2CQYA

Solution structure of b domain from human propionyl-coa carboxylase alpha subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
GSSGSSGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHISGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of B domain from human propionyl-CoA carboxylase alpha subunit
rcsb
source organism Homo sapiens
molecule tags Ligase
molecule keywords Propionyl-CoA carboxylase alpha chain, mitochondrial
total genus 14
structure length 108
sequence length 108
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2cqyA01
2CQYA 2YS7A 2GLTA 2V59A 3R5XA 4IHJF 5H80A 3VPDA 4HR7A 1A9XA 3Q1KA 2W70A 1W96A 3K5IA 3RFCA 4TUYF 5D8DA 1GSAA 2R7LA 4YJ3F 1KJ9A 2W71A 2XCLA 2IP4A 3JZIA 2W6ZA 4XZ3B 2YZNA 3Q2OA 2FP4B 4IWYA 2DWCA 3BG5A 3GLKA 1JDEA 4EGQA 2DZDA 3OUUA 4ME6A 2CZGA 5C1PA 5CA0F 1I7NA 1PX2A 1SCUB 1VBGA 5LXTF 1CQJB 4MAMA 1E4EB 4EG0A 2DLNA 2R7KA 3MWEA 4YB8B 2R82A 3MWDA 4M9UA 3VPBA 5LYJF 1I7LA 2PVPA 2P0AA 2FB9A 2R86A 3R5FA 4O4LF 5J2TF 1E4EA 1VKZA 1PK8A 2HJWA 3ETHA 3V4ZA 3TIGA 4MV8A 3GIDA 4YAJB 2SCUB 1IOVA 2QK4A 3HB9A 3VMMA 2W6MA 4YJ2F 1CE8A 2YYAA 3RUPA 4DLKA 5LP6F 4MV1A 2R7NA 4HNTA 2X0SA 4MV4A 3K3PA 1AUXA 2ZDGA 3WO1A 1M6VA 3U9SA 5GONF 4Y8VB 3HBLA 4MA5A 4O4HF 4C5BA 2XD4A 2R87A 2GPWA 5I47A 1JDBB 1KJJA 4L1KA 2FPIB 2YL2A 4XX0B 3RV3A 2FPGB 3VPCA 5LOVF 1DV1A 1GSOA 3N8DA 2PN1A 3TQTA 3TINA 2NUAB 3V4SA 5JVLA 1UC8A 3E5NA 3MJFA 4IWXA 4XYMB 5JVDF 5KX5F 2R84A 1BNCA 1B6RA 2YZGA 4WBNF 1B6SA 5J2UF 1EUCB 2VQDA 2GPSA 3LWBA 4MV3A 3TIIA 2I8CA 3WNZA 4HQ6A 1C3OA 5CAEB 4YAKB 2NU9B 4EGJA 4I50F 5BPFA 1EUDB 2ZDHA 5KKNB 4ZOLF 4ZQIA 2W6QA 4C5CA 5BMVF 2OLSA 1KC7A 5LA6F 3LP8A 1EHIA 2PBZA 1BXRA 3UFXB 5BPHA 2R6FA 2VPQA 5JQWA 2FPPB 1KJ8A 5JH7F 3I12A 1C30A 5EZYF 2V5AA 2V58A 3SE7A 2W6NA 2R85A 1JKJB 1DIKA 4I55F 1KJQA 1AUVA 4XYLB 2W6OA 1WR2A 3ETJA 4WD3A 2NU8B 2C00A 2I87A 1KBLA 1KJIA 4TV9F 4FU0A 3K5HA 4MV6A 2DIKA 2VR1A 2ZDQA 5K2MA 2J9GA 3OUZA 1T36A 4YBZB 2YRXA 4ZI7F 3G8CA 5CA1F 3WO0A 4O4IF 1CQIB 1EYZA 1GGOA 1IOWA 1GSHA 2R7MA 1EZ1A 3RV4A 2YS6A 1VBHA 3ORQA 1W93A 4C5AA 1UC9A 4O2AF 4ZHQF 4HNUA 5C1OA 1JLLB 4MA0A 2NU6B 3JRWA 3R23A 4HNVA 2W6PA 1DV2A 3QFFA 1ULZA 1KEEA 3R5HA 4O2BF 5IYZF 2YRWA 5CB4F 5HV6A 2YZMA 4IZOA 3ORRA 5C8YF 5HBRB 3U9TA 4TV8F 1CS0A 4I4TF 2YW2A 2NU7B 2I80A 3JRXA 1GLVA 4E4TA
chains in the Genus database with same CATH superfamily
2CQYA 1Z2OX 2YS7A 2UXCH 5H80A 1BGWA 1T94A 5IYDG 2W70A 3HKZA 1W96A 1OWTA 4J9NA 2UVVA 5KFWA 2R93A 2ZM6H 3MR2A 4RUAA 2YZNA 2HGSA 4IWYA 5KFKA 5DGAA 5DQIA 4RB0A 1Y1VA 4A3GG 2JA5A 1I7NA 1SCUB 1VBGA 5LXTF 2VUGA 2FK1A 2R7ZG 4A3CG 1E4EB 2FLPA 4YB8B 4ED1A 3GQCA 4M9UA 1DGSA 5L1KA 1I7LA 4LH7A 2R8JA 5KFIA 2R86A 4ED0A 3GIPA 4DL4A 4O4LF 5KFUA 4DV5H 3GTJA 3KTMA 4YR3A 2FK3A 4EEQA 2W9BB 3TIGA 3G6YA 5DQHA 4MV8A 3GIDA 3J7AK 1P8LA 5LP6F 1N48A 2JA7G 2R7NA 3QZ8A 4Q43A 3OHAA 2X0SA 5KT4A 5KFYA 3WO1A 4ECWA 5L1LA 5D1PA 4IR9A 1FJGH 5GONF 5IT9W 4MA5A 5FJ8G 4O4HF 4ECRA 2YCHA 4APMA 5BR8H 3RB3A 3N43B 5I47A 1JDBB 1KJJA 4Q44A 4X64H 3RV3A 3T5LA 2W8LA 2PN1A 4UFZA 3PW7A 2NUAB 2WAQA 5JVLA 1B04A 2Q2UA 3GTLA 1BNCA 4WBNF 1I94H 2UVRA 1B6SA 2VQDA 