2B63G

Complete rna polymerase ii-rna inhibitor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase/rna
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b63G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2b63G01
3CCSA 4MNOA 1GO3E 5GAGC 4B3SQ 1Z47A 4HIOA 1YNXA 4KHPQ 1IBML 2PI2A 3KJOA 3KF8B 2R7FA 4GN5A 1OXTA 4JI6Q 2R92G 4L5RC 2HQLA 1IXRA 1C9OA 1OXUA 3TEHB 2K75A 4PZ6A 3PCOB 1EQQA 1HR0W 4JYAL 3CAMA 1S72A 4DR7L 3T1YQ 1EIYB 4O0AA 1RL2A 4DPGA 3H0GG 3I4MG 2K4KA 2Y0SG 3A5ZB 4MTNA 2JA6G 1GVPA 2LSSA 1PH1A 4IPHA 1VQKA 2ZJQA 1X6OA 3TS2A 2UXBL 3H15A 5M3FH 3CXCA 1G51A 1J6QA 5C0XJ 1IYJB 4K0KQ 1TXYA 2F4VL 1N34L 1N36L 2JJQA 5JEAJ 2UUCL 2K52A 3CC4A 1CUKA 3I2ZA 1X54A 3GTGH 5FLXc 1X9NA 3PUVA 2IX1A 1NMGA 2D0OA 3GTKH 1IBKL 2HT1A 1VQBA 2KENA 2KBNA 1MJCA 4QQBX 1PH9A 4UP9A 4DUYQ 2ZTDA 2JE6I 4P72A 5IYBH 2FXQA 1K9MC 4DAYB 2D0PA 2UXDQ 1HZ9A 1YHBA 4A93H 3IRBA 4QJFA 3M85A 1K83H 4R4CA 3CCUA 4A3DG 1SMXA 4GKJQ 4PZ7A 1HR0L 1PYBA 3MXNB 3G6EA 2VQFL 1Q8KA 4DV6Q 1EWIA 4LUZA 4JI8Q 3U4ZA 3S1RH 3KFUA 1DGSA 3KF6A 4YWLA 3RLNA 4LF7L 2IY5B 1TWGH 2CWPA 2Y0SE 4DV2Q 1VQLA 3TREA 4B3SL 4A3KG 4KHPL 1JT8A 1YBYA 5IP9H 1AE3A 4A3EG 4LF5Q 4JI6L 1NY4A 3CCLA 1PH5A 4QGUA 1PHJA 5IYDG 3CMEA 3KYHC 3HKZG 1VQDA 2LXJA 3U50C 1RIPA 4FDBA 3TQYA 3DLLA 4DUZQ 4YHHQ 3T1YL 2RHSB 3ZJYC 1SN8A 4A3GG 4NXNQ 4C3IH 1N9WA 3F2CA 2IT1A 1EFWA 3GTJH 4DV5Q 3PO3H 1YJNA 3HOVG 2R93H 2E2JH 3HOWG 4K0KL 1J5EL 2RCNA 5C4JH 1SRUA 3AEVA 1NJIC 4GN4B 1VQ9A 3PIPA 4JI5Q 3AFQA 2B63H 4A75A 2CQOA 1EYGA 2UXCL 2D62A 2JEBI 3KF6B 2A1AA 5JJKA 2AHOB 4JOIA 4POFA 1C0AA 1IZ6A 1HZBA 1GKHA 2A19A 5H1SE 5FLMG 5FJ8G 3PF4A 3E9HA 4DUYL 4A3MG 2AWNA 3TRZA 2UXDL 4JCVE 1QVFA 1PH4A 5C3EG 1QVCA 3E0EA 5DLQE 4JC0A 4A3IG 4JBKA 1ASYA 3CW2C 3HKZE 1Y1WH 2F3IA 4GKJL 2VQEL 1SROA 1L2FA 1VQ4A 4DV6L 3K8AA 4JI8L 1KXLA 2F4VQ 1N34Q 2UUCQ 3CP0A 1XPOA 1CKNA 1V43A 1JJCB 2JQOA 4BBRH 1Y1VG 4DV2L 1YVCA 5E7NA 2WAQG 1MKHA 3J80i 2JA9A 1HJPA 4YWKA 1YEZA 3FP9A 3NBHB 3K80C 1SE8A 5J3BA 4LFAQ 1EIFA 1M90C 3CCJA 4LF5L 1G6PA 1A63A 1FGUA 1VQGA 4LFCQ 2LXKA 1VQ6A 1SLJA 3M4PA 1L0WA 5LMNL 4A3FG 4A3LH 1MIUA 1WYDA 5C0XG 1Q82C 3Q8DA 1KL9A 4DUZL 5JEAG 4YHHL 3GDEA 4NXNL 1PH2A 1HNXQ 4JI2Q 3NELA 4QL5A 3F1ZA 3W1BA 3HOYG 5IP7G 4DV5L 1IBLQ 1Z9FA 3KJPA 4AYBG 1VQOA 1K8GA 4OX9Q 3JAMi 4BA2I 1PVOA 2NZHA 3G4SA 1K3RA 1HH2P 3RN2A 3J80c 4UP8A 4BXXG 2R92H 1QZGA 1W2BA 4AH6A 2ZJPA 4JI0Q 1WJJA 4JI5L 1E1OA 2Q2UA 1E1TA 1QVGA 2HHHL 2N49A 3OW2A 3S2HH 4KI0A 2AKWB 1NBWA 5C0XI 5GAHC 4DR3Q 3RN5A 1CKNB 4X66Q 4GLXA 2WAQE 1X3FA 1VQCA 2F52A 3BZKA 4JBWA 5ELOA 1I50H 1UE5A 3A5UA 2JA6H 1EUJA 1A62A 4GNXC 2QA4A 3RZDH 1HNWQ 3RNUA 2VL6A 4OWWB 3S14H 3S17H 1S40A 4LF8L 4BY7G 3JAMc 2Q2IA 3J7ZC 4GOPC 1VQMA 1VQHA 4JI1Q 1VQIA 2JA8G 1WI5A 2MQHA 3CC7A 2XGTA 1J5EQ 2K50A 4UP7A 3F2BA 5M3MG 4B3TQ 3ICEA 1JE5A 3K81C 1N32Q 3PUWA 1Q7YC 1NMFA 1YZ6A 4C3HH 4DR4L 1LM0A 4AYBE 4LFAL 2UXCQ 4APVA 4JI3Q 2B3GA 3TS0A 2GVBA 3KLWA 4TQUS 2MNAA 4ALPA 1Q46A 2EQSA 4P73A 4LFCL 1VQPA 4GNXA 4DR5Q 1UEBA 2PNHA 3HKSA 5M5XH 3EBEA 3GTLH 4YWMA 4A3DH 3S24A 3PSIA 1X56A 4RMFA 1FL0A 1UE1A 4GKKQ 1YJWA 2MFIA 1LYLA 2CFMA 4GOPA 1XNQQ 3HOZG 2I5LX 1HNXL 2H5XA 2K5NA 3ULLA 2N78A 2VQEQ 4HJ9A 4GLVB 1YJ9A 4JI2L 2ATWA 5JJLA 1IBLL 3PO2H 4A3CG 2UUBQ 1WOCA 3M4QA 4DK6C 4A3KH 1I94Q 4OX9L 1XJVA 3RZOH 3HOUH 3M4OH 1VCIA 3S1QH 3OYYA 1EOVA 2K5VA 4JI0L 2MO1A 2BA1A 1Q1EA 5IYDH 3PUXA 2YV5A 1IL2A 1KC8C 4HIMA 2NVQH 5LMUL 2ZTEA 4DR3L 1PA6A 4X66L 2ZM6L 1N33Q 3AFPA 1NE3A 5LMNQ 3I4MH 4A93G 1CKOA 1X3EA 4JI4Q 3KDFA 3CMAA 5C44G 3I55A 3HOVH 1HNWL 4BY1H 4OO1G 3ERSX 3HOWH 2AWOA 2CWAA 1QUQA 3HFZB 4GNXB 2R6GA 5ELNA 1KIXA 4A76A 4GS3A 2OCEA 1HZCA 3FKIG 4JI1L 1PH3A 3G48A 1W3SA 3BJUA 3RLOA 4HJ5A 2IX0A 4B3TL 4Y52H 4GOPB 1N32L 4DV7L 4A3JG 1TWHH 3U4VA 1PH6A 5FLMH 5LMNW 5FJ8H 2HHHQ 3GTMH 3U58A 4JI3L 3GTQH 1A0IA 4A3MH 2A8VA 4OXPA 2E5LQ 1PFSA 4EX5A 1VS0A 4IFDJ 4DV0Q 4OO1I 1XPUA 5C3EH 2RHQB 2WB1G 4DR5L 2EXDA 2HIVA 3CF5A 4A3IH 3EIVA 3A74A 1OXXK 3STBD 1YITA 3D0FA 4YCVA 3UDXA 2NVXH 3H3VI 3I4NH 4GKKL 5GADC 4MZ9A 1XNQL 4LF8Q 4LW1A 4PG3A 3UDGA 4OWXB 3PGZA 1R9TH 4LNQA 4JG2A 1Y1VH 4LUOA 2PQAA 3CCRA 1HNZQ 4DR1Q 2BH2A 2UUBL 2VUMG 4BBSH 1I94L 3KDFB 5IY0A 2OQ0A 4UY8C 2KCTA 2PI2E 1VQ8A 4AQYL 4TVAB 4DR4Q 4YCUA 1QUQB 5IYCG 1PV4A 2R7ZG 4QIWE 1SR3A 4HIDA 1VQAA 4GN3B 1BBWA 4IPDA 2VY3A 3W1GA 5M5YH 4A3FH 2OTJA 1KAWA 4KLKA 2ID0A 2E2HH 1N33L 2GN5A 2UUAQ 1UE7A 2R7DA 3HOYH 4JI4L 4ME3A 2JK8A 3GO5A 5IP7H 2Z6KC 2JA7H 4L5TA 4IJHA 3AQQA 1JJGA 2YTYA 5BR8Q 2KCMA 2WB1E 2L15A 1OXVA 3VDYA 3EN2A 4BXXH 3LGJA 1BKBA 4R4QA 2Z0SA 3CC2A 4H02A 4YCWA 4DR2Q 3HOXG 4DR6Q 1EQRA 3KOJA 4DNIA 1WCMG 3M7NA 3PIOA 1ASZA 4XIGS 5AJ3Q 3K7UC 1B8AA 1TWAH 2PQAB 1V1QA 2BH8A 2IHFA 2KHJA 2QGQA 5LMUQ 2VNUD 4QY7A 5IE8A 2E8GA 2E5LL 2ZM6Q 2JA5G 4HIKA 4DV0L 1Q86C 4HJ7A 2N3SA 1X3GA 2Z6KA 2I5MX 1U5KA 3H0GH 2Q2TA 1VQ7A 4A4IA 2ES2A 4JBJA 4A3BG 4BY7H 3GTOH 1AE2A 3M9BA 3BU2A 3L7ZC 5C4XG 4R4TA 4YY3Q 1K0RA 4NPSA 2JA8H 3B6YA 3ULJA 1CKMA 4OWTB 2I5HA 4IOCA 5IWAQ 3NENA 5M3MH 4JI7Q 4JV5Q 2ALYB 2UU9Q 3PUYA 1P8LA 1S3OA 2MO0A 1CSQA 4HJ8A 1VQEA 4DR1L 1KRTA 1KD1C 2DGYA 1HNZL 3A0JA 2IHEA 2VZAA 4LF9Q 2CCZA 3CCMA 4DV7Q 4LFBL 1QZHA 4RG1A 3F2DA 3OTOL 2OQKA 4IPCA 3S16H 3RR5A 2VW9A 1BVSA 2WP8J 4IPGA 5GQOA 1PYSB 1UE6A 1K8AC 1E24A 4X62L 1X65A 4DV3Q 3SGIA 2UUAL 4PZ8A 1XNRQ 3J7A5 1TWCH 4AIMA 3HOZH 2C35B 4P74A 3CPFA 4R4IA 3PF5A 2ASBA 3ULPA 3AYHB 4A3CH 2JEAI 1OXSC 1Q12A 5BR8L 1Q81C 1P16A 4X65Q 5M3FG 4GLAC 2NN6G 3UE0A 2YTXA 1O7IA 2N8NA 3J81j 4DR2L 1K73C 4DR6L 4X64Q 3CQZH 4A3EH 2OTLA 3D31A 4AQYQ 2ZTCA 2KHIA 2EIFA 3WWVA 2QEXA 4IFDG 4O2DA 5AJ3L 5EAYA 1B70B 3S2DH 2ZJRA 3L0OA 3GTPH 3DM3A 3MEFA 3G71A 3PV0A 2VS1A 1JJ2A 3I4OA 2GVAA 5C44H 1KRSA 5IYBG 4A3GH 1Q1BA 1VQFA 3S1MH 1GD7A 1XMOQ 4DAMA 3F8TA 4LF6Q 3J81i 2NN6I 3JC66 3FKIH 4YY3L 4LF4Q 4DK3C 2NVTH 3H3VH 4IO9A 1YIJA 3S15H 5IWAL 4JI7L 4IFDI 2BA0A 4JV5L 4POGA 1TWFH 2UU9L 3PO2G 4A3JH 1OTCA 3HOUG 1FJGQ 4HJAA 4LF9L 5GROA 4KHZA 1KHIA 2DUDA 1L1OC 3CPWA 2HIXA 1A8VA 5IP9G 3CCQA 3T1HQ 4NXMQ 3UDIA 2E2IH 1D8LA 1NTGA 1MJEA 1XMQQ 4JOIC 4EQ5A 1BBUA 1E3PA 1G291 3E9IA 1V9PA 1VQ5A 4C3JH 1YI2A 3M3YH 4B3MQ 4B3RQ 2K14A 3J81c 4DV3L 1UWVA 4BA1I 1XNRL 2WFWA 2CKZB 1Y14B 1M1KC 5HY6A 2I0QA 4P71A 3L2PA 1VQJA 3PUZA 4DV4Q 1E7ZA 3S1NH 1PH8A 1I6HH 4DV1Q 1PH7A 3RLFA 4BY1G 2VUMH 3CCEA 2NZOA 5IT9c 1B7YB 3PO3G 3UE1A 4OONA 1E22A 4X65L 1XTDA 1XPRA 2R93G 3CD6A 2R7ZH 5IYCH 3BZCA 2YYZA 1LUZA 1IBMQ 4X6AH 4X64L 1L1OA 4LFBQ 5M5WH 4JBMA 4L5QA 4IOAA 1HZAA 3OTOQ 2OWOA 2B63G 1LTLA 3ER0A 1D7QA 4JYAQ 3NEMA 4R1JA 4DR7Q 4X62Q 3STBC 3CCVA 1AH9A 3K7AH 1JB7A 1N8RC 2B29A 3GD7A 1SFOH 1XMOL 2Q2HA 2UXBQ 1WFQA 3FHWA 4LF6L 3I4NG 2V1CC 4J15A 1X55A 4UPAA 5HGQA 1KQSA 1YHAA 3HOXH 4L5SA 1N36Q 4LF4L 2PMZE 1I5FA 1WCMH 1Y1WG 3I7FA 1T9HA 4XTCS 1C7YA 4R4OA 2YU9H 3UDFA 1VQNA 1H95A 5GAEC 2RF4A 4DKAC 4IJLA 4BBSG 2NVYH 1FVIA 4P75A 1FJGL 4BBRG 1IBKQ 4WJ4A 4NB3A 1I3QH 5K36G 2K5HA 1CSPA 4LWCA 4Y7NH 2YTVA 2JA5H 2AMCB 2XTIA 3W5OA 3T1HL 4NXML 1XMQL 4A3BH 1L1OB 1GM5A 4C2MH 5C4XH 4PMWA 3I56A 4B3ML 4B3RL 4A3LG 4WJ3M 1HR0Q 1JMCA 2VQFQ 1YHQA 3K0XA 4DV4L 1U0LA 2JA7G 4LUVA 4DV1L 4LF7Q 5JJIA
chains in the Genus database with same CATH superfamily
1O7ZA 4DR3H 1GO3E 3E3XA 1CM9A 4HIOA 2A74C 3WDNA 3KJOA 3KF8B 1V1OA 2HQLA 1DM0B 3GIDA 1B6RA 1SDFA 2AQ4A 4K6LA 1CT1D 3FKIA 4QF4A 1EQQA 3VPDA 4YJ3F 4TQSA 3CAMA 3LWEA 1YNNC 1S72A 1KNAA 3C0FB 4LJZC 1EIYB 2FMAA 1RL2A 3H0GG 4B3TH 2K4KA 1NR2A 2SEBD 2LSSA 4DV7H 2D2CC 3CXCA 1IYJB 5KKNB 1TXYA 4O4IF 1N34L 2JJQA 5JEAJ 2UUCL 3GV3A 3OMGA 3CC4A 2WKCA 3GTGH 2C5CA 2I07B 4N8X1 3PZPA 4IR9A 1ESRA 2IX1A 4DR5H 4EEYA 1BJTA 2PBZA 5D65A 3RIZA 3GTJA 4HCEA 4F8MA 3QZ7A 1II3A 4QQBX 4A93B 4DUYQ 5KFIA 2EDGA 1B53A 4P72A 3SHLA 1XTCD 4KY5A 4DAYB 2D0PA 1HZ9A 3IRBA 3QOLA 5COYA 2R7ZA 4J0MA 4A3DG 4OO1H 1DV2A 1CQIB 4PZ7A 3G6EA 3TZUA 2Z1CA 4JI8Q 4ED6A 2RDHA 4A2AA 3FDTA 2IY5B 3JRWA 2PQEA 2YRXA 4ILWA 2YW2A 2KECA 3IKJA 3X3NA 2JEFA 2VOBA 1YBYA 3PVXA 5FLXW 1H9SA 2R82A 1LT6D 1NY4A 4JI4H 4OL7A 1PHJA 3CMEA 5IYZF 1D5XC 1Y8PB 3M3YB 1WCMA 2B2UC 1DIKA 3CKIB 4FBUA 4CJ2C 1VMCA 3ZJYC 2XD4A 1I6HB 4RCNA 4DFAA 2JA5A 5C4JB 2E75C 3Q2OA 1J5EL 3VMMA 4ZHQF 3AEVA 2E5LH 1NJIC 5I47A 1JE4A 2R7KA 1H9KA 4JI5Q 4RNNA 5A35A 2CQOA 3I91A 1EYGA 1EQTA 1JQYD 2O4XA 2JEBI 2EJFC 5CC4A 2A1AA 2AHOB 3T5JA 1HZBA 1S97A 3PF4A 3E9HA 1WD0A 4DUYL 1WSCA 3M9NB 2IA6A 4JCVE 2DJFC 4DR1H 1Y1WB 2O03A 1QVCA 2C2RA 3PW4A 2F0TA 2F3IA 4U68A 3OWFA 2ZXRA 1L2FA 5KFHA 1CK1A 4QMGA 1BF4A 4JI8L 5T1GA 3ND8A 1WR2A 4KY6A 3VYRA 1Z2PX 5E3FA 2WAQG 1MKHA 2ZT9C 3FMAA 4Y7NB 2WIIB 2BQUA 3T51B 3BS1A 5JOBA 4LFCQ 4A3BB 2LXKA 4A3LH 3T13A 4A3FG 5C4XB 2FK2A 3GTGA 2X69A 5CAEB 4DR2H 3KUPA 4CC5A 3HP3A 4H0LC 3GDEA 5JVDF 4DR6H 2J0TD 2MHVA 3HOYG 3HB9A 3F1ZA 4ED2A 1Z9FA 4R8IA 4AYBG 1PVOA 4LSXA 3JAMi 1PK8A 3RB4A 1VF5C 1Q8IA 3GTLA 3RN2A 3J80c 2R92H 4ECXA 1HFGA 2ZJPA 4JI0Q 4EG0A 3DXJC 4JI5L 1SEBD 4K14A 1STEA 2P5ZX 4JV0A 3TP5A 5C0XI 4DR3Q 3RN5A 1W6JA 4C1NI 2K5WA 3Q6SA 4RWSC 2F52A 2O5IC 4O3SA 1S5CD 5KT4A 5JVG3 5EJWA 3S14B 5HBRB 4FS1A 1M6VA 5M3FB 1F2YA 1S40A 3NWSA 4LF8L 5E4XA 4BY7G 3J7ZC 1VQHA 3VYTA 2JA8G 4B3TQ 2PMZA 3Q8RB 5KG4A 2KEDA 4EFEA 4MV3A 1IL8A 4ECUA 1YZ6A 4DR4L 1ILQA 1W93A 2B3GA 3JZIA 1XNRH 1SNOA 4TQUS 3CRKC 4C56C 2MNAA 4A3DB 1A2TA 1Q46A 3ZYYX 4LFCL 5KT2A 2F0FA 4DR5Q 2PNHA 3HKSA 4KKUA 1D1IA 2F0WA 4YWMA 3S24A 1X56A 4RMFA 2OEOA 4XQQA 1UE1A 1HQRD 1F9SA 3G8CA 4KHVA 4X64H 3HOZG 1VDZA 2YCHA 3M4OB 2H5XA 2VQEQ 2ATWA 5KFUA 1QCBD 3TZDA 1PFNA 3PO2H 3MVVA 4DK6C 4A3KH 3RZOH 3E0JA 4ZUIA 4QUFA 3HOUH 3RUPA 3OYYA 2F3WA 2HDMA 5CORA 4RKLA 4BWSC 4JI0L 3K5OA 4FXKC 1EYZA 4J1MA 4TKOB 3T56B 3CVZA 3BA9A 1KTKA 4DR3L 2QILA 3OPOA 1PA6A 1JOOA 3KXYT 3J80L 2B2WC 3QO2A 1IKMA 1GYFA 2N55A 4C3IB 4JI4Q 4ME6A 4Q8FA 4CHTB 3NQIA 2XC9A 1RYRA 4BY1H 4ZRZA 4DNRB 4OO1G 2R93B 1PZKD 4U7CA 5IGBA 3PQIA 4GNXB 2EPBA 5ELNA 4A76A 4GS3A 4QW9A 4MHEA 2M05A 2OCEA 4I7HA 1PH3A 4HNUA 4OIKA 2IW3A 3BJYA 1W3SA 4B3TL 1TY2A 4GOPB 2DPJA 4DV7L 3GTQB 2W9CB 1TWHH 3U4VA 1PH6A 4B3MH 5IGEA 3PIO3 1EEFD 5LMNW 1O75A 5J39A 1A0IA 1PTOB 3R2IA 4Y8VB 2E5LQ 1XYIA 1AZPA 3T5HA 5C3EH 3J7AF 4DR5L 1EZ8A 4OEMB 2R92A 4A3IH 3EIVA 3A74A 1YITA 3FDSA 3OSNA 4YCVA 1TA8A 5GADC 1H9JA 4JV2A 4BBSB 1STHA 1Z2OX 4XT1B 2NUCA 2FB9A 4Q5VA 4DR1Q 4ZCKA 2QDBA 5IY0A 4UY8C 4JYAH 2KCTA 2PI2E 1E4GT 3Q23A 2KEEA 5K36H 3Q8SB 1QUQB 1BCPD 4LH7A 4A3FB 3D3RA 4HIDA 4IAJA 3U9SA 2ZXPA 2V59A 4KLKA 2ID0A 3HOYB 2SOBA 1GGOA 1RKNA 2JA7B 2TSSA 4RUAA 4JI4L 2JK8A 3GO5A 5IP7H 2EYPA 2HDLA 1E2ZA 3L3OC 3A7AB 4L5TA 1JJGA 1PZID 2YTYA 1IBKH 5KFOA 2SDFA 4DR2Q 4P2CB 4DR6Q 1CHQD 4DAVA 2W8LA 3H6MA 3R93A 4ZLTF 3ETJA 1B8AA 2PQAB 1HR0H 3I4LA 5LXTF 4QY7A 2V4DA 2R8JA 2E5LL 2UVVA 2JA6B 1ZXTA 4RB2C 3I4MH 4WD3A 2W9AA 2K6AA 2JA8B 1VQ7A 4B3SH 1AE2A 3S17B 3BU2A 1K0RA 4NPSA 3MWDA 5LA6F 1CKMA 1R4QB 2ASLA 3NENA 5M3MH 3KAJA 1EHIA 4ED0A 5EKIA 2ALYB 4J9LA 1S0NA 3PUYA 1P8LA 1CSQA 1TS3A 4DR1L 1CS0A 4Z9CB 3IN5A 2UVUA 5CV4A 4RG1A 3RR5A 4IPGA 4ZKCB 1PYSB 2NB0A 5M5XB 4R8UA 3HOZB 4CGYB 4R8NA 2GPWA 1XNRQ 1HRJA 3CPFA 4R4IA 1EZ1A 1RF2D 5KFQA 5J2TF 4N9TA 1SAPA 1P16A 3S1QB 3RAQA 4GLAC 2YYAA 3X3MA 2PO4A 4DR2L 1K73C 1Q3LA 3MFGA 3J81j 2B2TC 4X64Q 4DR6L 4A3EH 1VAJA 