2B63G

Complete rna polymerase ii-rna inhibitor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b63G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2b63G01
2PI2A 2R7ZG 2R7FA 1HNXL 3FKIH 5HY6A 2HIVA 4NPSA 1JJCB 2IHFA 3E9HA 1W3SA 3ULJA 4C3HH 1VQGA 2Z6KA 5GAGC 2QEXA 3CMAA 1LUZA 4JBWA 2VS1A 5JEAG 4LF4L 2NVTH 3HOVH 1X3GA 3J7A5 4A3LG 2MFIA 4DR7L 5C44H 3HOXH 4DPGA 4GNXA 1IBKQ 2UU9Q 4X64L 4BXXH 1O7IA 2F4VQ 1EIYB 2UXBL 4JI8L 3H3VH 2H5XA 1VQFA 4L5TA 3K81C 5IE8A 3S1NH 5IYCG 4H02A 1VQIA 2NVQH 4A3MH 4DV6L 1TWGH 1E7ZA 1TXYA 1VQ6A 2AMCB 2ZJPA 5GROA 2AHOB 1YJWA 2UXDQ 2C35B 3EN2A 4JI5L 1SN8A 1LM0A 2Z0SA 2D0PA 2D62A 3S14H 4PG3A 1N33L 4X65L 1I94L 1E1OA 1NY4A 3I4NG 1X55A 4PMWA 2IT1A 4IFDI 3K8AA 3PO3G 2KCMA 3CCMA 1Z9FA 1Y1WH 4OO1G 2FXQA 3NEMA 2UUCL 4P71A 3HOUG 4KHPQ 3I2ZA 3U4ZA 4LF9Q 1PHJA 4DR6Q 5ELNA 4ME3A 5IP7G 2B3GA 4HJ8A 4A3FG 1CKNA 4AH6A 2XGTA 1HZBA 4LF5L 4DV5Q 1EIFA 3CCUA 4GLXA 4JYAL 4YY3L 1BBWA 3RZDH 1YHQA 1NMFA 1PH8A 2VQEL 4A3KG 2I5MX 4X66Q 1A0IA 2LXKA 1ASYA 2R92H 4LFBL 5IT9c 1IYJB 2V1CC 3M85A 1V43A 4UP7A 4NXNL 2K5NA 2OCEA 1B8AA 3AFPA 1VQBA 1VS0A 2K4KA 1MJCA 2YV5A 4QJFA 3UE0A 1Q86C 4JI7L 3S15H 1GKHA 3FKIG 3L2PA 1WFQA 3S1QH 3G71A 4GKJQ 3KDFB 2E5LQ 3STBD 3ER0A 4C2MH 4DV7L 3HOVG 1L1OB 2JA9A 2PNHA 4DKAC 3SGIA 4POGA 3GTQH 3JC66 3UDGA 1PVOA 5C44G 3HOXG 3PUXA 1VQJA 2VNUD 1IBLQ 3S2HH 1N36L 1YJNA 1PH4A 2OQKA 3MEFA 3I4MH 1NJIC 1KIXA 1PYBA 1I5FA 2I0QA 4JCVE 3PGZA 2KCTA 4LW1A 4A3MG 3S2DH 2JQOA 3UDXA 2DUDA 5C0XG 1JT8A 1EUJA 4LFCQ 3RZOH 1KQSA 4DR2Q 4RG1A 1PH3A 5C4XH 1WJJA 3G4SA 4LF7L 4NB3A 4P75A 5IWAL 4LFAQ 1SROA 3E9IA 1A8VA 3CXCA 4A3JH 1CUKA 1HR0Q 1VQCA 1C9OA 1FL0A 1TWHH 4JI1L 3A0JA 1G291 1Y1WG 1HNZL 1H95A 1KHIA 1X9NA 4LNQA 3J81c 2F52A 2AKWB 2E8GA 3CC2A 1FJGL 4X62Q 1YHBA 1RIPA 3NENA 1X3FA 4ALPA 3J80c 4K0KL 1Y1VG 2CQOA 5BR8Q 3PO2H 1X65A 4JOIC 2CCZA 4AQYL 3HKZG 2HHHQ 4JBMA 5JJLA 2R92G 2WAQE 2UUBL 1L2FA 2BA1A 1N32L 3MXNB 4LF6Q 4OX9L 3CD6A 4JC0A 4LWCA 3BU2A 3H15A 4DV1L 3GD7A 3OYYA 1TWCH 3CPFA 1V1QA 1QUQA 1VQ4A 3EBEA 2ZTEA 3KOJA 4GKKQ 1C0AA 4P72A 1MKHA 4JOIA 4A3IH 2ZM6Q 2B63H 4YHHL 1A62A 2VUMH 4UPAA 3KF6B 1SFOH 4A93H 4C3JH 4X6AH 3PSIA 3CC7A 1Q12A 3VDYA 3AEVA 3OTOL 4P73A 5LMUQ 3W1GA 4DV2Q 1YNXA 3M3YH 4DR3L 4A3CH 3I4MG 1SR3A 1PA6A 3FP9A 1SLJA 3GDEA 4YCWA 4AYBG 4DV3Q 3H0GH 1KXLA 2QGQA 2NVXH 3D31A 1WCMH 4GLAC 2YU9H 2JA8H 5IP9H 5C4XG 1CSQA 2NZHA 3PUZA 4IFDG 5IYDH 2VW9A 2Q2HA 3TQYA 4A3JG 4B3RQ 5AJ3L 2Y0SG 1W2BA 4NXML 2A19A 1SMXA 4B3ML 1N34Q 2UXDL 3E0EA 2QA4A 1QVFA 4PZ6A 1XNQL 1P16A 1U5KA 3T1HQ 3I56A 1XTDA 4HJ5A 2Q2IA 4JBKA 4UP9A 1PV4A 3PO2G 1XPOA 1YZ6A 1KD1C 4QY7A 1GM5A 4C3IH 4LF4Q 4OWWB 1VQEA 4JI6Q 2MQHA 4UY8C 4BY7H 2ALYB 4KHPL 3PIPA 4HIDA 2VL6A 3U58A 4LF9L 2NN6G 4DR7Q 2Q2UA 4JV5Q 1K9MC 4IPDA 4X64Q 3I55A 3M9BA 2D0OA 3F2BA 4JI8Q 4A3BH 1VQHA 1VQ8A 2A1AA 4OONA 3BZCA 3U50C 2RHSB 3IRBA 1LYLA 1YI2A 5LMNQ 2YTVA 3DM3A 2VY3A 3STBC 2OTJA 4GN5A 4IJLA 1TWAH 2ZJRA 4A3IG 2B63G 5ELOA 1K8AC 4BY1H 2ID0A 3CQZH 2VUMG 4A93G 2YYZA 4X65Q 1N33Q 1XMQQ 1E3PA 2K50A 4DUYQ 4A3EH 4DR4Q 2NN6I 4YCVA 1BKBA 2UXCL 1OXTA 2E2IH 3K0XA 3RLOA 3J7ZC 4DV0L 3LGJA 1AE3A 3I4OA 4DR1Q 3PV0A 4A3CG 2UUCQ 4A76A 1WI5A 5IY0A 5LMNW 3F1ZA 3S16H 4IOAA 3AFQA 4YWLA 4GKJL 3BZKA 3L7ZC 2E5LL 4A4IA 2JE6I 4GS3A 1MJEA 3GTPH 2BA0A 2N8NA 2HT1A 2K5HA 3H0GG 5FLXc 1M90C 4JYAQ 2IY5B 4YY3Q 1WCMG 5M3FH 2JA8G 1IBLL 5IP9G 4QGUA 5IYBH 2VQFL 1XPRA 1PH2A 1D8LA 2OTLA 4BXXG 2JJQA 4HIOA 5IYDG 1VQ7A 3S24A 4LFBQ 4IPGA 5GADC 1JJGA 1K83H 4AIMA 1N8RC 3CF5A 2N3SA 2Q2TA 1JMCA 3TRZA 4JI2L 2R6GA 2WB1E 4BBSH 1YJ9A 4NXNQ 1FGUA 3ULPA 4DR2L 1SRUA 4JI3Q 5HGQA 4LFAL 2JA7H 4JI7Q 1YITA 1HR0L 1C7YA 1OTCA 4YWKA 3KLWA 4GNXB 4HJ7A 2IX0A 1HZCA 4L5QA 3PUYA 4R4TA 3T1YQ 1T9HA 1XNRQ 1XJVA 1P8LA 1B70B 1S40A 1N36Q 4PZ7A 4B3TQ 2ZTDA 3WWVA 3TEHB 5BR8L 2BH2A 2CWAA 2E2JH 3RN5A 5K36G 3A5ZB 4DK6C 3JAMc 1EQQA 1Z47A 2KHJA 1VQLA 3F2CA 1VQPA 2XTIA 3ERSX 4DUZQ 3NBHB 4BY1G 1SE8A 3OW2A 4B3SQ 3ICEA 5IWAQ 1EYGA 2GVBA 2VZAA 3RN2A 1YHAA 2PI2E 2ZTCA 1X54A 5IYCH 2JEBI 2EQSA 4A3EG 4LF8L 2NVYH 3HKSA 2KENA 1UE1A 1IBMQ 4GKKL 3K7AH 4XIGS 4JI1Q 2JA5H 1S3OA 1EQRA 1UWVA 1HNZQ 2ZM6L 2IHEA 1XMOQ 5E7NA 1CKNB 4DR5L 4JI4Q 2E2HH 1FJGQ 3GTJH 1BBUA 1Q46A 1VQNA 2K14A 3I4NH 2KBNA 5LMUL 5JEAJ 3NELA 1L1OC 2UUAQ 1UE7A 1V9PA 3UE1A 3G6EA 5M3FG 4O0AA 4DV4Q 1XNQQ 2KHIA 3B6YA 1QVCA 4O2DA 5FJ8H 5IYBG 2R93H 1YEZA 1D7QA 4LUZA 1J5EQ 1JE5A 3G48A 4A3GH 2UUBQ 1CKOA 1AH9A 2R7DA 4DV3L 1N32Q 1UE6A 4OX9Q 2N78A 4R1JA 4BBSG 1S72A 4DV1Q 1Q81C 4BBRH 1MIUA 3KDFA 1IBKL 2UU9L 1L1OA 4IPCA 2CWPA 1HZAA 1YVCA 1HH2P 3UDFA 2F4VL 2JA7G 1PH5A 1CKMA 1EFWA 3M7NA 4FDBA 4B3RL 1PH7A 5JJKA 1CSPA 1QVGA 3AYHB 1KC8C 3KJPA 4P74A 2IX1A 4IOCA 3CCLA 2OWOA 2MO1A 1QZGA 2ATWA 2HQLA 3M4OH 3RNUA 5DLQE 4YWMA 3J81j 4JI0Q 1IL2A 4DR3Q 1HNWQ 3RLNA 4J15A 4DAYB 2L15A 5FLMH 4TVAB 3T1HL 1VQ5A 3HOYH 5JJIA 3GTOH 5M5XH 3A5UA 3W5OA 1HNXQ 2DGYA 3CP0A 1B7YB 4MTNA 3TS0A 4JI6L 3M4QA 3HOWH 4A3DH 2RF4A 3TREA 1OXSC 4IO9A 4JV5L 1X3EA 2EIFA 2WAQG 1M1KC 4XTCS 4DR6L 4MNOA 1Q1EA 4UP8A 2I5LX 4TQUS 2GN5A 4DNIA 1PH9A 5LMNL 1KAWA 2UXBQ 4DV5L 5AJ3Q 4NXMQ 1PFSA 4R4OA 4DV6Q 3F2DA 2JA5G 4B3MQ 5M5YH 3CCVA 4WJ4A 1GD7A 4X66L 4WJ3M 4JI5Q 2NZOA 3M4PA 1XMQL 1PH6A 2PQAB 1KL9A 4DUYL 1WOCA 5M5WH 4DK3C 3F8TA 4DR4L 4A3DG 2BH8A 3PUWA 1I94Q 1X6OA 4JBJA 1VQKA 3CC4A 2PMZE 5EAYA 3PF4A 3RLFA 2YTXA 4IPHA 1VQAA 4DR1L 4GOPB 2R93G 1NE3A 5FJ8G 2EXDA 3CCEA 4R4QA 1VQDA 4QQBX 4A3GG 3S17H 4BA1I 2ZJQA 1Y14B 2GVAA 4LUOA 4RMFA 4Y52H 3PCOB 1Y1VH 1QUQB 2K5VA 5C0XJ 3KF6A 5GAEC 4A75A 4LF5Q 4BBRG 4QIWE 4OWTB 4EX5A 2YTYA 1HJPA 3HKZE 5C3EH 4HIKA 4L5SA 2VQEQ 1QZHA 3CW2C 2F3IA 5C4JH 4LUVA 3CCRA 1A63A 4OO1I 3GTLH 2WP8J 3EIVA 3CAMA 3UDIA 2UXCQ 1X56A 4R4IA 4GN3B 4L5RC 4LFCL 4JI3L 2RCNA 4DV0Q 3ULLA 4HIMA 1PH1A 1XPUA 5M3MH 2I5HA 5FLMG 2AWOA 1OXUA 3D0FA 4POFA 3HOYG 1G51A 1G6PA 2K52A 3J81i 3BJUA 3ZJYC 1K73C 5J3BA 3CCSA 3HOWG 3KJOA 1E22A 1I50H 2K75A 1EOVA 3HFZB 3J80i 4DV7Q 3T1YL 4KHZA 3PF5A 3KFUA 3HOZH 4BY7G 1XNRL 2JA6H 1NMGA 3JAMi 4X62L 2VQFQ 4B3TL 3W1BA 1VQOA 2R7ZH 4A3BG 2N49A 4AYBE 4JI2Q 2RHQB 1NTGA 1OXXK 4PZ8A 3GO5A 2MNAA 1UEBA 3DLLA 1KRTA 3CCQA 2HHHL 1U0LA 4A3LH 3K7UC 1DGSA 4HJ9A 1TWFH 4QL5A 4YCUA 4DUZL 4B3SL 1PYSB 3TS2A 1J6QA 1VQ9A 4LF7Q 1I6HH 1UE5A 3S1MH 4LF6L 2WFWA 1FVIA 1E1TA 3K80C 2Y0SE 2CKZB 1L0WA 1IBML 3H3VI 1I3QH 2JK8A 1RL2A 4GOPC 3RR5A 1VQMA 1XMOL 4JI4L 1GVPA 4MZ9A 3GTKH 5C0XI 1JJ2A 1EWIA 3AQQA 1NBWA 1K3RA 1WYDA 1GO3E 1R9TH 2LSSA 1K0RA 2UUAL 2PQAA 2ES2A 1N9WA 4K0KQ 1OXVA 4DV4L 2A8VA 1K8GA 1HZ9A 4DV2L 3GTGH 2JEAI 3PUVA 3KYHC 3PO3H 3A74A 1LTLA 5C3EG 1JB7A 1HR0W 1J5EL 4AQYQ 3S1RH 4IFDJ 4GOPA 4Y7NH 3HOUH 4IJHA 5H1SE 2OQ0A 1Q82C 2LXJA 5IP7H 4A3FH 3I7FA 4APVA 2HIXA 4LF8Q 3PIOA 2WB1G 2AWNA 1KRSA 1BVSA 1IZ6A 4OXPA 3CCJA 4GN4B 5GAHC 3CPWA 3CMEA 1VCIA 4DAMA 5M3MG 2MO0A 4BA2I 4A3KH 1AE2A 1Q1BA 1IXRA 3Q8DA 1YBYA 2Z6KC 4DR5Q 5GQOA 4EQ5A 4YHHQ 4HJAA 1Q7YC 2CFMA 4KI0A 1YIJA 2B29A 3U4VA 3OTOQ 4GNXC 1N34L 4JG2A 3KF8B 4R4CA 1ASZA 2ASBA 4JI0L 3HOZG 3FHWA 4GLVB 1E24A 4OWXB 2JA6G 1Q8KA 4KLKA 3GTMH 3L0OA 1HNWL
chains in the Genus database with same CATH superfamily
3EPGA 2PMZB 4C3IB 3G6YA 1DV1A 5HY6A 2HIVA 1O75A 5KG7A 1I3QA 1W3SA 3ULJA 4C3HH 3CMAA 3T5KA 5JEAG 5LL6b 2G9DA 2X69A 1EIHA 2VPQA 2IL8A 5C1PA 2D5DA 3HOXH 2AGPA 4BXXH 2H5XA 2GLTA 2JP1A 2ICEC 5JH7F 2I8CA 2KCCA 1TWAB 1HA5A 1UAPA 4DV6L 1JWMD 1E7ZA 2E2DC 2ZJPA 5HBRB 4CKCA 1YJWA 4HMIA 3NK9A 2C35B 1SE4A 3EN2A 2UXDQ 5J2UF 1LM0A 3NSWA 2Z0SA 4PG3A 3UI2A 1AZQA 2HDMA 2LMCB 5KG6A 2C00A 1WTWA 4IFDI 2V58A 4JUZA 3S16B 3PO3G 4YIJA 4FBTA 4KV6A 4OO1G 5KFYA 4ED2A 4P71A 5E3FA 4KHPQ 4LF9Q 4DR6Q 5ELNA 2K1BA 4HJ8A 1AP0A 5EPKA 1B53A 1RJQA 4E4TA 1DXMA 4ED0A 3VYSA 1EIFA 3CCUA 3C46A 1EL0A 3BVGA 1YHQA 1N56A 3EA6A 5C1OA 1ASYA 3RJ0A 4DK1A 4LFBL 3S2DB 4K5XA 4DR5H 3NHHA 5CORA 5K5PA 3M85A 5DG8A 4HR7B 3MEHA 4UP7A 1SNOA 3RV3A 4XT3B 2K5NA 1EHIA 2R8HA 5CC4A 5CV4A 5E4WC 3AFPA 2YV5A 3TP6A 1BCPF 2Y0SB 2KA7A 5DG9A 2B8FA 3S15H 3G71A 2VR1A 4OL7A 4L1KA 4C2MH 1L1OB 1DV2A 4NMZA 3GTQH 2O5IC 3R2TA 1VQJA 2VNUD 4O3NA 1E2VA 3FMCA 2Q8IB 2BE5C 2J6UA 2F4VH 2OQKA 3MEFA 1KIXA 1YNJD 2DUDA 2F3VA 2JYOA 3MFGA 1JT8A 3WDNA 5IGEA 1EUJA 4LFCQ 2MGSA 4ED7A 1M4VA 1PH3A 4IFDH 1TT2A 1QE6A 3E9IA 1IKMA 1JWUD 1HR0Q 1CUKA 1Y1VA 1V1OA 1VQCA 1C48A 2MPMA 3NTKA 1TWHH 4DFAA 3RFCA 4ID6A 1SFOB 3MFIA 4RUAA 1TR5A 3K3PA 5KYLA 1FJGL 2E8GA 3CC2A 3DMUA 3DF7A 1YHBA 1RIPA 1LTTD 3BYYB 5EWEA 4ALPA 3M3YB 4HSVA 2N88A 2CQOA 5BR8Q 3GIMA 4G3IA 2XC9A 2F0NA 4DV5H 1VMPA 4JOIC 4ZAIA 4EQNA 2J7ZA 4JBMA 2W8KA 5J2TF 1CE8A 4YAJB 4ZQ3A 2NN6H 5KFZA 5H80A 4X66H 5IYZF 3H20A 4OX9L 2QK4A 4C2MA 1VDZA 3OYYA 3GTQA 2K5DA 1ESRA 1QUQA 1U4MA 3T5JA 2ZTEA 3KOJA 5G3LF 1C0AA 5NUCA 1F77A 4JOIA 2B63H 1O78A 1EZ6A 4NP5A 2KHSA 2SEBD 3K5LA 4LK1C 3BG3A 4C3JH 3M4OB 4X6AH 1Q12A 3VDYA 3AEVA 4LSXA 2FHTA 2SNMA 2RDGA 2KSWA 5A2QL 2DWCA 2C2DA 1SXTA 1PA6A 3FP9A 2ASLA 4YCWA 4AYBG 4DV3Q 4BY7B 1TWHA 4F4XA 3LWUA 3HG9A 4JV1A 3MWEA 2QKIC 1PZKD 4ECZA 1TS3A 2VA3A 2QGQA 4A3BB 2NVXH 2YU9H 1WCMH 4GLAC 4TUYF 4JI3H 1GUOA 2XSCA 1ET6A 3DEOA 5C4XG 2NZHA 3PUZA 1F9RA 4LFAH 3TQYA 4EVOA 5DLFA 4K5VA 2K28A 2RBMA 2A19A 5KG1A 1N34Q 2UXDL 5M5WB 1K3BC 4FS2A 4FXGC 4F88A 1JORA 4FF4A 1SDFA 2QDBA 2NWGA 3JSLA 3RB3A 2F0MA 4QY7A 1CQVA 4C3IH 4IUQA 1GM5A 3R5HA 4A2BA 2K04A 4KHPL 2B63A 3PIPA 4DR7Q 4LF9L 4Q43A 1ZHSA 1K9MC 4IPDA 3I55A 1KDAA 3ORQA 4G57A 2IBKA 4JI8Q 4MV9A 1II3A 3KALA 1V4YA 2MCTA 2NZ1D 4CDDC 1RK6A 2YTVA 3GTMA 4KN4C 4DN4M 1RKNA 1JX4A 1M0TA 1TWAH 4GKKH 3H4BA 1I4RA 2EJMA 2YYZA 5C6AA 5IOCA 3HZXA 2EY2A 1E3PA 4FNFA 4DUYQ 1XMQQ 5FO8B 4DLKA 2UXCL 1OXTA 2PW7A 2NVXA 2YU9A 1WCMA 1WTVA 2OEOA 3DWQA 3FEWX 1DONA 3LGJA 4FBUA 4Q0YA 1AE3A 4DR1Q 3PV0A 4A3CG 2RKSA 2UUCQ 2J9GA 3IN5A 3PW5A 5IGBA 3EVQA 3S16H 5LYJF 4YWLA 2FK2A 3BZKA 3L7ZC 5KFIA 4A4IA 2JE6I 4EEYA 3RF2A 1FNVA 1DOKA 3H0GG 4EG0A 2WV6D 4YY3Q 4JK1C 5IP9G 4QGUA 5IYBH 2R8JA 2OTLA 3Q8SB 3N6XA 4F4YA 2FE3A 3PN1A 3CF5A 2Q2TA 3T56B 3NPPA 1CA5A 1JMCA 2PMZA 4R7RA 1RODA 1EYCA 1YJ9A 2WAQB 5IT9E 4NXNQ 1SJHD 3S1MB 2XCLA 3JZIA 1QG7A 1SRUA 5HGQA 4K8JA 1HR0L 2YCHA 4RWSC 1OTCA 1EWHA 3K3VA 2IX0A 1TWAA 4JI6H 1T9HA 2PCFB 4ECWA 1LT6D 3SE7A 3KHGA 1MD2D 3WWVA 2HVQA 5BR8L 2BH2A 2CWAA 5EBCA 2V4QA 2K33A 5JEAH 5LMNH 3RN5A 5KYIA 3JAMc 4MV1A 4A3FB 2YZGA 1EQQA 1Z47A 4H13C 2EY6A 1HFNA 1K8OA 1VQPA 3BJYA 3ERSX 1EZ8A 4KJNA 4BY1G 4MAMA 3BABA 2B39A 1ICFB 1EYGA 2GVBA 4RB2C 1QCBD 1YHAA 4A3EG 1X54A 3J7AV 2A5HA 3K5OA 4DR4H 3HKSA 1D1KA 2KENA 2CQYA 1SJED 4ZLTF 4XIGS 4LJZC 5KGUA 2FMAA 4XDXA 3AMUA 1CKNB 2F0SA 1B6SA 4F4WA 5KT6A 3G8CA 2K14A 3GILA 2J0TD 2KBNA 1ZXTA 5KNBA 1L1OC 2R7MA 2R82A 1LV9A 5I4DA 2NYZD 4DV4Q 4HR7A 2R93H 4C1NK 1QVCA 4EBCA 5FJ8H 1S0OA 2K6AA 3G48A 4ZUIA 3IFTA 3HOWB 2R7DA 4DV3L 4LFBH 3OIPA 2XRSD 3E0JA 2KECA 3S9WA 5C44B 1JDBB 4IHJF 1RTOA 4DV1Q 1E4FT 1MIUA 4O4LF 1I7NA 1IBKL 2UU9L 3S1NB 1L1OA 4IPCA 3ITPA 2CWPA 3SEBA 1B6RA 3UDFA 1EFWA 2K03A 1RJRA 4FDBA 4QMGA 1CSPA 1RD9D 3KJPA 1F9PA 3Q23A 2MO1A 4IUUA 1U4LA 3KHHA 2F0PA 3RNUA 3M4OH 2HVRA 3J81j 5DLGA 1IL2A 3MJFA 2G9HD 2L15A 3VR4A 1XNRH 1GOZA 3WOFA 4R9WA 2R8IA 4CJ2C 1B7YB 1Z2NX 3TS0A 1GSOA 3M4QA 1M0WA 3L3OC 1OXSC 4IO9A 2ATLA 2EIFA 1M1KC 