2RF4A

Crystal structure of the rna polymerase i subcomplex a14/43
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
192
structure length
174
Chain Sequence
KQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDGNSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional architecture of RNA polymerase I.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA4
total genus 23
structure length 174
sequence length 192
chains with identical sequence C, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
A PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2rf4A02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2rf4A01
2BA1A 2R92G 3BU2A 3Q8DA 4DV6L 5LMUQ 4BXXH 2R7DA 1CKOA 4X66Q 4BBSG 2N78A 3D0FA 1HZBA 1FVIA 2A19A 1SRUA 1BBWA 1PYBA 3EBEA 1OXVA 3OTOQ 2UU9L 1H95A 2WP8J 2C35B 4DUZQ 4HJ8A 2I5MX 3A5ZB 4OWXB 3I4OA 3ULLA 2YTYA 1S3OA 3GTJH 3HOUH 1Z47A 2CQOA 1JJCB 2RF4A 1PH7A 2A1AA 4DV0Q 1YITA 1QVGA 4LF9Q 4JI5Q 1IL2A 1HH2P 3I4MH 4DR6Q 4HIKA 4B3SL 2CWAA 2DGYA 4BBRH 1VQIA 3A5UA 3K81C 4C3JH 3PF4A 1CKMA 4YCUA 3G48A 1BVSA 2YV5A 3RZDH 2AWNA 3KYHC 3UDFA 4C3HH 1KHIA 1J5EL 3FHWA 1E7ZA 3FKIH 1HNWQ 2QGQA 2Z0SA 2NVXH 4GNXA 4A3JH 4JC0A 1N8RC 2F3IA 3UE1A 1NBWA 1TXYA 4KHZA 3S1QH 2UXCL 3KDFA 3F2DA 5LMUL 1G6PA 5GAEC 4QGUA 2B3GA 3G6EA 2CWPA 1KD1C 1N33Q 2ZJRA 1NTGA 1TWHH 1PH8A 1Q46A 2B63G 2VQFL 2R7FA 4JI3L 3F2BA 2NN6I 4KHPQ 2EIFA 1X3FA 3D31A 3W5OA 4PG3A 1FGUA 3KF6B 1GM5A 1P16A 4P71A 1EQRA 3PUWA 2IT1A 4JOIA 4AYBE 3CCEA 4GOPC 3CCSA 3M4QA 1YIJA 2I0QA 1E3PA 1X6OA 1XMQL 1B8AA 3S16H 3KLWA 2YTVA 4P74A 4YY3L 4YWMA 5H1SE 2H5XA 1PH4A 2OTJA 1KQSA 3S24A 4DV5L 4X65L 4AIMA 4BY7G 1L1OA 1J6QA 3JC66 1YI2A 1VQ5A 1SN8A 4DV6Q 3PSIA 2JA5G 3STBD 1AE3A 3RN2A 3CC2A 1V1QA 2JA7G 4IPHA 5IT9c 1N36Q 2WB1G 1VCIA 1OXUA 4OWTB 1XPUA 1Z9FA 4XIGS 3VDYA 2K14A 1UE6A 2VZAA 4JI2L 1VQDA 2MNAA 1C9OA 3CCMA 4JI4Q 3KOJA 4WJ3M 3NENA 1A63A 3E9IA 4LF9L 5IE8A 4IFDI 4JI7Q 3CPWA 1V9PA 5M3MH 4JI8Q 4NB3A 1BBUA 5M3FH 2E2IH 4LF4Q 2EQSA 4O0AA 2V1CC 1K0RA 1IBMQ 2D0OA 2Q2IA 2Z6KA 4APVA 4DNIA 4OO1I 1Q81C 2Q2UA 2VUMG 2WAQE 1HZ9A 2K5VA 4B3SQ 3K7AH 3NELA 3PIOA 3NBHB 2N8NA 2BH8A 2DUDA 4YY3Q 5IP7G 4WJ4A 2RCNA 5GQOA 5IY0A 1J5EQ 1XNQL 1SLJA 3RN5A 1JMCA 2VY3A 3J7A5 3H3VH 4A3IG 2UUBQ 5JEAG 3CMAA 1PH1A 2ES2A 1CKNA 2KENA 4NXNL 4PZ6A 4JCVE 3PUVA 3J7ZC 1KC8C 5IYDH 4IOAA 4YHHQ 4AYBG 2VS1A 5HGQA 2UUCL 3HOWH 5HY6A 4DV2L 4A3GG 1P8LA 1HZCA 2R93G 4PZ8A 3UE0A 4DUZL 1OTCA 2YYZA 4B3ML 3TS2A 3OYYA 4BY7H 3AFPA 5BR8L 4XTCS 2JEBI 2JA6H 1RL2A 2ZM6Q 1A0IA 2K52A 1XTDA 3PV0A 5BR8Q 1JB7A 1QZGA 3I4MG 4KHPL 3KDFB 2F52A 3G4SA 1SE8A 5GROA 3BJUA 4JI8L 1YHAA 4DR3Q 1NMFA 1PH9A 1HR0Q 4UP9A 1FJGL 3S2DH 3GTLH 1TWCH 3KF6A 4OO1G 2K75A 1HNXQ 1N32L 1GVPA 1N32Q 2KHIA 3BZKA 3RLFA 1VQLA 4DV5Q 4IJHA 1A8VA 1K73C 3F2CA 4A3KG 4R4OA 1VQ7A 1KXLA 3W1BA 1N33L 1KRTA 4UY8C 2JE6I 4B3RL 4DR2L 4RG1A 3CCJA 5GAGC 4A3FH 2E8GA 1VQKA 3PO3G 1E1OA 1K8GA 2ATWA 1LUZA 3J80c 3M4PA 2WFWA 3TS0A 1PH6A 4A3DH 2VQEL 3FP9A 4A3JG 1IBLL 1E24A 2CFMA 2IY5B 1VQGA 1O7IA 4LW1A 1QUQA 5IP7H 1X9NA 3RZOH 1VQ8A 1S40A 3M3YH 3S1MH 3ZJYC 2AWOA 1KRSA 3TEHB 2OQKA 4KLKA 5IP9G 3B6YA 5C4XH 5JJLA 2Y0SG 3GTOH 1G291 3K7UC 4A3DG 2ZJPA 2JJQA 1W2BA 4A3EH 3ULJA 3T1YL 3PO3H 1E22A 4GN4B 1D7QA 1XNRQ 2HIVA 3T1HQ 1EIYB 1KIXA 4BA2I 3STBC 1UE7A 4OONA 2JA6G 2JQOA 4BXXG 1X55A 4L5SA 4DR4L 3S2HH 4ME3A 5GAHC 2PMZE 1YBYA 3EIVA 4DV3L 2R92H 1N34L 2JA9A 4IPDA 2K4KA 3PF5A 3F1ZA 3HKZG 3HOWG 2YTXA 2MO0A 4LF6Q 3PIPA 1S72A 2JA7H 2UUCQ 5IWAL 1LTLA 3LGJA 2GVBA 1I3QH 4B3TQ 4MZ9A 4A3IH 1SR3A 2E2HH 3TRZA 2ZM6L 1JT8A 4EQ5A 3ULPA 4B3TL 1YZ6A 3H0GG 2UUAL 4JV5L 5C4XG 3U50C 1M1KC 5LMNQ 5FLMH 3CW2C 3UDGA 2K5NA 4LF4L 2A8VA 3S15H 3J81j 3TREA 4AQYL 1LM0A 3UDIA 4K0KL 3GTKH 2LXJA 2WB1E 3RLOA 2JA8H 1Q12A 2PI2E 4X66L 2HIXA 1T9HA 2RHSB 3PUYA 4GKJL 1NE3A 4JI2Q 3CCLA 5C4JH 4GS3A 5C44G 2NZOA 3HOZH 4QIWE 5IYCH 3CF5A 4DV4Q 1WCMH 3I4NH 4LFCQ 1L1OC 4DV7L 4YHHL 3GTGH 2VL6A 1VQBA 1IBKL 1VQOA 1I5FA 1C7YA 2IHEA 1IBLQ 5M5WH 2BH2A 2OCEA 4DAYB 5LMNW 1K83H 1Y14B 3DLLA 2MQHA 3KF8B 1QVCA 4GN5A 4A75A 3FKIG 4P75A 2LXKA 4IPGA 3M85A 3AFQA 1U0LA 2FXQA 1QVFA 1YEZA 2WAQG 5C3EH 5M3FG 2JA5H 1UE5A 3KJOA 4Y52H 4LF8L 5FLMG 3U58A 1DGSA 4BBRG 3ICEA 1MKHA 4DUYQ 3J80i 4HIOA 2N3SA 1GD7A 2R7ZG 4MTNA 1Q86C 4C2MH 5AJ3Q 3HOUG 4J15A 2Z6KC 4LF5L 3J81c 1AE2A 1MIUA 2JK8A 1X65A 4POGA 1XMOQ 2D0PA 4MNOA 1HNZL 1KAWA 4JBKA 4LF5Q 1PHJA 4ALPA 1YHQA 4LFBL 2YU9H 2UU9Q 5IYDG 2VQEQ 3EN2A 1NJIC 1OXXK 3PCOB 4JBWA 4KI0A 1IBKQ 2B63H 2F4VQ 2Q2HA 4B3MQ 1VQ4A 3S14H 4LF6L 3CMEA 1JJ2A 1CSQA 4A3CH 1EUJA 2ID0A 3I55A 5C0XG 1A62A 4HIDA 1CKNB 5IYCG 2CCZA 1BKBA 5LMNL 5C44H 3CCUA 3CAMA 4A3EG 3CQZH 4JV5Q 2AMCB 4R4TA 2NVQH 3HKZE 5ELNA 1QZHA 2VUMH 1XJVA 1L2FA 3OW2A 3HOVG 1SMXA 2NZHA 5IP9H 5FLXc 1WJJA 4P72A 4JI6Q 1E1TA 1WFQA 3K80C 3HOYG 1AH9A 1PH2A 3WWVA 1EQQA 3CC4A 3I2ZA 1XMQQ 1PV4A 4NXMQ 3CD6A 2OWOA 3NEMA 4QL5A 1VQFA 3IRBA 1B7YB 1K3RA 4JI5L 1Q1EA 1JJGA 1PFSA 4DR4Q 3H0GH 4HJ9A 3KJPA 2AHOB 4A3BH 2MFIA 1VQ9A 1UE1A 2Y0SE 1SFOH 1C0AA 3ER0A 2MO1A 1YJWA 4B3RQ 1UEBA 4A3FG 4DV2Q 3ERSX 1IXRA 1MJCA 1FL0A 5IYBH 1I94Q 2KCMA 4LNQA 2NVYH 5E7NA 4X64Q 4DR1Q 4IO9A 3OTOL 5J3BA 1KL9A 3S1RH 4GKKQ 4IJLA 2E5LQ 1IBML 4LF8Q 2NVTH 3U4ZA 1JE5A 1VQEA 4NPSA 2VQFQ 1X3EA 3S17H 1HZAA 1N9WA 1NMGA 2ALYB 2IHFA 3E9HA 4DK3C 4DR3L 4IFDG 4QQBX 1WI5A 4DR5Q 3M4OH 2GN5A 4L5QA 2PQAB 1VQCA 1CUKA 2UXDQ 1HNXL 2IX1A 1XPOA 4LWCA 2ZTCA 4DV1L 1V43A 2IX0A 1WYDA 4TQUS 3CCRA 1YNXA 4DPGA 4LFAQ 4BY1G 1XMOL 1HNWL 4DV4L 4C3IH 1I50H 4LFAL 1CSPA 5AJ3L 4A93H 2HQLA 3GTPH 4A3GH 4JI0L 1B70B 4L5RC 2PI2A 2OTLA 4GNXC 4X6AH 4OX9L 4X64L 4DR1L 3PUZA 4A3MH 4LFBQ 2K50A 3M7NA 4EX5A 1L1OB 1X56A 1I94L 2RHQB 1G51A 3GD7A 1VQJA 3L7ZC 4P73A 1VQNA 3E0EA 2Q2TA 2K5HA 1PH3A 3MEFA 4A3KH 1IYJB 1PYSB 3JAMc 2OQ0A 4X62Q 3CC7A 1N36L 1Q1BA 5C0XI 4L5TA 4DR6L 3CP0A 3PUXA 1D8LA 1GKHA 4R4QA 4O2DA 3AYHB 1MJEA 1FJGQ 4DR7Q 4A4IA 4JBMA 2HHHL 4UP7A 3HFZB 1L0WA 3UDXA 4GN3B 3GO5A 3I7FA 4GKJQ 2QEXA 1W3SA 4QJFA 5K36G 4NXNQ 1U5KA 4YCVA 2E2JH 3A74A 4POFA 4JI0Q 5IYBG 4LF7L 1Y1VH 3JAMi 3J81i 4LUOA 2ASBA 4GNXB 1OXTA 2LSSA 4R4CA 1VS0A 1PH5A 4TVAB 1M90C 4A3BG 4JI1Q 4HJ7A 2R93H 2PNHA 2F4VL 2R7ZH 4H02A 3AQQA 4HJAA 1N34Q 5EAYA 1TWAH 1TWFH 4OX9Q 5C0XJ 5ELOA 1WOCA 5FJ8G 2E5LL 2I5LX 3PO2H 4GLVB 4HIMA 4UP8A 1HJPA 4IOCA 3DM3A 4PMWA 3TQYA 1X3GA 1EIFA 5IWAQ 3S1NH 4R4IA 3GTMH 4JYAL 2CKZB 2UXBQ 3F8TA 4GLXA 2ZTEA 2UXBL 3PGZA 1VQPA 3CCVA 4GOPB 4IFDJ 4YWLA 1GO3E 2UXCQ 1SROA 1X54A 4DK6C 4A76A 2ZJQA 3HOXH 1ASZA 4A3CG 4HJ5A 2HHHQ 3HOZG 4NXML 4R1JA 3RLNA 5M3MG 4A3MG 2BA0A 3PO2G 2D62A 3RNUA 2B29A 4JG2A 4LF7Q 5M5YH 4JI3Q 4DV7Q 1VQAA 1Q7YC 5JJIA 4JI1L 4BY1H 2N49A 2GVAA 4A3LH 1Y1WH 3GTQH 4YCWA 1EYGA 3L0OA 3RR5A 2XGTA 1QUQB 2EXDA 1YJ9A 1XPRA 1VQHA 1NY4A 1HR0W 1K9MC 1OXSC 4Y7NH 4BA1I 3CPFA 3SGIA 4X65Q 1Q8KA 3CCQA 1VQ6A 3GDEA 1K8AC 2UXDL 4YWKA 5GADC 5C3EG 4DR5L 4OWWB 2I5HA 1YJNA 3H15A 1EWIA 4GOPA 4JOIC 1XNQQ 3KFUA 1RIPA 3T1YQ 1YHBA 4DR7L 1Y1WG 4A3LG 3CXCA 1R9TH 2KHJA 1EOVA 1Y1VG 3G71A 4DKAC 1IZ6A 1LYLA 1ASYA 2HT1A 3I4NG 1WCMG 4BBSH 2NN6G 3T1HL 2KCTA 3HKSA 2R6GA 4DAMA 5JEAJ 3W1GA 2VW9A 4DR2Q 4JBJA 3BZCA 3K0XA 4JI7L 1I6HH 3I56A 4RMFA 2VNUD 2KBNA 4JYAQ 4AH6A 4DV3Q 1Q82C 1EFWA 2JA8G 4LUZA 3M9BA 3A0JA 5DLQE 3HOXG 2UUAQ 3AEVA 1VQMA 4JI4L 4GKKL 2L15A 2ZTDA 4A93G 4FDBA 2PQAA 1PVOA 2QA4A 4DV0L 4AQYQ 5JJKA 4LUVA 4GLAC 2AKWB 3HOYH 1HR0L 4PZ7A 1UWVA 1YVCA 2JEAI 3MXNB 4QY7A 4OXPA 3U4VA 4DV1Q 4JI6L 3H3VI 3HOVH 4IPCA 4X62L 2UUBL 1PA6A 4DUYL 5FJ8H 4UPAA 1TWGH 2XTIA 3L2PA 1HNZQ 3K8AA 4K0KQ 4LFCL 1XNRL 5M5XH
chains in the Genus database with same CATH superfamily
1F2YA 4EEYA 1R4QB 2Q8IB 4BBSG 5M5WB 2N78A 3KBXA 1SRUA 1B44D 4RGTA 3OTOQ 3DM1A 2FJZA 2C35B 4DUZQ 3E5NA 2I5MX 1U4LA 4OWXB 3ULLA 3GTJH 1EIHA 3CQZA 1N56A 2RF4A 3FPPA 4DV0Q 1B2TA 2L5TA 1SYDA 1AN7A 1HH2P 3PVXA 4C5AA 2DGYA 3PF4A 3GIMA 3K81C 5C3WA 1CKMA 3N52A 4YCUA 1BNZA 1UC9A 4IHJF 2OF1A 2AWNA 4N8FA 3UDFA 2M00A 1S4ZA 2R93B 3FHWA 3FKIH 4NMZA 2Z0SA 4HYKA 4RHSA 2XGPA 1N8RC 2F3IA 3UE1A 3MAQA 5FOBB 1GUWA 3GTMB 4IUVA 3KDFA 5DGAA 1I7NA 5EBCA 2JSOA 3WOEA 3M7GA 4G4KA 4IAJA 1Y1VA 2DPIA 4TKOB 2B63G 2WB1B 3F2BA 4JI3L 3P1HA 2E2IA 1LTTD 2EIFA 1X3FA 1LTAD 1F77A 5E3FA 2CW0C 1GM5A 3KLSA 4P71A 2I0QA 1YIJA 2GA4B 1X6OA 5DQGA 2J9GA 3KLWA 2DIKA 5H1SE 2I80A 3J80W 5F9LA 2H5XA 1PH4A 2OTJA 2QILA 5BN3A 5KYLA 4DV5L 1UUPA 1H9RA 4X65L 4ZUIA 5JVDF 4BY7G 1L1OA 1N34H 1YI2A 4C5CA 1DJRD 4C3IB 3VDYA 3SI8A 1UE6A 2B2TC 2VZAA 3ONAB 3D6CA 3I90A 2LY7A 1C9OA 4ED3A 2ZXPA 3MR6A 2XCAA 3J81W 1SYGA 3E9IA 3IKJA 4PMCA 2FHTA 3CPWA 1V9PA 4LF4Q 5KFIA 4NB3A 4ILWA 2CW0D 1TQOA 5T14A 1IBMQ 3ND8A 4CKCA 2WAQE 2K5VA 4B3SQ 3K7AH 3P7JA 5LMUH 3DHQA 2N8NA 2GPWA 1BXTA 5IP7G 3WOFA 3QZ7A 4IR1A 3RN5A 1Z7TA 5JOBA 3NK9A 2W71A 2D5DA 5DG7A 2KENA 1LT3D 1D1KA 3J7ZC 5IYDH 3VPDA 1SFOA 4IOAA 1JWUD 1E0BA 5CGKA 4YHHQ 1F9RA 4KK7A 4L63B 5HY6A 4OELB 4DV2L 3R3OA 3HOWB 4FS2A 1HZCA 3GTGB 4BBSB 1IYVA 3SK8A 2KUMA 5BR8L 2JA6H 5J1ZA 2ZM6Q 3PV0A 5BR8Q 2F0MA 1BCPD 4UFZA 3DEPA 1PH9A 3BJUA 3HOUB 1YHAA 1NMFA 3QO2A 2XCLA 2V4RA 1IBLH 3MEHA 2PBZA 5D1PA 4J9SA 3S15B 1N32L 2K75A 2FMAA 4LFCH 4FYDA 5CV6A 1N32Q 3BZKA 2KOLA 3RLFA 1VQLA 4DV5Q 4IJHA 2R7KA 1QWYA 1K73C 3F2CA 1T94A 4A3KG 2WB1A 1KXLA 2SOBA 3W1BA 1I3QB 5FD5A 1KRTA 2JE6I 4DR2L 2W57A 2YW2A 2E8GA 1VQKA 3PO3G 1K8GA 3PO3B 1LUZA 3M4PA 5FD6A 4A2BA 4A3DH 4HMJA 3MR3A 2CFMA 2IY5B 4CC6A 5I9PA 4LW1A 4JI8H 2J6SA 3HOYB 3GTPB 5IP7H 1CA6A 2RVLA 2J6TA 1VQ8A 1S40A 3EVQA 5KFAA 4C3JG 2WAQA 4O4LF 5KFOA 5EDWA 1XNQH 4YBZB 5C4XH 3TQ1A 3PW4A 3T5LA 3GTOH 1SYCA 4A3DG 2JJQA 3PO3H 2KEEA 2Z8LA 3BVZA 2BE5D 4RZQA 3Q23A 1LABA 4OONA 4DL3A 3H0GB 4BXXG 2D2CC 4M1UB 4F7XA 3TINA 4EBCA 1YBYA 3RMHA 2F0GA 1EYAA 2SNMA 1JR0D 3HKZG 4U6PA 5KEEA 3PIPA 2JA7H 4DR4H 2UUCQ 4A3FB 1E4EA 2R8KA 2PQEA 2JEIA 1SR3A 1KLGD 4A3JB 3NSWA 1M6VA 1WTVA 2PZWA 4Q8FA 3CW2C 3UDGA 1TWCB 3J81j 4AQYL 4U7CA 1LM0A 1QB5D 3UDIA 2FPGB 4QWCA 4KN4C 2WB1E 2JA8H 3T1HH 1D5ZC 1Q12A 4CDDC 1EZ1A 2RHSB 2RSNA 2R92A 3HS0C 2O03A 1VDZA 4FNFA 4JI2Q 2K03A 2NZOA 4CJ1B 5IYCH 3CF5A 2F0UA 1WCMH 3I4NH 4GC6A 4I7ZC 1EY0A 4QWEA 1C7YA 1IHZA 1S10A 1MD2D 2MQHA 4O3OA 1T5EA 3FKIG 2A6EC 3GIDA 4PDBA 2AQ4A 3AFQA 2FXQA 4O3RA 1Z2NX 1YEZA 1M7JA 3N40P 3NTKA 3KJOA 1EY7A 3T4AC 3SHLA 4LF8L 1ZYRD 1K1SA 4DUYQ 4HIOA 2N3SA 3H6MA 2FPIB 4MTDA 4MTNA 3HOUG 5NUCA 1S03G 1CS0A 2Z6KC 1ET6A 1MIUA 4HR7B 2W70A 4K6DA 5M9OA 2CW8A 1VBGA 4FF1A 4ALPA 2R85A 2NVTB 4NXMH 4RGMA 1R9TB 2NVXB 2VQEQ 4R7RA 4IRDA 4ED1A 1DIKA 1Y1WA 3PCOB 5LHY1 2Q2HA 2F4VQ 3HKZB 4XZ3B 2RDGA 3HEJA 1JJ2A 1CSQA 3S2DB 3A7LA 2RCFA 1EUJA 2ID0A 4FBTA 1DXMA 4HIDA 1CKNB 1BKBA 2HD3A 5CV4A 1IBKH 1EY8A 4CDCC 4A3EG 3CQZH 1U9RA 1JQYD 4JV5Q 3P20A 2NVQH 3HKZE 3H40A 3OW2A 4DL2A 3IFDA 3FKIB 4JI6Q 3I70A 4P72A 3SK5A 3GV5B 3KALA 4EG0A 2AGPA 2NTTA 1EQQA 2X6LA 4EVOA 3GTLB 2SCUB 3I2ZA 3DMUA 4G7HC 1KABA 4QL5A 2B63B 2KA7A 1K3RA 4QB4A 4I7AA 1FNWA 1JJGA 3E3XA 2FFKB 4E6IA 2KSWA 4ULLA 3GTQB 2MFIA 1VQ9A 1SDFA 4KTAA 2FJ2A 1AZQA 3ERSX 1MJCA 1CFMA 4FXGC 1FYCA 5KG0A 2KCMA 4RKLA 5E7NA 4X64Q 1IOWA 4DK0A 5J3BA 3A8JE 1IBML 3S2HB 2FB9A 4RH6A 3GTJA 1Q90A 2NVTH 4YB8B 2OH2A 4NPSA 2GPSA 4X62H 3S17H 1HZAA 3E9HA 4DR3L 4IRKA 2C2EA 4QQBX 3RB3A 2BDOA 1I4XA 1V1PB 5CORA 2UXDQ 