4HJ7 A;  1XMO Q;  1S40 A;  3HOW G;  4DR7 Q;  4UP7 A;  4BA1 I;  1TWC H;  1V9P A;  4X62 Q;  1XMO L;  2KCT A;  3NBH B;  4APV A;  5IP9 H;  1EOV A;  4AQY Q;  4DR7 L;  5DLQ E;  1YHA A;  4AQY L;  1A62 A;  4IPG A;  3CCR A;  1M90 C;  3H3V I;  1QZH A;  1Q1E A;  1CKN A;  4P74 A;  3G4S A;  4JI4 Q;  4OWX B;  2PQA B;  4GKK Q;  3CPW A;  4JI4 L;  1YHQ A;  2UXD Q;  4JG2 A;  4GKK L;  4MTN A;  1FJG Q;  3A0J A;  3BJU A;  2UXD L;  4OX9 Q;  1P8L A;  1I3Q H;  4OX9 L;  1H95 A;  1YBY A;  2D62 A;  4IJL A;  4HIK A;  2Y0S E;  2ZTD A;  3VDY A;  1O7I A;  1SRO A;  1CKO A;  5JJL A;  1CSP A;  2K14 A;  3L2P A;  3ERS X;  3E0E A;  2C35 B;  2YTV A;  4J15 A;  4QGU A;  2YYZ A;  4K0K L;  4DR5 L;  3CD6 A;  4DAY B;  4LF5 Q;  3S2D H;  4A3B G;  1OXT A;  1J5E Q;  1TWA H;  5ELN A;  1NMG A;  2YV5 A;  3RN2 A;  4LF5 L;  1J5E L;  3FHW A;  2R7F A;  4OON A;  1UE7 A;  1VQ6 A;  1C9O A;  3CMA A;  1YJN A;  3OYY A;  1XNR Q;  5BR8 Q;  2VZA A;  2JA8 H;  4AYB G;  1XNR L;  3F2B A;  2OCE A;  1PV4 A;  5BR8 L;  5JJI A;  4JOI C;  4IFD J;  2L15 A;  1WJJ A;  3F1Z A;  3FKI H;  4TQU S;  2EXD A;  4X6A H;  4GLA C;  3STB D;  1GKH A;  3JC6 6;  1AE2 A;  3ICE A;  1CKN B;  2WP8 J;  2IHE A;  4A3L H;  3ZJY C;  4JI2 Q;  3STB C;  4IFD I;  4JV5 Q;  1M1K C;  2UXB Q;  3PO2 G;  5JJK A;  4LWC A;  1HR0 L;  4JI2 L;  3KJP A;  1NE3 A;  1VQF A;  1EYG A;  4DR6 Q;  4DR3 Q;  2R92 H;  1OXU A;  4HIM A;  1JB7 A;  4NXN Q;  1CUK A;  2GVB A;  2RHQ B;  3ER0 A;  4DR3 L;  4NXN L;  4MZ9 A;  1YZ6 A;  2GVA A;  3CQZ H;  5C3E G;  1Q82 C;  3RN5 A;  1EWI A;  4DV7 Q;  1YIJ A;  2V1C C;  1A0I A;  4BA2 I;  1BKB A;  5H1S E;  1MJC A;  4A3J H;  5C4J H;  2ZTC A;  3KLW A;  4XTC S;  2A19 A;  5IY0 A;  1PH9 A;  3HOV G;  4A3D G;  4A3F H;  1N9W A;  2AMC B;  3U4Z A;  3M4O H;  5IE8 A;  1JMC A;  1VQA A;  4DV0 L;  3HFZ B;  2K75 A;  1SR3 A;  3M85 A;  4GKJ L;  2R93 G;  1QUQ A;  1HH2 P;  3UE1 A;  4L5R C;  2LXK A;  4DV1 L;  4BY1 G;  1L2F A;  1E24 A;  4AH6 A;  5IYB G;  3GTQ H;  1KAW A;  1WCM H;  4X66 Q;  3HOY H;  3OW2 A;  5LMN Q;  1LTL A;  4X66 L;  5FLM H;  1UE5 A;  3U58 A;  1I5F A;  3HOW H;  2UXC Q;  3M4P A;  1C0A A;  3TS2 A;  1QVF A;  4KHZ A;  3RZD H;  1N36 Q;  4MNO A;  2UXC L;  3L7Z C;  1OTC A;  3WWV A;  4JBK A;  3J7A 5;  2BA1 A;  4TVA B;  3I4O A;  1N36 L;  2E5L Q;  1YJ9 A;  1VQL A;  1G6P A;  2YTX A;  1HZ9 A;  1XMQ Q;  2E5L L;  3NEM A;  4JI8 L;  2E2J H;  2VUM G;  1MIU A;  1VCI A;  2NN6 G;  3CCJ A;  3CCU A;  1XMQ L;  4LF9 Q;  2BH8 A;  5M5W H;  4IPH A;  1HNW Q;  3DM3 A;  4GN5 A;  3W5O A;  1X9N A;  4LF9 L;  1HNW L;  1K3R A;  2N8N A;  1I94 Q;  4JI5 Q;  2UU9 Q;  4IPD A;  1I94 L;  1X54 A;  4JI5 L;  1JJ2 A;  1QVC A;  2MO1 A;  5IYD G;  2UU9 L;  4A3E G;  1K8G A;  1TWG H;  4WJ3 M;  5K36 G;  1OXS C;  1HZA A;  5ELO A;  4LF6 L;  3G6E A;  4LUZ A;  5C0X J;  1QUQ B;  4HJ9 A;  4UP8 A;  5M3M G;  1CSQ A;  2K5H A;  4P73 A;  4X65 Q;  4A3B H;  5IT9 c;  2E2H H;  1KXL A;  4X65 L;  3HOZ G;  1X65 A;  4DV4 Q;  3S1R H;  3MXN B;  2JA6 G;  3D31 A;  5C0X I;  3UDI A;  5M3F G;  3AFP A;  4NXM Q;  4DV4 L;  1PH1 A;  1KQS A;  2Q2U A;  1HZC A;  4KHP Q;  1VQ4 A;  4QJF A;  3RLO A;  1ASY A;  1VQ5 A;  4NXM L;  4LF7 Q;  4KHP L;  2CFM A;  5GAG C;  4HJA A;  1N33 L;  4LF7 L;  5EAY A;  2B3G A;  1WYD A;  1Y1V G;  2NZH A;  3K8A A;  5LMU L;  1E1T A;  3HOX G;  3AEV A;  2CWA A;  1DGS A;  1PH4 A;  4PZ7 A;  1IBK Q;  1TWH H;  1IBK L;  3PO2 H;  3A74 A;  4GNX A;  1Q1B A;  4DV6 Q;  2Q2I A;  1QZG A;  2N3S A;  4DV6 L;  1X3G A;  5HGQ A;  1YVC A;  3S24 A;  1GD7 A;  3Q8D A;  4RMF A;  2OWO A;  3F2D A;  1RL2 A;  3K7U C;  3KF8 B;  4LF8 Q;  2I0Q A;  3HKS A;  5C3E H;  1PH5 A;  3PGZ A;  4LF8 L;  1Q86 C;  4YY3 Q;  2OTL A;  3W1B A;  1VQ9 A;  2GN5 A;  4GLV B;  4PMW A;  4YY3 L;  4JI6 Q;  4BY7 G;  1BBU A;  1TXY A;  3PF4 A;  1S3O A;  3HOV H;  3PO3 G;  5FJ8 G;  2AKW B;  3KJO A;  4JI6 L;  2VL6 A;  4A3D H;  4JI3 Q;  2WAQ E;  1YJW A;  4DR5 Q;  4K0K Q;  1X3E A;  2F3I A;  4JI3 L;  5FLX c;  3BU2 A;  2R93 H;  1XPU A;  4P71 A;  2UUB L;  2HT1 A;  1UEB A;  4POG A;  3B6Y A;  3S17 H;  2VS1 A;  4LFA Q;  3EBE A;  3ULJ A;  4BY1 H;  1EQR A;  5IYB H;  4A3I G;  2ZM6 Q;  4LFA L;  2NVQ H;  1WFQ A;  4JYA Q;  1I6H H;  5LMN W;  2ZM6 L;  3GTK H;  1L1O A;  4EX5 A;  1B70 B;  1HZB A;  2PNH A;  4JYA L;  1B7Y B;  1OXX K;  2JK8 A;  5HY6 A;  3S2H H;  1LUZ A;  4UPA A;  4A3G G;  1SRU A;  4LW1 A;  1WI5 A;  4GNX B;  3HKZ G;  2QGQ A;  2PI2 A;  3KDF A;  3K81 C;  2OQK A;  5IP7 G;  1HR0 Q;  1VQK A;  2VUM H;  4IOA A;  1PH6 A;  5JEA J;  1IBM Q;  4X64 L;  4A93 G;  4BBR G;  1EIF A;  5GAD C;  1IBM L;  4R1J A;  4DR1 Q;  1K9M C;  4FDB A;  3RLN A;  4DR1 L;  1FGU A;  1FVI A;  1P16 A;  4YWM A;  3BZC A;  2JA5 G;  1U0L A;  3CCL A;  1L0W A;  1EUJ A;  3J81 i;  3UDG A;  5IYD H;  2VQF L;  4A3E H;  4A3M G;  4NPS A;  3PIP A;  4WJ4 A;  3S16 H;  1V1Q A;  1PVO A;  2OTJ A;  4A75 A;  4R4T A;  5M3M H;  1SE8 A;  4DV0 Q;  1MJE A;  1C7Y A;  4GKJ Q;  3PUX A;  4LF4 Q;  4GS3 A;  3PV0 A;  4PG3 A;  1YNX A;  3EN2 A;  4YCU A;  2F4V Q;  3HOZ H;  3S1M H;  4JV5 L;  2JA6 H;  4LF4 L;  4DUY Q;  3UE0 A;  1L1O B;  3G71 A;  4DV1 Q;  1Q8K A;  4JC0 A;  4DKA C;  2DGY A;  5M3F H;  1Y1W G;  2KEN A;  4DUY L;  1SFO H;  2F4V L;  3FP9 A;  4H02 A;  4YCW A;  3M7N A;  4GN4 B;  3NEL A;  4GOP A;  4OO1 G;  1VQO A;  1A8V A;  4POF A;  2K50 A;  1NBW A;  3G48 A;  2VNU D;  1SMX A;  3F8T A;  1BVS A;  1Y1V H;  3KDF B;  4DV2 L;  1X55 A;  3HOX H;  2JQO A;  2MO0 A;  2NZO A;  1K8A C;  3LGJ A;  3CPF A;  4JI8 Q;  3JAM i;  4HJ5 A;  3CC7 A;  1NMF A;  4DNI A;  2IX1 A;  1JJG A;  2D0O A;  1BBW A;  1VQ7 A;  1JT8 A;  2H5X A;  4DR2 Q;  2JEB I;  4C3J H;  3T1Y Q;  4UY8 C;  4B3M Q;  3GTO H;  2IY5 B;  1G29 1;  2VY3 A;  4OWT B;  4DR2 L;  3CCV A;  3T1Y L;  4YWL A;  4B3M L;  2B63 G;  5J3B A;  4A3K G;  3W1G A;  2N49 A;  1XNQ L;  1VQE A;  3GTG H;  1A63 A;  4UP9 A;  2WB1 E;  4C2M H;  3UDX A;  4BY7 H;  2A1A A;  1N8R C;  4YWK A;  3RLF A;  4AYB E;  1IBL Q;  4LF6 Q;  2Y0S G;  4B3T L;  5FJ8 H;  3PO3 H;  4A3C G;  1VQI A;  3ULL A;  1IBL L;  2WAQ G;  3TEH B;  1AH9 A;  1J6Q A;  1UWV A;  1JJC B;  4JCV E;  5M5Y H;  1KHI A;  2KBN A;  1KL9 A;  1X56 A;  2NVY H;  3I55 A;  1IL2 A;  1K83 H;  3GDE A;  5M5X H;  4GOP B;  4A3I H;  3F2C A;  3AYH B;  1PYS B;  2CQO A;  4IPC A;  3GO5 A;  1IXR A;  4DV3 L;  1EQQ A;  3I4N G;  2F52 A;  4B3R L;  3I7F A;  4R4Q A;  3CW2 C;  2Q2H A;  5C44 G;  1Y14 B;  1N33 Q;  3GD7 A;  3GTL H;  2FXQ A;  4LUO A;  