2B63G

Complete rna polymerase ii-rna inhibitor complex
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 31-MER
publication title Structure of an RNA polymerase II-RNA inhibitor complex elucidates transcription regulation by noncoding RNAs
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase/rna
total genus 24
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2005-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2b63G02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2b63G01
1Z47A 1X6OA 2Z6KC 3S1RH 1PH3A 3I56A 1XMQL 5LMUQ 3G4SA 1CSPA 1YJ9A 2NVXH 4LFAQ 4DV6L 5IYCG 3S24A 4JI0L 1TWGH 1NJIC 2WAQG 4GLVB 4IJHA 2OWOA 4UY8C 5IWAL 2KBNA 2EXDA 2CCZA 1TWFH 1JJGA 1NMGA 4OWXB 2UUBQ 3Q8DA 3K7AH 1J5EL 1XTDA 1KC8C 1EQQA 1PH1A 4LF7Q 2ASBA 1A63A 1FJGL 3M3YH 3TS0A 3HOXH 1EUJA 3H0GH 1EFWA 2EQSA 3CPWA 3GTMH 3K81C 2K5VA 4GOPB 2E2IH 2UU9L 5M5XH 4C3IH 1UE6A 1UE1A 4YWLA 4BY1G 2A1AA 1VQ9A 1CKNA 4DV0Q 3JAMi 4JI7L 2BH8A 3S1NH 1HZBA 1PH2A 3PUWA 1NMFA 1VQAA 2VQFL 1N33Q 1Q86C 4DR1L 1I3QH 3H0GG 3G6EA 4A3MH 2JQOA 2V1CC 4PZ7A 3OYYA 4QIWE 1E1TA 4A3KH 2CWPA 1V1QA 3KYHC 2AMCB 2MNAA 1X3FA 4A3JH 3J81i 1QVFA 4IFDG 5GAHC 4DNIA 1G6PA 4J15A 4NXNL 1TWHH 3J81c 3T1YQ 1PA6A 4KI0A 2RHQB 5M5WH 3BZCA 3CCEA 4LF5Q 4GS3A 4A3MG 1QUQB 2R6GA 3OTOQ 1ASZA 2UXDQ 1AH9A 2ZJRA 1GVPA 2JE6I 2WB1G 3MEFA 4TQUS 1WOCA 5J3BA 2Q2UA 3GTOH 4A3KG 1PH8A 1HNXL 3HOWH 2OTLA 3E0EA 2PMZE 1MKHA 4A3JG 3I4NH 4BXXH 1YVCA 2XTIA 5HGQA 5JEAG 1HR0W 1E3PA 1YBYA 3KF6B 3RN2A 1VQLA 3CCSA 1I94Q 3HFZB 3D31A 4O2DA 1N34Q 4OWWB 4A93H 3KF8B 4A3GH 4LF9Q 3CQZH 5JJLA 4LFBL 1A62A 1K73C 4C3HH 3J7ZC 1L1OB 1SROA 3BJUA 4HIOA 3HOWG 4JYAQ 5C3EH 5IE8A 1E24A 1YZ6A 3I2ZA 1EYGA 3CMAA 3J81j 4DV5L 4BXXG 4OXPA 3MXNB 1I50H 3PF5A 1UE5A 1K0RA 2ES2A 2IHEA 1QVGA 4BA1I 4DR4L 1PYBA 3ULPA 2R7ZH 4X66L 4A3GG 2OCEA 4A93G 3KLWA 1KRSA 1YNXA 2KCTA 3EBEA 2BA1A 1CKOA 2I5LX 1N8RC 4LF4Q 4WJ4A 1HNWL 4JBMA 2PQAA 3RZOH 1NBWA 4PZ8A 3I55A 5C3EG 4GNXA 4A3DH 5C4JH 2ZTDA 2UXCL 3OW2A 2MFIA 1K8AC 4A3FH 2F3IA 4L5QA 4B3SQ 3K8AA 4L5TA 4NPSA 4YHHL 4O0AA 1XPOA 4A3LH 1OXTA 4AH6A 1EQRA 3BU2A 4DR2L 2N49A 4LNQA 4DV2Q 4FDBA 1IBLQ 3TS2A 1CUKA 4IO9A 3AEVA 4X62L 1HH2P 5K36G 4A3FG 1U5KA 5GAEC 3BZKA 3J80i 3S17H 1E7ZA 2HIXA 2B63H 4R4TA 4A3LG 2I5MX 1YI2A 3J80c 4PG3A 4DR5L 1KRTA 4JI3L 4YCVA 4JI2L 4UP9A 2K4KA 3AQQA 1XNQQ 2K5HA 2FXQA 2NVQH 4DKAC 1VS0A 3AYHB 3F2DA 1HZCA 2IT1A 4A4IA 1EIFA 2JA8G 2YV5A 4B3RQ 2B63G 4DR7L 2N8NA 5BR8L 2F4VL 4QQBX 4JI1Q 5LMNQ 3T1HQ 4LF8Q 4BY7G 1I6HH 4K0KQ 4X65Q 2K52A 4R4OA 4YWMA 3HOUH 5LMUL 2CFMA 3F1ZA 1SLJA 1X55A 4JBWA 4YCUA 4DUZQ 3U58A 5IYDH 1PYSB 4GOPA 4GKKQ 3J7A5 1AE2A 4DV7Q 4DR6Q 1L0WA 3KFUA 2R92H 4AQYQ 2VUMH 3PIOA 4PMWA 1X3GA 4UP8A 1PFSA 5GQOA 5IYBH 2UUBL 1KIXA 3CC4A 3HOUG 1VQ7A 2ZTCA 2ID0A 1LTLA 5IYDG 2UUAQ 2IX1A 5GROA 1RIPA 1K83H 4IFDJ 4LF7L 4BY1H 5C0XI 3HOYH 1WI5A 3CAMA 2NZOA 2R92G 2VUMG 3HKZE 2GN5A 2ATWA 3H3VI 4IOAA 3AFQA 2HT1A 4P72A 3FKIH 3HOVH 1D8LA 2Q2HA 1B7YB 2AHOB 5IYBG 3CCRA 1IZ6A 3PUVA 4QGUA 4GLAC 2RCNA 1K9MC 1WJJA 4JI8Q 3UDGA 1XMQQ 1YITA 1VQKA 5JEAJ 4OX9Q 3G48A 4DV0L 3RNUA 3D0FA 3HOYG 1N33L 1WFQA 2QA4A 1E22A 3PUYA 3DM3A 2E5LQ 3IRBA 5DLQE 2PNHA 4HIMA 3FKIG 3GD7A 3JAMc 1YEZA 4ME3A 3HOVG 1O7IA 1QVCA 3ER0A 3KF6A 3NEMA 3UDFA 4C2MH 3CMEA 3HOZH 1YHQA 2KCMA 4HJ7A 1HJPA 3EN2A 1WYDA 1A8VA 1OXVA 3G71A 1X54A 2D62A 4OWTB 2KENA 3HKSA 3T1YL 4R1JA 1DGSA 3K0XA 1L1OA 2VQEQ 1JJ2A 4L5SA 4POGA 1GM5A 5IP7H 4LF5L 2BH2A 4QL5A 1NE3A 3OTOL 2UXDL 5E7NA 3PCOB 4IPDA 3U4ZA 5C44G 3HOZG 1BBWA 1MJEA 4TVAB 1TWCH 1YHBA 3ULJA 1JB7A 2R7DA 2VW9A 4JI6Q 1I94L 4DR1Q 1N34L 5IP7G 4EQ5A 4KHPQ 4LF9L 1JMCA 4A3CH 4WJ3M 2I0QA 2UUCQ 2JA5G 1VCIA 1TXYA 4DV4Q 3PO2H 4X6AH 2K50A 2F52A 3PO3H 1C0AA 4KHZA 3GTQH 3M4OH 1N9WA 3F2CA 1S72A 5FLMG 3PIPA 1PH6A 4A3CG 1CKNB 5EAYA 2BA0A 2Y0SE 4NXMQ 3CPFA 1XNRQ 4L5RC 4LF4L 1MJCA 2OTJA 4A75A 1VQFA 1IYJB 3HKZG 4LUZA 4RG1A 1XMOQ 4B3MQ 3PO2G 4Y52H 3E9IA 4BBRH 4JI4Q 3PO3G 1VQEA 1VQ5A 4UP7A 4B3SL 4IPCA 1OXSC 3A5UA 3S16H 2OQ0A 2GVBA 1HZ9A 2LXJA 5FJ8H 3KDFB 5IY0A 3STBC 2R7FA 2MQHA 3K7UC 2AWOA 3A5ZB 3F2BA 4DUYL 4LFBQ 1NY4A 3GTJH 1QZGA 3ICEA 1VQIA 2WAQE 4DV2L 1IBLL 4X64L 4BBRG 1VQPA 1VQ6A 2IY5B 5ELNA 4GNXC 1QZHA 1PH4A 1N36Q 4QJFA 1VQHA 4BA2I 1VQJA 2UXBL 2R93H 2VL6A 4LFCQ 5FJ8G 4DV1Q 4DV3Q 2JA8H 2IHFA 1RL2A 2JEBI 3W1GA 1G291 3A0JA 4HIKA 3SGIA 1N32Q 3H3VH 4BY7H 1XNQL 1HZAA 2Z0SA 4JV5Q 1BVSA 2UXCQ 1V43A 2JJQA 3S1MH 1EOVA 1VQBA 2YTYA 1PHJA 4GKJQ 4YHHQ 4DAYB 3CCMA 4JI1L 2E8GA 4P73A 5C0XG 5LMNL 4GLXA 4YY3L 3T1HL 3NBHB 4JI5Q 2CWAA 4LF8L 3GTGH 2YTXA 1P16A 4X65L 4YWKA 2PI2A 1YIJA 4K0KL 2DGYA 2XGTA 4R4IA 2C35B 2YYZA 3STBD 3S1QH 2E2JH 4JOIA 2ZM6Q 4DUZL 4B3TQ 2JEAI 3CCUA 1B8AA 4DR7Q 2OQKA 1Y14B 4HJ9A 1KQSA 4JBKA 3RLNA 1B70B 1XJVA 4GKKL 5AJ3Q 4IPHA 3LGJA 4DK3C 1IBMQ 4LFAL 4DR6L 4HJ5A 3TEHB 4AQYL 1NTGA 3M4QA 2R93G 5IP9H 3NELA 2ZJPA 3NENA 3GDEA 4MZ9A 3KOJA 3ZJYC 1HR0Q 2K14A 1VQNA 2Z6KA 2CQOA 2UUAL 1W3SA 1LM0A 5IT9c 1HNZQ 2WB1E 4DR3Q 4GOPC 2B29A 3PUXA 4GN5A 4QY7A 3CD6A 1CSQA 2HHHQ 1VQ4A 3M7NA 1GO3E 3FP9A 2NVYH 1J6QA 1FVIA 4OONA 2JK8A 5IP9G 1EWIA 3CW2C 4XTCS 3CC7A 1S40A 1IBKQ 1IL2A 4AIMA 2VS1A 3WWVA 1CKMA 3GTPH 3W5OA 4LF6Q 4C3JH 3H15A 4JI8L 4LUOA 3KJOA 5H1SE 1UE7A 2NN6I 1LUZA 1S3OA 2NZHA 5HY6A 3ULLA 4OX9L 1SN8A 4LUVA 2NVTH 1PH9A 2LSSA 5JJKA 4YCWA 1QUQA 4DV6Q 2E2HH 1SMXA 1D7QA 2K75A 1OXXK 2E5LL 1GD7A 4JI0Q 3S2DH 5IWAQ 3TRZA 1AE3A 4P75A 2Q2TA 2ALYB 5C44H 1M1KC 3U50C 2CKZB 1J5EQ 1VQOA 3UDIA 3A74A 2VQEL 1VQ8A 1LYLA 2PI2E 5GADC 1OTCA 1FJGQ 1KD1C 3CCVA 2D0PA 4R4QA 3TREA 1SFOH 1XPUA 1KXLA 3M4PA 4MNOA 3EIVA 4LWCA 2AKWB 2JA5H 2UU9Q 1GKHA 1T9HA 1Q1EA 3GTKH 1Q82C 4JI6L 1OXUA 2JA7H 2VNUD 3HOXG 2N3SA 4JI7Q 1Q7YC 4KHPL 1JE5A 1UWVA 2KHJA 4RMFA 2VQFQ 1L1OC 3U4VA 4AYBE 2UUCL 3K80C 2MO0A 3E9HA 2L15A 3M9BA 5FLMH 1K8GA 1EIYB 4ALPA 1A0IA 1C9OA 4DV4L 5C4XH 3KDFA 4PZ6A 3L2PA 2HIVA 5LMNW 4JYAL 4POFA 4OO1G 2JA7G 4A3IH 3RR5A 3RN5A 3CCLA 3S2HH 1KAWA 1X56A 1SE8A 3KJPA 4NXNQ 3JC66 3DLLA 4NXML 2H5XA 2IX0A 1XNRL 1Q12A 5M3FH 1Q1BA 1M90C 2QEXA 1JJCB 1L2FA 1XMOL 3UE0A 1MIUA 4B3ML 5C4XG 3L0OA 5ELOA 4DPGA 4JI4L 1X9NA 1X3EA 1Y1VH 1HNXQ 2WFWA 3TQYA 1X65A 4A3IG 3PUZA 4A3EH 5C0XJ 3CF5A 2JA9A 2A19A 4DAMA 4P71A 2AWNA 4A76A 5M3FG 1IXRA 4JBJA 4KLKA 4MTNA 2RHSB 1PH7A 4DK6C 1W2BA 2RF4A 1YJWA 3I4NG 4IFDI 1Y1VG 5JJIA 1N36L 4OO1I 1WCMH 2WP8J 3CXCA 4A3EG 1VQMA 1PH5A 1YJNA 3GO5A 4DV5Q 3RLFA 4HIDA 4LFCL 3W1BA 1Y1WH 4DV1L 1Q8KA 2QGQA 4IJLA 4DV3L 4BBSH 4DR4Q 4X66Q 1H95A 4JCVE 3UDXA 1N32L 2N78A 3L7ZC 3PGZA 1G51A 3I4OA 1K3RA 4JV5L 1Q46A 4P74A 3VDYA 2EIFA 4NB3A 2JA6H 1HNWQ 1FGUA 3RZDH 1WCMG 2ZJQA 1BBUA 3F8TA 2VZAA 1SR3A 2GVAA 4H02A 4XIGS 1Y1WG 4LW1A 2R7ZG 4GKJL 4B3RL 4BBSG 4EX5A 4JI5L 1SRUA 3PSIA 5FLXc 2Q2IA 3ERSX 4JC0A 4DUYQ 4HJ8A 3UE1A 5M5YH 4A3BH 1KL9A 1TWAH 4A3DG 3M85A 4UPAA 1UEBA 4X64Q 2ZM6L 4B3TL 2JA6G 2HQLA 4DR2Q 4AYBG 2K5NA 4GN4B 5AJ3L 1Q81C 2NN6G 1JT8A 1Z9FA 1IBML 1PV4A 4X62Q 2UXBQ 3I7FA 3S14H 4DV7L 4GN3B 4IPGA 3PV0A 1ASYA 3CCJA 2PQAB 3PF4A 2YTVA 1I5FA 3I4MH 4GNXB 2LXKA 3CP0A 5M3MH 4DR5Q 4Y7NH 1HR0L 4JI3Q 2I5HA 3CCQA 4A3BG 3CC2A 1XPRA 4JI2Q 2VY3A 1BKBA 1P8LA 2MO1A 1PVOA 1V9PA 1HNZL 3GTLH 1E1OA 1U0LA 4JOIC 3RLOA 3B6YA 2ZTEA 4R4CA 4DR3L 2YU9H 3S15H 1YHAA 4HJAA 2HHHL 1FL0A 1VQDA 2D0OA 1KHIA 2Y0SG 5IYCH 2A8VA 1VQCA 2KHIA 3FHWA 4YY3Q 4IOCA 5BR8Q 4APVA 4JG2A 1R9TH 1IBKL 1C7YA 2F4VQ 3I4MG 5GAGC 2B3GA 5M3MG 4LF6L 3AFPA 2DUDA 1VQGA
chains in the Genus database with same CATH superfamily
1X6OA 1EEID 2JXMB 2Z6KC 3N42B 2YRXA 5IGGA 1LT3D 4PMCA 2PMZA 4IJHA 4DL5A 3ORQA 4X3SA 3Q8SB 2CCZA 2CH4W 3K0YA 3RBDA 5KFOA 4I4TF 3RIZA 2WV6D 1U4LA 1WCMB 2ZXOA 1FJGL 3M3YH 5A2QW 4K6LA 4F4XA 1EUJA 2AQ3B 3H0GH 1EFWA 2EQSA 5KT6A 3W3AA 1I94H 1N34H 1KNEA 1SNCA 4UFZA 4NLGA 4YWLA 1VQ9A 4HSVA 1WTQA 3M9NB 1SNQA 1CKNA 3VPDA 4RZQA 4IFDH 1Z2OX 3K5HA 1HZBA 1N33Q 3PUWA 3QIAA 2VQFL 5CA0F 1S9FA 2I07B 1Q86C 4DR1L 2GPWA 1V1PA 4B9XA 3MXGA 1NSNS 2JQOA 3N52A 1B3QA 5M5YB 1E1TA 3Q24A 1U4RA 3S1QB 2XC9A 2PZWA 4A3JH 4JI4H 5J22A 2XWBB 5JEAH 1G6PA 1AW7A 3T1YQ 3J81c 2WE6A 3S14B 2RHQB 5M5WH 4R9WA 1BCPB 4GS3A 3OTOQ 1AH9A 3TQ1A 2LMCB 4RAUC 4Y7NB 2C2RA 1CQIB 2OH2A 4TQUS 1WOCA 2E2HA 4A3KG 3KALA 3OWFA 2OTLA 3E0EA 3TIIA 3P75A 5KGUA 1EUDB 1DV2A 5H80A 4BXXH 5HGQA 1HR0W 1VKZA 4L6TB 3CCSA 1EYCA 4O2DA 4A93H 2J0TD 2AUJD 4UCRA 5JJLA 2A73B 5D1PA 5JVH3 5CAEB 1A62A 2BE5C 4JYAQ 1E24A 1LT4D 1SFOA 2K05A 1GUWA 1K0RA 1JKJB 2A5HA 3GIDA 2Q8TA 4DR4L 4RFBA 4HYKA 4O3SA 4O4IF 3NTIA 1KRSA 5EKLA 3GTKA 2I5LX 4DNRB 1TWFB 2L4NA 3CKIB 1HNWL 4JBMA 3RZOH 4TV9F 4GNXA 2FFKB 5C3EG 2QILA 2RDIA 2W6QA 2AGPA 3SR1A 2UXCL 3BDCA 3OW2A 2FB9A 4L5QA 3IFTA 4O0AA 1XPOA 3R2TA 4A3LH 3HOXB 4ZRZA 5KG4A 1I4RA 2W7OA 1HHVA 4M7EA 1IBLQ 3TS2A 2BE5D 5M5XB 4KD3A 1BNZA 3NWSA 5I2XA 1E7ZA 3BJYA 2C5CA 5ISRA 1YI2A 2HHHH 2NTSA 2PW7A 3J80c 1KRTA 4DR5L 5IT9W 1Y1VA 5CR3A 1H9RA 1QNUA 4A3MB 2K4KA 2SNSA 4RGTA 3I70A 2FXQA 1PTOB 2NVQH 2W6OA 1MD2D 1Y8NB 2YS6A 4MTDA 2UVWA 1EZ8A 1VS0A 2VB3X 3T5LA 1EIFA 2YV5A 2B63G 3OIPA 5JAVA 4QQBX 3O13A 5KT7A 1AN8A 1TWHB 1GJXA 4YAJB 3RAXA 4X65Q 2K52A 1JCKB 3RFCA 4YWMA 1EY6A 2YZNA 5LMUL 4RNNA 1SLJA 3U58A 1PYSB 3Q8QB 3HOWB 4GKKQ 1J5EH 1M7JA 1ICFB 1L0WA 3KFUA 1RTNA 1X32A 2RQXA 5IYBH 4H0LC 2CW8A 1KIXA 2W9AA 3JAME 3HOUG 3CQZB 4QB4A 2ID0A 5IYDG 2UUAQ 1H9MA 1K83H 2BDOA 4LF7L 4RHRA 1E4GT 2DNEA 2R8JA 2EPBA 4QW8A 4MV3A 2R92G 2VUMG 3BVMA 2GN5A 4O42A 2ATWA 4IOAA 4JI7H 5EGTA 3LWEA 2R7ZB 3FKIH 3HS0C 2B2TC 2DNCA 4BBSB 3J81E 4QGUA 1EHIA 5HBRB 1SMYC 2QW7A 2A68C 3UDGA 1GUOA 1XMQQ 1YITA 4OX9Q 3G48A 1I4XA 3FPUB 3KBGA 1GSAA 3MZ5A 4A3DB 4NP5A 1RJQA 4O3OA 3RB0A 3QO2A 5C4JB 4IUPA 5LA6F 2NU8B 1F9QA 3Q22A 4WFN3 1SE4A 1YEZA 4ME3A 3SI8A 1RCVD 3ER0A 5DNFA 4FVMA 3HOZH 4Q0FA 1B6SA 3C1EA 2ICIA 2WAQA 4A3BB 3I3CA 2F0DA 3D4DA 1WYDA 1X54A 1LTAD 1R4QB 3HKSA 4R1JA 2I8CA 1DGSA 2BH2A 4LF5L 2UXDL 5C44G 3PCOB 3PW5A 4ILWA 1DZ1A 2C22A 1SMYD 3RMHA 2A68D 1TWCH 2F3VA 2RA4A 2WKCA 4U68A 3MA2B 1PDQA 2QKIC 3GTLB 1I94L 1N34L 4ECVA 1RJTA 3KHHA 5IP7G 4DFAA 2F03A 4A3CH 4ED0A 1W93A 2JA5G 1I6HB 3JRWA 1GSHA 4F87A 4QWBA 4X6AH 5JH7F 3H0GA 3BQ2A 4EGJA 2F0GA 4EFBA 4KD4A 3JAML 3GV7B 2MPMA 3M4OH 2PN1A 5GONF 1S72A 4KN7C 5FLMG 1PH6A 4CDFC 2C00A 1ET9A 4L5RC 4LF4L 3K3VA 3KXYT 2UVUA 2ASDA 3J80E 3T13A 2JSOA 1IYJB 4RG1A 2XD4A 5KG5A 2KEDA 1STNA 3E9IA 4BBRH 4JI4Q 3PO3G 4DR2H 1BR9A 1LTTD 2O4XA 2B8GA 2KOLA 2A6ED 4IPCA 1OXSC 4ZUJA 4O2BF 1DXMA 4BY1B 2GVBA 5IY0A 2MQHA 3K7UC 4DUYL 4LFBQ 2HQEA 2QK4A 3G6JB 3HOVB 3N6RA 2X69A 3OHAA 1TKWB 2CVRA 1VQ6A 2RKSA 5ELNA 3MAQA 4C3IB 4BA2I 4B08A 1IW7C 1D5ZC 2JA8H 1Y8PB 2JEBI 4APMA 4MV7A 1DOLA 5NUCA 2F4VH 4WBNF 3H09A 3R2IA 2Z1CA 3SGIA 1XNQL 1HZAA 4C2MB 2GLTA 4R8NA 1BVSA 3VR3A 2JJQA 2WTFA 1EOVA 4Q5VA 2Q8RE 3CCMA 4P73A 4GLXA 3GTMH 3T1HL 2R93H 4JV0A 1YIJA 1P16A 2EYFA 2PI2A 3HP3A 2E2JH 4JK1C 3OHBA 1JLLB 4DL6A 1Y1WA 3RLNA 4IPHA 3LGJA 3TEHB 1S03G 1LTRD 1IW7D 3LP8A 3GDEA 3KOJA 4RKLA 2K14A 4LMQD 1VQNA 1H9SA 3AMUA 2Z6KA 2BOSA 3IKJA 3OOCA 1SDFA 4HAEA 1GLVA 1QILA 3V05A 5KFHA 5IT9c 2KUMA 3PO2B 1AN7A 5EBCA 4QY7A 4DR7Q 2UU9H 2LS01 2HHHQ 4DV0H 3J80L 1EQTA 3SE7A 1RKNA 1EU4A 3S16H 1EWIA 4XTCS 1IBKQ 2ATLA 1HXYD 1I50B 2VS1A 4UHVA 3W5OA 4V0BA 5KFLA 1EWHA 1LO5D 3TSSA 5KT3A 