2B63G

Complete rna polymerase ii-rna inhibitor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
molecule keywords 31-MER
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b63G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2b63G01
1EWIA 1E1OA 1Y14B 2E5LQ 1E1TA 3RNUA 3PO3G 1V43A 1VQDA 3GD7A 2KCMA 2B29A 4NXML 1CKNB 3U4ZA 4LF5L 1HNWQ 1EOVA 1WCMG 1K0RA 4JV5Q 1N34Q 2R92G 3MXNB 4LNQA 1VQ7A 1I3QH 1OXUA 1BBUA 3I4OA 5E7NA 3J81i 3H0GH 4LUZA 3PO2H 4JOIC 3ICEA 3DM3A 2YTXA 4B3SQ 4BY1H 4DV5Q 2VUMH 4YCWA 1I94L 2LXJA 2K5VA 1UE1A 4NXNQ 1AE2A 4YCUA 4X64L 1PHJA 1SE8A 2EIFA 1MKHA 1K3RA 2D0OA 2HIXA 1WYDA 1YJWA 4IFDI 2KCTA 4P72A 3AFQA 1QUQA 3UDFA 1TWFH 1KXLA 1KL9A 2BA0A 4UP8A 4YCVA 2AMCB 3LGJA 3S15H 4A3FG 4GKKL 1WCMH 4PZ8A 4IFDG 2QEXA 4C3IH 1B7YB 2HHHQ 2OQ0A 3NEMA 1VQ4A 2WFWA 1K8AC 2Y0SG 3GTOH 2CCZA 3CC7A 4DV5L 4A3DG 2WAQE 1KIXA 5C4JH 1JJ2A 1IL2A 2HIVA 1PV4A 3TREA 2K4KA 3H0GG 1XNRL 1XPUA 2UXCL 2L15A 1OXXK 4OWWB 2BA1A 5BR8L 1XMQQ 3CCRA 1VQ9A 4YY3L 4LF8L 1Q86C 3S2DH 4LUVA 1KD1C 1Y1WH 3KJOA 4JI3L 4OO1I 4OXPA 4DR1L 5J3BA 1SRUA 1VQJA 1VQBA 4WJ4A 4B3MQ 1HJPA 2MO0A 2HQLA 4R1JA 2YV5A 4DV0L 1XJVA 4AYBE 1QVFA 2IHFA 4A3JH 4BBSH 2WP8J 3JC66 1QUQB 4UP9A 4DUYL 2YYZA 2ZJQA 4C2MH 3EBEA 2ES2A 4DV3L 4B3RL 1SROA 3CPFA 5JEAG 4GLAC 3HKZG 4A4IA 5FJ8H 4P73A 4R4QA 1OTCA 3CF5A 1D7QA 1N34L 2K75A 4P71A 4JV5L 2B3GA 4P75A 3H15A 1D8LA 4GNXB 1PH3A 4LF4L 5IYDG 4JI1L 1LTLA 4YWKA 4KHPQ 1IXRA 5GAHC 4DR4L 4OONA 1UE6A 4X65L 1YI2A 2QA4A 4LF4Q 4JOIA 1NY4A 1Q12A 1PH8A 1Y1WG 3AEVA 2JA5H 1VQKA 4PZ6A 4HJ9A 4L5TA 1EIFA 3TEHB 3AQQA 3GTJH 4RMFA 1JJCB 1HR0Q 1CSPA 4LF6Q 4MTNA 2JA7H 2LXKA 1X9NA 4POGA 4GN4B 3KOJA 2K5NA 4JI2Q 1Q46A 3PUWA 1L1OB 3F2BA 4MZ9A 1CSQA 2UUCL 4A3KH 2N78A 3ULPA 4A3IH 3PF5A 4DPGA 1E7ZA 1IBMQ 3CXCA 1YJ9A 4IPGA 4A3EG 3PO2G 4GOPA 1N9WA 1CKNA 3K80C 2B63G 4JI7L 4BBRH 5IY0A 2UUBL 2GVAA 2Q2UA 3CP0A 4KHPL 1OXSC 4JI1Q 3UE0A 3L7ZC 4PG3A 3PV0A 3J81c 1EQQA 1XMOL 5BR8Q 1VQNA 3T1YQ 4X66Q 5IP9G 3U4VA 4A75A 3SGIA 2PNHA 1K83H 4NB3A 3K7UC 2I0QA 2UXCQ 5IWAQ 4IJLA 2UXDL 4QY7A 1H95A 1DGSA 5M5XH 5LMNQ 5AJ3Q 4DR3Q 3M4QA 3IRBA 3KDFB 5IE8A 3D0FA 5IP7H 3Q8DA 4DV2Q 2KHIA 4AQYQ 1FJGL 2IT1A 2PQAB 3GO5A 3JAMi 4Y52H 2ALYB 2R7ZH 1I5FA 5C0XG 1M1KC 2I5LX 1LUZA 3CCMA 4A3MG 3J81j 2JJQA 3CD6A 2CWAA 1U0LA 2UU9L 4HIOA 4IPCA 4UY8C 2QGQA 1HZCA 5LMUL 4DV1L 5FLMG 4A3CH 4A93G 1IBKL 5GADC 2UU9Q 2A8VA 4A3GH 2F3IA 1WFQA 2NZHA 3KF6B 3HOXH 5JJLA 4GKJQ 1E3PA 1NE3A 1YHAA 3OTOL 4DV4Q 3F8TA 2N49A 3CQZH 1PH9A 2OTJA 1V9PA 1HNXQ 1Y1VG 4A3BH 4NXNL 4C3HH 2YTVA 5HY6A 2R93G 1A63A 4K0KL 1MJEA 4A3EH 4EQ5A 2VZAA 3H3VH 3AYHB 3UE1A 5AJ3L 4DR6Q 4K0KQ 2Q2HA 5IWAL 5FLXc 1X65A 4O2DA 4DR7L 3RLOA 2AWNA 3K8AA 4X66L 1N32Q 1X3FA 1X3EA 4UP7A 3UDGA 1N36Q 2NVXH 4GKKQ 2A19A 4LF7L 3E9HA 1XNQQ 1L1OA 5M3FG 3WWVA 3PIOA 3KLWA 2MQHA 1Q81C 4LUOA 1VQ8A 2JA8H 1VQPA 5C3EH 1EQRA 1J6QA 2R6GA 4C3JH 4BY7H 5M5YH 2MFIA 1E24A 4DV7L 3FKIH 4JC0A 4DAMA 4JI2L 3L0OA 3F2DA 1Q1BA 4X62Q 4L5SA 4DAYB 2JA9A 3D31A 1A62A 5C44G 4RG1A 3G4SA 1N33L 1TWCH 4A3GG 4JYAQ 2ZM6L 4MNOA 3KJPA 4OO1G 1P8LA 3HFZB 2JK8A 3PIPA 4DR2Q 3L2PA 2UXDQ 4LFAL 3TRZA 3M4OH 4R4IA 2F52A 4HJ5A 3W1GA 4PZ7A 1XMOQ 4DKAC 1EIYB 2JA5G 4JI6Q 2K52A 3S1QH 1L0WA 1QVGA 2YU9H 2R7ZG 4AYBG 1JT8A 2Z0SA 1X3GA 5LMNW 3HKSA 4JI4L 1YNXA 1BKBA 2JQOA 4JBWA 4Y7NH 2E5LL 4YWLA 3J7A5 3RZOH 2AHOB 3OW2A 4O0AA 3T1HQ 4TQUS 3G48A 3S1NH 4X6AH 4APVA 1CKMA 5FLMH 4A3CG 2BH8A 1Z47A 2NN6G 3I56A 4BA2I 3ERSX 4BXXG 3RN5A 5GROA 1G51A 4A3FH 1YVCA 1ASZA 1UE7A 1X54A 2OQKA 2K5HA 4KHZA 4R4CA 3A5UA 2ZM6Q 4DUYQ 1VQIA 4JYAL 3CW2C 3BJUA 2WAQG 5IYBG 2NN6I 2K50A 1PH1A 2F4VQ 1NMGA 1X6OA 4A3BG 5C4XG 3HKZE 5C0XJ 2UXBL 3KDFA 3CCQA 1VQ5A 1KRTA 4X65Q 4DR4Q 3STBD 5K36G 2ID0A 3B6YA 3G6EA 1Q1EA 1PH5A 2GVBA 3GTKH 3TS2A 4BY1G 2V1CC 2I5MX 2CQOA 3AFPA 2D0PA 4ALPA 4DR5Q 4JI6L 1XNQL 2VNUD 3HOUG 5IYCH 5EAYA 4JI0L 1XTDA 2RHQB 1VQFA 1J5EL 3HOVG 2DUDA 1PH7A 4YHHL 1KQSA 4LF9L 1JMCA 1TWGH 4OX9L 3PUYA 3J80c 4HJ8A 4HJAA 1NJIC 3S17H 1YBYA 1GVPA 4X62L 2OCEA 3PUXA 1YHQA 1PA6A 3PO3H 1R9TH 1M90C 3S1RH 4JCVE 1KAWA 1YHBA 4DV6L 4GKJL 2PI2E 1FL0A 5C4XH 3BZCA 1IBKQ 4ME3A 1SR3A 5LMUQ 4DV1Q 1XPOA 2E8GA 1HZAA 3UDXA 4JI8Q 2XGTA 2Y0SE 1SLJA 2R92H 4YY3Q 4LF8Q 3S1MH 1WOCA 1N36L 1XMQL 5ELOA 2XTIA 1PYBA 4X64Q 1TWHH 4XTCS 1N32L 1HZ9A 1L2FA 4IPDA 3BZKA 1XNRQ 5M5WH 4L5QA 1PH4A 2NVQH 3PF4A 2FXQA 1PVOA 3CPWA 3PSIA 3U58A 1I94Q 2OWOA 4LFCL 4AQYL 2HT1A 4DR6L 1HH2P 3MEFA 1Q82C 1W3SA 3K81C 4YHHQ 4LFCQ 5LMNL 1CUKA 2JA7G 1JE5A 2PMZE 2ZJPA 3CCEA 1JJGA 1LM0A 3HOVH 4NPSA 4OWTB 1YIJA 2VY3A 1I50H 2LSSA 3I2ZA 3EIVA 3K0XA 2JA8G 2UUAQ 2WB1E 4LF5Q 1HNWL 2R7FA 2IY5B 1GD7A 1IZ6A 1OXVA 2MO1A 1KC8C 4AIMA 3G71A 3A0JA 4DK6C 2EQSA 1L1OC 1GM5A 3NENA 1QZGA 1IYJB 3NELA 4HJ7A 5DLQE 1HNZL 2F4VL 4DV6Q 3UDIA 1MIUA 2VL6A 4A3LH 3I55A 3W1BA 3M9BA 2VUMG 3FHWA 3M7NA 4HIDA 4B3TL 4PMWA 2IX1A 1W2BA 1S3OA 4B3SL 2RHSB 1NMFA 5ELNA 2EXDA 4P74A 2VQFL 3M3YH 2KBNA 1PH2A 3A74A 4GN3B 1FVIA 1B8AA 3ULJA 4JI0Q 2NZOA 2NVTH 1VQHA 3KF8B 2DGYA 1ASYA 3GTGH 4BXXH 1A0IA 4LWCA 1VQCA 2RCNA 2Z6KC 4DR5L 4GOPC 3T1HL 4YWMA 1X55A 2VQEQ 4EX5A 1EFWA 2JEAI 4QQBX 1S40A 4JG2A 1QVCA 1RL2A 1UWVA 1MJCA 4QL5A 3ZJYC 1C0AA 2VQEL 3S24A 1FGUA 5IYBH 1IBML 3CCLA 1KRSA 1X56A 2PQAA 1SMXA 2Z6KA 1IBLQ 2UUCQ 5C3EG 1S72A 4IPHA 4GLVB 1Q8KA 3K7AH 3I7FA 1VQEA 1VQLA 2JA6H 1E22A 4UPAA 3FP9A 2E2HH 2VS1A 3W5OA 3GTMH 5JJKA 3CAMA 3E9IA 3CCUA 4B3TQ 5HGQA 4IFDJ 1CKOA 1UEBA 4GLXA 1K73C 3HOWH 2WB1G 1C9OA 1G6PA 3KF6A 4LFBQ 3RN2A 4GN5A 2Q2TA 2ZTCA 1HZBA 1A8VA 4XIGS 3M85A 2I5HA 3NBHB 4JI4Q 1UE5A 2CFMA 3CMAA 2AWOA 3HOZH 3GTLH 3RLNA 3RR5A 2JEBI 4JBMA 1PH6A 2UUAL 3HOYG 3CCSA 3S14H 2YTYA 1YEZA 4L5RC 4IOCA 2GN5A 3U50C 3I4NG 2BH2A 1GKHA 1HR0W 1WI5A 4QJFA 1K9MC 3CC4A 1LYLA 1Z9FA 4B3RQ 4DV3Q 1VQAA 3BU2A 3STBC 4A76A 4JI5Q 1QZHA 4WJ3M 1N33Q 1VCIA 4BBRG 3FKIG 4DK3C 5C0XI 1HNXL 3J7ZC 3OTOQ 4DV4L 4A3JG 1Y1VH 3PUZA 1HNZQ 4J15A 4POFA 2RF4A 5GAEC 3JAMc 4A93H 3HOUH 1PYSB 1AE3A 1EUJA 1I6HH 4DR1Q 4DUZQ 4GNXA 3KYHC 5JEAJ 2D62A 3ULLA 4JI3Q 4DUZL 1KHIA 1GO3E 1YZ6A 3CCVA 1BVSA 1TXYA 1YJNA 4LF7Q 3I4MH 2IHEA 1K8GA 3OYYA 4HIKA 4DR7Q 4R4TA 3PCOB 2VW9A 4GOPB 4KI0A 1PFSA 4OWXB 3HOZG 2A1AA 4BY7G 4OX9Q 1B70B 4JI5L 4BBSG 5M3MH 4LF9Q 2ASBA 1RIPA 4A3IG 3TS0A 2N3SA 2HHHL 2C35B 4HIMA 5IYDH 3T1YL 2Q2IA 2N8NA 3GTQH 3RLFA 1OXTA 4NXMQ 2CWPA 4IJHA 2JA6G 5C44H 1YITA 3RZDH 4IOAA 4JI8L 5FJ8G 1TWAH 4LW1A 1C7YA 4JI7Q 3GTPH 5GAGC 4GS3A 1V1QA 3F2CA 4TVAB 2UXBQ 3PUVA 3KFUA 3S2HH 1XPRA 4FDBA 4KLKA 3CCJA 1VQOA 2ATWA 4BA1I 1VQGA 2NVYH 1U5KA 4DV2L 1EYGA 1FJGQ 5JJIA 3I4MG 5M3FH 3EN2A 4LF6L 4DR3L 3PGZA 3I4NH 2ZTDA 1J5EQ 2ZJRA 2K14A 5IT9c 4JBJA 1SFOH 3HOYH 1N8RC 1IBLL 4JBKA 3M4PA 5M3MG 2AKWB 1JB7A 1NBWA 2IX0A 2B63H 2CKZB 2UUBQ 3S16H 3H3VI 2R93H 4AH6A 1AH9A 3E0EA 1P16A 2MNAA 2OTLA 4A3LG 2KENA 3VDYA 4A3DH 3HOWG 2ZTEA 3HOXG 4LFBL 2KHJA 4QGUA 1G291 4LFAQ 3DLLA 2JE6I 3TQYA 3CMEA 4DR2L 4GNXC 1BBWA 5IP9H 2VQFQ 4QIWE 1NTGA 2E2IH 1VS0A 4H02A 5GQOA 4R4OA 5H1SE 1T9HA 1HR0L 3A5ZB 4A3MH 2PI2A 5IYCG 2R7DA 1Q7YC 1O7IA 2E2JH 1SN8A 3F1ZA 4DNIA 4DV0Q 3CC2A 1VQMA 4DV7Q 3ER0A 2H5XA 4B3ML 1WJJA 4A3KG 5IP7G 4IO9A 1VQ6A 3J80i 3GDEA
chains in the Genus database with same CATH superfamily
2DPJA 1Y14B 4J8QA 2E5LQ 1E1TA 1Y1VB 4M8AA 1AP0A 5KFIA 4ODGA 1V43A 3KLRA 4F8MA 3GTJB 2R85A 2B29A 4K6DA 3V4SA 1K0RA 5FD5A 1KEEA 2ZJTA 1BCPD 4IUUA 1IBMH 1F77A 1TS4A 1CZWA 2R7KA 4B3SQ 4DV5Q 2PMZB 3VR4A 3DWAA 2LXJA 3I72A 2J6TA 2K5VA 2B2YC 4ZQIA 3QZ8A 2K7VA 4N8FA 3A8IE 2B2WA 4K2LA 3SK8A 2F03A 2OH2A 4IFDI 1ZEQX 1S5FD 5L1KA 4O4IF 2F0JA 4RUAA 2C9OA 1TWFH 2GLTA 1KL9A 3KTMA 3IAYA 2MP1A 1MSGA 2NTTA 1WSCA 2NN6H 5HGTA 4DXFA 3UI2A 3Q24A 2B2YA 3NEMA 2WFWA 2Y0SG 4KTAA 1FGBD 2B2VA 3VA7A 4A3DG 2NVXA 1D5ZC 4NKLA 5C4JH 5D3IB 2UXBH 2FINB 2K4KA 2SNSA 3MFGA 2UXCL 4ECQA 5J22A 1CE8A 5BR8L 5KT6A 5ELBA 5DLFA 4G3IA 1H9SA 1Q86C 3S2DH 2F0SA 2UUBH 1Y1WH 3S1RB 2XVSA 4ZAIA 4JI3L 2QYZA 1U4PA 5KG6A 1FKAH 1W6JA 3NP8A 2NU9B 2KA7A 4MV6A 1I4QA 2F0OA 2MO0A 2P0AA 4R1JA 4CHTB 4CBVA 2F0VA 4C3IG 2AQ3B 2B63A 1ET9A 2GA4B 1WTQA 5JAVA 1HUMA 3LMLA 3H94A 2WYOA 1RTNA 2W8KA 1CFMA 4DUYL 4ZI7F 2YYZA 3T13A 4IZ8A 1Z2OX 3L4KA 4EFEA 5BR8H 2N88A 4P73A 4XT3B 2FMMA 1HA6A 3I70A 1D7QA 5LL6b 2MUYA 3RD4A 4JV5L 2KUMA 2B3GA 1PH3A 1CQIB 1V1PB 2DY8A 4FU0A 1D5XC 4C5BA 1KJ9A 3BQ2A 1CQFA 1TS5A 4IRDA 1IXRA 1XNQH 1KJIA 5LMNH 4FBUA 3HOVB 1UE6A 1YI2A 2YW2A 3R5XA 4DL4A 5D8DA 1NY4A 4O42A 1Q12A 5A35A 1PH8A 2Z9HA 1LT4D 3OIQA 4PZ6A 5IGFA 4HJ9A 1V4YA 3HOYB 1HR0Q 2R7NA 4HR7B 1DV1A 5I2XA 5KFGA 4JYAH 2LXKA 3M4OB 4C5CA 1YNND 4POGA 5M3FB 3P75A 1PLFA 3KOJA 1VBHA 4DL7A 1HNXH 3F2BA 1CSQA 1IYVA 2N78A 3ULPA 4A3IH 1A3TA 3PF5A 3I4MB 3K5HA 2O03A 3CXCA 4A3EG 1N9WA 1CKNA 3K80C 2M05A 4JI7L 4BBRH 4WORA 3J7AV 3HOUB 2NU6B 5D1PA 2RBMA 4JI1Q 5KFHA 1SYEA 4PG3A 5CB4F 2X6GA 3MXPA 1XMOL 2J7ZA 3GTMB 2UXCQ 4NB3A 1K83H 3MXUA 3P1HA 5LMNQ 4F4WA 5AJ3Q 1PZJD 4DR3Q 1GSOA 3Q8DA 1H9KA 2KHIA 4DV2Q 2IT1A 3K57A 4MHEA 3JAMi 5I6WA 2ALYB 1WD1A 5HV6A 2R7ZH 3G8CA 5JH7F 1II3A 5C0XG 2I5LX 1LUZA 1HR0H 1JC7A 3CD6A 2UU9L 4J6HA 1MD2D 2QDBA 4JV2A 5FLMG 5GADC 1WFQA 1Y8OB 1NE3A 4CGYB 3GTKB 3S2HB 3PO3B 1TS3A 2B2UC 3ND9A 4YJ3F 1MJEA 4A3EH 3R8BA 3AYHB 3A56A 3U9TA 5IGGA 1MSHA 4ED0A 3UE1A 1S97A 4DR6Q 1BO0A 3H6MA 1KLGD 1RJRA 2IA6A 5CA1F 5FK9C 1IW7C 5IWAL 5FLXc 2NUAB 4O2DA 3G6XA 4IUTA 3D4RA 1N32Q 4X66L 1LTID 1X3EA 4KMUC 2NVXH 2EY5A 3UDGA 1N36Q 2ZDHA 5L9XA 2E2DC 2F0NA 1NAPA 3PIOA 1Q81C 5C4HA 3NTHA 3Q0AA 1JDEA 3OHBA 5EPLA 5DG7A 1J6QA 1B4OA 5L1JA 1RYSA 4DAMA 1LTRD 1PFBA 4HN7A 2OF1A 2P5ZX 2Q8TA 4X62Q 3RGZA 4ECYA 3A55A 2JA9A 1KLUD 4DAYB 2F4VH 3JAML 4NLGA 3KJPA 1P8LA 5KEEA 2K5QA 2PBZA 1JB3A 3K5NA 3M4OH 1F2ZA 4KD4A 4DKAC 2YYAA 3R3OA 4IR1A 3RB6A 2K52A 2R7ZG 2YU9H 1N48A 4RAUC 2K1BA 5LMNW 4O4LF 3HKSA 3T4AC 3T1HH 4B3SH 4Y7NH 4JBWA 2CHBD 4A2BA 1H9JA 3RZOH 4UCTA 3CHBD 5KX5F 3OSPA 3I4NB 2W8LA 5L37A 3PW4A 4A3CG 2BH8A 1BXRA 3D6CA 2DY7A 2XWJB 4A3FH 4GKKH 2HQEA 2CW8A 3FVQA 5GONF 5DGBA 4FXGC 3OUUA 2NN6I 3CU7A 1BNCA 3PO2B 1STAA 2F4VQ 2CW7A 4V190 3I3CA 3TZDA 5C0XJ 1KRTA 4JPBW 3STBD 5K36G 2ID0A 3NPPA 4DLKA 3HP3A 2JEGA 2GVBA 3GTKH 4BY1G 2V1CC 1QILA 2I5MX 1XNQL 4EGVA 4JI6L 1EIGA 3RBDA 3QJYA 3C1FA 2PZUA 4LFBH 5CR3A 4ZYSA 3SHLA 5FO8B 2YZMA 5I2YA 3I91A 1PDQA 3MVVA 1J5EL 4ZRZA 2DUDA 1PH7A 2WAQA 3K3PA 2R92B 5DQIA 2JA5A 3HZXA 4OX9L 3PUYA 3J80c 4XXEA 5DG8A 3S1NB 4HYKA 3S17H 2JYOA 3PUXA 3GIJA 1Q8IA 1WR2A 4O3PA 4CJ2C 5LXTF 1FL0A 3L3OC 5C4XH 3A54A 1Z6HA 5LMUQ 2K05A 2R7ZA 1RJQA 2DJFC 1AFPA 2E8GA 3MAQA 2W9CB 1T36A 3K3VA 2QF7A 5L1IA 5C44B 3LWBA 1SLJA 2R92H 1N36L 1LABA 1XMQL 2XTIA 1CZGA 5FPRA 1HZ9A 1XNRQ 1PH4A 2JEIA 3PF4A 1G2SA 4FF4A 3U58A 4CDDC 2OWOA 4YHHH 2KEEA 1SNMA 2TMPA 3K81C 4K6LA 4RAYA 2ZJPA 2PMZE 5FLXE 1HHVA 3DEOA 2UVWA 4LFCH 1LM0A 3HOVH 1I50H 3EIVA 1GSAA 4LF5Q 1HNWL 1SBBB 4Y7NB 1GD7A 2EZVA 2MO1A 1Q3LA 5FPOA 2EQSA 1L1OC 2YL2A 1BNZA 2VB2X 1IYJB 3BVZA 3NELA 5DLQE 2IX3A 4HJ7A 4DR2H 2CW0C 1MIUA 3W1BA 4LFAH 5CV5A 3SK6A 4C1NI 1AUVA 2W9CA 4PMWA 4I7HA 1W2BA 1S3OA 1SE3A 4B3SL 3KXYT 3M9MB 2EXDA 3GQBA 3ETJA 2KBNA 4GN3B 3K5MA 5J2UF 4KJOA 4JV1A 4LWCA 4A3JG 2RCNA 1SAPA 4EG0A 2JXMB 2Z4HA 2VQEQ 3PQIA 1SE4A 1S40A 2WB1A 4DR3H 2X6LA 4DL5A 