2UXDH 1SYGA 1S03G 2ZTCA 5KFMA 4O2DA 3GIJA 1B70B 2V4QA 3MEFA 4GKJH 3G71A 3J7AV 3QG1A 2LKVA 2VS1A 1JJ2A 4DV6H 1AP0A 1LO5D 3I4OA 4UCRA 1KRSA 5IYBG 2FMMA 4GC6A 3CHBD 4S3SA 5EPLA 1TS2A 1Y69U 3BVZA 3HOWB 3RJ0A 3WO0A 2NN6I 3BAAA 3H4DA 1UNNC 1TR5A 2D9UA 1QE6A 3BG5A 1NSNS 3JC66 2NVTH 1SEIA 4DK3C 4RAYA 5LL6b 1YIJA 5IGCA 1TWFH 3PO2G 2B2YC 3HOUG 3D6CA 3OIQA 3GTMB 2XVSA 5GROA 4ECQA 4KHZA 2E2IB 2DUDA 5IGDA 3DWAA 4A3MB 4RUCA 1DV1A 4YHHH 1UUPA 5IP9G 1F2LA 1JKJB 5F9NA 4J9QA 4C5AA 1E3PA 2ZDHA 2O5JC 4C3JH 5JH7F 1YI2A 3M3YH 4B3MQ 2NVXB 1XNRL 2CKZB 3J7AK 4F4WA 2A69C 1I3QA 1PH8A 1I6HH 2NU6B 1PRTD 1PH7A 1Y1VB 4BY1G 5FOBB 3CCEA 5IT9c 1SYBA 3AMUA 1Q90A 3UE1A 3GIMA 1XTDA 4O1NA 1TQOA 1KBLA 3BZCA 2QYZA 4MV7A 4Q0FA 4X64L 4ZYSA 4ZQ3A 4DL6A 2B63G 4YAJB 4G7OC 1SE2A 2ZDGA 1FGBD 4CDEC 4JYAQ 1TU2B 5DLGA 2YS6A 4WORA 1U4MA 4X62Q 1EUDB 3D4DA 5ELEA 5A2QE 1N8RC 1N34H 2UUCH 4M7EA 4EBCA 2B29A 2V1CC 3KF8A 4LFAH 1KLGD 2C2DA 1VMPA 1J8IA 4IZ8A 4XTCS 3NPPA 3OSOA 3V6KA 4KKTA 3DEPA 2NVYH 2VXWA 3MXPA 5EBCA 2QW7A 1CI3M 1ENCA 3SEBA 1IBKQ 4FF1A 3L9AX 3M7GA 1AUXA 1ONLA 5K36G 4Y7NH 3DWQA 1A9XA 2W9BB 1SSOA 1EL0A 2L11A 3A8JE 4JI2H 5FK9C 4A3BH 1L1OB 1JIHA 5LP6F 4KN7C 3G6JB 4OX9H 2XRQD 5C4XH 1PYWD 4PMWA 4B3ML 1SJHD 2MJ8A 1WTOA 1SMYC 1HR0Q 1B3AA 2R86A 3DHQA 1YHQA 2WYOA 4XZ3B 1U0LA 4UFZA 3M9OB 5LMUH 3MXGA 4MNOA 2Q8RE 3TDQA 4O2BF 4B3SQ 4X66H 2F0PA 3EQLC 4DAYA 3BDCA 1LLRD 4IUTA 5EDWA 2PI2A 5LOVF 2XGPA 3Q0AA 4GN5A 1G2SA 1WTHA 1C9OA 1OXUA 1G2TA 2FMCA 4O4HF 5IT9L 1LTBD 1STYA 4PZ6A 5BN4A 3T4AC 4JYAL 2A6HC 2OF1A 1TWCB 4F87A 3K59A 1J5EH 4O0AA 4J9NA 4DPGA 3I4MG 1UAPA 3A5ZB 2Y0SG 3BVGA 3NTIA 2BOSA 3TS2A 5M3FH 5KFKA 1KEEA 3N6RA 2JEIA 1WTXA 2F0OA 4IFDH 1PTOC 3TP8A 1GSOA 2VA2A 2A6EC 5I9PA 2WDTA 3GTKH 3FPPA 4ZK9B 1IBKL 2KBNA 2XIWA 1BCPB 1CTMA 2MGSA 1MJCA 2ICEC 4RHSA 1V51A 2WV6D 4PQXA 2UXDQ 1K83B 3HRZC 1YHBA 4QJFA 5IGFA 1I94H 4R4CA 4TSSA 2EZVA 4GKJQ 1HR0L 4QIWB 1E2VA 5GONF 4JVZA 3BQ1A 1Q8KA 4DV6Q 3U4ZA 2C2EA 1STAA 3S1RH 4YBZB 5KT3A 4YWLA 1QOHA 1WTVA 2O2LD 3NP8A 4B3SL 4XYQA 1MSHA 2XGQA 4A3EG 4MV6A 2PVPA 2AQ2B 4KV6A 2AUKA 5FO7B 2WB1B 3CCLA 5CB4F 1PH5A 1EY7A 3VR3A 5IYDG 2FPGB 1YNJC 2PYKA 2EOTA 1B44D 3HKZG 3U50C 1U4PA 4CBVA 1JCKB 5CBAE 4YHHQ 3S1NB 5FD6A 1SN8A 4N8FA 4C3IH 3MFIA 1N9WA 2IT1A 2VUMB 4RZRA 3GTJH 3PO3H 2F4IA 1U4LA 5C3XA 4WFN3 3HOVG 2R93H 2E2JH 3V6JA 4DL5A 3MZ5A 3AU7A 2RCNA 5BN3A 3NTKA 3E6ZX 4F4XA 4KY7A 3VPBA 3AFQA 3ORRA 4A75A 4EGQA 4B08A 4FF4A 3N6XA 3IFTA 5HGTA 3KF6B 2WACA 4POFA 3KLRA 1IZ6A 2A19A 3K3PA 3O13A 5FJ8G 1PTOH 3OMCA 2F03A 3TRZA 1ILPA 1EFID 4UCOA 1U4RA 3RGXA 2UXDL 3QOJA 4PMCA 4OELB 1SFOB 3CRLC 1S9FA 4JC0A 4GKJL 3U9OA 1ASYA 4ETSA 3GIIA 1VQ4A 4DV6L 3RB6A 1NAPA 3GQCA 1N34Q 3HGBA 2UUCQ 5LL6X 1CFMA 3CP0A 3TBIB 1B2TA 2JQOA 2RBMA 4BBRH 4F7XA 1CZWA 4IR1A 3J80i 2JA9A 4LFAQ 3NBHB 5ELBA 3K80C 1SE8A 2UUAH 1B6SA 2XN9C 4F4ZA 5C3WA 2F0LA 3V6HA 1A63A 4HQ6A 3RBEA 1VQGA 3RTXA 1W96A 3AB9A 5BR8H 3CU7A 1EUCB 2AGPA 1L0WA 5LMNL 1BDOA 1BR9A 1SYCA 1JORA 1KL9A 4R7RA 5JEAG 4YHHL 1SNPA 3A8KE 3R8BA 3GTKA 3MFHA 4JI2Q 3NELA 5EBDA 2W6PA 5LYJF 3KJPA 1K8GA 4OX9Q 5KFCA 2NZHA 1K3RA 5JQWA 4UP8A 4BXXG 1QZGA 3J81E 3R5HA 2IP4A 1BGWA 3BVMA 4TUYF 4H44C 5KT5A 4KMUC 1TIID 3SE7A 4FU0A 2OH2A 1VF7A 5GAHC 4LMYA 1CKNB 4OGQC 5DAUA 4X66Q 4QWDA 4JBWA 1T36A 5ELOA 1N48A 4MTKA 1K8OA 4F4YA 2JA6H 1EUJA 2PNRC 4YJ2F 5KFFA 2F1MA 2QA4A 3NHHA 3RF2A 3RNUA 4J9KA 2E74C 3S17H 2C22A 5DG8A 3F2UA 2VPQA 1SYDA 3A56A 1VQMA 1WI5A 4TRDA 2MQHA 1J5EQ 2XGTA 4RNOA 1UNSA 4UP7A 5D1OB 3N52A 5EKLA 3PUWA 1Q7YC 4YR2A 4C3HH 2A68D 4LFAL 3P75A 1RJPA 3TS0A 3KBGA 2RDFA 3KLWA 1RK5A 1RTOA 4ALPA 2F0DA 4MV8A 2R93A 4DL3A 1JWUD 1EIGA 5E1FA 2V9WA 4LH6A 1VQPA 4GNXA 3GTLH 1UEBA 1L2ZA 5M5XH 3D6WA 2L55A 2PW7A 1SNCA 1YJWA 3PR5B 5KG3A 1LYLA 1H9RA 2HQEA 4GOPA 3GTQA 3H40A 3LNNA 2W9CA 4K2LA 2K5NA 3I70A 3ULLA 4JI2L 4HJ9A 4GLVB 5JJLA 2CQYA 1TWGB 1MHWC 1U9RA 4A3CG 1A15A 3JAMW 1I94Q 4OX9L 1JB3A 2QF7A 3V96A 2K5QA 3S1QH 4EYHB 1I4XA 1ET6A 3KHRA 2K7VA 1EOVA 3NK9A 1JICA 4EBEA 4HSPA 4JPBW 2NU8B 5LMUL 3RV3A 2W6MA 4X66L 4LF4H 1NE3A 4HR7B 3HOVB 1X3EA 1D5ZC 5C44G 3I55A 1CQJB 1FJGH 3HOWH 2V5AA 1DZ1A 2CW7A 1F9RA 1QUQA 2CWAA 2R6GA 4DXFA 3FKIG 1EY5A 3H94A 1KJJA 3T1HH 4NXMH 3G48A 3BJUA 2BE5D 4QB4A 5FD5A 1WTPA 2JN4A 4A3JG 2JA7A 5FLMH 3BDOA 3TN2A 3GTMH 1G8ZD 3U58A 4A3MH 1D2BA 1IW7C 1AUVA 4FXGC 4OXPA 4DV4H 1PFSA 1BCPF 4A2BA 1MSGA 4IFDJ 4QUCA 1BNZA 4OO1I 4DLKA 2RHQB 3I4NB 5KFAA 5FLXE 3N43B 3CF5A 3TIIA 4QW8A 3STBD 1I6VC 3D0FA 2NVXH 2HVSA 1R9TB 2Z6BA 4LF8Q 2CW0D 1Y1VH 2SCUB 3N8DA 3R5XA 2PQAA 1ZYRC 3CCRA 4DN4M 1I94L 3KDFB 1RTNA 1VQ8A 5I4DA 2JA6A 1BXTA 2M00A 4AQYL 3MHBA 4DR4Q 4YCUA 1PV4A 2R7ZG 2RCFA 4QIWE 5KIXA 1VQAA 1GLVA 1M0TA 3W1GA 2OTJA 5M5YH 5J2UF 5C0XH 2F4VH 2GN5A 4MV9A 5A2QL 5KFWA 2UUAQ 4CKCA 5FKAC 3SK6A 2V58A 4IJHA 5BR8Q 2WB1E 2L15A 1OXVA 4TV8F 3EN2A 3LGJA 2DZDA 1D6EC 3CC2A 4PMBA 3HOXG 5CYUA 1EQRA 3KOJA 1BQQT 4DNIA 1WCMG 3NBIA 4FM9A 4LK1C 1HUNA 4TQRA 1C3OA 2F0NA 2VB2X 4M1UB 4X3UA 4RA8A 2XCLA 3K7UC 2KHJA 4KD4A 3KAKA 1QNKA 5IE8A 2E8GA 4QWCA 3H0GB 3G6XA 1I50B 1LT5D 2D5DA 3KLSX 4HEDA 2JA5G 4NKLA 2KJXA 3N42B 2N3SA 1CHPD 2F0KA 1U5KA 2AUJD 1YNND 4C1NK 4DAPA 1GUOA 3VR6A 1S5BD 1QILA 5D1PA 4OWTB 2B39A 2I5HA 4RHRA 1WTWA 1VQEA 4FF2A 1EEID 1TS5A 2IHEA 4O4LF 4DV7Q 4LFBL 5LL6S 3F2DA 3EJIA 3W3AA 2XWBB 2OQKA 1HXYD 4NW2A 5JVH3 1UE6A 3KTMA 5ISRA 4L63B 3DF7A 3PMFA 3Q1KA 3C3LA 2UUAL 1TWCH 4XT3B 4AIMA 3MTSA 5CV6A 4MIUA 4CKEA 1O7LA 3NWTA 3ULPA 3AYHB 2X6GA 2JEAI 3GTMA 1T5EA 2E2IA 5BR8L 1Q81C 4HMJA 3S2DB 4UCSA 3P7JA 2KHIA 2EIFA 3WWVA 3PIP3 1HHVA 4HTHA 5EAYA 2PPBC 2NVXA 3M4IA 3L0OA 3DM3A 1GHJA 3PV0A 1Y1VA 5CA1F 1EZ6A 2GVAA 4A3GH 1Q1BA 5EKKA 2F0GA 3S1MH 5EWGA 4QWEA 3GV6A 2YS7A 3VYSA 4Q44A 5D14A 2F0JA 1RJTA 3HEJA 4LF4Q 1M4VA 4I65A 4IO9A 4LF5H 3S15H 4FVMA 4POGA 1PRTF 1A6XA 1J9OA 2JP1A 1FNVA 3A8IE 1FJGQ 4ULLA 1DOMA 2EY5A 3LWUA 1A8VA 2K05A 3T1HQ 4NXMQ 1WVLA 2YRWA 4NXNH 1NTGA 1MJEA 4JOIC 3MWEA 2F0SA 2J9GA 1LTGD 1MI2A 1JX4A 1AEXA 1DOKA 3J81c 3HXLA 2WFWA 3BDLA 4ED8A 5DGBA 5HY6A 4I4TF 4DV4Q 3S1NH 1O7YA 3IG0A 5JVLA 5FPRA 2VUMH 2WAQB 1MBYA 2DNCA 1EU4A 3KLSA 4V0BA 5IYCH 5KFBA 2R3ZA 2OXPA 1L1OA 2NWGA 3EFXD 5KT7A 4JBMA 4L5QA 4IOAA 4DL7A 5I6WA 1SJED 5KG2A 1GUTA 1D7QA 3NEMA 2E2HB 2GA4B 4PDBA 1AH9A 3CCVA 4O3QA 1STNA 5KG1A 4WRDA 4ECVA 4AYBB 1SFOH 2PW5A 1PDQA 2XWJB 3T16A 1WCMB 1DOLA 4UPAA 1KQSA 1G6ZA 3E5NA 3GLKA 5F9LA 2YU9B 4L5SA 4LF4L 1HTPA 4QWAA 3I7FA 5LHY1 1C7YA 3I73A 4R4OA 1B33N 1PZJD 1FJGL 2NBFA 1TWCA 5I2XA 2JA5B 2FHTA 1TWAB 4WJ4A 1I3QH 1CSPA 4LWCA 1KNEA 2FP4B 1EYCA 2XTIA 3T1HL 4RGNA 4NXML 4C2MB 2KUMA 2IMWP 5KNBA 5DM63 4YQWA 2CVRA 3EVQA 2YL2A 4BY7B 1JDBB 3K6OA 1DJRD 4A3LG 4WJ3M 2RA4A 3C1FA 3OHXC 3K0XA 4RGOS 4DV4L 4JUZA 5L1IA 4LUVA 1BOSA 3TP6A 5JJIA 3SR1A 3CCSA 2YZGA 4KD3A 4ZAIA 5J22A 4RFBA 3RMHA 3J81L 2DN8A 4CDFC 1K83A 3FMCA 2R7FA 2R92G 2ENBA 3KK7A 3S16B 4L5RC 2AU0A 4XXEA 5JUMA 1S0MA 2F0MA 3TEHB 4QIWA 3TQTA 3PCOB 1C48A 1I4HA 3P1HA 4IALA 4EEQA 4IZOA 4JI1H 1SE4A 1HFNA 5G3LD 1N32H 1PH1A 1VQKA 1HA5A 4IPHA 2ZJQA 3H15A 4ME5A 5IOCA 4I7AA 5C0XJ 2F4VL 1QB5D 4G4KA 2WB1A 2K52A 5CV5A 3CQZB 1X54A 3I2ZA 4IRDA 3A54A 5FLXc 1I4GA 1NMGA 4MAMA 4C5BA 2D0OA 2F0HA 1QG7A 2HT1A 4Q0YA 1VQBA 3GV5B 1CA5A 4GKKH 1LT4D 1HPCA 3FPUB 3L4JA 2VUMA 2JE6I 2ZTDA 4H13C 2FXQA 1K9MC 2L5TA 4A93H 5K2MA 3M85A 2A73B 2DLNA 4OHJA 3K5HA 2ATLA 3MXNB 2R7NA 2IPKD 4LUZA 2PZWA 3KF6A 4K5XA 1O80A 3RLNA 5KFVA 1TWGH 1D1KA 4Q45A 1VQLA 4EQOA 1PFMA 3I3CA 4A3KG 1R4PB 1N33H 3IAYA 1JT8A 5LMNH 3H4BA 4LF5Q 1SFOA 2L12A 4QGUA 3BA8A 4HNVA 3KYHC 3VR2A 3DWPA 3Q24A 2LXJA 4CKBA 2FK1A 3N40P 3R5FA 4FDBA 2F0VA 3DLLA 5IODA 3UFXB 2W57A 4A3GG 4NXNQ 5I6YA 4ZI7F 4G57A 1EFWA 3NBHA 1YJNA 3V4SA 2JXMB 5D8DA 5BMVF 5C4JH 1SRUA 5EZYF 5M5WB 1VQ9A 3PIPA 4LSAA 2EJMA 4DV0H 3R3OA 2UXCL 2D62A 1GUNA 2YZNA 2R8KA 4JOIA 2J6TA 4IUNA 1BO0A 1EY4A 1GKHA 5H1SE 2R7LA 4O3NA 1ENFA 1LT3D 1VKZA 2NU9B 4RGTA 1EYAA 2AWNA 5CGKA 3SXHA 5FLXL 4M9UA 1PH4A 5C3EG 2XRSD 3E0EA 5DLQE 2HGSA 3HBLA 4J9RA 4A3IG 3CW2C 1Y1WH 3H20A 1SROA 3NSWA 3OTOH 3DMUA 1IYVA 1KXLA 1RYSA 1STBA 4IRKA 2EXZA 3H91A 1E4EB 1NNXA 1CKNA 1V43A 1JJCB 1XPOA 3C2PA 2F0IA 2G5DA 4HN7A 4ABNA 2PN1A 4FS2A 3G6YA 5KG6A 2KOLA 1HJPA 1YEZA 2CHBD 3FP9A 1IOVA 1M90C 1DONA 3CCJA 4LF5L 1G6PA 2L1BA 4FF3A 1FGUA 1SYXB 3OUUA 1AN8A 4O3PA 5T1IA 1VQ6A 1SLJA 2JEGA 4UAIA 4KJOA 4HMIA 3SE0A 1KJIA 2XCAA 5D1OA 1HCZA 3DUZA 4E6IA 4NXNL 1NCVA 2EVBA 1PH2A 2J6SA 4QL5A 5IP7G 2LS01 1NR4A 4IUUA 5C4ZA 3GIQA 3MWMA 1F77A 1HH2P 2B8GA 1W2BA 4AH6A 4J9OA 2EYMA 1E1TA 1QVGA 2HHHL 2N49A 3OW2A 5FPOA 2C28A 2FFKB 4KI0A 2AKWB 1NBWA 4J9PA 2A5HA 2WAQE 1Z6HA 1VQCA 3BZKA 4JI7H 3UI2A 1TWGA 1I50H 3D8GA 4JV5H 3A5UA 4GNXC 2FPPB 2VL6A 3S14H 3URYA 4JW0A 2Q2IA 4NP5A 1HA6A 1F2MA 4GOPC 4ED7A 4JI1Q 2I46A 3OUZA 5HV6A 2K50A 5M3MG 2RSNA 1JE5A 1I7NA 3K81C 1N32Q 3MXUA 2PZTA 1X32A 3H09A 4HR7A 3J80W 4AYBE 1FNUA 3JRXA 2GVBA 1QNUA 1T5XD 4XYLB 2EQSA 2PCFB 5C5JA 2OLSA 4A3DH 4DL4A 3JSNA 3PSIA 2KCCA 2Q8TA 4X65H 4GKKQ 3C46A 2KHSA 3PO2B 4CJ1B 2I5LX 4A3KB 4XYMB 4AQYH 2N78A 1YJ9A 3HOUB 3RZOB 4MA0A 3M4QA 3M4OH 2BQ3A 1XJVA 3SI8A 4UCUA 2IJ0A 1KDBA 1CA6A 2DY7A 1K8MA 4HNTA 3ORQA 2BA1A 2TMPA 3EPGA 3PUXA 3NQTA 2YV5A 1KC8C 1XMOH 1Y1WA 5DQGA 3KHGA 1R9TA 2ZTEA 3HZXA 3SK8A 4CDDC 1N33Q 3J80E 2ZM6L 4FO2A 2AQ1B 5LMNQ 4EGJA 1JXLA 1V1PB 4BY1B 4A93G 1C4QA 5DQHA 1EWHA 3KDFA 1O78A 4IWYA 4XDXA 3VA5A 1T3NA 3ERSX 2A69D 3HFZB 3A55A 4JI1L 1HZCA 4X3TA 1TWHB 1EU3A 3RLOA 4HJ5A 2B63B 4Y52H 4JV1A 4Q43A 1N32L 1JOKA 3TSSA 4DL2A 4MTDA 2BDOA 3GTQH 5CV7A 5H80A 3VYUA 1NUCA 4RCOA 2A8VA 4EX5A 2W71A 4DV0Q 4ECSA 1XPUA 4IQZA 5KRUA 2JYOA 3KHLA 4C3JG 2MP1A 3UDXA 4GKKL 2ZXOA 3H3VI 1LTID 5EPKA 4RKBA 4V190 1M0WA 1IBMH 4MZ9A 1PX2A 4LFBH 4LW1A 1S5FD 1TAEA 3KHHA 5CV9A 2KCNA 2BH2A 4BBSH 2OQ0A 4XX0B 3H0GA 1I50A 2IL8A 4DR7H 2OT2A 4TVAB 1F9PA 5EWEA 3M9MB 2X0SA 1L0XB 5C5MA 2BDNA 5CV8A 5KNCA 1C8CA 2K32A 3Q8QB 3GV7B 4A3FH 4IPDA 2UXBH 1ZQ7A 1K3BC 1LTTD 2I87A 3ETHA 2NTTA 4MTEA 2E2HH 1N33L 1N36H 4EQNA 4WBNF 2R7DA 4ECWA 5CMDA 3MA2B 4NDXA 3HOYH 3PW7A 2JA7H 1SMYD 1Y8OB 4FBTA 3T53B 4R4QA 1BKBA 4O2AF 4L8JA 4YCWA 3V2TA 1RCVD 1K0SA 3S2HB 4HCSA 2KQ3A 5JPNC 2Z4HA 3FRPB 1TWAH 2VNUD 4LMQD 5LMUQ 3DEOA 2EJGC 3ONAB 2VQFH 3I4MB 2Y0SB 4DV0L 4LF7H 3RZDB 1Q86C 1X3GA 2Z6KA 2A6HD 1BXRA 4A3BG 4JBJA 4K5WA 4BY7H 3K0YA 3M9BA 1BBXC 4KHPH 5M3MB 5C4XG 4R4TA 2JA8H 3B6YA 3ULJA 3G6VA 1CQFA 4JI7Q 4JI6H 3BZDB 2Z4IA 3WO1A 4EFBA 4JV5Q 1PRTB 2MO0A 4HJ8A 1KD1C 1G91A 1KRTA 2DGYA 3LWBA 2VZAA 4G7HC 2R61A 1QZHA 1PTOD 3OTOL 4XQNA 3T1YH 1ENAA 3S16H 2A6ED 3RBDA 2MUYA 5GQOA 5BN5A 1K8AC 1VBGA 1E24A 2RDGA 2LMCB 4KTAA 4K0KH 4FNFA 1LABA 3HG9A 5KFSA 4PZ8A 3HOZH 3OSPA 2QEJC 2G9HD 4P74A 2ASBA 2MCTA 2E2DC 2LY7A 1I4PA 3K58A 2SNSA 4X65Q 4U673 5M3FG 4A3EB 2N8NA 3CQZH 1ULZA 3K3VA 4R9WA 5KFYA 4AQYQ 3RAXA 4IFDG 2G9DA 1RODA 2JSOA 4U6PA 2NVQB 3HKZB 5AFWA 3D4WA 4APMA 2ZJRA 2GPSA 4RU9A 1CE8A 2R8HA 2F0UA 1PFBA 4DK1A 2IX3A 4X3KA 4FXDA 4QCLA 2VQEH 4NLGA 1K1QA 2WAQA 1RHPA 1YNJD 1K1SA 3KALA 3RFCA 1XMOQ 2R7MA 2NVTB 1S5DD 3F8TA 3RGZA 4DV2H 3J81i 2RGRA 1N56A 1UC8A 5CA0F 1GSAA 1KJ9A 1DCZA 1CZGA 1TWFB 2K03A 4O3OA 1FKAH 4JI7L 5KG7A 2R85A 1X3QA 3GIPA 4JV5L 1D5MC 1HTLD 