2RF4A

Crystal structure of the rna polymerase i subcomplex a14/43
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
192
structure length
174
Chain Sequence
KQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGVVLGYEGLKILDADPPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKNNIPVDWTFVHNDGNSLGHWVDSNGEPIDGKLRFTVRNVHTTGRVVSVDGTLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Functional architecture of RNA polymerase I.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords DNA-directed RNA polymerase I subunit RPA4
total genus 23
structure length 174
sequence length 192
chains with identical sequence C, E
ec nomenclature ec 2.7.7.6: DNA-directed RNA polymerase.
pdb deposition date 2007-09-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
A PF17875 RPA43_OB RPA43 OB domain in RNA Pol I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2rf4A02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2rf4A01
4UP9A 1PH1A 1E22A 3I4MG 4GKKQ 4LF9Q 3A5UA 4Y52H 4JI3L 4B3TQ 5JEAG 1P16A 3UE1A 2JE6I 2BA0A 1Q1BA 3PV0A 3PUVA 4JC0A 1PYSB 4YHHQ 5IYDH 1L1OC 2PQAB 2XGTA 4JYAL 2GN5A 1WCMH 3S17H 2EIFA 4RG1A 4QIWE 1HNXL 1Z9FA 2Z6KA 4AIMA 3BZKA 4LUZA 4C3IH 4FDBA 3STBD 1X9NA 1WOCA 1GKHA 2JQOA 2ZJPA 5IY0A 1E24A 2CFMA 4LF6Q 3H0GH 1XPRA 5ELOA 4LF9L 4X64Q 1TWGH 2HHHQ 4LF4Q 2GVAA 3PUXA 4GN4B 1KHIA 4BY1G 3VDYA 4RMFA 1YZ6A 2F4VL 1PH8A 1K0RA 1RL2A 1Z47A 3DM3A 1FGUA 4L5TA 4JI0L 1N34L 1XPUA 5GAGC 3RZDH 2UXCL 3F2CA 1V1QA 2ZJRA 3L7ZC 3RN2A 1QZHA 3UDGA 1E1TA 1V43A 2YTXA 3J7ZC 2KENA 1TXYA 2OQ0A 3F8TA 4GKJL 4DV3L 1O7IA 2ID0A 3EBEA 3KLWA 1K73C 5J3BA 4AQYQ 4HIOA 1U0LA 5LMNW 3T1YL 1GM5A 3CCEA 1X65A 3Q8DA 3CCQA 4DUYQ 2NVTH 2Q2HA 3AFQA 2R7DA 1X55A 3L0OA 1S72A 2K5VA 3CC2A 3M3YH 2UUAL 5IYBG 2NZOA 4R4CA 4NPSA 1X6OA 2E2IH 4R4TA 3CD6A 3HOVH 2OTJA 1MKHA 2UUCQ 1YITA 1EYGA 1IZ6A 2I0QA 3ZJYC 2OCEA 4ALPA 3OW2A 2E5LQ 1Q46A 3GTMH 1N32L 3T1YQ 2A19A 3HKZE 3ULLA 4TVAB 5C3EH 1B7YB 1J5EQ 2HQLA 5IP9H 3H3VI 5FLMG 3CC7A 5C44G 3CCLA 2PMZE 2B29A 3I56A 4A3DG 5C0XI 3HOXG 4JI4L 4LF7Q 4WJ4A 1A0IA 3K7UC 1PVOA 5GAHC 4DR1Q 4P75A 4A3FH 4HJ9A 3S16H 1CSPA 1C7YA 3E9IA 2LXKA 1VQ5A 2WAQG 4POGA 2HHHL 3L2PA 4LF4L 5GROA 5LMUQ 2HT1A 2FXQA 5JJLA 1HZ9A 2QA4A 3PO3H 4DV2Q 4JOIC 3CCVA 3CW2C 1LTLA 3AFPA 2Z0SA 2WFWA 4PZ7A 3I4MH 1BVSA 4A3FG 3EN2A 1CSQA 1P8LA 1CKNA 1SRUA 5IP7G 2RHSB 5E7NA 5M3FH 4ME3A 4LF7L 2CWAA 3T1HL 1K3RA 1Y1WH 1KRTA 5IP9G 4GOPA 2QGQA 2NVQH 4A3BG 2RCNA 4HJ8A 4DUZQ 3HOXH 2ES2A 4JI3Q 3HOZG 4DR4Q 3W1GA 1TWAH 4BBSG 1KD1C 3TEHB 1YHBA 1HH2P 4A3IG 5IP7H 5C3EG 4MZ9A 1VQGA 3PUZA 3E0EA 5GAEC 1I94L 5C4JH 3KF6B 2DUDA 3HFZB 1GO3E 2ALYB 3FP9A 2UU9L 3PO3G 2N49A 4UP8A 3TRZA 4BA1I 1IBKQ 4OWTB 2JA8H 1VS0A 2UUCL 3PF4A 3A5ZB 5IWAL 2Q2IA 4OWWB 4X65Q 4OX9L 4A3DH 2F4VQ 3CQZH 4DV1L 1Y1VG 3RLOA 5AJ3L 1N34Q 4Y7NH 4A3GH 2D0PA 4GNXA 2VQEQ 4JOIA 4IPGA 5M5XH 4JI8Q 2CCZA 4DV5Q 1SMXA 3MXNB 3PCOB 2D0OA 1W3SA 4BY7G 3KDFB 2KBNA 4JI5Q 2NN6G 4P72A 3BJUA 4X66L 3UDIA 2R92H 2ZTCA 1R9TH 3PF5A 3LGJA 1YVCA 3TQYA 1RIPA 1C9OA 3M85A 2UUBQ 4H02A 2MO1A 2PQAA 4YCVA 4A3LH 2ZTEA 3JAMc 4DV6L 4DR3Q 1KQSA 3GD7A 4JI6Q 1M90C 3S15H 4X62Q 1IYJB 4DV7L 2HIVA 4GOPB 1Q12A 5IE8A 1PH2A 1H95A 1CKOA 1NMFA 2JJQA 4K0KL 1VQ4A 1SR3A 1VQ8A 4EQ5A 3GTGH 1SROA 3J81i 1N32Q 4APVA 1TWFH 4DR5Q 1S3OA 1HZCA 2K75A 3G71A 2ZJQA 4POFA 2VUMG 1SN8A 1K8GA 1E7ZA 4LUVA 4A3CH 1QUQA 2JA5G 1EIFA 4PMWA 3OYYA 1YNXA 3KOJA 5C4XH 4DR7L 5JJKA 1L0WA 5C44H 4LFBQ 1VQFA 1EQRA 1YBYA 4XTCS 4A3KG 1IXRA 4A3BH 1UEBA 2VQFQ 4B3RQ 2UXBQ 1VQIA 3BZCA 4UPAA 4A3LG 4MTNA 1A62A 2F3IA 5M3FG 3PIPA 3I2ZA 4IPDA 4DV2L 1I6HH 2A1AA 4KHPQ 2RHQB 4IOAA 4A3JH 5K36G 2I5LX 1SE8A 1V9PA 4R4QA 2VW9A 3KDFA 3T1HQ 2E2HH 4JI7L 2PI2A 3CMAA 5IYBH 2N3SA 4DV5L 3D0FA 4OXPA 1PA6A 1HR0W 2F52A 1EWIA 4B3RL 2PNHA 4JI5L 4GOPC 1IBMQ 2JA6G 3J80c 4BBRG 3CCMA 2E5LL 3UE0A 3HOWH 4A75A 1VQKA 5IYCG 3EIVA 3KJOA 4BBSH 3U4VA 3CP0A 4DK6C 4DV6Q 4A93G 2AWNA 1HR0L 1FVIA 2PI2E 3KYHC 5LMNL 1PH4A 4R1JA 2JA8G 1A63A 3J81j 2K5HA 2YTVA 4R4IA 1IBKL 1KL9A 3S1MH 2C35B 1AE3A 1W2BA 1S40A 2L15A 3W5OA 1YEZA 4LF5Q 1VQDA 1L1OA 1KC8C 1HZBA 4B3TL 4J15A 4JBMA 5M5WH 3ER0A 4IOCA 1Q82C 3JC66 1VQMA 3H0GG 4GN3B 1HR0Q 1CKNB 5IYCH 2QEXA 2OTLA 4DV4Q 1X3FA 1VQOA 5GQOA 1B8AA 3K8AA 2CWPA 4NXMQ 4LF6L 4X66Q 1OTCA 4LF5L 2VQFL 1X56A 1L2FA 3M4PA 1HNZQ 2B63H 1A8VA 2V1CC 3KJPA 2NN6I 3RN5A 2K4KA 3RNUA 4A3GG 3HKZG 1Q86C 1B70B 3GTLH 5HGQA 4P71A 5M3MH 4DV4L 1J5EL 4JI1Q 2IX0A 4LFAQ 1YJNA 4YWLA 2IHEA 4GNXC 4JI4Q 1XMOQ 4C3JH 1DGSA 4JG2A 4B3ML 1EFWA 2YTYA 4DR2Q 4GKJQ 5IT9c 5C4XG 4L5QA 1VQJA 4PG3A 3M4OH 2N8NA 4DUYL 1WI5A 3AQQA 1N8RC 4UP7A 4GNXB 1JB7A 1EIYB 2Q2UA 2VUMH 3M9BA 4JBJA 3I4OA 2CKZB 4JBWA 2EQSA 1MJCA 2LXJA 4HJ5A 4LFCL 4DUZL 1PFSA 4MNOA 4HJAA 2JA7G 2JEAI 2UXBL 2K14A 1LYLA 4HIKA 2AWOA 3G48A 4KHPL 1UE7A 1XJVA 1NJIC 1YHQA 4O2DA 2YU9H 3HOUG 5DLQE 2UXCQ 4R4OA 3H3VH 1OXUA 3PIOA 4IFDJ 1PV4A 1UE6A 4A3JG 1Q1EA 1X3EA 3TREA 1G6PA 2CQOA 3M4QA 4LF8Q 1NY4A 1PYBA 5JJIA 4QL5A 4A76A 1ASZA 2K50A 3SGIA 4GLXA 3CMEA 1VQLA 3HOVG 2R6GA 1KAWA 3CCJA 4OX9Q 2VNUD 4XIGS 1IL2A 1G51A 3K81C 4JI2Q 3G4SA 3K80C 2DGYA 4KI0A 5LMNQ 2AMCB 3ERSX 3HOZH 1N9WA 4A4IA 1CUKA 4YWKA 3S2DH 5M5YH 3DLLA 2ASBA 1XMOL 2JA7H 1NMGA 1N36Q 1HZAA 4DAMA 2D62A 1IBLL 2EXDA 1ASYA 4QGUA 3S14H 2K52A 3U4ZA 3G6EA 1QZGA 1NE3A 2UXDL 4QY7A 1EQQA 4JI6L 1M1KC 1VQHA 4LUOA 1T9HA 4DR3L 4LNQA 2WB1E 1NTGA 3RLNA 4JV5L 4X62L 4A3KH 2AHOB 4DV0L 4DR1L 2E8GA 1EUJA 1I5FA 3CPFA 1OXXK 1TWHH 4GN5A 1XMQL 4OO1G 2I5MX 4YWMA 3J7A5 2NZHA 1IBML 3WWVA 1Y1WG 3PSIA 1IBLQ 1TWCH 3OTOQ 2MFIA 1VQ9A 4OONA 2VZAA 4X65L 5LMUL 3E9HA 2ZM6L 2LSSA 4BBRH 2B63G 1PH7A 4HJ7A 3U50C 1K9MC 4A3EH 4A3CG 2WB1G 1HJPA 1CKMA 1PHJA 1N33L 4A93H 2OQKA 1JE5A 2VQEL 3KF8B 1HNXQ 4LFAL 1X3GA 4DR7Q 4GLAC 3STBC 1JMCA 1C0AA 4P74A 1D8LA 5M3MG 2R7ZH 1VQAA 4PZ6A 1XMQQ 3S1RH 1Y14B 2YYZA 4X64L 5BR8Q 1Y1VH 1BBWA 1L1OB 3OTOL 4DKAC 1VQCA 5JEAJ 2BA1A 3CC4A 1JJCB 4JI0Q 3HOUH 3GO5A 3GTQH 4IJHA 5IYDG 2IT1A 4UY8C 2B3GA 2IHFA 4NXNL 4IJLA 3KF6A 1UWVA 2ZTDA 4DK3C 4JBKA 1U5KA 2HIXA 2WAQE 1VCIA 3W1BA 4AYBG 3NEMA 4C3HH 4DV0Q 4AH6A 4AQYL 4IFDG 4OWXB 1GD7A 4IPCA 4DV3Q 3RLFA 1MJEA 1VQBA 2N78A 4A3EG 3S2HH 4JCVE 3GTOH 4YCWA 3FKIG 4NXNQ 3S1QH 2UUAQ 4DPGA 1PH5A 4JI1L 1E1OA 4L5RC 2R7ZG 4P73A 1BKBA 3ULJA 2JK8A 4LWCA 3I4NH 3MEFA 3NELA 4X6AH 2A8VA 4YY3Q 4HIDA 1BBUA 3F2DA 3B6YA 3NBHB 1KIXA 1VQ6A 3JAMi 4A3IH 4JI2L 4BA2I 2ZM6Q 1MIUA 3K0XA 3F2BA 1X54A 1LUZA 4C2MH 3CCSA 1J6QA 4JI7Q 4DV7Q 1QVFA 2VS1A 2WP8J 2Y0SG 1WJJA 3GDEA 4LW1A 4L5SA 1D7QA 3CXCA 3K7AH 1N36L 1YHAA 3PUYA 2AKWB 1JT8A 1SFOH 1JJ2A 1OXVA 2Q2TA 2IY5B 1XPOA 1HNWL 5ELNA 1WYDA 3HOYH 4DR5L 2R92G 1QUQB 3GTPH 2OWOA 4JYAQ 1KRSA 1PH3A 2BH8A 2E2JH 3H15A 1WFQA 1UE5A 1FJGL 2YV5A 5HY6A 1XNRQ 1XNQL 4GS3A 1FL0A 4PZ8A 2XTIA 1VQPA 3PO2G 4LFBL 1K83H 5C0XG 4KLKA 4DR4L 4BXXH 5EAYA 3PGZA 3S24A 1YIJA 4OO1I 3D31A 1E3PA 2I5HA 2Z6KC 2KCMA 5C0XJ 1UE1A 5FLXc 3TS2A 1QVCA 3IRBA 2VY3A 4A3MG 3KFUA 1NBWA 4GLVB 4HIMA 4B3SQ 3HOYG 3J80i 2IX1A 2MNAA 2UU9Q 3S1NH 1PH6A 4DNIA 3CCRA 1XNQQ 2KHIA 4BXXG 4DR6L 2KCTA 1GVPA 3NENA 5BR8L 4NXML 4QJFA 4YY3L 4QQBX 2R93H 2ATWA 4NB3A 3I55A 1G291 4YHHL 4KHZA 3J81c 1OXSC 4TQUS 3CPWA 2UXDQ 1Q81C 1Q7YC 2MO0A 1QVGA 1VQ7A 2JA5H 1KXLA 3A0JA 5AJ3Q 5FJ8G 2VL6A 5GADC 3I7FA 4IPHA 3UDXA 1AE2A 4DR6Q 1SLJA 2Y0SE 4A3MH 1K8AC 3CAMA 1WCMG 4B3MQ 4AYBE 3GTKH 4LF8L 3TS0A 2BH2A 1OXTA 4DR2L 2NVXH 3BU2A 3AEVA 4EX5A 3PUWA 5H1SE 5FJ8H 3AYHB 2UUBL 2JA6H 3HKSA 5FLMH 1XTDA 3FHWA 3CCUA 3PO2H 4IFDI 4WJ3M 1EOVA 4IO9A 1FJGQ 2NVYH 4K0KQ 4BY1H 1YI2A 4DAYB 1LM0A 3M7NA 3GTJH 1VQEA 1XNRL 2JEBI 3RZOH 3ICEA 1Q8KA 4LFCQ 1I94Q 2R93G 1PH9A 4GKKL 3A74A 5IWAQ 1HNZL 4BY7H 3UDFA 2R7FA 1VQNA 1N33Q 4DV1Q 2K5NA 3FKIH 2MQHA 2RF4A 1YJ9A 2GVBA 4YCUA 1HNWQ 4JV5Q 2JA9A 1I3QH 3U58A 4B3SL 3I4NG 1AH9A 4O0AA 4JI8L 3CF5A 2H5XA 3F1ZA 3RR5A 1YJWA 3HOWG 3ULPA 2KHJA 1JJGA 1I50H
chains in the Genus database with same CATH superfamily
1STEA 1TWHB 5J2UF 4GKJH 4GKKQ 1D1IA 5H80A 1P16A 1EEID 1G8ZD 2BA0A 4A93B 4FP5D 2YU9A 5IYDH 1L1OC 2PQAB 2FMCA 1KDCA 3GILA 1WCMH 5KFWA 1STNA 4AIMA 1J9OA 5COYA 5D1OB 5C44B 1WOCA 2K5DA 2ZJPA 2FPIB 2K5WA 4LF6Q 3H0GH 4DL2A 3FEWX 1XNRH 3D4RA 2GVAA 3PUXA 5EPKA 4A3KB 1KHIA 4BY1G 1BGWA 1YZ6A 2F4VL 4MV3A 3I73A 1FGUA 4DGZA 1WTXA 1N34L 3LMLA 1HTPA 2VR1A 1KNEA 4A3FB 1DOLA 2KEDA 2KENA 3U9TA 4X3UA 3R23A 3I70A 3F8TA 4DAVA 1ET9A 1E2VA 2QEJC 4GKJL 3EBEA 2IY5B 1GM5A 2MPMA 3Q1KA 2O4XA 3GTQH 5LMNW 2AUJD 1X65A 3CCQA 5I2XA 4DUYQ 4BBRB 4IAJA 4LH6A 4XX0B 1X55A 1PFBA 4ZKBB 3CC2A 3M3YH 2CW8A 1RD9D 2NZOA 2VA3A 3RZOB 4MTDA 1YNNC 3P75A 4OIJA 1L0YB 4GKKH 3N42B 4JW0A 2W9CB 1IZ6A 4QF4A 4WJWA 4DR6H 4ME5A 4FF3A 4ID6A 2E5LQ 4ECRA 2IA6A 3DM1A 4EGJA 4ZHQF 2F3VA 3HKZE 3ULLA 4R7RA 1CS0A 1B7YB 4HCSA 4HMIA 1PTOC 3H3VI 5AFWA 1H9MA 3BA9A 2B29A 4O1NA 3WOEA 5C0XI 1WD1A 1N34H 2UXCH 3T53B 2HHHH 4A3FH 1R4QB 4P75A 4CKCA 4HJ9A 1CSPA 1VQ5A 4KD3A 5GROA 2IX3A 3SK6A 2FXQA 5GONF 3M4OB 5JVLA 3PO3H 4DA2A 3PW5A 3DXJC 2FP4B 3CCVA 2DNCA 3CW2C 1I4HA 3AFPA 2WFWA 4PZ7A 1ILPA 1BVSA 2SDFA 3EN2A 1CSQA 1QNUA 2PMZA 5IP7G 4EG0A 5M3FH 4ME3A 2F0GA 2CWAA 3NK9A 4LF7L 2KA7A 3Q6SA 4CDDC 1CK1A 3KBXA 1Y1WH 3JRWA 3MR5A 4GOPA 1IYVA 3I4NB 4A3BG 4HJ8A 2ES2A 4QUCA 3VYRA 3TEHB 3OWEB 1N32H 3PN1A 4MZ9A 3E0EA 4DV7H 1SFOB 3RIZA 2DUDA 1GO3E 2UU9L 1SEIA 1ILQA 1IBKQ 4LF5H 1GSAA 4OO1H 1E4EB 3BQ1A 1JOKA 5CV4A 3SE0A 2UUCL 3ONAB 2Q2IA 5IGGA 4OX9L 4DV1L 2KEEA 3N52A 3VA7A 2RVLA 1N34Q 2W9AA 5E4WC 3GQCA 4IPGA 5M5XH 4JI8Q 2W71A 4P2CB 1GXDC 3GV8B 1W3SA 1YNJC 4C5AA 2KBNA 1Y1WB 2NN6G 2F0IA 4RNMA 3UDIA 2ZTCA 1R9TH 3LGJA 4EBCA 3VR6A 1RIPA 4A3LH 2MO1A 2JA6A 3TP6A 4DR3Q 3MXUA 4IWXA 3GD7A 5EPJA 3OSNA 1Q12A 5IE8A 1B9NA 3A54A 4F50A 1VQ8A 5EBCA 4EQ5A 1I50B 5JPMC 2NVYA 3QZ8A 3Q2OA 1EY9A 3MFHA 1XDNA 5KG7A 3I4LA 1N32Q 3CRLC 4DR5Q 1SCUB 3VR2A 3G71A 4RNNA 1FGBD 4IRDA 1SN8A 1K8GA 1E7ZA 3BDCA 4A3CH 4UCSA 1IBKH 4PMWA 3OYYA 1YNXA 5C4XH 4DR7L 4N9TA 2R93A 2R7ZB 4WRDA 3KBGA 4A3KG 1I4GA 1C4QA 2VQFQ 4ECWA 1TS3A 2UXBQ 1VQIA 4RAYA 2F3IA 3PIPA 5KFMA 4QIWA 5FOBB 4S3SA 4DXGA 1IOWA 1BNCA 1LT3D 2K1BA 2L5TA 4R4QA 3DF7A 3F8NA 5KFUA 3KDFA 3T1HQ 4JI5H 1NR4A 5IWAH 3WNZA 1KC7A 3TQTA 4MA0A 1MSGA 3TZUA 2I87A 4OX9H 1DCZA 3U9SA 4C2MB 2R7KA 4DL4A 3DMUA 1VQKA 3GTPB 1QILA 3BYYB 5IYCG 3QOJA 4NP5A 2G9HD 3CP0A 1UNNC 3BDOA 2JA8G 3KYHC 2W57A 2IP4A 2K5HA 1IBKL 4UHVA 1I4QA 3UFXB 1VQDA 1KC8C 4B3TL 5CORA 4JBMA 3ERQA 5M5WH 1Q82C 3JC66 3H0GG 4RGNA 3EPIA 1CKNB 5G3LD 5IYCH 2QEXA 2D9UA 1EYCA 2OTLA 2R8GA 4O3NA 5GQOA 4MTKA 2UXBH 2B2TA 4LF5L 4RUCA 3Q8SB 5C5LA 3J81W 2X69A 3GIQA 1SYXB 4P71A 4DV4L 1SE4A 2WACA 1SE3A 4GNXC 2QILA 4JG2A 4B3ML 3PR4A 3R8BA 2YTYA 3VYUA 5DM73 4HN7A 4GKJQ 3OW7A 4FM9A 2ASLA 5C4XG 3M4OH 1VQJA 4HCEA 3J81L 2N8NA 1GOZA 3MFGA 1ICFB 1II3A 4GNXB 4WBNF 1EIYB 3M9BA 1E4FT 4JBJA 3MXNA 2CKZB 2J9GA 3MR2A 3H6MA 2LXJA 4HJ5A 1C48A 3D8GA 4DUZL 4HJAA 1HRJA 4DL7A 2K14A 4LF6H 2F0NA 4X64H 1UE7A 1XJVA 1NJIC 1WTPA 1YHQA 4H0LC 4MIUA 2YU9H 2GPWA 2W6MA 2V4QA 3DWQA 3V96A 2VUGA 4DXFA 3PIOA 2PN1A 3OOCA 3HOXB 4IFDJ 1KDAA 1UE6A 4A3JG 2CQOA 3SDZA 2VPQA 3V6HA 3K5HA 5KT5A 4QL5A 1ASZA 3R5XA 3HOVG 4I7ZC 1KAWA 1PYWD 2PW7A 2YYAA 1EFID 4YR3A 3G4SA 4KN4C 5C5MA 1KJIA 2DGYA 5FD6A 1EY7A 4DUYH 2E2DC 1QWYA 3R3OA 4F88A 1MHWC 2GPSA 2TSSA 1F2LA 