2CQYA

Solution structure of b domain from human propionyl-coa carboxylase alpha subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
GSSGSSGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Propionyl-CoA carboxylase alpha chain, mitochondrial
publication title Solution structure of B domain from human propionyl-CoA carboxylase alpha subunit
rcsb
source organism Homo sapiens
total genus 14
structure length 108
sequence length 108
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2cqyA01
2YZGA 4L1KA 1JLLB 3G8CA 4IWYA 2FPGB 2W6NA 1GLVA 2W6PA 1VBHA 2I87A 4C5CA 2XD4A 3Q1KA 3RV4A 4I50F 5JH7F 1IOWA 1EHIA 4ZOLF 3V4SA 4MAMA 4IWXA 1C30A 2CZGA 2DIKA 2R7KA 2NUAB 2FB9A 2J9GA 2GPWA 1VKZA 1CQJB 4YBZB 1M6VA 3TQTA 5LYJF 2PN1A 4XZ3B 3N8DA 3VPDA 3I12A 3MWEA 5LXTF 5BMVF 2W6QA 4IHJF 1CS0A 1VBGA 1E4EA 1I7NA 2VR1A 4FU0A 4EG0A 1KJ8A 1W93A 2PBZA 2R82A 1T36A 4HR7A 1GSHA 2VQDA 1BXRA 1B6SA 5K2MA 2W70A 5EZYF 4MV1A 1GGOA 2V59A 3ETJA 2DWCA 2R85A 1JDEA 5D8DA 5JVLA 2R7NA 2YRWA 2ZDHA 2YRXA 4TUYF 4ZHQF 2YZNA 2CQYA 3Q2OA 4HNUA 4MV3A 5C8YF 5LP6F 4DLKA 2GLTA 3U9SA 5I47A 2C00A 2W6ZA 2YL2A 4O4LF 4YB8B 1ULZA 5KX5F 1EUCB 2P0AA 3ETHA 4IZOA 5C1OA 1A9XA 1KC7A 2V58A 1EYZA 2FP4B 2FPPB 2YW2A 2W6OA 2V5AA 3R5HA 4MV8A 3R5XA 4WD3A 3HB9A 3V4ZA 2DLNA 4EGQA 1JDBB 4C5BA 3K5HA 3QFFA 4O4IF 4TV9F 4HNTA 3BG5A 3TINA 4E4TA 2NU7B 1KJQA 1KJJA 1PX2A 4EGJA 3GIDA 2R7LA 1E4EB 1PK8A 1AUXA 2X0SA 3HBLA 5CA0F 3U9TA 5KKNB 2R86A 4ZQIA 4YAJB 4Y8VB 5BPFA 2R87A 4ME6A 2DZDA 5JQWA 3OUZA 2HJWA 3VPCA 2IP4A 4I55F 3MJFA 4C5AA 1EUDB 2FPIB 3R5FA 1CE8A 1DV1A 5LA6F 1GSOA 1KJ9A 2ZDGA 2R6FA 3RUPA 3MWDA 5J2TF 2ZDQA 4MV4A 2W6MA 2VPQA 3JZIA 3TIGA 4YAKB 2QK4A 2R84A 4XYMB 3GLKA 2NU6B 5J2UF 5IYZF 2I8CA 1B6RA 1BNCA 5GONF 3SE7A 5HBRB 4YJ2F 2YS7A 2OLSA 3LWBA 4XYLB 4WBNF 1UC8A 4MV6A 3LP8A 5BPHA 3WO0A 2NU9B 5HV6A 2I80A 1DV2A 4YJ3F 1UC9A 2SCUB 4I4TF 5CB4F 2XCLA 3K3PA 1JKJB 5H80A 1W96A 3RV3A 3OUUA 1KJIA 3TIIA 3RFCA 3E5NA 1I7LA 3WNZA 2YYAA 4TV8F 5LOVF 4O2AF 3VPBA 2W71A 2GPSA 4HNVA 1CQIB 4HQ6A 1KBLA 1IOVA 3UFXB 3VMMA 1GSAA 3ORQA 5C1PA 4M9UA 2YZMA 1WR2A 3K5IA 1DIKA 4ZI7F 2NU8B 5CAEB 5CA1F 2YS6A 2PVPA 1KEEA 4O4HF 1AUVA 3ORRA 3WO1A 4O2BF 3JRWA 1C3OA 2R7MA 3JRXA 4MA0A 4XX0B 5JVDF 3R23A 1SCUB 1EZ1A 4MA5A
chains in the Genus database with same CATH superfamily
3KAJA 2UXBH 4ECZA 1RK6A 3PW2A 2WTFA 1JLLB 4DR5H 2V4RA 4IWYA 3PW7A 4C5CA 5LMNH 1S0MA 4JV2A 2XD4A 3Q1KA 4FS2A 2AGPA 4LFCH 2B63G 4ZOLF 4R8UB 2VQFH 1C30A 2R7KA 1RYRA 2AQ4A 2JEJA 2GPWA 4UCTA 5EDWA 2F4VH 1AN7A 3N8DA 2O03A 5KFTA 5BMVF 4J9LA 2W6QA 1N56A 1CS0A 3GILA 2HVQA 3L4JA 2B63A 4HR7A 4EEYA 1TWHA 3PZPA 5KT6A 4LH7A 2W70A 2JA7A 4ETSA 4O3SA 4ECVA 2BQ3A 2V59A 4QWDA 4JI2H 4YR3A 2R85A 4BWSC 5KG6A 1T94A 2YRWA 3CVZA 2YRXA 2VUGA 5KFZA 5A2QW 2W9BB 3MFIA 1V51A 4DLKA 2GLTA 5KT3A 2C28A 2UU9H 2W6ZA 5DG9A 4JV0A 5KFXA 3KTMA 4EYIB 1EUCB 3ETHA 4ED3A 3T5KA 2FPPB 5IYDG 4TQRA 3R5XA 4AQYH 2DLNA 1R9TA 2JA8G 3GTGA 1N32H 3K5HA 3M9NB 4X66H 4B3RH 3TINA 4E4TA 2NU7B 3HOVG 2R7ZG 3KAKA 3GIDA 2R7LA 4QW8A 3M9MB 2X0SA 3HBLA 2VA3A 4FBUA 4YAJB 3GTKA 4A3GG 2HVRA 3MR5A 2ZJTA 4ME6A 5KFSA 5JQWA 