4PMCA 1MJCA 4DR5H 4QL5A 1SYGA 1TWCB 2Y0SB 5DEHA 5IYBH 5C0XH 3J81E 3RFCA 4HNUA 1EUDB 2Z6KA 5C3EG 4YB8B 1B53A 4CDEC 4WJWA 1LT6D 1WTPA 1SNPA 3KLSX 4HMIA 1JDBB 4UPAA 2GPSA 2WACA 2VS1A 3W5OA 3GIIA 5DGAA 1K73C 2F1MA 1C9OA 1RCVD 2K6AA 1HZBA 1PYWD 1A8VA 2ZTCA 2UUAH 2XGPA 3J80L 1VF7A 3R5FA 3CMAA 2AWOA 1SMYC 2JEBI 2ASJA 1W93A 1D5MC 1IKLA 5G3LD 2O5IC 5COYA 1WTWA 4YAJB 1BOSA 1WI5A 1Z9FA 4B3RQ 3JRWA 4F4XA 3HOWB 1EHIA 4DV3H 3GTOB 3MWEA 4APMA 1JWMD 1O7LA 5C0XI 1HNXL 4WBNF 1N33H 1N34H 1SNOA 4DV4L 4YR0A 4OELB 2Q8RE 4RA8A 4J15A 3JAMc 2F0IA 3HOUH 1PYSB 4EEYA 5C4JB 1I6HH 1HNZH 4DUZQ 4GNXA 3L4JA 3KYHC 2HVSA 1GO3E 1YZ6A 3CCVA 2LY7A 4KY6A 2W57A 3OHAA 3M4IA 1K8GA 1O7ZA 5KFOA 5EWFA 3Q8SB 5C6AA 1I3QA 4GOPB 4S3SA 2R8JA 1O78A 4A3JB 4OX9Q 2BE5D 4BBSG 3TDQA 4LF9Q 2R7ZB 4O3RA 3HB9A 5JUMA 3OOCA 2XGQA 5I47A 2N3SA 4ME5A 4DV5H 2EYLA 1SYCA 3BVMA 4N8X1 5IYDH 2Q2IA 3GTQH 5KG3A 2VQFH 5LL6S 2QK4A 1OXTA 1L0XB 4NXMQ 5KFFA 4IJHA 2JA6G 3HRZC 3GTOA 2XN9C 4JI8L 5FJ8G 4L1KA 3ONAB 2VPSA 4GS3A 2G9HD 4RNOA 1V1QA 3PIO3 1U4RA 3S2HH 4ED1A 5F9LA 2ZXPA 1XPRA 3RF2A 3CCJA 1XWEA 1VQOA 2ATWA 1B3AA 3NTKA 2AQ4A 5JJIA 2EY2A 3TP6A 5KRUA 1EU3A 3EN2A 3I4MG 2A6HD 2RA4A 3PGZA 1FJGH 1AZQA 4K5VA 4CDCC 4A3EB 1RTOA 2ZTDA 1S0NA 2UU9H 5IT9c 3RMHA 3TMEA 3HOYH 1JOOA 3NSWA 5M3MG 2JEJA 4MAMA 1NBWA 1AEXA 2UUBQ 3MXGA 3VA5A 1A2TA 4AH6A 4EFBA 1P16A 2L5TA 1A6XA 2KENA 3GP7A 2ZTEA 3HOXG 4X66H 5EKKA 2KHJA 4QGUA 1EWHA 4DR2L 1ZQ7A 1EZ6A 1M8AA 4MTDA 2LMCB 3F2UA 4H44C 1VS0A 5GQOA 5H1SE 4U673 3VR6A 5IYCG 2R7DA 2E2JH 3F1ZA 2A74C 1VQMA 1H9RA 1JORA 4QUFA 3KK7A 3NBHA 4IO9A 2ICEC 1VQ6A 2DNEA 3RZOB 2JP1A 4IWXA 4ECXA 5KFJA 1K3BC 2YZGA 2BR0A 1VQDA 2SCUB 3C46A 2V4DA 3RAXA 4NXML 2XIGA 1PTOC 3U4ZA 5C1OA 1A9XA 4UHVA 4DV4H 1EY6A 2UUCH 2R92G 3N6XA 4LNQA 3NQIA 3I4OA 1OXUA 1VQ7A 5E7NA 3JZIA 3J81i 1KTKA 4LUZA 2I8CA 1LT3D 4JOIC 1G6ZA 4YCWA 5K36H 5CMDA 1EY5A 4O1NA 1UE1A 3J81W 2WINB 1STYA 3AU7A 1PHJA 4QCLA 4FVMA 1SYBA 4L8JA 2EIFA 5M5YB 2AGQA 3E6ZX 5IGDA 3D6WA 2KCTA 1YNJC 3BAAA 4Q45A 3WDNA 3FKIA 1QUQA 4LH7A 2F0QA 3BDLA 4ED7A 1KXLA 1XX8A 1QJOA 2R87A 2AMCB 3LGJA 1X3QA 4A3FG 4GKKL 1WCMH 4Y8VB 5KFLA 1JLLB 2MHVA 3TZUA 3ETHA 1EIHA 2OQ0A 1JWSD 2VXWA 2CCZA 5D1OA 3CC7A 2HHHH 5FKAC 4J9QA 2WAQE 1KIXA 2CZGA 1JJ2A 1I4RA 2H4OA 2QKIC 1CT1D 3CRLC 5DG9A 2HIVA 4FM9A 2LFNA 3H0GG 1XPUA 1OXXK 4OWWB 1AW7A 2BA1A 5DM73 4I65A 1VQ9A 4I50F 3E5SA 4LF8L 4ZHQF 4JV5H 2XRSD 5CAEB 2A6HC 4MV3A 3BA8A 4DR1L 5J3BA 1I7LA 4JI1H 4C3IB 1VQBA 2HQLA 4YR3A 3LWUA 4EQPA 5CV9A 5FLXW 3PMFA 4DR7H 1QVFA 2IHFA 4JI2H 4RB3C 3JC66 2QILA 1QUQB 1Y1WA 2ZJQA 4C2MH 5KFMA 2ZM6H 2A69C 3DMUA 4NDXA 4B3RL 2G9DA 5JEAG 3CPFA 4OIJA 4GLAC 4A4IA 4ECTA 1HPCA 4UAIA 2X69A 1QWYA 4P75A 4PQXA 2V9WA 2PZTA 4ECZA 2EJGC 4JI1L 4YWKA 5IWAH 1FYCA 1F9QA 1I50B 5GAHC 1DD2A 2BE5C 1O75A 4OONA 2QA4A 1M0TA 3HOZB 1Y1WG 4DV0H 3EPGA 2WV6D 1VQKA 1H9MA 5G3LF 4C3JB 4L5TA 1WH2A 4RMFA 2PVPA 4DNTB 3X3NA 2EYHA 3A7LA 3N52A 4N9TA 3VR2A 2JA7H 4YP3A 1E4EA 4GKJH 1HNWH 3QR8A 2YS6A 2J6UA 4JI2Q 2O4XA 1Q46A 3PUWA 4MZ9A 2IP4A 5EKLA 4LSXA 3PR5B 2HCIA 2ASLA 1JOQA 5FD6A 3GTJA 1YJ9A 3MTSA 3K6OA 1EQTA 2B63G 3VYUA 3R93A 3SEBA 2FK2A 1U4MA 5IY0A 2GVAA 2Q2UA 4A3FB 2R86A 1OXSC 4QW8A 2AGPA 2F0PA 2C22A 2I0QA 2PNHA 3K7UC 5IWAQ 3K0YA 1PRTF 5NUCA 5E4XA 3EVQA 5BPHA 1SMYD 1TAEA 3TINA 1GJXA 3T16A 2W71A 2PQAB 3GO5A 3H91A 5TSSA 2Z6BA 2FP4B 3CCMA 3RZDB 4OGQC 2CWAA 4HIOA 1E4FT 5C5MA 2FPPB 1STNA 5KG2A 1SXTA 1IBKL 2UU9Q 4MV9A 2A8VA 4A3GH 2F3IA 2NZHA 3KF6B 3HOXH 3HBLA 4ID6A 2VUMB 1PH9A 3OTOL 4XYMB 2B2TA 3F8TA 3CQZH 4MA0A 1K28A 1PXUA 5EPKA 4DU9A 4GC6A 1R4PB 1STGA 2VZAA 4LF6H 2F3WA 5KFDA 3MR6A 4XDXA 1SJHD 2Q2HA 4YY3H 4K0KH 3SK4A 4DR7L 1UAPA 3K8AA 1X3FA 2R61A 4J0MA 4LF7L 3FPUB 3OIPA 3S9WA 3N44B 2BQ3A 4NW2A 4ILWA 1M0WA 4QWCA 1ML0D 1DCZA 3ITPA 5D1OB 5LMUH 1B50A 4JUZA 3V6JA 5DQGA 4ULLA 2DN8A 2R6GA 4C3JH 4LMYA 5M5YH 4C3JG 3NGDA 4ECVA 3L0OA 3MC0B 2L55A 4HTHA 1N33L 4OO1G 1TWCH 1T94A 3D3RA 4MNOA 4RZRA 1LACA 5ISRA 3HFZB 2JK8A 4B3TH 5J1ZA 4UCUA 1B9MA 4X3KA 4HCEA 2UXDQ 2E2HB 2YZNA 5K2MA 1V1PA 2XC9A 2HCCA 4R4IA 2F52A 1XMOQ 4A93G 4JI6Q 4UCOA 2B39A 3EJIA 1L0WA 3FEWX 2Z0SA 4MTKA 3OW7A 3J7A5 1W6KA 2AHOB 4O0AA 4TQUS 3G48A 2B2VC 4APVA 1TKWB 1Z47A 3I56A 4BA2I 3ERSX 4BY1B 2RSNA 5GROA 3RN5A 4BXXG 4WFN3 1I4XA 4F4ZA 1NNXA 4RB0A 2F0UA 3A5UA 1WTOA 4DUYQ 4JYAL 2F0DA 5BMVF 2XD4A 2FHTA 2WAQG 3BJUA 3RGXA 1RJPA 5KFUA 4KY5A 1PH1A 1NMGA 2M00A 4A3BG 4C2MB 3HKZE 1S9FA 4X3UA 1DXMA 2F0WA 4ED6A 2W6MA 5KT3A 4TSSA 4U7CA 4XQNA 1PH5A 3BJYA 2E2HA 1BR9A 2D0PA 3P20A 4DR5Q 4KHVA 2VNUD 1XMOH 3Q2OA 5IYCH 1STHA 2NZ1D 1A2UA 1BQQT 2XNAC 4JI0L 1I6HB 2R93A 1LTTD 3D8GA 1VQFA 2R8KA 2F0MA 3HOVG 3TSSA 4YHHL 3PW2A 4L6TB 3GTQA 4DK1A 2E2JB 3KALA 4XYLB 2MJ8A 1D2BA 1YBYA 1GVPA 5ELFA 3GTKA 1BF4A 1YHQA 1WVLA 1CS0A 2EJFC 1JIHA 1BCPF 1YHBA 4DV6L 4GKJL 3DUZA 3OHXC 3BZCA 2ATLA 4DV1Q 1B2TA 4O3QA 1ZYRD 1XPOA 4Q8EA 1K1SA 2XGTA 4RB1A 1ZHSA 2IL8A 1GLVA 2RGRA 4LF8Q 4XQQA 1WOCA 1DZ1A 5FOBB 1N32L 4C2MA 2NVYB 4IPDA 4R8NA 3BZKA 4L5QA 3RV3A 1PVOA 5T14A 3CPWA 2VA3A 3MA2B 1TA8A 1NR4A 4LFCL 2HT1A 1GHKA 4X65H 4LFCQ 2JA7G 1CUKA 1IBLH 1JE5A 3DWQA 4TV8F 4ZLTF 5M9OA 2FFKB 2EYOA 4IUNA 1NSNS 5CYUA 2W70A 2VUMA 3K0XA 5KFRA 2UUAQ 4FP5D 1IZ6A 5KG7A 3A0JA 4ZK9B 5LHY1 4IHJF 1HNZL 3R2TA 1PX2A 4A3LH 3I55A 1JKJB 2HVRA 4JK1C 4K14A 3K5OA 3BG3A 2RCFA 4B9WA 3M7NA 4IUPA 4RUCA 1R4QB 5IGBA 1KAAA 4FS1A 5H80A 1NMFA 4P74A 2F0GA 1EEID 3H40A 2PW7A 1FVIA 5M3MB 1K8MA 1EY8A 2NZOA 3KF8B 2DGYA 2YRXA 4BXXH 2RDHA 1A0IA 3D4WA 4DR5L 2JEAI 4G7OC 5A2QW 1EFWA 5KFWA 4EX5A 1BUVT 4ZUIA 2A73B 4H0LC 2LKVA 4JG2A 1K83A 3RV4A 3G6VA 2NU7B 3Q22A 1C0AA 1DM0B 1I4PA 2VQEL 3S24A 1KDAA 5L1LA 1B3QA 1X56A 1SMXA 4X3SA 4IPHA 4MV4A 1MI2A 3TIGA 3KHRA 4KK7A 4X62H 1VQLA 4TV9F 1I94H 2Z8LA 1ZYRC 1JCKB 3GTMH 5JJKA 3CAMA 3CCUA 1CA5A 2MCTA 4C5AA 1Q90A 4IFDJ 1CKOA 3HOWH 2WB1G 1G6PA 1PZKD 2B63B 3VPBA 4M1UB 4A3GB 2RQXA 3NUCA 4XT1B 4IURA 1UNSA 4B9XA 4CJ0B 2I5HA 1T5XD 3VR5A 3J80W 1UE5A 1S4ZA 3HOZH 4IN3A 4QMGA 5EKIA 3CQZA 5CV4A 5DQHA 2B8FA 3MXNA 3WOEA 3ZYYX 2WE6A 5EDWA 3S14H 4IOCA 3U50C 2PZWA 3I4NG 1G2TA 2FK1A 3PW7A 1HR0W 1RKNA 1K9MC 1K1QA 1LYLA 4DV3Q 1X3PA 3STBC 1JQYD 3TP5A 1QZHA 3GIDA 2B2TC 1N33Q 4KN4C 4RZQA 3GV6A 3NTIA 4DK3C 2R8GA 3A8KE 3T51B 3J7ZC 2AGOA 1HNZQ 2RF4A 3JSNA 1ENFA 5DLGA 2ZXOA 3FDSA 1KHIA 2PQEA 1BVSA 4G57A 4DF7A 1AN8A 2KJXA 1BXTA 3C0FB 4IR9A 3PCOB 2F0LA 2PO4A 4KI0A 1PFSA 2QCPX 5M3MH 3RIZA 3H0GB 1RIPA 4JI4H 4FXDA 2ZDGA 2VOBA 4HIMA 1KABA 3T1YL 4FNFA 3S16B 3RLFA 2NVYA 3SXHA 5C1PA 3T56B 5IOCA 3RZDH 1UUPA 4LW1A 4YJ2F 2KEDA 3H3VC 1B6SA 2FB9A 3F2CA 2UXBQ 1M7JA 3TP7A 1PK8A 2B2UA 2YU9B 1XNRH 1VQGA 1LV9A 1S5CD 1VDZA 1FJGQ 4FYDA 3PZPA 3GV3A 4ECRA 4LF6L 4DR3L 1GUGA 3I4NH 4QB4A 1J5EQ 4GZYC 2L0CA 2ZJRA 2K14A 4JBJA 4ECWA 2A68D 2K5WA 1UC9A 1IBLL 1KC7A 4J9NA 3NQTA 2M9VA 1JB7A 2B63H 4A3IB 5D3DA 3GILA 2FK3A 5D14A 1HRJA 1JICA 3HS0C 3TP8A 2OTLA 3VDYA 5J39A 1NCVA 2EDGA 1RF2D 4K5WA 1G291 4LFAQ 3DLLA 2ICIA 3GIMA 3K5LA 3FRPB 2E2IH 1ESFA 2EY1A 4R4OA 5KG0A 1F2LA 1T9HA 5LP6F 2W6ZA 1DONA 3A5ZB 4ABNA 2O5JC 3BG5A 3V05A 4E4TA 4DAYA 4A3KG 4Q8FA 1LLRD 2UVVA 3MFHA 3GDEA 2IWHA 1EWIA 4RHSA 1E1OA 1D1KA 1Y8NB 4CKCA 2G5DA 1I4HA 2KCMA 1KDCA 4C1NK 1GYFA 4LF5L 1EOVA 3K7AB 4LSAA 4EQNA 5BN4A 3S1MB 1J8IA 5D65A 1WCMB 2L9HA 1PTOD 3H0GH 3WOFA 1AN7A 3ICEA 3DM3A 1F9RA 1ZETA 4BY1H 3VPCA 2VUMH 1N56A 3NXWA 3CQZB 1I94L 1HFNA 4NXNQ 4EBCA 1RYRA 5C5LA 4X64L 3J81L 4B3MH 4EBDA 2I87A 1MKHA 1K3RA 2D0OA 5E4WC 1WYDA 1K8OA 4EEQA 1RK5A 1FR3A 1GUTA 3AFQA 4P72A 1VBGA 2C00A 1DYQA 4J9KA 1JXLA 2C2RA 5JVG3 1ET6A 2BA0A 4UP8A 5CC4A 4YCVA 1C8CA 4PZ8A 2QEXA 4C3IH 1B7YB 3GIQA 2KCCA 2HHHQ 5DNFA 1VQ4A 1K8AC 1AZPA 1G91A 2OT2A 2XCAA 3IFTA 5JPNC 5FO9B 5CGKA 1EY7A 1BJTA 3N40P 1IL2A 3MWMA 2K33A 1HUNA 5KYLA 4A93B 1IOWA 2C2EA 3TREA 1BCPC 1XNRL 3R2IA 2C28A 2L15A 1XMQQ 3CCRA 3KAKA 2OXPA 3RJ0A 1TWGB 2BCOA 1KD1C 3KAJA 3KJOA 2A69D 3BABA 4K2KA 4DNRB 3V4ZA 4B3MQ 1HJPA 3RAQA 1N32H 1JE4A 4DV0L 1XJVA 4K5XA 4AYBE 1IBKH 5IGCA 2WP8J 2R82A 3HXLA 2WKCA 1TWHA 3EBEA 1E2ZA 3TN2A 2KOLA 1SROA 4X64H 2E2IB 5FJ8H 4RGMA 3SVMA 1HCZA 1OTCA 3VR3A 2K75A 3RUZA 1RODA 2UVRA 3GIKA 4LF4L 5IYDG 3E5NA 1NR2A 1LTLA 4KHPQ 3GTGA 5K5PA 1EYDA 5C4ZA 4DR4L 1C3OA 1STEA 5CBEE 2W9BB 1F9PA 3GTLB 1XMQH 2K28A 2JA5H 3KBGA 1U4LA 1STBA 1EIFA 1SNCA 3QO2A 1QG7A 3AQQA 3BQ1A 1RDPD 3WO1A 2JN4A 1Z2NX 1CSPA 4LF6Q 2R8HA 5KFBA 4F87A 3MEHA 4LMQD 3OUZA 1EY4A 1WTVA 3Q1KA 2K5NA 4BWSC 3W3AA 4A3DB 2QEJC 2UUCL 1ESRA 4J9RA 4DPGA 1E7ZA 1IBMQ 4IPGA 4J1MA 3PO2G 4MTEA 2A5HA 4C3HG 3NWSA 2UUBL 3CP0A 5CA0F 1ENCA 3UE0A 4RFBA 1QOHA 2LS01 3J81c 5BR8Q 1VQNA 3T1YQ 4X66Q 2WDTA 5IP9G 1CTMA 3U4VA 4A75A 1CQJB 3N8DA 4J9MA 2UXDL 4J9LA 3HOXB 4KHPH 3J7AF 2J4XA 1V51A 3A7AB 3K5IA 1SDFA 4JVZA 2F4IA 3IRBA 3KDFB 3M4QA 3D0FA 4DL6A 5IP7H 3T5KA 1B33N 4DUYH 2FJ2A 3RB3A 1JX4A 1I5FA 1F2MA 4A3MG 2IW3A 1Z7TA 1I6UA 3GTPB 1U0LA 4IPCA 5HURA 1TR5A 2FJZA 4ZOLF 1HZCA 5LMUL 3I73A 4A3CH 4HQ6A 3EROA 3C2PA 1YHAA 4DV4Q 2OTJA 4O2BF 1MZBA 5CORA 1HNXQ 3T5HA 4A3BH 5HY6A 2VPQA 4B08A 4K0KL 2AUKA 4EQ5A 4ED2A 4HSPA 5AJ3L 3G6YA 4K0KQ 1MGSA 2V59A 1O80A 2BDNA 4QUCA 1Y69U 5KT2A 3RLOA 1S5ED 3H20A 4UP7A 4GKKQ 3S15B 2EYFA 2RDFA 1L1OA 5M3FG 3WNZA 1L2ZA 4HSVA 4LUOA 2JA8H 4DV1H 2XIWA 4MN3A 4FF2A 1EQRA 2MFIA 1E24A 2J6SA 1CI3M 3GTPA 2W9AA 1TWFA 4DL2A 4JI2L 3K58A 3F2DA 1HA5A 3QG1A 3EYYA 4L5SA 2R8IA 5KFNA 1A62A 5C44G 4RG1A 3G4SA 5JPMC 1BCPB 5ELEA 4A3GG 1EYAA 2ZM6L 4J9SA 3BDOA 4ZQ3A 1S5BD 5I9PA 3PIPA 2E76C 2XSCA 3OWEB 4DR2Q 2ASDA 3L2PA 2RDGA 4OO1H 1R9TA 3TRZA 4HJ5A 1IHZA 3W1GA 4PZ7A 1RK6A 1EIYB 2W6PA 3VYSA 4IUQA 1VMCA 1QVGA 5JQWA 1T5EA 2AQ1B 1QB5D 3QIAA 1DOLA 1GOZA 2JQOA 4RGTA 2E5LL 4JI4L 4XZ3B 4YWLA 3V6HA 4CDFC 3J80E 3O13A 5EWGA 1BBXC 2NYZD 4MV1A 2E2IA 5FLMH 3KHHA 2FKLA 2NN6G 1I4GA 2SEBD 3FDTA 5EPJA 4R8IA 4IUVA 1LTAD 3Q8QB 1UE7A 1LTGD 1X54A 2K5HA 4KHZA 4R4CA 2ZM6Q 3GTGB 1VQIA 1D1IA 1PRTD 2EXZA 2W6OA 2R3ZA 5LL6X 2W6QA 4Q44A 4R8UA 3IKJA 5IYBG 1JOKA 2K50A 2UXCH 5C4XG 4QWBA 1OO9B 3G7LA 1KJJA 3VMMA 3CCQA 4EQOA 1VQ5A 5KFTA 4DR4Q 1Q1EA 4YIJA 1SYFA 2SDFA 2ENBA 3AFPA 4ALPA 4M9UA 4XX0B 5EAYA 4RGNA 2RHQB 4AYBB 4MA5A 2WIIB 1A15A 2J0TD 4ZKBB 4IALA 1KQSA 1JMCA 4LF9L 1HQRD 1TWGH 4RNMA 5ELCA 4X62L 1PA6A 5A2QL 1SJED 5JJZA 1R9TH 5KFVA 2Z4IA 1KNEA 2A6ED 3MJFA 2PI2E 3MR2A 4H13C 1IBKQ 1SR3A 2C5CA 4Q0YA 2FLLA 1HZAA 4FS2A 1GUOA 1LT5D 3S1MH 2A6EC 5ELOA 1PYBA 1TWHH 5C8YF 1L2FA 2KHSA 4IQZA 1G8ZD 2ZDQA 2OEOA 3PSIA 1I94Q 3C1EA 4AQYL 4DR6L 1WTHA 1QNUA 4CKEA 2FE3A 1M4VA 1PFMA 3MEFA 4ZKCB 4YQWA 1Y8PB 3CCEA 2EYJA 3LP8A 1Z2PX 5KG4A 1EWCA 4NPSA 4RCOA 3A8JE 4V0BA 3I2ZA 4E6IA 2JA8G 4A2AA 5DM63 3HKZB 1CQVA 1OXVA 1ONLA 3IG0A 4AIMA 3G71A 4DK0A 5LA6F 3BDCA 3NENA 5E1FA 1QZGA 1GM5A 2NBFA 2F4VL 4DV6Q 3UDIA 2CW0D 4RKBA 3M9BA 2VUMG 4UCRA 3FHWA 4HIDA 3H4DA 2IX1A 2IPKD 4O2AF 3KHGA 2D2CC 2RHSB 5ELNA 2BDOA 1SYXB 5C5JA 3M3YH 2R6FA 2QDLA 4LK1C 3V2TA 3GTGH 2NVTH 1VQHA 5IODA 3VYRA 1VQCA 4BY7B 2Z6KC 1E4GT 3T1HL 4YWMA 1F9SA 1GUNA 4I7AA 4OHJA 1UWVA 2RDIA 3GQCA 3ZJYC 4DL3A 2NUCA 1KRSA 4DAVA 1TQOA 3M3YB 4GLVB 3E3XA 4LAAA 2W6NA 3IN5A 1AUXA 1TVXA 3FP9A 1EQVA 4FBTA 3E9IA 4B3TQ 5HGQA 1UEBA 3U9SA 1ZKOA 3TIIA 4LFBQ 2RVLA 3U9OA 1I7NA 1Y1VA 3RN2A 2Q2TA 