4HN7A 5LL6b 2ALZA 1I4QA 2TMPA 5H1SE 3KJOA 1D1KA 1LUZA 2NZHA 5HY6A 2NVTH 5BPHA 1EYAA 1SN8A 2PNRC 5AFWA 4J9QA 5K5PA 5C5LA 2FK2A 5KG0A 1SMXA 3SK5A 5A2QE 1D7QA 3I90A 1CQFA 1GD7A 2M05A 1K0SA 2R8GA 4CJ1B 3QZ8A 1HRJA 2Z9HA 2WYOA 5ELFA 4C3JG 5KFNA 1ESRA 4HMJA 2CKZB 1BO0A 2AQ4A 1J5EQ 3RTXA 3A74A 2G9DA 4F50A 5GADC 2V9WA 3JSNA 3QZ7A 2D0PA 4OELB 3S17B 1KXLA 5KFZA 2R82A 5KFEA 3EIVA 4LWCA 2PMZB 5KT5A 4BY7B 4KY5A 3SK6A 1TWGA 2R61A 1CTMA 2JA7H 4OO1H 3HOXG 1UC9A 2XGQA 2KVMA 4JI7Q 3TP8A 4ED8A 2KHJA 3DEPA 1L1OC 1VF7A 1PFBA 3K80C 2MO0A 3M9BA 2L15A 1K83A 5IODA 1AUXA 1HQRD 4YJ2F 3TINA 3ONAB 4FS1A 3A8KE 3R8BA 4F88A 2CQYA 2VR1A 4LSAA 4A3IH 1FYCA 3RN5A 3VA5A 3S2HH 3HZXA 5FD6A 1IKLA 1SE8A 4JVZA 5E4XA 3SK4A 1XNRL 1SNDA 2KHSA 1L0YB 2QEXA 1JJCB 3KLSA 1S68A 4XDXA 1S5CD 3L0OA 4ZQ3A 4ZI7F 1TY2A 1X9NA 2NZ1D 4DV2H 1XX8A 3PUZA 1CZGA 1V1PB 3D4RA 3DM1A 3U9SA 3RUZA 1G2TA 4DAMA 4IAJA 3HOYB 2AWNA 4LMYA 4NDXA 1QE6A 4A76A 1DOMA 3M9MB 4MTNA 1PH7A 2JYOA 4DK1A 1S5ED 5A2QL 2F0HA 1STHA 1KJJA 1S4ZA 5LXTF 1N36L 4LH6A 1SYGA 4N9PA 5A35A 3NSWA 4DAVA 1NCVA 3RLFA 3TZDA 3W1BA 4YP3A 1EZ6A 4DV1L 4DV3L 4KHVA 2E2HB 3ND9A 3PIO3 3EPGA 3S2DB 1H95A 4JI1H 5JOBA 3Q8PB 4YY3H 1U9RA 4PQXA 2JA6H 4P74A 2R86A 4TQSA 4DUZH 1CHQD 1BBUA 1DM0B 3HG9A 2RSNA 4H02A 1HFGA 2R7ZG 4EBDA 4BBSG 4EX5A 4JI5L 5IT9E 3CQZA 5KX5F 3L4JA 3FRPB 4UCUA 4A2AA 3WOEA 1CA5A 4AQYH 1RYSA 4HJ8A 2AGQA 3KAKA 3UE1A 2B39A 1SFOB 4A3DG 4B3TL 4DR2Q 4ECYA 1JT8A 3T51B 1IBML 3DF7A 3GTKB 2UXBQ 5BN5A 2HJWA 1JWSD 2R6FA 5IGEA 4GNXB 4CDDC 5I9OA 1HR0L 3CCQA 2VXWA 4A3BG 4UCTA 3CC2A 1XPRA 2PZUA 1PVOA 1V9PA 1HNZL 3C46A 3BA9A 4JI8H 4XYQA 3B6YA 2YU9H 1YHAA 1FL0A 3MC0B 3QB3A 3MHBA 2F0KA 3CVZA 3V6KA 1BXTA 5BR8Q 1R9TH 2F4VQ 1O80A 5BN4A 1ILPA 1KJ8A 5GAGC 1JX4A 4LF6L 5C5MA 3V4SA 3CU7A 2BDNA 4DN4M 1EIHA 3RV3A 3VPBA 5M3FB 3R23A 3PW7A 1A9XA 4A2BA 2NVXH 4CGYB 3I56A 4LFAQ 1D5XC 1Y1VB 5IYCG 1S10A 4JI0L 4EEQA 4DL2A 1NJIC 4UY8C 5EWGA 1RK6A 3T1YH 1NMGA 2CW0C 5C5JA 2P5ZX 2K1BA 4EBCA 3GTMA 5KEEA 2J6UA 3GLKA 1CHPD 3DWAA 3T5JA 3TS0A 4ZK9B 2W57A 3PIP3 4KHPH 3K81C 2K5VA 1JDEA 2UUCH 4JV1A 4EYHB 2UU9L 2A6HC 2V58A 4Z9CB 4BY1G 5G3LD 1DV1A 4K6DA 4DV0Q 3JAMi 2BH8A 3S1NH 4JYAH 1GYFA 4HQ6A 4X3UA 5EZYF 1FGBD 2Z4IA 2V1CC 3OYYA 2CW0D 4DNTB 4C3IG 2HCCA 4A3KH 2RDGA 1XMOH 3A7LA 2NUAB 1X3FA 3J81i 2YRWA 4J15A 4NXNL 1MBYA 4KI0A 1EY8A 2RDHA 3CCEA 1DOKA 2C28A 3RGXA 2R6GA 3I4MB 3JZIA 4H44C 5M3MB 1GVPA 2ZJRA 2JE6I 2WB1G 2PPBC 5J3BA 1PH8A 1HNXL 2F0QA 2MUYA 2PMZE 1MKHA 4HNUA 1YVCA 2XTIA 5L1LA 2F3WA 3DEOA 4CC6A 2ENBA 1JWMD 2N88A 2K7VA 3D31A 2WINB 2IJ0A 3HFZB 4OWWB 1RODA 5KG1A 3LX0A 4J9NA 2WAQB 3G6YA 3J7ZC 1GUNA 1SROA 4HIOA 2R87A 1EYDA 5C3EH 1K8OA 4JV5H 1YZ6A 4DV5L 3PR4A 2F0PA 4HNVA 3PF5A 2ES2A 1UE5A 1QVGA 4BA1I 2OEOA 2IWHA 3ULPA 4X66L 4A3GG 4J9OA 2RGRA 5L1IA 1YNXA 3QG1A 3K6OA 5KFMA 2JA7A 2SOBA 1A3UA 1JE4A 4WJ4A 1L0XB 5FLXW 4Q45A 1LTGD 3IN5A 4FP5D 2QF7A 3I55A 2FE3A 4BWGB 5C4HA 2ZTDA 1V1OA 1K8AC 5L1JA 4NPSA 4YHHL 3M3YB 2W9BA 1A2TA 1KDBA 3H0GB 1PYWD 3GQCA 4RKBA 1HPCA 3MR5A 4DV2Q 3J7AV 2FLLA 5DG8A 4IO9A 5COYA 5K36G 5EDWA 3KTMA 3J80i 2HIXA 2B63H 4R4TA 3VR4A 5LP6F 4BS9A 1KDCA 1B9NA 2L55A 1T94A 3U9TA 2EYHA 3BYYB 4DKAC 4FF1A 2O03A 4HMIA 3NE5B 1XMQH 4A4IA 3N43B 5KNCA 3L4KA 4B3RQ 4A3JB 4OX9H 2N8NA 2A69C 3GTJA 1K28A 4JI1Q 4RNOA 4BY7G 5ELDA 5KFCA 4RGNA 5IWAH 5IYZF 1PFNA 5KT4A 3GIKA 3CHBD 4ECWA 3HOUH 5KNDA 2CFMA 4DUZQ 1X55A 5IYDH 4G3IA 1KAAA 1VMPA 5FO7B 3J7A5 1GHKA 4DV7Q 3MR2A 1E2ZA 1JR0D 2R8IA 1B04A 2R92H 4OGQC 4AQYQ 2VUMH 3R5HA 2JA6A 4A3EB 4PMWA 5C6AA 1X3GA 1JOQA 1VBHA 1PFSA 1RF2D 4MA5A 1JOKA 5CBAE 4C5AA 1LTLA 4IFDJ 1RIPA 3GIIA 3CAMA 4J6HA 1B6RA 1SE3A 2NZOA 1G91A 3AFQA 2A69D 4DK0A 4P72A 1Y1WB 4CC5A 4N8X1 1QCBD 3CCRA 2R7LA 4IUQA 1T36A 2Y0SA 1K9MC 4JI8Q 1EYZA 5KFWA 3LWUA 5JEAJ 5D14A 2JN4A 2IBKA 5DGAA 3HOYG 1N33L 2QA4A 4TQRA 1UC8A 1H9SB 4K2KA 3Q2OA 5L1KA 5DLQE 4K5XA 4HIMA 4TSSA 3K59A 3GD7A 3JAMc 2YU9A 3UDFA 3GIQA 1II3A 1STYA 4NW2A 1BCPC 1SYXB 2YZGA 1R9TA 1HJPA 4UAIA 4F4ZA 1SAPA 3EVQA 1ZXTA 3T1YL 4ZYSA 3GTPA 1L1OA 1JJ2A 2HDMA 5J1ZA 4DXFA 5IP7H 1FNUA 2SNMA 4QL5A 3OTOL 2NVXA 2ASJA 1DD2A 2ICEC 1ET6A 4QW9A 4LFBH 2NVQB 3ULJA 1KC7A 2R7DA 2ZDHA 3EJIA 4DR1Q 4IRDA 1M0WA 4KHPQ 1JMCA 4WJ3M 2I0QA 1SYEA 2UUCQ 4ECZA 4K5WA 4CDEC 1ENFA 1XXGA 2PO4A 1TXYA 4HEDA 2R3ZA 1SEBD 1FD7D 1MSGA 3MFHA 2K50A 1R4PB 3PO3H 4PDBA 1BCPD 3OHXC 3HBLA 3GTQH 1L2ZA 3WNZA 4EGVA 2EY1A 5EAYA 1TWGB 1EY4A 5CC4A 1N56A 1MJCA 3P7JA 1W96A 3PN1A 4A75A 1XMOQ 2DJFC 3DHQA 2F0SA 5I6YA 1K83B 2L5TA 1D2BA 1B44D 1FR3A 3K7AB 1PLFA 3VMMA 1EL0A 1HZ9A 1GUTA 4MTEA 5KFRA 2R7FA 1QB5D 5CA1F 3F2BA 3FKIB 2WAQE 4JI3H 5CV7A 1GGOA 3BDLA 1IBLL 2FLPA 4X64L 4JI2H 3BAAA 2RVLA 2SDFA 3H4BA 3KLRA 1QZHA 1PH4A 4QJFA 1QG7A 1E4EA 3HXLA 1PTOC 5FJ8G 2FMMA 4DL3A 3A56A 2XVSA 2IHFA 1RL2A 4DR7H 3T53B 2MJ8A 1A15A 3I73A 1IBKH 4Y8VB 1B9MA 2VA2A 2Z0SA 1LABA 4JV5Q 3K58A 2UXCQ 2RGVA 1V43A 5I9PA 2EXZA 1D5MC 2JEJA 4GKJQ 2E75C 5J2TF 3H94A 5K2MA 5C0XG 2QCPX 3GTGH 2CWAA 4R8UA 1SYCA 1UUPA 3BYTB 4YWKA 1B53A 4X65L 2DGYA 3S1QH 2YYZA 2C2DA 1EOTA 3CCUA 2UUBH 2OQKA 1KQSA 4JBKA 2W6ZA 4GKKL 4DLKA 1B70B 1XJVA 3H4DA 5AJ3Q 3G6XA 4HJ5A 1EY0A 3M4QA 2QYZA 1PTOD 3NELA 2PZTA 2NWGA 4FS2A 1D6EC 4H7BA 4MZ9A 3ERQA 2DPJA 4AYBA 2FP4B 4FBTA 2CQOA 3BVZA 2UUAL 1BQQT 1SXTA 3GV8B 5IIFA 4YR0A 4C3HB 4GOPC 4GN5A 2VA3A 5CV5A 1VQ4A 3FP9A 4OONA 5IP9G 3M4OB 1TWAA 1IL2A 4MA0A 2EY2A 3WWVA 4AIMA 1CKMA 4U673 4C3JH 3I72A 2B2UC 3ULLA 1QWYA 1W6JA 2EOTA 4OX9L 2B63A 4LUVA 5JJKA 4YCWA 4BBRB 1CA6A 4DV6Q 4LH7A 2K75A 1GOZA 2F0MA 2AGOA 5IWAQ 4A3FB 2L12A 3R5XA 1STEA 3MJFA 3ORRA 5DAUA 5T1GA 2Q2TA 3RGZA 3RBEA 1GUSA 1I4PA 3V2TA 2V5AA 5CYUA 3TP7A 4Q0YA 3UDIA 1ZYRD 1TIID 1VQ8A 2PI2E 3WOFA 1OTCA 1WVLA 3CCVA 2JA8B 3N8DA 1V8QA 4LF9H 2XNAC 2VOBA 4FXGC 1GKHA 5FKAC 1T9HA 1Q1EA 4CBVA 1Q82C 1U4PA 3GILA 4ZKCB 2QEJC 2A6EC 4HNTA 2N3SA 4O4HF 2RDFA 1JE5A 1TS4A 4RMFA 3U4VA 3GTMB 4ETSA 4O3RA 1PTOH 1EIYB 3TP6A 5J2UF 2FJ2A 5F9LA 1A0IA 4MV1A 1B2TA 3FEWX 2D5DA 2E2JB 4POFA 3RR5A 1F9RA 4FNFA 2W8LA 2K5WA 1KAWA 3E5SA 5F2DA 5L37A 1WR2A 4LAAA 3KJPA 4B3SH 3JC66 1YNNC 2IX0A 2P0AA 2XCLA 4XZ3B 3UE0A 1MIUA 2DJGC 4FXDA 4JI4L 5KFPA 3D8GA 2WFWA 3TQYA 5I47A 2J4XA 1B33N 4IWXA 2UXBH 4P71A 2L9HA 4RCOA 3S16B 2W70A 3MWEA 4U7CA 4BWSC 5FLXE 4DAYA 2RHSB 5EPKA 3LMLA 5KFQA 3TP5A 4J1MA 4DK6C 3N40P 2RF4A 3NBHA 4OEMB 4C5CA 5JJIA 1ESFA 4OO1I 2NVTB 4ECTA 3NUCA 3NQTA 3CXCA 4A3EG 1VQMA 2K28A 1PK8A 5KT2A 2R8KA 1Q8KA 2MGSA 3GV3A 2SCUB 4BBSH 5BPFA 3EROA 4JCVE 5LMNH 1YNND 2N78A 3PGZA 5BR8H 4LF8H 4K0KH 1K3RA 3HEJA 5KFUA 3VDYA 1BXRA 2EIFA 4NB3A 3WO0A 1FGUA 3RZDH 1PXUA 1WCMG 2NUCA 4XIGS 2VZAA 1Y1WG 4LW1A 4FXKC 4HR7A 4LFAH 4DR6H 3PMFA 4DUYQ 3ERSX 1VMCA 3M7GA 3TDQA 4WORA 4A3BH 3HRZC 4UPAA 4J9PA 5DG7A 2HQLA 4C1NK 4YQWA 4KKTA 1Q81C 4GN4B 2NN6G 1Z9FA 4X62Q 2F0TA 5DQHA 4GN3B 2JA7B 4RB1A 3PV0A 3PZPA 2YTVA 1I5FA 2LXKA 2LKVA 3BG5A 3N44B 4JI3Q 5KFTA 4JI2Q 4RB2C 1F2YA 2X6GA 3GIMA 3GTLH 4HCEA 1E1OA 4JOIC 2UVRA 4QIWA 4R4CA 2W9BB 3S15H 2A8VA 2HHHL 4RAZA 1VQDA 5IYCH 1KHIA 5I6WA 4A3IB 2KHIA 3F8NA 2EYMA 1IBKL 1C7YA 1Y8OB 5C8YF 3Q8RB 1BNCA 2E5LH 5DLFA 1DONA 3VYSA 1S97A 3H91A 3S1RH 3N6XA 2G5DA 3G4SA 2W8KA 4O3NA 2FK1A 5FLXL 3S24A 5ELBA 3DXJC 3X3MA 1M4VA 4RZRA 1MGSA 4XX0B 2VQEH 2EXDA 1EQVA 3EQLC 1CFMA 4OWXB 2UUBQ 3OSNA 3IAYA 1J5EL 3GTJB 3NHHA 3GTGA 4CKEA 1EQQA 5DEHA 1PH1A 3FDSA 5KFFA 4JI6H 2KSWA 4UCOA 3HB9A 1H9JA 2EJGC 2EYOA 2E2IH 1TT2A 1FNWA 2ZT9C 1UE6A 1UE1A 4C3IH 2A1AA 2MCTA 4DV4H 2JA6B 2JEGA 4JI7L 5EPJA 1CI3M 1CQVA 1C3OA 4ECQA 3GQBA 1I3QH 4CJ2C 1C8CA 3G6EA 1J9OA 4QUFA 1TA8A 1ILQA 4NXMH 1U4MA 3QFFA 1H9KA 3G6VA 3D6WA 1V1QA 3KYHC 4B3MH 2H1EA 2IA6A 2AMCB 2JP1A 2MNAA 1RJPA 5GAHC 2NYZD 4DNIA 3FKIA 1PA6A 2Y0SB 1I6VC 2B2YC 1KBLA 3BZCA 3BQ1A 4A3MG 2YYAA 4Q8EA 1ASZA 4DU9A 4KY7A 4Q43A 3FPPA 3MEFA 4MN3A 1F2ZA 2EDGA 3GTOH 1RK5A 4KV6A 4XYMB 4DL7A 3I4NH 1VF5C 4N9TA 5DM63 2YU9B 1YBYA 2YS7A 4ZOLF 3RB6A 1C30A 1O7YA 4LFCH 3KF8B 4A3GH 4EYIB 3NK9A 3GP7A 2FINB 1R9TB 4LF9Q 4FBUA 1K73C 3QOLA 3K57A 1N32H 2XWJB 3GTPB 4IZOA 1L1OB 3I4LA 3HOWG 5IE8A 1RJRA 2NVXB 4ME5A 2EE1A 1LACA 3J81j 2EJMA 1I50H 1ICWA 1PYBA 2NB0A 2DLNA 3KHRA 1G2SA 2OCEA 4EGQA 4G57A 4B3RH 2KCTA 3EBEA 1JICA 3VYUA 4ZAIA 1CKOA 5KYLA 1TWCA 4C3HG 2F0EA 4C1NI 5LYJF 1IOVA 3RAQA 2PQAA 3FDTA 4XQQA 2ZM6H 4PMBA 5K36H 2AQ2B 3DUZA 2MFIA 4B3SQ 3K8AA 4L5TA 1TAEA 1DCZA 1OXTA 4DV7H 3Q6SA 3I8ZA 5D1OA 3HKZA 3BU2A 3T5KA 1PRTC 1JIHA 4DR2L 4RNMA 2N49A 4LNQA 1IYUA 2F0OA 3AEVA 1XDNA 1HH2P 2AU0A 4A3FG 1U5KA 1E4FT 3S17H 4DR3H 2Z6BA 2R7MA 2I5MX 3S1NB 4FF3A 3QWNA 4YCVA 4G7OC 2K5HA 1HUNA 4S3SA 2EY5A 4J8QA 2KJXA 3F2DA 2IT1A 5C4XB 2JA8G 2X0SA 3N41B 5FPRA 3SVMA 5BR8L 2V4QA 2F4VL 3M4YA 2J7ZA 5LMNQ 4LF8Q 1TQOA 4X3KA 4K0KQ 2EVBA 1XWEA 4R4OA 1M8AA 1E4EB 1T3NA 1PRTD 4JBWA 4YCUA 4GOPA 1I6UA 1SJHD 2W6NA 4DR6Q 3OMGA 2EJFC 4LJZC 3TN2A 1FJGH 1LTSD 1O78A 2M9VA 4IQZA 3MVVA 1RDPD 1C48A 2B2TA 3NTKA 3KHGA 3CC4A 1SYBA 3QR8A 1VQ7A 2ZTCA 4XT1B 2EYJA 4R8UB 5C3EB 4FO2A 5C0XI 1WI5A 3HOYH 2BQ3A 2R93A 5JPNC 2FPIB 2VQFH 2HT1A 1NR2A 1D8LA 2TSSA 5D8DA 2AHOB 5CV9A 1J8IA 1IZ6A 4DR1H 3J7YW 4GLAC 2RCNA 3OSOA 1WJJA 4M1UB 5EQ0A 3AU7A 1PX2A 1B3AA 4DV0L 3D0FA 4F8MA 4NMZA 4XYLB 2N55A 2HD3A 3UI2A 1IKMA 1E22A 3PUYA 2AQ1B 4AYBB 2E5LQ 4EFEA 3IRBA 5EBDA 2C2EA 4E6IA 1RYRA 2PNHA 1K1SA 3HOVG 3OUUA 3SXHA 5C1OA 3J81W 1O7IA 3KF6A 4IHJF 2EY6A 1TS3A 3CMEA 5KIXA 5BMVF 3MR6A 4J9KA 1LTID 3EN2A 1TWAB 5DGBA 3OWEB 1A8VA 1OXVA 3BVGA 5FPOA 1STGA 2KA7A 1O7ZA 3K0XA 2VQEQ 2J9GA 3V6JA 2B63B 4WD3A 1NE3A 3MXNA 5E7NA 4IPDA 3U4ZA 3NWTA 4IALA 1YHBA 2E74C 1JB7A 4JI6Q 3MFGA 1MSHA 1PRTF 4RB0A 1CS0A 1JWUD 4QWDA 5EWFA 4DR4H 2F0WA 4M9UA 4DV4Q 3HOUB 4ZCKA 1HNWH 1EEFD 1YNJC 2E2IA 2UXCH 1N9WA 4JV2A 1T5EA 2R92B 4NXMQ 2Y0SE 4GKJH 3CPFA 2IMWP 5IGCA 3FMCA 1SEIA 2OTJA 2D2CC 2W6MA 4B3MQ 4LUZA 4Y52H 3PO2G 1GSOA 1I3QA 1SNPA 1ZEQX 2F0NA 2V59A 4UP7A 2RBMA 2V4RA 2OQ0A 2WB1A 2LXJA 5FJ8H 1XTCD 3STBC 2PBZA 3RUPA 5G3LF 4EG0A 1NY4A 3ICEA 1VAJA 4DR5H 5JVLA 2GPSA 4DV2L 1NUCA 1E0BA 3R93A 4QMGA 4ZQIA 2O2LD 3V4ZA 4K14A 1AFPA 1VQHA 1VQJA 4LFCQ 2HVRA 1YNJD 3VR6A 3GTOA 1X3QA 5C0XH 3SK8A 2W9CA 5KG6A 3URYA 4HIKA 1G291 3A0JA 3JRXA 3H20A 3A8JE 1N32Q 1M6VA 5KFYA 4YIJA 2EYLA 1DIKA 4ZHQF 3S1MH 1JOOA 1VQBA 1PHJA 4YHHQ 4DAYB 4EEYA 4JI1L 1MZBA 4CJ0B 4YY3L 4UCSA 3NBHB 4XQNA 2D9UA 3ETHA 4DV6H 2B8FA 2CQAA 3AB9A 4ECRA 2XGTA 4R4IA 3STBD 2C35B 2BQRA 2PCFB 5M5WB 4JOIA 3VYRA 2ZM6Q 4DUZL 2JEAI 4K8IA 1B8AA 4YAKB 1Y14B 2O5IC 4G4KA 1WH2A 4WJWA 5KYIA 3NQIA 1LLRD 3RB3A 4LF7H 1O7LA 4EQNA 4AQYL 1CM9A 3KUPA 5IP9H 3RB4A 3NENA 3OPOA 4A93B 3KBXA 2R7NA 3E0JA 2DY8A 4HR7B 1W3SA 1LM0A 5DG9A 2HVSA 4F7XA 3K3PA 1AZPA 1Q8IA 4DR3Q 4V190 3CD6A 3PO3B 3PUXA 3M7NA 2R85A 1CSQA 5C4ZA 5CGKA 1GO3E 2NVYH 2YW2A 1FVIA 2G9HD 3CC7A 1S40A 3GTQB 2MHVA 3SE0A 4RHSA 1WTHA 2F0IA 3H15A 2PYKA 4JI8L 1T5XD 5FO8B 1UE7A 2NN6I 1EFID 2IX3A 4YR2A 3ND8A 1PH9A 2LSSA 1Z2PX 4YJ3F 2XN9C 3RZOB 1PZJD 3BG3A 4ED1A 4C5BA 1B4OA 1OXXK 3UQ8A 5KFBA 5IGDA 2XCAA 4GC7A 2QDBA 3QOJA 5HURA 4LF5H 4QIWB 4FF4A 3OSPA 2UXDH 2K33A 2OF1A 5C44H 2B2WC 3PW2A 1M1KC 4ZKBB 1VQOA 3KF8A 1WTPA 1ZQ7A 3U9OA 3NBIA 1LYLA 1FJGQ 1NR4A 2VUGA 1EY7A 3TQTA 1KD1C 1VBGA 3TREA 2XGPA 2PW5A 1G8ZD 5FO9B 2NU9B 2JA5H 1JB3A 5BN3A 3UFXB 