4EEQA 2R8JA 4C5AA 3M4IA 1EUDB 3N43B 2WYOA 2V4QA 1DV1A 3PO3G 1GSOA 5D1PA 2ZDGA 2R6FA 5KT5A 5DGAA 2VA2A 2CKZB 5BR8H 4QWEA 4X64H 4RU9A 2W7PA 2BQRA 4EFBA 1XNRH 2UVRA 2R8KA 1ZETA 4JI7H 4IAJA 2NU6B 4UCVA 5KFEA 2I8CA 4DV1H 5GONF 2AU0A 2ASDA 1Y1WA 1L2ZA 3J7AK 2RDIA 3GIKA 3N6XA 1FJGH 4KHPH 4GC6A 4DR2H 3GTMA 4XYLB 3PO2G 4ECSA 3LP8A 4PDBA 2I80A 1I3QA 4LF8H 3KHLA 3BQ0A 2XCLA 4B3MH 1RJQA 3K3PA 3GIQA 5H80A 1UNNC 2ZM6H 3TIIA 3H40A 3BABA 1I7LA 4EBCA 2YYAA 4UCRA 4IRKA 4F4XA 4O2AF 3VPBA 3GIIA 4Q44A 5KFKA 1KBLA 2ALZA 2VOBA 4HQ6A 3F8NA 5DGBA 4QWCA 3ORQA 4R7RA 4M9UA 4EFEA 4FBTA 3IG0A 4NXNH 2FMAA 1SFOA 5L9XA 1DIKA 4ED1A 5CAEB 5CA1F 2NVXA 1SYXB 1XDNA 1KEEA 5KT7A 3AYHB 2C22A 3JRWA 1XMOH 1C3OA 4A2AA 4JV1A 3RAQA 5C3EG 4J9NA 2DPJA 4GC7A 3EYYA 4DR4H 3K3VA 4OX9H 4MA5A 5L1KA 2W9BA 3T5JA 4Q45A 3I4NG 2YZGA 3H0GG 3RGZA 3OSPA 1VAJA 4LFAH 3RIZA 2FPGB 2FLNA 3G6YA 2ASLA 4F4WA 4IRDA 4RNNA 4RUCA 2FK3A 4O3PA 5L1IA 4J9QA 4MAMA 4EYHB 5EWEA 2CZGA 3C0FB 4MV9A 2XIGA 5DG7A 2FB9A 3GTJA 5KT4A 1VKZA 4YBZB 4AYBA 4RB2C 4XZ3B 4JV5H 4DR7H 1ZHQA 5LXTF 5KG3A 4J9KA 1TWGA 1TWAA 1I7NA 1TWFA 2VR1A 4FU0A 3J81W 4A3FG 2YCHA 4EG0A 3RF2A 5FD5A 1W93A 5LL6b 4DUZH 2HHHH 1T36A 1N48A 1GSHA 5C4XG 2C2RA 2KSWA 1BXRA 4DR3H 3HKZA 5KFBA 2VPSA 4DL6A 3KHRA 2VQEH 5EZYF 4JI6H 4RNMA 4MV1A 5L1LA 2C2EA 5FJ8G 2DWCA 3RB0A 1S0NA 1JDEA 4IR9A 5KFOA 4ECTA 1XNQH 2ZDHA 4HNUA 4J9PA 4DV2H 2YZNA 2CQYA 3JSNA 3Q2OA 2R8GA 4NLGA 3JAMW 5KT2A 1RYSA 2BR0A 5I47A 4O4LF 1M0TA 4J9MA 4QIWE 5KX5F 5KG4A 4DV3H 2JA7G 2W57A 4EBDA 2YW2A 2FP4B 4WD3A 4J0MA 4MV8A 2R92A 1M0WA 3HB9A 4EGQA 4QW9A 1JDBB 4G3IA 3QFFA 4HNTA 4FS1A 3N44B 1KJJA 1PX2A 4EGJA 4BBSG 5CA0F 2AGOA 1K1SA 3KXYT 2R86A 5DQGA 3GIMA 4RAYA 4ED6A 4X62H 3Q8QB 1VS0A 1HNWH 1K1QA 5F9NA 3FKIG 3MJFA 2FPIB 2J6TA 1CE8A 1HNXH 1DGSA 4ECYA 3T5LA 1GO3E 3MWDA 2R8HA 1Y1VA 4ECXA 2ZDQA 4MV4A 1I94H 2W9CB 3JZIA 3TIGA 2QK4A 3FKIA 1BNCA 5DLGA 1B33N 2JEGA 5EWFA 4YJ2F 4U6PA 3T1YH 4O3RA 3BA8A 4LSAA 4ED7A 4A3CG 1V9PA 1UC8A 3WO0A 3PW5A 4YJ3F 5DG8A 1UC9A 4A3JG 1I6UA 3CQZA 4CC6A 5LMUH 1RK5A 3RB3A 4A3DG 5FLMG 4TQSA 4DL7A 3H3VH 2CW8A 1Y1WG 4MTDA 3MR3A 3OUUA 1KJIA 5T14A 4F50A 4ED2A 4RZQA 4PWQA 2FLPA 5FD6A 4TV8F 5LOVF 5KFRA 5KFGA 3EPIA 1CQIB 2Y0SA 3UFXB 1P8LA 4LMYA 4YHHH 2YZMA 1N34H 2UVWA 4LFBH 3H4BA 2NU8B 4K0KH 3N41B 4DUYH 2UVVA 3M9OB 2PVPA 1WCMA 3HKZE 4O4HF 1AUVA 3ORRA 4RUAA 3WO1A 4O2BF 1FKAH 2E2HA 3PN1A 2R7MA 3JRXA 3OHAA 1E4FT 4MA0A 5KG5A 3BQ2A 3MWMA 3T5HA 1EZ1A 2RDJA 3UQ8A 3FDSA 3GIJA 4IRCA 1MZBA 2ASJA 2UVUA 2W8KA 5L1JA 3PR4A 1VBHA 2I87A 5DQIA 2UXCH 1FVIA 2FLLA 3RV4A 4RNOA 4I50F 3V4SA 4IWXA 2NUAB 2UUCH 2AGQA 2HGSA 2RGVA 2OH2A 1CQJB 3TQTA 1M6VA 5LYJF 2PN1A 3MFHA 1BGWA 3QZ8A 4A3MG 3PVXA 3VPDA 3I12A 4DR6H 5KG0A 2XGPA 4IHJF 1VBGA 4DV6H 4JI8H 5IYCG 3RJ0A 4DL4A 4QWAA 1K83A 4O3NA 5KG2A 2Q2UA 2WE6A 2R82A 4JUZA 2Q2TA 4Q8FA 3HOWG 4LF7H 1X9NA 5C44G 3I4MG 3OHBA 2VQDA 3HOZG 3G6VA 5K2MA 3GIPA 5F9LA 1GGOA 1OWTA 3ETJA 3IN5A 3PW0A 2UUBH 3SI8A 2R8IA 4ED0A 5JVLA 1TWCA 2R7NA 4TUYF 5KFUA 4ECQA 4ED8A 2FK1A 4A3KG 4MV3A 5C8YF 4LSXA 5KG7A 5FPOA 2W9CA 3U9SA 2C00A 4YB8B 4I7HA 2MCTA 4IZOA 5C1OA 1A9XA 5KFAA 1KC7A 2JEFA 1E4GT 