1B44D 3N6RA 2FINB 3DLLA 2ASBA 1I7NA 5KFPA 2BCOA 3HRZC 2E76C 1NMGA 1N36Q 2ZDHA 5JJZA 2ZXRA 3NGDA 5CC4A 3D4DA 2L55A 2FPPB 3U4ZA 3G6EA 1QZGA 5KFHA 1GHJA 1EQQA 2UXDL 1OWTA 2RDIA 4ED0A 1EYAA 1VQHA 4LUOA 1T9HA 2WB1E 1NTGA 2J4XA 3KLSA 5E3FA 3SHLA 4X62L 2YZMA 2JA7A 2Z1CA 2B2YC 1MBYA 4GN5A 4R8IA 1T3NA 2NZHA 1IBLQ 1VQ9A 1Y1WG 3TBIB 4IUVA 5LMUL 2LSSA 1S5CD 1A2TA 1SSOA 4HJ7A 4A3EH 5DQGA 4A93H 4DNRB 2VQEL 3STBC 4LH7A 4P74A 3GTKB 1D8LA 5M3MG 2R7ZH 4EQPA 2YYZA 4X64L 5K2MA 4O2BF 1WD0A 1BBWA 3OTOL 4UFZA 1K28A 3SK4A 3K6OA 5JEAJ 1JJCB 1FNWA 1S4ZA 4IJHA 2IT1A 5IYDG 5BPHA 5M9OA 2EY5A 1DM0B 3QZ7A 2RQXA 4ZUIA 2ZTDA 4DK3C 5KX5F 2WAQE 4EFEA 4AH6A 4IFDG 4ZRZA 1E0BA 1KNAA 4CHTB 1B3QA 4UAIA 4L63B 2YS6A 3FKIG 3H40A 2WB1A 1E1OA 4ZKCB 3ULJA 2JK8A 4HR7A 2L9HA 3MEHA 1B6RA 2K7VA 1TVXA 4HIDA 1K1QA 1EHIA 4L1KA 3RV3A 2NU8B 3NBHB 3V6KA 4A3IH 1JR0D 2ZM6Q 4Q0YA 3HKZA 5KFZA 4JK1C 4JI2H 3GV7B 1X54A 4C2MH 2VS1A 2Y0SG 1WJJA 4LW1A 4L5SA 4RB2C 4O3PA 5L1LA 2W7OA 3K7AH 5IGBA 2F0DA 5KFVA 3IFDA 3R93A 2Q2TA 4RZQA 5IIFA 4KJNA 2YRXA 3NTIA 1GJXA 3M9NB 1WYDA 1MZBA 1XX8A 3WO0A 1KRSA 1TWGB 4DL5A 3A55A 5JVDF 1DYQA 1GUNA 2FK3A 3E0JA 5HY6A 4CDFC 4K5WA 1XNRQ 2XIGA 1J8IA 5FD5A 3PO2G 4LFBL 3VR4A 4C1NI 2QKIC 5C0XG 4BXXH 3MFIA 3PGZA 4QUFA 1JDEA 2Z6KC 5FPOA 5KG1A 1TR5A 1UE1A 5FLXc 1KBLA 4Y8VB 4A3MG 3GP7A 2AGQA 2MNAA 2C00A 1PFNA 1PH6A 2KHIA 4X62H 3NENA 5BR8L 1DOKA 5JPNC 1C30A 3T13A 4DU9A 3MWMA 3I55A 4ZQ3A 1KABA 1T36A 3J81c 4TQUS 5E4XA 2A6HD 1Q81C 2EDGA 2K6AA 2MO0A 2JA5H 1TWAA 3RD4A 4U673 3A0JA 4ED7A 2BE5D 1NAPA 5FJ8G 3I7FA 1AE2A 4IR1A 5KG4A 4AYBE 3GTKH 1STGA 4PMCA 3TS0A 3GTOB 1KJ9A 2R8HA 4FS2A 1VMCA 1X3QA 2CW7A 5JEAH 2E2JB 4YB8B 3S17B 2JA6H 1XTDA 4WJ3M 1H9RA 4HMJA 1XXGA 2OF1A 3SK8A 4QWDA 1MGSA 2K28A 4KKTA 2JYOA 3OSOA 2VPSA 2UUAH 1SYCA 2F0QA 3R5HA 2LFNA 4GKKL 3C46A 4BY7H 1JXLA 3UDFA 5F2DA 4CJ2C 1N33Q 4DV1Q 2K5NA 3PVXA 1HNZH 3D6CA 4QWEA 4K6LA 3CF5A 3RR5A 4LAAA 1CTMA 1X3PA 3GTGB 4Q0FA 2NYZD 5TSSA 3I4MG 4XYMB 2W7PA 4ECTA 4IRKA 3A5UA 4NW2A 1YNND 3RJ0A 1NR2A 3PV0A 1Z6HA 3K57A 4O3SA 5KKNB 2GN5A 3S17H 1BUVT 4U68A 1HNXL 4LUZA 4FDBA 3STBD 3RBDA 1BQQT 1X9NA 4CKEA 3RB6A 1NUCA 2JQOA 4XXEA 4J9LA 2RA4A 2CFMA 1XPRA 1BJTA 4LF9L 2HHHQ 3OMGA 4FF2A 2VXWA 4GN4B 5DEHA 3J7AV 5K36H 3VDYA 3G6JB 3PR5B 2ASDA 3NXWA 3N6XA 2HVSA 2W70A 5KT3A 3F2CA 2ZJRA 1CA6A 5C3XA 4B3SH 4HAEA 3UDGA 1CA5A 2L0CA 2WAQB 3HXLA 4DV3L 1O7IA 2ID0A 5CV6A 1I7LA 4AQYQ 1HNWH 1U0LA 2BQ3A 3ND8A 3N44B 3CCEA 3QJYA 4QW8A 1D5MC 1QB5D 3AFQA 2JEGA 1R9TB 3RV4A 4N9PA 5IYBG 2Y0SA 3OIQA 4NPSA 2R86A 1CE8A 4R4TA 3CD6A 2F0FA 1YITA 4PNYA 2ICIA 4ALPA 3GTMH 1EUDB 1LTID 5C4HA 1HUNA 3L4JA 1H9KA 2R61A 1D1KA 1Y1VB 1J5EQ 5IP9H 5DM63 4IFDH 3MA2B 3I56A 4LF7Q 2C28A 2DY8A 1SNQA 3S16H 3WOFA 4LF4H 4UCOA 2LXKA 1GUOA 4RGTA 1DV2A 2YZGA 5EZYF 4LF8H 2ZXOA 5CA0F 2VB3X 2QA4A 3OHAA 5EKLA 1VBGA 4JOIC 4CDCC 1EOTA 1RHPA 2Z0SA 3I4MH 4WD3A 1P8LA 2RHSB 3Q8PB 1K3RA 1SXTA 4ODGA 1S5BD 3LX0A 3R2TA 2QGQA 3KHRA 4JI3Q 4YQWA 2FK2A 4DR4Q 5D1PA 1YHBA 1WCMA 4KJOA 5IP7H 2A6ED 1VQGA 4G7HC 5C4JH 1QG7A 3HFZB 3KF6B 1S0NA 3PO3G 3G6YA 1Z2OX 2UUCH 5KT4A 1JQYD 4BA1I 1RJPA 4NLGA 2E2IB 4LSAA 1ZYRC 2JA8H 4ED6A 3A5ZB 5IWAL 2BDNA 4OWWB 1K1SA 2DN8A 3D4WA 2YW2A 2V4DA 5FKAC 3LWEA 1SAPA 4CGYB 5AJ3L 2HUGA 2EYOA 2MUYA 3X3MA 1EZ8A 1K0SA 3KDFB 3BZDB 4JI5Q 3T1HH 2BE5C 2W6QA 4X66L 2HDLA 2IW3A 2PQEA 3IL8A 1I6HB 2HVRA 4R8NA 3M85A 4B08A 2PQAA 2ZTEA 4DV6L 3A8JE 5KNCA 3BG5A 4Q8EA 1KLGD 2B2TC 1IYJB 4DV7L 1SMYC 1ESFA 3BA8A 4RUAA 1NMFA 3N43B 4HSPA 4B9WA 2AQ3B 3W2DA 3PW4A 2KCNA 3QB3A 3Q22A 5ELBA 1S68A 2PYKA 4XT3B 4DL3A 3K5LA 1TWFH 4BWSC 2NU9B 2K75A 1CFMA 1HZCA 4QWCA 5DG7A 2H4OA 4KY7A 1EIFA 5C1OA 3SK5A 3K5NA 2XSCA 5C44H 1S5DD 1VQFA 4XTCS 4LFBQ 1ENAA 1UEBA 5A35A 1RF2D 1GSOA 5FLXE 4A3LG 4MTNA 4NDXA 4Y7NB 3KHGA 2ZT9C 2RKSA 3I2ZA 3GTMB 1I6HH 1JOOA 3CQZB 4KHPQ 1V4YA 3FPUB 2XN9C 2FMMA 4IOAA 1N48A 4ZOLF 2WE6A 5K36G 2VW9A 2E2HH 4MTEA 1H9SA 2A74C 2PI2A 4KKSA 4DV5L 2XGPA 1HR0W 1EWIA 4JI7H 4B3RL 4JI5L 4IURA 3J80c 1AEXA 3CCMA 3GTLA 5IGEA 5C0XH 3KJOA 4BBSH 3S2HB 1DV1A 2F1MA 2EXZA 1HR0L 5LMNL 1PH4A 4MV7A 1A63A 4DV0H 5CA1F 1K83A 3ETJA 1N56A 5J22A 2DIKA 1ONLA 3V2TA 3S1MH 2C35B 2EYHA 2HQEA 3BYTB 1AE3A 2B2VA 2KHSA 3RUPA 3EQLC 2C2RA 2VUMA 1S03G 5KFGA 1ET6A 1L1OA 2LMCB 5BN5A 2XRSD 2PW5A 4IUUA 3VR3A 4UCRA 3H4DA 4CDEC 4IOCA 1TWFA 2BQUA 1VQMA 1Y8NB 2A73B 4QMGA 3FPPA 1UC9A 1VQOA 1F9PA 5HURA 5JVH3 4NXMQ 1B33N 2F0UA 2K5QA 3K3PA 1L2FA 4APMA 3AB9A 3RMHA 1Y69U 4MV8A 1A8VA 2NN6I 3HKZG 1Q86C 2F0WA 5HGQA 4N8X1 4DN4M 5M3MH 1B4OA 4JI4Q 1E4EA 5CBEE 1XMOQ 4C3JH 2VB2X 2XIWA 1CHPD 2W6ZA 5C3EB 4DR2Q 1W6JA 5KFJA 4B3MH 5D14A 1DJRD 3M7GA 5T1IA 4PG3A 3J80W 3RB0A 3GTQA 1TWCB 2XCLA 1WI5A 1N8RC 2VUMH 4KTAA 5CMDA 2F3WA 3I4OA 1Z2NX 3V05A 2E5LH 1MJCA 4K0KH 4MNOA 3TN2A 4Q45A 4RKLA 5I9PA 2EYPA 1G2TA 1M8AA 2KCCA 4LFCH 3FKIB 4JPBW 1B1ZA 1OO9B 2R85A 4EEYA 2AWOA 3OSPA 3WO1A 3VYTA 2JP1A 4KHPL 1RJRA 2K03A 4O2DA 5DLQE 1D2BA 3EPGA 1PZKD 1SNPA 1S9FA 4O3OA 1I50A 3MR3A 1JCKB 4H44C 2C5CA 5KIXA 1EQVA 5JJIA 2B2WC 1KJQA 4A76A 3SGIA 5CV8A 3CVZA 4RHRA 2ZM6H 2CVRA 3CCJA 4A3JB 2VNUD 1IL2A 1F2MA 4O4HF 1M6VA 1HCZA 3K81C 1F2YA 2AMCB 3ERSX 1N9WA 4YAJB 1RKNA 4ZI7F 4CC5A 2EYLA 4J9NA 4F4WA 3KTMA 4LMYA 4YWKA 3S2DH 4WORA 1V1PB 2QDLA 1Z7TA 5C4JB 4OEMB 2W9CA 1TA8A 2KOLA 1IBLL 4QW9A 2K52A 3NE5B 1NE3A 1FNUA 3G7LA 4M8AA 3KLRA 4JV5L 3DEOA 4DV0L 4DR1L 4CC6A 3CPFA 1EUJA 1EU3A 1PRTC 5EKIA 3SR1A 1O80A 3TP8A 2FLLA 4OO1G 4X65H 5LMUH 4E4TA 4C56C 1IBML 3WWVA 3PSIA 2MFIA 2VZAA 4X65L 1O7YA 3E9HA 5IT9L 4BBRH 4PWQA 2B63G 1JKJB 4YR2A 1PH7A 2DPIA 3U50C 2LY7A 3HS0C 4A3CG 1HJPA 1PHJA 4J9OA 4A3BB 2OQKA 4DR7Q 5DLGA 3KF8B 1R4PB 4LFAL 3HKZB 1F77A 1JMCA 2R8JA 4B9XA 4U7CA 1VQAA 4R8UB 1JB3A 5HV6A 1SNOA 1Y1VH 5DG8A 2OT2A 3GIIA 5KT6A 1MD2D 1B04A 1XWEA 2BA1A 4DR4H 3CC4A 2B2UA 1CQJB 2XD4A 3HOUH 3GO5A 2R92B 4UY8C 5L1KA 3TZDA 4NXNL 4IJLA 3SVMA 4I50F 2C2DA 1SFOA 2XC9A 3SE7A 1A3TA 1U5KA 4AYBG 2VOBA 2EOTA 5CAEB 3BQ2A 4OWXB 1GD7A 4IPCA 3C1EA 4DV3Q 4J9PA 1VQBA 3IKJA 3N41B 5LYJF 4A3EG 3S2HH 3GTOH 2E74C 2B63A 5CV5A 5KEEA 1VBHA 2UUAQ 4DPGA 5D8DA 1ZQ7A 4O3QA 5LP6F 3I4NH 4FS1A 4L6TB 4ZYSA 4X6AH 2WIIB 4YY3Q 3MAQA 1BBUA 4ECVA 4J9MA 1PRTD 5KYLA 5A2QL 4ED2A 1KIXA 4PQXA 1F9SA 1PTOD 4ZUJA 2NVXB 2TMPA 4HSVA 3RUZA 2IL8A 2PZTA 3K0XA 5JOBA 1XMQH 1TWAB 1J6QA 1QVFA 1EWCA 3TINA 4FBTA 3S9WA 4GC7A 1HFGA 4KD4A 2F0LA 2Z9HA 2RDFA 2AKWB 1JT8A 1GUSA 3TQ1A 5FPRA 2DPJA 4DR5L 1QUQB 1ZKOA 4IWYA 5IT9E 4JYAQ 2BH8A 1FJGL 2IPKD 1QE6A 3H0GA 2O2LD 5BN3A 4GS3A 4PZ8A 5D65A 1WVLA 2XTIA 2R7ZA 1IW7D 5EGTA 4JI8H 1JX4A 5KFDA 4DV3H 3KUPA 3K59A 2HJWA 3Q8QB 5HBRB 3S24A 3ULPA 4OO1I 4NXNH 2KCMA 3PO2B 1Q90A 2F0SA 1QVCA 1M0WA 2KSWA 1L0XB 3KFUA 1NBWA 4HIMA 1CI3M 3J80i 4DR3H 3GTJB 4YY3H 4DNIA 3CCRA 1UEAB 2KCTA 5DAUA 1AFPA 3M3YB 4QJFA 2EY1A 3RB3A 1RTNA 2J7ZA 1QJOA 3GTPA 1VQ7A 5AJ3Q 5A2QE 2W6PA 3J80E 1LTSD 1YNJD 5GADC 5D1OA 1TY2A 3JAMW 1BOSA 4DR6Q 4A3MH 3RZDB 2E2HA 1U4MA 2W8KA 3RTXA 1PK8A 2XNAC 1OXTA 2XRQD 3I12A 4JYAH 3PUWA 3FVQA 3MJFA 5EOYA 2A6EC 3F2UA 3CCUA 2LS01 3PO2H 3VPCA 4LF7H 2QCPX 4IO9A 1FJGQ 2NVYH 4BY1H 1YI2A 1D6EC 3GTKA 1LM0A 2R8IA 3GTJH 1VQEA 5FO9B 2JEFA 2R93G 5KFFA 1G6ZA 3JRXA 3A74A 5IWAQ 5M3FB 3MXPA 1HNZL 1RCVD 1E4GT 4JVZA 3KALA 5KFYA 3JAML 5IOCA 4YCUA 1HNWQ 1Q3LA 4IUPA 1STBA 2EZVA 4F4ZA 4O0AA 2H5XA 3F1ZA 5KNBA 1YJWA 4JI1H 2KHJA 2MGSA 4JI3H 1I3QB 1E22A 5L9XA 3NSWA 4LF9Q 4Y52H 4BS9A 4B3TQ 3UE1A 3MHBA 1Q1BA 4JC0A 3PUVA 1U9RA 4YHHQ 2AGPA 1GSHA 4K6DA 4ZLTF 5FLXW 1I6UA 5IODA 4JYAL 1K8OA 4RG1A 4QIWE 5J2TF 3V6JA 1CZWA 3BZKA 5BN4A 3A7AB 3S16B 2FLPA 4ME6A 2YS7A 4BY1B 4RCNA 3QG1A 5IY0A 3TP5A 4EGQA 4LF4Q 4J8QA 5M5XB 4TQRA 4HNVA 3K5OA 4FVMA 3ORQA 1RTOA 1PH8A 3KAJA 2V58A 1FD7D 4YAKB 1XPUA 2PO4A 4FNFA 4ULLA 2UXCL 1B6SA 4XYLB 3H94A 3L7ZC 1QZHA 1E1TA 1V43A 2YTXA 1D5XC 3J7ZC 1TXYA 4FF4A 1EY0A 3GV3A 2R7MA 1B50A 1K73C 1EIGA 5J3BA 4HIOA 3T1YL 1QNKA 3MXGA 3L0OA 3DEPA 2L11A 4R4CA 5CV9A 1X6OA 2E2IH 3TIGA 4C3HB 1PRTF 1GGOA 1SJED 1MKHA 3T16A 2UUCQ 1EYGA 4JV2A 2P0AA 2I0QA 2E2IA 1NCVA 5C4XB 4DLKA 1N32L 1LT5D 1Q46A 1LT6D 4I55F 1UNSA 3DUZA 1JORA 2YU9B 4G7OC 2HQLA 1RODA 3CC7A 3K58A 2I8CA 4MAMA 3NWTA 4A3DG 4WJ4A 3BS1A 2DLNA 5JQWA 5ELEA 5GAHC 2JA7B 3BG3A 2NUCA 4KN7C 4POGA 4ETSA 2WAQG 3IFTA 3T56B 4LF4L 1A3VA 3I91A 3PMFA 3L2PA 2HT1A 4G57A 5JJLA 4A2AA 1HZ9A 4ABNA 2M2LA 4DV2Q 3J7AF 4U6PA 4MN3A 2F0OA 4HEDA 1LTLA 1HNWL 2WV6D 1SYDA 1I94Q 3I72A 1ENFA 3NTHA 4DNTB 2DJGC 3T1HL 1ML0D 2NVYB 1KRTA 5IP9G 1L2ZA 4K2LA 3Q0AA 5CR3A 3HOXH 4C3JG 1STAA 1TWAH 1RYSA 4JI0H 5IGCA 1BXRA 2FFKB 5C6AA 1PFMA 5C3EG 3WDNA 3PUZA 3L3OC 2NVTB 5LL6S 4M9UA 2ALYB 2OXPA 2SOBA 3S14B 2N49A 2C9OA 3HEJA 3DHQA 2FKLA 4O3RA 1BCPC 2FPGB 5KFQA 3T1YH 5EKKA 5EQ0A 4Q43A 4YBZB 1G2SA 2P5ZX 1M7JA 4QIWB 2F4VQ 1K3BC 3CQZH 1CQIB 2ZDGA 1Y1VG 3RLOA 2ZXPA 2WKDA 1HA5A 4IUQA 2RSNA 4A3GH 4ED1A 4A3DB 3I8ZA 2VQEQ 4JOIA 1TS4A 2Z8LA 2K32A 2ENBA 5IGFA 2PNRC 4HR7B 4P72A 3BJUA 2R92H 3L4KA 5T1GA 3HOZB 2V9WA 3PF5A 4DV2H 4Q5VA 4BBSB 3TQYA 2UUBQ 4YCVA 3JAMc 3RF2A 1KQSA 1TT2A 1V8QA 1M90C 2AGOA 4X62Q 4XQQA 2HIVA 1CKOA 2J6SA 1VQ4A 1SR3A 3GTGH 1SROA 3OPOA 2RDHA 2NZ1D 3M4YA 4EVOA 4IN3A 3OIPA 3BJYA 3T5LA 2RDGA 2ASJA 4APVA 2B2WA 5C5JA 3JSNA 1S3OA 3M4IA 5KFIA 4A2BA 2V4RA 5FLXL 5KRUA 3KOJA 3BDLA 5JJKA 1M0TA 3N8DA 5KFBA 3RAQA 1YBYA 3PQIA 2CQYA 2FMAA 1IXRA 1AZPA 4A3BH 4QCLA 4B3RQ 1O7LA 5EDWA 5KFNA 3BZCA 5EBDA 1A62A 3HOYB 5M3FG 4DV2L 4EFBA 4TUYF 1PMRA 5A2QW 2RHQB 3NQTA 3PZPA 2Z4HA 1SE8A 4JI7L 3P1HA 1JWSD 3IAYA 4ECXA 3E5SA 1N33H 3D0FA 3LNNA 4OXPA 1PA6A 2PNHA 4DV1H 1IBMQ 2JA6G 1I4PA 3EYYA 4BBRG 3UE0A 3HOWH 4DUZH 4A75A 1WTQA 3EIVA 3U4VA 4DK6C 4NKLA 4F8MA 4A93G 1W93A 1FVIA 2JA6B 2VA2A 2UVUA 4R1JA 3BVGA 4PDBA 1STYA 4A3IB 1JICA 4FXDA 1TWCA 1EYDA 3J81j 4GC6A 1RJQA 5KT7A 2H1EA 2MJ8A 4R4IA 1EY5A 1W2BA 3JSLA 2L15A 3K3VA 1YEZA 1TS2A 3QR8A 2J0TD 4J15A 3RGXA 4N8FA 4O42A 4FXGC 3TDQA 1HR0Q 4DAYA 4AYBA 3MC0B 2MHVA 4CJ0B 2R84A 1FKAH 3K8AA 4X3SA 4E6IA 1IKLA 2B2VC 1XTCD 1OTCA 4LF6L 1WSCA 2VQFL 4DK1A 5KG0A 4C5CA 3J7AK 3M9MB 4XZ3B 2X6LA 1U4PA 3KAKA 2DJFC 5IGDA 5I9OA 4M1UB 3X3NA 1AZQA 1RK5A 4A3GG 1S97A 3HOWB 3NBIA 3GIPA 3N40P 4MV1A 4DR7H 2R3ZA 1B53A 3C0FB 3EFXD 3MWEA 4JI6H 4JI1Q 1YJNA 1S0OA 2EY2A 1RYRA 3TIIA 2B2UC 4J9KA 1SYEA 1EFWA 4AQYH 1ULZA 4K8JA 2UVVA 5LHY1 1H9JA 5IT9c 2NWGA 2HCCA 5ELCA 4L5QA 4B3TH 4DUYL 3JAME 4G7ZC 3FDSA 2MP1A 4UP7A 2NVQB 1S5FD 1EL0A 2WINB 4M7EA 3GQBA 1U4LA 3C1FA 4JBWA 5KT2A 1HUMA 2A68C 1IYUA 4LFCL 2UXBL 2R7LA 2WTFA 4ZAIA 1HR0H 2JA5A 3OWFA 2VQFH 4HNTA 5DQIA 2RGVA 3G48A 2HVQA 1KTKA 4IZOA 2AU0A 5I47A 2UXCQ 4TRDA 4R4OA 2NUAB 3H3VH 1OXUA 3BVZA 2EYFA 2OH2A 1PV4A 4V190 2NTTA 5I6YA 1X3EA 4ECZA 4LF8Q 1NY4A 1PYBA 4KHVA 1C3OA 5KFRA 1VQLA 2K50A 4GLXA 1AN7A 2K33A 1JOQA 2CW0D 2NU6B 4XIGS 1LO5D 4EQNA 3RAXA 1G51A 2X6GA 4JI2Q 1PH2A 3K80C 2JEIA 5D3IB 4IRCA 4O2AF 2XCPA 3TMEA 4EGVA 1CUKA 5KYIA 5LL6b 1R9TA 5E1FA 5EWGA 1LABA 3KLSX 3PW7A 2O03A 1HZAA 1O7ZA 2AUKA 1BF4A 3GIDA 4RKBA 4Z9CB 3S14H 4RGMA 4FYDA 2B8GA 2G5DA 4O4LF 3HB9A 5KFLA 4JI6L 3CQZA 1M1KC 4DR3L 3OHXC 4LNQA 3RBEA 3RLNA 1UAPA 1OXXK 5DG9A 2XWJB 2I5MX 4YWMA 1U4RA 5I2YA 3NBHA 3J7A5 4ECUA 1TWCH 2Q8IB 3H3VC 2ZM6L 2PMZB 2LKVA 1K9MC 2WB1G 1CKMA 2YCHA 1JE5A 4XT1B 1X3GA 4GLAC 1T5EA 4C3HG 2HDMA 2AQ2B 4RB0A 1AP0A 1JWMD 5BMVF 4PZ6A 