3UQ8A 1V9PA 3T5JA 1SYXB 4EFEA 2DPJA 1TWHA 4YAKB 2AGPA 4JI3H 4RNOA 4RAZA 1TAEA 3H4DA 1Z2NX 3KAKA 2C2DA 3RB6A 3GV7B 4C2MA 3L2PA 4C5CA 4ZQIA 2W6QA 2CW7A 2XGQA 5BMVF 3BQ2A 4FBUA 4LF6H 4A3DG 4ECQA 3SI8A 5D1OA 1EHIA 5C44G 4JV5H 2R92G 2JA7A 3JSNA 4TQSA 5JH7F 3J81W 4J9PA 1S97A 1XDNA 1TWGA 4LH6A 3BABA 2V5AA 2V58A 3Q8SB 3PO2G 4DR4H 4GKJH 4QWDA 1N32H 1DIKA 5KT5A 1I3QA 2M05A 4O3PA 5KG4A 5C3EG 2IMWP 3N6XA 3GV8B 1KBLA 2Y0SA 2JEGA 4TV9F 2UVUA 4MV6A 3G6XA 2RDJA 4DUYH 3J80W 2E5LH 3Q8RB 5KG1A 2R7ZA 3IN5A 4ECZA 5K2MA 3BA8A 2J9GA 3N44B 4YBZB 5T14A 1IBMH 3G8CA 3GIKA 4ECYA 4NLGA 3JSLA 4R8UA 2VQEH 1EZ1A 5KT7A 4DV6H 2DPIA 1K1QA 4JV1A 3FKIA 3H4BA 4LF4H 4MTEA 4BWSC 1XNRH 4RB1A 4Q45A 2FJZA 4QIWA 2OH2A 2W6PA 2JA8G 1ULZA 5KT3A 5KFMA 2J6UA 3KHHA 4IZOA 3DF7A 5KT2A 1IBLH 4TV8F 4DR3H 3FKIG 4I4TF 4UCTA 2NU7B 4AQYH 2IBKA 4M7EA 3LMLA 1R9TA 2JEFA 3H0GG 2V59A 3R5XA 4HR7A 1A9XA 2Q2TA 1HR0H 3RFCA 4TUYF 5D8DA 2VUMA 5DGBA 3FDSA 2W71A 2WB1A 2XCLA 4X62H 2W6ZA 5EWGA 3Q8QB 4ED3A 2HVQA 4XZ3B 3EPGA 3Q2OA 2DWCA 4JI0H 4JI6H 2DZDA 5IP7G 4ME6A 2CZGA 3GTQA 3JAMW 5FD6A 1VS0A 2VPSA 3HOUG 1Y1WA 4MAMA 4EG0A 2DLNA 3MWEA 4JYAH 5LYJF 4DV2H 4DL2A 3PW0A 2JEIA 2OWOA 4NXNH 2FB9A 1O75A 4O3NA 3PW4A 4LSXA 3PW2A 5FPOA 2VUMG 2BQRA 2UUBH 4LF9H 2UXDH 4JI8H 5KFTA 4RUCA 4Q8FA 2W8KA 4A3BG 4FBTA 4MTDA 2AGQA 1IOVA 1IBKH 3VMMA 4J0MA 2UXBH 2W6MA 3RUPA 1CE8A 2YYAA 4DL3A 4DLKA 4JV2A 5C4XG 4AYBA 4HNTA 2V4RA 4F4YA 4DR7H 1AUXA 2ZDGA 4JI5H 4QWAA 2XIGA 3PVXA 3V6HA 3N40P 4F4XA 5FPRA 2IA6A 4B3RH 5KFSA 2GPWA 2AQ4A 2YL2A 4RU9A 5LOVF 2FPGB 1GSOA 1JXLA 1Z2PX 3V4SA 1UC8A 4XYMB 3MJFA 5IYBG 5KFZA 5JVDF 2R84A 2YZGA 1B6RA 4BY1G 4IRKA 2ALZA 1EUCB 4LF5H 3TIIA 3MWMA 1M0WA 2RGVA 5KG7A 1M7JA 3M9NB 2RGRA 4EGJA 2V9WA 2W9CA 4DV0H 5KKNB 5EOYA 1EUDB 2ZDHA 4FM9A 5FLXW 2R8IA 3NGDA 4EEYA 5KG5A 1B33N 2XGPA 4TQRA 2OLSA 1KC7A 4DL6A 1K1SA 4QW9A 4J9KA 1ZHSA 2PBZA 2FLLA 1N33H 2R6FA 2VPQA 2FPPB 2R8KA 5LMUH 1C30A 5DLGA 4J9OA 3SE7A 5IYCG 4B3TH 3BQ0A 3GV5B 1JKJB 2HVSA 4UCRA 2W9BA 4I55F 5JUMA 4B3SH 2B63G 1KJQA 2CW8A 4I7HA 2FMAA 4XYLB 1WR2A 3ETJA 4WD3A 3GIMA 3GTOA 5KFFA 3GIIA 4FU0A 5IWAH 5FD5A 4EBCA 4YHHH 3K5HA 5KFRA 4YQWA 3H0GA 2DIKA 3T5KA 4A3MG 3CVZA 3OSPA 4DR6H 3OUZA 1T36A 3RB0A 1E4FT 4O3OA 3RBEA 4O3SA 4O4IF 1GGOA 3RGZA 1IOWA 5KFEA 3PR5B 1VBHA 3ORQA 2FE3A 4DV3H 3M4IA 2AU0A 3HXLA 4PDBA 2V4QA 4HNUA 2HHHH 5C1OA 1JLLB 1RJPA 3R23A 2NU6B 3JRWA 1RK5A 4MA0A 5KFJA 4ECSA 1S0OA 1KEEA 3H3VH 3R5HA 5IYZF 2YRWA 1FVIA 4HYKA 5HV6A 3RIZA 4F4WA 1J5EH 3EPIA 2AGOA 5HBRB 2YW2A 4RAYA 2I80A 3KHGA 3RAQA 4A3LG 4E4TA 4J9SA 4ED6A 4UCSA 5DG7A 2ASLA 2VA2A 4FS2A 1GSAA 2R7LA 4RZRA 2UVWA 3V6JA 4YJ3F 4JI7H 3JZIA 3GTMA 2IP4A 3HOYG 4JI2H 3L4JA 3OHBA 3BJYA 2VA3A 2WDTA 1WCMG 2WAQE 2B63A 1L2ZA 3OUUA 4EFBA 4Q8EA 5CA0F 5C1PA 1PX2A 1TWAA 1CQJB 1ZETA 4UCVA 2XCAA 2R7KA 4BBRG 3VPBA 5KFPA 5KG6A 3L4KA 5EWFA 2PMZA 2PVPA 4A3IG 2P0AA 2HVRA 4ETSA 3R5FA 4MV9A 2C2RA 4GC7A 3GILA 3ETHA 1A0IA 5C5JA 4G3IA 2WE6A 1WH2A 4YAJB 1S9FA 2XC9A 4LFAH 4IAJA 4YJ2F 4A2BA 3MR5A 4MV1A 5EDWA 4EBDA 3TQ1A 4MV4A 2R8GA 4EBEA 4LFBH 1M6VA 5A2QW 3U9SA 5KFNA 5KFCA 1GYFA 4Y8VB 3HBLA 2XD4A 4O3RA 4L1KA 2FPIB 1S10A 