4A3G H;  2I5L X;  1YEZ A;  5LMU Q;  4JI7 Q;  2RCN A;  3H0G G;  4DPG A;  1OXV A;  4JI7 L;  2B29 A;  1R9T H;  5IYC G;  2ZJP A;  4AIM A;  3MEF A;  4QY7 A;  5GQO A;  1KIX A;  1Q46 A;  5IP7 H;  1HR0 W;  4IFD G;  4JOI A;  1N32 Q;  1PH8 A;  1T9H A;  2R6G A;  2YTY A;  3UDF A;  1GO3 E;  2I5M X;  4BBR H;  3KOJ A;  1FL0 A;  3PUZ A;  4DK3 C;  3PCO B;  1N32 L;  1TWF H;  4YHH Q;  3KF6 A;  1U5K A;  3RR5 A;  2JA5 H;  2UUA Q;  2WFW A;  4LUV A;  4YHH L;  3CF5 A;  4QL5 A;  3PUW A;  4DV5 Q;  4HID A;  1ASZ A;  1Q7Y C;  2ZJR A;  3IRB A;  2D0P A;  1K73 C;  1VQP A;  4A3M H;  2UUA L;  4DV5 L;  1IZ6 A;  4BXX G;  2CWP A;  2KHI A;  5IWA Q;  3TS0 A;  1Z9F A;  2JA7 G;  3HOU G;  4OXP A;  4NB3 A;  5IWA L;  3J80 c;  4BBS G;  3BZK A;  4B3S Q;  1E22 A;  4A76 A;  1K0R A;  3K7A H;  3SGI A;  1VQH A;  2UUB Q;  4B3S L;  4X62 L;  4JBJ A;  2PMZ E;  3ULP A;  1B8A A;  3TRE A;  4R4I A;  1Y1W H;  1VQG A;  3GTJ H;  2K5N A;  5C4X G;  2KCM A;  2JJQ A;  2NN6 I;  2IT1 A;  2EQS A;  2AWO A;  3NEN A;  3J81 c;  1PH2 A;  1NTG A;  4L5T A;  3J7Z C;  4QQB X;  1XPO A;  1XPR A;  1VQM A;  2ES2 A;  3GTP H;  4Y52 H;  1X3F A;  3S15 H;  3U4V A;  4GN3 B;  1GM5 A;  3CAM A;  1Z47 A;  4P72 A;  3S1Q H;  1IYJ B;  2PI2 E;  2K52 A;  4HJ8 A;  3H3V H;  3J80 i;  1LYL A;  3PSI A;  3A5Z B;  1UE6 A;  1Q12 A;  3KF6 B;  1D8L A;  4X64 Q;  1PYB A;  4A4I A;  2VQE Q;  4EQ5 A;  3AFQ A;  4ALP A;  1GVP A;  3D0F A;  2VQE L;  2R7Z G;  2ASB A;  3E9I A;  3L0O A;  2B63 H;  1VQN A;  2A8V A;  4A3K H;  1VQB A;  2VQF Q;  3PF5 A;  3I4M G;  2ZTE A;  2Z6K A;  2WB1 G;  4DAM A;  1I50 H;  4A3C H;  1VQC A;  1RIP A;  4PZ6 A;  2AHO B;  2HIV A;  3PIO A;  3CCE A;  4GNX C;  1EFW A;  4LFC Q;  1YIT A;  3JAM c;  4LFC L;  1VS0 A;  3I2Z A;  1AE3 A;  2Z0S A;  5AJ3 Q;  3I56 A;  3RZO H;  2JE6 I;  4Y7N H;  1Q81 C;  3S14 H;  5IP9 G;  1G51 A;  1SN8 A;  5AJ3 L;  2QEX A;  2ID0 A;  3PUY A;  5C0X G;  1E7Z A;  3A5U A;  2UXB L;  3I4N H;  2QA4 A;  1MKH A;  1X6O A;  1NJI C;  4KLK A;  1YI2 A;  5C44 H;  2ATW A;  4DR4 Q;  4DR6 L;  1XTD A;  1S72 A;  2CKZ B;  4DV2 Q;  2IX0 A;  2XGT A;  2NVT H;  2KHJ A;  1HNZ Q;  4DR4 L;  3AQQ A;  1CKM A;  3H0G H;  4R4O A;  1HNZ L;  2MFI A;  1N34 Q;  5IYC H;  4DV7 L;  3KYH C;  3TQY A;  1LM0 A;  1N34 L;  2E2I H;  4L5Q A;  1PH7 A;  1V43 A;  4R4C A;  4IJH A;  3M3Y H;  2R7D A;  4XIG S;  1W3S A;  2HIX A;  3M9B A;  1L1O C; 
#chains in the Genus database with same CATH topology
 2NVY A;  1K83 A;  1FJG L;  4JI4 H;  1PHJ A;  3ORQ A;  1PFB A;  1RK6 A;  3TRZ A;  4HIO A;  1SYE A;  1NAP A;  1VQJ A;  1DIK A;  1KTK A;  2GA4 B;  1XDN A;  2JA7 H;  4IQZ A;  3KAL A;  3H0G B;  5H80 A;  2DN8 A;  2F0F A;  1YHB A;  2JA8 G;  4QB4 A;  5KGU A;  4QIW E;  4FXD A;  2MPM A;  4FP5 D;  3HKZ A;  1H9M A;  4J9L A;  1HQR D;  1PRT B;  2PYK A;  4OWW B;  4DR5 H;  3BQ2 A;  2BQU A;  5KFG A;  1LV9 A;  3IG0 A;  5EKL A;  2SEB D;  3S1N H;  1VQ8 A;  3DF7 A;  4XT1 B;  2F3V A;  2F0D A;  2E75 C;  2K4K A;  4B3R Q;  3LML A;  1NY4 A;  1D7Q A;  1SMY D;  2HHH L;  1G8Z D;  3K6O A;  3RGZ A;  2JA5 A;  2HVS A;  4L6T B;  4C2M B;  4JI1 Q;  1GSA A;  4O3N A;  1M8A A;  1E4E B;  4PZ8 A;  1W93 A;  5IYZ F;  2JEF A;  4DK6 C;  2RGR A;  3BG5 A;  3TQ1 A;  1AZP A;  4RCN A;  4IO9 A;  4HN7 A;  3ERQ A;  3EJI A;  1PH3 A;  2FK2 A;  3J80 W;  1V8Q A;  1HNX L;  4DUZ Q;  2PPB C;  4A3J G;  1YNJ D;  2NVY B;  2ALY B;  1K83 B;  2I07 B;  2XRS D;  3L4K A;  3MJF A;  1BF4 A;  1E2Z A;  3ETH A;  2EDG A;  3NHH A;  3GTJ A;  2RDF A;  2ZT9 C;  5JEA G;  1Q3L A;  3KHR A;  3EFX D;  1CHQ D;  5I4D A;  3T1H L;  5ELF A;  4APM A;  1X32 A;  3HKZ B;  1AFP A;  1S40 A;  2P0A A;  5GRO A;  1XMO Q;  3GTP A;  1IOV A;  4IAJ A;  1KAA A;  2F0L A;  4DR7 L;  2G9D A;  4APV A;  4E4T A;  4PMC A;  4DV0 H;  4BBR B;  2QDB A;  5C0X H;  4AQY L;  1O78 A;  1WTH A;  1JIC A;  2EYM A;  1A3T A;  3P75 A;  4MIU A;  2JA5 B;  1M0W A;  3T5J A;  4GKK Q;  1JWU D;  3FDT A;  4JI4 L;  4DV1 H;  4NDX A;  2RKS A;  2UXD Q;  4MTN A;  2BDN A;  2K03 A;  2B63 A;  4XDX A;  4OX9 Q;  5D1P A;  1B2T A;  5J2T F;  3G6X A;  5EGT A;  4J9O A;  1C48 A;  4X3T A;  2D62 A;  2DWC A;  3WOE A;  5CC4 A;  5JJL A;  2WAQ A;  1N36 H;  3L2P A;  4G3I A;  3ERS X;  3E0E A;  2C35 B;  2HUG A;  2PZW A;  2YYZ A;  4DR5 L;  3CD6 A;  3GTJ B;  3N6R A;  3FMC A;  4EFE A;  1OXT A;  1NUC A;  4J8Q A;  4DL5 A;  5C5L A;  2UVW A;  4OON A;  4LF9 H;  1VQ6 A;  1C9O A;  2UVV A;  2HVQ A;  2QK4 A;  4H0L C;  2HDM A;  3GTP B;  4IUN A;  2VZA A;  4R8N A;  1RDP D;  2OCE A;  2XN9 C;  5JJI A;  1N56 A;  3EPG A;  3NE5 B;  1Q8I A;  2L15 A;  1WJJ A;  2CW0 C;  3F1Z A;  4LF6 H;  3STB D;  3U9T A;  3JC6 6;  5EBD A;  1GXD C;  3BQ0 A;  3D6W A;  2BQ3 A;  1JB3 A;  3FDS A;  4JI2 Q;  4IFD I;  1M1K C;  2XD4 A;  4ME6 A;  1EHI A;  1SYF A;  4B9X A;  2B63 B;  3KJP A;  1NE3 A;  1BBX C;  1VQF A;  4DR6 Q;  5CV7 A;  2B2W A;  4DR3 Q;  4J9S A;  4DV4 H;  1E2W A;  2PZU A;  4NXM H;  2RHQ B;  5KFK A;  2QW7 A;  3H40 A;  1I4R A;  4O2A F;  1WCM A;  5C3E G;  4FNF A;  4LF7 H;  2WAQ B;  4MTK A;  3RN5 A;  1JOR A;  4DV7 Q;  1YIJ A;  2L5T A;  5LMU H;  1BKB A;  1N48 A;  2YZM A;  3N44 B;  1WTX A;  3VA5 A;  5IY0 A;  3SXH A;  3TP7 A;  2NTS A;  4C5B A;  4YQW A;  4DV0 L;  3HFZ B;  4YAJ B;  2KEE A;  2TSS A;  2PCF B;  1CS0 A;  1QUQ A;  3UE1 A;  5FD5 A;  2FLP A;  1ENA A;  4DV1 L;  2R84 A;  2RA4 A;  3TIG A;  2C00 A;  4G4K A;  4EGJ A;  1WCM H;  3HOY H;  3PIO 3;  4LF8 H;  3U9O A;  5FLM H;  5CA0 F;  2UXC Q;  5CV6 A;  1QVF A;  4KHZ A;  3RZD H;  4JI6 H;  1ULZ A;  1N36 L;  4JI3 H;  4K0K H;  3NEM A;  2YL2 A;  3WOF A;  3RB3 A;  3CCU A;  2YS7 A;  2FB9 A;  3DM3 A;  3VYU A;  2TMP A;  1WCM B;  3W5O A;  4LF9 L;  2F3W A;  3ND9 A;  1EU4 A;  2N8N A;  3OUU A;  2J6T A;  5EPL A;  4HMJ A;  4IPD A;  5K2M A;  4ZCK A;  1QVC A;  1MSG A;  1GUW A;  1Y8P B;  4K2K A;  3RZD B;  1OXS C;  4KKU A;  4LF6 L;  1WSC A;  2R3Z A;  4KD3 A;  3G6E A;  2J0T D;  4ABN A;  1QUQ B;  5KFP A;  5IT9 c;  2E2H H;  3V6K A;  4X3U A;  3H4D A;  1KXL A;  1HR0 H;  4X3S A;  4DL6 A;  2D5D A;  1X65 A;  3VR6 A;  3J7A F;  2CVR A;  5C0X I;  4DV4 L;  3QJY A;  2XIG A;  2Q2U A;  1HZC A;  2BDO A;  2J9G A;  4ED2 A;  4NXM L;  3LWU A;  3R3O A;  2VQF H;  4HJA A;  1PTO F;  4LF7 L;  2NZ1 D;  1AP0 A;  5LMU L;  4C3I B;  1DGS A;  1EIG A;  4PZ7 A;  1PH4 A;  1A6X A;  1Q90 A;  3PO2 H;  1Q1B A;  2AUJ D;  2MCT A;  3I4M B;  1TWA A;  4IUU A;  4KN7 C;  3MZ5 A;  5KFI A;  5F9L A;  2A69 D;  4DAP A;  4QWE A;  3HG9 A;  4LF8 