2CQYA

Solution structure of b domain from human propionyl-coa carboxylase alpha subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
GSSGSSGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propionyl-CoA carboxylase alpha chain, mitochondrial
publication title Solution structure of B domain from human propionyl-CoA carboxylase alpha subunit
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 108
sequence length 108
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2cqyA01
1CE8A 1KJIA 2HJWA 4TUYF 3VMMA 3K5HA 4YBZB 2IP4A 4HQ6A 4ZQIA 3RFCA 2W6OA 2I80A 4M9UA 2C00A 4C5BA 4HNTA 5KX5F 1CS0A 1KJ9A 3JZIA 2ZDHA 3TIIA 1UC8A 2ZDQA 5J2TF 5LOVF 1EUCB 2YRWA 5JQWA 5HBRB 3LWBA 5EZYF 3WO1A 1M6VA 1WR2A 2V5AA 4MV3A 4WD3A 5LXTF 2GPSA 4HNUA 2FP4B 2V59A 4ME6A 3ORRA 4XX0B 1CQJB 1GSHA 4I4TF 3Q2OA 2W71A 2I87A 4L1KA 1E4EA 2CQYA 5D8DA 3V4SA 4WBNF 2NU9B 2VQDA 1KEEA 4MV8A 3I12A 2FB9A 2YW2A 3HB9A 1AUVA 4HR7A 1B6SA 1IOVA 2XD4A 2R6FA 2W6NA 4O4IF 1KJQA 3OUZA 5K2MA 4EGQA 1SCUB 3BG5A 3ETJA 1BNCA 2QK4A 1C3OA 1T36A 3WNZA 2YRXA 4FU0A 3RV4A 4EG0A 2VPQA 3K3PA 4IHJF 5HV6A 2NUAB 3TIGA 3V4ZA 5LA6F 3U9TA 3VPDA 3ORQA 3R5FA 4I55F 1JDBB 1I7NA 5H80A 3HBLA 4IWYA 4MA5A 4MV6A 3E5NA 2DWCA 4MV1A 4YAKB 2W70A 2GLTA 2R82A 3Q1KA 2NU7B 1GSOA 4EGJA 3N8DA 2R7NA 2DZDA 1PK8A 5CB4F 3WO0A 3K5IA 2VR1A 5LP6F 1GLVA 4O4LF 2W6MA 5JVDF 2YZNA 3JRWA 3R5XA 2J9GA 2W6ZA 3VPBA 2FPPB 4E4TA 4MA0A 5J2UF 3JRXA 1EHIA 3R5HA 4TV8F 2PVPA 2R7KA 2R7LA 1KJJA 3MJFA 1E4EB 4YJ2F 3GLKA 1ULZA 1DV2A 3R23A 4IZOA 3VPCA 4HNVA 1EYZA 4MV4A 2ZDGA 5BPFA 1I7LA 2R85A 2I8CA 2YZMA 1GGOA 2R84A 2NU8B 3TINA 5GONF 1JLLB 4XYMB 1DV1A 2PBZA 2YYAA 2OLSA 4Y8VB 1JKJB 4DLKA 3LP8A 3GIDA 4O2BF 2PN1A 2R7MA 1KBLA 1UC9A 4XZ3B 2CZGA 4XYLB 5C1OA 2GPWA 2XCLA 5BMVF 2FPIB 4ZOLF 4C5AA 5C8YF 1KC7A 3G8CA 1A9XA 2SCUB 2DLNA 1GSAA 5BPHA 1VBHA 3MWDA 5CAEB 1EUDB 4IWXA 4YB8B 1BXRA 5KKNB 3U9SA 5JVLA 4MAMA 1VBGA 2P0AA 2R87A 3OUUA 3UFXB 5JH7F 4I50F 1DIKA 2YS7A 4YJ3F 3RUPA 4C5CA 5I47A 2DIKA 1CQIB 1IOWA 4O2AF 1W93A 1VKZA 2YZGA 3MWEA 1EZ1A 1C30A 2W6PA 2V58A 2W6QA 4YAJB 3RV3A 5LYJF 4ZHQF 4O4HF 1W96A 5CA1F 2NU6B 2R86A 5C1PA 4ZI7F 3QFFA 3TQTA 3ETHA 1AUXA 1PX2A 1JDEA 2YS6A 1KJ8A 2FPGB 2X0SA 4TV9F 5IYZF 5CA0F 3SE7A 2YL2A 1B6RA
chains in the Genus database with same CATH superfamily
1CE8A 4EYHB 1Z2OX 2W9BB 3H0GA 3K5HA 1WCMA 1AN7A 2M05A 2ZJTA 4YBZB 3RFCA 1Y1VA 5C5JA 2UVUA 2C00A 4C5BA 4HNTA 5KX5F 5KFPA 3MFIA 3T1HH 2JEGA 3RAQA 1J5EH 4RNOA 5EWFA 3GIMA 1UC8A 4TQSA 4A93G 3M4IA 4LFBH 5J2TF 1GO3E 2Q2UA 2YRWA 1S0MA 4OX9H 3LWBA 1WR2A 4MV3A 3PO2G 5LXTF 2UXCH 3MWMA 4MV7A 1Y1WA 3DF7A 4ECSA 2V59A 4ME6A 1X9NA 2FK3A 2AGPA 3GTKA 2HGSA 2UVRA 4J9QA 5FLMG 1ZQ7A 4HR7A 3GIIA 1AUVA 4RB0A 2XCPA 1IOVA 2W6NA 3KAJA 4BY7G 4DUZH 4F4YA 3PW2A 1SCUB 3TQ1A 3Q8SB 3PW5A 1MZBA 5EOYA 2QK4A 1S0OA 5KG2A 3OTOH 4EG0A 4DV2H 4LH6A 2R8IA 4DL5A 5F9LA 4IHJF 2HHHH 4QWCA 3V4ZA 3J80W 5LA6F 1RJRA 3V6HA 4LSAA 4LF6H 3HKZE 1XDNA 2DWCA 5JUMA 4DR4H 4J9OA 3QZ7A 2R82A 1GSOA 2C2DA 3RF2A 1PK8A 4LMYA 2Y0SE 3HOVG 2C22A 3OSPA 1I6UA 2W6MA 3GTGA 4U7CA 2VQFH 2YZNA 4DV0H 2WB1E 2UVVA 4E4TA 4QIWA 5J2UF 3RB6A 