1HNWH 4F4ZA 3MR6A 3G6VA 1T3NA 3N8DA 2JA6A 4RB3C 3BAAA 1TWFA 3E5NA 3Q8PB 3M9MB 1RK6A 5LL6b 2GPSA 2WB1E 4MV3A 2I8CA 4ECUA 5EWEA 1C3OA 5CAEB 2NU9B 4ECTA 1Y1WG 2FLNA 4I50F 5BPFA 1V4YA 3OTOH 3MR3A 4DV1H 4J9LA 4ED8A 1FKAH 4Q0YA 5LA6F 3RJ0A 3LP8A 3UFXB 4CC5A 1BXRA 5BPHA 2W7PA 3OSNA 2KSWA 3KHRA 2YU9A 2E2IA 5LMNH 2R85A 3M9OB 2ASJA 4YY3H 1N36H 3KAJA 1JX4A 3F8NA 3GTGA 2NU8B 2I87A 3T1YH 3HOXG 1KJIA 4PWQA 5F9LA 4J9QA 4QJFA 1Y14B 2VR1A 4LFCH 5KG0A 4GKKH 3HOVG 5D1OB 4DR2H 1WCMA 5CA1F 3WO0A 1I50A 4A3JG 1EYZA 5KFLA 3RV4A 2YS6A 5KG3A 1W93A 4YR2A 3KALA 4O2AF 4A3FG 3N42B 2W9AA 5KFOA 4A3EG 3H20A 1DV2A 3QFFA 1XNQH 3CQZA 4U6PA 4X65H 5CB4F 2JA5G 1SFOA 5KG2A 3GTPA 2YZMA 5L9XA 4DR5H 5C8YF 4U7CA 1UNNC 4BY7G 3U9TA 4YR0A 3PR4A 3JRXA 1GLVA 3RBDA 2GLTA 4IHJF 3VPDA 1JIHA 1TA8A 1V51A 2ZJTA 3IG0A 3BQ1A 4DL5A 4JI1H 2F4VH 3Q1KA 4DV7H 3K5IA 4YP3A 2C2EA 5DG8A 1XMOH 2Y0SE 3RAXA 1KJ9A 3T5HA 1N56A 2J6TA 1S0NA 2FP4B 3BG5A 2E2HA 3V6KA 3GLKA 1JDEA 4EGQA 3HOZG 3PN1A 4QW8A 2XCPA 1BJTA 4ECVA 2R82A 5KFDA 4A93G 1SEIA 3MWDA 5KFVA 3KHLA 4GLXA 3MFHA 4LSAA 5IP9G 2WTFA 5J2TF 2FK2A 1E4EA 1VKZA 1PK8A 4DR1H 2JA6G 4B3MH 2QYZA 2HJWA 4OX9H 3V4ZA 1S0MA 4NXMH 1E4GT 2SCUB 2QK4A 3HB9A 2ATLA 4RNMA 2WYOA 4IR1A 4R8UB 4X66H 2C22A 3GIQA 4RNNA 1RYRA 4QIWE 2ASDA 3K3PA 2VQFH 4EYIB 5KT6A 4A3KG 3PO3G 1MZBA 4BXXG 3GIJA 4GC6A 2BR0A 3HKZE 5L1IA 3KXYT 2CKZB 2JEJA 5DG9A 4C5BA 4DV4H 4ED2A 2R87A 5KFAA 4XX0B 5KFGA 5KFHA 2UU9H 2NVYA 3VPCA 1DV1A 4JUZA 3TQTA 3TINA 2VOBA 4IWXA 1RYSA 2R93G 5KX5F 3AYHB 4IRCA 4K0KH 3RGXA 4MV7A 4UCOA 5DLFA 5J2UF 3LWBA 2UUAH 4KHPH 3WNZA 4HQ6A 1S03G 3RF2A 3PZPA 4JV0A 1X9NA 1S68A 4BBSG 3FMAA 1HNZH 1TWCA 3MFIA 4ZOLF 2NVXA 1I6UA 4QWEA 3K3VA 3N41B 1HNXH 3RTXA 5JQWA 1RJQA 1KJ8A 2RF4A 3I12A 4RZQA 5EZYF 3H40A 3QZ7A 3GTKA 3I4MG 2W6NA 2W9CB 4DUZH 1Y1VG 4LF7H 3PW5A 5KFXA 1AUVA 2W6OA 2C00A 3T1HH 1XMQH 5FLMG 4O3QA 2MCTA 2R8HA 1GO3E 4RB2C 2C35B 5KFQA 4CC6A 4QWCA 4F50A 4LMYA 2PMZE 2ZDQA 2FKLA 1AN7A 3BA9A 4ZI7F 2YRXA 3EYYA 4ED7A 4R7RA 2BQ3A 3HOWG 2R92A 1RJRA 1CQIB 1M0TA 2R7MA 1GSHA 2C28A 1K83A 4ECXA 4QWBA 4J9RA 4C5AA 1UC9A 4LF8H 1N34H 2W7OA 1VAJA 4ZHQF 1WSCA 2UUCH 4AYBE 3I4NG 2RDIA 4HNVA 1ZHQA 5F9NA 5KFBA 4EYHB 4J9MA 4O2BF 2O03A 2W57A 3RB4A 4JI4H 3C0FB 4FS1A 4UCUA 4A2AA 1ZQ7A 3ORRA 2BQUA 4DL7A 4IRDA 1CS0A 2J6SA 5DQGA 5L1JA
chains in the Genus database with same CATH topology
2CQYA 2YS7A 2GLTA 2V59A 3R5XA 4IHJF 5H80A 3VPDA 4HR7A 1A9XA 3Q1KA 2W70A 1W96A 3K5IA 3RFCA 4TUYF 5D8DA 1GSAA 2R7LA 4YJ3F 1KJ9A 2W71A 2XCLA 2IP4A 3JZIA 2W6ZA 4XZ3B 2YZNA 3Q2OA 2FP4B 4IWYA 2DWCA 3BG5A 3GLKA 1JDEA 4EGQA 2DZDA 3OUUA 4ME6A 2CZGA 5C1PA 5CA0F 1I7NA 1PX2A 1SCUB 1VBGA 5LXTF 1CQJB 4MAMA 1E4EB 4EG0A 2DLNA 2R7KA 3MWEA 4YB8B 2R82A 3MWDA 4M9UA 3VPBA 5LYJF 1I7LA 2PVPA 2P0AA 2FB9A 2R86A 3R5FA 4O4LF 5J2TF 1E4EA 1VKZA 1PK8A 2HJWA 3ETHA 3V4ZA 3TIGA 4MV8A 3GIDA 4YAJB 2SCUB 1IOVA 2QK4A 3HB9A 3VMMA 2W6MA 4YJ2F 1CE8A 2YYAA 3RUPA 4DLKA 5LP6F 4MV1A 2R7NA 4HNTA 2X0SA 4MV4A 3K3PA 1AUXA 2ZDGA 3WO1A 1M6VA 3U9SA 5GONF 4Y8VB 3HBLA 4MA5A 4O4HF 4C5BA 2XD4A 2R87A 2GPWA 5I47A 1JDBB 1KJJA 4L1KA 2FPIB 2YL2A 4XX0B 3RV3A 2FPGB 3VPCA 5LOVF 1DV1A 