2JEIA 2FK3A 3PVXA 2J6TA 4UP8A 4DAVA 3CRKC 2FKLA 1LO5D 3HKZB 4RH6A 4ULLA 2DLNA 2W9BB 2R92B 4RKLA 1PFSA 1BCPC 4FYDA 2R93A 2JA5G 4B3MQ 1S68A 1PTOF 1SYEA 5JJZA 4JI4H 4EYIB 2NZOA 1XMQL 1PH6A 1XNQQ 4DUYL 1FJGH 5M5WH 5CR3A 3N43B 2X6GA 3OPOA 4MTKA 1I94Q 4I7AA 2PYKA 5KT5A 5EAYA 3RLFA 3SI8A 2YTXA 1VQAA 4DR1L 2JEFA 1VQDA 1RJPA 3PW2A 4BA1I 2ZJQA 1Y14B 4LUOA 2FMMA 1CZWA 2FP4B 3QWNA 2DJFC 5EKLA 4OX9H 5C0XJ 1IYUA 2BCOA 4RAUC 4A75A 4YR3A 4LF5Q 4BBRG 4QIWE 4OWTB 1HJPA 5C3EH 4IR9A 1JC7A 2VQEQ 1QZHA 1HUMA 2HD3A 2MUYA 3GTLH 2WP8J 3UDIA 1I4QA 4DL5A 1I6HB 2RCNA 4DV0Q 1U4RA 1C30A 2DPIA 4KK7A 5EJWA 2E74C 4WRDA 1OXUA 4K6DA 3HOYG 1WH2A 4GC6A 3BJUA 3ZJYC 1T5EA 5J3BA 4A3DG 1E22A 2K75A 1EOVA 1MHWC 3KFUA 4KHZA 4A2AA 5KFWA 2KJXA 4PMBA 3PO2B 3G6JB 1KJJA 4MTEA 2PO4A 2YW2A 1VQOA 1JDEA 5HV6A 1ULZA 3GV5B 3NTHA 4AYBE 1PTOB 4JI2Q 1OXXK 2F0QA 3GO5A 1JB3A 2EPBA 1UEBA 1FNWA 3FMAA 2F0VA 1U0LA 2HHHL 3K7UC 4ME6A 2AUKA 1CFMA 1VQ9A 1S0NA 4LF7Q 4JI5H 3S1MH 1B50A 1FVIA 3F8NA 1HHVA 4IWYA 1E1TA 4FXDA 1L0WA 2ZJTA 2JK8A 4GOPC 4YP3A 4DL7A 3PW0A 2VXWA 1NNXA 2A6EC 1GVPA 1T36A 5L1LA 1B4OA 5C0XI 1EWIA 3QIAA 4QWBA 3MZ5A 3AQQA 4LF9H 1MSGA 2C9OA 3GTLA 4H7BA 4XXEA 1WYDA 5T1GA 1G2SA 3LP8A 1N9WA 4K0KQ 3K6OA 4DV4L 2PN1A 2A8VA 1HZ9A 4DV2L 1EUDB 1EYDA 1GUTA 5L1IA 2W9CA 4GOPA 2A73B 5H1SE 3GIKA 2LXJA 5IP7H 4A3FH 2L11A 1PRTF 2WB1G 5KKNB 1X32A 3OIQA 4JW0A 1KRSA 4OXPA 1IZ6A 1E0BA 5ELCA 5GONF 2UXCH 5M3MG 1JWSD 3GQBA 1GUWA 1KJ9A 2PZUA 1Q1BA 3Q8DA 2JXMB 3L4KA 2Z6KC 3V05A 3A8JE 4HAEA 4I50F 4HJAA 1Q7YC 5BPHA 3K59A 4WORA 1L2ZA 1YIJA 2WKCA 2B29A 1TAEA 3HOZG 4GLVB 1E24A 2JA6G 1O7LA 3L0OA 1K28A 1M6VA 4FF2A 2R7ZG 3FKIH 2F3WA 3DUZA 5JPMC 5KG4A 2QEXA 3CCMA 2Z6KA 3X3NA 3URYA 4LF4L 1X3GA 4A3LG 3IG0A 2JSOA 5C44H 5LL6X 4X64L 1O7IA 1EIYB 4ECQA 4L5TA 3K81C 4MA5A 3S1NH 4IURA 4K6LA 2I80A 1SE3A 3VA5A 1S9FA 5C0XH 3CQZB 1VQ6A 1B2TA 2R6FA 2FLNA 5KT2A 3SHLA 3R8BA 1SN8A 2D0PA 2D62A 2DNCA 1N33L 1I94L 3LX0A 3I4NG 1DOMA 1X55A 2DN8A 2CW0D 2IT1A 2XIGA 4TV9F 5DQHA 2KCMA 3HRZC 1Z9FA 4J9NA 3NEMA 3TDQA 3BG5A 1RHPA 3EYYA 5BPFA 1A9XA 3GTQB 1L0YB 1CKNA 4AH6A 1GXDC 2XGTA 4IZ8A 1HZBA 4LF5L 4C5BA 5CV5A 5CAEB 4JYAL 4KN7C 2RDFA 4R8UB 4J9KA 2VQEL 1GHKA 2R92H 2LXKA 1BGWA 4BBSB 3AU7A 3FKIA 1MSHA 4YR0A 4G7HC 4XYOA 3G6XA 2F03A 4YHHH 3M9NB 3E5SA 3KK7A 4KD3A 2W57A 4WD3A 3T4AC 1KABA 2A74C 1Q86C 1MJCA 2J6SA 3VR2A 4RGTA 1MBYA 4JI7L 4U6PA 3MFYA 1HPCA 3L2PA 1A2TA 2WYOA 4MV8A 3FRPB 4WFN3 3STBD 3HOVG 2NUCA 2PNHA 2AUJD 3TZDA 1IBKH 2UU9H 1IBLQ 3S2HH 4J6HA 1PH4A 3I4MH 1PYBA 1I5FA 2I0QA 4JCVE 3PGZA 2KCTA 4A3MG 2A6HC 3V4ZA 4XQJA 4DAPA 3RZOH 3GIQA 2OF1A 4ED1A 1KQSA 4DR2Q 4RG1A 4LF7L 1E4EA 1WJJA 3G4SA 2BOSA 2L5TA 4Q5VA 1C9OA 2HVSA 1A6XA 1B44D 2B63B 3GTJB 2QILA 3A0JA 4X3UA 3E5NA 3HKZA 5C8YF 1G291 1Y1WG 4C3JB 2A69C 1XYIA 1OO9B 1X9NA 1H95A 2YZMA 4LNQA 2R92A 1ZEQX 4NW2A 2AQ1B 2F52A 4X62Q 3NENA 2R7LA 4RB0A 3QZ7A 4I7HA 4RHSA 4K0KL 2AGOA 3PO2H 3KLSA 1SYFA 2CCZA 3JRWA 4QWCA 2UUBL 3PQIA 1N32L 4LF6Q 4JC0A 2YU9B 4RAZA 3H15A 3TQ1A 3NUCA 5L37A 1AUVA 1VQ4A 4DR1H 4P72A 2PPBC 3RGZA 3V6JA 1S5BD 4UFZA 3PSIA 4UDUC 5IT9L 4P73A 1EEID 2E5LH 5LMUQ 3GV8B 1RDPD 3GTOB 1B1ZA 1PYWD 1OWTA 1ET9A 2OXPA 2F0JA 3MHBA 3OHAA 3HB9A 2V5AA 2D9UA 1PTOC 3VYUA 1W6KA 1W93A 2NTTA 5IGGA 2JA8H 1CSQA 2C28A 5IYDH 1EU3A 4A3JG 3L4JA 4B3RQ 1DIKA 2Y0SG 2XIWA 1SMXA 5ELDA 1SBBB 3W2DA 1EQVA 1AW7A 2N55A 1QVFA 4PZ6A 2FFKB 3OWFA 1P16A 3T1HQ 4F4ZA 2F0WA 1XTDA 4J8QA 4HJ5A 3V6HA 1K8MA 1S03G 1YZ6A 3N52A 1KD1C 3K5IA 2XGPA 3SK5A 1VQEA 5FLXW 4UY8C 2HHHH 4HIDA 2VL6A 4JV5Q 4RGNA 1EUCB 4RCNA 3M9BA 4MIUA 1VQ8A 2M00A 2RHSB 1LYLA 2AGQA 3WOEA 4P2CB 3QZ8A 3KBGA 4PQXA 4GN5A 4IJLA 2AQ4A 1YNNC 4A3IG 2ZXRA 5ELOA 1K8AC 2VUMG 3CQZH 2ICIA 2ZM6H 3GV6A 2QW7A 4X65Q 4A93G 1EQTA 1XDNA 4C1NI 2NN6I 4YCVA 1BKBA 4EBDA 5KG5A 2NU9B 4IUVA 3LNNA 3MA2B 3I4OA 4DV2H 5JVDF 1D5XC 4A76A 1WI5A 5DEHA 4H0LC 4HCSA 3EJIA 3G6VA 4GS3A 1MJEA 2N8NA 2HT1A 4FS1A 2K5HA 5CGKA 1S5ED 4DA2A 3M9MB 5M3FH 4ECTA 3NP8A 1IBLL 2VQFL 2EZVA 5EBDA 1PH2A 1D8LA 3N40P 2ZXPA 4IPGA 5GADC 2RSOA 4AIMA 1HA6A 2N3SA 5BMVF 2R6GA 1FKAH 1AZPA 2WB1E 4CGYB 3I8ZA 4BBSH 4IRKA 1ZYRC 4DR2L 3KHRA 5KFRA 1EYZA 3GLKA 1VAJA 4YWKA 1GYFA 1HZCA 4LF4H 4YBZB 2H4OA 3T1YQ 3CQZA 2E75C 1PRTC 1X3QA 1S40A 1B70B 4X64H 1N36Q 3GTGB 2ZTDA 3MVVA 2R93B 5FPRA 2EYFA 2KEDA 4Y7NB 2IJ0A 5K36G 2F0EA 3MTSA 2W6PA 2CVRA 3F2CA 2XTIA 4DUZQ 1UNNC 5C3XA 2RDIA 5IWAQ 1PLFA 4MTDA 5CBAE 1AN8A 1TKWB 2PI2E 3RN2A 4LF8L 2JEBI 3UQ8A 1N33H 2NVYH 1UE1A 1IBMQ 1BCPB 4IWXA 4JI1Q 2IX3A 1S3OA 1HNZQ 4QUFA 4XQQA 1XMOQ 3BQ0A 4R8UA 2R3ZA 4TKOB 3GTJH 4ED6A 1Q46A 4O42A 1WTQA 3I4NH 1BOSA 5LMUL 5JEAJ 5CMDA 3RB0A 2IW3A 3QR8A 1UE7A 3CD6A 1TY0A 3OSOA 4JYAH 2KHIA 4O2DA 1B9NA 3H09A 1D7QA 3OSNA 4Q8EA 2LY7A 2VQEH 1J5EQ 1JE5A 1AH9A 4ZK9B 2A68C 4TSSA 4R8IA 1S72A 1Q81C 2MJ8A 3RBDA 5FLXL 2JA7G 3I12A 1PH5A 1CKMA 1HXYD 4UCTA 4JI7H 3OMCA 4B3RL 5JJKA 2P0AA 4P74A 5I6WA 4IOCA 2OWOA 5JVG3 1EY6A 1FYCA 1QZGA 4ECRA 4YR2A 2LS01 1WD0A 2NBFA 4DR3Q 1HNWQ 3T1HL 2JEJA 1PDQA 5FLMH 3SK4A 1PX2A 2W6QA 1GUNA 1TS2A 3BA8A 3GTOH 4NLGA 4B3TH 2NVYA 1HNXQ 2ASJA 5C4ZA 3GQCA 1ZHQA 1KJIA 4HNUA 2BDNA 3TREA 4JV5L 1CQJB 4YB8B 3GTJA 2WAQG 5L1JA 3MR6A 1GSAA 4DR6L 4B3SH 4MNOA 1Q1EA 1PH9A 2UXBQ 4TQUS 1CHPD 4UHVA 4XX0B 5C3EB 4K2LA 5AJ3Q 4NXMQ 5ISRA 3KHLA 2O03A 1DM0B 1QB5D 4R4OA 4FF1A 4L8JA 2RDJA 5M5YH 3MWYW 1BBXC 2GPWA 3GTLB 3KTMA 3J7AK 5I2YA 2R87A 1PTOD 1KL9A 4K2KA 3NBHA 5KEEA 3PUWA 4L63B 3CC4A 1FNUA 5KFKA 2PMZE 4Q44A 3D4DA 2W9CB 1JR0D 4IPHA 5I9OA 4O3PA 2UUAH 4GOPB 3S1QB 4WBNF 1NE3A 2EXDA 3BYTB 4QQBX 1I4PA 4A3GG 1M7JA 3W3AA 2YYAA 1KC7A 2UUBH 5I2XA 4Y52H 4CDFC 1N32H 1IW7C 1DCZA 3KLSX 4L5SA 4HIKA 2W7PA 2EYHA 3GTOA 1D5ZC 1SYDA 2KUMA 5CB4F 4N9PA 4OO1I 3EIVA 3CAMA 5I6YA 5C4XB 4F8MA 4OIKA 5M9OA 4LFCL 1XPUA 1SYXB 2D2CC 1EEFD 4JI0H 1S0MA 3D0FA 1G51A 2EOTA 1G6PA 2K52A 4RHRA 4KTAA 4PDBA 4RZQA 4CKEA 3VPBA 3CCSA 5FD5A 3HOWG 1YNND 4DV7Q 3T1YL 3MXGA 2EXZA 4KY5A 2VUGA 2R85A 1Y8PB 4K14A 1W6JA 1BJTA 1D1IA 4RAYA 3DLLA 3CCQA 4DV6H 1KNEA 4DUZL 2CH4A 4OELB 3T53B 3K57A 1Z2OX 2XRQD 2Y0SE 3TIGA 1IBML 5L1KA 3N6RA 2R7KA 2BE5D 1XMOL 1CI3M 4ECUA 3D8GA 3KUPA 3MC0B 1STNA 1R9TH 2LSSA 2PQAA 2ES2A 1A3TA 1OXVA 1S10A 2DNEA 3GTGH 3PO3H 2VA2A 1J9OA 3FKIB 1LTLA 3ND8A 5J1ZA 1J5EL 4OO1H 3KBXA 4Y7NH 1I4XA 1TQOA 1LLRD 2OQ0A 1M8AA 1SNMA 3I7FA 3RTXA 3TINA 5KG3A 4XT1B 3CCJA 3CPWA 1DOLA 3A7LA 1SYCA 3VA7A 1G91A 5C5JA 2I46A 3NTIA 1AE2A 2C2RA 2ZXOA 2BDOA 5EOYA 4ILWA 4DR5Q 5DQGA 2ZT9C 1JICA 4IUNA 4UCOA 3JRXA 4EQPA 3U4VA 1N34L 2KQ3A 1PZJD 3KF8B 4UCRA 1HNWL 4OWXB 3TZUA 1Q8KA 3PUXA 2VQFH 2R7FA 1HNXL 2EDGA 1SNQA 1VKZA 4NDXA 2HJWA 4APMA 4NPSA 3E9HA 1CZGA 1VQGA 1LUZA 4JBWA 2VS1A 3J7A5 1E4EB 4DR7L 1SYGA 3FPPA 1J8IA 4DPGA 1KDBA 2F4VQ 3MWDA 4HN7A 4JI8L 2UXBL 1R9TA 1F2LA 5IE8A 4RNNA 3DWAA 2NVQH 3GTGA 4BY1B 2AMCB 2AHOB 4F50A 4A3EB 1KEEA 2WTFA 2E2IB 5EQ0A 5KFGA 5C5LA 1GJXA 5KFXA 2F0FA 4ZYSA 4EEQA 3GTPB 2UUCL 3WO1A 3HOUG 3I2ZA 3U4ZA 1PHJA 3D6WA 1EY8A 4KY6A 1EOTA 1GHJA 1ZQ7A 4DV5Q 4LF8H 1TVXA 4GLXA 3S2HB 4YY3L 3I4MB 1PH8A 4MV7A 1NMFA 4O4IF 4FU0A 4A3KG 2I5MX 4LMYA 4X66Q 1A0IA 5FO9B 5IT9c 1IYJB 1EU4A 3V4SA 5LP6F 2V1CC 3RZOB 1ZETA 1NR4A 5KFEA 1V43A 4NXNL 4O3SA 2QEJC 3OW7A 4RU9A 2K4KA 4O1NA 4QJFA 3UE0A 3J81W 1HCZA 3MWMA 1GKHA 5KFOA 2K32A 3OHBA 2FB9A 4ODGA 3S1QH 1V1PB 2K05A 3CHBD 4C3HG 4KHVA 3J80W 2I87A 2JN4A 4DV7L 2JA9A 4DKAC 5D1OB 4DL2A 2Z1CA 3SGIA 3JAMW 3UDGA 1WTRA 3HOXG 2DY8A 1KJ8A 3IL8A 5DM73 4F7XA 3J7AF 2E2JB 1RYSA 1YJNA 5FLXE 1NJIC 5EKIA 4Q8FA 3PIP3 2JQOA 3D4RA 3UDXA 3KAJA 2I07B 5EWGA 2UXDH 5C4XH 4NB3A 4P75A 3KAKA 4LFAQ 4I4TF 1SROA 2B2VC 1MZBA 3A56A 2H1EA 1JE4A 4QIWA 1STHA 4ZRZA 2E2HB 5JQWA 1KHIA 5T14A 2L4NA 2AKWB 2DJGC 2YS6A 4KHPH 1X3FA 4ED3A 4DR6H 5JVLA 3PR4A 1ENFA 1Y1VG 2B8GA 2XD4A 2B2VA 3SR1A 3P20A 4ZHQF 3T5HA 3HXLA 1WTPA 4MN3A 1BDOA 5KRUA 2WAQE 1XWEA 1L2FA 2BA1A 5EDWA 2CW7A 4I55F 1T3NA 1SSOA 4LWCA 2JA8B 5CA0F 3BU2A 1K1SA 4KKSA 3GD7A 4DV1L 1TWCH 3CPFA 3BDOA 1PMRA 1V1QA 1EY0A 4X3KA 2ALZA 3EBEA 4ABNA 1XX8A 4GKKQ 1MKHA 3EFXD 3TN2A 4MA0A 1A62A 3RMHA 4KY7A 3KF6B 3PW7A 4PNYA 4AYBA 3TSSA 3CC7A 1VBHA 3OMGA 3HEJA 4FM9A 1QNUA 5J22A 3W1GA 4A3CH 2MP1A 4A3DB 2W9AA 1SR3A 4N8X1 5D3IB 5DGBA 3GDEA 2EJFC 5CYUA 1UNSA 4QW9A 1WTHA 5ELEA 3E6ZX 4CDCC 2X6LA 3H0GH 1KXLA 1F2YA 3D31A 3IAYA 4LFCH 4HCEA 2BR0A 5IP9H 4IFDG 5KFUA 2VW9A 1R4PB 1W2BA 1JKJB 1HR0H 4B3ML 3SK6A 2Q8TA 3P75A 4LH6A 3Q8QB 1HTLD 3E0EA 5DG7A 3MXUA 5HURA 2QA4A 3QO2A 3T1YH 3BZDB 1H9KA 1RTNA 1XNQL 1U5KA 1I6VC 4YQWA 1O7YA 3I56A 1TWCA 1PFNA 1XPOA 1PFMA 2QCPX 5BR8H 4Q0FA 4OWWB 1VF5C 2FPGB 4JI6Q 2MQHA 2ALYB 4TRDA 3U58A 2NN6G 2Q2UA 2Z9HA 1PRTB 3PMFA 4EQOA 4F87A 3F2BA 1VQHA 3J81L 3RB6A 5M3FB 4IAJA 2A1AA 3HP3A 3BZCA 4OONA 3U50C 1VBGA 1YI2A 3MR5A 4CDEC 5LMNQ 5IGDA 2VY3A 3J80L 2OTJA 3M4IA 4MV6A 1TS4A 3OOCA 2ZJRA 2B63G 3M7GA 4ZQIA 3TP7A 1O80A 4BY1H 2ID0A 4C3JG 1EFID 1KNAA 2K50A 4A3EH 5M3MB 4DR4Q 5K2MA 3I3CA 3N42B 4R8NA 3H0GA 4IRDA 1IL8A 2E2IH 3K0XA 3VR6A 3H6MA 3GV3A 3J7ZC 4DV0L 1CHQD 1YNJC 4O2AF 2F0LA 2O4XA 3E3XA 5LMNW 3F1ZA 2EVBA 4IOAA 1I50B 5EZYF 3HOZB 4XYMB 3GTPH 1BCPD 2K01A 1SYBA 5KFPA 4DV3H 1UUPA 3H94A 1S5CD 3RBEA 1SNCA 1F2ZA 1QOHA 5FLXc 1M90C 2R7ZB 1WCMG 2F0GA 4I65A 3KF8A 1XPRA 2YL2A 2JJQA 4HIOA 1VQ7A 1IYVA 4LFBQ 1JJGA 2HQEA 3LWBA 5LHY1 3TRZA 4JI2L 4QUCA 1E2WA 3PR5B 2EYMA 1LTBD 2EYOA 3OUUA 3ULPA 2HGSA 5KFLA 1N34H 1PXUA 5EPJA 2WE6A 2W70A 1SEBD 2R8KA 4LFAL 2NVYB 4DGZA 1YITA 1C7YA 4EGJA 2JA6A 4O4HF 3GTKB 2VB2X 3OWEB 1STGA 4C3IG 4GNXB 1AUXA 4DNRB 4L5QA 4R4TA 2L0CA 3I4NB 1G2TA 2RVLA 1XNRQ 4DR7H 5LXTF 1XJVA 1B04A 1PZID 4IUTA 3EPIA 4Z9CB 4JI8H 3K58A 2E2IA 1NCVA 2E2JH 1KBLA 3GIIA 3A5ZB 1UEAB 5EGTA 4DK6C 3TQTA 4ETSA 4QWEA 2KHJA 1VQLA 3ICEA 1KAAA 3NBHB 1WVLA 1CS0A 1JOKA 3GTPA 2Z4IA 1XMQH 3DXJC 5TSSA 2EQSA 4DU9A 4DUYH 5F9LA 2WINB 4GKKL 2JA5H 1E4GT 1EQRA 2CQAA 1IHZA 2IHEA 3L9AX 5IGFA 4JI4Q 2E2HH 1FJGQ 2UUCH 1BBUA 5G3LD 1SMYC 3BVZA 3HS0C 3N44B 3T16A 3SVMA 3LMLA 3NELA 2B2UC 2QYZA 1V9PA 3UE1A 3G6EA 4RNOA 4O0AA 1BXRA 3B6YA 4YY3H 3BVMA 5IYBG 1KJQA 4LUZA 3K5MA 5CV7A 2NVTB 3TP8A 1CT1D 2YRXA 2AQ3B 2J4XA 4OX9Q 2N78A 4R1JA 2M05A 4J0MA 3FPUB 5KFFA 1V1PA 2A6ED 2WKDA 4BBRH 4RNMA 4NXNH 2B2UA 3BS1A 2BQRA 3M7NA 1DZ1A 4A3MB 5D1OA 1TWGB 3O13A 4C5AA 1PH7A 3T5LA 5M5YB 4G7ZC 3CCLA 2JEGA 3S14B 3U9TA 1BF4A 2CZGA 5DLQE 3A55A 3RGXA 3G7LA 4RCOA 4YWMA 4J15A 4DAYB 1CTMA 3HOYH 5KFMA 5JJIA 5D3DA 1MGSA 5M5XH 3W5OA 1Y1WB 1T5XD 2DGYA 2TMPA 1RYRA 3HGBA 4MTNA 2F0IA 1B3AA 1R4QB 4JI6L 2JA5A 4A3DH 2RF4A 1TY2A 1F9QA 2E2HA 4RKBA 1X3EA 2NU7B 2WACA 4FXKC 1SAPA 3N41B 3RZDB 3V6KA 2I5LX 2X0SA 2DIKA 4DNIA 5LMNL 1KAWA 4TV8F 5A2QW 4S3SA 1EWCA 4XYQA 3F2DA 2VQDA 2W6NA 2L55A 3CCVA 3ONAB 2RQXA 4WJ4A 4TQSA 2KOLA 4HMJA 4JI5Q 1BUVT 2PQAB 4E6IA 4B9WA 1WOCA 4DR4L 4DK3C 2G5DA 3F8TA 1LTAD 1STEA 2BH8A 2F0DA 1X6OA 3SK8A 1VQKA 3Q1KA 1I6UA 4HNTA 1STAA 2M9VA 2DZDA 2R93G 5D1PA 4DV4H 1KDCA 5FJ8G 5D14A 4JV0A 2Z8LA 2XCAA 4R4QA 2FJ2A 3VYTA 4C56C 1IOVA 3PCOB 1Y1VH 3P1HA 3PZPA 3A8IE 3KF6A 1K0SA 2AU0A 4DV1H 2OH2A 1JIHA 2SCUB 1KTKA 4CJ1B 2YTYA 2C22A 2QDLA 5BN3A 3CW2C 5C4JH 3X3MA 5KFQA 2UXCQ 4L5RC 4GN3B 1PH1A 4A3JB 2NU6B 1LT5D 5M3MH 3DHQA 3FDSA 2I5HA 3RAQA 1U9RA 5A35A 