3FPUB 1HNXL 2IX1A 1F9PA 4K5WA 4TQUS 4DPGA 2PZUA 1TAEA 1BCPC 4RGNA 3GTOA 5CV9A 1MGSA 5M3MB 2E2JB 2K01A 5KG5A 3OOCA 2A6ED 1CHQD 1NAPA 2VUGA 2IBKA 4EGVA 2OTLA 1DOMA 4DR1L 4DL5A 2XSCA 1KDBA 1JX4A 3V2TA 4P73A 3HBLA 2NTSA 2NWGA 1HUMA 2DNCA 2WKCA 4NDXA 5C1PA 5JH7F 2NVQB 4RB1A 1HHVA 1PYSB 2CQAA 4U673 2OQ0A 4EYHB 1Q1BA 4IFDH 4KV6A 2TMPA 1BCPF 1BOSA 1GKHA 1SNDA 1W6KA 3V05A 5HGTA 4BY1B 1XX8A 1PTOB 1H9SA 4DR7Q 2UXCH 1JE4A 2CH4W 4UP7A 3JSNA 3UDXA 4GN3B 3E5SA 2QEXA 3G6XA 3JRXA 4NXNQ 3RJ0A 1A15A 2DPJA 1Y1VH 3JAMi 5HV6A 4OX9H 1STGA 3R2IA 4ECXA 1OXTA 2LSSA 5IGGA 3NQTA 4TVAB 3K6OA 1A3UA 4H02A 3AQQA 4HJAA 2FP4B 1N34Q 4MV7A 2XC9A 5C0XJ 5FJ8G 3L4KA 4UP8A 1SNMA 4PMWA 5L1IA 5KG3A 3Q22A 3S1NB 3DWPA 4Y8VB 3F8TA 5COYA 4XYMB 1J9OA 1VQPA 3CCVA 2HJWA 4IFDJ 5LP6F 1GO3E 3L3OC 3N41B 1IL8A 3HG9A 5FKAC 4IN3A 1EZ8A 2HVSA 4PMBA 2QKIC 4DK6C 4A76A 1EHIA 3D4DA 2F0EA 4A3CG 5KG4A 4ED6A 3NBIA 3TSSA 4HJ5A 3HOZG 4NXML 4R1JA 3KBGA 5I2XA 3LMLA 4JI4H 2B2WC 4LH6A 2R3ZA 1G8ZD 1S5CD 1Y1WB 2JA8B 3CVZA 4LF7Q 1KNEA 5LA6F 5D65A 2R7ZB 4HSVA 3OHXC 5FLXE 4ECSA 4JI3Q 1VQAA 1CQVA 4JI1L 1L2ZA 2RDFA 1JWSD 4YCWA 1Y1WH 2RGVA 4O2BF 3L0OA 4OIJA 1XPRA 2O5JC 4NLGA 1K9MC 1OXSC 4YJ2F 2M9VA 3CPFA 4YIJA 2RQXA 4XX0B 1VQ6A 4JV1A 3GDEA 4F87A 4DV1H 4HTHA 5ELEA 4DR5L 1SMYC 1LTGD 1TWAB 4ZK9B 4OWWB 4R9WA 3JZIA 3T1YQ 2PW5A 4DR7L 4A3LG 1E4FT 1EOVA 1Y1VG 4ECWA 1STYA 1DONA 5KG6A 1RTNA 5L37A 2EXZA 1ASYA 1B04A 3I4NG 2F0NA 4BBSH 1X3PA 2F0QA 2KCTA 4DR2Q 2R6GA 2VW9A 3OTOH 1Q8IA 1DV2A 2BQRA 2W9BB 1KEEA 4L6TB 1Y8NB 1ZQ7A 3M9BA 3J80L 2DNEA 1Y8PB 1SE3A 4MHEA 1EFID 1WTXA 1Q3LA 4FDBA 4DR5H 1A9XA 5C1OA 4GLAC 3HOYH 3GIQA 4Q44A 1MHWC 1UWVA 5D1OA 4FXKC 3H3VI 3HOVH 3J81L 3K7AB 4K8JA 2HQEA 4YAKB 4JPBW 1LLRD 3H94A 1J8IA 4DUYL 1HR0H 4PQXA 4GC7A 4EYIB 1LT4D 1EL0A 2AU0A 4L8JA 2BA1A 3I72A 4YQWA 2FKLA 1LO5D 3BU2A 2VPSA 4DV6L 1JOKA 4BXXH 1CKOA 4N9PA 3BQ0A 1C30A 1FVIA 2A19A 1BBWA 5M5YB 2CH4A 5IGBA 1H95A 2WP8J 5GONF 1U4MA 4QUFA 1EUDB 3I4OA 2YTYA 2ASLA 3U9TA 3HOUH 1Z47A 2NUAB 1JJCB 4TQSA 3RGZA 2IW3A 1PH7A 4LF9Q 4DAYA 4B08A 2JA6B 3A5UA 1CTMA 4C3JH 3Q1KA 4H13C 1ENAA 1KC7A 2FINB 2YV5A 4UCUA 3VYSA 1TS5A 5IODA 2J7ZA 1QCBD 5FO9B 1YNJC 4X66H 2L55A 2QGQA 3H3VC 1PFMA 2YU9A 2XIWA 2DZDA 3CRKC 5JEAH 3S1QH 2UXCL 1GOZA 4K0KH 5LMUL 1G6PA 2EJMA 1STNA 2B3GA 1S0NA 3G6EA 2LKVA 1N33Q 3HXLA 2VA3A 1Q46A 4LJZC 4EQNA 1AUXA 3VYRA 2WDTA 5EWGA 2QF7A 4KHPQ 3G8CA 3W5OA 4F4YA 1SYBA 2DY8A 4CDEC 2XVSA 3RZOB 2WYOA 4JOIA 1SYXB 1V51A 1PZID 3M4QA 1AZPA 1XMQL 1GHKA 5C44B 3T5JA 3BZDB 4XYLB 2VQDA 1B8AA 4JI5H 2YTVA 3MFHA 4F4WA 4C1NK 3Q24A 5I6WA 3GTLA 2MHVA 4LF4H 1HNWH 1M4VA 3JC66 4K5XA 1SN8A 3PSIA 2JA7G 3N8DA 1AE3A 1ESFA 2B39A 1V1QA 3OMGA 3RN2A 5KFCA 4F4XA 4IUTA 1N36Q 3I4LA 5CMDA 1OXUA 4G57A 4OWTB 2DLNA 4XIGS 5J22A 2K14A 5EQ0A 3CU7A 3LX0A 4KY7A 3MWDA 3OHAA 3J7AK 3H20A 4JI4Q 4KHVA 1HPCA 3KOJA 5KG2A 3K5IA 5JPMC 4GKJH 3TP6A 4DL6A 1TU2B 5K36H 4JI7Q 2MUYA 2PMZA 2UVWA 1BBUA 2XRSD 2NBFA 4BWGB 1W93A 1L0XB 2RSOA 2J0TD 4A3IB 3C46A 3GTKB 2D0OA 2Q2IA 2WV6D 1Q81C 1EYDA 2L11A 4UCTA 2VUMG 1UC8A 4B3TH 1B53A 2BH8A 2DUDA 4YY3Q 3BA9A 5GQOA 3T51B 1S5FD 1E4EB 3HB9A 2VA2A 2PW7A 1JMCA 1WSCA 4K14A 3CQZB 1HRJA 3A54A 4A3IG 1E2ZA 2EDGA 5JEAG 5DLGA 1XNRL 1BCPB 2ES2A 1B6RA 4NXNL 4PZ6A 3OUUA 4JCVE 2AUJD 2NZ1D 3NUCA 5HGQA 3G7LA 2L4NA 2LS01 3Q8RB 1P8LA 2R93G 3FEWX 1VF5C 2EVBA 2ZT9C 4DUZL 1OTCA 4BY7H 1HA5A 3AFPA 4XTCS 2AGOA 4O3QA 2JEBI 1D5XC 1YNND 4ME6A 2K52A 4YR3A 3G4SA 5J39A 4JI8L 1GXDC 4DR3Q 5KG1A 4LAAA 1B9NA 1FJGL 3S2DH 3VA7A 1U4RA 5KFLA 4MTEA 4U68A 5EPKA 1PRTB 4FF4A 4UDUC 1TWCH 2K33A 4OO1G 1HNXQ 3K5OA 1GVPA 4XT3B 4V190 2WKDA 2R8GA 2AQ3B 3ORRA 2K5DA 2GLTA 3J7AF 1CZWA 2NB0A 1I7LA 4B3RL 3JAMW 4A3FH 4RG1A 3CCJA 3H09A 4QWDA 1E1OA 2ATWA 3EPIA 4I4TF 3K5LA 5KFJA 2VQEL 4ZRZA 4UCSA 2L1BA 4NP5A 1ML0D 1CZGA 1NSNS 3RZOH 4RB0A 1EQVA 3M3YH 4J8QA 2EY6A 1KRSA 2OQKA 4KLKA 5IP9G 3B6YA 3CRLC 2Y0SG 1XDNA 3Q0AA 2ZJPA 4H7BA 3T1YL 1ICWA 1JC7A 3V6KA 1HTLD 4XYOA 1E22A 2ZJTA 1KJJA 2K05A 1FNUA 1KIXA 3GIJA 1NUCA 4IZOA 5FPOA 1BJTA 4DL4A 2BQUA 4QF4A 1N34L 4IPDA 2A69D 2K4KA 3QG1A 4A3DB 4ECUA 3HOWG 1RK5A 2MO0A 2E2DC 4UCOA 4JI2H 5IWAL 2BQ3A 2NU7B 2GVBA 1I3QH 4B3TQ 3KLRA 4MZ9A 2YRWA 3VPBA 3RB0A 1N33H 2E2IB 1YZ6A 3H0GG 2UUAL 3GTQA 1HCZA 3U50C 1M1KC 1CE8A 5DNFA 5I47A 3V4SA 4GKKH 4LF4L 3S15H 4KD4A 3KK7A 3TP7A 5FO8B 1S5BD 3DEOA 3RLOA 3MXPA 5KFGA 2B2YA 3SXHA 2HIXA 4KY6A 4GZYC 4A3KB 2ZDQA 4JV0A 1NE3A 1JDBB 4GS3A 5EPJA 3HOZH 4QIWE 4XXEA 4DV4Q 4F88A 3V6HA 1G6ZA 2ZDHA 2F0HA 2W7PA 2W9AA 3GTGH 3HP3A 2K5WA 5KFRA 2IHEA 3QOLA 3CKIB 1VBHA 1EY4A 1K83H 4WRDA 4A75A 5JAVA 3D3RA 1XYIA 3M4OB 5C4XB 2E5LH 2R8HA 3M85A 3PIO3 5LYJF 3RB6A 2JA5H 2FMMA 1UE5A 4Y52H 5FLMG 3GIKA 4R8UA 4JI3H 1MKHA 3ETHA 4WFN3 2R7ZG 2V58A 5AJ3Q 5KG7A 3J81c 1AE2A 1X65A 1XMOQ 2D0PA 1HNZL 4JBKA 5G3LD 4C1NI 1PHJA 4V0BA 5FK9C 1YHQA 4LFBL 3QOJA 1BQQT 5DG9A 3MWMA 4ECQA 1NJIC 2CW7A 1VQ4A 5KNBA 1I4RA 1KJ9A 5LXTF 4LF6L 2W7OA 3CMEA 4KKSA 4BS9A 4KMUC 3I55A 5J2TF 2CCZA 1PTOC 3OHBA 2Z4HA 1O80A 1G91A 2BDNA 3RAXA 2WINB 3AB9A 2O5IC 2NU6B 1SMXA 3TBIB 5LL6b 1E1TA 1HFNA 3GIIA 3WWVA 2N88A 3CC4A 1D2BA 1PTOH 2B2VC 4Q5VA 1XMQQ 3CD6A 2OWOA 3EYYA 1TWHB 3VYTA 3NEMA 3NHHA 1CK1A 1VQFA 3J80E 2A68D 3IRBA 2F1MA 3MFGA 4EQOA 5KFXA 3K58A 3EQLC 2AHOB 3V96A 1EUCB 4HNVA 1TWGB 1UE1A 1FNVA 1YJWA 4B3RQ 5LOVF 4DV2Q 3N42B 1IXRA 2FK1A 1FL0A 3QFFA 3SE7A 4C3HB 4DR1Q 4O4IF 1KL9A 4GKKQ 4X3UA 1ONLA 4DL7A 2P5ZX 1V1OA 1VQEA 2VQFQ 1X3EA 2IHFA 1TKWB 5IT9L 3OWEB 3QR8A 1SEBD 4DR7H 4DR5Q 4L5QA 3F2UA 5FPRA 5DM63 1VQCA 3U9OA 1CUKA 5D3DA 3MTSA 4LWCA 5C3XA 4DV1L 1BNCA 2IX0A 4DFAA 2PZTA 3H0GA 3CCRA 4BY1G 2PN1A 1HNWL 1FD7D 3TIIA 4C3IH 1I50H 1CSPA 4A93H 4A3GH 1VKZA 4CDFC 1ESRA 5EWFA 1XXGA 5KIXA 4X64L 4A3MH 3PUZA 4OGQC 3GILA 3BJYA 4O3SA 2K50A 4EX5A 1X56A 3RTXA 2RHQB 1SNQA 3JSLA 1LTSD 3T13A 3PW2A 3L7ZC 3BQ2A 1SE4A 1PH3A 3MEFA 1W96A 4Z9CB 3G6JB 4UHVA 3JAMc 1J5EH 5EZYF 4DR6L 1D8LA 5KFZA 4O2DA 1FJGQ 1HFGA 4A4IA 2YCHA 1S5DD 4ZAIA 4GKJQ 1B1ZA 5J2UF 3G6VA 4ETSA 2K1BA 5ELCA 4JI7H 2AUKA 2E2JH 3A74A 4LF7L 3ZYYX 5IYBG 4JI0Q 1CQFA 2LFNA 1UNSA 4LUOA 5FO7B 3J81i 4GNXB 2YS6A 4A3BG 2R86A 4QW9A 4IR9A 5IT9E 4JI1Q 2R93H 2PNHA 2F4VL 1AP0A 2R87A 3TMEA 1EZ6A 4DV4H 4OX9Q 1KAAA 2EYJA 3AU7A 1IKMA 3R23A 3PO2H 1LTID 4IOCA 2C2DA 3DM3A 1PRTC 1EIFA 1E2WA 2UXBQ 2WAQB 1SCUB 4I50F 2UVRA 3KF8A 5D3IB 5K2MA 2RGRA 3M9NB 1UEAB 1XNRH 1S97A 4IURA 4ED2A 5E1FA 4DR6H 4EEQA 2XRQD 2UVVA 4DV0H 2C28A 3SVMA 2HHHQ 1T5XD 2XIGA 1D5MC 1DD2A 3RLNA 2EYOA 4FU0A 5KFWA 5M3MG 2R8JA 1S68A 2BA0A 3PO2G 3GV3A 2D62A 2F0PA 1C48A 2B29A 3BG3A 4JG2A 4RAYA 4KN7C 3MR2A 1XMOH 2VQFH 4DR3H 3N6RA 2EY1A 5M5YH 1KDAA 1BGWA 1WTRA 4KY5A 1Q7YC 5JJIA 4HNTA 4YR2A 4QUCA 3I4NB 4CC5A 3TIGA 2FMCA 2XGTA 3RR5A 1YJ9A 1K8OA 2I8CA 4LMYA 1I4PA 2JA7A 2DJGC 1Q8KA 2UXDL 1W6JA 1QOHA 1K8AC 3RBDA 2UVUA 5C3EG 2F0FA 3OUZA 5BPHA 1YJNA 4GOPA 1EWIA 1CQJB 2QEJC 1XNQQ 2B2TA 4A3MB 2AQ1B 3KFUA 4MV6A 1LT6D 4J9RA 1YHBA 3K5MA 5D14A 1R9TH 3K3VA 4A93B 3CHBD 4K2KA 1LYLA 4J6HA 1RKNA 3K3PA 2NN6G 1N36L 1I4HA 1I6HH 2IP4A 3I56A 1WTQA 2JEJA 2R7ZA 2KBNA 2W6MA 1RTOA 1EFWA 4LUZA 3HOXG 2VB2X 5H80A 2PNRC 2Q8RE 3ERQA 1DZ1A 2QA4A 4AQYQ 1Y69U 2X6GA 4LUVA 1PDQA 1EOTA 2R61A 4YAJB 1ZETA 2QK4A 3MXNB 2A69C 3T53B 4JI6L 3UQ8A 4IPCA 4Q0FA 5CA1F 5EWEA 3LWEA 2A73B 3C1FA 3R8BA 5C0XH 1EQTA 1G2SA 1TWGH 2XTIA 5E4XA 1ULZA 3BABA 3F8NA 4K0KQ 4LFCL 5IYZF 1A2TA 5M5XH 5G3LF 1TVXA 1K83B 4FVMA 5LMUQ 3S1RB 4X66Q 4DGZA 4NKLA 4MTKA 4RNOA 5T1IA 3D0FA 1HZBA 2EYPA 3EBEA 1OXVA 4JYAH 2UU9L 1ENFA 2HVQA 4HJ8A 3A5ZB 4APMA 1VMCA 4PNYA 4RAZA 2Z4IA 4DAVA 2A1AA 1QVGA 1B4OA 4ED0A 1IL2A 4DR6Q 5F9NA 4HIKA 4B3SL 2KECA 1CHPD 3LWBA 2EJGC 1FR3A 3G48A 1BVSA 1GUSA 2JA7B 3RZDH 3GLKA 3C0FB 2QDBA 2SDFA 1OWTA 4RB2C 2KHSA 3BYYB 2C22A 3DUZA 4HSPA 4LF8H 4DV7H 5EPLA 1SFOB 4KHZA 3L9AX 1JB3A 1GGOA 4XQNA 3M9MB 1KD1C 1NTGA 2VQFL 2R7FA 2RA4A 4P2CB 1QG7A 2NN6I 3VPCA 1SBBB 3R2TA 4XQJA 2RBMA 2JA5B 1FGUA 1L0YB 1HQMC 3KF6B 2AQ2B 3MXGA 1P16A 3OSNA 1EQRA 2IT1A 4AYBE 4GOPC 3CCSA 1N48A 1E3PA 1V8QA 2ZM6H 3RD4A 2W9BA 1IBMH 3MHBA 4P74A 1RDPD 4YY3L 2IPKD 2JEFA 1HUNA 2XD4A 4LFAH 4RGOS 1KQSA 3S24A 3JAML 5LMNH 1F2MA 1EU4A 3X3MA 3IG0A 4AIMA 2V9WA 3NE5B 1J6QA 1DYQA 1VQ5A 4JI5Q 1I94H 3STBD 5DGBA 2YU9B 1SE2A 2B2UC 2B8GA 4IPHA 5M5XB 4FS1A 1VCIA 3D6WA 2HDLA 1Z9FA 1XPUA 1LT5D 3V6JA 1QNUA 2L0CA 5D8DA 4K2LA 4JI2L 3PMFA 5AFWA 1S0MA 2IX3A 4ZCKA 3CCMA 2KEDA 4WJ3M 3A8IE 3VR3A 3OIQA 3R5FA 5I2YA 2F0WA 1M0WA 1NR2A 3Q6SA 3SK4A 2L12A 4ID6A 4IFDI 4DLKA 5M3MH 4JI8Q 4F50A 2E2IH 2VR1A 4O0AA 2V1CC 1K0RA 2V4DA 1S9FA 2Z6KA 3HRZC 4APVA 4OO1I 5EOYA 2Q2UA 2DWCA 1H9SB 4B3RH 1HZ9A 2A68C 3NELA 3PIOA 2O2LD 4ZUJA 4LSXA 5I4DA 4FBUA 4RCNA 3NWTA 2WTFA 1IYUA 1XNQL 1SLJA 2VY3A 4O4HF 1N32H 2OXPA 3MR5A 2UUBQ 3CMAA 1PH1A 4L1KA 2XGQA 4KJOA 1CKNA 2EPBA 4BY7B 4ZQIA 1KC8C 3PUVA 3KAKA 3RB4A 4LF5H 4AYBG 2UUCL 4A3GG 2ZXRA 3U9SA 3Q8PB 2R92B 4I65A 3AMUA 4B3ML 2YYZA 3TS2A 2QYZA 5KT4A 4QWAA 3J7YW 3A7AB 1RL2A 2YRXA 4DXGA 2W6OA 3I4MG 2E74C 2C5CA 2F52A 3R93A 2E2HB 1RYRA 5DLFA 1HR0Q 4TV8F 4UP9A 1SYFA 3NTHA 3GTLH 3UI2A 3KLSX 2HDMA 4FP5D 4X3TA 1WVLA 3NGDA 4HMIA 4ZYSA 4CHTB 4IWXA 2KHIA 4RAUC 4R4OA 4CGYB 1PLFA 2JP1A 4UY8C 1N33L 5BPFA 4IUQA 1O75A 3TQTA 3NPPA 2PPBC 4H44C 1RJTA 1MZBA 1TWAA 4IQZA 5KT3A 2WFWA 5CC4A 3FP9A 4A3JG 1IBLL 1II3A 4PWQA 1VQGA 1O7IA 3TDQA 3FMCA 5CR3A 4A3GB 2MJ8A 1HQRD 3S1MH 2AWOA 2F0OA 1DM0B 1AN8A 3TEHB 3DF7A 4MA5A 5JJLA 5LL6S 2F3WA 4UAIA 1B9MA 4ZOLF 1G291 3NXWA 1Z6HA 3E0JA 3EFXD 1W2BA 3RUZA 1SNCA 1ZXTA 1D7QA 4JV5H 1AW7A 2HIVA 3T1HQ 4PV1C 4BA2I 1UE7A 4YHHH 4L5SA 1WTWA 5GAHC 4DV3L 5CYUA 2R92H 5L1LA 2JA9A 4LSAA 3ETJA 3F1ZA 2PO4A 2X0SA 3BAAA 5KX5F 1PRTD 2EOTA 4M9UA 2MP1A 1PK8A 1LTLA 2H4OA 2JA5A 4LFBH 4O2AF 5C5MA 4A3IH 2E2HH 2ZM6L 4EQ5A 2KCCA 4ECYA 5EJWA 2A6HD 4JV5L 4R8UB 2HUGA 2IL8A 5FLMH 1F9SA 2Z6BA 4UCRA 5FLXL 3QB3A 2IA6A 4K0KL 1SSOA 2CZGA 1JIHA 2FK3A 2TSSA 1H9MA 4C3JB 2HCCA 4X66L 4FO2A 3D8GA 1JOOA 3GV8B 5C4JH 5DQIA 2NN6H 2NU9B 3PZPA 4LFCQ 2X69A 1WTOA 1K0SA 5C8YF 1L1OC 4DV7L 4Q8EA 3KHGA 2F0TA 2VL6A 3EA6A 1IBKL 2G9HD 4J1MA 1VQOA 4J9PA 1IBLQ 1M8AA 3A56A 3FDTA 1KJIA 1B50A 4GN5A 2ASJA 4P75A 2CVRA 5KFVA 2EY2A 1TWFA 1U0LA 5M3FG 3BG5A 5C3EH 3RV4A 1O7ZA 4BBRG 3ICEA 5KFNA 1PXUA 5HBRB 1HNZH 1BXRA 1D1IA 3RGXA 1GD7A 1O7LA 2RDHA 4C2MH 4J15A 2BE5C 1TY0A 4B9XA 3V4ZA 2K5QA 4MNOA 1S5ED 2VXWA 1WTPA 1KAWA 1WR2A 1KDCA 4EFBA 2W8KA 5M3FB 2HHHH 4J0MA 3FKIA 1HTPA 4DUZH 2YU9H 4IUNA 3FDSA 3MXNA 1PMRA 1H9JA 3EN2A 4HNUA 1ZYRC 1OXXK 4JBWA 4RHRA 5EGTA 3SDZA 2I87A 1SNPA 4B3MQ 4CKBA 2MCTA 1A3TA 2F0VA 3IN5A 4NXNH 4DV6H 5C0XG 1A62A 2IJ0A 5DG8A 3GP7A 3CCUA 1STAA 1GSHA 4RB3C 4DV2H 5ELNA 3MZ5A 2VUMH 5CV8A 1L2FA 1XJVA 5FLXc 5E4WC 1WJJA 2W8LA 3RAQA 4M7EA 1PH2A 4LF9H 1PV4A 3PQIA 4DF7A 2BR0A 3QZ8A 2BCOA 2E76C 1B7YB 3BVMA 4JI5L 4R8IA 1RYSA 2VUMB 3RF2A 3T5KA 3DWAA 2JN4A 4DR4Q 1EYZA 3KHLA 3BDLA 3H0GH 5DM73 4AQYH 2R7MA 3OSPA 1SFOH 1IKLA 1C0AA 3ER0A 2UUAH 5BN5A 4A3FG 5IYBH 4LNQA 4C3HG 1K28A 2A5HA 2L9HA 3OTOL 3S1RH 4WD3A 1QNKA 5C6AA 1WD1A 5KFKA 4LF8Q 3U4ZA 2OEOA 1JE5A 2VUMA 2FPPB 2K7VA 2HGSA 1CT1D 1C4QA 1N9WA 2ALYB 3BDCA 1GLVA 1WI5A 3M4OH 1TWFB 4QIWA 5DQHA 2Y0SB 2XWJB 3T56B 5A2QL 1TWGA 3S16B 2ZTCA 1V43A 3VYUA 1WYDA 1MSHA 3PN1A 4EGQA 1YNXA 2QCPX 