4BBRG 2R92G 4DV4H 3R5HA 3AYHB 5KFMA 3GIQA 1KJJA 3MJFA 3GILA 2BQ3A 4ECWA 2CKZB 3VPCA 4ECXA 1N32H 4Q44A 1I7LA 5KFCA 2JA7G 3GQCA 4YR2A 2NU8B 4RAYA 3TINA 5KFUA 4X64H 1GYFA 4XYMB 4RZRA 1DV1A 1XMOH 1JKJB 1M7JA 2PN1A 4X66H 4ED3A 4XZ3B 1IBLH 4RAZA 4XYLB 3RJ0A 1S68A 1VAJA 2XCLA 3OHAA 4C5AA 3MFHA 2V4RA 5L1KA 1KC7A 3G8CA 3IG0A 5C3EG 3V6JA 2DLNA 1V4YA 5BPHA 4DL3A 2E5LH 3MWDA 4GC7A 5CAEB 2Q2TA 1EUDB 2NVYA 3KALA 4EBEA 3EYYA 3U9SA 1HNXH 5JVLA 3KAKA 4MAMA 1VBGA 3M9OB 3UFXB 1N48A 4O3SA 1BJTA 5DGBA 2VUMA 1DIKA 3H0GG 4PWQA 2UUCH 3GTOA 1Y1VG 2C28A 1L2ZA 2J6TA 5DQIA 2AU0A 4RZQA 4G3IA 1HNWH 2DPIA 4A2AA 2C2RA 4J9NA 1IOWA 4LF7H 5IP7G 1W93A 5KT2A 5LYJF 3RV3A 4ZHQF 5KFTA 2NU6B 3UQ8A 5KG1A 4RNMA 4DR6H 2CW8A 4TQRA 1N34H 4APMA 1PX2A 2XGQA 1KJ8A 2X0SA 4DV7H 5CA0F 2AQ4A 3RIZA 4J0MA 5KFBA 1T3NA 5KFDA 2F4VH 2IP4A 4HQ6A 4ZQIA 4IR9A 2I80A 1Y14B 4J9KA 2KSWA 3JZIA 2YCHA 3TIIA 5KG6A 2ZDQA 5IYCG 4YP3A 1EUCB 5FLXW 4AQYH 4B3RH 4QWAA 5HBRB 4RUCA 4DR7H 2FK1A 1XNRH 2FK2A 2XCAA 5DG9A 4A3DG 5DLFA 4RB1A 2BQRA 5FJ8G 5L9XA 4XX0B 1HR0H 4ED7A 1OWTA 2R93G 2I87A 4WBNF 2WE6A 3GV7B 2J6UA 4QW9A 2NU9B 2VQDA 3BQ2A 2AGOA 4MV8A 5KG7A 3KHHA 3I12A 2FB9A 3HB9A 4O3QA 4JV5H 4YR0A 1B6SA 2XD4A 2R6FA 5A2QW 4JV1A 4EGQA 5IYBG 3BG5A 4Q0YA 3I4MG 4QIWE 2XIGA 2WYOA 3WNZA 5KT6A 2YRXA 2VOBA 2HVQA 4JI3H 4R8UB 3PR5B 3Q8PB 2RF4A 3T5HA 2JEIA 4A3GG 1RJQA 1TWGA 4EEYA 4I7HA 1JXLA 3U9TA 4FS2A 4EBCA 3ORQA 4I55F 1JDBB 4O3NA 4FM9A 1K83A 5D1OA 3E5NA 4MV1A 3KHGA 3PW4A 4ECVA 2GLTA 3L2PA 2JA5A 3FDSA 5KG0A 2W9CA 2DZDA 5T14A 3K5IA 3QZ8A 2UUAH 5LP6F 5EWEA 4KHPH 4O4LF 2RGRA 1M0TA 4Q8FA 2W6ZA 2R7ZA 3JRXA 1EHIA 2WAQA 4PDBA 2HVRA 4UFZA 4YJ2F 1ULZA 4IZOA 5DQGA 5KFHA 1EYZA 3N6XA 3RGZA 4A3EG 2I8CA 5IT9W 1GGOA 3JSNA 4X62H 5IP9G 3HXLA 2PBZA 3FKIG 4Y8VB 3Q8QB 4A2BA 1UC9A 5C1OA 4O3OA 5KFJA 4J9PA 4J9MA 1K1SA 4DR1H 1V9PA 2ATLA 2FLPA 3KHLA 4AYBA 5L1IA 5KFIA 5KFWA 5KFNA 5D1OB 2E2IA 3I4NG 4IWXA 1RYRA 1N36H 4K0KH 3OUUA 4JV0A 4ECUA 4YR3A 3PR4A 2W9CB 4RNNA 3RUPA 5KFOA 4ED6A 1CQIB 3EPGA 5KFFA 3GV8B 5KT3A 4O2AF 1I3QA 2ZM6H 1VKZA 2V58A 4YAJB 3MR6A 3MR2A 4R7RA 3C0FB 5CA1F 4JUZA 3HOZG 2R8GA 2R86A 3J81W 3MR3A 4UCOA 2PMZA 3ETHA 3GTQA 4J9LA 2FJZA 1AUXA 4DL2A 2CW7A 3Q8RB 5KFVA 2W8KA 4F4XA 2NVXA 5KFLA 3HOUG 4UCRA 3N40P 2O03A 3PZPA 4A3FG 3H40A 3VMMA 2HJWA 2MCTA 4DUYH 3RAXA 4BWSC 4JV2A 4F4ZA 4YY3H 2W6OA 2RDJA 4DL7A 2JA5G 4HYKA 2V9WA 4A3KG 2XC9A 3GTMA 3OHBA 2YU9A 2VUGA 1WCMG 3BAAA 5LMNH 4LSXA 5LOVF 3GV5B 1WSCA 3L4KA 4ED2A 5EZYF 1B33N 4O3PA 3G6YA 1ZHQA 3RTXA 3OSNA 4EFBA 2FP4B 1CQJB 3V4SA 1E4EA 2CQYA 1S97A 4ECRA 3T5KA 4DV3H 4LF5H 1Y1WG 4CC6A 4J9SA 2IMWP 3GTPA 3N44B 4UCSA 3H4BA 4FBUA 4MV9A 1E4GT 5K2MA 3OUZA 4DR2H 4QWBA 5FPRA 1BNCA 5BR8H 1C3OA 1T36A 2WAQE 4DV1H 3NGDA 4NXNH 3RV4A 5DQHA 2R7ZG 4QWEA 4RB2C 2VPQA 2JA6A 5HV6A 4UCTA 4JI0H 5KFQA 2NUAB 3TIGA 3HKZA 3VPDA 5FD6A 5H80A 2W9BA 3HBLA 4YAKB 4MA5A 5FD5A 2W70A 5L1LA 1E4FT 5IYDG 2BR0A 3SI8A 4LF8H 5DG8A 3Q1KA 2Y0SA 4QJFA 4DR3H 1TAEA 5KG4A 4EGJA 2V4QA 1RJPA 5CB4F 2R92A 3WO0A 2UXBH 4JYAH 3JRWA 2ASLA 1I50A 3R5XA 4M7EA 3VPBA 5EDWA 2IBKA 3GIPA 2B63A 5KFSA 3PW0A 2R7KA 2FE3A 2J6SA 5KFZA 1E4EB 2UU9H 