3Q22A 4RGOS 3FVQA 2YS7A 3M4YA 3ETJA 1I50H 3TBIB 1ENAA 3HOZH 4BY7G 4ECXA 1XNRL 2JA6H 1R9TB 1NMGA 1U4PA 3GIPA 4X62L 3EQLC 1JOOA 3W1BA 2R7ZH 4A3BG 3PO3B 2N49A 4ME5A 4PZ8A 1NTGA 2MNAA 1EY4A 3TP5A 2Z4HA 1KRTA 5JUMA 4A3LH 3VR5A 1G8ZD 1DGSA 2B2TC 4QL5A 1STBA 4YCUA 4B3MH 4X3SA 4O3RA 1LACA 1RJTA 3D6CA 4LF6L 3RB4A 1XNQH 4XZ3B 3K80C 1I94H 3H3VI 4A3IB 2VUMB 3Q8RB 4A93B 3RR5A 4JI4L 4MZ9A 3GTKH 2R7NA 1JJ2A 4O3OA 2B2TA 4DNTB 2A6HD 4BS9A 1GO3E 4ED8A 2WB1A 4CC5A 5KG2A 3A54A 3J81E 2FPPB 2VPSA 2YRWA 3I72A 5JOBA 1K8GA 4LF5H 3BDLA 5FPOA 2V9WA 1H9RA 4DL3A 5C3EG 1JB7A 1HR0W 3QFFA 3J80E 4AQYQ 3VMMA 3H4DA 4IJHA 4PMCA 1Z7TA 3D3RA 4HEDA 3JAME 2R86A 4X3TA 3WO0A 1B3QA 1A2UA 4RGMA 2HIXA 3PIOA 1I50A 4JVZA 3T13A 1BVSA 2CHBD 2A69D 1IOWA 4GN4B 5GAHC 5I47A 2NTSA 3CMEA 5T1IA 3C2PA 3FDTA 1JCKB 4ZUJA 4DV0H 4BA2I 4JPBW 2NVQB 2ZDHA 2R7ZA 1IXRA 3DM1A 3RV4A 5DGAA 2VB3X 5GQOA 2RCFA 1QNKA 4YHHQ 2V59A 3BAAA 4OHJA 2WDTA 1GUGA 4KI0A 2L9HA 4B08A 1WD1A 4GNXC 1X3PA 3QOLA 3OTOQ 4JG2A 2RGVA 3VPCA 2ASBA 3I73A 5ELBA 3FHWA 3GTMH 4ZOLF 2E76C 4J9LA 1EY7A 2PI2A 3DWPA 1JJCB 2IHFA 5GAGC 4RFBA 2NVTH 4JI2H 3HOVH 1Q3LA 3BDCA 3I91A 2MFIA 3GTKA 4UAIA 2CW8A 4GNXA 1IBKQ 2UU9Q 1SMYD 3H3VH 1DYQA 1VQFA 4LF7H 4QIWB 1V51A 1ILQA 5FOBB 5DQIA 5IYCG 2SNSA 1VQIA 4FO2A 4H02A 1AEXA 2Q8RE 3J7YW 4A3MH 3C0FB 1HQRD 1TWGH 1TXYA 1DJRD 2GA4B 5GROA 4IR1A 3I4LA 4JI5L 1S97A 1KLGD 2C5CA 3S14H 1GSHA 4X65L 3N8DA 2F0OA 1E1OA 1NY4A 1Y8NB 4PMWA 1Y8OB 3K8AA 3Q24A 3Q6SA 4C5CA 2FPIB 4K0KH 1Y1WH 1UC9A 2FXQA 3PW4A 5BN4A 1D5MC 2WIIB 1W96A 1H9JA 5IP7G 4ME3A 5DM63 2B3GA 4A3FG 4ECVA 2YZNA 3TMEA 2RDHA 3R3OA 1H9MA 3H3VC 3IKJA 1BBWA 3RZDH 1K83B 4AYBB 2IP4A 5CV9A 3H91A 2HCIA 2KVMA 5EPLA 4HNVA 2MHVA 4J9OA 2PZWA 1NR2A 2JA7B 2OCEA 1B8AA 1ESFA 3AB9A 1CQFA 1VQBA 1VS0A 1N48A 1Z6HA 4PWQA 3FKIG 1WFQA 2PBZA 2EYJA 4GKJQ 3OHXC 1XXGA 3KDFB 5AFWA 2E5LQ 3ER0A 1TWGA 4POGA 2XGQA 3JC66 1PVOA 2W7OA 3NQTA 3SDZA 5C44G 5CBEE 3ND9A 1B33N 4IRCA 5KFTA 2ENBA 1N36L 1SCUB 3EROA 1EZ1A 3C1FA 4DAYA 4IZOA 4LW1A 1RCVD 2OT2A 3S2DH 5C0XG 3IFDA 1Y1WA 2NU8B 1A3UA 4H44C 5KFJA 2FK1A 4HTHA 2IWHA 2EE1A 5D8DA 3R5FA 1TWCB 5IWAL 1ML0D 2FINB 3K7AB 1TA8A 1A8VA 3CXCA 4A3JH 3Q2OA 3RIZA 1G6ZA 1FL0A 1SNPA 4JI1L 3QOJA 1XTCD 1HNZL 1S5DD 4U673 3J81c 2HCCA 1WTXA 5FK9C 1PFBA 4DL4A 1SNDA 1HTPA 4TQRA 5C5MA 3J80c 5KG0A 1ICWA 4L6TB 2XCPA 1X65A 1ZYRD 4PV1C 4A3GB 2R61A 2V4DA 1WTOA 4AQYL 3HKZG 1KLUD 2HHHQ 3VPDA 3NGDA 1D6EC 2K5QA 2R92G 5JJLA 5C3WA 3U9OA 3H0GB 3MXNB 3JSNA 1A15A 2EY5A 3F2UA 4QF4A 3MFHA 4G7OC 1BQQT 2FMCA 5ELFA 1IKLA 1QJOA 3K5HA 4UCVA 1PRTD 4CKBA 1AFPA 3NE5B 2ZDQA 2UVVA 4IN3A 4A3IH 2ZM6Q 2R8GA 2IMWP 4CHTB 1O7ZA 2SOBA 4UPAA 4YHHL 1SFOH 2VUMH 4A93H 3OTOL 5L9XA 4DV2Q 1YNXA 2B2YC 4LMQD 3M3YH 4DR3L 3I90A 5D65A 2FJZA 3GV7B 1LTSD 3I4MG 1IBLH 5F2DA 1Q90A 2Y0SA 1SLJA 5DNFA 1JOQA 4EFBA 1FD7D 1LT4D 5J39A 1ILPA 2XN9C 2CW0C 4V190 3HBLA 4DR2H 1NUCA 2B2YA 4B9XA 1EYAA 2HDLA 2Q2HA 1WR2A 4QW8A 2IA6A 5AJ3L 4NXML 2W71A 3ZYYX 4YAKB 1EY5A 1ONLA 1LTGD 4RB3C 2EYPA 3H40A 4KKTA 4X62H 2A68D 4N9TA 4O3QA 2Q2IA 4JBKA 4UP9A 1PV4A 2DY7A 3PO2G 1TU2B 3S17B 4LF4Q 1F2MA 1CQIB 4BY7H 1H9SB 2VUMA 1SFOA 2K7VA 4X64Q 2D0OA 4A3BH 2P5ZX 4BWSC 2RGRA 4M1UB 4LF6H 1LT3D 1S5FD 3IRBA 3DM3A 3STBC 5K36H 1HUNA 3PIO3 3MXPA 4YJ2F 5JAVA 1DD2A 1N33Q 2EY1A 1TIID 3ERQA 1ENCA 3RLOA 5LMUH 2W6MA 5COYA 2IPKD 4YJ3F 5IY0A 3AFQA 5FKAC 4GKJL 2E5LL 5CV6A 1HFGA 5KFNA 1GGOA 4ECYA 2BA0A 2KEEA 4OGQC 4ECSA 3NWTA 4JYAQ 1JXLA 2L1BA 2IY5B 2JA8G 4BWGB 1SE2A 3GIDA 1FR3A 3ETHA 4BXXG 5IYDG 3S24A 2NUAB 1K83H 1LTID 1N8RC 3Q0AA 2R84A 1TWFB 2Z6BA 1BXTA 1EY9A 4DF7A 2M2LA 4U68A 5KFAA 4B3RH 1T94A 2F4IA 1FGUA 5KFBA 5KFSA 4Q45A 1NSNS 4I7ZC 4JI3Q 3CU7A 3QG1A 1D2BA 2XWJB 2JA7H 1I3QB 1L0XB 4JI7Q 5A2QE 4OIJA 1GLVA 3T1HH 4KKUA 2JA5B 4RZRA 3KLWA 1IW7D 1C3OA 4HJ7A 3PUYA 4CC6A 3DEPA 1S4ZA 3T51B 4HYKA 3GP7A 3QJYA 4JV5H 3A8KE 1P8LA 1BNCA 4CBVA 4PZ7A 4B3TQ 3TEHB 2W6ZA 2V4RA 4J1MA 2XVSA 2QF7A 3S1RB 4U7CA 1BO0A 1LABA 4M8AA 3HOUB 2RSNA 2PVPA 4IALA 5FO7B 4ZKBB 4J9QA 3OSPA 3CKIB 2EYLA 4MHEA 3NXWA 3OW2A 4B3SQ 2C2EA 1SE8A 4J9MA 4BBRB 2VZAA 5EKKA 4X65H 2ZTCA 5IYCH 2F0KA 4HSPA 4A3KB 4EGQA 1LTRD 3SXHA 1C8CA 3K7AH 5FD6A 1UWVA 2F1MA 2ZM6L 2W6OA 5E7NA 4DR5L 1K83A 5EWFA 4UCUA 2LKVA 4CJ0B 1VQNA 1HRJA 3NBIA 4RUCA 1JLLB 2UUAQ 2O2LD 3HOYB 5M3FG 5M5XB 2PNRC 4EYHB 4O2BF 2JA7A 1YEZA 4C3HB 5I9PA 1RK5A 2XWBB 3I70A 4A3GH 2UUBQ 4XYLB 1CKOA 5E1FA 3WNZA 5DAUA 1N32Q 1UE6A 2NB0A 4NKLA 4EGVA 3HOXB 2L12A 4BBSG 4EBEA 5E4XA 3KDFA 2F4VL 1HZAA 1YVCA 1HH2P 4EFEA 1QILA 4K8IA 3V96A 5CV8A 1QVGA 3AYHB 4IQZA 1KC8C 2IX1A 4J9PA 3KXYT 3K0YA 2OLSA 4GZYC 2XNAC 2ATWA 2CH4W 1STYA 2HQLA 5KT7A 2ASDA 5JVH3 3R2IA 2WAQA 4JI0Q 3D4WA 3RLNA 5KIXA 1VQ5A 5KFVA 1QWYA 4TVAB 1N36H 3A5UA 3QB3A 1I7LA 4ZCKA 3CP0A 1CK1A 4HQ6A 1V8QA 4QB4A 3HOWH 1AN7A 3R93A 3R23A 4M7EA 1Y1VB 4XTCS 4DUZH 5IT9W 4RB1A 3UFXB 3MR2A 5IWAH 2GN5A 2K5WA 4DV5L 2W8LA 1BR9A 1JQYD 2O5JC 4WJWA 5F9NA 4DV6Q 1IBMH 5C4JB 4JI1H 2PW5A 1GD7A 4X66L 4WJ3M 4RA8A 1HNZH 3JAML 1XMOH 1SEIA 2WB1B 4GC7A 3OUZA 3M4PA 2BQ3A 1K1QA 5IIFA 5IGCA 4DXFA 2B2WC 1UC8A 4JBJA 3CVZA 3PF4A 3MXNA 3NQIA 3S15B 5KT3A 5KFCA 2FLPA 1HQMC 5KNCA 4ZI7F 2F0HA 2KCNA 1C4QA 5KNDA 3CCEA 1Q8IA 4AQYH 4C2MB 3GIJA 5BN5A 1B9MA 4XQNA 3S17H 1J5EH 2DPJA 2GVAA 2PZTA 4RMFA 3MR3A 1QUQB 2K5VA 2SDFA 1VMCA 2JA6B 3VYRA 5GAEC 2GPSA 2B2WA 2UVWA 1RF2D 4EX5A 4V0BA 3HKZE 4QWAA 4FF3A 1VF7A 3C3LA 4J9SA 4J9RA 4MV4A 5KFDA 2F3IA 2TSSA 4LUVA 3RUZA 3CCRA 1A63A 4N8FA 4KD4A 3A7AB 3BQ2A 4DL6A 1CM9A 3OTOH 1X56A 4R4IA 1FGBD 1TS5A 4JI3L 3ULLA 4HIMA 4FVMA 4KMUC 5FLMG 2AWOA 2RA4A 4DR3H 1HNWH 1F9SA 4POFA 1TWHB 4MV3A 1E2ZA 3J81i 5LOVF 1HNXH 4FP5D 1K73C 1NAPA 3K5NA 3KJOA 3RD4A 3J80i 3HFZB 4DK0A 3PF5A 1Z2PX 1WSCA 4DXGA 3JAMi 2VQFQ 2F0TA 2F0UA 4B3TL 4QWDA 4ZKCB 2UXBH 1EIGA 2RHQB 3RUPA 4NXMH 1A3VA 4IUPA 4Y8VB 4HJ9A 1TWFH 4B3SL 3TS2A 1PYSB 1Y69U 1J6QA 1I6HH 1UE5A 1H9SA 3KLRA 3V2TA 1PK8A 2WFWA 3VR3A 4LH7A 3RAXA 2CKZB 5LA6F 1I3QH 2W9BA 1RL2A 3CRLC 2HUGA 4K5WA 4QCLA 2BQUA 1VQMA 3Q8PB 4KJOA 1NBWA 1K3RA 4OEMB 4UCSA 4LSAA 2LFNA 3GTMB 1K0RA 2UUAL 5CA1F 2VOBA 5C4HA 3MAQA 3TIIA 2JEAI 3PUVA 3KYHC 3A74A 5IODA 1PTOH 4LAAA 5HGTA 3S1RH 4IFDJ 3BA9A 1GUSA 3HOUH 4JV2A 3SE0A 1Q82C 1CA6A 3HOVB 2AQ2B 3U9SA 5JPNC 1I4HA 2NVXB 1WCMB 4APVA 3R5XA 1ZKOA 3NWSA 4LF8Q 2ZDGA 5KT4A 2UVRA 3C1EA 2AWNA 2EJGC 5KFHA 2PQEA 1VCIA 4DAMA 4M9UA 2MO0A 3P7JA 4A3KH 1YBYA 3LWEA 2FLLA 2UVUA 4EQ5A 5KX5F 4G4KA 3ORRA 4GKJH 2CFMA 5LL6S 3M9OB 3BQ1A 4R4CA 1ASZA 1TWFA 4JI0L 4DV7H 1I4GA 1BNZA 4KLKA 1MI2A
chains in the Genus database with same CATH topology
2PI2A 2R7ZG 2R7FA 1HNXL 3FKIH 5HY6A 2HIVA 4NPSA 1JJCB 2IHFA 3E9HA 1W3SA 3ULJA 4C3HH 1VQGA 2Z6KA 5GAGC 2QEXA 3CMAA 1LUZA 4JBWA 2VS1A 5JEAG 4LF4L 2NVTH 3HOVH 1X3GA 3J7A5 4A3LG 2MFIA 4DR7L 5C44H 3HOXH 4DPGA 4GNXA 1IBKQ 2UU9Q 4X64L 4BXXH 1O7IA 2F4VQ 1EIYB 2UXBL 4JI8L 3H3VH 2H5XA 1VQFA 4L5TA 3K81C 5IE8A 3S1NH 5IYCG 4H02A 1VQIA 2NVQH 4A3MH 4DV6L 1TWGH 1E7ZA 1TXYA 1VQ6A 2AMCB 2ZJPA 5GROA 2AHOB 1YJWA 2UXDQ 2C35B 3EN2A 4JI5L 1SN8A 1LM0A 2Z0SA 2D0PA 2D62A 3S14H 4PG3A 1N33L 4X65L 1I94L 1E1OA 1NY4A 3I4NG 1X55A 4PMWA 2IT1A 4IFDI 3K8AA 3PO3G 2KCMA 3CCMA 1Z9FA 1Y1WH 4OO1G 2FXQA 3NEMA 2UUCL 4P71A 3HOUG 4KHPQ 3I2ZA 3U4ZA 4LF9Q 1PHJA 4DR6Q 5ELNA 4ME3A 5IP7G 2B3GA 4HJ8A 4A3FG 1CKNA 4AH6A 2XGTA 1HZBA 4LF5L 4DV5Q 1EIFA 3CCUA 4GLXA 4JYAL 4YY3L 1BBWA 3RZDH 1YHQA 1NMFA 1PH8A 2VQEL 4A3KG 2I5MX 4X66Q 1A0IA 2LXKA 1ASYA 2R92H 4LFBL 5IT9c 1IYJB 2V1CC 3M85A 1V43A 4UP7A 4NXNL 2K5NA 2OCEA 1B8AA 3AFPA 1VQBA 1VS0A 2K4KA 1MJCA 2YV5A 4QJFA 3UE0A 1Q86C 4JI7L 3S15H 1GKHA 3FKIG 3L2PA 1WFQA 3S1QH 3G71A 4GKJQ 3KDFB 2E5LQ 3STBD 3ER0A 4C2MH 4DV7L 3HOVG 1L1OB 2JA9A 2PNHA 4DKAC 3SGIA 4POGA 3GTQH 3JC66 3UDGA 1PVOA 5C44G 3HOXG 3PUXA 1VQJA 2VNUD 1IBLQ 3S2HH 1N36L 1YJNA 1PH4A 2OQKA 3MEFA 3I4MH 1NJIC 1KIXA 1PYBA 1I5FA 2I0QA 4JCVE 3PGZA 2KCTA 4LW1A 4A3MG 3S2DH 2JQOA 3UDXA 2DUDA 5C0XG 1JT8A 1EUJA 4LFCQ 3RZOH 1KQSA 4DR2Q 4RG1A 1PH3A 5C4XH 1WJJA 3G4SA 4LF7L 4NB3A 4P75A 5IWAL 4LFAQ 1SROA 3E9IA 1A8VA 3CXCA 4A3JH 1CUKA 1HR0Q 1VQCA 1C9OA 1FL0A 1TWHH 4JI1L 3A0JA 1G291 1Y1WG 1HNZL 1H95A 1KHIA 1X9NA 4LNQA 3J81c 2F52A 2AKWB 2E8GA 3CC2A 1FJGL 4X62Q 1YHBA 1RIPA 3NENA 1X3FA 4ALPA 3J80c 4K0KL 1Y1VG 2CQOA 5BR8Q 3PO2H 1X65A 4JOIC 2CCZA 4AQYL 3HKZG 2HHHQ 4JBMA 5JJLA 2R92G 2WAQE 2UUBL 1L2FA 2BA1A 1N32L 3MXNB 4LF6Q 4OX9L 3CD6A 4JC0A 4LWCA 3BU2A 3H15A 4DV1L 3GD7A 3OYYA 1TWCH 3CPFA 1V1QA 1QUQA 1VQ4A 3EBEA 2ZTEA 3KOJA 4GKKQ 1C0AA 4P72A 1MKHA 4JOIA 4A3IH 2ZM6Q 2B63H 4YHHL 1A62A 2VUMH 4UPAA 3KF6B 1SFOH 4A93H 4C3JH 4X6AH 3PSIA 3CC7A 1Q12A 3VDYA 3AEVA 3OTOL 4P73A 5LMUQ 3W1GA 4DV2Q 1YNXA 3M3YH 4DR3L 4A3CH 3I4MG 1SR3A 1PA6A 3FP9A 1SLJA 3GDEA 4YCWA 4AYBG 4DV3Q 3H0GH 1KXLA 2QGQA 2NVXH 3D31A 1WCMH 4GLAC 2YU9H 2JA8H 5IP9H 5C4XG 1CSQA 2NZHA 3PUZA 4IFDG 5IYDH 2VW9A 2Q2HA 3TQYA 4A3JG 4B3RQ 5AJ3L 2Y0SG 1W2BA 4NXML 2A19A 1SMXA 4B3ML 1N34Q 2UXDL 3E0EA 2QA4A 1QVFA 4PZ6A 1XNQL 1P16A 1U5KA 3T1HQ 3I56A 1XTDA 4HJ5A 2Q2IA 4JBKA 4UP9A 1PV4A 3PO2G 1XPOA 1YZ6A 1KD1C 4QY7A 1GM5A 4C3IH 4LF4Q 4OWWB 1VQEA 4JI6Q 2MQHA 4UY8C 4BY7H 2ALYB 4KHPL 3PIPA 4HIDA 2VL6A 3U58A 4LF9L 2NN6G 4DR7Q 2Q2UA 4JV5Q 1K9MC 4IPDA 4X64Q 3I55A 3M9BA 2D0OA 3F2BA 4JI8Q 4A3BH 1VQHA 1VQ8A 2A1AA 4OONA 3BZCA 3U50C 2RHSB 3IRBA 1LYLA 1YI2A 5LMNQ 2YTVA 3DM3A 2VY3A 3STBC 2OTJA 4GN5A 4IJLA 1TWAH 2ZJRA 4A3IG 2B63G 5ELOA 1K8AC 4BY1H 2ID0A 3CQZH 2VUMG 4A93G 2YYZA 4X65Q 1N33Q 1XMQQ 1E3PA 2K50A 4DUYQ 4A3EH 4DR4Q 2NN6I 4YCVA 1BKBA 2UXCL 1OXTA 2E2IH 3K0XA 3RLOA 3J7ZC 4DV0L 3LGJA 1AE3A 3I4OA 4DR1Q 3PV0A 4A3CG 2UUCQ 4A76A 1WI5A 5IY0A 5LMNW 3F1ZA 3S16H 4IOAA 3AFQA 4YWLA 4GKJL 3BZKA 3L7ZC 2E5LL 4A4IA 2JE6I 4GS3A 1MJEA 3GTPH 2BA0A 2N8NA 2HT1A 2K5HA 3H0GG 5FLXc 1M90C 4JYAQ 2IY5B 4YY3Q 1WCMG 5M3FH 2JA8G 1IBLL 5IP9G 4QGUA 5IYBH 2VQFL 1XPRA 1PH2A 1D8LA 2OTLA 4BXXG 2JJQA 4HIOA 5IYDG 1VQ7A 3S24A 4LFBQ 4IPGA 5GADC 1JJGA 1K83H 4AIMA 1N8RC 3CF5A 2N3SA 2Q2TA 1JMCA 3TRZA 4JI2L 2R6GA 2WB1E 4BBSH 1YJ9A 4NXNQ 1FGUA 3ULPA 4DR2L 1SRUA 4JI3Q 5HGQA 4LFAL 2JA7H 4JI7Q 1YITA 1HR0L 1C7YA 1OTCA 4YWKA 3KLWA 4GNXB 4HJ7A 2IX0A 1HZCA 4L5QA 3PUYA 4R4TA 3T1YQ 1T9HA 1XNRQ 1XJVA 1P8LA 1B70B 1S40A 1N36Q 4PZ7A 4B3TQ 2ZTDA 3WWVA 3TEHB 5BR8L 2BH2A 2CWAA 2E2JH 3RN5A 5K36G 3A5ZB 4DK6C 3JAMc 1EQQA 1Z47A 2KHJA 1VQLA 3F2CA 1VQPA 2XTIA 3ERSX 4DUZQ 3NBHB 4BY1G 1SE8A 3OW2A 4B3SQ 3ICEA 5IWAQ 1EYGA 2GVBA 2VZAA 3RN2A 1YHAA 2PI2E 2ZTCA 1X54A 5IYCH 2JEBI 2EQSA 4A3EG 4LF8L 2NVYH 3HKSA 2KENA 1UE1A 1IBMQ 4GKKL 3K7AH 4XIGS 4JI1Q 2JA5H 1S3OA 1EQRA 1UWVA 1HNZQ 2ZM6L 2IHEA 1XMOQ 5E7NA 1CKNB 4DR5L 4JI4Q 2E2HH 1FJGQ 3GTJH 1BBUA 1Q46A 1VQNA 2K14A 3I4NH 2KBNA 5LMUL 5JEAJ 3NELA 1L1OC 2UUAQ 1UE7A 1V9PA 3UE1A 3G6EA 5M3FG 4O0AA 4DV4Q 1XNQQ 2KHIA 3B6YA 1QVCA 4O2DA 5FJ8H 5IYBG 2R93H 1YEZA 1D7QA 4LUZA 1J5EQ 1JE5A 3G48A 4A3GH 2UUBQ 1CKOA 1AH9A 2R7DA 4DV3L 1N32Q 1UE6A 4OX9Q 2N78A 4R1JA 4BBSG 1S72A 4DV1Q 1Q81C 4BBRH 1MIUA 3KDFA 1IBKL 2UU9L 1L1OA 4IPCA 2CWPA 1HZAA 1YVCA 1HH2P 3UDFA 2F4VL 2JA7G 1PH5A 1CKMA 1EFWA 3M7NA 4FDBA 4B3RL 1PH7A 5JJKA 1CSPA 1QVGA 3AYHB 1KC8C 3KJPA 4P74A 2IX1A 4IOCA 3CCLA 2OWOA 2MO1A 1QZGA 2ATWA 2HQLA 3M4OH 3RNUA 