2CQYA

Solution structure of b domain from human propionyl-coa carboxylase alpha subunit
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
108
structure length
108
Chain Sequence
b'GSSGSSGDKIESKLLAKKAEVNTIPGFDGVVKDAEEAVRIAREIGYPVMIKASAGGGGKGMRIAWDDEETRDGFRLSSQEAASSFGDDRLLIEKFIDNPRHISGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Propionyl-CoA carboxylase alpha chain, mitochondrial
publication title Solution structure of B domain from human propionyl-CoA carboxylase alpha subunit
rcsb
source organism Homo sapiens
molecule tags Ligase
total genus 14
structure length 108
sequence length 108
ec nomenclature ec 6.4.1.3: Propionyl-CoA carboxylase.
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1490.20 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 ATP-grasp fold, A domain 2cqyA01
3GLKA 4I4TF 5LP6F 4ZHQF 2NUAB 3RFCA 3TIGA 1DV2A 3U9TA 4XX0B 1GSAA 2R82A 3TQTA 1UC8A 5J2TF 4ZOLF 5BMVF 2W6QA 3MWDA 1VBHA 3Q1KA 4MV8A 2NU9B 1PX2A 4DLKA 1EUCB 5BPFA 1CE8A 2XCLA 3U9SA 3GIDA 3N8DA 4YBZB 1GSOA 2I8CA 2VPQA 2SCUB 1T36A 4IHJF 2YYAA 4MA0A 4E4TA 4HQ6A 2NU8B 4XZ3B 2DZDA 2HJWA 4TV8F 4TV9F 4YAKB 5KKNB 2W6ZA 3R5XA 4FU0A 3BG5A 2OLSA 1DIKA 3WO1A 4XYMB 3WNZA 2ZDGA 1JDEA 2C00A 4EGJA 4IZOA 4O4HF 5LOVF 1KJ9A 1JLLB 5I47A 1KC7A 1E4EA 3G8CA 2W70A 2PBZA 3JZIA 1IOWA 1B6RA 2R87A 5CAEB 5EZYF 2R6FA 4IWYA 3RUPA 3MJFA 2NU7B 2DLNA 4I50F 4O4IF 5KX5F 1SCUB 1GLVA 2DWCA 3TINA 3RV3A 2ZDHA 1EHIA 2R7LA 4MA5A 2R7MA 2PVPA 3JRXA 1KJ8A 2GPSA 3E5NA 3OUZA 3ETHA 2X0SA 4WD3A 2YL2A 1PK8A 4TUYF 4EGQA 4XYLB 5IYZF 1JKJB 3LP8A 1KJJA 5C1OA 4MV4A 2I80A 2XD4A 3QFFA 2YZNA 2W6NA 4YJ3F 4EG0A 4HNTA 4O4LF 1UC9A 2FP4B 3K3PA 4MAMA 1BXRA 2DIKA 3ORQA 4HNVA 4MV6A 5LA6F 1VKZA 4YB8B 1IOVA 5LXTF 2R85A 4M9UA 1W96A 2YZGA 3WO0A 5CB4F 1KBLA 2FB9A 2W6OA 3SE7A 2YS7A 2VR1A 3ETJA 4IWXA 1AUXA 1M6VA 5C1PA 2R86A 2FPPB 2PN1A 1C30A 3K5HA 5BPHA 2YRXA 1JDBB 4HR7A 3VMMA 4WBNF 2QK4A 5HV6A 1I7LA 4C5AA 3V4SA 5C8YF 5LYJF 3HBLA 4YAJB 3R23A 4L1KA 4ZQIA 4HNUA 2NU6B 5K2MA 1CS0A 1ULZA 3OUUA 1I7NA 2R84A 3VPDA 2R7NA 1KEEA 2GLTA 2YW2A 5CA1F 1A9XA 5J2UF 3R5FA 1EUDB 2YRWA 1GSHA 2IP4A 3JRWA 5JVLA 2CQYA 2I87A 4Y8VB 2FPGB 1EYZA 2V5AA 4C5BA 3MWEA 1VBGA 2ZDQA 1CQIB 4O2BF 2V59A 5JQWA 1KJQA 4YJ2F 4O2AF 2V58A 3HB9A 1DV1A 3V4ZA 5D8DA 1CQJB 3UFXB 1WR2A 1BNCA 5JH7F 3VPCA 1KJIA 2FPIB 2GPWA 1C3OA 2W71A 1B6SA 3VPBA 2W6PA 2W6MA 4MV1A 3RV4A 3TIIA 4ME6A 3I12A 2YS6A 4ZI7F 3LWBA 3ORRA 1E4EB 5GONF 5JVDF 2R7KA 3R5HA 4I55F 1AUVA 5CA0F 3K5IA 5HBRB 2CZGA 1GGOA 2VQDA 3Q2OA 5H80A 1W93A 4MV3A 2P0AA 2J9GA 4C5CA 1EZ1A 2YZMA
chains in the Genus database with same CATH superfamily
3GLKA 5LP6F 1P8LA 2XGQA 1TWGA 3RFCA 1DV2A 5KFRA 3GIKA 2OWOA 1GSAA 2R82A 3PO2G 2J6TA 5KT4A 4EEQA 1VBHA 4DLKA 1TAEA 3RGZA 4ECUA 2XCLA 2FLLA 5LL6b 1HR0H 4ECWA 2VPQA 1I94H 4FBUA 5FD5A 5L1LA 4DV7H 4MA0A 4RB0A 3FKIA 5KFJA 2NU8B 5EWEA 4XZ3B 2DZDA 4DR4H 4YAKB 3RAQA 2QYZA 2V4QA 4FU0A 1S0OA 3GTQA 3BA8A 3GTKA 4DV1H 4BY1G 1JDEA 4EGJA 4O4HF 2R8IA 5KG2A 3NGDA 1KJ9A 1JLLB 1SYXB 3EYYA 5KFCA 3BQ2A 4JI6H 2C2EA 3G8CA 2W70A 5KFAA 4Q8FA 4BXXG 2FMAA 5T14A 3JZIA 1S0NA 4MTDA 2C28A 1HNWH 2R6FA 2XC9A 2W9CB 5DGAA 3N41B 