2RF4A

Crystal structure of the rna polymerase i subcomplex a14/43
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
192
structure length
174
Chain Sequence
KQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDGNSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA4
publication title Functional architecture of RNA polymerase I.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 23
structure length 174
sequence length 192
chains with identical sequence C, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
A PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2rf4A02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2rf4A01
1IL2A 2HHHL 1FVIA 1KAWA 1NMGA 4LUZA 5IY0A 4JI7L 5IYBH 1A8VA 3GTJH 1EUJA 1MIUA 2CKZB 4WJ4A 1N36Q 1W3SA 3K80C 4O2DA 5C0XI 3PIPA 1GM5A 4IPDA 1VQJA 2OTLA 4DV0L 4A93H 3M9BA 1VQGA 1CSQA 1B7YB 5FJ8H 4DUYL 1XJVA 1RL2A 4IJHA 4JI8Q 1VQ5A 2HIXA 4JBWA 1Q12A 1YIJA 4DV5L 4UP8A 2EQSA 2NN6G 3F8TA 4K0KQ 4LF6L 4A3DG 3CCMA 1IBLQ 2WB1E 5FLXc 2I0QA 1L0WA 2V1CC 3CAMA 2F4VL 5LMNL 1HNZQ 1UE5A 4DUZQ 4IPHA 2F52A 4MTNA 4A3MH 4JBKA 2NVTH 2FXQA 5C4JH 4J15A 2ZTDA 4OX9Q 3J80i 4BBSH 2D62A 4DR2Q 2I5MX 3K7UC 4LFAQ 4POFA 1QZGA 1BKBA 4P75A 4B3TL 1G6PA 1VQBA 4DV4Q 1TWFH 3I4NG 1XPOA 1K8GA 1SE8A 5BR8Q 3JC66 1V9PA 3M4PA 1S40A 1C7YA 2IX1A 4DR1Q 3PCOB 3NENA 2WB1G 4DV6Q 2R7ZG 2VUMH 1N32L 4JI8L 4A3FH 1I6HH 3HOUG 2B29A 5IP7G 1VQMA 3KJOA 1WCMG 3G48A 1TWAH 4GOPC 4YY3Q 1IBLL 2Z0SA 4RMFA 5E7NA 2A8VA 1CKOA 2MO1A 3JAMc 3NBHB 3GO5A 4IJLA 1NY4A 4LF8Q 4QJFA 3ICEA 3AFPA 2JA9A 1JE5A 1LUZA 4JCVE 4YCUA 2JA5G 4OX9L 4DR2L 1Z9FA 1A0IA 1XNQL 1PV4A 2KHJA 2R92H 1WYDA 3TS2A 3RZDH 4IFDJ 1VQCA 4BBRG 3KOJA 4EQ5A 3RN5A 3PO2G 2UUAL 1A63A 1J6QA 5C3EG 3PUVA 4DR1L 2MFIA 1EFWA 2UXCQ 4QQBX 4DV6L 1UE7A 4R1JA 4DV2Q 3GTOH 1S3OA 1T9HA 3CC4A 4BY7H 1DGSA 2Z6KA 3ER0A 1L2FA 1EIFA 2KBNA 1P16A 3AEVA 5M5WH 4LUOA 2YTVA 2D0PA 4YY3L 1PVOA 1OXXK 5IYCH 3FKIG 4A3LG 2EIFA 4C3HH 1N8RC 2PMZE 3KF6A 2ASBA 1K9MC 4DR4L 1L1OC 2RCNA 2JA6G 2YTYA 1HNWQ 1WI5A 2L15A 4PZ8A 2QEXA 1JMCA 2MQHA 1I5FA 3EIVA 4DNIA 1KRSA 4GKJQ 1GO3E 4AIMA 3GTPH 1YJ9A 1YEZA 2UXBQ 2IX0A 2BH8A 3SGIA 1Y1WH 3PIOA 2DGYA 4AYBE 1GVPA 4A3KG 3KJPA 1VQ7A 4L5RC 2JA7H 4GKKQ 1S72A 4JI3Q 3PO3G 2UXCL 2R93H 4DV2L 5K36G 3MEFA 4HJAA 3GTGH 3CC2A 3PUYA 4R4OA 3JAMi 3FHWA 5C4XH 4NXNQ 3S1NH 3A5ZB 3CD6A 1KRTA 1G51A 1IBMQ 2HIVA 2NVYH 3S16H 1VQPA 3H3VH 4DR5Q 2K4KA 4A3EH 4GN4B 4QIWE 2QGQA 5C44H 4X62Q 5C0XJ 4B3ML 1HNWL 4AYBG 3BZKA 3G6EA 1K0RA 2ID0A 2NVQH 2I5LX 3GTMH 3HOZH 3KDFB 1BVSA 2UXBL 2ALYB 3H0GH 3D0FA 1JJGA 4DR4Q 4JI3L 3A0JA 4PZ6A 1YJNA 1NBWA 4DR7L 4DKAC 1SN8A 2HQLA 5IP9H 1IBKL 2N3SA 1WFQA 5IWAL 4BXXG 1D7QA 1LTLA 3PUZA 4NXNL 3G4SA 4LF6Q 3D31A 3K0XA 4GLAC 3KDFA 4YWMA 4NXML 4X66Q 3CMEA 2VS1A 2Q2UA 1UEBA 2AKWB 2IHEA 4PG3A 3J81c 1N34L 2F4VQ 3HOXH 5IT9c 4TQUS 4A3IH 1Q8KA 2UUCL 1QUQA 3H0GG 4L5SA 1OXTA 4X62L 4B3TQ 2XTIA 3H15A 5FLMG 1AE2A 3RR5A 1KL9A 3ERSX 1PYSB 1E1TA 2IHFA 4X6AH 1G291 2LXKA 2GVBA 4DR3L 4JI2L 1PYBA 2BA0A 3UE0A 5H1SE 2MO0A 3CCVA 1EQQA 1VQ8A 1VQKA 1XPUA 2KCTA 3CPFA 1N32Q 2ZJRA 4DR3Q 1FGUA 4A3BG 2K50A 1CKNA 1W2BA 1YHBA 3ZJYC 4UP7A 4JC0A 4UY8C 3TS0A 4LFBQ 1K3RA 4X66L 2YTXA 4QGUA 4R4CA 5IYBG 4NPSA 1OXSC 3W5OA 1VQOA 4B3RQ 4P73A 1E7ZA 1NE3A 1X55A 1YNXA 4R4IA 4JV5Q 1PH6A 4OWWB 1X65A 4A93G 1OTCA 1U5KA 1I94Q 2VY3A 2LXJA 2YYZA 2CQOA 1NJIC 1XNQQ 3I4OA 5FJ8G 4HIDA 1Z47A 1B70B 3CCQA 3S1RH 1ASZA 3M3YH 4IOAA 1AH9A 2PI2A 3A74A 1VQNA 2UUAQ 2YU9H 4YWKA 3L7ZC 4ALPA 1Q7YC 3HOWH 1YJWA 4JI6Q 4KI0A 4A3JH 1EOVA 3CQZH 4AH6A 2R6GA 3RN2A 2K5NA 2EXDA 5GQOA 2ZJPA 5ELNA 2ZTCA 1LYLA 2WFWA 3HFZB 1EQRA 4BA1I 3J81i 4A3MG 4HIKA 1UE1A 4DV7Q 2ZJQA 2OWOA 3PF5A 4BBSG 2VNUD 2KENA 4LFBL 1YI2A 3E9HA 3S14H 3KYHC 3TREA 4LFCL 5M5YH 4B3RL 3GTLH 4LNQA 1PFSA 2OQ0A 4GN3B 4C3JH 2OTJA 2RHQB 2Z6KC 4DK6C 4JV5L 4C3IH 1VQ9A 4YHHL 3PF4A 2OCEA 3DM3A 3I7FA 2VQEQ 3RLOA 5HGQA 3WWVA 1I94L 1EWIA 2VUMG 1Y14B 1Q86C 4A3FG 3F1ZA 1VQDA 3OW2A 3A5UA 2KHIA 1K83H 3U4VA 4JI6L 4X65Q 3KF6B 3K8AA 3E0EA 1VQ4A 3RLNA 5M3MH 1BBWA 2XGTA 2C35B 3I56A 3L0OA 4HJ9A 3TEHB 4DV7L 3BZCA 3CCRA 4JG2A 3GDEA 1XPRA 2R92G 1AE3A 2Y0SG 1HZ9A 1C9OA 2K75A 3PUWA 4JBJA 4B3MQ 1EYGA 2VQEL 2VQFQ 4JYAQ 4C2MH 3Q8DA 2ZTEA 5M3FH 1EIYB 2K5HA 4BY7G 5GAEC 4JI1Q 3I4MH 1Q1EA 4GLXA 5JJKA 3T1HQ 1KXLA 1CKMA 4QY7A 3HOYH 1VQLA 5IYCG 4DR7Q 4X65L 1XMQQ 1NTGA 1IBKQ 1H95A 2BH2A 5IWAQ 2B63H 1E3PA 1HJPA 2OQKA 3BJUA 1VQEA 4LWCA 4JI0Q 4DR6L 4NXMQ 2Q2TA 2K14A 1CUKA 1O7IA 2JA8H 1ASYA 1N34Q 2E5LQ 1QVGA 2E2JH 5M5XH 1E1OA 1QVFA 2UUCQ 1IZ6A 1OXVA 1X9NA 1TXYA 4A3CH 1VCIA 1Y1WG 3CCJA 2JA7G 2QA4A 1SFOH 2VQFL 4JYAL 1KD1C 1UWVA 1A62A 1YHAA 3HOYG 2R93G 3UDGA 3U58A 4HJ5A 1J5EQ 4JI1L 1D8LA 5C4XG 3RNUA 3T1HL 2E2HH 4PMWA 2JK8A 4HIMA 3FP9A 4JI2Q 4EX5A 1X54A 4LF9Q 1Y1VH 5DLQE 2VZAA 3CF5A 4HJ7A 1XMQL 4OO1G 1QUQB 4XIGS 3J81j 4DV3Q 2RHSB 1QZHA 1PH3A 1HR0W 4JI0L 5JJLA 2CWAA 4A3EG 1JT8A 2Q2IA 3J7ZC 1HR0Q 4GN5A 4P71A 5C44G 4A3GH 1FJGQ 5GADC 3F2CA 2E5LL 1WJJA 5GROA 3PSIA 1HH2P 2GN5A 3PV0A 3UDIA 1YHQA 2UUBQ 1SROA 3HOZG 5JJIA 1IYJB 1XTDA 1V1QA 4B3SQ 3PUXA 4DAMA 4MZ9A 1K73C 4AQYQ 1U0LA 4JI4Q 5ELOA 3OYYA 4QL5A 3M4QA 1B8AA 1CKNB 2ATWA 1NMFA 5IP9G 1J5EL 3CP0A 4LF9L 4WJ3M 4YCWA 4ME3A 4OXPA 4GNXC 3HOXG 4JI5Q 4A3IG 2GVAA 2LSSA 1Q1BA 3KLWA 4DV3L 4A75A 2NZOA 1R9TH 3NEMA 2CCZA 1VQAA 4POGA 4GNXB 4JOIC 1HR0L 4KHPL 1Q46A 1YZ6A 2F3IA 3KFUA 1FJGL 4A3DH 4LFCQ 3S2DH 5IYDH 4LW1A 3W1GA 3VDYA 2UUBL 2R7DA 5GAHC 1PH1A 4L5QA 4YHHQ 2PQAB 4OWXB 4B3SL 1KQSA 1HNXQ 4GNXA 3K81C 4AQYL 1VS0A 2CWPA 4JI4L 3CCEA 4IFDG 3UE1A 1SMXA 1TWHH 3OTOQ 3I2ZA 4JOIA 1QVCA 1KIXA 1PH8A 3T1YL 3I4NH 1PHJA 1GD7A 4P74A 1WOCA 2NVXH 1VQIA 2PQAA 3AFQA 5EAYA 4IO9A 2B3GA 3BU2A 5IYDG 3HKZE 4JI5L 5AJ3L 3CCLA 2R7ZH 4IPGA 1C0AA 4P72A 4UP9A 2E2IH 1X6OA 1SLJA 3DLLA 3HOUH 1HZCA 2KCMA 5IP7H 1PH9A 1WCMH 3U50C 1VQHA 2PI2E 4R4TA 1JJ2A 3G71A 1XNRQ 3M7NA 3S2HH 2D0OA 1CSPA 4Y52H 5JEAG 4KLKA 4XTCS 4HJ8A 4H02A 3HOWG 1N36L 1HZBA 4DV1Q 1HNXL 2IT1A 2JA5H 1P8LA 3RLFA 4A3JG 1PH5A 2WAQE 2Y0SE 4APVA 2K5VA 3M4OH 2H5XA 2JA8G 3HKZG 3OTOL 1X56A 4FDBA 1OXUA 2VW9A 2JEAI 4BBRH 1N33Q 3PO2H 1VQ6A 4K0KL 2MNAA 5C3EH 4OO1I 4MNOA 2R7FA 3HKSA 3H3VI 4RG1A 3CCSA 3TQYA 4GOPB 3S15H 4DR6Q 1HNZL 3M85A 4DUZL 3EN2A 4BY1H 3GTQH 1JJCB 1SR3A 1XNRL 2WAQG 3E9IA 3FKIH 1PA6A 3CMAA 3CPWA 4LFAL 4A3LH 2I5HA 4YCVA 1XMOQ 4DV4L 3ULJA 3PGZA 3KF8B 5C0XG 4GOPA 2N8NA 4DV1L 4KHZA 5BR8L 2JA6H 2JJQA 1X3FA 3GTKH 4X64Q 5M3MG 3S1QH 3IRBA 2JQOA 3L2PA 1MJEA 3S1MH 4UPAA 3S17H 2YV5A 1M90C 4BY1G 1N33L 3NELA 2E8GA 4A3KH 2PNHA 2A1AA 2AMCB 2K52A 4PZ7A 3PO3H 1K8AC 1X3GA 1TWCH 2JEBI 4LF8L 4TVAB 3MXNB 5JEAJ 2ZM6Q 2VL6A 4LUVA 4O0AA 2BA1A 2CFMA 4LF5Q 5M3FG 3TRZA 1MJCA 2UXDQ 1JB7A 3HOVH 2WP8J 1L1OB 1MKHA 2AWNA 3I4MG 1YVCA 1I3QH 1VQFA 2JE6I 3U4ZA 1XMOL 2ES2A 2UU9Q 4BA2I 3GD7A 3LGJA 3UDXA 1I50H 4DK3C 3ULPA 1V43A 4LF4Q 1PH4A 1GKHA 1E22A 4IFDI 4X64L 1FL0A 3CW2C 1SRUA 5J3BA 3B6YA 2B63G 3STBD 2N78A 2HT1A 1L1OA 2N49A 3I55A 5LMUQ 1PH2A 1KC8C 5HY6A 4NB3A 4JBMA 1KHIA 4L5TA 4LF7Q 2NN6I 5GAGC 4OONA 2Q2HA 2AWOA 3HOVG 1Q81C 4IOCA 2AHOB 4A3CG 1RIPA 2A19A 2ZM6L 4BXXH 4KHPQ 1N9WA 4GLVB 4OWTB 4LF5L 2HHHQ 1IXRA 3AQQA 1Q82C 2UXDL 3J7A5 2RF4A 4JI7Q 3EBEA 4Y7NH 1X3EA 3CCUA 1M1KC 4IPCA 2IY5B 3J80c 1PH7A 4GKJL 3W1BA 1HZAA 2UU9L 1Y1VG 1UE6A 4LF4L 3F2DA 4DV0Q 4GKKL 3RZOH 3UDFA 5IE8A 4HIOA 4DUYQ 3T1YQ 5FLMH 3CXCA 3CC7A 3AYHB 5LMUL 2NZHA 3S24A 4DV5Q 3ULLA 4A3GG 4LF7L 1YBYA 1TWGH 1IBML 4A76A 5AJ3Q 3K7AH 4R4QA 5LMNW 1YITA 4GS3A 3F2BA 4DAYB 5LMNQ 4YWLA 1E24A 1LM0A 4A4IA 4DPGA 1BBUA 4DR5L 4A3BH 3STBC 2DUDA
chains in the Genus database with same CATH superfamily
4DR7H 4KTAA 1NMGA 4LUZA 5EGTA 2XIGA 5IY0A 1RJQA 4XZ3B 4DL6A 4NXNH 4NXMH 3A7AB 2JA5B 4IPDA 4I55F 1VQJA 4F4XA 1N34H 5BMVF 4H13C 1RL2A 2F4IA 1I6HB 2N88A 3PO2B 4BBRB 4DV5L 4UP8A 5DG8A 2J6SA 3N43B 2EY1A 1E0BA 2WB1E 5FLXc 2LKVA 1L0WA 3H20A 2YZGA 2F4VL 3S15B 2VUMA 3QIAA 4NP5A 5C4JH 4J15A 3C0FB 3K7UC 4POFA 5EWFA 3G6YA 4B3TL 1AFPA 1G6PA 1VQBA 3A56A 1TT2A 3I4NG 5KFNA 2BDNA 3VR5A 2C22A 4X66H 3JC66 1V9PA 1C7YA 1HQRD 1B3QA 1I4GA 4OGQC 4DR1Q 1Y69U 2WB1G 4DV6Q 3PIO3 1O7LA 3FKIA 2FMCA 3JRWA 3S1MB 1MSGA 4UDUC 3HOUG 2PZUA 3G48A 2I07B 4GOPC 4N9PA 1HHVA 2Z0SA 2MO1A 1ZEQX 3NBHB 4YR2A 4DL3A 3MXGA 2B2WA 4IURA 2A69C 3ICEA 3AFPA 4JCVE 5FO7B 2H4OA 3Q23A 3FPUB 4O4HF 2ZXPA 2HDMA 1PV4A 4EGVA 1I3QB 1WYDA 4PMBA 2R92H 3V2TA 2DNEA 4ED7A 4HNVA 2R8HA 4DL4A 4EQ5A 4EEYA 3RN5A 1N56A 5LL6S 1J6QA 5FPOA 5C3EG 3PUVA 4RB0A 2MFIA 2UXCQ 2R93B 2FK2A 3GTOH 1UE7A 1S3OA 2D5DA 3CC4A 1DGSA 2Z1CA 5JOBA 1EUDB 1EIFA 2X0SA 5C4XB 2QILA 2D0PA 4YY3L 1B1ZA 3GTPA 3EQLC 3FKIG 4Q5VA 2JA7A 2EIFA 1N8RC 4IRDA 5KYIA 3KF6A 1V4YA 2RCNA 3RF2A 2RVLA 4EBDA 3GTGA 4G7OC 4MV7A 1M4VA 5KG4A 5KYLA 3RAQA 3BYTB 4UCSA 2NVQB 1YJ9A 3HOZB 5JUMA 1UAPA 3CVZA 2IX0A 3V4SA 3RJ0A 2XCAA 2DGYA 4AYBE 1GVPA 3RV3A 1D2BA 3PO3G 5K36G 4TV8F 3Q8SB 3BVGA 3G7LA 3JAMi 4R4OA 1UC8A 2VQEH 5BPHA 4PMCA 5KFVA 3A5ZB 4FXDA 1TWGB 3LWEA 2MGSA 4J0MA 2NVYH 5KFBA 4RUCA 1KEEA 3HOXB 1JWUD 2TSSA 1ILPA 1W93A 1QB5D 4A3BB 2FLLA 4DU9A 1ICFB 4RZQA 2RSOA 5L37A 1CZWA 3SDZA 1UC9A 3SE7A 4X62Q 1HNWL 2L1BA 4AYBG 2ZDGA 3D6WA 2QF7A 5DG9A 4DR6H 2I5LX 3KHGA 1SAPA 2ALYB 3H0GH 3D0FA 2WE6A 3A0JA 5FPRA 4DL7A 1S9FA 1SN8A 5IP9H 1E2WA 4BXXG 1LTLA 1U4LA 3CMEA 2AKWB 5BN4A 3J81c 2F4VQ 2EJGC 4KK7A 1ONLA 2KCNA 3NWTA 2UUCL 4F87A 4R8UA 2SCUB 3M7GA 1AUVA 5IGFA 3MR2A 3KLSA 4B3TQ 2L9HA 3TMEA 3RR5A 1KL9A 1O7ZA 5JVG3 5A2QW 1PYSB 2IHFA 4FM9A 4X6AH 1G291 3QJYA 1AN8A 3SHLA 2BA0A 1MZBA 1S0OA 2MO0A 3LX0A 1VQ8A 1XX8A 5J2TF 1FGUA 3HKZB 3NXWA 2K50A 1YHBA 3A8KE 4UY8C 4X3TA 4QGUA 2Z8LA 1MSHA 1IYUA 5C3XA 1ET9A 3W5OA 2Z6BA 4B3RQ 1NE3A 1X55A 3UFXB 1YNXA 4R4IA 2R86A 5JJZA 1S5BD 4K6LA 1EYAA 4OWWB 4FBUA 4A93G 1OTCA 1I94Q 2CQOA 1NJIC 2R92B 1ASZA 5T14A 3DEPA 3D3RA 4O1NA 3OSPA 2GPSA 1HR0H 4KHPH 1JWMD 1YNNC 1VQNA 1T94A 2YU9H 1Q7YC 2CW0C 5A2QL 1YJWA 4LMYA 3GTOB 3CQZH 4K8JA 1NUCA 3RN2A 2B2TC 5D65A 5GQOA 4DR3L 5ELNA 4BA1I 4A3MG 4B3SH 3OUZA 2Y0SA 5KFJA 5M9OA 2OWOA 3S9WA 2F0MA 4LFBL 4QB4A 1N48A 2O03A 1PYWD 2XN9C 3KYHC 3TREA 5M5YH 2VPQA 5KFGA 5A2QE 3GTLH 5CBEE 2OQ0A 4GN3B 1LACA 4JV5L 3PF4A 1LTTD 4EYHB 3OHAA 3RLOA 3IFTA 4DN4M 4O2BF 2W9CB 3F1ZA 1VQDA 1PK8A 2RDIA 4C56C 3LWBA 4JI6L 3D6CA 2KUMA 3E0EA 3K8AA 3A8JE 4YJ3F 1GXDC 1U4RA 2BOSA 5DEHA 5M3MH 2C35B 3I56A 1K28A 5ELFA 4C3IG 3H3VC 2C2RA 2NVYB 2EOTA 1G2TA 1Y1WA 2KHSA 2E2JB 4QWEA 5IOCA 1AE3A 2Y0SG 2O4XA 2J6UA 4M9UA 2JN4A 3VA7A 4M1UB 2EYPA 2K75A 1EYGA 3H4BA 4C2MH 4XYLB 4ETSA 3RBEA 1HNZH 1UUPA 2F0FA 5JJKA 4GLXA 2F0QA 3GIPA 3T1HQ 1IYVA 3TDQA 5C8YF 1CKMA 2R87A 5DLGA 1F9QA 1JQYD 4X65L 1CQVA 1Z2PX 1NTGA 1LABA 2YZNA 5KFUA 4DV4H 3VYTA 1CS0A 1BBXC 1E3PA 1HJPA 1SNOA 4LWCA 5BR8H 2JSOA 4ODGA 2PBZA 2CVRA 1GHJA 2E2HA 1PZID 1ASYA 4CDCC 2UUCQ 4O3RA 5KFIA 1JWSD 1TXYA 4TSSA 4A3CH 1FD7D 1VCIA 1Y1WG 4JYAL 3L4JA 3WOEA 4CGYB 3J7YW 1SFOH 1KD1C 1A62A 4IRCA 4G3IA 3UDGA 4HJ5A 1J5EQ 4JI1L 5CR3A 2B8FA 4PMWA 2JK8A 4RB3C 4RAYA 4MV3A 4HEDA 5D3IB 1SNQA 4CDEC 4CDFC 5LHY1 1XMQL 1PH3A 3GV3A 4MV8A 2KCCA 4JI0L 2ENBA 5C4ZA 1EFID 1IOWA 3QZ8A 5GADC 2BCOA 4J6HA 1S5FD 4YAJB 5LOVF 3UDIA 5KG5A 2JEGA 1V1QA 2K5DA 1O78A 4ECZA 3TSSA 5G3LD 4PQXA 1TWHB 4KJNA 5D1PA 4DAPA 2YU9B 3I4NB 4LF9L 