1C4QA 4XIGS 3M85A 4LF9H 3DF7A 4U68A 3GTLH 3RLNA 3RR5A 1PH6A 3HOYG 3TQ1A 2WKDA 4XYOA 1EOTA 4NXMH 4KKSA 1GKHA 1KNAA 3BU2A 1SNQA 4A76A 4WJ3M 5BN3A 1ZHQA 1VCIA 1M6VA 4BBRG 4LF4H 3G6JB 3QOLA 2F0KA 2JA8B 2PMZA 2MPMA 3P7JA 4EGQA 2KCNA 5EOYA 4POFA 5GAEC 4KKTA 5IT9E 2D62A 3ND8A 4N9PA 4DUZL 4JI3Q 2FPIB 3JAMW 1EZ1A 1TXYA 1YJNA 5FO7B 5I6YA 3KHLA 4LF7Q 1LTSD 1IKMA 3SE7A 4DAPA 5KFEA 3PIP3 3L9AX 3HOZG 4LF5H 1EY9A 4BY7G 1S68A 1B70B 1ZXTA 5IGEA 2ASBA 4IRCA 4A3IG 3RB4A 4IZOA 3TS0A 3QZ7A 2HHHL 3BYTB 1E4EB 4BWGB 3OSNA 2N8NA 5HBRB 3GV5B 3TQTA 2WTFA 1PRTB 2CWPA 4IOAA 5EBDA 5C44H 1YITA 2L11A 1C7YA 1TWAH 4M7EA 1XXGA 3GTPH 4GC7A 4JV0A 2RKSA 4ME6A 4TVAB 3KFUA 2HDLA 1A3UA 4TKOB 3V96A 4BA1I 1VAJA 2VQEH 2NVYH 4JI3H 4KV6A 5F2DA 4DV2L 1H9SB 4A3KB 1EYGA 4IRKA 5M3FH 3HKZA 5JVH3 4JI5H 3MZ5A 1UEAB 2UVUA 1GXDC 1VF5C 4C3HB 2JA7B 2D5DA 4WRDA 4KY7A 3PW0A 3OTOH 1N8RC 4JBKA 4BBRB 3KF8A 5IT9W 4DN4M 4G7ZC 4LH6A 1HQMC 3H3VI 2R93H 1AH9A 4KN7C 2MNAA 4A3DH 1K83B 4HEDA 3DWPA 3HOWG 2SOBA 4BBSB 3Q8RB 4PMBA 4TUYF 1SYDA 1IOVA 1SSOA 3TQYA 3CMEA 3V6KA 4GNXC 1BBWA 1F2YA 2VQFQ 4QIWE 5BN5A 1TIID 1WTRA 4H02A 1KJ8A 2EY6A 2R7MA 3MWYW 5CV6A 3Q23A 4A3MH 1Q7YC 1O7IA 1K0SA 4DV0Q 4DV7Q 3J80i 1B1ZA 2H5XA 4DXGA 4B3ML 4I4TF 5IP7G 4DR1H 3DM1A 4RB2C 3RNUA 3PO3G 4UCVA 2AU0A 4JI7H 3GD7A 4HR7A 2E5LH 3GTMA 2JA7A 4RHRA 1CKNB 1HNWQ 3PN1A 1GUWA 5KT5A 1S03G 1WCMG 2NVQB 3NE5B 4JV5Q 2NWGA 2RSOA 1N34Q 4F50A 3MXNB 4OL7A 1I3QH 3I8ZA 1BBUA 3R5HA 3PO2H 3OMCA 4DUZH 4EBEA 3M7GA 2YTXA 2DPIA 2F0HA 2CQAA 3N6RA 5KFYA 3FMAA 1AE2A 2ZT9C 1X32A 4YCUA 1OWTA 2WB1B 1SE8A 4CKBA 2HIXA 1YNNC 2I80A 1YJWA 3WO0A 1TY2A 3URYA 4EGJA 3H0GA 3NWTA 1EUCB 2L12A 3I12A 1L0YB 3UDFA 5KFAA 2HVQA 1TWAB 1W96A 3S15H 4IFDG 1S5DD 3T1YH 4EVOA 3KLSA 3GTOH 2K32A 4DV5L 1BGWA 5C4XB 1V8QA 3CVZA 5EQ0A 2F0TA 4R9WA 1PV4A 3Q8PB 3GV8B 3M4YA 4YY3L 1FNUA 4LUVA 3LNNA 3NHHA 4DGZA 3D4DA 4IWYA 1YNJD 4OO1I 4OXPA 1GSHA 1SRUA 1EL0A 1VQJA 4WJ4A 5ELDA 2BQRA 4O3NA 2YV5A 1S0OA 4RCNA 4ED3A 4A3JH 2BOSA 3H09A 4BBSH 4IFDH 2YU9A 2EE1A 4UP9A 3SDZA 2ES2A 4DV3L 3GTQB 3DHQA 3HKZG 4RNNA 4R4QA 1GHJA 3CF5A 3RBEA 3R23A 1N34L 4P71A 5KGUA 4GNXB 3H15A 1D8LA 2J9GA 1NUCA 5CV8A 5AFWA 3BQ0A 4RWSC 1B9NA 4ECSA 4X65L 3NBIA 4LF4Q 4JOIA 2DNCA 4AQYH 3AEVA 3N43B 1PZID 2A68C 2DJGC 3TEHB 1FNVA 3GTJH 1SFOB 1JJCB 5EWEA 2Z1CA 4I55F 5EBCA 4MTNA 3S14B 5KFPA 2PW5A 1X9NA 2OLSA 4GN4B 4LF7H 1L1OB 4A3KH 4QWDA 4R7RA 2CVRA 4FF3A 4ECUA 3EA6A 4GOPA 2XWBB 4HCSA 2FPGB 2EJMA 2SNMA 4TQSA 4KHPL 3BA9A 5JVDF 4H7BA 3L7ZC 4C56C 3PV0A 4DA2A 2JSOA 1EQQA 2IMWP 5JVLA 2K03A 1EYCA 3SGIA 4IJLA 4LJZC 4QY7A 2R7LA 1H95A 1DGSA 1PTOH 5M5XH 5IE8A 1VMPA 1EU4A 3KUPA 3ORQA 1FJGL 4AQYQ 3LX0A 1SEBD 2K5DA 2JA5B 2R92A 4Y52H 2W7PA 4QW9A 1U9RA 2NU8B 1M1KC 3RTXA 4XYQA 3J81j 3JAME 2JJQA 2DZDA 2YRWA 4O3SA 4ED8A 1J9OA 1FD7D 4A3MB 4UY8C 2QGQA 4HNVA 4DV1L 1PTOB 1BDOA 1HFGA 3OPOA 5IT9L 5I4DA 5M5XB 4MV7A 3FPPA 2JEFA 4GKJQ 1E3PA 4TRDA 3BZDB 2N49A 1V9PA 1Y1VG 2CH4A 4NXNL 4C3HH 4QF4A 2YTVA 4F88A 4NP5A 2R93G 1A63A 4QWEA 3H3VH 4WD3A 4I7ZC 5I9OA 1T3NA 3IL8A 3AB9A 4R8UB 1DV2A 2ZXRA 1XDNA 2VQDA 4LF8H 2B8GA 3OSOA 1X65A 1CHQD 5JOBA 1TWAA 2AWNA 1E2WA 2FMCA 5JJLA 4J9OA 2PN1A 1E2VA 2A19A 2K01A 3E9HA 1XNQQ 1TWHB 3WWVA 2PCFB 2R84A 3MR5A 3KLWA 2MQHA 1N36H 1O7YA 5KG1A 5F9NA 1VQ8A 1VQPA 5C3EH 4QWAA 4BY7H 1SE2A 4AYBA 4CC6A 4K8IA 3K59A 5C3WA 3FKIH 4DV7L 4JC0A 3QOJA 1S10A 1TY0A 1Q1BA 4J9PA 3D31A 4JYAQ 4Q43A 1KJQA 1QCBD 1EFID 1ICFB 1B6RA 4LFAL 1C30A 2KQ3A 5KT7A 2JA5G 3FKIB 3S1QH 1JT8A 2E75C 2EVBA 4AYBG 2YS7A 1UNNC 1X3GA 2W9BA 2EOTA 4UDUC 1YNXA 1BKBA 5A2QE 2XCPA 2RGVA 3OW2A 3T1HQ 2VUGA 2JA6A 2AQ2B 2NTSA 3S1NH 4X6AH 4YBZB 1ILPA 1CKMA 1S0MA 3X3MA 1EYZA 2W7OA 1G51A 1SEIA 1ASZA 1YVCA 4UFZA 4TQRA 4DV2H 2OQKA 1V1OA 3I90A 1GGOA 4HNTA 5EJWA 3CW2C 3ERQA 4ZCKA 2O2LD 2RDJA 5KYIA 3F8NA 3BYYB 1X6OA 1TU2B 2L4NA 1RHPA 2KVMA 4KD3A 2UXBL 3KDFA 4X65Q 1XYIA 2DLNA 5KNCA 1SFOA 4PV1C 4O4HF 3B6YA 3G6EA 3TS2A 2XCLA 5T1GA 2HUGA 2CQOA 1JR0D 3DEPA 3HOUG 2YCHA 2UXDH 1XTDA 3I4LA 3QFFA 4JI6H 4DR6H 4QIWB 2E74C 4HJ8A 4HJAA 2N55A 1NJIC 3RUPA 2JA6B 2V5AA 2OCEA 3PO3H 1PTOF 5KNBA 1HXYD 1JWUD 3T53B 4JCVE 3S1RH 1M90C 1KAWA 1KDBA 3SE0A 4CC5A 1I50A 1B04A 3M9OB 3IFDA 4ME3A 4IAJA 3SR1A 3UDXA 5KFZA 5JEAH 1SNDA 4JI8Q 3S2DB 2IJ0A 4XQJA 1B44D 2Y0SE 5EGTA 1WTXA 5KFXA 1WD0A 4YY3Q 1I3QB 2BQUA 1TS2A 1GUSA 2I46A 4X64Q 4XTCS 2NB0A 5M5WH 1RD9D 4P2CB 2NVQH 2FXQA 1DOKA 2F3VA 1HH2P 2B2WC 2ALZA 4X3TA 1Q82C 2V4RA 1W3SA 1XTCD 4YHHQ 5LMNL 2V4QA 1JJGA 5KIXA 3EQLC 3CKIB 2MGSA 4OWTB 1YIJA 2VY3A 3PW5A 2LSSA 1UC8A 2WB1E 2NVTB 2R7FA 2IY5B 1DJRD 5KG5A 1KC8C 3OMGA 1EEFD 1EZ8A 2VA2A 3FMCA 1R9TB 3S1QB 4DK6C 2HGSA 4RAZA 3ORRA 4G4KA 2VL6A 1I6VC 3SK5A 1ICWA 5C3XA 5J2TF 4B3TL 2GPWA 4JI8H 1TWFB 4A3BB 1WCMA 4MV8A 5KKNB 2Q8IB 5KFKA 2VQFL 2WAQB 1PH2A 3A74A 3MFYA 1B8AA 5BPFA 3ULJA 4JI0Q 2H1EA 5CV7A 1ASYA 1IYUA 4F7XA 5KFCA 2EPBA 1LO5D 2PYKA 3EPIA 1ILQA 4GOPC 1TT2A 1X55A 4QQBX 1D6EC 3H4BA 1IL8A 3BVGA 5T1IA 2PPBC 5IYZF 1QVCA 4CJ1B 1RL2A 1J5EH 2HD3A 3CCLA 1FGUA 1IBML 3E0JA 3MWDA 4G7HC 2PQAA 1ENAA 1IBLQ 2UUCQ 2KSWA 1TWGA 2DWCA 3SI8A 4Q0FA 1S72A 4FXKC 1VKZA 1Q8KA 3K7AH 3QWNA 4PWQA 3HG9A 3I7FA 1VQEA 3UQ8A 3JSLA 2JA6H 4FO2A 1E22A 5C3EB 1SCUB 2HDMA 2E2HH 2L1BA 1MBYA 3T5LA 1EY0A 4GLXA 4HAEA 3QB3A 5DAUA 3KF6A 2XRQD 5KFQA 4GN5A 1CHPD 1FNWA 4HMJA 4UCSA 3BS1A 3NBHB 4JI4Q 2CFMA 2HJWA 2CQYA 2EYPA 4JBMA 4JI0H 4BS9A 2UUAL 3CCSA 3LWEA 5KT4A 2VR1A 2C2DA 1DOMA 2FLPA 4NMZA 5KNDA 2YTYA 1YEZA 4L5RC 2GN5A 1C48A 5KFSA 2BH2A 2CH4W 4QJFA 3CC4A 3VYTA 3GV7B 3CRKC 1VQAA 5M5WB 4O3OA 4JI5Q 4L63B 3N41B 2X0SA 3GTLA 3FKIG 4Z9CB 3OTOQ 3OWFA 1Y1VH 3PUZA 4A93H 3AMUA 2F0FA 2M2LA 2V58A 1PRTC 1QNKA 1AE3A 1EUJA 4DR1Q 2NVXB 3PVXA 3J7YW 5JEAJ 3ULLA 4DR4H 3Q6SA 1KBLA 4QIWA 1LTBD 1CM9A 4ETSA 3I4MH 2IHEA 4RKLA 5LOVF 3OYYA 1PFNA 4HIKA 3S17B 4DR7Q 4R4TA 1TWCA 2Y0SA 4K8JA 3MFIA 1IW7D 2VW9A 3HEJA 4OWXB 1QE6A 2A1AA 4YR2A 2FLNA 2AUJD 3C3LA 4JI5L 3J7AK 3EFXD 3JRXA 4EYIB 2FMAA 3RB0A 2DIKA 2F0EA 2C35B 1ULZA 4PDBA 3HGBA 4RH6A 2PNRC 1HTLD 4KKUA 1CA6A 3T5JA 5CBAE 3PR4A 3DXJC 4JI7Q 1CK1A 4ZUJA 5GAGC 3PUVA 2R93B 4EYHB 3GIPA 4FF1A 4FDBA 4KLKA 3KBXA 4YAKB 1RJTA 5LYJF 1E0BA 1U5KA 4U6PA 3MR3A 1MHWC 3M9NB 3GLKA 2D9UA 1SFOH 4Q5VA 4RGOS 2TSSA 3M4PA 2AKWB 1PMRA 2EYMA 2IX0A 2CKZB 2VB3X 5EZYF 3S16H 2QW7A 3E0EA 1Y1WB 4NXNH 2K04A 4A3LG 4OIKA 2IBKA 4OEMB 2I07B 4DV6H 2KECA 4LFBL 5IIFA 3VPDA 5FLXL 2JE6I 4B3RH 5IP9H 3N42B 4RU9A 4PNYA 1NTGA 3TBIB 4OX9H 4DFAA 3MHBA 4MIUA 5E3FA 1A3VA 1HR0L 4JW0A 1DIKA 2PI2A 1HTPA 4DV7H 3NK9A 1SN8A 4DNIA 3CC2A 3ER0A 3W2DA 1WJJA 3UFXB 4KJNA 4F4YA
chains in the Genus database with same CATH topology
1EWIA 1E1OA 1Y14B 2E5LQ 1E1TA 3RNUA 3PO3G 1V43A 1VQDA 3GD7A 2KCMA 2B29A 4NXML 1CKNB 3U4ZA 4LF5L 1HNWQ 1EOVA 1WCMG 1K0RA 4JV5Q 1N34Q 2R92G 3MXNB 4LNQA 1VQ7A 1I3QH 1OXUA 1BBUA 3I4OA 5E7NA 3J81i 3H0GH 4LUZA 3PO2H 4JOIC 3ICEA 3DM3A 2YTXA 4B3SQ 4BY1H 4DV5Q 2VUMH 4YCWA 1I94L 2LXJA 2K5VA 1UE1A 4NXNQ 1AE2A 4YCUA 4X64L 1PHJA 1SE8A 2EIFA 1MKHA 1K3RA 2D0OA 2HIXA 1WYDA 1YJWA 4IFDI 2KCTA 4P72A 3AFQA 1QUQA 3UDFA 1TWFH 1KXLA 1KL9A 2BA0A 4UP8A 4YCVA 2AMCB 3LGJA 3S15H 4A3FG 4GKKL 1WCMH 4PZ8A 4IFDG 2QEXA 4C3IH 1B7YB 2HHHQ 2OQ0A 3NEMA 1VQ4A 2WFWA 1K8AC 2Y0SG 3GTOH 2CCZA 3CC7A 4DV5L 4A3DG 2WAQE 1KIXA 5C4JH 1JJ2A 1IL2A 2HIVA 1PV4A 3TREA 2K4KA 3H0GG 1XNRL 1XPUA 2UXCL 2L15A 1OXXK 4OWWB 2BA1A 5BR8L 1XMQQ 3CCRA 1VQ9A 4YY3L 4LF8L 1Q86C 3S2DH 4LUVA 1KD1C 1Y1WH 3KJOA 4JI3L 4OO1I 4OXPA 4DR1L 5J3BA 1SRUA 1VQJA 1VQBA 4WJ4A 4B3MQ 1HJPA 2MO0A 2HQLA 4R1JA 2YV5A 4DV0L 1XJVA 4AYBE 1QVFA 2IHFA 4A3JH 4BBSH 2WP8J 3JC66 1QUQB 4UP9A 4DUYL 2YYZA 2ZJQA 4C2MH 3EBEA 2ES2A 4DV3L 4B3RL 1SROA 3CPFA 5JEAG 4GLAC 3HKZG 4A4IA 5FJ8H 4P73A 4R4QA 1OTCA 3CF5A 1D7QA 1N34L 2K75A 4P71A 4JV5L 2B3GA 4P75A 3H15A 1D8LA 4GNXB 1PH3A 4LF4L 5IYDG 4JI1L 1LTLA 4YWKA 4KHPQ 1IXRA 5GAHC 4DR4L 4OONA 1UE6A 4X65L 1YI2A 2QA4A 4LF4Q 4JOIA 1NY4A 1Q12A 1PH8A 1Y1WG 3AEVA 2JA5H 1VQKA 4PZ6A 4HJ9A 4L5TA 1EIFA 3TEHB 3AQQA 3GTJH 4RMFA 1JJCB 1HR0Q 1CSPA 4LF6Q 4MTNA 2JA7H 2LXKA 1X9NA 4POGA 4GN4B 3KOJA 2K5NA 4JI2Q 1Q46A 3PUWA 1L1OB 3F2BA 4MZ9A 1CSQA 2UUCL 4A3KH 2N78A 3ULPA 4A3IH 3PF5A 4DPGA 1E7ZA 1IBMQ 3CXCA 1YJ9A 4IPGA 4A3EG 3PO2G 4GOPA 1N9WA 1CKNA 3K80C 2B63G 4JI7L 4BBRH 5IY0A 2UUBL 2GVAA 2Q2UA 3CP0A 4KHPL 1OXSC 4JI1Q 3UE0A 3L7ZC 4PG3A 3PV0A 3J81c 1EQQA 1XMOL 5BR8Q 1VQNA 3T1YQ 4X66Q 5IP9G 3U4VA 4A75A 3SGIA 2PNHA 1K83H 4NB3A 3K7UC 2I0QA 2UXCQ 5IWAQ 4IJLA 2UXDL 4QY7A 1H95A 1DGSA 5M5XH 5LMNQ 5AJ3Q 4DR3Q 3M4QA 3IRBA 3KDFB 5IE8A 3D0FA 5IP7H 3Q8DA 4DV2Q 2KHIA 4AQYQ 1FJGL 2IT1A 2PQAB 3GO5A 3JAMi 4Y52H 2ALYB 2R7ZH 1I5FA 5C0XG 1M1KC 2I5LX 1LUZA 3CCMA 4A3MG 3J81j 2JJQA 3CD6A 2CWAA 1U0LA 2UU9L 4HIOA 4IPCA 4UY8C 2QGQA 1HZCA 5LMUL 4DV1L 5FLMG 4A3CH 4A93G 1IBKL 5GADC 2UU9Q 2A8VA 4A3GH 2F3IA 1WFQA 2NZHA 3KF6B 3HOXH 5JJLA 4GKJQ 1E3PA 1NE3A 1YHAA 3OTOL 4DV4Q 3F8TA 2N49A 3CQZH 1PH9A 2OTJA 1V9PA 1HNXQ 1Y1VG 4A3BH 4NXNL 4C3HH 2YTVA 5HY6A 2R93G 1A63A 4K0KL 1MJEA 4A3EH 4EQ5A 2VZAA 3H3VH 3AYHB 3UE1A 5AJ3L 4DR6Q 4K0KQ 2Q2HA 5IWAL 5FLXc 1X65A 4O2DA 4DR7L 3RLOA 2AWNA 3K8AA 4X66L 1N32Q 1X3FA 1X3EA 4UP7A 3UDGA 1N36Q 2NVXH 4GKKQ 2A19A 4LF7L 3E9HA 1XNQQ 1L1OA 5M3FG 3WWVA 3PIOA 3KLWA 2MQHA 1Q81C 4LUOA 1VQ8A 2JA8H 1VQPA 5C3EH 1EQRA 1J6QA 2R6GA 4C3JH 4BY7H 5M5YH 2MFIA 1E24A 4DV7L 3FKIH 4JC0A 4DAMA 4JI2L 3L0OA 3F2DA 1Q1BA 4X62Q 4L5SA 4DAYB 2JA9A 3D31A 1A62A 5C44G 4RG1A 3G4SA 1N33L 1TWCH 4A3GG 4JYAQ 2ZM6L 4MNOA 3KJPA 4OO1G 1P8LA 3HFZB 2JK8A 3PIPA 4DR2Q 3L2PA 2UXDQ 4LFAL 3TRZA 3M4OH 4R4IA 2F52A 4HJ5A 3W1GA 4PZ7A 1XMOQ 4DKAC 1EIYB 2JA5G 4JI6Q 2K52A 3S1QH 1L0WA 1QVGA 2YU9H 2R7ZG 4AYBG 1JT8A 2Z0SA 1X3GA 5LMNW 3HKSA 4JI4L 1YNXA 1BKBA 2JQOA 4JBWA 4Y7NH 2E5LL 4YWLA 3J7A5 3RZOH 2AHOB 3OW2A 4O0AA 3T1HQ 4TQUS 3G48A 3S1NH 4X6AH 4APVA 1CKMA 5FLMH 4A3CG 2BH8A 1Z47A 2NN6G 3I56A 4BA2I 3ERSX 4BXXG 3RN5A 5GROA 1G51A 4A3FH 1YVCA 1ASZA 1UE7A 1X54A 2OQKA 2K5HA 4KHZA 4R4CA 3A5UA 2ZM6Q 4DUYQ 1VQIA 4JYAL 3CW2C 3BJUA 2WAQG 5IYBG 2NN6I 2K50A 1PH1A 2F4VQ 1NMGA 1X6OA 4A3BG 5C4XG 3HKZE 5C0XJ 2UXBL 3KDFA 3CCQA 1VQ5A 1KRTA 4X65Q 4DR4Q 3STBD 5K36G 2ID0A 3B6YA 3G6EA 1Q1EA 1PH5A 2GVBA 3GTKH 3TS2A 4BY1G 2V1CC 2I5MX 2CQOA 3AFPA 2D0PA 4ALPA 4DR5Q 4JI6L 1XNQL 2VNUD 3HOUG 5IYCH 5EAYA 4JI0L 1XTDA 2RHQB 1VQFA 1J5EL 3HOVG 2DUDA 1PH7A 4YHHL 1KQSA 4LF9L 1JMCA 1TWGH 4OX9L 3PUYA 3J80c 4HJ8A 4HJAA 1NJIC 3S17H 1YBYA 1GVPA 4X62L 2OCEA 3PUXA 1YHQA 1PA6A 3PO3H 1R9TH 1M90C 3S1RH 4JCVE 1KAWA 1YHBA 4DV6L 4GKJL 2PI2E 1FL0A 5C4XH 3BZCA 1IBKQ 4ME3A 1SR3A 5LMUQ 4DV1Q 1XPOA 2E8GA 1HZAA 3UDXA 4JI8Q 2XGTA 2Y0SE 1SLJA 2R92H 4YY3Q 4LF8Q 3S1MH 1WOCA 1N36L 1XMQL 5ELOA 2XTIA 1PYBA 4X64Q 1TWHH 4XTCS 1N32L 1HZ9A 1L2FA 4IPDA 3BZKA 1XNRQ 5M5WH 4L5QA 1PH4A 2NVQH 3PF4A 2FXQA 1PVOA 3CPWA 3PSIA 3U58A 1I94Q 2OWOA 4LFCL 4AQYL 2HT1A 4DR6L 1HH2P 3MEFA 1Q82C 1W3SA 3K81C 4YHHQ 4LFCQ 5LMNL 1CUKA 2JA7G 1JE5A 2PMZE 2ZJPA 3CCEA 1JJGA 1LM0A 3HOVH 4NPSA 4OWTB 1YIJA 2VY3A 1I50H 2LSSA 3I2ZA 3EIVA 3K0XA 2JA8G 2UUAQ 2WB1E 4LF5Q 1HNWL 2R7FA 2IY5B 1GD7A 1IZ6A 1OXVA 2MO1A 1KC8C 4AIMA 3G71A 3A0JA 4DK6C 2EQSA 1L1OC 1GM5A 3NENA 1QZGA 1IYJB 3NELA 4HJ7A 5DLQE 1HNZL 2F4VL 4DV6Q 