4JI8H 5KFRA 2RDIA 2ZDGA 5BPFA 3G6XA 2E2HA 3GTJA 2YZMA 4GKJH 5GONF 3M9NB 2W7OA 5FPOA 2DPJA 2FKLA 1P8LA 1XMQH 4LF9H 3LP8A 3HOXG 4J9RA 3MR5A 1FJGH 4EFEA 5KFYA 3BQ0A 2R8JA 2PMZE 1B04A 2FPIB 5BMVF 3BJYA 4ECYA 4DL4A 4UCUA 1A9XA 3N41B 2SCUB 4GKKH 1GSAA 4JI7H 3T5JA 1Z2PX 2WDTA 4IAJA 4YB8B 1BXRA 3H20A 2XGPA 5KFGA 2P0AA 2R87A 3J7AK 5KG5A 2AGQA 1IBKH 4I50F 2JA8G 1RYSA 3GIJA 2DIKA 1FVIA 4IRDA 2W7PA 1M0WA 4IRKA 2YZGA 2VUMG 2W8LA 1C30A 2W6PA 2W6QA 3IN5A 4O4HF 1W96A 5C4XG 1ZETA 3HOYG 3BABA 4EBDA 2QYZA 3QFFA 4B3MH 5KFAA 1O75A 4MTEA 2YS6A 5KFKA 5IYZF 4A3BG 4JI1H 3SE7A 2YL2A 1B6RA 1KJIA 3LMLA 4TUYF 2UUBH 4NLGA 4M9UA 4UCVA 2VPSA 3RB3A 1CS0A 2R8HA 1KJ9A 2ZDHA 3FMAA 5DGAA 1JIHA 4X65H 2UVWA 2VA2A 4ED0A 3T1YH 1I94H 4BY1G 4LFCH 3H4DA 3JAMW 3N42B 1VS0A 2HVSA 1IBMH 5JQWA 2R93A 3WO1A 1M6VA 2V5AA 4WD3A 1S03G 5DG7A 2JA6G 2GPSA 4HNUA 4GLXA 2FLNA 3ORRA 1GSHA 4I4TF 3Q2OA 2W71A 4L1KA 1ZHSA 5D8DA 5F9NA 4DL6A 1JX4A 1WH2A 3RBDA 1FKAH 2FLLA 4A3CG 4IRCA 1KEEA 4Q43A 4DR5H 3V6KA 4A3MG 5KT5A 4QW8A 2FMAA 2YW2A 4RUAA 5DLGA 4O4IF 4BBSG 1KJQA 2RGVA 1A0IA 3K3VA 3ETJA 3PVXA 3RB4A 2W57A 4NXMH 4FU0A 3KTMA 2ALZA 1TWCA 2B63G 1Z2NX 1DGSA 3K3PA 4YQWA 5LL6b 3CQZA 1SFOA 4F4WA 3R5FA 1I7NA 5KT7A 4IWYA 3L4JA 4MV6A 3KHRA 5KFXA 3F8NA 1S10A 2NU7B 5EWGA 3N8DA 2R7NA 3BQ1A 4GC6A 3JSLA 2VR1A 1S9FA 1GLVA 3BA9A 5L1JA 1T94A 5JVDF 4A3LG 1V51A 5LMUH 2J9GA 2FPPB 4MA0A 4DV5H 3PO3G 4JI2H 4TV8F 1R9TA 2PVPA 2R7LA 1RK6A 3T5LA 4RB3C 3GLKA 1DV2A 3R23A 1BGWA 4LFAH 4HNVA 2BQUA 3FKIA 4MV4A 4CC5A 3M9MB 3RB0A 2R85A 4U6PA 4YHHH 4ECQA 4ED1A 2R84A 2IA6A 4LF4H 2ASDA 1S0NA 1JLLB 1UNNC 2YYAA 4ECZA 2WTFA 2ASJA 1TWHA 5KG3A 2OLSA 4DLKA 1XNQH 2OWOA 3GIDA 4O2BF 4DV6H 4B3SH 4IR1A 1N33H 1RK5A 2R7MA 1KBLA 4LH7A 2CZGA 3BA8A 4R8UA 2VQEH 2GPWA 1TWFA 4F50A 5C8YF 4ZOLF 4O3RA 2OH2A 1K1QA 2WB1A 5D1PA 1VBHA 1SEIA 2C35B 5KT4A 4JI6H 1N56A 4FBTA 4AYBE 4ECTA 4JI5H 5KKNB 4FS1A 3EPIA 4MTDA 2C2EA 2VA3A 2JA7A 3G6VA 4ETSA 5JH7F 4RU9A 3CVZA 2YS7A 4YJ3F 4C5CA 5I47A 2W9AA 2R8KA 3RBEA 5KFEA 3N43B 4ED8A 1SYXB 4EEQA 4EYIB 4A3JG 3MWEA 1EZ1A 3GIKA 3KXYT 1HNZH 2UXDH 4C2MA 4Q8EA 4A3IG 4B3TH 5C1PA 1TWAA 4ZI7F 3TQTA 3H3VH 4BXXG 3HOWG 2JEFA 3PN1A 4Q45A 2JEJA 4QWDA 1JDEA 1TA8A 2FPGB 4TV9F 4JI4H 5C44G 3PW7A 5IWAH 3RGXA 3GTLA
chains in the Genus database with same CATH topology
1CE8A 1KJIA 2HJWA 4TUYF 3VMMA 3K5HA 4YBZB 2IP4A 4HQ6A 4ZQIA 3RFCA 2W6OA 2I80A 4M9UA 2C00A 4C5BA 4HNTA 5KX5F 1CS0A 1KJ9A 3JZIA 2ZDHA 3TIIA 1UC8A 2ZDQA 5J2TF 5LOVF 1EUCB 2YRWA 5JQWA 5HBRB 3LWBA 5EZYF 3WO1A 1M6VA 1WR2A 2V5AA 4MV3A 4WD3A 5LXTF 2GPSA 4HNUA 2FP4B 2V59A 4ME6A 3ORRA 4XX0B 1CQJB 1GSHA 4I4TF 3Q2OA 2W71A 2I87A 4L1KA 1E4EA 2CQYA 5D8DA 3V4SA 4WBNF 2NU9B 2VQDA 1KEEA 4MV8A 3I12A 2FB9A 2YW2A 3HB9A 1AUVA 4HR7A 1B6SA 1IOVA 2XD4A 2R6FA 2W6NA 4O4IF 1KJQA 3OUZA 5K2MA 4EGQA 1SCUB 3BG5A 3ETJA 1BNCA 2QK4A 1C3OA 1T36A 3WNZA 2YRXA 4FU0A 3RV4A 4EG0A 2VPQA 3K3PA 4IHJF 5HV6A 2NUAB 3TIGA 3V4ZA 5LA6F 3U9TA 3VPDA 3ORQA 3R5FA 4I55F 1JDBB 1I7NA 5H80A 3HBLA 4IWYA 4MA5A 4MV6A 3E5NA 2DWCA 4MV1A 4YAKB 2W70A 2GLTA 2R82A 3Q1KA 2NU7B 1GSOA 4EGJA 3N8DA 2R7NA 2DZDA 1PK8A 5CB4F 3WO0A 3K5IA 