2F0EA 3IFDA 5KFPA 2E2HA 2FLPA 1TY0A 1OTCA 3L4KA 1KDAA 2DNEA 1KHIA 2FJZA 4DUZH 4FP5D 1L1OC 3CPWA 4AYBA 3JAME 4F88A 2E2IH 1D8LA 4C3JB 5KFRA 4ECZA 4ODGA 1GUSA 4NMZA 1G291 3E9IA 2W9BA 4DV5H 3N44B 3VR5A 4YB8B 2YU9A 1C30A 1KABA 5DM73 3MFYA 4XQJA 2K14A 3HS0C 2W6NA 3OHBA 1Y14B 2I0QA 4P71A 1RK6A 3PUZA 1JOQA 1E7ZA 4ECRA 5KFNA 3MJFA 1FYCA 3RLFA 4C3IG 1TWAA 2NZOA 1B7YB 3PO3G 2J7ZA 4OONA 1E22A 4X65L 2R93G 1XPRA 4C2MA 1JC7A 1IBMQ 1LUZA 3QB3A 1A3VA 5M5WH 4LFBQ 1WTRA 1HZAA 4I7ZC 2F3VA 5E4WC 4UCTA 1LTLA 4QWBA 2CQAA 4DR7Q 1KJQA 3RV4A 5KEEA 3NTHA 5CBEE 2KVMA 4K5VA 3RB3A 1SYEA 1Z7TA 3BYYB 1XMOL 2IBKA 1M8AA 1WFQA 1SNQA 3RD4A 2UXBQ 4CDCC 1X55A 2XSCA 3SDZA 1YHAA 5HGQA 4RB1A 2H4OA 1N36Q 3PW5A 3BYTB 5BPFA 3TINA 1T9HA 2NVYB 1H95A 1VQNA 1EY0A 5GAEC 4BBSG 4EVOA 5IT9W 2B2VC 1BCPC 2K04A 5I9OA 2NU7B 2W7PA 1FVIA 4P75A 4BBRG 2W8KA 2YTVA 2M2LA 3MR3A 2AMCB 2HCCA 2K5DA 1HNXH 3WOFA 4ZUJA 4J6HA 1AFPA 1GM5A 1IBLH 3TMEA 3GTOB 3I56A 3CQZA 2VQFQ 1B3QA 5G3LF 2JA7G 1QWYA 5KYLA 1RD9D 1GJXA 1E4FT 4LF7Q 3FVQA 3T5KA 4K6DA 5JPMC 2WE6A 5GAGC 5BPHA 1Z47A 4KHPQ 1YNXA 4MA5A 5EPJA 1XX8A 4KKSA 5KNDA 2DIKA 1IBML 3F8NA 1TT2A 1OXTA 4JI6Q 4K2KA 5FO9B 1S68A 1IXRA 4FYDA 2W6QA 5IT9E 1HNWH 3MC0B 2K75A 3MXNA 1HR0W 3ND9A 4DR7L 4HSVA 2HVQA 3EROA 3VA7A 5KYIA 3T1YQ 5L9XA 4RB0A 4E4TA 2EYOA 4MTNA 2JA6G 1GVPA 2UXBL 1X6OA 1G51A 2UXCH 1J6QA 4K0KQ 4JI3H 1SYFA 1N36L 2VQDA 2PZUA 1CUKA 1E2WA 3GTKB 1X9NA 3PUVA 3OWEB 3GTPB 2KENA 4EYIB 2R87A 4C3HG 4Q8EA 3I90A 3J7YW 1S0OA 1PH9A 4UP9A 1XNQH 5IYBH 5C44B 1STGA 1EIHA 2C9OA 3MR6A 5ELFA 2UUBH 1K83H 3CCUA 2J6UA 2GLTA 4ECYA 1SMXA 3S1RB 3FKIB 1PYBA 1ZEQX 5KX5F 2VQFL 3OOCA 2AQ3B 1EWIA 1ICWA 5JAVA 4ED1A 3KFUA 1DGSA 3OHAA 4K8IA 2NTSA 4A3JB 5J1ZA 4LF7L 2Q8IB 2CWPA 2Y0SE 4DV2Q 1IYUA 3TREA 4KK7A 4KHPL 2N88A 4IRCA 1B9MA 5IP9H 4I50F 1AE3A 1ICFB 3LP8A 4JI6L 1B04A 2EYFA 1VQDA 1IW7D 3NXWA 3TQ1A 1LV9A 1RIPA 4ZKBB 3TQYA 2HVRA 4DUZQ 1E4EA 1PMRA 3T1YL 3GTJB 2RHSB 3PO3B 1TKWB 3KBXA 3I8ZA 1KAAA 2Z8LA 1UC9A 1GOZA 3F2CA 2E2JB 4DV5Q 1GUGA 3MAQA 1EY8A 2HHHH 1S10A 3HOWG 4K0KL 1GHKA 2ZDQA 1EWCA 3A7LA 1A3TA 2WTFA 5L1JA 2R7ZB 2FINB 5D3DA 5C4HA 4GN4B 1ZYRD 1SNDA 2ZJTA 2B63H 4LAAA 4H7BA 1JLLB 1KC7A 2JEJA 1DXMA 5JJKA 1C0AA 1KDCA 3G7LA 1EY9A 2B2UA 4IUQA 5IIFA 5FLMG 4HYKA 3K7AB 2R84A 4A3MG 2QK4A 3K57A 1HNZH 1H9SB 4RZQA 1QVFA 2V4RA 3GV8B 1PRTC 2B8FA 2W6OA 4JBKA 3R2TA 3HKZE 3HOXB 4PNYA 4GZYC 2VQEL 2C00A 1A3UA 3K8AA 4BBRB 1MGSA 5FO8B 2F4VQ 1I4QA 2L9HA 1SBBB 1Y1VG 4DV2L 1YVCA 5E7NA 2FKLA 4X62H 5J3BA 4YWKA 1EIFA 1OWTA 2FK3A 1AW7A 4KJNA 4UHVA 5KFJA 5EWFA 3PW0A 3QIAA 4TV9F 2WKDA 3MR5A 2XCPA 3EYYA 2IWHA 3M4PA 1MIUA 1MZBA 2UVWA 2R8GA 1EYDA 1KLUD 1WYDA 2CH4W 5C0XG 3Q8DA 1Q82C 5L1KA 4DUZL 4ZOLF 1HNXQ 4DXGA 3W1BA 5EGTA 5KT6A 4DV5L 1MD2D 3SVMA 1IBLQ 2ALZA 1VQOA 4BA2I 3G4SA 2B2VA 1XXGA 5C6AA 3UQ8A 2ZM6H 5DGAA 1WJJA 1Z2NX 1E1OA 2Q2UA 4XYOA 5C8YF 4WJWA 3S2HH 1HUMA 4HAEA 4GLXA 2FPIB 1K28A 1X3FA 4YY3H 4EBDA 5IWAH 3OW7A 1UE5A 2UU9H 1A62A 2L0CA 5D3IB 1H9MA 3RZDH 4N9PA 4F50A 1HNWQ 1PXUA 3K5MA 4OWWB 3S9WA 4LF9H 1JWMD 3JAMc 3NE5B 1DYQA 2NN6H 1VQIA 2X6LA 3I12A 3GTGB 3ICEA 3CC7A 1I7LA 2BQRA 3SK5A 3TP7A 1E0BA 1RDPD 1W6KA 3F2BA 4C3HB 4X3SA 2VR1A 5K5PA 1NMFA 3NGDA 1V1PA 1XDNA 1LM0A 1EQVA 2RKSA 2UXCQ 2RDIA 4APVA 4JI3Q 2NUAB 4DV3H 1ESFA 1JWSD 2QDLA 2L4NA 1DD2A 3GTLB 2R8IA 3BQ0A 3SK4A 1M7JA 5NUCA 4P73A 1LTAD 4ID6A 1A2UA 3EBEA 2DY8A 2EYHA 5DEHA 1BUVT 3MEHA 1FL0A 5DNFA 1FD7D 2MFIA 1TWHA 4UDUC 2B63A 4YR0A 1FR3A 2CFMA 1XNQQ 1HNXL 1TS4A 2H1EA 1IBLL 1EY6A 1WOCA 2UUBQ 3D4RA 1VCIA 5ELCA 1ET9A 1SXTA 4C5CA 2NZ1D 2SNMA 1I6UA 2EYLA 2K5VA 3NUCA 2MO1A 5KFGA 1Q1EA 5IYDH 4RAZA 4RGMA 1IL2A 4HIMA 2NVQH 5JJZA 4LF6H 2PMZB 2F0QA 3RB0A 1KJ8A 2VUGA 1SCUB 4RB3C 2KA7A 3AFPA 2J4XA 1CKOA 4DNTB 3CMAA 3HOVH 1HNWL 3QZ8A 1ZHSA 3PN1A 2RGVA 2AWOA 1KIXA 3M4YA 4YP3A 4K8JA 5DLFA 1XMQH 2IX0A 2HUGA 1RJQA 3GQBA 1BNCA 2R6FA 5A2QW 2HD3A 2MPMA 1GUWA 2HHHQ 3ITPA 5FJ8H 3JAML 2QCPX 4JI3L 3U9TA 4B3RH 1UEAB 2B2WA 1FNWA 3DM1A 4DGZA 2DPIA 4DV1H 1VS0A 5DG9A 5L1LA 2WB1G 3BABA 2EXDA 2HIVA 4DF7A 3K5LA 2CZGA 1OXXK 1IKLA 3EA6A 5KG0A 4ED3A 3I4NH 1XNQL 3UDGA 4PG3A 4LNQA 4OWXB 3PGZA 3QR8A 1R9TH 2P0AA 4JG2A 4LUOA 4DA2A 1HNZQ 1S4ZA 2UUBL 2VUMG 4G7ZC 1ZHQA 5KFEA 1LTRD 2K28A 3QWNA 4CC6A 2Y0SA 2K01A 5C1PA 3FEWX 3VPCA 5IYCG 2UVRA 4B9XA 1SR3A 5M5YB 1GSHA 4GN3B 4IUPA 4PV1C 1BBWA 5TSSA 2VY3A 2CW8A 2FLNA 4OIJA 5I2YA 1HQMC 1KAWA 3GILA 4L1KA 1SE3A 5JEAH 4O42A 3WNZA 1UE7A 2K33A 2AGOA 4ME3A 3MWYW 1QJOA 2Z6KC 1I4RA 3AQQA 2KCMA 3VDYA 4BXXH 2Z0SA 4H02A 2R92B 1B4OA 3BG3A 3R23A 3M7NA 3PIOA 1ASZA 4XIGS 2EY2A 2ICIA 5AJ3Q 4PWQA 3IL8A 5HURA 2FE3A 2I80A 5KFDA 1LTSD 3Q8PB 1V1QA 2BH8A 2IHFA 2KSWA 2QGQA 3K5IA 1PTOF 3P20A 5EQ0A 3H3VC 2ZM6Q 2K1BA 2RDJA 4HIKA 4HJ7A 5KFZA 3H0GH 3JSLA 2Q2TA 2I5MX 5KFLA 4A4IA 2ES2A 1WTQA 3GTOH 1IHZA 3L7ZC 1GXDC 4YY3Q 4IOCA 3K5NA 1CQVA 5IWAQ 3HKZA 4MV4A 2DWCA 2UU9Q 4RAUC 1S3OA 1ZETA 1HNZL 3QJYA 3A0JA 4LF9Q 2CCZA 3CCMA 4IPCA 3N41B 4RH6A 2VW9A 1BVSA 2WP8J 4J8QA 2ASDA 4X62L 1TWFA 1X65A 4DV3Q 3SGIA 3J7A5 4DU9A 2C35B 5DQIA 3PF5A 2DJGC 2QKIC 4A3CH 5T14A 1OXSC 4L6TB 4ZQIA 1V4YA 1Q12A 3Q22A 3I72A 2W7OA 2NN6G 3UE0A 2YTXA 1O7IA 4BWGB 5KFXA 2A68C 4DUYH 2OTLA 3D31A 1VBHA 5CR3A 2QEXA 4J9MA 2EY6A 4MN3A 4BS9A 2HCIA 5AJ3L 3S2DH 2WINB 4IN3A 5L37A 3GTPH 1S5ED 2M9VA 2RSOA 4A3GB 3BQ2A 3S1MB 4JI8H 5C44H 3TIGA 3WOEA 1VQFA 2YZMA 5KFTA 1GD7A 1X3PA 1ZKOA 4DAMA 3ERQA 4LF6Q 1L0YB 3S15B 3W2DA 4R8UB 3FKIH 4YY3L 3H3VH 4UCVA 2W70A 5IWAL 4YR3A 4IFDI 2B2TA 2BA0A 2CH4A 2UU9L 5F2DA 1WH2A 4I55F 4A3JH 2AGQA 4IHJF 2EYJA 4HJAA 3MR2A 4DK0A 1RJRA 1LACA 4LF9L 4J9SA 4G3IA 1AZQA 2Z9HA 2EY1A 2HIXA 3CCQA 3UDIA 1XMQQ 4EQ5A 1BBUA 1F9QA 2RQXA 5C3EB 3C1EA 1XWEA 1V9PA 1VQ5A 4YAKB 1TVXA 4CJ0B 4A3IB 5KG5A 4MV1A 5C1OA 4B3RQ 2NVYA 4DV3L 1UWVA 4BA1I 1M1KC 4O3RA 3L2PA 1VQJA 3PW2A 4ECTA 1B1ZA 4JI5H 4DV1Q 1JR0D 2B2YA 5EOYA 2BE5C 4GC7A 5KGUA 3RUZA 2VPSA 2W6ZA 4M8AA 1JDEA 3CD6A 2R7ZH 2YYZA 4X6AH 4IWXA 5ELDA 4RNMA 3E5SA 1EOTA 3GTOA 3OTOQ 4EQPA 2OWOA 2NYZD 4KN4C 1IOWA 4IUVA 3ER0A 1F2ZA 1Y8NB 2ASJA 4R1JA 3QFFA 4LF8H 3T5LA 5M9OA 3STBC 2FLLA 3PR4A 1WD1A 3K7AH 3VR4A 1JB7A 3EPIA 5C5LA 3GD7A 1PLFA 4JK1C 1AN7A 2Q2HA 3FHWA 2E76C 4LF6L 2CW0C 3I4NG 2HJWA 4J15A 3J81W 4DR4H 1B9NA 3GIKA 3HOXH 3LX0A 1ML0D 1I5FA 1WCMH 2PMZE 1Y1WG 2XIGA 2YU9H 3UDFA 2XNAC 5IGGA 3LMLA 2RF4A 4DKAC 4IJLA 2BR0A 2VA3A 4LFCH 1I3QB 1B50A 4IURA 1V8QA 2VB3X 4NB3A 2I8CA 4B9WA 2K5HA 1OO9B 2BCOA 3OIPA 4YIJA 2JA5H 3W5OA 1XMQL 3GP7A 2LFNA 3V05A 4C2MH 4B3RL 2RVLA 1SNMA 4EGVA 3V4ZA 1JMCA 1T94A 5DG7A 4JI0H 2FJ2A 3GTPA 4DV1L 2EE1A
chains in the Genus database with same CATH topology
3CCSA 4MNOA 1GO3E 5GAGC 4B3SQ 1Z47A 4HIOA 1YNXA 4KHPQ 1IBML 2PI2A 3KJOA 3KF8B 2R7FA 4GN5A 1OXTA 4JI6Q 2R92G 4L5RC 2HQLA 1IXRA 1C9OA 1OXUA 3TEHB 2K75A 4PZ6A 3PCOB 1EQQA 1HR0W 4JYAL 3CAMA 1S72A 4DR7L 3T1YQ 1EIYB 4O0AA 1RL2A 4DPGA 3H0GG 3I4MG 2K4KA 2Y0SG 3A5ZB 4MTNA 2JA6G 1GVPA 2LSSA 1PH1A 4IPHA 1VQKA 2ZJQA 1X6OA 3TS2A 2UXBL 3H15A 5M3FH 3CXCA 1G51A 1J6QA 5C0XJ 1IYJB 4K0KQ 1TXYA 2F4VL 1N34L 1N36L 2JJQA 5JEAJ 2UUCL 2K52A 3CC4A 1CUKA 3I2ZA 1X54A 3GTGH 5FLXc 1X9NA 3PUVA 2IX1A 1NMGA 2D0OA 3GTKH 1IBKL 2HT1A 1VQBA 2KENA 2KBNA 1MJCA 4QQBX 1PH9A 4UP9A 4DUYQ 2ZTDA 2JE6I 4P72A 5IYBH 2FXQA 1K9MC 4DAYB 2D0PA 2UXDQ 1HZ9A 1YHBA 4A93H 3IRBA 4QJFA 3M85A 1K83H 4R4CA 3CCUA 4A3DG 1SMXA 4GKJQ 4PZ7A 1HR0L 1PYBA 3MXNB 3G6EA 2VQFL 1Q8KA 4DV6Q 1EWIA 4LUZA 4JI8Q 3U4ZA 3S1RH 3KFUA 1DGSA 3KF6A 4YWLA 3RLNA 4LF7L 2IY5B 1TWGH 2CWPA 2Y0SE 4DV2Q 1VQLA 3TREA 4B3SL 4A3KG 4KHPL 1JT8A 1YBYA 5IP9H 1AE3A 4A3EG 4LF5Q 4JI6L 1NY4A 3CCLA 1PH5A 4QGUA 1PHJA 5IYDG 3CMEA 3KYHC 3HKZG 1VQDA 2LXJA 3U50C 1RIPA 4FDBA 3TQYA 3DLLA 4DUZQ 4YHHQ 3T1YL 2RHSB 3ZJYC 1SN8A 4A3GG 4NXNQ 4C3IH 1N9WA 3F2CA 2IT1A 1EFWA 3GTJH 4DV5Q 3PO3H 1YJNA 3HOVG 2R93H 2E2JH 3HOWG 4K0KL 1J5EL 2RCNA 5C4JH 1SRUA 3AEVA 1NJIC 4GN4B 1VQ9A 3PIPA 4JI5Q 3AFQA 2B63H 4A75A 2CQOA 1EYGA 2UXCL 2D62A 2JEBI 3KF6B 2A1AA 5JJKA 2AHOB 4JOIA 4POFA 1C0AA 1IZ6A 1HZBA 1GKHA 2A19A 5H1SE 5FLMG 5FJ8G 3PF4A 3E9HA 4DUYL 4A3MG 2AWNA 3TRZA 2UXDL 4JCVE 1QVFA 1PH4A 5C3EG 1QVCA 3E0EA 5DLQE 4JC0A 4A3IG 4JBKA 1ASYA 3CW2C 3HKZE 1Y1WH 2F3IA 4GKJL 2VQEL 1SROA 1L2FA 1VQ4A 4DV6L 3K8AA 4JI8L 1KXLA 2F4VQ 1N34Q 2UUCQ 3CP0A 1XPOA 1CKNA 1V43A 1JJCB 2JQOA 4BBRH 1Y1VG 4DV2L 1YVCA 5E7NA 2WAQG 1MKHA 3J80i 2JA9A 1HJPA 4YWKA 1YEZA 3FP9A 3NBHB 3K80C 1SE8A 5J3BA 4LFAQ 1EIFA 1M90C 3CCJA 4LF5L 1G6PA 1A63A 1FGUA 1VQGA 4LFCQ 2LXKA 1VQ6A 1SLJA 3M4PA 1L0WA 5LMNL 4A3FG 4A3LH 1MIUA 1WYDA 5C0XG 1Q82C 3Q8DA 1KL9A 4DUZL 5JEAG 4YHHL 3GDEA 4NXNL 1PH2A 1HNXQ 4JI2Q 3NELA 4QL5A 3F1ZA 3W1BA 3HOYG 5IP7G 4DV5L 1IBLQ 1Z9FA 3KJPA 4AYBG 1VQOA 1K8GA 4OX9Q 3JAMi 4BA2I 1PVOA 2NZHA 3G4SA 1K3RA 1HH2P 3RN2A 3J80c 4UP8A 4BXXG 2R92H 1QZGA 1W2BA 4AH6A 2ZJPA 4JI0Q 1WJJA 4JI5L 1E1OA 2Q2UA 1E1TA 1QVGA 2HHHL 2N49A 3OW2A 3S2HH 4KI0A 2AKWB 1NBWA 5C0XI 5GAHC 4DR3Q 3RN5A 1CKNB 4X66Q 4GLXA 2WAQE 1X3FA 1VQCA 2F52A 3BZKA 4JBWA 5ELOA 1I50H 1UE5A 3A5UA 2JA6H 1EUJA 1A62A 4GNXC 2QA4A 3RZDH 1HNWQ 3RNUA 2VL6A 4OWWB 3S14H 3S17H 1S40A 4LF8L 4BY7G 3JAMc 2Q2IA 3J7ZC 4GOPC 1VQMA 1VQHA 4JI1Q 1VQIA 2JA8G 1WI5A 2MQHA 3CC7A 2XGTA 1J5EQ 2K50A 4UP7A 3F2BA 5M3MG 4B3TQ 3ICEA 1JE5A 3K81C 1N32Q 3PUWA 1Q7YC 1NMFA 1YZ6A 4C3HH 4DR4L 1LM0A 4AYBE 4LFAL 2UXCQ 4APVA 4JI3Q 2B3GA 3TS0A 2GVBA 3KLWA 4TQUS 2MNAA 4ALPA 1Q46A 2EQSA 4P73A 4LFCL 1VQPA 4GNXA 4DR5Q 1UEBA 2PNHA 3HKSA 5M5XH 3EBEA 3GTLH 4YWMA 4A3DH 3S24A 3PSIA 1X56A 4RMFA 1FL0A 1UE1A 4GKKQ 1YJWA 2MFIA 1LYLA 2CFMA 4GOPA 1XNQQ 3HOZG 2I5LX 1HNXL 2H5XA 2K5NA 3ULLA 2N78A 2VQEQ 4HJ9A 4GLVB 1YJ9A 4JI2L 2ATWA 5JJLA 1IBLL 3PO2H 4A3CG 2UUBQ 1WOCA 3M4QA 4DK6C 4A3KH 1I94Q 4OX9L 1XJVA 3RZOH 3HOUH 3M4OH 1VCIA 3S1QH 3OYYA 1EOVA 2K5VA 4JI0L 2MO1A 2BA1A 1Q1EA 5IYDH 3PUXA 2YV5A 1IL2A 1KC8C 4HIMA 2NVQH 5LMUL 2ZTEA 4DR3L 1PA6A 4X66L 2ZM6L 1N33Q 3AFPA 1NE3A 5LMNQ 3I4MH 4A93G 1CKOA 1X3EA 4JI4Q 3KDFA 3CMAA 5C44G 3I55A 3HOVH 1HNWL 4BY1H 4OO1G 3ERSX 3HOWH 2AWOA 2CWAA 1QUQA 3HFZB 4GNXB 2R6GA 5ELNA 1KIXA 4A76A 4GS3A 2OCEA 1HZCA 3FKIG 4JI1L 1PH3A 3G48A 1W3SA 3BJUA 3RLOA 4HJ5A 2IX0A 4B3TL 4Y52H 4GOPB 1N32L 4DV7L 4A3JG 1TWHH 3U4VA 1PH6A 5FLMH 5LMNW 5FJ8H 2HHHQ 3GTMH 3U58A 4JI3L 3GTQH 1A0IA 4A3MH 2A8VA 4OXPA 2E5LQ 1PFSA 4EX5A 1VS0A 4IFDJ 4DV0Q 4OO1I 1XPUA 5C3EH 2RHQB 2WB1G 4DR5L 2EXDA 2HIVA 3CF5A 4A3IH 3EIVA 3A74A 1OXXK 3STBD 1YITA 3D0FA 4YCVA 3UDXA 2NVXH 3H3VI 3I4NH 4GKKL 5GADC 4MZ9A 1XNQL 4LF8Q 4LW1A 4PG3A 3UDGA 4OWXB 3PGZA 1R9TH 4LNQA 4JG2A 1Y1VH 4LUOA 2PQAA 3CCRA 1HNZQ 4DR1Q 2BH2A 2UUBL 2VUMG 4BBSH 1I94L 3KDFB 5IY0A 2OQ0A 4UY8C 2KCTA 2PI2E 1VQ8A 4AQYL 4TVAB 4DR4Q 4YCUA 1QUQB 5IYCG 1PV4A 2R7ZG 4QIWE 1SR3A 4HIDA 1VQAA 4GN3B 1BBWA 4IPDA 2VY3A 3W1GA 5M5YH 4A3FH 2OTJA 1KAWA 4KLKA 2ID0A 2E2HH 1N33L 2GN5A 2UUAQ 1UE7A 2R7DA 3HOYH 4JI4L 4ME3A 2JK8A 3GO5A 5IP7H 2Z6KC 2JA7H 4L5TA 4IJHA 3AQQA 1JJGA 2YTYA 5BR8Q 2KCMA 2WB1E 2L15A 1OXVA 3VDYA 3EN2A 4BXXH 3LGJA 1BKBA 4R4QA 2Z0SA 3CC2A 4H02A 4YCWA 4DR2Q 3HOXG 4DR6Q 1EQRA 3KOJA 4DNIA 1WCMG 3M7NA 3PIOA 1ASZA 4XIGS 5AJ3Q 3K7UC 1B8AA 1TWAH 2PQAB 1V1QA 2BH8A 2IHFA 2KHJA 2QGQA 5LMUQ 2VNUD 4QY7A 5IE8A 2E8GA 2E5LL 2ZM6Q 2JA5G 