5DLQE 4YWMA 3J81j 4JI0Q 1IL2A 4DR3Q 1HNWQ 3RLNA 4J15A 4DAYB 2L15A 5FLMH 4TVAB 3T1HL 1VQ5A 3HOYH 5JJIA 3GTOH 5M5XH 3A5UA 3W5OA 1HNXQ 2DGYA 3CP0A 1B7YB 4MTNA 3TS0A 4JI6L 3M4QA 3HOWH 4A3DH 2RF4A 3TREA 1OXSC 4IO9A 4JV5L 1X3EA 2EIFA 2WAQG 1M1KC 4XTCS 4DR6L 4MNOA 1Q1EA 4UP8A 2I5LX 4TQUS 2GN5A 4DNIA 1PH9A 5LMNL 1KAWA 2UXBQ 4DV5L 5AJ3Q 4NXMQ 1PFSA 4R4OA 4DV6Q 3F2DA 2JA5G 4B3MQ 5M5YH 3CCVA 4WJ4A 1GD7A 4X66L 4WJ3M 4JI5Q 2NZOA 3M4PA 1XMQL 1PH6A 2PQAB 1KL9A 4DUYL 1WOCA 5M5WH 4DK3C 3F8TA 4DR4L 4A3DG 2BH8A 3PUWA 1I94Q 1X6OA 4JBJA 1VQKA 3CC4A 2PMZE 5EAYA 3PF4A 3RLFA 2YTXA 4IPHA 1VQAA 4DR1L 4GOPB 2R93G 1NE3A 5FJ8G 2EXDA 3CCEA 4R4QA 1VQDA 4QQBX 4A3GG 3S17H 4BA1I 2ZJQA 1Y14B 2GVAA 4LUOA 4RMFA 4Y52H 3PCOB 1Y1VH 1QUQB 2K5VA 5C0XJ 3KF6A 5GAEC 4A75A 4LF5Q 4BBRG 4QIWE 4OWTB 4EX5A 2YTYA 1HJPA 3HKZE 5C3EH 4HIKA 4L5SA 2VQEQ 1QZHA 3CW2C 2F3IA 5C4JH 4LUVA 3CCRA 1A63A 4OO1I 3GTLH 2WP8J 3EIVA 3CAMA 3UDIA 2UXCQ 1X56A 4R4IA 4GN3B 4L5RC 4LFCL 4JI3L 2RCNA 4DV0Q 3ULLA 4HIMA 1PH1A 1XPUA 5M3MH 2I5HA 5FLMG 2AWOA 1OXUA 3D0FA 4POFA 3HOYG 1G51A 1G6PA 2K52A 3J81i 3BJUA 3ZJYC 1K73C 5J3BA 3CCSA 3HOWG 3KJOA 1E22A 1I50H 2K75A 1EOVA 3HFZB 3J80i 4DV7Q 3T1YL 4KHZA 3PF5A 3KFUA 3HOZH 4BY7G 1XNRL 2JA6H 1NMGA 3JAMi 4X62L 2VQFQ 4B3TL 3W1BA 1VQOA 2R7ZH 4A3BG 2N49A 4AYBE 4JI2Q 2RHQB 1NTGA 1OXXK 4PZ8A 3GO5A 2MNAA 1UEBA 3DLLA 1KRTA 3CCQA 2HHHL 1U0LA 4A3LH 3K7UC 1DGSA 4HJ9A 1TWFH 4QL5A 4YCUA 4DUZL 4B3SL 1PYSB 3TS2A 1J6QA 1VQ9A 4LF7Q 1I6HH 1UE5A 3S1MH 4LF6L 2WFWA 1FVIA 1E1TA 3K80C 2Y0SE 2CKZB 1L0WA 1IBML 3H3VI 1I3QH 2JK8A 1RL2A 4GOPC 3RR5A 1VQMA 1XMOL 4JI4L 1GVPA 4MZ9A 3GTKH 5C0XI 1JJ2A 1EWIA 3AQQA 1NBWA 1K3RA 1WYDA 1GO3E 1R9TH 2LSSA 1K0RA 2UUAL 2PQAA 2ES2A 1N9WA 4K0KQ 1OXVA 4DV4L 2A8VA 1K8GA 1HZ9A 4DV2L 3GTGH 2JEAI 3PUVA 3KYHC 3PO3H 3A74A 1LTLA 5C3EG 1JB7A 1HR0W 1J5EL 4AQYQ 3S1RH 4IFDJ 4GOPA 4Y7NH 3HOUH 4IJHA 5H1SE 2OQ0A 1Q82C 2LXJA 5IP7H 4A3FH 3I7FA 4APVA 2HIXA 4LF8Q 3PIOA 2WB1G 2AWNA 1KRSA 1BVSA 1IZ6A 4OXPA 3CCJA 4GN4B 5GAHC 3CPWA 3CMEA 1VCIA 4DAMA 5M3MG 2MO0A 4BA2I 4A3KH 1AE2A 1Q1BA 1IXRA 3Q8DA 1YBYA 2Z6KC 4DR5Q 5GQOA 4EQ5A 4YHHQ 4HJAA 1Q7YC 2CFMA 4KI0A 1YIJA 2B29A 3U4VA 3OTOQ 4GNXC 1N34L 4JG2A 3KF8B 4R4CA 1ASZA 2ASBA 4JI0L 3HOZG 3FHWA 4GLVB 1E24A 4OWXB 2JA6G 1Q8KA 4KLKA 3GTMH 3L0OA 1HNWL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PI2 A;  2R7Z G;  2R7F A;  1HNX L;  3FKI H;  5HY6 A;  2HIV A;  4NPS A;  1JJC B;  2IHF A;  3E9H A;  1W3S A;  3ULJ A;  4C3H H;  1VQG A;  2Z6K A;  5GAG C;  2QEX A;  3CMA A;  1LUZ A;  4JBW A;  2VS1 A;  5JEA G;  4LF4 L;  2NVT H;  3HOV H;  1X3G A;  3J7A 5;  4A3L G;  2MFI A;  4DR7 L;  5C44 H;  3HOX H;  4DPG A;  4GNX A;  1IBK Q;  2UU9 Q;  4X64 L;  4BXX H;  1O7I A;  2F4V Q;  1EIY B;  2UXB L;  4JI8 L;  3H3V H;  2H5X A;  1VQF A;  4L5T A;  3K81 C;  5IE8 A;  3S1N H;  5IYC G;  4H02 A;  1VQI A;  2NVQ H;  4A3M H;  4DV6 L;  1TWG H;  1E7Z A;  1TXY A;  1VQ6 A;  2AMC B;  2ZJP A;  5GRO A;  2AHO B;  1YJW A;  2UXD Q;  2C35 B;  3EN2 A;  4JI5 L;  1SN8 A;  1LM0 A;  2Z0S A;  2D0P A;  2D62 A;  3S14 H;  4PG3 A;  1N33 L;  4X65 L;  1I94 L;  1E1O A;  1NY4 A;  3I4N G;  1X55 A;  4PMW A;  2IT1 A;  4IFD I;  3K8A A;  3PO3 G;  2KCM A;  3CCM A;  1Z9F A;  1Y1W H;  4OO1 G;  2FXQ A;  3NEM A;  2UUC L;  4P71 A;  3HOU G;  4KHP Q;  3I2Z A;  3U4Z A;  4LF9 Q;  1PHJ A;  4DR6 Q;  5ELN A;  4ME3 A;  5IP7 G;  2B3G A;  4HJ8 A;  4A3F G;  1CKN A;  4AH6 A;  2XGT A;  1HZB A;  4LF5 L;  4DV5 Q;  1EIF A;  3CCU A;  4GLX A;  4JYA L;  4YY3 L;  1BBW A;  3RZD H;  1YHQ A;  1NMF A;  1PH8 A;  2VQE L;  4A3K G;  2I5M X;  4X66 Q;  1A0I A;  2LXK A;  1ASY A;  2R92 H;  4LFB L;  5IT9 c;  1IYJ B;  2V1C C;  3M85 A;  1V43 A;  4UP7 A;  4NXN L;  2K5N A;  2OCE A;  1B8A A;  3AFP A;  1VQB A;  1VS0 A;  2K4K A;  1MJC A;  2YV5 A;  4QJF A;  3UE0 A;  1Q86 C;  4JI7 L;  3S15 H;  1GKH A;  3FKI G;  3L2P A;  1WFQ A;  3S1Q H;  3G71 A;  4GKJ Q;  3KDF B;  2E5L Q;  3STB D;  3ER0 A;  4C2M H;  4DV7 L;  3HOV G;  1L1O B;  2JA9 A;  2PNH A;  4DKA C;  3SGI A;  4POG A;  3GTQ H;  3JC6 6;  3UDG A;  1PVO A;  5C44 G;  3HOX G;  3PUX A;  1VQJ A;  2VNU D;  1IBL Q;  3S2H H;  1N36 L;  1YJN A;  1PH4 A;  2OQK A;  3MEF A;  3I4M H;  1NJI C;  1KIX A;  1PYB A;  1I5F A;  2I0Q A;  4JCV E;  3PGZ A;  2KCT A;  4LW1 A;  4A3M G;  3S2D H;  2JQO A;  3UDX A;  2DUD A;  5C0X G;  1JT8 A;  1EUJ A;  4LFC Q;  3RZO H;  1KQS A;  4DR2 Q;  4RG1 A;  1PH3 A;  5C4X H;  1WJJ A;  3G4S A;  4LF7 L;  4NB3 A;  4P75 A;  5IWA L;  4LFA Q;  1SRO A;  3E9I A;  1A8V A;  3CXC A;  4A3J H;  1CUK A;  1HR0 Q;  1VQC A;  1C9O A;  1FL0 A;  1TWH H;  4JI1 L;  3A0J A;  1G29 1;  1Y1W G;  1HNZ L;  1H95 A;  1KHI A;  1X9N A;  4LNQ A;  3J81 c;  2F52 A;  2AKW B;  2E8G A;  3CC2 A;  1FJG L;  4X62 Q;  1YHB A;  1RIP A;  3NEN A;  1X3F A;  4ALP A;  3J80 c;  4K0K L;  1Y1V G;  2CQO A;  5BR8 Q;  3PO2 H;  1X65 A;  4JOI C;  2CCZ A;  4AQY L;  3HKZ G;  2HHH Q;  4JBM A;  5JJL A;  2R92 G;  2WAQ E;  2UUB L;  1L2F A;  2BA1 A;  1N32 L;  3MXN B;  4LF6 Q;  4OX9 L;  3CD6 A;  4JC0 A;  4LWC A;  3BU2 A;  3H15 A;  4DV1 L;  3GD7 A;  3OYY A;  1TWC H;  3CPF A;  1V1Q A;  1QUQ A;  1VQ4 A;  3EBE A;  2ZTE A;  3KOJ A;  4GKK Q;  1C0A A;  4P72 A;  1MKH A;  4JOI A;  4A3I H;  2ZM6 Q;  2B63 H;  4YHH L;  1A62 A;  2VUM H;  4UPA A;  3KF6 B;  1SFO H;  4A93 H;  4C3J H;  4X6A H;  3PSI A;  3CC7 A;  1Q12 A;  3VDY A;  3AEV A;  3OTO L;  4P73 A;  5LMU Q;  3W1G A;  4DV2 Q;  1YNX A;  3M3Y H;  4DR3 L;  4A3C H;  3I4M G;  1SR3 A;  1PA6 A;  3FP9 A;  1SLJ A;  3GDE A;  4YCW A;  4AYB G;  4DV3 Q;  3H0G H;  1KXL A;  2QGQ A;  2NVX H;  3D31 A;  1WCM H;  4GLA C;  2YU9 H;  2JA8 H;  5IP9 H;  5C4X G;  1CSQ A;  2NZH A;  3PUZ A;  4IFD G;  5IYD H;  2VW9 A;  2Q2H A;  3TQY A;  4A3J G;  4B3R Q;  5AJ3 L;  2Y0S G;  1W2B A;  4NXM L;  2A19 A;  1SMX A;  4B3M L;  1N34 Q;  2UXD L;  3E0E A;  2QA4 A;  1QVF A;  4PZ6 A;  1XNQ L;  1P16 A;  1U5K A;  3T1H Q;  3I56 A;  1XTD A;  4HJ5 A;  2Q2I A;  4JBK A;  4UP9 A;  1PV4 A;  3PO2 G;  1XPO A;  1YZ6 A;  1KD1 C;  4QY7 A;  1GM5 A;  4C3I H;  4LF4 Q;  4OWW B;  1VQE A;  4JI6 Q;  2MQH A;  4UY8 C;  4BY7 H;  2ALY B;  4KHP L;  3PIP A;  4HID A;  2VL6 A;  3U58 A;  4LF9 L;  2NN6 G;  4DR7 Q;  2Q2U A;  4JV5 Q;  1K9M C;  4IPD A;  4X64 Q;  3I55 A;  3M9B A;  2D0O A;  3F2B A;  4JI8 Q;  4A3B H;  1VQH A;  1VQ8 A;  2A1A A;  4OON A;  3BZC A;  3U50 C;  2RHS B;  3IRB A;  1LYL A;  1YI2 A;  5LMN Q;  2YTV A;  3DM3 A;  2VY3 A;  3STB C;  2OTJ A;  4GN5 A;  4IJL A;  1TWA H;  2ZJR A;  4A3I G;  2B63 G;  5ELO A;  1K8A C;  4BY1 H;  2ID0 A;  3CQZ H;  2VUM G;  4A93 G;  2YYZ A;  4X65 Q;  1N33 Q;  1XMQ Q;  1E3P A;  2K50 A;  4DUY Q;  4A3E H;  4DR4 Q;  2NN6 I;  4YCV A;  1BKB A;  2UXC L;  1OXT A;  2E2I H;  3K0X A;  3RLO A;  3J7Z C;  4DV0 L;  3LGJ A;  1AE3 A;  3I4O A;  4DR1 Q;  3PV0 A;  4A3C G;  2UUC Q;  4A76 A;  1WI5 A;  5IY0 A;  5LMN W;  3F1Z A;  3S16 H;  4IOA A;  3AFQ A;  4YWL A;  4GKJ L;  3BZK A;  3L7Z C;  2E5L L;  4A4I A;  2JE6 I;  4GS3 A;  1MJE A;  3GTP H;  2BA0 A;  2N8N A;  2HT1 A;  2K5H A;  3H0G G;  5FLX c;  1M90 C;  4JYA Q;  2IY5 B;  4YY3 Q;  1WCM G;  5M3F H;  2JA8 G;  1IBL L;  5IP9 G;  4QGU A;  5IYB H;  2VQF L;  1XPR A;  1PH2 A;  1D8L A;  2OTL A;  4BXX G;  2JJQ A;  4HIO A;  5IYD G;  1VQ7 A;  3S24 A;  4LFB Q;  4IPG A;  5GAD C;  1JJG A;  1K83 H;  4AIM A;  1N8R C;  3CF5 A;  2N3S A;  2Q2T A;  1JMC A;  3TRZ A;  4JI2 L;  2R6G A;  2WB1 E;  4BBS H;  1YJ9 A;  4NXN Q;  1FGU A;  3ULP A;  4DR2 L;  1SRU A;  4JI3 Q;  5HGQ A;  4LFA L;  2JA7 H;  4JI7 Q;  1YIT A;  1HR0 L;  1C7Y A;  1OTC A;  4YWK A;  3KLW A;  4GNX B;  4HJ7 A;  2IX0 A;  1HZC A;  4L5Q A;  3PUY A;  4R4T A;  3T1Y Q;  1T9H A;  1XNR Q;  1XJV A;  1P8L A;  1B70 B;  1S40 A;  1N36 Q;  4PZ7 A;  4B3T Q;  2ZTD A;  3WWV A;  3TEH B;  5BR8 L;  2BH2 A;  2CWA A;  2E2J H;  3RN5 A;  5K36 G;  3A5Z B;  4DK6 C;  3JAM c;  1EQQ A;  1Z47 A;  2KHJ A;  1VQL A;  3F2C A;  1VQP A;  2XTI A;  3ERS X;  4DUZ Q;  3NBH B;  4BY1 G;  1SE8 A;  3OW2 A;  4B3S Q;  3ICE A;  5IWA Q;  1EYG A;  2GVB A;  2VZA A;  3RN2 A;  1YHA A;  2PI2 E;  2ZTC A;  1X54 A;  5IYC H;  2JEB I;  2EQS A;  4A3E G;  4LF8 L;  2NVY H;  3HKS A;  2KEN A;  1UE1 A;  1IBM Q;  4GKK L;  3K7A H;  4XIG S;  4JI1 Q;  2JA5 H;  1S3O A;  1EQR A;  1UWV A;  1HNZ Q;  2ZM6 L;  2IHE A;  1XMO Q;  5E7N A;  1CKN B;  4DR5 L;  4JI4 Q;  2E2H H;  1FJG Q;  3GTJ H;  1BBU A;  1Q46 A;  1VQN A;  2K14 A;  3I4N H;  2KBN A;  5LMU L;  5JEA J;  3NEL A;  1L1O C;  2UUA Q;  1UE7 A;  1V9P A;  3UE1 A;  3G6E A;  5M3F G;  4O0A A;  4DV4 Q;  1XNQ Q;  2KHI A;  3B6Y A;  1QVC A;  4O2D A;  5FJ8 H;  5IYB G;  2R93 H;  1YEZ A;  1D7Q A;  4LUZ A;  1J5E Q;  1JE5 A;  3G48 A;  4A3G H;  2UUB Q;  1CKO A;  1AH9 A;  2R7D A;  4DV3 L;  1N32 Q;  1UE6 A;  4OX9 Q;  2N78 A;  4R1J A;  4BBS G;  1S72 A;  4DV1 Q;  1Q81 C;  4BBR H;  1MIU A;  3KDF A;  1IBK L;  2UU9 L;  1L1O A;  4IPC A;  2CWP A;  1HZA A;  1YVC A;  1HH2 P;  3UDF A;  2F4V L;  2JA7 G;  1PH5 A;  1CKM A;  1EFW A;  3M7N A;  4FDB A;  4B3R L;  1PH7 A;  5JJK A;  1CSP A;  1QVG A;  3AYH B;  1KC8 C;  3KJP A;  4P74 A;  2IX1 A;  4IOC A;  3CCL A;  2OWO A;  2MO1 A;  1QZG A;  2ATW A;  2HQL A;  3M4O H;  3RNU A;  5DLQ E;  4YWM A;  3J81 j;  4JI0 Q;  1IL2 A;  4DR3 Q;  1HNW Q;  3RLN A;  4J15 A;  4DAY B;  2L15 A;  5FLM H;  4TVA B;  3T1H L;  1VQ5 A;  3HOY H;  5JJI A;  3GTO H;  5M5X H;  3A5U A;  3W5O A;  1HNX Q;  2DGY A;  3CP0 A;  1B7Y B;  4MTN A;  3TS0 A;  4JI6 L;  3M4Q A;  3HOW H;  4A3D H;  2RF4 A;  3TRE A;  1OXS C;  4IO9 A;  4JV5 L;  1X3E A;  2EIF A;  2WAQ G;  1M1K C;  4XTC S;  4DR6 L;  4MNO A;  1Q1E A;  4UP8 A;  2I5L X;  4TQU S;  2GN5 A;  4DNI A;  1PH9 A;  5LMN L;  1KAW A;  2UXB Q;  4DV5 L;  5AJ3 Q;  4NXM Q;  1PFS A;  4R4O A;  4DV6 Q;  3F2D A;  2JA5 G;  4B3M Q;  5M5Y H;  3CCV A;  4WJ4 A;  1GD7 A;  4X66 L;  4WJ3 M;  4JI5 Q;  2NZO A;  3M4P A;  1XMQ L;  1PH6 A;  2PQA B;  1KL9 A;  4DUY L;  1WOC A;  5M5W H;  4DK3 C;  3F8T A;  4DR4 L;  4A3D G;  2BH8 A;  3PUW A;  1I94 Q;  1X6O A;  4JBJ A;  1VQK A;  3CC4 A;  2PMZ E;  5EAY A;  3PF4 A;  3RLF A;  2YTX A;  4IPH A;  1VQA A;  4DR1 L;  4GOP B;  2R93 G;  1NE3 A;  5FJ8 G;  2EXD A;  3CCE A;  4R4Q A;  1VQD A;  4QQB X;  4A3G G;  3S17 H;  4BA1 I;  2ZJQ A;  1Y14 B;  2GVA A;  4LUO A;  4RMF A;  4Y52 H;  3PCO B;  1Y1V H;  1QUQ B;  2K5V A;  5C0X J;  3KF6 A;  5GAE C;  4A75 A;  4LF5 Q;  4BBR G;  4QIW E;  4OWT B;  4EX5 A;  2YTY A;  1HJP A;  3HKZ E;  5C3E H;  4HIK A;  4L5S A;  2VQE Q;  1QZH A;  3CW2 C;  2F3I A;  5C4J H;  4LUV A;  3CCR A;  1A63 A;  4OO1 I;  3GTL H;  2WP8 J;  3EIV A;  3CAM A;  3UDI A;  2UXC Q;  1X56 A;  4R4I A;  4GN3 B;  4L5R C;  4LFC L;  4JI3 L;  2RCN A;  4DV0 Q;  3ULL A;  4HIM A;  1PH1 A;  1XPU A;  5M3M H;  2I5H A;  5FLM G;  2AWO A;  1OXU A;  3D0F A;  4POF A;  3HOY G;  1G51 A;  1G6P A;  2K52 A;  3J81 i;  3BJU A;  3ZJY C;  1K73 C;  5J3B A;  3CCS A;  3HOW G;  3KJO A;  1E22 A;  1I50 H;  2K75 A;  1EOV A;  3HFZ B;  3J80 i;  4DV7 Q;  3T1Y L;  4KHZ A;  3PF5 A;  3KFU A;  3HOZ H;  4BY7 G;  1XNR L;  2JA6 H;  1NMG A;  3JAM i;  4X62 L;  2VQF Q;  4B3T L;  3W1B A;  1VQO A;  2R7Z H;  4A3B G;  2N49 A;  4AYB E;  4JI2 Q;  2RHQ B;  1NTG A;  1OXX K;  4PZ8 A;  3GO5 A;  2MNA A;  1UEB A;  3DLL A;  1KRT A;  3CCQ A;  2HHH L;  1U0L A;  4A3L H;  3K7U C;  1DGS A;  4HJ9 A;  1TWF H;  4QL5 A;  4YCU A;  4DUZ L;  4B3S L;  1PYS B;  3TS2 A;  1J6Q A;  1VQ9 A;  4LF7 Q;  1I6H H;  1UE5 A;  3S1M H;  4LF6 L;  2WFW A;  1FVI A;  1E1T A;  3K80 C;  2Y0S E;  2CKZ B;  1L0W A;  1IBM L;  3H3V I;  1I3Q H;  2JK8 A;  1RL2 A;  4GOP C;  3RR5 A;  1VQM A;  1XMO L;  4JI4 L;  1GVP A;  4MZ9 A;  3GTK H;  5C0X I;  1JJ2 A;  1EWI A;  3AQQ A;  1NBW A;  1K3R A;  1WYD A;  1GO3 E;  1R9T H;  2LSS A;  1K0R A;  2UUA L;  2PQA A;  2ES2 A;  1N9W A;  4K0K Q;  1OXV A;  4DV4 L;  2A8V A;  1K8G A;  1HZ9 A;  4DV2 L;  3GTG H;  2JEA I;  3PUV A;  3KYH C;  3PO3 H;  3A74 A;  1LTL A;  5C3E G;  1JB7 A;  1HR0 W;  1J5E L;  4AQY Q;  3S1R H;  4IFD J;  4GOP A;  4Y7N H;  3HOU H;  4IJH A;  5H1S E;  2OQ0 A;  1Q82 C;  2LXJ A;  5IP7 H;  4A3F H;  3I7F A;  4APV A;  2HIX A;  4LF8 Q;  3PIO A;  2WB1 G;  2AWN A;  1KRS A;  1BVS A;  1IZ6 A;  4OXP A;  3CCJ A;  4GN4 B;  5GAH C;  3CPW A;  3CME A;  1VCI A;  4DAM A;  5M3M G;  2MO0 A;  4BA2 I;  4A3K H;  1AE2 A;  1Q1B A;  1IXR A;  3Q8D A;  1YBY A;  2Z6K C;  4DR5 Q;  5GQO A;  4EQ5 A;  4YHH Q;  4HJA A;  1Q7Y C;  2CFM A;  4KI0 A;  1YIJ A;  2B29 A;  3U4V A;  3OTO Q;  4GNX C;  1N34 L;  4JG2 A;  3KF8 B;  4R4C A;  1ASZ A;  2ASB A;  4JI0 L;  3HOZ G;  3FHW A;  4GLV B;  1E24 A;  4OWX B;  2JA6 G;  1Q8K A;  4KLK A;  3GTM H;  3L0O A;  1HNW L; 