3KHLA 4IAJA 3RV3A 1S97A 2R7LA 4F4YA 2UVRA 3HOZG 3H4BA 2PVPA 4DUZH 1KJ8A 4LF6H 1L2ZA 3MFHA 3MWMA 2X0SA 1PK8A 1XDNA 4O3NA 5IYZF 1RYRA 1WSCA 1JKJB 2WB1A 3MR3A 2AGOA 2CKZB 3HKZE 3QFFA 3N44B 2FJZA 4YJ3F 4HYKA 2J6UA 2ASLA 2VPSA 2FP4B 4MAMA 1VKZA 4J9NA 4OX9H 4RUCA 5IP9G 3OSPA 2Q2UA 2R85A 4ECZA 1W96A 3HOUG 3I4NG 5CB4F 5KFWA 4GKKH 1KBLA 5FJ8G 2W6OA 4J9QA 1HNXH 3HOWG 4A3IG 3Q8PB 1AUXA 3RIZA 4RB2C 4RNNA 4ED6A 2FPPB 5BPHA 4EFEA 5L1JA 5IWAH 3PW7A 1JDBB 4DR7H 5KFYA 4A2BA 2R8GA 4B3MH 3HBLA 5D1PA 4DV6H 5K2MA 1ULZA 3H40A 4DL5A 1ZHQA 3Q8SB 2CW7A 1A9XA 2ATLA 2AGPA 2C2RA 2WAQA 4UCOA 4JUZA 5KG4A 5DQGA 1K1SA 3CQZA 5JVLA 3L2PA 2CQYA 4F4WA 1R9TA 4Y8VB 3PW4A 3JSNA 3MR6A 1CQIB 5DQIA 4J9RA 2V59A 2WB1E 2Q2TA 4GC6A 1IBLH 2DPJA 4MV9A 5DQHA 1Y1WG 5D8DA 3MR2A 5KG5A 1CQJB 4GC7A 3FDSA 4RUAA 5JH7F 1KJIA 1HNZH 5FD6A 4KHPH 5L1IA 4F4XA 4YQWA 2W71A 2UUCH 4CC5A 1MZBA 3BAAA 3H0GA 3MR5A 4RZRA 2YCHA 4ME6A 4DR5H 4RZQA 2VQEH 2E2IA 2BQUA 4YP3A 3T5HA 4U7CA 3HOXG 4R7RA 4JI0H 5GONF 1Y1VA 5IP7G 2R8KA 1AUVA 5CA0F 2PMZA 3K5IA 1M0TA 3GILA 3GIIA 2Y0SE 3PN1A 2VUMG 5DLFA 4ECVA 1W93A 4ECXA 4I4TF 4JI5H 4UCUA 4ZHQF 3TIGA 5D1OB 4DL3A 4YR3A 4YR2A 3KAKA 4IRCA 4NLGA 5KT3A 4EFBA 3G6YA 2W6QA 3MWDA 3Q1KA 2NU9B 4DR1H 1PX2A 5KFOA 5DG8A 4J9MA 1CE8A 2WTFA 2SCUB 2FLNA 1M0WA 4J9OA 1RJRA 1RK6A 2YYAA 4APMA 3GTJA 4E4TA 4HQ6A 2VQFH 4TV8F 5BR8H 3RB6A 3PR4A 2B63A 2HVQA 4JV5H 3BG5A 1DIKA 3WNZA 3RGXA 5IYDG 4A3JG 4A3LG 2ZJTA 4J9LA 5LOVF 5I47A 4J9PA 2HHHH 3FKIG 1Z2PX 4QWEA 4EBDA 5EZYF 1ZQ7A 3HKZA 3IG0A 4JYAH 2UXCH 5EDWA 3GIMA 3TQ1A 2XIGA 2DWCA 2FKLA 3BABA 1N33H 2ZDHA 1A0IA 4G3IA 2PMZE 3ETHA 2ASJA 4RNMA 3G6XA 4FS1A 4TUYF 4XYLB 4B3RH 2BQ3A 3T5LA 3RB0A 4LF8H 5C1OA 5KFHA 5L1KA 4A3BG 4DV0H 3PW2A 3KHRA 4EYHB 4HNTA 4O4LF 1UC9A 3K3PA 5EWFA 3PW5A 3ORQA 2OH2A 4Q8EA 4HNVA 5LA6F 4QW9A 5KG0A 4YB8B 4JV0A 3L4JA 3T1HH 1IOVA 2JA5A 5LXTF 4M9UA 2AGQA 2YZGA 3WO0A 4A93G 2R7ZA 5KFVA 5C3EG 2CW8A 4UCVA 1O75A 4IWXA 2C22A 5KFMA 5KFPA 4DL7A 4DR2H 4LF5H 4EYIB 2ALZA 3T5JA 2FK1A 4R8UA 2YRXA 4ECYA 4HR7A 1T3NA 5HV6A 4LMYA 1I7LA 4C5AA 3RAXA 2R92A 2W7PA 2C35B 3R23A 4ZQIA 3RJ0A 2NU6B 1M7JA 3OUUA 5C44G 2R84A 1BGWA 3VPDA 2BQRA 4YR0A 5CA1F 3R5FA 3F8NA 2J6SA 2IP4A 4DL2A 4JI1H 3GTPA 5C4XG 2FPGB 4DUYH 4EBEA 4DR3H 3K3VA 2RF4A 1FVIA 2W8LA 4IR1A 5KFUA 1XNQH 2JA8G 1DGSA 1KJQA 4JI2H 3SI8A 5LMNH 3V4ZA 3UFXB 2W9BA 2UUAH 1E4GT 2JEIA 5KFZA 2WYOA 5IT9W 2Y0SA 4LFBH 4DV2H 5KFGA 2W6PA 4LH6A 3RV4A 2W7OA 4BBRG 4ZI7F 3LWBA 3ORRA 4LF7H 4LH7A 4QWCA 3KHHA 3M4IA 2WE6A 4QIWE 5KFKA 2CZGA 1GO3E 2MCTA 3H0GG 5H80A 4X65H 5KFDA 5DLGA 2J9GA 4C5CA 3C0FB 5KFIA 3CVZA 3M9OB 4ECTA 4FBTA 1ZHSA 4O3RA 5DGBA 2NUAB 4FM9A 3U9TA 4XX0B 3OHBA 4Q45A 4RAYA 3V6HA 2JA7G 4RB1A 3TQTA 4YHHH 4ED2A 3BQ0A 2RGVA 5BPFA 1S10A 4CC6A 3GIDA 3N6XA 1S0MA 1RYSA 4UCSA 4TQSA 1I6UA 4C2MA 4DV3H 4IHJF 2NVXA 1N56A 1E4FT 3GTGA 4TV9F 2BR0A 5F9LA 1B33N 2W6ZA 2R8HA 2OLSA 2JEJA 2ZDGA 1RJPA 4IZOA 5FPRA 4LSAA 1KC7A 5KG3A 1E4EA 5KFFA 1K83A 3I4MG 2PBZA 4LF9H 1IOWA 1TWHA 3T5KA 2B63G 3RUPA 3V6JA 4ED3A 3MJFA 2V4RA 2F4VH 5KG6A 4UCRA 3V6KA 2NU7B 2JA6A 2DLNA 4I50F 3RB3A 4O4IF 5KT5A 1JXLA 1SCUB 1GLVA 3OTOH 2C2DA 3TINA 2E2HA 3EPIA 2VA2A 1Z2NX 5KG7A 