4X65H 4DV4L 3HOZB 1DCZA 5L1JA 1K8MA 2HQLA 4J9OA 2CHBD 4JI0L 1Z2PX 2YZGA 3GTGA 2KQ3A 3DXJC 4L5RC 1WCMA 3VR2A 3A8KE 4X6AH 4OX9L 4LF7H 4QCLA 4J9LA 3M7NA 1L1OB 1I94L 2P0AA 1G51A 1VQJA 2XNAC 4JUZA 1VQNA 2VQEH 1S0OA 2K5HA 1STHA 1IYJB 5I9OA 1SAPA 4HCSA 5JVH3 1GUTA 4ED8A 4QIWB 5C0XI 4YJ3F 4L5TA 3PUXA 3WNZA 4R4QA 3PIP3 3AYHB 2Z9HA 5IIFA 4JBMA 5KT5A 2HHHL 4KJNA 1R9TA 1CI3M 1L0WA 1MBYA 3GO5A 2UXBH 1NNXA 1UNNC 4RA8A 3PW0A 4QJFA 1R4PB 2YL2A 1U5KA 1FJGH 4HCEA 4YCVA 4Q43A 1Y1VB 4POFA 1GYFA 2B2VA 3PR4A 1GSOA 2ASBA 1PFNA 3SK6A 1VS0A 1CM9A 1PH5A 2YS7A 3GTPA 3I12A 5EAYA 4N9TA 1WOCA 5ELOA 4B9WA 2I5LX 2V59A 4GLVB 4ECTA 1HJPA 4ECRA 1BO0A 1EY5A 1X3GA 2KCNA 5IWAQ 5C3EB 3GTMH 3S1NH 1U4PA 2CKZB 2OT2A 1K83A 4GLXA 2K6AA 5KFYA 2EYHA 3FVQA 3PGZA 5BN4A 4GOPB 4YWLA 1JDEA 1GSAA 4I7HA 3I73A 4ZHQF 4A2AA 4O1NA 4FF2A 2Q8TA 2DJFC 1SROA 1X32A 1X54A 2ZJQA 5KFBA 4X64H 1D6EC 3HOXH 1ASZA 2SEBD 5EKLA 2RDIA 3KXYT 1PZKD 1GUNA 5K5PA 5C4JB 2UU9H 1HNXH 4A3MG 3PO2B 1CA5A 3GTJB 4ZKCB 1SEIA 1TT2A 3N44B 3JAME 2RDJA 4C5BA 5L1KA 4BY1H 2R6FA 4A3LH 3GTQH 1PRTF 1EYGA 3RV3A 4E4TA 3D4WA 1AEXA 1PZJD 1VQHA 2A6HC 1NY4A 2FLLA 4Y7NH 4BA1I 3SGIA 4X65Q 1EEFD 5CAEB 1KNAA 2I5HA 5KFDA 1A2UA 3H15A 4WBNF 4JOIC 5CV7A 2V4QA 1RIPA 3BDOA 3BA8A 5JVG3 3K59A 1Y1WG 2JEGA 2KJXA 3C1EA 4Y7NB 4B3SH 1ZKOA 1GHJA 2KHJA 3GV7B 3G71A 4MA0A 3SE0A 2HT1A 2F3VA 3OIPA 2F0IA 4XT1B 3BS1A 2M05A 2B63A 3HKSA 4DAMA 1DOLA 3W1GA 5IGFA 2R8IA 4JBJA 2NU8B 3K0XA 3PW7A 3G6YA 2PVPA 4RMFA 4UCVA 5KFHA 2YYAA 1Q82C 2H1EA 3A0JA 2UUAQ 4LMQD 3IAYA 4G7ZC 1KLUD 1A6XA 3S17B 2ZTDA 4A93G 1I50B 2B8FA 1BR9A 2PQAA 4OL7A 1PVOA 3IFTA 4DV0L 4DN4M 2AKWB 4JK1C 4HN7A 4PZ7A 1YVCA 1KJ8A 2JEAI 2XWBB 4QY7A 5EKIA 3WO0A 1KJQA 4X62L 4X3SA 2UUBL 4XYQA 1ENCA 3T5HA 2QW7A 4UPAA 1RODA 3K8AA 1WD0A 3BQ1A 2R92G 1SMYD 3Q8DA 2R93A 2R7DA 3VR6A 3HOXB 3ITPA 2HVRA 1PYBA 4RFBA 3IL8A 3K57A 5CV5A 4TQRA 2VOBA 2WACA 1S3OA 2CQOA 2F03A 2W6NA 3HZXA 3I4MH 1YITA 5KT6A 2CWAA 5JUMA 4BBRH 1VQIA 2W6QA 1KTKA 3W3AA 3KYHC 4CJ0B 1EU3A 1Z2OX 4C3HH 1KHIA 3Q2OA 1J5EL 3KUPA 1E7ZA 1HNWQ 1HXYD 1B33N 2NVXH 4GNXA 4A3JH 4HAEA 4JC0A 1RD9D 1NBWA 1TXYA 3X3NA 2F4VH 1EIGA 3S1QB 1F2ZA 5KFQA 3F2DA 5JJZA 1QILA 1SNOA 1F9QA 5GAEC 4QGUA 2C00A 2CWPA 2R7NA 2ZJRA 1TWHH 1PH8A 5JQWA 5CBAE 1AUVA 2EY5A 1QJOA 3D31A 4PG3A 3T1YH 1B6SA 1YNNC 3PUWA 2R82A 3CCEA 2WE6A 4O3NA 3S16H 4RZRA 4YWMA 4B3MH 2G9DA 1VAJA 5IWAH 5KNCA 3GTOB 4RU9A 4IRCA 4MV9A 1GJXA 4K5VA 5EKKA 2ICIA 1WCMB 3EJIA 2JA5G 4DV6Q 2PCFB 4TUYF 3MC0B 3CC2A 5ELBA 4J9QA 1B3AA 5IT9c 3GTKA 1I6VC 3KHHA 2WB1G 2XN9C 4HEDA 4IUPA 1IW7D 1I50A 5CB4F 1VQDA 2MNAA 5KFSA 4ECZA 2IMWP 1SJED 3NENA 3HOVB 1A63A 1BUVT 1LTRD 3GQBA 5IE8A 4LF9L 3OMCA 3M9OB 4H0LC 3RFCA 5M3FH 1VF7A 3PR5B 2EQSA 4DNIA 3EROA 1FKAH 2EZVA 3NTIA 3S9WA 4C2MA 4S3SA 3NBHB 2DN8A 4WJ4A 2RCNA 2LMCB 5IY0A 1J5EQ 3MWYW 3BVGA 1RHPA 3J7A5 3H3VH 5KGUA 1ILQA 1UAPA 4JVZA 4MV8A 4RKBA 1T3NA 2VS1A 3WDNA 4RNMA 1QE6A 3HOWH 3VR4A 3J81E 4OHJA 2OLSA 3BYTB 3R5XA 3RZDB 4PZ8A 3TN2A 3UE0A 4C3IG 1M0TA 3OYYA 2VPQA 3I8ZA 3NWSA 3Q8SB 2KVMA 1JB7A 1A0IA 2EYFA 1XTDA 2SNSA 5IGEA 3MJFA 1NR4A 1X3QA 1QZGA 4KHPL 3N43B 3E6ZX 1FGBD 3KDFB 4R8NA 1SE8A 5GROA 4C2MB 4QWBA 4M8AA 1SYEA 3KF6A 5I6YA 1CQIB 3WO1A 1RJRA 5KFTA 1A8VA 3TZUA 4O3PA 3I4MB 4MV1A 1VQ7A 1PYWD 4YR0A 1K3BC 5GAGC 4AYBA 3J80c 1TA8A 3TS0A 1PH6A 2F0DA 4QW8A 1E24A 4CJ2C 3ND9A 4OEMB 4ZQ3A 5JPNC 3RUPA 1QUQA 2FLNA 2ATLA 1C3OA 1X9NA 3M3YB 5KFEA 4RUAA 3SEBA 3ZJYC 4DNTB 4XDXA 2K28A 3O13A 4G7OC 4IWYA 2B2YC 3K7UC 4FXDA 1ICFB 4A3EH 3ULJA 4EQPA 2FE3A 4ECVA 4GN4B 1JCKB 4DV3H 4DK1A 1XNRQ 3S1MB 2W6ZA 3HKZA 1MI2A 4XQQA 1TWCA 1EIYB 4DV5H 3LWUA 3STBC 2JA6G 3MXUA 2JQOA 4ZLTF 1X55A 4DR4L 3S2HH 1TWHA 4ME3A 2PMZE 3EIVA 3K5HA 5DEHA 5F2DA 3PF5A 3GIPA 2YTXA 4LF6Q 1RK6A 1S72A 2NVYA 3LGJA 2K32A 4YY3H 4BBRB 3I91A 1BF4A 1WH2A 3NBHA 3LP8A 3TRZA 1JT8A 1XMQH 2MGSA 1XWEA 3ULPA 4B3TL 5IOCA 2PYKA 5C4XG 3M4IA 5LMNQ 2A8VA 1JICA 2K5NA 3TREA 1ZHQA 3TZDA 2ICEC 3MFIA 2C9OA 3GTKH 2LXJA 4ODGA 2R7LA 2PI2E 1T9HA 1TS2A 3PUYA 4GKJL 5TSSA 1ZEQX 1JLLB 2UUCH 3CCLA 5C44G 2YZMA 3HGBA 5LL6X 5EBDA 1I4GA 4C56C 1Y8OB 2J6UA 4KKUA 4YHHL 3T16A 1VQBA 1EYCA 3MWEA 3H91A 1I5FA 3FRPB 2BH2A 5A35A 3M4YA 2OCEA 4TRDA 3URYA 3TP5A 4DAYB 4CKEA 1Y14B 5M5WH 3DLLA 3KF8B 5ELFA 1QVCA 5LMNW 1PTOD 2K04A 2E75C 2LXKA 5IGCA 2EYMA 4IPGA 1QVFA 2WAQG 2F0LA 3QIAA 4ZI7F 3VR5A 3U58A 1DGSA 1I3QA 2HCIA 4A3EB 3J80i 3DWQA 3QWNA 1Q86C 4MV4A 4LF5L 4POGA 2JK8A 4HQ6A 2F0KA 2D9UA 4LF5Q 4J9KA 1SXTA 4JV2A 2CQYA 2UU9Q 1PFBA 5IYDG 2F0JA 5JVLA 4KI0A 1IBKQ 2B63H 4KHPH 2W6PA 2O4XA 1I4QA 3S14H 3MA2B 4A3CH 1G2TA 1RF2D 1JKJB 2EE1A 3TP8A 5IYCG 1EY9A 5LMNL 5C44H 3CAMA 2G5DA 5IT9W 5CA0F 1BBXC 2AMCB 4R4TA 1TS3A 3HOVG 1QZHA 2A74C 2NZHA 5IP9H 1WFQA 1V1PA 3K80C 3HOYG 1AH9A 1JXLA 1EY6A 3QJYA 4NXMQ 3RBEA 4O42A 4WJWA 2F4IA 5C4HA 1C8CA 1Q1EA 1PFSA 4LK1C 4IZ8A 4HJ9A 2J4XA 3KJPA 5FLXW 4DNRB 1GUGA 4A3BH 2Y0SE 1MSGA 2JYOA 2MO1A 3Q8QB 1UEBA 2B2WA 1I94Q 2FLPA 2NVYH 4EGJA 4IO9A 4MAMA 4DR2H 4IJLA 2E5LQ 1E4GT 1RCVD 1IOVA 3JRWA 2C2RA 4F4ZA 4OO1H 3OPOA 4RWSC 2UXDH 3A55A 5HURA 1DOKA 1NMGA 4DK3C 2EJFC 1V4YA 4BWSC 4F8MA 1AFPA 3UFXB 4IFDG 4IALA 1WTHA 2W9CB 2GN5A 3OWFA 2PQAB 1EWCA 2I46A 4MV3A 1XPOA 4Q45A 3KHRA 2ASDA 1N36H 4LFAQ 1XMOL 4FM9A 3OSOA 4LFAL 5AJ3L 3VMMA 1OO9B 4WORA 3GTPH 5BR8H 1B70B 5CBEE 2PI2A 2NYZD 4GNXC 4LFBQ 5C5LA 2ENBA 3GD7A 3KAJA 1HA6A 2JA6A 3E0EA 2Y0SA 2Q2TA 3NQIA 2XCPA 3L4JA 4A3KH 4ED7A 4LF6H 1BDOA 3CC7A 4X62Q 1STEA 4J9NA 5KKNB 3CP0A 5DAUA 1ET9A 3GTMA 1MJEA 3MFYA 5ELDA 1LACA 5KYIA 4I55F 3HFZB 4DXFA 4K8IA 1XTCD 3I7FA 1JWMD 1W3SA 5K36G 4G3IA 4TV9F 4CBVA 1LTBD 1RJPA 2F0SA 1DV1A 3I3CA 4R4CA 1M90C 1TR5A 2Z1CA 2UUBH 4HJ7A 1PX2A 3C3LA 2R7ZH 2I07B 4DA2A 5D1OB 1TWAH 1TWFH 2E5LL 2FK2A 4HIMA 5IGDA 4MN3A 1TS4A 5KFMA 2JXMB 1B3QA 3TQYA 3N6XA 1KBLA 4JYAL 4R4IA 2RKSA 4DUYH 2EYLA 3SR1A 2ZTEA 4RUCA 2UXBL 2N55A 4HR7A 2V5AA 2B2UA 4RNNA 5KFUA 4EBEA 2YZNA 3P75A 2UXCQ 1GUOA 2W9CA 1EEID 5C4ZA 3NP8A 4ABNA 5BMVF 4TSSA 4DR1H 2AGQA 3W2DA 5L9XA 1JOQA 1K1QA 3GQCA 3ORQA 1RJQA 1SJHD 3C2PA 4YP3A 3RNUA 2IWHA 3MVVA 3PW5A 3K0YA 4X3KA 2NUCA 3D4RA 3R5HA 1I6HB 2BOSA 5KNDA 4DV7Q 4KKTA 2N49A 2GVAA 4A3BB 2WIIB 3FMAA 1QUQB 2EXDA 5KT7A 4JI6H 1HR0W 4KD3A 2ZXOA 5T1GA 1IW7C 3CCQA 4YWKA 2PMZB 4DU9A 5GADC 3VA5A 4LH7A 4AYBB 1STBA 5C5JA 3LNNA 4J9MA 4NW2A 4DAPA 1E2VA 4IUUA 3H4BA 1TY2A 3CXCA 4JI0H 2ZDGA 5KFFA 2M2LA 4DKAC 1IZ6A 1EWHA 1TIID 4JW0A 4QMGA 4JI1H 1WCMG 3T1HL 3H4DA 4EFEA 1VMPA 3OW7A 5JEAJ 3S14B 4MIUA 3BZCA 4JI7L 1T36A 2E2HA 2VNUD 4ZKBB 3GV6A 4N8X1 5A2QE 4JYAQ 4AH6A 4K6LA 4DV3Q 2JA8G 1H9KA 1O78A 3AEVA 4RCOA 5DLQE 1ZHSA 2MPMA 4GKKL 1VQMA 4JI4L 2R84A 5ISRA 1JORA 3K5NA 1LV9A 1PTOF 2L15A 3RIZA 2QDLA 1O7YA 5KFPA 4ME5A 2DY7A 5JJKA 1NCVA 1HR0L 5KRUA 5A2QW 4FF3A 1YNJD 3J7AV 4EBDA 3EPGA 2NVXA 4DV1Q 4OXPA 3U4VA 4Q0YA 2NVYB 1F2LA 1A3VA 1PA6A 1I6UA 2ALZA 5FJ8H 1ILPA 5KT2A 3L2PA 1HNZQ 3KTMA 4OIKA 2VB3X
chains in the Genus database with same CATH topology
2BA1A 2R92G 3BU2A 3Q8DA 4DV6L 5LMUQ 4BXXH 2R7DA 1CKOA 4X66Q 4BBSG 2N78A 3D0FA 1HZBA 1FVIA 2A19A 1SRUA 1BBWA 1PYBA 3EBEA 1OXVA 3OTOQ 2UU9L 1H95A 2WP8J 2C35B 4DUZQ 4HJ8A 2I5MX 3A5ZB 4OWXB 3I4OA 3ULLA 2YTYA 1S3OA 3GTJH 3HOUH 1Z47A 2CQOA 1JJCB 2RF4A 1PH7A 2A1AA 4DV0Q 1YITA 1QVGA 4LF9Q 4JI5Q 1IL2A 1HH2P 3I4MH 4DR6Q 4HIKA 4B3SL 2CWAA 2DGYA 4BBRH 1VQIA 3A5UA 3K81C 4C3JH 3PF4A 1CKMA 4YCUA 3G48A 1BVSA 2YV5A 3RZDH 2AWNA 3KYHC 3UDFA 4C3HH 1KHIA 1J5EL 3FHWA 1E7ZA 3FKIH 1HNWQ 2QGQA 2Z0SA 2NVXH 4GNXA 4A3JH 4JC0A 1N8RC 2F3IA 3UE1A 1NBWA 1TXYA 4KHZA 3S1QH 2UXCL 3KDFA 3F2DA 5LMUL 1G6PA 5GAEC 4QGUA 2B3GA 3G6EA 2CWPA 1KD1C 1N33Q 2ZJRA 1NTGA 1TWHH 1PH8A 1Q46A 2B63G 2VQFL 2R7FA 4JI3L 3F2BA 2NN6I 4KHPQ 2EIFA 1X3FA 3D31A 3W5OA 4PG3A 1FGUA 3KF6B 1GM5A 1P16A 4P71A 1EQRA 3PUWA 2IT1A 4JOIA 4AYBE 3CCEA 4GOPC 3CCSA 3M4QA 1YIJA 2I0QA 1E3PA 1X6OA 1XMQL 1B8AA 3S16H 3KLWA 2YTVA 4P74A 4YY3L 4YWMA 5H1SE 2H5XA 1PH4A 2OTJA 1KQSA 3S24A 4DV5L 4X65L 4AIMA 4BY7G 1L1OA 1J6QA 3JC66 1YI2A 1VQ5A 1SN8A 4DV6Q 3PSIA 2JA5G 3STBD 1AE3A 3RN2A 3CC2A 1V1QA 2JA7G 4IPHA 5IT9c 1N36Q 2WB1G 1VCIA 1OXUA 4OWTB 1XPUA 1Z9FA 4XIGS 3VDYA 2K14A 1UE6A 2VZAA 4JI2L 1VQDA 2MNAA 1C9OA 3CCMA 4JI4Q 3KOJA 4WJ3M 3NENA 1A63A 3E9IA 4LF9L 5IE8A 4IFDI 4JI7Q 3CPWA 1V9PA 5M3MH 4JI8Q 4NB3A 1BBUA 5M3FH 2E2IH 4LF4Q 2EQSA 4O0AA 2V1CC 1K0RA 1IBMQ 2D0OA 2Q2IA 2Z6KA 4APVA 4DNIA 4OO1I 1Q81C 2Q2UA 2VUMG 2WAQE 1HZ9A 2K5VA 4B3SQ 3K7AH 3NELA 3PIOA 3NBHB 2N8NA 2BH8A 2DUDA 4YY3Q 5IP7G 4WJ4A 2RCNA 5GQOA 5IY0A 1J5EQ 1XNQL 1SLJA 3RN5A 1JMCA 2VY3A 3J7A5 3H3VH 4A3IG 2UUBQ 5JEAG 3CMAA 1PH1A 2ES2A 1CKNA 2KENA 4NXNL 4PZ6A 4JCVE 3PUVA 3J7ZC 1KC8C 5IYDH 4IOAA 4YHHQ 4AYBG 2VS1A 5HGQA 2UUCL 3HOWH 5HY6A 4DV2L 4A3GG 1P8LA 1HZCA 2R93G 4PZ8A 3UE0A 4DUZL 1OTCA 2YYZA 4B3ML 3TS2A 3OYYA 4BY7H 3AFPA 5BR8L 4XTCS 2JEBI 2JA6H 1RL2A 2ZM6Q 1A0IA 2K52A 1XTDA 3PV0A 5BR8Q 1JB7A 1QZGA 3I4MG 4KHPL 3KDFB 2F52A 3G4SA 1SE8A 5GROA 3BJUA 4JI8L 1YHAA 4DR3Q 1NMFA 1PH9A 1HR0Q 4UP9A 1FJGL 3S2DH 3GTLH 1TWCH 3KF6A 4OO1G 2K75A 1HNXQ 1N32L 1GVPA 1N32Q 2KHIA 3BZKA 3RLFA 1VQLA 4DV5Q 4IJHA 1A8VA 1K73C 3F2CA 4A3KG 4R4OA 1VQ7A 1KXLA 3W1BA 1N33L 1KRTA 4UY8C 2JE6I 4B3RL 4DR2L 4RG1A 3CCJA 5GAGC 4A3FH 2E8GA 1VQKA 3PO3G 1E1OA 1K8GA 2ATWA 1LUZA 3J80c 3M4PA 2WFWA 3TS0A 1PH6A 4A3DH 2VQEL 3FP9A 4A3JG 1IBLL 1E24A 2CFMA 2IY5B 1VQGA 1O7IA 4LW1A 1QUQA 5IP7H 1X9NA 3RZOH 1VQ8A 1S40A 3M3YH 3S1MH 3ZJYC 2AWOA 1KRSA 3TEHB 2OQKA 4KLKA 5IP9G 3B6YA 5C4XH 5JJLA 2Y0SG 3GTOH 1G291 3K7UC 4A3DG 2ZJPA 2JJQA 1W2BA 4A3EH 3ULJA 3T1YL 3PO3H 1E22A 4GN4B 1D7QA 1XNRQ 2HIVA 3T1HQ 1EIYB 1KIXA 4BA2I 3STBC 1UE7A 4OONA 2JA6G 2JQOA 4BXXG 1X55A 4L5SA 4DR4L 3S2HH 4ME3A 5GAHC 2PMZE 1YBYA 3EIVA 4DV3L 2R92H 1N34L 2JA9A 4IPDA 2K4KA 3PF5A 3F1ZA 3HKZG 3HOWG 2YTXA 2MO0A 4LF6Q 3PIPA 1S72A 2JA7H 2UUCQ 5IWAL 1LTLA 3LGJA 2GVBA 1I3QH 4B3TQ 4MZ9A 4A3IH 1SR3A 2E2HH 3TRZA 2ZM6L 1JT8A 4EQ5A 3ULPA 4B3TL 1YZ6A 3H0GG 2UUAL 4JV5L 5C4XG 3U50C 1M1KC 5LMNQ 5FLMH 3CW2C 3UDGA 2K5NA 4LF4L 2A8VA 3S15H 3J81j 3TREA 4AQYL 1LM0A 3UDIA 4K0KL 3GTKH 2LXJA 2WB1E 3RLOA 2JA8H 1Q12A 2PI2E 4X66L 2HIXA 1T9HA 2RHSB 3PUYA 4GKJL 1NE3A 4JI2Q 3CCLA 5C4JH 4GS3A 5C44G 2NZOA 3HOZH 4QIWE 5IYCH 3CF5A 4DV4Q 1WCMH 3I4NH 4LFCQ 1L1OC 4DV7L 4YHHL 3GTGH 2VL6A 1VQBA 1IBKL 1VQOA 1I5FA 1C7YA 2IHEA 1IBLQ 5M5WH 2BH2A 2OCEA 4DAYB 5LMNW 1K83H 1Y14B 3DLLA 2MQHA 3KF8B 1QVCA 4GN5A 4A75A 3FKIG 4P75A 2LXKA 4IPGA 3M85A 3AFQA 1U0LA 2FXQA 1QVFA 1YEZA 2WAQG 5C3EH 5M3FG 2JA5H 1UE5A 3KJOA 4Y52H 4LF8L 5FLMG 3U58A 1DGSA 4BBRG 3ICEA 1MKHA 4DUYQ 3J80i 4HIOA 2N3SA 1GD7A 2R7ZG 4MTNA 1Q86C 4C2MH 5AJ3Q 3HOUG 4J15A 2Z6KC 4LF5L 3J81c 1AE2A 1MIUA 2JK8A 1X65A 4POGA 1XMOQ 2D0PA 4MNOA 1HNZL 1KAWA 4JBKA 4LF5Q 1PHJA 4ALPA 1YHQA 4LFBL 2YU9H 2UU9Q 5IYDG 2VQEQ 3EN2A 1NJIC 1OXXK 3PCOB 4JBWA 4KI0A 1IBKQ 2B63H 2F4VQ 2Q2HA 4B3MQ 1VQ4A 3S14H 4LF6L 3CMEA 1JJ2A 1CSQA 4A3CH 1EUJA 2ID0A 3I55A 5C0XG 1A62A 4HIDA 1CKNB 5IYCG 2CCZA 1BKBA 5LMNL 5C44H 3CCUA 3CAMA 4A3EG 3CQZH 4JV5Q 2AMCB 4R4TA 2NVQH 3HKZE 5ELNA 1QZHA 2VUMH 1XJVA 1L2FA 3OW2A 3HOVG 1SMXA 2NZHA 5IP9H 5FLXc 1WJJA 4P72A 4JI6Q 1E1TA 1WFQA 3K80C 3HOYG 1AH9A 1PH2A 3WWVA 1EQQA 3CC4A 3I2ZA 1XMQQ 1PV4A 4NXMQ 3CD6A 2OWOA 3NEMA 4QL5A 1VQFA 3IRBA 1B7YB 1K3RA 4JI5L 