#chains in the Genus database with same CATH topology
 3EPG A;  2PMZ B;  4C3I B;  3G6Y A;  1DV1 A;  5HY6 A;  2HIV A;  1O75 A;  5KG7 A;  1I3Q A;  1W3S A;  3ULJ A;  4C3H H;  3CMA A;  3T5K A;  5JEA G;  5LL6 b;  2G9D A;  2X69 A;  1EIH A;  2VPQ A;  2IL8 A;  5C1P A;  2D5D A;  3HOX H;  2AGP A;  4BXX H;  2H5X A;  2GLT A;  2JP1 A;  2ICE C;  5JH7 F;  2I8C A;  2KCC A;  1TWA B;  1HA5 A;  1UAP A;  4DV6 L;  1JWM D;  1E7Z A;  2E2D C;  2ZJP A;  5HBR B;  4CKC A;  1YJW A;  4HMI A;  3NK9 A;  2C35 B;  1SE4 A;  3EN2 A;  2UXD Q;  5J2U F;  1LM0 A;  3NSW A;  2Z0S A;  4PG3 A;  3UI2 A;  1AZQ A;  2HDM A;  2LMC B;  5KG6 A;  2C00 A;  1WTW A;  4IFD I;  2V58 A;  4JUZ A;  3S16 B;  3PO3 G;  4YIJ A;  4FBT A;  4KV6 A;  4OO1 G;  5KFY A;  4ED2 A;  4P71 A;  5E3F A;  4KHP Q;  4LF9 Q;  4DR6 Q;  5ELN A;  2K1B A;  4HJ8 A;  1AP0 A;  5EPK A;  1B53 A;  1RJQ A;  4E4T A;  1DXM A;  4ED0 A;  3VYS A;  1EIF A;  3CCU A;  3C46 A;  1EL0 A;  3BVG A;  1YHQ A;  1N56 A;  3EA6 A;  5C1O A;  1ASY A;  3RJ0 A;  4DK1 A;  4LFB L;  3S2D B;  4K5X A;  4DR5 H;  3NHH A;  5COR A;  5K5P A;  3M85 A;  5DG8 A;  4HR7 B;  3MEH A;  4UP7 A;  1SNO A;  3RV3 A;  4XT3 B;  2K5N A;  1EHI A;  2R8H A;  5CC4 A;  5CV4 A;  5E4W C;  3AFP A;  2YV5 A;  3TP6 A;  1BCP F;  2Y0S B;  2KA7 A;  5DG9 A;  2B8F A;  3S15 H;  3G71 A;  2VR1 A;  4OL7 A;  4L1K A;  4C2M H;  1L1O B;  1DV2 A;  4NMZ A;  3GTQ H;  2O5I C;  3R2T A;  1VQJ A;  2VNU D;  4O3N A;  1E2V A;  3FMC A;  2Q8I B;  2BE5 C;  2J6U A;  2F4V H;  2OQK A;  3MEF A;  1KIX A;  1YNJ D;  2DUD A;  2F3V A;  2JYO A;  3MFG A;  1JT8 A;  3WDN A;  5IGE A;  1EUJ A;  4LFC Q;  2MGS A;  4ED7 A;  1M4V A;  1PH3 A;  4IFD H;  1TT2 A;  1QE6 A;  3E9I A;  1IKM A;  1JWU D;  1HR0 Q;  1CUK A;  1Y1V A;  1V1O A;  1VQC A;  1C48 A;  2MPM A;  3NTK A;  1TWH H;  4DFA A;  3RFC A;  4ID6 A;  1SFO B;  3MFI A;  4RUA A;  1TR5 A;  3K3P A;  5KYL A;  1FJG L;  2E8G A;  3CC2 A;  3DMU A;  3DF7 A;  1YHB A;  1RIP A;  1LTT D;  3BYY B;  5EWE A;  4ALP A;  3M3Y B;  4HSV A;  2N88 A;  2CQO A;  5BR8 Q;  3GIM A;  4G3I A;  2XC9 A;  2F0N A;  4DV5 H;  1VMP A;  4JOI C;  4ZAI A;  4EQN A;  2J7Z A;  4JBM A;  2W8K A;  5J2T F;  1CE8 A;  4YAJ B;  4ZQ3 A;  2NN6 H;  5KFZ A;  5H80 A;  4X66 H;  5IYZ F;  3H20 A;  4OX9 L;  2QK4 A;  4C2M A;  1VDZ A;  3OYY A;  3GTQ A;  2K5D A;  1ESR A;  1QUQ A;  1U4M A;  3T5J A;  2ZTE A;  3KOJ A;  5G3L F;  1C0A A;  5NUC A;  1F77 A;  4JOI A;  2B63 H;  1O78 A;  1EZ6 A;  4NP5 A;  2KHS A;  2SEB D;  3K5L A;  4LK1 C;  3BG3 A;  4C3J H;  3M4O B;  4X6A H;  1Q12 A;  3VDY A;  3AEV A;  4LSX A;  2FHT A;  2SNM A;  2RDG A;  2KSW A;  5A2Q L;  2DWC A;  2C2D A;  1SXT A;  1PA6 A;  3FP9 A;  2ASL A;  4YCW A;  4AYB G;  4DV3 Q;  4BY7 B;  1TWH A;  4F4X A;  3LWU A;  3HG9 A;  4JV1 A;  3MWE A;  2QKI C;  1PZK D;  4ECZ A;  1TS3 A;  2VA3 A;  2QGQ A;  4A3B B;  2NVX H;  2YU9 H;  1WCM H;  4GLA C;  4TUY F;  4JI3 H;  1GUO A;  2XSC A;  1ET6 A;  3DEO A;  5C4X G;  2NZH A;  3PUZ A;  1F9R A;  4LFA H;  3TQY A;  4EVO A;  5DLF A;  4K5V A;  2K28 A;  2RBM A;  2A19 A;  5KG1 A;  1N34 Q;  2UXD L;  5M5W B;  1K3B C;  4FS2 A;  4FXG C;  4F88 A;  1JOR A;  4FF4 A;  1SDF A;  2QDB A;  2NWG A;  3JSL A;  3RB3 A;  2F0M A;  4QY7 A;  1CQV A;  4C3I H;  4IUQ A;  1GM5 A;  3R5H A;  4A2B A;  2K04 A;  4KHP L;  2B63 A;  3PIP A;  4DR7 Q;  4LF9 L;  4Q43 A;  1ZHS A;  1K9M C;  4IPD A;  3I55 A;  1KDA A;  3ORQ A;  4G57 A;  2IBK A;  4JI8 Q;  4MV9 A;  1II3 A;  3KAL A;  1V4Y A;  2MCT A;  2NZ1 D;  4CDD C;  1RK6 A;  2YTV A;  3GTM A;  4KN4 C;  4DN4 M;  1RKN A;  1JX4 A;  1M0T A;  1TWA H;  4GKK H;  3H4B A;  1I4R A;  2EJM A;  2YYZ A;  5C6A A;  5IOC A;  3HZX A;  2EY2 A;  1E3P A;  4FNF A;  4DUY Q;  1XMQ Q;  5FO8 B;  4DLK A;  2UXC L;  1OXT A;  2PW7 A;  2NVX A;  2YU9 A;  1WCM A;  1WTV A;  2OEO A;  3DWQ A;  3FEW X;  1DON A;  3LGJ A;  4FBU A;  4Q0Y A;  1AE3 A;  4DR1 Q;  3PV0 A;  4A3C G;  2RKS A;  2UUC Q;  2J9G A;  3IN5 A;  3PW5 A;  5IGB A;  3EVQ A;  3S16 H;  5LYJ F;  4YWL A;  2FK2 A;  3BZK A;  3L7Z C;  5KFI A;  4A4I A;  2JE6 I;  4EEY A;  3RF2 A;  1FNV A;  1DOK A;  3H0G G;  4EG0 A;  2WV6 D;  4YY3 Q;  4JK1 C;  5IP9 G;  4QGU A;  5IYB H;  2R8J A;  2OTL A;  3Q8S B;  3N6X A;  4F4Y A;  2FE3 A;  3PN1 A;  3CF5 A;  2Q2T A;  3T56 B;  3NPP A;  1CA5 A;  1JMC A;  2PMZ A;  4R7R A;  1ROD A;  1EYC A;  1YJ9 A;  2WAQ B;  5IT9 E;  4NXN Q;  1SJH D;  3S1M B;  2XCL A;  3JZI A;  1QG7 A;  1SRU A;  5HGQ A;  4K8J A;  1HR0 L;  2YCH A;  4RWS C;  1OTC A;  1EWH A;  3K3V A;  2IX0 A;  1TWA A;  4JI6 H;  1T9H A;  2PCF B;  4ECW A;  1LT6 D;  3SE7 A;  3KHG A;  1MD2 D;  3WWV A;  2HVQ A;  5BR8 L;  2BH2 A;  2CWA A;  5EBC A;  2V4Q A;  2K33 A;  5JEA H;  5LMN H;  3RN5 A;  5KYI A;  3JAM c;  4MV1 A;  4A3F B;  2YZG A;  1EQQ A;  1Z47 A;  4H13 C;  2EY6 A;  1HFN A;  1K8O A;  1VQP A;  3BJY A;  3ERS X;  1EZ8 A;  4KJN A;  4BY1 G;  4MAM A;  3BAB A;  2B39 A;  1ICF B;  1EYG A;  2GVB A;  4RB2 C;  1QCB D;  1YHA A;  4A3E G;  1X54 A;  3J7A V;  2A5H A;  3K5O A;  4DR4 H;  3HKS A;  1D1K A;  2KEN A;  2CQY A;  1SJE D;  4ZLT F;  4XIG S;  4LJZ C;  5KGU A;  2FMA A;  4XDX A;  3AMU A;  1CKN B;  2F0S A;  1B6S A;  4F4W A;  5KT6 A;  3G8C A;  2K14 A;  3GIL A;  2J0T D;  2KBN A;  1ZXT A;  5KNB A;  1L1O C;  2R7M A;  2R82 A;  1LV9 A;  5I4D A;  2NYZ D;  4DV4 Q;  4HR7 A;  2R93 H;  4C1N K;  1QVC A;  4EBC A;  5FJ8 H;  1S0O A;  2K6A A;  3G48 A;  4ZUI A;  3IFT A;  3HOW B;  2R7D A;  4DV3 L;  4LFB H;  3OIP A;  2XRS D;  3E0J A;  2KEC A;  3S9W A;  5C44 B;  1JDB B;  4IHJ F;  1RTO A;  4DV1 Q;  1E4F T;  1MIU A;  4O4L F;  1I7N A;  1IBK L;  2UU9 L;  3S1N B;  1L1O A;  4IPC A;  3ITP A;  2CWP A;  3SEB A;  1B6R A;  3UDF A;  1EFW A;  2K03 A;  1RJR A;  4FDB A;  4QMG A;  1CSP A;  1RD9 D;  3KJP A;  1F9P A;  3Q23 A;  2MO1 A;  4IUU A;  1U4L A;  3KHH A;  2F0P A;  3RNU A;  3M4O H;  2HVR A;  3J81 j;  5DLG A;  1IL2 A;  3MJF A;  2G9H D;  2L15 A;  3VR4 A;  1XNR H;  1GOZ A;  3WOF A;  4R9W A;  2R8I A;  4CJ2 C;  1B7Y B;  1Z2N X;  3TS0 A;  1GSO A;  3M4Q A;  1M0W A;  3L3O C;  1OXS C;  4IO9 A;  2ATL A;  2EIF A;  1M1K C;  2JEI A;  2FK3 A;  3PVX A;  2J6T A;  4UP8 A;  4DAV A;  3CRK C;  2FKL A;  1LO5 D;  3HKZ B;  4RH6 A;  4ULL A;  2DLN A;  2W9B B;  2R92 B;  4RKL A;  1PFS A;  1BCP C;  4FYD A;  2R93 A;  2JA5 G;  4B3M Q;  1S68 A;  1PTO F;  1SYE A;  5JJZ A;  4JI4 H;  4EYI B;  2NZO A;  1XMQ L;  1PH6 A;  1XNQ Q;  4DUY L;  1FJG H;  5M5W H;  5CR3 A;  3N43 B;  2X6G A;  3OPO A;  4MTK A;  1I94 Q;  4I7A A;  2PYK A;  5KT5 A;  5EAY A;  3RLF A;  3SI8 A;  2YTX A;  1VQA A;  4DR1 L;  2JEF A;  1VQD A;  1RJP A;  3PW2 A;  4BA1 I;  2ZJQ A;  1Y14 B;  4LUO A;  2FMM A;  1CZW A;  2FP4 B;  3QWN A;  2DJF C;  5EKL A;  4OX9 H;  5C0X J;  1IYU A;  2BCO A;  4RAU C;  4A75 A;  4YR3 A;  4LF5 Q;  4BBR G;  4QIW E;  4OWT B;  1HJP A;  5C3E H;  4IR9 A;  1JC7 A;  2VQE Q;  1QZH A;  1HUM A;  2HD3 A;  2MUY A;  3GTL H;  2WP8 J;  3UDI A;  1I4Q A;  4DL5 A;  1I6H B;  2RCN A;  4DV0 Q;  1U4R A;  1C30 A;  2DPI A;  4KK7 A;  5EJW A;  2E74 C;  4WRD A;  1OXU A;  4K6D A;  3HOY G;  1WH2 A;  4GC6 A;  3BJU A;  3ZJY C;  1T5E A;  5J3B A;  4A3D G;  1E22 A;  2K75 A;  1EOV A;  1MHW C;  3KFU A;  4KHZ A;  4A2A A;  5KFW A;  2KJX A;  4PMB A;  3PO2 B;  3G6J B;  1KJJ A;  4MTE A;  2PO4 A;  2YW2 A;  1VQO A;  1JDE A;  5HV6 A;  1ULZ A;  3GV5 B;  3NTH A;  4AYB E;  1PTO B;  4JI2 Q;  1OXX K;  2F0Q A;  3GO5 A;  1JB3 A;  2EPB A;  1UEB A;  1FNW A;  3FMA A;  2F0V A;  1U0L A;  2HHH L;  3K7U C;  4ME6 A;  2AUK A;  1CFM A;  1VQ9 A;  1S0N A;  4LF7 Q;  4JI5 H;  3S1M H;  1B50 A;  1FVI A;  3F8N A;  1HHV A;  4IWY A;  1E1T A;  4FXD A;  1L0W A;  2ZJT A;  2JK8 A;  4GOP C;  4YP3 A;  4DL7 A;  3PW0 A;  2VXW A;  1NNX A;  2A6E C;  1GVP A;  1T36 A;  5L1L A;  1B4O A;  5C0X I;  1EWI A;  3QIA A;  4QWB A;  3MZ5 A;  3AQQ A;  4LF9 H;  1MSG A;  2C9O A;  3GTL A;  4H7B A;  4XXE A;  1WYD A;  5T1G A;  1G2S A;  3LP8 A;  1N9W A;  4K0K Q;  3K6O A;  4DV4 L;  2PN1 A;  2A8V A;  1HZ9 A;  4DV2 L;  1EUD B;  1EYD A;  1GUT A;  5L1I A;  2W9C A;  4GOP A;  2A73 B;  5H1S E;  3GIK A;  2LXJ A;  5IP7 H;  4A3F H;  2L11 A;  1PRT F;  2WB1 G;  5KKN B;  1X32 A;  3OIQ A;  4JW0 A;  1KRS A;  4OXP A;  1IZ6 A;  1E0B A;  5ELC A;  5GON F;  2UXC H;  5M3M G;  1JWS D;  3GQB A;  1GUW A;  1KJ9 A;  2PZU A;  1Q1B A;  3Q8D A;  2JXM B;  3L4K A;  2Z6K C;  3V05 A;  3A8J E;  4HAE A;  4I50 F;  4HJA A;  1Q7Y C;  5BPH A;  3K59 A;  4WOR A;  1L2Z A;  1YIJ A;  2WKC A;  2B29 A;  1TAE A;  3HOZ G;  4GLV B;  1E24 A;  2JA6 G;  1O7L A;  3L0O A;  1K28 A;  1M6V A;  4FF2 A;  2R7Z G;  3FKI H;  2F3W A;  3DUZ A;  5JPM C;  5KG4 A;  2QEX A;  3CCM A;  2Z6K A;  3X3N A;  3URY A;  4LF4 L;  1X3G A;  4A3L G;  3IG0 A;  2JSO A;  5C44 H;  5LL6 X;  4X64 L;  1O7I A;  1EIY B;  4ECQ A;  4L5T A;  3K81 C;  4MA5 A;  3S1N H;  4IUR A;  4K6L A;  2I80 A;  1SE3 A;  3VA5 A;  1S9F A;  5C0X H;  3CQZ B;  1VQ6 A;  1B2T A;  2R6F A;  2FLN A;  5KT2 A;  3SHL A;  3R8B A;  1SN8 A;  2D0P A;  2D62 A;  2DNC A;  1N33 L;  1I94 L;  3LX0 A;  3I4N G;  1DOM A;  1X55 A;  2DN8 A;  2CW0 D;  2IT1 A;  2XIG A;  4TV9 F;  5DQH A;  2KCM A;  3HRZ C;  1Z9F A;  4J9N A;  3NEM A;  3TDQ A;  3BG5 A;  1RHP A;  3EYY A;  5BPF A;  1A9X A;  3GTQ B;  1L0Y B;  1CKN A;  4AH6 A;  1GXD C;  2XGT A;  4IZ8 A;  1HZB A;  4LF5 L;  4C5B A;  5CV5 A;  5CAE B;  4JYA L;  4KN7 C;  2RDF A;  4R8U B;  4J9K A;  2VQE L;  1GHK A;  2R92 H;  2LXK A;  1BGW A;  4BBS B;  3AU7 A;  3FKI A;  1MSH A;  4YR0 A;  4G7H C;  4XYO A;  3G6X A;  2F03 A;  4YHH H;  3M9N B;  3E5S A;  3KK7 A;  4KD3 A;  2W57 A;  4WD3 A;  3T4A