4GLXA 1WCMA 2R7MA 4RB3C 1K1QA 1Z2OX 2GPSA 4QWBA 3N40P 4WD3A 4Q44A 4JV2A 4I7HA 4ETSA 3LP8A 2NVYA 1KJJA 3PR5B 4IR9A 3DF7A 5KFSA 2I80A 2XD4A 4J0MA 2UUBH 2DPIA 3M9MB 3J7AK 2W57A 4ED1A 1TA8A 1TWAA 5FPOA 5FLXW 1BXRA 2ASDA 2RGRA 4MV6A 4ECQA 1Y14B 2UXBH 2KSWA 5DG7A 3PO3G 4UCTA 2XCPA 4ED8A 3BQ1A 2UVVA 3GTLA 2VR1A 3ETJA 3OSNA 3IN5A 5C1PA 2R86A 2PN1A 1C30A 3K5HA 5KT7A 2JA5G 4LF4H 1IBMH 2JEGA 2R7ZG 2W9CA 4A3DG 2FE3A 3VMMA 4WBNF 3RB4A 2AU0A 5C8YF 3GIJA 4YAJB 4DV4H 3QZ7A 3GQCA 2UU9H 3Q8QB 2YU9A 3T1YH 4A3CG 2GLTA 1GSHA 3JRWA 4UFZA 4RNOA 2R92G 1N34H 5KFQA 2I87A 5IYCG 2R93A 4IRDA 2AQ4A 4EBCA 1VBGA 2ZDQA 4O2BF 3HOYG 4YJ2F 4O2AF 5EOYA 1N32H 2V58A 3HB9A 4A2AA 3RBDA 1GYFA 4O3QA 3GIPA 2IA6A 1TWCA 4QIWA 2FPIB 2HGSA 1T94A 2GPWA 4BY7G 4JI4H 4LSXA 4BWSC 4O3OA 3I12A 2RDJA 4QW8A 4FS2A 2YS6A 1XNRH 2UVUA 5EWGA 1SFOA 4I55F 1J5EH 4M7EA 5HBRB 1I50A 3Q2OA 1GGOA 2VQDA 1IBKH 4BBSG 4Q43A 1JIHA 3GV7B 1BJTA 1EZ1A 5BMVF 2YZMA 2UVWA 1ZETA 4U6PA 1UNNC 4JI7H 3BA9A 5JUMA 1UC8A 5J2TF 4ZOLF 1X9NA 4MV8A 3RBEA 4NXMH 1EUCB 4DL4A 3U9SA 4JI8H 4X64H 3N8DA 4YBZB 1GSOA 3MFIA 2V9WA 2I8CA 4MV7A 1T36A 2IMWP 4ED0A 3Q8RB 4O3SA 5FLMG 2XCAA 4B3SH 2HJWA 5DG9A 1S9FA 5KKNB 3R5XA 3WO1A 4XYMB 4J9SA 2WDTA 1SEIA 2C00A 2XGPA 1S68A 2W9AA 4X66H 5KFLA 4Q0YA 3GIQA 5F9NA 4A3EG 3J81W 4NXNH 4X62H 4DV5H 3BJYA 5KFXA 4R8UB 1B6RA 2R87A 5CAEB 4IWYA 5KT6A 3PVXA 3RTXA 5KT2A 1Y1VG 5C5JA 4YY3H 1WH2A 2O03A 5KFNA 3J80W 4QWDA 1N36H 5KX5F 3G6VA 1VAJA 1EHIA 4MA5A 3UQ8A 4JV1A 3JRXA 3H20A 3OUZA 5D1OA 3E5NA 3JAMW 3JSLA 2YL2A 2FLPA 4LFAH 4EGQA 2JA6G 1V9PA 4AYBA 3AYHB 3M9NB 2ZM6H 3EPGA 4MV4A 2YZNA 2W6NA 2VA3A 1WCMG 4EEYA 4EG0A 2R8JA 3KXYT 2DIKA 1XMOH 3GV5B 1I3QA 3L4KA 5KFBA 2W9BB 5KG1A 1OWTA 2FB9A 3SE7A 1JX4A 4LFCH 2YS7A 2HVRA 3PZPA 4PDBA 1M6VA 2W8KA 1V4YA 4PWQA 4RU9A 2RDIA 2JEFA 4DR6H 4DL6A 4GKJH 5L9XA 3KALA 4O3PA 2IBKA 4K0KH 4A3GG 2QK4A 1B04A 2E5LH 3H4DA 3V4SA 5LYJF 5KFEA 4F4ZA 1FJGH 4L1KA 4HNUA 1V51A 4A3MG 4QWAA 1CS0A 1VS0A 1I7NA 1RK5A 2VUGA 4JI3H 2R7NA 1KEEA 5A2QW 4A3KG 2YW2A 2JA7A 4MTEA 5J2UF 3GTOA 1Y1WA 1EUDB 2YRWA 3KHGA 3GV8B 3N43B 2FK3A 1EYZA 2FK2A 1RJQA 2V5AA 4C5BA 3MWEA 5IYBG 3OHAA 1XMQH 3RF2A 4AYBE 4J9KA 3FMAA 5JQWA 4ECRA 3KTMA 3N42B 1N48A 3H3VH 1DV1A 1S03G 2R93G 1WR2A 1BNCA 2WAQE 3VPCA 3HXLA 3LMLA 1C3OA 5KFTA 1B6SA 2M05A 3VPBA 4TQRA 4F50A 2W6MA 4MV1A 4ED7A 3TIIA 2UXDH 2VUMA 3HOVG 3KAJA 1FKAH 2HVSA 1E4EB 5JVDF 2VOBA 4QJFA 2R7KA 5LMUH 4IRKA 3R5HA 4ECSA 3QZ8A 1AN7A 3PW0A 3GTMA 4B3TH 4A3FG 4AQYH 4MV3A 2P0AA 1TWFA 4RAZA
chains in the Genus database with same CATH topology
3GLKA 4I4TF 5LP6F 4ZHQF 2NUAB 3RFCA 3TIGA 1DV2A 3U9TA 4XX0B 1GSAA 2R82A 3TQTA 1UC8A 5J2TF 4ZOLF 5BMVF 2W6QA 3MWDA 1VBHA 3Q1KA 4MV8A 2NU9B 1PX2A 4DLKA 1EUCB 5BPFA 1CE8A 2XCLA 3U9SA 3GIDA 3N8DA 4YBZB 1GSOA 2I8CA 2VPQA 2SCUB 1T36A 4IHJF 2YYAA 4MA0A 4E4TA 4HQ6A 2NU8B 4XZ3B 2DZDA 2HJWA 4TV8F 4TV9F 4YAKB 5KKNB 2W6ZA 3R5XA 4FU0A 3BG5A 2OLSA 1DIKA 3WO1A 4XYMB 3WNZA 2ZDGA 1JDEA 2C00A 4EGJA 4IZOA 4O4HF 5LOVF 1KJ9A 1JLLB 5I47A 1KC7A 1E4EA 3G8CA 2W70A 2PBZA 3JZIA 1IOWA 1B6RA 2R87A 5CAEB 5EZYF 2R6FA 4IWYA 3RUPA 3MJFA 2NU7B 2DLNA 4I50F 4O4IF 5KX5F 1SCUB 1GLVA 2DWCA 3TINA 3RV3A 2ZDHA 