1GYFA 4LF5H 2F0VA 3ORQA 1VBGA 2WYOA 1GHKA 4ED1A 1Q1BA 2F0HA 4A75A 4POGA 4KKSA 3P7JA 4GKJH 3K3PA 5KFQA 3KBXA 3LP8A 4ZOLF 1TQOA 1Q46A 2F03A 4TRDA 3S2DH 1KTKA 4LW1A 4DNRB 1SSOA 3W1GA 3KHLA 2G9DA 2EJFC 1PH1A 5CMDA 1IBMH 1SE3A 4GNXA 3CCEA 3GIQA 3RFCA 3T56B 1WCMA 2IMWP 1S03G 4R8IA 2RSNA 3I2ZA 1H9KA 3T1YL 2EVBA 1WVLA 4P74A 1SJED 1EY5A 3R93A 3N41B 5EAYA 2PQAA 1EZ1A 1I4RA 4CKCA 5C3EB 4IO9A 2B3GA 5M3MB 3FPPA 4QW9A 4OEMB 5LYJF 2R7ZH 2FPPB 4IPGA 2PVPA 4OL7A 3NP8A 4CC6A 1HZCA 2KCMA 1CQJB 3QZ7A 4P2CB 2ALZA 2PI2E 1JJ2A 3LMLA 5CBAE 2FPGB 3IN5A 1AUXA 4B08A 4XTCS 1HNXL 4C2MB 5CV8A 1K1QA 1C3OA 3M4OH 5KG1A 3VPDA 1DYQA 3C46A 1X56A 5F9NA 1EYDA 1OXUA 2XSCA 1AP0A 2JEAI 1STBA 4OO1I 1SBBB 3SVMA 3H3VI 4F7XA 3TP5A 2B2VC 3TQYA 3PVXA 4DUZL 1TKWB 3F8NA 3GTQH 1STEA 4BY1H 1JJCB 1ZXTA 1VDZA 1SR3A 2X69A 3HOVB 4LFAL 4A3LH 4JI8H 4DR3H 4U673 1OWTA 3ULJA 5KFYA 5BN3A 5C0XG 1SFOB 2N8NA 1SE4A 4YBZB 3DMUA 1CTMA 2JA6H 2JJQA 4F88A 3GTKH 1JOOA 3GQCA 1F9SA 4F4WA 1TS3A 4O42A 4RKBA 1RTOA 4OX9H 1WD1A 2YV5A 1M90C 1I3QA 5ELCA 3KF8A 2E8GA 4A3KH 1XNQH 2FJ2A 1I50A 2K52A 4ULLA 1S5DD 3CHBD 4LF8L 4TVAB 5KFXA 4ILWA 2UUAH 2FFKB 3NHHA 2BA1A 5BN5A 5M3FG 1C4QA 2UXDQ 1MKHA 4CHTB 1K1SA 1HFGA 1LTSD 2JE6I 3OHXC 3J7AF 3MJFA 3BQ0A 2C9OA 1LT3D 5EKLA 2UU9Q 2W6PA 3VYUA 1PH4A 4FF2A 4MTKA 1HUNA 2R82A 4C5AA 2A68C 3Q8PB 2B63G 2H1EA 2HT1A 1L1OA 2N49A 5LMUQ 2DPJA 5HY6A 1KC7A 2NN6I 2Q2HA 2AWOA 3F2UA 5KG6A 2EY2A 4U6PA 1QJOA 4WFN3 1SNDA 3BAAA 4OWTB 1BXTA 2HHHQ 4DV2H 3S2DB 1Q82C 1GUTA 4ZKCB 3EBEA 2F0IA 2FMMA 1M1KC 3SI8A 1B33N 3J80c 4K6DA 3BDCA 1UE6A 2L55A 4G7HC 3TBIB 4GKKL 3RZOH 4A93B 3MZ5A 3UDFA 2GPWA 5CV6A 5IE8A 4YJ2F 4HIOA 1ZETA 3T1YQ 5JVLA 3CXCA 3CC7A 5I47A 4J9RA 1R4PB 1T3NA 2JP1A 3BVMA 5C4HA 1YBYA 2I8CA 1D6EC 1YITA 3K7AH 4R4QA 5LMNW 4GS3A 2IL8A 2R7ZB 4DAYB 2UXBH 1IW7C 1LM0A 1IKLA 4L63B 4DPGA 4HNUA 1ZKOA 4YR3A 2EYLA 2AU0A 2DUDA 3X3NA 2NU6B 4JI3H 4IUNA 1IL2A 1FVIA 3K0YA 3MHBA 4LAAA 3WNZA 2NVXA 5FD6A 1KNAA 4JI7L 1IBKH 1A8VA 3GIKA 5IWAH 5JPMC 1MIUA 3GTJH 4WJ4A 1X3PA 2AQ1B 4DK1A 4DV0L 3AB9A 3M4OB 2RKSA 1B7YB 3I4LA 2B2YA 2HDLA 1LT6D 1W6KA 3MFGA 5FJ8H 4DUYL 2L0CA 1XJVA 1VQ5A 2HIXA 4JBWA 2YCHA 2CW8A 2NN6G 3F8TA 2A6HC 4A3DG 3DXJC 2PZTA 1IBLQ 1WD0A 2I0QA 5KKNB 2V1CC 3CAMA 1Q90A 5LMNL 4DUZQ 5KIXA 4JBKA 3J7A5 3VR4A 4JI2H 3JAMW 4DR4H 4ZUIA 4BBSH 2R85A 4DR2Q 3KLSX 3FMCA 4LFAQ 1BKBA 3WOFA 4B9WA 1QZGA 3RZDB 4H0LC 1KDBA 3SK5A 1SE8A 3R5FA 3M4PA 2IX1A 3J7AK 1QNUA 5ELBA 2X6GA 1N32L 4A3FH 1I6HH 1JOQA 1VQMA 2EYHA 2NUCA 2F0OA 1TWAH 1G8ZD 1VMPA 4A3KB 1EIGA 4HQ6A 1EOTA 2UVWA 3VPBA 1TS5A 3BS1A 1NY4A 4TKOB 4LF8Q 2PMZB 3K58A 1JE5A 4YCUA 4J8QA 3JAML 2J9GA 3UI2A 1BCPB 5D3DA 3TS2A 2KHJA 2KOLA 1QOHA 3L4KA 1PXUA 1VQCA 2K6AA 3KOJA 2FP4B 1A63A 4KY6A 4N8X1 4DR1L 4QQBX 4DV6L 4R1JA 4I50F 4DL2A 2J0TD 1Q3LA 1T9HA 1A9XA 1RJTA 4E6IA 3JAME 1M7JA 3ER0A 2TMPA 3RTXA 1TS4A 4Y8VB 1STAA 3OW7A 4RGOS 3S1NB 3BQ2A 1PVOA 5E1FA 4RHRA 4K8IA 5DQHA 5KFOA 2ASBA 1K9MC 2FLNA 1E4EB 2IPKD 4Q44A 3IAYA 2QDLA 1LV9A 1WI5A 4PZ8A 1JMCA 1I5FA 2R84A 2W57A 1KRSA 1EY9A 1GO3E 4AIMA 2NU7B 4DV7H 1B9MA 3SGIA 2NU8B 3PIOA 4GKKQ 2VUGA 2RDFA 3RZOB 3KJPA 1JICA 2R93H 2UXCL 4QIWA 1PMRA 3MEFA 3A55A 3NPPA 5C4XH 4NXNQ 3CD6A 4O4LF 5DLFA 2OF1A 2VOBA 3K7AB 3H0GA 5F2DA 3ORRA 2HD3A 2Q8RE 4QWAA 4OO1H 5FD5A 3MWMA 1VQPA 3H3VH 2YW2A 2K4KA 4GN4B 2QDBA 4QIWE 2QGQA 4I7AA 5C44H 4B3ML 3BZKA 4KN7C 3E3XA 4JV2A 3P20A 2ID0A 2NVQH 3V6HA 3GTMH 3HOZH 5HBRB 2NYZD 3LNNA 1WTXA 1JJGA 2ZXRA 2MJ8A 2K5QA 3V6KA 3SXHA 4LH7A 4DKAC 2HQLA 1D7QA 1VF5C 5K2MA 3PUZA 3G4SA 2VQFH 1EY7A 4GLAC 3KDFA 1SYEA 4X66Q 1Q8IA 1TAEA 2IHEA 5EKKA 4PG3A 3HOXH 4TQUS 2ZDHA 4A3IH 2ZJTA 2LS01 4CKEA 5LL6X 5C1OA 4QUCA 3H0GG 4BBSB 4O2AF 3R5HA 4X62L 4BS9A 1PZKD 2XTIA 1D1IA 4XYMB 2Q8TA 1R4QB 1D5MC 5DQIA 5EWGA 1EYCA 5L9XA 4XDXA 1E1TA 3A54A 2W6QA 2E5LH 1NR2A 2W6OA 4KY5A 1EQQA 1AW7A 4RB2C 4EQNA 5EBDA 2VPSA 1N32Q 5DQGA 5FK9C 1WTQA 4A3FB 4NMZA 4O3PA 4RUAA 2V4QA 1TWAB 4JW0A 2P0AA 4R4CA 5IYBG 5CV7A 1RD9D 1VQOA 2V4RA 3CQZA 4Q0FA 1K8MA 3K57A 1PH6A 2YS6A 4J1MA 4R7RA 3Q6SA 2VY3A 3RGZA 4DV3H 3GQBA 4HIDA 1Z47A 3S1RH 4X3SA 2IP4A 4IOAA 2ATLA 1YNJD 1DCZA 3A74A 4K2KA 5CC4A 1EUCB 2KSWA 5JH7F 3GIJA 3GTLA 4ALPA 3GLKA 1FJGH 1JORA 4KI0A 4A2AA 1WR2A 3PW0A 2UUBH 2HJWA 2EDGA 2M00A 2R6GA 4IWXA 2K5NA 2EXDA 2ZJPA 5EBCA 2WFWA 3J81i 1EQRA 2R3ZA 4AQYH 4JI4H 4G4KA 3E9HA 1F2MA 1M6VA 4Z9CB 4EBEA 4FO2A 4LFCL 4B3RL 4JPBW 4J9MA 3OSOA 4C3JH 2OTJA 1BCPC 2Z6KC 2OT2A 1RKNA 3BG3A 1VQ9A 4YHHL 5F9LA 3DM3A 2VQEQ 1RYSA 1S0MA 3WWVA 1I94L 4ECUA 2VB2X 5DAUA 3EA6A 2VUMG 2F0JA 3RMHA 1PRTB 5FO8B 3A5UA 4FF3A 2KHIA 4RKLA 3BVZA 4JUZA 3ITPA 3HOYB 1VQ4A 4APMA 1XWEA 2A6EC 2F0KA 1BBWA 2R61A 3P75A 3C2PA 5KGUA 2JEFA 3L0OA 4ZHQF 2PZWA 3EROA 5EPKA 3TEHB 4HJ9A 2R6FA 5DG7A 3BZCA 2BQ3A 4HR7B 3CCRA 3I12A 3MR3A 4JG2A 1SNPA 3X3MA 3OTOH 5L1KA 1HZ9A 3PUWA 4JBJA 5C6AA 4B3MQ 3V96A 5C44B 1B2TA 2CQAA 1D5ZC 1WTOA 4BY7G 3VA5A 4EGQA 3GTMB 3O13A 5KFSA 1Q1EA 3BQ1A 3OIPA 3D4DA 4YP3A 3NTIA 4K2LA 1S4ZA 1XNRH 3URYA 5IYCG 4FXGC 4C3HG 3WO1A 1H95A 2GLTA 2SDFA 4RU9A 1ZQ7A 4DV1H 5D1OB 1SNMA 2K33A 2Q2TA 2K14A 1DOMA 4EVOA 2E2JH 1MGSA 5EPLA 1J9OA 2LMCB 4A3IB 1OXVA 4PDBA 1SEBD 4IHJF 1ULZA 1N33H 2JA7G 2QA4A 1UWVA 4CKBA 3KAJA 1V1PA 4MHEA 1DOLA 5HURA 3H40A 3MXUA 5KFCA 1IW7D 3VR6A 2W9AA 2IW3A 4XT3B 3T1HL 4NKLA 1Y1VH 3J7AV 5IODA 3CF5A 3VMMA 4WJWA 2E74C 5KT2A 4XIGS 2X6LA 4K5XA 1XMOH 5HGTA 1SMYC 1STGA 4A3EG 2E75C 3J7ZC 1HR0Q 2WV6D 1T5EA 2PQEA 4GN5A 2F0SA 5D14A 5C5MA 4A3GH 4MTEA 4X64H 4XQNA 1G2SA 4O3OA 1PTOC 3PSIA 3HBLA 2GN5A 3PV0A 2F0TA 1YHQA 1SROA 4B3SQ 4DAMA 4DK0A 1TY2A 5JPNC 3OYYA 4KMUC 4QL5A 3M4QA 3S1RB 1CKNB 1VMCA 1J5EL 2ZM6H 4KJOA 3SK4A 3CP0A 1VAJA 3MA2B 2V5AA 2JEIA 1KABA 4ME3A 4WBNF 4GNXC 4JI5Q 1WH2A 2CCZA 1R9TH 2NZOA 3NEMA 2E2IB 4LF4H 4ZLTF 3KFUA 1U4PA 3C1FA 4XXEA 4LFCQ 3S2HB 4ZI7F 3HG9A 4C3JB 4RCNA 3VDYA 4UCVA 4CC5A 1UNNC 4YHHQ 4LF7H 2R7ZA 3K81C 2R8KA 4DXGA 2G5DA 2WAQB 4IFDG 2ZT9C 1TWHH 3CRKC 3I4NH 1PH8A 2FINB 3LWUA 3ETJA 3AFQA 2F0NA 1JIHA 1BOSA 2Q8IB 5IGGA 4MV4A 1X6OA 3HOUH 1VF7A 2V59A 1C8CA 2OLSA 4R4TA 1K83A 3M7NA 4C5BA 1CSPA 1S68A 5JEAG 1NCVA 4KLKA 1KLUD 4DV5H 5KFMA 1LT4D 2WINB 3VR3A 1EQVA 1N36L 2EYJA 3HOWG 1PRTC 3RLFA 4A3JG 4TV9F 4M7EA 3GTQA 2Y0SE 5DGAA 2F4VH 4APVA 3TQTA 2H5XA 5KEEA 2JA8G 3EPGA 3DM1A 4LSXA 5I9OA 4OELB 1VQ6A 4K0KL 2MNAA 1JDBB 4ECSA 5C3EH 4B3TH 2R7NA 1BCPF 4I65A 2R7FA 1BGWA 2JA6A 3CCSA 3GTKA 1TWCB 5BPFA 1SE2A 3RUZA 2HUGA 4RNOA 2MP1A 1G6ZA 2IBKA 1VKZA 3E9IA 3FKIH 3IG0A 3CPWA 2BQUA 2I5HA 4YCVA 1HA5A 2NUAB 1B4OA 4GOPA 1CFMA 4KHZA 5TSSA 3RBDA 1LTRD 2WTFA 2HVSA 2OXPA 3IRBA 1EYZA 3OPOA 1GUWA 1Y1VB 4BY1G 1HA6A 1C48A 3NELA 1H9SB 1Z2NX 2AMCB 3PO3H 2SNMA 2L12A 1WTWA 5K36H 2VA3A 2JEBI 2HVQA 3BA8A 3MXNB 5JEAJ 4A3GB 4LF5Q 2BR0A 4RZRA 1MD2D 3HOVH 2AWNA 3R2TA 3I4MG 2M9VA 3T5LA 2MHVA 4YY3H 4BA2I 3UDXA 5LP6F 1V43A 4DL5A 1GKHA 1JXLA 3CW2C 1FNWA 1SRUA 4CBVA 1JKJB 3B6YA 4H7BA 4PWQA 5HV6A 4J9PA 3I55A 1PH2A 3M9OB 1PFMA 2K04A 2LY7A 4OONA 2DPIA 3HRZC 2KJXA 4BWSC 4IOCA 1R9TB 4I4TF 2AHOB 3GILA 3ERQA 2SOBA 4BXXH 3SK6A 1AN7A 4FP5D 3D8GA 3AQQA 2SNSA 2UXDL 3MC0B 2RF4A 4ZQIA 3AU7A 3H09A 2ZDQA 1X3EA 3CCUA 1SDFA 2RCFA 4IPCA 3GP7A 2UU9L 4L1KA 4ED2A 3V4ZA 1B9NA 4UCRA 3NUCA 2AGOA 2IWHA 2AUKA 2JYOA 5LMUL 3GTJA 3BYYB 3H94A 4HNTA 1HNWH 1RHPA 1D5XC 2E76C 4A76A 4JV1A 2WB1B 1GUGA 2FE3A 2F0DA 4YWLA 1E24A 2PW7A 2RDGA 4A4IA 3H4DA 3HOUB 1BBUA 5FLXW 4DR5L 4UCTA 3STBC 1S10A 1X32A 2ICIA 2F0EA 2HHHL 3I8ZA 4KKTA 1SYDA 1TU2B 1EUJA 2CKZB 2FK3A 1N36Q 4IUUA 3K80C 3PIPA 4O2DA 3A8IE 5C0XI 1GM5A 2OTLA 1JDEA 4A93H 4N9TA 1VQGA 1CSQA 1HFNA 2UUCH 3H91A 2A69D 3NE5B 2VUMB 2M05A 4IJHA 3IFDA 4JI8Q 1D1KA 2R7LA 1YIJA 4IUTA 4ZCKA 4K0KQ 4LF6L 3CCMA 2JA5A 4K14A 3GV8B 3Q8RB 4IPHA 4A3MH 2FXQA 4OX9Q 1KAAA 5FLXL 1ZHQA 2W7PA 3J80i 2I5MX 3FKIB 4HTHA 1TWAA 4P75A 2Z4HA 4ECWA 2NTSA 1DJRD 1TWFH 2YZMA 1XPOA 5KFPA 2ICEC 4RHSA 3R8BA 2C28A 4GC7A 5E4WC 1A3TA 1M8AA 4RNNA 5FLXE 3BZDB 3TQ1A 2O2LD 5IP7G 3KJOA 1WCMG 2CH4W 3SE0A 1IBLL 5E7NA 2A8VA 1CKOA 4RH6A 3PO3B 3Q1KA 1PRTF 2JA9A 4U68A 3BDLA 3IKJA 5KNDA 2JA5G 5CA1F 2UVRA 1O75A 2HCIA 4DR2L 1A15A 1Z9FA 2WDTA 2B2TA 1UNSA 4FBTA 3RZDH 3NBHA 3BG5A 2EXZA 3QG1A 2XNAC 3OWEB 4BBRG 3PO2G 4LFBH 3Q24A 2JA7B 4AYBB 1QG7A 5KFEA 4DV2Q 2CZGA 4JV5H 3GTGB 5CGKA 2KBNA 3AEVA 1ML0D 5M5WH 5KT7A 2YTVA 2CH4A 3D4RA 2DIKA 2YYAA 1OXXK 4J9NA 4F8MA 1ZYRC 1Z6HA 1DONA 3T51B 2R93A 1BR9A 3N40P 3DF7A 1W6JA 1SYFA 2F0GA 3WDNA 3EYYA 1JE4A 1IHZA 2DY8A 4RB1A 3RAXA 2VA2A 4JI6H 2YTYA 2P5ZX 1F2LA 1B6RA 2PCFB 1K0SA 2MQHA 4EQPA 3EIVA 3E6ZX 1BDOA 1YEZA 2UXBQ 2BH8A 2UVUA 4JI0H 1Y1WH 1Z7TA 3ZYYX 1VQ7A 4L5RC 1S72A 4JI3Q 4EEQA 4I7ZC 5DNFA 4TQSA 4EQOA 3V6JA 5KT3A 3PUYA 4CJ1B 3FHWA 1C30A 3S1NH 1IKMA 5T1GA 3K5MA 2W6NA 3KALA 5KG0A 3RB4A 1Y8NB 2HIVA 3N42B 1SXTA 1NR4A 2EZVA 3HS0C 4FXKC 4DR5Q 4RGNA 4WRDA 4V190 4ECTA 5FKAC 4DNTB 2FHTA 1QCBD 1JLLB 3J81W 1CI3M 4X65H 1SYCA 3MR6A 5C0XJ 1KLGD 5D1OA 1TWGA 5KFKA 4RGTA 3BABA 1DV2A 5KG7A 3OSNA 2IA6A 5KFFA 1KBLA 1BVSA 1CK1A 1GJXA 2NZ1D 5LA6F 4DR4Q 2EY6A 1EWHA 3CKIB 4DR7L 1NBWA 4FNFA 4R8UB 4JYAH 4KD3A 2KEEA 3U9OA 2RQXA 4NXNL 4LF6Q 4K5VA 4NXML 2Q2UA 4U7CA 1UEBA 1N34L 4QWCA 4JI1H 1T5XD 1YNND 1Q8KA 4A3MB 1M0WA 2CW0D 4L5SA 2WKDA 2QEJC 1OXTA 1XMQH 3RV4A 4IUQA 1MBYA 3H15A 1TWFB 5FLMG 1AE2A 1KJ9A 3M4YA 1RJRA 1DD2A 4EFBA 2XC9A 2F0WA 2LXKA 2GVBA 5H1SE 1RF2D 3I70A 5KFDA 4A3JB 4L8JA 1VQKA 4JV0A 2KCTA 2DN8A 3CPFA 3PR5B 4EFEA 2NVTB 3NQIA 3EFXD 4A3BG 1CKNA 3K5HA 1PRTD 4UP7A 4DGZA 4JC0A 2YRWA 1RYRA 2Z9HA 1JOKA 4X66L 1FNUA 1GUNA 3ND9A 1OXSC 4XYQA 1E7ZA 1MHWC 3MEHA 1H9RA 3K5LA 1TA8A 4QWBA 4LF9H 4MIUA 4NW2A 3KLRA 4C3IB 3NWSA 1X65A 3HKZA 1PTOH 3N6XA 1I4HA 2F0PA 3EVQA 2YYZA 2LXJA 1RJPA 5EQ0A 1LTAD 1AH9A 2Y0SB 3CRLC 3ONAB 2B2WC 4CDDC 4YIJA 3L7ZC 2IX3A 1B50A 1KDCA 1AZPA 1QNKA 4OIKA 4XQQA 2I87A 2R92A 1LYLA 2ZTCA 3HFZB 5M5WB 2ZJQA 2BH2A 4LSAA 4HIKA 4DV7Q 2VNUD 3MWEA 3Q8QB 1YI2A 4LK1C 4ECQA 4R8NA 3KAKA 3T1YH 4LNQA 1PFSA 4I7HA 3GTOA 3KXYT 2RHQB 5C1PA 2O5IC 1HTPA 3Q22A 1STYA 1Y14B 5ELDA 3I4MB 3FMAA 4QF4A 1Y1WB 1SYXB 3U4VA 5KG2A 1V1OA 5J22A 4ECYA 3RLNA 2DLNA 2XGTA 2W7OA 5IYZF 1PFNA 2W9CA 1HNXH 5D8DA 4O3SA 1I7NA 1DM0B 3Q0AA 5IGBA 5M5XB 1XPRA 2R92G 4ECVA 5I2YA 3GV5B 3MWDA 2B2UA 2FJZA 5EDWA 1XDNA 2VQEL 2VQFQ 2E2DC 2WACA 4UCUA 3PR4A 3Q8DA 4TQRA 5M3FH 2NVYA 1EIYB 2K5HA 2B2VA 1ENAA 4DUZH 2E2HB 1GOZA 5L1IA 4FF4A 1LLRD 5KT4A 3HOYH 5COYA 1VQLA 4DR7Q 1B6SA 1I4XA 4LFAH 1E4FT 2B63H 4GZYC 2OQKA 3BJUA 4G57A 4ED8A 4DR6L 4NXMQ 3FEWX 2K7VA 3TIIA 1CUKA 1O7IA 4YAKB 1N34Q 2VB3X 2E5LQ 5EZYF 1E1OA 1BXRA 1SYBA 3K5OA 5IT9W 4FVMA 3CCJA 4MAMA 1YHAA 2D2CC 1EU4A 2AQ4A 2A5HA 3U58A 4LF8H 1L2ZA 3DWAA 1D8LA 3RNUA 4HIMA 3FP9A 4DF7A 1X54A 2VQDA 4ED6A 3JRXA 2VZAA 5EOYA 3UQ8A 1QUQB 2AQ3B 3J81j 4IALA 4DV3Q 3M4IA 5JJLA 4IUVA 1HR0W 2CWAA 1RTNA 2Q2IA 1AEXA 2MPMA 1FJGQ 2L4NA 1O80A 2UUBQ 5JJIA 5CB4F 1XTDA 4J9OA 1PTOB 3PUXA 3GIIA 4MZ9A 1K73C 1B44D 5IT9L 4AQYQ 4JI4Q 3BA9A 5ELOA 1CQIB 1K3BC 1NMFA 5IP9G 1EL0A 1IL8A 1DOKA 4ZKBB 1JB3A 2YRXA 4WJ3M 4MA5A 4M8AA 1XXGA 2KECA 2KEDA 4OXPA 2EY5A 3KLWA 5IT9E 4GNXB 1TWHA 1HR0L 4KHPL 1RODA 5KFRA 1YZ6A 2FMAA 2YU9A 4GKKH 2NN6H 1KDAA 4A3DH 3VR2A 3OOCA 5IYDH 2CQYA 3L3OC 3GV7B 1WTHA 2R7DA 4MTDA 2PN1A 2WB1A 2W8LA 2PQAB 4OWXB 