C;  1KAB A;  2A74 C;  1Q86 C;  1MJC A;  2J6S A;  3VR2 A;  4RGT A;  1MBY A;  4JI7 L;  4U6P A;  3MFY A;  1HPC A;  3L2P A;  1A2T A;  2WYO A;  4MV8 A;  3FRP B;  4WFN 3;  3STB D;  3HOV G;  2NUC A;  2PNH A;  2AUJ D;  3TZD A;  1IBK H;  2UU9 H;  1IBL Q;  3S2H H;  4J6H A;  1PH4 A;  3I4M H;  1PYB A;  1I5F A;  2I0Q A;  4JCV E;  3PGZ A;  2KCT A;  4A3M G;  2A6H C;  3V4Z A;  4XQJ A;  4DAP A;  3RZO H;  3GIQ A;  2OF1 A;  4ED1 A;  1KQS A;  4DR2 Q;  4RG1 A;  4LF7 L;  1E4E A;  1WJJ A;  3G4S A;  2BOS A;  2L5T A;  4Q5V A;  1C9O A;  2HVS A;  1A6X A;  1B44 D;  2B63 B;  3GTJ B;  2QIL A;  3A0J A;  4X3U A;  3E5N A;  3HKZ A;  5C8Y F;  1G29 1;  1Y1W G;  4C3J B;  2A69 C;  1XYI A;  1OO9 B;  1X9N A;  1H95 A;  2YZM A;  4LNQ A;  2R92 A;  1ZEQ X;  4NW2 A;  2AQ1 B;  2F52 A;  4X62 Q;  3NEN A;  2R7L A;  4RB0 A;  3QZ7 A;  4I7H A;  4RHS A;  4K0K L;  2AGO A;  3PO2 H;  3KLS A;  1SYF A;  2CCZ A;  3JRW A;  4QWC A;  2UUB L;  3PQI A;  1N32 L;  4LF6 Q;  4JC0 A;  2YU9 B;  4RAZ A;  3H15 A;  3TQ1 A;  3NUC A;  5L37 A;  1AUV A;  1VQ4 A;  4DR1 H;  4P72 A;  2PPB C;  3RGZ A;  3V6J A;  1S5B D;  4UFZ A;  3PSI A;  4UDU C;  5IT9 L;  4P73 A;  1EEI D;  2E5L H;  5LMU Q;  3GV8 B;  1RDP D;  3GTO B;  1B1Z A;  1PYW D;  1OWT A;  1ET9 A;  2OXP A;  2F0J A;  3MHB A;  3OHA A;  3HB9 A;  2V5A A;  2D9U A;  1PTO C;  3VYU A;  1W6K A;  1W93 A;  2NTT A;  5IGG A;  2JA8 H;  1CSQ A;  2C28 A;  5IYD H;  1EU3 A;  4A3J G;  3L4J A;  4B3R Q;  1DIK A;  2Y0S G;  2XIW A;  1SMX A;  5ELD A;  1SBB B;  3W2D A;  1EQV A;  1AW7 A;  2N55 A;  1QVF A;  4PZ6 A;  2FFK B;  3OWF A;  1P16 A;  3T1H Q;  4F4Z A;  2F0W A;  1XTD A;  4J8Q A;  4HJ5 A;  3V6H A;  1K8M A;  1S03 G;  1YZ6 A;  3N52 A;  1KD1 C;  3K5I A;  2XGP A;  3SK5 A;  1VQE A;  5FLX W;  4UY8 C;  2HHH H;  4HID A;  2VL6 A;  4JV5 Q;  4RGN A;  1EUC B;  4RCN A;  3M9B A;  4MIU A;  1VQ8 A;  2M00 A;  2RHS B;  1LYL A;  2AGQ A;  3WOE A;  4P2C B;  3QZ8 A;  3KBG A;  4PQX A;  4GN5 A;  4IJL A;  2AQ4 A;  1YNN C;  4A3I G;  2ZXR A;  5ELO A;  1K8A C;  2VUM G;  3CQZ H;  2ICI A;  2ZM6 H;  3GV6 A;  2QW7 A;  4X65 Q;  4A93 G;  1EQT A;  1XDN A;  4C1N I;  2NN6 I;  4YCV A;  1BKB A;  4EBD A;  5KG5 A;  2NU9 B;  4IUV A;  3LNN A;  3MA2 B;  3I4O A;  4DV2 H;  5JVD F;  1D5X C;  4A76 A;  1WI5 A;  5DEH A;  4H0L C;  4HCS A;  3EJI A;  3G6V A;  4GS3 A;  1MJE A;  2N8N A;  2HT1 A;  4FS1 A;  2K5H A;  5CGK A;  1S5E D;  4DA2 A;  3M9M B;  5M3F H;  4ECT A;  3NP8 A;  1IBL L;  2VQF L;  2EZV A;  5EBD A;  1PH2 A;  1D8L A;  3N40 P;  2ZXP A;  4IPG A;  5GAD C;  2RSO A;  4AIM A;  1HA6 A;  2N3S A;  5BMV F;  2R6G A;  1FKA H;  1AZP A;  2WB1 E;  4CGY B;  3I8Z A;  4BBS H;  4IRK A;  1ZYR C;  4DR2 L;  3KHR A;  5KFR A;  1EYZ A;  3GLK A;  1VAJ A;  4YWK A;  1GYF A;  1HZC A;  4LF4 H;  4YBZ B;  2H4O A;  3T1Y Q;  3CQZ A;  2E75 C;  1PRT C;  1X3Q A;  1S40 A;  1B70 B;  4X64 H;  1N36 Q;  3GTG B;  2ZTD A;  3MVV A;  2R93 B;  5FPR A;  2EYF A;  2KED A;  4Y7N B;  2IJ0 A;  5K36 G;  2F0E A;  3MTS A;  2W6P A;  2CVR A;  3F2C A;  2XTI A;  4DUZ Q;  1UNN C;  5C3X A;  2RDI A;  5IWA Q;  1PLF A;  4MTD A;  5CBA E;  1AN8 A;  1TKW B;  2PI2 E;  3RN2 A;  4LF8 L;  2JEB I;  3UQ8 A;  1N33 H;  2NVY H;  1UE1 A;  1IBM Q;  1BCP B;  4IWX A;  4JI1 Q;  2IX3 A;  1S3O A;  1HNZ Q;  4QUF A;  4XQQ A;  1XMO Q;  3BQ0 A;  4R8U A;  2R3Z A;  4TKO B;  3GTJ H;  4ED6 A;  1Q46 A;  4O42 A;  1WTQ A;  3I4N H;  1BOS A;  5LMU L;  5JEA J;  5CMD A;  3RB0 A;  2IW3 A;  3QR8 A;  1UE7 A;  3CD6 A;  1TY0 A;  3OSO A;  4JYA H;  2KHI A;  4O2D A;  1B9N A;  3H09 A;  1D7Q A;  3OSN A;  4Q8E A;  2LY7 A;  2VQE H;  1J5E Q;  1JE5 A;  1AH9 A;  4ZK9 B;  2A68 C;  4TSS A;  4R8I A;  1S72 A;  1Q81 C;  2MJ8 A;  3RBD A;  5FLX L;  2JA7 G;  3I12 A;  1PH5 A;  1CKM A;  1HXY D;  4UCT A;  4JI7 H;  3OMC A;  4B3R L;  5JJK A;  2P0A A;  4P74 A;  5I6W A;  4IOC A;  2OWO A;  5JVG 3;  1EY6 A;  1FYC A;  1QZG A;  4ECR A;  4YR2 A;  2LS0 1;  1WD0 A;  2NBF A;  4DR3 Q;  1HNW Q;  3T1H L;  2JEJ A;  1PDQ A;  5FLM H;  3SK4 A;  1PX2 A;  2W6Q A;  1GUN A;  1TS2 A;  3BA8 A;  3GTO H;  4NLG A;  4B3T H;  2NVY A;  1HNX Q;  2ASJ A;  5C4Z A;  3GQC A;  1ZHQ A;  1KJI A;  4HNU A;  2BDN A;  3TRE A;  4JV5 L;  1CQJ B;  4YB8 B;  3GTJ A;  2WAQ G;  5L1J A;  3MR6 A;  1GSA A;  4DR6 L;  4B3S H;  4MNO A;  1Q1E A;  1PH9 A;  2UXB Q;  4TQU S;  1CHP D;  4UHV A;  4XX0 B;  5C3E B;  4K2L A;  5AJ3 Q;  4NXM Q;  5ISR A;  3KHL A;  2O03 A;  1DM0 B;  1QB5 D;  4R4O A;  4FF1 A;  4L8J A;  2RDJ A;  5M5Y H;  3MWY W;  1BBX C;  2GPW A;  3GTL B;  3KTM A;  3J7A K;  5I2Y A;  2R87 A;  1PTO D;  1KL9 A;  4K2K A;  3NBH A;  5KEE A;  3PUW A;  4L63 B;  3CC4 A;  1FNU A;  5KFK A;  2PMZ E;  4Q44 A;  3D4D A;  2W9C B;  1JR0 D;  4IPH A;  5I9O A;  4O3P A;  2UUA H;  4GOP B;  3S1Q B;  4WBN F;  1NE3 A;  2EXD A;  3BYT B;  4QQB X;  1I4P A;  4A3G G;  1M7J A;  3W3A A;  2YYA A;  1KC7 A;  2UUB H;  5I2X A;  4Y52 H;  4CDF C;  1N32 H;  1IW7 C;  1DCZ A;  3KLS X;  4L5S A;  4HIK A;  2W7P A;  2EYH A;  3GTO A;  1D5Z C;  1SYD A;  2KUM A;  5CB4 F;  4N9P A;  4OO1 I;  3EIV A;  3CAM A;  5I6Y A;  5C4X B;  4F8M A;  4OIK A;  5M9O A;  4LFC L;  1XPU A;  1SYX B;  2D2C C;  1EEF D;  4JI0 H;  1S0M A;  3D0F A;  1G51 A;  2EOT A;  1G6P A;  2K52 A;  4RHR A;  4KTA A;  4PDB A;  4RZQ A;  4CKE A;  3VPB A;  3CCS A;  5FD5 A;  3HOW G;  1YNN D;  4DV7 Q;  3T1Y L;  3MXG A;  2EXZ A;  4KY5 A;  2VUG A;  2R85 A;  1Y8P B;  4K14 A;  1W6J A;  1BJT A;  1D1I A;  4RAY A;  3DLL A;  3CCQ A;  4DV6 H;  1KNE A;  4DUZ L;  2CH4 A;  4OEL B;  3T53 B;  3K57 A;  1Z2O X;  2XRQ D;  2Y0S E;  3TIG A;  1IBM L;  5L1K A;  3N6R A;  2R7K A;  2BE5 D;  1XMO L;  1CI3 M;  4ECU A;  3D8G A;  3KUP A;  3MC0 B;  1STN A;  1R9T H;  2LSS A;  2PQA A;  2ES2 A;  1A3T A;  1OXV A;  1S10 A;  2DNE A;  3GTG H;  3PO3 H;  2VA2 A;  1J9O A;  3FKI B;  1LTL A;  3ND8 A;  5J1Z A;  1J5E L;  4OO1 H;  3KBX A;  4Y7N H;  1I4X A;  1TQO A;  1LLR D;  2OQ0 A;  1M8A A;  1SNM A;  3I7F A;  3RTX A;  3TIN A;  5KG3 A;  4XT1 B;  3CCJ A;  3CPW A;  1DOL A;  3A7L A;  1SYC A;  3VA7 A;  1G91 A;  5C5J A;  2I46 A;  3NTI A;  1AE2 A;  2C2R A;  2ZXO A;  2BDO A;  5EOY A;  4ILW A;  4DR5 Q;  5DQG A;  2ZT9 C;  1JIC A;  4IUN A;  4UCO A;  3JRX A;  4EQP A;  3U4V A;  1N34 L;  2KQ3 A;  1PZJ D;  3KF8 B;  4UCR A;  1HNW L;  4OWX B;  3TZU A;  1Q8K A;  3PUX A;  2VQF H;  2R7F A;  1HNX L;  2EDG A;  1SNQ A;  1VKZ A;  4NDX A;  2HJW A;  4APM A;  4NPS A;  3E9H A;  1CZG A;  1VQG A;  1LUZ A;  4JBW A;  2VS1 A;  3J7A 5;  1E4E B;  4DR7 L;  1SYG A;  3FPP A;  1J8I A;  4DPG A;  1KDB A;  2F4V Q;  3MWD A;  4HN7 A;  4JI8 L;  2UXB L;  1R9T A;  1F2L A;  5IE8 A;  4RNN A;  3DWA A;  2NVQ H;  3GTG A;  4BY1 B;  2AMC B;  2AHO B;  4F50 A;  4A3E B;  1KEE A;  2WTF A;  2E2I B;  5EQ0 A;  5KFG A;  5C5L A;  1GJX A;  5KFX A;  2F0F A;  4ZYS A;  4EEQ A;  3GTP B;  2UUC L;  3WO1 A;  3HOU G;  3I2Z A;  3U4Z A;  1PHJ A;  3D6W A;  1EY8 A;  4KY6 A;  1EOT A;  1GHJ A;  1ZQ7 A;  4DV5 Q;  4LF8 H;  1TVX A;  4GLX A;  3S2H B;  4YY3 L;  3I4M B;  1PH8 A;  4MV7 A;  1NMF A;  4O4I F;  4FU0 A;  4A3K G;  2I5M X;  4LMY A;  4X66 Q;  1A0I A;  5FO9 B;  5IT9 c;  1IYJ B;  1EU4 A;  3V4S A;  5LP6 F;  2V1C C;  3RZO B;  1ZET A;  1NR4 A;  5KFE A;  1V43 A;  4NXN L;  4O3S A;  2QEJ C;  3OW7 A;  4RU9 A;  2K4K A;  4O1N A;  4QJF A;  3UE0 A;  3J81 W;  1HCZ A;  3MWM A;  1GKH A;  5KFO A;  2K32 A;  3OHB A;  2FB9 A;  4ODG A;  3S1Q H;  1V1P B;  2K05 A;  3CHB D;  4C3H G;  4KHV A;  3J80 W;  2I87 A;  2JN4 A;  4DV7 L;  2JA9 A;  4DKA C;  5D1O B;  4DL2 A;  2Z1C A;  3SGI A;  3JAM W;  3UDG A;  1WTR A;  3HOX G;  2DY8 A;  1KJ8 A;  3IL8 A;  5DM7 3;  4F7X A;  3J7A F;  2E2J B;  1RYS A;  1YJN A;  5FLX E;  1NJI C;  5EKI A;  4Q8F A;  3PIP 3;  2JQO A;  3D4R A;  3UDX A;  3KAJ A;  2I07 B;  5EWG A;  2UXD H;  5C4X H;  4NB3 A;  4P75 A;  3KAK A;  4LFA Q;  4I4T F;  1SRO A;  2B2V C;  1MZB A;  3A56 A;  2H1E A;  1JE4 A;  4QIW A;  1STH A;  4ZRZ A;  2E2H B;  5JQW A;  1KHI A;  5T14 A;  2L4N A;  2AKW B;  2DJG C;  2YS6 A;  4KHP H;  1X3F A;  4ED3 A;  4DR6 H;  5JVL A;  3PR4 A;  1ENF A;  1Y1V G;  2B8G A;  2XD4 A;  2B2V A;  3SR1 A;  3P20 A;  4ZHQ F;  3T5H A;  3HXL A;  1WTP A;  4MN3 A;  1BDO A;  5KRU A;  2WAQ E;  1XWE A;  1L2F A;  2BA1 A;  5EDW A;  2CW7 A;  4I55 F;  1T3N A;  1SSO A;  4LWC A;  2JA8 B;  5CA0 F;  3BU2 A;  1K1S A;  4KKS A;  3GD7 A;  4DV1 L;  1TWC H;  3CPF A;  3BDO A;  1PMR A;  1V1Q A;  1EY0 A;  4X3K A;  2ALZ A;  3EBE A;  4ABN A;  1XX8 A;  4GKK Q;  1MKH A;  3EFX D;  3TN2 A;  4MA0 A;  1A62 A;  3RMH A;  4KY7 A;  3KF6 B;  3PW7 A;  4PNY A;  4AYB A;  3TSS A;  3CC7 A;  1VBH A;  3OMG A;  3HEJ A;  4FM9 A;  1QNU A;  5J22 A;  3W1G A;  4A3C H;  2MP1 A;  4A3D B;  2W9A A;  1SR3 A;  4N8X 1;  5D3I B;  5DGB A;  3GDE A;  2EJF C;  5CYU A;  1UNS A;  4QW9 A;  1WTH A;  5ELE A;  3E6Z X;  4CDC C;  2X6L A;  3H0G H;  1KXL A;  1F2Y A;  3D31 A;  3IAY A;  4LFC H;  4HCE A;  2BR0 A;  5IP9 H;  4IFD G;  5KFU A;  2VW9 A;  1R4P B;  1W2B A;  1JKJ B;  1HR0 H;  4B3M L;  3SK6 A;  2Q8T A;  3P75 A;  4LH6 A;  3Q8Q B;  1HTL D;  3E0E A;  5DG7 A;  3MXU A;  5HUR A;  2QA4 A;  3QO2 A;  3T1Y H;  3BZD B;  1H9K A;  1RTN A;  1XNQ L;  1U5K A;  1I6V C;  4YQW A;  1O7Y A;  3I56 A;  1TWC A;  1PFN A;  1XPO A;  1PFM A;  2QCP X;  5BR8 H;  4Q0F A;  4OWW B;  1VF5 C;  2FPG B;  4JI6 Q;  2MQH A;  2ALY B;  4TRD A;  3U58 A;  2NN6 G;  2Q2U A;  2Z9H A;  1PRT B;  3PMF A;  4EQO A;  4F87 A;  3F2B A;  1VQH A;  3J81 L;  3RB6 A;  5M3F B;  4IAJ A;  2A1A A;  3HP3 A;  3BZC A;  4OON A;  3U50 C;  1VBG A;  1YI2 A;  3MR5 A;  4CDE C;  5LMN Q;  5IGD A;  2VY3 A;  3J80 L;  2OTJ A;  3M4I A;  4MV6 A;  1TS4 A;  3OOC A;  2ZJR A;  2B63 G;  3M7G A;  4ZQI A;  3TP7 A;  1O80 A;  4BY1 H;  2ID0 A;  4C3J G;  1EFI D;  1KNA A;  2K50 A;  4A3E H;  5M3M B;  4DR4 Q;  5K2M A;  3I3C A;  3N42 B;  4R8N A;  3H0G A;  4IRD A;  1IL8 A;  2E2I H;  3K0X A;  3VR6 A;  3H6M A;  3GV3 A;  3J7Z C;  4DV0 L;  1CHQ D;  1YNJ C;  4O2A F;  2F0L A;  2O4X A;  3E3X A;  5LMN W;  3F1Z A;  2EVB A;  4IOA A;  1I50 B;  5EZY F;  3HOZ B;  4XYM B;  3GTP H;  1BCP D;  2K01 A;  1SYB A;  5KFP A;  4DV3 H;  1UUP A;  3H94 A;  1S5C D;  3RBE A;  1SNC A;  1F2Z A;  1QOH A;  5FLX c;  1M90 C;  2R7Z B;  1WCM G;  2F0G A;  4I65 A;  3KF8 A;  1XPR A;  2YL2 A;  2JJQ A;  4HIO A;  1VQ7 A;  1IYV A;  4LFB Q;  1JJG A;  2HQE A;  3LWB A;  5LHY 1;  3TRZ A;  4JI2 L;  4QUC A;  1E2W A;  3PR5 B;  2EYM A;  1LTB D;  2EYO A;  3OUU A;  3ULP A;  2HGS A;  5KFL A;  1N34 H;  1PXU A;  5EPJ A;  2WE6 A;  2W70 A;  1SEB D;  2R8K A;  4LFA L;  2NVY B;  4DGZ A;  1YIT A;  1C7Y A;  4EGJ A;  2JA6 A;  4O4H F;  3GTK B;  2VB2 X;  3OWE B;  1STG A;  4C3I G;  4GNX B;  1AUX A;  4DNR B;  4L5Q A;  4R4T A;  2L0C A;  3I4N B;  1G2T A;  2RVL A;  1XNR Q;  4DR7 H;  5LXT F;  1XJV A;  1B04 A;  1PZI D;  4IUT A;  3EPI A;  4Z9C B;  4JI8 H;  3K58 A;  2E2I A;  1NCV A;  2E2J H;  1KBL A;  3GII A;  3A5Z B;  1UEA B;  5EGT A;  4DK6 C;  3TQT A;  4ETS A;  4QWE A;  2KHJ A;  1VQL A;  3ICE A;  1KAA A;  3NBH B;  1WVL A;  1CS0 A;  1JOK A;  3GTP A;  2Z4I A;  1XMQ H;  3DXJ C;  5TSS A;  2EQS A;  4DU9 A;  4DUY H;  