1EHIA 2R7LA 4MA5A 2R7MA 2PVPA 3JRXA 1KJ8A 2GPSA 3E5NA 3OUZA 3ETHA 2X0SA 4WD3A 2YL2A 1PK8A 4TUYF 4EGQA 4XYLB 5IYZF 1JKJB 3LP8A 1KJJA 5C1OA 4MV4A 2I80A 2XD4A 3QFFA 2YZNA 2W6NA 4YJ3F 4EG0A 4HNTA 4O4LF 1UC9A 2FP4B 3K3PA 4MAMA 1BXRA 2DIKA 3ORQA 4HNVA 4MV6A 5LA6F 1VKZA 4YB8B 1IOVA 5LXTF 2R85A 4M9UA 1W96A 2YZGA 3WO0A 5CB4F 1KBLA 2FB9A 2W6OA 3SE7A 2YS7A 2VR1A 3ETJA 4IWXA 1AUXA 1M6VA 5C1PA 2R86A 2FPPB 2PN1A 1C30A 3K5HA 5BPHA 2YRXA 1JDBB 4HR7A 3VMMA 4WBNF 2QK4A 5HV6A 1I7LA 4C5AA 3V4SA 5C8YF 5LYJF 3HBLA 4YAJB 3R23A 4L1KA 4ZQIA 4HNUA 2NU6B 5K2MA 1CS0A 1ULZA 3OUUA 1I7NA 2R84A 3VPDA 2R7NA 1KEEA 2GLTA 2YW2A 5CA1F 1A9XA 5J2UF 3R5FA 1EUDB 2YRWA 1GSHA 2IP4A 3JRWA 5JVLA 2CQYA 2I87A 4Y8VB 2FPGB 1EYZA 2V5AA 4C5BA 3MWEA 1VBGA 2ZDQA 1CQIB 4O2BF 2V59A 5JQWA 1KJQA 4YJ2F 4O2AF 2V58A 3HB9A 1DV1A 3V4ZA 5D8DA 1CQJB 3UFXB 1WR2A 1BNCA 5JH7F 3VPCA 1KJIA 2FPIB 2GPWA 1C3OA 2W71A 1B6SA 3VPBA 2W6PA 2W6MA 4MV1A 3RV4A 3TIIA 4ME6A 3I12A 2YS6A 4ZI7F 3LWBA 3ORRA 1E4EB 5GONF 5JVDF 2R7KA 3R5HA 4I55F 1AUVA 5CA0F 3K5IA 5HBRB 2CZGA 1GGOA 2VQDA 3Q2OA 5H80A 1W93A 4MV3A 2P0AA 2J9GA 4C5CA 1EZ1A 2YZMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLK A;  4I4T F;  5LP6 F;  4ZHQ F;  2NUA B;  3RFC A;  3TIG A;  1DV2 A;  3U9T A;  4XX0 B;  1GSA A;  2R82 A;  3TQT A;  1UC8 A;  5J2T F;  4ZOL F;  5BMV F;  2W6Q A;  3MWD A;  1VBH A;  3Q1K A;  4MV8 A;  2NU9 B;  1PX2 A;  4DLK A;  1EUC B;  5BPF A;  1CE8 A;  2XCL A;  3U9S A;  3GID A;  3N8D A;  4YBZ B;  1GSO A;  2I8C A;  2VPQ A;  2SCU B;  1T36 A;  4IHJ F;  2YYA A;  4MA0 A;  4E4T A;  4HQ6 A;  2NU8 B;  4XZ3 B;  2DZD A;  2HJW A;  4TV8 F;  4TV9 F;  4YAK B;  5KKN B;  2W6Z A;  3R5X A;  4FU0 A;  3BG5 A;  2OLS A;  1DIK A;  3WO1 A;  4XYM B;  3WNZ A;  2ZDG A;  1JDE A;  2C00 A;  4EGJ A;  4IZO A;  4O4H F;  5LOV F;  1KJ9 A;  1JLL B;  5I47 A;  1KC7 A;  1E4E A;  3G8C A;  2W70 A;  2PBZ A;  3JZI A;  1IOW A;  1B6R A;  2R87 A;  5CAE B;  5EZY F;  2R6F A;  4IWY A;  3RUP A;  3MJF A;  2NU7 B;  2DLN A;  4I50 F;  4O4I F;  5KX5 F;  1SCU B;  1GLV A;  2DWC A;  3TIN A;  3RV3 A;  2ZDH A;  1EHI A;  2R7L A;  4MA5 A;  2R7M A;  2PVP A;  3JRX A;  1KJ8 A;  2GPS A;  3E5N A;  3OUZ A;  3ETH A;  2X0S A;  4WD3 A;  2YL2 A;  1PK8 A;  4TUY F;  4EGQ A;  4XYL B;  5IYZ F;  1JKJ B;  3LP8 A;  1KJJ A;  5C1O A;  4MV4 A;  2I80 A;  2XD4 A;  3QFF A;  2YZN A;  2W6N A;  4YJ3 F;  4EG0 A;  4HNT A;  4O4L F;  1UC9 A;  2FP4 B;  3K3P A;  4MAM A;  1BXR A;  2DIK A;  3ORQ A;  4HNV A;  4MV6 A;  5LA6 F;  1VKZ A;  4YB8 B;  1IOV A;  5LXT F;  2R85 A;  4M9U A;  1W96 A;  2YZG A;  3WO0 A;  5CB4 F;  1KBL A;  2FB9 A;  2W6O A;  3SE7 A;  2YS7 A;  2VR1 A;  3ETJ A;  4IWX A;  1AUX A;  1M6V A;  5C1P A;  2R86 A;  2FPP B;  2PN1 A;  1C30 A;  3K5H A;  5BPH A;  2YRX A;  1JDB B;  4HR7 A;  3VMM A;  4WBN F;  2QK4 A;  5HV6 A;  1I7L A;  4C5A A;  3V4S A;  5C8Y F;  5LYJ F;  3HBL A;  4YAJ B;  3R23 A;  4L1K A;  4ZQI A;  4HNU A;  2NU6 B;  5K2M A;  1CS0 A;  1ULZ A;  3OUU A;  1I7N A;  2R84 A;  3VPD A;  2R7N A;  1KEE A;  2GLT A;  2YW2 A;  5CA1 F;  1A9X A;  5J2U F;  3R5F A;  1EUD B;  2YRW A;  1GSH A;  2IP4 A;  3JRW A;  5JVL A;  2CQY A;  2I87 A;  4Y8V B;  2FPG