1Q1EA 1JJGA 1PFSA 4DR4Q 3H0GH 4HJ9A 3KJPA 2AHOB 4A3BH 2MFIA 1VQ9A 1UE1A 2Y0SE 1SFOH 1C0AA 3ER0A 2MO1A 1YJWA 4B3RQ 1UEBA 4A3FG 4DV2Q 3ERSX 1IXRA 1MJCA 1FL0A 5IYBH 1I94Q 2KCMA 4LNQA 2NVYH 5E7NA 4X64Q 4DR1Q 4IO9A 3OTOL 5J3BA 1KL9A 3S1RH 4GKKQ 4IJLA 2E5LQ 1IBML 4LF8Q 2NVTH 3U4ZA 1JE5A 1VQEA 4NPSA 2VQFQ 1X3EA 3S17H 1HZAA 1N9WA 1NMGA 2ALYB 2IHFA 3E9HA 4DK3C 4DR3L 4IFDG 4QQBX 1WI5A 4DR5Q 3M4OH 2GN5A 4L5QA 2PQAB 1VQCA 1CUKA 2UXDQ 1HNXL 2IX1A 1XPOA 4LWCA 2ZTCA 4DV1L 1V43A 2IX0A 1WYDA 4TQUS 3CCRA 1YNXA 4DPGA 4LFAQ 4BY1G 1XMOL 1HNWL 4DV4L 4C3IH 1I50H 4LFAL 1CSPA 5AJ3L 4A93H 2HQLA 3GTPH 4A3GH 4JI0L 1B70B 4L5RC 2PI2A 2OTLA 4GNXC 4X6AH 4OX9L 4X64L 4DR1L 3PUZA 4A3MH 4LFBQ 2K50A 3M7NA 4EX5A 1L1OB 1X56A 1I94L 2RHQB 1G51A 3GD7A 1VQJA 3L7ZC 4P73A 1VQNA 3E0EA 2Q2TA 2K5HA 1PH3A 3MEFA 4A3KH 1IYJB 1PYSB 3JAMc 2OQ0A 4X62Q 3CC7A 1N36L 1Q1BA 5C0XI 4L5TA 4DR6L 3CP0A 3PUXA 1D8LA 1GKHA 4R4QA 4O2DA 3AYHB 1MJEA 1FJGQ 4DR7Q 4A4IA 4JBMA 2HHHL 4UP7A 3HFZB 1L0WA 3UDXA 4GN3B 3GO5A 3I7FA 4GKJQ 2QEXA 1W3SA 4QJFA 5K36G 4NXNQ 1U5KA 4YCVA 2E2JH 3A74A 4POFA 4JI0Q 5IYBG 4LF7L 1Y1VH 3JAMi 3J81i 4LUOA 2ASBA 4GNXB 1OXTA 2LSSA 4R4CA 1VS0A 1PH5A 4TVAB 1M90C 4A3BG 4JI1Q 4HJ7A 2R93H 2PNHA 2F4VL 2R7ZH 4H02A 3AQQA 4HJAA 1N34Q 5EAYA 1TWAH 1TWFH 4OX9Q 5C0XJ 5ELOA 1WOCA 5FJ8G 2E5LL 2I5LX 3PO2H 4GLVB 4HIMA 4UP8A 1HJPA 4IOCA 3DM3A 4PMWA 3TQYA 1X3GA 1EIFA 5IWAQ 3S1NH 4R4IA 3GTMH 4JYAL 2CKZB 2UXBQ 3F8TA 4GLXA 2ZTEA 2UXBL 3PGZA 1VQPA 3CCVA 4GOPB 4IFDJ 4YWLA 1GO3E 2UXCQ 1SROA 1X54A 4DK6C 4A76A 2ZJQA 3HOXH 1ASZA 4A3CG 4HJ5A 2HHHQ 3HOZG 4NXML 4R1JA 3RLNA 5M3MG 4A3MG 2BA0A 3PO2G 2D62A 3RNUA 2B29A 4JG2A 4LF7Q 5M5YH 4JI3Q 4DV7Q 1VQAA 1Q7YC 5JJIA 4JI1L 4BY1H 2N49A 2GVAA 4A3LH 1Y1WH 3GTQH 4YCWA 1EYGA 3L0OA 3RR5A 2XGTA 1QUQB 2EXDA 1YJ9A 1XPRA 1VQHA 1NY4A 1HR0W 1K9MC 1OXSC 4Y7NH 4BA1I 3CPFA 3SGIA 4X65Q 1Q8KA 3CCQA 1VQ6A 3GDEA 1K8AC 2UXDL 4YWKA 5GADC 5C3EG 4DR5L 4OWWB 2I5HA 1YJNA 3H15A 1EWIA 4GOPA 4JOIC 1XNQQ 3KFUA 1RIPA 3T1YQ 1YHBA 4DR7L 1Y1WG 4A3LG 3CXCA 1R9TH 2KHJA 1EOVA 1Y1VG 3G71A 4DKAC 1IZ6A 1LYLA 1ASYA 2HT1A 3I4NG 1WCMG 4BBSH 2NN6G 3T1HL 2KCTA 3HKSA 2R6GA 4DAMA 5JEAJ 3W1GA 2VW9A 4DR2Q 4JBJA 3BZCA 3K0XA 4JI7L 1I6HH 3I56A 4RMFA 2VNUD 2KBNA 4JYAQ 4AH6A 4DV3Q 1Q82C 1EFWA 2JA8G 4LUZA 3M9BA 3A0JA 5DLQE 3HOXG 2UUAQ 3AEVA 1VQMA 4JI4L 4GKKL 2L15A 2ZTDA 4A93G 4FDBA 2PQAA 1PVOA 2QA4A 4DV0L 4AQYQ 5JJKA 4LUVA 4GLAC 2AKWB 3HOYH 1HR0L 4PZ7A 1UWVA 1YVCA 2JEAI 3MXNB 4QY7A 4OXPA 3U4VA 4DV1Q 4JI6L 3H3VI 3HOVH 4IPCA 4X62L 2UUBL 1PA6A 4DUYL 5FJ8H 4UPAA 1TWGH 2XTIA 3L2PA 1HNZQ 3K8AA 4K0KQ 4LFCL 1XNRL 5M5XH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BA1 A;  2R92 G;  3BU2 A;  3Q8D A;  4DV6 L;  5LMU Q;  4BXX H;  2R7D A;  1CKO A;  4X66 Q;  4BBS G;  2N78 A;  3D0F A;  1HZB A;  1FVI A;  2A19 A;  1SRU A;  1BBW A;  1PYB A;  3EBE A;  1OXV A;  3OTO Q;  2UU9 L;  1H95 A;  2WP8 J;  2C35 B;  4DUZ Q;  4HJ8 A;  2I5M X;  3A5Z B;  4OWX B;  3I4O A;  3ULL A;  2YTY A;  1S3O A;  3GTJ H;  3HOU H;  1Z47 A;  2CQO A;  1JJC B;  2RF4 A;  1PH7 A;  2A1A A;  4DV0 Q;  1YIT A;  1QVG A;  4LF9 Q;  4JI5 Q;  1IL2 A;  1HH2 P;  3I4M H;  4DR6 Q;  4HIK A;  4B3S L;  2CWA A;  2DGY A;  4BBR H;  1VQI A;  3A5U A;  3K81 C;  4C3J H;  3PF4 A;  1CKM A;  4YCU A;  3G48 A;  1BVS A;  2YV5 A;  3RZD H;  2AWN A;  3KYH C;  3UDF A;  4C3H H;  1KHI A;  1J5E L;  3FHW A;  1E7Z A;  3FKI H;  1HNW Q;  2QGQ A;  2Z0S A;  2NVX H;  4GNX A;  4A3J H;  4JC0 A;  1N8R C;  2F3I A;  3UE1 A;  1NBW A;  1TXY A;  4KHZ A;  3S1Q H;  2UXC L;  3KDF A;  3F2D A;  5LMU L;  1G6P A;  5GAE C;  4QGU A;  2B3G A;  3G6E A;  2CWP A;  1KD1 C;  1N33 Q;  2ZJR A;  1NTG A;  1TWH H;  1PH8 A;  1Q46 A;  2B63 G;  2VQF L;  2R7F A;  4JI3 L;  3F2B A;  2NN6 I;  4KHP Q;  2EIF A;  1X3F A;  3D31 A;  3W5O A;  4PG3 A;  1FGU A;  3KF6 B;  1GM5 A;  1P16 A;  4P71 A;  1EQR A;  3PUW A;  2IT1 A;  4JOI A;  4AYB E;  3CCE A;  4GOP C;  3CCS A;  3M4Q A;  1YIJ A;  2I0Q A;  1E3P A;  1X6O A;  1XMQ L;  1B8A A;  3S16 H;  3KLW A;  2YTV A;  4P74 A;  4YY3 L;  4YWM A;  5H1S E;  2H5X A;  1PH4 A;  2OTJ A;  1KQS A;  3S24 A;  4DV5 L;  4X65 L;  4AIM A;  4BY7 G;  1L1O A;  1J6Q A;  3JC6 6;  1YI2 A;  1VQ5 A;  1SN8 A;  4DV6 Q;  3PSI A;  2JA5 G;  3STB D;  1AE3 A;  3RN2 A;  3CC2 A;  1V1Q A;  2JA7 G;  4IPH A;  5IT9 c;  1N36 Q;  2WB1 G;  1VCI A;  1OXU A;  4OWT B;  1XPU A;  1Z9F A;  4XIG S;  3VDY A;  2K14 A;  1UE6 A;  2VZA A;  4JI2 L;  1VQD A;  2MNA A;  1C9O A;  3CCM A;  4JI4 Q;  3KOJ A;  4WJ3 M;  3NEN A;  1A63 A;  3E9I A;  4LF9 L;  5IE8 A;  4IFD I;  4JI7 Q;  3CPW A;  1V9P A;  5M3M H;  4JI8 Q;  4NB3 A;  1BBU A;  5M3F H;  2E2I H;  4LF4 Q;  2EQS A;  4O0A A;  2V1C C;  1K0R A;  1IBM Q;  2D0O A;  2Q2I A;  2Z6K A;  4APV A;  4DNI A;  4OO1 I;  1Q81 C;  2Q2U A;  2VUM G;  2WAQ E;  1HZ9 A;  2K5V A;  4B3S Q;  3K7A H;  3NEL A;  3PIO A;  3NBH B;  2N8N A;  2BH8 A;  2DUD A;  4YY3 Q;  5IP7 G;  4WJ4 A;  2RCN A;  5GQO A;  5IY0 A;  1J5E Q;  1XNQ L;  1SLJ A;  3RN5 A;  1JMC A;  2VY3 A;  3J7A 5;  3H3V H;  4A3I G;  2UUB Q;  5JEA G;  3CMA A;  1PH1 A;  2ES2 A;  1CKN A;  2KEN A;  4NXN L;  4PZ6 A;  4JCV E;  3PUV A;  3J7Z C;  1KC8 C;  5IYD H;  4IOA A;  4YHH Q;  4AYB G;  2VS1 A;  5HGQ A;  2UUC L;  3HOW H;  5HY6 A;  4DV2 L;  4A3G G;  1P8L A;  1HZC A;  2R93 G;  4PZ8 A;  3UE0 A;  4DUZ L;  1OTC A;  2YYZ A;  4B3M L;  3TS2 A;  3OYY A;  4BY7 H;  3AFP A;  5BR8 L;  4XTC S;  2JEB I;  2JA6 H;  1RL2 A;  2ZM6 Q;  1A0I A;  2K52 A;  1XTD A;  3PV0 A;  5BR8 Q;  1JB7 A;  1QZG A;  3I4M G;  4KHP L;  3KDF B;  2F52 A;  3G4S A;  1SE8 A;  5GRO A;  3BJU A;  4JI8 L;  1YHA A;  4DR3 Q;  1NMF A;  1PH9 A;  1HR0 Q;  4UP9 A;  1FJG L;  3S2D H;  3GTL H;  1TWC H;  3KF6 A;  4OO1 G;  2K75 A;  1HNX Q;  1N32 L;  1GVP A;  1N32 Q;  2KHI A;  3BZK A;  3RLF A;  1VQL A;  4DV5 Q;  4IJH A;  1A8V A;  1K73 C;  3F2C A;  4A3K G;  4R4O A;  1VQ7 A;  1KXL A;  3W1B A;  1N33 L;  1KRT A;  4UY8 C;  2JE6 I;  4B3R L;  4DR2 L;  4RG1 A;  3CCJ A;  5GAG C;  4A3F H;  2E8G A;  1VQK A;  3PO3 G;  1E1O A;  1K8G A;  2ATW A;  1LUZ A;  3J80 c;  3M4P A;  2WFW A;  3TS0 A;  1PH6 A;  4A3D H;  2VQE L;  3FP9 A;  4A3J G;  1IBL L;  1E24 A;  2CFM A;  2IY5 B;  1VQG A;  1O7I A;  4LW1 A;  1QUQ A;  5IP7 H;  1X9N A;  3RZO H;  1VQ8 A;  1S40 A;  3M3Y H;  3S1M H;  3ZJY C;  2AWO A;  1KRS A;  3TEH B;  2OQK A;  4KLK A;  5IP9 G;  3B6Y A;  5C4X H;  5JJL A;  2Y0S G;  3GTO H;  1G29 1;  3K7U C;  4A3D G;  2ZJP A;  2JJQ A;  1W2B A;  4A3E H;  3ULJ A;  3T1Y L;  3PO3 H;  1E22 A;  4GN4 B;  1D7Q A;  1XNR Q;  2HIV A;  3T1H Q;  1EIY B;  1KIX A;  4BA2 I;  3STB C;  1UE7 A;  4OON A;  2JA6 G;  2JQO A;  4BXX G;  1X55 A;  4L5S A;  4DR4 L;  3S2H H;  4ME3 A;  5GAH C;  2PMZ E;  1YBY A;  3EIV A;  4DV3 L;  2R92 H;  1N34 L;  2JA9 A;  4IPD A;  2K4K A;  3PF5 A;  3F1Z A;  3HKZ G;  3HOW G;  2YTX A;  2MO0 A;  4LF6 Q;  3PIP A;  1S72 A;  2JA7 H;  2UUC Q;  5IWA L;  1LTL A;  3LGJ A;  2GVB A;  1I3Q H;  4B3T Q;  4MZ9 A;  4A3I H;  1SR3 A;  2E2H H;  3TRZ A;  2ZM6 L;  1JT8 A;  4EQ5 A;  3ULP A;  4B3T L;  1YZ6 A;  3H0G G;  2UUA L;  4JV5 L;  5C4X G;  3U50 C;  1M1K C;  5LMN Q;  5FLM H;  3CW2 C;  3UDG A;  2K5N A;  4LF4 L;  2A8V A;  3S15 H;  3J81 j;  3TRE A;  4AQY L;  1LM0 A;  3UDI A;  4K0K L;  3GTK H;  2LXJ A;  2WB1 E;  3RLO A;  2JA8 H;  1Q12 A;  2PI2 E;  4X66 L;  2HIX A;  1T9H A;  2RHS B;  3PUY A;  4GKJ L;  1NE3 A;  4JI2 Q;  3CCL A;  5C4J H;  4GS3 A;  5C44 G;  2NZO A;  3HOZ H;  4QIW E;  5IYC H;  3CF5 A;  4DV4 Q;  1WCM H;  3I4N H;  4LFC Q;  1L1O C;  4DV7 L;  4YHH L;  3GTG H;  2VL6 A;  1VQB A;  1IBK L;  1VQO A;  1I5F A;  1C7Y A;  2IHE A;  1IBL Q;  5M5W H;  2BH2 A;  2OCE A;  4DAY B;  5LMN W;  1K83 H;  1Y14 B;  3DLL A;  2MQH A;  3KF8 B;  1QVC A;  4GN5 A;  4A75 A;  3FKI G;  4P75 A;  2LXK A;  4IPG A;  3M85 A;  3AFQ A;  1U0L A;  2FXQ A;  1QVF A;  1YEZ A;  2WAQ G;  5C3E H;  5M3F G;  2JA5 H;  1UE5 A;  3KJO A;  4Y52 H;  4LF8 L;  5FLM G;  3U58 A;  1DGS A;  4BBR G;  3ICE A;  1MKH A;  4DUY Q;  3J80 i;  4HIO A;  2N3S A;  1GD7 A;  2R7Z G;  4MTN A;  1Q86 C;  4C2M H;  5AJ3 Q;  3HOU G;  4J15 A;  2Z6K C;  4LF5 L;  3J81 c;  1AE2 A;  1MIU A;  2JK8 A;  1X65 A;  4POG A;  1XMO Q;  2D0P A;  4MNO A;  1HNZ L;  1KAW A;  4JBK A;  4LF5 Q;  1PHJ A;  4ALP A;  1YHQ A;  4LFB L;  2YU9 H;  2UU9 Q;  5IYD G;  2VQE Q;  3EN2 A;  1NJI C;  1OXX K;  3PCO B;  4JBW A;  4KI0 A;  1IBK Q;  2B63 H;  2F4V Q;  2Q2H A;  4B3M Q;  1VQ4 A;  3S14 H;  4LF6 L;  3CME A;  1JJ2 A;  1CSQ A;  4A3C H;  1EUJ A;  2ID0 A;  3I55 A;  5C0X G;  1A62 A;  4HID A;  1CKN B;  5IYC G;  2CCZ A;  1BKB A;  5LMN L;  5C44 H;  3CCU A;  3CAM A;  4A3E G;  3CQZ H;  4JV5 Q;  2AMC B;  4R4T A;  2NVQ H;  3HKZ E;  5ELN A;  1QZH A;  2VUM H;  1XJV A;  1L2F A;  3OW2 A;  3HOV G;  1SMX A;  2NZH A;  5IP9 H;  5FLX c;  1WJJ A;  4P72 A;  4JI6 Q;  1E1T A;  1WFQ A;  3K80 C;  3HOY G;  1AH9 A;  1PH2 A;  3WWV A;  1EQQ A;  3CC4 A;  3I2Z A;  1XMQ Q;  1PV4 A;  4NXM Q;  3CD6 A;  2OWO A;  3NEM A;  4QL5 A;  1VQF A;  3IRB A;  1B7Y B;  1K3R A;  4JI5 L;  1Q1E A;  1JJG A;  1PFS A;  4DR4 Q;  3H0G H;  4HJ9 A;  3KJP A;  2AHO B;  4A3B H;  2MFI A;  1VQ9 A;  1UE1 A;  2Y0S E;  1SFO H;  1C0A A;  3ER0 A;  2MO1 A;  1YJW A;  4B3R Q;  1UEB A;  4A3F G;  4DV2 Q;  3ERS X;  1IXR A;  1MJC A;  1FL0 A;  5IYB H;  1I94 Q;  2KCM A;  4LNQ A;  2NVY H;  5E7N A;  4X64 Q;  4DR1 Q;  4IO9 A;  3OTO L;  5J3B A;  1KL9 A;  3S1R H;  4GKK Q;  4IJL A;  2E5L Q;  1IBM L;  4LF8 Q;  2NVT H;  3U4Z A;  1JE5 A;  1VQE A;  4NPS A;  2VQF Q;  1X3E A;  3S17 H;  1HZA A;  1N9W A;  1NMG A;  2ALY B;  2IHF A;  3E9H A;  4DK3 C;  4DR3 L;  4IFD G;  4QQB X;  1WI5 A;  4DR5 Q;  3M4O H;  2GN5 A;  4L5Q A;  2PQA B;  1VQC A;  1CUK A;  2UXD Q;  1HNX L;  2IX1 A;  1XPO A;  4LWC A;  2ZTC A;  4DV1 L;  1V43 A;  2IX0 A;  1WYD A;  4TQU S;  3CCR A;  1YNX A;  4DPG A;  4LFA Q;  4BY1 G;  1XMO L;  1HNW L;  4DV4 L;  4C3I H;  1I50 H;  4LFA L;  1CSP A;  5AJ3 L;  4A93 H;  2HQL A;  3GTP H;  4A3G H;  4JI0 L;  1B70 B;  4L5R C;  2PI2 A;  2OTL A;  4GNX C;  4X6A H;  4OX9 L;  4X64 L;  4DR1 L;  3PUZ A;  4A3M H;  4LFB Q;  2K50 A;  3M7N A;  4EX5 A;  1L1O B;  1X56 A;  1I94 L;  2RHQ B;  1G51 A;  3GD7 A;  1VQJ A;  3L7Z C;  4P73 A;  1VQN A;  3E0E A;  2Q2T A;  2K5H A;  1PH3 A;  3MEF A;  4A3K H;  1IYJ B;  1PYS B;  3JAM c;  2OQ0 A;  4X62 Q;  3CC7 A;  1N36 L;  1Q1B A;  5C0X I;  4L5T A;  4DR6 L;  3CP0 A;  3PUX A;  1D8L A;  1GKH A;  4R4Q A;  4O2D A;  3AYH B;  1MJE A;  1FJG Q;  4DR7 Q;  4A4I A;  4JBM A;  2HHH L;  4UP7 A;  3HFZ B;  1L0W A;  3UDX A;  4GN3 B;  3GO5 A;  3I7F A;  4GKJ Q;  2QEX A;  1W3S A;  4QJF A;  5K36 G;  4NXN Q;  1U5K A;  4YCV A;  2E2J H;  3A74 A;  4POF A;  4JI0 Q;  5IYB G;  4LF7 L;  1Y1V H;  3JAM i;  3J81 i;  4LUO A;  2ASB A;  4GNX B;  1OXT A;  2LSS A;  4R4C A;  1VS0 A;  1PH5 A;  4TVA B;  1M90 C;  4A3B G;  4JI1 Q;  4HJ7 A;  2R93 H;  2PNH A;  2F4V L;  2R7Z H;  4H02 A;  3AQQ A;  4HJA A;  1N34 Q;  5EAY A;  1TWA H;  1TWF H;  4OX9 Q;  5C0X J;  5ELO A;  1WOC A;  5FJ8 G;  2E5L L;  2I5L X;  3PO2 H;  4GLV B;  4HIM A;  4UP8 A;  1HJP A;  4IOC A;  3DM3 A;  4PMW A;  3TQY A;  1X3G A;  1EIF A;  5IWA Q;  3S1N H;  4R4I A;  3GTM H;  