1GSOA 3N8DA 2PN1A 3TQTA 3TINA 2NUAB 3V4SA 5JVLA 1UC8A 3E5NA 3MJFA 4IWXA 4XYMB 5JVDF 5KX5F 2R84A 1BNCA 1B6RA 2YZGA 4WBNF 1B6SA 5J2UF 1EUCB 2VQDA 2GPSA 3LWBA 4MV3A 3TIIA 2I8CA 3WNZA 4HQ6A 1C3OA 5CAEB 4YAKB 2NU9B 4EGJA 4I50F 5BPFA 1EUDB 2ZDHA 5KKNB 4ZOLF 4ZQIA 2W6QA 4C5CA 5BMVF 2OLSA 1KC7A 5LA6F 3LP8A 1EHIA 2PBZA 1BXRA 3UFXB 5BPHA 2R6FA 2VPQA 5JQWA 2FPPB 1KJ8A 5JH7F 3I12A 1C30A 5EZYF 2V5AA 2V58A 3SE7A 2W6NA 2R85A 1JKJB 1DIKA 4I55F 1KJQA 1AUVA 4XYLB 2W6OA 1WR2A 3ETJA 4WD3A 2NU8B 2C00A 2I87A 1KBLA 1KJIA 4TV9F 4FU0A 3K5HA 4MV6A 2DIKA 2VR1A 2ZDQA 5K2MA 2J9GA 3OUZA 1T36A 4YBZB 2YRXA 4ZI7F 3G8CA 5CA1F 3WO0A 4O4IF 1CQIB 1EYZA 1GGOA 1IOWA 1GSHA 2R7MA 1EZ1A 3RV4A 2YS6A 1VBHA 3ORQA 1W93A 4C5AA 1UC9A 4O2AF 4ZHQF 4HNUA 5C1OA 1JLLB 4MA0A 2NU6B 3JRWA 3R23A 4HNVA 2W6PA 1DV2A 3QFFA 1ULZA 1KEEA 3R5HA 4O2BF 5IYZF 2YRWA 5CB4F 5HV6A 2YZMA 4IZOA 3ORRA 5C8YF 5HBRB 3U9TA 4TV8F 1CS0A 4I4TF 2YW2A 2NU7B 2I80A 3JRXA 1GLVA 4E4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CQY A;  2YS7 A;  2GLT A;  2V59 A;  3R5X A;  4IHJ F;  5H80 A;  3VPD A;  4HR7 A;  1A9X A;  3Q1K A;  2W70 A;  1W96 A;  3K5I A;  3RFC A;  4TUY F;  5D8D A;  1GSA A;  2R7L A;  4YJ3 F;  1KJ9 A;  2W71 A;  2XCL A;  2IP4 A;  3JZI A;  2W6Z A;  4XZ3 B;  2YZN A;  3Q2O A;  2FP4 B;  4IWY A;  2DWC A;  3BG5 A;  3GLK A;  1JDE A;  4EGQ A;  2DZD A;  3OUU A;  4ME6 A;  2CZG A;  5C1P A;  5CA0 F;  1I7N A;  1PX2 A;  1SCU B;  1VBG A;  5LXT F;  1CQJ B;  4MAM A;  1E4E B;  4EG0 A;  2DLN A;  2R7K A;  3MWE A;  4YB8 B;  2R82 A;  3MWD A;  4M9U A;  3VPB A;  5LYJ F;  1I7L A;  2PVP A;  2P0A A;  2FB9 A;  2R86 A;  3R5F A;  4O4L F;  5J2T F;  1E4E A;  1VKZ A;  1PK8 A;  2HJW A;  3ETH A;  3V4Z A;  3TIG A;  4MV8 A;  3GID A;  4YAJ B;  2SCU B;  1IOV A;  2QK4 A;  3HB9 A;  3VMM A;  2W6M A;  4YJ2 F;  1CE8 A;  2YYA A;  3RUP A;  4DLK A;  5LP6 F;  4MV1 A;  2R7N A;  4HNT A;  2X0S A;  4MV4 A;  3K3P A;  1AUX A;  2ZDG A;  3WO1 A;  1M6V A;  3U9S A;  5GON F;  4Y8V B;  3HBL A;  4MA5 A;  4O4H F;  4C5B A;  2XD4 A;  2R87 A;  2GPW A;  5I47 A;  1JDB B;  1KJJ A;  4L1K A;  2FPI B;  2YL2 A;  4XX0 B;  3RV3 A;  2FPG B;  3VPC A;  5LOV F;  1DV1 A;  1GSO A;  3N8D A;  2PN1 A;  3TQT A;  3TIN A;  2NUA B;  3V4S A;  5JVL A;  1UC8 A;  3E5N A;  3MJF A;  4IWX A;  4XYM B;  5JVD F;  5KX5 F;  2R84 A;  1BNC A;  1B6R A;  2YZG A;  4WBN F;  1B6S A;  5J2U F;  1EUC B;  2VQD A;  2GPS A;  3LWB A;  4MV3 A;  3TII A;  2I8C A;  3WNZ A;  4HQ6 A;  1C3O A;  5CAE B;  4YAK B;  2NU9 B;  4EGJ A;  4I50 F;  5BPF A;  1EUD B;  2ZDH A;  5KKN B;  4ZOL F;  4ZQI A;  2W6Q A;  4C5C A;  5BMV F;  2OLS A;  1KC7 A;  5LA6 F;  3LP8 A;  1EHI A;  2PBZ A;  1BXR A;  3UFX B;  5BPH A;  2R6F A;  2VPQ A;  5JQW A;  2FPP B;  1KJ8 A;  5JH7 F;  3I12 A;  1C30 A;  5EZY F;  2V5A A;  2V58 A;  3SE7 A;  2W6N A;  2R85 A;  1JKJ B;  1DIK A;  4I55 F;  1KJQ A;  1AUV A;  4XYL B;  2W6O A;  1WR2 A;  3ETJ A;  4WD3 A;  2NU8 B;  2C00 A;  2I87 A;  1KBL A;  1KJI A;  4TV9 F;  4FU0 A;  3K5H A;  4MV6 A;  2DIK A;  2VR1 A;  2ZDQ A;  5K2M A;  2J9G A;  3OUZ A;  1T36 A;  4YBZ B;  2YRX A;  4ZI7 F;  3G8C A;  5CA1 F;  3WO0 A;  4O4I