B;  1EYZ A;  2V5A A;  4C5B A;  3MWE A;  1VBG A;  2ZDQ A;  1CQI B;  4O2B F;  2V59 A;  5JQW A;  1KJQ A;  4YJ2 F;  4O2A F;  2V58 A;  3HB9 A;  1DV1 A;  3V4Z A;  5D8D A;  1CQJ B;  3UFX B;  1WR2 A;  1BNC A;  5JH7 F;  3VPC A;  1KJI A;  2FPI B;  2GPW A;  1C3O A;  2W71 A;  1B6S A;  3VPB A;  2W6P A;  2W6M A;  4MV1 A;  3RV4 A;  3TII A;  4ME6 A;  3I12 A;  2YS6 A;  4ZI7 F;  3LWB A;  3ORR A;  1E4E B;  5GON F;  5JVD F;  2R7K A;  3R5H A;  4I55 F;  1AUV A;  5CA0 F;  3K5I A;  5HBR B;  2CZG A;  1GGO A;  2VQD A;  3Q2O A;  5H80 A;  1W93 A;  4MV3 A;  2P0A A;  2J9G A;  4C5C A;  1EZ1 A;  2YZM A; 
#chains in the Genus database with same CATH topology
 3GLK A;  5LP6 F;  1P8L A;  2XGQ A;  1TWG A;  3RFC A;  1DV2 A;  5KFR A;  3GIK A;  2OWO A;  1GSA A;  2R82 A;  3PO2 G;  2J6T A;  5KT4 A;  4EEQ A;  1VBH A;  4DLK A;  1TAE A;  3RGZ A;  4ECU A;  2XCL A;  2FLL A;  5LL6 b;  1HR0 H;  4ECW A;  2VPQ A;  1I94 H;  4FBU A;  5FD5 A;  5L1L A;  4DV7 H;  4MA0 A;  4RB0 A;  3FKI A;  5KFJ A;  2NU8 B;  5EWE A;  4XZ3 B;  2DZD A;  4DR4 H;  4YAK B;  3RAQ A;  2QYZ A;  2V4Q A;  4FU0 A;  1S0O A;  3GTQ A;  3BA8 A;  3GTK A;  4DV1 H;  4BY1 G;  1JDE A;  4EGJ A;  4O4H F;  2R8I A;  5KG2 A;  3NGD A;  1KJ9 A;  1JLL B;  1SYX B;  3EYY A;  5KFC A;  3BQ2 A;  4JI6 H;  2C2E A;  3G8C A;  2W70 A;  5KFA A;  4Q8F A;  4BXX G;  2FMA A;  5T14 A;  3JZI A;  1S0N A;  4MTD A;  2C28 A;  1HNW H;  2R6F A;  2XC9 A;  2W9C B;  5DGA A;  3N41 B;  3KHL A;  4IAJ A;  3RV3 A;  1S97 A;  2R7L A;  4F4Y A;  2UVR A;  3HOZ G;  3H4B A;  2PVP A;  4DUZ H;  1KJ8 A;  4LF6 H;  1L2Z A;  3MFH A;  3MWM A;  2X0S A;  1PK8 A;  1XDN A;  4O3N A;  5IYZ F;  1RYR A;  1WSC A;  1JKJ B;  2WB1 A;  3MR3 A;  2AGO A;  2CKZ B;  3HKZ E;  3QFF A;  3N44 B;  2FJZ A;  4YJ3 F;  4HYK A;  2J6U A;  2ASL A;  2VPS A;  2FP4 B;  4MAM A;  1VKZ A;  4J9N A;  4OX9 H;  4RUC A;  5IP9 G;  3OSP A;  2Q2U A;  2R85 A;  4ECZ A;  1W96 A;  3HOU G;  3I4N G;  5CB4 F;  5KFW A;  4GKK H;  1KBL A;  5FJ8 G;  2W6O A;  4J9Q A;  1HNX H;  3HOW G;  4A3I G;  3Q8P B;  1AUX A;  3RIZ A;  4RB2 C;  4RNN A;  4ED6 A;  2FPP B;  5BPH A;  4EFE A;  5L1J A;  5IWA H;  3PW7 A;  1JDB B;  4DR7 H;  5KFY A;  4A2B A;  2R8G A;  4B3M H;  3HBL A;  5D1P A;  4DV6 H;  5K2M A;  1ULZ A;  3H40 A;  4DL5 A;  1ZHQ A;  3Q8S B;  2CW7 A;  1A9X A;  2ATL A;  2AGP A;  2C2R A;  2WAQ A;  4UCO A;  4JUZ A;  5KG4 A;  5DQG A;  1K1S A;  3CQZ A;  5JVL A;  3L2P A;  2CQY A;  4F4W A;  1R9T A;  4Y8V B;  3PW4 A;  3JSN A;  3MR6 A;  1CQI B;  5DQI A;  4J9R A;  2V59 A;  2WB1 E;  2Q2T A;  4GC6 A;  1IBL H;  2DPJ A;  4MV9 A;  5DQH A;  1Y1W G;  5D8D A;  3MR2 A;  5KG5 A;  1CQJ B;  4GC7 A;  3FDS A;  4RUA A;  5JH7 F;  1KJI A;  1HNZ H;  5FD6 A;  4KHP H;  5L1I A;  4F4X A;  4YQW A;  2W71 A;  2UUC H;  4CC5 A;  1MZB A;  3BAA A;  3H0G A;  3MR5 A;  4RZR A;  2YCH A;  4ME6 A;  4DR5 H;  4RZQ A;  2VQE H;  2E2I A;  2BQU A;  4YP3 A;  3T5H A;  4U7C A;  3HOX G;  4R7R A;  4JI0 H;  5GON F;  1Y1V A;  5IP7 G;  2R8K A;  1AUV A;  5CA0 F;  2PMZ A;  3K5I A;  1M0T A;  3GIL A;  3GII A;  2Y0S E;  3PN1 A;  2VUM G;  5DLF A;  4ECV A;  1W93 A;  4ECX A;  4I4T F;  4JI5 H;  4UCU A;  4ZHQ F;  3TIG A;  5D1O