L;  2OTL A;  4RNM A;  3C1E A;  3V6J A;  1M0T A;  2EYO A;  3T5K A;  3TP5 A;  4FF4 A;  1S3O A;  3HOV H;  3KTM A;  4RU9 A;  4JI6 L;  1TS4 A;  4DL2 A;  1YJW A;  3FKI A;  2GPS A;  1X3E A;  4JI3 L;  1PLF A;  4I4T F;  2HT1 A;  1D6E C;  3P1H A;  3S17 H;  2C2R A;  4YIJ A;  3TP8 A;  4TV8 F;  3I3C A;  5FOB B;  1EQR A;  5IYB H;  4Q5V A;  2ZM6 Q;  1S68 A;  5KFY A;  4JYA Q;  2NUA B;  5LMN W;  1L1O A;  3F8N A;  1HZB A;  3A8I E;  1FNU A;  2JK8 A;  1EYZ A;  1RHP A;  2L55 A;  4FF1 A;  4FF2 A;  1RJR A;  1IBL H;  3HKZ G;  3OWF A;  2VQD A;  3KDF A;  4CDF C;  5KNB A;  5A2Q L;  4K6L A;  2F0M A;  1WH2 A;  5ELD A;  2OQK A;  4IOA A;  1TWA B;  3G8C A;  2NN6 H;  1PH6 A;  3PVX A;  1EY5 A;  4BBR G;  2NU8 B;  4DR1 Q;  1GHJ A;  1PX2 A;  4B3R H;  5CMD A;  5FLX L;  2JA5 G;  5ELE A;  1L0W A;  3MR6 A;  5IT9 E;  2VQF L;  2DY7 A;  5HBR B;  3PIP A;  1JWS D;  3FKI B;  3S16 H;  1PVO A;  2R8J A;  1DD2 A;  1SE8 A;  1WTV A;  1MJE A;  4PG3 A;  2F4V Q;  2JA6 H;  4DUY Q;  1L1O B;  2HJW A;  2VB2 X;  4DKA C;  4L5S A;  5D8D A;  4H02 A;  4YCW A;  1EUC B;  3M7N A;  4GOP A;  3NEL A;  1GOZ A;  2XNA C;  4QMG A;  1S4Z A;  1VQO A;  3MR3 A;  4DV5 H;  1KJ8 A;  3TII A;  1NBW A;  1G2S A;  5LP6 F;  2VNU D;  1SMX A;  3MWD A;  2AGO A;  3KDF B;  1BVS A;  2YS6 A;  4MA0 A;  5IWA H;  3GTG A;  5C4J B;  2QKI C;  4FYD A;  1SCU B;  4IR9 A;  1F2Y A;  4JV0 A;  3NP8 A;  4A3F B;  3UFX B;  3OSP A;  2F0J A;  4IZ8 A;  2ZJT A;  3CC7 A;  5KFX A;  1BBW A;  5KT5 A;  2F0N A;  3EA6 A;  2FLN A;  2JEB I;  4LK1 C;  4B3M Q;  3GTO H;  4UCS A;  2B2V A;  2VY3 A;  4YWL A;  2B63 G;  3C0F B;  3GTG H;  2WB1 E;  3HOW B;  1RKN A;  3UDX A;  2GPW A;  3ULL A;  1EIH A;  1IBL L;  3TBI B;  2WAQ G;  5J1Z A;  1SE4 A;  5M5Y H;  4ED8 A;  1SYC A;  4ED1 A;  5M5X H;  1B9N A;  1W6J A;  1TWH A;  2R8K A;  5M5W B;  4GOP B;  4A3I H;  3F2C A;  3PQI A;  2HDL A;  4RNO A;  1OWT A;  3IFT A;  5JVD F;  3EPI A;  1TWF A;  4B3R L;  3SE0 A;  4R4Q A;  3CW2 C;  5FPO A;  3GTG B;  1EY6 A;  4LUO A;  1J9O A;  3OIP A;  3K5L A;  4A3G H;  2I5L X;  3LWE A;  4J1M A;  3BQ1 A;  2O4X A;  2AU0 A;  3Q8P B;  4DPG A;  4TQR A;  3QR8 A;  1RTO A;  1S9F A;  1HR0 W;  1VMP A;  3MEF A;  4QY7 A;  3R2I A;  1FD7 D;  1Q46 A;  4A3B B;  3TIN A;  4QWD A;  1PH8 A;  2R6G A;  2YTY A;  5FLX W;  4XQQ A;  1CI3 M;  2ICI A;  3PCO B;  3TZD A;  1TWF H;  1X3P A;  2R93 A;  1U5K A;  3E0J A;  1KBL A;  4HID A;  3HRZ C;  3OIQ A;  3T5H A;  1ASZ A;  3BJY A;  5JVG 3;  4DR6 H;  3PR4 A;  1Q7Y C;  3IRB A;  1A3V A;  1K73 C;  5CR3 A;  4A3M H;  4DV5 L;  5LA6 F;  4KMU C;  1DON A;  1Z2N X;  2CWP A;  2KHI A;  1HNZ H;  3QFF A;  1S10 A;  5J39 A;  2KVM A;  5IWA L;  3JZI A;  4DV7 H;  4DGZ A;  1STY A;  1AUV A;  2IMW P;  1E22 A;  1MSH A;  1TWH B;  3K7A H;  1RCV D;  2UUB Q;  5JPN C;  3ULP A;  1B8A A;  2I87 A;  2V59 A;  3OUZ A;  4R4I A;  1TWF B;  3A7A B;  4QCL A;  3T4A C;  5KFE A;  2VUM A;  1Z2O X;  4GC6 A;  2JJQ A;  2NN6 I;  2IT1 A;  2EQS A;  3MC0 B;  1PH2 A;  2R6F A;  1DJR D;  4O3O A;  2W6N A;  4QQB X;  1XPO A;  2V4D A;  2ES2 A;  3NTK A;  1X3F A;  1FYC A;  5LXT F;  2KCC A;  3U9S A;  5IGC A;  3RB6 A;  4YR0 A;  4A3D B;  2Z6B A;  4GN3 B;  1GM5 A;  3S1Q H;  1YNN D;  2F03 A;  2PI2 E;  2K52 A;  2PN1 A;  1LYL A;  3PSI A;  1JOK A;  1UE6 A;  2R93 B;  1GSH A;  4C3I G;  3OTO H;  2UUC H;  1JX4 A;  2F0P A;  3E6Z X;  2R82 A;  4ALP A;  1ZQ7 A;  5EPJ A;  2NVQ B;  5IGE A;  1I6H B;  3NWT A;  1BGW A;  2BQR A;  1VQB A;  3OMG A;  3I4M G;  3PF5 A;  2Z6K A;  1I50 H;  2IW3 A;  4KY5 A;  1KJI A;  1I7N A;  4IRC A;  3CCE A;  4GNX C;  2HIV A;  1EFW A;  4LFC Q;  1Y1V A;  2BOS A;  1YIT A;  1C30 A;  3RZO H;  1AE3 A;  2Z0S A;  1ROD A;  2J4X A;  2VUM B;  4LMQ D;  3Q8R B;  5D3D A;  1EYA A;  1SN8 A;  1IL8 A;  2FHT A;  3I91 A;  4LFB H;  2NTT A;  2QA4 A;  1X6O A;  4KLK A;  3GIL A;  3BVM A;  1B4O A;  5C44 H;  2ATW A;  3NK9 A;  4DR4 Q;  4DR6 L;  2OEO A;  2MHV A;  4HQ6 A;  5F9N A;  2V9W A;  4DV2 Q;  1WTP A;  2XGT A;  3AQQ A;  2FMM A;  1HNZ L;  1STA A;  1N34 Q;  4EGQ A;  2IPK D;  5IYC H;  4Q45 A;  4DV7 L;  5IGF A;  2LFN A;  4C1N K;  2J6S A;  4DF7 A;  1QE6 A;  4IUV A;  3H09 A;  2OLS A;  4XIG S;  2HIX A;  3RUP A;  1E3P A;  5EKI A;  4QF4 A;  2NVX H;  1HRJ A;  3QZ8 A;  2D2C C;  2XTI A;  5GAH C;  1UEA B;  4LH7 A;  5ELB A;  1XNQ Q;  2Z1C A;  2BR0 A;  4FU0 A;  2DJF C;  4BXX H;  1A3U A;  1Y1V B;  3H91 A;  3GTL A;  3T56 B;  4BBS H;  4S3S A;  1STB A;  3CCM A;  2MNA A;  1TT2 A;  3FKI G;  3HKZ E;  1KDA A;  3G6J B;  1EUD B;  2EYF A;  2EJF C;  3EIV A;  2HGS A;  3OTO L;  2UUC L;  5CAE B;  4A2A A;  1XX8 A;  2M05 A;  4A3L G;  3CC2 A;  4C3J B;  4LF5 H;  3NBH A;  1GJX A;  1J5E H;  5G3L D;  4JI0 Q;  3UI2 A;  1EY0 A;  4ODG A;  4XQN A;  3RAQ A;  1I4X A;  3NBI A;  1SEI A;  2PQA A;  2EE1 A;  2F0G A;  4BY7 B;  1KD1 C;  1XNR H;  3PO3 B;  1PA6 A;  4XYM B;  1VF5 C;  3C2P A;  4HNU A;  2BA0 A;  2MJ8 A;  1HQM C;  4NW2 A;  5CBA E;  2R8G A;  1IYV A;  2HQL A;  4A3F G;  2L1B A;  5E7N A;  1QWY A;  3K57 A;  2I80 A;  2R7Z H;  4LFB L;  3U50 C;  4JBW A;  2IJ0 A;  4KTA A;  5LL6 b;  1XXG A;  2JP1 A;  3M4Q A;  1E4G T;  4I50 F;  4EVO A;  1KC8 C;  4HED A;  3IKJ A;  3GTL B;  4MV3 A;  3OHB A;  4CC6 A;  4NXN H;  3J81 W;  1PFS A;  3CP0 A;  3CME A;  2OF1 A;  2K1B A;  4IUQ A;  4RG1 A;  4IWY A;  4HJ7 A;  3HOW G;  5AFW A;  5FO7 B;  4BA1 I;  1KJQ A;  5IP9 H;  3I72 A;  3NBH B;  1EOV A;  5DLQ E;  1I4G A;  4A93 B;  1A62 A;  4IPG A;  1M90 C;  1Q1E A;  3G4S A;  5JVH 3;  1JCK B;  1EQV A;  2PQA B;  5CYU A;  4CHT B;  3OWE B;  1YHQ A;  1PTO H;  1T94 A;  4JG2 A;  4Q0Y A;  5IT9 L;  1I7L A;  3A0J A;  2W9A A;  2KEC A;  3RAX A;  4X66 H;  1I3Q H;  3DXJ C;  1TA8 A;  5KFO A;  2RSN A;  2W71 A;  2XVS A;  5JUM A;  4YR3 A;  1SRO A;  2RBM A;  1CSP A;  2K14 A;  4QGU A;  4J15 A;  3JAM W;  5FK9 C;  4UCT A;  4ECR A;  2E5L H;  4A3B G;  1XMQ H;  4LF5 L;  4KKT A;  5M9O A;  1J5E L;  1WD0 A;  3NQI A;  1HNW H;  1JQY D;  3CMA A;  1YJN A;  3OYY A;  1QJO A;  3GV8 B;  1I94 H;  2CW0 D;  5BR8 Q;  5DM6 3;  4RB2 C;  3S15 B;  4I55 F;  1XNR L;  3F2B A;  5DG7 A;  2UU9 H;  4JOI C;  1M6V A;  3RFC A;  1C8C A;  2EXD A;  4GLA C;  1Z2P X;  2QDL A;  1GKH A;  2W6P A;  3SVM A;  2E2I A;  2CH4 A;  1GHK A;  5EQ0 A;  3ZJY C;  3SK8 A;  5JJK A;  4X65 H;  1TY0 A;  2UXB Q;  5GON F;  4LWC A;  2KUM A;  4U68 A;  4U7C A;  1K8M A;  1EYG A;  3ORR A;  4O3P A;  3GQC A;  2R92 H;  2Q8R E;  4HIM A;  2GVB A;  3ER0 A;  4RAY A;  3PR5 B;  4NXN