F;  1CQI B;  1EYZ A;  1GGO A;  1IOW A;  1GSH A;  2R7M A;  1EZ1 A;  3RV4 A;  2YS6 A;  1VBH A;  3ORQ A;  1W93 A;  4C5A A;  1UC9 A;  4O2A F;  4ZHQ F;  4HNU A;  5C1O A;  1JLL B;  4MA0 A;  2NU6 B;  3JRW A;  3R23 A;  4HNV A;  2W6P A;  1DV2 A;  3QFF A;  1ULZ A;  1KEE A;  3R5H A;  4O2B F;  5IYZ F;  2YRW A;  5CB4 F;  5HV6 A;  2YZM A;  4IZO A;  3ORR A;  5C8Y F;  5HBR B;  3U9T A;  4TV8 F;  1CS0 A;  4I4T F;  2YW2 A;  2NU7 B;  2I80 A;  3JRX A;  1GLV A;  4E4T A; 
#chains in the Genus database with same CATH topology
 2CQY A;  1Z2O X;  2YS7 A;  2UXC H;  5H80 A;  1BGW A;  1T94 A;  5IYD G;  2W70 A;  3HKZ A;  1W96 A;  1OWT A;  4J9N A;  2UVV A;  5KFW A;  2R93 A;  2ZM6 H;  3MR2 A;  4RUA A;  2YZN A;  2HGS A;  4IWY A;  5KFK A;  5DGA A;  5DQI A;  4RB0 A;  1Y1V A;  4A3G G;  2JA5 A;  1I7N A;  1SCU B;  1VBG A;  5LXT F;  2VUG A;  2FK1 A;  2R7Z G;  4A3C G;  1E4E B;  2FLP A;  4YB8 B;  4ED1 A;  3GQC A;  4M9U A;  1DGS A;  5L1K A;  1I7L A;  4LH7 A;  2R8J A;  5KFI A;  2R86 A;  4ED0 A;  3GIP A;  4DL4 A;  4O4L F;  5KFU A;  4DV5 H;  3GTJ A;  3KTM A;  4YR3 A;  2FK3 A;  4EEQ A;  2W9B B;  3TIG A;  3G6Y A;  5DQH A;  4MV8 A;  3GID A;  3J7A K;  1P8L A;  5LP6 F;  1N48 A;  2JA7 G;  2R7N A;  3QZ8 A;  4Q43 A;  3OHA A;  2X0S A;  5KT4 A;  5KFY A;  3WO1 A;  4ECW A;  5L1L A;  5D1P A;  4IR9 A;  1FJG H;  5GON F;  5IT9 W;  4MA5 A;  5FJ8 G;  4O4H F;  4ECR A;  2YCH A;  4APM A;  5BR8 H;  3RB3 A;  3N43 B;  5I47 A;  1JDB B;  1KJJ A;  4Q44 A;  4X64 H;  3RV3 A;  3T5L A;  2W8L A;  2PN1 A;  4UFZ A;  3PW7 A;  2NUA B;  2WAQ A;  5JVL A;  1B04 A;  2Q2U A;  3GTL A;  1BNC A;  4WBN F;  1I94 H;  2UVR A;  1B6S A;  2VQD A;  3UQ8 A;  1V9P A;  3T5J A;  1SYX B;  4EFE A;  2DPJ A;  1TWH A;  4YAK B;  2AGP A;  4JI3 H;  4RNO A;  4RAZ A;  1TAE A;  3H4D A;  1Z2N X;  3KAK A;  2C2D A;  3RB6 A;  3GV7 B;  4C2M A;  3L2P A;  4C5C A;  4ZQI A;  2W6Q A;  2CW7 A;  2XGQ A;  5BMV F;  3BQ2 A;  4FBU A;  4LF6 H;  4A3D G;  4ECQ A;  3SI8 A;  5D1O A;  1EHI A;  5C44 G;  4JV5 H;  2R92 G;  2JA7 A;  3JSN A;  4TQS A;  5JH7 F;  3J81 W;  4J9P A;  1S97 A;  1XDN A;  1TWG A;  4LH6 A;  3BAB A;  2V5A A;  2V58 A;  3Q8S B;  3PO2 G;  4DR4 H;  4GKJ H;  4QWD A;  1N32 H;  1DIK A;  5KT5 A;  1I3Q A;  2M05 A;  4O3P A;  5KG4 A;  5C3E G;  2IMW P;  3N6X A;  3GV8 B;  1KBL A;  2Y0S A;  2JEG A;  4TV9 F;  2UVU A;  4MV6 A;  3G6X A;  2RDJ A;  4DUY H;  3J80 W;  2E5L H;  3Q8R B;  5KG1 A;  2R7Z A;  3IN5 A;  4ECZ A;  5K2M A;  3BA8 A;  2J9G A;  3N44 B;  4YBZ B;  5T14 A;  1IBM H;  3G8C A;  3GIK A;  4ECY A;  4NLG A;  3JSL A;  4R8U A;  2VQE H;  1EZ1 A;  5KT7 A;  4DV6 H;  2DPI A;  1K1Q A;  4JV1 A;  3FKI A;  3H4B A;  4LF4 H;  4MTE A;  4BWS C;  1XNR H;  4RB1 A;  4Q45 A;  2FJZ A;  4QIW A;  2OH2 A;  2W6P A;  2JA8 G;  1ULZ A;  5KT3 A;  5KFM A;  2J6U A;  3KHH A;  4IZO A;  3DF7 A;  5KT2 A;  1IBL H;  4TV8 F;  4DR3 H;  3FKI G;  4I4T F;  4UCT A;  2NU7 B;  4AQY H;  2IBK A;  4M7E A;  3LML A;  1R9T A;  2JEF A;  3H0G G;  2V59 A;  3R5X A;  4HR7 A;  1A9X A;  2Q2T A;  1HR0 H;  3RFC A;  4TUY F;  5D8D A;  2VUM A;  5DGB A;  3FDS A;  2W71 A;  2WB1 A;  2XCL A;  4X62 H;  2W6Z