4B3SL 1KQSA 4KV6A 4QCLA 3HGBA 1VS0A 2CWPA 4UAIA 5CA0F 3E5NA 3UE1A 4EG0A 1SMXA 4X3KA 3I90A 3T53B 4JOIA 3OTOQ 2IJ0A 1EIHA 1PHJA 3G6JB 2VXWA 1QE6A 1WOCA 2NVXH 2XGQA 4JI7H 2QYZA 3BU2A 4JI5L 5AJ3L 3T5HA 2HCCA 4P72A 3T13A 2E2IH 1SLJA 4N8FA 2MUYA 4WD3A 4DV0H 4ZK9B 1VQHA 1S5ED 3NTKA 3G71A 1XNRQ 3S2HH 3NGDA 4DUYH 3Q2OA 2F1MA 4HJ8A 4H02A 4RFBA 5CORA 1HZBA 4DV1Q 2IT1A 1PLFA 1ZYRD 3KUPA 5M3FB 3HZXA 3FVQA 2XGPA 2CHBD 5LMNH 2BQRA 4NLGA 2VW9A 1N33Q 4ED3A 3PQIA 4ECRA 4C2MA 1VBHA 4MNOA 5KG3A 2EYOA 1B3AA 2B63B 4DLKA 3C1EA 4HMIA 4E4TA 1UEAB 4DR6Q 3RB6A 3EJIA 2RGRA 4HCEA 1HNZL 3M85A 2K05A 1II3A 2A68D 1WTRA 5CAEB 2RDJA 1N32H 1L0XB 1PA6A 3CMAA 2V9WA 3T5KA 1XMOQ 4DV4L 4J9LA 3KF8B 5A35A 3PW5A 1ENFA 1I50B 5BR8L 4IUPA 3K5IA 1MI2A 1X3FA 4X64Q 1A3UA 5M3MG 3S1QH 4KHVA 4MV6A 1U4MA 3S17H 2FK1A 5I6WA 4FU0A 1EY0A 1SNCA 1SFOA 4MA0A 1HTLD 1X3GA 1TWCH 4AYBA 2ZM6Q 2RDHA 1GUOA 1BF4A 2UVVA 2VL6A 4LUVA 4OHJA 4DR1H 4FS1A 2CFMA 4DV6H 3TZDA 2F3WA 5KX5F 1MJCA 4YR0A 2WP8J 2XWJB 1L1OB 2NU9B 4HCSA 3U4ZA 1VQFA 1J8IA 3N8DA 4WORA 4J9SA 2ES2A 3GD7A 3ULPA 4LF4Q 2N55A 3NBIA 2HQEA 4IFDI 4FYDA 3J80W 2EPBA 5J3BA 3HEJA 3MFHA 1EY6A 2DWCA 5CYUA 4NB3A 1I4PA 5JVDF 1KHIA 4LF7Q 5KFLA 1Y8OB 4Q43A 2BDOA 3ND8A 3HOVG 2Z4IA 5JAVA 1Q81C 4PV1C 4A3CG 4ECXA 1RIPA 3MAQA 4KHPQ 5LXTF 1ET6A 4YQWA 2UXCH 1FYCA 4GLVB 4A3DB 4LF5L 2FLPA 1RK5A 4Y7NH 2MCTA 2YS7A 4HYKA 2IY5B 1PH7A 1WTPA 1EY8A 2A6HD 3TP6A 3W1BA 4GKJL 2SEBD 3K3VA 3OUUA 4IR1A 3F2DA 3PMFA 1XTCD 2FPIB 1CT1D 3J80L 3AMUA 4J9KA 1BO0A 5KFHA 2J6TA 4HAEA 4HMJA 4DV5Q 3S24A 4CJ0B 2L5TA 2RBMA 3ULLA 2NVXB 4B3MH 1ESRA 1IBML 5AJ3Q 3RGXA 5T1IA 2QCPX 4RCOA 1DV1A 2QK4A 5C4JB 1Z2OX 3J80E 2KVMA 5GONF 1KAWA 3QR8A 5IYBH 1LTBD 3OMGA 2BE5C 1V51A 1W3SA 4DAYA 2R8IA 4ZYSA 4F4ZA 1BQQT 3M9BA 3G6XA 2PPBC 1EZ8A 4OIJA 1Q12A 3KK7A 1TWFA 1FNVA 4X62H 2EQSA 3RIZA 4IAJA 3GV6A 2DZDA 3TINA 4XYOA 3DEOA 1HNZQ 1ICWA 1UE5A 2F52A 4MTNA 3MWYW 5I4DA 3HB9A 1RCVD 2ZTDA 5J1ZA 2D62A 2EE1A 3W2DA 4DV4Q 3WO0A 4ZUJA 5ISRA 2ZXOA 1K8GA 1I4QA 5BR8Q 5KNCA 3K59A 1WTVA 1S40A 4RAZA 3U9TA 5G3LF 4XQJA 3I3CA 3PCOB 3S1QB 3NENA 2R7ZG 2VUMH 1QILA 4JI8L 3S17B 1E4GT 2B29A 2XRQD 4IN3A 3FDTA 3W3AA 3TP7A 4YY3Q 2FB9A 5I6YA 3N44B 3G8CA 4RMFA 3PZPA 2V4DA 3TP8A 3JAMc 3GO5A 1EY4A 3OIQA 2A74C 4IJLA 1HQMC 2M2LA 4QJFA 1RK6A 1LUZA 4OX9L 3MTSA 4JVZA 1A0IA 4JI5H 2PNRC 1XNQL 2J4XA 4ZQ3A 1EQTA 4IFDJ 3VPCA 1TR5A 2NWGA 4H44C 2NTTA 1SJHD 2PMZA 2UUAL 2PYKA 1OO9B 2K28A 1EFWA 2AGPA 4LFCH 3MVVA 4B3RH 1I6VC 4BY7H 4HSPA 2Z6KA 4YHHH 1L2FA 1P16A 3IL8A 3PW2A 4LUOA 1I94H 1DZ1A 3N6RA 3T5JA 1LTID 5IIFA 1LTGD 2W9BB 5IYCH 4A3LG 4C3HH 4C1NI 2PMZE 3PN1A 2ASJA 1L1OC 2JA6G 3N52A 4QIWB 5I9PA 3ETHA 1HNWQ 2EYFA 4O3NA 1CA5A 2AGQA 1LO5D 2L15A 4Y7NB 2WKCA 2QEXA 4DNIA 3KHHA 4GKJQ 1KJJA 3GTPH 4MN3A 3H0GB 3R23A 2JA7H 4A3KG 1E4EA 3K6OA 4DV2L 5DGBA 4HJAA 4DAVA 3GTGH 3CC2A 4HSVA 4QWDA 1NAPA 1JCKB 1SYGA 4IQZA 3FDSA 1KRTA 1G51A 4CJ2C 5FOBB 1IBMQ 1KNEA 4UHVA 4Q45A 1JX4A 2B8GA 3S16H 3QOJA 2NB0A 2XWBB 4A3EH 3DHQA 3R5XA 4XT1B 2DNCA 5C5JA 3G6EA 1K0RA 3HP3A 1LT5D 3KDFB 2UXBL 2DJGC 1IOVA 3U9SA 4JI3L 4X3UA 4PZ6A 1YJNA 4KN4C 3I72A 3KBGA 2F0LA 2WIIB 1S97A 1IBKL 1U9RA 2N3SA 1WFQA 5IWAL 2XIWA 1DXMA 1PTOF 3T16A 3D31A 3K0XA 5DM63 4YWMA 2VS1A 3M9NB 4F50A 4DXFA 5IT9c 2FKLA 2B2YC 2K1BA 3T1HH 1FGBD 1GSAA 3C3LA 1QUQA 5E4XA 2A73B 3E5SA 1CA6A 3BDOA 5KFZA 5K5PA 4YB8B 3TN2A 2VR1A 3ERSX 3HXLA 1STNA 4NDXA 3D4WA 4HN7A 4JI2L 3L9AX 1PYBA 4DR4L 3UE0A 3CCVA 1XPUA 3CQZB 4IFDH 3H6MA 2ZJRA 1BCPD 4DR3Q 4LH6A 1W2BA 3ZJYC 3TS0A 4LFBQ 1K3RA 1E2ZA 2YTXA 4UFZA 5J39A 4O3QA 1J5EH 3V05A 1O7YA 2PW5A 4NPSA 5M5YB 2AUJD 4P73A 3GTLB 4EYIB 1RDPD 4JV5Q 5KRUA 1M0TA 1HCZA 1U5KA 2A6ED 1XNQQ 2K03A 3I4OA 3QB3A 5FJ8G 3M3YH 1B70B 1A2UA 3CCQA 5JEAH 3FRPB 2PI2A 3SR1A 1WSCA 2UUAQ 4YWKA 3NSWA 3JSNA 3HOWH 2XD4A 4JI6Q 2KQ3A 4A3JH 2OH2A 1EOVA 2YL2A 3OMCA 4AH6A 4BY7B 3MXPA 2JA8H 2NVTH 2D9UA 1HPCA 4B9XA 3I73A 2NBFA 1UE1A 4C1NK 4BBSG 3PF5A 4IRKA 2KENA 3S14H 4C3HB 2EYMA 5J2UF 4S3SA 1F2ZA 5L1JA 4DK6C 2KA7A 1EU3A 4C3IH 5KFWA 2OCEA 3I7FA 1X3QA 5KNBA 5HGQA 2K5WA 1EWIA 3SEBA 1PX2A 1HXYD 1Q86C 4A3FG 4EBCA 4BWGB 3OW2A 3GTPB 3JZIA 3RB0A 2G9HD 3P1HA 5IGDA 1K83H 2OEOA 4LMQD 2W6MA 1E2VA 2B2UC 3T4AC 3KF6B 4X65Q 3G6VA 2GA4B 5L1LA 2RA4A 4QUFA 1N36H 4A2BA 4RWSC 1YNJC 5JQWA 1TVXA 4DV7L 1GSOA 3DUZA 3S16B 3GDEA 2I46A 4IR9A 5KT5A 4XX0B 4ID6A 4A3EB 1ESFA 1C9OA 4JYAQ 1QWYA 4K0KH 2B63A 4FS2A 4JK1C 2ZTEA 3A7LA 5I2XA 4HR7A 2AQ2B 3JSLA 1SMYD 4DFAA 4QW8A 5GAEC 1GGOA 4JI1Q 3I4MH 2HVRA 1KXLA 3M9MB 4QY7A 2LFNA 1F77A 4RNMA 1PTOD 4ZRZA 1XMQQ 1IBKQ 3VYRA 5IWAQ 4JI0Q 1VQEA 4ME6A 3GTMA 1V1PB 1HUMA 5FO9B 1F9RA 2XRSD 1BUVT 1QVGA 1AZQA 5M5XH 1QVFA 1IZ6A 1X9NA 3VYSA 2ASDA 1H9JA 3NK9A 2VQFL 2R93G 4Q8EA 3HOYG 2QW7A 1G91A 5EKIA 2C2DA 3PIP3 4QMGA 3E0JA 5C4XG 5NUCA 2E2HH 4LF9Q 4JI2Q 4EX5A 1F9PA 5DLQE 4HJ7A 4OO1G 4O4IF 2BE5D 4DA2A 1I6UA 4K5WA 2JXMB 2RHSB 1QZHA 5CV4A 1JT8A 4P71A 3RD4A 5C44G 1CZGA 3QO2A 3F2CA 2E5LL 1WJJA 2C5CA 5GROA 1HH2P 3HOZG 3MR5A 1IYJB 2RGVA 4LJZC 3J81L 2DY7A 1PFBA 3R2IA 1U0LA 4KY7A 2F3VA 3M3YB 4TUYF 2W8KA 1B8AA 3KHRA 2ATWA 1CE8A 2W70A 3HOWB 5LL6b 3I91A 4YCWA 2UXDH 2B39A 1V8QA 5IGEA 3CU7A 3HOXG 3TIGA 3TZUA 3J81E 4A3IG 2JA8B 2GVAA 2LSSA 4L6TB 4DV3L 2R8JA 5ELEA 2UU9H 5EPJA 1VQAA 3RUPA 4JOIC 2F3IA 4R9WA 4MV9A 1FJGL 4ME5A 1H9MA 3S14B 1A3VA 2K32A 2ASLA 2PO4A 3K5NA 1FR3A 5LMUH 5CV9A 2UUBL 3KTMA 5GAHC 1S0NA 4ZAIA 1KJIA 1ENCA 4L5QA 4J9QA 1ZHSA 2HGSA 1HNXQ 5EWEA 2E2IA 2CW7A 4AQYL 4JI4L 1B53A 1CHQD 1CQFA 4DR5H 1QVCA 1KIXA 4ED0A 2R8GA 1EEID 2DJFC 4IWYA 2V58A 1K83B 2HHHH 1EZ6A 1GD7A 1KJQA 4MV1A 1VQIA 2R7KA 5IYDG 3HKZE 1DIKA 1TY0A 3CCLA 4IZ8A 2WAQA 1C0AA 4UP9A 3DLLA 5IP7H 3GTQB 5DM73 1PH9A 1WCMH 3U50C 4BY1B 2D0OA 4Y52H 2EJMA 4Q8FA 4G7ZC 1B04A 3MFYA 2XCLA 2W6ZA 4LF6H 3MFIA 4GC6A 5JVH3 2JA5H 1P8LA 1PH5A 2WAQE 2JA6B 3GTKB 4PNYA 2XVSA 2K5VA 1BJTA 2I80A 3DWQA 3HKZG 3OTOL 4FDBA 3GIMA 4ABNA 5C0XH 1SCUB 4KKUA 1I7LA 3PO2H 4BBRH 3R3OA 1TIID 3QOLA 3HKSA 4RG1A 5AFWA 4C3JG 4GOPB 3S15H 2W71A 4IZOA 5KFAA 3GIDA 1JR0D 3EN2A 1T36A 1PZJD 2C00A 1KJ8A 1XNRL 2WAQG 5C5LA 1PDQA 1XYIA 3PGZA 2O5JC 5EJWA 1TWCA 2C2EA 1IBLH 4DV1L 4Q0YA 1HRJA 4V0BA 1MJEA 2JQOA 1NSNS 3L2PA 1EHIA 3S1MH 4UPAA 1S5CD 1N33L 4DR2H 1STHA 3QWNA 2PNHA 1BNCA 1JC7A 2A1AA 4PZ7A 1K8AC 4RGMA 1F2YA 1NNXA 2QKIC 5H80A 5KFTA 4O0AA 1Y1VA 3TRZA 3PW4A 3NQTA 3EPIA 1JB7A 1H9SA 5KT6A 1YVCA 1I3QH 2W9BA 1XMOL 3NTHA 4RAUC 3LGJA 3PW7A 1I50H 3MXNA 4DK3C 4C5CA 1E22A 3OWFA 1FL0A 4X64L 5IGCA 1GLVA 3STBD 2N78A 2K01A 3DWPA 1KC8C 4JBMA 1A2TA 4RA8A 4L5TA 5GAGC 1K8OA 1GSHA 1A6XA 3QFFA 1CHPD 2F0UA 4UCOA 3OHBA 2ZM6L 2A19A 3SK8A 1ILQA 1N9WA 1IXRA 2J7ZA 4JI7Q 3BJYA 1FKAH 5C3WA 3GTJB 4F4YA 1R9TA 1HZAA 1Y1VG 4LF4L 4DV0Q 1EWCA 1GUSA 5CV5A 1Y8PB 4DUYQ 5FLMH 1TS2A 3AYHB 2NZHA 4A3GG 2R7MA 1BNZA 3RB3A 4LF7L 2XCPA 1L0YB 1TWGH 1CM9A 2JEJA 4EGJA 5E3FA 3F2BA 5LMNQ 1EEFD 4KD4A 4FF1A 4A3BH 1W96A 1WCMB 1SEIA 2L11A
chains in the Genus database with same CATH topology
1IL2A 2HHHL 1FVIA 1KAWA 1NMGA 4LUZA 5IY0A 4JI7L 5IYBH 1A8VA 3GTJH 1EUJA 1MIUA 2CKZB 4WJ4A 1N36Q 1W3SA 3K80C 4O2DA 5C0XI 3PIPA 1GM5A 4IPDA 1VQJA 2OTLA 4DV0L 4A93H 3M9BA 1VQGA 1CSQA 1B7YB 5FJ8H 4DUYL 1XJVA 1RL2A 4IJHA 4JI8Q 1VQ5A 2HIXA 4JBWA 1Q12A 1YIJA 4DV5L 4UP8A 2EQSA 2NN6G 3F8TA 4K0KQ 4LF6L 4A3DG 3CCMA 1IBLQ 2WB1E 5FLXc 2I0QA 1L0WA 2V1CC 3CAMA 2F4VL 5LMNL 1HNZQ 1UE5A 4DUZQ 4IPHA 2F52A 4MTNA 4A3MH 4JBKA 2NVTH 2FXQA 5C4JH 4J15A 2ZTDA 4OX9Q 3J80i 4BBSH 2D62A 4DR2Q 2I5MX 3K7UC 4LFAQ 4POFA 1QZGA 1BKBA 4P75A 4B3TL 1G6PA 1VQBA 4DV4Q 1TWFH 3I4NG 1XPOA 1K8GA 1SE8A 5BR8Q 3JC66 1V9PA 3M4PA 1S40A 1C7YA 2IX1A 4DR1Q 3PCOB 3NENA 2WB1G 4DV6Q 2R7ZG 2VUMH 1N32L 4JI8L 4A3FH 1I6HH 3HOUG 2B29A 5IP7G 1VQMA 3KJOA 1WCMG 3G48A 1TWAH 4GOPC 4YY3Q 1IBLL 2Z0SA 4RMFA 5E7NA 2A8VA 1CKOA 2MO1A 3JAMc 3NBHB 3GO5A 4IJLA 1NY4A 4LF8Q 4QJFA 3ICEA 3AFPA 2JA9A 1JE5A 1LUZA 4JCVE 4YCUA 2JA5G 4OX9L 4DR2L 1Z9FA 1A0IA 1XNQL 1PV4A 2KHJA 2R92H 1WYDA 3TS2A 3RZDH 4IFDJ 1VQCA 4BBRG 3KOJA 4EQ5A 3RN5A 3PO2G 2UUAL 1A63A 1J6QA 5C3EG 3PUVA 4DR1L 2MFIA 1EFWA 2UXCQ 4QQBX 4DV6L 1UE7A 4R1JA 4DV2Q 3GTOH 1S3OA 1T9HA 3CC4A 4BY7H 1DGSA 2Z6KA 3ER0A 1L2FA 1EIFA 2KBNA 1P16A 3AEVA 5M5WH 4LUOA 2YTVA 2D0PA 4YY3L 1PVOA 1OXXK 5IYCH 3FKIG 4A3LG 2EIFA 4C3HH 1N8RC 2PMZE 3KF6A 2ASBA 1K9MC 4DR4L 1L1OC 2RCNA 2JA6G 2YTYA 1HNWQ 1WI5A 2L15A 4PZ8A 2QEXA 1JMCA 2MQHA 1I5FA 3EIVA 4DNIA 1KRSA 4GKJQ 1GO3E 4AIMA 3GTPH 1YJ9A 1YEZA 2UXBQ 2IX0A 2BH8A 3SGIA 1Y1WH 3PIOA 2DGYA 4AYBE 1GVPA 4A3KG 3KJPA 1VQ7A 4L5RC 2JA7H 4GKKQ 1S72A 4JI3Q 3PO3G 2UXCL 2R93H 4DV2L 5K36G 3MEFA 4HJAA 3GTGH 3CC2A 3PUYA 4R4OA 3JAMi 3FHWA 5C4XH 4NXNQ 3S1NH 3A5ZB 3CD6A 1KRTA 1G51A 1IBMQ 2HIVA 2NVYH 3S16H 1VQPA 3H3VH 4DR5Q 2K4KA 4A3EH 4GN4B 4QIWE 2QGQA 5C44H 4X62Q 5C0XJ 4B3ML 1HNWL 4AYBG 3BZKA 3G6EA 1K0RA 2ID0A 2NVQH 2I5LX 3GTMH 3HOZH 3KDFB 1BVSA 2UXBL 2ALYB 3H0GH 3D0FA 1JJGA 4DR4Q 4JI3L 3A0JA 4PZ6A 1YJNA 1NBWA 4DR7L 4DKAC 1SN8A 2HQLA 5IP9H 1IBKL 2N3SA 1WFQA 5IWAL 4BXXG 1D7QA 1LTLA 3PUZA 4NXNL 3G4SA 4LF6Q 3D31A 3K0XA 4GLAC 3KDFA 4YWMA 4NXML 4X66Q 3CMEA 2VS1A 2Q2UA 1UEBA 2AKWB 2IHEA 4PG3A 3J81c 1N34L 2F4VQ 3HOXH 5IT9c 4TQUS 4A3IH 1Q8KA 2UUCL 1QUQA 3H0GG 4L5SA 1OXTA 4X62L 4B3TQ 2XTIA 3H15A 5FLMG 1AE2A 3RR5A 1KL9A 3ERSX 1PYSB 1E1TA 2IHFA 4X6AH 1G291 2LXKA 2GVBA 4DR3L 4JI2L 1PYBA 2BA0A 3UE0A 5H1SE 2MO0A 3CCVA 1EQQA 1VQ8A 1VQKA 1XPUA 2KCTA 3CPFA 1N32Q 2ZJRA 4DR3Q 1FGUA 4A3BG 2K50A 1CKNA 1W2BA 1YHBA 3ZJYC 4UP7A 4JC0A 4UY8C 3TS0A 4LFBQ 1K3RA 4X66L 2YTXA 4QGUA 4R4CA 5IYBG 4NPSA 1OXSC 3W5OA 1VQOA 4B3RQ 4P73A 1E7ZA 1NE3A 1X55A 1YNXA 4R4IA 4JV5Q 1PH6A 4OWWB 1X65A 4A93G 1OTCA 1U5KA 1I94Q 2VY3A 2LXJA 2YYZA 2CQOA 1NJIC 1XNQQ 3I4OA 5FJ8G 4HIDA 1Z47A 1B70B 3CCQA 3S1RH 1ASZA 3M3YH 4IOAA 1AH9A 2PI2A 3A74A 1VQNA 2UUAQ 2YU9H 4YWKA 3L7ZC 4ALPA 1Q7YC 3HOWH 1YJWA 4JI6Q 4KI0A 4A3JH 1EOVA 3CQZH 4AH6A 2R6GA 3RN2A 2K5NA 2EXDA 5GQOA 2ZJPA 5ELNA 2ZTCA 1LYLA 2WFWA 3HFZB 1EQRA 4BA1I 3J81i 4A3MG 4HIKA 1UE1A 4DV7Q 2ZJQA 2OWOA 3PF5A 4BBSG 2VNUD 2KENA 4LFBL 1YI2A 3E9HA 3S14H 3KYHC 3TREA 4LFCL 5M5YH 4B3RL 3GTLH 4LNQA 1PFSA 2OQ0A 4GN3B 4C3JH 2OTJA 2RHQB 2Z6KC 4DK6C 4JV5L 4C3IH 1VQ9A 4YHHL 3PF4A 2OCEA 3DM3A 3I7FA 2VQEQ 3RLOA 5HGQA 3WWVA 1I94L 1EWIA 2VUMG 1Y14B 1Q86C 4A3FG 3F1ZA 1VQDA 3OW2A 3A5UA 2KHIA 1K83H 3U4VA 4JI6L 4X65Q 3KF6B 3K8AA 3E0EA 1VQ4A 3RLNA 5M3MH 1BBWA 2XGTA 2C35B 3I56A 3L0OA 4HJ9A 3TEHB 4DV7L 3BZCA 3CCRA 4JG2A 3GDEA 1XPRA 2R92G 1AE3A 2Y0SG 1HZ9A 1C9OA 2K75A 3PUWA 4JBJA 4B3MQ 1EYGA 2VQEL 2VQFQ 4JYAQ 4C2MH 3Q8DA 2ZTEA 5M3FH 1EIYB 2K5HA 4BY7G 5GAEC 4JI1Q 3I4MH 1Q1EA 4GLXA 5JJKA 3T1HQ 1KXLA 1CKMA 4QY7A 3HOYH 1VQLA 5IYCG 4DR7Q 4X65L 1XMQQ 1NTGA 1IBKQ 1H95A 2BH2A 5IWAQ 2B63H 1E3PA 1HJPA 2OQKA 3BJUA 1VQEA 4LWCA 4JI0Q 4DR6L 4NXMQ 2Q2TA 2K14A 1CUKA 1O7IA 2JA8H 1ASYA 1N34Q 2E5LQ 1QVGA 2E2JH 5M5XH 1E1OA 1QVFA 2UUCQ 1IZ6A 1OXVA 1X9NA 1TXYA 4A3CH 1VCIA 1Y1WG 3CCJA 2JA7G 2QA4A 1SFOH 2VQFL 4JYAL 1KD1C 1UWVA 1A62A 1YHAA 3HOYG 2R93G 3UDGA 3U58A 4HJ5A 1J5EQ 4JI1L 1D8LA 5C4XG 3RNUA 3T1HL 2E2HH 4PMWA 2JK8A 4HIMA 3FP9A 4JI2Q 4EX5A 1X54A 4LF9Q 1Y1VH 5DLQE 2VZAA 3CF5A 4HJ7A 1XMQL 4OO1G 1QUQB 4XIGS 3J81j 4DV3Q 2RHSB 1QZHA 1PH3A 1HR0W 4JI0L 5JJLA 2CWAA 4A3EG 1JT8A 2Q2IA 3J7ZC 1HR0Q 4GN5A 4P71A 5C44G 4A3GH 1FJGQ 5GADC 3F2CA 2E5LL 1WJJA 5GROA 3PSIA 1HH2P 2GN5A 3PV0A 3UDIA 1YHQA 2UUBQ 1SROA 3HOZG 5JJIA 1IYJB 1XTDA 1V1QA 4B3SQ 3PUXA 4DAMA 4MZ9A 1K73C 4AQYQ 1U0LA 4JI4Q 5ELOA 3OYYA 4QL5A 3M4QA 1B8AA 1CKNB 2ATWA 1NMFA 5IP9G 1J5EL 3CP0A 4LF9L 4WJ3M 4YCWA 4ME3A 4OXPA 4GNXC 3HOXG 4JI5Q 4A3IG 2GVAA 2LSSA 1Q1BA 3KLWA 4DV3L 4A75A 2NZOA 1R9TH 3NEMA 2CCZA 1VQAA 4POGA 4GNXB 4JOIC 1HR0L 4KHPL 1Q46A 1YZ6A 2F3IA 3KFUA 1FJGL 4A3DH 4LFCQ 3S2DH 5IYDH 4LW1A 3W1GA 3VDYA 2UUBL 2R7DA 5GAHC 1PH1A 4L5QA 4YHHQ 2PQAB 4OWXB 4B3SL 1KQSA 1HNXQ 4GNXA 3K81C 4AQYL 1VS0A 2CWPA 4JI4L 3CCEA 4IFDG 3UE1A 1SMXA 1TWHH 3OTOQ 3I2ZA 4JOIA 1QVCA 1KIXA 1PH8A 3T1YL 3I4NH 1PHJA 1GD7A 4P74A 1WOCA 2NVXH 1VQIA 2PQAA 3AFQA 5EAYA 4IO9A 2B3GA 3BU2A 5IYDG 3HKZE 4JI5L 5AJ3L 3CCLA 2R7ZH 4IPGA 1C0AA 4P72A 4UP9A 2E2IH 1X6OA 1SLJA 3DLLA 3HOUH 1HZCA 2KCMA 5IP7H 1PH9A 1WCMH 3U50C 1VQHA 2PI2E 4R4TA 1JJ2A 3G71A 1XNRQ 3M7NA 3S2HH 2D0OA 1CSPA 4Y52H 5JEAG 4KLKA 4XTCS 4HJ8A 4H02A 3HOWG 1N36L 1HZBA 4DV1Q 1HNXL 2IT1A 2JA5H 1P8LA 3RLFA 4A3JG 1PH5A 2WAQE 2Y0SE 4APVA 2K5VA 3M4OH 2H5XA 2JA8G 3HKZG 3OTOL 1X56A 4FDBA 1OXUA 2VW9A 2JEAI 4BBRH 1N33Q 3PO2H 1VQ6A 4K0KL 2MNAA 5C3EH 4OO1I 4MNOA 2R7FA 3HKSA 3H3VI 4RG1A 3CCSA 3TQYA 4GOPB 3S15H 4DR6Q 1HNZL 3M85A 4DUZL 3EN2A 4BY1H 3GTQH 1JJCB 1SR3A 1XNRL 2WAQG 3E9IA 3FKIH 1PA6A 3CMAA 3CPWA 4LFAL 4A3LH 2I5HA 4YCVA 1XMOQ 4DV4L 3ULJA 3PGZA 3KF8B 5C0XG 4GOPA 2N8NA 4DV1L 4KHZA 5BR8L 2JA6H 2JJQA 1X3FA 3GTKH 4X64Q 5M3MG 3S1QH 3IRBA 2JQOA 3L2PA 1MJEA 3S1MH 4UPAA 3S17H 2YV5A 1M90C 4BY1G 1N33L 3NELA 2E8GA 4A3KH 2PNHA 2A1AA 2AMCB 2K52A 4PZ7A 3PO3H 1K8AC 1X3GA 1TWCH 2JEBI 4LF8L 4TVAB 3MXNB 5JEAJ 2ZM6Q 2VL6A 4LUVA 4O0AA 2BA1A 2CFMA 4LF5Q 5M3FG 3TRZA 1MJCA 2UXDQ 1JB7A 3HOVH 2WP8J 1L1OB 1MKHA 2AWNA 3I4MG 1YVCA 1I3QH 1VQFA 2JE6I 3U4ZA 1XMOL 2ES2A 2UU9Q 4BA2I 3GD7A 3LGJA 3UDXA 1I50H 4DK3C 3ULPA 1V43A 4LF4Q 1PH4A 1GKHA 1E22A 4IFDI 4X64L 1FL0A 3CW2C 1SRUA 5J3BA 3B6YA 2B63G 3STBD 2N78A 2HT1A 1L1OA 2N49A 3I55A 5LMUQ 1PH2A 1KC8C 5HY6A 4NB3A 4JBMA 1KHIA 4L5TA 4LF7Q 2NN6I 5GAGC 4OONA 2Q2HA 2AWOA 3HOVG 1Q81C 4IOCA 2AHOB 4A3CG 1RIPA 2A19A 2ZM6L 4BXXH 4KHPQ 1N9WA 4GLVB 4OWTB 4LF5L 2HHHQ 1IXRA 3AQQA 1Q82C 2UXDL 3J7A5 2RF4A 4JI7Q 3EBEA 4Y7NH 1X3EA 3CCUA 1M1KC 4IPCA 2IY5B 3J80c 1PH7A 4GKJL 3W1BA 1HZAA 2UU9L 1Y1VG 1UE6A 4LF4L 3F2DA 4DV0Q 4GKKL 3RZOH 3UDFA 5IE8A 4HIOA 4DUYQ 3T1YQ 5FLMH 3CXCA 3CC7A 3AYHB 5LMUL 2NZHA 3S24A 4DV5Q 3ULLA 4A3GG 4LF7L 1YBYA 1TWGH 1IBML 4A76A 5AJ3Q 3K7AH 4R4QA 5LMNW 1YITA 4GS3A 3F2BA 4DAYB 5LMNQ 4YWLA 1E24A 1LM0A 4A4IA 4DPGA 1BBUA 4DR5L 4A3BH 3STBC 2DUDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IL2 A;  2HHH L;  1FVI A;  1KAW A;  1NMG A;  4LUZ A;  5IY0 A;  4JI7 L;  5IYB H;  1A8V A;  3GTJ H;  1EUJ A;  1MIU A;  2CKZ B;  4WJ4 A;  1N36 Q;  1W3S A;  3K80 C;  4O2D A;  5C0X I;  3PIP A;  1GM5 A;  4IPD A;  1VQJ A;  2OTL A;  4DV0 L;  4A93 H;  3M9B A;  1VQG A;  1CSQ A;  1B7Y B;  5FJ8 H;  4DUY L;  1XJV A;  1RL2 A;  4IJH A;  4JI8 Q;  1VQ5 A;  2HIX A;  4JBW A;  1Q12 A;  1YIJ A;  4DV5 L;  4UP8 A;  2EQS A;  2NN6 G;  3F8T A;  4K0K Q;  4LF6 L;  4A3D G;  3CCM A;  1IBL Q;  2WB1 E;  5FLX c;  2I0Q A;  1L0W A;  2V1C C;  3CAM A;  2F4V L;  5LMN L;  1HNZ Q;  1UE5 A;  4DUZ Q;  4IPH A;  2F52 A;  4MTN A;  4A3M H;  4JBK A;  2NVT H;  2FXQ A;  5C4J H;  4J15 A;  2ZTD A;  4OX9 Q;  3J80 i;  4BBS H;  2D62 A;  4DR2 Q;  2I5M X;  3K7U C;  4LFA Q;  4POF A;  1QZG A;  1BKB A;  4P75 A;  4B3T L;  1G6P A;  1VQB A;  4DV4 Q;  1TWF H;  3I4N G;  1XPO A;  1K8G A;  1SE8 A;  5BR8 Q;  3JC6 6;  1V9P A;  3M4P A;  1S40 A;  1C7Y A;  2IX1 A;  4DR1 Q;  3PCO B;  3NEN A;  2WB1 G;  4DV6 Q;  2R7Z G;  2VUM H;  1N32 L;  4JI8 L;  4A3F H;  1I6H H;  3HOU G;  2B29 A;  5IP7 G;  1VQM A;  3KJO A;  1WCM G;  3G48 A;  1TWA H;  4GOP C;  4YY3 Q;  1IBL L;  2Z0S A;  4RMF A;  5E7N A;  2A8V A;  1CKO A;  2MO1 A;  3JAM c;  3NBH B;  3GO5 A;  4IJL A;  1NY4 A;  4LF8 Q;  4QJF A;  3ICE A;  3AFP A;  2JA9 A;  1JE5 A;  1LUZ A;  4JCV E;  4YCU A;  2JA5 G;  4OX9 L;  4DR2 L;  1Z9F A;  1A0I A;  1XNQ L;  1PV4 A;  2KHJ A;  2R92 H;  1WYD A;  3TS2 A;  3RZD H;  4IFD J;  1VQC A;  4BBR G;  3KOJ A;  4EQ5 A;  3RN5 A;  3PO2 G;  2UUA L;  1A63 A;  1J6Q A;  5C3E G;  3PUV A;  4DR1 L;  2MFI A;  1EFW A;  2UXC Q;  4QQB X;  4DV6 L;  1UE7 A;  4R1J A;  4DV2 Q;  3GTO H;  1S3O A;  1T9H A;  3CC4 A;  4BY7 H;  1DGS A;  2Z6K A;  3ER0 A;  1L2F A;  1EIF A;  2KBN A;  1P16 A;  3AEV A;  5M5W H;  4LUO A;  2YTV A;  2D0P A;  4YY3 L;  1PVO A;  1OXX K;  5IYC H;  3FKI G;  4A3L G;  2EIF A;  4C3H H;  1N8R C;  2PMZ E;  3KF6 A;  2ASB A;  1K9M C;  4DR4 L;  1L1O C;  2RCN A;  2JA6 G;  2YTY A;  1HNW Q;  1WI5 A;  2L15 A;  4PZ8 A;  2QEX A;  1JMC A;  2MQH A;  1I5F A;  3EIV A;  4DNI A;  1KRS A;  4GKJ Q;  1GO3 E;  4AIM A;  3GTP H;  1YJ9 A;  1YEZ A;  2UXB Q;  2IX0 A;  2BH8 A;  3SGI A;  1Y1W H;  3PIO A;  2DGY A;  4AYB E;  1GVP A;  4A3K G;  3KJP A;  1VQ7 A;  4L5R C;  2JA7 H;  4GKK Q;  1S72 A;  4JI3 Q;  3PO3 G;  2UXC L;  2R93 H;  4DV2 L;  5K36 G;  3MEF A;  4HJA A;  3GTG H;  3CC2 A;  3PUY A;  4R4O A;  3JAM i;  3FHW A;  5C4X H;  4NXN Q;  3S1N H;  3A5Z B;  3CD6 A;  1KRT A;  1G51 A;  1IBM Q;  2HIV A;  2NVY H;  3S16 H;  1VQP A;  3H3V H;  4DR5 Q;  2K4K A;  4A3E H;  4GN4 B;  4QIW E;  2QGQ A;  5C44 H;  4X62 Q;  5C0X J;  4B3M L;  1HNW L;  4AYB G;  3BZK A;  3G6E A;  1K0R A;  2ID0 A;  2NVQ H;  2I5L X;  3GTM H;  3HOZ H;  3KDF B;  1BVS A;  2UXB L;  2ALY B;  3H0G H;  3D0F A;  1JJG A;  4DR4 Q;  4JI3 L;  3A0J A;  4PZ6 A;  1YJN A;  1NBW A;  4DR7 L;  4DKA C;  1SN8 A;  2HQL A;  5IP9 H;  1IBK L;  2N3S A;  1WFQ A;  5IWA L;  4BXX G;  1D7Q A;  1LTL A;  3PUZ A;  4NXN L;  3G4S A;  4LF6 Q;  3D31 A;  3K0X A;  4GLA C;  3KDF A;  4YWM A;  4NXM L;  4X66 Q;  3CME A;  2VS1 A;  2Q2U A;  1UEB A;  2AKW B;  2IHE A;  4PG3 A;  3J81 c;  1N34 L;  2F4V Q;  3HOX H;  5IT9 c;  4TQU S;  4A3I H;  1Q8K A;  2UUC L;  1QUQ A;  3H0G G;  4L5S A;  1OXT A;  4X62 L;  4B3T Q;  2XTI A;  3H15 A;  5FLM G;  1AE2 A;  3RR5 A;  1KL9 A;  3ERS X;  1PYS B;  1E1T A;  2IHF A;  4X6A H;  1G29 1;  2LXK A;  2GVB A;  4DR3 L;  4JI2 L;  1PYB A;  2BA0 A;  3UE0 A;  5H1S E;  2MO0 A;  3CCV A;  1EQQ A;  1VQ8 A;  1VQK A;  1XPU A;  2KCT A;  3CPF A;  1N32 Q;  2ZJR A;  4DR3 Q;  1FGU A;  4A3B G;  2K50 A;  1CKN A;  1W2B A;  1YHB A;  3ZJY C;  4UP7 A;  4JC0 A;  4UY8 C;  3TS0 A;  4LFB Q;  1K3R A;  4X66 L;  2YTX A;  4QGU A;  4R4C A;  5IYB G;  4NPS A;  1OXS C;  3W5O A;  1VQO A;  4B3R Q;  4P73 A;  1E7Z A;  1NE3 A;  1X55 A;  1YNX A;  4R4I A;  4JV5 Q;  1PH6 A;  4OWW B;  1X65 A;  4A93 G;  1OTC A;  1U5K A;  1I94 Q;  2VY3 A;  2LXJ A;  2YYZ A;  2CQO A;  1NJI C;  1XNQ Q;  3I4O A;  5FJ8 G;  4HID A;  1Z47 A;  1B70 B;  3CCQ A;  3S1R H;  1ASZ A;  3M3Y H;  4IOA A;  1AH9 A;  2PI2 A;  3A74 A;  1VQN A;  2UUA Q;  2YU9 H;  4YWK A;  3L7Z C;  4ALP A;  1Q7Y C;  3HOW H;  1YJW A;  4JI6 Q;  4KI0 A;  4A3J H;  1EOV A;  3CQZ H;  4AH6 A;  2R6G A;  3RN2 A;  2K5N A;  2EXD A;  5GQO A;  2ZJP A;  5ELN A;  2ZTC A;  1LYL A;  2WFW A;  3HFZ B;  1EQR A;  4BA1 I;  3J81 i;  4A3M G;  4HIK A;  1UE1 A;  4DV7 Q;  2ZJQ A;  2OWO A;  3PF5 A;  4BBS G;  2VNU D;  2KEN A;  4LFB L;  1YI2 A;  3E9H A;  3S14 H;  3KYH C;  3TRE A;  4LFC L;  5M5Y H;  4B3R L;  3GTL H;  4LNQ A;  1PFS A;  2OQ0 A;  4GN3 B;  4C3J H;  2OTJ A;  2RHQ B;  2Z6K C;  4DK6 C;  4JV5 L;  4C3I H;  1VQ9 A;  4YHH L;  3PF4 A;  2OCE A;  3DM3 A;  3I7F A;  2VQE Q;  3RLO A;  5HGQ A;  3WWV A;  1I94 L;  1EWI A;  2VUM G;  1Y14 B;  1Q86 C;  4A3F G;  3F1Z A;  1VQD A;  3OW2 A;  3A5U A;  2KHI A;  1K83 H;  3U4V A;  4JI6 L;  4X65 Q;  3KF6 B;  3K8A A;  3E0E A;  1VQ4 A;  3RLN A;  5M3M H;  1BBW A;  2XGT A;  2C35 B;  3I56 A;  3L0O A;  4HJ9 A;  3TEH B;  4DV7 L;  3BZC A;  3CCR A;  4JG2 A;  3GDE A;  1XPR A;  2R92 G;  1AE3 A;  2Y0S G;  1HZ9 A;  1C9O A;  2K75 A;  3PUW A;  4JBJ A;  4B3M Q;  1EYG A;  2VQE L;  2VQF Q;  4JYA Q;  4C2M H;  3Q8D A;  2ZTE A;  5M3F H;  1EIY B;  2K5H A;  4BY7 G;  5GAE C;  4JI1 Q;  3I4M H;  1Q1E A;  4GLX A;  5JJK A;  3T1H Q;  1KXL A;  1CKM A;  4QY7 A;  3HOY H;  1VQL A;  5IYC G;  4DR7 Q;  4X65 L;  1XMQ Q;  1NTG A;  1IBK Q;  1H95 A;  2BH2 A;  5IWA Q;  2B63 H;  1E3P A;  1HJP A;  2OQK A;  3BJU A;  1VQE A;  4LWC A;  4JI0 Q;  4DR6 L;  4NXM Q;  2Q2T A;  2K14 A;  1CUK A;  1O7I A;  2JA8 H;  1ASY A;  1N34 Q;  2E5L Q;  1QVG A;  2E2J H;  5M5X H;  1E1O A;  1QVF A;  2UUC Q;  1IZ6 A;  1OXV A;  1X9N A;  1TXY A;  4A3C H;  1VCI A;  1Y1W G;  3CCJ A;  2JA7 G;  2QA4 A;  1SFO H;  2VQF L;  4JYA L;  1KD1 C;  1UWV A;  1A62 A;  1YHA A;  3HOY G;  2R93 G;  3UDG A;  3U58 A;  4HJ5 A;  1J5E Q;  4JI1 L;  1D8L A;  5C4X G;  3RNU A;  3T1H L;  2E2H H;  4PMW A;  2JK8 A;  4HIM A;  3FP9 A;  4JI2 Q;  4EX5 A;  1X54 A;  4LF9 Q;  1Y1V H;  5DLQ E;  2VZA A;  3CF5 A;  4HJ7 A;  1XMQ L;  4OO1 G;  1QUQ B;  4XIG S;  3J81 j;  4DV3 Q;  2RHS B;  1QZH A;  1PH3 A;  1HR0 W;  4JI0 L;  5JJL A;  2CWA A;  4A3E G;  1JT8 A;  2Q2I A;  3J7Z C;  1HR0 Q;  4GN5 A;  4P71 A;  5C44 G;  4A3G H;  1FJG Q;  5GAD C;  3F2C A;  2E5L L;  1WJJ A;  5GRO A;  3PSI A;  1HH2 P;  2GN5 A;  3PV0 A;  3UDI A;  1YHQ A;  2UUB Q;  1SRO A;  3HOZ G;  5JJI A;  1IYJ B;  1XTD A;  1V1Q A;  4B3S Q;  3PUX A;  4DAM A;  4MZ9 A;  1K73 C;  4AQY Q;  1U0L A;  4JI4 Q;  5ELO A;  3OYY A;  4QL5 A;  3M4Q A;  1B8A A;  1CKN B;  2ATW A;  1NMF A;  5IP9 G;  1J5E L;  3CP0 A;  4LF9 L;  4WJ3 M;  4YCW A;  4ME3 A;  4OXP A;  4GNX C;  3HOX G;  4JI5 Q;  4A3I G;  2GVA A;  2LSS A;  1Q1B A;  3KLW A;  4DV3 L;  4A75 A;  2NZO A;  1R9T H;  3NEM A;  2CCZ A;  1VQA A;  4POG A;  4GNX B;  4JOI C;  1HR0 L;  4KHP L;  1Q46 A;  1YZ6 A;  2F3I A;  3KFU A;  1FJG L;  4A3D H;  4LFC Q;  3S2D H;  5IYD H;  4LW1 A;  3W1G A;  3VDY A;  2UUB L;  2R7D A;  5GAH C;  1PH1 A;  4L5Q A;  4YHH Q;  2PQA B;  4OWX B;  4B3S L;  1KQS A;  1HNX Q;  4GNX A;  3K81 C;  4AQY L;  1VS0 A;  2CWP A;  4JI4 L;  3CCE A;  4IFD G;  3UE1 A;  1SMX A;  1TWH H;  3OTO Q;  3I2Z A;  4JOI A;  1QVC A;  1KIX A;  1PH8 A;  3T1Y L;  3I4N H;  1PHJ A;  1GD7 A;  4P74 A;  1WOC A;  2NVX H;  1VQI A;  2PQA A;  3AFQ A;  5EAY A;  4IO9 A;  2B3G A;  3BU2 A;  5IYD G;  3HKZ E;  4JI5 L;  5AJ3 L;  3CCL A;  2R7Z H;  4IPG A;  1C0A A;  4P72 A;  4UP9 A;  2E2I H;  1X6O A;  1SLJ A;  3DLL A;  3HOU H;  1HZC A;  2KCM A;  5IP7 H;  1PH9 A;  1WCM H;  3U50 C;  1VQH A;  2PI2 E;  4R4T A;  1JJ2 A;  3G71 A;  1XNR Q;  3M7N A;  3S2H H;  2D0O A;  1CSP A;  4Y52 H;  5JEA G;  4KLK A;  4XTC S;  4HJ8 A;  4H02 A;  3HOW G;  1N36 L;  1HZB A;  4DV1 Q;  1HNX L;  2IT1 A;  2JA5 H;  1P8L A;  3RLF A;  4A3J G;  1PH5 A;  2WAQ E;  2Y0S E;  4APV A;  2K5V A;  3M4O H;  2H5X A;  2JA8 G;  3HKZ G;  3OTO L;  1X56 A;  4FDB A;  1OXU A;  2VW9 A;  2JEA I;  4BBR H;  1N33 Q;  3PO2 H;  1VQ6 A;  4K0K L;  2MNA A;  5C3E H;  4OO1 I;  4MNO A;  2R7F A;  3HKS A;  3H3V I;  4RG1 A;  3CCS A;  3TQY A;  4GOP B;  3S15 H;  4DR6 Q;  1HNZ L;  3M85 A;  4DUZ L;  3EN2 A;  4BY1 H;  3GTQ H;  1JJC B;  1SR3 A;  1XNR L;  2WAQ G;  3E9I A;  3FKI H;  1PA6 A;  3CMA A;  3CPW A;  4LFA L;  4A3L H;  2I5H A;  4YCV A;  1XMO Q;  4DV4 L;  3ULJ A;  3PGZ A;  3KF8 B;  5C0X