4X3TA 1TR5A 1MHWC 1OXUA 5LL6X 1STAA 4QF4A 3FVQA 2B2YA 3SEBA 4KHPL 2VQFQ 5DQGA 4QWAA 3C3LA 4AYBE 2UUCL 3C0FB 3GTGB 1K8GA 5I4DA 5FLMH 4RCNA 3Q1KA 4LSXA 3EPIA 1S0NA 3MEHA 3KDFA 5D65A 1TY0A 4LF4H 2HIVA 5LMNW 4JYAL 2EYPA 1V4YA 2KCCA 3CCLA 5IGFA 3R5FA 1HQMC 1STBA 4ID6A 3DLLA 2H5XA 1W6KA 1K1QA 2F0UA 5E4WC 2R84A 1Q1BA 1XMOL 5C4XG 4DUYH 2XIWA 1I7NA 1F9SA 5ELOA 2R8HA 1X65A 4A3EH 4MIUA 3GV5B 3CF5A 2JA9A 3J7AK 1ML0D 3BS1A 4X62H 4ZUIA 4I7ZC 5M3FG 2FPPB 3A8IE 4KLKA 3V96A 4EVOA 4C3JB 1KJ9A 1Y1VG 1XNQH 1WCMH 2VQDA 1TVXA 1YJNA 3GO5A 4HIDA 1PMRA 1Y1WH 1K3BC 2V4DA 1WTRA 1ENCA 2QGQA 4IJLA 1CQJB 4DR4Q 3UDXA 2KECA 3T1HH 1CK1A 1G51A 4HCSA 4I65A 2J6TA 1JORA 4JV5L 1WSCA 1Q46A 1HNWQ 1PFMA 3ZYYX 3HOZB 4IZ8A 2NN6H 3F8TA 1SR3A 4KJNA 4GKJL 3OMCA 5FLXc 4FYDA 1UNNC 5IOCA 5M5YH 1KL9A 4IRCA 3M85A 4X64Q 1KEEA 1JC7A 1JDBB 4MTKA 3MWDA 4AYBG 5AJ3L 3BDOA 2VPQA 2K03A 4UDUC 5CORA 4DGZA 3S14H 4ECSA 1TWCB 2ZXPA 2PQAB 3PF4A 4DR5Q 4YBZB 1GXDC 1BCPF 4Y7NH 4DL4A 2I5HA 3K5NA 2FPGB 4O3PA 2VY3A 2CZGA 4IUTA 3DWQA 1U0LA 3RLOA 4DF7A 3M4IA 5T14A 3EA6A 5D1OB 3RF2A 3HKZB 2D0OA 1ZYRC 1VQCA 4IOCA 4JG2A 5M9OA 1TS5A 1ZKOA 3I4MG 5M3MG 5KFGA 4UCVA 2DUDA 1VQGA 2OXPA 1Z47A 4I50F 3M9OB 3HGBA 2L11A 5FK9C 1PH3A 1XMQL 4IR9A 5LMUQ 2R7KA 1CSPA 1YJ9A 1MI2A 1KABA 5JJZA 4DV6L 5C1PA 1SNMA 1A3VA 3L9AX 1TWGH 2HVQA 3V6HA 2WAQG 4GLVB 3GIJA 2OWOA 4RWSC 3T56B 5IWAL 2KBNA 4JUZA 1TWFH 1JJGA 1KLGD 5DM73 2LY7A 3A54A 3T16A 2K32A 1S0MA 2DY7A 3Q8DA 3TZUA 3K7AH 1KTKA 2RDJA 2W7PA 1XTDA 1KC8C 3C2PA 4LF7Q 2ASBA 1A63A 3HOXH 2IW3A 3CPWA 2MP1A 4GOPB 4KY6A 1AP0A 4JW0A 3W2DA 1WD1A 3TIGA 2KCNA 5M5XH 2FMAA 4IWYA 4GZYC 2R92A 3RZDB 2VUMA 3TMEA 4H13C 3K5IA 1PH2A 4ME6A 1K8MA 1NMFA 1VQAA 2PQEA 4PNYA 2BQUA 3H0GG 1Q3LA 4A3MH 5KFXA 1HTLD 1EY9A 4PZ7A 2R93B 4YB8B 2PVPA 1XNRH 4QIWE 2F4IA 2NVYA 2CWPA 1PTOF 4MV4A 3IL8A 3KLSX 1QVFA 4IFDG 1S0OA 4PV1C 1QJOA 1TWHH 2FMCA 4LF5Q 1I4HA 1Z2NX 5FOBB 1QUQB 2UXDQ 4OHJA 1DJRD 2IPKD 1B1ZA 3RV4A 2Q2UA 1RTOA 3HOWH 4A3JG 1SJED 5JEAG 1N36H 1E3PA 3KF6B 3S15B 3RN2A 4EQOA 1C4QA 1I94Q 1N34Q 1VQLA 4QWEA 1WTWA 3MR3A 4DV1H 4DV3H 5C3XA 2Z8LA 1FNVA 3CQZH 4K2LA 4LFBL 5ELEA 3KAJA 2VB2X 4C3HH 4EBEA 2ZXRA 3BJUA 1IYVA 2I46A 3S1RB 3I2ZA 1EYGA 3CMAA 4BXXG 4OXPA 4GC6A 3MXNB 2IHEA 4A93G 2R7ZH 2JA5A 4IUNA 3KLWA 2FJZA 4JI5H 2DWCA 4OIJA 2BA1A 4MV6A 5DLGA 1N8RC 4RH6A 2AUKA 3X3NA 4LF4Q 1ONLA 1KJQA 4ABNA 1NBWA 4PZ8A 4IRKA 4J9RA 2B2VC 4A3DH 4KMUC 4IR1A 4B3TH 1HTPA 3LNNA 5C4JH 3J81L 5FD5A 4ECUA 2OLSA 1SNOA 1IL8A 3D6CA 2F3IA 4A3FH 4ED3A 1IBMH 4KKUA 1WD0A 2F0VA 4U6PA 3PVXA 4AH6A 1I4GA 1EQRA 2J6SA 3OIQA 5E1FA 5HGTA 3NXWA 2F0JA 2E2IB 2ZJTA 1HR0H 4FDBA 4HSPA 3GTQA 1CUKA 2E2DC 4X62L 1HNZH 4J9MA 5KFKA 4Q8FA 5GAEC 3BZKA 3E3XA 5J39A 2EZVA 4A3LG 1VDZA 1O75A 4PG3A 1HCZA 1F2LA 4ULLA 4JI3L 4CHTB 1I3QB 5KG7A 4JI2L 4UP9A 4LF6H 2M00A 5CB4F 3AQQA 2M2LA 5EPLA 1XNQQ 3IG0A 2WB1B 1WTOA 3S9WA 2NTTA 1EIGA 4KTAA 5D3DA 1BBXC 5L9XA 3AYHB 1HZCA 4KKSA 1SYFA 1QNKA 1D1IA 4DR7L 3RD4A 2L1BA 4JI0H 2OT2A 3S2HB 4J0MA 3T1HQ 1AZQA 4C56C 1Z6HA 1I6HH 1SBBB 1WCMA 2DN8A 4QUCA 4I7AA 4RUAA 1CE8A 3SHLA 4IUUA 3F1ZA 1RHPA 3GTOB 2W9CB 1GHJA 4TV8F 2NU7B 1AE2A 3I4NB 4DXGA 5LHY1 4L8JA 2XSCA 3TBIB 3PIOA 3H40A 4A3GB 4UP8A 3J7AF 5GQOA 2I80A 2UUBL 2FKLA 4TUYF 4FM9A 2IX1A 1BGWA 5GROA 1EUCB 2CW7A 3GV6A 4BY1H 1AEXA 1NAPA 4XXEA 1GUGA 3P1HA 3HKZE 4WRDA 3H3VC 3QJYA 3H3VI 2DPIA 2F0LA 2E76C 1LTBD 2Q2HA 1B7YB 4KJOA 5IYBG 1WTXA 3HOVH 3PUVA 4O4LF 2GA4B 5KG2A 2B2WA 2UVVA 4ECXA 5KFVA 4J9LA 1VQKA 4G7HC 2ZDGA 2ZDQA 2A74C 1LT5D 3P20A 4KK7A 3RNUA 3PW0A 1AUVA 3H6MA 1WFQA 1Z7TA 5DQIA 3DM3A 1E2VA 1ZHSA 2FHTA 4L63B 1WTVA 3FKIG 4NXNH 1QVCA 3NEMA 4O1NA 4C2MH 1M0TA 2JEFA 3C1FA 1YHQA 1B50A 4PWQA 2KCMA 4HJ7A 4RA8A 3BZDB 3G71A 3VYTA 2BR0A 4J9SA 2D62A 4OWTB 2KENA 3RJ0A 1HNXH 4CDCC 4POGA 4L5SA 1GM5A 1HFNA 3JSLA 3SDZA 1IHZA 2WKDA 1LV9A 4ZLTF 3HOZG 3LWBA 1FKAH 3A7AB 1BBWA 1MJEA 2DZDA 5JUMA 3R3OA 4TVAB 4P2CB 5KG3A 2K6AA 1TWFA 2VW9A 2QDLA 3I91A 1E2WA 2HDLA 2XIGA 4DV5H 5EJWA 5KFJA 1TS2A 1HA5A 5EOYA 4EQ5A 4LF9L 3GIPA 4MV9A 4O3QA 2K01A 5CV8A 4X66H 2NU6B 1VCIA 4FU0A 2W71A 3PO2H 2W6PA 1S5DD 3MWYW 4KN4C 1C0AA 2F52A 4KHZA 3F2CA 4XT3B 3PIPA 4A3CG 1CKNB 2BA0A 4YR3A 4YHHH 3NGDA 2XRQD 4HTHA 1XNRQ 5JVG3 1SYDA 2CHBD 1KNAA 1UEAB 1RD9D 1VQFA 3HKZG 4IURA 1DYQA 3Q23A 1VQEA 1VQ5A 1V51A 4B3SL 3A5UA 1ENAA 3KDFB 2SEBD 4G7ZC 5KFSA 3PR5B 2AWOA 3A5ZB 4XQJA 3GTJH 1QZGA 1VQIA 5CV6A 5JVDF 3MFIA 1BDOA 3OW7A 3BABA 1TWHA 2CH4A 4BBRG 1VQPA 2IY5B 4GNXC 1N36Q 1F9PA 5T1IA 2UXBL 4RU9A 3T4AC 2VL6A 4XYOA 1A2UA 2H4OA 3BQ0A 4DV1Q 4DV3Q 3K5OA 4L1KA 3F2UA 4RB3C 3W1GA 5KNBA 3ITPA 3H3VH 4BY7H 1S5BD 2F0FA 5ELCA 4DA2A 2KQ3A 3D4WA 2YTYA 2YL2A 1HA6A 1BUVT 4A3KB 3L3OC 1JQYD 3G8CA 2K5QA 2E8GA 5LMNL 3ETJA 3WDNA 4JI5Q 2K04A 4LF8L 2YTXA 4K0KL 4MHEA 4MAMA 4B3TQ 2R7ZA 2L0CA 4HJ9A 4F4YA 1Q90A 5CV4A 1BF4A 4DK3C 1IBMQ 4LFAL 4DR6L 1PRTB 3IFDA 1NTGA 4M8AA 1N48A 2R93G 1F2MA 2ZJPA 3ZJYC 1HR0Q 4OIKA 2IP4A 2YCHA 5I2YA 2JEIA 2RSOA 3OUZA 1EU3A 2B2UA 3DWPA 1I7LA 1HNZQ 3VR2A 2WB1E 3EFXD 2B29A 2KEEA 3MTSA 3MXUA 1J6QA 2JK8A 1N33H 3CW2C 4IUVA 3GTPH 5D3IB 4LF6Q 2F1MA 4LUOA 3JAMW 1S3OA 5CMDA 3MWMA 1TU2B 3KHLA 1QUQA 3PQIA 2E2HH 3EYYA 4JI0Q 2E5LL 3S2DH 4I7HA 4B9WA 4ED2A 3TRZA 3GTLA 2I87A 4EQPA 1AE3A 3OTOH 4P75A 2ALYB 3U50C 2C9OA 3I12A 4IN3A 3G7LA 2VQEL 1EWCA 4CKBA 2IL8A 3T5HA 4R4QA 1SFOH 4E4TA 1XPUA 3M4PA 4MNOA 5IT9L 2Q8IB 5LL6S 1XYIA 2AKWB 2WIIB 2FK3A 2UU9Q 5EKIA 2K5DA 2O5JC 3GTKH 1SCUB 1Y69U 4JI6L 1BJTA 2VNUD 4RAYA 3S1MB 1IOWA 1Q7YC 1QOHA 1UWVA 3CRKC 1OO9B 1SE2A 3E9HA 4ED6A 3VA7A 4ALPA 1NNXA 1C9OA 4DV4L 4F4WA 5C4XH 1OWTA 2HUGA 4PZ6A 3L2PA 3VR5A 4K5VA 3FMAA 4OO1G 2JA7G 1JXLA 5IGBA 4K8JA 1ZETA 1X56A 3NTHA 4NXNQ 4R7RA 3K5LA 4NXML 2X6LA 2FLNA 1Q12A 5M3FH 4JPBW 1M90C 2ASLA 2VUMB 1EZ1A 1L2FA 4B3ML 5EWEA 5E3FA 4FF2A 2A6HD 4DPGA 1X3EA 1Y1VH 1KLUD 1HNXQ 1IBLH 4CKCA 4A3IG 5KKNB 1CZWA 4X64H 1G6ZA 5C0XJ 4C2MA 5EKKA 2A19A 2NVYB 2BCOA 2Z4HA 1IXRA 1ZHQA 3DMUA 4JBJA 4ED7A 2B2VA 2LFNA 1W2BA 1X3PA 1YJWA 1LT6D 3I4NG 4IFDI 3J80W 5C3WA 4OL7A 2WP8J 1PH5A 1UNSA 4DV5Q 3E6ZX 4LFCL 2WDTA 2WACA 1A3TA 5KFIA 5JQWA 4X66Q 1N32L 3L7ZC 3I4OA 4MV8A 4X65H 4R8IA 2DIKA 4RGOS 2XRSD 4TKOB 3KK7A 5C44B 3MXPA 2ZJQA 5LOVF 3Q0AA 2GVAA 4N8FA 2VPSA 4GKKH 4QCLA 5LMUH 3NPPA 4B3RL 2HGSA 1SRUA 3PSIA 4O2AF 2Q2IA 4JC0A 5KFDA 4ODGA 4LK1C 1SSOA 2NBFA 5HV6A 3MFYA 5KFAA 1TWAH 3NP8A 2ZM6L 1UEBA 2JA6G 1KJIA 1I50A 3K5MA 1PZID 3D3RA 2K5NA 3A55A 1UAPA 5JPMC 1PZKD 2JA5B 3PW4A 2UUAH 1PV4A 2XCPA 2HCIA 3I7FA 5CBEE 5KRUA 4DV7L 4RUCA 4IPGA 5TSSA 3CCJA 1ASYA 3I4MH 1HUMA 1A6XA 3CP0A 5M3MH 1CT1D 3VPCA 2YZMA 3E5NA 1BKBA 1P8LA 2MO1A 4NKLA 3BA8A 4TRDA 4Q44A 4DR3L 1KDAA 1S5FD 2ZTEA 4I55F 3WO1A 4HJAA 2Y0SG 1ULZA 2RCFA 3FHWA 4YY3Q 4RGMA 4APVA 1EY5A 1F77A 4QWCA 2B3GA 1BOSA 3CRLC 3AFPA 5F9NA 4DAPA
chains in the Genus database with same CATH topology
1Z47A 1X6OA 2Z6KC 3S1RH 1PH3A 3I56A 1XMQL 5LMUQ 3G4SA 1CSPA 1YJ9A 2NVXH 4LFAQ 4DV6L 5IYCG 3S24A 4JI0L 1TWGH 1NJIC 2WAQG 4GLVB 4IJHA 2OWOA 4UY8C 5IWAL 2KBNA 2EXDA 2CCZA 1TWFH 1JJGA 1NMGA 4OWXB 2UUBQ 3Q8DA 3K7AH 1J5EL 1XTDA 1KC8C 1EQQA 1PH1A 4LF7Q 2ASBA 1A63A 1FJGL 3M3YH 3TS0A 3HOXH 1EUJA 3H0GH 1EFWA 2EQSA 3CPWA 3GTMH 3K81C 2K5VA 4GOPB 2E2IH 2UU9L 5M5XH 4C3IH 1UE6A 1UE1A 4YWLA 4BY1G 2A1AA 1VQ9A 1CKNA 4DV0Q 3JAMi 4JI7L 2BH8A 3S1NH 1HZBA 1PH2A 3PUWA 1NMFA 1VQAA 2VQFL 1N33Q 1Q86C 4DR1L 1I3QH 3H0GG 3G6EA 4A3MH 2JQOA 2V1CC 4PZ7A 3OYYA 4QIWE 1E1TA 4A3KH 2CWPA 1V1QA 3KYHC 2AMCB 2MNAA 1X3FA 4A3JH 3J81i 1QVFA 4IFDG 5GAHC 4DNIA 1G6PA 4J15A 4NXNL 1TWHH 3J81c 3T1YQ 1PA6A 4KI0A 2RHQB 5M5WH 3BZCA 3CCEA 4LF5Q 4GS3A 4A3MG 1QUQB 2R6GA 3OTOQ 1ASZA 2UXDQ 1AH9A 2ZJRA 1GVPA 2JE6I 2WB1G 3MEFA 4TQUS 1WOCA 5J3BA 2Q2UA 3GTOH 4A3KG 1PH8A 1HNXL 3HOWH 2OTLA 3E0EA 2PMZE 1MKHA 4A3JG 3I4NH 4BXXH 1YVCA 2XTIA 5HGQA 5JEAG 1HR0W 1E3PA 1YBYA 3KF6B 3RN2A 1VQLA 3CCSA 1I94Q 3HFZB 3D31A 4O2DA 1N34Q 4OWWB 4A93H 3KF8B 4A3GH 4LF9Q 3CQZH 5JJLA 4LFBL 1A62A 1K73C 4C3HH 3J7ZC 1L1OB 1SROA 3BJUA 4HIOA 3HOWG 4JYAQ 5C3EH 5IE8A 1E24A 1YZ6A 3I2ZA 1EYGA 3CMAA 3J81j 4DV5L 4BXXG 4OXPA 3MXNB 1I50H 3PF5A 1UE5A 1K0RA 2ES2A 2IHEA 1QVGA 4BA1I 4DR4L 1PYBA 3ULPA 2R7ZH 4X66L 4A3GG 2OCEA 4A93G 3KLWA 1KRSA 1YNXA 2KCTA 3EBEA 2BA1A 1CKOA 2I5LX 1N8RC 4LF4Q 4WJ4A 1HNWL 4JBMA 2PQAA 3RZOH 1NBWA 4PZ8A 3I55A 5C3EG 4GNXA 4A3DH 5C4JH 2ZTDA 2UXCL 3OW2A 2MFIA 1K8AC 4A3FH 2F3IA 4L5QA 4B3SQ 3K8AA 4L5TA 4NPSA 4YHHL 4O0AA 1XPOA 4A3LH 1OXTA 4AH6A 1EQRA 3BU2A 4DR2L 2N49A 4LNQA 4DV2Q 4FDBA 1IBLQ 3TS2A 1CUKA 4IO9A 3AEVA 4X62L 1HH2P 5K36G 4A3FG 1U5KA 5GAEC 3BZKA 3J80i 3S17H 1E7ZA 2HIXA 2B63H 4R4TA 4A3LG 2I5MX 1YI2A 3J80c 4PG3A 4DR5L 1KRTA 4JI3L 4YCVA 4JI2L 4UP9A 2K4KA 3AQQA 1XNQQ 2K5HA 2FXQA 2NVQH 4DKAC 1VS0A 3AYHB 3F2DA 1HZCA 2IT1A 4A4IA 1EIFA 2JA8G 2YV5A 4B3RQ 2B63G 4DR7L 2N8NA 5BR8L 2F4VL 4QQBX 4JI1Q 5LMNQ 3T1HQ 4LF8Q 4BY7G 1I6HH 4K0KQ 4X65Q 2K52A 4R4OA 4YWMA 3HOUH 5LMUL 2CFMA 3F1ZA 1SLJA 1X55A 4JBWA 4YCUA 4DUZQ 3U58A 5IYDH 1PYSB 4GOPA 4GKKQ 3J7A5 1AE2A 4DV7Q 4DR6Q 1L0WA 3KFUA 2R92H 4AQYQ 2VUMH 3PIOA 4PMWA 1X3GA 4UP8A 1PFSA 5GQOA 5IYBH 2UUBL 1KIXA 3CC4A 3HOUG 1VQ7A 2ZTCA 2ID0A 1LTLA 5IYDG 2UUAQ 2IX1A 5GROA 1RIPA 1K83H 4IFDJ 4LF7L 4BY1H 5C0XI 3HOYH 1WI5A 3CAMA 2NZOA 2R92G 2VUMG 3HKZE 2GN5A 2ATWA 3H3VI 4IOAA 3AFQA 2HT1A 4P72A 3FKIH 3HOVH 1D8LA 2Q2HA 1B7YB 2AHOB 5IYBG 3CCRA 1IZ6A 3PUVA 4QGUA 4GLAC 2RCNA 1K9MC 1WJJA 4JI8Q 3UDGA 1XMQQ 1YITA 1VQKA 5JEAJ 4OX9Q 3G48A 4DV0L 3RNUA 3D0FA 3HOYG 1N33L 1WFQA 2QA4A 1E22A 3PUYA 3DM3A 2E5LQ 3IRBA 5DLQE 2PNHA 4HIMA 3FKIG 3GD7A 3JAMc 1YEZA 4ME3A 3HOVG 1O7IA 1QVCA 3ER0A 3KF6A 3NEMA 3UDFA 4C2MH 3CMEA 3HOZH 1YHQA 2KCMA 4HJ7A 1HJPA 3EN2A 1WYDA 1A8VA 1OXVA 3G71A 1X54A 2D62A 4OWTB 2KENA 3HKSA 3T1YL 4R1JA 1DGSA 3K0XA 1L1OA 2VQEQ 1JJ2A 4L5SA 4POGA 1GM5A 5IP7H 4LF5L 2BH2A 4QL5A 1NE3A 3OTOL 2UXDL 5E7NA 3PCOB 4IPDA 3U4ZA 5C44G 3HOZG 1BBWA 1MJEA 4TVAB 1TWCH 1YHBA 3ULJA 1JB7A 2R7DA 2VW9A 4JI6Q 1I94L 4DR1Q 1N34L 5IP7G 4EQ5A 4KHPQ 4LF9L 1JMCA 4A3CH 4WJ3M 2I0QA 2UUCQ 2JA5G 1VCIA 1TXYA 4DV4Q 3PO2H 4X6AH 2K50A 2F52A 3PO3H 1C0AA 4KHZA 3GTQH 3M4OH 1N9WA 3F2CA 1S72A 5FLMG 3PIPA 1PH6A 4A3CG 1CKNB 5EAYA 2BA0A 2Y0SE 4NXMQ 3CPFA 1XNRQ 4L5RC 4LF4L 1MJCA 2OTJA 4A75A 1VQFA 1IYJB 3HKZG 4LUZA 4RG1A 1XMOQ 4B3MQ 3PO2G 4Y52H 3E9IA 4BBRH 4JI4Q 3PO3G 1VQEA 1VQ5A 4UP7A 4B3SL 4IPCA 1OXSC 3A5UA 3S16H 2OQ0A 2GVBA 1HZ9A 2LXJA 5FJ8H 3KDFB 5IY0A 3STBC 2R7FA 2MQHA 3K7UC 2AWOA 3A5ZB 3F2BA 4DUYL 4LFBQ 1NY4A 3GTJH 1QZGA 3ICEA 1VQIA 2WAQE 4DV2L 1IBLL 4X64L 4BBRG 1VQPA 1VQ6A 2IY5B 5ELNA 4GNXC 1QZHA 1PH4A 1N36Q 4QJFA 1VQHA 4BA2I 1VQJA 2UXBL 2R93H 2VL6A 4LFCQ 5FJ8G 4DV1Q 4DV3Q 2JA8H 2IHFA 1RL2A 2JEBI 3W1GA 1G291 3A0JA 4HIKA 3SGIA 1N32Q 3H3VH 4BY7H 1XNQL 1HZAA 2Z0SA 4JV5Q 1BVSA 2UXCQ 1V43A 2JJQA 3S1MH 1EOVA 1VQBA 2YTYA 1PHJA 4GKJQ 4YHHQ 4DAYB 3CCMA 4JI1L 2E8GA 4P73A 5C0XG 5LMNL 4GLXA 4YY3L 3T1HL 3NBHB 4JI5Q 2CWAA 4LF8L 3GTGH 2YTXA 1P16A 4X65L 4YWKA 2PI2A 1YIJA 4K0KL 2DGYA 2XGTA 4R4IA 2C35B 2YYZA 3STBD 3S1QH 2E2JH 4JOIA 2ZM6Q 4DUZL 4B3TQ 2JEAI 3CCUA 1B8AA 4DR7Q 2OQKA 1Y14B 4HJ9A 1KQSA 4JBKA 3RLNA 1B70B 1XJVA 4GKKL 5AJ3Q 4IPHA 3LGJA 4DK3C 1IBMQ 4LFAL 4DR6L 4HJ5A 3TEHB 4AQYL 1NTGA 3M4QA 2R93G 5IP9H 3NELA 2ZJPA 