A;  5EWG A;  3Q8Q B;  4ED3 A;  2HVQ A;  4XZ3 B;  3EPG A;  3Q2O A;  2DWC A;  4JI0 H;  4JI6 H;  2DZD A;  5IP7 G;  4ME6 A;  2CZG A;  3GTQ A;  3JAM W;  5FD6 A;  1VS0 A;  2VPS A;  3HOU G;  1Y1W A;  4MAM A;  4EG0 A;  2DLN A;  3MWE A;  4JYA H;  5LYJ F;  4DV2 H;  4DL2 A;  3PW0 A;  2JEI A;  2OWO A;  4NXN H;  2FB9 A;  1O75 A;  4O3N A;  3PW4 A;  4LSX A;  3PW2 A;  5FPO A;  2VUM G;  2BQR A;  2UUB H;  4LF9 H;  2UXD H;  4JI8 H;  5KFT A;  4RUC A;  4Q8F A;  2W8K A;  4A3B G;  4FBT A;  4MTD A;  2AGQ A;  1IOV A;  1IBK H;  3VMM A;  4J0M A;  2UXB H;  2W6M A;  3RUP A;  1CE8 A;  2YYA A;  4DL3 A;  4DLK A;  4JV2 A;  5C4X G;  4AYB A;  4HNT A;  2V4R A;  4F4Y A;  4DR7 H;  1AUX A;  2ZDG A;  4JI5 H;  4QWA A;  2XIG A;  3PVX A;  3V6H A;  3N40 P;  4F4X A;  5FPR A;  2IA6 A;  4B3R H;  5KFS A;  2GPW A;  2AQ4 A;  2YL2 A;  4RU9 A;  5LOV F;  2FPG B;  1GSO A;  1JXL A;  1Z2P X;  3V4S A;  1UC8 A;  4XYM B;  3MJF A;  5IYB G;  5KFZ A;  5JVD F;  2R84 A;  2YZG A;  1B6R A;  4BY1 G;  4IRK A;  2ALZ A;  1EUC B;  4LF5 H;  3TII A;  3MWM A;  1M0W A;  2RGV A;  5KG7 A;  1M7J A;  3M9N B;  2RGR A;  4EGJ A;  2V9W A;  2W9C A;  4DV0 H;  5KKN B;  5EOY A;  1EUD B;  2ZDH A;  4FM9 A;  5FLX W;  2R8I A;  3NGD A;  4EEY A;  5KG5 A;  1B33 N;  2XGP A;  4TQR A;  2OLS A;  1KC7 A;  4DL6 A;  1K1S A;  4QW9 A;  4J9K A;  1ZHS A;  2PBZ A;  2FLL A;  1N33 H;  2R6F A;  2VPQ A;  2FPP B;  2R8K A;  5LMU H;  1C30 A;  5DLG A;  4J9O A;  3SE7 A;  5IYC G;  4B3T H;  3BQ0 A;  3GV5 B;  1JKJ B;  2HVS A;  4UCR A;  2W9B A;  4I55 F;  5JUM A;  4B3S H;  2B63 G;  1KJQ A;  2CW8 A;  4I7H A;  2FMA A;  4XYL B;  1WR2 A;  3ETJ A;  4WD3 A;  3GIM A;  3GTO A;  5KFF A;  3GII A;  4FU0 A;  5IWA H;  5FD5 A;  4EBC A;  4YHH H;  3K5H A;  5KFR A;  4YQW A;  3H0G A;  2DIK A;  3T5K A;  4A3M G;  3CVZ A;  3OSP A;  4DR6 H;  3OUZ A;  1T36 A;  3RB0 A;  1E4F T;  4O3O A;  3RBE A;  4O3S A;  4O4I F;  1GGO A;  3RGZ A;  1IOW A;  5KFE A;  3PR5 B;  1VBH A;  3ORQ A;  2FE3 A;  4DV3 H;  3M4I A;  2AU0 A;  3HXL A;  4PDB A;  2V4Q A;  4HNU A;  2HHH H;  5C1O A;  1JLL B;  1RJP A;  3R23 A;  2NU6 B;  3JRW A;  1RK5 A;  4MA0 A;  5KFJ A;  4ECS A;  1S0O A;  1KEE A;  3H3V H;  3R5H A;  5IYZ F;  2YRW A;  1FVI A;  4HYK A;  5HV6 A;  3RIZ A;  4F4W A;  1J5E H;  3EPI A;  2AGO A;  5HBR B;  2YW2 A;  4RAY A;  2I80 A;  3KHG A;  3RAQ A;  4A3L G;  4E4T A;  4J9S A;  4ED6 A;  4UCS A;  5DG7 A;  2ASL A;  2VA2 A;  4FS2 A;  1GSA A;  2R7L A;  4RZR A;  2UVW A;  3V6J A;  4YJ3 F;  4JI7 H;  3JZI A;  3GTM A;  2IP4 A;  3HOY G;  4JI2 H;  3L4J A;  3OHB A;  3BJY A;  2VA3 A;  2WDT A;  1WCM G;  2WAQ E;  2B63 A;  1L2Z A;  3OUU A;  4EFB A;  4Q8E A;  5CA0 F;  5C1P A;  1PX2 A;  1TWA A;  1CQJ B;  1ZET A;  4UCV A;  2XCA A;  2R7K A;  4BBR G;  3VPB A;  5KFP A;  5KG6 A;  3L4K A;  5EWF A;  2PMZ A;  2PVP A;  4A3I G;  2P0A A;  2HVR A;  4ETS A;  3R5F A;  4MV9 A;  2C2R A;  4GC7 A;  3GIL A;  3ETH A;  1A0I A;  5C5J A;  4G3I A;  2WE6 A;  1WH2 A;  4YAJ B;  1S9F A;  2XC9 A;  4LFA H;  4IAJ A;  4YJ2 F;  4A2B A;  3MR5 A;  4MV1 A;  5EDW A;  4EBD A;  3TQ1 A;  4MV4 A;  2R8G A;  4EBE A;  4LFB H;  1M6V A;  5A2Q W;  3U9S A;  