3T1HH 2W6OA 4ECWA 1WSCA 1BJTA 5KFLA 4BXXG 5IYBG 4O4IF 3BG5A 1KJQA 3LMLA 4QWBA 3MR6A 4F4ZA 4A3EG 5KKNB 1E4EB 1AUXA 4EBEA 2C2DA 3Q8PB 2M05A 4ZQIA 2JEIA 3N40P 5FLXW 4ECRA 4RB1A 4UCUA 2HJWA 3VPCA 5IT9W 2RF4A 2XCPA 5KFNA 2R92G 4JYAH 3R5FA 4GKJH 2VUMA 2JA6G 3DF7A 4RB0A 2Y0SE 3HXLA 3RUPA 1S03G 4CC5A 4C2MA 4A3IG 1RJPA 2PMZA 1SEIA 1Y14B 2VPQA 4JI0H 5J2UF 4JI3H 3GLKA 2WB1A 5IYZF 4DL3A 1B6RA 1S10A 1TAEA 4A93G 2E5LH 2J6UA 2YS7A 3GTQA 4HYKA 2JA6A 3LWBA 4WBNF 1J5EH 5FPRA 5BPHA 5KFPA 3GTPA 1N33H 2E2IA 5DQHA 4FM9A 1DV2A 1Y1VG 2SCUB 1ZHSA 3RAXA 4O3OA 4LF5H 3MR2A 1S68A 3GV5B 5D1OA 4DL2A 3RV3A 4JI4H 3V6JA 3BQ1A 3GV8B 1IBMH 3RFCA 2FE3A 4YQWA 2WDTA 2RGRA 2W71A 5EOYA 1GSAA 1V4YA 4M7EA 1XMQH 1IBKH 4ZI7F 1S0OA 3BA9A 3KALA 3RB6A 4J9OA 4LF9H 4GLXA 1HR0H 5JVDF 1RJRA 3R23A 2W7OA 4L1KA 5KFQA 3J80W 3G8CA 2W9AA 4B3SH 2NVYA 2XC9A 4JI5H 2W6NA 1GLVA 4YY3H 2W6PA 3RBDA 4O3QA 3PR5B 1WCMG 1IOWA 1EHIA 4LH6A 4X65H 4RAZA 4AYBE 5C5JA 5KFJA 4YR0A 1T3NA 4LF4H 2DIKA 2FK2A 2WAQA 2J9GA 2UXDH 1A0IA 3MWEA 5KFVA 4Q43A 3N42B 2C35B 2IMWP 2V9WA 1E4EA 3QZ7A 3OTOH 2UUAH 1KJ8A 2PBZA 2IBKA 3Q8RB 4MTEA 2W8LA 1B6SA 2XGQA 2YU9A 4NXMH 3HOXG 5D8DA 4JI1H 3RGXA 4ZHQF 5KFCA 4Q0YA 5LP6F 5KFDA 4A3BG 1O75A 4ECUA 4DV7H 2R93G 3GV7B 2R7ZA 1GYFA 3BAAA 2PMZE 4GKKH 1Z2OX 2YL2A 4UFZA 5D1OB 2WB1E 1ULZA 2P0AA 1I50A 3G6XA 2V58A 2XCAA 1EYZA 1ZQ7A 3R5HA 4QIWA 2V5AA 2BQUA 1JXLA 1Z2PX 1B04A 3V4ZA 1N36H 2CW7A 4C5BA 4TV9F 5KFIA 3BJYA 2IA6A 4MV7A 5IP7G 2R93A 3GTOA 4U7CA 4DV5H 3OSNA 5IWAH 4A3LG 4DV0H 1PK8A 1JX4A 3U9TA 5DLFA 4BBRG 3EPGA 5KFWA 5KFFA 3GTLA 4Y8VB 1S97A 4R8UA 5BPFA 2R87A 2DZDA 4YR2A 3OUZA 3Q8SB 2IP4A 4I55F 4RZRA 2FJZA 3GQCA 3KHGA 2JA5G 5LA6F 1KJ9A 2ATLA 1M7JA 4LF6H 5J2TF 3RB4A 3HOUG 2DPIA 1Z2NX 2FKLA 2W6MA 2OWOA 4YAKB 2R84A 4XYMB 5KG1A 3SE7A 1S9FA 5HBRB 4J9RA 2JA5A 2OLSA 1JIHA 2VUMG 3KHHA 4MV6A 5HV6A 4APMA 4BY7G 3PW4A 2NU9B 4Q8EA 4UCSA 4F4YA 3RTXA 3NGDA 4I4TF 1IBLH 4DV4H 3H4DA 5CB4F 4RB3C 2HVSA 1TA8A 4BY1G 3V6HA 2WAQE 1JKJB 3L2PA 1W96A 3V6KA 2QYZA 3TQ1A 5EWGA 1WH2A 3E5NA 3JSLA 3WNZA 3RBEA 1HNZH 4QJFA 3L4KA 3H0GA 2GPSA 4HNVA 1IOVA 5JUMA 3VMMA 5KFMA 4B3TH 5C1PA 1WR2A 5KFYA 3K5IA 5KFHA 4YP3A 2YS6A 3HOYG 3FMAA 4A2BA 5IP9G 4DL5A 4DR1H 4IR1A 2J6SA 4UCOA 4J9SA 4XX0B 3H20A 1SCUB 5JH7F
chains in the Genus database with same CATH topology
2YZGA 4L1KA 1JLLB 3G8CA 4IWYA 2FPGB 2W6NA 1GLVA 2W6PA 1VBHA 2I87A 4C5CA 2XD4A 3Q1KA 3RV4A 4I50F 5JH7F 1IOWA 1EHIA 4ZOLF 3V4SA 4MAMA 4IWXA 1C30A 2CZGA 2DIKA 2R7KA 2NUAB 2FB9A 2J9GA 2GPWA 1VKZA 1CQJB 4YBZB 1M6VA 3TQTA 5LYJF 2PN1A 4XZ3B 3N8DA 3VPDA 3I12A 3MWEA 5LXTF 5BMVF 2W6QA 4IHJF 1CS0A 1VBGA 1E4EA 1I7NA 2VR1A 4FU0A 4EG0A 1KJ8A 1W93A 2PBZA 2R82A 1T36A 4HR7A 1GSHA 2VQDA 1BXRA 1B6SA 5K2MA 2W70A 5EZYF 4MV1A 1GGOA 2V59A 3ETJA 2DWCA 2R85A 1JDEA 5D8DA 5JVLA 2R7NA 2YRWA 2ZDHA 2YRXA 4TUYF 4ZHQF 2YZNA 2CQYA 3Q2OA 4HNUA 4MV3A 5C8YF 5LP6F 4DLKA 2GLTA 3U9SA 5I47A 2C00A 2W6ZA 2YL2A 4O4LF 4YB8B 1ULZA 5KX5F 1EUCB 2P0AA 3ETHA 4IZOA 5C1OA 1A9XA 1KC7A 2V58A 1EYZA 2FP4B 2FPPB 2YW2A 2W6OA 2V5AA 3R5HA 4MV8A 3R5XA 4WD3A 3HB9A 3V4ZA 2DLNA 4EGQA 1JDBB 4C5BA 3K5HA 3QFFA 4O4IF 4TV9F 