L;  3NGD A;  4MZ9 A;  1BCP C;  2X6G A;  2XIW A;  3CQZ H;  4J9N A;  2O5I C;  3DEO A;  4A2B A;  1WD1 A;  2JA7 A;  1MD2 D;  2V1C C;  1PH9 A;  3S14 B;  4Y7N B;  2RVL A;  3V4Z A;  4V0B A;  4A3D G;  1IBK H;  1N9W A;  3URY A;  2AMC B;  5IE8 A;  1VQA A;  4K6D A;  2R93 G;  3I4N B;  4L5R C;  5KG4 A;  1L2F A;  1E24 A;  1PK8 A;  3PN1 A;  1EWH A;  3MAQ A;  1KLU D;  1V4Y A;  4X66 L;  4PQX A;  3JSL A;  3VA7 A;  5KFH A;  1C0A A;  2E2I B;  3TS2 A;  1SND A;  3QOJ A;  3K59 A;  1OTC A;  3M3Y B;  4TVA B;  3I4O A;  4J9Q A;  4K5V A;  1VQL A;  1G6P A;  3KLS A;  4MTE A;  2YTX A;  3MEH A;  2UUB H;  2E5L L;  5EOY A;  1HHV A;  5KFN A;  1FR3 A;  2E2J H;  2VUM G;  1MIU A;  2EY5 A;  3CCJ A;  1XMQ L;  4IPH A;  3I12 A;  1HNW L;  5LL6 X;  4JI5 Q;  4CKC A;  2JA7 B;  1I94 L;  1X54 A;  2YCH A;  2UU9 L;  5IYD G;  1STE A;  5K36 G;  1HZA A;  5ELO A;  2K32 A;  2CW7 A;  5JH7 F;  1O7Z A;  2PW7 A;  4ECT A;  4HJ9 A;  3IAY A;  2M2L A;  3DWA A;  4P73 A;  2B2W C;  4L63 B;  3C3L A;  3S1N B;  2IL8 A;  4X65 L;  4O4I F;  4RUC A;  4DN4 M;  4XZ3 B;  4JVZ A;  4RGO S;  4KHP Q;  4QJF A;  4HYK A;  1SYG A;  3GIQ A;  4ECX A;  1HTP A;  3T16 A;  3TN2 A;  3JRX A;  4UAI A;  3V96 A;  2I46 A;  1WYD A;  1LTS D;  1Y1V G;  3K8A A;  1E1T A;  2CWA A;  2ZDQ A;  5CB4 F;  3PW7 A;  1SJH D;  3H94 A;  4KV6 A;  2AQ1 B;  3Q24 A;  3P20 A;  1IBK L;  2JEJ A;  4DV6 Q;  3Q1K A;  5KX5 F;  1EZ8 A;  1X3G A;  4IRK A;  3CU7 A;  5J22 A;  4C3J G;  3F2D A;  1RL2 A;  5DNF A;  2I0Q A;  4EBC A;  4DV2 H;  4YY3 Q;  1UAP A;  3DHQ A;  3W1B A;  3N43 B;  1JOO A;  4BY7 G;  4J9M A;  3PO3 G;  1H9R A;  5KT7 A;  2RDG A;  1ESR A;  5FJ8 G;  2AKW B;  1B3A A;  1B53 A;  2RSO A;  4U67 3;  4RB3 C;  2F3I A;  2KJX A;  2MUY A;  4JW0 A;  4ULL A;  3HEJ A;  2UUB L;  1EYD A;  4EG0 A;  3FRP B;  2VS1 A;  4LFA Q;  3EBE A;  1K28 A;  4BY1 H;  2EY2 A;  3SI8 A;  4O3R A;  3T1Y H;  3QG1 A;  2B2U C;  4TSS A;  1UC9 A;  4NP5 A;  2VA3 A;  2HCI A;  1B70 B;  2PNH A;  1XNQ H;  1OXX K;  2EY6 A;  1HA5 A;  4RA8 A;  3S2H H;  2CZG A;  1B3Q A;  1W96 A;  1LUZ A;  5KT4 A;  2EJM A;  4FM9 A;  4LW1 A;  4RZQ A;  1IHZ A;  2SOB A;  1HA6 A;  5C5J A;  1WI5 A;  1CQI B;  4M8A A;  2FIN B;  1AN7 A;  1NNX A;  5IP7 G;  4RFB A;  5JEA J;  1IBM Q;  2PW5 A;  2JN4 A;  2KHS A;  4A93 G;  5GAD C;  1EIF A;  3UQ8 A;  4G57 A;  1K9M C;  1II3 A;  1E0B A;  3RLN A;  1FGU A;  1FVI A;  4WOR A;  1U0L A;  4K5W A;  1W6K A;  4O2B F;  3UDG A;  1ILP A;  3GQB A;  4A3E H;  1U4L A;  2B2T C;  2F0Q A;  4NPS A;  4WJ4 A;  2ICE C;  4FS1 A;  1L0Y B;  1E4F T;  5DQG A;  2OTJ A;  4A75 A;  5C1P A;  1SNM A;  3MXP A;  5M3M H;  4OIK A;  1C7Y A;  3PUX A;  1TU2 B;  4YCU A;  4LF4 Q;  3EN2 A;  3HOZ H;  4PMB A;  3S1M H;  2QYZ A;  3UE0 A;  5M3F H;  3K5H A;  2DGY A;  4IZO A;  1SJE D;  4H13 C;  4YHH H;  1DV1 A;  3NTI A;  1GGO A;  1JE4 A;  4GN4 B;  4BWG B;  3JRW A;  4A3E B;  2C5C A;  4M9U A;  3OHX C;  2CH4 W;  3F8T A;  3MXG A;  4DV2 L;  1QCB D;  1Z6H A;  3HOX H;  1Y69 U;  2NZO A;  4CGY B;  2GLT A;  1ESF A;  4ED7 A;  2QF7 A;  1A2U A;  4B3S H;  2QCP X;  5COR A;  1NMF A;  1T3N A;  1BUV T;  1VQ7 A;  1JT8 A;  5M3F B;  3VPD A;  3PW0 A;  2H5X A;  2ZXP A;  4DR2 Q;  5EKK A;  1GUG A;  3MHB A;  2E2H A;  3TSS A;  3SE7 A;  2KA7 A;  4MV1 A;  3T1Y L;  2L4N A;  3HOY B;  4ZQ3 A;  4FO2 A;  1QIL A;  1QNK A;  1XNQ L;  4LAA A;  4UP9 A;  3RIZ A;  2A1A A;  1GUS A;  3RLF A;  1LT5 D;  4AYB A;  3AB9 A;  4QIW A;  3TEH B;  4N9T A;  3GLK A;  1F2L A;  1JJC B;  4JCV E;  1BNZ A;  1IYU A;  3VR2 A;  2JXM B;  4DK1 A;  3I55 A;  1IL2 A;  4EFB A;  2CQY A;  2FPG B;  2W6M A;  2CQO A;  1C4Q A;  3I4N G;  1EQQ A;  1BNC A;  3D4D A;  1N33 Q;  4PWQ A;  3FVQ A;  1HFG A;  2EZV A;  4XX0 B;  1YEZ A;  1S97 A;  4JI7 Q;  2RCN A;  3V2T A;  1AUX A;  2Z8L A;  3H0G G;  4J9K A;  3I73 A;  1J8I A;  1R9T H;  1ET9 A;  3PW2 A;  4V19 0;  4F87 A;  4IFD G;  2E2H B;  1N32 Q;  1SXT A;  5DGA A;  4XYL B;  3RV4 A;  4FVM A;  3NPP A;  5DG8 A;  1MZB A;  2UXB H;  1B6S A;  3BDL A;  3KF6 A;  3CHB D;  3RBD A;  3RR5 A;  5C6A A;  1Y1W A;  2UUA Q;  4F88 A;  2QIL A;  4YHH L;  1CQV A;  5I9P A;  1GSO A;  4AYB B;  2P5Z X;  2ZJR A;  3R23 A;  2D0P A;  5FD6 A;  1KNE A;  4FS2 A;  4QIW B;  5KG0 A;  4DK0 A;  1F77 A;  1VF7 A;  2JA7 G;  1STH A;  1IKL A;  3K5O A;  4NB3 A;  5E1F A;  3J80 c;  2RDJ A;  3CKI B;  3PO2 B;  2R7N A;  1VQH A;  1QB5 D;  4B3S L;  1PDQ A;  2B2V C;  4ZKB B;  1QNU A;  4JBJ A;  2V5A A;  2PMZ E;  1O75 A;  2EVB A;  3WNZ A;  5CA1 F;  3FMA A;  1Y1W H;  2F0V A;  1LTB D;  3HS0 C;  3VYS A;  3ERO A;  5TSS A;  4DNT B;  3NSW A;  4OO1 H;  4XYO A;  1DOK A;  2NU6 B;  5I9O A;  2DNE A;  3J7Z C;  1XPR A;  3HOV B;  3R5H A;  1Z47 A;  4OHJ A;  1ZKO A;  1PTO D;  2RDI A;  3KF6 B;  2VPS A;  1ML0 D;  1Y1W B;  3S17 B;  1PYB A;  1K1Q A;  4IWX A;  2VQE Q;  3RF2 A;  1GVP A;  5FO8 B;  2K04 A;  2JA6 A;  2A8V A;  4A3K H;  2A73 B;  1LTT D;  1LTA D;  4A3C H;  4JI1 H;  2ENB A;  2WE6 A;  2AHO B;  4K5X A;  3DM1 A;  3BAB A;  1VS0 A;  2AUK A;  4DUZ H;  2WAC A;  2PZT A;  2EY1 A;  2MGS A;  5AJ3 L;  2ID0 A;  5C0X G;  1IKM A;  1CTM A;  3FPP A;  2UXB L;  1SE3 A;  3G6Y A;  2B8G A;  3W3A A;  3VR3 A;  1D5M C;  4F7X A;  1YI2 A;  3GTO A;  1LTI D;  2CKZ B;  2NVT H;  3G7L A;  3SK4 A;  3S16 B;  1CKM A;  1BOS A;  3VR5 A;  1H9K A;  5EWE A;  1WR2 A;  3KYH C;  3GIK A;  1XMO H;  4G7Z C;  4YAK B;  4IJH A;  3MR5 A;  1CZG A;  3QOL A;  2AQ2 B;  2R7D A;  2JA6 B;  2A5H A;  5KFF A;  4QWB A;  3D6C A;  3MA2 B;  1FJG Q;  2I5H A;  5IOD A;  4XYQ A;  5BMV F;  3CC4 A;  1UUP A;  3J80 E;  5BPH A;  5DQI A;  3KFU A;  4GKK H;  1RF2 D;  4ECS A;  2A6E D;  3CRK C;  2RHS B;  2UXD H;  3GTM H;  2C28 A;  2C2E A;  3HOU H;  5L1I A;  3CXC A;  4OX9 H;  2N78 A;  3J81 j;  4ECQ A;  2BH2 A;  4RAZ A;  4P75 A;  2LS0 1;  2LSS A;  5DEH A;  5BN4 A;  3IL8 A;  1S0N A;  3KK7 A;  4C1N I;  1EEI D;  1SNP A;  5GAE C;  1B33 N;  4KI0 A;  1K3B C;  4FXK C;  5C4X H;  4LNQ A;  3A55 A;  3PMF A;  5CV8 A;  3GTO B;  2Z6K C;  4JK1 C;  4DV3 Q;  2HHH Q;  2LKV A;  3K80 C;  4YCV A;  1TAE A;  1EZ6 A;  1STN A;  2NU7 B;  1D5X C;  1QVG A;  4KKS A;  1BJT A;  4N8X 1;  1TVX A;  2AWN A;  5COY A;  5D3I B;  3RMH A;  4F50 A;  3C46 A;  4JPB W;  5A2Q W;  3SR1 A;  2KOL A;  4JI1 L;  1TR5 A;  4UCU A;  4O3S A;  1LAC A;  1STG A;  1VQD A;  3QWN A;  1JE5 A;  1HNX Q;  5KT2 A;  2FLL A;  5D65 A;  5M5Y B;  3DLL A;  3I4L A;  2CCZ A;  2E8G A;  1DZ1 A;  5EZY F;  4ECW A;  4DUZ L;  5M5X B;  2VXW A;  5T1I A;  