3NENA 3GDEA 4MZ9A 3KOJA 3ZJYC 1HR0Q 2K14A 1VQNA 2Z6KA 2CQOA 2UUAL 1W3SA 1LM0A 5IT9c 1HNZQ 2WB1E 4DR3Q 4GOPC 2B29A 3PUXA 4GN5A 4QY7A 3CD6A 1CSQA 2HHHQ 1VQ4A 3M7NA 1GO3E 3FP9A 2NVYH 1J6QA 1FVIA 4OONA 2JK8A 5IP9G 1EWIA 3CW2C 4XTCS 3CC7A 1S40A 1IBKQ 1IL2A 4AIMA 2VS1A 3WWVA 1CKMA 3GTPH 3W5OA 4LF6Q 4C3JH 3H15A 4JI8L 4LUOA 3KJOA 5H1SE 1UE7A 2NN6I 1LUZA 1S3OA 2NZHA 5HY6A 3ULLA 4OX9L 1SN8A 4LUVA 2NVTH 1PH9A 2LSSA 5JJKA 4YCWA 1QUQA 4DV6Q 2E2HH 1SMXA 1D7QA 2K75A 1OXXK 2E5LL 1GD7A 4JI0Q 3S2DH 5IWAQ 3TRZA 1AE3A 4P75A 2Q2TA 2ALYB 5C44H 1M1KC 3U50C 2CKZB 1J5EQ 1VQOA 3UDIA 3A74A 2VQEL 1VQ8A 1LYLA 2PI2E 5GADC 1OTCA 1FJGQ 1KD1C 3CCVA 2D0PA 4R4QA 3TREA 1SFOH 1XPUA 1KXLA 3M4PA 4MNOA 3EIVA 4LWCA 2AKWB 2JA5H 2UU9Q 1GKHA 1T9HA 1Q1EA 3GTKH 1Q82C 4JI6L 1OXUA 2JA7H 2VNUD 3HOXG 2N3SA 4JI7Q 1Q7YC 4KHPL 1JE5A 1UWVA 2KHJA 4RMFA 2VQFQ 1L1OC 3U4VA 4AYBE 2UUCL 3K80C 2MO0A 3E9HA 2L15A 3M9BA 5FLMH 1K8GA 1EIYB 4ALPA 1A0IA 1C9OA 4DV4L 5C4XH 3KDFA 4PZ6A 3L2PA 2HIVA 5LMNW 4JYAL 4POFA 4OO1G 2JA7G 4A3IH 3RR5A 3RN5A 3CCLA 3S2HH 1KAWA 1X56A 1SE8A 3KJPA 4NXNQ 3JC66 3DLLA 4NXML 2H5XA 2IX0A 1XNRL 1Q12A 5M3FH 1Q1BA 1M90C 2QEXA 1JJCB 1L2FA 1XMOL 3UE0A 1MIUA 4B3ML 5C4XG 3L0OA 5ELOA 4DPGA 4JI4L 1X9NA 1X3EA 1Y1VH 1HNXQ 2WFWA 3TQYA 1X65A 4A3IG 3PUZA 4A3EH 5C0XJ 3CF5A 2JA9A 2A19A 4DAMA 4P71A 2AWNA 4A76A 5M3FG 1IXRA 4JBJA 4KLKA 4MTNA 2RHSB 1PH7A 4DK6C 1W2BA 2RF4A 1YJWA 3I4NG 4IFDI 1Y1VG 5JJIA 1N36L 4OO1I 1WCMH 2WP8J 3CXCA 4A3EG 1VQMA 1PH5A 1YJNA 3GO5A 4DV5Q 3RLFA 4HIDA 4LFCL 3W1BA 1Y1WH 4DV1L 1Q8KA 2QGQA 4IJLA 4DV3L 4BBSH 4DR4Q 4X66Q 1H95A 4JCVE 3UDXA 1N32L 2N78A 3L7ZC 3PGZA 1G51A 3I4OA 1K3RA 4JV5L 1Q46A 4P74A 3VDYA 2EIFA 4NB3A 2JA6H 1HNWQ 1FGUA 3RZDH 1WCMG 2ZJQA 1BBUA 3F8TA 2VZAA 1SR3A 2GVAA 4H02A 4XIGS 1Y1WG 4LW1A 2R7ZG 4GKJL 4B3RL 4BBSG 4EX5A 4JI5L 1SRUA 3PSIA 5FLXc 2Q2IA 3ERSX 4JC0A 4DUYQ 4HJ8A 3UE1A 5M5YH 4A3BH 1KL9A 1TWAH 4A3DG 3M85A 4UPAA 1UEBA 4X64Q 2ZM6L 4B3TL 2JA6G 2HQLA 4DR2Q 4AYBG 2K5NA 4GN4B 5AJ3L 1Q81C 2NN6G 1JT8A 1Z9FA 1IBML 1PV4A 4X62Q 2UXBQ 3I7FA 3S14H 4DV7L 4GN3B 4IPGA 3PV0A 1ASYA 3CCJA 2PQAB 3PF4A 2YTVA 1I5FA 3I4MH 4GNXB 2LXKA 3CP0A 5M3MH 4DR5Q 4Y7NH 1HR0L 4JI3Q 2I5HA 3CCQA 4A3BG 3CC2A 1XPRA 4JI2Q 2VY3A 1BKBA 1P8LA 2MO1A 1PVOA 1V9PA 1HNZL 3GTLH 1E1OA 1U0LA 4JOIC 3RLOA 3B6YA 2ZTEA 4R4CA 4DR3L 2YU9H 3S15H 1YHAA 4HJAA 2HHHL 1FL0A 1VQDA 2D0OA 1KHIA 2Y0SG 5IYCH 2A8VA 1VQCA 2KHIA 3FHWA 4YY3Q 4IOCA 5BR8Q 4APVA 4JG2A 1R9TH 1IBKL 1C7YA 2F4VQ 3I4MG 5GAGC 2B3GA 5M3MG 4LF6L 3AFPA 2DUDA 1VQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z47 A;  1X6O A;  2Z6K C;  3S1R H;  1PH3 A;  3I56 A;  1XMQ L;  5LMU Q;  3G4S A;  1CSP A;  1YJ9 A;  2NVX H;  4LFA Q;  4DV6 L;  5IYC G;  3S24 A;  4JI0 L;  1TWG H;  1NJI C;  2WAQ G;  4GLV B;  4IJH A;  2OWO A;  4UY8 C;  5IWA L;  2KBN A;  2EXD A;  2CCZ A;  1TWF H;  1JJG A;  1NMG A;  4OWX B;  2UUB Q;  3Q8D A;  3K7A H;  1J5E L;  1XTD A;  1KC8 C;  1EQQ A;  1PH1 A;  4LF7 Q;  2ASB A;  1A63 A;  1FJG L;  3M3Y H;  3TS0 A;  3HOX H;  1EUJ A;  3H0G H;  1EFW A;  2EQS A;  3CPW A;  3GTM H;  3K81 C;  2K5V A;  4GOP B;  2E2I H;  2UU9 L;  5M5X H;  4C3I H;  1UE6 A;  1UE1 A;  4YWL A;  4BY1 G;  2A1A A;  1VQ9 A;  1CKN A;  4DV0 Q;  3JAM i;  4JI7 L;  2BH8 A;  3S1N H;  1HZB A;  1PH2 A;  3PUW A;  1NMF A;  1VQA A;  2VQF L;  1N33 Q;  1Q86 C;  4DR1 L;  1I3Q H;  3H0G G;  3G6E A;  4A3M H;  2JQO A;  2V1C C;  4PZ7 A;  3OYY A;  4QIW E;  1E1T A;  4A3K H;  2CWP A;  1V1Q A;  3KYH C;  2AMC B;  2MNA A;  1X3F A;  4A3J H;  3J81 i;  1QVF A;  4IFD G;  5GAH C;  4DNI A;  1G6P A;  4J15 A;  4NXN L;  1TWH H;  3J81 c;  3T1Y Q;  1PA6 A;  4KI0 A;  2RHQ B;  5M5W H;  3BZC A;  3CCE A;  4LF5 Q;  4GS3 A;  4A3M G;  1QUQ B;  2R6G A;  3OTO Q;  1ASZ A;  2UXD Q;  1AH9 A;  2ZJR A;  1GVP A;  2JE6 I;  2WB1 G;  3MEF A;  4TQU S;  1WOC A;  5J3B A;  2Q2U A;  3GTO H;  4A3K G;  1PH8 A;  1HNX L;  3HOW H;  2OTL A;  3E0E A;  2PMZ E;  1MKH A;  4A3J G;  3I4N H;  4BXX H;  1YVC A;  2XTI A;  5HGQ A;  5JEA G;  1HR0 W;  1E3P A;  1YBY A;  3KF6 B;  3RN2 A;  1VQL A;  3CCS A;  1I94 Q;  3HFZ B;  3D31 A;  4O2D A;  1N34 Q;  4OWW B;  4A93 H;  3KF8 B;  4A3G H;  4LF9 Q;  3CQZ H;  5JJL A;  4LFB L;  1A62 A;  1K73 C;  4C3H H;  3J7Z C;  1L1O B;  1SRO A;  3BJU A;  4HIO A;  3HOW G;  4JYA Q;  5C3E H;  5IE8 A;  1E24 A;  1YZ6 A;  3I2Z A;  1EYG A;  3CMA A;  3J81 j;  4DV5 L;  4BXX G;  4OXP A;  3MXN B;  1I50 H;  3PF5 A;  1UE5 A;  1K0R A;  2ES2 A;  2IHE A;  1QVG A;  4BA1 I;  4DR4 L;  1PYB A;  3ULP A;  2R7Z H;  4X66 L;  4A3G G;  2OCE A;  4A93 G;  3KLW A;  1KRS A;  1YNX A;  2KCT A;  3EBE A;  2BA1 A;  1CKO A;  2I5L X;  1N8R C;  4LF4 Q;  4WJ4 A;  1HNW L;  4JBM A;  2PQA A;  3RZO H;  1NBW A;  4PZ8 A;  3I55 A;  5C3E G;  4GNX A;  4A3D H;  5C4J H;  2ZTD A;  2UXC L;  3OW2 A;  2MFI A;  1K8A C;  4A3F H;  2F3I A;  4L5Q A;  4B3S Q;  3K8A A;  4L5T A;  4NPS A;  4YHH L;  4O0A A;  1XPO A;  4A3L H;  1OXT A;  4AH6 A;  1EQR A;  3BU2 A;  4DR2 L;  2N49 A;  4LNQ A;  4DV2 Q;  4FDB A;  1IBL Q;  3TS2 A;  1CUK A;  4IO9 A;  3AEV A;  4X62 L;  1HH2 P;  5K36 G;  4A3F G;  1U5K A;  5GAE C;  3BZK A;  3J80 i;  3S17 H;  1E7Z A;  2HIX A;  2B63 H;  4R4T A;  4A3L G;  2I5M X;  1YI2 A;  3J80 c;  4PG3 A;  4DR5 L;  1KRT A;  4JI3 L;  4YCV A;  4JI2 L;  4UP9 A;  2K4K A;  3AQQ A;  1XNQ Q;  2K5H A;  2FXQ A;  2NVQ H;  4DKA C;  1VS0 A;  3AYH B;  3F2D A;  1HZC A;  2IT1 A;  4A4I A;  1EIF A;  2JA8 G;  2YV5 A;  4B3R Q;  2B63 G;  4DR7 L;  2N8N A;  5BR8 L;  2F4V L;  4QQB X;  4JI1 Q;  5LMN Q;  3T1H Q;  4LF8 Q;  4BY7 G;  1I6H H;  4K0K Q;  4X65 Q;  2K52 A;  4R4O A;  4YWM A;  3HOU H;  5LMU L;  2CFM A;  3F1Z A;  1SLJ A;  1X55 A;  4JBW A;  4YCU A;  4DUZ Q;  3U58 A;  5IYD H;  1PYS B;  4GOP A;  4GKK Q;  3J7A 5;  1AE2 A;  4DV7 Q;  4DR6 Q;  1L0W A;  3KFU A;  2R92 H;  4AQY Q;  2VUM H;  3PIO A;  4PMW A;  1X3G A;  4UP8 A;  1PFS A;  5GQO A;  5IYB H;  2UUB L;  1KIX A;  3CC4 A;  3HOU G;  1VQ7 A;  2ZTC A;  2ID0 A;  1LTL A;  5IYD G;  2UUA Q;  2IX1 A;  5GRO A;  1RIP A;  1K83 H;  4IFD J;  4LF7 L;  4BY1 H;  5C0X I;  3HOY H;  1WI5 A;  3CAM A;  2NZO A;  2R92 G;  2VUM G;  3HKZ E;  2GN5 A;  2ATW A;  3H3V I;  4IOA A;  3AFQ A;  2HT1 A;  4P72 A;  3FKI H;  3HOV H;  1D8L A;  2Q2H A;  1B7Y B;  2AHO B;  5IYB G;  3CCR A;  1IZ6 A;  3PUV A;  4QGU A;  4GLA C;  2RCN A;  1K9M C;  1WJJ A;  4JI8 Q;  3UDG A;  1XMQ Q;  1YIT A;  1VQK A;  5JEA J;  4OX9 Q;  3G48 A;  4DV0 L;  3RNU A;  3D0F A;  3HOY G;  1N33 L;  1WFQ A;  2QA4 A;  1E22 A;  3PUY A;  3DM3 A;  2E5L Q;  3IRB A;  5DLQ E;  2PNH A;  4HIM A;  3FKI G;  3GD7 A;  3JAM c;  1YEZ A;  4ME3 A;  3HOV G;  1O7I A;  1QVC A;  3ER0 A;  3KF6 A;  3NEM A;  3UDF A;  4C2M H;  3CME A;  3HOZ H;  1YHQ A;  2KCM A;  4HJ7 A;  1HJP A;  3EN2 A;  1WYD A;  1A8V A;  1OXV A;  3G71 A;  1X54 A;  2D62 A;  4OWT B;  2KEN A;  3HKS A;  3T1Y L;  4R1J A;  1DGS A;  3K0X A;  1L1O A;  2VQE Q;  1JJ2 A;  4L5S A;  4POG A;  1GM5 A;  5IP7 H;  4LF5 L;  2BH2 A;  4QL5 A;  1NE3 A;  3OTO L;  2UXD L;  5E7N A;  3PCO B;  4IPD A;  3U4Z A;  5C44 G;  3HOZ G;  1BBW A;  1MJE A;  4TVA B;  1TWC H;  1YHB A;  3ULJ A;  1JB7 A;  2R7D A;  2VW9 A;  4JI6 Q;  1I94 L;  4DR1 Q;  1N34 L;  5IP7 G;  4EQ5 A;  4KHP Q;  4LF9 L;  1JMC A;  4A3C H;  4WJ3 M;  2I0Q A;  2UUC Q;  2JA5 G;  1VCI A;  1TXY A;  4DV4 Q;  3PO2 H;  4X6A H;  2K50 A;  2F52 A;  3PO3 H;  1C0A A;  4KHZ A;  3GTQ H;  3M4O H;  1N9W A;  3F2C A;  1S72 A;  5FLM G;  3PIP A;  1PH6 A;  4A3C G;  1CKN B;  5EAY A;  2BA0 A;  2Y0S E;  4NXM Q;  3CPF A;  1XNR Q;  4L5R C;  4LF4 L;  1MJC A;  2OTJ A;  4A75 A;  1VQF A;  1IYJ B;  3HKZ G;  4LUZ A;  4RG1 A;  1XMO Q;  4B3M Q;  3PO2 G;  4Y52 H;  3E9I A;  4BBR H;  4JI4 Q;  3PO3 G;  1VQE A;  1VQ5 A;  4UP7 A;  4B3S L;  4IPC A;  1OXS C;  3A5U A;  3S16 H;  2OQ0 A;  2GVB A;  1HZ9 A;  2LXJ A;  5FJ8 H;  3KDF B;  5IY0 A;  3STB C;  2R7F A;  2MQH A;  3K7U C;  2AWO A;  3A5Z B;  3F2B A;  4DUY L;  4LFB Q;  1NY4 A;  3GTJ H;  1QZG A;  3ICE A;  1VQI A;  2WAQ E;  4DV2 L;  1IBL L;  4X64 L;  4BBR G;  1VQP A;  1VQ6 A;  2IY5 B;  5ELN A;  4GNX C;  1QZH A;  1PH4 A;  1N36 Q;  4QJF A;  1VQH A;  4BA2 I;  1VQJ A;  2UXB L;  2R93 H;  2VL6 A;  4LFC Q;  5FJ8 G;  4DV1 Q;  4DV3 Q;  2JA8 H;  2IHF A;  1RL2 A;  2JEB I;  3W1G A;  1G29 1;  3A0J A;  4HIK A;  3SGI A;  1N32 Q;  3H3V H;  4BY7 H;  1XNQ L;  1HZA A;  2Z0S A;  4JV5 Q;  1BVS A;  2UXC Q;  1V43 A;  2JJQ A;  3S1M H;  1EOV A;  1VQB A;  2YTY A;  1PHJ A;  4GKJ Q;  4YHH Q;  4DAY B;  3CCM A;  4JI1 L;  2E8G A;  4P73 A;  5C0X G;  5LMN L;  4GLX A;  4YY3 L;  3T1H L;  3NBH B;  4JI5 Q;  2CWA A;  4LF8 L;  3GTG H;  2YTX A;  1P16 A;  4X65 L;  4YWK A;  2PI2 A;  1YIJ A;  4K0K L;  2DGY A;  2XGT A;  4R4I A;  2C35 B;  2YYZ A;  3STB D;  3S1Q H;  2E2J H;  4JOI A;  2ZM6 Q;  4DUZ L;  4B3T Q;  2JEA I;  3CCU A;  1B8A A;  4DR7 Q;  2OQK A;  1Y14 B;  4HJ9 A;  1KQS A;  4JBK A;  3RLN A;  1B70 B;  1XJV A;  4GKK L;  5AJ3 Q;  4IPH A;  3LGJ A;  4DK3 C;  1IBM Q;  4LFA L;  4DR6 L;  4HJ5 A;  3TEH B;  4AQY L;  1NTG A;  3M4Q A;  2R93 G;  5IP9 H;  3NEL A;  2ZJP A;  3NEN A;  3GDE A;  4MZ9 A;  3KOJ A;  3ZJY C;  1HR0 Q;  2K14 A;  1VQN A;  2Z6K A;  2CQO A;  2UUA L;  1W3S A;  1LM0 A;  5IT9 c;  1HNZ Q;  2WB1 E;  4DR3 Q;  4GOP C;  2B29 A;  3PUX A;  4GN5 A;  4QY7 A;  3CD6 A;  1CSQ A;  2HHH Q;  1VQ4 A;  3M7N A;  1GO3 E;  3FP9 A;  2NVY H;  1J6Q A;  1FVI A;  4OON A;  2JK8 A;  5IP9 G;  1EWI A;  3CW2 C;  4XTC S;  3CC7 A;  1S40 A;  1IBK Q;  1IL2 A;  4AIM A;  2VS1 A;  3WWV A;  1CKM A;  3GTP H;  3W5O A;  4LF6 Q;  4C3J H;  3H15 A;  4JI8 L;  4LUO A;  3KJO A;  5H1S E;  1UE7 A;  2NN6 I;  1LUZ A;  1S3O A;  2NZH A;  5HY6 A;  3ULL A;  4OX9 L;  1SN8 A;  4LUV A;  2NVT H;  1PH9 A;  2LSS A;  5JJK A;  4YCW A;  1QUQ A;  4DV6 Q;  2E2H H;  1SMX A;  1D7Q A;  2K75 A;  1OXX K;  2E5L L;  1GD7 A;  4JI0 Q;  3S2D H;  5IWA Q;  3TRZ A;  1AE3 A;  4P75 A;  2Q2T A;  2ALY B;  5C44 H;  1M1K C;  3U50 C;  2CKZ B;  1J5E Q;  1VQO A;  3UDI A;  3A74 A;  2VQE L;  1VQ8 A;  1LYL A;  2PI2 E;  5GAD C;  1OTC A;  1FJG Q;  1KD1 C;  3CCV A;  2D0P A;  4R4Q A;  3TRE A;  1SFO H;  1XPU A;  1KXL A;  3M4P A;  4MNO A;  3EIV A;  4LWC A;  2AKW B;  2JA5 H;  2UU9 Q;  1GKH A;  1T9H A;  1Q1E A;  3GTK H;  1Q82 C;  4JI6 L;  1OXU A;  2JA7 H;  2VNU D;  3HOX G;  2N3S A;  4JI7 Q;  1Q7Y C;  4KHP L;  1JE5 A;  1UWV A;  2KHJ A;  4RMF A;  2VQF Q;  1L1O C;  3U4V A;  4AYB E;  2UUC L;  3K80 C;  2MO0 A;  3E9H A;  2L15 A;  3M9B A;  5FLM H;  1K8G A;  1EIY B;  4ALP A;  1A0I A;  1C9O A;  4DV4 L;  5C4X H;  3KDF A;  4PZ6 A;  3L2P A;  2HIV A;  5LMN W;  4JYA L;  4POF A;  4OO1 G;  2JA7 G;  4A3I H;  3RR5 A;  3RN5 A;  3CCL A;  3S2H H;  1KAW A;  1X56 A;  1SE8 A;  3KJP A;  4NXN Q;  3JC6 6;  3DLL A;  4NXM L;  2H5X A;  2IX0 A;  1XNR L;  1Q12 A;  5M3F H;  1Q1B A;  1M90 C;  2QEX A;  1JJC B;  1L2F A;  1XMO L;  3UE0 A;  1MIU A;  4B3M L;  5C4X G;  3L0O A;  5ELO A;  4DPG A;  4JI4 L;  1X9N A;  1X3E A;  1Y1V H;  1HNX Q;  2WFW A;  3TQY A;  1X65 A;  4A3I G;  3PUZ A;  4A3E H;  5C0X J;  3CF5 A;  2JA9 A;  2A19 A;  4DAM A;  4P71 A;  2AWN A;  4A76 A;  5M3F G;  1IXR A;  4JBJ A;  4KLK A;  4MTN A;  2RHS B;  1PH7 