4HNTA 3BG5A 3TINA 4E4TA 2NU7B 1KJQA 1KJJA 1PX2A 4EGJA 3GIDA 2R7LA 1E4EB 1PK8A 1AUXA 2X0SA 3HBLA 5CA0F 3U9TA 5KKNB 2R86A 4ZQIA 4YAJB 4Y8VB 5BPFA 2R87A 4ME6A 2DZDA 5JQWA 3OUZA 2HJWA 3VPCA 2IP4A 4I55F 3MJFA 4C5AA 1EUDB 2FPIB 3R5FA 1CE8A 1DV1A 5LA6F 1GSOA 1KJ9A 2ZDGA 2R6FA 3RUPA 3MWDA 5J2TF 2ZDQA 4MV4A 2W6MA 2VPQA 3JZIA 3TIGA 4YAKB 2QK4A 2R84A 4XYMB 3GLKA 2NU6B 5J2UF 5IYZF 2I8CA 1B6RA 1BNCA 5GONF 3SE7A 5HBRB 4YJ2F 2YS7A 2OLSA 3LWBA 4XYLB 4WBNF 1UC8A 4MV6A 3LP8A 5BPHA 3WO0A 2NU9B 5HV6A 2I80A 1DV2A 4YJ3F 1UC9A 2SCUB 4I4TF 5CB4F 2XCLA 3K3PA 1JKJB 5H80A 1W96A 3RV3A 3OUUA 1KJIA 3TIIA 3RFCA 3E5NA 1I7LA 3WNZA 2YYAA 4TV8F 5LOVF 4O2AF 3VPBA 2W71A 2GPSA 4HNVA 1CQIB 4HQ6A 1KBLA 1IOVA 3UFXB 3VMMA 1GSAA 3ORQA 5C1PA 4M9UA 2YZMA 1WR2A 3K5IA 1DIKA 4ZI7F 2NU8B 5CAEB 5CA1F 2YS6A 2PVPA 1KEEA 4O4HF 1AUVA 3ORRA 3WO1A 4O2BF 3JRWA 1C3OA 2R7MA 3JRXA 4MA0A 4XX0B 5JVDF 3R23A 1SCUB 1EZ1A 4MA5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YZG A;  4L1K A;  1JLL B;  3G8C A;  4IWY A;  2FPG B;  2W6N A;  1GLV A;  2W6P A;  1VBH A;  2I87 A;  4C5C A;  2XD4 A;  3Q1K A;  3RV4 A;  4I50 F;  5JH7 F;  1IOW A;  1EHI A;  4ZOL F;  3V4S A;  4MAM A;  4IWX A;  1C30 A;  2CZG A;  2DIK A;  2R7K A;  2NUA B;  2FB9 A;  2J9G A;  2GPW A;  1VKZ A;  1CQJ B;  4YBZ B;  1M6V A;  3TQT A;  5LYJ F;  2PN1 A;  4XZ3 B;  3N8D A;  3VPD A;  3I12 A;  3MWE A;  5LXT F;  5BMV F;  2W6Q A;  4IHJ F;  1CS0 A;  1VBG A;  1E4E A;  1I7N A;  2VR1 A;  4FU0 A;  4EG0 A;  1KJ8 A;  1W93 A;  2PBZ A;  2R82 A;  1T36 A;  4HR7 A;  1GSH A;  2VQD A;  1BXR A;  1B6S A;  5K2M A;  2W70 A;  5EZY F;  4MV1 A;  1GGO A;  2V59 A;  3ETJ A;  2DWC A;  2R85 A;  1JDE A;  5D8D A;  5JVL A;  2R7N A;  2YRW A;  2ZDH A;  2YRX A;  4TUY F;  4ZHQ F;  2YZN A;  2CQY A;  3Q2O A;  4HNU A;  4MV3 A;  5C8Y F;  5LP6 F;  4DLK A;  2GLT A;  3U9S A;  5I47 A;  2C00 A;  2W6Z A;  2YL2 A;  4O4L F;  4YB8 B;  1ULZ A;  5KX5 F;  1EUC B;  2P0A A;  3ETH A;  4IZO A;  5C1O A;  1A9X A;  1KC7 A;  2V58 A;  1EYZ A;  2FP4 B;  2FPP B;  2YW2 A;  2W6O A;  2V5A A;  3R5H A;  4MV8 A;  3R5X A;  4WD3 A;  3HB9 A;  3V4Z A;  2DLN A;  4EGQ A;  1JDB B;  4C5B A;  3K5H A;  3QFF A;  4O4I F;  4TV9 F;  4HNT A;  3BG5 A;  3TIN A;  4E4T A;  2NU7 B;  1KJQ A;  1KJJ A;  1PX2 A;  4EGJ A;  3GID A;  2R7L A;  1E4E B;  1PK8 A;  1AUX A;  2X0S A;  3HBL A;  5CA0 F;  3U9T A;  5KKN B;  2R86 A;  4ZQI A;  4YAJ B;  4Y8V B;  5BPF A;  2R87 A;  4ME6 A;  2DZD A;  5JQW A;  3OUZ A;  2HJW A;  3VPC A;  2IP4 A;  4I55 F;  3MJF A;  4C5A A;  1EUD B;  2FPI B;  3R5F A;  1CE8 A;  1DV1 A;  5LA6 F;  1GSO A;  1KJ9 A;  2ZDG A;  2R6F A;  3RUP A;  3MWD A;  5J2T F;  2ZDQ A;  4MV4 A;  2W6M A;  2VPQ A;  3JZI A;  3TIG A;  4YAK B;  2QK4 A;  2R84 A;  4XYM B;  3GLK A;  2NU6 B;  5J2U F;  5IYZ F;  2I8C A;  1B6R A;  1BNC A;  5GON F;  3SE7 A;  5HBR B;  4YJ2 F;  2YS7 A;  2OLS A;  3LWB A;  4XYL B;  4WBN F;  1UC8 A;  4MV6 A;  3LP8 A;  5BPH A;  3WO0 A;  2NU9 B;  5HV6 A;  2I80 A;  1DV2 A;  4YJ3 F;  1UC9 A;  2SCU B;  4I4T F;  5CB4 F;  2XCL A;  3K3P A;  1JKJ B;  5H80 A;  1W96 A;  3RV3 A;  3OUU A;  1KJI A;  3TII A;  3RFC A;  3E5N A;  1I7L A;  3WNZ A;  2YYA A;  4TV8 F;  5LOV F;  4O2A F;  3VPB A;  2W71 A;  2GPS A;  4HNV A;  1CQI B;  4HQ6 A;  1KBL A;  1IOV A;  3UFX B;  3VMM A;  1GSA A;  3ORQ A;  5C1P A;  4M9U A;  2YZM A;  1WR2 A;  3K5I A;  1DIK A;  4ZI7 F;  2NU8 B;  5CAE B;  5CA1 F;  2YS6 A;  2PVP A;  1KEE A;  4O4H F;  1AUV A;  3ORR A;  3WO1 A;  4O2B F;  3JRW A;  1C3O A;  2R7M A;  3JRX A;  4MA0 A;  4XX0 B;  5JVD F;  3R23 A;  1SCU B;  1EZ1 A;  4MA5 A; 