4JYA L;  2CKZ B;  2UXB Q;  3F8T A;  4GLX A;  2ZTE A;  2UXB L;  3PGZ A;  1VQP A;  3CCV A;  4GOP B;  4IFD J;  4YWL A;  1GO3 E;  2UXC Q;  1SRO A;  1X54 A;  4DK6 C;  4A76 A;  2ZJQ A;  3HOX H;  1ASZ A;  4A3C G;  4HJ5 A;  2HHH Q;  3HOZ G;  4NXM L;  4R1J A;  3RLN A;  5M3M G;  4A3M G;  2BA0 A;  3PO2 G;  2D62 A;  3RNU A;  2B29 A;  4JG2 A;  4LF7 Q;  5M5Y H;  4JI3 Q;  4DV7 Q;  1VQA A;  1Q7Y C;  5JJI A;  4JI1 L;  4BY1 H;  2N49 A;  2GVA A;  4A3L H;  1Y1W H;  3GTQ H;  4YCW A;  1EYG A;  3L0O A;  3RR5 A;  2XGT A;  1QUQ B;  2EXD A;  1YJ9 A;  1XPR A;  1VQH A;  1NY4 A;  1HR0 W;  1K9M C;  1OXS C;  4Y7N H;  4BA1 I;  3CPF A;  3SGI A;  4X65 Q;  1Q8K A;  3CCQ A;  1VQ6 A;  3GDE A;  1K8A C;  2UXD L;  4YWK A;  5GAD C;  5C3E G;  4DR5 L;  4OWW B;  2I5H A;  1YJN A;  3H15 A;  1EWI A;  4GOP A;  4JOI C;  1XNQ Q;  3KFU A;  1RIP A;  3T1Y Q;  1YHB A;  4DR7 L;  1Y1W G;  4A3L G;  3CXC A;  1R9T H;  2KHJ A;  1EOV A;  1Y1V G;  3G71 A;  4DKA C;  1IZ6 A;  1LYL A;  1ASY A;  2HT1 A;  3I4N G;  1WCM G;  4BBS H;  2NN6 G;  3T1H L;  2KCT A;  3HKS A;  2R6G A;  4DAM A;  5JEA J;  3W1G A;  2VW9 A;  4DR2 Q;  4JBJ A;  3BZC A;  3K0X A;  4JI7 L;  1I6H H;  3I56 A;  4RMF A;  2VNU D;  2KBN A;  4JYA Q;  4AH6 A;  4DV3 Q;  1Q82 C;  1EFW A;  2JA8 G;  4LUZ A;  3M9B A;  3A0J A;  5DLQ E;  3HOX G;  2UUA Q;  3AEV A;  1VQM A;  4JI4 L;  4GKK L;  2L15 A;  2ZTD A;  4A93 G;  4FDB A;  2PQA A;  1PVO A;  2QA4 A;  4DV0 L;  4AQY Q;  5JJK A;  4LUV A;  4GLA C;  2AKW B;  3HOY H;  1HR0 L;  4PZ7 A;  1UWV A;  1YVC A;  2JEA I;  3MXN B;  4QY7 A;  4OXP A;  3U4V A;  4DV1 Q;  4JI6 L;  3H3V I;  3HOV H;  4IPC A;  4X62 L;  2UUB L;  1PA6 A;  4DUY L;  5FJ8 H;  4UPA A;  1TWG H;  2XTI A;  3L2P A;  1HNZ Q;  3K8A A;  4K0K Q;  4LFC L;  1XNR L;  5M5X H; 
#chains in the Genus database with same CATH topology
 1F2Y A;  4EEY A;  1R4Q B;  2Q8I B;  4BBS G;  5M5W B;  2N78 A;  3KBX A;  1SRU A;  1B44 D;  4RGT A;  3OTO Q;  3DM1 A;  2FJZ A;  2C35 B;  4DUZ Q;  3E5N A;  2I5M X;  1U4L A;  4OWX B;  3ULL A;  3GTJ H;  1EIH A;  3CQZ A;  1N56 A;  2RF4 A;  3FPP A;  4DV0 Q;  1B2T A;  2L5T A;  1SYD A;  1AN7 A;  1HH2 P;  3PVX A;  4C5A A;  2DGY A;  3PF4 A;  3GIM A;  3K81 C;  5C3W A;  1CKM A;  3N52 A;  4YCU A;  1BNZ A;  1UC9 A;  4IHJ F;  2OF1 A;  2AWN A;  4N8F A;  3UDF A;  2M00 A;  1S4Z A;  2R93 B;  3FHW A;  3FKI H;  4NMZ A;  2Z0S A;  4HYK A;  4RHS A;  2XGP A;  1N8R C;  2F3I A;  3UE1 A;  3MAQ A;  5FOB B;  1GUW A;  3GTM B;  4IUV A;  3KDF A;  5DGA A;  1I7N A;  5EBC A;  2JSO A;  3WOE A;  3M7G A;  4G4K A;  4IAJ A;  1Y1V A;  2DPI A;  4TKO B;  2B63 G;  2WB1 B;  3F2B A;  4JI3 L;  3P1H A;  2E2I A;  1LTT D;  2EIF A;  1X3F A;  1LTA D;  1F77 A;  5E3F A;  2CW0 C;  1GM5 A;  3KLS A;  4P71 A;  2I0Q A;  1YIJ A;  2GA4 B;  1X6O A;  5DQG A;  2J9G A;  3KLW A;  2DIK A;  5H1S E;  2I80 A;  3J80 W;  5F9L A;  2H5X A;  1PH4 A;  2OTJ A;  2QIL A;  5BN3 A;  5KYL A;  4DV5 L;  1UUP A;  1H9R A;  4X65 L;  4ZUI A;  5JVD F;  4BY7 G;  1L1O A;  1N34 H;  1YI2 A;  4C5C A;  1DJR D;  4C3I B;  3VDY A;  3SI8 A;  1UE6 A;  2B2T C;  2VZA A;  3ONA B;  3D6C A;  3I90 A;  2LY7 A;  1C9O A;  4ED3 A;  2ZXP A;  3MR6 A;  2XCA A;  3J81 W;  1SYG A;  3E9I A;  3IKJ A;  4PMC A;  2FHT A;  3CPW A;  1V9P A;  4LF4 Q;  5KFI A;  4NB3 A;  4ILW A;  2CW0 D;  1TQO A;  5T14 A;  1IBM Q;  3ND8 A;  4CKC A;  2WAQ E;  2K5V A;  4B3S Q;  3K7A H;  3P7J A;  5LMU H;  3DHQ A;  2N8N A;  2GPW A;  1BXT A;  5IP7 G;  3WOF A;  3QZ7 A;  4IR1 A;  3RN5 A;  1Z7T A;  5JOB A;  3NK9 A;  2W71 A;  2D5D A;  5DG7 A;  2KEN A;  1LT3 D;  1D1K A;  3J7Z C;  5IYD H;  3VPD A;  1SFO A;  4IOA A;  1JWU D;  1E0B A;  5CGK A;  4YHH Q;  1F9R A;  4KK7 A;  4L63 B;  5HY6 A;  4OEL B;  4DV2 L;  3R3O A;  3HOW B;  4FS2 A;  1HZC A;  3GTG B;  4BBS B;  1IYV A;  3SK8 A;  2KUM A;  5BR8 L;  2JA6 H;  5J1Z A;  2ZM6 Q;  3PV0 A;  5BR8 Q;  2F0M A;  1BCP D;  4UFZ A;  3DEP A;  1PH9 A;  3BJU A;  3HOU B;  1YHA A;  1NMF A;  3QO2 A;  2XCL A;  2V4R A;  1IBL H;  3MEH A;  2PBZ A;  5D1P A;  4J9S A;  3S15 B;  1N32 L;  2K75 A;  2FMA A;  4LFC H;  4FYD A;  5CV6 A;  1N32 Q;  3BZK A;  2KOL A;  3RLF A;  1VQL A;  4DV5 Q;  4IJH A;  2R7K A;  1QWY A;  1K73 C;  3F2C A;  1T94 A;  4A3K G;  2WB1 A;  1KXL A;  2SOB A;  3W1B A;  1I3Q B;  5FD5 A;  1KRT A;  2JE6 I;  4DR2 L;  2W57 A;  2YW2 A;  2E8G A;  1VQK A;  3PO3 G;  1K8G A;  3PO3 B;  1LUZ A;  3M4P A;  5FD6 A;  4A2B A;  4A3D H;  4HMJ A;  3MR3 A;  2CFM A;  2IY5 B;  4CC6 A;  5I9P A;  4LW1 A;  4JI8 H;  2J6S A;  3HOY B;  3GTP B;  5IP7 H;  1CA6 A;  2RVL A;  2J6T A;  1VQ8 A;  1S40 A;  3EVQ A;  5KFA A;  4C3J G;  2WAQ A;  4O4L F;  5KFO A;  5EDW A;  1XNQ H;  4YBZ B;  5C4X H;  3TQ1 A;  3PW4 A;  3T5L A;  3GTO H;  1SYC A;  4A3D G;  2JJQ A;  3PO3 H;  2KEE A;  2Z8L A;  3BVZ A;  2BE5 D;  4RZQ A;  3Q23 A;  1LAB A;  4OON A;  4DL3 A;  3H0G B;  4BXX G;  2D2C C;  4M1U B;  4F7X A;  3TIN A;  4EBC A;  1YBY A;  3RMH A;  2F0G A;  1EYA A;  2SNM A;  1JR0 D;  3HKZ G;  4U6P A;  5KEE A;  3PIP A;  2JA7 H;  4DR4 H;  2UUC Q;  4A3F B;  1E4E A;  2R8K A;  2PQE A;  2JEI A;  1SR3 A;  1KLG D;  4A3J B;  3NSW A;  1M6V A;  1WTV A;  2PZW A;  4Q8F A;  3CW2 C;  3UDG A;  1TWC B;  3J81 j;  4AQY L;  4U7C A;  1LM0 A;  1QB5 D;  3UDI A;  2FPG B;  4QWC A;  4KN4 C;  2WB1 E;  2JA8 H;  3T1H H;  1D5Z C;  1Q12 A;  4CDD C;  1EZ1 A;  2RHS B;  2RSN A;  2R92 A;  3HS0 C;  2O03 A;  1VDZ A;  4FNF A;  4JI2 Q;  2K03 A;  2NZO A;  4CJ1 B;  5IYC H;  3CF5 A;  2F0U A;  1WCM H;  3I4N H;  4GC6 A;  4I7Z C;  1EY0 A;  4QWE A;  1C7Y A;  1IHZ A;  1S10 A;  1MD2 D;  2MQH A;  4O3O A;  1T5E A;  3FKI G;  2A6E C;  3GID A;  4PDB A;  2AQ4 A;  3AFQ A;  2FXQ A;  4O3R A;  1Z2N X;  1YEZ A;  1M7J A;  3N40 P;  3NTK A;  3KJO A;  1EY7 A;  3T4A C;  3SHL A;  4LF8 L;  1ZYR D;  1K1S A;  4DUY Q;  4HIO A;  2N3S A;  3H6M A;  2FPI B;  4MTD A;  4MTN A;  3HOU G;  5NUC A;  1S03 G;  1CS0 A;  2Z6K C;  1ET6 A;  1MIU A;  4HR7 B;  2W70 A;  4K6D A;  5M9O A;  2CW8 A;  1VBG A;  4FF1 A;  4ALP A;  2R85 A;  2NVT B;  4NXM H;  4RGM A;  1R9T B;  2NVX B;  2VQE Q;  4R7R A;  4IRD A;  4ED1 A;  1DIK A;  1Y1W A;  3PCO B;  5LHY 1;  2Q2H A;  2F4V Q;  3HKZ B;  4XZ3 B;  2RDG A;  3HEJ A;  1JJ2 A;  1CSQ A;  3S2D B;  3A7L A;  2RCF A;  1EUJ A;  2ID0 A;  4FBT A;  1DXM A;  4HID A;  1CKN B;  1BKB A;  2HD3 A;  5CV4 A;  1IBK H;  1EY8 A;  4CDC C;  4A3E G;  3CQZ H;  1U9R A;  1JQY D;  4JV5 Q;  3P20 A;  2NVQ H;  3HKZ E;  3H40 A;  3OW2 A;  4DL2 A;  3IFD A;  3FKI B;  4JI6 Q;  3I70 A;  4P72 A;  3SK5 A;  3GV5 B;  3KAL A;  4EG0 A;  2AGP A;  2NTT A;  1EQQ A;  2X6L A;  4EVO A;  3GTL B;  2SCU B;  3I2Z A;  3DMU A;  4G7H C;  1KAB A;  4QL5 A;  2B63 B;  2KA7 A;  1K3R A;  4QB4 A;  4I7A A;  1FNW A;  1JJG A;  3E3X A;  2FFK B;  4E6I A;  2KSW A;  4ULL A;  3GTQ B;  2MFI A;  1VQ9 A;  1SDF A;  4KTA A;  2FJ2 A;  1AZQ A;  3ERS X;  1MJC A;  1CFM A;  4FXG C;  1FYC A;  5KG0 A;  2KCM A;  4RKL A;  5E7N A;  4X64 Q;  1IOW A;  4DK0 A;  5J3B A;  3A8J E;  1IBM L;  3S2H B;  2FB9 A;  4RH6 A;  3GTJ A;  1Q90 A;  2NVT H;  4YB8 B;  2OH2 A;  4NPS A;  2GPS A;  4X62 H;  3S17 H;  1HZA A;  3E9H A;  4DR3 L;  4IRK A;  2C2E A;  4QQB X;  3RB3 A;  2BDO A;  1I4X A;  1V1P B;  5COR A;  2UXD Q;  3FPU B;  1HNX L;  2IX1 A;  1F9P A;  4K5W A;  4TQU S;  4DPG A;  2PZU A;  1TAE A;  1BCP C;  4RGN A;  3GTO A;  5CV9 A;  1MGS A;  5M3M B;  2E2J B;  2K01 A;  5KG5 A;  3OOC A;  2A6E D;  1CHQ D;  1NAP A;  2VUG A;  2IBK A;  4EGV A;  2OTL A;  1DOM A;  4DR1 L;  4DL5 A;  2XSC A;  1KDB A;  1JX4 A;  3V2T A;  4P73 A;  3HBL A;  2NTS A;  2NWG A;  1HUM A;  2DNC A;  2WKC A;  4NDX A;  5C1P A;  5JH7 F;  2NVQ B;  4RB1 A;  1HHV A;  1PYS B;  2CQA A;  4U67 3;  2OQ0 A;  4EYH B;  1Q1B A;  4IFD H;  4KV6 A;  2TMP A;  1BCP F;  1BOS A;  1GKH A;  1SND A;  1W6K A;  3V05 A;  5HGT A;  4BY1 B;  1XX8 A;  1PTO B;  1H9S A;  4DR7 Q;  2UXC H;  1JE4 A;  2CH4 W;  4UP7 A;  3JSN A;  3UDX A;  4GN3 B;  3E5S A;  2QEX A;  3G6X A;  3JRX A;  4NXN Q;  3RJ0 A;  1A15 A;  2DPJ A;  1Y1V H;  3JAM i;  5HV6 A;  4OX9 H;  1STG A;  3R2I A;  4ECX A;  1OXT A;  2LSS A;  5IGG A;  3NQT A;  4TVA B;  3K6O A;  1A3U A;  4H02 A;  3AQQ A;  4HJA A;  2FP4 B;  1N34 Q;  4MV7 A;  2XC9 A;  5C0X J;  5FJ8 G;  3L4K A;  4UP8 A;  1SNM A;  4PMW A;  5L1I A;  5KG3 A;  3Q22 A;  3S1N B;  3DWP A;  4Y8V B;  3F8T A;  5COY A;  4XYM B;  1J9O A;  1VQP A;  3CCV A;  2HJW A;  4IFD J;  5LP6 F;  1GO3 E;  3L3O C;  3N41 B;  1IL8 A;  3HG9 A;  5FKA C;  4IN3 A;  1EZ8 A;  2HVS A;  4PMB A;  2QKI C;  4DK6 C;  4A76 A;  1EHI A;  3D4D A;  2F0E A;  4A3C G;  5KG4 A;  4ED6 A;  3NBI A;  3TSS A;  4HJ5 A;  3HOZ G;  4NXM L;  4R1J A;  3KBG A;  5I2X A;  3LML A;  4JI4 H;  2B2W C;  4LH6 A;  2R3Z A;  1G8Z D;  1S5C D;  1Y1W B;  2JA8 B;  3CVZ A;  4LF7 Q;  1KNE A;  5LA6 F;  5D65 A;  2R7Z B;  4HSV A;  3OHX C;  5FLX E;  4ECS A;  4JI3 Q;  1VQA A;  1CQV A;  4JI1 L;  1L2Z A;  2RDF A;  1JWS D;  4YCW A;  1Y1W H;  2RGV A;  4O2B F;  3L0O A;  4OIJ A;  1XPR A;  2O5J C;  4NLG A;  1K9M C;  1OXS C;  4YJ2 F;  2M9V A;  3CPF A;  4YIJ A;  2RQX A;  4XX0 B;  1VQ6 A;  4JV1 A;  3GDE A;  4F87 A;  4DV1 H;  4HTH A;  5ELE A;  4DR5 L;  1SMY C;  1LTG D;  1TWA B;  4ZK9 B;  4OWW B;  4R9W A;  3JZI A;  3T1Y Q;  2PW5 A;  4DR7 L;  4A3L G;  1E4F T;  1EOV A;  1Y1V G;  4ECW A;  1STY A;  1DON A;  5KG6 A;  1RTN A;  5L37 A;  2EXZ A;  1ASY A;  1B04 A;  3I4N G;  2F0N A;  4BBS H;  1X3P A;  2F0Q A;  2KCT A;  4DR2 Q;  2R6G A;  2VW9 A;  3OTO H;  1Q8I A;  1DV2 A;  2BQR A;  2W9B B;  1KEE A;  4L6T B;  1Y8N B;  1ZQ7 A;  3M9B A;  3J80 L;  2DNE A;  1Y8P B;  1SE3 A;  4MHE A;  1EFI D;  1WTX A;  1Q3L A;  4FDB A;  4DR5 H;  1A9X A;  5C1O A;  4GLA C;  3HOY H;  3GIQ A;  4Q44 A;  1MHW C;  1UWV A;  5D1O A;  4FXK C;  3H3V I;  3HOV H;  3J81 L;  3K7A B;  4K8J A;  2HQE A;  4YAK B;  4JPB W;  1LLR D;  3H94 A;  1J8I A;  4DUY L;  1HR0 H;  4PQX A;  4GC7 A;  4EYI B;  1LT4 D;  1EL0 A;  2AU0 A;  4L8J A;  2BA1 A;  3I72 A;  4YQW A;  2FKL A;  1LO5 D;  3BU2 A;  2VPS A;  4DV6 L;  1JOK A;  4BXX H;  1CKO A;  4N9P A;  3BQ0 A;  1C30 A;  1FVI A;  2A19 A;  1BBW A;  5M5Y B;  2CH4 A;  5IGB A;  1H95 A;  2WP8 J;  5GON F;  1U4M A;  4QUF A;  1EUD B;  3I4O A;  2YTY A;  2ASL A;  3U9T A;  3HOU H;  1Z47 A;  2NUA B;  1JJC B;  4TQS A;  3RGZ A;  2IW3 A;  1PH7 A;  4LF9 Q;  4DAY A;  4B08 A;  2JA6 B;  3A5U A;  1CTM A;  4C3J H;  3Q1K A;  4H13 C;  1ENA A;  1KC7 A;  2FIN B;  2YV5 A;  4UCU A;  3VYS A;  1TS5 A;  5IOD A;  2J7Z A;  1QCB D;  5FO9 B;  1YNJ C;  4X66 H;  2L55 A;  2QGQ A;  3H3V C;  1PFM A;  2YU9 A;  2XIW A;  2DZD A;  3CRK C;  5JEA H;  3S1Q H;  2UXC L;  1GOZ A;  4K0K H;  5LMU L;  1G6P A;  2EJM A;  1STN A;  2B3G A;  1S0N A;  3G6E A;  2LKV A;  1N33 Q;  3HXL A;  2VA3 A;  1Q46 A;  4LJZ C;  4EQN A;  1AUX A;  3VYR A;  2WDT A;  5EWG A;  2QF7 A;  4KHP Q;  3G8C A;  3W5O A;  4F4Y A;  1SYB A;  2DY8 A;  4CDE C;  2XVS A;  3RZO B;  2WYO A;  4JOI A;  1SYX B;  1V51 A;  1PZI D;  3M4Q A;  1AZP A;  1XMQ L;  1GHK A;  5C44 B;  3T5J A;  3BZD B;  4XYL B;  2VQD A;  1B8A A;  4JI5 H;  2YTV A;  3MFH A;  4F4W A;  4C1N K;  3Q24 A;  5I6W A;  3GTL A;  2MHV A;  4LF4 H;  1HNW H;  1M4V A;  3JC6 6;  4K5X A;  1SN8 A;  