4RB3C 1XMQQ 4LFAH 3S1RH 1Y14B 5BR8Q 1L1OB 3I90A 3EROA 3PO3B 4L8JA 4K8IA 4JI0Q 4I65A 3LP8A 2ZJTA 2A6HC 3KHHA 1KDBA 4IHJF 3KK7A 3KF6A 2A69C 1UWVA 2ZDQA 1J5EH 3K5IA 4JBKA 1IKMA 1I4RA 1PDQA 3HP3A 1B9MA 3W1BA 3D3RA 4AQYL 1AN8A 1MJEA 1HXYD 4LSXA 2N78A 1FJGH 4JCVE 2JXMB 4YCWA 4NXNQ 4BY7B 3ETHA 5CV7A 1RK6A 4JV1A 1LT4D 1PH5A 2R7ZG 3BVMA 2CH4W 1Y1WA 1AW7A 5ELFA 3NELA 1Q8IA 4IZ8A 2A8VA 3GTJA 3F2DA 3J80L 5LA6F 3B6YA 2F0MA 1V51A 2RCFA 2IJ0A 2NBFA 3SEBA 3GTQB 4JI2L 2B2YA 2E75C 2GLTA 1HFNA 1LV9A 2SNMA 2K01A 1MIUA 3R5FA 3F2BA 3CCSA 1LUZA 4JI7Q 4DV7Q 1GYFA 5BR8H 3GDEA 2WYOA 2RSOA 1KLUD 4C5BA 3CXCA 4XQJA 4X3KA 4C3JB 1N36L 1EUCB 2KUMA 1BO0A 4YHHH 1OXVA 5JVG3 4Q44A 1SJHD 5ELNA 4V0BA 3GTPH 2R92G 2K04A 1NSNS 2FHTA 2E2JH 3H15A 2GA4B 4HTHA 1WFQA 1UE5A 2W6OA 2QYZA 1HQMC 2XVSA 5C8YF 3VR5A 1XNQL 3GIKA 1VQPA 4EYHB 4OGQC 4DR4L 4DF7A 1GHKA 5EAYA 2WDTA 3HOUB 2G9DA 1WTRA 1BNZA 5KFEA 5ISRA 2KJXA 3GV5B 5C0XJ 3MFYA 5M5WB 3TS2A 3QIAA 4QWAA 4GLVB 4B3SQ 3BAAA 1LTTD 3QFFA 2UU9Q 4ECYA 2WB1B 1V1PA 4JV5H 1F2ZA 4DR6L 1F9RA 2WKCA 4I7AA 4F4XA 4K5XA 2F0JA 1BCPD 3MWYW 2R93H 3S1NB 3S15B 3MTSA 3BABA 2C22A 1MSHA 1I3QA 1G291 5KG6A 1IBMH 4LF9H 5BPFA 1M4VA 2F0KA 3CPWA 1Q7YC 1STHA 1QVGA 3CRKC 1KXLA 4ED3A 5KG5A 4KY5A 4IPHA 2L4NA 4EYIB 1K8AC 1DZ1A 3CAMA 4B3MQ 5KFXA 3ORRA 4LF8L 4MV9A 2NVXH 1T5XD 4EX5A 4G3IA 4IQZA 5C3WA 5H1SE 2UUBL 3CHBD 5NUCA 2FK1A 2EY6A 3FHWA 1TWFB 4EBDA 3KF8A 4K0KQ 2W9BA 3O13A 2PZWA 2C2EA 5CGKA 3V4SA 1XNRL 1PTOB 1KJ8A 2JEBI 3RZOH 3ICEA 4LFCQ 1PH9A 2R7NA 1QOHA 5EPLA 4J9RA 1PRTB 2EJGC 3GIMA 2R7FA 1VQNA 2JEJA 4C3IG 3VPBA 2MQHA 2FJZA 2GVBA 5ELDA 4DFAA 2EVBA 2UU9H 3A7LA 4KV6A 3P20A 4JV5Q 2JA9A 1I3QH 3U58A 2X0SA 4B3SL 4JI8L 2A69D 3HOWG 5I4DA 1VMPA 1I50H 3SXHA 4UP9A 4ZCKA 1PH1A 1PTOF 3IG0A 4JI3L 2CW0C 5JEAG 2JE6I 4F87A 3H20A 1PYSB 4DR2H 4I4TF 1EY4A 2XGTA 1EY6A 2EIFA 1JWUD 1Z9FA 2Z6KA 3VYSA 4C3IH 1VF5C 4CKBA 3VMMA 2D2CC 2EPBA 1GKHA 3H4BA 1T94A 1WTHA 3NPPA 5D3DA 1E24A 4BWGB 1PTOH 5ELOA 4X64Q 1TWGH 3HGBA 3MWDA 4A3EB 3MR6A 3GTOA 1UUPA 2W6NA 4RMFA 1V1OA 4R9WA 1GUTA 1TY0A 1K0RA 3FKIA 1RL2A 1Z47A 3DM3A 4L5TA 2KVMA 4JI0L 5GAGC 3RZDH 1E2WA 4YR0A 1V1QA 4UCVA 3E3XA 3RN2A 2L12A 3RB4A 4G4KA 1SYGA 2OQ0A 2UUBH 1SE2A 5I6WA 3KLWA 3S1QB 1N33L 3UI2A 2NVTH 4YP3A 3Q8DA 1FYCA 5C4ZA 4TV8F 2Q2HA 1S72A 2R7DA 3HOZH 2K5VA 4EQOA 2UUAL 5K5PA 1TWHA 1EYZA 3RGZA 2MCTA 5F9NA 5F9LA 3HOVH 2OTJA 2M9VA 3ZJYC 2OCEA 1TU2B 4I7HA 2QDBA 3OW2A 3G6XA 1S5ED 3HZXA 3T1YQ 1WTVA 2A19A 3T5JA 4C1NK 4HNUA 4TVAB 1WTOA 2QK4A 1X32A 5C3EH 1CHQD 4KMUC 4IALA 2F4VH 1DXMA 5FLMG 5C44G 3CCLA 2PMZE 1O78A 3P7JA 3NTKA 3HOXG 4JI4L 2O5JC 2XCAA 1A0IA 3K7UC 1PVOA 4DR1Q 1C7YA 3E9IA 4RNOA 1SNCA 4KY6A 2HHHL 3OUUA 4J9QA 5LMUQ 1ZXTA 2F0PA 1TIID 3QO2A 2EYJA 3MZ5A 3PW2A 4A3FG 1SRUA 1CKNA 5E7NA 5HGTA 2YZNA 1C8CA 3MVVA 1PX2A 2RDJA 1K8MA 2NVQH 5DNFA 3HOVB 2RCNA 4DUZQ 3HOZG 2FE3A 3W1GA 4BBSG 1A2UA 1KD1C 1HH2P 4A3IG 1MI2A 4KK7A 2XWBB 5DLFA 2FLNA 2F0TA 5GAEC 1I94L 1QCBD 2OEOA 3URYA 3FP9A 2B8FA 1PLFA 4UP8A 3TRZA 4OWTB 2YL2A 4RAUC 1VS0A 3PF4A 1IL8A 1HPCA 4IR9A 5CYUA 4KKUA 4X65Q 4TV9F 4A3DH 3Q24A 4B3RH 4RZRA 5KFSA 4K2KA 4Y7NH 2D0PA 1HQRD 2DY7A 1Y1VA 4GNXA 1IOVA 5T14A 2CCZA 4DV5Q 5M5YB 1SMXA 3MXNB 3PCOB 2D0OA 4BY7G 5KFCA 4LJZC 5IYZF 1YVCA 1C9OA 4H02A 1HTLD 1I6VC 1K83B 3QWNA 5L37A 3FRPB 3DWPA 4JI6Q 3S15H 1O75A 4JV0A 2NVXA 2EJMA 4DV6H 4GOPB 1H95A 2IMWP 2JJQA 4K0KL 1SDFA 1AUXA 1UC8A 2AQ1B 3G6VA 5G3LF 4TKOB 3GLKA 3J81i 2VUMB 3T5HA 2D5DA 3J81E 2ZJQA 4POFA 2VUMG 4LUVA 1TAEA 4ILWA 1QUQA 2JA5G 2F03A 4CJ1B 4ZQIA 1L0WA 4AYBB 1EQRA 1PZJD 1TKWB 3AU7A 4ZK9B 4DV4H 4FO2A 4DK0A 4UDUC 1WR2A 4UPAA 4X66H 4IPDA 4GZYC 3Q8RB 2RBMA 3NWSA 3LWUA 4IUNA 2A1AA 3FMAA 5KFKA 4MA5A 4ECQA 4DV5H 5EJWA 4A3JH 1G91A 2I5LX 4K5VA 1V9PA 4RAZA 3CMAA 5IYBH 2N3SA 2FB9A 2F52A 4A3MB 1JE4A 3HBLA 5J39A 4GOPC 2V5AA 3I4MB 4WFN3 1SNDA 2E5LL 2UXDH 5L1IA 4A3GB 4DV6Q 1ENCA 2AWNA 2PI2E 1Z2PX 3D6WA 2YTVA 5KFTA 3GV6A 1KL9A 3BQ0A 3EVQA 1ZYRD 3K0YA 2J6TA 1S40A 2NN6H 3W5OA 2SNSA 4LF5Q 2AQ4A 3OUZA 5DGBA 1HZBA 3PIO3 1BDOA 2IBKA 1IHZA 3ER0A 2JA5B 1S10A 4GN3B 4XYOA 2F0EA 2R93B 4FU0A 4DV4Q 1X3FA 3G8CA 5CB4F 3C2PA 4J0MA 2F0VA 1B8AA 2CWPA 2R8KA 4OL7A 4X66Q 1X56A 2F4IA 3M4PA 1HNZQ 2B63H 2V1CC 3KJPA 3RN5A 3RNUA 2K4KA 1D5ZC 1VAJA 3GTMA 1JC7A 1B70B 4RHSA 3GTLH 4F7XA 3JZIA 1J5EL 5LMNH 4TQSA 2HD3A 2IX0A 4LFAQ 4YWLA 3K5MA 3GTGA 4DAPA 2IHEA 4PMBA 3GIJA 3K7AB 4YJ2F 1DGSA 3AMUA 1ICWA 1KAAA 1SEBD 4RA8A 5KNDA 3S2DB 3LWBA 4C2MA 3UQ8A 4J6HA 4RU9A 5FK9C 1VDZA 2I07B 3AQQA 1JB7A 5L1JA 2Q2UA 2Q8RE 1GLVA 2EJFC 4PV1C 2EQSA 2ALZA 1D7QA 2UVRA 1PFSA 1ZEQX 2JA7G 4RFBA 2JEAI 1PZID 2DNEA 1LYLA 1SMYD 1BCPB 4HIKA 3OTOH 2JN4A 2VQDA 3HOUG 2PZUA 4X3TA 1TWGA 2V59A 1GUWA 4KHPH 3M9OB 2OLSA 3C3LA 1Q1EA 1G6PA 3TREA 2WAQA 3SI8A 3M4QA 1XYIA 4MHEA 3H09A 3E5NA 2N88A 2R6FA 2N55A 3CMEA 4OELB 1IW7C 2R6GA 3E6ZX 2CH4A 4C3IB 4OX9Q 4KI0A 1BCPF 5LMNQ 2HCIA 2NTSA 4IUTA 2Y0SB 1LACA 5KFOA 4A4IA 2CHBD 4JUZA 2KQ3A 4OIKA 2EE1A 2BOSA 5M5YH 1CQFA 1XMOL 1EY8A 2JA7H 1VF7A 4DAMA 1EQTA 2D62A 1ASYA 2EXDA 1ZHSA 4QGUA 5FO7B 4QY7A 3I3CA 4MV6A 3U9OA 3KXYT 2F0HA 4YIJA 2O5IC 1GUGA 3RFCA 3A56A 2A68D 4A3KH 2AHOB 2E8GA 1EU4A 1I5FA 2QF7A 3TSSA 2J6UA 1TWHH 3FMCA 2KECA 1XMQL 4HYKA 1CQVA 4DR1H 2I46A 1KJJA 3EA6A 3OTOQ 1DD2A 4OONA 5JH7F 5DQHA 2NU7B 1S0MA 4QB4A 2A5HA 1JDBB 4FBUA 2R82A 1SBBB 1PXUA 4OHJA 4XQNA 3Q23A 3QOLA 5CBAE 3S1RB 1HNXQ 2L1BA 1AUVA 3OMCA 1C0AA 1DONA 1B3AA 3A8KE 2PPBC 1ZETA 5JAVA 1ZHQA 1EWHA 1XMOH 5C1PA 4NMZA 3R2IA 5J1ZA 4DKAC 3J7YW 4J9SA 5KFAA 1VQCA 5M3MB 1BBXC 1W96A 3W3AA 2W8LA 1CM9A 2B3GA 2IHFA 1A6XA 1A3UA 2M05A 4LK1C 4QWBA 4RWSC 2HIXA 1VCIA 2DWCA 1A9XA 3NEMA 4C3HH 1BXTA 1FNVA 3RLFA 1Y8OB 1DIKA 4F4YA 3CKIB 2RGRA 1SYFA 4ECSA 1CZGA 1LTBD 4J1MA 3NQIA 3CU7A 3S1QH 4JI1L 2FJ2A 2Z4IA 4L5RC 4P73A 1BKBA 3OHBA 2VQEH 4LWCA 1ESRA 4RGOS 1IBLH 3MEFA 5KGUA 1F9QA 1E2ZA 1LTGD 1Y8PB 1B2TA 1VQ6A 4O4IF 3T51B 3JAMi 3L9AX 2NB0A 5FO8B 4BA2I 1HHVA 1HNXH 4FXKC 2UVWA 2DZDA 2YRWA 4HQ6A 3PIP3 4RB1A 3ITPA 2WP8J 2E2HB 4XDXA 2K05A 1YHAA 2CQAA 1I4XA 3PUYA 4R8UA 1SFOH 1JJ2A 1WH2A 4DR5H 4LMQD 1XPOA 1N36H 3ZYYX 2ICEC 3HOYH 4XYQA 5EWEA 3EJIA 2Z6BA 5LXTF 2OWOA 4EBEA 3T4AC 1PH3A 2R92A 2JSOA 2BQRA 3NHHA 2PBZA 1SYBA 2M00A 2YV5A 3NP8A 4H13C 1FL0A 2BDOA 4TSSA 2IWHA 2W9BB 3S1MB 1A15A 1K83H 4KLKA 4ED8A 2HGSA 3T5KA 1YIJA 3D31A 1E3PA 1BR9A 2I5HA 5LOVF 5KG3A 4Q8FA 3IRBA 2VY3A 1WTWA 1H9SB 1W6KA 3HOYG 2B63B 2B39A 4NXMH 1RJTA 2IX1A 3A8IE 3S1NH 2CZGA 1JIHA 1XNQQ 4BXXG 4EEQA 4RH6A 1RDPD 4MV4A 2I80A 2QW7A 1GVPA 2EYMA 4NXML 2ATLA 4QQBX 4YY3L 3GTLB 5DGAA 2ATWA 3VA5A 4NB3A 5EWFA 3IN5A 4CBVA 2SEBD 4YHHL 4KHZA 1OXSC 1EZ1A 2UXDQ 3NUCA 4FF1A 4JI4H 2VL6A 2PVPA 3UDXA 5IT9W 1FR3A 1SLJA 2Y0SE 2JA8B 1WCMG 3TP7A 3HG9A 1VKZA 2R87A 2BH2A 4LFBH 4DR2L 2SCUB 4UCTA 3BU2A 1NNXA 4K14A 5KG2A 3AEVA 3KHLA 3VPDA 1DOMA 1KEEA 5JUMA 1WCMB 3AYHB 5FJ8H 3HKSA 5FLMH 4UCUA 3DWAA 4IFDI 3FDTA 1CT1D 1EOVA 4YJ3F 3PW0A 2PCFB 1EZ6A 4DAYB 3M7NA 1JLLB 3H0GB 2BR0A 1TS5A 1Q8KA 5LL6X 1LLRD 1EIHA 4RCOA 3H91A 1TQOA 3FKIH 2RF4A 1YJ9A 2XGQA 4DL6A 1I94H 3V4ZA 1HA6A 2Q8TA 1XNQH 1LTRD 1SNMA 3I4NG 1AH9A 3ND9A 1EEFD 1LTAD 4DV0Q 1JJGA 4H7BA
chains in the Genus database with same CATH topology
4UP9A 1PH1A 1E22A 3I4MG 4GKKQ 4LF9Q 3A5UA 4Y52H 4JI3L 4B3TQ 5JEAG 1P16A 3UE1A 2JE6I 2BA0A 1Q1BA 3PV0A 3PUVA 4JC0A 1PYSB 4YHHQ 5IYDH 1L1OC 2PQAB 2XGTA 4JYAL 2GN5A 1WCMH 3S17H 2EIFA 4RG1A 4QIWE 1HNXL 1Z9FA 2Z6KA 4AIMA 3BZKA 4LUZA 4C3IH 4FDBA 3STBD 1X9NA 1WOCA 1GKHA 2JQOA 2ZJPA 5IY0A 1E24A 2CFMA 4LF6Q 3H0GH 1XPRA 5ELOA 4LF9L 4X64Q 1TWGH 2HHHQ 4LF4Q 2GVAA 3PUXA 4GN4B 1KHIA 4BY1G 3VDYA 4RMFA 1YZ6A 2F4VL 1PH8A 1K0RA 1RL2A 1Z47A 3DM3A 1FGUA 4L5TA 4JI0L 1N34L 1XPUA 5GAGC 3RZDH 2UXCL 3F2CA 1V1QA 2ZJRA 3L7ZC 3RN2A 1QZHA 3UDGA 1E1TA 1V43A 2YTXA 3J7ZC 2KENA 1TXYA 2OQ0A 3F8TA 4GKJL 4DV3L 1O7IA 2ID0A 3EBEA 3KLWA 1K73C 5J3BA 4AQYQ 4HIOA 1U0LA 5LMNW 3T1YL 1GM5A 3CCEA 1X65A 3Q8DA 3CCQA 4DUYQ 2NVTH 2Q2HA 3AFQA 2R7DA 1X55A 3L0OA 1S72A 2K5VA 3CC2A 3M3YH 2UUAL 5IYBG 2NZOA 4R4CA 4NPSA 1X6OA 2E2IH 4R4TA 3CD6A 3HOVH 2OTJA 1MKHA 2UUCQ 1YITA 1EYGA 1IZ6A 2I0QA 3ZJYC 2OCEA 4ALPA 3OW2A 2E5LQ 1Q46A 3GTMH 1N32L 3T1YQ 2A19A 3HKZE 3ULLA 4TVAB 5C3EH 1B7YB 1J5EQ 2HQLA 5IP9H 3H3VI 5FLMG 3CC7A 5C44G 3CCLA 2PMZE 2B29A 3I56A 4A3DG 5C0XI 3HOXG 4JI4L 4LF7Q 4WJ4A 1A0IA 3K7UC 1PVOA 5GAHC 4DR1Q 4P75A 4A3FH 4HJ9A 3S16H 1CSPA 1C7YA 3E9IA 2LXKA 1VQ5A 2WAQG 4POGA 2HHHL 3L2PA 4LF4L 5GROA 5LMUQ 2HT1A 2FXQA 5JJLA 1HZ9A 2QA4A 3PO3H 4DV2Q 4JOIC 3CCVA 3CW2C 1LTLA 3AFPA 2Z0SA 2WFWA 4PZ7A 3I4MH 1BVSA 4A3FG 3EN2A 1CSQA 1P8LA 1CKNA 1SRUA 5IP7G 2RHSB 5E7NA 5M3FH 4ME3A 4LF7L 2CWAA 3T1HL 1K3RA 1Y1WH 1KRTA 5IP9G 4GOPA 2QGQA 2NVQH 4A3BG 2RCNA 4HJ8A 4DUZQ 3HOXH 2ES2A 4JI3Q 3HOZG 4DR4Q 3W1GA 1TWAH 4BBSG 1KD1C 3TEHB 1YHBA 1HH2P 4A3IG 5IP7H 5C3EG 4MZ9A 1VQGA 3PUZA 3E0EA 5GAEC 1I94L 5C4JH 3KF6B 2DUDA 3HFZB 1GO3E 2ALYB 3FP9A 2UU9L 3PO3G 2N49A 4UP8A 3TRZA 4BA1I 1IBKQ 4OWTB 2JA8H 1VS0A 2UUCL 3PF4A 3A5ZB 5IWAL 2Q2IA 4OWWB 4X65Q 4OX9L 4A3DH 2F4VQ 3CQZH 4DV1L 1Y1VG 3RLOA 5AJ3L 1N34Q 4Y7NH 4A3GH 2D0PA 4GNXA 2VQEQ 4JOIA 4IPGA 5M5XH 4JI8Q 2CCZA 4DV5Q 1SMXA 3MXNB 3PCOB 2D0OA 1W3SA 4BY7G 3KDFB 2KBNA 4JI5Q 2NN6G 4P72A 3BJUA 4X66L 3UDIA 2R92H 2ZTCA 1R9TH 3PF5A 3LGJA 1YVCA 3TQYA 1RIPA 1C9OA 3M85A 2UUBQ 4H02A 2MO1A 2PQAA 4YCVA 4A3LH 2ZTEA 3JAMc 4DV6L 4DR3Q 1KQSA 3GD7A 4JI6Q 1M90C 3S15H 4X62Q 1IYJB 4DV7L 2HIVA 4GOPB 1Q12A 5IE8A 1PH2A 1H95A 1CKOA 1NMFA 2JJQA 4K0KL 1VQ4A 1SR3A 1VQ8A 4EQ5A 3GTGH 1SROA 3J81i 1N32Q 4APVA 1TWFH 4DR5Q 1S3OA 1HZCA 2K75A 3G71A 2ZJQA 4POFA 2VUMG 1SN8A 1K8GA 1E7ZA 4LUVA 4A3CH 1QUQA 2JA5G 1EIFA 4PMWA 3OYYA 1YNXA 3KOJA 5C4XH 4DR7L 5JJKA 1L0WA 5C44H 4LFBQ 1VQFA 1EQRA 1YBYA 4XTCS 4A3KG 1IXRA 4A3BH 1UEBA 2VQFQ 4B3RQ 2UXBQ 1VQIA 3BZCA 4UPAA 4A3LG 4MTNA 1A62A 2F3IA 5M3FG 3PIPA 3I2ZA 4IPDA 4DV2L 1I6HH 2A1AA 4KHPQ 2RHQB 4IOAA 4A3JH 5K36G 2I5LX 1SE8A 1V9PA 4R4QA 2VW9A 3KDFA 3T1HQ 2E2HH 4JI7L 2PI2A 3CMAA 5IYBH 2N3SA 4DV5L 3D0FA 4OXPA 1PA6A 1HR0W 2F52A 1EWIA 4B3RL 2PNHA 4JI5L 4GOPC 1IBMQ 2JA6G 3J80c 4BBRG 3CCMA 2E5LL 3UE0A 3HOWH 4A75A 1VQKA 5IYCG 3EIVA 3KJOA 4BBSH 3U4VA 3CP0A 4DK6C 4DV6Q 4A93G 2AWNA 1HR0L 1FVIA 2PI2E 3KYHC 5LMNL 1PH4A 4R1JA 2JA8G 1A63A 3J81j 2K5HA 2YTVA 4R4IA 1IBKL 1KL9A 3S1MH 2C35B 1AE3A 1W2BA 1S40A 2L15A 3W5OA 1YEZA 4LF5Q 1VQDA 1L1OA 1KC8C 1HZBA 4B3TL 4J15A 4JBMA 5M5WH 3ER0A 4IOCA 1Q82C 3JC66 1VQMA 3H0GG 4GN3B 1HR0Q 1CKNB 5IYCH 2QEXA 2OTLA 4DV4Q 1X3FA 1VQOA 5GQOA 1B8AA 3K8AA 2CWPA 4NXMQ 4LF6L 4X66Q 1OTCA 4LF5L 2VQFL 1X56A 1L2FA 3M4PA 1HNZQ 2B63H 1A8VA 2V1CC 3KJPA 2NN6I 3RN5A 2K4KA 3RNUA 4A3GG 3HKZG 1Q86C 1B70B 3GTLH 5HGQA 4P71A 5M3MH 4DV4L 1J5EL 4JI1Q 2IX0A 4LFAQ 1YJNA 4YWLA 2IHEA 4GNXC 4JI4Q 1XMOQ 4C3JH 1DGSA 4JG2A 4B3ML 1EFWA 2YTYA 4DR2Q 4GKJQ 5IT9c 5C4XG 4L5QA 1VQJA 4PG3A 3M4OH 2N8NA 4DUYL 1WI5A 3AQQA 1N8RC 4UP7A 4GNXB 1JB7A 1EIYB 2Q2UA 2VUMH 3M9BA 4JBJA 3I4OA 2CKZB 4JBWA 2EQSA 1MJCA 2LXJA 4HJ5A 4LFCL 4DUZL 1PFSA 4MNOA 4HJAA 2JA7G 2JEAI 2UXBL 2K14A 1LYLA 4HIKA 2AWOA 3G48A 4KHPL 1UE7A 1XJVA 1NJIC 1YHQA 4O2DA 2YU9H 3HOUG 5DLQE 2UXCQ 4R4OA 3H3VH 1OXUA 3PIOA 4IFDJ 1PV4A 1UE6A 4A3JG 1Q1EA 1X3EA 3TREA 1G6PA 2CQOA 3M4QA 4LF8Q 1NY4A 1PYBA 5JJIA 4QL5A 4A76A 1ASZA 2K50A 3SGIA 4GLXA 3CMEA 1VQLA 3HOVG 