3CCQ A;  5KG6 A;  3E9H A;  4A3I B;  4JI2 H;  2FE3 A;  1ET6 A;  1F9P A;  1KRT A;  2B2Y A;  4C3H H;  4DAY A;  4DL4 A;  5ELC A;  2EIF A;  1C3O A;  1A2T A;  4WRD A;  3T1H Q;  4DR3 H;  1H9J A;  4A3G B;  1WCM G;  1A9X A;  4RZR A;  4OO1 I;  2JEA I;  4FF3 A;  3HOY G;  1UE1 A;  3I8Z A;  1TS5 A;  4GLX A;  1TY2 A;  3TME A;  4O0A A;  1KRS A;  4IOC A;  2RF4 A;  1XTC D;  5EJW A;  2IHF A;  5FLM G;  1XJV A;  2I8C A;  5FKA C;  4HCE A;  3J7A V;  4M7E A;  4DR7 Q;  4ED3 A;  1TWC H;  4X62 Q;  1XMO L;  5I47 A;  5IIF A;  4ZUJ A;  5L1L A;  1BCP F;  4AQY Q;  5KG7 A;  4PV1 C;  4IAL A;  5KFW A;  4RB1 A;  4P74 A;  4JI4 Q;  2W6Q A;  4C3H B;  4OWX B;  2K33 A;  2NB0 A;  3MFH A;  3CPW A;  4NKL A;  4H44 C;  4GKK L;  4A3M B;  4UCV A;  1CZW A;  3BJU A;  4KN4 C;  4EGV A;  2UXD L;  2PBZ A;  3MR2 A;  5KIX A;  1P8L A;  1EY7 A;  4OX9 L;  2M9V A;  1H95 A;  1YBY A;  1I50 A;  2UXC H;  5JJZ A;  2ZTD A;  3K7A B;  2Y0S A;  3L3O C;  1CKO A;  2K28 A;  1EWC A;  2KQ3 A;  2SDF A;  2EOT A;  4DAY B;  3S2D H;  3TDQ A;  5ELN A;  1UE7 A;  2NBF A;  5E4W C;  3MWM A;  4QWC A;  4E6I A;  4C56 C;  4F4Y A;  4L8J A;  2JA8 H;  4AYB G;  1PV4 A;  4MV4 A;  3S1Q B;  5DLG A;  4G7H C;  2E2D C;  4X6A H;  1VKZ A;  2F4I A;  4XQJ A;  2ZDH A;  1FGB D;  3ICE A;  2WP8 J;  1DXM A;  1M4V A;  2XCL A;  3ONA B;  3PO2 G;  4TKO B;  4ZHQ F;  1T36 A;  4JI2 L;  3MWE A;  5CV5 A;  1BCP D;  1AEX A;  2NVX A;  4DR3 L;  1I50 B;  1DOM A;  2Y0S B;  2R7M A;  1N33 H;  2Q8T A;  1EWI A;  1A0I A;  3D4W A;  1QOH A;  1K0S A;  1RYS A;  1MJC A;  2B8F A;  2N55 A;  4A3J H;  3RZO B;  3KLW A;  4XTC S;  3HOV G;  2A19 A;  5C1O A;  1IW7 C;  3M4O H;  3U4Z A;  1SR3 A;  3M85 A;  2DY8 A;  3K58 A;  2R7K A;  2K01 A;  2AGP A;  2IBK A;  5JEA H;  5C44 B;  4UHV A;  3GTQ H;  4AH6 A;  5IGG A;  5IYB G;  4I65 A;  1KAW A;  2WII B;  1RJQ A;  3I70 A;  3MXN A;  5LMN Q;  1LTL A;  1UE5 A;  2B39 A;  1I5F A;  3M4P A;  2DLN A;  2UXC L;  1N36 Q;  3Q8Q B;  4WBN F;  3J7A 5;  2BA1 A;  5KG3 A;  4GKJ H;  1HZ9 A;  1RD9 D;  4QWA A;  2NVX B;  1VCI A;  2NN6 G;  4LF9 Q;  1PXU A;  2BH8 A;  2OH2 A;  2R7Z A;  5DAU A;  2SCU B;  4B9W A;  1K3R A;  2FK1 A;  2ZM6 H;  1NCV A;  4JYA H;  5DLF A;  2W57 A;  1TQO A;  1VDZ A;  1JJ2 A;  2WB1 A;  4BBS B;  1F9Q A;  1SNO A;  3KF8 A;  1K8G A;  1TWG H;  4WJ3 M;  3RBE A;  1EYC A;  1ZYR C;  1BXR A;  1CE8 A;  2ASL A;  1PRT C;  1EU3 A;  2HQE A;  4UP8 A;  3PZP A;  1CSQ A;  1JC7 A;  3SEB A;  4J0M A;  2R86 A;  1Y8N B;  4DV4 Q;  3S1R H;  1LT3 D;  3MXN B;  4HTH A;  2A68 C;  3D31 A;  2JA6 G;  3UDI A;  1D1K A;  4DR1 H;  2C2D A;  4NXM Q;  1KQS A;  3K3P A;  5K5P A;  3RLO A;  1WTQ A;  4LF7 Q;  1JIH A;  3BG3 A;  2CFM A;  2ZXO A;  1MI2 A;  1N33 L;  3JSN A;  1SYD A;  5EAY A;  3VPB A;  4TRD A;  3HP3 A;  2B3G A;  1I3Q A;  5KEE A;  4IHJ F;  2X69 A;  2FKL A;  1EL0 A;  4CDD C;  1ENF A;  1ENC A;  1G2T A;  4GNX A;  2R7Z B;  1B6R A;  3DUZ A;  2Q2I A;  2F4V H;  2A6H C;  5HGQ A;  1YVC A;  4DUY H;  4RMF A;  2OWO A;  2WB1 B;  2FJ2 A;  3KF8 B;  3RGX A;  1GYF A;  4LF8 Q;  3SK6 A;  1WTO A;  5C3E H;  1PH5 A;  3HGB A;  3BA9 A;  4R8U A;  2GN5 A;  4JI6 Q;  3PF4 A;  3E3X A;  1SYB A;  3L4J A;  3KJO A;  1D5Z C;  4JI3 Q;  2WAQ E;  4K0K Q;  2W70 A;  4K8J A;  2KCN A;  5FLX c;  2F1M A;  3QZ7 A;  2MP1 A;  1I4H A;  2XCA A;  4P71 A;  1KNA A;  3KAJ A;  4POG A;  3RB0 A;  1JDE A;  1PTO B;  4C5A A;  5BN3 A;  5KFM A;  4A3I G;  4B3M H;  1PFN A;  1H9S A;  2ZM6 L;  4EX5 A;  4JYA L;  1I3Q B;  2R92 A;  3S9W A;  5KFR A;  1ZEQ X;  2XSC A;  4A3G G;  2WTF A;  3CQZ A;  4HR7 A;  4GNX B;  3EYY A;  2QGQ A;  4ZQI A;  2PI2 A;  2VPQ A;  4YB8 B;  3E5N A;  1RYR A;  2W7O A;  2X0S A;  1HR0 Q;  5C8Y F;  2R8H A;  2N88 A;  4OL7 A;  3J80 L;  4R1J A;  4FDB A;  2IA6 A;  4DV3 H;  4DR1 L;  3V4S A;  3CCL A;  3BZC A;  3OMC A;  4R8U B;  1U4R A;  3AU7 A;  5L1J A;  3J81 i;  1RK5 A;  2AGQ A;  1FNW A;  3M9N B;  4A3M G;  1B50 A;  1MBY A;  4ZRZ A;  4MA5 A;  5KRU A;  3H3V C;  1LT6 D;  1O7L A;  3KHH A;  4HSV A;  4GKJ Q;  5E4X A;  1V1P A;  5EPK A;  3PV0 A;  2W8L A;  1EOT A;  1YNX A;  1LAB A;  3A54 A;  1H9S B;  3G71 A;  4JC0 A;  3N52 A;  2F4V L;  1K1S A;  1SFO H;  2KEN A;  4DUY L;  2R92 B;  3Q8S B;  4UFZ A;  3FP9 A;  3K0Y A;  4R9W A;  1SE2 A;  2L9H A;  1DM0 B;  1A8V A;  3SHL A;  3CQZ B;  4POF A;  4HR7 B;  2K50 A;  4EBE A;  1LTG D;  2WYO A;  3NQT A;  1X55 A;  3LP8 A;  3KBG A;  4JV2 A;  2MO0 A;  3CPF A;  3MXU A;  4X62 H;  5T1G A;  5JOB A;  2XC9 A;  4JI8 Q;  1RJT A;  3JAM i;  4DNI A;  2F0S A;  2D0O A;  5IT9 W;  4RB0 A;  2XGQ A;  1HPC A;  4M1U B;  2W6Z A;  4EQN A;  1HCZ A;  2IY5 B;  4B3M L;  1OO9 B;  3W1G A;  5FLX E;  2N49 A;  3NUC A;  1A63 A;  1BO0 A;  4C2M H;  1CT1 D;  2K5Q A;  4AYB E;  1IBL Q;  4N9P A;  1CK1 A;  2Y0S G;  1KJ9 A;  3V05 A;  3HBL A;  1V1P B;  1VQI A;  4CJ2 C;  1AH9 A;  1D2B A;  2RQX A;  2KBN A;  1KL9 A;  4RUA A;  2NVY H;  2E2J B;  4RKB A;  1K83 H;  3GDE A;  1AN8 A;  3O13 A;  5CV4 A;  1PYS B;  3GO5 A;  1IXR A;  4DV3 L;  1E2V A;  3I7F A;  2IX3 A;  4IN3 A;  2Q2H A;  5C44 G;  5DM7 3;  3GD7 A;  4IUT A;  4ED6 A;  1SAP A;  5LOV F;  5LL6 S;  2EPB A;  1JOQ A;  2NU9 B;  5KFC A;  4LFC H;  5IYC G;  3EQL C;  4AIM A;  4UDU C;  1KIX A;  5GQO A;  3R93 A;  2HVR A;  1EFI D;  2L11 A;  4JOI A;  1JLL B;  2ALZ A;  3W2D A;  2BE5 C;  4BBR H;  1GO3 E;  2I5M X;  5BPF A;  1FL0 A;  3N40 P;  3QIA A;  1QG7 A;  2JA5 H;  4O3Q A;  3TP6 A;  2WFW A;  4R8I A;  3PUW A;  3MTS A;  4DV5 Q;  3BVG A;  1NR4 A;  5L37 A;  1VQP A;  4DR4 H;  3VYR A;  4X3K A;  1L0X B;  4BXX G;  1LT4 D;  5IWA Q;  2EXZ A;  3TS0 A;  3T53 B;  1Z9F A;  5KFU A;  5NUC A;  2F0W A;  3OSN A;  3IFD A;  4BBS G;  3BDO A;  1N34 H;  2FMA A;  4MHE A;  3HZX A;  1K0R A;  4A76 A;  3LX0 A;  4YJ3 F;  2EYH A;  4EQO A;  1LTR D;  4X62 L;  4J6H A;  3QB3 A;  3TRE A;  3ZYY X;  5JVL A;  3GTJ H;  1EY4 A;  1I6V C;  1HTL D;  1I4P A;  2Q8I B;  5KFA A;  2C9O A;  4U6P A;  2AWO A;  3NEN A;  3J81 c;  4I7Z C;  4TQS A;  1NTG A;  1VAJ A;  1U4M A;  3KLR A;  4ZAI A;  3A56 A;  3GTP H;  1EY8 A;  5CBE E;  1VQM A;  2WKD A;  4Y52 H;  3VPC A;  5LMN H;  2F0E A;  3RJ0 A;  1CHP D;  3CAM A;  2O2L D;  5C3X A;  4RHR A;  3H3V H;  3J80 i;  1Q12 A;  4X64 Q;  4A4I A;  4RGT A;  1CA5 A;  3ETJ A;  2ZXR A;  4BY1 B;  2R7Z G;  5KT3 A;  3E9I A;  4ID6 A;  2J7Z A;  5IGD A;  4K8I A;  4CBV A;  2B63 H;  2W9C A;  4JI0 H;  1TKW B;  4WD3 A;  4CKE A;  3SK5 A;  2ZTE A;  3S2H B;  2WB1 G;  1KLG D;  2NWG A;  1BCP B;  