2VR1A 5LP6F 1GLVA 4O4LF 2W6MA 5JVDF 2YZNA 3JRWA 3R5XA 2J9GA 2W6ZA 3VPBA 2FPPB 4E4TA 4MA0A 5J2UF 3JRXA 1EHIA 3R5HA 4TV8F 2PVPA 2R7KA 2R7LA 1KJJA 3MJFA 1E4EB 4YJ2F 3GLKA 1ULZA 1DV2A 3R23A 4IZOA 3VPCA 4HNVA 1EYZA 4MV4A 2ZDGA 5BPFA 1I7LA 2R85A 2I8CA 2YZMA 1GGOA 2R84A 2NU8B 3TINA 5GONF 1JLLB 4XYMB 1DV1A 2PBZA 2YYAA 2OLSA 4Y8VB 1JKJB 4DLKA 3LP8A 3GIDA 4O2BF 2PN1A 2R7MA 1KBLA 1UC9A 4XZ3B 2CZGA 4XYLB 5C1OA 2GPWA 2XCLA 5BMVF 2FPIB 4ZOLF 4C5AA 5C8YF 1KC7A 3G8CA 1A9XA 2SCUB 2DLNA 1GSAA 5BPHA 1VBHA 3MWDA 5CAEB 1EUDB 4IWXA 4YB8B 1BXRA 5KKNB 3U9SA 5JVLA 4MAMA 1VBGA 2P0AA 2R87A 3OUUA 3UFXB 5JH7F 4I50F 1DIKA 2YS7A 4YJ3F 3RUPA 4C5CA 5I47A 2DIKA 1CQIB 1IOWA 4O2AF 1W93A 1VKZA 2YZGA 3MWEA 1EZ1A 1C30A 2W6PA 2V58A 2W6QA 4YAJB 3RV3A 5LYJF 4ZHQF 4O4HF 1W96A 5CA1F 2NU6B 2R86A 5C1PA 4ZI7F 3QFFA 3TQTA 3ETHA 1AUXA 1PX2A 1JDEA 2YS6A 1KJ8A 2FPGB 2X0SA 4TV9F 5IYZF 5CA0F 3SE7A 2YL2A 1B6RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CE8 A;  1KJI A;  2HJW A;  4TUY F;  3VMM A;  3K5H A;  4YBZ B;  2IP4 A;  4HQ6 A;  4ZQI A;  3RFC A;  2W6O A;  2I80 A;  4M9U A;  2C00 A;  4C5B A;  4HNT A;  5KX5 F;  1CS0 A;  1KJ9 A;  3JZI A;  2ZDH A;  3TII A;  1UC8 A;  2ZDQ A;  5J2T F;  5LOV F;  1EUC B;  2YRW A;  5JQW A;  5HBR B;  3LWB A;  5EZY F;  3WO1 A;  1M6V A;  1WR2 A;  2V5A A;  4MV3 A;  4WD3 A;  5LXT F;  2GPS A;  4HNU A;  2FP4 B;  2V59 A;  4ME6 A;  3ORR A;  4XX0 B;  1CQJ B;  1GSH A;  4I4T F;  3Q2O A;  2W71 A;  2I87 A;  4L1K A;  1E4E A;  2CQY A;  5D8D A;  3V4S A;  4WBN F;  2NU9 B;  2VQD A;  1KEE A;  4MV8 A;  3I12 A;  2FB9 A;  2YW2 A;  3HB9 A;  1AUV A;  4HR7 A;  1B6S A;  1IOV A;  2XD4 A;  2R6F A;  2W6N A;  4O4I F;  1KJQ A;  3OUZ A;  5K2M A;  4EGQ A;  1SCU B;  3BG5 A;  3ETJ A;  1BNC A;  2QK4 A;  1C3O A;  1T36 A;  3WNZ A;  2YRX A;  4FU0 A;  3RV4 A;  4EG0 A;  2VPQ A;  3K3P A;  4IHJ F;  5HV6 A;  2NUA B;  3TIG A;  3V4Z A;  5LA6 F;  3U9T A;  3VPD A;  3ORQ A;  3R5F A;  4I55 F;  1JDB B;  1I7N A;  5H80 A;  3HBL A;  4IWY A;  4MA5 A;  4MV6 A;  3E5N A;  2DWC A;  4MV1 A;  4YAK B;  2W70 A;  2GLT A;  2R82 A;  3Q1K A;  2NU7 B;  1GSO A;  4EGJ A;  3N8D A;  2R7N A;  2DZD A;  1PK8 A;  5CB4 F;  3WO0 A;  3K5I A;  2VR1 A;  5LP6 F;  1GLV A;  4O4L F;  2W6M A;  5JVD F;  2YZN A;  3JRW A;  3R5X A;  2J9G A;  2W6Z A;  3VPB A;  2FPP B;  4E4T A;  4MA0 A;  5J2U F;  3JRX A;  1EHI A;  3R5H A;  4TV8 F;  2PVP A;  2R7K A;  2R7L A;  1KJJ A;  3MJF A;  1E4E B;  4YJ2 F;  3GLK A;  1ULZ A;  1DV2 A;  3R23 A;  4IZO A;  3VPC A;  4HNV A;  1EYZ A;  4MV4 A;  2ZDG A;  5BPF A;  1I7L A;  2R85 A;  2I8C A;  2YZM A;  1GGO A;  2R84 A;  2NU8 B;  3TIN A;  5GON F;  1JLL B;  4XYM B;  1DV1 A;  2PBZ A;  2YYA A;  2OLS A;  4Y8V B;  1JKJ B;  4DLK A;  3LP8 A;  3GID A;  4O2B F;  2PN1 A;  2R7M A;  1KBL A;  1UC9 A;  4XZ3 B;  2CZG A;  4XYL B;  5C1O A;  2GPW A;  2XCL A;  5BMV F;  2FPI B;  4ZOL F;  4C5A A;  5C8Y F;  1KC7 A;  3G8C A;  1A9X A;  2SCU B;  2DLN A;  1GSA A;  5BPH A;  1VBH A;  3MWD A;  5CAE B;  1EUD B;  4IWX A;  4YB8 B;  1BXR A;  5KKN B;  3U9S A;  5JVL A;  4MAM A;  1VBG A;  2P0A A;  2R87 A;  3OUU A;  3UFX B;  5JH7 F;  4I50 F;  1DIK A;  2YS7 A;  4YJ3 F;  3RUP A;  4C5C A;  5I47 A;  2DIK A;  1CQI B;  1IOW A;  4O2A F;  1W93 A;  1VKZ A;  2YZG A;  3MWE A;  1EZ1 A;  1C30 A;  2W6P A;  2V58 A;  2W6Q A;  4YAJ B;  3RV3 A;  5LYJ F;  4ZHQ F;  4O4H F;  1W96 A;  5CA1 F;  2NU6 B;  2R86 A;  5C1P A;  4ZI7 F;  3QFF A;  3TQT A;  3ETH A;  1AUX A;  1PX2 A;  1JDE A;  2YS6 A;  1KJ8 A;  2FPG B;  2X0S A;  4TV9 F;  5IYZ F;  5CA0 F;  3SE7 A;  2YL2 A;  1B6R A; 