3UDIA 1MIUA 2VL6A 4A3LH 3I55A 3W1BA 3M9BA 2VUMG 3FHWA 3M7NA 4HIDA 4B3TL 4PMWA 2IX1A 1W2BA 1S3OA 4B3SL 2RHSB 1NMFA 5ELNA 2EXDA 4P74A 2VQFL 3M3YH 2KBNA 1PH2A 3A74A 4GN3B 1FVIA 1B8AA 3ULJA 4JI0Q 2NZOA 2NVTH 1VQHA 3KF8B 2DGYA 1ASYA 3GTGH 4BXXH 1A0IA 4LWCA 1VQCA 2RCNA 2Z6KC 4DR5L 4GOPC 3T1HL 4YWMA 1X55A 2VQEQ 4EX5A 1EFWA 2JEAI 4QQBX 1S40A 4JG2A 1QVCA 1RL2A 1UWVA 1MJCA 4QL5A 3ZJYC 1C0AA 2VQEL 3S24A 1FGUA 5IYBH 1IBML 3CCLA 1KRSA 1X56A 2PQAA 1SMXA 2Z6KA 1IBLQ 2UUCQ 5C3EG 1S72A 4IPHA 4GLVB 1Q8KA 3K7AH 3I7FA 1VQEA 1VQLA 2JA6H 1E22A 4UPAA 3FP9A 2E2HH 2VS1A 3W5OA 3GTMH 5JJKA 3CAMA 3E9IA 3CCUA 4B3TQ 5HGQA 4IFDJ 1CKOA 1UEBA 4GLXA 1K73C 3HOWH 2WB1G 1C9OA 1G6PA 3KF6A 4LFBQ 3RN2A 4GN5A 2Q2TA 2ZTCA 1HZBA 1A8VA 4XIGS 3M85A 2I5HA 3NBHB 4JI4Q 1UE5A 2CFMA 3CMAA 2AWOA 3HOZH 3GTLH 3RLNA 3RR5A 2JEBI 4JBMA 1PH6A 2UUAL 3HOYG 3CCSA 3S14H 2YTYA 1YEZA 4L5RC 4IOCA 2GN5A 3U50C 3I4NG 2BH2A 1GKHA 1HR0W 1WI5A 4QJFA 1K9MC 3CC4A 1LYLA 1Z9FA 4B3RQ 4DV3Q 1VQAA 3BU2A 3STBC 4A76A 4JI5Q 1QZHA 4WJ3M 1N33Q 1VCIA 4BBRG 3FKIG 4DK3C 5C0XI 1HNXL 3J7ZC 3OTOQ 4DV4L 4A3JG 1Y1VH 3PUZA 1HNZQ 4J15A 4POFA 2RF4A 5GAEC 3JAMc 4A93H 3HOUH 1PYSB 1AE3A 1EUJA 1I6HH 4DR1Q 4DUZQ 4GNXA 3KYHC 5JEAJ 2D62A 3ULLA 4JI3Q 4DUZL 1KHIA 1GO3E 1YZ6A 3CCVA 1BVSA 1TXYA 1YJNA 4LF7Q 3I4MH 2IHEA 1K8GA 3OYYA 4HIKA 4DR7Q 4R4TA 3PCOB 2VW9A 4GOPB 4KI0A 1PFSA 4OWXB 3HOZG 2A1AA 4BY7G 4OX9Q 1B70B 4JI5L 4BBSG 5M3MH 4LF9Q 2ASBA 1RIPA 4A3IG 3TS0A 2N3SA 2HHHL 2C35B 4HIMA 5IYDH 3T1YL 2Q2IA 2N8NA 3GTQH 3RLFA 1OXTA 4NXMQ 2CWPA 4IJHA 2JA6G 5C44H 1YITA 3RZDH 4IOAA 4JI8L 5FJ8G 1TWAH 4LW1A 1C7YA 4JI7Q 3GTPH 5GAGC 4GS3A 1V1QA 3F2CA 4TVAB 2UXBQ 3PUVA 3KFUA 3S2HH 1XPRA 4FDBA 4KLKA 3CCJA 1VQOA 2ATWA 4BA1I 1VQGA 2NVYH 1U5KA 4DV2L 1EYGA 1FJGQ 5JJIA 3I4MG 5M3FH 3EN2A 4LF6L 4DR3L 3PGZA 3I4NH 2ZTDA 1J5EQ 2ZJRA 2K14A 5IT9c 4JBJA 1SFOH 3HOYH 1N8RC 1IBLL 4JBKA 3M4PA 5M3MG 2AKWB 1JB7A 1NBWA 2IX0A 2B63H 2CKZB 2UUBQ 3S16H 3H3VI 2R93H 4AH6A 1AH9A 3E0EA 1P16A 2MNAA 2OTLA 4A3LG 2KENA 3VDYA 4A3DH 3HOWG 2ZTEA 3HOXG 4LFBL 2KHJA 4QGUA 1G291 4LFAQ 3DLLA 2JE6I 3TQYA 3CMEA 4DR2L 4GNXC 1BBWA 5IP9H 2VQFQ 4QIWE 1NTGA 2E2IH 1VS0A 4H02A 5GQOA 4R4OA 5H1SE 1T9HA 1HR0L 3A5ZB 4A3MH 2PI2A 5IYCG 2R7DA 1Q7YC 1O7IA 2E2JH 1SN8A 3F1ZA 4DNIA 4DV0Q 3CC2A 1VQMA 4DV7Q 3ER0A 2H5XA 4B3ML 1WJJA 4A3KG 5IP7G 4IO9A 1VQ6A 3J80i 3GDEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EWI A;  1E1O A;  1Y14 B;  2E5L Q;  1E1T A;  3RNU A;  3PO3 G;  1V43 A;  1VQD A;  3GD7 A;  2KCM A;  2B29 A;  4NXM L;  1CKN B;  3U4Z A;  4LF5 L;  1HNW Q;  1EOV A;  1WCM G;  1K0R A;  4JV5 Q;  1N34 Q;  2R92 G;  3MXN B;  4LNQ A;  1VQ7 A;  1I3Q H;  1OXU A;  1BBU A;  3I4O A;  5E7N A;  3J81 i;  3H0G H;  4LUZ A;  3PO2 H;  4JOI C;  3ICE A;  3DM3 A;  2YTX A;  4B3S Q;  4BY1 H;  4DV5 Q;  2VUM H;  4YCW A;  1I94 L;  2LXJ A;  2K5V A;  1UE1 A;  4NXN Q;  1AE2 A;  4YCU A;  4X64 L;  1PHJ A;  1SE8 A;  2EIF A;  1MKH A;  1K3R A;  2D0O A;  2HIX A;  1WYD A;  1YJW A;  4IFD I;  2KCT A;  4P72 A;  3AFQ A;  1QUQ A;  3UDF A;  1TWF H;  1KXL A;  1KL9 A;  2BA0 A;  4UP8 A;  4YCV A;  2AMC B;  3LGJ A;  3S15 H;  4A3F G;  4GKK L;  1WCM H;  4PZ8 A;  4IFD G;  2QEX A;  4C3I H;  1B7Y B;  2HHH Q;  2OQ0 A;  3NEM A;  1VQ4 A;  2WFW A;  1K8A C;  2Y0S G;  3GTO H;  2CCZ A;  3CC7 A;  4DV5 L;  4A3D G;  2WAQ E;  1KIX A;  5C4J H;  1JJ2 A;  1IL2 A;  2HIV A;  1PV4 A;  3TRE A;  2K4K A;  3H0G G;  1XNR L;  1XPU A;  2UXC L;  2L15 A;  1OXX K;  4OWW B;  2BA1 A;  5BR8 L;  1XMQ Q;  3CCR A;  1VQ9 A;  4YY3 L;  4LF8 L;  1Q86 C;  3S2D H;  4LUV A;  1KD1 C;  1Y1W H;  3KJO A;  4JI3 L;  4OO1 I;  4OXP A;  4DR1 L;  5J3B A;  1SRU A;  1VQJ A;  1VQB A;  4WJ4 A;  4B3M Q;  1HJP A;  2MO0 A;  2HQL A;  4R1J A;  2YV5 A;  4DV0 L;  1XJV A;  4AYB E;  1QVF A;  2IHF A;  4A3J H;  4BBS H;  2WP8 J;  3JC6 6;  1QUQ B;  4UP9 A;  4DUY L;  2YYZ A;  2ZJQ A;  4C2M H;  3EBE A;  2ES2 A;  4DV3 L;  4B3R L;  1SRO A;  3CPF A;  5JEA G;  4GLA C;  3HKZ G;  4A4I A;  5FJ8 H;  4P73 A;  4R4Q A;  1OTC A;  3CF5 A;  1D7Q A;  1N34 L;  2K75 A;  4P71 A;  4JV5 L;  2B3G A;  4P75 A;  3H15 A;  1D8L A;  4GNX B;  1PH3 A;  4LF4 L;  5IYD G;  4JI1 L;  1LTL A;  4YWK A;  4KHP Q;  1IXR A;  5GAH C;  4DR4 L;  4OON A;  1UE6 A;  4X65 L;  1YI2 A;  2QA4 A;  4LF4 Q;  4JOI A;  1NY4 A;  1Q12 A;  1PH8 A;  1Y1W G;  3AEV A;  2JA5 H;  1VQK A;  4PZ6 A;  4HJ9 A;  4L5T A;  1EIF A;  3TEH B;  3AQQ A;  3GTJ H;  4RMF A;  1JJC B;  1HR0 Q;  1CSP A;  4LF6 Q;  4MTN A;  2JA7 H;  2LXK A;  1X9N A;  4POG A;  4GN4 B;  3KOJ A;  2K5N A;  4JI2 Q;  1Q46 A;  3PUW A;  1L1O B;  3F2B A;  4MZ9 A;  1CSQ A;  2UUC L;  4A3K H;  2N78 A;  3ULP A;  4A3I H;  3PF5 A;  4DPG A;  1E7Z A;  1IBM Q;  3CXC A;  1YJ9 A;  4IPG A;  4A3E G;  3PO2 G;  4GOP A;  1N9W A;  1CKN A;  3K80 C;  2B63 G;  4JI7 L;  4BBR H;  5IY0 A;  2UUB L;  2GVA A;  2Q2U A;  3CP0 A;  4KHP L;  1OXS C;  4JI1 Q;  3UE0 A;  3L7Z C;  4PG3 A;  3PV0 A;  3J81 c;  1EQQ A;  1XMO L;  5BR8 Q;  1VQN A;  3T1Y Q;  4X66 Q;  5IP9 G;  3U4V A;  4A75 A;  3SGI A;  2PNH A;  1K83 H;  4NB3 A;  3K7U C;  2I0Q A;  2UXC Q;  5IWA Q;  4IJL A;  2UXD L;  4QY7 A;  1H95 A;  1DGS A;  5M5X H;  5LMN Q;  5AJ3 Q;  4DR3 Q;  3M4Q A;  3IRB A;  3KDF B;  5IE8 A;  3D0F A;  5IP7 H;  3Q8D A;  4DV2 Q;  2KHI A;  4AQY Q;  1FJG L;  2IT1 A;  2PQA B;  3GO5 A;  3JAM i;  4Y52 H;  2ALY B;  2R7Z H;  1I5F A;  5C0X G;  1M1K C;  2I5L X;  1LUZ A;  3CCM A;  4A3M G;  3J81 j;  2JJQ A;  3CD6 A;  2CWA A;  1U0L A;  2UU9 L;  4HIO A;  4IPC A;  4UY8 C;  2QGQ A;  1HZC A;  5LMU L;  4DV1 L;  5FLM G;  4A3C H;  4A93 G;  1IBK L;  5GAD C;  2UU9 Q;  2A8V A;  4A3G H;  2F3I A;  1WFQ A;  2NZH A;  3KF6 B;  3HOX H;  5JJL A;  4GKJ Q;  1E3P A;  1NE3 A;  1YHA A;  3OTO L;  4DV4 Q;  3F8T A;  2N49 A;  3CQZ H;  1PH9 A;  2OTJ A;  1V9P A;  1HNX Q;  1Y1V G;  4A3B H;  4NXN L;  4C3H H;  2YTV A;  5HY6 A;  2R93 G;  1A63 A;  4K0K L;  1MJE A;  4A3E H;  4EQ5 A;  2VZA A;  3H3V H;  3AYH B;  3UE1 A;  5AJ3 L;  4DR6 Q;  4K0K Q;  2Q2H A;  5IWA L;  5FLX c;  1X65 A;  4O2D A;  4DR7 L;  3RLO A;  2AWN A;  3K8A A;  4X66 L;  1N32 Q;  1X3F A;  1X3E A;  4UP7 A;  3UDG A;  1N36 Q;  2NVX H;  4GKK Q;  2A19 A;  4LF7 L;  3E9H A;  1XNQ Q;  1L1O A;  5M3F G;  3WWV A;  3PIO A;  3KLW A;  2MQH A;  1Q81 C;  4LUO A;  1VQ8 A;  2JA8 H;  1VQP A;  5C3E H;  1EQR A;  1J6Q A;  2R6G A;  4C3J H;  4BY7 H;  5M5Y H;  2MFI A;  1E24 A;  4DV7 L;  3FKI H;  4JC0 A;  4DAM A;  4JI2 L;  3L0O A;  3F2D A;  1Q1B A;  4X62 Q;  4L5S A;  4DAY B;  2JA9 A;  3D31 A;  1A62 A;  5C44 G;  4RG1 A;  3G4S A;  1N33 L;  1TWC H;  4A3G G;  4JYA Q;  2ZM6 L;  4MNO A;  3KJP A;  4OO1 G;  1P8L A;  3HFZ B;  2JK8 A;  3PIP A;  4DR2 Q;  3L2P A;  2UXD Q;  4LFA L;  3TRZ A;  3M4O H;  4R4I A;  2F52 A;  4HJ5 A;  3W1G A;  4PZ7 A;  1XMO Q;  4DKA C;  1EIY B;  2JA5 G;  4JI6 Q;  2K52 A;  3S1Q H;  1L0W A;  1QVG A;  2YU9 H;  2R7Z G;  4AYB G;  1JT8 A;  2Z0S A;  1X3G A;  5LMN W;  3HKS A;  4JI4 L;  1YNX A;  1BKB A;  2JQO A;  4JBW A;  4Y7N H;  2E5L L;  4YWL A;  3J7A 5;  3RZO H;  2AHO B;  3OW2 A;  4O0A A;  3T1H Q;  4TQU S;  3G48 A;  3S1N H;  4X6A H;  4APV A;  1CKM A;  5FLM H;  4A3C G;  2BH8 A;  1Z47 A;  2NN6 G;  3I56 A;  4BA2 I;  3ERS X;  4BXX G;  3RN5 A;  5GRO A;  1G51 A;  4A3F H;  1YVC A;  1ASZ A;  1UE7 A;  1X54 A;  2OQK A;  2K5H A;  4KHZ A;  4R4C A;  3A5U A;  2ZM6 Q;  4DUY Q;  1VQI A;  4JYA L;  3CW2 C;  3BJU A;  2WAQ G;  5IYB G;  2NN6 I;  2K50 A;  1PH1 A;  2F4V Q;  1NMG A;  1X6O A;  4A3B G;  5C4X G;  3HKZ E;  5C0X J;  2UXB L;  3KDF A;  3CCQ A;  1VQ5 A;  1KRT A;  4X65 Q;  4DR4 Q;  3STB D;  5K36 G;  2ID0 A;  3B6Y A;  3G6E A;  1Q1E A;  1PH5 A;  2GVB A;  3GTK H;  3TS2 A;  4BY1 G;  2V1C C;  2I5M X;  2CQO A;  3AFP A;  2D0P A;  4ALP A;  4DR5 Q;  4JI6 L;  1XNQ L;  2VNU D;  3HOU G;  5IYC H;  5EAY A;  4JI0 L;  1XTD A;  2RHQ B;  1VQF A;  1J5E L;  3HOV G;  2DUD A;  1PH7 A;  4YHH L;  1KQS A;  4LF9 L;  1JMC A;  1TWG H;  4OX9 L;  3PUY A;  3J80 c;  4HJ8 A;  4HJA A;  1NJI C;  3S17 H;  1YBY A;  1GVP A;  4X62 L;  2OCE A;  3PUX A;  1YHQ A;  1PA6 A;  3PO3 H;  1R9T H;  1M90 C;  3S1R H;  4JCV E;  1KAW A;  1YHB A;  4DV6 L;  4GKJ L;  2PI2 E;  1FL0 A;  5C4X H;  3BZC A;  1IBK Q;  4ME3 A;  1SR3 A;  5LMU Q;  4DV1 Q;  1XPO A;  2E8G A;  1HZA A;  3UDX A;  4JI8 Q;  2XGT A;  2Y0S E;  1SLJ A;  2R92 H;  4YY3 Q;  4LF8 Q;  3S1M H;  1WOC A;  1N36 L;  1XMQ L;  5ELO A;  2XTI A;  1PYB A;  4X64 Q;  1TWH H;  4XTC S;  1N32 L;  1HZ9 A;  1L2F A;  4IPD A;  3BZK A;  1XNR Q;  5M5W H;  4L5Q A;  1PH4 A;  2NVQ H;  3PF4 A;  2FXQ A;  1PVO A;  3CPW A;  3PSI A;  3U58 A;  1I94 Q;  2OWO A;  4LFC L;  4AQY L;  2HT1 A;  4DR6 L;  1HH2 P;  3MEF A;  1Q82 C;  1W3S A;  3K81 C;  4YHH Q;  4LFC Q;  5LMN L;  1CUK A;  2JA7 G;  1JE5 A;  2PMZ E;  2ZJP A;  3CCE A;  1JJG A;  1LM0 A;  3HOV H;  4NPS A;  4OWT B;  1YIJ A;  2VY3 A;  1I50 H;  2LSS A;  3I2Z A;  3EIV A;  3K0X A;  2JA8 G;  2UUA Q;  2WB1 E;  4LF5 Q;  1HNW L;  2R7F A;  2IY5 B;  1GD7 A;  1IZ6 A;  1OXV A;  2MO1 A;  1KC8 C;  4AIM A;  3G71 A;  3A0J A;  4DK6 C;  2EQS A;  1L1O C;  1GM5 A;  3NEN A;  1QZG A;  1IYJ B;  3NEL A;  4HJ7 A;  5DLQ E;  1HNZ L;  2F4V L;  4DV6 Q;  3UDI A;  1MIU A;  2VL6 A;  4A3L H;  3I55 A;  3W1B A;  3M9B A;  2VUM G;  3FHW A;  3M7N A;  4HID A;  4B3T L;  4PMW A;  2IX1 A;  1W2B A;  1S3O A;  4B3S L;  2RHS B;  1NMF A;  5ELN A;  2EXD A;  4P74 A;  2VQF L;  3M3Y H;  2KBN A;  1PH2 A;  3A74 A;  4GN3 B;  1FVI A;  1B8A A;  3ULJ A;  4JI0 Q;  2NZO A;  2NVT H;  1VQH A;  3KF8 B;  2DGY A;  1ASY A;  3GTG H;  4BXX H;  1A0I A;  4LWC A;  1VQC A;  2RCN A;  2Z6K C;  4DR5 L;  4GOP C;  3T1H L;  4YWM A;  1X55 A;  2VQE Q;  4EX5 A;  1EFW A;  2JEA I;  4QQB X;  1S40 A;  4JG2 A;  1QVC A;  1RL2 A;  1UWV A;  1MJC A;  4QL5 A;  3ZJY C;  1C0A A;  2VQE L;  3S24 A;  1FGU A;  5IYB H;  1IBM L;  3CCL A;  1KRS A;  1X56 A;  2PQA A;  1SMX A;  2Z6K A;  1IBL Q;  2UUC Q;  5C3E G;  1S72 A;  4IPH A;  4GLV B;  1Q8K A;  3K7A H;  3I7F A;  1VQE A;  1VQL A;  2JA6 H;  1E22 A;  4UPA A;  3FP9 A;  2E2H H;  2VS1 A;  3W5O A;  3GTM H;  5JJK A;  3CAM A;  3E9I A;  3CCU A;  4B3T Q;  5HGQ A;  4IFD J;  1CKO A;  1UEB A;  4GLX A;  1K73 C;  3HOW H;  2WB1 G;  1C9O A;  1G6P A;  3KF6 A;  4LFB Q;  3RN2 A;  4GN5 A;  2Q2T A;  2ZTC A;  1HZB A;  1A8V A;  4XIG S;  3M85 A;  2I5H A;  3NBH B;  4JI4 Q;  1UE5 A;  2CFM A;  3CMA A;  2AWO A;  3HOZ H;  3GTL H;  3RLN A;  3RR5 A;  2JEB I;  4JBM A;  1PH6 A;  2UUA L;  3HOY G;  3CCS A;  3S14 H;  2YTY A;  1YEZ A;  4L5R C;  4IOC A;  2GN5 A;  3U50 C;  3I4N G;  2BH2 A;  1GKH A;  1HR0 W;  1WI5 A;  4QJF A;  1K9M C;  3CC4 A;  1LYL A;  1Z9F A;  4B3R Q;  4DV3 Q;  1VQA A;  3BU2 A;  3STB C;  4A76 A;  4JI5 Q;  1QZH A;  4WJ3 M;  1N33 Q;  1VCI A;  4BBR G;  3FKI G;  4DK3 C;  5C0X I;  1HNX L;  3J7Z C;  3OTO Q;  4DV4 L;  4A3J G;  1Y1V H;  3PUZ A;  1HNZ Q;  4J15 A;  4POF A;  2RF4 A;  5GAE C;  3JAM c;  4A93 H;  3HOU H;  1PYS B;  1AE3 A;  1EUJ A;  1I6H H;  4DR1 Q;  4DUZ Q;  4GNX A;  3KYH C;  5JEA J;  2D62 A;  3ULL A;  4JI3 Q;  4DUZ L;  1KHI A;  1GO3 E;  1YZ6 A;  3CCV A;  1BVS A;  1TXY A;  1YJN A;  4LF7 Q;  3I4M H;  2IHE A;  1K8G A;  3OYY A;  4HIK A;  4DR7 Q;  4R4T A;  3PCO B;  2VW9 A;  4GOP B;  4KI0 A;  1PFS A;  4OWX B;  3HOZ G;  2A1A A;  4BY7 G;  4OX9 Q;  1B70 B;  4JI5 L;  4BBS G;  5M3M H;  4LF9 Q;  2ASB A;  1RIP A;  4A3I G;  3TS0 A;  2N3S A;  2HHH L;  2C35 B;  4HIM A;  5IYD H;  3T1Y L;  2Q2I A;  2N8N A;  3GTQ H;  3RLF A;  1OXT A;  4NXM Q;  2CWP A;  4IJH A;  2JA6 G;  5C44 H;  1YIT A;  3RZD H;  4IOA A;  4JI8 L;  5FJ8 G;  1TWA H;  4LW1 A;  1C7Y A;  4JI7 Q;  3GTP H;  5GAG C;  4GS3 A;  1V1Q A;  3F2C A;  4TVA B;  2UXB Q;  3PUV A;  3KFU A;  3S2H H;  1XPR A;  4FDB A;  4KLK A;  3CCJ A;  1VQO A;  2ATW A;  4BA1 I;  1VQG A;  2NVY H;  1U5K A;  4DV2 L;  1EYG A;  1FJG Q;  5JJI A;  3I4M G;  5M3F H;  3EN2 A;  4LF6 L;  4DR3 L;  3PGZ A;  3I4N H;  2ZTD A;  1J5E Q;  2ZJR A;  2K14 A;  5IT9 c;  4JBJ A;  1SFO H;  3HOY H;  1N8R C;  1IBL L;  4JBK A;  3M4P A;  5M3M G;  2AKW B;  1JB7 A;  1NBW A;  2IX0 A;  2B63 H;  2CKZ B;  2UUB Q;  3S16 H;  3H3V I;  2R93 H;  4AH6 A;  1AH9 A;  3E0E A;  1P16 A;  2MNA A;  2OTL A;  4A3L G;  2KEN A;  3VDY A;  4A3D H;  3HOW G;  2ZTE A;  3HOX G;  4LFB L;  2KHJ A;  4QGU A;  1G29 1;  4LFA Q;  3DLL A;  2JE6 I;  3TQY A;  3CME A;  4DR2 L;  4GNX C;  1BBW A;  5IP9 H;  2VQF Q;  4QIW E;  1NTG A;  2E2I H;  1VS0 A;  4H02 A;  5GQO A;  4R4O A;  5H1S E;  1T9H A;  1HR0 L;  3A5Z B;  4A3M H;  2PI2 A;  5IYC G;  2R7D A;  1Q7Y C;  1O7I A;  2E2J H;  1SN8 A;  3F1Z A;  4DNI A;  4DV0 Q;  3CC2 A;  1VQM A;  4DV7 Q;  3ER0 A;  2H5X A;  4B3M L;  1WJJ A;  4A3K G;  5IP7 G;  4IO9 A;  1VQ6 A;  3J80 i;  3GDE A; 