#chains in the Genus database with same CATH topology
 3KAJ A;  2UXB H;  4ECZ A;  1RK6 A;  3PW2 A;  2WTF A;  1JLL B;  4DR5 H;  2V4R A;  4IWY A;  3PW7 A;  4C5C A;  5LMN H;  1S0M A;  4JV2 A;  2XD4 A;  3Q1K A;  4FS2 A;  2AGP A;  4LFC H;  2B63 G;  4ZOL F;  4R8U B;  2VQF H;  1C30 A;  2R7K A;  1RYR A;  2AQ4 A;  2JEJ A;  2GPW A;  4UCT A;  5EDW A;  2F4V H;  1AN7 A;  3N8D A;  2O03 A;  5KFT A;  5BMV F;  4J9L A;  2W6Q A;  1N56 A;  1CS0 A;  3GIL A;  2HVQ A;  3L4J A;  2B63 A;  4HR7 A;  4EEY A;  1TWH A;  3PZP A;  5KT6 A;  4LH7 A;  2W70 A;  2JA7 A;  4ETS A;  4O3S A;  4ECV A;  2BQ3 A;  2V59 A;  4QWD A;  4JI2 H;  4YR3 A;  2R85 A;  4BWS C;  5KG6 A;  1T94 A;  2YRW A;  3CVZ A;  2YRX A;  2VUG A;  5KFZ A;  5A2Q W;  2W9B B;  3MFI A;  1V51 A;  4DLK A;  2GLT A;  5KT3 A;  2C28 A;  2UU9 H;  2W6Z A;  5DG9 A;  4JV0 A;  5KFX A;  3KTM A;  4EYI B;  1EUC B;  3ETH A;  4ED3 A;  3T5K A;  2FPP B;  5IYD G;  4TQR A;  3R5X A;  4AQY H;  2DLN A;  1R9T A;  2JA8 G;  3GTG A;  1N32 H;  3K5H A;  3M9N B;  4X66 H;  4B3R H;  3TIN A;  4E4T A;  2NU7 B;  3HOV G;  2R7Z G;  3KAK A;  3GID A;  2R7L A;  4QW8 A;  3M9M B;  2X0S A;  3HBL A;  2VA3 A;  4FBU A;  4YAJ B;  3GTK A;  4A3G G;  2HVR A;  3MR5 A;  2ZJT A;  4ME6 A;  5KFS A;  5JQW A;  4EEQ A;  2R8J A;  4C5A A;  3M4I A;  1EUD B;  3N43 B;  2WYO A;  2V4Q A;  1DV1 A;  3PO3 G;  1GSO A;  5D1P A;  2ZDG A;  2R6F A;  5KT5 A;  5DGA A;  2VA2 A;  2CKZ B;  5BR8 H;  4QWE A;  4X64 H;  4RU9 A;  2W7P A;  2BQR A;  4EFB A;  1XNR H;  2UVR A;  2R8K A;  1ZET A;  4JI7 H;  4IAJ A;  2NU6 B;  4UCV A;  5KFE A;  2I8C A;  4DV1 H;  5GON F;  2AU0 A;  2ASD A;  1Y1W A;  1L2Z A;  3J7A K;  2RDI A;  3GIK A;  3N6X A;  1FJG H;  4KHP H;  4GC6 A;  4DR2 H;  3GTM A;  4XYL B;  3PO2 G;  4ECS A;  3LP8 A;  4PDB A;  2I80 A;  1I3Q A;  4LF8 H;  3KHL A;  3BQ0 A;  2XCL A;  4B3M H;  1RJQ A;  3K3P A;  3GIQ A;  5H80 A;  1UNN C;  2ZM6 H;  3TII A;  3H40 A;  3BAB A;  1I7L A;  4EBC A;  2YYA A;  4UCR A;  4IRK A;  4F4X A;  4O2A F;  3VPB A;  3GII A;  4Q44 A;  5KFK A;  1KBL A;  2ALZ A;  2VOB A;  4HQ6 A;  3F8N A;  5DGB A;  4QWC A;  3ORQ A;  4R7R A;  4M9U A;  4EFE A;  4FBT A;  3IG0 A;  4NXN H;  2FMA A;  1SFO A;  5L9X A;  1DIK A;  4ED1 A;  5CAE B;  5CA1 F;  2NVX A;  1SYX B;  1XDN A;  1KEE A;  5KT7 A;  3AYH B;  2C22 A;  3JRW A;  1XMO H;  1C3O A;  4A2A A;  4JV1 A;  3RAQ A;  5C3E G;  4J9N A;  2DPJ A;  4GC7 A;  3EYY A;  4DR4 H;  3K3V A;  4OX9 H;  4MA5 A;  5L1K A;  2W9B A;  3T5J A;  4Q45 A;  3I4N G;  2YZG A;  3H0G G;  3RGZ A;  3OSP A;  1VAJ A;  4LFA H;  3RIZ A;  2FPG B;  2FLN A;  3G6Y A;  2ASL A;  4F4W A;  4IRD A;  4RNN A;  4RUC A;  2FK3 A;  4O3P A;  5L1I A;  4J9Q A;  