3BVZ A;  2QEJ C;  4DA2 A;  1RIP A;  4PZ6 A;  3PIO A;  2R87 A;  1KAB A;  4OGQ C;  3JAM c;  4LFC L;  3I2Z A;  3I56 A;  4JV5 Q;  2JE6 I;  1Q81 C;  5IP9 G;  1G51 A;  4FXG C;  4RAU C;  2CQA A;  2YYA A;  2O03 A;  3K3V A;  4OEL B;  2K7V A;  4MAM A;  1MKH A;  5FPR A;  2ASD A;  2FP4 B;  2NYZ D;  3H20 A;  1BXT A;  1O7Y A;  1S72 A;  2IX0 A;  2KHJ A;  1HNZ Q;  4DR4 L;  1X3Q A;  5D1O A;  3A8K E;  2O5J C;  1S5D D;  3T5L A;  2MFI A;  4OEM B;  4YBZ B;  1PZI D;  4Z9C B;  1TII D;  2YU9 A;  5M3M B;  4GZY C;  1N34 L;  1LM0 A;  2FK3 A;  3EVQ A;  2PNR C;  4F4W A;  4HSP A;  3HOZ B;  3S1M B;  2W9C B;  1W3S A;  1IOW A;  3M9B A;  1L1O C;  2JYO A;  3BYY B;  3GII A;  3PUV A;  2JA9 A;  4RH6 A;  2VW9 A;  5T14 A;  1MHW C;  1W2B A;  4RNN A;  1M7J A;  3CCS A;  1SYX B;  4YR2 A;  3V6H A;  2E76 C;  4B3T Q;  2YU9 H;  3HOX B;  2CHB D;  5KG5 A;  3K0X A;  5LMN L;  3N8D A;  5KND A;  2OT2 A;  3M9O B;  4CC5 A;  3OTO Q;  2UUC Q;  3J81 E;  5JAV A;  1ONL A;  2J6U A;  2MQH A;  1R9T A;  1EY9 A;  2X6L A;  4KJO A;  3J7A K;  2DUD A;  2RCF A;  4ZYS A;  2G9H D;  4ILW A;  2K5V A;  1B1Z A;  4JBM A;  5I2X A;  1HJP A;  5D1O B;  4JI0 L;  1SLJ A;  1SNC A;  2SNS A;  3K5I A;  1JDB B;  3N42 B;  2R92 G;  4O42 A;  2YU9 B;  1E1O A;  4I7A A;  1SMY C;  3TZU A;  5BR8 H;  2B2U A;  2DNC A;  4DLK A;  4O2D A;  3GIJ A;  2OQ0 A;  2EYP A;  2RDH A;  4C3I H;  2LXJ A;  1PFM A;  1DCZ A;  4LFB Q;  3OHA A;  2XRQ D;  3G6V A;  3H15 A;  3RNU A;  4ZOL F;  4KJN A;  4GOP C;  1YNJ C;  3GV3 A;  1DOL A;  1EIY B;  3I4M H;  1EZ1 A;  2Q2T A;  3JAM E;  4ME3 A;  5FO9 B;  4H7B A;  2JEI A;  5CV9 A;  2ZJQ A;  4WFN 3;  3R5F A;  1WOC A;  4OIJ A;  3VYT A;  1R9T B;  2EJG C;  2Z4H A;  4UP7 A;  1V9P A;  2LMC B;  3FPU B;  2B2T A;  5KG1 A;  2KCT A;  2KED A;  1B9M A;  1EEF D;  1S0M A;  4MTD A;  3OPO A;  1YHA A;  3H6M A;  5KFV A;  4ZK9 B;  3CCR A;  3H3V I;  1XWE A;  1QZH A;  3A7L A;  5DGB A;  1CKN A;  4ECZ A;  2W8K A;  4DL3 A;  3HXL A;  2F0U A;  2XGP A;  4IUP A;  4RGM A;  1ZHQ A;  3MFI A;  5EWF A;  4ME5 A;  4IJL A;  3I90 A;  4HIK A;  2Y0S E;  3VDY A;  1O7I A;  5KG2 A;  4TUY F;  4J9P A;  4F4X A;  2YTV A;  4K0K L;  3MFG A;  5C4H A;  4LF5 Q;  3Q6S A;  4JI8 H;  1J5E Q;  1TWA H;  1SEB D;  3N6X A;  4QUC A;  1NMG A;  2R61 A;  2YV5 A;  1ICF B;  3RN2 A;  2C22 A;  3FHW A;  2R7F A;  1MGS A;  4LJZ C;  1ZXT A;  1UC8 A;  2YRW A;  2IWH A;  2EYL A;  1XNR Q;  4JI5 H;  5BN5 A;  4EEQ A;  2W7P A;  4RCO A;  1S0O A;  3D8G A;  5BR8 L;  4ECY A;  4Q43 A;  2R8I A;  1FKA H;  4IFD J;  1GUO A;  1O80 A;  3FKI H;  4TQU S;  5JQW A;  2WV6 D;  2FFK B;  4ETS A;  1SNQ A;  1AE2 A;  4MV9 A;  3KXY T;  1CKN B;  2WKC A;  2HCC A;  2B2Y C;  3RTX A;  2IHE A;  2YRX A;  4A3L H;  1CQJ B;  2PVP A;  3STB C;  2CW8 A;  3DWQ A;  4ZI7 F;  2L12 A;  3CRL C;  2R85 A;  4ECV A;  1HR0 L;  5ISR A;  3WO1 A;  1SDF A;  1PRT F;  4A3K B;  4CDC C;  3GP7 A;  3PW5 A;  1OXU A;  4NXN Q;  1JB7 A;  3BAA A;  1WTW A;  1CUK A;  4KHP H;  2UVR A;  4KD4 A;  1EQT A;  1YZ6 A;  2GVA A;  3GTM A;  1T5X D;  1Q82 C;  4CKB A;  1K8O A;  1IW7 D;  4BA2 I;  5H1S E;  3BYT B;  2K6A A;  3OOC A;  1PYW D;  4CDE C;  2ZTC A;  4XT3 B;  5C4J H;  4ECU A;  1WVL A;  4A3F H;  5KFB A;  3F2U A;  3M9M B;  4B08 A;  5C5M A;  1JMC A;  1KDC A;  2K75 A;  3P7J A;  5EDW A;  2JEG A;  4GKJ L;  4DV6 H;  1HH2 P;  3D3R A;  2LXK A;  4ZLT F;  3Q2O A;  4MV7 A;  4BY1 G;  1JXL A;  3PIP 3;  2NVT B;  4HNT A;  3VR4 A;  1LLR D;  4X66 Q;  3OW2 A;  1GLV A;  5KNC A;  3BA8 A;  3GID A;  3U58 A;  3HOW H;  4YY3 H;  1SBB B;  2ASJ A;  2Z4I A;  4UCO A;  4MNO A;  2L0C A;  3L7Z C;  4JBK A;  3WWV A;  2E5L Q;  1YJ9 A;  1S03 G;  1XMQ Q;  3BDC A;  4JI8 L;  2ZDG A;  5I6W A;  5KKN B;  3SDZ A;  5M5W H;  1HNW Q;  4LFA H;  1F2M A;  4GN5 A;  1X9N A;  3GTM B;  2NUC A;  1I94 Q;  4MV8 A;  3HOU B;  2YW2 A;  2UU9 Q;  1PZJ D;  4JI5 L;  1ZYR D;  2MO1 A;  1PRT D;  4A3E G;  2RGV A;  2BCO A;  1VBG A;  3M4Y A;  4DU9 A;  3QO2 A;  4HCS A;  3R8B A;  1S5C D;  2VA2 A;  4LUZ A;  5C0X J;  4RKL A;  5M3M G;  2K5H A;  4X65 Q;  1LO5 D;  4A3B H;  4DNR B;  5C4X B;  2A68 D;  1TWC A;  4X64 H;  2DIK A;  3HOZ G;  1IBM H;  2R7L A;  3Q22 A;  4C5C A;  1WTR A;  5M3F G;  3AFP A;  4WJW A;  1PH1 A;  1VQ4 A;  1ASY A;  1VQ5 A;  2PQE A;  3OW7 A;  4KY7 A;  5JPM C;  2FPI B;  4KHP L;  3K5M A;  5GAG C;  1A15 A;  3NWS A;  2VUG A;  3RB4 A;  2NZH A;  3DMU A;  1BDO A;  1CQF A;  3HOX G;  3AEV A;  3RV3 A;  1IBK Q;  4O4L F;  4GC7 A;  1TWH H;  1RJP A;  2A6H D;  4JV5 H;  1V1O A;  3A74 A;  3Q0A A;  5E3F A;  4LF4 H;  1QZG A;  2DJG C;  2N3S A;  4DV6 L;  4L1K A;  3S24 A;  1GD7 A;  3BZD B;  3Q8D A;  1GUT A;  3K5N A;  1KJJ A;  1KC7 A;  1L2Z A;  3VMM A;  1F2Z A;  3HB9 A;  1ILQ A;  3K7U C;  5IGB A;  2UVU A;  3HKS A;  3PGZ A;  3GTK A;  1Q86 C;  2YZN A;  3C1F A;  2A69 C;  4K2L A;  1VQ9 A;  4PMW A;  4GLV B;  4KHV A;  4YY3 L;  1JKJ B;  1BBU A;  1TXY A;  1TWC B;  2W9B A;  4A3D H;  2VL6 A;  4QUF A;  4DR5 Q;  4RGN A;  3BU2 A;  2R93 H;  2PMZ A;  1XPU A;  3DWP A;  5F2D A;  1UEB A;  3B6Y A;  4CJ1 B;  2E74 C;  2F0T A;  2V4R A;  3ULJ A;  3LWB A;  5HGT A;  4DR2 H;  4Y8V B;  4LFA L;  2NVQ H;  1WFQ A;  1I6H H;  3GTK H;  4BS9 A;  1B7Y B;  3NXW A;  5HY6 A;  3T51 B;  2DZD A;  4UPA A;  4BWS C;  2KSW A;  3DEP A;  4B3T H;  1SRU A;  1GUN A;  3M4I A;  3TQT A;  1B44 D;  4EYI B;  2WIN B;  3K81 C;  3S2D B;  1VQK A;  2VUM H;  4O1N A;  2G5D A;  2OXP A;  4X64 L;  4LMY A;  1PTO C;  3KHG A;  1IBM L;  5EWG A;  4LSX A;  3KBX A;  4DXF A;  3GTK B;  3KLS X;  1P16 A;  3OSO A;  4YWM A;  2XCP A;  4TV9 F;  2JA8 B;  1EUJ A;  4N8F A;  5KYL A;  2W9B B;  3GTQ A;  5IYD H;  2F0H A;  4MV6 A;  5K36 H;  4HNV A;  1V1Q A;  2FPP B;  5C3W A;  4JI7 H;  3J81 L;  2PMZ B;  4R4T A;  4RWS C;  5G3L F;  3NTH A;  4DV0 Q;  4J9R A;  4GS3 A;  4JV5 L;  1N32 H;  4LF4 L;  3BS1 A;  4DV1 Q;  1Q8K A;  1Y1W G;  4LSA A;  1TS3 A;  3GIP A;  3A8J E;  4NMZ A;  4DAV A;  2VB3 X;  2UUA H;  4G7O C;  1DYQ A;  2JSO A;  2H4O A;  4OO1 G;  1B04 A;  2VOB A;  2K5W A;  3KHL A;  1R4Q B;  3G48 A;  1SSO A;  1Y1V H;  1U4P A;  4FBT A;  4A3J B;  1ICW A;  2FJZ A;  2JQO A;  5LYJ F;  5C4Z A;  1TWG A;  1K8A C;  3LGJ A;  5CGK A;  3M4O B;  4MN3 A;  4ZUI A;  2F0K A;  4HJ5 A;  1JR0 D;  2IX1 A;  1JJG A;  4NLG A;  5KFJ A;  1CFM A;  4JUZ A;  5HUR A;  4C3J H;  3T1Y Q;  3JAM L;  4UY8 C;  3GTQ B;  1HUN A;  1G29 1;  4OWT B;  4DR2 L;  3H4B A;  3CCV A;  1BR9 A;  1S5B D;  5J3B A;  1F9R A;  5A35 A;  4CJ0 B;  3WDN