3PSI A;  2JA7 G;  3N8D A;  1AE3 A;  1ESF A;  2B39 A;  1V1Q A;  3OMG A;  3RN2 A;  5KFC A;  4F4X A;  4IUT A;  1N36 Q;  3I4L A;  5CMD A;  1OXU A;  4G57 A;  4OWT B;  2DLN A;  4XIG S;  5J22 A;  2K14 A;  5EQ0 A;  3CU7 A;  3LX0 A;  4KY7 A;  3MWD A;  3OHA A;  3J7A K;  3H20 A;  4JI4 Q;  4KHV A;  1HPC A;  3KOJ A;  5KG2 A;  3K5I A;  5JPM C;  4GKJ H;  3TP6 A;  4DL6 A;  1TU2 B;  5K36 H;  4JI7 Q;  2MUY A;  2PMZ A;  2UVW A;  1BBU A;  2XRS D;  2NBF A;  4BWG B;  1W93 A;  1L0X B;  2RSO A;  2J0T D;  4A3I B;  3C46 A;  3GTK B;  2D0O A;  2Q2I A;  2WV6 D;  1Q81 C;  1EYD A;  2L11 A;  4UCT A;  2VUM G;  1UC8 A;  4B3T H;  1B53 A;  2BH8 A;  2DUD A;  4YY3 Q;  3BA9 A;  5GQO A;  3T51 B;  1S5F D;  1E4E B;  3HB9 A;  2VA2 A;  2PW7 A;  1JMC A;  1WSC A;  4K14 A;  3CQZ B;  1HRJ A;  3A54 A;  4A3I G;  1E2Z A;  2EDG A;  5JEA G;  5DLG A;  1XNR L;  1BCP B;  2ES2 A;  1B6R A;  4NXN L;  4PZ6 A;  3OUU A;  4JCV E;  2AUJ D;  2NZ1 D;  3NUC A;  5HGQ A;  3G7L A;  2L4N A;  2LS0 1;  3Q8R B;  1P8L A;  2R93 G;  3FEW X;  1VF5 C;  2EVB A;  2ZT9 C;  4DUZ L;  1OTC A;  4BY7 H;  1HA5 A;  3AFP A;  4XTC S;  2AGO A;  4O3Q A;  2JEB I;  1D5X C;  1YNN D;  4ME6 A;  2K52 A;  4YR3 A;  3G4S A;  5J39 A;  4JI8 L;  1GXD C;  4DR3 Q;  5KG1 A;  4LAA A;  1B9N A;  1FJG L;  3S2D H;  3VA7 A;  1U4R A;  5KFL A;  4MTE A;  4U68 A;  5EPK A;  1PRT B;  4FF4 A;  4UDU C;  1TWC H;  2K33 A;  4OO1 G;  1HNX Q;  3K5O A;  1GVP A;  4XT3 B;  4V19 0;  2WKD A;  2R8G A;  2AQ3 B;  3ORR A;  2K5D A;  2GLT A;  3J7A F;  1CZW A;  2NB0 A;  1I7L A;  4B3R L;  3JAM W;  4A3F H;  4RG1 A;  3CCJ A;  3H09 A;  4QWD A;  1E1O A;  2ATW A;  3EPI A;  4I4T F;  3K5L A;  5KFJ A;  2VQE L;  4ZRZ A;  4UCS A;  2L1B A;  4NP5 A;  1ML0 D;  1CZG A;  1NSN S;  3RZO H;  4RB0 A;  1EQV A;  3M3Y H;  4J8Q A;  2EY6 A;  1KRS A;  2OQK A;  4KLK A;  5IP9 G;  3B6Y A;  3CRL C;  2Y0S G;  1XDN A;  3Q0A A;  2ZJP A;  4H7B A;  3T1Y L;  1ICW A;  1JC7 A;  3V6K A;  1HTL D;  4XYO A;  1E22 A;  2ZJT A;  1KJJ A;  2K05 A;  1FNU A;  1KIX A;  3GIJ A;  1NUC A;  4IZO A;  5FPO A;  1BJT A;  4DL4 A;  2BQU A;  4QF4 A;  1N34 L;  4IPD A;  2A69 D;  2K4K A;  3QG1 A;  4A3D B;  4ECU A;  3HOW G;  1RK5 A;  2MO0 A;  2E2D C;  4UCO A;  4JI2 H;  5IWA L;  2BQ3 A;  2NU7 B;  2GVB A;  1I3Q H;  4B3T Q;  3KLR A;  4MZ9 A;  2YRW A;  3VPB A;  3RB0 A;  1N33 H;  2E2I B;  1YZ6 A;  3H0G G;  2UUA L;  3GTQ A;  1HCZ A;  3U50 C;  1M1K C;  1CE8 A;  5DNF A;  5I47 A;  3V4S A;  4GKK H;  4LF4 L;  3S15 H;  4KD4 A;  3KK7 A;  3TP7 A;  5FO8 B;  1S5B D;  3DEO A;  3RLO A;  3MXP A;  5KFG A;  2B2Y A;  3SXH A;  2HIX A;  4KY6 A;  4GZY C;  4A3K B;  2ZDQ A;  4JV0 A;  1NE3 A;  1JDB B;  4GS3 A;  5EPJ A;  3HOZ H;  4QIW E;  4XXE A;  4DV4 Q;  4F88 A;  3V6H A;  1G6Z A;  2ZDH A;  2F0H A;  2W7P A;  2W9A A;  3GTG H;  3HP3 A;  2K5W A;  5KFR A;  2IHE A;  3QOL A;  3CKI B;  1VBH A;  1EY4 A;  1K83 H;  4WRD A;  4A75 A;  5JAV A;  3D3R A;  1XYI A;  3M4O B;  5C4X B;  2E5L H;  2R8H A;  3M85 A;  3PIO 3;  5LYJ F;  3RB6 A;  2JA5 H;  2FMM A;  1UE5 A;  4Y52 H;  5FLM G;  3GIK A;  4R8U A;  4JI3 H;  1MKH A;  3ETH A;  4WFN 3;  2R7Z G;  2V58 A;  5AJ3 Q;  5KG7 A;  3J81 c;  1AE2 A;  1X65 A;  1XMO Q;  2D0P A;  1HNZ L;  4JBK A;  5G3L D;  4C1N I;  1PHJ A;  4V0B A;  5FK9 C;  1YHQ A;  4LFB L;  3QOJ A;  1BQQ T;  5DG9 A;  3MWM A;  4ECQ A;  1NJI C;  2CW7 A;  1VQ4 A;  5KNB A;  1I4R A;  1KJ9 A;  5LXT F;  4LF6 L;  2W7O A;  3CME A;  4KKS A;  4BS9 A;  4KMU C;  3I55 A;  5J2T F;  2CCZ A;  1PTO C;  3OHB A;  2Z4H A;  1O80 A;  1G91 A;  2BDN A;  3RAX A;  2WIN B;  3AB9 A;  2O5I C;  2NU6 B;  1SMX A;  3TBI B;  5LL6 b;  1E1T A;  1HFN A;  3GII A;  3WWV A;  2N88 A;  3CC4 A;  1D2B A;  1PTO H;  2B2V C;  4Q5V A;  1XMQ Q;  3CD6 A;  2OWO A;  3EYY A;  1TWH B;  3VYT A;  3NEM A;  3NHH A;  1CK1 A;  1VQF A;  3J80 E;  2A68 D;  3IRB A;  2F1M A;  3MFG A;  4EQO A;  5KFX A;  3K58 A;  3EQL C;  2AHO B;  3V96 A;  1EUC B;  4HNV A;  1TWG B;  1UE1 A;  1FNV A;  1YJW A;  4B3R Q;  5LOV F;  4DV2 Q;  3N42 B;  1IXR A;  2FK1 A;  1FL0 A;  3QFF A;  3SE7 A;  4C3H B;  4DR1 Q;  4O4I F;  1KL9 A;  4GKK Q;  4X3U A;  1ONL A;  4DL7 A;  2P5Z X;  1V1O A;  1VQE A;  2VQF Q;  1X3E A;  2IHF A;  1TKW B;  5IT9 L;  3OWE B;  3QR8 A;  1SEB D;  4DR7 H;  4DR5 Q;  4L5Q A;  3F2U A;  5FPR A;  5DM6 3;  1VQC A;  3U9O A;  1CUK A;  5D3D A;  3MTS A;  4LWC A;  5C3X A;  4DV1 L;  1BNC A;  2IX0 A;  4DFA A;  2PZT A;  3H0G A;  3CCR A;  4BY1 G;  2PN1 A;  1HNW L;  1FD7 D;  3TII A;  4C3I H;  1I50 H;  1CSP A;  4A93 H;  4A3G H;  1VKZ A;  4CDF C;  1ESR A;  5EWF A;  1XXG A;  5KIX A;  4X64 L;  4A3M H;  3PUZ A;  4OGQ C;  3GIL A;  3BJY A;  4O3S A;  2K50 A;  4EX5 A;  1X56 A;  3RTX A;  2RHQ B;  1SNQ A;  3JSL A;  1LTS D;  3T13 A;  3PW2 A;  3L7Z C;  3BQ2 A;  1SE4 A;  1PH3 A;  3MEF A;  1W96 A;  4Z9C B;  3G6J B;  4UHV A;  3JAM c;  1J5E H;  5EZY F;  4DR6 L;  1D8L A;  5KFZ A;  4O2D A;  1FJG Q;  1HFG A;  4A4I A;  2YCH A;  1S5D D;  4ZAI A;  4GKJ Q;  1B1Z A;  5J2U F;  3G6V A;  4ETS A;  2K1B A;  5ELC A;  4JI7 H;  2AUK A;  2E2J H;  3A74 A;  4LF7 L;  3ZYY X;  5IYB G;  4JI0 Q;  1CQF A;  2LFN A;  1UNS A;  4LUO A;  5FO7 B;  3J81 i;  4GNX B;  2YS6 A;  4A3B G;  2R86 A;  4QW9 A;  4IR9 A;  5IT9 E;  4JI1 Q;  2R93 H;  2PNH A;  2F4V L;  1AP0 A;  2R87 A;  3TME A;  1EZ6 A;  4DV4 H;  4OX9 Q;  1KAA A;  2EYJ A;  3AU7 A;  1IKM A;  3R23 A;  3PO2 H;  1LTI D;  4IOC A;  2C2D A;  3DM3 A;  1PRT C;  1EIF A;  1E2W A;  2UXB Q;  2WAQ B;  1SCU B;  4I50 F;  2UVR A;  3KF8 A;  5D3I B;  5K2M A;  2RGR A;  3M9N B;  1UEA B;  1XNR H;  1S97 A;  4IUR A;  4ED2 A;  5E1F A;  4DR6 H;  4EEQ A;  2XRQ D;  2UVV A;  4DV0 H;  2C28 A;  3SVM A;  2HHH Q;  1T5X D;  2XIG A;  1D5M C;  1DD2 A;  3RLN A;  2EYO A;  4FU0 A;  5KFW A;  5M3M G;  2R8J A;  1S68 A;  2BA0 A;  3PO2 G;  3GV3 A;  2D62 A;  2F0P A;  1C48 A;  2B29 A;  3BG3 A;  4JG2 A;  4RAY A;  4KN7 C;  3MR2 A;  1XMO H;  2VQF H;  4DR3 H;  3N6R A;  2EY1 A;  5M5Y H;  1KDA A;  1BGW A;  1WTR A;  4KY5 A;  1Q7Y C;  5JJI A;  4HNT A;  4YR2 A;  4QUC A;  3I4N B;  4CC5 A;  3TIG A;  2FMC A;  2XGT A;  3RR5 A;  1YJ9 A;  1K8O A;  2I8C A;  4LMY A;  1I4P A;  2JA7 A;  2DJG C;  1Q8K A;  2UXD L;  1W6J A;  1QOH A;  1K8A C;  3RBD A;  2UVU A;  5C3E G;  2F0F A;  3OUZ A;  5BPH A;  1YJN A;  4GOP A;  1EWI A;  1CQJ B;  2QEJ C;  1XNQ Q;  2B2T A;  4A3M B;  2AQ1 B;  3KFU A;  4MV6 A;  1LT6 D;  4J9R A;  1YHB A;  3K5M A;  5D14 A;  1R9T H;  3K3V A;  4A93 B;  3CHB D;  4K2K A;  1LYL A;  4J6H A;  1RKN A;  3K3P A;  2NN6 G;  1N36 L;  1I4H A;  1I6H H;  2IP4 A;  3I56 A;  1WTQ A;  2JEJ A;  2R7Z A;  2KBN A;  2W6M A;  1RTO A;  1EFW A;  4LUZ A;  3HOX G;  2VB2 X;  5H80 A;  2PNR C;  2Q8R E;  3ERQ A;  1DZ1 A;  2QA4 A;  4AQY Q;  1Y69 U;  2X6G A;  4LUV A;  1PDQ A;  1EOT A;  2R61 A;  4YAJ B;  1ZET A;  2QK4 A;  3MXN B;  2A69 C;  3T53 B;  4JI6 L;  3UQ8 A;  4IPC A;  4Q0F A;  5CA1 F;  5EWE A;  3LWE A;  2A73 B;  3C1F A;  3R8B A;  5C0X H;  1EQT A;  1G2S A;  1TWG H;  2XTI A;  5E4X A;  1ULZ A;  3BAB A;  3F8N A;  4K0K Q;  4LFC L;  5IYZ F;  1A2T A;  5M5X H;  5G3L F;  1TVX A;  1K83 B;  4FVM A;  5LMU Q;  3S1R B;  4X66 Q;  4DGZ A;  4NKL A;  4MTK A;  4RNO A;  5T1I A;  3D0F A;  1HZB A;  2EYP A;  3EBE A;  1OXV A;  4JYA H;  2UU9 L;  1ENF A;  2HVQ A;  4HJ8 A;  3A5Z B;  4APM A;  1VMC A;  4PNY A;  4RAZ A;  2Z4I A;  4DAV A;  2A1A A;  1QVG A;  1B4O A;  4ED0 A;  1IL2 A;  4DR6 Q;  5F9N A;  4HIK A;  4B3S L;  2KEC A;  1CHP D;  3LWB A;  2EJG C;  1FR3 A;  3G48 A;  1BVS A;  1GUS A;  2JA7 B;  3RZD H;  3GLK A;  3C0F B;  2QDB A;  2SDF A;  1OWT A;  4RB2 C;  2KHS A;  3BYY B;  2C22 A;  3DUZ A;  4HSP A;  4LF8 H;  4DV7 H;  5EPL A;  1SFO B;  4KHZ A;  3L9A X;  1JB3 A;  1GGO A;  4XQN A;  3M9M B;  1KD1 C;  1NTG A;  2VQF L;  2R7F A;  2RA4 A;  4P2C B;  1QG7 A;  2NN6 I;  3VPC A;  1SBB B;  3R2T A;  4XQJ A;  2RBM A;  2JA5 B;  1FGU A;  1L0Y B;  1HQM C;  3KF6 B;  2AQ2 B;  3MXG A;  1P16 A;  3OSN A;  1EQR A;  2IT1 A;  4AYB E;  4GOP C;  3CCS A;  1N48 A;  1E3P A;  1V8Q A;  2ZM6 H;  3RD4 A;  2W9B A;  1IBM H;  3MHB A;  4P74 A;  1RDP D;  4YY3 L;  2IPK D;  2JEF A;  1HUN A;  2XD4 A;  4LFA H;  4RGO S;  1KQS A;  3S24 A;  3JAM L;  5LMN H;  1F2M A;  1EU4 A;  3X3M A;  3IG0 A;  4AIM A;  2V9W A;  3NE5 B;  1J6Q A;  1DYQ A;  1VQ5 A;  4JI5 Q;  1I94 H;  3STB D;  5DGB A;  2YU9 B;  1SE2 A;  2B2U C;  2B8G A;  4IPH A;  5M5X B;  4FS1 A;  1VCI A;  3D6W A;  2HDL A;  1Z9F A;  1XPU A;  1LT5 D;  3V6J A;  1QNU A;  2L0C A;  5D8D A;  4K2L A;  4JI2 L;  3PMF A;  5AFW A;  1S0M A;  2IX3 A;  4ZCK A;  3CCM A;  2KED A;  4WJ3 M;  3A8I E;  3VR3 A;  3OIQ A;  3R5F A;  5I2Y A;  2F0W A;  1M0W A;  1NR2 A;  3Q6S A;  3SK4 A;  2L12 A;  4ID6 A;  4IFD I;  4DLK A;  5M3M H;  4JI8 Q;  4F50 A;  2E2I H;  2VR1 A;  4O0A A;  2V1C C;  1K0R A;  2V4D A;  1S9F A;  2Z6K A;  3HRZ C;  4APV A;  4OO1 I;  5EOY A;  2Q2U A;  2DWC A;  1H9S B;  4B3R H;  1HZ9 A;  2A68 C;  3NEL A;  3PIO A;  2O2L D;  4ZUJ A;  4LSX A;  5I4D A;  4FBU A;  4RCN A;  3NWT A;  2WTF A;  1IYU A;  1XNQ L;  1SLJ A;  2VY3 A;  4O4H F;  1N32 H;  2OXP A;  3MR5 A;  2UUB Q;  3CMA A;  1PH1 A;  4L1K A;  2XGQ A;  4KJO A;  1CKN A;  2EPB A;  4BY7 B;  4ZQI A;  1KC8 C;  3PUV A;  3KAK A;  3RB4 A;  4LF5 H;  4AYB G;  2UUC L;  4A3G G;  2ZXR A;  3U9S A;  3Q8P B;  2R92 B;  4I65 A;  3AMU A;  4B3M L;  2YYZ A;  3TS2 A;  2QYZ A;  5KT4 A;  4QWA A;  3J7Y W;  3A7A B;  1RL2 A;  2YRX A;  4DXG A;  2W6O A;  3I4M G;  2E74 C;  2C5C A;  2F52 A;  3R93 A;  2E2H B;  1RYR A;  5DLF A;  1HR0 Q;  4TV8 F;  4UP9 A;  1SYF A;  3NTH A;  3GTL H;  3UI2 A;  3KLS X;  2HDM A;  4FP5 D;  4X3T A;  1WVL A;  3NGD A;  4HMI A;  4ZYS A;  4CHT B;  4IWX A;  2KHI A;  4RAU C;  4R4O A;  4CGY B;  1PLF A;  2JP1 A;  4UY8 C;  1N33 L;  5BPF A;  4IUQ A;  1O75 A;  3TQT A;  3NPP A;  2PPB C;  4H44 C;  1RJT A;  1MZB A;  1TWA A;  4IQZ A;  5KT3 A;  2WFW A;  5CC4 A;  3FP9 A;  4A3J G;  1IBL L;  1II3 A;  4PWQ A;  1VQG A;  1O7I A;  3TDQ A;  3FMC A;  5CR3 A;  4A3G B;  2MJ8 A;  1HQR D;  3S1M H;  2AWO A;  2F0O A;  1DM0 B;  1AN8 A;  3TEH B;  3DF7 A;  4MA5 A;  5JJL A;  5LL6 S;  2F3W A;  4UAI A;  1B9M A;  4ZOL F;  1G29 1;  3NXW A;  1Z6H A;  3E0J A;  3EFX D;  1W2B A;  3RUZ A;  1SNC A;  1ZXT A;  1D7Q A;  4JV5 H;  1AW7 A;  2HIV A;  3T1H Q;  4PV1 C;  4BA2 I;  1UE7 A;  4YHH H;  4L5S A;  1WTW A;  5GAH C;  4DV3 L;  5CYU A;  2R92 H;  5L1L A;  2JA9 A;  4LSA A;  3ETJ A;  3F1Z A;  2PO4 A;  2X0S A;  3BAA A;  5KX5 F;  1PRT D;  2EOT A;  4M9U A;  2MP1 A;  1PK8 A;  1LTL A;  2H4O A;  2JA5 A;  4LFB H;  4O2A F;  5C5M A;  4A3I H;  2E2H H;  2ZM6 L;  4EQ5 A;  2KCC A;  4ECY A;  5EJW A;  2A6H D;  4JV5 L;  4R8U B;  2HUG A;  2IL8 A;  5FLM H;  1F9S A;  2Z6B A;  4UCR A;  5FLX L;  3QB3 A;  2IA6 A;  4K0K L;  1SSO A;  2CZG A;  1JIH A;  2FK3 A;  2TSS A;  1H9M A;  4C3J B;  2HCC A;  4X66 L;  4FO2 A;  3D8G A;  1JOO A;  3GV8 B;  5C4J H;  5DQI A;  2NN6 H;  2NU9 B;  3PZP A;  4LFC Q;  2X69 A;  1WTO A;  1K0S A;  5C8Y F;  1L1O C;  4DV7 L;  4Q8E A;  3KHG A;  2F0T A;  2VL6 A;  3EA6 A;  1IBK L;  2G9H D;  4J1M A;  1VQO A;  4J9P A;  1IBL Q;  1M8A A;  3A56 A;  3FDT A;  1KJI A;  1B50 A;  4GN5 A;  2ASJ A;  4P75 A;  2CVR A;  