B;  4DL3 A;  4YR3 A;  4YR2 A;  3KAK A;  4IRC A;  4NLG A;  5KT3 A;  4EFB A;  3G6Y A;  2W6Q A;  3MWD A;  3Q1K A;  2NU9 B;  4DR1 H;  1PX2 A;  5KFO A;  5DG8 A;  4J9M A;  1CE8 A;  2WTF A;  2SCU B;  2FLN A;  1M0W A;  4J9O A;  1RJR A;  1RK6 A;  2YYA A;  4APM A;  3GTJ A;  4E4T A;  4HQ6 A;  2VQF H;  4TV8 F;  5BR8 H;  3RB6 A;  3PR4 A;  2B63 A;  2HVQ A;  4JV5 H;  3BG5 A;  1DIK A;  3WNZ A;  3RGX A;  5IYD G;  4A3J G;  4A3L G;  2ZJT A;  4J9L A;  5LOV F;  5I47 A;  4J9P A;  2HHH H;  3FKI G;  1Z2P X;  4QWE A;  4EBD A;  5EZY F;  1ZQ7 A;  3HKZ A;  3IG0 A;  4JYA H;  2UXC H;  5EDW A;  3GIM A;  3TQ1 A;  2XIG A;  2DWC A;  2FKL A;  3BAB A;  1N33 H;  2ZDH A;  1A0I A;  4G3I A;  2PMZ E;  3ETH A;  2ASJ A;  4RNM A;  3G6X A;  4FS1 A;  4TUY F;  4XYL B;  4B3R H;  2BQ3 A;  3T5L A;  3RB0 A;  4LF8 H;  5C1O A;  5KFH A;  5L1K A;  4A3B G;  4DV0 H;  3PW2 A;  3KHR A;  4EYH B;  4HNT A;  4O4L F;  1UC9 A;  3K3P A;  5EWF A;  3PW5 A;  3ORQ A;  2OH2 A;  4Q8E A;  4HNV A;  5LA6 F;  4QW9 A;  5KG0 A;  4YB8 B;  4JV0 A;  3L4J A;  3T1H H;  1IOV A;  2JA5 A;  5LXT F;  4M9U A;  2AGQ A;  2YZG A;  3WO0 A;  4A93 G;  2R7Z A;  5KFV A;  5C3E G;  2CW8 A;  4UCV A;  1O75 A;  4IWX A;  2C22 A;  5KFM A;  5KFP A;  4DL7 A;  4DR2 H;  4LF5 H;  4EYI B;  2ALZ A;  3T5J A;  2FK1 A;  4R8U A;  2YRX A;  4ECY A;  4HR7 A;  1T3N A;  5HV6 A;  4LMY A;  1I7L A;  4C5A A;  3RAX A;  2R92 A;  2W7P A;  2C35 B;  3R23 A;  4ZQI A;  3RJ0 A;  2NU6 B;  1M7J A;  3OUU A;  5C44 G;  2R84 A;  1BGW A;  3VPD A;  2BQR A;  4YR0 A;  5CA1 F;  3R5F A;  3F8N A;  2J6S A;  2IP4 A;  4DL2 A;  4JI1 H;  3GTP A;  5C4X G;  2FPG B;  4DUY H;  4EBE A;  4DR3 H;  3K3V A;  2RF4 A;  1FVI A;  2W8L A;  4IR1 A;  5KFU A;  1XNQ H;  2JA8 G;  1DGS A;  1KJQ A;  4JI2 H;  3SI8 A;  5LMN H;  3V4Z A;  3UFX B;  2W9B A;  2UUA H;  1E4G T;  2JEI A;  5KFZ A;  2WYO A;  5IT9 W;  2Y0S A;  4LFB H;  4DV2 H;  5KFG A;  2W6P A;  4LH6 A;  3RV4 A;  2W7O A;  4BBR G;  4ZI7 F;  3LWB A;  3ORR A;  4LF7 H;  4LH7 A;  4QWC A;  3KHH A;  3M4I A;  2WE6 A;  4QIW E;  5KFK A;  2CZG A;  1GO3 E;  2MCT A;  3H0G G;  5H80 A;  4X65 H;  5KFD A;  5DLG A;  2J9G A;  4C5C A;  3C0F B;  5KFI A;  3CVZ A;  3M9O B;  4ECT A;  4FBT A;  1ZHS A;  4O3R A;  5DGB A;  2NUA B;  4FM9 A;  3U9T A;  4XX0 B;  3OHB A;  4Q45 A;  4RAY A;  3V6H A;  2JA7 G;  4RB1 A;  3TQT A;  4YHH H;  4ED2 A;  3BQ0 A;  2RGV A;  5BPF A;  1S10 A;  4CC6 A;  3GID A;  3N6X A;  1S0M A;  1RYS A;  4UCS A;  4TQS A;  1I6U A;  4C2M A;  4DV3 H;  4IHJ F;  2NVX A;  1N56 A;  1E4F T;  3GTG A;  4TV9 F;  2BR0 A;  5F9L A;  1B33 N;  2W6Z A;  2R8H A;  2OLS A;  2JEJ A;  2ZDG A;  1RJP A;  4IZO A;  5FPR A;  4LSA A;  1KC7 A;  5KG3 A;  1E4E A;  5KFF A;  1K83 A;  3I4M G;  2PBZ A;  4LF9 H;  1IOW A;  1TWH A;  3T5K A;  2B63 G;  3RUP A;  3V6J A;  4ED3 A;  3MJF A;  2V4R A;  2F4V H;  5KG6 A;  4UCR A;  3V6K A;  2NU7 B;  2JA6 A;  2DLN A;  4I50 F;  3RB3 A;  4O4I F;  5KT5 A;  1JXL A;  1SCU B;  1GLV A;  3OTO H;  2C2D A;  3TIN A;  2E2H A;  3EPI A;  2VA2 A;  1Z2N X;  5KG7 A;  4GLX A;  1WCM A;  2R7M A;  4RB3 C;  1K1Q A;  1Z2O X;  2GPS A;  4QWB A;  3N40 P;  4WD3 A;  4Q44 A;  4JV2 A;  4I7H A;  4ETS A;  