4MAM A;  4EYH B;  5EWE A;  2CZG A;  3C0F B;  4MV9 A;  2XIG A;  5DG7 A;  2FB9 A;  3GTJ A;  5KT4 A;  1VKZ A;  4YBZ B;  4AYB A;  4RB2 C;  4XZ3 B;  4JV5 H;  4DR7 H;  1ZHQ A;  5LXT F;  5KG3 A;  4J9K A;  1TWG A;  1TWA A;  1I7N A;  1TWF A;  2VR1 A;  4FU0 A;  3J81 W;  4A3F G;  2YCH A;  4EG0 A;  3RF2 A;  5FD5 A;  1W93 A;  5LL6 b;  4DUZ H;  2HHH H;  1T36 A;  1N48 A;  1GSH A;  5C4X G;  2C2R A;  2KSW A;  1BXR A;  4DR3 H;  3HKZ A;  5KFB A;  2VPS A;  4DL6 A;  3KHR A;  2VQE H;  5EZY F;  4JI6 H;  4RNM A;  4MV1 A;  5L1L A;  2C2E A;  5FJ8 G;  2DWC A;  3RB0 A;  1S0N A;  1JDE A;  4IR9 A;  5KFO A;  4ECT A;  1XNQ H;  2ZDH A;  4HNU A;  4J9P A;  4DV2 H;  2YZN A;  2CQY A;  3JSN A;  3Q2O A;  2R8G A;  4NLG A;  3JAM W;  5KT2 A;  1RYS A;  2BR0 A;  5I47 A;  4O4L F;  1M0T A;  4J9M A;  4QIW E;  5KX5 F;  5KG4 A;  4DV3 H;  2JA7 G;  2W57 A;  4EBD A;  2YW2 A;  2FP4 B;  4WD3 A;  4J0M A;  4MV8 A;  2R92 A;  1M0W A;  3HB9 A;  4EGQ A;  4QW9 A;  1JDB B;  4G3I A;  3QFF A;  4HNT A;  4FS1 A;  3N44 B;  1KJJ A;  1PX2 A;  4EGJ A;  4BBS G;  5CA0 F;  2AGO A;  1K1S A;  3KXY T;  2R86 A;  5DQG A;  3GIM A;  4RAY A;  4ED6 A;  4X62 H;  3Q8Q B;  1VS0 A;  1HNW H;  1K1Q A;  5F9N A;  3FKI G;  3MJF A;  2FPI B;  2J6T A;  1CE8 A;  1HNX H;  1DGS A;  4ECY A;  3T5L A;  1GO3 E;  3MWD A;  2R8H A;  1Y1V A;  4ECX A;  2ZDQ A;  4MV4 A;  1I94 H;  2W9C B;  3JZI A;  3TIG A;  2QK4 A;  3FKI A;  1BNC A;  5DLG A;  1B33 N;  2JEG A;  5EWF A;  4YJ2 F;  4U6P A;  3T1Y H;  4O3R A;  3BA8 A;  4LSA A;  4ED7 A;  4A3C G;  1V9P A;  1UC8 A;  3WO0 A;  3PW5 A;  4YJ3 F;  5DG8 A;  1UC9 A;  4A3J G;  1I6U A;  3CQZ A;  4CC6 A;  5LMU H;  1RK5 A;  3RB3 A;  4A3D G;  5FLM G;  4TQS A;  4DL7 A;  3H3V H;  2CW8 A;  1Y1W G;  4MTD A;  3MR3 A;  3OUU A;  1KJI A;  5T14 A;  4F50 A;  4ED2 A;  4RZQ A;  4PWQ A;  2FLP A;  5FD6 A;  4TV8 F;  5LOV F;  5KFR A;  5KFG A;  3EPI A;  1CQI B;  2Y0S A;  3UFX B;  1P8L A;  4LMY A;  4YHH H;  2YZM A;  1N34 H;  2UVW A;  4LFB H;  3H4B A;  2NU8 B;  4K0K H;  3N41 B;  4DUY H;  2UVV A;  3M9O B;  2PVP A;  1WCM A;  3HKZ E;  4O4H F;  1AUV A;  3ORR A;  4RUA A;  3WO1 A;  4O2B F;  1FKA H;  2E2H A;  3PN1 A;  2R7M A;  3JRX A;  3OHA A;  1E4F T;  4MA0 A;  5KG5 A;  3BQ2 A;  3MWM A;  3T5H A;  1EZ1 A;  2RDJ A;  3UQ8 A;  3FDS A;  3GIJ A;  4IRC A;  1MZB A;  2ASJ A;  2UVU A;  2W8K A;  5L1J A;  3PR4 A;  1VBH A;  2I87 A;  5DQI A;  2UXC H;  1FVI A;  2FLL A;  3RV4 A;  4RNO A;  4I50 F;  3V4S A;  4IWX A;  2NUA B;  2UUC H;  2AGQ A;  2HGS A;  2RGV A;  2OH2 A;  1CQJ B;  3TQT A;  1M6V A;  5LYJ F;  2PN1 A;  3MFH A;  1BGW A;  3QZ8 A;  4A3M G;  3PVX A;  3VPD A;  3I12 A;  4DR6 H;  5KG0 A;  2XGP A;  4IHJ F;  1VBG A;  4DV6 H;  4JI8 H;  5IYC G;  3RJ0 A;  4DL4 A;  4QWA A;  1K83 A;  4O3N A;  5KG2 A;  2Q2U A;  2WE6 A;  2R82 A;  4JUZ A;  2Q2T A;  4Q8F A;  3HOW G;  4LF7 H;  1X9N A;  5C44 G;  3I4M G;  3OHB A;  2VQD A;  3HOZ G;  3G6V A;  5K2M A;  3GIP A;  5F9L A;  1GGO A;  1OWT A;  3ETJ A;  3IN5 A;  3PW0 A;  2UUB H;  3SI8 A;  2R8I A;  4ED0 A;  5JVL A;  1TWC A;  2R7N A;  4TUY F;  5KFU A;  4ECQ A;  4ED8 A;  2FK1 A;  4A3K G;  4MV3 A;  5C8Y