5F9L A;  2WIN B;  4GKK L;  2JA5 H;  1E4G T;  1EQR A;  2CQA A;  1IHZ A;  2IHE A;  3L9A X;  5IGF A;  4JI4 Q;  2E2H H;  1FJG Q;  2UUC H;  1BBU A;  5G3L D;  1SMY C;  3BVZ A;  3HS0 C;  3N44 B;  3T16 A;  3SVM A;  3LML A;  3NEL A;  2B2U C;  2QYZ A;  1V9P A;  3UE1 A;  3G6E A;  4RNO A;  4O0A A;  1BXR A;  3B6Y A;  4YY3 H;  3BVM A;  5IYB G;  1KJQ A;  4LUZ A;  3K5M A;  5CV7 A;  2NVT B;  3TP8 A;  1CT1 D;  2YRX A;  2AQ3 B;  2J4X A;  4OX9 Q;  2N78 A;  4R1J A;  2M05 A;  4J0M A;  3FPU B;  5KFF A;  1V1P A;  2A6E D;  2WKD A;  4BBR H;  4RNM A;  4NXN H;  2B2U A;  3BS1 A;  2BQR A;  3M7N A;  1DZ1 A;  4A3M B;  5D1O A;  1TWG B;  3O13 A;  4C5A A;  1PH7 A;  3T5L A;  5M5Y B;  4G7Z C;  3CCL A;  2JEG A;  3S14 B;  3U9T A;  1BF4 A;  2CZG A;  5DLQ E;  3A55 A;  3RGX A;  3G7L A;  4RCO A;  4YWM A;  4J15 A;  4DAY B;  1CTM A;  3HOY H;  5KFM A;  5JJI A;  5D3D A;  1MGS A;  5M5X H;  3W5O A;  1Y1W B;  1T5X D;  2DGY A;  2TMP A;  1RYR A;  3HGB A;  4MTN A;  2F0I A;  1B3A A;  1R4Q B;  4JI6 L;  2JA5 A;  4A3D H;  2RF4 A;  1TY2 A;  1F9Q A;  2E2H A;  4RKB A;  1X3E A;  2NU7 B;  2WAC A;  4FXK C;  1SAP A;  3N41 B;  3RZD B;  3V6K A;  2I5L X;  2X0S A;  2DIK A;  4DNI A;  5LMN L;  1KAW A;  4TV8 F;  5A2Q W;  4S3S A;  1EWC A;  4XYQ A;  3F2D A;  2VQD A;  2W6N A;  2L55 A;  3CCV A;  3ONA B;  2RQX A;  4WJ4 A;  4TQS A;  2KOL A;  4HMJ A;  4JI5 Q;  1BUV T;  2PQA B;  4E6I A;  4B9W A;  1WOC A;  4DR4 L;  4DK3 C;  2G5D A;  3F8T A;  1LTA D;  1STE A;  2BH8 A;  2F0D A;  1X6O A;  3SK8 A;  1VQK A;  3Q1K A;  1I6U A;  4HNT A;  1STA A;  2M9V A;  2DZD A;  2R93 G;  5D1P A;  4DV4 H;  1KDC A;  5FJ8 G;  5D14 A;  4JV0 A;  2Z8L A;  2XCA A;  4R4Q A;  2FJ2 A;  3VYT A;  4C56 C;  1IOV A;  3PCO B;  1Y1V H;  3P1H A;  3PZP A;  3A8I E;  3KF6 A;  1K0S A;  2AU0 A;  4DV1 H;  2OH2 A;  1JIH A;  2SCU B;  1KTK A;  4CJ1 B;  2YTY A;  2C22 A;  2QDL A;  5BN3 A;  3CW2 C;  5C4J H;  3X3M A;  5KFQ A;  2UXC Q;  4L5R C;  4GN3 B;  1PH1 A;  4A3J B;  2NU6 B;  1LT5 D;  5M3M H;  3DHQ A;  3FDS A;  2I5H A;  3RAQ A;  1U9R A;  5A35 A;  3Q22 A;  4RGO S;  3FVQ A;  2YS7 A;  3M4Y A;  3ETJ A;  1I50 H;  3TBI B;  1ENA A;  3HOZ H;  4BY7 G;  4ECX A;  1XNR L;  2JA6 H;  1R9T B;  1NMG A;  1U4P A;  3GIP A;  4X62 L;  3EQL C;  1JOO A;  3W1B A;  2R7Z H;  4A3B G;  3PO3 B;  2N49 A;  4ME5 A;  4PZ8 A;  1NTG A;  2MNA A;  1EY4 A;  3TP5 A;  2Z4H A;  1KRT A;  5JUM A;  4A3L H;  3VR5 A;  1G8Z D;  1DGS A;  2B2T C;  4QL5 A;  1STB A;  4YCU A;  4B3M H;  4X3S A;  4O3R A;  1LAC A;  1RJT A;  3D6C A;  4LF6 L;  3RB4 A;  1XNQ H;  4XZ3 B;  3K80 C;  1I94 H;  3H3V I;  4A3I B;  2VUM B;  3Q8R B;  4A93 B;  3RR5 A;  4JI4 L;  4MZ9 A;  3GTK H;  2R7N A;  1JJ2 A;  4O3O A;  2B2T A;  4DNT B;  2A6H D;  4BS9 A;  1GO3 E;  4ED8 A;  2WB1 A;  4CC5 A;  5KG2 A;  3A54 A;  3J81 E;  2FPP B;  2VPS A;  2YRW A;  3I72 A;  5JOB A;  1K8G A;  4LF5 H;  3BDL A;  5FPO A;  2V9W A;  1H9R A;  4DL3 A;  5C3E G;  1JB7 A;  1HR0 W;  3QFF A;  3J80 E;  4AQY Q;  3VMM A;  3H4D A;  4IJH A;  4PMC A;  1Z7T A;  3D3R A;  4HED A;  3JAM E;  2R86 A;  4X3T A;  3WO0 A;  1B3Q A;  1A2U A;  4RGM A;  2HIX A;  3PIO A;  1I50 A;  4JVZ A;  3T13 A;  1BVS A;  2CHB D;  2A69 D;  1IOW A;  4GN4 B;  5GAH C;  5I47 A;  2NTS A;  3CME A;  5T1I A;  3C2P A;  3FDT A;  1JCK B;  4ZUJ A;  4DV0 H;  4BA2 I;  4JPB W;  2NVQ B;  2ZDH A;  2R7Z A;  1IXR A;  3DM1 A;  3RV4 A;  5DGA A;  2VB3 X;  5GQO A;  2RCF A;  1QNK A;  4YHH Q;  2V59 A;  3BAA A;  4OHJ A;  2WDT A;  1GUG A;  4KI0 A;  2L9H A;  4B08 A;  1WD1 A;  4GNX C;  1X3P A;  3QOL A;  3OTO Q;  4JG2 A;  2RGV A;  3VPC A;  2ASB A;  3I73 A;  5ELB A;  3FHW A;  3GTM H;  4ZOL F;  2E76 C;  4J9L A;  1EY7 A;  2PI2 A;  3DWP A;  1JJC B;  2IHF A;  5GAG C;  4RFB A;  2NVT H;  4JI2 H;  3HOV H;  1Q3L A;  3BDC A;  3I91 A;  2MFI A;  3GTK A;  4UAI A;  2CW8 A;  4GNX A;  1IBK Q;  2UU9 Q;  1SMY D;  3H3V H;  1DYQ A;  1VQF A;  4LF7 H;  4QIW B;  1V51 A;  1ILQ A;  5FOB B;  5DQI A;  5IYC G;  2SNS A;  1VQI A;  4FO2 A;  4H02 A;  1AEX A;  2Q8R E;  3J7Y W;  4A3M H;  3C0F B;  1HQR D;  1TWG H;  1TXY A;  1DJR D;  2GA4 B;  5GRO A;  4IR1 A;  3I4L A;  4JI5 L;  1S97 A;  1KLG D;  2C5C A;  3S14 H;  1GSH A;  4X65 L;  3N8D A;  2F0O A;  1E1O A;  1NY4 A;  1Y8N B;  4PMW A;  1Y8O B;  3K8A A;  3Q24 A;  3Q6S A;  4C5C A;  2FPI B;  4K0K H;  1Y1W H;  1UC9 A;  2FXQ A;  3PW4 A;  5BN4 A;  1D5M C;  2WII B;  1W96 A;  1H9J A;  5IP7 G;  4ME3 A;  5DM6 3;  2B3G A;  4A3F G;  4ECV A;  2YZN A;  3TME A;  2RDH A;  3R3O A;  1H9M A;  3H3V C;  3IKJ A;  1BBW A;  3RZD H;  1K83 B;  4AYB B;  2IP4 A;  5CV9 A;  3H91 A;  2HCI A;  2KVM A;  5EPL A;  4HNV A;  2MHV A;  4J9O A;  2PZW A;  1NR2 A;  2JA7 B;  2OCE A;  1B8A A;  1ESF A;  3AB9 A;  1CQF A;  1VQB A;  1VS0 A;  1N48 A;  1Z6H A;  4PWQ A;  3FKI G;  1WFQ A;  2PBZ A;  2EYJ A;  4GKJ Q;  3OHX C;  1XXG A;  3KDF B;  5AFW A;  2E5L Q;  3ER0 A;  1TWG A;  4POG A;  2XGQ A;  3JC6 6;  1PVO A;  2W7O A;  3NQT A;  3SDZ A;  5C44 G;  5CBE E;  3ND9 A;  1B33 N;  4IRC A;  5KFT A;  2ENB A;  1N36 L;  1SCU B;  3ERO A;  1EZ1 A;  3C1F A;  4DAY A;  4IZO A;  4LW1 A;  1RCV D;  2OT2 A;  3S2D H;  5C0X G;  3IFD A;  1Y1W A;  2NU8 B;  1A3U A;  4H44 C;  5KFJ A;  2FK1 A;  4HTH A;  2IWH A;  2EE1 A;  5D8D A;  3R5F A;  1TWC B;  5IWA L;  1ML0 D;  2FIN B;  3K7A B;  1TA8 A;  1A8V A;  3CXC A;  4A3J H;  3Q2O A;  3RIZ A;  1G6Z A;  1FL0 A;  1SNP A;  4JI1 L;  3QOJ A;  1XTC D;  1HNZ L;  1S5D D;  4U67 3;  3J81 c;  2HCC A;  1WTX A;  5FK9 C;  1PFB A;  4DL4 A;  1SND A;  1HTP A;  4TQR A;  5C5M A;  3J80 c;  5KG0 A;  1ICW A;  4L6T B;  2XCP A;  1X65 A;  1ZYR D;  4PV1 C;  4A3G B;  2R61 A;  2V4D A;  1WTO A;  4AQY L;  3HKZ G;  1KLU D;  2HHH Q;  3VPD A;  3NGD A;  1D6E C;  2K5Q A;  2R92 G;  5JJL A;  5C3W A;  3U9O A;  3H0G B;  3MXN B;  3JSN A;  1A15 A;  2EY5 A;  3F2U A;  4QF4 A;  3MFH A;  4G7O C;  1BQQ T;  2FMC A;  5ELF A;  1IKL A;  1QJO A;  3K5H A;  4UCV A;  1PRT D;  4CKB A;  1AFP A;  3NE5 B;  2ZDQ A;  2UVV A;  4IN3 A;  4A3I H;  2ZM6 Q;  2R8G A;  2IMW P;  4CHT B;  1O7Z A;  2SOB A;  4UPA A;  4YHH L;  1SFO H;  2VUM H;  4A93 H;  3OTO L;  5L9X A;  4DV2 Q;  1YNX A;  2B2Y C;  4LMQ D;  3M3Y H;  4DR3 L;  3I90 A;  5D65 A;  2FJZ A;  3GV7 B;  1LTS D;  3I4M G;  1IBL H;  5F2D A;  1Q90 A;  2Y0S A;  1SLJ A;  5DNF A;  1JOQ A;  4EFB A;  1FD7 D;  1LT4 D;  5J39 A;  1ILP A;  2XN9 C;  2CW0 C;  4V19 0;  3HBL A;  4DR2 H;  1NUC A;  2B2Y A;  4B9X A;  1EYA A;  2HDL A;  2Q2H A;  1WR2 A;  4QW8 A;  2IA6 A;  5AJ3 L;  4NXM L;  2W71 A;  3ZYY X;  4YAK B;  1EY5 A;  1ONL A;  1LTG D;  4RB3 C;  2EYP A;  3H40 A;  4KKT A;  4X62 H;  2A68 D;  4N9T A;  4O3Q A;  2Q2I A;  4JBK A;  4UP9 A;  1PV4 A;  2DY7 A;  3PO2 G;  1TU2 B;  3S17 B;  4LF4 Q;  1F2M A;  1CQI B;  4BY7 H;  1H9S B;  2VUM A;  1SFO A;  2K7V A;  4X64 Q;  2D0O A;  4A3B H;  2P5Z X;  4BWS C;  2RGR A;  4M1U B;  4LF6 H;  1LT3 D;  1S5F D;  3IRB A;  3DM3 A;  3STB C;  5K36 H;  1HUN A;  3PIO 3;  3MXP A;  4YJ2 F;  5JAV A;  1DD2 A;  1N33 Q;  2EY1 A;  1TII D;  3ERQ A;  1ENC A;  3RLO A;  5LMU H;  2W6M A;  5COY A;  2IPK D;  4YJ3 F;  5IY0 A;  3AFQ A;  5FKA C;  4GKJ L;  2E5L L;  5CV6 A;  1HFG A;  5KFN A;  1GGO A;  4ECY A;  2BA0 A;  2KEE A;  4OGQ C;  4ECS A;  3NWT A;  4JYA Q;  1JXL A;  2L1B A;  2IY5 B;  2JA8 G;  4BWG B;  1SE2 A;  3GID A;  1FR3 A;  3ETH A;  4BXX G;  5IYD G;  3S24 A;  2NUA B;  1K83 H;  1LTI D;  1N8R C;  3Q0A A;  2R84 A;  1TWF B;  2Z6B A;  1BXT A;  1EY9 A;  4DF7 A;  2M2L A;  4U68 A;  5KFA A;  4B3R H;  1T94 A;  2F4I A;  1FGU A;  5KFB A;  5KFS A;  4Q45 A;  1NSN S;  4I7Z C;  4JI3 Q;  3CU7 A;  3QG1 A;  1D2B A;  2XWJ B;  2JA7 H;  1I3Q B;  1L0X B;  4JI7 Q;  5A2Q E;  4OIJ A;  1GLV A;  3T1H H;  4KKU A;  2JA5 B;  4RZR A;  3KLW A;  1IW7 D;  1C3O A;  4HJ7 A;  3PUY A;  4CC6 A;  3DEP A;  1S4Z A;  3T51 B;  4HYK A;  3GP7 A;  3QJY A;  4JV5 H;  3A8K E;  1P8L A;  1BNC A;  4CBV A;  4PZ7 A;  4B3T Q;  3TEH B;  2W6Z A;  2V4R A;  4J1M A;  2XVS A;  2QF7 A;  3S1R B;  4U7C A;  1BO0 A;  1LAB A;  4M8A A;  3HOU B;  2RSN A;  2PVP A;  4IAL A;  5FO7 B;  4ZKB B;  4J9Q A;  3OSP A;  3CKI B;  2EYL A;  4MHE A;  3NXW A;  3OW2 A;  4B3S Q;  2C2E A;  1SE8 A;  4J9M A;  4BBR B;  2VZA A;  5EKK A;  4X65 H;  2ZTC A;  5IYC H;  2F0K A;  4HSP A;  4A3K B;  4EGQ A;  1LTR D;  3SXH A;  1C8C A;  3K7A H;  5FD6 A;  1UWV A;  2F1M A;  2ZM6 L;  2W6O A;  5E7N A;  4DR5 L;  1K83 A;  5EWF A;  4UCU A;  2LKV A;  4CJ0 B;  1VQN A;  1HRJ A;  3NBI A;  4RUC A;  1JLL B;  2UUA Q;  2O2L D;  3HOY B;  5M3F G;  5M5X B;  2PNR C;  4EYH B;  4O2B F;  2JA7 A;  1YEZ A;  4C3H B;  5I9P A;  1RK5 A;  2XWB B;  3I70 A;  4A3G H;  2UUB Q;  4XYL B;  1CKO A;  5E1F A;  3WNZ A;  5DAU A;  1N32 Q;  1UE6 A;  2NB0 A;  4NKL A;  4EGV A;  3HOX B;  2L12 A;  4BBS G;  4EBE A;  5E4X A;  3KDF A;  2F4V L;  1HZA A;  1YVC A;  1HH2 P;  4EFE A;  1QIL A;  4K8I A;  3V96 A;  5CV8 A;  1QVG A;  3AYH B;  4IQZ A;  1KC8 C;  2IX1 A;  4J9P A;  3KXY T;  3K0Y A;  2OLS A;  4GZY C;  2XNA C;  2ATW A;  2CH4 W;  1STY A;  2HQL A;  5KT7 A;  2ASD A;  5JVH 3;  3R2I A;  2WAQ A;  4JI0 Q;  3D4W A;  3RLN A;  5KIX A;  1VQ5 A;  5KFV A;  1QWY A;  4TVA B;  1N36 H;  3A5U A;  3QB3 A;  1I7L A;  4ZCK A;  3CP0 A;  1CK1 A;  4HQ6 A;  1V8Q A;  4QB4 A;  3HOW H;  1AN7 A;  3R93 A;  3R23 A;  4M7E A;  1Y1V B;  4XTC S;  4DUZ H;  5IT9 W;  4RB1 A;  3UFX B;  3MR2 A;  5IWA H;  2GN5 A;  2K5W A;  4DV5 L;  2W8L A;  1BR9 A;  1JQY D;  2O5J C;  4WJW A;  5F9N A;  4DV6 Q;  1IBM H;  5C4J B;  4JI1 H;  2PW5 A;  1GD7 A;  4X66 L;  4WJ3 M;  4RA8 A;  1HNZ H;  3JAM L;  1XMO H;  1SEI A;  2WB1 B;  4GC7 A;  3OUZ A;  3M4P A;  2BQ3 A;  1K1Q A;  5IIF A;  5IGC A;  4DXF A;  2B2W C;  1UC8 A;  4JBJ A;  3CVZ A;  3PF4 A;  3MXN A;  3NQI A;  3S15 B;  5KT3 A;  5KFC A;  2FLP A;  1HQM C;  5KNC A;  4ZI7 F;  2F0H A;  2KCN A;  1C4Q A;  5KND A;  3CCE A;  1Q8I A;  4AQY H;  4C2M B;  3GIJ A;  5BN5 A;  1B9M A;  4XQN A;  3S17 H;  1J5E H;  2DPJ A;  2GVA A;  2PZT A;  4RMF A;  3MR3 A;  1QUQ B;  2K5V A;  2SDF A;  1VMC A;  2JA6 B;  3VYR A;  5GAE C;  2GPS A;  2B2W A;  2UVW A;  1RF2 D;  4EX5 A;  4V0B A;  3HKZ E;  4QWA A;  4FF3 A;  1VF7 A;  3C3L A;  4J9S A;  4J9R A;  4MV4 A;  5KFD A;  2F3I A;  2TSS A;  4LUV A;  3RUZ A;  3CCR A;  1A63 A;  4N8F A;  4KD4 A;  3A7A B;  3BQ2 A;  4DL6 A;  1CM9 A;  3OTO H;  1X56 A;  4R4I A;  1FGB D;  1TS5 A;  4JI3 L;  3ULL A;  4HIM A;  4FVM A;  4KMU C;  5FLM G;  2AWO A;  2RA4 A;  4DR3 H;  1HNW H;  1F9S A;  4POF A;  1TWH B;  4MV3 A;  1E2Z A;  3J81 i;  5LOV F;  1HNX H;  4FP5 D;  1K73 C;  1NAP A;  3K5N A;  3KJO A;  3RD4 A;  3J80 i;  3HFZ B;  4DK0 A;  3PF5 A;  1Z2P X;  1WSC A;  4DXG A;  3JAM i;  2VQF Q;  2F0T A;  2F0U A;  4B3T L;  4QWD A;  4ZKC B;  2UXB H;  1EIG A;  2RHQ B;  3RUP A;  4NXM H;  1A3V A;  4IUP A;  4Y8V B;  4HJ9 A;  1TWF H;  4B3S L;  3TS2 A;  1PYS B;  1Y69 U;  1J6Q A;  1I6H H;  1UE5 A;  1H9S A;  3KLR A;  3V2T A;  1PK8 A;  2WFW A;  3VR3 A;  4LH7 A;  3RAX A;  2CKZ B;  5LA6 F;  1I3Q H;  2W9B A;  1RL2 A;  3CRL C;  2HUG A;  4K5W A;  4QCL A;  2BQU A;  1VQM A;  3Q8P B;  4KJO A;  1NBW A;  1K3R A;  4OEM B;  4UCS A;  4LSA A;  2LFN A;  3GTM B;  1K0R A;  2UUA L;  5CA1 F;  2VOB A;  5C4H A;  3MAQ A;  3TII A;  2JEA I;  3PUV A;  3KYH C;  3A74 A;  5IOD A;  1PTO H;  4LAA A;  5HGT A;  3S1R H;  4IFD J;  3BA9 A;  1GUS A;  3HOU H;  4JV2 A;  3SE0 A;  1Q82 C;  1CA6 A;  3HOV B;  2AQ2 B;  3U9S A;  5JPN C;  1I4H A;  2NVX B;  1WCM B;  4APV A;  3R5X A;  1ZKO A;  3NWS A;  4LF8 Q;  2ZDG A;  5KT4 A;  2UVR A;  3C1E A;  2AWN A;  2EJG C;  5KFH A;  2PQE A;  1VCI A;  4DAM A;  4M9U A;  2MO0 A;  3P7J A;  4A3K H;  1YBY A;  3LWE A;  2FLL A;  2UVU A;  4EQ5 A;  5KX5 F;  4G4K A;  3ORR A;  4GKJ H;  2CFM A;  5LL6 S;  3M9O B;  3BQ1 A;  4R4C A;  1ASZ A;  1TWF A;  4JI0 L;  4DV7 H;  1I4G A;  1BNZ A;  4KLK A;  1MI2 A; 