4HIKA 4DV0L 1Q86C 4HJ7A 2N3SA 1X3GA 2Z6KA 2I5MX 1U5KA 3H0GH 2Q2TA 1VQ7A 4A4IA 2ES2A 4JBJA 4A3BG 4BY7H 3GTOH 1AE2A 3M9BA 3BU2A 3L7ZC 5C4XG 4R4TA 4YY3Q 1K0RA 4NPSA 2JA8H 3B6YA 3ULJA 1CKMA 4OWTB 2I5HA 4IOCA 5IWAQ 3NENA 5M3MH 4JI7Q 4JV5Q 2ALYB 2UU9Q 3PUYA 1P8LA 1S3OA 2MO0A 1CSQA 4HJ8A 1VQEA 4DR1L 1KRTA 1KD1C 2DGYA 1HNZL 3A0JA 2IHEA 2VZAA 4LF9Q 2CCZA 3CCMA 4DV7Q 4LFBL 1QZHA 4RG1A 3F2DA 3OTOL 2OQKA 4IPCA 3S16H 3RR5A 2VW9A 1BVSA 2WP8J 4IPGA 5GQOA 1PYSB 1UE6A 1K8AC 1E24A 4X62L 1X65A 4DV3Q 3SGIA 2UUAL 4PZ8A 1XNRQ 3J7A5 1TWCH 4AIMA 3HOZH 2C35B 4P74A 3CPFA 4R4IA 3PF5A 2ASBA 3ULPA 3AYHB 4A3CH 2JEAI 1OXSC 1Q12A 5BR8L 1Q81C 1P16A 4X65Q 5M3FG 4GLAC 2NN6G 3UE0A 2YTXA 1O7IA 2N8NA 3J81j 4DR2L 1K73C 4DR6L 4X64Q 3CQZH 4A3EH 2OTLA 3D31A 4AQYQ 2ZTCA 2KHIA 2EIFA 3WWVA 2QEXA 4IFDG 4O2DA 5AJ3L 5EAYA 1B70B 3S2DH 2ZJRA 3L0OA 3GTPH 3DM3A 3MEFA 3G71A 3PV0A 2VS1A 1JJ2A 3I4OA 2GVAA 5C44H 1KRSA 5IYBG 4A3GH 1Q1BA 1VQFA 3S1MH 1GD7A 1XMOQ 4DAMA 3F8TA 4LF6Q 3J81i 2NN6I 3JC66 3FKIH 4YY3L 4LF4Q 4DK3C 2NVTH 3H3VH 4IO9A 1YIJA 3S15H 5IWAL 4JI7L 4IFDI 2BA0A 4JV5L 4POGA 1TWFH 2UU9L 3PO2G 4A3JH 1OTCA 3HOUG 1FJGQ 4HJAA 4LF9L 5GROA 4KHZA 1KHIA 2DUDA 1L1OC 3CPWA 2HIXA 1A8VA 5IP9G 3CCQA 3T1HQ 4NXMQ 3UDIA 2E2IH 1D8LA 1NTGA 1MJEA 1XMQQ 4JOIC 4EQ5A 1BBUA 1E3PA 1G291 3E9IA 1V9PA 1VQ5A 4C3JH 1YI2A 3M3YH 4B3MQ 4B3RQ 2K14A 3J81c 4DV3L 1UWVA 4BA1I 1XNRL 2WFWA 2CKZB 1Y14B 1M1KC 5HY6A 2I0QA 4P71A 3L2PA 1VQJA 3PUZA 4DV4Q 1E7ZA 3S1NH 1PH8A 1I6HH 4DV1Q 1PH7A 3RLFA 4BY1G 2VUMH 3CCEA 2NZOA 5IT9c 1B7YB 3PO3G 3UE1A 4OONA 1E22A 4X65L 1XTDA 1XPRA 2R93G 3CD6A 2R7ZH 5IYCH 3BZCA 2YYZA 1LUZA 1IBMQ 4X6AH 4X64L 1L1OA 4LFBQ 5M5WH 4JBMA 4L5QA 4IOAA 1HZAA 3OTOQ 2OWOA 2B63G 1LTLA 3ER0A 1D7QA 4JYAQ 3NEMA 4R1JA 4DR7Q 4X62Q 3STBC 3CCVA 1AH9A 3K7AH 1JB7A 1N8RC 2B29A 3GD7A 1SFOH 1XMOL 2Q2HA 2UXBQ 1WFQA 3FHWA 4LF6L 3I4NG 2V1CC 4J15A 1X55A 4UPAA 5HGQA 1KQSA 1YHAA 3HOXH 4L5SA 1N36Q 4LF4L 2PMZE 1I5FA 1WCMH 1Y1WG 3I7FA 1T9HA 4XTCS 1C7YA 4R4OA 2YU9H 3UDFA 1VQNA 1H95A 5GAEC 2RF4A 4DKAC 4IJLA 4BBSG 2NVYH 1FVIA 4P75A 1FJGL 4BBRG 1IBKQ 4WJ4A 4NB3A 1I3QH 5K36G 2K5HA 1CSPA 4LWCA 4Y7NH 2YTVA 2JA5H 2AMCB 2XTIA 3W5OA 3T1HL 4NXML 1XMQL 4A3BH 1L1OB 1GM5A 4C2MH 5C4XH 4PMWA 3I56A 4B3ML 4B3RL 4A3LG 4WJ3M 1HR0Q 1JMCA 2VQFQ 1YHQA 3K0XA 4DV4L 1U0LA 2JA7G 4LUVA 4DV1L 4LF7Q 5JJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCS A;  4MNO A;  1GO3 E;  5GAG C;  4B3S Q;  1Z47 A;  4HIO A;  1YNX A;  4KHP Q;  1IBM L;  2PI2 A;  3KJO A;  3KF8 B;  2R7F A;  4GN5 A;  1OXT A;  4JI6 Q;  2R92 G;  4L5R C;  2HQL A;  1IXR A;  1C9O A;  1OXU A;  3TEH B;  2K75 A;  4PZ6 A;  3PCO B;  1EQQ A;  1HR0 W;  4JYA L;  3CAM A;  1S72 A;  4DR7 L;  3T1Y Q;  1EIY B;  4O0A A;  1RL2 A;  4DPG A;  3H0G G;  3I4M G;  2K4K A;  2Y0S G;  3A5Z B;  4MTN A;  2JA6 G;  1GVP A;  2LSS A;  1PH1 A;  4IPH A;  1VQK A;  2ZJQ A;  1X6O A;  3TS2 A;  2UXB L;  3H15 A;  5M3F H;  3CXC A;  1G51 A;  1J6Q A;  5C0X J;  1IYJ B;  4K0K Q;  1TXY A;  2F4V L;  1N34 L;  1N36 L;  2JJQ A;  5JEA J;  2UUC L;  2K52 A;  3CC4 A;  1CUK A;  3I2Z A;  1X54 A;  3GTG H;  5FLX c;  1X9N A;  3PUV A;  2IX1 A;  1NMG A;  2D0O A;  3GTK H;  1IBK L;  2HT1 A;  1VQB A;  2KEN A;  2KBN A;  1MJC A;  4QQB X;  1PH9 A;  4UP9 A;  4DUY Q;  2ZTD A;  2JE6 I;  4P72 A;  5IYB H;  2FXQ A;  1K9M C;  4DAY B;  2D0P A;  2UXD Q;  1HZ9 A;  1YHB A;  4A93 H;  3IRB A;  4QJF A;  3M85 A;  1K83 H;  4R4C A;  3CCU A;  4A3D G;  1SMX A;  4GKJ Q;  4PZ7 A;  1HR0 L;  1PYB A;  3MXN B;  3G6E A;  2VQF L;  1Q8K A;  4DV6 Q;  1EWI A;  4LUZ A;  4JI8 Q;  3U4Z A;  3S1R H;  3KFU A;  1DGS A;  3KF6 A;  4YWL A;  3RLN A;  4LF7 L;  2IY5 B;  1TWG H;  2CWP A;  2Y0S E;  4DV2 Q;  1VQL A;  3TRE A;  4B3S L;  4A3K G;  4KHP L;  1JT8 A;  1YBY A;  5IP9 H;  1AE3 A;  4A3E G;  4LF5 Q;  4JI6 L;  1NY4 A;  3CCL A;  1PH5 A;  4QGU A;  1PHJ A;  5IYD G;  3CME A;  3KYH C;  3HKZ G;  1VQD A;  2LXJ A;  3U50 C;  1RIP A;  4FDB A;  3TQY A;  3DLL A;  4DUZ Q;  4YHH Q;  3T1Y L;  2RHS B;  3ZJY C;  1SN8 A;  4A3G G;  4NXN Q;  4C3I H;  1N9W A;  3F2C A;  2IT1 A;  1EFW A;  3GTJ H;  4DV5 Q;  3PO3 H;  1YJN A;  3HOV G;  2R93 H;  2E2J H;  3HOW G;  4K0K L;  1J5E L;  2RCN A;  5C4J H;  1SRU A;  3AEV A;  1NJI C;  4GN4 B;  1VQ9 A;  3PIP A;  4JI5 Q;  3AFQ A;  2B63 H;  4A75 A;  2CQO A;  1EYG A;  2UXC L;  2D62 A;  2JEB I;  3KF6 B;  2A1A A;  5JJK A;  2AHO B;  4JOI A;  4POF A;  1C0A A;  1IZ6 A;  1HZB A;  1GKH A;  2A19 A;  5H1S E;  5FLM G;  5FJ8 G;  3PF4 A;  3E9H A;  4DUY L;  4A3M G;  2AWN A;  3TRZ A;  2UXD L;  4JCV E;  1QVF A;  1PH4 A;  5C3E G;  1QVC A;  3E0E A;  5DLQ E;  4JC0 A;  4A3I G;  4JBK A;  1ASY A;  3CW2 C;  3HKZ E;  1Y1W H;  2F3I A;  4GKJ L;  2VQE L;  1SRO A;  1L2F A;  1VQ4 A;  4DV6 L;  3K8A A;  4JI8 L;  1KXL A;  2F4V Q;  1N34 Q;  2UUC Q;  3CP0 A;  1XPO A;  1CKN A;  1V43 A;  1JJC B;  2JQO A;  4BBR H;  1Y1V G;  4DV2 L;  1YVC A;  5E7N A;  2WAQ G;  1MKH A;  3J80 i;  2JA9 A;  1HJP A;  4YWK A;  1YEZ A;  3FP9 A;  3NBH B;  3K80 C;  1SE8 A;  5J3B A;  4LFA Q;  1EIF A;  1M90 C;  3CCJ A;  4LF5 L;  1G6P A;  1A63 A;  1FGU A;  1VQG A;  4LFC Q;  2LXK A;  1VQ6 A;  1SLJ A;  3M4P A;  1L0W A;  5LMN L;  4A3F G;  4A3L H;  1MIU A;  1WYD A;  5C0X G;  1Q82 C;  3Q8D A;  1KL9 A;  4DUZ L;  5JEA G;  4YHH L;  3GDE A;  4NXN L;  1PH2 A;  1HNX Q;  4JI2 Q;  3NEL A;  4QL5 A;  3F1Z A;  3W1B A;  3HOY G;  5IP7 G;  4DV5 L;  1IBL Q;  1Z9F A;  3KJP A;  4AYB G;  1VQO A;  1K8G A;  4OX9 Q;  3JAM i;  4BA2 I;  1PVO A;  2NZH A;  3G4S A;  1K3R A;  1HH2 P;  3RN2 A;  3J80 c;  4UP8 A;  4BXX G;  2R92 H;  1QZG A;  1W2B A;  4AH6 A;  2ZJP A;  4JI0 Q;  1WJJ A;  4JI5 L;  1E1O A;  2Q2U A;  1E1T A;  1QVG A;  2HHH L;  2N49 A;  3OW2 A;  3S2H H;  4KI0 A;  2AKW B;  1NBW A;  5C0X I;  5GAH C;  4DR3 Q;  3RN5 A;  1CKN B;  4X66 Q;  4GLX A;  2WAQ E;  1X3F A;  1VQC A;  2F52 A;  3BZK A;  4JBW A;  5ELO A;  1I50 H;  1UE5 A;  3A5U A;  2JA6 H;  1EUJ A;  1A62 A;  4GNX C;  2QA4 A;  3RZD H;  1HNW Q;  3RNU A;  2VL6 A;  4OWW B;  3S14 H;  3S17 H;  1S40 A;  4LF8 L;  4BY7 G;  3JAM c;  2Q2I A;  3J7Z C;  4GOP C;  1VQM A;  1VQH A;  4JI1 Q;  1VQI A;  2JA8 G;  1WI5 A;  2MQH A;  3CC7 A;  2XGT A;  1J5E Q;  2K50 A;  4UP7 A;  3F2B A;  5M3M G;  4B3T Q;  3ICE A;  1JE5 A;  3K81 C;  1N32 Q;  3PUW A;  1Q7Y C;  1NMF A;  1YZ6 A;  4C3H H;  4DR4 L;  1LM0 A;  4AYB E;  4LFA L;  2UXC Q;  4APV A;  4JI3 Q;  2B3G A;  3TS0 A;  2GVB A;  3KLW A;  4TQU S;  2MNA A;  4ALP A;  1Q46 A;  2EQS A;  4P73 A;  4LFC L;  1VQP A;  4GNX A;  4DR5 Q;  1UEB A;  2PNH A;  3HKS A;  5M5X H;  3EBE A;  3GTL H;  4YWM A;  4A3D H;  3S24 A;  3PSI A;  1X56 A;  4RMF A;  1FL0 A;  1UE1 A;  4GKK Q;  1YJW A;  2MFI A;  1LYL A;  2CFM A;  4GOP A;  1XNQ Q;  3HOZ G;  2I5L X;  1HNX L;  2H5X A;  2K5N A;  3ULL A;  2N78 A;  2VQE Q;  4HJ9 A;  4GLV B;  1YJ9 A;  4JI2 L;  2ATW A;  5JJL A;  1IBL L;  3PO2 H;  4A3C G;  2UUB Q;  1WOC A;  3M4Q A;  4DK6 C;  4A3K H;  1I94 Q;  4OX9 L;  1XJV A;  3RZO H;  3HOU H;  3M4O H;  1VCI A;  3S1Q H;  3OYY A;  1EOV A;  2K5V A;  4JI0 L;  2MO1 A;  2BA1 A;  1Q1E A;  5IYD H;  3PUX A;  2YV5 A;  1IL2 A;  1KC8 C;  4HIM A;  2NVQ H;  5LMU L;  2ZTE A;  4DR3 L;  1PA6 A;  4X66 L;  2ZM6 L;  1N33 Q;  3AFP A;  1NE3 A;  5LMN Q;  3I4M H;  4A93 G;  1CKO A;  1X3E A;  4JI4 Q;  3KDF A;  3CMA A;  5C44 G;  3I55 A;  3HOV H;  1HNW L;  4BY1 H;  4OO1 G;  3ERS X;  3HOW H;  2AWO A;  2CWA A;  1QUQ A;  3HFZ B;  4GNX B;  2R6G A;  5ELN A;  1KIX A;  4A76 A;  4GS3 A;  2OCE A;  1HZC A;  3FKI G;  4JI1 L;  1PH3 A;  3G48 A;  1W3S A;  3BJU A;  3RLO A;  4HJ5 A;  2IX0 A;  4B3T L;  4Y52 H;  4GOP B;  1N32 L;  4DV7 L;  4A3J G;  1TWH H;  3U4V A;  1PH6 A;  5FLM H;  5LMN W;  5FJ8 H;  2HHH Q;  3GTM H;  3U58 A;  4JI3 L;  3GTQ H;  1A0I A;  4A3M H;  2A8V A;  4OXP A;  2E5L Q;  1PFS A;  4EX5 A;  1VS0 A;  4IFD J;  4DV0 Q;  4OO1 I;  1XPU A;  5C3E H;  2RHQ B;  2WB1 G;  4DR5 L;  2EXD A;  2HIV A;  3CF5 A;  4A3I H;  3EIV A;  3A74 A;  1OXX K;  3STB D;  1YIT A;  3D0F A;  4YCV A;  3UDX A;  2NVX H;  3H3V I;  3I4N H;  4GKK L;  5GAD C;  4MZ9 A;  1XNQ L;  4LF8 Q;  4LW1 A;  4PG3 A;  3UDG A;  4OWX B;  3PGZ A;  1R9T H;  4LNQ A;  4JG2 A;  1Y1V H;  4LUO A;  2PQA A;  3CCR A;  1HNZ Q;  4DR1 Q;  2BH2 A;  2UUB L;  2VUM G;  4BBS H;  1I94 L;  3KDF B;  5IY0 A;  2OQ0 A;  4UY8 C;  2KCT A;  2PI2 E;  1VQ8 A;  4AQY L;  4TVA B;  4DR4 Q;  4YCU A;  1QUQ B;  5IYC G;  1PV4 A;  2R7Z G;  4QIW E;  1SR3 A;  4HID A;  1VQA A;  4GN3 B;  1BBW A;  4IPD A;  2VY3 A;  3W1G A;  5M5Y H;  4A3F H;  2OTJ A;  1KAW A;  4KLK A;  2ID0 A;  2E2H H;  1N33 L;  2GN5 A;  2UUA Q;  1UE7 A;  2R7D A;  3HOY H;  4JI4 L;  4ME3 A;  2JK8 A;  3GO5 A;  5IP7 H;  2Z6K C;  2JA7 H;  4L5T A;  4IJH A;  3AQQ A;  1JJG A;  2YTY A;  5BR8 Q;  2KCM A;  2WB1 E;  2L15 A;  1OXV A;  3VDY A;  3EN2 A;  4BXX H;  3LGJ A;  1BKB A;  4R4Q A;  2Z0S A;  3CC2 A;  4H02 A;  4YCW A;  4DR2 Q;  3HOX G;  4DR6 Q;  1EQR A;  3KOJ A;  4DNI A;  1WCM G;  3M7N A;  3PIO A;  1ASZ A;  4XIG S;  5AJ3 Q;  3K7U C;  1B8A A;  1TWA H;  2PQA B;  1V1Q A;  2BH8 A;  2IHF A;  2KHJ A;  2QGQ A;  5LMU Q;  2VNU D;  4QY7 A;  5IE8 A;  2E8G A;  2E5L L;  2ZM6 Q;  2JA5 G;  4HIK A;  4DV0 L;  1Q86 C;  4HJ7 A;  2N3S A;  1X3G A;  2Z6K A;  2I5M X;  1U5K A;  3H0G H;  2Q2T A;  1VQ7 A;  4A4I A;  2ES2 A;  4JBJ A;  4A3B G;  4BY7 H;  3GTO H;  1AE2 A;  3M9B A;  3BU2 A;  3L7Z C;  5C4X G;  4R4T A;  4YY3 Q;  1K0R A;  4NPS A;  2JA8 H;  3B6Y A;  3ULJ A;  1CKM A;  4OWT B;  2I5H A;  4IOC A;  5IWA Q;  3NEN A;  5M3M H;  4JI7 Q;  4JV5 Q;  2ALY B;  2UU9 Q;  3PUY A;  1P8L A;  1S3O A;  2MO0 A;  1CSQ A;  4HJ8 A;  1VQE A;  4DR1 L;  1KRT A;  1KD1 C;  2DGY A;  1HNZ L;  3A0J A;  2IHE A;  2VZA A;  4LF9 Q;  2CCZ A;  3CCM A;  4DV7 Q;  4LFB L;  1QZH A;  4RG1 A;  3F2D A;  3OTO L;  2OQK A;  4IPC A;  3S16 H;  3RR5 A;  2VW9 A;  1BVS A;  2WP8 J;  4IPG A;  5GQO A;  1PYS B;  1UE6 A;  1K8A C;  1E24 A;  4X62 L;  1X65 A;  4DV3 Q;  3SGI A;  2UUA L;  4PZ8 A;  1XNR Q;  3J7A 5;  1TWC H;  4AIM A;  3HOZ H;  2C35 B;  4P74 A;  3CPF A;  4R4I A;  3PF5 A;  2ASB A;  3ULP A;  3AYH B;  4A3C H;  2JEA I;  1OXS C;  1Q12 A;  5BR8 L;  1Q81 C;  1P16 A;  4X65 Q;  5M3F G;  4GLA C;  2NN6 G;  3UE0 A;  2YTX A;  1O7I A;  2N8N A;  3J81 j;  4DR2 L;  1K73 C;  4DR6 L;  4X64 Q;  3CQZ H;  4A3E H;  2OTL A;  3D31 A;  4AQY Q;  2ZTC A;  2KHI A;  2EIF A;  3WWV A;  2QEX A;  4IFD G;  4O2D A;  5AJ3 L;  5EAY A;  1B70 B;  3S2D H;  2ZJR A;  3L0O A;  3GTP H;  3DM3 A;  3MEF A;  3G71 A;  3PV0 A;  2VS1 A;  1JJ2 A;  3I4O A;  2GVA A;  5C44 H;  1KRS A;  5IYB G;  4A3G H;  1Q1B A;  1VQF A;  3S1M H;  1GD7 A;  1XMO Q;  4DAM A;  3F8T A;  4LF6 Q;  3J81 i;  2NN6 I;  3JC6 6;  3FKI H;  4YY3 L;  4LF4 Q;  4DK3 C;  2NVT H;  3H3V H;  4IO9 A;  1YIJ A;  3S15 H;  5IWA L;  4JI7 L;  4IFD I;  2BA0 A;  4JV5 L;  4POG A;  1TWF H;  2UU9 L;  3PO2 G;  4A3J H;  1OTC A;  3HOU G;  1FJG Q;  4HJA A;  4LF9 L;  5GRO A;  4KHZ A;  1KHI A;  2DUD A;  1L1O C;  3CPW A;  2HIX A;  1A8V A;  5IP9 G;  3CCQ A;  3T1H Q;  4NXM Q;  3UDI A;  2E2I H;  1D8L A;  1NTG A;  1MJE A;  1XMQ Q;  4JOI C;  4EQ5 A;  1BBU A;  1E3P A;  1G29 1;  3E9I A;  1V9P A;  1VQ5 A;  4C3J H;  1YI2 A;  3M3Y H;  4B3M Q;  4B3R Q;  2K14 A;  3J81 c;  4DV3 L;  1UWV A;  4BA1 I;  1XNR L;  2WFW A;  2CKZ B;  1Y14 B;  1M1K C;  5HY6 A;  2I0Q A;  4P71 A;  3L2P A;  1VQJ A;  3PUZ A;  4DV4 Q;  1E7Z A;  3S1N H;  1PH8 A;  1I6H H;  4DV1 Q;  1PH7 A;  3RLF A;  4BY1 G;  2VUM H;  3CCE A;  2NZO A;  5IT9 c;  1B7Y B;  3PO3 G;  3UE1 A;  4OON A;  1E22 A;  4X65 L;  1XTD A;  1XPR A;  2R93 G;  3CD6 A;  2R7Z H;  5IYC H;  3BZC A;  2YYZ A;  1LUZ A;  1IBM Q;  4X6A H;  4X64 L;  1L1O A;  4LFB Q;  5M5W H;  4JBM A;  4L5Q A;  4IOA A;  1HZA A;  3OTO Q;  2OWO A;  2B63 G;  1LTL A;  3ER0 A;  1D7Q A;  4JYA Q;  3NEM A;  4R1J A;  4DR7 Q;  4X62 Q;  3STB C;  3CCV A;  1AH9 A;  3K7A H;  1JB7 A;  1N8R C;  2B29 A;  3GD7 A;  1SFO H;  1XMO L;  2Q2H A;  2UXB Q;  1WFQ A;  3FHW A;  4LF6 L;  3I4N G;  2V1C C;  4J15 A;  1X55 A;  4UPA A;  5HGQ A;  1KQS A;  1YHA A;  3HOX H;  4L5S A;  1N36 Q;  4LF4 L;  2PMZ E;  1I5F A;  1WCM H;  1Y1W G;  3I7F A;  1T9H A;  4XTC S;  1C7Y A;  4R4O A;  2YU9 H;  3UDF A;  1VQN A;  1H95 A;  5GAE C;  2RF4 A;  4DKA C;  4IJL A;  4BBS G;  2NVY H;  1FVI A;  4P75 A;  1FJG L;  4BBR G;  1IBK Q;  4WJ4 A;  4NB3 A;  1I3Q H;  5K36 G;  2K5H A;  1CSP A;  4LWC A;  4Y7N H;  2YTV A;  2JA5 H;  2AMC B;  2XTI A;  3W5O A;  3T1H L;  4NXM L;  1XMQ L;  4A3B H;  1L1O B;  1GM5 A;  4C2M H;  5C4X H;  4PMW A;  3I56 A;  4B3M L;  4B3R L;  4A3L G;  4WJ3 M;  1HR0 Q;  1JMC A;  2VQF Q;  1YHQ A;  3K0X A;  4DV4 L;  1U0L A;  2JA7 G;  4LUV A;  4DV1 L;  4LF7 Q;  5JJI A; 