#chains in the Genus database with same CATH topology
 1CE8 A;  4EYH B;  1Z2O X;  2W9B B;  3H0G A;  3K5H A;  1WCM A;  1AN7 A;  2M05 A;  2ZJT A;  4YBZ B;  3RFC A;  1Y1V A;  5C5J A;  2UVU A;  2C00 A;  4C5B A;  4HNT A;  5KX5 F;  5KFP A;  3MFI A;  3T1H H;  2JEG A;  3RAQ A;  1J5E H;  4RNO A;  5EWF A;  3GIM A;  1UC8 A;  4TQS A;  4A93 G;  3M4I A;  4LFB H;  5J2T F;  1GO3 E;  2Q2U A;  2YRW A;  1S0M A;  4OX9 H;  3LWB A;  1WR2 A;  4MV3 A;  3PO2 G;  5LXT F;  2UXC H;  3MWM A;  4MV7 A;  1Y1W A;  3DF7 A;  4ECS A;  2V59 A;  4ME6 A;  1X9N A;  2FK3 A;  2AGP A;  3GTK A;  2HGS A;  2UVR A;  4J9Q A;  5FLM G;  1ZQ7 A;  4HR7 A;  3GII A;  1AUV A;  4RB0 A;  2XCP A;  1IOV A;  2W6N A;  3KAJ A;  4BY7 G;  4DUZ H;  4F4Y A;  3PW2 A;  1SCU B;  3TQ1 A;  3Q8S B;  3PW5 A;  1MZB A;  5EOY A;  2QK4 A;  1S0O A;  5KG2 A;  3OTO H;  4EG0 A;  4DV2 H;  4LH6 A;  2R8I A;  4DL5 A;  5F9L A;  4IHJ F;  2HHH H;  4QWC A;  3V4Z A;  3J80 W;  5LA6 F;  1RJR A;  3V6H A;  4LSA A;  4LF6 H;  3HKZ E;  1XDN A;  2DWC A;  5JUM A;  4DR4 H;  4J9O A;  3QZ7 A;  2R82 A;  1GSO A;  2C2D A;  3RF2 A;  1PK8 A;  4LMY A;  2Y0S E;  3HOV G;  2C22 A;  3OSP A;  1I6U A;  2W6M A;  3GTG A;  4U7C A;  2VQF H;  2YZN A;  4DV0 H;  2WB1 E;  2UVV A;  4E4T A;  4QIW A;  5J2U F;  3RB6 A;  4BBR G;  2R92 G;  4DV4 H;  3R5H A;  3AYH B;  5KFM A;  3GIQ A;  1KJJ A;  3MJF A;  3GIL A;  2BQ3 A;  4ECW A;  2CKZ B;  3VPC A;  4ECX A;  1N32 H;  4Q44 A;  1I7L A;  5KFC A;  2JA7 G;  3GQC A;  4YR2 A;  2NU8 B;  4RAY A;  3TIN A;  5KFU A;  4X64 H;  1GYF A;  4XYM B;  4RZR A;  1DV1 A;  1XMO H;  1JKJ B;  1M7J A;  2PN1 A;  4X66 H;  4ED3 A;  4XZ3 B;  1IBL H;  4RAZ A;  4XYL B;  3RJ0 A;  1S68 A;  1VAJ A;  2XCL A;  3OHA A;  4C5A A;  3MFH A;  2V4R A;  5L1K A;  1KC7 A;  3G8C A;  3IG0 A;  5C3E G;  3V6J A;  2DLN A;  1V4Y A;  5BPH A;  4DL3 A;  2E5L H;  3MWD A;  4GC7 A;  5CAE B;  2Q2T A;  1EUD B;  2NVY A;  3KAL A;  4EBE A;  3EYY A;  3U9S A;  1HNX H;  5JVL A;  3KAK A;  4MAM A;  1VBG A;  3M9O B;  3UFX B;  1N48 A;  4O3S A;  1BJT A;  5DGB A;  2VUM A;  1DIK A;  3H0G G;  4PWQ A;  2UUC H;  3GTO A;  1Y1V G;  2C28 A;  1L2Z A;  2J6T A;  5DQI A;  2AU0 A;  4RZQ A;  4G3I A;  1HNW H;  2DPI A;  4A2A A;  2C2R A;  4J9N A;  1IOW A;  4LF7 H;  5IP7 G;  1W93 A;  5KT2 A;  5LYJ F;  3RV3 A;  4ZHQ F;  5KFT A;  2NU6 B;  3UQ8 A;  5KG1 A;  4RNM A;  4DR6 H;  2CW8 A;  4TQR A;  1N34 H;  4APM A;  1PX2 A;  2XGQ A;  1KJ8 A;  2X0S A;  4DV7 H;  5CA0 F;  2AQ4 A;  3RIZ A;  4J0M A;  5KFB A;  1T3N A;  5KFD A;  2F4V H;  2IP4 A;  4HQ6 A;  4ZQI A;  4IR9 A;  2I80 A;  1Y14 B;  4J9K A;  2KSW A;  3JZI A;  2YCH A;  3TII A;  5KG6 A;  2ZDQ A;  5IYC G;  4YP3 A;  1EUC B;  5FLX