5KFV A;  2EY2 A;  1TWF A;  1U0L A;  5M3F G;  3BG5 A;  5C3E H;  3RV4 A;  1O7Z A;  4BBR G;  3ICE A;  5KFN A;  1PXU A;  5HBR B;  1HNZ H;  1BXR A;  1D1I A;  3RGX A;  1GD7 A;  1O7L A;  2RDH A;  4C2M H;  4J15 A;  2BE5 C;  1TY0 A;  4B9X A;  3V4Z A;  2K5Q A;  4MNO A;  1S5E D;  2VXW A;  1WTP A;  1KAW A;  1WR2 A;  1KDC A;  4EFB A;  2W8K A;  5M3F B;  2HHH H;  4J0M A;  3FKI A;  1HTP A;  4DUZ H;  2YU9 H;  4IUN A;  3FDS A;  3MXN A;  1PMR A;  1H9J A;  3EN2 A;  4HNU A;  1ZYR C;  1OXX K;  4JBW A;  4RHR A;  5EGT A;  3SDZ A;  2I87 A;  1SNP A;  4B3M Q;  4CKB A;  2MCT A;  1A3T A;  2F0V A;  3IN5 A;  4NXN H;  4DV6 H;  5C0X G;  1A62 A;  2IJ0 A;  5DG8 A;  3GP7 A;  3CCU A;  1STA A;  1GSH A;  4RB3 C;  4DV2 H;  5ELN A;  3MZ5 A;  2VUM H;  5CV8 A;  1L2F A;  1XJV A;  5FLX c;  5E4W C;  1WJJ A;  2W8L A;  3RAQ A;  4M7E A;  1PH2 A;  4LF9 H;  1PV4 A;  3PQI A;  4DF7 A;  2BR0 A;  3QZ8 A;  2BCO A;  2E76 C;  1B7Y B;  3BVM A;  4JI5 L;  4R8I A;  1RYS A;  2VUM B;  3RF2 A;  3T5K A;  3DWA A;  2JN4 A;  4DR4 Q;  1EYZ A;  3KHL A;  3BDL A;  3H0G H;  5DM7 3;  4AQY H;  2R7M A;  3OSP A;  1SFO H;  1IKL A;  1C0A A;  3ER0 A;  2UUA H;  5BN5 A;  4A3F G;  5IYB H;  4LNQ A;  4C3H G;  1K28 A;  2A5H A;  2L9H A;  3OTO L;  3S1R H;  4WD3 A;  1QNK A;  5C6A A;  1WD1 A;  5KFK A;  4LF8 Q;  3U4Z A;  2OEO A;  1JE5 A;  2VUM A;  2FPP B;  2K7V A;  2HGS A;  1CT1 D;  1C4Q A;  1N9W A;  2ALY B;  3BDC A;  1GLV A;  1WI5 A;  3M4O H;  1TWF B;  4QIW A;  5DQH A;  2Y0S B;  2XWJ B;  3T56 B;  5A2Q L;  1TWG A;  3S16 B;  2ZTC A;  1V43 A;  3VYU A;  1WYD A;  1MSH A;  3PN1 A;  4EGQ A;  1YNX A;  2QCP X;  4X65 H;  4DV4 L;  3HOZ B;  1DCZ A;  5L1J A;  1K8M A;  2HQL A;  4J9O A;  2CHB D;  4JI0 L;  1Z2P X;  2YZG A;  3GTG A;  2KQ3 A;  3DXJ C;  4L5R C;  1WCM A;  3VR2 A;  3A8K E;  4X6A H;  4OX9 L;  4LF7 H;  4QCL A;  4J9L A;  3M7N A;  1L1O B;  1I94 L;  2P0A A;  1G51 A;  1VQJ A;  2XNA C;  4JUZ A;  1VQN A;  2VQE H;  1S0O A;  2K5H A;  1STH A;  1IYJ B;  5I9O A;  1SAP A;  4HCS A;  5JVH 3;  1GUT A;  4ED8 A;  4QIW B;  5C0X I;  4YJ3 F;  4L5T A;  3PUX A;  3WNZ A;  4R4Q A;  3PIP 3;  3AYH B;  2Z9H A;  5IIF A;  4JBM A;  5KT5 A;  2HHH L;  4KJN A;  1R9T A;  1CI3 M;  1L0W A;  1MBY A;  3GO5 A;  2UXB H;  1NNX A;  1UNN C;  4RA8 A;  3PW0 A;  4QJF A;  1R4P B;  2YL2 A;  1U5K A;  1FJG H;  4HCE A;  4YCV A;  4Q43 A;  1Y1V B;  4POF A;  1GYF A;  2B2V A;  3PR4 A;  1GSO A;  2ASB A;  1PFN A;  3SK6 A;  1VS0 A;  1CM9 A;  1PH5 A;  2YS7 A;  3GTP A;  3I12 A;  5EAY A;  4N9T A;  1WOC A;  5ELO A;  4B9W A;  2I5L X;  2V59 A;  4GLV B;  4ECT A;  1HJP A;  4ECR A;  1BO0 A;  1EY5 A;  1X3G A;  2KCN A;  5IWA Q;  5C3E B;  3GTM H;  3S1N H;  1U4P A;  2CKZ B;  2OT2 A;  1K83 A;  4GLX A;  2K6A A;  5KFY A;  2EYH A;  3FVQ A;  3PGZ A;  5BN4 A;  4GOP B;  4YWL A;  1JDE A;  1GSA A;  4I7H A;  3I73 A;  4ZHQ F;  4A2A A;  4O1N A;  4FF2 A;  2Q8T A;  2DJF C;  1SRO A;  1X32 A;  1X54 A;  2ZJQ A;  5KFB A;  4X64 H;  1D6E C;  3HOX H;  1ASZ A;  2SEB D;  5EKL A;  2RDI A;  3KXY T;  1PZK D;  1GUN A;  5K5P A;  5C4J B;  2UU9 H;  1HNX H;  4A3M G;  3PO2 B;  1CA5 A;  3GTJ B;  4ZKC B;  1SEI A;  1TT2 A;  3N44 B;  3JAM E;  2RDJ A;  4C5B A;  5L1K A;  4BY1 H;  2R6F A;  4A3L H;  3GTQ H;  1PRT F;  1EYG A;  3RV3 A;  4E4T A;  3D4W A;  1AEX A;  1PZJ D;  1VQH A;  2A6H C;  1NY4 A;  2FLL A;  4Y7N H;  4BA1 I;  3SGI A;  4X65 Q;  1EEF D;  5CAE B;  1KNA A;  2I5H A;  5KFD A;  1A2U A;  3H15 A;  4WBN F;  4JOI C;  5CV7 A;  2V4Q A;  1RIP A;  3BDO A;  3BA8 A;  5JVG 3;  3K59 A;  1Y1W G;  2JEG A;  2KJX A;  3C1E A;  4Y7N B;  4B3S H;  1ZKO A;  1GHJ A;  2KHJ A;  3GV7 B;  3G71 A;  4MA0 A;  3SE0 A;  2HT1 A;  2F3V A;  3OIP A;  2F0I A;  4XT1 B;  3BS1 A;  2M05 A;  2B63 A;  3HKS A;  4DAM A;  1DOL A;  3W1G A;  5IGF A;  2R8I A;  4JBJ A;  2NU8 B;  3K0X A;  3PW7 A;  3G6Y A;  2PVP A;  4RMF A;  4UCV A;  5KFH A;  2YYA A;  1Q82 C;  2H1E A;  3A0J A;  2UUA Q;  4LMQ D;  3IAY A;  4G7Z C;  1KLU D;  1A6X A;  3S17 B;  2ZTD A;  4A93 G;  1I50 B;  2B8F A;  1BR9 A;  2PQA A;  4OL7 A;  1PVO A;  3IFT A;  4DV0 L;  4DN4 M;  2AKW B;  4JK1 C;  4HN7 A;  4PZ7 A;  1YVC A;  1KJ8 A;  2JEA I;  2XWB B;  4QY7 A;  5EKI A;  3WO0 A;  1KJQ A;  4X62 L;  4X3S A;  2UUB L;  4XYQ A;  1ENC A;  3T5H A;  2QW7 A;  4UPA A;  1ROD A;  3K8A A;  1WD0 A;  3BQ1 A;  2R92 G;  1SMY D;  3Q8D A;  2R93 A;  2R7D A;  3VR6 A;  3HOX B;  3ITP A;  2HVR A;  1PYB A;  4RFB A;  3IL8 A;  3K57 A;  5CV5 A;  4TQR A;  2VOB A;  2WAC A;  1S3O A;  2CQO A;  2F03 A;  2W6N A;  3HZX A;  3I4M H;  1YIT A;  5KT6 A;  2CWA A;  5JUM A;  4BBR H;  1VQI A;  2W6Q A;  1KTK A;  3W3A A;  3KYH C;  4CJ0 B;  1EU3 A;  1Z2O X;  4C3H H;  1KHI A;  3Q2O A;  1J5E L;  3KUP A;  1E7Z A;  1HNW Q;  1HXY D;  1B33 N;  2NVX H;  4GNX A;  4A3J H;  4HAE A;  4JC0 A;  1RD9 D;  1NBW A;  1TXY A;  3X3N A;  2F4V H;  1EIG A;  3S1Q B;  1F2Z A;  5KFQ A;  3F2D A;  5JJZ A;  1QIL A;  1SNO A;  1F9Q A;  5GAE C;  4QGU A;  2C00 A;  2CWP A;  2R7N A;  2ZJR A;  1TWH H;  1PH8 A;  5JQW A;  5CBA E;  1AUV A;  2EY5 A;  1QJO A;  3D31 A;  4PG3 A;  3T1Y H;  1B6S A;  1YNN C;  3PUW A;  2R82 A;  3CCE A;  2WE6 A;  4O3N A;  3S16 H;  4RZR A;  4YWM A;  4B3M H;  2G9D A;  1VAJ A;  5IWA H;  5KNC A;  3GTO B;  4RU9 A;  4IRC A;  4MV9 A;  1GJX A;  4K5V A;  5EKK A;  2ICI A;  1WCM B;  3EJI A;  2JA5 G;  4DV6 Q;  2PCF B;  4TUY F;  3MC0 B;  3CC2 A;  5ELB A;  4J9Q A;  1B3A A;  5IT9 c;  3GTK A;  1I6V C;  3KHH A;  2WB1 G;  2XN9 C;  4HED A;  4IUP A;  1IW7 D;  1I50 A;  5CB4 F;  1VQD A;  2MNA A;  5KFS A;  4ECZ A;  2IMW P;  1SJE D;  3NEN A;  3HOV B;  1A63 A;  1BUV T;  1LTR D;  3GQB A;  5IE8 A;  4LF9 L;  3OMC A;  3M9O B;  4H0L C;  3RFC A;  5M3F H;  1VF7 A;  3PR5 B;  2EQS A;  4DNI A;  3ERO A;  1FKA H;  2EZV A;  3NTI A;  3S9W A;  4C2M A;  4S3S A;  3NBH B;  2DN8 A;  4WJ4 A;  2RCN A;  2LMC B;  5IY0 A;  1J5E Q;  3MWY W;  3BVG A;  1RHP A;  3J7A 5;  3H3V H;  5KGU A;  1ILQ A;  1UAP A;  4JVZ A;  4MV8 A;  4RKB A;  1T3N A;  2VS1 A;  3WDN A;  4RNM A;  1QE6 A;  3HOW H;  3VR4 A;  3J81 E;  4OHJ A;  2OLS A;  3BYT B;  3R5X A;  3RZD B;  4PZ8 A;  3TN2 A;  3UE0 A;  4C3I G;  1M0T A;  3OYY A;  2VPQ A;  3I8Z A;  3NWS A;  3Q8S B;  2KVM A;  1JB7 A;  1A0I A;  2EYF A;  1XTD A;  2SNS A;  5IGE A;  3MJF A;  1NR4 A;  1X3Q A;  1QZG A;  4KHP L;  3N43 B;  3E6Z X;  1FGB D;  3KDF B;  4R8N A;  1SE8 A;  5GRO A;  4C2M B;  4QWB A;  4M8A A;  1SYE A;  3KF6 A;  5I6Y A;  1CQI B;  3WO1 A;  1RJR A;  5KFT A;  1A8V A;  3TZU A;  4O3P A;  3I4M B;  4MV1 A;  1VQ7 A;  1PYW D;  4YR0 A;  1K3B C;  5GAG C;  4AYB A;  3J80 c;  1TA8 A;  3TS0 A;  1PH6 A;  2F0D A;  4QW8 A;  1E24 A;  4CJ2 C;  3ND9 A;  4OEM B;  4ZQ3 A;  5JPN C;  3RUP A;  1QUQ A;  2FLN A;  2ATL A;  1C3O A;  1X9N A;  3M3Y B;  5KFE A;  4RUA A;  3SEB A;  3ZJY C;  4DNT B;  4XDX A;  2K28 A;  3O13 A;  4G7O C;  4IWY A;  2B2Y C;  3K7U C;  4FXD A;  1ICF B;  4A3E H;  3ULJ A;  4EQP A;  2FE3 A;  4ECV A;  4GN4 B;  1JCK B;  4DV3 H;  4DK1 A;  1XNR Q;  3S1M B;  2W6Z A;  3HKZ A;  1MI2 A;  4XQQ A;  1TWC A;  1EIY B;  4DV5 H;  3LWU A;  3STB C;  2JA6 G;  3MXU A;  2JQO A;  4ZLT F;  1X55 A;  4DR4 L;  3S2H H;  1TWH A;  4ME3 A;  2PMZ E;  3EIV A;  3K5H A;  5DEH A;  5F2D A;  3PF5 A;  3GIP A;  2YTX A;  4LF6 Q;  1RK6 A;  1S72 A;  2NVY A;  3LGJ A;  2K32 A;  4YY3 H;  4BBR B;  3I91 A;  1BF4 A;  1WH2 A;  3NBH A;  3LP8 A;  3TRZ A;  1JT8 A;  1XMQ H;  2MGS A;  1XWE A;  3ULP A;  4B3T L;  5IOC A;  2PYK A;  5C4X G;  3M4I A;  5LMN Q;  2A8V A;  1JIC A;  2K5N A;  3TRE A;  1ZHQ A;  3TZD A;  2ICE C;  3MFI A;  2C9O A;  3GTK H;  2LXJ A;  4ODG A;  2R7L A;  2PI2 E;  1T9H A;  1TS2 A;  3PUY A;  4GKJ L;  5TSS A;  1ZEQ X;  1JLL B;  2UUC H;  3CCL A;  5C44 G;  2YZM A;  3HGB A;  5LL6 X;  5EBD A;  1I4G A;  4C56 C;  1Y8O B;  2J6U A;  4KKU A;  4YHH L;  3T16 A;  1VQB A;  1EYC A;  3MWE A;  3H91 A;  1I5F A;  3FRP B;  2BH2 A;  5A35 A;  3M4Y A;  2OCE A;  4TRD A;  3URY A;  3TP5 A;  4DAY B;  4CKE A;  1Y14 B;  5M5W H;  3DLL A;  3KF8 B;  5ELF A;  1QVC A;  5LMN W;  1PTO D;  2K04 A;  2E75 C;  2LXK A;  5IGC A;  2EYM A;  4IPG A;  1QVF A;  2WAQ G;  2F0L A;  3QIA A;  4ZI7 F;  3VR5 A;  3U58 A;  1DGS A;  1I3Q A;  2HCI A;  4A3E B;  3J80 i;  3DWQ A;  3QWN A;  1Q86 C;  4MV4 A;  4LF5 L;  4POG A;  2JK8 A;  4HQ6 A;  2F0K A;  2D9U A;  4LF5 Q;  4J9K A;  1SXT A;  4JV2 A;  2CQY A;  2UU9 Q;  1PFB A;  5IYD G;  2F0J A;  5JVL A;  4KI0 A;  1IBK Q;  2B63 H;  4KHP H;  2W6P A;  2O4X A;  1I4Q A;  3S14 H;  3MA2 B;  4A3C H;  1G2T A;  1RF2 D;  1JKJ B;  2EE1 A;  3TP8 A;  5IYC G;  1EY9 A;  5LMN L;  5C44 H;  3CAM A;  2G5D A;  5IT9 W;  5CA0 F;  1BBX C;  2AMC B;  4R4T A;  1TS3 A;  3HOV G;  1QZH A;  2A74 C;  2NZH A;  5IP9 H;  1WFQ A;  1V1P A;  3K80 C;  3HOY G;  1AH9 A;  1JXL A;  1EY6 A;  3QJY A;  4NXM Q;  3RBE A;  4O42 A;  4WJW A;  2F4I A;  5C4H A;  1C8C A;  1Q1E A;  1PFS A;  4LK1 C;  4IZ8 A;  4HJ9 A;  2J4X A;  3KJP A;  5FLX W;  4DNR B;  1GUG A;  4A3B H;  2Y0S E;  1MSG A;  2JYO A;  2MO1 A;  3Q8Q B;  1UEB A;  2B2W A;  1I94 Q;  2FLP A;  2NVY H;  4EGJ A;  4IO9 A;  4MAM A;  4DR2 H;  4IJL A;  2E5L Q;  1E4G T;  1RCV D;  1IOV A;  3JRW A;  2C2R A;  4F4Z A;  4OO1 H;  3OPO A;  4RWS C;  2UXD H;  3A55 A;  5HUR A;  1DOK A;  1NMG A;  4DK3 C;  2EJF C;  1V4Y A;  4BWS C;  4F8M A;  1AFP A;  3UFX B;  4IFD G;  4IAL A;  1WTH A;  2W9C B;  2GN5 A;  3OWF A;  2PQA B;  1EWC A;  2I46 A;  4MV3 A;  1XPO A;  4Q45 A;  3KHR A;  2ASD A;  1N36 H;  4LFA Q;  1XMO L;  4FM9 A;  3OSO A;  4LFA L;  5AJ3 L;  3VMM A;  1OO9 B;  4WOR A;  3GTP H;  5BR8 H;  1B70 B;  5CBE E;  2PI2 A;  2NYZ D;  4GNX C;  4LFB Q;  5C5L A;  2ENB A;  3GD7 A;  3KAJ A;  1HA6 A;  2JA6 A;  3E0E A;  2Y0S A;  2Q2T A;  3NQI A;  2XCP A;  3L4J A;  4A3K H;  4ED7 A;  4LF6 H;  1BDO A;  3CC7 A;  4X62 Q;  1STE A;  4J9N A;  5KKN B;  3CP0 A;  5DAU A;  1ET9 A;  3GTM A;  1MJE A;  3MFY A;  5ELD A;  1LAC A;  5KYI A;  4I55 F;  3HFZ B;  4DXF A;  4K8I A;  1XTC D;  3I7F A;  1JWM D;  1W3S A;  5K36 G;  4G3I A;  4TV9 F;  4CBV A;  1LTB D;  1RJP A;  2F0S A;  1DV1 A;  3I3C A;  4R4C A;  1M90 C;  1TR5 A;  2Z1C A;  2UUB H;  4HJ7 A;  1PX2 A;  3C3L A;  2R7Z H;  2I07 B;  4DA2 A;  5D1O B;  1TWA H;  1TWF H;  2E5L L;  2FK2 A;  4HIM A;  5IGD A;  4MN3 A;  1TS4 A;  5KFM A;  2JXM B;  1B3Q A;  3TQY A;  3N6X A;  1KBL A;  4JYA L;  4R4I A;  2RKS A;  4DUY H;  2EYL A;  3SR1 A;  2ZTE A;  4RUC A;  2UXB L;  2N55 A;  4HR7 A;  2V5A A;  2B2U A;  4RNN A;  5KFU A;  4EBE A;  2YZN A;  3P75 A;  2UXC Q;  1GUO A;  2W9C A;  1EEI D;  5C4Z A;  3NP8 A;  4ABN A;  5BMV F;  4TSS A;  4DR1 H;  2AGQ A;  3W2D A;  5L9X A;  1JOQ A;  1K1Q A;  3GQC A;  3ORQ A;  1RJQ A;  1SJH D;  3C2P A;  4YP3 A;  3RNU A;  2IWH A;  3MVV A;  3PW5 A;  3K0Y A;  4X3K A;  2NUC A;  3D4R A;  3R5H A;  1I6H B;  2BOS A;  5KND A;  4DV7 Q;  4KKT A;  2N49 A;  2GVA A;  4A3B B;  2WII B;  3FMA A;  1QUQ B;  2EXD A;  5KT7 A;  4JI6 H;  1HR0 W;  4KD3 A;  2ZXO A;  5T1G A;  1IW7 C;  3CCQ A;  4YWK A;  2PMZ B;  4DU9 A;  5GAD C;  3VA5 A;  4LH7 A;  4AYB B;  1STB A;  5C5J A;  3LNN A;  4J9M A;  4NW2 A;  4DAP A;  1E2V A;  4IUU A;  3H4B A;  1TY2 A;  3CXC A;  4JI0 H;  2ZDG A;  5KFF A;  2M2L A;  4DKA C;  1IZ6 A;  1EWH A;  1TII D;  4JW0 A;  4QMG A;  4JI1 H;  1WCM G;  3T1H L;  3H4D A;  4EFE A;  1VMP A;  3OW7 A;  5JEA J;  3S14 B;  4MIU A;  3BZC A;  4JI7 L;  1T36 A;  2E2H A;  2VNU D;  4ZKB B;  3GV6 A;  4N8X 1;  5A2Q E;  4JYA Q;  4AH6 A;  4K6L A;  4DV3 Q;  2JA8 G;  1H9K A;  1O78 A;  3AEV A;  4RCO A;  5DLQ E;  1ZHS A;  2MPM A;  4GKK L;  1VQM A;  4JI4 L;  2R84 A;  5ISR A;  1JOR A;  3K5N A;  1LV9 A;  1PTO F;  2L15 A;  3RIZ A;  2QDL A;  1O7Y A;  5KFP A;  4ME5 A;  2DY7 A;  5JJK A;  1NCV A;  1HR0 L;  5KRU A;  5A2Q W;  4FF3 A;  1YNJ D;  3J7A V;  4EBD A;  3EPG A;  2NVX A;  4DV1 Q;  4OXP A;  3U4V A;  4Q0Y A;  2NVY B;  1F2L A;  1A3V A;  1PA6 A;  1I6U A;  2ALZ A;  5FJ8 H;  1ILP A;  5KT2 A;  3L2P A;  1HNZ Q;  3KTM A;  4OIK A;  2VB3 X; 