2R6GA 1KAWA 3CCJA 4OX9Q 2VNUD 4XIGS 1IL2A 1G51A 3K81C 4JI2Q 3G4SA 3K80C 2DGYA 4KI0A 5LMNQ 2AMCB 3ERSX 3HOZH 1N9WA 4A4IA 1CUKA 4YWKA 3S2DH 5M5YH 3DLLA 2ASBA 1XMOL 2JA7H 1NMGA 1N36Q 1HZAA 4DAMA 2D62A 1IBLL 2EXDA 1ASYA 4QGUA 3S14H 2K52A 3U4ZA 3G6EA 1QZGA 1NE3A 2UXDL 4QY7A 1EQQA 4JI6L 1M1KC 1VQHA 4LUOA 1T9HA 4DR3L 4LNQA 2WB1E 1NTGA 3RLNA 4JV5L 4X62L 4A3KH 2AHOB 4DV0L 4DR1L 2E8GA 1EUJA 1I5FA 3CPFA 1OXXK 1TWHH 4GN5A 1XMQL 4OO1G 2I5MX 4YWMA 3J7A5 2NZHA 1IBML 3WWVA 1Y1WG 3PSIA 1IBLQ 1TWCH 3OTOQ 2MFIA 1VQ9A 4OONA 2VZAA 4X65L 5LMUL 3E9HA 2ZM6L 2LSSA 4BBRH 2B63G 1PH7A 4HJ7A 3U50C 1K9MC 4A3EH 4A3CG 2WB1G 1HJPA 1CKMA 1PHJA 1N33L 4A93H 2OQKA 1JE5A 2VQEL 3KF8B 1HNXQ 4LFAL 1X3GA 4DR7Q 4GLAC 3STBC 1JMCA 1C0AA 4P74A 1D8LA 5M3MG 2R7ZH 1VQAA 4PZ6A 1XMQQ 3S1RH 1Y14B 2YYZA 4X64L 5BR8Q 1Y1VH 1BBWA 1L1OB 3OTOL 4DKAC 1VQCA 5JEAJ 2BA1A 3CC4A 1JJCB 4JI0Q 3HOUH 3GO5A 3GTQH 4IJHA 5IYDG 2IT1A 4UY8C 2B3GA 2IHFA 4NXNL 4IJLA 3KF6A 1UWVA 2ZTDA 4DK3C 4JBKA 1U5KA 2HIXA 2WAQE 1VCIA 3W1BA 4AYBG 3NEMA 4C3HH 4DV0Q 4AH6A 4AQYL 4IFDG 4OWXB 1GD7A 4IPCA 4DV3Q 3RLFA 1MJEA 1VQBA 2N78A 4A3EG 3S2HH 4JCVE 3GTOH 4YCWA 3FKIG 4NXNQ 3S1QH 2UUAQ 4DPGA 1PH5A 4JI1L 1E1OA 4L5RC 2R7ZG 4P73A 1BKBA 3ULJA 2JK8A 4LWCA 3I4NH 3MEFA 3NELA 4X6AH 2A8VA 4YY3Q 4HIDA 1BBUA 3F2DA 3B6YA 3NBHB 1KIXA 1VQ6A 3JAMi 4A3IH 4JI2L 4BA2I 2ZM6Q 1MIUA 3K0XA 3F2BA 1X54A 1LUZA 4C2MH 3CCSA 1J6QA 4JI7Q 4DV7Q 1QVFA 2VS1A 2WP8J 2Y0SG 1WJJA 3GDEA 4LW1A 4L5SA 1D7QA 3CXCA 3K7AH 1N36L 1YHAA 3PUYA 2AKWB 1JT8A 1SFOH 1JJ2A 1OXVA 2Q2TA 2IY5B 1XPOA 1HNWL 5ELNA 1WYDA 3HOYH 4DR5L 2R92G 1QUQB 3GTPH 2OWOA 4JYAQ 1KRSA 1PH3A 2BH8A 2E2JH 3H15A 1WFQA 1UE5A 1FJGL 2YV5A 5HY6A 1XNRQ 1XNQL 4GS3A 1FL0A 4PZ8A 2XTIA 1VQPA 3PO2G 4LFBL 1K83H 5C0XG 4KLKA 4DR4L 4BXXH 5EAYA 3PGZA 3S24A 1YIJA 4OO1I 3D31A 1E3PA 2I5HA 2Z6KC 2KCMA 5C0XJ 1UE1A 5FLXc 3TS2A 1QVCA 3IRBA 2VY3A 4A3MG 3KFUA 1NBWA 4GLVB 4HIMA 4B3SQ 3HOYG 3J80i 2IX1A 2MNAA 2UU9Q 3S1NH 1PH6A 4DNIA 3CCRA 1XNQQ 2KHIA 4BXXG 4DR6L 2KCTA 1GVPA 3NENA 5BR8L 4NXML 4QJFA 4YY3L 4QQBX 2R93H 2ATWA 4NB3A 3I55A 1G291 4YHHL 4KHZA 3J81c 1OXSC 4TQUS 3CPWA 2UXDQ 1Q81C 1Q7YC 2MO0A 1QVGA 1VQ7A 2JA5H 1KXLA 3A0JA 5AJ3Q 5FJ8G 2VL6A 5GADC 3I7FA 4IPHA 3UDXA 1AE2A 4DR6Q 1SLJA 2Y0SE 4A3MH 1K8AC 3CAMA 1WCMG 4B3MQ 4AYBE 3GTKH 4LF8L 3TS0A 2BH2A 1OXTA 4DR2L 2NVXH 3BU2A 3AEVA 4EX5A 3PUWA 5H1SE 5FJ8H 3AYHB 2UUBL 2JA6H 3HKSA 5FLMH 1XTDA 3FHWA 3CCUA 3PO2H 4IFDI 4WJ3M 1EOVA 4IO9A 1FJGQ 2NVYH 4K0KQ 4BY1H 1YI2A 4DAYB 1LM0A 3M7NA 3GTJH 1VQEA 1XNRL 2JEBI 3RZOH 3ICEA 1Q8KA 4LFCQ 1I94Q 2R93G 1PH9A 4GKKL 3A74A 5IWAQ 1HNZL 4BY7H 3UDFA 2R7FA 1VQNA 1N33Q 4DV1Q 2K5NA 3FKIH 2MQHA 2RF4A 1YJ9A 2GVBA 4YCUA 1HNWQ 4JV5Q 2JA9A 1I3QH 3U58A 4B3SL 3I4NG 1AH9A 4O0AA 4JI8L 3CF5A 2H5XA 3F1ZA 3RR5A 1YJWA 3HOWG 3ULPA 2KHJA 1JJGA 1I50H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UP9 A;  1PH1 A;  1E22 A;  3I4M G;  4GKK Q;  4LF9 Q;  3A5U A;  4Y52 H;  4JI3 L;  4B3T Q;  5JEA G;  1P16 A;  3UE1 A;  2JE6 I;  2BA0 A;  1Q1B A;  3PV0 A;  3PUV A;  4JC0 A;  1PYS B;  4YHH Q;  5IYD H;  1L1O C;  2PQA B;  2XGT A;  4JYA L;  2GN5 A;  1WCM H;  3S17 H;  2EIF A;  4RG1 A;  4QIW E;  1HNX L;  1Z9F A;  2Z6K A;  4AIM A;  3BZK A;  4LUZ A;  4C3I H;  4FDB A;  3STB D;  1X9N A;  1WOC A;  1GKH A;  2JQO A;  2ZJP A;  5IY0 A;  1E24 A;  2CFM A;  4LF6 Q;  3H0G H;  1XPR A;  5ELO A;  4LF9 L;  4X64 Q;  1TWG H;  2HHH Q;  4LF4 Q;  2GVA A;  3PUX A;  4GN4 B;  1KHI A;  4BY1 G;  3VDY A;  4RMF A;  1YZ6 A;  2F4V L;  1PH8 A;  1K0R A;  1RL2 A;  1Z47 A;  3DM3 A;  1FGU A;  4L5T A;  4JI0 L;  1N34 L;  1XPU A;  5GAG C;  3RZD H;  2UXC L;  3F2C A;  1V1Q A;  2ZJR A;  3L7Z C;  3RN2 A;  1QZH A;  3UDG A;  1E1T A;  1V43 A;  2YTX A;  3J7Z C;  2KEN A;  1TXY A;  2OQ0 A;  3F8T A;  4GKJ L;  4DV3 L;  1O7I A;  2ID0 A;  3EBE A;  3KLW A;  1K73 C;  5J3B A;  4AQY Q;  4HIO A;  1U0L A;  5LMN W;  3T1Y L;  1GM5 A;  3CCE A;  1X65 A;  3Q8D A;  3CCQ A;  4DUY Q;  2NVT H;  2Q2H A;  3AFQ A;  2R7D A;  1X55 A;  3L0O A;  1S72 A;  2K5V A;  3CC2 A;  3M3Y H;  2UUA L;  5IYB G;  2NZO A;  4R4C A;  4NPS A;  1X6O A;  2E2I H;  4R4T A;  3CD6 A;  3HOV H;  2OTJ A;  1MKH A;  2UUC Q;  1YIT A;  1EYG A;  1IZ6 A;  2I0Q A;  3ZJY C;  2OCE A;  4ALP A;  3OW2 A;  2E5L Q;  1Q46 A;  3GTM H;  1N32 L;  3T1Y Q;  2A19 A;  3HKZ E;  3ULL A;  4TVA B;  5C3E H;  1B7Y B;  1J5E Q;  2HQL A;  5IP9 H;  3H3V I;  5FLM G;  3CC7 A;  5C44 G;  3CCL A;  2PMZ E;  2B29 A;  3I56 A;  4A3D G;  5C0X I;  3HOX G;  4JI4 L;  4LF7 Q;  4WJ4 A;  1A0I A;  3K7U C;  1PVO A;  5GAH C;  4DR1 Q;  4P75 A;  4A3F H;  4HJ9 A;  3S16 H;  1CSP A;  1C7Y A;  3E9I A;  2LXK A;  1VQ5 A;  2WAQ G;  4POG A;  2HHH L;  3L2P A;  4LF4 L;  5GRO A;  5LMU Q;  2HT1 A;  2FXQ A;  5JJL A;  1HZ9 A;  2QA4 A;  3PO3 H;  4DV2 Q;  4JOI C;  3CCV A;  3CW2 C;  1LTL A;  3AFP A;  2Z0S A;  2WFW A;  4PZ7 A;  3I4M H;  1BVS A;  4A3F G;  3EN2 A;  1CSQ A;  1P8L A;  1CKN A;  1SRU A;  5IP7 G;  2RHS B;  5E7N A;  5M3F H;  4ME3 A;  4LF7 L;  2CWA A;  3T1H L;  1K3R A;  1Y1W H;  1KRT A;  5IP9 G;  4GOP A;  2QGQ A;  2NVQ H;  4A3B G;  2RCN A;  4HJ8 A;  4DUZ Q;  3HOX H;  2ES2 A;  4JI3 Q;  3HOZ G;  4DR4 Q;  3W1G A;  1TWA H;  4BBS G;  1KD1 C;  3TEH B;  1YHB A;  1HH2 P;  4A3I G;  5IP7 H;  5C3E G;  4MZ9 A;  1VQG A;  3PUZ A;  3E0E A;  5GAE C;  1I94 L;  5C4J H;  3KF6 B;  2DUD A;  3HFZ B;  1GO3 E;  2ALY B;  3FP9 A;  2UU9 L;  3PO3 G;  2N49 A;  4UP8 A;  3TRZ A;  4BA1 I;  1IBK Q;  4OWT B;  2JA8 H;  1VS0 A;  2UUC L;  3PF4 A;  3A5Z B;  5IWA L;  2Q2I A;  4OWW B;  4X65 Q;  4OX9 L;  4A3D H;  2F4V Q;  3CQZ H;  4DV1 L;  1Y1V G;  3RLO A;  5AJ3 L;  1N34 Q;  4Y7N H;  4A3G H;  2D0P A;  4GNX A;  2VQE Q;  4JOI A;  4IPG A;  5M5X H;  4JI8 Q;  2CCZ A;  4DV5 Q;  1SMX A;  3MXN B;  3PCO B;  2D0O A;  1W3S A;  4BY7 G;  3KDF B;  2KBN A;  4JI5 Q;  2NN6 G;  4P72 A;  3BJU A;  4X66 L;  3UDI A;  2R92 H;  2ZTC A;  1R9T H;  3PF5 A;  3LGJ A;  1YVC A;  3TQY A;  1RIP A;  1C9O A;  3M85 A;  2UUB Q;  4H02 A;  2MO1 A;  2PQA A;  4YCV A;  4A3L H;  2ZTE A;  3JAM c;  4DV6 L;  4DR3 Q;  1KQS A;  3GD7 A;  4JI6 Q;  1M90 C;  3S15 H;  4X62 Q;  1IYJ B;  4DV7 L;  2HIV A;  4GOP B;  1Q12 A;  5IE8 A;  1PH2 A;  1H95 A;  1CKO A;  1NMF A;  2JJQ A;  4K0K L;  1VQ4 A;  1SR3 A;  1VQ8 A;  4EQ5 A;  3GTG H;  1SRO A;  3J81 i;  1N32 Q;  4APV A;  1TWF H;  4DR5 Q;  1S3O A;  1HZC A;  2K75 A;  3G71 A;  2ZJQ A;  4POF A;  2VUM G;  1SN8 A;  1K8G A;  1E7Z A;  4LUV A;  4A3C H;  1QUQ A;  2JA5 G;  1EIF A;  4PMW A;  3OYY A;  1YNX A;  3KOJ A;  5C4X H;  4DR7 L;  5JJK A;  1L0W A;  5C44 H;  4LFB Q;  1VQF A;  1EQR A;  1YBY A;  4XTC S;  4A3K G;  1IXR A;  4A3B H;  1UEB A;  2VQF Q;  4B3R Q;  2UXB Q;  1VQI A;  3BZC A;  4UPA A;  4A3L G;  4MTN A;  1A62 A;  2F3I A;  5M3F G;  3PIP A;  3I2Z A;  4IPD A;  4DV2 L;  1I6H H;  2A1A A;  4KHP Q;  2RHQ B;  4IOA A;  4A3J H;  5K36 G;  2I5L X;  1SE8 A;  1V9P A;  4R4Q A;  2VW9 A;  3KDF A;  3T1H Q;  2E2H H;  4JI7 L;  2PI2 A;  3CMA A;  5IYB H;  2N3S A;  4DV5 L;  3D0F A;  4OXP A;  1PA6 A;  1HR0 W;  2F52 A;  1EWI A;  4B3R L;  2PNH A;  4JI5 L;  4GOP C;  1IBM Q;  2JA6 G;  3J80 c;  4BBR G;  3CCM A;  2E5L L;  3UE0 A;  3HOW H;  4A75 A;  1VQK A;  5IYC G;  3EIV A;  3KJO A;  4BBS H;  3U4V A;  3CP0 A;  4DK6 C;  4DV6 Q;  4A93 G;  2AWN A;  1HR0 L;  1FVI A;  2PI2 E;  3KYH C;  5LMN L;  1PH4 A;  4R1J A;  2JA8 G;  1A63 A;  3J81 j;  2K5H A;  2YTV A;  4R4I A;  1IBK L;  1KL9 A;  3S1M H;  2C35 B;  1AE3 A;  1W2B A;  1S40 A;  2L15 A;  3W5O A;  1YEZ A;  4LF5 Q;  1VQD A;  1L1O A;  1KC8 C;  1HZB A;  4B3T L;  4J15 A;  4JBM A;  5M5W H;  3ER0 A;  4IOC A;  1Q82 C;  3JC6 6;  1VQM A;  3H0G G;  4GN3 B;  1HR0 Q;  1CKN B;  5IYC H;  2QEX A;  2OTL A;  4DV4 Q;  1X3F A;  1VQO A;  5GQO A;  1B8A A;  3K8A A;  2CWP A;  4NXM Q;  4LF6 L;  4X66 Q;  1OTC A;  4LF5 L;  2VQF L;  1X56 A;  1L2F A;  3M4P A;  1HNZ Q;  2B63 H;  1A8V A;  2V1C C;  3KJP A;  2NN6 I;  3RN5 A;  2K4K A;  3RNU A;  4A3G G;  3HKZ G;  1Q86 C;  1B70 B;  3GTL H;  5HGQ A;  4P71 A;  5M3M H;  4DV4 L;  1J5E L;  4JI1 Q;  2IX0 A;  4LFA Q;  1YJN A;  4YWL A;  2IHE A;  4GNX C;  4JI4 Q;  1XMO Q;  4C3J H;  1DGS A;  4JG2 A;  4B3M L;  1EFW A;  2YTY A;  4DR2 Q;  4GKJ Q;  5IT9 c;  5C4X G;  4L5Q A;  1VQJ A;  4PG3 A;  3M4O H;  2N8N A;  4DUY L;  1WI5 A;  3AQQ A;  1N8R C;  4UP7 A;  4GNX B;  1JB7 A;  1EIY B;  2Q2U A;  2VUM H;  3M9B A;  4JBJ A;  3I4O A;  2CKZ B;  4JBW A;  2EQS A;  1MJC A;  2LXJ A;  4HJ5 A;  4LFC L;  4DUZ L;  1PFS A;  4MNO A;  4HJA A;  2JA7 G;  2JEA I;  2UXB L;  2K14 A;  1LYL A;  4HIK A;  2AWO A;  3G48 A;  4KHP L;  1UE7 A;  1XJV A;  1NJI C;  1YHQ A;  4O2D A;  2YU9 H;  3HOU G;  5DLQ E;  2UXC Q;  4R4O A;  3H3V H;  1OXU A;  3PIO A;  4IFD J;  1PV4 A;  1UE6 A;  4A3J G;  1Q1E A;  1X3E A;  3TRE A;  1G6P A;  2CQO A;  3M4Q A;  4LF8 Q;  1NY4 A;  1PYB A;  5JJI A;  4QL5 A;  4A76 A;  1ASZ A;  2K50 A;  3SGI A;  4GLX A;  3CME A;  1VQL A;  3HOV G;  2R6G A;  1KAW A;  3CCJ A;  4OX9 Q;  2VNU D;  4XIG S;  1IL2 A;  1G51 A;  3K81 C;  4JI2 Q;  3G4S A;  3K80 C;  2DGY A;  4KI0 A;  5LMN Q;  2AMC B;  3ERS X;  3HOZ H;  1N9W A;  4A4I A;  1CUK A;  4YWK A;  3S2D H;  5M5Y H;  3DLL A;  2ASB A;  1XMO L;  2JA7 H;  1NMG A;  1N36 Q;  1HZA A;  4DAM A;  2D62 A;  1IBL L;  2EXD A;  1ASY A;  4QGU A;  3S14 H;  2K52 A;  3U4Z A;  3G6E A;  1QZG A;  1NE3 A;  2UXD L;  4QY7 A;  1EQQ A;  4JI6 L;  1M1K C;  1VQH A;  4LUO A;  1T9H A;  4DR3 L;  4LNQ A;  2WB1 E;  1NTG A;  3RLN A;  4JV5 L;  4X62 L;  4A3K H;  2AHO B;  4DV0 L;  4DR1 L;  2E8G A;  1EUJ A;  1I5F A;  3CPF A;  1OXX K;  1TWH H;  4GN5 A;  1XMQ L;  4OO1 G;  2I5M X;  4YWM A;  3J7A 5;  2NZH A;  1IBM L;  3WWV A;  1Y1W G;  3PSI A;  1IBL Q;  1TWC H;  3OTO Q;  2MFI A;  1VQ9 A;  4OON A;  2VZA A;  4X65 L;  5LMU L;  3E9H A;  2ZM6 L;  2LSS A;  4BBR H;  2B63 G;  1PH7 A;  4HJ7 A;  3U50 C;  1K9M C;  4A3E H;  4A3C G;  2WB1 G;  1HJP A;  1CKM A;  1PHJ A;  1N33 L;  4A93 H;  2OQK A;  1JE5 A;  2VQE L;  3KF8 B;  1HNX Q;  4LFA L;  1X3G A;  4DR7 Q;  4GLA C;  3STB C;  1JMC A;  1C0A A;  4P74 A;  1D8L A;  5M3M G;  2R7Z H;  1VQA A;  4PZ6 A;  1XMQ Q;  3S1R H;  1Y14 B;  2YYZ A;  4X64 L;  5BR8 Q;  1Y1V H;  1BBW A;  1L1O B;  3OTO L;  4DKA C;  1VQC A;  5JEA J;  2BA1 A;  3CC4 A;  1JJC B;  4JI0 Q;  3HOU H;  3GO5 A;  3GTQ H;  4IJH A;  5IYD G;  2IT1 A;  4UY8 C;  2B3G A;  2IHF A;  4NXN L;  4IJL A;  3KF6 A;  1UWV A;  2ZTD A;  4DK3 C;  4JBK A;  1U5K A;  2HIX A;  2WAQ E;  1VCI A;  3W1B A;  4AYB G;  3NEM A;  4C3H H;  4DV0 Q;  4AH6 A;  4AQY L;  4IFD G;  4OWX B;  1GD7 A;  4IPC A;  4DV3 Q;  3RLF A;  1MJE A;  1VQB A;  2N78 A;  4A3E G;  3S2H H;  4JCV E;  3GTO H;  4YCW A;  3FKI G;  4NXN Q;  3S1Q H;  2UUA Q;  4DPG A;  1PH5 A;  4JI1 L;  1E1O A;  4L5R C;  2R7Z G;  4P73 A;  1BKB A;  3ULJ A;  2JK8 A;  4LWC A;  3I4N H;  3MEF A;  3NEL A;  4X6A H;  2A8V A;  4YY3 Q;  4HID A;  1BBU A;  3F2D A;  3B6Y A;  3NBH B;  1KIX A;  1VQ6 A;  3JAM i;  4A3I H;  4JI2 L;  4BA2 I;  2ZM6 Q;  1MIU A;  3K0X A;  3F2B A;  1X54 A;  1LUZ A;  4C2M H;  3CCS A;  1J6Q A;  4JI7 Q;  4DV7 Q;  1QVF A;  2VS1 A;  2WP8 J;  2Y0S G;  1WJJ A;  3GDE A;  4LW1 A;  4L5S A;  1D7Q A;  3CXC A;  3K7A H;  1N36 L;  1YHA A;  3PUY A;  2AKW B;  