#chains in the Genus database with same CATH topology
 2DPJ A;  1Y14 B;  4J8Q A;  2E5L Q;  1E1T A;  1Y1V B;  4M8A A;  1AP0 A;  5KFI A;  4ODG A;  1V43 A;  3KLR A;  4F8M A;  3GTJ B;  2R85 A;  2B29 A;  4K6D A;  3V4S A;  1K0R A;  5FD5 A;  1KEE A;  2ZJT A;  1BCP D;  4IUU A;  1IBM H;  1F77 A;  1TS4 A;  1CZW A;  2R7K A;  4B3S Q;  4DV5 Q;  2PMZ B;  3VR4 A;  3DWA A;  2LXJ A;  3I72 A;  2J6T A;  2K5V A;  2B2Y C;  4ZQI A;  3QZ8 A;  2K7V A;  4N8F A;  3A8I E;  2B2W A;  4K2L A;  3SK8 A;  2F03 A;  2OH2 A;  4IFD I;  1ZEQ X;  1S5F D;  5L1K A;  4O4I F;  2F0J A;  4RUA A;  2C9O A;  1TWF H;  2GLT A;  1KL9 A;  3KTM A;  3IAY A;  2MP1 A;  1MSG A;  2NTT A;  1WSC A;  2NN6 H;  5HGT A;  4DXF A;  3UI2 A;  3Q24 A;  2B2Y A;  3NEM A;  2WFW A;  2Y0S G;  4KTA A;  1FGB D;  2B2V A;  3VA7 A;  4A3D G;  2NVX A;  1D5Z C;  4NKL A;  5C4J H;  5D3I B;  2UXB H;  2FIN B;  2K4K A;  2SNS A;  3MFG A;  2UXC L;  4ECQ A;  5J22 A;  1CE8 A;  5BR8 L;  5KT6 A;  5ELB A;  5DLF A;  4G3I A;  1H9S A;  1Q86 C;  3S2D H;  2F0S A;  2UUB H;  1Y1W H;  3S1R B;  2XVS A;  4ZAI A;  4JI3 L;  2QYZ A;  1U4P A;  5KG6 A;  1FKA H;  1W6J A;  3NP8 A;  2NU9 B;  2KA7 A;  4MV6 A;  1I4Q A;  2F0O A;  2MO0 A;  2P0A A;  4R1J A;  4CHT B;  4CBV A;  2F0V A;  4C3I G;  2AQ3 B;  2B63 A;  1ET9 A;  2GA4 B;  1WTQ A;  5JAV A;  1HUM A;  3LML A;  3H94 A;  2WYO A;  1RTN A;  2W8K A;  1CFM A;  4DUY L;  4ZI7 F;  2YYZ A;  3T13 A;  4IZ8 A;  1Z2O X;  3L4K A;  4EFE A;  5BR8 H;  2N88 A;  4P73 A;  4XT3 B;  2FMM A;  1HA6 A;  3I70 A;  1D7Q A;  5LL6 b;  2MUY A;  3RD4 A;  4JV5 L;  2KUM A;  2B3G A;  1PH3 A;  1CQI B;  1V1P B;  2DY8 A;  4FU0 A;  1D5X C;  4C5B A;  1KJ9 A;  3BQ2 A;  1CQF A;  1TS5 A;  4IRD A;  1IXR A;  1XNQ H;  1KJI A;  5LMN H;  4FBU A;  3HOV B;  1UE6 A;  1YI2 A;  2YW2 A;  3R5X A;  4DL4 A;  5D8D A;  1NY4 A;  4O42 A;  1Q12 A;  5A35 A;  1PH8 A;  2Z9H A;  1LT4 D;  3OIQ A;  4PZ6 A;  5IGF A;  4HJ9 A;  1V4Y A;  3HOY B;  1HR0 Q;  2R7N A;  4HR7 B;  1DV1 A;  5I2X A;  5KFG A;  4JYA H;  2LXK A;  3M4O B;  4C5C A;  1YNN D;  4POG A;  5M3F B;  3P75 A;  1PLF A;  3KOJ A;  1VBH A;  4DL7 A;  1HNX H;  3F2B A;  1CSQ A;  1IYV A;  2N78 A;  3ULP A;  4A3I H;  1A3T A;  3PF5 A;  3I4M B;  3K5H A;  2O03 A;  3CXC A;  4A3E G;  1N9W A;  1CKN A;  3K80 C;  2M05 A;  4JI7 L;  4BBR H;  4WOR A;  3J7A V;  3HOU B;  2NU6 B;  5D1P A;  2RBM A;  4JI1 Q;  5KFH A;  1SYE A;  4PG3 A;  5CB4 F;  2X6G A;  3MXP A;  1XMO L;  2J7Z A;  3GTM B;  2UXC Q;  4NB3 A;  1K83 H;  3MXU A;  3P1H A;  5LMN Q;  4F4W A;  5AJ3 Q;  1PZJ D;  4DR3 Q;  1GSO A;  3Q8D A;  1H9K A;  2KHI A;  4DV2 Q;  2IT1 A;  3K57 A;  4MHE A;  3JAM i;  5I6W A;  2ALY B;  1WD1 A;  5HV6 A;  2R7Z H;  3G8C A;  5JH7 F;  1II3 A;  5C0X G;  2I5L X;  1LUZ A;  1HR0 H;  1JC7 A;  3CD6 A;  2UU9 L;  4J6H A;  1MD2 D;  2QDB A;  4JV2 A;  5FLM G;  5GAD C;  1WFQ A;  1Y8O B;  1NE3 A;  4CGY B;  3GTK B;  3S2H B;  3PO3 B;  1TS3 A;  2B2U C;  3ND9 A;  4YJ3 F;  1MJE A;  4A3E H;  3R8B A;  3AYH B;  3A56 A;  3U9T A;  5IGG A;  1MSH A;  4ED0 A;  3UE1 A;  1S97 A;  4DR6 Q;  1BO0 A;  3H6M A;  1KLG D;  1RJR A;  2IA6 A;  5CA1 F;  5FK9 C;  1IW7 C;  5IWA L;  5FLX c;  2NUA B;  4O2D A;  3G6X A;  4IUT A;  3D4R A;  1N32 Q;  4X66 L;  1LTI D;  1X3E A;  4KMU C;  2NVX H;  2EY5 A;  3UDG A;  1N36 Q;  2ZDH A;  5L9X A;  2E2D C;  2F0N A;  1NAP A;  3PIO A;  1Q81 C;  5C4H A;  3NTH A;  3Q0A A;  1JDE A;  3OHB A;  5EPL A;  5DG7 A;  1J6Q A;  1B4O A;  5L1J A;  1RYS A;  4DAM A;  1LTR D;  1PFB A;  4HN7 A;  2OF1 A;  2P5Z X;  2Q8T A;  4X62 Q;  3RGZ A;  4ECY A;  3A55 A;  2JA9 A;  1KLU D;  4DAY B;  2F4V H;  3JAM L;  4NLG A;  3KJP A;  1P8L A;  5KEE A;  2K5Q A;  2PBZ A;  1JB3 A;  3K5N A;  3M4O H;  1F2Z A;  4KD4 A;  4DKA C;  2YYA A;  3R3O A;  4IR1 A;  3RB6 A;  2K52 A;  2R7Z G;  2YU9 H;  1N48 A;  4RAU C;  2K1B A;  5LMN W;  4O4L F;  3HKS A;  3T4A C;  3T1H H;  4B3S H;  4Y7N H;  4JBW A;  2CHB D;  4A2B A;  1H9J A;  3RZO H;  4UCT A;  3CHB D;  5KX5 F;  3OSP A;  3I4N B;  2W8L A;  5L37 A;  3PW4 A;  4A3C G;  2BH8 A;  1BXR A;  3D6C A;  2DY7 A;  2XWJ B;  4A3F H;  4GKK H;  2HQE A;  2CW8 A;  3FVQ A;  5GON F;  5DGB A;  4FXG C;  3OUU A;  2NN6 I;  3CU7 A;  1BNC A;  3PO2 B;  1STA A;  2F4V Q;  2CW7 A;  4V19 0;  3I3C A;  3TZD A;  5C0X J;  1KRT A;  4JPB W;  3STB D;  5K36 G;  2ID0 A;  3NPP A;  4DLK A;  3HP3 A;  2JEG A;  2GVB A;  3GTK H;  4BY1 G;  2V1C C;  1QIL A;  2I5M X;  1XNQ L;  4EGV A;  4JI6 L;  1EIG A;  3RBD A;  3QJY A;  3C1F A;  2PZU A;  4LFB H;  5CR3 A;  4ZYS A;  3SHL A;  5FO8 B;  2YZM A;  5I2Y A;  3I91 A;  1PDQ A;  3MVV A;  1J5E L;  4ZRZ A;  2DUD A;  1PH7 A;  2WAQ A;  3K3P A;  2R92 B;  5DQI A;  2JA5 A;  3HZX A;  4OX9 L;  3PUY A;  3J80 c;  4XXE A;  5DG8 A;  3S1N B;  4HYK A;  3S17 H;  2JYO A;  3PUX A;  3GIJ A;  1Q8I A;  1WR2 A;  4O3P A;  4CJ2 C;  5LXT F;  1FL0 A;  3L3O C;  5C4X H;  3A54 A;  1Z6H A;  5LMU Q;  2K05 A;  2R7Z A;  1RJQ A;  2DJF C;  1AFP A;  2E8G A;  3MAQ A;  2W9C B;  1T36 A;  3K3V A;  2QF7 A;  5L1I A;  5C44 B;  3LWB A;  1SLJ A;  2R92 H;  1N36 L;  1LAB A;  1XMQ L;  2XTI A;  1CZG A;  5FPR A;  1HZ9 A;  1XNR Q;  1PH4 A;  2JEI A;  3PF4 A;  1G2S A;  4FF4 A;  3U58 A;  4CDD C;  2OWO A;  4YHH H;  2KEE A;  1SNM A;  2TMP A;  3K81 C;  4K6L A;  4RAY A;  2ZJP A;  2PMZ E;  5FLX E;  1HHV A;  3DEO A;  2UVW A;  4LFC H;  1LM0 A;  3HOV H;  1I50 H;  3EIV A;  1GSA A;  4LF5 Q;  1HNW L;  1SBB B;  4Y7N B;  1GD7 A;  2EZV A;  2MO1 A;  1Q3L A;  5FPO A;  2EQS A;  1L1O C;  2YL2 A;  1BNZ A;  2VB2 X;  1IYJ B;  3BVZ A;  3NEL A;  5DLQ E;  2IX3 A;  4HJ7 A;  4DR2 H;  2CW0 C;  1MIU A;  3W1B A;  4LFA H;  5CV5 A;  3SK6 A;  4C1N I;  1AUV A;  2W9C A;  4PMW A;  4I7H A;  1W2B A;  1S3O A;  1SE3 A;  4B3S L;  3KXY T;  3M9M B;  2EXD A;  3GQB A;  3ETJ A;  2KBN A;  4GN3 B;  3K5M A;  5J2U F;  4KJO A;  4JV1 A;  4LWC A;  4A3J G;  2RCN A;  1SAP A;  4EG0 A;  2JXM B;  2Z4H A;  2VQE Q;  3PQI A;  1SE4 A;  1S40 A;  2WB1 A;  4DR3 H;  2X6L A;  4DL5 A;  4PMC A;  1MJC A;  4DR5 H;  4QL5 A;  1SYG A;  1TWC B;  2Y0S B;  5DEH A;  5IYB H;  5C0X H;  3J81 E;  3RFC A;  4HNU A;  1EUD B;  2Z6K A;  5C3E G;  4YB8 B;  1B53 A;  4CDE C;  4WJW A;  1LT6 D;  1WTP A;  1SNP A;  3KLS X;  4HMI A;  1JDB B;  4UPA A;  2GPS A;  2WAC A;  2VS1 A;  3W5O A;  3GII A;  5DGA A;  1K73 C;  2F1M A;  1C9O A;  1RCV D;  2K6A A;  1HZB A;  1PYW D;  1A8V A;  2ZTC A;  2UUA H;  2XGP A;  3J80 L;  1VF7 A;  3R5F A;  3CMA A;  2AWO A;  1SMY C;  2JEB I;  2ASJ A;  1W93 A;  1D5M C;  1IKL A;  5G3L D;  2O5I C;  5COY A;  1WTW A;  4YAJ B;  1BOS A;  1WI5 A;  1Z9F A;  4B3R Q;  3JRW A;  4F4X A;  3HOW B;  1EHI A;  4DV3 H;  3GTO B;  3MWE A;  4APM A;  1JWM D;  1O7L A;  5C0X I;  1HNX L;  4WBN F;  1N33 H;  1N34 H;  1SNO A;  4DV4 L;  4YR0 A;  4OEL B;  2Q8R E;  4RA8 A;  4J15 A;  3JAM c;  2F0I A;  3HOU H;  1PYS B;  4EEY A;  5C4J B;  1I6H H;  1HNZ H;  4DUZ Q;  4GNX A;  3L4J A;  3KYH C;  2HVS A;  1GO3 E;  1YZ6 A;  3CCV A;  2LY7 A;  4KY6 A;  2W57 A;  3OHA A;  3M4I A;  1K8G A;  1O7Z A;  5KFO A;  5EWF A;  3Q8S B;  5C6A A;  1I3Q A;  4GOP B;  4S3S A;  2R8J A;  1O78 A;  4A3J B;  4OX9 Q;  2BE5 D;  4BBS G;  3TDQ A;  4LF9 Q;  2R7Z B;  4O3R A;  3HB9 A;  5JUM A;  3OOC A;  2XGQ A;  5I47 A;  2N3S A;  4ME5 A;  4DV5 H;  2EYL A;  1SYC A;  3BVM A;  4N8X 1;  5IYD H;  2Q2I A;  3GTQ H;  5KG3 A;  2VQF H;  5LL6 S;  2QK4 A;  1OXT A;  1L0X B;  4NXM Q;  5KFF A;  4IJH A;  2JA6 G;  3HRZ C;  3GTO A;  2XN9 C;  4JI8 L;  5FJ8 G;  4L1K A;  3ONA B;  2VPS A;  4GS3 A;  2G9H D;  4RNO A;  1V1Q A;  3PIO 3;  1U4R A;  3S2H H;  4ED1 A;  5F9L A;  2ZXP A;  1XPR A;  3RF2 A;  3CCJ A;  1XWE A;  1VQO A;  2ATW A;  1B3A A;  3NTK A;  2AQ4 A;  5JJI A;  2EY2 A;  3TP6 A;  5KRU A;  1EU3 A;  3EN2 A;  3I4M G;  2A6H D;  2RA4 A;  3PGZ A;  1FJG H;  1AZQ A;  4K5V A;  4CDC C;  4A3E B;  1RTO A;  2ZTD A;  1S0N A;  2UU9 H;  5IT9 c;  3RMH A;  3TME A;  3HOY H;  1JOO A;  3NSW A;  5M3M G;  2JEJ A;  4MAM A;  1NBW A;  1AEX A;  2UUB Q;  3MXG A;  3VA5 A;  1A2T A;  4AH6 A;  4EFB A;  1P16 A;  2L5T A;  1A6X A;  2KEN A;  3GP7 A;  2ZTE A;  3HOX G;  4X66 H;  5EKK A;  2KHJ A;  4QGU A;  1EWH A;  4DR2 L;  1ZQ7 A;  1EZ6 A;  1M8A A;  4MTD A;  2LMC B;  3F2U A;  4H44 C;  1VS0 A;  5GQO A;  5H1S E;  4U67 3;  3VR6 A;  5IYC G;  2R7D A;  2E2J H;  3F1Z A;  2A74 C;  1VQM A;  1H9R A;  1JOR A;  4QUF A;  3KK7 A;  3NBH A;  4IO9 A;  2ICE C;  1VQ6 A;  2DNE A;  3RZO B;  2JP1 A;  4IWX A;  4ECX A;  5KFJ A;  1K3B C;  2YZG A;  2BR0 A;  1VQD A;  2SCU B;  3C46 A;  2V4D A;  3RAX A;  4NXM L;  2XIG A;  1PTO C;  3U4Z A;  5C1O A;  1A9X A;  4UHV A;  4DV4 H;  1EY6 A;  2UUC H;  2R92 G;  3N6X A;  4LNQ A;  3NQI A;  3I4O A;  1OXU A;  1VQ7 A;  5E7N A;  3JZI A;  3J81 i;  1KTK A;  4LUZ A;  2I8C A;  1LT3 D;  4JOI C;  1G6Z A;  4YCW A;  5K36 H;  5CMD A;  1EY5 A;  4O1N A;  1UE1 A;  3J81 W;  2WIN B;  1STY A;  3AU7 A;  1PHJ A;  4QCL A;  4FVM A;  1SYB A;  4L8J A;  2EIF A;  5M5Y B;  2AGQ A;  3E6Z X;  5IGD A;  3D6W A;  2KCT A;  1YNJ C;  3BAA A;  4Q45 A;  3WDN A;  3FKI A;  1QUQ A;  4LH7 A;  2F0Q A;  3BDL A;  4ED7 A;  1KXL A;  1XX8 A;  1QJO A;  2R87 A;  2AMC B;  3LGJ A;  1X3Q A;  4A3F G;  4GKK L;  1WCM H;  4Y8V B;  5KFL A;  1JLL B;  2MHV A;  3TZU A;  3ETH A;  1EIH A;  2OQ0 A;  1JWS D;  2VXW A;  2CCZ A;  5D1O A;  3CC7 A;  2HHH H;  5FKA C;  4J9Q A;  2WAQ E;  1KIX A;  2CZG A;  1JJ2 A;  1I4R A;  2H4O A;  2QKI C;  1CT1 D;  3CRL C;  5DG9 A;  2HIV A;  4FM9 A;  2LFN A;  3H0G G;  1XPU A;  1OXX K;  4OWW B;  1AW7 A;  2BA1 A;  5DM7 3;  4I65 A;  1VQ9 A;  4I50 F;  