A;  4DK6 C;  1W2B A;  2RF4 A;  1YJW A;  3I4N G;  4IFD I;  1Y1V G;  5JJI A;  1N36 L;  4OO1 I;  1WCM H;  2WP8 J;  3CXC A;  4A3E G;  1VQM A;  1PH5 A;  1YJN A;  3GO5 A;  4DV5 Q;  3RLF A;  4HID A;  4LFC L;  3W1B A;  1Y1W H;  4DV1 L;  1Q8K A;  2QGQ A;  4IJL A;  4DV3 L;  4BBS H;  4DR4 Q;  4X66 Q;  1H95 A;  4JCV E;  3UDX A;  1N32 L;  2N78 A;  3L7Z C;  3PGZ A;  1G51 A;  3I4O A;  1K3R A;  4JV5 L;  1Q46 A;  4P74 A;  3VDY A;  2EIF A;  4NB3 A;  2JA6 H;  1HNW Q;  1FGU A;  3RZD H;  1WCM G;  2ZJQ A;  1BBU A;  3F8T A;  2VZA A;  1SR3 A;  2GVA A;  4H02 A;  4XIG S;  1Y1W G;  4LW1 A;  2R7Z G;  4GKJ L;  4B3R L;  4BBS G;  4EX5 A;  4JI5 L;  1SRU A;  3PSI A;  5FLX c;  2Q2I A;  3ERS X;  4JC0 A;  4DUY Q;  4HJ8 A;  3UE1 A;  5M5Y H;  4A3B H;  1KL9 A;  1TWA H;  4A3D G;  3M85 A;  4UPA A;  1UEB A;  4X64 Q;  2ZM6 L;  4B3T L;  2JA6 G;  2HQL A;  4DR2 Q;  4AYB G;  2K5N A;  4GN4 B;  5AJ3 L;  1Q81 C;  2NN6 G;  1JT8 A;  1Z9F A;  1IBM L;  1PV4 A;  4X62 Q;  2UXB Q;  3I7F A;  3S14 H;  4DV7 L;  4GN3 B;  4IPG A;  3PV0 A;  1ASY A;  3CCJ A;  2PQA B;  3PF4 A;  2YTV A;  1I5F A;  3I4M H;  4GNX B;  2LXK A;  3CP0 A;  5M3M H;  4DR5 Q;  4Y7N H;  1HR0 L;  4JI3 Q;  2I5H A;  3CCQ A;  4A3B G;  3CC2 A;  1XPR A;  4JI2 Q;  2VY3 A;  1BKB A;  1P8L A;  2MO1 A;  1PVO A;  1V9P A;  1HNZ L;  3GTL H;  1E1O A;  1U0L A;  4JOI C;  3RLO A;  3B6Y A;  2ZTE A;  4R4C A;  4DR3 L;  2YU9 H;  3S15 H;  1YHA A;  4HJA A;  2HHH L;  1FL0 A;  1VQD A;  2D0O A;  1KHI A;  2Y0S G;  5IYC H;  2A8V A;  1VQC A;  2KHI A;  3FHW A;  4YY3 Q;  4IOC A;  5BR8 Q;  4APV A;  4JG2 A;  1R9T H;  1IBK L;  1C7Y A;  2F4V Q;  3I4M G;  5GAG C;  2B3G A;  5M3M G;  4LF6 L;  3AFP A;  2DUD A;  1VQG A; 
#chains in the Genus database with same CATH topology
 1X6O A;  1EEI D;  2JXM B;  2Z6K C;  3N42 B;  2YRX A;  5IGG A;  1LT3 D;  4PMC A;  2PMZ A;  4IJH A;  4DL5 A;  3ORQ A;  4X3S A;  3Q8S B;  2CCZ A;  2CH4 W;  3K0Y A;  3RBD A;  5KFO A;  4I4T F;  3RIZ A;  2WV6 D;  1U4L A;  1WCM B;  2ZXO A;  1FJG L;  3M3Y H;  5A2Q W;  4K6L A;  4F4X A;  1EUJ A;  2AQ3 B;  3H0G H;  1EFW A;  2EQS A;  5KT6 A;  3W3A A;  1I94 H;  1N34 H;  1KNE A;  1SNC A;  4UFZ A;  4NLG A;  4YWL A;  1VQ9 A;  4HSV A;  1WTQ A;  3M9N B;  1SNQ A;  1CKN A;  3VPD A;  4RZQ A;  4IFD H;  1Z2O X;  3K5H A;  1HZB A;  1N33 Q;  3PUW A;  3QIA A;  2VQF L;  5CA0 F;  1S9F A;  2I07 B;  1Q86 C;  4DR1 L;  2GPW A;  1V1P A;  4B9X A;  3MXG A;  1NSN S;  2JQO A;  3N52 A;  1B3Q A;  5M5Y B;  1E1T A;  3Q24 A;  1U4R A;  3S1Q B;  2XC9 A;  2PZW A;  4A3J H;  4JI4 H;  5J22 A;  2XWB B;  5JEA H;  1G6P A;  1AW7 A;  3T1Y Q;  3J81 c;  2WE6 A;  3S14 B;  2RHQ B;  5M5W H;  4R9W A;  1BCP B;  4GS3 A;  3OTO Q;  1AH9 A;  3TQ1 A;  2LMC B;  4RAU C;  4Y7N B;  2C2R A;  1CQI B;  2OH2 A;  4TQU S;  1WOC A;  2E2H A;  4A3K G;  3KAL A;  3OWF A;  2OTL A;  3E0E A;  3TII A;  3P75 A;  5KGU A;  1EUD B;  1DV2 A;  5H80 A;  4BXX H;  5HGQ A;  1HR0 W;  1VKZ A;  4L6T B;  3CCS A;  1EYC A;  4O2D A;  4A93 H;  2J0T D;  2AUJ D;  4UCR A;  5JJL A;  2A73 B;  5D1P A;  5JVH 3;  5CAE B;  1A62 A;  2BE5 C;  4JYA Q;  1E24 A;  1LT4 D;  1SFO A;  2K05 A;  1GUW A;  1K0R A;  1JKJ B;  2A5H A;  3GID A;  2Q8T A;  4DR4 L;  4RFB A;  4HYK A;  4O3S A;  4O4I F;  3NTI A;  1KRS A;  5EKL A;  3GTK A;  2I5L X;  4DNR B;  1TWF B;  2L4N A;  3CKI B;  1HNW L;  4JBM A;  3RZO H;  4TV9 F;  4GNX A;  2FFK B;  5C3E G;  2QIL A;  2RDI A;  2W6Q A;  2AGP A;  3SR1 A;  2UXC L;  3BDC A;  3OW2 A;  2FB9 A;  4L5Q A;  3IFT A;  4O0A A;  1XPO A;  3R2T A;  4A3L H;  3HOX B;  4ZRZ A;  5KG4 A;  1I4R A;  2W7O A;  1HHV A;  4M7E A;  1IBL Q;  3TS2 A;  2BE5 D;  5M5X B;  4KD3 A;  1BNZ A;  3NWS A;  5I2X A;  1E7Z A;  3BJY A;  2C5C A;  5ISR A;  1YI2 A;  2HHH H;  2NTS A;  2PW7 A;  3J80 c;  1KRT A;  4DR5 L;  5IT9 W;  1Y1V A;  5CR3 A;  1H9R A;  1QNU A;  4A3M B;  2K4K A;  2SNS A;  4RGT A;  3I70 A;  2FXQ A;  1PTO B;  2NVQ H;  2W6O A;  1MD2 D;  1Y8N B;  2YS6 A;  4MTD A;  2UVW A;  1EZ8 A;  1VS0 A;  2VB3 X;  3T5L A;  1EIF A;  2YV5 A;  2B63 G;  3OIP A;  5JAV A;  4QQB X;  3O13 A;  5KT7 A;  1AN8 A;  1TWH B;  1GJX A;  4YAJ B;  3RAX A;  4X65 Q;  2K52 A;  1JCK B;  3RFC A;  4YWM A;  1EY6 A;  2YZN A;  5LMU L;  4RNN A;  1SLJ A;  3U58 A;  1PYS B;  3Q8Q B;  3HOW B;  4GKK Q;  1J5E H;  1M7J A;  1ICF B;  1L0W A;  3KFU A;  1RTN A;  1X32 A;  2RQX A;  5IYB H;  4H0L C;  2CW8 A;  1KIX A;  2W9A A;  3JAM E;  3HOU G;  3CQZ B;  4QB4 A;  2ID0 A;  5IYD G;  2UUA Q;  1H9M A;  1K83 H;  2BDO A;  4LF7 L;  4RHR A;  1E4G T;  2DNE A;  2R8J A;  2EPB A;  4QW8 A;  4MV3 A;  2R92 G;  2VUM G;  3BVM A;  2GN5 A;  4O42 A;  2ATW A;  4IOA A;  4JI7 H;  5EGT A;  3LWE A;  2R7Z B;  3FKI H;  3HS0 C;  2B2T C;  2DNC A;  4BBS B;  3J81 E;  4QGU A;  1EHI A;  5HBR B;  1SMY C;  2QW7 A;  2A68 C;  3UDG A;  1GUO A;  1XMQ Q;  1YIT A;  4OX9 Q;  3G48 A;  1I4X A;  3FPU B;  3KBG A;  1GSA A;  3MZ5 A;  4A3D B;  4NP5 A;  1RJQ A;  4O3O A;  3RB0 A;  3QO2 A;  5C4J B;  4IUP A;  5LA6 F;  2NU8 B;  1F9Q A;  3Q22 A;  4WFN 3;  1SE4 A;  1YEZ A;  4ME3 A;  3SI8 A;  1RCV D;  3ER0 A;  5DNF A;  4FVM A;  3HOZ H;  4Q0F A;  1B6S A;  3C1E A;  2ICI A;  2WAQ A;  4A3B B;  3I3C A;  2F0D A;  3D4D A;  1WYD A;  1X54 A;  1LTA D;  1R4Q B;  3HKS A;  4R1J A;  2I8C A;  1DGS A;  2BH2 A;  4LF5 L;  2UXD L;  5C44 G;  3PCO B;  3PW5 A;  4ILW A;  1DZ1 A;  2C22 A;  1SMY D;  3RMH A;  2A68 D;  1TWC H;  2F3V A;  2RA4 A;  2WKC A;  4U68 A;  3MA2 B;  1PDQ A;  2QKI C;  3GTL B;  1I94 L;  1N34 L;  4ECV A;  1RJT A;  3KHH A;  5IP7 G;  4DFA A;  2F03 A;  4A3C H;  4ED0 A;  1W93 A;  2JA5 G;  1I6H B;  3JRW A;  1GSH A;  4F87 A;  4QWB A;  4X6A H;  5JH7 F;  3H0G A;  3BQ2 A;  4EGJ A;  2F0G A;  4EFB A;  4KD4 A;  3JAM L;  3GV7 B;  2MPM A;  3M4O H;  2PN1 A;  5GON F;  1S72 A;  4KN7 C;  5FLM G;  1PH6 A;  4CDF C;  2C00 A;  1ET9 A;  4L5R C;  4LF4 L;  3K3V A;  3KXY T;  2UVU A;  2ASD A;  3J80 E;  3T13 A;  2JSO A;  1IYJ B;  4RG1 A;  2XD4 A;  5KG5 A;  2KED A;  1STN A;  3E9I A;  4BBR H;  4JI4 Q;  3PO3 G;  4DR2 H;  1BR9 A;  1LTT D;  2O4X A;  2B8G A;  2KOL A;  2A6E D;  4IPC A;  1OXS C;  4ZUJ A;  4O2B F;  1DXM A;  4BY1 B;  2GVB A;  5IY0 A;  2MQH A;  3K7U C;  4DUY L;  4LFB Q;  2HQE A;  2QK4 A;  3G6J B;  3HOV B;  3N6R A;  2X69 A;  3OHA A;  1TKW B;  2CVR A;  1VQ6 A;  2RKS A;  5ELN A;  3MAQ A;  4C3I B;  4BA2 I;  4B08 A;  1IW7 C;  1D5Z C;  2JA8 H;  1Y8P B;  2JEB I;  4APM A;  4MV7 A;  1DOL A;  5NUC A;  2F4V H;  4WBN F;  3H09 A;  3R2I A;  2Z1C A;  3SGI A;  1XNQ L;  1HZA A;  4C2M B;  2GLT A;  4R8N A;  1BVS A;  3VR3 A;  2JJQ A;  2WTF A;  1EOV A;  4Q5V A;  2Q8R E;  3CCM A;  4P73 A;  4GLX A;  3GTM H;  3T1H L;  2R93 H;  4JV0 A;  1YIJ A;  1P16 A;  2EYF A;  2PI2 A;  3HP3 A;  2E2J H;  4JK1 C;  3OHB A;  1JLL B;  4DL6 A;  1Y1W A;  3RLN A;  4IPH A;  3LGJ A;  3TEH B;  1S03 G;  1LTR D;  1IW7 D;  3LP8 A;  3GDE A;  3KOJ A;  4RKL A;  2K14 A;  4LMQ D;  1VQN A;  1H9S A;  3AMU A;  2Z6K A;  2BOS A;  3IKJ A;  3OOC A;  1SDF A;  4HAE A;  1GLV A;  1QIL A;  3V05 A;  5KFH A;  5IT9 c;  2KUM A;  3PO2 B;  1AN7 A;  5EBC A;  4QY7 A;  4DR7 Q;  2UU9 H;  2LS0 1;  2HHH Q;  4DV0 H;  3J80 L;  1EQT A;  3SE7 A;  1RKN A;  1EU4 A;  3S16 H;  1EWI A;  4XTC S;  1IBK Q;  2ATL A;  1HXY D;  1I50 B;  2VS1 A;  4UHV A;  3W5O A;  4V0B A;  5KFL A;  1EWH A;  1LO5 D;  3TSS A;  5KT3 A;  4HN7 A;  5LL6 b;  2ALZ A;  1I4Q A;  2TMP A;  5H1S E;  3KJO A;  1D1K A;  1LUZ A;  2NZH A;  5HY6 A;  2NVT H;  5BPH A;  1EYA A;  1SN8 A;  2PNR C;  5AFW A;  4J9Q A;  5K5P A;  5C5L A;  2FK2 A;  5KG0 A;  1SMX A;  3SK5 A;  5A2Q E;  1D7Q A;  3I90 A;  1CQF A;  1GD7 A;  2M05 A;  1K0S A;  2R8G A;  4CJ1 B;  3QZ8 A;  1HRJ A;  2Z9H A;  2WYO A;  5ELF A;  4C3J G;  5KFN A;  1ESR A;  4HMJ A;  2CKZ B;  1BO0 A;  2AQ4 A;  1J5E Q;  3RTX A;  3A74 A;  2G9D A;  4F50 A;  5GAD C;  2V9W A;  3JSN A;  3QZ7 A;  2D0P A;  4OEL B;  3S17 B;  1KXL A;  5KFZ A;  2R82 A;  5KFE A;  3EIV A;  4LWC A;  2PMZ B;  5KT5 A;  4BY7 B;  4KY5 A;  3SK6 A;  1TWG A;  2R61 A;  1CTM A;  2JA7 H;  4OO1 H;  3HOX G;  1UC9 A;  2XGQ A;  2KVM A;  4JI7 Q;  3TP8 A;  4ED8 A;  2KHJ A;  3DEP A;  1L1O C;  1VF7 A;  1PFB A;  3K80 C;  2MO0 A;  3M9B A;  2L15 A;  1K83 A;  5IOD A;  1AUX A;  1HQR D;  4YJ2 F;  3TIN A;  3ONA B;  4FS1 A;  3A8K E;  3R8B A;  4F88 A;  2CQY A;  2VR1 A;  4LSA A;  4A3I H;  1FYC A;  3RN5 A;  3VA5 A;  3S2H H;  3HZX A;  5FD6 A;  1IKL A;  1SE8 A;  4JVZ A;  5E4X A;  3SK4 A;  1XNR L;  1SND A;  2KHS A;  1L0Y B;  2QEX A;  1JJC B;  3KLS A;  1S68 A;  4XDX A;  1S5C D;  3L0O A;  4ZQ3 A;  4ZI7 F;  1TY2 A;  1X9N A;  2NZ1 D;  4DV2 H;  1XX8 A;  3PUZ A;  1CZG A;  1V1P B;  3D4R A;  3DM1 A;  3U9S A;  3RUZ A;  1G2T A;  4DAM A;  4IAJ A;  3HOY B;  2AWN A;  4LMY A;  4NDX A;  1QE6 A;  4A76 A;  1DOM A;  3M9M B;  4MTN A;  1PH7 A;  2JYO A;  4DK1 A;  1S5E D;  5A2Q L;  2F0H A;  1STH A;  1KJJ A;  1S4Z A;  5LXT F;  1N36 L;  4LH6 A;  1SYG A;  4N9P A;  5A35 A;  3NSW A;  4DAV A;  1NCV A;  3RLF A;  3TZD A;  3W1B A;  4YP3 A;  1EZ6 A;  4DV1 L;  4DV3 L;  4KHV A;  2E2H B;  3ND9 A;  3PIO 3;  3EPG A;  3S2D B;  1H95 A;  4JI1 H;  5JOB A;  3Q8P B;  4YY3 H;  1U9R A;  4PQX A;  2JA6 H;  4P74 A;  2R86 A;  4TQS A;  4DUZ H;  1CHQ D;  1BBU A;  1DM0 B;  3HG9 A;  2RSN A;  4H02 A;  1HFG A;  2R7Z G;  4EBD A;  4BBS G;  4EX5 A;  4JI5 L;  5IT9 E;  3CQZ A;  5KX5 F;  3L4J A;  3FRP B;  4UCU A;  4A2A A;  3WOE A;  1CA5 A;  4AQY H;  1RYS A;  4HJ8 A;  2AGQ A;  3KAK A;  3UE1 A;  2B39 A;  1SFO B;  4A3D G;  4B3T L;  4DR2 Q;  4ECY A;  1JT8 A;  3T51 B;  1IBM L;  3DF7 A;  3GTK B;  2UXB Q;  5BN5 A;  2HJW A;  1JWS D;  2R6F A;  5IGE A;  4GNX B;  4CDD C;  5I9O A;  1HR0 L;  3CCQ A;  2VXW A;  4A3B G;  4UCT A;  3CC2 A;  1XPR A;  2PZU A;  1PVO A;  1V9P A;  1HNZ L;  3C46 A;  3BA9 A;  4JI8 H;  4XYQ A;  3B6Y A;  2YU9 H;  1YHA A;  1FL0 A;  3MC0 B;  3QB3 A;  3MHB A;  2F0K A;  3CVZ A;  3V6K A;  1BXT A;  5BR8 Q;  1R9T H;  2F4V Q;  1O80 A;  5BN4 A;  1ILP A;  1KJ8 A;  5GAG C;  1JX4 A;  4LF6 L;  5C5M A;  3V4S A;  3CU7 A;  2BDN A;  4DN4 M;  1EIH A;  3RV3 A;  3VPB A;  5M3F B;  3R23 A;  3PW7 A;  1A9X A;  4A2B A;  2NVX H;  4CGY B;  3I56 A;  4LFA Q;  1D5X C;  1Y1V B;  5IYC G;  1S10 A;  4JI0 L;  4EEQ A;  4DL2 A;  1NJI C;  4UY8 C;  5EWG A;  1RK6 A;  3T1Y H;  1NMG A;  2CW0 C;  5C5J A;  2P5Z X;  2K1B A;  4EBC A;  3GTM A;  5KEE A;  2J6U A;  3GLK A;  1CHP D;  3DWA A;  3T5J A;  3TS0 A;  4ZK9 B;  2W57 A;  3PIP 3;  4KHP H;  3K81 C;  2K5V A;  1JDE A;  2UUC H;  4JV1 A;  4EYH B;  2UU9 L;  2A6H C;  2V58 A;  4Z9C B;  4BY1 G;  5G3L D;  1DV1 A;  4K6D A;  4DV0 Q;  3JAM i;  2BH8 A;  3S1N H;  4JYA H;  1GYF A;  4HQ6 A;  4X3U A;  5EZY F;  1FGB D;  2Z4I A;  2V1C C;  3OYY A;  2CW0 D;  4DNT B;  4C3I G;  2HCC A;  4A3K H;  2RDG A;  1XMO H;  3A7L A;  2NUA B;  1X3F A;  3J81 i;  2YRW A;  4J15 A;  4NXN L;  1MBY A;  4KI0 A;  1EY8 A;  2RDH A;  3CCE A;  1DOK A;  2C28 A;  3RGX A;  2R6G A;  3I4M B;  3JZI A;  4H44 C;  5M3M B;  1GVP A;  2ZJR A;  2JE6 I;  2WB1 G;  2PPB C;  5J3B A;  1PH8 A;  1HNX L;  2F0Q A;  2MUY A;  2PMZ E;  1MKH A;  4HNU A;  1YVC A;  2XTI A;  5L1L A;  2F3W A;  3DEO A;  4CC6 A;  2ENB A;  1JWM D;  2N88 