5KFN A;  5KFC A;  1GYF A;  4Y8V B;  3HBL A;  2XD4 A;  4O3R A;  4L1K A;  2FPI B;  1S10 A;  1HNW H;  4F4Z A;  3MR6 A;  3G6V A;  1T3N A;  3N8D A;  2JA6 A;  4RB3 C;  3BAA A;  1TWF A;  3E5N A;  3Q8P B;  3M9M B;  1RK6 A;  5LL6 b;  2GPS A;  2WB1 E;  4MV3 A;  2I8C A;  4ECU A;  5EWE A;  1C3O A;  5CAE B;  2NU9 B;  4ECT A;  1Y1W G;  2FLN A;  4I50 F;  5BPF A;  1V4Y A;  3OTO H;  3MR3 A;  4DV1 H;  4J9L A;  4ED8 A;  1FKA H;  4Q0Y A;  5LA6 F;  3RJ0 A;  3LP8 A;  3UFX B;  4CC5 A;  1BXR A;  5BPH A;  2W7P A;  3OSN A;  2KSW A;  3KHR A;  2YU9 A;  2E2I A;  5LMN H;  2R85 A;  3M9O B;  2ASJ A;  4YY3 H;  1N36 H;  3KAJ A;  1JX4 A;  3F8N A;  3GTG A;  2NU8 B;  2I87 A;  3T1Y H;  3HOX G;  1KJI A;  4PWQ A;  5F9L A;  4J9Q A;  4QJF A;  1Y14 B;  2VR1 A;  4LFC H;  5KG0 A;  4GKK H;  3HOV G;  5D1O B;  4DR2 H;  1WCM A;  5CA1 F;  3WO0 A;  1I50 A;  4A3J G;  1EYZ A;  5KFL A;  3RV4 A;  2YS6 A;  5KG3 A;  1W93 A;  4YR2 A;  3KAL A;  4O2A F;  4A3F G;  3N42 B;  2W9A A;  5KFO A;  4A3E G;  3H20 A;  1DV2 A;  3QFF A;  1XNQ H;  3CQZ A;  4U6P A;  4X65 H;  5CB4 F;  2JA5 G;  1SFO A;  5KG2 A;  3GTP A;  2YZM A;  5L9X A;  4DR5 H;  5C8Y F;  4U7C A;  1UNN C;  4BY7 G;  3U9T A;  4YR0 A;  3PR4 A;  3JRX A;  1GLV A;  3RBD A;  2GLT A;  4IHJ F;  3VPD A;  1JIH A;  1TA8 A;  1V51 A;  2ZJT A;  3IG0 A;  3BQ1 A;  4DL5 A;  4JI1 H;  2F4V H;  3Q1K A;  4DV7 H;  3K5I A;  4YP3 A;  2C2E A;  5DG8 A;  1XMO H;  2Y0S E;  3RAX A;  1KJ9 A;  3T5H A;  1N56 A;  2J6T A;  1S0N A;  2FP4 B;  3BG5 A;  2E2H A;  3V6K A;  3GLK A;  1JDE A;  4EGQ A;  3HOZ G;  3PN1 A;  4QW8 A;  2XCP A;  1BJT A;  4ECV A;  2R82 A;  5KFD A;  4A93 G;  1SEI A;  3MWD A;  5KFV A;  3KHL A;  4GLX A;  3MFH A;  4LSA A;  5IP9 G;  2WTF A;  5J2T F;  2FK2 A;  1E4E A;  1VKZ A;  1PK8 A;  4DR1 H;  2JA6 G;  4B3M H;  2QYZ A;  2HJW A;  4OX9 H;  3V4Z A;  1S0M A;  4NXM H;  1E4G T;  2SCU B;  2QK4 A;  3HB9 A;  2ATL A;  4RNM A;  2WYO A;  4IR1 A;  4R8U B;  4X66 H;  2C22 A;  3GIQ A;  4RNN A;  1RYR A;  4QIW E;  2ASD A;  3K3P A;  2VQF H;  4EYI B;  5KT6 A;  4A3K G;  3PO3 G;  1MZB A;  4BXX G;  3GIJ A;  4GC6 A;  2BR0 A;  3HKZ E;  5L1I A;  3KXY T;  2CKZ B;  2JEJ A;  5DG9 A;  4C5B A;  4DV4 H;  4ED2 A;  2R87 A;  5KFA A;  4XX0 B;  5KFG A;  5KFH A;  2UU9 H;  2NVY A;  3VPC A;  1DV1 A;  4JUZ A;  3TQT A;  3TIN A;  2VOB A;  4IWX A;  1RYS A;  2R93 G;  5KX5 F;  3AYH B;  4IRC A;  4K0K H;  3RGX A;  4MV7 A;  4UCO A;  5DLF A;  5J2U F;  3LWB A;  2UUA H;  4KHP H;  3WNZ A;  4HQ6 A;  1S03 G;  3RF2 A;  3PZP A;  4JV0 A;  1X9N A;  1S68 A;  4BBS G;  3FMA A;  1HNZ H;  1TWC A;  3MFI A;  4ZOL F;  2NVX A;  1I6U A;  4QWE A;  3K3V A;  3N41 B;  1HNX H;  3RTX A;  5JQW A;  1RJQ A;  1KJ8 A;  2RF4 A;  3I12 A;  4RZQ A;  5EZY F;  3H40 A;  3QZ7 A;  3GTK A;  3I4M G;  2W6N A;  2W9C B;  4DUZ H;  1Y1V G;  4LF7 H;  3PW5 A;  5KFX A;  1AUV A;  2W6O A;  2C00 A;  3T1H H;  1XMQ H;  5FLM G;  4O3Q A;  2MCT A;  2R8H A;  1GO3 E;  4RB2 C;  2C35 B;  5KFQ A;  4CC6 A;  4QWC A;  4F50 A;  4LMY A;  2PMZ E;  2ZDQ A;  2FKL A;  1AN7 A;  3BA9 A;  4ZI7 F;  2YRX A;  3EYY A;  4ED7 A;  4R7R A;  2BQ3 A;  3HOW G;  2R92 A;  1RJR A;  1CQI B;  1M0T A;  2R7M A;  1GSH A;  2C28 A;  1K83 A;  4ECX A;  4QWB A;  4J9R A;  4C5A A;  1UC9 A;  4LF8 H;  1N34 H;  2W7O A;  1VAJ A;  4ZHQ F;  1WSC A;  2UUC H;  4AYB E;  3I4N G;  2RDI A;  4HNV A;  1ZHQ A;  5F9N A;  5KFB A;  4EYH B;  4J9M A;  4O2B F;  2O03 A;  2W57 A;  3RB4 A;  4JI4 H;  3C0F B;  4FS1 A;  4UCU A;  4A2A A;  1ZQ7 A;  3ORR A;  2BQU A;  4DL7 A;  4IRD A;  1CS0 A;  2J6S A;  5DQG A;  5L1J A; 