3E5S A;  4LF8 L;  4ZHQ F;  4JV5 H;  2XRS D;  5CAE B;  2A6H C;  4MV3 A;  3BA8 A;  4DR1 L;  5J3B A;  1I7L A;  4JI1 H;  4C3I B;  1VQB A;  2HQL A;  4YR3 A;  3LWU A;  4EQP A;  5CV9 A;  5FLX W;  3PMF A;  4DR7 H;  1QVF A;  2IHF A;  4JI2 H;  4RB3 C;  3JC6 6;  2QIL A;  1QUQ B;  1Y1W A;  2ZJQ A;  4C2M H;  5KFM A;  2ZM6 H;  2A69 C;  3DMU A;  4NDX A;  4B3R L;  2G9D A;  5JEA G;  3CPF A;  4OIJ A;  4GLA C;  4A4I A;  4ECT A;  1HPC A;  4UAI A;  2X69 A;  1QWY A;  4P75 A;  4PQX A;  2V9W A;  2PZT A;  4ECZ A;  2EJG C;  4JI1 L;  4YWK A;  5IWA H;  1FYC A;  1F9Q A;  1I50 B;  5GAH C;  1DD2 A;  2BE5 C;  1O75 A;  4OON A;  2QA4 A;  1M0T A;  3HOZ B;  1Y1W G;  4DV0 H;  3EPG A;  2WV6 D;  1VQK A;  1H9M A;  5G3L F;  4C3J B;  4L5T A;  1WH2 A;  4RMF A;  2PVP A;  4DNT B;  3X3N A;  2EYH A;  3A7L A;  3N52 A;  4N9T A;  3VR2 A;  2JA7 H;  4YP3 A;  1E4E A;  4GKJ H;  1HNW H;  3QR8 A;  2YS6 A;  2J6U A;  4JI2 Q;  2O4X A;  1Q46 A;  3PUW A;  4MZ9 A;  2IP4 A;  5EKL A;  4LSX A;  3PR5 B;  2HCI A;  2ASL A;  1JOQ A;  5FD6 A;  3GTJ A;  1YJ9 A;  3MTS A;  3K6O A;  1EQT A;  2B63 G;  3VYU A;  3R93 A;  3SEB A;  2FK2 A;  1U4M A;  5IY0 A;  2GVA A;  2Q2U A;  4A3F B;  2R86 A;  1OXS C;  4QW8 A;  2AGP A;  2F0P A;  2C22 A;  2I0Q A;  2PNH A;  3K7U C;  5IWA Q;  3K0Y A;  1PRT F;  5NUC A;  5E4X A;  3EVQ A;  5BPH A;  1SMY D;  1TAE A;  3TIN A;  1GJX A;  3T16 A;  2W71 A;  2PQA B;  3GO5 A;  3H91 A;  5TSS A;  2Z6B A;  2FP4 B;  3CCM A;  3RZD B;  4OGQ C;  2CWA A;  4HIO A;  1E4F T;  5C5M A;  2FPP B;  1STN A;  5KG2 A;  1SXT A;  1IBK L;  2UU9 Q;  4MV9 A;  2A8V A;  4A3G H;  2F3I A;  2NZH A;  3KF6 B;  3HOX H;  3HBL A;  4ID6 A;  2VUM B;  1PH9 A;  3OTO L;  4XYM B;  2B2T A;  3F8T A;  3CQZ H;  4MA0 A;  1K28 A;  1PXU A;  5EPK A;  4DU9 A;  4GC6 A;  1R4P B;  1STG A;  2VZA A;  4LF6 H;  2F3W A;  5KFD A;  3MR6 A;  4XDX A;  1SJH D;  2Q2H A;  4YY3 H;  4K0K H;  3SK4 A;  4DR7 L;  1UAP A;  3K8A A;  1X3F A;  2R61 A;  4J0M A;  4LF7 L;  3FPU B;  3OIP A;  3S9W A;  3N44 B;  2BQ3 A;  4NW2 A;  4ILW A;  1M0W A;  4QWC A;  1ML0 D;  1DCZ A;  3ITP A;  5D1O B;  5LMU H;  1B50 A;  4JUZ A;  3V6J A;  5DQG A;  4ULL A;  2DN8 A;  2R6G A;  4C3J H;  4LMY A;  5M5Y H;  4C3J G;  3NGD A;  4ECV A;  3L0O A;  3MC0 B;  2L55 A;  4HTH A;  1N33 L;  4OO1 G;  1TWC H;  1T94 A;  3D3R A;  4MNO A;  4RZR A;  1LAC A;  5ISR A;  3HFZ B;  2JK8 A;  4B3T H;  5J1Z A;  4UCU A;  1B9M A;  4X3K A;  4HCE A;  2UXD Q;  2E2H B;  2YZN A;  5K2M A;  1V1P A;  2XC9 A;  2HCC A;  4R4I A;  2F52 A;  1XMO Q;  4A93 G;  4JI6 Q;  4UCO A;  2B39 A;  3EJI A;  1L0W A;  3FEW X;  2Z0S A;  4MTK A;  3OW7 A;  3J7A 5;  1W6K A;  2AHO B;  4O0A A;  4TQU S;  3G48 A;  2B2V C;  4APV A;  1TKW B;  1Z47 A;  3I56 A;  4BA2 I;  3ERS X;  4BY1 B;  2RSN A;  5GRO A;  3RN5 A;  4BXX G;  4WFN 3;  1I4X A;  4F4Z A;  1NNX A;  4RB0 A;  2F0U A;  3A5U A;  1WTO A;  4DUY Q;  4JYA L;  2F0D A;  5BMV F;  2XD4 A;  2FHT A;  2WAQ G;  3BJU A;  3RGX A;  1RJP A;  5KFU A;  4KY5 A;  1PH1 A;  1NMG A;  2M00 A;  4A3B G;  4C2M B;  3HKZ E;  1S9F A;  4X3U A;  1DXM A;  2F0W A;  4ED6 A;  2W6M A;  5KT3 A;  4TSS A;  4U7C A;  4XQN A;  1PH5 A;  3BJY A;  2E2H A;  1BR9 A;  2D0P A;  3P20 A;  4DR5 Q;  4KHV A;  2VNU D;  1XMO H;  3Q2O A;  5IYC H;  1STH A;  2NZ1 D;  1A2U A;  1BQQ T;  2XNA C;  4JI0 L;  1I6H B;  2R93 A;  1LTT D;  3D8G A;  1VQF A;  2R8K A;  2F0M A;  3HOV G;  3TSS A;  4YHH L;  3PW2 A;  4L6T B;  3GTQ A;  4DK1 A;  2E2J B;  3KAL A;  4XYL B;  2MJ8 A;  1D2B A;  1YBY A;  1GVP A;  5ELF A;  3GTK A;  1BF4 A;  1YHQ A;  1WVL A;  1CS0 A;  2EJF C;  1JIH A;  1BCP F;  1YHB A;  4DV6 L;  4GKJ L;  3DUZ A;  3OHX C;  3BZC A;  2ATL A;  4DV1 Q;  1B2T A;  4O3Q A;  1ZYR D;  1XPO A;  4Q8E A;  1K1S A;  2XGT A;  4RB1 A;  1ZHS A;  2IL8 A;  1GLV A;  2RGR A;  4LF8 Q;  4XQQ A;  1WOC A;  1DZ1 A;  5FOB B;  1N32 L;  4C2M A;  2NVY B;  4IPD A;  4R8N A;  3BZK A;  4L5Q A;  3RV3 A;  1PVO A;  5T14 A;  3CPW A;  2VA3 A;  3MA2 B;  1TA8 A;  1NR4 A;  4LFC L;  2HT1 A;  1GHK A;  4X65 H;  4LFC Q;  2JA7 G;  1CUK A;  1IBL H;  1JE5 A;  3DWQ A;  4TV8 F;  4ZLT F;  5M9O A;  2FFK B;  2EYO A;  4IUN A;  1NSN S;  5CYU A;  2W70 A;  2VUM A;  3K0X A;  5KFR A;  2UUA Q;  4FP5 D;  1IZ6 A;  5KG7 A;  3A0J A;  4ZK9 B;  5LHY 1;  4IHJ F;  1HNZ L;  3R2T A;  1PX2 A;  4A3L H;  3I55 A;  1JKJ B;  2HVR A;  4JK1 C;  4K14 A;  3K5O A;  3BG3 A;  2RCF A;  4B9W A;  3M7N A;  4IUP A;  4RUC A;  1R4Q B;  5IGB A;  1KAA A;  4FS1 A;  5H80 A;  1NMF A;  4P74 A;  2F0G A;  1EEI D;  3H40 A;  2PW7 A;  1FVI A;  5M3M B;  1K8M A;  1EY8 A;  2NZO A;  3KF8 B;  2DGY A;  2YRX A;  4BXX H;  2RDH A;  1A0I A;  3D4W A;  4DR5 L;  2JEA I;  4G7O C;  5A2Q W;  1EFW A;  5KFW A;  4EX5 A;  1BUV T;  4ZUI A;  2A73 B;  4H0L C;  2LKV A;  4JG2 A;  1K83 A;  3RV4 A;  3G6V A;  2NU7 B;  3Q22 A;  1C0A A;  1DM0 B;  1I4P A;  2VQE L;  3S24 A;  1KDA A;  5L1L A;  1B3Q A;  1X56 A;  1SMX A;  4X3S A;  4IPH A;  4MV4 A;  1MI2 A;  3TIG A;  3KHR A;  4KK7 A;  4X62 H;  1VQL A;  4TV9 F;  1I94 H;  2Z8L A;  1ZYR C;  1JCK B;  3GTM H;  5JJK A;  3CAM A;  3CCU A;  1CA5 A;  2MCT A;  4C5A A;  1Q90 A;  4IFD J;  1CKO A;  3HOW H;  2WB1 G;  1G6P A;  1PZK D;  2B63 B;  3VPB A;  4M1U B;  4A3G B;  2RQX A;  3NUC A;  4XT1 B;  4IUR A;  1UNS A;  4B9X A;  4CJ0 B;  2I5H A;  1T5X D;  3VR5 A;  3J80 W;  1UE5 A;  1S4Z A;  3HOZ H;  4IN3 A;  4QMG A;  5EKI A;  3CQZ A;  5CV4 A;  5DQH A;  2B8F A;  3MXN A;  3WOE A;  3ZYY X;  2WE6 A;  5EDW A;  3S14 H;  4IOC A;  3U50 C;  2PZW A;  3I4N G;  1G2T A;  2FK1 A;  3PW7 A;  1HR0 W;  1RKN A;  1K9M C;  1K1Q A;  1LYL A;  4DV3 Q;  1X3P A;  3STB C;  1JQY D;  3TP5 A;  1QZH A;  3GID A;  2B2T C;  1N33 Q;  4KN4 C;  4RZQ A;  3GV6 A;  3NTI A;  4DK3 C;  2R8G A;  3A8K E;  3T51 B;  3J7Z C;  2AGO A;  1HNZ Q;  2RF4 A;  3JSN A;  1ENF A;  5DLG A;  2ZXO A;  3FDS A;  1KHI A;  2PQE A;  1BVS A;  4G57 A;  4DF7 A;  1AN8 A;  2KJX A;  1BXT A;  3C0F B;  4IR9 A;  3PCO B;  2F0L A;  2PO4 A;  4KI0 A;  1PFS A;  2QCP X;  5M3M H;  3RIZ A;  3H0G B;  1RIP A;  4JI4 H;  4FXD A;  2ZDG A;  2VOB A;  4HIM A;  1KAB A;  3T1Y L;  4FNF A;  3S16 B;  3RLF A;  2NVY A;  3SXH A;  5C1P A;  3T56 B;  5IOC A;  3RZD H;  1UUP A;  4LW1 A;  4YJ2 F;  2KED A;  3H3V C;  1B6S A;  2FB9 A;  3F2C A;  2UXB Q;  1M7J A;  3TP7 A;  1PK8 A;  2B2U A;  2YU9 B;  1XNR H;  1VQG A;  1LV9 A;  1S5C D;  1VDZ A;  1FJG Q;  4FYD A;  3PZP A;  3GV3 A;  4ECR A;  4LF6 L;  4DR3 L;  1GUG A;  3I4N H;  4QB4 A;  1J5E Q;  4GZY C;  2L0C A;  2ZJR A;  2K14 A;  4JBJ A;  4ECW A;  2A68 D;  2K5W A;  1UC9 A;  1IBL L;  1KC7 A;  4J9N A;  3NQT A;  2M9V A;  1JB7 A;  2B63 H;  4A3I B;  5D3D A;  3GIL A;  2FK3 A;  5D14 A;  1HRJ A;  1JIC A;  3HS0 C;  3TP8 A;  2OTL A;  3VDY A;  5J39 A;  1NCV A;  2EDG A;  1RF2 D;  4K5W A;  1G29 1;  4LFA Q;  3DLL A;  2ICI A;  3GIM A;  3K5L A;  3FRP B;  2E2I H;  1ESF A;  2EY1 A;  4R4O A;  5KG0 A;  1F2L A;  1T9H A;  5LP6 F;  2W6Z A;  1DON A;  3A5Z B;  4ABN A;  2O5J C;  3BG5 A;  3V05 A;  4E4T A;  4DAY A;  4A3K G;  4Q8F A;  1LLR D;  2UVV A;  3MFH A;  3GDE A;  2IWH A;  1EWI A;  4RHS A;  1E1O A;  1D1K A;  1Y8N B;  4CKC A;  2G5D A;  1I4H A;  2KCM A;  1KDC A;  4C1N K;  1GYF A;  4LF5 L;  1EOV A;  3K7A B;  4LSA A;  4EQN A;  5BN4 A;  3S1M B;  1J8I A;  5D65 A;  1WCM B;  2L9H A;  1PTO D;  3H0G H;  3WOF A;  1AN7 A;  3ICE A;  3DM3 A;  1F9R A;  1ZET A;  4BY1 H;  3VPC A;  2VUM H;  1N56 A;  3NXW A;  3CQZ B;  1I94 L;  1HFN A;  4NXN Q;  4EBC A;  1RYR A;  5C5L A;  4X64 L;  3J81 L;  4B3M H;  4EBD A;  2I87 A;  1MKH A;  1K3R A;  2D0O A;  5E4W C;  1WYD A;  1K8O A;  4EEQ A;  1RK5 A;  1FR3 A;  1GUT A;  3AFQ A;  4P72 A;  1VBG A;  2C00 A;  1DYQ A;  4J9K A;  1JXL A;  2C2R A;  5JVG 3;  1ET6 A;  2BA0 A;  4UP8 A;  5CC4 A;  4YCV A;  1C8C A;  4PZ8 A;  2QEX A;  4C3I H;  1B7Y B;  3GIQ A;  2KCC A;  2HHH Q;  5DNF A;  1VQ4 A;  1K8A C;  1AZP A;  1G91 A;  2OT2 A;  2XCA A;  3IFT A;  5JPN C;  5FO9 B;  5CGK A;  1EY7 A;  1BJT A;  3N40 P;  1IL2 A;  3MWM A;  2K33 A;  1HUN A;  5KYL A;  4A93 B;  1IOW A;  2C2E A;  3TRE A;  1BCP C;  1XNR L;  3R2I A;  2C28 A;  2L15 A;  1XMQ Q;  3CCR A;  3KAK A;  2OXP A;  3RJ0 A;  1TWG B;  2BCO A;  1KD1 C;  3KAJ A;  3KJO A;  2A69 D;  3BAB A;  4K2K A;  4DNR B;  3V4Z A;  4B3M Q;  1HJP A;  3RAQ A;  1N32 H;  1JE4 A;  4DV0 L;  1XJV A;  4K5X A;  4AYB E;  1IBK H;  5IGC A;  2WP8 J;  2R82 A;  3HXL A;  2WKC A;  1TWH A;  3EBE A;  1E2Z A;  3TN2 A;  2KOL A;  1SRO A;  4X64 H;  2E2I B;  5FJ8 H;  4RGM A;  3SVM A;  1HCZ A;  1OTC A;  3VR3 A;  2K75 A;  3RUZ A;  1ROD A;  2UVR A;  3GIK A;  4LF4 L;  5IYD G;  3E5N A;  1NR2 A;  1LTL A;  4KHP Q;  3GTG A;  5K5P A;  1EYD A;  5C4Z A;  4DR4 L;  1C3O A;  1STE A;  5CBE E;  2W9B B;  1F9P A;  3GTL B;  1XMQ H;  2K28 A;  2JA5 H;  3KBG A;  1U4L A;  1STB A;  1EIF A;  1SNC A;  3QO2 A;  1QG7 A;  3AQQ A;  3BQ1 A;  1RDP D;  3WO1 A;  2JN4 A;  1Z2N X;  1CSP A;  4LF6 Q;  2R8H A;  5KFB A;  4F87 A;  3MEH A;  4LMQ D;  3OUZ A;  1EY4 A;  1WTV A;  3Q1K A;  2K5N A;  4BWS C;  3W3A A;  4A3D B;  2QEJ C;  2UUC L;  1ESR A;  4J9R A;  4DPG A;  1E7Z A;  1IBM Q;  4IPG A;  4J1M A;  3PO2 G;  4MTE A;  2A5H A;  4C3H G;  3NWS A;  2UUB L;  3CP0 A;  5CA0 F;  1ENC A;  3UE0 A;  4RFB A;  1QOH A;  2LS0 1;  3J81 c;  5BR8 Q;  1VQN A;  3T1Y Q;  4X66 Q;  2WDT A;  5IP9 G;  1CTM A;  3U4V A;  4A75 A;  1CQJ B;  3N8D A;  4J9M A;  2UXD L;  4J9L A;  3HOX B;  4KHP H;  3J7A F;  2J4X A;  1V51 A;  3A7A B;  3K5I A;  1SDF A;  4JVZ A;  2F4I A;  3IRB A;  3KDF B;  3M4Q A;  3D0F A;  4DL6 A;  5IP7 H;  3T5K A;  1B33 N;  4DUY H;  2FJ2 A;  3RB3 A;  1JX4 A;  1I5F A;  1F2M A;  4A3M G;  2IW3 A;  1Z7T A;  1I6U A;  3GTP B;  1U0L A;  4IPC A;  5HUR A;  1TR5 A;  2FJZ A;  4ZOL F;  1HZC A;  5LMU L;  3I73 A;  4A3C H;  4HQ6 A;  3ERO A;  3C2P A;  1YHA A;  4DV4 Q;  2OTJ A;  4O2B F;  1MZB A;  5COR A;  1HNX Q;  3T5H A;  4A3B H;  5HY6 A;  2VPQ A;  4B08 A;  4K0K L;  2AUK A;  4EQ5 A;  4ED2 A;  4HSP A;  5AJ3 L;  3G6Y A;  4K0K Q;  1MGS A;  2V59 A;  1O80 A;  2BDN A;  4QUC A;  1Y69 U;  5KT2 A;  3RLO A;  1S5E D;  3H20 A;  4UP7 A;  4GKK Q;  3S15 B;  2EYF A;  2RDF A;  1L1O A;  5M3F G;  3WNZ A;  1L2Z A;  4HSV A;  4LUO A;  2JA8 H;  4DV1 H;  2XIW A;  4MN3 A;  4FF2 A;  1EQR A;  2MFI A;  1E24 A;  2J6S A;  1CI3 M;  3GTP A;  2W9A A;  1TWF A;  4DL2 A;  4JI2 L;  3K58 A;  3F2D A;  1HA5 A;  3QG1 A;  3EYY A;  4L5S A;  2R8I A;  5KFN A;  1A62 A;  5C44 G;  4RG1 A;  3G4S A;  5JPM C;  1BCP B;  5ELE A;  4A3G G;  1EYA A;  2ZM6 L;  4J9S A;  3BDO A;  4ZQ3 A;  1S5B D;  5I9P A;  3PIP A;  2E76 C;  2XSC A;  3OWE B;  4DR2 Q;  2ASD A;  3L2P A;  2RDG A;  4OO1 H;  1R9T A;  3TRZ A;  4HJ5 A;  1IHZ A;  3W1G A;  4PZ7 A;  1RK6 A;  1EIY B;  2W6P A;  3VYS A;  4IUQ A;  1VMC A;  1QVG A;  5JQW A;  1T5E A;  2AQ1 B;  1QB5 D;  3QIA A;  1DOL A;  1GOZ A;  2JQO A;  4RGT A;  2E5L L;  4JI4 L;  4XZ3 B;  4YWL A;  3V6H A;  4CDF C;  3J80 E;  3O13 A;  5EWG A;  1BBX C;  2NYZ D;  4MV1 A;  2E2I A;  5FLM H;  3KHH A;  2FKL A;  2NN6 G;  1I4G A;  2SEB D;  3FDT A;  5EPJ A;  4R8I A;  4IUV A;  1LTA D;  3Q8Q B;  1UE7 A;  1LTG D;  1X54 A;  2K5H A;  4KHZ A;  4R4C