1JT8 A;  1SFO H;  1JJ2 A;  1OXV A;  2Q2T A;  2IY5 B;  1XPO A;  1HNW L;  5ELN A;  1WYD A;  3HOY H;  4DR5 L;  2R92 G;  1QUQ B;  3GTP H;  2OWO A;  4JYA Q;  1KRS A;  1PH3 A;  2BH8 A;  2E2J H;  3H15 A;  1WFQ A;  1UE5 A;  1FJG L;  2YV5 A;  5HY6 A;  1XNR Q;  1XNQ L;  4GS3 A;  1FL0 A;  4PZ8 A;  2XTI A;  1VQP A;  3PO2 G;  4LFB L;  1K83 H;  5C0X G;  4KLK A;  4DR4 L;  4BXX H;  5EAY A;  3PGZ A;  3S24 A;  1YIJ A;  4OO1 I;  3D31 A;  1E3P A;  2I5H A;  2Z6K C;  2KCM A;  5C0X J;  1UE1 A;  5FLX c;  3TS2 A;  1QVC A;  3IRB A;  2VY3 A;  4A3M G;  3KFU A;  1NBW A;  4GLV B;  4HIM A;  4B3S Q;  3HOY G;  3J80 i;  2IX1 A;  2MNA A;  2UU9 Q;  3S1N H;  1PH6 A;  4DNI A;  3CCR A;  1XNQ Q;  2KHI A;  4BXX G;  4DR6 L;  2KCT A;  1GVP A;  3NEN A;  5BR8 L;  4NXM L;  4QJF A;  4YY3 L;  4QQB X;  2R93 H;  2ATW A;  4NB3 A;  3I55 A;  1G29 1;  4YHH L;  4KHZ A;  3J81 c;  1OXS C;  4TQU S;  3CPW A;  2UXD Q;  1Q81 C;  1Q7Y C;  2MO0 A;  1QVG A;  1VQ7 A;  2JA5 H;  1KXL A;  3A0J A;  5AJ3 Q;  5FJ8 G;  2VL6 A;  5GAD C;  3I7F A;  4IPH A;  3UDX A;  1AE2 A;  4DR6 Q;  1SLJ A;  2Y0S E;  4A3M H;  1K8A C;  3CAM A;  1WCM G;  4B3M Q;  4AYB E;  3GTK H;  4LF8 L;  3TS0 A;  2BH2 A;  1OXT A;  4DR2 L;  2NVX H;  3BU2 A;  3AEV A;  4EX5 A;  3PUW A;  5H1S E;  5FJ8 H;  3AYH B;  2UUB L;  2JA6 H;  3HKS A;  5FLM H;  1XTD A;  3FHW A;  3CCU A;  3PO2 H;  4IFD I;  4WJ3 M;  1EOV A;  4IO9 A;  1FJG Q;  2NVY H;  4K0K Q;  4BY1 H;  1YI2 A;  4DAY B;  1LM0 A;  3M7N A;  3GTJ H;  1VQE A;  1XNR L;  2JEB I;  3RZO H;  3ICE A;  1Q8K A;  4LFC Q;  1I94 Q;  2R93 G;  1PH9 A;  4GKK L;  3A74 A;  5IWA Q;  1HNZ L;  4BY7 H;  3UDF A;  2R7F A;  1VQN A;  1N33 Q;  4DV1 Q;  2K5N A;  3FKI H;  2MQH A;  2RF4 A;  1YJ9 A;  2GVB A;  4YCU A;  1HNW Q;  4JV5 Q;  2JA9 A;  1I3Q H;  3U58 A;  4B3S L;  3I4N G;  1AH9 A;  4O0A A;  4JI8 L;  3CF5 A;  2H5X A;  3F1Z A;  3RR5 A;  1YJW A;  3HOW G;  3ULP A;  2KHJ A;  1JJG A;  1I50 H; 
#chains in the Genus database with same CATH topology
 1STE A;  1TWH B;  5J2U F;  4GKJ H;  4GKK Q;  1D1I A;  5H80 A;  1P16 A;  1EEI D;  1G8Z D;  2BA0 A;  4A93 B;  4FP5 D;  2YU9 A;  5IYD H;  1L1O C;  2PQA B;  2FMC A;  1KDC A;  3GIL A;  1WCM H;  5KFW A;  1STN A;  4AIM A;  1J9O A;  5COY A;  5D1O B;  5C44 B;  1WOC A;  2K5D A;  2ZJP A;  2FPI B;  2K5W A;  4LF6 Q;  3H0G H;  4DL2 A;  3FEW X;  1XNR H;  3D4R A;  2GVA A;  3PUX A;  5EPK A;  4A3K B;  1KHI A;  4BY1 G;  1BGW A;  1YZ6 A;  2F4V L;  4MV3 A;  3I73 A;  1FGU A;  4DGZ A;  1WTX A;  1N34 L;  3LML A;  1HTP A;  2VR1 A;  1KNE A;  4A3F B;  1DOL A;  2KED A;  2KEN A;  3U9T A;  4X3U A;  3R23 A;  3I70 A;  3F8T A;  4DAV A;  1ET9 A;  1E2V A;  2QEJ C;  4GKJ L;  3EBE A;  2IY5 B;  1GM5 A;  2MPM A;  3Q1K A;  2O4X A;  3GTQ H;  5LMN W;  2AUJ D;  1X65 A;  3CCQ A;  5I2X A;  4DUY Q;  4BBR B;  4IAJ A;  4LH6 A;  4XX0 B;  1X55 A;  1PFB A;  4ZKB B;  3CC2 A;  3M3Y H;  2CW8 A;  1RD9 D;  2NZO A;  2VA3 A;  3RZO B;  4MTD A;  1YNN C;  3P75 A;  4OIJ A;  1L0Y B;  4GKK H;  3N42 B;  4JW0 A;  2W9C B;  1IZ6 A;  4QF4 A;  4WJW A;  4DR6 H;  4ME5 A;  4FF3 A;  4ID6 A;  2E5L Q;  4ECR A;  2IA6 A;  3DM1 A;  4EGJ A;  4ZHQ F;  2F3V A;  3HKZ E;  3ULL A;  4R7R A;  1CS0 A;  1B7Y B;  4HCS A;  4HMI A;  1PTO C;  3H3V I;  5AFW A;  1H9M A;  3BA9 A;  2B29 A;  4O1N A;  3WOE A;  5C0X I;  1WD1 A;  1N34 H;  2UXC H;  3T53 B;  2HHH H;  4A3F H;  1R4Q B;  4P75 A;  4CKC A;  4HJ9 A;  1CSP A;  1VQ5 A;  4KD3 A;  5GRO A;  2IX3 A;  3SK6 A;  2FXQ A;  5GON F;  3M4O B;  5JVL A;  3PO3 H;  4DA2 A;  3PW5 A;  3DXJ C;  2FP4 B;  3CCV A;  2DNC A;  3CW2 C;  1I4H A;  3AFP A;  2WFW A;  4PZ7 A;  1ILP A;  1BVS A;  2SDF A;  3EN2 A;  1CSQ A;  1QNU A;  2PMZ A;  5IP7 G;  4EG0 A;  5M3F H;  4ME3 A;  2F0G A;  2CWA A;  3NK9 A;  4LF7 L;  2KA7 A;  3Q6S A;  4CDD C;  1CK1 A;  3KBX A;  1Y1W H;  3JRW A;  3MR5 A;  4GOP A;  1IYV A;  3I4N B;  4A3B G;  4HJ8 A;  2ES2 A;  4QUC A;  3VYR A;  3TEH B;  3OWE B;  1N32 H;  3PN1 A;  4MZ9 A;  3E0E A;  4DV7 H;  1SFO B;  3RIZ A;  2DUD A;  1GO3 E;  2UU9 L;  1SEI A;  1ILQ A;  1IBK Q;  4LF5 H;  1GSA A;  4OO1 H;  1E4E B;  3BQ1 A;  1JOK A;  5CV4 A;  3SE0 A;  2UUC L;  3ONA B;  2Q2I A;  5IGG A;  4OX9 L;  4DV1 L;  2KEE A;  3N52 A;  3VA7 A;  2RVL A;  1N34 Q;  2W9A A;  5E4W C;  3GQC A;  4IPG A;  5M5X H;  4JI8 Q;  2W71 A;  4P2C B;  1GXD C;  3GV8 B;  1W3S A;  1YNJ C;  4C5A A;  2KBN A;  1Y1W B;  2NN6 G;  2F0I A;  4RNM A;  3UDI A;  2ZTC A;  1R9T H;  3LGJ A;  4EBC A;  3VR6 A;  1RIP A;  4A3L H;  2MO1 A;  2JA6 A;  3TP6 A;  4DR3 Q;  3MXU A;  4IWX A;  3GD7 A;  5EPJ A;  3OSN A;  1Q12 A;  5IE8 A;  1B9N A;  3A54 A;  4F50 A;  1VQ8 A;  5EBC A;  4EQ5 A;  1I50 B;  5JPM C;  2NVY A;  3QZ8 A;  3Q2O A;  1EY9 A;  3MFH A;  1XDN A;  5KG7 A;  3I4L A;  1N32 Q;  3CRL C;  4DR5 Q;  1SCU B;  3VR2 A;  3G71 A;  4RNN A;  1FGB D;  4IRD A;  1SN8 A;  1K8G A;  1E7Z A;  3BDC A;  4A3C H;  4UCS A;  1IBK H;  4PMW A;  3OYY A;  1YNX A;  5C4X H;  4DR7 L;  4N9T A;  2R93 A;  2R7Z B;  4WRD A;  3KBG A;  4A3K G;  1I4G A;  1C4Q A;  2VQF Q;  4ECW A;  1TS3 A;  2UXB Q;  1VQI A;  4RAY A;  2F3I A;  3PIP A;  5KFM A;  4QIW A;  5FOB B;  4S3S A;  4DXG A;  1IOW A;  1BNC A;  1LT3 D;  2K1B A;  2L5T A;  4R4Q A;  3DF7 A;  3F8N A;  5KFU A;  3KDF A;  3T1H Q;  4JI5 H;  1NR4 A;  5IWA H;  3WNZ A;  1KC7 A;  3TQT A;  4MA0 A;  1MSG A;  3TZU A;  2I87 A;  4OX9 H;  1DCZ A;  3U9S A;  4C2M B;  2R7K A;  4DL4 A;  3DMU A;  1VQK A;  3GTP B;  1QIL A;  3BYY B;  5IYC G;  3QOJ A;  4NP5 A;  2G9H D;  3CP0 A;  1UNN C;  3BDO A;  2JA8 G;  3KYH C;  2W57 A;  2IP4 A;  2K5H A;  1IBK L;  4UHV A;  1I4Q A;  3UFX B;  1VQD A;  1KC8 C;  4B3T L;  5COR A;  4JBM A;  3ERQ A;  5M5W H;  1Q82 C;  3JC6 6;  3H0G G;  4RGN A;  3EPI A;  1CKN B;  5G3L D;  5IYC H;  2QEX A;  2D9U A;  1EYC A;  2OTL A;  2R8G A;  4O3N A;  5GQO A;  4MTK A;  2UXB H;  2B2T A;  4LF5 L;  4RUC A;  3Q8S B;  5C5L A;  3J81 W;  2X69 A;  3GIQ A;  1SYX B;  4P71 A;  4DV4 L;  1SE4 A;  2WAC A;  1SE3 A;  4GNX C;  2QIL A;  4JG2 A;  4B3M L;  3PR4 A;  3R8B A;  2YTY A;  3VYU A;  5DM7 3;  4HN7 A;  4GKJ Q;  3OW7 A;  4FM9 A;  2ASL A;  5C4X G;  3M4O H;  1VQJ A;  4HCE A;  3J81 L;  2N8N A;  1GOZ A;  3MFG A;  1ICF B;  1II3 A;  4GNX B;  4WBN F;  1EIY B;  3M9B A;  1E4F T;  4JBJ A;  3MXN A;  2CKZ B;  2J9G A;  3MR2 A;  3H6M A;  2LXJ A;  4HJ5 A;  1C48 A;  3D8G A;  4DUZ L;  4HJA A;  1HRJ A;  4DL7 A;  2K14 A;  4LF6 H;  2F0N A;  4X64 H;  1UE7 A;  1XJV A;  1NJI C;  1WTP A;  1YHQ A;  4H0L C;  4MIU A;  2YU9 H;  2GPW A;  2W6M A;  2V4Q A;  3DWQ A;  3V96 A;  2VUG A;  4DXF A;  3PIO A;  2PN1 A;  3OOC A;  3HOX B;  4IFD J;  1KDA A;  1UE6 A;  4A3J G;  2CQO A;  3SDZ A;  2VPQ A;  3V6H A;  3K5H A;  5KT5 A;  4QL5 A;  1ASZ A;  3R5X A;  3HOV G;  4I7Z C;  1KAW A;  1PYW D;  2PW7 A;  2YYA A;  1EFI D;  4YR3 A;  3G4S A;  4KN4 C;  5C5M A;  1KJI A;  2DGY A;  5FD6 A;  1EY7 A;  4DUY H;  2E2D C;  1QWY A;  3R3O A;  4F88 A;  1MHW C;  2GPS A;  2TSS A;  1F2L A;  1B44 D;  3N6R A;  2FIN B;  3DLL A;  2ASB A;  1I7N A;  5KFP A;  2BCO A;  3HRZ C;  2E76 C;  1NMG A;  1N36 Q;  2ZDH A;  5JJZ A;  2ZXR A;  3NGD A;  5CC4 A;  3D4D A;  2L55 A;  2FPP B;  3U4Z A;  3G6E A;  1QZG A;  5KFH A;  1GHJ A;  1EQQ A;  2UXD L;  1OWT A;  2RDI A;  4ED0 A;  1EYA A;  1VQH A;  4LUO A;  1T9H A;  2WB1 E;  1NTG A;  2J4X A;  3KLS A;  5E3F A;  3SHL A;  4X62 L;  2YZM A;  2JA7 A;  2Z1C A;  2B2Y C;  1MBY A;  4GN5 A;  4R8I A;  1T3N A;  2NZH A;  1IBL Q;  1VQ9 A;  1Y1W G;  3TBI B;  4IUV A;  5LMU L;  2LSS A;  1S5C D;  1A2T A;  1SSO A;  4HJ7 A;  4A3E H;  5DQG A;  4A93 H;  4DNR B;  2VQE L;  3STB C;  4LH7 A;  4P74 A;  3GTK B;  1D8L A;  5M3M G;  2R7Z H;  4EQP A;  2YYZ A;  4X64 L;  5K2M A;  4O2B F;  1WD0 A;  1BBW A;  3OTO L;  4UFZ A;  1K28 A;  3SK4 A;  3K6O A;  5JEA J;  1JJC B;  1FNW A;  1S4Z A;  4IJH A;  2IT1 A;  5IYD G;  5BPH A;  5M9O A;  2EY5 A;  1DM0 B;  3QZ7 A;  2RQX A;  4ZUI A;  2ZTD A;  4DK3 C;  5KX5 F;  2WAQ E;  4EFE A;  4AH6 A;  4IFD G;  4ZRZ A;  1E0B A;  1KNA A;  4CHT B;  1B3Q A;  4UAI A;  4L63 B;  2YS6 A;  3FKI G;  3H40 A;  2WB1 A;  1E1O A;  4ZKC B;  3ULJ A;  2JK8 A;  4HR7 A;  2L9H A;  3MEH A;  1B6R A;  2K7V A;  1TVX A;  4HID A;  1K1Q A;  1EHI A;  4L1K A;  3RV3 A;  2NU8 B;  3NBH B;  3V6K A;  4A3I H;  1JR0 D;  2ZM6 Q;  4Q0Y A;  3HKZ A;  5KFZ A;  4JK1 C;  4JI2 H;  3GV7 B;  1X54 A;  4C2M H;  2VS1 A;  2Y0S G;  1WJJ A;  4LW1 A;  4L5S A;  4RB2 C;  4O3P A;  5L1L A;  2W7O A;  3K7A H;  5IGB A;  2F0D A;  5KFV A;  3IFD A;  3R93 A;  2Q2T A;  4RZQ A;  5IIF A;  4KJN A;  2YRX A;  3NTI A;  1GJX A;  3M9N B;  1WYD A;  1MZB A;  1XX8 A;  3WO0 A;  1KRS A;  1TWG B;  4DL5 A;  3A55 A;  5JVD F;  1DYQ A;  1GUN A;  2FK3 A;  3E0J A;  5HY6 A;  4CDF C;  4K5W A;  1XNR Q;  2XIG A;  1J8I A;  5FD5 A;  3PO2 G;  4LFB L;  3VR4 A;  4C1N I;  2QKI C;  5C0X G;  4BXX H;  3MFI A;  3PGZ A;  4QUF A;  1JDE A;  2Z6K C;  5FPO A;  5KG1 A;  1TR5 A;  1UE1 A;  5FLX c;  1KBL A;  4Y8V B;  4A3M G;  3GP7 A;  2AGQ A;  2MNA A;  2C00 A;  1PFN A;  1PH6 A;  2KHI A;  4X62 H;  3NEN A;  5BR8 L;  1DOK A;  5JPN C;  1C30 A;  3T13 A;  4DU9 A;  3MWM A;  3I55 A;  4ZQ3 A;  1KAB A;  1T36 A;  3J81 c;  4TQU S;  5E4X A;  2A6H D;  1Q81 C;  2EDG A;  2K6A A;  2MO0 A;  2JA5 H;  1TWA A;  3RD4 A;  4U67 3;  3A0J A;  4ED7 A;  2BE5 D;  1NAP A;  5FJ8 G;  3I7F A;  1AE2 A;  4IR1 A;  5KG4 A;  4AYB E;  3GTK H;  1STG A;  4PMC A;  3TS0 A;  3GTO B;  1KJ9 A;  2R8H A;  4FS2 A;  1VMC A;  1X3Q A;  2CW7 A;  5JEA H;  2E2J B;  4YB8 B;  3S17 B;  2JA6 H;  1XTD A;  4WJ3 M;  1H9R A;  4HMJ A;  1XXG A;  2OF1 A;  3SK8 A;  4QWD A;  1MGS A;  2K28 A;  4KKT A;  2JYO A;  3OSO A;  2VPS A;  2UUA H;  1SYC A;  2F0Q A;  3R5H A;  2LFN A;  4GKK L;  3C46 A;  4BY7 H;  1JXL A;  3UDF A;  5F2D A;  4CJ2 C;  1N33 Q;  4DV1 Q;  2K5N A;  3PVX A;  1HNZ H;  3D6C A;  4QWE A;  4K6L A;  3CF5 A;  3RR5 A;  4LAA A;  1CTM A;  1X3P A;  3GTG B;  4Q0F A;  2NYZ D;  5TSS A;  3I4M G;  4XYM B;  2W7P A;  4ECT A;  4IRK A;  3A5U A;  4NW2 A;  1YNN D;  3RJ0 A;  1NR2 A;  3PV0 A;  1Z6H A;  3K57 A;  4O3S A;  5KKN B;  2GN5 A;  3S17 H;  1BUV T;  4U68 A;  1HNX L;  4LUZ A;  4FDB A;  3STB D;  3RBD A;  1BQQ T;  1X9N A;  4CKE A;  3RB6 A;  1NUC A;  2JQO A;  4XXE A;  4J9L A;  2RA4 A;  2CFM A;  1XPR A;  1BJT A;  4LF9 L;  2HHH Q;  3OMG A;  4FF2 A;  2VXW A;  4GN4 B;  5DEH A;  3J7A V;  5K36 H;  3VDY A;  3G6J B;  3PR5 B;  2ASD A;  3NXW A;  3N6X A;  2HVS A;  2W70 A;  5KT3 A;  3F2C A;  2ZJR A;  1CA6 A;  5C3X A;  4B3S H;  4HAE A;  3UDG A;  1CA5 A;  2L0C A;  2WAQ B;  3HXL A;  4DV3 L;  1O7I A;  2ID0 A;  5CV6 A;  1I7L A;  4AQY Q;  1HNW H;  1U0L A;  2BQ3 A;  3ND8 A;  3N44 B;  3CCE A;  3QJY A;  4QW8 A;  1D5M C;  1QB5 D;  3AFQ A;  2JEG A;  1R9T B;  3RV4 A;  4N9P A;  5IYB G;  2Y0S A;  3OIQ A;  4NPS A;  2R86 A;  1CE8 A;  4R4T A;  3CD6 A;  2F0F A;  1YIT A;  4PNY A;  2ICI A;  4ALP A;  3GTM H;  1EUD B;  1LTI D;  5C4H A;  1HUN A;  3L4J A;  1H9K A;  2R61 A;  1D1K A;  1Y1V B;  1J5E Q;  5IP9 H;  5DM6 3;  4IFD H;  3MA2 B;  3I56 A;  4LF7 Q;  2C28 A;  2DY8 A;  1SNQ A;  3S16 H;  3WOF A;  4LF4 H;  4UCO A;  2LXK A;  1GUO A;  4RGT A;  1DV2 A;  2YZG A;  5EZY F;  4LF8 H;  2ZXO A;  5CA0 F;  2VB3 X;  2QA4 A;  3OHA A;  5EKL A;  1VBG