W;  4AQY H;  4B3R H;  4QWA A;  5HBR B;  4RUC A;  4DR7 H;  2FK1 A;  1XNR H;  2FK2 A;  2XCA A;  5DG9 A;  4A3D G;  5DLF A;  4RB1 A;  2BQR A;  5FJ8 G;  5L9X A;  4XX0 B;  1HR0 H;  4ED7 A;  1OWT A;  2R93 G;  2I87 A;  4WBN F;  2WE6 A;  3GV7 B;  2J6U A;  4QW9 A;  2NU9 B;  2VQD A;  3BQ2 A;  2AGO A;  4MV8 A;  5KG7 A;  3KHH A;  3I12 A;  2FB9 A;  3HB9 A;  4O3Q A;  4JV5 H;  4YR0 A;  1B6S A;  2XD4 A;  2R6F A;  5A2Q W;  4JV1 A;  4EGQ A;  5IYB G;  3BG5 A;  4Q0Y A;  3I4M G;  4QIW E;  2XIG A;  2WYO A;  3WNZ A;  5KT6 A;  2YRX A;  2VOB A;  2HVQ A;  4JI3 H;  4R8U B;  3PR5 B;  3Q8P B;  2RF4 A;  3T5H A;  2JEI A;  4A3G G;  1RJQ A;  1TWG A;  4EEY A;  4I7H A;  1JXL A;  3U9T A;  4FS2 A;  4EBC A;  3ORQ A;  4I55 F;  1JDB B;  4O3N A;  4FM9 A;  1K83 A;  5D1O A;  3E5N A;  4MV1 A;  3KHG A;  3PW4 A;  4ECV A;  2GLT A;  3L2P A;  2JA5 A;  3FDS A;  5KG0 A;  2W9C A;  2DZD A;  5T14 A;  3K5I A;  3QZ8 A;  2UUA H;  5LP6 F;  5EWE A;  4KHP H;  4O4L F;  2RGR A;  1M0T A;  4Q8F A;  2W6Z A;  2R7Z A;  3JRX A;  1EHI A;  2WAQ A;  4PDB A;  2HVR A;  4UFZ A;  4YJ2 F;  1ULZ A;  4IZO A;  5DQG A;  5KFH A;  1EYZ A;  3N6X A;  3RGZ A;  4A3E G;  2I8C A;  5IT9 W;  1GGO A;  3JSN A;  4X62 H;  5IP9 G;  3HXL A;  2PBZ A;  3FKI G;  4Y8V B;  3Q8Q B;  4A2B A;  1UC9 A;  5C1O A;  4O3O A;  5KFJ A;  4J9P A;  4J9M A;  1K1S A;  4DR1 H;  1V9P A;  2ATL A;  2FLP A;  3KHL A;  4AYB A;  5L1I A;  5KFI A;  5KFW A;  5KFN A;  5D1O B;  2E2I A;  3I4N G;  4IWX A;  1RYR A;  1N36 H;  4K0K H;  3OUU A;  4JV0 A;  4ECU A;  4YR3 A;  3PR4 A;  2W9C B;  4RNN A;  3RUP A;  5KFO A;  4ED6 A;  1CQI B;  3EPG A;  5KFF A;  3GV8 B;  5KT3 A;  4O2A F;  1I3Q A;  2ZM6 H;  1VKZ A;  2V58 A;  4YAJ B;  3MR6 A;  3MR2 A;  4R7R A;  3C0F B;  5CA1 F;  4JUZ A;  3HOZ G;  2R8G A;  2R86 A;  3J81 W;  3MR3 A;  4UCO A;  2PMZ A;  3ETH A;  3GTQ A;  4J9L A;  2FJZ A;  1AUX A;  4DL2 A;  2CW7 A;  3Q8R B;  5KFV A;  2W8K A;  4F4X A;  2NVX A;  5KFL A;  3HOU G;  4UCR A;  3N40 P;  2O03 A;  3PZP A;  4A3F G;  3H40 A;  3VMM A;  2HJW A;  2MCT A;  4DUY H;  3RAX A;  4BWS C;  4JV2 A;  4F4Z A;  4YY3 H;  2W6O A;  2RDJ A;  4DL7 A;  2JA5 G;  4HYK A;  2V9W A;  4A3K G;  2XC9 A;  3GTM A;  3OHB A;  2YU9 A;  2VUG A;  1WCM G;  3BAA A;  5LMN H;  4LSX A;  5LOV F;  3GV5 B;  1WSC A;  3L4K A;  4ED2 A;  5EZY F;  1B33 N;  4O3P A;  3G6Y A;  1ZHQ A;  3RTX A;  3OSN A;  4EFB A;  2FP4 B;  1CQJ B;  3V4S A;  1E4E A;  2CQY A;  1S97 A;  4ECR A;  3T5K A;  4DV3 H;  4LF5 H;  1Y1W G;  4CC6 A;  4J9S A;  2IMW P;  3GTP A;  3N44 B;  4UCS A;  3H4B A;  4FBU A;  4MV9 A;  1E4G T;  5K2M A;  3OUZ A;  4DR2 H;  4QWB A;  5FPR A;  1BNC A;  5BR8 H;  1C3O A;  1T36 A;  2WAQ E;  4DV1 H;  3NGD A;  4NXN H;  3RV4 A;  5DQH A;  2R7Z G;  4QWE A;  4RB2 C;  2VPQ A;  2JA6 A;  5HV6 A;  4UCT A;  4JI0 H;  5KFQ A;  2NUA B;  3TIG A;  3HKZ A;  3VPD A;  5FD6 A;  5H80 A;  2W9B A;  3HBL A;  4YAK B;  4MA5 A;  5FD5 A;  2W70 A;  5L1L A;  1E4F T;  5IYD G;  2BR0 A;  3SI8 A;  4LF8 H;  5DG8 A;  3Q1K A;  2Y0S A;  4QJF A;  4DR3 H;  1TAE A;  5KG4 A;  4EGJ A;  2V4Q A;  1RJP A;  5CB4 F;  2R92 A;  3WO0 A;  2UXB H;  4JYA H;  3JRW A;  