#chains in the Genus database with same CATH topology
 1O7Z A;  4DR3 H;  1GO3 E;  3E3X A;  1CM9 A;  4HIO A;  2A74 C;  3WDN A;  3KJO A;  3KF8 B;  1V1O A;  2HQL A;  1DM0 B;  3GID A;  1B6R A;  1SDF A;  2AQ4 A;  4K6L A;  1CT1 D;  3FKI A;  4QF4 A;  1EQQ A;  3VPD A;  4YJ3 F;  4TQS A;  3CAM A;  3LWE A;  1YNN C;  1S72 A;  1KNA A;  3C0F B;  4LJZ C;  1EIY B;  2FMA A;  1RL2 A;  3H0G G;  4B3T H;  2K4K A;  1NR2 A;  2SEB D;  2LSS A;  4DV7 H;  2D2C C;  3CXC A;  1IYJ B;  5KKN B;  1TXY A;  4O4I F;  1N34 L;  2JJQ A;  5JEA J;  2UUC L;  3GV3 A;  3OMG A;  3CC4 A;  2WKC A;  3GTG H;  2C5C A;  2I07 B;  4N8X 1;  3PZP A;  4IR9 A;  1ESR A;  2IX1 A;  4DR5 H;  4EEY A;  1BJT A;  2PBZ A;  5D65 A;  3RIZ A;  3GTJ A;  4HCE A;  4F8M A;  3QZ7 A;  1II3 A;  4QQB X;  4A93 B;  4DUY Q;  5KFI A;  2EDG A;  1B53 A;  4P72 A;  3SHL A;  1XTC D;  4KY5 A;  4DAY B;  2D0P A;  1HZ9 A;  3IRB A;  3QOL A;  5COY A;  2R7Z A;  4J0M A;  4A3D G;  4OO1 H;  1DV2 A;  1CQI B;  4PZ7 A;  3G6E A;  3TZU A;  2Z1C A;  4JI8 Q;  4ED6 A;  2RDH A;  4A2A A;  3FDT A;  2IY5 B;  3JRW A;  2PQE A;  2YRX A;  4ILW A;  2YW2 A;  2KEC A;  3IKJ A;  3X3N A;  2JEF A;  2VOB A;  1YBY A;  3PVX A;  5FLX W;  1H9S A;  2R82 A;  1LT6 D;  1NY4 A;  4JI4 H;  4OL7 A;  1PHJ A;  3CME A;  5IYZ F;  1D5X C;  1Y8P B;  3M3Y B;  1WCM A;  2B2U C;  1DIK A;  3CKI B;  4FBU A;  4CJ2 C;  1VMC A;  3ZJY C;  2XD4 A;  1I6H B;  4RCN A;  4DFA A;  2JA5 A;  5C4J B;  2E75 C;  3Q2O A;  1J5E L;  3VMM A;  4ZHQ F;  3AEV A;  2E5L H;  1NJI C;  5I47 A;  1JE4 A;  2R7K A;  1H9K A;  4JI5 Q;  4RNN A;  5A35 A;  2CQO A;  3I91 A;  1EYG A;  1EQT A;  1JQY D;  2O4X A;  2JEB I;  2EJF C;  5CC4 A;  2A1A A;  2AHO B;  3T5J A;  1HZB A;  1S97 A;  3PF4 A;  3E9H A;  1WD0 A;  4DUY L;  1WSC A;  3M9N B;  2IA6 A;  4JCV E;  2DJF C;  4DR1 H;  1Y1W B;  2O03 A;  1QVC A;  2C2R A;  3PW4 A;  2F0T A;  2F3I A;  4U68 A;  3OWF A;  2ZXR A;  1L2F A;  5KFH A;  1CK1 A;  4QMG A;  1BF4 A;  4JI8 L;  5T1G A;  3ND8 A;  1WR2 A;  4KY6 A;  3VYR A;  1Z2P X;  5E3F A;  2WAQ G;  1MKH A;  2ZT9 C;  3FMA A;  4Y7N B;  2WII B;  2BQU A;  3T51 B;  3BS1 A;  5JOB A;  4LFC Q;  4A3B B;  2LXK A;  4A3L H;  3T13 A;  4A3F G;  5C4X B;  2FK2 A;  3GTG A;  2X69 A;  5CAE B;  4DR2 H;  3KUP A;  4CC5 A;  3HP3 A;  4H0L C;  3GDE A;  5JVD F;  4DR6 H;  2J0T D;  2MHV A;  3HOY G;  3HB9 A;  3F1Z A;  4ED2 A;  1Z9F A;  4R8I A;  4AYB G;  1PVO A;  4LSX A;  3JAM i;  1PK8 A;  3RB4 A;  1VF5 C;  1Q8I A;  3GTL A;  3RN2 A;  3J80 c;  2R92 H;  4ECX A;  1HFG A;  2ZJP A;  4JI0 Q;  4EG0 A;  3DXJ C;  4JI5 L;  1SEB D;  4K14 A;  1STE A;  2P5Z X;  4JV0 A;  3TP5 A;  5C0X I;  4DR3 Q;  3RN5 A;  1W6J A;  4C1N I;  2K5W A;  3Q6S A;  4RWS C;  2F52 A;  2O5I C;  4O3S A;  1S5C D;  5KT4 A;  5JVG 3;  5EJW A;  3S14 B;  5HBR B;  4FS1 A;  1M6V A;  5M3F B;  1F2Y A;  1S40 A;  3NWS A;  4LF8 L;  5E4X A;  4BY7 G;  3J7Z C;  1VQH A;  3VYT A;  2JA8 G;  4B3T Q;  2PMZ A;  3Q8R B;  5KG4 A;  2KED A;  4EFE A;  4MV3 A;  1IL8 A;  4ECU A;  1YZ6 A;  4DR4 L;  1ILQ A;  1W93 A;  2B3G A;  3JZI A;  1XNR H;  1SNO A;  4TQU S;  3CRK C;  4C56 C;  2MNA A;  4A3D B;  1A2T A;  1Q46 A;  3ZYY X;  4LFC L;  5KT2 A;  2F0F A;  4DR5 Q;  2PNH A;  3HKS A;  4KKU A;  1D1I A;  2F0W A;  4YWM A;  3S24 A;  1X56 A;  4RMF A;  2OEO A;  4XQQ A;  1UE1 A;  1HQR D;  1F9S A;  3G8C A;  4KHV A;  4X64 H;  3HOZ G;  1VDZ A;  2YCH A;  3M4O B;  2H5X A;  2VQE Q;  2ATW A;  5KFU A;  1QCB D;  3TZD A;  1PFN A;  3PO2 H;  3MVV A;  4DK6 C;  4A3K H;  3RZO H;  3E0J A;  4ZUI A;  4QUF A;  3HOU H;  3RUP A;  3OYY A;  2F3W A;  2HDM A;  5COR A;  4RKL A;  4BWS C;  4JI0 L;  3K5O A;  4FXK C;  1EYZ A;  4J1M A;  4TKO B;  3T56 B;  3CVZ A;  3BA9 A;  1KTK A;  4DR3 L;  2QIL A;  3OPO A;  1PA6 A;  1JOO A;  3KXY T;  3J80 L;  2B2W C;  3QO2 A;  1IKM A;  1GYF A;  2N55 A;  4C3I B;  4JI4 Q;  4ME6 A;  4Q8F A;  4CHT B;  3NQI A;  2XC9 A;  1RYR A;  4BY1 H;  4ZRZ A;  4DNR B;  4OO1 G;  2R93 B;  1PZK D;  4U7C A;  5IGB A;  3PQI A;  4GNX B;  2EPB A;  5ELN A;  4A76 A;  4GS3 A;  4QW9 A;  4MHE A;  2M05 A;  2OCE A;  4I7H A;  1PH3 A;  4HNU A;  4OIK A;  2IW3 A;  3BJY A;  1W3S A;  4B3T L;  1TY2 A;  4GOP B;  2DPJ A;  4DV7 L;  3GTQ B;  2W9C B;  1TWH H;  3U4V A;  1PH6 A;  4B3M H;  5IGE A;  3PIO 3;  1EEF D;  5LMN W;  1O75 A;  5J39 A;  1A0I A;  1PTO B;  3R2I A;  4Y8V B;  2E5L Q;  1XYI A;  1AZP A;  3T5H A;  5C3E H;  3J7A F;  4DR5 L;  1EZ8 A;  4OEM B;  2R92 A;  4A3I H;  3EIV A;  3A74 A;  1YIT A;  3FDS A;  3OSN A;  4YCV A;  1TA8 A;  5GAD C;  1H9J A;  4JV2 A;  4BBS B;  1STH A;  1Z2O X;  4XT1 B;  2NUC A;  2FB9 A;  4Q5V A;  4DR1 Q;  4ZCK A;  2QDB A;  5IY0 A;  4UY8 C;  4JYA H;  2KCT A;  2PI2 E;  1E4G T;  3Q23 A;  2KEE A;  5K36 H;  3Q8S B;  1QUQ B;  1BCP D;  4LH7 A;  4A3F B;  3D3R A;  4HID A;  4IAJ A;  3U9S A;  2ZXP A;  2V59 A;  4KLK A;  2ID0 A;  3HOY B;  2SOB A;  1GGO A;  1RKN A;  2JA7 B;  2TSS A;  4RUA A;  4JI4 L;  2JK8 A;  3GO5 A;  5IP7 H;  2EYP A;  2HDL A;  1E2Z A;  3L3O C;  3A7A B;  4L5T A;  1JJG A;  1PZI D;  2YTY A;  1IBK H;  5KFO A;  2SDF A;  4DR2 Q;  4P2C B;  4DR6 Q;  1CHQ D;  4DAV A;  2W8L A;  3H6M A;  3R93 A;  4ZLT F;  3ETJ A;  1B8A A;  2PQA B;  1HR0 H;  3I4L A;  5LXT F;  4QY7 A;  2V4D A;  2R8J A;  2E5L L;  2UVV A;  2JA6 B;  1ZXT A;  4RB2 C;  3I4M H;  4WD3 A;  2W9A A;  2K6A A;  2JA8 B;  1VQ7 A;  4B3S H;  1AE2 A;  3S17 B;  3BU2 A;  1K0R A;  4NPS A;  3MWD A;  5LA6 F;  1CKM A;  1R4Q B;  2ASL A;  3NEN A;  5M3M H;  3KAJ A;  1EHI A;  4ED0 A;  5EKI A;  2ALY B;  4J9L A;  1S0N A;  3PUY A;  1P8L A;  1CSQ A;  1TS3 A;  4DR1 L;  1CS0 A;  4Z9C B;  3IN5 A;  2UVU A;  5CV4 A;  4RG1 A;  3RR5 A;  4IPG A;  4ZKC B;  1PYS B;  2NB0 A;  5M5X B;  4R8U A;  3HOZ B;  4CGY B;  4R8N A;  2GPW A;  1XNR Q;  1HRJ A;  3CPF A;  4R4I A;  1EZ1 A;  1RF2 D;  5KFQ A;  5J2T F;  4N9T A;  1SAP A;  1P16 A;  3S1Q B;  3RAQ A;  4GLA C;  2YYA A;  3X3M A;  2PO4 A;  4DR2 L;  1K73 C;  1Q3L A;  3MFG A;  3J81 j;  2B2T C;  4X64 Q;  4DR6 L;  4A3E H;  1VAJ A;  2UXD H;  1SYG A;  1S03 G;  2ZTC A;  5KFM A;  4O2D A;  3GIJ A;  1B70 B;  2V4Q A;  3MEF A;  4GKJ H;  3G71 A;  3J7A V;  3QG1 A;  2LKV A;  2VS1 A;  1JJ2 A;  4DV6 H;  1AP0 A;  1LO5 D;  3I4O A;  4UCR A;  1KRS A;  5IYB G;  2FMM A;  4GC6 A;  3CHB D;  4S3S A;  5EPL A;  1TS2 A;  1Y69 U;  3BVZ A;  3HOW B;  3RJ0 A;  3WO0 A;  2NN6 I;  3BAA A;  3H4D A;  1UNN C;  1TR5 A;  2D9U A;  1QE6 A;  3BG5 A;  1NSN S;  3JC6 6;  2NVT H;  1SEI A;  4DK3 C;  4RAY A;  5LL6 b;  1YIJ A;  5IGC A;  1TWF H;  3PO2 G;  2B2Y C;  3HOU G;  3D6C A;  3OIQ A;  3GTM B;  2XVS A;  5GRO A;  4ECQ A;  4KHZ A;  2E2I B;  2DUD A;  5IGD A;  3DWA A;  4A3M B;  4RUC A;  1DV1 A;  4YHH H;  1UUP A;  5IP9 G;  1F2L A;  1JKJ B;  5F9N A;  4J9Q A;  4C5A A;  1E3P A;  2ZDH A;  2O5J C;  4C3J H;  5JH7 F;  1YI2 A;  3M3Y H;  4B3M Q;  2NVX B;  1XNR L;  2CKZ B;  3J7A K;  4F4W A;  2A69 C;  1I3Q A;  1PH8 A;  1I6H H;  2NU6 B;  1PRT D;  1PH7 A;  1Y1V B;  4BY1 G;  5FOB B;  3CCE A;  5IT9 c;  1SYB A;  3AMU A;  1Q90 A;  3UE1 A;  3GIM A;  1XTD A;  4O1N A;  1TQO A;  1KBL A;  3BZC A;  2QYZ A;  4MV7 A;  4Q0F A;  4X64 L;  4ZYS A;  4ZQ3 A;  4DL6 A;  2B63 G;  4YAJ B;  4G7O C;  1SE2 A;  2ZDG A;  1FGB D;  4CDE C;  4JYA Q;  1TU2 B;  5DLG A;  2YS6 A;  4WOR A;  1U4M A;  4X62 Q;  1EUD B;  3D4D A;  5ELE A;  5A2Q E;  1N8R C;  1N34 H;  2UUC H;  4M7E A;  4EBC A;  2B29 A;  2V1C C;  3KF8 A;  4LFA H;  1KLG D;  2C2D A;  1VMP A;  1J8I A;  4IZ8 A;  4XTC S;  3NPP A;  3OSO A;  3V6K A;  4KKT A;  3DEP A;  2NVY H;  2VXW A;  3MXP A;  5EBC A;  2QW7 A;  1CI3 M;  1ENC A;  3SEB A;  1IBK Q;  4FF1 A;  3L9A X;  3M7G A;  1AUX A;  1ONL A;  5K36 G;  4Y7N H;  3DWQ A;  1A9X A;  2W9B B;  1SSO A;  1EL0 A;  2L11 A;  3A8J E;  4JI2 H;  5FK9 C;  4A3B H;  1L1O B;  1JIH A;  5LP6 F;  4KN7 C;  3G6J B;  4OX9 H;  2XRQ D;  5C4X H;  1PYW D;  4PMW A;  4B3M L;  1SJH D;  2MJ8 A;  1WTO A;  1SMY C;  1HR0 Q;  1B3A A;  2R86 A;  3DHQ A;  1YHQ A;  2WYO A;  4XZ3 B;  1U0L A;  4UFZ A;  3M9O B;  5LMU H;  3MXG A;  4MNO A;  2Q8R E;  3TDQ A;  4O2B F;  4B3S Q;  4X66 H;  2F0P A;  3EQL C;  4DAY A;  3BDC A;  1LLR D;  4IUT A;  5EDW A;  2PI2 A;  5LOV F;  2XGP A;  3Q0A A;  4GN5 A;  1G2S A;  1WTH A;  1C9O A;  1OXU A;  1G2T A;  2FMC A;  4O4H F;  5IT9 L;  1LTB D;  1STY A;  4PZ6 A;  5BN4 A;  3T4A C;  4JYA L;  2A6H C;  2OF1 A;  1TWC B;  4F87 A;  3K59 A;  1J5E H;  4O0A A;  4J9N A;  4DPG A;  3I4M G;  1UAP A;  3A5Z B;  2Y0S G;  3BVG A;  3NTI A;  2BOS A;  3TS2 A;  5M3F H;  5KFK A;  1KEE A;  3N6R A;  2JEI A;  1WTX A;  2F0O A;  4IFD H;  1PTO C;  3TP8 A;  1GSO A;  2VA2 A;  2A6E C;  5I9P A;  2WDT A;  3GTK H;  3FPP A;  4ZK9 B;  1IBK L;  2KBN A;  2XIW A;  1BCP B;  1CTM A;  2MGS A;  1MJC A;  2ICE C;  4RHS A;  1V51 A;  2WV6 D;  4PQX A;  2UXD Q;  1K83 B;  3HRZ C;  1YHB A;  4QJF A;  5IGF A;  1I94 H;  4R4C A;  4TSS A;  2EZV A;  4GKJ Q;  1HR0 L;  4QIW B;  1E2V A;  5GON F;  4JVZ A;  3BQ1 A;  1Q8K A;  4DV6 Q;  3U4Z A;  2C2E A;  1STA A;  3S1R H;  4YBZ B;  5KT3 A;  4YWL A;  1QOH A;  1WTV A;  2O2L D;  3NP8 A;  4B3S L;  4XYQ A;  1MSH A;  2XGQ A;  4A3E G;  4MV6 A;  2PVP A;  2AQ2 B;  4KV6 A;  2AUK A;  5FO7 B;  2WB1 B;  3CCL A;  5CB4 F;  1PH5 A;  1EY7 A;  3VR3 A;  5IYD G;  2FPG B;  1YNJ C;  2PYK A;  2EOT A;  1B44 D;  3HKZ G;  3U50 C;  1U4P A;  4CBV A;  1JCK B;  5CBA E;  4YHH Q;  3S1N B;  5FD6 A;  1SN8 A;  4N8F A;  4C3I H;  3MFI A;  1N9W A;  2IT1 A;  2VUM B;  4RZR A;  3GTJ H;  3PO3 H;  2F4I A;  1U4L A;  5C3X A;  4WFN 3;  3HOV G;  2R93 H;  2E2J H;  3V6J A;  4DL5 A;  3MZ5 A;  