A;  2K7V A;  3D31 A;  2WIN B;  2IJ0 A;  3HFZ B;  4OWW B;  1ROD A;  5KG1 A;  3LX0 A;  4J9N A;  2WAQ B;  3G6Y A;  3J7Z C;  1GUN A;  1SRO A;  4HIO A;  2R87 A;  1EYD A;  5C3E H;  1K8O A;  4JV5 H;  1YZ6 A;  4DV5 L;  3PR4 A;  2F0P A;  4HNV A;  3PF5 A;  2ES2 A;  1UE5 A;  1QVG A;  4BA1 I;  2OEO A;  2IWH A;  3ULP A;  4X66 L;  4A3G G;  4J9O A;  2RGR A;  5L1I A;  1YNX A;  3QG1 A;  3K6O A;  5KFM A;  2JA7 A;  2SOB A;  1A3U A;  1JE4 A;  4WJ4 A;  1L0X B;  5FLX W;  4Q45 A;  1LTG D;  3IN5 A;  4FP5 D;  2QF7 A;  3I55 A;  2FE3 A;  4BWG B;  5C4H A;  2ZTD A;  1V1O A;  1K8A C;  5L1J A;  4NPS A;  4YHH L;  3M3Y B;  2W9B A;  1A2T A;  1KDB A;  3H0G B;  1PYW D;  3GQC A;  4RKB A;  1HPC A;  3MR5 A;  4DV2 Q;  3J7A V;  2FLL A;  5DG8 A;  4IO9 A;  5COY A;  5K36 G;  5EDW A;  3KTM A;  3J80 i;  2HIX A;  2B63 H;  4R4T A;  3VR4 A;  5LP6 F;  4BS9 A;  1KDC A;  1B9N A;  2L55 A;  1T94 A;  3U9T A;  2EYH A;  3BYY B;  4DKA C;  4FF1 A;  2O03 A;  4HMI A;  3NE5 B;  1XMQ H;  4A4I A;  3N43 B;  5KNC A;  3L4K A;  4B3R Q;  4A3J B;  4OX9 H;  2N8N A;  2A69 C;  3GTJ A;  1K28 A;  4JI1 Q;  4RNO A;  4BY7 G;  5ELD A;  5KFC A;  4RGN A;  5IWA H;  5IYZ F;  1PFN A;  5KT4 A;  3GIK A;  3CHB D;  4ECW A;  3HOU H;  5KND A;  2CFM A;  4DUZ Q;  1X55 A;  5IYD H;  4G3I A;  1KAA A;  1VMP A;  5FO7 B;  3J7A 5;  1GHK A;  4DV7 Q;  3MR2 A;  1E2Z A;  1JR0 D;  2R8I A;  1B04 A;  2R92 H;  4OGQ C;  4AQY Q;  2VUM H;  3R5H A;  2JA6 A;  4A3E B;  4PMW A;  5C6A A;  1X3G A;  1JOQ A;  1VBH A;  1PFS A;  1RF2 D;  4MA5 A;  1JOK A;  5CBA E;  4C5A A;  1LTL A;  4IFD J;  1RIP A;  3GII A;  3CAM A;  4J6H A;  1B6R A;  1SE3 A;  2NZO A;  1G91 A;  3AFQ A;  2A69 D;  4DK0 A;  4P72 A;  1Y1W B;  4CC5 A;  4N8X 1;  1QCB D;  3CCR A;  2R7L A;  4IUQ A;  1T36 A;  2Y0S A;  1K9M C;  4JI8 Q;  1EYZ A;  5KFW A;  3LWU A;  5JEA J;  5D14 A;  2JN4 A;  2IBK A;  5DGA A;  3HOY G;  1N33 L;  2QA4 A;  4TQR A;  1UC8 A;  1H9S B;  4K2K A;  3Q2O A;  5L1K A;  5DLQ E;  4K5X A;  4HIM A;  4TSS A;  3K59 A;  3GD7 A;  3JAM c;  2YU9 A;  3UDF A;  3GIQ A;  1II3 A;  1STY A;  4NW2 A;  1BCP C;  1SYX B;  2YZG A;  1R9T A;  1HJP A;  4UAI A;  4F4Z A;  1SAP A;  3EVQ A;  1ZXT A;  3T1Y L;  4ZYS A;  3GTP A;  1L1O A;  1JJ2 A;  2HDM A;  5J1Z A;  4DXF A;  5IP7 H;  1FNU A;  2SNM A;  4QL5 A;  3OTO L;  2NVX A;  2ASJ A;  1DD2 A;  2ICE C;  1ET6 A;  4QW9 A;  4LFB H;  2NVQ B;  3ULJ A;  1KC7 A;  2R7D A;  2ZDH A;  3EJI A;  4DR1 Q;  4IRD A;  1M0W A;  4KHP Q;  1JMC A;  4WJ3 M;  2I0Q A;  1SYE A;  2UUC Q;  4ECZ A;  4K5W A;  4CDE C;  1ENF A;  1XXG A;  2PO4 A;  1TXY A;  4HED A;  2R3Z A;  1SEB D;  1FD7 D;  1MSG A;  3MFH A;  2K50 A;  1R4P B;  3PO3 H;  4PDB A;  1BCP D;  3OHX C;  3HBL A;  3GTQ H;  1L2Z A;  3WNZ A;  4EGV A;  2EY1 A;  5EAY A;  1TWG B;  1EY4 A;  5CC4 A;  1N56 A;  1MJC A;  3P7J A;  1W96 A;  3PN1 A;  4A75 A;  1XMO Q;  2DJF C;  3DHQ A;  2F0S A;  5I6Y A;  1K83 B;  2L5T A;  1D2B A;  1B44 D;  1FR3 A;  3K7A B;  1PLF A;  3VMM A;  1EL0 A;  1HZ9 A;  1GUT A;  4MTE A;  5KFR A;  2R7F A;  1QB5 D;  5CA1 F;  3F2B A;  3FKI B;  2WAQ E;  4JI3 H;  5CV7 A;  1GGO A;  3BDL A;  1IBL L;  2FLP A;  4X64 L;  4JI2 H;  3BAA A;  2RVL A;  2SDF A;  3H4B A;  3KLR A;  1QZH A;  1PH4 A;  4QJF A;  1QG7 A;  1E4E A;  3HXL A;  1PTO C;  5FJ8 G;  2FMM A;  4DL3 A;  3A56 A;  2XVS A;  2IHF A;  1RL2 A;  4DR7 H;  3T53 B;  2MJ8 A;  1A15 A;  3I73 A;  1IBK H;  4Y8V B;  1B9M A;  2VA2 A;  2Z0S A;  1LAB A;  4JV5 Q;  3K58 A;  2UXC Q;  2RGV A;  1V43 A;  5I9P A;  2EXZ A;  1D5M C;  2JEJ A;  4GKJ Q;  2E75 C;  5J2T F;  3H94 A;  5K2M A;  5C0X G;  2QCP X;  3GTG H;  2CWA A;  4R8U A;  1SYC A;  1UUP A;  3BYT B;  4YWK A;  1B53 A;  4X65 L;  2DGY A;  3S1Q H;  2YYZ A;  2C2D A;  1EOT A;  3CCU A;  2UUB H;  2OQK A;  1KQS A;  4JBK A;  2W6Z A;  4GKK L;  4DLK A;  1B70 B;  1XJV A;  3H4D A;  5AJ3 Q;  3G6X A;  4HJ5 A;  1EY0 A;  3M4Q A;  2QYZ A;  1PTO D;  3NEL A;  2PZT A;  2NWG A;  4FS2 A;  1D6E C;  4H7B A;  4MZ9 A;  3ERQ A;  2DPJ A;  4AYB A;  2FP4 B;  4FBT A;  2CQO A;  3BVZ A;  2UUA L;  1BQQ T;  1SXT A;  3GV8 B;  5IIF A;  4YR0 A;  4C3H B;  4GOP C;  4GN5 A;  2VA3 A;  5CV5 A;  1VQ4 A;  3FP9 A;  4OON A;  5IP9 G;  3M4O B;  1TWA A;  1IL2 A;  4MA0 A;  2EY2 A;  3WWV A;  4AIM A;  1CKM A;  4U67 3;  4C3J H;  3I72 A;  2B2U C;  3ULL A;  1QWY A;  1W6J A;  2EOT A;  4OX9 L;  2B63 A;  4LUV A;  5JJK A;  4YCW A;  4BBR B;  1CA6 A;  4DV6 Q;  4LH7 A;  2K75 A;  1GOZ A;  2F0M A;  2AGO A;  5IWA Q;  4A3F B;  2L12 A;  3R5X A;  1STE A;  3MJF A;  3ORR A;  5DAU A;  5T1G A;  2Q2T A;  3RGZ A;  3RBE A;  1GUS A;  1I4P A;  3V2T A;  2V5A A;  5CYU A;  3TP7 A;  4Q0Y A;  3UDI A;  1ZYR D;  1TII D;  1VQ8 A;  2PI2 E;  3WOF A;  1OTC A;  1WVL A;  3CCV A;  2JA8 B;  3N8D A;  1V8Q A;  4LF9 H;  2XNA C;  2VOB A;  4FXG C;  1GKH A;  5FKA C;  1T9H A;  1Q1E A;  4CBV A;  1Q82 C;  1U4P A;  3GIL A;  4ZKC B;  2QEJ C;  2A6E C;  4HNT A;  2N3S A;  4O4H F;  2RDF A;  1JE5 A;  1TS4 A;  4RMF A;  3U4V A;  3GTM B;  4ETS A;  4O3R A;  1PTO H;  1EIY B;  3TP6 A;  5J2U F;  2FJ2 A;  5F9L A;  1A0I A;  4MV1 A;  1B2T A;  3FEW X;  2D5D A;  2E2J B;  4POF A;  3RR5 A;  1F9R A;  4FNF A;  2W8L A;  2K5W A;  1KAW A;  3E5S A;  5F2D A;  5L37 A;  1WR2 A;  4LAA A;  3KJP A;  4B3S H;  3JC6 6;  1YNN C;  2IX0 A;  2P0A A;  2XCL A;  4XZ3 B;  3UE0 A;  1MIU A;  2DJG C;  4FXD A;  4JI4 L;  5KFP A;  3D8G A;  2WFW A;  3TQY A;  5I47 A;  2J4X A;  1B33 N;  4IWX A;  2UXB H;  4P71 A;  2L9H A;  4RCO A;  3S16 B;  2W70 A;  3MWE A;  4U7C A;  4BWS C;  5FLX E;  4DAY A;  2RHS B;  5EPK A;  3LML A;  5KFQ A;  3TP5 A;  4J1M A;  4DK6 C;  3N40 P;  2RF4 A;  3NBH A;  4OEM B;  4C5C A;  5JJI A;  1ESF A;  4OO1 I;  2NVT B;  4ECT A;  3NUC A;  3NQT A;  3CXC A;  4A3E G;  1VQM A;  2K28 A;  1PK8 A;  5KT2 A;  2R8K A;  1Q8K A;  2MGS A;  3GV3 A;  2SCU B;  4BBS H;  5BPF A;  3ERO A;  4JCV E;  5LMN H;  1YNN D;  2N78 A;  3PGZ A;  5BR8 H;  4LF8 H;  4K0K H;  1K3R A;  3HEJ A;  5KFU A;  3VDY A;  1BXR A;  2EIF A;  4NB3 A;  3WO0 A;  1FGU A;  3RZD H;  1PXU A;  1WCM G;  2NUC A;  4XIG S;  2VZA A;  1Y1W G;  4LW1 A;  4FXK C;  4HR7 A;  4LFA H;  4DR6 H;  3PMF A;  4DUY Q;  3ERS X;  1VMC A;  3M7G A;  3TDQ A;  4WOR A;  4A3B H;  3HRZ C;  4UPA A;  4J9P A;  5DG7 A;  2HQL A;  4C1N K;  4YQW A;  4KKT A;  1Q81 C;  4GN4 B;  2NN6 G;  1Z9F A;  4X62 Q;  2F0T A;  5DQH A;  4GN3 B;  2JA7 B;  4RB1 A;  3PV0 A;  3PZP A;  2YTV A;  1I5F A;  2LXK A;  2LKV A;  3BG5 A;  3N44 B;  4JI3 Q;  5KFT A;  4JI2 Q;  4RB2 C;  1F2Y A;  2X6G A;  3GIM A;  3GTL H;  4HCE A;  1E1O A;  4JOI C;  2UVR A;  4QIW A;  4R4C A;  2W9B B;  3S15 H;  2A8V A;  2HHH L;  4RAZ A;  1VQD A;  5IYC H;  1KHI A;  5I6W A;  4A3I B;  2KHI A;  3F8N A;  2EYM A;  1IBK L;  1C7Y A;  1Y8O B;  5C8Y F;  3Q8R B;  1BNC A;  2E5L H;  5DLF A;  1DON A;  3VYS A;  1S97 A;  3H91 A;  3S1R H;  3N6X A;  2G5D A;  3G4S A;  2W8K A;  4O3N A;  2FK1 A;  5FLX L;  3S24 A;  5ELB A;  3DXJ C;  3X3M A;  1M4V A;  4RZR A;  1MGS A;  4XX0 B;  2VQE H;  2EXD A;  1EQV A;  3EQL C;  1CFM A;  4OWX B;  2UUB Q;  3OSN A;  3IAY A;  1J5E L;  3GTJ B;  3NHH A;  3GTG A;  4CKE A;  1EQQ A;  5DEH A;  1PH1 A;  3FDS A;  5KFF A;  4JI6 H;  2KSW A;  4UCO A;  3HB9 A;  1H9J A;  2EJG C;  2EYO A;  2E2I H;  1TT2 A;  1FNW A;  2ZT9 C;  1UE6 A;  1UE1 A;  4C3I H;  2A1A A;  2MCT A;  4DV4 H;  2JA6 B;  2JEG A;  4JI7 L;  5EPJ A;  1CI3 M;  1CQV A;  1C3O A;  4ECQ A;  3GQB A;  1I3Q H;  4CJ2 C;  1C8C A;  3G6E A;  1J9O A;  4QUF A;  1TA8 A;  1ILQ A;  4NXM H;  1U4M A;  3QFF A;  1H9K A;  3G6V A;  3D6W A;  1V1Q A;  3KYH C;  4B3M H;  2H1E A;  2IA6 A;  2AMC B;  2JP1 A;  2MNA A;  1RJP A;  5GAH C;  2NYZ D;  4DNI A;  3FKI A;  1PA6 A;  2Y0S B;  1I6V C;  2B2Y C;  1KBL A;  3BZC A;  3BQ1 A;  4A3M G;  2YYA A;  4Q8E A;  1ASZ A;  4DU9 A;  4KY7 A;  4Q43 A;  3FPP A;  3MEF A;  4MN3 A;  1F2Z A;  2EDG A;  3GTO H;  1RK5 A;  4KV6 A;  4XYM B;  4DL7 A;  3I4N H;  1VF5 C;  4N9T A;  5DM6 3;  2YU9 B;  1YBY A;  2YS7 A;  4ZOL F;  3RB6 A;  1C30 A;  1O7Y A;  4LFC H;  3KF8 B;  4A3G H;  4EYI B;  3NK9 A;  3GP7 A;  2FIN B;  1R9T B;  4LF9 Q;  4FBU A;  1K73 C;  3QOL A;  3K57 A;  1N32 H;  2XWJ B;  3GTP B;  4IZO A;  1L1O B;  3I4L A;  3HOW G;  5IE8 A;  1RJR A;  2NVX B;  4ME5 A;  2EE1 A;  1LAC A;  3J81 j;  2EJM A;  1I50 H;  1ICW A;  1PYB A;  2NB0 A;  2DLN A;  3KHR A;  1G2S A;  2OCE A;  4EGQ A;  4G57 A;  4B3R H;  2KCT A;  3EBE A;  1JIC A;  3VYU A;  4ZAI A;  1CKO A;  5KYL A;  1TWC A;  4C3H G;  2F0E A;  4C1N I;  5LYJ F;  1IOV A;  3RAQ A;  2PQA A;  3FDT A;  4XQQ A;  2ZM6 H;  4PMB A;  5K36 H;  2AQ2 B;  3DUZ A;  2MFI A;  4B3S Q;  3K8A A;  4L5T A;  1TAE A;  1DCZ A;  1OXT A;  4DV7 H;  3Q6S A;  3I8Z A;  5D1O A;  3HKZ A;  3BU2 A;  3T5K A;  1PRT C;  1JIH A;  4DR2 L;  4RNM A;  2N49 A;  4LNQ A;  1IYU A;  2F0O A;  3AEV A;  1XDN A;  1HH2 P;  2AU0 A;  4A3F G;  1U5K A;  1E4F T;  3S17 H;  4DR3 H;  2Z6B A;  2R7M A;  2I5M X;  3S1N B;  4FF3 A;  3QWN A;  4YCV A;  4G7O C;  2K5H A;  1HUN A;  4S3S A;  2EY5 A;  4J8Q A;  2KJX A;  3F2D A;  2IT1 A;  5C4X B;  2JA8 G;  2X0S A;  3N41 B;  5FPR A;  3SVM A;  5BR8 L;  2V4Q A;  2F4V L;  3M4Y A;  2J7Z A;  5LMN Q;  4LF8 Q;  1TQO A;  4X3K A;  4K0K Q;  2EVB A;  1XWE A;  4R4O A;  1M8A A;  1E4E B;  1T3N A;  1PRT D;  4JBW A;  4YCU A;  4GOP A;  1I6U A;  1SJH D;  2W6N A;  4DR6 Q;  3OMG A;  2EJF C;  4LJZ C;  3TN2 A;  1FJG H;  1LTS D;  1O78 A;  2M9V A;  4IQZ A;  3MVV A;  1RDP D;  1C48 A;  2B2T A;  3NTK A;  3KHG A;  3CC4 A;  1SYB A;  3QR8 A;  1VQ7 A;  2ZTC A;  4XT1 B;  2EYJ A;  4R8U B;  5C3E B;  4FO2 A;  5C0X I;  1WI5 A;  3HOY H;  2BQ3 A;  2R93 A;  5JPN C;  2FPI B;  2VQF H;  2HT1 A;  1NR2 A;  1D8L A;  2TSS A;  5D8D A;  2AHO B;  5CV9 A;  1J8I A;  1IZ6 A;  4DR1 H;  3J7Y W;  4GLA C;  2RCN A;  3OSO A;  1WJJ A;  4M1U B;  5EQ0 A;  3AU7 A;  1PX2 A;  1B3A A;  4DV0 L;  3D0F A;  4F8M A;  4NMZ A;  4XYL B;  2N55 A;  2HD3 A;  3UI2 A;  1IKM A;  1E22 A;  3PUY A;  2AQ1 B;  4AYB B;  2E5L Q;  4EFE A;  3IRB A;  5EBD A;  2C2E A;  4E6I A;  1RYR A;  2PNH A;  1K1S A;  3HOV G;  3OUU A;  3SXH A;  5C1O A;  3J81 W;  1O7I A;  3KF6 A;  4IHJ F;  2EY6 A;  1TS3 A;  3CME A;  5KIX A;  5BMV F;  3MR6 A;  4J9K A;  1LTI D;  3EN2 A;  1TWA B;  5DGB A;  3OWE B;  1A8V A;  1OXV A;  3BVG A;  5FPO A;  1STG A;  2KA7 A;  1O7Z A;  3K0X A;  2VQE Q;  2J9G A;  3V6J A;  2B63 B;  4WD3 A;  1NE3 A;  3MXN A;  5E7N A;  4IPD A;  3U4Z A;  3NWT A;  4IAL A;  1YHB A;  2E74 C;  1JB7 A;  4JI6 Q;  3MFG A;  1MSH A;  1PRT F;  4RB0 A;  1CS0 A;  1JWU D;  4QWD A;  5EWF A;  4DR4 H;  2F0W A;  4M9U A;  4DV4 Q;  3HOU B;  4ZCK A;  1HNW H;  1EEF D;  1YNJ C;  2E2I A;  2UXC H;  1N9W A;  4JV2 A;  1T5E A;  2R92 B;  4NXM Q;  2Y0S E;  4GKJ H;  3CPF A;  2IMW P;  5IGC A;  3FMC A;  1SEI A;  2OTJ A;  2D2C C;  2W6M A;  4B3M Q;  4LUZ A;  4Y52 H;  3PO2 G;  1GSO A;  1I3Q A;  1SNP A;  1ZEQ X;  2F0N A;  2V59 A;  4UP7 A;  2RBM A;  2V4R A;  2OQ0 A;  2WB1 A;  2LXJ A;  5FJ8 H;  1XTC D;  3STB C;  2PBZ A;  3RUP A;  5G3L F;  4EG0 A;  1NY4 A;  3ICE A;  1VAJ A;  4DR5 H;  5JVL A;  2GPS A;  4DV2 L;  1NUC A;  1E0B A;  3R93 A;  4QMG A;  4ZQI A;  2O2L D;  3V4Z A;  4K14 A;  1AFP A;  1VQH