A;  5KYI A;  4A3K G;  1VQE A;  1PZK D;  4XXE A;  2A6E C;  4BY7 H;  1N8R C;  4YWK A;  4LF6 Q;  3PO3 H;  4A3C G;  4B3T L;  3GV5 B;  5FJ8 H;  4Q8E A;  2AQ4 A;  4QW8 A;  1J6Q A;  1UWV A;  3M7G A;  1KHI A;  3MVV A;  5I2Y A;  1X56 A;  4UCR A;  2K5D A;  3PW4 A;  2A74 C;  1FNV A;  3CVZ A;  5L9X A;  3R2T A;  2V58 A;  3AYH B;  4F8M A;  2VQE H;  1CM9 A;  4IPC A;  5KFD A;  1UNN C;  2F52 A;  3X3M A;  1U9R A;  4IRD A;  3MFY A;  1I4Q A;  1Y14 B;  5KFZ A;  2ATL A;  3GTL H;  2FXQ A;  5EBC A;  1G6Z A;  1F9S A;  1TWG B;  5LMU Q;  4R7R A;  2SNM A;  2XWB B;  2Z9H A;  1OXV A;  4JI7 L;  3WO0 A;  2B29 A;  4ED0 A;  2BE5 D;  2ZJP A;  4DFA A;  4LH6 A;  5IP7 H;  4QW9 A;  4PDB A;  2YZG A;  1T9H A;  3ND8 A;  3UDF A;  4DK3 C;  3Q23 A;  4A93 H;  1N32 L;  4IR1 A;  1S5F D;  3KOJ A;  3PUZ A;  4RHS A;  4PNY A;  3J7Y W;  3S1R B;  4YHH Q;  4YP3 A;  4EBD A;  5KFQ A;  4F4Z A;  4LUV A;  3CF5 A;  4QL5 A;  2UUA L;  5D14 A;  2EYJ A;  1IZ6 A;  3HOU G;  4DXG A;  4OXP A;  5HV6 A;  1PMR A;  5KFS A;  4HMI A;  3BZK A;  4B3S Q;  5DQH A;  2H1E A;  1V51 A;  2HD3 A;  3SGI A;  1CA6 A;  1VBH A;  5J2U F;  1VMC A;  1VQG A;  2K5N A;  5C4X G;  5KT6 A;  3D4R A;  2V4Q A;  1FJG H;  2KCM A;  3X3N A;  2VR1 A;  5C3E B;  2K05 A;  4ZKC B;  4L5T A;  4EYH B;  3FEW X;  1AZQ A;  3N41 B;  1RTN A;  3S15 H;  3U4V A;  1KDB A;  2W6O A;  1T5E A;  1XYI A;  2FMC A;  4P72 A;  4O4H F;  1NSN S;  3RD4 A;  1IYJ B;  4EEY A;  3GV6 A;  3MWY W;  4HJ8 A;  1KEE A;  1UNS A;  5DG9 A;  2AQ3 B;  3A5Z B;  1D8L A;  3KUP A;  1JWM D;  2LY7 A;  1YNN C;  1BQQ T;  1R4P B;  3AFQ A;  1D1I A;  4Q0F A;  4EQ5 A;  4K14 A;  4P2C B;  4JV1 A;  3D0F A;  4KY6 A;  5IOC A;  2VQE L;  2ASB A;  3L0O A;  3R5X A;  2F0O A;  2HHH H;  2D9U A;  1VQN A;  2DPJ A;  4C3H G;  5KFT A;  1SFO A;  1TS2 A;  2VQF Q;  2F0I A;  3RUZ A;  1AW7 A;  4DAM A;  1Y8O B;  4KK7 A;  4FBU A;  1VQC A;  5I6Y A;  3H0G A;  1HXY D;  4Q44 A;  1HNX H;  2DPI A;  4EQP A;  4HAE A;  5AJ3 Q;  4Q8F A;  2XWJ B;  3S14 H;  4Y7N H;  2WDT A;  2QEX A;  1Z7T A;  2IP4 A;  3E5S A;  3PUY A;  4DL7 A;  1E7Z A;  3A5U A;  3I4N H;  1NJI C;  3T13 A;  1ZET A;  3GV7 B;  2M00 A;  3GIM A;  3LNN A;  1XTD A;  3AMU A;  1NR2 A;  3T1H H;  1ZHS A;  4YJ2 F;  3H0G H;  4R4O A;  3IN5 A;  4C2M A;  5L1K A;  1DV2 A;  1E4E A;  3TQY A;  2E2I H;  4IFD H;  4L5Q A;  1PH7 A;  4I7H A;  4DR7 H;  1V43 A;  3ITP A;  4R4C A;  3M3Y H;  2PO4 A;  1S5E D;  3L9A X;  1HUM A;  5A2Q E;  1HFN A;  5LHY 1;  1G91 A;  3KAK A;  4AQY H;  1I6U A;  5KFL A;  4IUR A;  1SFO B; 
#chains in the Genus database with same CATH homology
 1E3P A;  2I5H A;  2NVX H;  3CC4 A;  1FJG L;  1PHJ A;  3PUV A;  2XTI A;  5GAH C;  3KFU A;  2JA9 A;  3TRZ A;  4HIO A;  2RHS B;  2VW9 A;  1XNQ Q;  3GTM H;  1VQJ A;  1W2B A;  4BXX H;  2JA7 H;  3CCS A;  3HOU H;  3CXC A;  2N78 A;  4B3T Q;  2YU9 H;  3J81 j;  1YHB A;  2JA8 G;  2BH2 A;  3K0X A;  4P75 A;  5LMN L;  4BBS H;  4QIW E;  2LSS A;  2MNA A;  3CCM A;  3FKI G;  3HKZ E;  3OTO Q;  2UUC Q;  3EIV A;  4A93 H;  2MQH A;  4OWW B;  5GAE C;  3OTO L;  2UUC L;  4KI0 A;  2DUD A;  5C4X H;  4LNQ A;  4A3L G;  3CC2 A;  3S1N H;  1VQ8 A;  2Z6K C;  2K4K A;  2K5V A;  4DV3 Q;  3K80 C;  4YCV A;  2HHH Q;  4JBM A;  1HJP A;  4JI0 Q;  4L5S A;  1NY4 A;  4B3R Q;  1D7Q A;  1QVG A;  2HHH L;  4JI0 L;  1SLJ A;  2R92 G;  2PQA A;  2AWN A;  4JI1 Q;  1E1O A;  1KD1 C;  4PZ8 A;  4DK6 C;  4JI1 L;  1PA6 A;  4O2D A;  4IO9 A;  2OQ0 A;  1VQD A;  1HNX Q;  1JE5 A;  1PH3 A;  3DLL A;  4C3I H;  2E8G A;  4DUZ Q;  4A3J G;  1HNX L;  2CCZ A;  2BA0 A;  2ALY B;  2LXJ A;  4DUZ L;  2HQL A;  3CCQ A;  4A3F G;  4LFB Q;  3H15 A;  5E7N A;  3E9H A;  4GOP C;  3RNU A;  2R7Z H;  4LFB L;  3U50 C;  4JBW A;  3M4Q A;  1KRT A;  1EIY B;  4C3H H;  1KC8 C;  3I4M H;  2EIF A;  2Q2T A;  5JEA G;  4ME3 A;  3T1H Q;  1WCM G;  3T1H L;  1PFS A;  4OO1 I;  3CP0 A;  2JEA I;  3CME A;  3HOY G;  1UE1 A;  4GLX A;  2ZJQ A;  4O0A A;  1KRS A;  1WOC A;  2RF4 A;  4IOC A;  1XJV A;  2IHF A;  4RG1 A;  5GRO A;  5FLM G;  4HJ7 A;  1XMO Q;  1S40 A;  3HOW G;  4DR7 Q;  4UP7 A;  4BA1 I;  1TWC H;  1V9P A;  4X62 Q;  1XMO L;  2KCT A;  3NBH B;  4APV A;  5IP9 H;  1EOV A;  4AQY Q;  4DR7 L;  5DLQ E;  1YHA A;  4AQY L;  1A62 A;  4IPG A;  3CCR A;  1M90 C;  3H3V I;  1QZH A;  1Q1E A;  1CKN A;  4P74 A;  3G4S A;  4JI4 Q;  4OWX B;  2PQA B;  4GKK Q;  3CPW A;  4JI4 L;  1YHQ A;  2UXD Q;  4JG2 A;  4GKK L;  4MTN A;  1FJG Q;  3A0J A;  3BJU A;  2UXD L;  4OX9 Q;  1P8L A;  1I3Q H;  4OX9 L;  1H95 A;  1YBY A;  2D62 A;  4IJL A;  4HIK A;  2Y0S E;  2ZTD A;  3VDY A;  1O7I A;  1SRO A;  1CKO A;  5JJL A;  1CSP A;  2K14 A;  3L2P A;  3ERS X;  3E0E A;  2C35 B;  2YTV A;  4J15 A;  4QGU A;  2YYZ A;  4K0K L;  4DR5 L;  3CD6 A;  4DAY B;  4LF5 Q;  3S2D H;  4A3B G;  1OXT A;  1J5E Q;  1TWA H;  5ELN A;  1NMG A;  2YV5 A;  3RN2 A;  4LF5 L;  1J5E L;  3FHW A;  2R7F A;  4OON A;  1UE7 A;  1VQ6 A;  1C9O A;  3CMA A;  1YJN A;  3OYY A;  1XNR Q;  5BR8 Q;  2VZA A;  2JA8 H;  4AYB G;  1XNR L;  3F2B A;  2OCE A;  1PV4 A;  5BR8 L;  5JJI A;  4JOI C;  4IFD J;  2L15 A;  1WJJ A;  3F1Z A;  3FKI H;  4TQU S;  2EXD A;  4X6A H;  4GLA C;  3STB D;  1GKH A;  3JC6 6;  1AE2 A;  3ICE A;  1CKN B;  2WP8 J;  2IHE A;  4A3L H;  3ZJY C;  4JI2 Q;  3STB C;  4IFD I;  4JV5 Q;  1M1K C;  2UXB Q;  3PO2 G;  5JJK A;  4LWC A;  1HR0 L;  4JI2 L;  3KJP A;  1NE3 A;  1VQF A;  1EYG A;  4DR6 Q;  4DR3 Q;  2R92 H;  1OXU A;  4HIM A;  1JB7 A;  4NXN Q;  1CUK A;  2GVB A;  2RHQ B;  3ER0 A;  4DR3 L;  4NXN L;  4MZ9 A;  1YZ6 A;  2GVA A;  3CQZ H;  5C3E G;  1Q82 C;  3RN5 A;  1EWI A;  4DV7 Q;  1YIJ A;  2V1C C;  1A0I A;  4BA2 I;  1BKB A;  5H1S E;  1MJC A;  4A3J H;  5C4J H;  2ZTC A;  3KLW A;  4XTC S;  2A19 A;  5IY0 A;  1PH9 A;  3HOV G;  4A3D G;  4A3F H;  1N9W A;  2AMC B;  3U4Z A;  3M4O H;  5IE8 A;  1JMC A;  1VQA A;  4DV0 L;  3HFZ B;  2K75 A;  1SR3 A;  3M85 A;  4GKJ L;  2R93 G;  1QUQ A;  1HH2 P;  3UE1 A;  4L5R C;  2LXK A;  4DV1 L;  4BY1 G;  1L2F A;  1E24 A;  4AH6 A;  5IYB G;  3GTQ H;  1KAW A;  1WCM H;  4X66 Q;  3HOY H;  3OW2 A;  5LMN Q;  1LTL A;  4X66 L;  5FLM H;  1UE5 A;  3U58 A;  1I5F A;  3HOW H;  2UXC Q;  3M4P A;  1C0A A;  3TS2 A;  1QVF A;  4KHZ A;  3RZD H;  1N36 Q;  4MNO A;  2UXC L;  3L7Z C;  1OTC A;  3WWV A;  4JBK A;  3J7A 5;  2BA1 A;  4TVA B;  3I4O A;  1N36 L;  2E5L Q;  1YJ9 A;  1VQL A;  1G6P A;  2YTX A;  1HZ9 A;  1XMQ Q;  2E5L L;  3NEM A;  4JI8 L;  2E2J H;  2VUM G;  1MIU A;  1VCI A;  2NN6 G;  3CCJ A;  3CCU A;  1XMQ L;  4LF9 Q;  2BH8 A;  5M5W H;  4IPH A;  1HNW Q;  3DM3 A;  4GN5 A;  3W5O A;  1X9N A;  4LF9 L;  1HNW L;  1K3R A;  2N8N A;  1I94 Q;  4JI5 Q;  2UU9 Q;  4IPD A;  1I94 L;  1X54 A;  4JI5 L;  1JJ2 A;  1QVC A;  2MO1 A;  5IYD G;  2UU9 L;  4A3E G;  1K8G A;  1TWG H;  4WJ3 M;  5K36 G;  1OXS C;  1HZA A;  5ELO A;  4LF6 L;  3G6E A;  4LUZ A;  5C0X J;  1QUQ B;  4HJ9 A;  4UP8 A;  5M3M G;  1CSQ A;  2K5H A;  4P73 A;  4X65 Q;  4A3B H;  5IT9 c;  2E2H H;  1KXL A;  4X65 L;  3HOZ G;  1X65 A;  4DV4 Q;  3S1R H;  3MXN B;  2JA6 G;  3D31 A;  5C0X I;  3UDI A;  5M3F G;  3AFP A;  4NXM Q;  4DV4 L;  1PH1 A;  1KQS A;  2Q2U A;  1HZC A;  4KHP Q;  1VQ4 A;  4QJF A;  3RLO A;  1ASY A;  1VQ5 A;  4NXM L;  4LF7 Q;  4KHP L;  2CFM A;  5GAG C;  4HJA A;  1N33 L;  4LF7 L;  5EAY A;  2B3G A;  1WYD A;  1Y1V G;  2NZH A;  3K8A A;  5LMU L;  1E1T A;  3HOX G;  3AEV A;  2CWA A;  1DGS A;  1PH4 A;  4PZ7 A;  1IBK Q;  1TWH H;  1IBK L;  3PO2 H;  3A74 A;  4GNX A;  1Q1B A;  4DV6 Q;  2Q2I A;  1QZG A;  2N3S A;  4DV6 L;  1X3G A;  5HGQ A;  1YVC A;  3S24 A;  1GD7 A;  3Q8D A;  4RMF A;  2OWO A;  3F2D A;  1RL2 A;  3K7U C;  3KF8 B;  4LF8 Q;  2I0Q A;  3HKS A;  5C3E H;  1PH5 A;  3PGZ A;  4LF8 L;  1Q86 C;  4YY3 Q;  2OTL A;  3W1B A;  1VQ9 A;  2GN5 A;  4GLV B;  4PMW A;  4YY3 L;  4JI6 Q;  4BY7 G;  1BBU A;  1TXY A;  3PF4 A;  1S3O A;  3HOV H;  3PO3 G;  5FJ8 G;  2AKW B;  3KJO A;  4JI6 L;  2VL6 A;  4A3D H;  4JI3 Q;  2WAQ E;  1YJW A;  4DR5 Q;  4K0K Q;  1X3E A;  2F3I A;  4JI3 L;  5FLX c;  3BU2 A;  2R93 H;  1XPU A;  4P71 A;  2UUB L;  2HT1 A;  1UEB A;  4POG A;  3B6Y A;  3S17 H;  2VS1 A;  4LFA Q;  3EBE A;  3ULJ A;  4BY1 H;  1EQR A;  5IYB H;  4A3I G;  2ZM6 Q;  4LFA L;  2NVQ H;  1WFQ A;  4JYA Q;  1I6H H;  5LMN W;  2ZM6 L;  3GTK H;  1L1O A;  4EX5 A;  1B70 B;  1HZB A;  2PNH A;  4JYA L;  1B7Y B;  1OXX K;  2JK8 A;  5HY6 A;  3S2H H;  1LUZ A;  4UPA A;  4A3G G;  1SRU A;  4LW1 A;  1WI5 A;  4GNX B;  3HKZ G;  2QGQ A;  2PI2 A;  3KDF A;  3K81 C;  2OQK A;  5IP7 G;  1HR0 Q;  1VQK A;  2VUM H;  4IOA A;  1PH6 A;  5JEA J;  1IBM Q;  4X64 L;  4A93 G;  4BBR G;  1EIF A;  5GAD C;  1IBM L;  4R1J A;  4DR1 Q;  1K9M C;  4FDB A;  3RLN A;  4DR1 L;  1FGU A;  1FVI A;  1P16 A;  4YWM A;  3BZC A;  2JA5 G;  1U0L A;  3CCL A;  1L0W A;  1EUJ A;  3J81 i;  3UDG A;  5IYD H;  2VQF L;  4A3E H;  4A3M G;  4NPS A;  3PIP A;  4WJ4 A;  3S16 H;  1V1Q A;  1PVO A;  2OTJ A;  4A75 A;  4R4T A;  5M3M H;  1SE8 A;  4DV0 Q;  1MJE A;  1C7Y A;  4GKJ Q;  3PUX A;  4LF4 Q;  4GS3 A;  3PV0 A;  4PG3 A;  1YNX A;  3EN2 A;  4YCU A;  2F4V Q;  3HOZ H;  3S1M H;  4JV5 L;  2JA6 H;  4LF4 L;  4DUY Q;  3UE0 A;  1L1O B;  3G71 A;  4DV1 Q;  1Q8K A;  4JC0 A;  4DKA C;  2DGY A;  5M3F H;  1Y1W G;  2KEN A;  4DUY L;  1SFO H;  2F4V L;  3FP9 A;  4H02 A;  4YCW A;  3M7N A;  4GN4 B;  3NEL A;  4GOP A;  4OO1 G;  1VQO A;  1A8V A;  4POF A;  2K50 A;  1NBW A;  3G48 A;  2VNU D;  1SMX A;  3F8T A;  1BVS A;  1Y1V H;  3KDF B;  4DV2 L;  1X55 A;  3HOX H;  2JQO A;  2MO0 A;  2NZO A;  1K8A C;  3LGJ A;  3CPF A;  4JI8 Q;  3JAM i;  4HJ5 A;  3CC7 A;  1NMF A;  4DNI A;  2IX1 A;  1JJG A;  2D0O A;  1BBW A;  1VQ7 A;  1JT8 A;  2H5X A;  4DR2 Q;  2JEB I;  4C3J H;  3T1Y Q;  4UY8 C;  4B3M Q;  3GTO H;  2IY5 B;  1G29 1;  2VY3 A;  4OWT B;  4DR2 L;  3CCV A;  3T1Y L;  4YWL A;  4B3M L;  2B63 G;  5J3B A;  4A3K G;  3W1G A;  2N49 A;  1XNQ L;  1VQE A;  3GTG H;  1A63 A;  4UP9 A;  2WB1 E;  4C2M H;  3UDX A;  4BY7 H;  2A1A A;  1N8R C;  4YWK A;  3RLF A;  4AYB E;  1IBL Q;  4LF6 Q;  2Y0S G;  4B3T L;  5FJ8 H;  3PO3 H;  4A3C G;  1VQI A;  3ULL A;  1IBL L;  2WAQ G;  3TEH B;  1AH9 A;  1J6Q A;  1UWV A;  1JJC B;  4JCV E;  5M5Y H;  1KHI A;  2KBN A;  1KL9 A;  1X56 A;  2NVY H;  3I55 A;  1IL2 A;  1K83 H;  3GDE A;  5M5X H;  4GOP B;  4A3I H;  3F2C A;  3AYH B;  1PYS B;  2CQO A;  4IPC A;  3GO5 A;  1IXR A;  4DV3 L;  1EQQ A;  3I4N G;  2F52 A;  4B3R L;  3I7F A;  4R4Q A;  3CW2 C;  2Q2H A;  5C44 G;  1Y14 B;  1N33 Q;  3GD7 A;  3GTL H;  2FXQ A;  4LUO A;  4A3G H;  2I5L X;  1YEZ A;  5LMU Q;  4JI7 Q;  2RCN A;  3H0G G;  4DPG A;  1OXV A;  4JI7 L;  2B29 A;  1R9T H;  5IYC G;  2ZJP A;  4AIM A;  3MEF A;  4QY7 A;  5GQO A;  1KIX A;  1Q46 A;  5IP7 H;  1HR0 W;  4IFD G;  4JOI A;  1N32 Q;  1PH8 A;  1T9H A;  2R6G A;  2YTY A;  3UDF A;  1GO3 E;  2I5M X;  4BBR H;  3KOJ A;  1FL0 A;  3PUZ A;  4DK3 C;  3PCO B;  1N32 L;  1TWF H;  4YHH Q;  3KF6 A;  1U5K A;  3RR5 A;  2JA5 H;  2UUA Q;  2WFW A;  4LUV A;  4YHH L;  3CF5 A;  4QL5 A;  3PUW A;  4DV5 Q;  4HID A;  1ASZ A;  1Q7Y C;  2ZJR A;  3IRB A;  2D0P A;  1K73 C;  1VQP A;  4A3M H;  2UUA L;  4DV5 L;  1IZ6 A;  4BXX G;  2CWP A;  2KHI A;  5IWA Q;  3TS0 A;  1Z9F A;  2JA7 G;  3HOU G;  4OXP A;  4NB3 A;  5IWA L;  3J80 c;  4BBS G;  3BZK A;  4B3S Q;  1E22 A;  4A76 A;  1K0R A;  3K7A H;  3SGI A;  1VQH A;  2UUB Q;  4B3S L;  4X62 L;  4JBJ A;  2PMZ E;  3ULP A;  1B8A A;  3TRE A;  4R4I A;  1Y1W H;  1VQG A;  3GTJ H;  2K5N A;  5C4X G;  2KCM A;  2JJQ A;  2NN6 I;  2IT1 A;  2EQS A;  2AWO A;  3NEN A;  3J81 c;  1PH2 A;  1NTG A;  4L5T A;  3J7Z C;  4QQB X;  1XPO A;  1XPR A;  1VQM A;  2ES2 A;  3GTP H;  4Y52 H;  1X3F A;  3S15 H;  3U4V A;  4GN3 B;  1GM5 A;  3CAM A;  1Z47 A;  4P72 A;  3S1Q H;  1IYJ B;  2PI2 E;  2K52 A;  4HJ8 A;  3H3V H;  3J80 i;  1LYL A;  3PSI A;  3A5Z B;  1UE6 A;  1Q12 A;  3KF6 B;  1D8L A;  4X64 Q;  1PYB A;  4A4I A;  2VQE Q;  4EQ5 A;  3AFQ A;  4ALP A;  1GVP A;  3D0F A;  2VQE L;  2R7Z G;  2ASB A;  3E9I A;  3L0O A;  2B63 H;  1VQN A;  2A8V A;  4A3K H;  1VQB A;  2VQF Q;  3PF5 A;  3I4M G;  2ZTE A;  2Z6K A;  2WB1 G;  4DAM A;  1I50 H;  4A3C H;  1VQC A;  1RIP A;  4PZ6 A;  2AHO B;  2HIV A;  3PIO A;  3CCE A;  4GNX C;  1EFW A;  4LFC Q;  1YIT A;  3JAM c;  4LFC L;  1VS0 A;  3I2Z A;  1AE3 A;  2Z0S A;  5AJ3 Q;  3I56 A;  3RZO H;  2JE6 I;  4Y7N H;  1Q81 C;  3S14 H;  5IP9 G;  1G51 A;  1SN8 A;  5AJ3 L;  2QEX A;  2ID0 A;  3PUY A;  5C0X G;  1E7Z A;  3A5U A;  2UXB L;  3I4N H;  2QA4 A;  1MKH A;  1X6O A;  1NJI C;  4KLK A;  1YI2 A;  5C44 H;  2ATW A;  4DR4 Q;  4DR6 L;  1XTD A;  1S72 A;  2CKZ B;  4DV2 Q;  2IX0 A;  2XGT A;  2NVT H;  2KHJ A;  1HNZ Q;  4DR4 L;  3AQQ A;  1CKM A;  3H0G H;  4R4O A;  1HNZ L;  2MFI A;  1N34 Q;  5IYC H;  4DV7 L;  3KYH C;  3TQY A;  1LM0 A;  1N34 L;  2E2I H;  4L5Q A;  1PH7 A;  1V43 A;  4R4C A;  4IJH A;  3M3Y H;  2R7D A;  4XIG S;  1W3S A;  2HIX A;  3M9B A;  1L1O C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...