3AU7 A;  2RCN A;  5BN3 A;  3NTK A;  3E6Z X;  4F4X A;  4KY7 A;  3VPB A;  3AFQ A;  3ORR A;  4A75 A;  4EGQ A;  4B08 A;  4FF4 A;  3N6X A;  3IFT A;  5HGT A;  3KF6 B;  2WAC A;  4POF A;  3KLR A;  1IZ6 A;  2A19 A;  3K3P A;  3O13 A;  5FJ8 G;  1PTO H;  3OMC A;  2F03 A;  3TRZ A;  1ILP A;  1EFI D;  4UCO A;  1U4R A;  3RGX A;  2UXD L;  3QOJ A;  4PMC A;  4OEL B;  1SFO B;  3CRL C;  1S9F A;  4JC0 A;  4GKJ L;  3U9O A;  1ASY A;  4ETS A;  3GII A;  1VQ4 A;  4DV6 L;  3RB6 A;  1NAP A;  3GQC A;  1N34 Q;  3HGB A;  2UUC Q;  5LL6 X;  1CFM A;  3CP0 A;  3TBI B;  1B2T A;  2JQO A;  2RBM A;  4BBR H;  4F7X A;  1CZW A;  4IR1 A;  3J80 i;  2JA9 A;  4LFA Q;  3NBH B;  5ELB A;  3K80 C;  1SE8 A;  2UUA H;  1B6S A;  2XN9 C;  4F4Z A;  5C3W A;  2F0L A;  3V6H A;  1A63 A;  4HQ6 A;  3RBE A;  1VQG A;  3RTX A;  1W96 A;  3AB9 A;  5BR8 H;  3CU7 A;  1EUC B;  2AGP A;  1L0W A;  5LMN L;  1BDO A;  1BR9 A;  1SYC A;  1JOR A;  1KL9 A;  4R7R A;  5JEA G;  4YHH L;  1SNP A;  3A8K E;  3R8B A;  3GTK A;  3MFH A;  4JI2 Q;  3NEL A;  5EBD A;  2W6P A;  5LYJ F;  3KJP A;  1K8G A;  4OX9 Q;  5KFC A;  2NZH A;  1K3R A;  5JQW A;  4UP8 A;  4BXX G;  1QZG A;  3J81 E;  3R5H A;  2IP4 A;  1BGW A;  3BVM A;  4TUY F;  4H44 C;  5KT5 A;  4KMU C;  1TII D;  3SE7 A;  4FU0 A;  2OH2 A;  1VF7 A;  5GAH C;  4LMY A;  1CKN B;  4OGQ C;  5DAU A;  4X66 Q;  4QWD A;  4JBW A;  1T36 A;  5ELO A;  1N48 A;  4MTK A;  1K8O A;  4F4Y A;  2JA6 H;  1EUJ A;  2PNR C;  4YJ2 F;  5KFF A;  2F1M A;  2QA4 A;  3NHH A;  3RF2 A;  3RNU A;  4J9K A;  2E74 C;  3S17 H;  2C22 A;  5DG8 A;  3F2U A;  2VPQ A;  1SYD A;  3A56 A;  1VQM A;  1WI5 A;  4TRD A;  2MQH A;  1J5E Q;  2XGT A;  4RNO A;  1UNS A;  4UP7 A;  5D1O B;  3N52 A;  5EKL A;  3PUW A;  1Q7Y C;  4YR2 A;  4C3H H;  2A68 D;  4LFA L;  3P75 A;  1RJP A;  3TS0 A;  3KBG A;  2RDF A;  3KLW A;  1RK5 A;  1RTO A;  4ALP A;  2F0D A;  4MV8 A;  2R93 A;  4DL3 A;  1JWU D;  1EIG A;  5E1F A;  2V9W A;  4LH6 A;  1VQP A;  4GNX A;  3GTL H;  1UEB A;  1L2Z A;  5M5X H;  3D6W A;  2L55 A;  2PW7 A;  1SNC A;  1YJW A;  3PR5 B;  5KG3 A;  1LYL A;  1H9R A;  2HQE A;  4GOP A;  3GTQ A;  3H40 A;  3LNN A;  2W9C A;  4K2L A;  2K5N A;  3I70 A;  3ULL A;  4JI2 L;  4HJ9 A;  4GLV B;  5JJL A;  2CQY A;  1TWG B;  1MHW C;  1U9R A;  4A3C G;  1A15 A;  3JAM W;  1I94 Q;  4OX9 L;  1JB3 A;  2QF7 A;  3V96 A;  2K5Q A;  3S1Q H;  4EYH B;  1I4X A;  1ET6 A;  3KHR A;  2K7V A;  1EOV A;  3NK9 A;  1JIC A;  4EBE A;  4HSP A;  4JPB W;  2NU8 B;  5LMU L;  3RV3 A;  2W6M A;  4X66 L;  4LF4 H;  1NE3 A;  4HR7 B;  3HOV B;  1X3E A;  1D5Z C;  5C44 G;  3I55 A;  1CQJ B;  1FJG H;  3HOW H;  2V5A A;  1DZ1 A;  2CW7 A;  1F9R A;  1QUQ A;  2CWA A;  2R6G A;  4DXF A;  3FKI G;  1EY5 A;  3H94 A;  1KJJ A;  3T1H H;  4NXM H;  3G48 A;  3BJU A;  2BE5 D;  4QB4 A;  5FD5 A;  1WTP A;  2JN4 A;  4A3J G;  2JA7 A;  5FLM H;  3BDO A;  3TN2 A;  3GTM H;  1G8Z D;  3U58 A;  4A3M H;  1D2B A;  1IW7 C;  1AUV A;  4FXG C;  4OXP A;  4DV4 H;  1PFS A;  1BCP F;  4A2B A;  1MSG A;  4IFD J;  4QUC A;  1BNZ A;  4OO1 I;  4DLK A;  2RHQ B;  3I4N B;  5KFA A;  5FLX E;  3N43 B;  3CF5 A;  3TII A;  4QW8 A;  3STB D;  1I6V C;  3D0F A;  2NVX H;  2HVS A;  1R9T B;  2Z6B A;  4LF8 Q;  2CW0 D;  1Y1V H;  2SCU B;  3N8D A;  3R5X A;  2PQA A;  1ZYR C;  3CCR A;  4DN4 M;  1I94 L;  3KDF B;  1RTN A;  1VQ8 A;  5I4D A;  2JA6 A;  1BXT A;  2M00 A;  4AQY L;  3MHB A;  4DR4 Q;  4YCU A;  1PV4 A;  2R7Z G;  2RCF A;  4QIW E;  5KIX A;  1VQA A;  1GLV A;  1M0T A;  3W1G A;  2OTJ A;  5M5Y H;  5J2U F;  5C0X H;  2F4V H;  2GN5 A;  4MV9 A;  5A2Q L;  5KFW A;  2UUA Q;  4CKC A;  5FKA C;  3SK6 A;  2V58 A;  4IJH A;  5BR8 Q;  2WB1 E;  2L15 A;  1OXV A;  4TV8 F;  3EN2 A;  3LGJ A;  2DZD A;  1D6E C;  3CC2 A;  4PMB A;  3HOX G;  5CYU A;  1EQR A;  3KOJ A;  1BQQ T;  4DNI A;  1WCM G;  3NBI A;  4FM9 A;  4LK1 C;  1HUN A;  4TQR A;  1C3O A;  2F0N A;  2VB2 X;  4M1U B;  4X3U A;  4RA8 A;  2XCL A;  3K7U C;  2KHJ A;  4KD4 A;  3KAK A;  1QNK A;  5IE8 A;  2E8G A;  4QWC A;  3H0G B;  3G6X A;  1I50 B;  1LT5 D;  2D5D A;  3KLS X;  4HED A;  2JA5 G;  4NKL A;  2KJX A;  3N42 B;  2N3S A;  1CHP D;  2F0K A;  1U5K A;  2AUJ D;  1YNN D;  4C1N K;  4DAP A;  1GUO A;  3VR6 A;  1S5B D;  1QIL A;  5D1P A;  4OWT B;  2B39 A;  2I5H A;  4RHR A;  1WTW A;  1VQE A;  4FF2 A;  1EEI D;  1TS5 A;  2IHE A;  4O4L F;  4DV7 Q;  4LFB L;  5LL6 S;  3F2D A;  3EJI A;  3W3A A;  2XWB B;  2OQK A;  1HXY D;  4NW2 A;  5JVH 3;  1UE6 A;  3KTM A;  5ISR A;  4L63 B;  3DF7 A;  3PMF A;  3Q1K A;  3C3L A;  2UUA L;  1TWC H;  4XT3 B;  4AIM A;  3MTS A;  5CV6 A;  4MIU A;  4CKE A;  1O7L A;  3NWT A;  3ULP A;  3AYH B;  2X6G A;  2JEA I;  3GTM A;  1T5E A;  2E2I A;  5BR8 L;  1Q81 C;  4HMJ A;  3S2D B;  4UCS A;  3P7J A;  2KHI A;  2EIF A;  3WWV A;  3PIP 3;  1HHV A;  4HTH A;  5EAY A;  2PPB C;  2NVX A;  3M4I A;  3L0O A;  3DM3 A;  1GHJ A;  3PV0 A;  1Y1V A;  5CA1 F;  1EZ6 A;  2GVA A;  4A3G H;  1Q1B A;  5EKK A;  2F0G A;  3S1M H;  5EWG A;  4QWE A;  3GV6 A;  2YS7 A;  3VYS A;  4Q44 A;  5D14 A;  2F0J A;  1RJT A;  3HEJ A;  4LF4 Q;  1M4V A;  4I65 A;  4IO9 A;  4LF5 H;  3S15 H;  4FVM A;  4POG A;  1PRT F;  1A6X A;  1J9O A;  2JP1 A;  1FNV A;  3A8I E;  1FJG Q;  4ULL A;  1DOM A;  2EY5 A;  3LWU A;  1A8V A;  2K05 A;  3T1H Q;  4NXM Q;  1WVL A;  2YRW A;  4NXN H;  1NTG A;  1MJE A;  4JOI C;  3MWE A;  2F0S A;  2J9G A;  1LTG D;  1MI2 A;  1JX4 A;  1AEX A;  1DOK A;  3J81 c;  3HXL A;  2WFW A;  3BDL A;  4ED8 A;  5DGB A;  5HY6 A;  4I4T F;  4DV4 Q;  3S1N H;  1O7Y A;  3IG0 A;  5JVL A;  5FPR A;  2VUM H;  2WAQ B;  1MBY A;  2DNC A;  1EU4 A;  3KLS A;  4V0B A;  5IYC H;  5KFB A;  2R3Z A;  2OXP A;  1L1O A;  2NWG A;  3EFX D;  5KT7 A;  4JBM A;  4L5Q A;  4IOA A;  4DL7 A;  5I6W A;  1SJE D;  5KG2 A;  1GUT A;  1D7Q A;  3NEM A;  2E2H B;  2GA4 B;  4PDB A;  1AH9 A;  3CCV A;  4O3Q A;  1STN A;  5KG1 A;  4WRD A;  4ECV A;  4AYB B;  1SFO H;  2PW5 A;  1PDQ A;  2XWJ B;  3T16 A;  1WCM B;  1DOL A;  4UPA A;  1KQS A;  1G6Z A;  3E5N A;  3GLK A;  5F9L A;  2YU9 B;  4L5S A;  4LF4 L;  1HTP A;  4QWA A;  3I7F A;  5LHY 1;  1C7Y A;  3I73 A;  4R4O A;  1B33 N;  1PZJ D;  1FJG L;  2NBF A;  1TWC A;  5I2X A;  2JA5 B;  2FHT A;  1TWA B;  4WJ4 A;  1I3Q H;  1CSP A;  4LWC A;  1KNE A;  2FP4 B;  1EYC A;  2XTI A;  3T1H L;  4RGN A;  4NXM L;  4C2M B;  2KUM A;  2IMW P;  5KNB A;  5DM6 3;  4YQW A;  2CVR A;  3EVQ A;  2YL2 A;  4BY7 B;  1JDB B;  3K6O A;  1DJR D;  4A3L G;  4WJ3 M;  2RA4 A;  3C1F A;  3OHX C;  3K0X A;  4RGO S;  4DV4 L;  4JUZ A;  5L1I A;  4LUV A;  1BOS A;  3TP6 A;  5JJI A;  3SR1 A;  3CCS A;  2YZG A;  4KD3 A;  4ZAI A;  5J22 A;  4RFB A;  3RMH A;  3J81 L;  2DN8 A;  4CDF C;  1K83 A;  3FMC A;  2R7F A;  2R92 G;  2ENB A;  3KK7 A;  3S16 B;  4L5R C;  2AU0 A;  4XXE A;  5JUM A;  1S0M A;  2F0M A;  3TEH B;  4QIW A;  3TQT A;  3PCO B;  1C48 A;  1I4H A;  3P1H A;  4IAL A;  4EEQ A;  4IZO A;  4JI1 H;  1SE4 A;  1HFN A;  5G3L D;  1N32 H;  1PH1 A;  1VQK A;  1HA5 A;  4IPH A;  2ZJQ A;  3H15 A;  4ME5 A;  5IOC A;  4I7A A;  5C0X J;  2F4V L;  1QB5 D;  4G4K A;  2WB1 A;  2K52 A;  5CV5 A;  3CQZ B;  1X54 A;  3I2Z A;  4IRD A;  3A54 A;  5FLX c;  1I4G A;  1NMG A;  4MAM A;  4C5B A;  2D0O A;  2F0H A;  1QG7 A;  2HT1 A;  4Q0Y A;  1VQB A;  3GV5 B;  1CA5 A;  4GKK H;  1LT4 D;  1HPC A;  3FPU B;  3L4J A;  2VUM A;  2JE6 I;  2ZTD A;  4H13 C;  2FXQ A;  1K9M C;  2L5T A;  4A93 H;  5K2M A;  3M85 A;  2A73 B;  2DLN A;  4OHJ A;  3K5H A;  2ATL A;  3MXN B;  2R7N A;  2IPK D;  4LUZ A;  2PZW A;  3KF6 A;  4K5X A;  1O80 A;  3RLN A;  5KFV A;  1TWG H;  1D1K A;  4Q45 A;  1VQL A;  4EQO A;  1PFM A;  3I3C A;  4A3K G;  1R4P B;  1N33 H;  3IAY A;  1JT8 A;  5LMN H;  3H4B A;  4LF5 Q;  1SFO A;  2L12 A;  4QGU A;  3BA8 A;  4HNV A;  3KYH C;  3VR2 A;  3DWP A;  3Q24 A;  2LXJ A;  4CKB A;  2FK1 A;  3N40 P;  3R5F A;  4FDB A;  2F0V A;  3DLL A;  5IOD A;  3UFX B;  2W57 A;  4A3G G;  4NXN Q;  5I6Y A;  4ZI7 F;  4G57 A;  1EFW A;  3NBH A;  1YJN A;  3V4S A;  2JXM B;  5D8D A;  5BMV F;  5C4J H;  1SRU A;  5EZY F;  5M5W B;  1VQ9 A;  3PIP A;  4LSA A;  2EJM A;  4DV0 H;  3R3O A;  2UXC L;  2D62 A;  1GUN A;  2YZN A;  2R8K A;  4JOI A;  2J6T A;  4IUN A;  1BO0 A;  1EY4 A;  1GKH A;  5H1S E;  2R7L A;  4O3N A;  1ENF A;  1LT3 D;  1VKZ A;  2NU9 B;  4RGT A;  1EYA A;  2AWN A;  5CGK A;  3SXH A;  5FLX L;  4M9U A;  1PH4 A;  5C3E G;  2XRS D;  3E0E A;  5DLQ E;  2HGS A;  3HBL A;  4J9R A;  4A3I G;  3CW2 C;  1Y1W H;  3H20 A;  1SRO A;  3NSW A;  3OTO H;  3DMU A;  1IYV A;  1KXL A;  1RYS A;  1STB A;  4IRK A;  2EXZ A;  3H91 A;  1E4E B;  1NNX A;  1CKN A;  1V43 A;  1JJC B;  1XPO A;  3C2P A;  2F0I A;  2G5D A;  4HN7 A;  4ABN A;  2PN1 A;  4FS2 A;  3G6Y A;  5KG6 A;  2KOL A;  1HJP A;  1YEZ A;  2CHB D;  3FP9 A;  1IOV A;  1M90 C;  1DON A;  3CCJ A;  4LF5 L;  1G6P A;  2L1B A;  4FF3 A;  1FGU A;  1SYX B;  3OUU A;  1AN8 A;  4O3P A;  5T1I A;  1VQ6 A;  1SLJ A;  2JEG A;  4UAI A;  4KJO A;  4HMI A;  3SE0 A;  1KJI A;  2XCA A;  5D1O A;  1HCZ A;  3DUZ A;  4E6I A;  4NXN L;  1NCV A;  2EVB A;  1PH2 A;  2J6S A;  4QL5 A;  5IP7 G;  2LS0 1;  1NR4 A;  4IUU A;  5C4Z A;  3GIQ A;  3MWM A;  1F77 A;  1HH2 P;  2B8G A;  1W2B A;  4AH6 A;  4J9O A;  2EYM A;  1E1T A;  1QVG A;  2HHH L;  2N49 A;  3OW2 A;  5FPO A;  2C28 A;  2FFK B;  4KI0 A;  2AKW B;  1NBW A;  4J9P A;  2A5H A;  2WAQ E;  1Z6H A;  1VQC A;  3BZK A;  4JI7 H;  3UI2 A;  1TWG A;  1I50 H;  3D8G A;  4JV5 H;  3A5U A;  4GNX C;  2FPP B;  2VL6 A;  3S14 H;  3URY A;  4JW0 A;  2Q2I A;  4NP5 A;  1HA6 A;  1F2M A;  4GOP C;  4ED7 A;  4JI1 Q;  2I46 A;  3OUZ A;  5HV6 A;  2K50 A;  5M3M G;  2RSN A;  1JE5 A;  1I7N A;  3K81 C;  1N32 Q;  3MXU A;  2PZT A;  1X32 A;  3H09 A;  4HR7 A;  3J80 W;  4AYB E;  1FNU A;  3JRX A;  2GVB A;  1QNU A;  1T5X D;  4XYL B;  2EQS A;  2PCF B;  5C5J A;  2OLS A;  4A3D H;  4DL4 A;  3JSN A;  3PSI A;  2KCC A;  2Q8T A;  4X65 H;  4GKK Q;  3C46 A;  2KHS A;  3PO2 B;  4CJ1 B;  2I5L X;  4A3K B;  4XYM B;  4AQY H;  2N78 A;  1YJ9 A;  3HOU B;  3RZO B;  4MA0 A;  3M4Q A;  3M4O H;  2BQ3 A;  1XJV A;  3SI8 A;  4UCU A;  2IJ0 A;  1KDB A;  1CA6 A;  2DY7 A;  1K8M A;  4HNT A;  3ORQ A;  2BA1 A;  2TMP A;  3EPG A;  3PUX A;  3NQT A;  2YV5 A;  1KC8 C;  1XMO H;  1Y1W A;  5DQG A;  3KHG A;  1R9T A;  2ZTE A;  3HZX A;  3SK8 A;  4CDD C;  1N33 Q;  3J80 E;  2ZM6 L;  4FO2 A;  2AQ1 B;  5LMN Q;  4EGJ A;  1JXL A;  1V1P B;  4BY1 B;  4A93 G;  1C4Q A;  5DQH A;  1EWH A;  3KDF A;  1O78 A;  4IWY A;  4XDX A;  3VA5 A;  1T3N A;  3ERS X;  2A69 D;  3HFZ B;  3A55 A;  4JI1 L;  1HZC A;  4X3T A;  1TWH B;  1EU3 A;  3RLO A;  4HJ5 A;  2B63 B;  4Y52 H;  4JV1 A;  4Q43 A;  1N32 L;  1JOK A;  3TSS A;  4DL2 A;  4MTD A;  2BDO A;  3GTQ H;  5CV7 A;  5H80 A;  3VYU A;  1NUC A;  4RCO A;  2A8V A;  4EX5 A;  2W71 A;  4DV0 Q;  4ECS A;  1XPU A;  4IQZ A;  5KRU A;  2JYO A;  3KHL A;  4C3J G;  2MP1 A;  3UDX A;  4GKK L;  2ZXO A;  3H3V I;  1LTI D;  5EPK A;  4RKB A;  4V19 0;  1M0W A;  1IBM H;  4MZ9 A;  1PX2 A;  4LFB H;  4LW1 A;  1S5F D;  1TAE A;  3KHH A;  5CV9 A;  2KCN A;  2BH2 A;  4BBS H;  2OQ0 A;  4XX0 B;  3H0G A;  1I50 A;  2IL8 A;  4DR7 H;  2OT2 A;  4TVA B;  1F9P A;  5EWE A;  