#chains in the Genus database with same CATH homology
 2BA1 A;  2R92 G;  3BU2 A;  3Q8D A;  4DV6 L;  5LMU Q;  4BXX H;  2R7D A;  1CKO A;  4X66 Q;  4BBS G;  2N78 A;  3D0F A;  1HZB A;  1FVI A;  2A19 A;  1SRU A;  1BBW A;  1PYB A;  3EBE A;  1OXV A;  3OTO Q;  2UU9 L;  1H95 A;  2WP8 J;  2C35 B;  4DUZ Q;  4HJ8 A;  2I5M X;  3A5Z B;  4OWX B;  3I4O A;  3ULL A;  2YTY A;  1S3O A;  3GTJ H;  3HOU H;  1Z47 A;  2CQO A;  1JJC B;  2RF4 A;  1PH7 A;  2A1A A;  4DV0 Q;  1YIT A;  1QVG A;  4LF9 Q;  4JI5 Q;  1IL2 A;  1HH2 P;  3I4M H;  4DR6 Q;  4HIK A;  4B3S L;  2CWA A;  2DGY A;  4BBR H;  1VQI A;  3A5U A;  3K81 C;  4C3J H;  3PF4 A;  1CKM A;  4YCU A;  3G48 A;  1BVS A;  2YV5 A;  3RZD H;  2AWN A;  3KYH C;  3UDF A;  4C3H H;  1KHI A;  1J5E L;  3FHW A;  1E7Z A;  3FKI H;  1HNW Q;  2QGQ A;  2Z0S A;  2NVX H;  4GNX A;  4A3J H;  4JC0 A;  1N8R C;  2F3I A;  3UE1 A;  1NBW A;  1TXY A;  4KHZ A;  3S1Q H;  2UXC L;  3KDF A;  3F2D A;  5LMU L;  1G6P A;  5GAE C;  4QGU A;  2B3G A;  3G6E A;  2CWP A;  1KD1 C;  1N33 Q;  2ZJR A;  1NTG A;  1TWH H;  1PH8 A;  1Q46 A;  2B63 G;  2VQF L;  2R7F A;  4JI3 L;  3F2B A;  2NN6 I;  4KHP Q;  2EIF A;  1X3F A;  3D31 A;  3W5O A;  4PG3 A;  1FGU A;  3KF6 B;  1GM5 A;  1P16 A;  4P71 A;  1EQR A;  3PUW A;  2IT1 A;  4JOI A;  4AYB E;  3CCE A;  4GOP C;  3CCS A;  3M4Q A;  1YIJ A;  2I0Q A;  1E3P A;  1X6O A;  1XMQ L;  1B8A A;  3S16 H;  3KLW A;  2YTV A;  4P74 A;  4YY3 L;  4YWM A;  5H1S E;  2H5X A;  1PH4 A;  2OTJ A;  1KQS A;  3S24 A;  4DV5 L;  4X65 L;  4AIM A;  4BY7 G;  1L1O A;  1J6Q A;  3JC6 6;  1YI2 A;  1VQ5 A;  1SN8 A;  4DV6 Q;  3PSI A;  2JA5 G;  3STB D;  1AE3 A;  3RN2 A;  3CC2 A;  1V1Q A;  2JA7 G;  4IPH A;  5IT9 c;  1N36 Q;  2WB1 G;  1VCI A;  1OXU A;  4OWT B;  1XPU A;  1Z9F A;  4XIG S;  3VDY A;  2K14 A;  1UE6 A;  2VZA A;  4JI2 L;  1VQD A;  2MNA A;  1C9O A;  3CCM A;  4JI4 Q;  3KOJ A;  4WJ3 M;  3NEN A;  1A63 A;  3E9I A;  4LF9 L;  5IE8 A;  4IFD I;  4JI7 Q;  3CPW A;  1V9P A;  5M3M H;  4JI8 Q;  4NB3 A;  1BBU A;  5M3F H;  2E2I H;  4LF4 Q;  2EQS A;  4O0A A;  2V1C C;  1K0R A;  1IBM Q;  2D0O A;  2Q2I A;  2Z6K A;  4APV A;  4DNI A;  4OO1 I;  1Q81 C;  2Q2U A;  2VUM G;  2WAQ E;  1HZ9 A;  2K5V A;  4B3S Q;  3K7A H;  3NEL A;  3PIO A;  3NBH B;  2N8N A;  2BH8 A;  2DUD A;  4YY3 Q;  5IP7 G;  4WJ4 A;  2RCN A;  5GQO A;  5IY0 A;  1J5E Q;  1XNQ L;  1SLJ A;  3RN5 A;  1JMC A;  2VY3 A;  3J7A 5;  3H3V H;  4A3I G;  2UUB Q;  5JEA G;  3CMA A;  1PH1 A;  2ES2 A;  1CKN A;  2KEN A;  4NXN L;  4PZ6 A;  4JCV E;  3PUV A;  3J7Z C;  1KC8 C;  5IYD H;  4IOA A;  4YHH Q;  4AYB G;  2VS1 A;  5HGQ A;  2UUC L;  3HOW H;  5HY6 A;  4DV2 L;  4A3G G;  1P8L A;  1HZC A;  2R93 G;  4PZ8 A;  3UE0 A;  4DUZ L;  1OTC A;  2YYZ A;  4B3M L;  3TS2 A;  3OYY A;  4BY7 H;  3AFP A;  5BR8 L;  4XTC S;  2JEB I;  2JA6 H;  1RL2 A;  2ZM6 Q;  1A0I A;  2K52 A;  1XTD A;  3PV0 A;  5BR8 Q;  1JB7 A;  1QZG A;  3I4M G;  4KHP L;  3KDF B;  2F52 A;  3G4S A;  1SE8 A;  5GRO A;  3BJU A;  4JI8 L;  1YHA A;  4DR3 Q;  1NMF A;  1PH9 A;  1HR0 Q;  4UP9 A;  1FJG L;  3S2D H;  3GTL H;  1TWC H;  3KF6 A;  4OO1 G;  2K75 A;  1HNX Q;  1N32 L;  1GVP A;  1N32 Q;  2KHI A;  3BZK A;  3RLF A;  1VQL A;  4DV5 Q;  4IJH A;  1A8V A;  1K73 C;  3F2C A;  4A3K G;  4R4O A;  1VQ7 A;  1KXL A;  3W1B A;  1N33 L;  1KRT A;  4UY8 C;  2JE6 I;  4B3R L;  4DR2 L;  4RG1 A;  3CCJ A;  5GAG C;  4A3F H;  2E8G A;  1VQK A;  3PO3 G;  1E1O A;  1K8G A;  2ATW A;  1LUZ A;  3J80 c;  3M4P A;  2WFW A;  3TS0 A;  1PH6 A;  4A3D H;  2VQE L;  3FP9 A;  4A3J G;  1IBL L;  1E24 A;  2CFM A;  2IY5 B;  1VQG A;  1O7I A;  4LW1 A;  1QUQ A;  5IP7 H;  1X9N A;  3RZO H;  1VQ8 A;  1S40 A;  3M3Y H;  3S1M H;  3ZJY C;  2AWO A;  1KRS A;  3TEH B;  2OQK A;  4KLK A;  5IP9 G;  3B6Y A;  5C4X H;  5JJL A;  2Y0S G;  3GTO H;  1G29 1;  3K7U C;  4A3D G;  2ZJP A;  2JJQ A;  1W2B A;  4A3E H;  3ULJ A;  3T1Y L;  3PO3 H;  1E22 A;  4GN4 B;  1D7Q A;  1XNR Q;  2HIV A;  3T1H Q;  1EIY B;  1KIX A;  4BA2 I;  3STB C;  1UE7 A;  4OON A;  2JA6 G;  2JQO A;  4BXX G;  1X55 A;  4L5S A;  4DR4 L;  3S2H H;  4ME3 A;  5GAH C;  2PMZ E;  1YBY A;  3EIV A;  4DV3 L;  2R92 H;  1N34 L;  2JA9 A;  4IPD A;  2K4K A;  3PF5 A;  3F1Z A;  3HKZ G;  3HOW G;  2YTX A;  2MO0 A;  4LF6 Q;  3PIP A;  1S72 A;  2JA7 H;  2UUC Q;  5IWA L;  1LTL A;  3LGJ A;  2GVB A;  1I3Q H;  4B3T Q;  4MZ9 A;  4A3I H;  1SR3 A;  2E2H H;  3TRZ A;  2ZM6 L;  1JT8 A;  4EQ5 A;  3ULP A;  4B3T L;  1YZ6 A;  3H0G G;  2UUA L;  4JV5 L;  5C4X G;  3U50 C;  1M1K C;  5LMN Q;  5FLM H;  3CW2 C;  3UDG A;  2K5N A;  4LF4 L;  2A8V A;  3S15 H;  3J81 j;  3TRE A;  4AQY L;  1LM0 A;  3UDI A;  4K0K L;  3GTK H;  2LXJ A;  2WB1 E;  3RLO A;  2JA8 H;  1Q12 A;  2PI2 E;  4X66 L;  2HIX A;  1T9H A;  2RHS B;  3PUY A;  4GKJ L;  1NE3 A;  4JI2 Q;  3CCL A;  5C4J H;  4GS3 A;  5C44 G;  2NZO A;  3HOZ H;  4QIW E;  5IYC H;  3CF5 A;  4DV4 Q;  1WCM H;  3I4N H;  4LFC Q;  1L1O C;  4DV7 L;  4YHH L;  3GTG H;  2VL6 A;  1VQB A;  1IBK L;  1VQO A;  1I5F A;  1C7Y A;  2IHE A;  1IBL Q;  5M5W H;  2BH2 A;  2OCE A;  4DAY B;  5LMN W;  1K83 H;  1Y14 B;  3DLL A;  2MQH A;  3KF8 B;  1QVC A;  4GN5 A;  4A75 A;  3FKI G;  4P75 A;  2LXK A;  4IPG A;  3M85 A;  3AFQ A;  1U0L A;  2FXQ A;  1QVF A;  1YEZ A;  2WAQ G;  5C3E H;  5M3F G;  2JA5 H;  1UE5 A;  3KJO A;  4Y52 H;  4LF8 L;  5FLM G;  3U58 A;  1DGS A;  4BBR G;  3ICE A;  1MKH A;  4DUY Q;  3J80 i;  4HIO A;  2N3S A;  1GD7 A;  2R7Z G;  4MTN A;  1Q86 C;  4C2M H;  5AJ3 Q;  3HOU G;  4J15 A;  2Z6K C;  4LF5 L;  3J81 c;  1AE2 A;  1MIU A;  2JK8 A;  1X65 A;  4POG A;  1XMO Q;  2D0P A;  4MNO A;  1HNZ L;  1KAW A;  4JBK A;  4LF5 Q;  1PHJ A;  4ALP A;  1YHQ A;  4LFB L;  2YU9 H;  2UU9 Q;  5IYD G;  2VQE Q;  3EN2 A;  1NJI C;  1OXX K;  3PCO B;  4JBW A;  4KI0 A;  1IBK Q;  2B63 H;  2F4V Q;  2Q2H A;  4B3M Q;  1VQ4 A;  3S14 H;  4LF6 L;  3CME A;  1JJ2 A;  1CSQ A;  4A3C H;  1EUJ A;  2ID0 A;  3I55 A;  5C0X G;  1A62 A;  4HID A;  1CKN B;  5IYC G;  2CCZ A;  1BKB A;  5LMN L;  5C44 H;  3CCU A;  3CAM A;  4A3E G;  3CQZ H;  4JV5 Q;  2AMC B;  4R4T A;  2NVQ H;  3HKZ E;  5ELN A;  1QZH A;  2VUM H;  1XJV A;  1L2F A;  3OW2 A;  3HOV G;  1SMX A;  2NZH A;  5IP9 H;  5FLX c;  1WJJ A;  4P72 A;  4JI6 Q;  1E1T A;  1WFQ A;  3K80 C;  3HOY G;  1AH9 A;  1PH2 A;  3WWV A;  1EQQ A;  3CC4 A;  3I2Z A;  1XMQ Q;  1PV4 A;  4NXM Q;  3CD6 A;  2OWO A;  3NEM A;  4QL5 A;  1VQF A;  3IRB A;  1B7Y B;  1K3R A;  4JI5 L;  1Q1E A;  1JJG A;  1PFS A;  4DR4 Q;  3H0G H;  4HJ9 A;  3KJP A;  2AHO B;  4A3B H;  2MFI A;  1VQ9 A;  1UE1 A;  2Y0S E;  1SFO H;  1C0A A;  3ER0 A;  2MO1 A;  1YJW A;  4B3R Q;  1UEB A;  4A3F G;  4DV2 Q;  3ERS X;  1IXR A;  1MJC A;  1FL0 A;  5IYB H;  1I94 Q;  2KCM A;  4LNQ A;  2NVY H;  5E7N A;  4X64 Q;  4DR1 Q;  4IO9 A;  3OTO L;  5J3B A;  1KL9 A;  3S1R H;  4GKK Q;  4IJL A;  2E5L Q;  1IBM L;  4LF8 Q;  2NVT H;  3U4Z A;  1JE5 A;  1VQE A;  4NPS A;  2VQF Q;  1X3E A;  3S17 H;  1HZA A;  1N9W A;  1NMG A;  2ALY B;  2IHF A;  3E9H A;  4DK3 C;  4DR3 L;  4IFD G;  4QQB X;  1WI5 A;  4DR5 Q;  3M4O H;  2GN5 A;  4L5Q A;  2PQA B;  1VQC A;  1CUK A;  2UXD Q;  1HNX L;  2IX1 A;  1XPO A;  4LWC A;  2ZTC A;  4DV1 L;  1V43 A;  2IX0 A;  1WYD A;  4TQU S;  3CCR A;  1YNX A;  4DPG A;  4LFA Q;  4BY1 G;  1XMO L;  1HNW L;  4DV4 L;  4C3I H;  1I50 H;  4LFA L;  1CSP A;  5AJ3 L;  4A93 H;  2HQL A;  3GTP H;  4A3G H;  4JI0 L;  1B70 B;  4L5R C;  2PI2 A;  2OTL A;  4GNX C;  4X6A H;  4OX9 L;  4X64 L;  4DR1 L;  3PUZ A;  4A3M H;  4LFB Q;  2K50 A;  3M7N A;  4EX5 A;  1L1O B;  1X56 A;  1I94 L;  2RHQ B;  1G51 A;  3GD7 A;  1VQJ A;  3L7Z C;  4P73 A;  1VQN A;  3E0E A;  2Q2T A;  2K5H A;  1PH3 A;  3MEF A;  4A3K H;  1IYJ B;  1PYS B;  3JAM c;  2OQ0 A;  4X62 Q;  3CC7 A;  1N36 L;  1Q1B A;  5C0X I;  4L5T A;  4DR6 L;  3CP0 A;  3PUX A;  1D8L A;  1GKH A;  4R4Q A;  4O2D A;  3AYH B;  1MJE A;  1FJG Q;  4DR7 Q;  4A4I A;  4JBM A;  2HHH L;  4UP7 A;  3HFZ B;  1L0W A;  3UDX A;  4GN3 B;  3GO5 A;  3I7F A;  4GKJ Q;  2QEX A;  1W3S A;  4QJF A;  5K36 G;  4NXN Q;  1U5K A;  4YCV A;  2E2J H;  3A74 A;  4POF A;  4JI0 Q;  5IYB G;  4LF7 L;  1Y1V H;  3JAM i;  3J81 i;  4LUO A;  2ASB A;  4GNX B;  1OXT A;  2LSS A;  4R4C A;  1VS0 A;  1PH5 A;  4TVA B;  1M90 C;  4A3B G;  4JI1 Q;  4HJ7 A;  2R93 H;  2PNH A;  2F4V L;  2R7Z H;  4H02 A;  3AQQ A;  4HJA A;  1N34 Q;  5EAY A;  1TWA H;  1TWF H;  4OX9 Q;  5C0X J;  5ELO A;  1WOC A;  5FJ8 G;  2E5L L;  2I5L X;  3PO2 H;  4GLV B;  4HIM A;  4UP8 A;  1HJP A;  4IOC A;  3DM3 A;  4PMW A;  3TQY A;  1X3G A;  1EIF A;  5IWA Q;  3S1N H;  4R4I A;  3GTM H;  4JYA L;  2CKZ B;  2UXB Q;  3F8T A;  4GLX A;  2ZTE A;  2UXB L;  3PGZ A;  1VQP A;  3CCV A;  4GOP B;  4IFD J;  4YWL A;  1GO3 E;  2UXC Q;  1SRO A;  1X54 A;  4DK6 C;  4A76 A;  2ZJQ A;  3HOX H;  1ASZ A;  4A3C G;  4HJ5 A;  2HHH Q;  3HOZ G;  4NXM L;  4R1J A;  3RLN A;  5M3M G;  4A3M G;  2BA0 A;  3PO2 G;  2D62 A;  3RNU A;  2B29 A;  4JG2 A;  4LF7 Q;  5M5Y H;  4JI3 Q;  4DV7 Q;  1VQA A;  1Q7Y C;  5JJI A;  4JI1 L;  4BY1 H;  2N49 A;  2GVA A;  4A3L H;  1Y1W H;  3GTQ H;  4YCW A;  1EYG A;  3L0O A;  3RR5 A;  2XGT A;  1QUQ B;  2EXD A;  1YJ9 A;  1XPR A;  1VQH A;  1NY4 A;  1HR0 W;  1K9M C;  1OXS C;  4Y7N H;  4BA1 I;  3CPF A;  3SGI A;  4X65 Q;  1Q8K A;  3CCQ A;  1VQ6 A;  3GDE A;  1K8A C;  2UXD L;  4YWK A;  5GAD C;  5C3E G;  4DR5 L;  4OWW B;  2I5H A;  1YJN A;  3H15 A;  1EWI A;  4GOP A;  4JOI C;  1XNQ Q;  3KFU A;  1RIP A;  3T1Y Q;  1YHB A;  4DR7 L;  1Y1W G;  4A3L G;  3CXC A;  1R9T H;  2KHJ A;  1EOV A;  1Y1V G;  3G71 A;  4DKA C;  1IZ6 A;  1LYL A;  1ASY A;  2HT1 A;  3I4N G;  1WCM G;  4BBS H;  2NN6 G;  3T1H L;  2KCT A;  3HKS A;  2R6G A;  4DAM A;  5JEA J;  3W1G A;  2VW9 A;  4DR2 Q;  4JBJ A;  3BZC A;  3K0X A;  4JI7 L;  1I6H H;  3I56 A;  4RMF A;  2VNU D;  2KBN A;  4JYA Q;  4AH6 A;  4DV3 Q;  1Q82 C;  1EFW A;  2JA8 G;  4LUZ A;  3M9B A;  3A0J A;  5DLQ E;  3HOX G;  2UUA Q;  3AEV A;  1VQM A;  4JI4 L;  4GKK L;  2L15 A;  2ZTD A;  4A93 G;  4FDB A;  2PQA A;  1PVO A;  2QA4 A;  4DV0 L;  4AQY Q;  5JJK A;  4LUV A;  4GLA C;  2AKW B;  3HOY H;  1HR0 L;  4PZ7 A;  1UWV A;  1YVC A;  2JEA I;  3MXN B;  4QY7 A;  4OXP A;  3U4V A;  4DV1 Q;  4JI6 L;  3H3V I;  3HOV H;  4IPC A;  4X62 L;  2UUB L;  1PA6 A;  4DUY L;  5FJ8 H;  4UPA A;  1TWG H;  2XTI A;  3L2P A;  1HNZ Q;  3K8A A;  4K0K Q;  4LFC L;  1XNR L;  5M5X H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...