A;  1VQJ A;  4LFC Q;  2HVR A;  1YNJ D;  3VR6 A;  3GTO A;  1X3Q A;  5C0X H;  3SK8 A;  2W9C A;  5KG6 A;  3URY A;  4HIK A;  1G29 1;  3A0J A;  3JRX A;  3H20 A;  3A8J E;  1N32 Q;  1M6V A;  5KFY A;  4YIJ A;  2EYL A;  1DIK A;  4ZHQ F;  3S1M H;  1JOO A;  1VQB A;  1PHJ A;  4YHH Q;  4DAY B;  4EEY A;  4JI1 L;  1MZB A;  4CJ0 B;  4YY3 L;  4UCS A;  3NBH B;  4XQN A;  2D9U A;  3ETH A;  4DV6 H;  2B8F A;  2CQA A;  3AB9 A;  4ECR A;  2XGT A;  4R4I A;  3STB D;  2C35 B;  2BQR A;  2PCF B;  5M5W B;  4JOI A;  3VYR A;  2ZM6 Q;  4DUZ L;  2JEA I;  4K8I A;  1B8A A;  4YAK B;  1Y14 B;  2O5I C;  4G4K A;  1WH2 A;  4WJW A;  5KYI A;  3NQI A;  1LLR D;  3RB3 A;  4LF7 H;  1O7L A;  4EQN A;  4AQY L;  1CM9 A;  3KUP A;  5IP9 H;  3RB4 A;  3NEN A;  3OPO A;  4A93 B;  3KBX A;  2R7N A;  3E0J A;  2DY8 A;  4HR7 B;  1W3S A;  1LM0 A;  5DG9 A;  2HVS A;  4F7X A;  3K3P A;  1AZP A;  1Q8I A;  4DR3 Q;  4V19 0;  3CD6 A;  3PO3 B;  3PUX A;  3M7N A;  2R85 A;  1CSQ A;  5C4Z A;  5CGK A;  1GO3 E;  2NVY H;  2YW2 A;  1FVI A;  2G9H D;  3CC7 A;  1S40 A;  3GTQ B;  2MHV A;  3SE0 A;  4RHS A;  1WTH A;  2F0I A;  3H15 A;  2PYK A;  4JI8 L;  1T5X D;  5FO8 B;  1UE7 A;  2NN6 I;  1EFI D;  2IX3 A;  4YR2 A;  3ND8 A;  1PH9 A;  2LSS A;  1Z2P X;  4YJ3 F;  2XN9 C;  3RZO B;  1PZJ D;  3BG3 A;  4ED1 A;  4C5B A;  1B4O A;  1OXX K;  3UQ8 A;  5KFB A;  5IGD A;  2XCA A;  4GC7 A;  2QDB A;  3QOJ A;  5HUR A;  4LF5 H;  4QIW B;  4FF4 A;  3OSP A;  2UXD H;  2K33 A;  2OF1 A;  5C44 H;  2B2W C;  3PW2 A;  1M1K C;  4ZKB B;  1VQO A;  3KF8 A;  1WTP A;  1ZQ7 A;  3U9O A;  3NBI A;  1LYL A;  1FJG Q;  1NR4 A;  2VUG A;  1EY7 A;  3TQT A;  1KD1 C;  1VBG A;  3TRE A;  2XGP A;  2PW5 A;  1G8Z D;  5FO9 B;  2NU9 B;  2JA5 H;  1JB3 A;  5BN3 A;  3UFX B;  4X3T A;  1TR5 A;  1MHW C;  1OXU A;  5LL6 X;  1STA A;  4QF4 A;  3FVQ A;  2B2Y A;  3SEB A;  4KHP L;  2VQF Q;  5DQG A;  4QWA A;  3C3L A;  4AYB E;  2UUC L;  3C0F B;  3GTG B;  1K8G A;  5I4D A;  5FLM H;  4RCN A;  3Q1K A;  4LSX A;  3EPI A;  1S0N A;  3MEH A;  3KDF A;  5D65 A;  1TY0 A;  4LF4 H;  2HIV A;  5LMN W;  4JYA L;  2EYP A;  1V4Y A;  2KCC A;  3CCL A;  5IGF A;  3R5F A;  1HQM C;  1STB A;  4ID6 A;  3DLL A;  2H5X A;  1W6K A;  1K1Q A;  2F0U A;  5E4W C;  2R84 A;  1Q1B A;  1XMO L;  5C4X G;  4DUY H;  2XIW A;  1I7N A;  1F9S A;  5ELO A;  2R8H A;  1X65 A;  4A3E H;  4MIU A;  3GV5 B;  3CF5 A;  2JA9 A;  3J7A K;  1ML0 D;  3BS1 A;  4X62 H;  4ZUI A;  4I7Z C;  5M3F G;  2FPP B;  3A8I E;  4KLK A;  3V96 A;  4EVO A;  4C3J B;  1KJ9 A;  1Y1V G;  1XNQ H;  1WCM H;  2VQD A;  1TVX A;  1YJN A;  3GO5 A;  4HID A;  1PMR A;  1Y1W H;  1K3B C;  2V4D A;  1WTR A;  1ENC A;  2QGQ A;  4IJL A;  1CQJ B;  4DR4 Q;  3UDX A;  2KEC A;  3T1H H;  1CK1 A;  1G51 A;  4HCS A;  4I65 A;  2J6T A;  1JOR A;  4JV5 L;  1WSC A;  1Q46 A;  1HNW Q;  1PFM A;  3ZYY X;  3HOZ B;  4IZ8 A;  2NN6 H;  3F8T A;  1SR3 A;  4KJN A;  4GKJ L;  3OMC A;  5FLX c;  4FYD A;  1UNN C;  5IOC A;  5M5Y H;  1KL9 A;  4IRC A;  3M85 A;  4X64 Q;  1KEE A;  1JC7 A;  1JDB B;  4MTK A;  3MWD A;  4AYB G;  5AJ3 L;  3BDO A;  2VPQ A;  2K03 A;  4UDU C;  5COR A;  4DGZ A;  3S14 H;  4ECS A;  1TWC B;  2ZXP A;  2PQA B;  3PF4 A;  4DR5 Q;  4YBZ B;  1GXD C;  1BCP F;  4Y7N H;  4DL4 A;  2I5H A;  3K5N A;  2FPG B;  4O3P A;  2VY3 A;  2CZG A;  4IUT A;  3DWQ A;  1U0L A;  3RLO A;  4DF7 A;  3M4I A;  5T14 A;  3EA6 A;  5D1O B;  3RF2 A;  3HKZ B;  2D0O A;  1ZYR C;  1VQC A;  4IOC A;  4JG2 A;  5M9O A;  1TS5 A;  1ZKO A;  3I4M G;  5M3M G;  5KFG A;  4UCV A;  2DUD A;  1VQG A;  2OXP A;  1Z47 A;  4I50 F;  3M9O B;  3HGB A;  2L11 A;  5FK9 C;  1PH3 A;  1XMQ L;  4IR9 A;  5LMU Q;  2R7K A;  1CSP A;  1YJ9 A;  1MI2 A;  1KAB A;  5JJZ A;  4DV6 L;  5C1P A;  1SNM A;  1A3V A;  3L9A X;  1TWG H;  2HVQ A;  3V6H A;  2WAQ G;  4GLV B;  3GIJ A;  2OWO A;  4RWS C;  3T56 B;  5IWA L;  2KBN A;  4JUZ A;  1TWF H;  1JJG A;  1KLG D;  5DM7 3;  2LY7 A;  3A54 A;  3T16 A;  2K32 A;  1S0M A;  2DY7 A;  3Q8D A;  3TZU A;  3K7A H;  1KTK A;  2RDJ A;  2W7P A;  1XTD A;  1KC8 C;  3C2P A;  4LF7 Q;  2ASB A;  1A63 A;  3HOX H;  2IW3 A;  3CPW A;  2MP1 A;  4GOP B;  4KY6 A;  1AP0 A;  4JW0 A;  3W2D A;  1WD1 A;  3TIG A;  2KCN A;  5M5X H;  2FMA A;  4IWY A;  4GZY C;  2R92 A;  3RZD B;  2VUM A;  3TME A;  4H13 C;  3K5I A;  1PH2 A;  4ME6 A;  1K8M A;  1NMF A;  1VQA A;  2PQE A;  4PNY A;  2BQU A;  3H0G G;  1Q3L A;  4A3M H;  5KFX A;  1HTL D;  1EY9 A;  4PZ7 A;  2R93 B;  4YB8 B;  2PVP A;  1XNR H;  4QIW E;  2F4I A;  2NVY A;  2CWP A;  1PTO F;  4MV4 A;  3IL8 A;  3KLS X;  1QVF A;  4IFD G;  1S0O A;  4PV1 C;  1QJO A;  1TWH H;  2FMC A;  4LF5 Q;  1I4H A;  1Z2N X;  5FOB B;  1QUQ B;  2UXD Q;  4OHJ A;  1DJR D;  2IPK D;  1B1Z A;  3RV4 A;  2Q2U A;  1RTO A;  3HOW H;  4A3J G;  1SJE D;  5JEA G;  1N36 H;  1E3P A;  3KF6 B;  3S15 B;  3RN2 A;  4EQO A;  1C4Q A;  1I94 Q;  1N34 Q;  1VQL A;  4QWE A;  1WTW A;  3MR3 A;  4DV1 H;  4DV3 H;  5C3X A;  2Z8L A;  1FNV A;  3CQZ H;  4K2L A;  4LFB L;  5ELE A;  3KAJ A;  2VB2 X;  4C3H H;  4EBE A;  2ZXR A;  3BJU A;  1IYV A;  2I46 A;  3S1R B;  3I2Z A;  1EYG A;  3CMA A;  4BXX G;  4OXP A;  4GC6 A;  3MXN B;  2IHE A;  4A93 G;  2R7Z H;  2JA5 A;  4IUN A;  3KLW A;  2FJZ A;  4JI5 H;  2DWC A;  4OIJ A;  2BA1 A;  4MV6 A;  5DLG A;  1N8R C;  4RH6 A;  2AUK A;  3X3N A;  4LF4 Q;  1ONL A;  1KJQ A;  4ABN A;  1NBW A;  4PZ8 A;  4IRK A;  4J9R A;  2B2V C;  4A3D H;  4KMU C;  4IR1 A;  4B3T H;  1HTP A;  3LNN A;  5C4J H;  3J81 L;  5FD5 A;  4ECU A;  2OLS A;  1SNO A;  1IL8 A;  3D6C A;  2F3I A;  4A3F H;  4ED3 A;  1IBM H;  4KKU A;  1WD0 A;  2F0V A;  4U6P A;  3PVX A;  4AH6 A;  1I4G A;  1EQR A;  2J6S A;  3OIQ A;  5E1F A;  5HGT A;  3NXW A;  2F0J A;  2E2I B;  2ZJT A;  1HR0 H;  4FDB A;  4HSP A;  3GTQ A;  1CUK A;  2E2D C;  4X62 L;  1HNZ H;  4J9M A;  5KFK A;  4Q8F A;  5GAE C;  3BZK A;  3E3X A;  5J39 A;  2EZV A;  4A3L G;  1VDZ A;  1O75 A;  4PG3 A;  1HCZ A;  1F2L A;  4ULL A;  4JI3 L;  4CHT B;  1I3Q B;  5KG7 A;  4JI2 L;  4UP9 A;  4LF6 H;  2M00 A;  5CB4 F;  3AQQ A;  2M2L A;  5EPL A;  1XNQ Q;  3IG0 A;  2WB1 B;  1WTO A;  3S9W A;  2NTT A;  1EIG A;  4KTA A;  5D3D A;  1BBX C;  5L9X A;  3AYH B;  1HZC A;  4KKS A;  1SYF A;  1QNK A;  1D1I A;  4DR7 L;  3RD4 A;  2L1B A;  4JI0 H;  2OT2 A;  3S2H B;  4J0M A;  3T1H Q;  1AZQ A;  4C56 C;  1Z6H A;  1I6H H;  1SBB B;  1WCM A;  2DN8 A;  4QUC A;  4I7A A;  4RUA A;  1CE8 A;  3SHL A;  4IUU A;  3F1Z A;  1RHP A;  3GTO B;  2W9C B;  1GHJ A;  4TV8 F;  2NU7 B;  1AE2 A;  3I4N B;  4DXG A;  5LHY 1;  4L8J A;  2XSC A;  3TBI B;  3PIO A;  3H40 A;  4A3G B;  4UP8 A;  3J7A F;  5GQO A;  2I80 A;  2UUB L;  2FKL A;  4TUY F;  4FM9 A;  2IX1 A;  1BGW A;  5GRO A;  1EUC B;  2CW7 A;  3GV6 A;  4BY1 H;  1AEX A;  1NAP A;  4XXE A;  1GUG A;  3P1H A;  3HKZ E;  4WRD A;  3H3V C;  3QJY A;  3H3V I;  2DPI A;  2F0L A;  2E76 C;  1LTB D;  2Q2H A;  1B7Y B;  4KJO A;  5IYB G;  1WTX A;  3HOV H;  3PUV A;  4O4L F;  2GA4 B;  5KG2 A;  2B2W A;  2UVV A;  4ECX A;  5KFV A;  4J9L A;  1VQK A;  4G7H C;  2ZDG A;  2ZDQ A;  2A74 C;  1LT5 D;  3P20 A;  4KK7 A;  3RNU A;  3PW0 A;  1AUV A;  3H6M A;  1WFQ A;  1Z7T A;  5DQI A;  3DM3 A;  1E2V A;  1ZHS A;  2FHT A;  4L63 B;  1WTV A;  3FKI G;  4NXN H;  1QVC A;  3NEM A;  4O1N A;  4C2M H;  1M0T A;  2JEF A;  3C1F A;  1YHQ A;  1B50 A;  4PWQ A;  2KCM A;  4HJ7 A;  4RA8 A;  3BZD B;  3G71 A;  3VYT A;  2BR0 A;  4J9S A;  2D62 A;  4OWT B;  2KEN A;  3RJ0 A;  1HNX H;  4CDC C;  4POG A;  4L5S A;  1GM5 A;  1HFN A;  3JSL A;  3SDZ A;  1IHZ A;  2WKD A;  1LV9 A;  4ZLT F;  3HOZ G;  3LWB A;  1FKA H;  3A7A B;  1BBW A;  1MJE A;  2DZD A;  5JUM A;  3R3O A;  4TVA B;  4P2C B;  5KG3 A;  2K6A A;  1TWF A;  2VW9 A;  2QDL A;  3I91 A;  1E2W A;  2HDL A;  2XIG A;  4DV5 H;  5EJW A;  5KFJ A;  1TS2 A;  1HA5 A;  5EOY A;  4EQ5 A;  4LF9 L;  3GIP A;  4MV9 A;  4O3Q A;  2K01 A;  5CV8 A;  4X66 H;  2NU6 B;  1VCI A;  4FU0 A;  2W71 A;  3PO2 H;  2W6P A;  1S5D D;  3MWY W;  4KN4 C;  1C0A A;  2F52 A;  4KHZ A;  3F2C A;  4XT3 B;  3PIP A;  4A3C G;  1CKN B;  2BA0 A;  4YR3 A;  4YHH H;  3NGD A;  2XRQ D;  4HTH A;  1XNR Q;  5JVG 3;  1SYD A;  2CHB D;  1KNA A;  1UEA B;  1RD9 D;  1VQF A;  3HKZ G;  4IUR A;  1DYQ A;  3Q23 A;  1VQE A;  1VQ5 A;  1V51 A;  4B3S L;  3A5U A;  1ENA A;  3KDF B;  2SEB D;  4G7Z C;  5KFS A;  3PR5 B;  2AWO A;  3A5Z B;  4XQJ A;  3GTJ H;  1QZG A;  1VQI A;  5CV6 A;  5JVD F;  3MFI A;  1BDO A;  3OW7 A;  3BAB A;  1TWH A;  2CH4 A;  4BBR G;  1VQP A;  2IY5 B;  4GNX C;  1N36 Q;  1F9P A;  5T1I A;  2UXB L;  4RU9 A;  3T4A C;  2VL6 A;  4XYO A;  1A2U A;  2H4O A;  3BQ0 A;  4DV1 Q;  4DV3 Q;  3K5O A;  4L1K A;  3F2U A;  4RB3 C;  3W1G A;  5KNB A;  3ITP A;  3H3V H;  4BY7 H;  1S5B D;  2F0F A;  5ELC A;  4DA2 A;  2KQ3 A;  3D4W A;  2YTY A;  2YL2 A;  1HA6 A;  1BUV T;  4A3K B;  3L3O C;  1JQY D;  3G8C A;  2K5Q A;  2E8G A;  5LMN L;  3ETJ A;  3WDN A;  4JI5 Q;  2K04 A;  4LF8 L;  2YTX A;  4K0K L;  4MHE A;  4MAM A;  4B3T Q;  2R7Z A;  2L0C A;  4HJ9 A;  4F4Y A;  1Q90 A;  5CV4 A;  1BF4 A;  4DK3 C;  1IBM Q;  4LFA L;  4DR6 L;  1PRT B;  3IFD A;  1NTG A;  4M8A A;  1N48 A;  2R93 G;  1F2M A;  2ZJP A;  3ZJY C;  1HR0 Q;  4OIK A;  2IP4 A;  2YCH A;  5I2Y A;  2JEI A;  2RSO A;  3OUZ A;  1EU3 A;  2B2U A;  3DWP A;  1I7L A;  1HNZ Q;  3VR2 A;  2WB1 E;  3EFX D;  2B29 A;  2KEE A;  3MTS A;  3MXU A;  1J6Q A;  2JK8 A;  1N33 H;  3CW2 C;  4IUV A;  3GTP H;  5D3I B;  4LF6 Q;  2F1M A;  4LUO A;  3JAM W;  1S3O A;  5CMD A;  3MWM A;  1TU2 B;  3KHL A;  1QUQ A;  3PQI A;  2E2H H;  3EYY A;  4JI0 Q;  2E5L L;  3S2D H;  4I7H A;  4B9W A;  4ED2 A;  3TRZ A;  3GTL A;  2I87 A;  4EQP A;  1AE3 A;  3OTO H;  4P75 A;  2ALY B;  3U50 C;  2C9O A;  3I12 A;  4IN3 A;  3G7L A;  2VQE L;  1EWC A;  4CKB A;  2IL8 A;  3T5H A;  4R4Q A;  1SFO H;  4E4T A;  1XPU A;  3M4P A;  4MNO A;  5IT9 L;  2Q8I B;  5LL6 S;  1XYI A;  2AKW B;  2WII B;  2FK3 A;  2UU9 Q;  5EKI A;  2K5D A;  2O5J C;  3GTK H;  1SCU B;  1Y69 U;  4JI6 L;  1BJT A;  2VNU D;  4RAY A;  3S1M B;  1IOW A;  1Q7Y C;  1QOH A;  1UWV A;  3CRK C;  1OO9 B;  1SE2 A;  3E9H A;  4ED6 A;  3VA7 A;  4ALP A;  1NNX A;  1C9O A;  4DV4 L;  4F4W A;  5C4X H;  1OWT A;  2HUG A;  4PZ6 A;  3L2P A;  3VR5 A;  4K5V A;  3FMA A;  4OO1 G;  2JA7 G;  1JXL A;  5IGB A;  4K8J A;  1ZET A;  1X56 A;  3NTH A;  4NXN Q;  4R7R A;  3K5L A;  4NXM L;  2X6L A;  2FLN A;  1Q12 A;  5M3F H;  4JPB W;  1M90 C;  2ASL A;  2VUM B;  1EZ1 A;  1L2F A;  4B3M L;  5EWE A;  5E3F A;  4FF2 A;  2A6H D;  4DPG A;  1X3E A;  1Y1V H;  1KLU D;  1HNX Q;  1IBL H;  4CKC A;  4A3I G;  5KKN B;  1CZW A;  4X64 H;  1G6Z A;  5C0X J;  4C2M A;  5EKK A;  2A19 A;  2NVY B;  2BCO A;  2Z4H A;  1IXR A;  1ZHQ A;  3DMU A;  4JBJ A;  4ED7 A;  2B2V A;  2LFN A;  1W2B A;  1X3P A;  1YJW A;  1LT6 D;  3I4N G;  4IFD I;  3J80 W;  5C3W A;  4OL7 A;  2WP8 J;  1PH5 A;  1UNS A;  4DV5 Q;  3E6Z X;  4LFC L;  2WDT A;  2WAC A;  1A3T A;  5KFI A;  5JQW A;  4X66 Q;  1N32 L;  3L7Z C;  3I4O A;  4MV8 A;  4X65 H;  4R8I A;  2DIK A;  4RGO S;  2XRS D;  4TKO B;  3KK7 A;  5C44 B;  3MXP A;  2ZJQ A;  5LOV F;  3Q0A A;  2GVA A;  4N8F A;  2VPS A;  4GKK H;  4QCL A;  5LMU H;  3NPP A;  4B3R L;  2HGS A;  1SRU A;  3PSI A;  4O2A F;  2Q2I A;  4JC0 A;  5KFD A;  4ODG A;  4LK1 C;  1SSO A;  2NBF A;  5HV6 A;  3MFY A;  5KFA A;  1TWA H;  3NP8 A;  2ZM6 L;  1UEB A;  2JA6 G;  1KJI A;  1I50 A;  3K5M A;  1PZI D;  3D3R A;  2K5N A;  3A55 A;  1UAP A;  5JPM C;  1PZK D;  2JA5 B;  3PW4 A;  2UUA H;  1PV4 A;  2XCP A;  2HCI A;  3I7F A;  5CBE E;  5KRU A;  4DV7 L;  4RUC A;  4IPG A;  5TSS A;  3CCJ A;  1ASY A;  3I4M H;  1HUM A;  1A6X A;  3CP0 A;  5M3M H;  1CT1 D;  3VPC A;  2YZM A;  3E5N A;  1BKB A;  1P8L A;  2MO1 A;  4NKL A;  3BA8 A;  4TRD A;  4Q44 A;  4DR3 L;  1KDA A;  1S5F D;  2ZTE A;  4I55 F;  3WO1 A;  4HJA A;  2Y0S G;  1ULZ A;  2RCF A;  3FHW A;  4YY3 Q;  4RGM A;  4APV A;  1EY5 A;  1F77 A;  4QWC A;  2B3G A;  1BOS A;  3CRL C;  3AFP A;  5F9N A;  4DAP A; 