3M9M B;  2X0S A;  1L0X B;  5C5M A;  2BDN A;  5CV8 A;  5KNC A;  1C8C A;  2K32 A;  3Q8Q B;  3GV7 B;  4A3F H;  4IPD A;  2UXB H;  1ZQ7 A;  1K3B C;  1LTT D;  2I87 A;  3ETH A;  2NTT A;  4MTE A;  2E2H H;  1N33 L;  1N36 H;  4EQN A;  4WBN F;  2R7D A;  4ECW A;  5CMD A;  3MA2 B;  4NDX A;  3HOY H;  3PW7 A;  2JA7 H;  1SMY D;  1Y8O B;  4FBT A;  3T53 B;  4R4Q A;  1BKB A;  4O2A F;  4L8J A;  4YCW A;  3V2T A;  1RCV D;  1K0S A;  3S2H B;  4HCS A;  2KQ3 A;  5JPN C;  2Z4H A;  3FRP B;  1TWA H;  2VNU D;  4LMQ D;  5LMU Q;  3DEO A;  2EJG C;  3ONA B;  2VQF H;  3I4M B;  2Y0S B;  4DV0 L;  4LF7 H;  3RZD B;  1Q86 C;  1X3G A;  2Z6K A;  2A6H D;  1BXR A;  4A3B G;  4JBJ A;  4K5W A;  4BY7 H;  3K0Y A;  3M9B A;  1BBX C;  4KHP H;  5M3M B;  5C4X G;  4R4T A;  2JA8 H;  3B6Y A;  3ULJ A;  3G6V A;  1CQF A;  4JI7 Q;  4JI6 H;  3BZD B;  2Z4I A;  3WO1 A;  4EFB A;  4JV5 Q;  1PRT B;  2MO0 A;  4HJ8 A;  1KD1 C;  1G91 A;  1KRT A;  2DGY A;  3LWB A;  2VZA A;  4G7H C;  2R61 A;  1QZH A;  1PTO D;  3OTO L;  4XQN A;  3T1Y H;  1ENA A;  3S16 H;  2A6E D;  3RBD A;  2MUY A;  5GQO A;  5BN5 A;  1K8A C;  1VBG A;  1E24 A;  2RDG A;  2LMC B;  4KTA A;  4K0K H;  4FNF A;  1LAB A;  3HG9 A;  5KFS A;  4PZ8 A;  3HOZ H;  3OSP A;  2QEJ C;  2G9H D;  4P74 A;  2ASB A;  2MCT A;  2E2D C;  2LY7 A;  1I4P A;  3K58 A;  2SNS A;  4X65 Q;  4U67 3;  5M3F G;  4A3E B;  2N8N A;  3CQZ H;  1ULZ A;  3K3V A;  4R9W A;  5KFY A;  4AQY Q;  3RAX A;  4IFD G;  2G9D A;  1ROD A;  2JSO A;  4U6P A;  2NVQ B;  3HKZ B;  5AFW A;  3D4W A;  4APM A;  2ZJR A;  2GPS A;  4RU9 A;  1CE8 A;  2R8H A;  2F0U A;  1PFB A;  4DK1 A;  2IX3 A;  4X3K A;  4FXD A;  4QCL A;  2VQE H;  4NLG A;  1K1Q A;  2WAQ A;  1RHP A;  1YNJ D;  1K1S A;  3KAL A;  3RFC A;  1XMO Q;  2R7M A;  2NVT B;  1S5D D;  3F8T A;  3RGZ A;  4DV2 H;  3J81 i;  2RGR A;  1N56 A;  1UC8 A;  5CA0 F;  1GSA A;  1KJ9 A;  1DCZ A;  1CZG A;  1TWF B;  2K03 A;  4O3O A;  1FKA H;  4JI7 L;  5KG7 A;  2R85 A;  1X3Q A;  3GIP A;  4JV5 L;  1D5M C;  1HTL D;  2F0E A;  3IFD A;  5KFP A;  2E2H A;  2FLP A;  1TY0 A;  1OTC A;  3L4K A;  1KDA A;  2DNE A;  1KHI A;  2FJZ A;  4DUZ H;  4FP5 D;  1L1O C;  3CPW A;  4AYB A;  3JAM E;  4F88 A;  2E2I H;  1D8L A;  4C3J B;  5KFR A;  4ECZ A;  4ODG A;  1GUS A;  4NMZ A;  1G29 1;  3E9I A;  2W9B A;  4DV5 H;  3N44 B;  3VR5 A;  4YB8 B;  2YU9 A;  1C30 A;  1KAB A;  5DM7 3;  3MFY A;  4XQJ A;  2K14 A;  3HS0 C;  2W6N A;  3OHB A;  1Y14 B;  2I0Q A;  4P71 A;  1RK6 A;  3PUZ A;  1JOQ A;  1E7Z A;  4ECR A;  5KFN A;  3MJF A;  1FYC A;  3RLF A;  4C3I G;  1TWA A;  2NZO A;  1B7Y B;  3PO3 G;  2J7Z A;  4OON A;  1E22 A;  4X65 L;  2R93 G;  1XPR A;  4C2M A;  1JC7 A;  1IBM Q;  1LUZ A;  3QB3 A;  1A3V A;  5M5W H;  4LFB Q;  1WTR A;  1HZA A;  4I7Z C;  2F3V A;  5E4W C;  4UCT A;  1LTL A;  4QWB A;  2CQA A;  4DR7 Q;  1KJQ A;  3RV4 A;  5KEE A;  3NTH A;  5CBE E;  2KVM A;  4K5V A;  3RB3 A;  1SYE A;  1Z7T A;  3BYY B;  1XMO L;  2IBK A;  1M8A A;  1WFQ A;  1SNQ A;  3RD4 A;  2UXB Q;  4CDC C;  1X55 A;  2XSC A;  3SDZ A;  1YHA A;  5HGQ A;  4RB1 A;  2H4O A;  1N36 Q;  3PW5 A;  3BYT B;  5BPF A;  3TIN A;  1T9H A;  2NVY B;  1H95 A;  1VQN A;  1EY0 A;  5GAE C;  4BBS G;  4EVO A;  5IT9 W;  2B2V C;  1BCP C;  2K04 A;  5I9O A;  2NU7 B;  2W7P A;  1FVI A;  4P75 A;  4BBR G;  2W8K A;  2YTV A;  2M2L A;  3MR3 A;  2AMC B;  2HCC A;  2K5D A;  1HNX H;  3WOF A;  4ZUJ A;  4J6H A;  1AFP A;  1GM5 A;  1IBL H;  3TME A;  3GTO B;  3I56 A;  3CQZ A;  2VQF Q;  1B3Q A;  5G3L F;  2JA7 G;  1QWY A;  5KYL A;  1RD9 D;  1GJX A;  1E4F T;  4LF7 Q;  3FVQ A;  3T5K A;  4K6D A;  5JPM C;  2WE6 A;  5GAG C;  5BPH A;  1Z47 A;  4KHP Q;  1YNX A;  4MA5 A;  5EPJ A;  1XX8 A;  4KKS A;  5KND A;  2DIK A;  1IBM L;  3F8N A;  1TT2 A;  1OXT A;  4JI6 Q;  4K2K A;  5FO9 B;  1S68 A;  1IXR A;  4FYD A;  2W6Q A;  5IT9 E;  1HNW H;  3MC0 B;  2K75 A;  3MXN A;  1HR0 W;  3ND9 A;  4DR7 L;  4HSV A;  2HVQ A;  3ERO A;  3VA7 A;  5KYI A;  3T1Y Q;  5L9X A;  4RB0 A;  4E4T A;  2EYO A;  4MTN A;  2JA6 G;  1GVP A;  2UXB L;  1X6O A;  1G51 A;  2UXC H;  1J6Q A;  4K0K Q;  4JI3 H;  1SYF A;  1N36 L;  2VQD A;  2PZU A;  1CUK A;  1E2W A;  3GTK B;  1X9N A;  3PUV A;  3OWE B;  3GTP B;  2KEN A;  4EYI B;  2R87 A;  4C3H G;  4Q8E A;  3I90 A;  3J7Y W;  1S0O A;  1PH9 A;  4UP9 A;  1XNQ H;  5IYB H;  5C44 B;  1STG A;  1EIH A;  2C9O A;  3MR6 A;  5ELF A;  2UUB H;  1K83 H;  3CCU A;  2J6U A;  2GLT A;  4ECY A;  1SMX A;  3S1R B;  3FKI B;  1PYB A;  1ZEQ X;  5KX5 F;  2VQF L;  3OOC A;  2AQ3 B;  1EWI A;  1ICW A;  5JAV A;  4ED1 A;  3KFU A;  1DGS A;  3OHA A;  4K8I A;  2NTS A;  4A3J B;  5J1Z A;  4LF7 L;  2Q8I B;  2CWP A;  2Y0S E;  4DV2 Q;  1IYU A;  3TRE A;  4KK7 A;  4KHP L;  2N88 A;  4IRC A;  1B9M A;  5IP9 H;  4I50 F;  1AE3 A;  1ICF B;  3LP8 A;  4JI6 L;  1B04 A;  2EYF A;  1VQD A;  1IW7 D;  3NXW A;  3TQ1 A;  1LV9 A;  1RIP A;  4ZKB B;  3TQY A;  2HVR A;  4DUZ Q;  1E4E A;  1PMR A;  3T1Y L;  3GTJ B;  2RHS B;  3PO3 B;  1TKW B;  3KBX A;  3I8Z A;  1KAA A;  2Z8L A;  1UC9 A;  1GOZ A;  3F2C A;  2E2J B;  4DV5 Q;  1GUG A;  3MAQ A;  1EY8 A;  2HHH H;  1S10 A;  3HOW G;  4K0K L;  1GHK A;  2ZDQ A;  1EWC A;  3A7L A;  1A3T A;  2WTF A;  5L1J A;  2R7Z B;  2FIN B;  5D3D A;  5C4H A;  4GN4 B;  1ZYR D;  1SND A;  2ZJT A;  2B63 H;  4LAA A;  4H7B A;  1JLL B;  1KC7 A;  2JEJ A;  1DXM A;  5JJK A;  1C0A A;  1KDC A;  3G7L A;  1EY9 A;  2B2U A;  4IUQ A;  5IIF A;  5FLM G;  4HYK A;  3K7A B;  2R84 A;  4A3M G;  2QK4 A;  3K57 A;  1HNZ H;  1H9S B;  4RZQ A;  1QVF A;  2V4R A;  3GV8 B;  1PRT C;  2B8F A;  2W6O A;  4JBK A;  3R2T A;  3HKZ E;  3HOX B;  4PNY A;  4GZY C;  2VQE L;  2C00 A;  1A3U A;  3K8A A;  4BBR B;  1MGS A;  5FO8 B;  2F4V Q;  1I4Q A;  2L9H A;  1SBB B;  1Y1V G;  4DV2 L;  1YVC A;  5E7N A;  2FKL A;  4X62 H;  5J3B A;  4YWK A;  1EIF A;  1OWT A;  2FK3 A;  1AW7 A;  4KJN A;  4UHV A;  5KFJ A;  5EWF A;  3PW0 A;  3QIA A;  4TV9 F;  2WKD A;  3MR5 A;  2XCP A;  3EYY A;  2IWH A;  3M4P A;  1MIU A;  1MZB A;  2UVW A;  2R8G A;  1EYD A;  1KLU D;  1WYD A;  2CH4 W;  5C0X G;  3Q8D A;  1Q82 C;  5L1K A;  4DUZ L;  4ZOL F;  1HNX Q;  4DXG A;  3W1B A;  5EGT A;  5KT6 A;  4DV5 L;  1MD2 D;  3SVM A;  1IBL Q;  2ALZ A;  1VQO A;  4BA2 I;  3G4S A;  2B2V A;  1XXG A;  5C6A A;  3UQ8 A;  2ZM6 H;  5DGA A;  1WJJ A;  1Z2N X;  1E1O A;  2Q2U A;  4XYO A;  5C8Y F;  4WJW A;  3S2H H;  1HUM A;  4HAE A;  4GLX A;  2FPI B;  1K28 A;  1X3F A;  4YY3 H;  4EBD A;  5IWA H;  3OW7 A;  1UE5 A;  2UU9 H;  1A62 A;  2L0C A;  5D3I B;  1H9M A;  3RZD H;  4N9P A;  4F50 A;  1HNW Q;  1PXU A;  3K5M A;  4OWW B;  3S9W A;  4LF9 H;  1JWM D;  3JAM c;  3NE5 B;  1DYQ A;  2NN6 H;  1VQI A;  2X6L A;  3I12 A;  3GTG B;  3ICE A;  3CC7 A;  1I7L A;  2BQR A;  3SK5 A;  3TP7 A;  1E0B A;  1RDP D;  1W6K A;  3F2B A;  4C3H B;  4X3S A;  2VR1 A;  5K5P A;  1NMF A;  3NGD A;  1V1P A;  1XDN A;  1LM0 A;  1EQV A;  2RKS A;  2UXC Q;  2RDI A;  4APV A;  4JI3 Q;  2NUA B;  4DV3 H;  1ESF A;  1JWS D;  2QDL A;  2L4N A;  1DD2 A;  3GTL B;  2R8I A;  3BQ0 A;  3SK4 A;  1M7J A;  5NUC A;  4P73 A;  1LTA D;  4ID6 A;  1A2U A;  3EBE A;  2DY8 A;  2EYH A;  5DEH A;  1BUV T;  3MEH A;  1FL0 A;  5DNF A;  1FD7 D;  2MFI A;  1TWH A;  4UDU C;  2B63 A;  4YR0 A;  1FR3 A;  2CFM A;  1XNQ Q;  1HNX L;  1TS4 A;  2H1E A;  1IBL L;  1EY6 A;  1WOC A;  2UUB Q;  3D4R A;  1VCI A;  5ELC A;  1ET9 A;  1SXT A;  4C5C A;  2NZ1 D;  2SNM A;  1I6U A;  2EYL A;  2K5V A;  3NUC A;  2MO1 A;  5KFG A;  1Q1E A;  5IYD H;  4RAZ A;  4RGM A;  1IL2 A;  4HIM A;  2NVQ H;  5JJZ A;  4LF6 H;  2PMZ B;  2F0Q A;  3RB0 A;  1KJ8 A;  2VUG A;  1SCU B;  4RB3 C;  2KA7 A;  3AFP A;  2J4X A;  1CKO A;  4DNT B;  3CMA A;  3HOV H;  1HNW L;  3QZ8 A;  1ZHS A;  3PN1 A;  2RGV A;  2AWO A;  1KIX A;  3M4Y A;  4YP3 A;  4K8J A;  5DLF A;  1XMQ H;  2IX0 A;  2HUG A;  1RJQ A;  3GQB A;  1BNC A;  2R6F A;  5A2Q W;  2HD3 A;  2MPM A;  1GUW A;  2HHH Q;  3ITP A;  5FJ8 H;  3JAM L;  2QCP X;  4JI3 L;  3U9T A;  4B3R H;  1UEA B;  2B2W A;  1FNW A;  3DM1 A;  4DGZ A;  2DPI A;  4DV1 H;  1VS0 A;  5DG9 A;  5L1L A;  2WB1 G;  3BAB A;  2EXD A;  2HIV A;  4DF7 A;  3K5L A;  2CZG A;  1OXX K;  1IKL A;  3EA6 A;  5KG0 A;  4ED3 A;  3I4N H;  1XNQ L;  3UDG A;  4PG3 A;  4LNQ A;  4OWX B;  3PGZ A;  3QR8 A;  1R9T H;  2P0A A;  4JG2 A;  4LUO A;  4DA2 A;  1HNZ Q;  1S4Z A;  2UUB L;  2VUM G;  4G7Z C;  1ZHQ A;  5KFE A;  1LTR D;  2K28 A;  3QWN A;  4CC6 A;  2Y0S A;  2K01 A;  5C1P A;  3FEW X;  3VPC A;  5IYC G;  2UVR A;  4B9X A;  1SR3 A;  5M5Y B;  1GSH A;  4GN3 B;  4IUP A;  4PV1 C;  1BBW A;  5TSS A;  2VY3 A;  2CW8 A;  2FLN A;  4OIJ A;  5I2Y A;  1HQM C;  1KAW A;  3GIL A;  4L1K A;  1SE3 A;  5JEA H;  4O42 A;  3WNZ A;  1UE7 A;  2K33 A;  2AGO A;  4ME3 A;  3MWY W;  1QJO A;  2Z6K C;  1I4R A;  3AQQ A;  2KCM A;  3VDY A;  4BXX H;  2Z0S A;  4H02 A;  2R92 B;  1B4O A;  3BG3 A;  3R23 A;  3M7N A;  3PIO A;  1ASZ A;  4XIG S;  2EY2 A;  2ICI A;  5AJ3 Q;  4PWQ A;  3IL8 A;  5HUR A;  2FE3 A;  2I80 A;  5KFD A;  1LTS D;  3Q8P B;  1V1Q A;  2BH8 A;  2IHF A;  2KSW A;  2QGQ A;  3K5I A;  1PTO F;  3P20 A;  5EQ0 A;  3H3V C;  2ZM6 Q;  2K1B A;  2RDJ A;  4HIK A;  4HJ7 A;  5KFZ A;  3H0G H;  3JSL A;  2Q2T A;  2I5M X;  5KFL A;  4A4I A;  2ES2 A;  1WTQ A;  3GTO H;  1IHZ A;  3L7Z C;  1GXD C;  4YY3 Q;  4IOC A;  3K5N A;  1CQV A;  5IWA Q;  3HKZ A;  4MV4 A;  2DWC A;  2UU9 Q;  4RAU C;  1S3O A;  1ZET A;  1HNZ L;  3QJY A;  3A0J A;  4LF9 Q;  2CCZ A;  3CCM A;  4IPC A;  3N41 B;  4RH6 A;  2VW9 A;  1BVS A;  2WP8 J;  4J8Q A;  2ASD A;  4X62 L;  1TWF A;  1X65 A;  4DV3 Q;  3SGI A;  3J7A 5;  4DU9 A;  2C35 B;  5DQI A;  3PF5 A;  2DJG C;  2QKI C;  4A3C H;  5T14 A;  1OXS C;  4L6T B;  4ZQI A;  1V4Y A;  1Q12 A;  3Q22 A;  3I72 A;  2W7O A;  2NN6 G;  3UE0 A;  2YTX A;  1O7I A;  4BWG B;  5KFX A;  2A68 C;  4DUY H;  2OTL A;  3D31 A;  1VBH A;  5CR3 A;  2QEX A;  4J9M A;  2EY6 A;  4MN3 A;  4BS9 A;  2HCI A;  5AJ3 L;  3S2D H;  2WIN B;  4IN3 A;  5L37 A;  3GTP H;  1S5E D;  2M9V A;  2RSO A;  4A3G B;  3BQ2 A;  3S1M B;  4JI8 H;  5C44 H;  3TIG A;  3WOE A;  1VQF A;  2YZM A;  5KFT A;  1GD7 A;  1X3P A;  1ZKO A;  4DAM A;  3ERQ A;  4LF6 Q;  1L0Y B;  3S15 B;  3W2D A;  4R8U B;  3FKI H;  4YY3 L;  3H3V H;  4UCV A;  2W70 A;  5IWA L;  4YR3 A;  4IFD I;  2B2T A;  2BA0 A;  2CH4 A;  2UU9 L;  5F2D A;  1WH2 A;  4I55 F;  4A3J H;  2AGQ A;  4IHJ F;  2EYJ A;  4HJA A;  3MR2 A;  4DK0 A;  1RJR A;  1LAC A;  4LF9 L;  4J9S A;  4G3I A;  1AZQ A;  2Z9H A;  2EY1 A;  2HIX A;  3CCQ A;  3UDI A;  1XMQ Q;  4EQ5 A;  1BBU A;  1F9Q A;  2RQX A;  5C3E B;  3C1E A;  1XWE A;  1V9P A;  1VQ5 A;  4YAK B;  1TVX A;  4CJ0 B;  4A3I B;  5KG5 A;  4MV1 A;  5C1O A;  4B3R Q;  2NVY A;  4DV3 L;  1UWV A;  4BA1 I;  1M1K C;  4O3R A;  3L2P A;  1VQJ A;  3PW2 A;  4ECT A;  1B1Z A;  4JI5 H;  4DV1 Q;  1JR0 D;  2B2Y A;  5EOY A;  2BE5 C;  4GC7 A;  5KGU A;  3RUZ A;  2VPS A;  2W6Z A;  4M8A A;  1JDE A;  3CD6 A;  2R7Z H;  2YYZ A;  4X6A H;  4IWX A;  5ELD A;  4RNM A;  3E5S A;  1EOT A;  3GTO A;  3OTO Q;  4EQP A;  2OWO A;  2NYZ D;  4KN4 C;  1IOW A;  4IUV A;  3ER0 A;  1F2Z A;  1Y8N B;  2ASJ A;  4R1J A;  3QFF A;  4LF8 H;  3T5L A;  5M9O A;  3STB C;  2FLL A;  3PR4 A;  1WD1 A;  3K7A H;  3VR4 A;  1JB7 A;  3EPI A;  5C5L A;  3GD7 A;  1PLF A;  4JK1 C;  1AN7 A;  2Q2H A;  3FHW A;  2E76 C;  4LF6 L;  2CW0 C;  3I4N G;  2HJW A;  4J15 A;  3J81 W;  4DR4 H;  1B9N A;  3GIK A;  3HOX H;  3LX0 A;  1ML0 D;  1I5F A;  1WCM H;  2PMZ E;  1Y1W G;  2XIG A;  2YU9 H;  3UDF A;  2XNA C;  5IGG A;  3LML A;  2RF4 A;  4DKA C;  4IJL A;  2BR0 A;  2VA3 A;  4LFC H;  1I3Q B;  1B50 A;  4IUR A;  1V8Q A;  2VB3 X;  4NB3 A;  2I8C A;  4B9W A;  2K5H A;  1OO9 B;  2BCO A;  3OIP A;  4YIJ A;  2JA5 H;  3W5O A;  1XMQ L;  3GP7 A;  2LFN A;  3V05 A;  4C2M H;  4B3R L;  2RVL A;  1SNM A;  4EGV A;  3V4Z A;  1JMC A;  1T94 A;  5DG7 A;  4JI0 H;  2FJ2 A;  3GTP A;  4DV1 L;  2EE1 A; 