A;  4JOI C;  4CDC C;  1EOT A;  1RHP A;  2Z0S A;  3I4M H;  4WD3 A;  1P8L A;  2RHS B;  3Q8P B;  1K3R A;  1SXT A;  4ODG A;  1S5B D;  3LX0 A;  3R2T A;  2QGQ A;  3KHR A;  4JI3 Q;  4YQW A;  2FK2 A;  4DR4 Q;  5D1P A;  1YHB A;  1WCM A;  4KJO A;  5IP7 H;  2A6E D;  1VQG A;  4G7H C;  5C4J H;  1QG7 A;  3HFZ B;  3KF6 B;  1S0N A;  3PO3 G;  3G6Y A;  1Z2O X;  2UUC H;  5KT4 A;  1JQY D;  4BA1 I;  1RJP A;  4NLG A;  2E2I B;  4LSA A;  1ZYR C;  2JA8 H;  4ED6 A;  3A5Z B;  5IWA L;  2BDN A;  4OWW B;  1K1S A;  2DN8 A;  3D4W A;  2YW2 A;  2V4D A;  5FKA C;  3LWE A;  1SAP A;  4CGY B;  5AJ3 L;  2HUG A;  2EYO A;  2MUY A;  3X3M A;  1EZ8 A;  1K0S A;  3KDF B;  3BZD B;  4JI5 Q;  3T1H H;  2BE5 C;  2W6Q A;  4X66 L;  2HDL A;  2IW3 A;  2PQE A;  3IL8 A;  1I6H B;  2HVR A;  4R8N A;  3M85 A;  4B08 A;  2PQA A;  2ZTE A;  4DV6 L;  3A8J E;  5KNC A;  3BG5 A;  4Q8E A;  1KLG D;  2B2T C;  1IYJ B;  4DV7 L;  1SMY C;  1ESF A;  3BA8 A;  4RUA A;  1NMF A;  3N43 B;  4HSP A;  4B9W A;  2AQ3 B;  3W2D A;  3PW4 A;  2KCN A;  3QB3 A;  3Q22 A;  5ELB A;  1S68 A;  2PYK A;  4XT3 B;  4DL3 A;  3K5L A;  1TWF H;  4BWS C;  2NU9 B;  2K75 A;  1CFM A;  1HZC A;  4QWC A;  5DG7 A;  2H4O A;  4KY7 A;  1EIF A;  5C1O A;  3SK5 A;  3K5N A;  2XSC A;  5C44 H;  1S5D D;  1VQF A;  4XTC S;  4LFB Q;  1ENA A;  1UEB A;  5A35 A;  1RF2 D;  1GSO A;  5FLX E;  4A3L G;  4MTN A;  4NDX A;  4Y7N B;  3KHG A;  2ZT9 C;  2RKS A;  3I2Z A;  3GTM B;  1I6H H;  1JOO A;  3CQZ B;  4KHP Q;  1V4Y A;  3FPU B;  2XN9 C;  2FMM A;  4IOA A;  1N48 A;  4ZOL F;  2WE6 A;  5K36 G;  2VW9 A;  2E2H H;  4MTE A;  1H9S A;  2A74 C;  2PI2 A;  4KKS A;  4DV5 L;  2XGP A;  1HR0 W;  1EWI A;  4JI7 H;  4B3R L;  4JI5 L;  4IUR A;  3J80 c;  1AEX A;  3CCM A;  3GTL A;  5IGE A;  5C0X H;  3KJO A;  4BBS H;  3S2H B;  1DV1 A;  2F1M A;  2EXZ A;  1HR0 L;  5LMN L;  1PH4 A;  4MV7 A;  1A63 A;  4DV0 H;  5CA1 F;  1K83 A;  3ETJ A;  1N56 A;  5J22 A;  2DIK A;  1ONL A;  3V2T A;  3S1M H;  2C35 B;  2EYH A;  2HQE A;  3BYT B;  1AE3 A;  2B2V A;  2KHS A;  3RUP A;  3EQL C;  2C2R A;  2VUM A;  1S03 G;  5KFG A;  1ET6 A;  1L1O A;  2LMC B;  5BN5 A;  2XRS D;  2PW5 A;  4IUU A;  3VR3 A;  4UCR A;  3H4D A;  4CDE C;  4IOC A;  1TWF A;  2BQU A;  1VQM A;  1Y8N B;  2A73 B;  4QMG A;  3FPP A;  1UC9 A;  1VQO A;  1F9P A;  5HUR A;  5JVH 3;  4NXM Q;  1B33 N;  2F0U A;  2K5Q A;  3K3P A;  1L2F A;  4APM A;  3AB9 A;  3RMH A;  1Y69 U;  4MV8 A;  1A8V A;  2NN6 I;  3HKZ G;  1Q86 C;  2F0W A;  5HGQ A;  4N8X 1;  4DN4 M;  5M3M H;  1B4O A;  4JI4 Q;  1E4E A;  5CBE E;  1XMO Q;  4C3J H;  2VB2 X;  2XIW A;  1CHP D;  2W6Z A;  5C3E B;  4DR2 Q;  1W6J A;  5KFJ A;  4B3M H;  5D14 A;  1DJR D;  3M7G A;  5T1I A;  4PG3 A;  3J80 W;  3RB0 A;  3GTQ A;  1TWC B;  2XCL A;  1WI5 A;  1N8R C;  2VUM H;  4KTA A;  5CMD A;  2F3W A;  3I4O A;  1Z2N X;  3V05 A;  2E5L H;  1MJC A;  4K0K H;  4MNO A;  3TN2 A;  4Q45 A;  4RKL A;  5I9P A;  2EYP A;  1G2T A;  1M8A A;  2KCC A;  4LFC H;  3FKI B;  4JPB W;  1B1Z A;  1OO9 B;  2R85 A;  4EEY A;  2AWO A;  3OSP A;  3WO1 A;  3VYT A;  2JP1 A;  4KHP L;  1RJR A;  2K03 A;  4O2D A;  5DLQ E;  1D2B A;  3EPG A;  1PZK D;  1SNP A;  1S9F A;  4O3O A;  1I50 A;  3MR3 A;  1JCK B;  4H44 C;  2C5C A;  5KIX A;  1EQV A;  5JJI A;  2B2W C;  1KJQ A;  4A76 A;  3SGI A;  5CV8 A;  3CVZ A;  4RHR A;  2ZM6 H;  2CVR A;  3CCJ A;  4A3J B;  2VNU D;  1IL2 A;  1F2M A;  4O4H F;  1M6V A;  1HCZ A;  3K81 C;  1F2Y A;  2AMC B;  3ERS X;  1N9W A;  4YAJ B;  1RKN A;  4ZI7 F;  4CC5 A;  2EYL A;  4J9N A;  4F4W A;  3KTM A;  4LMY A;  4YWK A;  3S2D H;  4WOR A;  1V1P B;  2QDL A;  1Z7T A;  5C4J B;  4OEM B;  2W9C A;  1TA8 A;  2KOL A;  1IBL L;  4QW9 A;  2K52 A;  3NE5 B;  1NE3 A;  1FNU A;  3G7L A;  4M8A A;  3KLR A;  4JV5 L;  3DEO A;  4DV0 L;  4DR1 L;  4CC6 A;  3CPF A;  1EUJ A;  1EU3 A;  1PRT C;  5EKI A;  3SR1 A;  1O80 A;  3TP8 A;  2FLL A;  4OO1 G;  4X65 H;  5LMU H;  4E4T A;  4C56 C;  1IBM L;  3WWV A;  3PSI A;  2MFI A;  2VZA A;  4X65 L;  1O7Y A;  3E9H A;  5IT9 L;  4BBR H;  4PWQ A;  2B63 G;  1JKJ B;  4YR2 A;  1PH7 A;  2DPI A;  3U50 C;  2LY7 A;  3HS0 C;  4A3C G;  1HJP A;  1PHJ A;  4J9O A;  4A3B B;  2OQK A;  4DR7 Q;  5DLG A;  3KF8 B;  1R4P B;  4LFA L;  3HKZ B;  1F77 A;  1JMC A;  2R8J A;  4B9X A;  4U7C A;  1VQA A;  4R8U B;  1JB3 A;  5HV6 A;  1SNO A;  1Y1V H;  5DG8 A;  2OT2 A;  3GII A;  5KT6 A;  1MD2 D;  1B04 A;  1XWE A;  2BA1 A;  4DR4 H;  3CC4 A;  2B2U A;  1CQJ B;  2XD4 A;  3HOU H;  3GO5 A;  2R92 B;  4UY8 C;  5L1K A;  3TZD A;  4NXN L;  4IJL A;  3SVM A;  4I50 F;  2C2D A;  1SFO A;  2XC9 A;  3SE7 A;  1A3T A;  1U5K A;  4AYB G;  2VOB A;  2EOT A;  5CAE B;  3BQ2 A;  4OWX B;  1GD7 A;  4IPC A;  3C1E A;  4DV3 Q;  4J9P A;  1VQB A;  3IKJ A;  3N41 B;  5LYJ F;  4A3E G;  3S2H H;  3GTO H;  2E74 C;  2B63 A;  5CV5 A;  5KEE A;  1VBH A;  2UUA Q;  4DPG A;  5D8D A;  1ZQ7 A;  4O3Q A;  5LP6 F;  3I4N H;  4FS1 A;  4L6T B;  4ZYS A;  4X6A H;  2WII B;  4YY3 Q;  3MAQ A;  1BBU A;  4ECV A;  4J9M A;  1PRT D;  5KYL A;  5A2Q L;  4ED2 A;  1KIX A;  4PQX A;  1F9S A;  1PTO D;  4ZUJ A;  2NVX B;  2TMP A;  4HSV A;  3RUZ A;  2IL8 A;  2PZT A;  3K0X A;  5JOB A;  1XMQ H;  1TWA B;  1J6Q A;  1QVF A;  1EWC A;  3TIN A;  4FBT A;  3S9W A;  4GC7 A;  1HFG A;  4KD4 A;  2F0L A;  2Z9H A;  2RDF A;  2AKW B;  1JT8 A;  1GUS A;  3TQ1 A;  5FPR A;  2DPJ A;  4DR5 L;  1QUQ B;  1ZKO A;  4IWY A;  5IT9 E;  4JYA Q;  2BH8 A;  1FJG L;  2IPK D;  1QE6 A;  3H0G A;  2O2L D;  5BN3 A;  4GS3 A;  4PZ8 A;  5D65 A;  1WVL A;  2XTI A;  2R7Z A;  1IW7 D;  5EGT A;  4JI8 H;  1JX4 A;  5KFD A;  4DV3 H;  3KUP A;  3K59 A;  2HJW A;  3Q8Q B;  5HBR B;  3S24 A;  3ULP A;  4OO1 I;  4NXN H;  2KCM A;  3PO2 B;  1Q90 A;  2F0S A;  1QVC A;  1M0W A;  2KSW A;  1L0X B;  3KFU A;  1NBW A;  4HIM A;  1CI3 M;  3J80 i;  4DR3 H;  3GTJ B;  4YY3 H;  4DNI A;  3CCR A;  1UEA B;  2KCT A;  5DAU A;  1AFP A;  3M3Y B;  4QJF A;  2EY1 A;  3RB3 A;  1RTN A;  2J7Z A;  1QJO A;  3GTP A;  1VQ7 A;  5AJ3 Q;  5A2Q E;  2W6P A;  3J80 E;  1LTS D;  1YNJ D;  5GAD C;  5D1O A;  1TY2 A;  3JAM W;  1BOS A;  4DR6 Q;  4A3M H;  3RZD B;  2E2H A;  1U4M A;  2W8K A;  3RTX A;  1PK8 A;  2XNA C;  1OXT A;  2XRQ D;  3I12 A;  4JYA H;  3PUW A;  3FVQ A;  3MJF A;  5EOY A;  2A6E C;  3F2U A;  3CCU A;  2LS0 1;  3PO2 H;  3VPC A;  4LF7 H;  2QCP X;  4IO9 A;  1FJG Q;  2NVY H;  4BY1 H;  1YI2 A;  1D6E C;  3GTK A;  1LM0 A;  2R8I A;  3GTJ H;  1VQE A;  5FO9 B;  2JEF A;  2R93 G;  5KFF A;  1G6Z A;  3JRX A;  3A74 A;  5IWA Q;  5M3F B;  3MXP A;  1HNZ L;  1RCV D;  1E4G T;  4JVZ A;  3KAL A;  5KFY A;  3JAM L;  5IOC A;  4YCU A;  1HNW Q;  1Q3L A;  4IUP A;  1STB A;  2EZV A;  4F4Z A;  4O0A A;  2H5X A;  3F1Z A;  5KNB A;  1YJW A;  4JI1 H;  2KHJ A;  2MGS A;  4JI3 H;  1I3Q B;  1E22 A;  5L9X A;  3NSW A;  4LF9 Q;  4Y52 H;  4BS9 A;  4B3T Q;  3UE1 A;  3MHB A;  1Q1B A;  4JC0 A;  3PUV A;  1U9R A;  4YHH Q;  2AGP A;  1GSH A;  4K6D A;  4ZLT F;  5FLX W;  1I6U A;  5IOD A;  4JYA L;  1K8O A;  4RG1 A;  4QIW E;  5J2T F;  3V6J A;  1CZW A;  3BZK A;  5BN4 A;  3A7A B;  3S16 B;  2FLP A;  4ME6 A;  2YS7 A;  4BY1 B;  4RCN A;  3QG1 A;  5IY0 A;  3TP5 A;  4EGQ A;  4LF4 Q;  4J8Q A;  5M5X B;  4TQR A;  4HNV A;  3K5O A;  4FVM A;  3ORQ A;  1RTO A;  1PH8 A;  3KAJ A;  2V58 A;  1FD7 D;  4YAK B;  1XPU A;  2PO4 A;  4FNF A;  4ULL A;  2UXC L;  1B6S A;  4XYL B;  3H94 A;  3L7Z C;  1QZH A;  1E1T A;  1V43 A;  2YTX A;  1D5X C;  3J7Z C;  1TXY A;  4FF4 A;  1EY0 A;  3GV3 A;  2R7M A;  1B50 A;  1K73 C;  1EIG A;  5J3B A;  4HIO A;  3T1Y L;  1QNK A;  3MXG A;  3L0O A;  3DEP A;  2L11 A;  4R4C A;  5CV9 A;  1X6O A;  2E2I H;  3TIG A;  4C3H B;  1PRT F;  1GGO A;  1SJE D;  1MKH A;  3T16 A;  2UUC Q;  1EYG A;  4JV2 A;  2P0A A;  2I0Q A;  2E2I A;  1NCV A;  5C4X B;  4DLK A;  1N32 L;  1LT5 D;  1Q46 A;  1LT6 D;  4I55 F;  1UNS A;  3DUZ A;  1JOR A;  2YU9 B;  4G7O C;  2HQL A;  1ROD A;  3CC7 A;  3K58 A;  2I8C A;  4MAM A;  3NWT A;  4A3D G;  4WJ4 A;  3BS1 A;  2DLN A;  5JQW A;  5ELE A;  5GAH C;  2JA7 B;  3BG3 A;  2NUC A;  4KN7 C;  4POG A;  4ETS A;  2WAQ G;  3IFT A;  3T56 B;  4LF4 L;  1A3V A;  3I91 A;  3PMF A;  3L2P A;  2HT1 A;  4G57 A;  5JJL A;  4A2A A;  1HZ9 A;  4ABN A;  2M2L A;  4DV2 Q;  3J7A F;  4U6P A;  4MN3 A;  2F0O A;  4HED A;  1LTL A;  1HNW L;  2WV6 D;  1SYD A;  1I94 Q;  3I72 A;  1ENF A;  3NTH A;  4DNT B;  2DJG C;  3T1H L;  1ML0 D;  2NVY B;  1KRT A;  5IP9 G;  1L2Z A;  4K2L A;  3Q0A A;  5CR3 A;  3HOX H;  4C3J G;  1STA A;  1TWA H;  1RYS A;  4JI0 H;  5IGC A;  1BXR A;  2FFK B;  5C6A A;  1PFM A;  5C3E G;  3WDN A;  3PUZ A;  3L3O C;  2NVT B;  5LL6 S;  4M9U A;  2ALY B;  2OXP A;  2SOB A;  3S14 B;  2N49 A;  2C9O A;  3HEJ A;  3DHQ A;  2FKL A;  4O3R A;  1BCP C;  2FPG B;  5KFQ A;  3T1Y H;  5EKK A;  5EQ0 A;  4Q43 A;  4YBZ B;  1G2S A;  2P5Z X;  1M7J A;  4QIW B;  2F4V Q;  1K3B C;  3CQZ H;  1CQI B;  2ZDG A;  1Y1V G;  3RLO A;  2ZXP A;  2WKD A;  1HA5 A;  4IUQ A;  2RSN A;  4A3G H;  4ED1 A;  4A3D B;  3I8Z A;  2VQE Q;  4JOI A;  1TS4 A;  2Z8L A;  2K32 A;  2ENB A;  5IGF A;  2PNR C;  4HR7 B;  4P72 A;  3BJU A;  2R92 H;  3L4K A;  5T1G A;  3HOZ B;  2V9W A;  3PF5 A;  4DV2 H;  4Q5V A;  4BBS B;  3TQY A;  2UUB Q;  4YCV A;  3JAM c;  3RF2 A;  1KQS A;  1TT2 A;  1V8Q A;  1M90 C;  2AGO A;  4X62 Q;  4XQQ A;  2HIV A;  1CKO A;  2J6S A;  1VQ4 A;  1SR3 A;  3GTG H;  1SRO A;  3OPO A;  2RDH A;  2NZ1 D;  3M4Y A;  4EVO A;  4IN3 A;  3OIP A;  3BJY A;  3T5L A;  2RDG A;  2ASJ A;  4APV A;  2B2W A;  5C5J A;  3JSN A;  1S3O A;  3M4I A;  5KFI A;  4A2B A;  2V4R A;  5FLX L;  5KRU A;  3KOJ A;  3BDL A;  5JJK A;  1M0T A;  3N8D A;  5KFB A;  3RAQ A;  1YBY A;  3PQI A;  2CQY A;  2FMA A;  1IXR A;  1AZP A;  4A3B H;  4QCL A;  4B3R Q;  1O7L A;  5EDW A;  5KFN A;  3BZC A;  5EBD A;  1A62 A;  3HOY B;  5M3F G;  4DV2 L;  4EFB A;  4TUY F;  1PMR A;  5A2Q W;  2RHQ B;  3NQT A;  3PZP A;  2Z4H A;  1SE8 A;  4JI7 L;  3P1H A;  1JWS D;  3IAY A;  4ECX A;  3E5S A;  1N33 H;  3D0F A;  3LNN A;  4OXP A;  1PA6 A;  2PNH A;  4DV1 H;  1IBM Q;  2JA6 G;  1I4P A;  3EYY A;  4BBR G;  3UE0 A;  3HOW H;  4DUZ H;  4A75 A;  1WTQ A;  3EIV A;  3U4V A;  4DK6 C;  4NKL A;  4F8M A;  4A93 G;  1W93 A;  1FVI A;  2JA6 B;  2VA2 A;  2UVU A;  4R1J A;  3BVG A;  4PDB A;  1STY A;  4A3I B;  1JIC A;  4FXD A;  1TWC A;  1EYD A;  3J81 j;  4GC6 A;  1RJQ A;  5KT7 A;  2H1E A;  2MJ8 A;  4R4I A;  1EY5 A;  1W2B A;  3JSL A;  2L15 A;  3K3V A;  1YEZ A;  1TS2 A;  3QR8 A;  2J0T D;  4J15 A;  3RGX A;  4N8F A;  4O42 A;  4FXG C;  3TDQ A;  1HR0 Q;  4DAY A;  4AYB A;  3MC0 B;  2MHV A;  4CJ0 B;  2R84 A;  1FKA H;  3K8A A;  4X3S A;  4E6I A;  1IKL A;  2B2V C;  1XTC D;  1OTC A;  4LF6 L;  1WSC A;  2VQF L;  4DK1 A;  5KG0 A;  4C5C A;  3J7A K;  3M9M B;  4XZ3 B;  2X6L A;  1U4P A;  3KAK A;  2DJF C;  5IGD A;  5I9O A;  4M1U B;  3X3N A;  1AZQ A;  1RK5 A;  4A3G G;  1S97 A;  3HOW B;  3NBI A;  3GIP A;  3N40 P;  4MV1 A;  4DR7 H;  2R3Z A;  1B53 A;  3C0F B;  3EFX D;  3MWE A;  4JI6 H;  4JI1 Q;  1YJN A;  1S0O A;  2EY2 A;  1RYR A;  3TII A;  2B2U C;  4J9K A;  1SYE A;  1EFW A;  4AQY H;  1ULZ A;  4K8J A;  2UVV A;  5LHY 1;  1H9J A;  5IT9 c;  2NWG A;  2HCC A;  5ELC A;  4L5Q A;  4B3T H;  4DUY L;  3JAM E;  4G7Z C;  3FDS A;  2MP1 A;  4UP7 A;  2NVQ B;  1S5F