A;  2ZM6 Q;  3GTG B;  1VQI A;  1D1I A;  1PRT D;  2EXZ A;  2W6O A;  2R3Z A;  5LL6 X;  2W6Q A;  4Q44 A;  4R8U A;  3IKJ A;  5IYB G;  1JOK A;  2K50 A;  2UXC H;  5C4X G;  4QWB A;  1OO9 B;  3G7L A;  1KJJ A;  3VMM A;  3CCQ A;  4EQO A;  1VQ5 A;  5KFT A;  4DR4 Q;  1Q1E A;  4YIJ A;  1SYF A;  2SDF A;  2ENB A;  3AFP A;  4ALP A;  4M9U A;  4XX0 B;  5EAY A;  4RGN A;  2RHQ B;  4AYB B;  4MA5 A;  2WII B;  1A15 A;  2J0T D;  4ZKB B;  4IAL A;  1KQS A;  1JMC A;  4LF9 L;  1HQR D;  1TWG H;  4RNM A;  5ELC A;  4X62 L;  1PA6 A;  5A2Q L;  1SJE D;  5JJZ A;  1R9T H;  5KFV A;  2Z4I A;  1KNE A;  2A6E D;  3MJF A;  2PI2 E;  3MR2 A;  4H13 C;  1IBK Q;  1SR3 A;  2C5C A;  4Q0Y A;  2FLL A;  1HZA A;  4FS2 A;  1GUO A;  1LT5 D;  3S1M H;  2A6E C;  5ELO A;  1PYB A;  1TWH H;  5C8Y F;  1L2F A;  2KHS A;  4IQZ A;  1G8Z D;  2ZDQ A;  2OEO A;  3PSI A;  1I94 Q;  3C1E A;  4AQY L;  4DR6 L;  1WTH A;  1QNU A;  4CKE A;  2FE3 A;  1M4V A;  1PFM A;  3MEF A;  4ZKC B;  4YQW A;  1Y8P B;  3CCE A;  2EYJ A;  3LP8 A;  1Z2P X;  5KG4 A;  1EWC A;  4NPS A;  4RCO A;  3A8J E;  4V0B A;  3I2Z A;  4E6I A;  2JA8 G;  4A2A A;  5DM6 3;  3HKZ B;  1CQV A;  1OXV A;  1ONL A;  3IG0 A;  4AIM A;  3G71 A;  4DK0 A;  5LA6 F;  3BDC A;  3NEN A;  5E1F A;  1QZG A;  1GM5 A;  2NBF A;  2F4V L;  4DV6 Q;  3UDI A;  2CW0 D;  4RKB A;  3M9B A;  2VUM G;  4UCR A;  3FHW A;  4HID A;  3H4D A;  2IX1 A;  2IPK D;  4O2A F;  3KHG A;  2D2C C;  2RHS B;  5ELN A;  2BDO A;  1SYX B;  5C5J A;  3M3Y H;  2R6F A;  2QDL A;  4LK1 C;  3V2T A;  3GTG H;  2NVT H;  1VQH A;  5IOD A;  3VYR A;  1VQC A;  4BY7 B;  2Z6K C;  1E4G T;  3T1H L;  4YWM A;  1F9S A;  1GUN A;  4I7A A;  4OHJ A;  1UWV A;  2RDI A;  3GQC A;  3ZJY C;  4DL3 A;  2NUC A;  1KRS A;  4DAV A;  1TQO A;  3M3Y B;  4GLV B;  3E3X A;  4LAA A;  2W6N A;  3IN5 A;  1AUX A;  1TVX A;  3FP9 A;  1EQV A;  4FBT A;  3E9I A;  4B3T Q;  5HGQ A;  1UEB A;  3U9S A;  1ZKO A;  3TII A;  4LFB Q;  2RVL A;  3U9O A;  1I7N A;  1Y1V A;  3RN2 A;  2Q2T A;  1C4Q A;  4XIG S;  3M85 A;  4LF9 H;  3DF7 A;  4U68 A;  3GTL H;  3RLN A;  3RR5 A;  1PH6 A;  3HOY G;  3TQ1 A;  2WKD A;  4XYO A;  1EOT A;  4NXM H;  4KKS A;  1GKH A;  1KNA A;  3BU2 A;  1SNQ A;  4A76 A;  4WJ3 M;  5BN3 A;  1ZHQ A;  1VCI A;  1M6V A;  4BBR G;  4LF4 H;  3G6J B;  3QOL A;  2F0K A;  2JA8 B;  2PMZ A;  2MPM A;  3P7J A;  4EGQ A;  2KCN A;  5EOY A;  4POF A;  5GAE C;  4KKT A;  5IT9 E;  2D62 A;  3ND8 A;  4N9P A;  4DUZ L;  4JI3 Q;  2FPI B;  3JAM W;  1EZ1 A;  1TXY A;  1YJN A;  5FO7 B;  5I6Y A;  3KHL A;  4LF7 Q;  1LTS D;  1IKM A;  3SE7 A;  4DAP A;  5KFE A;  3PIP 3;  3L9A X;  3HOZ G;  4LF5 H;  1EY9 A;  4BY7 G;  1S68 A;  1B70 B;  1ZXT A;  5IGE A;  2ASB A;  4IRC A;  4A3I G;  3RB4 A;  4IZO A;  3TS0 A;  3QZ7 A;  2HHH L;  3BYT B;  1E4E B;  4BWG B;  3OSN A;  2N8N A;  5HBR B;  3GV5 B;  3TQT A;  2WTF A;  1PRT B;  2CWP A;  4IOA A;  5EBD A;  5C44 H;  1YIT A;  2L11 A;  1C7Y A;  1TWA H;  4M7E A;  1XXG A;  3GTP H;  4GC7 A;  4JV0 A;  2RKS A;  4ME6 A;  4TVA B;  3KFU A;  2HDL A;  1A3U A;  4TKO B;  3V96 A;  4BA1 I;  1VAJ A;  2VQE H;  2NVY H;  4JI3 H;  4KV6 A;  5F2D A;  4DV2 L;  1H9S B;  4A3K B;  1EYG A;  4IRK A;  5M3F H;  3HKZ A;  5JVH 3;  4JI5 H;  3MZ5 A;  1UEA B;  2UVU A;  1GXD C;  1VF5 C;  4C3H B;  2JA7 B;  2D5D A;  4WRD A;  4KY7 A;  3PW0 A;  3OTO H;  1N8R C;  4JBK A;  4BBR B;  3KF8 A;  5IT9 W;  4DN4 M;  4G7Z C;  4LH6 A;  1HQM C;  3H3V I;  2R93 H;  1AH9 A;  4KN7 C;  2MNA A;  4A3D H;  1K83 B;  4HED A;  3DWP A;  3HOW G;  2SOB A;  4BBS B;  3Q8R B;  4PMB A;  4TUY F;  1SYD A;  1IOV A;  1SSO A;  3TQY A;  3CME A;  3V6K A;  4GNX C;  1BBW A;  1F2Y A;  2VQF Q;  4QIW E;  5BN5 A;  1TII D;  1WTR A;  4H02 A;  1KJ8 A;  2EY6 A;  2R7M A;  3MWY W;  5CV6 A;  3Q23 A;  4A3M H;  1Q7Y C;  1O7I A;  1K0S A;  4DV0 Q;  4DV7 Q;  3J80 i;  1B1Z A;  2H5X A;  4DXG A;  4B3M L;  4I4T F;  5IP7 G;  4DR1 H;  3DM1 A;  4RB2 C;  3RNU A;  3PO3 G;  4UCV A;  2AU0 A;  4JI7 H;  3GD7 A;  4HR7 A;  2E5L H;  3GTM A;  2JA7 A;  4RHR A;  1CKN B;  1HNW Q;  3PN1 A;  1GUW A;  5KT5 A;  1S03 G;  1WCM G;  2NVQ B;  3NE5 B;  4JV5 Q;  2NWG A;  2RSO A;  1N34 Q;  4F50 A;  3MXN B;  4OL7 A;  1I3Q H;  3I8Z A;  1BBU A;  3R5H A;  3PO2 H;  3OMC A;  4DUZ H;  4EBE A;  3M7G A;  2YTX A;  2DPI A;  2F0H A;  2CQA A;  3N6R A;  5KFY A;  3FMA A;  1AE2 A;  2ZT9 C;  1X32 A;  4YCU A;  1OWT A;  2WB1 B;  1SE8 A;  4CKB A;  2HIX A;  1YNN C;  2I80 A;  1YJW A;  3WO0 A;  1TY2 A;  3URY A;  4EGJ A;  3H0G A;  3NWT A;  1EUC B;  2L12 A;  3I12 A;  1L0Y B;  3UDF A;  5KFA A;  2HVQ A;  1TWA B;  1W96 A;  3S15 H;  4IFD G;  1S5D D;  3T1Y H;  4EVO A;  3KLS A;  3GTO H;  2K32 A;  4DV5 L;  1BGW A;  5C4X B;  1V8Q A;  3CVZ A;  5EQ0 A;  2F0T A;  4R9W A;  1PV4 A;  3Q8P B;  3GV8 B;  3M4Y A;  4YY3 L;  1FNU A;  4LUV A;  3LNN A;  3NHH A;  4DGZ A;  3D4D A;  4IWY A;  1YNJ D;  4OO1 I;  4OXP A;  1GSH A;  1SRU A;  1EL0 A;  1VQJ A;  4WJ4 A;  5ELD A;  2BQR A;  4O3N A;  2YV5 A;  1S0O A;  4RCN A;  4ED3 A;  4A3J H;  2BOS A;  3H09 A;  4BBS H;  4IFD H;  2YU9 A;  2EE1 A;  4UP9 A;  3SDZ A;  2ES2 A;  4DV3 L;  3GTQ B;  3DHQ A;  3HKZ G;  4RNN A;  4R4Q A;  1GHJ A;  3CF5 A;  3RBE A;  3R23 A;  1N34 L;  4P71 A;  5KGU A;  4GNX B;  3H15 A;  1D8L A;  2J9G A;  1NUC A;  5CV8 A;  5AFW A;  3BQ0 A;  4RWS C;  1B9N A;  4ECS A;  4X65 L;  3NBI A;  4LF4 Q;  4JOI A;  2DNC A;  4AQY H;  3AEV A;  3N43 B;  1PZI D;  2A68 C;  2DJG C;  3TEH B;  1FNV A;  3GTJ H;  1SFO B;  1JJC B;  5EWE A;  2Z1C A;  4I55 F;  5EBC A;  4MTN A;  3S14 B;  5KFP A;  2PW5 A;  1X9N A;  2OLS A;  4GN4 B;  4LF7 H;  1L1O B;  4A3K H;  4QWD A;  4R7R A;  2CVR A;  4FF3 A;  4ECU A;  3EA6 A;  4GOP A;  2XWB B;  4HCS A;  2FPG B;  2EJM A;  2SNM A;  4TQS A;  4KHP L;  3BA9 A;  5JVD F;  4H7B A;  3L7Z C;  4C56 C;  3PV0 A;  4DA2 A;  2JSO A;  1EQQ A;  2IMW P;  5JVL A;  2K03 A;  1EYC A;  3SGI A;  4IJL A;  4LJZ C;  4QY7 A;  2R7L A;  1H95 A;  1DGS A;  1PTO H;  5M5X H;  5IE8 A;  1VMP A;  1EU4 A;  3KUP A;  3ORQ A;  1FJG L;  4AQY Q;  3LX0 A;  1SEB D;  2K5D A;  2JA5 B;  2R92 A;  4Y52 H;  2W7P A;  4QW9 A;  1U9R A;  2NU8 B;  1M1K C;  3RTX A;  4XYQ A;  3J81 j;  3JAM E;  2JJQ A;  2DZD A;  2YRW A;  4O3S A;  4ED8 A;  1J9O A;  1FD7 D;  4A3M B;  4UY8 C;  2QGQ A;  4HNV A;  4DV1 L;  1PTO B;  1BDO A;  1HFG A;  3OPO A;  5IT9 L;  5I4D A;  5M5X B;  4MV7 A;  3FPP A;  2JEF A;  4GKJ Q;  1E3P A;  4TRD A;  3BZD B;  2N49 A;  1V9P A;  1Y1V G;  2CH4 A;  4NXN L;  4C3H H;  4QF4 A;  2YTV A;  4F88 A;  4NP5 A;  2R93 G;  1A63 A;  4QWE A;  3H3V H;  4WD3 A;  4I7Z C;  5I9O A;  1T3N A;  3IL8 A;  3AB9 A;  4R8U B;  1DV2 A;  2ZXR A;  1XDN A;  2VQD A;  4LF8 H;  2B8G A;  3OSO A;  1X65 A;  1CHQ D;  5JOB A;  1TWA A;  2AWN A;  1E2W A;  2FMC A;  5JJL A;  4J9O A;  2PN1 A;  1E2V A;  2A19 A;  2K01 A;  3E9H A;  1XNQ Q;  1TWH B;  3WWV A;  2PCF B;  2R84 A;  3MR5 A;  3KLW A;  2MQH A;  1N36 H;  1O7Y A;  5KG1 A;  5F9N A;  1VQ8 A;  1VQP A;  5C3E H;  4QWA A;  4BY7 H;  1SE2 A;  4AYB A;  4CC6 A;  4K8I A;  3K59 A;  5C3W A;  3FKI H;  4DV7 L;  4JC0 A;  3QOJ A;  1S10 A;  1TY0 A;  1Q1B A;  4J9P A;  3D31 A;  4JYA Q;  4Q43 A;  1KJQ A;  1QCB D;  1EFI D;  1ICF B;  1B6R A;  4LFA L;  1C30 A;  2KQ3 A;  5KT7 A;  2JA5 G;  3FKI B;  3S1Q H;  1JT8 A;  2E75 C;  2EVB A;  4AYB G;  2YS7 A;  1UNN C;  1X3G A;  2W9B A;  2EOT A;  4UDU C;  1YNX A;  1BKB A;  5A2Q E;  2XCP A;  2RGV A;  3OW2 A;  3T1H Q;  2VUG A;  2JA6 A;  2AQ2 B;  2NTS A;  3S1N H;  4X6A H;  4YBZ B;  1ILP A;  1CKM A;  1S0M A;  3X3M A;  1EYZ A;  2W7O A;  1G51 A;  1SEI A;  1ASZ A;  1YVC A;  4UFZ A;  4TQR A;  4DV2 H;  2OQK A;  1V1O A;  3I90 A;  1GGO A;  4HNT A;  5EJW A;  3CW2 C;  3ERQ A;  4ZCK A;  2O2L D;  2RDJ A;  5KYI A;  3F8N A;  3BYY B;  1X6O A;  1TU2 B;  2L4N A;  1RHP A;  2KVM A;  4KD3 A;  2UXB L;  3KDF A;  4X65 Q;  1XYI A;  2DLN A;  5KNC A;  1SFO A;  4PV1 C;  4O4H F;  3B6Y A;  3G6E A;  3TS2 A;  2XCL A;  5T1G A;  2HUG A;  2CQO A;  1JR0 D;  3DEP A;  3HOU G;  2YCH A;  2UXD H;  1XTD A;  3I4L A;  3QFF A;  4JI6 H;  4DR6 H;  4QIW B;  2E74 C;  4HJ8 A;  4HJA A;  2N55 A;  1NJI C;  3RUP A;  2JA6 B;  2V5A A;  2OCE A;  3PO3 H;  1PTO F;  5KNB A;  1HXY D;  1JWU D;  3T53 B;  4JCV E;  3S1R H;  1M90 C;  1KAW A;  1KDB A;  3SE0 A;  4CC5 A;  1I50 A;  1B04 A;  3M9O B;  3IFD A;  4ME3 A;  4IAJ A;  3SR1 A;  3UDX A;  5KFZ A;  5JEA H;  1SND A;  4JI8 Q;  3S2D B;  2IJ0 A;  4XQJ A;  1B44 D;  2Y0S E;  5EGT A;  1WTX A;  5KFX A;  1WD0 A;  4YY3 Q;  1I3Q B;  2BQU A;  1TS2 A;  1GUS A;  2I46 A;  4X64 Q;  4XTC S;  2NB0 A;  5M5W H;  1RD9 D;  4P2C B;  2NVQ H;  2FXQ A;  1DOK A;  2F3V A;  1HH2 P;  2B2W C;  2ALZ A;  4X3T A;  1Q82 C;  2V4R A;  1W3S A;  1XTC D;  4YHH Q;  5LMN L;  2V4Q A;  1JJG A;  5KIX A;  3EQL C;  3CKI B;  2MGS A;  4OWT B;  1YIJ A;  2VY3 A;  3PW5 A;  2LSS A;  1UC8 A;  2WB1 E;  2NVT B;  2R7F A;  2IY5 B;  1DJR D;  5KG5 A;  1KC8 C;  3OMG A;  1EEF D;  1EZ8 A;  2VA2 A;  3FMC A;  1R9T B;  3S1Q B;  4DK6 C;  2HGS A;  4RAZ A;  3ORR A;  4G4K A;  2VL6 A;  1I6V C;  3SK5 A;  1ICW A;  5C3X A;  5J2T F;  4B3T L;  2GPW A;  4JI8 H;  1TWF B;  4A3B B;  1WCM A;  4MV8 A;  5KKN B;  2Q8I B;  5KFK A;  2VQF L;  2WAQ B;  1PH2 A;  3A74 A;  3MFY A;  1B8A A;  5BPF A;  3ULJ A;  4JI0 Q;  2H1E A;  5CV7 A;  1ASY A;  1IYU A;  4F7X A;  5KFC A;  2EPB A;  1LO5 D;  2PYK A;  3EPI A;  1ILQ A;  4GOP C;  1TT2 A;  1X55 A;  4QQB X;  1D6E C;  3H4B A;  1IL8 A;  3BVG A;  5T1I A;  2PPB C;  5IYZ F;  1QVC A;  4CJ1 B;  1RL2 A;  1J5E H;  2HD3 A;  3CCL A;  1FGU A;  1IBM L;  3E0J A;  3MWD A;  4G7H C;  2PQA A;  1ENA A;  1IBL Q;  2UUC Q;  2KSW A;  1TWG A;  2DWC A;  3SI8 A;  4Q0F A;  1S72 A;  4FXK C;  1VKZ A;  1Q8K A;  3K7A H;  3QWN A;  4PWQ A;  3HG9 A;  3I7F A;  1VQE A;  3UQ8 A;  3JSL A;  2JA6 H;  4FO2 A;  1E22 A;  5C3E B;  1SCU B;  2HDM A;  2E2H H;  2L1B A;  1MBY A;  3T5L A;  1EY0 A;  4GLX A;  4HAE A;  3QB3 A;  5DAU A;  3KF6 A;  2XRQ D;  5KFQ A;  4GN5 A;  1CHP D;  1FNW A;  4HMJ A;  4UCS A;  3BS1 A;  3NBH B;  4JI4 Q;  2CFM A;  2HJW A;  2CQY A;  2EYP A;  4JBM A;  4JI0 H;  4BS9 A;  2UUA L;  3CCS A;  3LWE A;  5KT4 A;  2VR1 A;  2C2D A;  1DOM A;  2FLP A;  4NMZ A;  5KND A;  2YTY A;  1YEZ A;  4L5R C;  2GN5 A;  1C48 A;  5KFS A;  2BH2 A;  2CH4 W;  4QJF A;  3CC4 A;  3VYT A;  3GV7 B;  3CRK C;  1VQA A;  5M5W B;  4O3O A;  4JI5 Q;  4L63 B;  3N41 B;  2X0S A;  3GTL A;  3FKI G;  4Z9C B;  3OTO Q;  3OWF A;  1Y1V H;  3PUZ A;  4A93 H;  3AMU A;  2F0F A;  2M2L A;  2V58 A;  1PRT C;  1QNK A;  1AE3 A;  1EUJ A;  4DR1 Q;  2NVX B;  3PVX A;  3J7Y W;  5JEA J;  3ULL A;  4DR4 H;  3Q6S A;  1KBL A;  4QIW A;  1LTB D;  1CM9 A;  4ETS A;  3I4M H;  2IHE A;  4RKL A;  5LOV F;  3OYY A;  1PFN A;  4HIK A;  3S17 B;  4DR7 Q;  4R4T A;  1TWC A;  2Y0S A;  4K8J A;  3MFI A;  1IW7 D;  2VW9 A;  3HEJ A;  4OWX B;  1QE6 A;  2A1A A;  4YR2 A;  2FLN A;  2AUJ D;  3C3L A;  4JI5 L;  3J7A K;  3EFX D;  3JRX A;  4EYI B;  2FMA A;  3RB0 A;  2DIK A;  2F0E A;  2C35 B;  1ULZ A;  4PDB A;  3HGB A;  4RH6 A;  2PNR C;  1HTL D;  4KKU A;  1CA6 A;  3T5J A;  5CBA E;  3PR4 A;  3DXJ C;  4JI7 Q;  1CK1 A;  4ZUJ A;  5GAG C;  3PUV A;  2R93 B;  4EYH B;  3GIP A;  4FF1 A;  4FDB A;  4KLK A;  3KBX A;  4YAK B;  1RJT A;  5LYJ F;  1E0B A;  1U5K A;  4U6P A;  3MR3 A;  1MHW C;  3M9N B;  3GLK A;  2D9U A;  1SFO H;  4Q5V A;  4RGO S;  2TSS A;  3M4P A;  2AKW B;  1PMR A;  2EYM A;  2IX0 A;  2CKZ B;  2VB3 X;  5EZY F;  3S16 H;  2QW7 A;  3E0E A;  1Y1W B;  4NXN H;  2K04 A;  4A3L G;  4OIK A;  2IBK A;  4OEM B;  2I07 B;  4DV6 H;  2KEC A;  4LFB L;  5IIF A;  3VPD A;  5FLX L;  2JE6 I;  4B3R H;  5IP9 H;  3N42 B;  4RU9 A;  4PNY A;  1NTG A;  3TBI B;  4OX9 H;  4DFA A;  3MHB A;  4MIU A;  5E3F A;  1A3V A;  1HR0 L;  4JW0 A;  1DIK A;  2PI2 A;  1HTP A;  4DV7 H;  3NK9 A;  1SN8 A;  4DNI A;  3CC2 A;  3ER0 A;  3W2D A;  1WJJ A;  3UFX B;  4KJN A;  4F4Y A; 