#chains in the Genus database with same CATH homology
 3CCS A;  4MNO A;  1GO3 E;  5GAG C;  4B3S Q;  1Z47 A;  4HIO A;  1YNX A;  4KHP Q;  1IBM L;  2PI2 A;  3KJO A;  3KF8 B;  2R7F A;  4GN5 A;  1OXT A;  4JI6 Q;  2R92 G;  4L5R C;  2HQL A;  1IXR A;  1C9O A;  1OXU A;  3TEH B;  2K75 A;  4PZ6 A;  3PCO B;  1EQQ A;  1HR0 W;  4JYA L;  3CAM A;  1S72 A;  4DR7 L;  3T1Y Q;  1EIY B;  4O0A A;  1RL2 A;  4DPG A;  3H0G G;  3I4M G;  2K4K A;  2Y0S G;  3A5Z B;  4MTN A;  2JA6 G;  1GVP A;  2LSS A;  1PH1 A;  4IPH A;  1VQK A;  2ZJQ A;  1X6O A;  3TS2 A;  2UXB L;  3H15 A;  5M3F H;  3CXC A;  1G51 A;  1J6Q A;  5C0X J;  1IYJ B;  4K0K Q;  1TXY A;  2F4V L;  1N34 L;  1N36 L;  2JJQ A;  5JEA J;  2UUC L;  2K52 A;  3CC4 A;  1CUK A;  3I2Z A;  1X54 A;  3GTG H;  5FLX c;  1X9N A;  3PUV A;  2IX1 A;  1NMG A;  2D0O A;  3GTK H;  1IBK L;  2HT1 A;  1VQB A;  2KEN A;  2KBN A;  1MJC A;  4QQB X;  1PH9 A;  4UP9 A;  4DUY Q;  2ZTD A;  2JE6 I;  4P72 A;  5IYB H;  2FXQ A;  1K9M C;  4DAY B;  2D0P A;  2UXD Q;  1HZ9 A;  1YHB A;  4A93 H;  3IRB A;  4QJF A;  3M85 A;  1K83 H;  4R4C A;  3CCU A;  4A3D G;  1SMX A;  4GKJ Q;  4PZ7 A;  1HR0 L;  1PYB A;  3MXN B;  3G6E A;  2VQF L;  1Q8K A;  4DV6 Q;  1EWI A;  4LUZ A;  4JI8 Q;  3U4Z A;  3S1R H;  3KFU A;  1DGS A;  3KF6 A;  4YWL A;  3RLN A;  4LF7 L;  2IY5 B;  1TWG H;  2CWP A;  2Y0S E;  4DV2 Q;  1VQL A;  3TRE A;  4B3S L;  4A3K G;  4KHP L;  1JT8 A;  1YBY A;  5IP9 H;  1AE3 A;  4A3E G;  4LF5 Q;  4JI6 L;  1NY4 A;  3CCL A;  1PH5 A;  4QGU A;  1PHJ A;  5IYD G;  3CME A;  3KYH C;  3HKZ G;  1VQD A;  2LXJ A;  3U50 C;  1RIP A;  4FDB A;  3TQY A;  3DLL A;  4DUZ Q;  4YHH Q;  3T1Y L;  2RHS B;  3ZJY C;  1SN8 A;  4A3G G;  4NXN Q;  4C3I H;  1N9W A;  3F2C A;  2IT1 A;  1EFW A;  3GTJ H;  4DV5 Q;  3PO3 H;  1YJN A;  3HOV G;  2R93 H;  2E2J H;  3HOW G;  4K0K L;  1J5E L;  2RCN A;  5C4J H;  1SRU A;  3AEV A;  1NJI C;  4GN4 B;  1VQ9 A;  3PIP A;  4JI5 Q;  3AFQ A;  2B63 H;  4A75 A;  2CQO A;  1EYG A;  2UXC L;  2D62 A;  2JEB I;  3KF6 B;  2A1A A;  5JJK A;  2AHO B;  4JOI A;  4POF A;  1C0A A;  1IZ6 A;  1HZB A;  1GKH A;  2A19 A;  5H1S E;  5FLM G;  5FJ8 G;  3PF4 A;  3E9H A;  4DUY L;  4A3M G;  2AWN A;  3TRZ A;  2UXD L;  4JCV E;  1QVF A;  1PH4 A;  5C3E G;  1QVC A;  3E0E A;  5DLQ E;  4JC0 A;  4A3I G;  4JBK A;  1ASY A;  3CW2 C;  3HKZ E;  1Y1W H;  2F3I A;  4GKJ L;  2VQE L;  1SRO A;  1L2F A;  1VQ4 A;  4DV6 L;  3K8A A;  4JI8 L;  1KXL A;  2F4V Q;  1N34 Q;  2UUC Q;  3CP0 A;  1XPO A;  1CKN A;  1V43 A;  1JJC B;  2JQO A;  4BBR H;  1Y1V G;  4DV2 L;  1YVC A;  5E7N A;  2WAQ G;  1MKH A;  3J80 i;  2JA9 A;  1HJP A;  4YWK A;  1YEZ A;  3FP9 A;  3NBH B;  3K80 C;  1SE8 A;  5J3B A;  4LFA Q;  1EIF A;  1M90 C;  3CCJ A;  4LF5 L;  1G6P A;  1A63 A;  1FGU A;  1VQG A;  4LFC Q;  2LXK A;  1VQ6 A;  1SLJ A;  3M4P A;  1L0W A;  5LMN L;  4A3F G;  4A3L H;  1MIU A;  1WYD A;  5C0X G;  1Q82 C;  3Q8D A;  1KL9 A;  4DUZ L;  5JEA G;  4YHH L;  3GDE A;  4NXN L;  1PH2 A;  1HNX Q;  4JI2 Q;  3NEL A;  4QL5 A;  3F1Z A;  3W1B A;  3HOY G;  5IP7 G;  4DV5 L;  1IBL Q;  1Z9F A;  3KJP A;  4AYB G;  1VQO A;  1K8G A;  4OX9 Q;  3JAM i;  4BA2 I;  1PVO A;  2NZH A;  3G4S A;  1K3R A;  1HH2 P;  3RN2 A;  3J80 c;  4UP8 A;  4BXX G;  2R92 H;  1QZG A;  1W2B A;  4AH6 A;  2ZJP A;  4JI0 Q;  1WJJ A;  4JI5 L;  1E1O A;  2Q2U A;  1E1T A;  1QVG A;  2HHH L;  2N49 A;  3OW2 A;  3S2H H;  4KI0 A;  2AKW B;  1NBW A;  5C0X I;  5GAH C;  4DR3 Q;  3RN5 A;  1CKN B;  4X66 Q;  4GLX A;  2WAQ E;  1X3F A;  1VQC A;  2F52 A;  3BZK A;  4JBW A;  5ELO A;  1I50 H;  1UE5 A;  3A5U A;  2JA6 H;  1EUJ A;  1A62 A;  4GNX C;  2QA4 A;  3RZD H;  1HNW Q;  3RNU A;  2VL6 A;  4OWW B;  3S14 H;  3S17 H;  1S40 A;  4LF8 L;  4BY7 G;  3JAM c;  2Q2I A;  3J7Z C;  4GOP C;  1VQM A;  1VQH A;  4JI1 Q;  1VQI A;  2JA8 G;  1WI5 A;  2MQH A;  3CC7 A;  2XGT A;  1J5E Q;  2K50 A;  4UP7 A;  3F2B A;  5M3M G;  4B3T Q;  3ICE A;  1JE5 A;  3K81 C;  1N32 Q;  3PUW A;  1Q7Y C;  1NMF A;  1YZ6 A;  4C3H H;  4DR4 L;  1LM0 A;  4AYB E;  4LFA L;  2UXC Q;  4APV A;  4JI3 Q;  2B3G A;  3TS0 A;  2GVB A;  3KLW A;  4TQU S;  2MNA A;  4ALP A;  1Q46 A;  2EQS A;  4P73 A;  4LFC L;  1VQP A;  4GNX A;  4DR5 Q;  1UEB A;  2PNH A;  3HKS A;  5M5X H;  3EBE A;  3GTL H;  4YWM A;  4A3D H;  3S24 A;  3PSI A;  1X56 A;  4RMF A;  1FL0 A;  1UE1 A;  4GKK Q;  1YJW A;  2MFI A;  1LYL A;  2CFM A;  4GOP A;  1XNQ Q;  3HOZ G;  2I5L X;  1HNX L;  2H5X A;  2K5N A;  3ULL A;  2N78 A;  2VQE Q;  4HJ9 A;  4GLV B;  1YJ9 A;  4JI2 L;  2ATW A;  5JJL A;  1IBL L;  3PO2 H;  4A3C G;  2UUB Q;  1WOC A;  3M4Q A;  4DK6 C;  4A3K H;  1I94 Q;  4OX9 L;  1XJV A;  3RZO H;  3HOU H;  3M4O H;  1VCI A;  3S1Q H;  3OYY A;  1EOV A;  2K5V A;  4JI0 L;  2MO1 A;  2BA1 A;  1Q1E A;  5IYD H;  3PUX A;  2YV5 A;  1IL2 A;  1KC8 C;  4HIM A;  2NVQ H;  5LMU L;  2ZTE A;  4DR3 L;  1PA6 A;  4X66 L;  2ZM6 L;  1N33 Q;  3AFP A;  1NE3 A;  5LMN Q;  3I4M H;  4A93 G;  1CKO A;  1X3E A;  4JI4 Q;  3KDF A;  3CMA A;  5C44 G;  3I55 A;  3HOV H;  1HNW L;  4BY1 H;  4OO1 G;  3ERS X;  3HOW H;  2AWO A;  2CWA A;  1QUQ A;  3HFZ B;  4GNX B;  2R6G A;  5ELN A;  1KIX A;  4A76 A;  4GS3 A;  2OCE A;  1HZC A;  3FKI G;  4JI1 L;  1PH3 A;  3G48 A;  1W3S A;  3BJU A;  3RLO A;  4HJ5 A;  2IX0 A;  4B3T L;  4Y52 H;  4GOP B;  1N32 L;  4DV7 L;  4A3J G;  1TWH H;  3U4V A;  1PH6 A;  5FLM H;  5LMN W;  5FJ8 H;  2HHH Q;  3GTM H;  3U58 A;  4JI3 L;  3GTQ H;  1A0I A;  4A3M H;  2A8V A;  4OXP A;  2E5L Q;  1PFS A;  4EX5 A;  1VS0 A;  4IFD J;  4DV0 Q;  4OO1 I;  1XPU A;  5C3E H;  2RHQ B;  2WB1 G;  4DR5 L;  2EXD A;  2HIV A;  3CF5 A;  4A3I H;  3EIV A;  3A74 A;  1OXX K;  3STB D;  1YIT A;  3D0F A;  4YCV A;  3UDX A;  2NVX H;  3H3V I;  3I4N H;  4GKK L;  5GAD C;  4MZ9 A;  1XNQ L;  4LF8 Q;  4LW1 A;  4PG3 A;  3UDG A;  4OWX B;  3PGZ A;  1R9T H;  4LNQ A;  4JG2 A;  1Y1V H;  4LUO A;  2PQA A;  3CCR A;  1HNZ Q;  4DR1 Q;  2BH2 A;  2UUB L;  2VUM G;  4BBS H;  1I94 L;  3KDF B;  5IY0 A;  2OQ0 A;  4UY8 C;  2KCT A;  2PI2 E;  1VQ8 A;  4AQY L;  4TVA B;  4DR4 Q;  4YCU A;  1QUQ B;  5IYC G;  1PV4 A;  2R7Z G;  4QIW E;  1SR3 A;  4HID A;  1VQA A;  4GN3 B;  1BBW A;  4IPD A;  2VY3 A;  3W1G A;  5M5Y H;  4A3F H;  2OTJ A;  1KAW A;  4KLK A;  2ID0 A;  2E2H H;  1N33 L;  2GN5 A;  2UUA Q;  1UE7 A;  2R7D A;  3HOY H;  4JI4 L;  4ME3 A;  2JK8 A;  3GO5 A;  5IP7 H;  2Z6K C;  2JA7 H;  4L5T A;  4IJH A;  3AQQ A;  1JJG A;  2YTY A;  5BR8 Q;  2KCM A;  2WB1 E;  2L15 A;  1OXV A;  3VDY A;  3EN2 A;  4BXX H;  3LGJ A;  1BKB A;  4R4Q A;  2Z0S A;  3CC2 A;  4H02 A;  4YCW A;  4DR2 Q;  3HOX G;  4DR6 Q;  1EQR A;  3KOJ A;  4DNI A;  1WCM G;  3M7N A;  3PIO A;  1ASZ A;  4XIG S;  5AJ3 Q;  3K7U C;  1B8A A;  1TWA H;  2PQA B;  1V1Q A;  2BH8 A;  2IHF A;  2KHJ A;  2QGQ A;  5LMU Q;  2VNU D;  4QY7 A;  5IE8 A;  2E8G A;  2E5L L;  2ZM6 Q;  2JA5 G;  4HIK A;  4DV0 L;  1Q86 C;  4HJ7 A;  2N3S A;  1X3G A;  2Z6K A;  2I5M X;  1U5K A;  3H0G H;  2Q2T A;  1VQ7 A;  4A4I A;  2ES2 A;  4JBJ A;  4A3B G;  4BY7 H;  3GTO H;  1AE2 A;  3M9B A;  3BU2 A;  3L7Z C;  5C4X G;  4R4T A;  4YY3 Q;  1K0R A;  4NPS A;  2JA8 H;  3B6Y A;  3ULJ A;  1CKM A;  4OWT B;  2I5H A;  4IOC A;  5IWA Q;  3NEN A;  5M3M H;  4JI7 Q;  4JV5 Q;  2ALY B;  2UU9 Q;  3PUY A;  1P8L A;  1S3O A;  2MO0 A;  1CSQ A;  4HJ8 A;  1VQE A;  4DR1 L;  1KRT A;  1KD1 C;  2DGY A;  1HNZ L;  3A0J A;  2IHE A;  2VZA A;  4LF9 Q;  2CCZ A;  3CCM A;  4DV7 Q;  4LFB L;  1QZH A;  4RG1 A;  3F2D A;  3OTO L;  2OQK A;  4IPC A;  3S16 H;  3RR5 A;  2VW9 A;  1BVS A;  2WP8 J;  4IPG A;  5GQO A;  1PYS B;  1UE6 A;  1K8A C;  1E24 A;  4X62 L;  1X65 A;  4DV3 Q;  3SGI A;  2UUA L;  4PZ8 A;  1XNR Q;  3J7A 5;  1TWC H;  4AIM A;  3HOZ H;  2C35 B;  4P74 A;  3CPF A;  4R4I A;  3PF5 A;  2ASB A;  3ULP A;  3AYH B;  4A3C H;  2JEA I;  1OXS C;  1Q12 A;  5BR8 L;  1Q81 C;  1P16 A;  4X65 Q;  5M3F G;  4GLA C;  2NN6 G;  3UE0 A;  2YTX A;  1O7I A;  2N8N A;  3J81 j;  4DR2 L;  1K73 C;  4DR6 L;  4X64 Q;  3CQZ H;  4A3E H;  2OTL A;  3D31 A;  4AQY Q;  2ZTC A;  2KHI A;  2EIF A;  3WWV A;  2QEX A;  4IFD G;  4O2D A;  5AJ3 L;  5EAY A;  1B70 B;  3S2D H;  2ZJR A;  3L0O A;  3GTP H;  3DM3 A;  3MEF A;  3G71 A;  3PV0 A;  2VS1 A;  1JJ2 A;  3I4O A;  2GVA A;  5C44 H;  1KRS A;  5IYB G;  4A3G H;  1Q1B A;  1VQF A;  3S1M H;  1GD7 A;  1XMO Q;  4DAM A;  3F8T A;  4LF6 Q;  3J81 i;  2NN6 I;  3JC6 6;  3FKI H;  4YY3 L;  4LF4 Q;  4DK3 C;  2NVT H;  3H3V H;  4IO9 A;  1YIJ A;  3S15 H;  5IWA L;  4JI7 L;  4IFD I;  2BA0 A;  4JV5 L;  4POG A;  1TWF H;  2UU9 L;  3PO2 G;  4A3J H;  1OTC A;  3HOU G;  1FJG Q;  4HJA A;  4LF9 L;  5GRO A;  4KHZ A;  1KHI A;  2DUD A;  1L1O C;  3CPW A;  2HIX A;  1A8V A;  5IP9 G;  3CCQ A;  3T1H Q;  4NXM Q;  3UDI A;  2E2I H;  1D8L A;  1NTG A;  1MJE A;  1XMQ Q;  4JOI C;  4EQ5 A;  1BBU A;  1E3P A;  1G29 1;  3E9I A;  1V9P A;  1VQ5 A;  4C3J H;  1YI2 A;  3M3Y H;  4B3M Q;  4B3R Q;  2K14 A;  3J81 c;  4DV3 L;  1UWV A;  4BA1 I;  1XNR L;  2WFW A;  2CKZ B;  1Y14 B;  1M1K C;  5HY6 A;  2I0Q A;  4P71 A;  3L2P A;  1VQJ A;  3PUZ A;  4DV4 Q;  1E7Z A;  3S1N H;  1PH8 A;  1I6H H;  4DV1 Q;  1PH7 A;  3RLF A;  4BY1 G;  2VUM H;  3CCE A;  2NZO A;  5IT9 c;  1B7Y B;  3PO3 G;  3UE1 A;  4OON A;  1E22 A;  4X65 L;  1XTD A;  1XPR A;  2R93 G;  3CD6 A;  2R7Z H;  5IYC H;  3BZC A;  2YYZ A;  1LUZ A;  1IBM Q;  4X6A H;  4X64 L;  1L1O A;  4LFB Q;  5M5W H;  4JBM A;  4L5Q A;  4IOA A;  1HZA A;  3OTO Q;  2OWO A;  2B63 G;  1LTL A;  3ER0 A;  1D7Q A;  4JYA Q;  3NEM A;  4R1J A;  4DR7 Q;  4X62 Q;  3STB C;  3CCV A;  1AH9 A;  3K7A H;  1JB7 A;  1N8R C;  2B29 A;  3GD7 A;  1SFO H;  1XMO L;  2Q2H A;  2UXB Q;  1WFQ A;  3FHW A;  4LF6 L;  3I4N G;  2V1C C;  4J15 A;  1X55 A;  4UPA A;  5HGQ A;  1KQS A;  1YHA A;  3HOX H;  4L5S A;  1N36 Q;  4LF4 L;  2PMZ E;  1I5F A;  1WCM H;  1Y1W G;  3I7F A;  1T9H A;  4XTC S;  1C7Y A;  4R4O A;  2YU9 H;  3UDF A;  1VQN A;  1H95 A;  5GAE C;  2RF4 A;  4DKA C;  4IJL A;  4BBS G;  2NVY H;  1FVI A;  4P75 A;  1FJG L;  4BBR G;  1IBK Q;  4WJ4 A;  4NB3 A;  1I3Q H;  5K36 G;  2K5H A;  1CSP A;  4LWC A;  4Y7N H;  2YTV A;  2JA5 H;  2AMC B;  2XTI A;  3W5O A;  3T1H L;  4NXM L;  1XMQ L;  4A3B H;  1L1O B;  1GM5 A;  4C2M H;  5C4X H;  4PMW A;  3I56 A;  4B3M L;  4B3R L;  4A3L G;  4WJ3 M;  1HR0 Q;  1JMC A;  2VQF Q;  1YHQ A;  3K0X A;  4DV4 L;  1U0L A;  2JA7 G;  4LUV A;  4DV1 L;  4LF7 Q;  5JJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...