D;  1EL0 A;  2WIN B;  4M7E A;  3GQB A;  1U4L A;  3C1F A;  4JBW A;  5KT2 A;  1HUM A;  2A68 C;  1IYU A;  4LFC L;  2UXB L;  2R7L A;  2WTF A;  4ZAI A;  1HR0 H;  2JA5 A;  3OWF A;  2VQF H;  4HNT A;  5DQI A;  2RGV A;  3G48 A;  2HVQ A;  1KTK A;  4IZO A;  2AU0 A;  5I47 A;  2UXC Q;  4TRD A;  4R4O A;  2NUA B;  3H3V H;  1OXU A;  3BVZ A;  2EYF A;  2OH2 A;  1PV4 A;  4V19 0;  2NTT A;  5I6Y A;  1X3E A;  4ECZ A;  4LF8 Q;  1NY4 A;  1PYB A;  4KHV A;  1C3O A;  5KFR A;  1VQL A;  2K50 A;  4GLX A;  1AN7 A;  2K33 A;  1JOQ A;  2CW0 D;  2NU6 B;  4XIG S;  1LO5 D;  4EQN A;  3RAX A;  1G51 A;  2X6G A;  4JI2 Q;  1PH2 A;  3K80 C;  2JEI A;  5D3I B;  4IRC A;  4O2A F;  2XCP A;  3TME A;  4EGV A;  1CUK A;  5KYI A;  5LL6 b;  1R9T A;  5E1F A;  5EWG A;  1LAB A;  3KLS X;  3PW7 A;  2O03 A;  1HZA A;  1O7Z A;  2AUK A;  1BF4 A;  3GID A;  4RKB A;  4Z9C B;  3S14 H;  4RGM A;  4FYD A;  2B8G A;  2G5D A;  4O4L F;  3HB9 A;  5KFL A;  4JI6 L;  3CQZ A;  1M1K C;  4DR3 L;  3OHX C;  4LNQ A;  3RBE A;  3RLN A;  1UAP A;  1OXX K;  5DG9 A;  2XWJ B;  2I5M X;  4YWM A;  1U4R A;  5I2Y A;  3NBH A;  3J7A 5;  4ECU A;  1TWC H;  2Q8I B;  3H3V C;  2ZM6 L;  2PMZ B;  2LKV A;  1K9M C;  2WB1 G;  1CKM A;  2YCH A;  1JE5 A;  4XT1 B;  1X3G A;  4GLA C;  1T5E A;  4C3H G;  2HDM A;  2AQ2 B;  4RB0 A;  1AP0 A;  1JWM D;  5BMV F;  4PZ6 A;  4RB3 C;  1XMQ Q;  4LFA H;  3S1R H;  1Y14 B;  5BR8 Q;  1L1O B;  3I90 A;  3ERO A;  3PO3 B;  4L8J A;  4K8I A;  4JI0 Q;  4I65 A;  3LP8 A;  2ZJT A;  2A6H C;  3KHH A;  1KDB A;  4IHJ F;  3KK7 A;  3KF6 A;  2A69 C;  1UWV A;  2ZDQ A;  1J5E H;  3K5I A;  4JBK A;  1IKM A;  1I4R A;  1PDQ A;  3HP3 A;  1B9M A;  3W1B A;  3D3R A;  4AQY L;  1AN8 A;  1MJE A;  1HXY D;  4LSX A;  2N78 A;  1FJG H;  4JCV E;  2JXM B;  4YCW A;  4NXN Q;  4BY7 B;  3ETH A;  5CV7 A;  1RK6 A;  4JV1 A;  1LT4 D;  1PH5 A;  2R7Z G;  3BVM A;  2CH4 W;  1Y1W A;  1AW7 A;  5ELF A;  3NEL A;  1Q8I A;  4IZ8 A;  2A8V A;  3GTJ A;  3F2D A;  3J80 L;  5LA6 F;  3B6Y A;  2F0M A;  1V51 A;  2RCF A;  2IJ0 A;  2NBF A;  3SEB A;  3GTQ B;  4JI2 L;  2B2Y A;  2E75 C;  2GLT A;  1HFN A;  1LV9 A;  2SNM A;  2K01 A;  1MIU A;  3R5F A;  3F2B A;  3CCS A;  1LUZ A;  4JI7 Q;  4DV7 Q;  1GYF A;  5BR8 H;  3GDE A;  2WYO A;  2RSO A;  1KLU D;  4C5B A;  3CXC A;  4XQJ A;  4X3K A;  4C3J B;  1N36 L;  1EUC B;  2KUM A;  1BO0 A;  4YHH H;  1OXV A;  5JVG 3;  4Q44 A;  1SJH D;  5ELN A;  4V0B A;  3GTP H;  2R92 G;  2K04 A;  1NSN S;  2FHT A;  2E2J H;  3H15 A;  2GA4 B;  4HTH A;  1WFQ A;  1UE5 A;  2W6O A;  2QYZ A;  1HQM C;  2XVS A;  5C8Y F;  3VR5 A;  1XNQ L;  3GIK A;  1VQP A;  4EYH B;  4OGQ C;  4DR4 L;  4DF7 A;  1GHK A;  5EAY A;  2WDT A;  3HOU B;  2G9D A;  1WTR A;  1BNZ A;  5KFE A;  5ISR A;  2KJX A;  3GV5 B;  5C0X J;  3MFY A;  5M5W B;  3TS2 A;  3QIA A;  4QWA A;  4GLV B;  4B3S Q;  3BAA A;  1LTT D;  3QFF A;  2UU9 Q;  4ECY A;  2WB1 B;  1V1P A;  4JV5 H;  1F2Z A;  4DR6 L;  1F9R A;  2WKC A;  4I7A A;  4F4X A;  4K5X A;  2F0J A;  1BCP D;  3MWY W;  2R93 H;  3S1N B;  3S15 B;  3MTS A;  3BAB A;  2C22 A;  1MSH A;  1I3Q A;  1G29 1;  5KG6 A;  1IBM H;  4LF9 H;  5BPF A;  1M4V A;  2F0K A;  3CPW A;  1Q7Y C;  1STH A;  1QVG A;  3CRK C;  1KXL A;  4ED3 A;  5KG5 A;  4KY5 A;  4IPH A;  2L4N A;  4EYI B;  1K8A C;  1DZ1 A;  3CAM A;  4B3M Q;  5KFX A;  3ORR A;  4LF8 L;  4MV9 A;  2NVX H;  1T5X D;  4EX5 A;  4G3I A;  4IQZ A;  5C3W A;  5H1S E;  2UUB L;  3CHB D;  5NUC A;  2FK1 A;  2EY6 A;  3FHW A;  1TWF B;  4EBD A;  3KF8 A;  4K0K Q;  2W9B A;  3O13 A;  2PZW A;  2C2E A;  5CGK A;  3V4S A;  1XNR L;  1PTO B;  1KJ8 A;  2JEB I;  3RZO H;  3ICE A;  4LFC Q;  1PH9 A;  2R7N A;  1QOH A;  5EPL A;  4J9R A;  1PRT B;  2EJG C;  3GIM A;  2R7F A;  1VQN A;  2JEJ A;  4C3I G;  3VPB A;  2MQH A;  2FJZ A;  2GVB A;  5ELD A;  4DFA A;  2EVB A;  2UU9 H;  3A7L A;  4KV6 A;  3P20 A;  4JV5 Q;  2JA9 A;  1I3Q H;  3U58 A;  2X0S A;  4B3S L;  4JI8 L;  2A69 D;  3HOW G;  5I4D A;  1VMP A;  1I50 H;  3SXH A;  4UP9 A;  4ZCK A;  1PH1 A;  1PTO F;  3IG0 A;  4JI3 L;  2CW0 C;  5JEA G;  2JE6 I;  4F87 A;  3H20 A;  1PYS B;  4DR2 H;  4I4T F;  1EY4 A;  2XGT A;  1EY6 A;  2EIF A;  1JWU D;  1Z9F A;  2Z6K A;  3VYS A;  4C3I H;  1VF5 C;  4CKB A;  3VMM A;  2D2C C;  2EPB A;  1GKH A;  3H4B A;  1T94 A;  1WTH A;  3NPP A;  5D3D A;  1E24 A;  4BWG B;  1PTO H;  5ELO A;  4X64 Q;  1TWG H;  3HGB A;  3MWD A;  4A3E B;  3MR6 A;  3GTO A;  1UUP A;  2W6N A;  4RMF A;  1V1O A;  4R9W A;  1GUT A;  1TY0 A;  1K0R A;  3FKI A;  1RL2 A;  1Z47 A;  3DM3 A;  4L5T A;  2KVM A;  4JI0 L;  5GAG C;  3RZD H;  1E2W A;  4YR0 A;  1V1Q A;  4UCV A;  3E3X A;  3RN2 A;  2L12 A;  3RB4 A;  4G4K A;  1SYG A;  2OQ0 A;  2UUB H;  1SE2 A;  5I6W A;  3KLW A;  3S1Q B;  1N33 L;  3UI2 A;  2NVT H;  4YP3 A;  3Q8D A;  1FYC A;  5C4Z A;  4TV8 F;  2Q2H A;  1S72 A;  2R7D A;  3HOZ H;  2K5V A;  4EQO A;  2UUA L;  5K5P A;  1TWH A;  1EYZ A;  3RGZ A;  2MCT A;  5F9N A;  5F9L A;  3HOV H;  2OTJ A;  2M9V A;  3ZJY C;  2OCE A;  1TU2 B;  4I7H A;  2QDB A;  3OW2 A;  3G6X A;  1S5E D;  3HZX A;  3T1Y Q;  1WTV A;  2A19 A;  3T5J A;  4C1N K;  4HNU A;  4TVA B;  1WTO A;  2QK4 A;  1X32 A;  5C3E H;  1CHQ D;  4KMU C;  4IAL A;  2F4V H;  1DXM A;  5FLM G;  5C44 G;  3CCL A;  2PMZ E;  1O78 A;  3P7J A;  3NTK A;  3HOX G;  4JI4 L;  2O5J C;  2XCA A;  1A0I A;  3K7U C;  1PVO A;  4DR1 Q;  1C7Y A;  3E9I A;  4RNO A;  1SNC A;  4KY6 A;  2HHH L;  3OUU A;  4J9Q A;  5LMU Q;  1ZXT A;  2F0P A;  1TII D;  3QO2 A;  2EYJ A;  3MZ5 A;  3PW2 A;  4A3F G;  1SRU A;  1CKN A;  5E7N A;  5HGT A;  2YZN A;  1C8C A;  3MVV A;  1PX2 A;  2RDJ A;  1K8M A;  2NVQ H;  5DNF A;  3HOV B;  2RCN A;  4DUZ Q;  3HOZ G;  2FE3 A;  3W1G A;  4BBS G;  1A2U A;  1KD1 C;  1HH2 P;  4A3I G;  1MI2 A;  4KK7 A;  2XWB B;  5DLF A;  2FLN A;  2F0T A;  5GAE C;  1I94 L;  1QCB D;  2OEO A;  3URY A;  3FP9 A;  2B8F A;  1PLF A;  4UP8 A;  3TRZ A;  4OWT B;  2YL2 A;  4RAU C;  1VS0 A;  3PF4 A;  1IL8 A;  1HPC A;  4IR9 A;  5CYU A;  4KKU A;  4X65 Q;  4TV9 F;  4A3D H;  3Q24 A;  4B3R H;  4RZR A;  5KFS A;  4K2K A;  4Y7N H;  2D0P A;  1HQR D;  2DY7 A;  1Y1V A;  4GNX A;  1IOV A;  5T14 A;  2CCZ A;  4DV5 Q;  5M5Y B;  1SMX A;  3MXN B;  3PCO B;  2D0O A;  4BY7 G;  5KFC A;  4LJZ C;  5IYZ F;  1YVC A;  1C9O A;  4H02 A;  1HTL D;  1I6V C;  1K83 B;  3QWN A;  5L37 A;  3FRP B;  3DWP A;  4JI6 Q;  3S15 H;  1O75 A;  4JV0 A;  2NVX A;  2EJM A;  4DV6 H;  4GOP B;  1H95 A;  2IMW P;  2JJQ A;  4K0K L;  1SDF A;  1AUX A;  1UC8 A;  2AQ1 B;  3G6V A;  5G3L F;  4TKO B;  3GLK A;  3J81 i;  2VUM B;  3T5H A;  2D5D A;  3J81 E;  2ZJQ A;  4POF A;  2VUM G;  4LUV A;  1TAE A;  4ILW A;  1QUQ A;  2JA5 G;  2F03 A;  4CJ1 B;  4ZQI A;  1L0W A;  4AYB B;  1EQR A;  1PZJ D;  1TKW B;  3AU7 A;  4ZK9 B;  4DV4 H;  4FO2 A;  4DK0 A;  4UDU C;  1WR2 A;  4UPA A;  4X66 H;  4IPD A;  4GZY C;  3Q8R B;  2RBM A;  3NWS A;  3LWU A;  4IUN A;  2A1A A;  3FMA A;  5KFK A;  4MA5 A;  4ECQ A;  4DV5 H;  5EJW A;  4A3J H;  1G91 A;  2I5L X;  4K5V A;  1V9P A;  4RAZ A;  3CMA A;  5IYB H;  2N3S A;  2FB9 A;  2F52 A;  4A3M B;  1JE4 A;  3HBL A;  5J39 A;  4GOP C;  2V5A A;  3I4M B;  4WFN 3;  1SND A;  2E5L L;  2UXD H;  5L1I A;  4A3G B;  4DV6 Q;  1ENC A;  2AWN A;  2PI2 E;  1Z2P X;  3D6W A;  2YTV A;  5KFT A;  3GV6 A;  1KL9 A;  3BQ0 A;  3EVQ A;  1ZYR D;  3K0Y A;  2J6T A;  1S40 A;  2NN6 H;  3W5O A;  2SNS A;  4LF5 Q;  2AQ4 A;  3OUZ A;  5DGB A;  1HZB A;  3PIO 3;  1BDO A;  2IBK A;  1IHZ A;  3ER0 A;  2JA5 B;  1S10 A;  4GN3 B;  4XYO A;  2F0E A;  2R93 B;  4FU0 A;  4DV4 Q;  1X3F A;  3G8C A;  5CB4 F;  3C2P A;  4J0M A;  2F0V A;  1B8A A;  2CWP A;  2R8K A;  4OL7 A;  4X66 Q;  1X56 A;  2F4I A;  3M4P A;  1HNZ Q;  2B63 H;  2V1C C;  3KJP A;  3RN5 A;  3RNU A;  2K4K A;  1D5Z C;  1VAJ A;  3GTM A;  1JC7 A;  1B70 B;  4RHS A;  3GTL H;  4F7X A;  3JZI A;  1J5E L;  5LMN H;  4TQS A;  2HD3 A;  2IX0 A;  4LFA Q;  4YWL A;  3K5M A;  3GTG A;  4DAP A;  2IHE A;  4PMB A;  3GIJ A;  3K7A B;  4YJ2 F;  1DGS A;  3AMU A;  1ICW A;  1KAA A;  1SEB D;  4RA8 A;  5KND A;  3S2D B;  3LWB A;  4C2M A;  3UQ8 A;  4J6H A;  4RU9 A;  5FK9 C;  1VDZ A;  2I07 B;  3AQQ A;  1JB7 A;  5L1J A;  2Q2U A;  2Q8R E;  1GLV A;  2EJF C;  4PV1 C;  2EQS A;  2ALZ A;  1D7Q A;  2UVR A;  1PFS A;  1ZEQ X;  2JA7 G;  4RFB A;  2JEA I;  1PZI D;  2DNE A;  1LYL A;  1SMY D;  1BCP B;  4HIK A;  3OTO H;  2JN4 A;  2VQD A;  3HOU G;  2PZU A;  4X3T A;  1TWG A;  2V59 A;  1GUW A;  4KHP H;  3M9O B;  2OLS A;  3C3L A;  1Q1E A;  1G6P A;  3TRE A;  2WAQ A;  3SI8 A;  3M4Q A;  1XYI A;  4MHE A;  3H09 A;  3E5N A;  2N88 A;  2R6F A;  2N55 A;  3CME A;  4OEL B;  1IW7 C;  2R6G A;  3E6Z X;  2CH4 A;  4C3I B;  4OX9 Q;  4KI0 A;  1BCP F;  5LMN Q;  2HCI A;  2NTS A;  4IUT A;  2Y0S B;  1LAC A;  5KFO A;  4A4I A;  2CHB D;  4JUZ A;  2KQ3 A;  4OIK A;  2EE1 A;  2BOS A;  5M5Y H;  1CQF A;  1XMO L;  1EY8 A;  2JA7 H;  1VF7 A;  4DAM A;  1EQT A;  2D62 A;  1ASY A;  2EXD A;  1ZHS A;  4QGU A;  5FO7 B;  4QY7 A;  3I3C A;  4MV6 A;  3U9O A;  3KXY T;  2F0H A;  4YIJ A;  2O5I C;  1GUG A;  3RFC A;  3A56 A;  2A68 D;  4A3K H;  2AHO B;  2E8G A;  1EU4 A;  1I5F A;  2QF7 A;  3TSS A;  2J6U A;  1TWH H;  3FMC A;  2KEC A;  1XMQ L;  4HYK A;  1CQV A;  4DR1 H;  2I46 A;  1KJJ A;  3EA6 A;  3OTO Q;  1DD2 A;  4OON A;  5JH7 F;  5DQH A;  2NU7 B;  1S0M A;  4QB4 A;  2A5H A;  1JDB B;  4FBU A;  2R82 A;  1SBB B;  1PXU A;  4OHJ A;  4XQN A;  3Q23 A;  3QOL A;  5CBA E;  3S1R B;  1HNX Q;  2L1B A;  1AUV A;  3OMC A;  1C0A A;  1DON A;  1B3A A;  3A8K E;  2PPB C;  1ZET A;  5JAV A;  1ZHQ A;  1EWH A;  1XMO H;  5C1P A;  4NMZ A;  3R2I A;  5J1Z A;  4DKA C;  3J7Y W;  4J9S A;  5KFA A;  1VQC A;  5M3M B;  1BBX C;  1W96 A;  3W3A A;  2W8L A;  1CM9 A;  2B3G A;  2IHF A;  1A6X A;  1A3U A;  2M05 A;  4LK1 C;  4QWB A;  4RWS C;  2HIX A;  1VCI A;  2DWC A;  1A9X A;  3NEM A;  4C3H H;  1BXT A;  1FNV A;  3RLF A;  1Y8O B;  1DIK A;  4F4Y A;  3CKI B;  2RGR A;  1SYF A;  4ECS A;  1CZG A;  1LTB D;  4J1M A;  3NQI A;  3CU7 A;  3S1Q H;  4JI1 L;  2FJ2 A;  2Z4I A;  4L5R C;  4P73 A;  1BKB A;  3OHB A;  2VQE H;  4LWC A;  1ESR A;  4RGO S;  1IBL H;  3MEF A;  5KGU A;  1F9Q A;  1E2Z A;  1LTG D;  1Y8P B;  1B2T A;  1VQ6 A;  4O4I F;  3T51 B;  3JAM i;  3L9A X;  2NB0 A;  5FO8 B;  4BA2 I;  1HHV A;  1HNX H;  4FXK C;  2UVW A;  2DZD A;  2YRW A;  4HQ6 A;  3PIP 3;  4RB1 A;  3ITP A;  2WP8 J;  2E2H B;  4XDX A;  2K05 A;  1YHA A;  2CQA A;  1I4X A;  3PUY A;  4R8U A;  1SFO H;  1JJ2 A;  1WH2 A;  4DR5 H;  4LMQ D;  1XPO A;  1N36 H;  3ZYY X;  2ICE C;  3HOY H;  4XYQ A;  5EWE A;  3EJI A;  2Z6B A;  5LXT F;  2OWO A;  4EBE A;  3T4A C;  1PH3 A;  2R92 A;  2JSO A;  2BQR A;  3NHH A;  2PBZ A;  1SYB A;  2M00 A;  2YV5 A;  3NP8 A;  4H13 C;  1FL0 A;  2BDO A;  4TSS A;  2IWH A;  2W9B B;  3S1M B;  1A15 A;  1K83 H;  4KLK A;  4ED8 A;  2HGS A;  3T5K A;  1YIJ A;  3D31 A;  1E3P A;  1BR9 A;  2I5H A;  5LOV F;  5KG3 A;  4Q8F A;  3IRB A;  2VY3 A;  1WTW A;  1H9S B;  1W6K A;  3HOY G;  2B63 B;  2B39 A;  4NXM H;  1RJT A;  2IX1 A;  3A8I E;  3S1N H;  2CZG A;  1JIH A;  1XNQ Q;  4BXX G;  4EEQ A;  4RH6 A;  1RDP D;  4MV4 A;  2I80 A;  2QW7 A;  1GVP A;  2EYM A;  4NXM L;  2ATL A;  4QQB X;  4YY3 L;  3GTL B;  5DGA A;  2ATW A;  3VA5 A;  4NB3 A;  5EWF A;  3IN5 A;  4CBV A;  2SEB D;  4YHH L;  4KHZ A;  1OXS C;  1EZ1 A;  2UXD Q;  3NUC A;  4FF1 A;  4JI4 H;  2VL6 A;  2PVP A;  3UDX A;  5IT9 W;  1FR3 A;  1SLJ A;  2Y0S E;  2JA8 B;  1WCM G;  3TP7 A;  3HG9 A;  1VKZ A;  2R87 A;  2BH2 A;  4LFB H;  4DR2 L;  2SCU B;  4UCT A;  3BU2 A;  1NNX A;  4K14 A;  5KG2 A;  3AEV A;  3KHL A;  3VPD A;  1DOM A;  1KEE A;  5JUM A;  1WCM B;  3AYH B;  5FJ8 H;  3HKS A;  5FLM H;  4UCU A;  3DWA A;  4IFD I;  3FDT A;  1CT1 D;  1EOV A;  4YJ3 F;  3PW0 A;  2PCF B;  1EZ6 A;  4DAY B;  3M7N A;  1JLL B;  3H0G B;  2BR0 A;  1TS5 A;  1Q8K A;  5LL6 X;  1LLR D;  1EIH A;  4RCO A;  3H91 A;  1TQO A;  3FKI H;  2RF4 A;  1YJ9 A;  2XGQ A;  4DL6 A;  1I94 H;  3V4Z A;  1HA6 A;  2Q8T A;  1XNQ H;  1LTR D;  1SNM A;  3I4N G;  1AH9 A;  3ND9 A;  1EEF D;  1LTA D;  4DV0 Q;  1JJG A;  4H7B A; 