3LP8 A;  2NVY A;  1KJJ A;  3PR5 B;  4IR9 A;  3DF7 A;  5KFS A;  2I80 A;  2XD4 A;  4J0M A;  2UUB H;  2DPI A;  3M9M B;  3J7A K;  2W57 A;  4ED1 A;  1TA8 A;  1TWA A;  5FPO A;  5FLX W;  1BXR A;  2ASD A;  2RGR A;  4MV6 A;  4ECQ A;  1Y14 B;  2UXB H;  2KSW A;  5DG7 A;  3PO3 G;  4UCT A;  2XCP A;  4ED8 A;  3BQ1 A;  2UVV A;  3GTL A;  2VR1 A;  3ETJ A;  3OSN A;  3IN5 A;  5C1P A;  2R86 A;  2PN1 A;  1C30 A;  3K5H A;  5KT7 A;  2JA5 G;  4LF4 H;  1IBM H;  2JEG A;  2R7Z G;  2W9C A;  4A3D G;  2FE3 A;  3VMM A;  4WBN F;  3RB4 A;  2AU0 A;  5C8Y F;  3GIJ A;  4YAJ B;  4DV4 H;  3QZ7 A;  3GQC A;  2UU9 H;  3Q8Q B;  2YU9 A;  3T1Y H;  4A3C G;  2GLT A;  1GSH A;  3JRW A;  4UFZ A;  4RNO A;  2R92 G;  1N34 H;  5KFQ A;  2I87 A;  5IYC G;  2R93 A;  4IRD A;  2AQ4 A;  4EBC A;  1VBG A;  2ZDQ A;  4O2B F;  3HOY G;  4YJ2 F;  4O2A F;  5EOY A;  1N32 H;  2V58 A;  3HB9 A;  4A2A A;  3RBD A;  1GYF A;  4O3Q A;  3GIP A;  2IA6 A;  1TWC A;  4QIW A;  2FPI B;  2HGS A;  1T94 A;  2GPW A;  4BY7 G;  4JI4 H;  4LSX A;  4BWS C;  4O3O A;  3I12 A;  2RDJ A;  4QW8 A;  4FS2 A;  2YS6 A;  1XNR H;  2UVU A;  5EWG A;  1SFO A;  4I55 F;  1J5E H;  4M7E A;  5HBR B;  1I50 A;  3Q2O A;  1GGO A;  2VQD A;  1IBK H;  4BBS G;  4Q43 A;  1JIH A;  3GV7 B;  1BJT A;  1EZ1 A;  5BMV F;  2YZM A;  2UVW A;  1ZET A;  4U6P A;  1UNN C;  4JI7 H;  3BA9 A;  5JUM A;  1UC8 A;  5J2T F;  4ZOL F;  1X9N A;  4MV8 A;  3RBE A;  4NXM H;  1EUC B;  4DL4 A;  3U9S A;  4JI8 H;  4X64 H;  3N8D A;  4YBZ B;  1GSO A;  3MFI A;  2V9W A;  2I8C A;  4MV7 A;  1T36 A;  2IMW P;  4ED0 A;  3Q8R B;  4O3S A;  5FLM G;  2XCA A;  4B3S H;  2HJW A;  5DG9 A;  1S9F A;  5KKN B;  3R5X A;  3WO1 A;  4XYM B;  4J9S A;  2WDT A;  1SEI A;  2C00 A;  2XGP A;  1S68 A;  2W9A A;  4X66 H;  5KFL A;  4Q0Y A;  3GIQ A;  5F9N A;  4A3E G;  3J81 W;  4NXN H;  4X62 H;  4DV5 H;  3BJY A;  5KFX A;  4R8U B;  1B6R A;  2R87 A;  5CAE B;  4IWY A;  5KT6 A;  3PVX A;  3RTX A;  5KT2 A;  1Y1V G;  5C5J A;  4YY3 H;  1WH2 A;  2O03 A;  5KFN A;  3J80 W;  4QWD A;  1N36 H;  5KX5 F;  3G6V A;  1VAJ A;  1EHI A;  4MA5 A;  3UQ8 A;  4JV1 A;  3JRX A;  3H20 A;  3OUZ A;  5D1O A;  3E5N A;  3JAM W;  3JSL A;  2YL2 A;  2FLP A;  4LFA H;  4EGQ A;  2JA6 G;  1V9P A;  4AYB A;  3AYH B;  3M9N B;  2ZM6 H;  3EPG A;  4MV4 A;  2YZN A;  2W6N A;  2VA3 A;  1WCM G;  4EEY A;  4EG0 A;  2R8J A;  3KXY T;  2DIK A;  1XMO H;  3GV5 B;  1I3Q A;  3L4K A;  5KFB A;  2W9B B;  5KG1 A;  1OWT A;  2FB9 A;  3SE7 A;  1JX4 A;  4LFC H;  2YS7 A;  2HVR A;  3PZP A;  4PDB A;  1M6V A;  2W8K A;  1V4Y A;  4PWQ A;  4RU9 A;  2RDI A;  2JEF A;  4DR6 H;  4DL6 A;  4GKJ H;  5L9X A;  3KAL A;  4O3P A;  2IBK A;  4K0K H;  4A3G G;  2QK4 A;  1B04 A;  2E5L H;  3H4D A;  3V4S A;  5LYJ F;  5KFE A;  4F4Z A;  1FJG H;  4L1K A;  4HNU A;  1V51 A;  4A3M G;  4QWA A;  1CS0 A;  1VS0 A;  1I7N A;  1RK5 A;  2VUG A;  4JI3 H;  2R7N A;  1KEE A;  5A2Q W;  4A3K G;  2YW2 A;  2JA7 A;  4MTE A;  5J2U F;  3GTO A;  1Y1W A;  1EUD B;  2YRW A;  3KHG A;  3GV8 B;  3N43 B;  2FK3 A;  1EYZ A;  2FK2 A;  1RJQ A;  2V5A A;  4C5B A;  3MWE A;  5IYB G;  3OHA A;  1XMQ H;  3RF2 A;  4AYB E;  4J9K A;  3FMA A;  5JQW A;  4ECR A;  3KTM A;  3N42 B;  1N48 A;  3H3V H;  1DV1 A;  1S03 G;  2R93 G;  1WR2 A;  1BNC A;  2WAQ E;  3VPC A;  3HXL A;  3LML A;  1C3O A;  5KFT A;  1B6S A;  2M05 A;  3VPB A;  4TQR A;  4F50 A;  2W6M A;  4MV1 A;  4ED7 A;  3TII A;  2UXD H;  2VUM A;  3HOV G;  3KAJ A;  1FKA H;  2HVS A;  1E4E B;  5JVD F;  2VOB A;  4QJF A;  2R7K A;  5LMU H;  4IRK A;  3R5H A;  4ECS A;  3QZ8 A;  1AN7 A;  3PW0 A;  3GTM A;  4B3T H;  4A3F G;  4AQY H;  4MV3 A;  2P0A A;  1TWF A;  4RAZ A; 