2ASL A;  1I50 A;  3R5X A;  4M7E A;  3VPB A;  5EDW A;  2IBK A;  3GIP A;  2B63 A;  5KFS A;  3PW0 A;  2R7K A;  2FE3 A;  2J6S A;  5KFZ A;  1E4E B;  2UU9 H;  4JI8 H;  5KFR A;  2RDI A;  2ZDG A;  5BPF A;  3G6X A;  2E2H A;  3GTJ A;  2YZM A;  4GKJ H;  5GON F;  3M9N B;  2W7O A;  5FPO A;  2DPJ A;  2FKL A;  1P8L A;  1XMQ H;  4LF9 H;  3LP8 A;  3HOX G;  4J9R A;  3MR5 A;  1FJG H;  4EFE A;  5KFY A;  3BQ0 A;  2R8J A;  2PMZ E;  1B04 A;  2FPI B;  5BMV F;  3BJY A;  4ECY A;  4DL4 A;  4UCU A;  1A9X A;  3N41 B;  2SCU B;  4GKK H;  1GSA A;  4JI7 H;  3T5J A;  1Z2P X;  2WDT A;  4IAJ A;  4YB8 B;  1BXR A;  3H20 A;  2XGP A;  5KFG A;  2P0A A;  2R87 A;  3J7A K;  5KG5 A;  2AGQ A;  1IBK H;  4I50 F;  2JA8 G;  1RYS A;  3GIJ A;  2DIK A;  1FVI A;  4IRD A;  2W7P A;  1M0W A;  4IRK A;  2YZG A;  2VUM G;  2W8L A;  1C30 A;  2W6P A;  2W6Q A;  3IN5 A;  4O4H F;  1W96 A;  5C4X G;  1ZET A;  3HOY G;  3BAB A;  4EBD A;  2QYZ A;  3QFF A;  4B3M H;  5KFA A;  1O75 A;  4MTE A;  2YS6 A;  5KFK A;  5IYZ F;  4A3B G;  4JI1 H;  3SE7 A;  2YL2 A;  1B6R A;  1KJI A;  3LML A;  4TUY F;  2UUB H;  4NLG A;  4M9U A;  4UCV A;  2VPS A;  3RB3 A;  1CS0 A;  2R8H A;  1KJ9 A;  2ZDH A;  3FMA A;  5DGA A;  1JIH A;  4X65 H;  2UVW A;  2VA2 A;  4ED0 A;  3T1Y H;  1I94 H;  4BY1 G;  4LFC H;  3H4D A;  3JAM W;  3N42 B;  1VS0 A;  2HVS A;  1IBM H;  5JQW A;  2R93 A;  3WO1 A;  1M6V A;  2V5A A;  4WD3 A;  1S03 G;  5DG7 A;  2JA6 G;  2GPS A;  4HNU A;  4GLX A;  2FLN A;  3ORR A;  1GSH A;  4I4T F;  3Q2O A;  2W71 A;  4L1K A;  1ZHS A;  5D8D A;  5F9N A;  4DL6 A;  1JX4 A;  1WH2 A;  3RBD A;  1FKA H;  2FLL A;  4A3C G;  4IRC A;  1KEE A;  4Q43 A;  4DR5 H;  3V6K A;  4A3M G;  5KT5 A;  4QW8 A;  2FMA A;  2YW2 A;  4RUA A;  5DLG A;  4O4I F;  4BBS G;  1KJQ A;  2RGV A;  1A0I A;  3K3V A;  3ETJ A;  3PVX A;  3RB4 A;  2W57 A;  4NXM H;  4FU0 A;  3KTM A;  2ALZ A;  1TWC A;  2B63 G;  1Z2N X;  1DGS A;  3K3P A;  4YQW A;  5LL6 b;  3CQZ A;  1SFO A;  4F4W A;  3R5F A;  1I7N A;  5KT7 A;  4IWY A;  3L4J A;  4MV6 A;  3KHR A;  5KFX A;  3F8N A;  1S10 A;  2NU7 B;  5EWG A;  3N8D A;  2R7N A;  3BQ1 A;  4GC6 A;  3JSL A;  2VR1 A;  1S9F A;  1GLV A;  3BA9 A;  5L1J A;  1T94 A;  5JVD F;  4A3L G;  1V51 A;  5LMU H;  2J9G A;  2FPP B;  4MA0 A;  4DV5 H;  3PO3 G;  4JI2 H;  4TV8 F;  1R9T A;  2PVP A;  2R7L A;  1RK6 A;  3T5L A;  4RB3 C;  3GLK A;  1DV2 A;  3R23 A;  1BGW A;  4LFA H;  4HNV A;  2BQU A;  3FKI A;  4MV4 A;  4CC5 A;  3M9M B;  3RB0 A;  2R85 A;  4U6P A;  4YHH H;  4ECQ A;  4ED1 A;  2R84 A;  2IA6 A;  4LF4 H;  2ASD A;  1S0N A;  1JLL B;  1UNN C;  2YYA A;  4ECZ A;  2WTF A;  2ASJ A;  1TWH A;  5KG3 A;  2OLS A;  4DLK A;  1XNQ H;  2OWO A;  3GID A;  4O2B F;  4DV6 H;  4B3S H;  4IR1 A;  1N33 H;  1RK5 A;  2R7M A;  1KBL A;  4LH7 A;  2CZG A;  3BA8 A;  4R8U A;  2VQE H;  2GPW A;  1TWF A;  4F50 A;  5C8Y F;  4ZOL F;  4O3R A;  2OH2 A;  1K1Q A;  2WB1 A;  5D1P A;  1VBH A;  1SEI A;  2C35 B;  5KT4 A;  4JI6 H;  1N56 A;  4FBT A;  4AYB E;  4ECT A;  4JI5 H;  5KKN B;  4FS1 A;  3EPI A;  4MTD A;  2C2E A;  2VA3 A;  2JA7 A;  3G6V A;  4ETS A;  5JH7 F;  4RU9 A;  3CVZ A;  2YS7 A;  4YJ3 F;  4C5C A;  5I47 A;  2W9A A;  2R8K A;  3RBE A;  5KFE A;  3N43 B;  4ED8 A;  1SYX B;  4EEQ A;  4EYI B;  4A3J G;  3MWE A;  1EZ1 A;  3GIK A;  3KXY T;  1HNZ H;  2UXD H;  4C2M A;  4Q8E A;  4A3I G;  4B3T H;  5C1P A;  1TWA A;  4ZI7 F;  3TQT A;  3H3V H;  4BXX G;  3HOW G;  2JEF A;  3PN1 A;  4Q45 A;  2JEJ A;  4QWD A;  1JDE A;  1TA8 A;  2FPG B;  4TV9 F;  4JI4 H;  5C44 G;  3PW7 A;  5IWA H;  3RGX A;  3GTL A; 