F;  4LSX A;  5KG7 A;  5FPO A;  2W9C A;  3U9S A;  2C00 A;  4YB8 B;  4I7H A;  2MCT A;  4IZO A;  5C1O A;  1A9X A;  5KFA A;  1KC7 A;  2JEF A;  1E4G T;  3T1H H;  2W6O A;  4ECW A;  1WSC A;  1BJT A;  5KFL A;  4BXX G;  5IYB G;  4O4I F;  3BG5 A;  1KJQ A;  3LML A;  4QWB A;  3MR6 A;  4F4Z A;  4A3E G;  5KKN B;  1E4E B;  1AUX A;  4EBE A;  2C2D A;  3Q8P B;  2M05 A;  4ZQI A;  2JEI A;  3N40 P;  5FLX W;  4ECR A;  4RB1 A;  4UCU A;  2HJW A;  3VPC A;  5IT9 W;  2RF4 A;  2XCP A;  5KFN A;  2R92 G;  4JYA H;  3R5F A;  4GKJ H;  2VUM A;  2JA6 G;  3DF7 A;  4RB0 A;  2Y0S E;  3HXL A;  3RUP A;  1S03 G;  4CC5 A;  4C2M A;  4A3I G;  1RJP A;  2PMZ A;  1SEI A;  1Y14 B;  2VPQ A;  4JI0 H;  5J2U F;  4JI3 H;  3GLK A;  2WB1 A;  5IYZ F;  4DL3 A;  1B6R A;  1S10 A;  1TAE A;  4A93 G;  2E5L H;  2J6U A;  2YS7 A;  3GTQ A;  4HYK A;  2JA6 A;  3LWB A;  4WBN F;  1J5E H;  5FPR A;  5BPH A;  5KFP A;  3GTP A;  1N33 H;  2E2I A;  5DQH A;  4FM9 A;  1DV2 A;  1Y1V G;  2SCU B;  1ZHS A;  3RAX A;  4O3O A;  4LF5 H;  3MR2 A;  1S68 A;  3GV5 B;  5D1O A;  4DL2 A;  3RV3 A;  4JI4 H;  3V6J A;  3BQ1 A;  3GV8 B;  1IBM H;  3RFC A;  2FE3 A;  4YQW A;  2WDT A;  2RGR A;  2W71 A;  5EOY A;  1GSA A;  1V4Y A;  4M7E A;  1XMQ H;  1IBK H;  4ZI7 F;  1S0O A;  3BA9 A;  3KAL A;  3RB6 A;  4J9O A;  4LF9 H;  4GLX A;  1HR0 H;  5JVD F;  1RJR A;  3R23 A;  2W7O A;  4L1K A;  5KFQ A;  3J80 W;  3G8C A;  2W9A A;  4B3S H;  2NVY A;  2XC9 A;  4JI5 H;  2W6N A;  1GLV A;  4YY3 H;  2W6P A;  3RBD A;  4O3Q A;  3PR5 B;  1WCM G;  1IOW A;  1EHI A;  4LH6 A;  4X65 H;  4RAZ A;  4AYB E;  5C5J A;  5KFJ A;  4YR0 A;  1T3N A;  4LF4 H;  2DIK A;  2FK2 A;  2WAQ A;  2J9G A;  2UXD H;  1A0I A;  3MWE A;  5KFV A;  4Q43 A;  3N42 B;  2C35 B;  2IMW P;  2V9W A;  1E4E A;  3QZ7 A;  3OTO H;  2UUA H;  1KJ8 A;  2PBZ A;  2IBK A;  3Q8R B;  4MTE A;  2W8L A;  1B6S A;  2XGQ A;  2YU9 A;  4NXM H;  3HOX G;  5D8D A;  4JI1 H;  3RGX A;  4ZHQ F;  5KFC A;  4Q0Y A;  5LP6 F;  5KFD A;  4A3B G;  1O75 A;  4ECU A;  4DV7 H;  2R93 G;  3GV7 B;  2R7Z A;  1GYF A;  3BAA A;  2PMZ E;  4GKK H;  1Z2O X;  2YL2 A;  4UFZ A;  5D1O B;  2WB1 E;  1ULZ A;  2P0A A;  1I50 A;  3G6X A;  2V58 A;  2XCA A;  1EYZ A;  1ZQ7 A;  3R5H A;  4QIW A;  2V5A A;  2BQU A;  1JXL A;  1Z2P X;  1B04 A;  3V4Z A;  1N36 H;  2CW7 A;  4C5B A;  4TV9 F;  5KFI A;  3BJY A;  2IA6 A;  4MV7 A;  5IP7 G;  2R93 A;  3GTO A;  4U7C A;  4DV5 H;  3OSN A;  5IWA H;  4A3L G;  4DV0 H;  1PK8 A;  1JX4 A;  3U9T A;  5DLF A;  4BBR G;  3EPG A;  5KFW A;  5KFF A;  3GTL A;  4Y8V B;  1S97 A;  4R8U A;  5BPF A;  2R87 A;  2DZD A;  4YR2 A;  3OUZ A;  3Q8S B;  2IP4 A;  4I55 F;  4RZR A;  2FJZ A;  3GQC A;  3KHG A;  2JA5 G;  5LA6 F;  1KJ9 A;  2ATL A;  1M7J A;  4LF6 H;  5J2T F;  3RB4 A;  3HOU G;  2DPI A;  1Z2N X;  2FKL A;  2W6M A;  2OWO A;  4YAK B;  2R84 A;  4XYM B;  5KG1 A;  3SE7 A;  1S9F A;  5HBR B;  4J9R A;  2JA5 A;  2OLS A;  1JIH A;  2VUM G;  3KHH A;  4MV6 A;  5HV6 A;  4APM A;  4BY7 G;  3PW4 A;  2NU9 B;  4Q8E A;  4UCS A;  4F4Y A;  3RTX A;  3NGD A;  4I4T F;  1IBL H;  4DV4 H;  3H4D A;  5CB4 F;  4RB3 C;  2HVS A;  1TA8 A;  4BY1 G;  3V6H A;  2WAQ E;  1JKJ B;  3L2P A;  1W96 A;  3V6K A;  2QYZ A;  3TQ1 A;  5EWG A;  1WH2 A;  3E5N A;  3JSL A;  3WNZ A;  3RBE A;  1HNZ H;  4QJF A;  3L4K A;  3H0G A;  2GPS A;  4HNV A;  1IOV A;  5JUM A;  3VMM A;  5KFM A;  4B3T H;  5C1P A;  1WR2 A;  5KFY A;  3K5I A;  5KFH A;  4YP3 A;  2YS6 A;  3HOY G;  3FMA A;  4A2B A;  5IP9 G;  4DL5 A;  4DR1 H;  4IR1 A;  2J6S A;  4UCO A;  4J9S A;  4XX0 B;  3H20 A;  1SCU B;  5JH7 F; 