#chains in the Genus database with same CATH homology
 4UP9 A;  1PH1 A;  1E22 A;  3I4M G;  4GKK Q;  4LF9 Q;  3A5U A;  4Y52 H;  4JI3 L;  4B3T Q;  5JEA G;  1P16 A;  3UE1 A;  2JE6 I;  2BA0 A;  1Q1B A;  3PV0 A;  3PUV A;  4JC0 A;  1PYS B;  4YHH Q;  5IYD H;  1L1O C;  2PQA B;  2XGT A;  4JYA L;  2GN5 A;  1WCM H;  3S17 H;  2EIF A;  4RG1 A;  4QIW E;  1HNX L;  1Z9F A;  2Z6K A;  4AIM A;  3BZK A;  4LUZ A;  4C3I H;  4FDB A;  3STB D;  1X9N A;  1WOC A;  1GKH A;  2JQO A;  2ZJP A;  5IY0 A;  1E24 A;  2CFM A;  4LF6 Q;  3H0G H;  1XPR A;  5ELO A;  4LF9 L;  4X64 Q;  1TWG H;  2HHH Q;  4LF4 Q;  2GVA A;  3PUX A;  4GN4 B;  1KHI A;  4BY1 G;  3VDY A;  4RMF A;  1YZ6 A;  2F4V L;  1PH8 A;  1K0R A;  1RL2 A;  1Z47 A;  3DM3 A;  1FGU A;  4L5T A;  4JI0 L;  1N34 L;  1XPU A;  5GAG C;  3RZD H;  2UXC L;  3F2C A;  1V1Q A;  2ZJR A;  3L7Z C;  3RN2 A;  1QZH A;  3UDG A;  1E1T A;  1V43 A;  2YTX A;  3J7Z C;  2KEN A;  1TXY A;  2OQ0 A;  3F8T A;  4GKJ L;  4DV3 L;  1O7I A;  2ID0 A;  3EBE A;  3KLW A;  1K73 C;  5J3B A;  4AQY Q;  4HIO A;  1U0L A;  5LMN W;  3T1Y L;  1GM5 A;  3CCE A;  1X65 A;  3Q8D A;  3CCQ A;  4DUY Q;  2NVT H;  2Q2H A;  3AFQ A;  2R7D A;  1X55 A;  3L0O A;  1S72 A;  2K5V A;  3CC2 A;  3M3Y H;  2UUA L;  5IYB G;  2NZO A;  4R4C A;  4NPS A;  1X6O A;  2E2I H;  4R4T A;  3CD6 A;  3HOV H;  2OTJ A;  1MKH A;  2UUC Q;  1YIT A;  1EYG A;  1IZ6 A;  2I0Q A;  3ZJY C;  2OCE A;  4ALP A;  3OW2 A;  2E5L Q;  1Q46 A;  3GTM H;  1N32 L;  3T1Y Q;  2A19 A;  3HKZ E;  3ULL A;  4TVA B;  5C3E H;  1B7Y B;  1J5E Q;  2HQL A;  5IP9 H;  3H3V I;  5FLM G;  3CC7 A;  5C44 G;  3CCL A;  2PMZ E;  2B29 A;  3I56 A;  4A3D G;  5C0X I;  3HOX G;  4JI4 L;  4LF7 Q;  4WJ4 A;  1A0I A;  3K7U C;  1PVO A;  5GAH C;  4DR1 Q;  4P75 A;  4A3F H;  4HJ9 A;  3S16 H;  1CSP A;  1C7Y A;  3E9I A;  2LXK A;  1VQ5 A;  2WAQ G;  4POG A;  2HHH L;  3L2P A;  4LF4 L;  5GRO A;  5LMU Q;  2HT1 A;  2FXQ A;  5JJL A;  1HZ9 A;  2QA4 A;  3PO3 H;  4DV2 Q;  4JOI C;  3CCV A;  3CW2 C;  1LTL A;  3AFP A;  2Z0S A;  2WFW A;  4PZ7 A;  3I4M H;  1BVS A;  4A3F G;  3EN2 A;  1CSQ A;  1P8L A;  1CKN A;  1SRU A;  5IP7 G;  2RHS B;  5E7N A;  5M3F H;  4ME3 A;  4LF7 L;  2CWA A;  3T1H L;  1K3R A;  1Y1W H;  1KRT A;  5IP9 G;  4GOP A;  2QGQ A;  2NVQ H;  4A3B G;  2RCN A;  4HJ8 A;  4DUZ Q;  3HOX H;  2ES2 A;  4JI3 Q;  3HOZ G;  4DR4 Q;  3W1G A;  1TWA H;  4BBS G;  1KD1 C;  3TEH B;  1YHB A;  1HH2 P;  4A3I G;  5IP7 H;  5C3E G;  4MZ9 A;  1VQG A;  3PUZ A;  3E0E A;  5GAE C;  1I94 L;  5C4J H;  3KF6 B;  2DUD A;  3HFZ B;  1GO3 E;  2ALY B;  3FP9 A;  2UU9 L;  3PO3 G;  2N49 A;  4UP8 A;  3TRZ A;  4BA1 I;  1IBK Q;  4OWT B;  2JA8 H;  1VS0 A;  2UUC L;  3PF4 A;  3A5Z B;  5IWA L;  2Q2I A;  4OWW B;  4X65 Q;  4OX9 L;  4A3D H;  2F4V Q;  3CQZ H;  4DV1 L;  1Y1V G;  3RLO A;  5AJ3 L;  1N34 Q;  4Y7N H;  4A3G H;  2D0P A;  4GNX A;  2VQE Q;  4JOI A;  4IPG A;  5M5X H;  4JI8 Q;  2CCZ A;  4DV5 Q;  1SMX A;  3MXN B;  3PCO B;  2D0O A;  1W3S A;  4BY7 G;  3KDF B;  2KBN A;  4JI5 Q;  2NN6 G;  4P72 A;  3BJU A;  4X66 L;  3UDI A;  2R92 H;  2ZTC A;  1R9T H;  3PF5 A;  3LGJ A;  1YVC A;  3TQY A;  1RIP A;  1C9O A;  3M85 A;  2UUB Q;  4H02 A;  2MO1 A;  2PQA A;  4YCV A;  4A3L H;  2ZTE A;  3JAM c;  4DV6 L;  4DR3 Q;  1KQS A;  3GD7 A;  4JI6 Q;  1M90 C;  3S15 H;  4X62 Q;  1IYJ B;  4DV7 L;  2HIV A;  4GOP B;  1Q12 A;  5IE8 A;  1PH2 A;  1H95 A;  1CKO A;  1NMF A;  2JJQ A;  4K0K L;  1VQ4 A;  1SR3 A;  1VQ8 A;  4EQ5 A;  3GTG H;  1SRO A;  3J81 i;  1N32 Q;  4APV A;  1TWF H;  4DR5 Q;  1S3O A;  1HZC A;  2K75 A;  3G71 A;  2ZJQ A;  4POF A;  2VUM G;  1SN8 A;  1K8G A;  1E7Z A;  4LUV A;  4A3C H;  1QUQ A;  2JA5 G;  1EIF A;  4PMW A;  3OYY A;  1YNX A;  3KOJ A;  5C4X H;  4DR7 L;  5JJK A;  1L0W A;  5C44 H;  4LFB Q;  1VQF A;  1EQR A;  1YBY A;  4XTC S;  4A3K G;  1IXR A;  4A3B H;  1UEB A;  2VQF Q;  4B3R Q;  2UXB Q;  1VQI A;  3BZC A;  4UPA A;  4A3L G;  4MTN A;  1A62 A;  2F3I A;  5M3F G;  3PIP A;  3I2Z A;  4IPD A;  4DV2 L;  1I6H H;  2A1A A;  4KHP Q;  2RHQ B;  4IOA A;  4A3J H;  5K36 G;  2I5L X;  1SE8 A;  1V9P A;  4R4Q A;  2VW9 A;  3KDF A;  3T1H Q;  2E2H H;  4JI7 L;  2PI2 A;  3CMA A;  5IYB H;  2N3S A;  4DV5 L;  3D0F A;  4OXP A;  1PA6 A;  1HR0 W;  2F52 A;  1EWI A;  4B3R L;  2PNH A;  4JI5 L;  4GOP C;  1IBM Q;  2JA6 G;  3J80 c;  4BBR G;  3CCM A;  2E5L L;  3UE0 A;  3HOW H;  4A75 A;  1VQK A;  5IYC G;  3EIV A;  3KJO A;  4BBS H;  3U4V A;  3CP0 A;  4DK6 C;  4DV6 Q;  4A93 G;  2AWN A;  1HR0 L;  1FVI A;  2PI2 E;  3KYH C;  5LMN L;  1PH4 A;  4R1J A;  2JA8 G;  1A63 A;  3J81 j;  2K5H A;  2YTV A;  4R4I A;  1IBK L;  1KL9 A;  3S1M H;  2C35 B;  1AE3 A;  1W2B A;  1S40 A;  2L15 A;  3W5O A;  1YEZ A;  4LF5 Q;  1VQD A;  1L1O A;  1KC8 C;  1HZB A;  4B3T L;  4J15 A;  4JBM A;  5M5W H;  3ER0 A;  4IOC A;  1Q82 C;  3JC6 6;  1VQM A;  3H0G G;  4GN3 B;  1HR0 Q;  1CKN B;  5IYC H;  2QEX A;  2OTL A;  4DV4 Q;  1X3F A;  1VQO A;  5GQO A;  1B8A A;  3K8A A;  2CWP A;  4NXM Q;  4LF6 L;  4X66 Q;  1OTC A;  4LF5 L;  2VQF L;  1X56 A;  1L2F A;  3M4P A;  1HNZ Q;  2B63 H;  1A8V A;  2V1C C;  3KJP A;  2NN6 I;  3RN5 A;  2K4K A;  3RNU A;  4A3G G;  3HKZ G;  1Q86 C;  1B70 B;  3GTL H;  5HGQ A;  4P71 A;  5M3M H;  4DV4 L;  1J5E L;  4JI1 Q;  2IX0 A;  4LFA Q;  1YJN A;  4YWL A;  2IHE A;  4GNX C;  4JI4 Q;  1XMO Q;  4C3J H;  1DGS A;  4JG2 A;  4B3M L;  1EFW A;  2YTY A;  4DR2 Q;  4GKJ Q;  5IT9 c;  5C4X G;  4L5Q A;  1VQJ A;  4PG3 A;  3M4O H;  2N8N A;  4DUY L;  1WI5 A;  3AQQ A;  1N8R C;  4UP7 A;  4GNX B;  1JB7 A;  1EIY B;  2Q2U A;  2VUM H;  3M9B A;  4JBJ A;  3I4O A;  2CKZ B;  4JBW A;  2EQS A;  1MJC A;  2LXJ A;  4HJ5 A;  4LFC L;  4DUZ L;  1PFS A;  4MNO A;  4HJA A;  2JA7 G;  2JEA I;  2UXB L;  2K14 A;  1LYL A;  4HIK A;  2AWO A;  3G48 A;  4KHP L;  1UE7 A;  1XJV A;  1NJI C;  1YHQ A;  4O2D A;  2YU9 H;  3HOU G;  5DLQ E;  2UXC Q;  4R4O A;  3H3V H;  1OXU A;  3PIO A;  4IFD J;  1PV4 A;  1UE6 A;  4A3J G;  1Q1E A;  1X3E A;  3TRE A;  1G6P A;  2CQO A;  3M4Q A;  4LF8 Q;  1NY4 A;  1PYB A;  5JJI A;  4QL5 A;  4A76 A;  1ASZ A;  2K50 A;  3SGI A;  4GLX A;  3CME A;  1VQL A;  3HOV G;  2R6G A;  1KAW A;  3CCJ A;  4OX9 Q;  2VNU D;  4XIG S;  1IL2 A;  1G51 A;  3K81 C;  4JI2 Q;  3G4S A;  3K80 C;  2DGY A;  4KI0 A;  5LMN Q;  2AMC B;  3ERS X;  3HOZ H;  1N9W A;  4A4I A;  1CUK A;  4YWK A;  3S2D H;  5M5Y H;  3DLL A;  2ASB A;  1XMO L;  2JA7 H;  1NMG A;  1N36 Q;  1HZA A;  4DAM A;  2D62 A;  1IBL L;  2EXD A;  1ASY A;  4QGU A;  3S14 H;  2K52 A;  3U4Z A;  3G6E A;  1QZG A;  1NE3 A;  2UXD L;  4QY7 A;  1EQQ A;  4JI6 L;  1M1K C;  1VQH A;  4LUO A;  1T9H A;  4DR3 L;  4LNQ A;  2WB1 E;  1NTG A;  3RLN A;  4JV5 L;  4X62 L;  4A3K H;  2AHO B;  4DV0 L;  4DR1 L;  2E8G A;  1EUJ A;  1I5F A;  3CPF A;  1OXX K;  1TWH H;  4GN5 A;  1XMQ L;  4OO1 G;  2I5M X;  4YWM A;  3J7A 5;  2NZH A;  1IBM L;  3WWV A;  1Y1W G;  3PSI A;  1IBL Q;  1TWC H;  3OTO Q;  2MFI A;  1VQ9 A;  4OON A;  2VZA A;  4X65 L;  5LMU L;  3E9H A;  2ZM6 L;  2LSS A;  4BBR H;  2B63 G;  1PH7 A;  4HJ7 A;  3U50 C;  1K9M C;  4A3E H;  4A3C G;  2WB1 G;  1HJP A;  1CKM A;  1PHJ A;  1N33 L;  4A93 H;  2OQK A;  1JE5 A;  2VQE L;  3KF8 B;  1HNX Q;  4LFA L;  1X3G A;  4DR7 Q;  4GLA C;  3STB C;  1JMC A;  1C0A A;  4P74 A;  1D8L A;  5M3M G;  2R7Z H;  1VQA A;  4PZ6 A;  1XMQ Q;  3S1R H;  1Y14 B;  2YYZ A;  4X64 L;  5BR8 Q;  1Y1V H;  1BBW A;  1L1O B;  3OTO L;  4DKA C;  1VQC A;  5JEA J;  2BA1 A;  3CC4 A;  1JJC B;  4JI0 Q;  3HOU H;  3GO5 A;  3GTQ H;  4IJH A;  5IYD G;  2IT1 A;  4UY8 C;  2B3G A;  2IHF A;  4NXN L;  4IJL A;  3KF6 A;  1UWV A;  2ZTD A;  4DK3 C;  4JBK A;  1U5K A;  2HIX A;  2WAQ E;  1VCI A;  3W1B A;  4AYB G;  3NEM A;  4C3H H;  4DV0 Q;  4AH6 A;  4AQY L;  4IFD G;  4OWX B;  1GD7 A;  4IPC A;  4DV3 Q;  3RLF A;  1MJE A;  1VQB A;  2N78 A;  4A3E G;  3S2H H;  4JCV E;  3GTO H;  4YCW A;  3FKI G;  4NXN Q;  3S1Q H;  2UUA Q;  4DPG A;  1PH5 A;  4JI1 L;  1E1O A;  4L5R C;  2R7Z G;  4P73 A;  1BKB A;  3ULJ A;  2JK8 A;  4LWC A;  3I4N H;  3MEF A;  3NEL A;  4X6A H;  2A8V A;  4YY3 Q;  4HID A;  1BBU A;  3F2D A;  3B6Y A;  3NBH B;  1KIX A;  1VQ6 A;  3JAM i;  4A3I H;  4JI2 L;  4BA2 I;  2ZM6 Q;  1MIU A;  3K0X A;  3F2B A;  1X54 A;  1LUZ A;  4C2M H;  3CCS A;  1J6Q A;  4JI7 Q;  4DV7 Q;  1QVF A;  2VS1 A;  2WP8 J;  2Y0S G;  1WJJ A;  3GDE A;  4LW1 A;  4L5S A;  1D7Q A;  3CXC A;  3K7A H;  1N36 L;  1YHA A;  3PUY A;  2AKW B;  1JT8 A;  1SFO H;  1JJ2 A;  1OXV A;  2Q2T A;  2IY5 B;  1XPO A;  1HNW L;  5ELN A;  1WYD A;  3HOY H;  4DR5 L;  2R92 G;  1QUQ B;  3GTP H;  2OWO A;  4JYA Q;  1KRS A;  1PH3 A;  2BH8 A;  2E2J H;  3H15 A;  1WFQ A;  1UE5 A;  1FJG L;  2YV5 A;  5HY6 A;  1XNR Q;  1XNQ L;  4GS3 A;  1FL0 A;  4PZ8 A;  2XTI A;  1VQP A;  3PO2 G;  4LFB L;  1K83 H;  5C0X G;  4KLK A;  4DR4 L;  4BXX H;  5EAY A;  3PGZ A;  3S24 A;  1YIJ A;  4OO1 I;  3D31 A;  1E3P A;  2I5H A;  2Z6K C;  2KCM A;  5C0X J;  1UE1 A;  5FLX c;  3TS2 A;  1QVC A;  3IRB A;  2VY3 A;  4A3M G;  3KFU A;  1NBW A;  4GLV B;  4HIM A;  4B3S Q;  3HOY G;  3J80 i;  2IX1 A;  2MNA A;  2UU9 Q;  3S1N H;  1PH6 A;  4DNI A;  3CCR A;  1XNQ Q;  2KHI A;  4BXX G;  4DR6 L;  2KCT A;  1GVP A;  3NEN A;  5BR8 L;  4NXM L;  4QJF A;  4YY3 L;  4QQB X;  2R93 H;  2ATW A;  4NB3 A;  3I55 A;  1G29 1;  4YHH L;  4KHZ A;  3J81 c;  1OXS C;  4TQU S;  3CPW A;  2UXD Q;  1Q81 C;  1Q7Y C;  2MO0 A;  1QVG A;  1VQ7 A;  2JA5 H;  1KXL A;  3A0J A;  5AJ3 Q;  5FJ8 G;  2VL6 A;  5GAD C;  3I7F A;  4IPH A;  3UDX A;  1AE2 A;  4DR6 Q;  1SLJ A;  2Y0S E;  4A3M H;  1K8A C;  3CAM A;  1WCM G;  4B3M Q;  4AYB E;  3GTK H;  4LF8 L;  3TS0 A;  2BH2 A;  1OXT A;  4DR2 L;  2NVX H;  3BU2 A;  3AEV A;  4EX5 A;  3PUW A;  5H1S E;  5FJ8 H;  3AYH B;  2UUB L;  2JA6 H;  3HKS A;  5FLM H;  1XTD A;  3FHW A;  3CCU A;  3PO2 H;  4IFD I;  4WJ3 M;  1EOV A;  4IO9 A;  1FJG Q;  2NVY H;  4K0K Q;  4BY1 H;  1YI2 A;  4DAY B;  1LM0 A;  3M7N A;  3GTJ H;  1VQE A;  1XNR L;  2JEB I;  3RZO H;  3ICE A;  1Q8K A;  4LFC Q;  1I94 Q;  2R93 G;  1PH9 A;  4GKK L;  3A74 A;  5IWA Q;  1HNZ L;  4BY7 H;  3UDF A;  2R7F A;  1VQN A;  1N33 Q;  4DV1 Q;  2K5N A;  3FKI H;  2MQH A;  2RF4 A;  1YJ9 A;  2GVB A;  4YCU A;  1HNW Q;  4JV5 Q;  2JA9 A;  1I3Q H;  3U58 A;  4B3S L;  3I4N G;  1AH9 A;  4O0A A;  4JI8 L;  3CF5 A;  2H5X A;  3F1Z A;  3RR5 A;  1YJW A;  3HOW G;  3ULP A;  2KHJ A;  1JJG A;  1I50 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...