G;  4GOP A;  2N8N A;  4DV1 L;  4KHZ A;  5BR8 L;  2JA6 H;  2JJQ A;  1X3F A;  3GTK H;  4X64 Q;  5M3M G;  3S1Q H;  3IRB A;  2JQO A;  3L2P A;  1MJE A;  3S1M H;  4UPA A;  3S17 H;  2YV5 A;  1M90 C;  4BY1 G;  1N33 L;  3NEL A;  2E8G A;  4A3K H;  2PNH A;  2A1A A;  2AMC B;  2K52 A;  4PZ7 A;  3PO3 H;  1K8A C;  1X3G A;  1TWC H;  2JEB I;  4LF8 L;  4TVA B;  3MXN B;  5JEA J;  2ZM6 Q;  2VL6 A;  4LUV A;  4O0A A;  2BA1 A;  2CFM A;  4LF5 Q;  5M3F G;  3TRZ A;  1MJC A;  2UXD Q;  1JB7 A;  3HOV H;  2WP8 J;  1L1O B;  1MKH A;  2AWN A;  3I4M G;  1YVC A;  1I3Q H;  1VQF A;  2JE6 I;  3U4Z A;  1XMO L;  2ES2 A;  2UU9 Q;  4BA2 I;  3GD7 A;  3LGJ A;  3UDX A;  1I50 H;  4DK3 C;  3ULP A;  1V43 A;  4LF4 Q;  1PH4 A;  1GKH A;  1E22 A;  4IFD I;  4X64 L;  1FL0 A;  3CW2 C;  1SRU A;  5J3B A;  3B6Y A;  2B63 G;  3STB D;  2N78 A;  2HT1 A;  1L1O A;  2N49 A;  3I55 A;  5LMU Q;  1PH2 A;  1KC8 C;  5HY6 A;  4NB3 A;  4JBM A;  1KHI A;  4L5T A;  4LF7 Q;  2NN6 I;  5GAG C;  4OON A;  2Q2H A;  2AWO A;  3HOV G;  1Q81 C;  4IOC A;  2AHO B;  4A3C G;  1RIP A;  2A19 A;  2ZM6 L;  4BXX H;  4KHP Q;  1N9W A;  4GLV B;  4OWT B;  4LF5 L;  2HHH Q;  1IXR A;  3AQQ A;  1Q82 C;  2UXD L;  3J7A 5;  2RF4 A;  4JI7 Q;  3EBE A;  4Y7N H;  1X3E A;  3CCU A;  1M1K C;  4IPC A;  2IY5 B;  3J80 c;  1PH7 A;  4GKJ L;  3W1B A;  1HZA A;  2UU9 L;  1Y1V G;  1UE6 A;  4LF4 L;  3F2D A;  4DV0 Q;  4GKK L;  3RZO H;  3UDF A;  5IE8 A;  4HIO A;  4DUY Q;  3T1Y Q;  5FLM H;  3CXC A;  3CC7 A;  3AYH B;  5LMU L;  2NZH A;  3S24 A;  4DV5 Q;  3ULL A;  4A3G G;  4LF7 L;  1YBY A;  1TWG H;  1IBM L;  4A76 A;  5AJ3 Q;  3K7A H;  4R4Q A;  5LMN W;  1YIT A;  4GS3 A;  3F2B A;  4DAY B;  5LMN Q;  4YWL A;  1E24 A;  1LM0 A;  4A4I A;  4DPG A;  1BBU A;  4DR5 L;  4A3B H;  3STB C;  2DUD A; 
#chains in the Genus database with same CATH topology
 4DR7 H;  4KTA A;  1NMG A;  4LUZ A;  5EGT A;  2XIG A;  5IY0 A;  1RJQ A;  4XZ3 B;  4DL6 A;  4NXN H;  4NXM H;  3A7A B;  2JA5 B;  4IPD A;  4I55 F;  1VQJ A;  4F4X A;  1N34 H;  5BMV F;  4H13 C;  1RL2 A;  2F4I A;  1I6H B;  2N88 A;  3PO2 B;  4BBR B;  4DV5 L;  4UP8 A;  5DG8 A;  2J6S A;  3N43 B;  2EY1 A;  1E0B A;  2WB1 E;  5FLX c;  2LKV A;  1L0W A;  3H20 A;  2YZG A;  2F4V L;  3S15 B;  2VUM A;  3QIA A;  4NP5 A;  5C4J H;  4J15 A;  3C0F B;  3K7U C;  4POF A;  5EWF A;  3G6Y A;  4B3T L;  1AFP A;  1G6P A;  1VQB A;  3A56 A;  1TT2 A;  3I4N G;  5KFN A;  2BDN A;  3VR5 A;  2C22 A;  4X66 H;  3JC6 6;  1V9P A;  1C7Y A;  1HQR D;  1B3Q A;  1I4G A;  4OGQ C;  4DR1 Q;  1Y69 U;  2WB1 G;  4DV6 Q;  3PIO 3;  1O7L A;  3FKI A;  2FMC A;  3JRW A;  3S1M B;  1MSG A;  4UDU C;  3HOU G;  2PZU A;  3G48 A;  2I07 B;  4GOP C;  4N9P A;  1HHV A;  2Z0S A;  2MO1 A;  1ZEQ X;  3NBH B;  4YR2 A;  4DL3 A;  3MXG A;  2B2W A;  4IUR A;  2A69 C;  3ICE A;  3AFP A;  4JCV E;  5FO7 B;  2H4O A;  3Q23 A;  3FPU B;  4O4H F;  2ZXP A;  2HDM A;  1PV4 A;  4EGV A;  1I3Q B;  1WYD A;  4PMB A;  2R92 H;  3V2T A;  2DNE A;  4ED7 A;  4HNV A;  2R8H A;  4DL4 A;  4EQ5 A;  4EEY A;  3RN5 A;  1N56 A;  5LL6 S;  1J6Q A;  5FPO A;  5C3E G;  3PUV A;  4RB0 A;  2MFI A;  2UXC Q;  2R93 B;  2FK2 A;  3GTO H;  1UE7 A;  1S3O A;  2D5D A;  3CC4 A;  1DGS A;  2Z1C A;  5JOB A;  1EUD B;  1EIF A;  2X0S A;  5C4X B;  2QIL A;  2D0P A;  4YY3 L;  1B1Z A;  3GTP A;  3EQL C;  3FKI G;  4Q5V A;  2JA7 A;  2EIF A;  1N8R C;  4IRD A;  5KYI A;  3KF6 A;  1V4Y A;  2RCN A;  3RF2 A;  2RVL A;  4EBD A;  3GTG A;  4G7O C;  4MV7 A;  1M4V A;  5KG4 A;  5KYL A;  3RAQ A;  3BYT B;  4UCS A;  2NVQ B;  1YJ9 A;  3HOZ B;  5JUM A;  1UAP A;  3CVZ A;  2IX0 A;  3V4S A;  3RJ0 A;  2XCA A;  2DGY A;  4AYB E;  1GVP A;  3RV3 A;  1D2B A;  3PO3 G;  5K36 G;  4TV8 F;  3Q8S B;  3BVG A;  3G7L A;  3JAM i;  4R4O A;  1UC8 A;  2VQE H;  5BPH A;  4PMC A;  5KFV A;  3A5Z B;  4FXD A;  1TWG B;  3LWE A;  2MGS A;  4J0M A;  2NVY H;  5KFB A;  4RUC A;  1KEE A;  3HOX B;  1JWU D;  2TSS A;  1ILP A;  1W93 A;  1QB5 D;  4A3B B;  2FLL A;  4DU9 A;  1ICF B;  4RZQ A;  2RSO A;  5L37 A;  1CZW A;  3SDZ A;  1UC9 A;  3SE7 A;  4X62 Q;  1HNW L;  2L1B A;  4AYB G;  2ZDG A;  3D6W A;  2QF7 A;  5DG9 A;  4DR6 H;  2I5L X;  3KHG A;  1SAP A;  2ALY B;  3H0G H;  3D0F A;  2WE6 A;  3A0J A;  5FPR A;  4DL7 A;  1S9F A;  1SN8 A;  5IP9 H;  1E2W A;  4BXX G;  1LTL A;  1U4L A;  3CME A;  2AKW B;  5BN4 A;  3J81 c;  2F4V Q;  2EJG C;  4KK7 A;  1ONL A;  2KCN A;  3NWT A;  2UUC L;  4F87 A;  4R8U A;  2SCU B;  3M7G A;  1AUV A;  5IGF A;  3MR2 A;  3KLS A;  4B3T Q;  2L9H A;  3TME A;  3RR5 A;  1KL9 A;  1O7Z A;  5JVG 3;  5A2Q W;  1PYS B;  2IHF A;  4FM9 A;  4X6A H;  1G29 1;  3QJY A;  1AN8 A;  3SHL A;  2BA0 A;  1MZB A;  1S0O A;  2MO0 A;  3LX0 A;  1VQ8 A;  1XX8 A;  5J2T F;  1FGU A;  3HKZ B;  3NXW A;  2K50 A;  1YHB A;  3A8K E;  4UY8 C;  4X3T A;  4QGU A;  2Z8L A;  1MSH A;  1IYU A;  5C3X A;  1ET9 A;  3W5O A;  2Z6B A;  4B3R Q;  1NE3 A;  1X55 A;  3UFX B;  1YNX A;  4R4I A;  2R86 A;  5JJZ A;  1S5B D;  4K6L A;  1EYA A;  4OWW B;  4FBU A;  4A93 G;  1OTC A;  1I94 Q;  2CQO A;  1NJI C;  2R92 B;  1ASZ A;  5T14 A;  3DEP A;  3D3R A;  4O1N A;  3OSP A;  2GPS A;  1HR0 H;  4KHP H;  1JWM D;  1YNN C;  1VQN A;  1T94 A;  2YU9 H;  1Q7Y C;  2CW0 C;  5A2Q L;  1YJW A;  4LMY A;  3GTO B;  3CQZ H;  4K8J A;  1NUC A;  3RN2 A;  2B2T C;  5D65 A;  5GQO A;  4DR3 L;  5ELN A;  4BA1 I;  4A3M G;  4B3S H;  3OUZ A;  2Y0S A;  5KFJ A;  5M9O A;  2OWO A;  3S9W A;  2F0M A;  4LFB L;  4QB4 A;  1N48 A;  2O03 A;  1PYW D;  2XN9 C;  3KYH C;  3TRE A;  5M5Y H;  2VPQ A;  5KFG A;  5A2Q E;  3GTL H;  5CBE E;  2OQ0 A;  4GN3 B;  1LAC A;  4JV5 L;  3PF4 A;  1LTT D;  4EYH B;  3OHA A;  3RLO A;  3IFT A;  4DN4 M;  4O2B F;  2W9C B;  3F1Z A;  1VQD A;  1PK8 A;  2RDI A;  4C56 C;  3LWB A;  4JI6 L;  3D6C A;  2KUM A;  3E0E A;  3K8A A;  3A8J E;  4YJ3 F;  1GXD C;  1U4R A;  2BOS A;  5DEH A;  5M3M H;  2C35 B;  3I56 A;  1K28 A;  5ELF A;  4C3I G;  3H3V C;  2C2R A;  2NVY B;  2EOT A;  1G2T A;  1Y1W A;  2KHS A;  2E2J B;  4QWE A;  5IOC A;  1AE3 A;  2Y0S G;  2O4X A;  2J6U A;  4M9U A;  2JN4 A;  3VA7 A;  4M1U B;  2EYP A;  2K75 A;  1EYG A;  3H4B A;  4C2M H;  4XYL B;  4ETS A;  3RBE A;  1HNZ H;  1UUP A;  2F0F A;  5JJK A;  4GLX A;  2F0Q A;  3GIP A;  3T1H Q;  1IYV A;  3TDQ A;  5C8Y F;  1CKM A;  2R87 A;  5DLG A;  1F9Q A;  1JQY D;  4X65 L;  1CQV A;  1Z2P X;  1NTG A;  1LAB A;  2YZN A;  5KFU A;  4DV4 H;  3VYT A;  1CS0 A;  1BBX C;  1E3P A;  1HJP A;  1SNO A;  4LWC A;  5BR8 H;  2JSO A;  4ODG A;  2PBZ A;  2CVR A;  1GHJ A;  2E2H A;  1PZI D;  1ASY A;  4CDC C;  2UUC Q;  4O3R A;  5KFI A;  1JWS D;  1TXY A;  4TSS A;  4A3C H;  1FD7 D;  1VCI A;  1Y1W G;  4JYA L;  3L4J A;  3WOE A;  4CGY B;  3J7Y W;  1SFO H;  1KD1 C;  1A62 A;  4IRC A;  4G3I A;  3UDG A;  4HJ5 A;  1J5E Q;  4JI1 L;  5CR3 A;  2B8F A;  4PMW A;  2JK8 A;  4RB3 C;  4RAY A;  4MV3 A;  4HED A;  5D3I B;  1SNQ A;  4CDE C;  4CDF C;  5LHY 1;  1XMQ L;  1PH3 A;  3GV3 A;  4MV8 A;  2KCC A;  4JI0 L;  2ENB A;  5C4Z A;  1EFI D;  1IOW A;  3QZ8 A;  5GAD C;  2BCO A;  4J6H A;  1S5F D;  4YAJ B;  5LOV F;  3UDI A;  5KG5 A;  2JEG A;  1V1Q A;  2K5D A;  1O78 A;  4ECZ A;  3TSS A;  5G3L D;  4PQX A;  1TWH B;  4KJN A;  5D1P A;  4DAP A;  2YU9 B;  3I4N B;  4LF9 L;  1GYF A;  4LF5 H;  2F0V A;  3ORQ A;  1VBG A;  2WYO A;  1GHK A;  4ED1 A;  1Q1B A;  2F0H A;  4A75 A;  4POG A;  4KKS A;  3P7J A;  4GKJ H;  3K3P A;  5KFQ A;  3KBX A;  3LP8 A;  4ZOL F;  1TQO A;  1Q46 A;  2F03 A;  4TRD A;  3S2D H;  1KTK A;  4LW1 A;  4DNR B;  1SSO A;  3W1G A;  3KHL A;  2G9D A;  2EJF C;  1PH1 A;  5CMD A;  1IBM H;  1SE3 A;  4GNX A;  3CCE A;  3GIQ A;  3RFC A;  3T56 B;  1WCM A;  2IMW P;  1S03 G;  4R8I A;  2RSN A;  3I2Z A;  1H9K A;  3T1Y L;  2EVB A;  1WVL A;  4P74 A;  1SJE D;  1EY5 A;  3R93 A;  3N41 B;  5EAY A;  2PQA A;  1EZ1 A;  1I4R A;  4CKC A;  5C3E B;  4IO9 A;  2B3G A;  5M3M B;  3FPP A;  4QW9 A;  4OEM B;  5LYJ F;  2R7Z H;  2FPP B;  4IPG A;  2PVP A;  4OL7 A;  3NP8 A;  4CC6 A;  1HZC A;  2KCM A;  1CQJ B;  3QZ7 A;  4P2C B;  2ALZ A;  2PI2 E;  1JJ2 A;  3LML A;  5CBA E;  2FPG B;  3IN5 A;  1AUX A;  4B08 A;  4XTC S;  1HNX L;  4C2M B;  5CV8 A;  1K1Q A;  1C3O A;  3M4O H;  5KG1 A;  3VPD A;  1DYQ A;  3C46 A;  1X56 A;  5F9N A;  1EYD A;  1OXU A;  2XSC A;  1AP0 A;  2JEA I;  1STB A;  4OO1 I;  1SBB B;  3SVM A;  3H3V I;  4F7X A;  3TP5 A;  2B2V C;  3TQY A;  3PVX A;  4DUZ L;  1TKW B;  3F8N A;  3GTQ H;  1STE A;  4BY1 H;  1JJC B;  1ZXT A;  1VDZ A;  1SR3 A;  2X69 A;  3HOV B;  4LFA L;  4A3L H;  4JI8 H;  4DR3 H;  4U67 3;  1OWT A;  3ULJ A;  5KFY A;  5BN3 A;  5C0X G;  1SFO B;  2N8N A;  1SE4 A;  4YBZ B;  3DMU A;  1CTM A;  2JA6 H;  2JJQ A;  4F88 A;  3GTK H;  1JOO A;  3GQC A;  1F9S A;  4F4W A;  1TS3 A;  4O42 A;  4RKB A;  1RTO A;  4OX9 H;  1WD1 A;  2YV5 A;  1M90 C;  1I3Q A;  5ELC A;  3KF8 A;  2E8G A;  4A3K H;  1XNQ H;  2FJ2 A;  1I50 A;  2K52 A;  4ULL A;  1S5D D;  3CHB D;  4LF8 L;  4TVA B;  5KFX A;  4ILW A;  2UUA H;  2FFK B;  3NHH A;  2BA1 A;  5BN5 A;  5M3F G;  1C4Q A;  2UXD Q;  1MKH A;  4CHT B;  1K1S A;  1HFG A;  1LTS D;  2JE6 I;  3OHX C;  3J7A F;  3MJF A;  3BQ0 A;  2C9O A;  1LT3 D;  5EKL A;  2UU9 Q;  2W6P A;  3VYU A;  1PH4 A;  4FF2 A;  4MTK A;  1HUN A;  2R82 A;  4C5A A;  2A68 C;  3Q8P B;  2B63 G;  2H1E A;  2HT1 A;  1L1O A;  2N49 A;  5LMU Q;  2DPJ A;  5HY6 A;  1KC7 A;  2NN6 I;  2Q2H A;  2AWO A;  3F2U A;  5KG6 A;  2EY2 A;  4U6P A;  1QJO A;  4WFN 3;  1SND A;  3BAA A;  4OWT B;  1BXT A;  2HHH Q;  4DV2 H;  3S2D B;  1Q82 C;  1GUT A;  4ZKC B;  3EBE A;  2F0I A;  2FMM A;  1M1K C;  3SI8 A;  1B33 N;  3J80 c;  4K6D A;  3BDC A;  1UE6 A;  2L55 A;  4G7H C;  3TBI B;  4GKK L;  3RZO H;  4A93 B;  3MZ5 A;  3UDF A;  2GPW A;  5CV6 A;  5IE8 A;  4YJ2 F;  4HIO A;  1ZET A;  3T1Y Q;  5JVL A;  3CXC A;  3CC7 A;  5I47 A;  4J9R A;  1R4P B;  1T3N A;  2JP1 A;  3BVM A;  5C4H A;  1YBY A;  2I8C A;  1D6E C;  1YIT A;  3K7A H;  4R4Q A;  5LMN W;  4GS3 A;  2IL8 A;  2R7Z B;  4DAY B;  2UXB H;  1IW7 C;  1LM0 A;  1IKL A;  4L63 B;  4DPG A;  4HNU A;  1ZKO A;  4YR3 A;  2EYL A;  2AU0 A;  2DUD A;  3X3N A;  2NU6 B;  4JI3 H;  4IUN A;  1IL2 A;  1FVI A;  3K0Y A;  3MHB A;  4LAA A;  3WNZ A;  2NVX A;  5FD6 A;  1KNA A;  4JI7 L;  1IBK H;  1A8V A;  3GIK A;  5IWA H;  5JPM C;  1MIU A;  3GTJ H;  4WJ4 A;  1X3P A;  2AQ1 B;  4DK1 A;  4DV0 L;  3AB9 A;  3M4O B;  2RKS A;  1B7Y B;  3I4L A;  2B2Y A;  2HDL A;  1LT6 D;  1W6K A;  3MFG A;  5FJ8 H;  4DUY L;  2L0C A;  1XJV A;  1VQ5 A;  2HIX A;  4JBW A;  2YCH A;  2CW8 A;  2NN6 G;  3F8T A;  2A6H C;  4A3D G;  3DXJ C;  2PZT A;  1IBL Q;  1WD0 A;  2I0Q A;  5KKN B;  2V1C C;  3CAM A;  1Q90 A;  5LMN L;  4DUZ Q;  5KIX A;  4JBK A;  3J7A 5;  3VR4 A;  4JI2 H;  3JAM W;  4DR4 H;  4ZUI A;  4BBS H;  2R85 A;  4DR2 Q;  3KLS X;  3FMC A;  4LFA Q;  1BKB A;  3WOF A;  4B9W A;  1QZG A;  3RZD B;  4H0L C;  1KDB A;  3SK5 A;  1SE8 A;  3R5F A;  3M4P A;  2IX1 A;  3J7A K;  1QNU A;  5ELB A;  2X6G A;  1N32 L;  4A3F H;  1I6H H;  1JOQ A;  1VQM A;  2EYH A;  2NUC A;  2F0O A;  1TWA H;  1G8Z D;  1VMP A;  4A3K B;  1EIG A;  4HQ6 A;  1EOT A;  2UVW A;  3VPB A;  1TS5 A;  3BS1 A;  1NY4 A;  4TKO B;  4LF8 Q;  2PMZ B;  3K58 A;  1JE5 A;  4YCU A;  4J8Q A;  3JAM L;  2J9G