#chains in the Genus database with same CATH homology
 1EWI A;  1E1O A;  1Y14 B;  2E5L Q;  1E1T A;  3RNU A;  3PO3 G;  1V43 A;  1VQD A;  3GD7 A;  2KCM A;  2B29 A;  4NXM L;  1CKN B;  3U4Z A;  4LF5 L;  1HNW Q;  1EOV A;  1WCM G;  1K0R A;  4JV5 Q;  1N34 Q;  2R92 G;  3MXN B;  4LNQ A;  1VQ7 A;  1I3Q H;  1OXU A;  1BBU A;  3I4O A;  5E7N A;  3J81 i;  3H0G H;  4LUZ A;  3PO2 H;  4JOI C;  3ICE A;  3DM3 A;  2YTX A;  4B3S Q;  4BY1 H;  4DV5 Q;  2VUM H;  4YCW A;  1I94 L;  2LXJ A;  2K5V A;  1UE1 A;  4NXN Q;  1AE2 A;  4YCU A;  4X64 L;  1PHJ A;  1SE8 A;  2EIF A;  1MKH A;  1K3R A;  2D0O A;  2HIX A;  1WYD A;  1YJW A;  4IFD I;  2KCT A;  4P72 A;  3AFQ A;  1QUQ A;  3UDF A;  1TWF H;  1KXL A;  1KL9 A;  2BA0 A;  4UP8 A;  4YCV A;  2AMC B;  3LGJ A;  3S15 H;  4A3F G;  4GKK L;  1WCM H;  4PZ8 A;  4IFD G;  2QEX A;  4C3I H;  1B7Y B;  2HHH Q;  2OQ0 A;  3NEM A;  1VQ4 A;  2WFW A;  1K8A C;  2Y0S G;  3GTO H;  2CCZ A;  3CC7 A;  4DV5 L;  4A3D G;  2WAQ E;  1KIX A;  5C4J H;  1JJ2 A;  1IL2 A;  2HIV A;  1PV4 A;  3TRE A;  2K4K A;  3H0G G;  1XNR L;  1XPU A;  2UXC L;  2L15 A;  1OXX K;  4OWW B;  2BA1 A;  5BR8 L;  1XMQ Q;  3CCR A;  1VQ9 A;  4YY3 L;  4LF8 L;  1Q86 C;  3S2D H;  4LUV A;  1KD1 C;  1Y1W H;  3KJO A;  4JI3 L;  4OO1 I;  4OXP A;  4DR1 L;  5J3B A;  1SRU A;  1VQJ A;  1VQB A;  4WJ4 A;  4B3M Q;  1HJP A;  2MO0 A;  2HQL A;  4R1J A;  2YV5 A;  4DV0 L;  1XJV A;  4AYB E;  1QVF A;  2IHF A;  4A3J H;  4BBS H;  2WP8 J;  3JC6 6;  1QUQ B;  4UP9 A;  4DUY L;  2YYZ A;  2ZJQ A;  4C2M H;  3EBE A;  2ES2 A;  4DV3 L;  4B3R L;  1SRO A;  3CPF A;  5JEA G;  4GLA C;  3HKZ G;  4A4I A;  5FJ8 H;  4P73 A;  4R4Q A;  1OTC A;  3CF5 A;  1D7Q A;  1N34 L;  2K75 A;  4P71 A;  4JV5 L;  2B3G A;  4P75 A;  3H15 A;  1D8L A;  4GNX B;  1PH3 A;  4LF4 L;  5IYD G;  4JI1 L;  1LTL A;  4YWK A;  4KHP Q;  1IXR A;  5GAH C;  4DR4 L;  4OON A;  1UE6 A;  4X65 L;  1YI2 A;  2QA4 A;  4LF4 Q;  4JOI A;  1NY4 A;  1Q12 A;  1PH8 A;  1Y1W G;  3AEV A;  2JA5 H;  1VQK A;  4PZ6 A;  4HJ9 A;  4L5T A;  1EIF A;  3TEH B;  3AQQ A;  3GTJ H;  4RMF A;  1JJC B;  1HR0 Q;  1CSP A;  4LF6 Q;  4MTN A;  2JA7 H;  2LXK A;  1X9N A;  4POG A;  4GN4 B;  3KOJ A;  2K5N A;  4JI2 Q;  1Q46 A;  3PUW A;  1L1O B;  3F2B A;  4MZ9 A;  1CSQ A;  2UUC L;  4A3K H;  2N78 A;  3ULP A;  4A3I H;  3PF5 A;  4DPG A;  1E7Z A;  1IBM Q;  3CXC A;  1YJ9 A;  4IPG A;  4A3E G;  3PO2 G;  4GOP A;  1N9W A;  1CKN A;  3K80 C;  2B63 G;  4JI7 L;  4BBR H;  5IY0 A;  2UUB L;  2GVA A;  2Q2U A;  3CP0 A;  4KHP L;  1OXS C;  4JI1 Q;  3UE0 A;  3L7Z C;  4PG3 A;  3PV0 A;  3J81 c;  1EQQ A;  1XMO L;  5BR8 Q;  1VQN A;  3T1Y Q;  4X66 Q;  5IP9 G;  3U4V A;  4A75 A;  3SGI A;  2PNH A;  1K83 H;  4NB3 A;  3K7U C;  2I0Q A;  2UXC Q;  5IWA Q;  4IJL A;  2UXD L;  4QY7 A;  1H95 A;  1DGS A;  5M5X H;  5LMN Q;  5AJ3 Q;  4DR3 Q;  3M4Q A;  3IRB A;  3KDF B;  5IE8 A;  3D0F A;  5IP7 H;  3Q8D A;  4DV2 Q;  2KHI A;  4AQY Q;  1FJG L;  2IT1 A;  2PQA B;  3GO5 A;  3JAM i;  4Y52 H;  2ALY B;  2R7Z H;  1I5F A;  5C0X G;  1M1K C;  2I5L X;  1LUZ A;  3CCM A;  4A3M G;  3J81 j;  2JJQ A;  3CD6 A;  2CWA A;  1U0L A;  2UU9 L;  4HIO A;  4IPC A;  4UY8 C;  2QGQ A;  1HZC A;  5LMU L;  4DV1 L;  5FLM G;  4A3C H;  4A93 G;  1IBK L;  5GAD C;  2UU9 Q;  2A8V A;  4A3G H;  2F3I A;  1WFQ A;  2NZH A;  3KF6 B;  3HOX H;  5JJL A;  4GKJ Q;  1E3P A;  1NE3 A;  1YHA A;  3OTO L;  4DV4 Q;  3F8T A;  2N49 A;  3CQZ H;  1PH9 A;  2OTJ A;  1V9P A;  1HNX Q;  1Y1V G;  4A3B H;  4NXN L;  4C3H H;  2YTV A;  5HY6 A;  2R93 G;  1A63 A;  4K0K L;  1MJE A;  4A3E H;  4EQ5 A;  2VZA A;  3H3V H;  3AYH B;  3UE1 A;  5AJ3 L;  4DR6 Q;  4K0K Q;  2Q2H A;  5IWA L;  5FLX c;  1X65 A;  4O2D A;  4DR7 L;  3RLO A;  2AWN A;  3K8A A;  4X66 L;  1N32 Q;  1X3F A;  1X3E A;  4UP7 A;  3UDG A;  1N36 Q;  2NVX H;  4GKK Q;  2A19 A;  4LF7 L;  3E9H A;  1XNQ Q;  1L1O A;  5M3F G;  3WWV A;  3PIO A;  3KLW A;  2MQH A;  1Q81 C;  4LUO A;  1VQ8 A;  2JA8 H;  1VQP A;  5C3E H;  1EQR A;  1J6Q A;  2R6G A;  4C3J H;  4BY7 H;  5M5Y H;  2MFI A;  1E24 A;  4DV7 L;  3FKI H;  4JC0 A;  4DAM A;  4JI2 L;  3L0O A;  3F2D A;  1Q1B A;  4X62 Q;  4L5S A;  4DAY B;  2JA9 A;  3D31 A;  1A62 A;  5C44 G;  4RG1 A;  3G4S A;  1N33 L;  1TWC H;  4A3G G;  4JYA Q;  2ZM6 L;  4MNO A;  3KJP A;  4OO1 G;  1P8L A;  3HFZ B;  2JK8 A;  3PIP A;  4DR2 Q;  3L2P A;  2UXD Q;  4LFA L;  3TRZ A;  3M4O H;  4R4I A;  2F52 A;  4HJ5 A;  3W1G A;  4PZ7 A;  1XMO Q;  4DKA C;  1EIY B;  2JA5 G;  4JI6 Q;  2K52 A;  3S1Q H;  1L0W A;  1QVG A;  2YU9 H;  2R7Z G;  4AYB G;  1JT8 A;  2Z0S A;  1X3G A;  5LMN W;  3HKS A;  4JI4 L;  1YNX A;  1BKB A;  2JQO A;  4JBW A;  4Y7N H;  2E5L L;  4YWL A;  3J7A 5;  3RZO H;  2AHO B;  3OW2 A;  4O0A A;  3T1H Q;  4TQU S;  3G48 A;  3S1N H;  4X6A H;  4APV A;  1CKM A;  5FLM H;  4A3C G;  2BH8 A;  1Z47 A;  2NN6 G;  3I56 A;  4BA2 I;  3ERS X;  4BXX G;  3RN5 A;  5GRO A;  1G51 A;  4A3F H;  1YVC A;  1ASZ A;  1UE7 A;  1X54 A;  2OQK A;  2K5H A;  4KHZ A;  4R4C A;  3A5U A;  2ZM6 Q;  4DUY Q;  1VQI A;  4JYA L;  3CW2 C;  3BJU A;  2WAQ G;  5IYB G;  2NN6 I;  2K50 A;  1PH1 A;  2F4V Q;  1NMG A;  1X6O A;  4A3B G;  5C4X G;  3HKZ E;  5C0X J;  2UXB L;  3KDF A;  3CCQ A;  1VQ5 A;  1KRT A;  4X65 Q;  4DR4 Q;  3STB D;  5K36 G;  2ID0 A;  3B6Y A;  3G6E A;  1Q1E A;  1PH5 A;  2GVB A;  3GTK H;  3TS2 A;  4BY1 G;  2V1C C;  2I5M X;  2CQO A;  3AFP A;  2D0P A;  4ALP A;  4DR5 Q;  4JI6 L;  1XNQ L;  2VNU D;  3HOU G;  5IYC H;  5EAY A;  4JI0 L;  1XTD A;  2RHQ B;  1VQF A;  1J5E L;  3HOV G;  2DUD A;  1PH7 A;  4YHH L;  1KQS A;  4LF9 L;  1JMC A;  1TWG H;  4OX9 L;  3PUY A;  3J80 c;  4HJ8 A;  4HJA A;  1NJI C;  3S17 H;  1YBY A;  1GVP A;  4X62 L;  2OCE A;  3PUX A;  1YHQ A;  1PA6 A;  3PO3 H;  1R9T H;  1M90 C;  3S1R H;  4JCV E;  1KAW A;  1YHB A;  4DV6 L;  4GKJ L;  2PI2 E;  1FL0 A;  5C4X H;  3BZC A;  1IBK Q;  4ME3 A;  1SR3 A;  5LMU Q;  4DV1 Q;  1XPO A;  2E8G A;  1HZA A;  3UDX A;  4JI8 Q;  2XGT A;  2Y0S E;  1SLJ A;  2R92 H;  4YY3 Q;  4LF8 Q;  3S1M H;  1WOC A;  1N36 L;  1XMQ L;  5ELO A;  2XTI A;  1PYB A;  4X64 Q;  1TWH H;  4XTC S;  1N32 L;  1HZ9 A;  1L2F A;  4IPD A;  3BZK A;  1XNR Q;  5M5W H;  4L5Q A;  1PH4 A;  2NVQ H;  3PF4 A;  2FXQ A;  1PVO A;  3CPW A;  3PSI A;  3U58 A;  1I94 Q;  2OWO A;  4LFC L;  4AQY L;  2HT1 A;  4DR6 L;  1HH2 P;  3MEF A;  1Q82 C;  1W3S A;  3K81 C;  4YHH Q;  4LFC Q;  5LMN L;  1CUK A;  2JA7 G;  1JE5 A;  2PMZ E;  2ZJP A;  3CCE A;  1JJG A;  1LM0 A;  3HOV H;  4NPS A;  4OWT B;  1YIJ A;  2VY3 A;  1I50 H;  2LSS A;  3I2Z A;  3EIV A;  3K0X A;  2JA8 G;  2UUA Q;  2WB1 E;  4LF5 Q;  1HNW L;  2R7F A;  2IY5 B;  1GD7 A;  1IZ6 A;  1OXV A;  2MO1 A;  1KC8 C;  4AIM A;  3G71 A;  3A0J A;  4DK6 C;  2EQS A;  1L1O C;  1GM5 A;  3NEN A;  1QZG A;  1IYJ B;  3NEL A;  4HJ7 A;  5DLQ E;  1HNZ L;  2F4V L;  4DV6 Q;  3UDI A;  1MIU A;  2VL6 A;  4A3L H;  3I55 A;  3W1B A;  3M9B A;  2VUM G;  3FHW A;  3M7N A;  4HID A;  4B3T L;  4PMW A;  2IX1 A;  1W2B A;  1S3O A;  4B3S L;  2RHS B;  1NMF A;  5ELN A;  2EXD A;  4P74 A;  2VQF L;  3M3Y H;  2KBN A;  1PH2 A;  3A74 A;  4GN3 B;  1FVI A;  1B8A A;  3ULJ A;  4JI0 Q;  2NZO A;  2NVT H;  1VQH A;  3KF8 B;  2DGY A;  1ASY A;  3GTG H;  4BXX H;  1A0I A;  4LWC A;  1VQC A;  2RCN A;  2Z6K C;  4DR5 L;  4GOP C;  3T1H L;  4YWM A;  1X55 A;  2VQE Q;  4EX5 A;  1EFW A;  2JEA I;  4QQB X;  1S40 A;  4JG2 A;  1QVC A;  1RL2 A;  1UWV A;  1MJC A;  4QL5 A;  3ZJY C;  1C0A A;  2VQE L;  3S24 A;  1FGU A;  5IYB H;  1IBM L;  3CCL A;  1KRS A;  1X56 A;  2PQA A;  1SMX A;  2Z6K A;  1IBL Q;  2UUC Q;  5C3E G;  1S72 A;  4IPH A;  4GLV B;  1Q8K A;  3K7A H;  3I7F A;  1VQE A;  1VQL A;  2JA6 H;  1E22 A;  4UPA A;  3FP9 A;  2E2H H;  2VS1 A;  3W5O A;  3GTM H;  5JJK A;  3CAM A;  3E9I A;  3CCU A;  4B3T Q;  5HGQ A;  4IFD J;  1CKO A;  1UEB A;  4GLX A;  1K73 C;  3HOW H;  2WB1 G;  1C9O A;  1G6P A;  3KF6 A;  4LFB Q;  3RN2 A;  4GN5 A;  2Q2T A;  2ZTC A;  1HZB A;  1A8V A;  4XIG S;  3M85 A;  2I5H A;  3NBH B;  4JI4 Q;  1UE5 A;  2CFM A;  3CMA A;  2AWO A;  3HOZ H;  3GTL H;  3RLN A;  3RR5 A;  2JEB I;  4JBM A;  1PH6 A;  2UUA L;  3HOY G;  3CCS A;  3S14 H;  2YTY A;  1YEZ A;  4L5R C;  4IOC A;  2GN5 A;  3U50 C;  3I4N G;  2BH2 A;  1GKH A;  1HR0 W;  1WI5 A;  4QJF A;  1K9M C;  3CC4 A;  1LYL A;  1Z9F A;  4B3R Q;  4DV3 Q;  1VQA A;  3BU2 A;  3STB C;  4A76 A;  4JI5 Q;  1QZH A;  4WJ3 M;  1N33 Q;  1VCI A;  4BBR G;  3FKI G;  4DK3 C;  5C0X I;  1HNX L;  3J7Z C;  3OTO Q;  4DV4 L;  4A3J G;  1Y1V H;  3PUZ A;  1HNZ Q;  4J15 A;  4POF A;  2RF4 A;  5GAE C;  3JAM c;  4A93 H;  3HOU H;  1PYS B;  1AE3 A;  1EUJ A;  1I6H H;  4DR1 Q;  4DUZ Q;  4GNX A;  3KYH C;  5JEA J;  2D62 A;  3ULL A;  4JI3 Q;  4DUZ L;  1KHI A;  1GO3 E;  1YZ6 A;  3CCV A;  1BVS A;  1TXY A;  1YJN A;  4LF7 Q;  3I4M H;  2IHE A;  1K8G A;  3OYY A;  4HIK A;  4DR7 Q;  4R4T A;  3PCO B;  2VW9 A;  4GOP B;  4KI0 A;  1PFS A;  4OWX B;  3HOZ G;  2A1A A;  4BY7 G;  4OX9 Q;  1B70 B;  4JI5 L;  4BBS G;  5M3M H;  4LF9 Q;  2ASB A;  1RIP A;  4A3I G;  3TS0 A;  2N3S A;  2HHH L;  2C35 B;  4HIM A;  5IYD H;  3T1Y L;  2Q2I A;  2N8N A;  3GTQ H;  3RLF A;  1OXT A;  4NXM Q;  2CWP A;  4IJH A;  2JA6 G;  5C44 H;  1YIT A;  3RZD H;  4IOA A;  4JI8 L;  5FJ8 G;  1TWA H;  4LW1 A;  1C7Y A;  4JI7 Q;  3GTP H;  5GAG C;  4GS3 A;  1V1Q A;  3F2C A;  4TVA B;  2UXB Q;  3PUV A;  3KFU A;  3S2H H;  1XPR A;  4FDB A;  4KLK A;  3CCJ A;  1VQO A;  2ATW A;  4BA1 I;  1VQG A;  2NVY H;  1U5K A;  4DV2 L;  1EYG A;  1FJG Q;  5JJI A;  3I4M G;  5M3F H;  3EN2 A;  4LF6 L;  4DR3 L;  3PGZ A;  3I4N H;  2ZTD A;  1J5E Q;  2ZJR A;  2K14 A;  5IT9 c;  4JBJ A;  1SFO H;  3HOY H;  1N8R C;  1IBL L;  4JBK A;  3M4P A;  5M3M G;  2AKW B;  1JB7 A;  1NBW A;  2IX0 A;  2B63 H;  2CKZ B;  2UUB Q;  3S16 H;  3H3V I;  2R93 H;  4AH6 A;  1AH9 A;  3E0E A;  1P16 A;  2MNA A;  2OTL A;  4A3L G;  2KEN A;  3VDY A;  4A3D H;  3HOW G;  2ZTE A;  3HOX G;  4LFB L;  2KHJ A;  4QGU A;  1G29 1;  4LFA Q;  3DLL A;  2JE6 I;  3TQY A;  3CME A;  4DR2 L;  4GNX C;  1BBW A;  5IP9 H;  2VQF Q;  4QIW E;  1NTG A;  2E2I H;  1VS0 A;  4H02 A;  5GQO A;  4R4O A;  5H1S E;  1T9H A;  1HR0 L;  3A5Z B;  4A3M H;  2PI2 A;  5IYC G;  2R7D A;  1Q7Y C;  1O7I A;  2E2J H;  1SN8 A;  3F1Z A;  4DNI A;  4DV0 Q;  3CC2 A;  1VQM A;  4DV7 Q;  3ER0 A;  2H5X A;  4B3M L;  1WJJ A;  4A3K G;  5IP7 G;  4IO9 A;  1VQ6 A;  3J80 i;  3GDE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...