#chains in the Genus database with same CATH homology
 2CQY A;  2YS7 A;  2GLT A;  2V59 A;  3R5X A;  4IHJ F;  5H80 A;  3VPD A;  4HR7 A;  1A9X A;  3Q1K A;  2W70 A;  1W96 A;  3K5I A;  3RFC A;  4TUY F;  5D8D A;  1GSA A;  2R7L A;  4YJ3 F;  1KJ9 A;  2W71 A;  2XCL A;  2IP4 A;  3JZI A;  2W6Z A;  4XZ3 B;  2YZN A;  3Q2O A;  2FP4 B;  4IWY A;  2DWC A;  3BG5 A;  3GLK A;  1JDE A;  4EGQ A;  2DZD A;  3OUU A;  4ME6 A;  2CZG A;  5C1P A;  5CA0 F;  1I7N A;  1PX2 A;  1SCU B;  1VBG A;  5LXT F;  1CQJ B;  4MAM A;  1E4E B;  4EG0 A;  2DLN A;  2R7K A;  3MWE A;  4YB8 B;  2R82 A;  3MWD A;  4M9U A;  3VPB A;  5LYJ F;  1I7L A;  2PVP A;  2P0A A;  2FB9 A;  2R86 A;  3R5F A;  4O4L F;  5J2T F;  1E4E A;  1VKZ A;  1PK8 A;  2HJW A;  3ETH A;  3V4Z A;  3TIG A;  4MV8 A;  3GID A;  4YAJ B;  2SCU B;  1IOV A;  2QK4 A;  3HB9 A;  3VMM A;  2W6M A;  4YJ2 F;  1CE8 A;  2YYA A;  3RUP A;  4DLK A;  5LP6 F;  4MV1 A;  2R7N A;  4HNT A;  2X0S A;  4MV4 A;  3K3P A;  1AUX A;  2ZDG A;  3WO1 A;  1M6V A;  3U9S A;  5GON F;  4Y8V B;  3HBL A;  4MA5 A;  4O4H F;  4C5B A;  2XD4 A;  2R87 A;  2GPW A;  5I47 A;  1JDB B;  1KJJ A;  4L1K A;  2FPI B;  2YL2 A;  4XX0 B;  3RV3 A;  2FPG B;  3VPC A;  5LOV F;  1DV1 A;  1GSO A;  3N8D A;  2PN1 A;  3TQT A;  3TIN A;  2NUA B;  3V4S A;  5JVL A;  1UC8 A;  3E5N A;  3MJF A;  4IWX A;  4XYM B;  5JVD F;  5KX5 F;  2R84 A;  1BNC A;  1B6R A;  2YZG A;  4WBN F;  1B6S A;  5J2U F;  1EUC B;  2VQD A;  2GPS A;  3LWB A;  4MV3 A;  3TII A;  2I8C A;  3WNZ A;  4HQ6 A;  1C3O A;  5CAE B;  4YAK B;  2NU9 B;  4EGJ A;  4I50 F;  5BPF A;  1EUD B;  2ZDH A;  5KKN B;  4ZOL F;  4ZQI A;  2W6Q A;  4C5C A;  5BMV F;  2OLS A;  1KC7 A;  5LA6 F;  3LP8 A;  1EHI A;  2PBZ A;  1BXR A;  3UFX B;  5BPH A;  2R6F A;  2VPQ A;  5JQW A;  2FPP B;  1KJ8 A;  5JH7 F;  3I12 A;  1C30 A;  5EZY F;  2V5A A;  2V58 A;  3SE7 A;  2W6N A;  2R85 A;  1JKJ B;  1DIK A;  4I55 F;  1KJQ A;  1AUV A;  4XYL B;  2W6O A;  1WR2 A;  3ETJ A;  4WD3 A;  2NU8 B;  2C00 A;  2I87 A;  1KBL A;  1KJI A;  4TV9 F;  4FU0 A;  3K5H A;  4MV6 A;  2DIK A;  2VR1 A;  2ZDQ A;  5K2M A;  2J9G A;  3OUZ A;  1T36 A;  4YBZ B;  2YRX A;  4ZI7 F;  3G8C A;  5CA1 F;  3WO0 A;  4O4I F;  1CQI B;  1EYZ A;  1GGO A;  1IOW A;  1GSH A;  2R7M A;  1EZ1 A;  3RV4 A;  2YS6 A;  1VBH A;  3ORQ A;  1W93 A;  4C5A A;  1UC9 A;  4O2A F;  4ZHQ F;  4HNU A;  5C1O A;  1JLL B;  4MA0 A;  2NU6 B;  3JRW A;  3R23 A;  4HNV A;  2W6P A;  1DV2 A;  3QFF A;  1ULZ A;  1KEE A;  3R5H A;  4O2B F;  5IYZ F;  2YRW A;  5CB4 F;  5HV6 A;  2YZM A;  4IZO A;  3ORR A;  5C8Y F;  5HBR B;  3U9T A;  4TV8 F;  1CS0 A;  4I4T F;  2YW2 A;  2NU7 B;  2I80 A;  3JRX A;  1GLV A;  4E4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...