#chains in the Genus database with same CATH homology
 1CE8 A;  1KJI A;  2HJW A;  4TUY F;  3VMM A;  3K5H A;  4YBZ B;  2IP4 A;  4HQ6 A;  4ZQI A;  3RFC A;  2W6O A;  2I80 A;  4M9U A;  2C00 A;  4C5B A;  4HNT A;  5KX5 F;  1CS0 A;  1KJ9 A;  3JZI A;  2ZDH A;  3TII A;  1UC8 A;  2ZDQ A;  5J2T F;  5LOV F;  1EUC B;  2YRW A;  5JQW A;  5HBR B;  3LWB A;  5EZY F;  3WO1 A;  1M6V A;  1WR2 A;  2V5A A;  4MV3 A;  4WD3 A;  5LXT F;  2GPS A;  4HNU A;  2FP4 B;  2V59 A;  4ME6 A;  3ORR A;  4XX0 B;  1CQJ B;  1GSH A;  4I4T F;  3Q2O A;  2W71 A;  2I87 A;  4L1K A;  1E4E A;  2CQY A;  5D8D A;  3V4S A;  4WBN F;  2NU9 B;  2VQD A;  1KEE A;  4MV8 A;  3I12 A;  2FB9 A;  2YW2 A;  3HB9 A;  1AUV A;  4HR7 A;  1B6S A;  1IOV A;  2XD4 A;  2R6F A;  2W6N A;  4O4I F;  1KJQ A;  3OUZ A;  5K2M A;  4EGQ A;  1SCU B;  3BG5 A;  3ETJ A;  1BNC A;  2QK4 A;  1C3O A;  1T36 A;  3WNZ A;  2YRX A;  4FU0 A;  3RV4 A;  4EG0 A;  2VPQ A;  3K3P A;  4IHJ F;  5HV6 A;  2NUA B;  3TIG A;  3V4Z A;  5LA6 F;  3U9T A;  3VPD A;  3ORQ A;  3R5F A;  4I55 F;  1JDB B;  1I7N A;  5H80 A;  3HBL A;  4IWY A;  4MA5 A;  4MV6 A;  3E5N A;  2DWC A;  4MV1 A;  4YAK B;  2W70 A;  2GLT A;  2R82 A;  3Q1K A;  2NU7 B;  1GSO A;  4EGJ A;  3N8D A;  2R7N A;  2DZD A;  1PK8 A;  5CB4 F;  3WO0 A;  3K5I A;  2VR1 A;  5LP6 F;  1GLV A;  4O4L F;  2W6M A;  5JVD F;  2YZN A;  3JRW A;  3R5X A;  2J9G A;  2W6Z A;  3VPB A;  2FPP B;  4E4T A;  4MA0 A;  5J2U F;  3JRX A;  1EHI A;  3R5H A;  4TV8 F;  2PVP A;  2R7K A;  2R7L A;  1KJJ A;  3MJF A;  1E4E B;  4YJ2 F;  3GLK A;  1ULZ A;  1DV2 A;  3R23 A;  4IZO A;  3VPC A;  4HNV A;  1EYZ A;  4MV4 A;  2ZDG A;  5BPF A;  1I7L A;  2R85 A;  2I8C A;  2YZM A;  1GGO A;  2R84 A;  2NU8 B;  3TIN A;  5GON F;  1JLL B;  4XYM B;  1DV1 A;  2PBZ A;  2YYA A;  2OLS A;  4Y8V B;  1JKJ B;  4DLK A;  3LP8 A;  3GID A;  4O2B F;  2PN1 A;  2R7M A;  1KBL A;  1UC9 A;  4XZ3 B;  2CZG A;  4XYL B;  5C1O A;  2GPW A;  2XCL A;  5BMV F;  2FPI B;  4ZOL F;  4C5A A;  5C8Y F;  1KC7 A;  3G8C A;  1A9X A;  2SCU B;  2DLN A;  1GSA A;  5BPH A;  1VBH A;  3MWD A;  5CAE B;  1EUD B;  4IWX A;  4YB8 B;  1BXR A;  5KKN B;  3U9S A;  5JVL A;  4MAM A;  1VBG A;  2P0A A;  2R87 A;  3OUU A;  3UFX B;  5JH7 F;  4I50 F;  1DIK A;  2YS7 A;  4YJ3 F;  3RUP A;  4C5C A;  5I47 A;  2DIK A;  1CQI B;  1IOW A;  4O2A F;  1W93 A;  1VKZ A;  2YZG A;  3MWE A;  1EZ1 A;  1C30 A;  2W6P A;  2V58 A;  2W6Q A;  4YAJ B;  3RV3 A;  5LYJ F;  4ZHQ F;  4O4H F;  1W96 A;  5CA1 F;  2NU6 B;  2R86 A;  5C1P A;  4ZI7 F;  3QFF A;  3TQT A;  3ETH A;  1AUX A;  1PX2 A;  1JDE A;  2YS6 A;  1KJ8 A;  2FPG B;  2X0S A;  4TV9 F;  5IYZ F;  5CA0 F;  3SE7 A;  2YL2 A;  1B6R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...