A;  3UI2 A;  1BCP B;  5D3D A;  3TS2 A;  2KHJ A;  2KOL A;  1QOH A;  3L4K A;  1PXU A;  1VQC A;  2K6A A;  3KOJ A;  2FP4 B;  1A63 A;  4KY6 A;  4N8X 1;  4DR1 L;  4QQB X;  4DV6 L;  4R1J A;  4I50 F;  4DL2 A;  2J0T D;  1Q3L A;  1T9H A;  1A9X A;  1RJT A;  4E6I A;  3JAM E;  1M7J A;  3ER0 A;  2TMP A;  3RTX A;  1TS4 A;  4Y8V B;  1STA A;  3OW7 A;  4RGO S;  3S1N B;  3BQ2 A;  1PVO A;  5E1F A;  4RHR A;  4K8I A;  5DQH A;  5KFO A;  2ASB A;  1K9M C;  2FLN A;  1E4E B;  2IPK D;  4Q44 A;  3IAY A;  2QDL A;  1LV9 A;  1WI5 A;  4PZ8 A;  1JMC A;  1I5F A;  2R84 A;  2W57 A;  1KRS A;  1EY9 A;  1GO3 E;  4AIM A;  2NU7 B;  4DV7 H;  1B9M A;  3SGI A;  2NU8 B;  3PIO A;  4GKK Q;  2VUG A;  2RDF A;  3RZO B;  3KJP A;  1JIC A;  2R93 H;  2UXC L;  4QIW A;  1PMR A;  3MEF A;  3A55 A;  3NPP A;  5C4X H;  4NXN Q;  3CD6 A;  4O4L F;  5DLF A;  2OF1 A;  2VOB A;  3K7A B;  3H0G A;  5F2D A;  3ORR A;  2HD3 A;  2Q8R E;  4QWA A;  4OO1 H;  5FD5 A;  3MWM A;  1VQP A;  3H3V H;  2YW2 A;  2K4K A;  4GN4 B;  2QDB A;  4QIW E;  2QGQ A;  4I7A A;  5C44 H;  4B3M L;  3BZK A;  4KN7 C;  3E3X A;  4JV2 A;  3P20 A;  2ID0 A;  2NVQ H;  3V6H A;  3GTM H;  3HOZ H;  5HBR B;  2NYZ D;  3LNN A;  1WTX A;  1JJG A;  2ZXR A;  2MJ8 A;  2K5Q A;  3V6K A;  3SXH A;  4LH7 A;  4DKA C;  2HQL A;  1D7Q A;  1VF5 C;  5K2M A;  3PUZ A;  3G4S A;  2VQF H;  1EY7 A;  4GLA C;  3KDF A;  1SYE A;  4X66 Q;  1Q8I A;  1TAE A;  2IHE A;  5EKK A;  4PG3 A;  3HOX H;  4TQU S;  2ZDH A;  4A3I H;  2ZJT A;  2LS0 1;  4CKE A;  5LL6 X;  5C1O A;  4QUC A;  3H0G G;  4BBS B;  4O2A F;  3R5H A;  4X62 L;  4BS9 A;  1PZK D;  2XTI A;  1D1I A;  4XYM B;  2Q8T A;  1R4Q B;  1D5M C;  5DQI A;  5EWG A;  1EYC A;  5L9X A;  4XDX A;  1E1T A;  3A54 A;  2W6Q A;  2E5L H;  1NR2 A;  2W6O A;  4KY5 A;  1EQQ A;  1AW7 A;  4RB2 C;  4EQN A;  5EBD A;  2VPS A;  1N32 Q;  5DQG A;  5FK9 C;  1WTQ A;  4A3F B;  4NMZ A;  4O3P A;  4RUA A;  2V4Q A;  1TWA B;  4JW0 A;  2P0A A;  4R4C A;  5IYB G;  5CV7 A;  1RD9 D;  1VQO A;  2V4R A;  3CQZ A;  4Q0F A;  1K8M A;  3K57 A;  1PH6 A;  2YS6 A;  4J1M A;  4R7R A;  3Q6S A;  2VY3 A;  3RGZ A;  4DV3 H;  3GQB A;  4HID A;  1Z47 A;  3S1R H;  4X3S A;  2IP4 A;  4IOA A;  2ATL A;  1YNJ D;  1DCZ A;  3A74 A;  4K2K A;  5CC4 A;  1EUC B;  2KSW A;  5JH7 F;  3GIJ A;  3GTL A;  4ALP A;  3GLK A;  1FJG H;  1JOR A;  4KI0 A;  4A2A A;  1WR2 A;  3PW0 A;  2UUB H;  2HJW A;  2EDG A;  2M00 A;  2R6G A;  4IWX A;  2K5N A;  2EXD A;  2ZJP A;  5EBC A;  2WFW A;  3J81 i;  1EQR A;  2R3Z A;  4AQY H;  4JI4 H;  4G4K A;  3E9H A;  1F2M A;  1M6V A;  4Z9C B;  4EBE A;  4FO2 A;  4LFC L;  4B3R L;  4JPB W;  4J9M A;  3OSO A;  4C3J H;  2OTJ A;  1BCP C;  2Z6K C;  2OT2 A;  1RKN A;  3BG3 A;  1VQ9 A;  4YHH L;  5F9L A;  3DM3 A;  2VQE Q;  1RYS A;  1S0M A;  3WWV A;  1I94 L;  4ECU A;  2VB2 X;  5DAU A;  3EA6 A;  2VUM G;  2F0J A;  3RMH A;  1PRT B;  5FO8 B;  3A5U A;  4FF3 A;  2KHI A;  4RKL A;  3BVZ A;  4JUZ A;  3ITP A;  3HOY B;  1VQ4 A;  4APM A;  1XWE A;  2A6E C;  2F0K A;  1BBW A;  2R61 A;  3P75 A;  3C2P A;  5KGU A;  2JEF A;  3L0O A;  4ZHQ F;  2PZW A;  3ERO A;  5EPK A;  3TEH B;  4HJ9 A;  2R6F A;  5DG7 A;  3BZC A;  2BQ3 A;  4HR7 B;  3CCR A;  3I12 A;  3MR3 A;  4JG2 A;  1SNP A;  3X3M A;  3OTO H;  5L1K A;  1HZ9 A;  3PUW A;  4JBJ A;  5C6A A;  4B3M Q;  3V96 A;  5C44 B;  1B2T A;  2CQA A;  1D5Z C;  1WTO A;  4BY7 G;  3VA5 A;  4EGQ A;  3GTM B;  3O13 A;  5KFS A;  1Q1E A;  3BQ1 A;  3OIP A;  3D4D A;  4YP3 A;  3NTI A;  4K2L A;  1S4Z A;  1XNR H;  3URY A;  5IYC G;  4FXG C;  4C3H G;  3WO1 A;  1H95 A;  2GLT A;  2SDF A;  4RU9 A;  1ZQ7 A;  4DV1 H;  5D1O B;  1SNM A;  2K33 A;  2Q2T A;  2K14 A;  1DOM A;  4EVO A;  2E2J H;  1MGS A;  5EPL A;  1J9O A;  2LMC B;  4A3I B;  1OXV A;  4PDB A;  1SEB D;  4IHJ F;  1ULZ A;  1N33 H;  2JA7 G;  2QA4 A;  1UWV A;  4CKB A;  3KAJ A;  1V1P A;  4MHE A;  1DOL A;  5HUR A;  3H40 A;  3MXU A;  5KFC A;  1IW7 D;  3VR6 A;  2W9A A;  2IW3 A;  4XT3 B;  3T1H L;  4NKL A;  1Y1V H;  3J7A V;  5IOD A;  3CF5 A;  3VMM A;  4WJW A;  2E74 C;  5KT2 A;  4XIG S;  2X6L A;  4K5X A;  1XMO H;  5HGT A;  1SMY C;  1STG A;  4A3E G;  2E75 C;  3J7Z C;  1HR0 Q;  2WV6 D;  1T5E A;  2PQE A;  4GN5 A;  2F0S A;  5D14 A;  5C5M A;  4A3G H;  4MTE A;  4X64 H;  4XQN A;  1G2S A;  4O3O A;  1PTO C;  3PSI A;  3HBL A;  2GN5 A;  3PV0 A;  2F0T A;  1YHQ A;  1SRO A;  4B3S Q;  4DAM A;  4DK0 A;  1TY2 A;  5JPN C;  3OYY A;  4KMU C;  4QL5 A;  3M4Q A;  3S1R B;  1CKN B;  1VMC A;  1J5E L;  2ZM6 H;  4KJO A;  3SK4 A;  3CP0 A;  1VAJ A;  3MA2 B;  2V5A A;  2JEI A;  1KAB A;  4ME3 A;  4WBN F;  4GNX C;  4JI5 Q;  1WH2 A;  2CCZ A;  1R9T H;  2NZO A;  3NEM A;  2E2I B;  4LF4 H;  4ZLT F;  3KFU A;  1U4P A;  3C1F A;  4XXE A;  4LFC Q;  3S2H B;  4ZI7 F;  3HG9 A;  4C3J B;  4RCN A;  3VDY A;  4UCV A;  4CC5 A;  1UNN C;  4YHH Q;  4LF7 H;  2R7Z A;  3K81 C;  2R8K A;  4DXG A;  2G5D A;  2WAQ B;  4IFD G;  2ZT9 C;  1TWH H;  3CRK C;  3I4N H;  1PH8 A;  2FIN B;  3LWU A;  3ETJ A;  3AFQ A;  2F0N A;  1JIH A;  1BOS A;  2Q8I B;  5IGG A;  4MV4 A;  1X6O A;  3HOU H;  1VF7 A;  2V59 A;  1C8C A;  2OLS A;  4R4T A;  1K83 A;  3M7N A;  4C5B A;  1CSP A;  1S68 A;  5JEA G;  1NCV A;  4KLK A;  1KLU D;  4DV5 H;  5KFM A;  1LT4 D;  2WIN B;  3VR3 A;  1EQV A;  1N36 L;  2EYJ A;  3HOW G;  1PRT C;  3RLF A;  4A3J G;  4TV9 F;  4M7E A;  3GTQ A;  2Y0S E;  5DGA A;  2F4V H;  4APV A;  3TQT A;  2H5X A;  5KEE A;  2JA8 G;  3EPG A;  3DM1 A;  4LSX A;  5I9O A;  4OEL B;  1VQ6 A;  4K0K L;  2MNA A;  1JDB B;  4ECS A;  5C3E H;  4B3T H;  2R7N A;  1BCP F;  4I65 A;  2R7F A;  1BGW A;  2JA6 A;  3CCS A;  3GTK A;  1TWC B;  5BPF A;  1SE2 A;  3RUZ A;  2HUG A;  4RNO A;  2MP1 A;  1G6Z A;  2IBK A;  1VKZ A;  3E9I A;  3FKI H;  3IG0 A;  3CPW A;  2BQU A;  2I5H A;  4YCV A;  1HA5 A;  2NUA B;  1B4O A;  4GOP A;  1CFM A;  4KHZ A;  5TSS A;  3RBD A;  1LTR D;  2WTF A;  2HVS A;  2OXP A;  3IRB A;  1EYZ A;  3OPO A;  1GUW A;  1Y1V B;  4BY1 G;  1HA6 A;  1C48 A;  3NEL A;  1H9S B;  1Z2N X;  2AMC B;  3PO3 H;  2SNM A;  2L12 A;  1WTW A;  5K36 H;  2VA3 A;  2JEB I;  2HVQ A;  3BA8 A;  3MXN B;  5JEA J;  4A3G B;  4LF5 Q;  2BR0 A;  4RZR A;  1MD2 D;  3HOV H;  2AWN A;  3R2T A;  3I4M G;  2M9V A;  3T5L A;  2MHV A;  4YY3 H;  4BA2 I;  3UDX A;  5LP6 F;  1V43 A;  4DL5 A;  1GKH A;  1JXL A;  3CW2 C;  1FNW A;  1SRU A;  4CBV A;  1JKJ B;  3B6Y A;  4H7B A;  4PWQ A;  5HV6 A;  4J9P A;  3I55 A;  1PH2 A;  3M9O B;  1PFM A;  2K04 A;  2LY7 A;  4OON A;  2DPI A;  3HRZ C;  2KJX A;  4BWS C;  4IOC A;  1R9T B;  4I4T F;  2AHO B;  3GIL A;  3ERQ A;  2SOB A;  4BXX H;  3SK6 A;  1AN7 A;  4FP5 D;  3D8G A;  3AQQ A;  2SNS A;  2UXD L;  3MC0 B;  2RF4 A;  4ZQI A;  3AU7 A;  3H09 A;  2ZDQ A;  1X3E A;  3CCU A;  1SDF A;  2RCF A;  4IPC A;  3GP7 A;  2UU9 L;  4L1K A;  4ED2 A;  3V4Z A;  1B9N A;  4UCR A;  3NUC A;  2AGO A;  2IWH A;  2AUK A;  2JYO A;  5LMU L;  3GTJ A;  3BYY B;  3H94 A;  4HNT A;  1HNW H;  1RHP A;  1D5X C;  2E76 C;  4A76 A;  4JV1 A;  2WB1 B;  1GUG A;  2FE3 A;  2F0D A;  4YWL A;  1E24 A;  2PW7 A;  2RDG A;  4A4I A;  3H4D A;  3HOU B;  1BBU A;  5FLX W;  4DR5 L;  4UCT A;  3STB C;  1S10 A;  1X32 A;  2ICI A;  2F0E A;  2HHH L;  3I8Z A;  4KKT A;  1SYD A;  1TU2 B;  1EUJ A;  2CKZ B;  2FK3 A;  1N36 Q;  4IUU A;  3K80 C;  3PIP A;  4O2D A;  3A8I E;  5C0X I;  1GM5 A;  2OTL A;  1JDE A;  4A93 H;  4N9T A;  1VQG A;  1CSQ A;  1HFN A;  2UUC H;  3H91 A;  2A69 D;  3NE5 B;  2VUM B;  2M05 A;  4IJH A;  3IFD A;  4JI8 Q;  1D1K A;  2R7L A;  1YIJ A;  4IUT A;  4ZCK A;  4K0K Q;  4LF6 L;  3CCM A;  2JA5 A;  4K14 A;  3GV8 B;  3Q8R B;  4IPH A;  4A3M H;  2FXQ A;  4OX9 Q;  1KAA A;  5FLX L;  1ZHQ A;  2W7P A;  3J80 i;  2I5M X;  3FKI B;  4HTH A;  1TWA A;  4P75 A;  2Z4H A;  4ECW A;  2NTS A;  1DJR D;  1TWF H;  2YZM A;  1XPO A;  5KFP A;  2ICE C;  4RHS A;  3R8B A;  2C28 A;  4GC7 A;  5E4W C;  1A3T A;  1M8A A;  4RNN A;  5FLX E;  3BZD B;  3TQ1 A;  2O2L D;  5IP7 G;  3KJO A;  1WCM G;  2CH4 W;  3SE0 A;  1IBL L;  5E7N A;  2A8V A;  1CKO A;  4RH6 A;  3PO3 B;  3Q1K A;  1PRT F;  2JA9 A;  4U68 A;  3BDL A;  3IKJ A;  5KND A;  2JA5 G;  5CA1 F;  2UVR A;  1O75 A;  2HCI A;  4DR2 L;  1A15 A;  1Z9F A;  2WDT A;  2B2T A;  1UNS A;  4FBT A;  3RZD H;  3NBH A;  3BG5 A;  2EXZ A;  3QG1 A;  2XNA C;  3OWE B;  4BBR G;  3PO2 G;  4LFB H;  3Q24 A;  2JA7 B;  4AYB B;  1QG7 A;  5KFE A;  4DV2 Q;  2CZG A;  4JV5 H;  3GTG B;  5CGK A;  2KBN A;  3AEV A;  1ML0 D;  5M5W H;  5KT7 A;  2YTV A;  2CH4 A;  3D4R A;  2DIK A;  2YYA A;  1OXX K;  4J9N A;  4F8M A;  1ZYR C;  1Z6H A;  1DON A;  3T51 B;  2R93 A;  1BR9 A;  3N40 P;  3DF7 A;  1W6J A;  1SYF A;  2F0G A;  3WDN A;  3EYY A;  1JE4 A;  1IHZ A;  2DY8 A;  4RB1 A;  3RAX A;  2VA2 A;  4JI6 H;  2YTY A;  2P5Z X;  1F2L A;  1B6R A;  2PCF B;  1K0S A;  2MQH A;  4EQP A;  3EIV A;  3E6Z X;  1BDO A;  1YEZ A;  2UXB Q;  2BH8 A;  2UVU A;  4JI0 H;  1Y1W H;  1Z7T A;  3ZYY X;  1VQ7 A;  4L5R C;  1S72 A;  4JI3 Q;  4EEQ A;  4I7Z C;  5DNF A;  4TQS A;  4EQO A;  3V6J A;  5KT3 A;  3PUY A;  4CJ1 B;  3FHW A;  1C30 A;  3S1N H;  1IKM A;  5T1G A;  3K5M A;  2W6N A;  3KAL A;  5KG0 A;  3RB4 A;  1Y8N B;  2HIV A;  3N42 B;  1SXT A;  1NR4 A;  2EZV A;  3HS0 C;  4FXK C;  4DR5 Q;  4RGN A;  4WRD A;  4V19 0;  4ECT A;  5FKA C;  4DNT B;  2FHT A;  1QCB D;  1JLL B;  3J81 W;  1CI3 M;  4X65 H;  1SYC A;  3MR6 A;  5C0X J;  1KLG D;  5D1O A;  1TWG A;  5KFK A;  4RGT A;  3BAB A;  1DV2 A;  5KG7 A;  3OSN A;  2IA6 A;  5KFF A;  1KBL A;  1BVS A;  1CK1 A;  1GJX A;  2NZ1 D;  5LA6 F;  4DR4 Q;  2EY6 A;  1EWH A;  3CKI B;  4DR7 L;  1NBW A;  4FNF A;  4R8U B;  4JYA H;  4KD3 A;  2KEE A;  3U9O A;  2RQX A;  4NXN L;  4LF6 Q;  4K5V A;  4NXM L;  2Q2U A;  4U7C A;  1UEB A;  1N34 L;  4QWC A;  4JI1 H;  1T5X D;  1YNN D;  1Q8K A;  4A3M B;  1M0W A;  2CW0 D;  4L5S A;  2WKD A;  2QEJ C;  1OXT A;  1XMQ H;  3RV4 A;  4IUQ A;  1MBY A;  3H15 A;  1TWF B;  5FLM G;  1AE2 A;  1KJ9 A;  3M4Y A;  1RJR A;  1DD2 A;  4EFB A;  2XC9 A;  2F0W A;  2LXK A;  2GVB A;  5H1S E;  1RF2 D;  3I70 A;  5KFD A;  4A3J B;  4L8J A;  1VQK A;  4JV0 A;  2KCT A;  2DN8 A;  3CPF A;  3PR5 B;  4EFE A;  2NVT B;  3NQI A;  3EFX D;  4A3B G;  1CKN A;  3K5H A;  1PRT D;  4UP7 A;  4DGZ A;  4JC0 A;  2YRW A;  1RYR A;  2Z9H A;  1JOK A;  4X66 L;  1FNU A;  1GUN A;  3ND9 A;  1OXS C;  4XYQ A;  1E7Z A;  1MHW C;  3MEH A;  1H9R A;  3K5L A;  1TA8 A;  4QWB A;  4LF9 H;  4MIU A;  4NW2 A;  3KLR A;  4C3I B;  3NWS A;  1X65 A;  3HKZ A;  1PTO H;  3N6X A;  1I4H A;  2F0P A;  3EVQ A;  2YYZ A;  2LXJ A;  1RJP A;  5EQ0 A;  1LTA D;  1AH9 A;  2Y0S B;  3CRL C;  3ONA B;  2B2W C;  4CDD C;  4YIJ A;  3L7Z C;  2IX3 A;  1B50 A;  1KDC A;  1AZP A;  1QNK A;  4OIK A;  4XQQ A;  2I87 A;  2R92 A;  1LYL A;  2ZTC A;  3HFZ B;  5M5W B;  2ZJQ A;  2BH2 A;  4LSA A;  4HIK A;  4DV7 Q;  2VNU D;  3MWE A;  3Q8Q B;  1YI2 A;  4LK1 C;  4ECQ A;  4R8N A;  3KAK A;  3T1Y H;  4LNQ A;  1PFS A;  4I7H A;  3GTO A;  3KXY T;  2RHQ B;  5C1P A;  2O5I C;  1HTP A;  3Q22 A;  1STY A;  1Y14 B;  5ELD A;  3I4M B;  3FMA A;  4QF4 A;  1Y1W B;  1SYX B;  3U4V A;  5KG2 A;  1V1O A;  5J22 A;  4ECY A;  3RLN A;  2DLN A;  2XGT A;  2W7O A;  5IYZ F;  1PFN A;  2W9C A;  1HNX H;  5D8D A;  4O3S A;  1I7N A;  1DM0 