#chains in the Genus database with same CATH homology
 3GLK A;  4I4T F;  5LP6 F;  4ZHQ F;  2NUA B;  3RFC A;  3TIG A;  1DV2 A;  3U9T A;  4XX0 B;  1GSA A;  2R82 A;  3TQT A;  1UC8 A;  5J2T F;  4ZOL F;  5BMV F;  2W6Q A;  3MWD A;  1VBH A;  3Q1K A;  4MV8 A;  2NU9 B;  1PX2 A;  4DLK A;  1EUC B;  5BPF A;  1CE8 A;  2XCL A;  3U9S A;  3GID A;  3N8D A;  4YBZ B;  1GSO A;  2I8C A;  2VPQ A;  2SCU B;  1T36 A;  4IHJ F;  2YYA A;  4MA0 A;  4E4T A;  4HQ6 A;  2NU8 B;  4XZ3 B;  2DZD A;  2HJW A;  4TV8 F;  4TV9 F;  4YAK B;  5KKN B;  2W6Z A;  3R5X A;  4FU0 A;  3BG5 A;  2OLS A;  1DIK A;  3WO1 A;  4XYM B;  3WNZ A;  2ZDG A;  1JDE A;  2C00 A;  4EGJ A;  4IZO A;  4O4H F;  5LOV F;  1KJ9 A;  1JLL B;  5I47 A;  1KC7 A;  1E4E A;  3G8C A;  2W70 A;  2PBZ A;  3JZI A;  1IOW A;  1B6R A;  2R87 A;  5CAE B;  5EZY F;  2R6F A;  4IWY A;  3RUP A;  3MJF A;  2NU7 B;  2DLN A;  4I50 F;  4O4I F;  5KX5 F;  1SCU B;  1GLV A;  2DWC A;  3TIN A;  3RV3 A;  2ZDH A;  1EHI A;  2R7L A;  4MA5 A;  2R7M A;  2PVP A;  3JRX A;  1KJ8 A;  2GPS A;  3E5N A;  3OUZ A;  3ETH A;  2X0S A;  4WD3 A;  2YL2 A;  1PK8 A;  4TUY F;  4EGQ A;  4XYL B;  5IYZ F;  1JKJ B;  3LP8 A;  1KJJ A;  5C1O A;  4MV4 A;  2I80 A;  2XD4 A;  3QFF A;  2YZN A;  2W6N A;  4YJ3 F;  4EG0 A;  4HNT A;  4O4L F;  1UC9 A;  2FP4 B;  3K3P A;  4MAM A;  1BXR A;  2DIK A;  3ORQ A;  4HNV A;  4MV6 A;  5LA6 F;  1VKZ A;  4YB8 B;  1IOV A;  5LXT F;  2R85 A;  4M9U A;  1W96 A;  2YZG A;  3WO0 A;  5CB4 F;  1KBL A;  2FB9 A;  2W6O A;  3SE7 A;  2YS7 A;  2VR1 A;  3ETJ A;  4IWX A;  1AUX A;  1M6V A;  5C1P A;  2R86 A;  2FPP B;  2PN1 A;  1C30 A;  3K5H A;  5BPH A;  2YRX A;  1JDB B;  4HR7 A;  3VMM A;  4WBN F;  2QK4 A;  5HV6 A;  1I7L A;  4C5A A;  3V4S A;  5C8Y F;  5LYJ F;  3HBL A;  4YAJ B;  3R23 A;  4L1K A;  4ZQI A;  4HNU A;  2NU6 B;  5K2M A;  1CS0 A;  1ULZ A;  3OUU A;  1I7N A;  2R84 A;  3VPD A;  2R7N A;  1KEE A;  2GLT A;  2YW2 A;  5CA1 F;  1A9X A;  5J2U F;  3R5F A;  1EUD B;  2YRW A;  1GSH A;  2IP4 A;  3JRW A;  5JVL A;  2CQY A;  2I87 A;  4Y8V B;  2FPG B;  1EYZ A;  2V5A A;  4C5B A;  3MWE A;  1VBG A;  2ZDQ A;  1CQI B;  4O2B F;  2V59 A;  5JQW A;  1KJQ A;  4YJ2 F;  4O2A F;  2V58 A;  3HB9 A;  1DV1 A;  3V4Z A;  5D8D A;  1CQJ B;  3UFX B;  1WR2 A;  1BNC A;  5JH7 F;  3VPC A;  1KJI A;  2FPI B;  2GPW A;  1C3O A;  2W71 A;  1B6S A;  3VPB A;  2W6P A;  2W6M A;  4MV1 A;  3RV4 A;  3TII A;  4ME6 A;  3I12 A;  2YS6 A;  4ZI7 F;  3LWB A;  3ORR A;  1E4E B;  5GON F;  5JVD F;  2R7K A;  3R5H A;  4I55 F;  1AUV A;  5CA0 F;  3K5I A;  5HBR B;  2CZG A;  1GGO A;  2VQD A;  3Q2O A;  5H80 A;  1W93 A;  4MV3 A;  2P0A A;  2J9G A;  4C5C A;  1EZ1 A;  2YZM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...