#chains in the Genus database with same CATH homology
 2PI2 A;  2R7Z G;  2R7F A;  1HNX L;  3FKI H;  5HY6 A;  2HIV A;  4NPS A;  1JJC B;  2IHF A;  3E9H A;  1W3S A;  3ULJ A;  4C3H H;  1VQG A;  2Z6K A;  5GAG C;  2QEX A;  3CMA A;  1LUZ A;  4JBW A;  2VS1 A;  5JEA G;  4LF4 L;  2NVT H;  3HOV H;  1X3G A;  3J7A 5;  4A3L G;  2MFI A;  4DR7 L;  5C44 H;  3HOX H;  4DPG A;  4GNX A;  1IBK Q;  2UU9 Q;  4X64 L;  4BXX H;  1O7I A;  2F4V Q;  1EIY B;  2UXB L;  4JI8 L;  3H3V H;  2H5X A;  1VQF A;  4L5T A;  3K81 C;  5IE8 A;  3S1N H;  5IYC G;  4H02 A;  1VQI A;  2NVQ H;  4A3M H;  4DV6 L;  1TWG H;  1E7Z A;  1TXY A;  1VQ6 A;  2AMC B;  2ZJP A;  5GRO A;  2AHO B;  1YJW A;  2UXD Q;  2C35 B;  3EN2 A;  4JI5 L;  1SN8 A;  1LM0 A;  2Z0S A;  2D0P A;  2D62 A;  3S14 H;  4PG3 A;  1N33 L;  4X65 L;  1I94 L;  1E1O A;  1NY4 A;  3I4N G;  1X55 A;  4PMW A;  2IT1 A;  4IFD I;  3K8A A;  3PO3 G;  2KCM A;  3CCM A;  1Z9F A;  1Y1W H;  4OO1 G;  2FXQ A;  3NEM A;  2UUC L;  4P71 A;  3HOU G;  4KHP Q;  3I2Z A;  3U4Z A;  4LF9 Q;  1PHJ A;  4DR6 Q;  5ELN A;  4ME3 A;  5IP7 G;  2B3G A;  4HJ8 A;  4A3F G;  1CKN A;  4AH6 A;  2XGT A;  1HZB A;  4LF5 L;  4DV5 Q;  1EIF A;  3CCU A;  4GLX A;  4JYA L;  4YY3 L;  1BBW A;  3RZD H;  1YHQ A;  1NMF A;  1PH8 A;  2VQE L;  4A3K G;  2I5M X;  4X66 Q;  1A0I A;  2LXK A;  1ASY A;  2R92 H;  4LFB L;  5IT9 c;  1IYJ B;  2V1C C;  3M85 A;  1V43 A;  4UP7 A;  4NXN L;  2K5N A;  2OCE A;  1B8A A;  3AFP A;  1VQB A;  1VS0 A;  2K4K A;  1MJC A;  2YV5 A;  4QJF A;  3UE0 A;  1Q86 C;  4JI7 L;  3S15 H;  1GKH A;  3FKI G;  3L2P A;  1WFQ A;  3S1Q H;  3G71 A;  4GKJ Q;  3KDF B;  2E5L Q;  3STB D;  3ER0 A;  4C2M H;  4DV7 L;  3HOV G;  1L1O B;  2JA9 A;  2PNH A;  4DKA C;  3SGI A;  4POG A;  3GTQ H;  3JC6 6;  3UDG A;  1PVO A;  5C44 G;  3HOX G;  3PUX A;  1VQJ A;  2VNU D;  1IBL Q;  3S2H H;  1N36 L;  1YJN A;  1PH4 A;  2OQK A;  3MEF A;  3I4M H;  1NJI C;  1KIX A;  1PYB A;  1I5F A;  2I0Q A;  4JCV E;  3PGZ A;  2KCT A;  4LW1 A;  4A3M G;  3S2D H;  2JQO A;  3UDX A;  2DUD A;  5C0X G;  1JT8 A;  1EUJ A;  4LFC Q;  3RZO H;  1KQS A;  4DR2 Q;  4RG1 A;  1PH3 A;  5C4X H;  1WJJ A;  3G4S A;  4LF7 L;  4NB3 A;  4P75 A;  5IWA L;  4LFA Q;  1SRO A;  3E9I A;  1A8V A;  3CXC A;  4A3J H;  1CUK A;  1HR0 Q;  1VQC A;  1C9O A;  1FL0 A;  1TWH H;  4JI1 L;  3A0J A;  1G29 1;  1Y1W G;  1HNZ L;  1H95 A;  1KHI A;  1X9N A;  4LNQ A;  3J81 c;  2F52 A;  2AKW B;  2E8G A;  3CC2 A;  1FJG L;  4X62 Q;  1YHB A;  1RIP A;  3NEN A;  1X3F A;  4ALP A;  3J80 c;  4K0K L;  1Y1V G;  2CQO A;  5BR8 Q;  3PO2 H;  1X65 A;  4JOI C;  2CCZ A;  4AQY L;  3HKZ G;  2HHH Q;  4JBM A;  5JJL A;  2R92 G;  2WAQ E;  2UUB L;  1L2F A;  2BA1 A;  1N32 L;  3MXN B;  4LF6 Q;  4OX9 L;  3CD6 A;  4JC0 A;  4LWC A;  3BU2 A;  3H15 A;  4DV1 L;  3GD7 A;  3OYY A;  1TWC H;  3CPF A;  1V1Q A;  1QUQ A;  1VQ4 A;  3EBE A;  2ZTE A;  3KOJ A;  4GKK Q;  1C0A A;  4P72 A;  1MKH A;  4JOI A;  4A3I H;  2ZM6 Q;  2B63 H;  4YHH L;  1A62 A;  2VUM H;  4UPA A;  3KF6 B;  1SFO H;  4A93 H;  4C3J H;  4X6A H;  3PSI A;  3CC7 A;  1Q12 A;  3VDY A;  3AEV A;  3OTO L;  4P73 A;  5LMU Q;  3W1G A;  4DV2 Q;  1YNX A;  3M3Y H;  4DR3 L;  4A3C H;  3I4M G;  1SR3 A;  1PA6 A;  3FP9 A;  1SLJ A;  3GDE A;  4YCW A;  4AYB G;  4DV3 Q;  3H0G H;  1KXL A;  2QGQ A;  2NVX H;  3D31 A;  1WCM H;  4GLA C;  2YU9 H;  2JA8 H;  5IP9 H;  5C4X G;  1CSQ A;  2NZH A;  3PUZ A;  4IFD G;  5IYD H;  2VW9 A;  2Q2H A;  3TQY A;  4A3J G;  4B3R Q;  5AJ3 L;  2Y0S G;  1W2B A;  4NXM L;  2A19 A;  1SMX A;  4B3M L;  1N34 Q;  2UXD L;  3E0E A;  2QA4 A;  1QVF A;  4PZ6 A;  1XNQ L;  1P16 A;  1U5K A;  3T1H Q;  3I56 A;  1XTD A;  4HJ5 A;  2Q2I A;  4JBK A;  4UP9 A;  1PV4 A;  3PO2 G;  1XPO A;  1YZ6 A;  1KD1 C;  4QY7 A;  1GM5 A;  4C3I H;  4LF4 Q;  4OWW B;  1VQE A;  4JI6 Q;  2MQH A;  4UY8 C;  4BY7 H;  2ALY B;  4KHP L;  3PIP A;  4HID A;  2VL6 A;  3U58 A;  4LF9 L;  2NN6 G;  4DR7 Q;  2Q2U A;  4JV5 Q;  1K9M C;  4IPD A;  4X64 Q;  3I55 A;  3M9B A;  2D0O A;  3F2B A;  4JI8 Q;  4A3B H;  1VQH A;  1VQ8 A;  2A1A A;  4OON A;  3BZC A;  3U50 C;  2RHS B;  3IRB A;  1LYL A;  1YI2 A;  5LMN Q;  2YTV A;  3DM3 A;  2VY3 A;  3STB C;  2OTJ A;  4GN5 A;  4IJL A;  1TWA H;  2ZJR A;  4A3I G;  2B63 G;  5ELO A;  1K8A C;  4BY1 H;  2ID0 A;  3CQZ H;  2VUM G;  4A93 G;  2YYZ A;  4X65 Q;  1N33 Q;  1XMQ Q;  1E3P A;  2K50 A;  4DUY Q;  4A3E H;  4DR4 Q;  2NN6 I;  4YCV A;  1BKB A;  2UXC L;  1OXT A;  2E2I H;  3K0X A;  3RLO A;  3J7Z C;  4DV0 L;  3LGJ A;  1AE3 A;  3I4O A;  4DR1 Q;  3PV0 A;  4A3C G;  2UUC Q;  4A76 A;  1WI5 A;  5IY0 A;  5LMN W;  3F1Z A;  3S16 H;  4IOA A;  3AFQ A;  4YWL A;  4GKJ L;  3BZK A;  3L7Z C;  2E5L L;  4A4I A;  2JE6 I;  4GS3 A;  1MJE A;  3GTP H;  2BA0 A;  2N8N A;  2HT1 A;  2K5H A;  3H0G G;  5FLX c;  1M90 C;  4JYA Q;  2IY5 B;  4YY3 Q;  1WCM G;  5M3F H;  2JA8 G;  1IBL L;  5IP9 G;  4QGU A;  5IYB H;  2VQF L;  1XPR A;  1PH2 A;  1D8L A;  2OTL A;  4BXX G;  2JJQ A;  4HIO A;  5IYD G;  1VQ7 A;  3S24 A;  4LFB Q;  4IPG A;  5GAD C;  1JJG A;  1K83 H;  4AIM A;  1N8R C;  3CF5 A;  2N3S A;  2Q2T A;  1JMC A;  3TRZ A;  4JI2 L;  2R6G A;  2WB1 E;  4BBS H;  1YJ9 A;  4NXN Q;  1FGU A;  3ULP A;  4DR2 L;  1SRU A;  4JI3 Q;  5HGQ A;  4LFA L;  2JA7 H;  4JI7 Q;  1YIT A;  1HR0 L;  1C7Y A;  1OTC A;  4YWK A;  3KLW A;  4GNX B;  4HJ7 A;  2IX0 A;  1HZC A;  4L5Q A;  3PUY A;  4R4T A;  3T1Y Q;  1T9H A;  1XNR Q;  1XJV A;  1P8L A;  1B70 B;  1S40 A;  1N36 Q;  4PZ7 A;  4B3T Q;  2ZTD A;  3WWV A;  3TEH B;  5BR8 L;  2BH2 A;  2CWA A;  2E2J H;  3RN5 A;  5K36 G;  3A5Z B;  4DK6 C;  3JAM c;  1EQQ A;  1Z47 A;  2KHJ A;  1VQL A;  3F2C A;  1VQP A;  2XTI A;  3ERS X;  4DUZ Q;  3NBH B;  4BY1 G;  1SE8 A;  3OW2 A;  4B3S Q;  3ICE A;  5IWA Q;  1EYG A;  2GVB A;  2VZA A;  3RN2 A;  1YHA A;  2PI2 E;  2ZTC A;  1X54 A;  5IYC H;  2JEB I;  2EQS A;  4A3E G;  4LF8 L;  2NVY H;  3HKS A;  2KEN A;  1UE1 A;  1IBM Q;  4GKK L;  3K7A H;  4XIG S;  4JI1 Q;  2JA5 H;  1S3O A;  1EQR A;  1UWV A;  1HNZ Q;  2ZM6 L;  2IHE A;  1XMO Q;  5E7N A;  1CKN B;  4DR5 L;  4JI4 Q;  2E2H H;  1FJG Q;  3GTJ H;  1BBU A;  1Q46 A;  1VQN A;  2K14 A;  3I4N H;  2KBN A;  5LMU L;  5JEA J;  3NEL A;  1L1O C;  2UUA Q;  1UE7 A;  1V9P A;  3UE1 A;  3G6E A;  5M3F G;  4O0A A;  4DV4 Q;  1XNQ Q;  2KHI A;  3B6Y A;  1QVC A;  4O2D A;  5FJ8 H;  5IYB G;  2R93 H;  1YEZ A;  1D7Q A;  4LUZ A;  1J5E Q;  1JE5 A;  3G48 A;  4A3G H;  2UUB Q;  1CKO A;  1AH9 A;  2R7D A;  4DV3 L;  1N32 Q;  1UE6 A;  4OX9 Q;  2N78 A;  4R1J A;  4BBS G;  1S72 A;  4DV1 Q;  1Q81 C;  4BBR H;  1MIU A;  3KDF A;  1IBK L;  2UU9 L;  1L1O A;  4IPC A;  2CWP A;  1HZA A;  1YVC A;  1HH2 P;  3UDF A;  2F4V L;  2JA7 G;  1PH5 A;  1CKM A;  1EFW A;  3M7N A;  4FDB A;  4B3R L;  1PH7 A;  5JJK A;  1CSP A;  1QVG A;  3AYH B;  1KC8 C;  3KJP A;  4P74 A;  2IX1 A;  4IOC A;  3CCL A;  2OWO A;  2MO1 A;  1QZG A;  2ATW A;  2HQL A;  3M4O H;  3RNU A;  5DLQ E;  4YWM A;  3J81 j;  4JI0 Q;  1IL2 A;  4DR3 Q;  1HNW Q;  3RLN A;  4J15 A;  4DAY B;  2L15 A;  5FLM H;  4TVA B;  3T1H L;  1VQ5 A;  3HOY H;  5JJI A;  3GTO H;  5M5X H;  3A5U A;  3W5O A;  1HNX Q;  2DGY A;  3CP0 A;  1B7Y B;  4MTN A;  3TS0 A;  4JI6 L;  3M4Q A;  3HOW H;  4A3D H;  2RF4 A;  3TRE A;  1OXS C;  4IO9 A;  4JV5 L;  1X3E A;  2EIF A;  2WAQ G;  1M1K C;  4XTC S;  4DR6 L;  4MNO A;  1Q1E A;  4UP8 A;  2I5L X;  4TQU S;  2GN5 A;  4DNI A;  1PH9 A;  5LMN L;  1KAW A;  2UXB Q;  4DV5 L;  5AJ3 Q;  4NXM Q;  1PFS A;  4R4O A;  4DV6 Q;  3F2D A;  2JA5 G;  4B3M Q;  5M5Y H;  3CCV A;  4WJ4 A;  1GD7 A;  4X66 L;  4WJ3 M;  4JI5 Q;  2NZO A;  3M4P A;  1XMQ L;  1PH6 A;  2PQA B;  1KL9 A;  4DUY L;  1WOC A;  5M5W H;  4DK3 C;  3F8T A;  4DR4 L;  4A3D G;  2BH8 A;  3PUW A;  1I94 Q;  1X6O A;  4JBJ A;  1VQK A;  3CC4 A;  2PMZ E;  5EAY A;  3PF4 A;  3RLF A;  2YTX A;  4IPH A;  1VQA A;  4DR1 L;  4GOP B;  2R93 G;  1NE3 A;  5FJ8 G;  2EXD A;  3CCE A;  4R4Q A;  1VQD A;  4QQB X;  4A3G G;  3S17 H;  4BA1 I;  2ZJQ A;  1Y14 B;  2GVA A;  4LUO A;  4RMF A;  4Y52 H;  3PCO B;  1Y1V H;  1QUQ B;  2K5V A;  5C0X J;  3KF6 A;  5GAE C;  4A75 A;  4LF5 Q;  4BBR G;  4QIW E;  4OWT B;  4EX5 A;  2YTY A;  1HJP A;  3HKZ E;  5C3E H;  4HIK A;  4L5S A;  2VQE Q;  1QZH A;  3CW2 C;  2F3I A;  5C4J H;  4LUV A;  3CCR A;  1A63 A;  4OO1 I;  3GTL H;  2WP8 J;  3EIV A;  3CAM A;  3UDI A;  2UXC Q;  1X56 A;  4R4I A;  4GN3 B;  4L5R C;  4LFC L;  4JI3 L;  2RCN A;  4DV0 Q;  3ULL A;  4HIM A;  1PH1 A;  1XPU A;  5M3M H;  2I5H A;  5FLM G;  2AWO A;  1OXU A;  3D0F A;  4POF A;  3HOY G;  1G51 A;  1G6P A;  2K52 A;  3J81 i;  3BJU A;  3ZJY C;  1K73 C;  5J3B A;  3CCS A;  3HOW G;  3KJO A;  1E22 A;  1I50 H;  2K75 A;  1EOV A;  3HFZ B;  3J80 i;  4DV7 Q;  3T1Y L;  4KHZ A;  3PF5 A;  3KFU A;  3HOZ H;  4BY7 G;  1XNR L;  2JA6 H;  1NMG A;  3JAM i;  4X62 L;  2VQF Q;  4B3T L;  3W1B A;  1VQO A;  2R7Z H;  4A3B G;  2N49 A;  4AYB E;  4JI2 Q;  2RHQ B;  1NTG A;  1OXX K;  4PZ8 A;  3GO5 A;  2MNA A;  1UEB A;  3DLL A;  1KRT A;  3CCQ A;  2HHH L;  1U0L A;  4A3L H;  3K7U C;  1DGS A;  4HJ9 A;  1TWF H;  4QL5 A;  4YCU A;  4DUZ L;  4B3S L;  1PYS B;  3TS2 A;  1J6Q A;  1VQ9 A;  4LF7 Q;  1I6H H;  1UE5 A;  3S1M H;  4LF6 L;  2WFW A;  1FVI A;  1E1T A;  3K80 C;  2Y0S E;  2CKZ B;  1L0W A;  1IBM L;  3H3V I;  1I3Q H;  2JK8 A;  1RL2 A;  4GOP C;  3RR5 A;  1VQM A;  1XMO L;  4JI4 L;  1GVP A;  4MZ9 A;  3GTK H;  5C0X I;  1JJ2 A;  1EWI A;  3AQQ A;  1NBW A;  1K3R A;  1WYD A;  1GO3 E;  1R9T H;  2LSS A;  1K0R A;  2UUA L;  2PQA A;  2ES2 A;  1N9W A;  4K0K Q;  1OXV A;  4DV4 L;  2A8V A;  1K8G A;  1HZ9 A;  4DV2 L;  3GTG H;  2JEA I;  3PUV A;  3KYH C;  3PO3 H;  3A74 A;  1LTL A;  5C3E G;  1JB7 A;  1HR0 W;  1J5E L;  4AQY Q;  3S1R H;  4IFD J;  4GOP A;  4Y7N H;  3HOU H;  4IJH A;  5H1S E;  2OQ0 A;  1Q82 C;  2LXJ A;  5IP7 H;  4A3F H;  3I7F A;  4APV A;  2HIX A;  4LF8 Q;  3PIO A;  2WB1 G;  2AWN A;  1KRS A;  1BVS A;  1IZ6 A;  4OXP A;  3CCJ A;  4GN4 B;  5GAH C;  3CPW A;  3CME A;  1VCI A;  4DAM A;  5M3M G;  2MO0 A;  4BA2 I;  4A3K H;  1AE2 A;  1Q1B A;  1IXR A;  3Q8D A;  1YBY A;  2Z6K C;  4DR5 Q;  5GQO A;  4EQ5 A;  4YHH Q;  4HJA A;  1Q7Y C;  2CFM A;  4KI0 A;  1YIJ A;  2B29 A;  3U4V A;  3OTO Q;  4GNX C;  1N34 L;  4JG2 A;  3KF8 B;  4R4C A;  1ASZ A;  2ASB A;  4JI0 L;  3HOZ G;  3FHW A;  4GLV B;  1E24 A;  4OWX B;  2JA6 G;  1Q8K A;  4KLK A;  3GTM H;  3L0O A;  1HNW L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...