B;  3Q0A A;  5IGB A;  5M5X B;  1XPR A;  2R92 G;  4ECV A;  5I2Y A;  3GV5 B;  3MWD A;  2B2U A;  2FJZ A;  5EDW A;  1XDN A;  2VQE L;  2VQF Q;  2E2D C;  2WAC A;  4UCU A;  3PR4 A;  3Q8D A;  4TQR A;  5M3F H;  2NVY A;  1EIY B;  2K5H A;  2B2V A;  1ENA A;  4DUZ H;  2E2H B;  1GOZ A;  5L1I A;  4FF4 A;  1LLR D;  5KT4 A;  3HOY H;  5COY A;  1VQL A;  4DR7 Q;  1B6S A;  1I4X A;  4LFA H;  1E4F T;  2B63 H;  4GZY C;  2OQK A;  3BJU A;  4G57 A;  4ED8 A;  4DR6 L;  4NXM Q;  3FEW X;  2K7V A;  3TII A;  1CUK A;  1O7I A;  4YAK B;  1N34 Q;  2VB3 X;  2E5L Q;  5EZY F;  1E1O A;  1BXR A;  1SYB A;  3K5O A;  5IT9 W;  4FVM A;  3CCJ A;  4MAM A;  1YHA A;  2D2C C;  1EU4 A;  2AQ4 A;  2A5H A;  3U58 A;  4LF8 H;  1L2Z A;  3DWA A;  1D8L A;  3RNU A;  4HIM A;  3FP9 A;  4DF7 A;  1X54 A;  2VQD A;  4ED6 A;  3JRX A;  2VZA A;  5EOY A;  3UQ8 A;  1QUQ B;  2AQ3 B;  3J81 j;  4IAL A;  4DV3 Q;  3M4I A;  5JJL A;  4IUV A;  1HR0 W;  2CWA A;  1RTN A;  2Q2I A;  1AEX A;  2MPM A;  1FJG Q;  2L4N A;  1O80 A;  2UUB Q;  5JJI A;  5CB4 F;  1XTD A;  4J9O A;  1PTO B;  3PUX A;  3GII A;  4MZ9 A;  1K73 C;  1B44 D;  5IT9 L;  4AQY Q;  4JI4 Q;  3BA9 A;  5ELO A;  1CQI B;  1K3B C;  1NMF A;  5IP9 G;  1EL0 A;  1IL8 A;  1DOK A;  4ZKB B;  1JB3 A;  2YRX A;  4WJ3 M;  4MA5 A;  4M8A A;  1XXG A;  2KEC A;  2KED A;  4OXP A;  2EY5 A;  3KLW A;  5IT9 E;  4GNX B;  1TWH A;  1HR0 L;  4KHP L;  1ROD A;  5KFR A;  1YZ6 A;  2FMA A;  2YU9 A;  4GKK H;  2NN6 H;  1KDA A;  4A3D H;  3VR2 A;  3OOC A;  5IYD H;  2CQY A;  3L3O C;  3GV7 B;  1WTH A;  2R7D A;  4MTD A;  2PN1 A;  2WB1 A;  2W8L A;  2PQA B;  4OWX B;  4B3S L;  1KQS A;  4KV6 A;  4QCL A;  3HGB A;  1VS0 A;  2CWP A;  4UAI A;  5CA0 F;  3E5N A;  3UE1 A;  4EG0 A;  1SMX A;  4X3K A;  3I90 A;  3T53 B;  4JOI A;  3OTO Q;  2IJ0 A;  1EIH A;  1PHJ A;  3G6J B;  2VXW A;  1QE6 A;  1WOC A;  2NVX H;  2XGQ A;  4JI7 H;  2QYZ A;  3BU2 A;  4JI5 L;  5AJ3 L;  3T5H A;  2HCC A;  4P72 A;  3T13 A;  2E2I H;  1SLJ A;  4N8F A;  2MUY A;  4WD3 A;  4DV0 H;  4ZK9 B;  1VQH A;  1S5E D;  3NTK A;  3G71 A;  1XNR Q;  3S2H H;  3NGD A;  4DUY H;  3Q2O A;  2F1M A;  4HJ8 A;  4H02 A;  4RFB A;  5COR A;  1HZB A;  4DV1 Q;  2IT1 A;  1PLF A;  1ZYR D;  3KUP A;  5M3F B;  3HZX A;  3FVQ A;  2XGP A;  2CHB D;  5LMN H;  2BQR A;  4NLG A;  2VW9 A;  1N33 Q;  4ED3 A;  3PQI A;  4ECR A;  4C2M A;  1VBH A;  4MNO A;  5KG3 A;  2EYO A;  1B3A A;  2B63 B;  4DLK A;  3C1E A;  4HMI A;  4E4T A;  1UEA B;  4DR6 Q;  3RB6 A;  3EJI A;  2RGR A;  4HCE A;  1HNZ L;  3M85 A;  2K05 A;  1II3 A;  2A68 D;  1WTR A;  5CAE B;  2RDJ A;  1N32 H;  1L0X B;  1PA6 A;  3CMA A;  2V9W A;  3T5K A;  1XMO Q;  4DV4 L;  4J9L A;  3KF8 B;  5A35 A;  3PW5 A;  1ENF A;  1I50 B;  5BR8 L;  4IUP A;  3K5I A;  1MI2 A;  1X3F A;  4X64 Q;  1A3U A;  5M3M G;  3S1Q H;  4KHV A;  4MV6 A;  1U4M A;  3S17 H;  2FK1 A;  5I6W A;  4FU0 A;  1EY0 A;  1SNC A;  1SFO A;  4MA0 A;  1HTL D;  1X3G A;  1TWC H;  4AYB A;  2ZM6 Q;  2RDH A;  1GUO A;  1BF4 A;  2UVV A;  2VL6 A;  4LUV A;  4OHJ A;  4DR1 H;  4FS1 A;  2CFM A;  4DV6 H;  3TZD A;  2F3W A;  5KX5 F;  1MJC A;  4YR0 A;  2WP8 J;  2XWJ B;  1L1O B;  2NU9 B;  4HCS A;  3U4Z A;  1VQF A;  1J8I A;  3N8D A;  4WOR A;  4J9S A;  2ES2 A;  3GD7 A;  3ULP A;  4LF4 Q;  2N55 A;  3NBI A;  2HQE A;  4IFD I;  4FYD A;  3J80 W;  2EPB A;  5J3B A;  3HEJ A;  3MFH A;  1EY6 A;  2DWC A;  5CYU A;  4NB3 A;  1I4P A;  5JVD F;  1KHI A;  4LF7 Q;  5KFL A;  1Y8O B;  4Q43 A;  2BDO A;  3ND8 A;  3HOV G;  2Z4I A;  5JAV A;  1Q81 C;  4PV1 C;  4A3C G;  4ECX A;  1RIP A;  3MAQ A;  4KHP Q;  5LXT F;  1ET6 A;  4YQW A;  2UXC H;  1FYC A;  4GLV B;  4A3D B;  4LF5 L;  2FLP A;  1RK5 A;  4Y7N H;  2MCT A;  2YS7 A;  4HYK A;  2IY5 B;  1PH7 A;  1WTP A;  1EY8 A;  2A6H D;  3TP6 A;  3W1B A;  4GKJ L;  2SEB D;  3K3V A;  3OUU A;  4IR1 A;  3F2D A;  3PMF A;  1XTC D;  2FPI B;  1CT1 D;  3J80 L;  3AMU A;  4J9K A;  1BO0 A;  5KFH A;  2J6T A;  4HAE A;  4HMJ A;  4DV5 Q;  3S24 A;  4CJ0 B;  2L5T A;  2RBM A;  3ULL A;  2NVX B;  4B3M H;  1ESR A;  1IBM L;  5AJ3 Q;  3RGX A;  5T1I A;  2QCP X;  4RCO A;  1DV1 A;  2QK4 A;  5C4J B;  1Z2O X;  3J80 E;  2KVM A;  5GON F;  1KAW A;  3QR8 A;  5IYB H;  1LTB D;  3OMG A;  2BE5 C;  1V51 A;  1W3S A;  4DAY A;  2R8I A;  4ZYS A;  4F4Z A;  1BQQ T;  3M9B A;  3G6X A;  2PPB C;  1EZ8 A;  4OIJ A;  1Q12 A;  3KK7 A;  1TWF A;  1FNV A;  4X62 H;  2EQS A;  3RIZ A;  4IAJ A;  3GV6 A;  2DZD A;  3TIN A;  4XYO A;  3DEO A;  1HNZ Q;  1ICW A;  1UE5 A;  2F52 A;  4MTN A;  3MWY W;  5I4D A;  3HB9 A;  1RCV D;  2ZTD A;  5J1Z A;  2D62 A;  2EE1 A;  3W2D A;  4DV4 Q;  3WO0 A;  4ZUJ A;  5ISR A;  2ZXO A;  1K8G A;  1I4Q A;  5BR8 Q;  5KNC A;  3K59 A;  1WTV A;  1S40 A;  4RAZ A;  3U9T A;  5G3L F;  4XQJ A;  3I3C A;  3PCO B;  3S1Q B;  3NEN A;  2R7Z G;  2VUM H;  1QIL A;  4JI8 L;  3S17 B;  1E4G T;  2B29 A;  2XRQ D;  4IN3 A;  3FDT A;  3W3A A;  3TP7 A;  4YY3 Q;  2FB9 A;  5I6Y A;  3N44 B;  3G8C A;  4RMF A;  3PZP A;  2V4D A;  3TP8 A;  3JAM c;  3GO5 A;  1EY4 A;  3OIQ A;  2A74 C;  4IJL A;  1HQM C;  2M2L A;  4QJF A;  1RK6 A;  1LUZ A;  4OX9 L;  3MTS A;  4JVZ A;  1A0I A;  4JI5 H;  2PNR C;  1XNQ L;  2J4X A;  4ZQ3 A;  1EQT A;  4IFD J;  3VPC A;  1TR5 A;  2NWG A;  4H44 C;  2NTT A;  1SJH D;  2PMZ A;  2UUA L;  2PYK A;  1OO9 B;  2K28 A;  1EFW A;  2AGP A;  4LFC H;  3MVV A;  4B3R H;  1I6V C;  4BY7 H;  4HSP A;  2Z6K A;  4YHH H;  1L2F A;  1P16 A;  3IL8 A;  3PW2 A;  4LUO A;  1I94 H;  1DZ1 A;  3N6R A;  3T5J A;  1LTI D;  5IIF A;  1LTG D;  2W9B B;  5IYC H;  4A3L G;  4C3H H;  4C1N I;  2PMZ E;  3PN1 A;  2ASJ A;  1L1O C;  2JA6 G;  3N52 A;  4QIW B;  5I9P A;  3ETH A;  1HNW Q;  2EYF A;  4O3N A;  1CA5 A;  2AGQ A;  1LO5 D;  2L15 A;  4Y7N B;  2WKC A;  2QEX A;  4DNI A;  3KHH A;  4GKJ Q;  1KJJ A;  3GTP H;  4MN3 A;  3H0G B;  3R23 A;  2JA7 H;  4A3K G;  1E4E A;  3K6O A;  4DV2 L;  5DGB A;  4HJA A;  4DAV A;  3GTG H;  3CC2 A;  4HSV A;  4QWD A;  1NAP A;  1JCK B;  1SYG A;  4IQZ A;  3FDS A;  1KRT A;  1G51 A;  4CJ2 C;  5FOB B;  1IBM Q;  1KNE A;  4UHV A;  4Q45 A;  1JX4 A;  2B8G A;  3S16 H;  3QOJ A;  2NB0 A;  2XWB B;  4A3E H;  3DHQ A;  3R5X A;  4XT1 B;  2DNC A;  5C5J A;  3G6E A;  1K0R A;  3HP3 A;  1LT5 D;  3KDF B;  2UXB L;  2DJG C;  1IOV A;  3U9S A;  4JI3 L;  4X3U A;  4PZ6 A;  1YJN A;  4KN4 C;  3I72 A;  3KBG A;  2F0L A;  2WII B;  1S97 A;  1IBK L;  1U9R A;  2N3S A;  1WFQ A;  5IWA L;  2XIW A;  1DXM A;  1PTO F;  3T16 A;  3D31 A;  3K0X A;  5DM6 3;  4YWM A;  2VS1 A;  3M9N B;  4F50 A;  4DXF A;  5IT9 c;  2FKL A;  2B2Y C;  2K1B A;  3T1H H;  1FGB D;  1GSA A;  3C3L A;  1QUQ A;  5E4X A;  2A73 B;  3E5S A;  1CA6 A;  3BDO A;  5KFZ A;  5K5P A;  4YB8 B;  3TN2 A;  2VR1 A;  3ERS X;  3HXL A;  1STN A;  4NDX A;  3D4W A;  4HN7 A;  4JI2 L;  3L9A X;  1PYB A;  4DR4 L;  3UE0 A;  3CCV A;  1XPU A;  3CQZ B;  4IFD H;  3H6M A;  2ZJR A;  1BCP D;  4DR3 Q;  4LH6 A;  1W2B A;  3ZJY C;  3TS0 A;  4LFB Q;  1K3R A;  1E2Z A;  2YTX A;  4UFZ A;  5J39 A;  4O3Q A;  1J5E H;  3V05 A;  1O7Y A;  2PW5 A;  4NPS A;  5M5Y B;  2AUJ D;  4P73 A;  3GTL B;  4EYI B;  1RDP D;  4JV5 Q;  5KRU A;  1M0T A;  1HCZ A;  1U5K A;  2A6E D;  1XNQ Q;  2K03 A;  3I4O A;  3QB3 A;  5FJ8 G;  3M3Y H;  1B70 B;  1A2U A;  3CCQ A;  5JEA H;  3FRP B;  2PI2 A;  3SR1 A;  1WSC A;  2UUA Q;  4YWK A;  3NSW A;  3JSN A;  3HOW H;  2XD4 A;  4JI6 Q;  2KQ3 A;  4A3J H;  2OH2 A;  1EOV A;  2YL2 A;  3OMC A;  4AH6 A;  4BY7 B;  3MXP A;  2JA8 H;  2NVT H;  2D9U A;  1HPC A;  4B9X A;  3I73 A;  2NBF A;  1UE1 A;  4C1N K;  4BBS G;  3PF5 A;  4IRK A;  2KEN A;  3S14 H;  4C3H B;  2EYM A;  5J2U F;  4S3S A;  1F2Z A;  5L1J A;  4DK6 C;  2KA7 A;  1EU3 A;  4C3I H;  5KFW A;  2OCE A;  3I7F A;  1X3Q A;  5KNB A;  5HGQ A;  2K5W A;  1EWI A;  3SEB A;  1PX2 A;  1HXY D;  1Q86 C;  4A3F G;  4EBC A;  4BWG B;  3OW2 A;  3GTP B;  3JZI A;  3RB0 A;  2G9H D;  3P1H A;  5IGD A;  1K83 H;  2OEO A;  4LMQ D;  2W6M A;  1E2V A;  2B2U C;  3T4A C;  3KF6 B;  4X65 Q;  3G6V A;  2GA4 B;  5L1L A;  2RA4 A;  4QUF A;  1N36 H;  4A2B A;  4RWS C;  1YNJ C;  5JQW A;  1TVX A;  4DV7 L;  1GSO A;  3DUZ A;  3S16 B;  3GDE A;  2I46 A;  4IR9 A;  5KT5 A;  4XX0 B;  4ID6 A;  4A3E B;  1ESF A;  1C9O A;  4JYA Q;  1QWY A;  4K0K H;  2B63 A;  4FS2 A;  4JK1 C;  2ZTE A;  3A7L A;  5I2X A;  4HR7 A;  2AQ2 B;  3JSL A;  1SMY D;  4DFA A;  4QW8 A;  5GAE C;  1GGO A;  4JI1 Q;  3I4M H;  2HVR A;  1KXL A;  3M9M B;  4QY7 A;  2LFN A;  1F77 A;  4RNM A;  1PTO D;  4ZRZ A;  1XMQ Q;  1IBK Q;  3VYR A;  5IWA Q;  4JI0 Q;  1VQE A;  4ME6 A;  3GTM A;  1V1P B;  1HUM A;  5FO9 B;  1F9R A;  2XRS D;  1BUV T;  1QVG A;  1AZQ A;  5M5X H;  1QVF A;  1IZ6 A;  1X9N A;  3VYS A;  2ASD A;  1H9J A;  3NK9 A;  2VQF L;  2R93 G;  4Q8E A;  3HOY G;  2QW7 A;  1G91 A;  5EKI A;  2C2D A;  3PIP 3;  4QMG A;  3E0J A;  5C4X G;  5NUC A;  2E2H H;  4LF9 Q;  4JI2 Q;  4EX5 A;  1F9P A;  5DLQ E;  4HJ7 A;  4OO1 G;  4O4I F;  2BE5 D;  4DA2 A;  1I6U A;  4K5W A;  2JXM B;  2RHS B;  1QZH A;  5CV4 A;  1JT8 A;  4P71 A;  3RD4 A;  5C44 G;  1CZG A;  3QO2 A;  3F2C A;  2E5L L;  1WJJ A;  2C5C A;  5GRO A;  1HH2 P;  3HOZ G;  3MR5 A;  1IYJ B;  2RGV A;  4LJZ C;  3J81 L;  2DY7 A;  1PFB A;  3R2I A;  1U0L A;  4KY7 A;  2F3V A;  3M3Y B;  4TUY F;  2W8K A;  1B8A A;  3KHR A;  2ATW A;  1CE8 A;  2W70 A;  3HOW B;  5LL6 b;  3I91 A;  4YCW A;  2UXD H;  2B39 A;  1V8Q A;  5IGE A;  3CU7 A;  3HOX G;  3TIG A;  3TZU A;  3J81 E;  4A3I G;  2JA8 B;  2GVA A;  2LSS A;  4L6T B;  4DV3 L;  2R8J A;  5ELE A;  2UU9 H;  5EPJ A;  1VQA A;  3RUP A;  4JOI C;  2F3I A;  4R9W A;  4MV9 A;  1FJG L;  4ME5 A;  1H9M A;  3S14 B;  1A3V A;  2K32 A;  2ASL A;  2PO4 A;  3K5N A;  1FR3 A;  5LMU H;  5CV9 A;  2UUB L;  3KTM A;  5GAH C;  1S0N A;  4ZAI A;  1KJI A;  1ENC A;  4L5Q A;  4J9Q A;  1ZHS A;  2HGS A;  1HNX Q;  5EWE A;  2E2I A;  2CW7 A;  4AQY L;  4JI4 L;  1B53 A;  1CHQ D;  1CQF A;  4DR5 H;  1QVC A;  1KIX A;  4ED0 A;  2R8G A;  1EEI D;  2DJF C;  4IWY A;  2V58 A;  1K83 B;  2HHH H;  1EZ6 A;  1GD7 A;  1KJQ A;  4MV1 A;  1VQI A;  2R7K A;  5IYD G;  3HKZ E;  1DIK A;  1TY0 A;  3CCL A;  4IZ8 A;  2WAQ A;  1C0A A;  4UP9 A;  3DLL A;  5IP7 H;  3GTQ B;  5DM7 3;  1PH9 A;  1WCM H;  3U50 C;  4BY1 B;  2D0O A;  4Y52 H;  2EJM A;  4Q8F A;  4G7Z C;  1B04 A;  3MFY A;  2XCL A;  2W6Z A;  4LF6 H;  3MFI A;  4GC6 A;  5JVH 3;  2JA5 H;  1P8L A;  1PH5 A;  2WAQ E;  2JA6 B;  3GTK B;  4PNY A;  2XVS A;  2K5V A;  1BJT A;  2I80 A;  3DWQ A;  3HKZ G;  3OTO L;  4FDB A;  3GIM A;  4ABN A;  5C0X H;  1SCU B;  4KKU A;  1I7L A;  3PO2 H;  4BBR H;  3R3O A;  1TII D;  3QOL A;  3HKS A;  4RG1 A;  5AFW A;  4C3J G;  4GOP B;  3S15 H;  2W71 A;  4IZO A;  5KFA A;  3GID A;  1JR0 D;  3EN2 A;  1T36 A;  1PZJ D;  2C00 A;  1KJ8 A;  1XNR L;  2WAQ G;  5C5L A;  1PDQ A;  1XYI A;  3PGZ A;  2O5J C;  5EJW A;  1TWC A;  2C2E A;  1IBL H;  4DV1 L;  4Q0Y A;  1HRJ A;  4V0B A;  1MJE A;  2JQO A;  1NSN S;  3L2P A;  1EHI A;  3S1M H;  4UPA A;  1S5C D;  1N33 L;  4DR2 H;  1STH A;  3QWN A;  2PNH A;  1BNC A;  1JC7 A;  2A1A A;  4PZ7 A;  1K8A C;  4RGM A;  1F2Y A;  1NNX A;  2QKI C;  5H80 A;  5KFT A;  4O0A A;  1Y1V A;  3TRZ A;  3PW4 A;  3NQT A;  3EPI A;  1JB7 A;  1H9S A;  5KT6 A;  1YVC A;  1I3Q H;  2W9B A;  1XMO L;  3NTH A;  4RAU C;  3LGJ A;  3PW7 A;  1I50 H;  3MXN A;  4DK3 C;  4C5C A;  1E22 A;  3OWF A;  1FL0 A;  4X64 L;  5IGC A;  1GLV A;  3STB D;  2N78 A;  2K01 A;  3DWP A;  1KC8 C;  4JBM A;  1A2T A;  4RA8 A;  4L5T A;  5GAG C;  1K8O A;  1GSH A;  1A6X A;  3QFF A;  1CHP D;  2F0U A;  4UCO A;  3OHB A;  2ZM6 L;  2A19 A;  3SK8 A;  1ILQ A;  1N9W A;  1IXR A;  2J7Z A;  4JI7 Q;  3BJY A;  1FKA H;  5C3W A;  3GTJ B;  4F4Y A;  1R9T A;  1HZA A;  1Y1V G;  4LF4 L;  4DV0 Q;  1EWC A;  1GUS A;  5CV5 A;  1Y8P B;  4DUY Q;  5FLM H;  1TS2 A;  3AYH B;  2NZH A;  4A3G G;  2R7M A;  1BNZ A;  3RB3 A;  4LF7 L;  2XCP A;  1L0Y B;  1TWG H;  1CM9 A;  2JEJ A;  4EGJ A;  5E3F A;  3F2B A;  5LMN Q;  1EEF D;  4KD4 A;  4FF1 A;  4A3B H;  1W96 A;  1WCM B;  1SEI A;  2L11 A; 