#chains in the Genus database with same CATH homology
 1Z47 A;  1X6O A;  2Z6K C;  3S1R H;  1PH3 A;  3I56 A;  1XMQ L;  5LMU Q;  3G4S A;  1CSP A;  1YJ9 A;  2NVX H;  4LFA Q;  4DV6 L;  5IYC G;  3S24 A;  4JI0 L;  1TWG H;  1NJI C;  2WAQ G;  4GLV B;  4IJH A;  2OWO A;  4UY8 C;  5IWA L;  2KBN A;  2EXD A;  2CCZ A;  1TWF H;  1JJG A;  1NMG A;  4OWX B;  2UUB Q;  3Q8D A;  3K7A H;  1J5E L;  1XTD A;  1KC8 C;  1EQQ A;  1PH1 A;  4LF7 Q;  2ASB A;  1A63 A;  1FJG L;  3M3Y H;  3TS0 A;  3HOX H;  1EUJ A;  3H0G H;  1EFW A;  2EQS A;  3CPW A;  3GTM H;  3K81 C;  2K5V A;  4GOP B;  2E2I H;  2UU9 L;  5M5X H;  4C3I H;  1UE6 A;  1UE1 A;  4YWL A;  4BY1 G;  2A1A A;  1VQ9 A;  1CKN A;  4DV0 Q;  3JAM i;  4JI7 L;  2BH8 A;  3S1N H;  1HZB A;  1PH2 A;  3PUW A;  1NMF A;  1VQA A;  2VQF L;  1N33 Q;  1Q86 C;  4DR1 L;  1I3Q H;  3H0G G;  3G6E A;  4A3M H;  2JQO A;  2V1C C;  4PZ7 A;  3OYY A;  4QIW E;  1E1T A;  4A3K H;  2CWP A;  1V1Q A;  3KYH C;  2AMC B;  2MNA A;  1X3F A;  4A3J H;  3J81 i;  1QVF A;  4IFD G;  5GAH C;  4DNI A;  1G6P A;  4J15 A;  4NXN L;  1TWH H;  3J81 c;  3T1Y Q;  1PA6 A;  4KI0 A;  2RHQ B;  5M5W H;  3BZC A;  3CCE A;  4LF5 Q;  4GS3 A;  4A3M G;  1QUQ B;  2R6G A;  3OTO Q;  1ASZ A;  2UXD Q;  1AH9 A;  2ZJR A;  1GVP A;  2JE6 I;  2WB1 G;  3MEF A;  4TQU S;  1WOC A;  5J3B A;  2Q2U A;  3GTO H;  4A3K G;  1PH8 A;  1HNX L;  3HOW H;  2OTL A;  3E0E A;  2PMZ E;  1MKH A;  4A3J G;  3I4N H;  4BXX H;  1YVC A;  2XTI A;  5HGQ A;  5JEA G;  1HR0 W;  1E3P A;  1YBY A;  3KF6 B;  3RN2 A;  1VQL A;  3CCS A;  1I94 Q;  3HFZ B;  3D31 A;  4O2D A;  1N34 Q;  4OWW B;  4A93 H;  3KF8 B;  4A3G H;  4LF9 Q;  3CQZ H;  5JJL A;  4LFB L;  1A62 A;  1K73 C;  4C3H H;  3J7Z C;  1L1O B;  1SRO A;  3BJU A;  4HIO A;  3HOW G;  4JYA Q;  5C3E H;  5IE8 A;  1E24 A;  1YZ6 A;  3I2Z A;  1EYG A;  3CMA A;  3J81 j;  4DV5 L;  4BXX G;  4OXP A;  3MXN B;  1I50 H;  3PF5 A;  1UE5 A;  1K0R A;  2ES2 A;  2IHE A;  1QVG A;  4BA1 I;  4DR4 L;  1PYB A;  3ULP A;  2R7Z H;  4X66 L;  4A3G G;  2OCE A;  4A93 G;  3KLW A;  1KRS A;  1YNX A;  2KCT A;  3EBE A;  2BA1 A;  1CKO A;  2I5L X;  1N8R C;  4LF4 Q;  4WJ4 A;  1HNW L;  4JBM A;  2PQA A;  3RZO H;  1NBW A;  4PZ8 A;  3I55 A;  5C3E G;  4GNX A;  4A3D H;  5C4J H;  2ZTD A;  2UXC L;  3OW2 A;  2MFI A;  1K8A C;  4A3F H;  2F3I A;  4L5Q A;  4B3S Q;  3K8A A;  4L5T A;  4NPS A;  4YHH L;  4O0A A;  1XPO A;  4A3L H;  1OXT A;  4AH6 A;  1EQR A;  3BU2 A;  4DR2 L;  2N49 A;  4LNQ A;  4DV2 Q;  4FDB A;  1IBL Q;  3TS2 A;  1CUK A;  4IO9 A;  3AEV A;  4X62 L;  1HH2 P;  5K36 G;  4A3F G;  1U5K A;  5GAE C;  3BZK A;  3J80 i;  3S17 H;  1E7Z A;  2HIX A;  2B63 H;  4R4T A;  4A3L G;  2I5M X;  1YI2 A;  3J80 c;  4PG3 A;  4DR5 L;  1KRT A;  4JI3 L;  4YCV A;  4JI2 L;  4UP9 A;  2K4K A;  3AQQ A;  1XNQ Q;  2K5H A;  2FXQ A;  2NVQ H;  4DKA C;  1VS0 A;  3AYH B;  3F2D A;  1HZC A;  2IT1 A;  4A4I A;  1EIF A;  2JA8 G;  2YV5 A;  4B3R Q;  2B63 G;  4DR7 L;  2N8N A;  5BR8 L;  2F4V L;  4QQB X;  4JI1 Q;  5LMN Q;  3T1H Q;  4LF8 Q;  4BY7 G;  1I6H H;  4K0K Q;  4X65 Q;  2K52 A;  4R4O A;  4YWM A;  3HOU H;  5LMU L;  2CFM A;  3F1Z A;  1SLJ A;  1X55 A;  4JBW A;  4YCU A;  4DUZ Q;  3U58 A;  5IYD H;  1PYS B;  4GOP A;  4GKK Q;  3J7A 5;  1AE2 A;  4DV7 Q;  4DR6 Q;  1L0W A;  3KFU A;  2R92 H;  4AQY Q;  2VUM H;  3PIO A;  4PMW A;  1X3G A;  4UP8 A;  1PFS A;  5GQO A;  5IYB H;  2UUB L;  1KIX A;  3CC4 A;  3HOU G;  1VQ7 A;  2ZTC A;  2ID0 A;  1LTL A;  5IYD G;  2UUA Q;  2IX1 A;  5GRO A;  1RIP A;  1K83 H;  4IFD J;  4LF7 L;  4BY1 H;  5C0X I;  3HOY H;  1WI5 A;  3CAM A;  2NZO A;  2R92 G;  2VUM G;  3HKZ E;  2GN5 A;  2ATW A;  3H3V I;  4IOA A;  3AFQ A;  2HT1 A;  4P72 A;  3FKI H;  3HOV H;  1D8L A;  2Q2H A;  1B7Y B;  2AHO B;  5IYB G;  3CCR A;  1IZ6 A;  3PUV A;  4QGU A;  4GLA C;  2RCN A;  1K9M C;  1WJJ A;  4JI8 Q;  3UDG A;  1XMQ Q;  1YIT A;  1VQK A;  5JEA J;  4OX9 Q;  3G48 A;  4DV0 L;  3RNU A;  3D0F A;  3HOY G;  1N33 L;  1WFQ A;  2QA4 A;  1E22 A;  3PUY A;  3DM3 A;  2E5L Q;  3IRB A;  5DLQ E;  2PNH A;  4HIM A;  3FKI G;  3GD7 A;  3JAM c;  1YEZ A;  4ME3 A;  3HOV G;  1O7I A;  1QVC A;  3ER0 A;  3KF6 A;  3NEM A;  3UDF A;  4C2M H;  3CME A;  3HOZ H;  1YHQ A;  2KCM A;  4HJ7 A;  1HJP A;  3EN2 A;  1WYD A;  1A8V A;  1OXV A;  3G71 A;  1X54 A;  2D62 A;  4OWT B;  2KEN A;  3HKS A;  3T1Y L;  4R1J A;  1DGS A;  3K0X A;  1L1O A;  2VQE Q;  1JJ2 A;  4L5S A;  4POG A;  1GM5 A;  5IP7 H;  4LF5 L;  2BH2 A;  4QL5 A;  1NE3 A;  3OTO L;  2UXD L;  5E7N A;  3PCO B;  4IPD A;  3U4Z A;  5C44 G;  3HOZ G;  1BBW A;  1MJE A;  4TVA B;  1TWC H;  1YHB A;  3ULJ A;  1JB7 A;  2R7D A;  2VW9 A;  4JI6 Q;  1I94 L;  4DR1 Q;  1N34 L;  5IP7 G;  4EQ5 A;  4KHP Q;  4LF9 L;  1JMC A;  4A3C H;  4WJ3 M;  2I0Q A;  2UUC Q;  2JA5 G;  1VCI A;  1TXY A;  4DV4 Q;  3PO2 H;  4X6A H;  2K50 A;  2F52 A;  3PO3 H;  1C0A A;  4KHZ A;  3GTQ H;  3M4O H;  1N9W A;  3F2C A;  1S72 A;  5FLM G;  3PIP A;  1PH6 A;  4A3C G;  1CKN B;  5EAY A;  2BA0 A;  2Y0S E;  4NXM Q;  3CPF A;  1XNR Q;  4L5R C;  4LF4 L;  1MJC A;  2OTJ A;  4A75 A;  1VQF A;  1IYJ B;  3HKZ G;  4LUZ A;  4RG1 A;  1XMO Q;  4B3M Q;  3PO2 G;  4Y52 H;  3E9I A;  4BBR H;  4JI4 Q;  3PO3 G;  1VQE A;  1VQ5 A;  4UP7 A;  4B3S L;  4IPC A;  1OXS C;  3A5U A;  3S16 H;  2OQ0 A;  2GVB A;  1HZ9 A;  2LXJ A;  5FJ8 H;  3KDF B;  5IY0 A;  3STB C;  2R7F A;  2MQH A;  3K7U C;  2AWO A;  3A5Z B;  3F2B A;  4DUY L;  4LFB Q;  1NY4 A;  3GTJ H;  1QZG A;  3ICE A;  1VQI A;  2WAQ E;  4DV2 L;  1IBL L;  4X64 L;  4BBR G;  1VQP A;  1VQ6 A;  2IY5 B;  5ELN A;  4GNX C;  1QZH A;  1PH4 A;  1N36 Q;  4QJF A;  1VQH A;  4BA2 I;  1VQJ A;  2UXB L;  2R93 H;  2VL6 A;  4LFC Q;  5FJ8 G;  4DV1 Q;  4DV3 Q;  2JA8 H;  2IHF A;  1RL2 A;  2JEB I;  3W1G A;  1G29 1;  3A0J A;  4HIK A;  3SGI A;  1N32 Q;  3H3V H;  4BY7 H;  1XNQ L;  1HZA A;  2Z0S A;  4JV5 Q;  1BVS A;  2UXC Q;  1V43 A;  2JJQ A;  3S1M H;  1EOV A;  1VQB A;  2YTY A;  1PHJ A;  4GKJ Q;  4YHH Q;  4DAY B;  3CCM A;  4JI1 L;  2E8G A;  4P73 A;  5C0X G;  5LMN L;  4GLX A;  4YY3 L;  3T1H L;  3NBH B;  4JI5 Q;  2CWA A;  4LF8 L;  3GTG H;  2YTX A;  1P16 A;  4X65 L;  4YWK A;  2PI2 A;  1YIJ A;  4K0K L;  2DGY A;  2XGT A;  4R4I A;  2C35 B;  2YYZ A;  3STB D;  3S1Q H;  2E2J H;  4JOI A;  2ZM6 Q;  4DUZ L;  4B3T Q;  2JEA I;  3CCU A;  1B8A A;  4DR7 Q;  2OQK A;  1Y14 B;  4HJ9 A;  1KQS A;  4JBK A;  3RLN A;  1B70 B;  1XJV A;  4GKK L;  5AJ3 Q;  4IPH A;  3LGJ A;  4DK3 C;  1IBM Q;  4LFA L;  4DR6 L;  4HJ5 A;  3TEH B;  4AQY L;  1NTG A;  3M4Q A;  2R93 G;  5IP9 H;  3NEL A;  2ZJP A;  3NEN A;  3GDE A;  4MZ9 A;  3KOJ A;  3ZJY C;  1HR0 Q;  2K14 A;  1VQN A;  2Z6K A;  2CQO A;  2UUA L;  1W3S A;  1LM0 A;  5IT9 c;  1HNZ Q;  2WB1 E;  4DR3 Q;  4GOP C;  2B29 A;  3PUX A;  4GN5 A;  4QY7 A;  3CD6 A;  1CSQ A;  2HHH Q;  1VQ4 A;  3M7N A;  1GO3 E;  3FP9 A;  2NVY H;  1J6Q A;  1FVI A;  4OON A;  2JK8 A;  5IP9 G;  1EWI A;  3CW2 C;  4XTC S;  3CC7 A;  1S40 A;  1IBK Q;  1IL2 A;  4AIM A;  2VS1 A;  3WWV A;  1CKM A;  3GTP H;  3W5O A;  4LF6 Q;  4C3J H;  3H15 A;  4JI8 L;  4LUO A;  3KJO A;  5H1S E;  1UE7 A;  2NN6 I;  1LUZ A;  1S3O A;  2NZH A;  5HY6 A;  3ULL A;  4OX9 L;  1SN8 A;  4LUV A;  2NVT H;  1PH9 A;  2LSS A;  5JJK A;  4YCW A;  1QUQ A;  4DV6 Q;  2E2H H;  1SMX A;  1D7Q A;  2K75 A;  1OXX K;  2E5L L;  1GD7 A;  4JI0 Q;  3S2D H;  5IWA Q;  3TRZ A;  1AE3 A;  4P75 A;  2Q2T A;  2ALY B;  5C44 H;  1M1K C;  3U50 C;  2CKZ B;  1J5E Q;  1VQO A;  3UDI A;  3A74 A;  2VQE L;  1VQ8 A;  1LYL A;  2PI2 E;  5GAD C;  1OTC A;  1FJG Q;  1KD1 C;  3CCV A;  2D0P A;  4R4Q A;  3TRE A;  1SFO H;  1XPU A;  1KXL A;  3M4P A;  4MNO A;  3EIV A;  4LWC A;  2AKW B;  2JA5 H;  2UU9 Q;  1GKH A;  1T9H A;  1Q1E A;  3GTK H;  1Q82 C;  4JI6 L;  1OXU A;  2JA7 H;  2VNU D;  3HOX G;  2N3S A;  4JI7 Q;  1Q7Y C;  4KHP L;  1JE5 A;  1UWV A;  2KHJ A;  4RMF A;  2VQF Q;  1L1O C;  3U4V A;  4AYB E;  2UUC L;  3K80 C;  2MO0 A;  3E9H A;  2L15 A;  3M9B A;  5FLM H;  1K8G A;  1EIY B;  4ALP A;  1A0I A;  1C9O A;  4DV4 L;  5C4X H;  3KDF A;  4PZ6 A;  3L2P A;  2HIV A;  5LMN W;  4JYA L;  4POF A;  4OO1 G;  2JA7 G;  4A3I H;  3RR5 A;  3RN5 A;  3CCL A;  3S2H H;  1KAW A;  1X56 A;  1SE8 A;  3KJP A;  4NXN Q;  3JC6 6;  3DLL A;  4NXM L;  2H5X A;  2IX0 A;  1XNR L;  1Q12 A;  5M3F H;  1Q1B A;  1M90 C;  2QEX A;  1JJC B;  1L2F A;  1XMO L;  3UE0 A;  1MIU A;  4B3M L;  5C4X G;  3L0O A;  5ELO A;  4DPG A;  4JI4 L;  1X9N A;  1X3E A;  1Y1V H;  1HNX Q;  2WFW A;  3TQY A;  1X65 A;  4A3I G;  3PUZ A;  4A3E H;  5C0X J;  3CF5 A;  2JA9 A;  2A19 A;  4DAM A;  4P71 A;  2AWN A;  4A76 A;  5M3F G;  1IXR A;  4JBJ A;  4KLK A;  4MTN A;  2RHS B;  1PH7 A;  4DK6 C;  1W2B A;  2RF4 A;  1YJW A;  3I4N G;  4IFD I;  1Y1V G;  5JJI A;  1N36 L;  4OO1 I;  1WCM H;  2WP8 J;  3CXC A;  4A3E G;  1VQM A;  1PH5 A;  1YJN A;  3GO5 A;  4DV5 Q;  3RLF A;  4HID A;  4LFC L;  3W1B A;  1Y1W H;  4DV1 L;  1Q8K A;  2QGQ A;  4IJL A;  4DV3 L;  4BBS H;  4DR4 Q;  4X66 Q;  1H95 A;  4JCV E;  3UDX A;  1N32 L;  2N78 A;  3L7Z C;  3PGZ A;  1G51 A;  3I4O A;  1K3R A;  4JV5 L;  1Q46 A;  4P74 A;  3VDY A;  2EIF A;  4NB3 A;  2JA6 H;  1HNW Q;  1FGU A;  3RZD H;  1WCM G;  2ZJQ A;  1BBU A;  3F8T A;  2VZA A;  1SR3 A;  2GVA A;  4H02 A;  4XIG S;  1Y1W G;  4LW1 A;  2R7Z G;  4GKJ L;  4B3R L;  4BBS G;  4EX5 A;  4JI5 L;  1SRU A;  3PSI A;  5FLX c;  2Q2I A;  3ERS X;  4JC0 A;  4DUY Q;  4HJ8 A;  3UE1 A;  5M5Y H;  4A3B H;  1KL9 A;  1TWA H;  4A3D G;  3M85 A;  4UPA A;  1UEB A;  4X64 Q;  2ZM6 L;  4B3T L;  2JA6 G;  2HQL A;  4DR2 Q;  4AYB G;  2K5N A;  4GN4 B;  5AJ3 L;  1Q81 C;  2NN6 G;  1JT8 A;  1Z9F A;  1IBM L;  1PV4 A;  4X62 Q;  2UXB Q;  3I7F A;  3S14 H;  4DV7 L;  4GN3 B;  4IPG A;  3PV0 A;  1ASY A;  3CCJ A;  2PQA B;  3PF4 A;  2YTV A;  1I5F A;  3I4M H;  4GNX B;  2LXK A;  3CP0 A;  5M3M H;  4DR5 Q;  4Y7N H;  1HR0 L;  4JI3 Q;  2I5H A;  3CCQ A;  4A3B G;  3CC2 A;  1XPR A;  4JI2 Q;  2VY3 A;  1BKB A;  1P8L A;  2MO1 A;  1PVO A;  1V9P A;  1HNZ L;  3GTL H;  1E1O A;  1U0L A;  4JOI C;  3RLO A;  3B6Y A;  2ZTE A;  4R4C A;  4DR3 L;  2YU9 H;  3S15 H;  1YHA A;  4HJA A;  2HHH L;  1FL0 A;  1VQD A;  2D0O A;  1KHI A;  2Y0S G;  5IYC H;  2A8V A;  1VQC A;  2KHI A;  3FHW A;  4YY3 Q;  4IOC A;  5BR8 Q;  4APV A;  4JG2 A;  1R9T H;  1IBK L;  1C7Y A;  2F4V Q;  3I4M G;  5GAG C;  2B3G A;  5M3M G;  4LF6 L;  3AFP A;  2DUD A;  1VQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...