#chains in the Genus database with same CATH homology
 2YZG A;  4L1K A;  1JLL B;  3G8C A;  4IWY A;  2FPG B;  2W6N A;  1GLV A;  2W6P A;  1VBH A;  2I87 A;  4C5C A;  2XD4 A;  3Q1K A;  3RV4 A;  4I50 F;  5JH7 F;  1IOW A;  1EHI A;  4ZOL F;  3V4S A;  4MAM A;  4IWX A;  1C30 A;  2CZG A;  2DIK A;  2R7K A;  2NUA B;  2FB9 A;  2J9G A;  2GPW A;  1VKZ A;  1CQJ B;  4YBZ B;  1M6V A;  3TQT A;  5LYJ F;  2PN1 A;  4XZ3 B;  3N8D A;  3VPD A;  3I12 A;  3MWE A;  5LXT F;  5BMV F;  2W6Q A;  4IHJ F;  1CS0 A;  1VBG A;  1E4E A;  1I7N A;  2VR1 A;  4FU0 A;  4EG0 A;  1KJ8 A;  1W93 A;  2PBZ A;  2R82 A;  1T36 A;  4HR7 A;  1GSH A;  2VQD A;  1BXR A;  1B6S A;  5K2M A;  2W70 A;  5EZY F;  4MV1 A;  1GGO A;  2V59 A;  3ETJ A;  2DWC A;  2R85 A;  1JDE A;  5D8D A;  5JVL A;  2R7N A;  2YRW A;  2ZDH A;  2YRX A;  4TUY F;  4ZHQ F;  2YZN A;  2CQY A;  3Q2O A;  4HNU A;  4MV3 A;  5C8Y F;  5LP6 F;  4DLK A;  2GLT A;  3U9S A;  5I47 A;  2C00 A;  2W6Z A;  2YL2 A;  4O4L F;  4YB8 B;  1ULZ A;  5KX5 F;  1EUC B;  2P0A A;  3ETH A;  4IZO A;  5C1O A;  1A9X A;  1KC7 A;  2V58 A;  1EYZ A;  2FP4 B;  2FPP B;  2YW2 A;  2W6O A;  2V5A A;  3R5H A;  4MV8 A;  3R5X A;  4WD3 A;  3HB9 A;  3V4Z A;  2DLN A;  4EGQ A;  1JDB B;  4C5B A;  3K5H A;  3QFF A;  4O4I F;  4TV9 F;  4HNT A;  3BG5 A;  3TIN A;  4E4T A;  2NU7 B;  1KJQ A;  1KJJ A;  1PX2 A;  4EGJ A;  3GID A;  2R7L A;  1E4E B;  1PK8 A;  1AUX A;  2X0S A;  3HBL A;  5CA0 F;  3U9T A;  5KKN B;  2R86 A;  4ZQI A;  4YAJ B;  4Y8V B;  5BPF A;  2R87 A;  4ME6 A;  2DZD A;  5JQW A;  3OUZ A;  2HJW A;  3VPC A;  2IP4 A;  4I55 F;  3MJF A;  4C5A A;  1EUD B;  2FPI B;  3R5F A;  1CE8 A;  1DV1 A;  5LA6 F;  1GSO A;  1KJ9 A;  2ZDG A;  2R6F A;  3RUP A;  3MWD A;  5J2T F;  2ZDQ A;  4MV4 A;  2W6M A;  2VPQ A;  3JZI A;  3TIG A;  4YAK B;  2QK4 A;  2R84 A;  4XYM B;  3GLK A;  2NU6 B;  5J2U F;  5IYZ F;  2I8C A;  1B6R A;  1BNC A;  5GON F;  3SE7 A;  5HBR B;  4YJ2 F;  2YS7 A;  2OLS A;  3LWB A;  4XYL B;  4WBN F;  1UC8 A;  4MV6 A;  3LP8 A;  5BPH A;  3WO0 A;  2NU9 B;  5HV6 A;  2I80 A;  1DV2 A;  4YJ3 F;  1UC9 A;  2SCU B;  4I4T F;  5CB4 F;  2XCL A;  3K3P A;  1JKJ B;  5H80 A;  1W96 A;  3RV3 A;  3OUU A;  1KJI A;  3TII A;  3RFC A;  3E5N A;  1I7L A;  3WNZ A;  2YYA A;  4TV8 F;  5LOV F;  4O2A F;  3VPB A;  2W71 A;  2GPS A;  4HNV A;  1CQI B;  4HQ6 A;  1KBL A;  1IOV A;  3UFX B;  3VMM A;  1GSA A;  3ORQ A;  5C1P A;  4M9U A;  2YZM A;  1WR2 A;  3K5I A;  1DIK A;  4ZI7 F;  2NU8 B;  5CAE B;  5CA1 F;  2YS6 A;  2PVP A;  1KEE A;  4O4H F;  1AUV A;  3ORR A;  3WO1 A;  4O2B F;  3JRW A;  1C3O A;  2R7M A;  3JRX A;  4MA0 A;  4XX0 B;  5JVD F;  3R23 A;  1SCU B;  1EZ1 A;  4MA5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...