#chains in the Genus database with same CATH homology
 1IL2 A;  2HHH L;  1FVI A;  1KAW A;  1NMG A;  4LUZ A;  5IY0 A;  4JI7 L;  5IYB H;  1A8V A;  3GTJ H;  1EUJ A;  1MIU A;  2CKZ B;  4WJ4 A;  1N36 Q;  1W3S A;  3K80 C;  4O2D A;  5C0X I;  3PIP A;  1GM5 A;  4IPD A;  1VQJ A;  2OTL A;  4DV0 L;  4A93 H;  3M9B A;  1VQG A;  1CSQ A;  1B7Y B;  5FJ8 H;  4DUY L;  1XJV A;  1RL2 A;  4IJH A;  4JI8 Q;  1VQ5 A;  2HIX A;  4JBW A;  1Q12 A;  1YIJ A;  4DV5 L;  4UP8 A;  2EQS A;  2NN6 G;  3F8T A;  4K0K Q;  4LF6 L;  4A3D G;  3CCM A;  1IBL Q;  2WB1 E;  5FLX c;  2I0Q A;  1L0W A;  2V1C C;  3CAM A;  2F4V L;  5LMN L;  1HNZ Q;  1UE5 A;  4DUZ Q;  4IPH A;  2F52 A;  4MTN A;  4A3M H;  4JBK A;  2NVT H;  2FXQ A;  5C4J H;  4J15 A;  2ZTD A;  4OX9 Q;  3J80 i;  4BBS H;  2D62 A;  4DR2 Q;  2I5M X;  3K7U C;  4LFA Q;  4POF A;  1QZG A;  1BKB A;  4P75 A;  4B3T L;  1G6P A;  1VQB A;  4DV4 Q;  1TWF H;  3I4N G;  1XPO A;  1K8G A;  1SE8 A;  5BR8 Q;  3JC6 6;  1V9P A;  3M4P A;  1S40 A;  1C7Y A;  2IX1 A;  4DR1 Q;  3PCO B;  3NEN A;  2WB1 G;  4DV6 Q;  2R7Z G;  2VUM H;  1N32 L;  4JI8 L;  4A3F H;  1I6H H;  3HOU G;  2B29 A;  5IP7 G;  1VQM A;  3KJO A;  1WCM G;  3G48 A;  1TWA H;  4GOP C;  4YY3 Q;  1IBL L;  2Z0S A;  4RMF A;  5E7N A;  2A8V A;  1CKO A;  2MO1 A;  3JAM c;  3NBH B;  3GO5 A;  4IJL A;  1NY4 A;  4LF8 Q;  4QJF A;  3ICE A;  3AFP A;  2JA9 A;  1JE5 A;  1LUZ A;  4JCV E;  4YCU A;  2JA5 G;  4OX9 L;  4DR2 L;  1Z9F A;  1A0I A;  1XNQ L;  1PV4 A;  2KHJ A;  2R92 H;  1WYD A;  3TS2 A;  3RZD H;  4IFD J;  1VQC A;  4BBR G;  3KOJ A;  4EQ5 A;  3RN5 A;  3PO2 G;  2UUA L;  1A63 A;  1J6Q A;  5C3E G;  3PUV A;  4DR1 L;  2MFI A;  1EFW A;  2UXC Q;  4QQB X;  4DV6 L;  1UE7 A;  4R1J A;  4DV2 Q;  3GTO H;  1S3O A;  1T9H A;  3CC4 A;  4BY7 H;  1DGS A;  2Z6K A;  3ER0 A;  1L2F A;  1EIF A;  2KBN A;  1P16 A;  3AEV A;  5M5W H;  4LUO A;  2YTV A;  2D0P A;  4YY3 L;  1PVO A;  1OXX K;  5IYC H;  3FKI G;  4A3L G;  2EIF A;  4C3H H;  1N8R C;  2PMZ E;  3KF6 A;  2ASB A;  1K9M C;  4DR4 L;  1L1O C;  2RCN A;  2JA6 G;  2YTY A;  1HNW Q;  1WI5 A;  2L15 A;  4PZ8 A;  2QEX A;  1JMC A;  2MQH A;  1I5F A;  3EIV A;  4DNI A;  1KRS A;  4GKJ Q;  1GO3 E;  4AIM A;  3GTP H;  1YJ9 A;  1YEZ A;  2UXB Q;  2IX0 A;  2BH8 A;  3SGI A;  1Y1W H;  3PIO A;  2DGY A;  4AYB E;  1GVP A;  4A3K G;  3KJP A;  1VQ7 A;  4L5R C;  2JA7 H;  4GKK Q;  1S72 A;  4JI3 Q;  3PO3 G;  2UXC L;  2R93 H;  4DV2 L;  5K36 G;  3MEF A;  4HJA A;  3GTG H;  3CC2 A;  3PUY A;  4R4O A;  3JAM i;  3FHW A;  5C4X H;  4NXN Q;  3S1N H;  3A5Z B;  3CD6 A;  1KRT A;  1G51 A;  1IBM Q;  2HIV A;  2NVY H;  3S16 H;  1VQP A;  3H3V H;  4DR5 Q;  2K4K A;  4A3E H;  4GN4 B;  4QIW E;  2QGQ A;  5C44 H;  4X62 Q;  5C0X J;  4B3M L;  1HNW L;  4AYB G;  3BZK A;  3G6E A;  1K0R A;  2ID0 A;  2NVQ H;  2I5L X;  3GTM H;  3HOZ H;  3KDF B;  1BVS A;  2UXB L;  2ALY B;  3H0G H;  3D0F A;  1JJG A;  4DR4 Q;  4JI3 L;  3A0J A;  4PZ6 A;  1YJN A;  1NBW A;  4DR7 L;  4DKA C;  1SN8 A;  2HQL A;  5IP9 H;  1IBK L;  2N3S A;  1WFQ A;  5IWA L;  4BXX G;  1D7Q A;  1LTL A;  3PUZ A;  4NXN L;  3G4S A;  4LF6 Q;  3D31 A;  3K0X A;  4GLA C;  3KDF A;  4YWM A;  4NXM L;  4X66 Q;  3CME A;  2VS1 A;  2Q2U A;  1UEB A;  2AKW B;  2IHE A;  4PG3 A;  3J81 c;  1N34 L;  2F4V Q;  3HOX H;  5IT9 c;  4TQU S;  4A3I H;  1Q8K A;  2UUC L;  1QUQ A;  3H0G G;  4L5S A;  1OXT A;  4X62 L;  4B3T Q;  2XTI A;  3H15 A;  5FLM G;  1AE2 A;  3RR5 A;  1KL9 A;  3ERS X;  1PYS B;  1E1T A;  2IHF A;  4X6A H;  1G29 1;  2LXK A;  2GVB A;  4DR3 L;  4JI2 L;  1PYB A;  2BA0 A;  3UE0 A;  5H1S E;  2MO0 A;  3CCV A;  1EQQ A;  1VQ8 A;  1VQK A;  1XPU A;  2KCT A;  3CPF A;  1N32 Q;  2ZJR A;  4DR3 Q;  1FGU A;  4A3B G;  2K50 A;  1CKN A;  1W2B A;  1YHB A;  3ZJY C;  4UP7 A;  4JC0 A;  4UY8 C;  3TS0 A;  4LFB Q;  1K3R A;  4X66 L;  2YTX A;  4QGU A;  4R4C A;  5IYB G;  4NPS A;  1OXS C;  3W5O A;  1VQO A;  4B3R Q;  4P73 A;  1E7Z A;  1NE3 A;  1X55 A;  1YNX A;  4R4I A;  4JV5 Q;  1PH6 A;  4OWW B;  1X65 A;  4A93 G;  1OTC A;  1U5K A;  1I94 Q;  2VY3 A;  2LXJ A;  2YYZ A;  2CQO A;  1NJI C;  1XNQ Q;  3I4O A;  5FJ8 G;  4HID A;  1Z47 A;  1B70 B;  3CCQ A;  3S1R H;  1ASZ A;  3M3Y H;  4IOA A;  1AH9 A;  2PI2 A;  3A74 A;  1VQN A;  2UUA Q;  2YU9 H;  4YWK A;  3L7Z C;  4ALP A;  1Q7Y C;  3HOW H;  1YJW A;  4JI6 Q;  4KI0 A;  4A3J H;  1EOV A;  3CQZ H;  4AH6 A;  2R6G A;  3RN2 A;  2K5N A;  2EXD A;  5GQO A;  2ZJP A;  5ELN A;  2ZTC A;  1LYL A;  2WFW A;  3HFZ B;  1EQR A;  4BA1 I;  3J81 i;  4A3M G;  4HIK A;  1UE1 A;  4DV7 Q;  2ZJQ A;  2OWO A;  3PF5 A;  4BBS G;  2VNU D;  2KEN A;  4LFB L;  1YI2 A;  3E9H A;  3S14 H;  3KYH C;  3TRE A;  4LFC L;  5M5Y H;  4B3R L;  3GTL H;  4LNQ A;  1PFS A;  2OQ0 A;  4GN3 B;  4C3J H;  2OTJ A;  2RHQ B;  2Z6K C;  4DK6 C;  4JV5 L;  4C3I H;  1VQ9 A;  4YHH L;  3PF4 A;  2OCE A;  3DM3 A;  3I7F A;  2VQE Q;  3RLO A;  5HGQ A;  3WWV A;  1I94 L;  1EWI A;  2VUM G;  1Y14 B;  1Q86 C;  4A3F G;  3F1Z A;  1VQD A;  3OW2 A;  3A5U A;  2KHI A;  1K83 H;  3U4V A;  4JI6 L;  4X65 Q;  3KF6 B;  3K8A A;  3E0E A;  1VQ4 A;  3RLN A;  5M3M H;  1BBW A;  2XGT A;  2C35 B;  3I56 A;  3L0O A;  4HJ9 A;  3TEH B;  4DV7 L;  3BZC A;  3CCR A;  4JG2 A;  3GDE A;  1XPR A;  2R92 G;  1AE3 A;  2Y0S G;  1HZ9 A;  1C9O A;  2K75 A;  3PUW A;  4JBJ A;  4B3M Q;  1EYG A;  2VQE L;  2VQF Q;  4JYA Q;  4C2M H;  3Q8D A;  2ZTE A;  5M3F H;  1EIY B;  2K5H A;  4BY7 G;  5GAE C;  4JI1 Q;  3I4M H;  1Q1E A;  4GLX A;  5JJK A;  3T1H Q;  1KXL A;  1CKM A;  4QY7 A;  3HOY H;  1VQL A;  5IYC G;  4DR7 Q;  4X65 L;  1XMQ Q;  1NTG A;  1IBK Q;  1H95 A;  2BH2 A;  5IWA Q;  2B63 H;  1E3P A;  1HJP A;  2OQK A;  3BJU A;  1VQE A;  4LWC A;  4JI0 Q;  4DR6 L;  4NXM Q;  2Q2T A;  2K14 A;  1CUK A;  1O7I A;  2JA8 H;  1ASY A;  1N34 Q;  2E5L Q;  1QVG A;  2E2J H;  5M5X H;  1E1O A;  1QVF A;  2UUC Q;  1IZ6 A;  1OXV A;  1X9N A;  1TXY A;  4A3C H;  1VCI A;  1Y1W G;  3CCJ A;  2JA7 G;  2QA4 A;  1SFO H;  2VQF L;  4JYA L;  1KD1 C;  1UWV A;  1A62 A;  1YHA A;  3HOY G;  2R93 G;  3UDG A;  3U58 A;  4HJ5 A;  1J5E Q;  4JI1 L;  1D8L A;  5C4X G;  3RNU A;  3T1H L;  2E2H H;  4PMW A;  2JK8 A;  4HIM A;  3FP9 A;  4JI2 Q;  4EX5 A;  1X54 A;  4LF9 Q;  1Y1V H;  5DLQ E;  2VZA A;  3CF5 A;  4HJ7 A;  1XMQ L;  4OO1 G;  1QUQ B;  4XIG S;  3J81 j;  4DV3 Q;  2RHS B;  1QZH A;  1PH3 A;  1HR0 W;  4JI0 L;  5JJL A;  2CWA A;  4A3E G;  1JT8 A;  2Q2I A;  3J7Z C;  1HR0 Q;  4GN5 A;  4P71 A;  5C44 G;  4A3G H;  1FJG Q;  5GAD C;  3F2C A;  2E5L L;  1WJJ A;  5GRO A;  3PSI A;  1HH2 P;  2GN5 A;  3PV0 A;  3UDI A;  1YHQ A;  2UUB Q;  1SRO A;  3HOZ G;  5JJI A;  1IYJ B;  1XTD A;  1V1Q A;  4B3S Q;  3PUX A;  4DAM A;  4MZ9 A;  1K73 C;  4AQY Q;  1U0L A;  4JI4 Q;  5ELO A;  3OYY A;  4QL5 A;  3M4Q A;  1B8A A;  1CKN B;  2ATW A;  1NMF A;  5IP9 G;  1J5E L;  3CP0 A;  4LF9 L;  4WJ3 M;  4YCW A;  4ME3 A;  4OXP A;  4GNX C;  3HOX G;  4JI5 Q;  4A3I G;  2GVA A;  2LSS A;  1Q1B A;  3KLW A;  4DV3 L;  4A75 A;  2NZO A;  1R9T H;  3NEM A;  2CCZ A;  1VQA A;  4POG A;  4GNX B;  4JOI C;  1HR0 L;  4KHP L;  1Q46 A;  1YZ6 A;  2F3I A;  3KFU A;  1FJG L;  4A3D H;  4LFC Q;  3S2D H;  5IYD H;  4LW1 A;  3W1G A;  3VDY A;  2UUB L;  2R7D A;  5GAH C;  1PH1 A;  4L5Q A;  4YHH Q;  2PQA B;  4OWX B;  4B3S L;  1KQS A;  1HNX Q;  4GNX A;  3K81 C;  4AQY L;  1VS0 A;  2CWP A;  4JI4 L;  3CCE A;  4IFD G;  3UE1 A;  1SMX A;  1TWH H;  3OTO Q;  3I2Z A;  4JOI A;  1QVC A;  1KIX A;  1PH8 A;  3T1Y L;  3I4N H;  1PHJ A;  1GD7 A;  4P74 A;  1WOC A;  2NVX H;  1VQI A;  2PQA A;  3AFQ A;  5EAY A;  4IO9 A;  2B3G A;  3BU2 A;  5IYD G;  3HKZ E;  4JI5 L;  5AJ3 L;  3CCL A;  2R7Z H;  4IPG A;  1C0A A;  4P72 A;  4UP9 A;  2E2I H;  1X6O A;  1SLJ A;  3DLL A;  3HOU H;  1HZC A;  2KCM A;  5IP7 H;  1PH9 A;  1WCM H;  3U50 C;  1VQH A;  2PI2 E;  4R4T A;  1JJ2 A;  3G71 A;  1XNR Q;  3M7N A;  3S2H H;  2D0O A;  1CSP A;  4Y52 H;  5JEA G;  4KLK A;  4XTC S;  4HJ8 A;  4H02 A;  3HOW G;  1N36 L;  1HZB A;  4DV1 Q;  1HNX L;  2IT1 A;  2JA5 H;  1P8L A;  3RLF A;  4A3J G;  1PH5 A;  2WAQ E;  2Y0S E;  4APV A;  2K5V A;  3M4O H;  2H5X A;  2JA8 G;  3HKZ G;  3OTO L;  1X56 A;  4FDB A;  1OXU A;  2VW9 A;  2JEA I;  4BBR H;  1N33 Q;  3PO2 H;  1VQ6 A;  4K0K L;  2MNA A;  5C3E H;  4OO1 I;  4MNO A;  2R7F A;  3HKS A;  3H3V I;  4RG1 A;  3CCS A;  3TQY A;  4GOP B;  3S15 H;  4DR6 Q;  1HNZ L;  3M85 A;  4DUZ L;  3EN2 A;  4BY1 H;  3GTQ H;  1JJC B;  1SR3 A;  1XNR L;  2WAQ G;  3E9I A;  3FKI H;  1PA6 A;  3CMA A;  3CPW A;  4LFA L;  4A3L H;  2I5H A;  4YCV A;  1XMO Q;  4DV4 L;  3ULJ A;  3PGZ A;  3KF8 B;  5C0X G;  4GOP A;  2N8N A;  4DV1 L;  4KHZ A;  5BR8 L;  2JA6 H;  2JJQ A;  1X3F A;  3GTK H;  4X64 Q;  5M3M G;  3S1Q H;  3IRB A;  2JQO A;  3L2P A;  1MJE A;  3S1M H;  4UPA A;  3S17 H;  2YV5 A;  1M90 C;  4BY1 G;  1N33 L;  3NEL A;  2E8G A;  4A3K H;  2PNH A;  2A1A A;  2AMC B;  2K52 A;  4PZ7 A;  3PO3 H;  1K8A C;  1X3G A;  1TWC H;  2JEB I;  4LF8 L;  4TVA B;  3MXN B;  5JEA J;  2ZM6 Q;  2VL6 A;  4LUV A;  4O0A A;  2BA1 A;  2CFM A;  4LF5 Q;  5M3F G;  3TRZ A;  1MJC A;  2UXD Q;  1JB7 A;  3HOV H;  2WP8 J;  1L1O B;  1MKH A;  2AWN A;  3I4M G;  1YVC A;  1I3Q H;  1VQF A;  2JE6 I;  3U4Z A;  1XMO L;  2ES2 A;  2UU9 Q;  4BA2 I;  3GD7 A;  3LGJ A;  3UDX A;  1I50 H;  4DK3 C;  3ULP A;  1V43 A;  4LF4 Q;  1PH4 A;  1GKH A;  1E22 A;  4IFD I;  4X64 L;  1FL0 A;  3CW2 C;  1SRU A;  5J3B A;  3B6Y A;  2B63 G;  3STB D;  2N78 A;  2HT1 A;  1L1O A;  2N49 A;  3I55 A;  5LMU Q;  1PH2 A;  1KC8 C;  5HY6 A;  4NB3 A;  4JBM A;  1KHI A;  4L5T A;  4LF7 Q;  2NN6 I;  5GAG C;  4OON A;  2Q2H A;  2AWO A;  3HOV G;  1Q81 C;  4IOC A;  2AHO B;  4A3C G;  1RIP A;  2A19 A;  2ZM6 L;  4BXX H;  4KHP Q;  1N9W A;  4GLV B;  4OWT B;  4LF5 L;  2HHH Q;  1IXR A;  3AQQ A;  1Q82 C;  2UXD L;  3J7A 5;  2RF4 A;  4JI7 Q;  3EBE A;  4Y7N H;  1X3E A;  3CCU A;  1M1K C;  4IPC A;  2IY5 B;  3J80 c;  1PH7 A;  4GKJ L;  3W1B A;  1HZA A;  2UU9 L;  1Y1V G;  1UE6 A;  4LF4 L;  3F2D A;  4DV0 Q;  4GKK L;  3RZO H;  3UDF A;  5IE8 A;  4HIO A;  4DUY Q;  3T1Y Q;  5FLM H;  3CXC A;  3CC7 A;  3AYH B;  5LMU L;  2NZH A;  3S24 A;  4DV5 Q;  3ULL A;  4A3G G;  4LF7 L;  1YBY A;  1TWG H;  1IBM L;  4A76 A;  5AJ3 Q;  3K7A H;  4R4Q A;  5LMN W;  1YIT A;  4GS3 A;  3F2B A;  4DAY B;  5LMN Q;  4YWL A;  1E24 A;  1LM0 A;  4A4I A;  4DPG A;  1BBU A;  4DR5 L;  4A3B H;  3STB C;  2DUD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...